5FS6A

Crystal structure of the v243l mutant of human apoptosis inducing factor
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
491
structure length
454
Chain Sequence
b'KAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMLKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHEDLVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Structure/Function Relations in Aifm1 Variants Associated with Neurodegenerative Disorders
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 146
structure length 454
sequence length 491
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fs6A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs6A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs6A01
4K5RA 4GDPA 5J60A 1YQ4A 3GDPA 1ONFA 4J56A 2JB2A 4TM3A 3VRBA 2FJAA 4U8LA 1GTEA 1LQTA 4FX9A 2C73A 4EM3A 1KFYA 4BK1A 2EQ8A 1L9DA 4U8MA 3ABVA 3UP5A 3NRNA 3UKFA 2BCPA 3K7TA 1MO9A 3K30A 4U8KA 3HZLA 4TM0A 3G5QA 3EF6A 4U8PA 3BNMA 2AQJA 2YAUA 4IVMB 2Q6UA 1OJ9A 1TDFA 1L9EA 2GR1A 1X31B 1IUSA 2C70A 1ZP0A 3QSEA 3AEAA 2RABA 1VDCA 3DK9A 4B66A 2WU5A 1ZKQA 4H50A 2WDVA 3AD8B 5FMHA 2YWLA 3SFDA 4U8NA 3UKPA 5BULA 4Z2RA 1KSUA 4CNKA 1MXTA 3I6DA 3NT6A 1LPFA 1BZLA 4YKFA 1B4VA 2R0GA 2ZZCA 5KOXA 3DK8A 4BURA 1PJ6A 1NG3A 1H6VA 2C65A 3C96A 1K4QA 2C7GA 2I0ZA 1OJTA 3PVCA 3SGLA 4YSHA 3C4AA 3QSMA 5KXJA 3UKHA 1PBBA 4H4RA 2ZBWA 1KF6A 1DODA 1VG9A 1O5WA 2AR8A 1E39A 2C67A 2X8GA 2Y6QA 4Z25A 5EB5A 1M64A 3GWFA 3CGCA 2YLTA 2XLTA 5U25A 2XVEA 3FPZA 4RG3A 3DJEA 3EPTA 4FK1C 4GF7A 1IJHA 3AE4A 3IWAA 3AEGA 4HA6A 4A79A 4EIQA 1PJ5A 4WX1A 1B5QA 4A6NB 2BK3A 4H4TA 3DMEA 5KOWA 2WEUA 3P9UA 4YSZA 4RSLA 1NEKA 2WOVA 1ZY8A 4J33A 3RP8A 5IPYA 3AYIA 2YQUA 4CCRA 4DNAA 3AE3A 2GMJA 2NVKX 2JAEA 3NYEA 2YLRA 1YY5A 2OALA 1IUVA 1E1NA 2WPFA 3QJ4A 3P1WA 4OCGA 5FS7A 3AEBA 1CC6A 4X9MA 2WPCA 2WU2A 2Q7VA 3LOVA 4FK1A 1OJCA 4LU6A 3DGZA 2A87A 4H4SA 3CNDA 4MJWA 1JNRA 2YVJA 1LJ1A 2Z5XA 3CPJG 2BK4A 1LV0A 3NG7X 3UOYA 2WBAA 4C5OA 4H7UA 2R46A 4H2QA 3UKAA 4AOXA 4Z2TA 3COXA 1DNCA 2BCGG 1DJNA 2R4JA 2QAEA 2YR5A 4AP3A 4GCMA 2QA2A 5M10A 2BC0A 3DJJA 1FECA 3NK1X 4NTEA 3NGCX 4C77A 4NTDA 4NZHA 2GRTA 1B37A 2APGA 2XLRA 3OZ2A 3GDNA 3NKSA 2EQ6A 3GRSA 1DJQA 1CF3A 1RP0A 2V3AA 3UOXA 4TLZA 4D03A 4IVOB 1CJ3A 4OVIA 2XVJA 3NTDA 3IC9A 3B3RA 1JU2A 1ZOYA 2VOUA 1H82A 1BGNA 4REKA 2XFOA 3GMBA 1JRZA 3K7QX 4YSYA 1EL7A 2WP5A 1S3EA 4TLXA 2V6OA 1GT8A 4ADWA 2XFQA 3QVPA 1VQWA 5IQ4A 1DOBA 4B67A 3KKJA 2EQ9A 1BF3A 4Z2UA 2VVLA 3GYJA 3ALLA 1CJCA 2GAGB 4H4XA 4B63A 1JRYA 1PXBA 2IIDA 2R9ZA 2PYXA 3T37A 4CRTA 1KNRA 2FJDA 4JNAA 4UDRA 4BK2A 2V3BA 5EBKA 2WOWA 1FCDA 3O0HA 1NG4A 2C64A 2O9ZA 2R0CA 2Z5YA 3IF9A 3KD9A 4A6NA 5U63A 4PAAA 3Q6JA 3P4RA 4K8DA 2OLNA 2WHDA 4DSGA 2CULA 2GAHB 2YG3A 3UTGA 1P2HA 1GERA 3FMWA 3UKKA 1PBEA 3P4SA 1XANA 2WP6A 4YWOA 1TDKA 3ADAB 1GESA 4AOSA 1Y56A 3VRDB 1GRTA 3V3OA 3AE6A 3CGBA 2ACZA 5HY5A 1D5TA 3K7MX 1S3BA 4USRA 3EAOA 3H4KA 3CN8A 2EQ7A 1JEHA 4H4QA 4B69A 5ER0A 4TM1A 1NDAA 1L0VA 4OPTA 3F8PA 3GSIA 4U2TA 3CPIG 1D7YA 2YLZA 4O5QA 3UKLA 5BVAA 4DSHA 4O5UA 2E4GA 3CIRA 2JKCA 3UOZA 5GRTA 3DA1A 5JCIA 3UKQA 4H4UA 1NHRA 1YQ3A 1GOSA 1D4DA 3G5SA 1F6MA 4OPCA 1Q1WA 4XWZA 1AOGA 5L46A 3AD7B 1IUWA 2XLSA 1N4VA 1PBDA 2GB0A 3M13A 2FJEA 4JY2A 3ALMA 1TYPA 2VVLG 1E6EA 2JB3A 2VZ2A 1EL8A 2ARDA 2XDOA 2WDRA 4TM4A 1E1MA 3NLCA 4U8JA 5J7XA 3QSSA 3II4A 1FOHA 1S2YA 2JBVA 4H4PA 1TDEA 2H89A 3I3LA 4K2XA 4D04A 5JCMA 3ISHA 1ZX9A 4EMWA 3AECA 2F5ZA 2GR3A 1B8SA 4FDCB 1CHUA 2WQYA 4Z26A 2WDQA 4APNA 2YG6A 2CDUA 3IHMA 2XFNA 3ICTA 3GRTA 1W4XA 3LJPA 5JCNA 4HB9A 2GH5A 3B6DA 4I58A 1H86A 3LZWA 4EMJA 3AE7A 1QLBA 2JB1A 4EIPA 2C76A 3NYCA 1VRQB 1M6IA 1GRHA 1NHSA 2XYOA 4OPUA 3P4PA 1TRBA 3VR9A 2A89A 1NHPA 3NHOX 4UP3A 4Y4LA 4XWRA 1Y56B 1F8SA 3F8RA 3CNSA 2XVFA 2DKIA 1ZK7A 5HXIA 4H2RA 1XHCA 4ZCCA 4H2NA 3BHKA 3SM8A 2W0HA 3CNTA 2FJBA 2PHHA 1K0JA 3PS9A 2GQFA 3ICRA 3DK4A 2VRMA 3QFAA 1GRFA 3AYLA 2VQ7A 2XVHA 4A65A 3AEDA 4ECHA 2VRLA 3CTYA 3DJDA 3ITJA 2CVJA 1DXLA 4GRTA 2R45A 2BK5A 3DH9A 1H84A 1LVLA 4AT2A 1V59A 4EMIA 5EB4A 1S2QA 3LXDA 3RHAA 1FEAA 4B68A 3VQRA 4A99A 4P9SA 1GTHA 1IUUA 4M52A 4OPGA 3KPFA 1Y0PA 4H4WA 2YVFA 4LA1A 2IVEA 2Y6RA 2XVIA 4LIIA 5JCKA 1H7XA 2X50A 1P2EA 3M0OA 3JSKA 5KWFA 4NEWA 2CFYA 1H81A 1ZOVA 3S61A 4X9NA 2HQMA 1E7PA 1CC4A 1ZMDA 2C66A 3FBSA 3KA7A 5TR3A 1JNZA 3URHA 1JRXA 4NTCA 2WOIA 4H4VA 1BKWA 2H88A 2VVMA 4ZN0A 4ZCDA 2R0PA 4I59A 2V5ZA 4EM4A 2YLXA 1TDOA 1H83A 2XLUA 3ATRA 3KU9A 4YTNA 1Q9IA 4AT0A 1PJ7A 3IHGA 3NH3X 2B76A 4U2SA 3OC4A 2YG4A 5C2TA 4Z44A 3REDA 2WP9A 2BA9A 3NN0X 4YXDA 2GV8A 5BUKA 4A7AA 3GMCA 1PBCA 3NIXA 2XFPA 2A8XA 3NK2X 3BI4A 1CC2A 1NPXA 2BYBA 1IUTA 4OPDA 4KX6A 4CY8A 3ZYXA 3E1TA 4C3YA 1CJ4A 2B9XA 3DGHA 2GR2A 2E5VA 3D8XA 2WPEA 2RGOA 1MOKA 2XLPA 3UCLA 3V76A 2YG7A 1VG0A 3AEEA 3M12A 5JCLA 4Z24A 3RP7A 5KRQA 4EQXA 2BACA 2QA1A 2X99A 5IQ1A 3V3NA 4Z43A 5M0ZA 2YG5A 2AAQA 1PXAA 2RGJA 2GQWA 2YR6A 3ATQA 4ICYA 1NHQA 5HYMA 4K7ZA 1DOCA 3H8LA 1YKJA 2BC1A 2X8HA 2B9YA 3SFEA 4BK3A 1F8RA 2ZZBA 4CBQA 1CJ2A 2BS4A 2YLWA 3AE8A 2OAMA 2ZZ0A 4NEVA 4A5LA 1GSNA 2YM1A 1ZDLA 1D4EA 1GRAA 2C3CA 1D7LA 3BHFA 1O95A 2GMHA 2JK6A 5LV9A 1E1KA 4E0VA 3QFBA 1YQZA 4YKGA 3SQPA 3AE2A 1LQUA 3EANA 2XCGA 4C3XA 1PN0A 2GR0A 1PHHA 1OJAA 1EBDA 4H4ZA 4JDRA 4J2WA 3BI5A 3BNUA 4OPIA 2YM2A 1E1LA 3GD4A 1KSSA 4CCQA 3VR8A 4J57A 1GV4A 1NAAA 4GR1A 3NTAA 1GEUA 2Q0KA 3NNEA 2GF3A 4J36A 1GETA 2C72A 4A9WA 5EOWA 3AYJA 4KPRA 2BXSA 2OLOA 4B1BA 2FBWA 4EQWA 2V60A 2WETA 1D4CA 2C75A 3PO7A 4BJZA 4Y4MA 4IA6A 3P4QA 3LB8A 3CNJA 1OJDA 1F8WA 1GRGA 1EL5A 2B7SA 2YR4A 1PS9A 1F3PA 3ICSA 4U8OA 4JQ9A 3C4NA 5BRTA 1KDGA 4K22A 3BI2A 4IV9A 2TMDA 1BGJA 4U2LA 1H7WA 3UTFA 3AB1A 1CL0A 2RGHA 3UTEA 5DBJA 3R9UA 2X3NA 1PBFA 1TDNA 1Z6LA 3AEFA 1BWCA 4IA5A 4CNJA 1CBOA 3AE1A 3UTHA 1TYTA 3H8IA 3G5RA 3CPHG 4WCTA 1REOA 2E1MA 3KLJA 1UKVG 4H4YA 4GDEA 5HHFA 3NN6X 2UZZA 4JNQA 5FS8A 3GYIA 3DJGX 5U1OA 1Q1RA 3GWDA 2BS2A 2R4EA 2YLSA 4C74A 1N4UA 1NENA 1RYIA 3Q9TA 4BJYA 1GXFA 1ELIA 2C3DA 5KVIA 1GNDA 4CY6A 4EQSA 3FIMB 1N1PA 1GREA 4OPLA 2B7RA 3ALJA 2J3NA 3CGEA 5FS9A 1KNPA 1SEZA 1GALA 1XPQA 2DKHA 2WS3A 1RSGA 3S5WA 3UP4A 1FEBA 1COYA 3AD9B 2B9WA 4BV6A 4YSXA 3GD3A 1IUXA 2BXRA 1DOEA 3D1CA 5C3JA 1PDHA 1JOAA 2NPXA 2Q0LA 4JY3A 1K0LA 4GUVA 4AP1A 4JN9A 2BS3A 4XXGA 2YVGA 3RNMA 4YTPA 5KVHA 1GRBA 1O94A 2OA1A 1GPEA 1XDIA 3CNPA 3RP6A 4B64A 3KVEA 4Y4NA 3FG2P 3AE5A 4J34A 2BABA 4K5SA 4U8IA 3WE0A 1FL2A 1EL9A 4UDQA 3AE9A 1K0IA 2IVDA 4RG4A 4USQA 3NYFA 3UOVA 1QJDA 3L8KA 4YT0A 3LADA 5FS6A 1LTXR 1ZMCA 2VQBA 4X4JA 1N4WA 2X8CA 1PXCA 4EQRA 4DGKA 2QCUA 5CQFA 5GSNA 3AXBA 4UDPA 2V61A 3AWIA 4N9XA 2WESA 3F8DA 5CKUA 4YTMA 3VRAA 3NK0X 2XFUA 2TPRA 3QVRA 1L9CA 1QO8A 3ZDNA 2GVCA 2GEWA 3CGDA 3LZXA 3L1RA 4H2PA 4PABA 1HYUA 4B65A 4J31A
chains in the Genus database with same CATH superfamily
1YQ4A 3GDPA 1GTEA 4FX9A 2P3ZA 1KFYA 3UKFA 3K7TA 3Q4DA 4TM0A 4HN8A 4U8PA 3BNMA 2AQJA 3CMMA 2GR1A 2C70A 2RABA 2WU5A 1ZKQA 3AD8B 3SFDA 4U8NA 3DGBA 1KSUA 1BZLA 1H6VA 2C7GA 2HXTA 2I0ZA 3PVCA 5KXJA 3D9XA 4H4RA 1KF6A 2GL5A 1S7MA 2Y6QA 3FPZA 5U25A 3DJEA 3EPTA 4FK1C 3AEGA 4A79A 2WEUA 2WOVA 1ZY8A 2XH0A 3PWIA 2AL2A 2YQUA 3RR1A 1YY5A 1IUVA 3QJ4A 2OPJA 5FS7A 3NO1A 4X9MA 2WPCA 2Q7VA 4FK1A 3DGZA 3CNDA 4H4SA 3SN1A 3UXLA 1JNRA 1LV0A 2WBAA 4C5OA 3UKAA 2R4JA 2QA2A 5M10A 4C77A 2GRTA 3TQPA 1DJQA 1RP0A 4TLZA 1ONEA 1JU2A 4TVWA 3FCPA 2XFOA 1JRZA 2QJMA 4ADWA 5IQ4A 2EQ9A 1BF3A 4Z2UA 1CJCA 1JRYA 2PYXA 2DW6A 3DG6A 3T37A 4BK2A 3OZYA 5EBKA 2WOWA 1FCDA 1NG4A 2Z5YA 2R0CA 3Q6JA 1PBEA 1TDKA 1GESA 2OO6A 3VRDB 1GRTA 3T2ZA 3AE6A 2ACZA 1S3BA 1F9CA 2XH7A 5ER0A 4OPTA 3GSIA 5BVAA 2GGGA 4DSHA 4E8GA 3UKQA 4F4RA 1STZA 2AL1A 4NWZA 3G5SA 4XWZA 2GDQA 2XLSA 3M13A 1TYPA 2XDOA 2ARDA 1E1MA 3QSSA 3H70A 2JBVA 1TDEA 2H89A 2OKTA 3R1ZA 1SJAA 2W55A 4X2PA 3CAWA 2GR3A 4FDCB 2WQYA 2YG6A 3GRTA 4MMWA 1SB3B 5JCNA 2GH5A 3LZWA 2PPGA 4EIPA 3AM9A 1NHSA 3DG3A 3T0KA 4OPUA 1NHPA 3GY1A 2FKPA 3BHKA 1YEYA 2FJBA 3PS9A 3ICRA 3STPA 1KKRA 1DXLA 3TW9A 3CYJA 4AT2A 4IP4A 1NELA 4A99A 4P9SA 4OPGA 4GFIA 2XVIA 1H7XA 2X50A 1P2EA 4E6MA 3SZ0A 2HQMA 2C66A 3KA7A 3HYWA 3OP2A 3URHA 1JRXA 4H4VA 1BKWA 4ZN0A 4ZCDA 2R0PA 2V5ZA 3ATRA 2B76A 4Z44A 2WP9A 3NN0X 2GV8A 3FYYA 3GMCA 1PBCA 2A8XA 3VDGA 1R0MA 1CC2A 3CK5A 4H1ZA 3MWCA 4OPDA 4CY8A 3ZYXA 4C3YA 2OQYA 2GR2A 2XLPA 3V76A 5JCLA 4YWSA 3RP7A 5KRQA 3V3NA 2QA1A 4Z43A 2PA6A 3V3WA 2GQWA 2YR6A 3ATQA 2B9YA 4IT1A 2ZZBA 4HYRA 4A35A 1ZDLA 5LV9A 3GYXA 4YKGA 1LQUA 3ENLA 1E1LA 3GD4A 1KSSA 3PFRA 4J57A 3DFYA 4GR1A 2Q0KA 4A9WA 5EOWA 4KPRA 2BXSA 4EQWA 1OJDA 4JN7A 1F3PA 3ICSA 3R25A 1KD0A 4K22A 2RGHA 3QTPA 3R11A 2QJNA 2HZGA 3TCSA 2PP1A 3THUA 2DW7A 2E1MA 3KLJA 4DYEA 3UJEA 4JNQA 3DJGX 5U1OA 1N4UA 1NENA 3SR6B 3Q9TA 4JN8A 4CY6A 6ENLA 3BSMA 4IZGA 3ZVHB 1SEZA 1XPQA 1GALA 3UP4A 2B9WA 5C3JA 1PDHA 3EUB3 4GUVA 4JN9A 1WUFA 3KVEA 4Y4NA 3FG2P 2BABA 3FJ4A 1SJCA 3UOVA 3NVWB 1QJDA 3LADA 2VQBA 4X4JA 1ZXIC 1N4WA 2X8CA 4EQRA 3I4KA 2QCUA 4HCLA 4UDPA 3EEZA 2WESA 4ROPA 3NK0X 2GEWA 3CGDA 3L1RA 4A65A 1HYUA 4B65A 3JZUA 3SJNA 4K5RA 4GDPA 3KUMA 5BOFA 3ETRB 4EM3A 4BK1A 1L9DA 3ABVA 4GMEA 2PCEA 3Q45A 3GO2A 3G5QA 2Q6UA 1IUSA 3QSEA 5FMHA 2YWLA 3UKPA 5BULA 4Z2RA 5ENLA 1MXTA 1KKOA 4YKFA 1JROA 4BURA 3R07C 1K4QA 4ZA0A 4YSHA 3C4AA 3QSMA 3UKHA 2PP0A 1PBBA 1VG9A 3DDMA 1EC9A 1FHVA 1E39A 2C67A 2X8GA 2XVEA 1KCZA 4WX1A 1B5QA 4H4TA 4RSLA 4J33A 2QJJA 4K2SA 3NYEA 3CT2A 1E1NA 2WPFA 3P1WA 4ENLA 4OCGA 1CC6A 1P48A 4LU6A 2A87A 4MJWA 3T31A 3CPJG 2BK4A 4KWSA 4HNLA 4Z2TA 1PDZA 1DNCA 1DJNA 2QAEA 4AP3A 4GCMA 1FECA 3NGCX 4NZHA 2W3RA 3I6TA 1B37A 4GAVA 2P8BA 2APGA 3OZ2A 2V3AA 4D03A 4OVIA 3IC9A 3TTEA 3B3RA 3NS1B 1H82A 1BGNA 3GMBA 3K7QX 1EL7A 4TLXA 1S3EA 1GT8A 1DTNA 1FIQB 2VVLA 3GYJA 3ALLA 2R9ZA 1KNRA 2FJDA 4JNAA 2V3BA 2O9ZA 1JPDX 4KPLA 3O0HA 4A6NA 4PAAA 2OLNA 2O56A 3UTGA 1P2HA 4M6UA 3N4EA 1FFVC 3QPEA 3ADAB 4AOSA 3V3OA 5HY5A 1D5TA 2RDXA 1JEHA 4B69A 2PMQA 3P0WA 4O5QA 3SX6A 2E4GA 3CIRA 3UOZA 5JCIA 4H4UA 2OG9A 3AD7B 1N4VA 2GB0A 2FJEA 3RGTA 4GISA 4II2A 1EL8A 4TM4A 2XSXA 1S2YA 4H4PA 4D04A 3NVYB 3ISHA 3AECA 4DHGA 4DN1A 4APNA 5FJRA 5EU9A 4HCDA 4Z1YA 3AE7A 2JB1A 1VRQB 1M6IA 1GRHA 3T2YA 2XYOA 2OZTA 3P4PA 3H8AA 4XWRA 1Y56B 1F8SA 5KMPA 2XVFA 1ZK7A 5HXIA 4ZCCA 3CNTA 3B97A 1K0JA 4G7FA 3QFAA 3AYLA 2VQ7A 2C4CA 2XVHA 3DJDA 4GRTA 3U4FA 2BK5A 3DH9A 3PG6A 1H84A 3HRDC 1JCTA 2QDEA 4EMIA 5EB4A 3SXIA 3LXDA 3P3BA 3KPFA 4IL0A 1N63C 3M0OA 3JSKA 1ZOVA 3DFHA 3ZLGA 1CC4A 3FBSA 5FJOA 3GD6A 2VVMA 1XS2A 4EM4A 1H83A 1Q9IA 4AT0A 3IHGA 3NH3X 5C2TA 5BUKA 4A3RA 2XFPA 1NPXA 2BYBA 3E1TA 2E5VA 2WPEA 2RGOA 2YG7A 1VG0A 3MZNA 3QLDA 4EQXA 2BACA 3IK4A 4ICYA 5HYMA 4K7ZA 1DOCA 4BK3A 1T3QC 1F8RA 2ZC8A 2BS4A 1FO4A 3AE8A 1MUCA 2OAMA 3SZFA 4A5LA 3T14A 2YM1A 1D4EA 3BHFA 1GRAA 3KPKA 1D7LA 1O95A 2JK6A 1FHUA 1E1KA 4HCHA 2XCGA 1PN0A 3TWAA 4GIRA 4H4ZA 4GAPA 4OPIA 2PGWA 4CCQA 1RM6B 3NNEA 2GF3A 4B1BA 2WETA 4BJZA 2B7SA 2YR4A 3ZLHA 3SQSA 5BRTA 4IV9A 1E9IA 1BGJA 3UTFA 5DBJA 2X3NA 3AEFA 1BWCA 3NFUA 4IA5A 3AE1A 5KMQA 3H8IA 3G5RA 3RRAA 5HHFA 3NN6X 2R4EA 2YLSA 1RYIA 1ELIA 5KVIA 4EQSA 2PTYA 1GREA 1N1PA 2B7RA 1WUEA 1RSGA 5JRBA 1EC8A 2BXRA 1DOEA 3D1CA 2Q0LA 4AP1A 2OZ3A 3DESA 4YTPA 5KVHA 3IJQA 2OA1A 1GPEA 3CNPA 4B64A 2P88A 4J34A 2QVHA 4U8IA 1EL9A 3AE9A 2IVDA 4RG4A 3NYFA 3L8KA 1LTXR 4DGKA 5CQFA 4N9XA 2P0IA 3F8DA 4YTMA 4EWJA 3HYXA 3ZDNA 1QO8A 3LZXA 4H2PA 5G5HB 1ONFA 4TM3A 2JB2A 4G6GA 2CHRA 2FJAA 4U8LA 4DX3A 3UJSA 2EQ8A 5FJTA 4A6GA 2BCPA 3K30A 1MO9A 4U8KA 3HZLA 3EF6A 4IVMB 2YAUA 1OJ9A 1TDFA 1L9EA 1X31B 3QKEA 1VDCA 3DK9A 3VA8A 4H50A 3TOYA 4CNKA 3I6DA 4G74A 5KMSA 3D47A 1LPFA 2R0GA 2ZZCA 2QQ6A 2C65A 1PJ6A 3SGLA 3C96A 3UJ2A 2AR8A 3U9IA 3SZWA 3GWFA 4RG3A 4GF7A 3AE4A 4EIQA 1PJ5A 4A6NB 5KOWA 3DMEA 3P9UA 4YSZA 1NEKA 3RP8A 1EBHA 1VDVA 3AE3A 2QDDA 3DG7A 5G5GB 1ECQA 2WU2A 3LOVA 1OJCA 1L0VA 2YVJA 1LJ1A 2Z5XA 3UOYA 2AKZA 4HPNA 4H7UA 2R46A 4AOXA 1BQGA 3SYIA 2YR5A 2BC0A 4NTEA 7ENLA 1V97A 3PK7A 2XLRA 3GDNA 1CF3A 3UOXA 4IVOB 3NTDA 3OZMA 4REKA 2WP5A 3CB3A 4II3A 3KKJA 3AN1A 4FI4A 2GAGB 4UDRA 2C64A 3IF9A 3KD9A 5U63A 1MRAA 4K8DA 2WHDA 2CULA 2AL2B 3FMWA 3PWGA 4YWOA 1R6WA 4USRA 2EQ7A 4H4QA 1NDAA 4U2TA 3UKLA 4O5UA 3MY9A 5GRTA 3DA1A 1NHRA 4OPCA 1Q1WA 1AOGA 4E5TA 1PBDA 3ALMA 2VVLG 1E6EA 2VZ2A 3T6CA 4U8JA 3T2KA 1FOHA 3I3LA 2I5QA 3R0KA 4EMWA 3DEQA 2F5ZA 1B8SA 4Z26A 2WDQA 2CDUA 3IHMA 3ICTA 1X2GA 3LJPA 4HB9A 4I58A 2W3SA 1H86A 4ZOHB 4EMJA 3MQTA 3VR9A 3NHOX 2OX4A 4Y4LA 1WYGA 3F8RA 1XHCA 4H2NA 3V5CA 3SM8A 2W0HA 2PHHA 2GQFA 3DK4A 3N4FA 2VRMA 3AEDA 4ECHA 1BKHA 2VRLA 3CTYA 3ITJA 1V59A 1S2QA 3DERA 3IJLA 3HPFA 1GTHA 4MGGA 4TVYA 1IUUA 4M52A 4H4WA 2YVFA 2Y6RA 2PS2A 5KWFA 4NEWA 2CFYA 1H81A 3S61A 4IP5A 5TR3A 4M0XA 1TKKA 2WOIA 2H88A 4I59A 4YTNA 4NNJA 3TJIA 4U2SA 3OC4A 3TWBA 4A7AA 3NIXA 4DWDA 2PTZA 3UCDA 1CJ4A 1MOKA 3UXKA 3UCLA 3AEEA 3MKCA 4Z24A 3ZLFA 1JRPA 5IQ1A 2X99A 2QGYA 5FJPA 2RGJA 1RVKA 1NHQA 3SBFA 3H8LA 4G73A 3SFEA 1MDRA 2BC1A 3VFCA 1W6TA 3L5OA 3RITA 1CJ2A 1N5XA 4NEVA 3A7UA 1X2HA 1GSNA 2PP3A 2GMHA 3S5SA 4E0VA 1YQZA 3ZVHA 3SQPA 3AE2A 2XH2A 4C3XA 2GR0A 1PHHA 1OJAA 1EBDA 1N60C 2GGEA 4GYPC 3BI5A 3FXGA 2YM2A 3T4WA 3VR8A 1GV4A 3NTAA 3T9PA 4J36A 1GETA 3RCYA 2C72A 3B9JB 4KT2A 3AYJA 2OLOA 4J1OA 1D4CA 2C75A 4IA6A 3CNJA 1F8WA 1GRGA 5KMRA 1PS9A 4GYPA 1KDGA 4U2LA 1H7WA 2ONEA 3AB1A 1CL0A 3UTEA 1TDNA 3P93A 3VC5A 2GSHA 1P43A 1FFUC 3MUCA 4CNJA 1TYTA 4GGBA 1OEPA 1REOA 1UKVG 5FS8A 3GWDA 2BS2A 3NZGA 1ELSA 1GXFA 2C3DA 3FIMB 3ALJA 2J3NA 3CGEA 5FS9A 4YSXA 1FEBA 4BV6A 1IUXA 4Z17A 4JY3A 1XPYA 2XGZA 2YVGA 3RNMA 4MKSA 1XDIA 3RP6A 1JPMA 3WE0A 1NU5A 1FL2A 4USQA 3DIPA 4YT0A 5FS6A 3AXBA 3JVAA 1MNSA 3OPSA 1L8PA 3VRAA 2PU0A 2XFUA 3QVRA 1JDFA 4PABA 3SY4A 2XH4A 5J60A 4J56A 3R10A 2GGIA 3VRBA 1LQTA 2C73A 4HNCA 3SN0A 4U8MA 3UP5A 3NRNA 2AKMA 3UCCA 1ZP0A 3AEAA 4B66A 2WDVA 3TJ4A 1IYXA 2E3TA 3NT6A 1B4VA 5KOXA 3DK8A 1NG3A 1OJTA 2ZBWA 1DODA 1O5WA 3UJRA 4Z25A 5EB5A 1M64A 3CGCA 2YLTA 2XLTA 1IJHA 3IWAA 4HA6A 2BK3A 5IPYA 3AYIA 4CCRA 4DNAA 2GMJA 2NVKX 2JAEA 2YLRA 2OALA 3S47A 1EBGA 3AEBA 1VQZA 1EC7A 5BOEA 5J04A 3NVVB 3H7VA 3HW2A 1MDLA 3NG7X 2BRAA 4H2QA 3COXA 2BCGG 3H12A 3V5FA 3DJJA 3NK1X 4NTDA 3NKSA 2EQ6A 3GRSA 1CJ3A 2XVJA 3FVDA 1ZOYA 2VOUA 4YSYA 2V6OA 2XFQA 2HXUA 3QVPA 1VQWA 1DOBA 4B67A 2PU1A 2OLAA 4H4XA 4B63A 4H19A 3A7RA 1PXBA 2IIDA 4CRTA 4DXKA 1SJDA 3P4RA 4DSGA 2GAHB 2YG3A 1GERA 3T8QA 3UKKA 3D46A 3P4SA 1XANA 2NQLA 2WP6A 3UJFA 2MUCA 3N6HA 1Y56A 4J3ZA 3CGBA 3K7MX 3EAOA 3H4KA 3CN8A 4TM1A 3F8PA 2PODA 3CPIG 1D7YA 2YLZA 2JKCA 1YQ3A 2MNRA 1D4DA 1GOSA 1F6MA 5L46A 1IUWA 3RO6A 3FV9A 4JY2A 3ES8A 2JB3A 2WDRA 3NLCA 5J7XA 4IL2A 3II4A 4K2XA 5JCMA 1ZX9A 1CHUA 4E4FA 2HNEA 2XFNA 5KNLA 2PTWA 1W4XA 3B6DA 2PGEA 3R0UA 1QLBA 2C76A 3NYCA 1SJBA 3SN4A 2PSNA 2OFJA 3ES7A 1TRBA 2A89A 2P8CA 4GGHA 4UP3A 3SSZA 3NRZB 3AMZA 3CNSA 2DKIA 1N61C 4H2RA 3JW7A 3UGVA 3CXBA 2PTXA 1GRFA 3GC2A 2ZADA 2CVJA 1PDYA 2R45A 1LVLA 3NVZB 3N6JA 3RHAA 1FEAA 4B68A 3VQRA 3NXLA 3A7AA 1Y0PA 1H2IA 4LA1A 2IVEA 4LIIA 5JCKA 3V4BA 4K1WA 3VC6A 4K8GA 4X9NA 1E7PA 1ZMDA 1JNZA 4E4UA 4NTCA 2POZA 2YLXA 1TDOA 4FP1A 2XLUA 3KU9A 1PJ7A 2YG4A 3REDA 4YXDA 2BA9A 2OVLA 3NK2X 5IDZA 3BI4A 1IUTA 4KX6A 2B9XA 3DGHA 3D8XA 4H2HA 3M12A 5FJUA 3OTRA 1N62C 3QN3A 5M0ZA 2YG5A 2AAQA 1PXAA 2BRYA 1YKJA 2X8HA 4CBQA 3I6EA 4JHMA 2YLWA 2ZZ0A 3K1GA 4G8TA 2C3CA 4H83A 3QFBA 2GGJA 3EANA 4JDRA 4J2WA 1KN0A 3BNUA 2GGHA 1NAAA 2OQHA 1GEUA 3HYVA 1N5WC 2FBWA 2V60A 4IHCA 3PO7A 4Y4MA 3P4QA 3LB8A 4ZCWA 1EL5A 4U8OA 1TE6A 4JQ9A 3C4NA 3BI2A 3VCCA 2TMDA 3OW1A 3R9UA 1PBFA 1Z6LA 3BOXA 1CBOA 3UTHA 3CPHG 4WCTA 4H4YA 4KEMA 4GDEA 3BJSA 2UZZA 3GYIA 1Q1RA 4BJYA 1GNDA 3IJIA 4OPLA 4G9KA 3EKGA 1KNPA 2DKHA 2WS3A 3S5WA 1COYA 3AD9B 3GD3A 1JOAA 2NPXA 1K0LA 2BS3A 4XXGA 1GRBA 1O94A 3AE5A 4K5SA 2W54A 4UDQA 3SZCA 1K0IA 2E5AA 1TZZA 2OZ8A 4G6HA 1ZMCA 2FYMA 1PXCA 3CXOA 5GSNA 2V61A 3AWIA 3MSYA 3ZVIA 5CKUA 2TPRA 3VCNA 1L9CA 2GVCA 4C74A 4J31A
chains in the Genus database with same CATH topology
4K5RA 3SY4A 4GDPA 5J60A 1YQ4A 3GDPA 1ONFA 4J56A 2JB2A 4G6GA 4TM3A 3VRBA 2FJAA 4U8LA 1GTEA 1LQTA 4FX9A 2C73A 4EM3A 1KFYA 4BK1A 2EQ8A 1L9DA 4U8MA 3ABVA 3UP5A 3NRNA 3UKFA 2BCPA 3K7TA 1MO9A 3K30A 4U8KA 3HZLA 4TM0A 3G5QA 3EF6A 4U8PA 3BNMA 2AQJA 2YAUA 4IVMB 2Q6UA 1OJ9A 1TDFA 3CMMA 1L9EA 2GR1A 1X31B 1IUSA 2C70A 1ZP0A 3QSEA 3AEAA 2RABA 1VDCA 3DK9A 4B66A 2WU5A 1ZKQA 4H50A 2WDVA 3AD8B 5FMHA 3T31A 2YWLA 3SFDA 4U8NA 3UKPA 5BULA 4Z2RA 1KSUA 4CNKA 1MXTA 3I6DA 3NT6A 4G74A 5KMSA 1LPFA 1BZLA 4YKFA 1B4VA 2R0GA 2ZZCA 5KOXA 3DK8A 4BURA 1PJ6A 1NG3A 1H6VA 2C65A 3C96A 1K4QA 2C7GA 2I0ZA 1OJTA 3PVCA 3SGLA 4YSHA 3C4AA 3QSMA 5KXJA 3UKHA 1PBBA 3D9XA 4H4RA 1KF6A 1DODA 1VG9A 2ZBWA 1S7MA 1O5WA 2AR8A 1E39A 2C67A 2X8GA 2Y6QA 4Z25A 5EB5A 3SZWA 1M64A 3GWFA 3CGCA 2YLTA 2XLTA 5U25A 2XVEA 3FPZA 4RG3A 3DJEA 3EPTA 4FK1C 4GF7A 1IJHA 3AE4A 3IWAA 3AEGA 4HA6A 4A79A 4EIQA 1PJ5A 4WX1A 1B5QA 4A6NB 2BK3A 4H4TA 3DMEA 5KOWA 2WEUA 3P9UA 4YSZA 4RSLA 1NEKA 2WOVA 1ZY8A 4J33A 3RP8A 5IPYA 3AYIA 2YQUA 4CCRA 4DNAA 3AE3A 2GMJA 2NVKX 2JAEA 3NYEA 2YLRA 1YY5A 2OALA 1IUVA 1E1NA 2WPFA 3QJ4A 3P1WA 4OCGA 5FS7A 3AEBA 1CC6A 4X9MA 2WPCA 2WU2A 2Q7VA 3LOVA 4FK1A 1OJCA 4LU6A 3DGZA 2A87A 4H4SA 3CNDA 4MJWA 1JNRA 2YVJA 1LJ1A 2Z5XA 3CPJG 2BK4A 1LV0A 3NG7X 3UOYA 2WBAA 4C5OA 2BRAA 4H7UA 2R46A 4H2QA 3UKAA 4AOXA 4Z2TA 3COXA 1DNCA 2BCGG 1DJNA 2R4JA 2QAEA 3SYIA 2YR5A 4AP3A 4GCMA 2QA2A 5M10A 2BC0A 3DJJA 1FECA 3NK1X 4NTEA 3NGCX 4C77A 4NTDA 4NZHA 2GRTA 1B37A 4GAVA 2APGA 2XLRA 3OZ2A 3GDNA 3NKSA 2EQ6A 3GRSA 1DJQA 1CF3A 2V3AA 1RP0A 3UOXA 4TLZA 4D03A 4IVOB 1CJ3A 4OVIA 2XVJA 3NTDA 3IC9A 3B3RA 1JU2A 1ZOYA 2VOUA 1H82A 1BGNA 4REKA 2XFOA 3GMBA 1JRZA 3K7QX 4YSYA 1EL7A 2WP5A 1S3EA 4TLXA 2V6OA 1GT8A 4ADWA 2XFQA 3QVPA 1VQWA 4II3A 5IQ4A 1DOBA 4B67A 3KKJA 2EQ9A 1BF3A 4Z2UA 2VVLA 3GYJA 3ALLA 1CJCA 2GAGB 4H4XA 4B63A 1JRYA 1PXBA 2IIDA 2R9ZA 2PYXA 3T37A 4CRTA 1KNRA 2FJDA 4JNAA 4UDRA 4BK2A 2V3BA 5EBKA 2WOWA 1FCDA 3O0HA 1NG4A 2C64A 2O9ZA 2R0CA 2Z5YA 3IF9A 3KD9A 4A6NA 5U63A 4PAAA 3Q6JA 3P4RA 4K8DA 2OLNA 2WHDA 4DSGA 2CULA 2GAHB 2YG3A 3UTGA 1P2HA 1GERA 3FMWA 3UKKA 1PBEA 3P4SA 1XANA 2WP6A 4YWOA 1TDKA 3ADAB 1GESA 4AOSA 1Y56A 3VRDB 1GRTA 3T2ZA 3V3OA 3AE6A 3CGBA 2ACZA 5HY5A 1D5TA 3K7MX 1S3BA 4USRA 3EAOA 3H4KA 3CN8A 2EQ7A 1JEHA 4H4QA 4B69A 5ER0A 4TM1A 1NDAA 1L0VA 4OPTA 3F8PA 3GSIA 4U2TA 3CPIG 1D7YA 2YLZA 4O5QA 3UKLA 5BVAA 3SX6A 4O5UA 2E4GA 3CIRA 4DSHA 2JKCA 3UOZA 5GRTA 3DA1A 5JCIA 3UKQA 4H4UA 1NHRA 1YQ3A 4NWZA 1GOSA 1D4DA 3G5SA 1F6MA 4OPCA 1Q1WA 4XWZA 1AOGA 5L46A 3AD7B 1IUWA 2XLSA 1N4VA 1PBDA 2GB0A 3M13A 2FJEA 4JY2A 3ALMA 1TYPA 2VVLG 4II2A 1E6EA 2JB3A 2VZ2A 1EL8A 2ARDA 2XDOA 2WDRA 4TM4A 1E1MA 3NLCA 4U8JA 5J7XA 3QSSA 3II4A 3T2KA 1FOHA 1S2YA 2JBVA 4H4PA 1TDEA 2H89A 3I3LA 4K2XA 4D04A 5JCMA 3ISHA 1ZX9A 4EMWA 3AECA 2F5ZA 2GR3A 1B8SA 4FDCB 1CHUA 2WQYA 4Z26A 2WDQA 4APNA 2YG6A 2CDUA 3IHMA 2XFNA 3ICTA 3GRTA 5KNLA 1W4XA 3LJPA 5JCNA 4HB9A 2GH5A 3B6DA 4I58A 1H86A 3LZWA 4EMJA 3AE7A 1QLBA 2JB1A 4EIPA 2C76A 3NYCA 1VRQB 1M6IA 1GRHA 3T2YA 1NHSA 2XYOA 3T0KA 4OPUA 3P4PA 1TRBA 3VR9A 2A89A 1NHPA 3NHOX 4UP3A 4Y4LA 4XWRA 1Y56B 1F8SA 3F8RA 3CNSA 2XVFA 5KMPA 2DKIA 1ZK7A 5HXIA 4H2RA 1XHCA 4ZCCA 4H2NA 3BHKA 3SM8A 2W0HA 3CNTA 2FJBA 2PHHA 1K0JA 3PS9A 2GQFA 3ICRA 3DK4A 2VRMA 3QFAA 1GRFA 3AYLA 2VQ7A 2C4CA 2XVHA 4A65A 3AEDA 4ECHA 2VRLA 3CTYA 3DJDA 3ITJA 2CVJA 1DXLA 4GRTA 2R45A 2BK5A 3DH9A 3PG6A 1H84A 1LVLA 4AT2A 1V59A 4EMIA 5EB4A 1S2QA 3LXDA 3RHAA 3SXIA 1FEAA 4B68A 3VQRA 4A99A 4P9SA 1GTHA 1IUUA 4M52A 4OPGA 3KPFA 1Y0PA 1H2IA 4H4WA 2YVFA 4LA1A 2IVEA 2Y6RA 2XVIA 4LIIA 5JCKA 1H7XA 2X50A 1P2EA 3M0OA 3JSKA 5KWFA 4NEWA 3SZ0A 2CFYA 1H81A 1ZOVA 3S61A 4X9NA 2HQMA 1E7PA 1CC4A 1ZMDA 2C66A 3FBSA 3HYWA 3KA7A 5TR3A 1JNZA 3URHA 1JRXA 4NTCA 2WOIA 4H4VA 1BKWA 2H88A 2VVMA 4ZN0A 4ZCDA 2R0PA 4I59A 2V5ZA 4EM4A 2YLXA 1TDOA 1H83A 2XLUA 3ATRA 3KU9A 4NNJA 4YTNA 1Q9IA 4AT0A 1PJ7A 3IHGA 3NH3X 2B76A 4U2SA 3OC4A 2YG4A 5C2TA 4Z44A 3REDA 2WP9A 2BA9A 3NN0X 4YXDA 2GV8A 5BUKA 4A7AA 3GMCA 1PBCA 3NIXA 2XFPA 2A8XA 3NK2X 3BI4A 1CC2A 1NPXA 2BYBA 1IUTA 4OPDA 4KX6A 4CY8A 3ZYXA 3E1TA 4C3YA 1CJ4A 2B9XA 3DGHA 2GR2A 2E5VA 3D8XA 2WPEA 2RGOA 1MOKA 2XLPA 3UCLA 3V76A 2YG7A 1VG0A 3AEEA 3M12A 5JCLA 4Z24A 3RP7A 5KRQA 4EQXA 2BACA 2QA1A 2X99A 5IQ1A 3V3NA 4Z43A 5M0ZA 2YG5A 2AAQA 1PXAA 2RGJA 2GQWA 2YR6A 2BRYA 3ATQA 4ICYA 1NHQA 5HYMA 4K7ZA 1DOCA 3H8LA 1YKJA 2BC1A 2X8HA 2B9YA 4G73A 3SFEA 4BK3A 1F8RA 2ZZBA 4CBQA 1CJ2A 3L5OA 2BS4A 2YLWA 3AE8A 2OAMA 2ZZ0A 4NEVA 3SZFA 4A5LA 1GSNA 3T14A 2YM1A 1ZDLA 1D4EA 1GRAA 2C3CA 1D7LA 3BHFA 3KPKA 1O95A 2GMHA 2JK6A 5LV9A 1E1KA 3GYXA 4E0VA 3QFBA 1YQZA 4YKGA 3SQPA 3AE2A 1LQUA 3EANA 2XCGA 4C3XA 1PN0A 2GR0A 1PHHA 1OJAA 1EBDA 4H4ZA 4JDRA 4J2WA 1KN0A 3BI5A 4GAPA 3BNUA 4OPIA 2YM2A 1E1LA 3GD4A 1KSSA 4CCQA 3VR8A 4J57A 1GV4A 1NAAA 4GR1A 3NTAA 1GEUA 2Q0KA 3NNEA 2GF3A 4J36A 1GETA 2C72A 4A9WA 3HYVA 5EOWA 3AYJA 4KPRA 2BXSA 2OLOA 4B1BA 2FBWA 4EQWA 2V60A 2WETA 1D4CA 2C75A 3PO7A 4BJZA 4Y4MA 4IA6A 3P4QA 3LB8A 3CNJA 1OJDA 1F8WA 1GRGA 1EL5A 2B7SA 5KMRA 2YR4A 1PS9A 1F3PA 3ICSA 4U8OA 4JQ9A 3C4NA 5BRTA 1KDGA 4K22A 3BI2A 4IV9A 2TMDA 1BGJA 4U2LA 1H7WA 3UTFA 3AB1A 1CL0A 2RGHA 3UTEA 5DBJA 3R9UA 2X3NA 1PBFA 1TDNA 1Z6LA 3AEFA 1BWCA 4IA5A 4CNJA 1CBOA 3AE1A 5KMQA 1TYTA 3UTHA 3H8IA 3G5RA 3CPHG 4WCTA 1REOA 2E1MA 3KLJA 1UKVG 4H4YA 4GDEA 5HHFA 3NN6X 2UZZA 4JNQA 5FS8A 3GYIA 3DJGX 5U1OA 1Q1RA 3GWDA 2BS2A 2R4EA 2YLSA 4C74A 1N4UA 1NENA 1RYIA 3Q9TA 4BJYA 1GXFA 1ELIA 2C3DA 5KVIA 1GNDA 4CY6A 4EQSA 3FIMB 1N1PA 1GREA 4OPLA 4G9KA 2B7RA 3ALJA 2J3NA 3CGEA 5FS9A 1KNPA 1SEZA 1GALA 1XPQA 2DKHA 2WS3A 1RSGA 3S5WA 3UP4A 1FEBA 5JRBA 1COYA 2B9WA 4BV6A 3AD9B 4YSXA 3GD3A 1IUXA 2BXRA 1DOEA 3D1CA 5C3JA 1PDHA 1JOAA 2NPXA 2Q0LA 4JY3A 1K0LA 4GUVA 4AP1A 4JN9A 2BS3A 4XXGA 2YVGA 3RNMA 4YTPA 5KVHA 1GRBA 1O94A 2OA1A 1GPEA 1XDIA 3CNPA 3RP6A 4B64A 3KVEA 4Y4NA 3FG2P 3AE5A 4J34A 2BABA 4K5SA 4U8IA 3WE0A 1FL2A 1EL9A 4UDQA 3SZCA 3AE9A 1K0IA 2IVDA 4RG4A 4USQA 3NYFA 3UOVA 1QJDA 3L8KA 4G6HA 4YT0A 3LADA 5FS6A 1LTXR 1ZMCA 2VQBA 4X4JA 1N4WA 2X8CA 1PXCA 4EQRA 4DGKA 2QCUA 5CQFA 5GSNA 3AXBA 4UDPA 2V61A 3AWIA 4N9XA 2WESA 3F8DA 5CKUA 4YTMA 3VRAA 3HYXA 3NK0X 2XFUA 2TPRA 3QVRA 1L9CA 1QO8A 3ZDNA 2GVCA 2GEWA 3CGDA 3LZXA 3L1RA 4H2PA 4PABA 1HYUA 4B65A 4J31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K5R A;  4GDP A;  5J60 A;  1YQ4 A;  3GDP A;  1ONF A;  4J56 A;  2JB2 A;  4TM3 A;  3VRB A;  2FJA A;  4U8L A;  1GTE A;  1LQT A;  4FX9 A;  2C73 A;  4EM3 A;  1KFY A;  4BK1 A;  2EQ8 A;  1L9D A;  4U8M A;  3ABV A;  3UP5 A;  3NRN A;  3UKF A;  2BCP A;  3K7T A;  1MO9 A;  3K30 A;  4U8K A;  3HZL A;  4TM0 A;  3G5Q A;  3EF6 A;  4U8P A;  3BNM A;  2AQJ A;  2YAU A;  4IVM B;  2Q6U A;  1OJ9 A;  1TDF A;  1L9E A;  2GR1 A;  1X31 B;  1IUS A;  2C70 A;  1ZP0 A;  3QSE A;  3AEA A;  2RAB A;  1VDC A;  3DK9 A;  4B66 A;  2WU5 A;  1ZKQ A;  4H50 A;  2WDV A;  3AD8 B;  5FMH A;  2YWL A;  3SFD A;  4U8N A;  3UKP A;  5BUL A;  4Z2R A;  1KSU A;  4CNK A;  1MXT A;  3I6D A;  3NT6 A;  1LPF A;  1BZL A;  4YKF A;  1B4V A;  2R0G A;  2ZZC A;  5KOX A;  3DK8 A;  4BUR A;  1PJ6 A;  1NG3 A;  1H6V A;  2C65 A;  3C96 A;  1K4Q A;  2C7G A;  2I0Z A;  1OJT A;  3PVC A;  3SGL A;  4YSH A;  3C4A A;  3QSM A;  5KXJ A;  3UKH A;  1PBB A;  4H4R A;  2ZBW A;  1KF6 A;  1DOD A;  1VG9 A;  1O5W A;  2AR8 A;  1E39 A;  2C67 A;  2X8G A;  2Y6Q A;  4Z25 A;  5EB5 A;  1M64 A;  3GWF A;  3CGC A;  2YLT A;  2XLT A;  5U25 A;  2XVE A;  3FPZ A;  4RG3 A;  3DJE A;  3EPT A;  4FK1 C;  4GF7 A;  1IJH A;  3AE4 A;  3IWA A;  3AEG A;  4HA6 A;  4A79 A;  4EIQ A;  1PJ5 A;  4WX1 A;  1B5Q A;  4A6N B;  2BK3 A;  4H4T A;  3DME A;  5KOW A;  2WEU A;  3P9U A;  4YSZ A;  4RSL A;  1NEK A;  2WOV A;  1ZY8 A;  4J33 A;  3RP8 A;  5IPY A;  3AYI A;  2YQU A;  4CCR A;  4DNA A;  3AE3 A;  2GMJ A;  2NVK X;  2JAE A;  3NYE A;  2YLR A;  1YY5 A;  2OAL A;  1IUV A;  1E1N A;  2WPF A;  3QJ4 A;  3P1W A;  4OCG A;  5FS7 A;  3AEB A;  1CC6 A;  4X9M A;  2WPC A;  2WU2 A;  2Q7V A;  3LOV A;  4FK1 A;  1OJC A;  4LU6 A;  3DGZ A;  2A87 A;  4H4S A;  3CND A;  4MJW A;  1JNR A;  2YVJ A;  1LJ1 A;  2Z5X A;  3CPJ G;  2BK4 A;  1LV0 A;  3NG7 X;  3UOY A;  2WBA A;  4C5O A;  4H7U A;  2R46 A;  4H2Q A;  3UKA A;  4AOX A;  4Z2T A;  3COX A;  1DNC A;  2BCG G;  1DJN A;  2R4J A;  2QAE A;  2YR5 A;  4AP3 A;  4GCM A;  2QA2 A;  5M10 A;  2BC0 A;  3DJJ A;  1FEC A;  3NK1 X;  4NTE A;  3NGC X;  4C77 A;  4NTD A;  4NZH A;  2GRT A;  1B37 A;  2APG A;  2XLR A;  3OZ2 A;  3GDN A;  3NKS A;  2EQ6 A;  3GRS A;  1DJQ A;  1CF3 A;  1RP0 A;  2V3A A;  3UOX A;  4TLZ A;  4D03 A;  4IVO B;  1CJ3 A;  4OVI A;  2XVJ A;  3NTD A;  3IC9 A;  3B3R A;  1JU2 A;  1ZOY A;  2VOU A;  1H82 A;  1BGN A;  4REK A;  2XFO A;  3GMB A;  1JRZ A;  3K7Q X;  4YSY A;  1EL7 A;  2WP5 A;  1S3E A;  4TLX A;  2V6O A;  1GT8 A;  4ADW A;  2XFQ A;  3QVP A;  1VQW A;  5IQ4 A;  1DOB A;  4B67 A;  3KKJ A;  2EQ9 A;  1BF3 A;  4Z2U A;  2VVL A;  3GYJ A;  3ALL A;  1CJC A;  2GAG B;  4H4X A;  4B63 A;  1JRY A;  1PXB A;  2IID A;  2R9Z A;  2PYX A;  3T37 A;  4CRT A;  1KNR A;  2FJD A;  4JNA A;  4UDR A;  4BK2 A;  2V3B A;  5EBK A;  2WOW A;  1FCD A;  3O0H A;  1NG4 A;  2C64 A;  2O9Z A;  2R0C A;  2Z5Y A;  3IF9 A;  3KD9 A;  4A6N A;  5U63 A;  4PAA A;  3Q6J A;  3P4R A;  4K8D A;  2OLN A;  2WHD A;  4DSG A;  2CUL A;  2GAH B;  2YG3 A;  3UTG A;  1P2H A;  1GER A;  3FMW A;  3UKK A;  1PBE A;  3P4S A;  1XAN A;  2WP6 A;  4YWO A;  1TDK A;  3ADA B;  1GES A;  4AOS A;  1Y56 A;  3VRD B;  1GRT A;  3V3O A;  3AE6 A;  3CGB A;  2ACZ A;  5HY5 A;  1D5T A;  3K7M X;  1S3B A;  4USR A;  3EAO A;  3H4K A;  3CN8 A;  2EQ7 A;  1JEH A;  4H4Q A;  4B69 A;  5ER0 A;  4TM1 A;  1NDA A;  1L0V A;  4OPT A;  3F8P A;  3GSI A;  4U2T A;  3CPI G;  1D7Y A;  2YLZ A;  4O5Q A;  3UKL A;  5BVA A;  4DSH A;  4O5U A;  2E4G A;  3CIR A;  2JKC A;  3UOZ A;  5GRT A;  3DA1 A;  5JCI A;  3UKQ A;  4H4U A;  1NHR A;  1YQ3 A;  1GOS A;  1D4D A;  3G5S A;  1F6M A;  4OPC A;  1Q1W A;  4XWZ A;  1AOG A;  5L46 A;  3AD7 B;  1IUW A;  2XLS A;  1N4V A;  1PBD A;  2GB0 A;  3M13 A;  2FJE A;  4JY2 A;  3ALM A;  1TYP A;  2VVL G;  1E6E A;  2JB3 A;  2VZ2 A;  1EL8 A;  2ARD A;  2XDO A;  2WDR A;  4TM4 A;  1E1M A;  3NLC A;  4U8J A;  5J7X A;  3QSS A;  3II4 A;  1FOH A;  1S2Y A;  2JBV A;  4H4P A;  1TDE A;  2H89 A;  3I3L A;  4K2X A;  4D04 A;  5JCM A;  3ISH A;  1ZX9 A;  4EMW A;  3AEC A;  2F5Z A;  2GR3 A;  1B8S A;  4FDC B;  1CHU A;  2WQY A;  4Z26 A;  2WDQ A;  4APN A;  2YG6 A;  2CDU A;  3IHM A;  2XFN A;  3ICT A;  3GRT A;  1W4X A;  3LJP A;  5JCN A;  4HB9 A;  2GH5 A;  3B6D A;  4I58 A;  1H86 A;  3LZW A;  4EMJ A;  3AE7 A;  1QLB A;  2JB1 A;  4EIP A;  2C76 A;  3NYC A;  1VRQ B;  1M6I A;  1GRH A;  1NHS A;  2XYO A;  4OPU A;  3P4P A;  1TRB A;  3VR9 A;  2A89 A;  1NHP A;  3NHO X;  4UP3 A;  4Y4L A;  4XWR A;  1Y56 B;  1F8S A;  3F8R A;  3CNS A;  2XVF A;  2DKI A;  1ZK7 A;  5HXI A;  4H2R A;  1XHC A;  4ZCC A;  4H2N A;  3BHK A;  3SM8 A;  2W0H A;  3CNT A;  2FJB A;  2PHH A;  1K0J A;  3PS9 A;  2GQF A;  3ICR A;  3DK4 A;  2VRM A;  3QFA A;  1GRF A;  3AYL A;  2VQ7 A;  2XVH A;  4A65 A;  3AED A;  4ECH A;  2VRL A;  3CTY A;  3DJD A;  3ITJ A;  2CVJ A;  1DXL A;  4GRT A;  2R45 A;  2BK5 A;  3DH9 A;  1H84 A;  1LVL A;  4AT2 A;  1V59 A;  4EMI A;  5EB4 A;  1S2Q A;  3LXD A;  3RHA A;  1FEA A;  4B68 A;  3VQR A;  4A99 A;  4P9S A;  1GTH A;  1IUU A;  4M52 A;  4OPG A;  3KPF A;  1Y0P A;  4H4W A;  2YVF A;  4LA1 A;  2IVE A;  2Y6R A;  2XVI A;  4LII A;  5JCK A;  1H7X A;  2X50 A;  1P2E A;  3M0O A;  3JSK A;  5KWF A;  4NEW A;  2CFY A;  1H81 A;  1ZOV A;  3S61 A;  4X9N A;  2HQM A;  1E7P A;  1CC4 A;  1ZMD A;  2C66 A;  3FBS A;  3KA7 A;  5TR3 A;  1JNZ A;  3URH A;  1JRX A;  4NTC A;  2WOI A;  4H4V A;  1BKW A;  2H88 A;  2VVM A;  4ZN0 A;  4ZCD A;  2R0P A;  4I59 A;  2V5Z A;  4EM4 A;  2YLX A;  1TDO A;  1H83 A;  2XLU A;  3ATR A;  3KU9 A;  4YTN A;  1Q9I A;  4AT0 A;  1PJ7 A;  3IHG A;  3NH3 X;  2B76 A;  4U2S A;  3OC4 A;  2YG4 A;  5C2T A;  4Z44 A;  3RED A;  2WP9 A;  2BA9 A;  3NN0 X;  4YXD A;  2GV8 A;  5BUK A;  4A7A A;  3GMC A;  1PBC A;  3NIX A;  2XFP A;  2A8X A;  3NK2 X;  3BI4 A;  1CC2 A;  1NPX A;  2BYB A;  1IUT A;  4OPD A;  4KX6 A;  4CY8 A;  3ZYX A;  3E1T A;  4C3Y A;  1CJ4 A;  2B9X A;  3DGH A;  2GR2 A;  2E5V A;  3D8X A;  2WPE A;  2RGO A;  1MOK A;  2XLP A;  3UCL A;  3V76 A;  2YG7 A;  1VG0 A;  3AEE A;  3M12 A;  5JCL A;  4Z24 A;  3RP7 A;  5KRQ A;  4EQX A;  2BAC A;  2QA1 A;  2X99 A;  5IQ1 A;  3V3N A;  4Z43 A;  5M0Z A;  2YG5 A;  2AAQ A;  1PXA A;  2RGJ A;  2GQW A;  2YR6 A;  3ATQ A;  4ICY A;  1NHQ A;  5HYM A;  4K7Z A;  1DOC A;  3H8L A;  1YKJ A;  2BC1 A;  2X8H A;  2B9Y A;  3SFE A;  4BK3 A;  1F8R A;  2ZZB A;  4CBQ A;  1CJ2 A;  2BS4 A;  2YLW A;  3AE8 A;  2OAM A;  2ZZ0 A;  4NEV A;  4A5L A;  1GSN A;  2YM1 A;  1ZDL A;  1D4E A;  1GRA A;  2C3C A;  1D7L A;  3BHF A;  1O95 A;  2GMH A;  2JK6 A;  5LV9 A;  1E1K A;  4E0V A;  3QFB A;  1YQZ A;  4YKG A;  3SQP A;  3AE2 A;  1LQU A;  3EAN A;  2XCG A;  4C3X A;  1PN0 A;  2GR0 A;  1PHH A;  1OJA A;  1EBD A;  4H4Z A;  4JDR A;  4J2W A;  3BI5 A;  3BNU A;  4OPI A;  2YM2 A;  1E1L A;  3GD4 A;  1KSS A;  4CCQ A;  3VR8 A;  4J57 A;  1GV4 A;  1NAA A;  4GR1 A;  3NTA A;  1GEU A;  2Q0K A;  3NNE A;  2GF3 A;  4J36 A;  1GET A;  2C72 A;  4A9W A;  5EOW A;  3AYJ A;  4KPR A;  2BXS A;  2OLO A;  4B1B A;  2FBW A;  4EQW A;  2V60 A;  2WET A;  1D4C A;  2C75 A;  3PO7 A;  4BJZ A;  4Y4M A;  4IA6 A;  3P4Q A;  3LB8 A;  3CNJ A;  1OJD A;  1F8W A;  1GRG A;  1EL5 A;  2B7S A;  2YR4 A;  1PS9 A;  1F3P A;  3ICS A;  4U8O A;  4JQ9 A;  3C4N A;  5BRT A;  1KDG A;  4K22 A;  3BI2 A;  4IV9 A;  2TMD A;  1BGJ A;  4U2L A;  1H7W A;  3UTF A;  3AB1 A;  1CL0 A;  2RGH A;  3UTE A;  5DBJ A;  3R9U A;  2X3N A;  1PBF A;  1TDN A;  1Z6L A;  3AEF A;  1BWC A;  4IA5 A;  4CNJ A;  1CBO A;  3AE1 A;  3UTH A;  1TYT A;  3H8I A;  3G5R A;  3CPH G;  4WCT A;  1REO A;  2E1M A;  3KLJ A;  1UKV G;  4H4Y A;  4GDE A;  5HHF A;  3NN6 X;  2UZZ A;  4JNQ A;  5FS8 A;  3GYI A;  3DJG X;  5U1O A;  1Q1R A;  3GWD A;  2BS2 A;  2R4E A;  2YLS A;  4C74 A;  1N4U A;  1NEN A;  1RYI A;  3Q9T A;  4BJY A;  1GXF A;  1ELI A;  2C3D A;  5KVI A;  1GND A;  4CY6 A;  4EQS A;  3FIM B;  1N1P A;  1GRE A;  4OPL A;  2B7R A;  3ALJ A;  2J3N A;  3CGE A;  5FS9 A;  1KNP A;  1SEZ A;  1GAL A;  1XPQ A;  2DKH A;  2WS3 A;  1RSG A;  3S5W A;  3UP4 A;  1FEB A;  1COY A;  3AD9 B;  2B9W A;  4BV6 A;  4YSX A;  3GD3 A;  1IUX A;  2BXR A;  1DOE A;  3D1C A;  5C3J A;  1PDH A;  1JOA A;  2NPX A;  2Q0L A;  4JY3 A;  1K0L A;  4GUV A;  4AP1 A;  4JN9 A;  2BS3 A;  4XXG A;  2YVG A;  3RNM A;  4YTP A;  5KVH A;  1GRB A;  1O94 A;  2OA1 A;  1GPE A;  1XDI A;  3CNP A;  3RP6 A;  4B64 A;  3KVE A;  4Y4N A;  3FG2 P;  3AE5 A;  4J34 A;  2BAB A;  4K5S A;  4U8I A;  3WE0 A;  1FL2 A;  1EL9 A;  4UDQ A;  3AE9 A;  1K0I A;  2IVD A;  4RG4 A;  4USQ A;  3NYF A;  3UOV A;  1QJD A;  3L8K A;  4YT0 A;  3LAD A;  5FS6 A;  1LTX R;  1ZMC A;  2VQB A;  4X4J A;  1N4W A;  2X8C A;  1PXC A;  4EQR A;  4DGK A;  2QCU A;  5CQF A;  5GSN A;  3AXB A;  4UDP A;  2V61 A;  3AWI A;  4N9X A;  2WES A;  3F8D A;  5CKU A;  4YTM A;  3VRA A;  3NK0 X;  2XFU A;  2TPR A;  3QVR A;  1L9C A;  1QO8 A;  3ZDN A;  2GVC A;  2GEW A;  3CGD A;  3LZX A;  3L1R A;  4H2P A;  4PAB A;  1HYU A;  4B65 A;  4J31 A; 
#chains in the Genus database with same CATH topology
 1YQ4 A;  3GDP A;  1GTE A;  4FX9 A;  2P3Z A;  1KFY A;  3UKF A;  3K7T A;  3Q4D A;  4TM0 A;  4HN8 A;  4U8P A;  3BNM A;  2AQJ A;  3CMM A;  2GR1 A;  2C70 A;  2RAB A;  2WU5 A;  1ZKQ A;  3AD8 B;  3SFD A;  4U8N A;  3DGB A;  1KSU A;  1BZL A;  1H6V A;  2C7G A;  2HXT A;  2I0Z A;  3PVC A;  5KXJ A;  3D9X A;  4H4R A;  1KF6 A;  2GL5 A;  1S7M A;  2Y6Q A;  3FPZ A;  5U25 A;  3DJE A;  3EPT A;  4FK1 C;  3AEG A;  4A79 A;  2WEU A;  2WOV A;  1ZY8 A;  2XH0 A;  3PWI A;  2AL2 A;  2YQU A;  3RR1 A;  1YY5 A;  1IUV A;  3QJ4 A;  2OPJ A;  5FS7 A;  3NO1 A;  4X9M A;  2WPC A;  2Q7V A;  4FK1 A;  3DGZ A;  3CND A;  4H4S A;  3SN1 A;  3UXL A;  1JNR A;  1LV0 A;  2WBA A;  4C5O A;  3UKA A;  2R4J A;  2QA2 A;  5M10 A;  4C77 A;  2GRT A;  3TQP A;  1DJQ A;  1RP0 A;  4TLZ A;  1ONE A;  1JU2 A;  4TVW A;  3FCP A;  2XFO A;  1JRZ A;  2QJM A;  4ADW A;  5IQ4 A;  2EQ9 A;  1BF3 A;  4Z2U A;  1CJC A;  1JRY A;  2PYX A;  2DW6 A;  3DG6 A;  3T37 A;  4BK2 A;  3OZY A;  5EBK A;  2WOW A;  1FCD A;  1NG4 A;  2Z5Y A;  2R0C A;  3Q6J A;  1PBE A;  1TDK A;  1GES A;  2OO6 A;  3VRD B;  1GRT A;  3T2Z A;  3AE6 A;  2ACZ A;  1S3B A;  1F9C A;  2XH7 A;  5ER0 A;  4OPT A;  3GSI A;  5BVA A;  2GGG A;  4DSH A;  4E8G A;  3UKQ A;  4F4R A;  1STZ A;  2AL1 A;  4NWZ A;  3G5S A;  4XWZ A;  2GDQ A;  2XLS A;  3M13 A;  1TYP A;  2XDO A;  2ARD A;  1E1M A;  3QSS A;  3H70 A;  2JBV A;  1TDE A;  2H89 A;  2OKT A;  3R1Z A;  1SJA A;  2W55 A;  4X2P A;  3CAW A;  2GR3 A;  4FDC B;  2WQY A;  2YG6 A;  3GRT A;  4MMW A;  1SB3 B;  5JCN A;  2GH5 A;  3LZW A;  2PPG A;  4EIP A;  3AM9 A;  1NHS A;  3DG3 A;  3T0K A;  4OPU A;  1NHP A;  3GY1 A;  2FKP A;  3BHK A;  1YEY A;  2FJB A;  3PS9 A;  3ICR A;  3STP A;  1KKR A;  1DXL A;  3TW9 A;  3CYJ A;  4AT2 A;  4IP4 A;  1NEL A;  4A99 A;  4P9S A;  4OPG A;  4GFI A;  2XVI A;  1H7X A;  2X50 A;  1P2E A;  4E6M A;  3SZ0 A;  2HQM A;  2C66 A;  3KA7 A;  3HYW A;  3OP2 A;  3URH A;  1JRX A;  4H4V A;  1BKW A;  4ZN0 A;  4ZCD A;  2R0P A;  2V5Z A;  3ATR A;  2B76 A;  4Z44 A;  2WP9 A;  3NN0 X;  2GV8 A;  3FYY A;  3GMC A;  1PBC A;  2A8X A;  3VDG A;  1R0M A;  1CC2 A;  3CK5 A;  4H1Z A;  3MWC A;  4OPD A;  4CY8 A;  3ZYX A;  4C3Y A;  2OQY A;  2GR2 A;  2XLP A;  3V76 A;  5JCL A;  4YWS A;  3RP7 A;  5KRQ A;  3V3N A;  2QA1 A;  4Z43 A;  2PA6 A;  3V3W A;  2GQW A;  2YR6 A;  3ATQ A;  2B9Y A;  4IT1 A;  2ZZB A;  4HYR A;  4A35 A;  1ZDL A;  5LV9 A;  3GYX A;  4YKG A;  1LQU A;  3ENL A;  1E1L A;  3GD4 A;  1KSS A;  3PFR A;  4J57 A;  3DFY A;  4GR1 A;  2Q0K A;  4A9W A;  5EOW A;  4KPR A;  2BXS A;  4EQW A;  1OJD A;  4JN7 A;  1F3P A;  3ICS A;  3R25 A;  1KD0 A;  4K22 A;  2RGH A;  3QTP A;  3R11 A;  2QJN A;  2HZG A;  3TCS A;  2PP1 A;  3THU A;  2DW7 A;  2E1M A;  3KLJ A;  4DYE A;  3UJE A;  4JNQ A;  3DJG X;  5U1O A;  1N4U A;  1NEN A;  3SR6 B;  3Q9T A;  4JN8 A;  4CY6 A;  6ENL A;  3BSM A;  4IZG A;  3ZVH B;  1SEZ A;  1XPQ A;  1GAL A;  3UP4 A;  2B9W A;  5C3J A;  1PDH A;  3EUB 3;  4GUV A;  4JN9 A;  1WUF A;  3KVE A;  4Y4N A;  3FG2 P;  2BAB A;  3FJ4 A;  1SJC A;  3UOV A;  3NVW B;  1QJD A;  3LAD A;  2VQB A;  4X4J A;  1ZXI C;  1N4W A;  2X8C A;  4EQR A;  3I4K A;  2QCU A;  4HCL A;  4UDP A;  3EEZ A;  2WES A;  4ROP A;  3NK0 X;  2GEW A;  3CGD A;  3L1R A;  4A65 A;  1HYU A;  4B65 A;  3JZU A;  3SJN A;  4K5R A;  4GDP A;  3KUM A;  5BOF A;  3ETR B;  4EM3 A;  4BK1 A;  1L9D A;  3ABV A;  4GME A;  2PCE A;  3Q45 A;  3GO2 A;  3G5Q A;  2Q6U A;  1IUS A;  3QSE A;  5FMH A;  2YWL A;  3UKP A;  5BUL A;  4Z2R A;  5ENL A;  1MXT A;  1KKO A;  4YKF A;  1JRO A;  4BUR A;  3R07 C;  1K4Q A;  4ZA0 A;  4YSH A;  3C4A A;  3QSM A;  3UKH A;  2PP0 A;  1PBB A;  1VG9 A;  3DDM A;  1EC9 A;  1FHV A;  1E39 A;  2C67 A;  2X8G A;  2XVE A;  1KCZ A;  4WX1 A;  1B5Q A;  4H4T A;  4RSL A;  4J33 A;  2QJJ A;  4K2S A;  3NYE A;  3CT2 A;  1E1N A;  2WPF A;  3P1W A;  4ENL A;  4OCG A;  1CC6 A;  1P48 A;  4LU6 A;  2A87 A;  4MJW A;  3T31 A;  3CPJ G;  2BK4 A;  4KWS A;  4HNL A;  4Z2T A;  1PDZ A;  1DNC A;  1DJN A;  2QAE A;  4AP3 A;  4GCM A;  1FEC A;  3NGC X;  4NZH A;  2W3R A;  3I6T A;  1B37 A;  4GAV A;  2P8B A;  2APG A;  3OZ2 A;  2V3A A;  4D03 A;  4OVI A;  3IC9 A;  3TTE A;  3B3R A;  3NS1 B;  1H82 A;  1BGN A;  3GMB A;  3K7Q X;  1EL7 A;  4TLX A;  1S3E A;  1GT8 A;  1DTN A;  1FIQ B;  2VVL A;  3GYJ A;  3ALL A;  2R9Z A;  1KNR A;  2FJD A;  4JNA A;  2V3B A;  2O9Z A;  1JPD X;  4KPL A;  3O0H A;  4A6N A;  4PAA A;  2OLN A;  2O56 A;  3UTG A;  1P2H A;  4M6U A;  3N4E A;  1FFV C;  3QPE A;  3ADA B;  4AOS A;  3V3O A;  5HY5 A;  1D5T A;  2RDX A;  1JEH A;  4B69 A;  2PMQ A;  3P0W A;  4O5Q A;  3SX6 A;  2E4G A;  3CIR A;  3UOZ A;  5JCI A;  4H4U A;  2OG9 A;  3AD7 B;  1N4V A;  2GB0 A;  2FJE A;  3RGT A;  4GIS A;  4II2 A;  1EL8 A;  4TM4 A;  2XSX A;  1S2Y A;  4H4P A;  4D04 A;  3NVY B;  3ISH A;  3AEC A;  4DHG A;  4DN1 A;  4APN A;  5FJR A;  5EU9 A;  4HCD A;  4Z1Y A;  3AE7 A;  2JB1 A;  1VRQ B;  1M6I A;  1GRH A;  3T2Y A;  2XYO A;  2OZT A;  3P4P A;  3H8A A;  4XWR A;  1Y56 B;  1F8S A;  5KMP A;  2XVF A;  1ZK7 A;  5HXI A;  4ZCC A;  3CNT A;  3B97 A;  1K0J A;  4G7F A;  3QFA A;  3AYL A;  2VQ7 A;  2C4C A;  2XVH A;  3DJD A;  4GRT A;  3U4F A;  2BK5 A;  3DH9 A;  3PG6 A;  1H84 A;  3HRD C;  1JCT A;  2QDE A;  4EMI A;  5EB4 A;  3SXI A;  3LXD A;  3P3B A;  3KPF A;  4IL0 A;  1N63 C;  3M0O A;  3JSK A;  1ZOV A;  3DFH A;  3ZLG A;  1CC4 A;  3FBS A;  5FJO A;  3GD6 A;  2VVM A;  1XS2 A;  4EM4 A;  1H83 A;  1Q9I A;  4AT0 A;  3IHG A;  3NH3 X;  5C2T A;  5BUK A;  4A3R A;  2XFP A;  1NPX A;  2BYB A;  3E1T A;  2E5V A;  2WPE A;  2RGO A;  2YG7 A;  1VG0 A;  3MZN A;  3QLD A;  4EQX A;  2BAC A;  3IK4 A;  4ICY A;  5HYM A;  4K7Z A;  1DOC A;  4BK3 A;  1T3Q C;  1F8R A;  2ZC8 A;  2BS4 A;  1FO4 A;  3AE8 A;  1MUC A;  2OAM A;  3SZF A;  4A5L A;  3T14 A;  2YM1 A;  1D4E A;  3BHF A;  1GRA A;  3KPK A;  1D7L A;  1O95 A;  2JK6 A;  1FHU A;  1E1K A;  4HCH A;  2XCG A;  1PN0 A;  3TWA A;  4GIR A;  4H4Z A;  4GAP A;  4OPI A;  2PGW A;  4CCQ A;  1RM6 B;  3NNE A;  2GF3 A;  4B1B A;  2WET A;  4BJZ A;  2B7S A;  2YR4 A;  3ZLH A;  3SQS A;  5BRT A;  4IV9 A;  1E9I A;  1BGJ A;  3UTF A;  5DBJ A;  2X3N A;  3AEF A;  1BWC A;  3NFU A;  4IA5 A;  3AE1 A;  5KMQ A;  3H8I A;  3G5R A;  3RRA A;  5HHF A;  3NN6 X;  2R4E A;  2YLS A;  1RYI A;  1ELI A;  5KVI A;  4EQS A;  2PTY A;  1GRE A;  1N1P A;  2B7R A;  1WUE A;  1RSG A;  5JRB A;  1EC8 A;  2BXR A;  1DOE A;  3D1C A;  2Q0L A;  4AP1 A;  2OZ3 A;  3DES A;  4YTP A;  5KVH A;  3IJQ A;  2OA1 A;  1GPE A;  3CNP A;  4B64 A;  2P88 A;  4J34 A;  2QVH A;  4U8I A;  1EL9 A;  3AE9 A;  2IVD A;  4RG4 A;  3NYF A;  3L8K A;  1LTX R;  4DGK A;  5CQF A;  4N9X A;  2P0I A;  3F8D A;  4YTM A;  4EWJ A;  3HYX A;  3ZDN A;  1QO8 A;  3LZX A;  4H2P A;  5G5H B;  1ONF A;  4TM3 A;  2JB2 A;  4G6G A;  2CHR A;  2FJA A;  4U8L A;  4DX3 A;  3UJS A;  2EQ8 A;  5FJT A;  4A6G A;  2BCP A;  3K30 A;  1MO9 A;  4U8K A;  3HZL A;  3EF6 A;  4IVM B;  2YAU A;  1OJ9 A;  1TDF A;  1L9E A;  1X31 B;  3QKE A;  1VDC A;  3DK9 A;  3VA8 A;  4H50 A;  3TOY A;  4CNK A;  3I6D A;  4G74 A;  5KMS A;  3D47 A;  1LPF A;  2R0G A;  2ZZC A;  2QQ6 A;  2C65 A;  1PJ6 A;  3SGL A;  3C96 A;  3UJ2 A;  2AR8 A;  3U9I A;  3SZW A;  3GWF A;  4RG3 A;  4GF7 A;  3AE4 A;  4EIQ A;  1PJ5 A;  4A6N B;  5KOW A;  3DME A;  3P9U A;  4YSZ A;  1NEK A;  3RP8 A;  1EBH A;  1VDV A;  3AE3 A;  2QDD A;  3DG7 A;  5G5G B;  1ECQ A;  2WU2 A;  3LOV A;  1OJC A;  1L0V A;  2YVJ A;  1LJ1 A;  2Z5X A;  3UOY A;  2AKZ A;  4HPN A;  4H7U A;  2R46 A;  4AOX A;  1BQG A;  3SYI A;  2YR5 A;  2BC0 A;  4NTE A;  7ENL A;  1V97 A;  3PK7 A;  2XLR A;  3GDN A;  1CF3 A;  3UOX A;  4IVO B;  3NTD A;  3OZM A;  4REK A;  2WP5 A;  3CB3 A;  4II3 A;  3KKJ A;  3AN1 A;  4FI4 A;  2GAG B;  4UDR A;  2C64 A;  3IF9 A;  3KD9 A;  5U63 A;  1MRA A;  4K8D A;  2WHD A;  2CUL A;  2AL2 B;  3FMW A;  3PWG A;  4YWO A;  1R6W A;  4USR A;  2EQ7 A;  4H4Q A;  1NDA A;  4U2T A;  3UKL A;  4O5U A;  3MY9 A;  5GRT A;  3DA1 A;  1NHR A;  4OPC A;  1Q1W A;  1AOG A;  4E5T A;  1PBD A;  3ALM A;  2VVL G;  1E6E A;  2VZ2 A;  3T6C A;  4U8J A;  3T2K A;  1FOH A;  3I3L A;  2I5Q A;  3R0K A;  4EMW A;  3DEQ A;  2F5Z A;  1B8S A;  4Z26 A;  2WDQ A;  2CDU A;  3IHM A;  3ICT A;  1X2G A;  3LJP A;  4HB9 A;  4I58 A;  2W3S A;  1H86 A;  4ZOH B;  4EMJ A;  3MQT A;  3VR9 A;  3NHO X;  2OX4 A;  4Y4L A;  1WYG A;  3F8R A;  1XHC A;  4H2N A;  3V5C A;  3SM8 A;  2W0H A;  2PHH A;  2GQF A;  3DK4 A;  3N4F A;  2VRM A;  3AED A;  4ECH A;  1BKH A;  2VRL A;  3CTY A;  3ITJ A;  1V59 A;  1S2Q A;  3DER A;  3IJL A;  3HPF A;  1GTH A;  4MGG A;  4TVY A;  1IUU A;  4M52 A;  4H4W A;  2YVF A;  2Y6R A;  2PS2 A;  5KWF A;  4NEW A;  2CFY A;  1H81 A;  3S61 A;  4IP5 A;  5TR3 A;  4M0X A;  1TKK A;  2WOI A;  2H88 A;  4I59 A;  4YTN A;  4NNJ A;  3TJI A;  4U2S A;  3OC4 A;  3TWB A;  4A7A A;  3NIX A;  4DWD A;  2PTZ A;  3UCD A;  1CJ4 A;  1MOK A;  3UXK A;  3UCL A;  3AEE A;  3MKC A;  4Z24 A;  3ZLF A;  1JRP A;  5IQ1 A;  2X99 A;  2QGY A;  5FJP A;  2RGJ A;  1RVK A;  1NHQ A;  3SBF A;  3H8L A;  4G73 A;  3SFE A;  1MDR A;  2BC1 A;  3VFC A;  1W6T A;  3L5O A;  3RIT A;  1CJ2 A;  1N5X A;  4NEV A;  3A7U A;  1X2H A;  1GSN A;  2PP3 A;  2GMH A;  3S5S A;  4E0V A;  1YQZ A;  3ZVH A;  3SQP A;  3AE2 A;  2XH2 A;  4C3X A;  2GR0 A;  1PHH A;  1OJA A;  1EBD A;  1N60 C;  2GGE A;  4GYP C;  3BI5 A;  3FXG A;  2YM2 A;  3T4W A;  3VR8 A;  1GV4 A;  3NTA A;  3T9P A;  4J36 A;  1GET A;  3RCY A;  2C72 A;  3B9J B;  4KT2 A;  3AYJ A;  2OLO A;  4J1O A;  1D4C A;  2C75 A;  4IA6 A;  3CNJ A;  1F8W A;  1GRG A;  5KMR A;  1PS9 A;  4GYP A;  1KDG A;  4U2L A;  1H7W A;  2ONE A;  3AB1 A;  1CL0 A;  3UTE A;  1TDN A;  3P93 A;  3VC5 A;  2GSH A;  1P43 A;  1FFU C;  3MUC A;  4CNJ A;  1TYT A;  4GGB A;  1OEP A;  1REO A;  1UKV G;  5FS8 A;  3GWD A;  2BS2 A;  3NZG A;  1ELS A;  1GXF A;  2C3D A;  3FIM B;  3ALJ A;  2J3N A;  3CGE A;  5FS9 A;  4YSX A;  1FEB A;  4BV6 A;  1IUX A;  4Z17 A;  4JY3 A;  1XPY A;  2XGZ A;  2YVG A;  3RNM A;  4MKS A;  1XDI A;  3RP6 A;  1JPM A;  3WE0 A;  1NU5 A;  1FL2 A;  4USQ A;  3DIP A;  4YT0 A;  5FS6 A;  3AXB A;  3JVA A;  1MNS A;  3OPS A;  1L8P A;  3VRA A;  2PU0 A;  2XFU A;  3QVR A;  1JDF A;  4PAB A;  3SY4 A;  2XH4 A;  5J60 A;  4J56 A;  3R10 A;  2GGI A;  3VRB A;  1LQT A;  2C73 A;  4HNC A;  3SN0 A;  4U8M A;  3UP5 A;  3NRN A;  2AKM A;  3UCC A;  1ZP0 A;  3AEA A;  4B66 A;  2WDV A;  3TJ4 A;  1IYX A;  2E3T A;  3NT6 A;  1B4V A;  5KOX A;  3DK8 A;  1NG3 A;  1OJT A;  2ZBW A;  1DOD A;  1O5W A;  3UJR A;  4Z25 A;  5EB5 A;  1M64 A;  3CGC A;  2YLT A;  2XLT A;  1IJH A;  3IWA A;  4HA6 A;  2BK3 A;  5IPY A;  3AYI A;  4CCR A;  4DNA A;  2GMJ A;  2NVK X;  2JAE A;  2YLR A;  2OAL A;  3S47 A;  1EBG A;  3AEB A;  1VQZ A;  1EC7 A;  5BOE A;  5J04 A;  3NVV B;  3H7V A;  3HW2 A;  1MDL A;  3NG7 X;  2BRA A;  4H2Q A;  3COX A;  2BCG G;  3H12 A;  3V5F A;  3DJJ A;  3NK1 X;  4NTD A;  3NKS A;  2EQ6 A;  3GRS A;  1CJ3 A;  2XVJ A;  3FVD A;  1ZOY A;  2VOU A;  4YSY A;  2V6O A;  2XFQ A;  2HXU A;  3QVP A;  1VQW A;  1DOB A;  4B67 A;  2PU1 A;  2OLA A;  4H4X A;  4B63 A;  4H19 A;  3A7R A;  1PXB A;  2IID A;  4CRT A;  4DXK A;  1SJD A;  3P4R A;  4DSG A;  2GAH B;  2YG3 A;  1GER A;  3T8Q A;  3UKK A;  3D46 A;  3P4S A;  1XAN A;  2NQL A;  2WP6 A;  3UJF A;  2MUC A;  3N6H A;  1Y56 A;  4J3Z A;  3CGB A;  3K7M X;  3EAO A;  3H4K A;  3CN8 A;  4TM1 A;  3F8P A;  2POD A;  3CPI G;  1D7Y A;  2YLZ A;  2JKC A;  1YQ3 A;  2MNR A;  1D4D A;  1GOS A;  1F6M A;  5L46 A;  1IUW A;  3RO6 A;  3FV9 A;  4JY2 A;  3ES8 A;  2JB3 A;  2WDR A;  3NLC A;  5J7X A;  4IL2 A;  3II4 A;  4K2X A;  5JCM A;  1ZX9 A;  1CHU A;  4E4F A;  2HNE A;  2XFN A;  5KNL A;  2PTW A;  1W4X A;  3B6D A;  2PGE A;  3R0U A;  1QLB A;  2C76 A;  3NYC A;  1SJB A;  3SN4 A;  2PSN A;  2OFJ A;  3ES7 A;  1TRB A;  2A89 A;  2P8C A;  4GGH A;  4UP3 A;  3SSZ A;  3NRZ B;  3AMZ A;  3CNS A;  2DKI A;  1N61 C;  4H2R A;  3JW7 A;  3UGV A;  3CXB A;  2PTX A;  1GRF A;  3GC2 A;  2ZAD A;  2CVJ A;  1PDY A;  2R45 A;  1LVL A;  3NVZ B;  3N6J A;  3RHA A;  1FEA A;  4B68 A;  3VQR A;  3NXL A;  3A7A A;  1Y0P A;  1H2I A;  4LA1 A;  2IVE A;  4LII A;  5JCK A;  3V4B A;  4K1W A;  3VC6 A;  4K8G A;  4X9N A;  1E7P A;  1ZMD A;  1JNZ A;  4E4U A;  4NTC A;  2POZ A;  2YLX A;  1TDO A;  4FP1 A;  2XLU A;  3KU9 A;  1PJ7 A;  2YG4 A;  3RED A;  4YXD A;  2BA9 A;  2OVL A;  3NK2 X;  5IDZ A;  3BI4 A;  1IUT A;  4KX6 A;  2B9X A;  3DGH A;  3D8X A;  4H2H A;  3M12 A;  5FJU A;  3OTR A;  1N62 C;  3QN3 A;  5M0Z A;  2YG5 A;  2AAQ A;  1PXA A;  2BRY A;  1YKJ A;  2X8H A;  4CBQ A;  3I6E A;  4JHM A;  2YLW A;  2ZZ0 A;  3K1G A;  4G8T A;  2C3C A;  4H83 A;  3QFB A;  2GGJ A;  3EAN A;  4JDR A;  4J2W A;  1KN0 A;  3BNU A;  2GGH A;  1NAA A;  2OQH A;  1GEU A;  3HYV A;  1N5W C;  2FBW A;  2V60 A;  4IHC A;  3PO7 A;  4Y4M A;  3P4Q A;  3LB8 A;  4ZCW A;  1EL5 A;  4U8O A;  1TE6 A;  4JQ9 A;  3C4N A;  3BI2 A;  3VCC A;  2TMD A;  3OW1 A;  3R9U A;  1PBF A;  1Z6L A;  3BOX A;  1CBO A;  3UTH A;  3CPH G;  4WCT A;  4H4Y A;  4KEM A;  4GDE A;  3BJS A;  2UZZ A;  3GYI A;  1Q1R A;  4BJY A;  1GND A;  3IJI A;  4OPL A;  4G9K A;  3EKG A;  1KNP A;  2DKH A;  2WS3 A;  3S5W A;  1COY A;  3AD9 B;  3GD3 A;  1JOA A;  2NPX A;  1K0L A;  2BS3 A;  4XXG A;  1GRB A;  1O94 A;  3AE5 A;  4K5S A;  2W54 A;  4UDQ A;  3SZC A;  1K0I A;  2E5A A;  1TZZ A;  2OZ8 A;  4G6H A;  1ZMC A;  2FYM A;  1PXC A;  3CXO A;  5GSN A;  2V61 A;  3AWI A;  3MSY A;  3ZVI A;  5CKU A;  2TPR A;  3VCN A;  1L9C A;  2GVC A;  4C74 A;  4J31 A; 
#chains in the Genus database with same CATH homology
 4K5R A;  3SY4 A;  4GDP A;  5J60 A;  1YQ4 A;  3GDP A;  1ONF A;  4J56 A;  2JB2 A;  4G6G A;  4TM3 A;  3VRB A;  2FJA A;  4U8L A;  1GTE A;  1LQT A;  4FX9 A;  2C73 A;  4EM3 A;  1KFY A;  4BK1 A;  2EQ8 A;  1L9D A;  4U8M A;  3ABV A;  3UP5 A;  3NRN A;  3UKF A;  2BCP A;  3K7T A;  1MO9 A;  3K30 A;  4U8K A;  3HZL A;  4TM0 A;  3G5Q A;  3EF6 A;  4U8P A;  3BNM A;  2AQJ A;  2YAU A;  4IVM B;  2Q6U A;  1OJ9 A;  1TDF A;  3CMM A;  1L9E A;  2GR1 A;  1X31 B;  1IUS A;  2C70 A;  1ZP0 A;  3QSE A;  3AEA A;  2RAB A;  1VDC A;  3DK9 A;  4B66 A;  2WU5 A;  1ZKQ A;  4H50 A;  2WDV A;  3AD8 B;  5FMH A;  3T31 A;  2YWL A;  3SFD A;  4U8N A;  3UKP A;  5BUL A;  4Z2R A;  1KSU A;  4CNK A;  1MXT A;  3I6D A;  3NT6 A;  4G74 A;  5KMS A;  1LPF A;  1BZL A;  4YKF A;  1B4V A;  2R0G A;  2ZZC A;  5KOX A;  3DK8 A;  4BUR A;  1PJ6 A;  1NG3 A;  1H6V A;  2C65 A;  3C96 A;  1K4Q A;  2C7G A;  2I0Z A;  1OJT A;  3PVC A;  3SGL A;  4YSH A;  3C4A A;  3QSM A;  5KXJ A;  3UKH A;  1PBB A;  3D9X A;  4H4R A;  1KF6 A;  1DOD A;  1VG9 A;  2ZBW A;  1S7M A;  1O5W A;  2AR8 A;  1E39 A;  2C67 A;  2X8G A;  2Y6Q A;  4Z25 A;  5EB5 A;  3SZW A;  1M64 A;  3GWF A;  3CGC A;  2YLT A;  2XLT A;  5U25 A;  2XVE A;  3FPZ A;  4RG3 A;  3DJE A;  3EPT A;  4FK1 C;  4GF7 A;  1IJH A;  3AE4 A;  3IWA A;  3AEG A;  4HA6 A;  4A79 A;  4EIQ A;  1PJ5 A;  4WX1 A;  1B5Q A;  4A6N B;  2BK3 A;  4H4T A;  3DME A;  5KOW A;  2WEU A;  3P9U A;  4YSZ A;  4RSL A;  1NEK A;  2WOV A;  1ZY8 A;  4J33 A;  3RP8 A;  5IPY A;  3AYI A;  2YQU A;  4CCR A;  4DNA A;  3AE3 A;  2GMJ A;  2NVK X;  2JAE A;  3NYE A;  2YLR A;  1YY5 A;  2OAL A;  1IUV A;  1E1N A;  2WPF A;  3QJ4 A;  3P1W A;  4OCG A;  5FS7 A;  3AEB A;  1CC6 A;  4X9M A;  2WPC A;  2WU2 A;  2Q7V A;  3LOV A;  4FK1 A;  1OJC A;  4LU6 A;  3DGZ A;  2A87 A;  4H4S A;  3CND A;  4MJW A;  1JNR A;  2YVJ A;  1LJ1 A;  2Z5X A;  3CPJ G;  2BK4 A;  1LV0 A;  3NG7 X;  3UOY A;  2WBA A;  4C5O A;  2BRA A;  4H7U A;  2R46 A;  4H2Q A;  3UKA A;  4AOX A;  4Z2T A;  3COX A;  1DNC A;  2BCG G;  1DJN A;  2R4J A;  2QAE A;  3SYI A;  2YR5 A;  4AP3 A;  4GCM A;  2QA2 A;  5M10 A;  2BC0 A;  3DJJ A;  1FEC A;  3NK1 X;  4NTE A;  3NGC X;  4C77 A;  4NTD A;  4NZH A;  2GRT A;  1B37 A;  4GAV A;  2APG A;  2XLR A;  3OZ2 A;  3GDN A;  3NKS A;  2EQ6 A;  3GRS A;  1DJQ A;  1CF3 A;  2V3A A;  1RP0 A;  3UOX A;  4TLZ A;  4D03 A;  4IVO B;  1CJ3 A;  4OVI A;  2XVJ A;  3NTD A;  3IC9 A;  3B3R A;  1JU2 A;  1ZOY A;  2VOU A;  1H82 A;  1BGN A;  4REK A;  2XFO A;  3GMB A;  1JRZ A;  3K7Q X;  4YSY A;  1EL7 A;  2WP5 A;  1S3E A;  4TLX A;  2V6O A;  1GT8 A;  4ADW A;  2XFQ A;  3QVP A;  1VQW A;  4II3 A;  5IQ4 A;  1DOB A;  4B67 A;  3KKJ A;  2EQ9 A;  1BF3 A;  4Z2U A;  2VVL A;  3GYJ A;  3ALL A;  1CJC A;  2GAG B;  4H4X A;  4B63 A;  1JRY A;  1PXB A;  2IID A;  2R9Z A;  2PYX A;  3T37 A;  4CRT A;  1KNR A;  2FJD A;  4JNA A;  4UDR A;  4BK2 A;  2V3B A;  5EBK A;  2WOW A;  1FCD A;  3O0H A;  1NG4 A;  2C64 A;  2O9Z A;  2R0C A;  2Z5Y A;  3IF9 A;  3KD9 A;  4A6N A;  5U63 A;  4PAA A;  3Q6J A;  3P4R A;  4K8D A;  2OLN A;  2WHD A;  4DSG A;  2CUL A;  2GAH B;  2YG3 A;  3UTG A;  1P2H A;  1GER A;  3FMW A;  3UKK A;  1PBE A;  3P4S A;  1XAN A;  2WP6 A;  4YWO A;  1TDK A;  3ADA B;  1GES A;  4AOS A;  1Y56 A;  3VRD B;  1GRT A;  3T2Z A;  3V3O A;  3AE6 A;  3CGB A;  2ACZ A;  5HY5 A;  1D5T A;  3K7M X;  1S3B A;  4USR A;  3EAO A;  3H4K A;  3CN8 A;  2EQ7 A;  1JEH A;  4H4Q A;  4B69 A;  5ER0 A;  4TM1 A;  1NDA A;  1L0V A;  4OPT A;  3F8P A;  3GSI A;  4U2T A;  3CPI G;  1D7Y A;  2YLZ A;  4O5Q A;  3UKL A;  5BVA A;  3SX6 A;  4O5U A;  2E4G A;  3CIR A;  4DSH A;  2JKC A;  3UOZ A;  5GRT A;  3DA1 A;  5JCI A;  3UKQ A;  4H4U A;  1NHR A;  1YQ3 A;  4NWZ A;  1GOS A;  1D4D A;  3G5S A;  1F6M A;  4OPC A;  1Q1W A;  4XWZ A;  1AOG A;  5L46 A;  3AD7 B;  1IUW A;  2XLS A;  1N4V A;  1PBD A;  2GB0 A;  3M13 A;  2FJE A;  4JY2 A;  3ALM A;  1TYP A;  2VVL G;  4II2 A;  1E6E A;  2JB3 A;  2VZ2 A;  1EL8 A;  2ARD A;  2XDO A;  2WDR A;  4TM4 A;  1E1M A;  3NLC A;  4U8J A;  5J7X A;  3QSS A;  3II4 A;  3T2K A;  1FOH A;  1S2Y A;  2JBV A;  4H4P A;  1TDE A;  2H89 A;  3I3L A;  4K2X A;  4D04 A;  5JCM A;  3ISH A;  1ZX9 A;  4EMW A;  3AEC A;  2F5Z A;  2GR3 A;  1B8S A;  4FDC B;  1CHU A;  2WQY A;  4Z26 A;  2WDQ A;  4APN A;  2YG6 A;  2CDU A;  3IHM A;  2XFN A;  3ICT A;  3GRT A;  5KNL A;  1W4X A;  3LJP A;  5JCN A;  4HB9 A;  2GH5 A;  3B6D A;  4I58 A;  1H86 A;  3LZW A;  4EMJ A;  3AE7 A;  1QLB A;  2JB1 A;  4EIP A;  2C76 A;  3NYC A;  1VRQ B;  1M6I A;  1GRH A;  3T2Y A;  1NHS A;  2XYO A;  3T0K A;  4OPU A;  3P4P A;  1TRB A;  3VR9 A;  2A89 A;  1NHP A;  3NHO X;  4UP3 A;  4Y4L A;  4XWR A;  1Y56 B;  1F8S A;  3F8R A;  3CNS A;  2XVF A;  5KMP A;  2DKI A;  1ZK7 A;  5HXI A;  4H2R A;  1XHC A;  4ZCC A;  4H2N A;  3BHK A;  3SM8 A;  2W0H A;  3CNT A;  2FJB A;  2PHH A;  1K0J A;  3PS9 A;  2GQF A;  3ICR A;  3DK4 A;  2VRM A;  3QFA A;  1GRF A;  3AYL A;  2VQ7 A;  2C4C A;  2XVH A;  4A65 A;  3AED A;  4ECH A;  2VRL A;  3CTY A;  3DJD A;  3ITJ A;  2CVJ A;  1DXL A;  4GRT A;  2R45 A;  2BK5 A;  3DH9 A;  3PG6 A;  1H84 A;  1LVL A;  4AT2 A;  1V59 A;  4EMI A;  5EB4 A;  1S2Q A;  3LXD A;  3RHA A;  3SXI A;  1FEA A;  4B68 A;  3VQR A;  4A99 A;  4P9S A;  1GTH A;  1IUU A;  4M52 A;  4OPG A;  3KPF A;  1Y0P A;  1H2I A;  4H4W A;  2YVF A;  4LA1 A;  2IVE A;  2Y6R A;  2XVI A;  4LII A;  5JCK A;  1H7X A;  2X50 A;  1P2E A;  3M0O A;  3JSK A;  5KWF A;  4NEW A;  3SZ0 A;  2CFY A;  1H81 A;  1ZOV A;  3S61 A;  4X9N A;  2HQM A;  1E7P A;  1CC4 A;  1ZMD A;  2C66 A;  3FBS A;  3HYW A;  3KA7 A;  5TR3 A;  1JNZ A;  3URH A;  1JRX A;  4NTC A;  2WOI A;  4H4V A;  1BKW A;  2H88 A;  2VVM A;  4ZN0 A;  4ZCD A;  2R0P A;  4I59 A;  2V5Z A;  4EM4 A;  2YLX A;  1TDO A;  1H83 A;  2XLU A;  3ATR A;  3KU9 A;  4NNJ A;  4YTN A;  1Q9I A;  4AT0 A;  1PJ7 A;  3IHG A;  3NH3 X;  2B76 A;  4U2S A;  3OC4 A;  2YG4 A;  5C2T A;  4Z44 A;  3RED A;  2WP9 A;  2BA9 A;  3NN0 X;  4YXD A;  2GV8 A;  5BUK A;  4A7A A;  3GMC A;  1PBC A;  3NIX A;  2XFP A;  2A8X A;  3NK2 X;  3BI4 A;  1CC2 A;  1NPX A;  2BYB A;  1IUT A;  4OPD A;  4KX6 A;  4CY8 A;  3ZYX A;  3E1T A;  4C3Y A;  1CJ4 A;  2B9X A;  3DGH A;  2GR2 A;  2E5V A;  3D8X A;  2WPE A;  2RGO A;  1MOK A;  2XLP A;  3UCL A;  3V76 A;  2YG7 A;  1VG0 A;  3AEE A;  3M12 A;  5JCL A;  4Z24 A;  3RP7 A;  5KRQ A;  4EQX A;  2BAC A;  2QA1 A;  2X99 A;  5IQ1 A;  3V3N A;  4Z43 A;  5M0Z A;  2YG5 A;  2AAQ A;  1PXA A;  2RGJ A;  2GQW A;  2YR6 A;  2BRY A;  3ATQ A;  4ICY A;  1NHQ A;  5HYM A;  4K7Z A;  1DOC A;  3H8L A;  1YKJ A;  2BC1 A;  2X8H A;  2B9Y A;  4G73 A;  3SFE A;  4BK3 A;  1F8R A;  2ZZB A;  4CBQ A;  1CJ2 A;  3L5O A;  2BS4 A;  2YLW A;  3AE8 A;  2OAM A;  2ZZ0 A;  4NEV A;  3SZF A;  4A5L A;  1GSN A;  3T14 A;  2YM1 A;  1ZDL A;  1D4E A;  1GRA A;  2C3C A;  1D7L A;  3BHF A;  3KPK A;  1O95 A;  2GMH A;  2JK6 A;  5LV9 A;  1E1K A;  3GYX A;  4E0V A;  3QFB A;  1YQZ A;  4YKG A;  3SQP A;  3AE2 A;  1LQU A;  3EAN A;  2XCG A;  4C3X A;  1PN0 A;  2GR0 A;  1PHH A;  1OJA A;  1EBD A;  4H4Z A;  4JDR A;  4J2W A;  1KN0 A;  3BI5 A;  4GAP A;  3BNU A;  4OPI A;  2YM2 A;  1E1L A;  3GD4 A;  1KSS A;  4CCQ A;  3VR8 A;  4J57 A;  1GV4 A;  1NAA A;  4GR1 A;  3NTA A;  1GEU A;  2Q0K A;  3NNE A;  2GF3 A;  4J36 A;  1GET A;  2C72 A;  4A9W A;  3HYV A;  5EOW A;  3AYJ A;  4KPR A;  2BXS A;  2OLO A;  4B1B A;  2FBW A;  4EQW A;  2V60 A;  2WET A;  1D4C A;  2C75 A;  3PO7 A;  4BJZ A;  4Y4M A;  4IA6 A;  3P4Q A;  3LB8 A;  3CNJ A;  1OJD A;  1F8W A;  1GRG A;  1EL5 A;  2B7S A;  5KMR A;  2YR4 A;  1PS9 A;  1F3P A;  3ICS A;  4U8O A;  4JQ9 A;  3C4N A;  5BRT A;  1KDG A;  4K22 A;  3BI2 A;  4IV9 A;  2TMD A;  1BGJ A;  4U2L A;  1H7W A;  3UTF A;  3AB1 A;  1CL0 A;  2RGH A;  3UTE A;  5DBJ A;  3R9U A;  2X3N A;  1PBF A;  1TDN A;  1Z6L A;  3AEF A;  1BWC A;  4IA5 A;  4CNJ A;  1CBO A;  3AE1 A;  5KMQ A;  1TYT A;  3UTH A;  3H8I A;  3G5R A;  3CPH G;  4WCT A;  1REO A;  2E1M A;  3KLJ A;  1UKV G;  4H4Y A;  4GDE A;  5HHF A;  3NN6 X;  2UZZ A;  4JNQ A;  5FS8 A;  3GYI A;  3DJG X;  5U1O A;  1Q1R A;  3GWD A;  2BS2 A;  2R4E A;  2YLS A;  4C74 A;  1N4U A;  1NEN A;  1RYI A;  3Q9T A;  4BJY A;  1GXF A;  1ELI A;  2C3D A;  5KVI A;  1GND A;  4CY6 A;  4EQS A;  3FIM B;  1N1P A;  1GRE A;  4OPL A;  4G9K A;  2B7R A;  3ALJ A;  2J3N A;  3CGE A;  5FS9 A;  1KNP A;  1SEZ A;  1GAL A;  1XPQ A;  2DKH A;  2WS3 A;  1RSG A;  3S5W A;  3UP4 A;  1FEB A;  5JRB A;  1COY A;  2B9W A;  4BV6 A;  3AD9 B;  4YSX A;  3GD3 A;  1IUX A;  2BXR A;  1DOE A;  3D1C A;  5C3J A;  1PDH A;  1JOA A;  2NPX A;  2Q0L A;  4JY3 A;  1K0L A;  4GUV A;  4AP1 A;  4JN9 A;  2BS3 A;  4XXG A;  2YVG A;  3RNM A;  4YTP A;  5KVH A;  1GRB A;  1O94 A;  2OA1 A;  1GPE A;  1XDI A;  3CNP A;  3RP6 A;  4B64 A;  3KVE A;  4Y4N A;  3FG2 P;  3AE5 A;  4J34 A;  2BAB A;  4K5S A;  4U8I A;  3WE0 A;  1FL2 A;  1EL9 A;  4UDQ A;  3SZC A;  3AE9 A;  1K0I A;  2IVD A;  4RG4 A;  4USQ A;  3NYF A;  3UOV A;  1QJD A;  3L8K A;  4G6H A;  4YT0 A;  3LAD A;  5FS6 A;  1LTX R;  1ZMC A;  2VQB A;  4X4J A;  1N4W A;  2X8C A;  1PXC A;  4EQR A;  4DGK A;  2QCU A;  5CQF A;  5GSN A;  3AXB A;  4UDP A;  2V61 A;  3AWI A;  4N9X A;  2WES A;  3F8D A;  5CKU A;  4YTM A;  3VRA A;  3HYX A;  3NK0 X;  2XFU A;  2TPR A;  3QVR A;  1L9C A;  1QO8 A;  3ZDN A;  2GVC A;  2GEW A;  3CGD A;  3LZX A;  3L1R A;  4H2P A;  4PAB A;  1HYU A;  4B65 A;  4J31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...