3BSMA

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
386
structure length
358
Chain Sequence
b'LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
molecule tags Lyase
source organism Chromohalobacter salexigens dsm 3043
publication title Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens.
rcsb
total genus 131
structure length 358
sequence length 386
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2007-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3bsmA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3bsmA01
3VFCA 1R6WA 2PTYA 3D46A 2I5QA 1KD0A 3ZVHA 3VA8A 2PP1A 3R0UA 4DX3A 2DW6A 3V5FA 3VC6A 1JPMA 4H2HA 1BKHA 3VC5A 2RDXA 3RO6A 3DFHA 3OP2A 4E4FA 3QPEA 4K8GA 4A6GA 3NO1A 4HCDA 2GGEA 3IK4A 3FJ4A 2QVHA 3DFYA 3SSZA 7ENLA 2P3ZA 1SJBA 3FCPA 2AL2A 3RGTA 3UJFA 3MSYA 3N6JA 3QLDA 4Z17A 3T9PA 1EBHA 3P0WA 3EKGA 1ECQA 3OW1A 3DG3A 2AL1A 4E5TA 3MUCA 3TJIA 2OZ3A 4H83A 4HCLA 1EC7A 1DTNA 1R0MA 3BOXA 4JN7A 1YEYA 3NZGA 3SJNA 4IT1A 3GC2A 4IZGA 2ZC8A 3P3BA 2PODA 3QN3A 1NU5A 4ENLA 3D47A 1ELSA 2PP0A 3PFRA 2CHRA 3UXKA 1EBGA 3ZLHA 4GIRA 4KPLA 2ZADA 2P88A 1FHVA 4DYEA 2HZGA 2QJMA 3DESA 1JDFA 3QTPA 3DIPA 3CT2A 3QKEA 3OZYA 2P0IA 3DG7A 5FJPA 2P8CA 1TKKA 3UJEA 4ZCWA 3P93A 3UGVA 3R11A 2PU1A 4F4RA 4DN1A 2POZA 6ENLA 3MZNA 2OVLA 4K2SA 3RITA 3N4FA 5FJTA 3PWGA 3RRAA 3ES7A 3Q4DA 2GGJA 3CK5A 2GGGA 3Q45A 2PSNA 4IHCA 4E4UA 2OZTA 2PPGA 3DEQA 3PK7A 3VCCA 4JN8A 3GO2A 1MDLA 4HCHA 4G7FA 3MWCA 1MDRA 3TJ4A 3BJSA 3DG6A 3T8QA 2OQHA 2XH2A 2MUCA 3MKCA 3V5CA 4IP5A 2O56A 3I4KA 3MQTA 3N6HA 4A35A 5FJOA 2AL2B 2AKMA 4FI4A 4IP4A 1SJAA 4GYPC 3ZVIA 4DHGA 3ZVHB 2OLAA 2OG9A 2QDDA 2MNRA 4HNCA 2XGZA 4FP1A 3IJQA 2XH7A 3JZUA 4YWSA 3CXOA 2PGWA 3UJSA 2AKZA 1MUCA 4KEMA 4IL0A 4HPNA 3JVAA 4G8TA 5FJRA 3H12A 3V4BA 3SN4A 4MGGA 4DXKA 1XPYA 2PTWA 3DERA 2QDEA 2PTZA 2NQLA 3OPSA 4GMEA 5BOFA 4GYPA 2PCEA 3TTEA 1NELA 1W6TA 2FKPA 3UJ2A 3UXLA 1PDYA 4ZA0A 1TZZA 3FXGA 4M0XA 4HYRA 3GY1A 3UCCA 3ZLGA 3CYJA 4KWSA 3CB3A 1FHUA 3T4WA 1ONEA 2ONEA 2PA6A 1KKOA 4DWDA 2XH4A 1IYXA 3JW7A 3TQPA 3DDMA 2PP3A 2QGYA 2GSHA 3U9IA 4EWJA 1MNSA 3K1GA 4E8GA 3U4FA 5J04A 3I6EA 1TE6A 1JCTA 4M6UA 3FV9A 3TWBA 3OZMA 2OQYA 3NFUA 3SQSA 3BSMA 3MY9A 3ENLA 2OPJA 4MMWA 3FYYA 4Z1YA 2PU0A 1XS2A 2PTXA 4ROPA 2HXTA 4KT2A 1MRAA 3N4EA 3PWIA 4MKSA 2OZ8A 3H8AA 2OO6A 3UJRA 3R25A 1WUFA 2GDQA 1F9CA 4K1WA 4GISA 5BOEA 4HNLA 2OX4A 1KCZA 2FYMA 2PGEA 4H1ZA 3ES8A 3RCYA 1PDZA 3SN1A 3VDGA 3I6TA 4IL2A 4JHMA 2HXUA 5FJUA 5ENLA 3H7VA 3KUMA 2GL5A 1WUEA 5IDZA 3OTRA 3TOYA 3S5SA 3ZLFA 4H19A 1P48A 2OKTA 3H70A 3EEZA 3HPFA 3B97A 1OEPA 1BQGA 1JPDX 3SN0A 1SJDA 3TCSA 2HNEA 2DW7A 2XSXA 3FVDA 4A3RA 3R10A 3THUA 1SJCA 2QQ6A 1RVKA 4J3ZA 3DGBA 2GGHA 2PMQA 1E9IA 1KKRA 3UCDA 4GGBA 4X2PA 4GFIA 4J1OA 3V3WA 2GGIA 3SBFA 3VCNA 3NXLA 4E6MA 2PS2A 3CAWA 3IJLA 3IJIA 3T6CA 4HN8A 3TWAA 3R0KA 3R1ZA 2QJJA 4GGHA 3TW9A 2QJNA 2OFJA 5EU9A 3RR1A 3S47A 3GD6A 1P43A 2P8BA 2XH0A 1L8PA 1EC9A 3STPA 1EC8A
chains in the Genus database with same CATH superfamily
1NOFA 2RUSA 3HQOA 1C8QA 5E9AA 2I5QA 3N15A 2E4TA 1BQCA 4IISA 4NZ3A 4DZIA 3BW4A 2DSUA 1CB7B 3OO2A 3M0VA 4AVFA 1B1YA 3WNLA 3UWQA 1SPQA 3PPGA 2A3EA 1WV2A 2R1MA 1KB3A 2JIWA 5F2MA 2FPVA 1LG1A 2QVHA 3CH9A 2XU2A 1IHIA 4LFYA 3OOQA 3VD5A 3W7GA 5J8LA 3XINA 1LVLA 3QLDA 4ZL1A 1PKNA 4JZ5A 1JZ7A 4GRSA 1U83A 4E5TA 2FJKA 1KRMA 2D0HA 5D9PA 4AB4A 1Q65A 1ZBKA 1GUVA 1H4PA 3AMCA 3BSHA 4N6FA 3UVAA 1K03A 3HPZA 1HUVA 2YOCA 4JDRA 2DEPA 1Q6GA 3UFYA 3W2JA 4QGCA 3WMLA 5EYWA 3QHOA 3HMCA 2TPRA 2R94A 3AROA 1FCBA 3AO0A 1U2YA 5FF7A 4YVPA 5J5RA 1JXJA 4S39A 3O6YX 4S3KA 3AZTA 1W56A 4Q8UA 4FNTA 3VNMA 4MWAC 1PAMA 1CXLA 3T81A 4K8HA 2E3TA 1AJ0A 4H8UA 1GOQA 3OLGA 5FJPA 1JRCA 4KH2A 1I4NA 3FSUA 1DWGM 3CPUA 3LHUA 1YBQB 5E1QA 4ZO7A 2BC1A 1OADA 3PJUA 4PBGA 2ZZBA 4Q8WA 2WVSA 3S2MA 1EDQA 5AC8A 4GJJA 1SZFA 2OZTA 3T2OA 5LIUX 4E2OA 1BF2A 4MUZA 3ZOAA 4A2SA 2E25A 2FQIA 1IZKA 3RLHA 2OEMA 1IWPA 1OGGA 2AQOA 2DY3A 5LNVA 4Y8EA 4XAZA 1JRPA 3LQGA 4EQRA 2DZVA 5A8PA 1P6WA 3CUGA 1KGUA 5A5WA 3QMTA 5HR6A 2QKFA 2DT0A 4H41A 3SCVA 4JKLA 3V5CA 2NVCA 3MZ2A 3SFWA 1KTNA 4ZXOA 3W74A 6PTDA 2O56A 3R58A 3RILA 3I4KA 4H8NA 4KEVA 3UWEA 2GR1A 1FWAC 3SAZA 1E0VA 3VK5A 5HMSA 1WA3A 2GQ3A 4DHGA 4HNCA 2XGZA 3URQA 3KBVA 3BGGA 1VBGA 1DWHM 3A5VA 2X41A 2QMJA 4IL0A 4K3ZA 1EFZA 4DZAA 4Q8OA 4CQCA 2WNNA 1QOQA 4I5XA 1D8CA 4REQB 4TR9A 2PWFA 1PL9A 1E51A 1M9HA 4LV4A 3EDDA 1VHNA 2O9PA 3WH6A 5AFDA 4NYYA 4AX7A 4Z1AA 4LW7A 4GMEA 5BOFA 4FNQA 4CEXC 3EWXA 1UOKA 3NPWA 1KV5A 2Z00A 3T07A 4S3GA 1H7XA 2DJXA 4GZ7A 1YNYA 3S9IA 1W6TA 4JIRA 1EA9C 1TV3A 4AIUA 2W3RA 3OA5A 2PDQA 5CQ1A 3WNOA 1AD4A 4KRUA 1KFCA 1V3MA 5D9MA 5CPSA 4Q22A 2KZHA 1ECEA 3RM8A 4Y9OA 3N1AA 1L6FA 3S5NA 1ITQA 1O5KA 4J56A 1P0KA 3K1DA 3CYJA 1TPB1 2WJZA 3STGA 2AGTA 1N60C 4M6VA 3MI6A 4GZJA 1UP2A 2PD9A 1S2CA 4GYKA 4DELA 1DIDA 3NL6A 2YFOA 3BANA 4B5VA 5C2XA 3R8GA 1TB3A 1TE1A 3BL3A 3K1GA 4RW5A 1JCTA 3N34A 2WNQA 4RJEA 2C13A 1JCYA 3L4VA 3B9AA 3EA2A 4R9OA 5IDIA 1CECA 4WGHA 2G37A 3WLQA 1LP6A 1TPFA 4E2VA 3H22A 2OO0A 7PTDA 2DVUA 3FYYA 5HDRA 1W3JA 2EBNA 1C3FA 4Z1YA 1HJXA 3LPGA 3V75A 1XS2A 1EPVA 3EDEA 4FDCB 4GRTA 1KTCA 4RDZA 5BXRA 3M0YA 3MYPA 5AOUA 3KP0A 3DN5A 5D33A 2XFYA 2OYKA 3CUZA 4GCXA 3O0HA 1C9DA 3NZQA 3QOMA 2HWGA 4AZGA 5BOEA 4FK9A 2J47A 2A3HA 3B9EA 1QAPA 2Y8UA 4P61A 2IKJA 3I6TA 1PTGA 1V5XA 4YWIA 3GNOA 1X2HA 1FH9A 4O15A 3ZLFA 1EX1A 5JBDA 1UWUA 1YBQA 2CCRA 3WLIA 4DI8A 2BNJA 3LK6A 4GI4A 1YQZA 2E7FA 1OEPA 4YNGA 1HIZA 4WXYA 5AECA 3WL0A 4PCSA 3KBWA 5A6BA 3AWOA 2YLLA 3UCQA 3SRDA 1GZ1A 3SO7A 1ENUA 4ZQPA 4D6EA 4A8NA 2OLSA 5CG7A 3ARWA 1PKMA 2H9AA 1N8IA 3LUTA 5FA5A 1XDIA 1S2AA 4NASA 4NVTA 4GFIA 2B0MA 3V3WA 1LWHA 4LOCA 1EIXA 5I0DA 2PS2A 4LBUA 5DBTA 1OK6A 1Y5VA 3T6CA 4HN8A 3TWAA 1GHRA 4S38A 3V1PA 1TV7A 2WKGA 3EA1A 3N3MA 4HPGA 3W38A 2QJJA 4HZMA 3RM9A 3UR8A 4IWWA 3WK2A 3HW2A 3TW9A 4KS0A 4Y96A 2FH8A 1JFHA 3CWNA 4HKPA 4LNYA 5BWAA 1EGVA 1GERA 4RZ5A 4QE4A 1RV8A 3GU2A 3RHGA 2JE8A 4EXAA 1XIMA 1KRCC 1GOWA 1M01A 4F66A 2PWUA 3MDWA 3VC5A 3NPVA 4P8WA 3RO6A 3M5YA 1TPEA 1Z44A 4PBEA 3T08A 4K1GA 1DJHA 1Y5WA 4ZR8A 2Y61A 2X30A 1V6TA 4IFKB 2GR0A 3CZGA 7ENLA 4PFHA 1JAEA 1TTIA 3FCPA 4EK7A 3T7VA 3MSYA 4Z17A 2O9TA 1LOSA 1TMHA 4RDVA 3NL2A 4DXXA 2ZUSA 1FWJC 3M44A 2YBVA 1REQA 2BY0A 3WQPA 3E38A 3QQ0A 5FF0A 1DIOA 1R5YA 3LQLA 2VGFA 2VZSA 1VCFA 4JN6A 5FSEC 3KOFA 2BGQA 2OWCA 5KVIA 2YXOA 5JIWA 4ASTA 3EOUA 4J35A 4EACA 1M7OA 1Y0EA 3VGEA 3FEQA 5DRCA 5G1MA 3WG6A 4DYEA 3N2MA 2VC7A 3LTSA 3PTKA 1XLLA 1XLFA 2BOEX 3E0WA 3R07C 3ZS4A 3LBOA 4UZSA 1QNSA 4XB3A 5G5HB 4U3AA 3L65A 4DN1A 1CLVA 1CPUA 1BYAA 3M1ZA 1U5JA 1UZHA 1V3JA 3ZT6A 2QF7A 1XLDA 5CG0A 4F3HA 1QRQA 5FSDC 4PMXA 4B9ZA 2YAUA 2YA0A 1Q66A 2OX1A 3ZT7A 1SFTA 1GQJA 1GK8A 2A7RA 3EXSA 4Z2GA 4LUTA 1XRVA 1DWAM 4V33A 3IARA 4N9BA 2OEKA 4JPGA 2V6OA 2GQ8A 1RH9A 4AZ6A 3SCTA 4UTHA 2Y7EA 3WBEA 5I3JA 4JTHA 5CC7A 5TF0A 4IMGA 1XIBA 4DBWA 4RDWA 4Q4PA 4LAOA 5FJOA 3BG3A 5I5RA 1FVPA 4FI4A 2J74A 3S6OA 1DE6A 3MV11 4UOQA 1IWAA 5GNYA 2AMGA 4IGHA 5EMMA 5A6TC 1NF7A 2WYSA 3IJQA 4OUEA 3VM5A 4Y6GA 4TVDA 2FZDA 1QOPA 1RP9A 1OX4B 1E56A 1C29A 3IPWA 1JPHA 3RJXA 1YDVA 3JVAA 3B0PA 4ZO8A 1GQIA 1V6WA 4N7QA 1BG4A 1VFUA 2WCAA 3BV7A 4LYPA 1EWDA 2Q8ZA 2YLAA 4L1XA 1FDZA 1N61C 2VCCA 3CUXA 2FGZA 3NZPA 3QF0A 4PTVA 1KLZA 5A8OA 3PNUA 5E9XA 4GE8A 1WDQA 1NELA 1TPDA 4B3ZA 4UQDA 2OU4A 4QAIA 2TYSA 3UJ2A 3RCNA 1JDEA 1R3VA 2D2JA 1OF6A 3R6IA 2YL5A 5AZ1A 3GDBA 3HQ1A 4HK7A 2C6QA 5I3FA 4XVEA 4GKLA 3CUHA 3TC6A 2ZZ7A 1B3OA 5FJIA 3EB2A 2GK1A 2E6AA 1CDGA 5DXYA 1X8CA 4UNKA 4OKDA 4JX6A 3CO4A 4RK8A 1M6IA 2WKJA 1KTBA 1N55A 4KWWA 3L8KA 3MHGA 4C6CA 4Q4SA 4I3GA 2OELA 4WQ6A 3GVQA 2WW5A 2J8FA 3BQ5A 3NJ3A 5A6SA 1TA3A 3MCMA 4RZ4A 3AJXA 1NWSA 4J57A 2NV1A 1ZRQA 1KWKA 3AS2A 2JKEA 4K36A 5EBAA 3TWBA 1WO2A 4MB1A 1L8NA 2Y89A 3L4TA 1MUMA 1KM2A 1EXPA 1UWRA 4JTFA 3OVRA 5CSSA 4CKQA 4XG1A 3QLLA 1XANA 5H2ZA 2NWSA 3MCOA 4UC5A 3T0TA 1SW0A 3WUEA 1DVJA 2P50A 2G50A 2FZ8A 2Z27A 3SCWA 4EQWA 1E0UA 1F5ZA 5DANA 1B4KA 3FKRA 4IMEA 3TNBA 1US2A 1F9CA 4FF5A 2VP8A 4CLMA 4JQ3A 4XSLA 4AZIA 5D37A 3F4NA 3RCYA 1LL6A 2BDQA 4NZ4A 5I02A 4IL2A 5U1OA 1CGTA 5F4WA 2PDUA 1SO5A 3ELFA 4CUCA 1A5AA 4H19A 4GQBA 2W55A 1PXGA 2V8ZA 3VZXA 1KN0A 1P0NA 3S9ZA 3WQ8A 1BQGA 1V6VA 3EX6A 4QM1A 4W89A 3DFQA 1X6LA 3VKJA 2A0NA 3E2RA 2PDGA 4AEEA 2VL4A 1J11A 1DJGA 3CL6A 4V28A 2QIWA 3L0NA 1G7VA 2X2GA 3D0CA 3BLFA 3RX2A 3IJLA 2YKKA 2EPMX 1FY6A 3FDKA 2PWVA 2W61A 4JQ1A 3VKBA 3WL1A 1ICQA 4EMIA 1QPNA 4UOZA 5AN7A 5AY7A 2QJNA 2HS6A 4TX6A 2VJXA 4HPJA 2VWTA 3TQ0A 1IGSA 3OJGA 1L8PA 2Z24A 1E6RA 1O95A 1V7AA 3ZYZA 3GQYA 3TAOA 3UPWA 3VA8A 2YCEA 2OJPA 1YTEA 1KM6A 4AMAA 4XZ9A 3CTTA 1IV8A 1BKHA 2X40A 4L9ZA 3TV8A 2RDUA 2RDXA 1ME9A 3VFLA 3TLQA 3SUTA 3IEBA 5LIYX 3NAVA 4ZTYA 5C2GA 2HSAA 5BYWA 3APYA 4HIBA 5G4HC 3N9KA 1BKSA 3DFYA 4ZTXA 1I45A 1QBBA 1DJYA 4UTFA 3N6JA 1EDGA 2XJ7A 4AU0A 1HJWA 3H7UA 3W7IA 4HNNA 1HG3A 2YBTA 3S2LA 4PL2A 1WZMA 4LIIA 1E73M 2W5FA 2OZ3A 3LTYA 2YQUA 3U2EA 1GGOA 2C16A 1YEYA 3DUGA 1ISWA 4A8IA 5GJMA 3N14A 3OIXA 2VGGA 1LG2A 2J25A 2Z1WA 4Z1CA 5IFTA 1XX1A 2W54A 3HGOA 3AMKA 3GXMA 3LMYA 3G8EA 3QY7A 3U5UA 5HULA 1IQ8A 3NGJA 3LENA 2QJMA 3LM7A 3QKEA 4YS1A 4IX0A 3PZVA 4BI5A 4H9VA 2CZ5A 2PU1A 4F4RA 1PWMA 5CXPA 1RLCL 1VBUA 2ZRXA 3CUFA 4K2SA 2YXXA 2DSKA 1QPRA 1FWWA 3PJXA 1H51A 2ZZ5A 5DMNA 1K70A 3QRHA 2OYLA 3QFWA 2A1YA 2YL8A 2WBAA 1Q6OA 3MHUA 2VCAA 3W00A 4YVVA 3ITTA 1BVNP 4TVWA 3HG5A 3AMZA 2J8GA 1FIQB 4BFAA 5DY2A 3AIBA 3PTQA 3LM3A 4LUJA 1OYCA 3S9YA 1L2UA 3SADA 3QMRA 1PSCA 3WMCA 2NW0A 5HPCA 4AD5A 4BI7A 3W71A 1JZ2A 4MDPA 1RPKA 2CNCA 3QMSA 1EUNA 4KWUA 4L9XA 1IXPA 2H3DA 1KR1A 3PPCA 1WYIA 2OR2A 2QV4A 1W5NA 4UNIA 4FP1A 1T5AA 1M5WA 4YYCA 1HGWA 1XLKA 2HPIA 5DX7A 4I8DA 1MUCA 2BY3A 2DQWA 2Y0FA 3B0YA 1DTUA 4WIWA 4ADTA 4H4UA 2HQAA 2PZNA 3YPIA 3PG6A 3E1F1 1Q3NA 1F7BA 3OLDA 3DERA 1V6UA 4EPEC 2BHYA 4PUNA 4RDYA 4O18A 1QNQA 3GNXA 1TVNA 1K8CA 2XTKA 4PSPA 3FA3A 4WKFA 3GHUA 4DJFA 4GI9A 4HU8A 4QDMA 5HANA 3R8HA 3WQFA 1G01A 2OWWA 4ZA0A 3PBUA 3QVQA 2WZEA 2ZTKA 1QI2A 2J6XA 1CTNA 1NM9A 1UC4A 4GHRA 3VM7A 3H24A 1BWLA 3C5QA 4PMVA 2DT1A 4JEQA 4KWSA 1A5NC 1OJTA 1HFBA 3T4WA 1A53A 2BY2A 2NVAA 3TA9A 4AY1A 3BAYA 1KM1A 3FIGA 1BTMA 3WLKX 1QCWA 1XYFA 2F84A 5CGTA 1JZ4A 4HU3A 3CNYA 2ZVIA 5CAKA 2PP3A 3M5XA 1A5UA 2HK0A 4GABA 1EQPA 2QUVA 2A8XA 3S6DA 1RBOB 3RX4A 2FJUB 1A5MC 1JUBA 4P2VA 4ZO9A 5FL1A 3NSMA 4UTTC 2Q09A 4B90A 3L21A 4JKMA 2ZUNA 3OYXA 2VEPA 1V3HA 2ASHA 3CQJA 3GTHA 4IPPA 3HIJA 3AAMA 1KM5A 2G3MA 3ANUA 3EPNA 3G0UA 3GVGA 2F2KA 1LRTA 2NXIA 1Z41A 2OPJA 3VUSA 2DT3A 5JCKA 3TX9A 5LA2A 2YIHA 4MB4A 1HXJA 1T7LA 2PTXA 2P5NA 4GI6A 3PWIA 1S1PA 4HNUA 3MKKA 4JTEA 4C6JA 9XIAA 1H1NA 4PTNA 4XKYB 3AU2A 4B5TA 3UJRA 2WO5A 4QLKA 1DJIA 3TK7A 2CESA 4O4WA 2R1NA 2VOMA 5F1VA 4LNCA 3L2LA 3JZEA 5I3DA 1H0IA 1P7TA 1XICA 2BXZA 4ZZ9A 4KWVA 2PC8A 5HQLA 1AJ2A 4NNCA 2OKTA 4AD4A 2BBFA 3UEQA 5HK4A 3HPFA 1DQXA 3HOJA 1F3WA 1DQUA 1VPXA 4Q8TA 4JL2A 4P7LA 3GRSA 1EJ7L 2WOIA 3TXVA 1W2PA 1EBDA 2Q3OA 3W86A 4JQ4A 2ZRYA 2VQTA 3T4CA 4CVWA 2E8ZA 4B3LA 3PZ9A 3THAA 3SCQA 2VC6A 1L6YA 1E9IA 3GX9A 4DF2A 4AYSA 2A3CA 2PUZA 3TUUA 4A2RA 4HYVA 3VCNA 4I9AA 4N9EA 1XISA 2ZBTA 3OYZA 2NVKX 1PIIA 3QYSA 3QHMA 4GYJA 2VZTA 3M5ZA 4J5NA 4TVCA 3UR7A 3SY1A 3P8IA 4XK2A 1AW5A 4OVXA 1ESWA 3GD6A 4FAMA 1X7FA 5FF2A 1TPUA 1ZQ5A 2OT1A 1L2QA 2ZICA 4MJZA 3GDTA 1ONRA 3O6AA 1ZPTA 3VFCA 2PLCA 3ITOA 1IT8A 3TLLA 1EHAA 3C4UA 3VC6A 1JCLA 2EQ6A 2PDKA 3SIMA 4YTUA 3BPWA 2VXNA 2WJEA 4Q4MA 3SR6B 1A5KC 2X8RA 2ISFA 5CLWA 2QR6A 3TJXA 4HMEA 2B7NA 1TV2A 3KBMA 4O1CA 1HL9A 3W7MA 3N19B 2CBVA 5FL0A 3BZJA 1EUAA 2QJIA 1TUXA 2OWXA 5I3HA 2QDGA 5ECUA 2PF8A 3IVSA 4S2BA 2C3DA 1MVYA 2BP1A 2A5HA 1UR8A 4AHOA 2YR1A 2ZZ3A 3KOZA 4HZ7A 4QSHA 4HCLA 3LZ3A 1H60A 1FWEC 1DTNA 1UWSA 3BG5A 1K77A 3AS0A 1LOQA 2XFFA 5GJPA 3AZRA 5JQ9A 5LKYA 2PODA 1KQZA 3RJYA 4UQ9A 1QNOA 3TN5A 2R14A 1FUYA 3SCUA 1OM0A 3UXKA 2VWSA 3GR7A 4DJEA 3EUB3 4PUKA 1XC6A 4ECLA 4GNJA 5CPTA 4GUIA 1ZBCA 4UBPC 2P0OA 3Q94A 3K13A 1ZMDA 1Q85A 1WXYA 1OABA 3AZSA 4RNFA 2PLKA 3DIPA 1XRFA 3SRKA 1PE1A 5KSWA 5LA0A 4Q7IA 3SSJA 5I3GA 2CFYA 4H3DA 3RYSA 2PDIA 3EWDA 2AAQA 1KM4A 5A6KA 1EJXC 2W66A 3LI0A 2XISA 4A22A 2ZUMA 2GJLA 3KBSA 4RNIA 4JNMA 5DT7A 1TWZA 1ZJIA 4Y7EA 3Q45A 1XIEA 2GVEA 5A6MA 2I17A 1QDSA 2EEXA 3EAUA 3GS6A 3WQCA 3TKFA 3MWCA 4NXSA 3W7QA 2WPBA 1R9YA 4GVFA 5HNNA 4EPDC 1K4GA 3WH7A 1BXCA 5HWNA 3T8QA 3Q67A 2FZMA 3PAJA 4LALA 3CGCA 1GRBA 1DJZA 1ZS2A 5M3WA 3KTCA 2A7NA 4Z1BA 1G7UA 2BWGA 3RR4A 3VOIA 1SJAA 3NURA 1GWJA 4EAYA 4M51A 2RDTA 2EPLX 3HV8A 1PUDA 2OG9A 1XYMA 5M03A 1TTQA 3FY1A 1MEHA 3JZUA 2C91A 1S2VA 4M29A 3NQAA 4C6NA 4L80A 2AKZA 3RCMA 3NPUA 4KEMA 3NXFA 3QFBA 5H8UA 5DN1A 2IS7A 1JZ6A 4H6KA 1XIDA 1GESA 2FMOA 3T0DA 5AC6A 2W91A 5F2IA 1CIUA 3GHSA 2Z2BA 1VDVA 3URHA 3V18A 3C2OA 4CVUA 4MSSA 3H2EA 3ZIZA 5EMJA 4H8HA 4PRWA 3C3NA 5XIMA 1NP2A 2GUYA 1JDCA 1M53A 3DCPA 4Z2KA 4X2RA 7TIMA 4ZB5A 3WFZA 2QF8A 2XN2A 4HD5A 1E70M 1O4UA 5G2HA 4YU1A 3MI2A 4HYRA 4Q3MA 1ZL1A 1O94A 4U4MA 4GBUA 4R7JA 4R9XA 1J79A 4UR8A 1PBGA 4NZFA 4IQDA 2QYGA 2QPUA 4JFUA 4LAKA 4TOQA 3TEVA 3W28A 3NO5A 5E93A 1LBMA 1PB0A 3LPFA 1QPKA 4DWDA 4EKJA 1HF6A 1OG6A 1PZ0A 1G6CA 3QZAA 2YJQA 5JH2A 2J66A 4PULA 5GPRA 3W2NA 1JNEA 5BMWA 4U2ZA 1K9DA 2C0HA 1Q7QA 3IUIA 4WX2A 5XINA 4O50A 2PBGA 1GVIA 1JDAA 3DFSA 4Z2IA 2HTMA 3VKKA 4PMUA 5EFFA 2BS9A 3R43A 3W24A 4LS0A 4JTTA 1H2IA 4GZIA 3B9DA 1Q4WA 1R3QA 3QY6A 4TX9A 2FZBA 2UZ9A 3F1QA 4HOZA 1G0CA 4MKSA 2OZ8A 4FA3A 2R91A 3ONCA 3WDHA 4MLJA 1MXDA 3GH5A 3W22A 1DQWA 3L0KA 4DLMA 4WSJA 1UD8A 3KRSA 3WUBA 3G0SA 2PE4A 4KCTA 4PTXA 4DYJA 1AJZA 2YB1A 3GVVA 3KEHA 3HA1A 2DU2A 3L9CA 1WDWA 3KS6A 4R88A 3LG3A 1JCNA 1LQ0A 3VE7A 3H7VA 4R33A 2DZXA 2NT0A 1PPIA 1V77A 1W1YA 2ZYFA 4ROQA 3VNYA 1VAHA 3MSRA 2INZA 1VPYA 1UASA 4PSRA 1KWGA 4XD6A 1OWQA 3GH7A 1N2VA 2WHJA 2PLMA 1V6YA 1J6PA 2HPMA 3V1HA 1ZBWA 5DCEA 1XW8A 4AFYA 5KVHA 4RV3A 4H9TA 1ZB5A 2OOGA 2DQXA 1TRIA 1S5MA 2UY5A 2NT1A 4E8DA 1VBRA 5B80A 1OT1A 4E6MA 4F48A 5K3VA 4EE9A 2B7PA 4QJ1A 3QTGA 4DJED 3P14A 1VD6A 1IIHA 4ZQNA 1Q8JA 1RUSA 3P6LA 3WQ5A 3RDKA 3F4WA 4OUIA 2Z0IA 1P43A 4C1NB 2CYGA 4QS6A 5I07A 3LNPA 1ICSA 2I9EA 5BRQA 1EC8A 3WBWA 2GJPA 3LHTA 4F2BA 5K4ZA 3WFLA 3W37A 2DZWA 1KD0A 4IIFA 4DBUA 4H7VA 2B31A 3WD2A 2C7FA 1LT8A 3AYVA 4GYFA 1Q1WA 4W93A 2J3NA 2REQB 3NL3A 4QBXA 1DOSA 3QQWA 4QAWA 1QATA 3MWAA 3W81A 1BTCA 4A6GA 3OG2A 4MG4A 3CU2A 3VPLA 2PDPA 1RSCA 3CGEA 1ME8A 1TYPA 3HPXA 4LRSA 1O7AA 4AZCB 2X1UA 1PO9A 3U3HA 1E5JA 1JGMA 3EBVA 3CZ8A 4LEQA 2Y88A 3CAVA 5D02A 4AX6A 3BO9A 4GPNA 1PYMA 4IMAA 2VOTA 3NIYA 1CGYA 4AWUA 2WQPA 2IXVA 5BCAA 3D3FA 1RM6B 1BXBA 2J88A 4JTQA 1OFEA 4A8LA 1N82A 2DORA 4XIAA 3SGZA 1J01A 1LTDA 2EQ8A 4H7CA 1KM0A 4IT1A 4JTIA 4E4PA 3K8KA 3M0HA 4AMCA 1VEPA 3B8DA 1W91A 4Y8FA 3ATYA 3A4XA 3QW3A 3W26A 1FECA 1EF3A 2QT3A 4L6DA 3OLEA 1VFTA 2ESCA 1GVOA 2WWCA 4HA4A 2XGBA 3RNDA 4PUWA 3ARUA 3C0SA 3AS3A 2D69A 4ZCWA 5I7GA 2ZDSA 1EH9A 1QASA 4PMOA 3RU8X 4HHMA 3KL0A 1EF2A 5HMDA 1ALDA 4UTKA 3M9YA 4CD5A 4ADWA 3A3XA 3U6WA 4ACYA 2GVLA 4DJDA 3AXKA 4BQ3A 3MP3A 4OGZA 4DZHA 1GV4A 4CNOA 1G94A 5I79A 1TTPA 5MKGB 1PIFA 1N63C 1PKLA 3GDMA 1XLCA 1OYBA 4KCWA 2GRTA 4NEVA 2DVTA 1JOAA 2Y7FA 3DG6A 2WWDA 5RUBA 4D6IA 2OQHA 1UR0A 5D2VA 3VGFA 3WYZA 4BHYA 2VNCA 4LS1A 1ISXA 4D8ZA 3PP7A 4H9UA 3A3HA 2FH6A 1HQTA 1WAUA 2YA1A 1CWYA 1K9EA 2UY4A 4UTJA 3A4JA 4DUXA 3N6HA 3T78A 2WPEA 3BLIA 1EO7A 1PKYA 1DHKA 5A8GA 4KEZA 3ZVHB 3JS3A 2PBOA 3V0SA 1FXQA 1NDVA 1PJ9A 2Y4SA 5EKYA 1W9XA 3U8GA 4YWSA 4MNMA 4EVZA 3ZR6A 1S5VA 3AIWA 3UJSA 1OX6A 3BOLA 1E71M 1HP4A 4TU1A 4ZB2A 3BJTA 4JS3A 4N9CA 2O55A 1OSEA 5A8MA 1GVSA 1WKEA 4NAEB 1PWLA 2XIOA 1TMLA 3BDKA 2TPSA 2VTFA 5CBIA 4YTRA 4HSNA 1LM1A 4IIDA 4MFEA 1E3ZA 3S0CA 4RZBA 1YNQA 4NNBA 2HQMA 3FAXA 4RV8A 2QPSA 1R2TA 4CN1A 1EA0A 1FKXA 4C1KA 2QPXA 2YDQA 3SW6A 4H01A 3WX7A 1C92A 4JAWA 4XO7A 1U30A 3LB0A 4BR1A 1OYAA 5IBXA 2FVMA 2GSEA 2BVDA 4KGLA 3S2JA 2PLJA 1QWKA 3M0XA 3PB2A 4KW2A 3N9SA 4IX2A 2AAAA 4FNPA 3GVRA 3ATZA 5E6YA 3RLUA 3IUHA 1XH2A 3VD4A 2VFHA 3GKAA 5FMHA 4Z2LA 3E2QA 2GJXB 3W83A 1VC4A 2QGYA 1DXFA 3FOKA 3K8MA 2GK1B 2GSHA 5H8PA 4X61A 1JI1A 1R87A 3O6DA 1V97A 1EJWC 3B40A 4E8GA 2CLMA 2R8WA 2EF9A 4DO6A 4LB4A 1W37A 3CQKA 2J9XA 1XLGA 4MNLA 5HINA 3L5MA 3PULA 3RPTA 3ERPA 4KFPA 2XDFA 1JEHA 3AUOA 1SFSA 2E09A 3IJDA 4NF7A 4M24A 3VUPA 3MY9A 3THQA 4DJEC 2WMIA 3ICJA 3OIHA 4JFTA 3TTQA 3AIVA 4LU0A 1YNPA 2B7QA 3VIFA 3FYOA 1CGUA 2E40A 4C7FA 1ONFA 3T55A 4LBSA 2PU0A 3VZYA 4A29A 4GK8A 1E4LA 5EMLA 3WD0A 1HN1A 2CITA 3M46A 2V5LA 1YW1A 2I16A 2YSWA 2HBVA 3VOGA 5BU9A 3M7WA 1JCJA 3R25A 1CYGA 5JIPA 3EOLA 1JQXA 2I5IA 5CPLA 5LNWA 3NPXA 4FLQA 1J9YA 1UWQA 1RLDA 4MFDA 3G1YA 2ABBA 1RJRA 4AD3A 3MW7A 2IQTA 2DDXA 2BX7A 3LEPA 4ATDA 2GZXA 4DZ5A 3HTWA 5DT5A 3TSDA 4AC1X 2AOSA 4L6OA 3BAWA 3H70A 3IJ8A 1T8XA 3NZRA 5CKSA 3L2IA 1VQZA 4ZXLA 4BEUA 1F07A 1IE7C 3PNZA 5T91A 1S3HA 3F5JA 1VYRA 1XKYA 4YHGA 3A23A 2VRQA 1YKWA 1SUXA 1R7AA 4WKHA 3SECA 1JF6A 1W5MA 3MUZ1 3DGBA 7CGTA 4ZQCA 4FHAA 1JAKA 1O5RA 2GH5A 5CPOA 1SB3B 3WF2A 2ODOA 3BMXA 4ERAA 4RX0A 1WZKA 5CC5A 2J6VA 4BZYA 4MADA 1I0BA 2Y62A 3LADA 5HXMA 2TODA 3O3RA 2W27A 4O10A 5GRTA 3S1WA 4O1BA 4IGMA 3ZJ6A 1LRNA 4JNYA 4CU8A 2A4AA 5TAOA 1UD6A 3BAXA 4M5PA 1XGEA 3M16A 4JQAA 1N7KA 3P5ZA 3ZVHA 1WKFA 1V0LA 4C6QA 1CX9A 2EKGA 3JR2A 2V81A 3AMGA 1D8WA 5ABTA 1EYWA 1C8YA 2E67A 4ACZB 3MC5A 2V5JA 3P82A 4IQEA 1FWHC 5KZEA 3OP2A 4E8CA 2OLHA 3VINA 4HJWA 5FF4A 3IGUA 3FJ4A 3QC0A 2I1OA 2ZXAA 3ZMRA 4MF4A 1A49A 1RBLA 1UH3A 2WHMA 3PZUA 3H2FA 1GOKA 2C8NA 4ZOAA 2G3JA 2ZA1A 4GACA 3MUY1 3IWPA 5CBJA 4FR1A 4INFA 2C15A 3ITGA 4I7WA 4GINA 4CD6A 4PFMA 4KIEA 4LYRA 3W75A 2E1WA 3EX4A 3WJWA 1VQTA 4WEVX 3BOXA 1JR1A 4I5UA 4IFOA 4W8AA 3DXIA 3NA8A 3GSMA 1LWJA 4IPJA 3VIGA 2QDHA 2PWHA 3QN3A 2A85A 1QT1A 1E6QM 4J2PA 3GD3A 1IGWA 4LS2A 3KE0A 4KPLA 1S2UA 1JZ5A 3MTWA 4RXGA 4B4FA 3DOPA 3SR7A 2P88A 4JBRA 1SW7A 3B8WA 4V1XA 4W88A 2CBIA 1JDFA 4F79A 4E3TA 4L64A 3A7RA 4X22A 1NDYA 5D2XA 3WQGA 1RJQA 1TZ9A 2P0IA 3A21A 4DQWA 1UCWA 3E49A 1H1ZA 3ARTA 3MBDA 5EMKA 3UJEA 1NHQA 4AAJA 3UF9A 5I09A 1DV7A 5KINA 3SY5A 3ZXWA 2WXDM 3AS1A 3QEZA 4UFLA 1I75A 3QY8A 2PAJA 1CXFA 2W67A 3PZNA 1E55A 2GUBA 1RA5A 2G5WA 3QOKA 1BWVA 4O28A 3ME3A 2FHBA 2Y63A 1LPFA 3GM8A 5D2YA 3TYEA 4QFUA 3GO2A 3W6LA 5BXPA 2DSWA 4G7FA 2XWDA 1A3HA 1AZ2A 3N2CA 3CTLA 4LBRA 1ZU8A 3IIVA 1A3WA 4NX0A 3AXXA 3MUIA 3ISIX 3F4CA 4Z1DA 2VGBA 2Q01A 1HKWA 3S5ZA 1AQHA 2HCVA 2EHHA 4XUGA 3LRMA 3WNNA 4A35A 2O7SA 3WMBA 1UH2A 2AL2B 1BWCA 1NF0A 4GYPC 1Q5MA 5I24A 3DHFA 3AC0A 4LEFA 4KETA 4D1JA 3FK4A 1YDYA 1YX1A 3KL5A 5CGMA 1KCXA 4I6KA 3G24A 3CHEA 2GDUA 2YB4A 4U28A 1NIUA 3GHRA 4HPNA 4WR3A 3LTPA 1OG0A 1SZNA 1LQ2A 1FH8A 5C9XA 2NX3A 1EIBA 4GY1A 3TYCA 1XPYA 3NOYA 4DXKA 2YYUA 3H4GA 4CCEA 2GR3A 4Y9PA 1FP9A 3OPSA 1MZRA 3VYLA 4GYPA 2Z4GA 1KFBA 3LI1A 4BF5A 4H50A 3BC9A 4QCEA 4LCRA 4O8AA 2Z1VA 1ZGDA 4L65A 1S2TA 3PZOA 3UG5A 5FS9A 1UBSA 2FPYA 2OQLA 4HMCA 1BG9A 1HP5A 1K7FA 1ZMCA 3H23A 3M0JA 4CQBA 3R13A 1UD2A 4JYEA 4HHHA 5EPDA 2OGJA 4PCFA 2X1TA 3CGTA 3NDYA 2L5HA 3DAQA 3FYPA 4PODA 2R6OA 1P0EA 3PZIA 2ZOXA 4YPJA 1UB3A 1J0HA 3VOFA 1HT6A 2F9RA 1O12A 2DPEA 4ZSTA 3E5BA 1AFSA 1OD0A 3IGHX 4TQTA 4LF2A 1YE4A 3EZ4A 3L4ZA 4J3UA 1ZP3A 4UFJA 1GW1A 1I8JA 2Z1XA 4L1WA 3W4RA 1J4EA 3R4IA 1GPWA 1I2OA 5A6BD 3U9IA 4R5EA 1MNSA 5PTDA 1LWIA 1AMYA 4P8UA 1OC6A 1AG1O 1QHZA 2XGIA 3G6LA 3KL3A 3GBDA 3QR3A 3N3TA 2A3LA 3QFAA 2OKOA 2UWFA 4O4VA 4LUSB 4TTGA 1EOKA 1SU5A 1JROA 1LJYA 3GNDA 2XN0A 1LYXA 5AC7A 2WLZA 1XL9A 3FGCB 3GVWA 1MMFA 5CPQA 4WD0A 4ROPA 2HXTA 2DP3A 3MSDA 1D7YA 2V3DA 1OZQA 2W9MA 2RJHA 2V5DA 4GR1A 4DWSC 3NVYB 4B5NA 3SUWA 4AVNA 3TROA 3EMZA 3PHAA 4GLEA 1J0KA 3LCGA 1ZY8A 4JTDA 4POCA 3GAKA 5H91A 2BHZA 3LD5A 3KDOA 3PC0A 3O9NA 2VFIA 5FJUA 3EWCA 2PDJA 1EEXA 3WZ0E 5A6JA 2J78A 3VDBA 4J3VA 1PVNA 4XBSA 4HTYA 3VNZA 4IUGA 3VKAA 1YTKA 5GQBA 1TELA 4LCSA 1D3CA 2WMFA 3W7NA 2OSYA 1WDPA 2CIPA 1T96A 2XSXA 3O15A 1JXKA 2I57A 4WCJA 4LB3A 3TP4A 3R10A 3W7OA 2QQ6A 1RPXA 2J79A 5FD0A 2JKAA 1EP2A 1UYQA 1VFLA 1HJQA 3P5YA 2E77A 1NHRA 5FJJA 2CU0A 3K5XA 4B2DA 2V69A 2EPKX 4XSMA 3N18A 1U33A 1GETA 3BE7A 3T0BA 5FF3A 2AQWA 2FFIA 3OC4A 2GFTA 3R0KA 1AVAA 2D0GA 4LGXA 1U1UA 1M7XA 3SCPA 3S3GA 2P8BA 4FIQA 5HMFA 4BURA 4ICMA 3LPPA 3RXZA 2B81A 3SY8A 1VJSA 1IZCA 1EC9A 3FGCA 4PMYA 1NDWA 2VFDA 3RG6A 3GRTA 4V27A 2IQ0A 1HKIA 1JCXA 4UB9A 1OY0A 3PG8A 3USBA 1VJZA 5JH1A 5JRBA 3W1TA 1B5TA 2XIJA 4D8LA 1FFVC 1JPMA 3C2EA 1HJSA 1MQRA 2RABA 2O0TA 1KFKA 3PAOA 1EPXA 1SYTA 1B90A 1MRQA 3CV7A 3N2XA 1FFRA 2QV5A 1UJQA 4LV9A 1US3A 1AUSL 4L4LA 4IPNB 4TUFA 1Z69A 3L5AA 4UQEA 1GOMA 1PEZA 1UKQA 1W54A 5CLTA 2J9YA 1ISVA 3DI1A 4PGLA 3N04A 5D8WA 2W3SA 3HGSA 1VB9A 3QBUA 4YLWA 2CLLA 3FJ6A 4APNA 1XRTA 4S3BA 2QCNA 3A22A 4Q8NA 4AIOA 5K7JA 2CLFA 3CAQA 1EBGA 4B16A 4IMFA 3EX2A 3NVTA 1SZEA 3PZQA 4YYFA 1HKMA 4HP5A 5H1WA 3MJYA 3C2VA 2QEZA 3OZYA 3QR1A 2SFPA 4MWAD 3LGDA 3WMSA 3DBNA 1TKKA 4QLLA 3FHAA 1BEUA 3R11A 1OIFA 4UFMA 4MKVA 4O52A 6ENLA 4W8LA 1GORA 2BMBA 3LCLA 2VFFA 2VEGA 3WQOA 1Q2RA 4IJBA 4CQ9A 1PX3A 4OECA 3WEMA 4BCEA 4A3YA 3ARYA 1RXOB 3KTXA 4Y9MA 4DBSA 3S4TA 5C2CA 1U1HA 1MDLA 2VHLA 1LROA 3H2OA 3PJWA 5HJLA 4Q6XA 1S5TA 4AZCA 5KMYA 4PL1A 4W4QA 2YXGA 4U10A 3UVIA 1GKPA 7TAAA 1CZ1A 5AZ0A 4QXIA 3VU2A 2QGHA 3QPZA 5BWFA 2ZTJA 3GG1A 2J7FA 4RE3A 3W6YA 1JZ3A 2KAUC 3OZOA 1YMYA 2GOUA 2ZXDA 3ITXA 4CD7A 5LA1A 3UZJA 4X3ZA 5T8GA 1OCBA 1PCKA 3W7PA 2PGFA 1GEHA 5I3KA 2Y2WA 1A5BA 1NH6A 4I9TA 4NAFB 4O1AA 3W1AA 2QCHA 2QMKA 3GIPA 1OINA 4NY2A 1FWDC 4UQAA 3UW6A 2V3GA 3F5KA 4GVIA 3WLHA 1TQXA 4GX8A 1KGWA 3B8UA 4MGGA 5T9CE 4F40A 2X1SA 3SGGA 2PTZA 4I7VA 2FZNA 1ZKQA 3IVTA 3UG8A 3KM8A 5BRBA 4DJFC 4EMJA 4NJHA 3TQVA 2DIKA 3MBFA 3VDHA 3AQUA 3REQB 4Q4OA 5A2BA 2DH2A 1YPFA 4K39A 1B31A 3UQNA 4G56A 5LNUA 1XG3A 3UXLA 5D8ZA 2Z1BA 4GY0A 4REQA 4XAYA 4HQVA 3WO8A 1W9BM 4GG9A 1OGSA 3URAA 3DC0A 1GKQA 2WCSA 2VYOA 5ABEA 2J27A 3VNJA 4M1BA 2ONEA 4AF0B 3CV2A 2PDBA 2OSXA 4LTSA 4FF7A 1DNCA 1Q8AA 2PURA 1AL8A 1E6PA 4JKKA 2YVJA 1EJUC 4OIFA 4H4IA 3KZPA 4GUHA 2FZ9A 1K4QA 4S3AA 1OVDA 1XCFA 4GI8A 4H4PA 3CUIA 4JIEA 4AISA 1IEIA 6XIMA 3FV9A 1AQFA 1IT0A 2OQYA 2FDMA 3ZJKA 3URBA 4PUDA 2GLKA 2ZUVA 2R1LA 3WBAA 3NQ8A 3D9XA 4NAEA 4CNNA 2W63A 2O4MA 1QO2A 1OB0A 3OGRA 5EMYA 3TN6A 1IEXA 1A80A 4PA8A 2NLYA 4KWOA 1BYBA 1YE6A 1TWSA 3R89A 4JR5A 3U7VA 3AXMA 3WDIA 4FXFA 4J2MA 4QCFA 4JL1A 1FEAA 1HL8A 2DVXA 1S46A 3LERA 1O5XA 2E9MA 4FPSA 4GISA 4GO8A 5AB3A 3KS5A 1V0NA 1QW9A 2FYMA 1F76A 1NQ6A 2PGEA 4QE1A 1V3LA 3SN1A 4AQLA 5LXXA 4MNJA 4KQNA 2JBMA 4FNRA 2GSJA 1BYDA 1WX0A 2WP5A 1FWCC 2WM1A 1MI3A 3EEZA 5A95A 2ANUA 2UBPC 1GONA 4GQQA 1PHWA 1KCKA 2CXEA 4NILA 3SN0A 1DKWA 1FX6A 1Q6DA 3ANVA 4KPRA 2V3AA 3K46A 3GU9A 4LCQA 4PEKA 1GVYA 2DH3A 5TQLA 3THUA 1C90A 4Y9AA 3M41A 1P5BA 5C70A 1M7JA 2PWGA 3MMWA 4CN6A 1LBFA 2GGHA 3EAOA 3GXIA 3AYTA 3UCDA 3PBYA 4GGBA 2JEPA 4QS5A 4XZMX 3G6MA 2QULA 1W1VA 3PTMA 3BCJA 1CI1A 2W79A 3I7RA 1S3TC 3R1ZA 3AUJA 3MVTA 3S5OA 2OFJA 1W3IA 1Z48A 3S47A 1WXZA 4ZGYA 4QJ3B 1H5YA 2XH0A 4GUFA 4L4MA 1XSJA 2P3EA 2ZE3A 4YTTA 3Q58A 9CGTA 2FIQA 3W7KA 3GDRA 3A24A 3AHXA 2YPIA 2QJHA 3TA6A 2BVYA 2PTYA 3SUVA 3G5EA 3XISA 5HATA 2G97A 2WVTA 4HPHA 3B4YA 4N4QA 4LXFA 1FH7A 1R2RA 1KA9F 4NAFA 2QCMA 3H4WA 4M3PA 4FIRA 5HPOA 2G3IA 3II1A 1N8WA 3BMVA 3MVIA 3UP8A 1GYLA 3TDFA 3HMJG 4YMZA 2C1HA 3SSZA 4UFIA 1QVBA 1YDOA 3PPHA 3QSTA 1UQYA 4KFOA 3P61A 4D9PA 3SB0A 2QCFA 3LSCA 1UA3A 3T9PA 1FWFC 3VGHA 4KKXA 4PZVA 3DG3A 3THCA 4D2JA 2AL1A 2CDUA 3QZ6A 2ZE0A 3I6RA 1UWIA 3IVUA 3FAWA 3VDAA 3HPSA 1TPC1 1TWWA 3DFNA 3QXBA 1M68A 3LCFA 3S2NA 2HE8A 1VKFA 4UR7A 3KVJA 1XV8A 1NU5A 3DECA 4UTIA 4H4XA 1Q6QA 2PP0A 1BWKA 1EGMA 1I60A 4BJHA 1DPMA 4JY8A 4DM1A 4Q7BA 1T3QC 1XQKA 4WLCA 4A4AA 4X9SA 1H1YA 2WBKA 3QTPA 5EA9A 4W86A 4DNAA 2P53A 1ZTVA 2A6NA 1EJRC 3WLMA 4WDUA 2GWNA 3NM3A 3EMCA 3I3DA 1Q2SA 4OBSA 4LYKA 4GY7A 4Q7NA 3JRKA 1GVRA 2Y24A 3NWRA 4IFKA 1XLIA 3GNNA 3W87A 1XWYA 1YTDA 2YCIX 1B3XA 4F0SA 1STZA 4B4HA 4PRRA 8RUCA 3W53A 3PK7A 3VCCA 4HYWA 2H90A 3PUGA 4HCHA 4L4PA 5BZAA 3LPOA 1Q6CA 4U5IA 3UWUA 4NZCA 1BGAA 3TJ4A 2IKHA 3T2QA 4PMNA 1UR3M 3TE9A 2HVMA 1IEWA 1AH0A 1P7TB 2BFGA 3BH4A 4XO6A 5I6SA 5LNSA 3NVZB 2G0WA 3MKCA 3DKJA 2GVGA 4AW7A 1E9YB 2WPCA 3RMJA 2VFEA 1Q6EA 3MQTA 3QPYA 3CLWA 1A0CA 1H7RA 4XQ6A 3WH5A 2H3BA 4P8VA 3W29A 3T05A 1J18A 3GKFA 2QHAA 5FEXA 2XIMA 2QXWA 5I06A 3G1XA 3ID7A 1D3GA 4QSFA 2CLIA 4IGNA 1H62A 1JYNA 2PGWA 3TFCA 4PUMA 2XUCA 5CJNA 5CZSA 5GJNA 5A94A 4RZ6A 1F61A 1Z6KA 4OZOA 5A3HA 2JKPA 3WJXA 1GEQA 1I2PA 1QR7A 1THFD 1VZWA 1DIEA 3K2GA 5CH9A 3WBXA 3AALA 1XBVA 5F2GA 4MWAB 2VKZG 2C3CA 3VIPA 2RHGA 2VZVA 2JQXA 4MPQA 4D6CA 1X39A 2ZWZA 3ZFHA 2Z6IA 1RAKA 2PRLA 1RK5A 4QDWA 3W7RA 3UWWA 3VGGA 4LC8A 1FHDA 5FI8A 3KX6A 1UKPA 7REQB 2GJNA 2E28A 4UQBA 1E4NA 4MJ2A 1A47A 3R7MA 2FB2A 5IM51 2BOFX 3LBCA 1JL8A 3GTXA 1UR9A 4QIUA 5A6LA 3E9AA 1ISZA 1L6WA 2HE5A 3VGDA 3P8JA 3ZLGA 4M6QA 3WFAA 4ALDA 4US5A 3MV01 5CGQA 3VGBA 1UR2A 2AAMA 4PH6A 3P80A 2E5AA 1UOZA 1PHQA 3TCEA 4DJFD 4Z0JA 2NQHA 4J28A 1K02A 4IMCA 1UR4A 3LA4A 3V16A 2I5GA 1W9PA 3MB9A 2E0PA 4BY3A 5JCLA 1UUOA 3UNTA 2GJXA 5EBUA 4B91A 1EZ2A 3POHA 5DQPA 3SJ3A 3ZT5A 1V6XA 3GTFA 4XV0A 3VNIA 2NSXA 3OZMA 4TV6A 3VOCA 1SO3A 3TJLA 3E2VA 3I7SA 2F6XA 3UGRA 5AYZA 1J6OA 3CHVA 1FFUC 3A47A 1NWRA 3AMDA 3W07A 2F61A 3A64A 2HDJA 5CC3A 4XZLX 2YL9A 3PUOA 2YZRA 4HZ6A 7REQA 3QSRA 4EXQA 3N4EA 4PE8A 1J8VA 3WLOA 3H8AA 5F4SA 1TCMA 3IIZA 1EO5A 1UR1A 2VDGA 4LUSA 1WP6A 3MO7A 2X7VA 3VD3A 3H2CA 1R47A 5DFAA 1KFJA 2PDCA 2WPFA 2FDSA 2OB3A 4WKAA 4J3XA 3E0LA 1DXIA 4FXSA 5ENLA 3PBGA 2NQ5A 1MYRA 4ZOEA 4ZB0A 3OTRA 2CZDA 1G5AA 1YYAA 2VT0A 2G96A 2ZUUA 3IUDA 4IFRA 3B0UX 2Q8XA 2ACQA 1F3PA 4EOUA 4O16A 3ETRB 1WBJA 1GW9A 2GOKA 1T41A 3P7YA 2HEJA 3K4WA 4FXJA 4N4PA 2BXYA 2WP6A 2QCDA 4NJJA 2PD5A 3W1UA 3W1NA 2G3NA 4UTUA 3QM3A 4PB5A 1REQB 4U31A 3PTDA 1S39A 3NVWB 4YXGA 1CENA 1KKRA 3DBPA 1UPMB 1ZAIA 4CEUC 3UY7A 3DI0A 2BCPA 4LYQA 4W7UA 4DLFA 3P81A 1RA0A 3DFOA 2PGRA 4PB3A 1AODA 2E5BA 2OGYA 4OT7A 3ZQ9A 3Q6JA 1GRGA 3HO8A 7A3HA 4ATLA 3G1FA 4N02A 1F8MA 1SR0A 1TYGA 4DAFA 4IOTA 1R9ZA 3SCNA 2NX1A 3V5FA 2FLIA 3MSGA 2FPTA 1FTXA 2C19A 3U48A 3A9BA 3IIOA 2BSLA 4WGXA 4NU7A 1FBAA 2WZIA 3OGSA 1CT5A 4GX9A 2GGEA 2EPNA 3HFTA 4I9MA 3CL7A 1KQYA 2ZA3A 5K9XA 3VKDA 1JCMP 1I2QA 1MXGA 2RAGA 1HO4A 4TMBA 4C6BA 1XFBA 4O19A 1ZHAA 1EHNA 1OQFA 4HZ8A 4H4SA 2EQ9A 5MHBA 2BHUA 2ZX9A 2FHFA 4DJDD 4JIPA 1GOIA 4RKAA 5FS6A 3ZWTA 3WJSA 2WLYA 2XSBA 4AF0A 1VFFA 1VLIA 1QPOA 1DJQA 3EANA 3EX3A 3OVPA 3RO8A 4HA3A 2EQ7A 3MHFA 1OCJA 4IIGA 4AXNA 2PFHA 4AZ5A 3N17A 4C65A 1Q45A 1C8VA 4I5RA 1WZAA 5D2WA 3DESA 1KXTA 3STEA 4MIMA 4AEOA 5FKYA 1MNZA 2D20A 4GKTA 1KCLA 1LDCA 1VEMA 4LF1A 3LZ5A 5HNUA 2XVPA 3R94A 1GJUA 2QUUA 3SQLA 4M80A 4Y2WA 1MXSA 5HNTA 4M7SA 1V8EA 3L67A 4AHQA 4CU6A 1RQHA 3K4DA 3ITYA 2X42A 4KEUA 1SM9A 3O05A 1FQ0A 4J4KA 1ADSA 1R7OA 3QYQA 4P7NA 2WOWA 4JN8A 2NSOA 2V30A 1K7XA 1H11A 3GC4A 2J7GA 1DP0A 2QS8A 1CLKA 3VKCA 4AZHA 9XIMA 1XC4A 4DWSA 3O2LA 2ZZ1A 3WJZA 4FOJA 1ML1A 4LQ1A 4RXFA 4XZNX 2E3ZA 1ZJAA 1RK6A 4XUYA 1JFXA 5GVJA 1UMYA 3PY2A 5H6HA 2A7PA 1F3EA 1OCNA 1GVFA 1SVDA 2H9AB 1VYSX 4QQUA 2JIEA 2B4GA 1Q63A 5M2FX 3SEPA 4EF8A 4MB5A 3FW6A 4XISA 1YRRA 6A3HA 2R82A 1A5OC 2R9RA 1GCYA 4Z2JA 4NG3A 4MAVA 3L0GA 1TPH1 2QUMA 4W87A 4F8XA 1XBZA 1A4MA 1OX5A 5FJRA 3DHUA 4AYGA 3SN4A 5LZLA 4BS0A 3N73A 3IV3A 1TVLA 2WC3A 2V38A 3IANA 4CD8A 1WE5A 4O11A 2QDEA 3UWZA 3QHNA 1AH3A 2OT0A 3WDJA 2PCEA 3LX9A 3WDQA 1GRHA 1KBIA 3NQ2A 3ANYA 2PF0A 1BLIA 5A2CA 2B7OA 4R7WA 4B5WA 5LIKX 5M1TA 5JXQA 2ZZ4A 3FXGA 1KW1A 3KBJA 1UC5A 2A6LA 3WUGA 3UG3A 5C8BB 4G1NA 1IR2A 1L6SA 2FHCA 4NP7A 4PCNA 3ONBA 4QG8A 5HR7A 1J0IA 4UTLA 1LLWA 3HG3A 5KZMA 5E6ZA 3VI2A 5G4WA 2ZZCA 3C0JA 3TAKA 1F8WA 3T2PA 3H4XA 3CZKA 3LXDA 3V35A 3VD7A 1E0WA 1BSLA 3KFTA 3DDMA 1I1WA 2Z28A 5ABGA 3THDA 1NSJA 1FO4A 5J04A 1HNYA 2X7WA 3GFYA 2ZQ0A 2Y8VA 3LLDA 5LGXA 2GDVA 1GYMA 4MM1A 2XVLA 3Q37A 4W8BA 4RUBA 3NFUA 2NVDA 5CC6A 3BSMA 2QAFA 1JYWA 1WDRA 4GC4A 1P4CA 4ZOCA 3WH9A 8CGTA 1F6YA 4MMWA 1V7YA 1W1TA 2IUZA 5H8MA 4XZBA 2WSKA 1TJ0A 5AYBA 3EYPA 2XIBA 4JTSA 2QCLA 3HBLA 4MY9A 1MW3A 3W73A 2WMKA 3VO0A 2HISA 2VFGA 3C6CA 2VD9A 3BUVA 2F6KA 4K8DA 2ACSA 4H1ZA 4WXZA 4ZO6A 3KRZA 1Q6LA 3DU0A 3WQVA 1QJWA 4AIBA 1NTHA 4OQVA 1SO4A 3L12A 2FGBA 2WMGA 4LAZA 2Y7DA 3VTRA 2FMNA 2J7EA 3W82A 3RK8A 3TMLA 2ZX7A 4D1IA 4XWUA 2E9LA 3A5FA 3RPMA 2DW7A 4CCDA 3C2RA 3FVDA 3MUAA 2E8YA 4ZQRA 3PPFA 4A3RA 4EPKA 2PI6A 3T09A 4DWSB 2DV0A 2J77A 5EGRA 4J3ZA 1VS1A 4EIVA 2HS8A 4FLOA 1XLJA 3EWWA 5JCNA 4Q6JA 3S2CA 5JBFA 2CXGA 8TIMA 4EP8C 5FAGA 3FG2P 4WJXA 2WZTA 1GRAA 3RF9A 3CUJA 2WSRA 5FEWA 4GGHA 4C6LA 1K8ZA 5FEZA 3RR1A 2WHLA 2QNEA 4XTIA 2Y5EA 4IIBA 1UQZA 2WNZA 1LRQA 5AHFA 5FIPA 2XN1A 3VDCA 1ZLPA 1A5LC 3Q2DA 2DW6A 1BAGA 2QIIA 3AFBA 3ARQA 3TSMA 3EOEA 3T0AA 5EL1A 1EKOA 3E12A 1R46A 3WNMA 4RPPA 1UD4A 4Z0SA 3W0KA 4D72A 3QPEA 1W3NA 4K8GA 2IPWA 4IF2A 1AQMA 3NO1A 2VZUA 2A79A 4J3TA 2TRSA 3GK0A 2I7GA 2P3ZA 1XYBA 3UZZA 1MUWA 3TTYA 4MUPA 4OE7A 3HZ3A 3OBAA 2O7QA 1GYNA 4UTWC 3VD9A 3SM0A 4QG6A 1XBYA 1IEVA 3B8IA 5FACA 4IQLA 3O1NA 2ZRWA 3GU1A 1AMKA 1B3YA 4JN7A 1D3HA 2EJAA 4L7ZA 3NZGA 3MT1A 3PG9A 4HGXA 4AWEA 1XSKA 5REQB 5G4EA 3PSVA 4W85A 2CHRA 2C71A 5LXEA 3W1XA 4M6PA 4C5YA 4GBDA 1Z9AA 5LIXX 3LHYA 1NFPA 3HN3A 4OHQA 1YADA 3L68A 2BB0A 1E6SM 2E5DA 1F4HA 2EGZA 5A8NA 3FDGA 3C2YA 1VH7A 1MFVA 4DAIA 1AQ0A 1U22A 3L7RA 1ZALA 3WSUA 5LYRA 3UGVA 2NUXA 3PJTA 4TO8A 3WH8A 1FRBA 5E0CA 3WELA 3MZNA 4AD1A 3S6TA 1VFOA 3CQ0A 3PSWA 3PWGA 3TW7A 1M41A 4EX4A 4MDOA 1E0XA 3GIQA 4P7RA 2YCLA 4CN4A 3QV9A 3KCOA 2ALDA 2J75A 1NHSA 4YTQA 4AHPA 2EXOA 3GW3A 1KC7A 2RKXA 4M1RA 4H4RA 5A2AA 2V3BA 3EA3A 2NQZA 4X60A 2EAWA 3WLSA 1ADDA 2H8ZA 1CCWB 3VIMA 1KBLA 4O54A 3N9RA 1LORA 1M6JA 3MP5A 3KWXA 3NO3A 4IJCA 3TYAA 3WLRA 4D6GA 1ZSXA 4FX8A 1J0ZA 5U25A 2J7DA 4H4WA 1VHCA 3TNOA 2AKMA 4W5UA 4LX4A 1JIBA 1POKA 3RNMA 5HNRA 2YDSA 2MNRA 2GQAA 2ZX5A 4UXDA 4D71A 3N2TA 3N12A 4JQ2A 2CC0A 3QV6A 3AICA 4G9PA 2VVSA 3H2NA 2C0AA 4QP0A 1XYZA 4HA0A 1XG4A 4G8TA 3UWYA 2CETA 1RCOB 1ITCA 4QNWA 1YXDA 2A3AA 3N13A 4UMBA 3CMJA 3GB6A 1CW2A 3F03K 3S1XA 2VD8A 1QU4A 2YL6A 1LLOA 3AXHA 4KFNA 2V6AA 1E72M 2ZCGA 4H9ZA 1XPGA 4RNHA 5HAOA 2WSYA 4GFSA 4XD4A 3CC1A 2DUXA 4D6HA 4XKMA 2TSYA 4CNTA 3KHJA 1B2YA 2F6UA 1PDYA 5D09A 1TZZA 3IS4A 3VOJA 3G18A 2QCEA 2ACUA 4M0XA 2F38A 2X8HA 1SSGA 1XCXA 3UCCA 3PWAA 3GIYA 1TTJA 2ABAA 3NQEA 2ZRUA 5K4XA 1WB0A 2X1RA 2CLOA 4KGJA 2W92A 1W3KA 4AY7A 1V93A 3INPA 1V08A 3LCWA 3TONA 1HJVA 3VABA 2R1PA 1PCWA 3G22A 4DVOA 4EAMA 1ZAHA 5IOBA 1IYXA 1XDJA 3GZ3A 4MB3A 2PRMA 4DPPA 4LH8A 4C6FA 4D6JA 4A21A 4GJIA 4XIMA 1CGWA 4CNPA 3KLKA 4Q4QA 2QZRA 3NS1B 1TE6A 1BYCA 3OVQA 1Z89A 4S23A 4GVHA 5C7HA 1B3WA 5C71A 2YGYA 3QGAC 4DYKA 3C2FA 1W32A 4MNKA 4HOXA 3LHWA 1RVGA 1QW8A 4N2YA 1TMQA 1PX4A 4LWWA 1XF0A 3CZJA 3B4UA 4UTMA 1P6CA 4OOZA 3AHYA 1NQKA 5G5IA 4QR6A 5KTLA 1XFCA 5KEZA 3I68A 2VEKA 3KP1A 2DIJA 1XBXA 5T9BG 3I3EA 3WLLA 3M07A 1I1XA 1YHTA 1G9HA 1W3HA 1W8SA 3BG9A 1NPXA 2WPGA 4HNLA 3L4XA 3PZGA 4J3WA 3ES8A 1ZP4A 4DXVA 1WQ5A 5AHEA 2HBXA 4LSBA 4NJIA 1ZJHA 3W7JA 1XQLA 4W7WA 2OZ0A 2BVTA 1KBBA 2ZC1A 1E6XM 1QFEA 3TZFA 1ZXIC 3HQPA 3DK9A 1FWTA 2XZ9A 1QW7A 1B30A 1UHVA 1DBTA 4RLIA 1X38A 4O0KA 4G1KA 1JPDX 2YCLB 3ABRA 2WV8A 3AHTA 3LGGA 1TJRA 3ECQA 1BHGA 5I77A 1I2RA 1HZYA 1UUQA 1E40A 1MEWA 1PZ1A 1RVKA 4JHZA 1Q1RA 4F9DA 3WF1A 1MW1A 2EO7A 3AHVA 3EB3A 4AY8A 1C9WA 4C6IA 2IMRA 1A0DA 1YDNA 4AD0A 4HHPA 3NCOA 4HTBA 3S1VA 1KRAC 1CXEA 3AN1A 1FDYA 4QEHA 1XDLA 5BOOA 5C5YA 1W8GA 1EL3A 1E1FA 4LRTA 3H53A 4H4QA 3IIPA 1HKKA 2OOFA 1OC5A 1HW6A 1V02A 8XIMA 5HWJA 4JCLA 1NWTA 4XZHA 1R6WA 1BXNA 3IJ7A 4HMDA 1MW0A 2A2IA 4DX3A 1JJKA 1UP3A 4HK6A 3GXFA 2OYMA 3A7AA 4H2HA 4DWSD 3ZR5A 3WD3A 3KWSA 4GIYA 4TX8A 2DSZA 6XIAA 1Q6RA 1F6KA 4H2CA 4H9YA 3HF3A 2VUYA 2ZFAA 1TJ1A 3HG4A 3DX5A 1KFWA 3UZWA 1SJBA 1XGDA 2AL2A 2CZFA 4CCCA 2QUTA 3UJFA 3O6CA 1OX4A 1IXNA 3OA3A 4NZ1A 2RGMA 2Y70A 1EBHA 1X1OA 1FHLA 3N29A 3WBYA 3VX0A 3PFMA 1EZWA 2PWDA 1XIJA 4ILSA 5AYYA 3IRDA 3BZGA 2CHNA 4IMDA 3P3BA 5I2UA 1NFGA 3BSGA 3RN6A 2BY1A 4ZMGA 1DIKA 1H7OA 1YPIA 1G4EA 5C54A 2X0HA 1O6IA 1SW3A 4QQ3A 1VENA 4B5UA 1KV8A 4O13A 2ISVA 3AIQA 5M17A 1BPLB 2MANA 5TIMA 1WDDA 3SDOA 1LCOA 4IXHA 1C93A 2CHOA 1NDAA 1EYEA 1ZY9A 1TR1A 3LRKA 1YLVA 1DWFM 3B8SA 2Z25A 5J5DA 1H0GA 4LC6A 4DY1A 1CXHA 3SGUA 4ACZA 1K6WA 1VRDA 3SI9A 2OVLA 3M47A 2WVVA 3O8AA 5ECVA 3CIVA 3EWZA 4J27A 3L23A 3G1SA 4L1GA 4X9YA 4BF9A 1XD1A 2PSNA 2ZVRA 3LCXA 2P1FA 3EB4A 3HGRA 3DEQA 3W23A 2CFFA 3EKLA 4NZJA 2IPJA 3NQBA 3AMLA 2HMCA 3DK8A 4NSBA 1RHCA 4AWSA 1TO3A 1P0BA 2YW3A 4DUOA 3CEUA 1O60A 3G77A 1VFHA 1B3ZA 1W9DM 3B06A 4KRZA 3W88A 2D2HA 1J2WA 1R85A 2DJLA 4PMRA 2IW0A 3AYRA 2PCQA 1W5OA 4O1EA 1GRTA 4WDXA 4CNUA 1D7KA 3S1UA 1VCVA 4K7VA 1ZX9A 3WQ6A 3TN3A 4P7QA 4BF7A 3VNLA 3RFAA 4JCMA 4F0LA 4DNHA 2NV9A 2V3EA 4MWAE 4EANA 3UY8A 4JTAA 1CGXA 4JNZA 3MCNA 3GR4A 3EXRA 3QW4B 1IT7A 3TR2A 4LUIA 5BU6A 5D38A 1FOBA 4I8YA 3TYBA 3LV5A 1EX5A 2NXGA 3TU9A 2ZUTA 2CERA 1X7IA 4GXWA 3CMGA 3UA4A 3V4BA 4PCTA 2Y5SA 5IHSA 3EWYA 3HGJA 5DELA 2WVUA 2PTDA 5HA7A 2Y85A 1TWIA 3T44A 1FP8A 2UY2A 2YCKX 4DO5A 2VR2A 1NWUA 3IV8A 3LS9A 4B9YA 4XAFA 1WZLA 1GOXA 1GOOA 1A0EA 3TTEA 1TYTA 1W5QA 4L61A 1EDTA 3NYZA 4W84A 1UWTA 3VIIA 4US6A 4NJKA 3BCDA 2PZ0A 3WNPA 4HN4A 2ZDRA 4YVXA 2VC5A 3QFEA 6REQA 4YCPA 3DYPA 3GY1A 1KNWA 1FWRA 4R27A 3AM9A 1ZCCA 3RPDA 2XYLA 1XUZA 3FSTA 4QJ5B 2GVJA 3IAPA 3D5HA 1XLHA 2ZRZA 3KHDA 3DYMA 4IIEA 3CEPA 3CL8A 4CCZA 1QI3A 3G8RA 2X0SA 3WDPP 4FLSA 4ERGA 3HFYA 4ZVJA 1RJPA 4H4ZA 1DWJM 3DZ1A 1CXIA 4K38A 1AW1A 3UZ5A 3WQEA 4FX7A 3DH9A 4GQ0A 3FXYA 4FB7A 1ADOA 5CZJA 3UXAA 1UJPA 3EX1A 1TV8A 3L5LA 1C91A 1GVQA 1E1EA 3NGFA 5CJMA 4JYFA 3VE9A 5DCDA 3NNTA 3ENLA 5AYXA 3A9IA 5ER0A 3M5VA 2RFGA 5M5DA 1O68A 1L9WA 1XDMA 3ZR4A 4IG2A 3PZTA 4X63A 2ADAA 1GTHA 4JX5A 4N42A 1MRAA 4C1NA 1E4MM 4U33A 5CJ5A 5CSRA 4DEFA 3LRLA 1EJVC 2Y7GA 4JTRA 4O53A 2NX9A 3HU7A 4US5D 5LHEA 2C1IA 4UZUA 3FEMA 1B9BA 4IM4A 3A7UA 3NL5A 3BVJA 4GNVA 4F0MA 3P74A 5JCIA 4CQ8A 3NEHA 5TR3A 1LBLA 5D32A 4EF9A 4PC8A 2VENA 3ABZA 3TOYA 3S5SA 4CD4A 1J2BA 2FGLA 1QTWA 1SGJA 3UR5A 1FWBC 2ALRA 2R24A 4GUJA 1R38A 1HL2A 2ON3A 1WKDA 2XSAA 4RW3A 3TCSA 1AW2A 1PIGA 2HNEA 1VYPX 2NLIA 3FHQA 4J40A 3RM4A 3TVAA 1LUCA 3GRIA 1X96A 4ZENA 5F7UA 4AWTA 1KBJA 3W1RA 4XBKA 3QJAA 1VJIA 2WKLA 3E3HA 4JFWA 4U2YA 5CEWA 1SZGA 3CM4A 4HK5A 3HPAA 3IRSA 4X2PA 2NZLA 1KR0A 1QK2A 1JQVA 5KZDA 4HT3A 4L9YA 2HK1A 4ORMA 3IJIA 1RD6A 2J7CA 3EWBX 4WDWA 3OBEA 3STCA 2ZZ0A 2V5BA 4HB7A 1X2GA 3C61A 1CBGA 3UYIA 4H9XA 4UR9A 4H4TA 1KGXA 1GNXA 1TWDA 2XHYA 1VCGA 3ZO9A 3H26A 3E74A 1DWIM 2Z1SA 1TUFA 3N25A 4PEEA 5HMEA 2WZHA 3W27A 3UT0A 3WN6A 3EWUA 1ZBVA 2IQDA 3UD6A 4XX6A 4HNOA 3E5PA 1AK5A 4EMWA 1HO1A 2VRJA 3LHZA 2J62A 4GD0A 2BODX 4FEZA 1ZAJA 4LPCA 3CZEA 4ORIA 3OLIA 3OZPA 1POJA 5BMXA 4UNLA 4DPQA 4S3JA 3KOWA 3BURA 1QHPA 1R3SA 2EG8A 1D2KA 3CGDA 3OW1A 3R79A 3KRUA 4LT9A 2CZVA 1GKRA 4H83A 3NQGA 2Q71A 4QRNA 4RE0A 3R5EA 2ZZ6A 1XI3A 4OV9A 1ITXA 2I56A 4AUBA 1XRSA 3BAIA 3SJNA 1GXFA 3C0QA 4DM2A 1BGGA 5C7VA 3W01A 4TV5A 2WHKA 2H6RA 3CAKA 2BV9A 1Q13A 4ES4A 1Y7VA 3U0HA 4W7VA 1TREA 3Q65A 1FWGC 3ZLHA 3BLDA 4YL2A 1XHCA 4JFVA 2V2CA 1V03A 4YN5A 1Q6FA 1F05A 4JGDA 4PTDA 1QHOA 1XH1A 3W7CA 3ABOA 2CZEA 2WMHA 1RZMA 1FEBA 3DG7A 4PTWA 2JK2A 4S3EA 3OHIA 2KX9A 4HBKA 3WUFA 3U7BA 2OCZA 4XZWA 4CU7A 1VPQA 4AH7A 4E3VA 1ZNNA 4H6EA 4Q8PA 1Q7ZA 4HJFA 5FESA 3BK0A 5DMLA 1NAL1 3GW0A 3L4WA 4N6EA 3UETA 3Q4DA 4QTGA 2Z2UA 5AYIA 1W0MA 4LAUA 2Y6ZA 1VP5A 1PZ3A 3U2CA 4ICNA 3V5OA 3TN4A 5CPMA 3W2LA 2IKIA 2WSPA 3BJSA 4BQ4A 4QE5A 2VRKA 2V9DA 1ME7A 2WJFA 1WXJA 1ZENA 3B05A 4IH3A 1R9XA 3NDZA 4DBDA 3W84A 1W2VA 1QNRA 5C9RA 3NG3A 1ISYA 4PMJA 5I00A 3VZZA 2PC4A 4IQJA 2ZZ2A 3VAVA 4DF1A 1US0A 3UYCA 3G3DA 1UMLA 4QITA 2D2GA 2QDDA 4C7DA 5TD4A 1XGZA 3BLOA 3U57A 4C90A 2O4QA 1VIZA 2ZWYA 1LT7A 3AIEA 4JFSA 3LN3A 3PUDA 2BXVA 3REQA 1GRFA 4ZBCA 5HOSA 4WDTA 3O0FA 3NTYA 4F9JA 4TXEA 1S1RA 3FN9A 4LY8A 1T99A 2PTWA 1C7SA 1GG0A 3HM7A 3U4AA 3N4AA 2LLEA 2QLYA 1T6MA 1K9FA 3CIXA 1FCUA 4JY9A 2JFEX 5AC5A 1OFDA 2YW4A 3OEXA 4HOWA 4FX9A 4DJDC 3GHTA 3FX4A 5HQEA 3W6MA 4FMVA 3F7JA 3CHFA 2YVGA 4C6OA 4M81A 4FXRA 3B9OA 3GUWA 2Q3RA 3AYSA 5AHNA 1UIPA 3DHPA 3M6YA 1F74A 2C18A 3RRXA 1G4TA 1OT2A 3LB8A 1H7PA 4HNVA 4W5ZA 4Q8VA 4LVDA 1WCGA 1XSIA 2BOGX 1ONEA 4UWMA 1F73A 3VMPA 3NM1A 1OFBA 1EGZA 3WQWA 4UTWA 1UKTA 1HJUA 3ARVA 3BV4A 3UNDA 4JTLA 5LIWX 1TCDA 4LUYA 4J3SA 4QLJA 3MPGA 3G0XA 4C1LA 1TJ2A 3BLEA 1HTIA 1UPPA 2PDFA 1DXLA 3U2OA 2E5CA 4NYUA 3U4FA 1RCQA 2EPHA 1O5QA 1GJWA 1SSDA 3CGBA 3WY1A 3ARPA 1C7TA 4AZBA 1QNVA 3WF0A 3GNRA 4H00A 4FALA 1FXPA 5D04C 3VIKA 1HKJA 1H7NA 1H09A 2C1GA 5EB8A 4PMZA 4QISA 5SWUA 2X0YA 1CGVA 5K9CA 2G4JA 4L56A 2YDAA 7ODCA 2XFWA 5G2IA 3WD1A 4I7UA 2TMDA 4E38A 2XFRA 3LMZA 4KT2A 2REQA 2GYIA 3PANA 2OO6A 3HG2A 3VNKA 1K3UA 1P1MA 4A3QA 2E1DA 2PDLA 2GDQA 1KO0A 2J9ZA 3GYCA 2Z7KA 4PBFA 3KTSA 4W9TA 1VRXA 4HA1A 1K4HA 4JHMA 3B9NA 2GL5A 3P0XA 1DORA 1WBHA 1JF5A 1TQJA 3DGRA 3LDVA 2BTMA 4FR6A 4LUTB 1JGIA 3M0KA 1E1CB 1W1IE 4QEEA 4NEWA 3LGEA 3B97A 3RX3A 2A3BA 4UMCA 4L5ZA 2PDMA 4HU0A 3N6QA 3PUEA 1SJDA 4HU4A 3USZA 3PM6A 1IXOA 4JYDA 3UA3A 3UZXA 3E0VA 3DYOA 3WEZA 1W1A1 3ZJ7A 1EB3A 4WK9A 3GR8A 1SQ7A 2PMQA 2OTDA 5HBFA 3ZSTA 4LVGA 2NV2A 4ML4A 4J1OA 1BVWA 3JUGA 3NXLA 3EDFA 2Q8LA 5JU6A 4E2BA 2WJDA 1E6ZA 3CAWA 1V59A 3T42A 1JEZA 4XZIA 4WOQA 4XAPA 4XTDA 2WC4A 3CASA 1SFLA 4BK9A 2WM0A 5EU9A 5HWMA 5BXTA 2FB3A 3UERA 4AC7C 1MO0A 3PR2A 4S3DA 4BEQA 5IXEA 3UXIA 3LHVA 1M65A 3AIUA 3DJJA 1LQAA 2D22A 2W3ZA 2CPUA 2WVVB 2VR4A 3OBKA 4JDYA 2WOQA 5DMMA 4H6QA 3CQIA 3GH4A 3DFHA 1K1DA 5D4YA 2NWRA 4UQCA 4A3HA 5TBOA 4ONVA 3M0IA 1O1ZA 2CKRA 3BLKA 4O1DA 4HMNA 1XH0A 3BLLA 1RCXB 2DZAA 2GJRA 1F8IA 3LXCA 4B2DD 3KXQA 3GAYA 5A8QA 2J24A 5CCZA 3PVFA 1GEUA 4XAGA 3NOEA 4O1FA 3FNDA 3HQNA 2RJGA 3AISA 5LGZA 3MUCA 1HVXA 3TJIA 2DZTA 1EC7A 5E70A 2W62A 3MMUA 4Z42C 1WAWA 3A6OA 3G1AA 3PS7A 4K37A 5DY3A 3WNKA 1AOGA 1WPCA 4IZGA 4PCPA 2OMAA 3J7HA 4J7RA 1XLBA 1I2NA 1VF8A 3VX1A 1W1B1 2Z29A 3NQFA 3CPRA 4U3CA 4GIRA 3FVMA 4IPLA 1JG9A 5D9NA 1AA1B 2QJGA 1RQEA 4H04A 3U2ZA 4JX4A 3KW3A 1FHVA 5KZ6A 2HZGA 1VR6A 1J5TA 1BFNA 4XD5A 3QH2A 4LY4A 4EPBC 2GPTA 5HUPA 2G4FA 4LJ3A 3MS8A 2P8CA 2X8CA 5AHMA 1FA2A 5JUVA 3TOPA 5HQMA 2ISWA 1M3UA 5B7YA 5FS8A 1GREA 1J5SA 4E2DA 5E0KA 1GT8A 1W9UA 4M82A 4DUWA 3M6DA 4DUVA 3V0TA 1XLMA 2V5KA 3MI3A 2GGJA 1OFAA 3CK5A 2GGGA 4IHCA 1U5HA 4E4UA 5IRPA 4MZ8A 4AVOA 1BZLA 2BGNE 2FTWA 4MY8A 2GUUA 4GVGA 1MW2A 3RUBL 3K8LA 3ABXA 3M7SA 3QGVA 3NQ6A 1MDRA 1K9TA 2D3LA 4WY0B 1Q7MA 2NXHA 4RNJA 4QHRA 5A1AA 2MUCA 1Q4NX 4AXKA 4C60A 3SCOA 3W02A 1W1ZA 3APTA 3V7PA 3KLLA 4GC3A 2DT2A 1E15A 2E6FA 1H63A 1V0KA 4XVDA 4QG9A 1ZFJA 2VO5A 1LL4A 1OIMA 5CPNA 1JNDA 3AIRA 2OLAA 2J7HA 1TX0A 4AEFA 4H6RA 5DBUA 1XXXA 2AQVA 1H61A 4FZIA 3HB9A 2XH7A 1NHPA 1CNVA 5IFPA 6CGTA 3GC5A 1FKWA 2Y8KA 2I14A 2XPKA 3E6EA 1GHSA 5AVHA 4HVXA 3TC7A 2BG5A 3UPMA 1YQ2A 4PRTA 3P84A 3HJEA 4R53A 1Y5XA 3TTSA 3K4AA 3WLTA 4YIWA 2DUZA 3W1QA 1E4IA 5HUOA 2CLEA 4NQ1A 5B7ZA 2GVYA 3M4HA 2FKPA 4C91A 2EG6A 5C0QA 5IBXC 4GJ1A 1T0OA 1WNOA 3COTA 1QI5A 1XIGA 1UH4A 4ZFCA 3VVGA 1CEOA 4PTMA 3UU0A 3O7UA 3E2SA 3MDUA 3W85A 1B54A 4EM3A 4IUOA 1EQCA 1P6BA 3R0DA 4JIIX 2RH9A 5DEZA 1FHUA 4WHBA 4H4YA 2C14A 4AD2A 2TAAA 2CBJA 2J4GA 1RY0A 3ABSA 2XM1A 3OODA 3OQEA 2CWNA 4GH1A 5EMUA 5FAJA 4F0RA 2JGQA 1B57A 3A4AA 3ZSSA 4BKNA 1X97A 3TQPA 3ITLA 1XR2A 3C0LA 5L6UA 3L66A 4F2TA 2Z7GA 2ISSA 4EWJA 1W17A 1YXYA 1DJWA 2O9OA 3W25A 2INEA 1EJTC 3GFZA 1LL7A 4NHVA 4DB7A 4C6MA 2XIQA 1ZK7A 2HNHA 3LXAA 3WQ4A 4MPKA 1PTAA 2XINA 1XYAA 2F8QA 3UXDA 3QC3A 1VLWA 3BQ6A 3SCSA 2DZPA 2ZX8A 4JIHA 3G1VA 1XYLA 3A4WA 1IR1A 2X8GA 4ZE4A 2D23A 2WBGA 4C5ZA 1ONWA 4BWLC 3EF6A 3RLVA 4FO4A 2WAGA 1E1CA 3W72A 3PN8A 3ALGA 3DKLA 3PBWA 3GE7A 1J0YA 1J93A 3LV6A 3FJNA 2FTYA 3SRFA 3W2MA 1H50A 4JTGA 2XVKA 3DGZA 1PDZA 2BGSA 5DXXA 4DF0A 4O14A 2HXUA 3KUMA 3DH7A 8XIAA 3LY0A 1RBAA 1OHLA 5EFDA 5IDZA 1KXQA 1TPWA 1L0PA 3H6OA 4I9JA 2YA2A 4NRRA 3B04A 3NVDA 5JMUA 3UESA 3L4UA 3ORWA 3GTNA 4P8XA 4KMQA 2VC9A 2NQ9A 1FWIC 4G6CA 3TSBA 1HX0A 4M8UA 3PBVA 4NRSA 4P5UA 3GXTA 4Y90A 2BZNA 2X1IA 4FOUA 1FCVA 2J7BA 4ZQMA 1SR9A 1W31A 3GZAA 3WDRA 3S83A 3CHDA 1H7WA 3IIXA 5FOOA 4OBTA 1XYCA 3LXBA 2DIEA 2HVNA 6ALDA 1UG6A 3RLGA 4JQ9A 3W1MA 1X6UA 3CT7A 3P62A 4FS9A 4ZOHB 1I9CB 3POCA 4GQGA 5DMYA 2WCGA 3B0XA 5JVLA 3KVLA 2E6YA 4N0RA 5D9OA 2PRHA 3R0UA 5KITA 1JPKA 4KERA 2HROA 3RAOA 3DENA 2Z2AA 3AHZA 4RE2A 3SURA 5LNRA 1FWSA 1IEQA 1BVZA 3OVGA 3WEOA 3SQMA 1UKSA 3TFXA 1QPQA 2EKCA 3TMQA 4D6DA 1MQPA 4QX4A 3W2KA 3GBEA 5D2TA 3EKGA 3UR2A 3W2UA 1ECQA 3K30A 2WMJA 1M1BA 4NT0A 2QW5A 2RGLA 2Q6ZA 2EPOA 4IGSA 1CLXA 4GCAA 1R0MA 2VELA 4I90A 4KRTA 4LVAA 3VIHA 3GC2A 1U1JA 4MJ4A 2BC0A 3BJFA 3D47A 4PUUA 3M0MA 3PFRA 3A13A 1PZ2A 1RQBA 4KESA 3UZYA 3CBWA 2XWEA 1TFVA 5TNVA 1FDJA 3F2BA 1N8FA 5A6AA 2FTPA 1R2SA 4DBEA 2ZKMX 4S2CA 2CKSA 3H4KA 3IGXA 5C9ZA 3GWQA 3DFPA 4PMDA 2POZA 1GTEA 3LSBA 1NOUA 1JVNA 1TV5A 2D1ZA 2JF7A 4FNSA 3N4FA 1BRLA 3RRAA 2DUAA 3BTNA 3UG4A 2VEMA 2W0HA 3WCZA 1ONXA 4MWAA 5C9WA 3ARRA 1R30A 3KRBA 4Q32A 4B5XA 3JU2A 1TX2A 3CZLA 4UCFA 2JALA 4GNKB 1TA3B 4WSHA 3WKZA 1LLZA 3LCHA 2VCBA 4WY0F</