5FMHA

Crystal structure of the e405k mutant of human apoptosis inducing factor
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
486
structure length
472
Chain Sequence
APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVKLAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Novel Mutation in Aifm1
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 154
structure length 472
sequence length 486
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fmhA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fmhA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fmhA01
2GR3A 1PXBA 5EOWA 5L46A 4A65A 2NPXA 1GV4A 4OPUA 1P2HA 2XLRA 2YVJA 2GR2A 2YAUA 4YSXA 3VRDB 2WU2A 2XVJA 3DMEA 3SM8A 4RG3A 5HY5A 1DXLA 2R4EA 2WHDA 3G5QA 4E0VA 1X31B 4YT0A 1BKWA 2UZZA 1E1LA 2X8GA 2GRTA 4BJZA 1L9DA 4C3YA 5C3JA 1GRTA 2WPCA 4Y4MA 2YLRA 4H4UA 4CNKA 2ARDA 1IUXA 1ELIA 3UTFA 1GRGA 2WPEA 2BK5A 4U8PA 2WOWA 4OPGA 2AAQA 3CGEA 1E1KA 1B4VA 4GF7A 3IHMA 2X50A 3T37A 2V5ZA 3GWDA 2JK6A 3P4SA 3VRAA 2TPRA 3PO7A 1CJCA 3F8RA 5EB4A 3CIRA 5LV9A 2VRLA 1YQ4A 3NK2X 1KFYA 3CGCA 4HB9A 2F5ZA 3DJGX 5FMHA 4H2QA 4B64A 1L9EA 3QFBA 1O94A 2Y6QA 4J34A 2R4JA 4UP3A 1Y56A 2YG5A 4LA1A 3ABVA 2GAHB 3AE4A 1CC4A 4K22A 3AD8B 2V3AA 4KX6A 3M0OA 3SGLA 3ZYXA 1CL0A 1GERA 4XWZA 2BA9A 3B6DA 2YLWA 1M6IA 4UDRA 3AYIA 2C3CA 4JQ9A 4OCGA 4I59A 4NTEA 3LZWA 3DK4A 5FS6A 2BK3A 2CULA 2XDOA 1PS9A 4JNQA 3KD9A 2RGOA 3LB8A 4H4RA 4X4JA 3UOVA 3CTYA 4H2RA 3GSIA 3NN0X 4FK1A 2X3NA 2YLTA 2GQWA 1N4WA 2RABA 2Q0KA 3P1WA 3GDNA 3UTEA 4A7AA 1K0JA 3AEFA 1GNDA 4NTCA 1PN0A 3K7MX 4C77A 5IQ4A 2B9WA 2GMJA 1JRYA 4GCMA 4D04A 3UP5A 4YSYA 2A87A 3EANA 1E6EA 3KVEA 1PBFA 4EQSA 1NG3A 3DJDA 4EMIA 3KKJA 4TM3A 4B66A 2WP9A 1ZK7A 3Q9TA 3BHKA 1GRHA 3KPFA 3FG2P 3C4AA 3ICRA 3QSSA 1GT8A 4U2TA 2GR1A 4U8IA 3UKLA 3IWAA 4PABA 1NENA 2ZBWA 4WCTA 2E5VA 3S61A 1QO8A 1GETA 1ZOYA 2FJAA 4J31A 4JY3A 4OPDA 2C3DA 1CC6A 1DODA 3GWFA 5BVAA 1KSSA 2OALA 4AT2A 2C73A 4U8MA 5J7XA 4A99A 3IHGA 4B65A 1PJ5A 3NYEA 2WOVA 4NTDA 1LQUA 1ZX9A 3FPZA 3BI4A 3AE1A 4JNAA 4U8OA 5EB5A 1DOEA 1TDFA 2B76A 2ZZCA 1TRBA 1XDIA 5JCKA 3UOZA 2V60A 3C4NA 3UTGA 2XVFA 1GRBA 1GTHA 2V6OA 5GSNA 1LVLA 1H6VA 4BK1A 2GR0A 2VOUA 3NT6A 4YWOA 2A89A 4U8JA 4Z2UA 3AXBA 1DOBA 2YLXA 2DKIA 1KDGA 1OJ9A 1L9CA 1RP0A 3H8LA 4B69A 4H4ZA 1JRZA 2HQMA 2YM2A 1LPFA 1XHCA 2PHHA 2V3BA 3L1RA 4UDQA 3KLJA 4Z44A 1ZKQA 4J33A 5FS7A 1YY5A 2ZZBA 3AE7A 2C70A 4O5UA 4X9MA 3LOVA 3AE3A 2EQ6A 2XLPA 1GPEA 5U25A 2YG7A 1NHSA 3QSMA 2VQ7A 1REOA 2X8HA 1QJDA 2GVCA 4M52A 3Q6JA 1PJ6A 2YG6A 2YM1A 3K30A 1KNPA 4C74A 3O0HA 2BC1A 2XLSA 3H4KA 5U1OA 1IUVA 4FK1C 1H7XA 5KVIA 2BXSA 1W4XA 5KOWA 2VVLG 2GQFA 4AOXA 4XXGA 2BC0A 2BABA 4A6NB 1TYTA 3DK8A 3QFAA 1O95A 2EQ7A 3AE6A 4B63A 2B9XA 3AECA 4H7UA 3S5WA 2VRMA 3DA1A 4IA6A 1TDKA 4O5QA 4YSHA 3VR8A 1PBBA 2OLNA 4Y4NA 3EF6A 2YLZA 5M0ZA 4JN9A 4REKA 5JCMA 4YTPA 1GTEA 3AE8A 3UKAA 1GRFA 4H4QA 4YSZA 3UCLA 5M10A 1FCDA 3UKPA 2BS2A 5HYMA 2VZ2A 3D8XA 3UKQA 1CJ4A 4PAAA 4H2NA 1D7LA 1F8RA 1S2QA 4X9NA 3AYLA 1LQTA 4ZCDA 1XANA 1D4CA 1Q1RA 3GD3A 1ZDLA 4EM3A 2FBWA 3AE9A 1S3BA 4J2WA 3GYIA 5IQ1A 4EIQA 2QA1A 1V59A 3LJPA 2Q7VA 1PDHA 4YKFA 3ALLA 3AEEA 3AYJA 3UOXA 1JNRA 1LTXR 1F3PA 1YQZA 1GSNA 1NHQA 1IUTA 1GREA 1Q1WA 1OJCA 2IVDA 2EQ8A 2YVGA 1DJNA 2APGA 3IF9A 3R9UA 1JRXA 1NG4A 2IVEA 4OPTA 3CNDA 4EIPA 2C7GA 2WOIA 1KNRA 3M13A 3QSEA 4IVOB 4BV6A 3RP7A 4H4SA 4NEVA 2H89A 1B5QA 3BI2A 2WDRA 3HZLA 5KVHA 4Z26A 1RYIA 3P4RA 4TM4A 2YWLA 4GR1A 2V61A 2R0GA 2XFOA 2YR6A 3WE0A 4USQA 5CQFA 4CNJA 1NHPA 1LJ1A 1CF3A 3ATRA 2E4GA 3K7TA 4EMJA 4H4WA 4XWRA 1CJ2A 4H4XA 2W0HA 4Z25A 3QVRA 1YQ3A 3NTDA 1VG0A 2Y6RA 4ZN0A 1H81A 2C64A 1OJTA 3BHFA 1VQWA 3ISHA 3SFDA 5KXJA 1ZMCA 1IUUA 3QJ4A 4FDCB 2VQBA 4USRA 4YXDA 4H4YA 2B9YA 2R9ZA 3F8PA 4AT0A 1N1PA 1H7WA 2WEUA 4B1BA 1LV0A 4LIIA 1P2EA 1DNCA 3NRNA 3PVCA 1GEUA 4IA5A 2QCUA 4IV9A 3KA7A 2FJDA 2BACA 1YKJA 4OPCA 4AOSA 4Z43A 2OLOA 3CGDA 1KSUA 4H4PA 4TM0A 5DBJA 4DGKA 5BUKA 5KWFA 4JDRA 2C67A 1D5TA 2JAEA 1M64A 3CPJG 3G5RA 4BK2A 1MOKA 1D7YA 5HHFA 1TDNA 3UKKA 2YG4A 2VVMA 1CBOA 4CY8A 2WP5A 4A79A 2O9ZA 3NN6X 3I6DA 1CJ3A 4B67A 2AQJA 2CDUA 3NGCX 4U8KA 4EQXA 5FS9A 1ZY8A 4EM4A 1PHHA 3C96A 3CNSA 1VRQB 2BXRA 3NG7X 2Z5XA 3AD7B 1GESA 2VVLA 3AD9B 3GD4A 1FEBA 3RHAA 3LADA 2XYOA 1BGNA 3URHA 3CPIG 1F8WA 3FMWA 2R46A 1BGJA 1PBCA 2WS3A 3NKSA 1ONFA 3ALMA 4U2SA 4J36A 4CCQA 1PBEA 4WX1A 1B8SA 1GXFA 1Q9IA 1PXCA 2R45A 3ITJA 2XFPA 5JCNA 5IPYA 1IUSA 1Z6LA 2GMHA 1FEAA 5ER0A 2PYXA 2BS3A 4K7ZA 3NYCA 5JCIA 2RGJA 1QLBA 3DGHA 4EMWA 2YR5A 3AB1A 3ICSA 4C3XA 1COYA 3CGBA 4CRTA 2JB2A 3JSKA 2EQ9A 1GOSA 4YTNA 1JEHA 1RSGA 4Z24A 1EL7A 1JU2A 3DH9A 1PJ7A 2A8XA 2JB1A 4DNAA 4Y4LA 1SEZA 2NVKX 1S2YA 1ZP0A 2OAMA 2XCGA 1H84A 1AOGA 4FX9A 3K7QX 4ZCCA 3UP4A 1GRAA 2R0PA 3UOYA 1NPXA 2Q0LA 1OJDA 5EBKA 1BZLA 2WESA 2R0CA 4A6NA 4EQWA 3DK9A 3BNMA 1E1MA 2FJBA 2Z5YA 4A5LA 1D4EA 3CNTA 4EQRA 2WETA 2GAGB 4U8NA 1TYPA 2OA1A 3AEBA 3NYFA 1DJQA 3PS9A 3L8KA 3GMCA 1JNZA 3AEDA 3GDPA 3VRBA 3GYJA 1F8SA 3KU9A 3AWIA 2BYBA 5CKUA 1D4DA 3FBSA 1EBDA 1K0IA 3II4A 2JKCA 3REDA 4ECHA 2GB0A 2YR4A 2JBVA 1NAAA 4Z2RA 2RGHA 5C2TA 2I0ZA 2YG3A 1PXAA 4GUVA 4BJYA 2X8CA 3IC9A 4NEWA 1OJAA 1IUWA 3VR9A 4DSHA 1Y56B 2WP6A 4J57A 1EL5A 2BCGG 4APNA 1GALA 1EL9A 2QAEA 4U8LA 3QVPA 3EAOA 3UKHA 1FOHA 5TR3A 2WQYA 5HXIA 3BI5A 2YLSA 1CHUA 1N4UA 1FECA 4DSGA 3DJJA 3LXDA 3CN8A 4GRTA 2B7RA 2GH5A 4OPLA 3DGZA 1B37A 1TDEA 1Y0PA 4OVIA 1NHRA 1DOCA 2H88A 5KOXA 4ICYA 2ACZA 2XVEA 5GRTA 3OZ2A 4K2XA 5FS8A 3ICTA 2XVIA 3GRSA 3NTAA 3P9UA 4IVMB 5BULA 1ZOVA 2C76A 4ADWA 3ZDNA 2AR8A 3F8DA 3NIXA 4TM1A 3NHOX 2B7SA 3AEGA 2CVJA 2E1MA 3ALJA 3NH3X 4YTMA 3V3NA 1BF3A 4KPRA 5JCLA 1S3EA 2IIDA 3LZXA 3B3RA 3BNUA 4AP3A 3E1TA 4UDPA 2X99A 4H4TA 3CNPA 2CFYA 1MXTA 2GEWA 1BWCA 2GV8A 2JB3A 3UKFA 4RG4A 4H4VA 4H50A 1E1NA 2YVFA 3COXA 1H83A 4OPIA 2C72A 4K5SA 4GDPA 5U63A 3P4PA 3SQPA 3SFEA 4BK3A 2FJEA 3V3OA 5J60A 4JY2A 1F6MA 1UKVG 4NZHA 3CPHG 3NLCA 2ZZ0A 4GDEA 5KRQA 1K4QA 1H82A 2XLTA 3RP6A 2WBAA 1KF6A 4D03A 4I58A 4A9WA 3ATQA 1EL8A 1XPQA 4HA6A 2WPFA 4MJWA 3NK1X 2GF3A 3AEAA 5BRTA 2BCPA 1TDOA 1FL2A 1E7PA 1PBDA 3V76A 1E39A 3FIMB 3GMBA 1N4VA 2XFUA 3UTHA 2WDVA 2J3NA 1O5WA 1JOAA 1CC2A 3OC4A 2WU5A 4TLXA 1L0VA 3GRTA 2Q6UA 2TMDA 1MO9A 3M12A 4CBQA 3NK0X 2QA2A 4K8DA 3AE2A 3AE5A 3RNMA 2C65A 2XVHA 2XFNA 4K5RA 4CY6A 4YKGA 4BURA 1K0LA 2BS4A 3G5SA 4TLZA 1ZMDA 2C75A 2WDQA 3RP8A 1NDAA 2C66A 1HYUA 4B68A 4RSLA 2BK4A 4C5OA 2YQUA 3P4QA 4AP1A 2DKHA 3D1CA 1NEKA 3EPTA 3CNJA 1IJHA 4H2PA 4LU6A 3VQRA 3NNEA 4J56A 1VDCA 3ADAB 3I3LA 3DJEA 4Z2TA 2XLUA 1VG9A 2XFQA 4CCRA 3H8IA 1H86A 4N9XA 4U2LA 4P9SA
chains in the Genus database with same CATH superfamily
1PXBA 3CT2A 2NPXA 3VRDB 3DMEA 3SM8A 5HY5A 4E0VA 1TZZA 4YT0A 2X8GA 2GRTA 1L9DA 3HYWA 2WPCA 2YLRA 5FJOA 4ZCWA 1IUXA 1MDRA 2WOWA 3FV9A 2AAQA 1E1KA 4GF7A 2V5ZA 2TPRA 3CIRA 4H2QA 2R4JA 1R0MA 3ABVA 4JN8A 3AD8B 3ZYXA 4XWZA 3B6DA 3PG6A 4JQ9A 2PSNA 3DK4A 4JNQA 3SYIA 3CTYA 2X3NA 4ZOHB 2YLTA 2ONEA 3P1WA 1K0JA 3AEFA 1PN0A 4C77A 2PP3A 1JRYA 4JHMA 3KVEA 1PBFA 4EQSA 3DJDA 4EMIA 1GRHA 4NWZA 3C4AA 3UKLA 2GR1A 4A3RA 1N60C 1QO8A 1ZOYA 3SZFA 2GSHA 2FJAA 2C3DA 1CC6A 3GWFA 1XPYA 3NYEA 2WOVA 3FPZA 3S5SA 3BI4A 5EB5A 1DOEA 2BRYA 1JPMA 3C4NA 5GSNA 2PPGA 2GR0A 2A89A 2HXUA 3H8LA 1KDGA 1OJ9A 2HQMA 4Z44A 2ZZBA 3JW7A 1GPEA 5U25A 1REOA 3UJRA 2X8HA 2RDXA 1PJ6A 3O0HA 2BC1A 3H4KA 4IP5A 2GQFA 3DK8A 2EQ7A 3GD6A 2B9XA 4H7UA 4MMWA 3S5WA 2VRMA 4ROPA 4JN9A 5JCMA 3AE8A 4YSZA 3UCLA 3R25A 5M10A 1PDYA 3U4FA 5HYMA 3FVDA 3UKQA 4PAAA 1D7LA 1D4CA 2FKPA 2OX4A 4EM3A 2FBWA 4J2WA 5IQ1A 1V59A 2Q7VA 3STPA 4GAPA 1YQZA 1NHQA 1GREA 1Q1WA 1SB3B 2EQ8A 3TW9A 1DJNA 4G8TA 4OPTA 4EIPA 2C7GA 2WOIA 3QSEA 3T2YA 3CB3A 2PTWA 3HZLA 3RITA 4ZA0A 2YWLA 2YR6A 4CNJA 1NHPA 3QVRA 1VG0A 4HYRA 2C64A 3BHFA 5KMQA 3QJ4A 3F8PA 4AT0A 4FP1A 4IA5A 3V3WA 1DNCA 1GEUA 2OZTA 4IV9A 3NS1B 1ONEA 3CGDA 5DBJA 4DGKA 2OZ8A 2C67A 1D7YA 3NZGA 3AM9A 1TDNA 3UKKA 2YG4A 1CBOA 4CY8A 2O9ZA 3I6DA 4B67A 4G9KA 4U8KA 1RM6B 5FS9A 3KUMA 2VVLA 2GDQA 3V5FA 3RHAA 3URHA 1F8WA 1N63C 4Z17A 2WS3A 1ONFA 4J36A 3P0WA 4WX1A 2PP0A 1DTNA 1GXFA 4ENLA 1IUSA 2GMHA 1FEAA 5ER0A 4K7ZA 4EMWA 4J1OA 3VC6A 3VA8A 4YTNA 5KMPA 1JU2A 3DH9A 1PJ7A 2A8XA 1SEZA 1ZP0A 2GGEA 4TVYA 3UP4A 1KKOA 3AMZA 5EBKA 4H19A 3NRZB 4EQWA 3TJIA 1D4EA 1JPDX 7ENLA 3JZUA 2WETA 2XH7A 3L8KA 3GMCA 1JNZA 3VRBA 3KU9A 4GIRA 2O56A 1FFVC 1EBDA 2JKCA 1NAAA 1PXAA 3IC9A 4H2HA 4DSHA 2BCGG 3S47A 3UKHA 1FOHA 3OW1A 5TR3A 3UJFA 3BI5A 1R6WA 3DJJA 3LXDA 3DGZA 1X2HA 3A7UA 2H88A 2ACZA 4II3A 5GRTA 4K2XA 5FS8A 3ICTA 2C76A 2HZGA 3ZDNA 2AR8A 4TM1A 3NHOX 2B7SA 2CVJA 1JROA 4IL2A 1BF3A 1S3EA 2HNEA 3E1TA 4HPNA 4H4TA 3AN1A 3CNPA 2MNRA 4H4VA 2C72A 4GDPA 3SQPA 4BK3A 5J60A 3THUA 3NLCA 2ZZ0A 4GDEA 5KRQA 2WBAA 1KF6A 1RVKA 4I58A 3N6JA 3PWIA 4K2SA 2GF3A 3H70A 4GGBA 3UTHA 2XFUA 2J3NA 1CC2A 3OC4A 3GRTA 2Q6UA 4K8DA 3AE5A 4YKGA 4BURA 1K0LA 4TLZA 1F9CA 3B9JB 3EPTA 3CNJA 4J56A 3DJEA 1VG9A 4M6UA 2OZ3A 4U2LA 5L46A 1P2HA 4YSXA 2WU2A 2XVJA 3SZ0A 4RG3A 2R4EA 2WHDA 1X31B 2UZZA 4GYPA 3SQSA 3HPFA 4C3YA 3CMMA 1GRTA 4H4UA 1FHUA 3UTFA 1KCZA 1GRGA 4U8PA 2XSXA 4E8GA 4TVWA 2X50A 4GFIA 4F4RA 3PO7A 1CJCA 3F8RA 5EB4A 1YQ4A 3D9XA 3CGCA 4HB9A 2F5ZA 3DJGX 5FMHA 5KNLA 4J34A 3DFYA 4IZGA 1Y56A 5JRBA 3IK4A 2C4CA 2PU0A 2W54A 1X2GA 1CC4A 2V3AA 3M0OA 2BA9A 4UDRA 1M6IA 3AYIA 2C3CA 1EC8A 4OCGA 3LZWA 5FS6A 2BK3A 2XDOA 1PS9A 2RGOA 4H4RA 3FXGA 3UOVA 3GSIA 3NN0X 2GQWA 4HN8A 2Q0KA 3FYYA 4DWDA 4NTCA 5IQ4A 2GMJA 2OQYA 4D04A 3VFCA 2A87A 3EANA 4J3ZA 1E6EA 1NG3A 4B66A 2WP9A 1ZK7A 3Q9TA 3KPFA 2W3SA 3QSSA 4U8IA 2E3TA 2E5VA 3S61A 1GETA 5IDZA 4J31A 5BVAA 1KSSA 4U8MA 4IHCA 3IHGA 1LQUA 1ZX9A 2ZZCA 1LVLA 3L5OA 2VOUA 4U8JA 4Z2UA 3AXBA 1RP0A 2QJJA 1JRZA 1LPFA 1XHCA 2PHHA 1ZKQA 5FS7A 1YY5A 2C70A 1N5XA 1P48A 3ZLHA 2XLPA 3RRAA 3DG3A 1QJDA 3K30A 2YG6A 2QJMA 1IUVA 5KVIA 5KOWA 4GMEA 2VVLG 4XXGA 4A6NB 1O95A 4B63A 2W55A 4O5QA 1TDKA 3VR8A 1PBBA 2OLNA 2YLZA 3QN3A 3UKAA 5ENLA 2BS2A 2VZ2A 3DERA 1CJ4A 4H2NA 4II2A 4KPLA 4X9NA 3GD3A 3UJSA 4G73A 3BSMA 3HYXA 4YKFA 3AYJA 1IUTA 1OJCA 2IVDA 2BRAA 4IT1A 2APGA 3IF9A 1JRXA 4IVOB 3RP7A 3CXOA 4H4SA 4NEVA 2H89A 1B5QA 3BI2A 4JN7A 4TM4A 1YEYA 2R0GA 3ATRA 2E4GA 3ZLGA 2W0HA 1YQ3A 4GYPC 1H81A 3ISHA 3SFDA 5KXJA 2VQBA 4USRA 3GY1A 4H4YA 2R9ZA 3ZVHB 1P2EA 3OP2A 3KA7A 3SX6A 1YKJA 4AOSA 4Z43A 4KWSA 3ZVHA 1KSUA 2OLOA 5KWFA 4JDRA 4H1ZA 1S7MA 1D5TA 2JAEA 3P93A 2VVMA 2PODA 2WP5A 3NN6X 1CJ3A 3MKCA 2AQJA 3NGCX 3C96A 3CNSA 2BXRA 1GESA 3GD4A 3CPIG 1N5WC 1BGJA 1PBCA 1SJCA 3SXIA 2E5AA 1B8SA 1Q9IA 1PXCA 2R45A 2XFPA 1Z6LA 1QLBA 3ICSA 1WUEA 3CGBA 3JSKA 2EQ9A 2ZC8A 3UCCA 1JEHA 1RSGA 2PGWA 4DNAA 1S2YA 3K7QX 4FX9A 3UOYA 2Q0LA 3OTRA 3JVAA 2WESA 3DK9A 1FHVA 1ZXIC 4A5LA 3CNTA 4EQRA 3ETRB 4U8NA 3AEBA 3NYFA 3AEDA 3H7VA 3AWIA 3Q4DA 3R11A 1D4DA 2OLAA 3REDA 2YR4A 3TWBA 4E4UA 4Z1YA 2YG3A 4GUVA 4BJYA 2X8CA 1KKRA 1OJAA 3VR9A 2WP6A 4J57A 1EL9A 2QAEA 3QVPA 3EAOA 4DXKA 2YLSA 5FJUA 4G6HA 1FECA 4DSGA 3CN8A 2GH5A 3SZCA 1NHRA 2XVEA 2DW7A 3OZ2A 2AKZA 3P9UA 5BULA 2E1MA 3V3NA 1MDLA 5JCLA 2IIDA 2NQLA 3ES7A 3B3RA 4UDPA 1MXTA 2GV8A 1BWCA 2JB3A 3T2KA 3H8AA 1H83A 3QTPA 5U63A 3SFEA 3UJ2A 3CK5A 1UKVG 3H12A 3SN4A 1ELSA 2XLTA 4DN1A 4GGHA 3RGTA 3GYXA 4MJWA 1PBDA 2WDVA 2WU5A 1JOAA 4E5TA 1L0VA 4KEMA 2OG9A 3A7AA 2PTZA 4CBQA 2QA2A 2C65A 3G5SA 4A6GA 2BK4A 2YQUA 3N4FA 1NEKA 3VQRA 4HCDA 1P43A 5J04A 2XLUA 2XFQA 3H8IA 4N9XA 3T0KA 2GR3A 5EOWA 4A65A 4OPUA 2XLRA 2YVJA 1MRAA 1DXLA 4E4FA 2QGYA 1E1LA 3DGBA 4BJZA 5C3JA 2PGEA 3A7RA 2ARDA 3TJ4A 1SJDA 1ELIA 4OPGA 3CGEA 1B4VA 3IHMA 3T37A 3P4SA 3VRAA 1KFYA 1O94A 2Y6QA 2YG5A 2XH4A 3NVZB 2GAHB 4K22A 4KX6A 1SJBA 4YWSA 1BQGA 3FCPA 4I59A 1JCTA 4NTEA 4X4JA 3KD9A 1IYXA 2QDEA 3LB8A 3P3BA 3DG7A 1N4WA 2RABA 4A7AA 3GDNA 3UTEA 1GNDA 2B9WA 4GAVA 4GCMA 3EUB3 4TM3A 4X2PA 3FG2P 1T3QC 3IJQA 3VCNA 3IWAA 3K1GA 1NENA 2ZBWA 3GO2A 4JY3A 1DODA 3VC5A 4B65A 4A99A 1PJ5A 3T9PA 4NTDA 3AE1A 1TDFA 2PA6A 3SBFA 2B76A 1XDIA 5JCKA 3UOZA 2V60A 2XVFA 1GRBA 1GTHA 2V6OA 4BK1A 3NT6A 4YWOA 3IJLA 3HYVA 2GGJA 2DKIA 5KMRA 1L9CA 4B69A 2P3ZA 2V3BA 3KLJA 4J33A 3AE7A 1FFUC 4O5UA 4X9MA 3LOVA 2EQ6A 2YG7A 2OO6A 1NHSA 3QSMA 2GVCA 3Q6JA 2YM1A 1KNPA 4C74A 4HCHA 2XLSA 1NELA 2XH2A 2BXSA 4AOXA 2BC0A 3NFUA 1FIQB 2BABA 4MGGA 3QFAA 3IJIA 3NXLA 4G7FA 4Y4NA 3UCDA 3N4EA 1GTEA 3DDMA 4H4QA 1FCDA 3UKPA 2OKTA 1F8RA 3NVWB 1S2QA 3AYLA 1LQTA 4ZCDA 1XANA 3OZMA 1ZDLA 2FYMA 1MUCA 1XS2A 4EIQA 3LJPA 2W3RA 1WYGA 3AEEA 3ALLA 1F3PA 3DG6A 1GSNA 2QQ6A 4HNCA 3M13A 2WDRA 5FJPA 5KVHA 4Z26A 1RYIA 1EBHA 2XGZA 2GL5A 2V61A 2XFOA 4USQA 2P88A 1LJ1A 1EC7A 3K7TA 4H4WA 4Z25A 3NTDA 2Y6RA 2AL1A 4ZN0A 2QJNA 1OJTA 1VQWA 1ZMCA 3QLDA 1IUUA 4FDCB 2MUCA 2DW6A 2WEUA 4B1BA 5FJTA 4LIIA 3NRNA 1N61C 2FJDA 2OFJA 4OPCA 3R10A 3CPJG 1M64A 4BK2A 4H83A 3T8QA 2GGIA 3DEQA 3NVYB 4EM4A 1VRQB 3NG7X 3HW2A 1FEBA 3LADA 2XYOA 1KD0A 3NKSA 3ALMA 4CCQA 1PBEA 3ITJA 3NYCA 2BS3A 5KMSA 3QPEA 1COYA 2JB2A 1N62C 1EL7A 4IP4A 2JB1A 2XCGA 2OAMA 1H84A 1GRAA 1NPXA 3VCCA 1OJDA 2R0CA 4A6NA 5EU9A 3CAWA 1E1MA 2FJBA 2GAGB 2OA1A 4EWJA 3GYJA 1F8SA 2OVLA 2P8CA 3B97A 3FBSA 4ECHA 2JBVA 4Z2RA 5C2TA 1TKKA 4NEWA 1IUWA 3DFHA 1EL5A 1GALA 3U9IA 2WQYA 1WUFA 1CHUA 1N4UA 4GRTA 1TDEA 1VDVA 1DOCA 5KOXA 4ICYA 5G5GB 2HXTA 2XVIA 1E9IA 4IVMB 1ZOVA 4ADWA 3NIXA 3AEGA 3NH3X 4YTMA 3LZXA 2AL2B 3SZWA 2CFYA 2GEWA 1JDFA 3COXA 3MUCA 4DYEA 4K5SA 3P4PA 2AL2A 3BJSA 4HCLA 1F6MA 4NZHA 1EBGA 1K4QA 1H82A 4D03A 3MZNA 1MNSA 1EL8A 1XPQA 4HA6A 2WPFA 2XH0A 3TOYA 3AEAA 1FL2A 1E7PA 3V76A 1E39A 2PMQA 3FIMB 2POZA 3R0UA 1N4VA 1O5WA 1W6TA 3T2ZA 1MO9A 3M12A 3NK0X 2XFNA 4FI4A 1BKHA 2C75A 2WDQA 1NDAA 4B68A 1HYUA 2QDDA 4AP1A 3I6EA 4H2PA 3NNEA 3ADAB 3SY4A 4CCRA 1H86A 1H2IA 1GV4A 2GR2A 2YAUA 3NO1A 3FJ4A 3G5QA 1BKWA 3Q45A 4Y4MA 4CNKA 1VQZA 3ZLFA 2WPEA 2BK5A 2CHRA 1PDZA 3ENLA 3UJEA 2P8BA 3GWDA 1KN0A 2JK6A 3TCSA 5LV9A 2VRLA 3NK2X 1TE6A 3VDGA 4B64A 1L9EA 3QFBA 3ES8A 3D46A 4UP3A 4LA1A 3PK7A 3AE4A 3BOXA 3SGLA 1CL0A 1GERA 2YLWA 3RR1A 1SJAA 3T4WA 2CULA 4H2RA 4FK1A 4M0XA 3K7MX 3MQTA 3UXKA 4GISA 3UP5A 4YSYA 2GGGA 3KKJA 3TQPA 1FO4A 3BHKA 3ICRA 3PWGA 1GT8A 4U2TA 4PABA 4WCTA 3UXLA 4OPDA 2PP1A 2PU1A 2OALA 2C73A 5J7XA 4JNAA 4U8OA 5G5HB 1TRBA 3N6HA 3UTGA 2GGHA 1JRPA 1H6VA 3DIPA 3NVVB 1DOBA 2YLXA 4H4ZA 3GC2A 2YM2A 3L1RA 4UDQA 2OQHA 2PCEA 3AE3A 3V4BA 2PTYA 2VQ7A 3I6TA 2OPJA 3MY9A 4M52A 5BOEA 5U1OA 1H7XA 1W4XA 1EC9A 1NU5A 1TYTA 3AE6A 3AECA 5FJRA 3R0KA 3RCYA 3DA1A 4IA6A 4YSHA 3EF6A 5M0ZA 4REKA 4YTPA 1GRFA 3ZVIA 3DESA 3V5CA 3OZYA 3D8XA 3HRDC 3SJNA 4DHGA 1Q1RA 3AE9A 1S3BA 3GYIA 2QA1A 1PDHA 3UOXA 3R1ZA 1JNRA 1LTXR 2YVGA 3R9UA 1NG4A 2IVEA 3CNDA 1KNRA 3EKGA 4BV6A 4G6GA 3SSZA 3P4RA 4IL0A 3EEZA 4GR1A 3WE0A 5CQFA 1CF3A 4EMJA 4XWRA 1CJ2A 4H4XA 3KPKA 3SN0A 2PTXA 2I5QA 4DX3A 3MWCA 3T6CA 4K8GA 4YXDA 2B9YA 3T31A 1N1PA 1H7WA 1LV0A 3PVCA 2QCUA 2BACA 4K1WA 4H4PA 4TM0A 5BUKA 1STZA 3CXBA 3UGVA 3OPSA 3G5RA 1MOKA 5HHFA 4KT2A 3T14A 2PS2A 4A79A 2CDUA 6ENLA 4EQXA 5BOFA 1PHHA 1ZY8A 2Z5XA 3AD7B 3AD9B 1BGNA 3FMWA 2R46A 4U2SA 4HNLA 3QKEA 3SN1A 3I4KA 5JCNA 5IPYA 4FK1C 2AKMA 2PYXA 5JCIA 2RGJA 2YR5A 3DGHA 3AB1A 4C3XA 4CRTA 1GOSA 4A35A 4Z24A 4Y4LA 2NVKX 4ZCCA 1AOGA 2R0PA 1BZLA 1OEPA 3BNMA 2Z5YA 4NNJA 1TYPA 1DJQA 3PS9A 3R07C 3GDPA 4MKSA 2BYBA 5CKUA 1K0IA 3II4A 2GB0A 2RGHA 2I0ZA 3SR6B 1Y56B 4APNA 4U8LA 5HXIA 3TTEA 2QVHA 2B7RA 3RO6A 4OPLA 1B37A 1Y0PA 4OVIA 3GRSA 3NTAA 3MSYA 4E6MA 3F8DA 3ALJA 4KPRA 1L8PA 3BNUA 4AP3A 2X99A 2ZADA 3UKFA 4RG4A 4H50A 1E1NA 1ECQA 2YVFA 4OPIA 2FJEA 3V3OA 3CYJA 4JY2A 3CPHG 3RP6A 4A9WA 3ATQA 3TWAA 4G74A 1V97A 3NK1X 5BRTA 2BCPA 1TDOA 3GMBA 4TLXA 3PFRA 2TMDA 3AE2A 3RNMA 2XVHA 4K5RA 3D47A 4CY6A 2BS4A 1ZMDA 3RP8A 2C66A 4RSLA 4C5OA 3P4QA 2DKHA 3D1CA 1IJHA 4LU6A 1VDCA 3I3LA 2P0IA 4Z2TA 4AT2A 4P9SA
chains in the Genus database with same CATH topology
2GR3A 1PXBA 5EOWA 1H2IA 4A65A 2NPXA 1GV4A 4OPUA 5L46A 1P2HA 2XLRA 2YVJA 2GR2A 2YAUA 4YSXA 3VRDB 2WU2A 2XVJA 3DMEA 3SM8A 3SZ0A 4RG3A 5HY5A 1DXLA 2R4EA 2WHDA 3G5QA 4E0VA 1X31B 4YT0A 1BKWA 2UZZA 1E1LA 2X8GA 2GRTA 4BJZA 1L9DA 4C3YA 5C3JA 3HYWA 3CMMA 1GRTA 2WPCA 4Y4MA 2YLRA 4H4UA 4CNKA 2ARDA 1IUXA 1ELIA 3UTFA 1GRGA 2WPEA 2BK5A 4U8PA 2WOWA 4OPGA 2AAQA 3CGEA 1E1KA 1B4VA 4GF7A 3IHMA 2X50A 3T37A 2V5ZA 3GWDA 1KN0A 2JK6A 3P4SA 3VRAA 2TPRA 3PO7A 1CJCA 3F8RA 5EB4A 3CIRA 5LV9A 2VRLA 1YQ4A 3NK2X 3D9XA 1KFYA 3CGCA 4HB9A 2F5ZA 3DJGX 5FMHA 5KNLA 4H2QA 4B64A 1L9EA 3QFBA 1O94A 2Y6QA 4J34A 2R4JA 4UP3A 1Y56A 5JRBA 4LA1A 2YG5A 2C4CA 3ABVA 2GAHB 3AE4A 1CC4A 4K22A 3AD8B 2V3AA 4KX6A 3M0OA 3SGLA 3ZYXA 1CL0A 1GERA 4XWZA 2BA9A 3B6DA 2YLWA 1M6IA 4UDRA 3AYIA 3PG6A 2C3CA 4JQ9A 4OCGA 4I59A 4NTEA 3LZWA 3DK4A 5FS6A 2BK3A 2CULA 2XDOA 1PS9A 4JNQA 3KD9A 2RGOA 3LB8A 4H4RA 4X4JA 3SYIA 3CTYA 3UOVA 4H2RA 3GSIA 3NN0X 4FK1A 2X3NA 2YLTA 2GQWA 1N4WA 2RABA 2Q0KA 3P1WA 3GDNA 3UTEA 4A7AA 1K0JA 3AEFA 1GNDA 4NTCA 1PN0A 3K7MX 4C77A 5IQ4A 2B9WA 2GMJA 1JRYA 4GAVA 4GCMA 4D04A 3UP5A 4YSYA 2A87A 3EANA 1E6EA 3KVEA 1PBFA 4EQSA 1NG3A 3DJDA 4EMIA 3KKJA 4TM3A 4B66A 2WP9A 1ZK7A 3Q9TA 3BHKA 1GRHA 3KPFA 3FG2P 4NWZA 3C4AA 3ICRA 3QSSA 1GT8A 4U2TA 2GR1A 4U8IA 3UKLA 3IWAA 4PABA 1NENA 2ZBWA 4WCTA 2E5VA 3S61A 1QO8A 1GETA 1ZOYA 3SZFA 2FJAA 4J31A 4JY3A 4OPDA 2C3DA 1CC6A 1DODA 3GWFA 5BVAA 1KSSA 2OALA 4AT2A 2C73A 4U8MA 5J7XA 4A99A 3IHGA 4B65A 1PJ5A 3NYEA 2WOVA 4NTDA 1LQUA 1ZX9A 3FPZA 3BI4A 3AE1A 4JNAA 4U8OA 5EB5A 1DOEA 1TDFA 2B76A 2ZZCA 1TRBA 1XDIA 5JCKA 2BRYA 2V60A 3UOZA 3C4NA 3UTGA 2XVFA 1GRBA 1GTHA 2V6OA 5GSNA 1LVLA 1H6VA 4BK1A 2GR0A 3L5OA 2VOUA 3NT6A 4YWOA 2A89A 3HYVA 4U8JA 4Z2UA 3AXBA 1DOBA 2YLXA 2DKIA 1KDGA 1OJ9A 1L9CA 1RP0A 3H8LA 4B69A 4H4ZA 1JRZA 5KMRA 2HQMA 2YM2A 1LPFA 1XHCA 2V3BA 2PHHA 3L1RA 4UDQA 3KLJA 4Z44A 1ZKQA 4J33A 5FS7A 1YY5A 2ZZBA 3AE7A 2C70A 4O5UA 4X9MA 3LOVA 3AE3A 2EQ6A 2XLPA 1GPEA 5U25A 2YG7A 1NHSA 3QSMA 2VQ7A 1REOA 2X8HA 1QJDA 2GVCA 4M52A 3Q6JA 1PJ6A 2YG6A 2YM1A 3K30A 1KNPA 4C74A 3O0HA 2BC1A 2XLSA 3H4KA 5U1OA 1IUVA 4FK1C 1H7XA 5KVIA 2BXSA 1W4XA 5KOWA 2VVLG 2GQFA 4AOXA 4XXGA 2BC0A 2BABA 4A6NB 1TYTA 3DK8A 3QFAA 1O95A 2EQ7A 3AE6A 4B63A 2B9XA 3AECA 4H7UA 3S5WA 2VRMA 3DA1A 4IA6A 1TDKA 4O5QA 4YSHA 3VR8A 1PBBA 2OLNA 4Y4NA 3EF6A 2YLZA 5M0ZA 4JN9A 4REKA 5JCMA 4YTPA 1GTEA 3AE8A 3UKAA 1GRFA 4H4QA 4YSZA 3UCLA 5M10A 1FCDA 3UKPA 2BS2A 5HYMA 2VZ2A 3D8XA 3UKQA 1CJ4A 4PAAA 4H2NA 4II2A 1D7LA 1F8RA 1S2QA 4X9NA 3AYLA 1LQTA 4ZCDA 1XANA 1D4CA 1Q1RA 3GD3A 1ZDLA 4EM3A 2FBWA 3AE9A 1S3BA 4G73A 4J2WA 3GYIA 5IQ1A 4EIQA 2QA1A 1V59A 3LJPA 2Q7VA 1PDHA 3HYXA 4YKFA 3ALLA 3AEEA 3AYJA 3UOXA 1JNRA 1LTXR 4GAPA 1F3PA 1YQZA 1GSNA 1NHQA 1IUTA 1GREA 1Q1WA 1OJCA 2BRAA 2IVDA 2EQ8A 2YVGA 1DJNA 2APGA 3IF9A 3R9UA 1JRXA 1NG4A 2IVEA 4OPTA 3CNDA 4EIPA 2C7GA 2WOIA 1KNRA 3M13A 3QSEA 4IVOB 4BV6A 3RP7A 4H4SA 4NEVA 2H89A 1B5QA 3BI2A 3T2YA 4G6GA 2WDRA 3HZLA 5KVHA 4Z26A 1RYIA 3P4RA 4TM4A 2YWLA 4GR1A 2V61A 2R0GA 2XFOA 2YR6A 3WE0A 4USQA 5CQFA 4CNJA 1NHPA 1LJ1A 1CF3A 3ATRA 2E4GA 3K7TA 4EMJA 4H4WA 4XWRA 1CJ2A 4H4XA 2W0HA 4Z25A 3KPKA 1YQ3A 3NTDA 1VG0A 2Y6RA 3QVRA 4ZN0A 1H81A 2C64A 1OJTA 3BHFA 1VQWA 3ISHA 3SFDA 5KXJA 1ZMCA 5KMQA 1IUUA 3QJ4A 4FDCB 2VQBA 4USRA 4YXDA 4H4YA 2B9YA 3T31A 2R9ZA 3F8PA 4AT0A 1N1PA 1H7WA 2WEUA 4B1BA 1LV0A 4LIIA 1P2EA 1DNCA 3NRNA 3PVCA 1GEUA 4IA5A 2QCUA 4IV9A 3KA7A 3SX6A 2FJDA 2BACA 1YKJA 4OPCA 4AOSA 4Z43A 2OLOA 3CGDA 1KSUA 4H4PA 4TM0A 5DBJA 4DGKA 5BUKA 5KWFA 4JDRA 2C67A 1D5TA 1S7MA 1M64A 2JAEA 3CPJG 3G5RA 4BK2A 1MOKA 1D7YA 5HHFA 1TDNA 3T14A 3UKKA 2YG4A 2VVMA 1CBOA 4CY8A 2WP5A 4A79A 2O9ZA 3NN6X 3I6DA 1CJ3A 4B67A 2AQJA 2CDUA 3NGCX 4G9KA 4U8KA 4EQXA 5FS9A 1ZY8A 4EM4A 1PHHA 3C96A 3CNSA 1VRQB 2BXRA 3NG7X 2Z5XA 3AD7B 1GESA 2VVLA 3AD9B 3GD4A 1FEBA 3RHAA 3LADA 2XYOA 1BGNA 3URHA 3CPIG 1F8WA 3FMWA 2R46A 1BGJA 1PBCA 2WS3A 3NKSA 1ONFA 3ALMA 4U2SA 4J36A 3SXIA 4CCQA 1PBEA 4WX1A 1B8SA 1GXFA 1Q9IA 1PXCA 2R45A 3ITJA 2XFPA 5JCNA 5IPYA 1IUSA 1Z6LA 2GMHA 1FEAA 5ER0A 2PYXA 2BS3A 4K7ZA 3NYCA 5JCIA 2RGJA 1QLBA 3DGHA 4EMWA 2YR5A 3AB1A 3ICSA 4C3XA 5KMSA 1COYA 3CGBA 4CRTA 2JB2A 3JSKA 2EQ9A 1GOSA 4YTNA 1JEHA 5KMPA 1RSGA 4Z24A 1EL7A 1JU2A 3DH9A 1PJ7A 2A8XA 2JB1A 4DNAA 4Y4LA 1SEZA 2NVKX 1S2YA 1ZP0A 2OAMA 2XCGA 1H84A 1AOGA 4FX9A 3K7QX 4ZCCA 3UP4A 1GRAA 2R0PA 3UOYA 1NPXA 2Q0LA 1OJDA 5EBKA 1BZLA 2WESA 2R0CA 4A6NA 4EQWA 3DK9A 3BNMA 1E1MA 2FJBA 2Z5YA 4NNJA 4A5LA 1D4EA 3CNTA 4EQRA 2WETA 2GAGB 4U8NA 1TYPA 2OA1A 3AEBA 3NYFA 1DJQA 3PS9A 3L8KA 3GMCA 1JNZA 3AEDA 3GDPA 3VRBA 3GYJA 1F8SA 3KU9A 3AWIA 2BYBA 5CKUA 1D4DA 3FBSA 1EBDA 1K0IA 3II4A 2JKCA 3REDA 4ECHA 2GB0A 2YR4A 2JBVA 1NAAA 4Z2RA 2RGHA 5C2TA 2I0ZA 2YG3A 1PXAA 4GUVA 4BJYA 2X8CA 3IC9A 4NEWA 1OJAA 1IUWA 3VR9A 4DSHA 1Y56B 2WP6A 4J57A 1EL5A 2BCGG 4APNA 1GALA 1EL9A 2QAEA 4U8LA 3QVPA 3EAOA 3UKHA 1FOHA 5TR3A 2WQYA 5HXIA 3BI5A 2YLSA 1CHUA 1N4UA 4G6HA 1FECA 4DSGA 3DJJA 3LXDA 3CN8A 4GRTA 2B7RA 2GH5A 4OPLA 3DGZA 1B37A 1TDEA 1Y0PA 3SZCA 4OVIA 1NHRA 1DOCA 2H88A 5KOXA 4ICYA 2ACZA 2XVEA 5GRTA 3OZ2A 4K2XA 4II3A 5FS8A 3ICTA 2XVIA 3GRSA 3NTAA 3P9UA 4IVMB 5BULA 1ZOVA 2C76A 4ADWA 3ZDNA 2AR8A 3F8DA 3NIXA 4TM1A 3NHOX 2B7SA 3AEGA 2CVJA 2E1MA 3ALJA 3NH3X 4YTMA 3V3NA 1BF3A 4KPRA 5JCLA 1S3EA 2IIDA 3LZXA 3B3RA 3BNUA 3SZWA 4AP3A 3E1TA 4UDPA 2X99A 4H4TA 3CNPA 2CFYA 1MXTA 2GEWA 1BWCA 2GV8A 2JB3A 3UKFA 3T2KA 4RG4A 4H4VA 4H50A 1E1NA 2YVFA 3COXA 1H83A 4OPIA 2C72A 4K5SA 4GDPA 5U63A 3P4PA 3SQPA 3SFEA 4BK3A 2FJEA 3V3OA 5J60A 4JY2A 1F6MA 1UKVG 4NZHA 3CPHG 3NLCA 2ZZ0A 4GDEA 5KRQA 1K4QA 1H82A 2XLTA 3RP6A 2WBAA 1KF6A 4D03A 4I58A 4A9WA 3ATQA 3GYXA 1EL8A 1XPQA 4HA6A 2WPFA 4MJWA 4G74A 3NK1X 2GF3A 3AEAA 5BRTA 2BCPA 1TDOA 1FL2A 1E7PA 1PBDA 3V76A 1E39A 3FIMB 3GMBA 1N4VA 2XFUA 3UTHA 2WDVA 2J3NA 1O5WA 1JOAA 1CC2A 3OC4A 2WU5A 4TLXA 1L0VA 3GRTA 2Q6UA 2TMDA 3T2ZA 1MO9A 3M12A 4CBQA 3NK0X 2QA2A 4K8DA 3AE2A 3AE5A 3RNMA 2C65A 2XVHA 2XFNA 4K5RA 4CY6A 4YKGA 4BURA 1K0LA 2BS4A 3G5SA 4TLZA 1ZMDA 2C75A 2WDQA 3RP8A 1NDAA 2C66A 1HYUA 4B68A 4RSLA 2BK4A 4C5OA 2YQUA 3P4QA 4AP1A 2DKHA 3D1CA 1NEKA 3EPTA 3CNJA 1IJHA 4H2PA 4LU6A 3VQRA 3NNEA 4J56A 1VDCA 3ADAB 3I3LA 3SY4A 3DJEA 4Z2TA 2XLUA 1VG9A 2XFQA 4CCRA 3H8IA 1H86A 4N9XA 4U2LA 4P9SA 3T0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GR3 A;  1PXB A;  5EOW A;  5L46 A;  4A65 A;  2NPX A;  1GV4 A;  4OPU A;  1P2H A;  2XLR A;  2YVJ A;  2GR2 A;  2YAU A;  4YSX A;  3VRD B;  2WU2 A;  2XVJ A;  3DME A;  3SM8 A;  4RG3 A;  5HY5 A;  1DXL A;  2R4E A;  2WHD A;  3G5Q A;  4E0V A;  1X31 B;  4YT0 A;  1BKW A;  2UZZ A;  1E1L A;  2X8G A;  2GRT A;  4BJZ A;  1L9D A;  4C3Y A;  5C3J A;  1GRT A;  2WPC A;  4Y4M A;  2YLR A;  4H4U A;  4CNK A;  2ARD A;  1IUX A;  1ELI A;  3UTF A;  1GRG A;  2WPE A;  2BK5 A;  4U8P A;  2WOW A;  4OPG A;  2AAQ A;  3CGE A;  1E1K A;  1B4V A;  4GF7 A;  3IHM A;  2X50 A;  3T37 A;  2V5Z A;  3GWD A;  2JK6 A;  3P4S A;  3VRA A;  2TPR A;  3PO7 A;  1CJC A;  3F8R A;  5EB4 A;  3CIR A;  5LV9 A;  2VRL A;  1YQ4 A;  3NK2 X;  1KFY A;  3CGC A;  4HB9 A;  2F5Z A;  3DJG X;  5FMH A;  4H2Q A;  4B64 A;  1L9E A;  3QFB A;  1O94 A;  2Y6Q A;  4J34 A;  2R4J A;  4UP3 A;  1Y56 A;  2YG5 A;  4LA1 A;  3ABV A;  2GAH B;  3AE4 A;  1CC4 A;  4K22 A;  3AD8 B;  2V3A A;  4KX6 A;  3M0O A;  3SGL A;  3ZYX A;  1CL0 A;  1GER A;  4XWZ A;  2BA9 A;  3B6D A;  2YLW A;  1M6I A;  4UDR A;  3AYI A;  2C3C A;  4JQ9 A;  4OCG A;  4I59 A;  4NTE A;  3LZW A;  3DK4 A;  5FS6 A;  2BK3 A;  2CUL A;  2XDO A;  1PS9 A;  4JNQ A;  3KD9 A;  2RGO A;  3LB8 A;  4H4R A;  4X4J A;  3UOV A;  3CTY A;  4H2R A;  3GSI A;  3NN0 X;  4FK1 A;  2X3N A;  2YLT A;  2GQW A;  1N4W A;  2RAB A;  2Q0K A;  3P1W A;  3GDN A;  3UTE A;  4A7A A;  1K0J A;  3AEF A;  1GND A;  4NTC A;  1PN0 A;  3K7M X;  4C77 A;  5IQ4 A;  2B9W A;  2GMJ A;  1JRY A;  4GCM A;  4D04 A;  3UP5 A;  4YSY A;  2A87 A;  3EAN A;  1E6E A;  3KVE A;  1PBF A;  4EQS A;  1NG3 A;  3DJD A;  4EMI A;  3KKJ A;  4TM3 A;  4B66 A;  2WP9 A;  1ZK7 A;  3Q9T A;  3BHK A;  1GRH A;  3KPF A;  3FG2 P;  3C4A A;  3ICR A;  3QSS A;  1GT8 A;  4U2T A;  2GR1 A;  4U8I A;  3UKL A;  3IWA A;  4PAB A;  1NEN A;  2ZBW A;  4WCT A;  2E5V A;  3S61 A;  1QO8 A;  1GET A;  1ZOY A;  2FJA A;  4J31 A;  4JY3 A;  4OPD A;  2C3D A;  1CC6 A;  1DOD A;  3GWF A;  5BVA A;  1KSS A;  2OAL A;  4AT2 A;  2C73 A;  4U8M A;  5J7X A;  4A99 A;  3IHG A;  4B65 A;  1PJ5 A;  3NYE A;  2WOV A;  4NTD A;  1LQU A;  1ZX9 A;  3FPZ A;  3BI4 A;  3AE1 A;  4JNA A;  4U8O A;  5EB5 A;  1DOE A;  1TDF A;  2B76 A;  2ZZC A;  1TRB A;  1XDI A;  5JCK A;  3UOZ A;  2V60 A;  3C4N A;  3UTG A;  2XVF A;  1GRB A;  1GTH A;  2V6O A;  5GSN A;  1LVL A;  1H6V A;  4BK1 A;  2GR0 A;  2VOU A;  3NT6 A;  4YWO A;  2A89 A;  4U8J A;  4Z2U A;  3AXB A;  1DOB A;  2YLX A;  2DKI A;  1KDG A;  1OJ9 A;  1L9C A;  1RP0 A;  3H8L A;  4B69 A;  4H4Z A;  1JRZ A;  2HQM A;  2YM2 A;  1LPF A;  1XHC A;  2PHH A;  2V3B A;  3L1R A;  4UDQ A;  3KLJ A;  4Z44 A;  1ZKQ A;  4J33 A;  5FS7 A;  1YY5 A;  2ZZB A;  3AE7 A;  2C70 A;  4O5U A;  4X9M A;  3LOV A;  3AE3 A;  2EQ6 A;  2XLP A;  1GPE A;  5U25 A;  2YG7 A;  1NHS A;  3QSM A;  2VQ7 A;  1REO A;  2X8H A;  1QJD A;  2GVC A;  4M52 A;  3Q6J A;  1PJ6 A;  2YG6 A;  2YM1 A;  3K30 A;  1KNP A;  4C74 A;  3O0H A;  2BC1 A;  2XLS A;  3H4K A;  5U1O A;  1IUV A;  4FK1 C;  1H7X A;  5KVI A;  2BXS A;  1W4X A;  5KOW A;  2VVL G;  2GQF A;  4AOX A;  4XXG A;  2BC0 A;  2BAB A;  4A6N B;  1TYT A;  3DK8 A;  3QFA A;  1O95 A;  2EQ7 A;  3AE6 A;  4B63 A;  2B9X A;  3AEC A;  4H7U A;  3S5W A;  2VRM A;  3DA1 A;  4IA6 A;  1TDK A;  4O5Q A;  4YSH A;  3VR8 A;  1PBB A;  2OLN A;  4Y4N A;  3EF6 A;  2YLZ A;  5M0Z A;  4JN9 A;  4REK A;  5JCM A;  4YTP A;  1GTE A;  3AE8 A;  3UKA A;  1GRF A;  4H4Q A;  4YSZ A;  3UCL A;  5M10 A;  1FCD A;  3UKP A;  2BS2 A;  5HYM A;  2VZ2 A;  3D8X A;  3UKQ A;  1CJ4 A;  4PAA A;  4H2N A;  1D7L A;  1F8R A;  1S2Q A;  4X9N A;  3AYL A;  1LQT A;  4ZCD A;  1XAN A;  1D4C A;  1Q1R A;  3GD3 A;  1ZDL A;  4EM3 A;  2FBW A;  3AE9 A;  1S3B A;  4J2W A;  3GYI A;  5IQ1 A;  4EIQ A;  2QA1 A;  1V59 A;  3LJP A;  2Q7V A;  1PDH A;  4YKF A;  3ALL A;  3AEE A;  3AYJ A;  3UOX A;  1JNR A;  1LTX R;  1F3P A;  1YQZ A;  1GSN A;  1NHQ A;  1IUT A;  1GRE A;  1Q1W A;  1OJC A;  2IVD A;  2EQ8 A;  2YVG A;  1DJN A;  2APG A;  3IF9 A;  3R9U A;  1JRX A;  1NG4 A;  2IVE A;  4OPT A;  3CND A;  4EIP A;  2C7G A;  2WOI A;  1KNR A;  3M13 A;  3QSE A;  4IVO B;  4BV6 A;  3RP7 A;  4H4S A;  4NEV A;  2H89 A;  1B5Q A;  3BI2 A;  2WDR A;  3HZL A;  5KVH A;  4Z26 A;  1RYI A;  3P4R A;  4TM4 A;  2YWL A;  4GR1 A;  2V61 A;  2R0G A;  2XFO A;  2YR6 A;  3WE0 A;  4USQ A;  5CQF A;  4CNJ A;  1NHP A;  1LJ1 A;  1CF3 A;  3ATR A;  2E4G A;  3K7T A;  4EMJ A;  4H4W A;  4XWR A;  1CJ2 A;  4H4X A;  2W0H A;  4Z25 A;  3QVR A;  1YQ3 A;  3NTD A;  1VG0 A;  2Y6R A;  4ZN0 A;  1H81 A;  2C64 A;  1OJT A;  3BHF A;  1VQW A;  3ISH A;  3SFD A;  5KXJ A;  1ZMC A;  1IUU A;  3QJ4 A;  4FDC B;  2VQB A;  4USR A;  4YXD A;  4H4Y A;  2B9Y A;  2R9Z A;  3F8P A;  4AT0 A;  1N1P A;  1H7W A;  2WEU A;  4B1B A;  1LV0 A;  4LII A;  1P2E A;  1DNC A;  3NRN A;  3PVC A;  1GEU A;  4IA5 A;  2QCU A;  4IV9 A;  3KA7 A;  2FJD A;  2BAC A;  1YKJ A;  4OPC A;  4AOS A;  4Z43 A;  2OLO A;  3CGD A;  1KSU A;  4H4P A;  4TM0 A;  5DBJ A;  4DGK A;  5BUK A;  5KWF A;  4JDR A;  2C67 A;  1D5T A;  2JAE A;  1M64 A;  3CPJ G;  3G5R A;  4BK2 A;  1MOK A;  1D7Y A;  5HHF A;  1TDN A;  3UKK A;  2YG4 A;  2VVM A;  1CBO A;  4CY8 A;  2WP5 A;  4A79 A;  2O9Z A;  3NN6 X;  3I6D A;  1CJ3 A;  4B67 A;  2AQJ A;  2CDU A;  3NGC X;  4U8K A;  4EQX A;  5FS9 A;  1ZY8 A;  4EM4 A;  1PHH A;  3C96 A;  3CNS A;  1VRQ B;  2BXR A;  3NG7 X;  2Z5X A;  3AD7 B;  1GES A;  2VVL A;  3AD9 B;  3GD4 A;  1FEB A;  3RHA A;  3LAD A;  2XYO A;  1BGN A;  3URH A;  3CPI G;  1F8W A;  3FMW A;  2R46 A;  1BGJ A;  1PBC A;  2WS3 A;  3NKS A;  1ONF A;  3ALM A;  4U2S A;  4J36 A;  4CCQ A;  1PBE A;  4WX1 A;  1B8S A;  1GXF A;  1Q9I A;  1PXC A;  2R45 A;  3ITJ A;  2XFP A;  5JCN A;  5IPY A;  1IUS A;  1Z6L A;  2GMH A;  1FEA A;  5ER0 A;  2PYX A;  2BS3 A;  4K7Z A;  3NYC A;  5JCI A;  2RGJ A;  1QLB A;  3DGH A;  4EMW A;  2YR5 A;  3AB1 A;  3ICS A;  4C3X A;  1COY A;  3CGB A;  4CRT A;  2JB2 A;  3JSK A;  2EQ9 A;  1GOS A;  4YTN A;  1JEH A;  1RSG A;  4Z24 A;  1EL7 A;  1JU2 A;  3DH9 A;  1PJ7 A;  2A8X A;  2JB1 A;  4DNA A;  4Y4L A;  1SEZ A;  2NVK X;  1S2Y A;  1ZP0 A;  2OAM A;  2XCG A;  1H84 A;  1AOG A;  4FX9 A;  3K7Q X;  4ZCC A;  3UP4 A;  1GRA A;  2R0P A;  3UOY A;  1NPX A;  2Q0L A;  1OJD A;  5EBK A;  1BZL A;  2WES A;  2R0C A;  4A6N A;  4EQW A;  3DK9 A;  3BNM A;  1E1M A;  2FJB A;  2Z5Y A;  4A5L A;  1D4E A;  3CNT A;  4EQR A;  2WET A;  2GAG B;  4U8N A;  1TYP A;  2OA1 A;  3AEB A;  3NYF A;  1DJQ A;  3PS9 A;  3L8K A;  3GMC A;  1JNZ A;  3AED A;  3GDP A;  3VRB A;  3GYJ A;  1F8S A;  3KU9 A;  3AWI A;  2BYB A;  5CKU A;  1D4D A;  3FBS A;  1EBD A;  1K0I A;  3II4 A;  2JKC A;  3RED A;  4ECH A;  2GB0 A;  2YR4 A;  2JBV A;  1NAA A;  4Z2R A;  2RGH A;  5C2T A;  2I0Z A;  2YG3 A;  1PXA A;  4GUV A;  4BJY A;  2X8C A;  3IC9 A;  4NEW A;  1OJA A;  1IUW A;  3VR9 A;  4DSH A;  1Y56 B;  2WP6 A;  4J57 A;  1EL5 A;  2BCG G;  4APN A;  1GAL A;  1EL9 A;  2QAE A;  4U8L A;  3QVP A;  3EAO A;  3UKH A;  1FOH A;  5TR3 A;  2WQY A;  5HXI A;  3BI5 A;  2YLS A;  1CHU A;  1N4U A;  1FEC A;  4DSG A;  3DJJ A;  3LXD A;  3CN8 A;  4GRT A;  2B7R A;  2GH5 A;  4OPL A;  3DGZ A;  1B37 A;  1TDE A;  1Y0P A;  4OVI A;  1NHR A;  1DOC A;  2H88 A;  5KOX A;  4ICY A;  2ACZ A;  2XVE A;  5GRT A;  3OZ2 A;  4K2X A;  5FS8 A;  3ICT A;  2XVI A;  3GRS A;  3NTA A;  3P9U A;  4IVM B;  5BUL A;  1ZOV A;  2C76 A;  4ADW A;  3ZDN A;  2AR8 A;  3F8D A;  3NIX A;  4TM1 A;  3NHO X;  2B7S A;  3AEG A;  2CVJ A;  2E1M A;  3ALJ A;  3NH3 X;  4YTM A;  3V3N A;  1BF3 A;  4KPR A;  5JCL A;  1S3E A;  2IID A;  3LZX A;  3B3R A;  3BNU A;  4AP3 A;  3E1T A;  4UDP A;  2X99 A;  4H4T A;  3CNP A;  2CFY A;  1MXT A;  2GEW A;  1BWC A;  2GV8 A;  2JB3 A;  3UKF A;  4RG4 A;  4H4V A;  4H50 A;  1E1N A;  2YVF A;  3COX A;  1H83 A;  4OPI A;  2C72 A;  4K5S A;  4GDP A;  5U63 A;  3P4P A;  3SQP A;  3SFE A;  4BK3 A;  2FJE A;  3V3O A;  5J60 A;  4JY2 A;  1F6M A;  1UKV G;  4NZH A;  3CPH G;  3NLC A;  2ZZ0 A;  4GDE A;  5KRQ A;  1K4Q A;  1H82 A;  2XLT A;  3RP6 A;  2WBA A;  1KF6 A;  4D03 A;  4I58 A;  4A9W A;  3ATQ A;  1EL8 A;  1XPQ A;  4HA6 A;  2WPF A;  4MJW A;  3NK1 X;  2GF3 A;  3AEA A;  5BRT A;  2BCP A;  1TDO A;  1FL2 A;  1E7P A;  1PBD A;  3V76 A;  1E39 A;  3FIM B;  3GMB A;  1N4V A;  2XFU A;  3UTH A;  2WDV A;  2J3N A;  1O5W A;  1JOA A;  1CC2 A;  3OC4 A;  2WU5 A;  4TLX A;  1L0V A;  3GRT A;  2Q6U A;  2TMD A;  1MO9 A;  3M12 A;  4CBQ A;  3NK0 X;  2QA2 A;  4K8D A;  3AE2 A;  3AE5 A;  3RNM A;  2C65 A;  2XVH A;  2XFN A;  4K5R A;  4CY6 A;  4YKG A;  4BUR A;  1K0L A;  2BS4 A;  3G5S A;  4TLZ A;  1ZMD A;  2C75 A;  2WDQ A;  3RP8 A;  1NDA A;  2C66 A;  1HYU A;  4B68 A;  4RSL A;  2BK4 A;  4C5O A;  2YQU A;  3P4Q A;  4AP1 A;  2DKH A;  3D1C A;  1NEK A;  3EPT A;  3CNJ A;  1IJH A;  4H2P A;  4LU6 A;  3VQR A;  3NNE A;  4J56 A;  1VDC A;  3ADA B;  3I3L A;  3DJE A;  4Z2T A;  2XLU A;  1VG9 A;  2XFQ A;  4CCR A;  3H8I A;  1H86 A;  4N9X A;  4U2L A;  4P9S A; 
#chains in the Genus database with same CATH topology
 1PXB A;  3CT2 A;  2NPX A;  3VRD B;  3DME A;  3SM8 A;  5HY5 A;  4E0V A;  1TZZ A;  4YT0 A;  2X8G A;  2GRT A;  1L9D A;  3HYW A;  2WPC A;  2YLR A;  5FJO A;  4ZCW A;  1IUX A;  1MDR A;  2WOW A;  3FV9 A;  2AAQ A;  1E1K A;  4GF7 A;  2V5Z A;  2TPR A;  3CIR A;  4H2Q A;  2R4J A;  1R0M A;  3ABV A;  4JN8 A;  3AD8 B;  3ZYX A;  4XWZ A;  3B6D A;  3PG6 A;  4JQ9 A;  2PSN A;  3DK4 A;  4JNQ A;  3SYI A;  3CTY A;  2X3N A;  4ZOH B;  2YLT A;  2ONE A;  3P1W A;  1K0J A;  3AEF A;  1PN0 A;  4C77 A;  2PP3 A;  1JRY A;  4JHM A;  3KVE A;  1PBF A;  4EQS A;  3DJD A;  4EMI A;  1GRH A;  4NWZ A;  3C4A A;  3UKL A;  2GR1 A;  4A3R A;  1N60 C;  1QO8 A;  1ZOY A;  3SZF A;  2GSH A;  2FJA A;  2C3D A;  1CC6 A;  3GWF A;  1XPY A;  3NYE A;  2WOV A;  3FPZ A;  3S5S A;  3BI4 A;  5EB5 A;  1DOE A;  2BRY A;  1JPM A;  3C4N A;  5GSN A;  2PPG A;  2GR0 A;  2A89 A;  2HXU A;  3H8L A;  1KDG A;  1OJ9 A;  2HQM A;  4Z44 A;  2ZZB A;  3JW7 A;  1GPE A;  5U25 A;  1REO A;  3UJR A;  2X8H A;  2RDX A;  1PJ6 A;  3O0H A;  2BC1 A;  3H4K A;  4IP5 A;  2GQF A;  3DK8 A;  2EQ7 A;  3GD6 A;  2B9X A;  4H7U A;  4MMW A;  3S5W A;  2VRM A;  4ROP A;  4JN9 A;  5JCM A;  3AE8 A;  4YSZ A;  3UCL A;  3R25 A;  5M10 A;  1PDY A;  3U4F A;  5HYM A;  3FVD A;  3UKQ A;  4PAA A;  1D7L A;  1D4C A;  2FKP A;  2OX4 A;  4EM3 A;  2FBW A;  4J2W A;  5IQ1 A;  1V59 A;  2Q7V A;  3STP A;  4GAP A;  1YQZ A;  1NHQ A;  1GRE A;  1Q1W A;  1SB3 B;  2EQ8 A;  3TW9 A;  1DJN A;  4G8T A;  4OPT A;  4EIP A;  2C7G A;  2WOI A;  3QSE A;  3T2Y A;  3CB3 A;  2PTW A;  3HZL A;  3RIT A;  4ZA0 A;  2YWL A;  2YR6 A;  4CNJ A;  1NHP A;  3QVR A;  1VG0 A;  4HYR A;  2C64 A;  3BHF A;  5KMQ A;  3QJ4 A;  3F8P A;  4AT0 A;  4FP1 A;  4IA5 A;  3V3W A;  1DNC A;  1GEU A;  2OZT A;  4IV9 A;  3NS1 B;  1ONE A;  3CGD A;  5DBJ A;  4DGK A;  2OZ8 A;  2C67 A;  1D7Y A;  3NZG A;  3AM9 A;  1TDN A;  3UKK A;  2YG4 A;  1CBO A;  4CY8 A;  2O9Z A;  3I6D A;  4B67 A;  4G9K A;  4U8K A;  1RM6 B;  5FS9 A;  3KUM A;  2VVL A;  2GDQ A;  3V5F A;  3RHA A;  3URH A;  1F8W A;  1N63 C;  4Z17 A;  2WS3 A;  1ONF A;  4J36 A;  3P0W A;  4WX1 A;  2PP0 A;  1DTN A;  1GXF A;  4ENL A;  1IUS A;  2GMH A;  1FEA A;  5ER0 A;  4K7Z A;  4EMW A;  4J1O A;  3VC6 A;  3VA8 A;  4YTN A;  5KMP A;  1JU2 A;  3DH9 A;  1PJ7 A;  2A8X A;  1SEZ A;  1ZP0 A;  2GGE A;  4TVY A;  3UP4 A;  1KKO A;  3AMZ A;  5EBK A;  4H19 A;  3NRZ B;  4EQW A;  3TJI A;  1D4E A;  1JPD X;  7ENL A;  3JZU A;  2WET A;  2XH7 A;  3L8K A;  3GMC A;  1JNZ A;  3VRB A;  3KU9 A;  4GIR A;  2O56 A;  1FFV C;  1EBD A;  2JKC A;  1NAA A;  1PXA A;  3IC9 A;  4H2H A;  4DSH A;  2BCG G;  3S47 A;  3UKH A;  1FOH A;  3OW1 A;  5TR3 A;  3UJF A;  3BI5 A;  1R6W A;  3DJJ A;  3LXD A;  3DGZ A;  1X2H A;  3A7U A;  2H88 A;  2ACZ A;  4II3 A;  5GRT A;  4K2X A;  5FS8 A;  3ICT A;  2C76 A;  2HZG A;  3ZDN A;  2AR8 A;  4TM1 A;  3NHO X;  2B7S A;  2CVJ A;  1JRO A;  4IL2 A;  1BF3 A;  1S3E A;  2HNE A;  3E1T A;  4HPN A;  4H4T A;  3AN1 A;  3CNP A;  2MNR A;  4H4V A;  2C72 A;  4GDP A;  3SQP A;  4BK3 A;  5J60 A;  3THU A;  3NLC A;  2ZZ0 A;  4GDE A;  5KRQ A;  2WBA A;  1KF6 A;  1RVK A;  4I58 A;  3N6J A;  3PWI A;  4K2S A;  2GF3 A;  3H70 A;  4GGB A;  3UTH A;  2XFU A;  2J3N A;  1CC2 A;  3OC4 A;  3GRT A;  2Q6U A;  4K8D A;  3AE5 A;  4YKG A;  4BUR A;  1K0L A;  4TLZ A;  1F9C A;  3B9J B;  3EPT A;  3CNJ A;  4J56 A;  3DJE A;  1VG9 A;  4M6U A;  2OZ3 A;  4U2L A;  5L46 A;  1P2H A;  4YSX A;  2WU2 A;  2XVJ A;  3SZ0 A;  4RG3 A;  2R4E A;  2WHD A;  1X31 B;  2UZZ A;  4GYP A;  3SQS A;  3HPF A;  4C3Y A;  3CMM A;  1GRT A;  4H4U A;  1FHU A;  3UTF A;  1KCZ A;  1GRG A;  4U8P A;  2XSX A;  4E8G A;  4TVW A;  2X50 A;  4GFI A;  4F4R A;  3PO7 A;  1CJC A;  3F8R A;  5EB4 A;  1YQ4 A;  3D9X A;  3CGC A;  4HB9 A;  2F5Z A;  3DJG X;  5FMH A;  5KNL A;  4J34 A;  3DFY A;  4IZG A;  1Y56 A;  5JRB A;  3IK4 A;  2C4C A;  2PU0 A;  2W54 A;  1X2G A;  1CC4 A;  2V3A A;  3M0O A;  2BA9 A;  4UDR A;  1M6I A;  3AYI A;  2C3C A;  1EC8 A;  4OCG A;  3LZW A;  5FS6 A;  2BK3 A;  2XDO A;  1PS9 A;  2RGO A;  4H4R A;  3FXG A;  3UOV A;  3GSI A;  3NN0 X;  2GQW A;  4HN8 A;  2Q0K A;  3FYY A;  4DWD A;  4NTC A;  5IQ4 A;  2GMJ A;  2OQY A;  4D04 A;  3VFC A;  2A87 A;  3EAN A;  4J3Z A;  1E6E A;  1NG3 A;  4B66 A;  2WP9 A;  1ZK7 A;  3Q9T A;  3KPF A;  2W3S A;  3QSS A;  4U8I A;  2E3T A;  2E5V A;  3S61 A;  1GET A;  5IDZ A;  4J31 A;  5BVA A;  1KSS A;  4U8M A;  4IHC A;  3IHG A;  1LQU A;  1ZX9 A;  2ZZC A;  1LVL A;  3L5O A;  2VOU A;  4U8J A;  4Z2U A;  3AXB A;  1RP0 A;  2QJJ A;  1JRZ A;  1LPF A;  1XHC A;  2PHH A;  1ZKQ A;  5FS7 A;  1YY5 A;  2C70 A;  1N5X A;  1P48 A;  3ZLH A;  2XLP A;  3RRA A;  3DG3 A;  1QJD A;  3K30 A;  2YG6 A;  2QJM A;  1IUV A;  5KVI A;  5KOW A;  4GME A;  2VVL G;  4XXG A;  4A6N B;  1O95 A;  4B63 A;  2W55 A;  4O5Q A;  1TDK A;  3VR8 A;  1PBB A;  2OLN A;  2YLZ A;  3QN3 A;  3UKA A;  5ENL A;  2BS2 A;  2VZ2 A;  3DER A;  1CJ4 A;  4H2N A;  4II2 A;  4KPL A;  4X9N A;  3GD3 A;  3UJS A;  4G73 A;  3BSM A;  3HYX A;  4YKF A;  3AYJ A;  1IUT A;  1OJC A;  2IVD A;  2BRA A;  4IT1 A;  2APG A;  3IF9 A;  1JRX A;  4IVO B;  3RP7 A;  3CXO A;  4H4S A;  4NEV A;  2H89 A;  1B5Q A;  3BI2 A;  4JN7 A;  4TM4 A;  1YEY A;  2R0G A;  3ATR A;  2E4G A;  3ZLG A;  2W0H A;  1YQ3 A;  4GYP C;  1H81 A;  3ISH A;  3SFD A;  5KXJ A;  2VQB A;  4USR A;  3GY1 A;  4H4Y A;  2R9Z A;  3ZVH B;  1P2E A;  3OP2 A;  3KA7 A;  3SX6 A;  1YKJ A;  4AOS A;  4Z43 A;  4KWS A;  3ZVH A;  1KSU A;  2OLO A;  5KWF A;  4JDR A;  4H1Z A;  1S7M A;  1D5T A;  2JAE A;  3P93 A;  2VVM A;  2POD A;  2WP5 A;  3NN6 X;  1CJ3 A;  3MKC A;  2AQJ A;  3NGC X;  3C96 A;  3CNS A;  2BXR A;  1GES A;  3GD4 A;  3CPI G;  1N5W C;  1BGJ A;  1PBC A;  1SJC A;  3SXI A;  2E5A A;  1B8S A;  1Q9I A;  1PXC A;  2R45 A;  2XFP A;  1Z6L A;  1QLB A;  3ICS A;  1WUE A;  3CGB A;  3JSK A;  2EQ9 A;  2ZC8 A;  3UCC A;  1JEH A;  1RSG A;  2PGW A;  4DNA A;  1S2Y A;  3K7Q X;  4FX9 A;  3UOY A;  2Q0L A;  3OTR A;  3JVA A;  2WES A;  3DK9 A;  1FHV A;  1ZXI C;  4A5L A;  3CNT A;  4EQR A;  3ETR B;  4U8N A;  3AEB A;  3NYF A;  3AED A;  3H7V A;  3AWI A;  3Q4D A;  3R11 A;  1D4D A;  2OLA A;  3RED A;  2YR4 A;  3TWB A;  4E4U A;  4Z1Y A;  2YG3 A;  4GUV A;  4BJY A;  2X8C A;  1KKR A;  1OJA A;  3VR9 A;  2WP6 A;  4J57 A;  1EL9 A;  2QAE A;  3QVP A;  3EAO A;  4DXK A;  2YLS A;  5FJU A;  4G6H A;  1FEC A;  4DSG A;  3CN8 A;  2GH5 A;  3SZC A;  1NHR A;  2XVE A;  2DW7 A;  3OZ2 A;  2AKZ A;  3P9U A;  5BUL A;  2E1M A;  3V3N A;  1MDL A;  5JCL A;  2IID A;  2NQL A;  3ES7 A;  3B3R A;  4UDP A;  1MXT A;  2GV8 A;  1BWC A;  2JB3 A;  3T2K A;  3H8A A;  1H83 A;  3QTP A;  5U63 A;  3SFE A;  3UJ2 A;  3CK5 A;  1UKV G;  3H12 A;  3SN4 A;  1ELS A;  2XLT A;  4DN1 A;  4GGH A;  3RGT A;  3GYX A;  4MJW A;  1PBD A;  2WDV A;  2WU5 A;  1JOA A;  4E5T A;  1L0V A;  4KEM A;  2OG9 A;  3A7A A;  2PTZ A;  4CBQ A;  2QA2 A;  2C65 A;  3G5S A;  4A6G A;  2BK4 A;  2YQU A;  3N4F A;  1NEK A;  3VQR A;  4HCD A;  1P43 A;  5J04 A;  2XLU A;  2XFQ A;  3H8I A;  4N9X A;  3T0K A;  2GR3 A;  5EOW A;  4A65 A;  4OPU A;  2XLR A;  2YVJ A;  1MRA A;  1DXL A;  4E4F A;  2QGY A;  1E1L A;  3DGB A;  4BJZ A;  5C3J A;  2PGE A;  3A7R A;  2ARD A;  3TJ4 A;  1SJD A;  1ELI A;  4OPG A;  3CGE A;  1B4V A;  3IHM A;  3T37 A;  3P4S A;  3VRA A;  1KFY A;  1O94 A;  2Y6Q A;  2YG5 A;  2XH4 A;  3NVZ B;  2GAH B;  4K22 A;  4KX6 A;  1SJB A;  4YWS A;  1BQG A;  3FCP A;  4I59 A;  1JCT A;  4NTE A;  4X4J A;  3KD9 A;  1IYX A;  2QDE A;  3LB8 A;  3P3B A;  3DG7 A;  1N4W A;  2RAB A;  4A7A A;  3GDN A;  3UTE A;  1GND A;  2B9W A;  4GAV A;  4GCM A;  3EUB 3;  4TM3 A;  4X2P A;  3FG2 P;  1T3Q C;  3IJQ A;  3VCN A;  3IWA A;  3K1G A;  1NEN A;  2ZBW A;  3GO2 A;  4JY3 A;  1DOD A;  3VC5 A;  4B65 A;  4A99 A;  1PJ5 A;  3T9P A;  4NTD A;  3AE1 A;  1TDF A;  2PA6 A;  3SBF A;  2B76 A;  1XDI A;  5JCK A;  3UOZ A;  2V60 A;  2XVF A;  1GRB A;  1GTH A;  2V6O A;  4BK1 A;  3NT6 A;  4YWO A;  3IJL A;  3HYV A;  2GGJ A;  2DKI A;  5KMR A;  1L9C A;  4B69 A;  2P3Z A;  2V3B A;  3KLJ A;  4J33 A;  3AE7 A;  1FFU C;  4O5U A;  4X9M A;  3LOV A;  2EQ6 A;  2YG7 A;  2OO6 A;  1NHS A;  3QSM A;  2GVC A;  3Q6J A;  2YM1 A;  1KNP A;  4C74 A;  4HCH A;  2XLS A;  1NEL A;  2XH2 A;  2BXS A;  4AOX A;  2BC0 A;  3NFU A;  1FIQ B;  2BAB A;  4MGG A;  3QFA A;  3IJI A;  3NXL A;  4G7F A;  4Y4N A;  3UCD A;  3N4E A;  1GTE A;  3DDM A;  4H4Q A;  1FCD A;  3UKP A;  2OKT A;  1F8R A;  3NVW B;  1S2Q A;  3AYL A;  1LQT A;  4ZCD A;  1XAN A;  3OZM A;  1ZDL A;  2FYM A;  1MUC A;  1XS2 A;  4EIQ A;  3LJP A;  2W3R A;  1WYG A;  3AEE A;  3ALL A;  1F3P A;  3DG6 A;  1GSN A;  2QQ6 A;  4HNC A;  3M13 A;  2WDR A;  5FJP A;  5KVH A;  4Z26 A;  1RYI A;  1EBH A;  2XGZ A;  2GL5 A;  2V61 A;  2XFO A;  4USQ A;  2P88 A;  1LJ1 A;  1EC7 A;  3K7T A;  4H4W A;  4Z25 A;  3NTD A;  2Y6R A;  2AL1 A;  4ZN0 A;  2QJN A;  1OJT A;  1VQW A;  1ZMC A;  3QLD A;  1IUU A;  4FDC B;  2MUC A;  2DW6 A;  2WEU A;  4B1B A;  5FJT A;  4LII A;  3NRN A;  1N61 C;  2FJD A;  2OFJ A;  4OPC A;  3R10 A;  3CPJ G;  1M64 A;  4BK2 A;  4H83 A;  3T8Q A;  2GGI A;  3DEQ A;  3NVY B;  4EM4 A;  1VRQ B;  3NG7 X;  3HW2 A;  1FEB A;  3LAD A;  2XYO A;  1KD0 A;  3NKS A;  3ALM A;  4CCQ A;  1PBE A;  3ITJ A;  3NYC A;  2BS3 A;  5KMS A;  3QPE A;  1COY A;  2JB2 A;  1N62 C;  1EL7 A;  4IP4 A;  2JB1 A;  2XCG A;  2OAM A;  1H84 A;  1GRA A;  1NPX A;  3VCC A;  1OJD A;  2R0C A;  4A6N A;  5EU9 A;  3CAW A;  1E1M A;  2FJB A;  2GAG B;  2OA1 A;  4EWJ A;  3GYJ A;  1F8S A;  2OVL A;  2P8C A;  3B97 A;  3FBS A;  4ECH A;  2JBV A;  4Z2R A;  5C2T A;  1TKK A;  4NEW A;  1IUW A;  3DFH A;  1EL5 A;  1GAL A;  3U9I A;  2WQY A;  1WUF A;  1CHU A;  1N4U A;  4GRT A;  1TDE A;  1VDV A;  1DOC A;  5KOX A;  4ICY A;  5G5G B;  2HXT A;  2XVI A;  1E9I A;  4IVM B;  1ZOV A;  4ADW A;  3NIX A;  3AEG A;  3NH3 X;  4YTM A;  3LZX A;  2AL2 B;  3SZW A;  2CFY A;  2GEW A;  1JDF A;  3COX A;  3MUC A;  4DYE A;  4K5S A;  3P4P A;  2AL2 A;  3BJS A;  4HCL A;  1F6M A;  4NZH A;  1EBG A;  1K4Q A;  1H82 A;  4D03 A;  3MZN A;  1MNS A;  1EL8 A;  1XPQ A;  4HA6 A;  2WPF A;  2XH0 A;  3TOY A;  3AEA A;  1FL2 A;  1E7P A;  3V76 A;  1E39 A;  2PMQ A;  3FIM B;  2POZ A;  3R0U A;  1N4V A;  1O5W A;  1W6T A;  3T2Z A;  1MO9 A;  3M12 A;  3NK0 X;  2XFN A;  4FI4 A;  1BKH A;  2C75 A;  2WDQ A;  1NDA A;  4B68 A;  1HYU A;  2QDD A;  4AP1 A;  3I6E A;  4H2P A;  3NNE A;  3ADA B;  3SY4 A;  4CCR A;  1H86 A;  1H2I A;  1GV4 A;  2GR2 A;  2YAU A;  3NO1 A;  3FJ4 A;  3G5Q A;  1BKW A;  3Q45 A;  4Y4M A;  4CNK A;  1VQZ A;  3ZLF A;  2WPE A;  2BK5 A;  2CHR A;  1PDZ A;  3ENL A;  3UJE A;  2P8B A;  3GWD A;  1KN0 A;  2JK6 A;  3TCS A;  5LV9 A;  2VRL A;  3NK2 X;  1TE6 A;  3VDG A;  4B64 A;  1L9E A;  3QFB A;  3ES8 A;  3D46 A;  4UP3 A;  4LA1 A;  3PK7 A;  3AE4 A;  3BOX A;  3SGL A;  1CL0 A;  1GER A;  2YLW A;  3RR1 A;  1SJA A;  3T4W A;  2CUL A;  4H2R A;  4FK1 A;  4M0X A;  3K7M X;  3MQT A;  3UXK A;  4GIS A;  3UP5 A;  4YSY A;  2GGG A;  3KKJ A;  3TQP A;  1FO4 A;  3BHK A;  3ICR A;  3PWG A;  1GT8 A;  4U2T A;  4PAB A;  4WCT A;  3UXL A;  4OPD A;  2PP1 A;  2PU1 A;  2OAL A;  2C73 A;  5J7X A;  4JNA A;  4U8O A;  5G5H B;  1TRB A;  3N6H A;  3UTG A;  2GGH A;  1JRP A;  1H6V A;  3DIP A;  3NVV B;  1DOB A;  2YLX A;  4H4Z A;  3GC2 A;  2YM2 A;  3L1R A;  4UDQ A;  2OQH A;  2PCE A;  3AE3 A;  3V4B A;  2PTY A;  2VQ7 A;  3I6T A;  2OPJ A;  3MY9 A;  4M52 A;  5BOE A;  5U1O A;  1H7X A;  1W4X A;  1EC9 A;  1NU5 A;  1TYT A;  3AE6 A;  3AEC A;  5FJR A;  3R0K A;  3RCY A;  3DA1 A;  4IA6 A;  4YSH A;  3EF6 A;  5M0Z A;  4REK A;  4YTP A;  1GRF A;  3ZVI A;  3DES A;  3V5C A;  3OZY A;  3D8X A;  3HRD C;  3SJN A;  4DHG A;  1Q1R A;  3AE9 A;  1S3B A;  3GYI A;  2QA1 A;  1PDH A;  3UOX A;  3R1Z A;  1JNR A;  1LTX R;  2YVG A;  3R9U A;  1NG4 A;  2IVE A;  3CND A;  1KNR A;  3EKG A;  4BV6 A;  4G6G A;  3SSZ A;  3P4R A;  4IL0 A;  3EEZ A;  4GR1 A;  3WE0 A;  5CQF A;  1CF3 A;  4EMJ A;  4XWR A;  1CJ2 A;  4H4X A;  3KPK A;  3SN0 A;  2PTX A;  2I5Q A;  4DX3 A;  3MWC A;  3T6C A;  4K8G A;  4YXD A;  2B9Y A;  3T31 A;  1N1P A;  1H7W A;  1LV0 A;  3PVC A;  2QCU A;  2BAC A;  4K1W A;  4H4P A;  4TM0 A;  5BUK A;  1STZ A;  3CXB A;  3UGV A;  3OPS A;  3G5R A;  1MOK A;  5HHF A;  4KT2 A;  3T14 A;  2PS2 A;  4A79 A;  2CDU A;  6ENL A;  4EQX A;  5BOF A;  1PHH A;  1ZY8 A;  2Z5X A;  3AD7 B;  3AD9 B;  1BGN A;  3FMW A;  2R46 A;  4U2S A;  4HNL A;  3QKE A;  3SN1 A;  3I4K A;  5JCN A;  5IPY A;  4FK1 C;  2AKM A;  2PYX A;  5JCI A;  2RGJ A;  2YR5 A;  3DGH A;  3AB1 A;  4C3X A;  4CRT A;  1GOS A;  4A35 A;  4Z24 A;  4Y4L A;  2NVK X;  4ZCC A;  1AOG A;  2R0P A;  1BZL A;  1OEP A;  3BNM A;  2Z5Y A;  4NNJ A;  1TYP A;  1DJQ A;  3PS9 A;  3R07 C;  3GDP A;  4MKS A;  2BYB A;  5CKU A;  1K0I A;  3II4 A;  2GB0 A;  2RGH A;  2I0Z A;  3SR6 B;  1Y56 B;  4APN A;  4U8L A;  5HXI A;  3TTE A;  2QVH A;  2B7R A;  3RO6 A;  4OPL A;  1B37 A;  1Y0P A;  4OVI A;  3GRS A;  3NTA A;  3MSY A;  4E6M A;  3F8D A;  3ALJ A;  4KPR A;  1L8P A;  3BNU A;  4AP3 A;  2X99 A;  2ZAD A;  3UKF A;  4RG4 A;  4H50 A;  1E1N A;  1ECQ A;  2YVF A;  4OPI A;  2FJE A;  3V3O A;  3CYJ A;  4JY2 A;  3CPH G;  3RP6 A;  4A9W A;  3ATQ A;  3TWA A;  4G74 A;  1V97 A;  3NK1 X;  5BRT A;  2BCP A;  1TDO A;  3GMB A;  4TLX A;  3PFR A;  2TMD A;  3AE2 A;  3RNM A;  2XVH A;  4K5R A;  3D47 A;  4CY6 A;  2BS4 A;  1ZMD A;  3RP8 A;  2C66 A;  4RSL A;  4C5O A;  3P4Q A;  2DKH A;  3D1C A;  1IJH A;  4LU6 A;  1VDC A;  3I3L A;  2P0I A;  4Z2T A;  4AT2 A;  4P9S A; 
#chains in the Genus database with same CATH homology
 2GR3 A;  1PXB A;  5EOW A;  1H2I A;  4A65 A;  2NPX A;  1GV4 A;  4OPU A;  5L46 A;  1P2H A;  2XLR A;  2YVJ A;  2GR2 A;  2YAU A;  4YSX A;  3VRD B;  2WU2 A;  2XVJ A;  3DME A;  3SM8 A;  3SZ0 A;  4RG3 A;  5HY5 A;  1DXL A;  2R4E A;  2WHD A;  3G5Q A;  4E0V A;  1X31 B;  4YT0 A;  1BKW A;  2UZZ A;  1E1L A;  2X8G A;  2GRT A;  4BJZ A;  1L9D A;  4C3Y A;  5C3J A;  3HYW A;  3CMM A;  1GRT A;  2WPC A;  4Y4M A;  2YLR A;  4H4U A;  4CNK A;  2ARD A;  1IUX A;  1ELI A;  3UTF A;  1GRG A;  2WPE A;  2BK5 A;  4U8P A;  2WOW A;  4OPG A;  2AAQ A;  3CGE A;  1E1K A;  1B4V A;  4GF7 A;  3IHM A;  2X50 A;  3T37 A;  2V5Z A;  3GWD A;  1KN0 A;  2JK6 A;  3P4S A;  3VRA A;  2TPR A;  3PO7 A;  1CJC A;  3F8R A;  5EB4 A;  3CIR A;  5LV9 A;  2VRL A;  1YQ4 A;  3NK2 X;  3D9X A;  1KFY A;  3CGC A;  4HB9 A;  2F5Z A;  3DJG X;  5FMH A;  5KNL A;  4H2Q A;  4B64 A;  1L9E A;  3QFB A;  1O94 A;  2Y6Q A;  4J34 A;  2R4J A;  4UP3 A;  1Y56 A;  5JRB A;  4LA1 A;  2YG5 A;  2C4C A;  3ABV A;  2GAH B;  3AE4 A;  1CC4 A;  4K22 A;  3AD8 B;  2V3A A;  4KX6 A;  3M0O A;  3SGL A;  3ZYX A;  1CL0 A;  1GER A;  4XWZ A;  2BA9 A;  3B6D A;  2YLW A;  1M6I A;  4UDR A;  3AYI A;  3PG6 A;  2C3C A;  4JQ9 A;  4OCG A;  4I59 A;  4NTE A;  3LZW A;  3DK4 A;  5FS6 A;  2BK3 A;  2CUL A;  2XDO A;  1PS9 A;  4JNQ A;  3KD9 A;  2RGO A;  3LB8 A;  4H4R A;  4X4J A;  3SYI A;  3CTY A;  3UOV A;  4H2R A;  3GSI A;  3NN0 X;  4FK1 A;  2X3N A;  2YLT A;  2GQW A;  1N4W A;  2RAB A;  2Q0K A;  3P1W A;  3GDN A;  3UTE A;  4A7A A;  1K0J A;  3AEF A;  1GND A;  4NTC A;  1PN0 A;  3K7M X;  4C77 A;  5IQ4 A;  2B9W A;  2GMJ A;  1JRY A;  4GAV A;  4GCM A;  4D04 A;  3UP5 A;  4YSY A;  2A87 A;  3EAN A;  1E6E A;  3KVE A;  1PBF A;  4EQS A;  1NG3 A;  3DJD A;  4EMI A;  3KKJ A;  4TM3 A;  4B66 A;  2WP9 A;  1ZK7 A;  3Q9T A;  3BHK A;  1GRH A;  3KPF A;  3FG2 P;  4NWZ A;  3C4A A;  3ICR A;  3QSS A;  1GT8 A;  4U2T A;  2GR1 A;  4U8I A;  3UKL A;  3IWA A;  4PAB A;  1NEN A;  2ZBW A;  4WCT A;  2E5V A;  3S61 A;  1QO8 A;  1GET A;  1ZOY A;  3SZF A;  2FJA A;  4J31 A;  4JY3 A;  4OPD A;  2C3D A;  1CC6 A;  1DOD A;  3GWF A;  5BVA A;  1KSS A;  2OAL A;  4AT2 A;  2C73 A;  4U8M A;  5J7X A;  4A99 A;  3IHG A;  4B65 A;  1PJ5 A;  3NYE A;  2WOV A;  4NTD A;  1LQU A;  1ZX9 A;  3FPZ A;  3BI4 A;  3AE1 A;  4JNA A;  4U8O A;  5EB5 A;  1DOE A;  1TDF A;  2B76 A;  2ZZC A;  1TRB A;  1XDI A;  5JCK A;  2BRY A;  2V60 A;  3UOZ A;  3C4N A;  3UTG A;  2XVF A;  1GRB A;  1GTH A;  2V6O A;  5GSN A;  1LVL A;  1H6V A;  4BK1 A;  2GR0 A;  3L5O A;  2VOU A;  3NT6 A;  4YWO A;  2A89 A;  3HYV A;  4U8J A;  4Z2U A;  3AXB A;  1DOB A;  2YLX A;  2DKI A;  1KDG A;  1OJ9 A;  1L9C A;  1RP0 A;  3H8L A;  4B69 A;  4H4Z A;  1JRZ A;  5KMR A;  2HQM A;  2YM2 A;  1LPF A;  1XHC A;  2V3B A;  2PHH A;  3L1R A;  4UDQ A;  3KLJ A;  4Z44 A;  1ZKQ A;  4J33 A;  5FS7 A;  1YY5 A;  2ZZB A;  3AE7 A;  2C70 A;  4O5U A;  4X9M A;  3LOV A;  3AE3 A;  2EQ6 A;  2XLP A;  1GPE A;  5U25 A;  2YG7 A;  1NHS A;  3QSM A;  2VQ7 A;  1REO A;  2X8H A;  1QJD A;  2GVC A;  4M52 A;  3Q6J A;  1PJ6 A;  2YG6 A;  2YM1 A;  3K30 A;  1KNP A;  4C74 A;  3O0H A;  2BC1 A;  2XLS A;  3H4K A;  5U1O A;  1IUV A;  4FK1 C;  1H7X A;  5KVI A;  2BXS A;  1W4X A;  5KOW A;  2VVL G;  2GQF A;  4AOX A;  4XXG A;  2BC0 A;  2BAB A;  4A6N B;  1TYT A;  3DK8 A;  3QFA A;  1O95 A;  2EQ7 A;  3AE6 A;  4B63 A;  2B9X A;  3AEC A;  4H7U A;  3S5W A;  2VRM A;  3DA1 A;  4IA6 A;  1TDK A;  4O5Q A;  4YSH A;  3VR8 A;  1PBB A;  2OLN A;  4Y4N A;  3EF6 A;  2YLZ A;  5M0Z A;  4JN9 A;  4REK A;  5JCM A;  4YTP A;  1GTE A;  3AE8 A;  3UKA A;  1GRF A;  4H4Q A;  4YSZ A;  3UCL A;  5M10 A;  1FCD A;  3UKP A;  2BS2 A;  5HYM A;  2VZ2 A;  3D8X A;  3UKQ A;  1CJ4 A;  4PAA A;  4H2N A;  4II2 A;  1D7L A;  1F8R A;  1S2Q A;  4X9N A;  3AYL A;  1LQT A;  4ZCD A;  1XAN A;  1D4C A;  1Q1R A;  3GD3 A;  1ZDL A;  4EM3 A;  2FBW A;  3AE9 A;  1S3B A;  4G73 A;  4J2W A;  3GYI A;  5IQ1 A;  4EIQ A;  2QA1 A;  1V59 A;  3LJP A;  2Q7V A;  1PDH A;  3HYX A;  4YKF A;  3ALL A;  3AEE A;  3AYJ A;  3UOX A;  1JNR A;  1LTX R;  4GAP A;  1F3P A;  1YQZ A;  1GSN A;  1NHQ A;  1IUT A;  1GRE A;  1Q1W A;  1OJC A;  2BRA A;  2IVD A;  2EQ8 A;  2YVG A;  1DJN A;  2APG A;  3IF9 A;  3R9U A;  1JRX A;  1NG4 A;  2IVE A;  4OPT A;  3CND A;  4EIP A;  2C7G A;  2WOI A;  1KNR A;  3M13 A;  3QSE A;  4IVO B;  4BV6 A;  3RP7 A;  4H4S A;  4NEV A;  2H89 A;  1B5Q A;  3BI2 A;  3T2Y A;  4G6G A;  2WDR A;  3HZL A;  5KVH A;  4Z26 A;  1RYI A;  3P4R A;  4TM4 A;  2YWL A;  4GR1 A;  2V61 A;  2R0G A;  2XFO A;  2YR6 A;  3WE0 A;  4USQ A;  5CQF A;  4CNJ A;  1NHP A;  1LJ1 A;  1CF3 A;  3ATR A;  2E4G A;  3K7T A;  4EMJ A;  4H4W A;  4XWR A;  1CJ2 A;  4H4X A;  2W0H A;  4Z25 A;  3KPK A;  1YQ3 A;  3NTD A;  1VG0 A;  2Y6R A;  3QVR A;  4ZN0 A;  1H81 A;  2C64 A;  1OJT A;  3BHF A;  1VQW A;  3ISH A;  3SFD A;  5KXJ A;  1ZMC A;  5KMQ A;  1IUU A;  3QJ4 A;  4FDC B;  2VQB A;  4USR A;  4YXD A;  4H4Y A;  2B9Y A;  3T31 A;  2R9Z A;  3F8P A;  4AT0 A;  1N1P A;  1H7W A;  2WEU A;  4B1B A;  1LV0 A;  4LII A;  1P2E A;  1DNC A;  3NRN A;  3PVC A;  1GEU A;  4IA5 A;  2QCU A;  4IV9 A;  3KA7 A;  3SX6 A;  2FJD A;  2BAC A;  1YKJ A;  4OPC A;  4AOS A;  4Z43 A;  2OLO A;  3CGD A;  1KSU A;  4H4P A;  4TM0 A;  5DBJ A;  4DGK A;  5BUK A;  5KWF A;  4JDR A;  2C67 A;  1D5T A;  1S7M A;  1M64 A;  2JAE A;  3CPJ G;  3G5R A;  4BK2 A;  1MOK A;  1D7Y A;  5HHF A;  1TDN A;  3T14 A;  3UKK A;  2YG4 A;  2VVM A;  1CBO A;  4CY8 A;  2WP5 A;  4A79 A;  2O9Z A;  3NN6 X;  3I6D A;  1CJ3 A;  4B67 A;  2AQJ A;  2CDU A;  3NGC X;  4G9K A;  4U8K A;  4EQX A;  5FS9 A;  1ZY8 A;  4EM4 A;  1PHH A;  3C96 A;  3CNS A;  1VRQ B;  2BXR A;  3NG7 X;  2Z5X A;  3AD7 B;  1GES A;  2VVL A;  3AD9 B;  3GD4 A;  1FEB A;  3RHA A;  3LAD A;  2XYO A;  1BGN A;  3URH A;  3CPI G;  1F8W A;  3FMW A;  2R46 A;  1BGJ A;  1PBC A;  2WS3 A;  3NKS A;  1ONF A;  3ALM A;  4U2S A;  4J36 A;  3SXI A;  4CCQ A;  1PBE A;  4WX1 A;  1B8S A;  1GXF A;  1Q9I A;  1PXC A;  2R45 A;  3ITJ A;  2XFP A;  5JCN A;  5IPY A;  1IUS A;  1Z6L A;  2GMH A;  1FEA A;  5ER0 A;  2PYX A;  2BS3 A;  4K7Z A;  3NYC A;  5JCI A;  2RGJ A;  1QLB A;  3DGH A;  4EMW A;  2YR5 A;  3AB1 A;  3ICS A;  4C3X A;  5KMS A;  1COY A;  3CGB A;  4CRT A;  2JB2 A;  3JSK A;  2EQ9 A;  1GOS A;  4YTN A;  1JEH A;  5KMP A;  1RSG A;  4Z24 A;  1EL7 A;  1JU2 A;  3DH9 A;  1PJ7 A;  2A8X A;  2JB1 A;  4DNA A;  4Y4L A;  1SEZ A;  2NVK X;  1S2Y A;  1ZP0 A;  2OAM A;  2XCG A;  1H84 A;  1AOG A;  4FX9 A;  3K7Q X;  4ZCC A;  3UP4 A;  1GRA A;  2R0P A;  3UOY A;  1NPX A;  2Q0L A;  1OJD A;  5EBK A;  1BZL A;  2WES A;  2R0C A;  4A6N A;  4EQW A;  3DK9 A;  3BNM A;  1E1M A;  2FJB A;  2Z5Y A;  4NNJ A;  4A5L A;  1D4E A;  3CNT A;  4EQR A;  2WET A;  2GAG B;  4U8N A;  1TYP A;  2OA1 A;  3AEB A;  3NYF A;  1DJQ A;  3PS9 A;  3L8K A;  3GMC A;  1JNZ A;  3AED A;  3GDP A;  3VRB A;  3GYJ A;  1F8S A;  3KU9 A;  3AWI A;  2BYB A;  5CKU A;  1D4D A;  3FBS A;  1EBD A;  1K0I A;  3II4 A;  2JKC A;  3RED A;  4ECH A;  2GB0 A;  2YR4 A;  2JBV A;  1NAA A;  4Z2R A;  2RGH A;  5C2T A;  2I0Z A;  2YG3 A;  1PXA A;  4GUV A;  4BJY A;  2X8C A;  3IC9 A;  4NEW A;  1OJA A;  1IUW A;  3VR9 A;  4DSH A;  1Y56 B;  2WP6 A;  4J57 A;  1EL5 A;  2BCG G;  4APN A;  1GAL A;  1EL9 A;  2QAE A;  4U8L A;  3QVP A;  3EAO A;  3UKH A;  1FOH A;  5TR3 A;  2WQY A;  5HXI A;  3BI5 A;  2YLS A;  1CHU A;  1N4U A;  4G6H A;  1FEC A;  4DSG A;  3DJJ A;  3LXD A;  3CN8 A;  4GRT A;  2B7R A;  2GH5 A;  4OPL A;  3DGZ A;  1B37 A;  1TDE A;  1Y0P A;  3SZC A;  4OVI A;  1NHR A;  1DOC A;  2H88 A;  5KOX A;  4ICY A;  2ACZ A;  2XVE A;  5GRT A;  3OZ2 A;  4K2X A;  4II3 A;  5FS8 A;  3ICT A;  2XVI A;  3GRS A;  3NTA A;  3P9U A;  4IVM B;  5BUL A;  1ZOV A;  2C76 A;  4ADW A;  3ZDN A;  2AR8 A;  3F8D A;  3NIX A;  4TM1 A;  3NHO X;  2B7S A;  3AEG A;  2CVJ A;  2E1M A;  3ALJ A;  3NH3 X;  4YTM A;  3V3N A;  1BF3 A;  4KPR A;  5JCL A;  1S3E A;  2IID A;  3LZX A;  3B3R A;  3BNU A;  3SZW A;  4AP3 A;  3E1T A;  4UDP A;  2X99 A;  4H4T A;  3CNP A;  2CFY A;  1MXT A;  2GEW A;  1BWC A;  2GV8 A;  2JB3 A;  3UKF A;  3T2K A;  4RG4 A;  4H4V A;  4H50 A;  1E1N A;  2YVF A;  3COX A;  1H83 A;  4OPI A;  2C72 A;  4K5S A;  4GDP A;  5U63 A;  3P4P A;  3SQP A;  3SFE A;  4BK3 A;  2FJE A;  3V3O A;  5J60 A;  4JY2 A;  1F6M A;  1UKV G;  4NZH A;  3CPH G;  3NLC A;  2ZZ0 A;  4GDE A;  5KRQ A;  1K4Q A;  1H82 A;  2XLT A;  3RP6 A;  2WBA A;  1KF6 A;  4D03 A;  4I58 A;  4A9W A;  3ATQ A;  3GYX A;  1EL8 A;  1XPQ A;  4HA6 A;  2WPF A;  4MJW A;  4G74 A;  3NK1 X;  2GF3 A;  3AEA A;  5BRT A;  2BCP A;  1TDO A;  1FL2 A;  1E7P A;  1PBD A;  3V76 A;  1E39 A;  3FIM B;  3GMB A;  1N4V A;  2XFU A;  3UTH A;  2WDV A;  2J3N A;  1O5W A;  1JOA A;  1CC2 A;  3OC4 A;  2WU5 A;  4TLX A;  1L0V A;  3GRT A;  2Q6U A;  2TMD A;  3T2Z A;  1MO9 A;  3M12 A;  4CBQ A;  3NK0 X;  2QA2 A;  4K8D A;  3AE2 A;  3AE5 A;  3RNM A;  2C65 A;  2XVH A;  2XFN A;  4K5R A;  4CY6 A;  4YKG A;  4BUR A;  1K0L A;  2BS4 A;  3G5S A;  4TLZ A;  1ZMD A;  2C75 A;  2WDQ A;  3RP8 A;  1NDA A;  2C66 A;  1HYU A;  4B68 A;  4RSL A;  2BK4 A;  4C5O A;  2YQU A;  3P4Q A;  4AP1 A;  2DKH A;  3D1C A;  1NEK A;  3EPT A;  3CNJ A;  1IJH A;  4H2P A;  4LU6 A;  3VQR A;  3NNE A;  4J56 A;  1VDC A;  3ADA B;  3I3L A;  3SY4 A;  3DJE A;  4Z2T A;  2XLU A;  1VG9 A;  2XFQ A;  4CCR A;  3H8I A;  1H86 A;  4N9X A;  4U2L A;  4P9S A;  3T0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...