5FMHA

Crystal structure of the e405k mutant of human apoptosis inducing factor
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
486
structure length
472
Chain Sequence
APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVKLAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Novel Mutation in Aifm1
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 154
structure length 472
sequence length 486
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fmhA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fmhA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fmhA01
4BV6A 4EQRA 4H4WA 3V3NA 2J3NA 1ZOVA 1JRXA 4CCRA 1GTHA 1LTXR 1PBFA 3AYJA 2BABA 2YM1A 2QCUA 3ADAB 1RYIA 4AP1A 3SFDA 4J33A 5C3JA 1KSUA 2YG6A 3UP5A 3EANA 1FCDA 3AEDA 1E7PA 2Y6QA 3ALMA 5BUKA 1TYPA 2JK6A 1L9CA 1PS9A 2XLTA 3ICRA 3ATQA 2V3BA 3UTHA 2YR4A 1XDIA 3AYLA 1DOEA 1JRYA 1KF6A 3KA7A 5IQ1A 1NENA 4C74A 4RG3A 4OPCA 4K5SA 2GAHB 3CNSA 2B7SA 4YSYA 5FS6A 1TDFA 2R46A 2TPRA 1ZX9A 3SM8A 4B68A 3QSMA 2JKCA 2H89A 3H8IA 3QSSA 1LPFA 4H2QA 3NNEA 1D4EA 3B3RA 2EQ6A 1IUUA 4HA6A 3RP7A 3I3LA 2WP9A 1NHSA 1XHCA 3QFAA 3QSEA 5FS8A 3D1CA 1PJ7A 1PJ6A 1H81A 1ZOYA 3CNJA 3DH9A 1PBBA 2GRTA 1GALA 1GRAA 1GERA 3LOVA 3UKQA 3CGDA 2C73A 2GQFA 3T37A 4K5RA 2WS3A 3AWIA 3CNTA 1NHQA 4ADWA 1TDNA 4B63A 2C70A 4TLXA 5BRTA 1OJ9A 4FX9A 1CC2A 1Y0PA 3AEEA 3UOZA 2R0GA 1DJNA 2WP6A 5KOWA 1GRFA 2YLXA 2XDOA 4ICYA 3NYEA 4NTDA 4GDPA 2WDVA 4Z2UA 3ZDNA 2YLRA 3D8XA 3F8DA 3V76A 4U2TA 3CTYA 3BNUA 3ITJA 4U8PA 2X3NA 4WX1A 2VQ7A 3NN6X 2Y6RA 1CJ4A 4NEVA 3P4RA 3L8KA 3VRBA 4C3XA 2E4GA 4TM1A 5M10A 5KRQA 1K0JA 3BI5A 1O5WA 2ACZA 2V5ZA 2GR0A 5KWFA 2C3CA 3CPIG 2B9WA 4JNAA 1AOGA 2ARDA 1LQUA 2UZZA 2XVFA 2X99A 2NVKX 1LJ1A 1TDEA 1VQWA 1F3PA 4A99A 1Y56B 2XLUA 1KDGA 3ALLA 3C4NA 2WDQA 1XANA 1S2QA 3CN8A 4H4UA 4H4PA 3FMWA 5J7XA 2BCGG 3AD9B 3ATRA 1GRHA 2RABA 2C75A 4CBQA 2AAQA 2B7RA 1MXTA 3URHA 4UDRA 2B9YA 1FEBA 1NDAA 4TM0A 4YT0A 1DOBA 5HY5A 4M52A 1GEUA 1B8SA 1GOSA 4UDPA 3EAOA 1YQ3A 1PN0A 2YLTA 2OAMA 3NRNA 2VOUA 1E1KA 2YLZA 1NHPA 2C66A 3HZLA 4DGKA 4JDRA 4A6NA 3AE3A 4AT0A 5KXJA 2ZZCA 1BGJA 3BI4A 1EL7A 3LB8A 2H88A 1ZK7A 3RP8A 1VG0A 4U8LA 4YTMA 3DA1A 3VRAA 3GD3A 4A9WA 1F6MA 2OLOA 3BNMA 4X9NA 1E1NA 3GSIA 3UKPA 2WU2A 2FJAA 1L0VA 3GDNA 2X8HA 4C3YA 3VQRA 3CPHG 5EOWA 2GR1A 1E39A 4REKA 2XFNA 2V61A 3AEAA 4IA6A 4Y4NA 2BXSA 1FL2A 3P1WA 2C3DA 4B66A 4B65A 3GMBA 3IF9A 4J34A 1NAAA 1YKJA 4K8DA 3NIXA 3ZYXA 5FS7A 1E1LA 1EL8A 1CL0A 2GVCA 4H4RA 1GRBA 2JBVA 3AE4A 3UP4A 1H6VA 1CJ2A 2CVJA 5EB4A 1DJQA 1JRZA 3M0OA 3AYIA 1FECA 2X8GA 1OJTA 2EQ9A 1L9EA 4H4ZA 3IWAA 2YLSA 5JCIA 2APGA 2V3AA 1GTEA 3NG7X 4A7AA 4XWZA 4EQWA 1CJCA 1SEZA 4Z24A 1CC4A 2GF3A 4ZN0A 4TM3A 3PVCA 2VVMA 4YXDA 3C96A 3NH3X 3AEBA 4A6NB 1GT8A 4U8JA 1P2EA 3CGCA 2GQWA 1PBDA 3GRTA 5DBJA 1YQZA 5JCMA 2GEWA 1GNDA 1H7WA 2WEUA 2I0ZA 4OPGA 1ZDLA 4GCMA 4U8KA 2A89A 2XVHA 4C5OA 1ONFA 2YM2A 1VG9A 2V6OA 1V59A 3FG2P 2VZ2A 3B6DA 1QJDA 3K7TA 3NK2X 4AT2A 2FBWA 4WCTA 2JAEA 3F8RA 3NTAA 3L1RA 4O5QA 4AOXA 1H7XA 1KFYA 1JEHA 2Q6UA 3KPFA 2WDRA 4LIIA 3AE1A 1ZMCA 4XWRA 1MOKA 2B76A 2BXRA 3IHMA 4RSLA 4BURA 2TMDA 1NPXA 1D7YA 1S2YA 3LADA 2JB1A 4YKGA 1BWCA 3BHFA 1L9DA 2NPXA 4U2LA 1F8RA 3KVEA 4A79A 4CNJA 4JN9A 4GDEA 4I58A 5EBKA 2XFPA 2BC0A 3DJEA 4AP3A 1RP0A 1GREA 3CGEA 2YG7A 2JB3A 2FJBA 4H2PA 3RP6A 4YSHA 1B37A 4GRTA 5M0ZA 4CCQA 2R0CA 2VQBA 2WETA 3AXBA 4KPRA 3SGLA 1IUTA 4KX6A 4C77A 5BVAA 4OPUA 4JQ9A 4YKFA 1Z6LA 3UKAA 4CY6A 2Z5XA 2PHHA 3NYCA 4EIPA 1PBCA 4H4QA 4NTCA 2GMJA 4YTPA 1PXAA 4LU6A 5TR3A 4Z44A 1M64A 1K0IA 4DSHA 2GH5A 4FK1C 4H4SA 2YR6A 1FOHA 3RHAA 1VRQB 4JY3A 3QVRA 2XYOA 4J2WA 1TDKA 5ER0A 2BA9A 4EIQA 1JU2A 3NHOX 3UKKA 2R4JA 3UOVA 2BCPA 5KVIA 5JCNA 2YVGA 2VRMA 5CKUA 3UOXA 3BHKA 3Q9TA 4CNKA 1B4VA 4P9SA 2FJDA 3KU9A 5HYMA 2R9ZA 4HB9A 2WQYA 3GYJA 1ZKQA 1IUXA 1OJCA 5CQFA 4BK1A 4ECHA 4A65A 3NTDA 3UTFA 2IVDA 4IVMB 4DSGA 4K2XA 1N1PA 4X4JA 3AE5A 1EL9A 3K7MX 4JY2A 4Z25A 3LXDA 3AE2A 5U25A 4D03A 1N4WA 4Y4LA 3KLJA 4EM4A 4BJYA 1CBOA 3AE7A 1GXFA 1P2HA 1ZP0A 4H2NA 4APNA 2VRLA 3K30A 4ZCDA 5KOXA 4YTNA 1H83A 4RG4A 3PO7A 1K0LA 2Q7VA 1NHRA 3DJJA 4H4XA 2XLSA 2OALA 1PXCA 2R45A 2XVJA 4GF7A 3ISHA 3NK1X 1BF3A 2WU5A 2GMHA 1NEKA 2C65A 3G5RA 3KD9A 3COXA 3FPZA 2YWLA 2C67A 2OLNA 3GYIA 4H4YA 4J36A 3LZWA 2WPEA 2YR5A 3AE6A 3NT6A 3G5SA 3II4A 3CGBA 3DK8A 1IUSA 3AEFA 4K7ZA 4J31A 1Q1RA 2ZBWA 4FK1A 1N4UA 2CULA 4Z2RA 4EQXA 2BK3A 4NEWA 5J60A 2Q0KA 4NTEA 2YLWA 1JNZA 4FDCB 3P9UA 2GB0A 1KNPA 2BK4A 1PXBA 3SQPA 4XXGA 3UKFA 3UOYA 1GSNA 1S3BA 2JB2A 1ZY8A 1GRGA 5JCLA 4YWOA 1EBDA 3NK0X 4IV9A 1IUVA 4X9MA 1D7LA 3S61A 1Q9IA 2GR2A 2WBAA 2XVEA 4EMIA 4EQSA 2E1MA 3NN0X 1TYTA 4U8MA 4OVIA 4MJWA 1CJ3A 1LVLA 3NYFA 4OPLA 1TDOA 4B67A 3VR9A 1GRTA 4U8OA 1Q1WA 1ZMDA 5LV9A 2V60A 1KSSA 1W4XA 2YVFA 2OA1A 2W0HA 1GESA 1OJAA 4H7UA 3C4AA 5KVHA 2X50A 1REOA 4GUVA 2Q0LA 2XFUA 4EMWA 3AD7B 3K7QX 4B1BA 4OPIA 3IHGA 4H2RA 1QLBA 3NLCA 1GETA 1E1MA 1FEAA 1H84A 1PBEA 1XPQA 5FMHA 1BKWA 3DGHA 1O94A 3NKSA 2WPCA 2HQMA 2BK5A 2PYXA 4UDQA 4K22A 3H4KA 3QJ4A 4N9XA 3AECA 5GRTA 5U1OA 1RSGA 2ZZBA 3QFBA 4NZHA 4Z2TA 4U8IA 1EL5A 1GPEA 4CY8A 3NGCX 3BI2A 3CNPA 3AE8A 3EPTA 2C7GA 1O95A 3REDA 1M6IA 3Q6JA 2RGJA 2WOIA 1B5QA 2XLRA 1PHHA 3R9UA 3UKLA 4U2SA 5L46A 3P4PA 2YAUA 3LJPA 5BULA 3VRDB 3G5QA 1S3EA 4YSXA 5FS9A 1CHUA 2QA2A 3UTEA 5U63A 3WE0A 4H4VA 1IJHA 4BK3A 2ZZ0A 1HYUA 2C72A 1X31B 2EQ7A 2AR8A 1JOAA 1Y56A 1LV0A 4Z26A 2WPFA 1YY5A 2BS2A 2CFYA 3OC4A 2A87A 2WP5A 1K4QA 3M12A 1F8SA 3ALJA 1D5TA 1D4CA 2GAGB 3GRSA 4A5LA 2QA1A 4J57A 3CPJG 3LZXA 3GMCA 4USQA 5HHFA 2XFQA 4OPTA 1GV4A 3RNMA 2B9XA 1DODA 2WESA 2R0PA 1QO8A 2XLPA 2O9ZA 1BGNA 2C76A 5GSNA 2XCGA 3FIMB 3AB1A 2GR3A 4OCGA 2YVJA 2VVLG 1DXLA 4ZCCA 3GWDA 2YG4A 3ABVA 2FJEA 2RGHA 4E0VA 2AQJA 1D4DA 3CNDA 1UKVG 5IQ4A 2Z5YA 3VR8A 2R4EA 1E6EA 1CF3A 1YQ4A 2RGOA 2DKIA 3AE9A 4AOSA 3DK9A 2WOVA 4H50A 3KKJA 2IIDA 1LQTA 2GV8A 5JCKA 3H8LA 4CRTA 2VVLA 3IC9A 1IUWA 3AD8B 1KNRA 1JNRA 4B69A 3PS9A 5EB5A 3UTGA 1BZLA 2WOWA 4IVOB 4PABA 1PDHA 4D04A 2E5VA 2YG3A 2X8CA 1COYA 3DJGX 3OZ2A 2BYBA 2CDUA 4J56A 2YG5A 3EF6A 4U8NA 2A8XA 4I59A 1DOCA 2WHDA 4Z43A 5HXIA 1TRBA 1DNCA 3DGZA 3F8PA 4YSZA 3ICSA 1PJ5A 3S5WA 4O5UA 4LA1A 4EMJA 3UKHA 2BC1A 3FBSA 3P4QA 1VDCA 2IVEA 4B64A 1H82A 1NG3A 3E1TA 3P4SA 4DNAA 4PAAA 1NG4A 1H86A 4TLZA 3CIRA 4TM4A 4Y4MA 4BK2A 1MO9A 4H4TA 3I6DA 2BACA 3QVPA 2XFOA 2F5ZA 3DK4A 3GDPA 2DKHA 1CC6A 3UCLA 3SFEA 5C2TA 5IPYA 2YQUA 1N4VA 1OJDA 3AEGA 3DJDA 2XVIA 4UP3A 2EQ8A 3V3OA 2QAEA 3O0HA 4USRA 3GD4A 4OPDA 4GR1A 3ICTA 4BJZA 4EM3A 4IA5A 4JNQA 3GWFA 1F8WA 1ELIA 3M13A 2BS3A 3DMEA 2C64A 2BS4A 3JSKA
chains in the Genus database with same CATH superfamily
4BV6A 5BOFA 3V3NA 2E5AA 3DG3A 1PBFA 3SR6B 2BABA 1RYIA 1WUEA 1FCDA 3ICRA 2V3BA 1KF6A 2HNEA 1JDFA 4YSYA 2R46A 1ZX9A 1WYGA 3QSMA 3ES7A 3NNEA 3B3RA 3R0UA 4HA6A 3QLDA 3I3LA 3RP7A 1NHSA 3QFAA 4MMWA 1PJ6A 3CNJA 1PBBA 1GRAA 3LOVA 2RDXA 2GQFA 4ADWA 4B63A 1CC2A 3RCYA 4ICYA 3NYEA 3SXIA 4A3RA 4Z2UA 2YLRA 1OEPA 3V76A 4U2TA 3T0KA 3N6JA 2VQ7A 3U9IA 3NZGA 4NEVA 2E4GA 1SB3B 4TM1A 2ACZA 5KWFA 2C3CA 1TZZA 2B9WA 2PODA 2XVFA 1LJ1A 3DG6A 3ALLA 4H4UA 3FMWA 2BCGG 2PPGA 3THUA 1KN0A 1MXTA 1NDAA 5HY5A 4HCDA 4G73A 3JVAA 3EAOA 3GY1A 4DWDA 4JDRA 1BGJA 2H88A 3MQTA 4YTMA 1F6MA 3GSIA 2WU2A 1H2IA 3VQRA 7ENLA 2GR1A 1E39A 2PGEA 3GMBA 1YKJA 3ZYXA 3NIXA 3RGTA 3UJEA 1E1LA 2I5QA 1EL8A 1TKKA 4HCHA 1GRBA 3AE4A 3T8QA 2C4CA 3UP4A 5EB4A 1CJ2A 2W54A 3DGBA 2YLSA 5JCIA 4EQWA 4Z24A 4TM3A 3C96A 3A7RA 3AEBA 2HXUA 2GQWA 5DBJA 1H7WA 1ZXIC 2I0ZA 1MDLA 2XVHA 1ONFA 2V6OA 3NK2X 2FYMA 2FBWA 1RVKA 2BRYA 2JAEA 4O5QA 4AOXA 1H7XA 4XWRA 1ZMCA 2BXRA 4BURA 1SJBA 2XH4A 2NPXA 4JN7A 4J1OA 2JB3A 4H2PA 1B37A 2GGHA 2WETA 4KPRA 1VQZA 2OG9A 4KX6A 1PBCA 4E6MA 4ROPA 3UJ2A 1XPYA 4FK1C 2YR6A 4JY3A 3T31A 5ER0A 3UKKA 2BCPA 2OQYA 5CKUA 3Q9TA 4P9SA 3D47A 4HB9A 1IUXA 2IVDA 3ETRB 4DSGA 3QTPA 1NU5A 3NXLA 1N1PA 4X4JA 3AE5A 1MUCA 4Z25A 3AE2A 5U25A 3KLJA 4EM4A 3QN3A 1GXFA 1ZP0A 3K30A 4ZCDA 3R1ZA 3PWGA 3QSEA 1K0LA 1NHRA 1PXCA 2R45A 1BF3A 2GMHA 1NEKA 3JW7A 3FPZA 1X2GA 3LZWA 3G5SA 1EBGA 3DK8A 4K7ZA 4EWJA 1N4UA 4NEWA 5KMRA 1JNZA 4FDCB 3P9UA 3IJLA 5FJTA 4J3ZA 2GB0A 4XXGA 3UKFA 1S3BA 2JB2A 1ZY8A 1EBDA 1KKRA 1D7LA 4EQSA 3NN0X 1TYTA 4OVIA 1LVLA 3NYFA 2GSHA 3VR9A 4U8OA 3T9PA 3T6CA 1REOA 2XFUA 3K7QX 3IHGA 1QLBA 3ZLFA 2PMQA 3R11A 1BKWA 2PYXA 3PG6A 4N9XA 3MY9A 3NO1A 5GRTA 1EL5A 3BI2A 3AE8A 3GYXA 4DX3A 3REDA 4H1ZA 4U2SA 3SYIA 3VRDB 2OZ8A 4YSXA 4GIRA 5U63A 1IJHA 2C72A 2AR8A 4Z26A 1YY5A 2CFYA 2A87A 4DYEA 4HN8A 2QA1A 2PTXA 4J57A 3CPJG 3LZXA 4G6HA 1N60C 1DODA 5FJPA 3HPFA 2R0PA 2XLPA 4II2A 2C76A 3R25A 5GSNA 2AL2A 2XSXA 1DXLA 2FJEA 2RGHA 2AQJA 3CNDA 1UKVG 5IQ4A 3UJRA 4KEMA 4IT1A 1CF3A 2MNRA 4AOSA 4H50A 1LQTA 3H8LA 4CRTA 1IUWA 1JNRA 3UTGA 1BZLA 1PDHA 2E5VA 3GO2A 2YG5A 3EF6A 2A8XA 2WHDA 1PJ5A 3S5WA 1V97A 3P4QA 2OZTA 1NG3A 4PAAA 4K1WA 1NG4A 2AL2B 4BK2A 3SX6A 2OFJA 2DKHA 3EEZA 4KWSA 3V3OA 2QAEA 4KPLA 4USRA 4OPDA 1FIQB 4JNQA 4HNLA 2PP1A 2PTZA 3GWFA 1F8WA 4EQRA 3SN4A 1FHVA 1ZOVA 1LTXR 1EBHA 2OVLA 2PSNA 5C3JA 4J33A 1KSUA 3UP5A 4IP5A 2Y6QA 1TYPA 2JK6A 1L9CA 2XLTA 1P48A 4C74A 4K5SA 2B7SA 2GGGA 2TPRA 4B68A 3H8IA 2H89A 3QSSA 2WP9A 5FS8A 2ZADA 4GFIA 1GALA 3CGDA 4K5RA 3H70A 4GYPA 1NHQA 5FJRA 3MSYA 5BRTA 4TLXA 3U4FA 3AEEA 3UOZA 2R0GA 3UXKA 3DDMA 1GRFA 1R0MA 3ZLGA 4GDPA 4M6UA 3S5SA 4IL0A 3TWAA 4C3XA 1E9IA 5KRQA 5M10A 3BJSA 2PU0A 2PTWA 2ARDA 3SZ0A 2UZZA 5G5HB 2NVKX 1W6TA 1TDEA 1Y56B 2XLUA 1XANA 3AD9B 1GRHA 4E5TA 2GL5A 3DIPA 2B7RA 4UDRA 3URHA 2B9YA 2OAMA 3H8AA 5KXJA 3PFRA 3VRAA 4A9WA 4A35A 2OLOA 1JCTA 3MZNA 3UKPA 1L0VA 3GDNA 2X8HA 4C3YA 4B66A 2C3DA 3IF9A 3IJQA 4J34A 2POZA 2P0IA 1H6VA 2FKPA 3M0OA 1FECA 3V5FA 2P88A 2EQ9A 1L9EA 4H4ZA 3IWAA 2V3AA 2APGA 3SN0A 3NG7X 4IP4A 3N6HA 4XWZA 2GF3A 1NELA 3PVCA 2QGYA 3BOXA 4GAPA 3NVZB 1GNDA 2P3ZA 2A89A 2YM2A 3FG2P 2VZ2A 3K7TA 4AT2A 2OZ3A 4WCTA 3F8RA 1JEHA 5ENLA 2WDRA 3AE1A 1NPXA 3UGVA 3BHFA 2BRAA 5EBKA 3DERA 2PS2A 2YG7A 2FJBA 5JRBA 3HRDC 1SJDA 2VQBA 3AXBA 4JQ9A 4YKFA 4CY6A 3NYCA 4G9KA 4EIPA 4H4QA 4NTCA 1PXAA 2W3SA 5TR3A 5KMQA 1K0IA 1L8PA 4J2WA 1EC9A 1TDKA 1JPMA 2BA9A 1JU2A 3UOVA 4H19A 5JCNA 4CNKA 2FJDA 2R9ZA 4KT2A 2AKZA 1ZKQA 5CQFA 3SQSA 3UTFA 4K2XA 1EL9A 3K7MX 2XH0A 3LXDA 4D03A 3DFHA 4Y4LA 1STZA 3T2KA 4BJYA 4H2NA 4APNA 2VRLA 3GD6A 1H83A 2QDDA 3D46A 3DJJA 4H4XA 2OALA 3L5OA 3EUB3 3NK1X 3G5RA 3FYYA 3COXA 3TQPA 3MWCA 4H4YA 2YR5A 3CT2A 3AEFA 4FK1A 2BK3A 5J60A 1KNPA 2BK4A 3SQPA 3UOYA 5JCLA 4X9MA 4YWOA 3P3BA 2GR2A 3TOYA 2E1MA 1P43A 3UCCA 3R07C 1GRTA 1Q1WA 1ZMDA 5LV9A 2V60A 2YVFA 2XH7A 1OJAA 4H7UA 2X50A 4GUVA 2Q0LA 3AD7B 4B1BA 4H2RA 3NLCA 1E1MA 1PBEA 1H84A 3P0WA 1XPQA 3NKSA 5FMHA 1O94A 3AECA 5U1OA 1RSGA 4U8IA 1GPEA 2RGJA 2PA6A 3UKLA 1PHHA 3CMMA 2O56A 4GGHA 3WE0A 1HYUA 1X31B 1JOAA 2WPFA 3OC4A 2WP5A 1K4QA 3M12A 1F8SA 3ALJA 3AN1A 3GRSA 1ONEA 2HZGA 3PWIA 5HHFA 1GV4A 2B9XA 4G74A 3PK7A 2XCGA 3HW2A 3GWDA 3ABVA 4E0VA 1EC8A 1YQ4A 2IIDA 2QQ6A 2VVLA 3IC9A 2OX4A 3TJIA 3V4BA 1MRAA 2YG3A 3FVDA 1COYA 3OZ2A 4ZOHB 2BYBA 4J56A 4H83A 1DNCA 4YSZA 3ICSA 3R10A 4O5UA 3E1TA 1H86A 5IDZA 1MO9A 3I6DA 3QVPA 2F5ZA 3GDPA 3UCLA 3SFEA 5IPYA 1N4VA 1OJDA 2EQ8A 3GD4A 2DW6A 4GR1A 3ICTA 4EM3A 4IA5A 3M13A 2C64A 4E4UA 3CPHG 2BS4A 3RRAA 2J3NA 3QPEA 4CCRA 1GTHA 3AYJA 2YM1A 3SFDA 3DEQA 2YG6A 3EANA 1E7PA 3ALMA 4NWZA 3UTHA 1PS9A 4DXKA 2YR4A 1XDIA 3AYLA 1DOEA 5IQ1A 2E3TA 4RG3A 2GAHB 5FS6A 1TDFA 3SM8A 2OQHA 1MDRA 1LPFA 4H2QA 2EQ6A 1IUUA 3D1CA 4X2PA 1ZOYA 3DH9A 3Q45A 5KNLA 2C73A 3T37A 3CNTA 3HYVA 1TDNA 1OJ9A 2WP6A 5KOWA 2YLXA 2XDOA 3FJ4A 2WDVA 3ZDNA 3D8XA 3F8DA 3BNUA 3ITJA 4U8PA 2X3NA 4WX1A 3NN6X 3P4RA 3VRBA 3BI5A 1O5WA 2GR0A 3ENLA 3CPIG 1LQUA 4A99A 3TJ4A 2PTYA 1KDGA 2QJJA 3T2YA 1JROA 3SBFA 3C4NA 3H7VA 1S2QA 4H4PA 5J7XA 2C75A 4CBQA 1VDVA 3NS1B 2GGJA 4YT0A 4UDPA 1GEUA 1GOSA 1PN0A 3NRNA 3HZLA 2C66A 3AE3A 1KD0A 4AT0A 3A7AA 1EL7A 3T14A 1FO4A 3RP8A 3I6TA 4U8LA 3N4EA 3GD3A 1E1NA 2FJAA 4HPNA 4REKA 2XFNA 2V61A 3AEAA 3EKGA 4IA6A 4Y4NA 3P1WA 4B65A 3OTRA 4K8DA 5BOEA 2GVCA 4H4RA 3TTEA 1DJQA 1JRZA 2X8GA 1OJTA 1GTEA 4A7AA 1CJCA 4ZN0A 3VCCA 4YXDA 1N5WC 3NH3X 1GT8A 2GGIA 3CGCA 3GRTA 1YQZA 2GEWA 4U8KA 3DESA 4GCMA 5FJUA 1QJDA 2NQLA 4A6GA 3NTAA 3L1RA 2W3RA 2Q6UA 4M0XA 1MOKA 2B76A 4RSLA 1D7YA 1S2YA 3P93A 4YKGA 1BWCA 3KVEA 4CNJA 4JN9A 4I58A 2BC0A 3DJEA 4AP3A 1RP0A 4ZA0A 5KMPA 3RP6A 4YSHA 4CCQA 2R0CA 3SGLA 1IUTA 5BVAA 4OPUA 1Z6LA 3UKAA 4E8GA 2Z5XA 2DW7A 1N63C 3NVVB 2GMJA 4E4FA 1M64A 3OPSA 2GH5A 1VRQB 2XYOA 4EIQA 3NHOX 2R4JA 1FFUC 5KVIA 2OPJA 2VRMA 4IHCA 3FXGA 1B4VA 3SY4A 3KU9A 5HYMA 2WQYA 1ECQA 4GMEA 3NTDA 4IVMB 1N4WA 3MUCA 2AKMA 5KOXA 4RG4A 2XLSA 4GF7A 2P8CA 3ISHA 2W55A 2WU5A 2YWLA 2C67A 3GYIA 3AE6A 3II4A 3VDGA 4J31A 4EQXA 4NTEA 2YLWA 1PXBA 4DHGA 3VC6A 3NK0X 3S61A 2WBAA 3KUMA 3SJNA 4EMIA 3OZMA 2ONEA 4MJWA 1CJ3A 3V5CA 4G8TA 1RM6B 2ZC8A 1KSSA 1PDYA 2OA1A 1KCZA 3C4AA 5KVHA 4EMWA 5G5GB 4OPIA 4H2HA 1GETA 1FEAA 3UJFA 4UDQA 4K22A 3H4KA 2ZZBA 3QFBA 4NZHA 5J04A 4Z2TA 3A7UA 4CY8A 3CNPA 1O95A 1M6IA 5KMSA 3Q6JA 2WOIA 1B5QA 3R9UA 3P4PA 3LJPA 5BULA 3G5QA 1S3EA 5FS9A 2QA2A 3UTEA 4H4VA 4DN1A 3SZCA 1LV0A 2BS2A 3VC5A 2GAGB 3BSMA 4USQA 3GMCA 4HCLA 4NNJA 2HXTA 3ZLHA 1BGNA 3AB1A 4OCGA 2YVJA 3T2ZA 4ZCCA 1D4DA 3VR8A 2RGOA 2DKIA 3AE9A 3DK9A 3KKJA 2GGEA 3AD8B 1ELSA 2WOWA 4IVOB 4PABA 4D04A 3ZVHA 1JPDX 3N4FA 2CDUA 4U8NA 4I59A 1DOCA 4Z43A 3GC2A 5HXIA 3F8PA 4EMJA 3UKHA 2BC1A 1VDCA 4B64A 1H82A 3P4SA 4MGGA 3OP2A 3CIRA 4H4TA 3UJSA 2BACA 2YQUA 1IYXA 3AEGA 3DJDA 2XVIA 1N5XA 4UP3A 3SSZA 1ELIA 3DMEA 3JSKA 4H4WA 3ZVHB 1SJAA 1JRXA 1BKHA 4TVWA 2OO6A 2QCUA 3ADAB 4AP1A 4FP1A 3VCNA 3AEDA 4MKSA 5BUKA 2QVHA 3ATQA 1FHUA 1JRYA 3KA7A 1NENA 4OPCA 3CNSA 4F4RA 3HYWA 2JKCA 1D4EA 2GDQA 1XHCA 3CXOA 1PJ7A 1H81A 2GRTA 3UKQA 1GERA 2WS3A 3AWIA 3AM9A 2C70A 3NRZB 4FX9A 1Y0PA 1DJNA 4Z17A 3V3WA 1YEYA 4NTDA 1WUFA 3CTYA 3QKEA 3DG7A 2Y6RA 1CJ4A 3L8KA 1K0JA 4HNCA 2V5ZA 4JNAA 3FV9A 1AOGA 2X99A 1VQWA 1F3PA 3R0KA 3CYJA 3B9JB 2AL1A 2WDQA 3CN8A 3ATRA 2RABA 2AAQA 3IK4A 3RR1A 1FEBA 4TVYA 4TM0A 1DOBA 4M52A 1B8SA 1YQ3A 2YLTA 2VOUA 1E1KA 2YLZA 1NHPA 4DGKA 3AMZA 1X2HA 4A6NA 2ZZCA 1N61C 3BI4A 3LB8A 2QDEA 1TE6A 3ZVIA 1ZK7A 1VG0A 4II3A 3DA1A 3BNMA 4X9NA 1F9CA 2MUCA 5EOWA 3HYXA 2BXSA 1FL2A 4IZGA 3RITA 1NAAA 5FS7A 1CL0A 2JBVA 2CVJA 3AYIA 1SEZA 1CC4A 2VVMA 4A6NB 4U8JA 1P2EA 3KPKA 1PBDA 5JCMA 1XS2A 3K1GA 2WEUA 4OPGA 3NFUA 3NVYB 1ZDLA 4C5OA 3MKCA 1VG9A 1V59A 3B6DA 3D9XA 1KFYA 3VFCA 3KPFA 4LIIA 2PU1A 3IHMA 2TMDA 3TW9A 4G7FA 2JB1A 3LADA 2QJNA 1L9DA 4U2LA 1F8RA 4A79A 4GDEA 2XFPA 2XH2A 3S47A 1GREA 3CGEA 2P8BA 3UCDA 1FFVC 1JRPA 1S7MA 4GRTA 3Q4DA 5M0ZA 2QJMA 4C77A 2PHHA 3I4KA 4YTPA 4LU6A 4Z44A 4DSHA 3RO6A 4H4SA 1FOHA 3RHAA 3QVRA 4ENLA 3UOXA 2YVGA 3ES8A 3IJIA 3BHKA 3DFYA 3GYJA 1OJCA 4BK1A 4ECHA 4A65A 2CHRA 3SZFA 4IL2A 4JY2A 1CBOA 3AE7A 1P2HA 4YTNA 4YWSA 3PO7A 2Q7VA 5EU9A 2XVJA 1BQGA 2PP3A 6ENLA 2PP0A 2C65A 3KD9A 2OLNA 4J36A 2WPEA 3NT6A 3B97A 1KKOA 3CGBA 3UXLA 1IUSA 1Q1RA 2ZBWA 2CULA 3FCPA 4Z2RA 2Q0KA 5FJOA 1GSNA 4IV9A 1GRGA 3TCSA 1IUVA 3H12A 1SJCA 2PCEA 1Q9IA 2XVEA 1EC7A 4GAVA 3VA8A 4U8MA 3JZUA 4OPLA 1TDOA 4B67A 1W4XA 2W0HA 1GESA 4HYRA 4ZCWA 3CAWA 3CK5A 3DGHA 2WPCA 2HQMA 2BK5A 3QJ4A 3TWBA 4GISA 3NGCX 3EPTA 2C7GA 3SN1A 2XLRA 5L46A 1MNSA 2YAUA 1R6WA 4G6GA 1CHUA 4Z1YA 4BK3A 2ZZ0A 4JHMA 4FI4A 2EQ7A 1Y56A 2XGZA 1D5TA 1D4CA 4A5LA 4GGBA 2XFQA 4OPTA 4JN8A 3RNMA 2WESA 4K8GA 1QO8A 2O9ZA 3STPA 3FIMB 2GR3A 2VVLG 2YG4A 2Z5YA 3I6EA 2R4EA 1E6EA 1DTNA 2WOVA 1T3QC 2GV8A 5JCKA 1KNRA 4B69A 2OLAA 3PS9A 5EB5A 3NVWB 2X8CA 3SZWA 3DJGX 3CB3A 1TRBA 3DGZA 4K2SA 4LA1A 3FBSA 2IVEA 1PDZA 4DNAA 4TLZA 3OZYA 4Y4MA 4TM4A 3T4WA 2OKTA 3OW1A 2XFOA 3DK4A 1N62C 1CC6A 5C2TA 4GYPC 3CXBA 2PGWA 3O0HA 4BJZA 2BS3A
chains in the Genus database with same CATH topology
4BV6A 4EQRA 4H4WA 3V3NA 2J3NA 1ZOVA 1JRXA 4CCRA 1GTHA 1LTXR 1PBFA 3AYJA 2BABA 2YM1A 2QCUA 3ADAB 1RYIA 4AP1A 3SFDA 4J33A 5C3JA 1KSUA 2YG6A 3UP5A 3EANA 1FCDA 3AEDA 1E7PA 2Y6QA 3ALMA 5BUKA 4NWZA 1TYPA 2JK6A 1L9CA 1PS9A 2XLTA 3ICRA 3ATQA 2V3BA 3UTHA 2YR4A 1XDIA 3AYLA 1DOEA 1JRYA 1KF6A 3KA7A 5IQ1A 1NENA 4C74A 4RG3A 4OPCA 4K5SA 2GAHB 3CNSA 2B7SA 4YSYA 5FS6A 1TDFA 2R46A 2TPRA 1ZX9A 3SM8A 4B68A 3HYWA 3QSMA 2JKCA 2H89A 3H8IA 3QSSA 1LPFA 4H2QA 3NNEA 1D4EA 3B3RA 2EQ6A 1IUUA 4HA6A 3RP7A 3I3LA 2WP9A 1NHSA 1XHCA 3QFAA 3QSEA 5FS8A 3D1CA 1PJ7A 1PJ6A 1H81A 1ZOYA 3CNJA 3DH9A 1PBBA 2GRTA 5KNLA 1GALA 1GRAA 1GERA 3LOVA 3UKQA 3CGDA 2C73A 2GQFA 3T37A 4K5RA 2WS3A 3AWIA 3CNTA 1NHQA 3HYVA 4ADWA 1TDNA 4B63A 2C70A 4TLXA 5BRTA 1OJ9A 4FX9A 1CC2A 1Y0PA 3AEEA 3UOZA 2R0GA 1DJNA 2WP6A 5KOWA 1GRFA 2YLXA 2XDOA 4ICYA 3NYEA 4NTDA 3SXIA 4GDPA 2WDVA 4Z2UA 3ZDNA 2YLRA 3D8XA 3F8DA 3V76A 4U2TA 3CTYA 3BNUA 3ITJA 3T0KA 4U8PA 2X3NA 4WX1A 2VQ7A 3NN6X 2Y6RA 1CJ4A 4NEVA 3P4RA 3L8KA 3VRBA 4C3XA 2E4GA 4TM1A 5M10A 5KRQA 1K0JA 3BI5A 1O5WA 2ACZA 2V5ZA 2GR0A 5KWFA 2C3CA 3CPIG 2B9WA 4JNAA 1AOGA 2ARDA 3SZ0A 1LQUA 2UZZA 2XVFA 2X99A 2NVKX 1LJ1A 1TDEA 1VQWA 1F3PA 4A99A 1Y56B 2XLUA 1KDGA 3T2YA 3ALLA 3C4NA 2WDQA 1XANA 1S2QA 3CN8A 4H4UA 4H4PA 3FMWA 5J7XA 2BCGG 3AD9B 3ATRA 1GRHA 2RABA 2C75A 1KN0A 2AAQA 2B7RA 4CBQA 1MXTA 3URHA 4UDRA 2B9YA 1FEBA 1NDAA 4TM0A 4YT0A 1DOBA 5HY5A 4M52A 1GEUA 1B8SA 1GOSA 4G73A 4UDPA 3EAOA 1YQ3A 1PN0A 2YLTA 2OAMA 3NRNA 2VOUA 1E1KA 2YLZA 1NHPA 2C66A 3HZLA 4DGKA 4JDRA 4A6NA 3AE3A 4AT0A 5KXJA 2ZZCA 1BGJA 3BI4A 1EL7A 3LB8A 2H88A 3T14A 1ZK7A 3RP8A 1VG0A 4II3A 4U8LA 4YTMA 3DA1A 3VRAA 3GD3A 4A9WA 1F6MA 2OLOA 3BNMA 4X9NA 1E1NA 3GSIA 3UKPA 2WU2A 2FJAA 1L0VA 3GDNA 2X8HA 4C3YA 1H2IA 3VQRA 3CPHG 5EOWA 2GR1A 1E39A 4REKA 2XFNA 2V61A 3AEAA 3HYXA 4IA6A 4Y4NA 2BXSA 1FL2A 3P1WA 2C3DA 4B66A 4B65A 3GMBA 3IF9A 4J34A 1NAAA 1YKJA 4K8DA 3NIXA 3ZYXA 5FS7A 1E1LA 1EL8A 1CL0A 2GVCA 4H4RA 1GRBA 2JBVA 3AE4A 2C4CA 3UP4A 1H6VA 1CJ2A 2CVJA 5EB4A 1DJQA 1JRZA 3M0OA 3AYIA 1FECA 2X8GA 1OJTA 2EQ9A 1L9EA 4H4ZA 3IWAA 2YLSA 2V3AA 5JCIA 2APGA 1GTEA 3NG7X 4A7AA 4XWZA 4EQWA 1CJCA 1SEZA 4Z24A 1CC4A 2GF3A 4ZN0A 4TM3A 3PVCA 2VVMA 4YXDA 3C96A 3NH3X 3AEBA 4A6NB 1GT8A 4U8JA 1P2EA 4GAPA 3CGCA 3KPKA 2GQWA 1PBDA 3GRTA 5DBJA 1YQZA 5JCMA 2GEWA 1GNDA 1H7WA 2WEUA 2I0ZA 4OPGA 1ZDLA 4GCMA 4U8KA 2A89A 2XVHA 4C5OA 1ONFA 2YM2A 1VG9A 2V6OA 1V59A 3FG2P 2VZ2A 3B6DA 1QJDA 3K7TA 3NK2X 4AT2A 2FBWA 2BRYA 4WCTA 2JAEA 3F8RA 3NTAA 3L1RA 4O5QA 4AOXA 3D9XA 1H7XA 1KFYA 1JEHA 2Q6UA 3KPFA 2WDRA 4LIIA 3AE1A 1ZMCA 4XWRA 1MOKA 2B76A 2BXRA 3IHMA 4RSLA 4BURA 2TMDA 1NPXA 1D7YA 1S2YA 3LADA 2JB1A 4YKGA 1BWCA 3BHFA 1L9DA 2BRAA 2NPXA 4U2LA 1F8RA 3KVEA 4A79A 4CNJA 4JN9A 4GDEA 4I58A 5EBKA 2XFPA 2BC0A 3DJEA 4AP3A 1RP0A 1GREA 3CGEA 2YG7A 2JB3A 5KMPA 2FJBA 4H2PA 3RP6A 5JRBA 1S7MA 4YSHA 1B37A 4GRTA 5M0ZA 4CCQA 2R0CA 2VQBA 2WETA 3AXBA 4KPRA 3SGLA 1IUTA 4KX6A 4C77A 5BVAA 4OPUA 4JQ9A 4YKFA 1Z6LA 3UKAA 4CY6A 2Z5XA 2PHHA 3NYCA 4G9KA 4EIPA 1PBCA 4H4QA 4NTCA 2GMJA 4YTPA 1PXAA 4LU6A 5TR3A 5KMQA 4Z44A 1M64A 1K0IA 4DSHA 2GH5A 4FK1C 4H4SA 2YR6A 1FOHA 3RHAA 1VRQB 4JY3A 3QVRA 2XYOA 4J2WA 1TDKA 3T31A 5ER0A 2BA9A 4EIQA 1JU2A 3NHOX 3UKKA 2R4JA 3UOVA 2BCPA 5KVIA 5JCNA 2YVGA 2VRMA 5CKUA 3UOXA 3BHKA 3Q9TA 4CNKA 1B4VA 4P9SA 2FJDA 3SY4A 3KU9A 5HYMA 2R9ZA 4HB9A 2WQYA 3GYJA 1ZKQA 1IUXA 1OJCA 5CQFA 4BK1A 4ECHA 4A65A 3NTDA 3UTFA 2IVDA 3SZFA 4IVMB 4DSGA 4K2XA 1N1PA 4X4JA 3AE5A 1EL9A 3K7MX 4JY2A 4Z25A 3LXDA 3AE2A 5U25A 4D03A 1N4WA 4Y4LA 3KLJA 3T2KA 4EM4A 4BJYA 1CBOA 3AE7A 1GXFA 1P2HA 1ZP0A 4H2NA 4APNA 2VRLA 3K30A 4ZCDA 5KOXA 4YTNA 1H83A 4RG4A 3PO7A 1K0LA 2Q7VA 1NHRA 3DJJA 4H4XA 2XLSA 2OALA 1PXCA 2R45A 2XVJA 4GF7A 3L5OA 3ISHA 3NK1X 1BF3A 2WU5A 2GMHA 1NEKA 2C65A 3G5RA 3KD9A 3COXA 3FPZA 2YWLA 2C67A 2OLNA 3GYIA 4H4YA 4J36A 3LZWA 2WPEA 2YR5A 3AE6A 3NT6A 3G5SA 3II4A 3CGBA 3DK8A 1IUSA 3AEFA 4K7ZA 4J31A 1Q1RA 2ZBWA 4FK1A 1N4UA 2CULA 4Z2RA 4EQXA 2BK3A 4NEWA 5J60A 2Q0KA 4NTEA 5KMRA 2YLWA 1JNZA 4FDCB 3P9UA 2GB0A 1KNPA 2BK4A 1PXBA 3SQPA 4XXGA 3UKFA 3UOYA 1GSNA 1S3BA 2JB2A 1ZY8A 1GRGA 5JCLA 4YWOA 1EBDA 3NK0X 4IV9A 1IUVA 4X9MA 1D7LA 3S61A 1Q9IA 2GR2A 2WBAA 2XVEA 4EMIA 4EQSA 4GAVA 2E1MA 3NN0X 1TYTA 4U8MA 4OVIA 4MJWA 1CJ3A 1LVLA 3NYFA 4OPLA 1TDOA 4B67A 3VR9A 1GRTA 4U8OA 1Q1WA 1ZMDA 5LV9A 2V60A 1KSSA 1W4XA 2YVFA 2OA1A 2W0HA 1GESA 1OJAA 4H7UA 3C4AA 5KVHA 2X50A 1REOA 4GUVA 2Q0LA 2XFUA 4EMWA 3AD7B 3K7QX 4B1BA 4OPIA 3IHGA 4H2RA 1QLBA 3NLCA 1GETA 1E1MA 1FEAA 1H84A 1PBEA 1XPQA 5FMHA 1BKWA 3DGHA 1O94A 3NKSA 2WPCA 2HQMA 3PG6A 2BK5A 2PYXA 4UDQA 4K22A 3H4KA 3QJ4A 4N9XA 3AECA 5GRTA 5U1OA 1RSGA 2ZZBA 3QFBA 4NZHA 4Z2TA 4U8IA 1EL5A 1GPEA 4CY8A 3NGCX 3BI2A 3CNPA 3AE8A 3GYXA 3EPTA 2C7GA 1O95A 3REDA 1M6IA 5KMSA 3Q6JA 2RGJA 2WOIA 1B5QA 2XLRA 1PHHA 3CMMA 3R9UA 4U2SA 3UKLA 5L46A 3P4PA 4G6GA 2YAUA 3SYIA 3LJPA 5BULA 3VRDB 3G5QA 1S3EA 4YSXA 5FS9A 1CHUA 2QA2A 3UTEA 5U63A 3WE0A 4H4VA 1IJHA 4BK3A 2ZZ0A 1HYUA 2C72A 1X31B 3SZCA 2EQ7A 2AR8A 1JOAA 1Y56A 1LV0A 4Z26A 2WPFA 1YY5A 2BS2A 2CFYA 3OC4A 2A87A 2WP5A 1K4QA 3M12A 1F8SA 3ALJA 1D5TA 1D4CA 2GAGB 3GRSA 4A5LA 2QA1A 4J57A 3CPJG 3LZXA 3GMCA 4USQA 5HHFA 2XFQA 4OPTA 1GV4A 4G6HA 3RNMA 2B9XA 4NNJA 1DODA 4G74A 2WESA 2R0PA 1QO8A 2XLPA 2O9ZA 1BGNA 4II2A 2C76A 5GSNA 2XCGA 3FIMB 3AB1A 2GR3A 4OCGA 2YVJA 2VVLG 3T2ZA 1DXLA 4ZCCA 3GWDA 2YG4A 3ABVA 2FJEA 2RGHA 4E0VA 2AQJA 1D4DA 3CNDA 1UKVG 5IQ4A 2Z5YA 3VR8A 2R4EA 1E6EA 1CF3A 1YQ4A 2RGOA 2DKIA 3AE9A 4AOSA 3DK9A 2WOVA 4H50A 3KKJA 2IIDA 1LQTA 2GV8A 5JCKA 3H8LA 4CRTA 2VVLA 3IC9A 1IUWA 3AD8B 1KNRA 1JNRA 4B69A 3PS9A 5EB5A 3UTGA 1BZLA 2WOWA 4IVOB 4PABA 1PDHA 4D04A 2E5VA 2YG3A 2X8CA 1COYA 3SZWA 3DJGX 3OZ2A 2BYBA 2CDUA 4J56A 2YG5A 3EF6A 4U8NA 2A8XA 4I59A 1DOCA 2WHDA 4Z43A 5HXIA 1TRBA 1DNCA 3DGZA 3F8PA 4YSZA 3ICSA 1PJ5A 3S5WA 4O5UA 4LA1A 4EMJA 3UKHA 2BC1A 3FBSA 3P4QA 1VDCA 2IVEA 4B64A 1H82A 1NG3A 3E1TA 3P4SA 4DNAA 4PAAA 1NG4A 1H86A 4TLZA 3CIRA 4TM4A 4Y4MA 4BK2A 3SX6A 1MO9A 4H4TA 3I6DA 2BACA 3QVPA 2XFOA 2F5ZA 3DK4A 3GDPA 2DKHA 1CC6A 3UCLA 3SFEA 5C2TA 5IPYA 2YQUA 1N4VA 1OJDA 3AEGA 3DJDA 2XVIA 4UP3A 2EQ8A 3V3OA 2QAEA 3O0HA 4USRA 3GD4A 4OPDA 4GR1A 3ICTA 4BJZA 4EM3A 4IA5A 4JNQA 3GWFA 1F8WA 1ELIA 3M13A 2BS3A 3DMEA 2C64A 2BS4A 3JSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BV6 A;  4EQR A;  4H4W A;  3V3N A;  2J3N A;  1ZOV A;  1JRX A;  4CCR A;  1GTH A;  1LTX R;  1PBF A;  3AYJ A;  2BAB A;  2YM1 A;  2QCU A;  3ADA B;  1RYI A;  4AP1 A;  3SFD A;  4J33 A;  5C3J A;  1KSU A;  2YG6 A;  3UP5 A;  3EAN A;  1FCD A;  3AED A;  1E7P A;  2Y6Q A;  3ALM A;  5BUK A;  1TYP A;  2JK6 A;  1L9C A;  1PS9 A;  2XLT A;  3ICR A;  3ATQ A;  2V3B A;  3UTH A;  2YR4 A;  1XDI A;  3AYL A;  1DOE A;  1JRY A;  1KF6 A;  3KA7 A;  5IQ1 A;  1NEN A;  4C74 A;  4RG3 A;  4OPC A;  4K5S A;  2GAH B;  3CNS A;  2B7S A;  4YSY A;  5FS6 A;  1TDF A;  2R46 A;  2TPR A;  1ZX9 A;  3SM8 A;  4B68 A;  3QSM A;  2JKC A;  2H89 A;  3H8I A;  3QSS A;  1LPF A;  4H2Q A;  3NNE A;  1D4E A;  3B3R A;  2EQ6 A;  1IUU A;  4HA6 A;  3RP7 A;  3I3L A;  2WP9 A;  1NHS A;  1XHC A;  3QFA A;  3QSE A;  5FS8 A;  3D1C A;  1PJ7 A;  1PJ6 A;  1H81 A;  1ZOY A;  3CNJ A;  3DH9 A;  1PBB A;  2GRT A;  1GAL A;  1GRA A;  1GER A;  3LOV A;  3UKQ A;  3CGD A;  2C73 A;  2GQF A;  3T37 A;  4K5R A;  2WS3 A;  3AWI A;  3CNT A;  1NHQ A;  4ADW A;  1TDN A;  4B63 A;  2C70 A;  4TLX A;  5BRT A;  1OJ9 A;  4FX9 A;  1CC2 A;  1Y0P A;  3AEE A;  3UOZ A;  2R0G A;  1DJN A;  2WP6 A;  5KOW A;  1GRF A;  2YLX A;  2XDO A;  4ICY A;  3NYE A;  4NTD A;  4GDP A;  2WDV A;  4Z2U A;  3ZDN A;  2YLR A;  3D8X A;  3F8D A;  3V76 A;  4U2T A;  3CTY A;  3BNU A;  3ITJ A;  4U8P A;  2X3N A;  4WX1 A;  2VQ7 A;  3NN6 X;  2Y6R A;  1CJ4 A;  4NEV A;  3P4R A;  3L8K A;  3VRB A;  4C3X A;  2E4G A;  4TM1 A;  5M10 A;  5KRQ A;  1K0J A;  3BI5 A;  1O5W A;  2ACZ A;  2V5Z A;  2GR0 A;  5KWF A;  2C3C A;  3CPI G;  2B9W A;  4JNA A;  1AOG A;  2ARD A;  1LQU A;  2UZZ A;  2XVF A;  2X99 A;  2NVK X;  1LJ1 A;  1TDE A;  1VQW A;  1F3P A;  4A99 A;  1Y56 B;  2XLU A;  1KDG A;  3ALL A;  3C4N A;  2WDQ A;  1XAN A;  1S2Q A;  3CN8 A;  4H4U A;  4H4P A;  3FMW A;  5J7X A;  2BCG G;  3AD9 B;  3ATR A;  1GRH A;  2RAB A;  2C75 A;  4CBQ A;  2AAQ A;  2B7R A;  1MXT A;  3URH A;  4UDR A;  2B9Y A;  1FEB A;  1NDA A;  4TM0 A;  4YT0 A;  1DOB A;  5HY5 A;  4M52 A;  1GEU A;  1B8S A;  1GOS A;  4UDP A;  3EAO A;  1YQ3 A;  1PN0 A;  2YLT A;  2OAM A;  3NRN A;  2VOU A;  1E1K A;  2YLZ A;  1NHP A;  2C66 A;  3HZL A;  4DGK A;  4JDR A;  4A6N A;  3AE3 A;  4AT0 A;  5KXJ A;  2ZZC A;  1BGJ A;  3BI4 A;  1EL7 A;  3LB8 A;  2H88 A;  1ZK7 A;  3RP8 A;  1VG0 A;  4U8L A;  4YTM A;  3DA1 A;  3VRA A;  3GD3 A;  4A9W A;  1F6M A;  2OLO A;  3BNM A;  4X9N A;  1E1N A;  3GSI A;  3UKP A;  2WU2 A;  2FJA A;  1L0V A;  3GDN A;  2X8H A;  4C3Y A;  3VQR A;  3CPH G;  5EOW A;  2GR1 A;  1E39 A;  4REK A;  2XFN A;  2V61 A;  3AEA A;  4IA6 A;  4Y4N A;  2BXS A;  1FL2 A;  3P1W A;  2C3D A;  4B66 A;  4B65 A;  3GMB A;  3IF9 A;  4J34 A;  1NAA A;  1YKJ A;  4K8D A;  3NIX A;  3ZYX A;  5FS7 A;  1E1L A;  1EL8 A;  1CL0 A;  2GVC A;  4H4R A;  1GRB A;  2JBV A;  3AE4 A;  3UP4 A;  1H6V A;  1CJ2 A;  2CVJ A;  5EB4 A;  1DJQ A;  1JRZ A;  3M0O A;  3AYI A;  1FEC A;  2X8G A;  1OJT A;  2EQ9 A;  1L9E A;  4H4Z A;  3IWA A;  2YLS A;  5JCI A;  2APG A;  2V3A A;  1GTE A;  3NG7 X;  4A7A A;  4XWZ A;  4EQW A;  1CJC A;  1SEZ A;  4Z24 A;  1CC4 A;  2GF3 A;  4ZN0 A;  4TM3 A;  3PVC A;  2VVM A;  4YXD A;  3C96 A;  3NH3 X;  3AEB A;  4A6N B;  1GT8 A;  4U8J A;  1P2E A;  3CGC A;  2GQW A;  1PBD A;  3GRT A;  5DBJ A;  1YQZ A;  5JCM A;  2GEW A;  1GND A;  1H7W A;  2WEU A;  2I0Z A;  4OPG A;  1ZDL A;  4GCM A;  4U8K A;  2A89 A;  2XVH A;  4C5O A;  1ONF A;  2YM2 A;  1VG9 A;  2V6O A;  1V59 A;  3FG2 P;  2VZ2 A;  3B6D A;  1QJD A;  3K7T A;  3NK2 X;  4AT2 A;  2FBW A;  4WCT A;  2JAE A;  3F8R A;  3NTA A;  3L1R A;  4O5Q A;  4AOX A;  1H7X A;  1KFY A;  1JEH A;  2Q6U A;  3KPF A;  2WDR A;  4LII A;  3AE1 A;  1ZMC A;  4XWR A;  1MOK A;  2B76 A;  2BXR A;  3IHM A;  4RSL A;  4BUR A;  2TMD A;  1NPX A;  1D7Y A;  1S2Y A;  3LAD A;  2JB1 A;  4YKG A;  1BWC A;  3BHF A;  1L9D A;  2NPX A;  4U2L A;  1F8R A;  3KVE A;  4A79 A;  4CNJ A;  4JN9 A;  4GDE A;  4I58 A;  5EBK A;  2XFP A;  2BC0 A;  3DJE A;  4AP3 A;  1RP0 A;  1GRE A;  3CGE A;  2YG7 A;  2JB3 A;  2FJB A;  4H2P A;  3RP6 A;  4YSH A;  1B37 A;  4GRT A;  5M0Z A;  4CCQ A;  2R0C A;  2VQB A;  2WET A;  3AXB A;  4KPR A;  3SGL A;  1IUT A;  4KX6 A;  4C77 A;  5BVA A;  4OPU A;  4JQ9 A;  4YKF A;  1Z6L A;  3UKA A;  4CY6 A;  2Z5X A;  2PHH A;  3NYC A;  4EIP A;  1PBC A;  4H4Q A;  4NTC A;  2GMJ A;  4YTP A;  1PXA A;  4LU6 A;  5TR3 A;  4Z44 A;  1M64 A;  1K0I A;  4DSH A;  2GH5 A;  4FK1 C;  4H4S A;  2YR6 A;  1FOH A;  3RHA A;  1VRQ B;  4JY3 A;  3QVR A;  2XYO A;  4J2W A;  1TDK A;  5ER0 A;  2BA9 A;  4EIQ A;  1JU2 A;  3NHO X;  3UKK A;  2R4J A;  3UOV A;  2BCP A;  5KVI A;  5JCN A;  2YVG A;  2VRM A;  5CKU A;  3UOX A;  3BHK A;  3Q9T A;  4CNK A;  1B4V A;  4P9S A;  2FJD A;  3KU9 A;  5HYM A;  2R9Z A;  4HB9 A;  2WQY A;  3GYJ A;  1ZKQ A;  1IUX A;  1OJC A;  5CQF A;  4BK1 A;  4ECH A;  4A65 A;  3NTD A;  3UTF A;  2IVD A;  4IVM B;  4DSG A;  4K2X A;  1N1P A;  4X4J A;  3AE5 A;  1EL9 A;  3K7M X;  4JY2 A;  4Z25 A;  3LXD A;  3AE2 A;  5U25 A;  4D03 A;  1N4W A;  4Y4L A;  3KLJ A;  4EM4 A;  4BJY A;  1CBO A;  3AE7 A;  1GXF A;  1P2H A;  1ZP0 A;  4H2N A;  4APN A;  2VRL A;  3K30 A;  4ZCD A;  5KOX A;  4YTN A;  1H83 A;  4RG4 A;  3PO7 A;  1K0L A;  2Q7V A;  1NHR A;  3DJJ A;  4H4X A;  2XLS A;  2OAL A;  1PXC A;  2R45 A;  2XVJ A;  4GF7 A;  3ISH A;  3NK1 X;  1BF3 A;  2WU5 A;  2GMH A;  1NEK A;  2C65 A;  3G5R A;  3KD9 A;  3COX A;  3FPZ A;  2YWL A;  2C67 A;  2OLN A;  3GYI A;  4H4Y A;  4J36 A;  3LZW A;  2WPE A;  2YR5 A;  3AE6 A;  3NT6 A;  3G5S A;  3II4 A;  3CGB A;  3DK8 A;  1IUS A;  3AEF A;  4K7Z A;  4J31 A;  1Q1R A;  2ZBW A;  4FK1 A;  1N4U A;  2CUL A;  4Z2R A;  4EQX A;  2BK3 A;  4NEW A;  5J60 A;  2Q0K A;  4NTE A;  2YLW A;  1JNZ A;  4FDC B;  3P9U A;  2GB0 A;  1KNP A;  2BK4 A;  1PXB A;  3SQP A;  4XXG A;  3UKF A;  3UOY A;  1GSN A;  1S3B A;  2JB2 A;  1ZY8 A;  1GRG A;  5JCL A;  4YWO A;  1EBD A;  3NK0 X;  4IV9 A;  1IUV A;  4X9M A;  1D7L A;  3S61 A;  1Q9I A;  2GR2 A;  2WBA A;  2XVE A;  4EMI A;  4EQS A;  2E1M A;  3NN0 X;  1TYT A;  4U8M A;  4OVI A;  4MJW A;  1CJ3 A;  1LVL A;  3NYF A;  4OPL A;  1TDO A;  4B67 A;  3VR9 A;  1GRT A;  4U8O A;  1Q1W A;  1ZMD A;  5LV9 A;  2V60 A;  1KSS A;  1W4X A;  2YVF A;  2OA1 A;  2W0H A;  1GES A;  1OJA A;  4H7U A;  3C4A A;  5KVH A;  2X50 A;  1REO A;  4GUV A;  2Q0L A;  2XFU A;  4EMW A;  3AD7 B;  3K7Q X;  4B1B A;  4OPI A;  3IHG A;  4H2R A;  1QLB A;  3NLC A;  1GET A;  1E1M A;  1FEA A;  1H84 A;  1PBE A;  1XPQ A;  5FMH A;  1BKW A;  3DGH A;  1O94 A;  3NKS A;  2WPC A;  2HQM A;  2BK5 A;  2PYX A;  4UDQ A;  4K22 A;  3H4K A;  3QJ4 A;  4N9X A;  3AEC A;  5GRT A;  5U1O A;  1RSG A;  2ZZB A;  3QFB A;  4NZH A;  4Z2T A;  4U8I A;  1EL5 A;  1GPE A;  4CY8 A;  3NGC X;  3BI2 A;  3CNP A;  3AE8 A;  3EPT A;  2C7G A;  1O95 A;  3RED A;  1M6I A;  3Q6J A;  2RGJ A;  2WOI A;  1B5Q A;  2XLR A;  1PHH A;  3R9U A;  3UKL A;  4U2S A;  5L46 A;  3P4P A;  2YAU A;  3LJP A;  5BUL A;  3VRD B;  3G5Q A;  1S3E A;  4YSX A;  5FS9 A;  1CHU A;  2QA2 A;  3UTE A;  5U63 A;  3WE0 A;  4H4V A;  1IJH A;  4BK3 A;  2ZZ0 A;  1HYU A;  2C72 A;  1X31 B;  2EQ7 A;  2AR8 A;  1JOA A;  1Y56 A;  1LV0 A;  4Z26 A;  2WPF A;  1YY5 A;  2BS2 A;  2CFY A;  3OC4 A;  2A87 A;  2WP5 A;  1K4Q A;  3M12 A;  1F8S A;  3ALJ A;  1D5T A;  1D4C A;  2GAG B;  3GRS A;  4A5L A;  2QA1 A;  4J57 A;  3CPJ G;  3LZX A;  3GMC A;  4USQ A;  5HHF A;  2XFQ A;  4OPT A;  1GV4 A;  3RNM A;  2B9X A;  1DOD A;  2WES A;  2R0P A;  1QO8 A;  2XLP A;  2O9Z A;  1BGN A;  2C76 A;  5GSN A;  2XCG A;  3FIM B;  3AB1 A;  2GR3 A;  4OCG A;  2YVJ A;  2VVL G;  1DXL A;  4ZCC A;  3GWD A;  2YG4 A;  3ABV A;  2FJE A;  2RGH A;  4E0V A;  2AQJ A;  1D4D A;  3CND A;  1UKV G;  5IQ4 A;  2Z5Y A;  3VR8 A;  2R4E A;  1E6E A;  1CF3 A;  1YQ4 A;  2RGO A;  2DKI A;  3AE9 A;  4AOS A;  3DK9 A;  2WOV A;  4H50 A;  3KKJ A;  2IID A;  1LQT A;  2GV8 A;  5JCK A;  3H8L A;  4CRT A;  2VVL A;  3IC9 A;  1IUW A;  3AD8 B;  1KNR A;  1JNR A;  4B69 A;  3PS9 A;  5EB5 A;  3UTG A;  1BZL A;  2WOW A;  4IVO B;  4PAB A;  1PDH A;  4D04 A;  2E5V A;  2YG3 A;  2X8C A;  1COY A;  3DJG X;  3OZ2 A;  2BYB A;  2CDU A;  4J56 A;  2YG5 A;  3EF6 A;  4U8N A;  2A8X A;  4I59 A;  1DOC A;  2WHD A;  4Z43 A;  5HXI A;  1TRB A;  1DNC A;  3DGZ A;  3F8P A;  4YSZ A;  3ICS A;  1PJ5 A;  3S5W A;  4O5U A;  4LA1 A;  4EMJ A;  3UKH A;  2BC1 A;  3FBS A;  3P4Q A;  1VDC A;  2IVE A;  4B64 A;  1H82 A;  1NG3 A;  3E1T A;  3P4S A;  4DNA A;  4PAA A;  1NG4 A;  1H86 A;  4TLZ A;  3CIR A;  4TM4 A;  4Y4M A;  4BK2 A;  1MO9 A;  4H4T A;  3I6D A;  2BAC A;  3QVP A;  2XFO A;  2F5Z A;  3DK4 A;  3GDP A;  2DKH A;  1CC6 A;  3UCL A;  3SFE A;  5C2T A;  5IPY A;  2YQU A;  1N4V A;  1OJD A;  3AEG A;  3DJD A;  2XVI A;  4UP3 A;  2EQ8 A;  3V3O A;  2QAE A;  3O0H A;  4USR A;  3GD4 A;  4OPD A;  4GR1 A;  3ICT A;  4BJZ A;  4EM3 A;  4IA5 A;  4JNQ A;  3GWF A;  1F8W A;  1ELI A;  3M13 A;  2BS3 A;  3DME A;  2C64 A;  2BS4 A;  3JSK A; 
#chains in the Genus database with same CATH topology
 4BV6 A;  5BOF A;  3V3N A;  2E5A A;  3DG3 A;  1PBF A;  3SR6 B;  2BAB A;  1RYI A;  1WUE A;  1FCD A;  3ICR A;  2V3B A;  1KF6 A;  2HNE A;  1JDF A;  4YSY A;  2R46 A;  1ZX9 A;  1WYG A;  3QSM A;  3ES7 A;  3NNE A;  3B3R A;  3R0U A;  4HA6 A;  3QLD A;  3I3L A;  3RP7 A;  1NHS A;  3QFA A;  4MMW A;  1PJ6 A;  3CNJ A;  1PBB A;  1GRA A;  3LOV A;  2RDX A;  2GQF A;  4ADW A;  4B63 A;  1CC2 A;  3RCY A;  4ICY A;  3NYE A;  3SXI A;  4A3R A;  4Z2U A;  2YLR A;  1OEP A;  3V76 A;  4U2T A;  3T0K A;  3N6J A;  2VQ7 A;  3U9I A;  3NZG A;  4NEV A;  2E4G A;  1SB3 B;  4TM1 A;  2ACZ A;  5KWF A;  2C3C A;  1TZZ A;  2B9W A;  2POD A;  2XVF A;  1LJ1 A;  3DG6 A;  3ALL A;  4H4U A;  3FMW A;  2BCG G;  2PPG A;  3THU A;  1KN0 A;  1MXT A;  1NDA A;  5HY5 A;  4HCD A;  4G73 A;  3JVA A;  3EAO A;  3GY1 A;  4DWD A;  4JDR A;  1BGJ A;  2H88 A;  3MQT A;  4YTM A;  1F6M A;  3GSI A;  2WU2 A;  1H2I A;  3VQR A;  7ENL A;  2GR1 A;  1E39 A;  2PGE A;  3GMB A;  1YKJ A;  3ZYX A;  3NIX A;  3RGT A;  3UJE A;  1E1L A;  2I5Q A;  1EL8 A;  1TKK A;  4HCH A;  1GRB A;  3AE4 A;  3T8Q A;  2C4C A;  3UP4 A;  5EB4 A;  1CJ2 A;  2W54 A;  3DGB A;  2YLS A;  5JCI A;  4EQW A;  4Z24 A;  4TM3 A;  3C96 A;  3A7R A;  3AEB A;  2HXU A;  2GQW A;  5DBJ A;  1H7W A;  1ZXI C;  2I0Z A;  1MDL A;  2XVH A;  1ONF A;  2V6O A;  3NK2 X;  2FYM A;  2FBW A;  1RVK A;  2BRY A;  2JAE A;  4O5Q A;  4AOX A;  1H7X A;  4XWR A;  1ZMC A;  2BXR A;  4BUR A;  1SJB A;  2XH4 A;  2NPX A;  4JN7 A;  4J1O A;  2JB3 A;  4H2P A;  1B37 A;  2GGH A;  2WET A;  4KPR A;  1VQZ A;  2OG9 A;  4KX6 A;  1PBC A;  4E6M A;  4ROP A;  3UJ2 A;  1XPY A;  4FK1 C;  2YR6 A;  4JY3 A;  3T31 A;  5ER0 A;  3UKK A;  2BCP A;  2OQY A;  5CKU A;  3Q9T A;  4P9S A;  3D47 A;  4HB9 A;  1IUX A;  2IVD A;  3ETR B;  4DSG A;  3QTP A;  1NU5 A;  3NXL A;  1N1P A;  4X4J A;  3AE5 A;  1MUC A;  4Z25 A;  3AE2 A;  5U25 A;  3KLJ A;  4EM4 A;  3QN3 A;  1GXF A;  1ZP0 A;  3K30 A;  4ZCD A;  3R1Z A;  3PWG A;  3QSE A;  1K0L A;  1NHR A;  1PXC A;  2R45 A;  1BF3 A;  2GMH A;  1NEK A;  3JW7 A;  3FPZ A;  1X2G A;  3LZW A;  3G5S A;  1EBG A;  3DK8 A;  4K7Z A;  4EWJ A;  1N4U A;  4NEW A;  5KMR A;  1JNZ A;  4FDC B;  3P9U A;  3IJL A;  5FJT A;  4J3Z A;  2GB0 A;  4XXG A;  3UKF A;  1S3B A;  2JB2 A;  1ZY8 A;  1EBD A;  1KKR A;  1D7L A;  4EQS A;  3NN0 X;  1TYT A;  4OVI A;  1LVL A;  3NYF A;  2GSH A;  3VR9 A;  4U8O A;  3T9P A;  3T6C A;  1REO A;  2XFU A;  3K7Q X;  3IHG A;  1QLB A;  3ZLF A;  2PMQ A;  3R11 A;  1BKW A;  2PYX A;  3PG6 A;  4N9X A;  3MY9 A;  3NO1 A;  5GRT A;  1EL5 A;  3BI2 A;  3AE8 A;  3GYX A;  4DX3 A;  3RED A;  4H1Z A;  4U2S A;  3SYI A;  3VRD B;  2OZ8 A;  4YSX A;  4GIR A;  5U63 A;  1IJH A;  2C72 A;  2AR8 A;  4Z26 A;  1YY5 A;  2CFY A;  2A87 A;  4DYE A;  4HN8 A;  2QA1 A;  2PTX A;  4J57 A;  3CPJ G;  3LZX A;  4G6H A;  1N60 C;  1DOD A;  5FJP A;  3HPF A;  2R0P A;  2XLP A;  4II2 A;  2C76 A;  3R25 A;  5GSN A;  2AL2 A;  2XSX A;  1DXL A;  2FJE A;  2RGH A;  2AQJ A;  3CND A;  1UKV G;  5IQ4 A;  3UJR A;  4KEM A;  4IT1 A;  1CF3 A;  2MNR A;  4AOS A;  4H50 A;  1LQT A;  3H8L A;  4CRT A;  1IUW A;  1JNR A;  3UTG A;  1BZL A;  1PDH A;  2E5V A;  3GO2 A;  2YG5 A;  3EF6 A;  2A8X A;  2WHD A;  1PJ5 A;  3S5W A;  1V97 A;  3P4Q A;  2OZT A;  1NG3 A;  4PAA A;  4K1W A;  1NG4 A;  2AL2 B;  4BK2 A;  3SX6 A;  2OFJ A;  2DKH A;  3EEZ A;  4KWS A;  3V3O A;  2QAE A;  4KPL A;  4USR A;  4OPD A;  1FIQ B;  4JNQ A;  4HNL A;  2PP1 A;  2PTZ A;  3GWF A;  1F8W A;  4EQR A;  3SN4 A;  1FHV A;  1ZOV A;  1LTX R;  1EBH A;  2OVL A;  2PSN A;  5C3J A;  4J33 A;  1KSU A;  3UP5 A;  4IP5 A;  2Y6Q A;  1TYP A;  2JK6 A;  1L9C A;  2XLT A;  1P48 A;  4C74 A;  4K5S A;  2B7S A;  2GGG A;  2TPR A;  4B68 A;  3H8I A;  2H89 A;  3QSS A;  2WP9 A;  5FS8 A;  2ZAD A;  4GFI A;  1GAL A;  3CGD A;  4K5R A;  3H70 A;  4GYP A;  1NHQ A;  5FJR A;  3MSY A;  5BRT A;  4TLX A;  3U4F A;  3AEE A;  3UOZ A;  2R0G A;  3UXK A;  3DDM A;  1GRF A;  1R0M A;  3ZLG A;  4GDP A;  4M6U A;  3S5S A;  4IL0 A;  3TWA A;  4C3X A;  1E9I A;  5KRQ A;  5M10 A;  3BJS A;  2PU0 A;  2PTW A;  2ARD A;  3SZ0 A;  2UZZ A;  5G5H B;  2NVK X;  1W6T A;  1TDE A;  1Y56 B;  2XLU A;  1XAN A;  3AD9 B;  1GRH A;  4E5T A;  2GL5 A;  3DIP A;  2B7R A;  4UDR A;  3URH A;  2B9Y A;  2OAM A;  3H8A A;  5KXJ A;  3PFR A;  3VRA A;  4A9W A;  4A35 A;  2OLO A;  1JCT A;  3MZN A;  3UKP A;  1L0V A;  3GDN A;  2X8H A;  4C3Y A;  4B66 A;  2C3D A;  3IF9 A;  3IJQ A;  4J34 A;  2POZ A;  2P0I A;  1H6V A;  2FKP A;  3M0O A;  1FEC A;  3V5F A;  2P88 A;  2EQ9 A;  1L9E A;  4H4Z A;  3IWA A;  2V3A A;  2APG A;  3SN0 A;  3NG7 X;  4IP4 A;  3N6H A;  4XWZ A;  2GF3 A;  1NEL A;  3PVC A;  2QGY A;  3BOX A;  4GAP A;  3NVZ B;  1GND A;  2P3Z A;  2A89 A;  2YM2 A;  3FG2 P;  2VZ2 A;  3K7T A;  4AT2 A;  2OZ3 A;  4WCT A;  3F8R A;  1JEH A;  5ENL A;  2WDR A;  3AE1 A;  1NPX A;  3UGV A;  3BHF A;  2BRA A;  5EBK A;  3DER A;  2PS2 A;  2YG7 A;  2FJB A;  5JRB A;  3HRD C;  1SJD A;  2VQB A;  3AXB A;  4JQ9 A;  4YKF A;  4CY6 A;  3NYC A;  4G9K A;  4EIP A;  4H4Q A;  4NTC A;  1PXA A;  2W3S A;  5TR3 A;  5KMQ A;  1K0I A;  1L8P A;  4J2W A;  1EC9 A;  1TDK A;  1JPM A;  2BA9 A;  1JU2 A;  3UOV A;  4H19 A;  5JCN A;  4CNK A;  2FJD A;  2R9Z A;  4KT2 A;  2AKZ A;  1ZKQ A;  5CQF A;  3SQS A;  3UTF A;  4K2X A;  1EL9 A;  3K7M X;  2XH0 A;  3LXD A;  4D03 A;  3DFH A;  4Y4L A;  1STZ A;  3T2K A;  4BJY A;  4H2N A;  4APN A;  2VRL A;  3GD6 A;  1H83 A;  2QDD A;  3D46 A;  3DJJ A;  4H4X A;  2OAL A;  3L5O A;  3EUB 3;  3NK1 X;  3G5R A;  3FYY A;  3COX A;  3TQP A;  3MWC A;  4H4Y A;  2YR5 A;  3CT2 A;  3AEF A;  4FK1 A;  2BK3 A;  5J60 A;  1KNP A;  2BK4 A;  3SQP A;  3UOY A;  5JCL A;  4X9M A;  4YWO A;  3P3B A;  2GR2 A;  3TOY A;  2E1M A;  1P43 A;  3UCC A;  3R07 C;  1GRT A;  1Q1W A;  1ZMD A;  5LV9 A;  2V60 A;  2YVF A;  2XH7 A;  1OJA A;  4H7U A;  2X50 A;  4GUV A;  2Q0L A;  3AD7 B;  4B1B A;  4H2R A;  3NLC A;  1E1M A;  1PBE A;  1H84 A;  3P0W A;  1XPQ A;  3NKS A;  5FMH A;  1O94 A;  3AEC A;  5U1O A;  1RSG A;  4U8I A;  1GPE A;  2RGJ A;  2PA6 A;  3UKL A;  1PHH A;  3CMM A;  2O56 A;  4GGH A;  3WE0 A;  1HYU A;  1X31 B;  1JOA A;  2WPF A;  3OC4 A;  2WP5 A;  1K4Q A;  3M12 A;  1F8S A;  3ALJ A;  3AN1 A;  3GRS A;  1ONE A;  2HZG A;  3PWI A;  5HHF A;  1GV4 A;  2B9X A;  4G74 A;  3PK7 A;  2XCG A;  3HW2 A;  3GWD A;  3ABV A;  4E0V A;  1EC8 A;  1YQ4 A;  2IID A;  2QQ6 A;  2VVL A;  3IC9 A;  2OX4 A;  3TJI A;  3V4B A;  1MRA A;  2YG3 A;  3FVD A;  1COY A;  3OZ2 A;  4ZOH B;  2BYB A;  4J56 A;  4H83 A;  1DNC A;  4YSZ A;  3ICS A;  3R10 A;  4O5U A;  3E1T A;  1H86 A;  5IDZ A;  1MO9 A;  3I6D A;  3QVP A;  2F5Z A;  3GDP A;  3UCL A;  3SFE A;  5IPY A;  1N4V A;  1OJD A;  2EQ8 A;  3GD4 A;  2DW6 A;  4GR1 A;  3ICT A;  4EM3 A;  4IA5 A;  3M13 A;  2C64 A;  4E4U A;  3CPH G;  2BS4 A;  3RRA A;  2J3N A;  3QPE A;  4CCR A;  1GTH A;  3AYJ A;  2YM1 A;  3SFD A;  3DEQ A;  2YG6 A;  3EAN A;  1E7P A;  3ALM A;  4NWZ A;  3UTH A;  1PS9 A;  4DXK A;  2YR4 A;  1XDI A;  3AYL A;  1DOE A;  5IQ1 A;  2E3T A;  4RG3 A;  2GAH B;  5FS6 A;  1TDF A;  3SM8 A;  2OQH A;  1MDR A;  1LPF A;  4H2Q A;  2EQ6 A;  1IUU A;  3D1C A;  4X2P A;  1ZOY A;  3DH9 A;  3Q45 A;  5KNL A;  2C73 A;  3T37 A;  3CNT A;  3HYV A;  1TDN A;  1OJ9 A;  2WP6 A;  5KOW A;  2YLX A;  2XDO A;  3FJ4 A;  2WDV A;  3ZDN A;  3D8X A;  3F8D A;  3BNU A;  3ITJ A;  4U8P A;  2X3N A;  4WX1 A;  3NN6 X;  3P4R A;  3VRB A;  3BI5 A;  1O5W A;  2GR0 A;  3ENL A;  3CPI G;  1LQU A;  4A99 A;  3TJ4 A;  2PTY A;  1KDG A;  2QJJ A;  3T2Y A;  1JRO A;  3SBF A;  3C4N A;  3H7V A;  1S2Q A;  4H4P A;  5J7X A;  2C75 A;  4CBQ A;  1VDV A;  3NS1 B;  2GGJ A;  4YT0 A;  4UDP A;  1GEU A;  1GOS A;  1PN0 A;  3NRN A;  3HZL A;  2C66 A;  3AE3 A;  1KD0 A;  4AT0 A;  3A7A A;  1EL7 A;  3T14 A;  1FO4 A;  3RP8 A;  3I6T A;  4U8L A;  3N4E A;  3GD3 A;  1E1N A;  2FJA A;  4HPN A;  4REK A;  2XFN A;  2V61 A;  3AEA A;  3EKG A;  4IA6 A;  4Y4N A;  3P1W A;  4B65 A;  3OTR A;  4K8D A;  5BOE A;  2GVC A;  4H4R A;  3TTE A;  1DJQ A;  1JRZ A;  2X8G A;  1OJT A;  1GTE A;  4A7A A;  1CJC A;  4ZN0 A;  3VCC A;  4YXD A;  1N5W C;  3NH3 X;  1GT8 A;  2GGI A;  3CGC A;  3GRT A;  1YQZ A;  2GEW A;  4U8K A;  3DES A;  4GCM A;  5FJU A;  1QJD A;  2NQL A;  4A6G A;  3NTA A;  3L1R A;  2W3R A;  2Q6U A;  4M0X A;  1MOK A;  2B76 A;  4RSL A;  1D7Y A;  1S2Y A;  3P93 A;  4YKG A;  1BWC A;  3KVE A;  4CNJ A;  4JN9 A;  4I58 A;  2BC0 A;  3DJE A;  4AP3 A;  1RP0 A;  4ZA0 A;  5KMP A;  3RP6 A;  4YSH A;  4CCQ A;  2R0C A;  3SGL A;  1IUT A;  5BVA A;  4OPU A;  1Z6L A;  3UKA A;  4E8G A;  2Z5X A;  2DW7 A;  1N63 C;  3NVV B;  2GMJ A;  4E4F A;  1M64 A;  3OPS A;  2GH5 A;  1VRQ B;  2XYO A;  4EIQ A;  3NHO X;  2R4J A;  1FFU C;  5KVI A;  2OPJ A;  2VRM A;  4IHC A;  3FXG A;  1B4V A;  3SY4 A;  3KU9 A;  5HYM A;  2WQY A;  1ECQ A;  4GME A;  3NTD A;  4IVM B;  1N4W A;  3MUC A;  2AKM A;  5KOX A;  4RG4 A;  2XLS A;  4GF7 A;  2P8C A;  3ISH A;  2W55 A;  2WU5 A;  2YWL A;  2C67 A;  3GYI A;  3AE6 A;  3II4 A;  3VDG A;  4J31 A;  4EQX A;  4NTE A;  2YLW A;  1PXB A;  4DHG A;  3VC6 A;  3NK0 X;  3S61 A;  2WBA A;  3KUM A;  3SJN A;  4EMI A;  3OZM A;  2ONE A;  4MJW A;  1CJ3 A;  3V5C A;  4G8T A;  1RM6 B;  2ZC8 A;  1KSS A;  1PDY A;  2OA1 A;  1KCZ A;  3C4A A;  5KVH A;  4EMW A;  5G5G B;  4OPI A;  4H2H A;  1GET A;  1FEA A;  3UJF A;  4UDQ A;  4K22 A;  3H4K A;  2ZZB A;  3QFB A;  4NZH A;  5J04 A;  4Z2T A;  3A7U A;  4CY8 A;  3CNP A;  1O95 A;  1M6I A;  5KMS A;  3Q6J A;  2WOI A;  1B5Q A;  3R9U A;  3P4P A;  3LJP A;  5BUL A;  3G5Q A;  1S3E A;  5FS9 A;  2QA2 A;  3UTE A;  4H4V A;  4DN1 A;  3SZC A;  1LV0 A;  2BS2 A;  3VC5 A;  2GAG B;  3BSM A;  4USQ A;  3GMC A;  4HCL A;  4NNJ A;  2HXT A;  3ZLH A;  1BGN A;  3AB1 A;  4OCG A;  2YVJ A;  3T2Z A;  4ZCC A;  1D4D A;  3VR8 A;  2RGO A;  2DKI A;  3AE9 A;  3DK9 A;  3KKJ A;  2GGE A;  3AD8 B;  1ELS A;  2WOW A;  4IVO B;  4PAB A;  4D04 A;  3ZVH A;  1JPD X;  3N4F A;  2CDU A;  4U8N A;  4I59 A;  1DOC A;  4Z43 A;  3GC2 A;  5HXI A;  3F8P A;  4EMJ A;  3UKH A;  2BC1 A;  1VDC A;  4B64 A;  1H82 A;  3P4S A;  4MGG A;  3OP2 A;  3CIR A;  4H4T A;  3UJS A;  2BAC A;  2YQU A;  1IYX A;  3AEG A;  3DJD A;  2XVI A;  1N5X A;  4UP3 A;  3SSZ A;  1ELI A;  3DME A;  3JSK A;  4H4W A;  3ZVH B;  1SJA A;  1JRX A;  1BKH A;  4TVW A;  2OO6 A;  2QCU A;  3ADA B;  4AP1 A;  4FP1 A;  3VCN A;  3AED A;  4MKS A;  5BUK A;  2QVH A;  3ATQ A;  1FHU A;  1JRY A;  3KA7 A;  1NEN A;  4OPC A;  3CNS A;  4F4R A;  3HYW A;  2JKC A;  1D4E A;  2GDQ A;  1XHC A;  3CXO A;  1PJ7 A;  1H81 A;  2GRT A;  3UKQ A;  1GER A;  2WS3 A;  3AWI A;  3AM9 A;  2C70 A;  3NRZ B;  4FX9 A;  1Y0P A;  1DJN A;  4Z17 A;  3V3W A;  1YEY A;  4NTD A;  1WUF A;  3CTY A;  3QKE A;  3DG7 A;  2Y6R A;  1CJ4 A;  3L8K A;  1K0J A;  4HNC A;  2V5Z A;  4JNA A;  3FV9 A;  1AOG A;  2X99 A;  1VQW A;  1F3P A;  3R0K A;  3CYJ A;  3B9J B;  2AL1 A;  2WDQ A;  3CN8 A;  3ATR A;  2RAB A;  2AAQ A;  3IK4 A;  3RR1 A;  1FEB A;  4TVY A;  4TM0 A;  1DOB A;  4M52 A;  1B8S A;  1YQ3 A;  2YLT A;  2VOU A;  1E1K A;  2YLZ A;  1NHP A;  4DGK A;  3AMZ A;  1X2H A;  4A6N A;  2ZZC A;  1N61 C;  3BI4 A;  3LB8 A;  2QDE A;  1TE6 A;  3ZVI A;  1ZK7 A;  1VG0 A;  4II3 A;  3DA1 A;  3BNM A;  4X9N A;  1F9C A;  2MUC A;  5EOW A;  3HYX A;  2BXS A;  1FL2 A;  4IZG A;  3RIT A;  1NAA A;  5FS7 A;  1CL0 A;  2JBV A;  2CVJ A;  3AYI A;  1SEZ A;  1CC4 A;  2VVM A;  4A6N B;  4U8J A;  1P2E A;  3KPK A;  1PBD A;  5JCM A;  1XS2 A;  3K1G A;  2WEU A;  4OPG A;  3NFU A;  3NVY B;  1ZDL A;  4C5O A;  3MKC A;  1VG9 A;  1V59 A;  3B6D A;  3D9X A;  1KFY A;  3VFC A;  3KPF A;  4LII A;  2PU1 A;  3IHM A;  2TMD A;  3TW9 A;  4G7F A;  2JB1 A;  3LAD A;  2QJN A;  1L9D A;  4U2L A;  1F8R A;  4A79 A;  4GDE A;  2XFP A;  2XH2 A;  3S47 A;  1GRE A;  3CGE A;  2P8B A;  3UCD A;  1FFV C;  1JRP A;  1S7M A;  4GRT A;  3Q4D A;  5M0Z A;  2QJM A;  4C77 A;  2PHH A;  3I4K A;  4YTP A;  4LU6 A;  4Z44 A;  4DSH A;  3RO6 A;  4H4S A;  1FOH A;  3RHA A;  3QVR A;  4ENL A;  3UOX A;  2YVG A;  3ES8 A;  3IJI A;  3BHK A;  3DFY A;  3GYJ A;  1OJC A;  4BK1 A;  4ECH A;  4A65 A;  2CHR A;  3SZF A;  4IL2 A;  4JY2 A;  1CBO A;  3AE7 A;  1P2H A;  4YTN A;  4YWS A;  3PO7 A;  2Q7V A;  5EU9 A;  2XVJ A;  1BQG A;  2PP3 A;  6ENL A;  2PP0 A;  2C65 A;  3KD9 A;  2OLN A;  4J36 A;  2WPE A;  3NT6 A;  3B97 A;  1KKO A;  3CGB A;  3UXL A;  1IUS A;  1Q1R A;  2ZBW A;  2CUL A;  3FCP A;  4Z2R A;  2Q0K A;  5FJO A;  1GSN A;  4IV9 A;  1GRG A;  3TCS A;  1IUV A;  3H12 A;  1SJC A;  2PCE A;  1Q9I A;  2XVE A;  1EC7 A;  4GAV A;  3VA8 A;  4U8M A;  3JZU A;  4OPL A;  1TDO A;  4B67 A;  1W4X A;  2W0H A;  1GES A;  4HYR A;  4ZCW A;  3CAW A;  3CK5 A;  3DGH A;  2WPC A;  2HQM A;  2BK5 A;  3QJ4 A;  3TWB A;  4GIS A;  3NGC X;  3EPT A;  2C7G A;  3SN1 A;  2XLR A;  5L46 A;  1MNS A;  2YAU A;  1R6W A;  4G6G A;  1CHU A;  4Z1Y A;  4BK3 A;  2ZZ0 A;  4JHM A;  4FI4 A;  2EQ7 A;  1Y56 A;  2XGZ A;  1D5T A;  1D4C A;  4A5L A;  4GGB A;  2XFQ A;  4OPT A;  4JN8 A;  3RNM A;  2WES A;  4K8G A;  1QO8 A;  2O9Z A;  3STP A;  3FIM B;  2GR3 A;  2VVL G;  2YG4 A;  2Z5Y A;  3I6E A;  2R4E A;  1E6E A;  1DTN A;  2WOV A;  1T3Q C;  2GV8 A;  5JCK A;  1KNR A;  4B69 A;  2OLA A;  3PS9 A;  5EB5 A;  3NVW B;  2X8C A;  3SZW A;  3DJG X;  3CB3 A;  1TRB A;  3DGZ A;  4K2S A;  4LA1 A;  3FBS A;  2IVE A;  1PDZ A;  4DNA A;  4TLZ A;  3OZY A;  4Y4M A;  4TM4 A;  3T4W A;  2OKT A;  3OW1 A;  2XFO A;  3DK4 A;  1N62 C;  1CC6 A;  5C2T A;  4GYP C;  3CXB A;  2PGW A;  3O0H A;  4BJZ A;  2BS3 A; 
#chains in the Genus database with same CATH homology
 4BV6 A;  4EQR A;  4H4W A;  3V3N A;  2J3N A;  1ZOV A;  1JRX A;  4CCR A;  1GTH A;  1LTX R;  1PBF A;  3AYJ A;  2BAB A;  2YM1 A;  2QCU A;  3ADA B;  1RYI A;  4AP1 A;  3SFD A;  4J33 A;  5C3J A;  1KSU A;  2YG6 A;  3UP5 A;  3EAN A;  1FCD A;  3AED A;  1E7P A;  2Y6Q A;  3ALM A;  5BUK A;  4NWZ A;  1TYP A;  2JK6 A;  1L9C A;  1PS9 A;  2XLT A;  3ICR A;  3ATQ A;  2V3B A;  3UTH A;  2YR4 A;  1XDI A;  3AYL A;  1DOE A;  1JRY A;  1KF6 A;  3KA7 A;  5IQ1 A;  1NEN A;  4C74 A;  4RG3 A;  4OPC A;  4K5S A;  2GAH B;  3CNS A;  2B7S A;  4YSY A;  5FS6 A;  1TDF A;  2R46 A;  2TPR A;  1ZX9 A;  3SM8 A;  4B68 A;  3HYW A;  3QSM A;  2JKC A;  2H89 A;  3H8I A;  3QSS A;  1LPF A;  4H2Q A;  3NNE A;  1D4E A;  3B3R A;  2EQ6 A;  1IUU A;  4HA6 A;  3RP7 A;  3I3L A;  2WP9 A;  1NHS A;  1XHC A;  3QFA A;  3QSE A;  5FS8 A;  3D1C A;  1PJ7 A;  1PJ6 A;  1H81 A;  1ZOY A;  3CNJ A;  3DH9 A;  1PBB A;  2GRT A;  5KNL A;  1GAL A;  1GRA A;  1GER A;  3LOV A;  3UKQ A;  3CGD A;  2C73 A;  2GQF A;  3T37 A;  4K5R A;  2WS3 A;  3AWI A;  3CNT A;  1NHQ A;  3HYV A;  4ADW A;  1TDN A;  4B63 A;  2C70 A;  4TLX A;  5BRT A;  1OJ9 A;  4FX9 A;  1CC2 A;  1Y0P A;  3AEE A;  3UOZ A;  2R0G A;  1DJN A;  2WP6 A;  5KOW A;  1GRF A;  2YLX A;  2XDO A;  4ICY A;  3NYE A;  4NTD A;  3SXI A;  4GDP A;  2WDV A;  4Z2U A;  3ZDN A;  2YLR A;  3D8X A;  3F8D A;  3V76 A;  4U2T A;  3CTY A;  3BNU A;  3ITJ A;  3T0K A;  4U8P A;  2X3N A;  4WX1 A;  2VQ7 A;  3NN6 X;  2Y6R A;  1CJ4 A;  4NEV A;  3P4R A;  3L8K A;  3VRB A;  4C3X A;  2E4G A;  4TM1 A;  5M10 A;  5KRQ A;  1K0J A;  3BI5 A;  1O5W A;  2ACZ A;  2V5Z A;  2GR0 A;  5KWF A;  2C3C A;  3CPI G;  2B9W A;  4JNA A;  1AOG A;  2ARD A;  3SZ0 A;  1LQU A;  2UZZ A;  2XVF A;  2X99 A;  2NVK X;  1LJ1 A;  1TDE A;  1VQW A;  1F3P A;  4A99 A;  1Y56 B;  2XLU A;  1KDG A;  3T2Y A;  3ALL A;  3C4N A;  2WDQ A;  1XAN A;  1S2Q A;  3CN8 A;  4H4U A;  4H4P A;  3FMW A;  5J7X A;  2BCG G;  3AD9 B;  3ATR A;  1GRH A;  2RAB A;  2C75 A;  1KN0 A;  2AAQ A;  2B7R A;  4CBQ A;  1MXT A;  3URH A;  4UDR A;  2B9Y A;  1FEB A;  1NDA A;  4TM0 A;  4YT0 A;  1DOB A;  5HY5 A;  4M52 A;  1GEU A;  1B8S A;  1GOS A;  4G73 A;  4UDP A;  3EAO A;  1YQ3 A;  1PN0 A;  2YLT A;  2OAM A;  3NRN A;  2VOU A;  1E1K A;  2YLZ A;  1NHP A;  2C66 A;  3HZL A;  4DGK A;  4JDR A;  4A6N A;  3AE3 A;  4AT0 A;  5KXJ A;  2ZZC A;  1BGJ A;  3BI4 A;  1EL7 A;  3LB8 A;  2H88 A;  3T14 A;  1ZK7 A;  3RP8 A;  1VG0 A;  4II3 A;  4U8L A;  4YTM A;  3DA1 A;  3VRA A;  3GD3 A;  4A9W A;  1F6M A;  2OLO A;  3BNM A;  4X9N A;  1E1N A;  3GSI A;  3UKP A;  2WU2 A;  2FJA A;  1L0V A;  3GDN A;  2X8H A;  4C3Y A;  1H2I A;  3VQR A;  3CPH G;  5EOW A;  2GR1 A;  1E39 A;  4REK A;  2XFN A;  2V61 A;  3AEA A;  3HYX A;  4IA6 A;  4Y4N A;  2BXS A;  1FL2 A;  3P1W A;  2C3D A;  4B66 A;  4B65 A;  3GMB A;  3IF9 A;  4J34 A;  1NAA A;  1YKJ A;  4K8D A;  3NIX A;  3ZYX A;  5FS7 A;  1E1L A;  1EL8 A;  1CL0 A;  2GVC A;  4H4R A;  1GRB A;  2JBV A;  3AE4 A;  2C4C A;  3UP4 A;  1H6V A;  1CJ2 A;  2CVJ A;  5EB4 A;  1DJQ A;  1JRZ A;  3M0O A;  3AYI A;  1FEC A;  2X8G A;  1OJT A;  2EQ9 A;  1L9E A;  4H4Z A;  3IWA A;  2YLS A;  2V3A A;  5JCI A;  2APG A;  1GTE A;  3NG7 X;  4A7A A;  4XWZ A;  4EQW A;  1CJC A;  1SEZ A;  4Z24 A;  1CC4 A;  2GF3 A;  4ZN0 A;  4TM3 A;  3PVC A;  2VVM A;  4YXD A;  3C96 A;  3NH3 X;  3AEB A;  4A6N B;  1GT8 A;  4U8J A;  1P2E A;  4GAP A;  3CGC A;  3KPK A;  2GQW A;  1PBD A;  3GRT A;  5DBJ A;  1YQZ A;  5JCM A;  2GEW A;  1GND A;  1H7W A;  2WEU A;  2I0Z A;  4OPG A;  1ZDL A;  4GCM A;  4U8K A;  2A89 A;  2XVH A;  4C5O A;  1ONF A;  2YM2 A;  1VG9 A;  2V6O A;  1V59 A;  3FG2 P;  2VZ2 A;  3B6D A;  1QJD A;  3K7T A;  3NK2 X;  4AT2 A;  2FBW A;  2BRY A;  4WCT A;  2JAE A;  3F8R A;  3NTA A;  3L1R A;  4O5Q A;  4AOX A;  3D9X A;  1H7X A;  1KFY A;  1JEH A;  2Q6U A;  3KPF A;  2WDR A;  4LII A;  3AE1 A;  1ZMC A;  4XWR A;  1MOK A;  2B76 A;  2BXR A;  3IHM A;  4RSL A;  4BUR A;  2TMD A;  1NPX A;  1D7Y A;  1S2Y A;  3LAD A;  2JB1 A;  4YKG A;  1BWC A;  3BHF A;  1L9D A;  2BRA A;  2NPX A;  4U2L A;  1F8R A;  3KVE A;  4A79 A;  4CNJ A;  4JN9 A;  4GDE A;  4I58 A;  5EBK A;  2XFP A;  2BC0 A;  3DJE A;  4AP3 A;  1RP0 A;  1GRE A;  3CGE A;  2YG7 A;  2JB3 A;  5KMP A;  2FJB A;  4H2P A;  3RP6 A;  5JRB A;  1S7M A;  4YSH A;  1B37 A;  4GRT A;  5M0Z A;  4CCQ A;  2R0C A;  2VQB A;  2WET A;  3AXB A;  4KPR A;  3SGL A;  1IUT A;  4KX6 A;  4C77 A;  5BVA A;  4OPU A;  4JQ9 A;  4YKF A;  1Z6L A;  3UKA A;  4CY6 A;  2Z5X A;  2PHH A;  3NYC A;  4G9K A;  4EIP A;  1PBC A;  4H4Q A;  4NTC A;  2GMJ A;  4YTP A;  1PXA A;  4LU6 A;  5TR3 A;  5KMQ A;  4Z44 A;  1M64 A;  1K0I A;  4DSH A;  2GH5 A;  4FK1 C;  4H4S A;  2YR6 A;  1FOH A;  3RHA A;  1VRQ B;  4JY3 A;  3QVR A;  2XYO A;  4J2W A;  1TDK A;  3T31 A;  5ER0 A;  2BA9 A;  4EIQ A;  1JU2 A;  3NHO X;  3UKK A;  2R4J A;  3UOV A;  2BCP A;  5KVI A;  5JCN A;  2YVG A;  2VRM A;  5CKU A;  3UOX A;  3BHK A;  3Q9T A;  4CNK A;  1B4V A;  4P9S A;  2FJD A;  3SY4 A;  3KU9 A;  5HYM A;  2R9Z A;  4HB9 A;  2WQY A;  3GYJ A;  1ZKQ A;  1IUX A;  1OJC A;  5CQF A;  4BK1 A;  4ECH A;  4A65 A;  3NTD A;  3UTF A;  2IVD A;  3SZF A;  4IVM B;  4DSG A;  4K2X A;  1N1P A;  4X4J A;  3AE5 A;  1EL9 A;  3K7M X;  4JY2 A;  4Z25 A;  3LXD A;  3AE2 A;  5U25 A;  4D03 A;  1N4W A;  4Y4L A;  3KLJ A;  3T2K A;  4EM4 A;  4BJY A;  1CBO A;  3AE7 A;  1GXF A;  1P2H A;  1ZP0 A;  4H2N A;  4APN A;  2VRL A;  3K30 A;  4ZCD A;  5KOX A;  4YTN A;  1H83 A;  4RG4 A;  3PO7 A;  1K0L A;  2Q7V A;  1NHR A;  3DJJ A;  4H4X A;  2XLS A;  2OAL A;  1PXC A;  2R45 A;  2XVJ A;  4GF7 A;  3L5O A;  3ISH A;  3NK1 X;  1BF3 A;  2WU5 A;  2GMH A;  1NEK A;  2C65 A;  3G5R A;  3KD9 A;  3COX A;  3FPZ A;  2YWL A;  2C67 A;  2OLN A;  3GYI A;  4H4Y A;  4J36 A;  3LZW A;  2WPE A;  2YR5 A;  3AE6 A;  3NT6 A;  3G5S A;  3II4 A;  3CGB A;  3DK8 A;  1IUS A;  3AEF A;  4K7Z A;  4J31 A;  1Q1R A;  2ZBW A;  4FK1 A;  1N4U A;  2CUL A;  4Z2R A;  4EQX A;  2BK3 A;  4NEW A;  5J60 A;  2Q0K A;  4NTE A;  5KMR A;  2YLW A;  1JNZ A;  4FDC B;  3P9U A;  2GB0 A;  1KNP A;  2BK4 A;  1PXB A;  3SQP A;  4XXG A;  3UKF A;  3UOY A;  1GSN A;  1S3B A;  2JB2 A;  1ZY8 A;  1GRG A;  5JCL A;  4YWO A;  1EBD A;  3NK0 X;  4IV9 A;  1IUV A;  4X9M A;  1D7L A;  3S61 A;  1Q9I A;  2GR2 A;  2WBA A;  2XVE A;  4EMI A;  4EQS A;  4GAV A;  2E1M A;  3NN0 X;  1TYT A;  4U8M A;  4OVI A;  4MJW A;  1CJ3 A;  1LVL A;  3NYF A;  4OPL A;  1TDO A;  4B67 A;  3VR9 A;  1GRT A;  4U8O A;  1Q1W A;  1ZMD A;  5LV9 A;  2V60 A;  1KSS A;  1W4X A;  2YVF A;  2OA1 A;  2W0H A;  1GES A;  1OJA A;  4H7U A;  3C4A A;  5KVH A;  2X50 A;  1REO A;  4GUV A;  2Q0L A;  2XFU A;  4EMW A;  3AD7 B;  3K7Q X;  4B1B A;  4OPI A;  3IHG A;  4H2R A;  1QLB A;  3NLC A;  1GET A;  1E1M A;  1FEA A;  1H84 A;  1PBE A;  1XPQ A;  5FMH A;  1BKW A;  3DGH A;  1O94 A;  3NKS A;  2WPC A;  2HQM A;  3PG6 A;  2BK5 A;  2PYX A;  4UDQ A;  4K22 A;  3H4K A;  3QJ4 A;  4N9X A;  3AEC A;  5GRT A;  5U1O A;  1RSG A;  2ZZB A;  3QFB A;  4NZH A;  4Z2T A;  4U8I A;  1EL5 A;  1GPE A;  4CY8 A;  3NGC X;  3BI2 A;  3CNP A;  3AE8 A;  3GYX A;  3EPT A;  2C7G A;  1O95 A;  3RED A;  1M6I A;  5KMS A;  3Q6J A;  2RGJ A;  2WOI A;  1B5Q A;  2XLR A;  1PHH A;  3CMM A;  3R9U A;  4U2S A;  3UKL A;  5L46 A;  3P4P A;  4G6G A;  2YAU A;  3SYI A;  3LJP A;  5BUL A;  3VRD B;  3G5Q A;  1S3E A;  4YSX A;  5FS9 A;  1CHU A;  2QA2 A;  3UTE A;  5U63 A;  3WE0 A;  4H4V A;  1IJH A;  4BK3 A;  2ZZ0 A;  1HYU A;  2C72 A;  1X31 B;  3SZC A;  2EQ7 A;  2AR8 A;  1JOA A;  1Y56 A;  1LV0 A;  4Z26 A;  2WPF A;  1YY5 A;  2BS2 A;  2CFY A;  3OC4 A;  2A87 A;  2WP5 A;  1K4Q A;  3M12 A;  1F8S A;  3ALJ A;  1D5T A;  1D4C A;  2GAG B;  3GRS A;  4A5L A;  2QA1 A;  4J57 A;  3CPJ G;  3LZX A;  3GMC A;  4USQ A;  5HHF A;  2XFQ A;  4OPT A;  1GV4 A;  4G6H A;  3RNM A;  2B9X A;  4NNJ A;  1DOD A;  4G74 A;  2WES A;  2R0P A;  1QO8 A;  2XLP A;  2O9Z A;  1BGN A;  4II2 A;  2C76 A;  5GSN A;  2XCG A;  3FIM B;  3AB1 A;  2GR3 A;  4OCG A;  2YVJ A;  2VVL G;  3T2Z A;  1DXL A;  4ZCC A;  3GWD A;  2YG4 A;  3ABV A;  2FJE A;  2RGH A;  4E0V A;  2AQJ A;  1D4D A;  3CND A;  1UKV G;  5IQ4 A;  2Z5Y A;  3VR8 A;  2R4E A;  1E6E A;  1CF3 A;  1YQ4 A;  2RGO A;  2DKI A;  3AE9 A;  4AOS A;  3DK9 A;  2WOV A;  4H50 A;  3KKJ A;  2IID A;  1LQT A;  2GV8 A;  5JCK A;  3H8L A;  4CRT A;  2VVL A;  3IC9 A;  1IUW A;  3AD8 B;  1KNR A;  1JNR A;  4B69 A;  3PS9 A;  5EB5 A;  3UTG A;  1BZL A;  2WOW A;  4IVO B;  4PAB A;  1PDH A;  4D04 A;  2E5V A;  2YG3 A;  2X8C A;  1COY A;  3SZW A;  3DJG X;  3OZ2 A;  2BYB A;  2CDU A;  4J56 A;  2YG5 A;  3EF6 A;  4U8N A;  2A8X A;  4I59 A;  1DOC A;  2WHD A;  4Z43 A;  5HXI A;  1TRB A;  1DNC A;  3DGZ A;  3F8P A;  4YSZ A;  3ICS A;  1PJ5 A;  3S5W A;  4O5U A;  4LA1 A;  4EMJ A;  3UKH A;  2BC1 A;  3FBS A;  3P4Q A;  1VDC A;  2IVE A;  4B64 A;  1H82 A;  1NG3 A;  3E1T A;  3P4S A;  4DNA A;  4PAA A;  1NG4 A;  1H86 A;  4TLZ A;  3CIR A;  4TM4 A;  4Y4M A;  4BK2 A;  3SX6 A;  1MO9 A;  4H4T A;  3I6D A;  2BAC A;  3QVP A;  2XFO A;  2F5Z A;  3DK4 A;  3GDP A;  2DKH A;  1CC6 A;  3UCL A;  3SFE A;  5C2T A;  5IPY A;  2YQU A;  1N4V A;  1OJD A;  3AEG A;  3DJD A;  2XVI A;  4UP3 A;  2EQ8 A;  3V3O A;  2QAE A;  3O0H A;  4USR A;  3GD4 A;  4OPD A;  4GR1 A;  3ICT A;  4BJZ A;  4EM3 A;  4IA5 A;  4JNQ A;  3GWF A;  1F8W A;  1ELI A;  3M13 A;  2BS3 A;  3DME A;  2C64 A;  2BS4 A;  3JSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...