4JN7A

Crystal structure of an enolase (putative galactarate dehydratase, target efi-500740) from agrobacterium radiobacter, bound na and l-malate, ordered active site
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
395
structure length
395
Chain Sequence
b'MKIDRMRVFMTRDKDRPRVIVALDTDDGLTGWGECYNHGPDKALPPILDYLYGFLSGQDPTRIDYLVNLLIQQSRFPPGALGLSAISALDHCLWDLSAKAANVPVYKLLGGAVRDRVKVYAGVYTAPDAPAARDEFDRLNAEWGFTAFKLSPWRVDIHAHRWGNVVKASADYFRSLRETVRDDYEIAFDAHAQIFEPVAARQLGNALAPYDPLFYEEPLRPENIDMWGDLKQGLNCVLATGESLYNRNEFLRLLQVKGADLIQPDICVVGGISEMRRIATLAEAYFVGVAPHNPMGPLATAVNVHFSAATQNFRILEYRLPKGQAYVYGGKDIEKRQGETRYVVDPYLPKDGYLELRPDRPGWGVEMDEKAMEEEGYIHWQRRVPKRPDGSYAFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOLASE
publication title CRYSTAL STRUCTURE OF AN ENOLASE (PUTATIVE GALACTARATE DEHYDRATASE, TARGET EFI-500740) FROM AGROBACTERIUM RADIOBACTER, BOUND NA and L-MALATE, ORDERED ACTIVE SITE
rcsb
source organism Agrobacterium radiobacter
molecule tags Lyase
total genus 132
structure length 395
sequence length 395
ec nomenclature
pdb deposition date 2013-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4jn7A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4jn7A01
3V3WA 1SJBA 4A35A 2QGYA 3CYJA 2OLAA 3DFYA 3S47A 1JDFA 4GISA 3I6TA 4GFIA 3MZNA 1P43A 3R10A 3QKEA 4H2HA 4IP4A 2HXTA 2OO6A 3Q45A 2XH7A 1SJDA 3MUCA 1MUCA 5IDZA 3ZVHA 1MDLA 3TCSA 3PFRA 7ENLA 2OQYA 3UJFA 2OG9A 1BQGA 2XH4A 2ONEA 1FHVA 1MNSA 4MKSA 3S5SA 3R1ZA 4MGGA 4DHGA 2GGEA 3CT2A 4M0XA 3P0WA 3R0UA 3TWAA 3BSMA 3UXLA 2FYMA 1IYXA 2PMQA 2OZTA 3PWIA 3SN0A 3THUA 3DFHA 1OEPA 1P48A 4GYPA 4ZCWA 1JPDX 1SJAA 3SN1A 3IJLA 3CAWA 3SJNA 4Z17A 3QN3A 3OZMA 1ONEA 2MNRA 2POZA 3GC2A 2I5QA 3UXKA 3I4KA 2PODA 4K2SA 4E5TA 1WUEA 4H1ZA 3H12A 1EBGA 2QVHA 1W6TA 4J3ZA 2OZ3A 4KEMA 3IK4A 3TQPA 4HCDA 3T8QA 3ZVHB 4Z1YA 2OZ8A 4G7FA 1KCZA 4IP5A 4HCLA 3Q4DA 4KWSA 3RRAA 3D46A 4EWJA 4DWDA 3R11A 2OFJA 4ZA0A 2PA6A 2RDXA 2AKZA 3FVDA 4DX3A 2XH0A 4GGHA 3MKCA 3VCNA 4K1WA 4A3RA 2HNEA 4GMEA 3R0KA 3NO1A 2PCEA 4X2PA 1NELA 4DYEA 5FJTA 3OPSA 2GDQA 3OW1A 3V5CA 1TZZA 3U4FA 3H7VA 3MWCA 4HPNA 4JHMA 3NXLA 4E4UA 2PP0A 4HCHA 3SQSA 3TOYA 6ENLA 3JW7A 4M6UA 3VC6A 3MQTA 3TJIA 2GGHA 2PTXA 2PU1A 1KKOA 2OPJA 3VFCA 2PSNA 4IHCA 3DESA 4JN8A 1TKKA 3UJEA 3P3BA 2PGWA 2XSXA 5FJUA 1ELSA 4HYRA 3CB3A 2QQ6A 3TWBA 3QTPA 3T6CA 3B97A 2AL2B 4DXKA 2P3ZA 1L8PA 4MMWA 5BOEA 1E9IA 1XS2A 2PPGA 3EKGA 2FKPA 3RGTA 3ZLHA 2OQHA 3JVAA 4ENLA 3ES8A 3QPEA 3MY9A 1JPMA 3DGBA 3UJRA 4ROPA 3VDGA 4E4FA 3MSYA 1PDZA 1YEYA 3OZYA 3UJSA 5FJPA 2QDEA 2DW7A 3IJQA 3VA8A 2DW6A 4HNLA 2AKMA 3HPFA 2AL2A 2GL5A 1EC8A 4K8GA 4IL2A 1ECQA 2PTWA 3PK7A 1SJCA 2QJMA 3BOXA 3OP2A 3T4WA 2QJNA 4F4RA 3T9PA 2XGZA 3KUMA 2P8CA 3DG3A 4IL0A 1EBHA 3TJ4A 3RO6A 2ZADA 3H70A 2P8BA 4GIRA 3RR1A 4J1OA 1EC7A 1KD0A 2PU0A 3H8AA 2NQLA 4H83A 3DERA 4G8TA 2PP3A 1NU5A 4JN7A 1FHUA 1MRAA 1PDYA 1KKRA 3UJ2A 2PTYA 3FJ4A 3N6HA 1DTNA 4A6GA 3DG7A 3CXOA 3UCCA 2GGGA 3QLDA 3ES7A 3IJIA 3TTEA 1BKHA 4IT1A 3SSZA 1XPYA 2PS2A 3GD6A 3ZLFA 3FCPA 5ENLA 3PWGA 1RVKA 3RCYA 3UCDA 3EEZA 3NZGA 3V5FA 3NFUA 3CK5A 2HXUA 4H19A 3N4FA 4KPLA 4HN8A 3DG6A 3DDMA 3I6EA 3R25A 3N4EA 3N6JA 2QDDA 2GSHA 3K1GA 2CHRA 2QJJA 4FI4A 3ENLA 1EC9A 3BJSA 4GYPC 3U9IA 4E8GA 3D47A 1F9CA 3V4BA 2HZGA 2OKTA 4KT2A 3GO2A 3ZVIA 2XH2A 1R6WA 2O56A 1TE6A 2PGEA 4E6MA 4YWSA 2PTZA 3TW9A 4FP1A 2GGJA 3DIPA 5J04A 3SN4A 3JZUA 3VC5A 2P88A 2AL1A 3RITA 3VCCA 1JCTA 4DN1A 3FYYA 1WUFA 2GGIA 4IZGA 2ZC8A 3FV9A 4HNCA 3ZLGA 3STPA 3SBFA 3OTRA 2MUCA 1MDRA 2OX4A 5FJRA 2PP1A 3P93A 5FJOA 1R0MA 4GGBA 5BOFA 3UGVA 2P0IA 2OVLA 3DEQA 5EU9A 3GY1A 3FXGA
chains in the Genus database with same CATH superfamily
2DSKA 5J5RA 2E6FA 4JNZA 2OGJA 3WEMA 3L2IA 2X2YA 4XUGA 1HKWA 2RFGA 3E96A 4DYJA 1Q6EA 4XBKA 4IPLA 4RV3A 3C8NA 1GG0A 4OUIA 3Q45A 2D0GA 1XINA 2R1PA 1S3HA 3DK9A 2J66A 2ACUA 3ZVHA 1MDLA 2I9EA 1JQVA 2KAUC 2I57A 2FDMA 3STEA 2PDJA 3FHQA 1BQGA 3R7MA 1TYTA 1ZZMA 3QBUA 1E40A 4MPQA 1YXDA 5C9XA 3CAVA 3CT2A 4O10A 2XSAA 4FX6M 2G3FA 1LRTA 3TC6A 1KXVA 1F3XA 4NAFA 2PMQA 1Q6FA 4O1CA 2BBFA 4V15A 4BJHA 3GVVA 3CQIA 4HD5A 2DGAA 2XIJA 3PSVA 3P7YA 1GSNA 2V3GA 3SUVA 4CNPA 3WMCA 2J7HA 1K9TA 3FS2A 3GNNA 5FACA 1JEZA 4BI6A 2XISA 1IZJA 2GJRA 1NHRA 5IHRA 3NEHA 2EGZA 4E5TA 1IZKA 1TVNA 4C6LA 3OU8A 1G5AA 3B0UX 2QUUA 3BPWA 3GW3A 1B54A 1GJUA 2J47A 1NSJA 4FZIA 5FAGA 2E3TA 2OJPA 1VYSX 3TQ0A 1Q63A 1GERA 3N1AA 3T8QA 1NQ6A 1KNWA 5H8PA 3A3HA 1E0UA 1XGEA 4Z1YA 1M68A 1HO4A 3POHA 3M6DA 3MI2A 3NL3A 5F1VA 4PSRA 2GQ9A 5JCNA 3PG6A 1QNRA 2VL4A 3MVIA 3DN5A 3RILA 1DHKA 1TB3A 4IIGA 3OA3A 2X50A 3WO8A 4GQGA 3VCNA 4GZ7A 4A3RA 4M1BA 4EWND 2WCGA 2OTDA 1US3A 2ZCGA 2BDQA 3EX2A 2WSRA 1H2JA 1OX5A 2G4FA 2EPMX 4LCSA 1Y8BA 4M7TA 3EDEA 1A5LC 4QCFA 1LYXA 4Z2IA 4IFRA 3DFOA 4W4QA 1ZAIA 2WJDA 3PTMA 3S2MA 2GUYA 2QPUA 4WSKA 3H7VA 3MCMA 4HPNA 4RJEA 1HG3A 4HOWA 2JIEA 3UXDA 1ZB5A 2PP0A 3TR9A 1JRPA 3BXWA 4DXVA 1W1TA 4MY1A 1R3VA 3VNKA 5H2ZA 1JNEA 4ZTXA 3BQ5A 1V6YA 1J93A 1QHOA 1RHCA 2V9DA 3QH2A 1XIGA 4NQ1A 2F9RA 1KFBA 4HYRA 1QU4A 3BWWA 4PB4A 3Q2DA 3AWNA 1WO2A 2RDTA 4XSMA 2V69A 4LCRA 2OEMA 5JUVA 1GTEA 1N8WA 1V7AA 1AK5A 4AU0A 4IXHA 2E1DA 2JIWA 1B9BA 4RDVA 1XHGA 3TA6A 2PPGA 2VR4A 2OWWA 3PN8A 2WW5A 4IH3A 3CB8A 3JVAA 3LCFA 4I6VA 3WLSA 3W1NA 4OFCA 4Q4MA 3BV4A 2GR0A 1FKWA 3SY1A 5HPOA 1EQCA 3MMTA 1QJWA 2JFEX 1T5AA 1UMLA 4Q8UA 4GYFA 2EPLX 2ZXBA 1LUCB 4JIHA 3G22A 3TW6A 1ZKQA 3RMEA 4WDUA 4C1NA 3YPIA 5CAHA 3CHDA 3WEZA 4D2JA 1QRQA 4LYRA 4L4OA 1NM9A 4HT3A 2Y6ZA 1JDEA 2Z7GA 2DIJA 3PR2A 3SECA 2X99A 4NNAA 1U5VA 5AC8A 2QCGA 4M56A 4H7CA 3EWUA 1MW0A 1C8QA 3UVAA 2ABBA 4X0VA 3CGTA 1OK6A 1CPUA 3BAYA 3BOFA 3OVRA 3ZWTA 1PEZA 4H83A 4HPJA 3OGRA 1JF6A 1LJYA 4C6JA 2EJAA 5C5YA 1WE5A 5AYBA 3MV01 3GDBA 4JTRA 3THQA 1E1CB 3QC0A 2XN1A 1J0ZA 2FHFA 1KC7A 4GVIA 1AZ1A 3N9SA 3SCRA 4JTIA 5A6SA 3C3NA 4ADTA 1UA3A 4GVFA 2QAPA 2I14A 1QXLA 4JEJA 3Q6JA 3UZ5A 3FK4A 2HJPA 5G1YA 5MKGB 1SO4A 4C5YA 3SJ3A 3H4WA 3EAOA 1J96A 4B5UA 4WIWA 4LCQA 2Z00A 3RCYA 4TMBA 3S4TA 1YE6A 4GIYA 1AG1O 1DYSA 3QPYA 1MW1A 1XCWA 4K37A 4WUIA 4ZOAA 5M17A 4BF9A 1H1NA 3UNTA 2HXUA 2C16A 2D20A 3N4FA 3T81A 1LOSA 2B0MA 1UMYA 3WD3A 1GOQA 4PODA 1N63C 2A7RA 1PKNA 4X22A 2E68A 2WBKA 1EC9A 3SQLA 1PCWA 3NVVB 2CBIA 4Y9OA 1R2RA 1EHAA 5H91A 1E72M 4WXZA 5ABTA 3TIMA 1K70A 4NZ3A 3F7JA 2XIOA 5C9WA 3OJGA 1XW8A 1CLXA 3T0DA 4OWGA 4FP1A 1PUDA 3N3TA 3UG5A 1Z3NA 2C1GA 1CGTA 1AW2A 2Y63A 1T7LA 5FJIA 4L65A 2WWDA 4P7RA 3RITA 3EWDA 4LS0A 2WM0A 5T9CE 3IEBA 2QIIA 5D03A 3W24A 4KEUA 5JQ9A 1PS9A 3SBFA 3CV7A 1B57A 2ALRA 2OX4A 2QCNA 2ZX9A 3DAQA 4RXGA 3NVYB 3S8HA 2NXHA 1AH0A 4PMDA 1EH9A 3AMKA 3H2FA 2ZXAA 4JYFA 4XTIA 4O14A 3WUGA 5F4WA 1A5AA 1BYCA 4DF0A 1CXHA 3AQUA 3GQYA 2CLKA 3FAWA 2Z1BA 3L65A 3TN4A 4JFWA 2ZTJA 1Q2RA 4H2HA 4O13A 1ZJHA 3A12A 5AHNA 3E74A 3TH6A 1W1IE 1W2PA 3WZ0E 4JGDA 3W74A 4J3TA 5AVHA 2DFAA 3WQOA 4A05A 2FTWA 3LUTA 1FHVA 1FWWA 3W3OA 3NQCA 5AC6A 1SPQA 3KP1A 3PJTA 1HT6A 4DUVA 4RE3A 2G3JA 4EANA 4H9ZA 4W5ZA 4X2RA 3RR4A 1FWJC 3TWAA 4N9EA 2VEIA 5CZTA 4FLOA 2CKRA 1EYEA 2WBAA 3A5FA 3W7RA 3U8GA 3AIQA 2QCMA 1VC4A 3B8UA 3AM9A 2VX7A 1UKSA 5C7VA 2WMGA 4WOQA 4O4WA 3WCZA 3AXMA 2ZDSA 2F8QA 4DAIA 4QG9A 1TTJA 4GCAA 4IPIA 5AYYA 3IJ8A 1BRLA 3PZUA 3T07A 4B16A 4QEHA 4M81A 1S2AA 2WMJA 2XVKA 4P8WA 3TC7A 3W71A 5KZ6A 3L66A 1TG7A 4QFUA 5IM51 3U6WA 4D9PA 3UU0A 1B30A 4MLRA 1KFWA 1HKIA 4GUHA 4KERA 4J3ZA 2QT3A 3GVWA 4RNJA 3E0FA 1DOSA 2Z2AA 1XI3A 1TRIA 3BLFA 3LMYA 1T8XA 5GNXA 4G7FA 4IP7A 2HDJA 1ODUA 1U30A 5TIMA 1JCNA 3O07A 2E40A 3T2QA 2PLKA 2WMIB 2XH0A 3CQHA 3MSRA 1GVQA 1N55A 4UFIA 1CB7B 1VIZA 4NX5A 2C71A 1U33A 1XBZA 3W2JA 4KKXA 2ZZ7A 4XQ6A 3PZVA 2CWNA 4WR3A 3HGSA 3GW0A 1S5VA 1EL3A 1IEQA 3VD3A 1GW9A 3LCWA 3E0VA 4JX4A 4GKTA 4EQSA 4OJYA 3GTHA 4NEVA 1XG3A 3OC4A 3NXLA 4UXDA 4N0RA 2BSLA 1OZMA 2NPXA 3JW7A 4QLJA 2PU1A 3UWZA 1RJPA 1Q6OA 1I60A 4KRUA 3W7DA 2Y1HA 5TNVA 2P53A 5BOOA 1A5UA 2CHOA 4JN8A 3WNNA 3UJEA 2EPNA 1I75A 4FLSA 3CUZA 3H2OA 1L6WA 2DQXA 1TCMA 2ZIDA 2QQ6A 2EQ9A 1AOGA 3HIJA 4UTWA 4DXKA 1JJKA 2VGFA 1L6YA 2P3ZA 4MMWA 3LPFA 3TTSA 3NCOA 2V8ZA 4M3PA 3W7IA 3GLCA 4L1XA 2WZMA 4H4TA 3EKGA 3H7UA 1O5RA 4J3VA 5KINA 2Z6JA 3CZLA 1YBQA 2VC7A 3KWSA 3QYQA 1KBIA 3DI1A 1RD6A 3UJSA 1EA0A 1PZ0A 4ZFMA 3W7NA 3UW6A 2J24A 2AKMA 4TVUA 3ZR5A 3ITOA 4DO7A 4AEEA 2AL2A 2XM2A 4IL2A 1IGSA 2QZRA 2NWRA 2PTWA 3MP5A 2GK1B 3PK7A 3E5BA 2RAGA 3LXDA 1AL7A 4OGZA 2DDXA 1CGVA 4IQLA 3T2PA 4Z2HA 3TZFA 4DM2A 1LOQA 3LN3A 2X8HA 1K8XA 2WXDM 2GVLA 4JXCA 1P6BA 3SRHA 3G1HA 1IEWA 1RALA 1Q7ZA 5EMJA 2DZWA 3AHYA 2VWTA 4MB5A 1CW2A 1TIWA 1PDYA 4JFTA 4XZNX 3REQB 4ZXOA 2B7OA 4NF7A 2QIWA 4DIAA 4OOUA 1W1B1 3RJXA 4HNNA 2DJLA 5IBXC 4EKJA 3NA8A 2FJKA 4IJBA 3TTEA 2PS2A 1W56A 1XWYA 2XZ7A 2Q8ZA 2GR1A 1ADSA 3LTYA 3SCVA 3LGEA 4QNWA 3VTRA 4W93A 4H41A 5AN7A 4ADWA 1JUBA 4NAEA 1MSSA 1MEWA 1HJXA 4DELA 4H4YA 4CVUA 1ENUA 2YL8A 4IG2B 2ISWA 4BFAA 3HGJA 1FDYA 2V2CA 1T8QA 4KPLA 1ZDLA 3WG6A 3DDMA 4MZ8A 4MG4A 3FFSA 1PCKA 3THCA 3N14A 2YL5A 2CHRA 4JY9A 5E70A 1QNSA 2FH8A 3EDJA 1JD7A 1UR1A 2VQUA 4UOZA 4E2DA 1EZWA 2GVYA 2ZQ0A 3FYPA 1RAKA 2AQOA 1SU5A 1BTMA 4BWLA 4K3ZA 1ICQA 2CLMA 3AFBA 5I78A 4ICCX 1IR1A 2FPYA 1KBLA 3IWPA 2VDHA 5GJNA 3VC5A 3UA3A 5AB3A 4IMAA 3VCCA 4JY8A 3ITXA 3F2BA 1X38A 4N6EA 1A0DA 1TUFA 2V5BA 4X9YA 1W3LA 2WMKA 2VT0A 1PYMA 5LGZA 1V77A 1SSDA 3IIZA 1QI5A 1MDRA 3MO4A 5FJRA 1A5OC 4QQ3A 3KW3A 1XJBA 3WBEA 1LQ2A 3QZ6A 4S3KA 1JRBA 1J0KA 3NPVA 4LUSA 4WHBA 4CNSA 4AIOA 3TFXA 2WOWA 4IMCA 3P61A 5D09A 3H4GA 3LHYA 4CNNA 3VNMA 3KBNA 3DBPA 4GFIA 3CO4A 1DQWA 4UTUA 4GQQA 2GR2A 3GXMA 4RPPA 2E9LA 3GD4A 3MKVA 3SCTA 2X8CA 3EDKA 1A49A 1K4HA 3W7EA 3TCSA 3QFAA 1SFLA 5EA9A 1WZAA 1REQA 5E0FA 2JKEA 4XZMX 1MXDA 5A6MA 2J6VA 4MKVA 2NX3A 3BLKA 3LPPA 3BG9A 4MWAB 1DWGM 4XZWA 3AWOA 5EFFA 3MSGA 4HNOA 4DUXA 5A2BA 4PTXA 3W7PA 3HO8A 2QDHA 2OZTA 4LAKA 3BCFA 4HB7A 2H8ZA 4AAJA 4M80A 2VR2A 2VI0A 2OEKA 1G67A 4ZGYA 4EMJA 1DWJM 4W89A 4NZCA 1GOWA 3ISIX 1OD8A 5C7HA 1JDDA 1S2UA 4UTWC 3NYZA 2TAAA 1JUKA 3SCOA 1M7OA 1IT0A 1XIFA 1TTIA 2UBPC 9CGTA 3UF9A 1MVYA 1RK6A 3DC0A 3SZ8A 3P5YA 3S6DA 3TYBA 1VP5A 2ZRXA 2PC4A 1KTCA 3UXKA 2PODA 3KWXA 1TJ1A 1UWIA 3VIMA 5C55A 1XH1A 5FKYA 3F2DA 4H9XA 2ZX7A 4LYQA 3FN9A 3W28A 3WLIA 4DJED 4DJFC 2ZUTA 2C0AA 4DB7A 4UOQA 1YHTA 1E4LA 5DRCA 5DEZA 5EPDA 1VBRA 6XIAA 3O16A 2J9XA 4DWDA 1BGAA 4TVWA 2E5AA 4A3QA 1TPB1 3D9XA 3NQGA 1OYBA 1DKWA 1EJSC 3GG1A 2WVVA 1IXNA 2HNEA 2PRLA 3OODA 5AFDA 1BXCA 2XIBA 4EPBC 1UBSA 3VKCA 5CPQA 2EG6A 4EAMA 4JKMA 1KGXA 2NT0A 4K7VA 2I56A 2ZA2A 2YDAA 5AVNA 3OPSA 1Z32X 4JTQA 3FKKA 1RD5A 3W53A 3SM0A 3LZ5A 4RW3A 2QUMA 2Z27A 2ZX8A 3VMOA 1GWJA 3QV9A 1R9YA 3A21A 2VOMA 5AZ0A 1WXJA 3VZXA 4PGLA 4AIBA 3ABRA 4H4QA 4QM1A 2OPJA 3T0CA 1DL3A 3IVSA 3M0HA 4YPJA 5C2GA 5TBOA 2IQ0A 2PF8A 3CHEA 2JALA 3W6LA 3JR2A 1GVYA 1XSIA 3SUSA 3IIPA 4JBRA 2YDQA 1EJVC 4U10A 2I16A 4FK9A 4LUIA 1W31A 1NOUA 3BUVA 2J3NA 4ZXLA 4JTAA 5FS6A 2BLEA 2REQA 3FDKA 1BYAA 5U7SA 5K9DA 2J9YA 1FWTA 3MUXA 4NRRA 4XD3A 2YSWA 3P5ZA 3WY1A 4JQ2A 3VIHA 2TRSA 1B9ZA 1Q6LA 2J9ZA 3VNJA 2XHYA 1YEYA 4GUJA 3NO5A 1EJWC 2VEMA 3BLOA 2DW7A 2VJXA 1BEUA 2YLLA 3CWNA 1ONRA 1ZCCA 2ZE0A 5DBUA 2XIQA 3SFKA 1EC8A 1JDAA 4K8GA 2FMNA 4YYCA 1U5JA 3ZJ8A 3EXTA 5HMDA 1MYRA 4R3UA 4NVTA 3OP2A 4Q7BA 2ZVRA 1DXIA 3WUEA 2J13A 3LPOA 1UUOA 4JYEA 4LAUA 3LCXA 1U2YA 4IX0A 3QFWA 2HCVA 1BF2A 4QAWA 1S46A 1GGOA 1KGWA 1JULA 3IV3A 3CL8A 1M41A 1E0XA 3V5OA 1WXZA 1E4MM 2YJQA 8CGTA 4GI8A 4XTDA 4IJRA 2F61A 4AHQA 1EP2A 3AC0A 4JTTA 3UY8A 4PE8A 3LI0A 3V0SA 5A6BD 3P82A 1OJTA 1D8CA 1W3TA 4CCCA 2PDYA 2D1ZA 4PUWA 4MF4A 1DVJA 4HOXA 3IK2A 4HU8A 3T42A 4EM3A 1J8VA 3WQWA 3UCDA 2BOEX 3KTSA 3UWVA 1W3JA 4P5UA 3S6OA 2VCAA 5ER0A 4ICNA 3QQWA 2BY1A 1YIXA 5JMUA 5KZDA 1VPYA 2OO0A 1JZ7A 3A4AA 2O9OA 4W7VA 1TV7A 1EUAA 1O95A 3WUFA 4NUWA 3NGJA 1KFCA 3S2JA 4ZODA 1W0MA 2WP6A 4B5NA 3R8HA 4UQEA 4JTSA 3VOJA 3ABQA 1M9HA 4N42A 4N9BA 3VNYA 2PGFA 3PTQA 5H6HA 3V18A 4AQLA 4HMDA 3Q58A 3TW9A 3AXIA 3FJLA 4D6HA 4DZ5A 3GNOA 4GKLA 2B4GA 3PULA 3CL6A 3KBMA 4OTKA 4O0KA 3MB9A 4ZO6A 5DELA 4AX6A 2ODOA 2NT1A 6TAAA 1VH7A 3BLDA 3QVQA 4PUJA 2O0TA 2Y5JA 3KM8A 2Z26A 1JAKA 4H4IA 5FJOA 3C0JA 1TSIA 5FL1A 4US5A 2X16A 5DLCA 2PD9A 4KGLA 3SUUA 4YXGA 5B80A 1THFD 4YVXA 2GJXB 3I10A 4NILA 6TIMA 3L4UA 1ITCA 5CGTA 4DBSA 1WX0A 2GSEA 4HQVA 5LA0A 1AJ0A 1FQ0A 4GNVA 2VX6A 3UQNA 4PB3A 2X1UA 3UFYA 5K2ZA 3N19B 3OA5A 2DU2A 1BKSA 2KX9A 3L0NA 3N11A 1MQQA 1JDCA 3T0BA 3W7LA 4E8DA 3RXZA 3SQMA 3S6TA 5DMLA 2EJ1A 3N12A 4M24A 1JPIA 5I03A 4JIRA 2QCHA 1LG1A 1AODA 1FH8A 4JFSA 3VMNA 4IFOA 3VE7A 2WVSA 5F4SA 4KWWA 4YTSA 3OYXA 4QAIA 1FBAA 1WCGA 3KRUA 1BXBA 1M53A 2XVPA 3KRBA 4UC5A 4Y6GA 3PUGA 4YTTA 3KS6A 3OVPA 5JIPA 3PWIA 1B4KA 1XCXA 3EANA 1MI3A 3CMGA 4ORIA 2IPGA 2W79A 4ERGA 2WZEA 1QNPA 2B81A 4B3LA 4C6MA 3GDLA 5LNWA 1GPFA 1PVNA 4DPQA 1TFVA 2BOGX 3MYOA 3PC0A 1FO4A 4OOZA 2OWCA 3HF3A 3CPGA 4REQB 5H8MA 2BC0A 4LB3A 3H21A 1UC4A 4JNYA 3W38A 1LWIA 3A5VA 2Y7GA 4PMNA 3UZWA 1EX5A 4DF2A 3GDKA 2BZNA 4FDCB 1TTPA 2QV5A 1EDGA 1OJXA 4JL1A 4FX9A 4IFKB 3GDRA 1VEOA 1T41A 3W1RA 2DIKA 2JEPA 1Q4WA 3S1GA 2VP8A 2X1SA 4RZBA 1O1ZA 2DSZA 3EOEA 3WQCA 4BKNA 1V02E 1FVPA 2VDIA 3CUXA 1MOKA 3CH0A 3NQFA 2RDXA 4YHGA 5EY5A 4DX3A 3UVIA 3FGCB 2VUNA 2CBVA 1R8LA 1SUXA 1X8FA 3TKFA 2PCEA 1V3LA 4BQ3A 2E3ZA 1KR1A 1XIBA 1HVXA 4R5EA 3FIGA 1FEAA 3OW1A 4LV4A 4YTRA 3TMLA 4EF8A 3ARUA 3PPFA 5HDRA 1SFTA 3TK7A 2PRHA 1Q2SA 4LT9A 3WQPA 4GQ0A 1PTAA 4QSHA 3SGUA 2WHLA 1KXQA 3P3BA 1OHLA 4JIIX 4QXIA 3TWBA 5CCZA 3T6CA 2TSYA 1X96A 3P6LA 5F2MA 2QMKA 3RX2A 3PTKA 4K8EA 1PL9A 3ARWA 3CS2A 4PRTA 1PAMA 5FS9A 5GJPA 1V3JA 1WQ5A 2NVKX 1TPFA 3P0XA 4U2YA 4ML4A 3VE9A 3XIMA 4Q8MA 3LHWA 3N04A 4W7WA 1JPMA 3PUDA 3HJEA 3Q65A 2EEXA 3PJUA 4Z0SA 1CXIA 1R3TA 1LVLA 1XDLA 2BVWA 1VPXA 2V38A 1EP3A 1XBVA 2G50A 3TJXA 4ZO7A 4F0HA 4JYDA 3AXXA 1A50A 3BW4A 4XAFA 5FMHA 1U1JA 4HHHA 2AMXA 4HOZA 3W9ZA 3VNDA 3NTYA 3RO6A 3SI9A 4PCFA 4U28A 2I9UA 4ZO8A 3VAVA 3FSTA 3PHAA 1ZAHA 4HYWA 3GRTA 1G4SA 3LPGA 2V3BA 3G2GA 1Q85A 3UR7A 2WSKA 1NU5A 1I4NA 3ARYA 3VIIA 5I07A 1S39A 1C93A 4CD7A 2VFIA 1GYNA 4MYAA 1DJIA 1UR9A 1JXJA 2FHBA 3FJ4A 3HOJA 3KTXA 2E5DA 2UY4A 1QFEA 1YDYA 2BHZA 2I17A 3WQEA 2YVJA 1E1FA 5I5RA 3UCCA 1KWGA 3QLDA 4CQ8A 4HMCA 3PFMA 4A8IA 3UYCA 3GXDA 4MDOA 2JBMA 4HJFA 3ORWA 5HQEA 4F66A 3LSCA 3VOGA 3N18A 4CVWA 3EX1A 3VIGA 1NEYA 3C56A 4DNHA 4LXFA 4XZIA 2FZBA 3HBLA 4PC8A 2QV4A 3GM8A 4WSJA 3NFUA 3CK5A 3T09A 3ZR4A 1KB3A 2YKKA 4UQDA 3QHMA 3GZAA 3UNDA 4E3TA 1ZTVA 1TJRA 3W2LA 3N6QA 1ME8A 1S1RA 4R7JA 5H1WA 3GS6A 3O6CA 1F8IA 3M0JA 3ENLA 1OYAA 3KL5A 3TC3A 1JD9A 3CAKA 2QAEA 2IKHA 1A80A 3D47A 3NQDA 1ZJBA 2DSWA 3S9ZA 4US6A 4KT2A 3ZVIA 4R9XA 3GXIA 1FTXA 4BV6A 3GRIA 2BOFX 2GDUA 4C90A 4NX0A 3DIPA 3ITTA 3ZJ7A 5M2FX 1B1YA 1K4QA 3CTTA 1CBGA 3H4XA 3L4YA 3ABXA 4XVDA 1OIMA 3U3HA 3UPWA 3VU2A 1JYXA 1RV8A 4AF0B 2W63A 3UR5A 1VFOA 1PX4A 3G1VA 3DOPA 2RGLA 4D1IA 3B0PA 5BRQA 1WBHA 1UD5A 2JGYA 3HV9A 4EQXA 2FQIA 2VD8A 1HJVA 1XBXA 1TZ9A 3QZAA 2YCKX 1V5XA 1FECA 1ZQ5A 4AIUA 4AWTA 1POKA 2Z28A 2DZAA 2O4QA 1NWTA 2HSAA 2WC7A 4QX4A 5CJMA 2ZZ3A 4CGTA 2PWEA 2W3RA 2PRMA 3DFPA 3RNDA 4XKYA 3ZQ9A 3NQEA 5KVIA 1E0VA 2Y24A 4D6FA 1S5WA 3NSXA 3MUCA 3PTDA 4AZCB 1JG9A 5TF0A 1BYBA 5E5CA 5E6ZA 4CN4A 1XLEA 5HUPA 2WVTA 4QJ5B 1HL8A 1PX3A 3GE7A 3RLGA 2HRWA 4JHOA 4MGGA 1SW7A 4I8DA 2Z2UA 4DHGA 5CGQA 1G4TA 3A9IA 1UKTA 1TIMA 2YAUA 4RE4A 1TYPA 2VEFA 1HNYA 5DT7A 3N2TA 4W5UA 1P0KA 3CLWA 4UOJA 3RLUA 4CU7A 3POCA 1WDPA 4GYPA 4Q33A 4GI9A 3AO0A 4FALA 1K77A 1RA0A 4JS3A 1J10A 4EAYA 4NEWA 3QOMA 4V33A 1CGYA 1MW2A 3OVQA 3EB2A 4C6KA 2ZUSA 4ZB0A 2WB5A 3KBJA 2EF9A 2V5CA 2C13A 4DWSC 2R1NA 3NVWB 2OEJA 1XYFA 1G69A 1WKDA 2G5WA 4EF9A 4QEEA 4C1LA 2A3BA 3H2MA 2PB1A 3WQ5A 2CLIA 2BXVA 1UKOA 4AXNA 3NDYA 1RLCL 4WY0F 2WNZA 3NZPA 3W7HA 1R9ZA 4IP5A 1FWHC 2GQWA 1FWIC 5ABFB 3C4UA 4YMZA 2V6OA 5KITA 4D71A 5G4HC 1PX8A 3HQ1A 4AXKA 3CO8A 3FVDA 4GUFA 4ZZ9A 3LG3A 5EKYA 1OIFA 2YX0A 3T55A 4Y7EA 3VDAA 4E8CA 4GMEA 3B8TA 2J8TA 3CGEA 4Q4SA 3T78A 3LCHA 1HJUA 2VFFA 1I2RA 1XLKA 2A6LA 3OHMB 4C6PA 4KWVA 4FF5A 3KCJA 1DE6A 2DH3A 4DBEA 2RDUA 4B2DA 1R3YA 3BAXA 3MMUA 1C8XA 3MWCA 3VM5A 1VGAA 4BQ2A 4WGXA 4E4UA 3C2EA 4PYSA 1FFUC 5BRPA 4LVGA 2DEPA 3T2OA 4DAFA 4YWOA 3C0QA 4H9MA 3U7VA 1R3QA 2Q3RA 1CLVA 4A3HA 3VFCA 3PZGA 4IHCA 4S3CA 1FFRA 3AZSA 3N2CA 5CLTA 1L2UA 4UNLA 1F6PA 3EGJA 3H2EA 3MHUA 4HHMA 4RW5A 3F5LA 2D2HA 4H8UA 2WOIA 4S3AA 3AI0A 4XG1A 4FXFA 3C61A 1UD4A 5FAJA 1LBMA 4NZJA 2XZ9A 3GKFA 4FA3A 5E93A 1K7EA 1ICSA 1VHCA 1YRRA 3WX7A 3D3AA 4GUGA 1ZMCA 1J4EA 5DANA 3RO8A 1TZ7A 1NDZA 5C71A 4KCWA 1ME9A 4E4FA 5FA5A 1RCQA 1UR3M 2X42A 3ABOA 4KFOA 3BJFA 2QEZA 4XZ9A 1GRTA 2HQMA 2GOUA 5ABEA 5HQLA 3KLJA 2P1FA 1HXJA 1GYMA 4N2YA 4JDRA 5I23A 1XQLA 1QPNA 3T08A 1VEMA 4FIQA 3AS0A 5HUOA 3E49A 4AW7A 1EWDA 1O5XA 2NVCA 1A5CA 1NWRA 2X09A 4CUCA 3H7RA 2ZRZA 3DHPA 1EC7A 3W70A 1DWHM 3VIOA 1GKQA 2VZUA 2FIQA 4OQVA 4PMJA 1RPXA 4UNKA 4I9JA 4A3UA 1KKRA 3KRSA 4M52A 3B4YA 2PDNA 4B9YA 3W72A 4O52A 1EJRC 1STZA 3SY8A 4GY1A 3WJSA 2YOCA 2C15A 5D04C 4KWOA 4P2VA 1UZHA 2ZUUA 4PH6A 1A4MA 2QVNA 1W1VA 4YCPA 2VO5A 4ZFCA 1XISA 2Z1WA 3P2VA 3GD6A 4H8HA 1LCOA 1QNVA 4X0NA 1MZHA 2OOGA 4D6EA 4NYUA 2H3BA 1I8JA 3VGHA 3MI6A 1ONFA 5D32A 4UTMA 4XD6A 3VIKA 1BTCA 3V36A 4OT7A 3G24A 3BDKA 1Y5WA 1VR6A 4GUIA 4QISA 5E9AA 2FFCA 3O63A 3OB8A 1XG4A 5HJLA 4WD0A 1JCJA 1YQZA 2E8ZA 3HQOA 2V67A 4GYPC 1BZLA 3EF6A 3UCQA 3AIRA 4HA0A 2HZGA 3NWRA 2QLYA 3GO2A 3HFTA 3OBKA 4NZ1A 2CW6A 3EWXA 4UBPC 1HL9A 1MW3A 3KZPA 1Q4NX 2DV0A 5A6JA 4S3BA 2OYLA 4YWSA 4MNLA 2YA2A 5JXQA 1GOKA 4IOTA 1WOBA 2J7BA 3WQ6A 1TTQA 5C2CA 2J7FA 4XO6A 1GKRA 3QLLA 5G2WA 4IIBA 2E5BA 4I6KA 5DCBA 1PZ1A 2ZA3A 1WUFA 3QGKC 3L4ZA 4WJXA 1R3WA 3UBPC 1GRBA 4ECLA 3G1AA 1EUNA 3B03A 1H60A 3P62A 3MJMA 3WELA 3GK0A 4GH1A 3SIMA 1R0MA 2EQ7A 1H09A 1SM9A 2QKFA 1OC5A 3RHGA 3MKKA 1UBPC 3BURA 2CZVA 5DCDA 2O7QA 2HQAA 1FIQB 2PZNA 3N2MA 5HPCA 3KL3A 4C6DA 4UCFA 1RR2A 1W1A1 5C9UA 3THDA 2X1TA 1P43A 5B7YA 2E1WA 2V81A 4D6IA 4UTJA 1I2PA 1I6NA 1IEXA 2WPEA 2Y0FA 7ENLA 4XVEA 4XIAA 3VGDA 2J8GA 2GVGA 3RPMA 2PLCA 2F38A 4JCMA 4GACA 1W1PA 4Z2JA 3FA5A 1YX1A 2C19A 3TV8A 1H63A 3IUDA 3W7JA 1FRBA 3GXTA 3A7AA 1OGGA 3WDQA 3RK8A 5A5WA 2D2GA 2Q09A 2AAMA 3MCNA 3R8RA 4P61A 4FS9A 1Q6RA 4WZHA 3TZNA 5A8GA 2FZ9A 4PUNA 2WVUA 2Y89A 2Z1XA 1ZENA 4RE2A 2TMDA 1K8ZA 4L56A 4KFPA 4O1BA 4W86A 1GUVA 3WJXA 1A47A 4AC1X 1C8VA 4NRSA 1AFSA 3BO9A 1JZ6A 3GC2A 3N73A 4DNAA 1J11A 2CPUA 3UGRA 1YPIA 1FWBC 4AVFA 1C9WA 1B5TA 4IIDA 4GO9A 2BC1A 1D3HA 1UQZA 1W1YA 4DO6A 1EBGA 4UTFA 4CD4A 3N9KA 2OZ3A 2ISDA 1U1HA 5ABHA 1TR1A 5CPOA 1KCZA 2R82A 1V6TA 4A29A 1KA9F 1HP4A 3E2SA 5GPRA 1WAWA 2AGTA 3R11A 1KXTA 1XIEA 3RG6A 1LT8A 4DY1A 2V3FA 4B91A 3P14A 2WQPA 4UWMA 1DIDA 5HR7A 2XGIA 4PRWA 3OYZA 3URAA 2WOQA 1OGBA 1EO7A 1GOMA 3CTLA 1UB3A 3R0KA 3PG8A 5BCAA 4YL2A 2FZDA 3LQLA 1B4EA 3NQ8A 1LLZA 3UESA 4RZ5A 3SR6B 3FLUA 4IFKA 1F3EA 5AHMA 3CWOX 3IV8A 3V5CA 4GR1A 2CFFA 2BY2A 4GI4A 4PEEA 3N25A 1L2QA 4ZSUA 3AIVA 4TV5A 1P0NA 1CECA 1FP8A 2D2JA 2DVUA 1B90A 2YA0A 2UY3A 4GWEA 3SAZA 1KKOA 1VB9A 3L5AA 4XAZA 2HISA 2CERA 1XPGA 3DENA 2DZVA 1J6PA 5CGMA 1AQMA 2PDQA 1CXFA 4NXSA 3BLIA 3W83A 4BURA 4HBKA 3CUIA 1OY0A 1ZNNA 3DJJA 5BOEA 1R2SA 3O6DA 4QR6A 2VMFA 5D9PA 4U3AA 3RUBL 3UZXA 3SRDA 4B5WA 2ZTKA 1JZ2A 2AOSA 5AHEA 1VEPA 2PDKA 1CZ1A 2Y8UA 4Y9MA 4EX4A 1EOMA 3HV8A 3T0TA 3BJTA 4Y9AA 1U1UA 4Q6JA 4HZ6A 4O0QA 3OZPA 3UJRA 1PDZA 2FPTA 4DF1A 4HHLA 3KOZA 3QMRA 4D6GA 2BVTA 3NNTA 3ARVA 3E5PA 1LRNA 1UWQA 3HZ3A 4CNOA 2GL5A 2PWFA 3H2AA 5REQB 4IUGA 3AMDA 3WF3A 4WF7A 4ES4A 1G4EA 4UTTA 3WNKA 2G37A 3IVTA 1P5BA 1N60C 3L8KA 2VGIA 4F4RA 1GONA 1KV8A 1RXOB 1BWLA 1PXGA 2P8CA 2Z0IA 2ESCA 3WDRA 3EOUA 3GDTA 4Z0JA 5DN1A 1FWGC 3KBWA 4UR7A 3UA4A 1MZRA 4H9YA 4L1WA 5T9BG 3NRZB 2V68A 3CQJA 1B3YA 3GKAA 4PTWA 1RPKA 4H00A 3S2LA 2EPOA 4EACA 4JN7A 3WQGA 2W66A 1E6QM 1JFXA 4LUTA 3WLJA 2AQVA 1VJIA 5K7JA 3BAJA 2PWDA 4ZE4A 2FZMA 4LA1A 2VX5A 3WLTA 3LB0A 1VRDA 2GGGA 5I3DA 3LHZA 5E9XA 3GTIA 1R3SA 1XPYA 4PTDA 4IF2A 5AKQA 2I1OA 3J7HA 4L4PA 1FHLA 4G56A 1O5QA 1PKYA 2ZYFA 4LY4A 1VFFA 1RVKA 1HKJA 3S2CA 2QJIA 3HQPA 4Q8WA 1CIUA 5D05A 3W26A 3CJPA 5U4NA 3G18A 1LRQA 4K8HA 4FOUA 2DSUA 1DE5A 2ZX5A 1TWIA 1W9DM 4PR4A 1O66A 4FLQA 2UY2A 4R33A 4JIPA 3R25A 1GHSA 1IXQA 1QMLA 3UERA 3I3EA 1JYWA 1RCXB 3GG8A 3S83A 1MXGA 2YCLB 3CIWA 3N15A 5A6AA 1OSEA 1EGZA 3U2OA 2ZZ5A 2GFTA 2HE8A 1E9LA 4QDWA 5A6TC 4DI9A 3LERA 2HV5A 1V93A 3PZMA 1TMQA 4UFJA 2HK1A 4M7SA 2ATMA 1N7KA 3BK0A 1EXBA 4GVGA 3KBSA 1C29A 1GQKA 4LQ1A 2Z2BA 4XD5A 3O06A 2D69A 4YTQA 3TSBA 1GVEA 3A64A 4XK2A 3BGJA 4PMYA 1XR2A 3UZYA 2H9AB 4LAMA 5HWJA 2IPWA 4KCUA 1GRAA 1LG2A 5K4ZA 1F76A 5A69A 4M6VA 3HJZA 2OU4A 4FNRA 1K8CA 4AFYA 4JN6A 1ZL1A 4OIFA 4ACZA 2FGLA 2I5IA 4PL2A 3DEQA 3F4NA 4PMOA 1R47A 3H54A 1V59A 1XV8A 1UWTA 4H6KA 3PVFA 3CQ0A 3WENA 1X7FA 1V08A 4JKLA 1N61C 2DT0A 3R10A 5C70A 1OM0A 4AF0A 3N29A 5K3VA 2GR3A 5JCLA 1LBFA 1BWKA 3AJXA 4J7RA 5D4YA 4BEQA 1ISVA 1XYBA 2WC3A 3ZXWA 4QRNA 1V0NA 2XJ7A 1NTHA 3FHAA 3MT1A 3B8IA 3UD6A 1W5QA 3MUY1 2NX1A 4FF7A 1AZ2A 2QCFA 4QE1A 5CZSA 3GUGA 4LVBA 1K6AA 1TV2A 3WQDA 3IJ9A 4OUEA 2OZ0A 2OSWA 3TTQA 5I3JA 2FYMA 2G41A 3VILA 4TOQA 3SN0A 1ZALA 4D8AA 2W9MA 4ZTYA 3GXPA 4WDWA 3JZEA 5DRIA 3E0WA 1ODZA 3RLVA 4IGHA 3EBVA 2Z1SA 2G96A 1DIKA 4LAZA 3DXIA 3BL3A 1ME7A 3SJNA 4UMBA 5LGXA 2C14A 3IGHX 4TX9A 3TUUA 1K7FA 4W7UA 2OELA 3FAXA 5BU9A 4HNVA 2Z25A 2NW0A 5HA7A 3NM1A 4LEQA 4JTLA 2OSXA 3M41A 4OVXA 3USBA 3BAWA 2GH5A 3USZA 3GTNA 3W29A 3UG3A 5LIUX 1JYNA 2W0UA 4LTSA 5LIKX 4Z1AA 2CITA 2GZXA 3T1GA 3DYOA 1RQEA 4KEMA 2D3LA 5GJMA 3IK4A 4JQ4A 1S38A 4HVXA 1NFBA 3RFAA 3SCUA 2YBVA 5MF5A 3Q4DA 1ZY9A 6REQB 2WNNA 1RBOB 2HBXA 2HVMA 4AD1A 1VBJA 3W2KA 3NZRA 2DH2A 2QMJA 3NOEA 2CZFA 2PA6A 2QPSA 4A8LA 4P7OA 3G3DA 1OFOA 3R58A 3RJYA 1EOKA 3MA8A 3ZS4A 2DJXA 3NPXA 3QQ0A 4GC4A 2P76A 4J3SA 5A8MA 3BW2A 3ATYA 4IM4A 1VCVA 1V02A 2FVKA 2P5NA 1E5JA 4NY2A 4ATWA 4MADA 4V28A 1HKVA 4CCEA 4FX8A 4IJCA 2Q3OA 4PMXA 2TODA 3GAKA 1GV4A 9XIMA 4HCHA 5CJ5A 1D7YA 1XLAA 3TJIA 2AQWA 2GDVA 3QFEA 4JOMA 3CGBA 1OX6A 4PEKA 2PLMA 4O8RA 3TP4A 3DESA 4ORMA 4O4VA 3KVJA 3G1FA 3H26A 4MB1A 3RCNA 4KGJA 4UTIA 5HJXA 2ICSA 4WJEA 4DBWA 3SRFA 4ADUA 2YGYA 3LI1A 3ZSTA 3RNMA 1FA2A 2JF7A 5LHEA 3KCOA 1L8PA 3IACA 2CU0A 5F7UA 1DEDA 2OT0A 3DK8A 1K9FA 4AY7A 1Z42A 2R24A 4MLJA 2FVMA 3OLGA 4F0LA 4YLWA 1U5HA 3QHOA 3CT7A 5D37A 5I3IA 1XSKA 1DJXA 2X2GA 2FH6A 3P74A 1FEBA 1V6WA 4F9JA 5XIAA 2PCQA 3UWYA 3OEXA 3APYA 3LLDA 4DPPA 1QVBA 2PEVA 3W27A 1NPXA 2PDWA 2QDEA 1F4AA 2D24A 1O7AA 4WKFA 5DCEA 1XFBA 2QNEA 5HNUA 3GVQA 3TYCA 5LHFA 1HIZA 4IX2A 4GE8A 3RM4A 2GWNA 2QCDB 4NJHA 4JTUA 2POTA 1YDVA 3WQ8A 2DSVA 1OCNA 4ZOHB 1CB2A 3A22A 2BB0A 3AZTA 4PL1A 4PMVA 4P8XA 4Y9PA 3U2ZA 1SZRA 1H49A 1E73M 3TJ4A 3M5YA 4L6OA 1F2JA 3S3GA 3L9CA 4GIRA 1WZLA 1BD0A 3CUJA 4OBRA 3LOTA 5BU6A 4Z2GA 4C7FA 4US5D 2X0YA 3TLQA 4HNUA 3PANA 3IJDA 1BF6A 3O3RA 1L8NA 3QGAC 4QIUA 1BHGA 3GU2A 1NF7A 1AW5A 1UWAA 4OBTA 3GVGA 3OHIA 3W7CA 5SWUA 4IT1A 4QLKA 4I7VA 1RLDA 8RUCA 2PDXA 5FS7A 1J0JA 1QAPA 3WBAA 1FHDA 1SGJA 4IPJA 1KM6A 2WYSA 3WDHA 3W6MA 2FDSA 4PFMA 2CEQA 3GIQA 4LYPA 4U5KA 2YFOA 1DV7A 3EYPA 4TO8A 5I24A 3O15A 3T0AA 2Y5EA 4H4SA 2WZTA 2G8ZA 1SZEA 3QY8A 3IAPA 1RH9A 2HPIA 4ML9A 3SO7A 4FXRA 3B40A 1Y5VA 4J56A 3EWYA 2YYTA 2KZHA 2ZXDA 4OU1A 3I6EA 3N6JA 3GC4A 4P7NA 1XGZA 5CG7A 4C60A 3BGAA 2ZC1A 1FXPA 4S3DA 3V4BA 4AZIA 1ICPA 5C9RA 1S1PA 2A3EA 4IQEA 4NNCA 9RUBA 4UIOA 4BQ5A 1YXYA 1TE6A 4I3GA 1I9CB 2PTZA 3LNPA 3TYAA 4JL2A 1IWBA 4O12A 3SN4A 5CZ0A 3AU6A 4YN5A 2JF6A 4LRTA 2D2OA 4PN2A 1LP6A 9XIAA 2E7FA 1M6IA 3M6YA 2BHUA 1OX4B 4W9TA 4R53A 4CCDA 4TU1A 5XINA 4B90A 3TFCA 1JR1A 4DUOA 1S2TA 4L9XA 1WXYA 5D2WA 2PDFA 1L0PA 1YMYA 4E3VA 4WOZA 1WDWA 1T96A 4R7OA 2I5QA 3WNOA 1DIEA 3DGHA 3V75A 4LC6A 3RF9A 2GWGA 1VFUA 5G1MA 1WYIA 3MZNA 1OCJA 1UJQA 4O1DA 5LXXA 1XFCA 4LBUA 2HXTA 2G3NA 2DT2A 2XH7A 3ALFA 3AUJA 1EEXA 2Y7FA 4HNTA 3G0UA 3UT0A 1DPMA 2IS7A 3IIXA 5I2UA 1QWKA 1FUYA 5D02A 4ERAA 3IC9A 4AC7C 4IICA 5F4XA 3K4DA 3KOXA 4M0XA 4DJDA 4O50A 1GESA 3R0UA 1TMHA 2VC9A 3ZT5A 3AALA 4KF1A 3H6OA 1FDZA 4ATLA 4TQTA 4AZHA 4LRSA 1XP3A 3DFHA 3TA9A 2Y5SA 1KFLA 1ZX9A 2YR1A 4ZCWA 4KW2A 2DPEA 4ZE5A 3QSRA 2NVAA 1ITXA 4DRSA 2NV9A 1IT8A 1LZOA 3HPSA 4PZVA 4AB4A 2ZKMX 3VO0A 4DWSD 4NHVA 3CWHA 4HZ8A 4LALA 1Q6DA 5FOOA 2BGQA 4QJ4B 1SZGA 4BI7A 4XB3A 3WF0A 2PDBA 4UQBA 4Z2LA 1ZK7A 4NYYA 1KRAC 3WLNA 4JQ1A 1VFHA 1W6TA 1H7PA 1FH7A 3LRLA 4AG0A 4HP5A 2GUUA 3MMWA 1UH2A 3EWWA 3A3WA 1MMFA 5E1QA 4QS5A 3WH9A 1Z7AA 3ZVHB 4KRZA 1P0BA 2RDWA 1H61A 4HCLA 2CLHA 2QJHA 3D46A 1Q3NA 1W3NA 3TTYA 1P1MA 1F8WA 4RNFA 1UC5A 3W1LA 2Y62A 4WY0A 2A0NA 1Q6CA 1M5WA 3W6YA 1E5NA 4GGHA 3APGA 2BVYA 3WNMA 2DUZA 2J7DA 1UROA 3W7OA 1ZLPA 4NAFB 4LF1A 2W67A 3HG3A 4LVDA 2YB4A 3P8JA 5FF7A 1R2TA 3VDCA 2X1IA 1JCLA 3CHVA 2DZUA 5BMXA 3PNUA 4R85A 3DECA 2NQ5A 2XFFA 3QJAA 2QHAA 1XICA 4J27A 4C7GA 3UP8A 3RCMA 3TN3A 3URNA 1I1XA 4MVAA 3WF1A 3NVDA 1UHVA 1JCXA 3MQTA 5CZJA 3RPTA 4LV9A 1W17A 4QHRA 2GGHA 1XKJA 3MHFA 4S38A 1QWGA 4RNIA 4LWWA 1KRMA 2TPSA 3FY1A 4AWUA 1OF6A 1CXLA 1VFTA 1F3WA 2A3LA 4EPEC 1RBAA 1FWAC 1JROA 3B97A 5KETA 4U2ZA 3M0MA 4LYKA 5IRPA 3SUWA 3BZGA 2J78A 5LNSA 1XX1A 3IGSA 4L6DA 3RIKA 1J0YA 2ANUA 3R2GA 3O05A 1I0BA 4EK7A 1V79A 1GCYA 1VJZA 1ZFJA 4CLMA 1EHNA 3AIEA 3AIBA 3L4XA 3MP3A 3DKLA 5C6MA 3L68A 2AGKA 3GNPA 1I45A 1A3XA 4IUOA 5KVHA 4JICA 2QULA 1T0OA 4I8YA 1YTKA 3KCLA 3QW4B 4W87A 3Q94A 2GPTA 3QR3A 1SJCA 2YL6A 1VBUA 1WBJA 4ZQPA 2VC5A 3ZT7A 3QR1A 2OYMA 2WHMA 2XGZA 2PDPA 1NWSA 3MJYA 4GVHA 3NM3A 2VNCA 3DG3A 2ON3A 5E09A 1EQPA 1UUMA 3GYEA 3RR1A 1TELA 3UZZA 4Y2WA 3W1UA 4NASA 1G0CA 1QI4A 3HTWA 1GRHA 2YXGA 2B7QA 5CXPA 1W9BM 1UR2A 2CESA 4TX8A 3E2VA 1FFQA 1PZ3A 2X7VA 4JAWA 2X0SA 4A6GA 3GH7A 3GHRA 3K8MA 1GRGA 2QW5A 3QXBA 3ZLFA 1UP2A 3SRKA 1V3HA 4FO4A 3M4HA 3CNYA 2CETA 1OFPA 3VDHA 3HMCA 2OCZA 1F74A 4G2DA 2HWGA 3W00A 4JQ3A 4LFYA 3H22A 1NQKA 3M46A 3GWQA 2WJZA 2Y7EA 4HSNA 4XKMA 4N4PA 4X61A 1BVZA 3DFTA 3EPOA 2Z1KA 4BZYA 3F5KA 4DJDC 4ZQNA 1ADOA 2F5ZA 5HXMA 4GINA 4I5XA 1W5OA 2DT1A 3R94A 3DG6A 1KRBC 1A3HA 3CAQA 4GQBA 1J12A 1VDVA 1BYDA 2V82A 4MWAE 3G8EA 4YIWA 1S2VA 5TD4A 5BNKA 1WZKA 3BVJA 1FWDC 3KOFA 1W5MA 3LLFA 1XLLA 2A1YA 4I5RA 5A6KA 2QCCA 4O0ZA 1R6WA 1XIDA 1UASA 1PYFA 4PBEA 2PGEA 4J3XA 1D7KA 2GLKA 2J7CA 2VWSA 3AYVA 2YCIX 3W1MA 3NSNA 4EP8C 4IIHA 4RK8A 3WK2A 3RLHA 2R1MA 5DQPA 4DJEA 1H50A 5B7ZA 3R5EA 4X9SA 5F2LA 1LWHA 3NSMA 1XIHA 5D8ZA 3OQ8A 4Q22A 1J79A 1M7XA 4GBUA 3TU9A 2HS6A 3I7RA 4D6JA 1H51A 4KEZA 4AX7A 1UKQA 3WLLA 1TV5A 3KOYA 3DBNA 3LV5A 1JGIA 4GRSA 4LGXA 1M7PA 3MI3A 5G2HA 4PB5A 1EBDA 3THAA 1RQBA 1LORA 1GYLA 3W7QA 1X97A 1ZBVA 3TNOA 1GORA 1TQJA 2BVDA 4NI3A 3LX9A 5I7GA 1JGMA 1G01A 5EL1A 4O19A 1EF3A 1XXXA 1IV8A 4GZJA 3I4EA 3S47A 3GNDA 2XSBA 1K8YA 1N82A 4L5ZA 1O60A 2HTMA 2CFYA 2Y7DA 1VYPX 4BF7A 2NVDA 4V27A 1J5SA 1MUCA 4B2DD 4Z1CA 3STCA 3WDJA 2WANA 3UJFA 3W01A 1H62A 3VKAA 4YTUA 1QO5A 2JK2A 3LXAA 1QHPA 4HPGA 3W1XA 3ZSSA 3ZJ6A 3R1ZA 4MB4A 1VZWA 3DK4A 1AD4A 4JTCA 4RL3A 3VYLA 1OFAA 3UR8A 4TVCA 3K8LA 1K6WA 5HWMA 1D3CA 3UXLA 2EKGA 5I3HA 1AQHA 2VELA 4O1EA 5CSRA 1OEPA 5D8WA 4PCSA 4WK9A 3S9YA 5KTLA 3DI0A 7XIMA 3PM6A 1EP1A 4CU6A 2F7FA 1P6CA 2D23A 3C2VA 5G1TA 3T44A 3QN3A 4S1FA 4GFSA 3TYZA 1LF1A 1WDDA 1ZSXA 2MNRA 2NLYA 7TAAA 2NSXA 3VINA 2J7GA 1H0IA 3W1AA 1E6NA 2NV1A 5HMSA 5I6SA 3QTGA 3BAKA 3NQ6A 3NL5A 1JYVA 1EB3A 3W81A 1EEPA 1XRSA 1AL8A 1UIPA 1DORA 3GHSA 2NQHA 1EJ7L 4B3KA 1VBHA 3L5OA 1GQLA 4GO8A 3E0LA 1ZPTA 1GTHA 4EWJA 3W85A 3CZJA 1JQXA 1BXNA 1W37A 3MDWA 4AZ5A 4Q8NA 6A3HA 3NOYA 2V2DA 1LWJA 3ZO9A 3M47A 4GJ1A 1J9YA 3O9NA 5BW6A 3HMJG 4HHPA 4QGCA 3VNIA 2C79A 3FSUA 5A6BA 2C1IA 3QV7A 3TQKA 1G4PA 2ALDA 4BR1A 3ANYA 2CIPA 4PUEA 4ZQMA 1RSCA 3M07A 3EKLA 3E0IA 3AICA 3IRSA 3AYRA 1H0GA 2E4TA 2R1LA 2V0TA 2INFA 2WMFA 5CSSA 3SQSA 3M64A 1BRLB 2GJLA 4IQDA 4TIMA 2EPKX 1XSJA 4IMFA 1RUSA 1IXOA 4NG3A 5DFAA 3B3DA 1RP9A 1Q13A 3PBVA 1DIOA 2DUXA 4J2PA 1JPKA 4V1XA 2XUCA 1R3RA 1FXQA 4HKPA 2I7GA 3NGFA 4BEUA 1PBGA 1VCFA 1RVGA 2OQHA 3U7BA 1EDQA 2Y85A 5A6LA 4CNTA 3VIPA 4WKHA 1FFVC 4HTYA 3PF3A 4RXFA 3I6RA 5ECVA 3DGBA 2VGBA 3NQVA 3WD4A 4HN4A 4ROPA 5ABGA 3MSYA 2TYSA 2LLEA 4ZENA 3O6AA 1JFHA 1XRTA 2ISFA 4I9AA 3PZ9A 3IAQA 2A3AA 4PBGA 1OK4A 4NT0A 1V0MA 3BOXA 5LNUA 1OFQA 1K7XA 2WKGA 3W0KA 1F61A 1ZY8A 3HB9A 2HBVA 1EKOA 4EOUA 2VFDA 3EWBX 3WLMA 1QBAA 1QDSA 1XKYA 3PZNA 3VD7A 1XLFA 3H8AA 4C6BA 1XYZA 4WJ8A 3DERA 3LS9A 4GYJA 1CYGA 3O6YX 2BY0A 1CNVA 4JIEA 1FHUA 2R14A 2GQAA 2VZSA 3QHNA 1Q65A 1D8WA 2TPRA 4H7ZA 2QCDA 4RV8A 5ECUA 2ZUWA 3N13A 3CMJA 1E3XA 4I5UA 3E9AA 1XIIA 3ES7A 1Q1WA 1XLMA 3W75A 5HMEA 5IFPA 5J8LA 3H4KA 3L23A 1WDSA 5ENLA 3PWGA 2EAWA 1YBQB 1M01A 4GHRA 4GY7A 5DF0A 1R7AA 4RPQA 2E25A 4PTMA 1T6MA 2O7SA 1KTNA 1YNPA 2XG9A 1X39A 2NXGA 2WSPA 1BPLB 1CWYA 4QG8A 2WMHA 3GDMA 5BYWA 1ZMDA 1NAL1 1DJZA 5D2TA 5H8UA 2ZOXA 1NP0A 1BWVA 2CXGA 1TPH1 1N5XA 4A8NA 2YBTA 4BQ4A 3GH5A 2E9BA 1F7BA 3V1PA 2CBUA 5EMMA 1OF8A 4PMRA 3BJSA 1VIWA 1KBKA 3PBGA 3S5OA 3E38A 3VOIA 1XLJA 3QW3A 2XH2A 3AOFA 3IIVA 4AWSA 2Z4GA 3LBMA 4B5SA 3DYMA 3EMCA 2C18A 3QGVA 2C6QA 4GC3A 3C86A 4JTHA 2WAGA 3AMLA 3SR7A 5C9ZA 3SGZA 4AY1A 1TPVA 4ALDA 2NQZA 4QP0A 1JXKA 1TX0A 5CH9A 5CKSA 2VCBA 1Q8AA 5FD0A 3FYYA 2OXNA 1OBAA 3WMLA 4D72A 4PBFA 1PB0A 5EMLA 5FF4A 3O0FA 1NDYA 4QITA 2YVFA 2JKPA 2PP1A 4UCGA 5FEZA 4NAEB 3KRZA 1XQKA 1KM1A 5C2XA 2HMCA 3GY1A 5FSDC 1E55A 2V2HA 2P0OA 3AJ7A 3CXBA 3M0KA 3URBA 1QPQA 3WJYA 5GQBA 2INEA 3K5XA 4KCTA 3I6TA 4XD4A 1EPXA 4HU4A 1HFBA 1G7UA 2PUZA 4UZSA 2OO6A 1JCMP 4Q4QA 2ZX6A 4DUWA 5DX7A 2YFNA 5EMYA 3R12A 4FEZA 3PFRA 4HYVA 4E2OA 1NHQA 1JZ5A 3EX3A 3DFSA 4L80A 5A95A 4K1GA 4L61A 3G3MA 3S5SA 1JNDA 4JX5A 3LM7A 5I3GA 2B7PA 1JVNA 3P0WA 1MEHA 3CLMA 1ISYA 3NQ7A 5HINA 3GVRA 1QNOA 3THUA 4UMAA 3SSJA 4CD5A 1KV5A 1Z9AA 2X30A 4O28A 5DT5A 3WH7A 3NL2A 1UH4A 3B8SA 5AC4A 4GNKB 6PTDA 2A7NA 5FEXA 3LDVA 3L5MA 2G4JA 4FR1A 3CAWA 4Z42C 3GNRA 1SVDA 1M3UA 4MDPA 3W82A 3UWEA 3OZMA 2BHYA 3N17A 3NURA 3MSDA 4GH3A 5CG0A 4I90A 2IUZA 1NIUA 1A5KC 4WRHA 3GG7A 3MP4A 1XCFA 1JZ8A 3UXIA 3KEHA 4WSHA 1KLYA 1YNYA 1IIHA 4H1ZA 4HPHA 4XAGA 1H11A 3CZEA 4XX6A 4BWLC 4NJKA 4J35A 1UOKA 4XV0A 1AQ0A 4XAPA 1VD6A 3A13A 3V0TA 1REQB 1VQZA 1DQUA 4XUYA 1E6SM 5EBAA 5CJNA 2ZZ0A 3DZ1A 1H4PA 1XLCA 5AHLA 4B4FA 4LBRA 3S1XA 3UR2A 3SCQA 1AH3A 2YQUA 4A2SA 2UV8G 3AYSA 4K1WA 3C2FA 1P1XA 1R9XA 3TX9A 4NZ5A 5DO8A 4OE7A 1LUCA 1QT1A 1TO3A 4HK6A 3WF4A 3GB6A 3WL0A 2DZTA 3H24A 4UQCA 1NELA 1V8EA 3VX0A 1O5KA 2ZZ1A 1F6KA 2WSQA 2BMBA 3QZEA 3LTSA 8A3HA 5HATA 2PDGA 3U4FA 2A85A 3OG2A 4GBDA 1NOWA 1EFZA 3VZZA 3AHTA 6ENLA 4GNJA 1PTDA 3H53A 1QW7A 3EPNA 2YA1A 2PURA 4IMDA 4H4XA 3BCDA 3PUEA 2OQLA 3M5VA 3W84A 2BXZA 1E1CA 4IIFA 3GIYA 3V35A 3NDOA 4APNA 2J7EA 4LJ3A 4C91A 1JIBA 1TE1A 3ITLA 4MAZA 3Q67A 1NVMA 1QTWA 3G1YA 4DZIA 1DJNA 4H4RA 3B9OA 4WKAA 3IJ6A 2ACSA 2ATSA 1WYGA 5MKGA 4QTGA 5RUBA 3FOKA 1EO5A 1PV8A 2Y61A 3UG8A 5HULA 4QE5A 4H4PA 4BK9A 2RJGA 1B3VA 2WVVB 3VDGA 2IQDA 2VYOA 3OZYA 3BG5A 1QOPA 1HO1A 2DUAA 3IJQA 1WZMA 4LU0A 1TPUA 2CCRA 2Q8XA 4HNLA 3IUIA 3IVUA 2PWUA 2A2IA 3ZOAA 3TYDA 1BQCA 5M5DA 4AZ6A 1J01A 2ZICA 3VD5A 4F0SA 1TPC1 3PZIA 3SCPA 3D3FA 3LXBA 3NXFA 4MSSA 2WNWA 3W2NA 2BP1A 2QAFA 3CU2A 3T4WA 4KPRA 4MZ1A 1ESWA 3W87A 3K2GA 5CQ1A 2XVGA 1V3MA 3HGRA 1SMAA 1TV8A 3I3DA 1HTIA 3XINA 2W6RA 4LX4A 1F3PA 3KX6A 2YZ5A 1FKXA 3RAOA 3S1UA 4MB3A 1TMLA 2E28A 1E15A 2XYLA 3DC8A 3WUBA 1W32A 4W84A 1A4LA 4Q8VA 3MWAA 3WFLA 4MUZA 1B3ZA 1OT2A 1E6ZA 4Q4RA 1MRAA 1BFNA 4NP7A 2G0WA 3SDOA 2WM1A 3LA4A 2XIIA 4EM4A 3W1QA 1VF8A 1SQ7A 1ZCOA 4PTVA 4ZB5A 3B0XA 1VS1A 3W7MA 3C2YA 3IJIA 1BKHA 2ZRUA 4H50A 1T99A 2REQB 5LKYA 1WA3A 2BY3A 1RCOB 4LS2A 4DZHA 3F5JA 3AMZA 1UR4A 5CEWA 2W92A 3M0VA 4IIEA 5I0DA 3C8FA 3A3XA 3EEZA 1XLBA 3QC3A 3QF0A 2HPMA 3B04A 1XM3A 3KXQA 4KETA 1AVAA 2WNQA 3R13A 2XVNA 4L1GA 5A94A 4W8LA 4H19A 3GR8A 1W8GA 3I7SA 4RUBA 2VZTA 4M51A 4D6CA 4TX6A 1QPKA 3QYSA 1SW3A 3L0KA 4GXMA 4K7ZA 1VLIA 2ZDRA 5CPMA 2VZOA 4F2BA 4GYKA 1B0IA 1QCWA 1O1HA 1DJWA 1VFLA 2WJEA 4E8GA 4MFEA 3KL0A 2Q8LA 2YZRA 4D1JA 5EFDA 4JNMA 4Y90A 5CPSA 3W23A 1M6JA 3WK0A 5G5GB 2I5GA 3M43A 4J5NA 4JPGA 2DT3A 3CQKA 2NUXA 2BFGA 4B3ZA 1PKMA 1IIGA 3L21A 1ALDA 5AOUA 5J04A 1W9XA 3SIZA 2VCCA 4UB9A 4EIVA 1QPRA 1I2QA 4MJMA 5F2IA 5LXEA 4I9MA 2NZLA 1TRDA 1SFJA 1VAHA 4C6NA 1ISXA 1CTNA 5T8GA 4RLIA 3TEVA 1BWCA 4IZGA 3KVKA 3PS7A 1N62C 1V03A 2OR2A 4HNCA 3ZLGA 2XWDA 3FEMA 1MFVA 5A8NA 3GFYA 1TPDA 3L7RA 4B5XA 1UZDA 2ZWZA 2V3DA 3BC9A 1FDJA 1L6GA 5DMNA 2PDMA 1XD0A 1YTEA 2WOVA 3VUSA 1SJBA 4A35A 5D30A 3B9DA 4ZBCA 5JRBA 3DFYA 3MZ2A 2EQ8A 1P0EA 4JQAA 4B92A 1SB3B 3QKEA 3W2UA 1VFMA 3ICJA 3U5YA 3BV7A 3GD3A 5L9FA 5A2AA 4S3GA 4GI6A 2J77A 3LXCA 1DXEA 1XYCA 4IQJA 4H6EA 4XZHA 1CXEA 4ZOBA 2H90A 2GGEA 3L0GA 2A4AA 3PJWA 4ZR8A 1QASA 2WMIA 4FR6A 1TJPA 4AVNA 3O7UA 3UG4A 1OT1A 2PC8A 3WMSA 3EWCA 1J0HA 3IIOA 1VYRA 4JFUA 3CZKA 5F2GA 3RM8A 1J2BA 3RMJA 3N2XA 3OO2A 3CYVA 5EGRA 3AZRA 4AVOA 4KRTA 1PIIA 3SB0A 3AS3A 1XYAA 3LNMA 3BQ6A 3W4RA 4PMUA 5CPTA 4NL1A 4H8VA 1AA1B 5JCMA 3TJLA 1T40A 5LNVA 3HRDC 3OIHA 3WNPA 3C2RA 3OQEA 3IGXA 2QF7A 2HS8A 4F3HA 3VGEA 3HM7A 5G5HB 3PUOA 4ZQCA 2PWHA 2QCLA 3PZTA 3UETA 3M0YA 3LGGA 4LC8A 3WH5A 4X60A 4K6AA 1WDQA 2F2HA 1PJ9A 3ARXA 4MKNA 5DY3A 1GNXA 3PP7A 4ILSA 2WP5A 1MO0A 2G95A 4N9DA 3GXFA 1L6SA 4YYFA 4POCA 3GH4A 2ZBTA 3PPCA 3WK1A 4WDXA 3MKCA 3NQ2A 4FOJA 5IBXA 3BSGA 5IDIA 1RJQA 2VTFA 2CBJA 2IPJA 1MNZA 1SW0A 1PIFA 3RRXA 3H2CA 2J88A 4HJWA 2QJGA 1LLWA 1QHZA 4HA4A 2GK1A 4GY0A 2CDUA 5JCIA 4UQAA 3WKZA 1JI1A 1AUSL 5LYRA 4C6EA 1YXCA 2FZ8A 3AHVA 4JHMA 3VKBA 2QR6A 1XC6A 2FGBA 4KESA 3PPGA 5BXRA 4JTKA 1BGGA 3R4IA 1W1ZA 5FJJA 3ZJKA 3T4CA 5E6YA 4C65A 3DHUA 1HL2A 4F0RA 4R7WA 1F3TA 3REQA 2YVGA 4W8AA 1CEOA 1WKFA 3VCRA 4KBXA 4EXQA 1V7YA 4AZGA 3U2CA 4A2RA 1E0TA 4URIA 3LHUA 1X6LA 1UQYA 1EF2A 4H3DA 1EWEA 3A4XA 4H9TA 1ZBWA 1TX2A 2CNCA 3TYUA 3K46A 4O11A 1FWFC 3LADA 1OYCA 1Q1RA 5A3HA 1XANA 3S0CA 3GIPA 4ENLA 3DH7A 1P7TB 3T7VA 3S5ZA 1DXFA 4LNYA 1E56A 3DYPA 4PRRA 3NO3A 1ZUAX 3M0IA 1FWRA 1IWAA 3WBYA 4IG2A 5BWAA 2WPCA 1EJTC 3W22A 4RZ4A 4ZOEA 2GSJA 3WK3A 2J74A 2OSYA 1H2IA 1XDJA 2RGMA 2IXUA 3EA3A 1LLOA 1NF0A 1GVSA 2PZ0A 1YPXA 3ITGA 3ARPA 3T9PA 3H55A 3LMZA 5CBJA 4XBJA 4IL0A 5GVJA 3B0YA 2CKSA 1PO9A 5HNRA 3G1DA 3PJXA 1VBGA 1HP5A 1V4YA 2GQ8A 4S2BA 1S2WA 1HF6A 1J5TA 3GC5A 1KM2A 3UY7A 5I79A 3KP0A 3N6HA 1OB0A 2ZUMA 1ZS2A 2ZVIA 3WLHA 2H3DA 3SGGA 1G6CA 2C1HA 1KRCC 4RDWA 1O4UA 3B9NA 5DBTA 3FCPA 1UIOA 4L64A 4DWSB 5U25A 4A8RA 1H5YA 5A8OA 2Z7KA 1UR0A 3E12A 3GFXA 2C8NA 5G4EA 5AYIA 7PTDA 3BZJA 2JQXA 3E2QA 3V5FA 4KQNA 1M04A 2E6YA 3CV1A 1YPFA 4DJDD 5AYXA 1W5PA 4W8BA 1XH0A 2B31A 3NG3A 4DO4A 2W0HA 2GQ3A 3TN6A 5BXPA 3KFTA 1F4HA 3WBXA 4AZBA 2X8GA 4IGNA 2RJHA 4E4PA 3TONA 3NL6A 3WD2A 4AWEA 2OOFA 4F2TA 2Y88A 3EXSA 2XFWA 4M6QA 4NZ4A 2J79A 1YW1A 4MY8A 3UEQA 1Y7VA 4XZLX 4C6OA 2O56A 4AYGA 3UXAA 1GVIA 3AROA 2W5FA 4MAVA 2PBOA 1BAGA 4UZUA 3EX4A 1Q45A 3NEVA 5FF0A 4MWAA 3U4AA 1YYAA 2WCSA 4DJFA 3AMGA 2G3MA 2VHLA 2ZWYA 4S39A 1PE1A 2F6UA 1RP8A 4WXYA 1MWOA 1E4NA 2ZC8A 3BOLA 4O18A 1PKLA 2YLAA 4FXJA 3WEOA 1YDNA 3MVTA 4H4VA 1V6UA 1G1YA 2UY5A 3P93A 4EQWA 5G2IA 5JVLA 4IXXA 3OIXA 1K03A 4GGBA 3TSDA 3AHZA 3A7RA 3BLLA 3EAUA 2QGYA 4HIBA 4FX7A 4WDTA 4AD5A 2OLAA 1Y65A 3WLKX 1U83A 3KOWA 4FNPA 1B2YA 3WNLA 2FZNA 4IP4A 4CQBA 5IDZA 3HURA 3K8KA 5CC3A 4KIEA 4Q3MA 4EXBA 3HW2A 2NUYA 5LNRA 4J9JA 1ZBKA 1WP6A 3F4WA 2BV9A 5EBKA 1ZU8A 4O57A 4WEVX 4ONVA 3QV6A 1XL9A 4Q4PA 3ANVA 5BWFA 3CUGA 2VRKA 1EA9C 1IYXA 3DFQA 4ERIA 1GEUA 1U22A 3B9AA 4UR8A 1XIMA 4LW7A 3M5XA 1MUMA 1TWDA 1DWFM 4C6QA 5D2YA 5T91A 1SR9A 2HVOA 4KMQA 4QS6A 5D9OA 4GXPA 3R6IA 2E5CA 3FA4A 3U0HA 4RDYA 1W54A 3HG5A 1G94A 5FF3A 3M9YA 1BVWA 3JRKA 1WB0A 4G6CA 4JKKA 2WZHA 3NPUA 1YLVA 1VFSA 1JL8A 5D2XA 3TAKA 3V7PA 4XKYB 3GU1A 3JS3A 4Y9NA 3RDKA 2IPFA 3VABA 4JX6A 2O9TA 3L67A 1K1DA 4J3UA 3AHXA 1UKPA 1TWWA 2A3CA 3NPWA 3ZIZA 3VXGA 2A79A 3PAJA 2JGQA 1PHWA 2DVTA 3S1WA 3LTPA 1CCWB 5LIXX 1GPWA 5XIMA 1SO5A 5A1AA 2XGBA 3BMWA 2PF0A 2Y4SA 4HZMA 2OFJA 7ODCA 4O1FA 4YVPA 2W54A 1LL6A 2AKZA 2CLFA 4JTGA 2E77A 3MC5A 3LRMA 3VVGA 3OLIA 1KCLA 2FHCA 1ITUA 4G9PA 4MNKA 4AD4A 8XIAA 4EVZA 4QE4A 5FJTA 2Z29A 1LL7A 3CGDA 5KSWA 2O55A 1TZZA 3CPRA 4LS1A 1J6OA 4WVXA 2P10A 3MMDA 2YDRA 4AMAA 4YWIA 4GX9A 3ZR6A 3K13A 1LBLA 1VQTA 1VLWA 2GVEA 4ICMA 3WJZA 2W27A 1ADDA 3HPXA 1VPQA 8TIMA 4PCPA 1E71M 3TVAA 3K30A 4LF2A 4AHPA 5EYWA 5DMYA 2PGWA 1PSCA 4N7QA 3U57A 3CB3A 1ZJAA 1OFEA 4S3FA 1HKMA 1QUMA 4LIIA 1H41A 4ATDA 1OADA 2HEJA 1H7RA 2VM8A 5LSMA 1AQFA 5CZKA 1GETA 4L4MA 3W73A 3LRKA 3VNZA 3N2BA 4QQUA 1KFKA 3CL7A 3RGTA 3G1RA 3LHTA 4MJ2A 4DO5A 3VIFA 2X40A 3ES8A 3MY9A 4GOAA 1KM4A 3GBEA 2NWSA 3K1DA 1WAUA 4O8AA 1XLDA 4BY3A 1K4GA 4BHYA 3VA8A 3OBEA 1BSLA 1LQAA 4CEUC 2YPIA 2B7NA 4MWAC 2W3ZA 4B5TA 1PIGA 4UFHA 3W7GA 2CLLA 4TVYA 3BLEA 4M82A 3EKZA 4JD4A 1R46A 3EPMA 5JU6A 3ZZ1A 2WV8A 3M1ZA 1EBHA 3A23A 2D73A 3WDPP 3H70A 1XYLA 4UUIA 4P8UA 5HQMA 1K9EA 4QNEA 1E0WA 2IKIA 1AMKA 1S5TA 3QY7A 3IARA 1FCBA 3UJ2A 2PDLA 3SCWA 2VOTA 1RA5A 4RNHA 3DH9A 4O54A 1JPHA 1HGYA 3FEQA 2PBGA 2Y8KA 5AHIA 3G0SA 1FCQA 1UWSA 3COTA 4RCXA 5DY2A 3CEPA 1ZXIC 2XFYA 1GVRA 5F1UA 3B06A 3ELFA 4NI8A 1UR8A 3NZGA 3HQNA 2EXOA 4CU8A 4PCTA 3SCNA 1HQTA 5HMFA 2GJXA 2J27A 4FIRA 3TW7A 3EX6A 1HX0A 2G97A 1BVNP 3HN3A 3HG2A 1NDVA 1W5NA 3O8AA 5G5IA 2ASHA 4HZ7A 3VD4A 1GOOA 2VEPA 3DJGX 3IANA 5CAKA 4PUKA 3MTWA 4B5VA 2RKXA 2XDFA 4CQ9A 3PB0A 3CIVA 1Q7MA 1MEIA 4GIEA 3U9IA 1F9CA 1MO9A 2FFIA 2Q02A 1UD3A 4J2MA 4WX2A 5KMYA 3G5EA 3CC1A 2A3HA 2V5KA 1TYGA 3B8VA 3E6EA 4S3EA 5AC5A 4Q32A 5FS8A 2BWGA 2XFRA 4LSBA 3VOHA 1H5VA 1XF0A 1JCTA 4KEVA 4TXEA 3QQ1A 4AD3A 1W3HA 3S46A 1E4IA 1J2WA 1GZJA 1F6YA 4EPDC 1SFSA 3R07C 5K4XA 4GABA 1W3IA 1UD8A 1RY0A 3CM4A 4JTEA 4REQA 2ZRWA 4NZFA 3NS1B 3GHTA 1C9DA 3FXGA 2YW3A 3STFA 4ZOCA 2DP3A 4Z1BA 3OBAA 3P81A 4MOZA 1NARA 3MBDA 4GISA 1XUUA 2WHKA 4D6DA 1TCDA 4MFDA 5HANA 3W07A 3LB8A 3JUGA 4DLMA 1KBBA 1SJDA 3AN1A 1UPPA 2EBNA 3I65A 3TN5A 5MHBA 2OQYA 4C6CA 2Y70A 2NXIA 3MHGA 1OGSA 2OLHA 2NV2A 3ECQA 1RM6B 3ARSA 3GUWA 5HOSA 3EDDA 4JIQA 4H8NA 1TVPA 1UZ4A 2NSOA 1FWCC 4DQWA 1KFJA 2GUBA 5C54A 3FGCA 1C90A 2A21A 1TPEA 3WF2A 4W88A 3BSMA 3G8RA 1KTBA 4CQCA 4ZVJA 3NQBA 3NUKA 2YL9A 1TREA 4UNIA 5BRBA 2YCEA 4IGSA 2BGNE 1P48A 1ITQA 4RX0A 4GJIA 3NYDA 3QEZA 2X7WA 1J0IA 3VKKA 2MANA 1DQXA 1SJAA 3SN1A 5HAOA 2PGRA 1KFEA 4EXAA 3SFWA 1Z48A 3AS1A 2HROA 1WNOA 1ONEA 2FPVA 3TCEA 1UG6A 1Q6GA 2JEQA 1DP0A 2BX7A 4JDBA 3ME3A 1M1BA 1S5MA 1WPCA 3UPMA 4O1AA 3LM3A 1W3KA 3D0CA 3EXRA 4K2SA 3CUFA 1A5SA 1ZHAA 2WHJA 4M1RA 1CXKA 3WLOA 3W37A 1FY6A 3C0LA 3AUOA 4KS0A 4CQDA 3M16A 4AD2A 1EX1A 2WC4A 3LK6A 1MXSA 4L4LA 1UWUA 2WK2A 1IEIA 3KLKA 1I0DA 5I02A 1Q6QA 3BTNA 3G6LA 1S2CA 5K9CA 2C3CA 1AMYA 2BS9A 2EPHA 3VKJA 2VQTA 3VM7A 3TXZA 3QY6A 1AW1A 3V0UA 5I00A 1UWRA 3SCSA 4UTHA 3CV6A 2Z1VA 3WFAA 3KHDA 1V3IA 2OT1A 5BZAA 4M6PA 1N8IA 1XH2A 1CT5A 3GYCA 1N5WC 4X2PA 1GEQA 4L9ZA 4DYEA 3UWQA 4O17A 3GG0A 2WQDA 5JCKA 5AHFA 3TDFA 3ITCA 2L5HA 2J6XA 1KO0A 2VFEA 4PUDA 1TR9A 3VC6A 1X6NA 4OV9A 3GTXA 3LLXA 2QXWA 3MU7A 4GG9A 2FMOA 4L9YA 4M29A 4ZQRA 5JBEA 1TKKA 3A4JA 2AMGA 4FNTA 3GAYA 3URQA 3QR0A 5FJUA 3IS4A 1S3TC 1Z8AA 3KBVA 3S42A 2WWCA 2YBUA 3FW6A 2A7PA 1V51A 4EPKA 4HPXA 3AAMA 1A3WA 5IOBA 1MUWA 4QJ3B 2Y8VA 3EOOA 1OFBA 2ZRYA 1F5ZA 1W9VA 5KEZA 3P60A 3NQAA 1WDRA 3B0VC 2QDGA 3FA3A 4M5PA 1A5MC 1LT7A 2ZUNA 1K3UA 2OLSA 1X2GA 4E0CA 2WKJA 3M0ZA 1C3FA 1FX6A 4RKAA 2XIMA 1V6VA 2PDHA 3BLPX 4ASTA 1N8FA 3EDFA 3GR4A 3S5YA 4Q6XA 3KDOA 5FEWA 4D8ZA 4H01A 3Q37A 3BMVA 1KBJA 5C8BB 2DW6A 4G5DA 3KS5A 4MM1A 4OZOA 4LUYA 5L6UA 2W91A 1ZP4A 1A0EA 1PZ2A 1US0A 1ZP3A 2OGYA 1ZBCA 2GOKA 1DJYA 4PULA 3B05A 4UQ9A 4KH2A 4C5ZA 1P7TA 4TUFA 2W4XA 3EOLA 4YHEA 3D5HA 3MO7A 3TROA 1XRFA 1CGUA 1OQFA 4GPNA 3PBMA 3APTA 1R30A 3STGA 2CYGA 4ZB2A 4AEFA 5CC5A 2ZUVA 4YJ5A 3EZ4A 2FTPA 2PTYA 5JBFA 4PMZA 1HKKA 2WZIA 4H2CA 3WLQA 3DU0A 1QOXA 2E9MA 4QDMA 1QW9A 4CNUA 3DG7A 1H7XA 1EJUC 3RX4A 3PWAA 2A5HA 3B8WA 1OINA 3OGSA 3SSZA 2H6RA 4R27A 1P4CA 2YCJA 3IPWA 2PAJA 1H7OA 3RU8X 3IRDA 1NJJA 5GRTA 1R5YA 3NAVA 3N9RA 4EQRA 2CLOA 2XN2A 2DZBA 2XINA 3I3BA 3NR0A 3KE0A 1BG4A 3WLRA 3BW3A 3BGGA 2OODA 3VMPA 3N4EA 2AAQA 1XDIA 3RPDA 1JUEA 2J75A 1KWKA 1EGMA 3DCPA 3WQFA 4AZCA 4H04A 3M5ZA 4DWSA 1GVFA 2CWXA 4DVOA 1E9ZB 3OOQA 2FTYA 2OKTA 3VOFA 3W7KA 2YIHA 1XLGA 2VEKA 1Z44A 5FIPA 2QUVA 3VFLA 4FLRA 3F03K 3F2CA 1B3WA 4LUTB 2DIEA 4N02A 2J62A 3N2OA 2BG5A 1XLIA 3ITYA 1CGWA 3DHFA 2W61A 1JEHA 2UWFA 4MY9A 2RH9A 5A2CA 2AL1A 1UW9A 1QK0A 4KIRA 1ZAJA 1PWMA 3BICA 1GKPA 4G7EB 1Q7QA 2CZDA 1GK8A 3TYEA 4O53A 3II1A 3STPA 3OTRA 1EJXC 2MUCA 7REQB 1AH4A 5AY7A 2BCPA 4UTTC 2BXYA 3ZWSA 4O15A 1KGUA 4XO7A 3SY5A 1NDAA 1TWZA 2R9ZA 3B4UA 1TV4A 4NJIA 2BNJA 5EU9A 3VKDA 4JQ9A 2C91A 4J40A 3V3WA 5AYZA 1SO6A 4PUUA 3CYJA 2IW0A 2JE8A 3NVTA 4F2UA 5CSYA 3KDNA 1FP9A 1BLIA 1HUVA 7A3HA 2R1KA 1NHPA 3NIYA 4N4QA 4K38A 4ZSTA 4F48A 3VPLA 1OVDA 4XISA 2OG9A 2XH4A 3LYEA 1ONXA 5ABFA 4MKSA 3O0HA 2E8YA 3OZOA 3K4WA 1IE7C 3T05A 1F73A 3MANA 2WSYA 2R9RA 2DQWA 3G6MA 3DGRA 2QUTA 1SO3A 5JH2A 3C3UA 2PWVA 3I68A 3NZQA 3PZOA 3OLEA 2XN0A 4JFVA 3MS8A 4V1YA 2IMRA 2HE5A 2V3EA 3W2MA 1FOBA 2P3EA 3HGOA 4TV6A 3KTCA 3EMQA 4AUBA 1W91A 4PUMA 4ACYA 4Z17A 1TV3A 2X41A 4PFHA 2PLJA 1UD2A 4GZEA 4ACZB 1JZ4A 3BSHA 3UZJA 5JBDA 4LH8A 3VDBA 1MQPA 2VKZG 4IPNB 7TIMA 3LU2A 2QPXA 3GNXA 4E38A 3S9IA 3TNBA 4H6QA 1XBYA 1WKYA 4WCJA 1QNQA 4F9DA 1D7FA 2PD5A 2EHHA 3TQPA 4HCDA 4I7WA 3IUHA 4TMCA 1KQZA 3FDGA 3GTFA 1M03A 4Q8OA 2OZ8A 3WL1A 4KWSA 3RM9A 3WFZA 1OG6A 1OFDA 4HMEA 4DI8A 3R89A 4ZA0A 4H4UA 4MYXA 4Y8EA 1E70M 2OMAA 1LL4A 1TQXA 1IQ8A 3M7SA 1EPVA 1XLHA 3ARRA 4FHAA 5I77A 1FCVA 1H1YA 1XRVA 4YS1A 3ABSA 4ZL1A 2VEGA 2PFHA 2WBGA 3WN6A 1OC7A 2QS8A 5CC6A 2GDQA 1GOXA 2WLZA 3QOKA 2IQTA 4JZ5A 4UTLA 5I3KA 3WIJA 4H4WA 2WCAA 1C7SA 2ZA1A 4M6UA 2YB1A 1QBBA 3B9EA 1Q8JA 5GNYA 3W1PA 4NNBA 5DXYA 3O2LA 1Z69A 1V6XA 1HJWA 2Y2WA 2QYGA