3BSMA

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
386
structure length
358
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens.
rcsb
source organism Chromohalobacter salexigens dsm 3043
total genus 131
structure length 358
sequence length 386
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2007-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3bsmA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3bsmA01
4FI4A 3QLDA 2PTXA 3VCNA 1EC8A 2QQ6A 3JVAA 3UJ2A 3N6HA 3DDMA 3VCCA 2OZTA 1BQGA 2FKPA 3KUMA 4GMEA 3SBFA 3BOXA 3ES7A 3BSMA 4JN7A 3MKCA 2OZ8A 2PP3A 3T9PA 3VC6A 1ECQA 2XH0A 3DESA 3SJNA 1P43A 2OG9A 3TTEA 3UCCA 3CK5A 3OPSA 3UJSA 3R0UA 3H70A 3R0KA 2OFJA 4J1OA 4ROPA 3CYJA 2OVLA 3H12A 3GO2A 3DIPA 2XH2A 2O56A 3IJLA 3DG7A 1XS2A 1JPMA 4K1WA 1SJAA 3FCPA 3RCYA 3DG3A 2HXUA 3ZLHA 2P3ZA 4H1ZA 2PA6A 4Z1YA 3D46A 3MSYA 1EC7A 4IP5A 1SJDA 2MUCA 3FV9A 3Q45A 1PDYA 3SSZA 3TWAA 1EBHA 2QDEA 1RVKA 3T8QA 1SJBA 3UCDA 3NXLA 4M0XA 3RITA 3MZNA 2DW6A 2AKZA 2RDXA 5FJPA 4YWSA 3GC2A 2PS2A 2QJNA 3RR1A 1MDLA 1KKOA 1P48A 2OLAA 4H2HA 4E8GA 3NZGA 3TQPA 5FJRA 3FJ4A 2ZADA 3ENLA 4IHCA 3OZYA 4MGGA 3UJRA 3HPFA 3VFCA 4E4UA 2HXTA 2PGEA 3SN4A 4HPNA 3TW9A 4K8GA 1KD0A 4IP4A 4DXKA 4J3ZA 5BOFA 3MUCA 3ZLFA 3RGTA 3CB3A 3I6TA 3T4WA 2XH4A 2HZGA 3THUA 3DGBA 4M6UA 2XGZA 3QN3A 3PFRA 2PODA 3GY1A 2AL1A 3OW1A 2GGIA 4KPLA 4HCDA 3VDGA 3MWCA 2PTYA 4MKSA 3V5FA 3JW7A 4IT1A 3P93A 4H83A 4E4FA 2P88A 2PTWA 3MQTA 1R6WA 2HNEA 3R10A 2AL2B 3PK7A 4JN8A 1W6TA 4DX3A 1EBGA 4FP1A 3FYYA 4E6MA 2PU1A 2OQYA 2FYMA 4EWJA 3UGVA 1YEYA 2I5QA 1ONEA 4G7FA 2POZA 4IL2A 1R0MA 1MRAA 3ZVHA 3H8AA 4HCLA 4HN8A 4GYPC 3PWGA 3U9IA 4KT2A 4A3RA 3CT2A 2QJMA 3IJQA 3N6JA 3DERA 4GISA 1FHVA 4IZGA 3ZVIA 1L8PA 4GFIA 5IDZA 3QKEA 2DW7A 2P8BA 3P0WA 5ENLA 1F9CA 2PP1A 3Q4DA 3IK4A 4ZCWA 3GD6A 4KWSA 4GIRA 2GDQA 2ONEA 2XSXA 3S47A 3H7VA 2ZC8A 3SQSA 3ES8A 1MNSA 3QPEA 4DYEA 3ZLGA 2PPGA 2PGWA 2CHRA 3OTRA 4HNLA 3P3BA 1MUCA 3DG6A 2XH7A 6ENLA 4DN1A 2QDDA 3T6CA 1EC9A 1NU5A 3STPA 3TOYA 2QJJA 4K2SA 1OEPA 3RRAA 1NELA 2GSHA 3UXLA 3OP2A 3CXOA 3NFUA 4ENLA 5BOEA 3V3WA 2QVHA 7ENLA 3R11A 3DFHA 4HYRA 2GGEA 1WUFA 2PU0A 3OZMA 1XPYA 2GGHA 5EU9A 4F4RA 3SN1A 2PMQA 5FJTA 4A35A 2QGYA 1IYXA 2OX4A 3I4KA 4GGBA 3EEZA 4H19A 3TJ4A 1TZZA 1TE6A 3NO1A 3I6EA 1MDRA 4E5TA 3DEQA 2PTZA 3N4FA 2AL2A 2NQLA 5FJUA 3TCSA 2PSNA 3SN0A 4A6GA 4KEMA 2OZ3A 4JHMA 3K1GA 4ZA0A 4GYPA 2AKMA 4X2PA 3S5SA 1FHUA 5J04A 2GL5A 2PP0A 3ZVHB 3DFYA 1ELSA 3TJIA 2OO6A 4GGHA 1JPDX 3VA8A 3V4BA 3BJSA 3FXGA 3IJIA 4IL0A 3D47A 1KKRA 1TKKA 2MNRA 2OKTA 2P8CA 3FVDA 4Z17A 3R1ZA 3UXKA 3RO6A 2GGGA 1E9IA 1PDZA 4MMWA 5FJOA 3N4EA 3QTPA 3CAWA 1WUEA 2GGJA 3UJFA 4HNCA 3U4FA 1DTNA 3B97A 4DHGA 1JDFA 3JZUA 3MY9A 3UJEA 1KCZA 1SJCA 2OPJA 2PCEA 4HCHA 3PWIA 3EKGA 3VC5A 3TWBA 4G8TA 3R25A 1BKHA 3V5CA 2OQHA 4DWDA 1JCTA 2P0IA
chains in the Genus database with same CATH superfamily
1RAKA 1H3GA 3WZ0E 1DTUA 3WBEA 2DUAA 1MNZA 3BGAA 4EMWA 4CCEA 5CG7A 1DIKA 4LYQA 4QFUA 2ZA2A 3B9DA 3VE9A 2CCRA 3M7SA 3VCCA 2GQ9A 2XDFA 1HO4A 4PMNA 3C4UA 1NHRA 1PO9A 1UBPC 3TDFA 2BC1A 1NF7A 3NO5A 3T9PA 3P74A 1FKWA 4DJED 1V3MA 1P4CA 3R0UA 2VNCA 2AMGA 3W27A 3W1TA 4O0ZA 4HK7A 3NL6A 2E25A 5CC3A 2BNJA 3VIMA 3VD7A 1GPFA 2J79A 3VD9A 1ADSA 4DM1A 5K9XA 2VDIA 4PEEA 1KGXA 5EB8A 4ZQOA 2A8XA 1BG4A 1VFTA 1GORA 1OYCA 1OK6A 1CYGA 3R8HA 4V15A 3MBDA 3SY8A 3L4YA 5C2CA 4HA4A 4HHPA 4DLFA 3Q45A 1YNYA 1ZRQA 2EQ7A 3M0VA 3PM6A 3ZYZA 2I1OA 4J57A 1WAWA 2FJUB 4GVGA 1JF5A 1KRAC 2RDXA 4ADSA 4JFWA 4AHQA 3GC2A 1IEIA 3O3RA 3CZJA 1JI1A 1IXNA 3MUIA 4MYAA 1FFRA 5CZ0A 1UJQA 4EOUA 3PVFA 2VR2A 3KZSA 1SZEA 1UQZA 3A12A 3M43A 5EBAA 3EAOA 1NOWA 1OCBA 1AODA 2XSAA 4CVUA 4E4UA 4NU7A 2A7NA 3CASA 1FCUA 3GIQA 4HPJA 3VZZA 1I4NA 2VZVA 3HA1A 2DSUA 4PR4A 1F74A 3TH6A 3CWNA 3ZT5A 2FTPA 2ISVA 5KETA 3PJXA 1SSDA 2V63A 2X40A 1R30A 2Z0IA 3WQ4A 2XH4A 5I6SA 4S3FA 4PA8A 6ALDA 2PODA 4JOMA 1GHSA 4FR1A 1YTEA 4LPCA 1I0DA 1NY1A 4XKMA 2EJ1A 1GOMA 3LTSA 4EIVA 2REQB 1EA9C 2D23A 2H9AB 3APTA 3GG1A 3ZIZA 4PUEA 3T4CA 1RVGA 5HMFA 1XC6A 3G1SA 2DSZA 4KWUA 2G37A 4UTWA 2J25A 4BF7A 4GH1A 4JICA 1E0TA 4FX8A 3VKBA 5LGXA 1Y8BA 4H41A 3EMQA 1W3IA 4RUBA 3DXIA 3S1VA 3BOFA 3WN6A 3B0VC 2CITA 1J4EA 1EJVC 2QDGA 4AX6A 4CQBA 4GR1A 3LRKA 4F2BA 2F6UA 2V2DA 1LRQA 4MUPA 5I3HA 2YVGA 2WBAA 3O2LA 4C5YA 4IFKA 1BSIA 3ZVHA 5AC7A 4GYPC 2WHJA 4WZHA 3SFWA 1IHIA 2YAUA 5T26A 2C71A 2YDQA 4GPNA 5HBFA 4L4PA 3N6JA 5LXEA 3VGFA 1EXPA 2XU2A 1M65A 2OGJA 3W88A 1GVEA 4C6LA 5G4EA 3BG5A 3P0WA 3UW6A 1FHDA 4S3KA 3IK4A 2EQ9A 3GD6A 3CB8A 4ML9A 2ONEA 1E4IA 3AICA 5D9NA 2VGIA 2GH5A 5U1OA 1QOQA 3H23A 4ZEPA 2AAAA 3P80A 1C7TA 2PC4A 5FL1A 5GQBA 1YMYA 3HJZA 4IGSA 2WK2A 3LG3A 5I7GA 4PCNA 2IQTA 2FVLA 1Q85A 4GY1A 3UXLA 3VDBA 4Y9MA 3NQ2A 5EBUA 4LS2A 3OLEA 1U33A 1TZ7A 5ECVA 1FECA 4LAKA 3BO9A 5FJTA 2WW5A 4OUEA 3VINA 4YPJA 2X8GA 1UD5A 4CCZA 1NWTA 1A5BA 3GYCA 2CLHA 4MWAB 3TJ4A 3FFSA 4TV5A 1XLDA 3BL3A 3CMFA 1UKQA 1ZLPA 5MKGB 3IIPA 3DENA 1R47A 3WIJA 1KFEA 2E9MA 1YTDA 3EEGA 1XDIA 5BRPA 1RBAA 2GLKA 4WIWA 5C7VA 1WE5A 2CFYA 3VM5A 3N9KA 4CCDA 2QJHA 3PY2A 1VYSX 5FCZA 4Y9AA 1ZAJA 4C5ZA 3U7BA 4OQVA 1V0MA 1L6GA 3T1GA 2BODX 3P0XA 5D8WA 3SURA 1RD5A 2Z24A 5LNRA 4E4PA 3IUDA 3GU9A 1ZENA 3IJIA 3VI2A 3VTRA 1PYMA 3EKLA 3FVDA 2JK2A 5E5CA 2A79A 1B9ZA 4GRSA 4LY4A 3DGRA 2Z1KA 1QT1A 1G69A 2BTMA 4GZJA 2BSLA 4L56A 2Z1VA 5ABHA 2E6AA 2WMFA 5A2CA 1QI3A 1WUEA 2RHGA 1FP9A 2NX3A 3EF6A 1LQ2A 1F73A 1DTNA 4LC6A 3VMOA 3MY9A 1LLOA 1OGSA 2E28A 4HYVA 2AAQA 2OPJA 4MY1A 3EMZA 5H91A 1IIGA 4DJFC 2ZDRA 4LV4A 4AWSA 6REQA 2Z2AA 3LZ3A 3Q58A 1W0MA 4AD3A 2QCEA 3T05A 3TZNA 1C7SA 4ZQNA 1JCTA 4Q6XA 1V6UA 1GHRA 3BZJA 3FW6A 3KBJA 4QP0A 3JVAA 3RHGA 1FWWA 2R9RA 1B0IA 2CU0A 3NA8A 3V5OA 2TSYA 2C91A 6TIMA 3Q6JA 3WF3A 4G5DA 3WFLA 4UFHA 2OCZA 4MNMA 3VC6A 1RPXA 1ECQA 1R9YA 3TTEA 3VCRA 3SQPA 3I7SA 1FCQA 2Y61A 1EX1A 4L80A 1EKOA 3W6MA 2R9ZA 1F6PA 5A6BD 2QAEA 2PBGA 3CZGA 1TPH1 1UR8A 2O9RA 3DH9A 5BOOA 1ISWA 1PKNA 4W7WA 2O56A 2J88A 1I8JA 4RXFA 1WYIA 3DHDA 1DPMA 4ZE5A 2QF8A 3UESA 4K8DA 3WQCA 5CSRA 3ZLHA 2YL5A 4GQBA 1G4PA 2GFTA 1WBHA 5I3FA 1EC7A 1C8YA 1SJDA 3M0MA 3UD6A 1XIEA 2VFGA 3BAXA 3OQ8A 2JKEA 5DELA 2O55A 4NP7A 2TRSA 3LM7A 3S2LA 4AEOA 1J12A 4XTIA 1O5XA 2AKZA 1E0WA 1XQKA 2XN1A 3MP5A 1GZ1A 5E0FA 2OX1A 1ML1A 2VGGA 2DZTA 1D7KA 1MXSA 1S1RA 4RE2A 3KBMA 3NIYA 3EX2A 2J8GA 3T0CA 2OU4A 2A0NA 3TXZA 1X38A 2J62A 3BAYA 2NV9A 4A2RA 4ZOEA 3VGBA 3MO7A 3UPBA 1ISVA 3IVUA 2YBTA 4YXGA 2WWCA 1TWDA 4ZTXA 2ZICA 4WDUA 5AY7A 4HJFA 2C1GA 3AMCA 4L6DA 2CLPA 4WRHA 3APYA 3QY6A 3VIOA 4JX6A 1MXGA 4ADWA 2QPUA 3GH7A 3BE7A 1ZMCA 1YHTA 1DJWA 3SJ3A 2NLYA 2Q3OA 3GVWA 1R2TA 2QHAA 3QYSA 4Q3MA 3CGCA 2OMAA 1GVRA 3QZ6A 4HHMA 4DJEA 2GJLA 3N1AA 2ZX7A 4UOZA 1VHCA 4LV9A 4IH3A 3GBEA 2X2GA 1ISXA 2AGKA 1VIWA 1YDVA 1N8WA 4B90A 3NQDA 3IJ8A 1TUFA 1QI0A 4FNSA 1PKLA 2AL2B 5CJNA 2VD8A 4HA1A 4FP1A 4M7SA 4YTTA 1BEUA 2PC8A 3EOEA 5TNVA 2ZE3A 3VOGA 4W85A 3ARTA 1DP0A 4DZHA 3B40A 2Y85A 4ROQA 5KSWA 4WQ6A 1PZ2A 3ZJ7A 1FWFC 2Q01A 3IJ6A 2DT2A 1V03A 1E6XM 2VZUA 2CLFA 2BLEA 1ICSA 1AUSL 4ML4A 3AXKA 1UWRA 2V2CA 5FF7A 1QRQA 1ZL1A 3AMDA 2EPMX 4GI9A 2EKGA 3I10A 2Z00A 2QJMA 1GYNA 1MVYA 3BAJA 3ZQ9A 2OOGA 3IJQA 4ZR8A 1PX8A 2GK1A 4D72A 2WJDA 3A4AA 3UG5A 1U5HA 5HA7A 5FF3A 2Y5SA 5I3GA 2R82A 2ZZ6A 3RCNA 2QAFA 3S6TA 2H6RA 3F2DA 2VELA 4ZFMA 3QFAA 4CNUA 4UTUA 4QBXA 1KRMA 1V3HA 3L0NA 1R85A 3G22A 1MNSA 1A49A 1MW3A 5DANA 4EAYA 3KBNA 3DZ1A 1SZNA 5A95A 3EXRA 1KFLA 2WAGA 1OFRA 3TTOA 2PGWA 4EPBC 5C9ZA 3LZ5A 1M7XA 1SFJA 4PTXA 9RUBA 4I9AA 2XIQA 3RPMA 5TAOA 1U22A 3CIVA 1UYQA 1TTIA 3LGDA 3NVZB 1XLIA 1CXHA 1IEWA 4FXSA 4HNTA 4IP7A 3TTSA 3DBNA 1TJ0A 3GVGA 4JL2A 3TYBA 5C9UA 1ZY8A 1J11A 4S3AA 5CGMA 4QE5A 1LOSA 3BJTA 1J2WA 3WEOA 4HZ6A 1ZSXA 3B3DA 4Q4OA 4Q8UA 1F6YA 3I4KA 4GVHA 1RBLA 1ZDLA 4ATWA 3EXSA 3CUIA 4B5XA 3R79A 1Z9AA 5KZ6A 4JHOA 2QT3A 3QHOA 4C6OA 4M24A 1MEWA 4QE1A 3W7DA 4FPSA 4F9DA 1EX5A 2X50A 5H8PA 4GVIA 4A6GA 2C19A 4CU8A 2Y7DA 4JHMA 4B3LA 1TJ1A 1RJRA 1P6CA 5KEZA 4L6HA 3UG8A 3VYLA 4JQ4A 3ALGA 4CD8A 4LGXA 2ZXBA 4WEVX 2PP0A 4AYGA 1EBDA 3WJWA 1K7FA 1BGGA 4TVWA 2XWEA 1XIHA 2Z4GA 1Z69A 3PUEA 1Q65A 1UP3A 2YW3A 3HQNA 3HRDC 3W01A 1Z48A 4DLMA 3GXNA 1U30A 3BAIA 2YB4A 1XLEA 1OCQA 1WBJA 3KS5A 4DPQA 2GR2A 1LWJA 1B3ZA 4MVAA 3BW2A 2TPRA 1H41A 4GUHA 2XFYA 2VO5A 3CHVA 4NF7A 2G3FA 1ECEA 2WMIB 3P5YA 4NQ1A 1GRTA 4MB3A 2BCPA 4JQAA 4DBSA 4QGCA 4ICMA 2HBVA 5AYZA 3EKGA 1FQ0A 2VX7A 5FOOA 2WP6A 4MNKA 1BXBA 1WDQA 3QTGA 1DQXA 2J8FA 4K7YA 3IRDA 4DRSA 1P7TB 4W5ZA 1EC8A 4XZWA 5FJIA 3RNMA 2IUZA 2YFOA 1HJXA 1JNEA 1DJIA 2CBIA 4X60A 4JTGA 2DPEA 3TONA 4JEJA 1OB0A 1ITXA 3UP8A 3VKKA 4O12A 3WDHA 2Z6JA 1WX0A 4QJ4B 1C9WA 1KV8A 3OIXA 2PP3A 4CD7A 3PZNA 1JULA 2UBPC 2WSRA 2CZFA 5HNTA 4S1FA 5CBBA 3OPSA 2WOWA 3G77A 3GE7A 1T8XA 1V3LA 4UCGA 4IMEA 3MS8A 4WK9A 3RILA 1S2WA 4XD3A 1GVIA 1XYZA 4FS9A 4EQWA 3K30A 4NJKA 3A6OA 2BY3A 4PTDA 4NNCA 1D8CA 3HGSA 4CNOA 1UROA 4Q4KA 8RUCA 4M81A 1JZ8A 4IFKB 1SJAA 2BDQA 4JN6A 3RCYA 1VJSA 2J6VA 3GNXA 1K02A 4BI5A 1T99A 1E51A 4JTDA 1SFTA 1T6MA 1V7AA 1MFVA 2WZTA 4N9DA 4ZB5A 2UY3A 4ERIA 2WJEA 2L5HA 4AZ6A 2V6AA 3S2MA 3J7HA 3QYQA 3MW7A 1AOGA 4ORMA 1VFOA 3LLFA 2A7PA 4IM4A 1AJ2A 1ZPTA 2G97A 3MV01 1DE5A 9XIAA 2WCSA 4F0SA 2VENA 4C7FA 1X39A 3WJXA 1UQYA 4BWLA 4IWWA 2VRQA 2DP3A 3M07A 3L2MA 4QROA 4L4LA 4UIOA 1AFSA 4LH8A 5CPLA 4DXKA 5I24A 2WPCA 1AMKA 5HWMA 4I3GA 4DI8A 3PTMA 3CB3A 4JQ2A 5IRPA 1GVOA 4JTFA 4O50A 1ZAHA 5LIXX 4D8LA 3NPVA 3LSBA 1K77A 3AWOA 1W3TA 1JRBA 4RDZA 3S1XA 1YXDA 2XGZA 3NM1A 2NVKX 2WP5A 2BY2A 3PFRA 4US6A 3TYUA 4FX6M 4HA0A 4MKSA 4S2CA 1IT7A 4GC4A 5A6BA 3T0AA 3R4IA 3HPAA 1HP4A 4EF8A 4OKDA 3MQTA 4IG2A 3AAMA 1EWDA 5EFDA 4LUJA 3SDOA 1HJUA 1IR1A 1E5NA 2KZHA 2EQDA 2A1YA 2FIQA 3FYYA 1TB3A 2QXWA 3HQOA 1E0VA 2F61A 4LB3A 1XI3A 3CO4A 1LG2A 3T07A 1CIUA 2OELA 3BICA 4JIRA 1YEYA 1ICPA 4IQLA 1HTIA 3EWBX 1R0MA 3H8AA 4P8WA 1HIZA 3N2TA 4UNKA 1VB9A 3P84A 3U9IA 1H60A 4ACZA 4Z0JA 3LD5A 4IIFA 1L8PA 3BW4A 3RLGA 1GRFA 3CC1A 3WH6A 4ZENA 4XZBA 4UFLA 1J01A 5A6LA 5JIWA 2QCDB 1YPIA 2V3FA 1DORA 3PBYA 3WLLA 2WMHA 2F38A 3THQA 1XUZA 5AB3A 4PTVA 4IFOA 4H50A 4JHZA 4BS0A 3AIBA 2OWXA 1LL6A 2WC4A 4W7UA 2QCHA 3U2OA 3DX5A 4JFSA 1FTXA 3DUGA 4LYPA 2B7NA 1WXJA 4FLOA 3BLDA 4ADTA 2C1HA 1O7AA 1PIGA 3AYRA 2YLAA 3TYAA 5IHSA 1ONXA 4L1GA 3K4DA 3GK0A 2X2YA 5D05A 1EDGA 1NU5A 4C6BA 5CC6A 4INFA 4BQ5A 3RRAA 5A8OA 4EMJA 1TMLA 3LM3A 1MFUA 4Q8WA 3NFUA 1RPKA 2ZRZA 4ENLA 4YTQA 8XIAA 3URAA 2GGEA 4HMCA 4RLIA 2NT0A 1CWYA 2W5FA 1BFNA 2GPTA 2F8QA 2VEMA 3ZR5A 3JR2A 1ZJAA 1XF0A 2PDPA 2Z28A 2WZHA 1ZCCA 5HINA 1TRDA 1CW2A 1YXYA 3EEZA 3OLIA 4H19A 4RDYA 3LHVA 3BTNA 3LTYA 1B54A 3EB2A 3M0KA 1LT8A 1UWAA 3RN6A 3WH5A 4GUIA 1A5NC 3W86A 3L7RA 4FOKA 3GLCA 3NPXA 3UCQA 2BVWA 1RSCA 1I2OA 3GNOA 3QMRA 4QG6A 3SSJA 1A0EA 3T44A 4UTJA 3EB3A 4S38A 4P7RA 4QEHA 4Y90A 2QPSA 3DGHA 1MEIA 2JE8A 4O11A 5EMUA 1W8GA 3LMYA 4LVAA 3JUGA 4CCCA 3AUOA 5JRBA 3M4HA 1YLVA 1KW1A 1H7WA 1LRTA 4KF1A 1LWIA 4L4OA 3S5ZA 2J9XA 4A22A 3TN6A 4CEUC 4H8HA 4QHRA 1Z3NA 3BQ6A 1WPCA 1M04A 1LTDA 4NJJA 3N4EA 1A50A 4JFVA 3SRFA 2JEQA 3UJFA 3TZFA 1CXLA 2YFNA 3MA8A 4NEVA 4G6CA 5ABGA 4LQ1A 4L9ZA 1J2BA 3CHCA 1FFVC 4J3SA 4XZLX 1R7OA 1JQVA 3NQ8A 1FH8A 4PTWA 2VDGA 3A13A 1XM3A 2FZNA 3JRKA 5A8GA 3STFA 1H49A 5HMDA 2QIIA 3FXYA 3WLJA 2CHNA 3T09A 1EPXA 4GZIA 2E8YA 4H4TA 4H01A 3XIMA 4LFYA 4XD5A 1CENA 2J7FA 4LNCA 2LLEA 4GVFA 5AC8A 2B81A 3IVSA 3NZPA 3UJ2A 3VDHA 2OQLA 3SFKA 1XLLA 4L9YA 4O15A 3E0VA 4GIYA 3NRZB 1QHZA 3BSMA 4JKMA 3MHFA 5HDRA 1TX2A 2CNCA 5AHNA 3N2OA 1TZ9A 4BR1A 1DJHA 1BXNA 3FGCB 4MY9A 1M6JA 1CBGA 3GVRA 4U5IA 3PZVA 1AW5A 1FWNA 4H6RA 3O6DA 3WKZA 3GD4A 1HKWA 3VK5A 1R3RA 1VRDA 2XH2A 2IS7A 1S3TC 2PRHA 1O1ZA 1K8ZA 2PDQA 4AZIA 4AU0A 4H9VA 3LV6A 1JL8A 3NPUA 3SGGA 4C6FA 3G1VA 4K68A 2H3BA 3MDUA 4HIBA 2PA6A 2EF9A 2W61A 2YVFA 2CEQA 1HNYA 3NURA 4AH7A 3TJXA 3STGA 3FK4A 1LORA 3EOSA 3SSZA 3S9IA 5G2HA 1XDJA 1CLXA 1REQA 1JZ2A 1KWGA 1NP2A 5C9XA 1OCJA 3TW7A 2GR0A 1D3CA 3MZNA 1KCXA 4H6QA 2GQAA 1B30A 1UD2A 1PX4A 5F2MA 4XSMA 3H55A 3KRZA 2VZTA 4JDRA 2E6YA 4E8GA 1VEOA 4QQUA 3BPWA 4NASA 2XVKA 1Z32X 3RK8A 4FOUA 2OEJA 1NSJA 2DZVA 4BCEA 3MYOA 3WD3A 3UT0A 5A6MA 3HPFA 3W23A 3SCSA 2PGEA 5LNSA 1XYMA 2HEJA 3LBCA 2GR3A 4O10A 3CQJA 4H9MA 2POTA 4MM1A 5BOFA 1GETA 2A7RA 1K9EA 2CESA 4CD5A 2NQ9A 4DXVA 5C5YA 2V3EA 3I6TA 2IPJA 3GTIA 4QQ3A 3FYOA 4PGLA 5A94A 3HGOA 3LCLA 1CGYA 3W7KA 3TIMA 5I00A 4Z2LA 1VYRA 4HOZA 1I6NA 3F4NA 2ABBA 3KRSA 3W2JA 4GYFA 3C52A 1R5YA 4TTGA 3GRTA 4KESA 4OBRA 1UH2A 4E0CA 1FH7A 3EGJA 4H83A 3TNBA 3GHSA 4UBPC 5E09A 2G50A 1HJWA 1OYBA 1CB7B 5E0CA 3G1DA 5AZ0A 2GZXA 3GFZA 3KOXA 1RA5A 2DZWA 4YWOA 1ZY9A 1JAKA 1G6CA 1Q5MA 2JKAA 4QG8A 5M3WA 1XYBA 2VR5A 2VD9A 2X42A 5XIAA 1ME9A 1R3TA 3W2KA 3W7LA 1F8WA 1ITCA 4PUJA 3TN5A 3CQIA 4RNJA 5LSMA 1W8SA 3AZSA 5HMEA 3TA9A 1UP2A 2FB2A 3WMBA 2I9EA 3CT2A 2GJPA 3WQGA 1L2QA 5T91A 4KMQA 3AQUA 3RFAA 3AISA 1TQXA 1UMLA 1CECA 2A3AA 1VCVA 4FHAA 3FY1A 4UQAA 5FEXA 3ANVA 3L66A 3I7QA 5LIKX 5A6TC 3PUOA 3NWRA 3M41A 1YE4A 2ZX6A 3GTNA 5K4XA 1D3HA 3ALFA 2DORA 4HHHA 2Y70A 1R7AA 1EGMA 1MW0A 4RZBA 3H7VA 1QTWA 4ZQPA 1E9ZB 1VRXA 5H2ZA 4BURA 2JEPA 3LNMA 3AYSA 3CGBA 2DT3A 3ES8A 4BZYA 3M5ZA 5M03A 1X7IA 3M7WA 3WNPA 1UCWA 1F05A 4BHYA 3RLUA 2PPGA 4GKLA 3VFLA 1XBYA 1Q6RA 1BLIA 3H2CA 1E43A 5D30A 3VNJA 4QLJA 1VF8A 4RPQA 4EP8C 1H6VA 2AOSA 4KWVA 1YNQA 1WDDA 3NXFA 2WQDA 3B0PA 2X99A 2VR4A 2NQHA 4FA3A 2ZUUA 1DXEA 3R2GA 1K4QA 1A80A 2D69A 4NI8A 4BKNA 3OZMA 3NJ3A 4C6EA 3JZEA 4F4RA 3AHVA 3E12A 1Q6DA 1V4YA 4XZNX 3PP7A 4AHOA 1MRQA 2OX4A 5H1WA 5PTDA 1JFHA 4DNMA 3VX0A 3GVQA 2VTFA 3CL8A 1XW8A 2HNHA 1QHOA 5I09A 1MDRA 4OHQA 4PMZA 4UTHA 1BHGA 2QV5A 2ISWA 2GDUA 1KCLA 2FZ9A 4UUIA 3VNMA 3O7UA 3L2IA 1SO6A 4H7VA 2JIEA 3AI0A 2IXVA 2EPOA 3EA3A 2TPSA 1FCVA 3VOHA 2V8ZA 1F8IA 4M51A 1IGWA 1AD4A 4HB7A 4B5VA 3NNTA 3SY5A 3D5HA 3L4WA 3PZUA 3S9ZA 3M0ZA 3VIPA 3EXTA 4S3DA 1XBXA 2ZE0A 4FDCB 2VGFA 1ZNNA 4GI4A 3CGDA 4NL1A 1ZKQA 3G8EA 1R3YA 1CTNA 1G94A 2V3BA 2WJZA 3CJPA 1DJXA 5FJOA 3L4UA 1KM6A 1RV8A 2DJXA 3NUKA 2ZFAA 1NWRA 3BV7A 4QCFA 3N19B 2DZAA 2HISA 7REQA 3WEMA 1OM0A 3W1QA 3PZTA 3G3DA 4AD2A 5HNUA 2JALA 4D8ZA 2V38A 3VKCA 1FP8A 2PURA 3R8GA 3HOJA 3C86A 1FWSA 2R1MA 3GDLA 3VC5A 1YYAA 5BROA 1LM1A 4DWSD 2AMXA 1G4SA 2I9UA 1PCKA 1NHPA 2ZZ1A 4HTYA 3HG4A 2NLIA 2YOCA 4MAZA 3QLDA 1OJTA 1KV5A 3REQA 2PTXA 3PZMA 2QQ6A 1GV4A 1QDSA 4DELA 4CD6A 3KHDA 2ZX5A 2Q71A 1RA0A 2J77A 3OEXA 3ELFA 3GB6A 3V75A 2YXOA 1FFQA 4L4MA 2X1UA 1XH2A 4DBEA 4APNA 4UTTC 4IG2B 5CLWA 4PSRA 1P43A 2OG9A 1KM0A 3W82A 2JK6A 3NQBA 1RQEA 5FF0A 3TYZA 2YCEA 2D22A 1H62A 4HNVA 2Y8VA 5E0KA 3II4A 4AMCA 2YDRA 4RJEA 2WPGA 1IGSA 3HTWA 3EOLA 1AVAA 1J9YA 1O12A 1YTKA 3BQ5A 1DJYA 1I2PA 5F2GA 4DZAA 3L5MA 1SW7A 4X3ZA 2WZIA 2E3TA 1R8LA 2C7FA 3HPXA 4H7ZA 5CGQA 3LPPA 3CPGA 1PL9A 2OLSA 1FHLA 3ARVA 4J3UA 4MFDA 5C71A 1AQHA 4MKNA 5HR7A 2WO5A 4AZCA 1EP3A 1TWZA 3W6YA 4F0KA 1N7KA 3RMJA 3GUGA 4RE4A 5BU9A 1W9DM 3BARA 1EQPA 3RR1A 3PPGA 3E49A 4I6KA 1QR7A 4Q8OA 7TAAA 1XKYA 3M5YA 1UWTA 2XYLA 4FNUA 3LX9A 4HK6A 1AL8A 3AYTA 4AF0B 4I7WA 1GRGA 4ZOBA 3LHYA 4IHCA 2Z27A 3N2BA 2WQPA 4XAYA 4D6JA 1A5MC 3UJRA 1E9YB 2J7GA 3EDKA 5F1UA 1K3UA 5FA5A 3LBOA 3THDA 4HPNA 4XQ6A 1XLFA 4O1FA 4Q4MA 2HDJA 1AZ2A 1PWMA 2W0UA 2ZXDA 3UZZA 3WDIA 1NOUA 2FZ8A 1OBAA 4RDWA 1C29A 2VM8A 2DSKA 2QJGA 5D2YA 1EGZA 1ONRA 1LOQA 2A21A 1IXOA 4N6EA 5D04C 5D2WA 4EE9A 3GU1A 4B4FA 2NSOA 4C1KA 3WDPP 3W0KA 4AW7A 4N2YA 5CZSA 4XZMX 1DWFM 2PB1A 4KEUA 4DUWA 4IT1A 2ALRA 1MWOA 3WL1A 1DJGA 1J0ZA 3MCOA 3E6EA 2R1KA 3WQ8A 2WSPA 4GO9A 4DJDD 1N2VA 3GBDA 3U8GA 3P14A 3U7VA 2ZRYA 3AUJA 4TQTA 5HMSA 1W54A 4KWWA 3GFXA 2WWDA 5H6HA 1K6AA 4KCWA 2W54A 3UZJA 3GTHA 2YZRA 2EG6A 1BAGA 3N34A 4HKPA 2Y7EA 3LPGA 5D8ZA 4G2DA 4EVZA 2PD5A 5KZMA 2FJKA 1D7YA 4C91A 2RGMA 4X22A 1V5XA 3B06A 4KERA 3V18A 4QS5A 1OIMA 1W3NA 4IPIA 3NQAA 4JTSA 1N5WC 4IZGA 4EX4A 3ZVIA 4DQWA 1PCWA 1Q2RA 1JD9A 2PRMA 1TELA 4NG3A 3S5NA 4IIEA 4OE7A 1GREA 2HVMA 1V02E 1TG7A 2O9TA 2GQWA 1K7XA 1N61C 3W7PA 1UH3A 1FCBA 3A4WA 4YTSA 2O9PA 4LT9A 2WVUA 2VKZG 4GFSA 3AHZA 3IV8A 5AECA 4JTTA 3H2FA 1X8CA 4ZO9A 4QSFA 1UP0A 4UFJA 3W25A 3IWPA 1J5TA 5REQB 4AZGA 4HNLA 1IWPA 3UWZA 2BGSA 2QUUA 6ENLA 3SADA 1GVSA 5DO8A 1W1VA 5HUOA 1WKEA 2O0TA 4NAEA 5LNWA 2P50A 2BXYA 2QUTA 1UD4A 1RJQA 1M3UA 1NELA 3VOCA 3OP2A 2V30A 3V3WA 2QZRA 4NI3A 1AH4A 5CPTA 2HK0A 3WLSA 5I03A 1MO0A 4NY2A 2QGYA 1ZFJA 4KGJA 1POKA 1KFJA 3H6OA 3GDKA 3DBPA 1TE6A 2OSWA 5I79A 3RR4A 2E9BA 3DCPA 4XZ9A 1XHGA 1HGYA 1ZU8A 1UWIA 1ZBWA 5L6UA 1WCGA 1HKIA 2XGBA 5HAOA 4ZFCA 3K5XA 3GDRA 4QAWA 1BPLB 2A6LA 3SCUA 1RK6A 2ZQ0A 3N2XA 4KEMA 3W7GA 4NILA 1EIXA 4GC3A 1OD8A 2CZEA 2PDYA 1TPWA 4W88A 3UZYA 1UR0A 4IPJA 4PL1A 4X2PA 4AZBA 1FEAA 5CSYA 2INEA 1X2GA 3WLKX 5JCLA 4Y9NA 3ZSSA 4ZZ9A 1XWYA 4FNPA 1BWCA 2G4FA 2YBVA 4PCTA 1REQB 4MZ8A 1LLZA 4LOCA 1BWLA 1ZJHA 3P81A 4NRRA 2ZUMA 4IFRA 1TJPA 3PS7A 4JTRA 1QK2A 2F5ZA 1XIGA 2Z25A 3WD2A 1OD0A 4OZOA 2GGJA 3T40A 3L5AA 3BXWA 2XM1A 4ERGA 2VHLA 2HQAA 3HGRA 2XVPA 3HIJA 3RPDA 2GOUA 4HCHA 5EMYA 1XLKA 1JCNA 1BQCA 2DVTA 3NO3A 2CERA 3KVLA 1CLKA 3T2QA 2IPWA 3QSTA 2YCLA 4E3VA 1JZ3A 3LNPA 1RALA 2C6QA 3W1LA 4IMDA 3QPYA 2A3EA 4IJCA 4JX4A 3WDQA 2WM0A 1JIBA 5EBKA 3QR1A 3ERPA 4Z1DA 3W37A 2WPEA 4MB5A 2OZTA 1CX9A 1UR1A 3ME3A 5J5DA 1BTCA 1UD8A 3SBFA 3RPTA 1W32A 1XIFA 1QCWA 1LP6A 4IPNB 2YYTA 4DB7A 3B9OA 2FPTA 3ARUA 1F5ZA 5DXXA 4B3ZA 3C2YA 3FJLA 5CPSA 2PGRA 2QUVA 3VIIA 2FB3A 2WHLA 1AQFA 2ZRVA 2RH9A 2VCBA 3CYJA 2J7EA 3CAVA 3NYDA 3H12A 4H4YA 1YBQA 2E6FA 4Q8QA 1Q13A 3DIPA 3SR6B 3IJLA 1IEVA 4K1WA 1WDPA 4R3UA 1P0KA 3F5JA 2XHYA 4H4ZA 4L61A 4D6HA 4AISA 2QJIA 2CXGA 3EX6A 1O5RA 3ZS4A 4PMJA 4ZB2A 2E5AA 3N17A 2NXHA 4O18A 5H8MA 1WB0A 2QUMA 1QBAA 2B7OA 3N4AA 2OO0A 4JTHA 1P6WA 1V93A 1EDTA 1X1ZA 5D37A 5K2ZA 2I7GA 1W1TA 4B91A 5JH1A 4NAFB 2QYGA 2QJNA 4REQB 5FAJA 1KRCC 3IPWA 1KKOA 4DVOA 3SY1A 2OLAA 1OFDA 3E2VA 1GXFA 4IICA 2E0PA 3UY7A 1R46A 4UWMA 1H5VA 3EA1A 1XSJA 1U2YA 3OVQA 2VEPA 4DWSA 3VX1A 4AXNA 2OYKA 4UMBA 3OBAA 2QIWA 2R91A 3RO8A 3INPA 4NVTA 1NHSA 3ITGA 3KP0A 3LRMA 4QCEA 4YL2A 1DKWA 3TFCA 4GWEA 4M6VA 3RGTA 4HU4A 1LQAA 1KXTA 3N29A 3N6QA 1OC5A 1IZJA 4PMQA 4M5PA 1RCQA 2Y0FA 2JBMA 3E2SA 1WKDA 4MIMA 1J96A 1E72M 3H4GA 1HJQA 3M46A 1UKTA 3TMQA 2INFA 3NTYA 2X8CA 1LPFA 2VZSA 4KPLA 1QWKA 2A3HA 3F5LA 3W6LA 5C70A 3MWCA 5SWUA 5MF5A 3V5FA 3N2CA 4GG9A 3BURA 1ZQ5A 1H2IA 2FQIA 2FVKA 2HRWA 3R10A 2D0FA 4AIUA 4N0RA 4OT7A 2V2HA 5G5HB 4EPKA 2OQYA 1SZGA 1MUWA 1F4AA 3SUSA 3NVWB 5CJMA 4LC8A 2UV8G 2A3LA 1CGTA 1AL7A 3BW3A 3ANYA 1GVFA 3EWZA 4GK8A 3E0FA 3ECQA 2J13A 3DHUA 5JQ9A 4ADUA 4KCUA 3PB2A 2YCKX 5HANA 4IL2A 3EA2A 4I5XA 3KL0A 4AMAA 1N55A 3HO8A 3B0UX 4JX5A 2WC3A 3ABSA 2VOTA 4KT2A 3SB0A 1XLGA 4IISA 2PD9A 4X0NA 4IGMA 3SCPA 1B90A 3L5LA 1BYBA 1FA2A 4LBUA 4BQ3A 2HVOA 1TA3A 4HGXA 1ISYA 1J0JA 2ACSA 3CS2A 4MNJA 3LQGA 4ZCWA 3AU6A 2IW0A 1N82A 3LCHA 4HT3A 4EXQA 4TVUA 1W5NA 1H5YA 1SPQA 2FGBA 1DOSA 4XBJA 2C13A 3B8SA 3CUHA 4PMDA 1VYPX 1RLCL 3GVVA 1A5KC 1G01A 3THCA 3BLEA 2R1PA 3FSUA 4I5RA 4E2VA 1TVLA 1XIMA 4M7TA 6CGTA 3YPIA 1SFSA 1BYDA 4O0QA 4DN1A 1DXIA 2PWUA 2X7VA 1IIHA 4IUOA 1EC9A 1E4NA 2AQVA 2H90A 2GSHA 3WBXA 4IMAA 4Z2KA 1SR0A 1S5MA 4TMBA 2ZRXA 3F4DA 3H22A 4ZGYA 4NZ4A 4ZSUA 4HOWA 2VXNA 3PTDA 3MI6A 4DJDA 2H8XA 4AD1A 4XZIA 1Y0EA 1B3YA 2C18A 4KCTA 4B15A 4IIHA 1GRAA 4J35A 2GSEA 5I06A 1GTEA 3KDOA 4TV6A 3ZWTA 2PRLA 3I7RA 3NOYA 2O4MA 4WSKA 4DZIA 1XDMA 4E5TA 4KFOA 4JTJA 1DNCA 2VX4A 6XIMA 3W73A 5BZAA 4JFTA 2OZ3A 1JEHA 3MP4A 4K1GA 1RCOB 1I9CB 4YHEA 5I3IA 1FWEC 2R94A 2AKMA 4LUSB 4WGHA 2C3DA 1KRBC 5IHRA 3VIJA 1LVLA 3T42A 3TJIA 4XUYA 4RR4A 1JPDX 1V08A 4TVYA 2PDJA 4WY0A 4AZCB 3MC5A 4WXZA 4CQ9A 1EJWC 2P8CA 4DUVA 4JIHA 1JDDA 2X1RA 1AK5A 4MOZA 2E5DA 2EKCA 3A7AA 1SO5A 3N12A 3TROA 1WXZA 1XQLA 1OIFA 5IFTA 2WVVA 3S1WA 1JD7A 4KRZA 2GUYA 3LI0A 2PWGA 2PWEA 3NDOA 3PAOA 3LI1A 3TSDA 4F0HA 3LV5A 1QO5A 2RJHA 2BOGX 3U2EA 2Z7KA 4DJFD 4ZQRA 1ZAIA 2HROA 1JDAA 2WPFA 4UQBA 2QULA 3NDYA 3WBWA 3CIXA 1BYAA 2YR1A 3VOFA 4ATLA 3TKFA 5LA0A 1CXIA 1QNRA 3L5OA 3AMLA 1A4MA 4H4SA 4PMRA 1S39A 1FDYA 3EZ4A 2WBGA 3ATYA 4A21A 4TMCA 3UCCA 1DIOA 4UR9A 4J56A 2PDGA 1LUCA 1O6IA 3PUDA 2VRJA 3M64A 1PYFA 4Q6JA 4HYWA 4L9XA 3WQOA 4ROPA 1HKVA 3EKZA 4KW2A 4UC5A 4B5SA 1M53A 2PLJA 1E56A 2E77A 4HMNA 4Z0SA 3D9XA 1XS2A 4O13A 2GJRA 5I07A 1C92A 3F4CA 3DG3A 2V69A 1OCNA 2CETA 3ISIX 2VDHA 2EG7A 1X2HA 3WLOA 1R2SA 3SRHA 1A3HA 3QZAA 1FWBC 1X7FA 3RG6A 5ABEA 3USZA 5D9OA 3ZJ8A 2NT1A 3IAQA 1UZ4A 5I23A 2YPIA 3T8QA 3KVJA 2YL6A 1SM9A 1KNWA 4IMCA 3RITA 2WJFA 5A8PA 3IS4A 1ZK7A 1XLAA 3PBVA 1GONA 4MSSA 4O1CA 2PWFA 1Q1RA 4YVPA 4O28A 3U48A 1DQWA 5AOUA 1VBUA 1HVQA 1JPHA 3V0SA 2BHZA 2HE5A 2WHKA 1Q4WA 1J8VA 3CUFA 1QNPA 3WQWA 4P7QA 5AVNA 2ZCGA 5IBXC 2YYUA 1N60C 5CPOA 1TYGA 4X63A 3L4XA 3VFCA 1M7JA 3MKKA 4HSOA 1E3XA 5KINA 3EMCA 2QCFA 4W84A 3WLPA 3TW9A 3VABA 2CLIA 4QG9A 1WAUA 3EYPA 3MUCA 1NDVA 1EWEA 3I68A 4JNYA 4PZVA 1VIZA 3W2MA 4I90A 3BZGA 3QGKC 4TX8A 1UWUA 1UPMB 4HNOA 4S3JA 4M6PA 2AL1A 3OW1A 4ZMGA 3B8IA 5D33A 2WMKA 3C2EA 5D9PA 2IQ0A 1HGWA 4WKHA 1CGXA 1GPWA 4O1EA 3AC0A 3S5YA 2ZTJA 1RHCA 3QR0A 4HU3A 1R6WA 2G95A 3II1A 1S2CA 1VP5A 1LROA 2E1WA 3E5PA 1ONFA 4NZJA 3E5BA 1U1JA 2BX7A 3URNA 1XH1A 2VCCA 2D2JA 3N25A 4HZ7A 4GNJA 2YSWA 5DBUA 4LCRA 2EBNA 3CGEA 3NSNA 3SEPA 4O8AA 2VFIA 5E9XA 4ES4A 2V3DA 3SCNA 3NZ1A 4G7FA 3S5OA 4JR5A 1V97A 5CZKA 2J6XA 3EOUA 3KHJA 3GQYA 3AHTA 3TLQA 1V7YA 2E1DA 3LXAA 3RYSA 1J10A 4B9ZA 4XZHA 3MSDA 4LF2A 1NHQA 1YE6A 2PDBA 3GX9A 3OODA 4W8BA 3QFWA 3POHA 4QDWA 4BEQA 4C6IA 3L68A 1GCYA 3MKVA 4HQVA 2Z1WA 1V0NA 4QITA 3W1RA 5I3KA 3M5VA 1HW6A 3RLVA 2W92A 3LGGA 2O4QA 4XSLA 2PAJA 3O0HA 3GZAA 4JZ5A 3SCOA 2GVYA 4W93A 4AYSA 4US5D 1VD6A 1YDNA 4G9PA 5JCIA 2FPYA 5DLCA 3L9CA 3E2RA 4U3CA 1ADDA 2PGFA 5A69A 3ABOA 2OYMA 1DWGM 3AMGA 5U7SA 3VKAA 4GNKB 2QDDA 1JUKA 2D20A 2EQ8A 4Z2JA 2QJJA 4H4QA 2VYOA 4PMVA 1W9PA 3KW3A 1C8XA 3K13A 4I7VA 1YPXA 3UERA 3GTXA 4K36A 1WUFA 4O1AA 3QMSA 1W1B1 3N15A 5G5IA 1WZLA 3AIUA 2PMQA 4AX7A 1RP9A 2VC7A 3A4XA 2ZVIA 4B5WA 3W2NA 1TPEA 4Y96A 3LLDA 2D0GA 2UY2A 4UFKA 4Y7EA 1JOAA 1XJBA 1OJXA 2O92A 3VNDA 4J3TA 1EH9A 3EWWA 4LXFA 1HJVA 3RX3A 1W17A 3V1PA 4UZUA 1EXBA 4B5NA 1H7RA 3GG7A 3QGVA 3S2NA 5LNUA 1B57A 3EBVA 3ABRA 4D6FA 4PH6A 3SAZA 4GYPA 3SGZA 5DEZA 4BK9A 1IF2A 4N6FA 1V6YA 1H63A 2VRKA 4C6NA 3ARSA 1ELSA 1BXCA 4TU1A 3A23A 2C3ZA 3TSBA 2HE8A 4XK2A 1DJQA 2E09A 4EACA 5HK4A 1UA3A 4GZEA 4M6QA 1QUMA 1G0CA 3ARPA 4G56A 3KS6A 3FA4A 4U28A 3B03A 3TW6A 3W7EA 1U83A 3KFTA 1HL2A 5DT7A 3PZGA 1JYVA 1S5NA 4C6CA 3QHNA 4QDPA 5CLTA 2OOFA 3AMZA 1GZJA 3NS1B 4U5KA 3M5XA 4XAZA 1SJCA 1XD1A 2PDKA 3QQ1A 4BI7A 3WF4A 2NQJA 4B16A 3UR5A 4HNNA 3OBEA 3N18A 2Y24A 4Y2WA 1Z41A 2Y8UA 3FAXA 3GSMA 1VR6A 2W79A 4L6OA 4XVDA 1KN0A 4U2ZA 1D3GA 4CGTA 5DRCA 1ZALA 5BMWA 3WQFA 4WJEA 2X16A 3N6HA 3LRLA 3KVKA 2DH2A 4I9TA 4M19A 2QGHA 1Q63A 4JN7A 1YDOA 3FNDA 3MKCA 2HPMA 1W1IE 2G3NA 3C0SA 4PULA 4DNHA 1OFAA 2V82A 3M0JA 3L0KA 2VQUA 2CLEA 3UJSA 3FDGA 2W91A 4JQ9A 1Q6EA 5JBFA 2A3CA 3EX3A 3MHUA 1W5OA 3VIKA 4CQAA 1TPVA 5CJ5A 3S6OA 1PIFA 1UUQA 3GG0A 4A4AA 3Q67A 3WH7A 3U2CA 2HXUA 2OEKA 1V6VA 4K6AA 3VDCA 3I4EA 3DHFA 3LYEA 1KBKA 3Q37A 2WSYA 4DEFA 1V3JA 4YCOA 4Q8VA 4XBSA 2FPVA 3P5ZA 4PBFA 3QH2A 1VZWA 1XH0A 1STZA 3ARWA 1F61A 3P67A 1M41A 3SUWA 3MI3A 3PNUA 4OTKA 1XGEA 3U2ZA 1ZJIA 3QHMA 4NX5A 4D1IA 2YZ5A 3SIMA 1SR9A 4LCQA 5A2BA 2ZWZA 2YGYA 1D2KA 4J7RA 4LW7A 1UZDA 1QNVA 1EJTC 4MJMA 4AIEA 3CV7A 5G5GB 3LN3A 1EDQA 2PI6A 1UBSA 4DJFA 1WQ5A 5LIYX 1CDGA 4OFCA 5TR3A 1HG3A 1LBLA 4UNIA 4IP4A 3TE9A 3PPHA 7XIMA 2XTKA 3LU2A 4O19A 4HHLA 3GW0A 3LENA 3M0XA 2PDWA 3W2UA 4EKJA 1X98A 4RXGA 2R14A 1Q7ZA 4OUIA 4UNLA 2W0HA 4RX0A 3M1ZA 2HSAA 3AYVA 3ZO9A 1KXHA 3MCNA 3SECA 1DXFA 4MZYA 3OA5A 4ICNA 1XHCA 1NH6A 2YIHA 1V8EA 1S5WA 1SYTA 1OYAA 1I60A 2ZRWA 5A5WA 1Q8JA 2ZIDA 5HPCA 3ZOAA 3L8KA 3OA3A 2P88A 3OZPA 3OVRA 3OU8A 1H61A 1B4KA 5J5RA 4KCVA 5LZLA 3A7UA 1C8QA 2CW6A 3M44A 4NHVA 1OFPA 1MXDA 3LXDA 1GOOA 3A24A 5FJJA 2I5QA 3W26A 2B7QA 2FZMA 1KBBA 1I1XA 2POZA 1UR2A 3UVIA 1K4HA 4AUBA 3WD4A 5FEZA 4N4PA 4IX0A 3IK2A 5DN1A 3KRUA 3NVTA 1OC6A 4GCAA 2BFGA 3QSRA 2CWXA 4GISA 1FHVA 3CV6A 1HKJA 3R5EA 4LVBA 7PTDA 5BRQA 5ABFB 4XKYA 3OG3A 2DW7A 2QDHA 4A3UA 2PP1A 3MANA 1JFXA 3C8FA 3WD1A 4F9JA 1XSIA 4GIRA 1DWIM 4W7VA 2C0HA 4NYYA 1FWAC 5LYRA 4GQQA 2VFDA 3VOJA 4LUTA 2XJ7A 3SO7A 1J6OA 3UGRA 1UD3A 4H9ZA 3BCJA 1VJZA 1XYAA 4WSJA 1ZZMA 1NPXA 1GRHA 1M5WA 4FXFA 3IUHA 1N8FA 2GJXA 3VD4A 1HFBA 2VWSA 1S2UA 4WDWA 3TOYA 5BMXA 3IGUA 1VEMA 4RZ4A 4UMAA 1EZ2A 1BG9A 1PSCA 3I3BA 4PBGA 3CAQA 4DI9A 2EO7A 3CV1A 3TOPA 1LQ0A 5DRIA 2PU0A 1QNSA 2GGHA 4AY1A 4GQ0A 2YXXA 4GY7A 2HBXA 4DO7A 1ZX9A 3C56A 4PB5A 2Q02A 1I0BA 1SW0A 3MJMA 3L67A 3PANA 5AKQA 2V5CA 1TX0A 2WVTA 3WH9A 1J18A 3B05A 1WZAA 3WD0A 1JZ5A 3ITXA 3VKDA 3WQDA 1TIMA 4PEKA 3DFNA 3KL5A 4GZ7A 4URIA 3SN0A 5HULA 4HK5A 3W53A 3XISA 4AD4A 2ANUA 5AHIA 2XFWA 2DZPA 3F2CA 4N9BA 1EYWA 3OC4A 3H7RA 1UD6A 4FX7A 1O95A 5K4ZA 4HSNA 1QI2A 1FHUA 5HQEA 1SO4A 2GL5A 3WO8A 3WENA 2X1SA 1WV2A 4MLJA 4GGHA 2QV4A 4LALA 4D6CA 1U5VA 1LL4A 3GM8A 4KWOA 3VZXA 4G7EB 3GR7A 3G2GA 1X97A 3G1RA 2WLZA 3O0KA 4J40A 2YX0A 3UR7A 1HKKA 1BKSA 2CLMA 3FDKA 1UKOA 5T9CE 5FKYA 1ZCOA 4UQCA 3RUBL 3UA4A 1TV7A 1GOKA 2MNRA 4X9YA 1TJ2A 4Z17A 1UZHA 4B5UA 4US5A 3QJAA 2PEVA 5K9CA 5CSSA 2NZLA 1CB2A 4ZQCA 4Y6GA 5JBEA 2ACUA 3UXIA 4HNCA 1KXQA 2EEXA 3ITCA 3W7QA 4ZBCA 1Z7AA 3OIHA 5AZ1A 3TV8A 5BWFA 3EDDA 2QCGA 3QFBA 1TJRA 3WX7A 4UCFA 1L2UA 1NQ6A 4JIQA 5G2WA 4FNRA 4MPQA 4LY8A 2BXVA 4GYJA 2J8TA 2C79A 4K7VA 3FX4A 4ECLA 4N7QA 3GR8A 3FA3A 4QRNA 4A8IA 3VU2A 3WUEA 1BRLB 2ADAA 1QPNA 3E1F1 1F4HA 1JQXA 3BOLA 4JYDA 3GG8A 3T8LA 5JXQA 4HBKA 3KUMA 2PWHA 4A3YA 4ICCX 1UUOA 4MFEA 2OZ8A 1BWVA 1PKYA 1IZKA 4X9SA 2Z29A 3DU0A 3SJNA 4PYSA 4I5UA 2OT1A 2W67A 3G0SA 5DMMA 3G5EA 4K37A 5HNNA 3EWDA 3OBKA 1KFCA 3L2LA 5RUBA 1V02A 4OBSA 2DIKA 2X1IA 2W3RA 4RNHA 3R89A 4N42A 2UWFA 3EANA 1GERA 4YVXA 1JPMA 2R1NA 4GE8A 5FESA 2QKFA 2XFRA 2PF0A 1EZWA 3CPRA 5BRBA 4HPGA 4FSAA 1OSEA 4E2BA 3W76A 3WLNA 4PUKA 4FEZA 1LF1A 3ARZA 1D7FA 3BMWA 1VFLA 3L65A 3N9SA 2JGQA 1VDVA 3G1FA 4OOUA 3DFQA 1PDYA 1H7OA 4OWGA 5EMMA 5LXXA 3S8HA 1PTGA 3W1AA 4CQ8A 1F2JA 1O1HA 4LSBA 3A5FA 3IIVA 3OO2A 1YRRA 3NG3A 1DJNA 3AIQA 3KL3A 5C55A 3DFOA 2VCAA 3PPFA 4K38A 4KEVA 2PUZA 4LIIA 1WXYA 5A1AA 4KFNA 1G4EA 1TMQA 3N04A 4KFPA 2C14A 3KLLA 1G1YA 4CNPA 3G1AA 3BVJA 1WNOA 3TR2A 2HXTA 3NZRA 3PBMA 1PAMA 1KFKA 3S9YA 4NYUA 2Y7FA 4J3ZA 4WVXA 3C2VA 3R07C 1A4LA 1Q45A 2BXZA 2PDIA 3VNIA 1GG1A 5D38A 3KP1A 5F1VA 5KZEA 2NWSA 2WNZA 4AZ7A 3VXGA 2HZGA 3QV6A 1K8XA 3THUA 1JYWA 4M6UA 2J7DA 3NVYB 3WCZA 2GGIA 2C15A 4H9UA 2RJGA 3IGSA 2PTDA 4Z1BA 2J24A 1S2TA 5IM51 3NQEA 1V59A 1QI4A 4JTLA 2DZXA 2INZA 4XWUA 4J9JA 1E4LA 2PWDA 4ONVA 1W5QA 4FIRA 2WOQA 3GNNA 4UR8A 1WKFA 3IEBA 1K7EA 1FFUC 2VFFA 4UMCA 3AS2A 1MW2A 1TV5A 4N4QA 5ECUA 2D73A 3PWAA 1MW1A 1MYRA 3O07A 1DBTA 4W86A 4PMOA 2BS9A 4E38A 4LRSA 2J4GA 2WLYA 3B0YA 3B9NA 3BLPX 2CLKA 1XUUA 2BASA 1E55A 4GD0A 2GWGA 3UG3A 4DF1A 4R9XA 1Z42A 2Y1HA 3PSVA 1ZTVA 3O6AA 4K8EA 5AC5A 1JUBA 1S5TA 4PUDA 2YJQA 1PV8A 1ENUA 4AFYA 2VURA 3V0UA 3QKEA 1QJWA 2WYSA 5ENLA 1NOFA 3FG2P 1UJPA 3LERA 4YNGA 1Q3NA 3FSTA 4KWSA 2JF6A 3OLDA 3H4XA 3TYCA 3WNLA 1QNQA 4UTKA 3ORWA 4XB3A 1M6IA 1Y65A 3LUTA 3NQVA 4MHBA 3QPEA 4DYEA 5I5RA 2Y63A 1I2QA 3BCDA 2DUXA 4H3DA 1K03A 1OADA 3OG2A 4YWIA 3AXXA 2I57A 3P62A 2XFFA 1Y5XA 1B3WA 3QXBA 4D6EA 3BGGA 1NM9A 2X0YA 2GOKA 1RK5A 2HV5A 3KX6A 1QI5A 3SN1A 4U3AA 2ZZ7A 3GWQA 1K9DA 3ABZA 1T5AA 5KZDA 3MVIA 2VZOA 3DI0A 1BD0A 4D71A 5EFFA 3LLXA 2Q09A 1TZZA 1SVDA 3MCMA 3R8RA 1W56A 1W9VA 1P0NA 3HMCA 4NNBA 4MWAC 4YVVA 1G7UA 4HP5A 1JCYA 4HJWA 4Q7BA 5LGZA 1BVZA 1AJZA 2NX9A 4DO5A 1TYPA 5M5DA 1XG3A 3M9YA 5E6ZA 3AWNA 3W7IA 1EL3A 3C0LA 5GNXA 3ZVHB 1TE1A 2FHCA 2XGIA 1DWHM 3DK4A 4RCXA 4ACYA 9XIMA 2WNWA 2G5WA 4J3VA 5F4SA 4NXKA 3V4BA 4AZHA 1YXCA 4LUIA 3MHGA 1KM4A 3URHA 3OLGA 5CPNA 5C7HA 4HPHA 3WLMA 1W2VA 3UG4A 3HQ1A 3CTTA 2BGNE 3GXDA 3E96A 4LVGA 2ZWYA 4LWWA 3CUXA 4GJJA 3DJGX 3GNPA 3SW6A 5D2TA 5FEWA 4LF1A 1UOKA 1SGJA 4PODA 1VFSA 1RLDA 4BQ4A 4MLRA 1XANA 4UTLA 2EGZA 3MPGA 1EUAA 3SCWA 4D9PA 3LHWA 3CEPA 3W75A 3PF3A 1SMAA 3BAKA 2CYGA 1B2YA 3W22A 4LCSA 4JTCA 2PLCA 3KBSA 3TU9A 1NAL1 3WK3A 3THAA 2PF8A 5EGRA 2BVTA 4GXMA 2FLIA 1FWGC 1XISA 2B4GA 1CXKA 2NPXA 2VVNA 5FF2A 2RDTA 4H6KA 3W24A 4Q8NA 3QQ0A 3QOMA 5I3JA 5A8MA 4WGXA 4PCSA 3DDMA 1UUMA 3TYEA 4GBUA 1WDRA 1BQGA 3VMPA 2DY3A 4F8XA 1OINA 5FF4A 1YIXA 4JY8A 2XN0A 4E2DA 2GVLA 3UPMA 3GH4A 1H11A 1RD6A 1N8IA 3LK6A 1XRVA 3W7MA 3MSGA 3KDNA 4GH3A 5HATA 2QAPA 2VFHA 1TUXA 2P5NA 4GX8A 8TIMA 1U5JA 3UXDA 1Q7MA 1E0XA 4L7ZA 3LCFA 1IV8A 5TBOA 2XVNA 2XVGA 2C1IA 4MADA 3DG7A 2XVLA 1FO4A 5C0QA 1KM5A 3TQ0A 1RBOB 1W3LA 4PCFA 2P3ZA 2Q3RA 2V5BA 1VPXA 5JCMA 1IXPA 4F40A 2GUBA 4Z1YA 3ARQA 3D46A 4IP5A 5C9WA 4JIIX 3R58A 1GQKA 4AWUA 5IXEA 5GVJA 1XCXA 3UCDA 1H1NA 4RDVA 3WF2A 1FY6A 4KRUA 2F2KA 4MJ2A 4B3KA 3DC0A 4XIAA 3L4ZA 5BCAA 1ZMDA 4XKYB 3NL5A 2CBUA 4F2TA 4OVXA 1HJSA 4JBRA 3FN9A 5AYYA 1G5AA 3OGRA 1IQ8A 3GNRA 4C7DA 2OJPA 4LUTB 4IXHA 4O16A 2O7QA 5FJRA 3UWWA 3FJ4A 3RRXA 4W89A 1TWSA 3P61A 1IWAA 2DQWA 8CGTA 1PJ9A 1UWSA 1BSLA 1FOBA 4J2PA 1ADOA 3RM8A 4MB1A 3TAKA 1IWBA 3HG2A 2VQTA 3G1HA 2ZA3A 1M7PA 4EWND 2GUUA 6REQB 3HPSA 4HOXA 3WBAA 4BV6A 4MDOA 1MI3A 4M56A 3SQMA 3R6IA 5XIMA 5A8NA 5CGTA 1XLHA 1Q6GA 1RH9A 2VEIA 2B31A 2HS8A 2ZXQA 4PSPA 3BAWA 4CQCA 1EFZA 2YBUA 2ZDSA 3AIEA 2QVNA 5MHBA 4MJZA 1KBIA 1A0CA 2HJPA 2OYLA 3E2QA 5E6YA 1AH0A 5FI8A 3QVQA 2V5DA 2ZZ3A 3AO0A 4S39A 3P6LA 1Q2SA 1W6TA 1NDAA 3LEPA 2WHMA 1V79A 2DIJA 2PU1A 2UZ9A 1KTNA 5AN7A 5D4YA 3NGJA 1F3EA 4C60A 3WF0A 4NXSA 4RL3A 4GJIA 4JKLA 1F3XA 4QEEA 1WO2A 2J7HA 3QW3A 1A3XA 1H1YA 4J27A 3NQFA 4RZ5A 4KQNA 5M2FX 3GIPA 4JDBA 1NVMA 3WQEA 3AIRA 1OQFA 1ODUA 4DF2A 1IXQA 4FMVA 2FFCA 5B80A 1NIUA 5BWAA 2OT0A 3NL2A 4A3RA 4X2RA 4AC7C 3KAOA 1E6RA 3T78A 5CEWA 5KITA 3NQ6A 3GHRA 2YVJA 3O05A 4C6JA 5KVHA 4JY9A 3SM0A 3LPOA 5BNKA 1LBMA 1F6KA 3LSCA 1DVJA 1XGZA 5IDZA 2VEKA 3MWAA 1W1A1 3P8JA 1QBBA 3G3MA 1J0YA 1S46A 1U1HA 4MAVA 3W72A 1OZMA 4RE0A 1SQ7A 1IT0A 1PTAA 3EDEA 4M29A 4RV3A 2FFIA 1KQZA 1XP3A 2WMIA 3BWWA 3A64A 3FJNA 1RY8A 1VKFA 3AS0A 4IJRA 5HJYA 1EJXC 1JCXA 2XIJA 5GNZA 2D3NA 1UIPA 3WMSA 3E0WA 1QNOA 3WLQA 1EOMA 3UA3A 3DG6A 1FWCC 1BF2A 3BG3A 3BSHA 1J0IA 4B92A 1F07A 4O53A 4OJYA 3T6CA 1FWDC 3C6CA 1OFQA 3FAWA 1P7TA 2Z1XA 4RE3A 2V68A 3LHZA 5E93A 1VBJA 4DUXA 1A5LC 1US2A 4DAIA 4RK8A 2CZ5A 1GUVA 2P1FA 4NRSA 3ID7A 4TX6A 1XRFA 3QPZA 1W9UA 3W4RA 3GIYA 2C0AA 2EJAA 1I75A 1K70A 3UEQA 5AC6A 4GGBA 1WKYA 3PBWA 3B9AA 3CTLA 1MMFA 1YPFA 3M0LA 1JUEA 4EM4A 2WB5A 1EJ7L 3WG6A 2EHHA 4K7ZA 4O57A 3CIWA 4LTSA 1TWIA 4FF5A 4EXBA 1LBFA 2XG9A 3E0IA 5EA9A 2FTYA 4HZMA 1A47A 4A3HA 4GKTA 2GVEA 3KTSA 3LCGA 2JKPA 3PFMA 2DGAA 2J27A 2OKOA 2ZX8A 5DT5A 3GD3A 1M68A 1KLYA 3W83A 4V33A 3U57A 5D09A 2PDUA 1EEPA 3AIVA 1B3XA 4UR7A 3BH4A 3TXVA 1JCJA 3KRBA 4JS3A 4F0LA 1I2NA 3T0DA 2GK1B 1TKKA 5M1TA 4P8XA 1TR1A 2QCLA 3MMDA 4OIFA 2C16A 3W7HA 4UQEA 2NWRA 4UQDA 1AJ0A 2JIWA 3KWXA 3RJXA 2WXDM 4U4MA 1XC4A 1XICA 1S38A 4D6GA 1JDFA 1C8VA 3BMXA 3FHAA 3H2NA 1M7OA 1W37A 3JZUA 2YB1A 5KVIA 4IQJA 3RX2A 3TLLA 1X6LA 3R94A 2RKXA 4HU8A 2YA0A 3C8NA 2FDSA 5TQLA 1PE1A 4LB4A 3UWYA 3MUXA 1L6SA 3TWBA 1HXJA 1DEDA 2BC0A 3RU6A 1YNPA 4DWDA 1DV7A 2BWGA 3TK7A 1FEBA 5E70A 2J3NA 3W70A 1VLIA 2F6XA 3ATZA 4XAGA 3WYZA 4H4UA 3K4AA 1XR2A 3DK9A 2R24A 1WDWA 4ZQMA 4M8UA 4JTUA 1HKMA 1FBAA 3GU2A 2A4AA 1VFUA 3TTQA 2DVXA 1FIQB 2P53A 2WOIA 4HN4A 1OX4A 3GXFA 3W38A 3LHUA 1XG4A 3ARYA 3TN4A 3E9AA 3NPWA 4HTBA 2OFJA 1T96A 4JCMA 3QZEA 5CAHA 2E7FA 2D2HA 4UTWC 4FALA 2BVDA 2OVLA 2BHUA 2RFGA 5GNYA 2QEZA 1R2RA 1FUYA 2ON3A 4R7JA 3A9BA 3LCWA 3KEHA 3K8LA 4LYRA 4EMIA 1PWLA 2E67A 3RJYA 3D3FA 2Y5JA 5GJMA 2EAWA 4AAJA 5CBJA 1RZMA 3UNTA 3MMUA 2FTWA 1A5SA 3FVMA 4HMDA 2A85A 3DJJA 3MI2A 1SO3A 3G1XA 3W1NA 1UH4A 4YWSA 4L1XA 3TVAA 3KCLA 4DY1A 4EQRA 2PS2A 2QCDA 2G0WA 3AU2A 1YQZA 3WNNA 5FS7A 1J0HA 4MKVA 3UFYA 4JKKA 2DQXA 1RCXB 2ZUSA 4OOZA 1GKQA 3OOQA 1XBZA 1K9FA 5JCNA 1R3SA 3W07A 1XFCA 3DFTA 1JAEA 1L6YA 1GQNA 1DIEA 3QV7A 3V1HA 1GKRA 4MGGA 2EPKX 1EIBA 3A21A 2I5IA 3W7CA 4WUIA 4AVNA 2BOEX 2IKIA 1KD0A 1IEXA 4V28A 3T2PA 1TTPA 4NZCA 4Q22A 3AOFA 3ONCA 4LBRA 4CEXC 4U31A 5HUPA 1XX1A 3SCTA 8XIMA 1RP8A 1UR4A 1NF0A 5JIPA 3TNOA 1KXVA 5G2IA 4EK7A 4DBWA 3T55A 1TV4A 3B4UA 3W87A 3NYZA 4HCDA 3VDGA 1C3FA 4UTTA 3LB0A 4BA0A 3IAPA 1HL9A 4XIMA 2GJNA 2CC0A 2PTYA 4KBXA 4J28A 1RY0A 3HPZA 3H2MA 3LXCA 4R33A 4WOQA 1HF6A 2WKJA 4C1NA 5CC7A 2AAMA 4DX3A 2B7PA 3KVMA 3BLKA 3CXBA 5CBIA 3W7JA 5B7ZA 1GVYA 4LAZA 4EWJA 4R88A 3WJSA 5JMUA 3EPMA 3UGVA 3QF0A 3RX4A 3GC5A 1UW9A 2ZX9A 1AD1A 1XLJA 1ONEA 3NZQA 5HWNA 4IOTA 2BBFA 1VC4A 3O9NA 1EF3A 3T08A 2PZNA 2VX6A 4QXIA 4JCLA 1QASA 5JVLA 3ARRA 3R43A 3TN3A 1M01A 4XBKA 1BVNP 2YL8A 4JDYA 4MJ4A 1O66A 4C65A 3E38A 1QW8A 1R86A 2KAUC 3AS3A 5TD4A 3TQVA 3CHEA 1CEOA 1JDEA 4A29A 2Y4SA 3H21A 1EJUC 2YKKA 5DBTA 4B9YA 3WUFA 2VVSA 3PG8A 2BP1A 3VE7A 3ZFHA 3ZJ6A 3LPFA 3B8TA 4W87A 1K1DA 1KFBA 1IE7C 3UZWA 3DOPA 4S3CA 3BK0A 1K8YA 3BLFA 4IF2A 1HL8A 1NFBA 3A22A 4MDPA 3WK0A 4JAWA 1MUCA 4YMZA 1QOPA 4EAMA 2DH3A 3VNKA 3STPA 3WJZA 1AW1A 3GRIA 4PTNA 3MBFA 1ME7A 3NQCA 1AMYA 1E3ZA 4Y8FA 1X1NA 4RPPA 4HD5A 1TVNA 3MMWA 4Q4SA 4WX2A 2GQ3A 1IYXA 4I6VA 1J0KA 4ZB0A 3URQA 2OZ0A 3CQ0A 4LAUA 2E5CA 3FGCA 5FIPA 3GFYA 4UOJA 4AEFA 2RUSA 3VGDA 2HPIA 3PBUA 3GTFA 4H2CA 3SUVA 3OVGA 3N4FA 4XD6A 1GNXA 3AMKA 5F2IA 2ACRA 2HK1A 2AQOA 3E0LA 5DCBA 5A6AA 1CGVA 3EWUA 1LWHA 1XIDA 3O16A 3NGFA 1CLVA 3PUGA 3LGEA 1JGMA 3F4WA 2X0HA 3CH0A 2E6DA 3B8DA 4GINA 2PDLA 1QU4A 2P3EA 3Q2DA 5I77A 3CV2A 1OT1A 2VJXA 3IGHX 3R13A 4QLLA 4F79A 3T0BA 1KA9F 1JJKA 3JU2A 1GOWA 3BJSA 4BF9A 4D6DA 3E02A 4G1NA 3FXGA 4BI6A 3OGSA 3KTCA 4ACZB 5AYBA 2OKTA 3MSRA 4P5UA 3CNYA 3R1ZA 1XYCA 1KBLA 3CH9A 3ITLA 1GQJA 4S3GA 5FSEC 1DHKA 4DF0A 3NEVA 2QMKA 3VGEA 4L5ZA 1R3WA 5G4HC 2X8HA 3CAWA 4R85A 3H2OA 4ZXLA 3HF3A 1Q6FA 3RLHA 3U4FA 5EL1A 2A2IA 4DHGA 4IIDA 5LIUX 3ZR6A 1KGUA 4NUWA 1W1PA 3QKZA 3TA6A 1VS1A 5HPOA 5ER0A 5CKSA 3D6NA 2OLHA 5H8UA 3VUPA 3NVDA 2OXNA 4GLEA 3KOYA 4ZOHB 3W85A 4P2VA 1VBGA 3V5CA 1WOAA 2OQHA 2X1TA 3PZ9A 1JDCA 2QMJA 4WSHA 4FI4A 4PTMA 2WSQA 3IRSA 1U1UA 5I78A 1JYXA 4RNFA 3KCOA 1H09A 1VAHA 3PULA 2QUNA 4GJ1A 3U5UA 4AXKA 5BYWA 3TUUA 4V2XA 1XCWA 3VM7A 4H4RA 4PN2A 1C93A 2V67A 3VD5A 2W9MA 3W7RA 5AC4A 4TUFA 1V6XA 1TV8A 4DJEC 1VJIA 3DESA 3G18A 1UR9A 3LTPA 3R0KA 4MZ1A 3AN1A 4D2JA 2BG5A 1V6TA 4A8RA 1TV2A 2NXGA 1VQZA 1E6PA 1E1CA 3WY1A 2VC9A 4HPXA 2XIBA 1H0GA 2FHBA 1JEZA 3DC8A 2G8ZA 4NZ1A 1WOBA 3WMLA 5DMYA 3HBLA 5FS6A 4Z1AA 2FGLA 4MG4A 3KWSA 5G1MA 2MUCA 1CXEA 4I8YA 1KLZA 4JGDA 2TMDA 2QDEA 1BVWA 1O68A 4MF4A 3N73A 2ISFA 5T9BG 2VWTA 1TPDA 1X6NA 4FNTA 4IPPA 2RDWA 1H2JA 3PG6A 2WCGA 1E1EA 3MB9A 5KMYA 4FIQA 4L64A 1JZ6A 1UWQA 5GJPA 1P48A 4NIRA 5CZJA 1Y5VA 4UQ9A 1PEZA 2BV9A 2V5JA 4W8LA 4WLCA 4E3TA 3QFEA 1PPIA 3W1MA 1PB0A 4I9MA 2XN2A 3AHYA 4QLKA 3M0HA 4W5UA 3WNOA 1DE6A 2IXUA 4R5EA 1KTBA 2ZC1A 4K8GA 4H00A 3V36A 3M16A 4YYFA 5C2GA 1P0BA 4H8NA 5CPMA 2Z2BA 2ZTKA 2NX1A 1TCMA 4ZL1A 4MNLA 3TJLA 3T7VA 1L9WA 4B2DD 4YCPA 1OFBA 3BC9A 2VUNA 1IT8A 4ZO7A 3F5KA 3QN3A 1WP6A 4F2UA 3W71A 5F4XA 1UG6A 3TR9A 4YS1A 1ITQA 1OFOA 2NV2A 4CU6A 2QCNA 4GNVA 4BJHA 1VPQA 1G4TA 1UKSA 3HZ3A 4PUWA 3GKAA 1T8QA 3P2VA 2WMGA 1OABA 3PG9A 4UFMA 1F8MA 1L6FA 1TPB1 3WNMA 2YW4A 2Q8LA 3AZTA 3FKRA 3JS3A 4WD0A 3DI1A 4LYKA 4E6MA 1NDWA 4PRWA 2VC6A 4LAOA 2OWCA 1NFPA 5KTLA 4LS1A 3LS9A 1XYFA 1G9HA 2DSVA 4S2BA 1H7XA 2W4XA 2Q6ZA 3W9ZA 1TIWA 1TMHA 3C0JA 1VEPA 5CPQA 4HCLA 2E68A 4HN8A 1XXXA 4QM1A 1FKXA 3G6MA 4AWTA 3KXQA 1M03A 3VOIA 1DIDA 4F48A 3OYXA 2OEMA 5AHFA 3SCRA 1JPKA 4AHPA 4H4VA 2YCJA 4MWAE 3GDBA 4TX9A 5DMNA 3Q4DA 4HA3A 4XD4A 3IIZA 5LA2A 4QJ3B 5U4NA 2ZOXA 3FLUA 4GXPA 2CDUA 3HG5A 2D1ZA 2ISDA 1UHVA 5BW6A 3K2GA 1W5MA 2QR6A 3BMVA 3M0IA 1XINA 2WCAA 1HT6A 1V3IA 4LEFA 2WV8A 3ICJA 3K8MA 1VQTA 5G1TA 1HUVA 4PBEA 2F9RA 2PDFA 2CHRA 1OGGA 2NVAA 1F7BA 3P3BA 1JI2A 4NT0A 1GK8A 4QE4A 1FVPA 1HO1A 3KCJA 4K2SA 4CN4A 3BLOA 2Y6ZA 2QLYA 3W2LA 4YTRA 2NSXA 2H8ZA 3GR4A 2DSWA 2YA1A 2I14A 5A6SA 3VILA 2IKJA 2ABAA 1E70M 3UWQA 4TIMA 1XGDA 3N2MA 4XVEA 2YCIX 3LCXA 5C2XA 2ESCA 3H53A 1OX4B 3RCMA 1QMLA 4M52A 1ZB5A 5D2XA 4IMFA 1CGWA 3IIXA 3VAVA 1VH7A 3VD3A 3ITOA 3CZ8A 3VO0A 3UF9A 4GYKA 5CXPA 3C2FA 4PB3A 1GRBA 2X05A 2DVUA 4AC1X 3G0UA 4AZ5A 1EP2A 1SMDA 3K1GA 4BQ2A 3IGXA 5M17A 2JFEX 3KOWA 1ZP3A 2PDHA 2IPFA 4WHBA 3AIWA 3ZJKA 2ZA1A 4QTGA 2RAGA 3F1QA 3H54A 1SB3B 1KFWA 3N3MA 4NZ5A 1EO7A 3TCEA 4H4IA 3R0DA 5DY2A 2A3BA 1TQJA 4CD4A 2F2HA 1Q7QA 3BG9A 1KKRA 4S3BA 3EPOA 3UXKA 3HJEA 3PTQA 2ZXAA 3WK1A 2W6RA 4AF0A 5FS8A 3RM9A 5CAKA 1QXLA 4IGNA 4RNIA 1ZP4A 1MSSA 1R87A 4HVXA 4QJ5B 3B97A 1ZBVA 4UOQA 4ZVJA 2DFAA 3ZWSA 2ZZBA 3FJ6A 2PWVA 4RKAA 5JCKA 1XL9A 1HQTA 1T3QC 4HMEA 4BWLC 1VPYA 2YLLA 3PNZA 3R12A 1E6SM 1XIJA 4P7NA 1E40A 4MYXA 4R53A 4AD0A 4WCJA 4Z1CA 3G8RA 3PHAA 3EAUA 1RQHA 3RNDA 4B4HA 4JXCA 3KOFA 1UA7A 4GHRA 2XUCA 2FGZA 3KM8A 1KM2A 1SZFA 1HP5A 4DXXA 1X96A 1ZS2A 4JTAA 3O1NA 5I2UA 1GOIA 4F3HA 1FWIC 3T2OA 1D8WA 3EDJA 3ES7A 3PSWA 1XBVA 2NUYA 4DUOA 4CUCA 3C2RA 4GXWA 7ODCA 4EM3A 3G24A 3FA5A 2XH0A 3NSXA 1Y7VA 4C1NB 2QPXA 3GKFA 1KO0A 3CO8A 3CQHA 2ZUTA 3TC3A 3H70A 1S2AA 1S1PA 4RW5A 1JGIA 1OG0A 3UWVA 3VZYA 3U3HA 3URBA 2QCCA 1JXJA 1S7MA 3S2JA 1M9HA 1S2VA 4ATDA 3KBWA 4LVDA 4YU1A 3GO2A 2NXIA 5FS9A 1TTQA 5LKYA 3G6LA 2WBKA 3GXMA 4PRTA 4JTIA 3IJDA 4XX6A 3VUSA 1MQQA 3ETRB 2DU2A 3R7MA 3GHTA 1MQRA 4QISA 3CM4A 4CN1A 3PN8A 4H1ZA 1XDLA 3FYPA 1E6QM 1P0EA 2BVYA 5G1YA 1QPOA 4POCA 2IKGA 4Q4PA 3FV9A 1GSNA 4Y8EA 1T7LA 3S0CA 3AS1A 1A5CA 1A5OC 1RVKA 4R7OA 2CBJA 2CIPA 3ITVA 4YTUA 3A3XA 3O06A 2I56A 2BY1A 4EQSA 4P7OA 3LXBA 2FMNA 2ZUVA 3WLIA 2DW6A 4YLWA 5DMLA 4GI8A 5LA1A 3EDFA 3QC3A 5EKYA 4ZOCA 1FWTA 5BXPA 5EMJA 1FWRA 3QEZA 3RM4A 3GYEA 1E71M 1W9XA 1OVDA 3UNDA 1Q66A 4UZSA 3TQPA 3C3UA 3PJWA 4DPPA 2ZADA 3UR2A 4X61A 1KGWA 3FKKA 5BU6A 7REQB 4CNSA 4FZIA 3LHTA 3VVGA 5REQA 3WUBA 4Y9PA 2WPBA 3ZLFA 4DBDA 3RIKA 1VCFA 5GPRA 3KBVA 3DGZA 3GNDA 3S4TA 3DN5A 2E9LA 1PHWA 3CUZA 3WK2A 3AJ7A 3QC0A 2RGLA 3QMTA 3REQB 3DYMA 3CZKA 3DGBA 4PMUA 3BDKA 4L1WA 3QY8A 3SIZA 2WNNA 1TO3A 8A3HA 3O6YX 4PFMA 2O9OA 4IJBA 2NVDA 2XISA 1O60A 4Q8TA 1H7NA 4DYJA 4J4KA 9CGTA 4WJXA 1CZ1A 2ASHA 3MJYA 1GQIA 3C0QA 4F0RA 4C6QA 1LG1A 2ZRUA 3XINA 4D8AA 3O8AA 4DBUA 3P8IA 1C91A 3IVTA 3DAQA 5L9FA 1JYNA 4H4PA 3U5YA 3FHQA 2CLLA 1UPPA 2G96A 4GY0A 4UFIA 3CEUA 3NAVA 3MUAA 4R9OA 3DERA 4CKQA 3SUUA 2PLMA 4OV4A 3BANA 4I9JA 4OU1A 2ICSA 1KC7A 2B0MA 2FZBA 4P8VA 2F84A 4K3ZA 1Q4NX 1FX6A 1TVPA 2P8BA 3CL7A 3ABQA 5CC5A 3ZT6A 1P0DA 3UQNA 5IBXA 2Y5EA 3NVVB 2ZC8A 4PUNA 3TMLA 2Z2UA 3HG3A 1ITUA 1LCOA 3F7JA 3GRSA 4DM2A 1US3A 3QV9A 1ZGDA 1Q6CA 1Q6OA 3L21A 4J3XA 1E15A 4LU0A 3WUGA 1J5SA 2X7WA 3WELA 5D03A 4B2DA 2G41A 4EQXA 3A3HA 4WDXA 3LOTA 3Q94A 4IUGA 5F4WA 1ALDA 1CI1A 5C8BB 5BOEA 2QVHA 1H1ZA 3LADA 1KM1A 3R11A 2F7FA 4LS0A 2Q8XA 1DHPA 1LRNA 2C8NA 4A35A 2XIOA 3GDMA 2J47A 1ZHAA 4NKCA 3SRKA 2GSJA 1BZLA 2NV1A 3SCVA 1UIOA 3M47A 1Y5WA 2PDXA 4ZSTA 2DZBA 1ZBCA 2P0OA 3NO1A 3W74A 1JROA 1O4UA 4NSBA 2PTZA 4LAMA 4HZ8A 1W3KA 2NQLA 2ZBTA 3LCIA 5CH9A 4H4XA 2TYSA 2KX9A 2Y62A 3GC4A 1E1CB 4D6IA 1JZ7A 4KEZA 1GW1A 1JRCA 1MO9A 3CPUA 4A8NA 3S3GA 1AG1O 1OGBA 4JQ1A 4Q8MA 1MOKA 2FDMA 3KOZA 4NX0A 2OO6A 1J93A 1SZRA 2VMFA 3U4AA 4K8HA 1XSKA 3WMCA 4AY7A 1NWUA 1A0DA 1VFFA 1TYTA 1YQ2A 1EA0A 2GVJA 4DYKA 3V0TA 4IQDA 3D47A 3NEHA 1DYSA 1YW1A 1PHQA 4NAFA 2GR1A 1THFD 3AHXA 4REQA 3P60A 2GGGA 3B8WA 3H26A 1Z6KA 4JYFA 1E9IA 4MMWA 2EQ6A 4PB4A 4H8VA 4I7UA 2YDSA 3CZLA 3U0HA 4JTQA 2X8RA 3OGVA 4FLSA 1DXLA 4B5TA 1FWHC 1ZUAX 4R34A 3UXAA 3CZEA 4V1YA 4GIAA 4FR6A 1V51A 3PWIA 3GZ3A 1Q6QA 1ZXIC 2V3AA 4JTEA 4AQLA 3BSGA 3KZPA 5FEPA 1VFMA 3RXZA 1AQ0A 3WFAA 1PTDA 2SFPA 3CBWA 3E3HA 4YN5A 4Q7IA 4NAEB 2MANA 3SCQA 4H9XA 2X41A 4J5NA 1GJWA 4QX4A 3KLKA 5JBDA 3A7RA 3PJTA 3TC7A 1S5VA 4FAMA 3CMGA 1KQYA 3WF1A 2DT1A 4LX4A 1TRIA 1FDJA 3UWEA 2D3LA 2FKPA 3HN3A 2CFFA 1ME8A 4Q8PA 4GMEA 1FXPA 3VIFA 4BEUA 2CHOA 5D2VA 2WC7A 5HOSA 3GH5A 3NOEA 2PDMA 4O4VA 3W1PA 2XSBA 1XKJA 4O4WA 1EB3A 4O14A 2I17A 2PDCA 5BXTA 3BLLA 3F03K 1N62C 3WQVA 2CWNA 2VT0A 4BY3A 5ABTA 1K8CA 2H3DA 2Y2WA 5BXSA 3LDVA 3CUJA 1NEYA 1DWAM 3LY0A 3SGUA 2J78A 4EF9A 4QS6A 1TV3A 2V0TA 2VEGA 3LB8A 5TF0A 4O8RA 3O63A 4J3WA 2BZNA 4RV8A 5DXYA 1X1OA 3CAKA 3QRHA 3QOKA 1M1BA 4EPDC 3LBMA 1W3HA 1F3TA 1OY0A 4XO6A 5FJPA 1F3PA 1UC5A 3A5VA 1US0A 3DYOA 1GEHA 1QAPA 3ARXA 1JZ4A 4H2HA 4FLRA 5D9MA 3WBYA 2FHFA 4GQRA 3I6RA 4V27A 2Z7GA 4XG1A 5A3HA 2I5GA 1EYEA 3L4TA 5FMHA 4LVFA 2CKRA 4XAFA 3W28A 2PLKA 1QW7A 1EQCA 1BWKA 4WR3A 3OZOA 4IMGA 4NZFA 1W1ZA 5C6MA 2WNQA 4UTMA 2D24A 1H51A 5AHMA 1OFEA 4ORIA 2ZZ5A 4FXJA 3H2EA 4X0VA 2YCLB 3L12A 2BB0A 3FIGA 1C9DA 1KBJA 3W3OA 2W66A 3UYIA 3IARA 5IFPA 3GY1A 1TCDA 5D32A 4PRRA 3NL3A 4Z08A 2QNEA 3ABXA 4AVOA 4ZO8A 3O15A 5A6KA 1UMYA 3WQ5A 1GOQA 1JRPA 2EPHA 4CVWA 1VBHA 2XZ7A 2PTWA 3L0GA 1VHNA 4C6KA 1E6ZA 2R8WA 3PK7A 4JN8A 3V7PA 1B3VA 3GHUA 1EBGA 1Q8AA 3BLIA 1SW3A 2TODA 1W3JA 4OV9A 4PL2A 1R9X