3BSMA

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
386
structure length
358
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens.
rcsb
source organism Chromohalobacter salexigens dsm 3043
molecule tags Lyase
total genus 131
structure length 358
sequence length 386
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2007-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3bsmA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3bsmA01
3S47A 3PK7A 2QQ6A 2QDEA 1NELA 2PTWA 4E5TA 3MWCA 3TWBA 4JHMA 3U4FA 2XH2A 3GD6A 2O56A 3NXLA 3MY9A 2ONEA 3ZLHA 3V4BA 3QLDA 5EU9A 4DX3A 3UGVA 1TKKA 4DYEA 4JN8A 2XH4A 2NQLA 1P43A 1JPDX 3DGBA 4KPLA 2P8CA 2PTYA 3GY1A 3R10A 4Z1YA 3DIPA 4HYRA 1MNSA 4A35A 2DW7A 1EC8A 3TQPA 2PP1A 3DFYA 3IK4A 1SJDA 3DDMA 1PDYA 3RITA 3MKCA 3FVDA 2HNEA 2OQYA 2P88A 1W6TA 2OKTA 3UJEA 1FHUA 4IP4A 1WUFA 2OZ8A 4DWDA 3IJLA 1E9IA 1P48A 3TOYA 4H1ZA 3ZVIA 4GMEA 3T8QA 3H70A 2GGEA 3BJSA 4YWSA 3TWAA 2PGEA 4E4UA 2OO6A 4ZA0A 3DERA 3UCCA 3CT2A 5IDZA 7ENLA 4J1OA 3HPFA 3T4WA 3ZVHA 3SN4A 2P0IA 6ENLA 1JCTA 4M6UA 1MDLA 3JZUA 1TE6A 3Q45A 2HXUA 3QPEA 3TW9A 3ZVHB 3VC5A 1YEYA 5FJOA 4GIRA 3STPA 5ENLA 2GDQA 1JPMA 3I4KA 3DFHA 3SJNA 3P3BA 3CB3A 3VCCA 2QDDA 3ES8A 4E8GA 3GO2A 3I6TA 2GL5A 1WUEA 4GFIA 3RRAA 2PGWA 4IHCA 4G8TA 1F9CA 1EBGA 2RDXA 1EC9A 4IL2A 3UXKA 3K1GA 3OW1A 3TJIA 5FJTA 2FKPA 3NZGA 2POZA 3THUA 2ZC8A 4JN7A 3OP2A 3TJ4A 4HCHA 1SJBA 4EWJA 2GSHA 3SBFA 4KT2A 2QJNA 3DESA 3DG7A 4HCLA 4K8GA 3I6EA 3SN1A 3FYYA 3RGTA 3BSMA 3V3WA 3UCDA 1OEPA 1PDZA 3V5CA 3RR1A 2AL2A 1KKRA 4DXKA 2HXTA 3P0WA 2AKZA 4ENLA 4F4RA 2PODA 3UJFA 4H2HA 3QN3A 4GGBA 3FXGA 2AL2B 3R0KA 3UJRA 2HZGA 3UXLA 3MSYA 4DN1A 3V5FA 2OZ3A 3H12A 3OZMA 2PU0A 3OZYA 3UJSA 4ZCWA 2OG9A 1ELSA 3U9IA 3DG6A 3SSZA 3VFCA 3KUMA 5FJRA 3EKGA 2OPJA 4GISA 5BOEA 3SQSA 3ES7A 2DW6A 2AKMA 2PCEA 3QKEA 4H19A 2PMQA 3GC2A 2P3ZA 1XPYA 2FYMA 2XH7A 4K2SA 4X2PA 3B97A 3QTPA 3VA8A 5BOFA 4IL0A 3DEQA 1ECQA 4HNCA 1KKOA 2PU1A 3H8AA 1MDRA 2PP3A 4J3ZA 4ROPA 1RVKA 4FP1A 4HN8A 2PPGA 3FV9A 2QJMA 2QVHA 2OFJA 3EEZA 3CYJA 1R0MA 1XS2A 3MZNA 4FI4A 4IP5A 3UJ2A 4MGGA 3SN0A 3JW7A 4G7FA 2I5QA 3TCSA 2QGYA 1DTNA 3PWGA 2MUCA 4KEMA 2OZTA 3D47A 3NFUA 5J04A 3IJQA 3ENLA 4MMWA 1MRAA 1KCZA 2P8BA 2XH0A 4GGHA 4Z17A 3ZLFA 4H83A 2GGIA 4A3RA 3N6JA 4KWSA 2XGZA 4K1WA 2GGJA 3CAWA 3BOXA 3T6CA 2QJJA 3MQTA 2PSNA 3D46A 3P93A 3R0UA 2OLAA 4GYPA 3NO1A 1FHVA 2GGGA 5FJUA 3R1ZA 3MUCA 4IZGA 4DHGA 1TZZA 4E6MA 3Q4DA 2PS2A 2OVLA 3IJIA 1MUCA 4HPNA 1BQGA 3N4FA 4E4FA 3PWIA 1NU5A 3TTEA 3DG3A 1L8PA 4A6GA 1KD0A 1BKHA 3PFRA 3N4EA 3R25A 2GGHA 1SJCA 3FCPA 3JVAA 1EC7A 3R11A 3RO6A 4GYPC 3N6HA 1SJAA 3CXOA 1IYXA 1R6WA 5FJPA 3FJ4A 4HCDA 1EBHA 2PA6A 3OTRA 2CHRA 4IT1A 3H7VA 3T9PA 1JDFA 2PP0A 4HNLA 3VCNA 3OPSA 3VDGA 2OQHA 3VC6A 3RCYA 2XSXA 2AL1A 2PTZA 2MNRA 2OX4A 3S5SA 3ZLGA 4MKSA 4M0XA 1ONEA 2PTXA 3CK5A 2ZADA
chains in the Genus database with same CATH superfamily
3LQLA 4Q6XA 5DBUA 3NO5A 3T2OA 3UW6A 3MWCA 3LGDA 2PLJA 1KC7A 2NT1A 4GYJA 4HA4A 4KFPA 1OGSA 4XZWA 2CERA 3EPOA 4I9AA 2PWHA 4S3GA 4Q4MA 1SW3A 4HNVA 3IRSA 3G0XA 3RR4A 2EPLX 1QI0A 1R3RA 1MO0A 4ZOAA 1VFUA 5C2CA 1EGVA 1K8XA 3B8TA 1Z41A 4H4QA 2QAEA 1IZJA 4O13A 3QR3A 3P74A 2PDJA 3N11A 3NRZB 1MNSA 3LADA 4EQSA 1EC8A 4JTDA 4QNEA 4IPPA 1XGZA 1RCXB 4H4UA 5A6AA 4R27A 1QO5A 5JRBA 1H7PA 5DT7A 1PB0A 2ZKMX 2DIKA 3ZO9A 1FHUA 2WSYA 3U2OA 3P8IA 5LA0A 1I2RA 3NVYB 4H4TA 2CFYA 3GDBA 5CC6A 4DBDA 5I03A 1V3IA 3AIVA 3EMZA 3WQFA 3FLUA 3GHRA 4FXJA 4MFDA 1RP8A 3BW4A 2PLKA 4C1NA 2ZRWA 5FIPA 3A4WA 2FVMA 2J7GA 1KFEA 1CB7B 3CL8A 4H9VA 3K8LA 3GZAA 4P7OA 2ZX7A 1OADA 4QTGA 1E5NA 3LBMA 2OB3A 3AYVA 3SCPA 3GR4A 4NAFB 1XD1A 3VMNA 1JI1A 4EAYA 3ALGA 1WP6A 5ECUA 3QPEA 2YA2A 2R9ZA 1ZK7A 2RDTA 2GVLA 3ARYA 4ZSUA 2E4TA 3TN4A 4E38A 1YEYA 3KVLA 5AOUA 4O4VA 3GYCA 5BYWA 2WZIA 1JD9A 1IXNA 4IPJA 1VFSA 3I4KA 2V3AA 1XBYA 3ZXWA 4ZO9A 2X30A 1E6QM 2XFWA 2YQUA 4GY7A 2CLPA 3T05A 1GORA 3NGFA 3ID7A 3H7RA 3B3DA 4HNTA 1GPFA 1QPQA 3RK8A 1FWAC 4F8XA 5BXSA 1Y5WA 4AU0A 5F2GA 1ZENA 2ZOXA 4ACYA 2RDXA 1FWIC 4KGJA 1TWZA 4RNIA 3GAKA 3TDFA 4IL2A 3K4DA 3TJIA 2CBIA 4UTWA 2FKPA 2PUZA 3W84A 1LG1A 2YIHA 4JZ5A 1SMAA 2CBJA 1UKQA 3M0MA 3N6QA 1VJIA 2JQXA 3AMDA 2XFFA 4U5KA 5ABGA 3TOPA 2V6OA 5KMYA 5D32A 4NP7A 4WY0A 1PWLA 3AC0A 1HTIA 3GR8A 5K9XA 5DXYA 3VNMA 3FJLA 1TVPA 5RUBA 1OEPA 2QF8A 3QEZA 1PDZA 3N12A 1LBFA 3AZSA 1EIBA 3QHNA 5LKYA 1FO4A 1FP8A 4Z1DA 4TVDA 1LUCB 3IUIA 1R3SA 1B4EA 1ZKQA 1F5ZA 3QOKA 1BVNP 1J5TA 4A2RA 4X22A 3UERA 1Q8JA 4BJHA 4QEEA 2ISDA 2VRJA 1AH4A 2GVJA 2QUVA 2VO5A 1GVIA 4QEHA 4DWSA 3W73A 3OZMA 3S3GA 1I2NA 4UFKA 3LUTA 4I5UA 2X1RA 1W1ZA 1LROA 2OG9A 4UR7A 1YDNA 4LVFA 5GNYA 1ZALA 3L4XA 4BS0A 1MW1A 2EG8A 1H1YA 4C5ZA 1IV8A 2OPJA 1NSJA 3PBYA 2E1WA 3I68A 1NF7A 3LA4A 3UPBA 4F9DA 2EQDA 2PU1A 3W1MA 5MKGA 3W6MA 1PZ1A 1XLBA 3QY6A 1EHNA 4MSSA 3INPA 5B7YA 5CJNA 1XJBA 4L6OA 2AAQA 3SZ8A 2QJMA 3IRDA 3EEZA 4RXFA 1Z69A 1XS2A 3KBNA 3VOGA 4KH2A 4IP5A 1TPWA 3SN0A 3IJ8A 2ZRVA 2J7DA 3PN8A 2F2HA 3VKJA 1EOMA 4QIUA 5CBJA 5GNXA 1G4EA 5I0DA 4MAZA 3OLEA 4WDTA 1JQXA 3IS4A 3W3OA 2JFEX 5C54A 4AHOA 5DELA 2IW0A 3EUB3 3C8FA 5AC8A 3LRMA 3USZA 1TV7A 1CB2A 4I8YA 2YFNA 3L4YA 2PDPA 4J28A 1NDWA 2Y61A 2Z2AA 5F2IA 5C7HA 5D38A 1CPUA 1XH2A 3L2MA 3DBNA 1XYCA 8TIMA 1XKJA 3GTXA 5U7SA 4CNNA 1C7TA 3CGEA 4RZBA 2CWNA 4REQB 4JDYA 5TAOA 4XTDA 3ARVA 1TB3A 3RXZA 3L12A 1OD8A 4EE9A 3PZNA 2A8XA 1WDWA 1KXQA 4NT0A 1EA9C 1GT8A 3L4UA 1FFQA 3U2ZA 4ATWA 4N6FA 3GNRA 3AXXA 1L8NA 4QE5A 3UNTA 2ZUWA 1NP2A 3WEZA 5CPTA 4PMYA 4TVCA 4RCXA 2GR1A 2NSOA 4MWAA 1VRXA 4RL3A 2B7QA 2CKRA 1T3QC 1Q6FA 3W82A 3C2EA 4WDXA 5LNSA 4HCDA 2HPIA 1EBHA 2HVNA 3B8WA 2ZUVA 3RMEA 2PP0A 4ZFMA 6XIAA 3PZ9A 4WVXA 2CW6A 3EX1A 1CGXA 2QCDA 4I9MA 1DIOA 4NZ1A 2MNRA 1GJPA 3WMCA 1TFVA 1OX6A 1DOSA 4P5UA 3UR2A 1O6IA 4S2BA 2DJXA 3R7MA 3DC8A 1W91A 2P0OA 5HMFA 1JDAA 4A3UA 2OGYA 1EXPA 1V79A 4H8UA 5BU9A 4WSJA 2EG7A 3E0FA 3S5ZA 3AHVA 1RXOB 2HK1A 4NL1A 3EBVA 3UGVA 1XG3A 4EMIA 1BG9A 2J8TA 3S0CA 1XLJA 2YCEA 1FFRA 1P43A 3AIEA 3GIYA 3W7QA 4A8IA 2A3EA 4L9YA 4DXVA 4JKKA 3BQ5A 1NWSA 5D2VA 3CNYA 4LY4A 1QPOA 4I7VA 1VPXA 2WMHA 1XH0A 1H0GA 4MVAA 2E5AA 2Z1WA 1I2OA 3A47A 4DZAA 1LWJA 3WUFA 4EMJA 2Y4SA 1H4PA 1Q6GA 4P7QA 5A8QA 1J18A 3QFEA 5BU6A 4AYSA 8CGTA 3EAOA 2B7PA 2OQYA 3QTGA 3VKAA 1X6NA 3TC7A 3GNXA 1WUFA 3LTYA 3GRTA 3DH9A 2ZCGA 3B0XA 2YR1A 2NXGA 4AD1A 4DO6A 3LX9A 2IPFA 3RAOA 1RY8A 3H70A 4C6DA 4AC7C 3EF6A 4LYKA 1Q7QA 2WNQA 2TPRA 1MW0A 1E0WA 4D8ZA 4HT3A 4I9TA 1QI5A 1S3HA 4IFKB 3B4UA 3LHYA 2GZXA 3BPWA 4HZ7A 1UWTA 1UUQA 4L5ZA 3HGJA 3GLCA 1A5OC 4EXBA 3VIIA 1R3VA 4RR4A 5D2YA 4OOUA 4XTIA 1JCNA 3PUDA 3CH0A 3NL3A 3PY2A 1AL8A 5DRCA 3ANUA 1DJYA 2W6RA 2DDXA 1PO9A 4MJ2A 4AZBA 4QDWA 4JAWA 4GXMA 4HJFA 5LGZA 4S3FA 4A29A 2PDIA 2XUCA 4CD6A 1L2QA 1DXLA 4DBUA 4GJIA 4BEUA 1IEVA 5KZEA 4IHCA 3NGJA 2QV5A 3I7QA 3G3MA 1WOAA 3S2NA 4LBUA 1J96A 1AW1A 4PRRA 4H9XA 1AZ2A 3L4ZA 3Q94A 3EPMA 4JKMA 4YVVA 4NVTA 4WK9A 2XIQA 1HN1A 1D9EA 1OX5A 1KWGA 2ZRXA 3AHZA 5EBUA 2ZQ0A 4TR9A 1ZGDA 3BG9A 3BARA 3NG3A 1B0IA 1P1XA 2DT2A 3ZSSA 4V1YA 1VKFA 3QH2A 4LVGA 4LS2A 4NZ4A 4B5XA 4K8GA 4UIOA 4MY9A 1FKXA 5D02A 3FSTA 3N13A 3VD5A 3V5CA 2ATSA 2Y5EA 4YTTA 3H2FA 1BRLA 4WR3A 3T0BA 3UA4A 4UNLA 4GBDA 5HNUA 3VYLA 2W27A 3I7RA 4GABA 2OLSA 5BZAA 4KERA 1X2HA 3ELFA 3GKAA 3PJUA 3A3WA 4K8EA 2VGBA 5GJNA 2HZGA 3GRIA 3VIOA 3PUOA 3Q37A 2V9DA 2NPXA 1UH2A 1CI1A 2WOIA 3REQB 2PU0A 4JQAA 5I07A 3KWXA 3UJSA 4PRWA 5AB3A 3THCA 1XISA 3IAQA 1GW9A 4KRTA 4E2BA 4C6IA 2AKMA 3WNMA 1PIFA 3QKEA 4IMGA 3N3TA 1UKTA 3K1DA 4GI9A 4AD0A 4LXFA 2CZFA 1XFBA 2VEIA 3MI6A 3OO2A 1C29A 3AS2A 3I7SA 1KKOA 5A95A 4GQQA 3A21A 4LS1A 5KETA 1E72M 2D0FA 3WLJA 1OC6A 2X05A 3E38A 4XKYA 4GCAA 3GE7A 2QJHA 5FL1A 4ZSTA 3L5AA 4Q4RA 1NP0A 5HUOA 2C1IA 1K77A 1JF6A 1C91A 5FAJA 4GO9A 3TSDA 1EDQA 3A4AA 4G7FA 3R8HA 3TCSA 2QGYA 3WFAA 5HQLA 3HOJA 2VEMA 1IWAA 1QRQA 3LN3A 1KCZA 1L6WA 2IMRA 3WKZA 1W1A1 3CIVA 2GGIA 3W2KA 3E02A 3CAWA 2TPSA 3DGHA 3ZJ8A 1PTDA 1TV5A 1EWDA 1H49A 2X99A 1LT7A 3TTSA 4H4YA 2DZXA 2F84A 4P7LA 4MAVA 4U5IA 5FMHA 4S3AA 1UD4A 2XVPA 4H4RA 4FOUA 2I5IA 5CGTA 3MYPA 3ZWTA 2IQDA 5D2TA 2GWNA 5ABFA 2AQWA 3YPIA 4C6BA 5KVIA 4QSHA 3LGEA 2PBGA 3OG2A 3IUDA 4U2YA 2J7BA 2C16A 2BHUA 2OZ0A 3TYEA 2YDSA 1US2A 2IUZA 4QX4A 1XWYA 3WLIA 1VYRA 3CHFA 4AZCB 4NXSA 1WYIA 3O06A 2C8NA 5BOOA 4N9BA 3T1GA 1IYXA 1EGZA 1V6XA 4AF0A 5M5DA 4KIEA 1FTXA 3QSRA 1JRPA 3W85A 1M03A 4KS0A 1TPC1 2Z1XA 3CWOX 1G7VA 1DXEA 3AS1A 3STFA 5I24A 4GY0A 2PTXA 1FWRA 4TVYA 1KN0A 2BWGA 3H2CA 4JIRA 5D9MA 3OA5A 4IG2B 3ITTA 1AOGA 5CPMA 5D8ZA 5JBEA 1TWWA 1M7OA 1JZ5A 3G0SA 2HBXA 2WZEA 1JUKA 2X1SA 3CPUA 3EXRA 3R8GA 1E6XM 3P6LA 3W86A 2BC1A 3WLOA 1M5WA 4CQCA 1RH9A 4ADUA 3CGBA 1VEPA 5I7GA 1AQ0A 3CB8A 1EJUC 3OG3A 3CGCA 2HVOA 2EGZA 4LYQA 2GYIA 3WL0A 3VUPA 3VMOA 4FLSA 4BWLC 4JQ1A 5I09A 2DZVA 3TXVA 3EDJA 2YL5A 4MJ4A 1K7EA 3CIWA 4CCEA 4JQ4A 4PCNA 2IXUA 3NQDA 1QNQA 2CXEA 3RITA 5CC7A 1OFEA 1MW2A 1Z32X 1QPKA 3AXKA 2NQJA 1NDYA 1WZLA 2QLYA 4CNSA 4H3DA 1UC4A 3EA1A 2W9MA 3WQ5A 4UTWC 1V51A 2J75A 3NPVA 3KDNA 1OCBA 3H54A 1QASA 2WW5A 1JZ2A 3NPWA 1E56A 1DJIA 4Q3MA 3SAZA 3QMTA 3SR6B 3HFTA 3B04A 1W3JA 1NDZA 4JTTA 1M7PA 2BZNA 1OFQA 4R34A 2BDQA 4P2VA 3VO0A 1DWFM 1EDGA 3LG3A 1SZEA 2A3LA 1OCJA 1Z44A 3ABQA 3GH4A 4ES4A 4H00A 5ENLA 2EF9A 3COTA 4ZFCA 4AG0A 3C61A 4DWSC 3I10A 1H51A 3PAJA 4P7NA 4GQ0A 4B5UA 4MIMA 3BSGA 2Z2UA 3RJXA 3M5VA 4OVXA 1L6GA 1WUEA 4PBGA 4LTSA 2VFIA 1IE7C 1V3HA 4ZODA 1UP0A 1NOFA 3DAQA 4FX9A 2EQ8A 5M17A 1P4CA 1EBGA 4AIUA 1OWQA 5BROA 4OFCA 2H90A 1NDVA 1T8QA 3W7CA 1XYAA 5JMUA 4KFOA 3THUA 3DOPA 4CD8A 3NVDA 2PRLA 1VQTA 1Y65A 2ABAA 5CPLA 2WOWA 4JIEA 1JPKA 3F4CA 3OB8A 5LNVA 1VS1A 1YPFA 3IGXA 5A2CA 4LAUA 4GFSA 2TRSA 3LHUA 2VGFA 3DESA 2YZ5A 2V82A 4NRSA 1DE6A 3L66A 4Z2IA 1EFZA 4TQTA 2J62A 3SY1A 2B7OA 3GFYA 3U5YA 1FKWA 2Z1SA 4DXKA 2CPUA 3P5ZA 2H3DA 4YVPA 4LUJA 3WLHA 3C3UA 1I2QA 2IS7A 3MI3A 3N18A 4NY2A 1QDSA 3UXLA 3MSYA 4C91A 4AZ6A 3ITVA 3BMXA 5LIYX 2XM1A 4PMUA 1GVQA 4NAFA 5KINA 4YVXA 4JOMA 3E2QA 1TV4A 1ZXIC 1ODUA 3AXIA 2YBUA 7PTDA 2RGMA 1ELSA 5I5RA 1GETA 4K37A 3L4WA 2XGIA 1LOQA 3KUMA 3FX4A 3P2VA 3RUBL 4UTUA 1HXJA 5A6JA 4JTGA 2AGTA 4JQ9A 4O0ZA 5DO8A 5HPOA 3CZKA 3WQDA 3DXIA 1JD7A 4F9JA 1JZ8A 3FY1A 5T91A 3O7UA 3VDAA 3TTOA 3DK8A 4LC8A 1YDOA 1ZFJA 4OBSA 3TTYA 4GVIA 2X8GA 2EQ9A 3EKZA 4FLQA 4EANA 9XIAA 1ADDA 4QG6A 4HVXA 4FP1A 2H9AB 2WKGA 4LPCA 3O2LA 4RKAA 2XGBA 1FOBA 1QI3A 4Q33A 5I00A 3GDTA 1AA1B 3BLOA 4UMAA 2QUUA 2I56A 4HPGA 2QHAA 1SO4A 3MP3A 3EZ4A 1SO6A 3S9YA 4QHRA 2YPIA 4LALA 1OZMA 2D3NA 3ZT7A 2C0AA 3MUZ1 3RCNA 1TV8A 2O0TA 2PWDA 3NFUA 1M65A 4X60A 3BJFA 3IJQA 3ENLA 3O6DA 2QCFA 4PSPA 4QM1A 2E1DA 2CBVA 4BQ4A 1X8FA 5EMUA 2HTMA 3PFMA 6REQB 3M6YA 2FPVA 2W54A 4DZHA 3PG9A 4GXWA 3LCWA 2AQOA 4LIIA 5G4EA 4DJDD 3BTNA 2NLIA 2YBTA 2DZBA 3BWWA 4RDVA 2V38A 3JUGA 1RPKA 4EX4A 3CL6A 5M03A 4XO6A 3PZMA 5C7VA 4AFYA 3FA4A 3CMJA 1GEQA 3CHVA 5T8GA 1UWUA 1W3HA 3WUBA 4AZHA 4E3TA 1AQHA 2YLLA 3MBFA 4DQWA 1KBKA 4LT9A 1QW9A 1BYCA 4JX4A 1TMQA 2FTWA 3B8DA 3H2OA 1S2WA 2NT0A 1W9VA 4MY8A 4QQUA 4PYSA 3BW3A 1PX8A 1B4KA 3FN9A 2OT0A 2ON3A 3KBWA 1HL8A 1SJCA 2VJXA 3LHZA 3JVAA 1UR9A 1NTHA 2FPYA 4CN6A 4O50A 3WYZA 1OX4B 1WV2A 1SJAA 3AXMA 3GSMA 3A7UA 1J4EA 1G6CA 3UD6A 3BLLA 4PMRA 1IWBA 2F9RA 3M0IA 1CECA 5EKYA 4HNLA 1DJQA 1H62A 1L9WA 4RE0A 2F2KA 4LWWA 3RCYA 4BI7A 1ZCOA 4H7VA 1BTCA 1KBJA 2X0YA 8XIMA 2VC6A 3LV6A 1V3KA 3GD4A 3SGZA 1K1DA 2V2HA 1JFXA 3VMPA 2HWGA 2OWCA 4OV4A 1O1HA 2WJFA 1OFRA 1M1BA 2P10A 1V08A 1Z9AA 3MY9A 4HGXA 3MA8A 3AMGA 5DY3A 3KOYA 4IGSA 4AVOA 1WXYA 4YLWA 4CD5A 4JN8A 4V27A 5IRPA 1Y0EA 3HQ1A 2E09A 2XJ7A 1TJ1A 1RQEA 1QBAA 3GS6A 3POCA 4PMOA 2PTYA 3L23A 1GVYA 1JR1A 1QK0A 4HYRA 3CBWA 4PCFA 2VC7A 4LEFA 3CAQA 4REQA 3TQPA 3A23A 1GOWA 3THAA 2DQWA 2PP1A 4Q4PA 2YA1A 3DFYA 4UZUA 3A4XA 5IXEA 3HQPA 3WN6A 2ESCA 4NF7A 3ONBA 5GNZA 1C7SA 1XL9A 4QCFA 1ZAJA 3C56A 1GQKA 4N02A 1AVAA 5CSYA 3WQOA 1TZ9A 2DT0A 4WUIA 1E3XA 3CEPA 2BVWA 1R3QA 1RJPA 4C6FA 4INFA 2V3DA 1TQXA 3FK4A 1VBHA 1C3FA 3F2BA 1ZL1A 4Z1BA 1V03A 3QYSA 5E9XA 1XRVA 4A3HA 1LRNA 4YWSA 3SUSA 2YCLB 1EJ7L 4E4UA 4LVBA 3B0VC 2X0SA 5IDZA 1FH9A 1O1ZA 4UNKA 4C90A 4AZ7A 5AC6A 1XC4A 3C0JA 4M6UA 3W00A 3EX3A 5KITA 2G37A 3USBA 3G22A 1GRTA 2HXUA 2YB1A 3S6DA 5K7JA 2LLEA 3MCNA 1J79A 3NDOA 1YHTA 2WVSA 4D72A 4G5DA 2F38A 3EDDA 4CGTA 1JEZA 3FEMA 1YTKA 2VELA 1TO3A 2EAWA 2Q09A 3SW6A 3QV9A 4YMZA 3P3BA 1I60A 2W0UA 5AYBA 2ISWA 1ZS2A 1Y7VA 4U2ZA 4YNGA 3M5YA 3ONCA 2VGIA 4I6KA 3GDKA 2B7NA 2G50A 2NQZA 2PI6A 4NZFA 5A3HA 4GQGA 1X38A 1PTAA 1EC9A 4GUGA 1SFSA 4U3AA 3T0CA 2POZA 2J13A 3AISA 3T81A 2JIWA 1O95A 1PJ9A 2C71A 2D3LA 5C9RA 4OUIA 4PUMA 4HCHA 2NV2A 3GHUA 4S2CA 4H01A 3P84A 4DAFA 3B06A 1I45A 3F2CA 4J3VA 1V7AA 5IDIA 1ISWA 1IEIA 5CSUA 1R2TA 1NHRA 2DEPA 3S46A 1HJQA 3WNKA 2XIBA 4AIBA 2CYGA 3V5OA 1JNDA 3W1TA 4R9XA 2CZDA 4AH7A 4NNBA 4ENLA 3W83A 4GC3A 4H50A 4Z2GA 1A5AA 3LSCA 2XU2A 4IQEA 4ZOEA 1HO4A 4XWUA 5I2UA 3V1HA 3EWCA 3WQPA 3Q58A 1C8XA 3V5FA 2ALDA 2ZA3A 3PTKA 4L4PA 3TMLA 2EBNA 2YDQA 3H12A 1RV8A 1M01A 1VAHA 1I2PA 2C15A 4XSLA 2BY2A 1JGMA 4H04A 3PSVA 3FAWA 1BQCA 2V5CA 1ZAIA 4UQDA 3W38A 1AMYA 1ZU8A 4GQRA 4O11A 3ES7A 4B5TA 3BANA 3O0FA 3T78A 4NXKA 3GC2A 2WVUA 3GXPA 5A2AA 2VVNA 3V36A 2QMJA 1CWYA 1AQMA 4JTCA 1TIWA 5BOFA 1QATA 1UP2A 4XD6A 3N1AA 1K9FA 2VRKA 2VC9A 3NYZA 3GNPA 3THDA 3R8RA 3W7KA 1FCQA 1VBJA 4L9XA 4IOTA 4XUYA 1B31A 3M0YA 1Q6EA 1F3PA 3WBYA 2EG6A 2GQAA 5BW6A 2PPGA 3RLGA 3CZJA 3BLIA 1GSNA 2WPEA 1HW6A 1GRHA 3MZNA 1UD2A 2PDWA 1OVDA 4MLRA 3H2NA 5I3JA 1WDSA 1XH1A 1MMFA 4AZGA 2EQ6A 2E5BA 3WFZA 5KZMA 3D47A 9CGTA 1ZZMA 3C2VA 3W2LA 3OA3A 4UTTC 1MRAA 3CO8A 5FS9A 2UY2A 1JZ6A 3NNTA 3M64A 2GR0A 3EOLA 4G9PA 1MEHA 3S5NA 4PB4A 3BOXA 2V6AA 1MZHA 4DIAA 1KW1A 4WOQA 4FZIA 4LB3A 2J27A 3LBOA 4AD3A 3G8RA 1OM0A 2OLAA 4GYPA 1QU4A 1QCWA 3REQA 3MUCA 3PPHA 1SW7A 1GOMA 4MADA 3UZXA 1GXFA 3GXFA 3LY0A 3NQ8A 4Q8UA 4HPNA 3CH9A 4X0VA 1UQZA 3PB2A 2FFIA 3W53A 1YBQB 3BW2A 1JRCA 2ABBA 2R1NA 1FWWA 2CLMA 3MJMA 4OIFA 2GPTA 1DNCA 1EXBA 1XHCA 4BR1A 2XIOA 2CC0A 4DJEA 4F0RA 1PCKA 1JG9A 3IK2A 1TJ2A 4AB4A 1EP2A 2WBKA 4LYPA 1XLDA 1YQZA 1GHRA 4I5XA 4RDYA 5K9DA 3G1AA 4DF0A 3NSNA 4HOZA 5H8UA 4DJDC 2ZVRA 4MZYA 4QAIA 1JYNA 5G5HB 1VPQA 1V3JA 4M0XA 3SI9A 2YVJA 1TG7A 1TPEA 1V0NA 2X40A 3TA9A 3TW6A 1FFVC 3PK7A 3AHYA 1XF0A 3G1YA 1RLDA 2BXVA 2V3BA 3QFAA 1NQ6A 1D7YA 1XLLA 5JCLA 2R6OA 3WO8A 5A6BA 6XIMA 2Z00A 1UBPC 1N8FA 3WIJA 3STGA 1OFBA 3BDKA 4H7ZA 1PIGA 1GHSA 4IF2A 3M0ZA 4NZJA 1K03A 3E2VA 2TODA 3DGBA 2ZTKA 4AZ5A 1V93A 3NPXA 3ZFHA 1SZRA 1WNOA 3SB0A 2YCJA 2BODX 4H41A 1W9DM 2HJPA 2Y62A 4URIA 2VOTA 4ZR8A 1LL4A 3IK4A 1J0ZA 3WEOA 4A3YA 3MS8A 1XBZA 2R1LA 5HA7A 3VE9A 1YQ2A 3FVDA 3CMGA 1W6TA 1HQTA 1PEZA 4Y9NA 1G0CA 4AZCA 2ZFAA 3RHGA 4N9DA 3D3FA 1P48A 4H1ZA 3ITLA 3GXNA 2PC4A 3MSGA 3UP8A 1XC6A 2CEQA 3B9JB 2GGEA 1SUXA 4GUHA 3UG5A 1DKWA 3OLIA 4LVAA 1QW7A 3GBEA 3ERPA 1XQLA 3SRHA 3GXDA 3ZVHA 2WMGA 3F03K 3SN4A 3DGZA 1B1YA 3GXIA 2RH9A 3LU2A 1CXIA 3UXIA 3O6AA 4AEEA 3KOWA 3DKJA 5L6UA 4HOWA 3GVRA 4MUZA 1Q85A 3W74A 3CO4A 3VC5A 3GZ3A 4R7WA 3SEPA 1A5KC 4IG2A 4UUIA 2VNCA 4X9SA 2WNNA 3GG0A 4L4MA 3BGAA 4M29A 4NAEB 1CIUA 1N7KA 4GC4A 3APYA 1LLWA 3FYPA 3AWNA 4E8GA 1ZAHA 4H4SA 2XN0A 2GK1B 3UA3A 1UR8A 2CLIA 3H4XA 1OT1A 1TIMA 3HN3A 3DX5A 3PBUA 5I77A 2VR5A 3DENA 3U4AA 4J3WA 4H6RA 2WOQA 4EOUA 1QT1A 4S3BA 3IJ6A 2ZUNA 4HSHA 5HOSA 1EGMA 2VDHA 1VBRA 3K1GA 3RNDA 3N2CA 5J8LA 2HMCA 4DI9A 5LZLA 4Q4SA 1NFGA 2PDNA 2E9LA 2OOGA 3HU7A 3VD9A 4FO4A 3TC3A 3RFAA 3WJSA 1E71M 3SFWA 4PE8A 1WDPA 1VFFA 4GCXA 2FJUB 2F8QA 1XIBA 3NR0A 3W7GA 3L4TA 4GACA 1PYMA 4PRTA 3N4AA 1HKIA 1GTEA 3TEVA 3WCZA 2HNHA 3BLEA 3QHMA 3L9CA 1H41A 3TP4A 4LUYA 1JCMP 3H23A 4YWOA 4YTRA 4EPEC 1Z7AA 3N2TA 1QK2A 2CETA 2P50A 3TR2A 1KQYA 4WJEA 3VGDA 1LQ2A 2XN1A 3WD3A 4MB4A 5DBTA 4DN1A 3QJAA 2O9RA 2QNEA 5REQB 1HGWA 4GUIA 5FAGA 2EXOA 4Z2KA 4W93A 2J8GA 3R0DA 2D20A 4WXZA 3BUVA 1QJWA 2E40A 3GHTA 1ZB5A 4IXXA 3H7UA 4O28A 4R33A 2QZRA 4OECA 2XM2A 4DPPA 1VR6A 1XPYA 1JCJA 2VEPA 2XH7A 4X2PA 2UY5A 5DCEA 4OOZA 2RKXA 3PR2A 5LXEA 3IIXA 1E73M 3TN5A 4LYRA 3B0UX 1XGEA 1TJ0A 2GSEA 3W7IA 1BWCA 1Y8BA 1F76A 2Z25A 3QRHA 3MO4A 2VM8A 4KWUA 1UWQA 2OWWA 5IFTA 4UFIA 5TD4A 2NWSA 2G3JA 3U57A 2C1HA 4Q8MA 1VD6A 5LNWA 2YBVA 3GIQA 2WVVB 2EQ7A 3W1LA 4LH8A 5DMYA 3W4RA 1S5VA 4B9ZA 3WK0A 4JKLA 4QNWA 4IIGA 1FCUA 1WKEA 4FOKA 1H50A 2HCVA 4N7QA 4DPQA 4MMWA 2QEZA 3M9YA 2G3NA 4HNNA 2XH0A 1HX0A 1HP5A 4XAFA 3LHTA 4KW2A 4ZTXA 2E28A 5CSSA 2BSLA 3HQNA 4PUDA 1MUWA 2Z29A 1A3HA 1UR1A 5AYIA 4NJKA 2QGHA 1GESA 4OZOA 4S1FA 4GZJA 1ONWA 5CZTA 3AFBA 4UFMA 1RA5A 1TCDA 4HPHA 1ME8A 1SFTA 5JBDA 1V0LA 2EPNA 4F66A 1X7IA 2J24A 4PGLA 4TXEA 4LW7A 3HV8A 4LC6A 1M41A 4E4FA 4ALDA 5D03A 3KCLA 3N14A 4IMDA 4DVOA 1HZYA 1DWJM 4NX0A 3VI2A 3PC0A 3QGKC 3L67A 4F0HA 2WSRA 4LV4A 1O5KA 2VT0A 5FF7A 2XDFA 3AMCA 3CXOA 4DNAA 3AJXA 4JNMA 3K46A 2PA6A 2QJGA 2ZICA 5A94A 2Z6JA 3ATYA 2XISA 2BB0A 3JU2A 1A0EA 5JIPA 4FEZA 4WRHA 3RM8A 3ARUA 4JTRA 2DSWA 1TREA 3FVMA 3BMVA 3CK5A 4RE4A 3EA3A 4A21A 4Q8PA 5MF5A 3M7SA 1C8YA 1NELA 4Y8FA 4YHEA 4K68A 3RILA 4LY8A 1ZBKA 2FB2A 4Q4KA 1UBSA 2Y7EA 3W24A 3UCQA 4O10A 6REQA 3UG3A 3T2PA 1UUOA 1TKKA 4GVGA 1EP1A 4WDUA 5BRPA 2VFHA 3URHA 1YMYA 1QO2A 2WQPA 3PZQA 3SCWA 3E12A 1XLMA 4KPLA 1FXPA 3OIXA 4GRSA 4LAOA 2ZZ3A 1HKVA 1PKLA 1KCKA 1MUMA 4W8LA 4PMZA 1DPMA 1FEAA 5D04C 1XUUA 2WK2A 1SJDA 3T07A 1X39A 2CZEA 3EWBX 3PG8A 2Z7KA 1XLHA 2WHLA 1B90A 1MQRA 1F3XA 4A4AA 4HP5A 1ECEA 2VI0A 4X2RA 1KBIA 5C9ZA 1YDVA 2P3EA 3M16A 1TWIA 4LBSA 4M1RA 1B3YA 2GR3A 3VM5A 1KBBA 1LOLA 1RUSA 2Y8KA 2BY0A 1OX4A 1KM2A 1JAKA 3QC3A 2I5GA 3MKKA 4HYWA 2OT1A 1XBVA 5CJMA 1TX2A 1FECA 4XBSA 2DUXA 3VNJA 3LI1A 1H7WA 1Q2SA 1EF2A 4IPNB 3HPFA 3T4WA 3FIGA 2P0IA 3B05A 1VHNA 4IMEA 3VZXA 2J79A 2CLOA 1W3NA 3LM7A 2P53A 4UQCA 3H6OA 4D2JA 3RPDA 3DFQA 3GC4A 3EX4A 4QROA 1H3GA 3AI0A 4NIRA 5C0QA 5E6YA 3EB3A 5DEZA 4GXPA 1H5VA 1CXKA 3ES8A 2NQHA 4XZBA 3UXAA 3GO2A 3W6YA 1KTCA 1XLGA 3QMSA 2Q8ZA 3KE0A 3MSRA 1LRTA 3G1RA 1P1MA 1VLIA 2PGWA 4DRSA 1EL3A 2G97A 4G8TA 3VU2A 4ZE5A 1S3TC 4D1IA 4JIPA 1DTUA 2IKHA 5FJTA 7CGTA 3A3HA 4CN4A 4K7VA 1W9PA 4QE1A 1XCWA 2EKCA 1Q1RA 4YTSA 1Z89A 3QVQA 3MHFA 2QUMA 4EXAA 4YL2A 4NNAA 2OTDA 2QXWA 1CCWB 4XO7A 4PTWA 4PTMA 1ZBCA 1GVOA 1E1FA 1KTBA 2UY4A 2REQB 2YOCA 3Q67A 1BXNA 4PUNA 8A3HA 1NWRA 4Z2JA 1Q8AA 2XTKA 4KEZA 3K4WA 5FSEC 2Q01A 3WLSA 4OKDA 3N9SA 2IPGA 4DNMA 3WD4A 5DLCA 2GUUA 3QGVA 5T9BG 1N61C 3WQEA 3GDRA 4CQDA 4QXIA 1EUNA 3QV7A 3NSMA 2NUYA 1CX9A 3NCOA 7TIMA 1MNZA 4XAGA 5HANA 1T8XA 4AVNA 3UVAA 3N19B 5KSWA 3JZEA 3SO7A 1H7RA 3SSZA 1XP3A 4NX5A 1FWHC 1V3LA 4V28A 4XG1A 5D2XA 5DX7A 2XZ9A 4DJFA 4ADWA 3SQSA 2ODOA 1Q3NA 2JKEA 1FWGC 3LCHA 3UU0A 3WLNA 3WFLA 3G0UA 5D33A 3U6WA 3B0YA 4D6FA 2X8HA 3G8EA 3ABRA 4TX6A 4H4VA 3QTPA 4Y8EA 4IL0A 2PF8A 1E6PA 3MW7A 4ZQNA 1HKWA 1FVPA 3S83A 3CZLA 4JX5A 1WE5A 4H9ZA 4ZENA 4MPQA 3U48A 3PP7A 1KGXA 4R85A 2AOSA 2VD9A 5F2MA 3FV9A 2QVHA 4DUXA 1J0KA 4LOCA 3W29A 3CYJA 3UNDA 2I1OA 1RSCA 2XIJA 4BHYA 4DJEC 4GLEA 2A79A 3FDKA 3UJ2A 3GUGA 1EEXA 2ZIDA 3SRKA 5FF0A 1IEWA 1G67A 4KFNA 2DH3A 3R58A 3HO8A 4UFJA 4JL2A 4GWEA 1ITCA 4Z17A 3SCRA 3QOMA 1GG1A 1M04A 3P82A 2PURA 4KF1A 3GW0A 2C6QA 1XIMA 3VZZA 4GI8A 1BGAA 1DQWA 3BGJA 1FWSA 1K6AA 5LNUA 2D73A 4K3ZA 3UPMA 1TYPA 3T09A 5AHEA 1PE1A 4XIMA 4AC1X 2BHYA 1Q2RA 4LUSB 3S1XA 4HMEA 3OOQA 4XIAA 4ZO7A 1BYAA 4WKFA 1FWNA 3T55A 1E43A 4JHOA 4LU0A 1WAUA 4UC5A 2W3ZA 1DL3A 4G7EB 4KWOA 4QS6A 3BL3A 4IFOA 1Q13A 3W88A 2XN2A 4QS5A 4YTQA 1OCQA 3HPAA 1ZJBA 3GNNA 4KBXA 2OSWA 3R25A 1JXJA 2Q02A 2E77A 4L1WA 3KAOA 3VOIA 1EC7A 2A3CA 2HE5A 4R5EA 3UFYA 1XYFA 1V6VA 1L0PA 4ADTA 3MP5A 4PMNA 4Q8VA 1SR0A 3VNKA 1NHPA 1S2TA 4DUVA 2ZE3A 3TYUA 2V8ZA 1OF8A 2D2OA 1Q1WA 4UZSA 1V02A 3POHA 3VTRA 4ZOCA 3OEXA 3GG7A 1EA0A 4C6EA 1KXHA 3AS0A 3ITCA 2YXXA 2EPOA 2XSXA 4HU4A 1F7BA 5CZJA 1Q6OA 2OX4A 4AIOA 4L64A 3ITGA 1GOQA 3NQMA 3VCRA 5AECA 2NX9A 4ICNA 1ZRQA 1OGGA 3MMUA 3N2XA 5AYYA 2WPFA 4HA0A 3IAPA 2J7FA 2X2GA 3R07C 3BE7A 3TWBA 3N3MA 4GD0A 2SFPA 3VXGA 3GVVA 5DANA 4PMDA 1EQPA 3PBGA 2QT3A 1XYBA 4OHQA 3CV2A 3QLDA 2ZVIA 3BURA 1AZ1A 1UD5A 1ZX9A 1BFNA 1JF5A 4W84A 4ZB2A 2PGFA 4YHGA 4N9CA 3M47A 3OVGA 1JPDX 2DZPA 4OQVA 4LCSA 3ABZA 1KO0A 3SY5A 4YXGA 5HJYA 4OJYA 3RNMA 4NYYA 1N62C 2VYOA 1GJUA 3BG3A 1E1EA 3LRKA 4LQ1A 1XYMA 3THQA 1KBLA 2XHYA 1ZY9A 3VIJA 1UWAA 4PA8A 5LIWX 1YBQA 4DBEA 3L7RA 2OQLA 3R2GA 2OJPA 1VQZA 1LP6A 2GVGA 2OZ8A 1F4AA 4QAWA 5A6SA 2NX1A 4JX6A 2VEGA 3ZVIA 4BFAA 3SGUA 3RX3A 5FS6A 4UQ9A 2H8ZA 2P76A 4PUUA 3WH7A 3R12A 1A5MC 1X1ZA 2WM0A 1Q5MA 2JBMA 2OU4A 4JS3A 1K4GA 3QFWA 2WPGA 3CXBA 1OQFA 5CG0A 1CYGA 2WP5A 1J0HA 1LWIA 4GNKB 2XINA 1NWTA 4AWEA 4FB7A 1JCTA 3SUVA 4XB3A 1HJXA 1A5LC 4GVHA 1CNVA 1US3A 4FR6A 3AZRA 3LYEA 4G1KA 2GJLA 3TU9A 5AYZA 3UPWA 5D09A 3C8NA 3RX4A 2D22A 3M0JA 3BAWA 1TJRA 1JJKA 4HK6A 4GIRA 1R7OA 3PPCA 3QXBA 4QQ3A 1DJNA 4HZ8A 2GDQA 4GKLA 3K2GA 3ARWA 3MBDA 2CLEA 4BQ3A 2JIEA 3CB3A 3HURA 3OGRA 3VGHA 4XD4A 3LEPA 4IIHA 2V3GA 3KDOA 3B8IA 1RALA 1V02E 3PVFA 4FK9A 2R24A 1XDMA 1H1NA 1YNYA 4JD4A 4RK8A 3PNUA 2OODA 4DXXA 3AN1A 1GK8A 2AMXA 1MEWA 1EO5A 1ZP3A 1XLCA 2ZZ4A 1XIGA 2Y0FA 1L6SA 4CNTA 4E2DA 4B9YA 3GC5A 1AMKA 2HQMA 2HVMA 4PCTA 4MHBA 1UKOA 4TIMA 1EBDA 2CLFA 3AU2A 3RU8X 4KCTA 3O07A 3DYPA 3N04A 5EFFA 4CQBA 2GJXB 1ZQ5A 2GVEA 2WMIB 1JDDA 3VK5A 5EB8A 1UC5A 4ZXLA 3HGOA 2BOEX 1HJUA 5BWAA 2O4MA 1GQIA 1EJWC 2FFCA 5HXMA 2JE8A 2AL2A 1WBJA 3F4NA 1U1UA 1GRAA 4U28A 3SSJA 1BF2A 1XIHA 1GV4A 2X2YA 4GGBA 1T0OA 1TWDA 1F8WA 3DYMA 1DHPA 2FTPA 2FB3A 3ZMRA 3CUJA 2FJKA 2V30A 1U2YA 1OT2A 5BWFA 4XZHA 2DZWA 3OZYA 2YA0A 3C2OA 4PTDA 1SYTA 3AICA 4HB7A 1FWCC 5KZDA 4RNHA 2QCGA 2PF0A 2DSKA 1VENA 2VZUA 2YKKA 1QPRA 3PUEA 1BXCA 3TNOA 3CLWA 4KESA 5CQ1A 2X16A 5AC7A 3A24A 4QG8A 4FNSA 4NAEA 1JULA 3DK9A 4MF4A 2D2GA 1TRIA 3LV5A 1SB3B 1U33A 2VZVA 4B2DD 2QS8A 3H8AA 3HMCA 1J6OA 1Z8AA 7REQA 5M1TA 4J3ZA 1X1OA 4EF8A 4GJJA 3WNPA 1VC4A 3EB4A 2FZ9A 2G41A 1H1ZA 4TVUA 1S2UA 4N2YA 2A6LA 3WMLA 1VIZA 4XVEA 2DSUA 4D8AA 1MSSA 3IIOA 4EF9A 3G5EA 5ABEA 2ZX6A 1JPHA 1VCVA 1FY6A 3KLLA 2F6XA 1E3ZA 3WZ0E 2I5QA 2W63A 2YL8A 2NVAA 3C86A 1A4LA 1LL7A 3FKKA 3LPFA 3MMDA 3BAJA 4IFRA 3VKCA 1D8CA 2PFHA 5GPRA 3GWQA 3ZLFA 3NQBA 1QOPA 3ZR6A 2TYSA 4WJ8A 1R2SA 3UZ5A 4J3XA 5E9AA 4H4IA 4GHRA 1YKWA 1EHAA 3NTYA 2J7HA 3IARA 4HD5A 4W7VA 3NA8A 5LA1A 3NO1A 1ICPA 5REQA 1R38A 2INZA 1R87A 1X2GA 3KP0A 1C93A 2YCKX 5EYWA 4NSBA 2G8ZA 4O52A 1R5YA 2ASHA 3NQ2A 1MQQA 2C3DA 1SVDA 3MI2A 2A3HA 1F4HA 3A22A 4LRSA 5D05A 2BOGX 3NAVA 4V33A 4H4ZA 2HEJA 3EWUA 1B3XA 2GQ3A 3PBMA 4RW3A 1GZGA 3B8VA 1AD1A 3LPGA 4IPIA 1VGAA 3WD2A 3RLHA 5I06A 1J9YA 2R1KA 3FJ4A 5D9PA 1CBGA 1BKSA 3VD7A 2QCCA 3PBVA 1TUXA 3T9PA 2WZTA 3W7EA 1RA0A 3WK2A 2Z7GA 2CNCA 1ALDA 4GR1A 2PWUA 1RM6B 2D1ZA 1OD0A 1UASA 2WVVA 2FH8A 3C3NA 1WXJA 2GWGA 3V18A 4YS1A 1FXQA 3A9BA 3OLGA 4BWLA 2D69A 2BASA 2VKZG 3WJZA 3FDGA 4HA3A 2AAMA 4E0CA 1W1YA 1GEHA 1W1PA 3VKBA 4DX3A 2E5DA 4NZ3A 2PWVA 3N2MA 3U2CA 3DHFA 3A12A 1GQJA 4PL1A 3LLFA 4H6QA 2XH4A 4J3UA 3MHUA 1GVSA 3W37A 4ZB5A 2GJNA 1EUAA 2YL9A 5AHNA 2CXGA 1FHLA 4GKTA 1IXPA 1E9YB 4S3EA 4K6AA 1ZJAA 1E6SM 5AY7A 2GQWA 3NOYA 3MDWA 3RYSA 1CGUA 4EPKA 3FOKA 1GNXA 1F6KA 3WG6A 2J6XA 1Y5VA 1CW2A 3OVPA 4YN5A 4I5RA 3URQA 5CEWA 4L65A 2NVDA 1UJQA 5FS7A 2MANA 1ENUA 1QNSA 3M5XA 1I9CB 3W7RA 2DZSA 3LTPA 1YPXA 3ZS4A 3FJ6A 1U30A 3B9AA 4IIDA 1CT5A 4IJBA 3W1UA 1CGTA 2JEPA 4NI8A 3CQIA 1WDDA 2PGEA 3WSUA 2VWTA 2GH5A 1NH6A 5XINA 1RQBA 4W8BA 4KWVA 1UW9A 3WNNA 4UR9A 1CLXA 3VIGA 2A7PA 2XZ7A 2J25A 4Q7BA 2H6RA 4GK8A 1G9HA 4O14A 2Y63A 2CWXA 2WO5A 3GU1A 3UY8A 1VIWA 4LX4A 3MDUA 3STPA 4EMWA 4P8XA 2VFFA 1VB9A 2V69A 3TSMA 3MYOA 4GIYA 2Z28A 4PUWA 1U1HA 1VFOA 3M43A 3I6TA 4JFTA 1WO2A 3PBWA 1IGWA 3N25A 1R85A 2W5FA 2ZZ1A 1FUYA 3KZPA 3NZQA 4DJFC 2XVNA 1Q7MA 1SM9A 1EO7A 3HMJG 4FPSA 3LNMA 3WH6A 5AZ1A 1MEIA 3UEQA 2X8RA 3QM3A 3HG4A 3A7RA 4EM4A 2OO0A 3WQWA 2V63A 2I7GA 3GR7A 4ERGA 4FNPA 1B2YA 1SJBA 1CEOA 4S39A 2FGZA 3QHOA 4O12A 3W26A 3B9EA 4GX8A 2IKIA 1UCWA 2DH2A 4QBXA 3NZ1A 2XVKA 3I6EA 1VJZA 2A0NA 3FYYA 4LF2A 5HJLA 2GDVA 2WXDM 2WMKA 3VDCA 2DVTA 4JPGA 4AX6A 2W79A 1KKRA 4G56A 2GVYA 4WY0B 1PAMA 4O0QA 2ZUSA 3P0WA 1Q7ZA 2AKZA 4YCOA 2PCQA 4UTMA 1LOSA 2CIPA 6TAAA 5I3IA 4Q8WA 1EKOA 4M80A 1RZMA 4S23A 2PD5A 4J2PA 3R0KA 5JH1A 2BX7A 2FIQA 1PHQA 3UG8A 2INEA 2ZX5A 3P61A 5C71A 4KWWA 4C6PA 3KVJA 2GR2A 3BAKA 3NIYA 4BF7A 4DNHA 3W75A 3WLMA 2OLHA 1OC7A 1V6TA 4XZ9A 1RQHA 3ETRB 5FD0A 4P8WA 2I9UA 1LDCA 2VGGA 2AGKA 1ONRA 4DELA 3EMCA 2ACQA 2VFDA 1RPXA 1KM1A 5AFDA 4XBKA 3BG5A 3TFCA 3CU2A 1IIHA 3E9AA 4RDWA 5EMMA 3AU6A 1YTEA 3M0HA 2WP6A 3TYCA 4C5YA 4Q4QA 1MDRA 5JQ9A 1CDGA 3WD1A 1LL6A 3L0NA 3W23A 2DSZA 1ZHAA 1UA7A 4CNUA 3OQ8A 4LVDA 3WQVA 5MKGB 3K4AA 1G7UA 4FNUA 4AIEA 2E3TA 2QCHA 1H61A 3TAKA 1R0MA 4H8VA 1XIEA 3DI0A 4KQNA 3AYSA 3NQGA 1DTNA 4IIFA 5K4ZA 3GU2A 4TMCA 1ESWA 2Y2WA 2ZUTA 3NVTA 4A8LA 3VIMA 3DI1A 3CZGA 5C55A 3WMSA 4UR8A 1A50A 2REQA 2J74A 2IPJA 2OXNA 5DMNA 3N6JA 3W76A 2CDUA 1OF6A 2J3NA 1YXDA 2RDWA 3C2YA 3PM6A 5FA5A 1OIMA 1CXHA 4E3VA 3D46A 2WHMA 5LHFA 1XUZA 4F2BA 3BAYA 3SFKA 3WX7A 4J27A 3CHCA 3SUWA 1J93A 5L9FA 1DWHM 3UR7A 4F2TA 4UTJA 1IIGA 1I0BA 3LQGA 4HNOA 2QYGA 2NVKX 4GVFA 4Q6JA 1NEYA 3LXDA 3IJIA 2ZZ6A 1MFVA 6A3HA 4L4OA 3LHVA 3UXDA 5FJIA 2DIEA 1Q6DA 3QZAA 4KCWA 1X97A 1HJSA 5CPOA 4OTKA 4LV9A 1LF1A 4WJXA 1R9YA 4IMAA 4PSRA 2PDKA 3VABA 4YWIA 5CLWA 1LT8A 3ITYA 3ARTA 3TQ0A 1YDYA 4BEQA 5DMMA 1W9UA 1N8WA 2FZBA 2F6KA 4IP7A 1KM4A 3VDGA 3NQEA 3OHIA 3GBDA 4IIBA 4MFEA 1N8IA 4BZYA 3VZYA 2OWXA 4PMXA 1LG2A 5JCIA 2TSYA 4QR6A 2UY3A 3L2IA 1GOXA 2ZADA 2J9XA 5K3VA 1V5XA 5DY2A 4MDOA 3MC5A 1PHWA 3EDEA 3GXMA 1QR7A 4ROQA 5HBFA 3S5OA 4CD7A 2ZDSA 3V0SA 3MSDA 4P61A 2XIIA 4UTIA 4LAZA 2ZZ2A 1ISZA 4YU1A 4EPDC 3MJYA 3APGA 4JTUA 1M68A 5D9OA 4RV8A 4F0KA 2ZBTA 5H8MA 2WZMA 4CQ9A 4C6LA 1H7NA 3UWZA 3SQMA 5FF2A 1TA3B 1W2PA 1AFSA 4LUSA 1R47A 3ZIZA 3A5FA 5GVJA 2CITA 1R86A 4B3ZA 1J0JA 1NJJA 4A35A 4EXQA 3TJXA 4BF5A 2POTA 5K2ZA 3E96A 2JGQA 5KTLA 4NYUA 4M51A 1DP0A 1DWGM 5G1YA 5IHRA 4R9OA 4B4FA 2FPTA 5H6HA 3A7AA 3UJEA 1DIEA 3E6EA 2VC5A 4Y9PA 4IP4A 3HG3A 1XINA 3BLFA 3O3RA 5XIMA 3ZM8A 1NIUA 1QNVA 3TOYA 1MFUA 4MKNA 3PZTA 3CQ0A 3TX9A 3A6OA 1S5WA 3E5PA 4AXKA 1W3IA 3W7LA 1XDLA 1VFTA 2E7FA 4PULA 1RBLA 1BLIA 3A9IA 3NZRA 3DERA 2ADAA 4H7CA 1JDCA 5FF3A 1K9DA 4OT7A 4MY1A 3MCMA 1IXQA 3NWRA 1GKRA 4AAJA 1UR2A 3EOOA 1ADOA 1OZQA 2X1UA 4IPLA 1CENA 3W1RA 3FHAA 1HP4A 4JYDA 2G95A 4PEKA 1ONFA 2VD8A 1OHLA 1HVQA 4DO7A 1RY0A 4Q8QA 2DPEA 1TMHA 2X41A 3W7HA 4RE3A 1KNWA 4NJGA 3F5LA 5JXQA 5G4HC 6PTDA 2J7CA 2VFEA 2WQDA 1H2IA 2YZRA 1FWJC 2PZ0A 4G1NA 4I7UA 2YW3A 3B9DA 1GZJA 3PJWA 3APTA 4D1JA 1TYTA 1JFHA 1CLKA 1GUVA 1F6YA 4N9EA 2QJIA 3GXTA 4M5PA 3EDFA 1DVJA 3AIRA 4H9UA 5C9WA 1WCGA 2CKSA 1KFCA 2V2CA 1VPYA 2W66A 2ZE0A 1E5JA 3WNOA 3KS6A 1Q6RA 3SCOA 2WKJA 3TJ4A 1CTNA 2WZHA 3KHJA 3HJEA 4C7FA 2VR2A 2V0TA 4JEJA 1RLCL 1AW2A 3QBUA 4LFYA 4CLMA 2Z6IA 1VZWA 4W86A 1R2RA 2CBUA 1BSIA 3SGGA 1Q45A 1RJQA 4NI3A 5FOOA 1EF3A 3FFSA 2BLEA 1EZ2A 1V7YA 4F4RA 2QPUA 3U2EA 3H24A 1MO9A 2P1FA 3FA5A 1Q66A 3WUGA 5FI8A 3ZT6A 4MB5A 5FJJA 5DF0A 1IGSA 3LCLA 3AIBA 1UB3A 3RCMA 1J2WA 1G4PA 2R14A 3L4VA 2JK6A 1HUVA 3SR7A 1ZJIA 1JZ7A 4IQDA 1T96A 3KOXA 4H4PA 3GFXA 2IKGA 4YTUA 2HS8A 5XIAA 1UOZA 1XQKA 1OY0A 1GOIA 4WGHA 3TW7A 5G5GB 4W5UA 2VX5A 4FNQA 4FMVA 1P0KA 3W6LA 1E9LA 3GH5A 3NXFA 2PD9A 3BLKA 4Q32A 1OJXA 3N15A 3CTLA 3D0CA 4L80A 1R30A 5HR6A 2QW5A 3BH4A 2GLKA 2FYMA 4QLJA 3H21A 5CPSA 3VA8A 2BXYA 3LLXA 1K9EA 2OSXA 4LRTA 4CD4A 4UTTA 4B16A 3OVRA 1EPXA 1W5PA 3LK6A 1A3XA 4XSMA 3E0VA 4FNTA 6TIMA 4IMCA 2VENA 2OFJA 3RJYA 2E67A 2WPBA 1IZCA 1US0A 2AMGA 4GI6A 3M4HA 4D6CA 4UOZA 1S46A 2VDIA 2AQVA 5I3FA 4HOXA 2GJXA 2JALA 1VLWA 2WMIA 5JCNA 2OZTA 4ILSA 3IANA 1WZAA 3P0XA 3KWSA 4HK7A 3IVTA 2V3FA 2NX3A 2XSAA 2P8BA 1VH7A 1O7AA 4AHPA 1A80A 5G2IA 1MVYA 1T7LA 3ZJ6A 4XZNX 1NAL1 1GKQA 4K1WA 3K8MA 3GFZA 3LXBA 1FEBA 1N2VA 1UPPA 3NEVA 2QJJA 2WHKA 1HJWA 1ZNNA 3LTSA 4NJHA 1BVZA 4M6VA 4M8UA 4XK2A 3VOJA 1L6FA 1W31A 4R3UA 1SSGA 3LCFA 5HWJA 2PBOA 2GUBA 1IR2A 1XDIA 2PWFA 1BYDA 4NU7A 5HNRA 1WKYA 3L2LA 3OBKA 3ZOAA 4DJDA 3L0GA 4AYGA 4RX0A 3O05A 3OYXA 3ARSA 1NU5A 5AN7A 1R46A 1QNOA 5CAHA 2DUAA 3VOFA 3AHTA 3VD3A 1QOXA 1HF6A 2B0MA 2Z27A 3OGVA 3PFRA 3DJJA 3BAIA 3DFNA 2VCCA 2CU0A 5HPCA 2ISSA 2XIMA 1H60A 2Q8LA 4KGLA 1O12A 1WPCA 3VGGA 1PKNA 3GHSA 1QNPA 3PTQA 4RNFA 5AYXA 3SQPA 1IHIA 1E4MM 3W71A 4LGXA 1XLIA 2ZXDA 5MHBA 3IC9A 2Y8VA 1S2CA 1ZP4A 5CBBA 4TTGA 1U1JA 1J6PA 4UNIA 3ZLGA 4G2DA 1W1B1 3H26A 3HG5A 1NFBA 4AQLA 1E6ZA 4XAPA 5CXPA 1R7AA 5D2WA 2QQ6A 4JFWA 4CCDA 3AMKA 9XIMA 1QNRA 1P7TB 1QI4A 1TPB1 2FHFA 5A8GA 1PPIA 3KX6A 5D4YA 1UJPA 4XUGA 1M53A 2GRTA 3KOZA 4BK9A 3LNPA 1GQNA 3BCFA 2W67A 4E8CA 3G1DA 3MANA 3WBXA 3EGJA 1GZ1A 5LIUX 3B03A 1SQ7A 2WV8A 4JNZA 2FDMA 2VX7A 3BJTA 3DFSA 3QSTA 3WQ6A 4IGHA 2DVXA 3BO9A 4LANA 1XGDA 5A6TC 4A3QA 4JCMA 3UWYA 3F4WA 4I6VA 3EWXA 3UZWA 5ECVA 4CQAA 3U7BA 5F4XA 5I79A 4C6NA 1ZJHA 4KMQA 2BS9A 1K9TA 4H9YA 3GG1A 5D30A 2YGYA 3IUHA 5U4NA 4C1LA 3IJLA 4W8AA 5U25A 1ITQA 4LUIA 2A4AA 1TELA 2PWEA 1W5NA 1DIDA 3VILA 3S1WA 3CYVA 2R82A 3DHPA 3KL3A 3TLLA 1QFEA 4DO5A 3EKLA 3HJZA 3S6TA 3CT2A 1A5SA 1EYEA 2I9EA 3P60A 3NDYA 3CEUA 4XAZA 3OVQA 3S1VA 2V5DA 6ENLA 4ZXOA 4EACA 5EMLA 5HK4A 2C14A 1YNQA 3KTXA 4PR4A 5PTDA 5E5CA 1TE6A 3W70A 1GWJA 3UYCA 3ARXA 4A2SA 3A3XA 4DBSA 1FWBC 3PPFA 3CS2A 2ZZBA 2QKFA 4RJEA 2QPXA 1HFBA 1W3LA 9RUBA 2C0HA 4K7YA 4LNCA 1H6VA 1QHZA 2A6NA 3TR9A 1ZLPA 3VCCA 3G1VA 3LERA 4M7SA 2EPMX 4K7ZA 4QDMA 1VEOA 3EWWA 2NW0A 1OYBA 3WEMA 4ICMA 4LAKA 1KV5A 4QITA 4ZQPA 1YNPA 3EAUA 4JTIA 1NY1A 1M6IA 3GVQA 1P0BA 1WB0A 1MQPA 2PDMA 5EBAA 5A69A 5GQBA 1TQJA 3ZR4A 2VUNA 1B5TA 4H4WA 1EQCA 3ME3A 3SY8A 3B40A 1OK6A 3GTNA 3NZGA 3HBLA 4JTQA 4XZIA 1J2BA 1BEUA 1P0NA 3UETA 1G01A 4OU1A 1NFPA 4TO8A 3WNLA 3HPZA 3TE9A 1OCNA 4BQ2A 3WDRA 1S2VA 1KCXA 1SO3A 1ZPTA 2GSHA 4HMNA 1DEDA 1CZ1A 1VF8A 2PDBA 4K8HA 3VOHA 4HCLA 2ZUMA 2E9MA 3E3HA 3UCDA 1LUCA 1FDZA 4AVFA 1XRTA 4ECLA 3GKFA 4AMAA 3SM0A 4O0KA 3ALFA 2DT1A 3RLUA 2ZXQA 3FHQA 4UFHA 3QN3A 4H8HA 1W8SA 5AZ0A 5LSMA 1XIJA 2BG5A 4C6MA 1TYGA 1S39A 3I65A 4MNLA 3AOFA 2A21A 3L5LA 4IISA 1E4IA 1JRBA 4H4XA 1I4NA 2I14A 3WK1A 2E6AA 1RD5A 3WQ4A 4IUOA 4V15A 5DCBA 5LYRA 3QPYA 1S5TA 4JYEA 3IJDA 4GISA 1BWLA 3R79A 1EZWA 4WIWA 2VMFA 3W01A 4Q22A 2PDLA 1OBAA 2PRHA 5T26A 1UMLA 4Z2HA 3B97A 3CUXA 2FZMA 3NEHA 5JBFA 5C2XA 3DEQA 3TN3A 1W32A 2WB5A 2OYKA 4XD3A 3QYQA 1KGWA 2WCAA 2VZTA 3FA3A 4HKPA 2BC0A 3LCIA 5GJMA 1RVKA 2PEVA 5CC5A 4Q4OA 4UCFA 4MB3A 3ABSA 3FS2A 3KRBA 4CCZA 4Q8NA 4FALA 4MNKA 5G2HA 1PZ3A 3MT1A 3ZSTA 4F48A 2OGJA 4KCVA 4PFHA 1REQB 3E0LA 1JUEA 1M7JA 5CPNA 4FI4A 1E9ZB 3EXTA 1SMDA 3QW3A 1K4QA 3WLLA 1TX0A 4AY1A 4US5D 3VDHA 4WLCA 1VRDA 4DUOA 1LQ0A 4PCSA 2GSJA 2NQ9A 5EY5A 1HO1A 3SCNA 2BBFA 3Q2DA 5A2BA 1LJYA 2F6UA 3CASA 2J78A 1DYSA 2GGJA 1GKPA 1I1WA 3T44A 2JGYA 2YX0A 4LAMA 3W1PA 1H7OA 5A8NA 2BMBA 4HJWA 4AEFA 4Z0SA 3UWEA 3ATZA 2PTDA 2O9TA 3UZYA 5J5DA 3ZZ1A 3MU7A 2BP1A 4XX6A 5E0FA 3AS3A 1PS9A 1ITXA 1CGVA 5I3GA 5C70A 1TZZA 3KP1A 4B92A 5F2LA 1I0DA 4MPKA 3IIPA 1F3TA 3PWAA 3G1FA 4DY1A 4PC8A 1KM3A 1XRFA 1BF6A 1ZUAX 2ZXBA 3HM7A 5CPQA 3DUGA 4O8RA 2ZRYA 1L8PA 3M44A 1KD0A 3WF2A 4A6GA 3T2QA 1BKHA 4KRZA 1CGWA 4GZIA 1PKYA 1KM6A 2B81A 2QAPA 1LBLA 4XAYA 3N6HA 2CLKA 4A05A 1R6WA 7TAAA 5KZ6A 4D6GA 2YYUA 5HINA 1XD0A 4CVUA 3EOUA 4F79A 3H7VA 1W3KA 1A0CA 3O8AA 4KETA 3TQKA 1LBMA 1EWEA 2YB4A 3BLPX 2WSQA 4NKCA 1TCMA 3LI0A 3S5SA 5EBKA 5HNNA 3CHDA 1VCFA 1PV8A 4F3HA 1XV8A 4B5NA 4GJ1A 1JVNA 1BSLA 2YXOA 2QDEA 3FEQA 1G4TA 4E5TA 5AVNA 3WH8A 4FX7A 4JHMA 4BF9A 4AW7A 1HG3A 4RZ5A 2GQ8A 3M46A 4CU7A 4JYFA 3VOCA 1F8IA 3GD6A 3UWQA 2F7FA 1PVNA 2QF7A 2QIWA 3FGCB 5BCAA 3S1GA 4X3ZA 4FXSA 2PC8A 4JIQA 4OV9A 4QJ3B 1RBOB 1JI2A 1FH7A 3AJ7A 4Z2LA 3M07A 4M52A 3N73A 3GY1A 2JF7A 3PF3A 1OFAA 4Z1YA 3TYDA 1UR0A 1D7FA 2QAFA 2Y70A 1RBAA 1W2VA 3LZ5A 3BV7A 1W56A 2HQAA 3DDMA 3G1HA 3HFYA 4PL2A 2R8WA 2XPKA 4MLJA 3UWWA 4GIAA 2A5HA 2OKTA 1EDTA 1TE1A 3W81A 3MPGA 4PBEA 1E9IA 4JTJA 5GRTA 3QV6A 3NQ7A 3CUZA 1RVGA 2WKLA 4GMEA 4JQ3A 4D6IA 4YYCA 3AQUA 5CH9A 4MZ1A 1F05A 1FDYA 4LF1A 1C8VA 2QIIA 3MUY1 4IFKA 3E2RA 1JNEA 4HIBA 4ZA0A 3UCCA 1CLVA 3L21A 1KWKA 3WUEA 4NEWA 3WD0A 3VUSA 1JCYA 2V67A 4QRNA 3CGDA 3JZUA 1BZLA 4UWMA 3O6YX 1W37A 3Q45A 4AUBA 1QTWA 3TW9A 3TC6A 4H9TA 4M82A 3VVGA 2NXIA 1MW3A 2DZAA 2XG9A 2NUXA 1TR9A 3LMYA 1VEMA 4IQLA 1E0VA 3WY1A 3SJNA 3M0VA 3CIXA 3WQ8A 4D9PA 1O94A 4UMBA 2DU2A 1OG6A 1F2JA 3P80A 5A6KA 4TX9A 1PX3A 1SZGA 3DJGX 4B5WA 2FVKA 3LRLA 3L65A 3R89A 1TA3A 2WSPA 3NYDA 4UBPC 4Z1AA 4JN6A 3UXKA 2X7WA 1S2AA 2X7VA 2L5HA 2V3EA 1I6NA 3BVJA 3WK3A 2V68A 3IIZA 2O9OA 2VCAA 3PZIA 3K13A 2DIJA 3S9ZA 4I90A 4Q7IA 2OYLA 3VFLA 4UQBA 1YYAA 3DG7A 3EA2A 1Q4WA 3R5EA 4FHAA 4BV6A 3T4CA 1NHSA 4DWSD 4Y9OA 4BI6A 3AALA 3DKLA 1MXDA 1HKMA 2R94A 4PTXA 2HXTA 2BXZA 1BYBA 3M41A 1XXXA 4H2HA 4NASA 2ZX9A 4H6KA 1S5NA 3DH7A 1V0MA 4AX7A 5JCKA 4FR1A 1GYMA 3UYIA 1TRDA 4C60A 1NPXA 1UMYA 3PTMA 3BZJA 3EOEA 4ORMA 5IM51 4J57A 1UG6A 3DU0A 4JTSA 4TTUA 4PFMA 2G0WA 3EXSA 2YFOA 2CZ5A 3SCVA 3H4GA 4LNYA 3M0KA 4LBRA 1GONA 3ZJ7A 1IWPA 1PZ0A 3PS7A 3HW2A 1M6JA 3S2MA 5I78A 3M7WA 3VNZA 4MWAE 5G2WA 3UESA 1KFLA 2VL4A 4LCRA 3KTCA 1PL9A 3O15A 3DHUA 4D6EA 3HQOA 1W5QA 4HNCA 4AY7A 1R3WA 2A2IA 1UYQA 3CPGA 2A3AA 1P6BA 3DCPA 3BK0A 1TV2A 2QCMA 1WOBA 4KPRA 5DXXA 2OKOA 1GVRA 1TPFA 3H4WA 2WNZA 1F8MA 1K6WA 4HMCA 3M6DA 1AH3A 4GX9A 3LCXA 3RM4A 3WMBA 4HA1A 5I23A 1ISVA 4FAMA 1XLAA 1Z6KA 4NZCA 4RLIA 2IQ0A 3NOEA 5D9NA 3VINA 1KXTA 4DLFA 6CGTA 2J7EA 2V5KA 3CV6A 4KEMA 2MUCA 3KL0A 4RDZA 4FXFA 3WQGA 1W3TA 4IJCA 5FESA 4WCJA 1SGJA 3P67A 1F07A 2WHJA 3UR8A 1KFJA 4RZ6A 4ZVJA 2HS6A 3BICA 1AG1O 3AHXA 4GGHA 5CBIA 1DBTA 1CXLA 4CU8A 1YRRA 4J9JA 5HDRA 1D3CA 1E51A 4Y90A 5FEZA 1EIXA 2Q71A 2VVSA 3B8SA 4N42A 4BURA 1J0IA 1BD0A 3PG6A 4LEQA 2EJAA 3R0UA 4GBUA 2F61A 3OYZA 2C18A 1PBGA 2FH6A 3NO3A 4EQRA 4J40A 1Q4NX 3R1ZA 4XBJA 1JCLA 4DHGA 4XKMA 3NVWB 1GW1A 1QHOA 4MWAD 3UWVA 3WF4A 1AK5A 1P5BA 2PS2A 4Q8TA 5AVHA 4M24A 3N4FA 2RDUA 1DORA 2EO7A 3VNYA 5AKQA 1IF2A 1OC5A 1KR1A 4CNPA 3PWIA 1O66A 3SECA 3WLPA 4GH3A 3I3BA 1TPVA 2G3MA 4R88A 3W07A 2R9RA 2GGHA 5T9CE 1ISXA 1E55A 1N5XA 4JDBA 3SJ3A 2ZZCA 4O16A 4PTVA 4GYKA 2GOUA 1ZBVA 3G1SA 4ML4A 3OHMB 4N4QA 3S42A 2ZRZA 4O1BA 2CHRA 1UD3A 3OQEA 1DWIM 2VXNA 4ZBCA 1UIPA 3WLQA 3QZ6A 1FQ0A 4O8AA 1W5MA 2E6YA 3EEGA 3KBVA 1EJTC 1JQVA 3H2AA 5LA2A 3N2BA 2QCEA 1DJWA 2C3CA 1C9DA 4B3LA 1VFHA 3KTSA 5HMEA 1QMLA 4C6QA 2RAGA 4MJMA 3EOSA 4YCPA 5AC4A 1W8GA 4L9ZA 2PTWA 2Y5JA 3NDZA 1FBAA 3GH7A 1UWIA 3FXYA 5I6SA 2EJ1A 3IJ9A 3VGBA 4PODA 1OJTA 2XH2A 5DT5A 1MOKA 3IGUA 3WJYA 3JS3A 5EPDA 1KXVA 4JBRA 1OIFA 4ZO8A 1YADA 5TIMA 2A85A 3EWZA 1HKJA 2DQXA 3V75A 2Z2BA 3UY7A 3URBA 3CT7A 4RW5A 2JEQA 2J9ZA 4ICCX 3BLDA 4KCUA 2HROA 4MUPA 3TK7A 1EX1A 2FLIA 1GGOA 3R10A 1DIKA 4ORIA 1LVLA 5HATA 2XWDA 3RMJA 1UPMB 2E0PA 4WGXA 4AD5A 1K8ZA 5JUVA 1EJSC 2YVGA 2DSVA 2JK2A 2F5ZA 3C6CA 3KLKA 1G69A 1K8YA 1GERA 4DWDA 2WBAA 1HVXA 4XD5A 4ACZB 3DHDA 2WWCA 1QAPA 1LWHA 1LLZA 1JGIA 3TMQA 4ZOHB 2QULA 1TPUA 3KW3A 2PRMA 1XIDA 3URAA 2RGLA 4HU8A 2VQUA 2WAGA 3W7OA 1MDLA 2Z1BA 3MCOA 4NJIA 4Y9MA 3C0QA 4A8NA 1A47A 1WBHA 1V6WA 3ZVHB 1D8WA 4HHMA 3CWHA 1YE4A 4PUJA 2QUNA 3OZPA 7ODCA 1KV8A 3HZ3A 1P7TA 3DFHA 1SPQA 1BWKA 1Y5XA 3S1UA 3VE7A 3W87A 1UHVA 1X6LA 3KRZA 4GYFA 4JTHA 1H2JA 3HRDC 1W5OA 3S6OA 3UG4A 5HUPA 2ZC1A 3MUXA 3W7NA 4GA8A 5HJXA 2OOFA 1B9ZA 3OW1A 4PB5A 1GRFA 4IIEA 3O1NA 3ORWA 2VFGA 3AM9A 1JCXA 1Q6QA 1Q6CA 2WPCA 2ANUA 3C2FA 4J56A 3PHAA 5SWUA 1A5UA 4AEOA 5CSRA 2J6VA 3PB0A 3TJLA 3SADA 3B9NA 2D2HA 4RPPA 3OU8A 1V77A 1UD8A 4KT2A 1U5VA 2QJNA 3F5JA 4ZE4A 5BMXA 1NM9A 3ITXA 4H6EA 1N55A 2G5WA 3KHDA 3RGTA 3BSMA 1B57A 3V3WA 1HGYA 2GJRA 4JICA 2DY3A 5TBOA 2PLMA 1EB3A 3WENA 2WWDA 2PWGA 2PDUA 3GTHA 2WJZA 4K8DA 3IACA 2FVLA 4J3SA 1PUDA 3ITOA 3MV11 4FSAA 2GDUA 1HL9A 1E40A 1I1XA 4IJRA 3TFXA 1F73A 2X42A 2FZDA 3XINA 4FX8A 1ZMDA 3N17A 2FZNA 3NQAA 1L2UA 1R9ZA 1L6YA 1W1TA 4ZCWA 1WDQA 4QCEA 4QJ4B 1G5AA 3I3EA 1B3WA 3GVGA 3DG6A 1LTDA 2VWSA 3HV9A 3MVIA 3EKGA 3DBPA 4AWSA 2ZDRA 2VUYA 3S4TA 2DV0A 4PH6A 4K2SA 2A7RA 3JRKA 3G1XA 3UGRA 5C2GA 4DM1A 4HU0A 1ECQA 4DF1A 2H9AA 4UOJA 4IX0A 5CAKA 1EX5A 3L5MA 3D9XA 1DJXA 1DWAM 1J12A 4AMCA 2Q3OA 5TNVA 5CGMA 3CAVA 3CAKA 5TF0A 4YIWA 2Y7DA 1AH0A 4EIVA 1TJPA 1A5CA 3P5YA 2UBPC 5FEXA 3W02A 3T0AA 1E1CB 1DXFA 4QDPA 4EAMA 4GZEA 3TN6A 3OGSA 2Z4GA 1PIIA 5FKYA 4FNRA 5IBXA 1A5NC 4PMJA 3EDKA 4S3DA 1QWGA 1YW1A 3AIUA 3CTTA 3ABXA 1TTQA 1T40A 1XYLA 1XIFA 2IXVA 4GQBA 2G4JA 3GNDA 4GUJA 2XGZA 1MXSA 1XDJA 5FEWA 1UH4A 3MQTA 1ISYA 1P6WA 3CM4A 1QW8A 4WDWA 4DLMA 4RV3A 4OGZA 5E09A 3M5ZA 2QV4A 1WZKA 3AZTA 3AIWA 3K5XA 1OB0A 4O17A 3GW3A 2CFFA 3HGSA 2V5JA 2WMFA 1D2KA 3VNLA 1F3EA 3GTFA 3Q4DA 4F2UA 3ANYA 5EGRA 1V4YA 5JIWA 1A4MA 3RU6A 1WX0A 2FHBA 2O9PA 5E70A 3DG3A 3N9RA 4HN4A 2C19A 4WHBA 1NOUA 1XR2A 1D7KA 5E6ZA 1B54A 3KEHA 4F40A 2WYSA 1FIQB 4XV0A 3CZ8A 2NXHA 3URNA 4IQJA 1ME9A 2PGRA 2VRQA 4M81A 1OK4A 4BKNA 2WBGA 3PZGA 3AMZA 3NVVB 4ATLA 2YXGA 4QGCA 1AD4A 1OYCA 3VCNA 4WEVX 1EEPA 3HIJA 3KLJA 2WJDA 1REQA 1F6PA 4LS0A 2Z0IA 4MDPA 1FDJA 4GY1A 2RJGA 3KBSA 1H11A 3STCA 4FDCB 3L0KA 1IEQA 1XLEA 4MWAC 4P7RA 2QR6A 2Y6ZA 3V0TA 4DZIA 3IEBA 2WM1A 4HK5A 1A49A 3GYEA 3QY8A 4E4PA 1CXEA 1XPGA 3QR1A 2O56A 1POJA 2HV5A 1Z3NA 1WKFA 3WBEA 5HQMA 3BOLA 3WH9A 1MXGA 4Y96A 4EM3A 4FS9A 4DYEA 1GYNA 4HYVA 1P0EA 2BGNE 4JR5A 2Q3RA 2RJHA 1JL8A 3E2SA 3JR2A 3I3DA 3A64A 2W4XA 2EEXA 1QBBA 4M7TA 2NUWA 2VR4A 3ZYZA 4IGNA 4P8UA 1TTIA 3HA1A 3CL7A 1FH8A 2PDYA 4ZZ9A 2DW7A 2QDHA 3O9NA 1KRAC 2J77A 1GVEA 2A3BA 2CHOA 3LD5A 4HNUA 4CKQA 1XSJA 2FDSA 3S5YA 3MKCA 5HAOA 2P88A 1GRGA 2P5NA 3CPRA 1AW5A 3LPOA 1SU5A 1K70A 3EWYA 5LIKX 4UQEA 2BVYA 3AROA 2YCLA 2C13A 2V5LA 1OFOA 3W7JA 2VURA 3W2NA 4GINA 3CQKA 2OCZA 4IM4A 3W1AA 4JXCA 5LGXA 3VNIA 1VFMA 1P0DA 1WA3A 2DP3A 4ZTYA 5CCZA 3PJTA 2HBVA 1WDRA 3CGTA 1WKDA 3AAMA 2PAJA 1K4HA 1KLZA 1QXLA 1AJ2A 3Q6JA 1FA2A 5TQLA 1UWSA 3CHEA 3GU9A 4M56A 1HL2A 2ZWYA 3LBCA 2BVTA 2NV9A 4HHHA 3HGRA 1ZBWA 5EMYA 1XLKA 3ZR5A 2IPWA 2NLYA 1OG0A 5AHIA 4I8DA 1DJGA 1W54A 2Q6ZA 2NWRA 2X0HA 3G6MA 3FGCA 1O5QA 4L6HA 2YL6A 4MNMA 3WBWA 3O0KA 4L1XA 4B90A 2FZ8A 2OR2A 1JYXA 2J47A 2RUSA 4GFIA 1LORA 5JH2A 2INFA 4J35A 4DEFA 3IVSA 2J8FA 1F9CA 2YW4A 3D3AA 1H63A 1R8LA 5HWMA 4LCQA 2TMDA 1KFKA 1PZ2A 3W7MA 4P8VA 1RR2A 3OBAA 1UR4A 4M6QA 4NUWA 1XRSA 3OP2A 3NZPA 3KCJA 3CUHA 1QWKA 3NL5A 1FX6A 2C3ZA 3T42A 3M1ZA 5CLTA 1GCYA 5C8BB 1N5WC 3VD4A 3SBFA 4JQ2A 3WDIA 2XFYA 1UOKA 3AMLA 4LA1A 1LM1A 3E5BA 3R13A 3VKDA 4UFLA 3FJNA 4XZMX 1BGGA 3EANA 5AHLA 3WDPP 3VGEA 1NWUA 1V97A 2VHLA 3T7VA 2PE4A 1YLVA 3NM3A 2HE8A 4IH3A 3GDMA 1AJ0A 3BOFA 3VNDA 3W2UA 1XCFA 1THFD 4U3CA 3UJRA 2VX6A 1UZ1A 4RPQA 3DECA 1B3VA 2HPMA 4BQ5A 2A1YA 4AD4A 4L1GA 3CQJA 4DO4A 4HPXA 6ALDA 5H91A 5CC3A 4JL1A 2UZ9A 1KRCC 4AWUA 4WOZA 4XVDA 2DW6A 4H19A 1FWTA 4NNCA 3V1PA 5LXXA 2P3ZA 1C90A 2C91A 4HU3A 3DK4A 3OC4A 2FTYA 4Z08A 4TOQA 1XM3A 2W55A 1SFLA 2HISA 1H7XA 3IV8A 4J5NA 1UIOA 1B3OA 4J4KA 5JU6A 5EFDA 1KA9F 4IWWA 4FIQA 5B80A 4TUFA 1TMLA 4W9TA 4ZO6A 3UZJA 3UWUA 5A5WA 3CLMA 1PSCA 2W61A 1S7MA 4TMBA 3QPZA 2PDQA 4GRTA 3MP4A 4O1CA 1PTGA 3ISIX 1EH9A 1FRBA 4X0NA 2IQTA 1EP3A 4B2DA 3VIKA 4E2OA 3TVAA 3VX0A 5JCMA 1JROA 3H22A 2D24A 4M19A 1OYAA 1K02A 2VEKA 5DFAA 4H83A 1QOQA 1S1PA 1I8JA 4EQXA 4W85A 2E25A 2PSNA 4JTAA 3HG2A 2WNWA 2ZWZA 1BTMA 5HMDA 3F4DA 1TTPA 4GO8A 1RK5A 4E8DA 2ZRUA 1K8CA 1FHVA 1D3HA 3KXQA 1RD6A 4QP0A 3ARZA 4Y6GA 2BVDA 5EA9A 4U31A 1DHKA 1XKYA 3KRUA 1JOAA 1YXCA 1YIXA 3NL2A 1BQGA 1F61A 2OELA 2VOMA 4ADSA 2KZHA 4Q7NA 4UTKA 3LLDA 4CUCA 2DFAA 4QLKA 1OGBA 1YX1A 2ZZ0A 1PKMA 3RO8A 4M6PA 1A3WA 1XX1A 5HNTA 4ZB0A 1VFLA 3GG8A 1S5MA 5GJPA 1GRBA 3RO6A 1YTDA 2E5CA 2KX9A 4JHZA 1EYWA 3CZEA 1IR1A 1PWMA 3VPLA 3R4IA 5BXPA 1N82A 3EMQA 4HQVA 3P81A 2W3SA 3SUTA 4B15A 3W7DA 1JYWA 1BHGA 3OTRA 1ME7A 1JDFA 5FS8A 3ARRA 1C8QA 1RK6A 3M0XA 3V7PA 3VDBA 2OQHA 3VC6A 5I3DA 4DM2A 1VCGA 5JVLA 3RLVA 3NQVA 3ZWSA 3TSBA 1ONEA 2TAAA 2WCSA 4AXNA 4JIHA 4JTKA 3S47A 3FG2P 3UQNA 4PB3A 3DN5A 2IKJA 5BMWA 1M7XA 1NARA 3R6IA 1NDAA 1TVLA 4MJZA 2VEFA 3DGRA 3CC1A 4IX2A 1JYVA 3P7YA 2O7QA 3MMTA 1R3YA 2ONEA 3ZLHA 3CV1A 1JAEA 3AIQA 1VHCA 3EPNA 4LUTB 1LPFA 3CUIA 3VIFA 3AUOA 4D71A 7A3HA 4JY8A 4UTFA 5J5RA 2WSKA 2CZVA 2DZUA 4JFVA 5M2FX 5H8PA 3C2RA 3DIPA 4GUFA 3WDHA 2Y24A 4MZ8A 1Z48A 3SCQA 3CMFA 2XFRA 3H53A 1LZOA 3WF1A 4JDRA 1H0IA 2X50A 2HNEA 4O1DA 4RZ4A 3ABOA 1QVBA 4W87A 3UF9A 1DQXA 1I75A 4XZLX 3IGSA 3SRFA 5BRBA 1FFUC 5BXRA 4CNOA 2Q8XA 2FMOA 3T8QA 3BCJA 1JEHA 1X1NA 4DUWA 4TU1A 2Z1VA 1ITUA 3BJSA 5FEPA 1WXZA 1TWSA 4ZMGA 4PUKA 1MI3A 3AYRA 3QMRA 5EMKA 3RRXA 3ARQA 1XW8A 3W72A 7ENLA 3MMWA 1XLFA 3F2DA 3W7PA 2PDCA 1YPIA 5G4WA 4JGDA 5CZKA 1SW0A 4S3JA 3GUWA 5FL0A 3KRSA 4PMVA 3K8KA 3PZUA 2FGLA 4D6DA 2DVUA 1XANA 3OIHA 3CUFA 5FJOA 3WLTA 1MZRA 1C92A 1UP3A 4UTHA 2NSXA 2GK1A 1JPMA 1RAKA 1WQ5A 3OODA 3W1NA 3NL6A 3IVUA 1DE5A 1TUFA 5DQPA 1VYSX 2ZZ7A 3AYTA 3RPMA 4C6OA 3PSWA 1ODZA 3LXAA 1KTNA 2YVFA 4W7WA 5FACA 4IMFA 2VP8A 4JEQA 1BVWA 4WKAA 5D8WA 4H9MA 3WLKX 1A0DA