5FS6A

Crystal structure of the v243l mutant of human apoptosis inducing factor
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
491
structure length
454
Chain Sequence
KAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMLKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHEDLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure/Function Relations in Aifm1 Variants Associated with Neurodegenerative Disorders
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
total genus 146
structure length 454
sequence length 491
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fs6A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs6A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs6A01
2FJBA 4A79A 3RP7A 3AE3A 2CVJA 2VRLA 2JB3A 2H89A 4BK3A 1K0IA 1BGJA 2A89A 2WP5A 5C2TA 2RABA 2WU5A 2XLUA 3NYFA 2FJEA 4U8LA 1O95A 4A9WA 1OJAA 3QFAA 5CQFA 3VRAA 4H4WA 4USRA 4BK1A 3AXBA 4EMIA 1NHQA 1H7WA 1TDEA 3CN8A 2R0PA 4H4VA 3KA7A 2RGHA 4XXGA 4ECHA 5J60A 4A99A 1BKWA 4APNA 5JCMA 3QVPA 3JSKA 2EQ8A 3CIRA 4REKA 1RYIA 1DOCA 1GTHA 2B9XA 2EQ6A 3QSEA 3NH3X 1DJQA 2JBVA 2EQ7A 2EQ9A 4J2WA 4CRTA 2ZZBA 2E1MA 1K0LA 3P4PA 2IVEA 5KVIA 1DNCA 2B9YA 1NHRA 2YLSA 4EQSA 3AE9A 2GR0A 4U8KA 3UKFA 3SQPA 4H2PA 1GALA 4TM4A 4YTNA 3CTYA 2BK5A 1GPEA 2YG5A 5M0ZA 1H7XA 4LU6A 3I3LA 4NEWA 3AD9B 4CNJA 4Z2RA 2Q0KA 4JY2A 2B7SA 1P2HA 1E6EA 1DOBA 5EBKA 2RGJA 4U8JA 4EIQA 1JRXA 1PDHA 1VG9A 2BYBA 1ZMCA 4BURA 4OPIA 1B37A 4IA5A 1VRQB 1NDAA 2W0HA 5FS9A 5FS6A 3EPTA 5BVAA 2YQUA 5KOWA 1E1LA 5TR3A 1M6IA 1PXBA 3BI2A 3UTFA 4EQRA 1GRAA 3CPIG 1KNPA 2PHHA 3AECA 1JOAA 5JCIA 4RG3A 1YQ4A 3AEEA 1JEHA 2Z5YA 3F8DA 2C7GA 1CJ3A 1E1MA 2ZZ0A 1MOKA 2V60A 4OVIA 4MJWA 3GRTA 4WX1A 2QA1A 1CBOA 4NTEA 3DMEA 4NTCA 1DOEA 1E1NA 1S3EA 1GEUA 1PJ5A 2QCUA 2VVLG 2V3AA 2JB1A 2YG4A 3F8RA 3ISHA 3P4QA 4C3XA 3NNEA 1IUWA 3AE8A 3C4AA 5M10A 1FEAA 1XHCA 2OA1A 2XFQA 3ALJA 3GDPA 3Q9TA 5JCNA 2GVCA 2R46A 4XWRA 3ZDNA 4GDPA 3FG2P 2WOVA 4YTMA 4AOSA 1OJ9A 2XLRA 2X8CA 2YLRA 3OC4A 1YQ3A 4ICYA 2WDRA 3M0OA 3CGCA 1ZX9A 4PABA 5CKUA 3BI5A 3K30A 2Y6QA 2TPRA 3DJEA 1SEZA 2GF3A 1NHPA 1F8RA 3IHGA 3NKSA 2BC0A 2X3NA 1D4DA 5JCKA 1H84A 3DA1A 3Q6JA 5U25A 1Q9IA 3H8LA 4A6NA 2Q7VA 3KLJA 2XVIA 4UDQA 4C5OA 2R9ZA 1QLBA 2RGOA 3G5QA 3SGLA 4H4RA 5FMHA 1N4VA 1D7YA 2J3NA 4H2RA 1ZP0A 4OPTA 3IWAA 5IQ1A 1HYUA 4A6NB 1VG0A 4D03A 4B66A 3AD8B 3D1CA 4J36A 1ELIA 1CJCA 3LB8A 4Z24A 2YR5A 2C3DA 3FIMB 3NIXA 2AAQA 4CY6A 2B76A 3ICSA 1BF3A 3LJPA 4IVMB 3S5WA 3LOVA 4Z26A 1Z6LA 4C74A 4OCGA 1FL2A 3AYIA 4O5QA 1Q1WA 5EOWA 1GRFA 4H4ZA 3NYEA 4YT0A 4H4QA 2XVHA 3NN0X 4X9MA 3FPZA 4AP1A 3O0HA 4YXDA 2XDOA 4DSGA 4JQ9A 4O5UA 1TDFA 1TDOA 5FS7A 3ALLA 4HA6A 4M52A 1PJ7A 1DXLA 3II4A 3GWFA 3M12A 1B8SA 2NVKX 3AYLA 4A7AA 3LXDA 2GR2A 1IUXA 2XVJA 1GOSA 3NYCA 4LIIA 1UKVG 1ZDLA 1FCDA 3FBSA 1GXFA 3V3NA 1LQTA 1IUVA 2BABA 5EB5A 2GRTA 2WP6A 1XDIA 3KPFA 5IQ4A 3DGZA 3QFBA 2E4GA 2C73A 4B69A 2C70A 2GAGB 5GRTA 3NLCA 2YLWA 1MO9A 1EL9A 1FECA 2FJAA 4K2XA 3CGDA 3NT6A 1YY5A 2B7RA 2XFUA 2BK4A 1K0JA 3ICRA 4GUVA 2GMHA 3GMBA 2C64A 4H4SA 4C77A 2V3BA 4GDEA 2YM1A 2TMDA 3H8IA 1CJ2A 1KNRA 3DJJA 2YWLA 3UP4A 2AR8A 1JRZA 2ACZA 4U8MA 1H6VA 1PS9A 5L46A 3NK1X 3VR9A 4U8OA 4X4JA 3B3RA 1FOHA 4TM0A 2C65A 1AOGA 4EMJA 4EQWA 3F8PA 2WOIA 4J31A 3COXA 2VZ2A 5GSNA 4K7ZA 3AB1A 3GD4A 1O94A 2WU2A 4IVOB 4U8IA 4ZCCA 1PBBA 4P9SA 3EANA 3ICTA 3UKPA 1L9EA 1PHHA 2GEWA 2XLPA 3I6DA 1OJDA 2WEUA 4JNAA 2CDUA 1E7PA 2VOUA 5KOXA 3RP6A 5EB4A 4OPGA 4RSLA 1N4WA 4OPLA 3V3OA 2BCGG 2CULA 3GMCA 3AEGA 2X8GA 1ZY8A 4EM4A 4GF7A 4OPCA 3PS9A 4B65A 4YWOA 1K4QA 1GTEA 3AE2A 3NTAA 4YKGA 4B67A 1RP0A 1BWCA 1COYA 1B5QA 2GR3A 2YAUA 1KSUA 4AT0A 2A87A 3ADAB 3VR8A 2YVJA 3WE0A 1YQZA 4EMWA 1PXCA 1PJ6A 1L9DA 2V61A 2WESA 3GYIA 3IHMA 4CCRA 4Z43A 2R0CA 1NEKA 4B64A 5BRTA 1KFYA 1IUUA 3G5RA 1YKJA 4CBQA 3KVEA 5ER0A 1S2QA 5HYMA 3C96A 3RNMA 5KVHA 2OALA 2R4JA 2JB2A 3KD9A 2YVFA 1CHUA 2YLZA 1KF6A 3UTEA 3ITJA 1Y56B 3UOVA 4B1BA 2ARDA 1LVLA 1BZLA 3EAOA 2APGA 2BACA 2WDQA 2E5VA 2XVFA 3V76A 2XLSA 3LADA 4FDCB 1XPQA 3SFEA 1DJNA 2FJDA 5JCLA 2BS2A 3ATRA 2OAMA 2PYXA 1EL7A 2JAEA 3NGCX 3SFDA 2WDVA 2YLTA 4H4TA 3KU9A 4GCMA 1DODA 3UOYA 1S2YA 3DJDA 3HZLA 2X50A 2VVLA 4ADWA 3P4SA 4UP3A 1L9CA 5FS8A 1LJ1A 2R0GA 1EL8A 4NZHA 4YTPA 2XYOA 2GQWA 2BK3A 4TM1A 1F8SA 2XVEA 2WBAA 3D8XA 1GRBA 2VVMA 3CNJA 3KKJA 3URHA 3UOXA 3GWDA 1TYTA 3T37A 1MXTA 1F6MA 4Z2UA 1E1KA 1ZOYA 3AEAA 3DK8A 4K5RA 4AP3A 3UOZA 4IV9A 3PO7A 4UDPA 1GSNA 1LQUA 1NENA 2Q0LA 3UKAA 2YLXA 4FX9A 4H4PA 2XLTA 2ZZCA 4A5LA 4YSZA 1LTXR 3UKLA 4H4YA 1OJTA 1PBDA 2BCPA 1QJDA 1IJHA 2X8HA 3AE7A 3AEDA 3QJ4A 2C3CA 4U2TA 1W4XA 4KPRA 2WETA 3B6DA 1PXAA 4WCTA 3AE5A 4IA6A 4YSXA 3DK9A 1LV0A 2XFPA 1ZKQA 3GRSA 1GV4A 1JNZA 3RP8A 3IC9A 3EF6A 4H50A 2AQJA 2B9WA 3AE4A 3CPJG 4U2SA 5HXIA 3G5SA 1CL0A 4FK1C 4Y4MA 4PAAA 1D5TA 4I59A 2F5ZA 2XFNA 3IF9A 2YG3A 3GYJA 2VQ7A 5DBJA 4Y4LA 3H4KA 4JDRA 4H2NA 1GRHA 1EBDA 3CGEA 4U8NA 1ZMDA 2WPEA 4LA1A 2R4EA 3AEBA 5HY5A 1D7LA 3UKHA 2WP9A 3E1TA 3CNSA 3NTDA 4Z25A 3LZXA 1ONFA 1BGNA 4J33A 3QSMA 3UCLA 2GH5A 1B4VA 1CC4A 2BS3A 1RSGA 3K7QX 5BUKA 3DK4A 4K8DA 2JKCA 3DH9A 1TDNA 4B63A 4YSYA 3BNMA 3BHFA 1V59A 2Q6UA 1ZK7A 4OPUA 3REDA 4Z2TA 5U1OA 2Y6RA 4Y4NA 2O9ZA 2GMJA 2WPFA 2DKIA 3QSSA 3L1RA 2GAHB 4X9NA 1JRYA 2BS4A 4ZCDA 4H4UA 3PVCA 4JN9A 2UZZA 3R9UA 3S61A 3UTHA 1PBEA 3AD7B 2CFYA 2WHDA 1CC6A 1GETA 1NAAA 4BJZA 3NN6X 3CGBA 3CNPA 3NG7X 2WPCA 4NTDA 2NPXA 3ALMA 1CF3A 3AYJA 2YVGA 5J7XA 3K7MX 2BXSA 4YSHA 4OPDA 3GDNA 1NG4A 4YKFA 1EL5A 2H88A 2YR6A 3P9UA 1VQWA 3DGHA 1LPFA 2YR4A 3P1WA 4Z44A 1E39A 1TDKA 3CNTA 1ZOVA 2C67A 2GQFA 4EQXA 2HQMA 1REOA 4DNAA 3GD3A 3AE6A 4K22A 2IVDA 3P4RA 4H2QA 2VRMA 1P2EA 1S3BA 3K7TA 4J34A 1GESA 4J56A 4EM3A 2C75A 1H81A 2VQBA 5HHFA 3CPHG 3M13A 2C72A 4DGKA 4GRTA 3BHKA 1PN0A 3DJGX 3CNDA 1GT8A 4JNQA 4CNKA 4TLXA 4EIPA 1Y56A 2BXRA 1KSSA 2IIDA 2WQYA 3ABVA 3BI4A 2DKHA 1GRGA 1CJ4A 1F3PA 4D04A 5KRQA 4XWZA 4TLZA 2GB0A 4B68A 3AEFA 3FMWA 3VRBA 1VDCA 1FEBA 4J57A 4BV6A 1N4UA 1O5WA 4H4XA 3UKQA 4FK1A 4I58A 1NHSA 4CCQA 1H82A 1M64A 1OJCA 1TRBA 1JU2A 2YG7A 2OLOA 2WOWA 3ATQA 4AT2A 5U63A 1PBFA 2YM2A 2Z5XA 3NHOX 5KWFA 1GRTA 1GREA 1NPXA 1X31B 2XCGA 4DSHA 2YG6A 3LZWA 1D4CA 4RG4A 3L8KA 1IUSA 4BJYA 1NG3A 4K5SA 4NEVA 5KXJA 3RHAA 1Q1RA 2QA2A 2BC1A 4N9XA 2X99A 3GSIA 2WS3A 3NK2X 3VQRA 5C3JA 2GR1A 1N1PA 4U8PA 3VRDB 1F8WA 1GNDA 4AOXA 2V6OA 2XFOA 3ZYXA 2OLNA 4U2LA 1JNRA 4JY3A 2I0ZA 4CY8A 5BULA 1H83A 1CC2A 1XANA 1TYPA 2BA9A 5IPYA 2C76A 3NK0X 4HB9A 1D4EA 1QO8A 2V5ZA 3C4NA 4E0VA 4A65A 2QAEA 5LV9A 3UKKA 4BK2A 3QVRA 4KX6A 1L0VA 4TM3A 1KDGA 3UTGA 2C66A 4H7UA 1PBCA 4UDRA 4C3YA 1IUTA 3AWIA 1H86A 3BNUA 4ZN0A 1Y0PA 3OZ2A 3UP5A 1GERA 3AE1A 2ZBWA 4GR1A 4USQA 2GV8A 2R45A 3NRNA 2FBWA 2A8XA 3SM8A 2JK6A
chains in the Genus database with same CATH superfamily
4BK3A 1K0IA 1OJAA 3OP2A 1H7WA 2R0PA 4ECHA 2PCEA 3KA7A 4XXGA 1BKWA 4APNA 3JSKA 2EQ8A 4REKA 2EQ6A 1EC9A 1DJQA 3HYXA 2EQ9A 1K0LA 3P4PA 1NHRA 3AE9A 4TM4A 2YG5A 4BURA 4OPIA 1VRQB 1M6IA 1PXBA 3DFYA 4EQRA 1KNPA 3V3WA 3CK5A 5JCIA 1CJ3A 1MOKA 4OVIA 2PGWA 3N6JA 3GRTA 2QA1A 1E9IA 3DMEA 2JB1A 3P4QA 1IUWA 5M10A 2XFQA 3Q9TA 1FHVA 3FG2P 3RRAA 2WDRA 3M0OA 3CGCA 1ZX9A 3UJRA 2TPRA 2GF3A 4H1ZA 1F8RA 3IHGA 3NKSA 1D4DA 3DA1A 1Q9IA 2QDDA 2XVIA 4C5OA 2R9ZA 3SGLA 3R10A 3IWAA 1CJCA 4Z24A 2YR5A 3FIMB 4CY6A 3S5WA 1Z6LA 4C74A 2DW6A 3H70A 3NVYB 3OW1A 5EOWA 4X9MA 5KMRA 2PPGA 2XDOA 4IZGA 4O5UA 1TDOA 3NFUA 1T3QC 2GDQA 3GWFA 3II4A 3DDMA 1B8SA 1FFUC 3VDGA 3DG3A 1FO4A 1GOSA 3FBSA 1LQTA 2BABA 3SXIA 2PMQA 5IQ4A 2E4GA 2C70A 5GRTA 3NLCA 2C4CA 2YLWA 3CGDA 3THUA 2I5QA 1K0JA 1X2HA 4H4SA 4C77A 2QJNA 2O56A 1CJ2A 1KNRA 1KKRA 2YWLA 1JRZA 4U8MA 3DESA 5L46A 3NK1X 3VR9A 4J31A 3OTRA 5GSNA 4IVOB 4U8IA 4ZCCA 3EANA 2XH2A 3ICTA 1L9EA 2GEWA 5KOXA 1E7PA 3SZCA 2BCGG 2CULA 4Z1YA 2X8GA 3D46A 4YKGA 3NTAA 3P0WA 4B67A 1BWCA 1COYA 2A87A 3ADAB 2YVJA 3WE0A 3GYIA 4B64A 3PFRA 1IUUA 3C96A 3RNMA 2JB2A 3KD9A 4B1BA 2OZTA 3CAWA 5BOFA 3IJQA 5JCLA 2BS2A 2PTWA 1EL7A 2YLTA 3A7AA 3DJDA 3HZLA 2VVLA 3P4SA 1SJDA 1L9CA 1LJ1A 1MNSA 4GISA 4NZHA 3IJIA 3AM9A 3URHA 1TYTA 1MXTA 1F6MA 2HXUA 4K5RA 2Q0LA 2GGGA 4II2A 2YLXA 4YSZA 1LTXR 3UKLA 4HCHA 4ZA0A 3AEDA 3MKCA 1KN0A 1GV4A 3IC9A 2B9WA 4I59A 3ZLGA 4G74A 2PTZA 2HZGA 3CGEA 1ZMDA 2WPEA 2ZADA 1D7LA 3E1TA 4J1OA 3NTDA 7ENLA 4Z25A 4J33A 3UCLA 2BS3A 1RSGA 3DK4A 1TDNA 4DWDA 1ZK7A 3SN4A 2GMJA 3L1RA 1JRYA 3PVCA 2WHDA 1NAAA 3HPFA 3L5OA 2YVGA 3FCPA 2BXSA 3GDNA 1NG4A 4YKFA 2YR6A 3JW7A 1VQWA 3DGHA 1EBHA 2YR4A 3NO1A 2C67A 3OPSA 1VQZA 3GD3A 1P2EA 3TOYA 4J34A 4EM3A 3CPHG 3BHKA 4JNQA 1GT8A 4TLXA 3VC5A 3MZNA 3UXLA 1F3PA 5KRQA 2GB0A 4B68A 4ROPA 1VDCA 4J57A 4H4XA 4I58A 1OJCA 1JU2A 3GYXA 2YG7A 2OLOA 2YM2A 5KWFA 1KCZA 2XCGA 4DSHA 1D4CA 4RG4A 3L8KA 2QA2A 2BC1A 1GNDA 3TQPA 5BULA 2BA9A 3TTEA 3V4BA 1QO8A 2OVLA 3UKKA 1L0VA 4TM3A 3BNUA 3UP5A 1FFVC 3DG7A 4E5TA 2GV8A 2R45A 3NRNA 3V5CA 2A8XA 2FJBA 1SJCA 2VRLA 2H89A 1BGJA 2A89A 2WP5A 2WU5A 3NYFA 5CQFA 3N4FA 4H4WA 4USRA 3T8QA 3CN8A 4H4VA 4A99A 4TVWA 5JCMA 3S47A 2JBVA 3DEQA 2ZZBA 3V5FA 2E1MA 1WUFA 2IVEA 5KVIA 4EQSA 2GR0A 3UKFA 3SQPA 2BK5A 1GPEA 4LU6A 3AD9B 4Z2RA 2P0IA 2B7SA 2RGJA 3DFHA 4U8JA 5IDZA 1ZMCA 4IA5A 1NDAA 5FS9A 2YQUA 5TR3A 3OZYA 1GRAA 2PHHA 1JDFA 1JOAA 3F8DA 1PDZA 4JN7A 1E1MA 3UJEA 2ZZ0A 2PODA 2V60A 4E6MA 4MJWA 1DOEA 2QCUA 3ISHA 2V3AA 3HYVA 3AE8A 3C4AA 1FEAA 2OA1A 4XWRA 4YTMA 2WOVA 4DYEA 2YLRA 2X8CA 3OC4A 2OZ8A 1YQ3A 4MKSA 4ICYA 3IK4A 3BI5A 1SEZA 3CMMA 1NHPA 4X2PA 3RR1A 2X3NA 3NXLA 2GGIA 1H84A 5U25A 2Q7VA 3TJIA 2OLAA 1QLBA 2RGOA 4H2RA 1VG0A 4B66A 3NVWB 2C3DA 2AAQA 3UJFA 3ICSA 3LJPA 3Q45A 4OCGA 4O5QA 1GRFA 4H4QA 1FIQB 3FXGA 4JQ9A 4HCDA 3ALLA 3P3BA 4M52A 2GR2A 2XVJA 3NYCA 4LIIA 3V3NA 1IUVA 2GRTA 2RDXA 4K2SA 1W6TA 2OQYA 1JCTA 4G6HA 1FECA 2FJAA 3NT6A 1YY5A 2B7RA 2BK4A 3RCYA 2C64A 2V3BA 2YM1A 1V97A 1ECQA 3UP4A 2PU0A 2ACZA 3ZVHA 1PS9A 4U8OA 3B3RA 4EMJA 2VZ2A 5KMQA 1O94A 4HCLA 4P9SA 2XLPA 1OJDA 2QVHA 4RSLA 3FV9A 3V3OA 1ZY8A 3K1GA 4OPCA 3PS9A 3R25A 4YWOA 1K4QA 3AE2A 1RP0A 2YAUA 1KSUA 4AT0A 3VR8A 3U4FA 1L9DA 4GGBA 1YEYA 4Z43A 3G5RA 1YKJA 3T0KA 3D9XA 5HYMA 2R4JA 2YLZA 1KF6A 1LVLA 3RO6A 2WDQA 3V76A 4FDCB 1XPQA 4J3ZA 3SFDA 4H4TA 4JHMA 3KU9A 1DODA 4ADWA 4UP3A 5FS8A 4KWSA 4YTPA 2XYOA 1F8SA 5ENLA 2WBAA 1GRBA 2VVMA 3CNJA 3KKJA 2OQHA 3ZLHA 4Z2UA 2FYMA 1IYXA 1E1KA 1ZOYA 4IV9A 3VFCA 4KEMA 1GSNA 1LQUA 2ZZCA 2QJJA 4A5LA 4H4YA 1PBDA 3KPKA 3KUMA 3BOXA 1IJHA 3AE7A 1W4XA 3R1ZA 2WETA 3B6DA 3AE5A 3SY4A 2XFPA 1ZKQA 3GRSA 4H50A 2AQJA 1XS2A 3T2KA 2POZA 2F5ZA 2XFNA 2YG3A 2P8BA 4JDRA 4U8NA 4LA1A 2R4EA 3NVZB 3AEBA 3UKHA 3CNSA 1ONFA 3QSMA 5BUKA 4Z2TA 2WPFA 3QSSA 4X9NA 2BS4A 4ZCDA 3R9UA 4A35A 2UZZA 3S61A 3VA8A 3UTHA 1PBEA 5FJTA 2CFYA 4BJZA 3NN6X 3EEZA 4NTDA 2NPXA 2AKZA 5J7XA 3K7MX 5KMPA 3FJ4A 4OPDA 1N60C 2H88A 1EC8A 3P9UA 1LPFA 3CNTA 1ZOVA 2GQFA 1REOA 2VRMA 1S3BA 1WYGA 3K7TA 3A7RA 4J56A 2C72A 4DGKA 3UJ2A 3CNDA 1JROA 4KT2A 2IIDA 4D04A 4XWZA 4GIRA 1DTNA 2GSHA 3FMWA 3IJLA 3QN3A 3VRBA 1NU5A 4CCQA 3VC6A 4FK1A 1NHSA 2OKTA 2WOWA 3SZ0A 4IT1A 2Z5XA 1GREA 3QPEA 3LZWA 2BRYA 4NNJA 4NEVA 3RHAA 4N9XA 2X99A 3GSIA 3NK2X 5C3JA 2GR1A 1F8WA 2OLNA 3TJ4A 4CY8A 1TYPA 5IPYA 2C76A 3N4EA 1D4EA 3C4NA 4A65A 2QAEA 5BOEA 1SJBA 4C3YA 2QQ6A 1H86A 1N62C 3TW9A 1RM6B 1OEPA 3UXKA 4U8PA 2JK6A 4A79A 3RP7A 2XLUA 4A9WA 2PP1A 4BK1A 3AXBA 4EMIA 2RGHA 3QVPA 1RYIA 1DOCA 1GTHA 3QSEA 3NH3X 2EQ7A 4J2WA 2YLSA 4ENLA 2PP0A 5FJRA 1EBGA 5M0ZA 1H7XA 3I3LA 1N63C 1P2HA 1DOBA 4EIQA 1PDHA 2BYBA 4K1WA 5FS6A 3EPTA 2ZC8A 3JVAA 5KOWA 3UTFA 3D47A 4RG3A 1JEHA 2C7GA 4HN8A 2NQLA 3VCNA 3CT2A 4NTEA 1CBOA 3SZWA 2YG4A 3CXBA 1PJ5A 2VVLG 4M0XA 1XHCA 1H2IA 5JCNA 2R46A 3ZDNA 3MUCA 2OFJA 1ELSA 4PABA 3K30A 2Y6QA 3DJEA 3TWBA 4GYPC 2P8CA 3KLJA 4H4RA 5FMHA 1N4VA 1D7YA 4GAVA 2J3NA 4Z17A 2BRAA 4D03A 3T2ZA 3AD8B 3D1CA 3T2YA 4IVMB 4Z26A 3LOVA 1FL2A 3QTPA 1Q1WA 4H4ZA 4YT0A 2XVHA 3FPZA 4AP1A 3ZLFA 4YXDA 3TWAA 4DSGA 1TDFA 5FS7A 3A7UA 3FVDA 1DXLA 1PJ7A 3LXDA 1IUXA 1UKVG 1GXFA 5EB5A 4GYPA 5J04A 1XDIA 3KPFA 2GAGB 3STPA 2AKMA 3RGTA 3I4KA 4GUVA 2GMHA 3GMBA 4GAPA 2TMDA 2W55A 2AR8A 1S7MA 3U9IA 2OO6A 1H6VA 3SBFA 4YWSA 4X4JA 1FOHA 4TM0A 4FI4A 3COXA 3AB1A 3ES7A 3H8AA 1KD0A 5EU9A 1PBBA 1PHHA 3I6DA 2WEUA 5FJPA 4MGGA 2VOUA 3RP6A 4A6GA 1ZXIC 2E3TA 2OZ3A 1R0MA 3GMCA 3AEGA 4EM4A 4B65A 3GY1A 2XSXA 1GTEA 3PK7A 2FKPA 1B5QA 2GR3A 3SQSA 1PXCA 3IHMA 2WESA 5BRTA 4CCRA 2R0CA 4CBQA 3T6CA 3NZGA 5KNLA 2OALA 2PTXA 5G5GB 2YVFA 1CHUA 3UTEA 3ITJA 1Y56B 3UOVA 2BACA 1BZLA 2APGA 2E5VA 2XGZA 3LADA 3SFEA 1DJNA 2FJDA 2PYXA 3NGCX 4TVYA 2GGHA 4DXKA 3UOYA 1S2YA 2X50A 3ZVIA 3T14A 2R0GA 1EL8A 1BKHA 1TE6A 2GQWA 2BK3A 4TM1A 2PS2A 4F4RA 3AEAA 3DK8A 3UOZA 3PO7A 3VCCA 4H83A 4H19A 3EKGA 1OJTA 2BCPA 2C3CA 4U2TA 1PXAA 4IA6A 3HW2A 1LV0A 4YSXA 3SX6A 2P3ZA 3RP8A 4U2SA 5HXIA 3G5SA 3CB3A 1D5TA 4G7FA 3IF9A 3GYJA 5DBJA 4Y4LA 3H4KA 1GRHA 1EBDA 2CHRA 1MDRA 1WUEA 4ZOHB 2XH4A 2WP9A 2HNEA 3B9JB 3B97A 1B4VA 1CC4A 3K7QX 2JKCA 4G6GA 4YSYA 3BNMA 3BHFA 2Q6UA 5U1OA 2Y6RA 2O9ZA 1CC6A 1GETA 3SJNA 3ALMA 1CF3A 3AYJA 4YSHA 1EL5A 3SZFA 4K8GA 2AL2B 3AE6A 4K22A 4DHGA 2IVDA 4IP4A 2C75A 5HHFA 4GRTA 3DJGX 1BQGA 4EIPA 3JZUA 2DKHA 1GRGA 3H7VA 4DN1A 4TLZA 2GGJA 3P93A 4BV6A 1O5WA 1KKOA 3AMZA 1M64A 2DW7A 3T4WA 5FJOA 3ATQA 4AT2A 5U63A 1PBFA 2OX4A 1X31B 2PGEA 1MDLA 1IUSA 4K5SA 3ETRB 2WS3A 1N1PA 2QJMA 2V6OA 2XFOA 3ZYXA 4U2LA 2I0ZA 1H83A 4IL0A 3NK0X 3QLDA 5G5HB 2V5ZA 4M6UA 1L8PA 5LV9A 3UTGA 2C66A 1PBCA 4UDRA 1IUTA 1Y0PA 2XH0A 1RVKA 4GR1A 4USQA 2FBWA 3SM8A 3AE3A 2CVJA 2JB3A 3SSZA 4G8TA 5C2TA 2RABA 2FJEA 4U8LA 1O95A 3QFAA 3VRAA 4E8GA 1NHQA 3SN1A 1TDEA 5J60A 4A3RA 1NELA 3CIRA 2B9XA 4CRTA 4E4FA 3AN1A 1DNCA 1ONEA 2B9YA 4U8KA 2PA6A 4H2PA 1GALA 4YTNA 3CTYA 4NEWA 2Q0KA 4JY2A 1E6EA 5EBKA 1JRXA 1VG9A 1F9CA 1B37A 2W0HA 5BVAA 1E1LA 3BI2A 2W3SA 3CPIG 3AECA 3R0UA 1YQ4A 3AEEA 2Z5YA 3N6HA 3ENLA 3BSMA 3DIPA 4HNCA 4WX1A 3DERA 4NTCA 1E1NA 1S3EA 1GEUA 3F8RA 4C3XA 3NNEA 2QDEA 4CNJA 3ALJA 3GDPA 2GVCA 4GDPA 4AOSA 1OJ9A 2XLRA 1P48A 3ZVHB 3SN0A 3MY9A 5CKUA 3TCSA 4NWZA 2MNRA 2BC0A 5JCKA 3FYYA 3Q6JA 4A6NA 3H8LA 3DG6A 4UDQA 3G5QA 4IHCA 2AL1A 1ZP0A 4OPTA 5IQ1A 1HYUA 4A6NB 4J36A 1ELIA 3LB8A 3NIXA 4G73A 2B76A 1BF3A 4HNLA 4IP5A 3AYIA 3NYEA 3NN0X 3GC2A 3O0HA 4GMEA 2AL2A 4HA6A 4JN8A 3M12A 6ENLA 2NVKX 3AYLA 4A7AA 4FP1A 1ZDLA 1FCDA 4G9KA 2WP6A 3T9PA 3DGZA 3QFBA 2C73A 3SYIA 4B69A 2OPJA 3PWGA 1MO9A 1EL9A 4K2XA 2XFUA 3ICRA 3I6TA 4GDEA 1FHUA 3H8IA 3DJJA 3Q4DA 3I6EA 4DX3A 3R11A 2C65A 1AOGA 4EQWA 3F8PA 2WOIA 5KMSA 4K7ZA 3GD4A 2WU2A 4EWJA 3UKPA 4JNAA 2CDUA 5EB4A 4OPGA 3H12A 1N4WA 4OPLA 3R0KA 2PP3A 3CXOA 4ZCWA 4GGHA 4GF7A 3NVVB 1TKKA 1YQZA 2V61A 4EMWA 1R6WA 3PG6A 1PJ6A 4H2HA 3DGBA 1NEKA 1KFYA 5FJUA 3KVEA 5ER0A 1S2QA 5KVHA 3OZMA 2GL5A 1N61C 3EAOA 2ARDA 1STZA 2XVFA 2XLSA 2QGYA 2GGEA 4E4UA 3ATRA 2OAMA 2XH7A 3T31A 2JAEA 2WDVA 3HRDC 2W3RA 4GCMA 3HYWA 4GFIA 2XVEA 3ES8A 3D8XA 3UOXA 3GWDA 2PTYA 1MUCA 2W54A 3T37A 3GO2A 4AP3A 2ONEA 4UDPA 1NENA 3UKAA 2PU1A 4FX9A 4H4PA 2XLTA 1EC7A 1QJDA 2X8HA 3QJ4A 4KPLA 4KPRA 4MMWA 4WCTA 3DK9A 1JNZA 3EF6A 3AE4A 3CPJG 1CL0A 4FK1C 4Y4MA 4PAAA 2PSNA 2VQ7A 4H2NA 1PDYA 5HY5A 3CYJA 2OG9A 2HXTA 3UCDA 3EUB3 3MSYA 3LZXA 2P88A 1BGNA 2GH5A 1VDVA 4IL2A 4K8DA 3DH9A 4B63A 1TZZA 1V59A 4OPUA 3REDA 4Y4NA 2DKIA 2GAHB 4H4UA 4JN9A 3NRZB 1N5XA 3AD7B 1MRAA 4HPNA 3CGBA 3CNPA 3NG7X 3MQTA 2WPCA 1JPDX 2MUCA 3UJSA 4Z44A 1JRPA 3P1WA 1E39A 1TDKA 1P43A 3UGVA 4EQXA 2HQMA 4DNAA 4II3A 3P4RA 4H2QA 1GESA 2VQBA 1H81A 1SB3B 1SJAA 3M13A 1N5WC 1PN0A 4CNKA 1Y56A 2BXRA 1KSSA 2WQYA 3ABVA 3MWCA 3BI4A 1CJ4A 1JPMA 3AEFA 1X2GA 1FEBA 3UKQA 1N4UA 1XPYA 1H82A 1TRBA 4HYRA 3NHOX 1GRTA 1NPXA 3UCCA 2YG6A 4BJYA 1NG3A 5KXJA 1Q1RA 3BJSA 3R07C 3NS1B 3RITA 3VQRA 3VRDB 4AOXA 2E5AA 3PWIA 1JNRA 4JY3A 1CC2A 1XANA 4HB9A 3S5SA 4E0VA 3QKEA 3GD6A 4BK2A 3QVRA 4KX6A 1KDGA 4H7UA 5JRBA 3AWIA 4ZN0A 3OZ2A 3SR6B 1GERA 3AE1A 2ZBWA
chains in the Genus database with same CATH topology
2FJBA 4A79A 3RP7A 3AE3A 2CVJA 2VRLA 2JB3A 2H89A 4BK3A 1K0IA 1BGJA 2A89A 5BRTA 2WP5A 5C2TA 2RABA 2WU5A 2XLUA 3NYFA 2FJEA 4U8LA 1O95A 4A9WA 1OJAA 3QFAA 5CQFA 3VRAA 4H4WA 4USRA 4BK1A 3AXBA 4EMIA 1NHQA 1H7WA 1TDEA 3CN8A 2R0PA 4H4VA 3KA7A 2RGHA 4XXGA 4ECHA 5J60A 4A99A 1BKWA 4APNA 5JCMA 3QVPA 3JSKA 2EQ8A 3CIRA 4REKA 1RYIA 1DOCA 1GTHA 2B9XA 2EQ6A 3QSEA 3NH3X 1DJQA 2JBVA 3HYXA 2EQ7A 2EQ9A 4J2WA 4CRTA 2ZZBA 2E1MA 1K0LA 3P4PA 2IVEA 5KVIA 1DNCA 2B9YA 1NHRA 2YLSA 4EQSA 3AE9A 2GR0A 4U8KA 3UKFA 3SQPA 4H2PA 1GALA 4TM4A 4YTNA 3CTYA 2BK5A 1GPEA 2YG5A 5M0ZA 1H7XA 4LU6A 3I3LA 4NEWA 3AD9B 4CNJA 4Z2RA 2Q0KA 4JY2A 2B7SA 1P2HA 1E6EA 1DOBA 5EBKA 2RGJA 4U8JA 4EIQA 1JRXA 1PDHA 1VG9A 2BYBA 1ZMCA 4BURA 4OPIA 1B37A 4IA5A 1VRQB 1NDAA 2W0HA 5FS9A 5FS6A 3EPTA 5BVAA 2YQUA 5KOWA 1E1LA 5TR3A 1M6IA 1PXBA 3BI2A 3UTFA 4EQRA 1GRAA 3CPIG 1KNPA 2PHHA 3AECA 1JOAA 5JCIA 4RG3A 1YQ4A 3AEEA 1JEHA 2Z5YA 3F8DA 2C7GA 1CJ3A 1E1MA 2ZZ0A 1MOKA 2V60A 4OVIA 4MJWA 3GRTA 4WX1A 2QA1A 1CBOA 4NTEA 3DMEA 4NTCA 1DOEA 3SZWA 1E1NA 1S3EA 1GEUA 1PJ5A 2QCUA 2VVLG 2V3AA 2JB1A 2YG4A 3F8RA 3ISHA 3HYVA 3P4QA 4C3XA 3NNEA 1IUWA 3AE8A 3C4AA 5M10A 1FEAA 1XHCA 2OA1A 2XFQA 3ALJA 3GDPA 3Q9TA 1H2IA 5JCNA 2GVCA 2R46A 4XWRA 4GDPA 3ZDNA 3FG2P 2WOVA 4YTMA 4AOSA 1OJ9A 2XLRA 2X8CA 2YLRA 3OC4A 1YQ3A 4ICYA 2WDRA 3M0OA 3CGCA 1ZX9A 4PABA 5CKUA 3BI5A 3K30A 2Y6QA 2TPRA 3DJEA 1SEZA 3CMMA 2GF3A 1NHPA 4NWZA 1F8RA 3IHGA 3NKSA 2BC0A 2X3NA 1D4DA 5JCKA 1H84A 3DA1A 3Q6JA 5U25A 1Q9IA 3H8LA 4A6NA 2Q7VA 3KLJA 2XVIA 4UDQA 4C5OA 2R9ZA 1QLBA 2RGOA 3G5QA 3SGLA 4H4RA 5FMHA 1N4VA 1D7YA 4GAVA 2J3NA 4H2RA 1ZP0A 4OPTA 2BRAA 3IWAA 5IQ1A 1HYUA 4A6NB 1VG0A 4D03A 4B66A 3T2ZA 3AD8B 3D1CA 4J36A 1ELIA 1CJCA 3LB8A 4Z24A 2YR5A 2C3DA 3FIMB 3NIXA 2AAQA 3T2YA 4CY6A 4G73A 2B76A 3ICSA 1BF3A 3LJPA 4IVMB 3S5WA 3LOVA 4Z26A 1Z6LA 4C74A 4OCGA 1FL2A 3AYIA 4O5QA 1Q1WA 5EOWA 1GRFA 4H4ZA 3NYEA 4YT0A 4H4QA 2XVHA 3NN0X 4X9MA 3FPZA 4AP1A 5KMRA 3O0HA 4YXDA 2XDOA 4DSGA 4JQ9A 4O5UA 1TDFA 1TDOA 5FS7A 3ALLA 4HA6A 4M52A 1PJ7A 1DXLA 3II4A 3GWFA 3M12A 1B8SA 2NVKX 3AYLA 4A7AA 3LXDA 2GR2A 1IUXA 2XVJA 1GOSA 3NYCA 4LIIA 1UKVG 1ZDLA 1FCDA 3FBSA 1GXFA 3V3NA 4G9KA 1LQTA 1IUVA 2BABA 5EB5A 3SXIA 2GRTA 2WP6A 1XDIA 3KPFA 5IQ4A 3DGZA 3QFBA 2E4GA 2C73A 3SYIA 4B69A 2C70A 2GAGB 5GRTA 3NLCA 2C4CA 2YLWA 1MO9A 1EL9A 4G6HA 1FECA 2FJAA 4K2XA 3CGDA 3NT6A 1YY5A 2B7RA 2XFUA 2BK4A 1K0JA 3ICRA 4GUVA 2GMHA 3GMBA 4GAPA 2C64A 4H4SA 4C77A 2V3BA 4GDEA 2YM1A 2TMDA 3H8IA 1CJ2A 1KNRA 3DJJA 2YWLA 3UP4A 2AR8A 1S7MA 1JRZA 2ACZA 4U8MA 1H6VA 1PS9A 5L46A 3NK1X 3VR9A 4U8OA 4X4JA 3B3RA 1FOHA 4TM0A 2C65A 1AOGA 4EMJA 4EQWA 3F8PA 2WOIA 5KMSA 4J31A 3COXA 2VZ2A 5GSNA 4K7ZA 3AB1A 3GD4A 5KMQA 1O94A 2WU2A 4IVOB 4U8IA 4ZCCA 1PBBA 4P9SA 3EANA 3ICTA 3UKPA 1L9EA 1PHHA 2GEWA 2XLPA 3I6DA 1OJDA 2WEUA 4JNAA 2CDUA 1E7PA 2VOUA 5KOXA 3RP6A 5EB4A 4OPGA 4RSLA 3SZCA 1N4WA 4OPLA 3V3OA 2BCGG 2CULA 3GMCA 3AEGA 2X8GA 1ZY8A 4EM4A 4GF7A 4OPCA 3PS9A 4B65A 4YWOA 1K4QA 1GTEA 3AE2A 3NTAA 4YKGA 4B67A 1RP0A 1BWCA 1COYA 1B5QA 2GR3A 2YAUA 1KSUA 4AT0A 2A87A 3ADAB 3VR8A 2YVJA 3WE0A 1YQZA 4EMWA 1PXCA 3PG6A 1L9DA 1PJ6A 2V61A 2WESA 3GYIA 3IHMA 4CCRA 2R0CA 1NEKA 4B64A 4Z43A 1KFYA 1IUUA 3G5RA 1YKJA 3T0KA 4CBQA 3KVEA 3D9XA 5KNLA 5ER0A 1S2QA 5HYMA 3C96A 3RNMA 5KVHA 2OALA 2R4JA 2JB2A 3KD9A 2YVFA 1CHUA 2YLZA 1KF6A 3UTEA 3ITJA 1Y56B 3UOVA 4B1BA 2ARDA 1LVLA 1BZLA 3EAOA 2APGA 2BACA 2WDQA 2E5VA 2XVFA 3V76A 2XLSA 3LADA 4FDCB 1XPQA 3SFEA 1DJNA 2FJDA 5JCLA 2BS2A 3ATRA 2OAMA 3T31A 2PYXA 1EL7A 2JAEA 3NGCX 3SFDA 2WDVA 2YLTA 4H4TA 3KU9A 4GCMA 1DODA 3HYWA 3UOYA 1S2YA 3DJDA 3HZLA 2X50A 2VVLA 4ADWA 3P4SA 4UP3A 1L9CA 5FS8A 1LJ1A 2R0GA 1EL8A 3T14A 4NZHA 4YTPA 2XYOA 2GQWA 2BK3A 4TM1A 1F8SA 2XVEA 2WBAA 3D8XA 1GRBA 2VVMA 3CNJA 3KKJA 3URHA 3UOXA 3GWDA 1TYTA 3T37A 1MXTA 1F6MA 4Z2UA 1E1KA 1ZOYA 3AEAA 3DK8A 4K5RA 4AP3A 3UOZA 4IV9A 3PO7A 4UDPA 1GSNA 1LQUA 1NENA 2Q0LA 4II2A 3UKAA 2YLXA 4FX9A 4H4PA 2XLTA 2ZZCA 4A5LA 4YSZA 1LTXR 3UKLA 4H4YA 1OJTA 1PBDA 2BCPA 1QJDA 3KPKA 1IJHA 2X8HA 3AE7A 3AEDA 3QJ4A 2C3CA 4U2TA 1W4XA 4KPRA 2WETA 3B6DA 1PXAA 4WCTA 3AE5A 4IA6A 3SY4A 1LV0A 3DK9A 2XFPA 3SX6A 1KN0A 4YSXA 1ZKQA 3GRSA 1GV4A 1JNZA 3RP8A 3IC9A 3EF6A 4H50A 2AQJA 2B9WA 3AE4A 3CPJG 4U2SA 5HXIA 3G5SA 1CL0A 3T2KA 4FK1C 4Y4MA 4PAAA 1D5TA 4I59A 2F5ZA 2XFNA 3IF9A 2YG3A 3GYJA 2VQ7A 4G74A 5DBJA 4Y4LA 3H4KA 4JDRA 4H2NA 1GRHA 1EBDA 3CGEA 4U8NA 1ZMDA 2WPEA 4LA1A 2R4EA 3AEBA 5HY5A 1D7LA 3UKHA 2WP9A 3E1TA 3CNSA 3NTDA 4Z25A 3LZXA 1ONFA 1BGNA 4J33A 3QSMA 3UCLA 2GH5A 1B4VA 1CC4A 2BS3A 1RSGA 3K7QX 5BUKA 3DK4A 4K8DA 2JKCA 4G6GA 3DH9A 1TDNA 4B63A 4YSYA 3BNMA 3BHFA 1V59A 2Q6UA 1ZK7A 4OPUA 3REDA 4Z2TA 5U1OA 2Y6RA 4Y4NA 2O9ZA 2GMJA 2WPFA 2DKIA 3QSSA 3L1RA 2GAHB 4X9NA 1JRYA 2BS4A 4ZCDA 4H4UA 3PVCA 4JN9A 2UZZA 3R9UA 3S61A 3UTHA 1PBEA 3AD7B 2CFYA 2WHDA 1CC6A 1GETA 1NAAA 4BJZA 3NN6X 3L5OA 3CGBA 3CNPA 3NG7X 2WPCA 4NTDA 2NPXA 3ALMA 1CF3A 3AYJA 2YVGA 5J7XA 3K7MX 2BXSA 5KMPA 4YSHA 4OPDA 3GDNA 1NG4A 4YKFA 1EL5A 2H88A 3SZFA 2YR6A 3P9UA 1VQWA 3DGHA 1LPFA 2YR4A 3P1WA 4Z44A 1E39A 1TDKA 3CNTA 1ZOVA 2C67A 2GQFA 4EQXA 2HQMA 1REOA 4DNAA 3GD3A 3AE6A 4K22A 4II3A 3P4RA 4H2QA 2IVDA 2VRMA 1P2EA 1S3BA 3K7TA 4J34A 1GESA 4J56A 4EM3A 2C75A 1H81A 2VQBA 5HHFA 3CPHG 3M13A 2C72A 4DGKA 4GRTA 3BHKA 1PN0A 3DJGX 3CNDA 1GT8A 4JNQA 4CNKA 4TLXA 4EIPA 1Y56A 2BXRA 1KSSA 2IIDA 2WQYA 3ABVA 3BI4A 2DKHA 1GRGA 1CJ4A 1F3PA 4D04A 5KRQA 4XWZA 4TLZA 2GB0A 4B68A 3AEFA 3FMWA 3VRBA 1VDCA 1FEBA 4J57A 4BV6A 1N4UA 1O5WA 4H4XA 3UKQA 4FK1A 4I58A 1NHSA 4CCQA 1H82A 1M64A 1OJCA 1TRBA 1JU2A 3GYXA 2YG7A 2OLOA 2WOWA 3ATQA 3SZ0A 4AT2A 5U63A 1PBFA 2YM2A 2Z5XA 3NHOX 5KWFA 1GRTA 1GREA 1NPXA 1X31B 2XCGA 4DSHA 2YG6A 3LZWA 1D4CA 4RG4A 3L8KA 1IUSA 4BJYA 2BRYA 1NG3A 4NNJA 4K5SA 4NEVA 5KXJA 3RHAA 1Q1RA 2QA2A 2BC1A 4N9XA 2X99A 3GSIA 2WS3A 3NK2X 3VQRA 5C3JA 2GR1A 1N1PA 4U8PA 3VRDB 1F8WA 1GNDA 4AOXA 2V6OA 2XFOA 3ZYXA 2OLNA 4U2LA 1JNRA 4JY3A 2I0ZA 4CY8A 5BULA 1H83A 1CC2A 1XANA 1TYPA 2BA9A 5IPYA 2C76A 3NK0X 4HB9A 1D4EA 1QO8A 2V5ZA 3C4NA 4E0VA 4A65A 2QAEA 5LV9A 3UKKA 4BK2A 3QVRA 4KX6A 1L0VA 4TM3A 1KDGA 3UTGA 2C66A 4H7UA 1PBCA 4UDRA 4C3YA 5JRBA 1IUTA 3AWIA 1H86A 3BNUA 4ZN0A 1Y0PA 3OZ2A 3UP5A 1GERA 3AE1A 2ZBWA 4GR1A 4USQA 2GV8A 2R45A 3NRNA 2FBWA 2A8XA 3SM8A 2JK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJB A;  4A79 A;  3RP7 A;  3AE3 A;  2CVJ A;  2VRL A;  2JB3 A;  2H89 A;  4BK3 A;  1K0I A;  1BGJ A;  2A89 A;  2WP5 A;  5C2T A;  2RAB A;  2WU5 A;  2XLU A;  3NYF A;  2FJE A;  4U8L A;  1O95 A;  4A9W A;  1OJA A;  3QFA A;  5CQF A;  3VRA A;  4H4W A;  4USR A;  4BK1 A;  3AXB A;  4EMI A;  1NHQ A;  1H7W A;  1TDE A;  3CN8 A;  2R0P A;  4H4V A;  3KA7 A;  2RGH A;  4XXG A;  4ECH A;  5J60 A;  4A99 A;  1BKW A;  4APN A;  5JCM A;  3QVP A;  3JSK A;  2EQ8 A;  3CIR A;  4REK A;  1RYI A;  1DOC A;  1GTH A;  2B9X A;  2EQ6 A;  3QSE A;  3NH3 X;  1DJQ A;  2JBV A;  2EQ7 A;  2EQ9 A;  4J2W A;  4CRT A;  2ZZB A;  2E1M A;  1K0L A;  3P4P A;  2IVE A;  5KVI A;  1DNC A;  2B9Y A;  1NHR A;  2YLS A;  4EQS A;  3AE9 A;  2GR0 A;  4U8K A;  3UKF A;  3SQP A;  4H2P A;  1GAL A;  4TM4 A;  4YTN A;  3CTY A;  2BK5 A;  1GPE A;  2YG5 A;  5M0Z A;  1H7X A;  4LU6 A;  3I3L A;  4NEW A;  3AD9 B;  4CNJ A;  4Z2R A;  2Q0K A;  4JY2 A;  2B7S A;  1P2H A;  1E6E A;  1DOB A;  5EBK A;  2RGJ A;  4U8J A;  4EIQ A;  1JRX A;  1PDH A;  1VG9 A;  2BYB A;  1ZMC A;  4BUR A;  4OPI A;  1B37 A;  4IA5 A;  1VRQ B;  1NDA A;  2W0H A;  5FS9 A;  5FS6 A;  3EPT A;  5BVA A;  2YQU A;  5KOW A;  1E1L A;  5TR3 A;  1M6I A;  1PXB A;  3BI2 A;  3UTF A;  4EQR A;  1GRA A;  3CPI G;  1KNP A;  2PHH A;  3AEC A;  1JOA A;  5JCI A;  4RG3 A;  1YQ4 A;  3AEE A;  1JEH A;  2Z5Y A;  3F8D A;  2C7G A;  1CJ3 A;  1E1M A;  2ZZ0 A;  1MOK A;  2V60 A;  4OVI A;  4MJW A;  3GRT A;  4WX1 A;  2QA1 A;  1CBO A;  4NTE A;  3DME A;  4NTC A;  1DOE A;  1E1N A;  1S3E A;  1GEU A;  1PJ5 A;  2QCU A;  2VVL G;  2V3A A;  2JB1 A;  2YG4 A;  3F8R A;  3ISH A;  3P4Q A;  4C3X A;  3NNE A;  1IUW A;  3AE8 A;  3C4A A;  5M10 A;  1FEA A;  1XHC A;  2OA1 A;  2XFQ A;  3ALJ A;  3GDP A;  3Q9T A;  5JCN A;  2GVC A;  2R46 A;  4XWR A;  3ZDN A;  4GDP A;  3FG2 P;  2WOV A;  4YTM A;  4AOS A;  1OJ9 A;  2XLR A;  2X8C A;  2YLR A;  3OC4 A;  1YQ3 A;  4ICY A;  2WDR A;  3M0O A;  3CGC A;  1ZX9 A;  4PAB A;  5CKU A;  3BI5 A;  3K30 A;  2Y6Q A;  2TPR A;  3DJE A;  1SEZ A;  2GF3 A;  1NHP A;  1F8R A;  3IHG A;  3NKS A;  2BC0 A;  2X3N A;  1D4D A;  5JCK A;  1H84 A;  3DA1 A;  3Q6J A;  5U25 A;  1Q9I A;  3H8L A;  4A6N A;  2Q7V A;  3KLJ A;  2XVI A;  4UDQ A;  4C5O A;  2R9Z A;  1QLB A;  2RGO A;  3G5Q A;  3SGL A;  4H4R A;  5FMH A;  1N4V A;  1D7Y A;  2J3N A;  4H2R A;  1ZP0 A;  4OPT A;  3IWA A;  5IQ1 A;  1HYU A;  4A6N B;  1VG0 A;  4D03 A;  4B66 A;  3AD8 B;  3D1C A;  4J36 A;  1ELI A;  1CJC A;  3LB8 A;  4Z24 A;  2YR5 A;  2C3D A;  3FIM B;  3NIX A;  2AAQ A;  4CY6 A;  2B76 A;  3ICS A;  1BF3 A;  3LJP A;  4IVM B;  3S5W A;  3LOV A;  4Z26 A;  1Z6L A;  4C74 A;  4OCG A;  1FL2 A;  3AYI A;  4O5Q A;  1Q1W A;  5EOW A;  1GRF A;  4H4Z A;  3NYE A;  4YT0 A;  4H4Q A;  2XVH A;  3NN0 X;  4X9M A;  3FPZ A;  4AP1 A;  3O0H A;  4YXD A;  2XDO A;  4DSG A;  4JQ9 A;  4O5U A;  1TDF A;  1TDO A;  5FS7 A;  3ALL A;  4HA6 A;  4M52 A;  1PJ7 A;  1DXL A;  3II4 A;  3GWF A;  3M12 A;  1B8S A;  2NVK X;  3AYL A;  4A7A A;  3LXD A;  2GR2 A;  1IUX A;  2XVJ A;  1GOS A;  3NYC A;  4LII A;  1UKV G;  1ZDL A;  1FCD A;  3FBS A;  1GXF A;  3V3N A;  1LQT A;  1IUV A;  2BAB A;  5EB5 A;  2GRT A;  2WP6 A;  1XDI A;  3KPF A;  5IQ4 A;  3DGZ A;  3QFB A;  2E4G A;  2C73 A;  4B69 A;  2C70 A;  2GAG B;  5GRT A;  3NLC A;  2YLW A;  1MO9 A;  1EL9 A;  1FEC A;  2FJA A;  4K2X A;  3CGD A;  3NT6 A;  1YY5 A;  2B7R A;  2XFU A;  2BK4 A;  1K0J A;  3ICR A;  4GUV A;  2GMH A;  3GMB A;  2C64 A;  4H4S A;  4C77 A;  2V3B A;  4GDE A;  2YM1 A;  2TMD A;  3H8I A;  1CJ2 A;  1KNR A;  3DJJ A;  2YWL A;  3UP4 A;  2AR8 A;  1JRZ A;  2ACZ A;  4U8M A;  1H6V A;  1PS9 A;  5L46 A;  3NK1 X;  3VR9 A;  4U8O A;  4X4J A;  3B3R A;  1FOH A;  4TM0 A;  2C65 A;  1AOG A;  4EMJ A;  4EQW A;  3F8P A;  2WOI A;  4J31 A;  3COX A;  2VZ2 A;  5GSN A;  4K7Z A;  3AB1 A;  3GD4 A;  1O94 A;  2WU2 A;  4IVO B;  4U8I A;  4ZCC A;  1PBB A;  4P9S A;  3EAN A;  3ICT A;  3UKP A;  1L9E A;  1PHH A;  2GEW A;  2XLP A;  3I6D A;  1OJD A;  2WEU A;  4JNA A;  2CDU A;  1E7P A;  2VOU A;  5KOX A;  3RP6 A;  5EB4 A;  4OPG A;  4RSL A;  1N4W A;  4OPL A;  3V3O A;  2BCG G;  2CUL A;  3GMC A;  3AEG A;  2X8G A;  1ZY8 A;  4EM4 A;  4GF7 A;  4OPC A;  3PS9 A;  4B65 A;  4YWO A;  1K4Q A;  1GTE A;  3AE2 A;  3NTA A;  4YKG A;  4B67 A;  1RP0 A;  1BWC A;  1COY A;  1B5Q A;  2GR3 A;  2YAU A;  1KSU A;  4AT0 A;  2A87 A;  3ADA B;  3VR8 A;  2YVJ A;  3WE0 A;  1YQZ A;  4EMW A;  1PXC A;  1PJ6 A;  1L9D A;  2V61 A;  2WES A;  3GYI A;  3IHM A;  4CCR A;  4Z43 A;  2R0C A;  1NEK A;  4B64 A;  5BRT A;  1KFY A;  1IUU A;  3G5R A;  1YKJ A;  4CBQ A;  3KVE A;  5ER0 A;  1S2Q A;  5HYM A;  3C96 A;  3RNM A;  5KVH A;  2OAL A;  2R4J A;  2JB2 A;  3KD9 A;  2YVF A;  1CHU A;  2YLZ A;  1KF6 A;  3UTE A;  3ITJ A;  1Y56 B;  3UOV A;  4B1B A;  2ARD A;  1LVL A;  1BZL A;  3EAO A;  2APG A;  2BAC A;  2WDQ A;  2E5V A;  2XVF A;  3V76 A;  2XLS A;  3LAD A;  4FDC B;  1XPQ A;  3SFE A;  1DJN A;  2FJD A;  5JCL A;  2BS2 A;  3ATR A;  2OAM A;  2PYX A;  1EL7 A;  2JAE A;  3NGC X;  3SFD A;  2WDV A;  2YLT A;  4H4T A;  3KU9 A;  4GCM A;  1DOD A;  3UOY A;  1S2Y A;  3DJD A;  3HZL A;  2X50 A;  2VVL A;  4ADW A;  3P4S A;  4UP3 A;  1L9C A;  5FS8 A;  1LJ1 A;  2R0G A;  1EL8 A;  4NZH A;  4YTP A;  2XYO A;  2GQW A;  2BK3 A;  4TM1 A;  1F8S A;  2XVE A;  2WBA A;  3D8X A;  1GRB A;  2VVM A;  3CNJ A;  3KKJ A;  3URH A;  3UOX A;  3GWD A;  1TYT A;  3T37 A;  1MXT A;  1F6M A;  4Z2U A;  1E1K A;  1ZOY A;  3AEA A;  3DK8 A;  4K5R A;  4AP3 A;  3UOZ A;  4IV9 A;  3PO7 A;  4UDP A;  1GSN A;  1LQU A;  1NEN A;  2Q0L A;  3UKA A;  2YLX A;  4FX9 A;  4H4P A;  2XLT A;  2ZZC A;  4A5L A;  4YSZ A;  1LTX R;  3UKL A;  4H4Y A;  1OJT A;  1PBD A;  2BCP A;  1QJD A;  1IJH A;  2X8H A;  3AE7 A;  3AED A;  3QJ4 A;  2C3C A;  4U2T A;  1W4X A;  4KPR A;  2WET A;  3B6D A;  1PXA A;  4WCT A;  3AE5 A;  4IA6 A;  4YSX A;  3DK9 A;  1LV0 A;  2XFP A;  1ZKQ A;  3GRS A;  1GV4 A;  1JNZ A;  3RP8 A;  3IC9 A;  3EF6 A;  4H50 A;  2AQJ A;  2B9W A;  3AE4 A;  3CPJ G;  4U2S A;  5HXI A;  3G5S A;  1CL0 A;  4FK1 C;  4Y4M A;  4PAA A;  1D5T A;  4I59 A;  2F5Z A;  2XFN A;  3IF9 A;  2YG3 A;  3GYJ A;  2VQ7 A;  5DBJ A;  4Y4L A;  3H4K A;  4JDR A;  4H2N A;  1GRH A;  1EBD A;  3CGE A;  4U8N A;  1ZMD A;  2WPE A;  4LA1 A;  2R4E A;  3AEB A;  5HY5 A;  1D7L A;  3UKH A;  2WP9 A;  3E1T A;  3CNS A;  3NTD A;  4Z25 A;  3LZX A;  1ONF A;  1BGN A;  4J33 A;  3QSM A;  3UCL A;  2GH5 A;  1B4V A;  1CC4 A;  2BS3 A;  1RSG A;  3K7Q X;  5BUK A;  3DK4 A;  4K8D A;  2JKC A;  3DH9 A;  1TDN A;  4B63 A;  4YSY A;  3BNM A;  3BHF A;  1V59 A;  2Q6U A;  1ZK7 A;  4OPU A;  3RED A;  4Z2T A;  5U1O A;  2Y6R A;  4Y4N A;  2O9Z A;  2GMJ A;  2WPF A;  2DKI A;  3QSS A;  3L1R A;  2GAH B;  4X9N A;  1JRY A;  2BS4 A;  4ZCD A;  4H4U A;  3PVC A;  4JN9 A;  2UZZ A;  3R9U A;  3S61 A;  3UTH A;  1PBE A;  3AD7 B;  2CFY A;  2WHD A;  1CC6 A;  1GET A;  1NAA A;  4BJZ A;  3NN6 X;  3CGB A;  3CNP A;  3NG7 X;  2WPC A;  4NTD A;  2NPX A;  3ALM A;  1CF3 A;  3AYJ A;  2YVG A;  5J7X A;  3K7M X;  2BXS A;  4YSH A;  4OPD A;  3GDN A;  1NG4 A;  4YKF A;  1EL5 A;  2H88 A;  2YR6 A;  3P9U A;  1VQW A;  3DGH A;  1LPF A;  2YR4 A;  3P1W A;  4Z44 A;  1E39 A;  1TDK A;  3CNT A;  1ZOV A;  2C67 A;  2GQF A;  4EQX A;  2HQM A;  1REO A;  4DNA A;  3GD3 A;  3AE6 A;  4K22 A;  2IVD A;  3P4R A;  4H2Q A;  2VRM A;  1P2E A;  1S3B A;  3K7T A;  4J34 A;  1GES A;  4J56 A;  4EM3 A;  2C75 A;  1H81 A;  2VQB A;  5HHF A;  3CPH G;  3M13 A;  2C72 A;  4DGK A;  4GRT A;  3BHK A;  1PN0 A;  3DJG X;  3CND A;  1GT8 A;  4JNQ A;  4CNK A;  4TLX A;  4EIP A;  1Y56 A;  2BXR A;  1KSS A;  2IID A;  2WQY A;  3ABV A;  3BI4 A;  2DKH A;  1GRG A;  1CJ4 A;  1F3P A;  4D04 A;  5KRQ A;  4XWZ A;  4TLZ A;  2GB0 A;  4B68 A;  3AEF A;  3FMW A;  3VRB A;  1VDC A;  1FEB A;  4J57 A;  4BV6 A;  1N4U A;  1O5W A;  4H4X A;  3UKQ A;  4FK1 A;  4I58 A;  1NHS A;  4CCQ A;  1H82 A;  1M64 A;  1OJC A;  1TRB A;  1JU2 A;  2YG7 A;  2OLO A;  2WOW A;  3ATQ A;  4AT2 A;  5U63 A;  1PBF A;  2YM2 A;  2Z5X A;  3NHO X;  5KWF A;  1GRT A;  1GRE A;  1NPX A;  1X31 B;  2XCG A;  4DSH A;  2YG6 A;  3LZW A;  1D4C A;  4RG4 A;  3L8K A;  1IUS A;  4BJY A;  1NG3 A;  4K5S A;  4NEV A;  5KXJ A;  3RHA A;  1Q1R A;  2QA2 A;  2BC1 A;  4N9X A;  2X99 A;  3GSI A;  2WS3 A;  3NK2 X;  3VQR A;  5C3J A;  2GR1 A;  1N1P A;  4U8P A;  3VRD B;  1F8W A;  1GND A;  4AOX A;  2V6O A;  2XFO A;  3ZYX A;  2OLN A;  4U2L A;  1JNR A;  4JY3 A;  2I0Z A;  4CY8 A;  5BUL A;  1H83 A;  1CC2 A;  1XAN A;  1TYP A;  2BA9 A;  5IPY A;  2C76 A;  3NK0 X;  4HB9 A;  1D4E A;  1QO8 A;  2V5Z A;  3C4N A;  4E0V A;  4A65 A;  2QAE A;  5LV9 A;  3UKK A;  4BK2 A;  3QVR A;  4KX6 A;  1L0V A;  4TM3 A;  1KDG A;  3UTG A;  2C66 A;  4H7U A;  1PBC A;  4UDR A;  4C3Y A;  1IUT A;  3AWI A;  1H86 A;  3BNU A;  4ZN0 A;  1Y0P A;  3OZ2 A;  3UP5 A;  1GER A;  3AE1 A;  2ZBW A;  4GR1 A;  4USQ A;  2GV8 A;  2R45 A;  3NRN A;  2FBW A;  2A8X A;  3SM8 A;  2JK6 A; 
#chains in the Genus database with same CATH topology
 4BK3 A;  1K0I A;  1OJA A;  3OP2 A;  1H7W A;  2R0P A;  4ECH A;  2PCE A;  3KA7 A;  4XXG A;  1BKW A;  4APN A;  3JSK A;  2EQ8 A;  4REK A;  2EQ6 A;  1EC9 A;  1DJQ A;  3HYX A;  2EQ9 A;  1K0L A;  3P4P A;  1NHR A;  3AE9 A;  4TM4 A;  2YG5 A;  4BUR A;  4OPI A;  1VRQ B;  1M6I A;  1PXB A;  3DFY A;  4EQR A;  1KNP A;  3V3W A;  3CK5 A;  5JCI A;  1CJ3 A;  1MOK A;  4OVI A;  2PGW A;  3N6J A;  3GRT A;  2QA1 A;  1E9I A;  3DME A;  2JB1 A;  3P4Q A;  1IUW A;  5M10 A;  2XFQ A;  3Q9T A;  1FHV A;  3FG2 P;  3RRA A;  2WDR A;  3M0O A;  3CGC A;  1ZX9 A;  3UJR A;  2TPR A;  2GF3 A;  4H1Z A;  1F8R A;  3IHG A;  3NKS A;  1D4D A;  3DA1 A;  1Q9I A;  2QDD A;  2XVI A;  4C5O A;  2R9Z A;  3SGL A;  3R10 A;  3IWA A;  1CJC A;  4Z24 A;  2YR5 A;  3FIM B;  4CY6 A;  3S5W A;  1Z6L A;  4C74 A;  2DW6 A;  3H70 A;  3NVY B;  3OW1 A;  5EOW A;  4X9M A;  5KMR A;  2PPG A;  2XDO A;  4IZG A;  4O5U A;  1TDO A;  3NFU A;  1T3Q C;  2GDQ A;  3GWF A;  3II4 A;  3DDM A;  1B8S A;  1FFU C;  3VDG A;  3DG3 A;  1FO4 A;  1GOS A;  3FBS A;  1LQT A;  2BAB A;  3SXI A;  2PMQ A;  5IQ4 A;  2E4G A;  2C70 A;  5GRT A;  3NLC A;  2C4C A;  2YLW A;  3CGD A;  3THU A;  2I5Q A;  1K0J A;  1X2H A;  4H4S A;  4C77 A;  2QJN A;  2O56 A;  1CJ2 A;  1KNR A;  1KKR A;  2YWL A;  1JRZ A;  4U8M A;  3DES A;  5L46 A;  3NK1 X;  3VR9 A;  4J31 A;  3OTR A;  5GSN A;  4IVO B;  4U8I A;  4ZCC A;  3EAN A;  2XH2 A;  3ICT A;  1L9E A;  2GEW A;  5KOX A;  1E7P A;  3SZC A;  2BCG G;  2CUL A;  4Z1Y A;  2X8G A;  3D46 A;  4YKG A;  3NTA A;  3P0W A;  4B67 A;  1BWC A;  1COY A;  2A87 A;  3ADA B;  2YVJ A;  3WE0 A;  3GYI A;  4B64 A;  3PFR A;  1IUU A;  3C96 A;  3RNM A;  2JB2 A;  3KD9 A;  4B1B A;  2OZT A;  3CAW A;  5BOF A;  3IJQ A;  5JCL A;  2BS2 A;  2PTW A;  1EL7 A;  2YLT A;  3A7A A;  3DJD A;  3HZL A;  2VVL A;  3P4S A;  1SJD A;  1L9C A;  1LJ1 A;  1MNS A;  4GIS A;  4NZH A;  3IJI A;  3AM9 A;  3URH A;  1TYT A;  1MXT A;  1F6M A;  2HXU A;  4K5R A;  2Q0L A;  2GGG A;  4II2 A;  2YLX A;  4YSZ A;  1LTX R;  3UKL A;  4HCH A;  4ZA0 A;  3AED A;  3MKC A;  1KN0 A;  1GV4 A;  3IC9 A;  2B9W A;  4I59 A;  3ZLG A;  4G74 A;  2PTZ A;  2HZG A;  3CGE A;  1ZMD A;  2WPE A;  2ZAD A;  1D7L A;  3E1T A;  4J1O A;  3NTD A;  7ENL A;  4Z25 A;  4J33 A;  3UCL A;  2BS3 A;  1RSG A;  3DK4 A;  1TDN A;  4DWD A;  1ZK7 A;  3SN4 A;  2GMJ A;  3L1R A;  1JRY A;  3PVC A;  2WHD A;  1NAA A;  3HPF A;  3L5O A;  2YVG A;  3FCP A;  2BXS A;  3GDN A;  1NG4 A;  4YKF A;  2YR6 A;  3JW7 A;  1VQW A;  3DGH A;  1EBH A;  2YR4 A;  3NO1 A;  2C67 A;  3OPS A;  1VQZ A;  3GD3 A;  1P2E A;  3TOY A;  4J34 A;  4EM3 A;  3CPH G;  3BHK A;  4JNQ A;  1GT8 A;  4TLX A;  3VC5 A;  3MZN A;  3UXL A;  1F3P A;  5KRQ A;  2GB0 A;  4B68 A;  4ROP A;  1VDC A;  4J57 A;  4H4X A;  4I58 A;  1OJC A;  1JU2 A;  3GYX A;  2YG7 A;  2OLO A;  2YM2 A;  5KWF A;  1KCZ A;  2XCG A;  4DSH A;  1D4C A;  4RG4 A;  3L8K A;  2QA2 A;  2BC1 A;  1GND A;  3TQP A;  5BUL A;  2BA9 A;  3TTE A;  3V4B A;  1QO8 A;  2OVL A;  3UKK A;  1L0V A;  4TM3 A;  3BNU A;  3UP5 A;  1FFV C;  3DG7 A;  4E5T A;  2GV8 A;  2R45 A;  3NRN A;  3V5C A;  2A8X A;  2FJB A;  1SJC A;  2VRL A;  2H89 A;  1BGJ A;  2A89 A;  2WP5 A;  2WU5 A;  3NYF A;  5CQF A;  3N4F A;  4H4W A;  4USR A;  3T8Q A;  3CN8 A;  4H4V A;  4A99 A;  4TVW A;  5JCM A;  3S47 A;  2JBV A;  3DEQ A;  2ZZB A;  3V5F A;  2E1M A;  1WUF A;  2IVE A;  5KVI A;  4EQS A;  2GR0 A;  3UKF A;  3SQP A;  2BK5 A;  1GPE A;  4LU6 A;  3AD9 B;  4Z2R A;  2P0I A;  2B7S A;  2RGJ A;  3DFH A;  4U8J A;  5IDZ A;  1ZMC A;  4IA5 A;  1NDA A;  5FS9 A;  2YQU A;  5TR3 A;  3OZY A;  1GRA A;  2PHH A;  1JDF A;  1JOA A;  3F8D A;  1PDZ A;  4JN7 A;  1E1M A;  3UJE A;  2ZZ0 A;  2POD A;  2V60 A;  4E6M A;  4MJW A;  1DOE A;  2QCU A;  3ISH A;  2V3A A;  3HYV A;  3AE8 A;  3C4A A;  1FEA A;  2OA1 A;  4XWR A;  4YTM A;  2WOV A;  4DYE A;  2YLR A;  2X8C A;  3OC4 A;  2OZ8 A;  1YQ3 A;  4MKS A;  4ICY A;  3IK4 A;  3BI5 A;  1SEZ A;  3CMM A;  1NHP A;  4X2P A;  3RR1 A;  2X3N A;  3NXL A;  2GGI A;  1H84 A;  5U25 A;  2Q7V A;  3TJI A;  2OLA A;  1QLB A;  2RGO A;  4H2R A;  1VG0 A;  4B66 A;  3NVW B;  2C3D A;  2AAQ A;  3UJF A;  3ICS A;  3LJP A;  3Q45 A;  4OCG A;  4O5Q A;  1GRF A;  4H4Q A;  1FIQ B;  3FXG A;  4JQ9 A;  4HCD A;  3ALL A;  3P3B A;  4M52 A;  2GR2 A;  2XVJ A;  3NYC A;  4LII A;  3V3N A;  1IUV A;  2GRT A;  2RDX A;  4K2S A;  1W6T A;  2OQY A;  1JCT A;  4G6H A;  1FEC A;  2FJA A;  3NT6 A;  1YY5 A;  2B7R A;  2BK4 A;  3RCY A;  2C64 A;  2V3B A;  2YM1 A;  1V97 A;  1ECQ A;  3UP4 A;  2PU0 A;  2ACZ A;  3ZVH A;  1PS9 A;  4U8O A;  3B3R A;  4EMJ A;  2VZ2 A;  5KMQ A;  1O94 A;  4HCL A;  4P9S A;  2XLP A;  1OJD A;  2QVH A;  4RSL A;  3FV9 A;  3V3O A;  1ZY8 A;  3K1G A;  4OPC A;  3PS9 A;  3R25 A;  4YWO A;  1K4Q A;  3AE2 A;  1RP0 A;  2YAU A;  1KSU A;  4AT0 A;  3VR8 A;  3U4F A;  1L9D A;  4GGB A;  1YEY A;  4Z43 A;  3G5R A;  1YKJ A;  3T0K A;  3D9X A;  5HYM A;  2R4J A;  2YLZ A;  1KF6 A;  1LVL A;  3RO6 A;  2WDQ A;  3V76 A;  4FDC B;  1XPQ A;  4J3Z A;  3SFD A;  4H4T A;  4JHM A;  3KU9 A;  1DOD A;  4ADW A;  4UP3 A;  5FS8 A;  4KWS A;  4YTP A;  2XYO A;  1F8S A;  5ENL A;  2WBA A;  1GRB A;  2VVM A;  3CNJ A;  3KKJ A;  2OQH A;  3ZLH A;  4Z2U A;  2FYM A;  1IYX A;  1E1K A;  1ZOY A;  4IV9 A;  3VFC A;  4KEM A;  1GSN A;  1LQU A;  2ZZC A;  2QJJ A;  4A5L A;  4H4Y A;  1PBD A;  3KPK A;  3KUM A;  3BOX A;  1IJH A;  3AE7 A;  1W4X A;  3R1Z A;  2WET A;  3B6D A;  3AE5 A;  3SY4 A;  2XFP A;  1ZKQ A;  3GRS A;  4H50 A;  2AQJ A;  1XS2 A;  3T2K A;  2POZ A;  2F5Z A;  2XFN A;  2YG3 A;  2P8B A;  4JDR A;  4U8N A;  4LA1 A;  2R4E A;  3NVZ B;  3AEB A;  3UKH A;  3CNS A;  1ONF A;  3QSM A;  5BUK A;  4Z2T A;  2WPF A;  3QSS A;  4X9N A;  2BS4 A;  4ZCD A;  3R9U A;  4A35 A;  2UZZ A;  3S61 A;  3VA8 A;  3UTH A;  1PBE A;  5FJT A;  2CFY A;  4BJZ A;  3NN6 X;  3EEZ A;  4NTD A;  2NPX A;  2AKZ A;  5J7X A;  3K7M X;  5KMP A;  3FJ4 A;  4OPD A;  1N60 C;  2H88 A;  1EC8 A;  3P9U A;  1LPF A;  3CNT A;  1ZOV A;  2GQF A;  1REO A;  2VRM A;  1S3B A;  1WYG A;  3K7T A;  3A7R A;  4J56 A;  2C72 A;  4DGK A;  3UJ2 A;  3CND A;  1JRO A;  4KT2 A;  2IID A;  4D04 A;  4XWZ A;  4GIR A;  1DTN A;  2GSH A;  3FMW A;  3IJL A;  3QN3 A;  3VRB A;  1NU5 A;  4CCQ A;  3VC6 A;  4FK1 A;  1NHS A;  2OKT A;  2WOW A;  3SZ0 A;  4IT1 A;  2Z5X A;  1GRE A;  3QPE A;  3LZW A;  2BRY A;  4NNJ A;  4NEV A;  3RHA A;  4N9X A;  2X99 A;  3GSI A;  3NK2 X;  5C3J A;  2GR1 A;  1F8W A;  2OLN A;  3TJ4 A;  4CY8 A;  1TYP A;  5IPY A;  2C76 A;  3N4E A;  1D4E A;  3C4N A;  4A65 A;  2QAE A;  5BOE A;  1SJB A;  4C3Y A;  2QQ6 A;  1H86 A;  1N62 C;  3TW9 A;  1RM6 B;  1OEP A;  3UXK A;  4U8P A;  2JK6 A;  4A79 A;  3RP7 A;  2XLU A;  4A9W A;  2PP1 A;  4BK1 A;  3AXB A;  4EMI A;  2RGH A;  3QVP A;  1RYI A;  1DOC A;  1GTH A;  3QSE A;  3NH3 X;  2EQ7 A;  4J2W A;  2YLS A;  4ENL A;  2PP0 A;  5FJR A;  1EBG A;  5M0Z A;  1H7X A;  3I3L A;  1N63 C;  1P2H A;  1DOB A;  4EIQ A;  1PDH A;  2BYB A;  4K1W A;  5FS6 A;  3EPT A;  2ZC8 A;  3JVA A;  5KOW A;  3UTF A;  3D47 A;  4RG3 A;  1JEH A;  2C7G A;  4HN8 A;  2NQL A;  3VCN A;  3CT2 A;  4NTE A;  1CBO A;  3SZW A;  2YG4 A;  3CXB A;  1PJ5 A;  2VVL G;  4M0X A;  1XHC A;  1H2I A;  5JCN A;  2R46 A;  3ZDN A;  3MUC A;  2OFJ A;  1ELS A;  4PAB A;  3K30 A;  2Y6Q A;  3DJE A;  3TWB A;  4GYP C;  2P8C A;  3KLJ A;  4H4R A;  5FMH A;  1N4V A;  1D7Y A;  4GAV A;  2J3N A;  4Z17 A;  2BRA A;  4D03 A;  3T2Z A;  3AD8 B;  3D1C A;  3T2Y A;  4IVM B;  4Z26 A;  3LOV A;  1FL2 A;  3QTP A;  1Q1W A;  4H4Z A;  4YT0 A;  2XVH A;  3FPZ A;  4AP1 A;  3ZLF A;  4YXD A;  3TWA A;  4DSG A;  1TDF A;  5FS7 A;  3A7U A;  3FVD A;  1DXL A;  1PJ7 A;  3LXD A;  1IUX A;  1UKV G;  1GXF A;  5EB5 A;  4GYP A;  5J04 A;  1XDI A;  3KPF A;  2GAG B;  3STP A;  2AKM A;  3RGT A;  3I4K A;  4GUV A;  2GMH A;  3GMB A;  4GAP A;  2TMD A;  2W55 A;  2AR8 A;  1S7M A;  3U9I A;  2OO6 A;  1H6V A;  3SBF A;  4YWS A;  4X4J A;  1FOH A;  4TM0 A;  4FI4 A;  3COX A;  3AB1 A;  3ES7 A;  3H8A A;  1KD0 A;  5EU9 A;  1PBB A;  1PHH A;  3I6D A;  2WEU A;  5FJP A;  4MGG A;  2VOU A;  3RP6 A;  4A6G A;  1ZXI C;  2E3T A;  2OZ3 A;  1R0M A;  3GMC A;  3AEG A;  4EM4 A;  4B65 A;  3GY1 A;  2XSX A;  1GTE A;  3PK7 A;  2FKP A;  1B5Q A;  2GR3 A;  3SQS A;  1PXC A;  3IHM A;  2WES A;  5BRT A;  4CCR A;  2R0C A;  4CBQ A;  3T6C A;  3NZG A;  5KNL A;  2OAL A;  2PTX A;  5G5G B;  2YVF A;  1CHU A;  3UTE A;  3ITJ A;  1Y56 B;  3UOV A;  2BAC A;  1BZL A;  2APG A;  2E5V A;  2XGZ A;  3LAD A;  3SFE A;  1DJN A;  2FJD A;  2PYX A;  3NGC X;  4TVY A;  2GGH A;  4DXK A;  3UOY A;  1S2Y A;  2X50 A;  3ZVI A;  3T14 A;  2R0G A;  1EL8 A;  1BKH A;  1TE6 A;  2GQW A;  2BK3 A;  4TM1 A;  2PS2 A;  4F4R A;  3AEA A;  3DK8 A;  3UOZ A;  3PO7 A;  3VCC A;  4H83 A;  4H19 A;  3EKG A;  1OJT A;  2BCP A;  2C3C A;  4U2T A;  1PXA A;  4IA6 A;  3HW2 A;  1LV0 A;  4YSX A;  3SX6 A;  2P3Z A;  3RP8 A;  4U2S A;  5HXI A;  3G5S A;  3CB3 A;  1D5T A;  4G7F A;  3IF9 A;  3GYJ A;  5DBJ A;  4Y4L A;  3H4K A;  1GRH A;  1EBD A;  2CHR A;  1MDR A;  1WUE A;  4ZOH B;  2XH4 A;  2WP9 A;  2HNE A;  3B9J B;  3B97 A;  1B4V A;  1CC4 A;  3K7Q X;  2JKC A;  4G6G A;  4YSY A;  3BNM A;  3BHF A;  2Q6U A;  5U1O A;  2Y6R A;  2O9Z A;  1CC6 A;  1GET A;  3SJN A;  3ALM A;  1CF3 A;  3AYJ A;  4YSH A;  1EL5 A;  3SZF A;  4K8G A;  2AL2 B;  3AE6 A;  4K22 A;  4DHG A;  2IVD A;  4IP4 A;  2C75 A;  5HHF A;  4GRT A;  3DJG X;  1BQG A;  4EIP A;  3JZU A;  2DKH A;  1GRG A;  3H7V A;  4DN1 A;  4TLZ A;  2GGJ A;  3P93 A;  4BV6 A;  1O5W A;  1KKO A;  3AMZ A;  1M64 A;  2DW7 A;  3T4W A;  5FJO A;  3ATQ A;  4AT2 A;  5U63 A;  1PBF A;  2OX4 A;  1X31 B;  2PGE A;  1MDL A;  1IUS A;  4K5S A;  3ETR B;  2WS3 A;  1N1P A;  2QJM A;  2V6O A;  2XFO A;  3ZYX A;  4U2L A;  2I0Z A;  1H83 A;  4IL0 A;  3NK0 X;  3QLD A;  5G5H B;  2V5Z A;  4M6U A;  1L8P A;  5LV9 A;  3UTG A;  2C66 A;  1PBC A;  4UDR A;  1IUT A;  1Y0P A;  2XH0 A;  1RVK A;  4GR1 A;  4USQ A;  2FBW A;  3SM8 A;  3AE3 A;  2CVJ A;  2JB3 A;  3SSZ A;  4G8T A;  5C2T A;  2RAB A;  2FJE A;  4U8L A;  1O95 A;  3QFA A;  3VRA A;  4E8G A;  1NHQ A;  3SN1 A;  1TDE A;  5J60 A;  4A3R A;  1NEL A;  3CIR A;  2B9X A;  4CRT A;  4E4F A;  3AN1 A;  1DNC A;  1ONE A;  2B9Y A;  4U8K A;  2PA6 A;  4H2P A;  1GAL A;  4YTN A;  3CTY A;  4NEW A;  2Q0K A;  4JY2 A;  1E6E A;  5EBK A;  1JRX A;  1VG9 A;  1F9C A;  1B37 A;  2W0H A;  5BVA A;  1E1L A;  3BI2 A;  2W3S A;  3CPI G;  3AEC A;  3R0U A;  1YQ4 A;  3AEE A;  2Z5Y A;  3N6H A;  3ENL A;  3BSM A;  3DIP A;  4HNC A;  4WX1 A;  3DER A;  4NTC A;  1E1N A;  1S3E A;  1GEU A;  3F8R A;  4C3X A;  3NNE A;  2QDE A;  4CNJ A;  3ALJ A;  3GDP A;  2GVC A;  4GDP A;  4AOS A;  1OJ9 A;  2XLR A;  1P48 A;  3ZVH B;  3SN0 A;  3MY9 A;  5CKU A;  3TCS A;  4NWZ A;  2MNR A;  2BC0 A;  5JCK A;  3FYY A;  3Q6J A;  4A6N A;  3H8L A;  3DG6 A;  4UDQ A;  3G5Q A;  4IHC A;  2AL1 A;  1ZP0 A;  4OPT A;  5IQ1 A;  1HYU A;  4A6N B;  4J36 A;  1ELI A;  3LB8 A;  3NIX A;  4G73 A;  2B76 A;  1BF3 A;  4HNL A;  4IP5 A;  3AYI A;  3NYE A;  3NN0 X;  3GC2 A;  3O0H A;  4GME A;  2AL2 A;  4HA6 A;  4JN8 A;  3M12 A;  6ENL A;  2NVK X;  3AYL A;  4A7A A;  4FP1 A;  1ZDL A;  1FCD A;  4G9K A;  2WP6 A;  3T9P A;  3DGZ A;  3QFB A;  2C73 A;  3SYI A;  4B69 A;  2OPJ A;  3PWG A;  1MO9 A;  1EL9 A;  4K2X A;  2XFU A;  3ICR A;  3I6T A;  4GDE A;  1FHU A;  3H8I A;  3DJJ A;  3Q4D A;  3I6E A;  4DX3 A;  3R11 A;  2C65 A;  1AOG A;  4EQW A;  3F8P A;  2WOI A;  5KMS A;  4K7Z A;  3GD4 A;  2WU2 A;  4EWJ A;  3UKP A;  4JNA A;  2CDU A;  5EB4 A;  4OPG A;  3H12 A;  1N4W A;  4OPL A;  3R0K A;  2PP3 A;  3CXO A;  4ZCW A;  4GGH A;  4GF7 A;  3NVV B;  1TKK A;  1YQZ A;  2V61 A;  4EMW A;  1R6W A;  3PG6 A;  1PJ6 A;  4H2H A;  3DGB A;  1NEK A;  1KFY A;  5FJU A;  3KVE A;  5ER0 A;  1S2Q A;  5KVH A;  3OZM A;  2GL5 A;  1N61 C;  3EAO A;  2ARD A;  1STZ A;  2XVF A;  2XLS A;  2QGY A;  2GGE A;  4E4U A;  3ATR A;  2OAM A;  2XH7 A;  3T31 A;  2JAE A;  2WDV A;  3HRD C;  2W3R A;  4GCM A;  3HYW A;  4GFI A;  2XVE A;  3ES8 A;  3D8X A;  3UOX A;  3GWD A;  2PTY A;  1MUC A;  2W54 A;  3T37 A;  3GO2 A;  4AP3 A;  2ONE A;  4UDP A;  1NEN A;  3UKA A;  2PU1 A;  4FX9 A;  4H4P A;  2XLT A;  1EC7 A;  1QJD A;  2X8H A;  3QJ4 A;  4KPL A;  4KPR A;  4MMW A;  4WCT A;  3DK9 A;  1JNZ A;  3EF6 A;  3AE4 A;  3CPJ G;  1CL0 A;  4FK1 C;  4Y4M A;  4PAA A;  2PSN A;  2VQ7 A;  4H2N A;  1PDY A;  5HY5 A;  3CYJ A;  2OG9 A;  2HXT A;  3UCD A;  3EUB 3;  3MSY A;  3LZX A;  2P88 A;  1BGN A;  2GH5 A;  1VDV A;  4IL2 A;  4K8D A;  3DH9 A;  4B63 A;  1TZZ A;  1V59 A;  4OPU A;  3RED A;  4Y4N A;  2DKI A;  2GAH B;  4H4U A;  4JN9 A;  3NRZ B;  1N5X A;  3AD7 B;  1MRA A;  4HPN A;  3CGB A;  3CNP A;  3NG7 X;  3MQT A;  2WPC A;  1JPD X;  2MUC A;  3UJS A;  4Z44 A;  1JRP A;  3P1W A;  1E39 A;  1TDK A;  1P43 A;  3UGV A;  4EQX A;  2HQM A;  4DNA A;  4II3 A;  3P4R A;  4H2Q A;  1GES A;  2VQB A;  1H81 A;  1SB3 B;  1SJA A;  3M13 A;  1N5W C;  1PN0 A;  4CNK A;  1Y56 A;  2BXR A;  1KSS A;  2WQY A;  3ABV A;  3MWC A;  3BI4 A;  1CJ4 A;  1JPM A;  3AEF A;  1X2G A;  1FEB A;  3UKQ A;  1N4U A;  1XPY A;  1H82 A;  1TRB A;  4HYR A;  3NHO X;  1GRT A;  1NPX A;  3UCC A;  2YG6 A;  4BJY A;  1NG3 A;  5KXJ A;  1Q1R A;  3BJS A;  3R07 C;  3NS1 B;  3RIT A;  3VQR A;  3VRD B;  4AOX A;  2E5A A;  3PWI A;  1JNR A;  4JY3 A;  1CC2 A;  1XAN A;  4HB9 A;  3S5S A;  4E0V A;  3QKE A;  3GD6 A;  4BK2 A;  3QVR A;  4KX6 A;  1KDG A;  4H7U A;  5JRB A;  3AWI A;  4ZN0 A;  3OZ2 A;  3SR6 B;  1GER A;  3AE1 A;  2ZBW A; 
#chains in the Genus database with same CATH homology
 2FJB A;  4A79 A;  3RP7 A;  3AE3 A;  2CVJ A;  2VRL A;  2JB3 A;  2H89 A;  4BK3 A;  1K0I A;  1BGJ A;  2A89 A;  5BRT A;  2WP5 A;  5C2T A;  2RAB A;  2WU5 A;  2XLU A;  3NYF A;  2FJE A;  4U8L A;  1O95 A;  4A9W A;  1OJA A;  3QFA A;  5CQF A;  3VRA A;  4H4W A;  4USR A;  4BK1 A;  3AXB A;  4EMI A;  1NHQ A;  1H7W A;  1TDE A;  3CN8 A;  2R0P A;  4H4V A;  3KA7 A;  2RGH A;  4XXG A;  4ECH A;  5J60 A;  4A99 A;  1BKW A;  4APN A;  5JCM A;  3QVP A;  3JSK A;  2EQ8 A;  3CIR A;  4REK A;  1RYI A;  1DOC A;  1GTH A;  2B9X A;  2EQ6 A;  3QSE A;  3NH3 X;  1DJQ A;  2JBV A;  3HYX A;  2EQ7 A;  2EQ9 A;  4J2W A;  4CRT A;  2ZZB A;  2E1M A;  1K0L A;  3P4P A;  2IVE A;  5KVI A;  1DNC A;  2B9Y A;  1NHR A;  2YLS A;  4EQS A;  3AE9 A;  2GR0 A;  4U8K A;  3UKF A;  3SQP A;  4H2P A;  1GAL A;  4TM4 A;  4YTN A;  3CTY A;  2BK5 A;  1GPE A;  2YG5 A;  5M0Z A;  1H7X A;  4LU6 A;  3I3L A;  4NEW A;  3AD9 B;  4CNJ A;  4Z2R A;  2Q0K A;  4JY2 A;  2B7S A;  1P2H A;  1E6E A;  1DOB A;  5EBK A;  2RGJ A;  4U8J A;  4EIQ A;  1JRX A;  1PDH A;  1VG9 A;  2BYB A;  1ZMC A;  4BUR A;  4OPI A;  1B37 A;  4IA5 A;  1VRQ B;  1NDA A;  2W0H A;  5FS9 A;  5FS6 A;  3EPT A;  5BVA A;  2YQU A;  5KOW A;  1E1L A;  5TR3 A;  1M6I A;  1PXB A;  3BI2 A;  3UTF A;  4EQR A;  1GRA A;  3CPI G;  1KNP A;  2PHH A;  3AEC A;  1JOA A;  5JCI A;  4RG3 A;  1YQ4 A;  3AEE A;  1JEH A;  2Z5Y A;  3F8D A;  2C7G A;  1CJ3 A;  1E1M A;  2ZZ0 A;  1MOK A;  2V60 A;  4OVI A;  4MJW A;  3GRT A;  4WX1 A;  2QA1 A;  1CBO A;  4NTE A;  3DME A;  4NTC A;  1DOE A;  3SZW A;  1E1N A;  1S3E A;  1GEU A;  1PJ5 A;  2QCU A;  2VVL G;  2V3A A;  2JB1 A;  2YG4 A;  3F8R A;  3ISH A;  3HYV A;  3P4Q A;  4C3X A;  3NNE A;  1IUW A;  3AE8 A;  3C4A A;  5M10 A;  1FEA A;  1XHC A;  2OA1 A;  2XFQ A;  3ALJ A;  3GDP A;  3Q9T A;  1H2I A;  5JCN A;  2GVC A;  2R46 A;  4XWR A;  4GDP A;  3ZDN A;  3FG2 P;  2WOV A;  4YTM A;  4AOS A;  1OJ9 A;  2XLR A;  2X8C A;  2YLR A;  3OC4 A;  1YQ3 A;  4ICY A;  2WDR A;  3M0O A;  3CGC A;  1ZX9 A;  4PAB A;  5CKU A;  3BI5 A;  3K30 A;  2Y6Q A;  2TPR A;  3DJE A;  1SEZ A;  3CMM A;  2GF3 A;  1NHP A;  4NWZ A;  1F8R A;  3IHG A;  3NKS A;  2BC0 A;  2X3N A;  1D4D A;  5JCK A;  1H84 A;  3DA1 A;  3Q6J A;  5U25 A;  1Q9I A;  3H8L A;  4A6N A;  2Q7V A;  3KLJ A;  2XVI A;  4UDQ A;  4C5O A;  2R9Z A;  1QLB A;  2RGO A;  3G5Q A;  3SGL A;  4H4R A;  5FMH A;  1N4V A;  1D7Y A;  4GAV A;  2J3N A;  4H2R A;  1ZP0 A;  4OPT A;  2BRA A;  3IWA A;  5IQ1 A;  1HYU A;  4A6N B;  1VG0 A;  4D03 A;  4B66 A;  3T2Z A;  3AD8 B;  3D1C A;  4J36 A;  1ELI A;  1CJC A;  3LB8 A;  4Z24 A;  2YR5 A;  2C3D A;  3FIM B;  3NIX A;  2AAQ A;  3T2Y A;  4CY6 A;  4G73 A;  2B76 A;  3ICS A;  1BF3 A;  3LJP A;  4IVM B;  3S5W A;  3LOV A;  4Z26 A;  1Z6L A;  4C74 A;  4OCG A;  1FL2 A;  3AYI A;  4O5Q A;  1Q1W A;  5EOW A;  1GRF A;  4H4Z A;  3NYE A;  4YT0 A;  4H4Q A;  2XVH A;  3NN0 X;  4X9M A;  3FPZ A;  4AP1 A;  5KMR A;  3O0H A;  4YXD A;  2XDO A;  4DSG A;  4JQ9 A;  4O5U A;  1TDF A;  1TDO A;  5FS7 A;  3ALL A;  4HA6 A;  4M52 A;  1PJ7 A;  1DXL A;  3II4 A;  3GWF A;  3M12 A;  1B8S A;  2NVK X;  3AYL A;  4A7A A;  3LXD A;  2GR2 A;  1IUX A;  2XVJ A;  1GOS A;  3NYC A;  4LII A;  1UKV G;  1ZDL A;  1FCD A;  3FBS A;  1GXF A;  3V3N A;  4G9K A;  1LQT A;  1IUV A;  2BAB A;  5EB5 A;  3SXI A;  2GRT A;  2WP6 A;  1XDI A;  3KPF A;  5IQ4 A;  3DGZ A;  3QFB A;  2E4G A;  2C73 A;  3SYI A;  4B69 A;  2C70 A;  2GAG B;  5GRT A;  3NLC A;  2C4C A;  2YLW A;  1MO9 A;  1EL9 A;  4G6H A;  1FEC A;  2FJA A;  4K2X A;  3CGD A;  3NT6 A;  1YY5 A;  2B7R A;  2XFU A;  2BK4 A;  1K0J A;  3ICR A;  4GUV A;  2GMH A;  3GMB A;  4GAP A;  2C64 A;  4H4S A;  4C77 A;  2V3B A;  4GDE A;  2YM1 A;  2TMD A;  3H8I A;  1CJ2 A;  1KNR A;  3DJJ A;  2YWL A;  3UP4 A;  2AR8 A;  1S7M A;  1JRZ A;  2ACZ A;  4U8M A;  1H6V A;  1PS9 A;  5L46 A;  3NK1 X;  3VR9 A;  4U8O A;  4X4J A;  3B3R A;  1FOH A;  4TM0 A;  2C65 A;  1AOG A;  4EMJ A;  4EQW A;  3F8P A;  2WOI A;  5KMS A;  4J31 A;  3COX A;  2VZ2 A;  5GSN A;  4K7Z A;  3AB1 A;  3GD4 A;  5KMQ A;  1O94 A;  2WU2 A;  4IVO B;  4U8I A;  4ZCC A;  1PBB A;  4P9S A;  3EAN A;  3ICT A;  3UKP A;  1L9E A;  1PHH A;  2GEW A;  2XLP A;  3I6D A;  1OJD A;  2WEU A;  4JNA A;  2CDU A;  1E7P A;  2VOU A;  5KOX A;  3RP6 A;  5EB4 A;  4OPG A;  4RSL A;  3SZC A;  1N4W A;  4OPL A;  3V3O A;  2BCG G;  2CUL A;  3GMC A;  3AEG A;  2X8G A;  1ZY8 A;  4EM4 A;  4GF7 A;  4OPC A;  3PS9 A;  4B65 A;  4YWO A;  1K4Q A;  1GTE A;  3AE2 A;  3NTA A;  4YKG A;  4B67 A;  1RP0 A;  1BWC A;  1COY A;  1B5Q A;  2GR3 A;  2YAU A;  1KSU A;  4AT0 A;  2A87 A;  3ADA B;  3VR8 A;  2YVJ A;  3WE0 A;  1YQZ A;  4EMW A;  1PXC A;  3PG6 A;  1L9D A;  1PJ6 A;  2V61 A;  2WES A;  3GYI A;  3IHM A;  4CCR A;  2R0C A;  1NEK A;  4B64 A;  4Z43 A;  1KFY A;  1IUU A;  3G5R A;  1YKJ A;  3T0K A;  4CBQ A;  3KVE A;  3D9X A;  5KNL A;  5ER0 A;  1S2Q A;  5HYM A;  3C96 A;  3RNM A;  5KVH A;  2OAL A;  2R4J A;  2JB2 A;  3KD9 A;  2YVF A;  1CHU A;  2YLZ A;  1KF6 A;  3UTE A;  3ITJ A;  1Y56 B;  3UOV A;  4B1B A;  2ARD A;  1LVL A;  1BZL A;  3EAO A;  2APG A;  2BAC A;  2WDQ A;  2E5V A;  2XVF A;  3V76 A;  2XLS A;  3LAD A;  4FDC B;  1XPQ A;  3SFE A;  1DJN A;  2FJD A;  5JCL A;  2BS2 A;  3ATR A;  2OAM A;  3T31 A;  2PYX A;  1EL7 A;  2JAE A;  3NGC X;  3SFD A;  2WDV A;  2YLT A;  4H4T A;  3KU9 A;  4GCM A;  1DOD A;  3HYW A;  3UOY A;  1S2Y A;  3DJD A;  3HZL A;  2X50 A;  2VVL A;  4ADW A;  3P4S A;  4UP3 A;  1L9C A;  5FS8 A;  1LJ1 A;  2R0G A;  1EL8 A;  3T14 A;  4NZH A;  4YTP A;  2XYO A;  2GQW A;  2BK3 A;  4TM1 A;  1F8S A;  2XVE A;  2WBA A;  3D8X A;  1GRB A;  2VVM A;  3CNJ A;  3KKJ A;  3URH A;  3UOX A;  3GWD A;  1TYT A;  3T37 A;  1MXT A;  1F6M A;  4Z2U A;  1E1K A;  1ZOY A;  3AEA A;  3DK8 A;  4K5R A;  4AP3 A;  3UOZ A;  4IV9 A;  3PO7 A;  4UDP A;  1GSN A;  1LQU A;  1NEN A;  2Q0L A;  4II2 A;  3UKA A;  2YLX A;  4FX9 A;  4H4P A;  2XLT A;  2ZZC A;  4A5L A;  4YSZ A;  1LTX R;  3UKL A;  4H4Y A;  1OJT A;  1PBD A;  2BCP A;  1QJD A;  3KPK A;  1IJH A;  2X8H A;  3AE7 A;  3AED A;  3QJ4 A;  2C3C A;  4U2T A;  1W4X A;  4KPR A;  2WET A;  3B6D A;  1PXA A;  4WCT A;  3AE5 A;  4IA6 A;  3SY4 A;  1LV0 A;  3DK9 A;  2XFP A;  3SX6 A;  1KN0 A;  4YSX A;  1ZKQ A;  3GRS A;  1GV4 A;  1JNZ A;  3RP8 A;  3IC9 A;  3EF6 A;  4H50 A;  2AQJ A;  2B9W A;  3AE4 A;  3CPJ G;  4U2S A;  5HXI A;  3G5S A;  1CL0 A;  3T2K A;  4FK1 C;  4Y4M A;  4PAA A;  1D5T A;  4I59 A;  2F5Z A;  2XFN A;  3IF9 A;  2YG3 A;  3GYJ A;  2VQ7 A;  4G74 A;  5DBJ A;  4Y4L A;  3H4K A;  4JDR A;  4H2N A;  1GRH A;  1EBD A;  3CGE A;  4U8N A;  1ZMD A;  2WPE A;  4LA1 A;  2R4E A;  3AEB A;  5HY5 A;  1D7L A;  3UKH A;  2WP9 A;  3E1T A;  3CNS A;  3NTD A;  4Z25 A;  3LZX A;  1ONF A;  1BGN A;  4J33 A;  3QSM A;  3UCL A;  2GH5 A;  1B4V A;  1CC4 A;  2BS3 A;  1RSG A;  3K7Q X;  5BUK A;  3DK4 A;  4K8D A;  2JKC A;  4G6G A;  3DH9 A;  1TDN A;  4B63 A;  4YSY A;  3BNM A;  3BHF A;  1V59 A;  2Q6U A;  1ZK7 A;  4OPU A;  3RED A;  4Z2T A;  5U1O A;  2Y6R A;  4Y4N A;  2O9Z A;  2GMJ A;  2WPF A;  2DKI A;  3QSS A;  3L1R A;  2GAH B;  4X9N A;  1JRY A;  2BS4 A;  4ZCD A;  4H4U A;  3PVC A;  4JN9 A;  2UZZ A;  3R9U A;  3S61 A;  3UTH A;  1PBE A;  3AD7 B;  2CFY A;  2WHD A;  1CC6 A;  1GET A;  1NAA A;  4BJZ A;  3NN6 X;  3L5O A;  3CGB A;  3CNP A;  3NG7 X;  2WPC A;  4NTD A;  2NPX A;  3ALM A;  1CF3 A;  3AYJ A;  2YVG A;  5J7X A;  3K7M X;  2BXS A;  5KMP A;  4YSH A;  4OPD A;  3GDN A;  1NG4 A;  4YKF A;  1EL5 A;  2H88 A;  3SZF A;  2YR6 A;  3P9U A;  1VQW A;  3DGH A;  1LPF A;  2YR4 A;  3P1W A;  4Z44 A;  1E39 A;  1TDK A;  3CNT A;  1ZOV A;  2C67 A;  2GQF A;  4EQX A;  2HQM A;  1REO A;  4DNA A;  3GD3 A;  3AE6 A;  4K22 A;  4II3 A;  3P4R A;  4H2Q A;  2IVD A;  2VRM A;  1P2E A;  1S3B A;  3K7T A;  4J34 A;  1GES A;  4J56 A;  4EM3 A;  2C75 A;  1H81 A;  2VQB A;  5HHF A;  3CPH G;  3M13 A;  2C72 A;  4DGK A;  4GRT A;  3BHK A;  1PN0 A;  3DJG X;  3CND A;  1GT8 A;  4JNQ A;  4CNK A;  4TLX A;  4EIP A;  1Y56 A;  2BXR A;  1KSS A;  2IID A;  2WQY A;  3ABV A;  3BI4 A;  2DKH A;  1GRG A;  1CJ4 A;  1F3P A;  4D04 A;  5KRQ A;  4XWZ A;  4TLZ A;  2GB0 A;  4B68 A;  3AEF A;  3FMW A;  3VRB A;  1VDC A;  1FEB A;  4J57 A;  4BV6 A;  1N4U A;  1O5W A;  4H4X A;  3UKQ A;  4FK1 A;  4I58 A;  1NHS A;  4CCQ A;  1H82 A;  1M64 A;  1OJC A;  1TRB A;  1JU2 A;  3GYX A;  2YG7 A;  2OLO A;  2WOW A;  3ATQ A;  3SZ0 A;  4AT2 A;  5U63 A;  1PBF A;  2YM2 A;  2Z5X A;  3NHO X;  5KWF A;  1GRT A;  1GRE A;  1NPX A;  1X31 B;  2XCG A;  4DSH A;  2YG6 A;  3LZW A;  1D4C A;  4RG4 A;  3L8K A;  1IUS A;  4BJY A;  2BRY A;  1NG3 A;  4NNJ A;  4K5S A;  4NEV A;  5KXJ A;  3RHA A;  1Q1R A;  2QA2 A;  2BC1 A;  4N9X A;  2X99 A;  3GSI A;  2WS3 A;  3NK2 X;  3VQR A;  5C3J A;  2GR1 A;  1N1P A;  4U8P A;  3VRD B;  1F8W A;  1GND A;  4AOX A;  2V6O A;  2XFO A;  3ZYX A;  2OLN A;  4U2L A;  1JNR A;  4JY3 A;  2I0Z A;  4CY8 A;  5BUL A;  1H83 A;  1CC2 A;  1XAN A;  1TYP A;  2BA9 A;  5IPY A;  2C76 A;  3NK0 X;  4HB9 A;  1D4E A;  1QO8 A;  2V5Z A;  3C4N A;  4E0V A;  4A65 A;  2QAE A;  5LV9 A;  3UKK A;  4BK2 A;  3QVR A;  4KX6 A;  1L0V A;  4TM3 A;  1KDG A;  3UTG A;  2C66 A;  4H7U A;  1PBC A;  4UDR A;  4C3Y A;  5JRB A;  1IUT A;  3AWI A;  1H86 A;  3BNU A;  4ZN0 A;  1Y0P A;  3OZ2 A;  3UP5 A;  1GER A;  3AE1 A;  2ZBW A;  4GR1 A;  4USQ A;  2GV8 A;  2R45 A;  3NRN A;  2FBW A;  2A8X A;  3SM8 A;  2JK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...