5FS6A

Crystal structure of the v243l mutant of human apoptosis inducing factor
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
491
structure length
454
Chain Sequence
KAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMLKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHEDLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure/Function Relations in Aifm1 Variants Associated with Neurodegenerative Disorders
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
total genus 146
structure length 454
sequence length 491
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fs6A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs6A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs6A01
4XXGA 3QJ4A 3AEFA 3SFDA 2WPEA 4Y4NA 2VRMA 2YG7A 1CC2A 5KOXA 4ZN0A 3CGBA 2Y6RA 1ZMCA 2GR3A 1PJ7A 2R0CA 3I3LA 3NK1X 3VRBA 4TM1A 2WHDA 4A65A 3AD8B 2R46A 2BK3A 4BJZA 2WP6A 2DKHA 3KU9A 2WP9A 1JU2A 3BNMA 3AEEA 1IUXA 3AE6A 4AT0A 4CY8A 3ISHA 1K0LA 1E1KA 2QA1A 4ZCCA 1GSNA 3CPJG 2C7GA 3GMCA 3GYJA 4UP3A 4N9XA 1E1MA 4U2LA 4JDRA 3G5SA 1KSUA 2RGHA 1QJDA 3UKPA 2WBAA 1PBFA 1JNRA 4BK2A 2Z5YA 2XVIA 3P9UA 3GD3A 4FDCB 2C75A 4IA6A 2YR4A 3ITJA 4CBQA 3AEGA 3GD4A 3FPZA 3NK0X 3UTGA 3AE4A 2YWLA 3UOVA 1B4VA 3DK8A 4CNKA 2A87A 1QLBA 3ALLA 4GDPA 4P9SA 3AD7B 1ZX9A 4OPUA 4JNAA 2W0HA 4AOXA 3K30A 4B69A 1NENA 4EM4A 1D5TA 3K7MX 3REDA 4IV9A 5HY5A 3AYIA 1VDCA 4H4RA 3K7TA 3IHGA 3BI5A 3AE2A 5L46A 1GERA 2WESA 2C76A 4EMIA 2BK5A 4EQSA 1PBDA 3GWFA 3IC9A 1ZOVA 4APNA 2GR0A 2OLNA 3BNUA 3EF6A 5JCIA 2IIDA 2WDQA 4GF7A 3S5WA 3C4AA 3GRSA 1X31B 4YSZA 4Z25A 4TM4A 3V3NA 4H4ZA 2GEWA 1JEHA 3BI2A 1N4WA 3UKAA 4BK1A 4U8LA 3P4RA 1Q9IA 3F8PA 4U8IA 2BC0A 4J31A 3DJEA 4DSHA 1E1NA 4RSLA 1YKJA 5BUKA 4NEVA 2R0GA 2YM2A 3UKFA 1CC4A 3P4PA 4CCRA 2V5ZA 4JN9A 1E6EA 4A5LA 1H83A 3CIRA 3CN8A 3NYFA 2HQMA 1QO8A 2YVGA 3SQPA 1GNDA 2YG6A 3FIMB 4NTDA 2BXRA 1NHQA 3QSEA 1D7YA 4JY2A 4JQ9A 2C73A 4K22A 4Z2RA 4AT2A 1ELIA 2J3NA 4H50A 3VRAA 2BXSA 1GESA 2C3DA 2QCUA 3IWAA 4B68A 1IUTA 1FOHA 1NG3A 2C67A 1KF6A 4UDRA 5CQFA 3NGCX 1GETA 3UKKA 1RYIA 1W4XA 1MOKA 5ER0A 1S2YA 2WP5A 1BWCA 3GWDA 3CGEA 2YG4A 4A6NA 2XYOA 4CY6A 1GRGA 4OPGA 5FS9A 2OALA 2Q6UA 1CF3A 2JKCA 3QFAA 1OJDA 3LOVA 4YTPA 4U2SA 3CNJA 2YLSA 5BRTA 2BS3A 1H81A 2IVDA 1F6MA 1O5WA 3D8XA 2XFPA 1KDGA 2FJBA 3LZXA 5C2TA 5KWFA 1LQTA 2GVCA 4PAAA 4Z2TA 2C66A 4H4VA 3URHA 3SGLA 1Q1RA 3COXA 3L1RA 1F8RA 4XWRA 3AEDA 3AEAA 2CULA 4BV6A 1BGNA 1YQ3A 5U63A 3QVRA 3DGZA 3AE1A 3ZYXA 1EL5A 3QSMA 4B64A 1BGJA 1Z6LA 3ALMA 1H84A 2BC1A 2QAEA 5J7XA 1HYUA 2FBWA 4USRA 1GRTA 4AP3A 3UOZA 4EQXA 4B66A 2BA9A 1KFYA 2PHHA 1CHUA 1TYPA 4IVMB 1DODA 2E5VA 4NEWA 4H4YA 3G5RA 4UDQA 2VQBA 3UTEA 4YTNA 1LVLA 4RG4A 1H82A 4I58A 1PHHA 1JRYA 1N4UA 3M12A 4HB9A 2ZZBA 1RP0A 4J36A 4J33A 4WCTA 1OJCA 3KPFA 3FMWA 3P4QA 3GSIA 5LV9A 1VRQB 2RGOA 3DA1A 1DXLA 4XWZA 4LIIA 4YTMA 5EB4A 4EM3A 2JB1A 4UDPA 1CL0A 2FJAA 3RP6A 2VVLA 1D7LA 2C72A 3M0OA 4NZHA 5TR3A 4GCMA 1GT8A 1L9EA 3UP5A 3UTFA 1JNZA 2BS4A 5J60A 3LXDA 3NTDA 2JK6A 4H4TA 3CNPA 4ECHA 4NTEA 4H4UA 1GRFA 1ONFA 3NN6X 2GQWA 4C3XA 3QVPA 2WU2A 2YQUA 2XFNA 3FG2P 3O0HA 4U8NA 3AE7A 2EQ7A 4KX6A 1S2QA 3KKJA 3G5QA 1L9DA 2BABA 4KPRA 4B63A 2RGJA 4Z26A 2BCGG 2YLZA 2H88A 2WOVA 5C3JA 4C5OA 1TDFA 2C70A 2C3CA 1EL9A 3GRTA 4X9MA 3EAOA 4YSXA 4TM0A 4FK1C 3GMBA 1OJTA 3RP8A 2GAGB 4J57A 2YLXA 4J56A 2EQ6A 2YR5A 4HA6A 5IPYA 5M10A 3F8DA 4EQWA 2ZBWA 5DBJA 3IHMA 2F5ZA 3DJJA 2B9WA 4NTCA 3VRDB 2CFYA 2X8HA 4ADWA 3EANA 3RNMA 3VR8A 2EQ8A 1N1PA 3UP4A 2YLRA 3K7QX 2XFUA 3BI4A 4A7AA 2XCGA 4FX9A 1B8SA 1CBOA 4JNQA 2WOIA 4OPCA 3ICTA 3SFEA 4H7UA 2V6OA 3AYLA 4IVOB 2R45A 3UKLA 1TDKA 2CVJA 3P1WA 5KVHA 1VG0A 2RABA 1Y56A 3ADAB 2APGA 4YSYA 1M64A 3PS9A 5IQ1A 3AE5A 4GR1A 4YKGA 2BYBA 2WU5A 1GPEA 1YY5A 1FEBA 1B5QA 1UKVG 2FJDA 2ACZA 1KSSA 4WX1A 4Z43A 3H4KA 2EQ9A 3L8KA 3M13A 5BULA 4H2NA 5M0ZA 1PXBA 1XANA 4O5UA 1OJ9A 3P4SA 2AAQA 3I6DA 4DSGA 1JRZA 2XLUA 3UOYA 4X4JA 2B9YA 2YG5A 4K7ZA 3BHFA 1DNCA 1GRHA 2C64A 2GH5A 2GAHB 3E1TA 2Q0LA 2YAUA 4U2TA 1IUSA 2GR2A 1B37A 1K0JA 1GALA 1NHPA 1EL8A 3CGDA 3SM8A 1P2EA 2VVMA 2UZZA 4TM3A 1DOBA 4OVIA 4EIPA 1MO9A 2GR1A 3LADA 2NPXA 2WQYA 1VQWA 2Z5XA 1ZOYA 1PBBA 2Q0KA 5KRQA 5GSNA 2R0PA 1L0VA 1CJCA 4EMJA 3NG7X 1VG9A 3AEBA 2XDOA 4H2QA 3KD9A 1Y56B 2FJEA 4DNAA 3NT6A 4ZCDA 2V3AA 3CTYA 1O95A 3S61A 4LA1A 2IVEA 2O9ZA 4MJWA 4CNJA 2Y6QA 1F3PA 3NHOX 4OPDA 5FS8A 3ALJA 3BHKA 4USQA 4TLXA 2BCPA 5HYMA 2NVKX 4J34A 3NKSA 1FEAA 2YG3A 2X3NA 4RG3A 1LTXR 2WS3A 4AP1A 2B7RA 2YVJA 2WETA 3AWIA 1LV0A 2V3BA 4CRTA 4BK3A 4Y4MA 2E4GA 1DOEA 1PXCA 2XFOA 1XDIA 4H4WA 2V60A 4PABA 2OAMA 3CNDA 1K0IA 3EPTA 2OA1A 1L9CA 1BKWA 1E7PA 4GDEA 4U8JA 1IUVA 1MXTA 2R4JA 1GOSA 1FCDA 2Q7VA 1ZY8A 4K2XA 1DJQA 4TLZA 1TYTA 3Q9TA 5KXJA 1XPQA 2B9XA 1NHRA 3ICSA 1IUUA 2OLOA 4OPIA 4B65A 3DK4A 2XFQA 1BF3A 4U8PA 2V61A 3RP7A 3GYIA 4YWOA 3UKQA 2A8XA 1P2HA 2ZZCA 1ZK7A 3ATQA 2GRTA 2XVFA 1JRXA 3AYJA 3WE0A 4OCGA 2X99A 1TDNA 1PN0A 3PVCA 1GRBA 5JCMA 2AR8A 4BURA 4H2RA 1F8WA 4B67A 3GDPA 3KVEA 5JCKA 4H4PA 3AD9B 3NYCA 3UKHA 1IJHA 3HZLA 1H6VA 4A6NB 5GRTA 1NHSA 1YQZA 1RSGA 3H8IA 4ICYA 2JB3A 3ABVA 3NRNA 4A79A 2X8GA 2XLSA 3QSSA 1M6IA 4YKFA 1GV4A 3T37A 3ATRA 3KLJA 4GRTA 2VRLA 5FS7A 3JSKA 4K5RA 4YXDA 4LU6A 2GQFA 1IUWA 4BJYA 3B3RA 2PYXA 1PXAA 4EQRA 2JAEA 2WPCA 2WPFA 1YQ4A 4GUVA 2TPRA 1GTHA 2A89A 3AB1A 1D4EA 4D03A 4M52A 5EB5A 3NNEA 3DJGX 1LJ1A 3FBSA 3DK9A 1N4VA 1FECA 4IA5A 5IQ4A 3DGHA 2VQ7A 3LZWA 3ZDNA 4AOSA 2TMDA 3AE3A 1ZMDA 3VQRA 3CNSA 2BK4A 4Z44A 4B1BA 5U1OA 1PS9A 1NAAA 4U8OA 2QA2A 4I59A 2ARDA 1ZKQA 4EMWA 1F8SA 1XHCA 3B6DA 4OPTA 1ZP0A 4K8DA 4E0VA 3NN0X 1LQUA 1KNRA 2WDRA 1E1LA 4H4QA 4J2WA 5JCNA 5CKUA 4Z2UA 3R9UA 3PO7A 3CGCA 2I0ZA 1PJ5A 4REKA 2X8CA 5KVIA 4CCQA 5JCLA 1FL2A 2YVFA 1CJ4A 1ZDLA 2YM1A 3OC4A 2JBVA 4H2PA 4A9WA 3C4NA 1CC6A 4DGKA 3CNTA 1H86A 2GB0A 1NDAA 3VR9A 2YR6A 1EL7A 2VOUA 1PBEA 3F8RA 3NTAA 4Z24A 2H89A 1PDHA 2GMHA 4X9NA 1GREA 4C3YA 4EIQA 2GF3A 2XVJA 2WOWA 5BVAA 4FK1A 2DKIA 2JB2A 1S3EA 4Y4LA 3UOXA 1SEZA 2YLWA 3H8LA 2XLTA 1D4CA 2WDVA 2XVEA 2R9ZA 3AXBA 2E1MA 3NH3X 3NLCA 1GTEA 1S3BA 5HHFA 1D4DA 1PJ6A 3LB8A 3V3OA 2VVLG 1Q1WA 2GV8A 1JOAA 2WEUA 1V59A 3UTHA 5FS6A 2B76A 2X50A 3DJDA 4K5SA 1H7WA 1OJAA 4JY3A 3LJPA 3RHAA 1E39A 1GRAA 2B7SA 1KNPA 2CDUA 2C65A 3NIXA 4YSHA 1TDOA 3ICRA 5EBKA 4D04A 1DJNA 1O94A 1REOA 2XVHA 2XLRA 3QFBA 3D1CA 3DH9A 4YT0A 2AQJA 2ZZ0A 3DMEA 1NG4A 4U8MA 3GDNA 3UCLA 2YLTA 1GEUA 1CJ2A 1GXFA 3II4A 3OZ2A 1TRBA 3Q6JA 1DOCA 3CPIG 1PBCA 2BACA 2GMJA 3C96A 4U8KA 1Y0PA 1LPFA 2VZ2A 1AOGA 1BZLA 5KOWA 4H4SA 4H4XA 3IF9A 1NEKA 4A99A 5HXIA 2BS2A 1COYA 3AE8A 2XLPA 3AE9A 2R4EA 1K4QA 3NYEA 4C77A 3AECA 5U25A 3CPHG 1NPXA 1H7XA 3KA7A 5FMHA 4C74A 4OPLA 5EOWA 3V76A 1TDEA 1CJ3A 3NK2X 4O5QA 1EBDA
chains in the Genus database with same CATH superfamily
4DN1A 3SFDA 1CC2A 3L5OA 2GR3A 3VRBA 4TM1A 4A65A 4Z1YA 3KU9A 5KNLA 3BNMA 3AEEA 1IUXA 3AE6A 4AT0A 1JCTA 4CY8A 4ZCCA 4F4RA 3TWAA 4N9XA 1E1MA 1QJDA 2WBAA 1PBFA 4GAPA 2QDEA 2XVIA 4IA6A 4CBQA 4ENLA 3AE4A 4G8TA 4GDPA 2MUCA 2W0HA 5FJTA 1D5TA 4IV9A 1BKHA 1VDCA 1KD0A 4G7FA 3IHGA 1GERA 2WESA 2BK5A 4H83A 5IDZA 3IC9A 1ZOVA 4GF7A 3BNUA 3EF6A 3OPSA 4YSZA 4ZA0A 1Q9IA 4U8IA 4HNCA 1E1NA 1VQZA 1E6EA 4A5LA 3NYFA 2HQMA 4GFIA 3FIMB 4NTDA 1NHQA 3QSEA 1D7YA 2ONEA 3D47A 4JY2A 3FXGA 3SZ0A 4H50A 3RGTA 3VRAA 1GESA 2C3DA 4B68A 1GETA 3I6EA 1EBHA 5ER0A 2WP5A 3T2ZA 4A6NA 4J3ZA 2OALA 1CF3A 4U2SA 2YLSA 2PCEA 3R0UA 3T8QA 1KDGA 2GVCA 3JVAA 2W3SA 4H4VA 3URHA 4DHGA 4XWRA 3DFHA 3U4FA 5U63A 2P3ZA 1EL5A 2BC1A 2FBWA 1GRTA 4HYRA 1TYPA 2E5VA 3G5RA 4H4YA 2VQBA 3RCYA 4I58A 3M12A 4J33A 4WCTA 1OJCA 3KPFA 4Z17A 3GSIA 4YTMA 3FVDA 3DA1A 3PWIA 1S7MA 1CL0A 3V5FA 3EEZA 1L9EA 4GCMA 5J60A 3LXDA 2P8BA 1ONFA 2GQWA 4U8NA 3AE7A 2OFJA 4TVWA 1S2QA 3N6JA 1L9DA 2BABA 2YLZA 1TDFA 2C3CA 1EL9A 4X9MA 4YSXA 4TM0A 4FK1C 3ZLHA 3RP8A 4K2SA 3F8DA 4EQWA 2ZBWA 3DJJA 4NTCA 4G6GA 3EANA 3KPKA 4GMEA 2EQ8A 3UP4A 2YLRA 1B8SA 1CBOA 2WOIA 3SZWA 3ICTA 4G73A 4H7UA 3AYLA 1TDKA 2CVJA 1YY5A 1N5WC 1KSSA 4WX1A 5BULA 4H2NA 1EC8A 1OJ9A 3I6DA 2QJNA 1JRZA 2HXUA 4X4JA 2YG5A 3BHFA 1DNCA 1GRHA 2GAHB 2P0IA 1K0JA 1EL8A 3UJEA 1P2EA 2HXTA 1DOBA 4GYPC 2PTZA 1VQWA 2Z5XA 1PBBA 5KRQA 1L0VA 1CJCA 5BOFA 4H2QA 1MRAA 2FJEA 3NT6A 2V3AA 3CTYA 4CNJA 1F9CA 3NHOX 5FS8A 3ALJA 2BCPA 3UJFA 1LTXR 4H2HA 2WETA 3HRDC 2V3BA 4BK3A 2V60A 1L9CA 4ROPA 3SZCA 1DJQA 4II2A 1IUUA 3STPA 4U8PA 3GYIA 3R07C 2XVFA 3NO1A 2X99A 2AKZA 4DXKA 1N61C 3GDPA 5JCKA 4H4PA 3NYCA 1DTNA 3CXOA 1NHSA 3ABVA 4HN8A 4A79A 1RVKA 3ATRA 3AMZA 2VRLA 5FS7A 3JSKA 4K5RA 4YXDA 4LU6A 1IYXA 2PYXA 1PXAA 2TPRA 5EB5A 1FECA 5IQ4A 3AE3A 3CNSA 5U1OA 4U8OA 3DERA 1OEPA 1XHCA 1ZP0A 4K8DA 5CKUA 3R9UA 3PO7A 4REKA 1FL2A 1ZDLA 4KWSA 3OC4A 4H2PA 4A9WA 3C4NA 1H86A 2GB0A 3VR9A 4JN8A 2YR6A 4GAVA 2VOUA 5BVAA 2DKIA 2JB2A 3H8LA 1D4CA 3VC6A 2R9ZA 3V5CA 3NH3X 1GTEA 1S3BA 5HHFA 3LB8A 3V3OA 1JOAA 2WEUA 1V59A 3DJDA 3HW2A 1P48A 3I4KA 2B76A 1H7WA 3LJPA 1GRAA 1KNPA 2C65A 1TDOA 1O94A 2MNRA 2XVHA 2XLRA 3S47A 3ETRB 1NG4A 3GDNA 1GXFA 3II4A 2OO6A 3PWGA 1PBCA 3CPIG 4IP5A 3P3BA 3AE8A 1K4QA 3NYEA 3AECA 4NNJA 1NPXA 5FMHA 2WPEA 2VRMA 3RR1A 4ZN0A 3CGBA 3H8AA 3I3LA 2R0CA 2O56A 3NK1X 2GGIA 3AD8B 3THUA 1JU2A 1N5XA 1K0LA 3TW9A 4UP3A 3CPJG 3FJ4A 3EUB3 3G5SA 3GO2A 1KSUA 1MUCA 1WYGA 3P9UA 3PG6A 3ITJA 4FI4A 3DIPA 3RRAA 1B4VA 3TTEA 3AD7B 3K30A 3REDA 3H12A 3DG6A 3CXBA 3SX6A 4G74A 1JRPA 4J1OA 5JCIA 3S5WA 2WDQA 3UJ2A 4A35A 3V3NA 1JEHA 3UKAA 5JRBA 4U8LA 1EC9A 2BC0A 3DJEA 5BOEA 2PODA 1CC4A 4JN9A 1H83A 2YVGA 1GNDA 2YG6A 2AL2B 2BXRA 2C73A 3FYYA 2FKPA 2QCUA 3NVYB 1NG3A 2C4CA 4UDRA 3SQSA 5CQFA 2PU0A 3ZVIA 3UKKA 1RYIA 2OZTA 1BWCA 3ENLA 1SJDA 3CGEA 3GWDA 1GRGA 4MGGA 5BRTA 1F6MA 3IJQA 5C2TA 2FJBA 5KWFA 4PAAA 3SGLA 1Q1RA 3MUCA 4MMWA 3MQTA 3QSMA 4HCLA 1H84A 3CK5A 5J7XA 4USRA 3GY1A 3NVVB 3ZVHB 2BA9A 2E3TA 5FJPA 4UDQA 4YTNA 3T4WA 1N4UA 2ZZBA 4J36A 2OZ8A 5LV9A 4LIIA 4E5TA 3OW1A 2VVLA 1D7LA 3EKGA 2AL1A 2GGEA 3M0OA 4NZHA 3SN0A 3UP5A 2BS4A 4ECHA 4H4UA 3V3WA 4C3XA 3QVPA 2WU2A 3O0HA 3KKJA 4B63A 2BCGG 1VDVA 3DG7A 3EAOA 3GMBA 2DW6A 3IHMA 1YEYA 3RNMA 3HPFA 2XGZA 3K7QX 2XFUA 3BI4A 2PPGA 5J04A 3A7AA 4JNQA 2V6OA 4IVOB 3UKLA 5KVHA 2RABA 1Y56A 2PGWA 2WU5A 2ACZA 4Z43A 3H7VA 5M0ZA 1R0MA 4O5UA 2AAQA 3T0KA 1X2GA 4JN7A 1N63C 1W6TA 2B9YA 3E1TA 2C64A 2DW7A 2GH5A 1B37A 3CMMA 1MDRA 4GISA 1NHPA 3JZUA 3CGDA 2VVMA 2UZZA 1MO9A 3LADA 2NPXA 1ONEA 1ZOYA 2Q0KA 5GSNA 1Y56B 1O95A 3NXLA 3VC5A 2O9ZA 3D9XA 3HYWA 4J34A 2YG3A 2X3NA 2B7RA 2YVJA 4KT2A 1LV0A 2OX4A 2E4GA 2OAMA 3CNDA 2OA1A 1BKWA 3VA8A 4GDEA 2OKTA 3NVWB 4U8JA 2OZ3A 4TLZA 1ZXIC 3A7RA 4OPIA 1BF3A 2V61A 3MWCA 3T6CA 3N4FA 3ATQA 2GRTA 4G6HA 3NVZB 1PN0A 3PVCA 1GRBA 4H2RA 2PTXA 3KVEA 3AD9B 1RSGA 4ICYA 1EBGA 4EWJA 3T37A 4YKFA 3DDMA 1IUWA 3MZNA 3B3RA 3AB1A 1GTHA 1D4EA 3FBSA 5KMRA 3DK9A 1N4VA 4AOSA 2TMDA 1V97A 2PA6A 5ENLA 4Z44A 4B1BA 4I59A 3NRZB 2ARDA 4EMWA 1F8SA 3NN0X 1LQUA 1KNRA 2XH7A 4J2WA 5JCNA 4Z2UA 3BOXA 1PJ5A 4CCQA 2YVFA 1CJ4A 3SBFA 4DGKA 1SJBA 1H2IA 3IK4A 3TOYA 3F8RA 4IZGA 4X9NA 1GREA 2XVJA 3T31A 1S3EA 4Y4LA 2GGGA 3SJNA 5FJUA 3NLCA 2CHRA 4M6UA 2I5QA 3JW7A 2VVLG 1R6WA 2GV8A 3UTHA 5FS6A 2AKMA 1OJAA 3GC2A 3SN1A 2B7SA 3ICRA 4D04A 1REOA 3D1CA 3SSZA 3DH9A 4YT0A 3R0KA 5KMSA 3DMEA 2PP0A 1GEUA 4H19A 3HYVA 3C96A 2GMJA 2VZ2A 1LPFA 1AOGA 4H4XA 3IF9A 2BS2A 3VCNA 5U25A 3CPHG 3KA7A 3OZYA 3NK2X 1TE6A 3QJ4A 1EC7A 3GYXA 2HNEA 2OG9A 5KOXA 3TQPA 1ZMCA 1PJ7A 4H1ZA 2OPJA 2WHDA 3FCPA 2BK3A 2WP6A 2DKHA 2WP9A 2W55A 1GSNA 3GMCA 3GYJA 4U2LA 4JDRA 2RGHA 4E4FA 1JNRA 3GD3A 2C75A 3QN3A 1MNSA 2PU1A 3GD4A 3AEGA 3FPZA 3NK0X 3UTGA 1KN0A 2YWLA 2W3RA 3DK8A 2A87A 4P9SA 1ZX9A 4AOXA 1NENA 4EM4A 3DFYA 3K7TA 3VFCA 3AE2A 2C76A 4EMIA 6ENLA 3GWFA 4APNA 2GR0A 2OLNA 2GGHA 2IIDA 3C4AA 2QJMA 3OTRA 4KPLA 4H4ZA 2GEWA 2NQLA 1N4WA 3FV9A 3B9JB 4BK1A 3P4RA 3F8PA 4J31A 2PMQA 1TKKA 4A6GA 4RSLA 1YKJA 2YM2A 4G9KA 3UKFA 4CCRA 2V5ZA 3CIRA 1SJCA 1QO8A 3SQPA 1TZZA 3ES7A 4YWSA 3CYJA 4Z2RA 4AT2A 4E4UA 2BXSA 1P43A 1FOHA 2C67A 1PDYA 3N4EA 3NGCX 1W4XA 1MOKA 4E6MA 2XYOA 4HCDA 3UCCA 5FS9A 2PS2A 3BSMA 3QFAA 3LOVA 1WUFA 2BS3A 3D8XA 3LZXA 3UXLA 1F8RA 3AEAA 4BV6A 1BGNA 1YQ3A 3AE1A 1FIQB 3ZYXA 3TWBA 1BGJA 1Z6LA 3ALMA 3AM9A 1HYUA 4AP3A 4HNLA 3UOZA 1JPMA 4EQXA 4B66A 2PHHA 1CHUA 4IVMB 1DODA 1JROA 2XH4A 3UJSA 2PSNA 1H82A 1JRYA 3FMWA 1VRQB 2RGOA 4XWZA 2JB1A 4UDPA 2FJAA 3BJSA 2PGEA 5TR3A 3UTFA 1JNZA 3NTDA 4ZCWA 1GRFA 2YQUA 2XFNA 3FG2P 2EQ7A 3T2KA 2W54A 4KPRA 2RGJA 3DGBA 2H88A 2WOVA 1OJTA 3HYXA 3P93A 2GAGB 2YR5A 2YLXA 4J56A 4HA6A 5DBJA 2F5ZA 2B9WA 2XH0A 4K8GA 1MDLA 3MY9A 3GD6A 2PTYA 3VRDB 2X8HA 3VR8A 4A7AA 2XCGA 3K1GA 4OPCA 3AN1A 2POZA 2OLAA 2R45A 3P1WA 3ADAB 4DWDA 2APGA 3P0WA 1M64A 3PS9A 5IQ1A 3AE5A 4GR1A 4YKGA 1FEBA 1UKVG 1PDZA 2EQ9A 2OQHA 3M13A 3NZGA 2AL2A 1PXBA 1XANA 3I6TA 3P4SA 3MSYA 3UOYA 3ZLFA 2XSXA 4K7ZA 2Q0LA 2YAUA 1IUSA 2GR2A 3OP2A 1GALA 2ZADA 3SXIA 4ZOHB 4TM3A 2ZC8A 2GR1A 3RO6A 2WQYA 3UCDA 3KD9A 4LA1A 4MJWA 1F3PA 4OPDA 4USQA 5HYMA 2QJJA 2NVKX 1FEAA 4RG3A 3AWIA 4DX3A 2RDXA 1PXCA 4H4WA 1K0IA 3EPTA 4M0XA 2PTWA 1IUVA 1FCDA 2Q7VA 1ZY8A 1FO4A 4KEMA 3Q9TA 3QPEA 2OVLA 2P8CA 1FHUA 3ICSA 3DK4A 3RP7A 4YWOA 3UKQA 1P2HA 2ZZCA 3ES8A 2HZGA 4OCGA 5FJRA 5JCMA 1F8WA 3KUMA 3HZLA 3B97A 5GRTA 3H8IA 2JB3A 2X8GA 3SN4A 2XLSA 3QSSA 1GV4A 2PP1A 4A3RA 2PP3A 4EQRA 2WPCA 2WPFA 4DYEA 4GUVA 3NNEA 3DJGX 1LJ1A 3LZWA 3VQRA 1NAAA 1ZKQA 4OPTA 3CT2A 2QDDA 2WDRA 3UGVA 3CGCA 2I0ZA 5KVIA 2QGYA 2YM1A 2BRAA 2JBVA 1CC6A 3IJLA 4C3YA 3NTAA 2BRYA 2GDQA 3D46A 2H89A 4IL0A 2WOWA 2YLWA 2XLTA 3PK7A 3SY4A 3AXBA 2E1MA 2P88A 3CB3A 3R10A 2X50A 3RHAA 1E39A 2CDUA 3NIXA 1FHVA 4IP4A 5EBKA 3Q45A 2ZZ0A 4U8MA 1XS2A 1TRBA 1DOCA 2BACA 1Y0PA 3R1ZA 5KOWA 1NEKA 4A99A 2XLPA 3AE9A 4C77A 5G5GB 1KKRA 1BQGA 3V76A 4XXGA 3AEFA 4Y4NA 2YG7A 2Y6RA 4BJZA 2R46A 3ISHA 1E1KA 2QA1A 2C7GA 3UKPA 4BK2A 2Z5YA 4FDCB 2YR4A 3UOVA 4CNKA 3ALLA 1QLBA 4OPUA 4JNAA 4GIRA 4B69A 3K7MX 5HY5A 3AYIA 4H4RA 3BI5A 5L46A 2OQYA 1FFUC 1SB3B 4EQSA 1PBDA 2XH2A 4HCHA 3S5SA 3GRSA 1X31B 4Z25A 4TM4A 3BI2A 3MKCA 5EU9A 4E8GA 4MKSA 4DSHA 5BUKA 4NEVA 2R0GA 4TVYA 3R11A 3P4PA 3CN8A 3CAWA 1T3QC 4JQ9A 4K22A 3A7UA 2GSHA 1ELIA 2J3NA 3VCCA 3IWAA 4IL2A 1IUTA 1KF6A 1ELSA 1S2YA 2YG4A 4CY6A 4OPGA 2Q6UA 2JKCA 4IT1A 1OJDA 4YTPA 1X2HA 2GL5A 3CNJA 1H81A 2IVDA 1O5WA 2XFPA 4HPNA 1LQTA 4Z2TA 1FFVC 2C66A 3COXA 3L1RA 3AEDA 2CULA 3QVRA 3DGZA 4B64A 2QAEA 3IJIA 1KKOA 3T2YA 1KFYA 4NEWA 1RM6B 3UTEA 3SZFA 3UJRA 1LVLA 4RG4A 1WUEA 1PHHA 4HB9A 1STZA 1RP0A 3P4QA 1DXLA 5EB4A 4EM3A 3RP6A 3PFRA 3TJ4A 2C72A 3TJIA 1GT8A 2JK6A 4H4TA 3CNPA 4NTEA 3NN6X 1JDFA 1NU5A 4KX6A 4IHCA 3G5QA 4Z26A 5C3JA 4C5OA 2C70A 3R25A 3GRTA 2QQ6A 4J57A 1JPDX 5IPYA 2EQ6A 5M10A 1N60C 3T9PA 2CFYA 4ADWA 1NELA 1N1PA 4FX9A 3SFEA 3DESA 1VG0A 3ZLGA 4YSYA 3QKEA 2BYBA 1GPEA 3SR6B 1B5QA 2GGJA 3DEQA 2FJDA 3H4KA 4GYPA 3L8KA 4DSGA 3DG3A 2XLUA 4U2TA 5G5HB 4GGHA 3VDGA 4FP1A 3SM8A 3RITA 4OVIA 3T14A 4EIPA 5KMQA 2R0PA 4EMJA 3NG7X 1VG9A 3U9IA 2XDOA 3AEBA 4DNAA 4ZCDA 3S61A 2IVEA 2Y6QA 3BHKA 4TLXA 5FJOA 3NKSA 2WS3A 4AP1A 4CRTA 4Y4MA 1N62C 3H70A 1DOEA 2XFOA 1XDIA 4PABA 1E7PA 1MXTA 4GGBA 2R4JA 1GOSA 3SYIA 4K2XA 1TYTA 5KXJA 1XPQA 2B9XA 1NHRA 3TCSA 2OLOA 4B65A 2XFQA 1XPYA 3QTPA 2A8XA 1KCZA 1ZK7A 1JRXA 3AYJA 3WE0A 4K1WA 1TDNA 2AR8A 4BURA 3NS1B 4B67A 4JHMA 3UKHA 1IJHA 1H6VA 4A6NB 1YQZA 3OZMA 3NRNA 1M6IA 3V4BA 3KLJA 4GRTA 2GQFA 4X2PA 4BJYA 2JAEA 1YQ4A 4D03A 2A89A 2FYMA 4M52A 4IA5A 3DGHA 2VQ7A 3ZDNA 1ZMDA 2BK4A 1PS9A 2QA2A 5KMPA 3B6DA 7ENLA 4E0VA 3ZVHA 4NWZA 3UXKA 1E1LA 4H4QA 2X8CA 5JCLA 3CNTA 1NDAA 1EL7A 1PBEA 4Z24A 1PDHA 2GMHA 4EIQA 2GF3A 4FK1A 3UOXA 1SEZA 2WDVA 2XVEA 1D4DA 1PJ6A 1Q1WA 2E5AA 1E9IA 3Q4DA 1ECQA 4K5SA 4JY3A 4YSHA 1DJNA 3QLDA 3QFBA 3NFUA 2AQJA 3UCLA 2YLTA 1CJ2A 3OZ2A 2QVHA 3Q6JA 4II3A 1SJAA 4U8KA 1BZLA 4H4SA 5HXIA 1COYA 1L8PA 2R4EA 3N6HA 1H7XA 4C74A 4OPLA 5EOWA 1TDEA 1CJ3A 4O5QA 1EBDA
chains in the Genus database with same CATH topology
4XXGA 3QJ4A 3AEFA 3GYXA 2WPEA 4Y4NA 2VRMA 2YG7A 1CC2A 3SFDA 5KOXA 4ZN0A 3L5OA 3CGBA 2Y6RA 1ZMCA 2GR3A 1PJ7A 2R0CA 3I3LA 3NK1X 3VRBA 4TM1A 2WHDA 4A65A 3AD8B 2R46A 2BK3A 4BJZA 2WP6A 2DKHA 3KU9A 2WP9A 5KNLA 1JU2A 3BNMA 3AEEA 1IUXA 3AE6A 4AT0A 4CY8A 3ISHA 1K0LA 1E1KA 2QA1A 4ZCCA 1GSNA 3CPJG 2C7GA 3GMCA 3GYJA 4UP3A 4N9XA 1E1MA 4U2LA 4JDRA 3G5SA 1KSUA 2RGHA 1QJDA 3UKPA 2WBAA 1PBFA 4GAPA 1JNRA 4BK2A 2Z5YA 2XVIA 3P9UA 3PG6A 3GD3A 4FDCB 2C75A 4IA6A 2YR4A 3ITJA 4CBQA 3AEGA 3GD4A 3FPZA 3NK0X 3UTGA 1KN0A 2YWLA 3AE4A 3UOVA 1B4VA 3DK8A 4CNKA 2A87A 1QLBA 3ALLA 4GDPA 4P9SA 3AD7B 1ZX9A 4OPUA 4JNAA 2W0HA 4AOXA 3K30A 4B69A 1NENA 4EM4A 1D5TA 3K7MX 3REDA 4IV9A 5HY5A 3AYIA 1VDCA 4H4RA 3K7TA 3IHGA 3BI5A 3AE2A 5L46A 3SX6A 1GERA 4G74A 2WESA 2C76A 4EMIA 2BK5A 4EQSA 1PBDA 3GWFA 3IC9A 1ZOVA 4APNA 2GR0A 2OLNA 3BNUA 3EF6A 5JCIA 2IIDA 2WDQA 4GF7A 3S5WA 3C4AA 3GRSA 1X31B 4YSZA 4Z25A 4TM4A 3V3NA 4H4ZA 2GEWA 1JEHA 3BI2A 1N4WA 3UKAA 5JRBA 4BK1A 4U8LA 3P4RA 1Q9IA 3F8PA 4U8IA 2BC0A 4J31A 3DJEA 4DSHA 1E1NA 4RSLA 1YKJA 5BUKA 4NEVA 2R0GA 2YM2A 4G9KA 3UKFA 1CC4A 3P4PA 4CCRA 2V5ZA 4JN9A 1E6EA 4A5LA 1H83A 3CIRA 3CN8A 3NYFA 2HQMA 1QO8A 2YVGA 3SQPA 1GNDA 2YG6A 3FIMB 4NTDA 2BXRA 1NHQA 3QSEA 1D7YA 4JY2A 4JQ9A 2C73A 4K22A 4Z2RA 4AT2A 3SZ0A 1ELIA 2J3NA 4H50A 3VRAA 2BXSA 1GESA 2C3DA 2QCUA 3IWAA 4B68A 1IUTA 1FOHA 1NG3A 2C4CA 1KF6A 2C67A 4UDRA 5CQFA 3NGCX 1GETA 3UKKA 1RYIA 1W4XA 1MOKA 5ER0A 1S2YA 2WP5A 3T2ZA 1BWCA 3GWDA 3CGEA 2YG4A 4A6NA 2XYOA 4CY6A 1GRGA 4OPGA 5FS9A 2OALA 2Q6UA 1CF3A 2JKCA 3QFAA 1OJDA 3LOVA 4YTPA 4U2SA 3CNJA 2YLSA 5BRTA 2BS3A 1H81A 2IVDA 1F6MA 1O5WA 3D8XA 2XFPA 1KDGA 2FJBA 3LZXA 5C2TA 5KWFA 1LQTA 2GVCA 4PAAA 4Z2TA 2C66A 4H4VA 3URHA 3SGLA 1Q1RA 3COXA 3L1RA 1F8RA 4XWRA 3AEDA 3AEAA 2CULA 4BV6A 1BGNA 1YQ3A 5U63A 3QVRA 3DGZA 3AE1A 3ZYXA 1EL5A 3QSMA 4B64A 1BGJA 1Z6LA 3ALMA 1H84A 2BC1A 2QAEA 5J7XA 1HYUA 2FBWA 4USRA 1GRTA 4AP3A 3UOZA 4EQXA 4B66A 2BA9A 3T2YA 1KFYA 2PHHA 1CHUA 1TYPA 4IVMB 1DODA 2E5VA 4NEWA 4H4YA 3G5RA 4UDQA 2VQBA 3UTEA 4YTNA 3SZFA 1LVLA 4RG4A 1H82A 4I58A 1PHHA 1JRYA 1N4UA 3M12A 4HB9A 2ZZBA 1RP0A 4J36A 4J33A 4WCTA 1OJCA 3KPFA 3FMWA 3P4QA 3GSIA 5LV9A 1VRQB 2RGOA 3DA1A 1DXLA 4XWZA 4LIIA 4YTMA 5EB4A 4EM3A 2JB1A 1S7MA 4UDPA 1CL0A 2FJAA 3RP6A 2VVLA 1D7LA 2C72A 3M0OA 4NZHA 5TR3A 4GCMA 1GT8A 1L9EA 3UP5A 3UTFA 1JNZA 2BS4A 5J60A 3LXDA 3NTDA 2JK6A 4H4TA 3CNPA 4ECHA 4NTEA 4H4UA 1GRFA 1ONFA 3NN6X 2GQWA 4C3XA 3QVPA 2WU2A 2YQUA 2XFNA 3FG2P 3O0HA 4U8NA 3AE7A 2EQ7A 4KX6A 3T2KA 1S2QA 3KKJA 3G5QA 1L9DA 2BABA 4KPRA 4B63A 2RGJA 4Z26A 2BCGG 2YLZA 2H88A 2WOVA 5C3JA 4C5OA 1TDFA 2C70A 2C3CA 1EL9A 3GRTA 4X9MA 3EAOA 4YSXA 4TM0A 4FK1C 3GMBA 1OJTA 3HYXA 3RP8A 2GAGB 4J57A 2YLXA 4J56A 2EQ6A 2YR5A 4HA6A 5IPYA 5M10A 3F8DA 4EQWA 2ZBWA 5DBJA 3IHMA 2F5ZA 3DJJA 2B9WA 4NTCA 4G6GA 3VRDB 2CFYA 2X8HA 4ADWA 3EANA 3KPKA 3RNMA 3VR8A 2EQ8A 1N1PA 3UP4A 2YLRA 3K7QX 2XFUA 3BI4A 4A7AA 2XCGA 4FX9A 1B8SA 1CBOA 4JNQA 2WOIA 4OPCA 3ICTA 3SFEA 3SZWA 4G73A 4H7UA 2V6OA 3AYLA 4IVOB 2R45A 3UKLA 1TDKA 2CVJA 3P1WA 5KVHA 1VG0A 2RABA 1Y56A 3ADAB 2APGA 4YSYA 1M64A 3PS9A 5IQ1A 3AE5A 4GR1A 4YKGA 2BYBA 2WU5A 1GPEA 1YY5A 1FEBA 1B5QA 1UKVG 2FJDA 2ACZA 1KSSA 4WX1A 4Z43A 3H4KA 2EQ9A 3L8KA 3M13A 5BULA 4H2NA 5M0ZA 1PXBA 1XANA 4O5UA 1OJ9A 3P4SA 2AAQA 3I6DA 4DSGA 3T0KA 1JRZA 2XLUA 3UOYA 4X4JA 2B9YA 2YG5A 4K7ZA 3BHFA 1DNCA 1GRHA 2C64A 2GH5A 2GAHB 3E1TA 2Q0LA 2YAUA 4U2TA 1IUSA 2GR2A 1B37A 3CMMA 1K0JA 1GALA 1NHPA 1EL8A 3CGDA 3SM8A 1P2EA 2VVMA 3SXIA 2UZZA 4TM3A 1DOBA 4OVIA 3T14A 4EIPA 1MO9A 5KMQA 2GR1A 3LADA 2NPXA 2WQYA 1VQWA 2Z5XA 1ZOYA 1PBBA 2Q0KA 5KRQA 5GSNA 2R0PA 1L0VA 1CJCA 4EMJA 3NG7X 1VG9A 3AEBA 2XDOA 4H2QA 3KD9A 1Y56B 2FJEA 4DNAA 3NT6A 4ZCDA 2V3AA 3CTYA 1O95A 3S61A 4LA1A 2IVEA 3D9XA 2O9ZA 4MJWA 4CNJA 2Y6QA 1F3PA 3NHOX 4OPDA 3HYWA 5FS8A 3ALJA 3BHKA 4USQA 4TLXA 2BCPA 5HYMA 2NVKX 4J34A 3NKSA 1FEAA 2YG3A 2X3NA 4RG3A 1LTXR 2WS3A 4AP1A 2B7RA 2YVJA 2WETA 3AWIA 1LV0A 2V3BA 4CRTA 4BK3A 4Y4MA 2E4GA 1DOEA 1PXCA 2XFOA 1XDIA 4H4WA 2V60A 4PABA 2OAMA 3CNDA 1K0IA 3EPTA 2OA1A 1L9CA 1BKWA 1E7PA 4GDEA 4U8JA 1IUVA 1MXTA 2R4JA 3SZCA 1GOSA 1FCDA 2Q7VA 1ZY8A 3SYIA 4K2XA 1DJQA 4TLZA 1TYTA 3Q9TA 5KXJA 1XPQA 2B9XA 4II2A 1NHRA 3ICSA 1IUUA 2OLOA 4OPIA 4B65A 3DK4A 2XFQA 1BF3A 4U8PA 2V61A 3RP7A 3GYIA 4YWOA 3UKQA 2A8XA 1P2HA 2ZZCA 1ZK7A 3ATQA 2GRTA 2XVFA 1JRXA 3AYJA 3WE0A 4G6HA 4OCGA 2X99A 1TDNA 1PN0A 3PVCA 1GRBA 5JCMA 2AR8A 4BURA 4H2RA 1F8WA 4B67A 3GDPA 3KVEA 5JCKA 4H4PA 3AD9B 3NYCA 3UKHA 1IJHA 3HZLA 1H6VA 4A6NB 5GRTA 1NHSA 1YQZA 1RSGA 3H8IA 4ICYA 2JB3A 3ABVA 3NRNA 4A79A 2X8GA 2XLSA 3QSSA 1M6IA 4YKFA 1GV4A 3T37A 3ATRA 3KLJA 4GRTA 2VRLA 5FS7A 3JSKA 4K5RA 4YXDA 4LU6A 2GQFA 1IUWA 4BJYA 3B3RA 2PYXA 1PXAA 4EQRA 2JAEA 2WPCA 2WPFA 1YQ4A 4GUVA 2TPRA 1GTHA 2A89A 3AB1A 1D4EA 4D03A 4M52A 5EB5A 3NNEA 4C3YA 3DJGX 1LJ1A 3FBSA 3DK9A 5KMRA 1N4VA 1FECA 4IA5A 5IQ4A 3DGHA 2VQ7A 3LZWA 3ZDNA 4AOSA 2TMDA 3AE3A 1ZMDA 3VQRA 3CNSA 2BK4A 4Z44A 4B1BA 5U1OA 1PS9A 1NAAA 4U8OA 2QA2A 4I59A 5KMPA 2ARDA 1ZKQA 4EMWA 1F8SA 1XHCA 3B6DA 4OPTA 1ZP0A 4K8DA 4E0VA 3NN0X 1LQUA 4NWZA 1KNRA 2WDRA 1E1LA 4H4QA 4J2WA 5JCNA 5CKUA 4Z2UA 3R9UA 3PO7A 3CGCA 2I0ZA 1PJ5A 4REKA 2X8CA 5KVIA 4CCQA 5JCLA 1FL2A 2YVFA 1CJ4A 1ZDLA 2YM1A 3OC4A 2BRAA 2JBVA 4H2PA 4A9WA 3C4NA 1CC6A 4DGKA 1H2IA 3CNTA 1H86A 2GB0A 1NDAA 3VR9A 2YR6A 4GAVA 1EL7A 2VOUA 1PBEA 2BRYA 3F8RA 3NTAA 2H89A 1PDHA 2GMHA 4X9NA 1GREA 4Z24A 4EIQA 2GF3A 2XVJA 2WOWA 5BVAA 4FK1A 2DKIA 2JB2A 3T31A 1S3EA 4Y4LA 3UOXA 1SEZA 2YLWA 3H8LA 2XLTA 1D4CA 2WDVA 2XVEA 3SY4A 2R9ZA 3AXBA 2E1MA 3NH3X 3NLCA 1GTEA 1S3BA 5HHFA 1D4DA 1PJ6A 3LB8A 3V3OA 2VVLG 1Q1WA 2GV8A 1JOAA 2WEUA 1V59A 3UTHA 5FS6A 2B76A 2X50A 3DJDA 4K5SA 1H7WA 1OJAA 4JY3A 3LJPA 3RHAA 1E39A 1GRAA 2B7SA 1KNPA 2CDUA 2C65A 3NIXA 4YSHA 1TDOA 3ICRA 5EBKA 4D04A 1DJNA 1O94A 1REOA 2XVHA 2XLRA 3QFBA 3D1CA 3DH9A 4YT0A 5KMSA 2AQJA 2ZZ0A 3DMEA 1NG4A 4U8MA 3GDNA 3UCLA 2YLTA 1GEUA 1CJ2A 1GXFA 3II4A 3OZ2A 1TRBA 3Q6JA 1DOCA 3HYVA 4II3A 3CPIG 1PBCA 2BACA 2GMJA 3C96A 4U8KA 1Y0PA 1LPFA 2VZ2A 1AOGA 1BZLA 5KOWA 4H4SA 4H4XA 3IF9A 1NEKA 4A99A 5HXIA 2BS2A 1COYA 3AE8A 2XLPA 3AE9A 2R4EA 1K4QA 3NYEA 4C77A 3AECA 4NNJA 5U25A 3CPHG 1NPXA 1H7XA 3KA7A 5FMHA 4C74A 4OPLA 5EOWA 3V76A 1TDEA 1CJ3A 3NK2X 4O5QA 1EBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XXG A;  3QJ4 A;  3AEF A;  3SFD A;  2WPE A;  4Y4N A;  2VRM A;  2YG7 A;  1CC2 A;  5KOX A;  4ZN0 A;  3CGB A;  2Y6R A;  1ZMC A;  2GR3 A;  1PJ7 A;  2R0C A;  3I3L A;  3NK1 X;  3VRB A;  4TM1 A;  2WHD A;  4A65 A;  3AD8 B;  2R46 A;  2BK3 A;  4BJZ A;  2WP6 A;  2DKH A;  3KU9 A;  2WP9 A;  1JU2 A;  3BNM A;  3AEE A;  1IUX A;  3AE6 A;  4AT0 A;  4CY8 A;  3ISH A;  1K0L A;  1E1K A;  2QA1 A;  4ZCC A;  1GSN A;  3CPJ G;  2C7G A;  3GMC A;  3GYJ A;  4UP3 A;  4N9X A;  1E1M A;  4U2L A;  4JDR A;  3G5S A;  1KSU A;  2RGH A;  1QJD A;  3UKP A;  2WBA A;  1PBF A;  1JNR A;  4BK2 A;  2Z5Y A;  2XVI A;  3P9U A;  3GD3 A;  4FDC B;  2C75 A;  4IA6 A;  2YR4 A;  3ITJ A;  4CBQ A;  3AEG A;  3GD4 A;  3FPZ A;  3NK0 X;  3UTG A;  3AE4 A;  2YWL A;  3UOV A;  1B4V A;  3DK8 A;  4CNK A;  2A87 A;  1QLB A;  3ALL A;  4GDP A;  4P9S A;  3AD7 B;  1ZX9 A;  4OPU A;  4JNA A;  2W0H A;  4AOX A;  3K30 A;  4B69 A;  1NEN A;  4EM4 A;  1D5T A;  3K7M X;  3RED A;  4IV9 A;  5HY5 A;  3AYI A;  1VDC A;  4H4R A;  3K7T A;  3IHG A;  3BI5 A;  3AE2 A;  5L46 A;  1GER A;  2WES A;  2C76 A;  4EMI A;  2BK5 A;  4EQS A;  1PBD A;  3GWF A;  3IC9 A;  1ZOV A;  4APN A;  2GR0 A;  2OLN A;  3BNU A;  3EF6 A;  5JCI A;  2IID A;  2WDQ A;  4GF7 A;  3S5W A;  3C4A A;  3GRS A;  1X31 B;  4YSZ A;  4Z25 A;  4TM4 A;  3V3N A;  4H4Z A;  2GEW A;  1JEH A;  3BI2 A;  1N4W A;  3UKA A;  4BK1 A;  4U8L A;  3P4R A;  1Q9I A;  3F8P A;  4U8I A;  2BC0 A;  4J31 A;  3DJE A;  4DSH A;  1E1N A;  4RSL A;  1YKJ A;  5BUK A;  4NEV A;  2R0G A;  2YM2 A;  3UKF A;  1CC4 A;  3P4P A;  4CCR A;  2V5Z A;  4JN9 A;  1E6E A;  4A5L A;  1H83 A;  3CIR A;  3CN8 A;  3NYF A;  2HQM A;  1QO8 A;  2YVG A;  3SQP A;  1GND A;  2YG6 A;  3FIM B;  4NTD A;  2BXR A;  1NHQ A;  3QSE A;  1D7Y A;  4JY2 A;  4JQ9 A;  2C73 A;  4K22 A;  4Z2R A;  4AT2 A;  1ELI A;  2J3N A;  4H50 A;  3VRA A;  2BXS A;  1GES A;  2C3D A;  2QCU A;  3IWA A;  4B68 A;  1IUT A;  1FOH A;  1NG3 A;  2C67 A;  1KF6 A;  4UDR A;  5CQF A;  3NGC X;  1GET A;  3UKK A;  1RYI A;  1W4X A;  1MOK A;  5ER0 A;  1S2Y A;  2WP5 A;  1BWC A;  3GWD A;  3CGE A;  2YG4 A;  4A6N A;  2XYO A;  4CY6 A;  1GRG A;  4OPG A;  5FS9 A;  2OAL A;  2Q6U A;  1CF3 A;  2JKC A;  3QFA A;  1OJD A;  3LOV A;  4YTP A;  4U2S A;  3CNJ A;  2YLS A;  5BRT A;  2BS3 A;  1H81 A;  2IVD A;  1F6M A;  1O5W A;  3D8X A;  2XFP A;  1KDG A;  2FJB A;  3LZX A;  5C2T A;  5KWF A;  1LQT A;  2GVC A;  4PAA A;  4Z2T A;  2C66 A;  4H4V A;  3URH A;  3SGL A;  1Q1R A;  3COX A;  3L1R A;  1F8R A;  4XWR A;  3AED A;  3AEA A;  2CUL A;  4BV6 A;  1BGN A;  1YQ3 A;  5U63 A;  3QVR A;  3DGZ A;  3AE1 A;  3ZYX A;  1EL5 A;  3QSM A;  4B64 A;  1BGJ A;  1Z6L A;  3ALM A;  1H84 A;  2BC1 A;  2QAE A;  5J7X A;  1HYU A;  2FBW A;  4USR A;  1GRT A;  4AP3 A;  3UOZ A;  4EQX A;  4B66 A;  2BA9 A;  1KFY A;  2PHH A;  1CHU A;  1TYP A;  4IVM B;  1DOD A;  2E5V A;  4NEW A;  4H4Y A;  3G5R A;  4UDQ A;  2VQB A;  3UTE A;  4YTN A;  1LVL A;  4RG4 A;  1H82 A;  4I58 A;  1PHH A;  1JRY A;  1N4U A;  3M12 A;  4HB9 A;  2ZZB A;  1RP0 A;  4J36 A;  4J33 A;  4WCT A;  1OJC A;  3KPF A;  3FMW A;  3P4Q A;  3GSI A;  5LV9 A;  1VRQ B;  2RGO A;  3DA1 A;  1DXL A;  4XWZ A;  4LII A;  4YTM A;  5EB4 A;  4EM3 A;  2JB1 A;  4UDP A;  1CL0 A;  2FJA A;  3RP6 A;  2VVL A;  1D7L A;  2C72 A;  3M0O A;  4NZH A;  5TR3 A;  4GCM A;  1GT8 A;  1L9E A;  3UP5 A;  3UTF A;  1JNZ A;  2BS4 A;  5J60 A;  3LXD A;  3NTD A;  2JK6 A;  4H4T A;  3CNP A;  4ECH A;  4NTE A;  4H4U A;  1GRF A;  1ONF A;  3NN6 X;  2GQW A;  4C3X A;  3QVP A;  2WU2 A;  2YQU A;  2XFN A;  3FG2 P;  3O0H A;  4U8N A;  3AE7 A;  2EQ7 A;  4KX6 A;  1S2Q A;  3KKJ A;  3G5Q A;  1L9D A;  2BAB A;  4KPR A;  4B63 A;  2RGJ A;  4Z26 A;  2BCG G;  2YLZ A;  2H88 A;  2WOV A;  5C3J A;  4C5O A;  1TDF A;  2C70 A;  2C3C A;  1EL9 A;  3GRT A;  4X9M A;  3EAO A;  4YSX A;  4TM0 A;  4FK1 C;  3GMB A;  1OJT A;  3RP8 A;  2GAG B;  4J57 A;  2YLX A;  4J56 A;  2EQ6 A;  2YR5 A;  4HA6 A;  5IPY A;  5M10 A;  3F8D A;  4EQW A;  2ZBW A;  5DBJ A;  3IHM A;  2F5Z A;  3DJJ A;  2B9W A;  4NTC A;  3VRD B;  2CFY A;  2X8H A;  4ADW A;  3EAN A;  3RNM A;  3VR8 A;  2EQ8 A;  1N1P A;  3UP4 A;  2YLR A;  3K7Q X;  2XFU A;  3BI4 A;  4A7A A;  2XCG A;  4FX9 A;  1B8S A;  1CBO A;  4JNQ A;  2WOI A;  4OPC A;  3ICT A;  3SFE A;  4H7U A;  2V6O A;  3AYL A;  4IVO B;  2R45 A;  3UKL A;  1TDK A;  2CVJ A;  3P1W A;  5KVH A;  1VG0 A;  2RAB A;  1Y56 A;  3ADA B;  2APG A;  4YSY A;  1M64 A;  3PS9 A;  5IQ1 A;  3AE5 A;  4GR1 A;  4YKG A;  2BYB A;  2WU5 A;  1GPE A;  1YY5 A;  1FEB A;  1B5Q A;  1UKV G;  2FJD A;  2ACZ A;  1KSS A;  4WX1 A;  4Z43 A;  3H4K A;  2EQ9 A;  3L8K A;  3M13 A;  5BUL A;  4H2N A;  5M0Z A;  1PXB A;  1XAN A;  4O5U A;  1OJ9 A;  3P4S A;  2AAQ A;  3I6D A;  4DSG A;  1JRZ A;  2XLU A;  3UOY A;  4X4J A;  2B9Y A;  2YG5 A;  4K7Z A;  3BHF A;  1DNC A;  1GRH A;  2C64 A;  2GH5 A;  2GAH B;  3E1T A;  2Q0L A;  2YAU A;  4U2T A;  1IUS A;  2GR2 A;  1B37 A;  1K0J A;  1GAL A;  1NHP A;  1EL8 A;  3CGD A;  3SM8 A;  1P2E A;  2VVM A;  2UZZ A;  4TM3 A;  1DOB A;  4OVI A;  4EIP A;  1MO9 A;  2GR1 A;  3LAD A;  2NPX A;  2WQY A;  1VQW A;  2Z5X A;  1ZOY A;  1PBB A;  2Q0K A;  5KRQ A;  5GSN A;  2R0P A;  1L0V A;  1CJC A;  4EMJ A;  3NG7 X;  1VG9 A;  3AEB A;  2XDO A;  4H2Q A;  3KD9 A;  1Y56 B;  2FJE A;  4DNA A;  3NT6 A;  4ZCD A;  2V3A A;  3CTY A;  1O95 A;  3S61 A;  4LA1 A;  2IVE A;  2O9Z A;  4MJW A;  4CNJ A;  2Y6Q A;  1F3P A;  3NHO X;  4OPD A;  5FS8 A;  3ALJ A;  3BHK A;  4USQ A;  4TLX A;  2BCP A;  5HYM A;  2NVK X;  4J34 A;  3NKS A;  1FEA A;  2YG3 A;  2X3N A;  4RG3 A;  1LTX R;  2WS3 A;  4AP1 A;  2B7R A;  2YVJ A;  2WET A;  3AWI A;  1LV0 A;  2V3B A;  4CRT A;  4BK3 A;  4Y4M A;  2E4G A;  1DOE A;  1PXC A;  2XFO A;  1XDI A;  4H4W A;  2V60 A;  4PAB A;  2OAM A;  3CND A;  1K0I A;  3EPT A;  2OA1 A;  1L9C A;  1BKW A;  1E7P A;  4GDE A;  4U8J A;  1IUV A;  1MXT A;  2R4J A;  1GOS A;  1FCD A;  2Q7V A;  1ZY8 A;  4K2X A;  1DJQ A;  4TLZ A;  1TYT A;  3Q9T A;  5KXJ A;  1XPQ A;  2B9X A;  1NHR A;  3ICS A;  1IUU A;  2OLO A;  4OPI A;  4B65 A;  3DK4 A;  2XFQ A;  1BF3 A;  4U8P A;  2V61 A;  3RP7 A;  3GYI A;  4YWO A;  3UKQ A;  2A8X A;  1P2H A;  2ZZC A;  1ZK7 A;  3ATQ A;  2GRT A;  2XVF A;  1JRX A;  3AYJ A;  3WE0 A;  4OCG A;  2X99 A;  1TDN A;  1PN0 A;  3PVC A;  1GRB A;  5JCM A;  2AR8 A;  4BUR A;  4H2R A;  1F8W A;  4B67 A;  3GDP A;  3KVE A;  5JCK A;  4H4P A;  3AD9 B;  3NYC A;  3UKH A;  1IJH A;  3HZL A;  1H6V A;  4A6N B;  5GRT A;  1NHS A;  1YQZ A;  1RSG A;  3H8I A;  4ICY A;  2JB3 A;  3ABV A;  3NRN A;  4A79 A;  2X8G A;  2XLS A;  3QSS A;  1M6I A;  4YKF A;  1GV4 A;  3T37 A;  3ATR A;  3KLJ A;  4GRT A;  2VRL A;  5FS7 A;  3JSK A;  4K5R A;  4YXD A;  4LU6 A;  2GQF A;  1IUW A;  4BJY A;  3B3R A;  2PYX A;  1PXA A;  4EQR A;  2JAE A;  2WPC A;  2WPF A;  1YQ4 A;  4GUV A;  2TPR A;  1GTH A;  2A89 A;  3AB1 A;  1D4E A;  4D03 A;  4M52 A;  5EB5 A;  3NNE A;  3DJG X;  1LJ1 A;  3FBS A;  3DK9 A;  1N4V A;  1FEC A;  4IA5 A;  5IQ4 A;  3DGH A;  2VQ7 A;  3LZW A;  3ZDN A;  4AOS A;  2TMD A;  3AE3 A;  1ZMD A;  3VQR A;  3CNS A;  2BK4 A;  4Z44 A;  4B1B A;  5U1O A;  1PS9 A;  1NAA A;  4U8O A;  2QA2 A;  4I59 A;  2ARD A;  1ZKQ A;  4EMW A;  1F8S A;  1XHC A;  3B6D A;  4OPT A;  1ZP0 A;  4K8D A;  4E0V A;  3NN0 X;  1LQU A;  1KNR A;  2WDR A;  1E1L A;  4H4Q A;  4J2W A;  5JCN A;  5CKU A;  4Z2U A;  3R9U A;  3PO7 A;  3CGC A;  2I0Z A;  1PJ5 A;  4REK A;  2X8C A;  5KVI A;  4CCQ A;  5JCL A;  1FL2 A;  2YVF A;  1CJ4 A;  1ZDL A;  2YM1 A;  3OC4 A;  2JBV A;  4H2P A;  4A9W A;  3C4N A;  1CC6 A;  4DGK A;  3CNT A;  1H86 A;  2GB0 A;  1NDA A;  3VR9 A;  2YR6 A;  1EL7 A;  2VOU A;  1PBE A;  3F8R A;  3NTA A;  4Z24 A;  2H89 A;  1PDH A;  2GMH A;  4X9N A;  1GRE A;  4C3Y A;  4EIQ A;  2GF3 A;  2XVJ A;  2WOW A;  5BVA A;  4FK1 A;  2DKI A;  2JB2 A;  1S3E A;  4Y4L A;  3UOX A;  1SEZ A;  2YLW A;  3H8L A;  2XLT A;  1D4C A;  2WDV A;  2XVE A;  2R9Z A;  3AXB A;  2E1M A;  3NH3 X;  3NLC A;  1GTE A;  1S3B A;  5HHF A;  1D4D A;  1PJ6 A;  3LB8 A;  3V3O A;  2VVL G;  1Q1W A;  2GV8 A;  1JOA A;  2WEU A;  1V59 A;  3UTH A;  5FS6 A;  2B76 A;  2X50 A;  3DJD A;  4K5S A;  1H7W A;  1OJA A;  4JY3 A;  3LJP A;  3RHA A;  1E39 A;  1GRA A;  2B7S A;  1KNP A;  2CDU A;  2C65 A;  3NIX A;  4YSH A;  1TDO A;  3ICR A;  5EBK A;  4D04 A;  1DJN A;  1O94 A;  1REO A;  2XVH A;  2XLR A;  3QFB A;  3D1C A;  3DH9 A;  4YT0 A;  2AQJ A;  2ZZ0 A;  3DME A;  1NG4 A;  4U8M A;  3GDN A;  3UCL A;  2YLT A;  1GEU A;  1CJ2 A;  1GXF A;  3II4 A;  3OZ2 A;  1TRB A;  3Q6J A;  1DOC A;  3CPI G;  1PBC A;  2BAC A;  2GMJ A;  3C96 A;  4U8K A;  1Y0P A;  1LPF A;  2VZ2 A;  1AOG A;  1BZL A;  5KOW A;  4H4S A;  4H4X A;  3IF9 A;  1NEK A;  4A99 A;  5HXI A;  2BS2 A;  1COY A;  3AE8 A;  2XLP A;  3AE9 A;  2R4E A;  1K4Q A;  3NYE A;  4C77 A;  3AEC A;  5U25 A;  3CPH G;  1NPX A;  1H7X A;  3KA7 A;  5FMH A;  4C74 A;  4OPL A;  5EOW A;  3V76 A;  1TDE A;  1CJ3 A;  3NK2 X;  4O5Q A;  1EBD A; 
#chains in the Genus database with same CATH topology
 4DN1 A;  3SFD A;  1CC2 A;  3L5O A;  2GR3 A;  3VRB A;  4TM1 A;  4A65 A;  4Z1Y A;  3KU9 A;  5KNL A;  3BNM A;  3AEE A;  1IUX A;  3AE6 A;  4AT0 A;  1JCT A;  4CY8 A;  4ZCC A;  4F4R A;  3TWA A;  4N9X A;  1E1M A;  1QJD A;  2WBA A;  1PBF A;  4GAP A;  2QDE A;  2XVI A;  4IA6 A;  4CBQ A;  4ENL A;  3AE4 A;  4G8T A;  4GDP A;  2MUC A;  2W0H A;  5FJT A;  1D5T A;  4IV9 A;  1BKH A;  1VDC A;  1KD0 A;  4G7F A;  3IHG A;  1GER A;  2WES A;  2BK5 A;  4H83 A;  5IDZ A;  3IC9 A;  1ZOV A;  4GF7 A;  3BNU A;  3EF6 A;  3OPS A;  4YSZ A;  4ZA0 A;  1Q9I A;  4U8I A;  4HNC A;  1E1N A;  1VQZ A;  1E6E A;  4A5L A;  3NYF A;  2HQM A;  4GFI A;  3FIM B;  4NTD A;  1NHQ A;  3QSE A;  1D7Y A;  2ONE A;  3D47 A;  4JY2 A;  3FXG A;  3SZ0 A;  4H50 A;  3RGT A;  3VRA A;  1GES A;  2C3D A;  4B68 A;  1GET A;  3I6E A;  1EBH A;  5ER0 A;  2WP5 A;  3T2Z A;  4A6N A;  4J3Z A;  2OAL A;  1CF3 A;  4U2S A;  2YLS A;  2PCE A;  3R0U A;  3T8Q A;  1KDG A;  2GVC A;  3JVA A;  2W3S A;  4H4V A;  3URH A;  4DHG A;  4XWR A;  3DFH A;  3U4F A;  5U63 A;  2P3Z A;  1EL5 A;  2BC1 A;  2FBW A;  1GRT A;  4HYR A;  1TYP A;  2E5V A;  3G5R A;  4H4Y A;  2VQB A;  3RCY A;  4I58 A;  3M12 A;  4J33 A;  4WCT A;  1OJC A;  3KPF A;  4Z17 A;  3GSI A;  4YTM A;  3FVD A;  3DA1 A;  3PWI A;  1S7M A;  1CL0 A;  3V5F A;  3EEZ A;  1L9E A;  4GCM A;  5J60 A;  3LXD A;  2P8B A;  1ONF A;  2GQW A;  4U8N A;  3AE7 A;  2OFJ A;  4TVW A;  1S2Q A;  3N6J A;  1L9D A;  2BAB A;  2YLZ A;  1TDF A;  2C3C A;  1EL9 A;  4X9M A;  4YSX A;  4TM0 A;  4FK1 C;  3ZLH A;  3RP8 A;  4K2S A;  3F8D A;  4EQW A;  2ZBW A;  3DJJ A;  4NTC A;  4G6G A;  3EAN A;  3KPK A;  4GME A;  2EQ8 A;  3UP4 A;  2YLR A;  1B8S A;  1CBO A;  2WOI A;  3SZW A;  3ICT A;  4G73 A;  4H7U A;  3AYL A;  1TDK A;  2CVJ A;  1YY5 A;  1N5W C;  1KSS A;  4WX1 A;  5BUL A;  4H2N A;  1EC8 A;  1OJ9 A;  3I6D A;  2QJN A;  1JRZ A;  2HXU A;  4X4J A;  2YG5 A;  3BHF A;  1DNC A;  1GRH A;  2GAH B;  2P0I A;  1K0J A;  1EL8 A;  3UJE A;  1P2E A;  2HXT A;  1DOB A;  4GYP C;  2PTZ A;  1VQW A;  2Z5X A;  1PBB A;  5KRQ A;  1L0V A;  1CJC A;  5BOF A;  4H2Q A;  1MRA A;  2FJE A;  3NT6 A;  2V3A A;  3CTY A;  4CNJ A;  1F9C A;  3NHO X;  5FS8 A;  3ALJ A;  2BCP A;  3UJF A;  1LTX R;  4H2H A;  2WET A;  3HRD C;  2V3B A;  4BK3 A;  2V60 A;  1L9C A;  4ROP A;  3SZC A;  1DJQ A;  4II2 A;  1IUU A;  3STP A;  4U8P A;  3GYI A;  3R07 C;  2XVF A;  3NO1 A;  2X99 A;  2AKZ A;  4DXK A;  1N61 C;  3GDP A;  5JCK A;  4H4P A;  3NYC A;  1DTN A;  3CXO A;  1NHS A;  3ABV A;  4HN8 A;  4A79 A;  1RVK A;  3ATR A;  3AMZ A;  2VRL A;  5FS7 A;  3JSK A;  4K5R A;  4YXD A;  4LU6 A;  1IYX A;  2PYX A;  1PXA A;  2TPR A;  5EB5 A;  1FEC A;  5IQ4 A;  3AE3 A;  3CNS A;  5U1O A;  4U8O A;  3DER A;  1OEP A;  1XHC A;  1ZP0 A;  4K8D A;  5CKU A;  3R9U A;  3PO7 A;  4REK A;  1FL2 A;  1ZDL A;  4KWS A;  3OC4 A;  4H2P A;  4A9W A;  3C4N A;  1H86 A;  2GB0 A;  3VR9 A;  4JN8 A;  2YR6 A;  4GAV A;  2VOU A;  5BVA A;  2DKI A;  2JB2 A;  3H8L A;  1D4C A;  3VC6 A;  2R9Z A;  3V5C A;  3NH3 X;  1GTE A;  1S3B A;  5HHF A;  3LB8 A;  3V3O A;  1JOA A;  2WEU A;  1V59 A;  3DJD A;  3HW2 A;  1P48 A;  3I4K A;  2B76 A;  1H7W A;  3LJP A;  1GRA A;  1KNP A;  2C65 A;  1TDO A;  1O94 A;  2MNR A;  2XVH A;  2XLR A;  3S47 A;  3ETR B;  1NG4 A;  3GDN A;  1GXF A;  3II4 A;  2OO6 A;  3PWG A;  1PBC A;  3CPI G;  4IP5 A;  3P3B A;  3AE8 A;  1K4Q A;  3NYE A;  3AEC A;  4NNJ A;  1NPX A;  5FMH A;  2WPE A;  2VRM A;  3RR1 A;  4ZN0 A;  3CGB A;  3H8A A;  3I3L A;  2R0C A;  2O56 A;  3NK1 X;  2GGI A;  3AD8 B;  3THU A;  1JU2 A;  1N5X A;  1K0L A;  3TW9 A;  4UP3 A;  3CPJ G;  3FJ4 A;  3EUB 3;  3G5S A;  3GO2 A;  1KSU A;  1MUC A;  1WYG A;  3P9U A;  3PG6 A;  3ITJ A;  4FI4 A;  3DIP A;  3RRA A;  1B4V A;  3TTE A;  3AD7 B;  3K30 A;  3RED A;  3H12 A;  3DG6 A;  3CXB A;  3SX6 A;  4G74 A;  1JRP A;  4J1O A;  5JCI A;  3S5W A;  2WDQ A;  3UJ2 A;  4A35 A;  3V3N A;  1JEH A;  3UKA A;  5JRB A;  4U8L A;  1EC9 A;  2BC0 A;  3DJE A;  5BOE A;  2POD A;  1CC4 A;  4JN9 A;  1H83 A;  2YVG A;  1GND A;  2YG6 A;  2AL2 B;  2BXR A;  2C73 A;  3FYY A;  2FKP A;  2QCU A;  3NVY B;  1NG3 A;  2C4C A;  4UDR A;  3SQS A;  5CQF A;  2PU0 A;  3ZVI A;  3UKK A;  1RYI A;  2OZT A;  1BWC A;  3ENL A;  1SJD A;  3CGE A;  3GWD A;  1GRG A;  4MGG A;  5BRT A;  1F6M A;  3IJQ A;  5C2T A;  2FJB A;  5KWF A;  4PAA A;  3SGL A;  1Q1R A;  3MUC A;  4MMW A;  3MQT A;  3QSM A;  4HCL A;  1H84 A;  3CK5 A;  5J7X A;  4USR A;  3GY1 A;  3NVV B;  3ZVH B;  2BA9 A;  2E3T A;  5FJP A;  4UDQ A;  4YTN A;  3T4W A;  1N4U A;  2ZZB A;  4J36 A;  2OZ8 A;  5LV9 A;  4LII A;  4E5T A;  3OW1 A;  2VVL A;  1D7L A;  3EKG A;  2AL1 A;  2GGE A;  3M0O A;  4NZH A;  3SN0 A;  3UP5 A;  2BS4 A;  4ECH A;  4H4U A;  3V3W A;  4C3X A;  3QVP A;  2WU2 A;  3O0H A;  3KKJ A;  4B63 A;  2BCG G;  1VDV A;  3DG7 A;  3EAO A;  3GMB A;  2DW6 A;  3IHM A;  1YEY A;  3RNM A;  3HPF A;  2XGZ A;  3K7Q X;  2XFU A;  3BI4 A;  2PPG A;  5J04 A;  3A7A A;  4JNQ A;  2V6O A;  4IVO B;  3UKL A;  5KVH A;  2RAB A;  1Y56 A;  2PGW A;  2WU5 A;  2ACZ A;  4Z43 A;  3H7V A;  5M0Z A;  1R0M A;  4O5U A;  2AAQ A;  3T0K A;  1X2G A;  4JN7 A;  1N63 C;  1W6T A;  2B9Y A;  3E1T A;  2C64 A;  2DW7 A;  2GH5 A;  1B37 A;  3CMM A;  1MDR A;  4GIS A;  1NHP A;  3JZU A;  3CGD A;  2VVM A;  2UZZ A;  1MO9 A;  3LAD A;  2NPX A;  1ONE A;  1ZOY A;  2Q0K A;  5GSN A;  1Y56 B;  1O95 A;  3NXL A;  3VC5 A;  2O9Z A;  3D9X A;  3HYW A;  4J34 A;  2YG3 A;  2X3N A;  2B7R A;  2YVJ A;  4KT2 A;  1LV0 A;  2OX4 A;  2E4G A;  2OAM A;  3CND A;  2OA1 A;  1BKW A;  3VA8 A;  4GDE A;  2OKT A;  3NVW B;  4U8J A;  2OZ3 A;  4TLZ A;  1ZXI C;  3A7R A;  4OPI A;  1BF3 A;  2V61 A;  3MWC A;  3T6C A;  3N4F A;  3ATQ A;  2GRT A;  4G6H A;  3NVZ B;  1PN0 A;  3PVC A;  1GRB A;  4H2R A;  2PTX A;  3KVE A;  3AD9 B;  1RSG A;  4ICY A;  1EBG A;  4EWJ A;  3T37 A;  4YKF A;  3DDM A;  1IUW A;  3MZN A;  3B3R A;  3AB1 A;  1GTH A;  1D4E A;  3FBS A;  5KMR A;  3DK9 A;  1N4V A;  4AOS A;  2TMD A;  1V97 A;  2PA6 A;  5ENL A;  4Z44 A;  4B1B A;  4I59 A;  3NRZ B;  2ARD A;  4EMW A;  1F8S A;  3NN0 X;  1LQU A;  1KNR A;  2XH7 A;  4J2W A;  5JCN A;  4Z2U A;  3BOX A;  1PJ5 A;  4CCQ A;  2YVF A;  1CJ4 A;  3SBF A;  4DGK A;  1SJB A;  1H2I A;  3IK4 A;  3TOY A;  3F8R A;  4IZG A;  4X9N A;  1GRE A;  2XVJ A;  3T31 A;  1S3E A;  4Y4L A;  2GGG A;  3SJN A;  5FJU A;  3NLC A;  2CHR A;  4M6U A;  2I5Q A;  3JW7 A;  2VVL G;  1R6W A;  2GV8 A;  3UTH A;  5FS6 A;  2AKM A;  1OJA A;  3GC2 A;  3SN1 A;  2B7S A;  3ICR A;  4D04 A;  1REO A;  3D1C A;  3SSZ A;  3DH9 A;  4YT0 A;  3R0K A;  5KMS A;  3DME A;  2PP0 A;  1GEU A;  4H19 A;  3HYV A;  3C96 A;  2GMJ A;  2VZ2 A;  1LPF A;  1AOG A;  4H4X A;  3IF9 A;  2BS2 A;  3VCN A;  5U25 A;  3CPH G;  3KA7 A;  3OZY A;  3NK2 X;  1TE6 A;  3QJ4 A;  1EC7 A;  3GYX A;  2HNE A;  2OG9 A;  5KOX A;  3TQP A;  1ZMC A;  1PJ7 A;  4H1Z A;  2OPJ A;  2WHD A;  3FCP A;  2BK3 A;  2WP6 A;  2DKH A;  2WP9 A;  2W55 A;  1GSN A;  3GMC A;  3GYJ A;  4U2L A;  4JDR A;  2RGH A;  4E4F A;  1JNR A;  3GD3 A;  2C75 A;  3QN3 A;  1MNS A;  2PU1 A;  3GD4 A;  3AEG A;  3FPZ A;  3NK0 X;  3UTG A;  1KN0 A;  2YWL A;  2W3R A;  3DK8 A;  2A87 A;  4P9S A;  1ZX9 A;  4AOX A;  1NEN A;  4EM4 A;  3DFY A;  3K7T A;  3VFC A;  3AE2 A;  2C76 A;  4EMI A;  6ENL A;  3GWF A;  4APN A;  2GR0 A;  2OLN A;  2GGH A;  2IID A;  3C4A A;  2QJM A;  3OTR A;  4KPL A;  4H4Z A;  2GEW A;  2NQL A;  1N4W A;  3FV9 A;  3B9J B;  4BK1 A;  3P4R A;  3F8P A;  4J31 A;  2PMQ A;  1TKK A;  4A6G A;  4RSL A;  1YKJ A;  2YM2 A;  4G9K A;  3UKF A;  4CCR A;  2V5Z A;  3CIR A;  1SJC A;  1QO8 A;  3SQP A;  1TZZ A;  3ES7 A;  4YWS A;  3CYJ A;  4Z2R A;  4AT2 A;  4E4U A;  2BXS A;  1P43 A;  1FOH A;  2C67 A;  1PDY A;  3N4E A;  3NGC X;  1W4X A;  1MOK A;  4E6M A;  2XYO A;  4HCD A;  3UCC A;  5FS9 A;  2PS2 A;  3BSM A;  3QFA A;  3LOV A;  1WUF A;  2BS3 A;  3D8X A;  3LZX A;  3UXL A;  1F8R A;  3AEA A;  4BV6 A;  1BGN A;  1YQ3 A;  3AE1 A;  1FIQ B;  3ZYX A;  3TWB A;  1BGJ A;  1Z6L A;  3ALM A;  3AM9 A;  1HYU A;  4AP3 A;  4HNL A;  3UOZ A;  1JPM A;  4EQX A;  4B66 A;  2PHH A;  1CHU A;  4IVM B;  1DOD A;  1JRO A;  2XH4 A;  3UJS A;  2PSN A;  1H82 A;  1JRY A;  3FMW A;  1VRQ B;  2RGO A;  4XWZ A;  2JB1 A;  4UDP A;  2FJA A;  3BJS A;  2PGE A;  5TR3 A;  3UTF A;  1JNZ A;  3NTD A;  4ZCW A;  1GRF A;  2YQU A;  2XFN A;  3FG2 P;  2EQ7 A;  3T2K A;  2W54 A;  4KPR A;  2RGJ A;  3DGB A;  2H88 A;  2WOV A;  1OJT A;  3HYX A;  3P93 A;  2GAG B;  2YR5 A;  2YLX A;  4J56 A;  4HA6 A;  5DBJ A;  2F5Z A;  2B9W A;  2XH0 A;  4K8G A;  1MDL A;  3MY9 A;  3GD6 A;  2PTY A;  3VRD B;  2X8H A;  3VR8 A;  4A7A A;  2XCG A;  3K1G A;  4OPC A;  3AN1 A;  2POZ A;  2OLA A;  2R45 A;  3P1W A;  3ADA B;  4DWD A;  2APG A;  3P0W A;  1M64 A;  3PS9 A;  5IQ1 A;  3AE5 A;  4GR1 A;  4YKG A;  1FEB A;  1UKV G;  1PDZ A;  2EQ9 A;  2OQH A;  3M13 A;  3NZG A;  2AL2 A;  1PXB A;  1XAN A;  3I6T A;  3P4S A;  3MSY A;  3UOY A;  3ZLF A;  2XSX A;  4K7Z A;  2Q0L A;  2YAU A;  1IUS A;  2GR2 A;  3OP2 A;  1GAL A;  2ZAD A;  3SXI A;  4ZOH B;  4TM3 A;  2ZC8 A;  2GR1 A;  3RO6 A;  2WQY A;  3UCD A;  3KD9 A;  4LA1 A;  4MJW A;  1F3P A;  4OPD A;  4USQ A;  5HYM A;  2QJJ A;  2NVK X;  1FEA A;  4RG3 A;  3AWI A;  4DX3 A;  2RDX A;  1PXC A;  4H4W A;  1K0I A;  3EPT A;  4M0X A;  2PTW A;  1IUV A;  1FCD A;  2Q7V A;  1ZY8 A;  1FO4 A;  4KEM A;  3Q9T A;  3QPE A;  2OVL A;  2P8C A;  1FHU A;  3ICS A;  3DK4 A;  3RP7 A;  4YWO A;  3UKQ A;  1P2H A;  2ZZC A;  3ES8 A;  2HZG A;  4OCG A;  5FJR A;  5JCM A;  1F8W A;  3KUM A;  3HZL A;  3B97 A;  5GRT A;  3H8I A;  2JB3 A;  2X8G A;  3SN4 A;  2XLS A;  3QSS A;  1GV4 A;  2PP1 A;  4A3R A;  2PP3 A;  4EQR A;  2WPC A;  2WPF A;  4DYE A;  4GUV A;  3NNE A;  3DJG X;  1LJ1 A;  3LZW A;  3VQR A;  1NAA A;  1ZKQ A;  4OPT A;  3CT2 A;  2QDD A;  2WDR A;  3UGV A;  3CGC A;  2I0Z A;  5KVI A;  2QGY A;  2YM1 A;  2BRA A;  2JBV A;  1CC6 A;  3IJL A;  4C3Y A;  3NTA A;  2BRY A;  2GDQ A;  3D46 A;  2H89 A;  4IL0 A;  2WOW A;  2YLW A;  2XLT A;  3PK7 A;  3SY4 A;  3AXB A;  2E1M A;  2P88 A;  3CB3 A;  3R10 A;  2X50 A;  3RHA A;  1E39 A;  2CDU A;  3NIX A;  1FHV A;  4IP4 A;  5EBK A;  3Q45 A;  2ZZ0 A;  4U8M A;  1XS2 A;  1TRB A;  1DOC A;  2BAC A;  1Y0P A;  3R1Z A;  5KOW A;  1NEK A;  4A99 A;  2XLP A;  3AE9 A;  4C77 A;  5G5G B;  1KKR A;  1BQG A;  3V76 A;  4XXG A;  3AEF A;  4Y4N A;  2YG7 A;  2Y6R A;  4BJZ A;  2R46 A;  3ISH A;  1E1K A;  2QA1 A;  2C7G A;  3UKP A;  4BK2 A;  2Z5Y A;  4FDC B;  2YR4 A;  3UOV A;  4CNK A;  3ALL A;  1QLB A;  4OPU A;  4JNA A;  4GIR A;  4B69 A;  3K7M X;  5HY5 A;  3AYI A;  4H4R A;  3BI5 A;  5L46 A;  2OQY A;  1FFU C;  1SB3 B;  4EQS A;  1PBD A;  2XH2 A;  4HCH A;  3S5S A;  3GRS A;  1X31 B;  4Z25 A;  4TM4 A;  3BI2 A;  3MKC A;  5EU9 A;  4E8G A;  4MKS A;  4DSH A;  5BUK A;  4NEV A;  2R0G A;  4TVY A;  3R11 A;  3P4P A;  3CN8 A;  3CAW A;  1T3Q C;  4JQ9 A;  4K22 A;  3A7U A;  2GSH A;  1ELI A;  2J3N A;  3VCC A;  3IWA A;  4IL2 A;  1IUT A;  1KF6 A;  1ELS A;  1S2Y A;  2YG4 A;  4CY6 A;  4OPG A;  2Q6U A;  2JKC A;  4IT1 A;  1OJD A;  4YTP A;  1X2H A;  2GL5 A;  3CNJ A;  1H81 A;  2IVD A;  1O5W A;  2XFP A;  4HPN A;  1LQT A;  4Z2T A;  1FFV C;  2C66 A;  3COX A;  3L1R A;  3AED A;  2CUL A;  3QVR A;  3DGZ A;  4B64 A;  2QAE A;  3IJI A;  1KKO A;  3T2Y A;  1KFY A;  4NEW A;  1RM6 B;  3UTE A;  3SZF A;  3UJR A;  1LVL A;  4RG4 A;  1WUE A;  1PHH A;  4HB9 A;  1STZ A;  1RP0 A;  3P4Q A;  1DXL A;  5EB4 A;  4EM3 A;  3RP6 A;  3PFR A;  3TJ4 A;  2C72 A;  3TJI A;  1GT8 A;  2JK6 A;  4H4T A;  3CNP A;  4NTE A;  3NN6 X;  1JDF A;  1NU5 A;  4KX6 A;  4IHC A;  3G5Q A;  4Z26 A;  5C3J A;  4C5O A;  2C70 A;  3R25 A;  3GRT A;  2QQ6 A;  4J57 A;  1JPD X;  5IPY A;  2EQ6 A;  5M10 A;  1N60 C;  3T9P A;  2CFY A;  4ADW A;  1NEL A;  1N1P A;  4FX9 A;  3SFE A;  3DES A;  1VG0 A;  3ZLG A;  4YSY A;  3QKE A;  2BYB A;  1GPE A;  3SR6 B;  1B5Q A;  2GGJ A;  3DEQ A;  2FJD A;  3H4K A;  4GYP A;  3L8K A;  4DSG A;  3DG3 A;  2XLU A;  4U2T A;  5G5H B;  4GGH A;  3VDG A;  4FP1 A;  3SM8 A;  3RIT A;  4OVI A;  3T14 A;  4EIP A;  5KMQ A;  2R0P A;  4EMJ A;  3NG7 X;  1VG9 A;  3U9I A;  2XDO A;  3AEB A;  4DNA A;  4ZCD A;  3S61 A;  2IVE A;  2Y6Q A;  3BHK A;  4TLX A;  5FJO A;  3NKS A;  2WS3 A;  4AP1 A;  4CRT A;  4Y4M A;  1N62 C;  3H70 A;  1DOE A;  2XFO A;  1XDI A;  4PAB A;  1E7P A;  1MXT A;  4GGB A;  2R4J A;  1GOS A;  3SYI A;  4K2X A;  1TYT A;  5KXJ A;  1XPQ A;  2B9X A;  1NHR A;  3TCS A;  2OLO A;  4B65 A;  2XFQ A;  1XPY A;  3QTP A;  2A8X A;  1KCZ A;  1ZK7 A;  1JRX A;  3AYJ A;  3WE0 A;  4K1W A;  1TDN A;  2AR8 A;  4BUR A;  3NS1 B;  4B67 A;  4JHM A;  3UKH A;  1IJH A;  1H6V A;  4A6N B;  1YQZ A;  3OZM A;  3NRN A;  1M6I A;  3V4B A;  3KLJ A;  4GRT A;  2GQF A;  4X2P A;  4BJY A;  2JAE A;  1YQ4 A;  4D03 A;  2A89 A;  2FYM A;  4M52 A;  4IA5 A;  3DGH A;  2VQ7 A;  3ZDN A;  1ZMD A;  2BK4 A;  1PS9 A;  2QA2 A;  5KMP A;  3B6D A;  7ENL A;  4E0V A;  3ZVH A;  4NWZ A;  3UXK A;  1E1L A;  4H4Q A;  2X8C A;  5JCL A;  3CNT A;  1NDA A;  1EL7 A;  1PBE A;  4Z24 A;  1PDH A;  2GMH A;  4EIQ A;  2GF3 A;  4FK1 A;  3UOX A;  1SEZ A;  2WDV A;  2XVE A;  1D4D A;  1PJ6 A;  1Q1W A;  2E5A A;  1E9I A;  3Q4D A;  1ECQ A;  4K5S A;  4JY3 A;  4YSH A;  1DJN A;  3QLD A;  3QFB A;  3NFU A;  2AQJ A;  3UCL A;  2YLT A;  1CJ2 A;  3OZ2 A;  2QVH A;  3Q6J A;  4II3 A;  1SJA A;  4U8K A;  1BZL A;  4H4S A;  5HXI A;  1COY A;  1L8P A;  2R4E A;  3N6H A;  1H7X A;  4C74 A;  4OPL A;  5EOW A;  1TDE A;  1CJ3 A;  4O5Q A;  1EBD A; 
#chains in the Genus database with same CATH homology
 4XXG A;  3QJ4 A;  3AEF A;  3GYX A;  2WPE A;  4Y4N A;  2VRM A;  2YG7 A;  1CC2 A;  3SFD A;  5KOX A;  4ZN0 A;  3L5O A;  3CGB A;  2Y6R A;  1ZMC A;  2GR3 A;  1PJ7 A;  2R0C A;  3I3L A;  3NK1 X;  3VRB A;  4TM1 A;  2WHD A;  4A65 A;  3AD8 B;  2R46 A;  2BK3 A;  4BJZ A;  2WP6 A;  2DKH A;  3KU9 A;  2WP9 A;  5KNL A;  1JU2 A;  3BNM A;  3AEE A;  1IUX A;  3AE6 A;  4AT0 A;  4CY8 A;  3ISH A;  1K0L A;  1E1K A;  2QA1 A;  4ZCC A;  1GSN A;  3CPJ G;  2C7G A;  3GMC A;  3GYJ A;  4UP3 A;  4N9X A;  1E1M A;  4U2L A;  4JDR A;  3G5S A;  1KSU A;  2RGH A;  1QJD A;  3UKP A;  2WBA A;  1PBF A;  4GAP A;  1JNR A;  4BK2 A;  2Z5Y A;  2XVI A;  3P9U A;  3PG6 A;  3GD3 A;  4FDC B;  2C75 A;  4IA6 A;  2YR4 A;  3ITJ A;  4CBQ A;  3AEG A;  3GD4 A;  3FPZ A;  3NK0 X;  3UTG A;  1KN0 A;  2YWL A;  3AE4 A;  3UOV A;  1B4V A;  3DK8 A;  4CNK A;  2A87 A;  1QLB A;  3ALL A;  4GDP A;  4P9S A;  3AD7 B;  1ZX9 A;  4OPU A;  4JNA A;  2W0H A;  4AOX A;  3K30 A;  4B69 A;  1NEN A;  4EM4 A;  1D5T A;  3K7M X;  3RED A;  4IV9 A;  5HY5 A;  3AYI A;  1VDC A;  4H4R A;  3K7T A;  3IHG A;  3BI5 A;  3AE2 A;  5L46 A;  3SX6 A;  1GER A;  4G74 A;  2WES A;  2C76 A;  4EMI A;  2BK5 A;  4EQS A;  1PBD A;  3GWF A;  3IC9 A;  1ZOV A;  4APN A;  2GR0 A;  2OLN A;  3BNU A;  3EF6 A;  5JCI A;  2IID A;  2WDQ A;  4GF7 A;  3S5W A;  3C4A A;  3GRS A;  1X31 B;  4YSZ A;  4Z25 A;  4TM4 A;  3V3N A;  4H4Z A;  2GEW A;  1JEH A;  3BI2 A;  1N4W A;  3UKA A;  5JRB A;  4BK1 A;  4U8L A;  3P4R A;  1Q9I A;  3F8P A;  4U8I A;  2BC0 A;  4J31 A;  3DJE A;  4DSH A;  1E1N A;  4RSL A;  1YKJ A;  5BUK A;  4NEV A;  2R0G A;  2YM2 A;  4G9K A;  3UKF A;  1CC4 A;  3P4P A;  4CCR A;  2V5Z A;  4JN9 A;  1E6E A;  4A5L A;  1H83 A;  3CIR A;  3CN8 A;  3NYF A;  2HQM A;  1QO8 A;  2YVG A;  3SQP A;  1GND A;  2YG6 A;  3FIM B;  4NTD A;  2BXR A;  1NHQ A;  3QSE A;  1D7Y A;  4JY2 A;  4JQ9 A;  2C73 A;  4K22 A;  4Z2R A;  4AT2 A;  3SZ0 A;  1ELI A;  2J3N A;  4H50 A;  3VRA A;  2BXS A;  1GES A;  2C3D A;  2QCU A;  3IWA A;  4B68 A;  1IUT A;  1FOH A;  1NG3 A;  2C4C A;  1KF6 A;  2C67 A;  4UDR A;  5CQF A;  3NGC X;  1GET A;  3UKK A;  1RYI A;  1W4X A;  1MOK A;  5ER0 A;  1S2Y A;  2WP5 A;  3T2Z A;  1BWC A;  3GWD A;  3CGE A;  2YG4 A;  4A6N A;  2XYO A;  4CY6 A;  1GRG A;  4OPG A;  5FS9 A;  2OAL A;  2Q6U A;  1CF3 A;  2JKC A;  3QFA A;  1OJD A;  3LOV A;  4YTP A;  4U2S A;  3CNJ A;  2YLS A;  5BRT A;  2BS3 A;  1H81 A;  2IVD A;  1F6M A;  1O5W A;  3D8X A;  2XFP A;  1KDG A;  2FJB A;  3LZX A;  5C2T A;  5KWF A;  1LQT A;  2GVC A;  4PAA A;  4Z2T A;  2C66 A;  4H4V A;  3URH A;  3SGL A;  1Q1R A;  3COX A;  3L1R A;  1F8R A;  4XWR A;  3AED A;  3AEA A;  2CUL A;  4BV6 A;  1BGN A;  1YQ3 A;  5U63 A;  3QVR A;  3DGZ A;  3AE1 A;  3ZYX A;  1EL5 A;  3QSM A;  4B64 A;  1BGJ A;  1Z6L A;  3ALM A;  1H84 A;  2BC1 A;  2QAE A;  5J7X A;  1HYU A;  2FBW A;  4USR A;  1GRT A;  4AP3 A;  3UOZ A;  4EQX A;  4B66 A;  2BA9 A;  3T2Y A;  1KFY A;  2PHH A;  1CHU A;  1TYP A;  4IVM B;  1DOD A;  2E5V A;  4NEW A;  4H4Y A;  3G5R A;  4UDQ A;  2VQB A;  3UTE A;  4YTN A;  3SZF A;  1LVL A;  4RG4 A;  1H82 A;  4I58 A;  1PHH A;  1JRY A;  1N4U A;  3M12 A;  4HB9 A;  2ZZB A;  1RP0 A;  4J36 A;  4J33 A;  4WCT A;  1OJC A;  3KPF A;  3FMW A;  3P4Q A;  3GSI A;  5LV9 A;  1VRQ B;  2RGO A;  3DA1 A;  1DXL A;  4XWZ A;  4LII A;  4YTM A;  5EB4 A;  4EM3 A;  2JB1 A;  1S7M A;  4UDP A;  1CL0 A;  2FJA A;  3RP6 A;  2VVL A;  1D7L A;  2C72 A;  3M0O A;  4NZH A;  5TR3 A;  4GCM A;  1GT8 A;  1L9E A;  3UP5 A;  3UTF A;  1JNZ A;  2BS4 A;  5J60 A;  3LXD A;  3NTD A;  2JK6 A;  4H4T A;  3CNP A;  4ECH A;  4NTE A;  4H4U A;  1GRF A;  1ONF A;  3NN6 X;  2GQW A;  4C3X A;  3QVP A;  2WU2 A;  2YQU A;  2XFN A;  3FG2 P;  3O0H A;  4U8N A;  3AE7 A;  2EQ7 A;  4KX6 A;  3T2K A;  1S2Q A;  3KKJ A;  3G5Q A;  1L9D A;  2BAB A;  4KPR A;  4B63 A;  2RGJ A;  4Z26 A;  2BCG G;  2YLZ A;  2H88 A;  2WOV A;  5C3J A;  4C5O A;  1TDF A;  2C70 A;  2C3C A;  1EL9 A;  3GRT A;  4X9M A;  3EAO A;  4YSX A;  4TM0 A;  4FK1 C;  3GMB A;  1OJT A;  3HYX A;  3RP8 A;  2GAG B;  4J57 A;  2YLX A;  4J56 A;  2EQ6 A;  2YR5 A;  4HA6 A;  5IPY A;  5M10 A;  3F8D A;  4EQW A;  2ZBW A;  5DBJ A;  3IHM A;  2F5Z A;  3DJJ A;  2B9W A;  4NTC A;  4G6G A;  3VRD B;  2CFY A;  2X8H A;  4ADW A;  3EAN A;  3KPK A;  3RNM A;  3VR8 A;  2EQ8 A;  1N1P A;  3UP4 A;  2YLR A;  3K7Q X;  2XFU A;  3BI4 A;  4A7A A;  2XCG A;  4FX9 A;  1B8S A;  1CBO A;  4JNQ A;  2WOI A;  4OPC A;  3ICT A;  3SFE A;  3SZW A;  4G73 A;  4H7U A;  2V6O A;  3AYL A;  4IVO B;  2R45 A;  3UKL A;  1TDK A;  2CVJ A;  3P1W A;  5KVH A;  1VG0 A;  2RAB A;  1Y56 A;  3ADA B;  2APG A;  4YSY A;  1M64 A;  3PS9 A;  5IQ1 A;  3AE5 A;  4GR1 A;  4YKG A;  2BYB A;  2WU5 A;  1GPE A;  1YY5 A;  1FEB A;  1B5Q A;  1UKV G;  2FJD A;  2ACZ A;  1KSS A;  4WX1 A;  4Z43 A;  3H4K A;  2EQ9 A;  3L8K A;  3M13 A;  5BUL A;  4H2N A;  5M0Z A;  1PXB A;  1XAN A;  4O5U A;  1OJ9 A;  3P4S A;  2AAQ A;  3I6D A;  4DSG A;  3T0K A;  1JRZ A;  2XLU A;  3UOY A;  4X4J A;  2B9Y A;  2YG5 A;  4K7Z A;  3BHF A;  1DNC A;  1GRH A;  2C64 A;  2GH5 A;  2GAH B;  3E1T A;  2Q0L A;  2YAU A;  4U2T A;  1IUS A;  2GR2 A;  1B37 A;  3CMM A;  1K0J A;  1GAL A;  1NHP A;  1EL8 A;  3CGD A;  3SM8 A;  1P2E A;  2VVM A;  3SXI A;  2UZZ A;  4TM3 A;  1DOB A;  4OVI A;  3T14 A;  4EIP A;  1MO9 A;  5KMQ A;  2GR1 A;  3LAD A;  2NPX A;  2WQY A;  1VQW A;  2Z5X A;  1ZOY A;  1PBB A;  2Q0K A;  5KRQ A;  5GSN A;  2R0P A;  1L0V A;  1CJC A;  4EMJ A;  3NG7 X;  1VG9 A;  3AEB A;  2XDO A;  4H2Q A;  3KD9 A;  1Y56 B;  2FJE A;  4DNA A;  3NT6 A;  4ZCD A;  2V3A A;  3CTY A;  1O95 A;  3S61 A;  4LA1 A;  2IVE A;  3D9X A;  2O9Z A;  4MJW A;  4CNJ A;  2Y6Q A;  1F3P A;  3NHO X;  4OPD A;  3HYW A;  5FS8 A;  3ALJ A;  3BHK A;  4USQ A;  4TLX A;  2BCP A;  5HYM A;  2NVK X;  4J34 A;  3NKS A;  1FEA A;  2YG3 A;  2X3N A;  4RG3 A;  1LTX R;  2WS3 A;  4AP1 A;  2B7R A;  2YVJ A;  2WET A;  3AWI A;  1LV0 A;  2V3B A;  4CRT A;  4BK3 A;  4Y4M A;  2E4G A;  1DOE A;  1PXC A;  2XFO A;  1XDI A;  4H4W A;  2V60 A;  4PAB A;  2OAM A;  3CND A;  1K0I A;  3EPT A;  2OA1 A;  1L9C A;  1BKW A;  1E7P A;  4GDE A;  4U8J A;  1IUV A;  1MXT A;  2R4J A;  3SZC A;  1GOS A;  1FCD A;  2Q7V A;  1ZY8 A;  3SYI A;  4K2X A;  1DJQ A;  4TLZ A;  1TYT A;  3Q9T A;  5KXJ A;  1XPQ A;  2B9X A;  4II2 A;  1NHR A;  3ICS A;  1IUU A;  2OLO A;  4OPI A;  4B65 A;  3DK4 A;  2XFQ A;  1BF3 A;  4U8P A;  2V61 A;  3RP7 A;  3GYI A;  4YWO A;  3UKQ A;  2A8X A;  1P2H A;  2ZZC A;  1ZK7 A;  3ATQ A;  2GRT A;  2XVF A;  1JRX A;  3AYJ A;  3WE0 A;  4G6H A;  4OCG A;  2X99 A;  1TDN A;  1PN0 A;  3PVC A;  1GRB A;  5JCM A;  2AR8 A;  4BUR A;  4H2R A;  1F8W A;  4B67 A;  3GDP A;  3KVE A;  5JCK A;  4H4P A;  3AD9 B;  3NYC A;  3UKH A;  1IJH A;  3HZL A;  1H6V A;  4A6N B;  5GRT A;  1NHS A;  1YQZ A;  1RSG A;  3H8I A;  4ICY A;  2JB3 A;  3ABV A;  3NRN A;  4A79 A;  2X8G A;  2XLS A;  3QSS A;  1M6I A;  4YKF A;  1GV4 A;  3T37 A;  3ATR A;  3KLJ A;  4GRT A;  2VRL A;  5FS7 A;  3JSK A;  4K5R A;  4YXD A;  4LU6 A;  2GQF A;  1IUW A;  4BJY A;  3B3R A;  2PYX A;  1PXA A;  4EQR A;  2JAE A;  2WPC A;  2WPF A;  1YQ4 A;  4GUV A;  2TPR A;  1GTH A;  2A89 A;  3AB1 A;  1D4E A;  4D03 A;  4M52 A;  5EB5 A;  3NNE A;  4C3Y A;  3DJG X;  1LJ1 A;  3FBS A;  3DK9 A;  5KMR A;  1N4V A;  1FEC A;  4IA5 A;  5IQ4 A;  3DGH A;  2VQ7 A;  3LZW A;  3ZDN A;  4AOS A;  2TMD A;  3AE3 A;  1ZMD A;  3VQR A;  3CNS A;  2BK4 A;  4Z44 A;  4B1B A;  5U1O A;  1PS9 A;  1NAA A;  4U8O A;  2QA2 A;  4I59 A;  5KMP A;  2ARD A;  1ZKQ A;  4EMW A;  1F8S A;  1XHC A;  3B6D A;  4OPT A;  1ZP0 A;  4K8D A;  4E0V A;  3NN0 X;  1LQU A;  4NWZ A;  1KNR A;  2WDR A;  1E1L A;  4H4Q A;  4J2W A;  5JCN A;  5CKU A;  4Z2U A;  3R9U A;  3PO7 A;  3CGC A;  2I0Z A;  1PJ5 A;  4REK A;  2X8C A;  5KVI A;  4CCQ A;  5JCL A;  1FL2 A;  2YVF A;  1CJ4 A;  1ZDL A;  2YM1 A;  3OC4 A;  2BRA A;  2JBV A;  4H2P A;  4A9W A;  3C4N A;  1CC6 A;  4DGK A;  1H2I A;  3CNT A;  1H86 A;  2GB0 A;  1NDA A;  3VR9 A;  2YR6 A;  4GAV A;  1EL7 A;  2VOU A;  1PBE A;  2BRY A;  3F8R A;  3NTA A;  2H89 A;  1PDH A;  2GMH A;  4X9N A;  1GRE A;  4Z24 A;  4EIQ A;  2GF3 A;  2XVJ A;  2WOW A;  5BVA A;  4FK1 A;  2DKI A;  2JB2 A;  3T31 A;  1S3E A;  4Y4L A;  3UOX A;  1SEZ A;  2YLW A;  3H8L A;  2XLT A;  1D4C A;  2WDV A;  2XVE A;  3SY4 A;  2R9Z A;  3AXB A;  2E1M A;  3NH3 X;  3NLC A;  1GTE A;  1S3B A;  5HHF A;  1D4D A;  1PJ6 A;  3LB8 A;  3V3O A;  2VVL G;  1Q1W A;  2GV8 A;  1JOA A;  2WEU A;  1V59 A;  3UTH A;  5FS6 A;  2B76 A;  2X50 A;  3DJD A;  4K5S A;  1H7W A;  1OJA A;  4JY3 A;  3LJP A;  3RHA A;  1E39 A;  1GRA A;  2B7S A;  1KNP A;  2CDU A;  2C65 A;  3NIX A;  4YSH A;  1TDO A;  3ICR A;  5EBK A;  4D04 A;  1DJN A;  1O94 A;  1REO A;  2XVH A;  2XLR A;  3QFB A;  3D1C A;  3DH9 A;  4YT0 A;  5KMS A;  2AQJ A;  2ZZ0 A;  3DME A;  1NG4 A;  4U8M A;  3GDN A;  3UCL A;  2YLT A;  1GEU A;  1CJ2 A;  1GXF A;  3II4 A;  3OZ2 A;  1TRB A;  3Q6J A;  1DOC A;  3HYV A;  4II3 A;  3CPI G;  1PBC A;  2BAC A;  2GMJ A;  3C96 A;  4U8K A;  1Y0P A;  1LPF A;  2VZ2 A;  1AOG A;  1BZL A;  5KOW A;  4H4S A;  4H4X A;  3IF9 A;  1NEK A;  4A99 A;  5HXI A;  2BS2 A;  1COY A;  3AE8 A;  2XLP A;  3AE9 A;  2R4E A;  1K4Q A;  3NYE A;  4C77 A;  3AEC A;  4NNJ A;  5U25 A;  3CPH G;  1NPX A;  1H7X A;  3KA7 A;  5FMH A;  4C74 A;  4OPL A;  5EOW A;  3V76 A;  1TDE A;  1CJ3 A;  3NK2 X;  4O5Q A;  1EBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...