2HQMA

Crystal structure of glutathione reductase glr1 from the yeast saccharomyces cerevisiae
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
462
structure length
461
Chain Sequence
KHYDYLVIGGGSGGVASARRAASYGAKTLLVEAKALGGTCVNVGCVPKKVMWYASDLATRVSHANEYGLYQNLPLDKEHLTFNWPEFKQKRDAYVHRLNGIYQKNLEKEKVDVVFGWARFNKDGNVEVQKRDNTTEVYSANHILVATGGKAIFPENIPGFELGTDSDGFFRLEEQPKKVVVVGAGYIGIELAGVFHGLGSETHLVIRGETVLRKFDECIQNTITDHYVKEGINVHKLSKIVKVEKNVTDKLKIHMNDSKSIDDVDELIWTIGRKSHLGMGSENVGIKLNSHDQIIADEYQNTNVPNIYSLGDVVGKVELTPVAIAAGRKLSNRLFGPEKFRNDKLDYENVPSVIFSHPEAGSIGISEKEAIEKYGKENIKVYNSKFTAMYYAMLSEKSPTRYKIVCAGPNEKVVGLHIVGDSSAEILQGFGVAIKMGATKADFDNCVAIHPTSAEELVTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione reductase
publication title Crystal structure of glutathione reductase Glr1 from the yeast Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 147
structure length 461
sequence length 462
chains with identical sequence B
ec nomenclature ec 1.8.1.7: Glutathione-disulfide reductase.
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF12831 FAD_oxidored FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 2hqmA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2hqmA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2hqmA02
3B6DA 1D7YA 3DH9A 4GR1A 1GTHA 1YQ4A 1F8SA 2FJBA 4OPCA 2TPRA 2WOWA 4U8MA 2WHDA 3UOYA 3ALLA 5JCNA 2A89A 2DKIA 2WPEA 1KFYA 4USRA 3AYJA 3GRTA 1FOHA 1PS9A 4RSLA 4Z2UA 2XFPA 1NHRA 3AECA 3VQRA 2V60A 3WE0A 2C7GA 1MXTA 2YLWA 1ONFA 2RGJA 5FS8A 3G5RA 4K8DA 1CJCA 2ZZBA 2X8HA 1M6IA 2FBWA 1O5WA 4EMWA 1MO9A 2RGOA 2VVLA 3GYJA 4OPDA 4B64A 4BJZA 1H83A 4H4UA 4H4YA 3ICRA 1BGJA 3AYIA 2XFNA 2JKCA 1H7XA 2GRTA 2WPCA 3LOVA 2CVJA 3V3NA 4Z26A 2YR6A 5EOWA 5M10A 3FG2P 3DK8A 2R4EA 4NTDA 3UKFA 1FCDA 2YR4A 4YSZA 3ALJA 3RP6A 4C3YA 1BZLA 3UKHA 3CPIG 3NGCX 2H89A 2XFUA 1TRBA 4BJYA 1DOEA 2GR2A 4RG4A 4YXDA 3DMEA 2VVMA 2XLSA 2WP6A 1E1NA 4JNQA 2JB2A 4IVMB 3AE9A 2AAQA 4JNAA 5BULA 2BK4A 2R9ZA 4H4TA 3AEFA 3CNJA 1CF3A 4GDPA 3VRDB 3DJGX 4ICYA 4C77A 3QSSA 1JRYA 1O94A 1L9DA 1TDKA 3UCLA 2XVFA 4EIQA 2B9WA 3DJJA 2XLUA 4CRTA 2GAHB 3KVEA 4NEVA 2IIDA 5M0ZA 5GRTA 3NYEA 2XDOA 1Q1RA 3QVRA 1NEKA 4JY2A 3NK2X 3GWDA 3SGLA 3RHAA 3P4SA 2NVKX 1EL9A 4H2PA 1CHUA 1LV0A 3UKQA 4EMIA 5DBJA 4TM3A 4GRTA 1ZDLA 2WETA 3KD9A 5KOWA 3KKJA 1CBOA 3FMWA 3PO7A 3IHMA 3K7TA 2C67A 3VR9A 3C4AA 3DGZA 1S2YA 2WQYA 3UKPA 5C3JA 3I6DA 2EQ8A 3C96A 3UKLA 3CIRA 2A87A 4KX6A 1VDCA 3KPFA 3ALMA 2H88A 1BF3A 1X31B 2BABA 1ZOYA 4O5QA 4U8KA 4ADWA 3K7MX 2GMJA 3VRBA 1ZK7A 2UZZA 3CNTA 4HB9A 1GRHA 3BI5A 2B9XA 3AYLA 3OZ2A 3RP8A 4TLZA 4LU6A 4DSHA 5KRQA 2DKHA 5EBKA 1PJ6A 1RP0A 2C66A 3UP4A 2I0ZA 3VR8A 3H8IA 2WESA 3AB1A 3DJDA 2X99A 1B8SA 4H4RA 4OVIA 1GRGA 2BC1A 3UKAA 3AEEA 4U8JA 1XHCA 3AWIA 1GPEA 2FJEA 5KOXA 4JY3A 4H4XA 1CJ3A 1N4WA 3NRNA 4TM1A 2Q6UA 3AE6A 5JCKA 2R45A 1PXCA 2OLOA 4BK2A 4EM4A 1F6MA 4X9NA 1TYPA 2R0PA 2YWLA 2VQ7A 2C70A 3QFAA 2CFYA 4OCGA 4A5LA 3GD3A 3H4KA 2XFOA 3ATRA 1GRFA 4B68A 1NHPA 1H82A 3PS9A 2ZBWA 4IV9A 2ACZA 1Y56B 3GDNA 3P4PA 4USQA 4A7AA 4C5OA 4CNJA 2BS2A 3UTHA 4H4QA 1LTXR 4B1BA 3IF9A 1F3PA 5IPYA 3KU9A 1B37A 2X50A 1YQZA 2APGA 4YT0A 2V3BA 4APNA 3G5SA 1XDIA 1NENA 2E1MA 4YSYA 3COXA 1OJDA 2VRLA 4BK3A 1QO8A 1PXAA 4D04A 3NKSA 4EQXA 2Q0LA 3F8DA 4WCTA 3S61A 3BI4A 1NG4A 2CDUA 1NHSA 3NTAA 2GQFA 2GVCA 2B76A 1E1LA 2RABA 2ZZCA 2JB1A 3GDPA 2GV8A 4BV6A 1Y56A 2XVIA 5HYMA 3P9UA 4FX9A 5HXIA 1OJTA 2QAEA 5BUKA 4Z2RA 1GOSA 1M64A 1TDEA 2JK6A 4OPTA 1Y0PA 4J56A 4X9MA 2C76A 4U8PA 3FBSA 3ITJA 3Q6JA 1LQTA 1VG9A 1JOAA 4EMJA 1PBCA 2F5ZA 4U2TA 4H4ZA 3CGDA 1H81A 3K7QX 1ELIA 2Z5YA 1TDOA 4IVOB 4UP3A 3ABVA 4XXGA 3G5QA 1D5TA 3II4A 1S2QA 5KXJA 1REOA 3AE7A 1GRTA 3ATQA 4H2QA 4YKFA 3GMCA 4OPGA 4J34A 3GWFA 3CGEA 3GMBA 1GSNA 3SFDA 1S3BA 4B67A 1KSSA 4ZCDA 3ADAB 1ZY8A 4AOSA 1CL0A 1XANA 1KDGA 2QA1A 4U8NA 2BCGG 4H4WA 4YSXA 1CC4A 1E39A 2XLRA 2XYOA 3AEGA 3C4NA 2AQJA 3K30A 4PAAA 4TLXA 1K0JA 4E0VA 4CBQA 1NPXA 1K4QA 3Q9TA 2QCUA 2NPXA 2V3AA 2YLRA 4FK1A 1NDAA 4NEWA 2XCGA 4JQ9A 3AE1A 2VVLG 3KLJA 4TM4A 2WU2A 1NHQA 2CULA 1CJ2A 4O5UA 3LB8A 4J36A 3RP7A 1EL8A 3I3LA 2GQWA 4YSHA 4EQWA 3PVCA 2BC0A 2IVEA 3CNDA 2X8GA 1D7LA 2BXSA 4K22A 2GR3A 2BCPA 3EAOA 4YTNA 2WP9A 3CGCA 1IJHA 3UTFA 3H8LA 4YTPA 2E4GA 3P4RA 3M0OA 2C73A 2XVEA 3S5WA 1JNZA 2R0CA 3HZLA 3BHFA 4AT0A 1Z6LA 4CNKA 2YVJA 3DGHA 2EQ7A 3O0HA 1IUUA 2YLZA 4C3XA 3NYFA 4H7UA 3F8RA 4UDQA 3F8PA 2JB3A 2Y6QA 2EQ9A 1GNDA 2A8XA 4H4SA 2WDQA 4H4VA 4XWZA 1N1PA 3V3OA 4DGKA 4P9SA 1UKVG 1L0VA 3AE5A 3CTYA 3LXDA 4AT2A 4DSGA 4NTEA 2C75A 5EB5A 2OA1A 3IHGA 3M12A 3UTEA 2GF3A 4REKA 3IC9A 2FJAA 2Q7VA 2VRMA 2AR8A 2R4JA 5FS6A 2GEWA 2C3DA 2WOVA 3LJPA 3AE8A 1L9CA 3QVPA 5BVAA 2YVFA 2GR0A 4IA6A 3NG7X 1DJNA 4J31A 1KNRA 4K5SA 1ZP0A 1GRBA 5FS7A 4U8LA 1N4UA 1KSUA 3ZYXA 5FMHA 2YAUA 4GUVA 2GMHA 3UKKA 2RGHA 4A65A 4EQSA 1E6EA 1V59A 4NTCA 5U1OA 1PXBA 1GERA 2FJDA 4UDRA 1ZOVA 3LZWA 1IUVA 1ZX9A 1YKJA 4J57A 4BK1A 1W4XA 5GSNA 3BHKA 1ZMDA 2TMDA 4U8IA 3NN6X 4U8OA 1GESA 1GREA 3CN8A 4K5RA 1OJAA 2QA2A 1L9EA 2YVGA 1PHHA 3NK1X 1DXLA 2YR5A 4B66A 3GD4A 1BGNA 1D4CA 1D4DA 3AE4A 3JSKA 4K7ZA 4DNAA 1JRZA 3EPTA 2E5VA 3QFBA 1DJQA 1IUXA 2BK3A 2PHHA 3SQPA 1AOGA 4EM3A 3ZDNA 1Q1WA 4I58A 4YTMA 4OPLA 3QJ4A 5J60A 3DK4A 3L8KA 4I59A 1GXFA 4FDCB 3CNSA 4ZN0A 1YQ3A 4AP3A 1TDNA 1KF6A 1FEAA 1E7PA 1OJ9A 3ISHA 4CY6A 2Z5XA 3QSEA 4CCRA 1BKWA 2GR1A 4GF7A 1FEBA 3T37A 1Q9IA 1H6VA 3E1TA 4B65A 1ZKQA 2BXRA 4ECHA 5KWFA 1KNPA 2YG5A 2BS3A 3EF6A 1LQUA 2B7SA 2VOUA 3FIMB 1QJDA 3CPJG 4IA5A 4H4PA 3NIXA 5CQFA 4CCQA 1H84A 2WPFA 4WX1A 5ER0A 5U25A 1B5QA 4N9XA 4YKGA 1FL2A 1DOCA 1GRAA 1H7WA 5HHFA 3AEBA 1VQWA 3P4QA 1GTEA 3CPHG 1OJCA 1GV4A 4KPRA 1RYIA 1PDHA 3V76A 3QSMA 2C64A 2BA9A 2VZ2A 3NLCA 3D8XA 4J2WA 4Z43A 4B69A 1EBDA 2ARDA 4MJWA 1RSGA 4LA1A 3ICTA 3NN0X 4OPIA 2WEUA 2C72A 4J33A 1F8WA 3NT6A 4Z2TA 3RNMA 3B3RA 2YM1A 2WU5A 2BK5A 3D1CA 3DJEA 1P2EA 1LJ1A 2X8CA 2OALA 3GRSA 5FS9A 3AD7B 1NG3A 2WP5A 5EB4A 4CY8A 1MOKA 2J3NA 4LIIA 2C3CA 5TR3A 3BNMA 4Z44A 2YQUA 4GDEA 2O9ZA 4YWOA 3URHA 2WOIA 1JNRA 1PBEA 1N4VA 1TYTA 1GEUA 1CC2A 2X3NA 2YG4A 4M52A 2XVHA 5KVHA 2GH5A 3NYCA 5C2TA 1PN0A 1NAAA 1IUSA 2GB0A 3NH3X 2BYBA 1TDFA 3CNPA 3M13A 4PABA 2V5ZA 2HQMA 2BS4A 1EL5A 1FECA 4EIPA 5LV9A 4K2XA 3AEDA 4H2NA 4Z24A 4Z25A 4RG3A 2YG3A 4B63A 2WDRA 1PJ7A 2XLTA 3BNUA 1LPFA 1JU2A 4A6NB 3GYIA 4A9WA 1PBDA 3NNEA 1EL7A 4AP1A 1DNCA 3GSIA 1VG0A 5IQ4A 1K0IA 5U63A 5KVIA 1B4VA 2WBAA 4Y4NA 2YG7A 4GCMA 4BURA 3SFEA 3AD8B 1BWCA 2OLNA 1PBBA 4TM0A 4X4JA 3LZXA 1S3EA 2W0HA 1CC6A 1DODA 2BACA 2B7RA 3EANA 2YM2A 4NZHA 3UP5A 1D4EA 3AXBA 1GETA 1ZMCA 3UOVA 3DK9A 2R0GA 3DA1A 2YLXA 4A79A 1JEHA 2WDVA 2IVDA 3UOXA 3BI2A 3AD9B 3IWAA 2YLSA 1O95A 2C65A 4ZCCA 4A6NA 2EQ6A 3CGBA 4Y4MA 3SM8A 2OAMA 4UDPA 2Q0KA 3NTDA 3NHOX 5L46A 2V6OA 5JCMA 1YY5A 5HY5A 2JBVA 4H50A 2YG6A 1JRXA 1PBFA 3KA7A 4D03A 2YLTA 4H2RA 1XPQA 4EQRA 1K0LA 2XFQA 2GAGB 1IUWA 3REDA 2VQBA 3FPZA 1P2HA 3P1WA 1QLBA 1GT8A 1GALA 2ZZ0A 1HYUA 4OPUA 2V61A 1CJ4A 2JAEA 2XVJA 1DOBA 3UTGA 4Y4LA 1E1KA 4A99A 4C74A 2B9YA 2Y6RA 3NK0X 1SEZA 3R9UA 5JCLA 3ICSA 4AOXA 3UOZA 5BRTA 1F8RA 5JCIA 2PYXA 4FK1C 4HA6A 4JN9A 5CKUA 5IQ1A 4JDRA 1VRQB 1PJ5A 3AE2A 4U2SA 4XWRA 5J7XA 3OC4A 2R46A 3AEAA 1COYA 2WS3A 3VRAA 3LADA 3AE3A 1H86A 3L1RA 1IUTA 4U2LA 1E1MA 1LVLA 2XLPA
chains in the Genus database with same CATH superfamily
3B6DA 2PTYA 4GR1A 3AM9A 2FJBA 2TPRA 2WHDA 2PP1A 3ALLA 5JCNA 4XXGA 1R6WA 4Z2UA 1PS9A 1XS2A 2XFPA 3VQRA 1KKOA 4DHGA 1ONFA 4A79A 1O5WA 4BJZA 2XFNA 1H7XA 2WPCA 3R25A 4Z26A 2YR6A 4GYPA 3D47A 3FG2P 1N63C 4NTDA 1BZLA 1RVKA 1L8PA 2GGIA 2H89A 4BJYA 2AL2B 1E1NA 3MSYA 4JNAA 4H4TA 3CYJA 2I5QA 1CF3A 4GDPA 3CAWA 3QSSA 1JRYA 1L9DA 5GRTA 3NYEA 3QVRA 1NEKA 1CHUA 3VA8A 5KOWA 3PO7A 3IHMA 2C67A 1S2YA 2A87A 3AMZA 3KPFA 2H88A 2GDQA 1ZK7A 3RP8A 3DG6A 1RP0A 3V5CA 2WESA 3AB1A 1B8SA 4OVIA 1GRGA 2BC1A 3CMMA 3UKAA 2FJEA 4TM1A 3AE6A 5JCKA 2OLOA 4BK2A 1F6MA 4X9NA 3RO6A 2YWLA 2VQ7A 1N60C 1JCTA 2CFYA 2FKPA 4MGGA 3ATRA 3PWIA 4GIRA 4A7AA 4CNJA 2BS2A 4H4QA 1F3PA 3DFYA 2X50A 4YT0A 4M0XA 3COXA 3A7UA 4EQXA 3S61A 1NG4A 3MZNA 2ZZCA 1FIQB 3SSZA 3RRAA 2QAEA 3B97A 2C76A 5KNLA 2PP3A 3RGTA 4G8TA 4UP3A 2PTXA 4HYRA 3L5OA 2HXTA 2PGEA 3GWFA 1S3BA 1ONEA 3ES8A 3ADAB 1XANA 2QA1A 4H4WA 1E39A 3AEGA 4MKSA 4ZOHB 3Q9TA 3T2YA 1FFVC 3Q4DA 4GISA 2V3AA 2YLRA 1NDAA 4NEWA 3SN4A 3MQTA 4JQ9A 3KLJA 3UJRA 1CJ2A 4O5UA 3RP7A 2IVEA 2BXSA 2GR3A 3EAOA 1N62C 2XVEA 1JNZA 4KPLA 4DXKA 4AT0A 1Z6LA 3O0HA 1RM6B 1V97A 2GGHA 3F8PA 2JB3A 2EQ9A 3T14A 2WDQA 4H4VA 3AE5A 3CTYA 3LXDA 1EC9A 3M12A 3UTEA 3IC9A 4HCLA 2GEWA 2PSNA 1WYGA 3AE8A 3OPSA 1KNRA 1GRBA 5FMHA 2GMHA 4EQSA 1V59A 1PXBA 4UDRA 1X2HA 3IJQA 3LZWA 2PA6A 4J57A 2NQLA 3DIPA 5GSNA 3BHKA 4JHMA 1ZMDA 3EEZA 3VDGA 3NN6X 4U8OA 1GESA 4K5RA 1OJAA 3FYYA 2YVGA 1PHHA 3NK1X 1DXLA 1PDYA 3AE4A 1DJQA 3SQPA 3ZDNA 1Q1WA 4I58A 3QJ4A 2OO6A 5J60A 3DK4A 3CNSA 2GGGA 3ISHA 4CY6A 2Z5XA 3QSEA 4CCRA 1FEBA 4ENLA 1KNPA 2GGJA 2OPJA 1NU5A 1QJDA 4H4PA 3ZVIA 5CQFA 4CCQA 1B5QA 2ZC8A 1DOCA 1H7WA 5HHFA 3AEBA 3PG6A 1PDHA 2W55A 2C64A 3D8XA 3BSMA 4B69A 4MJWA 3NN0X 3R10A 3RNMA 2OZ8A 3D1CA 3DJEA 3ETRB 3GRSA 5FS9A 4X2PA 4CY8A 3HRDC 4LIIA 1MUCA 3GD6A 1N4VA 1TYTA 1BQGA 4A35A 4A3RA 5C2TA 2POZA 2BYBA 1TDFA 3M13A 2OVLA 1FECA 3NVVB 1VDVA 4EIPA 3I6TA 5G5GB 3N4EA 2WDRA 2ONEA 1PBDA 3NNEA 1WUFA 1K0IA 5KVIA 2YG7A 3JW7A 4BURA 5FJTA 2OLNA 3JVAA 1PBBA 4TM0A 2W0HA 1CC6A 1DODA 3DK9A 2YLXA 1JEHA 2IVDA 3BI2A 2C65A 4A6NA 2DW6A 2OAMA 5JCMA 1JPDX 2YG6A 3A7AA 4H2RA 4IHCA 2PODA 2VQBA 4OPUA 1HYUA 2JAEA 4C74A 1P48A 1F8RA 4JN9A 2PYXA 5CKUA 5IQ1A 1VRQB 3AE2A 3AEAA 1COYA 3VRAA 3AE3A 4U2LA 3DDMA 1YQ4A 1F8SA 4OPCA 3UOYA 2A89A 4RSLA 3AECA 2V60A 3WE0A 1T3QC 3MY9A 3NVYB 3P3BA 4K8DA 2ZZBA 2X8HA 2FBWA 4EMWA 1MO9A 3UJ2A 1H83A 4H4UA 2P8CA 2CVJA 2QQ6A 2YR4A 4YSZA 3ALJA 3RP6A 4C3YA 3UKHA 2GR2A 2PS2A 4RG4A 4HN8A 1TZZA 4YXDA 3CB3A 4JNQA 5BULA 3AEFA 2MNRA 3RR1A 4C77A 1O94A 3UCLA 1TDKA 2XVFA 5JRBA 2XLUA 4CRTA 3KVEA 5M0ZA 2OQHA 2AKMA 1Q1RA 4JY2A 3RHAA 3P4SA 2AL2A 4IP5A 3GO2A 4GRTA 1ZDLA 3KD9A 1H2IA 3KKJA 3VCCA 3VR9A 3UKPA 2WQYA 3T31A 2EQ8A 2C4CA 4O5QA 2GMJA 2UZZA 4HB9A 3SXIA 1GRHA 5KOXA 5KRQA 3D46A 4DSHA 4LU6A 2DKHA 5EBKA 3NVZB 3STPA 4NNJA 3UP4A 3VR8A 2X99A 3NVWB 1XHCA 1N4WA 3NRNA 3P0WA 3OP2A 4EM4A 1DTNA 4A5LA 3I4KA 3TWAA 1SJCA 1NHPA 3PS9A 4IV9A 2ACZA 1Y56B 3P4PA 4USQA 4B1BA 3KU9A 1B37A 2APGA 2PTZA 4YSYA 1XDIA 2E1MA 1QO8A 3NKSA 3F8DA 3SZWA 3BI4A 3NTAA 2CDUA 2GQFA 3FVDA 2B76A 2RABA 4DN1A 4BV6A 2XSXA 5HYMA 3S47A 4FX9A 3TCSA 1OJTA 1GOSA 1M64A 4U8PA 3ITJA 1LQTA 1JOAA 4EMJA 4H4ZA 3CGDA 1ELIA 2Z5YA 1TDOA 3II4A 1S2QA 5KXJA 7ENLA 3AE7A 4YKFA 3GMCA 5FJOA 4J34A 3GMBA 1KSSA 4ZCDA 4AOSA 1ZY8A 1KDGA 4U8NA 1CC4A 4E0VA 2QCUA 2OZ3A 1OEPA 3AE1A 2VVLG 3R0UA 5KMPA 3LB8A 4J36A 1EL8A 4HCDA 3I3LA 3CK5A 4YSHA 3PVCA 2BC0A 1D7LA 4YTNA 3QPEA 3CGCA 1IJHA 3UTFA 4TVWA 3V5FA 4E4UA 2E4GA 4YTPA 3M0OA 1XPYA 3HZLA 4GMEA 3GY1A 4CNKA 2FYMA 2YVJA 2YLZA 4C3XA 3N6HA 2OZTA 4H7UA 4UDQA 3U9IA 3GC2A 4H4SA 4IT1A 1N1PA 4XWZA 3V3OA 4DGKA 4P9SA 1L0VA 4K8GA 4TVYA 1MDLA 3H7VA 4NTEA 5EB5A 2OA1A 2GF3A 2Q7VA 2XH2A 2AR8A 2QJJA 2PGWA 3QVPA 2P3ZA 5BVAA 2GR0A 4IA6A 1ZP0A 5FS7A 1N4UA 3ZYXA 2YAUA 4A65A 4GAPA 3N6JA 2FJDA 3VCNA 1YKJA 3TW9A 3H12A 4H19A 2QDEA 2QA2A 3SBFA 1MNSA 1L9EA 4B66A 4IL0A 3T4WA 3EPTA 3QFBA 1IUXA 4J1OA 3IJLA 3UJSA 4YTMA 4OPLA 4I59A 3BJSA 4FDCB 3PK7A 1YQ3A 4AP3A 1KF6A 1FEAA 2XH7A 1BKWA 2GR1A 4GF7A 3T37A 3E1TA 3UJEA 2YG5A 1FHUA 2BS3A 2B7SA 4G73A 4IA5A 3HYXA 3IJIA 4IL2A 1H84A 4WX1A 4YKGA 1VQWA 3CPHG 1OJCA 1GV4A 3NXLA 2XH0A 2BA9A 4G6GA 3ICTA 4OPIA 2OKTA 2C72A 4J33A 3B3RA 2YM1A 2WU5A 2XGZA 1LJ1A 4KWSA 3SN1A 5KMQA 3VC5A 4YWOA 2WOIA 4ZA0A 2P88A 1CC2A 2XVHA 2GH5A 1PN0A 1JPMA 1IUSA 2BS4A 2HNEA 4Z17A 3TWBA 4HNLA 2QGYA 3I6EA 5FJRA 5G5HB 4AP1A 1EL7A 1DNCA 1VG0A 5IQ4A 3T9PA 5U63A 1B4VA 4GCMA 3SFEA 1S3EA 2BACA 4G9KA 4NZHA 3UOVA 1D4EA 1ZMCA 4E8GA 4Z1YA 3RITA 4ZCCA 3CGBA 4Y4MA 2PU0A 3PFRA 2JBVA 4HCHA 3HPFA 3SZFA 2GAGB 1IUWA 1P2HA 3R1ZA 4Y4LA 3NFUA 1SEZA 3R9UA 4AOXA 5BRTA 3SQSA 4FK1C 4HA6A 3TJIA 5J7XA 2R46A 2WS3A 3K1GA 4GFIA 3DH9A 2WOWA 2DKIA 2WPEA 3AYJA 2C7GA 2YLWA 2RGJA 5FS8A 1CJCA 2VVLA 1M6IA 2RGOA 3FXGA 4B64A 4OPDA 3NT6A 3ICRA 3ZLGA 1BGJA 2JKCA 2GRTA 3NZGA 3V4BA 4M6UA 1SJDA 4FI4A 5EOWA 5M10A 2R4EA 3DK8A 3UKFA 3CPIG 3NGCX 3TTEA 1TRBA 3DMEA 2VVMA 2XLSA 3AE9A 2BK4A 3CNJA 3VRDB 1KN0A 2B9WA 1NELA 3DJJA 4NEVA 3NK2X 1EL9A 4H2PA 1LV0A 3UKQA 4EMIA 4ZCWA 4TM3A 5DBJA 3U4FA 5BOEA 3I6DA 3UKLA 4KX6A 1VDCA 3ALMA 1BF3A 4ADWA 3K7MX 3CNTA 2B9XA 3DGBA 4TLZA 1YEYA 1PJ6A 1KCZA 3DJDA 2QVHA 3AEEA 4U8JA 2W3SA 4H4XA 1PXCA 1TYPA 5ENLA 3GD3A 3H4KA 2XFOA 1GRFA 4B68A 2ZBWA 4GGBA 3KPKA 3GDNA 5EU9A 4H2HA 4IP4A 3V3WA 1ZXIC 1YQZA 4J3ZA 4APNA 3G5SA 1NENA 1OJDA 4MMWA 2VRLA 4BK3A 1PXAA 4D04A 4WCTA 2OFJA 2GVCA 1E1LA 2JB1A 3GDPA 1Y56A 2XVIA 3P9UA 5HXIA 4Z2RA 4OPTA 1Y0PA 3UXKA 3FBSA 3Q6JA 1VG9A 1PBCA 5FJUA 3SJNA 2P0IA 4G6HA 1EC7A 3G5QA 1D5TA 3ES7A 1GRTA 3ATQA 4H2QA 4JN8A 4OPGA 3T8QA 1CL0A 4YSXA 2XYOA 3C4NA 4DWDA 4PAAA 4TLXA 3SN0A 1NPXA 3ENLA 2NPXA 4FK1A 2XCGA 4TM4A 2WU2A 1NHQA 3PWGA 2PTWA 2X8GA 3H8LA 4KT2A 4HNCA 3P4RA 3S5WA 3BHFA 3CXBA 2OX4A 3DGHA 1IUUA 3DEQA 3F8RA 5IDZA 2A8XA 3ZLHA 4AT2A 3IHGA 2R4JA 5FS6A 3JZUA 1L9CA 2YVFA 4ROPA 4U8LA 4GUVA 4NTCA 5U1OA 1IUVA 3CT2A 3S5SA 4DX3A 2E3TA 3A7RA 3T0KA 4H83A 3GD4A 1D4CA 1D4DA 3JSKA 3NRZB 4DNAA 1R0MA 1VQZA 3UJFA 1BKHA 3OZYA 1GXFA 4ZN0A 1TDNA 1E7PA 1OJ9A 1Q9IA 3QLDA 1H6VA 5J04A 4B65A 1WUEA 3MWCA 5KWFA 3CPJG 5KMRA 3DG3A 3NIXA 1FHVA 5ER0A 4N9XA 3P4QA 4GGHA 3QTPA 3CXOA 2VZ2A 4Z43A 1RSGA 4LA1A 1F8WA 4G74A 3QN3A 1PDZA 4FP1A 2X8CA 3AD7B 3GYXA 1TE6A 5EB4A 1MOKA 1FO4A 3BNMA 2C3CA 5TR3A 4Z44A 2YQUA 4GDEA 3URHA 4K1WA 1PBEA 1GEUA 2AKZA 3H8AA 1KD0A 5KVHA 3HYWA 4DYEA 3NO1A 1IYXA 3QKEA 2GB0A 3NH3X 3RCYA 2V5ZA 2HQMA 5LV9A 5FJPA 4K2XA 3AEDA 1PJ7A 3UCDA 3GSIA 4F4RA 3ZVHB 2WBAA 2PMQA 1BWCA 2OLAA 4Z2TA 3LZXA 3T6CA 5IPYA 3AXBA 1GETA 1TKKA 3UOXA 4E6MA 3IWAA 2YLSA 4UDPA 3NTDA 3NHOX 1F9CA 1SB3B 5HY5A 1PBFA 3KA7A 4D03A 2YLTA 1XPQA 1K0LA 2XFQA 3REDA 3P1WA 1QLBA 2V61A 2XVJA 1DOBA 1E1KA 4A99A 3SZ0A 3ICSA 3UOZA 3OTRA 2GGEA 4U2SA 3BOXA 3LADA 2HZGA 3B9JB 1LVLA 2XLPA 1D7YA 1GTHA 3SYIA 2E5AA 2O56A 4U8MA 1KFYA 4USRA 3GRTA 1FOHA 1NHRA 2DW7A 1MXTA 3ZLFA 3G5RA 1MRAA 3T2KA 5KMSA 2W54A 3GYJA 4H4YA 3AYIA 3LOVA 2OG9A 3V3NA 3DERA 1FCDA 3T2ZA 2XFUA 1DOEA 1EBHA 2MUCA 2WP6A 2JB2A 4IVMB 2AAQA 4IZGA 2R9ZA 2BRAA 3DJGX 4ICYA 3EKGA 4EIQA 3DG7A 3FJ4A 2GAHB 2IIDA 2XDOA 3GWDA 3SGLA 2NVKX 1N61C 3N4FA 3VC6A 2WETA 4A6GA 1CBOA 3FMWA 3K7TA 3C4AA 3DGZA 5C3JA 3C96A 3CIRA 3FCPA 3FV9A 2BRYA 4II3A 1X31B 2BABA 1ZOYA 4U8KA 3VRBA 3BI5A 3AYLA 3OZ2A 2C66A 2I0ZA 3H8IA 4H4RA 3AWIA 1GPEA 4JY3A 1CJ3A 2Q6UA 3P93A 2R45A 1E9IA 1JRPA 2R0PA 2C70A 3QFAA 4OCGA 1H82A 4C5OA 3UTHA 1LTXR 3IF9A 2V3BA 2Q0LA 1NHSA 2QDDA 2GV8A 1JDFA 3DFHA 5BUKA 1TDEA 2JK6A 2QJMA 4J56A 4X9MA 1SJBA 4G7FA 2F5ZA 4U2TA 1H81A 3K7QX 3EUB3 3TQPA 4IVOB 3ABVA 1SJAA 1REOA 2RDXA 1JROA 3CGEA 1GSNA 3DESA 3SFDA 4B67A 3R0KA 3SY4A 1S7MA 2BCGG 2XLRA 2AQJA 3K30A 1K0JA 4CBQA 1K4QA 1KKRA 2CULA 1N5XA 2GQWA 4EQWA 4E5TA 3CNDA 4K22A 2BCPA 2GSHA 3UGVA 2WP9A 2C73A 5BOFA 2AL1A 4GAVA 2R0CA 2EQ7A 3NYFA 3UXLA 2Y6QA 1GNDA 2PP0A 1FFUC 4JN7A 1UKVG 4DSGA 2P8BA 2ZADA 2C75A 3TOYA 4REKA 4II2A 2FJAA 2VRMA 2W3RA 3KUMA 2C3DA 2WOVA 3LJPA 3NG7X 1DJNA 4J31A 3R07C 4K5SA 1KSUA 2OQYA 3UKKA 2RGHA 4EWJA 1E6EA 1GERA 1ZOVA 1ZX9A 4BK1A 1EC8A 1W4XA 2TMDA 1ECQA 4U8IA 1GREA 3CN8A 4K2SA 2PU1A 4H1ZA 2YR5A 4HPNA 1BGNA 4K7ZA 1JRZA 2E5VA 2BK3A 4GYPC 2PHHA 1AOGA 3MUCA 4EM3A 3SR6B 3SZCA 3L8KA 2PCEA 3H70A 3MKCA 1ZKQA 2BXRA 4ECHA 3EF6A 1LQUA 2VOUA 3FIMB 4YWSA 1EBGA 3THUA 2WPFA 5U25A 1FL2A 1GRAA 1GTEA 4KPRA 1RYIA 3V76A 3AN1A 3QSMA 4E4FA 3NLCA 4J2WA 3HW2A 1EBDA 2ARDA 2WEUA 2BK5A 1P2EA 1MDRA 2OALA 3NS1B 1NG3A 2QJNA 2WP5A 6ENLA 2HXUA 4KEMA 2J3NA 1STZA 3Q45A 2O9ZA 1JNRA 2X3NA 2YG4A 4M52A 3HYVA 3NYCA 1NAAA 4PABA 3CNPA 1EL5A 3SX6A 4H2NA 2GL5A 4Z24A 4Z25A 4RG3A 2YG3A 4B63A 3VFCA 2XLTA 3BNUA 1LPFA 1JU2A 4A6NB 3GYIA 4A9WA 4Y4NA 3AD8B 1P43A 2PPGA 4X4JA 2YM2A 3UP5A 1W6TA 3EANA 2B7RA 3DA1A 2R0GA 2WDVA 2XH4A 3AD9B 3IK4A 1ELSA 1O95A 1X2GA 2EQ6A 3SM8A 3ZVHA 3R11A 2Q0KA 5L46A 2V6OA 1YY5A 4H50A 1JRXA 3TJ4A 4EQRA 3D9XA 3OZMA 3FPZA 1GT8A 1GALA 2ZZ0A 1CJ4A 3UTGA 2B9YA 2Y6RA 3NK0X 4NWZA 2CHRA 5JCLA 5JCIA 4JDRA 4XWRA 1PJ5A 3UCCA 3OC4A 1H86A 1N5WC 3L1RA 1IUTA 1E1MA 3OW1A
chains in the Genus database with same CATH topology
3B6DA 1D7YA 3DH9A 4GR1A 1GTHA 1YQ4A 3SYIA 1F8SA 2FJBA 4OPCA 2TPRA 2WOWA 4U8MA 2WHDA 3UOYA 3ALLA 5JCNA 2A89A 2DKIA 2WPEA 1KFYA 4USRA 3AYJA 3GRTA 1FOHA 1PS9A 4RSLA 4Z2UA 2XFPA 1NHRA 3AECA 3VQRA 2V60A 3WE0A 2C7GA 1MXTA 2YLWA 1ONFA 2RGJA 5FS8A 3G5RA 4K8DA 1CJCA 3T2KA 2ZZBA 2X8HA 1M6IA 2FBWA 1O5WA 4EMWA 1MO9A 2RGOA 2VVLA 3GYJA 4OPDA 4B64A 4BJZA 1H83A 4H4UA 4H4YA 3ICRA 1BGJA 3AYIA 2XFNA 2JKCA 1H7XA 2GRTA 2WPCA 3LOVA 2CVJA 3V3NA 4Z26A 2YR6A 5EOWA 5M10A 3FG2P 3DK8A 2R4EA 4NTDA 3UKFA 1FCDA 2YR4A 4YSZA 3ALJA 3RP6A 4C3YA 1BZLA 3T2ZA 3UKHA 3CPIG 3NGCX 2H89A 2XFUA 1TRBA 4BJYA 1DOEA 2GR2A 4RG4A 4YXDA 3DMEA 2VVMA 2XLSA 2WP6A 1E1NA 4JNQA 2JB2A 4IVMB 3AE9A 2AAQA 4JNAA 5BULA 2BK4A 2R9ZA 4H4TA 3AEFA 3CNJA 1CF3A 2BRAA 4GDPA 3VRDB 3DJGX 4ICYA 4C77A 3QSSA 1JRYA 1O94A 1KN0A 1L9DA 1TDKA 2XVFA 3UCLA 4EIQA 2B9WA 3DJJA 5JRBA 2XLUA 2GAHB 4CRTA 3KVEA 4NEVA 2IIDA 5M0ZA 5GRTA 3NYEA 2XDOA 1Q1RA 3QVRA 1NEKA 4JY2A 3NK2X 3GWDA 3SGLA 3RHAA 3P4SA 2NVKX 1EL9A 4H2PA 1CHUA 1LV0A 3UKQA 4EMIA 5DBJA 4TM3A 4GRTA 1ZDLA 2WETA 3KD9A 5KOWA 1H2IA 3KKJA 1CBOA 3FMWA 3PO7A 3IHMA 3K7TA 2C67A 3VR9A 3C4AA 3DGZA 1S2YA 2WQYA 3UKPA 3T31A 3I6DA 5C3JA 2EQ8A 3C96A 3UKLA 3CIRA 2A87A 4KX6A 1VDCA 3KPFA 2BRYA 4II3A 3ALMA 2H88A 1BF3A 1X31B 2BABA 1ZOYA 2C4CA 4O5QA 4U8KA 4ADWA 3K7MX 2GMJA 3VRBA 1ZK7A 2UZZA 3CNTA 4HB9A 1GRHA 3BI5A 2B9XA 3AYLA 3OZ2A 3RP8A 4TLZA 4LU6A 3SXIA 4DSHA 5KRQA 2DKHA 5EBKA 1PJ6A 1RP0A 2C66A 4NNJA 3UP4A 2I0ZA 3VR8A 3H8IA 2WESA 3AB1A 3DJDA 2X99A 1B8SA 4H4RA 4OVIA 1GRGA 2BC1A 3CMMA 3UKAA 3AEEA 4U8JA 1XHCA 3AWIA 1GPEA 2FJEA 5KOXA 4JY3A 4H4XA 1CJ3A 1N4WA 3NRNA 4TM1A 2Q6UA 3AE6A 5JCKA 2R45A 1PXCA 2OLOA 4BK2A 4EM4A 1F6MA 4X9NA 1TYPA 2R0PA 2YWLA 2VQ7A 2C70A 3QFAA 2CFYA 4OCGA 4A5LA 3GD3A 3H4KA 2XFOA 3ATRA 1GRFA 4B68A 1NHPA 1H82A 3PS9A 2ZBWA 4IV9A 2ACZA 1Y56B 3KPKA 3GDNA 3P4PA 4USQA 4A7AA 4C5OA 4CNJA 2BS2A 3UTHA 4H4QA 1LTXR 4B1BA 3IF9A 1F3PA 5IPYA 3KU9A 1B37A 2X50A 1YQZA 2APGA 4YT0A 2V3BA 4APNA 3G5SA 1XDIA 1NENA 2E1MA 4YSYA 3COXA 1OJDA 2VRLA 4BK3A 1QO8A 1PXAA 4D04A 3NKSA 4EQXA 2Q0LA 3F8DA 4WCTA 3SZWA 3S61A 3BI4A 1NG4A 2CDUA 1NHSA 3NTAA 2GQFA 2GVCA 2B76A 1E1LA 2RABA 2ZZCA 2JB1A 3GDPA 2GV8A 4BV6A 1Y56A 2XVIA 5HYMA 3P9UA 4FX9A 5HXIA 1OJTA 2QAEA 5BUKA 4Z2RA 1GOSA 1M64A 1TDEA 2JK6A 4OPTA 1Y0PA 4J56A 4X9MA 2C76A 4U8PA 3FBSA 3ITJA 3Q6JA 1LQTA 1VG9A 1JOAA 4EMJA 5KNLA 1PBCA 2F5ZA 4U2TA 4H4ZA 3CGDA 1H81A 3K7QX 1ELIA 2Z5YA 1TDOA 4G6HA 4IVOB 3ABVA 4UP3A 4XXGA 3G5QA 1D5TA 3II4A 1S2QA 5KXJA 1REOA 3L5OA 3AE7A 1GRTA 3ATQA 4H2QA 4YKFA 3GMCA 4OPGA 4J34A 3GWFA 3CGEA 3GMBA 1GSNA 3SFDA 1S3BA 4B67A 1KSSA 4ZCDA 3ADAB 1ZY8A 4AOSA 1CL0A 1XANA 3SY4A 1KDGA 2QA1A 4U8NA 1S7MA 4H4WA 2BCGG 4YSXA 1CC4A 1E39A 2XLRA 2XYOA 3AEGA 3C4NA 2AQJA 3K30A 4PAAA 4TLXA 1K0JA 4E0VA 4CBQA 1NPXA 1K4QA 3Q9TA 3T2YA 2QCUA 2NPXA 2V3AA 2YLRA 4FK1A 1NDAA 4NEWA 2XCGA 4JQ9A 3AE1A 2VVLG 3KLJA 4TM4A 2WU2A 1NHQA 2CULA 5KMPA 1CJ2A 4O5UA 3LB8A 4J36A 3RP7A 1EL8A 3I3LA 2GQWA 4YSHA 4EQWA 3PVCA 2BC0A 2IVEA 3CNDA 2X8GA 1D7LA 2BXSA 4K22A 2GR3A 2BCPA 3EAOA 4YTNA 2WP9A 3CGCA 1IJHA 3UTFA 3H8LA 4YTPA 2E4GA 3P4RA 3M0OA 2C73A 2XVEA 3S5WA 1JNZA 4GAVA 2R0CA 3HZLA 3BHFA 4AT0A 1Z6LA 4CNKA 2YVJA 3DGHA 2EQ7A 3O0HA 1IUUA 2YLZA 4C3XA 3NYFA 4H7UA 3F8RA 4UDQA 3F8PA 5KMSA 2JB3A 2Y6QA 2EQ9A 1GNDA 2A8XA 3T14A 4H4SA 2WDQA 4H4VA 4XWZA 1N1PA 3V3OA 4DGKA 4P9SA 1UKVG 1L0VA 3AE5A 3CTYA 3LXDA 4AT2A 4DSGA 4NTEA 2C75A 5EB5A 2OA1A 3IHGA 3M12A 3UTEA 2GF3A 4REKA 4II2A 3IC9A 2FJAA 2Q7VA 2VRMA 2AR8A 2R4JA 5FS6A 2GEWA 2C3DA 2WOVA 3LJPA 3AE8A 1L9CA 3QVPA 5BVAA 2YVFA 2GR0A 4IA6A 3NG7X 1DJNA 4J31A 1KNRA 4K5SA 1ZP0A 1GRBA 5FS7A 4U8LA 1N4UA 1KSUA 3ZYXA 5FMHA 2YAUA 4GUVA 2GMHA 3UKKA 2RGHA 4A65A 4EQSA 1E6EA 4GAPA 1V59A 4NTCA 5U1OA 1PXBA 1GERA 2FJDA 4UDRA 1ZOVA 3LZWA 1IUVA 1ZX9A 1YKJA 4J57A 4BK1A 1W4XA 5GSNA 3BHKA 1ZMDA 2TMDA 4U8IA 3NN6X 4U8OA 1GESA 1GREA 3CN8A 4K5RA 1OJAA 2QA2A 1L9EA 2YVGA 1PHHA 3NK1X 3T0KA 1DXLA 2YR5A 4B66A 3GD4A 1BGNA 1D4CA 1D4DA 3AE4A 3JSKA 4K7ZA 4DNAA 1JRZA 3EPTA 2E5VA 3QFBA 1DJQA 1IUXA 2BK3A 2PHHA 3SQPA 1AOGA 4EM3A 3ZDNA 1Q1WA 4I58A 4YTMA 4OPLA 3QJ4A 3SZCA 5J60A 3DK4A 3L8KA 4I59A 1GXFA 4FDCB 3CNSA 4ZN0A 1YQ3A 4AP3A 1TDNA 1KF6A 1FEAA 1E7PA 1OJ9A 3ISHA 4CY6A 2Z5XA 3QSEA 4CCRA 1BKWA 2GR1A 4GF7A 1FEBA 3T37A 1Q9IA 1H6VA 3E1TA 4B65A 1ZKQA 2BXRA 4ECHA 5KWFA 1KNPA 2YG5A 2BS3A 3EF6A 1LQUA 2B7SA 2VOUA 3FIMB 4G73A 1QJDA 3CPJG 4IA5A 4H4PA 5KMRA 3NIXA 3HYXA 5CQFA 4CCQA 1H84A 2WPFA 4WX1A 5ER0A 5U25A 1B5QA 4N9XA 4YKGA 1FL2A 1DOCA 1GRAA 1H7WA 5HHFA 3AEBA 1VQWA 3P4QA 1GTEA 3CPHG 1OJCA 1GV4A 4KPRA 1RYIA 3PG6A 1PDHA 3V76A 3QSMA 2C64A 2BA9A 2VZ2A 3NLCA 3D8XA 4J2WA 4Z43A 4B69A 1EBDA 2ARDA 4MJWA 1RSGA 4LA1A 4G6GA 3ICTA 3NN0X 4OPIA 2WEUA 2C72A 4J33A 1F8WA 4G74A 3NT6A 4Z2TA 3RNMA 3B3RA 2YM1A 2WU5A 2BK5A 3D1CA 3DJEA 1P2EA 1LJ1A 2X8CA 2OALA 3GRSA 5FS9A 3AD7B 3GYXA 5KMQA 1NG3A 2WP5A 5EB4A 4CY8A 1MOKA 2J3NA 4LIIA 2C3CA 5TR3A 3BNMA 4Z44A 2YQUA 4GDEA 2O9ZA 4YWOA 3URHA 2WOIA 1JNRA 1PBEA 1N4VA 1TYTA 1GEUA 1CC2A 2X3NA 2YG4A 4M52A 3HYVA 2XVHA 5KVHA 2GH5A 3HYWA 3NYCA 5C2TA 1PN0A 1NAAA 1IUSA 2GB0A 3NH3X 2BYBA 1TDFA 3CNPA 3M13A 4PABA 2V5ZA 2HQMA 2BS4A 1EL5A 3SX6A 1FECA 4EIPA 5LV9A 4K2XA 3AEDA 4H2NA 4Z24A 4Z25A 4RG3A 2YG3A 4B63A 2WDRA 1PJ7A 2XLTA 3BNUA 1LPFA 1JU2A 4A6NB 3GYIA 4A9WA 1PBDA 3NNEA 1EL7A 4AP1A 1DNCA 3GSIA 1VG0A 5IQ4A 1K0IA 5U63A 5KVIA 1B4VA 2WBAA 4Y4NA 2YG7A 4GCMA 4BURA 3SFEA 3AD8B 1BWCA 2OLNA 1PBBA 4TM0A 4X4JA 3LZXA 1S3EA 2W0HA 1CC6A 1DODA 2BACA 2B7RA 3EANA 2YM2A 4G9KA 4NZHA 1D4EA 3AXBA 1GETA 1ZMCA 3UOVA 3DK9A 2R0GA 3DA1A 2YLXA 4A79A 1JEHA 2WDVA 2IVDA 3UOXA 3BI2A 3AD9B 3IWAA 2YLSA 1O95A 2C65A 4ZCCA 4A6NA 2EQ6A 3CGBA 4Y4MA 3SM8A 2OAMA 4UDPA 2Q0KA 3NTDA 3NHOX 5L46A 2V6OA 5JCMA 1YY5A 3UP5A 5HY5A 2JBVA 4H50A 2YG6A 1JRXA 1PBFA 3KA7A 4D03A 2YLTA 4H2RA 1XPQA 3SZFA 4EQRA 3D9XA 1K0LA 2XFQA 2GAGB 1IUWA 3REDA 2VQBA 3FPZA 1P2HA 3P1WA 1QLBA 1GT8A 1GALA 2ZZ0A 1HYUA 4OPUA 2V61A 1CJ4A 2JAEA 2XVJA 1DOBA 3UTGA 4Y4LA 1E1KA 4A99A 4C74A 2B9YA 2Y6RA 3NK0X 4NWZA 1SEZA 3R9UA 3SZ0A 5JCLA 3ICSA 4AOXA 3UOZA 5BRTA 1F8RA 5JCIA 2PYXA 4FK1C 4HA6A 4JN9A 5CKUA 5IQ1A 4JDRA 1VRQB 1PJ5A 3AE2A 4U2SA 4XWRA 5J7XA 3OC4A 2R46A 3AEAA 1COYA 2WS3A 3VRAA 3LADA 3AE3A 1H86A 3L1RA 1IUTA 4U2LA 1E1MA 1LVLA 2XLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6D A;  1D7Y A;  3DH9 A;  4GR1 A;  1GTH A;  1YQ4 A;  1F8S A;  2FJB A;  4OPC A;  2TPR A;  2WOW A;  4U8M A;  2WHD A;  3UOY A;  3ALL A;  5JCN A;  2A89 A;  2DKI A;  2WPE A;  1KFY A;  4USR A;  3AYJ A;  3GRT A;  1FOH A;  1PS9 A;  4RSL A;  4Z2U A;  2XFP A;  1NHR A;  3AEC A;  3VQR A;  2V60 A;  3WE0 A;  2C7G A;  1MXT A;  2YLW A;  1ONF A;  2RGJ A;  5FS8 A;  3G5R A;  4K8D A;  1CJC A;  2ZZB A;  2X8H A;  1M6I A;  2FBW A;  1O5W A;  4EMW A;  1MO9 A;  2RGO A;  2VVL A;  3GYJ A;  4OPD A;  4B64 A;  4BJZ A;  1H83 A;  4H4U A;  4H4Y A;  3ICR A;  1BGJ A;  3AYI A;  2XFN A;  2JKC A;  1H7X A;  2GRT A;  2WPC A;  3LOV A;  2CVJ A;  3V3N A;  4Z26 A;  2YR6 A;  5EOW A;  5M10 A;  3FG2 P;  3DK8 A;  2R4E A;  4NTD A;  3UKF A;  1FCD A;  2YR4 A;  4YSZ A;  3ALJ A;  3RP6 A;  4C3Y A;  1BZL A;  3UKH A;  3CPI G;  3NGC X;  2H89 A;  2XFU A;  1TRB A;  4BJY A;  1DOE A;  2GR2 A;  4RG4 A;  4YXD A;  3DME A;  2VVM A;  2XLS A;  2WP6 A;  1E1N A;  4JNQ A;  2JB2 A;  4IVM B;  3AE9 A;  2AAQ A;  4JNA A;  5BUL A;  2BK4 A;  2R9Z A;  4H4T A;  3AEF A;  3CNJ A;  1CF3 A;  4GDP A;  3VRD B;  3DJG X;  4ICY A;  4C77 A;  3QSS A;  1JRY A;  1O94 A;  1L9D A;  1TDK A;  3UCL A;  2XVF A;  4EIQ A;  2B9W A;  3DJJ A;  2XLU A;  4CRT A;  2GAH B;  3KVE A;  4NEV A;  2IID A;  5M0Z A;  5GRT A;  3NYE A;  2XDO A;  1Q1R A;  3QVR A;  1NEK A;  4JY2 A;  3NK2 X;  3GWD A;  3SGL A;  3RHA A;  3P4S A;  2NVK X;  1EL9 A;  4H2P A;  1CHU A;  1LV0 A;  3UKQ A;  4EMI A;  5DBJ A;  4TM3 A;  4GRT A;  1ZDL A;  2WET A;  3KD9 A;  5KOW A;  3KKJ A;  1CBO A;  3FMW A;  3PO7 A;  3IHM A;  3K7T A;  2C67 A;  3VR9 A;  3C4A A;  3DGZ A;  1S2Y A;  2WQY A;  3UKP A;  5C3J A;  3I6D A;  2EQ8 A;  3C96 A;  3UKL A;  3CIR A;  2A87 A;  4KX6 A;  1VDC A;  3KPF A;  3ALM A;  2H88 A;  1BF3 A;  1X31 B;  2BAB A;  1ZOY A;  4O5Q A;  4U8K A;  4ADW A;  3K7M X;  2GMJ A;  3VRB A;  1ZK7 A;  2UZZ A;  3CNT A;  4HB9 A;  1GRH A;  3BI5 A;  2B9X A;  3AYL A;  3OZ2 A;  3RP8 A;  4TLZ A;  4LU6 A;  4DSH A;  5KRQ A;  2DKH A;  5EBK A;  1PJ6 A;  1RP0 A;  2C66 A;  3UP4 A;  2I0Z A;  3VR8 A;  3H8I A;  2WES A;  3AB1 A;  3DJD A;  2X99 A;  1B8S A;  4H4R A;  4OVI A;  1GRG A;  2BC1 A;  3UKA A;  3AEE A;  4U8J A;  1XHC A;  3AWI A;  1GPE A;  2FJE A;  5KOX A;  4JY3 A;  4H4X A;  1CJ3 A;  1N4W A;  3NRN A;  4TM1 A;  2Q6U A;  3AE6 A;  5JCK A;  2R45 A;  1PXC A;  2OLO A;  4BK2 A;  4EM4 A;  1F6M A;  4X9N A;  1TYP A;  2R0P A;  2YWL A;  2VQ7 A;  2C70 A;  3QFA A;  2CFY A;  4OCG A;  4A5L A;  3GD3 A;  3H4K A;  2XFO A;  3ATR A;  1GRF A;  4B68 A;  1NHP A;  1H82 A;  3PS9 A;  2ZBW A;  4IV9 A;  2ACZ A;  1Y56 B;  3GDN A;  3P4P A;  4USQ A;  4A7A A;  4C5O A;  4CNJ A;  2BS2 A;  3UTH A;  4H4Q A;  1LTX R;  4B1B A;  3IF9 A;  1F3P A;  5IPY A;  3KU9 A;  1B37 A;  2X50 A;  1YQZ A;  2APG A;  4YT0 A;  2V3B A;  4APN A;  3G5S A;  1XDI A;  1NEN A;  2E1M A;  4YSY A;  3COX A;  1OJD A;  2VRL A;  4BK3 A;  1QO8 A;  1PXA A;  4D04 A;  3NKS A;  4EQX A;  2Q0L A;  3F8D A;  4WCT A;  3S61 A;  3BI4 A;  1NG4 A;  2CDU A;  1NHS A;  3NTA A;  2GQF A;  2GVC A;  2B76 A;  1E1L A;  2RAB A;  2ZZC A;  2JB1 A;  3GDP A;  2GV8 A;  4BV6 A;  1Y56 A;  2XVI A;  5HYM A;  3P9U A;  4FX9 A;  5HXI A;  1OJT A;  2QAE A;  5BUK A;  4Z2R A;  1GOS A;  1M64 A;  1TDE A;  2JK6 A;  4OPT A;  1Y0P A;  4J56 A;  4X9M A;  2C76 A;  4U8P A;  3FBS A;  3ITJ A;  3Q6J A;  1LQT A;  1VG9 A;  1JOA A;  4EMJ A;  1PBC A;  2F5Z A;  4U2T A;  4H4Z A;  3CGD A;  1H81 A;  3K7Q X;  1ELI A;  2Z5Y A;  1TDO A;  4IVO B;  4UP3 A;  3ABV A;  4XXG A;  3G5Q A;  1D5T A;  3II4 A;  1S2Q A;  5KXJ A;  1REO A;  3AE7 A;  1GRT A;  3ATQ A;  4H2Q A;  4YKF A;  3GMC A;  4OPG A;  4J34 A;  3GWF A;  3CGE A;  3GMB A;  1GSN A;  3SFD A;  1S3B A;  4B67 A;  1KSS A;  4ZCD A;  3ADA B;  1ZY8 A;  4AOS A;  1CL0 A;  1XAN A;  1KDG A;  2QA1 A;  4U8N A;  2BCG G;  4H4W A;  4YSX A;  1CC4 A;  1E39 A;  2XLR A;  2XYO A;  3AEG A;  3C4N A;  2AQJ A;  3K30 A;  4PAA A;  4TLX A;  1K0J A;  4E0V A;  4CBQ A;  1NPX A;  1K4Q A;  3Q9T A;  2QCU A;  2NPX A;  2V3A A;  2YLR A;  4FK1 A;  1NDA A;  4NEW A;  2XCG A;  4JQ9 A;  3AE1 A;  2VVL G;  3KLJ A;  4TM4 A;  2WU2 A;  1NHQ A;  2CUL A;  1CJ2 A;  4O5U A;  3LB8 A;  4J36 A;  3RP7 A;  1EL8 A;  3I3L A;  2GQW A;  4YSH A;  4EQW A;  3PVC A;  2BC0 A;  2IVE A;  3CND A;  2X8G A;  1D7L A;  2BXS A;  4K22 A;  2GR3 A;  2BCP A;  3EAO A;  4YTN A;  2WP9 A;  3CGC A;  1IJH A;  3UTF A;  3H8L A;  4YTP A;  2E4G A;  3P4R A;  3M0O A;  2C73 A;  2XVE A;  3S5W A;  1JNZ A;  2R0C A;  3HZL A;  3BHF A;  4AT0 A;  1Z6L A;  4CNK A;  2YVJ A;  3DGH A;  2EQ7 A;  3O0H A;  1IUU A;  2YLZ A;  4C3X A;  3NYF A;  4H7U A;  3F8R A;  4UDQ A;  3F8P A;  2JB3 A;  2Y6Q A;  2EQ9 A;  1GND A;  2A8X A;  4H4S A;  2WDQ A;  4H4V A;  4XWZ A;  1N1P A;  3V3O A;  4DGK A;  4P9S A;  1UKV G;  1L0V A;  3AE5 A;  3CTY A;  3LXD A;  4AT2 A;  4DSG A;  4NTE A;  2C75 A;  5EB5 A;  2OA1 A;  3IHG A;  3M12 A;  3UTE A;  2GF3 A;  4REK A;  3IC9 A;  2FJA A;  2Q7V A;  2VRM A;  2AR8 A;  2R4J A;  5FS6 A;  2GEW A;  2C3D A;  2WOV A;  3LJP A;  3AE8 A;  1L9C A;  3QVP A;  5BVA A;  2YVF A;  2GR0 A;  4IA6 A;  3NG7 X;  1DJN A;  4J31 A;  1KNR A;  4K5S A;  1ZP0 A;  1GRB A;  5FS7 A;  4U8L A;  1N4U A;  1KSU A;  3ZYX A;  5FMH A;  2YAU A;  4GUV A;  2GMH A;  3UKK A;  2RGH A;  4A65 A;  4EQS A;  1E6E A;  1V59 A;  4NTC A;  5U1O A;  1PXB A;  1GER A;  2FJD A;  4UDR A;  1ZOV A;  3LZW A;  1IUV A;  1ZX9 A;  1YKJ A;  4J57 A;  4BK1 A;  1W4X A;  5GSN A;  3BHK A;  1ZMD A;  2TMD A;  4U8I A;  3NN6 X;  4U8O A;  1GES A;  1GRE A;  3CN8 A;  4K5R A;  1OJA A;  2QA2 A;  1L9E A;  2YVG A;  1PHH A;  3NK1 X;  1DXL A;  2YR5 A;  4B66 A;  3GD4 A;  1BGN A;  1D4C A;  1D4D A;  3AE4 A;  3JSK A;  4K7Z A;  4DNA A;  1JRZ A;  3EPT A;  2E5V A;  3QFB A;  1DJQ A;  1IUX A;  2BK3 A;  2PHH A;  3SQP A;  1AOG A;  4EM3 A;  3ZDN A;  1Q1W A;  4I58 A;  4YTM A;  4OPL A;  3QJ4 A;  5J60 A;  3DK4 A;  3L8K A;  4I59 A;  1GXF A;  4FDC B;  3CNS A;  4ZN0 A;  1YQ3 A;  4AP3 A;  1TDN A;  1KF6 A;  1FEA A;  1E7P A;  1OJ9 A;  3ISH A;  4CY6 A;  2Z5X A;  3QSE A;  4CCR A;  1BKW A;  2GR1 A;  4GF7 A;  1FEB A;  3T37 A;  1Q9I A;  1H6V A;  3E1T A;  4B65 A;  1ZKQ A;  2BXR A;  4ECH A;  5KWF A;  1KNP A;  2YG5 A;  2BS3 A;  3EF6 A;  1LQU A;  2B7S A;  2VOU A;  3FIM B;  1QJD A;  3CPJ G;  4IA5 A;  4H4P A;  3NIX A;  5CQF A;  4CCQ A;  1H84 A;  2WPF A;  4WX1 A;  5ER0 A;  5U25 A;  1B5Q A;  4N9X A;  4YKG A;  1FL2 A;  1DOC A;  1GRA A;  1H7W A;  5HHF A;  3AEB A;  1VQW A;  3P4Q A;  1GTE A;  3CPH G;  1OJC A;  1GV4 A;  4KPR A;  1RYI A;  1PDH A;  3V76 A;  3QSM A;  2C64 A;  2BA9 A;  2VZ2 A;  3NLC A;  3D8X A;  4J2W A;  4Z43 A;  4B69 A;  1EBD A;  2ARD A;  4MJW A;  1RSG A;  4LA1 A;  3ICT A;  3NN0 X;  4OPI A;  2WEU A;  2C72 A;  4J33 A;  1F8W A;  3NT6 A;  4Z2T A;  3RNM A;  3B3R A;  2YM1 A;  2WU5 A;  2BK5 A;  3D1C A;  3DJE A;  1P2E A;  1LJ1 A;  2X8C A;  2OAL A;  3GRS A;  5FS9 A;  3AD7 B;  1NG3 A;  2WP5 A;  5EB4 A;  4CY8 A;  1MOK A;  2J3N A;  4LII A;  2C3C A;  5TR3 A;  3BNM A;  4Z44 A;  2YQU A;  4GDE A;  2O9Z A;  4YWO A;  3URH A;  2WOI A;  1JNR A;  1PBE A;  1N4V A;  1TYT A;  1GEU A;  1CC2 A;  2X3N A;  2YG4 A;  4M52 A;  2XVH A;  5KVH A;  2GH5 A;  3NYC A;  5C2T A;  1PN0 A;  1NAA A;  1IUS A;  2GB0 A;  3NH3 X;  2BYB A;  1TDF A;  3CNP A;  3M13 A;  4PAB A;  2V5Z A;  2HQM A;  2BS4 A;  1EL5 A;  1FEC A;  4EIP A;  5LV9 A;  4K2X A;  3AED A;  4H2N A;  4Z24 A;  4Z25 A;  4RG3 A;  2YG3 A;  4B63 A;  2WDR A;  1PJ7 A;  2XLT A;  3BNU A;  1LPF A;  1JU2 A;  4A6N B;  3GYI A;  4A9W A;  1PBD A;  3NNE A;  1EL7 A;  4AP1 A;  1DNC A;  3GSI A;  1VG0 A;  5IQ4 A;  1K0I A;  5U63 A;  5KVI A;  1B4V A;  2WBA A;  4Y4N A;  2YG7 A;  4GCM A;  4BUR A;  3SFE A;  3AD8 B;  1BWC A;  2OLN A;  1PBB A;  4TM0 A;  4X4J A;  3LZX A;  1S3E A;  2W0H A;  1CC6 A;  1DOD A;  2BAC A;  2B7R A;  3EAN A;  2YM2 A;  4NZH A;  3UP5 A;  1D4E A;  3AXB A;  1GET A;  1ZMC A;  3UOV A;  3DK9 A;  2R0G A;  3DA1 A;  2YLX A;  4A79 A;  1JEH A;  2WDV A;  2IVD A;  3UOX A;  3BI2 A;  3AD9 B;  3IWA A;  2YLS A;  1O95 A;  2C65 A;  4ZCC A;  4A6N A;  2EQ6 A;  3CGB A;  4Y4M A;  3SM8 A;  2OAM A;  4UDP A;  2Q0K A;  3NTD A;  3NHO X;  5L46 A;  2V6O A;  5JCM A;  1YY5 A;  5HY5 A;  2JBV A;  4H50 A;  2YG6 A;  1JRX A;  1PBF A;  3KA7 A;  4D03 A;  2YLT A;  4H2R A;  1XPQ A;  4EQR A;  1K0L A;  2XFQ A;  2GAG B;  1IUW A;  3RED A;  2VQB A;  3FPZ A;  1P2H A;  3P1W A;  1QLB A;  1GT8 A;  1GAL A;  2ZZ0 A;  1HYU A;  4OPU A;  2V61 A;  1CJ4 A;  2JAE A;  2XVJ A;  1DOB A;  3UTG A;  4Y4L A;  1E1K A;  4A99 A;  4C74 A;  2B9Y A;  2Y6R A;  3NK0 X;  1SEZ A;  3R9U A;  5JCL A;  3ICS A;  4AOX A;  3UOZ A;  5BRT A;  1F8R A;  5JCI A;  2PYX A;  4FK1 C;  4HA6 A;  4JN9 A;  5CKU A;  5IQ1 A;  4JDR A;  1VRQ B;  1PJ5 A;  3AE2 A;  4U2S A;  4XWR A;  5J7X A;  3OC4 A;  2R46 A;  3AEA A;  1COY A;  2WS3 A;  3VRA A;  3LAD A;  3AE3 A;  1H86 A;  3L1R A;  1IUT A;  4U2L A;  1E1M A;  1LVL A;  2XLP A; 
#chains in the Genus database with same CATH topology
 3B6D A;  2PTY A;  4GR1 A;  3AM9 A;  2FJB A;  2TPR A;  2WHD A;  2PP1 A;  3ALL A;  5JCN A;  4XXG A;  1R6W A;  4Z2U A;  1PS9 A;  1XS2 A;  2XFP A;  3VQR A;  1KKO A;  4DHG A;  1ONF A;  4A79 A;  1O5W A;  4BJZ A;  2XFN A;  1H7X A;  2WPC A;  3R25 A;  4Z26 A;  2YR6 A;  4GYP A;  3D47 A;  3FG2 P;  1N63 C;  4NTD A;  1BZL A;  1RVK A;  1L8P A;  2GGI A;  2H89 A;  4BJY A;  2AL2 B;  1E1N A;  3MSY A;  4JNA A;  4H4T A;  3CYJ A;  2I5Q A;  1CF3 A;  4GDP A;  3CAW A;  3QSS A;  1JRY A;  1L9D A;  5GRT A;  3NYE A;  3QVR A;  1NEK A;  1CHU A;  3VA8 A;  5KOW A;  3PO7 A;  3IHM A;  2C67 A;  1S2Y A;  2A87 A;  3AMZ A;  3KPF A;  2H88 A;  2GDQ A;  1ZK7 A;  3RP8 A;  3DG6 A;  1RP0 A;  3V5C A;  2WES A;  3AB1 A;  1B8S A;  4OVI A;  1GRG A;  2BC1 A;  3CMM A;  3UKA A;  2FJE A;  4TM1 A;  3AE6 A;  5JCK A;  2OLO A;  4BK2 A;  1F6M A;  4X9N A;  3RO6 A;  2YWL A;  2VQ7 A;  1N60 C;  1JCT A;  2CFY A;  2FKP A;  4MGG A;  3ATR A;  3PWI A;  4GIR A;  4A7A A;  4CNJ A;  2BS2 A;  4H4Q A;  1F3P A;  3DFY A;  2X50 A;  4YT0 A;  4M0X A;  3COX A;  3A7U A;  4EQX A;  3S61 A;  1NG4 A;  3MZN A;  2ZZC A;  1FIQ B;  3SSZ A;  3RRA A;  2QAE A;  3B97 A;  2C76 A;  5KNL A;  2PP3 A;  3RGT A;  4G8T A;  4UP3 A;  2PTX A;  4HYR A;  3L5O A;  2HXT A;  2PGE A;  3GWF A;  1S3B A;  1ONE A;  3ES8 A;  3ADA B;  1XAN A;  2QA1 A;  4H4W A;  1E39 A;  3AEG A;  4MKS A;  4ZOH B;  3Q9T A;  3T2Y A;  1FFV C;  3Q4D A;  4GIS A;  2V3A A;  2YLR A;  1NDA A;  4NEW A;  3SN4 A;  3MQT A;  4JQ9 A;  3KLJ A;  3UJR A;  1CJ2 A;  4O5U A;  3RP7 A;  2IVE A;  2BXS A;  2GR3 A;  3EAO A;  1N62 C;  2XVE A;  1JNZ A;  4KPL A;  4DXK A;  4AT0 A;  1Z6L A;  3O0H A;  1RM6 B;  1V97 A;  2GGH A;  3F8P A;  2JB3 A;  2EQ9 A;  3T14 A;  2WDQ A;  4H4V A;  3AE5 A;  3CTY A;  3LXD A;  1EC9 A;  3M12 A;  3UTE A;  3IC9 A;  4HCL A;  2GEW A;  2PSN A;  1WYG A;  3AE8 A;  3OPS A;  1KNR A;  1GRB A;  5FMH A;  2GMH A;  4EQS A;  1V59 A;  1PXB A;  4UDR A;  1X2H A;  3IJQ A;  3LZW A;  2PA6 A;  4J57 A;  2NQL A;  3DIP A;  5GSN A;  3BHK A;  4JHM A;  1ZMD A;  3EEZ A;  3VDG A;  3NN6 X;  4U8O A;  1GES A;  4K5R A;  1OJA A;  3FYY A;  2YVG A;  1PHH A;  3NK1 X;  1DXL A;  1PDY A;  3AE4 A;  1DJQ A;  3SQP A;  3ZDN A;  1Q1W A;  4I58 A;  3QJ4 A;  2OO6 A;  5J60 A;  3DK4 A;  3CNS A;  2GGG A;  3ISH A;  4CY6 A;  2Z5X A;  3QSE A;  4CCR A;  1FEB A;  4ENL A;  1KNP A;  2GGJ A;  2OPJ A;  1NU5 A;  1QJD A;  4H4P A;  3ZVI A;  5CQF A;  4CCQ A;  1B5Q A;  2ZC8 A;  1DOC A;  1H7W A;  5HHF A;  3AEB A;  3PG6 A;  1PDH A;  2W55 A;  2C64 A;  3D8X A;  3BSM A;  4B69 A;  4MJW A;  3NN0 X;  3R10 A;  3RNM A;  2OZ8 A;  3D1C A;  3DJE A;  3ETR B;  3GRS A;  5FS9 A;  4X2P A;  4CY8 A;  3HRD C;  4LII A;  1MUC A;  3GD6 A;  1N4V A;  1TYT A;  1BQG A;  4A35 A;  4A3R A;  5C2T A;  2POZ A;  2BYB A;  1TDF A;  3M13 A;  2OVL A;  1FEC A;  3NVV B;  1VDV A;  4EIP A;  3I6T A;  5G5G B;  3N4E A;  2WDR A;  2ONE A;  1PBD A;  3NNE A;  1WUF A;  1K0I A;  5KVI A;  2YG7 A;  3JW7 A;  4BUR A;  5FJT A;  2OLN A;  3JVA A;  1PBB A;  4TM0 A;  2W0H A;  1CC6 A;  1DOD A;  3DK9 A;  2YLX A;  1JEH A;  2IVD A;  3BI2 A;  2C65 A;  4A6N A;  2DW6 A;  2OAM A;  5JCM A;  1JPD X;  2YG6 A;  3A7A A;  4H2R A;  4IHC A;  2POD A;  2VQB A;  4OPU A;  1HYU A;  2JAE A;  4C74 A;  1P48 A;  1F8R A;  4JN9 A;  2PYX A;  5CKU A;  5IQ1 A;  1VRQ B;  3AE2 A;  3AEA A;  1COY A;  3VRA A;  3AE3 A;  4U2L A;  3DDM A;  1YQ4 A;  1F8S A;  4OPC A;  3UOY A;  2A89 A;  4RSL A;  3AEC A;  2V60 A;  3WE0 A;  1T3Q C;  3MY9 A;  3NVY B;  3P3B A;  4K8D A;  2ZZB A;  2X8H A;  2FBW A;  4EMW A;  1MO9 A;  3UJ2 A;  1H83 A;  4H4U A;  2P8C A;  2CVJ A;  2QQ6 A;  2YR4 A;  4YSZ A;  3ALJ A;  3RP6 A;  4C3Y A;  3UKH A;  2GR2 A;  2PS2 A;  4RG4 A;  4HN8 A;  1TZZ A;  4YXD A;  3CB3 A;  4JNQ A;  5BUL A;  3AEF A;  2MNR A;  3RR1 A;  4C77 A;  1O94 A;  3UCL A;  1TDK A;  2XVF A;  5JRB A;  2XLU A;  4CRT A;  3KVE A;  5M0Z A;  2OQH A;  2AKM A;  1Q1R A;  4JY2 A;  3RHA A;  3P4S A;  2AL2 A;  4IP5 A;  3GO2 A;  4GRT A;  1ZDL A;  3KD9 A;  1H2I A;  3KKJ A;  3VCC A;  3VR9 A;  3UKP A;  2WQY A;  3T31 A;  2EQ8 A;  2C4C A;  4O5Q A;  2GMJ A;  2UZZ A;  4HB9 A;  3SXI A;  1GRH A;  5KOX A;  5KRQ A;  3D46 A;  4DSH A;  4LU6 A;  2DKH A;  5EBK A;  3NVZ B;  3STP A;  4NNJ A;  3UP4 A;  3VR8 A;  2X99 A;  3NVW B;  1XHC A;  1N4W A;  3NRN A;  3P0W A;  3OP2 A;  4EM4 A;  1DTN A;  4A5L A;  3I4K A;  3TWA A;  1SJC A;  1NHP A;  3PS9 A;  4IV9 A;  2ACZ A;  1Y56 B;  3P4P A;  4USQ A;  4B1B A;  3KU9 A;  1B37 A;  2APG A;  2PTZ A;  4YSY A;  1XDI A;  2E1M A;  1QO8 A;  3NKS A;  3F8D A;  3SZW A;  3BI4 A;  3NTA A;  2CDU A;  2GQF A;  3FVD A;  2B76 A;  2RAB A;  4DN1 A;  4BV6 A;  2XSX A;  5HYM A;  3S47 A;  4FX9 A;  3TCS A;  1OJT A;  1GOS A;  1M64 A;  4U8P A;  3ITJ A;  1LQT A;  1JOA A;  4EMJ A;  4H4Z A;  3CGD A;  1ELI A;  2Z5Y A;  1TDO A;  3II4 A;  1S2Q A;  5KXJ A;  7ENL A;  3AE7 A;  4YKF A;  3GMC A;  5FJO A;  4J34 A;  3GMB A;  1KSS A;  4ZCD A;  4AOS A;  1ZY8 A;  1KDG A;  4U8N A;  1CC4 A;  4E0V A;  2QCU A;  2OZ3 A;  1OEP A;  3AE1 A;  2VVL G;  3R0U A;  5KMP A;  3LB8 A;  4J36 A;  1EL8 A;  4HCD A;  3I3L A;  3CK5 A;  4YSH A;  3PVC A;  2BC0 A;  1D7L A;  4YTN A;  3QPE A;  3CGC A;  1IJH A;  3UTF A;  4TVW A;  3V5F A;  4E4U A;  2E4G A;  4YTP A;  3M0O A;  1XPY A;  3HZL A;  4GME A;  3GY1 A;  4CNK A;  2FYM A;  2YVJ A;  2YLZ A;  4C3X A;  3N6H A;  2OZT A;  4H7U A;  4UDQ A;  3U9I A;  3GC2 A;  4H4S A;  4IT1 A;  1N1P A;  4XWZ A;  3V3O A;  4DGK A;  4P9S A;  1L0V A;  4K8G A;  4TVY A;  1MDL A;  3H7V A;  4NTE A;  5EB5 A;  2OA1 A;  2GF3 A;  2Q7V A;  2XH2 A;  2AR8 A;  2QJJ A;  2PGW A;  3QVP A;  2P3Z A;  5BVA A;  2GR0 A;  4IA6 A;  1ZP0 A;  5FS7 A;  1N4U A;  3ZYX A;  2YAU A;  4A65 A;  4GAP A;  3N6J A;  2FJD A;  3VCN A;  1YKJ A;  3TW9 A;  3H12 A;  4H19 A;  2QDE A;  2QA2 A;  3SBF A;  1MNS A;  1L9E A;  4B66 A;  4IL0 A;  3T4W A;  3EPT A;  3QFB A;  1IUX A;  4J1O A;  3IJL A;  3UJS A;  4YTM A;  4OPL A;  4I59 A;  3BJS A;  4FDC B;  3PK7 A;  1YQ3 A;  4AP3 A;  1KF6 A;  1FEA A;  2XH7 A;  1BKW A;  2GR1 A;  4GF7 A;  3T37 A;  3E1T A;  3UJE A;  2YG5 A;  1FHU A;  2BS3 A;  2B7S A;  4G73 A;  4IA5 A;  3HYX A;  3IJI A;  4IL2 A;  1H84 A;  4WX1 A;  4YKG A;  1VQW A;  3CPH G;  1OJC A;  1GV4 A;  3NXL A;  2XH0 A;  2BA9 A;  4G6G A;  3ICT A;  4OPI A;  2OKT A;  2C72 A;  4J33 A;  3B3R A;  2YM1 A;  2WU5 A;  2XGZ A;  1LJ1 A;  4KWS A;  3SN1 A;  5KMQ A;  3VC5 A;  4YWO A;  2WOI A;  4ZA0 A;  2P88 A;  1CC2 A;  2XVH A;  2GH5 A;  1PN0 A;  1JPM A;  1IUS A;  2BS4 A;  2HNE A;  4Z17 A;  3TWB A;  4HNL A;  2QGY A;  3I6E A;  5FJR A;  5G5H B;  4AP1 A;  1EL7 A;  1DNC A;  1VG0 A;  5IQ4 A;  3T9P A;  5U63 A;  1B4V A;  4GCM A;  3SFE A;  1S3E A;  2BAC A;  4G9K A;  4NZH A;  3UOV A;  1D4E A;  1ZMC A;  4E8G A;  4Z1Y A;  3RIT A;  4ZCC A;  3CGB A;  4Y4M A;  2PU0 A;  3PFR A;  2JBV A;  4HCH A;  3HPF A;  3SZF A;  2GAG B;  1IUW A;  1P2H A;  3R1Z A;  4Y4L A;  3NFU A;  1SEZ A;  3R9U A;  4AOX A;  5BRT A;  3SQS A;  4FK1 C;  4HA6 A;  3TJI A;  5J7X A;  2R46 A;  2WS3 A;  3K1G A;  4GFI A;  3DH9 A;  2WOW A;  2DKI A;  2WPE A;  3AYJ A;  2C7G A;  2YLW A;  2RGJ A;  5FS8 A;  1CJC A;  2VVL A;  1M6I A;  2RGO A;  3FXG A;  4B64 A;  4OPD A;  3NT6 A;  3ICR A;  3ZLG A;  1BGJ A;  2JKC A;  2GRT A;  3NZG A;  3V4B A;  4M6U A;  1SJD A;  4FI4 A;  5EOW A;  5M10 A;  2R4E A;  3DK8 A;  3UKF A;  3CPI G;  3NGC X;  3TTE A;  1TRB A;  3DME A;  2VVM A;  2XLS A;  3AE9 A;  2BK4 A;  3CNJ A;  3VRD B;  1KN0 A;  2B9W A;  1NEL A;  3DJJ A;  4NEV A;  3NK2 X;  1EL9 A;  4H2P A;  1LV0 A;  3UKQ A;  4EMI A;  4ZCW A;  4TM3 A;  5DBJ A;  3U4F A;  5BOE A;  3I6D A;  3UKL A;  4KX6 A;  1VDC A;  3ALM A;  1BF3 A;  4ADW A;  3K7M X;  3CNT A;  2B9X A;  3DGB A;  4TLZ A;  1YEY A;  1PJ6 A;  1KCZ A;  3DJD A;  2QVH A;  3AEE A;  4U8J A;  2W3S A;  4H4X A;  1PXC A;  1TYP A;  5ENL A;  3GD3 A;  3H4K A;  2XFO A;  1GRF A;  4B68 A;  2ZBW A;  4GGB A;  3KPK A;  3GDN A;  5EU9 A;  4H2H A;  4IP4 A;  3V3W A;  1ZXI C;  1YQZ A;  4J3Z A;  4APN A;  3G5S A;  1NEN A;  1OJD A;  4MMW A;  2VRL A;  4BK3 A;  1PXA A;  4D04 A;  4WCT A;  2OFJ A;  2GVC A;  1E1L A;  2JB1 A;  3GDP A;  1Y56 A;  2XVI A;  3P9U A;  5HXI A;  4Z2R A;  4OPT A;  1Y0P A;  3UXK A;  3FBS A;  3Q6J A;  1VG9 A;  1PBC A;  5FJU A;  3SJN A;  2P0I A;  4G6H A;  1EC7 A;  3G5Q A;  1D5T A;  3ES7 A;  1GRT A;  3ATQ A;  4H2Q A;  4JN8 A;  4OPG A;  3T8Q A;  1CL0 A;  4YSX A;  2XYO A;  3C4N A;  4DWD A;  4PAA A;  4TLX A;  3SN0 A;  1NPX A;  3ENL A;  2NPX A;  4FK1 A;  2XCG A;  4TM4 A;  2WU2 A;  1NHQ A;  3PWG A;  2PTW A;  2X8G A;  3H8L A;  4KT2 A;  4HNC A;  3P4R A;  3S5W A;  3BHF A;  3CXB A;  2OX4 A;  3DGH A;  1IUU A;  3DEQ A;  3F8R A;  5IDZ A;  2A8X A;  3ZLH A;  4AT2 A;  3IHG A;  2R4J A;  5FS6 A;  3JZU A;  1L9C A;  2YVF A;  4ROP A;  4U8L A;  4GUV A;  4NTC A;  5U1O A;  1IUV A;  3CT2 A;  3S5S A;  4DX3 A;  2E3T A;  3A7R A;  3T0K A;  4H83 A;  3GD4 A;  1D4C A;  1D4D A;  3JSK A;  3NRZ B;  4DNA A;  1R0M A;  1VQZ A;  3UJF A;  1BKH A;  3OZY A;  1GXF A;  4ZN0 A;  1TDN A;  1E7P A;  1OJ9 A;  1Q9I A;  3QLD A;  1H6V A;  5J04 A;  4B65 A;  1WUE A;  3MWC A;  5KWF A;  3CPJ G;  5KMR A;  3DG3 A;  3NIX A;  1FHV A;  5ER0 A;  4N9X A;  3P4Q A;  4GGH A;  3QTP A;  3CXO A;  2VZ2 A;  4Z43 A;  1RSG A;  4LA1 A;  1F8W A;  4G74 A;  3QN3 A;  1PDZ A;  4FP1 A;  2X8C A;  3AD7 B;  3GYX A;  1TE6 A;  5EB4 A;  1MOK A;  1FO4 A;  3BNM A;  2C3C A;  5TR3 A;  4Z44 A;  2YQU A;  4GDE A;  3URH A;  4K1W A;  1PBE A;  1GEU A;  2AKZ A;  3H8A A;  1KD0 A;  5KVH A;  3HYW A;  4DYE A;  3NO1 A;  1IYX A;  3QKE A;  2GB0 A;  3NH3 X;  3RCY A;  2V5Z A;  2HQM A;  5LV9 A;  5FJP A;  4K2X A;  3AED A;  1PJ7 A;  3UCD A;  3GSI A;  4F4R A;  3ZVH B;  2WBA A;  2PMQ A;  1BWC A;  2OLA A;  4Z2T A;  3LZX A;  3T6C A;  5IPY A;  3AXB A;  1GET A;  1TKK A;  3UOX A;  4E6M A;  3IWA A;  2YLS A;  4UDP A;  3NTD A;  3NHO X;  1F9C A;  1SB3 B;  5HY5 A;  1PBF A;  3KA7 A;  4D03 A;  2YLT A;  1XPQ A;  1K0L A;  2XFQ A;  3RED A;  3P1W A;  1QLB A;  2V61 A;  2XVJ A;  1DOB A;  1E1K A;  4A99 A;  3SZ0 A;  3ICS A;  3UOZ A;  3OTR A;  2GGE A;  4U2S A;  3BOX A;  3LAD A;  2HZG A;  3B9J B;  1LVL A;  2XLP A;  1D7Y A;  1GTH A;  3SYI A;  2E5A A;  2O56 A;  4U8M A;  1KFY A;  4USR A;  3GRT A;  1FOH A;  1NHR A;  2DW7 A;  1MXT A;  3ZLF A;  3G5R A;  1MRA A;  3T2K A;  5KMS A;  2W54 A;  3GYJ A;  4H4Y A;  3AYI A;  3LOV A;  2OG9 A;  3V3N A;  3DER A;  1FCD A;  3T2Z A;  2XFU A;  1DOE A;  1EBH A;  2MUC A;  2WP6 A;  2JB2 A;  4IVM B;  2AAQ A;  4IZG A;  2R9Z A;  2BRA A;  3DJG X;  4ICY A;  3EKG A;  4EIQ A;  3DG7 A;  3FJ4 A;  2GAH B;  2IID A;  2XDO A;  3GWD A;  3SGL A;  2NVK X;  1N61 C;  3N4F A;  3VC6 A;  2WET A;  4A6G A;  1CBO A;  3FMW A;  3K7T A;  3C4A A;  3DGZ A;  5C3J A;  3C96 A;  3CIR A;  3FCP A;  3FV9 A;  2BRY A;  4II3 A;  1X31 B;  2BAB A;  1ZOY A;  4U8K A;  3VRB A;  3BI5 A;  3AYL A;  3OZ2 A;  2C66 A;  2I0Z A;  3H8I A;  4H4R A;  3AWI A;  1GPE A;  4JY3 A;  1CJ3 A;  2Q6U A;  3P93 A;  2R45 A;  1E9I A;  1JRP A;  2R0P A;  2C70 A;  3QFA A;  4OCG A;  1H82 A;  4C5O A;  3UTH A;  1LTX R;  3IF9 A;  2V3B A;  2Q0L A;  1NHS A;  2QDD A;  2GV8 A;  1JDF A;  3DFH A;  5BUK A;  1TDE A;  2JK6 A;  2QJM A;  4J56 A;  4X9M A;  1SJB A;  4G7F A;  2F5Z A;  4U2T A;  1H81 A;  3K7Q X;  3EUB 3;  3TQP A;  4IVO B;  3ABV A;  1SJA A;  1REO A;  2RDX A;  1JRO A;  3CGE A;  1GSN A;  3DES A;  3SFD A;  4B67 A;  3R0K A;  3SY4 A;  1S7M A;  2BCG G;  2XLR A;  2AQJ A;  3K30 A;  1K0J A;  4CBQ A;  1K4Q A;  1KKR A;  2CUL A;  1N5X A;  2GQW A;  4EQW A;  4E5T A;  3CND A;  4K22 A;  2BCP A;  2GSH A;  3UGV A;  2WP9 A;  2C73 A;  5BOF A;  2AL1 A;  4GAV A;  2R0C A;  2EQ7 A;  3NYF A;  3UXL A;  2Y6Q A;  1GND A;  2PP0 A;  1FFU C;  4JN7 A;  1UKV G;  4DSG A;  2P8B A;  2ZAD A;  2C75 A;  3TOY A;  4REK A;  4II2 A;  2FJA A;  2VRM A;  2W3R A;  3KUM A;  2C3D A;  2WOV A;  3LJP A;  3NG7 X;  1DJN A;  4J31 A;  3R07 C;  4K5S A;  1KSU A;  2OQY A;  3UKK A;  2RGH A;  4EWJ A;  1E6E A;  1GER A;  1ZOV A;  1ZX9 A;  4BK1 A;  1EC8 A;  1W4X A;  2TMD A;  1ECQ A;  4U8I A;  1GRE A;  3CN8 A;  4K2S A;  2PU1 A;  4H1Z A;  2YR5 A;  4HPN A;  1BGN A;  4K7Z A;  1JRZ A;  2E5V A;  2BK3 A;  4GYP C;  2PHH A;  1AOG A;  3MUC A;  4EM3 A;  3SR6 B;  3SZC A;  3L8K A;  2PCE A;  3H70 A;  3MKC A;  1ZKQ A;  2BXR A;  4ECH A;  3EF6 A;  1LQU A;  2VOU A;  3FIM B;  4YWS A;  1EBG A;  3THU A;  2WPF A;  5U25 A;  1FL2 A;  1GRA A;  1GTE A;  4KPR A;  1RYI A;  3V76 A;  3AN1 A;  3QSM A;  4E4F A;  3NLC A;  4J2W A;  3HW2 A;  1EBD A;  2ARD A;  2WEU A;  2BK5 A;  1P2E A;  1MDR A;  2OAL A;  3NS1 B;  1NG3 A;  2QJN A;  2WP5 A;  6ENL A;  2HXU A;  4KEM A;  2J3N A;  1STZ A;  3Q45 A;  2O9Z A;  1JNR A;  2X3N A;  2YG4 A;  4M52 A;  3HYV A;  3NYC A;  1NAA A;  4PAB A;  3CNP A;  1EL5 A;  3SX6 A;  4H2N A;  2GL5 A;  4Z24 A;  4Z25 A;  4RG3 A;  2YG3 A;  4B63 A;  3VFC A;  2XLT A;  3BNU A;  1LPF A;  1JU2 A;  4A6N B;  3GYI A;  4A9W A;  4Y4N A;  3AD8 B;  1P43 A;  2PPG A;  4X4J A;  2YM2 A;  3UP5 A;  1W6T A;  3EAN A;  2B7R A;  3DA1 A;  2R0G A;  2WDV A;  2XH4 A;  3AD9 B;  3IK4 A;  1ELS A;  1O95 A;  1X2G A;  2EQ6 A;  3SM8 A;  3ZVH A;  3R11 A;  2Q0K A;  5L46 A;  2V6O A;  1YY5 A;  4H50 A;  1JRX A;  3TJ4 A;  4EQR A;  3D9X A;  3OZM A;  3FPZ A;  1GT8 A;  1GAL A;  2ZZ0 A;  1CJ4 A;  3UTG A;  2B9Y A;  2Y6R A;  3NK0 X;  4NWZ A;  2CHR A;  5JCL A;  5JCI A;  4JDR A;  4XWR A;  1PJ5 A;  3UCC A;  3OC4 A;  1H86 A;  1N5W C;  3L1R A;  1IUT A;  1E1M A;  3OW1 A; 
#chains in the Genus database with same CATH homology
 3B6D A;  1D7Y A;  3DH9 A;  4GR1 A;  1GTH A;  1YQ4 A;  3SYI A;  1F8S A;  2FJB A;  4OPC A;  2TPR A;  2WOW A;  4U8M A;  2WHD A;  3UOY A;  3ALL A;  5JCN A;  2A89 A;  2DKI A;  2WPE A;  1KFY A;  4USR A;  3AYJ A;  3GRT A;  1FOH A;  1PS9 A;  4RSL A;  4Z2U A;  2XFP A;  1NHR A;  3AEC A;  3VQR A;  2V60 A;  3WE0 A;  2C7G A;  1MXT A;  2YLW A;  1ONF A;  2RGJ A;  5FS8 A;  3G5R A;  4K8D A;  1CJC A;  3T2K A;  2ZZB A;  2X8H A;  1M6I A;  2FBW A;  1O5W A;  4EMW A;  1MO9 A;  2RGO A;  2VVL A;  3GYJ A;  4OPD A;  4B64 A;  4BJZ A;  1H83 A;  4H4U A;  4H4Y A;  3ICR A;  1BGJ A;  3AYI A;  2XFN A;  2JKC A;  1H7X A;  2GRT A;  2WPC A;  3LOV A;  2CVJ A;  3V3N A;  4Z26 A;  2YR6 A;  5EOW A;  5M10 A;  3FG2 P;  3DK8 A;  2R4E A;  4NTD A;  3UKF A;  1FCD A;  2YR4 A;  4YSZ A;  3ALJ A;  3RP6 A;  4C3Y A;  1BZL A;  3T2Z A;  3UKH A;  3CPI G;  3NGC X;  2H89 A;  2XFU A;  1TRB A;  4BJY A;  1DOE A;  2GR2 A;  4RG4 A;  4YXD A;  3DME A;  2VVM A;  2XLS A;  2WP6 A;  1E1N A;  4JNQ A;  2JB2 A;  4IVM B;  3AE9 A;  2AAQ A;  4JNA A;  5BUL A;  2BK4 A;  2R9Z A;  4H4T A;  3AEF A;  3CNJ A;  1CF3 A;  2BRA A;  4GDP A;  3VRD B;  3DJG X;  4ICY A;  4C77 A;  3QSS A;  1JRY A;  1O94 A;  1KN0 A;  1L9D A;  1TDK A;  2XVF A;  3UCL A;  4EIQ A;  2B9W A;  3DJJ A;  5JRB A;  2XLU A;  2GAH B;  4CRT A;  3KVE A;  4NEV A;  2IID A;  5M0Z A;  5GRT A;  3NYE A;  2XDO A;  1Q1R A;  3QVR A;  1NEK A;  4JY2 A;  3NK2 X;  3GWD A;  3SGL A;  3RHA A;  3P4S A;  2NVK X;  1EL9 A;  4H2P A;  1CHU A;  1LV0 A;  3UKQ A;  4EMI A;  5DBJ A;  4TM3 A;  4GRT A;  1ZDL A;  2WET A;  3KD9 A;  5KOW A;  1H2I A;  3KKJ A;  1CBO A;  3FMW A;  3PO7 A;  3IHM A;  3K7T A;  2C67 A;  3VR9 A;  3C4A A;  3DGZ A;  1S2Y A;  2WQY A;  3UKP A;  3T31 A;  3I6D A;  5C3J A;  2EQ8 A;  3C96 A;  3UKL A;  3CIR A;  2A87 A;  4KX6 A;  1VDC A;  3KPF A;  2BRY A;  4II3 A;  3ALM A;  2H88 A;  1BF3 A;  1X31 B;  2BAB A;  1ZOY A;  2C4C A;  4O5Q A;  4U8K A;  4ADW A;  3K7M X;  2GMJ A;  3VRB A;  1ZK7 A;  2UZZ A;  3CNT A;  4HB9 A;  1GRH A;  3BI5 A;  2B9X A;  3AYL A;  3OZ2 A;  3RP8 A;  4TLZ A;  4LU6 A;  3SXI A;  4DSH A;  5KRQ A;  2DKH A;  5EBK A;  1PJ6 A;  1RP0 A;  2C66 A;  4NNJ A;  3UP4 A;  2I0Z A;  3VR8 A;  3H8I A;  2WES A;  3AB1 A;  3DJD A;  2X99 A;  1B8S A;  4H4R A;  4OVI A;  1GRG A;  2BC1 A;  3CMM A;  3UKA A;  3AEE A;  4U8J A;  1XHC A;  3AWI A;  1GPE A;  2FJE A;  5KOX A;  4JY3 A;  4H4X A;  1CJ3 A;  1N4W A;  3NRN A;  4TM1 A;  2Q6U A;  3AE6 A;  5JCK A;  2R45 A;  1PXC A;  2OLO A;  4BK2 A;  4EM4 A;  1F6M A;  4X9N A;  1TYP A;  2R0P A;  2YWL A;  2VQ7 A;  2C70 A;  3QFA A;  2CFY A;  4OCG A;  4A5L A;  3GD3 A;  3H4K A;  2XFO A;  3ATR A;  1GRF A;  4B68 A;  1NHP A;  1H82 A;  3PS9 A;  2ZBW A;  4IV9 A;  2ACZ A;  1Y56 B;  3KPK A;  3GDN A;  3P4P A;  4USQ A;  4A7A A;  4C5O A;  4CNJ A;  2BS2 A;  3UTH A;  4H4Q A;  1LTX R;  4B1B A;  3IF9 A;  1F3P A;  5IPY A;  3KU9 A;  1B37 A;  2X50 A;  1YQZ A;  2APG A;  4YT0 A;  2V3B A;  4APN A;  3G5S A;  1XDI A;  1NEN A;  2E1M A;  4YSY A;  3COX A;  1OJD A;  2VRL A;  4BK3 A;  1QO8 A;  1PXA A;  4D04 A;  3NKS A;  4EQX A;  2Q0L A;  3F8D A;  4WCT A;  3SZW A;  3S61 A;  3BI4 A;  1NG4 A;  2CDU A;  1NHS A;  3NTA A;  2GQF A;  2GVC A;  2B76 A;  1E1L A;  2RAB A;  2ZZC A;  2JB1 A;  3GDP A;  2GV8 A;  4BV6 A;  1Y56 A;  2XVI A;  5HYM A;  3P9U A;  4FX9 A;  5HXI A;  1OJT A;  2QAE A;  5BUK A;  4Z2R A;  1GOS A;  1M64 A;  1TDE A;  2JK6 A;  4OPT A;  1Y0P A;  4J56 A;  4X9M A;  2C76 A;  4U8P A;  3FBS A;  3ITJ A;  3Q6J A;  1LQT A;  1VG9 A;  1JOA A;  4EMJ A;  5KNL A;  1PBC A;  2F5Z A;  4U2T A;  4H4Z A;  3CGD A;  1H81 A;  3K7Q X;  1ELI A;  2Z5Y A;  1TDO A;  4G6H A;  4IVO B;  3ABV A;  4UP3 A;  4XXG A;  3G5Q A;  1D5T A;  3II4 A;  1S2Q A;  5KXJ A;  1REO A;  3L5O A;  3AE7 A;  1GRT A;  3ATQ A;  4H2Q A;  4YKF A;  3GMC A;  4OPG A;  4J34 A;  3GWF A;  3CGE A;  3GMB A;  1GSN A;  3SFD A;  1S3B A;  4B67 A;  1KSS A;  4ZCD A;  3ADA B;  1ZY8 A;  4AOS A;  1CL0 A;  1XAN A;  3SY4 A;  1KDG A;  2QA1 A;  4U8N A;  1S7M A;  4H4W A;  2BCG G;  4YSX A;  1CC4 A;  1E39 A;  2XLR A;  2XYO A;  3AEG A;  3C4N A;  2AQJ A;  3K30 A;  4PAA A;  4TLX A;  1K0J A;  4E0V A;  4CBQ A;  1NPX A;  1K4Q A;  3Q9T A;  3T2Y A;  2QCU A;  2NPX A;  2V3A A;  2YLR A;  4FK1 A;  1NDA A;  4NEW A;  2XCG A;  4JQ9 A;  3AE1 A;  2VVL G;  3KLJ A;  4TM4 A;  2WU2 A;  1NHQ A;  2CUL A;  5KMP A;  1CJ2 A;  4O5U A;  3LB8 A;  4J36 A;  3RP7 A;  1EL8 A;  3I3L A;  2GQW A;  4YSH A;  4EQW A;  3PVC A;  2BC0 A;  2IVE A;  3CND A;  2X8G A;  1D7L A;  2BXS A;  4K22 A;  2GR3 A;  2BCP A;  3EAO A;  4YTN A;  2WP9 A;  3CGC A;  1IJH A;  3UTF A;  3H8L A;  4YTP A;  2E4G A;  3P4R A;  3M0O A;  2C73 A;  2XVE A;  3S5W A;  1JNZ A;  4GAV A;  2R0C A;  3HZL A;  3BHF A;  4AT0 A;  1Z6L A;  4CNK A;  2YVJ A;  3DGH A;  2EQ7 A;  3O0H A;  1IUU A;  2YLZ A;  4C3X A;  3NYF A;  4H7U A;  3F8R A;  4UDQ A;  3F8P A;  5KMS A;  2JB3 A;  2Y6Q A;  2EQ9 A;  1GND A;  2A8X A;  3T14 A;  4H4S A;  2WDQ A;  4H4V A;  4XWZ A;  1N1P A;  3V3O A;  4DGK A;  4P9S A;  1UKV G;  1L0V A;  3AE5 A;  3CTY A;  3LXD A;  4AT2 A;  4DSG A;  4NTE A;  2C75 A;  5EB5 A;  2OA1 A;  3IHG A;  3M12 A;  3UTE A;  2GF3 A;  4REK A;  4II2 A;  3IC9 A;  2FJA A;  2Q7V A;  2VRM A;  2AR8 A;  2R4J A;  5FS6 A;  2GEW A;  2C3D A;  2WOV A;  3LJP A;  3AE8 A;  1L9C A;  3QVP A;  5BVA A;  2YVF A;  2GR0 A;  4IA6 A;  3NG7 X;  1DJN A;  4J31 A;  1KNR A;  4K5S A;  1ZP0 A;  1GRB A;  5FS7 A;  4U8L A;  1N4U A;  1KSU A;  3ZYX A;  5FMH A;  2YAU A;  4GUV A;  2GMH A;  3UKK A;  2RGH A;  4A65 A;  4EQS A;  1E6E A;  4GAP A;  1V59 A;  4NTC A;  5U1O A;  1PXB A;  1GER A;  2FJD A;  4UDR A;  1ZOV A;  3LZW A;  1IUV A;  1ZX9 A;  1YKJ A;  4J57 A;  4BK1 A;  1W4X A;  5GSN A;  3BHK A;  1ZMD A;  2TMD A;  4U8I A;  3NN6 X;  4U8O A;  1GES A;  1GRE A;  3CN8 A;  4K5R A;  1OJA A;  2QA2 A;  1L9E A;  2YVG A;  1PHH A;  3NK1 X;  3T0K A;  1DXL A;  2YR5 A;  4B66 A;  3GD4 A;  1BGN A;  1D4C A;  1D4D A;  3AE4 A;  3JSK A;  4K7Z A;  4DNA A;  1JRZ A;  3EPT A;  2E5V A;  3QFB A;  1DJQ A;  1IUX A;  2BK3 A;  2PHH A;  3SQP A;  1AOG A;  4EM3 A;  3ZDN A;  1Q1W A;  4I58 A;  4YTM A;  4OPL A;  3QJ4 A;  3SZC A;  5J60 A;  3DK4 A;  3L8K A;  4I59 A;  1GXF A;  4FDC B;  3CNS A;  4ZN0 A;  1YQ3 A;  4AP3 A;  1TDN A;  1KF6 A;  1FEA A;  1E7P A;  1OJ9 A;  3ISH A;  4CY6 A;  2Z5X A;  3QSE A;  4CCR A;  1BKW A;  2GR1 A;  4GF7 A;  1FEB A;  3T37 A;  1Q9I A;  1H6V A;  3E1T A;  4B65 A;  1ZKQ A;  2BXR A;  4ECH A;  5KWF A;  1KNP A;  2YG5 A;  2BS3 A;  3EF6 A;  1LQU A;  2B7S A;  2VOU A;  3FIM B;  4G73 A;  1QJD A;  3CPJ G;  4IA5 A;  4H4P A;  5KMR A;  3NIX A;  3HYX A;  5CQF A;  4CCQ A;  1H84 A;  2WPF A;  4WX1 A;  5ER0 A;  5U25 A;  1B5Q A;  4N9X A;  4YKG A;  1FL2 A;  1DOC A;  1GRA A;  1H7W A;  5HHF A;  3AEB A;  1VQW A;  3P4Q A;  1GTE A;  3CPH G;  1OJC A;  1GV4 A;  4KPR A;  1RYI A;  3PG6 A;  1PDH A;  3V76 A;  3QSM A;  2C64 A;  2BA9 A;  2VZ2 A;  3NLC A;  3D8X A;  4J2W A;  4Z43 A;  4B69 A;  1EBD A;  2ARD A;  4MJW A;  1RSG A;  4LA1 A;  4G6G A;  3ICT A;  3NN0 X;  4OPI A;  2WEU A;  2C72 A;  4J33 A;  1F8W A;  4G74 A;  3NT6 A;  4Z2T A;  3RNM A;  3B3R A;  2YM1 A;  2WU5 A;  2BK5 A;  3D1C A;  3DJE A;  1P2E A;  1LJ1 A;  2X8C A;  2OAL A;  3GRS A;  5FS9 A;  3AD7 B;  3GYX A;  5KMQ A;  1NG3 A;  2WP5 A;  5EB4 A;  4CY8 A;  1MOK A;  2J3N A;  4LII A;  2C3C A;  5TR3 A;  3BNM A;  4Z44 A;  2YQU A;  4GDE A;  2O9Z A;  4YWO A;  3URH A;  2WOI A;  1JNR A;  1PBE A;  1N4V A;  1TYT A;  1GEU A;  1CC2 A;  2X3N A;  2YG4 A;  4M52 A;  3HYV A;  2XVH A;  5KVH A;  2GH5 A;  3HYW A;  3NYC A;  5C2T A;  1PN0 A;  1NAA A;  1IUS A;  2GB0 A;  3NH3 X;  2BYB A;  1TDF A;  3CNP A;  3M13 A;  4PAB A;  2V5Z A;  2HQM A;  2BS4 A;  1EL5 A;  3SX6 A;  1FEC A;  4EIP A;  5LV9 A;  4K2X A;  3AED A;  4H2N A;  4Z24 A;  4Z25 A;  4RG3 A;  2YG3 A;  4B63 A;  2WDR A;  1PJ7 A;  2XLT A;  3BNU A;  1LPF A;  1JU2 A;  4A6N B;  3GYI A;  4A9W A;  1PBD A;  3NNE A;  1EL7 A;  4AP1 A;  1DNC A;  3GSI A;  1VG0 A;  5IQ4 A;  1K0I A;  5U63 A;  5KVI A;  1B4V A;  2WBA A;  4Y4N A;  2YG7 A;  4GCM A;  4BUR A;  3SFE A;  3AD8 B;  1BWC A;  2OLN A;  1PBB A;  4TM0 A;  4X4J A;  3LZX A;  1S3E A;  2W0H A;  1CC6 A;  1DOD A;  2BAC A;  2B7R A;  3EAN A;  2YM2 A;  4G9K A;  4NZH A;  1D4E A;  3AXB A;  1GET A;  1ZMC A;  3UOV A;  3DK9 A;  2R0G A;  3DA1 A;  2YLX A;  4A79 A;  1JEH A;  2WDV A;  2IVD A;  3UOX A;  3BI2 A;  3AD9 B;  3IWA A;  2YLS A;  1O95 A;  2C65 A;  4ZCC A;  4A6N A;  2EQ6 A;  3CGB A;  4Y4M A;  3SM8 A;  2OAM A;  4UDP A;  2Q0K A;  3NTD A;  3NHO X;  5L46 A;  2V6O A;  5JCM A;  1YY5 A;  3UP5 A;  5HY5 A;  2JBV A;  4H50 A;  2YG6 A;  1JRX A;  1PBF A;  3KA7 A;  4D03 A;  2YLT A;  4H2R A;  1XPQ A;  3SZF A;  4EQR A;  3D9X A;  1K0L A;  2XFQ A;  2GAG B;  1IUW A;  3RED A;  2VQB A;  3FPZ A;  1P2H A;  3P1W A;  1QLB A;  1GT8 A;  1GAL A;  2ZZ0 A;  1HYU A;  4OPU A;  2V61 A;  1CJ4 A;  2JAE A;  2XVJ A;  1DOB A;  3UTG A;  4Y4L A;  1E1K A;  4A99 A;  4C74 A;  2B9Y A;  2Y6R A;  3NK0 X;  4NWZ A;  1SEZ A;  3R9U A;  3SZ0 A;  5JCL A;  3ICS A;  4AOX A;  3UOZ A;  5BRT A;  1F8R A;  5JCI A;  2PYX A;  4FK1 C;  4HA6 A;  4JN9 A;  5CKU A;  5IQ1 A;  4JDR A;  1VRQ B;  1PJ5 A;  3AE2 A;  4U2S A;  4XWR A;  5J7X A;  3OC4 A;  2R46 A;  3AEA A;  1COY A;  2WS3 A;  3VRA A;  3LAD A;  3AE3 A;  1H86 A;  3L1R A;  1IUT A;  4U2L A;  1E1M A;  1LVL A;  2XLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...