2HQMA

Crystal structure of glutathione reductase glr1 from the yeast saccharomyces cerevisiae
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
462
structure length
461
Chain Sequence
KHYDYLVIGGGSGGVASARRAASYGAKTLLVEAKALGGTCVNVGCVPKKVMWYASDLATRVSHANEYGLYQNLPLDKEHLTFNWPEFKQKRDAYVHRLNGIYQKNLEKEKVDVVFGWARFNKDGNVEVQKRDNTTEVYSANHILVATGGKAIFPENIPGFELGTDSDGFFRLEEQPKKVVVVGAGYIGIELAGVFHGLGSETHLVIRGETVLRKFDECIQNTITDHYVKEGINVHKLSKIVKVEKNVTDKLKIHMNDSKSIDDVDELIWTIGRKSHLGMGSENVGIKLNSHDQIIADEYQNTNVPNIYSLGDVVGKVELTPVAIAAGRKLSNRLFGPEKFRNDKLDYENVPSVIFSHPEAGSIGISEKEAIEKYGKENIKVYNSKFTAMYYAMLSEKSPTRYKIVCAGPNEKVVGLHIVGDSSAEILQGFGVAIKMGATKADFDNCVAIHPTSAEELVTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of glutathione reductase Glr1 from the yeast Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords Glutathione reductase
total genus 147
structure length 461
sequence length 462
chains with identical sequence B
ec nomenclature ec 1.8.1.7: Glutathione-disulfide reductase.
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF12831 FAD_oxidored FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 2hqmA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2hqmA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2hqmA02
1KNPA 2VRMA 4Y4LA 4PABA 1PS9A 4A65A 2E4GA 4A99A 1NEKA 2EQ9A 2XFUA 2B9YA 1VRQB 5KXJA 4GDPA 4EM3A 2AAQA 3SGLA 3UP4A 2GR2A 3BHKA 1EL8A 1NG4A 1L9CA 4OCGA 2FJDA 3C4NA 2XVEA 1GETA 3VRDB 2XFNA 1RSGA 2V6OA 5CQFA 4A9WA 3UCLA 3O0HA 5KVIA 4TLXA 2C75A 1REOA 3CGCA 2OLNA 1ZOYA 2EQ7A 2GMJA 2CULA 3SFDA 4O5UA 1V59A 4OPUA 1E39A 2C7GA 4H4TA 2GAHB 4LA1A 3BI2A 3AEFA 3I3LA 3NYFA 3ITJA 3RP7A 1GRTA 3BNMA 2WPCA 2JK6A 2F5ZA 3REDA 2JAEA 3UKQA 4J2WA 2WDQA 3COXA 3DK8A 1PXAA 1YQ4A 2V61A 2Y6RA 4YSYA 5LV9A 4JNQA 4GR1A 3UOXA 3IWAA 4H4WA 4C3YA 1F8RA 3ICRA 3NT6A 4J31A 3S61A 4CY6A 4EQWA 5GSNA 5KWFA 3QFBA 1IUVA 4K7ZA 2YLWA 2WOVA 3V76A 1DNCA 3LZXA 2X99A 2GQFA 4EIQA 2WP5A 3AE4A 1H84A 2GB0A 3DA1A 3LADA 1XPQA 4OVIA 2XVIA 3H8IA 2WQYA 1VG0A 4ZCCA 2QCUA 4UDQA 3GDPA 2WETA 2XFQA 1B37A 3G5SA 4Z25A 1GXFA 4NZHA 1TYPA 4FDCB 2FJAA 4H4UA 1JEHA 1MO9A 3DJGX 3GD4A 1SEZA 1TDEA 4NTDA 1O95A 1O94A 3P9UA 4C74A 1ZP0A 3K7TA 4RG4A 1DOEA 5TR3A 1H83A 1KDGA 4EIPA 4YTPA 1OJTA 5KVHA 1EL9A 5BVAA 4K2XA 1H7XA 2WOIA 2GF3A 2C3CA 3ISHA 2C70A 3AXBA 3V3NA 1S3EA 2Q7VA 1S2YA 2V60A 1RYIA 3VR8A 1W4XA 4P9SA 4B67A 1FOHA 2OAMA 5BUKA 3KVEA 1X31B 3RHAA 1YKJA 1PJ5A 1LPFA 2V3AA 2XDOA 4GCMA 4H4ZA 4B66A 3NLCA 4YWOA 1GESA 1UKVG 4CCRA 4OPLA 3KD9A 2WEUA 3UTHA 4OPIA 1CF3A 3LB8A 2FJEA 3QSEA 2WPFA 4H2QA 1Q1WA 1NAAA 3AD7B 3CPHG 3G5RA 1JNZA 3GMBA 1Y56B 2QAEA 1H86A 1PBEA 3AD8B 1M64A 3CNTA 1ZX9A 1YQZA 3QFAA 3H8LA 1LVLA 1O5WA 3C4AA 4DNAA 2GH5A 5M10A 3PVCA 3FMWA 3LOVA 1D4CA 4GUVA 2QA1A 1GSNA 1P2EA 1VDCA 1Y56A 1IUTA 1LQUA 3FBSA 4OPCA 3CPJG 2Q0KA 2GEWA 2VZ2A 3VRBA 5EB5A 2BXRA 1LTXR 2YG5A 3QVRA 2TMDA 3H4KA 2R4EA 5DBJA 2RABA 3NYCA 2VVLA 2XLUA 4J56A 1FCDA 3BI4A 4AOXA 1KF6A 3M0OA 1H81A 3DJDA 1GT8A 2B9XA 3D1CA 1CL0A 1GERA 4I59A 1E7PA 2R0PA 3QSSA 4CBQA 3AEDA 1CJCA 3V3OA 2WESA 2GR1A 2BS2A 3AD9B 4H2RA 2YAUA 4HA6A 4IVOB 4CNKA 3UKAA 3WE0A 1GALA 4USQA 1GV4A 4REKA 1K0JA 4B65A 2YM1A 3NN0X 3AEGA 1L9EA 4BK1A 2XLRA 3UOZA 4C3XA 1PXBA 2BC0A 1TYTA 3DGZA 2YM2A 1DODA 1GNDA 1S2QA 2BC1A 1ZMDA 4OPTA 3IC9A 3K7MX 4GDEA 2BABA 2APGA 1TDNA 3NH3X 2ZZCA 1TDOA 2Z5YA 4AT0A 2IIDA 4YSHA 4DGKA 4Z2RA 2J3NA 2YR6A 1IUSA 3OZ2A 3AWIA 4A7AA 4Z44A 3II4A 2YR4A 2X50A 3ZDNA 4B1BA 2C73A 5C2TA 2ZBWA 5FS6A 4A6NA 1L9DA 2YVGA 2EQ8A 4H4RA 4M52A 4U8JA 2WOWA 4YSZA 2RGHA 2TPRA 4J34A 3VQRA 2GAGB 4J57A 3NRNA 3GD3A 1Q9IA 4EQRA 3GWDA 4NEWA 2WHDA 2WBAA 5FS8A 5GRTA 4APNA 4K22A 2OALA 4YTMA 1JRYA 4A79A 4Z2UA 2PYXA 3FG2P 1YY5A 2UZZA 3JSKA 3EF6A 2BK5A 4JQ9A 3DGHA 2X8HA 3T37A 2BACA 2OA1A 2FBWA 2ACZA 2R46A 1E6EA 3QSMA 4H2PA 5J60A 2DKIA 4RSLA 3E1TA 1D4DA 1KNRA 1TRBA 1OJCA 4WCTA 3UKKA 3B6DA 1JRXA 3CGDA 4MJWA 3M12A 2VRLA 4USRA 4BURA 4ICYA 4NTEA 1H6VA 5FS7A 4H4XA 4GRTA 1EL5A 2V3BA 1QJDA 4LU6A 4U2LA 5JCIA 4FX9A 1CJ4A 3CTYA 1XHCA 2YG3A 3RP6A 1D7LA 4O5QA 2WP6A 1F6MA 2XYOA 2H88A 3EAOA 1F3PA 4DSGA 3AE6A 4NTCA 4E0VA 4Z43A 4WX1A 4EMJA 3GYIA 2O9ZA 2B9WA 3NHOX 1PJ6A 4H4SA 4B63A 2B7RA 2YVJA 3GRSA 2C66A 1E1LA 4I58A 3FPZA 3ALLA 4IVMB 1CHUA 1MOKA 1PN0A 4JY3A 1E1KA 3NTAA 1N4VA 3P1WA 1NHQA 4OPGA 4U2TA 4YSXA 1K0LA 3F8DA 3P4RA 1E1NA 4Z24A 2RGJA 3ALJA 4U8LA 2B7SA 4OPDA 3CIRA 3DH9A 3NKSA 2QA2A 2YVFA 3BNUA 4D03A 4EQXA 5FS9A 3IHMA 1L0VA 2WDVA 5EBKA 4EM4A 2VVMA 4TLZA 1ZOVA 3ALMA 1QO8A 2YQUA 4TM4A 5HY5A 3F8PA 2GRTA 3P4PA 1CBOA 4YKFA 1QLBA 1CJ2A 5U25A 1JU2A 4BK2A 1GRBA 3ATQA 3FIMB 3NIXA 4EMIA 5KOXA 1CC4A 5JCKA 4U8OA 3NGCX 2WU5A 2GQWA 2WPEA 3LXDA 2I0ZA 3DJEA 3UTGA 2NVKX 3AE8A 1PXCA 3VRAA 4AP3A 3GRTA 2OLOA 1N4UA 3AEBA 1NG3A 2JB1A 3DMEA 2YG4A 3Q6JA 2XLTA 3PO7A 1GREA 4Z26A 2IVDA 1OJDA 1CJ3A 4BV6A 2ZZ0A 3P4QA 2Y6QA 4H4PA 4HB9A 2VVLG 5EB4A 3EANA 1Z6LA 2CFYA 2XLPA 5ER0A 3CNJA 3F8RA 1GTHA 1LV0A 3HZLA 4YXDA 3UKPA 1ZY8A 4IA5A 3DK4A 2BYBA 2C64A 4EQSA 1VQWA 2JB2A 1NHRA 2VQ7A 3GSIA 1K4QA 4NEVA 2B76A 3UP5A 5U1OA 1KFYA 5JCNA 1PBBA 4Y4MA 4KPRA 1ZMCA 4YKGA 2YLTA 2C65A 2YLSA 3KU9A 1MXTA 2XCGA 3AECA 4GF7A 4H4QA 4ECHA 3K30A 3UTEA 1NHSA 3AE2A 1GOSA 1FEAA 2X3NA 4KX6A 1EL7A 1BZLA 4CY8A 2Q6UA 2RGOA 3GDNA 4AOSA 3KKJA 3SM8A 3D8XA 3L1RA 1ZKQA 4JY2A 3AB1A 1VG9A 3K7QX 1BGJA 1DOBA 3UKLA 2BXSA 2W0HA 2YWLA 3BI5A 4DSHA 5BULA 3QVPA 2VOUA 2R45A 1IUUA 4X9NA 1N1PA 2DKHA 3M13A 4H7UA 4B64A 1H7WA 3AEEA 3CNSA 1JOAA 3DK9A 5C3JA 1D5TA 3RNMA 2E5VA 1B5QA 3BHFA 1GTEA 4X4JA 4CNJA 1DJNA 3P4SA 3URHA 2IVEA 1GRHA 2BCGG 1GPEA 1NENA 3AEAA 3AE1A 3R9UA 4H2NA 5J7XA 1IUWA 3EPTA 4Z2TA 2YLZA 3NK0X 4XWRA 2Q0LA 3KA7A 1H82A 1GEUA 3NK1X 4U8PA 3UKFA 3OC4A 1PHHA 2CDUA 2YG6A 2YR5A 3ADAB 1D7YA 1XDIA 1ZK7A 4B69A 4XXGA 2A87A 4TM1A 4UDRA 3DJJA 5IQ1A 3AYJA 2XFPA 3UKHA 2BS3A 1KSUA 4A5LA 1JRZA 2XVFA 5JCLA 4H4YA 2WS3A 5KRQA 4ZCDA 3AE5A 4C5OA 1BWCA 2JB3A 4X9MA 5IPYA 2XLSA 3AE9A 3GWFA 3I6DA 3UOVA 1PJ7A 4U2SA 1ONFA 1NPXA 1S3BA 3ZYXA 3CNDA 2WP9A 3C96A 2H89A 3AE3A 1TDFA 4JDRA 1F8SA 4LIIA 4H50A 1FECA 3ICSA 5L46A 4JN9A 2V5ZA 1DXLA 3NG7X 2EQ6A 3PS9A 2WU2A 2JKCA 1PDHA 1E1MA 2R4JA 4D04A 3AYIA 3GYJA 2R0CA 3CGEA 3UTFA 1PBCA 1JNRA 5JCMA 1IUXA 1TDKA 5CKUA 1LJ1A 2FJBA 4JNAA 1YQ3A 2BS4A 1XANA 5EOWA 1GRGA 4EMWA 1BGNA 4K5SA 1P2HA 4J36A 4C77A 2R0GA 2YG7A 3NTDA 4YT0A 1ELIA 2WDRA 3GMCA 3IF9A 2GV8A 4TM0A 2ARDA 3VR9A 3ABVA 4K5RA 4IA6A 4PAAA 3ICTA 2XVJA 2XFOA 1GRFA 4AP1A 2AR8A 4U8KA 4ZN0A 4Y4NA 1OJ9A 1Y0PA 5HYMA 4FK1C 2X8CA 1AOGA 2A89A 2C3DA 1DOCA 4UDPA 1GRAA 1B4VA 3AYLA 1Q1RA 1D4EA 2BA9A 2E1MA 5U63A 3LZWA 3UOYA 2VQBA 2A8XA 4IV9A 1B8SA 2BCPA 2HQMA 2R9ZA 4CCQA 3NYEA 2JBVA 2C67A 2CVJA 3Q9TA 3KLJA 1HYUA 1N4WA 1NHPA 1CC6A 3AE7A 3NNEA 1K0IA 3B3RA 5M0ZA 1FL2A 3IHGA 4U8NA 4U8MA 2C72A 4YTNA 4U8IA 5FMHA 2BK3A 4B68A 3SQPA 2C76A 4H4VA 4BJZA 2GR0A 3NN6X 2GVCA 1EBDA 3CNPA 1BF3A 5BRTA 4N9XA 2GR3A 4TM3A 1ZDLA 4ADWA 1IJHA 2YLXA 3NK2X 1KSSA 1F8WA 2NPXA 4AT2A 1OJAA 4XWZA 2X8GA 4A6NB 4RG3A 1NDAA 1COYA 1LQTA 5HXIA 5IQ4A 4J33A 4UP3A 3S5WA 3CGBA 5KOWA 1PBFA 3KPFA 5HHFA 2XVHA 3L8KA 2AQJA 4FK1A 3ATRA 2YLRA 3CPIG 4BJYA 1CC2A 2ZZBA 1DJQA 1PBDA 1M6IA 3SFEA 2BK4A 3RP8A 1FEBA 1BKWA 4K8DA 1RP0A 2GMHA 3G5QA 3QJ4A 3LJPA 2Z5XA 4BK3A 4CRTA 3CN8A 2PHHA
chains in the Genus database with same CATH superfamily
3RR1A 1KNPA 5KMSA 4PABA 1PS9A 4A65A 4G6HA 2OQYA 1NEKA 2B9YA 1VRQB 4GDPA 3SGLA 3SBFA 1L9CA 1L8PA 2XVEA 3NVVB 3O0HA 3MUCA 2ONEA 3CGCA 3SFDA 4O5UA 3SY4A 3NYFA 3U9IA 3RP7A 3BNMA 3ZVIA 2WPCA 3R1ZA 2JAEA 3UKQA 3COXA 1WUEA 1PXAA 3CB3A 5LV9A 4JNQA 4GR1A 3UOXA 1F8RA 3S61A 5GSNA 3OTRA 2X99A 2GQFA 2GB0A 4ROPA 2XVIA 4OVIA 4ZCCA 2WETA 5BOFA 1B37A 4Z25A 2FJAA 4H4UA 4NTDA 1TDEA 1JROA 4C74A 3K7TA 1T3QC 4RG4A 4MMWA 1KDGA 4K2XA 1H7XA 2WOIA 2GF3A 2Q7VA 2V60A 1FOHA 2XDOA 3H70A 3NLCA 2PU0A 3A7RA 1CF3A 3QSEA 3RCYA 3CPHG 2PSNA 1PBEA 3MWCA 3MQTA 3QFAA 1D4CA 3VCNA 2QA1A 1VDCA 3FBSA 5G5HB 3SSZA 4OPCA 3CPJG 2GEWA 2PGEA 3H4KA 4MGGA 3NYCA 3DESA 2XLUA 4J56A 1FFVC 4AOXA 1GT8A 3D1CA 3RRAA 4A6GA 2R0PA 4II3A 3R11A 1CJCA 4CNKA 2GR1A 3UTEA 1GALA 3MZNA 3AEGA 4C3XA 2BC0A 1TYTA 3MSYA 3ES8A 3DG6A 1S2QA 3K7MX 3FV9A 4GDEA 2PTZA 2APGA 2PA6A 1PDYA 1SJCA 2ZZCA 4X2PA 1EBGA 2IIDA 4YSHA 4IL2A 4Z44A 3II4A 2X50A 2PP3A 2C73A 3ZLHA 5C2TA 3L5OA 4A6NA 3DG3A 2YVGA 2EQ8A 4H4RA 4M52A 2AL1A 4YSZA 1BQGA 2OLAA 4J57A 4NEWA 2WBAA 2OALA 4A79A 3FG2P 4IT1A 3OZMA 3QTPA 2BK5A 4JQ9A 3DGHA 3T37A 2OA1A 2FBWA 2ACZA 1FO4A 5J60A 1SJDA 2MUCA 4II2A 1OJCA 2QJJA 3UJFA 3B6DA 3CGDA 4MJWA 2VRLA 3FCPA 1H6VA 4GRTA 1QJDA 4LU6A 4FX9A 1XHCA 1D7LA 4O5QA 2QGYA 1N63C 2O9ZA 4Z17A 2YVJA 2OZTA 2C66A 3FPZA 1MOKA 3NTAA 4U2TA 1N5XA 2RGJA 4U8LA 3ZVHA 4G9KA 3NKSA 2QA2A 2YVFA 2PODA 1E9IA 1L0VA 2WDVA 4TLZA 1QO8A 4TM4A 4A3RA 4GFIA 4YKFA 1QLBA 1SJAA 4K8GA 4EMIA 3T2YA 4U8OA 3ES7A 3IJLA 4GMEA 2W55A 3AE8A 3GRTA 3AEBA 2P3ZA 4Z26A 1CJ3A 4HCHA 2Y6QA 5ER0A 3F8RA 1GTHA 4IA5A 4ENLA 3NZGA 2C64A 3EUB3 2VQ7A 4EWJA 2B76A 5U1OA 1KFYA 1PBBA 5KMRA 3TJ4A 2YLTA 3AECA 4GF7A 4ECHA 3SJNA 1FEAA 1EL7A 2W54A 4E6MA 5FJTA 4NNJA 3GDNA 4AOSA 3KKJA 3D8XA 3K7QX 1BGJA 3UKLA 4DSHA 3R0KA 5BULA 4B64A 3DK9A 1D5TA 3RNMA 1GTEA 2BRYA 3P4SA 1NENA 3AE1A 3T9PA 3EPTA 4XWRA 3OC4A 1PHHA 2YG6A 2P88A 2YR5A 3P93A 1ZK7A 4XXGA 4TM1A 4E4UA 1KSUA 2XVFA 3AN1A 3PFRA 4ZCDA 4C5OA 4X9MA 2QJMA 2XLSA 1PJ7A 3ZYXA 3C96A 1TDFA 4H50A 2EQ6A 2HXUA 1PDHA 2P8CA 2R4JA 1LJ1A 4HPNA 4GAVA 1BGNA 4K5SA 2R0GA 3HYWA 3SXIA 3GMCA 2ARDA 4K5RA 2QQ6A 3V4BA 1GRFA 4AP1A 1XS2A 4ZN0A 4IZGA 2XH0A 1AOGA 4GGBA 2E1MA 3LZWA 2GSHA 1KCZA 2W3SA 2C67A 3B3RA 1BKHA 1FIQB 4U8MA 4JN8A 3UJEA 4B68A 3NS1B 3RGTA 4H4VA 2C76A 4BJZA 2GVCA 3CNPA 1ZDLA 4H1ZA 3SZWA 4XWZA 4A6NB 1NDAA 1LQTA 5IQ4A 3SR6B 3S5WA 3ENLA 3ATRA 2PU1A 4BJYA 1M6IA 1DJQA 1PBDA 3SFEA 3I6TA 2E4GA 2EQ9A 3RITA 1EL8A 5KVIA 1N62C 1REOA 2OLNA 1ZOYA 2GMJA 1E39A 4H4TA 2GAHB 2GL5A 4LA1A 3BI2A 1STZA 3GYXA 3CK5A 3KPKA 3MKCA 4EQWA 5KWFA 3LZXA 1EC8A 3DA1A 3LADA 3GY1A 3TWBA 2QCUA 2XFQA 1O95A 3P9UA 2XH2A 6ENLA 4YTPA 2E3TA 2P8BA 4A35A 2C3CA 4K1WA 3ISHA 2C70A 3AXBA 3NRZB 2OAMA 5BUKA 3KVEA 1X31B 4GCMA 1KKRA 4OPLA 2WEUA 3UTHA 4OPIA 2FJEA 2WPFA 1NAAA 3G5RA 2QVHA 3HPFA 3C4AA 4DNAA 2GH5A 5M10A 3N4EA 3QKEA 1LQUA 2Q0KA 2TMDA 2R4EA 2PTXA 1FCDA 4E8GA 1CL0A 1GERA 3AEDA 3THUA 2BS2A 2OVLA 3UKAA 3WE0A 4USQA 1GV4A 1K0JA 4B65A 2XLRA 4IL0A 1DODA 3IC9A 2Z5YA 3QPEA 3DFYA 4DGKA 4Z2RA 4KWSA 1IUSA 2YR4A 3VDGA 3OZYA 3SN1A 2ZBWA 3ZLFA 4U8JA 2WOWA 2TPRA 4J34A 3FVDA 3NRNA 1Q9IA 3GWDA 5GRTA 1YEYA 1JRYA 2X8HA 3NO1A 2R46A 1E6EA 3R0UA 3E1TA 1D4DA 1JRXA 4USRA 4NTEA 4ICYA 5FS7A 1EL5A 1CJ4A 2H88A 4DSGA 4E0VA 4EMJA 2B9WA 3NHOX 4H4SA 2B7RA 3GRSA 1PN0A 1JPDX 1N4VA 1NHQA 4A7AA 4Z24A 3F8DA 4OPDA 1FHUA 3CIRA 4MKSA 3HW2A 4GGHA 3BNUA 4EQXA 4EM4A 1ZOVA 3ALMA 2YQUA 3VC5A 5HY5A 1WUFA 3P4PA 1CBOA 2NQLA 1CJ2A 5U25A 3B9JB 1JU2A 1GRBA 3ATQA 4FP1A 3A7UA 3FXGA 3NGCX 2WU5A 3TTEA 2I0ZA 3DJEA 2NVKX 4AP3A 1N4UA 2PP1A 3DMEA 3GO2A 2ZADA 1GREA 1OJDA 1ELSA 3P4QA 5EB4A 3CNJA 1LV0A 3UKPA 3DK4A 2AL2B 2GGGA 1VQWA 3UP5A 3GSIA 1FFUC 1K4QA 4NEVA 3DERA 5JCNA 1ZMCA 3T4WA 4YKGA 3NXLA 2C65A 2YLSA 4H4QA 1GOSA 1H2IA 3L1RA 3BJSA 4JY2A 3K1GA 2OG9A 3VA8A 1H7WA 5C3JA 3DDMA 3CMMA 2BRAA 2E5VA 3QLDA 3BHFA 4CNJA 4Z1YA 4HN8A 3V5CA 2OFJA 1GPEA 5J7XA 2GGHA 4KT2A 3TWAA 2CDUA 1D7YA 1XDIA 1S7MA 5IQ1A 3AYJA 2BS3A 3T31A 3NFUA 3T8QA 1BWCA 2JB3A 2E5AA 3I6DA 3UOVA 4U2SA 1S3BA 2XH7A 1DXLA 3IJIA 1N5WC 2WU2A 2GGIA 3GYJA 1JNRA 5CKUA 1MDRA 4YWSA 1PBCA 1YQ3A 2BS4A 3ZVHB 4F4RA 3NTDA 4YT0A 3IF9A 4G74A 2GV8A 4TM0A 3S47A 2XVJA 2DW7A 3VC6A 5HYMA 1OJ9A 1PDZA 2X8CA 3GC2A 2A89A 1X2HA 1B4VA 3UOYA 4IV9A 2JBVA 2HZGA 1NHPA 3AE7A 2XH4A 1K0IA 1FL2A 4GISA 2C72A 5FMHA 4J3ZA 3SQPA 3A7AA 3NN6X 5BRTA 4N9XA 4TM3A 1IJHA 4ADWA 2YLXA 3NK2X 1KSSA 1OJAA 4RG3A 3UCCA 4UP3A 3CGBA 2XVHA 2AQJA 3I4KA 3CPIG 2ZZBA 5EU9A 3RP8A 4BK3A 3G5QA 2VRMA 3NVZB 2O56A 4A99A 5KXJA 1ZXIC 2GR2A 3BHKA 3VRDB 5CQFA 2V6OA 3DGBA 3UXKA 3IK4A 4OPUA 3ITJA 1GRTA 3T14A 2JK6A 2F5ZA 3REDA 4J2WA 4TVYA 1YQ4A 1P43A 1EBHA 3EKGA 3ICRA 3ETRB 4CY6A 3QFBA 3V76A 4K7ZA 1DNCA 4EIQA 2WP5A 3AE4A 1XPQA 3H8IA 3N4FA 2WQYA 3GDPA 4FDCB 3DJGX 1SEZA 1O94A 1ZP0A 1DOEA 1EL9A 5KVHA 5BVAA 5FJPA 1S3EA 1RYIA 1W4XA 4P9SA 4ZCWA 4B67A 3RHAA 1PJ5A 4H4ZA 4B66A 4YWOA 1GESA 3KD9A 3PWGA 1Q1WA 2XGZA 4GYPA 2OO6A 4FI4A 2QAEA 1H86A 3R07C 2PGWA 1YQZA 3H8LA 1O5WA 3HYXA 3FMWA 1NELA 4GUVA 1GSNA 1IUTA 1N61C 4J1OA 2VZ2A 3SX6A 5EB5A 3OPSA 1MDLA 2BXRA 1LTXR 2YG5A 2RABA 2VVLA 3V3WA 1XPYA 3M0OA 1H81A 3DJDA 2B9XA 3TQPA 3QSSA 4HA6A 2WESA 3AD9B 4H2RA 2YAUA 2AKZA 4IVOB 4KEMA 1L9EA 4G7FA 2YM2A 1GNDA 4GYPC 3SN0A 1TDOA 4G73A 4M0XA 4AT0A 2J3NA 3SN4A 3ZDNA 2GGJA 1KN0A 4H19A 3GD3A 4EQRA 5BOEA 2WHDA 4APNA 4K22A 4YTMA 3UXLA 1YY5A 2UZZA 3JSKA 4E4FA 3EF6A 4H2PA 3QSMA 4RSLA 1KNRA 1TRBA 3VCCA 4WCTA 4G6GA 4M6UA 7ENLA 3M12A 3D46A 4BURA 4H4XA 4U2LA 3CTYA 5KNLA 2YG3A 3RP6A 1F9CA 2WP6A 1F6MA 2XYOA 3EAOA 1F3PA 4Z43A 3GYIA 1PJ6A 4I58A 1E1LA 3ALLA 4IVMB 1CHUA 1E1KA 1TKKA 4YSXA 1K0LA 3DH9A 3T2ZA 3UCDA 2XSXA 1MNSA 1EC9A 5FS9A 3R25A 3IHMA 5EBKA 1W6TA 2GRTA 4BK2A 3FIMB 3TOYA 3B97A 2ZC8A 5JCKA 3PK7A 2WPEA 4JN7A 1PXCA 3VRAA 3SZ0A 1NG3A 2JB1A 3CXBA 5ENLA 2IVDA 3SQSA 4HB9A 1NU5A 3HRDC 3TJIA 2BYBA 4NWZA 3JW7A 2XCGA 3K30A 4KPLA 1NHSA 3AE2A 2X3NA 4KX6A 2RGOA 1KKOA 3SM8A 3UJRA 1ZKQA 3Q4DA 1VG9A 1JDFA 2BXSA 2W0HA 2VOUA 2R45A 3DEQA 1IUUA 3I6EA 2DKHA 3M13A 4H7UA 3STPA 3AEEA 3CNSA 2PCEA 1DJNA 3JZUA 3URHA 1GRHA 2BCGG 1JPMA 3AEAA 3BOXA 4Z2TA 3NK0X 3KA7A 1GEUA 4U8PA 3ADAB 2A87A 4UDRA 3T6CA 2XFPA 3UKHA 4A5LA 1JRZA 3AMZA 4H4YA 2WS3A 5KRQA 4H2HA 3AE5A 3AE9A 3GWFA 1NPXA 5FJRA 3CNDA 2WP9A 1JRPA 3CXOA 3SZCA 2H89A 1WYGA 3AE3A 4LIIA 1FECA 2V5ZA 3T0KA 3NG7X 4HYRA 3PS9A 1E1MA 3CAWA 4D04A 2R0CA 3CGEA 3UTFA 1TDKA 3V5FA 4JNAA 2QDEA 1XANA 1RM6B 5EOWA 1GRGA 4J36A 4JHMA 3VR9A 2MNRA 3ICTA 1SJBA 4U8KA 4Y4NA 3VFCA 2C3DA 1Q1RA 1D4EA 1TZZA 2VQBA 2A8XA 2BCPA 2HQMA 2R9ZA 4CCQA 2CVJA 1DTNA 1N4WA 1CC6A 3NNEA 5M0ZA 2RDXA 1ONEA 3GD6A 2BK3A 3RO6A 2GR0A 1VDVA 2HXTA 1F8WA 4AT2A 3DG7A 3MY9A 4J33A 3EEZA 1PBFA 3KPFA 5HHFA 3QN3A 2YLRA 1CC2A 1BKWA 2GMHA 3QJ4A 3P0WA 2DW6A 3Q45A 2Z5XA 4IHCA 2PHHA 2PS2A 4Y4LA 2XFUA 2I5QA 1KD0A 3PG6A 4EM3A 2AAQA 4DWDA 3UP4A 5KMPA 1X2GA 1NG4A 4OCGA 3SYIA 2FJDA 3C4NA 4IP4A 1GETA 2XFNA 3S5SA 1RSGA 4A9WA 3UCLA 1N60C 4TLXA 2C75A 2EQ7A 4DN1A 2CULA 1V59A 2FKPA 2C7GA 2PMQA 3AEFA 3I3LA 2WDQA 3DK8A 4DYEA 1MRAA 4DXKA 2V61A 2Y6RA 4YSYA 3FYYA 3IWAA 4H4WA 4C3YA 3H7VA 3NT6A 4J31A 3R10A 1IUVA 2YLWA 2WOVA 1H84A 5FJOA 1VG0A 5KMQA 4UDQA 3KUMA 2PTYA 3G5SA 1GXFA 4NZHA 1TYPA 3PWIA 1JEHA 1MO9A 3GD4A 4GIRA 3D47A 2PP0A 5TR3A 1H83A 4EIPA 1OJTA 3V3NA 1S2YA 3VR8A 2GDQA 2C4CA 1YKJA 1LPFA 2V3AA 1UKVG 4CCRA 2OZ8A 2POZA 3LB8A 4H2QA 3AD7B 4DHGA 1JNZA 4G8TA 3GMBA 1Y56B 3AD8B 1M64A 3CNTA 1ZX9A 1LVLA 4IP5A 3N6JA 3PVCA 5FJUA 3LOVA 4H83A 1P2EA 1Y56A 3VRBA 3QVRA 3D9XA 2OPJA 5DBJA 3BI4A 1KF6A 4I59A 1E7PA 4CBQA 3U4FA 3V3OA 3DIPA 4REKA 4BK1A 2YM1A 3NN0X 3H12A 3UOZA 1PXBA 3DGZA 1R0MA 2OZ3A 2BC1A 1ZMDA 4OPTA 2BABA 1TDNA 3NH3X 2AL2A 2YR6A 3OZ2A 3AWIA 4TVWA 1P48A 4B1BA 3TCSA 1JCTA 5FS6A 2OQHA 3HYVA 1L9DA 3TW9A 2RGHA 3VQRA 2GAGB 3N6HA 5FS8A 1OEPA 2OKTA 4Z2UA 2PYXA 2AKMA 3OP2A 2BACA 2DKIA 3AM9A 3T2KA 3UKKA 2V3BA 5JCIA 3AE6A 4NTCA 4WX1A 2HNEA 4B63A 3CYJA 4JY3A 3P1WA 4OPGA 3P4RA 1E1NA 3CT2A 3ALJA 2B7SA 3NVYB 4D03A 2VVMA 3IJQA 3F8PA 2PTWA 3NIXA 3ZLGA 5KOXA 1CC4A 5J04A 2GQWA 3LXDA 3UTGA 2OLOA 2YG4A 3Q6JA 2XLTA 3PO7A 4E5TA 4BV6A 2ZZ0A 3UGVA 4H4PA 2VVLG 3EANA 1Z6LA 2CFYA 2XLPA 1ECQA 3HZLA 4YXDA 1ZY8A 4EQSA 2JB2A 1NHRA 1R6WA 4HCLA 5IDZA 4Y4MA 4KPRA 1MUCA 2QDDA 3KU9A 1MXTA 3P3BA 1BZLA 4CY8A 2Q6UA 1SB3B 3AB1A 2W3RA 1DOBA 2YWLA 3BI5A 3QVPA 4X9NA 1N1PA 1JOAA 1B5QA 4X4JA 2IVEA 3H8AA 3R9UA 4H2NA 1IUWA 2YLZA 3FJ4A 2Q0LA 1H82A 3NK1X 3UKFA 3UJ2A 4B69A 3DJJA 1TE6A 2OX4A 5JCLA 2PPGA 5IPYA 4HNLA 4DX3A 1ONFA 1FHVA 3ICSA 4JDRA 1F8SA 5L46A 4JN9A 2JKCA 3AYIA 3OW1A 4ZOHB 5JCMA 1IUXA 2FJBA 4EMWA 1EC7A 1P2HA 4C77A 2YG7A 1ELIA 2WDRA 3ABVA 4K2SA 4IA6A 4PAAA 2GGEA 5JRBA 1VQZA 2XFOA 2AR8A 1Y0PA 4FK1C 1DOCA 4UDPA 1GRAA 3AYLA 2BA9A 1RVKA 5U63A 3UJSA 5G5GB 1B8SA 2FYMA 3NYEA 2CHRA 3Q9TA 3KLJA 1HYUA 3IHGA 4U8NA 4GAPA 4HCDA 4YTNA 4U8IA 2QJNA 1IYXA 1EBDA 1V97A 1BF3A 2GR3A 2P0IA 4HNCA 2NPXA 2X8GA 3BSMA 1COYA 5HXIA 5KOWA 3DFHA 3JVAA 3L8KA 4FK1A 3SZFA 4ZA0A 2BK4A 1FEBA 1RP0A 4K8DA 3LJPA 3NVWB 4CRTA 3CN8A
chains in the Genus database with same CATH topology
1KNPA 2VRMA 4Y4LA 4PABA 1PS9A 4A65A 5KMSA 2E4GA 4G6HA 4A99A 1NEKA 2EQ9A 2XFUA 2B9YA 1VRQB 5KXJA 4GDPA 3PG6A 4EM3A 2AAQA 3SGLA 3UP4A 2GR2A 3BHKA 1EL8A 5KMPA 1NG4A 1L9CA 4OCGA 3SYIA 2FJDA 3C4NA 2XVEA 1GETA 3VRDB 2XFNA 1RSGA 2V6OA 5CQFA 4A9WA 3UCLA 3O0HA 5KVIA 4TLXA 2C75A 1REOA 3CGCA 2OLNA 1ZOYA 2EQ7A 2GMJA 2CULA 3SFDA 4O5UA 1V59A 4OPUA 1E39A 2C7GA 4H4TA 2GAHB 4LA1A 3SY4A 3BI2A 3AEFA 3I3LA 3NYFA 3ITJA 3RP7A 1GRTA 3BNMA 2WPCA 3GYXA 3T14A 2JK6A 2F5ZA 3REDA 2JAEA 3UKQA 4J2WA 2WDQA 3COXA 3DK8A 1PXAA 1YQ4A 2V61A 2Y6RA 4YSYA 5LV9A 3KPKA 4JNQA 4GR1A 3UOXA 3IWAA 4H4WA 4C3YA 1F8RA 3ICRA 3NT6A 4J31A 3S61A 4CY6A 4EQWA 5GSNA 5KWFA 3QFBA 1IUVA 4K7ZA 2YLWA 2WOVA 3V76A 1DNCA 3LZXA 2X99A 2GQFA 4EIQA 2WP5A 3AE4A 1H84A 2GB0A 3DA1A 3LADA 1XPQA 4OVIA 2XVIA 3H8IA 2WQYA 1VG0A 4ZCCA 5KMQA 2QCUA 4UDQA 3GDPA 2WETA 2XFQA 1B37A 3G5SA 4Z25A 1GXFA 4NZHA 1TYPA 4FDCB 2FJAA 4H4UA 1JEHA 1MO9A 3DJGX 3GD4A 1SEZA 1TDEA 4NTDA 1O95A 1O94A 3P9UA 4C74A 1ZP0A 3K7TA 4RG4A 1DOEA 5TR3A 1H83A 1KDGA 4EIPA 4YTPA 1OJTA 5KVHA 1EL9A 5BVAA 4K2XA 1H7XA 2WOIA 2GF3A 2C3CA 3ISHA 2C70A 3AXBA 3V3NA 1S3EA 2Q7VA 1S2YA 2V60A 1RYIA 3VR8A 1W4XA 4P9SA 4B67A 1FOHA 2OAMA 2C4CA 5BUKA 3KVEA 1X31B 3RHAA 1YKJA 1PJ5A 1LPFA 2V3AA 2XDOA 4GCMA 4H4ZA 4B66A 3NLCA 4YWOA 1GESA 1UKVG 4CCRA 4OPLA 3KD9A 2WEUA 3UTHA 4OPIA 1CF3A 3LB8A 2FJEA 3QSEA 2WPFA 4H2QA 1Q1WA 1NAAA 3AD7B 3CPHG 3G5RA 1JNZA 3GMBA 1Y56B 2QAEA 1H86A 1PBEA 3AD8B 1M64A 3CNTA 1ZX9A 1YQZA 3QFAA 3H8LA 1LVLA 1O5WA 3C4AA 4DNAA 3HYXA 2GH5A 5M10A 3PVCA 3FMWA 3LOVA 1D4CA 4GUVA 2QA1A 1GSNA 1P2EA 1VDCA 1Y56A 1IUTA 1LQUA 3FBSA 4OPCA 3CPJG 2Q0KA 2GEWA 2VZ2A 3SX6A 5EB5A 3VRBA 2BXRA 1LTXR 2YG5A 3QVRA 3D9XA 2TMDA 3H4KA 2R4EA 5DBJA 2RABA 3NYCA 2VVLA 2XLUA 4J56A 1FCDA 3BI4A 4AOXA 1KF6A 3M0OA 1H81A 3DJDA 1GT8A 2B9XA 3D1CA 1CL0A 1GERA 4I59A 1E7PA 2R0PA 3QSSA 4CBQA 3AEDA 4II3A 1CJCA 3V3OA 2WESA 2GR1A 2BS2A 3AD9B 4H2RA 2YAUA 4HA6A 4IVOB 4CNKA 3UKAA 3WE0A 1GALA 4USQA 1GV4A 4REKA 1K0JA 4B65A 2YM1A 3NN0X 3AEGA 1L9EA 4BK1A 2XLRA 3UOZA 4C3XA 1PXBA 2BC0A 1TYTA 3DGZA 2YM2A 1DODA 1GNDA 1S2QA 2BC1A 1ZMDA 4OPTA 3IC9A 3K7MX 4GDEA 2BABA 2APGA 1TDNA 3NH3X 2ZZCA 1TDOA 2Z5YA 4G73A 4AT0A 2IIDA 4YSHA 4DGKA 4Z2RA 2J3NA 2YR6A 1IUSA 3OZ2A 3AWIA 4A7AA 4Z44A 3II4A 2YR4A 2X50A 3ZDNA 4B1BA 2C73A 5C2TA 3L5OA 2ZBWA 5FS6A 4A6NA 3HYVA 1L9DA 2YVGA 2EQ8A 4H4RA 4M52A 4U8JA 1KN0A 2WOWA 4YSZA 2RGHA 2TPRA 4J34A 3VQRA 2GAGB 4J57A 3NRNA 3GD3A 4EQRA 1Q9IA 3GWDA 4NEWA 2WHDA 2WBAA 5FS8A 5GRTA 4APNA 4K22A 2OALA 4YTMA 1JRYA 4A79A 4Z2UA 2PYXA 3FG2P 1YY5A 2UZZA 3JSKA 3EF6A 2BK5A 4JQ9A 3DGHA 2X8HA 3T37A 2BACA 2OA1A 2FBWA 2ACZA 2R46A 1E6EA 3QSMA 4H2PA 5J60A 2DKIA 4RSLA 3E1TA 1D4DA 1KNRA 1TRBA 4II2A 1OJCA 3T2KA 4WCTA 4G6GA 3UKKA 3B6DA 1JRXA 3CGDA 4MJWA 3M12A 2VRLA 4USRA 4BURA 4ICYA 4NTEA 1H6VA 5FS7A 4H4XA 4GRTA 1EL5A 2V3BA 1QJDA 4LU6A 4U2LA 5JCIA 4FX9A 1CJ4A 3CTYA 5KNLA 1XHCA 2YG3A 3RP6A 1D7LA 4O5QA 2WP6A 1F6MA 2XYOA 2H88A 3EAOA 1F3PA 4DSGA 3AE6A 4NTCA 4E0VA 4Z43A 4WX1A 4EMJA 3GYIA 2O9ZA 2B9WA 3NHOX 1PJ6A 4H4SA 4B63A 2B7RA 2YVJA 3GRSA 2C66A 1E1LA 4I58A 3FPZA 3ALLA 4IVMB 1CHUA 1MOKA 1PN0A 4JY3A 1E1KA 3NTAA 1N4VA 3P1WA 1NHQA 4OPGA 4U2TA 4YSXA 1K0LA 3F8DA 3P4RA 1E1NA 4Z24A 2RGJA 3ALJA 4U8LA 2B7SA 4OPDA 4G9KA 3CIRA 3DH9A 3NKSA 3T2ZA 2QA2A 2YVFA 3BNUA 4D03A 4EQXA 5FS9A 3IHMA 1L0VA 2WDVA 5EBKA 4EM4A 2VVMA 4TLZA 1ZOVA 3ALMA 1QO8A 2YQUA 4TM4A 5HY5A 3F8PA 2GRTA 3P4PA 1CBOA 4YKFA 1QLBA 1CJ2A 5U25A 1JU2A 4BK2A 1GRBA 3ATQA 3FIMB 3NIXA 4EMIA 5KOXA 3T2YA 1CC4A 5JCKA 4U8OA 3NGCX 2WU5A 2GQWA 2WPEA 3LXDA 2I0ZA 3DJEA 3UTGA 2NVKX 3AE8A 1PXCA 3VRAA 4AP3A 3GRTA 2OLOA 1N4UA 3AEBA 3SZ0A 1NG3A 2JB1A 3DMEA 2YG4A 3Q6JA 2XLTA 3PO7A 1GREA 4Z26A 2IVDA 1OJDA 1CJ3A 4BV6A 2ZZ0A 3P4QA 2Y6QA 4H4PA 4HB9A 2VVLG 5EB4A 3EANA 1Z6LA 2CFYA 2XLPA 5ER0A 3CNJA 3F8RA 1GTHA 1LV0A 3HZLA 4YXDA 3UKPA 1ZY8A 4IA5A 3DK4A 2BYBA 2C64A 4EQSA 1VQWA 2JB2A 1NHRA 2VQ7A 3GSIA 1K4QA 4NEVA 2B76A 3UP5A 5U1OA 4NWZA 1KFYA 5JCNA 1PBBA 5KMRA 4Y4MA 4KPRA 1ZMCA 4YKGA 2YLTA 2C65A 2YLSA 3KU9A 1MXTA 2XCGA 3AECA 4GF7A 4H4QA 4ECHA 3K30A 3UTEA 1NHSA 3AE2A 1GOSA 1FEAA 2X3NA 4KX6A 1EL7A 1BZLA 4CY8A 2Q6UA 4NNJA 2RGOA 3GDNA 4AOSA 1H2IA 3KKJA 3SM8A 3D8XA 3L1RA 1ZKQA 4JY2A 3AB1A 1VG9A 3K7QX 1BGJA 1DOBA 3UKLA 2BXSA 2W0HA 2YWLA 3BI5A 4DSHA 5BULA 3QVPA 2VOUA 2R45A 1IUUA 4X9NA 1N1PA 2DKHA 3M13A 4H7UA 4B64A 1H7WA 3AEEA 3CNSA 1JOAA 3DK9A 5C3JA 1D5TA 3RNMA 2BRAA 1B5QA 2E5VA 1GTEA 3BHFA 3CMMA 4X4JA 4CNJA 2BRYA 1DJNA 3P4SA 3URHA 2IVEA 1GRHA 2BCGG 1GPEA 1NENA 3AEAA 3AE1A 3R9UA 4H2NA 5J7XA 1IUWA 3EPTA 4Z2TA 2YLZA 3NK0X 4XWRA 2Q0LA 3KA7A 1H82A 1GEUA 3NK1X 4U8PA 3UKFA 3OC4A 1PHHA 2CDUA 2YG6A 2YR5A 3ADAB 1D7YA 1XDIA 1ZK7A 4B69A 1S7MA 4XXGA 2A87A 4TM1A 4UDRA 3DJJA 5IQ1A 3AYJA 2XFPA 3UKHA 2BS3A 1KSUA 4A5LA 1JRZA 2XVFA 3T31A 5JCLA 4H4YA 2WS3A 5KRQA 4ZCDA 3AE5A 4C5OA 1BWCA 2JB3A 4X9MA 5IPYA 2XLSA 3AE9A 3GWFA 3I6DA 3UOVA 1PJ7A 4U2SA 1ONFA 1NPXA 1S3BA 3ZYXA 3CNDA 2WP9A 3SZCA 3C96A 2H89A 3AE3A 1TDFA 4JDRA 1F8SA 4LIIA 4H50A 1FECA 3ICSA 5L46A 4JN9A 2V5ZA 3T0KA 1DXLA 3NG7X 2EQ6A 3PS9A 2WU2A 2JKCA 1PDHA 1E1MA 2R4JA 4D04A 3AYIA 3GYJA 2R0CA 3CGEA 3UTFA 1PBCA 1JNRA 5JCMA 1IUXA 1TDKA 5CKUA 1LJ1A 2FJBA 4JNAA 1YQ3A 2BS4A 1XANA 4GAVA 5EOWA 1GRGA 4EMWA 1BGNA 4K5SA 1P2HA 4J36A 4C77A 2R0GA 2YG7A 3NTDA 3HYWA 4YT0A 3SXIA 1ELIA 2WDRA 3GMCA 3IF9A 4G74A 2GV8A 4TM0A 2ARDA 3VR9A 3ABVA 4K5RA 4IA6A 4PAAA 5JRBA 3ICTA 2XVJA 2XFOA 1GRFA 4AP1A 2AR8A 4U8KA 4ZN0A 4Y4NA 1OJ9A 1Y0PA 5HYMA 4FK1C 2X8CA 1AOGA 2A89A 2C3DA 1DOCA 4UDPA 1GRAA 1B4VA 3AYLA 1Q1RA 1D4EA 2BA9A 2E1MA 5U63A 3LZWA 3UOYA 2VQBA 2A8XA 4IV9A 1B8SA 2BCPA 2HQMA 2R9ZA 4CCQA 3NYEA 2JBVA 2C67A 2CVJA 3Q9TA 3KLJA 1HYUA 1N4WA 1NHPA 1CC6A 3AE7A 3NNEA 1K0IA 3B3RA 5M0ZA 1FL2A 3IHGA 4U8NA 4GAPA 4U8MA 2C72A 4YTNA 4U8IA 5FMHA 2BK3A 4B68A 3SQPA 2C76A 4H4VA 4BJZA 2GR0A 3NN6X 2GVCA 1EBDA 3CNPA 1BF3A 5BRTA 4N9XA 2GR3A 4TM3A 1ZDLA 4ADWA 1IJHA 2YLXA 3NK2X 3SZWA 1KSSA 1F8WA 2NPXA 4AT2A 1OJAA 4XWZA 2X8GA 4A6NB 4RG3A 1NDAA 1COYA 1LQTA 5HXIA 5IQ4A 4J33A 4UP3A 3S5WA 3CGBA 5KOWA 1PBFA 3KPFA 5HHFA 2XVHA 3L8KA 2AQJA 4FK1A 3ATRA 2YLRA 3CPIG 3SZFA 4BJYA 1CC2A 2ZZBA 1DJQA 1PBDA 1M6IA 3SFEA 2BK4A 3RP8A 1FEBA 1BKWA 4K8DA 1RP0A 2GMHA 3G5QA 3QJ4A 3LJPA 2Z5XA 4BK3A 4CRTA 3CN8A 2PHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KNP A;  2VRM A;  4Y4L A;  4PAB A;  1PS9 A;  4A65 A;  2E4G A;  4A99 A;  1NEK A;  2EQ9 A;  2XFU A;  2B9Y A;  1VRQ B;  5KXJ A;  4GDP A;  4EM3 A;  2AAQ A;  3SGL A;  3UP4 A;  2GR2 A;  3BHK A;  1EL8 A;  1NG4 A;  1L9C A;  4OCG A;  2FJD A;  3C4N A;  2XVE A;  1GET A;  3VRD B;  2XFN A;  1RSG A;  2V6O A;  5CQF A;  4A9W A;  3UCL A;  3O0H A;  5KVI A;  4TLX A;  2C75 A;  1REO A;  3CGC A;  2OLN A;  1ZOY A;  2EQ7 A;  2GMJ A;  2CUL A;  3SFD A;  4O5U A;  1V59 A;  4OPU A;  1E39 A;  2C7G A;  4H4T A;  2GAH B;  4LA1 A;  3BI2 A;  3AEF A;  3I3L A;  3NYF A;  3ITJ A;  3RP7 A;  1GRT A;  3BNM A;  2WPC A;  2JK6 A;  2F5Z A;  3RED A;  2JAE A;  3UKQ A;  4J2W A;  2WDQ A;  3COX A;  3DK8 A;  1PXA A;  1YQ4 A;  2V61 A;  2Y6R A;  4YSY A;  5LV9 A;  4JNQ A;  4GR1 A;  3UOX A;  3IWA A;  4H4W A;  4C3Y A;  1F8R A;  3ICR A;  3NT6 A;  4J31 A;  3S61 A;  4CY6 A;  4EQW A;  5GSN A;  5KWF A;  3QFB A;  1IUV A;  4K7Z A;  2YLW A;  2WOV A;  3V76 A;  1DNC A;  3LZX A;  2X99 A;  2GQF A;  4EIQ A;  2WP5 A;  3AE4 A;  1H84 A;  2GB0 A;  3DA1 A;  3LAD A;  1XPQ A;  4OVI A;  2XVI A;  3H8I A;  2WQY A;  1VG0 A;  4ZCC A;  2QCU A;  4UDQ A;  3GDP A;  2WET A;  2XFQ A;  1B37 A;  3G5S A;  4Z25 A;  1GXF A;  4NZH A;  1TYP A;  4FDC B;  2FJA A;  4H4U A;  1JEH A;  1MO9 A;  3DJG X;  3GD4 A;  1SEZ A;  1TDE A;  4NTD A;  1O95 A;  1O94 A;  3P9U A;  4C74 A;  1ZP0 A;  3K7T A;  4RG4 A;  1DOE A;  5TR3 A;  1H83 A;  1KDG A;  4EIP A;  4YTP A;  1OJT A;  5KVH A;  1EL9 A;  5BVA A;  4K2X A;  1H7X A;  2WOI A;  2GF3 A;  2C3C A;  3ISH A;  2C70 A;  3AXB A;  3V3N A;  1S3E A;  2Q7V A;  1S2Y A;  2V60 A;  1RYI A;  3VR8 A;  1W4X A;  4P9S A;  4B67 A;  1FOH A;  2OAM A;  5BUK A;  3KVE A;  1X31 B;  3RHA A;  1YKJ A;  1PJ5 A;  1LPF A;  2V3A A;  2XDO A;  4GCM A;  4H4Z A;  4B66 A;  3NLC A;  4YWO A;  1GES A;  1UKV G;  4CCR A;  4OPL A;  3KD9 A;  2WEU A;  3UTH A;  4OPI A;  1CF3 A;  3LB8 A;  2FJE A;  3QSE A;  2WPF A;  4H2Q A;  1Q1W A;  1NAA A;  3AD7 B;  3CPH G;  3G5R A;  1JNZ A;  3GMB A;  1Y56 B;  2QAE A;  1H86 A;  1PBE A;  3AD8 B;  1M64 A;  3CNT A;  1ZX9 A;  1YQZ A;  3QFA A;  3H8L A;  1LVL A;  1O5W A;  3C4A A;  4DNA A;  2GH5 A;  5M10 A;  3PVC A;  3FMW A;  3LOV A;  1D4C A;  4GUV A;  2QA1 A;  1GSN A;  1P2E A;  1VDC A;  1Y56 A;  1IUT A;  1LQU A;  3FBS A;  4OPC A;  3CPJ G;  2Q0K A;  2GEW A;  2VZ2 A;  3VRB A;  5EB5 A;  2BXR A;  1LTX R;  2YG5 A;  3QVR A;  2TMD A;  3H4K A;  2R4E A;  5DBJ A;  2RAB A;  3NYC A;  2VVL A;  2XLU A;  4J56 A;  1FCD A;  3BI4 A;  4AOX A;  1KF6 A;  3M0O A;  1H81 A;  3DJD A;  1GT8 A;  2B9X A;  3D1C A;  1CL0 A;  1GER A;  4I59 A;  1E7P A;  2R0P A;  3QSS A;  4CBQ A;  3AED A;  1CJC A;  3V3O A;  2WES A;  2GR1 A;  2BS2 A;  3AD9 B;  4H2R A;  2YAU A;  4HA6 A;  4IVO B;  4CNK A;  3UKA A;  3WE0 A;  1GAL A;  4USQ A;  1GV4 A;  4REK A;  1K0J A;  4B65 A;  2YM1 A;  3NN0 X;  3AEG A;  1L9E A;  4BK1 A;  2XLR A;  3UOZ A;  4C3X A;  1PXB A;  2BC0 A;  1TYT A;  3DGZ A;  2YM2 A;  1DOD A;  1GND A;  1S2Q A;  2BC1 A;  1ZMD A;  4OPT A;  3IC9 A;  3K7M X;  4GDE A;  2BAB A;  2APG A;  1TDN A;  3NH3 X;  2ZZC A;  1TDO A;  2Z5Y A;  4AT0 A;  2IID A;  4YSH A;  4DGK A;  4Z2R A;  2J3N A;  2YR6 A;  1IUS A;  3OZ2 A;  3AWI A;  4A7A A;  4Z44 A;  3II4 A;  2YR4 A;  2X50 A;  3ZDN A;  4B1B A;  2C73 A;  5C2T A;  2ZBW A;  5FS6 A;  4A6N A;  1L9D A;  2YVG A;  2EQ8 A;  4H4R A;  4M52 A;  4U8J A;  2WOW A;  4YSZ A;  2RGH A;  2TPR A;  4J34 A;  3VQR A;  2GAG B;  4J57 A;  3NRN A;  3GD3 A;  1Q9I A;  4EQR A;  3GWD A;  4NEW A;  2WHD A;  2WBA A;  5FS8 A;  5GRT A;  4APN A;  4K22 A;  2OAL A;  4YTM A;  1JRY A;  4A79 A;  4Z2U A;  2PYX A;  3FG2 P;  1YY5 A;  2UZZ A;  3JSK A;  3EF6 A;  2BK5 A;  4JQ9 A;  3DGH A;  2X8H A;  3T37 A;  2BAC A;  2OA1 A;  2FBW A;  2ACZ A;  2R46 A;  1E6E A;  3QSM A;  4H2P A;  5J60 A;  2DKI A;  4RSL A;  3E1T A;  1D4D A;  1KNR A;  1TRB A;  1OJC A;  4WCT A;  3UKK A;  3B6D A;  1JRX A;  3CGD A;  4MJW A;  3M12 A;  2VRL A;  4USR A;  4BUR A;  4ICY A;  4NTE A;  1H6V A;  5FS7 A;  4H4X A;  4GRT A;  1EL5 A;  2V3B A;  1QJD A;  4LU6 A;  4U2L A;  5JCI A;  4FX9 A;  1CJ4 A;  3CTY A;  1XHC A;  2YG3 A;  3RP6 A;  1D7L A;  4O5Q A;  2WP6 A;  1F6M A;  2XYO A;  2H88 A;  3EAO A;  1F3P A;  4DSG A;  3AE6 A;  4NTC A;  4E0V A;  4Z43 A;  4WX1 A;  4EMJ A;  3GYI A;  2O9Z A;  2B9W A;  3NHO X;  1PJ6 A;  4H4S A;  4B63 A;  2B7R A;  2YVJ A;  3GRS A;  2C66 A;  1E1L A;  4I58 A;  3FPZ A;  3ALL A;  4IVM B;  1CHU A;  1MOK A;  1PN0 A;  4JY3 A;  1E1K A;  3NTA A;  1N4V A;  3P1W A;  1NHQ A;  4OPG A;  4U2T A;  4YSX A;  1K0L A;  3F8D A;  3P4R A;  1E1N A;  4Z24 A;  2RGJ A;  3ALJ A;  4U8L A;  2B7S A;  4OPD A;  3CIR A;  3DH9 A;  3NKS A;  2QA2 A;  2YVF A;  3BNU A;  4D03 A;  4EQX A;  5FS9 A;  3IHM A;  1L0V A;  2WDV A;  5EBK A;  4EM4 A;  2VVM A;  4TLZ A;  1ZOV A;  3ALM A;  1QO8 A;  2YQU A;  4TM4 A;  5HY5 A;  3F8P A;  2GRT A;  3P4P A;  1CBO A;  4YKF A;  1QLB A;  1CJ2 A;  5U25 A;  1JU2 A;  4BK2 A;  1GRB A;  3ATQ A;  3FIM B;  3NIX A;  4EMI A;  5KOX A;  1CC4 A;  5JCK A;  4U8O A;  3NGC X;  2WU5 A;  2GQW A;  2WPE A;  3LXD A;  2I0Z A;  3DJE A;  3UTG A;  2NVK X;  3AE8 A;  1PXC A;  3VRA A;  4AP3 A;  3GRT A;  2OLO A;  1N4U A;  3AEB A;  1NG3 A;  2JB1 A;  3DME A;  2YG4 A;  3Q6J A;  2XLT A;  3PO7 A;  1GRE A;  4Z26 A;  2IVD A;  1OJD A;  1CJ3 A;  4BV6 A;  2ZZ0 A;  3P4Q A;  2Y6Q A;  4H4P A;  4HB9 A;  2VVL G;  5EB4 A;  3EAN A;  1Z6L A;  2CFY A;  2XLP A;  5ER0 A;  3CNJ A;  3F8R A;  1GTH A;  1LV0 A;  3HZL A;  4YXD A;  3UKP A;  1ZY8 A;  4IA5 A;  3DK4 A;  2BYB A;  2C64 A;  4EQS A;  1VQW A;  2JB2 A;  1NHR A;  2VQ7 A;  3GSI A;  1K4Q A;  4NEV A;  2B76 A;  3UP5 A;  5U1O A;  1KFY A;  5JCN A;  1PBB A;  4Y4M A;  4KPR A;  1ZMC A;  4YKG A;  2YLT A;  2C65 A;  2YLS A;  3KU9 A;  1MXT A;  2XCG A;  3AEC A;  4GF7 A;  4H4Q A;  4ECH A;  3K30 A;  3UTE A;  1NHS A;  3AE2 A;  1GOS A;  1FEA A;  2X3N A;  4KX6 A;  1EL7 A;  1BZL A;  4CY8 A;  2Q6U A;  2RGO A;  3GDN A;  4AOS A;  3KKJ A;  3SM8 A;  3D8X A;  3L1R A;  1ZKQ A;  4JY2 A;  3AB1 A;  1VG9 A;  3K7Q X;  1BGJ A;  1DOB A;  3UKL A;  2BXS A;  2W0H A;  2YWL A;  3BI5 A;  4DSH A;  5BUL A;  3QVP A;  2VOU A;  2R45 A;  1IUU A;  4X9N A;  1N1P A;  2DKH A;  3M13 A;  4H7U A;  4B64 A;  1H7W A;  3AEE A;  3CNS A;  1JOA A;  3DK9 A;  5C3J A;  1D5T A;  3RNM A;  2E5V A;  1B5Q A;  3BHF A;  1GTE A;  4X4J A;  4CNJ A;  1DJN A;  3P4S A;  3URH A;  2IVE A;  1GRH A;  2BCG G;  1GPE A;  1NEN A;  3AEA A;  3AE1 A;  3R9U A;  4H2N A;  5J7X A;  1IUW A;  3EPT A;  4Z2T A;  2YLZ A;  3NK0 X;  4XWR A;  2Q0L A;  3KA7 A;  1H82 A;  1GEU A;  3NK1 X;  4U8P A;  3UKF A;  3OC4 A;  1PHH A;  2CDU A;  2YG6 A;  2YR5 A;  3ADA B;  1D7Y A;  1XDI A;  1ZK7 A;  4B69 A;  4XXG A;  2A87 A;  4TM1 A;  4UDR A;  3DJJ A;  5IQ1 A;  3AYJ A;  2XFP A;  3UKH A;  2BS3 A;  1KSU A;  4A5L A;  1JRZ A;  2XVF A;  5JCL A;  4H4Y A;  2WS3 A;  5KRQ A;  4ZCD A;  3AE5 A;  4C5O A;  1BWC A;  2JB3 A;  4X9M A;  5IPY A;  2XLS A;  3AE9 A;  3GWF A;  3I6D A;  3UOV A;  1PJ7 A;  4U2S A;  1ONF A;  1NPX A;  1S3B A;  3ZYX A;  3CND A;  2WP9 A;  3C96 A;  2H89 A;  3AE3 A;  1TDF A;  4JDR A;  1F8S A;  4LII A;  4H50 A;  1FEC A;  3ICS A;  5L46 A;  4JN9 A;  2V5Z A;  1DXL A;  3NG7 X;  2EQ6 A;  3PS9 A;  2WU2 A;  2JKC A;  1PDH A;  1E1M A;  2R4J A;  4D04 A;  3AYI A;  3GYJ A;  2R0C A;  3CGE A;  3UTF A;  1PBC A;  1JNR A;  5JCM A;  1IUX A;  1TDK A;  5CKU A;  1LJ1 A;  2FJB A;  4JNA A;  1YQ3 A;  2BS4 A;  1XAN A;  5EOW A;  1GRG A;  4EMW A;  1BGN A;  4K5S A;  1P2H A;  4J36 A;  4C77 A;  2R0G A;  2YG7 A;  3NTD A;  4YT0 A;  1ELI A;  2WDR A;  3GMC A;  3IF9 A;  2GV8 A;  4TM0 A;  2ARD A;  3VR9 A;  3ABV A;  4K5R A;  4IA6 A;  4PAA A;  3ICT A;  2XVJ A;  2XFO A;  1GRF A;  4AP1 A;  2AR8 A;  4U8K A;  4ZN0 A;  4Y4N A;  1OJ9 A;  1Y0P A;  5HYM A;  4FK1 C;  2X8C A;  1AOG A;  2A89 A;  2C3D A;  1DOC A;  4UDP A;  1GRA A;  1B4V A;  3AYL A;  1Q1R A;  1D4E A;  2BA9 A;  2E1M A;  5U63 A;  3LZW A;  3UOY A;  2VQB A;  2A8X A;  4IV9 A;  1B8S A;  2BCP A;  2HQM A;  2R9Z A;  4CCQ A;  3NYE A;  2JBV A;  2C67 A;  2CVJ A;  3Q9T A;  3KLJ A;  1HYU A;  1N4W A;  1NHP A;  1CC6 A;  3AE7 A;  3NNE A;  1K0I A;  3B3R A;  5M0Z A;  1FL2 A;  3IHG A;  4U8N A;  4U8M A;  2C72 A;  4YTN A;  4U8I A;  5FMH A;  2BK3 A;  4B68 A;  3SQP A;  2C76 A;  4H4V A;  4BJZ A;  2GR0 A;  3NN6 X;  2GVC A;  1EBD A;  3CNP A;  1BF3 A;  5BRT A;  4N9X A;  2GR3 A;  4TM3 A;  1ZDL A;  4ADW A;  1IJH A;  2YLX A;  3NK2 X;  1KSS A;  1F8W A;  2NPX A;  4AT2 A;  1OJA A;  4XWZ A;  2X8G A;  4A6N B;  4RG3 A;  1NDA A;  1COY A;  1LQT A;  5HXI A;  5IQ4 A;  4J33 A;  4UP3 A;  3S5W A;  3CGB A;  5KOW A;  1PBF A;  3KPF A;  5HHF A;  2XVH A;  3L8K A;  2AQJ A;  4FK1 A;  3ATR A;  2YLR A;  3CPI G;  4BJY A;  1CC2 A;  2ZZB A;  1DJQ A;  1PBD A;  1M6I A;  3SFE A;  2BK4 A;  3RP8 A;  1FEB A;  1BKW A;  4K8D A;  1RP0 A;  2GMH A;  3G5Q A;  3QJ4 A;  3LJP A;  2Z5X A;  4BK3 A;  4CRT A;  3CN8 A;  2PHH A; 
#chains in the Genus database with same CATH topology
 3RR1 A;  1KNP A;  5KMS A;  4PAB A;  1PS9 A;  4A65 A;  4G6H A;  2OQY A;  1NEK A;  2B9Y A;  1VRQ B;  4GDP A;  3SGL A;  3SBF A;  1L9C A;  1L8P A;  2XVE A;  3NVV B;  3O0H A;  3MUC A;  2ONE A;  3CGC A;  3SFD A;  4O5U A;  3SY4 A;  3NYF A;  3U9I A;  3RP7 A;  3BNM A;  3ZVI A;  2WPC A;  3R1Z A;  2JAE A;  3UKQ A;  3COX A;  1WUE A;  1PXA A;  3CB3 A;  5LV9 A;  4JNQ A;  4GR1 A;  3UOX A;  1F8R A;  3S61 A;  5GSN A;  3OTR A;  2X99 A;  2GQF A;  2GB0 A;  4ROP A;  2XVI A;  4OVI A;  4ZCC A;  2WET A;  5BOF A;  1B37 A;  4Z25 A;  2FJA A;  4H4U A;  4NTD A;  1TDE A;  1JRO A;  4C74 A;  3K7T A;  1T3Q C;  4RG4 A;  4MMW A;  1KDG A;  4K2X A;  1H7X A;  2WOI A;  2GF3 A;  2Q7V A;  2V60 A;  1FOH A;  2XDO A;  3H70 A;  3NLC A;  2PU0 A;  3A7R A;  1CF3 A;  3QSE A;  3RCY A;  3CPH G;  2PSN A;  1PBE A;  3MWC A;  3MQT A;  3QFA A;  1D4C A;  3VCN A;  2QA1 A;  1VDC A;  3FBS A;  5G5H B;  3SSZ A;  4OPC A;  3CPJ G;  2GEW A;  2PGE A;  3H4K A;  4MGG A;  3NYC A;  3DES A;  2XLU A;  4J56 A;  1FFV C;  4AOX A;  1GT8 A;  3D1C A;  3RRA A;  4A6G A;  2R0P A;  4II3 A;  3R11 A;  1CJC A;  4CNK A;  2GR1 A;  3UTE A;  1GAL A;  3MZN A;  3AEG A;  4C3X A;  2BC0 A;  1TYT A;  3MSY A;  3ES8 A;  3DG6 A;  1S2Q A;  3K7M X;  3FV9 A;  4GDE A;  2PTZ A;  2APG A;  2PA6 A;  1PDY A;  1SJC A;  2ZZC A;  4X2P A;  1EBG A;  2IID A;  4YSH A;  4IL2 A;  4Z44 A;  3II4 A;  2X50 A;  2PP3 A;  2C73 A;  3ZLH A;  5C2T A;  3L5O A;  4A6N A;  3DG3 A;  2YVG A;  2EQ8 A;  4H4R A;  4M52 A;  2AL1 A;  4YSZ A;  1BQG A;  2OLA A;  4J57 A;  4NEW A;  2WBA A;  2OAL A;  4A79 A;  3FG2 P;  4IT1 A;  3OZM A;  3QTP A;  2BK5 A;  4JQ9 A;  3DGH A;  3T37 A;  2OA1 A;  2FBW A;  2ACZ A;  1FO4 A;  5J60 A;  1SJD A;  2MUC A;  4II2 A;  1OJC A;  2QJJ A;  3UJF A;  3B6D A;  3CGD A;  4MJW A;  2VRL A;  3FCP A;  1H6V A;  4GRT A;  1QJD A;  4LU6 A;  4FX9 A;  1XHC A;  1D7L A;  4O5Q A;  2QGY A;  1N63 C;  2O9Z A;  4Z17 A;  2YVJ A;  2OZT A;  2C66 A;  3FPZ A;  1MOK A;  3NTA A;  4U2T A;  1N5X A;  2RGJ A;  4U8L A;  3ZVH A;  4G9K A;  3NKS A;  2QA2 A;  2YVF A;  2POD A;  1E9I A;  1L0V A;  2WDV A;  4TLZ A;  1QO8 A;  4TM4 A;  4A3R A;  4GFI A;  4YKF A;  1QLB A;  1SJA A;  4K8G A;  4EMI A;  3T2Y A;  4U8O A;  3ES7 A;  3IJL A;  4GME A;  2W55 A;  3AE8 A;  3GRT A;  3AEB A;  2P3Z A;  4Z26 A;  1CJ3 A;  4HCH A;  2Y6Q A;  5ER0 A;  3F8R A;  1GTH A;  4IA5 A;  4ENL A;  3NZG A;  2C64 A;  3EUB 3;  2VQ7 A;  4EWJ A;  2B76 A;  5U1O A;  1KFY A;  1PBB A;  5KMR A;  3TJ4 A;  2YLT A;  3AEC A;  4GF7 A;  4ECH A;  3SJN A;  1FEA A;  1EL7 A;  2W54 A;  4E6M A;  5FJT A;  4NNJ A;  3GDN A;  4AOS A;  3KKJ A;  3D8X A;  3K7Q X;  1BGJ A;  3UKL A;  4DSH A;  3R0K A;  5BUL A;  4B64 A;  3DK9 A;  1D5T A;  3RNM A;  1GTE A;  2BRY A;  3P4S A;  1NEN A;  3AE1 A;  3T9P A;  3EPT A;  4XWR A;  3OC4 A;  1PHH A;  2YG6 A;  2P88 A;  2YR5 A;  3P93 A;  1ZK7 A;  4XXG A;  4TM1 A;  4E4U A;  1KSU A;  2XVF A;  3AN1 A;  3PFR A;  4ZCD A;  4C5O A;  4X9M A;  2QJM A;  2XLS A;  1PJ7 A;  3ZYX A;  3C96 A;  1TDF A;  4H50 A;  2EQ6 A;  2HXU A;  1PDH A;  2P8C A;  2R4J A;  1LJ1 A;  4HPN A;  4GAV A;  1BGN A;  4K5S A;  2R0G A;  3HYW A;  3SXI A;  3GMC A;  2ARD A;  4K5R A;  2QQ6 A;  3V4B A;  1GRF A;  4AP1 A;  1XS2 A;  4ZN0 A;  4IZG A;  2XH0 A;  1AOG A;  4GGB A;  2E1M A;  3LZW A;  2GSH A;  1KCZ A;  2W3S A;  2C67 A;  3B3R A;  1BKH A;  1FIQ B;  4U8M A;  4JN8 A;  3UJE A;  4B68 A;  3NS1 B;  3RGT A;  4H4V A;  2C76 A;  4BJZ A;  2GVC A;  3CNP A;  1ZDL A;  4H1Z A;  3SZW A;  4XWZ A;  4A6N B;  1NDA A;  1LQT A;  5IQ4 A;  3SR6 B;  3S5W A;  3ENL A;  3ATR A;  2PU1 A;  4BJY A;  1M6I A;  1DJQ A;  1PBD A;  3SFE A;  3I6T A;  2E4G A;  2EQ9 A;  3RIT A;  1EL8 A;  5KVI A;  1N62 C;  1REO A;  2OLN A;  1ZOY A;  2GMJ A;  1E39 A;  4H4T A;  2GAH B;  2GL5 A;  4LA1 A;  3BI2 A;  1STZ A;  3GYX A;  3CK5 A;  3KPK A;  3MKC A;  4EQW A;  5KWF A;  3LZX A;  1EC8 A;  3DA1 A;  3LAD A;  3GY1 A;  3TWB A;  2QCU A;  2XFQ A;  1O95 A;  3P9U A;  2XH2 A;  6ENL A;  4YTP A;  2E3T A;  2P8B A;  4A35 A;  2C3C A;  4K1W A;  3ISH A;  2C70 A;  3AXB A;  3NRZ B;  2OAM A;  5BUK A;  3KVE A;  1X31 B;  4GCM A;  1KKR A;  4OPL A;  2WEU A;  3UTH A;  4OPI A;  2FJE A;  2WPF A;  1NAA A;  3G5R A;  2QVH A;  3HPF A;  3C4A A;  4DNA A;  2GH5 A;  5M10 A;  3N4E A;  3QKE A;  1LQU A;  2Q0K A;  2TMD A;  2R4E A;  2PTX A;  1FCD A;  4E8G A;  1CL0 A;  1GER A;  3AED A;  3THU A;  2BS2 A;  2OVL A;  3UKA A;  3WE0 A;  4USQ A;  1GV4 A;  1K0J A;  4B65 A;  2XLR A;  4IL0 A;  1DOD A;  3IC9 A;  2Z5Y A;  3QPE A;  3DFY A;  4DGK A;  4Z2R A;  4KWS A;  1IUS A;  2YR4 A;  3VDG A;  3OZY A;  3SN1 A;  2ZBW A;  3ZLF A;  4U8J A;  2WOW A;  2TPR A;  4J34 A;  3FVD A;  3NRN A;  1Q9I A;  3GWD A;  5GRT A;  1YEY A;  1JRY A;  2X8H A;  3NO1 A;  2R46 A;  1E6E A;  3R0U A;  3E1T A;  1D4D A;  1JRX A;  4USR A;  4NTE A;  4ICY A;  5FS7 A;  1EL5 A;  1CJ4 A;  2H88 A;  4DSG A;  4E0V A;  4EMJ A;  2B9W A;  3NHO X;  4H4S A;  2B7R A;  3GRS A;  1PN0 A;  1JPD X;  1N4V A;  1NHQ A;  4A7A A;  4Z24 A;  3F8D A;  4OPD A;  1FHU A;  3CIR A;  4MKS A;  3HW2 A;  4GGH A;  3BNU A;  4EQX A;  4EM4 A;  1ZOV A;  3ALM A;  2YQU A;  3VC5 A;  5HY5 A;  1WUF A;  3P4P A;  1CBO A;  2NQL A;  1CJ2 A;  5U25 A;  3B9J B;  1JU2 A;  1GRB A;  3ATQ A;  4FP1 A;  3A7U A;  3FXG A;  3NGC X;  2WU5 A;  3TTE A;  2I0Z A;  3DJE A;  2NVK X;  4AP3 A;  1N4U A;  2PP1 A;  3DME A;  3GO2 A;  2ZAD A;  1GRE A;  1OJD A;  1ELS A;  3P4Q A;  5EB4 A;  3CNJ A;  1LV0 A;  3UKP A;  3DK4 A;  2AL2 B;  2GGG A;  1VQW A;  3UP5 A;  3GSI A;  1FFU C;  1K4Q A;  4NEV A;  3DER A;  5JCN A;  1ZMC A;  3T4W A;  4YKG A;  3NXL A;  2C65 A;  2YLS A;  4H4Q A;  1GOS A;  1H2I A;  3L1R A;  3BJS A;  4JY2 A;  3K1G A;  2OG9 A;  3VA8 A;  1H7W A;  5C3J A;  3DDM A;  3CMM A;  2BRA A;  2E5V A;  3QLD A;  3BHF A;  4CNJ A;  4Z1Y A;  4HN8 A;  3V5C A;  2OFJ A;  1GPE A;  5J7X A;  2GGH A;  4KT2 A;  3TWA A;  2CDU A;  1D7Y A;  1XDI A;  1S7M A;  5IQ1 A;  3AYJ A;  2BS3 A;  3T31 A;  3NFU A;  3T8Q A;  1BWC A;  2JB3 A;  2E5A A;  3I6D A;  3UOV A;  4U2S A;  1S3B A;  2XH7 A;  1DXL A;  3IJI A;  1N5W C;  2WU2 A;  2GGI A;  3GYJ A;  1JNR A;  5CKU A;  1MDR A;  4YWS A;  1PBC A;  1YQ3 A;  2BS4 A;  3ZVH B;  4F4R A;  3NTD A;  4YT0 A;  3IF9 A;  4G74 A;  2GV8 A;  4TM0 A;  3S47 A;  2XVJ A;  2DW7 A;  3VC6 A;  5HYM A;  1OJ9 A;  1PDZ A;  2X8C A;  3GC2 A;  2A89 A;  1X2H A;  1B4V A;  3UOY A;  4IV9 A;  2JBV A;  2HZG A;  1NHP A;  3AE7 A;  2XH4 A;  1K0I A;  1FL2 A;  4GIS A;  2C72 A;  5FMH A;  4J3Z A;  3SQP A;  3A7A A;  3NN6 X;  5BRT A;  4N9X A;  4TM3 A;  1IJH A;  4ADW A;  2YLX A;  3NK2 X;  1KSS A;  1OJA A;  4RG3 A;  3UCC A;  4UP3 A;  3CGB A;  2XVH A;  2AQJ A;  3I4K A;  3CPI G;  2ZZB A;  5EU9 A;  3RP8 A;  4BK3 A;  3G5Q A;  2VRM A;  3NVZ B;  2O56 A;  4A99 A;  5KXJ A;  1ZXI C;  2GR2 A;  3BHK A;  3VRD B;  5CQF A;  2V6O A;  3DGB A;  3UXK A;  3IK4 A;  4OPU A;  3ITJ A;  1GRT A;  3T14 A;  2JK6 A;  2F5Z A;  3RED A;  4J2W A;  4TVY A;  1YQ4 A;  1P43 A;  1EBH A;  3EKG A;  3ICR A;  3ETR B;  4CY6 A;  3QFB A;  3V76 A;  4K7Z A;  1DNC A;  4EIQ A;  2WP5 A;  3AE4 A;  1XPQ A;  3H8I A;  3N4F A;  2WQY A;  3GDP A;  4FDC B;  3DJG X;  1SEZ A;  1O94 A;  1ZP0 A;  1DOE A;  1EL9 A;  5KVH A;  5BVA A;  5FJP A;  1S3E A;  1RYI A;  1W4X A;  4P9S A;  4ZCW A;  4B67 A;  3RHA A;  1PJ5 A;  4H4Z A;  4B66 A;  4YWO A;  1GES A;  3KD9 A;  3PWG A;  1Q1W A;  2XGZ A;  4GYP A;  2OO6 A;  4FI4 A;  2QAE A;  1H86 A;  3R07 C;  2PGW A;  1YQZ A;  3H8L A;  1O5W A;  3HYX A;  3FMW A;  1NEL A;  4GUV A;  1GSN A;  1IUT A;  1N61 C;  4J1O A;  2VZ2 A;  3SX6 A;  5EB5 A;  3OPS A;  1MDL A;  2BXR A;  1LTX R;  2YG5 A;  2RAB A;  2VVL A;  3V3W A;  1XPY A;  3M0O A;  1H81 A;  3DJD A;  2B9X A;  3TQP A;  3QSS A;  4HA6 A;  2WES A;  3AD9 B;  4H2R A;  2YAU A;  2AKZ A;  4IVO B;  4KEM A;  1L9E A;  4G7F A;  2YM2 A;  1GND A;  4GYP C;  3SN0 A;  1TDO A;  4G73 A;  4M0X A;  4AT0 A;  2J3N A;  3SN4 A;  3ZDN A;  2GGJ A;  1KN0 A;  4H19 A;  3GD3 A;  4EQR A;  5BOE A;  2WHD A;  4APN A;  4K22 A;  4YTM A;  3UXL A;  1YY5 A;  2UZZ A;  3JSK A;  4E4F A;  3EF6 A;  4H2P A;  3QSM A;  4RSL A;  1KNR A;  1TRB A;  3VCC A;  4WCT A;  4G6G A;  4M6U A;  7ENL A;  3M12 A;  3D46 A;  4BUR A;  4H4X A;  4U2L A;  3CTY A;  5KNL A;  2YG3 A;  3RP6 A;  1F9C A;  2WP6 A;  1F6M A;  2XYO A;  3EAO A;  1F3P A;  4Z43 A;  3GYI A;  1PJ6 A;  4I58 A;  1E1L A;  3ALL A;  4IVM B;  1CHU A;  1E1K A;  1TKK A;  4YSX A;  1K0L A;  3DH9 A;  3T2Z A;  3UCD A;  2XSX A;  1MNS A;  1EC9 A;  5FS9 A;  3R25 A;  3IHM A;  5EBK A;  1W6T A;  2GRT A;  4BK2 A;  3FIM B;  3TOY A;  3B97 A;  2ZC8 A;  5JCK A;  3PK7 A;  2WPE A;  4JN7 A;  1PXC A;  3VRA A;  3SZ0 A;  1NG3 A;  2JB1 A;  3CXB A;  5ENL A;  2IVD A;  3SQS A;  4HB9 A;  1NU5 A;  3HRD C;  3TJI A;  2BYB A;  4NWZ A;  3JW7 A;  2XCG A;  3K30 A;  4KPL A;  1NHS A;  3AE2 A;  2X3N A;  4KX6 A;  2RGO A;  1KKO A;  3SM8 A;  3UJR A;  1ZKQ A;  3Q4D A;  1VG9 A;  1JDF A;  2BXS A;  2W0H A;  2VOU A;  2R45 A;  3DEQ A;  1IUU A;  3I6E A;  2DKH A;  3M13 A;  4H7U A;  3STP A;  3AEE A;  3CNS A;  2PCE A;  1DJN A;  3JZU A;  3URH A;  1GRH A;  2BCG G;  1JPM A;  3AEA A;  3BOX A;  4Z2T A;  3NK0 X;  3KA7 A;  1GEU A;  4U8P A;  3ADA B;  2A87 A;  4UDR A;  3T6C A;  2XFP A;  3UKH A;  4A5L A;  1JRZ A;  3AMZ A;  4H4Y A;  2WS3 A;  5KRQ A;  4H2H A;  3AE5 A;  3AE9 A;  3GWF A;  1NPX A;  5FJR A;  3CND A;  2WP9 A;  1JRP A;  3CXO A;  3SZC A;  2H89 A;  1WYG A;  3AE3 A;  4LII A;  1FEC A;  2V5Z A;  3T0K A;  3NG7 X;  4HYR A;  3PS9 A;  1E1M A;  3CAW A;  4D04 A;  2R0C A;  3CGE A;  3UTF A;  1TDK A;  3V5F A;  4JNA A;  2QDE A;  1XAN A;  1RM6 B;  5EOW A;  1GRG A;  4J36 A;  4JHM A;  3VR9 A;  2MNR A;  3ICT A;  1SJB A;  4U8K A;  4Y4N A;  3VFC A;  2C3D A;  1Q1R A;  1D4E A;  1TZZ A;  2VQB A;  2A8X A;  2BCP A;  2HQM A;  2R9Z A;  4CCQ A;  2CVJ A;  1DTN A;  1N4W A;  1CC6 A;  3NNE A;  5M0Z A;  2RDX A;  1ONE A;  3GD6 A;  2BK3 A;  3RO6 A;  2GR0 A;  1VDV A;  2HXT A;  1F8W A;  4AT2 A;  3DG7 A;  3MY9 A;  4J33 A;  3EEZ A;  1PBF A;  3KPF A;  5HHF A;  3QN3 A;  2YLR A;  1CC2 A;  1BKW A;  2GMH A;  3QJ4 A;  3P0W A;  2DW6 A;  3Q45 A;  2Z5X A;  4IHC A;  2PHH A;  2PS2 A;  4Y4L A;  2XFU A;  2I5Q A;  1KD0 A;  3PG6 A;  4EM3 A;  2AAQ A;  4DWD A;  3UP4 A;  5KMP A;  1X2G A;  1NG4 A;  4OCG A;  3SYI A;  2FJD A;  3C4N A;  4IP4 A;  1GET A;  2XFN A;  3S5S A;  1RSG A;  4A9W A;  3UCL A;  1N60 C;  4TLX A;  2C75 A;  2EQ7 A;  4DN1 A;  2CUL A;  1V59 A;  2FKP A;  2C7G A;  2PMQ A;  3AEF A;  3I3L A;  2WDQ A;  3DK8 A;  4DYE A;  1MRA A;  4DXK A;  2V61 A;  2Y6R A;  4YSY A;  3FYY A;  3IWA A;  4H4W A;  4C3Y A;  3H7V A;  3NT6 A;  4J31 A;  3R10 A;  1IUV A;  2YLW A;  2WOV A;  1H84 A;  5FJO A;  1VG0 A;  5KMQ A;  4UDQ A;  3KUM A;  2PTY A;  3G5S A;  1GXF A;  4NZH A;  1TYP A;  3PWI A;  1JEH A;  1MO9 A;  3GD4 A;  4GIR A;  3D47 A;  2PP0 A;  5TR3 A;  1H83 A;  4EIP A;  1OJT A;  3V3N A;  1S2Y A;  3VR8 A;  2GDQ A;  2C4C A;  1YKJ A;  1LPF A;  2V3A A;  1UKV G;  4CCR A;  2OZ8 A;  2POZ A;  3LB8 A;  4H2Q A;  3AD7 B;  4DHG A;  1JNZ A;  4G8T A;  3GMB A;  1Y56 B;  3AD8 B;  1M64 A;  3CNT A;  1ZX9 A;  1LVL A;  4IP5 A;  3N6J A;  3PVC A;  5FJU A;  3LOV A;  4H83 A;  1P2E A;  1Y56 A;  3VRB A;  3QVR A;  3D9X A;  2OPJ A;  5DBJ A;  3BI4 A;  1KF6 A;  4I59 A;  1E7P A;  4CBQ A;  3U4F A;  3V3O A;  3DIP A;  4REK A;  4BK1 A;  2YM1 A;  3NN0 X;  3H12 A;  3UOZ A;  1PXB A;  3DGZ A;  1R0M A;  2OZ3 A;  2BC1 A;  1ZMD A;  4OPT A;  2BAB A;  1TDN A;  3NH3 X;  2AL2 A;  2YR6 A;  3OZ2 A;  3AWI A;  4TVW A;  1P48 A;  4B1B A;  3TCS A;  1JCT A;  5FS6 A;  2OQH A;  3HYV A;  1L9D A;  3TW9 A;  2RGH A;  3VQR A;  2GAG B;  3N6H A;  5FS8 A;  1OEP A;  2OKT A;  4Z2U A;  2PYX A;  2AKM A;  3OP2 A;  2BAC A;  2DKI A;  3AM9 A;  3T2K A;  3UKK A;  2V3B A;  5JCI A;  3AE6 A;  4NTC A;  4WX1 A;  2HNE A;  4B63 A;  3CYJ A;  4JY3 A;  3P1W A;  4OPG A;  3P4R A;  1E1N A;  3CT2 A;  3ALJ A;  2B7S A;  3NVY B;  4D03 A;  2VVM A;  3IJQ A;  3F8P A;  2PTW A;  3NIX A;  3ZLG A;  5KOX A;  1CC4 A;  5J04 A;  2GQW A;  3LXD A;  3UTG A;  2OLO A;  2YG4 A;  3Q6J A;  2XLT A;  3PO7 A;  4E5T A;  4BV6 A;  2ZZ0 A;  3UGV A;  4H4P A;  2VVL G;  3EAN A;  1Z6L A;  2CFY A;  2XLP A;  1ECQ A;  3HZL A;  4YXD A;  1ZY8 A;  4EQS A;  2JB2 A;  1NHR A;  1R6W A;  4HCL A;  5IDZ A;  4Y4M A;  4KPR A;  1MUC A;  2QDD A;  3KU9 A;  1MXT A;  3P3B A;  1BZL A;  4CY8 A;  2Q6U A;  1SB3 B;  3AB1 A;  2W3R A;  1DOB A;  2YWL A;  3BI5 A;  3QVP A;  4X9N A;  1N1P A;  1JOA A;  1B5Q A;  4X4J A;  2IVE A;  3H8A A;  3R9U A;  4H2N A;  1IUW A;  2YLZ A;  3FJ4 A;  2Q0L A;  1H82 A;  3NK1 X;  3UKF A;  3UJ2 A;  4B69 A;  3DJJ A;  1TE6 A;  2OX4 A;  5JCL A;  2PPG A;  5IPY A;  4HNL A;  4DX3 A;  1ONF A;  1FHV A;  3ICS A;  4JDR A;  1F8S A;  5L46 A;  4JN9 A;  2JKC A;  3AYI A;  3OW1 A;  4ZOH B;  5JCM A;  1IUX A;  2FJB A;  4EMW A;  1EC7 A;  1P2H A;  4C77 A;  2YG7 A;  1ELI A;  2WDR A;  3ABV A;  4K2S A;  4IA6 A;  4PAA A;  2GGE A;  5JRB A;  1VQZ A;  2XFO A;  2AR8 A;  1Y0P A;  4FK1 C;  1DOC A;  4UDP A;  1GRA A;  3AYL A;  2BA9 A;  1RVK A;  5U63 A;  3UJS A;  5G5G B;  1B8S A;  2FYM A;  3NYE A;  2CHR A;  3Q9T A;  3KLJ A;  1HYU A;  3IHG A;  4U8N A;  4GAP A;  4HCD A;  4YTN A;  4U8I A;  2QJN A;  1IYX A;  1EBD A;  1V97 A;  1BF3 A;  2GR3 A;  2P0I A;  4HNC A;  2NPX A;  2X8G A;  3BSM A;  1COY A;  5HXI A;  5KOW A;  3DFH A;  3JVA A;  3L8K A;  4FK1 A;  3SZF A;  4ZA0 A;  2BK4 A;  1FEB A;  1RP0 A;  4K8D A;  3LJP A;  3NVW B;  4CRT A;  3CN8 A; 
#chains in the Genus database with same CATH homology
 1KNP A;  2VRM A;  4Y4L A;  4PAB A;  1PS9 A;  4A65 A;  5KMS A;  2E4G A;  4G6H A;  4A99 A;  1NEK A;  2EQ9 A;  2XFU A;  2B9Y A;  1VRQ B;  5KXJ A;  4GDP A;  3PG6 A;  4EM3 A;  2AAQ A;  3SGL A;  3UP4 A;  2GR2 A;  3BHK A;  1EL8 A;  5KMP A;  1NG4 A;  1L9C A;  4OCG A;  3SYI A;  2FJD A;  3C4N A;  2XVE A;  1GET A;  3VRD B;  2XFN A;  1RSG A;  2V6O A;  5CQF A;  4A9W A;  3UCL A;  3O0H A;  5KVI A;  4TLX A;  2C75 A;  1REO A;  3CGC A;  2OLN A;  1ZOY A;  2EQ7 A;  2GMJ A;  2CUL A;  3SFD A;  4O5U A;  1V59 A;  4OPU A;  1E39 A;  2C7G A;  4H4T A;  2GAH B;  4LA1 A;  3SY4 A;  3BI2 A;  3AEF A;  3I3L A;  3NYF A;  3ITJ A;  3RP7 A;  1GRT A;  3BNM A;  2WPC A;  3GYX A;  3T14 A;  2JK6 A;  2F5Z A;  3RED A;  2JAE A;  3UKQ A;  4J2W A;  2WDQ A;  3COX A;  3DK8 A;  1PXA A;  1YQ4 A;  2V61 A;  2Y6R A;  4YSY A;  5LV9 A;  3KPK A;  4JNQ A;  4GR1 A;  3UOX A;  3IWA A;  4H4W A;  4C3Y A;  1F8R A;  3ICR A;  3NT6 A;  4J31 A;  3S61 A;  4CY6 A;  4EQW A;  5GSN A;  5KWF A;  3QFB A;  1IUV A;  4K7Z A;  2YLW A;  2WOV A;  3V76 A;  1DNC A;  3LZX A;  2X99 A;  2GQF A;  4EIQ A;  2WP5 A;  3AE4 A;  1H84 A;  2GB0 A;  3DA1 A;  3LAD A;  1XPQ A;  4OVI A;  2XVI A;  3H8I A;  2WQY A;  1VG0 A;  4ZCC A;  5KMQ A;  2QCU A;  4UDQ A;  3GDP A;  2WET A;  2XFQ A;  1B37 A;  3G5S A;  4Z25 A;  1GXF A;  4NZH A;  1TYP A;  4FDC B;  2FJA A;  4H4U A;  1JEH A;  1MO9 A;  3DJG X;  3GD4 A;  1SEZ A;  1TDE A;  4NTD A;  1O95 A;  1O94 A;  3P9U A;  4C74 A;  1ZP0 A;  3K7T A;  4RG4 A;  1DOE A;  5TR3 A;  1H83 A;  1KDG A;  4EIP A;  4YTP A;  1OJT A;  5KVH A;  1EL9 A;  5BVA A;  4K2X A;  1H7X A;  2WOI A;  2GF3 A;  2C3C A;  3ISH A;  2C70 A;  3AXB A;  3V3N A;  1S3E A;  2Q7V A;  1S2Y A;  2V60 A;  1RYI A;  3VR8 A;  1W4X A;  4P9S A;  4B67 A;  1FOH A;  2OAM A;  2C4C A;  5BUK A;  3KVE A;  1X31 B;  3RHA A;  1YKJ A;  1PJ5 A;  1LPF A;  2V3A A;  2XDO A;  4GCM A;  4H4Z A;  4B66 A;  3NLC A;  4YWO A;  1GES A;  1UKV G;  4CCR A;  4OPL A;  3KD9 A;  2WEU A;  3UTH A;  4OPI A;  1CF3 A;  3LB8 A;  2FJE A;  3QSE A;  2WPF A;  4H2Q A;  1Q1W A;  1NAA A;  3AD7 B;  3CPH G;  3G5R A;  1JNZ A;  3GMB A;  1Y56 B;  2QAE A;  1H86 A;  1PBE A;  3AD8 B;  1M64 A;  3CNT A;  1ZX9 A;  1YQZ A;  3QFA A;  3H8L A;  1LVL A;  1O5W A;  3C4A A;  4DNA A;  3HYX A;  2GH5 A;  5M10 A;  3PVC A;  3FMW A;  3LOV A;  1D4C A;  4GUV A;  2QA1 A;  1GSN A;  1P2E A;  1VDC A;  1Y56 A;  1IUT A;  1LQU A;  3FBS A;  4OPC A;  3CPJ G;  2Q0K A;  2GEW A;  2VZ2 A;  3SX6 A;  5EB5 A;  3VRB A;  2BXR A;  1LTX R;  2YG5 A;  3QVR A;  3D9X A;  2TMD A;  3H4K A;  2R4E A;  5DBJ A;  2RAB A;  3NYC A;  2VVL A;  2XLU A;  4J56 A;  1FCD A;  3BI4 A;  4AOX A;  1KF6 A;  3M0O A;  1H81 A;  3DJD A;  1GT8 A;  2B9X A;  3D1C A;  1CL0 A;  1GER A;  4I59 A;  1E7P A;  2R0P A;  3QSS A;  4CBQ A;  3AED A;  4II3 A;  1CJC A;  3V3O A;  2WES A;  2GR1 A;  2BS2 A;  3AD9 B;  4H2R A;  2YAU A;  4HA6 A;  4IVO B;  4CNK A;  3UKA A;  3WE0 A;  1GAL A;  4USQ A;  1GV4 A;  4REK A;  1K0J A;  4B65 A;  2YM1 A;  3NN0 X;  3AEG A;  1L9E A;  4BK1 A;  2XLR A;  3UOZ A;  4C3X A;  1PXB A;  2BC0 A;  1TYT A;  3DGZ A;  2YM2 A;  1DOD A;  1GND A;  1S2Q A;  2BC1 A;  1ZMD A;  4OPT A;  3IC9 A;  3K7M X;  4GDE A;  2BAB A;  2APG A;  1TDN A;  3NH3 X;  2ZZC A;  1TDO A;  2Z5Y A;  4G73 A;  4AT0 A;  2IID A;  4YSH A;  4DGK A;  4Z2R A;  2J3N A;  2YR6 A;  1IUS A;  3OZ2 A;  3AWI A;  4A7A A;  4Z44 A;  3II4 A;  2YR4 A;  2X50 A;  3ZDN A;  4B1B A;  2C73 A;  5C2T A;  3L5O A;  2ZBW A;  5FS6 A;  4A6N A;  3HYV A;  1L9D A;  2YVG A;  2EQ8 A;  4H4R A;  4M52 A;  4U8J A;  1KN0 A;  2WOW A;  4YSZ A;  2RGH A;  2TPR A;  4J34 A;  3VQR A;  2GAG B;  4J57 A;  3NRN A;  3GD3 A;  4EQR A;  1Q9I A;  3GWD A;  4NEW A;  2WHD A;  2WBA A;  5FS8 A;  5GRT A;  4APN A;  4K22 A;  2OAL A;  4YTM A;  1JRY A;  4A79 A;  4Z2U A;  2PYX A;  3FG2 P;  1YY5 A;  2UZZ A;  3JSK A;  3EF6 A;  2BK5 A;  4JQ9 A;  3DGH A;  2X8H A;  3T37 A;  2BAC A;  2OA1 A;  2FBW A;  2ACZ A;  2R46 A;  1E6E A;  3QSM A;  4H2P A;  5J60 A;  2DKI A;  4RSL A;  3E1T A;  1D4D A;  1KNR A;  1TRB A;  4II2 A;  1OJC A;  3T2K A;  4WCT A;  4G6G A;  3UKK A;  3B6D A;  1JRX A;  3CGD A;  4MJW A;  3M12 A;  2VRL A;  4USR A;  4BUR A;  4ICY A;  4NTE A;  1H6V A;  5FS7 A;  4H4X A;  4GRT A;  1EL5 A;  2V3B A;  1QJD A;  4LU6 A;  4U2L A;  5JCI A;  4FX9 A;  1CJ4 A;  3CTY A;  5KNL A;  1XHC A;  2YG3 A;  3RP6 A;  1D7L A;  4O5Q A;  2WP6 A;  1F6M A;  2XYO A;  2H88 A;  3EAO A;  1F3P A;  4DSG A;  3AE6 A;  4NTC A;  4E0V A;  4Z43 A;  4WX1 A;  4EMJ A;  3GYI A;  2O9Z A;  2B9W A;  3NHO X;  1PJ6 A;  4H4S A;  4B63 A;  2B7R A;  2YVJ A;  3GRS A;  2C66 A;  1E1L A;  4I58 A;  3FPZ A;  3ALL A;  4IVM B;  1CHU A;  1MOK A;  1PN0 A;  4JY3 A;  1E1K A;  3NTA A;  1N4V A;  3P1W A;  1NHQ A;  4OPG A;  4U2T A;  4YSX A;  1K0L A;  3F8D A;  3P4R A;  1E1N A;  4Z24 A;  2RGJ A;  3ALJ A;  4U8L A;  2B7S A;  4OPD A;  4G9K A;  3CIR A;  3DH9 A;  3NKS A;  3T2Z A;  2QA2 A;  2YVF A;  3BNU A;  4D03 A;  4EQX A;  5FS9 A;  3IHM A;  1L0V A;  2WDV A;  5EBK A;  4EM4 A;  2VVM A;  4TLZ A;  1ZOV A;  3ALM A;  1QO8 A;  2YQU A;  4TM4 A;  5HY5 A;  3F8P A;  2GRT A;  3P4P A;  1CBO A;  4YKF A;  1QLB A;  1CJ2 A;  5U25 A;  1JU2 A;  4BK2 A;  1GRB A;  3ATQ A;  3FIM B;  3NIX A;  4EMI A;  5KOX A;  3T2Y A;  1CC4 A;  5JCK A;  4U8O A;  3NGC X;  2WU5 A;  2GQW A;  2WPE A;  3LXD A;  2I0Z A;  3DJE A;  3UTG A;  2NVK X;  3AE8 A;  1PXC A;  3VRA A;  4AP3 A;  3GRT A;  2OLO A;  1N4U A;  3AEB A;  3SZ0 A;  1NG3 A;  2JB1 A;  3DME A;  2YG4 A;  3Q6J A;  2XLT A;  3PO7 A;  1GRE A;  4Z26 A;  2IVD A;  1OJD A;  1CJ3 A;  4BV6 A;  2ZZ0 A;  3P4Q A;  2Y6Q A;  4H4P A;  4HB9 A;  2VVL G;  5EB4 A;  3EAN A;  1Z6L A;  2CFY A;  2XLP A;  5ER0 A;  3CNJ A;  3F8R A;  1GTH A;  1LV0 A;  3HZL A;  4YXD A;  3UKP A;  1ZY8 A;  4IA5 A;  3DK4 A;  2BYB A;  2C64 A;  4EQS A;  1VQW A;  2JB2 A;  1NHR A;  2VQ7 A;  3GSI A;  1K4Q A;  4NEV A;  2B76 A;  3UP5 A;  5U1O A;  4NWZ A;  1KFY A;  5JCN A;  1PBB A;  5KMR A;  4Y4M A;  4KPR A;  1ZMC A;  4YKG A;  2YLT A;  2C65 A;  2YLS A;  3KU9 A;  1MXT A;  2XCG A;  3AEC A;  4GF7 A;  4H4Q A;  4ECH A;  3K30 A;  3UTE A;  1NHS A;  3AE2 A;  1GOS A;  1FEA A;  2X3N A;  4KX6 A;  1EL7 A;  1BZL A;  4CY8 A;  2Q6U A;  4NNJ A;  2RGO A;  3GDN A;  4AOS A;  1H2I A;  3KKJ A;  3SM8 A;  3D8X A;  3L1R A;  1ZKQ A;  4JY2 A;  3AB1 A;  1VG9 A;  3K7Q X;  1BGJ A;  1DOB A;  3UKL A;  2BXS A;  2W0H A;  2YWL A;  3BI5 A;  4DSH A;  5BUL A;  3QVP A;  2VOU A;  2R45 A;  1IUU A;  4X9N A;  1N1P A;  2DKH A;  3M13 A;  4H7U A;  4B64 A;  1H7W A;  3AEE A;  3CNS A;  1JOA A;  3DK9 A;  5C3J A;  1D5T A;  3RNM A;  2BRA A;  1B5Q A;  2E5V A;  1GTE A;  3BHF A;  3CMM A;  4X4J A;  4CNJ A;  2BRY A;  1DJN A;  3P4S A;  3URH A;  2IVE A;  1GRH A;  2BCG G;  1GPE A;  1NEN A;  3AEA A;  3AE1 A;  3R9U A;  4H2N A;  5J7X A;  1IUW A;  3EPT A;  4Z2T A;  2YLZ A;  3NK0 X;  4XWR A;  2Q0L A;  3KA7 A;  1H82 A;  1GEU A;  3NK1 X;  4U8P A;  3UKF A;  3OC4 A;  1PHH A;  2CDU A;  2YG6 A;  2YR5 A;  3ADA B;  1D7Y A;  1XDI A;  1ZK7 A;  4B69 A;  1S7M A;  4XXG A;  2A87 A;  4TM1 A;  4UDR A;  3DJJ A;  5IQ1 A;  3AYJ A;  2XFP A;  3UKH A;  2BS3 A;  1KSU A;  4A5L A;  1JRZ A;  2XVF A;  3T31 A;  5JCL A;  4H4Y A;  2WS3 A;  5KRQ A;  4ZCD A;  3AE5 A;  4C5O A;  1BWC A;  2JB3 A;  4X9M A;  5IPY A;  2XLS A;  3AE9 A;  3GWF A;  3I6D A;  3UOV A;  1PJ7 A;  4U2S A;  1ONF A;  1NPX A;  1S3B A;  3ZYX A;  3CND A;  2WP9 A;  3SZC A;  3C96 A;  2H89 A;  3AE3 A;  1TDF A;  4JDR A;  1F8S A;  4LII A;  4H50 A;  1FEC A;  3ICS A;  5L46 A;  4JN9 A;  2V5Z A;  3T0K A;  1DXL A;  3NG7 X;  2EQ6 A;  3PS9 A;  2WU2 A;  2JKC A;  1PDH A;  1E1M A;  2R4J A;  4D04 A;  3AYI A;  3GYJ A;  2R0C A;  3CGE A;  3UTF A;  1PBC A;  1JNR A;  5JCM A;  1IUX A;  1TDK A;  5CKU A;  1LJ1 A;  2FJB A;  4JNA A;  1YQ3 A;  2BS4 A;  1XAN A;  4GAV A;  5EOW A;  1GRG A;  4EMW A;  1BGN A;  4K5S A;  1P2H A;  4J36 A;  4C77 A;  2R0G A;  2YG7 A;  3NTD A;  3HYW A;  4YT0 A;  3SXI A;  1ELI A;  2WDR A;  3GMC A;  3IF9 A;  4G74 A;  2GV8 A;  4TM0 A;  2ARD A;  3VR9 A;  3ABV A;  4K5R A;  4IA6 A;  4PAA A;  5JRB A;  3ICT A;  2XVJ A;  2XFO A;  1GRF A;  4AP1 A;  2AR8 A;  4U8K A;  4ZN0 A;  4Y4N A;  1OJ9 A;  1Y0P A;  5HYM A;  4FK1 C;  2X8C A;  1AOG A;  2A89 A;  2C3D A;  1DOC A;  4UDP A;  1GRA A;  1B4V A;  3AYL A;  1Q1R A;  1D4E A;  2BA9 A;  2E1M A;  5U63 A;  3LZW A;  3UOY A;  2VQB A;  2A8X A;  4IV9 A;  1B8S A;  2BCP A;  2HQM A;  2R9Z A;  4CCQ A;  3NYE A;  2JBV A;  2C67 A;  2CVJ A;  3Q9T A;  3KLJ A;  1HYU A;  1N4W A;  1NHP A;  1CC6 A;  3AE7 A;  3NNE A;  1K0I A;  3B3R A;  5M0Z A;  1FL2 A;  3IHG A;  4U8N A;  4GAP A;  4U8M A;  2C72 A;  4YTN A;  4U8I A;  5FMH A;  2BK3 A;  4B68 A;  3SQP A;  2C76 A;  4H4V A;  4BJZ A;  2GR0 A;  3NN6 X;  2GVC A;  1EBD A;  3CNP A;  1BF3 A;  5BRT A;  4N9X A;  2GR3 A;  4TM3 A;  1ZDL A;  4ADW A;  1IJH A;  2YLX A;  3NK2 X;  3SZW A;  1KSS A;  1F8W A;  2NPX A;  4AT2 A;  1OJA A;  4XWZ A;  2X8G A;  4A6N B;  4RG3 A;  1NDA A;  1COY A;  1LQT A;  5HXI A;  5IQ4 A;  4J33 A;  4UP3 A;  3S5W A;  3CGB A;  5KOW A;  1PBF A;  3KPF A;  5HHF A;  2XVH A;  3L8K A;  2AQJ A;  4FK1 A;  3ATR A;  2YLR A;  3CPI G;  3SZF A;  4BJY A;  1CC2 A;  2ZZB A;  1DJQ A;  1PBD A;  1M6I A;  3SFE A;  2BK4 A;  3RP8 A;  1FEB A;  1BKW A;  4K8D A;  1RP0 A;  2GMH A;  3G5Q A;  3QJ4 A;  3LJP A;  2Z5X A;  4BK3 A;  4CRT A;  3CN8 A;  2PHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...