5FMHA

Crystal structure of the e405k mutant of human apoptosis inducing factor
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
486
structure length
472
Chain Sequence
b'APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVKLAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Novel Mutation in Aifm1
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 154
structure length 472
sequence length 486
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fmhA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fmhA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fmhA01
2GQFA 2X8HA 2W0HA 2XVJA 3AYIA 3UKLA 3RP7A 3PO7A 1PXCA 4U8PA 3KA7A 4REKA 2GR2A 2IVEA 3VR9A 1NHSA 3FBSA 1D4DA 3F8DA 4YTMA 4BJYA 1N4VA 4Y4NA 3K7TA 2BXRA 3ATQA 1TDKA 4A5LA 4C3XA 3DH9A 1CJ3A 4EMIA 1DJQA 1DXLA 1GPEA 2NVKX 3VRBA 3IC9A 3E1TA 3EANA 2B9XA 4BURA 2FJAA 3V3NA 4CCRA 2RGJA 3P4QA 2QA1A 1V59A 3COXA 2C70A 2BCPA 5L46A 1OJDA 4OPCA 1JOAA 2J3NA 2C72A 3FPZA 4OPTA 1KNRA 1CC4A 3LOVA 4JNQA 3Q9TA 3CGBA 2GV8A 2BXSA 2XLPA 4GUVA 2VRMA 4BK1A 2YLWA 5KRQA 3NLCA 5BVAA 4RSLA 4Y4LA 3UKFA 1D5TA 3GYIA 2Q0KA 2XVEA 4BK2A 1L9DA 5FS9A 1NG4A 3CPIG 3WE0A 3LZXA 3P4SA 2EQ9A 4H4RA 4J33A 3V3OA 3NT6A 4O5UA 2GMJA 1D7LA 3GSIA 3KPFA 2DKIA 3AEEA 2OALA 4H2NA 3DK4A 1DOEA 4TM3A 4B66A 4J56A 4EIQA 1KSUA 2X50A 3CNPA 2C7GA 5IQ1A 4GCMA 4H4QA 3FIMB 1D7YA 2WDRA 4K5RA 4M52A 4EIPA 4LA1A 1GRTA 4K7ZA 5HHFA 2Q6UA 1IUWA 2XVIA 4TM0A 1GNDA 2OA1A 3UKAA 2R45A 1LPFA 2C67A 5M10A 1BWCA 3DK8A 5U25A 1CJCA 1Q1RA 4D03A 2EQ6A 2XLTA 1E1NA 2BC1A 3AD9B 3RNMA 5EBKA 3CGEA 4USRA 3UP5A 2ARDA 1TDOA 3RP6A 3AE1A 3VRDB 1GALA 3AEGA 1B37A 1E7PA 2RABA 2CDUA 4FX9A 2YM2A 1P2HA 1KFYA 3ITJA 3UKPA 3AE9A 3B3RA 1Q1WA 4H50A 4Y4MA 1H86A 4U8NA 3V76A 2GRTA 1L9EA 2IIDA 1OJAA 1TDFA 3CPHG 3R9UA 5EB5A 2YAUA 1Y56B 1LTXR 3NK1X 1REOA 2YG3A 4OVIA 3ADAB 1MO9A 1DJNA 3NTAA 1FCDA 4KPRA 3UOYA 5EOWA 2YVGA 3GRTA 2YG6A 1ZY8A 2BC0A 1L9CA 3P9UA 2WOIA 3NH3X 5JCLA 4EM4A 3BI2A 4XWZA 4ZCCA 1COYA 2WDQA 1VG9A 1GEUA 1PXAA 4YSYA 3KVEA 5FMHA 3DJJA 3EAOA 2PYXA 4A6NB 1E39A 4CCQA 3M13A 2AAQA 2X8GA 1OJCA 1K4QA 2YVFA 2NPXA 3GMBA 4U8IA 4CRTA 1EL5A 4U8LA 4LU6A 4EMJA 2WP5A 2BK3A 2Y6RA 3H8LA 2R0GA 4CNJA 4A7AA 1D4EA 1EL8A 1TDNA 3DJEA 3NTDA 4AOXA 3DK9A 2B9YA 4CNKA 3AYLA 4O5QA 2B7SA 1FOHA 4YSXA 3D8XA 3BHFA 3GMCA 4IVOB 3BHKA 2CULA 4B1BA 1HYUA 3DGHA 4KX6A 2JAEA 2ZZCA 1OJTA 5J7XA 4DSHA 3G5QA 1VRQB 4H2QA 3NK0X 4BK3A 3CNSA 3C96A 1DOCA 3G5RA 4ADWA 2C3CA 4GR1A 5EB4A 2ZZBA 1RP0A 3LB8A 3DA1A 2WETA 2BS2A 1IUXA 2X8CA 5KXJA 2XFQA 3GDNA 4OPLA 3AE5A 2YQUA 2E1MA 4GDPA 4JN9A 3ZDNA 5HY5A 2GR1A 1S3EA 2XVFA 3BI4A 3CNTA 5KOWA 1DNCA 4YWOA 1CF3A 2WP6A 3HZLA 3BI5A 1Y56A 1GSNA 3GD3A 2B7RA 4IA5A 1GRAA 4MJWA 1PN0A 4LIIA 1TDEA 5HYMA 2H89A 4OPGA 5HXIA 4UDQA 5FS8A 3F8PA 1S2YA 1B8SA 1FEBA 1EBDA 4Z25A 4BV6A 2R0CA 4C5OA 1E1MA 3CNDA 3NGCX 3H8IA 2DKHA 3KU9A 4J2WA 1PBDA 4PABA 4EQWA 3ALMA 1ZKQA 2TMDA 3CPJG 4FK1A 1TRBA 5CKUA 1O94A 1NEKA 1H83A 4A6NA 1BZLA 3NYCA 1ZP0A 2A87A 2B76A 4U8OA 3NN6X 3AD7B 3C4AA 2VQBA 4DNAA 2WP9A 1NHPA 1JNZA 5U1OA 2GF3A 1Z6LA 3AEFA 3GYJA 2FBWA 4J31A 3ISHA 1CC6A 1NDAA 1D4CA 2WBAA 4IA6A 3CN8A 3LZWA 3DGZA 2GAGB 3NN0X 3SFDA 4CY8A 1LQTA 4I59A 3UP4A 1W4XA 2OLNA 1ZOYA 2GAHB 1ZMCA 3UOVA 1ZOVA 4PAAA 3UOZA 3VRAA 1F3PA 3VR8A 1CJ4A 3PS9A 3QFAA 3AEBA 2I0ZA 2QA2A 1GTHA 2YLXA 3AEAA 3QVPA 1JEHA 4OPUA 2WHDA 1GRGA 1L0VA 4CBQA 5KWFA 4H4PA 1IUVA 4I58A 4C3YA 5FS6A 1H6VA 2YLZA 3CGCA 3OZ2A 2WESA 3IHGA 4GRTA 2V6OA 5DBJA 1K0JA 1XANA 5JCKA 2BCGG 2YR4A 1E6EA 2WU2A 3AE2A 1LQUA 1GV4A 5BRTA 3IWAA 1M64A 3B6DA 4AOSA 2VVLA 4H4TA 2R4EA 4BJZA 3AE3A 2VQ7A 3SFEA 1S2QA 1PHHA 4OCGA 5KVHA 1NENA 2VOUA 1O5WA 4X9NA 2PHHA 2EQ7A 4FDCB 1TYPA 2GQWA 1QJDA 4IVMB 1PBCA 4FK1C 1ZX9A 3H4KA 2JKCA 1PDHA 3ABVA 1ONFA 4NTDA 2GEWA 1BGNA 3AE7A 5CQFA 2GH5A 2RGOA 2YG7A 1GETA 4H2RA 5U63A 2VVLG 3S5WA 3LJPA 1XPQA 5JCIA 3AECA 4TLZA 4YSZA 3D1CA 1N1PA 1VG0A 4H4YA 5LV9A 1E1KA 4TLXA 4USQA 4B63A 2BK5A 2VZ2A 2RGHA 1B4VA 3AE6A 1XDIA 1K0LA 1Q9IA 3P1WA 4UDRA 2Z5YA 3KKJA 3GRSA 2QAEA 3GD4A 3P4PA 2V3BA 1NAAA 4AP3A 3QFBA 2BK4A 5C2TA 4Z2TA 2XFOA 2YLSA 4OPIA 4NTCA 4A99A 4A65A 1KSSA 4A9WA 4ZCDA 3NNEA 2YG5A 1YKJA 2UZZA 1NPXA 1E1LA 1IUTA 2E5VA 1PS9A 1H7WA 1Y0PA 2XFPA 1AOGA 3I6DA 2WPCA 2BS3A 3PVCA 3SM8A 3FG2P 2AQJA 4J36A 3CGDA 3LXDA 3UKQA 3DJDA 4Z24A 3UKHA 3UTGA 1FEAA 1GREA 1TYTA 3M0OA 3K30A 4Z2UA 4H4WA 2JB2A 3FMWA 1KF6A 3AD8B 2V3AA 3UTFA 4RG4A 3ICTA 2YLTA 1N4UA 2FJBA 3NYEA 1JRYA 2WOWA 3S61A 2Q0LA 4JY2A 1JU2A 1M6IA 1PBBA 2GB0A 4ICYA 1PBFA 2IVDA 4X4JA 2JBVA 3AE4A 1NHRA 4H4SA 3CNJA 3BNUA 2BABA 4N9XA 3QVRA 4Z26A 2CFYA 1CHUA 1JRZA 2XVHA 2WEUA 4U8JA 4TM4A 4YXDA 3L1RA 4H2PA 4ECHA 1DOBA 5KOXA 3ATRA 1ZK7A 2GR0A 1NG3A 2WOVA 4EM3A 2V61A 3P4RA 5ER0A 2WPFA 2E4GA 3KD9A 4K2XA 5GRTA 1VDCA 3ICRA 3K7QX 2YWLA 3QSMA 1H81A 4GF7A 3OC4A 3T37A 3CTYA 1X31B 3CIRA 4AT0A 1MXTA 3G5SA 5C3JA 1QLBA 3ALJA 3UKKA 4U2LA 3DMEA 1NHQA 3EPTA 4K22A 3AEDA 3EF6A 2FJEA 2ZBWA 4EQRA 4CY6A 2F5ZA 3BNMA 1IUUA 4A79A 4GDEA 2C66A 4NZHA 1VQWA 1GESA 2WPEA 1GOSA 3F8RA 3QSSA 2XCGA 1PJ5A 1OJ9A 4ZN0A 2XYOA 3SQPA 1F8SA 5GSNA 2C3DA 2CVJA 2JK6A 5JCNA 1H82A 2XFUA 4H4ZA 2O9ZA 1IUSA 5IQ4A 4J34A 4NTEA 3QSEA 4H7UA 5KVIA 2Q7VA 4JNAA 2R0PA 1GTEA 2OAMA 4DGKA 4B68A 1CL0A 4UDPA 1ZMDA 1LV0A 1GRHA 4B65A 3UTEA 2V60A 2OLOA 2YR6A 1MOKA 4J57A 4JQ9A 1PJ7A 1GT8A 1QO8A 3II4A 2WU5A 1BGJA 3QJ4A 1GRFA 1KDGA 4C77A 1RSGA 1BF3A 4HB9A 2YG4A 2WQYA 2R46A 4EQSA 4HA6A 2JB3A 2XLSA 2C76A 2ZZ0A 1KNPA 3NRNA 2APGA 2TPRA 1N4WA 3AWIA 3I3LA 4YTPA 4XXGA 1O95A 1SEZA 1H7XA 3URHA 2VVMA 4B69A 1LVLA 1GXFA 1PBEA 2C73A 1CBOA 2Y6QA 1UKVG 4Z2RA 4NEWA 1YY5A 4B64A 4Z43A 1B5QA 5J60A 4WCTA 1XHCA 3DJGX 2XLUA 2YM1A 3NHOX 3NKSA 1GRBA 1ELIA 2X3NA 3AE8A 1YQ3A 1RYIA 2X99A 2BACA 1F8RA 3AYJA 2A8XA 3Q6JA 4YSHA 4H4XA 1JRXA 2XFNA 3UTHA 3GWFA 4XWRA 3NYFA 4C74A 2JB1A 2R4JA 1S3BA 1EL7A 1F6MA 1FL2A 4JY3A 3REDA 2HQMA 5JCMA 1ZDLA 2EQ8A 2ACZA 2B9WA 1K0IA 2FJDA 3UCLA 3UOXA 4TM1A 4B67A 3JSKA 4IV9A 3VQRA 3RP8A 2V5ZA 2GVCA 3KLJA 1YQ4A 2GMHA 3C4NA 2YLRA 3SGLA 5BUKA 3GWDA 1PXBA 2QCUA 4AP1A 2H88A 4UP3A 4U8MA 4U2TA 1CC2A 2A89A 3K7MX 5BULA 3ZYXA 2BYBA 4JDRA 3AB1A 4WX1A 3NIXA 1FECA 1YQZA 1F8WA 2AR8A 1PJ6A 2BS4A 3NG7X 4OPDA 3NK2X 4E0VA 4YT0A 2YVJA 1P2EA 1BKWA 3GDPA 1CJ2A 4H4VA 4U2SA 4YTNA 1H84A 4DSGA 4H4UA 3O0HA 4NEVA 3RHAA 3ICSA 1DODA 1EL9A 4P9SA 1GERA 3ALLA 2BA9A 2Z5XA 4Z44A 4D04A 3L8KA 4EMWA 2VRLA 2GR3A 2XDOA 4APNA 2WS3A 4AT2A 1IJHA 2C75A 4X9MA 3IHMA 3M12A 2XLRA 2C65A 4K5SA 4RG3A 5IPYA 1JNRA 2WDVA 5TR3A 5M0ZA 2C64A 4YKGA 4YKFA 3AXBA 2R9ZA 3IF9A 3LADA 4K8DA 1LJ1A 2YR5A 4U8KA 4EQXA 5FS7A
chains in the Genus database with same CATH superfamily
4F4RA 2XVJA 3MWCA 1PXCA 4U8PA 4REKA 4IL2A 3FBSA 4FI4A 4C3XA 3L5OA 1CJ3A 3P0WA 1GPEA 3VRBA 3EKGA 3IK4A 4G9KA 3EANA 3V3NA 3P4QA 3COXA 2C70A 2BCPA 4OPCA 3VDGA 4OPTA 3OPSA 1KNRA 2E3TA 3NLCA 5BVAA 4Y4LA 1D5TA 3GYIA 1BKHA 3V3OA 1T3QC 2OALA 3EUB3 1DOEA 2X50A 4GFIA 4H4QA 4KT2A 2WDRA 2PP3A 5HHFA 1W6TA 2XVIA 4TM0A 3R1ZA 2GGIA 4D03A 1E1NA 3AD9B 4JN7A 3CGEA 5EBKA 4E4FA 1TDOA 3RP6A 3VRDB 4DX3A 2CDUA 3NRZB 4KPLA 1KFYA 4H50A 4J1OA 1H86A 3V76A 1L9EA 2IIDA 7ENLA 1Y56B 1LTXR 3NK1X 4OVIA 3ADAB 4GISA 3GRTA 4GGHA 2BC0A 3DDMA 3P9UA 4EM4A 4XWZA 4II2A 2WDQA 1GEUA 2PP1A 3KVEA 3MY9A 1E39A 3GO2A 3M13A 1K4QA 3GMBA 4U8LA 4EMJA 2WP5A 2BK3A 2Y6RA 3RITA 3DJEA 3NTDA 4ZOHB 4AOXA 3DK9A 2B7SA 3NVZB 4DXKA 2ZADA 3DGHA 2XH4A 3G5QA 2PU1A 4IHCA 1RP0A 2X8CA 2XFQA 3AE5A 2FKPA 4GDPA 3ZDNA 2GR1A 3CNTA 5G5GB 3VCCA 1GSNA 4MJWA 4LIIA 1XPYA 4OPGA 4UDQA 3T9PA 1FEBA 1E1MA 4J2WA 1ZKQA 5CKUA 1JPMA 1O94A 2OG9A 1BZLA 1RVKA 3NN6X 3C4AA 4DNAA 2WP9A 1NHPA 1Z6LA 1N5XA 3LZWA 3IJQA 2GAGB 1W4XA 2XGZA 1ZOVA 4HCLA 3VRAA 1F3PA 3VR8A 4OPUA 1JEHA 4I58A 2XSXA 2YLZA 3OZ2A 4H1ZA 3MKCA 3SZCA 1LQUA 4GYPA 2R4EA 3AE3A 4OCGA 3NS1B 4X9NA 2EQ7A 3GD6A 4FDCB 1QJDA 1PBCA 3ABVA 1PDHA 4Z17A 2XH0A 2YG7A 4H2RA 1GETA 5JCIA 3AECA 3FXGA 1TZZA 1E1KA 2VZ2A 4UDRA 1JDFA 2V3BA 4AP3A 3V5CA 2PODA 4A99A 3P93A 3SJNA 1YKJA 2E5VA 1Y0PA 1H7WA 3ZVHA 3I6DA 3UCCA 3SR6B 4J36A 3QTPA 3LXDA 1FHVA 3NVYB 1FEAA 4H19A 3FMWA 4GIRA 1MDRA 2V3AA 1N4UA 2WOWA 2Q0LA 4TVYA 4MKSA 1STZA 2JBVA 3DFYA 4H4SA 3BNUA 4N9XA 2BABA 1CHUA 1JRZA 3L1RA 3HYXA 2QDEA 1ZK7A 2WOVA 3KD9A 4K2XA 2RDXA 3OC4A 1X31B 1MXTA 3DMEA 4K22A 1SJAA 3UXKA 2FJEA 3SN4A 1IUUA 1VQWA 3ES8A 3CMMA 3F8RA 1PJ5A 4ZN0A 2XYOA 1E9IA 3PWGA 2HZGA 2XFUA 5J04A 4JNAA 4DGKA 1CL0A 3UTEA 3QN3A 2YR6A 4JQ9A 3QJ4A 4HB9A 1RSGA 2R46A 2JB3A 3NRNA 2TPRA 3FV9A 3AWIA 3I3LA 5IDZA 4YTPA 3RRAA 4B69A 3URHA 2VVMA 1GXFA 1YY5A 4IP5A 4NNJA 2YM1A 3NHOX 1YQ3A 3UJFA 1PDYA 1F8RA 3AN1A 3NO1A 2XFNA 3AMZA 3GWFA 1S3BA 3GY1A 2B9WA 2EQ8A 3H12A 1YQ4A 2AKMA 1PXBA 2A89A 2BYBA 4JDRA 1F8WA 1TKKA 4E0VA 4YT0A 1BKWA 3GDPA 3JVAA 1CJ2A 4H4VA 4H4UA 1NELA 3O0HA 3SQSA 1EL9A 4P9SA 4D04A 4E4UA 1ONEA 2GR3A 3OP2A 2DW6A 2I5QA 2C65A 2WDVA 5M0ZA 3B97A 1LJ1A 2YR5A 4U8KA 4EQXA 4HNLA 3AYIA 3UKLA 4ZCWA 3RP7A 3PO7A 2GR2A 2IVEA 4HN8A 2BXRA 1TDKA 4A5LA 4EMIA 3CXBA 1DXLA 1DJQA 2NVKX 4GAPA 3JZUA 3E1TA 2B9XA 2FJAA 3UGVA 2C72A 4II3A 3Q9TA 2XLPA 4GUVA 4HNCA 1L9DA 2CHRA 5FS9A 3CPIG 3WE0A 1FFVC 2EQ9A 3VA8A 4H4RA 4J33A 1D7LA 3GSIA 4H2NA 1PDZA 4TM3A 4B66A 2OPJA 1KSUA 5KNLA 4K5RA 3ES7A 1FHUA 1GRTA 4K7ZA 2Q6UA 2OA1A 3N4FA 2R45A 3T2ZA 1LPFA 5U25A 2XLTA 3RNMA 3UP5A 1P48A 5KMPA 4HCDA 1GALA 3AEGA 1B37A 1E7PA 4FX9A 4A6GA 3ITJA 3TOYA 3AE9A 3B3RA 1NU5A 4Y4MA 4KEMA 4U8NA 1OJAA 1TDFA 2OFJA 5EB5A 2YAUA 3JW7A 1EC8A 3NTAA 2NQLA 3DGBA 2YG6A 1ZY8A 3HRDC 1L9CA 3N6JA 3NH3X 3CXOA 4ENLA 1PXAA 2PYXA 4A6NB 2X8GA 4HPNA 2R0GA 1EC9A 4CNKA 3AYLA 4O5QA 1MUCA 3D8XA 4JN8A 4DYEA 2ZZCA 5J7XA 3CNSA 3GDNA 2E1MA 5HY5A 3U4FA 2XVFA 5KOWA 5BOFA 1DNCA 4YWOA 2WP6A 2QGYA 1KN0A 4GMEA 1Y56A 3GD3A 2B7RA 1GRAA 3UJRA 3Q4DA 4BV6A 2R0CA 4C5OA 3U9IA 2DKHA 3KU9A 2QJMA 3ALMA 4FK1A 3T31A 2B76A 4HYRA 4U8OA 4KWSA 4J31A 3ISHA 3ZLFA 3SXIA 4IA6A 3HYVA 2GAHB 3N4EA 3S47A 3QFAA 4G74A 3QVPA 2QA2A 1GRGA 1EC7A 4H4PA 1IUVA 3CAWA 3PG6A 2OLAA 3CGCA 2WESA 2BCGG 1KKRA 3IWAA 1M64A 3B6DA 4BJZA 2VQ7A 1S2QA 5KVHA 2VOUA 2GQWA 2JKCA 1ONFA 2GEWA 4J3ZA 3N6HA 2AL2B 5U63A 3SX6A 3CT2A 4TLXA 3T14A 3R07C 2BK5A 2RGHA 3P1WA 3OW1A 3P4PA 2PPGA 2BK4A 3DG7A 4Z2TA 2XFOA 2YLSA 3FJ4A 2YG5A 1PS9A 2P3ZA 3V5FA 3RGTA 3FG2P 3IJLA 2PTZA 1X2HA 3UKHA 1FO4A 1GREA 1TYTA 4G6HA 2PGEA 4RG4A 2OX4A 3KPKA 3DG3A 1JU2A 3TWBA 4X4JA 5FJTA 3CNJA 3Q45A 1EBGA 3QVRA 1ELSA 1L8PA 2XVHA 3R10A 2WEUA 4YXDA 4ECHA 3ATRA 1R6WA 3I4KA 5FJRA 2WPFA 2E4GA 3SN0A 5FJOA 1KKOA 4GF7A 3T37A 3CIRA 3G5SA 4MMWA 3ALJA 3EPTA 1FFUC 4A79A 4NZHA 1WUEA 2XCGA 5GSNA 2C3DA 2CVJA 2JK6A 5JCNA 2O9ZA 2QQ6A 3QSEA 4H7UA 1GTEA 1ZMDA 2QDDA 4B65A 3T0KA 3UCDA 1MOKA 4J57A 1QO8A 3II4A 2WU5A 1KDGA 4C77A 4ZCDA 2PP0A 4EQSA 4HA6A 1KNPA 1SEZA 1H7XA 4IT1A 1PBEA 2C73A 1CBOA 3T4WA 2OQHA 3VFCA 3D47A 1V97A 4Z43A 4YWSA 1XHCA 3NKSA 2X3NA 5G5HB 3AE8A 3QLDA 3AYJA 2A8XA 1JPDX 3UTHA 3NYFA 1EL7A 1F6MA 2MNRA 1FL2A 2FJDA 4TM1A 4G8TA 5KMSA 1RM6B 2V5ZA 2GMHA 1DTNA 2QCUA 4AP1A 4UP3A 4U8MA 4E8GA 3K7MX 5BULA 1FECA 2BS4A 4GAVA 2BRAA 3TJIA 4NEVA 3T2YA 3RHAA 2QVHA 3TW9A 3ALLA 3DIPA 2E5AA 4AT2A 2C75A 2PGWA 4K5SA 6ENLA 1JNRA 5TR3A 4YKGA 1N62C 3AXBA 2P8BA 3VR9A 3I6TA 1NHSA 3F8DA 4BJYA 2GGEA 3K7TA 3ATQA 3DH9A 4G73A 3VCNA 1X2GA 4BURA 4CCRA 2QA1A 2PS2A 1OJDA 1JOAA 2J3NA 3FPZA 3LOVA 4JNQA 3CGBA 2GV8A 2BXSA 4BK1A 2YLWA 5KRQA 3UKFA 3PWIA 2Q0KA 4BK2A 3B9JB 3P4SA 5FJUA 2GMJA 3A7RA 3CB3A 3KPFA 2GL5A 4J56A 3CNPA 5IQ1A 4DN1A 3FIMB 4IP4A 2ZC8A 4DWDA 1GNDA 3UKAA 2C67A 1BWCA 2EQ6A 2BC1A 2QJJA 1N63C 2RABA 2YM2A 5ENLA 1WYGA 3KUMA 1Q1WA 3K1GA 2GRTA 3CPHG 3R9UA 2OVLA 1REOA 2YG3A 4GGBA 5KMQA 4MGGA 1FCDA 3UOYA 5EOWA 2YVGA 2WOIA 5JCLA 3BI2A 4ZCCA 1COYA 1VG9A 3DJJA 3EAOA 4U8IA 3NZGA 3ZLHA 4LU6A 3H8LA 1EL8A 3BHFA 3GMCA 4IVOB 3RCYA 4KX6A 4DSHA 1VRQB 4BK3A 3NK0X 3C96A 4ADWA 4GR1A 5KXJA 1IUXA 4OPLA 2YQUA 3TJ4A 2PCEA 3PK7A 1CF3A 3BI5A 1PN0A 5HXIA 1MRAA 1S2YA 1EBDA 3NGCX 3H8IA 4EQWA 2GGJA 3THUA 1NEKA 2PTYA 4A6NA 3NYCA 3AD7B 2GF3A 5U1OA 3SSZA 1D4CA 3CN8A 3DGZA 4I59A 3UP4A 1ZOYA 1ZMCA 4PAAA 1SJCA 4IZGA 3VC6A 2I0ZA 3AEAA 1GTHA 3AEBA 4A65A 1L0VA 4CBQA 5KWFA 4C3YA 5FS6A 1H6VA 3R25A 4GRTA 2V6OA 5DBJA 5JCKA 3EEZA 1VDVA 3D9XA 3V3WA 1E6EA 2YR4A 3PFRA 3AE2A 1GV4A 4AOSA 2VVLA 4H4TA 3SFEA 2XH2A 1PHHA 3CK5A 3H4KA 4TVWA 3MSYA 4NTDA 3T6CA 3AE7A 5CQFA 2RGOA 3S5WA 2VVLG 1XPQA 3D1CA 1VG0A 4H4YA 1ZXIC 3AE6A 1B4VA 3BJSA 1XDIA 1K0LA 1H2IA 2Z5YA 3GRSA 1MNSA 2GSHA 3QFBA 5C2TA 3TTEA 1SJBA 4NTCA 3V4BA 4A9WA 1N60C 2W55A 1E1LA 3P3BA 2XFPA 1AOGA 1YEYA 2WPCA 2BS3A 3PVCA 3SM8A 4GYPC 3D46A 4Z24A 3H7VA 3MQTA 3A7UA 4H4WA 2JB2A 1KF6A 3AD8B 3RO6A 3MUCA 3S61A 3FYYA 4JY2A 1M6IA 3OZMA 2GB0A 4ICYA 2AL2A 1PBFA 2IVDA 1NHRA 2O56A 2OKTA 4Z26A 4TM4A 1BQGA 1FIQB 2V61A 5GRTA 1VDCA 3ICRA 3QSMA 4JHMA 3CTYA 1KCZA 3UKKA 3EF6A 4EQRA 4CY6A 2F5ZA 3BNMA 4GDEA 3DESA 3UJ2A 1GESA 1GOSA 3NVVB 3T2KA 3R0UA 4E5TA 3SQPA 3NXLA 1H82A 4H4ZA 2C4CA 4J34A 5KVIA 2Q7VA 2R0PA 2OAMA 4UDPA 3DG6A 1GRHA 2OLOA 2PTWA 1PJ7A 4HCHA 1BGJA 2WQYA 2XLSA 4DHGA 2ZZ0A 5JRBA 1N4WA 2AL1A 4XXGA 3HW2A 1O95A 1LVLA 4M6UA 4H83A 3UXLA 4IL0A 2Y6QA 4Z2RA 4NEWA 1B5QA 3DJGX 2XLUA 3R11A 1GRBA 1RYIA 2X99A 2BACA 3UJEA 4YSHA 3UJSA 4H4XA 1JRXA 2DW7A 3I6EA 4C74A 2JB1A 2R4JA 4JY3A 3UCLA 2ACZA 3UOXA 4B67A 3JSKA 5KMRA 3VQRA 3RP8A 3QKEA 2GVCA 5BUKA 3SGLA 3C4NA 2YLRA 4NWZA 3IJIA 1TE6A 1CC2A 2AR8A 3NK2X 2YVJA 1P2EA 2BRYA 4U2SA 4YTNA 4DSGA 5BOEA 3CYJA 3ICSA 2HXUA 4A3RA 1P43A 2Z5XA 4Z44A 2VRLA 1IJHA 3IHMA 2XLRA 2C64A 2R9ZA 3LADA 3SZWA 3NVWB 2GQFA 2X8HA 2W0HA 3KA7A 1D4DA 2OQYA 4YTMA 1N4VA 4Y4NA 1IYXA 2HXTA 3IC9A 1ECQA 2RGJA 1V59A 5L46A 1CC4A 2VRMA 3OTRA 4RSLA 2XVEA 1NG4A 3LZXA 3HYWA 3NT6A 4O5UA 2XH7A 1EBHA 2PSNA 3GC2A 2DKIA 3AEEA 3DK4A 4EIQA 2C7GA 4GCMA 1D7YA 4EIPA 4M52A 4LA1A 1IUWA 3TCSA 3H70A 5M10A 3DK8A 1CJCA 4FP1A 1Q1RA 3SZ0A 4USRA 3NFUA 2ARDA 1MDLA 3AE1A 3SY4A 2P88A 2ONEA 1P2HA 3UKPA 2OZ3A 4G6GA 1WUFA 1XS2A 1MO9A 1DJNA 4KPRA 3HPFA 3TQPA 4YSYA 5FMHA 1SJDA 4CCQA 2AAQA 1OJCA 4CRTA 2YVFA 2NPXA 1EL5A 4CNJA 4A7AA 1D4EA 1TDNA 3S5SA 2B9YA 3AM9A 1FOHA 4YSXA 1N61C 4B1BA 3BHKA 2CULA 1HYUA 2JAEA 1OJTA 1N5WC 4H2QA 1R0MA 3G5RA 1DOCA 2W3SA 2C3CA 5EB4A 2ZZBA 3LB8A 3DA1A 2WETA 2BS2A 3MZNA 4JN9A 1S3EA 3BI4A 3HZLA 4ZA0A 4IA5A 2OZ8A 1TDEA 5HYMA 2H89A 5FS8A 3F8PA 1B8SA 1VQZA 4Z25A 3CNDA 1S7MA 2GGGA 1PBDA 4PABA 1KD0A 2TMDA 3CPJG 1TRBA 2QJNA 1H83A 1ZP0A 2A87A 2P0IA 2VQBA 1JNZA 3AEFA 3GYJA 2FBWA 1CC6A 1NDAA 2WBAA 3SFDA 3SYIA 3FVDA 3NN0X 4CY8A 1LQTA 3BOXA 2OLNA 3UOVA 3UOZA 2GGHA 3VC5A 1CJ4A 3PS9A 2YLXA 3T8QA 3SN1A 2WHDA 2PMQA 3DERA 4M0XA 3IHGA 1K0JA 1XANA 2WU2A 3ZVHB 2PA6A 5BRTA 3QPEA 3ETRB 1NENA 1O5WA 2PHHA 1TYPA 2POZA 2PTXA 4IVMB 2PU0A 4FK1C 1ZX9A 3A7AA 1BGNA 2GH5A 3LJPA 4K2SA 4TLZA 4YSZA 1N1PA 5LV9A 4USQA 2AKZA 4B63A 3H8AA 1Q9IA 3BSMA 3OZYA 3KKJA 4G7FA 2QAEA 3GD4A 1NAAA 4OPIA 4A35A 1KSSA 3NNEA 2UZZA 1NPXA 1IUTA 2OZTA 1JRPA 2AQJA 3CGDA 3UKQA 3DJDA 3UTGA 3M0OA 3K30A 4Z2UA 3UTFA 3ICTA 2YLTA 2FJBA 3NYEA 1JRYA 3ZVIA 1PBBA 3AE4A 2W3RA 3GYXA 2CFYA 4K1WA 4U8JA 4H2PA 5KOXA 1DOBA 4EWJA 2GR0A 1NG3A 3P4RA 4EM3A 4H2HA 5ER0A 2W54A 3K7QX 2YWLA 1H81A 4AT0A 5C3JA 1QLBA 4U2LA 1NHQA 3AEDA 2ZBWA 3FCPA 2C66A 2WPEA 3QSSA 1OJ9A 3R0KA 1F8SA 1IUSA 5IQ4A 4NTEA 1F9CA 4B68A 1LV0A 2MUCA 2V60A 1GT8A 1GRFA 1OEPA 1BF3A 2YG4A 1JCTA 2C76A 2APGA 5EU9A 1UKVG 3ZLGA 4B64A 3RR1A 5J60A 4WCTA 3STPA 2OO6A 4ROPA 1ELIA 2HNEA 1SB3B 3Q6JA 5FJPA 4XWRA 2GDQA 3REDA 2HQMA 5JCMA 1ZDLA 1K0IA 3DFHA 4X2PA 4IV9A 3KLJA 3GWDA 2P8CA 2H88A 4K8GA 4U2TA 3ZYXA 3DEQA 3AB1A 4WX1A 3NIXA 1YQZA 1PJ6A 4Z1YA 3NG7X 4OPDA 3TWAA 3SBFA 4E6MA 1H84A 1DODA 2FYMA 1GERA 2BA9A 3L8KA 4EMWA 2XDOA 1JROA 4APNA 2WS3A 4X9MA 3M12A 4RG3A 5IPYA 3SZFA 4YKFA 3IF9A 4K8DA 5FS7A 3ENLA
chains in the Genus database with same CATH topology
2GQFA 2X8HA 2W0HA 2XVJA 3AYIA 3UKLA 3RP7A 3PO7A 1PXCA 4U8PA 3KA7A 4REKA 2GR2A 2IVEA 3VR9A 1NHSA 3FBSA 1D4DA 3F8DA 4YTMA 4BJYA 1N4VA 4Y4NA 3K7TA 2BXRA 3ATQA 1TDKA 4A5LA 3L5OA 3DH9A 1CJ3A 4EMIA 1DJQA 1DXLA 1GPEA 2NVKX 4G73A 4GAPA 4G9KA 3VRBA 3IC9A 3E1TA 3EANA 2B9XA 4BURA 2FJAA 3V3NA 4CCRA 2RGJA 3P4QA 2QA1A 1V59A 3COXA 2C70A 2BCPA 5L46A 1OJDA 4OPCA 1JOAA 2J3NA 2C72A 3FPZA 4II3A 4OPTA 1KNRA 1CC4A 3LOVA 4JNQA 3Q9TA 3CGBA 2GV8A 2BXSA 2XLPA 4GUVA 2VRMA 4BK1A 2YLWA 5KRQA 3NLCA 5BVAA 4RSLA 4Y4LA 3UKFA 1D5TA 3GYIA 2Q0KA 2XVEA 4BK2A 1L9DA 5FS9A 1NG4A 3CPIG 3WE0A 3LZXA 3P4SA 2EQ9A 4H4RA 4J33A 3HYWA 3V3OA 3NT6A 4O5UA 2GMJA 1D7LA 3GSIA 3KPFA 2DKIA 3AEEA 2OALA 4H2NA 3DK4A 1DOEA 4TM3A 4B66A 4J56A 4EIQA 1KSUA 2X50A 3CNPA 2C7GA 5IQ1A 4GCMA 5KNLA 4H4QA 3FIMB 1D7YA 2WDRA 4K5RA 4M52A 4EIPA 4LA1A 1GRTA 4K7ZA 5HHFA 2Q6UA 1IUWA 2XVIA 4TM0A 1GNDA 2OA1A 3UKAA 2R45A 3T2ZA 1LPFA 2C67A 5M10A 1BWCA 3DK8A 5U25A 1CJCA 1Q1RA 4D03A 2EQ6A 2XLTA 1E1NA 2BC1A 3SZ0A 3AD9B 3RNMA 5EBKA 3CGEA 4USRA 3UP5A 2ARDA 1TDOA 3RP6A 5KMPA 3AE1A 3VRDB 3SY4A 1GALA 3AEGA 1B37A 1E7PA 2RABA 2CDUA 4FX9A 2YM2A 1P2HA 1KFYA 3ITJA 3UKPA 3AE9A 3B3RA 1Q1WA 4H50A 4Y4MA 1H86A 4U8NA 3V76A 2GRTA 1L9EA 2IIDA 1OJAA 1TDFA 3CPHG 4G6GA 3R9UA 5EB5A 2YAUA 1Y56B 1LTXR 3NK1X 1REOA 2YG3A 4OVIA 3ADAB 1MO9A 1DJNA 3NTAA 5KMQA 1FCDA 4KPRA 3UOYA 5EOWA 2YVGA 3GRTA 2YG6A 1ZY8A 2BC0A 1L9CA 3P9UA 2WOIA 3NH3X 5JCLA 4EM4A 3BI2A 4XWZA 4ZCCA 4II2A 1COYA 2WDQA 1VG9A 1GEUA 1PXAA 4YSYA 3KVEA 5FMHA 3DJJA 3EAOA 2PYXA 4A6NB 1E39A 4CCQA 3M13A 2AAQA 2X8GA 1OJCA 1K4QA 2YVFA 2NPXA 3GMBA 4U8IA 4CRTA 1EL5A 4U8LA 4LU6A 4EMJA 2WP5A 2BK3A 2Y6RA 3H8LA 2R0GA 4CNJA 4A7AA 1D4EA 1EL8A 1TDNA 3DJEA 3NTDA 4AOXA 3DK9A 2B9YA 4CNKA 3AYLA 4O5QA 2B7SA 1FOHA 4YSXA 3D8XA 3BHFA 3GMCA 4IVOB 3BHKA 2CULA 4B1BA 1HYUA 3DGHA 4KX6A 2JAEA 2ZZCA 1OJTA 5J7XA 4DSHA 3G5QA 1VRQB 4H2QA 3NK0X 4BK3A 3CNSA 3C96A 1DOCA 3G5RA 4ADWA 2C3CA 4GR1A 5EB4A 2ZZBA 1RP0A 3LB8A 3DA1A 2WETA 2BS2A 1IUXA 2X8CA 5KXJA 2XFQA 3GDNA 4OPLA 3AE5A 2YQUA 2E1MA 4GDPA 4JN9A 3ZDNA 5HY5A 2GR1A 1S3EA 2XVFA 3BI4A 3CNTA 5KOWA 1DNCA 4YWOA 1CF3A 2WP6A 3HZLA 1KN0A 3BI5A 1Y56A 1GSNA 3GD3A 2B7RA 4IA5A 1GRAA 4MJWA 1PN0A 4LIIA 1TDEA 5HYMA 2H89A 4OPGA 5HXIA 4UDQA 5FS8A 3F8PA 1S2YA 1B8SA 1FEBA 1EBDA 4Z25A 4BV6A 2R0CA 4C5OA 1E1MA 3CNDA 3NGCX 3H8IA 2DKHA 1S7MA 3KU9A 4J2WA 1PBDA 4PABA 4EQWA 3ALMA 1ZKQA 2TMDA 3CPJG 4FK1A 1TRBA 5CKUA 1O94A 3T31A 1NEKA 1H83A 4A6NA 1BZLA 3NYCA 1ZP0A 2A87A 2B76A 4U8OA 3NN6X 3AD7B 3C4AA 2VQBA 4DNAA 2WP9A 1NHPA 1JNZA 5U1OA 2GF3A 1Z6LA 3AEFA 3GYJA 2FBWA 4J31A 3ISHA 1CC6A 1NDAA 1D4CA 3SXIA 2WBAA 4IA6A 3CN8A 3LZWA 3DGZA 2GAGB 3NN0X 3SFDA 3SYIA 1LQTA 4I59A 3UP4A 4CY8A 1W4XA 2OLNA 3HYVA 1ZOYA 2GAHB 1ZMCA 3UOVA 1ZOVA 4PAAA 3UOZA 3VRAA 1F3PA 3VR8A 1CJ4A 3PS9A 3QFAA 3AEBA 2I0ZA 2QA2A 1GTHA 2YLXA 3AEAA 3QVPA 1JEHA 4G74A 2WHDA 1GRGA 4OPUA 1L0VA 4CBQA 5KWFA 4H4PA 1IUVA 4I58A 4C3YA 5FS6A 1H6VA 3PG6A 2YLZA 3CGCA 3OZ2A 2WESA 3IHGA 4GRTA 2V6OA 5DBJA 1K0JA 1XANA 5JCKA 2BCGG 2YR4A 3D9XA 1E6EA 2WU2A 3SZCA 3AE2A 1LQUA 1GV4A 5BRTA 3IWAA 1M64A 3B6DA 4AOSA 2VVLA 4H4TA 2R4EA 4BJZA 3AE3A 2VQ7A 3SFEA 1S2QA 1PHHA 4OCGA 5KVHA 1NENA 2VOUA 1O5WA 4X9NA 2PHHA 2EQ7A 4FDCB 1TYPA 2GQWA 1QJDA 4IVMB 1PBCA 4FK1C 1ZX9A 3H4KA 2JKCA 1PDHA 3ABVA 1ONFA 4NTDA 2GEWA 1BGNA 3AE7A 5CQFA 2GH5A 2RGOA 2YG7A 1GETA 4H2RA 5U63A 2VVLG 3S5WA 3LJPA 1XPQA 5JCIA 3AECA 4TLZA 4YSZA 3D1CA 3SX6A 4C3XA 1N1PA 1VG0A 4H4YA 5LV9A 1E1KA 4TLXA 3T14A 4USQA 4B63A 2BK5A 2VZ2A 2RGHA 1B4VA 3AE6A 1XDIA 1K0LA 1Q9IA 1H2IA 3P1WA 4UDRA 2Z5YA 3KKJA 3GRSA 2QAEA 3GD4A 3P4PA 2V3BA 1NAAA 4AP3A 3QFBA 2BK4A 5C2TA 4Z2TA 2XFOA 2YLSA 4OPIA 4NTCA 4A99A 4A65A 1KSSA 4A9WA 4ZCDA 3NNEA 2YG5A 1YKJA 2UZZA 1NPXA 1E1LA 3SZWA 1IUTA 2E5VA 1PS9A 1H7WA 1Y0PA 2XFPA 1AOGA 3I6DA 2WPCA 2BS3A 3PVCA 3SM8A 3FG2P 2AQJA 4J36A 3CGDA 3LXDA 3UKQA 3DJDA 4Z24A 3UKHA 3UTGA 1FEAA 1GREA 1TYTA 3M0OA 3K30A 4Z2UA 4H4WA 2JB2A 3FMWA 1KF6A 4G6HA 3AD8B 2V3AA 3UTFA 4RG4A 3ICTA 2YLTA 1N4UA 2FJBA 3NYEA 1JRYA 2WOWA 3KPKA 3S61A 2Q0LA 4JY2A 1JU2A 1M6IA 1PBBA 2GB0A 4ICYA 1PBFA 2IVDA 4X4JA 2JBVA 3AE4A 1NHRA 4H4SA 3CNJA 3BNUA 2BABA 4N9XA 3GYXA 3QVRA 2CFYA 1CHUA 1JRZA 4Z26A 2XVHA 2WEUA 4U8JA 4TM4A 4YXDA 3L1RA 4H2PA 4ECHA 1DOBA 3HYXA 3ATRA 5KOXA 1ZK7A 2GR0A 1NG3A 2WOVA 4EM3A 2V61A 3P4RA 5ER0A 2WPFA 2E4GA 3KD9A 4K2XA 5GRTA 1VDCA 3ICRA 3K7QX 2YWLA 3QSMA 1H81A 4GF7A 3OC4A 3T37A 3CTYA 1X31B 3CIRA 4AT0A 1MXTA 3G5SA 5C3JA 1QLBA 3ALJA 3UKKA 4U2LA 3DMEA 1NHQA 3EPTA 4K22A 3AEDA 3EF6A 2FJEA 2ZBWA 4EQRA 4CY6A 2F5ZA 3BNMA 1IUUA 4A79A 4GDEA 2C66A 4NZHA 1VQWA 1GESA 2WPEA 1GOSA 3CMMA 3F8RA 3QSSA 2XCGA 1PJ5A 1OJ9A 3T2KA 4ZN0A 2XYOA 3SQPA 1F8SA 5GSNA 2C3DA 2CVJA 2JK6A 5JCNA 1H82A 2XFUA 4H4ZA 2O9ZA 1IUSA 5IQ4A 2C4CA 4J34A 4NTEA 3QSEA 4H7UA 5KVIA 2Q7VA 4JNAA 2R0PA 1GTEA 2OAMA 4DGKA 4B68A 1CL0A 4UDPA 1ZMDA 1LV0A 1GRHA 3T0KA 3UTEA 4B65A 2V60A 2OLOA 2YR6A 1MOKA 4J57A 4JQ9A 1PJ7A 1GT8A 1QO8A 3II4A 2WU5A 1BGJA 3QJ4A 1GRFA 1KDGA 4C77A 1RSGA 1BF3A 4HB9A 2YG4A 2WQYA 2R46A 4EQSA 4HA6A 2JB3A 2XLSA 2C76A 2ZZ0A 1KNPA 3NRNA 2APGA 5JRBA 2TPRA 1N4WA 3AWIA 3I3LA 4YTPA 4XXGA 1O95A 1SEZA 1H7XA 3URHA 2VVMA 4B69A 1LVLA 1GXFA 1PBEA 2C73A 1CBOA 2Y6QA 1UKVG 4Z2RA 4NEWA 1YY5A 4B64A 4Z43A 1B5QA 5J60A 4NNJA 4WCTA 1XHCA 3DJGX 2XLUA 2YM1A 3NHOX 3NKSA 1GRBA 1ELIA 2X3NA 3AE8A 1YQ3A 1RYIA 2X99A 2BACA 1F8RA 3AYJA 2A8XA 3Q6JA 4YSHA 4H4XA 1JRXA 2XFNA 3UTHA 3GWFA 4XWRA 3NYFA 4C74A 2JB1A 2R4JA 1S3BA 1EL7A 1F6MA 1FL2A 4JY3A 3REDA 2HQMA 5JCMA 1ZDLA 2EQ8A 2ACZA 2B9WA 1K0IA 2FJDA 3UCLA 3UOXA 4TM1A 4B67A 3JSKA 5KMRA 4IV9A 5KMSA 3VQRA 3RP8A 2V5ZA 2GVCA 3KLJA 1YQ4A 2GMHA 3C4NA 2YLRA 3SGLA 5BUKA 4NWZA 3GWDA 1PXBA 2QCUA 4AP1A 2H88A 4UP3A 4U8MA 4U2TA 1CC2A 2A89A 3K7MX 5BULA 3ZYXA 2BYBA 4JDRA 3AB1A 4WX1A 3NIXA 1FECA 1YQZA 1F8WA 2AR8A 1PJ6A 2BS4A 3NG7X 4OPDA 3NK2X 4E0VA 4YT0A 2YVJA 4GAVA 1P2EA 1BKWA 3GDPA 1CJ2A 4H4VA 2BRYA 4U2SA 4YTNA 1H84A 2BRAA 4DSGA 4H4UA 3O0HA 4NEVA 3T2YA 3RHAA 3ICSA 1DODA 1EL9A 4P9SA 1GERA 3ALLA 2BA9A 2Z5XA 4Z44A 4D04A 3L8KA 4EMWA 2VRLA 2GR3A 2XDOA 4APNA 2WS3A 4AT2A 1IJHA 2C75A 4X9MA 3IHMA 3M12A 2XLRA 2C65A 4K5SA 4RG3A 5IPYA 1JNRA 2WDVA 5TR3A 5M0ZA 2C64A 4YKGA 3SZFA 4YKFA 3AXBA 2R9ZA 3IF9A 3LADA 4K8DA 1LJ1A 2YR5A 4U8KA 4EQXA 5FS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQF A;  2X8H A;  2W0H A;  2XVJ A;  3AYI A;  3UKL A;  3RP7 A;  3PO7 A;  1PXC A;  4U8P A;  3KA7 A;  4REK A;  2GR2 A;  2IVE A;  3VR9 A;  1NHS A;  3FBS A;  1D4D A;  3F8D A;  4YTM A;  4BJY A;  1N4V A;  4Y4N A;  3K7T A;  2BXR A;  3ATQ A;  1TDK A;  4A5L A;  4C3X A;  3DH9 A;  1CJ3 A;  4EMI A;  1DJQ A;  1DXL A;  1GPE A;  2NVK X;  3VRB A;  3IC9 A;  3E1T A;  3EAN A;  2B9X A;  4BUR A;  2FJA A;  3V3N A;  4CCR A;  2RGJ A;  3P4Q A;  2QA1 A;  1V59 A;  3COX A;  2C70 A;  2BCP A;  5L46 A;  1OJD A;  4OPC A;  1JOA A;  2J3N A;  2C72 A;  3FPZ A;  4OPT A;  1KNR A;  1CC4 A;  3LOV A;  4JNQ A;  3Q9T A;  3CGB A;  2GV8 A;  2BXS A;  2XLP A;  4GUV A;  2VRM A;  4BK1 A;  2YLW A;  5KRQ A;  3NLC A;  5BVA A;  4RSL A;  4Y4L A;  3UKF A;  1D5T A;  3GYI A;  2Q0K A;  2XVE A;  4BK2 A;  1L9D A;  5FS9 A;  1NG4 A;  3CPI G;  3WE0 A;  3LZX A;  3P4S A;  2EQ9 A;  4H4R A;  4J33 A;  3V3O A;  3NT6 A;  4O5U A;  2GMJ A;  1D7L A;  3GSI A;  3KPF A;  2DKI A;  3AEE A;  2OAL A;  4H2N A;  3DK4 A;  1DOE A;  4TM3 A;  4B66 A;  4J56 A;  4EIQ A;  1KSU A;  2X50 A;  3CNP A;  2C7G A;  5IQ1 A;  4GCM A;  4H4Q A;  3FIM B;  1D7Y A;  2WDR A;  4K5R A;  4M52 A;  4EIP A;  4LA1 A;  1GRT A;  4K7Z A;  5HHF A;  2Q6U A;  1IUW A;  2XVI A;  4TM0 A;  1GND A;  2OA1 A;  3UKA A;  2R45 A;  1LPF A;  2C67 A;  5M10 A;  1BWC A;  3DK8 A;  5U25 A;  1CJC A;  1Q1R A;  4D03 A;  2EQ6 A;  2XLT A;  1E1N A;  2BC1 A;  3AD9 B;  3RNM A;  5EBK A;  3CGE A;  4USR A;  3UP5 A;  2ARD A;  1TDO A;  3RP6 A;  3AE1 A;  3VRD B;  1GAL A;  3AEG A;  1B37 A;  1E7P A;  2RAB A;  2CDU A;  4FX9 A;  2YM2 A;  1P2H A;  1KFY A;  3ITJ A;  3UKP A;  3AE9 A;  3B3R A;  1Q1W A;  4H50 A;  4Y4M A;  1H86 A;  4U8N A;  3V76 A;  2GRT A;  1L9E A;  2IID A;  1OJA A;  1TDF A;  3CPH G;  3R9U A;  5EB5 A;  2YAU A;  1Y56 B;  1LTX R;  3NK1 X;  1REO A;  2YG3 A;  4OVI A;  3ADA B;  1MO9 A;  1DJN A;  3NTA A;  1FCD A;  4KPR A;  3UOY A;  5EOW A;  2YVG A;  3GRT A;  2YG6 A;  1ZY8 A;  2BC0 A;  1L9C A;  3P9U A;  2WOI A;  3NH3 X;  5JCL A;  4EM4 A;  3BI2 A;  4XWZ A;  4ZCC A;  1COY A;  2WDQ A;  1VG9 A;  1GEU A;  1PXA A;  4YSY A;  3KVE A;  5FMH A;  3DJJ A;  3EAO A;  2PYX A;  4A6N B;  1E39 A;  4CCQ A;  3M13 A;  2AAQ A;  2X8G A;  1OJC A;  1K4Q A;  2YVF A;  2NPX A;  3GMB A;  4U8I A;  4CRT A;  1EL5 A;  4U8L A;  4LU6 A;  4EMJ A;  2WP5 A;  2BK3 A;  2Y6R A;  3H8L A;  2R0G A;  4CNJ A;  4A7A A;  1D4E A;  1EL8 A;  1TDN A;  3DJE A;  3NTD A;  4AOX A;  3DK9 A;  2B9Y A;  4CNK A;  3AYL A;  4O5Q A;  2B7S A;  1FOH A;  4YSX A;  3D8X A;  3BHF A;  3GMC A;  4IVO B;  3BHK A;  2CUL A;  4B1B A;  1HYU A;  3DGH A;  4KX6 A;  2JAE A;  2ZZC A;  1OJT A;  5J7X A;  4DSH A;  3G5Q A;  1VRQ B;  4H2Q A;  3NK0 X;  4BK3 A;  3CNS A;  3C96 A;  1DOC A;  3G5R A;  4ADW A;  2C3C A;  4GR1 A;  5EB4 A;  2ZZB A;  1RP0 A;  3LB8 A;  3DA1 A;  2WET A;  2BS2 A;  1IUX A;  2X8C A;  5KXJ A;  2XFQ A;  3GDN A;  4OPL A;  3AE5 A;  2YQU A;  2E1M A;  4GDP A;  4JN9 A;  3ZDN A;  5HY5 A;  2GR1 A;  1S3E A;  2XVF A;  3BI4 A;  3CNT A;  5KOW A;  1DNC A;  4YWO A;  1CF3 A;  2WP6 A;  3HZL A;  3BI5 A;  1Y56 A;  1GSN A;  3GD3 A;  2B7R A;  4IA5 A;  1GRA A;  4MJW A;  1PN0 A;  4LII A;  1TDE A;  5HYM A;  2H89 A;  4OPG A;  5HXI A;  4UDQ A;  5FS8 A;  3F8P A;  1S2Y A;  1B8S A;  1FEB A;  1EBD A;  4Z25 A;  4BV6 A;  2R0C A;  4C5O A;  1E1M A;  3CND A;  3NGC X;  3H8I A;  2DKH A;  3KU9 A;  4J2W A;  1PBD A;  4PAB A;  4EQW A;  3ALM A;  1ZKQ A;  2TMD A;  3CPJ G;  4FK1 A;  1TRB A;  5CKU A;  1O94 A;  1NEK A;  1H83 A;  4A6N A;  1BZL A;  3NYC A;  1ZP0 A;  2A87 A;  2B76 A;  4U8O A;  3NN6 X;  3AD7 B;  3C4A A;  2VQB A;  4DNA A;  2WP9 A;  1NHP A;  1JNZ A;  5U1O A;  2GF3 A;  1Z6L A;  3AEF A;  3GYJ A;  2FBW A;  4J31 A;  3ISH A;  1CC6 A;  1NDA A;  1D4C A;  2WBA A;  4IA6 A;  3CN8 A;  3LZW A;  3DGZ A;  2GAG B;  3NN0 X;  3SFD A;  4CY8 A;  1LQT A;  4I59 A;  3UP4 A;  1W4X A;  2OLN A;  1ZOY A;  2GAH B;  1ZMC A;  3UOV A;  1ZOV A;  4PAA A;  3UOZ A;  3VRA A;  1F3P A;  3VR8 A;  1CJ4 A;  3PS9 A;  3QFA A;  3AEB A;  2I0Z A;  2QA2 A;  1GTH A;  2YLX A;  3AEA A;  3QVP A;  1JEH A;  4OPU A;  2WHD A;  1GRG A;  1L0V A;  4CBQ A;  5KWF A;  4H4P A;  1IUV A;  4I58 A;  4C3Y A;  5FS6 A;  1H6V A;  2YLZ A;  3CGC A;  3OZ2 A;  2WES A;  3IHG A;  4GRT A;  2V6O A;  5DBJ A;  1K0J A;  1XAN A;  5JCK A;  2BCG G;  2YR4 A;  1E6E A;  2WU2 A;  3AE2 A;  1LQU A;  1GV4 A;  5BRT A;  3IWA A;  1M64 A;  3B6D A;  4AOS A;  2VVL A;  4H4T A;  2R4E A;  4BJZ A;  3AE3 A;  2VQ7 A;  3SFE A;  1S2Q A;  1PHH A;  4OCG A;  5KVH A;  1NEN A;  2VOU A;  1O5W A;  4X9N A;  2PHH A;  2EQ7 A;  4FDC B;  1TYP A;  2GQW A;  1QJD A;  4IVM B;  1PBC A;  4FK1 C;  1ZX9 A;  3H4K A;  2JKC A;  1PDH A;  3ABV A;  1ONF A;  4NTD A;  2GEW A;  1BGN A;  3AE7 A;  5CQF A;  2GH5 A;  2RGO A;  2YG7 A;  1GET A;  4H2R A;  5U63 A;  2VVL G;  3S5W A;  3LJP A;  1XPQ A;  5JCI A;  3AEC A;  4TLZ A;  4YSZ A;  3D1C A;  1N1P A;  1VG0 A;  4H4Y A;  5LV9 A;  1E1K A;  4TLX A;  4USQ A;  4B63 A;  2BK5 A;  2VZ2 A;  2RGH A;  1B4V A;  3AE6 A;  1XDI A;  1K0L A;  1Q9I A;  3P1W A;  4UDR A;  2Z5Y A;  3KKJ A;  3GRS A;  2QAE A;  3GD4 A;  3P4P A;  2V3B A;  1NAA A;  4AP3 A;  3QFB A;  2BK4 A;  5C2T A;  4Z2T A;  2XFO A;  2YLS A;  4OPI A;  4NTC A;  4A99 A;  4A65 A;  1KSS A;  4A9W A;  4ZCD A;  3NNE A;  2YG5 A;  1YKJ A;  2UZZ A;  1NPX A;  1E1L A;  1IUT A;  2E5V A;  1PS9 A;  1H7W A;  1Y0P A;  2XFP A;  1AOG A;  3I6D A;  2WPC A;  2BS3 A;  3PVC A;  3SM8 A;  3FG2 P;  2AQJ A;  4J36 A;  3CGD A;  3LXD A;  3UKQ A;  3DJD A;  4Z24 A;  3UKH A;  3UTG A;  1FEA A;  1GRE A;  1TYT A;  3M0O A;  3K30 A;  4Z2U A;  4H4W A;  2JB2 A;  3FMW A;  1KF6 A;  3AD8 B;  2V3A A;  3UTF A;  4RG4 A;  3ICT A;  2YLT A;  1N4U A;  2FJB A;  3NYE A;  1JRY A;  2WOW A;  3S61 A;  2Q0L A;  4JY2 A;  1JU2 A;  1M6I A;  1PBB A;  2GB0 A;  4ICY A;  1PBF A;  2IVD A;  4X4J A;  2JBV A;  3AE4 A;  1NHR A;  4H4S A;  3CNJ A;  3BNU A;  2BAB A;  4N9X A;  3QVR A;  4Z26 A;  2CFY A;  1CHU A;  1JRZ A;  2XVH A;  2WEU A;  4U8J A;  4TM4 A;  4YXD A;  3L1R A;  4H2P A;  4ECH A;  1DOB A;  5KOX A;  3ATR A;  1ZK7 A;  2GR0 A;  1NG3 A;  2WOV A;  4EM3 A;  2V61 A;  3P4R A;  5ER0 A;  2WPF A;  2E4G A;  3KD9 A;  4K2X A;  5GRT A;  1VDC A;  3ICR A;  3K7Q X;  2YWL A;  3QSM A;  1H81 A;  4GF7 A;  3OC4 A;  3T37 A;  3CTY A;  1X31 B;  3CIR A;  4AT0 A;  1MXT A;  3G5S A;  5C3J A;  1QLB A;  3ALJ A;  3UKK A;  4U2L A;  3DME A;  1NHQ A;  3EPT A;  4K22 A;  3AED A;  3EF6 A;  2FJE A;  2ZBW A;  4EQR A;  4CY6 A;  2F5Z A;  3BNM A;  1IUU A;  4A79 A;  4GDE A;  2C66 A;  4NZH A;  1VQW A;  1GES A;  2WPE A;  1GOS A;  3F8R A;  3QSS A;  2XCG A;  1PJ5 A;  1OJ9 A;  4ZN0 A;  2XYO A;  3SQP A;  1F8S A;  5GSN A;  2C3D A;  2CVJ A;  2JK6 A;  5JCN A;  1H82 A;  2XFU A;  4H4Z A;  2O9Z A;  1IUS A;  5IQ4 A;  4J34 A;  4NTE A;  3QSE A;  4H7U A;  5KVI A;  2Q7V A;  4JNA A;  2R0P A;  1GTE A;  2OAM A;  4DGK A;  4B68 A;  1CL0 A;  4UDP A;  1ZMD A;  1LV0 A;  1GRH A;  4B65 A;  3UTE A;  2V60 A;  2OLO A;  2YR6 A;  1MOK A;  4J57 A;  4JQ9 A;  1PJ7 A;  1GT8 A;  1QO8 A;  3II4 A;  2WU5 A;  1BGJ A;  3QJ4 A;  1GRF A;  1KDG A;  4C77 A;  1RSG A;  1BF3 A;  4HB9 A;  2YG4 A;  2WQY A;  2R46 A;  4EQS A;  4HA6 A;  2JB3 A;  2XLS A;  2C76 A;  2ZZ0 A;  1KNP A;  3NRN A;  2APG A;  2TPR A;  1N4W A;  3AWI A;  3I3L A;  4YTP A;  4XXG A;  1O95 A;  1SEZ A;  1H7X A;  3URH A;  2VVM A;  4B69 A;  1LVL A;  1GXF A;  1PBE A;  2C73 A;  1CBO A;  2Y6Q A;  1UKV G;  4Z2R A;  4NEW A;  1YY5 A;  4B64 A;  4Z43 A;  1B5Q A;  5J60 A;  4WCT A;  1XHC A;  3DJG X;  2XLU A;  2YM1 A;  3NHO X;  3NKS A;  1GRB A;  1ELI A;  2X3N A;  3AE8 A;  1YQ3 A;  1RYI A;  2X99 A;  2BAC A;  1F8R A;  3AYJ A;  2A8X A;  3Q6J A;  4YSH A;  4H4X A;  1JRX A;  2XFN A;  3UTH A;  3GWF A;  4XWR A;  3NYF A;  4C74 A;  2JB1 A;  2R4J A;  1S3B A;  1EL7 A;  1F6M A;  1FL2 A;  4JY3 A;  3RED A;  2HQM A;  5JCM A;  1ZDL A;  2EQ8 A;  2ACZ A;  2B9W A;  1K0I A;  2FJD A;  3UCL A;  3UOX A;  4TM1 A;  4B67 A;  3JSK A;  4IV9 A;  3VQR A;  3RP8 A;  2V5Z A;  2GVC A;  3KLJ A;  1YQ4 A;  2GMH A;  3C4N A;  2YLR A;  3SGL A;  5BUK A;  3GWD A;  1PXB A;  2QCU A;  4AP1 A;  2H88 A;  4UP3 A;  4U8M A;  4U2T A;  1CC2 A;  2A89 A;  3K7M X;  5BUL A;  3ZYX A;  2BYB A;  4JDR A;  3AB1 A;  4WX1 A;  3NIX A;  1FEC A;  1YQZ A;  1F8W A;  2AR8 A;  1PJ6 A;  2BS4 A;  3NG7 X;  4OPD A;  3NK2 X;  4E0V A;  4YT0 A;  2YVJ A;  1P2E A;  1BKW A;  3GDP A;  1CJ2 A;  4H4V A;  4U2S A;  4YTN A;  1H84 A;  4DSG A;  4H4U A;  3O0H A;  4NEV A;  3RHA A;  3ICS A;  1DOD A;  1EL9 A;  4P9S A;  1GER A;  3ALL A;  2BA9 A;  2Z5X A;  4Z44 A;  4D04 A;  3L8K A;  4EMW A;  2VRL A;  2GR3 A;  2XDO A;  4APN A;  2WS3 A;  4AT2 A;  1IJH A;  2C75 A;  4X9M A;  3IHM A;  3M12 A;  2XLR A;  2C65 A;  4K5S A;  4RG3 A;  5IPY A;  1JNR A;  2WDV A;  5TR3 A;  5M0Z A;  2C64 A;  4YKG A;  4YKF A;  3AXB A;  2R9Z A;  3IF9 A;  3LAD A;  4K8D A;  1LJ1 A;  2YR5 A;  4U8K A;  4EQX A;  5FS7 A; 
#chains in the Genus database with same CATH topology
 4F4R A;  2XVJ A;  3MWC A;  1PXC A;  4U8P A;  4REK A;  4IL2 A;  3FBS A;  4FI4 A;  4C3X A;  3L5O A;  1CJ3 A;  3P0W A;  1GPE A;  3VRB A;  3EKG A;  3IK4 A;  4G9K A;  3EAN A;  3V3N A;  3P4Q A;  3COX A;  2C70 A;  2BCP A;  4OPC A;  3VDG A;  4OPT A;  3OPS A;  1KNR A;  2E3T A;  3NLC A;  5BVA A;  4Y4L A;  1D5T A;  3GYI A;  1BKH A;  3V3O A;  1T3Q C;  2OAL A;  3EUB 3;  1DOE A;  2X50 A;  4GFI A;  4H4Q A;  4KT2 A;  2WDR A;  2PP3 A;  5HHF A;  1W6T A;  2XVI A;  4TM0 A;  3R1Z A;  2GGI A;  4D03 A;  1E1N A;  3AD9 B;  4JN7 A;  3CGE A;  5EBK A;  4E4F A;  1TDO A;  3RP6 A;  3VRD B;  4DX3 A;  2CDU A;  3NRZ B;  4KPL A;  1KFY A;  4H50 A;  4J1O A;  1H86 A;  3V76 A;  1L9E A;  2IID A;  7ENL A;  1Y56 B;  1LTX R;  3NK1 X;  4OVI A;  3ADA B;  4GIS A;  3GRT A;  4GGH A;  2BC0 A;  3DDM A;  3P9U A;  4EM4 A;  4XWZ A;  4II2 A;  2WDQ A;  1GEU A;  2PP1 A;  3KVE A;  3MY9 A;  1E39 A;  3GO2 A;  3M13 A;  1K4Q A;  3GMB A;  4U8L A;  4EMJ A;  2WP5 A;  2BK3 A;  2Y6R A;  3RIT A;  3DJE A;  3NTD A;  4ZOH B;  4AOX A;  3DK9 A;  2B7S A;  3NVZ B;  4DXK A;  2ZAD A;  3DGH A;  2XH4 A;  3G5Q A;  2PU1 A;  4IHC A;  1RP0 A;  2X8C A;  2XFQ A;  3AE5 A;  2FKP A;  4GDP A;  3ZDN A;  2GR1 A;  3CNT A;  5G5G B;  3VCC A;  1GSN A;  4MJW A;  4LII A;  1XPY A;  4OPG A;  4UDQ A;  3T9P A;  1FEB A;  1E1M A;  4J2W A;  1ZKQ A;  5CKU A;  1JPM A;  1O94 A;  2OG9 A;  1BZL A;  1RVK A;  3NN6 X;  3C4A A;  4DNA A;  2WP9 A;  1NHP A;  1Z6L A;  1N5X A;  3LZW A;  3IJQ A;  2GAG B;  1W4X A;  2XGZ A;  1ZOV A;  4HCL A;  3VRA A;  1F3P A;  3VR8 A;  4OPU A;  1JEH A;  4I58 A;  2XSX A;  2YLZ A;  3OZ2 A;  4H1Z A;  3MKC A;  3SZC A;  1LQU A;  4GYP A;  2R4E A;  3AE3 A;  4OCG A;  3NS1 B;  4X9N A;  2EQ7 A;  3GD6 A;  4FDC B;  1QJD A;  1PBC A;  3ABV A;  1PDH A;  4Z17 A;  2XH0 A;  2YG7 A;  4H2R A;  1GET A;  5JCI A;  3AEC A;  3FXG A;  1TZZ A;  1E1K A;  2VZ2 A;  4UDR A;  1JDF A;  2V3B A;  4AP3 A;  3V5C A;  2POD A;  4A99 A;  3P93 A;  3SJN A;  1YKJ A;  2E5V A;  1Y0P A;  1H7W A;  3ZVH A;  3I6D A;  3UCC A;  3SR6 B;  4J36 A;  3QTP A;  3LXD A;  1FHV A;  3NVY B;  1FEA A;  4H19 A;  3FMW A;  4GIR A;  1MDR A;  2V3A A;  1N4U A;  2WOW A;  2Q0L A;  4TVY A;  4MKS A;  1STZ A;  2JBV A;  3DFY A;  4H4S A;  3BNU A;  4N9X A;  2BAB A;  1CHU A;  1JRZ A;  3L1R A;  3HYX A;  2QDE A;  1ZK7 A;  2WOV A;  3KD9 A;  4K2X A;  2RDX A;  3OC4 A;  1X31 B;  1MXT A;  3DME A;  4K22 A;  1SJA A;  3UXK A;  2FJE A;  3SN4 A;  1IUU A;  1VQW A;  3ES8 A;  3CMM A;  3F8R A;  1PJ5 A;  4ZN0 A;  2XYO A;  1E9I A;  3PWG A;  2HZG A;  2XFU A;  5J04 A;  4JNA A;  4DGK A;  1CL0 A;  3UTE A;  3QN3 A;  2YR6 A;  4JQ9 A;  3QJ4 A;  4HB9 A;  1RSG A;  2R46 A;  2JB3 A;  3NRN A;  2TPR A;  3FV9 A;  3AWI A;  3I3L A;  5IDZ A;  4YTP A;  3RRA A;  4B69 A;  3URH A;  2VVM A;  1GXF A;  1YY5 A;  4IP5 A;  4NNJ A;  2YM1 A;  3NHO X;  1YQ3 A;  3UJF A;  1PDY A;  1F8R A;  3AN1 A;  3NO1 A;  2XFN A;  3AMZ A;  3GWF A;  1S3B A;  3GY1 A;  2B9W A;  2EQ8 A;  3H12 A;  1YQ4 A;  2AKM A;  1PXB A;  2A89 A;  2BYB A;  4JDR A;  1F8W A;  1TKK A;  4E0V A;  4YT0 A;  1BKW A;  3GDP A;  3JVA A;  1CJ2 A;  4H4V A;  4H4U A;  1NEL A;  3O0H A;  3SQS A;  1EL9 A;  4P9S A;  4D04 A;  4E4U A;  1ONE A;  2GR3 A;  3OP2 A;  2DW6 A;  2I5Q A;  2C65 A;  2WDV A;  5M0Z A;  3B97 A;  1LJ1 A;  2YR5 A;  4U8K A;  4EQX A;  4HNL A;  3AYI A;  3UKL A;  4ZCW A;  3RP7 A;  3PO7 A;  2GR2 A;  2IVE A;  4HN8 A;  2BXR A;  1TDK A;  4A5L A;  4EMI A;  3CXB A;  1DXL A;  1DJQ A;  2NVK X;  4GAP A;  3JZU A;  3E1T A;  2B9X A;  2FJA A;  3UGV A;  2C72 A;  4II3 A;  3Q9T A;  2XLP A;  4GUV A;  4HNC A;  1L9D A;  2CHR A;  5FS9 A;  3CPI G;  3WE0 A;  1FFV C;  2EQ9 A;  3VA8 A;  4H4R A;  4J33 A;  1D7L A;  3GSI A;  4H2N A;  1PDZ A;  4TM3 A;  4B66 A;  2OPJ A;  1KSU A;  5KNL A;  4K5R A;  3ES7 A;  1FHU A;  1GRT A;  4K7Z A;  2Q6U A;  2OA1 A;  3N4F A;  2R45 A;  3T2Z A;  1LPF A;  5U25 A;  2XLT A;  3RNM A;  3UP5 A;  1P48 A;  5KMP A;  4HCD A;  1GAL A;  3AEG A;  1B37 A;  1E7P A;  4FX9 A;  4A6G A;  3ITJ A;  3TOY A;  3AE9 A;  3B3R A;  1NU5 A;  4Y4M A;  4KEM A;  4U8N A;  1OJA A;  1TDF A;  2OFJ A;  5EB5 A;  2YAU A;  3JW7 A;  1EC8 A;  3NTA A;  2NQL A;  3DGB A;  2YG6 A;  1ZY8 A;  3HRD C;  1L9C A;  3N6J A;  3NH3 X;  3CXO A;  4ENL A;  1PXA A;  2PYX A;  4A6N B;  2X8G A;  4HPN A;  2R0G A;  1EC9 A;  4CNK A;  3AYL A;  4O5Q A;  1MUC A;  3D8X A;  4JN8 A;  4DYE A;  2ZZC A;  5J7X A;  3CNS A;  3GDN A;  2E1M A;  5HY5 A;  3U4F A;  2XVF A;  5KOW A;  5BOF A;  1DNC A;  4YWO A;  2WP6 A;  2QGY A;  1KN0 A;  4GME A;  1Y56 A;  3GD3 A;  2B7R A;  1GRA A;  3UJR A;  3Q4D A;  4BV6 A;  2R0C A;  4C5O A;  3U9I A;  2DKH A;  3KU9 A;  2QJM A;  3ALM A;  4FK1 A;  3T31 A;  2B76 A;  4HYR A;  4U8O A;  4KWS A;  4J31 A;  3ISH A;  3ZLF A;  3SXI A;  4IA6 A;  3HYV A;  2GAH B;  3N4E A;  3S47 A;  3QFA A;  4G74 A;  3QVP A;  2QA2 A;  1GRG A;  1EC7 A;  4H4P A;  1IUV A;  3CAW A;  3PG6 A;  2OLA A;  3CGC A;  2WES A;  2BCG G;  1KKR A;  3IWA A;  1M64 A;  3B6D A;  4BJZ A;  2VQ7 A;  1S2Q A;  5KVH A;  2VOU A;  2GQW A;  2JKC A;  1ONF A;  2GEW A;  4J3Z A;  3N6H A;  2AL2 B;  5U63 A;  3SX6 A;  3CT2 A;  4TLX A;  3T14 A;  3R07 C;  2BK5 A;  2RGH A;  3P1W A;  3OW1 A;  3P4P A;  2PPG A;  2BK4 A;  3DG7 A;  4Z2T A;  2XFO A;  2YLS A;  3FJ4 A;  2YG5 A;  1PS9 A;  2P3Z A;  3V5F A;  3RGT A;  3FG2 P;  3IJL A;  2PTZ A;  1X2H A;  3UKH A;  1FO4 A;  1GRE A;  1TYT A;  4G6H A;  2PGE A;  4RG4 A;  2OX4 A;  3KPK A;  3DG3 A;  1JU2 A;  3TWB A;  4X4J A;  5FJT A;  3CNJ A;  3Q45 A;  1EBG A;  3QVR A;  1ELS A;  1L8P A;  2XVH A;  3R10 A;  2WEU A;  4YXD A;  4ECH A;  3ATR A;  1R6W A;  3I4K A;  5FJR A;  2WPF A;  2E4G A;  3SN0 A;  5FJO A;  1KKO A;  4GF7 A;  3T37 A;  3CIR A;  3G5S A;  4MMW A;  3ALJ A;  3EPT A;  1FFU C;  4A79 A;  4NZH A;  1WUE A;  2XCG A;  5GSN A;  2C3D A;  2CVJ A;  2JK6 A;  5JCN A;  2O9Z A;  2QQ6 A;  3QSE A;  4H7U A;  1GTE A;  1ZMD A;  2QDD A;  4B65 A;  3T0K A;  3UCD A;  1MOK A;  4J57 A;  1QO8 A;  3II4 A;  2WU5 A;  1KDG A;  4C77 A;  4ZCD A;  2PP0 A;  4EQS A;  4HA6 A;  1KNP A;  1SEZ A;  1H7X A;  4IT1 A;  1PBE A;  2C73 A;  1CBO A;  3T4W A;  2OQH A;  3VFC A;  3D47 A;  1V97 A;  4Z43 A;  4YWS A;  1XHC A;  3NKS A;  2X3N A;  5G5H B;  3AE8 A;  3QLD A;  3AYJ A;  2A8X A;  1JPD X;  3UTH A;  3NYF A;  1EL7 A;  1F6M A;  2MNR A;  1FL2 A;  2FJD A;  4TM1 A;  4G8T A;  5KMS A;  1RM6 B;  2V5Z A;  2GMH A;  1DTN A;  2QCU A;  4AP1 A;  4UP3 A;  4U8M A;  4E8G A;  3K7M X;  5BUL A;  1FEC A;  2BS4 A;  4GAV A;  2BRA A;  3TJI A;  4NEV A;  3T2Y A;  3RHA A;  2QVH A;  3TW9 A;  3ALL A;  3DIP A;  2E5A A;  4AT2 A;  2C75 A;  2PGW A;  4K5S A;  6ENL A;  1JNR A;  5TR3 A;  4YKG A;  1N62 C;  3AXB A;  2P8B A;  3VR9 A;  3I6T A;  1NHS A;  3F8D A;  4BJY A;  2GGE A;  3K7T A;  3ATQ A;  3DH9 A;  4G73 A;  3VCN A;  1X2G A;  4BUR A;  4CCR A;  2QA1 A;  2PS2 A;  1OJD A;  1JOA A;  2J3N A;  3FPZ A;  3LOV A;  4JNQ A;  3CGB A;  2GV8 A;  2BXS A;  4BK1 A;  2YLW A;  5KRQ A;  3UKF A;  3PWI A;  2Q0K A;  4BK2 A;  3B9J B;  3P4S A;  5FJU A;  2GMJ A;  3A7R A;  3CB3 A;  3KPF A;  2GL5 A;  4J56 A;  3CNP A;  5IQ1 A;  4DN1 A;  3FIM B;  4IP4 A;  2ZC8 A;  4DWD A;  1GND A;  3UKA A;  2C67 A;  1BWC A;  2EQ6 A;  2BC1 A;  2QJJ A;  1N63 C;  2RAB A;  2YM2 A;  5ENL A;  1WYG A;  3KUM A;  1Q1W A;  3K1G A;  2GRT A;  3CPH G;  3R9U A;  2OVL A;  1REO A;  2YG3 A;  4GGB A;  5KMQ A;  4MGG A;  1FCD A;  3UOY A;  5EOW A;  2YVG A;  2WOI A;  5JCL A;  3BI2 A;  4ZCC A;  1COY A;  1VG9 A;  3DJJ A;  3EAO A;  4U8I A;  3NZG A;  3ZLH A;  4LU6 A;  3H8L A;  1EL8 A;  3BHF A;  3GMC A;  4IVO B;  3RCY A;  4KX6 A;  4DSH A;  1VRQ B;  4BK3 A;  3NK0 X;  3C96 A;  4ADW A;  4GR1 A;  5KXJ A;  1IUX A;  4OPL A;  2YQU A;  3TJ4 A;  2PCE A;  3PK7 A;  1CF3 A;  3BI5 A;  1PN0 A;  5HXI A;  1MRA A;  1S2Y A;  1EBD A;  3NGC X;  3H8I A;  4EQW A;  2GGJ A;  3THU A;  1NEK A;  2PTY A;  4A6N A;  3NYC A;  3AD7 B;  2GF3 A;  5U1O A;  3SSZ A;  1D4C A;  3CN8 A;  3DGZ A;  4I59 A;  3UP4 A;  1ZOY A;  1ZMC A;  4PAA A;  1SJC A;  4IZG A;  3VC6 A;  2I0Z A;  3AEA A;  1GTH A;  3AEB A;  4A65 A;  1L0V A;  4CBQ A;  5KWF A;  4C3Y A;  5FS6 A;  1H6V A;  3R25 A;  4GRT A;  2V6O A;  5DBJ A;  5JCK A;  3EEZ A;  1VDV A;  3D9X A;  3V3W A;  1E6E A;  2YR4 A;  3PFR A;  3AE2 A;  1GV4 A;  4AOS A;  2VVL A;  4H4T A;  3SFE A;  2XH2 A;  1PHH A;  3CK5 A;  3H4K A;  4TVW A;  3MSY A;  4NTD A;  3T6C A;  3AE7 A;  5CQF A;  2RGO A;  3S5W A;  2VVL G;  1XPQ A;  3D1C A;  1VG0 A;  4H4Y A;  1ZXI C;  3AE6 A;  1B4V A;  3BJS A;  1XDI A;  1K0L A;  1H2I A;  2Z5Y A;  3GRS A;  1MNS A;  2GSH A;  3QFB A;  5C2T A;  3TTE A;  1SJB A;  4NTC A;  3V4B A;  4A9W A;  1N60 C;  2W55 A;  1E1L A;  3P3B A;  2XFP A;  1AOG A;  1YEY A;  2WPC A;  2BS3 A;  3PVC A;  3SM8 A;  4GYP C;  3D46 A;  4Z24 A;  3H7V A;  3MQT A;  3A7U A;  4H4W A;  2JB2 A;  1KF6 A;  3AD8 B;  3RO6 A;  3MUC A;  3S61 A;  3FYY A;  4JY2 A;  1M6I A;  3OZM A;  2GB0 A;  4ICY A;  2AL2 A;  1PBF A;  2IVD A;  1NHR A;  2O56 A;  2OKT A;  4Z26 A;  4TM4 A;  1BQG A;  1FIQ B;  2V61 A;  5GRT A;  1VDC A;  3ICR A;  3QSM A;  4JHM A;  3CTY A;  1KCZ A;  3UKK A;  3EF6 A;  4EQR A;  4CY6 A;  2F5Z A;  3BNM A;  4GDE A;  3DES A;  3UJ2 A;  1GES A;  1GOS A;  3NVV B;  3T2K A;  3R0U A;  4E5T A;  3SQP A;  3NXL A;  1H82 A;  4H4Z A;  2C4C A;  4J34 A;  5KVI A;  2Q7V A;  2R0P A;  2OAM A;  4UDP A;  3DG6 A;  1GRH A;  2OLO A;  2PTW A;  1PJ7 A;  4HCH A;  1BGJ A;  2WQY A;  2XLS A;  4DHG A;  2ZZ0 A;  5JRB A;  1N4W A;  2AL1 A;  4XXG A;  3HW2 A;  1O95 A;  1LVL A;  4M6U A;  4H83 A;  3UXL A;  4IL0 A;  2Y6Q A;  4Z2R A;  4NEW A;  1B5Q A;  3DJG X;  2XLU A;  3R11 A;  1GRB A;  1RYI A;  2X99 A;  2BAC A;  3UJE A;  4YSH A;  3UJS A;  4H4X A;  1JRX A;  2DW7 A;  3I6E A;  4C74 A;  2JB1 A;  2R4J A;  4JY3 A;  3UCL A;  2ACZ A;  3UOX A;  4B67 A;  3JSK A;  5KMR A;  3VQR A;  3RP8 A;  3QKE A;  2GVC A;  5BUK A;  3SGL A;  3C4N A;  2YLR A;  4NWZ A;  3IJI A;  1TE6 A;  1CC2 A;  2AR8 A;  3NK2 X;  2YVJ A;  1P2E A;  2BRY A;  4U2S A;  4YTN A;  4DSG A;  5BOE A;  3CYJ A;  3ICS A;  2HXU A;  4A3R A;  1P43 A;  2Z5X A;  4Z44 A;  2VRL A;  1IJH A;  3IHM A;  2XLR A;  2C64 A;  2R9Z A;  3LAD A;  3SZW A;  3NVW B;  2GQF A;  2X8H A;  2W0H A;  3KA7 A;  1D4D A;  2OQY A;  4YTM A;  1N4V A;  4Y4N A;  1IYX A;  2HXT A;  3IC9 A;  1ECQ A;  2RGJ A;  1V59 A;  5L46 A;  1CC4 A;  2VRM A;  3OTR A;  4RSL A;  2XVE A;  1NG4 A;  3LZX A;  3HYW A;  3NT6 A;  4O5U A;  2XH7 A;  1EBH A;  2PSN A;  3GC2 A;  2DKI A;  3AEE A;  3DK4 A;  4EIQ A;  2C7G A;  4GCM A;  1D7Y A;  4EIP A;  4M52 A;  4LA1 A;  1IUW A;  3TCS A;  3H70 A;  5M10 A;  3DK8 A;  1CJC A;  4FP1 A;  1Q1R A;  3SZ0 A;  4USR A;  3NFU A;  2ARD A;  1MDL A;  3AE1 A;  3SY4 A;  2P88 A;  2ONE A;  1P2H A;  3UKP A;  2OZ3 A;  4G6G A;  1WUF A;  1XS2 A;  1MO9 A;  1DJN A;  4KPR A;  3HPF A;  3TQP A;  4YSY A;  5FMH A;  1SJD A;  4CCQ A;  2AAQ A;  1OJC A;  4CRT A;  2YVF A;  2NPX A;  1EL5 A;  4CNJ A;  4A7A A;  1D4E A;  1TDN A;  3S5S A;  2B9Y A;  3AM9 A;  1FOH A;  4YSX A;  1N61 C;  4B1B A;  3BHK A;  2CUL A;  1HYU A;  2JAE A;  1OJT A;  1N5W C;  4H2Q A;  1R0M A;  3G5R A;  1DOC A;  2W3S A;  2C3C A;  5EB4 A;  2ZZB A;  3LB8 A;  3DA1 A;  2WET A;  2BS2 A;  3MZN A;  4JN9 A;  1S3E A;  3BI4 A;  3HZL A;  4ZA0 A;  4IA5 A;  2OZ8 A;  1TDE A;  5HYM A;  2H89 A;  5FS8 A;  3F8P A;  1B8S A;  1VQZ A;  4Z25 A;  3CND A;  1S7M A;  2GGG A;  1PBD A;  4PAB A;  1KD0 A;  2TMD A;  3CPJ G;  1TRB A;  2QJN A;  1H83 A;  1ZP0 A;  2A87 A;  2P0I A;  2VQB A;  1JNZ A;  3AEF A;  3GYJ A;  2FBW A;  1CC6 A;  1NDA A;  2WBA A;  3SFD A;  3SYI A;  3FVD A;  3NN0 X;  4CY8 A;  1LQT A;  3BOX A;  2OLN A;  3UOV A;  3UOZ A;  2GGH A;  3VC5 A;  1CJ4 A;  3PS9 A;  2YLX A;  3T8Q A;  3SN1 A;  2WHD A;  2PMQ A;  3DER A;  4M0X A;  3IHG A;  1K0J A;  1XAN A;  2WU2 A;  3ZVH B;  2PA6 A;  5BRT A;  3QPE A;  3ETR B;  1NEN A;  1O5W A;  2PHH A;  1TYP A;  2POZ A;  2PTX A;  4IVM B;  2PU0 A;  4FK1 C;  1ZX9 A;  3A7A A;  1BGN A;  2GH5 A;  3LJP A;  4K2S A;  4TLZ A;  4YSZ A;  1N1P A;  5LV9 A;  4USQ A;  2AKZ A;  4B63 A;  3H8A A;  1Q9I A;  3BSM A;  3OZY A;  3KKJ A;  4G7F A;  2QAE A;  3GD4 A;  1NAA A;  4OPI A;  4A35 A;  1KSS A;  3NNE A;  2UZZ A;  1NPX A;  1IUT A;  2OZT A;  1JRP A;  2AQJ A;  3CGD A;  3UKQ A;  3DJD A;  3UTG A;  3M0O A;  3K30 A;  4Z2U A;  3UTF A;  3ICT A;  2YLT A;  2FJB A;  3NYE A;  1JRY A;  3ZVI A;  1PBB A;  3AE4 A;  2W3R A;  3GYX A;  2CFY A;  4K1W A;  4U8J A;  4H2P A;  5KOX A;  1DOB A;  4EWJ A;  2GR0 A;  1NG3 A;  3P4R A;  4EM3 A;  4H2H A;  5ER0 A;  2W54 A;  3K7Q X;  2YWL A;  1H81 A;  4AT0 A;  5C3J A;  1QLB A;  4U2L A;  1NHQ A;  3AED A;  2ZBW A;  3FCP A;  2C66 A;  2WPE A;  3QSS A;  1OJ9 A;  3R0K A;  1F8S A;  1IUS A;  5IQ4 A;  4NTE A;  1F9C A;  4B68 A;  1LV0 A;  2MUC A;  2V60 A;  1GT8 A;  1GRF A;  1OEP A;  1BF3 A;  2YG4 A;  1JCT A;  2C76 A;  2APG A;  5EU9 A;  1UKV G;  3ZLG A;  4B64 A;  3RR1 A;  5J60 A;  4WCT A;  3STP A;  2OO6 A;  4ROP A;  1ELI A;  2HNE A;  1SB3 B;  3Q6J A;  5FJP A;  4XWR A;  2GDQ A;  3RED A;  2HQM A;  5JCM A;  1ZDL A;  1K0I A;  3DFH A;  4X2P A;  4IV9 A;  3KLJ A;  3GWD A;  2P8C A;  2H88 A;  4K8G A;  4U2T A;  3ZYX A;  3DEQ A;  3AB1 A;  4WX1 A;  3NIX A;  1YQZ A;  1PJ6 A;  4Z1Y A;  3NG7 X;  4OPD A;  3TWA A;  3SBF A;  4E6M A;  1H84 A;  1DOD A;  2FYM A;  1GER A;  2BA9 A;  3L8K A;  4EMW A;  2XDO A;  1JRO A;  4APN A;  2WS3 A;  4X9M A;  3M12 A;  4RG3 A;  5IPY A;  3SZF A;  4YKF A;  3IF9 A;  4K8D A;  5FS7 A;  3ENL A; 
#chains in the Genus database with same CATH homology
 2GQF A;  2X8H A;  2W0H A;  2XVJ A;  3AYI A;  3UKL A;  3RP7 A;  3PO7 A;  1PXC A;  4U8P A;  3KA7 A;  4REK A;  2GR2 A;  2IVE A;  3VR9 A;  1NHS A;  3FBS A;  1D4D A;  3F8D A;  4YTM A;  4BJY A;  1N4V A;  4Y4N A;  3K7T A;  2BXR A;  3ATQ A;  1TDK A;  4A5L A;  3L5O A;  3DH9 A;  1CJ3 A;  4EMI A;  1DJQ A;  1DXL A;  1GPE A;  2NVK X;  4G73 A;  4GAP A;  4G9K A;  3VRB A;  3IC9 A;  3E1T A;  3EAN A;  2B9X A;  4BUR A;  2FJA A;  3V3N A;  4CCR A;  2RGJ A;  3P4Q A;  2QA1 A;  1V59 A;  3COX A;  2C70 A;  2BCP A;  5L46 A;  1OJD A;  4OPC A;  1JOA A;  2J3N A;  2C72 A;  3FPZ A;  4II3 A;  4OPT A;  1KNR A;  1CC4 A;  3LOV A;  4JNQ A;  3Q9T A;  3CGB A;  2GV8 A;  2BXS A;  2XLP A;  4GUV A;  2VRM A;  4BK1 A;  2YLW A;  5KRQ A;  3NLC A;  5BVA A;  4RSL A;  4Y4L A;  3UKF A;  1D5T A;  3GYI A;  2Q0K A;  2XVE A;  4BK2 A;  1L9D A;  5FS9 A;  1NG4 A;  3CPI G;  3WE0 A;  3LZX A;  3P4S A;  2EQ9 A;  4H4R A;  4J33 A;  3HYW A;  3V3O A;  3NT6 A;  4O5U A;  2GMJ A;  1D7L A;  3GSI A;  3KPF A;  2DKI A;  3AEE A;  2OAL A;  4H2N A;  3DK4 A;  1DOE A;  4TM3 A;  4B66 A;  4J56 A;  4EIQ A;  1KSU A;  2X50 A;  3CNP A;  2C7G A;  5IQ1 A;  4GCM A;  5KNL A;  4H4Q A;  3FIM B;  1D7Y A;  2WDR A;  4K5R A;  4M52 A;  4EIP A;  4LA1 A;  1GRT A;  4K7Z A;  5HHF A;  2Q6U A;  1IUW A;  2XVI A;  4TM0 A;  1GND A;  2OA1 A;  3UKA A;  2R45 A;  3T2Z A;  1LPF A;  2C67 A;  5M10 A;  1BWC A;  3DK8 A;  5U25 A;  1CJC A;  1Q1R A;  4D03 A;  2EQ6 A;  2XLT A;  1E1N A;  2BC1 A;  3SZ0 A;  3AD9 B;  3RNM A;  5EBK A;  3CGE A;  4USR A;  3UP5 A;  2ARD A;  1TDO A;  3RP6 A;  5KMP A;  3AE1 A;  3VRD B;  3SY4 A;  1GAL A;  3AEG A;  1B37 A;  1E7P A;  2RAB A;  2CDU A;  4FX9 A;  2YM2 A;  1P2H A;  1KFY A;  3ITJ A;  3UKP A;  3AE9 A;  3B3R A;  1Q1W A;  4H50 A;  4Y4M A;  1H86 A;  4U8N A;  3V76 A;  2GRT A;  1L9E A;  2IID A;  1OJA A;  1TDF A;  3CPH G;  4G6G A;  3R9U A;  5EB5 A;  2YAU A;  1Y56 B;  1LTX R;  3NK1 X;  1REO A;  2YG3 A;  4OVI A;  3ADA B;  1MO9 A;  1DJN A;  3NTA A;  5KMQ A;  1FCD A;  4KPR A;  3UOY A;  5EOW A;  2YVG A;  3GRT A;  2YG6 A;  1ZY8 A;  2BC0 A;  1L9C A;  3P9U A;  2WOI A;  3NH3 X;  5JCL A;  4EM4 A;  3BI2 A;  4XWZ A;  4ZCC A;  4II2 A;  1COY A;  2WDQ A;  1VG9 A;  1GEU A;  1PXA A;  4YSY A;  3KVE A;  5FMH A;  3DJJ A;  3EAO A;  2PYX A;  4A6N B;  1E39 A;  4CCQ A;  3M13 A;  2AAQ A;  2X8G A;  1OJC A;  1K4Q A;  2YVF A;  2NPX A;  3GMB A;  4U8I A;  4CRT A;  1EL5 A;  4U8L A;  4LU6 A;  4EMJ A;  2WP5 A;  2BK3 A;  2Y6R A;  3H8L A;  2R0G A;  4CNJ A;  4A7A A;  1D4E A;  1EL8 A;  1TDN A;  3DJE A;  3NTD A;  4AOX A;  3DK9 A;  2B9Y A;  4CNK A;  3AYL A;  4O5Q A;  2B7S A;  1FOH A;  4YSX A;  3D8X A;  3BHF A;  3GMC A;  4IVO B;  3BHK A;  2CUL A;  4B1B A;  1HYU A;  3DGH A;  4KX6 A;  2JAE A;  2ZZC A;  1OJT A;  5J7X A;  4DSH A;  3G5Q A;  1VRQ B;  4H2Q A;  3NK0 X;  4BK3 A;  3CNS A;  3C96 A;  1DOC A;  3G5R A;  4ADW A;  2C3C A;  4GR1 A;  5EB4 A;  2ZZB A;  1RP0 A;  3LB8 A;  3DA1 A;  2WET A;  2BS2 A;  1IUX A;  2X8C A;  5KXJ A;  2XFQ A;  3GDN A;  4OPL A;  3AE5 A;  2YQU A;  2E1M A;  4GDP A;  4JN9 A;  3ZDN A;  5HY5 A;  2GR1 A;  1S3E A;  2XVF A;  3BI4 A;  3CNT A;  5KOW A;  1DNC A;  4YWO A;  1CF3 A;  2WP6 A;  3HZL A;  1KN0 A;  3BI5 A;  1Y56 A;  1GSN A;  3GD3 A;  2B7R A;  4IA5 A;  1GRA A;  4MJW A;  1PN0 A;  4LII A;  1TDE A;  5HYM A;  2H89 A;  4OPG A;  5HXI A;  4UDQ A;  5FS8 A;  3F8P A;  1S2Y A;  1B8S A;  1FEB A;  1EBD A;  4Z25 A;  4BV6 A;  2R0C A;  4C5O A;  1E1M A;  3CND A;  3NGC X;  3H8I A;  2DKH A;  1S7M A;  3KU9 A;  4J2W A;  1PBD A;  4PAB A;  4EQW A;  3ALM A;  1ZKQ A;  2TMD A;  3CPJ G;  4FK1 A;  1TRB A;  5CKU A;  1O94 A;  3T31 A;  1NEK A;  1H83 A;  4A6N A;  1BZL A;  3NYC A;  1ZP0 A;  2A87 A;  2B76 A;  4U8O A;  3NN6 X;  3AD7 B;  3C4A A;  2VQB A;  4DNA A;  2WP9 A;  1NHP A;  1JNZ A;  5U1O A;  2GF3 A;  1Z6L A;  3AEF A;  3GYJ A;  2FBW A;  4J31 A;  3ISH A;  1CC6 A;  1NDA A;  1D4C A;  3SXI A;  2WBA A;  4IA6 A;  3CN8 A;  3LZW A;  3DGZ A;  2GAG B;  3NN0 X;  3SFD A;  3SYI A;  1LQT A;  4I59 A;  3UP4 A;  4CY8 A;  1W4X A;  2OLN A;  3HYV A;  1ZOY A;  2GAH B;  1ZMC A;  3UOV A;  1ZOV A;  4PAA A;  3UOZ A;  3VRA A;  1F3P A;  3VR8 A;  1CJ4 A;  3PS9 A;  3QFA A;  3AEB A;  2I0Z A;  2QA2 A;  1GTH A;  2YLX A;  3AEA A;  3QVP A;  1JEH A;  4G74 A;  2WHD A;  1GRG A;  4OPU A;  1L0V A;  4CBQ A;  5KWF A;  4H4P A;  1IUV A;  4I58 A;  4C3Y A;  5FS6 A;  1H6V A;  3PG6 A;  2YLZ A;  3CGC A;  3OZ2 A;  2WES A;  3IHG A;  4GRT A;  2V6O A;  5DBJ A;  1K0J A;  1XAN A;  5JCK A;  2BCG G;  2YR4 A;  3D9X A;  1E6E A;  2WU2 A;  3SZC A;  3AE2 A;  1LQU A;  1GV4 A;  5BRT A;  3IWA A;  1M64 A;  3B6D A;  4AOS A;  2VVL A;  4H4T A;  2R4E A;  4BJZ A;  3AE3 A;  2VQ7 A;  3SFE A;  1S2Q A;  1PHH A;  4OCG A;  5KVH A;  1NEN A;  2VOU A;  1O5W A;  4X9N A;  2PHH A;  2EQ7 A;  4FDC B;  1TYP A;  2GQW A;  1QJD A;  4IVM B;  1PBC A;  4FK1 C;  1ZX9 A;  3H4K A;  2JKC A;  1PDH A;  3ABV A;  1ONF A;  4NTD A;  2GEW A;  1BGN A;  3AE7 A;  5CQF A;  2GH5 A;  2RGO A;  2YG7 A;  1GET A;  4H2R A;  5U63 A;  2VVL G;  3S5W A;  3LJP A;  1XPQ A;  5JCI A;  3AEC A;  4TLZ A;  4YSZ A;  3D1C A;  3SX6 A;  4C3X A;  1N1P A;  1VG0 A;  4H4Y A;  5LV9 A;  1E1K A;  4TLX A;  3T14 A;  4USQ A;  4B63 A;  2BK5 A;  2VZ2 A;  2RGH A;  1B4V A;  3AE6 A;  1XDI A;  1K0L A;  1Q9I A;  1H2I A;  3P1W A;  4UDR A;  2Z5Y A;  3KKJ A;  3GRS A;  2QAE A;  3GD4 A;  3P4P A;  2V3B A;  1NAA A;  4AP3 A;  3QFB A;  2BK4 A;  5C2T A;  4Z2T A;  2XFO A;  2YLS A;  4OPI A;  4NTC A;  4A99 A;  4A65 A;  1KSS A;  4A9W A;  4ZCD A;  3NNE A;  2YG5 A;  1YKJ A;  2UZZ A;  1NPX A;  1E1L A;  3SZW A;  1IUT A;  2E5V A;  1PS9 A;  1H7W A;  1Y0P A;  2XFP A;  1AOG A;  3I6D A;  2WPC A;  2BS3 A;  3PVC A;  3SM8 A;  3FG2 P;  2AQJ A;  4J36 A;  3CGD A;  3LXD A;  3UKQ A;  3DJD A;  4Z24 A;  3UKH A;  3UTG A;  1FEA A;  1GRE A;  1TYT A;  3M0O A;  3K30 A;  4Z2U A;  4H4W A;  2JB2 A;  3FMW A;  1KF6 A;  4G6H A;  3AD8 B;  2V3A A;  3UTF A;  4RG4 A;  3ICT A;  2YLT A;  1N4U A;  2FJB A;  3NYE A;  1JRY A;  2WOW A;  3KPK A;  3S61 A;  2Q0L A;  4JY2 A;  1JU2 A;  1M6I A;  1PBB A;  2GB0 A;  4ICY A;  1PBF A;  2IVD A;  4X4J A;  2JBV A;  3AE4 A;  1NHR A;  4H4S A;  3CNJ A;  3BNU A;  2BAB A;  4N9X A;  3GYX A;  3QVR A;  2CFY A;  1CHU A;  1JRZ A;  4Z26 A;  2XVH A;  2WEU A;  4U8J A;  4TM4 A;  4YXD A;  3L1R A;  4H2P A;  4ECH A;  1DOB A;  3HYX A;  3ATR A;  5KOX A;  1ZK7 A;  2GR0 A;  1NG3 A;  2WOV A;  4EM3 A;  2V61 A;  3P4R A;  5ER0 A;  2WPF A;  2E4G A;  3KD9 A;  4K2X A;  5GRT A;  1VDC A;  3ICR A;  3K7Q X;  2YWL A;  3QSM A;  1H81 A;  4GF7 A;  3OC4 A;  3T37 A;  3CTY A;  1X31 B;  3CIR A;  4AT0 A;  1MXT A;  3G5S A;  5C3J A;  1QLB A;  3ALJ A;  3UKK A;  4U2L A;  3DME A;  1NHQ A;  3EPT A;  4K22 A;  3AED A;  3EF6 A;  2FJE A;  2ZBW A;  4EQR A;  4CY6 A;  2F5Z A;  3BNM A;  1IUU A;  4A79 A;  4GDE A;  2C66 A;  4NZH A;  1VQW A;  1GES A;  2WPE A;  1GOS A;  3CMM A;  3F8R A;  3QSS A;  2XCG A;  1PJ5 A;  1OJ9 A;  3T2K A;  4ZN0 A;  2XYO A;  3SQP A;  1F8S A;  5GSN A;  2C3D A;  2CVJ A;  2JK6 A;  5JCN A;  1H82 A;  2XFU A;  4H4Z A;  2O9Z A;  1IUS A;  5IQ4 A;  2C4C A;  4J34 A;  4NTE A;  3QSE A;  4H7U A;  5KVI A;  2Q7V A;  4JNA A;  2R0P A;  1GTE A;  2OAM A;  4DGK A;  4B68 A;  1CL0 A;  4UDP A;  1ZMD A;  1LV0 A;  1GRH A;  3T0K A;  3UTE A;  4B65 A;  2V60 A;  2OLO A;  2YR6 A;  1MOK A;  4J57 A;  4JQ9 A;  1PJ7 A;  1GT8 A;  1QO8 A;  3II4 A;  2WU5 A;  1BGJ A;  3QJ4 A;  1GRF A;  1KDG A;  4C77 A;  1RSG A;  1BF3 A;  4HB9 A;  2YG4 A;  2WQY A;  2R46 A;  4EQS A;  4HA6 A;  2JB3 A;  2XLS A;  2C76 A;  2ZZ0 A;  1KNP A;  3NRN A;  2APG A;  5JRB A;  2TPR A;  1N4W A;  3AWI A;  3I3L A;  4YTP A;  4XXG A;  1O95 A;  1SEZ A;  1H7X A;  3URH A;  2VVM A;  4B69 A;  1LVL A;  1GXF A;  1PBE A;  2C73 A;  1CBO A;  2Y6Q A;  1UKV G;  4Z2R A;  4NEW A;  1YY5 A;  4B64 A;  4Z43 A;  1B5Q A;  5J60 A;  4NNJ A;  4WCT A;  1XHC A;  3DJG X;  2XLU A;  2YM1 A;  3NHO X;  3NKS A;  1GRB A;  1ELI A;  2X3N A;  3AE8 A;  1YQ3 A;  1RYI A;  2X99 A;  2BAC A;  1F8R A;  3AYJ A;  2A8X A;  3Q6J A;  4YSH A;  4H4X A;  1JRX A;  2XFN A;  3UTH A;  3GWF A;  4XWR A;  3NYF A;  4C74 A;  2JB1 A;  2R4J A;  1S3B A;  1EL7 A;  1F6M A;  1FL2 A;  4JY3 A;  3RED A;  2HQM A;  5JCM A;  1ZDL A;  2EQ8 A;  2ACZ A;  2B9W A;  1K0I A;  2FJD A;  3UCL A;  3UOX A;  4TM1 A;  4B67 A;  3JSK A;  5KMR A;  4IV9 A;  5KMS A;  3VQR A;  3RP8 A;  2V5Z A;  2GVC A;  3KLJ A;  1YQ4 A;  2GMH A;  3C4N A;  2YLR A;  3SGL A;  5BUK A;  4NWZ A;  3GWD A;  1PXB A;  2QCU A;  4AP1 A;  2H88 A;  4UP3 A;  4U8M A;  4U2T A;  1CC2 A;  2A89 A;  3K7M X;  5BUL A;  3ZYX A;  2BYB A;  4JDR A;  3AB1 A;  4WX1 A;  3NIX A;  1FEC A;  1YQZ A;  1F8W A;  2AR8 A;  1PJ6 A;  2BS4 A;  3NG7 X;  4OPD A;  3NK2 X;  4E0V A;  4YT0 A;  2YVJ A;  4GAV A;  1P2E A;  1BKW A;  3GDP A;  1CJ2 A;  4H4V A;  2BRY A;  4U2S A;  4YTN A;  1H84 A;  2BRA A;  4DSG A;  4H4U A;  3O0H A;  4NEV A;  3T2Y A;  3RHA A;  3ICS A;  1DOD A;  1EL9 A;  4P9S A;  1GER A;  3ALL A;  2BA9 A;  2Z5X A;  4Z44 A;  4D04 A;  3L8K A;  4EMW A;  2VRL A;  2GR3 A;  2XDO A;  4APN A;  2WS3 A;  4AT2 A;  1IJH A;  2C75 A;  4X9M A;  3IHM A;  3M12 A;  2XLR A;  2C65 A;  4K5S A;  4RG3 A;  5IPY A;  1JNR A;  2WDV A;  5TR3 A;  5M0Z A;  2C64 A;  4YKG A;  3SZF A;  4YKF A;  3AXB A;  2R9Z A;  3IF9 A;  3LAD A;  4K8D A;  1LJ1 A;  2YR5 A;  4U8K A;  4EQX A;  5FS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...