5FS6A

Crystal structure of the v243l mutant of human apoptosis inducing factor
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
491
structure length
454
Chain Sequence
KAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMLKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHEDLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Structure/Function Relations in Aifm1 Variants Associated with Neurodegenerative Disorders
pubmed doi rcsb
source organism Homo sapiens
total genus 146
structure length 454
sequence length 491
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fs6A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs6A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs6A01
1O94A 1VDCA 1ZOYA 3ZYXA 2QCUA 3D8XA 1XDIA 3C4AA 4U8IA 1DOBA 1LTXR 5BVAA 3REDA 3C96A 4OVIA 3IC9A 4N9XA 2OA1A 2B9YA 1F8RA 3F8DA 3AEGA 2PYXA 4Y4LA 4AOXA 4OPCA 4U8LA 1CC2A 2ACZA 4C77A 2R9ZA 2B9XA 3V3NA 3CPIG 2VQ7A 1PXCA 4H4QA 4NEWA 2ARDA 3K7MX 3RP7A 3UTEA 4NTDA 1NHPA 3VR9A 3ISHA 3NNEA 4E0VA 1F8WA 4B66A 1FECA 2VVLG 3V3OA 3EAOA 1N4VA 3CNPA 3AD8B 1L0VA 2JB3A 2GR0A 3F8RA 3P4PA 1GESA 1OJTA 2X8GA 1E7PA 1JU2A 2C66A 3AE8A 4XXGA 4CRTA 4Z26A 4TM3A 4EMJA 1H84A 3NN0X 1NDAA 1GSNA 1S2YA 2WOVA 1AOGA 2BS4A 3FMWA 4OPTA 3VRDB 3ADAB 1KFYA 3DK4A 1BKWA 4BURA 3M0OA 2YM2A 4K7ZA 4YT0A 4BK3A 3SQPA 3D1CA 3NT6A 4RSLA 2C70A 2XLUA 4H4PA 2XFPA 1DNCA 1DJNA 4U8JA 3LB8A 4ZCCA 3AYLA 2FJEA 5U63A 1GRBA 3F8PA 1FEBA 2YWLA 1NPXA 4YSYA 3QSMA 4EQRA 3GRSA 4DSGA 1GREA 1H7WA 1O95A 1F3PA 2QA1A 2R4EA 1DODA 3LZWA 4H2RA 2XFQA 3AD9B 1LVLA 1QLBA 2JB1A 2R4JA 1NHSA 4BV6A 2YR4A 3SFDA 1M6IA 3DK9A 4LA1A 4JQ9A 1CJCA 2WU2A 2GF3A 1GRFA 3NTDA 1RP0A 4ICYA 3CPHG 2NVKX 1OJCA 1BGJA 1PHHA 1EL9A 5EB5A 4A65A 3LXDA 3NK0X 2YVJA 3BNMA 3HZLA 4NTCA 1VRQB 4OPDA 3E1TA 2C72A 4UDQA 3P1WA 4K5SA 4DSHA 3AE9A 4Z44A 4H50A 3II4A 5BRTA 3KVEA 2WEUA 3UP4A 3AECA 1EL8A 1NEKA 4CY8A 4CY6A 4Z24A 4CNKA 2XLRA 2VVMA 4RG4A 3GRTA 5J7XA 4EIQA 3NIXA 5IQ1A 2HQMA 3JSKA 2R45A 4ECHA 3FBSA 1KNRA 1CL0A 3UP5A 2VRLA 1Q9IA 5C3JA 4AOSA 3ALLA 4J34A 4U8OA 4M52A 1CC4A 2EQ6A 2X3NA 5DBJA 1KSSA 2XFUA 4YSXA 2GAHB 2FBWA 4GDEA 1JOAA 4WX1A 3S61A 1NG3A 2GR2A 5EBKA 1PS9A 4X9NA 1IUTA 1FOHA 2Z5YA 4B65A 2FJBA 4A7AA 4TM4A 1D4EA 2AAQA 1PN0A 3AWIA 5FS6A 3KU9A 4H4ZA 1CBOA 2X8CA 1PBBA 1EL5A 2YLWA 4H4RA 4UP3A 1D7YA 2A87A 1TDNA 4KPRA 1QJDA 1Y56B 5L46A 1HYUA 4USRA 2BXRA 4JNAA 1ZMCA 4EIPA 4EQWA 1OJDA 3AEEA 2IIDA 2AQJA 2XFNA 1N4WA 2YR5A 4FDCB 3ITJA 2XDOA 4TLXA 2JKCA 3B3RA 4U2LA 5KOXA 3PVCA 1NHQA 2Y6RA 5FS7A 4P9SA 1REOA 2I0ZA 3AE7A 5KRQA 1L9CA 1ZDLA 4NTEA 4EQSA 1JEHA 1Z6LA 2YG5A 3OZ2A 4K22A 3PO7A 1RSGA 3H4KA 1TRBA 3AXBA 4YXDA 4H4WA 2WDRA 1P2EA 1K0IA 1EBDA 1TYPA 3T37A 2B7RA 4H2PA 1PBEA 2GR1A 1QO8A 3UKHA 1E1NA 2WP5A 2CVJA 1D5TA 1ZX9A 3Q9TA 2WOWA 2EQ7A 3K7QX 2QAEA 3CPJG 2X50A 2BXSA 3BI5A 3EPTA 3FG2P 4B64A 4KX6A 3RP8A 4IVMB 4HA6A 4IVOB 4ZN0A 3QSSA 3AE4A 1L9EA 2VZ2A 1PXBA 2R0CA 3NKSA 5HHFA 2C65A 1GNDA 4IA6A 3UOXA 2YLZA 4FK1C 3GD3A 4GUVA 5JCIA 4REKA 4Z2RA 3CGCA 4ADWA 4A6NA 1N1PA 4A99A 3GDNA 1F8SA 1RYIA 2PHHA 5IPYA 2IVEA 3S5WA 3NH3X 4EM3A 3QVRA 3NLCA 4JY3A 1D4DA 5GSNA 3RHAA 4K5RA 2YG3A 2WHDA 1IUXA 4O5UA 4ZCDA 1BZLA 4JDRA 3KD9A 2DKHA 3DH9A 3AYIA 3H8LA 1ZMDA 4Z25A 2R0PA 1PJ5A 4FK1A 5ER0A 2GB0A 4H2NA 3VQRA 3ABVA 4BJZA 3NG7X 5KOWA 1E39A 2NPXA 4HB9A 2GRTA 1D7LA 2AR8A 5TR3A 4Z2TA 1CF3A 5GRTA 1YQ4A 3M12A 3AE5A 5EB4A 3QFAA 3VRBA 2OLOA 3G5SA 1JNZA 4I59A 1YKJA 1H86A 1LV0A 2GQFA 5LV9A 2BACA 1PDHA 4RG3A 2Q7VA 3DK8A 4JN9A 1ZK7A 2RABA 3DGZA 3AE1A 1GV4A 1H6VA 1Y56A 3DMEA 2BA9A 2H88A 2TMDA 1X31B 5FS8A 1GALA 1K4QA 1YQZA 3ICTA 3AEAA 2BYBA 3UOVA 3I3LA 4A6NB 4XWRA 2YQUA 1PJ6A 2ZZBA 2YLXA 3KPFA 4H2QA 3NRNA 4OCGA 2C3CA 1ZOVA 2DKIA 3ATRA 4J36A 5M0ZA 1GXFA 4Z2UA 2H89A 1K0LA 1B5QA 1KNPA 4OPIA 2VVLA 1MO9A 1B8SA 4TLZA 3UKQA 2ZZCA 1P2HA 2Q0LA 4PABA 5CQFA 3GYIA 4TM1A 3L8KA 3CNSA 1B4VA 2WESA 4YKGA 5CKUA 3AD7B 2F5ZA 2A89A 2GH5A 3UKKA 3NTAA 2YVFA 5JCNA 3BHKA 1GRAA 2BC1A 3DJDA 5U25A 1JRXA 4B67A 1FCDA 3Q6JA 4OPGA 1S3EA 5JCKA 3DA1A 4B1BA 1GOSA 3VRAA 1NHRA 2WETA 3BNUA 1MXTA 3OC4A 2WDVA 4LU6A 1JRYA 2XVJA 3EF6A 1DXLA 1DOCA 4BK1A 4UDPA 3UKLA 1E6EA 3NYCA 2V3AA 2C7GA 2YR6A 1ZKQA 4K2XA 2WPEA 3WE0A 2YAUA 1KDGA 1CHUA 1LJ1A 1TDEA 2R0GA 3LADA 4FX9A 2X8HA 3NYFA 3CIRA 3GWDA 2E5VA 3I6DA 1S3BA 4JY2A 2C76A 4IV9A 2GR3A 2WP6A 4LIIA 2WU5A 5KXJA 3CNTA 4H7UA 1N4UA 3AYJA 1NG4A 4X9MA 1CJ4A 2Z5XA 3C4NA 2BK3A 5EOWA 2JAEA 2FJDA 1MOKA 3LOVA 2OAMA 3SGLA 2XYOA 4YSZA 1VQWA 3GMCA 2VOUA 3NGCX 4YKFA 2E4GA 4AT0A 2VQBA 5IQ4A 3GMBA 2BS3A 4AP3A 1CJ3A 4H4YA 1IUSA 3ALMA 3IF9A 1W4XA 3IHMA 2BK4A 4U8PA 1LPFA 4AT2A 2OALA 3UOZA 2CDUA 2XVFA 1H81A 1PBCA 2B76A 2WDQA 4EMWA 1IUWA 1VG9A 3BI4A 2YLRA 3LJPA 4GF7A 3EANA 4C3XA 4X4JA 4EMIA 3K7TA 3CN8A 4PAAA 3P9UA 4MJWA 1H82A 1UKVG 4BJYA 4BK2A 4A9WA 4CBQA 3NHOX 3KKJA 4GRTA 3AE6A 4XWZA 4OPUA 3CGBA 5C2TA 3DJGX 2XLTA 1PBFA 2XLSA 3IHGA 2JBVA 3FPZA 3GD4A 1B37A 2WPCA 1ELIA 4C3YA 3IWAA 2V5ZA 3LZXA 4AP1A 2BABA 3AEFA 3CTYA 2B9WA 3FIMB 2C75A 2W0HA 4GCMA 3UCLA 2XVIA 5HYMA 5JCLA 2WP9A 1Y0PA 2GAGB 3K30A 4OPLA 4U8NA 2A8XA 4EM4A 4GR1A 2TPRA 1GTEA 5KVHA 1EL7A 3DJEA 2CULA 1SEZA 3KA7A 3L1RA 1XANA 4NZHA 5M10A 2E1MA 2YG7A 2EQ8A 1ZP0A 1FL2A 1OJ9A 4A79A 2WS3A 4I58A 4U2SA 3ZDNA 3RNMA 1OJAA 2WBAA 3AEBA 3V76A 1GPEA 2JK6A 2XFOA 3GYJA 1BWCA 4D03A 1LQUA 1IUUA 3BI2A 3KLJA 2R46A 4DGKA 2X99A 1V59A 1L9DA 2GVCA 3NK2X 3ALJA 1PBDA 4J2WA 2YLSA 3AEDA 2Y6QA 1GETA 2BCPA 2GV8A 1DOEA 1E1KA 2JB2A 4YSHA 3QFBA 3CGEA 1CJ2A 1NENA 3AE2A 3SFEA 4B69A 1GEUA 3URHA 3O0HA 1GT8A 2ZBWA 4EQXA 4U8MA 4JNQA 1XHCA 1H7XA 1DJQA 1S2QA 4TM0A 3VR8A 1GRHA 4H4VA 1CC6A 2WPFA 4H4XA 3QSEA 5KWFA 1BGNA 3G5QA 4APNA 1NAAA 1YY5A 3GSIA 2FJAA 3AE3A 3M13A 2GMHA 3AB1A 1IUVA 5FS9A 3PS9A 3UKAA 3RP6A 5BUKA 3ATQA 1PJ7A 4C74A 1TDFA 4K8DA 1F6MA 1VG0A 1KF6A 1ONFA 1KSUA 2GEWA 3NYEA 3P4RA 1TDKA 2CFYA 2Q0KA 4H4SA 2GMJA 2BS2A 4CCRA 5BULA 2C73A 1JRZA 4J57A 2BC0A 1YQ3A 3P4SA 1COYA 1Q1WA 1TYTA 1IJHA 3GWFA 3UOYA 2C3DA 2YG4A 4UDRA 1PXAA 2YVGA 2IVDA 3B6DA 3G5RA 3QVPA 4J31A 3NK1X 2GQWA 2B7SA 3UTFA 1Q1RA 2C67A 4IA5A 1GERA 4NEVA 2XVEA 2UZZA 3R9UA 2XCGA 2ZZ0A 1K0JA 2YLTA 4J33A 1FEAA 4YWOA 3UTGA 3CGDA 2EQ9A 2XLPA 2VRMA 2RGJA 3COXA 2QA2A 4B63A 3UKPA 1GRGA 2BCGG 1BF3A 4Y4MA 1TDOA 1H83A 2YG6A 2WQYA 5JCMA 2APGA 2O9ZA 3GDPA 3QJ4A 1D4CA 3CNJA 3UTHA 2OLNA 2V61A 4CNJA 3UKFA 2XVHA 4O5QA 4J56A 3ICRA 3H8IA 1M64A 1ZY8A 2C64A 3ICSA 4U8KA 4YTMA 2V3BA 4Z43A 3BHFA 4CCQA 2YM1A 1E1LA 3SM8A 1JNRA 5HY5A 5KVIA 2BK5A 5U1OA 3DJJA 1LQTA 4U2TA 4YTPA 2WOIA 1XPQA 4H4UA 4C5OA 4H4TA 5FMHA 4A5LA 2RGOA 4DNAA 4B68A 2RGHA 3CNDA 2Q6UA 3P4QA 1GRTA 2J3NA 1O5WA 3DGHA 3NN6X 1E1MA 4YTNA 4WCTA 4D04A 2V6OA 4GDPA 5J60A 1GTHA 5HXIA 4Y4NA 2V60A 4USQA
chains in the Genus database with same CATH superfamily
1O94A 2AL2B 3CK5A 1MUCA 3ZYXA 2OPJA 4IZGA 5BVAA 3REDA 3IC9A 1ZXIC 2B9YA 3SN0A 2PODA 3KUMA 3RP7A 4NEWA 3TW9A 1JDFA 1NHPA 4ZA0A 4K8GA 1N4VA 3AM9A 2X8GA 2PMQA 1BKHA 2C66A 3B9JB 4EMJA 2HXUA 1GSNA 3HRDC 1AOGA 2BS4A 4DWDA 3ADAB 1KFYA 4BURA 3NZGA 2YM2A 3N4FA 3SQPA 3D1CA 2C70A 3TOYA 4H4PA 2XFPA 4NNJA 3FXGA 4YSYA 3QSMA 1GREA 1H7WA 1O95A 1F3PA 2R4EA 3LZWA 2HNEA 1LVLA 3DG3A 4BV6A 4LA1A 4M0XA 2GF3A 1GRFA 1OJCA 4E4UA 1PHHA 1EL9A 1SJBA 3LXDA 2YVJA 3BNMA 3HZLA 4NTCA 3DFYA 3E1TA 3P1WA 3VCCA 2WEUA 3KPKA 3UP4A 3AECA 3R11A 1NEKA 3GRTA 4EIQA 3UCCA 2GAHB 2FBWA 4WX1A 3UGVA 1FOHA 2FJBA 4A7AA 3K1GA 5FS6A 3ETRB 4H4ZA 1CBOA 2YLWA 1Y56B 3OP2A 3OW1A 1X2HA 5L46A 1NU5A 4JNAA 3AEEA 2PS2A 2IIDA 2XFNA 2YR5A 4U2LA 3PVCA 1NHQA 5FS7A 2PSNA 3BOXA 3NVYB 1L9CA 2YG5A 4K22A 3PO7A 1TRBA 1PBEA 3UKHA 1ZX9A 5G5HB 2BXSA 2PTWA 3AE4A 4IA6A 3UOXA 2YLZA 4FK1C 3DGBA 3OPSA 3T14A 3PK7A 2OO6A 3NRZB 3GDNA 1F8SA 5IPYA 3S5WA 4EM3A 4G6GA 2YG3A 1IUXA 4JDRA 3AYIA 1ZMDA 2P3ZA 5KOWA 4ZCWA 2QQ6A 2GRTA 1D7LA 5GRTA 4E4FA 3VCNA 3QFAA 2OLOA 3FCPA 3DG7A 1YKJA 5LV9A 3DK8A 2ONEA 3DGZA 3VFCA 1GV4A 5G5GB 1ONEA 5FS8A 3ZLHA 4GGHA 2YLXA 3IJIA 2AKZA 2H89A 4OPIA 2VVLA 1B8SA 4TLZA 2ZZCA 4M6UA 2OZ3A 3L8KA 4TM1A 1B4VA 4YKGA 5CKUA 2F5ZA 4ZOHB 1GRAA 1JRXA 5FJUA 4OPGA 5JCKA 3SJNA 3EKGA 3VRAA 3BNUA 3OC4A 3R1ZA 1JRYA 3UKLA 3MZNA 2C7GA 1ZKQA 3P3BA 2E3TA 3T6CA 1E9IA 3CNTA 1N4UA 3AYJA 3D47A 2BK3A 5EOWA 1MOKA 2OAMA 2XYOA 4YSZA 2OFJA 1WUFA 2FKPA 1N61C 4GISA 1N60C 2XVFA 4GFIA 1PDZA 1H81A 1IUWA 4GF7A 3SZCA 2PGEA 4A9WA 4CBQA 3NHOX 1KKOA 2XLSA 1PBFA 2P88A 1ELIA 2WPCA 4AP1A 2BABA 3CTYA 3FIMB 2C75A 4GCMA 2XVIA 3H70A 5JCLA 3IK4A 4U8NA 4EM4A 1EL7A 1DTNA 2CULA 1ZP0A 1FL2A 2WS3A 3ZDNA 3RNMA 1OJAA 3PWIA 3V76A 2JK6A 3GYJA 4D03A 1IUUA 4DGKA 4J2WA 3SN1A 3N6JA 1GT8A 1OEPA 4U8MA 1H7XA 1DJQA 4IHCA 4ENLA 1BGNA 3M13A 2GMHA 1IUVA 3UKAA 3ATQA 1F6MA 2QJMA 5BOEA 2Q0KA 2GMJA 5BULA 4G7FA 3PFRA 2BC0A 1COYA 1IJHA 2PP1A 3UTFA 2ZZ0A 3TJIA 4J33A 1FEAA 4G74A 3CGDA 2XLPA 4B63A 1BF3A 3FYYA 2YG6A 3A7AA 2WQYA 3GDPA 3QJ4A 3CNJA 3UTHA 1JPMA 4CNJA 3RCYA 3I6TA 3SZ0A 3H8IA 3ICSA 2V3BA 3BHFA 3DEQA 1JNRA 5KVIA 3DJJA 1LQTA 4YTPA 2WOIA 2XH4A 4H4UA 4H4TA 4DNAA 2RGHA 2J3NA 4HYRA 4D04A 2V6OA 5J60A 1GTHA 1VDCA 3RO6A 3FJ4A 3C4AA 3N4EA 4U8IA 1DOBA 4ROPA 1LTXR 3Q45A 3C96A 4K1WA 2OA1A 4AOXA 4C77A 1CC2A 3CPIG 2VQ7A 1WUEA 1PXCA 2ARDA 3K7MX 4NTDA 3ISHA 3JW7A 1F8WA 3V3OA 3F8RA 2GR0A 4Z1YA 4Z26A 3VA8A 3SSZA 1NDAA 3GY1A 3NVVB 1S2YA 3FMWA 4OPTA 3DK4A 1BKWA 4K7ZA 3NT6A 1DNCA 2FJEA 4E5TA 5U63A 1FEBA 1KKRA 2OZ8A 4EQRA 3TJ4A 2QA1A 1DODA 4H2RA 3I6EA 1QLBA 3B97A 4JQ9A 4ICYA 3CB3A 4A65A 3SR6B 3NK0X 2PU0A 1VRQB 3AE9A 4Z44A 4H50A 3KVEA 1YEYA 4CY8A 4CY6A 4RG4A 5J7XA 1X2GA 4ECHA 2R45A 3FBSA 3UP5A 3DDMA 1Q9IA 5C3JA 4AOSA 3ALLA 3OZMA 4J34A 4II3A 1CC4A 2EQ6A 4H2HA 1NG3A 1PS9A 2ZADA 2DW6A 1PN0A 5IDZA 3NS1B 1EL5A 4JHMA 1TDNA 4KPRA 3P93A 4USRA 2BXRA 1ZMCA 2PTXA 4EIPA 3H12A 4TLXA 3B3RA 3DIPA 4P9SA 5KRQA 4EQSA 3OZ2A 4H4WA 3Q4DA 1EBDA 1TYPA 3T37A 4H2PA 1D5TA 3HW2A 3CPJG 4KX6A 4IVOB 3QSSA 3NKSA 1L9EA 3QPEA 3DESA 2OX4A 3S5SA 3SXIA 1RYIA 2IVEA 4JY3A 1D4DA 5GSNA 4K5RA 4ZCDA 3KD9A 3A7RA 4Z25A 2R0PA 1PJ5A 4FK1A 5ER0A 3ABVA 3NG7X 3T2ZA 4HB9A 1CF3A 2BACA 1FHVA 3VC6A 2Q7VA 1ZK7A 3V5CA 3AE1A 1XS2A 4HCLA 1Y56A 2BA9A 5ENLA 1YQZA 3T31A 3AEAA 1FO4A 2BYBA 3V5FA 3I3LA 3UOVA 1PJ6A 2ZZBA 2DKIA 3ATRA 4Z2UA 1EC9A 2A89A 3UKKA 4Z17A 5KNLA 3MWCA 2YVFA 3TWBA 4F4RA 1GOSA 2WETA 1MXTA 2HXTA 2XVJA 1DOCA 1E6EA 3NYCA 4G9KA 3RITA 1EBGA 3DFHA 1CHUA 3T2KA 1TDEA 4FX9A 2X8HA 2GR3A 3QN3A 4LIIA 2WU5A 4FI4A 2GDQA 1R0MA 2PCEA 3LOVA 3SGLA 3SBFA 4GMEA 3GMCA 2VOUA 3NGCX 3T9PA 5IQ4A 2BS3A 2PTYA 1IUSA 1CJ3A 3IF9A 4U8PA 3UOZA 1EC8A 1PBCA 2O56A 3SN4A 4EMWA 2WDQA 3BI4A 4EMIA 4PAAA 3ES7A 1H82A 1SB3B 4XWZA 3DJGX 2XLTA 3UJFA 2JBVA 2OZTA 3R0UA 3FVDA 4C3YA 3IWAA 4HPNA 2V5ZA 2W0HA 3UCLA 1Y0PA 3K30A 3SZFA 1TKKA 1GTEA 3IJQA 5FJRA 1SJCA 3L1RA 2YG7A 2EQ8A 2CHRA 3QTPA 3AEBA 3H7VA 1BWCA 4E6MA 1L9DA 3NK2X 1PBDA 2E5AA 4B69A 1GEUA 4GYPC 3URHA 1N62C 4IL2A 1S2QA 4HCHA 3VR8A 1GRHA 1STZA 2FJAA 3AE3A 5FS9A 1TDFA 1VG0A 4H4SA 4A6GA 1JRZA 1YQ3A 3P4SA 3D9XA 3UOYA 1N63C 4EWJA 3NK1X 2C67A 4IA5A 4NEVA 2ZC8A 5FJTA 2EQ9A 4TVYA 2BCGG 1TDOA 1H83A 3UJEA 2OLNA 2W55A 2V61A 4DXKA 2C64A 4Z43A 4CCQA 1E1LA 3SM8A 2BK5A 5FMHA 1R6WA 4B68A 2Q6UA 5HXIA 3MY9A 4IP4A 2V60A 4USQA 1ZOYA 3AMZA 4N9XA 3F8DA 2PYXA 4OPCA 2ACZA 2B9XA 3V3NA 1EC7A 3VR9A 3NNEA 1FECA 2VVLG 3EAOA 3CNPA 1MDRA 2JB3A 1E7PA 1JU2A 3AE8A 4XXGA 1H84A 1KCZA 2XH7A 1L8PA 3JZUA 5KMRA 3M0OA 4BK3A 2P8CA 1S7MA 1DJNA 3LB8A 4ZCCA 3AYLA 1GRBA 3F8PA 4DSGA 3R07C 4KPLA 2XFQA 2JB1A 1M6IA 2WU2A 3CPHG 1V97A 5EB5A 4OPDA 4NWZA 2C72A 4UDQA 4K5SA 3TTEA 3II4A 5BRTA 7ENLA 1EL8A 4Z24A 4CNKA 2XLRA 3NO1A 5IQ1A 4IL0A 1KNRA 3P0WA 1CL0A 3S47A 4U8OA 2X3NA 1KSSA 2XFUA 1JOAA 5EBKA 2XGZA 1JROA 4X9NA 1IUTA 1JPDX 4TM4A 1D4EA 3AWIA 3UJRA 2PGWA 1PBBA 1W6TA 1ECQA 4UP3A 2GGHA 1D7YA 2A87A 2P8BA 1HYUA 1OJDA 2OQHA 4G8TA 2AQJA 4HNLA 2PP0A 3ITJA 2JKCA 3R25A 2Y6RA 3NVWB 3TCSA 3AE7A 1ZDLA 4NTEA 1JEHA 1Z6LA 3AXBA 4YXDA 2DW7A 2WDRA 1P2EA 6ENLA 1QO8A 1E1NA 2WP5A 3T2YA 2EQ7A 2QAEA 3BJSA 3BI5A 4B64A 4IVMB 4HA6A 4ZN0A 2OG9A 5HHFA 2C65A 5JCIA 3CAWA 4A99A 1F9CA 3V4BA 3UJSA 3NH3X 3NLCA 3RHAA 2WHDA 2DKHA 3DH9A 3H8LA 2GB0A 4H2NA 2OLAA 1E39A 1PDYA 3RGTA 1JRPA 4Z2TA 3HPFA 2PTZA 3M12A 5KMSA 3AE5A 5EB4A 3VRBA 3G5SA 1ELSA 2XSXA 1H86A 1LV0A 1BQGA 1PDHA 1H6VA 3DMEA 1X31B 1K4QA 3ICTA 3ZVIA 4HN8A 2YQUA 4H2QA 4OCGA 2C3CA 4J36A 2QJJA 1GXFA 1K0LA 4G6HA 1B5QA 1MO9A 2AKMA 2Q0LA 3AD7B 2GH5A 5JCNA 1RVKA 4B67A 1MNSA 2GSHA 3Q6JA 1S3EA 3L5OA 2WDVA 3NVZB 4LU6A 3DG6A 3EF6A 4BK1A 4UDPA 4K2XA 3WE0A 1KDGA 1LJ1A 3T8QA 2R0GA 3I6DA 3DERA 4IV9A 3QKEA 2XH2A 5KXJA 1NG4A 1CJ4A 2QGYA 4YKFA 2E4GA 4AP3A 3IHMA 4AT2A 4J3ZA 2OALA 1KD0A 4X4JA 2GL5A 4DHGA 3P9UA 4MJWA 4BJYA 4BK2A 1FFVC 3KKJA 4GRTA 3AE6A 3MUCA 3IHGA 3FPZA 3GD4A 1B37A 4HCDA 3UCDA 2FYMA 4A3RA 3AEFA 2B9WA 2GAGB 4OPLA 3RR1A 2P0IA 3VC5A 1KN0A 3DJEA 3KA7A 4NZHA 1XANA 2E1MA 1OJ9A 2WBAA 2XFOA 3SY4A 1LQUA 3KLJA 3VDGA 2R46A 2X99A 1V59A 3ALJA 3AEDA 2Y6QA 1P43A 1E1KA 3QFBA 3CGEA 1CJ2A 1NENA 3AE2A 3ZLGA 1T3QC 3O0HA 3EEZA 4EQXA 3A7UA 1XHCA 5KMPA 3STPA 2WPFA 3PG6A 3AB1A 3PS9A 3RP6A 5BUKA 4C74A 4K8DA 3OTRA 1ONFA 1KF6A 1KSUA 2GEWA 4GYPA 3P4RA 1TDKA 3ZVHA 2C73A 1SJDA 4II2A 1TYTA 2W3SA 2C3DA 2YG4A 1PXAA 4GAVA 3B6DA 3BSMA 2GQWA 4YWSA 2XVEA 2XCGA 2BRYA 2YLTA 2VRMA 2RGJA 2QA2A 2BRAA 3TQPA 4Y4MA 5JCMA 2APGA 4H19A 2O9ZA 3U9IA 1D4CA 3MKCA 4JN7A 3UKFA 4O5QA 4U8KA 4YTMA 2OVLA 3ZLFA 5U1OA 4U2TA 3ZVHB 1MDLA 2RGOA 2QVHA 3CNDA 3P4QA 1GRTA 1O5WA 3DGHA 4YTNA 4WCTA 5BOFA 2MUCA 4Y4NA 3EUB3 2QCUA 3D8XA 1XDIA 4MMWA 5FJOA 3UXKA 3MSYA 4OVIA 1F8RA 3AEGA 4Y4LA 2RDXA 4U8LA 2PA6A 2R9ZA 1TE6A 4H4QA 3UTEA 4HNCA 4E0VA 4B66A 2I5QA 2GGIA 3AD8B 1L0VA 3P4PA 1GESA 1OJTA 3THUA 4CRTA 4TM3A 3NN0X 2WOVA 4DN1A 3VRDB 4YT0A 4RSLA 4MKSA 2XLUA 4U8JA 3IJLA 2YWLA 1NPXA 2PU1A 3GRSA 1N5WC 2MNRA 3AD9B 1EBHA 2R4JA 1NHSA 2YR4A 2POZA 3SFDA 3DK9A 4GGBA 1CJCA 3NTDA 1RP0A 2NVKX 1RM6B 3MQTA 1BGJA 4DSHA 3R0KA 4TVWA 2OQYA 3V3WA 3CMMA 2PP3A 4MGGA 3R10A 2VVMA 1SJAA 2QDDA 3UJ2A 3NIXA 2HQMA 1MRAA 3JSKA 2VRLA 4YSXA 4M52A 3NFUA 5DBJA 3TWAA 4GDEA 3S61A 2GR2A 2Z5YA 4B65A 3UXLA 2AAQA 3ES8A 4GIRA 4H1ZA 3KU9A 2X8CA 4H4RA 3SQSA 1QJDA 5KMQA 4EQWA 4A35A 1N4WA 4FDCB 2XDOA 5KOXA 3OZYA 1REOA 2I0ZA 5EU9A 3GYXA 2GGEA 2C4CA 1RSGA 3H4KA 1K0IA 2HZGA 2B7RA 2GR1A 2CVJA 3Q9TA 2WOWA 3K7QX 3EPTA 2X50A 3FG2P 3RP8A 2VZ2A 1PXBA 2R0CA 4GAPA 1GNDA 3GD3A 4GUVA 4REKA 2PPGA 4Z2RA 3CGCA 4ADWA 4A6NA 1N1PA 2OKTA 2PHHA 3QVRA 4O5UA 1BZLA 2GGJA 5FJPA 3VQRA 4BJZA 2NPXA 2AR8A 5TR3A 1IYXA 1YQ4A 3CT2A 1JNZA 4I59A 3CYJA 2GQFA 4RG3A 4KEMA 4JN9A 2RABA 2W3RA 2TMDA 2H88A 4X2PA 1GALA 1VQZA 4A6NB 4XWRA 3KPFA 4J1OA 3NRNA 3JVAA 1ZOVA 5M0ZA 3FV9A 2XH0A 3HYVA 1KNPA 3PWGA 5JRBA 3UKQA 1P2HA 4PABA 5CQFA 3GYIA 3CNSA 2WESA 3CXBA 3NTAA 3BHKA 2BC1A 3DJDA 3SX6A 3N6HA 5U25A 1H2IA 1FCDA 1P48A 3DA1A 4B1BA 3T0KA 1NHRA 1DXLA 2V3AA 3SZWA 2YR6A 3D46A 2WPEA 2YAUA 3LADA 2W54A 3NYFA 3CIRA 3GWDA 3NXLA 2E5VA 1S3BA 2NQLA 4JY2A 2C76A 2WP6A 4H7UA 4X9MA 2Z5XA 3C4NA 3GC2A 2JAEA 1VDVA 2FJDA 3AN1A 1VQWA 4FP1A 4AT0A 4H83A 2VQBA 3GMBA 3ALMA 4H4YA 1W4XA 2BK4A 1LPFA 2CDUA 2B76A 1VG9A 2YLRA 3LJPA 3EANA 4C3XA 3K7TA 3CN8A 1UKVG 4OPUA 3CGBA 1WYGA 5C2TA 2QJNA 3LZXA 5HYMA 3HYXA 2WP9A 4IP5A 2A8XA 4GR1A 2TPRA 5KVHA 3I4KA 1SEZA 5M10A 4A79A 4K2SA 4U2SA 4I58A 1GPEA 3BI2A 2QDEA 4DYEA 2GVCA 1FHUA 4JN8A 2AL1A 2YLSA 1GETA 1XPYA 2BCPA 2GV8A 1DOEA 2JB2A 4YSHA 3GO2A 3SFEA 4E8GA 1JCTA 2ZBWA 1TZZA 4JNQA 1FIQB 4TM0A 5J04A 3RRAA 4H4VA 1CC6A 4H4XA 3QSEA 5KWFA 3HYWA 3G5QA 4APNA 1NAAA 1YY5A 3GSIA 1FFUC 3QLDA 1PJ7A 3GD6A 3NYEA 2CFYA 2BS2A 4CCRA 3T4WA 4J57A 1Q1WA 3GWFA 4KWSA 4UDRA 2YVGA 3CXOA 2IVDA 3G5RA 3QVPA 4J31A 3ENLA 2B7SA 1Q1RA 1GERA 2UZZA 2AL2A 4KT2A 1NELA 3R9UA 3H8AA 1K0JA 4YWOA 3UTGA 2GGGA 3COXA 3UKPA 1GRGA 3U4FA 4IT1A 1N5XA 2XVHA 4J56A 3ICRA 1M64A 1ZY8A 2YM1A 5HY5A 1XPQA 4DX3A 3SYIA 4C5OA 4A5LA 3NN6X 1E1MA 4GDPA 4G73A
chains in the Genus database with same CATH topology
1O94A 1VDCA 1ZOYA 3ZYXA 2QCUA 3D8XA 1XDIA 3C4AA 4U8IA 1DOBA 1LTXR 5BVAA 3REDA 3C96A 4OVIA 3IC9A 4N9XA 2OA1A 2B9YA 1F8RA 3F8DA 3AEGA 2PYXA 4Y4LA 4AOXA 4OPCA 4U8LA 1CC2A 2ACZA 4C77A 2R9ZA 2B9XA 3V3NA 3CPIG 2VQ7A 1PXCA 4H4QA 4NEWA 2ARDA 3K7MX 3RP7A 3UTEA 4NTDA 1NHPA 3VR9A 3ISHA 3NNEA 4E0VA 1F8WA 4B66A 1FECA 2VVLG 3V3OA 3EAOA 1N4VA 3CNPA 3AD8B 1L0VA 2JB3A 2GR0A 3F8RA 3P4PA 1GESA 1OJTA 2X8GA 1E7PA 1JU2A 2C66A 3AE8A 4XXGA 4CRTA 4Z26A 4TM3A 4EMJA 1H84A 3NN0X 1NDAA 1GSNA 1S2YA 5KMRA 2WOVA 1AOGA 2BS4A 3FMWA 4OPTA 3VRDB 3ADAB 1KFYA 3DK4A 1BKWA 4BURA 3M0OA 2YM2A 4K7ZA 4YT0A 4BK3A 3SQPA 3D1CA 3NT6A 4RSLA 2C70A 2XLUA 4H4PA 2XFPA 1DNCA 1S7MA 1DJNA 4NNJA 3LB8A 4U8JA 4ZCCA 3AYLA 2FJEA 5U63A 1GRBA 3F8PA 1FEBA 2YWLA 1NPXA 4YSYA 3QSMA 4EQRA 3GRSA 4DSGA 1GREA 1H7WA 1O95A 1F3PA 2QA1A 2R4EA 1DODA 3LZWA 4H2RA 2XFQA 3AD9B 1LVLA 1QLBA 2JB1A 2R4JA 1NHSA 4BV6A 2YR4A 3SFDA 1M6IA 3DK9A 4LA1A 4JQ9A 1CJCA 2WU2A 2GF3A 1GRFA 3NTDA 1RP0A 4ICYA 3CPHG 2NVKX 1OJCA 1BGJA 1PHHA 1EL9A 5EB5A 4A65A 3LXDA 3NK0X 2YVJA 3BNMA 3HZLA 4NTCA 1VRQB 4NWZA 4OPDA 3E1TA 2C72A 4UDQA 3P1WA 4K5SA 4DSHA 3AE9A 4Z44A 4H50A 3II4A 5BRTA 3KVEA 2WEUA 3KPKA 3UP4A 3AECA 1EL8A 1NEKA 3CMMA 4CY8A 4CY6A 4Z24A 4CNKA 2XLRA 2VVMA 4RG4A 3GRTA 5J7XA 4EIQA 3NIXA 5IQ1A 2HQMA 3JSKA 2R45A 4ECHA 3FBSA 1KNRA 1CL0A 3UP5A 2VRLA 1Q9IA 5C3JA 4AOSA 3ALLA 4J34A 4II3A 4M52A 1CC4A 2EQ6A 2X3NA 4U8OA 1KSSA 2XFUA 5DBJA 2GAHB 2FBWA 4GDEA 1JOAA 4WX1A 3S61A 1NG3A 2GR2A 5EBKA 1PS9A 4X9NA 1IUTA 1FOHA 2Z5YA 4B65A 2FJBA 4A7AA 4TM4A 1D4EA 2AAQA 1PN0A 3AWIA 5FS6A 3KU9A 4H4ZA 1CBOA 2X8CA 1PBBA 1EL5A 2YLWA 4H4RA 4UP3A 1D7YA 2A87A 1TDNA 4KPRA 1QJDA 1Y56B 5L46A 1HYUA 4USRA 2BXRA 5KMQA 4JNAA 1ZMCA 4EIPA 4EQWA 1OJDA 3AEEA 2IIDA 2AQJA 2XFNA 1N4WA 2YR5A 4FDCB 3ITJA 2XDOA 4TLXA 2JKCA 3B3RA 4U2LA 5KOXA 3PVCA 1NHQA 2Y6RA 5FS7A 4P9SA 1REOA 2I0ZA 3AE7A 5KRQA 1L9CA 1ZDLA 4NTEA 4EQSA 1JEHA 1Z6LA 2YG5A 3OZ2A 4K22A 3GYXA 3PO7A 2C4CA 1RSGA 3H4KA 1TRBA 3AXBA 4YXDA 4H4WA 2WDRA 1P2EA 1K0IA 1EBDA 1TYPA 3T37A 2B7RA 4H2PA 1PBEA 2GR1A 1QO8A 3UKHA 1E1NA 2WP5A 2CVJA 1D5TA 1ZX9A 3Q9TA 2WOWA 3T2YA 2EQ7A 3K7QX 2QAEA 3CPJG 2X50A 2BXSA 3BI5A 3EPTA 3FG2P 4B64A 4KX6A 3RP8A 4IVMB 4HA6A 4IVOB 4ZN0A 3QSSA 3AE4A 1L9EA 2VZ2A 1PXBA 2R0CA 3NKSA 5HHFA 2C65A 4GAPA 1GNDA 4IA6A 3UOXA 2YLZA 4FK1C 3GD3A 4GUVA 5JCIA 4REKA 4Z2RA 3CGCA 4ADWA 3T14A 4A6NA 3SXIA 1N1PA 4A99A 3GDNA 1F8SA 1RYIA 2PHHA 5IPYA 2IVEA 3S5WA 3NH3X 4EM3A 3QVRA 3NLCA 4JY3A 4G6GA 1D4DA 5GSNA 3RHAA 4K5RA 2YG3A 2WHDA 1IUXA 4O5UA 4ZCDA 1BZLA 4JDRA 3KD9A 2DKHA 3DH9A 3AYIA 3H8LA 1ZMDA 4Z25A 2R0PA 1PJ5A 4FK1A 5ER0A 2GB0A 4H2NA 3VQRA 3ABVA 4BJZA 3NG7X 5KOWA 3T2ZA 1E39A 2NPXA 4HB9A 2GRTA 1D7LA 2AR8A 5TR3A 4Z2TA 1CF3A 5GRTA 1YQ4A 3M12A 5KMSA 3AE5A 5EB4A 3QFAA 3VRBA 2OLOA 3G5SA 1JNZA 4I59A 1YKJA 1H86A 1LV0A 2GQFA 5LV9A 2BACA 1PDHA 4RG3A 2Q7VA 3DK8A 4JN9A 1ZK7A 2RABA 3DGZA 3AE1A 1GV4A 1H6VA 1Y56A 3DMEA 2BA9A 2H88A 2TMDA 1X31B 5FS8A 1GALA 1K4QA 1YQZA 3ICTA 3T31A 3AEAA 2BYBA 3UOVA 3I3LA 4A6NB 4XWRA 2YQUA 1PJ6A 2ZZBA 2YLXA 3KPFA 4H2QA 3NRNA 4OCGA 2C3CA 1ZOVA 2DKIA 3ATRA 4J36A 5M0ZA 1GXFA 4Z2UA 2H89A 3HYVA 1K0LA 4G6HA 1B5QA 1KNPA 4OPIA 2VVLA 1MO9A 1B8SA 5JRBA 4TLZA 3UKQA 2ZZCA 1P2HA 2Q0LA 4PABA 5CQFA 3GYIA 4TM1A 3L8KA 3CNSA 1B4VA 2WESA 4YKGA 5CKUA 3AD7B 2F5ZA 2A89A 2GH5A 3UKKA 3NTAA 5KNLA 2YVFA 5JCNA 3BHKA 1GRAA 2BC1A 3DJDA 3SX6A 5U25A 1JRXA 4B67A 1H2IA 1FCDA 3Q6JA 4OPGA 1S3EA 5JCKA 3L5OA 3DA1A 4B1BA 1GOSA 3VRAA 3T0KA 1NHRA 2WETA 3BNUA 1MXTA 3OC4A 2WDVA 4LU6A 1JRYA 2XVJA 3EF6A 1DXLA 1DOCA 4BK1A 4UDPA 3UKLA 1E6EA 3NYCA 4G9KA 2V3AA 2C7GA 3SZWA 2YR6A 1ZKQA 4K2XA 2WPEA 3WE0A 2YAUA 1KDGA 1CHUA 3T2KA 1LJ1A 1TDEA 2R0GA 3LADA 4FX9A 2X8HA 3NYFA 3CIRA 3GWDA 2E5VA 3I6DA 1S3BA 4JY2A 4YSXA 2C76A 4IV9A 2GR3A 2WP6A 4LIIA 2WU5A 5KXJA 3CNTA 4H7UA 1N4UA 3AYJA 1NG4A 4X9MA 1CJ4A 2Z5XA 3C4NA 2BK3A 5EOWA 2JAEA 2FJDA 1MOKA 3LOVA 2OAMA 3SGLA 2XYOA 4YSZA 1VQWA 3GMCA 2VOUA 3NGCX 4YKFA 2E4GA 4AT0A 2VQBA 5IQ4A 3GMBA 2BS3A 4AP3A 1CJ3A 4H4YA 1IUSA 3ALMA 3IF9A 1W4XA 3IHMA 2BK4A 4U8PA 1LPFA 4AT2A 2OALA 3UOZA 2CDUA 2XVFA 1H81A 1PBCA 2B76A 2WDQA 4EMWA 1IUWA 1VG9A 3BI4A 2YLRA 3LJPA 4GF7A 3EANA 4C3XA 4X4JA 4EMIA 3K7TA 3CN8A 4PAAA 3SZCA 3P9UA 4MJWA 1H82A 1UKVG 4BJYA 4BK2A 4A9WA 4CBQA 3NHOX 3KKJA 4GRTA 3AE6A 4XWZA 4OPUA 3CGBA 5C2TA 3DJGX 2XLTA 1PBFA 2XLSA 3IHGA 2JBVA 3FPZA 3GD4A 1B37A 2WPCA 1ELIA 4C3YA 3IWAA 2V5ZA 3LZXA 4AP1A 2BABA 3AEFA 3CTYA 2B9WA 3FIMB 2C75A 2W0HA 4GCMA 3UCLA 2XVIA 3HYXA 5JCLA 2WP9A 5HYMA 1Y0PA 2GAGB 3K30A 3SZFA 4OPLA 4U8NA 2A8XA 4EM4A 4GR1A 1GTEA 2TPRA 5KVHA 1KN0A 1EL7A 3DJEA 2CULA 1SEZA 3KA7A 3L1RA 1XANA 4NZHA 5M10A 2E1MA 2YG7A 2EQ8A 1ZP0A 1FL2A 1OJ9A 4A79A 2WS3A 4I58A 4U2SA 3ZDNA 3RNMA 1OJAA 2WBAA 3AEBA 3V76A 1GPEA 2JK6A 2XFOA 3GYJA 1BWCA 3SY4A 1LQUA 4D03A 1IUUA 3BI2A 3KLJA 2R46A 4DGKA 2X99A 1V59A 1L9DA 2GVCA 3NK2X 3ALJA 1PBDA 4J2WA 2YLSA 3AEDA 2Y6QA 1GETA 2BCPA 2GV8A 1DOEA 1E1KA 2JB2A 4YSHA 3QFBA 3CGEA 1CJ2A 1NENA 3AE2A 3SFEA 4B69A 1GEUA 3URHA 3O0HA 1GT8A 2ZBWA 4EQXA 4U8MA 4JNQA 1XHCA 5KMPA 1H7XA 1DJQA 1S2QA 4TM0A 3VR8A 1GRHA 4H4VA 1CC6A 2WPFA 4H4XA 3QSEA 5KWFA 1BGNA 3HYWA 3G5QA 4APNA 1NAAA 1YY5A 3GSIA 2FJAA 3AE3A 3M13A 2GMHA 3PG6A 1IUVA 3AB1A 5FS9A 3PS9A 3UKAA 3RP6A 5BUKA 3ATQA 1PJ7A 4C74A 1TDFA 4K8DA 1F6MA 1VG0A 1KF6A 1ONFA 1KSUA 2GEWA 3NYEA 3P4RA 1TDKA 2CFYA 2Q0KA 4H4SA 2GMJA 2BS2A 4CCRA 5BULA 2C73A 1JRZA 4J57A 4II2A 2BC0A 1YQ3A 3P4SA 3D9XA 1COYA 1Q1WA 1TYTA 1IJHA 3GWFA 3UOYA 2C3DA 2YG4A 4UDRA 1PXAA 2YVGA 4GAVA 2IVDA 3B6DA 3G5RA 3QVPA 4J31A 3NK1X 2GQWA 2B7SA 3UTFA 1Q1RA 2C67A 4IA5A 1GERA 4NEVA 2XVEA 2UZZA 3R9UA 2XCGA 2BRYA 2ZZ0A 1K0JA 2YLTA 4J33A 1FEAA 4G74A 4YWOA 3UTGA 3CGDA 2EQ9A 2XLPA 2VRMA 2RGJA 3COXA 2QA2A 4B63A 2BRAA 3UKPA 1GRGA 2BCGG 1BF3A 4Y4MA 1TDOA 1H83A 2YG6A 2WQYA 5JCMA 2APGA 2O9ZA 3GDPA 3QJ4A 1D4CA 3CNJA 3UTHA 2OLNA 2V61A 4CNJA 3UKFA 2XVHA 4O5QA 4J56A 3ICRA 3SZ0A 3H8IA 1M64A 1ZY8A 2C64A 3ICSA 4U8KA 4YTMA 2V3BA 4Z43A 3BHFA 4CCQA 2YM1A 1E1LA 3SM8A 1JNRA 5HY5A 5KVIA 2BK5A 5U1OA 3DJJA 1LQTA 4U2TA 4YTPA 2WOIA 1XPQA 4H4UA 3SYIA 4C5OA 4H4TA 5FMHA 4A5LA 2RGOA 4DNAA 4B68A 2RGHA 3CNDA 2Q6UA 3P4QA 1GRTA 2J3NA 1O5WA 3DGHA 3NN6X 1E1MA 4YTNA 4WCTA 4D04A 2V6OA 4GDPA 5J60A 1GTHA 5HXIA 4Y4NA 4G73A 2V60A 4USQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O94 A;  1VDC A;  1ZOY A;  3ZYX A;  2QCU A;  3D8X A;  1XDI A;  3C4A A;  4U8I A;  1DOB A;  1LTX R;  5BVA A;  3RED A;  3C96 A;  4OVI A;  3IC9 A;  4N9X A;  2OA1 A;  2B9Y A;  1F8R A;  3F8D A;  3AEG A;  2PYX A;  4Y4L A;  4AOX A;  4OPC A;  4U8L A;  1CC2 A;  2ACZ A;  4C77 A;  2R9Z A;  2B9X A;  3V3N A;  3CPI G;  2VQ7 A;  1PXC A;  4H4Q A;  4NEW A;  2ARD A;  3K7M X;  3RP7 A;  3UTE A;  4NTD A;  1NHP A;  3VR9 A;  3ISH A;  3NNE A;  4E0V A;  1F8W A;  4B66 A;  1FEC A;  2VVL G;  3V3O A;  3EAO A;  1N4V A;  3CNP A;  3AD8 B;  1L0V A;  2JB3 A;  2GR0 A;  3F8R A;  3P4P A;  1GES A;  1OJT A;  2X8G A;  1E7P A;  1JU2 A;  2C66 A;  3AE8 A;  4XXG A;  4CRT A;  4Z26 A;  4TM3 A;  4EMJ A;  1H84 A;  3NN0 X;  1NDA A;  1GSN A;  1S2Y A;  2WOV A;  1AOG A;  2BS4 A;  3FMW A;  4OPT A;  3VRD B;  3ADA B;  1KFY A;  3DK4 A;  1BKW A;  4BUR A;  3M0O A;  2YM2 A;  4K7Z A;  4YT0 A;  4BK3 A;  3SQP A;  3D1C A;  3NT6 A;  4RSL A;  2C70 A;  2XLU A;  4H4P A;  2XFP A;  1DNC A;  1DJN A;  4U8J A;  3LB8 A;  4ZCC A;  3AYL A;  2FJE A;  5U63 A;  1GRB A;  3F8P A;  1FEB A;  2YWL A;  1NPX A;  4YSY A;  3QSM A;  4EQR A;  3GRS A;  4DSG A;  1GRE A;  1H7W A;  1O95 A;  1F3P A;  2QA1 A;  2R4E A;  1DOD A;  3LZW A;  4H2R A;  2XFQ A;  3AD9 B;  1LVL A;  1QLB A;  2JB1 A;  2R4J A;  1NHS A;  4BV6 A;  2YR4 A;  3SFD A;  1M6I A;  3DK9 A;  4LA1 A;  4JQ9 A;  1CJC A;  2WU2 A;  2GF3 A;  1GRF A;  3NTD A;  1RP0 A;  4ICY A;  3CPH G;  2NVK X;  1OJC A;  1BGJ A;  1PHH A;  1EL9 A;  5EB5 A;  4A65 A;  3LXD A;  3NK0 X;  2YVJ A;  3BNM A;  3HZL A;  4NTC A;  1VRQ B;  4OPD A;  3E1T A;  2C72 A;  4UDQ A;  3P1W A;  4K5S A;  4DSH A;  3AE9 A;  4Z44 A;  4H50 A;  3II4 A;  5BRT A;  3KVE A;  2WEU A;  3UP4 A;  3AEC A;  1EL8 A;  1NEK A;  4CY8 A;  4CY6 A;  4Z24 A;  4CNK A;  2XLR A;  2VVM A;  4RG4 A;  3GRT A;  5J7X A;  4EIQ A;  3NIX A;  5IQ1 A;  2HQM A;  3JSK A;  2R45 A;  4ECH A;  3FBS A;  1KNR A;  1CL0 A;  3UP5 A;  2VRL A;  1Q9I A;  5C3J A;  4AOS A;  3ALL A;  4J34 A;  4U8O A;  4M52 A;  1CC4 A;  2EQ6 A;  2X3N A;  5DBJ A;  1KSS A;  2XFU A;  4YSX A;  2GAH B;  2FBW A;  4GDE A;  1JOA A;  4WX1 A;  3S61 A;  1NG3 A;  2GR2 A;  5EBK A;  1PS9 A;  4X9N A;  1IUT A;  1FOH A;  2Z5Y A;  4B65 A;  2FJB A;  4A7A A;  4TM4 A;  1D4E A;  2AAQ A;  1PN0 A;  3AWI A;  5FS6 A;  3KU9 A;  4H4Z A;  1CBO A;  2X8C A;  1PBB A;  1EL5 A;  2YLW A;  4H4R A;  4UP3 A;  1D7Y A;  2A87 A;  1TDN A;  4KPR A;  1QJD A;  1Y56 B;  5L46 A;  1HYU A;  4USR A;  2BXR A;  4JNA A;  1ZMC A;  4EIP A;  4EQW A;  1OJD A;  3AEE A;  2IID A;  2AQJ A;  2XFN A;  1N4W A;  2YR5 A;  4FDC B;  3ITJ A;  2XDO A;  4TLX A;  2JKC A;  3B3R A;  4U2L A;  5KOX A;  3PVC A;  1NHQ A;  2Y6R A;  5FS7 A;  4P9S A;  1REO A;  2I0Z A;  3AE7 A;  5KRQ A;  1L9C A;  1ZDL A;  4NTE A;  4EQS A;  1JEH A;  1Z6L A;  2YG5 A;  3OZ2 A;  4K22 A;  3PO7 A;  1RSG A;  3H4K A;  1TRB A;  3AXB A;  4YXD A;  4H4W A;  2WDR A;  1P2E A;  1K0I A;  1EBD A;  1TYP A;  3T37 A;  2B7R A;  4H2P A;  1PBE A;  2GR1 A;  1QO8 A;  3UKH A;  1E1N A;  2WP5 A;  2CVJ A;  1D5T A;  1ZX9 A;  3Q9T A;  2WOW A;  2EQ7 A;  3K7Q X;  2QAE A;  3CPJ G;  2X50 A;  2BXS A;  3BI5 A;  3EPT A;  3FG2 P;  4B64 A;  4KX6 A;  3RP8 A;  4IVM B;  4HA6 A;  4IVO B;  4ZN0 A;  3QSS A;  3AE4 A;  1L9E A;  2VZ2 A;  1PXB A;  2R0C A;  3NKS A;  5HHF A;  2C65 A;  1GND A;  4IA6 A;  3UOX A;  2YLZ A;  4FK1 C;  3GD3 A;  4GUV A;  5JCI A;  4REK A;  4Z2R A;  3CGC A;  4ADW A;  4A6N A;  1N1P A;  4A99 A;  3GDN A;  1F8S A;  1RYI A;  2PHH A;  5IPY A;  2IVE A;  3S5W A;  3NH3 X;  4EM3 A;  3QVR A;  3NLC A;  4JY3 A;  1D4D A;  5GSN A;  3RHA A;  4K5R A;  2YG3 A;  2WHD A;  1IUX A;  4O5U A;  4ZCD A;  1BZL A;  4JDR A;  3KD9 A;  2DKH A;  3DH9 A;  3AYI A;  3H8L A;  1ZMD A;  4Z25 A;  2R0P A;  1PJ5 A;  4FK1 A;  5ER0 A;  2GB0 A;  4H2N A;  3VQR A;  3ABV A;  4BJZ A;  3NG7 X;  5KOW A;  1E39 A;  2NPX A;  4HB9 A;  2GRT A;  1D7L A;  2AR8 A;  5TR3 A;  4Z2T A;  1CF3 A;  5GRT A;  1YQ4 A;  3M12 A;  3AE5 A;  5EB4 A;  3QFA A;  3VRB A;  2OLO A;  3G5S A;  1JNZ A;  4I59 A;  1YKJ A;  1H86 A;  1LV0 A;  2GQF A;  5LV9 A;  2BAC A;  1PDH A;  4RG3 A;  2Q7V A;  3DK8 A;  4JN9 A;  1ZK7 A;  2RAB A;  3DGZ A;  3AE1 A;  1GV4 A;  1H6V A;  1Y56 A;  3DME A;  2BA9 A;  2H88 A;  2TMD A;  1X31 B;  5FS8 A;  1GAL A;  1K4Q A;  1YQZ A;  3ICT A;  3AEA A;  2BYB A;  3UOV A;  3I3L A;  4A6N B;  4XWR A;  2YQU A;  1PJ6 A;  2ZZB A;  2YLX A;  3KPF A;  4H2Q A;  3NRN A;  4OCG A;  2C3C A;  1ZOV A;  2DKI A;  3ATR A;  4J36 A;  5M0Z A;  1GXF A;  4Z2U A;  2H89 A;  1K0L A;  1B5Q A;  1KNP A;  4OPI A;  2VVL A;  1MO9 A;  1B8S A;  4TLZ A;  3UKQ A;  2ZZC A;  1P2H A;  2Q0L A;  4PAB A;  5CQF A;  3GYI A;  4TM1 A;  3L8K A;  3CNS A;  1B4V A;  2WES A;  4YKG A;  5CKU A;  3AD7 B;  2F5Z A;  2A89 A;  2GH5 A;  3UKK A;  3NTA A;  2YVF A;  5JCN A;  3BHK A;  1GRA A;  2BC1 A;  3DJD A;  5U25 A;  1JRX A;  4B67 A;  1FCD A;  3Q6J A;  4OPG A;  1S3E A;  5JCK A;  3DA1 A;  4B1B A;  1GOS A;  3VRA A;  1NHR A;  2WET A;  3BNU A;  1MXT A;  3OC4 A;  2WDV A;  4LU6 A;  1JRY A;  2XVJ A;  3EF6 A;  1DXL A;  1DOC A;  4BK1 A;  4UDP A;  3UKL A;  1E6E A;  3NYC A;  2V3A A;  2C7G A;  2YR6 A;  1ZKQ A;  4K2X A;  2WPE A;  3WE0 A;  2YAU A;  1KDG A;  1CHU A;  1LJ1 A;  1TDE A;  2R0G A;  3LAD A;  4FX9 A;  2X8H A;  3NYF A;  3CIR A;  3GWD A;  2E5V A;  3I6D A;  1S3B A;  4JY2 A;  2C76 A;  4IV9 A;  2GR3 A;  2WP6 A;  4LII A;  2WU5 A;  5KXJ A;  3CNT A;  4H7U A;  1N4U A;  3AYJ A;  1NG4 A;  4X9M A;  1CJ4 A;  2Z5X A;  3C4N A;  2BK3 A;  5EOW A;  2JAE A;  2FJD A;  1MOK A;  3LOV A;  2OAM A;  3SGL A;  2XYO A;  4YSZ A;  1VQW A;  3GMC A;  2VOU A;  3NGC X;  4YKF A;  2E4G A;  4AT0 A;  2VQB A;  5IQ4 A;  3GMB A;  2BS3 A;  4AP3 A;  1CJ3 A;  4H4Y A;  1IUS A;  3ALM A;  3IF9 A;  1W4X A;  3IHM A;  2BK4 A;  4U8P A;  1LPF A;  4AT2 A;  2OAL A;  3UOZ A;  2CDU A;  2XVF A;  1H81 A;  1PBC A;  2B76 A;  2WDQ A;  4EMW A;  1IUW A;  1VG9 A;  3BI4 A;  2YLR A;  3LJP A;  4GF7 A;  3EAN A;  4C3X A;  4X4J A;  4EMI A;  3K7T A;  3CN8 A;  4PAA A;  3P9U A;  4MJW A;  1H82 A;  1UKV G;  4BJY A;  4BK2 A;  4A9W A;  4CBQ A;  3NHO X;  3KKJ A;  4GRT A;  3AE6 A;  4XWZ A;  4OPU A;  3CGB A;  5C2T A;  3DJG X;  2XLT A;  1PBF A;  2XLS A;  3IHG A;  2JBV A;  3FPZ A;  3GD4 A;  1B37 A;  2WPC A;  1ELI A;  4C3Y A;  3IWA A;  2V5Z A;  3LZX A;  4AP1 A;  2BAB A;  3AEF A;  3CTY A;  2B9W A;  3FIM B;  2C75 A;  2W0H A;  4GCM A;  3UCL A;  2XVI A;  5HYM A;  5JCL A;  2WP9 A;  1Y0P A;  2GAG B;  3K30 A;  4OPL A;  4U8N A;  2A8X A;  4EM4 A;  4GR1 A;  2TPR A;  1GTE A;  5KVH A;  1EL7 A;  3DJE A;  2CUL A;  1SEZ A;  3KA7 A;  3L1R A;  1XAN A;  4NZH A;  5M10 A;  2E1M A;  2YG7 A;  2EQ8 A;  1ZP0 A;  1FL2 A;  1OJ9 A;  4A79 A;  2WS3 A;  4I58 A;  4U2S A;  3ZDN A;  3RNM A;  1OJA A;  2WBA A;  3AEB A;  3V76 A;  1GPE A;  2JK6 A;  2XFO A;  3GYJ A;  1BWC A;  4D03 A;  1LQU A;  1IUU A;  3BI2 A;  3KLJ A;  2R46 A;  4DGK A;  2X99 A;  1V59 A;  1L9D A;  2GVC A;  3NK2 X;  3ALJ A;  1PBD A;  4J2W A;  2YLS A;  3AED A;  2Y6Q A;  1GET A;  2BCP A;  2GV8 A;  1DOE A;  1E1K A;  2JB2 A;  4YSH A;  3QFB A;  3CGE A;  1CJ2 A;  1NEN A;  3AE2 A;  3SFE A;  4B69 A;  1GEU A;  3URH A;  3O0H A;  1GT8 A;  2ZBW A;  4EQX A;  4U8M A;  4JNQ A;  1XHC A;  1H7X A;  1DJQ A;  1S2Q A;  4TM0 A;  3VR8 A;  1GRH A;  4H4V A;  1CC6 A;  2WPF A;  4H4X A;  3QSE A;  5KWF A;  1BGN A;  3G5Q A;  4APN A;  1NAA A;  1YY5 A;  3GSI A;  2FJA A;  3AE3 A;  3M13 A;  2GMH A;  3AB1 A;  1IUV A;  5FS9 A;  3PS9 A;  3UKA A;  3RP6 A;  5BUK A;  3ATQ A;  1PJ7 A;  4C74 A;  1TDF A;  4K8D A;  1F6M A;  1VG0 A;  1KF6 A;  1ONF A;  1KSU A;  2GEW A;  3NYE A;  3P4R A;  1TDK A;  2CFY A;  2Q0K A;  4H4S A;  2GMJ A;  2BS2 A;  4CCR A;  5BUL A;  2C73 A;  1JRZ A;  4J57 A;  2BC0 A;  1YQ3 A;  3P4S A;  1COY A;  1Q1W A;  1TYT A;  1IJH A;  3GWF A;  3UOY A;  2C3D A;  2YG4 A;  4UDR A;  1PXA A;  2YVG A;  2IVD A;  3B6D A;  3G5R A;  3QVP A;  4J31 A;  3NK1 X;  2GQW A;  2B7S A;  3UTF A;  1Q1R A;  2C67 A;  4IA5 A;  1GER A;  4NEV A;  2XVE A;  2UZZ A;  3R9U A;  2XCG A;  2ZZ0 A;  1K0J A;  2YLT A;  4J33 A;  1FEA A;  4YWO A;  3UTG A;  3CGD A;  2EQ9 A;  2XLP A;  2VRM A;  2RGJ A;  3COX A;  2QA2 A;  4B63 A;  3UKP A;  1GRG A;  2BCG G;  1BF3 A;  4Y4M A;  1TDO A;  1H83 A;  2YG6 A;  2WQY A;  5JCM A;  2APG A;  2O9Z A;  3GDP A;  3QJ4 A;  1D4C A;  3CNJ A;  3UTH A;  2OLN A;  2V61 A;  4CNJ A;  3UKF A;  2XVH A;  4O5Q A;  4J56 A;  3ICR A;  3H8I A;  1M64 A;  1ZY8 A;  2C64 A;  3ICS A;  4U8K A;  4YTM A;  2V3B A;  4Z43 A;  3BHF A;  4CCQ A;  2YM1 A;  1E1L A;  3SM8 A;  1JNR A;  5HY5 A;  5KVI A;  2BK5 A;  5U1O A;  3DJJ A;  1LQT A;  4U2T A;  4YTP A;  2WOI A;  1XPQ A;  4H4U A;  4C5O A;  4H4T A;  5FMH A;  4A5L A;  2RGO A;  4DNA A;  4B68 A;  2RGH A;  3CND A;  2Q6U A;  3P4Q A;  1GRT A;  2J3N A;  1O5W A;  3DGH A;  3NN6 X;  1E1M A;  4YTN A;  4WCT A;  4D04 A;  2V6O A;  4GDP A;  5J60 A;  1GTH A;  5HXI A;  4Y4N A;  2V60 A;  4USQ A; 
#chains in the Genus database with same CATH topology
 1O94 A;  2AL2 B;  3CK5 A;  1MUC A;  3ZYX A;  2OPJ A;  4IZG A;  5BVA A;  3RED A;  3IC9 A;  1ZXI C;  2B9Y A;  3SN0 A;  2POD A;  3KUM A;  3RP7 A;  4NEW A;  3TW9 A;  1JDF A;  1NHP A;  4ZA0 A;  4K8G A;  1N4V A;  3AM9 A;  2X8G A;  2PMQ A;  1BKH A;  2C66 A;  3B9J B;  4EMJ A;  2HXU A;  1GSN A;  3HRD C;  1AOG A;  2BS4 A;  4DWD A;  3ADA B;  1KFY A;  4BUR A;  3NZG A;  2YM2 A;  3N4F A;  3SQP A;  3D1C A;  2C70 A;  3TOY A;  4H4P A;  2XFP A;  4NNJ A;  3FXG A;  4YSY A;  3QSM A;  1GRE A;  1H7W A;  1O95 A;  1F3P A;  2R4E A;  3LZW A;  2HNE A;  1LVL A;  3DG3 A;  4BV6 A;  4LA1 A;  4M0X A;  2GF3 A;  1GRF A;  1OJC A;  4E4U A;  1PHH A;  1EL9 A;  1SJB A;  3LXD A;  2YVJ A;  3BNM A;  3HZL A;  4NTC A;  3DFY A;  3E1T A;  3P1W A;  3VCC A;  2WEU A;  3KPK A;  3UP4 A;  3AEC A;  3R11 A;  1NEK A;  3GRT A;  4EIQ A;  3UCC A;  2GAH B;  2FBW A;  4WX1 A;  3UGV A;  1FOH A;  2FJB A;  4A7A A;  3K1G A;  5FS6 A;  3ETR B;  4H4Z A;  1CBO A;  2YLW A;  1Y56 B;  3OP2 A;  3OW1 A;  1X2H A;  5L46 A;  1NU5 A;  4JNA A;  3AEE A;  2PS2 A;  2IID A;  2XFN A;  2YR5 A;  4U2L A;  3PVC A;  1NHQ A;  5FS7 A;  2PSN A;  3BOX A;  3NVY B;  1L9C A;  2YG5 A;  4K22 A;  3PO7 A;  1TRB A;  1PBE A;  3UKH A;  1ZX9 A;  5G5H B;  2BXS A;  2PTW A;  3AE4 A;  4IA6 A;  3UOX A;  2YLZ A;  4FK1 C;  3DGB A;  3OPS A;  3T14 A;  3PK7 A;  2OO6 A;  3NRZ B;  3GDN A;  1F8S A;  5IPY A;  3S5W A;  4EM3 A;  4G6G A;  2YG3 A;  1IUX A;  4JDR A;  3AYI A;  1ZMD A;  2P3Z A;  5KOW A;  4ZCW A;  2QQ6 A;  2GRT A;  1D7L A;  5GRT A;  4E4F A;  3VCN A;  3QFA A;  2OLO A;  3FCP A;  3DG7 A;  1YKJ A;  5LV9 A;  3DK8 A;  2ONE A;  3DGZ A;  3VFC A;  1GV4 A;  5G5G B;  1ONE A;  5FS8 A;  3ZLH A;  4GGH A;  2YLX A;  3IJI A;  2AKZ A;  2H89 A;  4OPI A;  2VVL A;  1B8S A;  4TLZ A;  2ZZC A;  4M6U A;  2OZ3 A;  3L8K A;  4TM1 A;  1B4V A;  4YKG A;  5CKU A;  2F5Z A;  4ZOH B;  1GRA A;  1JRX A;  5FJU A;  4OPG A;  5JCK A;  3SJN A;  3EKG A;  3VRA A;  3BNU A;  3OC4 A;  3R1Z A;  1JRY A;  3UKL A;  3MZN A;  2C7G A;  1ZKQ A;  3P3B A;  2E3T A;  3T6C A;  1E9I A;  3CNT A;  1N4U A;  3AYJ A;  3D47 A;  2BK3 A;  5EOW A;  1MOK A;  2OAM A;  2XYO A;  4YSZ A;  2OFJ A;  1WUF A;  2FKP A;  1N61 C;  4GIS A;  1N60 C;  2XVF A;  4GFI A;  1PDZ A;  1H81 A;  1IUW A;  4GF7 A;  3SZC A;  2PGE A;  4A9W A;  4CBQ A;  3NHO X;  1KKO A;  2XLS A;  1PBF A;  2P88 A;  1ELI A;  2WPC A;  4AP1 A;  2BAB A;  3CTY A;  3FIM B;  2C75 A;  4GCM A;  2XVI A;  3H70 A;  5JCL A;  3IK4 A;  4U8N A;  4EM4 A;  1EL7 A;  1DTN A;  2CUL A;  1ZP0 A;  1FL2 A;  2WS3 A;  3ZDN A;  3RNM A;  1OJA A;  3PWI A;  3V76 A;  2JK6 A;  3GYJ A;  4D03 A;  1IUU A;  4DGK A;  4J2W A;  3SN1 A;  3N6J A;  1GT8 A;  1OEP A;  4U8M A;  1H7X A;  1DJQ A;  4IHC A;  4ENL A;  1BGN A;  3M13 A;  2GMH A;  1IUV A;  3UKA A;  3ATQ A;  1F6M A;  2QJM A;  5BOE A;  2Q0K A;  2GMJ A;  5BUL A;  4G7F A;  3PFR A;  2BC0 A;  1COY A;  1IJH A;  2PP1 A;  3UTF A;  2ZZ0 A;  3TJI A;  4J33 A;  1FEA A;  4G74 A;  3CGD A;  2XLP A;  4B63 A;  1BF3 A;  3FYY A;  2YG6 A;  3A7A A;  2WQY A;  3GDP A;  3QJ4 A;  3CNJ A;  3UTH A;  1JPM A;  4CNJ A;  3RCY A;  3I6T A;  3SZ0 A;  3H8I A;  3ICS A;  2V3B A;  3BHF A;  3DEQ A;  1JNR A;  5KVI A;  3DJJ A;  1LQT A;  4YTP A;  2WOI A;  2XH4 A;  4H4U A;  4H4T A;  4DNA A;  2RGH A;  2J3N A;  4HYR A;  4D04 A;  2V6O A;  5J60 A;  1GTH A;  1VDC A;  3RO6 A;  3FJ4 A;  3C4A A;  3N4E A;  4U8I A;  1DOB A;  4ROP A;  1LTX R;  3Q45 A;  3C96 A;  4K1W A;  2OA1 A;  4AOX A;  4C77 A;  1CC2 A;  3CPI G;  2VQ7 A;  1WUE A;  1PXC A;  2ARD A;  3K7M X;  4NTD A;  3ISH A;  3JW7 A;  1F8W A;  3V3O A;  3F8R A;  2GR0 A;  4Z1Y A;  4Z26 A;  3VA8 A;  3SSZ A;  1NDA A;  3GY1 A;  3NVV B;  1S2Y A;  3FMW A;  4OPT A;  3DK4 A;  1BKW A;  4K7Z A;  3NT6 A;  1DNC A;  2FJE A;  4E5T A;  5U63 A;  1FEB A;  1KKR A;  2OZ8 A;  4EQR A;  3TJ4 A;  2QA1 A;  1DOD A;  4H2R A;  3I6E A;  1QLB A;  3B97 A;  4JQ9 A;  4ICY A;  3CB3 A;  4A65 A;  3SR6 B;  3NK0 X;  2PU0 A;  1VRQ B;  3AE9 A;  4Z44 A;  4H50 A;  3KVE A;  1YEY A;  4CY8 A;  4CY6 A;  4RG4 A;  5J7X A;  1X2G A;  4ECH A;  2R45 A;  3FBS A;  3UP5 A;  3DDM A;  1Q9I A;  5C3J A;  4AOS A;  3ALL A;  3OZM A;  4J34 A;  4II3 A;  1CC4 A;  2EQ6 A;  4H2H A;  1NG3 A;  1PS9 A;  2ZAD A;  2DW6 A;  1PN0 A;  5IDZ A;  3NS1 B;  1EL5 A;  4JHM A;  1TDN A;  4KPR A;  3P93 A;  4USR A;  2BXR A;  1ZMC A;  2PTX A;  4EIP A;  3H12 A;  4TLX A;  3B3R A;  3DIP A;  4P9S A;  5KRQ A;  4EQS A;  3OZ2 A;  4H4W A;  3Q4D A;  1EBD A;  1TYP A;  3T37 A;  4H2P A;  1D5T A;  3HW2 A;  3CPJ G;  4KX6 A;  4IVO B;  3QSS A;  3NKS A;  1L9E A;  3QPE A;  3DES A;  2OX4 A;  3S5S A;  3SXI A;  1RYI A;  2IVE A;  4JY3 A;  1D4D A;  5GSN A;  4K5R A;  4ZCD A;  3KD9 A;  3A7R A;  4Z25 A;  2R0P A;  1PJ5 A;  4FK1 A;  5ER0 A;  3ABV A;  3NG7 X;  3T2Z A;  4HB9 A;  1CF3 A;  2BAC A;  1FHV A;  3VC6 A;  2Q7V A;  1ZK7 A;  3V5C A;  3AE1 A;  1XS2 A;  4HCL A;  1Y56 A;  2BA9 A;  5ENL A;  1YQZ A;  3T31 A;  3AEA A;  1FO4 A;  2BYB A;  3V5F A;  3I3L A;  3UOV A;  1PJ6 A;  2ZZB A;  2DKI A;  3ATR A;  4Z2U A;  1EC9 A;  2A89 A;  3UKK A;  4Z17 A;  5KNL A;  3MWC A;  2YVF A;  3TWB A;  4F4R A;  1GOS A;  2WET A;  1MXT A;  2HXT A;  2XVJ A;  1DOC A;  1E6E A;  3NYC A;  4G9K A;  3RIT A;  1EBG A;  3DFH A;  1CHU A;  3T2K A;  1TDE A;  4FX9 A;  2X8H A;  2GR3 A;  3QN3 A;  4LII A;  2WU5 A;  4FI4 A;  2GDQ A;  1R0M A;  2PCE A;  3LOV A;  3SGL A;  3SBF A;  4GME A;  3GMC A;  2VOU A;  3NGC X;  3T9P A;  5IQ4 A;  2BS3 A;  2PTY A;  1IUS A;  1CJ3 A;  3IF9 A;  4U8P A;  3UOZ A;  1EC8 A;  1PBC A;  2O56 A;  3SN4 A;  4EMW A;  2WDQ A;  3BI4 A;  4EMI A;  4PAA A;  3ES7 A;  1H82 A;  1SB3 B;  4XWZ A;  3DJG X;  2XLT A;  3UJF A;  2JBV A;  2OZT A;  3R0U A;  3FVD A;  4C3Y A;  3IWA A;  4HPN A;  2V5Z A;  2W0H A;  3UCL A;  1Y0P A;  3K30 A;  3SZF A;  1TKK A;  1GTE A;  3IJQ A;  5FJR A;  1SJC A;  3L1R A;  2YG7 A;  2EQ8 A;  2CHR A;  3QTP A;  3AEB A;  3H7V A;  1BWC A;  4E6M A;  1L9D A;  3NK2 X;  1PBD A;  2E5A A;  4B69 A;  1GEU A;  4GYP C;  3URH A;  1N62 C;  4IL2 A;  1S2Q A;  4HCH A;  3VR8 A;  1GRH A;  1STZ A;  2FJA A;  3AE3 A;  5FS9 A;  1TDF A;  1VG0 A;  4H4S A;  4A6G A;  1JRZ A;  1YQ3 A;  3P4S A;  3D9X A;  3UOY A;  1N63 C;  4EWJ A;  3NK1 X;  2C67 A;  4IA5 A;  4NEV A;  2ZC8 A;  5FJT A;  2EQ9 A;  4TVY A;  2BCG G;  1TDO A;  1H83 A;  3UJE A;  2OLN A;  2W55 A;  2V61 A;  4DXK A;  2C64 A;  4Z43 A;  4CCQ A;  1E1L A;  3SM8 A;  2BK5 A;  5FMH A;  1R6W A;  4B68 A;  2Q6U A;  5HXI A;  3MY9 A;  4IP4 A;  2V60 A;  4USQ A;  1ZOY A;  3AMZ A;  4N9X A;  3F8D A;  2PYX A;  4OPC A;  2ACZ A;  2B9X A;  3V3N A;  1EC7 A;  3VR9 A;  3NNE A;  1FEC A;  2VVL G;  3EAO A;  3CNP A;  1MDR A;  2JB3 A;  1E7P A;  1JU2 A;  3AE8 A;  4XXG A;  1H84 A;  1KCZ A;  2XH7 A;  1L8P A;  3JZU A;  5KMR A;  3M0O A;  4BK3 A;  2P8C A;  1S7M A;  1DJN A;  3LB8 A;  4ZCC A;  3AYL A;  1GRB A;  3F8P A;  4DSG A;  3R07 C;  4KPL A;  2XFQ A;  2JB1 A;  1M6I A;  2WU2 A;  3CPH G;  1V97 A;  5EB5 A;  4OPD A;  4NWZ A;  2C72 A;  4UDQ A;  4K5S A;  3TTE A;  3II4 A;  5BRT A;  7ENL A;  1EL8 A;  4Z24 A;  4CNK A;  2XLR A;  3NO1 A;  5IQ1 A;  4IL0 A;  1KNR A;  3P0W A;  1CL0 A;  3S47 A;  4U8O A;  2X3N A;  1KSS A;  2XFU A;  1JOA A;  5EBK A;  2XGZ A;  1JRO A;  4X9N A;  1IUT A;  1JPD X;  4TM4 A;  1D4E A;  3AWI A;  3UJR A;  2PGW A;  1PBB A;  1W6T A;  1ECQ A;  4UP3 A;  2GGH A;  1D7Y A;  2A87 A;  2P8B A;  1HYU A;  1OJD A;  2OQH A;  4G8T A;  2AQJ A;  4HNL A;  2PP0 A;  3ITJ A;  2JKC A;  3R25 A;  2Y6R A;  3NVW B;  3TCS A;  3AE7 A;  1ZDL A;  4NTE A;  1JEH A;  1Z6L A;  3AXB A;  4YXD A;  2DW7 A;  2WDR A;  1P2E A;  6ENL A;  1QO8 A;  1E1N A;  2WP5 A;  3T2Y A;  2EQ7 A;  2QAE A;  3BJS A;  3BI5 A;  4B64 A;  4IVM B;  4HA6 A;  4ZN0 A;  2OG9 A;  5HHF A;  2C65 A;  5JCI A;  3CAW A;  4A99 A;  1F9C A;  3V4B A;  3UJS A;  3NH3 X;  3NLC A;  3RHA A;  2WHD A;  2DKH A;  3DH9 A;  3H8L A;  2GB0 A;  4H2N A;  2OLA A;  1E39 A;  1PDY A;  3RGT A;  1JRP A;  4Z2T A;  3HPF A;  2PTZ A;  3M12 A;  5KMS A;  3AE5 A;  5EB4 A;  3VRB A;  3G5S A;  1ELS A;  2XSX A;  1H86 A;  1LV0 A;  1BQG A;  1PDH A;  1H6V A;  3DME A;  1X31 B;  1K4Q A;  3ICT A;  3ZVI A;  4HN8 A;  2YQU A;  4H2Q A;  4OCG A;  2C3C A;  4J36 A;  2QJJ A;  1GXF A;  1K0L A;  4G6H A;  1B5Q A;  1MO9 A;  2AKM A;  2Q0L A;  3AD7 B;  2GH5 A;  5JCN A;  1RVK A;  4B67 A;  1MNS A;  2GSH A;  3Q6J A;  1S3E A;  3L5O A;  2WDV A;  3NVZ B;  4LU6 A;  3DG6 A;  3EF6 A;  4BK1 A;  4UDP A;  4K2X A;  3WE0 A;  1KDG A;  1LJ1 A;  3T8Q A;  2R0G A;  3I6D A;  3DER A;  4IV9 A;  3QKE A;  2XH2 A;  5KXJ A;  1NG4 A;  1CJ4 A;  2QGY A;  4YKF A;  2E4G A;  4AP3 A;  3IHM A;  4AT2 A;  4J3Z A;  2OAL A;  1KD0 A;  4X4J A;  2GL5 A;  4DHG A;  3P9U A;  4MJW A;  4BJY A;  4BK2 A;  1FFV C;  3KKJ A;  4GRT A;  3AE6 A;  3MUC A;  3IHG A;  3FPZ A;  3GD4 A;  1B37 A;  4HCD A;  3UCD A;  2FYM A;  4A3R A;  3AEF A;  2B9W A;  2GAG B;  4OPL A;  3RR1 A;  2P0I A;  3VC5 A;  1KN0 A;  3DJE A;  3KA7 A;  4NZH A;  1XAN A;  2E1M A;  1OJ9 A;  2WBA A;  2XFO A;  3SY4 A;  1LQU A;  3KLJ A;  3VDG A;  2R46 A;  2X99 A;  1V59 A;  3ALJ A;  3AED A;  2Y6Q A;  1P43 A;  1E1K A;  3QFB A;  3CGE A;  1CJ2 A;  1NEN A;  3AE2 A;  3ZLG A;  1T3Q C;  3O0H A;  3EEZ A;  4EQX A;  3A7U A;  1XHC A;  5KMP A;  3STP A;  2WPF A;  3PG6 A;  3AB1 A;  3PS9 A;  3RP6 A;  5BUK A;  4C74 A;  4K8D A;  3OTR A;  1ONF A;  1KF6 A;  1KSU A;  2GEW A;  4GYP A;  3P4R A;  1TDK A;  3ZVH A;  2C73 A;  1SJD A;  4II2 A;  1TYT A;  2W3S A;  2C3D A;  2YG4 A;  1PXA A;  4GAV A;  3B6D A;  3BSM A;  2GQW A;  4YWS A;  2XVE A;  2XCG A;  2BRY A;  2YLT A;  2VRM A;  2RGJ A;  2QA2 A;  2BRA A;  3TQP A;  4Y4M A;  5JCM A;  2APG A;  4H19 A;  2O9Z A;  3U9I A;  1D4C A;  3MKC A;  4JN7 A;  3UKF A;  4O5Q A;  4U8K A;  4YTM A;  2OVL A;  3ZLF A;  5U1O A;  4U2T A;  3ZVH B;  1MDL A;  2RGO A;  2QVH A;  3CND A;  3P4Q A;  1GRT A;  1O5W A;  3DGH A;  4YTN A;  4WCT A;  5BOF A;  2MUC A;  4Y4N A;  3EUB 3;  2QCU A;  3D8X A;  1XDI A;  4MMW A;  5FJO A;  3UXK A;  3MSY A;  4OVI A;  1F8R A;  3AEG A;  4Y4L A;  2RDX A;  4U8L A;  2PA6 A;  2R9Z A;  1TE6 A;  4H4Q A;  3UTE A;  4HNC A;  4E0V A;  4B66 A;  2I5Q A;  2GGI A;  3AD8 B;  1L0V A;  3P4P A;  1GES A;  1OJT A;  3THU A;  4CRT A;  4TM3 A;  3NN0 X;  2WOV A;  4DN1 A;  3VRD B;  4YT0 A;  4RSL A;  4MKS A;  2XLU A;  4U8J A;  3IJL A;  2YWL A;  1NPX A;  2PU1 A;  3GRS A;  1N5W C;  2MNR A;  3AD9 B;  1EBH A;  2R4J A;  1NHS A;  2YR4 A;  2POZ A;  3SFD A;  3DK9 A;  4GGB A;  1CJC A;  3NTD A;  1RP0 A;  2NVK X;  1RM6 B;  3MQT A;  1BGJ A;  4DSH A;  3R0K A;  4TVW A;  2OQY A;  3V3W A;  3CMM A;  2PP3 A;  4MGG A;  3R10 A;  2VVM A;  1SJA A;  2QDD A;  3UJ2 A;  3NIX A;  2HQM A;  1MRA A;  3JSK A;  2VRL A;  4YSX A;  4M52 A;  3NFU A;  5DBJ A;  3TWA A;  4GDE A;  3S61 A;  2GR2 A;  2Z5Y A;  4B65 A;  3UXL A;  2AAQ A;  3ES8 A;  4GIR A;  4H1Z A;  3KU9 A;  2X8C A;  4H4R A;  3SQS A;  1QJD A;  5KMQ A;  4EQW A;  4A35 A;  1N4W A;  4FDC B;  2XDO A;  5KOX A;  3OZY A;  1REO A;  2I0Z A;  5EU9 A;  3GYX A;  2GGE A;  2C4C A;  1RSG A;  3H4K A;  1K0I A;  2HZG A;  2B7R A;  2GR1 A;  2CVJ A;  3Q9T A;  2WOW A;  3K7Q X;  3EPT A;  2X50 A;  3FG2 P;  3RP8 A;  2VZ2 A;  1PXB A;  2R0C A;  4GAP A;  1GND A;  3GD3 A;  4GUV A;  4REK A;  2PPG A;  4Z2R A;  3CGC A;  4ADW A;  4A6N A;  1N1P A;  2OKT A;  2PHH A;  3QVR A;  4O5U A;  1BZL A;  2GGJ A;  5FJP A;  3VQR A;  4BJZ A;  2NPX A;  2AR8 A;  5TR3 A;  1IYX A;  1YQ4 A;  3CT2 A;  1JNZ A;  4I59 A;  3CYJ A;  2GQF A;  4RG3 A;  4KEM A;  4JN9 A;  2RAB A;  2W3R A;  2TMD A;  2H88 A;  4X2P A;  1GAL A;  1VQZ A;  4A6N B;  4XWR A;  3KPF A;  4J1O A;  3NRN A;  3JVA A;  1ZOV A;  5M0Z A;  3FV9 A;  2XH0 A;  3HYV A;  1KNP A;  3PWG A;  5JRB A;  3UKQ A;  1P2H A;  4PAB A;  5CQF A;  3GYI A;  3CNS A;  2WES A;  3CXB A;  3NTA A;  3BHK A;  2BC1 A;  3DJD A;  3SX6 A;  3N6H A;  5U25 A;  1H2I A;  1FCD A;  1P48 A;  3DA1 A;  4B1B A;  3T0K A;  1NHR A;  1DXL A;  2V3A A;  3SZW A;  2YR6 A;  3D46 A;  2WPE A;  2YAU A;  3LAD A;  2W54 A;  3NYF A;  3CIR A;  3GWD A;  3NXL A;  2E5V A;  1S3B A;  2NQL A;  4JY2 A;  2C76 A;  2WP6 A;  4H7U A;  4X9M A;  2Z5X A;  3C4N A;  3GC2 A;  2JAE A;  1VDV A;  2FJD A;  3AN1 A;  1VQW A;  4FP1 A;  4AT0 A;  4H83 A;  2VQB A;  3GMB A;  3ALM A;  4H4Y A;  1W4X A;  2BK4 A;  1LPF A;  2CDU A;  2B76 A;  1VG9 A;  2YLR A;  3LJP A;  3EAN A;  4C3X A;  3K7T A;  3CN8 A;  1UKV G;  4OPU A;  3CGB A;  1WYG A;  5C2T A;  2QJN A;  3LZX A;  5HYM A;  3HYX A;  2WP9 A;  4IP5 A;  2A8X A;  4GR1 A;  2TPR A;  5KVH A;  3I4K A;  1SEZ A;  5M10 A;  4A79 A;  4K2S A;  4U2S A;  4I58 A;  1GPE A;  3BI2 A;  2QDE A;  4DYE A;  2GVC A;  1FHU A;  4JN8 A;  2AL1 A;  2YLS A;  1GET A;  1XPY A;  2BCP A;  2GV8 A;  1DOE A;  2JB2 A;  4YSH A;  3GO2 A;  3SFE A;  4E8G A;  1JCT A;  2ZBW A;  1TZZ A;  4JNQ A;  1FIQ B;  4TM0 A;  5J04 A;  3RRA A;  4H4V A;  1CC6 A;  4H4X A;  3QSE A;  5KWF A;  3HYW A;  3G5Q A;  4APN A;  1NAA A;  1YY5 A;  3GSI A;  1FFU C;  3QLD A;  1PJ7 A;  3GD6 A;  3NYE A;  2CFY A;  2BS2 A;  4CCR A;  3T4W A;  4J57 A;  1Q1W A;  3GWF A;  4KWS A;  4UDR A;  2YVG A;  3CXO A;  2IVD A;  3G5R A;  3QVP A;  4J31 A;  3ENL A;  2B7S A;  1Q1R A;  1GER A;  2UZZ A;  2AL2 A;  4KT2 A;  1NEL A;  3R9U A;  3H8A A;  1K0J A;  4YWO A;  3UTG A;  2GGG A;  3COX A;  3UKP A;  1GRG A;  3U4F A;  4IT1 A;  1N5X A;  2XVH A;  4J56 A;  3ICR A;  1M64 A;  1ZY8 A;  2YM1 A;  5HY5 A;  1XPQ A;  4DX3 A;  3SYI A;  4C5O A;  4A5L A;  3NN6 X;  1E1M A;  4GDP A;  4G73 A; 
#chains in the Genus database with same CATH homology
 1O94 A;  1VDC A;  1ZOY A;  3ZYX A;  2QCU A;  3D8X A;  1XDI A;  3C4A A;  4U8I A;  1DOB A;  1LTX R;  5BVA A;  3RED A;  3C96 A;  4OVI A;  3IC9 A;  4N9X A;  2OA1 A;  2B9Y A;  1F8R A;  3F8D A;  3AEG A;  2PYX A;  4Y4L A;  4AOX A;  4OPC A;  4U8L A;  1CC2 A;  2ACZ A;  4C77 A;  2R9Z A;  2B9X A;  3V3N A;  3CPI G;  2VQ7 A;  1PXC A;  4H4Q A;  4NEW A;  2ARD A;  3K7M X;  3RP7 A;  3UTE A;  4NTD A;  1NHP A;  3VR9 A;  3ISH A;  3NNE A;  4E0V A;  1F8W A;  4B66 A;  1FEC A;  2VVL G;  3V3O A;  3EAO A;  1N4V A;  3CNP A;  3AD8 B;  1L0V A;  2JB3 A;  2GR0 A;  3F8R A;  3P4P A;  1GES A;  1OJT A;  2X8G A;  1E7P A;  1JU2 A;  2C66 A;  3AE8 A;  4XXG A;  4CRT A;  4Z26 A;  4TM3 A;  4EMJ A;  1H84 A;  3NN0 X;  1NDA A;  1GSN A;  1S2Y A;  5KMR A;  2WOV A;  1AOG A;  2BS4 A;  3FMW A;  4OPT A;  3VRD B;  3ADA B;  1KFY A;  3DK4 A;  1BKW A;  4BUR A;  3M0O A;  2YM2 A;  4K7Z A;  4YT0 A;  4BK3 A;  3SQP A;  3D1C A;  3NT6 A;  4RSL A;  2C70 A;  2XLU A;  4H4P A;  2XFP A;  1DNC A;  1S7M A;  1DJN A;  4NNJ A;  3LB8 A;  4U8J A;  4ZCC A;  3AYL A;  2FJE A;  5U63 A;  1GRB A;  3F8P A;  1FEB A;  2YWL A;  1NPX A;  4YSY A;  3QSM A;  4EQR A;  3GRS A;  4DSG A;  1GRE A;  1H7W A;  1O95 A;  1F3P A;  2QA1 A;  2R4E A;  1DOD A;  3LZW A;  4H2R A;  2XFQ A;  3AD9 B;  1LVL A;  1QLB A;  2JB1 A;  2R4J A;  1NHS A;  4BV6 A;  2YR4 A;  3SFD A;  1M6I A;  3DK9 A;  4LA1 A;  4JQ9 A;  1CJC A;  2WU2 A;  2GF3 A;  1GRF A;  3NTD A;  1RP0 A;  4ICY A;  3CPH G;  2NVK X;  1OJC A;  1BGJ A;  1PHH A;  1EL9 A;  5EB5 A;  4A65 A;  3LXD A;  3NK0 X;  2YVJ A;  3BNM A;  3HZL A;  4NTC A;  1VRQ B;  4NWZ A;  4OPD A;  3E1T A;  2C72 A;  4UDQ A;  3P1W A;  4K5S A;  4DSH A;  3AE9 A;  4Z44 A;  4H50 A;  3II4 A;  5BRT A;  3KVE A;  2WEU A;  3KPK A;  3UP4 A;  3AEC A;  1EL8 A;  1NEK A;  3CMM A;  4CY8 A;  4CY6 A;  4Z24 A;  4CNK A;  2XLR A;  2VVM A;  4RG4 A;  3GRT A;  5J7X A;  4EIQ A;  3NIX A;  5IQ1 A;  2HQM A;  3JSK A;  2R45 A;  4ECH A;  3FBS A;  1KNR A;  1CL0 A;  3UP5 A;  2VRL A;  1Q9I A;  5C3J A;  4AOS A;  3ALL A;  4J34 A;  4II3 A;  4M52 A;  1CC4 A;  2EQ6 A;  2X3N A;  4U8O A;  1KSS A;  2XFU A;  5DBJ A;  2GAH B;  2FBW A;  4GDE A;  1JOA A;  4WX1 A;  3S61 A;  1NG3 A;  2GR2 A;  5EBK A;  1PS9 A;  4X9N A;  1IUT A;  1FOH A;  2Z5Y A;  4B65 A;  2FJB A;  4A7A A;  4TM4 A;  1D4E A;  2AAQ A;  1PN0 A;  3AWI A;  5FS6 A;  3KU9 A;  4H4Z A;  1CBO A;  2X8C A;  1PBB A;  1EL5 A;  2YLW A;  4H4R A;  4UP3 A;  1D7Y A;  2A87 A;  1TDN A;  4KPR A;  1QJD A;  1Y56 B;  5L46 A;  1HYU A;  4USR A;  2BXR A;  5KMQ A;  4JNA A;  1ZMC A;  4EIP A;  4EQW A;  1OJD A;  3AEE A;  2IID A;  2AQJ A;  2XFN A;  1N4W A;  2YR5 A;  4FDC B;  3ITJ A;  2XDO A;  4TLX A;  2JKC A;  3B3R A;  4U2L A;  5KOX A;  3PVC A;  1NHQ A;  2Y6R A;  5FS7 A;  4P9S A;  1REO A;  2I0Z A;  3AE7 A;  5KRQ A;  1L9C A;  1ZDL A;  4NTE A;  4EQS A;  1JEH A;  1Z6L A;  2YG5 A;  3OZ2 A;  4K22 A;  3GYX A;  3PO7 A;  2C4C A;  1RSG A;  3H4K A;  1TRB A;  3AXB A;  4YXD A;  4H4W A;  2WDR A;  1P2E A;  1K0I A;  1EBD A;  1TYP A;  3T37 A;  2B7R A;  4H2P A;  1PBE A;  2GR1 A;  1QO8 A;  3UKH A;  1E1N A;  2WP5 A;  2CVJ A;  1D5T A;  1ZX9 A;  3Q9T A;  2WOW A;  3T2Y A;  2EQ7 A;  3K7Q X;  2QAE A;  3CPJ G;  2X50 A;  2BXS A;  3BI5 A;  3EPT A;  3FG2 P;  4B64 A;  4KX6 A;  3RP8 A;  4IVM B;  4HA6 A;  4IVO B;  4ZN0 A;  3QSS A;  3AE4 A;  1L9E A;  2VZ2 A;  1PXB A;  2R0C A;  3NKS A;  5HHF A;  2C65 A;  4GAP A;  1GND A;  4IA6 A;  3UOX A;  2YLZ A;  4FK1 C;  3GD3 A;  4GUV A;  5JCI A;  4REK A;  4Z2R A;  3CGC A;  4ADW A;  3T14 A;  4A6N A;  3SXI A;  1N1P A;  4A99 A;  3GDN A;  1F8S A;  1RYI A;  2PHH A;  5IPY A;  2IVE A;  3S5W A;  3NH3 X;  4EM3 A;  3QVR A;  3NLC A;  4JY3 A;  4G6G A;  1D4D A;  5GSN A;  3RHA A;  4K5R A;  2YG3 A;  2WHD A;  1IUX A;  4O5U A;  4ZCD A;  1BZL A;  4JDR A;  3KD9 A;  2DKH A;  3DH9 A;  3AYI A;  3H8L A;  1ZMD A;  4Z25 A;  2R0P A;  1PJ5 A;  4FK1 A;  5ER0 A;  2GB0 A;  4H2N A;  3VQR A;  3ABV A;  4BJZ A;  3NG7 X;  5KOW A;  3T2Z A;  1E39 A;  2NPX A;  4HB9 A;  2GRT A;  1D7L A;  2AR8 A;  5TR3 A;  4Z2T A;  1CF3 A;  5GRT A;  1YQ4 A;  3M12 A;  5KMS A;  3AE5 A;  5EB4 A;  3QFA A;  3VRB A;  2OLO A;  3G5S A;  1JNZ A;  4I59 A;  1YKJ A;  1H86 A;  1LV0 A;  2GQF A;  5LV9 A;  2BAC A;  1PDH A;  4RG3 A;  2Q7V A;  3DK8 A;  4JN9 A;  1ZK7 A;  2RAB A;  3DGZ A;  3AE1 A;  1GV4 A;  1H6V A;  1Y56 A;  3DME A;  2BA9 A;  2H88 A;  2TMD A;  1X31 B;  5FS8 A;  1GAL A;  1K4Q A;  1YQZ A;  3ICT A;  3T31 A;  3AEA A;  2BYB A;  3UOV A;  3I3L A;  4A6N B;  4XWR A;  2YQU A;  1PJ6 A;  2ZZB A;  2YLX A;  3KPF A;  4H2Q A;  3NRN A;  4OCG A;  2C3C A;  1ZOV A;  2DKI A;  3ATR A;  4J36 A;  5M0Z A;  1GXF A;  4Z2U A;  2H89 A;  3HYV A;  1K0L A;  4G6H A;  1B5Q A;  1KNP A;  4OPI A;  2VVL A;  1MO9 A;  1B8S A;  5JRB A;  4TLZ A;  3UKQ A;  2ZZC A;  1P2H A;  2Q0L A;  4PAB A;  5CQF A;  3GYI A;  4TM1 A;  3L8K A;  3CNS A;  1B4V A;  2WES A;  4YKG A;  5CKU A;  3AD7 B;  2F5Z A;  2A89 A;  2GH5 A;  3UKK A;  3NTA A;  5KNL A;  2YVF A;  5JCN A;  3BHK A;  1GRA A;  2BC1 A;  3DJD A;  3SX6 A;  5U25 A;  1JRX A;  4B67 A;  1H2I A;  1FCD A;  3Q6J A;  4OPG A;  1S3E A;  5JCK A;  3L5O A;  3DA1 A;  4B1B A;  1GOS A;  3VRA A;  3T0K A;  1NHR A;  2WET A;  3BNU A;  1MXT A;  3OC4 A;  2WDV A;  4LU6 A;  1JRY A;  2XVJ A;  3EF6 A;  1DXL A;  1DOC A;  4BK1 A;  4UDP A;  3UKL A;  1E6E A;  3NYC A;  4G9K A;  2V3A A;  2C7G A;  3SZW A;  2YR6 A;  1ZKQ A;  4K2X A;  2WPE A;  3WE0 A;  2YAU A;  1KDG A;  1CHU A;  3T2K A;  1LJ1 A;  1TDE A;  2R0G A;  3LAD A;  4FX9 A;  2X8H A;  3NYF A;  3CIR A;  3GWD A;  2E5V A;  3I6D A;  1S3B A;  4JY2 A;  4YSX A;  2C76 A;  4IV9 A;  2GR3 A;  2WP6 A;  4LII A;  2WU5 A;  5KXJ A;  3CNT A;  4H7U A;  1N4U A;  3AYJ A;  1NG4 A;  4X9M A;  1CJ4 A;  2Z5X A;  3C4N A;  2BK3 A;  5EOW A;  2JAE A;  2FJD A;  1MOK A;  3LOV A;  2OAM A;  3SGL A;  2XYO A;  4YSZ A;  1VQW A;  3GMC A;  2VOU A;  3NGC X;  4YKF A;  2E4G A;  4AT0 A;  2VQB A;  5IQ4 A;  3GMB A;  2BS3 A;  4AP3 A;  1CJ3 A;  4H4Y A;  1IUS A;  3ALM A;  3IF9 A;  1W4X A;  3IHM A;  2BK4 A;  4U8P A;  1LPF A;  4AT2 A;  2OAL A;  3UOZ A;  2CDU A;  2XVF A;  1H81 A;  1PBC A;  2B76 A;  2WDQ A;  4EMW A;  1IUW A;  1VG9 A;  3BI4 A;  2YLR A;  3LJP A;  4GF7 A;  3EAN A;  4C3X A;  4X4J A;  4EMI A;  3K7T A;  3CN8 A;  4PAA A;  3SZC A;  3P9U A;  4MJW A;  1H82 A;  1UKV G;  4BJY A;  4BK2 A;  4A9W A;  4CBQ A;  3NHO X;  3KKJ A;  4GRT A;  3AE6 A;  4XWZ A;  4OPU A;  3CGB A;  5C2T A;  3DJG X;  2XLT A;  1PBF A;  2XLS A;  3IHG A;  2JBV A;  3FPZ A;  3GD4 A;  1B37 A;  2WPC A;  1ELI A;  4C3Y A;  3IWA A;  2V5Z A;  3LZX A;  4AP1 A;  2BAB A;  3AEF A;  3CTY A;  2B9W A;  3FIM B;  2C75 A;  2W0H A;  4GCM A;  3UCL A;  2XVI A;  3HYX A;  5JCL A;  2WP9 A;  5HYM A;  1Y0P A;  2GAG B;  3K30 A;  3SZF A;  4OPL A;  4U8N A;  2A8X A;  4EM4 A;  4GR1 A;  1GTE A;  2TPR A;  5KVH A;  1KN0 A;  1EL7 A;  3DJE A;  2CUL A;  1SEZ A;  3KA7 A;  3L1R A;  1XAN A;  4NZH A;  5M10 A;  2E1M A;  2YG7 A;  2EQ8 A;  1ZP0 A;  1FL2 A;  1OJ9 A;  4A79 A;  2WS3 A;  4I58 A;  4U2S A;  3ZDN A;  3RNM A;  1OJA A;  2WBA A;  3AEB A;  3V76 A;  1GPE A;  2JK6 A;  2XFO A;  3GYJ A;  1BWC A;  3SY4 A;  1LQU A;  4D03 A;  1IUU A;  3BI2 A;  3KLJ A;  2R46 A;  4DGK A;  2X99 A;  1V59 A;  1L9D A;  2GVC A;  3NK2 X;  3ALJ A;  1PBD A;  4J2W A;  2YLS A;  3AED A;  2Y6Q A;  1GET A;  2BCP A;  2GV8 A;  1DOE A;  1E1K A;  2JB2 A;  4YSH A;  3QFB A;  3CGE A;  1CJ2 A;  1NEN A;  3AE2 A;  3SFE A;  4B69 A;  1GEU A;  3URH A;  3O0H A;  1GT8 A;  2ZBW A;  4EQX A;  4U8M A;  4JNQ A;  1XHC A;  5KMP A;  1H7X A;  1DJQ A;  1S2Q A;  4TM0 A;  3VR8 A;  1GRH A;  4H4V A;  1CC6 A;  2WPF A;  4H4X A;  3QSE A;  5KWF A;  1BGN A;  3HYW A;  3G5Q A;  4APN A;  1NAA A;  1YY5 A;  3GSI A;  2FJA A;  3AE3 A;  3M13 A;  2GMH A;  3PG6 A;  1IUV A;  3AB1 A;  5FS9 A;  3PS9 A;  3UKA A;  3RP6 A;  5BUK A;  3ATQ A;  1PJ7 A;  4C74 A;  1TDF A;  4K8D A;  1F6M A;  1VG0 A;  1KF6 A;  1ONF A;  1KSU A;  2GEW A;  3NYE A;  3P4R A;  1TDK A;  2CFY A;  2Q0K A;  4H4S A;  2GMJ A;  2BS2 A;  4CCR A;  5BUL A;  2C73 A;  1JRZ A;  4J57 A;  4II2 A;  2BC0 A;  1YQ3 A;  3P4S A;  3D9X A;  1COY A;  1Q1W A;  1TYT A;  1IJH A;  3GWF A;  3UOY A;  2C3D A;  2YG4 A;  4UDR A;  1PXA A;  2YVG A;  4GAV A;  2IVD A;  3B6D A;  3G5R A;  3QVP A;  4J31 A;  3NK1 X;  2GQW A;  2B7S A;  3UTF A;  1Q1R A;  2C67 A;  4IA5 A;  1GER A;  4NEV A;  2XVE A;  2UZZ A;  3R9U A;  2XCG A;  2BRY A;  2ZZ0 A;  1K0J A;  2YLT A;  4J33 A;  1FEA A;  4G74 A;  4YWO A;  3UTG A;  3CGD A;  2EQ9 A;  2XLP A;  2VRM A;  2RGJ A;  3COX A;  2QA2 A;  4B63 A;  2BRA A;  3UKP A;  1GRG A;  2BCG G;  1BF3 A;  4Y4M A;  1TDO A;  1H83 A;  2YG6 A;  2WQY A;  5JCM A;  2APG A;  2O9Z A;  3GDP A;  3QJ4 A;  1D4C A;  3CNJ A;  3UTH A;  2OLN A;  2V61 A;  4CNJ A;  3UKF A;  2XVH A;  4O5Q A;  4J56 A;  3ICR A;  3SZ0 A;  3H8I A;  1M64 A;  1ZY8 A;  2C64 A;  3ICS A;  4U8K A;  4YTM A;  2V3B A;  4Z43 A;  3BHF A;  4CCQ A;  2YM1 A;  1E1L A;  3SM8 A;  1JNR A;  5HY5 A;  5KVI A;  2BK5 A;  5U1O A;  3DJJ A;  1LQT A;  4U2T A;  4YTP A;  2WOI A;  1XPQ A;  4H4U A;  3SYI A;  4C5O A;  4H4T A;  5FMH A;  4A5L A;  2RGO A;  4DNA A;  4B68 A;  2RGH A;  3CND A;  2Q6U A;  3P4Q A;  1GRT A;  2J3N A;  1O5W A;  3DGH A;  3NN6 X;  1E1M A;  4YTN A;  4WCT A;  4D04 A;  2V6O A;  4GDP A;  5J60 A;  1GTH A;  5HXI A;  4Y4N A;  4G73 A;  2V60 A;  4USQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...