5FS6A

Crystal structure of the v243l mutant of human apoptosis inducing factor
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
491
structure length
454
Chain Sequence
KAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMLKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHEDLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Structure/Function Relations in Aifm1 Variants Associated with Neurodegenerative Disorders
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 146
structure length 454
sequence length 491
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fs6A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs6A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs6A01
1PXBA 1FEBA 3GWDA 1LQTA 4NEWA 5KOWA 3NTAA 4YSXA 2V6OA 1KSSA 4BURA 4CNJA 1AOGA 2A8XA 2Q0KA 2XFPA 3EF6A 4E0VA 4B67A 2XFQA 3NN6X 2R0CA 5FS8A 3BI2A 3CPHG 4Z2TA 1PBDA 2XLRA 1Q9IA 3UOZA 3AYJA 3C4AA 1V59A 4FDCB 4J33A 1OJTA 4UP3A 2WP5A 2GH5A 3KLJA 1H84A 1JOAA 2ZZ0A 4UDQA 4XXGA 1BGNA 4REKA 4NTDA 3I6DA 3VRAA 2NVKX 4JN9A 1D4EA 2VRLA 3P4RA 3CPJG 3SFEA 4IA6A 3UTEA 1S2YA 4DNAA 3DJJA 1BWCA 3P1WA 4C5OA 2CFYA 1E1LA 1KNPA 2R45A 5LV9A 2GEWA 2WU5A 5TR3A 1PJ6A 2OAMA 2JKCA 5IQ1A 3AEBA 4C3XA 2B7SA 3M12A 1O95A 1KDGA 4OCGA 2B76A 2HQMA 1H81A 2V61A 1TYPA 4B63A 2WBAA 2XFNA 3NYFA 1ZDLA 2B7RA 3SGLA 4OPIA 2BABA 2DKIA 2E4GA 4H4XA 5C3JA 2C72A 4AOSA 3ALJA 2H88A 2YLTA 5DBJA 3NYCA 4H4VA 2WPEA 5U1OA 1CC2A 2GVCA 3LJPA 1GTEA 1GRBA 1NHSA 4Y4LA 4GDPA 2R0GA 3GYIA 1PJ5A 2BXRA 4ZN0A 3IHGA 3QSEA 4U8LA 3S5WA 4H4TA 3P4SA 1YQ3A 2GV8A 4BJZA 2R4EA 3K7QX 1OJCA 4JY3A 4X9MA 4YSHA 3DK4A 1X31B 2X50A 4K22A 4WCTA 3UKPA 4UDRA 3H4KA 1LJ1A 1P2EA 1PS9A 2UZZA 3AE6A 3P9UA 4PAAA 4GCMA 5EOWA 3LOVA 1GSNA 5JCLA 1DXLA 3LADA 2TPRA 2YR5A 1N4VA 3AYLA 5M0ZA 3NYEA 3VRBA 5IPYA 1XANA 1CC4A 1NHPA 4WX1A 2H89A 4H4YA 4RSLA 5FS6A 3UOVA 3ATQA 3EPTA 4H7UA 1K0LA 3ICRA 3SM8A 5IQ4A 3CNPA 2WPFA 1GRAA 3BHFA 2YVFA 2C3CA 4RG3A 1L0VA 1BGJA 4J36A 3C96A 2IVEA 4D04A 4B65A 2R46A 1JNZA 2C75A 3CTYA 4JNAA 4YTMA 4O5UA 2VVLA 4B64A 1ZOVA 4K7ZA 1FECA 1KNRA 4EIQA 4YSZA 1RYIA 3CNDA 2FBWA 4X4JA 5KVIA 5EB4A 1E1MA 1H83A 4TM4A 3KD9A 3CGDA 1ZOYA 4JY2A 4EMWA 2Q6UA 3GDPA 1EL7A 3NLCA 5FS9A 1TRBA 1GRGA 3D8XA 5U63A 4K8DA 2Z5XA 2XVFA 2X99A 1K0IA 2ACZA 1TDNA 1GERA 1L9DA 1CF3A 3AD7B 3G5RA 3IF9A 4B1BA 1N4WA 1NEKA 3H8IA 4U8OA 5EBKA 3LXDA 4H50A 3UTGA 5HYMA 3KVEA 4J34A 4GR1A 1MOKA 2WETA 1IUUA 3F8DA 5JCKA 3RP6A 2GR0A 1ZP0A 4EQSA 2A87A 3AB1A 4H4QA 1JRYA 4CBQA 2C70A 2QA2A 1E1KA 2C76A 3AEAA 3RHAA 3VR8A 5C2TA 4KPRA 2E1MA 2FJBA 2YM1A 4O5QA 4OPUA 5EB5A 2XVEA 2OLNA 2I0ZA 2GQFA 3CIRA 3T37A 2WOWA 2XFOA 3AE8A 3NGCX 2ZZCA 3BNMA 2QA1A 1DODA 1GESA 1Q1RA 1GRFA 3H8LA 3B6DA 2BC1A 2EQ7A 2IVDA 3UTHA 1Y56A 1VRQB 1EL9A 2YWLA 3AE9A 4K5SA 1GEUA 4IVMB 2WP6A 1NAAA 1NHRA 1GTHA 2GMJA 1K4QA 4I58A 3OC4A 1E7PA 5KRQA 3GRSA 4JQ9A 5M10A 2WQYA 4Y4MA 5GSNA 1Y0PA 4A5LA 3ICTA 2YLZA 2EQ8A 1YQZA 3AEEA 3O0HA 1CBOA 2C65A 3KU9A 4Z2RA 2YVGA 4YXDA 3AE1A 4NEVA 1OJ9A 2ZZBA 1O5WA 4USRA 4Z24A 1LV0A 2YR6A 4LA1A 2XVJA 5KVHA 1D5TA 3ATRA 1D4DA 3PO7A 2WEUA 4LU6A 1L9EA 1PBBA 4BJYA 4JNQA 1M64A 2XDOA 4YT0A 1GV4A 1DNCA 4YTNA 2YM2A 3F8RA 4Y4NA 2JBVA 2WP9A 5JCIA 3FBSA 1TDKA 2YLSA 2FJAA 4BV6A 4H4PA 5FMHA 3GWFA 2C3DA 1ZKQA 4Z2UA 2YVJA 4J2WA 4B66A 4AOXA 1CHUA 2R0PA 3RP7A 1PHHA 1KF6A 2DKHA 3KKJA 3C4NA 2RABA 1EL5A 4H4RA 1F3PA 4JDRA 1BKWA 3WE0A 4A9WA 1IJHA 3CNSA 3GRTA 3I3LA 2XVHA 2GMHA 1Q1WA 2XCGA 1XPQA 5BULA 1ZY8A 1PN0A 3NK1X 4U2TA 1GXFA 1XHCA 1PXAA 4DGKA 1DOCA 2WHDA 3ALLA 1W4XA 3DJGX 2OA1A 1LQUA 1GRTA 1CJ4A 2OLOA 2YG5A 1H86A 3PS9A 1B5QA 4Z43A 3VQRA 4C3YA 1ONFA 3CGCA 2B9WA 2YG7A 4YWOA 1HYUA 2WS3A 4OPTA 4GRTA 1CC6A 2VVLG 1IUXA 4EMJA 4YKFA 2X8GA 4TLZA 3KPFA 2JB3A 4HB9A 1GRHA 1YQ4A 3ZDNA 2BCGG 4TLXA 4CCRA 3L1RA 4H4WA 2WDRA 3GDNA 4U8NA 3IWAA 2PHHA 5HHFA 3VRDB 3B3RA 5J7XA 3UP5A 2Z5YA 2EQ6A 1CJ3A 4DSHA 4K2XA 4CCQA 1CJ2A 3SFDA 1M6IA 3FG2P 3AEGA 3AECA 1GREA 5U25A 2F5ZA 1GOSA 3SQPA 2YG3A 3QVRA 1NPXA 1H7XA 2GR1A 1D7LA 1E39A 4ZCCA 2NPXA 2C67A 2YLRA 2J3NA 2WPCA 1GPEA 3R9UA 1VDCA 3M0OA 1QJDA 1IUTA 2VVMA 5KXJA 1F8WA 4AT2A 4XWRA 4J31A 2WOVA 4H4UA 3KA7A 4A99A 3DK8A 4IVOB 1DJNA 1ELIA 3V3NA 1LVLA 3IC9A 3K30A 4TM0A 1GT8A 5KOXA 4H2RA 4OVIA 5CKUA 1KSUA 2V5ZA 2BC0A 5JCNA 2RGHA 2XYOA 3CNTA 1F6MA 3AD8B 3UOXA 3AE4A 1E6EA 1ZK7A 1PBFA 4GF7A 3BHKA 4H2NA 3S61A 1N4UA 3LZXA 3GMBA 4AP3A 2YG6A 2FJEA 3P4PA 4UDPA 1EL8A 2BS4A 3CGEA 3DK9A 2QAEA 2YR4A 4NZHA 4NTEA 3ABVA 2RGOA 4Z26A 4D03A 1JU2A 1OJAA 3CGBA 1B8SA 5GRTA 1QLBA 3LB8A 2WESA 2BACA 3UKQA 4PABA 2V3AA 1VG9A 3NKSA 2QCUA 3NTDA 1D7YA 1NG4A 3BI4A 1FL2A 3DJDA 2Q7VA 3K7TA 4A65A 4J56A 3RNMA 1S3BA 2AQJA 5JCMA 4IV9A 3DH9A 2X8HA 1TDFA 3ISHA 4HA6A 3AYIA 4EQRA 1Y56B 4YTPA 3E1TA 2GRTA 2GAHB 2XLTA 1XDIA 2A89A 1GNDA 3NK2X 3CNJA 4USQA 3UOYA 4A79A 1OJDA 3L8KA 2OALA 2APGA 4CY6A 1TDOA 2C64A 3NNEA 3ZYXA 1TYTA 4U8IA 4EIPA 4YKGA 1H82A 3CN8A 4BK2A 3QFAA 4XWZA 1TDEA 1N1PA 2ZBWA 3GYJA 1PDHA 3NIXA 2BK3A 3ITJA 2VOUA 4J57A 2X8CA 3ADAB 4N9XA 3DGZA 1IUWA 1BF3A 4ECHA 4NTCA 1NENA 3UKHA 3UCLA 2XLUA 3M13A 4H2QA 4DSGA 2GR3A 2JAEA 4GUVA 5HY5A 5KWFA 1IUSA 1RP0A 4EM4A 2BK4A 2VQ7A 1H6VA 1NG3A 2XLPA 1S2QA 1FCDA 5BUKA 3NG7X 2EQ9A 3QFBA 1MO9A 2GAGB 4M52A 4OPLA 3GMCA 4EQWA 2JK6A 1ZMDA 2JB2A 1B4VA 4K5RA 2JB1A 2E5VA 3EANA 1GETA 1ZX9A 3V76A 2AR8A 4BK3A 3BNUA 2TMDA 3NN0X 3D1CA 2W0HA 1QO8A 3NH3X 3AD9B 2FJDA 2VRMA 2GF3A 3G5SA 4LIIA 4KX6A 5J60A 2XVIA 3URHA 1LTXR 2YQUA 1JRXA 2YAUA 1F8SA 2PYXA 1Z6LA 3QSMA 4AT0A 2BA9A 2WDVA 1SEZA 2WOIA 4U8PA 2Q0LA 4CY8A 2Y6QA 5ER0A 4EMIA 1REOA 3DJEA 1B37A 2BXSA 4OPCA 3JSKA 2WDQA 2BS3A 2CULA 2VZ2A 2BK5A 4TM1A 1PJ7A 1JEHA 5L46A 3LZWA 3AE2A 3HZLA 1E1NA 3P4QA 2R4JA 3Q6JA 3RP8A 3K7MX 2YLXA 3GSIA 3NRNA 2Y6RA 4C74A 2C66A 4TM3A 3AE3A 4U8MA 3UKKA 2CDUA 1VQWA 1K0JA 4FX9A 2BS2A 1NHQA 2BCPA 4APNA 1PBEA 1EBDA 4U8JA 2C73A 1DOEA 2YLWA 1GALA 2YG4A 3FMWA 3BI5A 2O9ZA 3NT6A 3VR9A 1S3EA 1O94A 1FEAA 2V3BA 3AWIA 2GQWA 3IHMA 4X9NA 1JNRA 4BK1A 1NDAA 2V60A 1CL0A 1F8RA 3UKLA 1UKVG 3REDA 1YKJA 2C7GA 3COXA 3F8PA 4YSYA 1KFYA 3DGHA 3AEFA 4OPDA 4U2SA 1PBCA 3PVCA 1VG0A 2GB0A 1JRZA 3G5QA 4Z44A 3GD4A 3UKFA 1D4CA 3OZ2A 3QVPA 2IIDA 4RG4A 2R9ZA 3Q9TA 3ICSA 4U8KA 4ZCDA 4AP1A 1LPFA 4A6NA 3DA1A 1PXCA 4P9SA 1YY5A 2X3NA 2CVJA 3GD3A 3AXBA 1P2HA 3NK0X 4FK1A 3QSSA 2B9XA 1IUVA 2ARDA 4MJWA 4U2LA 5BVAA 1DOBA 2BYBA 4A6NB 4ICYA 4A7AA 4B69A 4Z25A 4OPGA 2RGJA 3II4A 1RSGA 3AE7A 4H4ZA 1COYA 3CPIG 4H4SA 3UP4A 1DJQA 5FS7A 2XFUA 5HXIA 4EQXA 2VQBA 2AAQA 3V3OA 4FK1C 3EAOA 2XLSA 1CJCA 4ADWA 1MXTA 4H2PA 5CQFA 3UTFA 4I59A 1BZLA 4C77A 5BRTA 3FPZA 4CNKA 4IA5A 3AE5A 3AEDA 2GR2A 1FOHA 4EM3A 1ZMCA 2B9YA 2WU2A 3DMEA 3QJ4A 4GDEA 4B68A 3NHOX 4CRTA 3UKAA 3FIMB 1H7WA 3ALMA 1L9CA
chains in the Genus database with same CATH superfamily
3GWDA 4NEWA 2V6OA 1KSSA 1N5WC 4E0VA 1FO4A 1PBDA 3AYJA 3H7VA 1OJTA 4NTDA 4G74A 3SZFA 2PP0A 4M6UA 4Z17A 1S2YA 3T2KA 3P1WA 1E1LA 5LV9A 2GEWA 5TR3A 3R25A 2JKCA 1RVKA 2HQMA 4HNLA 5FJTA 3OPSA 2PA6A 3NYFA 3SGLA 2BRYA 1EC8A 3H70A 4AOSA 3ALJA 4HYRA 5U1OA 2GVCA 1SJBA 1GTEA 4K2SA 1NHSA 4Y4LA 2PMQA 4ZN0A 2BXRA 4U8LA 4G8TA 3GO2A 4H4TA 2R4EA 3K7QX 5FJRA 3KPKA 4GAVA 3FXGA 1LJ1A 2QQ6A 4H2HA 3LADA 3AYLA 3GYXA 2HXUA 3JVAA 3VRBA 5IPYA 2H89A 5FS6A 3UOVA 3JZUA 3SM8A 3CNPA 2C3CA 3MSYA 4RG3A 1L0VA 1DTNA 2R46A 4YTMA 4B64A 1ZOVA 4EIQA 3CB3A 1RYIA 2FBWA 3UXLA 3DERA 3ZLFA 2XGZA 1ZOYA 1PDZA 5FS9A 3D8XA 4K8DA 3RO6A 1TDNA 1T3QC 3SSZA 3VDGA 1NEKA 3H8IA 4U8OA 3ENLA 4H50A 3UTGA 2OO6A 2OX4A 5HYMA 5JCKA 4EQSA 4CBQA 2C70A 2QA2A 3VR8A 4KPRA 2E1MA 2FJBA 3MUCA 2OLNA 1FFUC 2WOWA 2XFOA 2PGEA 2ZZCA 4DN1A 1DODA 4K8GA 3H8LA 4J3ZA 3H12A 1P43A 1EL9A 4IVMB 1ZXIC 1NHRA 1GTHA 3OC4A 4JQ9A 2PODA 2FYMA 4A3RA 3O0HA 3KU9A 3UCCA 3UGVA 1O5WA 1LV0A 5KVHA 3I6EA 3NXLA 4YTNA 4G7FA 2FJAA 3OP2A 4H4PA 1EC9A 3UJFA 4J2WA 1CHUA 1MNSA 3C4NA 1EL5A 4H4RA 3B97A 3CXOA 1VDVA 2XVHA 5BULA 1ZY8A 3NK1X 2RDXA 1W4XA 1CJ4A 2YG5A 3PS9A 3TOYA 1ONFA 5KMPA 2WS3A 4GRTA 3V5FA 1P48A 2BCGG 4TLXA 4H4WA 2WDRA 4U8NA 5HHFA 3VRDB 3B3RA 1CJ3A 3AEGA 1SJDA 4E5TA 1MDRA 2GR1A 4IP4A 1GPEA 3M0OA 3U9IA 5KMRA 1F8WA 4J31A 3BOXA 1DJNA 4TM0A 1GT8A 5KOXA 1PDYA 3CNTA 1F6MA 1ZK7A 4GF7A 3BHKA 2P3ZA 3DEQA 2FJEA 3IJIA 2GL5A 1JU2A 1B8SA 4K1WA 1X2GA 1QLBA 2WESA 3UKQA 1YEYA 3DJDA 2AQJA 4IV9A 3DH9A 3AYIA 4EQRA 2OPJA 3E1TA 1XDIA 2A89A 3FVDA 5BOEA 4USQA 3UOYA 1OJDA 2C64A 3ZYXA 4YKGA 3S5SA 5FJUA 3QFAA 3NIXA 1EC7A 4JHMA 2XLUA 4DSGA 2GR3A 1IUSA 3P0WA 2VQ7A 1FCDA 3GMCA 4EQWA 1ZMDA 2JB2A 2OFJA 1B4VA 3QLDA 2TMDA 3NN0X 4IHCA 3DFHA 3CXBA 2GF3A 2GGJA 3PFRA 1LTXR 1TKKA 2PYXA 3HYVA 1F8SA 3D9XA 2BA9A 4TVWA 1JPDX 3IJQA 4CY8A 3T0KA 3DJEA 3Q45A 2CULA 2VZ2A 2BK5A 4TM1A 1OEPA 3Q6JA 2YLXA 4C74A 4TM3A 1NELA 1JCTA 5KMSA 2PGWA 1VQWA 2BCPA 4APNA 1EBDA 2C73A 1GALA 3FMWA 3BI5A 2O9ZA 1S3EA 1O94A 2V3BA 4H83A 2GQWA 3AWIA 4X9NA 1BKHA 4BK1A 3NFUA 1CL0A 3NVVB 1YKJA 3F8PA 1KFYA 3AEFA 3SZCA 1VG0A 1JRZA 1EBGA 4U8KA 4ZCDA 3Q9TA 3ICSA 4AP1A 1PXCA 1KD0A 2OLAA 4FK1A 3NK0X 3TWBA 1IUVA 4A7AA 2RGJA 3ZVHA 2XFUA 5HXIA 4EQXA 2VQBA 5BRTA 1JPMA 3DMEA 2B9YA 1ZMCA 3V4BA 3NHOX 4CRTA 3QSEA 1L9CA 3NTAA 2Q0KA 3EF6A 3NN6X 3CPHG 1KCZA 3C4AA 4FDCB 2ZZ0A 3V3WA 1BGNA 3VRAA 2VRLA 3P4RA 4E4FA 1BWCA 4C5OA 1PJ6A 3OTRA 5IQ1A 1O95A 1KDGA 4OCGA 1H81A 2V61A 1TYPA 2AL2A 3PWIA 4H4XA 3V5CA 2C72A 1SJCA 2H88A 3NYCA 2QDEA 3LJPA 2R0GA 3IHGA 3S5WA 3TCSA 3SYIA 3P4SA 2GV8A 4BJZA 1OJCA 4JY3A 4X9MA 1L8PA 4HCDA 4UDRA 4GCMA 1DXLA 3BSMA 2TPRA 2PSNA 3NYEA 5JRBA 3NVYB 3R07C 3EPTA 1K0LA 4J36A 2HZGA 4D04A 3DG7A 1JNZA 4O5UA 2VVLA 4YSZA 3CNDA 1H83A 3UJ2A 3KD9A 1KKRA 3GDPA 1TRBA 1GRGA 5U63A 2XVFA 2X99A 2PTYA 3MQTA 1N4WA 3NVZB 3KVEA 4J34A 1MOKA 2WETA 1IUUA 2GR0A 1JRYA 1E1KA 3AEAA 1N63C 5C2TA 2PPGA 5EB5A 2YM1A 3VA8A 2XH4A 3AE8A 3NGCX 3BNMA 5EU9A 3UTHA 1Y56A 3DIPA 3HRDC 3AE9A 3QPEA 4K5SA 2WP6A 1NAAA 3CK5A 2GMJA 1FHUA 2OZ8A 3KUMA 4NWZA 3GY1A 2PU0A 2WQYA 5GSNA 1Y0PA 3TTEA 3OZYA 2YLZA 2EQ8A 3AEEA 1OJ9A 2ZZBA 2YR6A 4LA1A 1PBBA 4BJYA 4JNQA 2WP9A 5FMHA 2C3DA 1ZKQA 4Z2UA 2YVJA 2OZ3A 3RP7A 1PHHA 1KF6A 1EBHA 1F3PA 2HNEA 1BKWA 3WE0A 3GRTA 3I3LA 2XCGA 1XPQA 1SJAA 1XHCA 1N61C 3ALLA 1GRTA 4II2A 4C3YA 2B9WA 4OPTA 2VVLG 2OVLA 4IL2A 3KPFA 4HB9A 2AKZA 3SR6B 4EWJA 3GDNA 5J7XA 2Z5YA 4DSHA 5U25A 2F5ZA 2YG3A 3T31A 3QVRA 2E3TA 1E39A 4ZCCA 4H4UA 3KA7A 4A99A 4MKSA 1ELIA 3V3NA 3K30A 4H2RA 4OVIA 2RGHA 3UOXA 3SBFA 3CAWA 1N4UA 4UDPA 3CGEA 3DK9A 2YR4A 4NZHA 3ABVA 2RGOA 4D03A 3LB8A 4KPLA 3NKSA 2QCUA 1D7YA 1NG4A 3BI4A 3SXIA 3K7TA 5JCMA 1TDFA 3PWGA 4HN8A 2XLTA 3EUB3 3NK2X 3CNJA 4CY6A 3R10A 4U8IA 4EIPA 3N4FA 1H82A 3CN8A 4BK2A 4XWZA 3GYJA 1PDHA 3ITJA 4J57A 3HYXA 4NTCA 3M13A 3SN4A 2JAEA 4GUVA 5KWFA 3NG7X 2GAGB 4OPLA 4JN8A 2JB1A 3BNUA 3D1CA 1QO8A 3NH3X 2VRMA 3G5SA 2OQHA 4LIIA 4KX6A 3P93A 2YQUA 1Z6LA 4U8PA 1SEZA 2WOIA 5ER0A 4EMIA 3JSKA 3JW7A 1PJ7A 3AM9A 3LZWA 3HZLA 2CHRA 2Y6RA 2HXTA 2PP1A 3MWCA 3AE3A 2GGEA 3UKKA 1K0JA 4FX9A 2BS2A 2P88A 1NHQA 1PBEA 1DOEA 2YLWA 2XSXA 2DW7A 3IHMA 1JNRA 1F8RA 2GGGA 3COXA 4OPDA 4JN7A 3EEZA 3PVCA 2GB0A 4H19A 3FV9A 2IIDA 2R9ZA 4P9SA 2X3NA 3GD3A 4MJWA 4U2LA 3T2ZA 1DOBA 4Z25A 4H4ZA 1ECQA 1COYA 4H4SA 3HPFA 2C4CA 4FK1C 3SZ0A 2XLSA 4ADWA 5CQFA 3CMMA 3AEDA 3UCDA 1FOHA 4B68A 3UKAA 2P0IA 3EKGA 1PXBA 3T14A 1LQTA 4YSXA 2A8XA 2XFPA 2XFQA 5FS8A 3BI2A 4Z2TA 2XLRA 4GGHA 4J33A 2WP5A 2GH5A 1S7MA 4UDQA 1JOAA 4XXGA 3A7UA 2NVKX 4JN9A 1D4EA 3CPJG 2GSHA 3SFEA 4IT1A 2CFYA 3VCNA 2QDDA 2WU5A 2OAMA 3RR1A 3AEBA 1RM6B 4C3XA 2B7SA 2AL1A 2FKPA 3CT2A 2B7RA 2E4GA 3T9PA 5C3JA 4IP5A 4ZCWA 2YLTA 4HNCA 3I6TA 3NRZB 4GDPA 1PJ5A 1YQ3A 3TJIA 4YSHA 3T6CA 4K22A 3UKPA 3H4KA 1P2EA 3AE6A 2UZZA 1JROA 1GSNA 1N4VA 2XH7A 6ENLA 1NHPA 4E4UA 4WX1A 4H4YA 4RSLA 3ATQA 3ICRA 5IQ4A 2WPFA 1GRAA 3DGBA 1MUCA 3C96A 4B65A 2C75A 2POZA 3CTYA 1FECA 4GISA 1KNRA 3UJRA 3S47A 1H2IA 4JY2A 4EMWA 2Q6UA 7ENLA 1K0IA 2ACZA 1GERA 1CF3A 3G5RA 3IF9A 2OKTA 5EBKA 1ELSA 3F8DA 1ZP0A 3AB1A 4MMWA 4H4QA 4G9KA 4A6GA 2I0ZA 2GQFA 3N4EA 3T37A 3R0UA 2PCEA 4ENLA 3B6DA 2EQ7A 1VRQB 3AN1A 1ONEA 2PTWA 4GFIA 1W6TA 4I58A 1E7PA 3GRSA 4Y4MA 3ICTA 2GDQA 3I4KA 3AE1A 1STZA 4NEVA 3TQPA 4Z24A 3P3BA 3SN0A 3ATRA 2WEUA 1M64A 2XDOA 4YT0A 1DNCA 3F8RA 4Y4NA 2JBVA 3FBSA 1TDKA 4BV6A 4HPNA 4M0XA 3RCYA 3VC6A 4DHGA 2O56A 1IJHA 2QJMA 4G73A 3FYYA 3MY9A 1GXFA 1PXAA 1DOCA 3PK7A 3DJGX 4IL0A 1H86A 4Z43A 3VQRA 3CGCA 2YG7A 3SN1A 3STPA 1HYUA 1IYXA 4EMJA 4YKFA 1TE6A 2X8GA 4GGBA 4TLZA 1GRHA 3ZDNA 4CCRA 3L1RA 2PHHA 3T2YA 5IDZA 1R6WA 1CJ2A 3SFDA 1M6IA 3FG2P 3AECA 3ES7A 1N60C 1GOSA 3SQPA 1MRAA 3DDMA 3SJNA 1WYGA 1D7LA 2NPXA 2C67A 2J3NA 2WPCA 2W3SA 2VVMA 5KXJA 4AT2A 4XWRA 3QTPA 3DK8A 4X2PA 5FJOA 4IVOB 3DFYA 1KSUA 2BC0A 5JCNA 2XYOA 3AD8B 2QVHA 1E6EA 1PBFA 3GMBA 4AP3A 2YG6A 3P4PA 1EL8A 2BS4A 4NTEA 3CGBA 1KN0A 5GRTA 3B9JB 2BACA 1VG9A 3NTDA 1FL2A 3RITA 1FHVA 4J56A 3RNMA 4G6HA 2X8HA 3ISHA 4YTPA 2GRTA 3UXKA 3DG6A 3BJSA 3ETRB 4A79A 3L8KA 3NNEA 3R0KA 2W3RA 1TDEA 2E5AA 3QKEA 3ADAB 4N9XA 1IUWA 1BF3A 4ECHA 5FJPA 3UKHA 4H2QA 3U4FA 2NQLA 5HY5A 1RP0A 2BK4A 1H6VA 1NG3A 2MNRA 2EQ9A 4M52A 3SY4A 3SX6A 4K5RA 3SZWA 1GETA 2P8BA 3NS1B 3K1GA 5J60A 1JRXA 2YAUA 2WDVA 2Q0LA 1REOA 1B37A 2WDQA 3SQSA 2BS3A 3AE2A 1E1NA 3P4QA 4H1ZA 3RP8A 3ES8A 4KWSA 4DYEA 4U8JA 1WUEA 2YG4A 3NT6A 1FEAA 1NDAA 3UKLA 3REDA 3DGHA 4F4RA 4U2SA 3VCCA 3G5QA 4Z44A 4IZGA 3GD4A 4RG4A 4A6NA 3DA1A 1YY5A 2CVJA 3AXBA 2QGYA 2OZTA 1P2HA 3QSSA 1KKOA 2BYBA 3UJEA 3IJLA 3AE7A 1RSGA 3CPIG 5KMQA 3UP4A 2AAQA 3V3OA 3EAOA 1MXTA 3UTFA 1BZLA 4II3A 4CNKA 4IA5A 3AE5A 3D46A 2WU2A 4GDEA 3N6JA 1H7WA 3RRAA 3ALMA 1FEBA 5KOWA 4BURA 4CNJA 1AOGA 1X2HA 4B67A 2R0CA 4ZOHB 1Q9IA 3UOZA 1V59A 1WUFA 4UP3A 3Q4DA 1N5XA 3KLJA 1H84A 4REKA 3I6DA 3R11A 5G5HB 4IA6A 3UTEA 3GC2A 4DNAA 3DJJA 1KNPA 3HW2A 2R45A 2I5QA 3NVWB 2W54A 3M12A 4YWSA 1FIQB 2B76A 3MZNA 4B63A 2WBAA 1E9IA 2XFNA 1ZDLA 4OPIA 1V97A 2BABA 2DKIA 2P8CA 3H8AA 4Z1YA 5DBJA 4H4VA 2WPEA 1CC2A 1GRBA 4DX3A 3GYIA 1FFVC 4MGGA 2XH0A 3OW1A 3DK4A 3NZGA 1X31B 2X50A 4WCTA 4FP1A 3P9UA 5EOWA 1PS9A 4PAAA 3LOVA 5JCLA 2YR5A 5M0ZA 2BRAA 1XANA 1CC4A 2MUCA 4H7UA 3BHFA 2YVFA 3N6HA 1BGJA 2IVEA 2OG9A 4JNAA 4K7ZA 4X4JA 5KVIA 5EB4A 1E1MA 4TM4A 4DXKA 3CGDA 3NLCA 1EL7A 3THUA 2Z5XA 1L9DA 3AD7B 4B1BA 3LXDA 3RGTA 1VQZA 4GR1A 3ZVHB 3RP6A 2A87A 4GMEA 2C76A 3RHAA 4O5QA 4OPUA 2XVEA 3NO1A 3CIRA 2QA1A 1JRPA 1GESA 1Q1RA 1GRFA 2DW6A 2BC1A 2IVDA 2YWLA 1GEUA 3R1ZA 1N62C 2PS2A 1K4QA 3IK4A 4HCHA 5KRQA 5M10A 4A5LA 1R0MA 3ZLHA 1YQZA 1CBOA 2C65A 4Z2RA 2YVGA 4YXDA 4USRA 4HCLA 2XVJA 3VFCA 4E8GA 1D5TA 1D4DA 3PO7A 3FCPA 4LU6A 1L9EA 1GV4A 2YM2A 3OZMA 5JCIA 2AL2B 1XS2A 2YLSA 2PU1A 3GWFA 2PTZA 4B66A 4AOXA 2R0PA 3KKJA 2DKHA 2RABA 3AMZA 4JDRA 4A9WA 3TWAA 3CNSA 3T4WA 2GMHA 1Q1WA 2PTXA 4U2TA 1PN0A 4DGKA 3MKCA 4GYPC 2WHDA 2OA1A 1LQUA 2OLOA 3TJ4A 4DWDA 1B5QA 4YWOA 5KNLA 1CC6A 1IUXA 2JB3A 2XH2A 1YQ4A 4A35A 3UJSA 3IWAA 3UP5A 2EQ6A 4K2XA 4CCQA 1GREA 1NPXA 1H7XA 2YLRA 3A7AA 2ZADA 1VDCA 3R9UA 1QJDA 1IUTA 2WOVA 1F9CA 4TVYA 1LVLA 3IC9A 5CKUA 2V5ZA 5J04A 1MDLA 3AE4A 4H2NA 3S61A 3LZXA 2QAEA 5BOFA 4Z26A 3DESA 4ROPA 1OJAA 3A7RA 1JDFA 2ONEA 3FJ4A 2GGHA 4PABA 2V3AA 4ZA0A 1SB3B 3L5OA 2Q7VA 4A65A 4GAPA 1S3BA 4HA6A 1Y56B 2GAHB 3ZVIA 3VC5A 1GNDA 5ENLA 2OALA 2APGA 1TDOA 3T8QA 1TYTA 3ZLGA 2AKMA 2ZBWA 1N1PA 2BK3A 2VOUA 2OQYA 2X8CA 3DGZA 2PP3A 4G6GA 1NENA 3UCLA 4J1OA 3CYJA 3PG6A 4EM4A 2XLPA 1S2QA 5BUKA 3QFBA 1MO9A 2GGIA 2JK6A 4GYPA 2E5VA 3EANA 3V76A 1ZX9A 4BK3A 2AR8A 4KT2A 2W0HA 5G5GB 3AD9B 2FJDA 1XPYA 2XVIA 3URHA 3QSMA 4AT0A 2Y6QA 1TZZA 2BXSA 4OPCA 1JEHA 5L46A 2R4JA 3K7MX 3NRNA 3GSIA 3D47A 2W55A 2C66A 4U8MA 1NU5A 2CDUA 2QJNA 4E6MA 3TW9A 3VR9A 4GIRA 1BQGA 2V60A 1UKVG 2C7GA 4YSYA 3DG3A 1PBCA 4NNJA 4FI4A 3UKFA 1D4CA 3OZ2A 3QVPA 1LPFA 4KEMA 2B9XA 3GD6A 2ARDA 5BVAA 2ZC8A 4A6NB 4ICYA 4B69A 4OPGA 3II4A 3HYWA 1DJQA 5FS7A 3QN3A 2QJJA 1CJCA 4H2PA 4I59A 4C77A 3FPZA 2GR2A 4EM3A 3QJ4A 3FIMB
chains in the Genus database with same CATH topology
1PXBA 1FEBA 3GWDA 3T14A 1LQTA 4NEWA 5KOWA 3NTAA 4YSXA 2V6OA 1KSSA 4BURA 4CNJA 1AOGA 2A8XA 2Q0KA 2XFPA 3EF6A 4E0VA 4B67A 2XFQA 3NN6X 2R0CA 5FS8A 3BI2A 3CPHG 4Z2TA 1PBDA 2XLRA 1Q9IA 3UOZA 3AYJA 3C4AA 1V59A 4FDCB 4J33A 1OJTA 4UP3A 2WP5A 2GH5A 1S7MA 3KLJA 1H84A 1JOAA 2ZZ0A 4UDQA 4XXGA 1BGNA 4REKA 4NTDA 4AT0A 4G74A 3I6DA 3VRAA 3SZFA 2NVKX 4JN9A 1D4EA 2VRLA 3P4RA 3CPJG 3SFEA 4IA6A 3UTEA 1S2YA 4DNAA 3DJJA 3T2KA 1BWCA 3P1WA 4C5OA 2CFYA 1E1LA 1KNPA 2R45A 5LV9A 2GEWA 2WU5A 5TR3A 1PJ6A 2OAMA 2JKCA 5IQ1A 3AEBA 4C3XA 2B7SA 3M12A 1O95A 1KDGA 4OCGA 2B76A 2HQMA 1H81A 2V61A 1TYPA 4B63A 2WBAA 2XFNA 3NYFA 1ZDLA 2B7RA 3SGLA 4OPIA 2BABA 2BRYA 2DKIA 2E4GA 4H4XA 5C3JA 2C72A 4AOSA 3ALJA 2H88A 2YLTA 5DBJA 3NYCA 4H4VA 2WPEA 5U1OA 1CC2A 2GVCA 3LJPA 1GTEA 1GRBA 1NHSA 4Y4LA 4GDPA 2R0GA 3GYIA 1PJ5A 2BXRA 4ZN0A 3IHGA 3QSEA 4U8LA 3S5WA 4H4TA 3P4SA 1YQ3A 2GV8A 3SYIA 4BJZA 2R4EA 3K7QX 1OJCA 4JY3A 4X9MA 4YSHA 3DK4A 3KPKA 1X31B 2X50A 4K22A 4GAVA 4WCTA 3UKPA 4UDRA 3H4KA 1LJ1A 1P2EA 1PS9A 2UZZA 3AE6A 3P9UA 4PAAA 4GCMA 5EOWA 3LOVA 1GSNA 5JCLA 1DXLA 3LADA 2TPRA 2YR5A 1N4VA 3AYLA 3GYXA 5M0ZA 2BRAA 3NYEA 3VRBA 5IPYA 1XANA 5JRBA 1NHPA 1CC4A 4WX1A 2H89A 4H4YA 4RSLA 5FS6A 3UOVA 3ATQA 3EPTA 4H7UA 1K0LA 3ICRA 3SM8A 5IQ4A 3CNPA 2WPFA 1GRAA 3BHFA 2YVFA 2C3CA 4RG3A 1L0VA 1BGJA 4J36A 3C96A 2IVEA 4D04A 4B65A 2R46A 1JNZA 2C75A 3CTYA 4JNAA 4YTMA 4O5UA 2VVLA 4B64A 1ZOVA 4K7ZA 1FECA 1KNRA 4EIQA 4YSZA 1RYIA 3CNDA 2FBWA 4X4JA 5KVIA 5EB4A 1E1MA 1H83A 4TM4A 3KD9A 1H2IA 3CGDA 1ZOYA 4JY2A 4EMWA 2Q6UA 3GDPA 1EL7A 3NLCA 5FS9A 1TRBA 1GRGA 3D8XA 5U63A 4K8DA 2Z5XA 2XVFA 2X99A 1K0IA 2ACZA 1TDNA 1GERA 1L9DA 1CF3A 3AD7B 3G5RA 3IF9A 4B1BA 1N4WA 1NEKA 3H8IA 4U8OA 5EBKA 3LXDA 4H50A 3UTGA 5HYMA 3KVEA 4J34A 4GR1A 1MOKA 2WETA 1IUUA 3F8DA 5JCKA 3RP6A 2GR0A 1ZP0A 4EQSA 2A87A 3AB1A 4H4QA 1JRYA 4CBQA 2C70A 2QA2A 1E1KA 2C76A 3AEAA 3RHAA 3VR8A 5C2TA 4KPRA 2E1MA 2FJBA 2YM1A 4O5QA 4G9KA 4OPUA 2XVEA 5EB5A 2OLNA 2I0ZA 2GQFA 3CIRA 3T37A 2WOWA 2XFOA 3AE8A 3NGCX 2ZZCA 3BNMA 2QA1A 1DODA 1GESA 1Q1RA 1GRFA 3H8LA 3B6DA 2BC1A 2EQ7A 2IVDA 3UTHA 1Y56A 1VRQB 1EL9A 2YWLA 3AE9A 4K5SA 1GEUA 4IVMB 2WP6A 1NAAA 1NHRA 1GTHA 2GMJA 1K4QA 4I58A 4NWZA 3OC4A 1E7PA 5KRQA 3GRSA 4JQ9A 5M10A 2WQYA 4Y4MA 5GSNA 1Y0PA 4A5LA 3ICTA 2YLZA 2EQ8A 1YQZA 3AEEA 3O0HA 1CBOA 2C65A 3KU9A 4Z2RA 2YVGA 4YXDA 3AE1A 4NEVA 1OJ9A 2ZZBA 1O5WA 4USRA 4Z24A 1LV0A 2YR6A 4LA1A 2XVJA 5KVHA 1D5TA 3ATRA 1D4DA 3PO7A 2WEUA 4LU6A 1L9EA 1PBBA 4BJYA 4JNQA 1M64A 2XDOA 4YT0A 1GV4A 1DNCA 4YTNA 2YM2A 3F8RA 4Y4NA 2JBVA 2WP9A 5JCIA 3FBSA 1TDKA 2YLSA 2FJAA 4BV6A 4H4PA 5FMHA 3GWFA 2C3DA 1ZKQA 4Z2UA 2YVJA 4J2WA 4B66A 4AOXA 1CHUA 2R0PA 3RP7A 1PHHA 1KF6A 2DKHA 3KKJA 3C4NA 2RABA 1EL5A 4H4RA 1F3PA 4JDRA 1BKWA 3WE0A 4A9WA 1IJHA 3CNSA 3GRTA 3I3LA 2XVHA 2GMHA 1Q1WA 4G73A 2XCGA 1XPQA 5BULA 1ZY8A 1PN0A 3NK1X 4U2TA 1GXFA 1XHCA 1PXAA 4DGKA 1DOCA 2WHDA 3ALLA 1W4XA 3DJGX 2OA1A 1LQUA 1GRTA 1CJ4A 2OLOA 4II2A 2YG5A 1H86A 3PS9A 1B5QA 4Z43A 3VQRA 4C3YA 1ONFA 3CGCA 2B9WA 2YG7A 4YWOA 5KMPA 1HYUA 5KNLA 2WS3A 4OPTA 4GRTA 1CC6A 2VVLG 1IUXA 4EMJA 4YKFA 2X8GA 4TLZA 3KPFA 2JB3A 4HB9A 1GRHA 1YQ4A 3ZDNA 2BCGG 4TLXA 4CCRA 3L1RA 4H4WA 2WDRA 3GDNA 4U8NA 3IWAA 2PHHA 3T2YA 5HHFA 3VRDB 3B3RA 5J7XA 3UP5A 2Z5YA 2EQ6A 1CJ3A 4DSHA 4K2XA 4CCQA 1CJ2A 3SFDA 1M6IA 3FG2P 3AEGA 3AECA 1GREA 5U25A 2F5ZA 1GOSA 3SQPA 2YG3A 3T31A 3QVRA 1NPXA 1H7XA 2GR1A 1D7LA 1E39A 4ZCCA 2NPXA 2C67A 2YLRA 2J3NA 2WPCA 1GPEA 3R9UA 1VDCA 3M0OA 5KMRA 1QJDA 1IUTA 2VVMA 5KXJA 1F8WA 4AT2A 4XWRA 4J31A 2WOVA 4H4UA 3KA7A 4A99A 3DK8A 4IVOB 1DJNA 1ELIA 3V3NA 1LVLA 3IC9A 3K30A 4TM0A 1GT8A 5KOXA 4H2RA 4OVIA 5CKUA 1KSUA 2V5ZA 2BC0A 5JCNA 2RGHA 2XYOA 3CNTA 1F6MA 3AD8B 3UOXA 3AE4A 1E6EA 1ZK7A 1PBFA 4GF7A 3BHKA 4H2NA 3S61A 1N4UA 3LZXA 3GMBA 4AP3A 2YG6A 2FJEA 3P4PA 4UDPA 1EL8A 2BS4A 3CGEA 3DK9A 2QAEA 2YR4A 4NZHA 4NTEA 3ABVA 2RGOA 4Z26A 4D03A 1JU2A 1OJAA 3CGBA 1B8SA 1KN0A 5GRTA 1QLBA 3LB8A 2WESA 2BACA 3UKQA 4PABA 2V3AA 1VG9A 3NKSA 2QCUA 3NTDA 1D7YA 1NG4A 3BI4A 3SXIA 1FL2A 3L5OA 2Q7VA 3DJDA 3K7TA 4A65A 3QSMA 4J56A 3RNMA 4GAPA 1S3BA 2AQJA 5JCMA 4IV9A 3DH9A 4G6HA 2X8HA 1TDFA 3ISHA 4HA6A 3AYIA 4EQRA 1Y56B 4YTPA 3E1TA 2GRTA 2GAHB 2XLTA 1XDIA 2A89A 1GNDA 3NK2X 3CNJA 4USQA 3UOYA 4A79A 1OJDA 3L8KA 2OALA 2APGA 4CY6A 1TDOA 2C64A 3NNEA 3ZYXA 1TYTA 4U8IA 4EIPA 4YKGA 1H82A 3CN8A 4BK2A 3QFAA 4XWZA 1TDEA 1N1PA 2ZBWA 3GYJA 1PDHA 3NIXA 2BK3A 3ITJA 2VOUA 4J57A 2X8CA 3ADAB 3HYXA 3DGZA 1IUWA 4N9XA 1BF3A 4G6GA 4ECHA 4NTCA 1NENA 3UKHA 3UCLA 2XLUA 3M13A 4H2QA 4DSGA 2GR3A 2JAEA 4GUVA 5HY5A 5KWFA 3PG6A 1IUSA 1RP0A 4EM4A 2BK4A 2VQ7A 1H6VA 1NG3A 2XLPA 1S2QA 1FCDA 5BUKA 3NG7X 2EQ9A 3QFBA 1MO9A 2GAGB 4M52A 4OPLA 3GMCA 4EQWA 3SY4A 2JK6A 1ZMDA 2JB2A 1B4VA 4K5RA 3SX6A 2JB1A 2E5VA 3EANA 1GETA 1ZX9A 3SZWA 2AR8A 3V76A 4BK3A 3BNUA 2TMDA 3NN0X 3D1CA 2W0HA 1QO8A 3NH3X 3AD9B 2FJDA 2VRMA 2GF3A 3G5SA 4LIIA 4KX6A 5J60A 2XVIA 3URHA 1LTXR 2YQUA 1JRXA 2YAUA 1F8SA 2PYXA 3D9XA 1Z6LA 3HYVA 2BA9A 2WDVA 1SEZA 2WOIA 4U8PA 2Q0LA 4CY8A 2Y6QA 3T0KA 5ER0A 4EMIA 1REOA 3DJEA 1B37A 2BXSA 4OPCA 3JSKA 2WDQA 2BS3A 2CULA 2VZ2A 2BK5A 4TM1A 1PJ7A 1JEHA 5L46A 3LZWA 3AE2A 3HZLA 1E1NA 3P4QA 2R4JA 3Q6JA 3RP8A 3K7MX 2YLXA 3GSIA 3NRNA 2Y6RA 4C74A 2C66A 4TM3A 3AE3A 4U8MA 3UKKA 5KMSA 2CDUA 1VQWA 1K0JA 4FX9A 2BS2A 1NHQA 2BCPA 4APNA 1PBEA 1EBDA 4U8JA 2C73A 1DOEA 2YLWA 1GALA 2YG4A 3FMWA 3BI5A 2O9ZA 3NT6A 3VR9A 1S3EA 1O94A 1FEAA 2V3BA 3AWIA 2GQWA 3IHMA 4X9NA 1JNRA 4BK1A 1NDAA 2V60A 1CL0A 1F8RA 3UKLA 1UKVG 3REDA 1YKJA 2C7GA 3COXA 3F8PA 4YSYA 1KFYA 3DGHA 3AEFA 4OPDA 4U2SA 1PBCA 3SZCA 3PVCA 4NNJA 1VG0A 2GB0A 1JRZA 3G5QA 4Z44A 3GD4A 3UKFA 1D4CA 3OZ2A 3QVPA 2IIDA 4RG4A 2R9ZA 3Q9TA 3ICSA 4U8KA 4ZCDA 4AP1A 1LPFA 4A6NA 3DA1A 1PXCA 4P9SA 1YY5A 2X3NA 2CVJA 3GD3A 3AXBA 1P2HA 3NK0X 4FK1A 3QSSA 2B9XA 1IUVA 2ARDA 4MJWA 4U2LA 3T2ZA 5BVAA 1DOBA 2BYBA 4A6NB 4ICYA 4A7AA 4B69A 4Z25A 4OPGA 2RGJA 3II4A 1RSGA 3AE7A 4H4ZA 1COYA 3CPIG 4H4SA 3HYWA 5KMQA 1DJQA 5FS7A 2XFUA 3UP4A 5HXIA 4EQXA 2VQBA 2C4CA 2AAQA 3V3OA 4FK1C 3EAOA 3SZ0A 2XLSA 1CJCA 4ADWA 1MXTA 4H2PA 5CQFA 3UTFA 4I59A 1BZLA 3CMMA 4II3A 4C77A 5BRTA 3FPZA 4CNKA 4IA5A 3AE5A 3AEDA 2GR2A 1FOHA 4EM3A 1ZMCA 2B9YA 2WU2A 3DMEA 3QJ4A 4GDEA 4B68A 3NHOX 4CRTA 3UKAA 3FIMB 1H7WA 3ALMA 1L9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PXB A;  1FEB A;  3GWD A;  1LQT A;  4NEW A;  5KOW A;  3NTA A;  4YSX A;  2V6O A;  1KSS A;  4BUR A;  4CNJ A;  1AOG A;  2A8X A;  2Q0K A;  2XFP A;  3EF6 A;  4E0V A;  4B67 A;  2XFQ A;  3NN6 X;  2R0C A;  5FS8 A;  3BI2 A;  3CPH G;  4Z2T A;  1PBD A;  2XLR A;  1Q9I A;  3UOZ A;  3AYJ A;  3C4A A;  1V59 A;  4FDC B;  4J33 A;  1OJT A;  4UP3 A;  2WP5 A;  2GH5 A;  3KLJ A;  1H84 A;  1JOA A;  2ZZ0 A;  4UDQ A;  4XXG A;  1BGN A;  4REK A;  4NTD A;  3I6D A;  3VRA A;  2NVK X;  4JN9 A;  1D4E A;  2VRL A;  3P4R A;  3CPJ G;  3SFE A;  4IA6 A;  3UTE A;  1S2Y A;  4DNA A;  3DJJ A;  1BWC A;  3P1W A;  4C5O A;  2CFY A;  1E1L A;  1KNP A;  2R45 A;  5LV9 A;  2GEW A;  2WU5 A;  5TR3 A;  1PJ6 A;  2OAM A;  2JKC A;  5IQ1 A;  3AEB A;  4C3X A;  2B7S A;  3M12 A;  1O95 A;  1KDG A;  4OCG A;  2B76 A;  2HQM A;  1H81 A;  2V61 A;  1TYP A;  4B63 A;  2WBA A;  2XFN A;  3NYF A;  1ZDL A;  2B7R A;  3SGL A;  4OPI A;  2BAB A;  2DKI A;  2E4G A;  4H4X A;  5C3J A;  2C72 A;  4AOS A;  3ALJ A;  2H88 A;  2YLT A;  5DBJ A;  3NYC A;  4H4V A;  2WPE A;  5U1O A;  1CC2 A;  2GVC A;  3LJP A;  1GTE A;  1GRB A;  1NHS A;  4Y4L A;  4GDP A;  2R0G A;  3GYI A;  1PJ5 A;  2BXR A;  4ZN0 A;  3IHG A;  3QSE A;  4U8L A;  3S5W A;  4H4T A;  3P4S A;  1YQ3 A;  2GV8 A;  4BJZ A;  2R4E A;  3K7Q X;  1OJC A;  4JY3 A;  4X9M A;  4YSH A;  3DK4 A;  1X31 B;  2X50 A;  4K22 A;  4WCT A;  3UKP A;  4UDR A;  3H4K A;  1LJ1 A;  1P2E A;  1PS9 A;  2UZZ A;  3AE6 A;  3P9U A;  4PAA A;  4GCM A;  5EOW A;  3LOV A;  1GSN A;  5JCL A;  1DXL A;  3LAD A;  2TPR A;  2YR5 A;  1N4V A;  3AYL A;  5M0Z A;  3NYE A;  3VRB A;  5IPY A;  1XAN A;  1CC4 A;  1NHP A;  4WX1 A;  2H89 A;  4H4Y A;  4RSL A;  5FS6 A;  3UOV A;  3ATQ A;  3EPT A;  4H7U A;  1K0L A;  3ICR A;  3SM8 A;  5IQ4 A;  3CNP A;  2WPF A;  1GRA A;  3BHF A;  2YVF A;  2C3C A;  4RG3 A;  1L0V A;  1BGJ A;  4J36 A;  3C96 A;  2IVE A;  4D04 A;  4B65 A;  2R46 A;  1JNZ A;  2C75 A;  3CTY A;  4JNA A;  4YTM A;  4O5U A;  2VVL A;  4B64 A;  1ZOV A;  4K7Z A;  1FEC A;  1KNR A;  4EIQ A;  4YSZ A;  1RYI A;  3CND A;  2FBW A;  4X4J A;  5KVI A;  5EB4 A;  1E1M A;  1H83 A;  4TM4 A;  3KD9 A;  3CGD A;  1ZOY A;  4JY2 A;  4EMW A;  2Q6U A;  3GDP A;  1EL7 A;  3NLC A;  5FS9 A;  1TRB A;  1GRG A;  3D8X A;  5U63 A;  4K8D A;  2Z5X A;  2XVF A;  2X99 A;  1K0I A;  2ACZ A;  1TDN A;  1GER A;  1L9D A;  1CF3 A;  3AD7 B;  3G5R A;  3IF9 A;  4B1B A;  1N4W A;  1NEK A;  3H8I A;  4U8O A;  5EBK A;  3LXD A;  4H50 A;  3UTG A;  5HYM A;  3KVE A;  4J34 A;  4GR1 A;  1MOK A;  2WET A;  1IUU A;  3F8D A;  5JCK A;  3RP6 A;  2GR0 A;  1ZP0 A;  4EQS A;  2A87 A;  3AB1 A;  4H4Q A;  1JRY A;  4CBQ A;  2C70 A;  2QA2 A;  1E1K A;  2C76 A;  3AEA A;  3RHA A;  3VR8 A;  5C2T A;  4KPR A;  2E1M A;  2FJB A;  2YM1 A;  4O5Q A;  4OPU A;  5EB5 A;  2XVE A;  2OLN A;  2I0Z A;  2GQF A;  3CIR A;  3T37 A;  2WOW A;  2XFO A;  3AE8 A;  3NGC X;  2ZZC A;  3BNM A;  2QA1 A;  1DOD A;  1GES A;  1Q1R A;  1GRF A;  3H8L A;  3B6D A;  2BC1 A;  2EQ7 A;  2IVD A;  3UTH A;  1Y56 A;  1VRQ B;  1EL9 A;  2YWL A;  3AE9 A;  4K5S A;  1GEU A;  4IVM B;  2WP6 A;  1NAA A;  1NHR A;  1GTH A;  2GMJ A;  1K4Q A;  4I58 A;  3OC4 A;  1E7P A;  5KRQ A;  3GRS A;  4JQ9 A;  5M10 A;  2WQY A;  4Y4M A;  5GSN A;  1Y0P A;  4A5L A;  3ICT A;  2YLZ A;  2EQ8 A;  1YQZ A;  3AEE A;  3O0H A;  1CBO A;  2C65 A;  3KU9 A;  4Z2R A;  2YVG A;  4YXD A;  3AE1 A;  4NEV A;  1OJ9 A;  2ZZB A;  1O5W A;  4USR A;  4Z24 A;  1LV0 A;  2YR6 A;  4LA1 A;  2XVJ A;  5KVH A;  1D5T A;  3ATR A;  1D4D A;  3PO7 A;  2WEU A;  4LU6 A;  1L9E A;  1PBB A;  4BJY A;  4JNQ A;  1M64 A;  2XDO A;  4YT0 A;  1GV4 A;  1DNC A;  4YTN A;  2YM2 A;  3F8R A;  4Y4N A;  2JBV A;  2WP9 A;  5JCI A;  3FBS A;  1TDK A;  2YLS A;  2FJA A;  4BV6 A;  4H4P A;  5FMH A;  3GWF A;  2C3D A;  1ZKQ A;  4Z2U A;  2YVJ A;  4J2W A;  4B66 A;  4AOX A;  1CHU A;  2R0P A;  3RP7 A;  1PHH A;  1KF6 A;  2DKH A;  3KKJ A;  3C4N A;  2RAB A;  1EL5 A;  4H4R A;  1F3P A;  4JDR A;  1BKW A;  3WE0 A;  4A9W A;  1IJH A;  3CNS A;  3GRT A;  3I3L A;  2XVH A;  2GMH A;  1Q1W A;  2XCG A;  1XPQ A;  5BUL A;  1ZY8 A;  1PN0 A;  3NK1 X;  4U2T A;  1GXF A;  1XHC A;  1PXA A;  4DGK A;  1DOC A;  2WHD A;  3ALL A;  1W4X A;  3DJG X;  2OA1 A;  1LQU A;  1GRT A;  1CJ4 A;  2OLO A;  2YG5 A;  1H86 A;  3PS9 A;  1B5Q A;  4Z43 A;  3VQR A;  4C3Y A;  1ONF A;  3CGC A;  2B9W A;  2YG7 A;  4YWO A;  1HYU A;  2WS3 A;  4OPT A;  4GRT A;  1CC6 A;  2VVL G;  1IUX A;  4EMJ A;  4YKF A;  2X8G A;  4TLZ A;  3KPF A;  2JB3 A;  4HB9 A;  1GRH A;  1YQ4 A;  3ZDN A;  2BCG G;  4TLX A;  4CCR A;  3L1R A;  4H4W A;  2WDR A;  3GDN A;  4U8N A;  3IWA A;  2PHH A;  5HHF A;  3VRD B;  3B3R A;  5J7X A;  3UP5 A;  2Z5Y A;  2EQ6 A;  1CJ3 A;  4DSH A;  4K2X A;  4CCQ A;  1CJ2 A;  3SFD A;  1M6I A;  3FG2 P;  3AEG A;  3AEC A;  1GRE A;  5U25 A;  2F5Z A;  1GOS A;  3SQP A;  2YG3 A;  3QVR A;  1NPX A;  1H7X A;  2GR1 A;  1D7L A;  1E39 A;  4ZCC A;  2NPX A;  2C67 A;  2YLR A;  2J3N A;  2WPC A;  1GPE A;  3R9U A;  1VDC A;  3M0O A;  1QJD A;  1IUT A;  2VVM A;  5KXJ A;  1F8W A;  4AT2 A;  4XWR A;  4J31 A;  2WOV A;  4H4U A;  3KA7 A;  4A99 A;  3DK8 A;  4IVO B;  1DJN A;  1ELI A;  3V3N A;  1LVL A;  3IC9 A;  3K30 A;  4TM0 A;  1GT8 A;  5KOX A;  4H2R A;  4OVI A;  5CKU A;  1KSU A;  2V5Z A;  2BC0 A;  5JCN A;  2RGH A;  2XYO A;  3CNT A;  1F6M A;  3AD8 B;  3UOX A;  3AE4 A;  1E6E A;  1ZK7 A;  1PBF A;  4GF7 A;  3BHK A;  4H2N A;  3S61 A;  1N4U A;  3LZX A;  3GMB A;  4AP3 A;  2YG6 A;  2FJE A;  3P4P A;  4UDP A;  1EL8 A;  2BS4 A;  3CGE A;  3DK9 A;  2QAE A;  2YR4 A;  4NZH A;  4NTE A;  3ABV A;  2RGO A;  4Z26 A;  4D03 A;  1JU2 A;  1OJA A;  3CGB A;  1B8S A;  5GRT A;  1QLB A;  3LB8 A;  2WES A;  2BAC A;  3UKQ A;  4PAB A;  2V3A A;  1VG9 A;  3NKS A;  2QCU A;  3NTD A;  1D7Y A;  1NG4 A;  3BI4 A;  1FL2 A;  3DJD A;  2Q7V A;  3K7T A;  4A65 A;  4J56 A;  3RNM A;  1S3B A;  2AQJ A;  5JCM A;  4IV9 A;  3DH9 A;  2X8H A;  1TDF A;  3ISH A;  4HA6 A;  3AYI A;  4EQR A;  1Y56 B;  4YTP A;  3E1T A;  2GRT A;  2GAH B;  2XLT A;  1XDI A;  2A89 A;  1GND A;  3NK2 X;  3CNJ A;  4USQ A;  3UOY A;  4A79 A;  1OJD A;  3L8K A;  2OAL A;  2APG A;  4CY6 A;  1TDO A;  2C64 A;  3NNE A;  3ZYX A;  1TYT A;  4U8I A;  4EIP A;  4YKG A;  1H82 A;  3CN8 A;  4BK2 A;  3QFA A;  4XWZ A;  1TDE A;  1N1P A;  2ZBW A;  3GYJ A;  1PDH A;  3NIX A;  2BK3 A;  3ITJ A;  2VOU A;  4J57 A;  2X8C A;  3ADA B;  4N9X A;  3DGZ A;  1IUW A;  1BF3 A;  4ECH A;  4NTC A;  1NEN A;  3UKH A;  3UCL A;  2XLU A;  3M13 A;  4H2Q A;  4DSG A;  2GR3 A;  2JAE A;  4GUV A;  5HY5 A;  5KWF A;  1IUS A;  1RP0 A;  4EM4 A;  2BK4 A;  2VQ7 A;  1H6V A;  1NG3 A;  2XLP A;  1S2Q A;  1FCD A;  5BUK A;  3NG7 X;  2EQ9 A;  3QFB A;  1MO9 A;  2GAG B;  4M52 A;  4OPL A;  3GMC A;  4EQW A;  2JK6 A;  1ZMD A;  2JB2 A;  1B4V A;  4K5R A;  2JB1 A;  2E5V A;  3EAN A;  1GET A;  1ZX9 A;  3V76 A;  2AR8 A;  4BK3 A;  3BNU A;  2TMD A;  3NN0 X;  3D1C A;  2W0H A;  1QO8 A;  3NH3 X;  3AD9 B;  2FJD A;  2VRM A;  2GF3 A;  3G5S A;  4LII A;  4KX6 A;  5J60 A;  2XVI A;  3URH A;  1LTX R;  2YQU A;  1JRX A;  2YAU A;  1F8S A;  2PYX A;  1Z6L A;  3QSM A;  4AT0 A;  2BA9 A;  2WDV A;  1SEZ A;  2WOI A;  4U8P A;  2Q0L A;  4CY8 A;  2Y6Q A;  5ER0 A;  4EMI A;  1REO A;  3DJE A;  1B37 A;  2BXS A;  4OPC A;  3JSK A;  2WDQ A;  2BS3 A;  2CUL A;  2VZ2 A;  2BK5 A;  4TM1 A;  1PJ7 A;  1JEH A;  5L46 A;  3LZW A;  3AE2 A;  3HZL A;  1E1N A;  3P4Q A;  2R4J A;  3Q6J A;  3RP8 A;  3K7M X;  2YLX A;  3GSI A;  3NRN A;  2Y6R A;  4C74 A;  2C66 A;  4TM3 A;  3AE3 A;  4U8M A;  3UKK A;  2CDU A;  1VQW A;  1K0J A;  4FX9 A;  2BS2 A;  1NHQ A;  2BCP A;  4APN A;  1PBE A;  1EBD A;  4U8J A;  2C73 A;  1DOE A;  2YLW A;  1GAL A;  2YG4 A;  3FMW A;  3BI5 A;  2O9Z A;  3NT6 A;  3VR9 A;  1S3E A;  1O94 A;  1FEA A;  2V3B A;  3AWI A;  2GQW A;  3IHM A;  4X9N A;  1JNR A;  4BK1 A;  1NDA A;  2V60 A;  1CL0 A;  1F8R A;  3UKL A;  1UKV G;  3RED A;  1YKJ A;  2C7G A;  3COX A;  3F8P A;  4YSY A;  1KFY A;  3DGH A;  3AEF A;  4OPD A;  4U2S A;  1PBC A;  3PVC A;  1VG0 A;  2GB0 A;  1JRZ A;  3G5Q A;  4Z44 A;  3GD4 A;  3UKF A;  1D4C A;  3OZ2 A;  3QVP A;  2IID A;  4RG4 A;  2R9Z A;  3Q9T A;  3ICS A;  4U8K A;  4ZCD A;  4AP1 A;  1LPF A;  4A6N A;  3DA1 A;  1PXC A;  4P9S A;  1YY5 A;  2X3N A;  2CVJ A;  3GD3 A;  3AXB A;  1P2H A;  3NK0 X;  4FK1 A;  3QSS A;  2B9X A;  1IUV A;  2ARD A;  4MJW A;  4U2L A;  5BVA A;  1DOB A;  2BYB A;  4A6N B;  4ICY A;  4A7A A;  4B69 A;  4Z25 A;  4OPG A;  2RGJ A;  3II4 A;  1RSG A;  3AE7 A;  4H4Z A;  1COY A;  3CPI G;  4H4S A;  3UP4 A;  1DJQ A;  5FS7 A;  2XFU A;  5HXI A;  4EQX A;  2VQB A;  2AAQ A;  3V3O A;  4FK1 C;  3EAO A;  2XLS A;  1CJC A;  4ADW A;  1MXT A;  4H2P A;  5CQF A;  3UTF A;  4I59 A;  1BZL A;  4C77 A;  5BRT A;  3FPZ A;  4CNK A;  4IA5 A;  3AE5 A;  3AED A;  2GR2 A;  1FOH A;  4EM3 A;  1ZMC A;  2B9Y A;  2WU2 A;  3DME A;  3QJ4 A;  4GDE A;  4B68 A;  3NHO X;  4CRT A;  3UKA A;  3FIM B;  1H7W A;  3ALM A;  1L9C A; 
#chains in the Genus database with same CATH topology
 3GWD A;  4NEW A;  2V6O A;  1KSS A;  1N5W C;  4E0V A;  1FO4 A;  1PBD A;  3AYJ A;  3H7V A;  1OJT A;  4NTD A;  4G74 A;  3SZF A;  2PP0 A;  4M6U A;  4Z17 A;  1S2Y A;  3T2K A;  3P1W A;  1E1L A;  5LV9 A;  2GEW A;  5TR3 A;  3R25 A;  2JKC A;  1RVK A;  2HQM A;  4HNL A;  5FJT A;  3OPS A;  2PA6 A;  3NYF A;  3SGL A;  2BRY A;  1EC8 A;  3H70 A;  4AOS A;  3ALJ A;  4HYR A;  5U1O A;  2GVC A;  1SJB A;  1GTE A;  4K2S A;  1NHS A;  4Y4L A;  2PMQ A;  4ZN0 A;  2BXR A;  4U8L A;  4G8T A;  3GO2 A;  4H4T A;  2R4E A;  3K7Q X;  5FJR A;  3KPK A;  4GAV A;  3FXG A;  1LJ1 A;  2QQ6 A;  4H2H A;  3LAD A;  3AYL A;  3GYX A;  2HXU A;  3JVA A;  3VRB A;  5IPY A;  2H89 A;  5FS6 A;  3UOV A;  3JZU A;  3SM8 A;  3CNP A;  2C3C A;  3MSY A;  4RG3 A;  1L0V A;  1DTN A;  2R46 A;  4YTM A;  4B64 A;  1ZOV A;  4EIQ A;  3CB3 A;  1RYI A;  2FBW A;  3UXL A;  3DER A;  3ZLF A;  2XGZ A;  1ZOY A;  1PDZ A;  5FS9 A;  3D8X A;  4K8D A;  3RO6 A;  1TDN A;  1T3Q C;  3SSZ A;  3VDG A;  1NEK A;  3H8I A;  4U8O A;  3ENL A;  4H50 A;  3UTG A;  2OO6 A;  2OX4 A;  5HYM A;  5JCK A;  4EQS A;  4CBQ A;  2C70 A;  2QA2 A;  3VR8 A;  4KPR A;  2E1M A;  2FJB A;  3MUC A;  2OLN A;  1FFU C;  2WOW A;  2XFO A;  2PGE A;  2ZZC A;  4DN1 A;  1DOD A;  4K8G A;  3H8L A;  4J3Z A;  3H12 A;  1P43 A;  1EL9 A;  4IVM B;  1ZXI C;  1NHR A;  1GTH A;  3OC4 A;  4JQ9 A;  2POD A;  2FYM A;  4A3R A;  3O0H A;  3KU9 A;  3UCC A;  3UGV A;  1O5W A;  1LV0 A;  5KVH A;  3I6E A;  3NXL A;  4YTN A;  4G7F A;  2FJA A;  3OP2 A;  4H4P A;  1EC9 A;  3UJF A;  4J2W A;  1CHU A;  1MNS A;  3C4N A;  1EL5 A;  4H4R A;  3B97 A;  3CXO A;  1VDV A;  2XVH A;  5BUL A;  1ZY8 A;  3NK1 X;  2RDX A;  1W4X A;  1CJ4 A;  2YG5 A;  3PS9 A;  3TOY A;  1ONF A;  5KMP A;  2WS3 A;  4GRT A;  3V5F A;  1P48 A;  2BCG G;  4TLX A;  4H4W A;  2WDR A;  4U8N A;  5HHF A;  3VRD B;  3B3R A;  1CJ3 A;  3AEG A;  1SJD A;  4E5T A;  1MDR A;  2GR1 A;  4IP4 A;  1GPE A;  3M0O A;  3U9I A;  5KMR A;  1F8W A;  4J31 A;  3BOX A;  1DJN A;  4TM0 A;  1GT8 A;  5KOX A;  1PDY A;  3CNT A;  1F6M A;  1ZK7 A;  4GF7 A;  3BHK A;  2P3Z A;  3DEQ A;  2FJE A;  3IJI A;  2GL5 A;  1JU2 A;  1B8S A;  4K1W A;  1X2G A;  1QLB A;  2WES A;  3UKQ A;  1YEY A;  3DJD A;  2AQJ A;  4IV9 A;  3DH9 A;  3AYI A;  4EQR A;  2OPJ A;  3E1T A;  1XDI A;  2A89 A;  3FVD A;  5BOE A;  4USQ A;  3UOY A;  1OJD A;  2C64 A;  3ZYX A;  4YKG A;  3S5S A;  5FJU A;  3QFA A;  3NIX A;  1EC7 A;  4JHM A;  2XLU A;  4DSG A;  2GR3 A;  1IUS A;  3P0W A;  2VQ7 A;  1FCD A;  3GMC A;  4EQW A;  1ZMD A;  2JB2 A;  2OFJ A;  1B4V A;  3QLD A;  2TMD A;  3NN0 X;  4IHC A;  3DFH A;  3CXB A;  2GF3 A;  2GGJ A;  3PFR A;  1LTX R;  1TKK A;  2PYX A;  3HYV A;  1F8S A;  3D9X A;  2BA9 A;  4TVW A;  1JPD X;  3IJQ A;  4CY8 A;  3T0K A;  3DJE A;  3Q45 A;  2CUL A;  2VZ2 A;  2BK5 A;  4TM1 A;  1OEP A;  3Q6J A;  2YLX A;  4C74 A;  4TM3 A;  1NEL A;  1JCT A;  5KMS A;  2PGW A;  1VQW A;  2BCP A;  4APN A;  1EBD A;  2C73 A;  1GAL A;  3FMW A;  3BI5 A;  2O9Z A;  1S3E A;  1O94 A;  2V3B A;  4H83 A;  2GQW A;  3AWI A;  4X9N A;  1BKH A;  4BK1 A;  3NFU A;  1CL0 A;  3NVV B;  1YKJ A;  3F8P A;  1KFY A;  3AEF A;  3SZC A;  1VG0 A;  1JRZ A;  1EBG A;  4U8K A;  4ZCD A;  3Q9T A;  3ICS A;  4AP1 A;  1PXC A;  1KD0 A;  2OLA A;  4FK1 A;  3NK0 X;  3TWB A;  1IUV A;  4A7A A;  2RGJ A;  3ZVH A;  2XFU A;  5HXI A;  4EQX A;  2VQB A;  5BRT A;  1JPM A;  3DME A;  2B9Y A;  1ZMC A;  3V4B A;  3NHO X;  4CRT A;  3QSE A;  1L9C A;  3NTA A;  2Q0K A;  3EF6 A;  3NN6 X;  3CPH G;  1KCZ A;  3C4A A;  4FDC B;  2ZZ0 A;  3V3W A;  1BGN A;  3VRA A;  2VRL A;  3P4R A;  4E4F A;  1BWC A;  4C5O A;  1PJ6 A;  3OTR A;  5IQ1 A;  1O95 A;  1KDG A;  4OCG A;  1H81 A;  2V61 A;  1TYP A;  2AL2 A;  3PWI A;  4H4X A;  3V5C A;  2C72 A;  1SJC A;  2H88 A;  3NYC A;  2QDE A;  3LJP A;  2R0G A;  3IHG A;  3S5W A;  3TCS A;  3SYI A;  3P4S A;  2GV8 A;  4BJZ A;  1OJC A;  4JY3 A;  4X9M A;  1L8P A;  4HCD A;  4UDR A;  4GCM A;  1DXL A;  3BSM A;  2TPR A;  2PSN A;  3NYE A;  5JRB A;  3NVY B;  3R07 C;  3EPT A;  1K0L A;  4J36 A;  2HZG A;  4D04 A;  3DG7 A;  1JNZ A;  4O5U A;  2VVL A;  4YSZ A;  3CND A;  1H83 A;  3UJ2 A;  3KD9 A;  1KKR A;  3GDP A;  1TRB A;  1GRG A;  5U63 A;  2XVF A;  2X99 A;  2PTY A;  3MQT A;  1N4W A;  3NVZ B;  3KVE A;  4J34 A;  1MOK A;  2WET A;  1IUU A;  2GR0 A;  1JRY A;  1E1K A;  3AEA A;  1N63 C;  5C2T A;  2PPG A;  5EB5 A;  2YM1 A;  3VA8 A;  2XH4 A;  3AE8 A;  3NGC X;  3BNM A;  5EU9 A;  3UTH A;  1Y56 A;  3DIP A;  3HRD C;  3AE9 A;  3QPE A;  4K5S A;  2WP6 A;  1NAA A;  3CK5 A;  2GMJ A;  1FHU A;  2OZ8 A;  3KUM A;  4NWZ A;  3GY1 A;  2PU0 A;  2WQY A;  5GSN A;  1Y0P A;  3TTE A;  3OZY A;  2YLZ A;  2EQ8 A;  3AEE A;  1OJ9 A;  2ZZB A;  2YR6 A;  4LA1 A;  1PBB A;  4BJY A;  4JNQ A;  2WP9 A;  5FMH A;  2C3D A;  1ZKQ A;  4Z2U A;  2YVJ A;  2OZ3 A;  3RP7 A;  1PHH A;  1KF6 A;  1EBH A;  1F3P A;  2HNE A;  1BKW A;  3WE0 A;  3GRT A;  3I3L A;  2XCG A;  1XPQ A;  1SJA A;  1XHC A;  1N61 C;  3ALL A;  1GRT A;  4II2 A;  4C3Y A;  2B9W A;  4OPT A;  2VVL G;  2OVL A;  4IL2 A;  3KPF A;  4HB9 A;  2AKZ A;  3SR6 B;  4EWJ A;  3GDN A;  5J7X A;  2Z5Y A;  4DSH A;  5U25 A;  2F5Z A;  2YG3 A;  3T31 A;  3QVR A;  2E3T A;  1E39 A;  4ZCC A;  4H4U A;  3KA7 A;  4A99 A;  4MKS A;  1ELI A;  3V3N A;  3K30 A;  4H2R A;  4OVI A;  2RGH A;  3UOX A;  3SBF A;  3CAW A;  1N4U A;  4UDP A;  3CGE A;  3DK9 A;  2YR4 A;  4NZH A;  3ABV A;  2RGO A;  4D03 A;  3LB8 A;  4KPL A;  3NKS A;  2QCU A;  1D7Y A;  1NG4 A;  3BI4 A;  3SXI A;  3K7T A;  5JCM A;  1TDF A;  3PWG A;  4HN8 A;  2XLT A;  3EUB 3;  3NK2 X;  3CNJ A;  4CY6 A;  3R10 A;  4U8I A;  4EIP A;  3N4F A;  1H82 A;  3CN8 A;  4BK2 A;  4XWZ A;  3GYJ A;  1PDH A;  3ITJ A;  4J57 A;  3HYX A;  4NTC A;  3M13 A;  3SN4 A;  2JAE A;  4GUV A;  5KWF A;  3NG7 X;  2GAG B;  4OPL A;  4JN8 A;  2JB1 A;  3BNU A;  3D1C A;  1QO8 A;  3NH3 X;  2VRM A;  3G5S A;  2OQH A;  4LII A;  4KX6 A;  3P93 A;  2YQU A;  1Z6L A;  4U8P A;  1SEZ A;  2WOI A;  5ER0 A;  4EMI A;  3JSK A;  3JW7 A;  1PJ7 A;  3AM9 A;  3LZW A;  3HZL A;  2CHR A;  2Y6R A;  2HXT A;  2PP1 A;  3MWC A;  3AE3 A;  2GGE A;  3UKK A;  1K0J A;  4FX9 A;  2BS2 A;  2P88 A;  1NHQ A;  1PBE A;  1DOE A;  2YLW A;  2XSX A;  2DW7 A;  3IHM A;  1JNR A;  1F8R A;  2GGG A;  3COX A;  4OPD A;  4JN7 A;  3EEZ A;  3PVC A;  2GB0 A;  4H19 A;  3FV9 A;  2IID A;  2R9Z A;  4P9S A;  2X3N A;  3GD3 A;  4MJW A;  4U2L A;  3T2Z A;  1DOB A;  4Z25 A;  4H4Z A;  1ECQ A;  1COY A;  4H4S A;  3HPF A;  2C4C A;  4FK1 C;  3SZ0 A;  2XLS A;  4ADW A;  5CQF A;  3CMM A;  3AED A;  3UCD A;  1FOH A;  4B68 A;  3UKA A;  2P0I A;  3EKG A;  1PXB A;  3T14 A;  1LQT A;  4YSX A;  2A8X A;  2XFP A;  2XFQ A;  5FS8 A;  3BI2 A;  4Z2T A;  2XLR A;  4GGH A;  4J33 A;  2WP5 A;  2GH5 A;  1S7M A;  4UDQ A;  1JOA A;  4XXG A;  3A7U A;  2NVK X;  4JN9 A;  1D4E A;  3CPJ G;  2GSH A;  3SFE A;  4IT1 A;  2CFY A;  3VCN A;  2QDD A;  2WU5 A;  2OAM A;  3RR1 A;  3AEB A;  1RM6 B;  4C3X A;  2B7S A;  2AL1 A;  2FKP A;  3CT2 A;  2B7R A;  2E4G A;  3T9P A;  5C3J A;  4IP5 A;  4ZCW A;  2YLT A;  4HNC A;  3I6T A;  3NRZ B;  4GDP A;  1PJ5 A;  1YQ3 A;  3TJI A;  4YSH A;  3T6C A;  4K22 A;  3UKP A;  3H4K A;  1P2E A;  3AE6 A;  2UZZ A;  1JRO A;  1GSN A;  1N4V A;  2XH7 A;  6ENL A;  1NHP A;  4E4U A;  4WX1 A;  4H4Y A;  4RSL A;  3ATQ A;  3ICR A;  5IQ4 A;  2WPF A;  1GRA A;  3DGB A;  1MUC A;  3C96 A;  4B65 A;  2C75 A;  2POZ A;  3CTY A;  1FEC A;  4GIS A;  1KNR A;  3UJR A;  3S47 A;  1H2I A;  4JY2 A;  4EMW A;  2Q6U A;  7ENL A;  1K0I A;  2ACZ A;  1GER A;  1CF3 A;  3G5R A;  3IF9 A;  2OKT A;  5EBK A;  1ELS A;  3F8D A;  1ZP0 A;  3AB1 A;  4MMW A;  4H4Q A;  4G9K A;  4A6G A;  2I0Z A;  2GQF A;  3N4E A;  3T37 A;  3R0U A;  2PCE A;  4ENL A;  3B6D A;  2EQ7 A;  1VRQ B;  3AN1 A;  1ONE A;  2PTW A;  4GFI A;  1W6T A;  4I58 A;  1E7P A;  3GRS A;  4Y4M A;  3ICT A;  2GDQ A;  3I4K A;  3AE1 A;  1STZ A;  4NEV A;  3TQP A;  4Z24 A;  3P3B A;  3SN0 A;  3ATR A;  2WEU A;  1M64 A;  2XDO A;  4YT0 A;  1DNC A;  3F8R A;  4Y4N A;  2JBV A;  3FBS A;  1TDK A;  4BV6 A;  4HPN A;  4M0X A;  3RCY A;  3VC6 A;  4DHG A;  2O56 A;  1IJH A;  2QJM A;  4G73 A;  3FYY A;  3MY9 A;  1GXF A;  1PXA A;  1DOC A;  3PK7 A;  3DJG X;  4IL0 A;  1H86 A;  4Z43 A;  3VQR A;  3CGC A;  2YG7 A;  3SN1 A;  3STP A;  1HYU A;  1IYX A;  4EMJ A;  4YKF A;  1TE6 A;  2X8G A;  4GGB A;  4TLZ A;  1GRH A;  3ZDN A;  4CCR A;  3L1R A;  2PHH A;  3T2Y A;  5IDZ A;  1R6W A;  1CJ2 A;  3SFD A;  1M6I A;  3FG2 P;  3AEC A;  3ES7 A;  1N60 C;  1GOS A;  3SQP A;  1MRA A;  3DDM A;  3SJN A;  1WYG A;  1D7L A;  2NPX A;  2C67 A;  2J3N A;  2WPC A;  2W3S A;  2VVM A;  5KXJ A;  4AT2 A;  4XWR A;  3QTP A;  3DK8 A;  4X2P A;  5FJO A;  4IVO B;  3DFY A;  1KSU A;  2BC0 A;  5JCN A;  2XYO A;  3AD8 B;  2QVH A;  1E6E A;  1PBF A;  3GMB A;  4AP3 A;  2YG6 A;  3P4P A;  1EL8 A;  2BS4 A;  4NTE A;  3CGB A;  1KN0 A;  5GRT A;  3B9J B;  2BAC A;  1VG9 A;  3NTD A;  1FL2 A;  3RIT A;  1FHV A;  4J56 A;  3RNM A;  4G6H A;  2X8H A;  3ISH A;  4YTP A;  2GRT A;  3UXK A;  3DG6 A;  3BJS A;  3ETR B;  4A79 A;  3L8K A;  3NNE A;  3R0K A;  2W3R A;  1TDE A;  2E5A A;  3QKE A;  3ADA B;  4N9X A;  1IUW A;  1BF3 A;  4ECH A;  5FJP A;  3UKH A;  4H2Q A;  3U4F A;  2NQL A;  5HY5 A;  1RP0 A;  2BK4 A;  1H6V A;  1NG3 A;  2MNR A;  2EQ9 A;  4M52 A;  3SY4 A;  3SX6 A;  4K5R A;  3SZW A;  1GET A;  2P8B A;  3NS1 B;  3K1G A;  5J60 A;  1JRX A;  2YAU A;  2WDV A;  2Q0L A;  1REO A;  1B37 A;  2WDQ A;  3SQS A;  2BS3 A;  3AE2 A;  1E1N A;  3P4Q A;  4H1Z A;  3RP8 A;  3ES8 A;  4KWS A;  4DYE A;  4U8J A;  1WUE A;  2YG4 A;  3NT6 A;  1FEA A;  1NDA A;  3UKL A;  3RED A;  3DGH A;  4F4R A;  4U2S A;  3VCC A;  3G5Q A;  4Z44 A;  4IZG A;  3GD4 A;  4RG4 A;  4A6N A;  3DA1 A;  1YY5 A;  2CVJ A;  3AXB A;  2QGY A;  2OZT A;  1P2H A;  3QSS A;  1KKO A;  2BYB A;  3UJE A;  3IJL A;  3AE7 A;  1RSG A;  3CPI G;  5KMQ A;  3UP4 A;  2AAQ A;  3V3O A;  3EAO A;  1MXT A;  3UTF A;  1BZL A;  4II3 A;  4CNK A;  4IA5 A;  3AE5 A;  3D46 A;  2WU2 A;  4GDE A;  3N6J A;  1H7W A;  3RRA A;  3ALM A;  1FEB A;  5KOW A;  4BUR A;  4CNJ A;  1AOG A;  1X2H A;  4B67 A;  2R0C A;  4ZOH B;  1Q9I A;  3UOZ A;  1V59 A;  1WUF A;  4UP3 A;  3Q4D A;  1N5X A;  3KLJ A;  1H84 A;  4REK A;  3I6D A;  3R11 A;  5G5H B;  4IA6 A;  3UTE A;  3GC2 A;  4DNA A;  3DJJ A;  1KNP A;  3HW2 A;  2R45 A;  2I5Q A;  3NVW B;  2W54 A;  3M12 A;  4YWS A;  1FIQ B;  2B76 A;  3MZN A;  4B63 A;  2WBA A;  1E9I A;  2XFN A;  1ZDL A;  4OPI A;  1V97 A;  2BAB A;  2DKI A;  2P8C A;  3H8A A;  4Z1Y A;  5DBJ A;  4H4V A;  2WPE A;  1CC2 A;  1GRB A;  4DX3 A;  3GYI A;  1FFV C;  4MGG A;  2XH0 A;  3OW1 A;  3DK4 A;  3NZG A;  1X31 B;  2X50 A;  4WCT A;  4FP1 A;  3P9U A;  5EOW A;  1PS9 A;  4PAA A;  3LOV A;  5JCL A;  2YR5 A;  5M0Z A;  2BRA A;  1XAN A;  1CC4 A;  2MUC A;  4H7U A;  3BHF A;  2YVF A;  3N6H A;  1BGJ A;  2IVE A;  2OG9 A;  4JNA A;  4K7Z A;  4X4J A;  5KVI A;  5EB4 A;  1E1M A;  4TM4 A;  4DXK A;  3CGD A;  3NLC A;  1EL7 A;  3THU A;  2Z5X A;  1L9D A;  3AD7 B;  4B1B A;  3LXD A;  3RGT A;  1VQZ A;  4GR1 A;  3ZVH B;  3RP6 A;  2A87 A;  4GME A;  2C76 A;  3RHA A;  4O5Q A;  4OPU A;  2XVE A;  3NO1 A;  3CIR A;  2QA1 A;  1JRP A;  1GES A;  1Q1R A;  1GRF A;  2DW6 A;  2BC1 A;  2IVD A;  2YWL A;  1GEU A;  3R1Z A;  1N62 C;  2PS2 A;  1K4Q A;  3IK4 A;  4HCH A;  5KRQ A;  5M10 A;  4A5L A;  1R0M A;  3ZLH A;  1YQZ A;  1CBO A;  2C65 A;  4Z2R A;  2YVG A;  4YXD A;  4USR A;  4HCL A;  2XVJ A;  3VFC A;  4E8G A;  1D5T A;  1D4D A;  3PO7 A;  3FCP A;  4LU6 A;  1L9E A;  1GV4 A;  2YM2 A;  3OZM A;  5JCI A;  2AL2 B;  1XS2 A;  2YLS A;  2PU1 A;  3GWF A;  2PTZ A;  4B66 A;  4AOX A;  2R0P A;  3KKJ A;  2DKH A;  2RAB A;  3AMZ A;  4JDR A;  4A9W A;  3TWA A;  3CNS A;  3T4W A;  2GMH A;  1Q1W A;  2PTX A;  4U2T A;  1PN0 A;  4DGK A;  3MKC A;  4GYP C;  2WHD A;  2OA1 A;  1LQU A;  2OLO A;  3TJ4 A;  4DWD A;  1B5Q A;  4YWO A;  5KNL A;  1CC6 A;  1IUX A;  2JB3 A;  2XH2 A;  1YQ4 A;  4A35 A;  3UJS A;  3IWA A;  3UP5 A;  2EQ6 A;  4K2X A;  4CCQ A;  1GRE A;  1NPX A;  1H7X A;  2YLR A;  3A7A A;  2ZAD A;  1VDC A;  3R9U A;  1QJD A;  1IUT A;  2WOV A;  1F9C A;  4TVY A;  1LVL A;  3IC9 A;  5CKU A;  2V5Z A;  5J04 A;  1MDL A;  3AE4 A;  4H2N A;  3S61 A;  3LZX A;  2QAE A;  5BOF A;  4Z26 A;  3DES A;  4ROP A;  1OJA A;  3A7R A;  1JDF A;  2ONE A;  3FJ4 A;  2GGH A;  4PAB A;  2V3A A;  4ZA0 A;  1SB3 B;  3L5O A;  2Q7V A;  4A65 A;  4GAP A;  1S3B A;  4HA6 A;  1Y56 B;  2GAH B;  3ZVI A;  3VC5 A;  1GND A;  5ENL A;  2OAL A;  2APG A;  1TDO A;  3T8Q A;  1TYT A;  3ZLG A;  2AKM A;  2ZBW A;  1N1P A;  2BK3 A;  2VOU A;  2OQY A;  2X8C A;  3DGZ A;  2PP3 A;  4G6G A;  1NEN A;  3UCL A;  4J1O A;  3CYJ A;  3PG6 A;  4EM4 A;  2XLP A;  1S2Q A;  5BUK A;  3QFB A;  1MO9 A;  2GGI A;  2JK6 A;  4GYP A;  2E5V A;  3EAN A;  3V76 A;  1ZX9 A;  4BK3 A;  2AR8 A;  4KT2 A;  2W0H A;  5G5G B;  3AD9 B;  2FJD A;  1XPY A;  2XVI A;  3URH A;  3QSM A;  4AT0 A;  2Y6Q A;  1TZZ A;  2BXS A;  4OPC A;  1JEH A;  5L46 A;  2R4J A;  3K7M X;  3NRN A;  3GSI A;  3D47 A;  2W55 A;  2C66 A;  4U8M A;  1NU5 A;  2CDU A;  2QJN A;  4E6M A;  3TW9 A;  3VR9 A;  4GIR A;  1BQG A;  2V60 A;  1UKV G;  2C7G A;  4YSY A;  3DG3 A;  1PBC A;  4NNJ A;  4FI4 A;  3UKF A;  1D4C A;  3OZ2 A;  3QVP A;  1LPF A;  4KEM A;  2B9X A;  3GD6 A;  2ARD A;  5BVA A;  2ZC8 A;  4A6N B;  4ICY A;  4B69 A;  4OPG A;  3II4 A;  3HYW A;  1DJQ A;  5FS7 A;  3QN3 A;  2QJJ A;  1CJC A;  4H2P A;  4I59 A;  4C77 A;  3FPZ A;  2GR2 A;  4EM3 A;  3QJ4 A;  3FIM B; 
#chains in the Genus database with same CATH homology
 1PXB A;  1FEB A;  3GWD A;  3T14 A;  1LQT A;  4NEW A;  5KOW A;  3NTA A;  4YSX A;  2V6O A;  1KSS A;  4BUR A;  4CNJ A;  1AOG A;  2A8X A;  2Q0K A;  2XFP A;  3EF6 A;  4E0V A;  4B67 A;  2XFQ A;  3NN6 X;  2R0C A;  5FS8 A;  3BI2 A;  3CPH G;  4Z2T A;  1PBD A;  2XLR A;  1Q9I A;  3UOZ A;  3AYJ A;  3C4A A;  1V59 A;  4FDC B;  4J33 A;  1OJT A;  4UP3 A;  2WP5 A;  2GH5 A;  1S7M A;  3KLJ A;  1H84 A;  1JOA A;  2ZZ0 A;  4UDQ A;  4XXG A;  1BGN A;  4REK A;  4NTD A;  4AT0 A;  4G74 A;  3I6D A;  3VRA A;  3SZF A;  2NVK X;  4JN9 A;  1D4E A;  2VRL A;  3P4R A;  3CPJ G;  3SFE A;  4IA6 A;  3UTE A;  1S2Y A;  4DNA A;  3DJJ A;  3T2K A;  1BWC A;  3P1W A;  4C5O A;  2CFY A;  1E1L A;  1KNP A;  2R45 A;  5LV9 A;  2GEW A;  2WU5 A;  5TR3 A;  1PJ6 A;  2OAM A;  2JKC A;  5IQ1 A;  3AEB A;  4C3X A;  2B7S A;  3M12 A;  1O95 A;  1KDG A;  4OCG A;  2B76 A;  2HQM A;  1H81 A;  2V61 A;  1TYP A;  4B63 A;  2WBA A;  2XFN A;  3NYF A;  1ZDL A;  2B7R A;  3SGL A;  4OPI A;  2BAB A;  2BRY A;  2DKI A;  2E4G A;  4H4X A;  5C3J A;  2C72 A;  4AOS A;  3ALJ A;  2H88 A;  2YLT A;  5DBJ A;  3NYC A;  4H4V A;  2WPE A;  5U1O A;  1CC2 A;  2GVC A;  3LJP A;  1GTE A;  1GRB A;  1NHS A;  4Y4L A;  4GDP A;  2R0G A;  3GYI A;  1PJ5 A;  2BXR A;  4ZN0 A;  3IHG A;  3QSE A;  4U8L A;  3S5W A;  4H4T A;  3P4S A;  1YQ3 A;  2GV8 A;  3SYI A;  4BJZ A;  2R4E A;  3K7Q X;  1OJC A;  4JY3 A;  4X9M A;  4YSH A;  3DK4 A;  3KPK A;  1X31 B;  2X50 A;  4K22 A;  4GAV A;  4WCT A;  3UKP A;  4UDR A;  3H4K A;  1LJ1 A;  1P2E A;  1PS9 A;  2UZZ A;  3AE6 A;  3P9U A;  4PAA A;  4GCM A;  5EOW A;  3LOV A;  1GSN A;  5JCL A;  1DXL A;  3LAD A;  2TPR A;  2YR5 A;  1N4V A;  3AYL A;  3GYX A;  5M0Z A;  2BRA A;  3NYE A;  3VRB A;  5IPY A;  1XAN A;  5JRB A;  1NHP A;  1CC4 A;  4WX1 A;  2H89 A;  4H4Y A;  4RSL A;  5FS6 A;  3UOV A;  3ATQ A;  3EPT A;  4H7U A;  1K0L A;  3ICR A;  3SM8 A;  5IQ4 A;  3CNP A;  2WPF A;  1GRA A;  3BHF A;  2YVF A;  2C3C A;  4RG3 A;  1L0V A;  1BGJ A;  4J36 A;  3C96 A;  2IVE A;  4D04 A;  4B65 A;  2R46 A;  1JNZ A;  2C75 A;  3CTY A;  4JNA A;  4YTM A;  4O5U A;  2VVL A;  4B64 A;  1ZOV A;  4K7Z A;  1FEC A;  1KNR A;  4EIQ A;  4YSZ A;  1RYI A;  3CND A;  2FBW A;  4X4J A;  5KVI A;  5EB4 A;  1E1M A;  1H83 A;  4TM4 A;  3KD9 A;  1H2I A;  3CGD A;  1ZOY A;  4JY2 A;  4EMW A;  2Q6U A;  3GDP A;  1EL7 A;  3NLC A;  5FS9 A;  1TRB A;  1GRG A;  3D8X A;  5U63 A;  4K8D A;  2Z5X A;  2XVF A;  2X99 A;  1K0I A;  2ACZ A;  1TDN A;  1GER A;  1L9D A;  1CF3 A;  3AD7 B;  3G5R A;  3IF9 A;  4B1B A;  1N4W A;  1NEK A;  3H8I A;  4U8O A;  5EBK A;  3LXD A;  4H50 A;  3UTG A;  5HYM A;  3KVE A;  4J34 A;  4GR1 A;  1MOK A;  2WET A;  1IUU A;  3F8D A;  5JCK A;  3RP6 A;  2GR0 A;  1ZP0 A;  4EQS A;  2A87 A;  3AB1 A;  4H4Q A;  1JRY A;  4CBQ A;  2C70 A;  2QA2 A;  1E1K A;  2C76 A;  3AEA A;  3RHA A;  3VR8 A;  5C2T A;  4KPR A;  2E1M A;  2FJB A;  2YM1 A;  4O5Q A;  4G9K A;  4OPU A;  2XVE A;  5EB5 A;  2OLN A;  2I0Z A;  2GQF A;  3CIR A;  3T37 A;  2WOW A;  2XFO A;  3AE8 A;  3NGC X;  2ZZC A;  3BNM A;  2QA1 A;  1DOD A;  1GES A;  1Q1R A;  1GRF A;  3H8L A;  3B6D A;  2BC1 A;  2EQ7 A;  2IVD A;  3UTH A;  1Y56 A;  1VRQ B;  1EL9 A;  2YWL A;  3AE9 A;  4K5S A;  1GEU A;  4IVM B;  2WP6 A;  1NAA A;  1NHR A;  1GTH A;  2GMJ A;  1K4Q A;  4I58 A;  4NWZ A;  3OC4 A;  1E7P A;  5KRQ A;  3GRS A;  4JQ9 A;  5M10 A;  2WQY A;  4Y4M A;  5GSN A;  1Y0P A;  4A5L A;  3ICT A;  2YLZ A;  2EQ8 A;  1YQZ A;  3AEE A;  3O0H A;  1CBO A;  2C65 A;  3KU9 A;  4Z2R A;  2YVG A;  4YXD A;  3AE1 A;  4NEV A;  1OJ9 A;  2ZZB A;  1O5W A;  4USR A;  4Z24 A;  1LV0 A;  2YR6 A;  4LA1 A;  2XVJ A;  5KVH A;  1D5T A;  3ATR A;  1D4D A;  3PO7 A;  2WEU A;  4LU6 A;  1L9E A;  1PBB A;  4BJY A;  4JNQ A;  1M64 A;  2XDO A;  4YT0 A;  1GV4 A;  1DNC A;  4YTN A;  2YM2 A;  3F8R A;  4Y4N A;  2JBV A;  2WP9 A;  5JCI A;  3FBS A;  1TDK A;  2YLS A;  2FJA A;  4BV6 A;  4H4P A;  5FMH A;  3GWF A;  2C3D A;  1ZKQ A;  4Z2U A;  2YVJ A;  4J2W A;  4B66 A;  4AOX A;  1CHU A;  2R0P A;  3RP7 A;  1PHH A;  1KF6 A;  2DKH A;  3KKJ A;  3C4N A;  2RAB A;  1EL5 A;  4H4R A;  1F3P A;  4JDR A;  1BKW A;  3WE0 A;  4A9W A;  1IJH A;  3CNS A;  3GRT A;  3I3L A;  2XVH A;  2GMH A;  1Q1W A;  4G73 A;  2XCG A;  1XPQ A;  5BUL A;  1ZY8 A;  1PN0 A;  3NK1 X;  4U2T A;  1GXF A;  1XHC A;  1PXA A;  4DGK A;  1DOC A;  2WHD A;  3ALL A;  1W4X A;  3DJG X;  2OA1 A;  1LQU A;  1GRT A;  1CJ4 A;  2OLO A;  4II2 A;  2YG5 A;  1H86 A;  3PS9 A;  1B5Q A;  4Z43 A;  3VQR A;  4C3Y A;  1ONF A;  3CGC A;  2B9W A;  2YG7 A;  4YWO A;  5KMP A;  1HYU A;  5KNL A;  2WS3 A;  4OPT A;  4GRT A;  1CC6 A;  2VVL G;  1IUX A;  4EMJ A;  4YKF A;  2X8G A;  4TLZ A;  3KPF A;  2JB3 A;  4HB9 A;  1GRH A;  1YQ4 A;  3ZDN A;  2BCG G;  4TLX A;  4CCR A;  3L1R A;  4H4W A;  2WDR A;  3GDN A;  4U8N A;  3IWA A;  2PHH A;  3T2Y A;  5HHF A;  3VRD B;  3B3R A;  5J7X A;  3UP5 A;  2Z5Y A;  2EQ6 A;  1CJ3 A;  4DSH A;  4K2X A;  4CCQ A;  1CJ2 A;  3SFD A;  1M6I A;  3FG2 P;  3AEG A;  3AEC A;  1GRE A;  5U25 A;  2F5Z A;  1GOS A;  3SQP A;  2YG3 A;  3T31 A;  3QVR A;  1NPX A;  1H7X A;  2GR1 A;  1D7L A;  1E39 A;  4ZCC A;  2NPX A;  2C67 A;  2YLR A;  2J3N A;  2WPC A;  1GPE A;  3R9U A;  1VDC A;  3M0O A;  5KMR A;  1QJD A;  1IUT A;  2VVM A;  5KXJ A;  1F8W A;  4AT2 A;  4XWR A;  4J31 A;  2WOV A;  4H4U A;  3KA7 A;  4A99 A;  3DK8 A;  4IVO B;  1DJN A;  1ELI A;  3V3N A;  1LVL A;  3IC9 A;  3K30 A;  4TM0 A;  1GT8 A;  5KOX A;  4H2R A;  4OVI A;  5CKU A;  1KSU A;  2V5Z A;  2BC0 A;  5JCN A;  2RGH A;  2XYO A;  3CNT A;  1F6M A;  3AD8 B;  3UOX A;  3AE4 A;  1E6E A;  1ZK7 A;  1PBF A;  4GF7 A;  3BHK A;  4H2N A;  3S61 A;  1N4U A;  3LZX A;  3GMB A;  4AP3 A;  2YG6 A;  2FJE A;  3P4P A;  4UDP A;  1EL8 A;  2BS4 A;  3CGE A;  3DK9 A;  2QAE A;  2YR4 A;  4NZH A;  4NTE A;  3ABV A;  2RGO A;  4Z26 A;  4D03 A;  1JU2 A;  1OJA A;  3CGB A;  1B8S A;  1KN0 A;  5GRT A;  1QLB A;  3LB8 A;  2WES A;  2BAC A;  3UKQ A;  4PAB A;  2V3A A;  1VG9 A;  3NKS A;  2QCU A;  3NTD A;  1D7Y A;  1NG4 A;  3BI4 A;  3SXI A;  1FL2 A;  3L5O A;  2Q7V A;  3DJD A;  3K7T A;  4A65 A;  3QSM A;  4J56 A;  3RNM A;  4GAP A;  1S3B A;  2AQJ A;  5JCM A;  4IV9 A;  3DH9 A;  4G6H A;  2X8H A;  1TDF A;  3ISH A;  4HA6 A;  3AYI A;  4EQR A;  1Y56 B;  4YTP A;  3E1T A;  2GRT A;  2GAH B;  2XLT A;  1XDI A;  2A89 A;  1GND A;  3NK2 X;  3CNJ A;  4USQ A;  3UOY A;  4A79 A;  1OJD A;  3L8K A;  2OAL A;  2APG A;  4CY6 A;  1TDO A;  2C64 A;  3NNE A;  3ZYX A;  1TYT A;  4U8I A;  4EIP A;  4YKG A;  1H82 A;  3CN8 A;  4BK2 A;  3QFA A;  4XWZ A;  1TDE A;  1N1P A;  2ZBW A;  3GYJ A;  1PDH A;  3NIX A;  2BK3 A;  3ITJ A;  2VOU A;  4J57 A;  2X8C A;  3ADA B;  3HYX A;  3DGZ A;  1IUW A;  4N9X A;  1BF3 A;  4G6G A;  4ECH A;  4NTC A;  1NEN A;  3UKH A;  3UCL A;  2XLU A;  3M13 A;  4H2Q A;  4DSG A;  2GR3 A;  2JAE A;  4GUV A;  5HY5 A;  5KWF A;  3PG6 A;  1IUS A;  1RP0 A;  4EM4 A;  2BK4 A;  2VQ7 A;  1H6V A;  1NG3 A;  2XLP A;  1S2Q A;  1FCD A;  5BUK A;  3NG7 X;  2EQ9 A;  3QFB A;  1MO9 A;  2GAG B;  4M52 A;  4OPL A;  3GMC A;  4EQW A;  3SY4 A;  2JK6 A;  1ZMD A;  2JB2 A;  1B4V A;  4K5R A;  3SX6 A;  2JB1 A;  2E5V A;  3EAN A;  1GET A;  1ZX9 A;  3SZW A;  2AR8 A;  3V76 A;  4BK3 A;  3BNU A;  2TMD A;  3NN0 X;  3D1C A;  2W0H A;  1QO8 A;  3NH3 X;  3AD9 B;  2FJD A;  2VRM A;  2GF3 A;  3G5S A;  4LII A;  4KX6 A;  5J60 A;  2XVI A;  3URH A;  1LTX R;  2YQU A;  1JRX A;  2YAU A;  1F8S A;  2PYX A;  3D9X A;  1Z6L A;  3HYV A;  2BA9 A;  2WDV A;  1SEZ A;  2WOI A;  4U8P A;  2Q0L A;  4CY8 A;  2Y6Q A;  3T0K A;  5ER0 A;  4EMI A;  1REO A;  3DJE A;  1B37 A;  2BXS A;  4OPC A;  3JSK A;  2WDQ A;  2BS3 A;  2CUL A;  2VZ2 A;  2BK5 A;  4TM1 A;  1PJ7 A;  1JEH A;  5L46 A;  3LZW A;  3AE2 A;  3HZL A;  1E1N A;  3P4Q A;  2R4J A;  3Q6J A;  3RP8 A;  3K7M X;  2YLX A;  3GSI A;  3NRN A;  2Y6R A;  4C74 A;  2C66 A;  4TM3 A;  3AE3 A;  4U8M A;  3UKK A;  5KMS A;  2CDU A;  1VQW A;  1K0J A;  4FX9 A;  2BS2 A;  1NHQ A;  2BCP A;  4APN A;  1PBE A;  1EBD A;  4U8J A;  2C73 A;  1DOE A;  2YLW A;  1GAL A;  2YG4 A;  3FMW A;  3BI5 A;  2O9Z A;  3NT6 A;  3VR9 A;  1S3E A;  1O94 A;  1FEA A;  2V3B A;  3AWI A;  2GQW A;  3IHM A;  4X9N A;  1JNR A;  4BK1 A;  1NDA A;  2V60 A;  1CL0 A;  1F8R A;  3UKL A;  1UKV G;  3RED A;  1YKJ A;  2C7G A;  3COX A;  3F8P A;  4YSY A;  1KFY A;  3DGH A;  3AEF A;  4OPD A;  4U2S A;  1PBC A;  3SZC A;  3PVC A;  4NNJ A;  1VG0 A;  2GB0 A;  1JRZ A;  3G5Q A;  4Z44 A;  3GD4 A;  3UKF A;  1D4C A;  3OZ2 A;  3QVP A;  2IID A;  4RG4 A;  2R9Z A;  3Q9T A;  3ICS A;  4U8K A;  4ZCD A;  4AP1 A;  1LPF A;  4A6N A;  3DA1 A;  1PXC A;  4P9S A;  1YY5 A;  2X3N A;  2CVJ A;  3GD3 A;  3AXB A;  1P2H A;  3NK0 X;  4FK1 A;  3QSS A;  2B9X A;  1IUV A;  2ARD A;  4MJW A;  4U2L A;  3T2Z A;  5BVA A;  1DOB A;  2BYB A;  4A6N B;  4ICY A;  4A7A A;  4B69 A;  4Z25 A;  4OPG A;  2RGJ A;  3II4 A;  1RSG A;  3AE7 A;  4H4Z A;  1COY A;  3CPI G;  4H4S A;  3HYW A;  5KMQ A;  1DJQ A;  5FS7 A;  2XFU A;  3UP4 A;  5HXI A;  4EQX A;  2VQB A;  2C4C A;  2AAQ A;  3V3O A;  4FK1 C;  3EAO A;  3SZ0 A;  2XLS A;  1CJC A;  4ADW A;  1MXT A;  4H2P A;  5CQF A;  3UTF A;  4I59 A;  1BZL A;  3CMM A;  4II3 A;  4C77 A;  5BRT A;  3FPZ A;  4CNK A;  4IA5 A;  3AE5 A;  3AED A;  2GR2 A;  1FOH A;  4EM3 A;  1ZMC A;  2B9Y A;  2WU2 A;  3DME A;  3QJ4 A;  4GDE A;  4B68 A;  3NHO X;  4CRT A;  3UKA A;  3FIM B;  1H7W A;  3ALM A;  1L9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...