3BSMA

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
386
structure length
358
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens.
rcsb
source organism Chromohalobacter salexigens dsm 3043
molecule tags Lyase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
total genus 131
structure length 358
sequence length 386
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2007-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3bsmA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3bsmA01
3R25A 4HPNA 4K1WA 5FJOA 2PU0A 3KUMA 3Q45A 3UGVA 3OP2A 1R0MA 1EBGA 2PGEA 5FJTA 2OO6A 2OLAA 2RDXA 4DN1A 2PP1A 3TTEA 3DGBA 1E9IA 2OZTA 1JPDX 2ONEA 1MNSA 4HNCA 3H12A 3U9IA 2GGHA 2OG9A 2OVLA 4GIRA 4IT1A 3JVAA 2GL5A 3N4EA 3ES8A 2PS2A 3GO2A 3T9PA 2QDEA 3CK5A 2P8CA 3R1ZA 1TKKA 3CYJA 2OPJA 1OEPA 2PTXA 3SN1A 3VDGA 3H8AA 3OZYA 2GGGA 3DDMA 2GSHA 2XGZA 1XS2A 1ONEA 2HXUA 3MKCA 4G8TA 4K8GA 3V5FA 1SJAA 3PWGA 3N4FA 2POZA 2GDQA 1MDLA 2HNEA 3TW9A 1EBHA 2AKZA 1KKOA 3VA8A 2PCEA 4IL0A 3CXOA 2FYMA 4G7FA 3RO6A 3NO1A 3FV9A 3HPFA 4JN8A 3QN3A 2GGJA 3TOYA 3GY1A 3R0KA 2GGIA 3MZNA 2AL2B 4H83A 3OPSA 3THUA 4HN8A 3H7VA 2NQLA 3V4BA 3IJLA 3R10A 2XSXA 3FXGA 4GYPC 3DG7A 4IZGA 4HCLA 3OTRA 4A35A 4K2SA 3TWAA 3CAWA 3FCPA 2AKMA 3MUCA 2XH7A 3TCSA 4YWSA 3S47A 1R6WA 2PGWA 3ZVIA 3RGTA 1MUCA 3ZVHB 4F4RA 3P3BA 4DXKA 3UJRA 3SQSA 3JW7A 3DFHA 4MMWA 3MY9A 4MKSA 3NXLA 3VC5A 1ECQA 4M6UA 3RRAA 2ZC8A 3B97A 1MDRA 3CT2A 3SBFA 3T6CA 4JHMA 1L8PA 4GMEA 2CHRA 2OKTA 3R0UA 4DX3A 6ENLA 3NZGA 3BSMA 4Z1YA 4E4UA 1TE6A 3ZVHA 4ZCWA 2P88A 2PODA 3QLDA 4KPLA 3UJEA 3VCNA 3EKGA 3OZMA 2PTYA 3UJFA 3RCYA 3IK4A 3UXLA 3DFYA 2O56A 4JN7A 4GFIA 3ZLGA 3SSZA 3V3WA 3DIPA 3NFUA 1TZZA 2I5QA 3PFRA 3T4WA 3I4KA 3DG3A 1RVKA 4ENLA 1SJBA 3FVDA 3SJNA 2XH4A 1EC9A 4ROPA 4DHGA 4IL2A 4FI4A 3IJQA 3ZLFA 2PPGA 3DESA 3Q4DA 4IHCA 4DWDA 3RR1A 2ZADA 1NELA 2XH0A 3ES7A 3RITA 7ENLA 3ENLA 3FYYA 3UJ2A 1DTNA 4DYEA 4IP5A 3T8QA 3TJIA 3STPA 1KKRA 2PTZA 2QQ6A 3P93A 2P3ZA 1P48A 1P43A 3BJSA 1W6TA 3SN4A 4HCHA 3R11A 3I6TA 2QJJA 1MRAA 2MNRA 1WUEA 4X2PA 3EEZA 3TJ4A 2P8BA 4HNLA 4E6MA 3GC2A 5EU9A 2HXTA 1JDFA 2QVHA 3QKEA 2DW6A 1KCZA 4IP4A 2QGYA 4KT2A 3MSYA 1IYXA 5BOEA 4MGGA 4Z17A 5BOFA 2MUCA 1SJCA 3PWIA 2XH2A 5IDZA 2QDDA 3FJ4A 4E5TA 3IJIA 4KWSA 1F9CA 3MQTA 2OQYA 2AL2A 4HYRA 2FKPA 1PDYA 3P0WA 2OZ3A 2QJMA 1NU5A 3H70A 2GGEA 4EWJA 2OFJA 2HZGA 1EC8A 4J3ZA 4GISA 4H19A 3UXKA 1XPYA 3VCCA 3I6EA 1JPMA 1FHUA 2DW7A 3TWBA 1FHVA 3VC6A 2PA6A 4H1ZA 3DERA 5FJRA 4GGBA 4J1OA 2OZ8A 4FP1A 1PDZA 3GD6A 4E4FA 2PSNA 3N6HA 3S5SA 3QTPA 3QPEA 2OX4A 4ZA0A 5ENLA 4A6GA 3TQPA 2PP3A 5FJUA 2OQHA 3PK7A 3JZUA 3UCCA 1KD0A 5FJPA 3UCDA 3N6JA 2PU1A 1EC7A 3U4FA 2P0IA 3UJSA 5J04A 4GYPA 1JCTA 2QJNA 3VFCA 3CB3A 3ZLHA 4M0XA 3K1GA 4GGHA 4KEMA 1WUFA 3OW1A 3DEQA 3D47A 3BOXA 3DG6A 1BQGA 2AL1A 4E8GA 1BKHA 3SN0A 1ELSA 2PMQA 2PP0A 3D46A 4A3RA 4H2HA 2PTWA 4HCDA 1YEYA 3MWCA 3V5CA 1SJDA
chains in the Genus database with same CATH superfamily
5CBIA 4K1WA 2PBOA 4N6FA 4P7OA 1CZ1A 2CBIA 4PRRA 2YKKA 5EMUA 2BOGX 3OG3A 3USBA 1EIBA 4RPQA 3T0TA 3TAOA 1WDRA 4ZB2A 3TLLA 3I3EA 4JTJA 3NCOA 5BRPA 1HJWA 4LV9A 1OCBA 1C93A 3TNOA 2F8QA 1TIWA 3B9EA 2PZNA 1B31A 4MNKA 2V5JA 3QC0A 4QEHA 1H7NA 2QULA 1ICSA 3VE7A 3N4EA 5A95A 2C18A 4ERGA 1UW9A 4P8WA 3WNMA 2PTXA 4GZ7A 1RK6A 4AHOA 5EY5A 4XIMA 4AMCA 4X9YA 2FJKA 2G8ZA 4JTSA 1CIUA 2JF7A 2C7FA 5LNWA 3I7RA 3WL1A 2ZTJA 4CUCA 2BVWA 3LY0A 4G56A 4I5RA 3QSRA 4PCNA 1MMFA 4HVXA 5I02A 4GUIA 3GTNA 4LPCA 4HPGA 3OO2A 1GVOA 1XFCA 3LHTA 3NSMA 1FWBC 3MZNA 1J4EA 2XZ7A 3QBUA 2YYTA 2VOMA 3ZR5A 3ARXA 1XG3A 3KBNA 5CSSA 1IF2A 3DYMA 3VXGA 1R3TA 3UY7A 1MO9A 1F3XA 4NZ3A 1K6WA 4W8AA 3RNMA 1YTDA 1XBVA 1JCMP 1V79A 3V75A 1J0HA 4RE4A 4S3KA 4NSBA 3B8UA 3FCPA 3IWPA 1LQ2A 3G8EA 4AH7A 4EXAA 3EWWA 3VNDA 3G0XA 1MXGA 3PY2A 1MUCA 1ZENA 2P0OA 4QTGA 3S6OA 5M3WA 5JIPA 4NP7A 3DFHA 1KQZA 4GJJA 3MY9A 4CU6A 2YAUA 4HP5A 4JEJA 4IUOA 4LF1A 2J47A 3HG3A 4YWOA 3SY5A 3HPZA 5C9XA 2TRSA 4WSHA 4IIFA 3U3HA 4OTKA 3FOKA 4EMJA 3M1ZA 3AYSA 1N5XA 1S38A 1Q5MA 1CGUA 1ALDA 4N4QA 2D24A 3VM7A 2AGTA 3QLDA 1G0CA 4BJHA 3TLQA 3PZTA 2VL4A 4NG3A 3S2JA 2EAWA 4YVVA 2X0YA 1YQZA 3UF9A 3CXBA 1DXFA 1TJRA 3EWXA 4U2YA 1XIMA 3B9NA 5CPLA 1A0CA 4CKQA 3B0VC 3IAPA 2RHGA 3SR6B 4QJ4B 1K70A 1WCGA 1PCWA 4AAJA 4HA3A 1YE6A 3UZ5A 4AF0B 3VX0A 3URNA 1VIWA 3I4KA 2JGQA 3Q37A 1AK5A 3BICA 1TYGA 2AMGA 4NAEA 2YCEA 4H8NA 1OFEA 4B90A 5I3HA 1LBMA 2JKEA 2ON3A 3MKVA 4H3DA 3KZSA 4POCA 3G0UA 3TCEA 1RA5A 2VZOA 2WNQA 2G4FA 3THQA 2ZUUA 2DH3A 1J0KA 2XFWA 3GRSA 3WG6A 4DJFC 2VURA 3CHCA 1IGSA 3WCZA 4U5KA 1J0IA 4JQAA 4UMAA 2DP3A 1P43A 3M0XA 4BY3A 3A7UA 4HCHA 1XI3A 4MDOA 4IQDA 4JD4A 2CKSA 1WUEA 1RK5A 4A8IA 5FL1A 1W91A 4GVGA 4JOMA 1QI2A 3NSXA 2PD5A 5AZ1A 3OB8A 2YVGA 4F0SA 4MHBA 1DJIA 1M7OA 5HR7A 1VRXA 6TAAA 3B04A 4LY4A 2P3EA 4L5ZA 3DC8A 1ME8A 1YDOA 2E9BA 3WLSA 4ZGYA 3QYSA 4E3TA 2ZZCA 1XRTA 4QQUA 3TFXA 4DJDA 3WZ0E 2AQOA 4E5TA 3TNBA 4QQ3A 3IK2A 1V97A 1N8FA 4HKPA 1U33A 3THDA 3KBJA 1PDYA 4D6FA 3WQVA 3VNIA 2WANA 1RCQA 3FW6A 2J25A 3RU6A 3F2BA 1NWRA 1QO5A 1GUVA 2Z1KA 3O6CA 3SW6A 2F2HA 1EQCA 5LIXX 4A3QA 5XINA 3TJLA 4WOZA 3LZ3A 1Q63A 3ERPA 4QG8A 3U2EA 1FH8A 4NXKA 2H90A 3FHAA 2X09A 1LWHA 3W1PA 4Z2GA 1PXGA 3SCOA 4GC4A 3JRKA 4OFCA 4TO8A 5DXYA 1VLIA 2WBGA 4XKYB 4UTKA 1EYEA 2F6KA 3SCWA 1BXBA 3W6MA 3LXAA 1XLIA 1LL6A 3EWBX 1F8MA 5IHSA 1XGDA 1E3ZA 1AW5A 4W8LA 2PDXA 8XIAA 4JX4A 5A6AA 2DIJA 1XPGA 2OCZA 4AZCA 3WBEA 3GUGA 1A4LA 3C2FA 1TUFA 4X3ZA 2NWSA 3DU0A 4I5UA 4KEMA 1V0LA 1XYFA 2YFNA 1KGUA 4UTMA 3VE9A 4WRHA 3L0GA 1ZLPA 3OBKA 2FFCA 1Y8BA 1GHSA 3BW3A 3B4UA 3G0SA 2E6DA 3WQEA 1JULA 3O0HA 5CBJA 4XUGA 3GDRA 2Q09A 3EEGA 1CGVA 1CNVA 2QVNA 3QM3A 4E2BA 4H01A 5F4WA 4B3ZA 1HJQA 2BWGA 3KUMA 1OC6A 4CCDA 3SCSA 2DJLA 1A4MA 1EBGA 4K8EA 5LIUX 9XIMA 3COTA 3B8TA 1TPB1 4E0CA 5A8PA 1JNEA 4HSNA 1B90A 3NL6A 3A23A 4NXSA 4CN4A 4S23A 3STEA 4C6EA 3VOJA 5D2TA 4A2RA 1A3XA 3IC9A 2X30A 3KOZA 2PS2A 4L61A 4UOZA 3BG5A 3PUDA 3PZNA 2YA0A 4LAMA 1K9TA 4B5SA 4MAZA 3DFTA 3SURA 4IGHA 1X96A 4ORIA 2XWEA 4KGJA 1F8WA 4FIRA 2ZRXA 1DJNA 3GG1A 4O14A 5JUVA 3NM1A 4DUWA 1HKWA 2RDUA 3FJ6A 3QZEA 4RZBA 4Q7NA 1M3UA 3NJ3A 4I6VA 2VZVA 3FV9A 2ZOXA 5C70A 4JN8A 2PWDA 1HVQA 2ZXDA 3A3WA 4JL2A 2G50A 2IPWA 2F84A 3Q58A 1GEUA 1R87A 5IRPA 5C7VA 3O3RA 1KFCA 1RA0A 3QMSA 4BKNA 2O7SA 3HM7A 3CO4A 1S2WA 2OEJA 3AIVA 1NF0A 1GSNA 1WKFA 4FNTA 2BY2A 1TPVA 1M03A 1W31A 2XHYA 4L80A 4IZGA 2QUVA 2HDJA 3RPTA 2V3BA 2NLIA 1J2WA 4C7FA 2VDIA 2XH7A 3PJXA 3RGTA 3D3FA 3M43A 5J5RA 4AWUA 1G69A 4HIBA 3G2GA 1GV4A 1C3FA 2DH2A 2PDWA 4EK7A 1LWIA 3TV8A 3WF0A 2V3DA 1LP6A 3O6YX 3EWYA 4IPLA 1H11A 4AUBA 2RJHA 2GQ3A 2YL8A 1UROA 4GYKA 4PGLA 3EKLA 2WNNA 5BXTA 4UMBA 3GXMA 3AXHA 3FAWA 4MADA 4ACZA 4DWSA 1PHWA 1RV8A 1AW1A 2BHZA 1G9HA 3VIJA 3Q2DA 1S5VA 1V02E 3DK8A 5AC8A 3C4UA 3PZ9A 3PNZA 3EMQA 5A1AA 3E2QA 1W3HA 3UXDA 1UUOA 1HXJA 1D8WA 3MP5A 3LPFA 2Y63A 3MVTA 3VD5A 1KFKA 2DV0A 4OIFA 3VNLA 2OO0A 5M17A 3HG5A 2NX1A 3BW4A 4GWEA 3U48A 4FXRA 2OYLA 3EX4A 2E4TA 1QNOA 4NY2A 4E2VA 1M1BA 1N82A 1XX1A 2GJPA 2VWSA 4AHPA 2GVEA 1R3YA 2OQLA 3FGCB 1Q66A 4FXJA 1SU5A 3KP1A 1J0YA 2NXGA 1GZ1A 4QS5A 1JQXA 1X6UA 2PTZA 3AMCA 4LVFA 4M52A 1XH2A 3TSMA 1XYLA 4MB1A 5I6SA 3SRHA 5HBFA 5FMHA 3BLKA 3WSUA 4H00A 1ESWA 4J3UA 1NDWA 3HG2A 2XN0A 5ABGA 3LCIA 2WMGA 2O4QA 1DXEA 1LZOA 3VKKA 3WQPA 4F2TA 1KCXA 4LY8A 1VRDA 2EPMX 1S3HA 3W6YA 2VFGA 4IP4A 3OGSA 3RDKA 2WSQA 1UKSA 3F1QA 5CZTA 1RSCA 4XAGA 2D69A 3MANA 2QEZA 1W5PA 2RJGA 4AY7A 5BOFA 3AISA 1CCWB 3FVMA 1OFAA 2VD8A 3KRBA 3WENA 4IG2B 3P80A 3FEMA 3ZJ6A 5C9ZA 2QV5A 1IXQA 5K3VA 1KQYA 4UIOA 3ZMRA 1LRQA 3EAOA 4H9VA 3TP4A 2C15A 3MZ2A 4E2OA 1AD1A 1Q6CA 1UH4A 4D1JA 4O18A 3RJXA 4H19A 3E74A 1Q6LA 1Z41A 4HPJA 2BBFA 3DFNA 4Y6GA 1FRBA 4GHRA 3GIPA 2NV1A 2ODOA 3N17A 3EA3A 1LBLA 1Q2SA 3RYSA 1SM9A 1PYMA 3SR7A 2V30A 5HJLA 3WY1A 3HIJA 3QTPA 5CPQA 2ZUWA 4EOUA 4OU1A 1GREA 4N0RA 3TQPA 1W3IA 1TYPA 5U4NA 3PZMA 4H2CA 3WNNA 1I75A 5TIMA 1IZKA 5BNKA 4IQJA 4UMCA 3ZT6A 1V93A 1XHCA 1A5LC 3W01A 4KEZA 1F8IA 2IQ0A 2PDMA 2XISA 3ALFA 3NL5A 5G4HC 2UY4A 1Z6KA 1UR0A 4DBDA 4X60A 4RNHA 2DT3A 2ZRVA 4YS1A 4QBXA 4HU8A 2WK2A 3DGZA 2ZVIA 1E0TA 4RZ6A 3SCTA 3TOPA 1VFUA 4GQRA 4C6CA 5G5HB 3BAXA 3S1GA 3AU6A 4HCDA 4JN6A 5BU6A 2CC0A 1QBAA 1T0OA 4WVXA 5T8GA 4X9SA 3LLDA 4EF8A 3Q45A 4ZTXA 4HZ6A 2E68A 1HKKA 3BQ6A 2PGEA 4KGLA 5KVHA 4JS3A 4WLCA 1MNZA 1ZQ5A 3WKZA 1JEZA 3DGBA 1E9IA 1JXJA 3SZ8A 4NZ4A 2PWHA 4KIRA 5CPOA 4Y9MA 2F61A 4P8UA 3KTSA 3R8HA 4ZQOA 3M16A 4Q4MA 3VNZA 2DJXA 2H8XA 4DWSD 1R30A 3EWUA 2HPMA 4GE8A 3UR8A 3W86A 1MFVA 4MJ2A 3R1ZA 1VFSA 3V0SA 1Z42A 3G6LA 1X7FA 4TIMA 3CB8A 1H5VA 1OYCA 3SDOA 4GK8A 1M04A 4MUPA 2VEIA 2Y2WA 3U7VA 1GVRA 2HNEA 3FDKA 1OC7A 1U5HA 1JPHA 1ZFJA 1X39A 4CNUA 3CXOA 1GHRA 2BVYA 3KRSA 5D32A 5GQBA 2EPKX 4CVWA 1FXQA 2I7GA 1RVGA 4H04A 1TPH1 3A4XA 3TQVA 1LLZA 1VJSA 3QGKC 4DWSC 3OVRA 2PLCA 3W70A 4W87A 4HN4A 1GPWA 1ICQA 3FYOA 2ZZ3A 3DG7A 2EGZA 4UUIA 3PG9A 1QW8A 5U25A 3BC9A 2EF9A 3OLGA 4Q4OA 3A12A 3A4WA 4PCTA 3W1MA 5D2XA 3UW6A 3OVPA 1N55A 2PGWA 3ZVIA 4GBUA 3KBWA 4FK9A 1XSIA 3MBFA 3OBEA 1AL7A 2PDYA 3EA2A 3W53A 1TPC1 1U83A 2VT0A 4R5EA 1P4CA 5C7HA 3II4A 2EJAA 3NM3A 4TVYA 2NX3A 3E0VA 1YLVA 3LXDA 4IMFA 4P7LA 3HPAA 3R8GA 3I3DA 2XIMA 1JAEA 3ONCA 4Z1YA 1MQPA 4J5NA 4Q8PA 5I78A 5JVLA 3ZFHA 3S9YA 3N3TA 1U1JA 4QE1A 3VKCA 3OZMA 4Z1CA 3RCYA 4CD6A 1UPMB 1T99A 2CCRA 3WLOA 3TN6A 4EQWA 3ARYA 1JUBA 4J3SA 1CGYA 4C6OA 5FS8A 5BXPA 1Z7AA 4F2UA 5E9AA 4LC6A 4JCMA 2A4AA 3RX2A 2EO7A 3UR7A 5KMYA 3V36A 1I0DA 2XG9A 4OBTA 4IL2A 4LIIA 3TC6A 3RJYA 3KS6A 3E38A 4O11A 3UYCA 1XR2A 3FA4A 3GNNA 3H4GA 2HPIA 2WVTA 4D6GA 4AY8A 2WMFA 4KWOA 4R34A 3NXFA 2BOEX 4LBSA 5D9MA 3KS5A 2G41A 1HT6A 2WM1A 1JRBA 1XKYA 2J77A 3IACA 3FFSA 3G22A 1GEHA 4KESA 2PGRA 2WJFA 3QFBA 4NL1A 3T81A 3P93A 2CXEA 5EBKA 3A9IA 3F4WA 1OG6A 3DX5A 3N29A 4UFLA 1TWSA 3GHRA 4LB4A 3DFQA 3EAUA 3EOEA 1N62C 2FDMA 3W7JA 3CO8A 1BAGA 2GH5A 4GI4A 1HUVA 3IS4A 4XB3A 4AWEA 3RCMA 5B7ZA 4YN5A 3W81A 3T7VA 4L9YA 4XK2A 3EMZA 3QKEA 2D2HA 5C55A 3LCFA 2HK1A 2QGYA 2W3ZA 1IYXA 3STCA 3FJNA 1WKDA 3EOLA 4GG9A 4UQCA 3EXSA 1LF1A 3CIVA 3MSDA 4UCFA 3NOEA 5HK4A 2NW0A 4C65A 1AZ2A 1XG4A 2RH9A 2W0UA 4IMDA 1S2TA 1TJ0A 3N04A 2GVLA 4JL1A 4O1AA 1V5XA 4U2ZA 1VH7A 4JPGA 4KCTA 1TPFA 3DXIA 2OQYA 3WNPA 5D04C 4AD5A 3T0AA 4LU0A 4BS0A 3UCQA 1S7MA 4FR1A 2VVSA 4TR9A 4XBKA 1C90A 1YXDA 4O53A 3TAKA 3CAKA 1ZBCA 1BWVA 4FX9A 3W7LA 3MI3A 4C6BA 1KC7A 2I5IA 1V6XA 1PVNA 2HZGA 3ABRA 1DWAM 1NP2A 5E1QA 1ISXA 2X0HA 5T9CE 1X6NA 1VC4A 3I6EA 4TUFA 4GKLA 1FWRA 4TX8A 4CD4A 1WAWA 4O10A 4FP1A 1L6YA 7TIMA 1YPFA 5M03A 4DZ5A 3N9KA 4BZYA 4N02A 5I03A 4D6CA 3F2CA 1U22A 2PDHA 4MNMA 1Y65A 4WDTA 3U2OA 5CEWA 1EC7A 2IMRA 4X0NA 3BH4A 3G18A 3UWWA 2XVLA 4KRTA 2NVCA 1H7XA 4FB7A 3U0HA 3B8IA 2X2YA 1YPXA 4HYWA 5DN1A 3OW1A 3VIHA 2Y62A 2R1PA 1QOXA 1PCKA 5IDIA 1B2YA 2A79A 3T0DA 3S3GA 5AN7A 4A3RA 4LVBA 1FKWA 4H2HA 1Q6QA 1PKMA 4O1EA 4ZQPA 1BG9A 3E49A 1H0IA 4UQ9A 2AMXA 4HPNA 1UBSA 3AZTA 1FWJC 4HHPA 3MMTA 3CV7A 4H7VA 3RLVA 5HULA 1O60A 4IIDA 1OD8A 2QCNA 4AC1X 3CTTA 4O1DA 2D2JA 4IXXA 3WLIA 4AIUA 1BVNP 1WQ5A 3C56A 3MTWA 4JTKA 4PULA 2VX4A 3UNDA 4E2DA 2GVJA 2W27A 2Z1XA 1FFUC 3LI0A 5DEZA 1XRFA 4BQ3A 1UOKA 4QFUA 5TNVA 1Q4WA 4JQ3A 1GESA 1OIMA 1SQ7A 2Y7EA 7PTDA 3SN1A 3UERA 1GYMA 1ZGDA 3VDGA 2WQDA 3DDMA 3C2RA 1GJWA 2PBGA 1E51A 5I00A 2YOCA 4S3DA 2JGYA 2V5KA 3CHFA 3MKKA 3IJ6A 1ME9A 5FS9A 3N4FA 1E4NA 3A21A 4DI8A 2QPUA 3CUZA 5FF4A 1TREA 2ADAA 1LRTA 3TN5A 1MDLA 2FZ9A 4GR1A 4DUXA 2H3BA 4EPEC 4HZ8A 3LSBA 3T78A 5A6BD 3GZ3A 4IQEA 3SCRA 1OF8A 4H4IA 1UD6A 3TTYA 3RO6A 2ZX9A 1V0KA 1VCGA 2X1SA 3QN3A 4B92A 5EA9A 2GGIA 4FNSA 5XIAA 3C2OA 4PZVA 5CC5A 3ZR6A 1F3WA 1ZU8A 1A5MC 1SVDA 1RM6B 3XINA 3OQ8A 4LUIA 2NVDA 2BS9A 3V0TA 3VTRA 2CEQA 1FHDA 4CCCA 5B7YA 1J0JA 1EJWC 1JCXA 1GOQA 2PF0A 1PIGA 4X61A 2GK1A 1TPDA 4FX7A 1UZ1A 2WSPA 2P5NA 1GOKA 4HCLA 3SCPA 1KXQA 1POJA 1PTGA 2PFHA 3CASA 4O15A 4QCEA 5FACA 2YA2A 1N60C 1JZ7A 2WC7A 3TMQA 1GXFA 5I3IA 4DO7A 3WX7A 1S1PA 2NLYA 2ISFA 4XTDA 4BFAA 5LNRA 2IKJA 4WY0A 3OU8A 4MM1A 3W23A 3N15A 4RE2A 3WYZA 1G6CA 3W83A 1L8PA 1KM4A 4K6AA 1JCLA 3GR8A 4WUIA 1P1XA 4WHBA 3WQ5A 3WQ4A 5HDRA 5FCZA 4PH6A 3ARPA 2DY3A 3A13A 3U2ZA 2X1UA 3QRHA 2BFGA 4LAKA 1GKPA 3ALGA 3I4EA 3GH5A 4KPLA 3ZWTA 1NARA 2QLYA 3C2YA 1PZ3A 3BLLA 1R47A 2PTYA 1KTBA 3ID7A 2UV8G 1SZNA 3AUJA 4H9XA 2VEGA 4GVHA 3GKFA 3GE7A 1W9BM 5DT5A 2FQIA 1SO6A 1TCMA 4D71A 1XINA 4UQEA 3R58A 4MWAC 3UQNA 2I5QA 3N9SA 4LJ3A 5AFDA 3EX6A 4F0HA 1T5AA 3PS7A 4C5YA 2I56A 2DVTA 1QRQA 5JCIA 3E5BA 2GK1B 2FH8A 1VFFA 4GRSA 3IUIA 3KVJA 1NHPA 1TR1A 3CZKA 4O0QA 1N61C 2HMCA 3W38A 3W2KA 4AWTA 1U2YA 3UFYA 5CGTA 1O5KA 3IARA 1Q6EA 5CPNA 3WQOA 3TQKA 2JF6A 3CMGA 2FTWA 2PDPA 3H4WA 4AX7A 1DTNA 3E0FA 3ARRA 3WD4A 1GERA 4XSLA 1AG1O 1W9UA 2J6VA 1SSDA 1RP9A 3EX2A 4NF7A 3TUUA 2WZHA 3GYEA 2D2GA 2WZMA 1ZXIC 4IPNB 4KFOA 3EMCA 1F3EA 5CZKA 3BLPX 1LM1A 4M80A 4UTHA 2QAEA 4DQWA 2VI0A 2WHLA 3VMPA 1OK6A 4PTVA 5LXEA 1E3XA 3TTOA 3WDRA 4J28A 4GUHA 3KVLA 3PJUA 3PTMA 4WIWA 3P5YA 3ZQ9A 4HNTA 1R5YA 2AOSA 3R7MA 2VQUA 4NU7A 5CH9A 2QDDA 3AXXA 1J6PA 3IPWA 1UWAA 2CWXA 2H9AB 3RMEA 1TZ9A 4K3ZA 1GEQA 1DQWA 3DOPA 1H41A 3PR2A 3TK7A 2QCHA 2CZ5A 4GIAA 3CUGA 2ZUMA 4OV9A 1HJVA 1UZ4A 3QFWA 3GNPA 2PWUA 4AU0A 4C6IA 1V03A 1EJSC 4UTIA 2XIQA 1EC8A 4J3ZA 4NJIA 5DQPA 4GISA 3ATZA 6XIMA 1XPYA 2QAPA 2QIWA 5DMYA 3OA5A 4ASTA 2ZX7A 3UZWA 1GVIA 4IMCA 1CGTA 4AD4A 4H1ZA 1NEYA 1F7BA 1S39A 3H24A 1DE6A 4HQVA 1G01A 1H1NA 3GUWA 5FJUA 4TVUA 3VGDA 2E67A 1UP3A 1DWIM 1BLIA 1ZCOA 3WLLA 2DSWA 2Z00A 5D9PA 3S8HA 3S5ZA 3KLKA 5FJPA 2GJXB 3LRLA 4KWUA 3WH9A 3KL3A 4HK5A 4OZOA 1TIMA 3QQ1A 3HFTA 1ZRQA 3URBA 2WB5A 1X2GA 2YGYA 1O66A 4KCVA 2ABBA 3ZLHA 4TV6A 3FS2A 2WMKA 4NUWA 1F6PA 4UOJA 1W9VA 2E77A 1XLFA 2DVUA 4FNPA 3VK5A 4JYDA 1GOOA 3DEQA 3PBWA 1XQLA 3W75A 5EL1A 1P6CA 2Y8UA 3BOXA 3R8RA 1A5UA 1OABA 4MJZA 3SN0A 3A47A 3VOHA 2NZLA 1UR3M 3F4VA 4F9DA 1QW9A 2NQHA 3MB9A 1W3NA 4U33A 3HPSA 3BAKA 3D3AA 3L12A 2PTWA 1M65A 4FOUA 3HA1A 3STFA 3OZPA 3EBVA 4LAZA 4QLJA 4FSAA 3WNLA 5BU9A 3PWAA 2I1OA 3E3HA 3O06A 4HT3A 3S2MA 4DAFA 2YLLA 5E5CA 3ZJ7A 2I9EA 1GVFA 4MKNA 3PPCA 4M5PA 3H55A 1A47A 5HATA 4C60A 2BVDA 3K2GA 3URQA 3HW2A 1B9BA 3WQ6A 4CNOA 3DENA 5H91A 3U9IA 1HL8A 2X2GA 4BQ2A 3QR1A 4L4MA 5HQMA 2GL5A 3DHFA 4F0RA 2D23A 2C1GA 1TKKA 1OEPA 5REQB 2OEKA 4FF5A 1PKLA 5BROA 3GG8A 4HBKA 1V6TA 1ONEA 3WD2A 3AALA 1KFLA 2QHAA 4YHEA 4YCPA 3FLUA 4UR7A 3PC0A 3VNMA 1S2CA 4JTDA 1E4LA 3WLQA 3ETRB 2GDQA 2CPUA 4TU1A 1UB3A 4GYJA 3TA9A 4BHYA 3OYXA 2P10A 1CGWA 2Z27A 3FSUA 2H3DA 1UKQA 4G7FA 4FXFA 4IWWA 4ZSTA 3VIIA 5BXRA 3F2DA 3G6MA 1VHCA 3T8LA 1RD6A 1HNYA 1JYNA 4KCWA 3W22A 2G3FA 1G4PA 1F74A 4PB3A 2O9OA 4H83A 3TYCA 3GH7A 1EUAA 2XINA 2ZBTA 1NOFA 8XIMA 2ZZ2A 3WD3A 2G96A 1FH7A 1DTUA 3S5OA 2FMOA 3HMJG 2VRQA 2DDXA 2F6XA 4UTJA 2BGNE 3CAQA 1B1YA 3IJ8A 1N63C 3IAQA 1TPEA 2W5FA 1RQBA 1A5SA 4ALDA 1XH1A 1NIUA 1F73A 1BD0A 1M6JA 3ZVHB 1W5QA 2OSWA 4KRZA 1B30A 4TMBA 3G77A 3SQSA 4C6KA 4HOZA 4MMWA 5BZAA 4MWAB 4PMRA 4US5A 2W63A 2FIQA 2J6XA 4YMZA 1E6QM 2VKZG 1DWFM 1US0A 2ZA3A 1J9YA 3M0YA 3QOKA 2QGHA 3VMOA 1EXPA 1FWNA 4W86A 1X1NA 1Q6OA 3V0UA 3N2MA 2XSAA 3LV5A 1C8XA 3BSMA 3A22A 3AZRA 4O1FA 1EGVA 1S5TA 1TE6A 1JGIA 4PE8A 1JJKA 3TVAA 4DF1A 6ALDA 2NQ9A 4G7EB 2DEPA 1IHIA 2OODA 4HSHA 4D6JA 3OLEA 2GUUA 1GCYA 4GXPA 1B0IA 3NVDA 2D2OA 4EMWA 2XSBA 2V5LA 3Q67A 4QJ3B 4AD3A 4TVCA 2NX9A 3PTKA 1UIOA 2PWEA 3AROA 4CNPA 4LVDA 1YBQB 1GOWA 2WM0A 1FEAA 1SJBA 1KA9F 4H9ZA 5JBDA 1ITXA 2FTPA 2PE4A 3HMCA 5JCLA 3MUIA 1C8VA 2JIWA 4NAEB 1W37A 1YADA 2UBPC 4AD1A 3GS6A 1G4SA 3GBEA 3K8KA 4H6RA 4US6A 3WF3A 4FLOA 4OBRA 3H2EA 3LI1A 2XH0A 7ENLA 4XAYA 4QM1A 3LPPA 1N5WC 1M5WA 2ICSA 3NG3A 1E9ZB 2X99A 3NZRA 4UTTA 3GG0A 1E55A 7REQA 2CERA 4JIIX 1CW2A 2UZ9A 3HJZA 3VD9A 1QK2A 1PX4A 4PUNA 3M47A 2P8BA 2YDAA 2DORA 1H61A 2QCEA 3LGGA 1XRSA 1RJRA 2CZVA 2HQMA 2DU2A 3NQVA 4S2CA 3CHEA 3SQLA 1KBLA 3MI2A 1NFGA 4N42A 4ZXOA 2HRWA 4OOZA 1FWWA 5DFAA 4AYGA 4LRSA 3ARSA 3NZ1A 4PSRA 3RM4A 2FJUB 1SJCA 1FP9A 4HOXA 3SCNA 4ZB0A 1UWTA 5F2LA 3SGUA 1HL2A 1BHGA 2V3AA 5A3HA 4PUWA 1QFEA 5C71A 4AZIA 3DH7A 3JZEA 3WLNA 4LAOA 4MYAA 1XDLA 2JIEA 3NSNA 2D73A 2J13A 3LGDA 4JHOA 2QAFA 2OZ3A 3WNKA 3M5VA 1EQPA 2XU2A 2SFPA 4NYYA 1EDQA 1T7LA 1ZALA 1VQTA 5C2XA 4O57A 2WNWA 4V2XA 3WNOA 5MHBA 1UH2A 3PFMA 4PEEA 4IP7A 3T4CA 2IS7A 3N2CA 3KP0A 1JVNA 2PWVA 2IQDA 4U5IA 3WN6A 3BSHA 3KBVA 3VC6A 4XZ9A 4QJ1A 1SSGA 1XLLA 3NS1B 4BWLC 3GTXA 1KV5A 3BSGA 5CQ1A 2V82A 2OOGA 2B4GA 4XV0A 1IT7A 3UR2A 5D4YA 1CGXA 2QF7A 2VFDA 1W5OA 4JQ4A 5F4SA 3UWVA 3SCUA 1EHNA 4O54A 4UFKA 3EDKA 3DCPA 3LM7A 2P0IA 3FEQA 3G24A 1JZ5A 3C8NA 4EM4A 1GQIA 4Q8MA 3SCVA 3PZGA 2IXUA 2CFFA 5T9BG 2NUXA 4QHRA 4TVWA 3CZLA 4FHAA 5G2WA 1BYDA 3B0UX 2D20A 1QJWA 1CEOA 4EIVA 4YTRA 1UCWA 1H6VA 2OOFA 2YXGA 2TYSA 1HFBA 4INFA 4DVOA 3OHMB 3OLDA 3FK4A 4UXDA 5E6YA 4R9OA 4P2VA 1C9DA 3KCLA 4GIEA 4PB5A 2DUZA 3V5CA 2ZUNA 1RY0A 1HO1A 3VKBA 2QUNA 5AHNA 1VBRA 4P7QA 2WCGA 1YTEA 3W2JA 4DNMA 3AIQA 1SFSA 1GETA 1EA9C 1RH9A 4PTDA 3W37A 3NGFA 4FIQA 4AZ6A 2YCKX 4GKTA 2BNJA 5XIMA 2PP1A 4C90A 2YB1A 3GXDA 4PMXA 3H2OA 2PTDA 2ISDA 4S3FA 3AYRA 1B3WA 2QCGA 3SUVA 2C16A 4XAPA 2GQ8A 2X8HA 2JALA 1AMKA 5HPCA 4NNCA 3O7UA 9XIAA 4B3LA 4L65A 1WOBA 1JOAA 3N34A 3W7OA 2VCAA 5JCNA 4W84A 1MUMA 1O5XA 2PRLA 4MIMA 3ATYA 3AQUA 4I5XA 2Z24A 4K8GA 3W1UA 1WKYA 3WELA 3SIMA 3CHVA 4ZO7A 4M1BA 5CLTA 3TW9A 4IGNA 4A3HA 2X05A 2IPGA 3VA8A 4FNRA 2GLKA 4RV3A 4C7GA 5ECVA 1MYRA 2FZMA 3WF1A 3WFLA 3GLCA 2DZAA 4EXBA 3WEMA 3QY8A 3GHSA 2R82A 4QEEA 3LA4A 3MYOA 2AL2B 5L9FA 2VC5A 3THUA 3KM8A 3M5ZA 4MY8A 1JROA 8CGTA 5IFPA 1IXOA 1XBYA 2B7OA 3RRXA 5CAHA 1OQFA 5JH2A 1L9WA 4Z2JA 1R38A 2ACQA 4KMQA 1FUYA 2Z29A 1LOSA 2RAGA 4GABA 5DY3A 2QMKA 4DBUA 5EKYA 1J93A 3TSDA 5CC7A 4QSHA 1XLMA 2AKMA 2X50A 1ENUA 2ZICA 3W00A 1O6IA 1K9EA 3P5ZA 3MJYA 1VCFA 1BPLB 3O2LA 3C8FA 1F76A 1GOMA 1UWIA 4JFUA 1HQTA 2ZTKA 3L4UA 4OWGA 5LZLA 4KWVA 4AZ7A 2GR1A 3PPGA 4J40A 1M7PA 5FSEC 2XM2A 1JUEA 1DL3A 1LL4A 1BZLA 1VEPA 3CYVA 1MDRA 2WC3A 3DFSA 4CQBA 4W7UA 2G0WA 4Y2WA 2Y89A 5FF0A 3ZOAA 5AKQA 2Q8XA 4UZUA 2OKTA 1RHCA 1L6FA 2ZYFA 3LERA 1A5CA 2W54A 1OX6A 3MA8A 3W84A 3PBYA 3T40A 3L4ZA 3VKJA 4P8XA 2VNCA 1V3KA 5I3KA 1H51A 1CDGA 2HVMA 4J9JA 1LYXA 2WCSA 2XYLA 5DANA 3IK4A 3DAQA 3DFYA 5FA5A 4B4FA 1BQCA 2CLEA 4W9TA 5DMLA 1R9XA 1C7SA 3ZXWA 4LV4A 4MWAA 3NFUA 1WPCA 2FB2A 1IWPA 1GRAA 5M2FX 3WO8A 2P50A 1J96A 3FVDA 3E96A 3SJNA 1CXEA 5FJIA 4GACA 1W3JA 3ZLFA 3VD7A 3GC5A 1KM5A 1JPIA 3H7UA 1JF6A 2NUYA 3UVIA 3WQDA 1QAPA 3ENLA 4S3CA 5CC6A 3WQWA 5DF0A 3KDOA 4I7VA 5SWUA 1TJPA 3F4NA 4BR1A 4IP5A 3VIKA 1GQNA 5G2IA 3S6DA 3NGJA 1O5RA 1R7AA 1KNWA 4YTUA 3M0LA 3CPRA 5FKYA 3AHTA 3EPNA 3W7EA 3SN4A 2AQVA 2ZZBA 4XSMA 3MV11 1KV8A 4JTIA 3LK6A 2MNRA 1QOQA 4GINA 1PWLA 3BG3A 1QVBA 2O4MA 4O50A 1S2UA 4H4WA 2BP1A 1TR9A 3S4TA 1I9CB 4BF9A 3GIYA 3MCMA 4GQGA 3MSYA 3EWZA 5BOEA 3S46A 3N11A 4JIRA 4L1XA 2BG5A 2WBKA 2VD9A 1KTCA 1NM9A 3PWIA 2PB1A 3OVQA 4NZ1A 2QV4A 3PAJA 4QCFA 3AMZA 3VX1A 1ME7A 1MSSA 3CLMA 2A3AA 4UQAA 4Y9OA 1BSLA 2REQA 1E9YB 4KS0A 1XGEA 1I45A 2AL2A 3HBLA 2V3EA 1FHLA 1XIBA 3W07A 2QPXA 3KTXA 2H9AA 2HVOA 5KETA 3QJAA 2GVYA 1NU5A 3OIXA 1PEZA 3LMYA 1K4GA 1KM1A 1NJJA 1J8VA 4R27A 2PF8A 3MT1A 1OT1A 5HANA 1FHVA 3UEQA 3SQMA 2HWGA 1OGSA 4DM2A 4RXFA 3KLLA 1L6WA 1EL3A 5EPDA 4XZMX 5BOOA 2GOKA 2W55A 3H2NA 2OQHA 3ITXA 1EPVA 2J7FA 4AEEA 2Y85A 4AHQA 2R14A 3W2MA 1W9DM 5HJXA 1NFBA 1UR2A 2JFEX 3P82A 3A64A 4PCFA 2NV2A 4ZQNA 1W1TA 1VPYA 3TTSA 1CB7B 2E5AA 2V5BA 5FI8A 1GQLA 1C7TA 3C0JA 4F8XA 3KRUA 1BFNA 3TDFA 5AHMA 1CXKA 5I77A 1OFOA 3QSTA 1WO2A 2HV5A 3PF3A 4H9YA 2AL1A 2FHBA 2X1RA 3R89A 1IT0A 4WKAA 3NO5A 4NJHA 3W7NA 1W1PA 1B3OA 2E8ZA 2J24A 2YCJA 4GY7A 4ADSA 4HPXA 2D0HA 2WHJA 1H3GA 1VLWA 3AM9A 5DRIA 1BGAA 1YNPA 4NT0A 1VYSX 3RILA 4AQLA 4NEVA 3BOLA 1E5JA 1TA3A 2XM1A 4JQ1A 1AL8A 1THFD 2YA1A 4D2JA 4PRWA 3AZSA 3UXAA 4B4HA 2OLAA 3H21A 4Q4KA 1ISYA 5J8LA 3TTEA 5HOSA 4FAMA 1W9XA 5KZDA 1E73M 1ZMDA 1V3HA 1Q45A 4HNCA 3O07A 2XVPA 3RNDA 1YNQA 1AH4A 2OVLA 3ORWA 4GIRA 3FAXA 4IT1A 1K7EA 3CL7A 4WSJA 3TIMA 3I7SA 2QDEA 5HNNA 4QLLA 5CG7A 3W7KA 3CYJA 3QPZA 5JH1A 3H7RA 3CGCA 1H7RA 2D3NA 4IM4A 2WHKA 3PBMA 3T05A 3JUGA 5E93A 3L23A 3BURA 3JS3A 8RUCA 4WR3A 4GPNA 4ILSA 1SJAA 3UA3A 2EG7A 2C19A 4DI9A 2E25A 4AWSA 4GBDA 5BW6A 1ZBKA 1DXIA 3F03K 1BF2A 3QHNA 2V9DA 1TV8A 1OM0A 3PJWA 3KE0A 2CLFA 2Z6IA 3HU7A 3VM5A 2GGJA 5HNUA 2HVNA 3M4HA 4FOJA 3WJZA 3C86A 3M0KA 4BF5A 1QMLA 1JYXA 1IIHA 3AAMA 1F6YA 2Q6ZA 4Y9NA 1F05A 3IJLA 3F5KA 3SUWA 2X1TA 4E4PA 2QIIA 3T55A 4K2SA 4H4XA 3QGVA 4OVXA 2QKFA 2CW6A 3VIOA 2W3RA 4LUYA 3SRFA 4GLEA 1D3CA 5I3JA 4O13A 2WLYA 4LW7A 1GONA 4F0KA 5B80A 4KW2A 1D7FA 2NQZA 1JDDA 4DLFA 3OG2A 4LANA 4GJ1A 4IIGA 2TPSA 2FGLA 3APTA 2VRKA 3CH0A 1XF0A 4ERIA 1ZJHA 2QCLA 2YVFA 4L6OA 3G1SA 5KTLA 1H09A 3UPMA 3BLDA 3W25A 4YTSA 1OIFA 3BL3A 5EFDA 5EFFA 5LA2A 2P88A 3WK0A 3KHJA 2PODA 1JCNA 3OYZA 4HJFA 4GNJA 3NURA 2W0HA 4EX4A 4JAWA 4DBEA 3I7QA 1SPQA 3SY8A 1O95A 3QTGA 1WX0A 4HB7A 1MWOA 2RABA 4YIWA 2J7CA 3W2NA 4L4PA 5A6JA 3T4WA 1H49A 2NT1A 1E0XA 2G95A 2XPKA 1E0VA 1RVKA 2XZ9A 4RKAA 4AIOA 1JNDA 4ROPA 4DHGA 3E0WA 4J56A 3GDMA 1FFQA 3ABXA 2YR1A 4EAMA 3MW7A 4KIEA 3K8MA 3EB4A 4HD5A 3L2IA 1KM3A 3H53A 5HUPA 1OX5A 4RL3A 3A6OA 3AJ7A 1EJRC 5AZ0A 1VF8A 4YTQA 2DT2A 1XYCA 3DFOA 3D0CA 4F0LA 1MEIA 1OZQA 1Q13A 3I10A 5HQEA 4ZB5A 4GY0A 2FGBA 3R07C 3MO7A 4L56A 4DB7A 5GNXA 3EB2A 4DAIA 3T42A 3P6LA 2REQB 3MP3A 1W6TA 2BGSA 4CN1A 2A3HA 1NF7A 1UUMA 4ICMA 1VGAA 1V77A 1NHQA 5EMKA 3TJ4A 1TMLA 2A7NA 5AYYA 4O1CA 3WJYA 1QW7A 3VYLA 4UTWA 3M5YA 3W7IA 3LD5A 4OGZA 3E0IA 4RW3A 4A05A 4GVFA 1V4YA 3W26A 3NVVB 4GOAA 2Z28A 2BXVA 1P0EA 5GJMA 3S2LA 2HNHA 2GPTA 1J2BA 3G1DA 2C6QA 4RX0A 5D05A 3KBSA 3M07A 1V3IA 5F7UA 4KWSA 2BV9A 1EP2A 3HPXA 1NP0A 1I2NA 4YYFA 4Q8OA 1R9YA 3M64A 1MRQA 3AWNA 4GCAA 4EWND 3P0WA 3FKKA 4ECLA 4I6KA 3RPDA 2C8NA 1FCUA 2FDSA 1M7XA 4JY9A 4P7RA 5BRQA 1XQKA 5K9DA 3GVVA 4F48A 3UPWA 1V6UA 2EQ8A 4A29A 3ARWA 3EOOA 3O0KA 1Y0EA 2E7FA 2WVUA 5JCMA 3AICA 5D9OA 1XC6A 3B8WA 2DZWA 2FGZA 1TX0A 3BLFA 4S3EA 3EX1A 2NQ5A 1JZ3A 2PA6A 4YWIA 2C1IA 3AXMA 2PDLA 5T26A 1JYVA 4JZ5A 2OZ8A 3L65A 1WB0A 3GD6A 1RLCL 2V2CA 4FLRA 1I2QA 4N6EA 3QFEA 1GGOA 1GVYA 3S2NA 4MPKA 2RDWA 1UG6A 1ADDA 4HYVA 3QC3A 1OJTA 3K5XA 3OLIA 4H4QA 3SM0A 2JEQA 4L1GA 2R24A 1WAUA 2G4JA 3AMLA 2V0TA 3BARA 1E6XM 4C1LA 2YVJA 4S1FA 1Q6DA 2ATMA 1XV8A 4MPQA 4AW7A 3AXKA 1J11A 4WY0F 5H6HA 2WZIA 1I1WA 2WOVA 1WXYA 5HQLA 1K6AA 3SQPA 1M9HA 4ICNA 1JIBA 1XL9A 1RQHA 4QX4A 5HINA 5FEPA 2NVAA 3KLJA 2W3SA 1H1ZA 1GOXA 1YE4A 1FWDC 2CITA 4GXMA 1H1YA 3BGJA 3G1AA 1EIXA 4DN1A 2Y88A 3MBDA 4G7EA 2W9MA 4J7RA 3UR5A 4D1IA 1JI1A 2Z6JA 3OGVA 3QEZA 3GFZA 1ZY8A 1JPDX 3BLIA 3WMBA 2YLAA 4O16A 5A6MA 2OG9A 4K7VA 3URHA 3EGJA 2VHLA 4NAFA 5E0FA 1O12A 3ABZA 3PN8A 4RDWA 2P8CA 1WYGA 3W71A 2RDTA 4MFDA 3CGBA 1O1ZA 1X97A 4OV4A 5G5GB 2RGMA 3HV8A 5I2UA 3OZOA 4PMOA 3L4VA 1E4IA 2Z4GA 4YU1A 3OIHA 3OBAA 2J74A 1QATA 1HF6A 3U57A 4O4WA 5DLCA 1X98A 3VAVA 4Q8VA 2AKZA 2H6RA 5F1VA 4EF9A 2KAUC 4B5WA 3EPMA 4AZGA 4GZEA 3VKDA 2ZZ1A 2FYMA 4A3UA 4ZOEA 3DK4A 2HEJA 4ZOCA 4IF2A 4B9YA 1TJ1A 3AS3A 2A6LA 1GVQA 3AMDA 4AX6A 1DE5A 4QS6A 3JU2A 3OPSA 4J35A 3BCDA 2FB3A 2BCPA 1P7TB 5BMWA 3R10A 1VZWA 6XIAA 1YIXA 5K7JA 1O4UA 3B06A 1CTNA 3QPYA 4H8VA 1R3VA 3N73A 1V8EA 4TMCA 4G5DA 5U7SA 4GVIA 3ECQA 4XAFA 4J3TA 3W1LA 2EPOA 3TC3A 4ATWA 5A8GA 2FVKA 2VFIA 9CGTA 1QNPA 3LHUA 1Y5XA 4LCQA 4ORMA 3GVRA 4NAFB 3JW7A 3DHUA 4N9CA 5I5RA 1UMYA 3RRAA 3R6IA 4JYEA 4JTRA 1UWUA 3WQGA 3GYCA 1KXTA 3O15A 3SUUA 3IV8A 2VZUA 5D30A 3CWOX 3L67A 1TTPA 1H2IA 1N8WA 4I7WA 3WMCA 1FX6A 2OWWA 4K1GA 3NVTA 3VGGA 2FFIA 4YLWA 2W6RA 2ZE3A 1TV5A 1H63A 1GKRA 1XD1A 3UJEA 4BQ5A 1OX4B 2CBJA 6CGTA 5LGXA 4QP0A 3EKGA 3M7WA 5H8PA 4DY1A 3SECA 3BLEA 3EANA 5JMUA 1F5ZA 1DHKA 1KFBA 1YKWA 3BXWA 3NQCA 3OA3A 3ZLGA 3GAYA 3WUFA 4B2DA 4U3CA 3OHIA 3VZZA 1TVNA 3WDJA 1FA2A 2Z0IA 4JTFA 4QIUA 1Y5WA 5D33A 4DBWA 2TSYA 3W3OA 1JD7A 2D0GA 1XCWA 5A8MA 1WDQA 3MYPA 4C1NB 1LROA 1EC9A 3DC0A 3VIFA 4ZTYA 2G97A 2I14A 4FI4A 1EF2A 2PAJA 2UY5A 1DKWA 1GZGA 1OVDA 3ARZA 4JTUA 1UYQA 3ZIZA 1DXLA 1KRMA 3RR1A 1AZ1A 6PTDA 1TVLA 4AVOA 1K8XA 3RITA 3VMNA 3O63A 1XD0A 1HL9A 3W76A 3PTQA 2WHMA 2OYMA 3VFLA 2NXHA 2DVXA 4GRTA 2CBUA 1BRLB 2RKXA 5AOUA 1XIIA 2ZE0A 2GR0A 2OMAA 3RX4A 4NI3A 4AVNA 4D6DA 5A8OA 1G1YA 3NOYA 2CLMA 2VZTA 1G4EA 1JYWA 2I9UA 1K8CA 1J0ZA 2C13A 3IJ9A 1B3VA 3EDFA 5D37A 4HNLA 3CQKA 1SMDA 1JUKA 1JZ4A 4B9ZA 3A3HA 4H9MA 2QR6A 3V1HA 1Q65A 3N25A 3UZXA 5IFTA 3VDBA 3EDDA 4QITA 4MGGA 1GRBA 3FYPA 4DJFD 4EPBC 3KZPA 2EQ7A 4PL1A 1ZNNA 5G1MA 3WF4A 5HXMA 2TPRA 4BF7A 3FJ4A 1XIGA 4FX8A 1PE1A 4GY1A 5JCKA 3E0LA 3B05A 1W32A 3GG7A 5AHLA 1FFVC 4L9ZA 4E8DA 2A85A 4HZ7A 4AISA 1NAL1 2ZZ5A 2UY3A 3I65A 2GJNA 1TV2A 2PURA 2BLEA 3DGHA 3PZVA 2EQ9A 2Y1HA 5CCZA 1HP5A 3IIXA 4PBEA 4B5VA 4PUDA 5LIKX 1ZTVA 5EMMA 2PDIA 2R9ZA 5CZSA 4B5TA 2GYIA 3ONBA 1MW3A 3NYZA 2QT3A 4QNWA 4C6FA 4JIEA 4RJEA 3PG8A 3G8RA 1BGGA 3ZWSA 5D2WA 1C8QA 3V1PA 4QDMA 3I3BA 4Y8FA 1RALA 2GQ9A 4L9XA 2ASHA 3W7MA 3CL6A 3M7SA 1UPPA 1MFUA 3FN9A 1ODUA 4LQ1A 3MI6A 5KVIA 1LG1A 2PU1A 4PMUA 3K13A 2VX5A 3PSVA 2ZKMX 3U4FA 2J9XA 1EJTC 2DGAA 2XIIA 3V35A 1AD4A 1JCTA 2QJNA 4RUBA 4AY1A 4DF0A 3BE7A 4UWMA 1EWDA 1V7YA 1ZP4A 1ZZMA 2IXVA 2PDNA 2W61A 2OGJA 3QVQA 1NDVA 2QUMA 1BKHA 1Q2RA 4M3PA 1K02A 2VZSA 4F40A 1TWZA 3MJMA 2V2DA 3HF3A 3I6RA 2X8RA 3W9ZA 2OTDA 3MMWA 4JIQA 3CH9A 1CX9A 1E72M 1MQQA 3CUXA 4AEOA 3DHDA 1ML1A 1P5BA 1ZDLA 3R25A 1E15A 1TX2A 4BQ4A 1PIIA 1A0EA 3N19B 3D5HA 2A2IA 1F07A 4QE4A 4IICA 4P8VA 2FMNA 1EH9A 3L5OA 3GU2A 1XBXA 1FXPA 4US5D 2J9YA 3A7RA 3RU8X 3TJXA 2J78A 2ONEA 3QW3A 4YPJA 3WK2A 1PYFA 4LX4A 4PFHA 2PLKA 4K8HA 1RCOB 3T07A 1Z8AA 1LQ0A 1K7XA 1N2VA 1L6GA 3M0MA 2HBXA 3BCJA 4S39A 4FA3A 1A5OC 1NSJA 1OGGA 2DQWA 2ZXAA 1XLJA 2XFYA 3N3MA 1XYBA 1ZBWA 3W7RA 2J7HA 4FMVA 3N2OA 3N2BA 4LT9A 3VDHA 4AYSA 1GOIA 4OHQA 2VUYA 1W5MA 1RJPA 3WLMA 2YX0A 2OKOA 4K39A 3M9YA 2CNCA 2VFHA 2C3DA 4JTCA 2GQAA 5D8WA 1KKOA 3SEPA 2E6FA 2PCEA 4M7SA 1LORA 3THCA 1LRNA 4QSFA 4O8RA 4HNUA 4IMGA 4J27A 3NNTA 3KXQA 1OINA 4NZJA 4JTGA 3W02A 1OADA 2ZX6A 3UWYA 4ZO9A 1D9EA 3VU2A 4RE0A 1MVYA 4RPPA 2DSKA 4MYXA 2JEPA 3PULA 1Q85A 1JDEA 1YW1A 3NQDA 4W89A 1XYZA 3NVZB 1E56A 2GR3A 4C6MA 1PAMA 4EANA 3HQPA 4ADWA 1O68A 4HK7A 5HMDA 3LCGA 4HOWA 3KAOA 3KOFA 3ANUA 3L0KA 4UTWC 3CAWA 4G1KA 3CPGA 2DZSA 3MUCA 3TROA 1XLGA 3S1VA 3B9DA 2Z25A 4AD2A 3HGOA 3DKJA 3MUXA 5CG0A 1M7JA 1PUDA 3W29A 1F3PA 3W1NA 3DI1A 3DYOA 2NSXA 2ZIDA 2FZDA 3W72A 3T6CA 1GT8A 1HKVA 2PDCA 3A3XA 1QPNA 3H4KA 1KCLA 3KTCA 1A5AA 4WGHA 1JFHA 3R0UA 3BJTA 1IXPA 5F2IA 5PTDA 4H6QA 5I3FA 3LPGA 3SO7A 1NWSA 3SSJA 4PTNA 3UU0A 1HGWA 3UJFA 2FHCA 1YRRA 4WKFA 4O0ZA 1UZDA 3W7DA 1X8CA 5FJJA 1CLXA 4R7WA 4U10A 5C2CA 3CWNA 1J5SA 3CV1A 2EG6A 4MDPA 4CU7A 3HFYA 3KCJA 4BEQA 4V1YA 1PS9A 4FXSA 3MCOA 2PRMA 2PRHA 3M6YA 1BWKA 1QPKA 3L2MA 1NELA 4EACA 1H0GA 4ZFMA 3DK9A 3CS2A 1XFBA 3ES7A 1UR9A 1EX1A 3DYPA 4HNNA 1B3ZA 1JZ2A 3CM4A 3UY8A 3GHTA 4OUEA 1N7KA 5TAOA 5JQ9A 2P76A 4FLSA 5FOOA 4QAIA 3TJIA 4S38A 1VHNA 5GPRA 4H9TA 1EJXC 4P5UA 4Z2LA 2P3ZA 2QF8A 1VS1A 4AG0A 1SR9A 1LOLA 3IVSA 1AQMA 2A3BA 2R6OA 4X22A 1SUXA 2OWCA 1GYLA 4URIA 2QJJA 1MRAA 2WKLA 1JL8A 1X38A 4R3UA 3WIJA 5HNRA 3BO9A 4PBFA 1KN0A 1W1A1 3PANA 3GC2A 3W7HA 4PMQA 3N14A 4O52A 2DFAA 1ITUA 3VZXA 1DYSA 2ZZ6A 3UETA 2J8TA 3V7PA 3SGGA 4Z17A 4M8UA 2MUCA 3VIGA 1R2SA 4Y9PA 1T3QC 3W1RA 2X7WA 3VD3A 1KR1A 3QYQA 1V0NA 2Z2UA 1XSJA 4YNGA 4JNYA 3TSBA 3LLFA 3GTIA 3U2CA 3IIPA 3IVUA 2O9TA 3CGTA 2QCMA 2WPEA 3QMTA 4RCXA 1TV7A 1OYBA 2VGFA 5EGRA 8A3HA 2VEFA 2NWRA 1JZ8A 2CWNA 3AN1A 1U1UA 2PEVA 2MANA 3WUBA 4NZ5A 3HO8A 1SB3B 5C5YA 2VYOA 4FOKA 3CZJA 3RK8A 4G9PA 2XUCA 5HAOA 1VFOA 3LU2A 3NZPA 4MOZA 1PO9A 1V3LA 4KWWA 1XIHA 2Q71A 3EZ4A 2EKCA 4E4FA 1XJBA 2X16A 1ZCCA 5A2CA 3IUDA 1S5NA 3G3MA 5IXEA 2ABAA 2ESCA 4Q8TA 3H23A 2PDFA 1DP0A 3WJWA 1KD0A 2WMHA 1WDPA 3ELFA 4NX5A 1FCBA 3K46A 1GPFA 2OSYA 4AIEA 1XWYA 5FEZA 5BYWA 1OB0A 5GNYA 5D02A 2WKGA 1AA1B 4LBUA 3FKRA 3WBYA 3QGAC 1R9ZA 1DWJM 4ICCX 3LN3A 1H7WA 1UR4A 1XBZA 1XM3A 4PYSA 2WPCA 4AZ5A 2J8FA 4ZXLA 4EMIA 3WFAA 4W7WA 2ZWYA 1YBQA 1E71M 3WJXA 5HUOA 3KBMA 4AZBA 2V81A 2EG8A 6REQB 3URAA 2PU0A 5LSMA 1PWMA 3NR0A 4HSOA 4Z08A 3TN4A 5FJTA 2OO6A 1VFMA 3CGEA 2RDXA 4H6EA 4LUJA 2WVVA 1E1CA 3PAOA 1QK0A 5E0KA 2V5DA 2OZTA 1MI3A 1FH9A 3S9IA 1IWBA 4HU4A 1W3LA 3H2AA 1BYAA 3CIXA 5FD0A 3E9AA 3NQFA 2J66A 3PZQA 3UXIA 1SO4A 2YZ5A 4Q4PA 4DNHA 5CPSA 1PBGA 4HHMA 4MJ4A 1ONRA 1WOAA 3U5UA 4K8DA 1RBAA 2CLOA 5K2ZA 2CZEA 2OELA 4NRRA 1V7AA 1XUZA 1GJUA 6A3HA 4TV5A 2WMIB 5I24A 2FVLA 1GZJA 4DXVA 5AVHA 4G8TA 2VR4A 1C9WA 5G4WA 4QXIA 3QXBA 3II1A 4XZIA 4DEFA 3UG5A 1REQB 4C7DA 3IRDA 4YYCA 4Y90A 3UZYA 1UKTA 5LGZA 4IL0A 3NQMA 3IIVA 3T0BA 4DO5A 3VNJA 3GVGA 1NWUA 1B54A 3DBNA 2I17A 3PUGA 3VGFA 4BA0A 2GUBA 5H8MA 3CZ8A 2O0TA 3T2QA 3BW2A 1JDCA 3AIUA 4C1NA 3HV9A 3QHOA 4XIAA 1JAKA 2O7QA 3H7VA 3PUOA 3TZFA 4GH3A 5DX7A 4DELA 3HURA 3NA8A 4FNUA 4HJWA 2WC4A 5I7GA 1LG2A 1GQJA 2BY1A 3BAYA 1DPMA 5I0DA 3TWAA 3O1NA 1EF3A 3W24A 3QY6A 1KTNA 2PDKA 4FLQA 1OY0A 1N8IA 3S47A 2BHYA 4AFYA 3GDTA 4DUVA 5G4EA 1CLKA 2ISWA 5F1UA 1GW1A 1PZ0A 3TH6A 3WDQA 4MZ1A 4V1XA 3CT2A 4ZENA 1JCYA 4ZR8A 4U31A 4V15A 3SBFA 4JHMA 1X1OA 2HS8A 5LXXA 4GMEA 4D6HA 1RLDA 5FF7A 1H7OA 5A2AA 4MNLA 3QZ6A 2DIEA 4V28A 4IISA 3CBWA 4UTTC 4BV6A 2OLHA 3GBDA 4GUGA 4KRUA 3MS8A 4LGXA 4NRSA 3WUEA 4B5NA 3MHFA 3PBVA 4M51A 3INPA 3NL2A 2V38A 5EB8A 4I9JA 2HSAA 1I2PA 5GJNA 1AJZA 2YBVA 1R3RA 2BASA 3GVQA 4DZIA 2VFEA 2WJDA 4NX0A 1OCJA 1A5KC 3VDCA 3DHPA 1DWGM 1EP3A 4IH3A 1LOQA 3CPUA 3WDIA 3LADA 3MSGA 1EDTA 4N9BA 1CB2A 3N4AA 1E6RA 3P62A 2WZTA 2VQTA 3ZR4A 3IJQA 2PPGA 2PLJA 4CNTA 2DSZA 1C92A 4OBSA 3BMXA 3FHQA 3P14A 1RUSA 4IPPA 4EM3A 2OEMA 3S5YA 2G3JA 1JI2A 5FEWA 3VNKA 2FTYA 4L64A 4DJFA 3KL5A 4WOQA 1LBFA 2Y8VA 3GW0A 2HTMA 3W1XA 4ZBCA 1ZMCA 1ZB5A 2VX7A 1Q4NX 4D8LA 2QQ6A 1AQFA 2Z1SA 3P0XA 4LA1A 2ZZ7A 5CGQA 1W8SA 2ZRZA 1YYAA 3SIZA 3D6NA 3GKAA 3PZOA 2J3NA 1NDAA 2ISSA 4NYUA 1GRFA 1E70M 3O05A 1A3HA 3TZNA 1CWYA 3IVTA 1KWKA 2E9LA 4D6EA 3K4AA 4B3KA 3UYIA 1KCZA 4HA4A 4KT2A 1FTXA 2CZFA 4QROA 1EX5A 1IEWA 1XKJA 5I79A 1YDNA 1Q1RA 2DZBA 3DJJA 5AECA 3IGUA 1TV4A 3UG4A 2VM8A 3BQ5A 1TPWA 4HYRA 1D2KA 3LOTA 1K1DA 3G5EA 1F4HA 3HOJA 4MSSA 1AH3A 2WWDA 3S1XA 1KFEA 1EFZA 1NQKA 4JDBA 4UNKA 5AYIA 3F5JA 3L4XA 3ITCA 3H70A 5BMXA 3PZUA 4WCJA 1UQZA 2GOUA 4GIYA 4RNFA 2QJGA 1M41A 3AMGA 3MDWA 1IE7C 7REQB 3P74A 3O6AA 4IPJA 4EXQA 1PZ1A 1FDYA 1AQHA 4H6KA 2R91A 3DERA 4BWLA 4MB4A 1EJUC 3OODA 3LQLA 3NPUA 4XO7A 4W5UA 4A22A 3GD3A 4Y8EA 1FKXA 4L4OA 3WLRA 4KBXA 2YDQA 3UG8A 2PDBA 3BMWA 1XANA 3UPBA 1TB3A 3RLGA 2ATSA 3W1TA 1WE5A 3BPWA 3UESA 3W28A 3UG3A 3TA6A 3HJEA 5T91A 4UTLA 3LB8A 3CB3A 3HRDC 3WEZA 1PKNA 4WY0B 5ABEA 4W4QA 1PTDA 5E0CA 2VO5A 3GXTA 3RM9A 4FALA 3RAOA 1CXFA 1E0UA 3VINA 4GO9A 3EYPA 2DZVA 2J4GA 3L2LA 3VZYA 3PBGA 5AC6A 3CEUA 1W1YA 2V6OA 3AFBA 2AAMA 4AIBA 4PMNA 4PMDA 4KF1A 3WDPP 4ZE4A 1MW1A 1YEYA 3KVMA 4XISA 4DNAA 3E2RA 1Q8AA 1X6LA 3EWCA 3L66A 2Y70A 2XVKA 1TMHA 5DBUA 1VJIA 4RXGA 4J57A 3ARUA 3PM6A 4PMYA 3B9AA 1GQKA 2QS8A 4IPIA 3OP2A 3GNOA 3G1YA 3ME3A 4HMEA 3WLKX 1CENA 1UD3A 4A2SA 2V69A 3NL3A 2E40A 4O8AA 2GFTA 3FJLA 1ZPTA 1PPIA 2WZEA 2ZDSA 1X8FA 3S6TA 1VYPX 3TXVA 4PTXA 2QW5A 4OECA 3A24A 3KVKA 4DO4A 2V2HA 3FX4A 1Z48A 1QDSA 4LVGA 4YTTA 4HU0A 4JICA 1KW1A 4WZHA 4F3HA 2OJPA 3LV6A 4Z2IA 1CPUA 4B5UA 3IIOA 4O17A 4ZE5A 2YQUA 3MKCA 4HMNA 1E1FA 3NYDA 2VDGA 1QI5A 3PWGA 4LRTA 4BK9A 1Q6FA 3C61A 3LEPA 5FS6A 4W85A 3NPXA 3WLHA 1VR6A 3CZEA 5CC3A 4Q3MA 1BXNA 1TO3A 1G4TA 2Y4SA 5I3DA 1VFTA 4C6DA 2ZVRA 3EX3A 4ADUA 5DMMA 1MXDA 2DT0A 3GFYA 2J8GA 4BCEA 2G3IA 3C52A 4DJDD 1XLCA 1QI3A 2XSXA 1LTDA 4J3WA 1IQ8A 5GRTA 4HMDA 2GJLA 3WK1A 4FEZA 3BVJA 2YJQA 3G1XA 5EBUA 3TYUA 3MHUA 4NVTA 3AHVA 4G1NA 1BWLA 3W73A 2B7NA 1OFQA 4R88A 3E1F1 1QHPA 4G2DA 3R43A 1BTCA 3CL8A 1W5NA 4GFSA 3ZT7A 2EPHA 1YXYA 1ZJAA 4F4RA 4EQSA 2B7QA 3LQGA 4E38A 3UJRA 5JIWA 5HWJA 4MY1A 1TRIA 3TMLA 5TF0A 3IEBA 3VOFA 1AFSA 1V0MA 4FPSA 2W79A 1SZEA 1KCKA 1ZS2A 3LSCA 3CUJA 1NH6A 1PX3A 3KWSA 4Q8WA 1XYAA 1W2VA 3ITGA 4IFOA 1GW9A 3LCLA 4Q32A 2PZ0A 4DUOA 4JIPA 1R85A 1UWRA 3F5LA 1XDIA 3HTWA 4NZCA 3ITLA 4FNQA 3MMDA 3OQEA 5H1WA 3P61A 5ABHA 4XVDA 1TQXA 2BX7A 1KBIA 4DYKA 2OT0A 3SSZA 5LA1A 2VC7A 3C2EA 2YSWA 4KQNA 2DT1A 4I9TA 4XAZA 2FZ8A 3D9XA 3DECA 1DJWA 3PFRA 1WBHA 1ZX9A 1G7VA 3B8SA 3CUIA 1XHGA 4GUJA 2QDGA 4MB3A 4JFWA 5G2HA 3H2MA 3CQHA 3Q4DA 1M6IA 1B9ZA 2BDQA 4IHCA 3CNYA 1G7UA 3PBUA 3IIZA 3LXCA 1A53A 4MWAE 5ABTA 3R4IA 1KXVA 1K03A 3IGSA 4WXYA 3F4CA 5I23A 2C3ZA 5CPMA 4UFHA 4PBGA 1SFTA 1XUUA 4LUTA 2Z7KA 4B5XA 1FWCC 2Q3OA 3M44A 1KKRA 4H4ZA 2W62A 3T2PA 1W8GA 1J10A 2VX6A 3E2VA 5LNUA 1E5NA 3M0HA 3MV01 1WDSA 1ZL1A 1ZHAA 4ZOAA 4K68A 4ROQA 9RUBA 3AJXA 1NOUA 2WO5A 3GVWA 1I60A 3MHGA 3O0FA 3AU2A 3DZ1A 1GG1A 4RV8A 5EBAA 1OG0A 1IT8A 2BC1A 1TTQA 3SFWA 1XDMA 4J3XA 1PJ9A 2OR2A 4N9EA 3SJ3A 3WF2A 3P67A 1SZFA 3OVGA 3KDNA 1P0NA 1IIGA 1SO3A 2OGYA 2XH2A 1OYAA 4F79A 4O1BA 1Q7ZA 2PDUA 1TTJA 4GX9A 3G1FA 5ECUA 3NQGA 2Z1VA 4AD0A 3NWRA 3T44A 4W8BA 3PUEA 3DN5A 2OXNA 4H7ZA 3LG3A 4LSBA 5HA7A 3WEOA 4U3AA 3BK0A 2Y7FA 2J27A 3QQWA 1NY1A 1UA7A 2QJMA 1DJGA 4JYFA 2EEXA 2VR5A 4HK6A 1EDGA 1W1B1 3SAZA 2I57A 1AJ2A 1I6NA 4J3VA 2W66A 2VEKA 5DCDA 5A6LA 2IUZA 2IPJA 1R3QA 4LNCA 2Z2BA 1S46A 4WF7A 4EPDC 1DORA 3QY7A 1TG7A 2WWCA 4LVAA 3L9CA 4S3BA 2PSNA 4PUEA 5REQA 2D22A 5ENLA 3UWZA 1YNYA 3DUGA 2J75A 3AWOA 6TIMA 2PDGA 4MWAD 3JZUA 3GNRA 4DF2A 3UCCA 2O9PA 4O12A 2XN1A 4ERAA 1O94A 1EPXA 3UWUA 3UJSA 1FECA 2QUTA 1EZ2A 3RCNA 3W1QA 2GSEA 3PB0A 1M01A 3MDUA 4ZEPA 4CVUA 3MUZ1 5CSYA 3JR2A 3MP4A 4V27A 1UC5A 1FO4A 1S5WA 1POKA 1H7PA 4WX2A 4S3GA 1B4KA 4UTFA 1D3GA 1KM0A 1VEOA 3PPFA 1YDYA 3TC7A 1BVWA 1KRAC 1ONFA 4JY8A 2FVMA 5FF2A 4APNA 1UOZA 1C29A 4IUGA 1OCNA 2BB0A 5CGMA 4JFVA 3U4AA 4TVDA 3A5VA 3UGVA 3ITVA 2BXZA 4GCXA 3GRTA 1XLBA 1R0MA 4GXWA 2INZA 3AO0A 4W7VA 4ADTA 4HU3A 4Q6JA 3OJGA 3BV4A 1M53A 4GI9A 3THAA 1YQ2A 3EPOA 3ZJKA 2OT1A 1HIZA 4TXEA 3FIGA 3H12A 5AYZA 2YZRA 1Q1WA 3RR4A 2HBVA 1UZHA 1A80A 2RUSA 4WKHA 4YVXA 4V33A 3T2OA 1XC4A 3ES8A 3H6OA 2BVTA 4XZBA 2HS6A 1HGYA 4TQTA 3OZYA 4NZFA 2WQPA 3W0KA 2XGZA 2Z2AA 3C0SA 5TR3A 4EP8C 4A8NA 3N13A 4HNVA 1KFJA 4PFMA 3V5FA 4L7ZA 2POTA 3GM8A 2J62A 3PP7A 4O28A 1BKSA 3M0VA 1WDWA 1PB0A 2Y5SA 4H4VA 4MAVA 4LWWA 4ZQMA 5DCBA 2X1IA 2Z26A 4IOTA 1J18A 4AZCB 2VFFA 3T0CA 4ZFCA 3WLTA 3RN6A 1EGMA 1TA3B 2BC0A 2OB3A 3MPGA 3U5YA 1RAKA 5CZJA 1DIOA 5K9XA 3AHXA 3UBPC 3IV3A 1FVPA 1QBBA 4Q4QA 3E02A 1J01A 1S3TC 5CBBA 1GRGA 1STZA 1H5YA 1UR8A 4I9AA 3GD4A 5AC7A 4LCSA 1OK4A 1UD5A 2WPBA 1F6KA 3SADA 3G1RA 4YVPA 1IZCA 3OTRA 2CKRA 4GJIA 2WSKA 2F38A 1D7YA 1WXZA 1RJQA 3QR3A 3DBPA 1QHZA 4CN6A 3T09A 4TTUA 4MKSA 4CQAA 4W5ZA 2IKIA 1FWAC 2ZC8A 1S1RA 1WZLA 5LHFA 4JTHA 3C0QA 4EQRA 4IQLA 2EBNA 2YW3A 4DX3A 6ENLA 3NZGA 1IR1A 3GQYA 2CESA 3VUPA 5C2GA 2Z7GA 4CCZA 3NRZB 1UASA 3ZT5A 2VP8A 5KZMA 4TX6A 4B16A 3VCNA 4DRSA 3EB3A 5FS7A 2VMFA 4BURA 8TIMA 3WK3A 4GO8A 1ONXA 3GSMA 2VEPA 4PCSA 4F9JA 1E6PA 4LEQA 3VCRA 3GHUA 1P6BA 3LM3A 4NQ1A 4JFTA 1PZ2A 1A3WA 3NO3A 3PHAA 2VGBA 1NTHA 2V6AA 1RPXA 1XLKA 3NPVA 5BXSA 1UWQA 1T96A 4IFKA 1MW0A 1JEHA 2ZADA 1KB3A 4XO6A 3DJGX 1U1HA 3OGRA 4JBRA 3N6QA 4MJMA 1QPRA 2Q3RA 3ABSA 3FYYA 3Q6JA 3QV7A 3B0YA 3CTLA 1FIQB 5JRBA 3GTHA 3GR4A 3KOWA 1UJPA 3QKZA 4QDWA 3QMRA 3W2UA 2QDHA 1VPXA 3BZJA 1J6OA 4RNIA 2C1HA 1WV2A 1KFWA 3N9RA 2WV8A 1NOWA 5FAJA 3W7GA 3U7BA 1GTEA 3ANYA 3H22A 5IBXA 2XWDA 1OHLA 1G94A 4PMJA 4E8CA 5FIPA 3M0IA 3EWDA 4U28A 1QNRA 1HJUA 1LLOA 3RMJA 2X40A 1E1CB 2CLHA 1NDZA 4LS2A 2V63A 1SFJA 1XLHA 3B3DA 2J7EA 2KZHA 4EQXA 2ZFAA 1V6WA 3A4JA 3IJIA 1DQXA 4MY9A 3MVIA 4Q8QA 3MQTA 2ZUSA 2Q8ZA 3B9JB 2B31A 3CEPA 1EO5A 3I68A 2Y0FA 3L4YA 4MUZA 3K30A 4NNBA 3CWHA 3RHGA 5C6MA 3QZAA 1RQEA 2PCQA 5A6BA 4WDXA 2EPLX 1EYWA 4GI6A 4CQCA 1HG3A 3QFAA 1JGMA 2WCAA 2D3LA 3UXKA 4DJED 1IEQA 3RM8A 1FWTA 4MB5A 4M6QA 5HWMA 1OCQA 1GRHA 1XISA 4UBPC 3TW7A 3LCHA 4JTLA 5HWNA 1G67A 3MU7A 2E3ZA 5A6TC 1TRDA 4D8AA 1QR7A 5KSWA 2EJ1A 3O8AA 5AYXA 4OT7A 2PUZA 3TN3A 4Z42C 2HISA 1XIJA 1EOKA 4XBSA 1IZJA 4K36A 5FESA 1SR0A 5TBOA 1IR2A 4JFSA 5E09A 4UNLA 4M0XA 2NUWA 4IX0A 3FGCA 5CXPA 4H4PA 2VC6A 5E70A 4LC8A 1WUFA 2VWTA 4LF2A 3VGHA 4LOCA 1CBGA 3BLOA 5H8UA 4XD4A 3KOXA 4DJEC 5DELA 2VGGA 3W74A 3BGAA 3CV2A 1VJZA 3AS0A 3E6EA 2BOFX 2J7GA 4GNVA 1CXLA 4I3GA 1ZY9A 3LXBA 4QG6A 4GQBA 3WDHA 1V6YA 4GNKB 1A0DA 5GNZA 1XLAA 4REQA 1JRPA 4LYRA 2ZX5A 2V3GA 1SJDA 3M0JA 4O0KA 3CJPA 3CLWA 4QE5A 4I8DA 2FHFA 2VGIA 4WEVX 2CLIA 1A50A 2AGKA 4KFNA 3LCXA 3PSWA 1AOGA 4DZHA 1NFPA 1VPQA 2G37A 2XN2A 2WXDM 2XVNA 4QJ5B 1PL9A 1MZRA 4LYQA 1GJPA 3VGBA 2E5BA 3P7YA 4JXCA 4MG4A 3ANVA 3HGSA 4C6LA 1RZMA 3ZYZA 5LNSA 1CLVA 1QI0A 1UJQA 5DO8A 2C3CA 1F61A 2R94A 4NJGA 2E0PA 1RBOB 4Q8UA 3NTYA 2AAAA 1VBGA 3C0LA 2Q02A 4KETA 3W7PA 2D0FA 3C6CA 1HKMA 1OBAA 1OT2A 2CDUA 3PJTA 4J2PA 2INEA 4M81A 4FF7A 3EF6A 1NHSA 1BF6A 4XVEA 2QJHA 4MFEA 4JTAA 2Y8KA 3MUAA 4I9MA 1IEVA 3QF0A 2ZXBA 1W3TA 3LNPA 4M1RA 3WD0A 4GQQA 1I4NA 2O9RA 3GC4A 3HPFA 1HKJA 4PMZA 1ZJIA 4ATDA 1SZGA 1TYTA 2Y61A 1MZHA 4RE3A 2GJXA 4HA1A 4HN8A 2JKAA 3A9BA 3REQB 4A8RA 2ISVA 4C91A 3FXGA 5AY7A 2J7BA 3LHZA 4DPPA 4M24A 1ZKQA 3BANA 2IW0A 1QU4A 2CHNA 1VP5A 1TCDA 1QI4A 5MKGB 3C5QA 2ZRWA 1R86A 1VEMA 3CZGA 3WH6A 1EWEA 5AHIA 3GXFA 3TCSA 4YWSA 5FF3A 1BG4A 4MNJA 1M68A 2YL9A 3SB0A 3EXTA 1B3YA 1P7TA 2UWFA 3RUBL 4YL2A 1LL7A 1VKFA 4A4AA 2C91A 1TSIA 1EKOA 4NIRA 5C0QA 1W1IE 2ZX8A 4IMAA 4PMVA 1V02A 3IANA 3H54A 3SI9A 1P0BA 3EDJA 2E5DA 2WPGA 4KCUA 3RF9A 4IGMA 1FQ0A 4JCLA 3LHYA 2KX9A 2VOTA 2YXXA 3A5FA 4CD7A 3NQ2A 1WA3A 3S5NA 1HO4A 4QR6A 5D9NA 4PTMA 4CD8A 3WFZA 5D03A 4ZODA 5AC4A 2INFA 1RBLA 4G6CA 2WPFA 5RUBA 4GFIA 4WJXA 3EOUA 1PIFA 3GXNA 4H4RA 1SGJA 1ZBVA 1TZZA 1T8QA 1A49A 5HMEA 3K4DA 3UZJA 1VBUA 2WW5A 1RY8A 4RR4A 4Q33A 4R7OA 1ONWA 5K4XA 1LDCA 5I09A 2EKGA 3DESA 4PTWA 1K77A 4UQDA 4DWDA 2XJ7A 2PLMA 3KOYA 4N2YA 3LPOA 1E6ZA 1SYTA 1VCVA 4HTYA 3V18A 3R13A 1VQZA 1SMAA 3PNUA 2WOWA 2Z1BA 4Y7EA 3IGHX 3UJ2A 3T1GA 1QCWA 3MWAA 3L5MA 1LUCA 1D7KA 4JQ2A 1TWIA 3STPA 4OKDA 1GTHA 3GNDA 2OZ0A 5ABFB 2PC4A 2E5CA 2ZUTA 7A3HA 1YMYA 3R11A 4QG9A 2GQWA 1HJXA 2ZA1A 3BDKA 4R33A 1WDDA 2G3MA 1JZ6A 1ZAJA 3NVYB 2LLEA 1W0MA 2DZXA 3TKFA 3WH7A 1XW8A 3B0PA 3M6DA 2ACUA 2NT0A 2VELA 2HXTA 1JDFA 3HGJA 3VDAA 1Q6RA 3W88A 2JKPA 1Y5VA 1QPQA 3QH2A 2YCLB 5LIWX 5A6SA 1V08A 3ABQA 1QXLA 4I7UA 2WP5A 1V3MA 2YL5A 2V3FA 4ZQCA 1MEWA 2A1YA 4R53A 3W27A 4K38A 3QLLA 1UD8A 5M1TA 3AHZA 5A5WA 2XVGA 3BG9A 1F9CA 3AYTA 3W6LA 1XRVA 2D1ZA 4S3AA 3BAWA 1FCQA 3ARQA 3LBOA 3TYDA 4FZIA 1SW7A 3IUHA 1E0WA 1XGZA 1TZ7A 4HNOA 2HK0A 4X2RA 1GWJA 3SUTA 4F66A 1US3A 2GUYA 2X7VA 4B91A 4GYFA 1UC4A 3G1HA 4GUFA 3BZGA 3GIQA 1JPMA 1EA0A 3DGRA 1DWHM 3TWBA 2NQJA 2VDHA 3VOGA 3CQJA 1AMYA 4CEXC 1R3WA 4UNIA 1IEIA 3KFTA 4RW5A 2P1FA 2FPYA 5AC5A 5I07A 2OX4A 2V67A 4GX8A 4Q8NA 5GJPA 4AVFA 4A6GA 2NVKX 1J5TA 3B4YA 4H50A 1L6SA 4YCOA 1UD4A 3KWXA 4GZJA 1E6NA 2JE8A 5F2GA 3P60A 1U5VA 4DJDC 1Z32X 1B5TA 4HPHA 3UT0A 4IIEA 1OFRA 3FG2P 3H2CA 2DUXA 4D6IA 2BSLA 3POHA 5A69A 2YDRA 2BY3A 1GYNA 3K1GA 4IX2A 4PN2A 1KO0A 4KKXA 3F7JA 1W17A 3NQ7A 1KRBC 3L68A 4JKKA 1MO0A 3D47A 3M5XA 3QW4B 3DG6A 1BQGA 1WZKA 5A2BA 4E8GA 4C6NA 1TQJA 1XXXA 3KRZA 1KRCC 2PMQA 2PP0A 4UB9A 1HZYA 1ODZA 2VTFA 4QGCA 2XDFA 3GDKA 4XD5A 3K8LA 4C6JA 1KGXA 4JR5A 2R8WA 5EMYA 1PKYA 3BAIA 1T8XA 3NDZA 3FNDA 5A94A 2J9ZA 3ARVA 5FJOA 6REQA 5A8NA 3RO8A 4UOQA 1P6WA 4L6HA 5CZ0A 5H2ZA 1J79A 3FSTA 4PEKA 4N9DA 3DI0A 1EJVC 3IJDA 1YTKA 3GRIA 2A3CA 4DBSA 1OX4A 1MNSA 2CLLA 2UY2A 4OQVA 2HE5A 4DIAA 2E3TA 3LMZA 4C6PA 3ZM8A 1I8JA 3NQ8A 5DCEA 1HVXA 2DZUA 2PD9A 3BTNA 3CK5A 1UMLA 3W7QA 3U8GA 3LLXA 1HX0A 1UIPA 2OPJA 3W82A 3VABA 5BWFA 3R12A 4JDRA 4YXGA 1H62A 4BI6A 1O5QA 1XS2A 1Z9AA 5C54A 1NWTA 1F4AA 2W92A 5HMFA 1LT7A 1W2PA 4XTIA 3L5AA 1OD0A 5FEXA 1U30A 4LUSA 4FX6M 4M6PA 2FH6A 4PUMA 2A3EA 4M29A 2Y5JA 2ZC1A 4D9PA 3BGGA 2OWXA 1B3XA 1HP4A 4UR9A 1O1HA 4WD0A 2XGBA 4RDZA 1VFHA 1SFLA 4AXKA 3R0KA 3GY1A 1LQAA 1EBDA 2WAGA 5M5DA 1EUNA 3ITYA 4CCEA 4HA0A 2RGLA 3LTPA 1UH3A 4JX5A 4C6QA 2PC8A 4BI5A 3GU1A 4M19A 4MLRA 1NDYA 4MLJA 4XG1A 3RX3A 4DLMA 2I5GA 1AUSL 3N2TA 4Q6XA 4DPQA 1XLDA 4A35A 3M41A 4TTGA 4AB4A 1K4QA 2GDVA 1MXSA 1JF5A 1DBTA 4UR8A 2QCDA 3P3BA 3FXYA 3QV6A 2XFFA 4DXKA 3XISA 4GH1A 3W1AA 3WH5A 2E1WA 1JD9A 3PG6A 3B40A 1J12A 1JDAA 2ANUA 1C91A 1XDJA 1L2UA 4N7QA 1ECQA 4M6UA 3TYZA 4A3YA 2GRTA 4JTTA 3FA5A 3LBMA 4JGDA 1U5JA 3S42A 4X63A 4JEQA 1W9PA 1MOKA 4Z1AA 3QV8A 2WVSA 4L4LA 3TXZA 1ZK7A 3P81A 2WJEA 4Q4SA 1K8YA 1P0DA 4YHGA 1FWGC 4DZAA 1V51A 1DIKA 1E40A 4RZ5A 3ITTA 1ITQA 1QPOA 5D2YA 4ZCWA 1EXBA 2GWNA 1DHPA 4IIBA 1EHAA 1OWQA 3GDLA 4FR6A 3BOFA 2YL6A 1DNCA 3T08A 2GR2A 1WNOA 5BCAA 5D38A 1K7FA 2O56A 4JN7A 3GK0A 5HNTA 3GR7A 3ZJ8A 3V3WA 1FOBA 2C79A 3CAVA 2C71A 1HKIA 1RXOB 1UHVA 4A21A 3WQ8A 2GWGA 1GG0A 1X7IA 3KX6A 3LGEA 2Y7DA 1XSKA 4REQB 1TE1A 1H50A 2Q8LA 2IPFA 2F2KA 1VBJA 2NXIA 4FS9A 2XGIA 2ACRA 5KEZA 1L0PA 3N18A 1AVAA 4Q4RA 3B03A 3GB6A 3CUFA 1S2AA 4MTVA 2E8YA 4CGTA 4NEWA 3HG4A 3VI2A 3O6DA 1XH0A 1SZRA 3C3NA 2W67A 3WH8A 1MUWA 3RLUA 1QOPA