4JN7A

Crystal structure of an enolase (putative galactarate dehydratase, target efi-500740) from agrobacterium radiobacter, bound na and l-malate, ordered active site
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
395
structure length
395
Chain Sequence
MKIDRMRVFMTRDKDRPRVIVALDTDDGLTGWGECYNHGPDKALPPILDYLYGFLSGQDPTRIDYLVNLLIQQSRFPPGALGLSAISALDHCLWDLSAKAANVPVYKLLGGAVRDRVKVYAGVYTAPDAPAARDEFDRLNAEWGFTAFKLSPWRVDIHAHRWGNVVKASADYFRSLRETVRDDYEIAFDAHAQIFEPVAARQLGNALAPYDPLFYEEPLRPENIDMWGDLKQGLNCVLATGESLYNRNEFLRLLQVKGADLIQPDICVVGGISEMRRIATLAEAYFVGVAPHNPMGPLATAVNVHFSAATQNFRILEYRLPKGQAYVYGGKDIEKRQGETRYVVDPYLPKDGYLELRPDRPGWGVEMDEKAMEEEGYIHWQRRVPKRPDGSYAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords ENOLASE
publication title CRYSTAL STRUCTURE OF AN ENOLASE (PUTATIVE GALACTARATE DEHYDRATASE, TARGET EFI-500740) FROM AGROBACTERIUM RADIOBACTER, BOUND NA and L-MALATE, ORDERED ACTIVE SITE
rcsb
source organism Agrobacterium radiobacter
total genus 132
structure length 395
sequence length 395
ec nomenclature
pdb deposition date 2013-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4jn7A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4jn7A01
2AL2A 3I6TA 3N4FA 1P43A 2HZGA 3QKEA 3DFYA 3ES8A 3UJRA 4DYEA 1WUEA 4GYPC 2NQLA 4EWJA 3I4KA 1MDLA 3RGTA 2OQHA 4KEMA 4IHCA 3DDMA 3DFHA 3MUCA 3UCCA 3UXKA 3TW9A 3B97A 3SBFA 2P8BA 3K1GA 4HNLA 3OZYA 2HXUA 3DERA 1W6TA 3OPSA 4KPLA 3CYJA 3RITA 1PDZA 2PMQA 1JDFA 3PK7A 3UXLA 3VCCA 4DHGA 2OZ3A 3H70A 2RDXA 4MMWA 1P48A 3SSZA 2OX4A 4X2PA 2DW7A 2XH4A 3DG3A 3VDGA 3U4FA 4HYRA 4K8GA 2XSXA 2PA6A 2POZA 3FVDA 3VCNA 4J1OA 4GGHA 7ENLA 1KKOA 4J3ZA 3ZVHA 1TE6A 2QDDA 5FJUA 3RR1A 3QPEA 3DG7A 3OP2A 4H83A 3DG6A 3ENLA 3OTRA 1OEPA 3SN4A 1EC8A 4KWSA 2XH7A 3PWGA 2XH0A 3H12A 1MDRA 1SJCA 2ZC8A 4FI4A 3BJSA 2PS2A 1JPMA 4HNCA 3DEQA 3ZLFA 2PGEA 2GGJA 5ENLA 2OVLA 2OZTA 3BSMA 2PCEA 3RRAA 3QLDA 3V5CA 1ECQA 3H8AA 2GGHA 4JN8A 3TJ4A 3T4WA 3VC5A 3TOYA 3FJ4A 1RVKA 2P8CA 1YEYA 2OO6A 3PWIA 2OZ8A 4E6MA 5FJTA 3V4BA 4GIRA 1DTNA 3NXLA 4DXKA 3VC6A 3ZLHA 2HXTA 4ZCWA 4MGGA 4DN1A 2QGYA 3ZVIA 4GISA 4G7FA 2ZADA 3P0WA 3FCPA 4H2HA 5BOEA 2AKZA 1MNSA 3VA8A 2P0IA 3I6EA 4IL0A 3JVAA 3MY9A 3KUMA 2PGWA 3N6HA 2QQ6A 1PDYA 2P88A 3T6CA 3R1ZA 2DW6A 4IP5A 3TWBA 4M0XA 3QN3A 1MUCA 3QTPA 2PTZA 4JN7A 4HCDA 1TKKA 3TCSA 3TWAA 4M6UA 4FP1A 3CXOA 2O56A 2OQYA 4A3RA 1KD0A 1XPYA 2OPJA 1KKRA 2HNEA 3IJIA 2PSNA 3IJQA 2QJMA 3ZVHB 2PPGA 4GMEA 4H1ZA 2CHRA 1WUFA 4KT2A 3DGBA 1ELSA 1NELA 1XS2A 4IP4A 3NO1A 2GSHA 3R0KA 2OKTA 3IJLA 5IDZA 3R0UA 2MNRA 4Z17A 3NFUA 3DIPA 1ONEA 3P3BA 3TQPA 4JHMA 3N6JA 2PP3A 1L8PA 2GGEA 2QVHA 2MUCA 5FJPA 1BKHA 3MQTA 3SJNA 5BOFA 3JZUA 2GGIA 3H7VA 1IYXA 3FV9A 3R10A 3EEZA 5FJOA 1TZZA 3EKGA 2GL5A 5J04A 4IL2A 3OW1A 3SN0A 3NZGA 4E4UA 5EU9A 3DESA 3MKCA 1E9IA 3IK4A 4DX3A 2FYMA 2PU0A 2I5QA 2PTXA 3MSYA 4A35A 1BQGA 3MZNA 3THUA 4ROPA 1MRAA 2QJNA 1R6WA 3UJEA 1FHUA 2XGZA 2AKMA 3HPFA 3TTEA 3BOXA 3T9PA 1EC9A 3T8QA 2PP1A 3OZMA 3U9IA 3D46A 2PTYA 1NU5A 2PP0A 2ONEA 3V5FA 4HCLA 1F9CA 3SN1A 4E4FA 2PTWA 4HCHA 3N4EA 4E5TA 4A6GA 2GDQA 3ES7A 6ENLA 3TJIA 4ENLA 4YWSA 3UJSA 3JW7A 3UGVA 3UJFA 3RO6A 3Q45A 2OG9A 3FYYA 1SJBA 3PFRA 2AL1A 3FXGA 4F4RA 4K2SA 4H19A 4GFIA 2FKPA 4IT1A 3GC2A 4DWDA 1EBGA 3P93A 3MWCA 3S47A 3GO2A 4K1WA 3UCDA 4HPNA 3ZLGA 3D47A 3SQSA 3VFCA 2GGGA 4Z1YA 2OFJA 3R25A 4G8TA 3Q4DA 2PODA 3GD6A 4GGBA 4GYPA 1EC7A 3S5SA 4E8GA 4HN8A 1SJAA 4ZA0A 3R11A 3STPA 2QJJA 1FHVA 4IZGA 1KCZA 5FJRA 2OLAA 4MKSA 1SJDA 1R0MA 2QDEA 3CK5A 3GY1A 1JPDX 2XH2A 3CB3A 3CT2A 3V3WA 3RCYA 1EBHA 1JCTA 2AL2B 2P3ZA 3UJ2A 3CAWA 2PU1A
chains in the Genus database with same CATH superfamily
4N9DA 1UR1A 1CB2A 1E5NA 2VZSA 1YQ2A 3A47A 4IMAA 5F4WA 4IGHA 4UTJA 4DYEA 5MHBA 3VMPA 1V6WA 3ABQA 2BBFA 1QPNA 4GYPC 1TWSA 4HA1A 4MSSA 4KEMA 1QT1A 3KL0A 3P0XA 3CUJA 2TAAA 1LQ0A 2C3ZA 3B06A 1NAL1 1XLMA 2WHJA 4FSAA 2YJQA 1OVDA 1VHNA 3KBWA 1BTCA 4BF9A 4UNIA 3UP8A 3W0KA 3VKJA 2DUZA 2VCCA 2CETA 3P60A 1FWHC 3W25A 2ZRXA 5BU6A 2GR2A 2VX4A 2OX4A 3YPIA 2PDPA 4UCGA 4EIVA 1BYCA 1XC6A 4LUSB 4P7OA 3B9NA 2ZXQA 3AJ7A 4QFUA 2WP6A 4N6FA 4LUSA 3GH7A 1XFCA 3VGGA 4ZB0A 4XB3A 4J1OA 4GIEA 1JCMP 3TCEA 2ABBA 1OG0A 5I02A 5CC3A 4C5ZA 2V5LA 4H83A 3PTQA 1QO5A 1CXFA 2WKLA 3LOTA 2YPIA 5JH1A 4PCPA 1UKOA 3N18A 5BXTA 1WXZA 4GXWA 1VR6A 4HZMA 3GIPA 2BODX 1N60C 3VMNA 3TONA 4W7UA 2WANA 4CN1A 1H7NA 1OABA 3AYSA 1EWDA 1STZA 4JKMA 3F4NA 3E02A 5E6YA 5KZ6A 2I9UA 2OZTA 3CHFA 3E0FA 2XN2A 1GOMA 1RD5A 2PZ0A 1JI2A 3OQ8A 4PTXA 3TC7A 1B0IA 3V1HA 1QBAA 4O1CA 1W1VA 2ADAA 5C9WA 3ERPA 1SO5A 2WLYA 4LBUA 1W1TA 5A6AA 2X09A 4KS0A 3KBMA 4O52A 5FJTA 1W1B1 4QEEA 1DTNA 3VC6A 4J57A 4DO7A 3KLKA 4KPRA 2RDTA 4BWLC 4F40A 1UQZA 1L6YA 3N34A 1JCLA 5C6MA 4RZ6A 3H4KA 3WDJA 1W3JA 1TZ9A 4GQBA 1TX2A 1E4IA 3KVLA 1PIFA 1B57A 4RE0A 4O10A 4DY1A 3KCLA 1HO1A 4LAKA 2P88A 2INFA 3B0VC 1BZLA 4WKAA 1Q5MA 1TQJA 2A6LA 3KBJA 3W24A 4IUGA 4JN7A 2E0PA 3W7OA 1B30A 2G37A 2VCBA 2D22A 1GWJA 1GRFA 2IPFA 4N0RA 2V81A 1NDVA 1LL6A 2CERA 2GFTA 1C7SA 3BH4A 4CKQA 3CGEA 1ITQA 4JICA 5JBEA 1YE4A 4MNKA 1UD3A 2YA0A 1EX1A 2WAGA 3HJZA 3UXAA 2ZC1A 4C6BA 3W2KA 1S38A 3PBGA 1XLFA 2OLSA 1L2QA 1J0JA 3PZNA 4PL2A 2X8GA 4B5SA 1S1RA 1R2SA 1KCKA 4JYFA 3LPFA 1HNYA 4UR8A 5FAGA 3A7AA 4O28A 4S3GA 2DFAA 5B7ZA 3T7VA 4HJWA 5HNRA 4PBEA 4RZBA 1KFCA 4ZVJA 3B3DA 5I24A 3SJNA 2QPUA 3ZT5A 1R46A 4N7QA 5JIWA 3CGBA 2CFYA 4YL2A 3DU0A 2YFNA 2R24A 3UESA 7REQB 4GQGA 5U25A 1IEVA 7REQA 2CLOA 2PBOA 2XN0A 2ZIDA 4DJDA 1SFLA 3W7MA 1BXBA 3EX4A 1FFVC 4NXSA 5XINA 2G97A 5EU9A 1TPC1 3RCNA 3MP5A 1NPXA 3O6DA 1MSSA 2GDUA 3ARXA 4CGTA 1AD1A 3IK4A 4K3ZA 4CNPA 1XRFA 3TTQA 1TJ1A 4PULA 3WQCA 1EXPA 1SFTA 1Q6FA 4CD5A 2ZQ0A 3EANA 1FEAA 3BTNA 1FCBA 3WH6A 4ROPA 4IIGA 3MCNA 1UHVA 4CCEA 4OUIA 4J5NA 1W9UA 3GFXA 1ZCOA 3R89A 5EMJA 4DJFD 1Q66A 5BWAA 4MFDA 4UC5A 1V0LA 3V5FA 2ONEA 1MXGA 1Z8AA 3GXPA 4GI9A 2PTWA 4ZO7A 3F5KA 3HQNA 1VCFA 4F0KA 4Y9AA 2WMIB 2A3LA 4JTAA 2E8ZA 2QCCA 2R1LA 3NQFA 2WMIA 3UJSA 3RO6A 4DBUA 1VGAA 3IRSA 3B8UA 3WLTA 2YL5A 4K2SA 4BI6A 1FUYA 4NX5A 3VMOA 4GFIA 5I3JA 2WVVB 1V3IA 2FJUB 3PN8A 1J0IA 4NI8A 3OGVA 3BCJA 4K1WA 3GH5A 3N15A 4IXXA 3H7RA 5AY7A 3HF3A 1XLEA 3CWHA 1GOIA 1GGOA 4B5XA 1GKQA 2NV2A 2WPFA 2I14A 3CO4A 1D7KA 1GXFA 2Y5SA 3WQ5A 3S5SA 3ARZA 4GUHA 3E0LA 4ZA0A 1FHVA 2Y63A 1H51A 4QDPA 1RJQA 2R6OA 2CU0A 3I3EA 1QASA 2WVUA 3B9DA 1T96A 5LGXA 5ABGA 2GR1A 2VD8A 3CK5A 4O14A 3WF2A 4FNTA 4UFLA 3NYDA 2QJIA 1A5OC 3DJGX 1JCTA 1VFMA 4IGSA 4LVAA 3UJ2A 2X2GA 2YBTA 3GDMA 1PZ0A 3U7VA 1UOKA 1P43A 2DY3A 2NVAA 1EYEA 3A9BA 3DCPA 4D6DA 4RCXA 3II1A 2OTDA 3WBXA 4GBDA 2J79A 3WD1A 1HTIA 3PPCA 4RKAA 4A05A 5HQLA 3ZJ8A 3M0MA 5JUVA 5L9FA 3GNPA 2CZEA 3DFHA 2DSKA 4PTVA 1SMAA 3E1F1 4MB1A 4UMAA 2C18A 3VNDA 2ZUWA 3ZR4A 1QW9A 3L2IA 1EXBA 3DC0A 1CXLA 1HJSA 3CMJA 1WB0A 2ZWZA 3DHFA 3T08A 3TFCA 2VDGA 2Q8ZA 3TEVA 1PDZA 5EFFA 2FTPA 2OOGA 2J7BA 4DWSB 1HUVA 1FP9A 2UV8G 2QS8A 1KFWA 3LG3A 4DWSA 1BEUA 1NWUA 3PZTA 3C0QA 1Z32X 2O4MA 4C91A 3E0WA 4MLJA 4HNVA 2FPVA 2J24A 2XSXA 2C19A 4NUWA 4HSOA 1C91A 4ZQMA 2CBUA 1ZHAA 3W1LA 4BS0A 1LWJA 2OOFA 2IPWA 4CQ9A 3SIZA 2FHFA 2V3EA 3WKZA 3PZQA 4S3AA 2HQMA 3LCLA 3LCWA 1KFEA 4UMCA 5HJXA 5XIMA 2C1IA 2OR2A 4H4QA 3GVQA 3M1ZA 1KRBC 2DQWA 2HS8A 4V33A 4GIYA 1TPDA 4US6A 2OO0A 2PGRA 4Q8TA 1CXIA 3S3GA 1Q6EA 3FX4A 2F38A 4NJKA 1K8XA 2R9RA 1GVYA 5ENLA 5FIPA 2QCMA 2XGIA 5LSMA 5AYYA 2QYGA 5EFDA 2VEPA 5DXXA 2WMHA 4LYPA 3AIRA 2E1WA 3EOUA 4Y9OA 1JCXA 3RILA 1B9ZA 1TQXA 5F1UA 1Q6LA 4L61A 3E5BA 1L6GA 1Q8AA 5LNSA 3AM9A 4MZ8A 1E71M 3JR2A 4U3AA 1UW9A 3TJ4A 1F8MA 3W07A 3QC3A 4TU1A 4UB9A 1VB9A 1QI4A 2WM0A 5JBFA 2ZRZA 3OZPA 1V79A 4E6MA 1R2TA 2WYSA 4UZUA 1U5VA 3L9CA 3ZLHA 3CQ0A 3HV8A 4JKKA 5AFDA 3MS8A 3DUGA 3ME3A 4PFMA 1WP6A 2V9DA 4PMUA 2PE4A 4HOXA 3KCJA 4GVGA 2A7PA 2GVYA 4ES4A 1LUCB 3K4AA 1N62C 2NQ5A 4ROQA 2ABAA 1VJSA 3DI0A 2NLIA 2OZ0A 2YL9A 2IXUA 4AU0A 3WL0A 2WSKA 3NQGA 2IQ0A 2J4GA 1FWAC 1T7LA 1QOPA 3QEZA 1TPH1 1KW1A 2ACQA 4HKPA 2VM8A 4DZHA 3EXSA 1DIDA 3PUDA 4UXDA 3BAJA 4MOZA 2J6VA 3KL3A 4AD5A 1S5VA 5HPOA 1RXOB 1E9YB 4H1ZA 4E2BA 3GDTA 4F66A 3B8TA 4XQ6A 1W1ZA 1KFKA 2GSJA 3RX4A 1E4NA 3ZFHA 3BL3A 3I3DA 3WQ6A 3WUFA 3TROA 3THQA 3CMFA 2Z1WA 4GH3A 5AC8A 1WCGA 2DZVA 3F2BA 3C0LA 4ZB5A 1QMLA 3U2ZA 4JD4A 1JEHA 3W6LA 1HO4A 3DJJA 1WOAA 2P5NA 5DO8A 2FVLA 3BOFA 1VYRA 4GOAA 1XG3A 5CAHA 4HBKA 1RR2A 4PGLA 1EJRC 3VZZA 1EJSC 2R9ZA 2VT0A 4WIWA 1ITCA 4X63A 3AHVA 3NM3A 1R8LA 5CSRA 4ZMGA 3CZGA 4I8YA 3WQ8A 2DORA 2PWDA 3EMQA 4IQEA 2W91A 3TJLA 3THUA 4Q33A 5FSDC 3LZ3A 1VFUA 4JFVA 3M64A 3MWAA 5A2BA 3RU6A 1ZTVA 3SY1A 3AHYA 4J3WA 1XYZA 1UASA 4MNMA 3WUBA 3OYXA 3CWNA 4DJDC 4US5A 1EC9A 1I2RA 3ARUA 1W5MA 2PUZA 3OZMA 2Y88A 1K3UA 2NX3A 2XFYA 2FTYA 3N25A 3UR5A 4LH8A 2X8RA 4WQ6A 3MCMA 4A3HA 3CIVA 1VBGA 2ISSA 4TX8A 1NP2A 4Y6GA 1W9BM 3XISA 4CVUA 3LNMA 3EDJA 2WZEA 4JTRA 3EOLA 2YIHA 3V16A 4KFNA 5A8MA 3CNYA 4ZOAA 3CAKA 8XIMA 3MUAA 2YKKA 1BYDA 4OUEA 4W5UA 3NSMA 1F3PA 1XF0A 3IJDA 4EANA 1TR1A 4H4SA 2VFFA 3H24A 1I8JA 3UQNA 4HJFA 4NQ1A 1S46A 2OWCA 3GRIA 2VNCA 5ECUA 2Q71A 3PPHA 1EUAA 2F61A 4LQ1A 2QLYA 1NEYA 3S9ZA 3MBDA 1XH2A 3QMRA 5BRPA 1MMFA 1P5BA 3HPZA 4Z1YA 3PSVA 3CUHA 4O15A 1QNSA 3B0XA 4I9JA 1PHWA 1XI3A 2J75A 3IWPA 3C8FA 1JF6A 3OODA 1QPKA 4JTUA 2BXYA 4LEQA 3REQB 3FGCB 2BC0A 4LAOA 2CC0A 5D9MA 1XYFA 3FGCA 3REQA 4CUCA 2FHBA 4AWTA 2QV4A 2BXVA 1R0MA 3UEQA 2FZ9A 4EQWA 2ISVA 5FS9A 4UFJA 1M41A 5GQBA 1EDQA 3B9AA 4AZ6A 1QI3A 1FQ0A 1V6VA 1GRAA 3U57A 3Q67A 4YTUA 1VS1A 2J77A 1C8YA 1EBHA 3N29A 2YW3A 3STFA 4EPKA 3KP0A 2NW0A 2PDFA 5ABFB 5CZKA 1YDNA 5KMYA 3NA8A 2CBIA 1YYAA 4JS3A 3LHUA 3DFPA 1LM1A 1M1BA 1R3QA 1CZ1A 4B5NA 4DNHA 4S23A 1OX5A 3M5VA 1G5AA 1WUEA 1MXDA 3EA3A 1Q85A 3VNYA 5F4XA 1PIGA 4UMBA 4O0ZA 4PUUA 1OYBA 4AVNA 4JEQA 3A5FA 2X8HA 3D0CA 7PTDA 5HMEA 2OMAA 4ATLA 3OPSA 2VOMA 1KR1A 1TCDA 3EDFA 3SQPA 3V1PA 3NVTA 4H6RA 4DBWA 3S46A 1FBAA 4JYEA 1XISA 4N9BA 3NQ7A 1Z3NA 3B4UA 2XH4A 4QQUA 4GRSA 5C9RA 4PCFA 4XAYA 1EX5A 5CPTA 3S6OA 3A64A 2PAJA 3B03A 1AA1B 1FWCC 4K8GA 2C6QA 2VX5A 2PA6A 1UQYA 1RK6A 4KESA 1LBFA 4QXIA 1LL4A 4H4WA 4K37A 2ODOA 3F03K 2EKCA 2BDQA 1Q6QA 3INPA 5HK4A 3VAVA 2JEQA 4D71A 4AUBA 1OK4A 3QPEA 2Z6IA 2BMBA 3NPVA 4GVHA 2E3TA 1DJZA 5G2WA 3L12A 1NTHA 4XIMA 3FNDA 4YN5A 3ENLA 4O57A 3WNOA 3P6LA 2V8ZA 4KWSA 1JEZA 4DWSC 4YVXA 3W3OA 4QTGA 3ABOA 2PDXA 2Z0IA 1ZALA 2FFIA 3MU7A 3BGGA 1XH0A 2YR1A 3ORWA 2VGFA 3CHDA 3CAVA 4QM1A 3SADA 2AGTA 1VJIA 2EG6A 5CGQA 1JXJA 4WY0B 1YE6A 1N55A 2XZ7A 1F6YA 1GOXA 2PRLA 4J40A 4GCAA 4WY0A 1FO4A 1OCBA 2OXNA 2QCHA 2Y89A 3LTSA 1TIWA 1WOBA 1QXLA 3S1XA 3AXKA 5BMWA 1ZMDA 1QHOA 2Y7GA 3VKKA 3N3MA 4E8DA 8CGTA 4OBTA 1S2VA 3QY6A 4HSNA 3WY1A 2DT2A 1WBJA 1KFJA 2X7WA 3L65A 4WDWA 1A50A 2NVDA 2W54A 2HXTA 3LXCA 5BWFA 3NQCA 4REQA 4BF5A 1GRGA 3KVJA 1EF3A 2ZVRA 4C1KA 3EA2A 5C7HA 4ERGA 1UWIA 1XV8A 3AUJA 2BVYA 4LAUA 2EO7A 4Y90A 1XIFA 4LS0A 3THDA 3APGA 1POKA 4HK7A 1N2VA 2BHYA 4ZXOA 4C5YA 3VK5A 1J96A 2MANA 3T55A 4U4MA 2OLHA 1KD0A 2D23A 4J3XA 1UBPC 3CZJA 2G0WA 2J13A 3UNDA 3L67A 2DGAA 2BLEA 1RA0A 3QFWA 1ZX9A 2VYOA 1RBOB 1TIMA 1ELSA 3EB2A 1TYPA 1XS2A 4PUWA 1H7RA 2I7GA 1ZFJA 5IDZA 4NJHA 1OCQA 1QI0A 5CPMA 4J3VA 1OK6A 1Q65A 3MDWA 3KZSA 1J2WA 1VBJA 2OT1A 3A9IA 5B7YA 5BYWA 1R9ZA 4H8UA 3W7KA 4QJ1A 1WDWA 4HVXA 4JHMA 4JTIA 3S9IA 3DH9A 4XSMA 4P5UA 1PBGA 4HU0A 1LP6A 4H01A 3A22A 2E9BA 3FY1A 1CENA 1W9VA 1S2UA 2GGIA 3C2EA 3RJYA 1CIUA 2VWTA 1QJWA 3ABSA 2RABA 3BC9A 4OV4A 1PKNA 1O5KA 1FH7A 4IPNB 1KM4A 4HZ8A 4Y9NA 1SPQA 1K1DA 4LNYA 3VKAA 3MKCA 1LYXA 3EOSA 4DX3A 4R85A 3EPNA 3NSXA 1Q7MA 1FWIC 2Y2WA 4KERA 4ADWA 4DZ5A 1RBAA 4GUGA 4GG9A 3RG6A 3W37A 4IISA 1N8WA 3AISA 2V3BA 1NOFA 4HU4A 3P14A 1RV8A 2J7EA 1DXLA 3BZGA 1YQZA 4NKCA 5C54A 3UYCA 2G3MA 5CPNA 1GW1A 3RU8X 4NAFB 4HCLA 3MUY1 4NF7A 4MFEA 4NAFA 1GYLA 1PO9A 1FX6A 1I75A 3H2MA 3UG4A 3ISIX 3VNMA 1F5ZA 1P0DA 4H7CA 1LPFA 2FZMA 1KR0A 3W7RA 3FK4A 5CZ0A 1EO5A 2WCSA 1I2OA 4JTJA 2YLAA 4FALA 3JUGA 3POCA 3E0VA 3GVWA 1VHCA 1YNPA 1V4YA 1VYPX 3LQLA 1IXNA 1AW1A 4JN6A 3W7PA 4ZOBA 1H63A 1RK5A 4I5XA 3W70A 4CQBA 1UC5A 1MXSA 1OY0A 3TC3A 3GD6A 1BWLA 1IF2A 5K3VA 3TA9A 4M19A 3FSTA 5E6ZA 4APNA 1E6NA 3GX9A 4S39A 4GZJA 1SZNA 5AECA 1VFSA 2ATSA 4N42A 1ENUA 4DIAA 4JTGA 3QPYA 3SFKA 4FNSA 4Z08A 3N12A 2G4JA 3W72A 3F4VA 3CMGA 2VDIA 1RD6A 1W3HA 2O4QA 4EXQA 4DO4A 5CAKA 1FWSA 4O8RA 1JCJA 1M01A 1XSKA 1CLXA 5CQ1A 1GVSA 4A4AA 4N9CA 5I07A 2DZWA 2VENA 5T8GA 5K9CA 4RW5A 2XIMA 3OO2A 3V75A 4BY3A 2XTKA 4C1NB 5C2GA 1QPQA 3G1FA 4KPLA 4C1NA 3CV1A 3PK7A 3VGDA 4HP5A 5HOSA 3BAYA 2YDAA 1P48A 2EPMX 2ZRWA 1OGSA 3RXZA 3BGAA 2WCGA 1S3TC 3CHVA 4HSHA 2BX7A 3LNPA 3R79A 5FSEC 3ARQA 2QHAA 1TSIA 3CYVA 2WOIA 2G3NA 4XZBA 2Y8KA 4OT7A 3G24A 3PAJA 1N7KA 1EGVA 4W4QA 2A79A 1BGAA 1WA3A 2F2HA 4GQRA 1SM9A 1FP8A 2H8ZA 3G0XA 2YCIX 4JIHA 4KQNA 3O6YX 2PDLA 2XM2A 2F6XA 2A21A 2XH7A 1IZJA 3LM7A 2WBKA 3HN3A 4BEQA 1JPMA 3KHDA 1HG3A 1I0BA 1TYGA 1XLCA 3TN6A 3EX6A 1P7TB 2WM1A 1OX4B 5G2HA 1P7TA 4D8AA 1OX4A 1XIIA 3GG8A 4UTTA 1RLDA 3HJEA 2WJFA 1ZKQA 2DZSA 3MVIA 1PWMA 2VZOA 3KM8A 4NZ5A 4XZWA 5DBTA 3DFSA 4WOQA 1J18A 3AMGA 4KH2A 4JN8A 2XU2A 3EX2A 2XUCA 1X96A 3OLIA 3BCDA 2OO6A 1KCLA 5LIKX 2OZ8A 2YVFA 3KOYA 2PLMA 4GIRA 1X97A 3W38A 2DJLA 2WNNA 2VELA 1PCKA 3TZNA 3H2FA 1UUQA 4EACA 1XDJA 2QKFA 3MMDA 4ASTA 4MZYA 2E4TA 2QV5A 3RMEA 1DWFM 4HTYA 3W84A 3W7GA 4V1YA 1EP3A 3C4UA 3VOGA 1WPCA 3FW6A 2ZX9A 4PH6A 2H8XA 1ZAHA 5AOUA 4LYQA 4W8AA 3S5OA 3A24A 4UTMA 3NM1A 3FA3A 4GO9A 1CGWA 2NQ9A 4H8NA 3O06A 3ANUA 6XIMA 3TDFA 2HNEA 2J9YA 1SSGA 4S3DA 4WEVX 3MTWA 3N11A 4JTEA 2DIKA 2AOSA 2PBGA 4LVFA 3B9OA 2BASA 3GXMA 1TREA 3GFZA 5CC7A 1QWKA 1UP2A 2YXOA 1S39A 2OKTA 3BCFA 4UNLA 1DJGA 4B90A 1GQIA 1HZYA 1MI3A 2VFHA 4Z17A 2ZWYA 3UBPC 3LPPA 3KOFA 1YXYA 3T0BA 4DBEA 4M7SA 2JF7A 1BQCA 3N6JA 2GVLA 3LSBA 4QIUA 1VBRA 1A4LA 2WC4A 5H8MA 3QMTA 5AC4A 1C92A 1ZY9A 2DZUA 1LJYA 1SYTA 4D6GA 3EDEA 3VNLA 5CXPA 5CPSA 4K8HA 3KP1A 4AZBA 1UWQA 3GU2A 3PZMA 3PG6A 1LRQA 3OA3A 3QOKA 4ZENA 4WSJA 1X2HA 3MSDA 3M5YA 1E0WA 1L8NA 5CC5A 2I5IA 1GRHA 3MDUA 3ATYA 4PODA 4LNCA 2CZFA 2VEIA 3STCA 1KGXA 3WD0A 3QR1A 2ZZ3A 4XD3A 4K7ZA 5ABTA 2CZVA 3O2LA 1O94A 4XZMX 4XZLX 1WAUA 3UJEA 1QNOA 1YNQA 3BOLA 2ZXBA 1FHUA 2XGZA 4JTFA 4DJFA 5KVIA 1FWTA 2UBPC 1F76A 5E0FA 3SGZA 1W1PA 3R8GA 4MZ1A 4Y9PA 3TSMA 2E8YA 1F6PA 3RUBL 2C1GA 2PTYA 4QLJA 3SCSA 3UR8A 3DGZA 1NU5A 1UWAA 4XKYB 1AK5A 2PP0A 1EYWA 1YX1A 2WQPA 2PFHA 4XKYA 4HYVA 5EMLA 4CEUC 3IK2A 4EAYA 4HCHA 1JZ2A 1OIMA 2GQ9A 4R7JA 1DIEA 3ZM8A 3U48A 4MIMA 2BVTA 3U5UA 3PZUA 3LY0A 1KFLA 1YIXA 4I5UA 3ZQ9A 4XD5A 3G22A 4HK5A 2XGBA 3W82A 1UD6A 1Z6KA 3H2OA 5JQ9A 1Q6CA 4W84A 1PSCA 1VCVA 1EDTA 2A3BA 3GK0A 3L2MA 3UCDA 3UXDA 3S8HA 1FHDA 1WZKA 1UKQA 1UMLA 3GKAA 3T09A 3ARPA 3IGUA 4WZHA 4XAGA 4DJEC 1UA7A 1BVZA 1TE1A 4AX7A 4HN8A 2XVLA 2ZICA 3UWQA 4HZ6A 1BYAA 4IZGA 4Q7IA 4L4PA 1D7YA 2ZBTA 1FWFC 3WQOA 3ITYA 3QQ0A 2JBMA 4Q4SA 3R94A 4NYYA 3VYLA 2PLKA 3FJNA 4M24A 4NL1A 2Z1KA 2NQZA 2W0UA 4UIOA 4PE8A 3MYOA 3CGCA 3BZJA 2JGYA 3AS2A 5CH9A 3HU7A 5LNVA 2TMDA 1HKKA 4PMXA 1JZ5A 3PB2A 1MDLA 1LF1A 3DHUA 3MYPA 4JX6A 3WMSA 2ZZ6A 4W7WA 1W3IA 1GOWA 4IX2A 2OSWA 3R13A 2ZXDA 2XM1A 3CBWA 1M03A 3LXAA 2W6RA 2PMQA 1JDFA 1LLZA 3W81A 3NQAA 4F79A 3NPWA 4RE3A 1F73A 5DQPA 4GKTA 1DYSA 1RJPA 3G5EA 4C6LA 4AXKA 5HNUA 4X2PA 4Q8QA 4HHPA 2J9XA 4PBFA 1J5TA 4WGXA 5HR7A 3O16A 4R53A 4L4LA 1KBJA 1OFPA 2QZRA 3B0YA 3AYRA 4KIRA 4XVEA 3UF9A 1R3SA 3K8LA 2W3SA 5LYRA 4CD4A 3VPLA 1GK8A 1AH4A 4C65A 2X1TA 3G0UA 3TNBA 3GXNA 2PLCA 1JD9A 4L6OA 4QP0A 4UQCA 1H62A 3U6WA 1QTWA 3QGAC 3T0CA 4DB7A 1BRLB 4K7VA 3UZZA 4FB7A 1BRLA 1GQKA 1WYIA 3OVGA 4IMEA 3ZIZA 1FDZA 2V3FA 4FNUA 1OD0A 2EJ1A 5CZTA 1P1MA 2DV0A 5FA5A 4DPQA 1LOSA 5GJMA 4I8DA 3HO8A 2ZUVA 2WPCA 2G41A 4GE8A 1SGJA 1XYBA 3QRHA 3GDKA 4KRUA 1W5NA 4IMDA 3VNZA 2G50A 4PL1A 5I3FA 1W1IE 3LI0A 3OU8A 4NJIA 3T4WA 1T41A 4POCA 5C7VA 4RNJA 1IR1A 4DJDD 4RW3A 4R34A 4I3GA 1P0KA 3T44A 4L80A 1R3VA 3V4BA 3WDQA 4DXKA 2A1YA 4XVDA 4IQJA 3HB9A 4ZCWA 5C70A 2BXZA 2HROA 3KE0A 4QG9A 2QGYA 3ZVIA 4P61A 4TO8A 1IT7A 4Y8EA 3AU6A 1KBBA 3QPZA 4GNJA 1DJQA 4FPSA 5CBIA 3EDKA 1HGYA 3CB8A 1REQB 3N4AA 3KS6A 3EKLA 3DBPA 3STEA 3KCOA 3VIGA 2QGHA 2VCAA 2WXDM 4PMQA 4X60A 3TWBA 1H11A 1V8EA 2NSXA 2C3DA 4AC1X 1J0HA 2JFEX 2PC4A 4W93A 1X38A 1VCGA 1B5TA 4Q3MA 5FCZA 3CH9A 2NQJA 4Q8VA 2R1KA 4GY7A 5I3GA 4XD4A 3HG2A 3ZJ6A 5HMFA 1ADDA 1UR9A 1UWSA 3IJQA 3VUSA 3TJXA 5I23A 3WELA 1C7TA 3IRDA 3WLKX 3HV9A 3KL5A 2ZTKA 2A0NA 4IIHA 5EYWA 3VIMA 2EQ8A 3NFUA 3S42A 1DXIA 1W54A 3GBDA 3A3XA 4C7DA 1HIZA 5JH2A 3URHA 3L7RA 4W88A 3ARWA 3WDRA 1WXYA 3NZPA 4XBKA 4B15A 1BKHA 4WJ8A 1P1XA 1MZHA 3SB0A 5CPOA 4JHOA 3A6OA 2BGQA 3WZ0E 2ZX8A 5LGZA 4JFTA 4LC8A 3VM7A 3R10A 5JU6A 1H7OA 1MQRA 5FJOA 3WFAA 3NQVA 4FNRA 3EKGA 4PRRA 1GOOA 3LTPA 1UH3A 4PSRA 4IPIA 2O55A 5HXMA 1KQYA 1N82A 3BLLA 3MSGA 3FHQA 1EJTC 4B5TA 3HURA 3LGDA 3OBEA 3GLCA 1WV2A 4B5WA 4DVOA 2VQTA 3IUHA 3AWNA 4TVUA 1A5AA 4QDMA 4XG1A 1G67A 3RM4A 4NZFA 3MSYA 4HYWA 2NVCA 3ETRB 1IGWA 4AWSA 1XBYA 3N04A 3EAUA 1LOLA 4EXAA 3O0FA 4FO4A 1W3KA 4EM3A 3P74A 3V0UA 2AKMA 4BJHA 3FEMA 3TYAA 3Q37A 3LPOA 2BB0A 1MO9A 1C8QA 3CH0A 3LS9A 2F6UA 1CLVA 1GOKA 3E2QA 3WD3A 1KO0A 4M7TA 3R0DA 1CEOA 4E2VA 4FLOA 3BLEA 4JFWA 2J8TA 1I1WA 1S5WA 3ABZA 1WNOA 1GVOA 3CM4A 4QX4A 6ENLA 4DWSD 3N2TA 1MW1A 1N61C 3NRZB 1R5YA 3FXGA 1O60A 2FKPA 1EOKA 5C55A 2H6RA 1PKYA 5LNWA 2W66A 1V08A 3HPAA 4QG6A 1XLAA 3GE7A 1XJBA 1ADSA 3W2UA 3VFCA 1XQLA 3NVDA 4OVXA 5G5HB 1EEPA 4TR9A 2BZNA 2QW5A 4BI5A 3Q4DA 5BOOA 2CWNA 2G4FA 5DRCA 1VLIA 3E6EA 1DQWA 3PS7A 4M6QA 4AQLA 2OLAA 5E09A 1JPKA 4MM1A 1D9EA 2QDEA 3AMCA 4HN4A 3TW6A 2VC7A 4HNNA 1C8XA 2OU4A 2QCNA 3NGFA 3GKFA 4ZQRA 1LWHA 2WZMA 4RZ4A 3HFTA 2VX6A 3NPUA 5F2LA 3MT1A 1TVPA 3GG7A 4DO6A 3QMSA 1LQ2A 4C6EA 4GLEA 2J88A 2YCEA 5AC6A 3N14A 4KETA 3TQ0A 1OCJA 3CIXA 3AFBA 2DH3A 3NURA 4F2UA 2RKXA 5JRBA 3M44A 4HOWA 2NQLA 5A6MA 3I4KA 1L2UA 5CG0A 4B4FA 2O7SA 5A2CA 3UXKA 2CLKA 3SBFA 4MDOA 2X30A 3E49A 1TWIA 2P8BA 1Y8BA 1RAKA 2QUTA 3ZYZA 1C29A 1LBLA 1YTEA 1ISXA 1H61A 3MC5A 1DPMA 1CNVA 3VDCA 4O13A 5GPRA 4OOUA 3TZFA 3PTMA 1JVNA 3PVFA 2YA2A 5GJPA 5BXRA 2OZ3A 1TPVA 1HT6A 2GJPA 2HCVA 1FCUA 4IUOA 4H04A 1R87A 4B9YA 3DHPA 1OB0A 3GXIA 4LBSA 1RCXB 2Y5EA 3B8VA 3GU9A 1V59A 4LB4A 1XRVA 1V93A 2Z29A 1XANA 3BAIA 3AMDA 4O54A 4FAMA 4BR1A 3FVDA 3O15A 3AMLA 3L5MA 4S3CA 1VLWA 3E96A 3AXIA 2BWGA 1JAEA 4LIIA 3N73A 1RLCL 3NCOA 4AIOA 1GW9A 4GJIA 1VZWA 2QR6A 3HGSA 3UZWA 1VFFA 3TU9A 4NEWA 1IV8A 1XGDA 2V38A 4LUYA 3SUVA 1B3OA 4NZ3A 5AHFA 4CNUA 3M43A 2D0FA 3AZRA 4FI4A 1VRXA 4WOZA 4PUDA 4UFIA 4CCDA 2QDHA 2NXIA 2WOQA 1ZJIA 3FDKA 2Y0FA 3U2EA 1NVMA 4YVPA 5AN7A 1FHLA 3XIMA 3Q65A 4Q8WA 1QO2A 2D69A 3M0KA 1OFDA 1QUMA 2ZUSA 1UP0A 4L65A 3TTOA 2E9MA 2AQWA 1UZHA 1JZ8A 2QUVA 2GWNA 4WJEA 2A7NA 4DNMA 1BWCA 2WSRA 1NWTA 3AU2A 1A3WA 3BW2A 5I79A 2FMNA 3BXWA 1MFVA 1NSJA 2W61A 4X22A 2CEQA 5EA9A 4KEZA 3I7SA 4MGGA 1FWJC 4HA0A 3WLJA 4ERAA 4MWAE 2ZDSA 3LHWA 1IWAA 3V7PA 5BOEA 3FAXA 2Y7DA 3WLRA 4ORIA 5EKYA 5HQEA 4K6AA 1F61A 2XVPA 3ECQA 5D4YA 4CU8A 3URAA 1ONXA 4D8LA 4F0MA 3S0CA 1YKWA 4HOZA 5DY3A 1OYAA 1J01A 1JR1A 1DWJM 1G69A 2Q8XA 4HCDA 2VJXA 1M6IA 4MPKA 3CASA 1PX8A 3MMWA 4AHOA 3SCOA 1HX0A 4JL1A 3WENA 1UKTA 2Z1BA 1FWBC 2QAEA 2WNWA 4W8BA 2WMGA 4KRTA 3ZVHB 1X6UA 3L21A 5GNYA 1BSLA 1JOAA 1H1YA 3P62A 3APTA 4AD0A 1F6KA 3A3WA 4I7WA 4RPQA 1NELA 1GKPA 4O1BA 2YX0A 2HNHA 3QV6A 3S5NA 1GVFA 3W7LA 3BQ6A 3CAQA 3RIKA 4A29A 2R94A 5CZSA 3WUEA 4LX4A 4KRZA 4IXHA 1Q7QA 2O9OA 2Z00A 1JL8A 4MB5A 2XVNA 3CQKA 3NEHA 6CGTA 2PP3A 1WKYA 1L8PA 2ZTJA 2X1IA 3UZJA 4NNBA 4H00A 1JQXA 3TIMA 3MBFA 1AQMA 3ELFA 5BOFA 2GVJA 3GDLA 2DIEA 5I3IA 4JX5A 1XLDA 1HKJA 3MSRA 1Z89A 4ORMA 1M7OA 3C61A 4UR7A 1NH6A 1FA2A 3DYMA 4J3TA 3WCZA 4PRTA 4TOQA 3W22A 2WSQA 3PZOA 4EQRA 4TV5A 3C2OA 3ZJ7A 5DMYA 3EWZA 1HKIA 5JMUA 1PJ9A 1N8FA 1RY0A 4YVVA 4HZ7A 4AVOA 3WBEA 1AJ0A 2GQWA 1GEQA 1P6CA 2I5QA 4OHQA 1QHPA 3LTYA 3OLDA 4ZOHB 4H7VA 2KX9A 4AW7A 3VIOA 3LU2A 4Z2HA 4Q6XA 1T99A 3VD9A 2HWGA 5A8PA 2QJNA 5U4NA 1HGWA 1PUDA 3DC8A 2OEKA 4BCEA 1TRDA 2J9ZA 4Z0JA 3OC4A 3HPFA 2G96A 2HQAA 3T9PA 3AZTA 3BPWA 2CPUA 5D9OA 3DZ1A 3AHTA 1UR2A 3URQA 4QGCA 3OB8A 4ICCX 4ACYA 2PDBA 5MKGB 4FR1A 2J7HA 5MKGA 4Q4PA 3H2EA 2I5GA 2PDYA 4OIFA 4ALDA 1SO6A 1D2KA 2PWEA 2B7NA 3QW4B 2BTMA 2G95A 3HGJA 1R7OA 3A12A 2QUUA 2FZBA 1YPIA 2ZXAA 3SUTA 1L6WA 4ZQNA 5FEPA 1ICQA 3OHMB 3T40A 4NAEA 4DRSA 1UPMB 3F7JA 4M81A 1TVNA 3LB0A 1K77A 4PTNA 3VD5A 1U1JA 5GNZA 1JFXA 5EMMA 4O1AA 2GGGA 3TXZA 3IAQA 4LW7A 1HL8A 2QAPA 3KLJA 1TG7A 3V18A 3UWUA 2E7FA 2Y85A 4JQ3A 1PS9A 1VEMA 4FX7A 2E5CA 3R11A 3W76A 1MQPA 1JRPA 3VABA 1KRMA 1KCZA 2ESCA 4Q4KA 4IJBA 3SO7A 3UVIA 3BW4A 3PB0A 3KAOA 2OB3A 2X50A 4AIBA 1QOXA 3UZXA 2DSZA 5HBFA 5G4WA 3QY8A 1XYLA 1WDDA 3QYSA 1AMYA 1ITXA 4Q8MA 3HFYA 4PUMA 4DI9A 3MHGA 2AL2B 2PU1A 1AH3A 2GQ3A 4J7RA 4P2VA 2AL2A 2HZGA 4UWMA 3LENA 3WMBA 3WN6A 3NYZA 4CD8A 1J11A 1IR2A 1ICPA 3GU1A 4WDXA 5DN1A 4UZSA 4IJCA 6REQA 2GR3A 4MY8A 4GZIA 5D2XA 3M7SA 2YL6A 4NSBA 3KDOA 1JYXA 5IDIA 1UD5A 4MWAB 3OZYA 3KBSA 1THFD 3QTGA 1LT7A 1LROA 4LBRA 3PPFA 1BAGA 2OELA 4FIRA 5JCIA 2PDQA 2QCFA 1ZSXA 3O63A 2JF6A 2V2CA 3ZT6A 4XSLA 3TLLA 1YNYA 5JIPA 4MYXA 1OZMA 3UZYA 5FF0A 4UQAA 2XYLA 1NFPA 1JZ4A 4B92A 1TFVA 3VGEA 3VIFA 1GJUA 4L56A 3UR2A 3RM9A 2BP1A 3G1SA 2B81A 3VUPA 1TJRA 1JUBA 1M53A 4UUIA 5AHIA 4GUJA 3O7UA 4JZ5A 1POJA 5FJUA 1H1NA 3H23A 4MVAA 4EF9A 1RBLA 9XIAA 2IUZA 1FDYA 3S2JA 2CESA 1VD6A 3OTRA 3THCA 1V3JA 1OEPA 3WNLA 2YYTA 5LXEA 2G3FA 1NQ6A 3PFMA 1LQAA 4Q4MA 4ZQCA 4I7UA 2QT3A 5EBUA 4C6PA 1C93A 2PS2A 1Q45A 3EX3A 2F5ZA 4L9XA 4A8NA 4AIUA 1P4CA 3NVZB 1XR2A 1L6FA 5I3DA 1GZGA 3GR8A 1ZP3A 3RFAA 1AH0A 1SUXA 1MUWA 3VNKA 3H54A 1Q1WA 3GQYA 2ZOXA 5M2FX 4LPCA 4DF1A 1UBSA 5EMYA 3TOYA 1SZFA 4RXGA 4GRTA 4EQXA 1JZ3A 3F5JA 4LUIA 3M6DA 3ZXWA 1VKFA 3F5LA 3SUSA 3MVTA 4JR5A 1GKRA 3W74A 1ZAJA 3GNNA 4L6HA 3WF0A 2Z1XA 1W1YA 1GESA 5LIXX 3HW2A 4G2DA 1XGEA 4WKHA 5ABHA 3FCPA 3E2VA 4H2HA 3I6EA 4IL0A 1B3YA 3WQVA 4H9XA 3B8SA 5A94A 4GYJA 1UP3A 2X99A 3WD2A 3B8DA 3SURA 3HPSA 1CI1A 2F84A 1MUMA 5A6BD 1GSNA 4FR6A 3MCOA 5A95A 1XM3A 3R1ZA 2DW6A 2NT1A 4IP5A 1RSCA 1HVXA 2WMFA 1XSIA 5LHFA 3GTNA 2Y70A 4AYSA 3KWXA 3WBWA 4DBDA 3KOZA 1ZXIC 5PTDA 3EWYA 4G9PA 3DFQA 4KWOA 1XHCA 2P3EA 2X40A 4EPEC 8XIAA 3TE9A 2Y61A 4Z42C 3OVQA 1EQPA 4DJED 4LSBA 1PWLA 3MP4A 1GTHA 2CXEA 4H9YA 1AQHA 2WKJA 5AVNA 4GD0A 3C2RA 1XRSA 2BGSA 2WJDA 2EPLX 4C6FA 3TTSA 4FXRA 3EF6A 1DJWA 2ACSA 1JD7A 3DAQA 1IEIA 2E25A 2DDXA 5BU9A 1NM9A 1A5CA 3ITCA 1ZDLA 3OVRA 4GCXA 3SCPA 1M7JA 3CPUA 5AZ0A 1ZBCA 4RDWA 1GZ1A 3GNDA 4YNGA 4X3ZA 1TJPA 3VGFA 4MY1A 3OYZA 1RPXA 3CUGA 2QUMA 3JRKA 1UD4A 3TQKA 3VOJA 2VX7A 1B1YA 2BHZA 3CT7A 5K4ZA 2ACRA 3HA1A 3WH9A 2XWDA 3UT0A 1MOKA 1D3CA 2VRJA 4EK7A 4X0NA 4AHQA 2NUXA 1KV5A 4YPJA 3RMJA 2DU2A 2FYMA 1R86A 4X9YA 2NX1A 2XINA 1A5UA 2PTXA 2RFGA 1ISZA 2DVTA 4S2BA 2PGFA 4J9JA 1BWKA 4E38A 1MRAA 4IIDA 3EWWA 6ALDA 4LT9A 4B4HA 3TOPA 4PB4A 4HTBA 1NY1A 1W3TA 1DHPA 1DXEA 3R12A 3T0AA 1E56A 4GA8A 5HMSA 3LLFA 4B91A 5A6KA 1O66A 5I6SA 3SECA 1LDCA 1F9CA 1JUKA 4M6PA 3MI3A 3V36A 1KFBA 3WNKA 2VUNA 4Z1BA 1OC7A 3U2OA 1ZP4A 3MJYA 3L23A 3AOFA 4G7EB 4UTIA 3UWZA 5C71A 3GYEA 1V97A 3NVWB 1MZRA 1SJBA 3PFRA 3LLDA 2QVNA 2VC9A 2XSBA 2PDNA 3L2LA 3TC6A 1MVYA 3BVJA 4G5DA 4YJ5A 1ESWA 4IICA 1NF7A 4A3QA 4H3DA 4WD0A 4WK9A 5DMNA 4PMNA 2HVMA 1T8QA 5D2WA 2OSXA 2R1PA 3F2CA 1E6QM 1OC6A 4XISA 1FFRA 4Y2WA 1CYGA 2H3BA 1QPRA 4M8UA 5CPQA 3UG5A 5HUOA 3H6OA 1OCNA 3STPA 2ZX6A 2QJJA 3W7CA 1XYMA 5TR3A 4Z2JA 2BS9A 4NT0A 5I3KA 4CEXC 5F1VA 3EWCA 3AO0A 1UKSA 1F4HA 2BOEX 4JTCA 1B31A 2FB2A 5BNKA 1Y7VA 3V3WA 4WDUA 3WUGA 3IJ6A 1UWUA 4CN6A 1ZNNA 1SU5A 3E0IA 5FF3A 3CAWA 1NDYA 1HQTA 5A2AA 2Q3RA 1XDMA 2W67A 1SB3B 4HHLA 1XD0A 4A8LA 1G9HA 4M3PA 1I9CB 1H6VA 5FS7A 1UJPA 3FIGA 3NOYA 2HS6A 3GNRA 4QITA 3USZA 2VGGA 1AZ2A 3SRKA 1EHNA 4IIEA 4IHCA 2ATMA 4QAWA 4GKLA 2GQAA 2J25A 3UPMA 1ME9A 4MKVA 3NTYA 2ZZ1A 3TYUA 3NDYA 5C9XA 1W91A 1EP1A 1SO3A 3WSUA 2C16A 3VCCA 3S2NA 1J10A 4B3ZA 1R3TA 2FDSA 2O9TA 2WHKA 2XFFA 2GYIA 4MMWA 3IACA 4R3UA 8A3HA 4ZEPA 3BV4A 2WWCA 3MP3A 4GFSA 3U4FA 3IGXA 1MW2A 1VPQA 2I56A 4C6NA 3O6AA 3G1RA 5ER0A 2YCLB 2WOWA 4MNLA 2PDMA 4UQ9A 1D8CA 2YCLA 4PB5A 2PDUA 4IF2A 3UETA 2Q01A 3AXHA 1J79A 4AEOA 1QR7A 4TVWA 2D0GA 4MLRA 4NEVA 1B4KA 5TQLA 4MWAC 4Q7BA 4FX6M 4YYFA 1WO2A 2FPYA 1Q6GA 3FEQA 2NX9A 1F3TA 2WHLA 2EF9A 4JEJA 3G1HA 3CC1A 3WMLA 2XH0A 3WL1A 4CNSA 1MDRA 4MHBA 2FDMA 3LCXA 5FF7A 3HRDC 2I9EA 4OBRA 4JQ9A 4ZO6A 2JIEA 5DCBA 4QJ3B 3STGA 4YTQA 4FLRA 4QNEA 3WLQA 3UY8A 4YTRA 1E1CB 4M80A 4LRSA 4WCJA 1E1CA 4O11A 1AW2A 3H8AA 4DZIA 2GGHA 2FTWA 2H90A 1V0KA 3A4JA 3EB3A 1MRQA 4JY9A 4C6JA 1GJWA 1OINA 4HK6A 3CZEA 1VYSX 1JDCA 3SW6A 1DL3A 1KLYA 4OE7A 3RAOA 3PR2A 4QHRA 4MYAA 4C6QA 4RZ5A 2B7OA 1MNSA 3G18A 3VA8A 3U3HA 4RV3A 3ZMRA 1CGUA 1OWQA 1OGGA 2HK1A 1BWVA 2QQ6A 4ZBCA 3K46A 4R9XA 3BLIA 3LMYA 5M3WA 4GNKB 2UY3A 4JDYA 3R6IA 4RE4A 3TTYA 5K2ZA 1OT1A 1F4AA 2DUXA 1ML1A 1TKKA 3FSUA 3FKRA 4EPDC 1HJUA 1TMQA 6A3HA 2O56A 3W9ZA 4O50A 5HANA 1KCXA 3PG9A 4NNAA 4GMEA 3EZ4A 3VKCA 1A0EA 3FA4A 3SCTA 3WH7A 5KETA 4AFYA 4L7ZA 4W85A 2F8QA 4BQ5A 1OYCA 2ZDRA 2CLPA 4HPJA 4JAWA 1TWZA 2WVVA 3CTLA 3UYIA 3P3BA 4R33A 3SR7A 4KFOA 4L6DA 1LRTA 3H55A 4J28A 1WYGA 1CGXA 4DUOA 1DOSA 5D03A 2VVSA 2MUCA 2J8GA 5FJPA 2NVKX 4A2RA 3R5EA 1CB7B 3WEOA 2YAUA 2FGLA 4H4ZA 1F2JA 3GR4A 4Y8FA 4JKLA 1XUUA 2ZVIA 3BJFA 1JRCA 3AI0A 3II4A 1UZ1A 1DEDA 2P1FA 1O5RA 3V0TA 5FD0A 1J0YA 4H4UA 3BSHA 1MEWA 3FLUA 1IZCA 3BMWA 1GVQA 3R8HA 2O92A 1VC4A 3CUXA 4V2XA 4KF1A 4O0KA 3B9JB 2PDWA 3BQ5A 2INEA 3QOMA 1E9IA 4GXMA 1ZUAX 1G4PA 1JNDA 3WYZA 2C3CA 3WQPA 3NQ2A 4N4PA 1H09A 1UC4A 3KXQA 3I10A 4AY8A 2OX1A 3LD5A 3KEHA 5JBDA 1BQGA 1ME7A 1OFRA 3AXMA 2G3JA 1G4EA 4GI4A 1XCFA 3I4EA 1KC7A 2C15A 4PUJA 1F05A 3BOXA 3R58A 3LERA 4ZODA 1K7XA 2Z1SA 4AD4A 1X8FA 4O8AA 3GXFA 4UTFA 1CX9A 3B4YA 3CJPA 3UGRA 1S2WA 3ES7A 4V28A 3CZKA 3TJIA 3SIMA 3T42A 3QYQA 5G5GB 3ZO9A 2HPIA 4C6IA 3ABRA 3Q45A 4QNWA 1OIFA 2VEMA 3PUGA 3VXGA 4ILSA 1TWDA 1PX4A 4LCRA 4IT1A 4QQ3A 3G77A 1W37A 5T26A 2HBVA 3TKFA 4PMJA 5EB8A 4YHGA 3D47A 3GW3A 2Q6ZA 3BAWA 4AMCA 1M6JA 1DJNA 2NPXA 1NQKA 3AYVA 2P76A 4O1FA 1XC4A 4I90A 1ZU8A 3GNOA 3QGVA 3GIQA 4B16A 1SSDA 5C5YA 5DCDA 1C9WA 3HG4A 1EC7A 4PCSA 2OWWA 1QHZA 1SJAA 4JQAA 5DXYA 3EPOA 1TTJA 2WZIA 3WJWA 2AAMA 3W1XA 4EOUA 2WQDA 3FJ6A 4EF8A 3N9RA 2IKGA 1ZPTA 2YQUA 1YTKA 3EBVA 4ADTA 2AAQA 3GR7A 1QRQA 3NIYA 3W1TA 4B3LA 3U2CA 3QBUA 3VD7A 1VAHA 1G7UA 3WQDA 4CLMA 4GZEA 3GXDA 3ICJA 4KEUA 1EKOA 1EEXA 3Q58A 1WDPA 1B3WA 3FDGA 1P6WA 2JE8A 4K68A 5I2UA 2IPJA 3H21A 3RGTA 5BROA 2VMFA 1FCVA 1OJXA 1ECEA 4GI8A 1IWPA 1XCXA 1ME8A 4FZIA 1U5JA 2W63A 1RJRA 4QLLA 5AHNA 1M04A 4MPQA 1GHSA 4FMVA 4P7RA 5BZAA 2GDVA 4GIAA 3A4XA 3M0ZA 2H3DA 3G1XA 3KHJA 5ABEA 1LUCA 2V30A 3LXDA 4XZHA 1JRBA 3NL6A 4M29A 3KWSA 2RDXA 2VC5A 5I3HA 3IEBA 1UD2A 2I57A 3VDGA 2Z27A 4JDBA 3M0HA 2QEZA 5FL0A 1ZY8A 2V5CA 3A7RA 4XKMA 3LCGA 2PRMA 1DV7A 3QR3A 4NY2A 4B9ZA 3SRDA 5KVHA 1TV5A 1M9HA 4CD6A 5FL1A 4L1GA 5CSSA 3WLSA 1ZCCA 2E67A 3OP2A 4WX2A 4A3UA 1G4TA 2GZXA 3LHZA 3EWXA 3PY2A 4R7OA 4H6EA 1I2NA 5K4XA 2ZC8A 4R7WA 3E12A 2AQVA 2TODA 3GHRA 2B0MA 3LYEA 1JULA 4IMFA 4HNCA 3MUZ1 4FXSA 2HBXA 4J3SA 2GVEA 1RCOB 2YOCA 1RY8A 4GQQA 1GZJA 1RPKA 1VF8A 3BSMA 3MO4A 4TV6A 2DP3A 4JTSA 1OADA 2PCEA 2QAFA 1R3WA 3GYCA 5CZJA 4YCOA 2F6KA 3P84A 4JCLA 1I0DA 3THAA 3GXTA 3NOEA 1XKJA 1ECQA 1UKPA 3OG2A 3KW3A 3ARRA 5DRIA 5J5DA 3KTSA 4CVWA 3JS3A 5HULA 5L6UA 4H4PA 4V15A 1F07A 4PEEA 2QUNA 4E3VA 1LOQA 5A6JA 3OIXA 2I16A 3C0SA 2ZA2A 3TYCA 4G7FA 1W17A 4H4TA 1UH2A 1UROA 2GH5A 1XRTA 2ZE0A 3WQWA 4D6EA 3LX9A 1HN1A 3L4ZA 3EYPA 3HQ1A 4GUIA 3HTWA 4ECLA 1DHKA 1KBLA 4MTVA 4ZFMA 1DJXA 2X41A 5T91A 3NO5A 4M6UA 4ZB2A 3ATZA 4WY0F 1J6PA 2EG8A 4PTWA 3GH4A 3L4UA 4HU3A 2POTA 1D8WA 2PF8A 1IXQA 5B80A 4GACA 5AHEA 1OBAA 3OVPA 2IKJA 1DQUA 3QW3A 2REQB 4EM4A 5AKQA 1SW3A 1DTUA 2PZNA 2V82A 4NI3A 2REQA 1UB3A 3AIBA 2FVMA 3CS2A 1AD4A 5I0DA 4L9YA 4XO7A 1M7XA 3M5XA 1NHQA 3WK2A 3W7NA 3AS1A 2YB4A 3S5YA 3O9NA 5CLWA 2CNCA 3DFTA 2IPGA 3W6MA 2ACUA 4PEKA 3TYDA 2R82A 3I7RA 3EMCA 1EIBA 3IJ9A 1CCWB 2D20A 3RR4A 1NOUA 4E2OA 3ZT7A 3RRXA 4ZE4A 1UWTA 1F3WA 4NZ4A 4W7VA 4M56A 1RQBA 3PC0A 3PNZA 1TX0A 4PTDA 1FEBA 1Q6DA 5BW6A 1S2TA 1ZAIA 1WZLA 5AC5A 2JGQA 3TYZA 1KQZA 2R1MA 5FEXA 1Q2RA 2X8CA 3VINA 2EG7A 2QCDB 5ABFA 4BA0A 2QCDA 4JL2A 4O4WA 5JXQA 3T05A 3MZNA 4U28A 4UOQA 5A5WA 1KXQA 1US3A 1ISWA 4HNTA 2X1UA 1UIPA 3NWRA 1YTDA 1OF8A 3W28A 4OOZA 4B5UA 4U2ZA 1QCWA 3CUIA 3T8LA 2Z25A 3L66A 3T8QA 2PP1A 5E5CA 2TYSA 3RDKA 2A3EA 2XISA 4KWUA 1I1XA 4ZXLA 2A7RA 4I6KA 3RK8A 4E4FA 3QV8A 1WZMA 1XLJA 1PCWA 1SR9A 1E6XM 2C91A 3DENA 1TV3A 1VQZA 4QLKA 3N4EA 3O6CA 4K8DA 1Z9AA 4ENLA 4YWSA 1GVIA 3EWUA 4L4OA 3VOIA 1SQ7A 4L9ZA 4O17A 1OG6A 3GC5A 2AL1A 4XD6A 3G3DA 1RVGA 4YCPA 4OV9A 4S3FA 5F4SA 3HGRA 3MWCA 3S5ZA 3S47A 2CLHA 4D6CA 3ZLGA 4MUPA 1Q4NX 3MANA 1AG1O 3C3NA 4S3JA 4AZGA 4LF1A 1D3GA 2X1RA 3LSCA 4NJJA 1P0EA 4NU7A 1V3MA 2PODA 3PJTA 1V51A 2RDWA 2EHHA 2C8NA 1XSJA 4KIEA 2WNZA 4JNYA 3N13A 1CXKA 4N4QA 1FWEC 4D1JA 4AD3A 2W79A 3GY1A 1IT8A 4HHMA 2ZFAA 3S83A 1KGUA 5G1TA 2EJAA 4V27A 5I06A 5D02A 2Z28A 4G6CA 4KBXA 3UA4A 1B4EA 2V68A 2VZUA 2QNEA 3ES8A 3BO9A 1UR0A 2EPNA 3ZSSA 3FAWA 4BQ2A 3PAOA 3VU2A 1FXQA 2A2IA 1KM6A 5H91A 3LQGA 1GHRA 4MB4A 3MUCA 3TW9A 3B97A 2OGYA 4FX9A 4AG0A 1Q8JA 4LCSA 5FF4A 2DZTA 3GDBA 1DE6A 3RLGA 2VL4A 1PYFA 3B04A 3RITA 5TNVA 3K1DA 4P8UA 3BMVA 1K4QA 2Z1VA 3VI2A 1JUEA 1XGZA 4YWIA 5G1MA 5D37A 1Q1RA 3PUEA 2PDCA 3CQHA 4UTLA 1HKVA 3QSTA 4GO8A 4K1GA 3W1QA 3W71A 4NIRA 3ZWTA 1KXTA 2POZA 1A53A 2GJXB 2KAUC 1ITUA 2X0SA 4GGHA 2GJXA 4Y7EA 1SFSA 1Q2SA 1TE6A 3PPGA 4O16A 6TAAA 2GUYA 4QDWA 3HGOA 3QZ6A 4DBSA 3U5YA 1ZRQA 1VEOA 1S1PA 4CU7A 2JKPA 3E2RA 4BKNA 3SN4A 3R43A 3W23A 4QJ4B 1QFEA 1SJCA 4DXVA 3WK1A 1HXJA 3PUOA 3RLUA 3SCQA 1HJXA 2ON3A 2WSPA 4B3KA 1LLWA 3ITLA 1YXDA 1O5XA 2PGEA 1QOQA 1GRTA 1EP2A 3BLPX 2BSLA 2PD5A 3RRAA 5BXPA 2VZTA 1PZ1A 4UTHA 3ITXA 1UR3M 2W0HA 4BURA 3L4WA 1GOQA 3I6RA 3TMLA 2Y4SA 1FWWA 1BG9A 3FJ4A 2YZRA 3LHVA 2WMKA 1HJVA 4GQ0A 2E3ZA 3IS4A 3N19B 4OTKA 2PTDA 3LXBA 1EA9C 4KWWA 4DXXA 3OA5A 1TRIA 3HM7A 2ZADA 4N6EA 3P8IA 3CL7A 4HQVA 2BY2A 4X61A 2HISA 5A6BA 1Y5XA 2XVGA 1KLZA 1DXFA 3G8RA 5G5IA 1Y5WA 2Z2UA 2QIIA 3SI9A 1E3ZA 3MY9A 2C71A 1B90A 1SZRA 1GV4A 1UA3A 2P10A 4XAZA 4Q4OA 1JDAA 1FCQA 4IGMA 1ALDA 4PB3A 4NZCA 1TCMA 2CIPA 4TIMA 4IMGA 1GYMA 3ARVA 4DJEA 5HMDA 1KKRA 1TTQA 1W2PA 3BMXA 3MI6A 1O4UA 2PSNA 1C8VA 1R3RA 1V3KA 4CD7A 2XSAA 1A5MC 2WKGA 3QFBA 5AHMA 2EAWA 4J27A 1ZENA 3QV7A 1QNPA 4QBXA 1WUFA 4CCZA 2D2JA 2ZRUA 1M7PA 1W8SA 1AOGA 3R0UA 1HL2A 2VFEA 5DT5A 1A4MA 1K4HA 1H5YA 4NG3A 5IBXA 3IVUA 3DFNA 1PX3A 2FH6A 1C90A 1XKYA 4M1BA 2L5HA 5IFPA 2WV8A 3VIKA 1JJKA 3WBYA 1MW0A 1EDGA 2GJLA 3H7VA 3FV9A 1QU4A 3H7UA 3OLGA 1V5XA 4LUJA 4TMCA 5FMHA 2IS7A 4LY4A 2ZRVA 3D9XA 3BARA 2CKRA 3SQLA 5G2IA 1QNVA 3CLMA 3RJXA 1X6NA 4BQ3A 3UWEA 3A5VA 2A85A 2DZPA 4E4UA 2CCRA 3DI1A 3IAPA 4H4RA 3G1AA 4H50A 1H60A 2DEPA 4Y9MA 2G8ZA 4TX6A 3CEUA 3ANYA 1BSIA 4IIBA 3FFSA 3H2CA 1W5QA 1VBHA 3NL3A 2DIJA 3TSDA 4A35A 3COTA 3RO8A 1VENA 3NUKA 5E0CA 4PMVA 5AYZA 2BGNE 2NLYA 4DM2A 1PZ2A 5J8LA 4F9JA 2WPGA 3KOWA 5CPLA 4N2YA 1WKDA 4Z1AA 3BW3A 3JU2A 3H4XA 1QI5A 1UZ4A 4YMZA 2OQLA 2QPXA 3DX5A 1KTBA 4LXFA 2BV9A 4ADUA 1HP4A 1NHPA 3GUWA 4MWAD 3NQDA 1YHTA 4UFKA 1EFZA 4O1EA 3FXYA 3UVAA 3FYPA 4XK2A 3LADA 2A5HA 4WVXA 3FYYA 4JHZA 1UCWA 5LIYX 1X2GA 1FFUC 4HMDA 1YW1A 1HW6A 4H19A 4D72A 3HBLA 1M5WA 1P6BA 3WFLA 4DWDA 5K9XA 1FWGC 3TN5A 4YS1A 3HG3A 2Y8VA 4TVCA 1A80A 4JNMA 5AYBA 1E0TA 2RHGA 4GXPA 2X2YA 1VEPA 3IVSA 1GPWA 2OYMA 4EE9A 3DKLA 5HWJA 4WLCA 2X16A 5K9DA 4GGBA 2HE8A 1JYWA 2J7DA 2GVGA 3SY8A 4I5RA 1MWOA 3IV3A 2V67A 6XIAA 3N17A 3L4XA 3CZLA 5DBUA 3ALGA 3M0XA 2ZCGA 4H9MA 1E6ZA 3M9YA 2Z26A 1T6MA 1M65A 2XH2A 3CB3A 3CT2A 1QBBA 2D0HA 4U5KA 2JIWA 4GVFA 2P3ZA 1NHSA 4KMQA 2Y8UA 1PXGA 2W9MA 2AGKA 3GD3A 4JIPA 1W56A 3RCMA 4OQVA 1OC5A 1QAPA 4G56A 4GYFA 3WJYA 4KCWA 1OFAA 4JPGA 5C8BB 2OQHA 1O12A 3CQIA 3UCCA 4AX6A 5CSUA 1C3FA 1JIBA 2CBJA 2V2DA 2H9AB 2CLLA 1A49A 1H0IA 3LHTA 2O0TA 2V3DA 2YFOA 2H9AA 1WKEA 1XP3A 2ALRA 4QROA 1E4LA 2VFGA 4M5PA 3TK7A 2XZ9A 1IQ8A 2DPEA 2WMJA 4DHGA 3WMCA 3NG3A 4A22A 3SSZA 1F3XA 2WBGA 4NVTA 4FA3A 2BY1A 1I2QA 3OOQA 4WSKA 1FWNA 4KCUA 3LBMA 1AL8A 5G1YA 5F7UA 4ML9A 3AIWA 1HKWA 1FKXA 1ZQ5A 4CQCA 2WLZA 1JYNA 4BEUA 3W26A 3DG7A 4LYRA 1CGVA 2FFCA 3AJXA 1J2BA 1L9WA 4DZAA 4H7ZA 4IFKB 4O12A 4IP7A 3HQPA 3CWOX 2XJ7A 4IFKA 4CQAA 4TQTA 2GR0A 5DCEA 2YVGA 1H50A 2QCLA 4DELA 3PZGA 3G6LA 5IXEA 4CNTA 4Z0SA 3DEQA 3DK4A 3ARTA 1K9EA 4HMNA 2GGJA 4DQWA 4ZSTA 4PR4A 5TAOA 1NHRA 4X9SA 1EBDA 1ISVA 4M51A 1FDJA 3WD4A 3EGJA 3SCWA 1NWSA 4DAIA 2ZUTA 1Q7ZA 1Y5VA 2WVTA 4Q8OA 5KITA 5D04C 2CKSA 3QY7A 5FAJA 2ZUMA 2GOUA 1KA9F 3VC5A 2E77A 4L4MA 5H8PA 1KTCA 4DUXA 1S3HA 3CL8A 5U7SA 4C6DA 2PDHA 3NXLA 1K70A 3VIJA 4BZYA 1DP0A 4XIAA 5CJ5A 5CSYA 1AZ1A 1X1ZA 3KBNA 3P0WA 4S3EA 1E3XA 1ZJBA 4H4VA 4QEHA 1ZBWA 1D3HA 2PRHA 4QE5A 1SO4A 2PGWA 3BG3A 3ONCA 4CN4A 1XW8A 4RDYA 4UNKA 3S4TA 4M0XA 3WLHA 3QN3A 3C2YA 4TMBA 3EKZA 3ITGA 3RNDA 4FOKA 1YRRA 4FIQA 3K8KA 2RJGA 4U10A 1F8WA 3C5QA 2VOTA 4PA8A 1NWRA 1ZJAA 5KINA 4AXNA 3MPGA 2CDUA 4YHEA 5JCNA 2X05A 3D3FA 2EKGA 1TPEA 5RUBA 2E6DA 1XCWA 3T07A 2V6OA 5H8UA 2YBVA 3W88A 3AN1A 2NV1A 3L8KA 2GSHA 1LCOA 2CITA 1PPIA 3M0IA 1R85A 3UG8A 1F8IA 3IUIA 3PBYA 3UR7A 4J4KA 3TQPA 3VVGA 2V0TA 3KVKA 2JK2A 3MV01 1U30A 5DELA 2YXGA 4HGXA 2ZUNA 3JZEA 2B31A 1DORA 1DIOA 4LVBA 4Z1DA 1RH9A 5E1QA 3WJXA 1XIJA 2LLEA 2D24A 4HU8A 2HDJA 3P8JA 4H8VA 2E6FA 3F1QA 3UW6A 1DQXA 2HMCA 1EJ7L 2GL5A 4U33A 1U22A 1ISYA 3SN0A 3NZGA 4P7LA 4M1RA 1WDQA 4DO5A 5ECVA 3OGRA 4Q4QA 1XUZA 3G0SA 1BPLB 3S2CA 4GX8A 3AWOA 1KM2A 5IBXC 5F2MA 3ZZ1A 2XDFA 1FY6A 3GRTA 1TA3B 1TA3A 4H4IA 3VGHA 3UNTA 1JGMA 1QPOA 1XH1A 3GBEA 4JQ4A 4LYKA 3TTEA 4IPPA 2QCEA 4XX6A 1FWRA 3SJ3A 4Q22A 3VIPA 3LZ5A 2ISWA 3LUTA 1GEHA 1UOZA 2XHYA 3WF1A 3M4HA 1R9YA 4ZL1A 2W55A 3QR0A 4L5ZA 3W7DA 4UTWA 2IKIA 1EHAA 4XUYA 3WDPP 3KRZA 2GDQA 1ONWA 2HRWA 3OG3A 1TTIA 2RGMA 3UGVA 2OG9A 2WP5A 4HA3A 1MQQA 4PMRA 5AYIA 2XWEA 5A69A 2FZDA 4CQ8A 5C9UA 5I00A 1V02E 3GC2A 2VZVA 1VPXA 2VC6A 3TQVA 3PNUA 3OHIA 3LV5A 3VO0A 1V3LA 3T0DA 1KM0A 1A5NC 3NL2A 1R2RA 4ZO9A 3P81A 2PDJA 2Y62A 3IIXA 3W1UA 4A21A 2YCKX 1I45A 2JQXA 3R25A 4GINA 3W83A 1R47A 2DSVA 4XBJA 4GI6A 3TV8A 4E8GA 1WE5A 4UOJA 4TVYA 1ICSA 3GAYA 3H4WA 4LAZA 2HV5A 1GT8A 4IFOA 4EMWA 4MKSA 3I68A 1LBMA 2O7QA 2PWHA 4GBUA 2VGIA 4WXZA 4KGJA 3RLVA 1T8XA 4XAPA 5LHEA 3ZSTA 1K9FA 4MJMA 5XIAA 1GQNA 5A8QA 1UH4A 3A21A 1E1FA 4ICMA 5E9XA 3PSWA 4H41A 2PF0A 4JDRA 2FHCA 3LMZA 3UZ5A 1TV2A 2ZKMX 3M47A 1T0OA 3LDVA 4GWEA 2G5WA 4EWJA 2YYUA 3W87A 3ITOA 4AZCB 4E4PA 2WC3A 1EPVA 1WAWA 4KKXA 4AZCA 3NPXA 4NHVA 3ITVA 1Z69A 4DI8A 1JPIA 1G7VA 1LG1A 3QH2A 2V69A 3WNNA 3ID7A 1CDGA 1TTPA 2YSWA 4QE4A 3G1DA 1W2VA 4P7QA 2ZX5A 1REQA 4NXKA 5F2IA 3AMKA 2I17A 2Z4GA 3HOJA 4OKDA 2IQDA 5REQB 2XIQA 3XINA 3OQEA 2P53A 3DGRA 1TYTA 5REQA 4BF7A 3IPWA 4LVDA 3V35A 3VILA 4Z2KA 3HMCA 4BK9A 3UFYA 4KEVA 1X7IA 5LXXA 5FESA 4O19A 2ZZ7A 4LWWA 1HF6A 1UIOA 3GUGA 3C2VA 3W00A 1K9TA 2NT0A 3LEPA 1IXOA 5D8ZA 2CFFA 7TAAA 1XXXA 4D6JA 3RYSA 1ZB5A 5IRPA 1W8GA 2QDDA 5LA2A 4NP7A 1EZ2A 3CL6A 1BXCA 4LS1A 4N9EA 3BAXA 4H2CA 1BKSA 4FEZA 2J74A 3LRMA 2Y5JA 2OKOA 4JIRA 2ZZ5A 1PYMA 3BICA 4DF2A 4MNJA 1FXPA 2C79A 1A47A 1H49A 2E6AA 3W6YA 1S2AA 2ZZ4A 3MMUA 4FHAA 3S1GA 4ONVA 1S5MA 9XIMA 1XPGA 3P61A 4JTKA 1PTGA 4TTUA 1E1EA 4PMOA 1X8CA 4JQ2A 4LALA 3OBKA 2NSOA 3S9YA 2FIQA 5CGMA 5KTLA 3QXBA 2WHMA 5H2ZA 4CQDA 3AIQA 3PULA 1WZAA 1BYBA 4J2PA 2B4GA 3A13A 3IJ8A 2BNJA 2P8CA 4JFSA 1JCNA 1CW2A 1A0CA 3CUZA 1FTXA 2VGBA 4PC8A 1FECA 4FS9A 3AQUA 4FNQA 1H7WA 2RAGA 2WC7A 3L4YA 4F0RA 3BK0A 3GB6A 1U2YA 2WO5A 5GRTA 1RQHA 2NUWA 3JVAA 2OODA 3AICA 1Q63A 3NVYB 1IEWA 2YW4A 3QHMA 3KUMA 2WW5A 1H2IA 3KZPA 1KV8A 3T6CA 3AIUA 3U8GA 3W85A 2CZ5A 3W2LA 1MUCA 2Z7GA 4B5VA 2EQ9A 1RHCA 2ANUA 4RPPA 1K8YA 1GQLA 1NP0A 3A7UA 1NIUA 1E5JA 3SEPA 2OQYA 4A3RA 2OPJA 1M3UA 2ZX7A 2VUYA 3GWQA 4FF7A 2RUSA 2BFGA 4FLQA 4AMAA 5D33A 4XBSA 3RF9A 3H2AA 4KGLA 1JAKA 1SW0A 5DF0A 5BRBA 5D2TA 4KT2A 1XG4A 4E0CA 5GVJA 3M0YA 3OIHA 1XLGA 1XDIA 3WFZA 1EIXA 3BWWA 1SZGA 3O05A 1FVPA 2VRQA 3KS5A 3DIPA 4HNOA 1V02A 1QATA 3GNXA 5M5DA 1HFBA 3B0PA 4C6MA 4JIQA 3EPMA 4L1WA 2JEPA 4PUKA 3GTHA 2GJRA 2XVKA 4IIFA 1LLOA 3EWBX 4R88A 2EXOA 4HA4A 5D32A 1X1NA 3MQTA 4AHPA 4RX0A 4D2JA 1K6WA 1PAMA 4CNOA 3O0HA 1W9PA 3U7BA 3A4AA 3VDBA 3QVQA 3G2GA 1JI1A 1K4GA 4DPPA 1K9DA 4WR3A 2VI0A 4FX8A 1TV8A 1SMDA 4IL2A 3OW1A 4G1NA 3WF4A 1BVWA 2D3LA 3K13A 4GK8A 4S2CA 4ACZB 1QVBA 1LT8A 2PEVA 4J2MA 3EOEA 1AUSL 4ACZA 3TVAA 1CXEA 2X0YA 5AHLA 4DYKA 1V03A 2AMGA 4GY1A 2CWXA 4REQB 3FVMA 3IIZA 1O7AA 3BAKA 3TFXA 2WSYA 4D9PA 4PRWA 2PWVA 3P80A 4F3HA 2NWRA 3CZ8A 1Y65A 2VDHA 4DAFA 4ZTYA 5FEWA 3KLLA 3CGTA 3QHOA 4TXEA 1H5VA 1BG4A 3QSRA 1L6SA 3SZ8A 4H4YA 4RNHA 4WHBA 4C7GA 4NZJA 5DY2A 1BXNA 4BI7A 4W86A 2J8FA 4R27A 3DOPA 3NDZA 5HDRA 4GC4A 5JCMA 4ZQOA 2GLKA 4EP8C 3N6QA 2WCAA 3WBAA 4JX4A 5FJJA 1OHLA 5D9PA 5CC6A 3W7JA 1ZJHA 3O07A 4R5EA 3M7WA 4MUZA 1U83A 3BANA 3EA1A 1JDEA 5M03A 5DT7A 1EBGA 2YLLA 1EQCA 3BLDA 4J56A 3TN4A 1BLIA 3NZQA 4NNCA 1XHGA 2IMRA 3EXRA 4WXYA 2BVWA 3C0JA 3R07C 1F74A 1WBHA 4OECA 3GTIA 4XV0A 3QQ1A 4ATDA 1XD1A 1WDSA 4AIEA 2OFJA 3R4IA 1RUSA 5GJNA 4UTWC 3MA8A 3PWAA 2TSYA 4RUBA 2WK2A 1E6SM 1DNCA 4KWVA 4TVDA 3IC9A 4I7VA 1HP5A 4PMYA 4W89A 2DSWA 3MHFA 4BFAA 2C0HA 1VPYA 3G6MA 1IIHA 3D3AA 1KGWA 2V5KA 4IGNA 3T4CA 1QWGA 1ZK7A 2A3CA 1KN0A 1W5OA 3PF3A 3SCVA 3AC0A 4EVZA 1T3QC 3R7MA 3N4FA 1G1YA 4CU6A 3QKEA 3UXIA 4AH7A 3WNPA 1A5KC 4LTSA 1E70M 3TR9A 1VRDA 1R9XA 2D2HA 2XIBA 3ITTA 3BDKA 2OYKA 5BCAA 3CIWA 3VNJA 2A8XA 3W7IA 4GY0A 4NRRA 2OJPA 1YBQB 2JKAA 3CPRA 1YBQA 4GHRA 3DERA 2F7FA 4FNPA 4WF7A 1W6TA 1DE5A 4XZIA 3C52A 2A3AA 3UWWA 4D8ZA 3KRSA 3ZOAA 4GH1A 1DWHM 4AWUA 1H2JA 3WK3A 3DKJA 3OZOA 5H1WA 1O1ZA 2DT0A 4K36A 3TNOA 3FHAA 1WQ5A 3H70A 4QRNA 2HSAA 2HK0A 1JF5A 3PM6A 3TMQA 5EMKA 2O9RA 3G1YA 4GZ7A 4HYRA 5E70A 5HPCA 2WZHA 3A4WA 4EKJA 4UBPC 5EMUA 4H6QA 2A4AA 1H1ZA 4AD1A 1W1A1 3QZEA 4W9TA 3VCNA 1XIGA 2W27A 2Z2BA 3W1NA 1SFJA 2WPBA 1UZDA 1NDWA 3ZS4A 1KKOA 1LRNA 3HQOA 4IQLA 3ZVHA 1GYNA 3RX2A 3RR1A 3WLIA 2RGLA 1WX0A 2YB1A 5T9CE 2Q8LA 2R1NA 4Z1CA 1I4NA 3OBAA 3RX3A 3S6TA 1OGBA 5EGRA 4QR6A 2GRTA 3M46A 3WDIA 3VCRA 3TUUA 1N5XA 1TV7A 5HA7A 4P8VA 3H12A 3B8WA 3NSNA 2J7CA 3M07A 1K8ZA 2GJNA 5DLCA 1TWWA 5D9NA 1K02A 1DJYA 4IPLA 2GWGA 1CT5A 4DYJA 1TO3A 1FIQB 3QGKC 1Y0EA 3WNMA 2NXGA 3DK8A 4L64A 1PHQA 1B3VA 1GCYA 1GPFA 2Z2AA 4AAJA 3BGJA 4ICNA 4ZQPA 3EDDA 1BD0A 3PHAA 3VKDA 3DXIA 3WF3A 3EMZA 4C6OA 1TR9A 3TN3A 3NR0A 4O18A 3T0TA 1MFUA 3K8MA 1Z7AA 2VKZG 3G8EA 3SUWA 1MEHA 5A3HA 1CGTA 1YEYA 1XLLA 4NYUA 3PWIA 1O6IA 4H9UA 1A5LC 2VD9A 3TSBA 3LRKA 4DN1A 3K30A 3LCFA 1TB3A 3WG6A 1RP9A 4JOMA 1KM5A 2DVUA 1H3GA 1F3EA 2HVNA 4OJYA 3LPGA 3PBWA 3AS3A 3N6HA 1LL7A 4DLMA 5KEZA 2VEFA 4XTDA 5CBJA 1EJXC 3Q2DA 3AHZA 3GG1A 2ZZCA 4P7NA 4Q7NA 4PMZA 3FKKA 3AS0A 2VR5A 2NV9A 1VIWA 5E93A 2P0OA 1VFTA 3E38A 2HPMA 4DUWA 4HNUA 2VQUA 4Z2IA 3W27A 3UG3A 3GC4A 4HHHA 3VX0A 3IJIA 4ML4A 1TUXA 3VZXA 4EQSA 2DT3A 1UR4A 2D3NA 2EPKX 1XDLA 2CHRA 1AQ0A 2YCJA 4FOUA 4PUEA 4YTSA 4RK8A 1J93A 1GVEA 5DEZA 2MNRA 3IVTA 4LJ3A 2OEMA 3EX1A 1BTMA 3P67A 1GEUA 2X7VA 1JYVA 3MJMA 1UPPA 2YA1A 3PBMA 1EUNA 2D2OA 3BLOA 1GJPA 1AJZA 1LG2A 2VFDA 2GUBA 3GHTA 2QXWA 5CJMA 5I78A 2QMKA 4JIIX 1KXHA 3B05A 1EF2A 1V6XA 3BV7A 4HIBA 4B2DD 3CXBA 2BY0A 4FK9A 2E5DA 1NFGA 3GFYA 1JG9A 3N9SA 1J4EA 1PTDA 2CBVA 1XICA 2DT1A 3ABXA 3B8IA 4MJ4A 1ADOA 1EH9A 1EZWA 4AISA 1GVRA 3SM0A 4GC3A 1JFHA 3QZAA 4LAMA 4UTKA 3RPMA 3QFEA 3SUUA 3BUVA 5CBBA 1TELA 1NOWA 2FVKA 1E15A 3VD4A 3P7YA 3DESA 3WJZA 5FJIA 1OD8A 5CKSA 1RA5A 4EPBC 4LRTA 1EGZA 4J35A 4UCFA 1E55A 2VVNA 3W86A 1B54A 1JROA 2TRSA 1ZBVA 1W5PA 1VIZA 1AJ2A 3T2PA 1OFEA 3Q94A 2QF8A 2RJHA 1YLVA 1RQEA 2OSYA 4NX0A 4RE2A 3L4VA 4C60A 1AVAA 4HMEA 4JXCA 4H8HA 4GVIA 4H4XA 1EJUC 2FGBA 5A6SA 1KXVA 4MWAA 3ZWSA 4F0HA 3SN1A 1XL9A 2OYLA 5IM51 1XIHA 3AROA 3N2OA 3GVGA 1IZKA 2VXNA 4INFA 1GETA 3J7HA 4OBSA 4C6CA 2V6AA 1PTAA 4HMCA 3UU0A 5LKYA 4LFYA 4Z2LA 1XLIA 4LV9A 6PTDA 2Y6ZA 4AEFA 4LC6A 3ARYA 3CPGA 3T78A 7A3HA 1XLHA 3GHSA 1ONFA 3GVVA 2GUUA 3WQ4A 1AL7A 2V5JA 1LTDA 4ZOEA 1T40A 5IHRA 2YL8A 4QISA 4IFRA 3TAOA 3AXXA 1I6NA 5CG7A 2FGZA 2YBUA 4C7FA 2Y24A 3UPBA 3LGEA 1HJQA 4S3BA 1XIEA 4EX4A 3WH8A 1W9DM 2FB3A 1PV8A 1F7BA 3BG5A 1UMYA 1A0DA 5FJRA 1SJDA 1GG0A 4F9DA 5FKYA 1GNXA 4MAVA 3WX7A 4GJJA 2Q09A 4DNAA 3CO8A 4GUFA 3MV11 3L0KA 5M1TA 1HVQA 3CHCA 1Q6RA 7TIMA 3PZIA 3RCYA 3AZSA 2GK1B 3RHGA 4UQEA 3PBVA 2GK1A 3I6TA 3IV8A 3WLNA 3F4WA 3DFYA 3E5PA 4HB7A 4PZVA 5HAOA 3PTDA 3T2QA 3UJRA 4QE1A 4JTTA 2CLIA 5G4HC 5BRQA 1SVDA 3VIIA 3VOCA 1JDDA 2EGZA 3B0UX 2FJKA 3K1GA 3PP7A 4MB3A 4HNLA 2HXUA 1US0A 2PDIA 2WWDA 3SRFA 2ZUUA 3AUOA 1JCYA 2UY5A 4YU1A 2VEKA 4O1DA 1K03A 4Q6JA 3U0HA 1XFBA 1HJWA 3NL5A 3G3MA 3MMTA 3C6CA 3DG3A 1PZ3A 1EO7A 3BJTA 1E0VA 2FQIA 5TIMA 1TJ0A 1RCQA 3PTKA 4UQBA 2XIIA 4Q32A 1FH9A 2ICSA 1K6AA 3W7EA 3LGGA 4LV4A 3MUIA 2Z7KA 2ZYFA 3GTFA 1EA0A 4J3ZA 5D30A 4D1IA 4UOZA 3CV7A 4WJXA 5HJYA 3H2NA 4RDZA 5BXSA 1BHGA 1Z48A 4FXJA 4JCMA 2YDSA 1AODA 3LCIA 5I03A 1EC8A 4PN2A 3W01A 1U5HA 3SSJA 3VOHA 5EBAA 3L4TA 3W7HA 1CBGA 2ZA3A 3NDOA 2R14A 4WRHA 3ZLFA 4ATWA 3VTRA 4ZR8A 4EWND 3TH6A 2OVLA 1B3XA 1N8IA 1XLKA 3WQFA 5CCZA 3T2OA 4F0SA 1OX6A 4PSPA 2FPTA 4WDTA 3CLWA 4IWWA 4H9VA 1TUFA 4R9OA 1UUMA 3DBNA 4F2TA 3U4AA 3H22A 4UQDA 2E1DA 1Q13A 5C9ZA 5FS8A 4PCTA 2BOFX 5TD4A 3POHA 1EJVC 4IPJA 5HINA 2VURA 3TYBA 1TJ2A 2VR2A 1X98A 2QIWA 1VH7A 4MJZA 1A5BA 4FLSA 1JXKA 1XBZA 3VE7A 3LBOA 3MUXA 3TAKA 1ZL1A 2P0IA 3LHYA 4E8CA 3C86A 1PVNA 1TMHA 1CTNA 1ZGDA 1KRCC 3TYEA 3DHDA 4JFUA 1PDYA 4QCEA 1NARA 3FN9A 3GVRA 3L5OA 1IE7C 2PURA 4HPXA 4WKFA 5HWNA 1XINA 3NQMA 3VGBA 1O95A 3FOKA 3KFTA 3IGSA 3W53A 2W4XA 3M0VA