5FS6A

Crystal structure of the v243l mutant of human apoptosis inducing factor
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
491
structure length
454
Chain Sequence
KAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMLKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHEDLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Structure/Function Relations in Aifm1 Variants Associated with Neurodegenerative Disorders
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 146
structure length 454
sequence length 491
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fs6A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs6A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs6A01
3CIRA 1FOHA 4EIPA 4ZCDA 4OCGA 3UOVA 1NHSA 1CC4A 2RGHA 2JB1A 3P4PA 1ZX9A 1EL8A 3NYCA 3GYIA 3GWDA 1VG9A 1ZP0A 2Z5XA 4A6NB 2AAQA 3KA7A 2XLTA 3VR9A 2CVJA 3AYLA 3QSMA 3RP7A 2X8CA 2X50A 3CGDA 4M52A 2GR0A 1D4DA 3AEAA 2Z5YA 4C77A 1JNRA 3NIXA 4TLZA 4Z26A 5M0ZA 3VRDB 3PVCA 4FK1A 3UCLA 1B5QA 1LTXR 1QO8A 1YKJA 1E7PA 1OJCA 2YG6A 3P4QA 2IVEA 3BHFA 3GWFA 2BS3A 1MO9A 5J7XA 4K5RA 2WPEA 3CNPA 4LA1A 4RG4A 4H2NA 3T37A 1NG3A 2B7RA 2BA9A 4H4TA 5GSNA 1ZOYA 3LJPA 5FS7A 4EMIA 1BF3A 2C3DA 3K7QX 3UOZA 1PBEA 1PBCA 3DJGX 2R4JA 2C67A 2IIDA 4D03A 1B37A 2QCUA 1W4XA 5IPYA 3KPFA 1XPQA 1MOKA 1E1MA 2E1MA 3QSEA 4H2RA 3AEGA 4JNQA 4OPLA 3COXA 2BACA 2WPFA 2B9XA 4GCMA 4Y4LA 3AECA 1F6MA 1K0IA 4FK1C 3SFEA 2VOUA 2AR8A 3I3LA 4TM4A 3RP6A 1PHHA 2WESA 1D7YA 1PBFA 3AEDA 1NHPA 1Y0PA 1GEUA 2XVIA 3VR8A 4J56A 3ZYXA 3ALJA 4CCRA 1GPEA 1CJCA 5CKUA 1CBOA 3DK9A 3II4A 1VQWA 2O9ZA 4Y4MA 3K7MX 1ZK7A 3KU9A 4H7UA 4IA5A 4YTPA 4NZHA 1CF3A 4USRA 5FS9A 4P9SA 2YR4A 3GDPA 1YQ4A 3NN0X 4X4JA 2BC0A 2GR3A 5JCNA 3RHAA 3VRAA 4OPIA 5U25A 3FG2P 4YWOA 3NKSA 5HYMA 4JN9A 2XVHA 3L1RA 4CNKA 1GSNA 3NT6A 4YTMA 2RGOA 1N4UA 3GDNA 1PXCA 4J2WA 1TYPA 3AYJA 2YLZA 1TDNA 4GRTA 1N4VA 3ITJA 3IWAA 1M64A 1KF6A 3M13A 4YSZA 5KOXA 2YAUA 1DOBA 1PJ7A 2VVLA 2A87A 3HZLA 3C96A 4DSHA 4A79A 1B4VA 4BURA 4ADWA 2WU5A 3ALLA 4OPTA 3NK1X 3NYEA 5ER0A 3EF6A 1DJNA 1VRQB 2XYOA 1OJ9A 5IQ1A 2BS4A 4DNAA 3UOYA 4A7AA 2W0HA 4YTNA 3CNTA 2WQYA 5EB5A 1RP0A 2B76A 2BXRA 3CPHG 2BYBA 1YQZA 2GMJA 1DOCA 2XVJA 4U2LA 1IUXA 1S2YA 5EBKA 3M0OA 1H7XA 2C76A 4U8KA 5EB4A 1BZLA 1LVLA 1QLBA 2QA1A 1GXFA 2QA2A 4K2XA 2VVLG 3F8PA 4CCQA 2E4GA 3CPJG 4J34A 4IA6A 5L46A 3DH9A 2DKHA 5LV9A 3GMCA 1FECA 3KD9A 4BK3A 1D4EA 1Q9IA 4EM4A 4EM3A 3AE3A 1CC6A 3G5RA 3B6DA 1D5TA 3GYJA 1JOAA 2BXSA 3IHGA 1NENA 2I0ZA 3AD8B 4UDQA 2R4EA 1BWCA 5TR3A 4Z2RA 1K0JA 4O5QA 4U8PA 2Q0LA 1TDEA 1OJTA 5C3JA 1B8SA 2C64A 3AEFA 3LADA 4JY2A 3AXBA 2X8GA 3RNMA 2E5VA 2WDQA 2X3NA 3AE4A 4U8LA 4AP1A 2BCGG 4LU6A 4K7ZA 1DNCA 3QVPA 2C72A 4EIQA 2NVKX 3UOXA 4ZCCA 1GRBA 3C4NA 3NTAA 4AOSA 2X8HA 4A9WA 4OPDA 2YR6A 4YSYA 1H6VA 4NEVA 1GOSA 3ADAB 4IVOB 3UTGA 4EMWA 3AYIA 2WOVA 2GR1A 2XLSA 3GRSA 3UTHA 1GRGA 1PXBA 4JY3A 2OAMA 2WEUA 3CGCA 2JBVA 4HA6A 2JB3A 2GRTA 1QJDA 2GQFA 3JSKA 3RP8A 3CN8A 4J33A 3UTEA 1RYIA 2GQWA 4HB9A 2JB2A 4X9MA 2WOIA 3LZWA 3DJJA 1DJQA 3P4SA 3GRTA 3L8KA 4A65A 1IUUA 1BGNA 1JRXA 4PABA 1PBDA 1BGJA 3NK0X 2V61A 2WP6A 2WDVA 1F8SA 4DGKA 2VQ7A 1PN0A 4BK2A 4C74A 2XVFA 2BK4A 2YG5A 3S5WA 3NGCX 1NDAA 1TRBA 3UKFA 3AB1A 2V3BA 2YG4A 3F8RA 4N9XA 2ZZCA 3O0HA 4Y4NA 4GDEA 4A99A 2FJEA 2YG7A 3FIMB 1OJAA 3AEEA 4C3YA 1EBDA 4FX9A 3ICTA 3VQRA 1TDKA 3H8IA 3V3NA 2YWLA 2XFQA 3AE8A 2R0PA 3KVEA 3BNMA 3NYFA 5C2TA 3K30A 3AEBA 2WDRA 2YLRA 2Q0KA 4U8MA 4Z43A 1Y56A 4TLXA 3FBSA 3SFDA 2WHDA 1KFYA 4ICYA 4Z2TA 1GNDA 2R45A 1DXLA 2XDOA 3BI4A 4X9NA 2YLTA 1BKWA 1N1PA 3ISHA 4OVIA 4YT0A 4GUVA 4CRTA 5KVHA 2Q7VA 4B67A 2WS3A 4J31A 2WPCA 1EL7A 2TPRA 1OJDA 2C7GA 2PYXA 3SGLA 1FEAA 1TYTA 1FL2A 3NG7X 3H4KA 1LQUA 3QFBA 2YVGA 1JNZA 3SQPA 4BJZA 2XLPA 3BI2A 1TDFA 3UKLA 4GDPA 1H86A 2XFNA 1IUTA 4K22A 4H4PA 4Z25A 3DK4A 4J57A 3PS9A 2BC1A 4USQA 3D8XA 5KWFA 4KPRA 5CQFA 4H4RA 3CGEA 1GTEA 3EANA 2WOWA 5FMHA 1COYA 1FCDA 3AE1A 3P1WA 2VRMA 1DOEA 5U1OA 4EMJA 2H89A 3OC4A 4KX6A 4H4VA 2YLSA 1N4WA 3BHKA 3NK2X 1NHRA 1IUVA 1CJ3A 1P2EA 4EQWA 2Y6QA 5KRQA 4TM0A 1ONFA 3NN6X 5HY5A 1H83A 5BRTA 4H4XA 3DA1A 3EAOA 1L9EA 1O95A 5JCKA 2WU2A 4Z44A 4REKA 1MXTA 3ZDNA 1XDIA 3QJ4A 2XFOA 3KKJA 2XVEA 3WE0A 1X31B 4NTCA 3AE6A 3LB8A 1L9CA 1CL0A 3V3OA 4AT2A 2CFYA 3NLCA 3IC9A 5HHFA 1GERA 1PDHA 4JNAA 1CC2A 1S2QA 3UKAA 2C70A 2XLRA 4Z24A 3QVRA 2GAGB 5JCMA 5KOWA 5KXJA 1K4QA 2JK6A 5JCLA 1F8RA 1SEZA 1GTHA 3K7TA 3ATRA 4OPUA 3UKHA 1LQTA 2X99A 1EL9A 1UKVG 4RSLA 1PS9A 5EOWA 3NRNA 3QFAA 3NTDA 1GALA 5DBJA 2BABA 3GMBA 4XXGA 1Z6LA 1IJHA 1O5WA 3DJDA 4A6NA 4XWZA 3NNEA 1VDCA 1E1KA 1TDOA 3IF9A 4B64A 2FJDA 2BK3A 2XCGA 2V5ZA 2APGA 4H2PA 2GF3A 4NEWA 2FJBA 4XWRA 1V59A 3AE5A 2WETA 3DK8A 1CJ4A 3LOVA 3DMEA 4YSXA 1S3EA 3ABVA 1NAAA 3B3RA 3IHMA 2VQBA 3LXDA 3ICSA 2J3NA 2B7SA 5FS6A 1Q1RA 4H4WA 4EQSA 2B9WA 2VZ2A 2C3CA 1KSSA 2A89A 2R0CA 2R46A 3H8LA 4ECHA 4GF7A 4H4ZA 3F8DA 1D7LA 2PHHA 2C66A 2GH5A 3M12A 2BCPA 2OALA 4OPGA 2XFPA 4PAAA 2GVCA 4H4QA 2AQJA 5M10A 2H88A 2ZZ0A 4JDRA 1GREA 1JU2A 2JKCA 1LV0A 2VVMA 2R0GA 4JQ9A 1S3BA 3UKKA 2V3AA 2NPXA 1CJ2A 2FBWA 5J60A 1GT8A 5BVAA 4B63A 1PJ6A 3UP4A 4Z2UA 4CY8A 4U8JA 3AE7A 1GRAA 1M6IA 4H4UA 1E1LA 3QSSA 2ACZA 3DGZA 1YY5A 2EQ7A 2GEWA 3DJEA 1NPXA 2GAHB 3I6DA 4NTEA 2A8XA 2R9ZA 1AOGA 1E1NA 2CULA 2YLWA 4YKFA 4AOXA 3DGHA 4U2SA 3FPZA 3CNSA 3URHA 1K0LA 4U8NA 1ZOVA 5KVIA 3REDA 2VRLA 1PBBA 2V6OA 4TM3A 1YQ3A 3KLJA 1GRFA 5U63A 2EQ6A 1IUWA 1CHUA 2ZBWA 1JEHA 3AE2A 3Q9TA 2OLNA 4BK1A 1H81A 2DKIA 4AT0A 2EQ8A 1PXAA 2GMHA 2CDUA 1ZDLA 3CGBA 2YG3A 3CNJA 4H50A 2B9YA 3ATQA 3SM8A 1GESA 4J36A 1NEKA 4B1BA 3S61A 4LIIA 1E6EA 1KSUA 1RSGA 3GD3A 2C75A 2YVJA 1GV4A 3FMWA 1GRTA 2QAEA 4B66A 4U8OA 4H2QA 1KDGA 1FEBA 3P9UA 3UKPA 1NHQA 4EQXA 4AP3A 4GR1A 2BS2A 2YLXA 3NHOX 4E0VA 2OLOA 3E1TA 4UDRA 4EQRA 3LZXA 3AWIA 4CBQA 4FDCB 4D04A 1ELIA 5HXIA 1ZKQA 3BI5A 4K8DA 1Y56B 4UDPA 2GB0A 2IVDA 3UKQA 3ALMA 4CY6A 4BJYA 2ZZBA 1F3PA 1ZMDA 3UTFA 1H7WA 4U8IA 1GRHA 1E39A 4B69A 5BULA 4YKGA 1ZMCA 1KNPA 3GD4A 3GSIA 2GR2A 4U2TA 1HYUA 1P2HA 4I58A 4ZN0A 3CPIG 2YM1A 4WX1A 5BUKA 3Q6JA 2C65A 1GETA 1PJ5A 2WP9A 1IUSA 2RABA 1XANA 3CTYA 1DODA 2UZZA 4IV9A 4WCTA 2ARDA 3EPTA 4IVMB 4DSGA 1F8WA 2JAEA 1LJ1A 4I59A 2FJAA 1EL5A 4B65A 4YXDA 4O5UA 2WBAA 2XLUA 5JCIA 2Y6RA 1D4CA 4A5LA 4B68A 4C3XA 2F5ZA 4MJWA 2C73A 2YQUA 3BNUA 2HQMA 2GV8A 1XHCA 1NG4A 3CNDA 3V76A 4UP3A 3PO7A 5IQ4A 1O94A 3P4RA 2YR5A 1REOA 3VRBA 3D1CA 3UP5A 2EQ9A 1H84A 4APNA 4OPCA 2V60A 3NH3X 5FS8A 4H4SA 1LPFA 3C4AA 4TM1A 3G5QA 3R9UA 1H82A 3AD7B 4C5OA 3ICRA 4BV6A 1L9DA 1L0VA 4H4YA 1KNRA 4CNJA 1JRZA 5GRTA 2TMDA 2OA1A 1ZY8A 2YVFA 4K5SA 3OZ2A 4YSHA 4NTDA 1Q1WA 2RGJA 2XFUA 1JRYA 3AD9B 3AE9A 2BK5A 3G5SA 2WP5A 2Q6UA 4RG3A 2YM2A 1VG0A
chains in the Genus database with same CATH superfamily
3NZGA 3PWGA 4EIPA 1NHSA 3P4PA 3FYYA 2AAQA 2X50A 3AM9A 3ENLA 4Z26A 3SBFA 3UCLA 1B5QA 1LTXR 1QO8A 3MZNA 3BHFA 2BS3A 5J7XA 3SSZA 2XH4A 5KMSA 1ZOYA 3LJPA 3B97A 3HW2A 4KPLA 2C67A 3RCYA 2QJNA 3KPFA 3RRAA 1X2GA 3COXA 2BACA 1Y0PA 3VR8A 1GEUA 4J56A 1CJCA 3II4A 4Y4MA 3K7MX 3STPA 4YTPA 5FS9A 3JW7A 2YR4A 3NN0X 5JCNA 3NKSA 3L1RA 3NT6A 1X2HA 1R6WA 3Q45A 1PXCA 1TYPA 1N4VA 1KF6A 4YSZA 3EKGA 3RR1A 3HZLA 3ZVIA 4A35A 3ALLA 2XYOA 4H1ZA 4A7AA 4YTNA 2GGHA 2WQYA 3IJQA 5EB5A 2B76A 3CPHG 2BYBA 2FYMA 5EBKA 3M0OA 4U8KA 2QA1A 3IK4A 2QA2A 5L46A 4CCQA 4J34A 3T8QA 1D4EA 4EM3A 3I6EA 3G5RA 2BXSA 1L8PA 2R4EA 1EBHA 3MWCA 4O5QA 1TDEA 3IJIA 1H2IA 4JY2A 1YEYA 4U8LA 5KMQA 1KKOA 4ZCCA 3NTAA 4G9KA 4AOSA 4A9WA 4OPDA 3SZ0A 4NEVA 2WOVA 1RVKA 2XLSA 4HA6A 3RP8A 4IP4A 3CN8A 4J33A 1DJQA 3DG6A 1JRXA 4NWZA 4E5TA 3MUCA 2BK4A 3S5WA 2XH2A 3DGBA 3F8RA 3O0HA 3UCCA 2FJEA 4C3YA 1EBDA 3S5SA 3VQRA 4BJZA 3DG7A 5C2TA 3K30A 2WDRA 2Q0KA 4U8MA 4Z43A 1Y56A 3SFDA 3FBSA 1KFYA 4Z2TA 2R45A 7ENLA 1DXLA 4ENLA 2XDOA 2YLTA 1BKWA 1N1PA 3ISHA 4JN7A 4B67A 3H4KA 1LQUA 3QFBA 3SQPA 2POZA 2XLPA 3UKLA 3HYWA 3VA8A 4J57A 5CQFA 3EANA 2WOWA 3NVWB 1FCDA 1DOEA 3CB3A 1SJBA 2YLSA 3BHKA 3R11A 1NHRA 1IUVA 1CJ3A 1P2EA 4EQWA 3UJ2A 2P88A 3UJSA 3EAOA 1O95A 2WU2A 4Z44A 2XVEA 3NFUA 1X31B 3V3OA 3VFCA 1GERA 4JNAA 3UKAA 2C70A 5JCMA 1K4QA 3ATRA 3UKHA 2PP1A 3NO1A 3NTDA 1GALA 5DBJA 4GGBA 2W54A 4XWZA 3NNEA 2PP0A 1TDOA 3IF9A 1BQGA 4JN8A 2V5ZA 2GF3A 2GSHA 4XWRA 1V59A 3AE5A 1CJ4A 1S3EA 1NAAA 3QPEA 2J3NA 2P8BA 3DFYA 1TKKA 3OW1A 2R46A 4G6HA 4GF7A 4HPNA 3F8DA 1D7LA 2C66A 3RGTA 4Z17A 1W6TA 4JDRA 4G8TA 4JQ9A 2NPXA 1CJ2A 1KKRA 3DDMA 5J60A 3P3BA 4CY8A 4K1WA 1GRAA 4H4UA 2ACZA 6ENLA 3A7UA 2GEWA 3DJEA 2GAHB 4NTEA 2R9ZA 4AOXA 3DGHA 4U2SA 3CNSA 4U8NA 3REDA 4E4FA 4TM3A 1EBGA 4J1OA 3T9PA 1JEHA 3CYJA 2OLNA 4AT0A 1PXAA 3TWAA 3CNJA 2B9YA 1GESA 2GDQA 1NEKA 4LIIA 2OZTA 1RSGA 1GV4A 1GRTA 3TOYA 4B66A 4E4UA 1KDGA 1FEBA 3UKPA 1NHQA 3NHOX 3E1TA 4UDRA 4HCDA 1ELIA 3RO6A 4K8GA 3ALMA 2GGJA 4MGGA 4B69A 3GD4A 3ZLHA 3NRZB 3CPIG 4GISA 4WX1A 2GGGA 2C65A 2RABA 3SZFA 1DODA 2ARDA 4IVMB 4IL2A 3JVAA 2FJAA 4B65A 1N61C 2GGEA 5JCIA 2Y6RA 4A5LA 3DFHA 2AL1A 5IQ4A 3VRBA 1H84A 4APNA 5FS8A 3R9UA 3AD7B 1L9DA 4CNJA 5GRTA 3MKCA 2OA1A 4K5SA 3OZ2A 1Q1WA 2HXUA 1N5XA 2BK5A 3G5SA 3AN1A 3CIRA 1FOHA 1CC4A 3NYCA 3OZYA 3Q4DA 3RP7A 3T4WA 2X8CA 3CGDA 4GFIA 4M52A 4C77A 3VRDB 4FK1A 1N60C 2YG6A 4K5RA 1TE6A 3EUB3 2WPEA 4RG4A 1BKHA 4LA1A 1NG3A 1NU5A 3K7QX 3UOZA 1PBCA 4D03A 1B37A 1W4XA 5IPYA 4JNQA 3AEGA 2W3SA 4Y4LA 3SFEA 5G5HB 4TM4A 3I3LA 1PHHA 3AEDA 4CCRA 4DYEA 1CBOA 1N62C 2O9ZA 3KU9A 4H7UA 1N63C 3VRAA 2MUCA 2GR3A 4II3A 3RHAA 1TZZA 3FG2P 3OP2A 2XVHA 4FI4A 2RGOA 4YTMA 1N4UA 3GDNA 4J2WA 2YLZA 1TDNA 4GRTA 3IWAA 1M64A 2PA6A 2YAUA 1DOBA 4A79A 2WU5A 3ETRB 3NK1X 5FJTA 5ER0A 2PMQA 2C4CA 1OJ9A 1FIQB 1RP0A 2GMJA 1DOCA 4U2LA 1IUXA 2PTYA 1H7XA 1LVLA 3MQTA 1GXFA 4K2XA 3ZVHB 2VVLG 3F8PA 4IA6A 1JROA 5LV9A 3R10A 3GMCA 4BK3A 4EM4A 4FP1A 4NNJA 2W3RA 1JOAA 4UDQA 1K0JA 4U8PA 2Q0LA 1OJTA 3AEFA 3VDGA 5FJPA 3AXBA 3RNMA 2WDQA 4AP1A 2BCGG 4LU6A 1DNCA 4G7FA 2NVKX 3CMMA 2XH0A 3UOXA 1GRBA 3C4NA 2X8HA 3NXLA 1H6VA 4IVOB 3UTGA 3GRSA 1GRGA 2QDDA 2JBVA 2GRTA 3UTEA 3SN4A 1RYIA 1KCZA 4HB9A 2WOIA 3T31A 3I4KA 3L5OA 3L8KA 4KEMA 4PABA 1BGJA 3NK0X 2V61A 2WP6A 3UXKA 4DGKA 4BK2A 1TRBA 4A99A 2FKPA 2AKZA 2YG7A 3AEEA 1TDKA 3H8IA 2YWLA 3AEBA 2PSNA 4ICYA 2QJJA 4OVIA 1MDRA 1XS2A 4GUVA 4CRTA 5KVHA 4J31A 2WPCA 3GO2A 2TPRA 1OJDA 2C7GA 5JRBA 1FEAA 1FL2A 2YVGA 1TDFA 4GDPA 1SJCA 2BC1A 4A6GA 3BOXA 5KWFA 4H4RA 2OPJA 1COYA 3AE1A 3SN1A 2VRMA 4EMJA 2H89A 1XPYA 4GDEA 4H4VA 1N4WA 1ONFA 5HY5A 1H83A 4TVWA 2XFOA 3WE0A 3LB8A 1L9CA 1CL0A 2QDEA 5HHFA 3B9JB 1CC2A 3QTPA 1FFUC 4Z24A 3QVRA 2GAGB 2JK6A 1SEZA 3K7TA 3VCNA 4II2A 2OQHA 1LQTA 2X99A 1EL9A 4HCHA 5EOWA 1JPDX 3GMBA 4A6NA 1EC9A 4YWSA 2BK3A 2APGA 3OZMA 2VQBA 3LXDA 5FS6A 4H4WA 2B9WA 2VZ2A 1KSSA 2R0CA 4ECHA 3H8LA 5KNLA 4H4ZA 2PHHA 4ZA0A 4OPGA 3V5CA 1JU2A 1LV0A 3DG3A 2V3AA 1GT8A 3SX6A 4DX3A 4U8JA 3AE7A 1E1LA 2XGZA 3I6DA 5FJRA 1STZA 2YLWA 4YKFA 3FJ4A 1ZOVA 2V6OA 3KLJA 5U63A 2DKIA 3SJNA 3FV9A 1ZDLA 3SM8A 4B1BA 2GGIA 2QAEA 2PPGA 1SB3B 3P9UA 4GR1A 2OLOA 3AWIA 4FDCB 3BI5A 2IVDA 1Y56B 4UDPA 3UKQA 2GB0A 4BJYA 2ZZBA 4HN8A 3CT2A 2QJMA 4ZOHB 1HYUA 3GD6A 4X2PA 1P2HA 1P48A 3Q6JA 1GETA 1R0MA 1IUSA 4WCTA 3S47A 4YXDA 1LJ1A 1EL5A 2F5ZA 2OLAA 2C73A 3BNUA 2HQMA 1XHCA 1O94A 3P4RA 3UP5A 2EQ9A 3H12A 2V60A 3TJIA 1KD0A 4H4SA 1L0VA 3SXIA 2TMDA 3CXBA 2RGJA 3VCCA 3PWIA 1VG0A 3TCSA 4ZCDA 4OCGA 3D46A 1ZX9A 3HYVA 3GWDA 1ZP0A 2Z5XA 3KA7A 3VR9A 2CVJA 3QSMA 2GR0A 3AEAA 2Z5YA 1JNRA 3IJLA 4IL0A 5M0ZA 3PVCA 1YKJA 3P4QA 4DSHA 4YT0A 2IVEA 3GWFA 1MO9A 3CNPA 3T37A 4H2NA 5FS7A 3T2KA 2AL2A 5J04A 2QCUA 3OTRA 1XPQA 1FHVA 1E1MA 4H2RA 4OPLA 2B9XA 3TQPA 4GCMA 3A7AA 1F6MA 4FK1C 1PBFA 1NHPA 3ZYXA 2HXTA 2GL5A 5CKUA 3K1GA 1ZK7A 1SJDA 4IA5A 4NZHA 1CF3A 4USRA 4P9SA 4X4JA 2BC0A 3UJRA 4YWOA 3BSMA 1GSNA 4DHGA 1FFVC 3ITJA 3M13A 3VC5A 2XSXA 5KOXA 1PJ7A 2VVLA 2A87A 1KN0A 2QQ6A 3C96A 4GGHA 3QKEA 1WUFA 4ADWA 4BURA 3T0KA 5EU9A 3ZLFA 3ES8A 4Z1YA 4J3ZA 1ZXIC 3CNTA 3ZLGA 1YQZA 2XVJA 1S2YA 2C76A 3T14A 4KWSA 2PTZA 2E4GA 3CPJG 3DH9A 2DKHA 1FECA 4HYRA 1Q9IA 3B6DA 1D5TA 1NENA 2I0ZA 4MMWA 3AD8B 4Z2RA 3SQSA 5C3JA 3V4BA 3KPKA 2X8GA 2E5VA 2X3NA 1SJAA 3SN0A 4K7ZA 3QVPA 4H2HA 4EMWA 3AYIA 3I6TA 3UTHA 1PXBA 4DWDA 2WEUA 2JB3A 3JSKA 1MDLA 2GQWA 3DJJA 3P4SA 2OQYA 1F8SA 2PU1A 2DW6A 4C74A 2XVFA 3AMZA 1NDAA 3UCDA 4N9XA 2YG4A 3CXOA 2ZZCA 4Y4NA 1EC8A 5KMRA 3GYXA 3FIMB 2PGEA 3ICTA 3AE8A 2R0PA 3KVEA 4TLXA 4G6GA 3BI4A 2BRAA 2Q7VA 3DEQA 3NG7X 1JNZA 1T3QC 3QN3A 2XFNA 3V5FA 4H4PA 1E9IA 3R07C 4USQA 2PTXA 3D8XA 3CAWA 3NVVB 3CGEA 1GTEA 2CHRA 5FMHA 3P1WA 5U1OA 3OC4A 4KX6A 1PDYA 3T2ZA 3NK2X 2Y6QA 4H4XA 3DA1A 3HRDC 4REKA 1MXTA 3ZDNA 1MUCA 3QJ4A 3KKJA 4AT2A 3IC9A 3U4FA 1PDHA 2XLRA 1F8RA 3NVYB 1MNSA 1GTHA 4OPUA 3VC6A 1UKVG 4RSLA 5IDZA 1PS9A 3NRNA 2BABA 3DJDA 1IJHA 3T2YA 2W55A 1E1KA 4B64A 3MY9A 2FJBA 3SR6B 3HYXA 3DK8A 3LOVA 3ABVA 3B3RA 3GY1A 1RM6B 3UJFA 3ICSA 2O56A 1Q1RA 2C3CA 4GYPA 1F9CA 2GH5A 3M12A 2GVCA 2AQJA 1GREA 1ELSA 2VVMA 5KMPA 1S3BA 3UKKA 2FBWA 5BVAA 4ROPA 1PJ6A 1M6IA 2EQ7A 1NPXA 2A8XA 1E1NA 2CULA 2VRLA 3EEZA 4H19A 1IUWA 3PFRA 2EQ8A 2GMHA 3CGBA 2YG3A 4H50A 4J36A 3S61A 1KSUA 2C75A 2YVJA 3FMWA 4U8OA 2OKTA 3TWBA 2BS2A 2YLXA 3LZXA 4CBQA 5HXIA 4K8DA 4CY6A 1F3PA 3UTFA 4IP5A 2PGWA 5BULA 1ZMCA 3D47A 1KNPA 1ONEA 2GR2A 4ZN0A 3OPSA 2QVHA 3EPTA 4DSGA 1F8WA 3N6HA 4I59A 4O5UA 2WBAA 2XLUA 1D4CA 5FJOA 4GIRA 4B68A 4C3XA 4MJWA 2YQUA 3V3WA 1NG4A 3CNDA 2HNEA 3PO7A 2YR5A 1REOA 1LPFA 3G5QA 3THUA 3ICRA 4M0XA 4H4YA 3KUMA 1JRZA 1VQZA 3R1ZA 4E6MA 2YVFA 4YSHA 2BRYA 4TVYA 1JRYA 2OX4A 3RITA 3AD9B 3AE9A 1FO4A 2OO6A 5KXJA 3MSYA 2NQLA 3UOVA 1S7MA 2RGHA 2JB1A 1EL8A 3GC2A 5G5GB 3GYIA 4A6NB 1VG9A 1VDVA 2OZ3A 2XLTA 3AYLA 2P3ZA 2MNRA 1D4DA 2OVLA 3NIXA 4TLZA 2RDXA 1E7PA 1OJCA 4GAPA 2E3TA 2B7RA 4H83A 2BA9A 4H4TA 5GSNA 3UXLA 4EMIA 1BF3A 2C3DA 2OZ8A 1PBEA 2R4JA 3DJGX 2ZC8A 2IIDA 1MRAA 1MOKA 2E1MA 3QSEA 2WPFA 3AECA 1K0IA 3BJSA 2VOUA 2AR8A 5BOFA 1N5WC 1JDFA 3RP6A 2WESA 4F4RA 1D7YA 2XVIA 2AKMA 4HNLA 3ALJA 1GPEA 3DK9A 1VQWA 3GDPA 1YQ4A 4OPIA 5U25A 5HYMA 4JN9A 4CNKA 2PU0A 3N6JA 3AYJA 1B4VA 4OPTA 3N4FA 1OEPA 3QLDA 3NYEA 3TW9A 3EF6A 3U9IA 1DJNA 1VRQB 5IQ1A 2BS4A 4DNAA 4ZCWA 3UOYA 2W0HA 1JPMA 2ONEA 2BXRA 3DERA 5ENLA 5BOEA 1JCTA 3R0UA 5EB4A 1BZLA 5FJUA 1QLBA 1V97A 4G74A 3KD9A 2XH7A 2HZGA 3AE3A 3GYJA 1CC6A 1EC7A 3IHGA 1BWCA 5TR3A 3R25A 1B8SA 2C64A 3LADA 4G73A 2I5QA 3AE4A 3SY4A 2C72A 4EIQA 3D9XA 3SZWA 3ES7A 3TTEA 2YR6A 4YSYA 1GOSA 3ADAB 2GR1A 3FXGA 4JY3A 2OAMA 3CGCA 1QJDA 2GQFA 2JB2A 4X9MA 1PDZA 3LZWA 2OFJA 3GRTA 4A65A 1IUUA 1BGNA 3P0WA 1PBDA 2WDVA 2VQ7A 1PN0A 2YG5A 3NGCX 3UKFA 3SZCA 3AB1A 2V3BA 1OJAA 4FX9A 4HNCA 3V3NA 1FHUA 2XFQA 3NYFA 3BNMA 2YLRA 4GMEA 2WHDA 3A7RA 1GNDA 4X9NA 2WS3A 1EL7A 3SGLA 2PYXA 1TYTA 2QGYA 3BI2A 4JHMA 1H86A 3NS1B 1IUTA 4K22A 2PODA 4Z25A 2AL2B 4KT2A 3DK4A 3PS9A 4KPRA 2PS2A 2P0IA 4MKSA 4M6UA 3FVDA 3NVZB 3H8AA 4IT1A 5KRQA 4TM0A 2PTWA 3NN6X 5BRTA 3H7VA 1L9EA 5JCKA 1XDIA 4NTCA 3AE6A 2CFYA 3NLCA 3PG6A 1DTNA 4IHCA 3H70A 1S2QA 5KOWA 5JCLA 3QFAA 4XXGA 1Z6LA 1O5WA 1VDCA 2FJDA 2XCGA 3PK7A 4H2PA 1WUEA 4NEWA 4K2SA 2WETA 4DN1A 3DMEA 4YSXA 3IHMA 4IZGA 3P93A 4HCLA 2B7SA 1NELA 4EQSA 2A89A 2OG9A 2BCPA 2OALA 2XFPA 4PAAA 2E5AA 4H4QA 5M10A 2H88A 2ZZ0A 2JKCA 2R0GA 4B63A 1IYXA 3UP4A 4Z2UA 3QSSA 3DGZA 1YY5A 3DIPA 2P8CA 3HPFA 1P43A 4GYPC 1AOGA 3TJ4A 3FPZA 3URHA 1K0LA 5KVIA 1PBBA 1YQ3A 1GRFA 2EQ6A 1CHUA 3AE2A 2ZBWA 3Q9TA 4BK1A 1H81A 2CDUA 3UJEA 3ATQA 3JZUA 1E6EA 3GD3A 4A3RA 4H2QA 4EQXA 4AP3A 4E0VA 1WYGA 4EQRA 4D04A 4DXKA 1ZKQA 3ZVHA 1ZMDA 4EWJA 1H7WA 3T6CA 4U8IA 1GRHA 1E39A 3DESA 4YKGA 3N4EA 3CK5A 1JRPA 3GSIA 4U2TA 4I58A 2YM1A 5BUKA 1PJ5A 2WP9A 1XANA 3CTYA 2UZZA 4IV9A 1ECQA 2JAEA 2ZADA 3FCPA 2GV8A 3SYIA 3V76A 4UP3A 3UGVA 3D1CA 4OPCA 3NH3X 3C4AA 4TM1A 4GAVA 4E8GA 1H82A 4C5OA 4BV6A 2DW7A 3R0KA 2PP3A 1KNRA 2PCEA 1ZY8A 4NTDA 2XFUA 2WP5A 2Q6UA 4RG3A 2YM2A
chains in the Genus database with same CATH topology
3CIRA 1FOHA 4EIPA 4ZCDA 4OCGA 3UOVA 1NHSA 1CC4A 1S7MA 2RGHA 2JB1A 3P4PA 1ZX9A 1EL8A 3NYCA 3GYIA 3HYVA 3GWDA 1VG9A 1ZP0A 2Z5XA 4A6NB 2AAQA 3KA7A 2XLTA 3VR9A 2CVJA 3AYLA 3QSMA 3RP7A 2X8CA 2X50A 3CGDA 4M52A 2GR0A 1D4DA 3AEAA 2Z5YA 4C77A 1JNRA 3NIXA 4TLZA 4Z26A 5M0ZA 3VRDB 3PVCA 4FK1A 3UCLA 1B5QA 1LTXR 1QO8A 1YKJA 1E7PA 1OJCA 2YG6A 3P4QA 2IVEA 3BHFA 3GWFA 2BS3A 3T2ZA 1MO9A 4GAPA 4K5RA 5J7XA 2WPEA 3CNPA 4LA1A 4RG4A 4H2NA 3T37A 1NG3A 2B7RA 2BA9A 5KMSA 4H4TA 5GSNA 1ZOYA 3LJPA 5FS7A 3T2KA 4EMIA 1BF3A 2C3DA 3K7QX 3UOZA 1PBEA 1PBCA 3DJGX 2R4JA 2C67A 2IIDA 4D03A 1B37A 2QCUA 1W4XA 5IPYA 3KPFA 1XPQA 1MOKA 1E1MA 2E1MA 3QSEA 4H2RA 3AEGA 4JNQA 4OPLA 3COXA 2BACA 2WPFA 2B9XA 4GCMA 4Y4LA 3AECA 1F6MA 1K0IA 4FK1C 3SFEA 2VOUA 2AR8A 3I3LA 4TM4A 3RP6A 1PHHA 2WESA 1D7YA 1PBFA 3AEDA 1NHPA 1Y0PA 1GEUA 2XVIA 3VR8A 4J56A 3ZYXA 3ALJA 4CCRA 1GPEA 1CJCA 5CKUA 1CBOA 3DK9A 3II4A 1VQWA 2O9ZA 4Y4MA 3K7MX 1ZK7A 3KU9A 4H7UA 4IA5A 4YTPA 4NZHA 1CF3A 4USRA 5FS9A 4P9SA 2YR4A 3GDPA 1YQ4A 3NN0X 4X4JA 2BC0A 2GR3A 5JCNA 4II3A 3RHAA 3VRAA 4OPIA 5U25A 3FG2P 4YWOA 3NKSA 5HYMA 4JN9A 2XVHA 3L1RA 4CNKA 1GSNA 3NT6A 4YTMA 2RGOA 1N4UA 3GDNA 1PXCA 4J2WA 1TYPA 3AYJA 2YLZA 1TDNA 4GRTA 1N4VA 3ITJA 3IWAA 1M64A 1KF6A 3M13A 4YSZA 5KOXA 2YAUA 1DOBA 1PJ7A 2VVLA 2A87A 1KN0A 3HZLA 3C96A 4DSHA 4A79A 1B4VA 4BURA 4ADWA 2WU5A 3ALLA 4OPTA 3NK1X 3T0KA 3NYEA 5ER0A 3EF6A 1DJNA 1VRQB 2C4CA 2XYOA 1OJ9A 5IQ1A 2BS4A 4DNAA 3UOYA 4A7AA 2W0HA 4YTNA 3CNTA 2WQYA 5EB5A 1RP0A 2B76A 2BXRA 3CPHG 2BYBA 1YQZA 2GMJA 1DOCA 2XVJA 4U2LA 1IUXA 1S2YA 5EBKA 3M0OA 1H7XA 2C76A 4U8KA 3T14A 5EB4A 1BZLA 1LVLA 1QLBA 2QA1A 1GXFA 2QA2A 4K2XA 2VVLG 3F8PA 4CCQA 2E4GA 3CPJG 4G74A 4J34A 4IA6A 5L46A 3DH9A 2DKHA 5LV9A 3GMCA 1FECA 3KD9A 4BK3A 1D4EA 1Q9IA 4EM4A 4EM3A 3AE3A 1CC6A 3G5RA 3B6DA 1D5TA 3GYJA 4NNJA 1JOAA 2BXSA 3IHGA 1NENA 2I0ZA 3AD8B 4UDQA 2R4EA 1BWCA 5TR3A 4Z2RA 1K0JA 4O5QA 4U8PA 2Q0LA 1TDEA 1OJTA 5C3JA 1B8SA 2C64A 1H2IA 3LADA 3AEFA 4JY2A 3AXBA 4G73A 3KPKA 2X8GA 3RNMA 2E5VA 2WDQA 2X3NA 3AE4A 4U8LA 3SY4A 4AP1A 2BCGG 4LU6A 4K7ZA 1DNCA 3QVPA 2C72A 5KMQA 4EIQA 2NVKX 3D9XA 3CMMA 3SZWA 3UOXA 4ZCCA 1GRBA 3C4NA 3NTAA 4G9KA 2X8HA 4AOSA 4A9WA 4OPDA 2YR6A 4YSYA 1H6VA 4NEVA 1GOSA 3SZ0A 3ADAB 4IVOB 3UTGA 4EMWA 3AYIA 2WOVA 2GR1A 2XLSA 3GRSA 3UTHA 1GRGA 1PXBA 4JY3A 2OAMA 2WEUA 3CGCA 2JBVA 4HA6A 2JB3A 2GRTA 1QJDA 2GQFA 3JSKA 3RP8A 3CN8A 4J33A 3UTEA 1RYIA 2GQWA 4HB9A 2JB2A 4X9MA 2WOIA 3LZWA 3T31A 3DJJA 1DJQA 3L5OA 3P4SA 3GRTA 3L8KA 4A65A 1IUUA 1BGNA 1JRXA 4NWZA 1PBDA 4PABA 1BGJA 3NK0X 2V61A 2WP6A 2WDVA 1F8SA 4DGKA 2VQ7A 1PN0A 4BK2A 4C74A 2XVFA 2BK4A 2YG5A 3S5WA 3NGCX 1NDAA 1TRBA 3UKFA 3SZCA 3AB1A 2V3BA 2YG4A 3F8RA 4N9XA 2ZZCA 3O0HA 4Y4NA 4GDEA 4A99A 2FJEA 5KMRA 2YG7A 3GYXA 3FIMB 1OJAA 3AEEA 4C3YA 1EBDA 4FX9A 3ICTA 3VQRA 1TDKA 3H8IA 3V3NA 2YWLA 2XFQA 3AE8A 2R0PA 3KVEA 3BNMA 3NYFA 5C2TA 3K30A 3AEBA 2WDRA 2YLRA 2Q0KA 4U8MA 4Z43A 1Y56A 4TLXA 3FBSA 3SFDA 2WHDA 1KFYA 4ICYA 4Z2TA 1GNDA 2R45A 1DXLA 2XDOA 3BI4A 4G6GA 4X9NA 2YLTA 1BKWA 1N1PA 3ISHA 4OVIA 4YT0A 4GUVA 4CRTA 5KVHA 2BRAA 2Q7VA 4B67A 2WS3A 4J31A 2WPCA 1EL7A 2TPRA 1OJDA 2C7GA 2PYXA 3SGLA 5JRBA 1FEAA 1TYTA 1FL2A 3NG7X 3H4KA 1LQUA 3QFBA 2YVGA 1JNZA 3SQPA 4BJZA 2XLPA 3BI2A 1TDFA 3UKLA 4GDPA 3HYWA 1H86A 2XFNA 1IUTA 4K22A 4H4PA 4Z25A 3DK4A 4J57A 3PS9A 2BC1A 4USQA 3D8XA 5KWFA 4KPRA 5CQFA 4H4RA 3CGEA 1GTEA 3EANA 2WOWA 5FMHA 1COYA 1FCDA 3AE1A 3P1WA 2VRMA 1DOEA 5U1OA 4EMJA 2H89A 3OC4A 4KX6A 4H4VA 2YLSA 1N4WA 3BHKA 3NK2X 1NHRA 1IUVA 1CJ3A 1P2EA 4EQWA 2Y6QA 5KRQA 4TM0A 1ONFA 3NN6X 5HY5A 1H83A 5BRTA 4H4XA 3DA1A 3EAOA 1L9EA 1O95A 5JCKA 2WU2A 4Z44A 4REKA 1MXTA 3ZDNA 1XDIA 3QJ4A 2XFOA 3KKJA 2XVEA 3WE0A 1X31B 4NTCA 3AE6A 3LB8A 1L9CA 1CL0A 3V3OA 4AT2A 2CFYA 3NLCA 3IC9A 3PG6A 5HHFA 1GERA 1PDHA 4JNAA 1CC2A 1S2QA 3UKAA 2C70A 2XLRA 4Z24A 3QVRA 2GAGB 5JCMA 5KOWA 5KXJA 1K4QA 2JK6A 5JCLA 1F8RA 1SEZA 1GTHA 3K7TA 3ATRA 4II2A 4OPUA 3UKHA 1LQTA 2X99A 1EL9A 1UKVG 4RSLA 1PS9A 5EOWA 3NRNA 3QFAA 3NTDA 1GALA 5DBJA 2BABA 3GMBA 4XXGA 1Z6LA 1IJHA 1O5WA 3DJDA 3T2YA 4A6NA 4XWZA 3NNEA 1VDCA 1E1KA 1TDOA 3IF9A 4B64A 2FJDA 2BK3A 2XCGA 2V5ZA 2APGA 4H2PA 2GF3A 4NEWA 2FJBA 4XWRA 1V59A 3AE5A 2WETA 3DK8A 3HYXA 1CJ4A 3LOVA 3DMEA 4YSXA 1S3EA 3ABVA 1NAAA 3B3RA 3IHMA 2VQBA 3LXDA 3ICSA 2J3NA 2B7SA 5FS6A 1Q1RA 4H4WA 4EQSA 2B9WA 2VZ2A 2C3CA 1KSSA 2A89A 2R0CA 2R46A 3H8LA 4G6HA 4ECHA 4GF7A 5KNLA 4H4ZA 3F8DA 1D7LA 2PHHA 2C66A 2GH5A 3M12A 2BCPA 2OALA 4OPGA 2XFPA 4PAAA 2GVCA 4H4QA 2AQJA 5M10A 2H88A 2ZZ0A 4JDRA 1GREA 1JU2A 2JKCA 1LV0A 2VVMA 5KMPA 2R0GA 4JQ9A 1S3BA 3UKKA 2V3AA 2NPXA 1CJ2A 2FBWA 5J60A 1GT8A 5BVAA 4B63A 3SX6A 1PJ6A 3UP4A 4Z2UA 4CY8A 4U8JA 3AE7A 1GRAA 1M6IA 4H4UA 1E1LA 3QSSA 2ACZA 3DGZA 1YY5A 2EQ7A 2GEWA 3DJEA 1NPXA 2GAHB 3I6DA 4NTEA 2A8XA 2R9ZA 1AOGA 1E1NA 2CULA 2YLWA 4YKFA 4AOXA 3DGHA 4U2SA 3FPZA 3CNSA 3URHA 1K0LA 4U8NA 1ZOVA 5KVIA 3REDA 2VRLA 1PBBA 2V6OA 4TM3A 1YQ3A 3KLJA 1GRFA 5U63A 2EQ6A 1IUWA 1CHUA 2ZBWA 1JEHA 3AE2A 3Q9TA 2OLNA 4BK1A 1H81A 2DKIA 4AT0A 2EQ8A 1PXAA 2GMHA 2CDUA 1ZDLA 3CGBA 2YG3A 3CNJA 4H50A 2B9YA 3ATQA 3SM8A 1GESA 4J36A 1NEKA 4B1BA 3S61A 4LIIA 1E6EA 1KSUA 1RSGA 3GD3A 2C75A 2YVJA 1GV4A 3FMWA 1GRTA 2QAEA 4B66A 4U8OA 4H2QA 1KDGA 1FEBA 3P9UA 3UKPA 1NHQA 4EQXA 4AP3A 4GR1A 2BS2A 2YLXA 3NHOX 4E0VA 2OLOA 3E1TA 4UDRA 4EQRA 3LZXA 3AWIA 4CBQA 4FDCB 4D04A 1ELIA 5HXIA 1ZKQA 3BI5A 4K8DA 1Y56B 4UDPA 2GB0A 2IVDA 3UKQA 3ALMA 4CY6A 4BJYA 2ZZBA 1F3PA 1ZMDA 3UTFA 1H7WA 4U8IA 1GRHA 1E39A 4B69A 5BULA 4YKGA 1ZMCA 1KNPA 3GD4A 3GSIA 2GR2A 4U2TA 1HYUA 1P2HA 4I58A 4ZN0A 3CPIG 2YM1A 4WX1A 5BUKA 3Q6JA 2C65A 1GETA 1PJ5A 2WP9A 1IUSA 2RABA 1XANA 3SZFA 3CTYA 1DODA 2UZZA 4IV9A 4WCTA 2ARDA 3EPTA 4IVMB 4DSGA 1F8WA 2JAEA 1LJ1A 4I59A 2FJAA 1EL5A 4B65A 4YXDA 4O5UA 2WBAA 2XLUA 5JCIA 2Y6RA 1D4CA 4A5LA 4B68A 4C3XA 2F5ZA 4MJWA 2C73A 2YQUA 3BNUA 2HQMA 2GV8A 1XHCA 3SYIA 1NG4A 3CNDA 3V76A 4UP3A 3PO7A 5IQ4A 1O94A 3P4RA 2YR5A 1REOA 3VRBA 3D1CA 3UP5A 2EQ9A 1H84A 4APNA 4OPCA 2V60A 3NH3X 5FS8A 4H4SA 1LPFA 3C4AA 4TM1A 4GAVA 3G5QA 3R9UA 1H82A 3AD7B 4C5OA 3ICRA 4BV6A 1L9DA 1L0VA 4H4YA 3SXIA 1KNRA 4CNJA 1JRZA 5GRTA 2TMDA 2OA1A 1ZY8A 2YVFA 4K5SA 3OZ2A 4YSHA 2BRYA 1Q1WA 4NTDA 2RGJA 2XFUA 1JRYA 3AD9B 3AE9A 2BK5A 3G5SA 2WP5A 2Q6UA 4RG3A 2YM2A 1VG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIR A;  1FOH A;  4EIP A;  4ZCD A;  4OCG A;  3UOV A;  1NHS A;  1CC4 A;  2RGH A;  2JB1 A;  3P4P A;  1ZX9 A;  1EL8 A;  3NYC A;  3GYI A;  3GWD A;  1VG9 A;  1ZP0 A;  2Z5X A;  4A6N B;  2AAQ A;  3KA7 A;  2XLT A;  3VR9 A;  2CVJ A;  3AYL A;  3QSM A;  3RP7 A;  2X8C A;  2X50 A;  3CGD A;  4M52 A;  2GR0 A;  1D4D A;  3AEA A;  2Z5Y A;  4C77 A;  1JNR A;  3NIX A;  4TLZ A;  4Z26 A;  5M0Z A;  3VRD B;  3PVC A;  4FK1 A;  3UCL A;  1B5Q A;  1LTX R;  1QO8 A;  1YKJ A;  1E7P A;  1OJC A;  2YG6 A;  3P4Q A;  2IVE A;  3BHF A;  3GWF A;  2BS3 A;  1MO9 A;  5J7X A;  4K5R A;  2WPE A;  3CNP A;  4LA1 A;  4RG4 A;  4H2N A;  3T37 A;  1NG3 A;  2B7R A;  2BA9 A;  4H4T A;  5GSN A;  1ZOY A;  3LJP A;  5FS7 A;  4EMI A;  1BF3 A;  2C3D A;  3K7Q X;  3UOZ A;  1PBE A;  1PBC A;  3DJG X;  2R4J A;  2C67 A;  2IID A;  4D03 A;  1B37 A;  2QCU A;  1W4X A;  5IPY A;  3KPF A;  1XPQ A;  1MOK A;  1E1M A;  2E1M A;  3QSE A;  4H2R A;  3AEG A;  4JNQ A;  4OPL A;  3COX A;  2BAC A;  2WPF A;  2B9X A;  4GCM A;  4Y4L A;  3AEC A;  1F6M A;  1K0I A;  4FK1 C;  3SFE A;  2VOU A;  2AR8 A;  3I3L A;  4TM4 A;  3RP6 A;  1PHH A;  2WES A;  1D7Y A;  1PBF A;  3AED A;  1NHP A;  1Y0P A;  1GEU A;  2XVI A;  3VR8 A;  4J56 A;  3ZYX A;  3ALJ A;  4CCR A;  1GPE A;  1CJC A;  5CKU A;  1CBO A;  3DK9 A;  3II4 A;  1VQW A;  2O9Z A;  4Y4M A;  3K7M X;  1ZK7 A;  3KU9 A;  4H7U A;  4IA5 A;  4YTP A;  4NZH A;  1CF3 A;  4USR A;  5FS9 A;  4P9S A;  2YR4 A;  3GDP A;  1YQ4 A;  3NN0 X;  4X4J A;  2BC0 A;  2GR3 A;  5JCN A;  3RHA A;  3VRA A;  4OPI A;  5U25 A;  3FG2 P;  4YWO A;  3NKS A;  5HYM A;  4JN9 A;  2XVH A;  3L1R A;  4CNK A;  1GSN A;  3NT6 A;  4YTM A;  2RGO A;  1N4U A;  3GDN A;  1PXC A;  4J2W A;  1TYP A;  3AYJ A;  2YLZ A;  1TDN A;  4GRT A;  1N4V A;  3ITJ A;  3IWA A;  1M64 A;  1KF6 A;  3M13 A;  4YSZ A;  5KOX A;  2YAU A;  1DOB A;  1PJ7 A;  2VVL A;  2A87 A;  3HZL A;  3C96 A;  4DSH A;  4A79 A;  1B4V A;  4BUR A;  4ADW A;  2WU5 A;  3ALL A;  4OPT A;  3NK1 X;  3NYE A;  5ER0 A;  3EF6 A;  1DJN A;  1VRQ B;  2XYO A;  1OJ9 A;  5IQ1 A;  2BS4 A;  4DNA A;  3UOY A;  4A7A A;  2W0H A;  4YTN A;  3CNT A;  2WQY A;  5EB5 A;  1RP0 A;  2B76 A;  2BXR A;  3CPH G;  2BYB A;  1YQZ A;  2GMJ A;  1DOC A;  2XVJ A;  4U2L A;  1IUX A;  1S2Y A;  5EBK A;  3M0O A;  1H7X A;  2C76 A;  4U8K A;  5EB4 A;  1BZL A;  1LVL A;  1QLB A;  2QA1 A;  1GXF A;  2QA2 A;  4K2X A;  2VVL G;  3F8P A;  4CCQ A;  2E4G A;  3CPJ G;  4J34 A;  4IA6 A;  5L46 A;  3DH9 A;  2DKH A;  5LV9 A;  3GMC A;  1FEC A;  3KD9 A;  4BK3 A;  1D4E A;  1Q9I A;  4EM4 A;  4EM3 A;  3AE3 A;  1CC6 A;  3G5R A;  3B6D A;  1D5T A;  3GYJ A;  1JOA A;  2BXS A;  3IHG A;  1NEN A;  2I0Z A;  3AD8 B;  4UDQ A;  2R4E A;  1BWC A;  5TR3 A;  4Z2R A;  1K0J A;  4O5Q A;  4U8P A;  2Q0L A;  1TDE A;  1OJT A;  5C3J A;  1B8S A;  2C64 A;  3AEF A;  3LAD A;  4JY2 A;  3AXB A;  2X8G A;  3RNM A;  2E5V A;  2WDQ A;  2X3N A;  3AE4 A;  4U8L A;  4AP1 A;  2BCG G;  4LU6 A;  4K7Z A;  1DNC A;  3QVP A;  2C72 A;  4EIQ A;  2NVK X;  3UOX A;  4ZCC A;  1GRB A;  3C4N A;  3NTA A;  4AOS A;  2X8H A;  4A9W A;  4OPD A;  2YR6 A;  4YSY A;  1H6V A;  4NEV A;  1GOS A;  3ADA B;  4IVO B;  3UTG A;  4EMW A;  3AYI A;  2WOV A;  2GR1 A;  2XLS A;  3GRS A;  3UTH A;  1GRG A;  1PXB A;  4JY3 A;  2OAM A;  2WEU A;  3CGC A;  2JBV A;  4HA6 A;  2JB3 A;  2GRT A;  1QJD A;  2GQF A;  3JSK A;  3RP8 A;  3CN8 A;  4J33 A;  3UTE A;  1RYI A;  2GQW A;  4HB9 A;  2JB2 A;  4X9M A;  2WOI A;  3LZW A;  3DJJ A;  1DJQ A;  3P4S A;  3GRT A;  3L8K A;  4A65 A;  1IUU A;  1BGN A;  1JRX A;  4PAB A;  1PBD A;  1BGJ A;  3NK0 X;  2V61 A;  2WP6 A;  2WDV A;  1F8S A;  4DGK A;  2VQ7 A;  1PN0 A;  4BK2 A;  4C74 A;  2XVF A;  2BK4 A;  2YG5 A;  3S5W A;  3NGC X;  1NDA A;  1TRB A;  3UKF A;  3AB1 A;  2V3B A;  2YG4 A;  3F8R A;  4N9X A;  2ZZC A;  3O0H A;  4Y4N A;  4GDE A;  4A99 A;  2FJE A;  2YG7 A;  3FIM B;  1OJA A;  3AEE A;  4C3Y A;  1EBD A;  4FX9 A;  3ICT A;  3VQR A;  1TDK A;  3H8I A;  3V3N A;  2YWL A;  2XFQ A;  3AE8 A;  2R0P A;  3KVE A;  3BNM A;  3NYF A;  5C2T A;  3K30 A;  3AEB A;  2WDR A;  2YLR A;  2Q0K A;  4U8M A;  4Z43 A;  1Y56 A;  4TLX A;  3FBS A;  3SFD A;  2WHD A;  1KFY A;  4ICY A;  4Z2T A;  1GND A;  2R45 A;  1DXL A;  2XDO A;  3BI4 A;  4X9N A;  2YLT A;  1BKW A;  1N1P A;  3ISH A;  4OVI A;  4YT0 A;  4GUV A;  4CRT A;  5KVH A;  2Q7V A;  4B67 A;  2WS3 A;  4J31 A;  2WPC A;  1EL7 A;  2TPR A;  1OJD A;  2C7G A;  2PYX A;  3SGL A;  1FEA A;  1TYT A;  1FL2 A;  3NG7 X;  3H4K A;  1LQU A;  3QFB A;  2YVG A;  1JNZ A;  3SQP A;  4BJZ A;  2XLP A;  3BI2 A;  1TDF A;  3UKL A;  4GDP A;  1H86 A;  2XFN A;  1IUT A;  4K22 A;  4H4P A;  4Z25 A;  3DK4 A;  4J57 A;  3PS9 A;  2BC1 A;  4USQ A;  3D8X A;  5KWF A;  4KPR A;  5CQF A;  4H4R A;  3CGE A;  1GTE A;  3EAN A;  2WOW A;  5FMH A;  1COY A;  1FCD A;  3AE1 A;  3P1W A;  2VRM A;  1DOE A;  5U1O A;  4EMJ A;  2H89 A;  3OC4 A;  4KX6 A;  4H4V A;  2YLS A;  1N4W A;  3BHK A;  3NK2 X;  1NHR A;  1IUV A;  1CJ3 A;  1P2E A;  4EQW A;  2Y6Q A;  5KRQ A;  4TM0 A;  1ONF A;  3NN6 X;  5HY5 A;  1H83 A;  5BRT A;  4H4X A;  3DA1 A;  3EAO A;  1L9E A;  1O95 A;  5JCK A;  2WU2 A;  4Z44 A;  4REK A;  1MXT A;  3ZDN A;  1XDI A;  3QJ4 A;  2XFO A;  3KKJ A;  2XVE A;  3WE0 A;  1X31 B;  4NTC A;  3AE6 A;  3LB8 A;  1L9C A;  1CL0 A;  3V3O A;  4AT2 A;  2CFY A;  3NLC A;  3IC9 A;  5HHF A;  1GER A;  1PDH A;  4JNA A;  1CC2 A;  1S2Q A;  3UKA A;  2C70 A;  2XLR A;  4Z24 A;  3QVR A;  2GAG B;  5JCM A;  5KOW A;  5KXJ A;  1K4Q A;  2JK6 A;  5JCL A;  1F8R A;  1SEZ A;  1GTH A;  3K7T A;  3ATR A;  4OPU A;  3UKH A;  1LQT A;  2X99 A;  1EL9 A;  1UKV G;  4RSL A;  1PS9 A;  5EOW A;  3NRN A;  3QFA A;  3NTD A;  1GAL A;  5DBJ A;  2BAB A;  3GMB A;  4XXG A;  1Z6L A;  1IJH A;  1O5W A;  3DJD A;  4A6N A;  4XWZ A;  3NNE A;  1VDC A;  1E1K A;  1TDO A;  3IF9 A;  4B64 A;  2FJD A;  2BK3 A;  2XCG A;  2V5Z A;  2APG A;  4H2P A;  2GF3 A;  4NEW A;  2FJB A;  4XWR A;  1V59 A;  3AE5 A;  2WET A;  3DK8 A;  1CJ4 A;  3LOV A;  3DME A;  4YSX A;  1S3E A;  3ABV A;  1NAA A;  3B3R A;  3IHM A;  2VQB A;  3LXD A;  3ICS A;  2J3N A;  2B7S A;  5FS6 A;  1Q1R A;  4H4W A;  4EQS A;  2B9W A;  2VZ2 A;  2C3C A;  1KSS A;  2A89 A;  2R0C A;  2R46 A;  3H8L A;  4ECH A;  4GF7 A;  4H4Z A;  3F8D A;  1D7L A;  2PHH A;  2C66 A;  2GH5 A;  3M12 A;  2BCP A;  2OAL A;  4OPG A;  2XFP A;  4PAA A;  2GVC A;  4H4Q A;  2AQJ A;  5M10 A;  2H88 A;  2ZZ0 A;  4JDR A;  1GRE A;  1JU2 A;  2JKC A;  1LV0 A;  2VVM A;  2R0G A;  4JQ9 A;  1S3B A;  3UKK A;  2V3A A;  2NPX A;  1CJ2 A;  2FBW A;  5J60 A;  1GT8 A;  5BVA A;  4B63 A;  1PJ6 A;  3UP4 A;  4Z2U A;  4CY8 A;  4U8J A;  3AE7 A;  1GRA A;  1M6I A;  4H4U A;  1E1L A;  3QSS A;  2ACZ A;  3DGZ A;  1YY5 A;  2EQ7 A;  2GEW A;  3DJE A;  1NPX A;  2GAH B;  3I6D A;  4NTE A;  2A8X A;  2R9Z A;  1AOG A;  1E1N A;  2CUL A;  2YLW A;  4YKF A;  4AOX A;  3DGH A;  4U2S A;  3FPZ A;  3CNS A;  3URH A;  1K0L A;  4U8N A;  1ZOV A;  5KVI A;  3RED A;  2VRL A;  1PBB A;  2V6O A;  4TM3 A;  1YQ3 A;  3KLJ A;  1GRF A;  5U63 A;  2EQ6 A;  1IUW A;  1CHU A;  2ZBW A;  1JEH A;  3AE2 A;  3Q9T A;  2OLN A;  4BK1 A;  1H81 A;  2DKI A;  4AT0 A;  2EQ8 A;  1PXA A;  2GMH A;  2CDU A;  1ZDL A;  3CGB A;  2YG3 A;  3CNJ A;  4H50 A;  2B9Y A;  3ATQ A;  3SM8 A;  1GES A;  4J36 A;  1NEK A;  4B1B A;  3S61 A;  4LII A;  1E6E A;  1KSU A;  1RSG A;  3GD3 A;  2C75 A;  2YVJ A;  1GV4 A;  3FMW A;  1GRT A;  2QAE A;  4B66 A;  4U8O A;  4H2Q A;  1KDG A;  1FEB A;  3P9U A;  3UKP A;  1NHQ A;  4EQX A;  4AP3 A;  4GR1 A;  2BS2 A;  2YLX A;  3NHO X;  4E0V A;  2OLO A;  3E1T A;  4UDR A;  4EQR A;  3LZX A;  3AWI A;  4CBQ A;  4FDC B;  4D04 A;  1ELI A;  5HXI A;  1ZKQ A;  3BI5 A;  4K8D A;  1Y56 B;  4UDP A;  2GB0 A;  2IVD A;  3UKQ A;  3ALM A;  4CY6 A;  4BJY A;  2ZZB A;  1F3P A;  1ZMD A;  3UTF A;  1H7W A;  4U8I A;  1GRH A;  1E39 A;  4B69 A;  5BUL A;  4YKG A;  1ZMC A;  1KNP A;  3GD4 A;  3GSI A;  2GR2 A;  4U2T A;  1HYU A;  1P2H A;  4I58 A;  4ZN0 A;  3CPI G;  2YM1 A;  4WX1 A;  5BUK A;  3Q6J A;  2C65 A;  1GET A;  1PJ5 A;  2WP9 A;  1IUS A;  2RAB A;  1XAN A;  3CTY A;  1DOD A;  2UZZ A;  4IV9 A;  4WCT A;  2ARD A;  3EPT A;  4IVM B;  4DSG A;  1F8W A;  2JAE A;  1LJ1 A;  4I59 A;  2FJA A;  1EL5 A;  4B65 A;  4YXD A;  4O5U A;  2WBA A;  2XLU A;  5JCI A;  2Y6R A;  1D4C A;  4A5L A;  4B68 A;  4C3X A;  2F5Z A;  4MJW A;  2C73 A;  2YQU A;  3BNU A;  2HQM A;  2GV8 A;  1XHC A;  1NG4 A;  3CND A;  3V76 A;  4UP3 A;  3PO7 A;  5IQ4 A;  1O94 A;  3P4R A;  2YR5 A;  1REO A;  3VRB A;  3D1C A;  3UP5 A;  2EQ9 A;  1H84 A;  4APN A;  4OPC A;  2V60 A;  3NH3 X;  5FS8 A;  4H4S A;  1LPF A;  3C4A A;  4TM1 A;  3G5Q A;  3R9U A;  1H82 A;  3AD7 B;  4C5O A;  3ICR A;  4BV6 A;  1L9D A;  1L0V A;  4H4Y A;  1KNR A;  4CNJ A;  1JRZ A;  5GRT A;  2TMD A;  2OA1 A;  1ZY8 A;  2YVF A;  4K5S A;  3OZ2 A;  4YSH A;  4NTD A;  1Q1W A;  2RGJ A;  2XFU A;  1JRY A;  3AD9 B;  3AE9 A;  2BK5 A;  3G5S A;  2WP5 A;  2Q6U A;  4RG3 A;  2YM2 A;  1VG0 A; 
#chains in the Genus database with same CATH topology
 3NZG A;  3PWG A;  4EIP A;  1NHS A;  3P4P A;  3FYY A;  2AAQ A;  2X50 A;  3AM9 A;  3ENL A;  4Z26 A;  3SBF A;  3UCL A;  1B5Q A;  1LTX R;  1QO8 A;  3MZN A;  3BHF A;  2BS3 A;  5J7X A;  3SSZ A;  2XH4 A;  5KMS A;  1ZOY A;  3LJP A;  3B97 A;  3HW2 A;  4KPL A;  2C67 A;  3RCY A;  2QJN A;  3KPF A;  3RRA A;  1X2G A;  3COX A;  2BAC A;  1Y0P A;  3VR8 A;  1GEU A;  4J56 A;  1CJC A;  3II4 A;  4Y4M A;  3K7M X;  3STP A;  4YTP A;  5FS9 A;  3JW7 A;  2YR4 A;  3NN0 X;  5JCN A;  3NKS A;  3L1R A;  3NT6 A;  1X2H A;  1R6W A;  3Q45 A;  1PXC A;  1TYP A;  1N4V A;  1KF6 A;  4YSZ A;  3EKG A;  3RR1 A;  3HZL A;  3ZVI A;  4A35 A;  3ALL A;  2XYO A;  4H1Z A;  4A7A A;  4YTN A;  2GGH A;  2WQY A;  3IJQ A;  5EB5 A;  2B76 A;  3CPH G;  2BYB A;  2FYM A;  5EBK A;  3M0O A;  4U8K A;  2QA1 A;  3IK4 A;  2QA2 A;  5L46 A;  4CCQ A;  4J34 A;  3T8Q A;  1D4E A;  4EM3 A;  3I6E A;  3G5R A;  2BXS A;  1L8P A;  2R4E A;  1EBH A;  3MWC A;  4O5Q A;  1TDE A;  3IJI A;  1H2I A;  4JY2 A;  1YEY A;  4U8L A;  5KMQ A;  1KKO A;  4ZCC A;  3NTA A;  4G9K A;  4AOS A;  4A9W A;  4OPD A;  3SZ0 A;  4NEV A;  2WOV A;  1RVK A;  2XLS A;  4HA6 A;  3RP8 A;  4IP4 A;  3CN8 A;  4J33 A;  1DJQ A;  3DG6 A;  1JRX A;  4NWZ A;  4E5T A;  3MUC A;  2BK4 A;  3S5W A;  2XH2 A;  3DGB A;  3F8R A;  3O0H A;  3UCC A;  2FJE A;  4C3Y A;  1EBD A;  3S5S A;  3VQR A;  4BJZ A;  3DG7 A;  5C2T A;  3K30 A;  2WDR A;  2Q0K A;  4U8M A;  4Z43 A;  1Y56 A;  3SFD A;  3FBS A;  1KFY A;  4Z2T A;  2R45 A;  7ENL A;  1DXL A;  4ENL A;  2XDO A;  2YLT A;  1BKW A;  1N1P A;  3ISH A;  4JN7 A;  4B67 A;  3H4K A;  1LQU A;  3QFB A;  3SQP A;  2POZ A;  2XLP A;  3UKL A;  3HYW A;  3VA8 A;  4J57 A;  5CQF A;  3EAN A;  2WOW A;  3NVW B;  1FCD A;  1DOE A;  3CB3 A;  1SJB A;  2YLS A;  3BHK A;  3R11 A;  1NHR A;  1IUV A;  1CJ3 A;  1P2E A;  4EQW A;  3UJ2 A;  2P88 A;  3UJS A;  3EAO A;  1O95 A;  2WU2 A;  4Z44 A;  2XVE A;  3NFU A;  1X31 B;  3V3O A;  3VFC A;  1GER A;  4JNA A;  3UKA A;  2C70 A;  5JCM A;  1K4Q A;  3ATR A;  3UKH A;  2PP1 A;  3NO1 A;  3NTD A;  1GAL A;  5DBJ A;  4GGB A;  2W54 A;  4XWZ A;  3NNE A;  2PP0 A;  1TDO A;  3IF9 A;  1BQG A;  4JN8 A;  2V5Z A;  2GF3 A;  2GSH A;  4XWR A;  1V59 A;  3AE5 A;  1CJ4 A;  1S3E A;  1NAA A;  3QPE A;  2J3N A;  2P8B A;  3DFY A;  1TKK A;  3OW1 A;  2R46 A;  4G6H A;  4GF7 A;  4HPN A;  3F8D A;  1D7L A;  2C66 A;  3RGT A;  4Z17 A;  1W6T A;  4JDR A;  4G8T A;  4JQ9 A;  2NPX A;  1CJ2 A;  1KKR A;  3DDM A;  5J60 A;  3P3B A;  4CY8 A;  4K1W A;  1GRA A;  4H4U A;  2ACZ A;  6ENL A;  3A7U A;  2GEW A;  3DJE A;  2GAH B;  4NTE A;  2R9Z A;  4AOX A;  3DGH A;  4U2S A;  3CNS A;  4U8N A;  3RED A;  4E4F A;  4TM3 A;  1EBG A;  4J1O A;  3T9P A;  1JEH A;  3CYJ A;  2OLN A;  4AT0 A;  1PXA A;  3TWA A;  3CNJ A;  2B9Y A;  1GES A;  2GDQ A;  1NEK A;  4LII A;  2OZT A;  1RSG A;  1GV4 A;  1GRT A;  3TOY A;  4B66 A;  4E4U A;  1KDG A;  1FEB A;  3UKP A;  1NHQ A;  3NHO X;  3E1T A;  4UDR A;  4HCD A;  1ELI A;  3RO6 A;  4K8G A;  3ALM A;  2GGJ A;  4MGG A;  4B69 A;  3GD4 A;  3ZLH A;  3NRZ B;  3CPI G;  4GIS A;  4WX1 A;  2GGG A;  2C65 A;  2RAB A;  3SZF A;  1DOD A;  2ARD A;  4IVM B;  4IL2 A;  3JVA A;  2FJA A;  4B65 A;  1N61 C;  2GGE A;  5JCI A;  2Y6R A;  4A5L A;  3DFH A;  2AL1 A;  5IQ4 A;  3VRB A;  1H84 A;  4APN A;  5FS8 A;  3R9U A;  3AD7 B;  1L9D A;  4CNJ A;  5GRT A;  3MKC A;  2OA1 A;  4K5S A;  3OZ2 A;  1Q1W A;  2HXU A;  1N5X A;  2BK5 A;  3G5S A;  3AN1 A;  3CIR A;  1FOH A;  1CC4 A;  3NYC A;  3OZY A;  3Q4D A;  3RP7 A;  3T4W A;  2X8C A;  3CGD A;  4GFI A;  4M52 A;  4C77 A;  3VRD B;  4FK1 A;  1N60 C;  2YG6 A;  4K5R A;  1TE6 A;  3EUB 3;  2WPE A;  4RG4 A;  1BKH A;  4LA1 A;  1NG3 A;  1NU5 A;  3K7Q X;  3UOZ A;  1PBC A;  4D03 A;  1B37 A;  1W4X A;  5IPY A;  4JNQ A;  3AEG A;  2W3S A;  4Y4L A;  3SFE A;  5G5H B;  4TM4 A;  3I3L A;  1PHH A;  3AED A;  4CCR A;  4DYE A;  1CBO A;  1N62 C;  2O9Z A;  3KU9 A;  4H7U A;  1N63 C;  3VRA A;  2MUC A;  2GR3 A;  4II3 A;  3RHA A;  1TZZ A;  3FG2 P;  3OP2 A;  2XVH A;  4FI4 A;  2RGO A;  4YTM A;  1N4U A;  3GDN A;  4J2W A;  2YLZ A;  1TDN A;  4GRT A;  3IWA A;  1M64 A;  2PA6 A;  2YAU A;  1DOB A;  4A79 A;  2WU5 A;  3ETR B;  3NK1 X;  5FJT A;  5ER0 A;  2PMQ A;  2C4C A;  1OJ9 A;  1FIQ B;  1RP0 A;  2GMJ A;  1DOC A;  4U2L A;  1IUX A;  2PTY A;  1H7X A;  1LVL A;  3MQT A;  1GXF A;  4K2X A;  3ZVH B;  2VVL G;  3F8P A;  4IA6 A;  1JRO A;  5LV9 A;  3R10 A;  3GMC A;  4BK3 A;  4EM4 A;  4FP1 A;  4NNJ A;  2W3R A;  1JOA A;  4UDQ A;  1K0J A;  4U8P A;  2Q0L A;  1OJT A;  3AEF A;  3VDG A;  5FJP A;  3AXB A;  3RNM A;  2WDQ A;  4AP1 A;  2BCG G;  4LU6 A;  1DNC A;  4G7F A;  2NVK X;  3CMM A;  2XH0 A;  3UOX A;  1GRB A;  3C4N A;  2X8H A;  3NXL A;  1H6V A;  4IVO B;  3UTG A;  3GRS A;  1GRG A;  2QDD A;  2JBV A;  2GRT A;  3UTE A;  3SN4 A;  1RYI A;  1KCZ A;  4HB9 A;  2WOI A;  3T31 A;  3I4K A;  3L5O A;  3L8K A;  4KEM A;  4PAB A;  1BGJ A;  3NK0 X;  2V61 A;  2WP6 A;  3UXK A;  4DGK A;  4BK2 A;  1TRB A;  4A99 A;  2FKP A;  2AKZ A;  2YG7 A;  3AEE A;  1TDK A;  3H8I A;  2YWL A;  3AEB A;  2PSN A;  4ICY A;  2QJJ A;  4OVI A;  1MDR A;  1XS2 A;  4GUV A;  4CRT A;  5KVH A;  4J31 A;  2WPC A;  3GO2 A;  2TPR A;  1OJD A;  2C7G A;  5JRB A;  1FEA A;  1FL2 A;  2YVG A;  1TDF A;  4GDP A;  1SJC A;  2BC1 A;  4A6G A;  3BOX A;  5KWF A;  4H4R A;  2OPJ A;  1COY A;  3AE1 A;  3SN1 A;  2VRM A;  4EMJ A;  2H89 A;  1XPY A;  4GDE A;  4H4V A;  1N4W A;  1ONF A;  5HY5 A;  1H83 A;  4TVW A;  2XFO A;  3WE0 A;  3LB8 A;  1L9C A;  1CL0 A;  2QDE A;  5HHF A;  3B9J B;  1CC2 A;  3QTP A;  1FFU C;  4Z24 A;  3QVR A;  2GAG B;  2JK6 A;  1SEZ A;  3K7T A;  3VCN A;  4II2 A;  2OQH A;  1LQT A;  2X99 A;  1EL9 A;  4HCH A;  5EOW A;  1JPD X;  3GMB A;  4A6N A;  1EC9 A;  4YWS A;  2BK3 A;  2APG A;  3OZM A;  2VQB A;  3LXD A;  5FS6 A;  4H4W A;  2B9W A;  2VZ2 A;  1KSS A;  2R0C A;  4ECH A;  3H8L A;  5KNL A;  4H4Z A;  2PHH A;  4ZA0 A;  4OPG A;  3V5C A;  1JU2 A;  1LV0 A;  3DG3 A;  2V3A A;  1GT8 A;  3SX6 A;  4DX3 A;  4U8J A;  3AE7 A;  1E1L A;  2XGZ A;  3I6D A;  5FJR A;  1STZ A;  2YLW A;  4YKF A;  3FJ4 A;  1ZOV A;  2V6O A;  3KLJ A;  5U63 A;  2DKI A;  3SJN A;  3FV9 A;  1ZDL A;  3SM8 A;  4B1B A;  2GGI A;  2QAE A;  2PPG A;  1SB3 B;  3P9U A;  4GR1 A;  2OLO A;  3AWI A;  4FDC B;  3BI5 A;  2IVD A;  1Y56 B;  4UDP A;  3UKQ A;  2GB0 A;  4BJY A;  2ZZB A;  4HN8 A;  3CT2 A;  2QJM A;  4ZOH B;  1HYU A;  3GD6 A;  4X2P A;  1P2H A;  1P48 A;  3Q6J A;  1GET A;  1R0M A;  1IUS A;  4WCT A;  3S47 A;  4YXD A;  1LJ1 A;  1EL5 A;  2F5Z A;  2OLA A;  2C73 A;  3BNU A;  2HQM A;  1XHC A;  1O94 A;  3P4R A;  3UP5 A;  2EQ9 A;  3H12 A;  2V60 A;  3TJI A;  1KD0 A;  4H4S A;  1L0V A;  3SXI A;  2TMD A;  3CXB A;  2RGJ A;  3VCC A;  3PWI A;  1VG0 A;  3TCS A;  4ZCD A;  4OCG A;  3D46 A;  1ZX9 A;  3HYV A;  3GWD A;  1ZP0 A;  2Z5X A;  3KA7 A;  3VR9 A;  2CVJ A;  3QSM A;  2GR0 A;  3AEA A;  2Z5Y A;  1JNR A;  3IJL A;  4IL0 A;  5M0Z A;  3PVC A;  1YKJ A;  3P4Q A;  4DSH A;  4YT0 A;  2IVE A;  3GWF A;  1MO9 A;  3CNP A;  3T37 A;  4H2N A;  5FS7 A;  3T2K A;  2AL2 A;  5J04 A;  2QCU A;  3OTR A;  1XPQ A;  1FHV A;  1E1M A;  4H2R A;  4OPL A;  2B9X A;  3TQP A;  4GCM A;  3A7A A;  1F6M A;  4FK1 C;  1PBF A;  1NHP A;  3ZYX A;  2HXT A;  2GL5 A;  5CKU A;  3K1G A;  1ZK7 A;  1SJD A;  4IA5 A;  4NZH A;  1CF3 A;  4USR A;  4P9S A;  4X4J A;  2BC0 A;  3UJR A;  4YWO A;  3BSM A;  1GSN A;  4DHG A;  1FFV C;  3ITJ A;  3M13 A;  3VC5 A;  2XSX A;  5KOX A;  1PJ7 A;  2VVL A;  2A87 A;  1KN0 A;  2QQ6 A;  3C96 A;  4GGH A;  3QKE A;  1WUF A;  4ADW A;  4BUR A;  3T0K A;  5EU9 A;  3ZLF A;  3ES8 A;  4Z1Y A;  4J3Z A;  1ZXI C;  3CNT A;  3ZLG A;  1YQZ A;  2XVJ A;  1S2Y A;  2C76 A;  3T14 A;  4KWS A;  2PTZ A;  2E4G A;  3CPJ G;  3DH9 A;  2DKH A;  1FEC A;  4HYR A;  1Q9I A;  3B6D A;  1D5T A;  1NEN A;  2I0Z A;  4MMW A;  3AD8 B;  4Z2R A;  3SQS A;  5C3J A;  3V4B A;  3KPK A;  2X8G A;  2E5V A;  2X3N A;  1SJA A;  3SN0 A;  4K7Z A;  3QVP A;  4H2H A;  4EMW A;  3AYI A;  3I6T A;  3UTH A;  1PXB A;  4DWD A;  2WEU A;  2JB3 A;  3JSK A;  1MDL A;  2GQW A;  3DJJ A;  3P4S A;  2OQY A;  1F8S A;  2PU1 A;  2DW6 A;  4C74 A;  2XVF A;  3AMZ A;  1NDA A;  3UCD A;  4N9X A;  2YG4 A;  3CXO A;  2ZZC A;  4Y4N A;  1EC8 A;  5KMR A;  3GYX A;  3FIM B;  2PGE A;  3ICT A;  3AE8 A;  2R0P A;  3KVE A;  4TLX A;  4G6G A;  3BI4 A;  2BRA A;  2Q7V A;  3DEQ A;  3NG7 X;  1JNZ A;  1T3Q C;  3QN3 A;  2XFN A;  3V5F A;  4H4P A;  1E9I A;  3R07 C;  4USQ A;  2PTX A;  3D8X A;  3CAW A;  3NVV B;  3CGE A;  1GTE A;  2CHR A;  5FMH A;  3P1W A;  5U1O A;  3OC4 A;  4KX6 A;  1PDY A;  3T2Z A;  3NK2 X;  2Y6Q A;  4H4X A;  3DA1 A;  3HRD C;  4REK A;  1MXT A;  3ZDN A;  1MUC A;  3QJ4 A;  3KKJ A;  4AT2 A;  3IC9 A;  3U4F A;  1PDH A;  2XLR A;  1F8R A;  3NVY B;  1MNS A;  1GTH A;  4OPU A;  3VC6 A;  1UKV G;  4RSL A;  5IDZ A;  1PS9 A;  3NRN A;  2BAB A;  3DJD A;  1IJH A;  3T2Y A;  2W55 A;  1E1K A;  4B64 A;  3MY9 A;  2FJB A;  3SR6 B;  3HYX A;  3DK8 A;  3LOV A;  3ABV A;  3B3R A;  3GY1 A;  1RM6 B;  3UJF A;  3ICS A;  2O56 A;  1Q1R A;  2C3C A;  4GYP A;  1F9C A;  2GH5 A;  3M12 A;  2GVC A;  2AQJ A;  1GRE A;  1ELS A;  2VVM A;  5KMP A;  1S3B A;  3UKK A;  2FBW A;  5BVA A;  4ROP A;  1PJ6 A;  1M6I A;  2EQ7 A;  1NPX A;  2A8X A;  1E1N A;  2CUL A;  2VRL A;  3EEZ A;  4H19 A;  1IUW A;  3PFR A;  2EQ8 A;  2GMH A;  3CGB A;  2YG3 A;  4H50 A;  4J36 A;  3S61 A;  1KSU A;  2C75 A;  2YVJ A;  3FMW A;  4U8O A;  2OKT A;  3TWB A;  2BS2 A;  2YLX A;  3LZX A;  4CBQ A;  5HXI A;  4K8D A;  4CY6 A;  1F3P A;  3UTF A;  4IP5 A;  2PGW A;  5BUL A;  1ZMC A;  3D47 A;  1KNP A;  1ONE A;  2GR2 A;  4ZN0 A;  3OPS A;  2QVH A;  3EPT A;  4DSG A;  1F8W A;  3N6H A;  4I59 A;  4O5U A;  2WBA A;  2XLU A;  1D4C A;  5FJO A;  4GIR A;  4B68 A;  4C3X A;  4MJW A;  2YQU A;  3V3W A;  1NG4 A;  3CND A;  2HNE A;  3PO7 A;  2YR5 A;  1REO A;  1LPF A;  3G5Q A;  3THU A;  3ICR A;  4M0X A;  4H4Y A;  3KUM A;  1JRZ A;  1VQZ A;  3R1Z A;  4E6M A;  2YVF A;  4YSH A;  2BRY A;  4TVY A;  1JRY A;  2OX4 A;  3RIT A;  3AD9 B;  3AE9 A;  1FO4 A;  2OO6 A;  5KXJ A;  3MSY A;  2NQL A;  3UOV A;  1S7M A;  2RGH A;  2JB1 A;  1EL8 A;  3GC2 A;  5G5G B;  3GYI A;  4A6N B;  1VG9 A;  1VDV A;  2OZ3 A;  2XLT A;  3AYL A;  2P3Z A;  2MNR A;  1D4D A;  2OVL A;  3NIX A;  4TLZ A;  2RDX A;  1E7P A;  1OJC A;  4GAP A;  2E3T A;  2B7R A;  4H83 A;  2BA9 A;  4H4T A;  5GSN A;  3UXL A;  4EMI A;  1BF3 A;  2C3D A;  2OZ8 A;  1PBE A;  2R4J A;  3DJG X;  2ZC8 A;  2IID A;  1MRA A;  1MOK A;  2E1M A;  3QSE A;  2WPF A;  3AEC A;  1K0I A;  3BJS A;  2VOU A;  2AR8 A;  5BOF A;  1N5W C;  1JDF A;  3RP6 A;  2WES A;  4F4R A;  1D7Y A;  2XVI A;  2AKM A;  4HNL A;  3ALJ A;  1GPE A;  3DK9 A;  1VQW A;  3GDP A;  1YQ4 A;  4OPI A;  5U25 A;  5HYM A;  4JN9 A;  4CNK A;  2PU0 A;  3N6J A;  3AYJ A;  1B4V A;  4OPT A;  3N4F A;  1OEP A;  3QLD A;  3NYE A;  3TW9 A;  3EF6 A;  3U9I A;  1DJN A;  1VRQ B;  5IQ1 A;  2BS4 A;  4DNA A;  4ZCW A;  3UOY A;  2W0H A;  1JPM A;  2ONE A;  2BXR A;  3DER A;  5ENL A;  5BOE A;  1JCT A;  3R0U A;  5EB4 A;  1BZL A;  5FJU A;  1QLB A;  1V97 A;  4G74 A;  3KD9 A;  2XH7 A;  2HZG A;  3AE3 A;  3GYJ A;  1CC6 A;  1EC7 A;  3IHG A;  1BWC A;  5TR3 A;  3R25 A;  1B8S A;  2C64 A;  3LAD A;  4G73 A;  2I5Q A;  3AE4 A;  3SY4 A;  2C72 A;  4EIQ A;  3D9X A;  3SZW A;  3ES7 A;  3TTE A;  2YR6 A;  4YSY A;  1GOS A;  3ADA B;  2GR1 A;  3FXG A;  4JY3 A;  2OAM A;  3CGC A;  1QJD A;  2GQF A;  2JB2 A;  4X9M A;  1PDZ A;  3LZW A;  2OFJ A;  3GRT A;  4A65 A;  1IUU A;  1BGN A;  3P0W A;  1PBD A;  2WDV A;  2VQ7 A;  1PN0 A;  2YG5 A;  3NGC X;  3UKF A;  3SZC A;  3AB1 A;  2V3B A;  1OJA A;  4FX9 A;  4HNC A;  3V3N A;  1FHU A;  2XFQ A;  3NYF A;  3BNM A;  2YLR A;  4GME A;  2WHD A;  3A7R A;  1GND A;  4X9N A;  2WS3 A;  1EL7 A;  3SGL A;  2PYX A;  1TYT A;  2QGY A;  3BI2 A;  4JHM A;  1H86 A;  3NS1 B;  1IUT A;  4K22 A;  2POD A;  4Z25 A;  2AL2 B;  4KT2 A;  3DK4 A;  3PS9 A;  4KPR A;  2PS2 A;  2P0I A;  4MKS A;  4M6U A;  3FVD A;  3NVZ B;  3H8A A;  4IT1 A;  5KRQ A;  4TM0 A;  2PTW A;  3NN6 X;  5BRT A;  3H7V A;  1L9E A;  5JCK A;  1XDI A;  4NTC A;  3AE6 A;  2CFY A;  3NLC A;  3PG6 A;  1DTN A;  4IHC A;  3H70 A;  1S2Q A;  5KOW A;  5JCL A;  3QFA A;  4XXG A;  1Z6L A;  1O5W A;  1VDC A;  2FJD A;  2XCG A;  3PK7 A;  4H2P A;  1WUE A;  4NEW A;  4K2S A;  2WET A;  4DN1 A;  3DME A;  4YSX A;  3IHM A;  4IZG A;  3P93 A;  4HCL A;  2B7S A;  1NEL A;  4EQS A;  2A89 A;  2OG9 A;  2BCP A;  2OAL A;  2XFP A;  4PAA A;  2E5A A;  4H4Q A;  5M10 A;  2H88 A;  2ZZ0 A;  2JKC A;  2R0G A;  4B63 A;  1IYX A;  3UP4 A;  4Z2U A;  3QSS A;  3DGZ A;  1YY5 A;  3DIP A;  2P8C A;  3HPF A;  1P43 A;  4GYP C;  1AOG A;  3TJ4 A;  3FPZ A;  3URH A;  1K0L A;  5KVI A;  1PBB A;  1YQ3 A;  1GRF A;  2EQ6 A;  1CHU A;  3AE2 A;  2ZBW A;  3Q9T A;  4BK1 A;  1H81 A;  2CDU A;  3UJE A;  3ATQ A;  3JZU A;  1E6E A;  3GD3 A;  4A3R A;  4H2Q A;  4EQX A;  4AP3 A;  4E0V A;  1WYG A;  4EQR A;  4D04 A;  4DXK A;  1ZKQ A;  3ZVH A;  1ZMD A;  4EWJ A;  1H7W A;  3T6C A;  4U8I A;  1GRH A;  1E39 A;  3DES A;  4YKG A;  3N4E A;  3CK5 A;  1JRP A;  3GSI A;  4U2T A;  4I58 A;  2YM1 A;  5BUK A;  1PJ5 A;  2WP9 A;  1XAN A;  3CTY A;  2UZZ A;  4IV9 A;  1ECQ A;  2JAE A;  2ZAD A;  3FCP A;  2GV8 A;  3SYI A;  3V76 A;  4UP3 A;  3UGV A;  3D1C A;  4OPC A;  3NH3 X;  3C4A A;  4TM1 A;  4GAV A;  4E8G A;  1H82 A;  4C5O A;  4BV6 A;  2DW7 A;  3R0K A;  2PP3 A;  1KNR A;  2PCE A;  1ZY8 A;  4NTD A;  2XFU A;  2WP5 A;  2Q6U A;  4RG3 A;  2YM2 A; 
#chains in the Genus database with same CATH homology
 3CIR A;  1FOH A;  4EIP A;  4ZCD A;  4OCG A;  3UOV A;  1NHS A;  1CC4 A;  1S7M A;  2RGH A;  2JB1 A;  3P4P A;  1ZX9 A;  1EL8 A;  3NYC A;  3GYI A;  3HYV A;  3GWD A;  1VG9 A;  1ZP0 A;  2Z5X A;  4A6N B;  2AAQ A;  3KA7 A;  2XLT A;  3VR9 A;  2CVJ A;  3AYL A;  3QSM A;  3RP7 A;  2X8C A;  2X50 A;  3CGD A;  4M52 A;  2GR0 A;  1D4D A;  3AEA A;  2Z5Y A;  4C77 A;  1JNR A;  3NIX A;  4TLZ A;  4Z26 A;  5M0Z A;  3VRD B;  3PVC A;  4FK1 A;  3UCL A;  1B5Q A;  1LTX R;  1QO8 A;  1YKJ A;  1E7P A;  1OJC A;  2YG6 A;  3P4Q A;  2IVE A;  3BHF A;  3GWF A;  2BS3 A;  3T2Z A;  1MO9 A;  4GAP A;  4K5R A;  5J7X A;  2WPE A;  3CNP A;  4LA1 A;  4RG4 A;  4H2N A;  3T37 A;  1NG3 A;  2B7R A;  2BA9 A;  5KMS A;  4H4T A;  5GSN A;  1ZOY A;  3LJP A;  5FS7 A;  3T2K A;  4EMI A;  1BF3 A;  2C3D A;  3K7Q X;  3UOZ A;  1PBE A;  1PBC A;  3DJG X;  2R4J A;  2C67 A;  2IID A;  4D03 A;  1B37 A;  2QCU A;  1W4X A;  5IPY A;  3KPF A;  1XPQ A;  1MOK A;  1E1M A;  2E1M A;  3QSE A;  4H2R A;  3AEG A;  4JNQ A;  4OPL A;  3COX A;  2BAC A;  2WPF A;  2B9X A;  4GCM A;  4Y4L A;  3AEC A;  1F6M A;  1K0I A;  4FK1 C;  3SFE A;  2VOU A;  2AR8 A;  3I3L A;  4TM4 A;  3RP6 A;  1PHH A;  2WES A;  1D7Y A;  1PBF A;  3AED A;  1NHP A;  1Y0P A;  1GEU A;  2XVI A;  3VR8 A;  4J56 A;  3ZYX A;  3ALJ A;  4CCR A;  1GPE A;  1CJC A;  5CKU A;  1CBO A;  3DK9 A;  3II4 A;  1VQW A;  2O9Z A;  4Y4M A;  3K7M X;  1ZK7 A;  3KU9 A;  4H7U A;  4IA5 A;  4YTP A;  4NZH A;  1CF3 A;  4USR A;  5FS9 A;  4P9S A;  2YR4 A;  3GDP A;  1YQ4 A;  3NN0 X;  4X4J A;  2BC0 A;  2GR3 A;  5JCN A;  4II3 A;  3RHA A;  3VRA A;  4OPI A;  5U25 A;  3FG2 P;  4YWO A;  3NKS A;  5HYM A;  4JN9 A;  2XVH A;  3L1R A;  4CNK A;  1GSN A;  3NT6 A;  4YTM A;  2RGO A;  1N4U A;  3GDN A;  1PXC A;  4J2W A;  1TYP A;  3AYJ A;  2YLZ A;  1TDN A;  4GRT A;  1N4V A;  3ITJ A;  3IWA A;  1M64 A;  1KF6 A;  3M13 A;  4YSZ A;  5KOX A;  2YAU A;  1DOB A;  1PJ7 A;  2VVL A;  2A87 A;  1KN0 A;  3HZL A;  3C96 A;  4DSH A;  4A79 A;  1B4V A;  4BUR A;  4ADW A;  2WU5 A;  3ALL A;  4OPT A;  3NK1 X;  3T0K A;  3NYE A;  5ER0 A;  3EF6 A;  1DJN A;  1VRQ B;  2C4C A;  2XYO A;  1OJ9 A;  5IQ1 A;  2BS4 A;  4DNA A;  3UOY A;  4A7A A;  2W0H A;  4YTN A;  3CNT A;  2WQY A;  5EB5 A;  1RP0 A;  2B76 A;  2BXR A;  3CPH G;  2BYB A;  1YQZ A;  2GMJ A;  1DOC A;  2XVJ A;  4U2L A;  1IUX A;  1S2Y A;  5EBK A;  3M0O A;  1H7X A;  2C76 A;  4U8K A;  3T14 A;  5EB4 A;  1BZL A;  1LVL A;  1QLB A;  2QA1 A;  1GXF A;  2QA2 A;  4K2X A;  2VVL G;  3F8P A;  4CCQ A;  2E4G A;  3CPJ G;  4G74 A;  4J34 A;  4IA6 A;  5L46 A;  3DH9 A;  2DKH A;  5LV9 A;  3GMC A;  1FEC A;  3KD9 A;  4BK3 A;  1D4E A;  1Q9I A;  4EM4 A;  4EM3 A;  3AE3 A;  1CC6 A;  3G5R A;  3B6D A;  1D5T A;  3GYJ A;  4NNJ A;  1JOA A;  2BXS A;  3IHG A;  1NEN A;  2I0Z A;  3AD8 B;  4UDQ A;  2R4E A;  1BWC A;  5TR3 A;  4Z2R A;  1K0J A;  4O5Q A;  4U8P A;  2Q0L A;  1TDE A;  1OJT A;  5C3J A;  1B8S A;  2C64 A;  1H2I A;  3LAD A;  3AEF A;  4JY2 A;  3AXB A;  4G73 A;  3KPK A;  2X8G A;  3RNM A;  2E5V A;  2WDQ A;  2X3N A;  3AE4 A;  4U8L A;  3SY4 A;  4AP1 A;  2BCG G;  4LU6 A;  4K7Z A;  1DNC A;  3QVP A;  2C72 A;  5KMQ A;  4EIQ A;  2NVK X;  3D9X A;  3CMM A;  3SZW A;  3UOX A;  4ZCC A;  1GRB A;  3C4N A;  3NTA A;  4G9K A;  2X8H A;  4AOS A;  4A9W A;  4OPD A;  2YR6 A;  4YSY A;  1H6V A;  4NEV A;  1GOS A;  3SZ0 A;  3ADA B;  4IVO B;  3UTG A;  4EMW A;  3AYI A;  2WOV A;  2GR1 A;  2XLS A;  3GRS A;  3UTH A;  1GRG A;  1PXB A;  4JY3 A;  2OAM A;  2WEU A;  3CGC A;  2JBV A;  4HA6 A;  2JB3 A;  2GRT A;  1QJD A;  2GQF A;  3JSK A;  3RP8 A;  3CN8 A;  4J33 A;  3UTE A;  1RYI A;  2GQW A;  4HB9 A;  2JB2 A;  4X9M A;  2WOI A;  3LZW A;  3T31 A;  3DJJ A;  1DJQ A;  3L5O A;  3P4S A;  3GRT A;  3L8K A;  4A65 A;  1IUU A;  1BGN A;  1JRX A;  4NWZ A;  1PBD A;  4PAB A;  1BGJ A;  3NK0 X;  2V61 A;  2WP6 A;  2WDV A;  1F8S A;  4DGK A;  2VQ7 A;  1PN0 A;  4BK2 A;  4C74 A;  2XVF A;  2BK4 A;  2YG5 A;  3S5W A;  3NGC X;  1NDA A;  1TRB A;  3UKF A;  3SZC A;  3AB1 A;  2V3B A;  2YG4 A;  3F8R A;  4N9X A;  2ZZC A;  3O0H A;  4Y4N A;  4GDE A;  4A99 A;  2FJE A;  5KMR A;  2YG7 A;  3GYX A;  3FIM B;  1OJA A;  3AEE A;  4C3Y A;  1EBD A;  4FX9 A;  3ICT A;  3VQR A;  1TDK A;  3H8I A;  3V3N A;  2YWL A;  2XFQ A;  3AE8 A;  2R0P A;  3KVE A;  3BNM A;  3NYF A;  5C2T A;  3K30 A;  3AEB A;  2WDR A;  2YLR A;  2Q0K A;  4U8M A;  4Z43 A;  1Y56 A;  4TLX A;  3FBS A;  3SFD A;  2WHD A;  1KFY A;  4ICY A;  4Z2T A;  1GND A;  2R45 A;  1DXL A;  2XDO A;  3BI4 A;  4G6G A;  4X9N A;  2YLT A;  1BKW A;  1N1P A;  3ISH A;  4OVI A;  4YT0 A;  4GUV A;  4CRT A;  5KVH A;  2BRA A;  2Q7V A;  4B67 A;  2WS3 A;  4J31 A;  2WPC A;  1EL7 A;  2TPR A;  1OJD A;  2C7G A;  2PYX A;  3SGL A;  5JRB A;  1FEA A;  1TYT A;  1FL2 A;  3NG7 X;  3H4K A;  1LQU A;  3QFB A;  2YVG A;  1JNZ A;  3SQP A;  4BJZ A;  2XLP A;  3BI2 A;  1TDF A;  3UKL A;  4GDP A;  3HYW A;  1H86 A;  2XFN A;  1IUT A;  4K22 A;  4H4P A;  4Z25 A;  3DK4 A;  4J57 A;  3PS9 A;  2BC1 A;  4USQ A;  3D8X A;  5KWF A;  4KPR A;  5CQF A;  4H4R A;  3CGE A;  1GTE A;  3EAN A;  2WOW A;  5FMH A;  1COY A;  1FCD A;  3AE1 A;  3P1W A;  2VRM A;  1DOE A;  5U1O A;  4EMJ A;  2H89 A;  3OC4 A;  4KX6 A;  4H4V A;  2YLS A;  1N4W A;  3BHK A;  3NK2 X;  1NHR A;  1IUV A;  1CJ3 A;  1P2E A;  4EQW A;  2Y6Q A;  5KRQ A;  4TM0 A;  1ONF A;  3NN6 X;  5HY5 A;  1H83 A;  5BRT A;  4H4X A;  3DA1 A;  3EAO A;  1L9E A;  1O95 A;  5JCK A;  2WU2 A;  4Z44 A;  4REK A;  1MXT A;  3ZDN A;  1XDI A;  3QJ4 A;  2XFO A;  3KKJ A;  2XVE A;  3WE0 A;  1X31 B;  4NTC A;  3AE6 A;  3LB8 A;  1L9C A;  1CL0 A;  3V3O A;  4AT2 A;  2CFY A;  3NLC A;  3IC9 A;  3PG6 A;  5HHF A;  1GER A;  1PDH A;  4JNA A;  1CC2 A;  1S2Q A;  3UKA A;  2C70 A;  2XLR A;  4Z24 A;  3QVR A;  2GAG B;  5JCM A;  5KOW A;  5KXJ A;  1K4Q A;  2JK6 A;  5JCL A;  1F8R A;  1SEZ A;  1GTH A;  3K7T A;  3ATR A;  4II2 A;  4OPU A;  3UKH A;  1LQT A;  2X99 A;  1EL9 A;  1UKV G;  4RSL A;  1PS9 A;  5EOW A;  3NRN A;  3QFA A;  3NTD A;  1GAL A;  5DBJ A;  2BAB A;  3GMB A;  4XXG A;  1Z6L A;  1IJH A;  1O5W A;  3DJD A;  3T2Y A;  4A6N A;  4XWZ A;  3NNE A;  1VDC A;  1E1K A;  1TDO A;  3IF9 A;  4B64 A;  2FJD A;  2BK3 A;  2XCG A;  2V5Z A;  2APG A;  4H2P A;  2GF3 A;  4NEW A;  2FJB A;  4XWR A;  1V59 A;  3AE5 A;  2WET A;  3DK8 A;  3HYX A;  1CJ4 A;  3LOV A;  3DME A;  4YSX A;  1S3E A;  3ABV A;  1NAA A;  3B3R A;  3IHM A;  2VQB A;  3LXD A;  3ICS A;  2J3N A;  2B7S A;  5FS6 A;  1Q1R A;  4H4W A;  4EQS A;  2B9W A;  2VZ2 A;  2C3C A;  1KSS A;  2A89 A;  2R0C A;  2R46 A;  3H8L A;  4G6H A;  4ECH A;  4GF7 A;  5KNL A;  4H4Z A;  3F8D A;  1D7L A;  2PHH A;  2C66 A;  2GH5 A;  3M12 A;  2BCP A;  2OAL A;  4OPG A;  2XFP A;  4PAA A;  2GVC A;  4H4Q A;  2AQJ A;  5M10 A;  2H88 A;  2ZZ0 A;  4JDR A;  1GRE A;  1JU2 A;  2JKC A;  1LV0 A;  2VVM A;  5KMP A;  2R0G A;  4JQ9 A;  1S3B A;  3UKK A;  2V3A A;  2NPX A;  1CJ2 A;  2FBW A;  5J60 A;  1GT8 A;  5BVA A;  4B63 A;  3SX6 A;  1PJ6 A;  3UP4 A;  4Z2U A;  4CY8 A;  4U8J A;  3AE7 A;  1GRA A;  1M6I A;  4H4U A;  1E1L A;  3QSS A;  2ACZ A;  3DGZ A;  1YY5 A;  2EQ7 A;  2GEW A;  3DJE A;  1NPX A;  2GAH B;  3I6D A;  4NTE A;  2A8X A;  2R9Z A;  1AOG A;  1E1N A;  2CUL A;  2YLW A;  4YKF A;  4AOX A;  3DGH A;  4U2S A;  3FPZ A;  3CNS A;  3URH A;  1K0L A;  4U8N A;  1ZOV A;  5KVI A;  3RED A;  2VRL A;  1PBB A;  2V6O A;  4TM3 A;  1YQ3 A;  3KLJ A;  1GRF A;  5U63 A;  2EQ6 A;  1IUW A;  1CHU A;  2ZBW A;  1JEH A;  3AE2 A;  3Q9T A;  2OLN A;  4BK1 A;  1H81 A;  2DKI A;  4AT0 A;  2EQ8 A;  1PXA A;  2GMH A;  2CDU A;  1ZDL A;  3CGB A;  2YG3 A;  3CNJ A;  4H50 A;  2B9Y A;  3ATQ A;  3SM8 A;  1GES A;  4J36 A;  1NEK A;  4B1B A;  3S61 A;  4LII A;  1E6E A;  1KSU A;  1RSG A;  3GD3 A;  2C75 A;  2YVJ A;  1GV4 A;  3FMW A;  1GRT A;  2QAE A;  4B66 A;  4U8O A;  4H2Q A;  1KDG A;  1FEB A;  3P9U A;  3UKP A;  1NHQ A;  4EQX A;  4AP3 A;  4GR1 A;  2BS2 A;  2YLX A;  3NHO X;  4E0V A;  2OLO A;  3E1T A;  4UDR A;  4EQR A;  3LZX A;  3AWI A;  4CBQ A;  4FDC B;  4D04 A;  1ELI A;  5HXI A;  1ZKQ A;  3BI5 A;  4K8D A;  1Y56 B;  4UDP A;  2GB0 A;  2IVD A;  3UKQ A;  3ALM A;  4CY6 A;  4BJY A;  2ZZB A;  1F3P A;  1ZMD A;  3UTF A;  1H7W A;  4U8I A;  1GRH A;  1E39 A;  4B69 A;  5BUL A;  4YKG A;  1ZMC A;  1KNP A;  3GD4 A;  3GSI A;  2GR2 A;  4U2T A;  1HYU A;  1P2H A;  4I58 A;  4ZN0 A;  3CPI G;  2YM1 A;  4WX1 A;  5BUK A;  3Q6J A;  2C65 A;  1GET A;  1PJ5 A;  2WP9 A;  1IUS A;  2RAB A;  1XAN A;  3SZF A;  3CTY A;  1DOD A;  2UZZ A;  4IV9 A;  4WCT A;  2ARD A;  3EPT A;  4IVM B;  4DSG A;  1F8W A;  2JAE A;  1LJ1 A;  4I59 A;  2FJA A;  1EL5 A;  4B65 A;  4YXD A;  4O5U A;  2WBA A;  2XLU A;  5JCI A;  2Y6R A;  1D4C A;  4A5L A;  4B68 A;  4C3X A;  2F5Z A;  4MJW A;  2C73 A;  2YQU A;  3BNU A;  2HQM A;  2GV8 A;  1XHC A;  3SYI A;  1NG4 A;  3CND A;  3V76 A;  4UP3 A;  3PO7 A;  5IQ4 A;  1O94 A;  3P4R A;  2YR5 A;  1REO A;  3VRB A;  3D1C A;  3UP5 A;  2EQ9 A;  1H84 A;  4APN A;  4OPC A;  2V60 A;  3NH3 X;  5FS8 A;  4H4S A;  1LPF A;  3C4A A;  4TM1 A;  4GAV A;  3G5Q A;  3R9U A;  1H82 A;  3AD7 B;  4C5O A;  3ICR A;  4BV6 A;  1L9D A;  1L0V A;  4H4Y A;  3SXI A;  1KNR A;  4CNJ A;  1JRZ A;  5GRT A;  2TMD A;  2OA1 A;  1ZY8 A;  2YVF A;  4K5S A;  3OZ2 A;  4YSH A;  2BRY A;  1Q1W A;  4NTD A;  2RGJ A;  2XFU A;  1JRY A;  3AD9 B;  3AE9 A;  2BK5 A;  3G5S A;  2WP5 A;  2Q6U A;  4RG3 A;  2YM2 A;  1VG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...