2HQMA

Crystal structure of glutathione reductase glr1 from the yeast saccharomyces cerevisiae
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
462
structure length
461
Chain Sequence
KHYDYLVIGGGSGGVASARRAASYGAKTLLVEAKALGGTCVNVGCVPKKVMWYASDLATRVSHANEYGLYQNLPLDKEHLTFNWPEFKQKRDAYVHRLNGIYQKNLEKEKVDVVFGWARFNKDGNVEVQKRDNTTEVYSANHILVATGGKAIFPENIPGFELGTDSDGFFRLEEQPKKVVVVGAGYIGIELAGVFHGLGSETHLVIRGETVLRKFDECIQNTITDHYVKEGINVHKLSKIVKVEKNVTDKLKIHMNDSKSIDDVDELIWTIGRKSHLGMGSENVGIKLNSHDQIIADEYQNTNVPNIYSLGDVVGKVELTPVAIAAGRKLSNRLFGPEKFRNDKLDYENVPSVIFSHPEAGSIGISEKEAIEKYGKENIKVYNSKFTAMYYAMLSEKSPTRYKIVCAGPNEKVVGLHIVGDSSAEILQGFGVAIKMGATKADFDNCVAIHPTSAEELVTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutathione reductase
publication title Crystal structure of glutathione reductase Glr1 from the yeast Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 147
structure length 461
sequence length 462
chains with identical sequence B
ec nomenclature ec 1.8.1.7: Glutathione-disulfide reductase.
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF12831 FAD_oxidored FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 2hqmA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2hqmA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2hqmA02
3I6DA 4H4TA 2OALA 1JU2A 1D4DA 2R9ZA 3LXDA 1JEHA 2E4GA 2ZBWA 2RGOA 3AE2A 4GUVA 4H4QA 4IV9A 2XFPA 4EM3A 3KVEA 3UTEA 4J33A 3IC9A 2YLZA 3AEGA 3CGBA 4TLXA 2R45A 3K30A 3AD9B 4B67A 1GRFA 3DJJA 4EMWA 4ICYA 1CHUA 1F8RA 4CY6A 4I59A 2XFOA 4LIIA 5KVHA 1OJ9A 2XFUA 1ZDLA 2C3DA 3NK0X 4A79A 2JBVA 4LU6A 4UDRA 2GF3A 1EL9A 4O5QA 4OPLA 1EL8A 2OAMA 3M0OA 2VRMA 1W4XA 3LB8A 5CQFA 5EOWA 1CJ2A 3M13A 1TDOA 4JDRA 1MXTA 4ADWA 4ZCCA 3F8RA 5KRQA 3G5RA 5JCNA 4CCQA 4YWOA 2WU5A 2XFNA 4U8LA 5HXIA 4EQRA 2R46A 4Y4NA 3RNMA 1VG9A 2I0ZA 3AYLA 3REDA 4DSHA 2TMDA 1V59A 1BZLA 1H83A 2JB2A 4J34A 1DJQA 2XVIA 3NIXA 4Z2UA 1JNZA 4BJZA 5J60A 4JNQA 1E7PA 1ONFA 3B6DA 3H8IA 3IHGA 3K7TA 1EBDA 1MO9A 1F8SA 3BHKA 4Z24A 5C2TA 3O0HA 3UOZA 1ZX9A 3T37A 1PBEA 3NLCA 4JN9A 4CRTA 2GRTA 2BS3A 4YTPA 1CJ3A 4U8NA 5U63A 3P4QA 3BI4A 3D8XA 4U8KA 1LQTA 1LTXR 3NNEA 5ER0A 3AE6A 1GEUA 2X8CA 4BJYA 5FMHA 2AR8A 2V61A 2UZZA 3CPHG 4CCRA 2B9XA 4A6NA 4AP1A 3UOYA 5KOWA 3G5QA 3UP5A 5BULA 1JRXA 1JRYA 1FL2A 3UKAA 2XLTA 4JY2A 1BF3A 5FS9A 3NN6X 4MJWA 4AOXA 2VQ7A 1PBFA 3QVPA 3AD8B 3BNUA 1VQWA 3UKHA 4KPRA 5LV9A 1O95A 3E1TA 1Q1RA 1CC2A 1TYPA 4BV6A 1K4QA 3D1CA 4C3YA 5JCLA 5IPYA 2TPRA 2AQJA 2V60A 4JNAA 2GMJA 3GRTA 2GVCA 2R0CA 3BHFA 3AE3A 2GAGB 4IVOB 1NG4A 2PYXA 3EPTA 2NVKX 5DBJA 2NPXA 1ZOVA 1GALA 1P2HA 2XVHA 3GRSA 4B66A 2C72A 2WHDA 3II4A 2YR4A 2YVJA 2YG5A 5EBKA 2YR6A 2WEUA 3C4NA 4BK1A 3QFAA 1E1NA 5KXJA 1CC6A 2B9WA 3LJPA 3DH9A 1GT8A 4EMJA 2GQFA 2WDRA 4OPCA 1QO8A 1EL5A 4EMIA 4FK1A 4YKFA 2CDUA 2VVLA 3QFBA 1YY5A 3OZ2A 2WU2A 1P2EA 1ZMCA 2QA1A 3CNSA 3CPJG 4U2TA 1VDCA 2BACA 1X31B 1GETA 1D4EA 4X9MA 1S3EA 1OJDA 4WX1A 1TDNA 2FJDA 2OLOA 4EQSA 4J31A 3DJGX 3P4RA 1O94A 1PS9A 3RP6A 4ZN0A 2YM1A 2R4JA 3CNJA 3ABVA 1B5QA 3NN0X 3ALJA 3NK2X 4YSHA 1GV4A 1UKVG 3AE9A 3S61A 2BCGG 2X8HA 4B64A 2V3BA 1GRHA 3NTDA 4P9SA 1ZP0A 2YG4A 5FS7A 2VVLG 4A99A 3ATQA 2YLSA 3Q6JA 3IF9A 1PDHA 1PBDA 5KVIA 4EIPA 2EQ9A 4U2LA 3NKSA 4C77A 4H2PA 1GERA 4U8JA 5L46A 2GMHA 3ATRA 5GSNA 1NHPA 4RSLA 4YSYA 3CN8A 2C67A 4NZHA 5EB4A 2X8GA 3CNTA 1S2QA 2E5VA 2RGJA 2YLTA 3ALLA 2BXRA 2JB1A 2DKIA 4A9WA 3LZXA 1NHRA 3UTGA 4A6NB 4WCTA 1GESA 3CGEA 4K8DA 4Z2TA 1IUWA 1TDEA 3EF6A 2ARDA 3VRDB 1NG3A 1DNCA 1DOCA 2IIDA 4NTDA 4OPUA 2YLXA 5U1OA 5IQ4A 3AEBA 1KNRA 3GYIA 1OJCA 4B69A 5J7XA 1REOA 4OPTA 1LV0A 3SFEA 4YKGA 3NRNA 4YT0A 1KF6A 4H4WA 1BWCA 4CNKA 2Y6RA 4OVIA 4TM4A 1XPQA 4EIQA 1DXLA 3UKQA 1E1KA 4USQA 2X50A 4H50A 1F6MA 2RABA 2ZZBA 3KU9A 4USRA 2H89A 1ZY8A 3S5WA 4FDCB 4Z26A 1RYIA 3EANA 3NT6A 2GR0A 5C3JA 2R4EA 2XVJA 3AECA 1KSSA 1PJ7A 1GSNA 2YM2A 4XWRA 3H4KA 3AD7B 4IA5A 3COXA 5M0ZA 4XWZA 3C96A 3ISHA 3NYFA 3R9UA 4KX6A 1NPXA 1L9EA 1NENA 4OPGA 3GYJA 1YQ3A 2XDOA 1DOBA 3B3RA 4U2SA 2BS4A 4H4ZA 1GRTA 3LOVA 4JY3A 3KD9A 5EB5A 4AOSA 3GD3A 3URHA 2WDVA 2IVDA 1MOKA 2HQMA 1CBOA 2GR3A 3AE4A 2ACZA 4U8MA 3QJ4A 3UOXA 5U25A 1M64A 3AXBA 2GQWA 2CFYA 3UP4A 2OLNA 3BNMA 3ZYXA 2JB3A 1IJHA 2VOUA 3FIMB 1PXAA 3FBSA 4B63A 2WP6A 4DGKA 1NDAA 2BYBA 4Y4MA 1GRAA 3RHAA 1DODA 1O5WA 4OPIA 4EM4A 3KPFA 1Y0PA 2H88A 4GR1A 3AE7A 4BK3A 4YSXA 4Y4LA 2BK3A 1GNDA 3ITJA 4BURA 2FJAA 1FEBA 2WBAA 1RP0A 3CPIG 2WPEA 1KDGA 1L9CA 1LVLA 2B9YA 3ALMA 2XYOA 3NTAA 2Q6UA 1Q1WA 3DA1A 4UP3A 3CGDA 2X99A 2BC0A 1H7WA 5TR3A 1M6IA 1E1MA 2WOVA 2WQYA 2E1MA 3RP7A 2RGHA 1VRQB 3V3NA 3F8DA 3NH3X 1BGNA 2A87A 3DJDA 1H84A 5CKUA 4TM0A 3UOVA 3AEDA 4REKA 4K5RA 2C73A 4D03A 3PS9A 3ZDNA 2YG6A 3AWIA 1ZOYA 2VVMA 1D7YA 1ZK7A 1PJ6A 1E6EA 1ELIA 1YKJA 3DK8A 1GTHA 3CNDA 3AEAA 3ICSA 1F3PA 4N9XA 4D04A 2GEWA 2EQ7A 2XVFA 4OPDA 3P9UA 3QSSA 4AT2A 1CF3A 3DMEA 3GMCA 3BI2A 3DK4A 3NK1X 3UKPA 4U8IA 4J56A 2C65A 3PVCA 4TLZA 3BI5A 4B65A 4CY8A 1Q9IA 2WP5A 1NHSA 4NEVA 1E1LA 1N4UA 1TRBA 1L9DA 2YG7A 3AE8A 3PO7A 2YQUA 2QAEA 1EL7A 1NAAA 1XDIA 4IA6A 4RG3A 1CJCA 4HB9A 3UCLA 3DJEA 1FEAA 2B76A 3QSMA 2A8XA 3NYEA 1D4CA 4TM3A 1GREA 4X9NA 5BUKA 4FX9A 1PXCA 2R0GA 2Q0LA 2XCGA 3C4AA 1KSUA 4K2XA 2JAEA 4TM1A 5M10A 1GRGA 3FMWA 1GXFA 3IHMA 1D7LA 1JNRA 3NHOX 4PAAA 1TDKA 1K0JA 2BC1A 2V5ZA 2YLRA 4OCGA 5FS6A 1H6VA 1TYTA 2EQ6A 1FCDA 1PN0A 2WP9A 3GWFA 4Z44A 4C74A 2GV8A 3AB1A 2QCUA 3P1WA 1IUTA 1COYA 1Y56A 3VQRA 3GMBA 2Z5YA 4C5OA 5BVAA 2O9ZA 4B68A 5HHFA 2YVGA 4U8OA 2V6OA 2Z5XA 1OJAA 3L1RA 3GD4A 2BXSA 3JSKA 2PHHA 1CC4A 1PBBA 2F5ZA 1S2YA 2BS2A 1IUSA 3KA7A 4H2RA 1FECA 4C3XA 1GRBA 1TDFA 2APGA 2DKHA 2VQBA 3SFDA 4M52A 3V3OA 3I3LA 2B7SA 4YTNA 1JOAA 4H4VA 4NTEA 1CL0A 3FG2P 2BA9A 3SM8A 2WPCA 2YR5A 3SGLA 1B8SA 5JCKA 4EQWA 4YSZA 3VR8A 1XHCA 2Q7VA 3GDNA 1IUXA 2Y6QA 4Z25A 1LPFA 4PABA 1KFYA 4A5LA 3ICRA 4NTCA 1LQUA 4CBQA 2WOWA 4K22A 1YQ4A 4Z43A 2ZZCA 3CNPA 2JKCA 1XANA 3AE1A 4HA6A 4I58A 1SEZA 4H4PA 4GRTA 2BK5A 4DNAA 2C75A 1GOSA 3UTHA 3NGCX 1CJ4A 5FS8A 1KNPA 2Q0KA 1GPEA 1B37A 1PHHA 1VG0A 5JCMA 3AEEA 4GDEA 2OA1A 2VZ2A 3AEFA 4GF7A 4YXDA 2AAQA 4IVMB 4AP3A 4H4YA 2WDQA 2YVFA 2FBWA 4JQ9A 4A65A 3LADA 4H7UA 4CNJA 4K5SA 3VRBA 2WOIA 4H4SA 1S3BA 2V3AA 3AYJA 3G5SA 1IUUA 2WPFA 3K7QX 1B4VA 2XLPA 1BGJA 1H7XA 5HYMA 3GDPA 1FOHA 4A7AA 3DK9A 3OC4A 3AE5A 4U8PA 2YG3A 3QVRA 5BRTA 1F8WA 1YQZA 3QSEA 1D5TA 2YWLA 2B7RA 3CGCA 4FK1C 2C7GA 4B1BA 4ECHA 2C70A 3IWAA 1E39A 1HYUA 2YLWA 3HZLA 2FJBA 5GRTA 5IQ1A 3DGZA 4EQXA 1N4VA 3CTYA 4H4RA 3KLJA 3P4SA 3M12A 1QLBA 1NEKA 1ZKQA 1ZMDA 1LJ1A 3FPZA 3WE0A 1H82A 4XXGA 2W0HA 3RP8A 3ADAB 2CULA 1PBCA 2JK6A 3ICTA 2GB0A 3UKLA 4DSGA 3EAOA 3P4PA 4UDQA 1IUVA 4GCMA 4H2QA 3H8LA 2XLSA 4BK2A 1Y56B 4J2WA 3KKJA 2C3CA 1RSGA 2IVEA 3F8PA 3K7MX 1NHQA 1K0LA 3CIRA 2GR1A 2YAUA 2X3NA 3AYIA 1PJ5A 1H86A 4H2NA 5HY5A 4GDPA 5KWFA 4K7ZA 3LZWA 1K0IA 3DGHA 2GR2A 4X4JA 2GAHB 1OJTA 2C76A 1DJNA 3UKFA 1N1PA 2XFQA 3UTFA 4AT0A 2BABA 3VRAA 2XLRA 4ZCDA 2C66A 1Z6LA 2ZZ0A 4H4UA 2A89A 3GWDA 4LA1A 3NG7X 2J3NA 2WS3A 3UKKA 2XLUA 2BCPA 4H4XA 2VRLA 4APNA 2CVJA 4RG4A 4UDPA 4Z2RA 5KOXA 3V76A 1H81A 4J57A 1JRZA 1QJDA 2C64A 2WESA 1PXBA 1N4WA 2R0PA 4J36A 4YTMA 1L0VA 2EQ8A 4E0VA 3L8KA 1AOGA 2WETA 5JCIA 3NYCA 3VR9A 1GTEA 2FJEA 3GSIA 2QA2A 4NEWA 3SQPA 2GH5A 1DOEA 2BK4A 1BKWA 3Q9TA 4O5UA 2XVEA
chains in the Genus database with same CATH superfamily
1D4DA 2E4GA 2ZBWA 1XPYA 4H4QA 4EM3A 3IC9A 1MDRA 3CAWA 1N60C 1VQZA 3VC6A 3DJJA 4CY6A 1CHUA 1ZDLA 3NK0X 4O5QA 1EL8A 3IK4A 4Z17A 2E3TA 1MXTA 3NVVB 5KRQA 4YWOA 2XFNA 3ZLGA 2R46A 4Y4NA 4NWZA 2I0ZA 4DSHA 1V59A 1H83A 2RDXA 2JB2A 4J34A 1JNZA 5J60A 3EKGA 1ONFA 1E7PA 3IHGA 2CHRA 3THUA 1MUCA 1ZX9A 2GRTA 2BS3A 4U8NA 3P4QA 4U8KA 5ER0A 2QGYA 5FMHA 4CCRA 3CPHG 5JRBA 3UOYA 3TOYA 1JRYA 2W3SA 3UKAA 3NN6X 4MJWA 1PBFA 3QVPA 3BNUA 3D47A 1Q1RA 4HCHA 2W54A 3TJ4A 4C3YA 2V60A 1PDYA 3GRTA 2R0CA 3BHFA 2PYXA 3DFHA 3SJNA 2MNRA 5DBJA 2NPXA 3R1ZA 1P48A 1SJAA 3II4A 2XH7A 2YG5A 2WEUA 4BK1A 3QFAA 5KXJA 2FYMA 4EMJA 1QO8A 2O56A 1EL5A 4YKFA 3QKEA 1ZMCA 3UCCA 3UJ2A 4G7FA 4WX1A 1TDNA 4EQSA 3P4RA 3RP6A 2YM1A 3NTDA 1ZP0A 2YG4A 2PCEA 5FS7A 3B97A 4C77A 5L46A 3ATRA 2AKMA 2X8GA 1WUFA 3DGBA 3GY1A 2BXRA 2JB1A 1PDZA 3T0KA 2DKIA 4WCTA 4Z2TA 3VRDB 2IIDA 1DNCA 4OPUA 3R25A 4GIRA 1EC9A 4B69A 5J7XA 1REOA 1LV0A 3CYJA 4YKGA 2QJMA 4TM4A 4EIQA 3N4EA 4H50A 1F6MA 3KUMA 3KU9A 2H89A 1ZY8A 1N63C 2GR0A 2XVJA 3HRDC 1PJ7A 1GSNA 4XWRA 3H4KA 4IA5A 3COXA 3ISHA 1L9EA 4OPGA 3GYJA 1YQ3A 4U2SA 3SZ0A 2OQYA 3LOVA 4AOSA 3URHA 2WDVA 2HQMA 2GR3A 2AL1A 4HYRA 3DDMA 2OLNA 2JB3A 1IJHA 4B63A 3FBSA 1T3QC 3MY9A 3SR6B 3R07C 2BYBA 1GRAA 1DODA 1O5WA 3PWIA 3AE7A 3HYXA 4BK3A 4BURA 1RP0A 3VA8A 3A7AA 5TR3A 1M6IA 2E1MA 4E8GA 3RP7A 3F8DA 4KEMA 1BGNA 2A87A 1N61C 4TM0A 3SY4A 3OW1A 3UOVA 3PS9A 2YG6A 1PJ6A 3RO6A 2PSNA 1JDFA 4GYPC 3DK8A 3ICSA 3AEAA 2GEWA 4DWDA 1CF3A 2P8CA 3BI2A 3DK4A 4G6HA 3BOXA 1XS2A 2WP5A 1NHSA 2YG7A 1L9DA 3AE8A 3PO7A 3SSZA 3MQTA 1XDIA 4IA6A 4RG3A 1CJCA 3I4KA 4HB9A 4IZGA 2B76A 3NYEA 1D4CA 5BUKA 2Q0LA 2XCGA 4TM1A 1ECQA 3NHOX 3N6JA 1TYTA 3BJSA 1FCDA 1PN0A 4HNLA 4Z44A 2QCUA 4C5OA 2O9ZA 4K2SA 2YVGA 3ENLA 3ZVHB 1OJAA 3GD4A 2PHHA 3KA7A 2BS2A 1N5XA 3ZVIA 3V3OA 3I3LA 1CL0A 3FG2P 5JCKA 3PG6A 2PGWA 3VR8A 1XHCA 3GDNA 1IUXA 4PABA 4DHGA 4A5LA 3ICRA 2JKCA 4HA6A 3AE1A 1SEZA 4H4PA 3V3WA 3SZFA 1GPEA 1PHHA 1VG0A 5JCMA 3AEEA 5IDZA 2OA1A 2VZ2A 3AEFA 2AAQA 4K8GA 2FBWA 4A65A 3LADA 3VRBA 2FKPA 1B4VA 1BGJA 3HPFA 3VC5A 3OC4A 3TCSA 2GGIA 4B1BA 3IWAA 1HYUA 3P4SA 3CTYA 1ZKQA 3FPZA 3RITA 4A6GA 4KT2A 3UJSA 2GB0A 3UKLA 3P4PA 4H2QA 3H8LA 1Y56B 4J2WA 3KKJA 1RSGA 1F9CA 3UXLA 4GFIA 1MRAA 5ENLA 2OKTA 2C76A 4AT0A 3UTFA 4H4UA 3GWDA 3NG7X 2J3NA 3UKKA 2VRLA 4APNA 3DG3A 5KOXA 1H81A 1PXBA 1N4WA 1JROA 1L0VA 2EQ8A 4E0VA 3L8KA 2WETA 2QDEA 1GTEA 3GSIA 2QA2A 3FCPA 3SQPA 2GH5A 2BK4A 4GYPA 3R10A 2OALA 3LXDA 3AE2A 2RGOA 3KVEA 3UTEA 2YLZA 4TLXA 2R45A 1EBGA 1P43A 4B67A 4I59A 5KVHA 3AN1A 2JBVA 3MKCA 4LU6A 4OPLA 4EWJA 4DX3A 1W4XA 3LB8A 5EOWA 1CJ2A 1TDOA 4ZCCA 3EUB3 3F8RA 2PP1A 4CCQA 1WYGA 5HXIA 3AYLA 3P0WA 1KKRA 1W6TA 2XVIA 4Z2UA 4ENLA 4JNQA 3K7TA 3H8IA 1EBDA 1MO9A 1F8SA 3BHKA 3OP2A 4Z24A 3UOZA 4CRTA 2PU0A 3RCYA 1CJ3A 1LQTA 3MZNA 3GYXA 2X8CA 2V61A 4JHMA 5FS9A 3OZYA 2VQ7A 5LV9A 3AD8B 1O95A 3D1CA 3QTPA 3RRAA 5IPYA 4JNAA 2GMJA 2XGZA 2OG9A 3EPTA 4TVYA 3GRSA 4DN1A 1MNSA 3ES8A 2WHDA 2GDQA 4GGHA 2GSHA 1CC6A 2B9WA 2WDRA 2CDUA 2VVLA 1YY5A 1FFUC 1P2EA 3CNSA 3CPJG 4U2TA 2BACA 1GETA 4X9MA 1O94A 1PS9A 1FHUA 3CNJA 1B5QA 3NN0X 3NK2X 4B64A 2X8HA 2V3BA 1GRHA 4P9SA 1V97A 3P3BA 4IP5A 5KVIA 2EQ9A 3NKSA 1GERA 4GAPA 3T8QA 1JCTA 3DIPA 2OFJA 2PGEA 2C67A 4NZHA 4G73A 3ALLA 2YLTA 3CK5A 4A9WA 4JN8A 3JZUA 3EF6A 2ARDA 4NTDA 2YLXA 3AEBA 1KNRA 3SN1A 2QJJA 3SFEA 4OVIA 1XPQA 3UKQA 1E1KA 3RR1A 2ZZBA 3V5CA 4FDCB 2QJNA 1KSSA 2YM2A 3CXOA 1FFVC 1NENA 3N4FA 1X2HA 4JY3A 2IVDA 2OVLA 1CBOA 3SYIA 1N62C 3AE4A 3ZLFA 5KMSA 3UP4A 3FIMB 5KNLA 4DGKA 1OEPA 5EU9A 3RHAA 3DG7A 4YSXA 4Y4LA 5KMRA 1GNDA 4II2A 3ITJA 2FJAA 3GC2A 1FEBA 3HYVA 2WBAA 1KDGA 1L9CA 2Q6UA 1Q1WA 3CGDA 2BC0A 3UGVA 4F4RA 2RGHA 1STZA 1H84A 1KCZA 2C73A 3ZDNA 5J04A 1N5WC 1D7YA 1ZK7A 1E6EA 1GTHA 4HCDA 4D04A 3DMEA 3NK1X 2C65A 3PVCA 4B65A 1N4UA 4IHCA 1TRBA 1TE6A 3IJIA 1EL7A 3D46A 3MSYA 4Z1YA 3UCLA 3DJEA 1FEAA 2A8XA 4IP4A 1GREA 4FX9A 1PXCA 2C4CA 2R0GA 3ES7A 3C4AA 4K2XA 2P8BA 1GRGA 3IHMA 1GXFA 1JNRA 1TDKA 1K0JA 4II3A 3GWFA 1IUTA 2Z5YA 5BOFA 4X2PA 4U8OA 2V6OA 2Z5XA 3L1RA 3JSKA 3CB3A 2F5ZA 4C3XA 3NVZB 2VQBA 2APGA 3SFDA 4M52A 1JOAA 3SZWA 2BA9A 2YR5A 3SGLA 3UJRA 4EQWA 3FVDA 4Z25A 3DEQA 1KFYA 2WOWA 3GD6A 2ZZCA 3CNPA 4MGGA 4G6GA 1DTNA 3NGCX 1CJ4A 3NVYB 1KNPA 2Q0KA 5KMPA 4GAVA 1KN0A 1TZZA 4IVMB 2YVFA 4H7UA 2AL2B 2WOIA 4H4SA 3K7QX 2WPFA 5HYMA 3GDPA 2POZA 4A7AA 3T14A 2YG3A 3QSEA 1YQZA 4IL0A 3I6TA 2YWLA 1E39A 2YLWA 5GRTA 5IQ1A 3DGZA 1L8PA 3KLJA 5FJOA 1QLBA 1NEKA 1LJ1A 3RGTA 3RP8A 2W0HA 4M6UA 3EAOA 7ENLA 4GCMA 2XLSA 2DW6A 3K1GA 3K7MX 1NHQA 1K0LA 3CIRA 2GR1A 4H83A 2PA6A 1PJ5A 4H2NA 5HY5A 4GDPA 5KWFA 4K7ZA 3LZWA 1K0IA 2GR2A 3OZMA 2GAHB 1OJTA 1DJNA 4A3RA 3HYWA 1N1PA 2BABA 3VRAA 2XLRA 2ZZ0A 2WS3A 1MDLA 2BCPA 1SJDA 4J57A 1JRZA 2R0PA 3HW2A 1AOGA 3NYCA 2MUCA 4NEWA 3Q9TA 4O5UA 3I6DA 1YEYA 1JU2A 2R9ZA 1JEHA 4IV9A 2XFPA 4J33A 3CGBA 4ZA0A 4ICYA 3IJQA 4LIIA 4A79A 4E5TA 2GF3A 2OAMA 3D9XA 3VDGA 5CQFA 1NU5A 4JDRA 4ADWA 4H1ZA 4EQRA 4GGBA 4G74A 3REDA 1BZLA 3NIXA 3SZCA 3B6DA 3O0HA 3T9PA 1PBEA 3NLCA 1RM6B 1FO4A 4YTPA 5U63A 3D8XA 1LTXR 2UZZA 2B9XA 4A6NA 4AP1A 5KOWA 3UP5A 1JRXA 1FL2A 2XLTA 4JY2A 3UKHA 1VQWA 3NVWB 4KPRA 1CC2A 4E6MA 1K4QA 5G5HB 2AQJA 3Q45A 5FJUA 2GVCA 4J3ZA 2GAGB 4IVOB 1NG4A 3JW7A 3SN0A 2NVKX 3TQPA 3NXLA 1GALA 4KPLA 1P2HA 4B66A 4JN7A 2YR4A 2YVJA 3C4NA 1E1NA 4TVWA 3TW9A 2WU2A 3A7RA 1VDCA 1X31B 1S3EA 2OLOA 3SN4A 4J31A 2E5AA 3DJGX 2R4JA 2GGEA 3ABVA 3SX6A 3ALJA 4YSHA 1GV4A 1UKVG 3S61A 2BCGG 1BKHA 3OTRA 4A99A 3ATQA 3IF9A 1PDHA 1PBDA 4EIPA 4H2PA 2HNEA 4U8JA 2GMHA 5GSNA 1NHPA 4RSLA 3CN8A 3BSMA 5EB4A 3CNTA 1R6WA 1S2QA 2P88A 1NHRA 3UTGA 3CGEA 1IUWA 1TDEA 1DOCA 2ONEA 2GL5A 5IQ4A 3QLDA 3GYIA 1OJCA 3GO2A 4OPTA 4YT0A 4H4WA 3TJIA 1BWCA 4CNKA 2PTWA 4USQA 3S5WA 3EANA 5C3JA 3B9JB 3AD7B 4XWZA 3H8AA 3NYFA 1EBHA 2XDOA 3B3RA 2BS4A 4H4ZA 1MOKA 2ACZA 4U8MA 3QJ4A 3UOXA 5U25A 1H2IA 3AXBA 2CFYA 3BNMA 3ZYXA 2VOUA 1PXAA 4ZCWA 1EC8A 3KPFA 1Y0PA 2H88A 3CPIG 2WPEA 1LVLA 2B9YA 2XYOA 3TWAA 4UP3A 4YWSA 2OQHA 3U4FA 1E1MA 2WOVA 2WQYA 1VRQB 3V3NA 3NH3X 5CKUA 4E4UA 2OZ3A 2OZTA 3UCDA 2GGJA 3AEDA 4D03A 1ZOYA 2VVMA 1ELIA 2PODA 1YKJA 3CNDA 2EQ7A 4OPDA 1S7MA 2XSXA 3UKPA 3UJEA 4U8IA 4J56A 1JPDX 1KKOA 1Q9IA 4NEVA 1E1LA 3PK7A 2QAEA 3EEZA 4TM3A 3S5SA 5BOEA 4HNCA 5M10A 3FMWA 1D7LA 1BQGA 4PAAA 2V5ZA 5FS6A 2WP9A 3AB1A 3P1WA 3UXKA 1COYA 3VQRA 3GMBA 5BVAA 4HCLA 2HXUA 2BXSA 1CC4A 3DERA 2OLAA 4H2RA 1GRBA 2HZGA 2DKHA 4NTEA 2PMQA 3MUCA 1B8SA 2PPGA 4YSZA 1KD0A 3NO1A 2Y6QA 1LPFA 3KPKA 4NTCA 1LQUA 4DXKA 4CBQA 4K22A 1YQ4A 4Z43A 2ZADA 2BK5A 3UTHA 1B37A 4GDEA 3T2KA 4AP3A 1R0MA 4DYEA 2GGHA 4H19A 3G5SA 4G8TA 1IUUA 1VDVA 3CT2A 2QVHA 1H7XA 1ELSA 3AE5A 4U8PA 5BRTA 1F8WA 2B7RA 3CGCA 4FK1C 2C7GA 1SB3B 2C70A 2QDDA 3HZLA 2BRAA 4EQXA 1N4VA 4H4RA 4IL2A 2CULA 2OZ8A 2JK6A 3ICTA 4DSGA 3H7VA 1IUVA 3T2ZA 6ENLA 2X3NA 2OPJA 3AYIA 4HN8A 3N6HA 5FJTA 4X4JA 3V5FA 3UKFA 2XFQA 2I5QA 2C66A 1Z6LA 3STPA 2CVJA 4RG4A 3V76A 2WESA 4J36A 3QPEA 3QN3A 5JCIA 3H12A 3I6EA 4IT1A 4H4TA 3R0KA 4GUVA 3AMZA 3AEGA 3K30A 3AD9B 3V4BA 1GRFA 4EMWA 3H70A 1F8RA 2XFOA 1OJ9A 2XFUA 2C3DA 4UDRA 1ONEA 1EL9A 3M0OA 2VRMA 3TTEA 3M13A 3G5RA 5JCNA 4GMEA 2WU5A 4U8LA 3FYYA 3RNMA 1VG9A 2TMDA 1DJQA 4BJZA 5C2TA 3T37A 4JN9A 1NELA 2PU1A 3BI4A 3NNEA 3AE6A 1GEUA 4BJYA 1X2GA 2AR8A 3FXGA 4GISA 3G5QA 5BULA 1BF3A 3SQSA 4AOXA 2W3RA 3E1TA 3ETRB 1TYPA 4BV6A 3ZLHA 1IYXA 3DESA 5JCLA 2TPRA 3UJFA 3AE3A 3NFUA 1ZOVA 2XVHA 3L5OA 2C72A 5EBKA 2YR6A 2XH2A 3FV9A 2P3ZA 5KMQA 3LJPA 3DH9A 1GT8A 2GQFA 4OPCA 3DFYA 4FK1A 4EMIA 4M0XA 4FI4A 3QFBA 3OZ2A 4NNJA 2QA1A 1D4EA 3P93A 1OJDA 5G5GB 2FJDA 2AL2A 3T4WA 4ZN0A 4A35A 3AE9A 3OPSA 2VVLG 3NRZB 3Q6JA 4MKSA 2YLSA 4MMWA 4U2LA 2GGGA 4YSYA 3MWCA 2E5VA 2RGJA 3SXIA 3VCNA 3LZXA 4A6NB 1GESA 4K8DA 1NG3A 3JVAA 4H2HA 3T6CA 5U1OA 3TWBA 3NRNA 1KF6A 2Y6RA 1DXLA 3CXBA 1JPMA 2X50A 2RABA 1EC7A 4USRA 4Z26A 1RYIA 3NT6A 2R4EA 3AECA 2QQ6A 4B68A 5M0ZA 4FP1A 3DG6A 3C96A 3R9UA 4KX6A 1NPXA 1RVKA 1DOBA 3FJ4A 2PTXA 1GRTA 3KD9A 5EB5A 3GD3A 4ROPA 1M64A 2GQWA 3VCCA 2WP6A 1NDAA 4Y4MA 3CMMA 3ZVHA 3T2YA 4OPIA 4J1OA 3NS1B 4EM4A 3S47A 4GR1A 3IJLA 2BK3A 2XH4A 3ALMA 3NTAA 3DA1A 1FHVA 2X99A 1H7WA 3R0UA 2PTYA 3DJDA 3R11A 4REKA 4K5RA 3AWIA 2HXTA 1FIQB 3PWGA 4N9XA 1F3PA 2XVFA 3P9UA 3QSSA 4AT2A 3GMCA 4K1WA 2PS2A 4TLZA 3BI5A 4CY8A 3Q4DA 4ZOHB 2YQUA 3VFCA 1NAAA 4KWSA 2OX4A 3QSMA 4X9NA 1KSUA 2JAEA 4G9KA 2YLRA 2BC1A 4OCGA 1H6VA 2EQ6A 4C74A 2GV8A 1Y56A 3U9IA 5HHFA 1WUEA 5FJRA 1TKKA 2DW7A 1PBBA 1S2YA 1IUSA 1FECA 1TDFA 2B7SA 4YTNA 4H4VA 3SM8A 2WPCA 3PFRA 2Q7VA 1SJCA 3NZGA 2AKZA 1XANA 4E4FA 4I58A 4GRTA 4DNAA 2C75A 1GOSA 5FS8A 1JRPA 4GF7A 4YXDA 4H4YA 2WDQA 4JQ9A 2PP3A 4CNJA 4K5SA 3AM9A 1S3BA 2V3AA 3AYJA 2XLPA 2OO6A 3T31A 1FOHA 1E9IA 3DK9A 2PP0A 3QVRA 1D5TA 2ZC8A 4ECHA 2FJBA 2BRYA 3M12A 3WE0A 1ZMDA 1H82A 4XXGA 3ADAB 1PBCA 4UDQA 3SBFA 4BK2A 2NQLA 2XH0A 2C3CA 2IVEA 3F8PA 2YAUA 2PTZA 5FJPA 1H86A 2P0IA 3DGHA 4ZCDA 2A89A 1SJBA 4LA1A 2W55A 2XLUA 4H4XA 4UDPA 4Z2RA 3A7UA 1ZXIC 1QJDA 2C64A 4YTMA 4HPNA 3VR9A 2FJEA 1DOEA 1BKWA 2XVEA
chains in the Genus database with same CATH topology
3I6DA 4H4TA 2OALA 1JU2A 1D4DA 2R9ZA 3LXDA 1JEHA 2E4GA 2ZBWA 2RGOA 3AE2A 4GUVA 4H4QA 4IV9A 2XFPA 4EM3A 3KVEA 3UTEA 4J33A 3IC9A 2YLZA 3AEGA 3CGBA 4TLXA 2R45A 3K30A 3AD9B 4B67A 1GRFA 3DJJA 4EMWA 4ICYA 1CHUA 1F8RA 4CY6A 4I59A 2XFOA 4LIIA 5KVHA 1OJ9A 2XFUA 1ZDLA 2C3DA 3NK0X 4A79A 2JBVA 4LU6A 4UDRA 2GF3A 1EL9A 4O5QA 4OPLA 1EL8A 2OAMA 3D9XA 3M0OA 2VRMA 1W4XA 3LB8A 5CQFA 5EOWA 1CJ2A 3M13A 1TDOA 4JDRA 1MXTA 4ADWA 4ZCCA 3F8RA 5KRQA 3G5RA 5JCNA 4CCQA 4YWOA 2WU5A 2XFNA 4U8LA 5HXIA 4EQRA 2R46A 4Y4NA 3RNMA 1VG9A 2I0ZA 3AYLA 4G74A 4NWZA 3REDA 2TMDA 1V59A 4DSHA 1BZLA 1H83A 2JB2A 4J34A 1DJQA 2XVIA 3NIXA 4Z2UA 1JNZA 4BJZA 5J60A 4JNQA 1E7PA 1ONFA 3B6DA 3H8IA 3IHGA 3K7TA 3SZCA 1EBDA 1MO9A 1F8SA 3BHKA 4Z24A 5C2TA 3O0HA 3UOZA 1ZX9A 3T37A 1PBEA 3NLCA 4JN9A 4CRTA 2GRTA 2BS3A 4YTPA 1CJ3A 4U8NA 5U63A 3P4QA 3BI4A 3D8XA 4U8KA 1LQTA 1LTXR 3NNEA 5ER0A 3GYXA 3AE6A 1GEUA 2X8CA 4BJYA 5FMHA 2AR8A 2V61A 2UZZA 3CPHG 4CCRA 2B9XA 4A6NA 5JRBA 4AP1A 3UOYA 5KOWA 3G5QA 3UP5A 5BULA 1JRXA 1JRYA 1FL2A 3UKAA 2XLTA 4JY2A 1BF3A 5FS9A 3NN6X 4MJWA 4AOXA 2VQ7A 1PBFA 3QVPA 3AD8B 3BNUA 1VQWA 3UKHA 4KPRA 5LV9A 1O95A 3E1TA 1Q1RA 1CC2A 1TYPA 4BV6A 1K4QA 3D1CA 4C3YA 5JCLA 5IPYA 2TPRA 2AQJA 2V60A 4JNAA 2GMJA 3GRTA 2GVCA 2R0CA 3BHFA 3AE3A 2GAGB 4IVOB 1NG4A 2PYXA 3EPTA 2NVKX 5DBJA 2NPXA 1ZOVA 1GALA 1P2HA 2XVHA 3GRSA 3L5OA 4B66A 2C72A 2WHDA 3II4A 2YR4A 2YVJA 2YG5A 5EBKA 2YR6A 2WEUA 3C4NA 4BK1A 3QFAA 1E1NA 5KXJA 1CC6A 2B9WA 5KMQA 3LJPA 3DH9A 1GT8A 4EMJA 2GQFA 2WDRA 4OPCA 1QO8A 1EL5A 4EMIA 4FK1A 4YKFA 2CDUA 2VVLA 3QFBA 1YY5A 3OZ2A 2WU2A 4NNJA 1P2EA 1ZMCA 2QA1A 3CNSA 3CPJG 4U2TA 1VDCA 2BACA 1X31B 1GETA 1D4EA 4X9MA 1S3EA 1OJDA 4WX1A 1TDNA 2FJDA 2OLOA 4EQSA 4J31A 3DJGX 3P4RA 1O94A 1PS9A 3RP6A 4ZN0A 2YM1A 2R4JA 3CNJA 3ABVA 1B5QA 3SX6A 3NN0X 3ALJA 3NK2X 4YSHA 1GV4A 1UKVG 3AE9A 3S61A 2BCGG 2X8HA 4B64A 2V3BA 1GRHA 3NTDA 4P9SA 1ZP0A 2YG4A 5FS7A 2VVLG 4A99A 3ATQA 2YLSA 3Q6JA 3IF9A 1PDHA 1PBDA 5KVIA 4EIPA 2EQ9A 4U2LA 3NKSA 4C77A 4H2PA 1GERA 4GAPA 4U8JA 5L46A 2GMHA 3ATRA 5GSNA 1NHPA 4RSLA 4YSYA 3CN8A 2C67A 4NZHA 5EB4A 2X8GA 3CNTA 1S2QA 4G73A 2E5VA 2RGJA 2YLTA 3ALLA 2BXRA 2JB1A 3SXIA 3T0KA 2DKIA 4A9WA 3LZXA 1NHRA 3UTGA 4A6NB 4WCTA 1GESA 3CGEA 4K8DA 4Z2TA 1IUWA 1TDEA 3EF6A 2ARDA 3VRDB 1NG3A 1DNCA 1DOCA 2IIDA 4NTDA 4OPUA 2YLXA 5U1OA 5IQ4A 3AEBA 1KNRA 3GYIA 1OJCA 4B69A 5J7XA 1REOA 4OPTA 1LV0A 3SFEA 4YKGA 3NRNA 4YT0A 1KF6A 4H4WA 1BWCA 4CNKA 2Y6RA 4OVIA 4TM4A 1XPQA 4EIQA 1DXLA 3UKQA 1E1KA 4USQA 2X50A 4H50A 1F6MA 2RABA 2ZZBA 3KU9A 4USRA 2H89A 1ZY8A 3S5WA 4FDCB 4Z26A 1RYIA 3EANA 3NT6A 2GR0A 5C3JA 2R4EA 2XVJA 3AECA 1KSSA 1PJ7A 1GSNA 2YM2A 4XWRA 3H4KA 3AD7B 4IA5A 3COXA 5M0ZA 4XWZA 3C96A 3ISHA 3NYFA 3R9UA 4KX6A 1NPXA 1L9EA 1NENA 4OPGA 3GYJA 1YQ3A 2XDOA 1DOBA 3B3RA 4U2SA 3SZ0A 2BS4A 4H4ZA 1GRTA 3LOVA 4JY3A 3KD9A 5EB5A 4AOSA 3GD3A 3URHA 2WDVA 2IVDA 1MOKA 2HQMA 1CBOA 3SYIA 2GR3A 3AE4A 2ACZA 4U8MA 3QJ4A 3UOXA 5U25A 5KMSA 1H2IA 1M64A 3AXBA 2GQWA 2CFYA 3UP4A 2OLNA 3BNMA 3ZYXA 2JB3A 1IJHA 2VOUA 3FIMB 1PXAA 3FBSA 4B63A 2WP6A 5KNLA 4DGKA 1NDAA 2BYBA 4Y4MA 1GRAA 3CMMA 3T2YA 3RHAA 1DODA 1O5WA 4OPIA 4EM4A 3KPFA 1Y0PA 2H88A 4GR1A 3AE7A 3HYXA 4BK3A 4Y4LA 4YSXA 5KMRA 2BK3A 1GNDA 4II2A 3ITJA 4BURA 2FJAA 3HYVA 1FEBA 2WBAA 1RP0A 3CPIG 2WPEA 1KDGA 1L9CA 1LVLA 2B9YA 3ALMA 2XYOA 3NTAA 2Q6UA 1Q1WA 3DA1A 4UP3A 3CGDA 2X99A 2BC0A 1H7WA 5TR3A 1M6IA 1E1MA 2WOVA 2WQYA 2E1MA 3RP7A 2RGHA 1VRQB 3V3NA 3F8DA 3NH3X 1BGNA 2A87A 3DJDA 1H84A 5CKUA 4TM0A 3SY4A 3UOVA 3AEDA 4REKA 4K5RA 2C73A 4D03A 3PS9A 3ZDNA 2YG6A 3AWIA 1ZOYA 2VVMA 1D7YA 1ZK7A 1PJ6A 1E6EA 1ELIA 1YKJA 3DK8A 1GTHA 3CNDA 3AEAA 3ICSA 1F3PA 4N9XA 4D04A 2GEWA 2EQ7A 2XVFA 4OPDA 3P9UA 3QSSA 4AT2A 1CF3A 1S7MA 3DMEA 3GMCA 3BI2A 3DK4A 3NK1X 3UKPA 4U8IA 4J56A 2C65A 3PVCA 4TLZA 3BI5A 4G6HA 4B65A 4CY8A 1Q9IA 2WP5A 1NHSA 4NEVA 1E1LA 1N4UA 1TRBA 1L9DA 2YG7A 3AE8A 3PO7A 2YQUA 2QAEA 1EL7A 1NAAA 1XDIA 4IA6A 4RG3A 1CJCA 4HB9A 3UCLA 3DJEA 1FEAA 2B76A 3QSMA 2A8XA 3NYEA 1D4CA 4TM3A 1GREA 4X9NA 5BUKA 4FX9A 1PXCA 2C4CA 2R0GA 2Q0LA 2XCGA 3C4AA 1KSUA 4K2XA 2JAEA 4TM1A 5M10A 1GRGA 3FMWA 1GXFA 3IHMA 1D7LA 4G9KA 1JNRA 3NHOX 4PAAA 1TDKA 1K0JA 2BC1A 2V5ZA 2YLRA 4OCGA 4II3A 5FS6A 1H6VA 1TYTA 2EQ6A 1FCDA 1PN0A 2WP9A 3GWFA 4Z44A 4C74A 2GV8A 3AB1A 2QCUA 3P1WA 1IUTA 1COYA 1Y56A 3VQRA 3GMBA 2Z5YA 4C5OA 5BVAA 2O9ZA 4B68A 5HHFA 2YVGA 4U8OA 2V6OA 2Z5XA 1OJAA 3L1RA 3GD4A 2BXSA 3JSKA 2PHHA 1CC4A 1PBBA 2F5ZA 1S2YA 2BS2A 1IUSA 3KA7A 4H2RA 1FECA 4C3XA 1GRBA 1TDFA 2APGA 2DKHA 2VQBA 3SFDA 4M52A 3V3OA 3I3LA 2B7SA 4YTNA 1JOAA 4H4VA 3SZWA 4NTEA 1CL0A 3FG2P 2BA9A 3SM8A 2WPCA 2YR5A 3SGLA 1B8SA 5JCKA 3PG6A 4EQWA 4YSZA 3VR8A 1XHCA 2Q7VA 3GDNA 1IUXA 2Y6QA 4Z25A 1LPFA 4PABA 1KFYA 3KPKA 4A5LA 3ICRA 4NTCA 1LQUA 4CBQA 2WOWA 4K22A 1YQ4A 4Z43A 2ZZCA 3CNPA 2JKCA 1XANA 3AE1A 4HA6A 4I58A 1SEZA 4H4PA 4GRTA 2BK5A 4G6GA 4DNAA 2C75A 1GOSA 3UTHA 3NGCX 1CJ4A 5FS8A 1KNPA 3SZFA 2Q0KA 1GPEA 1B37A 1PHHA 1VG0A 5JCMA 3AEEA 5KMPA 4GDEA 2OA1A 4GAVA 1KN0A 2VZ2A 3AEFA 4GF7A 4YXDA 2AAQA 4IVMB 3T2KA 4H4YA 2WDQA 4AP3A 2YVFA 2FBWA 4JQ9A 4A65A 3LADA 4H7UA 4CNJA 4K5SA 3VRBA 2WOIA 4H4SA 1S3BA 2V3AA 3AYJA 3G5SA 1IUUA 2WPFA 3K7QX 1B4VA 2XLPA 1BGJA 1H7XA 3T31A 5HYMA 3GDPA 1FOHA 4A7AA 3DK9A 3OC4A 3AE5A 4U8PA 3T14A 2YG3A 3QVRA 5BRTA 1F8WA 1YQZA 3QSEA 1D5TA 2YWLA 2B7RA 3CGCA 4FK1C 2C7GA 4B1BA 4ECHA 2C70A 3IWAA 1E39A 1HYUA 2BRAA 2YLWA 2FJBA 3HZLA 5GRTA 5IQ1A 3DGZA 4EQXA 1N4VA 2BRYA 4H4RA 3KLJA 3CTYA 3P4SA 3M12A 1QLBA 1NEKA 1ZKQA 1ZMDA 1LJ1A 3FPZA 3WE0A 1H82A 4XXGA 2W0HA 3RP8A 3ADAB 2CULA 1PBCA 2JK6A 3ICTA 2GB0A 3UKLA 4DSGA 3EAOA 3P4PA 4UDQA 1IUVA 4GCMA 4H2QA 3H8LA 2XLSA 4BK2A 1Y56B 4J2WA 3T2ZA 3KKJA 2C3CA 1RSGA 2IVEA 3F8PA 3K7MX 1NHQA 1K0LA 3CIRA 2GR1A 2YAUA 2X3NA 3AYIA 1PJ5A 1H86A 4H2NA 5HY5A 4GDPA 5KWFA 4K7ZA 3LZWA 1K0IA 3DGHA 2GR2A 4X4JA 2GAHB 1OJTA 2C76A 1DJNA 3UKFA 3HYWA 1N1PA 2XFQA 3UTFA 4AT0A 2BABA 3VRAA 2XLRA 4ZCDA 2C66A 1Z6LA 2ZZ0A 4H4UA 2A89A 3GWDA 4LA1A 3NG7X 2J3NA 2WS3A 3UKKA 2XLUA 2BCPA 4H4XA 2VRLA 4APNA 2CVJA 4RG4A 4UDPA 4Z2RA 5KOXA 3V76A 1H81A 4J57A 1JRZA 1QJDA 2C64A 2WESA 1PXBA 1N4WA 2R0PA 4J36A 4YTMA 1L0VA 2EQ8A 4E0VA 3L8KA 1AOGA 2WETA 5JCIA 3NYCA 3VR9A 1GTEA 2FJEA 3GSIA 2QA2A 4NEWA 3SQPA 2GH5A 1DOEA 2BK4A 1BKWA 3Q9TA 4O5UA 2XVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I6D A;  4H4T A;  2OAL A;  1JU2 A;  1D4D A;  2R9Z A;  3LXD A;  1JEH A;  2E4G A;  2ZBW A;  2RGO A;  3AE2 A;  4GUV A;  4H4Q A;  4IV9 A;  2XFP A;  4EM3 A;  3KVE A;  3UTE A;  4J33 A;  3IC9 A;  2YLZ A;  3AEG A;  3CGB A;  4TLX A;  2R45 A;  3K30 A;  3AD9 B;  4B67 A;  1GRF A;  3DJJ A;  4EMW A;  4ICY A;  1CHU A;  1F8R A;  4CY6 A;  4I59 A;  2XFO A;  4LII A;  5KVH A;  1OJ9 A;  2XFU A;  1ZDL A;  2C3D A;  3NK0 X;  4A79 A;  2JBV A;  4LU6 A;  4UDR A;  2GF3 A;  1EL9 A;  4O5Q A;  4OPL A;  1EL8 A;  2OAM A;  3M0O A;  2VRM A;  1W4X A;  3LB8 A;  5CQF A;  5EOW A;  1CJ2 A;  3M13 A;  1TDO A;  4JDR A;  1MXT A;  4ADW A;  4ZCC A;  3F8R A;  5KRQ A;  3G5R A;  5JCN A;  4CCQ A;  4YWO A;  2WU5 A;  2XFN A;  4U8L A;  5HXI A;  4EQR A;  2R46 A;  4Y4N A;  3RNM A;  1VG9 A;  2I0Z A;  3AYL A;  3RED A;  4DSH A;  2TMD A;  1V59 A;  1BZL A;  1H83 A;  2JB2 A;  4J34 A;  1DJQ A;  2XVI A;  3NIX A;  4Z2U A;  1JNZ A;  4BJZ A;  5J60 A;  4JNQ A;  1E7P A;  1ONF A;  3B6D A;  3H8I A;  3IHG A;  3K7T A;  1EBD A;  1MO9 A;  1F8S A;  3BHK A;  4Z24 A;  5C2T A;  3O0H A;  3UOZ A;  1ZX9 A;  3T37 A;  1PBE A;  3NLC A;  4JN9 A;  4CRT A;  2GRT A;  2BS3 A;  4YTP A;  1CJ3 A;  4U8N A;  5U63 A;  3P4Q A;  3BI4 A;  3D8X A;  4U8K A;  1LQT A;  1LTX R;  3NNE A;  5ER0 A;  3AE6 A;  1GEU A;  2X8C A;  4BJY A;  5FMH A;  2AR8 A;  2V61 A;  2UZZ A;  3CPH G;  4CCR A;  2B9X A;  4A6N A;  4AP1 A;  3UOY A;  5KOW A;  3G5Q A;  3UP5 A;  5BUL A;  1JRX A;  1JRY A;  1FL2 A;  3UKA A;  2XLT A;  4JY2 A;  1BF3 A;  5FS9 A;  3NN6 X;  4MJW A;  4AOX A;  2VQ7 A;  1PBF A;  3QVP A;  3AD8 B;  3BNU A;  1VQW A;  3UKH A;  4KPR A;  5LV9 A;  1O95 A;  3E1T A;  1Q1R A;  1CC2 A;  1TYP A;  4BV6 A;  1K4Q A;  3D1C A;  4C3Y A;  5JCL A;  5IPY A;  2TPR A;  2AQJ A;  2V60 A;  4JNA A;  2GMJ A;  3GRT A;  2GVC A;  2R0C A;  3BHF A;  3AE3 A;  2GAG B;  4IVO B;  1NG4 A;  2PYX A;  3EPT A;  2NVK X;  5DBJ A;  2NPX A;  1ZOV A;  1GAL A;  1P2H A;  2XVH A;  3GRS A;  4B66 A;  2C72 A;  2WHD A;  3II4 A;  2YR4 A;  2YVJ A;  2YG5 A;  5EBK A;  2YR6 A;  2WEU A;  3C4N A;  4BK1 A;  3QFA A;  1E1N A;  5KXJ A;  1CC6 A;  2B9W A;  3LJP A;  3DH9 A;  1GT8 A;  4EMJ A;  2GQF A;  2WDR A;  4OPC A;  1QO8 A;  1EL5 A;  4EMI A;  4FK1 A;  4YKF A;  2CDU A;  2VVL A;  3QFB A;  1YY5 A;  3OZ2 A;  2WU2 A;  1P2E A;  1ZMC A;  2QA1 A;  3CNS A;  3CPJ G;  4U2T A;  1VDC A;  2BAC A;  1X31 B;  1GET A;  1D4E A;  4X9M A;  1S3E A;  1OJD A;  4WX1 A;  1TDN A;  2FJD A;  2OLO A;  4EQS A;  4J31 A;  3DJG X;  3P4R A;  1O94 A;  1PS9 A;  3RP6 A;  4ZN0 A;  2YM1 A;  2R4J A;  3CNJ A;  3ABV A;  1B5Q A;  3NN0 X;  3ALJ A;  3NK2 X;  4YSH A;  1GV4 A;  1UKV G;  3AE9 A;  3S61 A;  2BCG G;  2X8H A;  4B64 A;  2V3B A;  1GRH A;  3NTD A;  4P9S A;  1ZP0 A;  2YG4 A;  5FS7 A;  2VVL G;  4A99 A;  3ATQ A;  2YLS A;  3Q6J A;  3IF9 A;  1PDH A;  1PBD A;  5KVI A;  4EIP A;  2EQ9 A;  4U2L A;  3NKS A;  4C77 A;  4H2P A;  1GER A;  4U8J A;  5L46 A;  2GMH A;  3ATR A;  5GSN A;  1NHP A;  4RSL A;  4YSY A;  3CN8 A;  2C67 A;  4NZH A;  5EB4 A;  2X8G A;  3CNT A;  1S2Q A;  2E5V A;  2RGJ A;  2YLT A;  3ALL A;  2BXR A;  2JB1 A;  2DKI A;  4A9W A;  3LZX A;  1NHR A;  3UTG A;  4A6N B;  4WCT A;  1GES A;  3CGE A;  4K8D A;  4Z2T A;  1IUW A;  1TDE A;  3EF6 A;  2ARD A;  3VRD B;  1NG3 A;  1DNC A;  1DOC A;  2IID A;  4NTD A;  4OPU A;  2YLX A;  5U1O A;  5IQ4 A;  3AEB A;  1KNR A;  3GYI A;  1OJC A;  4B69 A;  5J7X A;  1REO A;  4OPT A;  1LV0 A;  3SFE A;  4YKG A;  3NRN A;  4YT0 A;  1KF6 A;  4H4W A;  1BWC A;  4CNK A;  2Y6R A;  4OVI A;  4TM4 A;  1XPQ A;  4EIQ A;  1DXL A;  3UKQ A;  1E1K A;  4USQ A;  2X50 A;  4H50 A;  1F6M A;  2RAB A;  2ZZB A;  3KU9 A;  4USR A;  2H89 A;  1ZY8 A;  3S5W A;  4FDC B;  4Z26 A;  1RYI A;  3EAN A;  3NT6 A;  2GR0 A;  5C3J A;  2R4E A;  2XVJ A;  3AEC A;  1KSS A;  1PJ7 A;  1GSN A;  2YM2 A;  4XWR A;  3H4K A;  3AD7 B;  4IA5 A;  3COX A;  5M0Z A;  4XWZ A;  3C96 A;  3ISH A;  3NYF A;  3R9U A;  4KX6 A;  1NPX A;  1L9E A;  1NEN A;  4OPG A;  3GYJ A;  1YQ3 A;  2XDO A;  1DOB A;  3B3R A;  4U2S A;  2BS4 A;  4H4Z A;  1GRT A;  3LOV A;  4JY3 A;  3KD9 A;  5EB5 A;  4AOS A;  3GD3 A;  3URH A;  2WDV A;  2IVD A;  1MOK A;  2HQM A;  1CBO A;  2GR3 A;  3AE4 A;  2ACZ A;  4U8M A;  3QJ4 A;  3UOX A;  5U25 A;  1M64 A;  3AXB A;  2GQW A;  2CFY A;  3UP4 A;  2OLN A;  3BNM A;  3ZYX A;  2JB3 A;  1IJH A;  2VOU A;  3FIM B;  1PXA A;  3FBS A;  4B63 A;  2WP6 A;  4DGK A;  1NDA A;  2BYB A;  4Y4M A;  1GRA A;  3RHA A;  1DOD A;  1O5W A;  4OPI A;  4EM4 A;  3KPF A;  1Y0P A;  2H88 A;  4GR1 A;  3AE7 A;  4BK3 A;  4YSX A;  4Y4L A;  2BK3 A;  1GND A;  3ITJ A;  4BUR A;  2FJA A;  1FEB A;  2WBA A;  1RP0 A;  3CPI G;  2WPE A;  1KDG A;  1L9C A;  1LVL A;  2B9Y A;  3ALM A;  2XYO A;  3NTA A;  2Q6U A;  1Q1W A;  3DA1 A;  4UP3 A;  3CGD A;  2X99 A;  2BC0 A;  1H7W A;  5TR3 A;  1M6I A;  1E1M A;  2WOV A;  2WQY A;  2E1M A;  3RP7 A;  2RGH A;  1VRQ B;  3V3N A;  3F8D A;  3NH3 X;  1BGN A;  2A87 A;  3DJD A;  1H84 A;  5CKU A;  4TM0 A;  3UOV A;  3AED A;  4REK A;  4K5R A;  2C73 A;  4D03 A;  3PS9 A;  3ZDN A;  2YG6 A;  3AWI A;  1ZOY A;  2VVM A;  1D7Y A;  1ZK7 A;  1PJ6 A;  1E6E A;  1ELI A;  1YKJ A;  3DK8 A;  1GTH A;  3CND A;  3AEA A;  3ICS A;  1F3P A;  4N9X A;  4D04 A;  2GEW A;  2EQ7 A;  2XVF A;  4OPD A;  3P9U A;  3QSS A;  4AT2 A;  1CF3 A;  3DME A;  3GMC A;  3BI2 A;  3DK4 A;  3NK1 X;  3UKP A;  4U8I A;  4J56 A;  2C65 A;  3PVC A;  4TLZ A;  3BI5 A;  4B65 A;  4CY8 A;  1Q9I A;  2WP5 A;  1NHS A;  4NEV A;  1E1L A;  1N4U A;  1TRB A;  1L9D A;  2YG7 A;  3AE8 A;  3PO7 A;  2YQU A;  2QAE A;  1EL7 A;  1NAA A;  1XDI A;  4IA6 A;  4RG3 A;  1CJC A;  4HB9 A;  3UCL A;  3DJE A;  1FEA A;  2B76 A;  3QSM A;  2A8X A;  3NYE A;  1D4C A;  4TM3 A;  1GRE A;  4X9N A;  5BUK A;  4FX9 A;  1PXC A;  2R0G A;  2Q0L A;  2XCG A;  3C4A A;  1KSU A;  4K2X A;  2JAE A;  4TM1 A;  5M10 A;  1GRG A;  3FMW A;  1GXF A;  3IHM A;  1D7L A;  1JNR A;  3NHO X;  4PAA A;  1TDK A;  1K0J A;  2BC1 A;  2V5Z A;  2YLR A;  4OCG A;  5FS6 A;  1H6V A;  1TYT A;  2EQ6 A;  1FCD A;  1PN0 A;  2WP9 A;  3GWF A;  4Z44 A;  4C74 A;  2GV8 A;  3AB1 A;  2QCU A;  3P1W A;  1IUT A;  1COY A;  1Y56 A;  3VQR A;  3GMB A;  2Z5Y A;  4C5O A;  5BVA A;  2O9Z A;  4B68 A;  5HHF A;  2YVG A;  4U8O A;  2V6O A;  2Z5X A;  1OJA A;  3L1R A;  3GD4 A;  2BXS A;  3JSK A;  2PHH A;  1CC4 A;  1PBB A;  2F5Z A;  1S2Y A;  2BS2 A;  1IUS A;  3KA7 A;  4H2R A;  1FEC A;  4C3X A;  1GRB A;  1TDF A;  2APG A;  2DKH A;  2VQB A;  3SFD A;  4M52 A;  3V3O A;  3I3L A;  2B7S A;  4YTN A;  1JOA A;  4H4V A;  4NTE A;  1CL0 A;  3FG2 P;  2BA9 A;  3SM8 A;  2WPC A;  2YR5 A;  3SGL A;  1B8S A;  5JCK A;  4EQW A;  4YSZ A;  3VR8 A;  1XHC A;  2Q7V A;  3GDN A;  1IUX A;  2Y6Q A;  4Z25 A;  1LPF A;  4PAB A;  1KFY A;  4A5L A;  3ICR A;  4NTC A;  1LQU A;  4CBQ A;  2WOW A;  4K22 A;  1YQ4 A;  4Z43 A;  2ZZC A;  3CNP A;  2JKC A;  1XAN A;  3AE1 A;  4HA6 A;  4I58 A;  1SEZ A;  4H4P A;  4GRT A;  2BK5 A;  4DNA A;  2C75 A;  1GOS A;  3UTH A;  3NGC X;  1CJ4 A;  5FS8 A;  1KNP A;  2Q0K A;  1GPE A;  1B37 A;  1PHH A;  1VG0 A;  5JCM A;  3AEE A;  4GDE A;  2OA1 A;  2VZ2 A;  3AEF A;  4GF7 A;  4YXD A;  2AAQ A;  4IVM B;  4AP3 A;  4H4Y A;  2WDQ A;  2YVF A;  2FBW A;  4JQ9 A;  4A65 A;  3LAD A;  4H7U A;  4CNJ A;  4K5S A;  3VRB A;  2WOI A;  4H4S A;  1S3B A;  2V3A A;  3AYJ A;  3G5S A;  1IUU A;  2WPF A;  3K7Q X;  1B4V A;  2XLP A;  1BGJ A;  1H7X A;  5HYM A;  3GDP A;  1FOH A;  4A7A A;  3DK9 A;  3OC4 A;  3AE5 A;  4U8P A;  2YG3 A;  3QVR A;  5BRT A;  1F8W A;  1YQZ A;  3QSE A;  1D5T A;  2YWL A;  2B7R A;  3CGC A;  4FK1 C;  2C7G A;  4B1B A;  4ECH A;  2C70 A;  3IWA A;  1E39 A;  1HYU A;  2YLW A;  3HZL A;  2FJB A;  5GRT A;  5IQ1 A;  3DGZ A;  4EQX A;  1N4V A;  3CTY A;  4H4R A;  3KLJ A;  3P4S A;  3M12 A;  1QLB A;  1NEK A;  1ZKQ A;  1ZMD A;  1LJ1 A;  3FPZ A;  3WE0 A;  1H82 A;  4XXG A;  2W0H A;  3RP8 A;  3ADA B;  2CUL A;  1PBC A;  2JK6 A;  3ICT A;  2GB0 A;  3UKL A;  4DSG A;  3EAO A;  3P4P A;  4UDQ A;  1IUV A;  4GCM A;  4H2Q A;  3H8L A;  2XLS A;  4BK2 A;  1Y56 B;  4J2W A;  3KKJ A;  2C3C A;  1RSG A;  2IVE A;  3F8P A;  3K7M X;  1NHQ A;  1K0L A;  3CIR A;  2GR1 A;  2YAU A;  2X3N A;  3AYI A;  1PJ5 A;  1H86 A;  4H2N A;  5HY5 A;  4GDP A;  5KWF A;  4K7Z A;  3LZW A;  1K0I A;  3DGH A;  2GR2 A;  4X4J A;  2GAH B;  1OJT A;  2C76 A;  1DJN A;  3UKF A;  1N1P A;  2XFQ A;  3UTF A;  4AT0 A;  2BAB A;  3VRA A;  2XLR A;  4ZCD A;  2C66 A;  1Z6L A;  2ZZ0 A;  4H4U A;  2A89 A;  3GWD A;  4LA1 A;  3NG7 X;  2J3N A;  2WS3 A;  3UKK A;  2XLU A;  2BCP A;  4H4X A;  2VRL A;  4APN A;  2CVJ A;  4RG4 A;  4UDP A;  4Z2R A;  5KOX A;  3V76 A;  1H81 A;  4J57 A;  1JRZ A;  1QJD A;  2C64 A;  2WES A;  1PXB A;  1N4W A;  2R0P A;  4J36 A;  4YTM A;  1L0V A;  2EQ8 A;  4E0V A;  3L8K A;  1AOG A;  2WET A;  5JCI A;  3NYC A;  3VR9 A;  1GTE A;  2FJE A;  3GSI A;  2QA2 A;  4NEW A;  3SQP A;  2GH5 A;  1DOE A;  2BK4 A;  1BKW A;  3Q9T A;  4O5U A;  2XVE A; 
#chains in the Genus database with same CATH topology
 1D4D A;  2E4G A;  2ZBW A;  1XPY A;  4H4Q A;  4EM3 A;  3IC9 A;  1MDR A;  3CAW A;  1N60 C;  1VQZ A;  3VC6 A;  3DJJ A;  4CY6 A;  1CHU A;  1ZDL A;  3NK0 X;  4O5Q A;  1EL8 A;  3IK4 A;  4Z17 A;  2E3T A;  1MXT A;  3NVV B;  5KRQ A;  4YWO A;  2XFN A;  3ZLG A;  2R46 A;  4Y4N A;  4NWZ A;  2I0Z A;  4DSH A;  1V59 A;  1H83 A;  2RDX A;  2JB2 A;  4J34 A;  1JNZ A;  5J60 A;  3EKG A;  1ONF A;  1E7P A;  3IHG A;  2CHR A;  3THU A;  1MUC A;  1ZX9 A;  2GRT A;  2BS3 A;  4U8N A;  3P4Q A;  4U8K A;  5ER0 A;  2QGY A;  5FMH A;  4CCR A;  3CPH G;  5JRB A;  3UOY A;  3TOY A;  1JRY A;  2W3S A;  3UKA A;  3NN6 X;  4MJW A;  1PBF A;  3QVP A;  3BNU A;  3D47 A;  1Q1R A;  4HCH A;  2W54 A;  3TJ4 A;  4C3Y A;  2V60 A;  1PDY A;  3GRT A;  2R0C A;  3BHF A;  2PYX A;  3DFH A;  3SJN A;  2MNR A;  5DBJ A;  2NPX A;  3R1Z A;  1P48 A;  1SJA A;  3II4 A;  2XH7 A;  2YG5 A;  2WEU A;  4BK1 A;  3QFA A;  5KXJ A;  2FYM A;  4EMJ A;  1QO8 A;  2O56 A;  1EL5 A;  4YKF A;  3QKE A;  1ZMC A;  3UCC A;  3UJ2 A;  4G7F A;  4WX1 A;  1TDN A;  4EQS A;  3P4R A;  3RP6 A;  2YM1 A;  3NTD A;  1ZP0 A;  2YG4 A;  2PCE A;  5FS7 A;  3B97 A;  4C77 A;  5L46 A;  3ATR A;  2AKM A;  2X8G A;  1WUF A;  3DGB A;  3GY1 A;  2BXR A;  2JB1 A;  1PDZ A;  3T0K A;  2DKI A;  4WCT A;  4Z2T A;  3VRD B;  2IID A;  1DNC A;  4OPU A;  3R25 A;  4GIR A;  1EC9 A;  4B69 A;  5J7X A;  1REO A;  1LV0 A;  3CYJ A;  4YKG A;  2QJM A;  4TM4 A;  4EIQ A;  3N4E A;  4H50 A;  1F6M A;  3KUM A;  3KU9 A;  2H89 A;  1ZY8 A;  1N63 C;  2GR0 A;  2XVJ A;  3HRD C;  1PJ7 A;  1GSN A;  4XWR A;  3H4K A;  4IA5 A;  3COX A;  3ISH A;  1L9E A;  4OPG A;  3GYJ A;  1YQ3 A;  4U2S A;  3SZ0 A;  2OQY A;  3LOV A;  4AOS A;  3URH A;  2WDV A;  2HQM A;  2GR3 A;  2AL1 A;  4HYR A;  3DDM A;  2OLN A;  2JB3 A;  1IJH A;  4B63 A;  3FBS A;  1T3Q C;  3MY9 A;  3SR6 B;  3R07 C;  2BYB A;  1GRA A;  1DOD A;  1O5W A;  3PWI A;  3AE7 A;  3HYX A;  4BK3 A;  4BUR A;  1RP0 A;  3VA8 A;  3A7A A;  5TR3 A;  1M6I A;  2E1M A;  4E8G A;  3RP7 A;  3F8D A;  4KEM A;  1BGN A;  2A87 A;  1N61 C;  4TM0 A;  3SY4 A;  3OW1 A;  3UOV A;  3PS9 A;  2YG6 A;  1PJ6 A;  3RO6 A;  2PSN A;  1JDF A;  4GYP C;  3DK8 A;  3ICS A;  3AEA A;  2GEW A;  4DWD A;  1CF3 A;  2P8C A;  3BI2 A;  3DK4 A;  4G6H A;  3BOX A;  1XS2 A;  2WP5 A;  1NHS A;  2YG7 A;  1L9D A;  3AE8 A;  3PO7 A;  3SSZ A;  3MQT A;  1XDI A;  4IA6 A;  4RG3 A;  1CJC A;  3I4K A;  4HB9 A;  4IZG A;  2B76 A;  3NYE A;  1D4C A;  5BUK A;  2Q0L A;  2XCG A;  4TM1 A;  1ECQ A;  3NHO X;  3N6J A;  1TYT A;  3BJS A;  1FCD A;  1PN0 A;  4HNL A;  4Z44 A;  2QCU A;  4C5O A;  2O9Z A;  4K2S A;  2YVG A;  3ENL A;  3ZVH B;  1OJA A;  3GD4 A;  2PHH A;  3KA7 A;  2BS2 A;  1N5X A;  3ZVI A;  3V3O A;  3I3L A;  1CL0 A;  3FG2 P;  5JCK A;  3PG6 A;  2PGW A;  3VR8 A;  1XHC A;  3GDN A;  1IUX A;  4PAB A;  4DHG A;  4A5L A;  3ICR A;  2JKC A;  4HA6 A;  3AE1 A;  1SEZ A;  4H4P A;  3V3W A;  3SZF A;  1GPE A;  1PHH A;  1VG0 A;  5JCM A;  3AEE A;  5IDZ A;  2OA1 A;  2VZ2 A;  3AEF A;  2AAQ A;  4K8G A;  2FBW A;  4A65 A;  3LAD A;  3VRB A;  2FKP A;  1B4V A;  1BGJ A;  3HPF A;  3VC5 A;  3OC4 A;  3TCS A;  2GGI A;  4B1B A;  3IWA A;  1HYU A;  3P4S A;  3CTY A;  1ZKQ A;  3FPZ A;  3RIT A;  4A6G A;  4KT2 A;  3UJS A;  2GB0 A;  3UKL A;  3P4P A;  4H2Q A;  3H8L A;  1Y56 B;  4J2W A;  3KKJ A;  1RSG A;  1F9C A;  3UXL A;  4GFI A;  1MRA A;  5ENL A;  2OKT A;  2C76 A;  4AT0 A;  3UTF A;  4H4U A;  3GWD A;  3NG7 X;  2J3N A;  3UKK A;  2VRL A;  4APN A;  3DG3 A;  5KOX A;  1H81 A;  1PXB A;  1N4W A;  1JRO A;  1L0V A;  2EQ8 A;  4E0V A;  3L8K A;  2WET A;  2QDE A;  1GTE A;  3GSI A;  2QA2 A;  3FCP A;  3SQP A;  2GH5 A;  2BK4 A;  4GYP A;  3R10 A;  2OAL A;  3LXD A;  3AE2 A;  2RGO A;  3KVE A;  3UTE A;  2YLZ A;  4TLX A;  2R45 A;  1EBG A;  1P43 A;  4B67 A;  4I59 A;  5KVH A;  3AN1 A;  2JBV A;  3MKC A;  4LU6 A;  4OPL A;  4EWJ A;  4DX3 A;  1W4X A;  3LB8 A;  5EOW A;  1CJ2 A;  1TDO A;  4ZCC A;  3EUB 3;  3F8R A;  2PP1 A;  4CCQ A;  1WYG A;  5HXI A;  3AYL A;  3P0W A;  1KKR A;  1W6T A;  2XVI A;  4Z2U A;  4ENL A;  4JNQ A;  3K7T A;  3H8I A;  1EBD A;  1MO9 A;  1F8S A;  3BHK A;  3OP2 A;  4Z24 A;  3UOZ A;  4CRT A;  2PU0 A;  3RCY A;  1CJ3 A;  1LQT A;  3MZN A;  3GYX A;  2X8C A;  2V61 A;  4JHM A;  5FS9 A;  3OZY A;  2VQ7 A;  5LV9 A;  3AD8 B;  1O95 A;  3D1C A;  3QTP A;  3RRA A;  5IPY A;  4JNA A;  2GMJ A;  2XGZ A;  2OG9 A;  3EPT A;  4TVY A;  3GRS A;  4DN1 A;  1MNS A;  3ES8 A;  2WHD A;  2GDQ A;  4GGH A;  2GSH A;  1CC6 A;  2B9W A;  2WDR A;  2CDU A;  2VVL A;  1YY5 A;  1FFU C;  1P2E A;  3CNS A;  3CPJ G;  4U2T A;  2BAC A;  1GET A;  4X9M A;  1O94 A;  1PS9 A;  1FHU A;  3CNJ A;  1B5Q A;  3NN0 X;  3NK2 X;  4B64 A;  2X8H A;  2V3B A;  1GRH A;  4P9S A;  1V97 A;  3P3B A;  4IP5 A;  5KVI A;  2EQ9 A;  3NKS A;  1GER A;  4GAP A;  3T8Q A;  1JCT A;  3DIP A;  2OFJ A;  2PGE A;  2C67 A;  4NZH A;  4G73 A;  3ALL A;  2YLT A;  3CK5 A;  4A9W A;  4JN8 A;  3JZU A;  3EF6 A;  2ARD A;  4NTD A;  2YLX A;  3AEB A;  1KNR A;  3SN1 A;  2QJJ A;  3SFE A;  4OVI A;  1XPQ A;  3UKQ A;  1E1K A;  3RR1 A;  2ZZB A;  3V5C A;  4FDC B;  2QJN A;  1KSS A;  2YM2 A;  3CXO A;  1FFV C;  1NEN A;  3N4F A;  1X2H A;  4JY3 A;  2IVD A;  2OVL A;  1CBO A;  3SYI A;  1N62 C;  3AE4 A;  3ZLF A;  5KMS A;  3UP4 A;  3FIM B;  5KNL A;  4DGK A;  1OEP A;  5EU9 A;  3RHA A;  3DG7 A;  4YSX A;  4Y4L A;  5KMR A;  1GND A;  4II2 A;  3ITJ A;  2FJA A;  3GC2 A;  1FEB A;  3HYV A;  2WBA A;  1KDG A;  1L9C A;  2Q6U A;  1Q1W A;  3CGD A;  2BC0 A;  3UGV A;  4F4R A;  2RGH A;  1STZ A;  1H84 A;  1KCZ A;  2C73 A;  3ZDN A;  5J04 A;  1N5W C;  1D7Y A;  1ZK7 A;  1E6E A;  1GTH A;  4HCD A;  4D04 A;  3DME A;  3NK1 X;  2C65 A;  3PVC A;  4B65 A;  1N4U A;  4IHC A;  1TRB A;  1TE6 A;  3IJI A;  1EL7 A;  3D46 A;  3MSY A;  4Z1Y A;  3UCL A;  3DJE A;  1FEA A;  2A8X A;  4IP4 A;  1GRE A;  4FX9 A;  1PXC A;  2C4C A;  2R0G A;  3ES7 A;  3C4A A;  4K2X A;  2P8B A;  1GRG A;  3IHM A;  1GXF A;  1JNR A;  1TDK A;  1K0J A;  4II3 A;  3GWF A;  1IUT A;  2Z5Y A;  5BOF A;  4X2P A;  4U8O A;  2V6O A;  2Z5X A;  3L1R A;  3JSK A;  3CB3 A;  2F5Z A;  4C3X A;  3NVZ B;  2VQB A;  2APG A;  3SFD A;  4M52 A;  1JOA A;  3SZW A;  2BA9 A;  2YR5 A;  3SGL A;  3UJR A;  4EQW A;  3FVD A;  4Z25 A;  3DEQ A;  1KFY A;  2WOW A;  3GD6 A;  2ZZC A;  3CNP A;  4MGG A;  4G6G A;  1DTN A;  3NGC X;  1CJ4 A;  3NVY B;  1KNP A;  2Q0K A;  5KMP A;  4GAV A;  1KN0 A;  1TZZ A;  4IVM B;  2YVF A;  4H7U A;  2AL2 B;  2WOI A;  4H4S A;  3K7Q X;  2WPF A;  5HYM A;  3GDP A;  2POZ A;  4A7A A;  3T14 A;  2YG3 A;  3QSE A;  1YQZ A;  4IL0 A;  3I6T A;  2YWL A;  1E39 A;  2YLW A;  5GRT A;  5IQ1 A;  3DGZ A;  1L8P A;  3KLJ A;  5FJO A;  1QLB A;  1NEK A;  1LJ1 A;  3RGT A;  3RP8 A;  2W0H A;  4M6U A;  3EAO A;  7ENL A;  4GCM A;  2XLS A;  2DW6 A;  3K1G A;  3K7M X;  1NHQ A;  1K0L A;  3CIR A;  2GR1 A;  4H83 A;  2PA6 A;  1PJ5 A;  4H2N A;  5HY5 A;  4GDP A;  5KWF A;  4K7Z A;  3LZW A;  1K0I A;  2GR2 A;  3OZM A;  2GAH B;  1OJT A;  1DJN A;  4A3R A;  3HYW A;  1N1P A;  2BAB A;  3VRA A;  2XLR A;  2ZZ0 A;  2WS3 A;  1MDL A;  2BCP A;  1SJD A;  4J57 A;  1JRZ A;  2R0P A;  3HW2 A;  1AOG A;  3NYC A;  2MUC A;  4NEW A;  3Q9T A;  4O5U A;  3I6D A;  1YEY A;  1JU2 A;  2R9Z A;  1JEH A;  4IV9 A;  2XFP A;  4J33 A;  3CGB A;  4ZA0 A;  4ICY A;  3IJQ A;  4LII A;  4A79 A;  4E5T A;  2GF3 A;  2OAM A;  3D9X A;  3VDG A;  5CQF A;  1NU5 A;  4JDR A;  4ADW A;  4H1Z A;  4EQR A;  4GGB A;  4G74 A;  3RED A;  1BZL A;  3NIX A;  3SZC A;  3B6D A;  3O0H A;  3T9P A;  1PBE A;  3NLC A;  1RM6 B;  1FO4 A;  4YTP A;  5U63 A;  3D8X A;  1LTX R;  2UZZ A;  2B9X A;  4A6N A;  4AP1 A;  5KOW A;  3UP5 A;  1JRX A;  1FL2 A;  2XLT A;  4JY2 A;  3UKH A;  1VQW A;  3NVW B;  4KPR A;  1CC2 A;  4E6M A;  1K4Q A;  5G5H B;  2AQJ A;  3Q45 A;  5FJU A;  2GVC A;  4J3Z A;  2GAG B;  4IVO B;  1NG4 A;  3JW7 A;  3SN0 A;  2NVK X;  3TQP A;  3NXL A;  1GAL A;  4KPL A;  1P2H A;  4B66 A;  4JN7 A;  2YR4 A;  2YVJ A;  3C4N A;  1E1N A;  4TVW A;  3TW9 A;  2WU2 A;  3A7R A;  1VDC A;  1X31 B;  1S3E A;  2OLO A;  3SN4 A;  4J31 A;  2E5A A;  3DJG X;  2R4J A;  2GGE A;  3ABV A;  3SX6 A;  3ALJ A;  4YSH A;  1GV4 A;  1UKV G;  3S61 A;  2BCG G;  1BKH A;  3OTR A;  4A99 A;  3ATQ A;  3IF9 A;  1PDH A;  1PBD A;  4EIP A;  4H2P A;  2HNE A;  4U8J A;  2GMH A;  5GSN A;  1NHP A;  4RSL A;  3CN8 A;  3BSM A;  5EB4 A;  3CNT A;  1R6W A;  1S2Q A;  2P88 A;  1NHR A;  3UTG A;  3CGE A;  1IUW A;  1TDE A;  1DOC A;  2ONE A;  2GL5 A;  5IQ4 A;  3QLD A;  3GYI A;  1OJC A;  3GO2 A;  4OPT A;  4YT0 A;  4H4W A;  3TJI A;  1BWC A;  4CNK A;  2PTW A;  4USQ A;  3S5W A;  3EAN A;  5C3J A;  3B9J B;  3AD7 B;  4XWZ A;  3H8A A;  3NYF A;  1EBH A;  2XDO A;  3B3R A;  2BS4 A;  4H4Z A;  1MOK A;  2ACZ A;  4U8M A;  3QJ4 A;  3UOX A;  5U25 A;  1H2I A;  3AXB A;  2CFY A;  3BNM A;  3ZYX A;  2VOU A;  1PXA A;  4ZCW A;  1EC8 A;  3KPF A;  1Y0P A;  2H88 A;  3CPI G;  2WPE A;  1LVL A;  2B9Y A;  2XYO A;  3TWA A;  4UP3 A;  4YWS A;  2OQH A;  3U4F A;  1E1M A;  2WOV A;  2WQY A;  1VRQ B;  3V3N A;  3NH3 X;  5CKU A;  4E4U A;  2OZ3 A;  2OZT A;  3UCD A;  2GGJ A;  3AED A;  4D03 A;  1ZOY A;  2VVM A;  1ELI A;  2POD A;  1YKJ A;  3CND A;  2EQ7 A;  4OPD A;  1S7M A;  2XSX A;  3UKP A;  3UJE A;  4U8I A;  4J56 A;  1JPD X;  1KKO A;  1Q9I A;  4NEV A;  1E1L A;  3PK7 A;  2QAE A;  3EEZ A;  4TM3 A;  3S5S A;  5BOE A;  4HNC A;  5M10 A;  3FMW A;  1D7L A;  1BQG A;  4PAA A;  2V5Z A;  5FS6 A;  2WP9 A;  3AB1 A;  3P1W A;  3UXK A;  1COY A;  3VQR A;  3GMB A;  5BVA A;  4HCL A;  2HXU A;  2BXS A;  1CC4 A;  3DER A;  2OLA A;  4H2R A;  1GRB A;  2HZG A;  2DKH A;  4NTE A;  2PMQ A;  3MUC A;  1B8S A;  2PPG A;  4YSZ A;  1KD0 A;  3NO1 A;  2Y6Q A;  1LPF A;  3KPK A;  4NTC A;  1LQU A;  4DXK A;  4CBQ A;  4K22 A;  1YQ4 A;  4Z43 A;  2ZAD A;  2BK5 A;  3UTH A;  1B37 A;  4GDE A;  3T2K A;  4AP3 A;  1R0M A;  4DYE A;  2GGH A;  4H19 A;  3G5S A;  4G8T A;  1IUU A;  1VDV A;  3CT2 A;  2QVH A;  1H7X A;  1ELS A;  3AE5 A;  4U8P A;  5BRT A;  1F8W A;  2B7R A;  3CGC A;  4FK1 C;  2C7G A;  1SB3 B;  2C70 A;  2QDD A;  3HZL A;  2BRA A;  4EQX A;  1N4V A;  4H4R A;  4IL2 A;  2CUL A;  2OZ8 A;  2JK6 A;  3ICT A;  4DSG A;  3H7V A;  1IUV A;  3T2Z A;  6ENL A;  2X3N A;  2OPJ A;  3AYI A;  4HN8 A;  3N6H A;  5FJT A;  4X4J A;  3V5F A;  3UKF A;  2XFQ A;  2I5Q A;  2C66 A;  1Z6L A;  3STP A;  2CVJ A;  4RG4 A;  3V76 A;  2WES A;  4J36 A;  3QPE A;  3QN3 A;  5JCI A;  3H12 A;  3I6E A;  4IT1 A;  4H4T A;  3R0K A;  4GUV A;  3AMZ A;  3AEG A;  3K30 A;  3AD9 B;  3V4B A;  1GRF A;  4EMW A;  3H70 A;  1F8R A;  2XFO A;  1OJ9 A;  2XFU A;  2C3D A;  4UDR A;  1ONE A;  1EL9 A;  3M0O A;  2VRM A;  3TTE A;  3M13 A;  3G5R A;  5JCN A;  4GME A;  2WU5 A;  4U8L A;  3FYY A;  3RNM A;  1VG9 A;  2TMD A;  1DJQ A;  4BJZ A;  5C2T A;  3T37 A;  4JN9 A;  1NEL A;  2PU1 A;  3BI4 A;  3NNE A;  3AE6 A;  1GEU A;  4BJY A;  1X2G A;  2AR8 A;  3FXG A;  4GIS A;  3G5Q A;  5BUL A;  1BF3 A;  3SQS A;  4AOX A;  2W3R A;  3E1T A;  3ETR B;  1TYP A;  4BV6 A;  3ZLH A;  1IYX A;  3DES A;  5JCL A;  2TPR A;  3UJF A;  3AE3 A;  3NFU A;  1ZOV A;  2XVH A;  3L5O A;  2C72 A;  5EBK A;  2YR6 A;  2XH2 A;  3FV9 A;  2P3Z A;  5KMQ A;  3LJP A;  3DH9 A;  1GT8 A;  2GQF A;  4OPC A;  3DFY A;  4FK1 A;  4EMI A;  4M0X A;  4FI4 A;  3QFB A;  3OZ2 A;  4NNJ A;  2QA1 A;  1D4E A;  3P93 A;  1OJD A;  5G5G B;  2FJD A;  2AL2 A;  3T4W A;  4ZN0 A;  4A35 A;  3AE9 A;  3OPS A;  2VVL G;  3NRZ B;  3Q6J A;  4MKS A;  2YLS A;  4MMW A;  4U2L A;  2GGG A;  4YSY A;  3MWC A;  2E5V A;  2RGJ A;  3SXI A;  3VCN A;  3LZX A;  4A6N B;  1GES A;  4K8D A;  1NG3 A;  3JVA A;  4H2H A;  3T6C A;  5U1O A;  3TWB A;  3NRN A;  1KF6 A;  2Y6R A;  1DXL A;  3CXB A;  1JPM A;  2X50 A;  2RAB A;  1EC7 A;  4USR A;  4Z26 A;  1RYI A;  3NT6 A;  2R4E A;  3AEC A;  2QQ6 A;  4B68 A;  5M0Z A;  4FP1 A;  3DG6 A;  3C96 A;  3R9U A;  4KX6 A;  1NPX A;  1RVK A;  1DOB A;  3FJ4 A;  2PTX A;  1GRT A;  3KD9 A;  5EB5 A;  3GD3 A;  4ROP A;  1M64 A;  2GQW A;  3VCC A;  2WP6 A;  1NDA A;  4Y4M A;  3CMM A;  3ZVH A;  3T2Y A;  4OPI A;  4J1O A;  3NS1 B;  4EM4 A;  3S47 A;  4GR1 A;  3IJL A;  2BK3 A;  2XH4 A;  3ALM A;  3NTA A;  3DA1 A;  1FHV A;  2X99 A;  1H7W A;  3R0U A;  2PTY A;  3DJD A;  3R11 A;  4REK A;  4K5R A;  3AWI A;  2HXT A;  1FIQ B;  3PWG A;  4N9X A;  1F3P A;  2XVF A;  3P9U A;  3QSS A;  4AT2 A;  3GMC A;  4K1W A;  2PS2 A;  4TLZ A;  3BI5 A;  4CY8 A;  3Q4D A;  4ZOH B;  2YQU A;  3VFC A;  1NAA A;  4KWS A;  2OX4 A;  3QSM A;  4X9N A;  1KSU A;  2JAE A;  4G9K A;  2YLR A;  2BC1 A;  4OCG A;  1H6V A;  2EQ6 A;  4C74 A;  2GV8 A;  1Y56 A;  3U9I A;  5HHF A;  1WUE A;  5FJR A;  1TKK A;  2DW7 A;  1PBB A;  1S2Y A;  1IUS A;  1FEC A;  1TDF A;  2B7S A;  4YTN A;  4H4V A;  3SM8 A;  2WPC A;  3PFR A;  2Q7V A;  1SJC A;  3NZG A;  2AKZ A;  1XAN A;  4E4F A;  4I58 A;  4GRT A;  4DNA A;  2C75 A;  1GOS A;  5FS8 A;  1JRP A;  4GF7 A;  4YXD A;  4H4Y A;  2WDQ A;  4JQ9 A;  2PP3 A;  4CNJ A;  4K5S A;  3AM9 A;  1S3B A;  2V3A A;  3AYJ A;  2XLP A;  2OO6 A;  3T31 A;  1FOH A;  1E9I A;  3DK9 A;  2PP0 A;  3QVR A;  1D5T A;  2ZC8 A;  4ECH A;  2FJB A;  2BRY A;  3M12 A;  3WE0 A;  1ZMD A;  1H82 A;  4XXG A;  3ADA B;  1PBC A;  4UDQ A;  3SBF A;  4BK2 A;  2NQL A;  2XH0 A;  2C3C A;  2IVE A;  3F8P A;  2YAU A;  2PTZ A;  5FJP A;  1H86 A;  2P0I A;  3DGH A;  4ZCD A;  2A89 A;  1SJB A;  4LA1 A;  2W55 A;  2XLU A;  4H4X A;  4UDP A;  4Z2R A;  3A7U A;  1ZXI C;  1QJD A;  2C64 A;  4YTM A;  4HPN A;  3VR9 A;  2FJE A;  1DOE A;  1BKW A;  2XVE A; 
#chains in the Genus database with same CATH homology
 3I6D A;  4H4T A;  2OAL A;  1JU2 A;  1D4D A;  2R9Z A;  3LXD A;  1JEH A;  2E4G A;  2ZBW A;  2RGO A;  3AE2 A;  4GUV A;  4H4Q A;  4IV9 A;  2XFP A;  4EM3 A;  3KVE A;  3UTE A;  4J33 A;  3IC9 A;  2YLZ A;  3AEG A;  3CGB A;  4TLX A;  2R45 A;  3K30 A;  3AD9 B;  4B67 A;  1GRF A;  3DJJ A;  4EMW A;  4ICY A;  1CHU A;  1F8R A;  4CY6 A;  4I59 A;  2XFO A;  4LII A;  5KVH A;  1OJ9 A;  2XFU A;  1ZDL A;  2C3D A;  3NK0 X;  4A79 A;  2JBV A;  4LU6 A;  4UDR A;  2GF3 A;  1EL9 A;  4O5Q A;  4OPL A;  1EL8 A;  2OAM A;  3D9X A;  3M0O A;  2VRM A;  1W4X A;  3LB8 A;  5CQF A;  5EOW A;  1CJ2 A;  3M13 A;  1TDO A;  4JDR A;  1MXT A;  4ADW A;  4ZCC A;  3F8R A;  5KRQ A;  3G5R A;  5JCN A;  4CCQ A;  4YWO A;  2WU5 A;  2XFN A;  4U8L A;  5HXI A;  4EQR A;  2R46 A;  4Y4N A;  3RNM A;  1VG9 A;  2I0Z A;  3AYL A;  4G74 A;  4NWZ A;  3RED A;  2TMD A;  1V59 A;  4DSH A;  1BZL A;  1H83 A;  2JB2 A;  4J34 A;  1DJQ A;  2XVI A;  3NIX A;  4Z2U A;  1JNZ A;  4BJZ A;  5J60 A;  4JNQ A;  1E7P A;  1ONF A;  3B6D A;  3H8I A;  3IHG A;  3K7T A;  3SZC A;  1EBD A;  1MO9 A;  1F8S A;  3BHK A;  4Z24 A;  5C2T A;  3O0H A;  3UOZ A;  1ZX9 A;  3T37 A;  1PBE A;  3NLC A;  4JN9 A;  4CRT A;  2GRT A;  2BS3 A;  4YTP A;  1CJ3 A;  4U8N A;  5U63 A;  3P4Q A;  3BI4 A;  3D8X A;  4U8K A;  1LQT A;  1LTX R;  3NNE A;  5ER0 A;  3GYX A;  3AE6 A;  1GEU A;  2X8C A;  4BJY A;  5FMH A;  2AR8 A;  2V61 A;  2UZZ A;  3CPH G;  4CCR A;  2B9X A;  4A6N A;  5JRB A;  4AP1 A;  3UOY A;  5KOW A;  3G5Q A;  3UP5 A;  5BUL A;  1JRX A;  1JRY A;  1FL2 A;  3UKA A;  2XLT A;  4JY2 A;  1BF3 A;  5FS9 A;  3NN6 X;  4MJW A;  4AOX A;  2VQ7 A;  1PBF A;  3QVP A;  3AD8 B;  3BNU A;  1VQW A;  3UKH A;  4KPR A;  5LV9 A;  1O95 A;  3E1T A;  1Q1R A;  1CC2 A;  1TYP A;  4BV6 A;  1K4Q A;  3D1C A;  4C3Y A;  5JCL A;  5IPY A;  2TPR A;  2AQJ A;  2V60 A;  4JNA A;  2GMJ A;  3GRT A;  2GVC A;  2R0C A;  3BHF A;  3AE3 A;  2GAG B;  4IVO B;  1NG4 A;  2PYX A;  3EPT A;  2NVK X;  5DBJ A;  2NPX A;  1ZOV A;  1GAL A;  1P2H A;  2XVH A;  3GRS A;  3L5O A;  4B66 A;  2C72 A;  2WHD A;  3II4 A;  2YR4 A;  2YVJ A;  2YG5 A;  5EBK A;  2YR6 A;  2WEU A;  3C4N A;  4BK1 A;  3QFA A;  1E1N A;  5KXJ A;  1CC6 A;  2B9W A;  5KMQ A;  3LJP A;  3DH9 A;  1GT8 A;  4EMJ A;  2GQF A;  2WDR A;  4OPC A;  1QO8 A;  1EL5 A;  4EMI A;  4FK1 A;  4YKF A;  2CDU A;  2VVL A;  3QFB A;  1YY5 A;  3OZ2 A;  2WU2 A;  4NNJ A;  1P2E A;  1ZMC A;  2QA1 A;  3CNS A;  3CPJ G;  4U2T A;  1VDC A;  2BAC A;  1X31 B;  1GET A;  1D4E A;  4X9M A;  1S3E A;  1OJD A;  4WX1 A;  1TDN A;  2FJD A;  2OLO A;  4EQS A;  4J31 A;  3DJG X;  3P4R A;  1O94 A;  1PS9 A;  3RP6 A;  4ZN0 A;  2YM1 A;  2R4J A;  3CNJ A;  3ABV A;  1B5Q A;  3SX6 A;  3NN0 X;  3ALJ A;  3NK2 X;  4YSH A;  1GV4 A;  1UKV G;  3AE9 A;  3S61 A;  2BCG G;  2X8H A;  4B64 A;  2V3B A;  1GRH A;  3NTD A;  4P9S A;  1ZP0 A;  2YG4 A;  5FS7 A;  2VVL G;  4A99 A;  3ATQ A;  2YLS A;  3Q6J A;  3IF9 A;  1PDH A;  1PBD A;  5KVI A;  4EIP A;  2EQ9 A;  4U2L A;  3NKS A;  4C77 A;  4H2P A;  1GER A;  4GAP A;  4U8J A;  5L46 A;  2GMH A;  3ATR A;  5GSN A;  1NHP A;  4RSL A;  4YSY A;  3CN8 A;  2C67 A;  4NZH A;  5EB4 A;  2X8G A;  3CNT A;  1S2Q A;  4G73 A;  2E5V A;  2RGJ A;  2YLT A;  3ALL A;  2BXR A;  2JB1 A;  3SXI A;  3T0K A;  2DKI A;  4A9W A;  3LZX A;  1NHR A;  3UTG A;  4A6N B;  4WCT A;  1GES A;  3CGE A;  4K8D A;  4Z2T A;  1IUW A;  1TDE A;  3EF6 A;  2ARD A;  3VRD B;  1NG3 A;  1DNC A;  1DOC A;  2IID A;  4NTD A;  4OPU A;  2YLX A;  5U1O A;  5IQ4 A;  3AEB A;  1KNR A;  3GYI A;  1OJC A;  4B69 A;  5J7X A;  1REO A;  4OPT A;  1LV0 A;  3SFE A;  4YKG A;  3NRN A;  4YT0 A;  1KF6 A;  4H4W A;  1BWC A;  4CNK A;  2Y6R A;  4OVI A;  4TM4 A;  1XPQ A;  4EIQ A;  1DXL A;  3UKQ A;  1E1K A;  4USQ A;  2X50 A;  4H50 A;  1F6M A;  2RAB A;  2ZZB A;  3KU9 A;  4USR A;  2H89 A;  1ZY8 A;  3S5W A;  4FDC B;  4Z26 A;  1RYI A;  3EAN A;  3NT6 A;  2GR0 A;  5C3J A;  2R4E A;  2XVJ A;  3AEC A;  1KSS A;  1PJ7 A;  1GSN A;  2YM2 A;  4XWR A;  3H4K A;  3AD7 B;  4IA5 A;  3COX A;  5M0Z A;  4XWZ A;  3C96 A;  3ISH A;  3NYF A;  3R9U A;  4KX6 A;  1NPX A;  1L9E A;  1NEN A;  4OPG A;  3GYJ A;  1YQ3 A;  2XDO A;  1DOB A;  3B3R A;  4U2S A;  3SZ0 A;  2BS4 A;  4H4Z A;  1GRT A;  3LOV A;  4JY3 A;  3KD9 A;  5EB5 A;  4AOS A;  3GD3 A;  3URH A;  2WDV A;  2IVD A;  1MOK A;  2HQM A;  1CBO A;  3SYI A;  2GR3 A;  3AE4 A;  2ACZ A;  4U8M A;  3QJ4 A;  3UOX A;  5U25 A;  5KMS A;  1H2I A;  1M64 A;  3AXB A;  2GQW A;  2CFY A;  3UP4 A;  2OLN A;  3BNM A;  3ZYX A;  2JB3 A;  1IJH A;  2VOU A;  3FIM B;  1PXA A;  3FBS A;  4B63 A;  2WP6 A;  5KNL A;  4DGK A;  1NDA A;  2BYB A;  4Y4M A;  1GRA A;  3CMM A;  3T2Y A;  3RHA A;  1DOD A;  1O5W A;  4OPI A;  4EM4 A;  3KPF A;  1Y0P A;  2H88 A;  4GR1 A;  3AE7 A;  3HYX A;  4BK3 A;  4Y4L A;  4YSX A;  5KMR A;  2BK3 A;  1GND A;  4II2 A;  3ITJ A;  4BUR A;  2FJA A;  3HYV A;  1FEB A;  2WBA A;  1RP0 A;  3CPI G;  2WPE A;  1KDG A;  1L9C A;  1LVL A;  2B9Y A;  3ALM A;  2XYO A;  3NTA A;  2Q6U A;  1Q1W A;  3DA1 A;  4UP3 A;  3CGD A;  2X99 A;  2BC0 A;  1H7W A;  5TR3 A;  1M6I A;  1E1M A;  2WOV A;  2WQY A;  2E1M A;  3RP7 A;  2RGH A;  1VRQ B;  3V3N A;  3F8D A;  3NH3 X;  1BGN A;  2A87 A;  3DJD A;  1H84 A;  5CKU A;  4TM0 A;  3SY4 A;  3UOV A;  3AED A;  4REK A;  4K5R A;  2C73 A;  4D03 A;  3PS9 A;  3ZDN A;  2YG6 A;  3AWI A;  1ZOY A;  2VVM A;  1D7Y A;  1ZK7 A;  1PJ6 A;  1E6E A;  1ELI A;  1YKJ A;  3DK8 A;  1GTH A;  3CND A;  3AEA A;  3ICS A;  1F3P A;  4N9X A;  4D04 A;  2GEW A;  2EQ7 A;  2XVF A;  4OPD A;  3P9U A;  3QSS A;  4AT2 A;  1CF3 A;  1S7M A;  3DME A;  3GMC A;  3BI2 A;  3DK4 A;  3NK1 X;  3UKP A;  4U8I A;  4J56 A;  2C65 A;  3PVC A;  4TLZ A;  3BI5 A;  4G6H A;  4B65 A;  4CY8 A;  1Q9I A;  2WP5 A;  1NHS A;  4NEV A;  1E1L A;  1N4U A;  1TRB A;  1L9D A;  2YG7 A;  3AE8 A;  3PO7 A;  2YQU A;  2QAE A;  1EL7 A;  1NAA A;  1XDI A;  4IA6 A;  4RG3 A;  1CJC A;  4HB9 A;  3UCL A;  3DJE A;  1FEA A;  2B76 A;  3QSM A;  2A8X A;  3NYE A;  1D4C A;  4TM3 A;  1GRE A;  4X9N A;  5BUK A;  4FX9 A;  1PXC A;  2C4C A;  2R0G A;  2Q0L A;  2XCG A;  3C4A A;  1KSU A;  4K2X A;  2JAE A;  4TM1 A;  5M10 A;  1GRG A;  3FMW A;  1GXF A;  3IHM A;  1D7L A;  4G9K A;  1JNR A;  3NHO X;  4PAA A;  1TDK A;  1K0J A;  2BC1 A;  2V5Z A;  2YLR A;  4OCG A;  4II3 A;  5FS6 A;  1H6V A;  1TYT A;  2EQ6 A;  1FCD A;  1PN0 A;  2WP9 A;  3GWF A;  4Z44 A;  4C74 A;  2GV8 A;  3AB1 A;  2QCU A;  3P1W A;  1IUT A;  1COY A;  1Y56 A;  3VQR A;  3GMB A;  2Z5Y A;  4C5O A;  5BVA A;  2O9Z A;  4B68 A;  5HHF A;  2YVG A;  4U8O A;  2V6O A;  2Z5X A;  1OJA A;  3L1R A;  3GD4 A;  2BXS A;  3JSK A;  2PHH A;  1CC4 A;  1PBB A;  2F5Z A;  1S2Y A;  2BS2 A;  1IUS A;  3KA7 A;  4H2R A;  1FEC A;  4C3X A;  1GRB A;  1TDF A;  2APG A;  2DKH A;  2VQB A;  3SFD A;  4M52 A;  3V3O A;  3I3L A;  2B7S A;  4YTN A;  1JOA A;  4H4V A;  3SZW A;  4NTE A;  1CL0 A;  3FG2 P;  2BA9 A;  3SM8 A;  2WPC A;  2YR5 A;  3SGL A;  1B8S A;  5JCK A;  3PG6 A;  4EQW A;  4YSZ A;  3VR8 A;  1XHC A;  2Q7V A;  3GDN A;  1IUX A;  2Y6Q A;  4Z25 A;  1LPF A;  4PAB A;  1KFY A;  3KPK A;  4A5L A;  3ICR A;  4NTC A;  1LQU A;  4CBQ A;  2WOW A;  4K22 A;  1YQ4 A;  4Z43 A;  2ZZC A;  3CNP A;  2JKC A;  1XAN A;  3AE1 A;  4HA6 A;  4I58 A;  1SEZ A;  4H4P A;  4GRT A;  2BK5 A;  4G6G A;  4DNA A;  2C75 A;  1GOS A;  3UTH A;  3NGC X;  1CJ4 A;  5FS8 A;  1KNP A;  3SZF A;  2Q0K A;  1GPE A;  1B37 A;  1PHH A;  1VG0 A;  5JCM A;  3AEE A;  5KMP A;  4GDE A;  2OA1 A;  4GAV A;  1KN0 A;  2VZ2 A;  3AEF A;  4GF7 A;  4YXD A;  2AAQ A;  4IVM B;  3T2K A;  4H4Y A;  2WDQ A;  4AP3 A;  2YVF A;  2FBW A;  4JQ9 A;  4A65 A;  3LAD A;  4H7U A;  4CNJ A;  4K5S A;  3VRB A;  2WOI A;  4H4S A;  1S3B A;  2V3A A;  3AYJ A;  3G5S A;  1IUU A;  2WPF A;  3K7Q X;  1B4V A;  2XLP A;  1BGJ A;  1H7X A;  3T31 A;  5HYM A;  3GDP A;  1FOH A;  4A7A A;  3DK9 A;  3OC4 A;  3AE5 A;  4U8P A;  3T14 A;  2YG3 A;  3QVR A;  5BRT A;  1F8W A;  1YQZ A;  3QSE A;  1D5T A;  2YWL A;  2B7R A;  3CGC A;  4FK1 C;  2C7G A;  4B1B A;  4ECH A;  2C70 A;  3IWA A;  1E39 A;  1HYU A;  2BRA A;  2YLW A;  2FJB A;  3HZL A;  5GRT A;  5IQ1 A;  3DGZ A;  4EQX A;  1N4V A;  2BRY A;  4H4R A;  3KLJ A;  3CTY A;  3P4S A;  3M12 A;  1QLB A;  1NEK A;  1ZKQ A;  1ZMD A;  1LJ1 A;  3FPZ A;  3WE0 A;  1H82 A;  4XXG A;  2W0H A;  3RP8 A;  3ADA B;  2CUL A;  1PBC A;  2JK6 A;  3ICT A;  2GB0 A;  3UKL A;  4DSG A;  3EAO A;  3P4P A;  4UDQ A;  1IUV A;  4GCM A;  4H2Q A;  3H8L A;  2XLS A;  4BK2 A;  1Y56 B;  4J2W A;  3T2Z A;  3KKJ A;  2C3C A;  1RSG A;  2IVE A;  3F8P A;  3K7M X;  1NHQ A;  1K0L A;  3CIR A;  2GR1 A;  2YAU A;  2X3N A;  3AYI A;  1PJ5 A;  1H86 A;  4H2N A;  5HY5 A;  4GDP A;  5KWF A;  4K7Z A;  3LZW A;  1K0I A;  3DGH A;  2GR2 A;  4X4J A;  2GAH B;  1OJT A;  2C76 A;  1DJN A;  3UKF A;  3HYW A;  1N1P A;  2XFQ A;  3UTF A;  4AT0 A;  2BAB A;  3VRA A;  2XLR A;  4ZCD A;  2C66 A;  1Z6L A;  2ZZ0 A;  4H4U A;  2A89 A;  3GWD A;  4LA1 A;  3NG7 X;  2J3N A;  2WS3 A;  3UKK A;  2XLU A;  2BCP A;  4H4X A;  2VRL A;  4APN A;  2CVJ A;  4RG4 A;  4UDP A;  4Z2R A;  5KOX A;  3V76 A;  1H81 A;  4J57 A;  1JRZ A;  1QJD A;  2C64 A;  2WES A;  1PXB A;  1N4W A;  2R0P A;  4J36 A;  4YTM A;  1L0V A;  2EQ8 A;  4E0V A;  3L8K A;  1AOG A;  2WET A;  5JCI A;  3NYC A;  3VR9 A;  1GTE A;  2FJE A;  3GSI A;  2QA2 A;  4NEW A;  3SQP A;  2GH5 A;  1DOE A;  2BK4 A;  1BKW A;  3Q9T A;  4O5U A;  2XVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...