5FMHA

Crystal structure of the e405k mutant of human apoptosis inducing factor
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
486
structure length
472
Chain Sequence
APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVKLAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Novel Mutation in Aifm1
rcsb
source organism Homo sapiens
total genus 154
structure length 472
sequence length 486
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fmhA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fmhA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fmhA01
4EQSA 1BKWA 3ALLA 3C4NA 3UTFA 5M10A 2C67A 1KDGA 4BK1A 1S3BA 2YG6A 4Y4MA 2A87A 3L8KA 2NVKX 1DOBA 1E7PA 1NDAA 2YAUA 3CPIG 3DJGX 4IV9A 2R9ZA 2TPRA 4H4VA 2R0CA 5EB5A 1NHQA 1O5WA 2XVJA 3H8IA 3P9UA 2ACZA 2GMJA 1ZMDA 5JCMA 3E1TA 3NYEA 4BJYA 5L46A 1GESA 1DOEA 1GTHA 2E5VA 1E1NA 4CY6A 2GAHB 2BS4A 3UTHA 1K0IA 2BXSA 3G5RA 3LZWA 2GVCA 2VVLG 3QJ4A 3UP4A 1GV4A 1TDEA 2B9YA 2RGHA 1DXLA 2WPEA 1NG4A 1YQZA 3NN6X 1N4WA 4Z24A 3KA7A 4U8NA 4YWOA 2BS2A 2VVMA 3NT6A 4ZN0A 2YR5A 3NK1X 2GQFA 4IA5A 2YG7A 3VRAA 4J2WA 1JNZA 4J34A 3P4PA 3ITJA 4CRTA 4B63A 3F8PA 3SFEA 4UDRA 4GF7A 3EANA 3NYFA 1ZOYA 3UKQA 4YSHA 2FBWA 2BA9A 3M13A 3G5SA 1ZOVA 1PBEA 2B7SA 2EQ7A 1JRXA 2C3DA 1NHSA 2Q7VA 2YG4A 2XLRA 4H4SA 4Z2UA 2GH5A 1KF6A 3CIRA 3NH3X 3M12A 3V3NA 2BC1A 4H2RA 3DH9A 1IUWA 1GSNA 4Z25A 1JEHA 2WQYA 2J3NA 1ZK7A 2JAEA 4J56A 2RGJA 4XXGA 3WE0A 2GR0A 4AOSA 4GCMA 1B37A 1Q9IA 4E0VA 4OPIA 3LJPA 1OJCA 1XANA 4H7UA 2GB0A 4PABA 2YQUA 2X8GA 2GV8A 4JY2A 1GRGA 4BJZA 4B65A 1DOCA 3QSSA 1N4VA 4NTCA 2JB3A 3JSKA 4B68A 3AE5A 4Z43A 3QVRA 1CJ3A 5C2TA 1LQUA 3AXBA 4RG4A 2RABA 2B9XA 4IA6A 1NEKA 3LZXA 3ZYXA 2WU5A 3FPZA 1E1LA 4H4UA 1CC4A 1NHPA 2XFQA 3ABVA 4H4WA 3ICTA 4REKA 2ARDA 3AEBA 1IJHA 3F8RA 4BK2A 4BV6A 1DJQA 3AECA 1H86A 2XFOA 3UP5A 5TR3A 3GMBA 1F8RA 4Y4NA 3NN0X 4USQA 1YQ4A 1VQWA 3NK0X 2WOWA 3ZDNA 3UKPA 2X8HA 1E39A 1TDFA 3SFDA 4AP3A 3AEDA 1P2HA 5IPYA 2C3CA 2FJEA 1PXAA 4EIQA 4H4ZA 1LVLA 2JB2A 3DJEA 3FBSA 3SM8A 2C70A 1TDOA 3P4QA 3UOXA 2GF3A 2FJDA 1V59A 2XVEA 4D03A 4M52A 4J31A 1FECA 5EOWA 2WU2A 4H2QA 3V76A 4JDRA 2WPCA 2YLSA 4NEWA 4TLXA 2V60A 1FCDA 1S3EA 3AYJA 2ZZBA 2WP9A 1ZKQA 4OPUA 3LB8A 4APNA 4AOXA 5KWFA 1SEZA 4N9XA 4NTDA 1CF3A 1YQ3A 1ZP0A 4RSLA 4K2XA 4C5OA 3PVCA 3BI2A 2WEUA 2YR4A 2BK5A 4PAAA 3VRBA 3I3LA 3EAOA 1GRFA 1YKJA 4OPDA 1M6IA 1BGNA 5BVAA 2BACA 1K4QA 3ICRA 4Z2RA 3I6DA 2E1MA 3S61A 3UOYA 5BUKA 2CDUA 2WDQA 2YLXA 1B5QA 5KXJA 2GQWA 3CPHG 5GRTA 5FS9A 3UKLA 1M64A 5CQFA 3DJJA 1REOA 3BHKA 2FJBA 1Y0PA 4H4QA 3GRSA 1KNPA 3VR8A 2XYOA 2GRTA 3UKAA 1CJ4A 2BK3A 4OPGA 4LU6A 2PHHA 5U63A 4A9WA 2EQ6A 5JCIA 1KSUA 2C73A 4NZHA 3L1RA 3DK9A 4YTPA 3AE3A 2XLPA 4JNAA 1F8WA 1GOSA 3AE1A 3KU9A 4C74A 4H4PA 4OVIA 1H84A 2X3NA 3GSIA 4WX1A 4IVMB 5KVIA 1GREA 5ER0A 1H82A 1TYTA 5JCKA 1FEAA 4U8JA 1NG3A 3AE7A 1JOAA 3BI5A 4A79A 3KVEA 3URHA 1AOGA 3ALJA 4CCQA 1GERA 3DK8A 4LA1A 1Y56B 1EBDA 1GT8A 2BYBA 3BHFA 1DJNA 3CNTA 4DGKA 2QA1A 2C66A 4A5LA 4CY8A 1E6EA 1E1KA 1MOKA 3GDNA 1D5TA 3NTDA 3ATRA 3DGHA 4X9MA 2W0HA 3BNMA 4EQXA 3CGDA 4U8LA 1PBBA 4B66A 1NPXA 2WPFA 2E4GA 1K0JA 3UOVA 3GWDA 4YTNA 4LIIA 3UTEA 2CFYA 4P9SA 4GR1A 2BK4A 4ICYA 2YG3A 2PYXA 3NK2X 2QCUA 3ADAB 4H2NA 3H4KA 1Y56A 2RGOA 4NTEA 3CGEA 3CGBA 2WETA 2XVFA 3BNUA 4Z26A 2YVGA 2B9WA 2H89A 4NEVA 5GSNA 4Z44A 4YT0A 4TM1A 1D7YA 3IWAA 3DJDA 1RP0A 3NIXA 3K7TA 4YXDA 2I0ZA 3GD4A 2APGA 1QO8A 5CKUA 1GRBA 3CGCA 2R4EA 4OCGA 3LOVA 3F8DA 4O5UA 3RP6A 4FX9A 5HHFA 4BK3A 2XVIA 2JKCA 3BI4A 2WP6A 4J57A 4EMWA 4FK1A 4JN9A 1PJ7A 3DMEA 1QJDA 2Q0KA 2Y6RA 3GD3A 2X99A 4A7AA 3AWIA 4B64A 1PHHA 3AD8B 3S5WA 4AT2A 2WHDA 3NKSA 2BXRA 1GALA 1L9CA 1N1PA 1GNDA 3AE8A 1JU2A 1PXCA 2XLUA 1KSSA 2CVJA 2XCGA 2JB1A 2IVEA 1OJDA 4UDPA 1Z6LA 2XVHA 4GDPA 4H4YA 2YLZA 2BC0A 4YTMA 2WOVA 2VZ2A 4H4RA 5J60A 5EBKA 2V3BA 2WDRA 1YY5A 2OALA 1PBFA 3UCLA 1PBCA 4B67A 2C75A 3B6DA 1CJCA 2B7RA 1B4VA 2EQ9A 3SGLA 4H4TA 3COXA 5J7XA 3CNPA 1IUSA 4FK1C 3UKKA 2YVJA 3R9UA 1KNRA 1ZDLA 2ZZCA 3RNMA 2OLNA 3OC4A 1VRQB 2R0PA 3H8LA 4K5SA 2GEWA 2WESA 2IIDA 4GRTA 3ISHA 4TM0A 3NGCX 5M0ZA 2C76A 5KOXA 4ECHA 4I58A 1NENA 5FS8A 2VVLA 2OLOA 3NLCA 4A65A 2Z5XA 2A89A 2B76A 4YSYA 3AE6A 3AEAA 3UTGA 1GPEA 3AE2A 2VRLA 1GTEA 4HB9A 5C3JA 3CNJA 5KRQA 1XDIA 4A6NB 1MXTA 3VRDB 3CTYA 4OPLA 4DSHA 1QLBA 4U8PA 3P1WA 3C4AA 4TM4A 1D4CA 2GAGB 2CULA 2JBVA 2WS3A 2XLTA 3VQRA 3B3RA 4U2SA 4YSXA 3CN8A 4C3YA 5BULA 2QA2A 2GR1A 3GDPA 2WP5A 5HY5A 2WDVA 1EL5A 1LJ1A 2YM1A 4IVOB 3NYCA 3NNEA 1PJ6A 1S2YA 3UKFA 4EQRA 4EIPA 1ZMCA 2NPXA 3KLJA 2BABA 4A6NA 3O0HA 2XFNA 4CBQA 2DKHA 3ICSA 2YM2A 3QSEA 3II4A 1GRAA 1JRZA 2OAMA 2V3AA 1IUTA 2YVFA 1H7WA 2V5ZA 3D8XA 2GR3A 2R4JA 1RYIA 4X4JA 2AR8A 1OJ9A 1PJ5A 1UKVG 4RG3A 3RP7A 4UP3A 1VDCA 1CL0A 1MO9A 3KPFA 4TM3A 3NRNA 1GETA 5BRTA 1ZX9A 5FS7A 1W4XA 2XDOA 4OPCA 4MJWA 2X8CA 4TLZA 1CHUA 4EMJA 4H50A 2F5ZA 1H6VA 1PS9A 5FS6A 2R0GA 2VQ7A 2Y6QA 4FDCB 3GWFA 4DSGA 4Z2TA 3UKHA 1FEBA 3V3OA 4EM3A 2UZZA 1EL8A 1CJ2A 1NHRA 2R46A 3RHAA 5FMHA 4K8DA 2YG5A 5IQ4A 4U8IA 4H4XA 1OJAA 1NAAA 5EB4A 1TYPA 1H83A 3AYLA 4CCRA 1K0LA 2C7GA 2V61A 4HA6A 2AAQA 2IVDA 2VRMA 1Q1RA 3DGZA 1VG0A 5KOWA 1L0VA 3GRTA 1XPQA 2XFUA 4XWZA 4U8OA 3HZLA 1B8SA 1OJTA 1ELIA 4GUVA 2VOUA 2Z5YA 3KKJA 3KD9A 3LXDA 1EL7A 3CNSA 2Q6UA 4YKGA 1S2QA 3VR9A 1D7LA 1D4EA 1O95A 1TRBA 3FG2P 1DODA 2YWLA 3AD7B 1X31B 4KX6A 3K30A 3CPJG 3AEEA 3Q6JA 2XLSA 2YLTA 4XWRA 4U8MA 5KVHA 2GMHA 4WCTA 4B1BA 3QSMA 5JCNA 1XHCA 4U2LA 3GYIA 3EPTA 2FJAA 4J33A 5JCLA 1HYUA 1COYA 1L9DA 4ZCDA 1L9EA 2ZZ0A 1H7XA 1GRHA 2Q0LA 3G5QA 3AEGA 3C96A 4GDEA 1BZLA 2EQ8A 1JNRA 5DBJA 4EM4A 4JNQA 3RP8A 1N4UA 4O5QA 1FL2A 3AEFA 2YLRA 3IF9A 3GYJA 1LQTA 3K7MX 2C72A 3NTAA 2TMDA 3T37A 3LADA 3FMWA 2BCPA 2HQMA 3SQPA 3AE9A 3AYIA 3PO7A 2V6OA 4JQ9A 4ADWA 4AT0A 1E1MA 1IUVA 1CBOA 2C65A 1TDNA 2YR6A 4H2PA 4B69A 5U25A 3Q9TA 1PDHA 2DKIA 1GRTA 1LTXR 3QFAA 1BWCA 3DA1A 4DNAA 1Q1WA 2WOIA 1EL9A 2H88A 2XFPA 3PS9A 4USRA 3AE4A 4I59A 1LV0A 1F6MA 1BGJA 1GXFA 4YKFA 3ATQA 4KPRA 2AQJA 2JK6A 4K5RA 1O94A 4C77A 2ZBWA 5LV9A 4ZCCA 4CNJA 3QFBA 4K7ZA 3IHGA 4OPTA 4UDQA 1F3PA 1GEUA 1RSGA 1F8SA 3M0OA 1DNCA 1P2EA 3CNDA 1H81A 2C64A 3AB1A 2X50A 1PXBA 4X9NA 4BURA 1VG9A 4AP1A 1ONFA 4YSZA 4D04A 1IUXA 4EQWA 1KFYA 2GR2A 3DK4A 3FIMB 4J36A 1FOHA 1CC6A 3OZ2A 2OA1A 2VQBA 3GMCA 5HYMA 3P4SA 2WBAA 3QVPA 5U1OA 2BS3A 1D4DA 4A99A 3AD9B 1CC2A 1TDKA 1BF3A 5HXIA 3IC9A 2R45A 4JY3A 1JRYA 3P4RA 3ALMA 1PBDA 4U2TA 3NG7X 4U8KA 2A8XA 2BCGG 1ZY8A 2QAEA 1LPFA 1PN0A 2O9ZA 3UOZA 3K7QX 4EMIA 3EF6A 1IUUA 2YLWA 3IHMA 4K22A 3REDA 4C3XA 4CNKA 4Y4LA 3NHOX 3D1CA 5IQ1A
chains in the Genus database with same CATH superfamily
4EQSA 3OPSA 4H1ZA 3L8KA 1E7PA 3CPIG 3DJGX 4H4VA 1NHQA 3P9UA 3E1TA 5L46A 1GESA 1E1NA 3NVWB 2GAHB 2BS4A 3QJ4A 2VVLG 2OQYA 3UP4A 3R10A 1N4WA 4YWOA 2BS2A 3NK1X 2GQFA 4HCDA 3F8PA 3SFEA 4UDRA 3UKQA 4HYRA 3M13A 3V5CA 3G5SA 1ZOVA 2Q7VA 1KF6A 3DESA 3DH9A 1IUWA 1GSNA 2WQYA 2J3NA 2PU0A 2GR0A 3JZUA 4GCMA 3D47A 3VDGA 4B65A 4YWSA 3QSSA 4NTCA 1MDLA 3AE5A 3LZXA 3ZYXA 6ENLA 2PTZA 1NHPA 1YEYA 2XFQA 3ABVA 2ARDA 1IJHA 4BK2A 4BV6A 1DJQA 3R25A 3UP5A 1F8RA 4USQA 3NK0X 1JCTA 3SQSA 1E39A 4AP3A 5IPYA 3IJQA 1PXAA 1FO4A 2JB2A 3FVDA 3DJEA 5G5GB 2OX4A 4J31A 1FECA 2W54A 4KWSA 3V76A 2WPCA 2YLSA 1R6WA 4TLXA 2WP9A 1SEZA 1CF3A 4C5OA 2YR4A 5KMPA 3HYVA 3VCCA 4OPDA 2BACA 3SBFA 2WDQA 2YLXA 3CPHG 3QKEA 3RR1A 3QPEA 3DJJA 3SN1A 3BHKA 2FJBA 2GRTA 2EQ6A 4JNAA 4A35A 2AL2A 4C74A 3R11A 1GREA 5ER0A 1H82A 1ECQA 1FEAA 4EWJA 2OG9A 2BRAA 1E9IA 3DK8A 3ZVIA 3VA8A 4HNLA 1ZXIC 2C66A 3GDNA 3ATRA 4U8LA 1PBBA 3N6HA 2P88A 2XH2A 4YTNA 4P9SA 2PS2A 4GR1A 3HYXA 2PYXA 3ADAB 2GGEA 4NTEA 2WETA 2XVFA 3TJ4A 4TM1A 1D7YA 4O5UA 2XVIA 2XH4A 2C4CA 4JN9A 3DIPA 3DMEA 2Q0KA 2X99A 4DYEA 2QJMA 1N1PA 5FJTA 2JB1A 4IP5A 1OJDA 4H4YA 2WOVA 2VZ2A 2WDRA 1PBFA 1IUSA 2YVJA 3UGVA 1KNRA 3RNMA 2OLNA 3V4BA 4IZGA 3TCSA 5FS8A 2OLOA 2W55A 4A65A 2A89A 1GPEA 3AE2A 3NVYB 2BRYA 2QVHA 1XDIA 4A6NB 4DSHA 3CTYA 4OPLA 3C4AA 2CULA 7ENLA 3A7RA 4C3YA 3GDPA 3CK5A 1LJ1A 3SXIA 3NYCA 3OZYA 3UKFA 4EIPA 1ZMCA 2XFNA 2DKHA 2V3AA 1IUTA 2V5ZA 1JPDX 2R4JA 3JW7A 3I4KA 1GETA 5FS7A 1W4XA 3ZVHA 4MJWA 1PDZA 2F5ZA 2VQ7A 3SZ0A 4FDCB 3V3OA 3OTRA 1N5WC 3UJ2A 4K8DA 2YG5A 3DFYA 2PGEA 4IT1A 4II2A 1OJAA 2PTWA 1FFUC 2AAQA 4MKSA 2VRMA 1Q1RA 3DGZA 1L0VA 3GRTA 4XWZA 4U8OA 2OZ8A 3HZLA 1TE6A 4GUVA 2QQ6A 3FXGA 4YKGA 1X31B 3HYWA 3K30A 3AEEA 4J3ZA 2P0IA 2YLTA 3QSMA 5JCNA 3GYIA 2FJAA 1COYA 1L9DA 2DW6A 1L9EA 4ZCWA 2OQHA 1GRHA 3G5QA 3AEGA 3U9IA 1N4UA 4O5QA 3AEFA 3IF9A 4JN8A 3LADA 3AYIA 2V6OA 2C65A 4FP1A 1XS2A 1TDNA 5U25A 1BWCA 3H7VA 3GC2A 2XFPA 4USRA 2OVLA 1GXFA 3GD6A 2ZBWA 3UJEA 1F8SA 1P2EA 1H81A 1VG9A 4EQWA 1KFYA 2GR2A 3FIMB 3OZ2A 2BS3A 4GAVA 3AD9B 1TDKA 1BF3A 2CHRA 2R45A 3SZWA 3NG7X 2BCGG 3PK7A 1RVKA 3MSYA 4N9XA 3NHOX 1BKWA 3QLDA 2P8BA 3UTFA 5M10A 4IP4A 1S3BA 2A87A 1DOBA 5FJPA 1NDAA 2R0CA 5EB5A 2XVJA 1ZMDA 5JCMA 3SZFA 4BJYA 1EC7A 1GTHA 4ZOHB 3G5RA 3LZWA 1TDEA 3MWCA 2B9YA 2RGHA 1NG4A 2WPEA 1YQZA 4U8NA 4GGBA 4IA5A 2YG7A 2P8CA 4J2WA 3RO6A 4J34A 3ITJA 4CRTA 5JRBA 4GF7A 1OEPA 2XH0A 2BA9A 1KKRA 1PBEA 2EQ7A 4HN8A 1NHSA 3RGTA 4Z2UA 2GH5A 3T14A 1JEHA 4J56A 1Q9IA 3CB3A 4PABA 2YQUA 4JY2A 1GRGA 1DOCA 1N4VA 4Z43A 5C2TA 4RG4A 2RABA 3HPFA 2GGIA 3UXKA 3SY4A 3VC5A 4DN1A 3VCNA 3NN0X 3ZDNA 1VQWA 2WOWA 3UKPA 3SFDA 1P2HA 2C3CA 2FJEA 4EIQA 2FJDA 1V59A 4GIRA 4M52A 2WU2A 4F4RA 1MNSA 4JDRA 3KUMA 4NEWA 1F9CA 4OPUA 3NFUA 3LB8A 4RSLA 1ZP0A 1YQ3A 3PVCA 3BI2A 3AM9A 3I3LA 1GRFA 5BVAA 3S61A 4E6MA 3TW9A 2GQWA 3UKLA 2QDDA 1REOA 1L8PA 5G5HB 3AMZA 2XYOA 2BK3A 5U63A 2PHHA 5JCIA 4NZHA 4M0XA 1GOSA 3GSIA 1H2IA 5KVIA 5KNLA 1TYTA 5JCKA 2DW7A 1JOAA 3URHA 2PA6A 2MUCA 4CCQA 1GERA 1XPYA 1EBDA 1GT8A 2BYBA 3CNTA 2QA1A 2POZA 2PP1A 1EBGA 2W0HA 3BNMA 3CGDA 1NPXA 3SJNA 2E4GA 1K0JA 3UOVA 3UTEA 1R0MA 3H70A 3JVAA 4ICYA 2YG3A 3H4KA 2RGOA 3S47A 3BNUA 4YT0A 5GSNA 4Z44A 4K8GA 3R07C 1FHVA 3V3WA 3GD4A 3LOVA 4FX9A 3BI4A 2WP6A 4EMWA 2Y6RA 3N4EA 4KPLA 4A7AA 3AWIA 1PHHA 2OZ3A 3AD8B 3NKSA 1DTNA 1N60C 3I6TA 2BXRA 2WHDA 1JU2A 1PXCA 1KSSA 2CVJA 2IVEA 3DG7A 3R0KA 3VFCA 5BOFA 5J60A 4G74A 1PBCA 1SJBA 2C75A 1CJCA 2HNEA 3SGLA 3UKKA 2ZZCA 3OC4A 1VRQB 3H8LA 2PGWA 2GEWA 1JPMA 4ZA0A 3NGCX 4TVYA 2C76A 4I58A 4NNJA 3CMMA 2Z5XA 2GSHA 4YSYA 1GTEA 4HB9A 2OPJA 1QLBA 1KD0A 4K2SA 3P1WA 4E4FA 2JBVA 2XLTA 3HW2A 3B3RA 3CN8A 3T0KA 2WP5A 5HY5A 2WDVA 3T31A 4KT2A 3HRDC 1PJ6A 3STPA 2BABA 4A6NA 4CBQA 2YM2A 3QSEA 2OAMA 1H7WA 2YVFA 1P43A 2AKZA 1OJ9A 4RG3A 4TM3A 4OPCA 4H19A 2X8CA 1CHUA 2R0GA 2PPGA 4JN7A 3GWFA 3UKHA 4Z2TA 1N62C 3RHAA 5FMHA 4U8IA 1NAAA 5EB4A 1TYPA 4JHMA 1H83A 1K0LA 2C7GA 2V61A 4HA6A 1XPQA 1B8SA 3MQTA 5FJOA 1OJTA 2MNRA 2PU1A 3VR9A 1TRBA 2OZTA 2GDQA 3FG2P 3TQPA 2XGZA 3UJRA 3Q6JA 4XWRA 5KVHA 2GMHA 4WCTA 5KMQA 5JCLA 4ZCDA 1PDYA 2ZZ0A 1H7XA 3C96A 4JNQA 1NU5A 3CYJA 3GYXA 1LQTA 2C72A 3NXLA 3FMWA 3PO7A 2HQMA 3AE9A 1CBOA 3ZLHA 2YR6A 4B69A 4MGGA 1STZA 1PDHA 4GYPA 2DKIA 3GY1A 1LTXR 2PODA 3OZMA 3VC6A 3OW1A 4I59A 1BGJA 4YKFA 3ATQA 2AQJA 4E4UA 4OPTA 3M0OA 1F3PA 3SN4A 3SR6B 5KMRA 1EBHA 3DK4A 5BOEA 1FOHA 3FYYA 2OA1A 3P4SA 3FCPA 2QDEA 5HXIA 1JRYA 3P4RA 1VDVA 3ALMA 4U8KA 2A8XA 1LPFA 3OP2A 4EMIA 3EF6A 3IHMA 4CNKA 3REDA 2C67A 4BK1A 2YG6A 2YAUA 1FHUA 2R9ZA 3H8IA 2ACZA 2GMJA 1WUEA 3NYEA 4G7FA 3NS1B 1DOEA 4GISA 1K0IA 1DXLA 2E3TA 3NN6X 4Z24A 2YR5A 3B97A 1JNZA 3P4PA 3EANA 4YSHA 2FBWA 1W6TA 4G73A 2B7SA 1JRXA 2YG4A 3MY9A 4H4SA 3M12A 3V3NA 4H2RA 4GMEA 1ZK7A 2JAEA 4XXGA 3WE0A 1EC8A 4AOSA 4E0VA 4OPIA 3QTPA 1OJCA 1XANA 2RDXA 4H7UA 2GV8A 4Z1YA 3DERA 3JSKA 4B68A 3QVRA 1LQUA 2B9XA 4IA6A 2PP0A 4IL0A 2WU5A 3FPZA 1E1LA 1CC4A 3EKGA 4H4WA 4DWDA 4REKA 4G9KA 3AECA 1H86A 3IJLA 2XFOA 1YQ4A 3PFRA 4DX3A 2C70A 1TDOA 3P4QA 2GGJA 5EOWA 4H2QA 1MRAA 3AYJA 1FCDA 1S3EA 2GL5A 4APNA 4AOXA 3ZLFA 4K2XA 2WEUA 3VRBA 3H8AA 3EEZA 1M6IA 4TVWA 4Z2RA 2E1MA 3TTEA 1M64A 1NELA 1Y0PA 4H4QA 3GRSA 1KNPA 3UKAA 2NQLA 1CJ4A 4OPGA 1KSUA 2C73A 3L1RA 3DK9A 3AE3A 2XLPA 3THUA 3ES7A 1F8WA 3AE1A 4OVIA 1H84A 3Q4DA 4DXKA 3DFHA 4X2PA 4IVMB 3CXBA 3T2ZA 4IL2A 3MUCA 3AE7A 4A79A 3ALJA 4LA1A 1Y56B 3BHFA 4DGKA 1RM6B 3SN0A 4A5LA 1MOKA 1T3QC 2OFJA 2W3SA 3P3BA 3DGHA 4B66A 2BK4A 2XSXA 3CGEA 3CGBA 3DJDA 4YXDA 2FYMA 1QO8A 1GRBA 3CGCA 3RP6A 2JKCA 3MKCA 1TZZA 1PJ7A 4G6GA 1QJDA 3I6EA 3RCYA 1GNDA 2XLUA 2P3ZA 2XCGA 4GAPA 4UDPA 1VQZA 3T4WA 2BC0A 4YTMA 4G6HA 1YY5A 4GFIA 2B7RA 1B4VA 1WYGA 4H4TA 2GGGA 3CT2A 3R9UA 4ENLA 4FI4A 3PG6A 2IIDA 4ECHA 3DG6A 3AEAA 3DGBA 3A7UA 5C3JA 3CNJA 5KRQA 3PWGA 3VRDB 3BJSA 4U8PA 3NVVB 3K1GA 3L5OA 1D4CA 2PTYA 3A7AA 2GAGB 2WS3A 3VQRA 5BULA 2GR1A 4IVOB 1KKOA 5EU9A 3NNEA 2AL1A 3ETRB 3UJSA 2HZGA 3ICSA 3MZNA 3II4A 1GRAA 3D8XA 1RYIA 4X4JA 2AR8A 1UKVG 1VDCA 1CL0A 1MO9A 3KPFA 5BRTA 1ZX9A 2XDOA 3SX6A 3FV9A 1SJAA 4TLZA 4H50A 5FS6A 1X2HA 4DSGA 2PP3A 1EL8A 1NHRA 5IQ4A 4H4XA 4A3RA 3AYLA 4CCRA 3H12A 2IVDA 3NVZB 1ELIA 2VOUA 2Z5YA 3KKJA 3CNSA 2Q6UA 3T2YA 3CPJG 3B9JB 1XHCA 3S5SA 2Q0LA 4GDEA 1BZLA 5DBJA 4EM4A 2ONEA 3RP8A 3K7MX 3T37A 2QJJA 2BCPA 4ADWA 4JQ9A 1E1MA 4H2PA 1EC9A 3QFAA 4DNAA 1Q1WA 1EL9A 2H88A 3PS9A 4E8GA 1O94A 4C77A 2FKPA 4ZCCA 4UDQA 1DNCA 3AB1A 4X9NA 2HXTA 4BURA 1ONFA 4YSZA 4D04A 1IUXA 4J36A 1TKKA 5HYMA 1BKHA 2WBAA 3QVPA 1D4DA 3IC9A 1KN0A 4U2TA 2O9ZA 1PN0A 3UOZA 2YLWA 4K22A 4C3XA 1FFVC 4Y4LA 3D1CA 3R0UA 1ONEA 3UCDA 3ALLA 3C4NA 1KDGA 4Y4MA 3SYIA 2NVKX 4IV9A 2TPRA 1O5WA 1JRPA 4HCLA 2I5QA 2E5VA 4CY6A 2GGHA 3UTHA 4J1OA 2BXSA 2GVCA 1GV4A 3QN3A 4G8TA 3KA7A 4ROPA 3D9XA 2VVMA 3NT6A 4ZN0A 3BOXA 3VRAA 3V5FA 4B63A 3NYFA 1ZOYA 3TWBA 1S7MA 2C3DA 2XLRA 3CIRA 4H83A 3NH3X 3BSMA 2BC1A 4Z25A 4II3A 3DDMA 2RGJA 1B37A 4KEMA 3LJPA 2GB0A 2X8GA 4BJZA 2JB3A 1CJ3A 3AXBA 1NEKA 5FJUA 3UJFA 3ZLGA 4H4UA 3ICTA 1IYXA 3AEBA 3F8RA 1V97A 2W3RA 5TR3A 3GMBA 4Y4NA 2X8HA 1TDFA 3AEDA 3TWAA 4H4ZA 1MUCA 1LVLA 3FBSA 3SM8A 3UOXA 2GF3A 2XVEA 4D03A 1JROA 2AKMA 1SJDA 4GYPC 2V60A 2ZZBA 1ZKQA 1N63C 5KWFA 4NTDA 2E5AA 3N4FA 4HNCA 2BK5A 4PAAA 3EAOA 1P48A 1YKJA 2O56A 1BGNA 3ICRA 1K4QA 2AL2B 3I6DA 3UOYA 5BUKA 2QGYA 4K1WA 2CDUA 3NZGA 1B5QA 5KXJA 5GRTA 5FS9A 5CQFA 3VR8A 4H2HA 3T6CA 4LU6A 4M6UA 4A9WA 4YTPA 1N61C 3KU9A 4H4PA 2X3NA 4WX1A 5KMSA 3NO1A 4U8JA 3TOYA 3IJIA 1NG3A 3BI5A 3KVEA 1AOGA 1DJNA 4CY8A 1E6EA 1E1KA 1D5TA 2ZADA 3NTDA 4X9MA 4EQXA 3RITA 2WPFA 3GWDA 4LIIA 2CFYA 5IDZA 3FJ4A 3NK2X 2QCUA 4H2NA 1Y56A 3KPKA 4Z26A 2YVGA 2B9WA 2H89A 4NEVA 3IWAA 3NIXA 1RP0A 3K7TA 2I0ZA 2APGA 3D46A 5CKUA 2R4EA 3T2KA 4OCGA 3F8DA 2PTXA 5HHFA 3DG3A 4BK3A 4J57A 4FK1A 3GD3A 4B64A 3S5WA 4AT2A 3EUB3 1GALA 1L9CA 3AE8A 1Z6LA 2XVHA 4GDPA 2YLZA 4H4RA 5EBKA 2V3BA 1SJCA 2OALA 3UCLA 4B67A 3B6DA 2EQ9A 2ZC8A 3COXA 5J7XA 2XH7A 4E5TA 2PCEA 3CNPA 3Q45A 4FK1C 1ZDLA 4K5SA 2R0PA 2PSNA 2WESA 4GRTA 3ISHA 4TM0A 5ENLA 5M0ZA 5KOXA 3SZCA 1NENA 2VVLA 3NLCA 1JDFA 2B76A 3PWIA 3AE6A 1N5XA 3UTGA 4DHGA 2VRLA 1MXTA 3RRAA 4TM4A 4U2SA 4YSXA 3ES8A 3UCCA 2QA2A 2OO6A 1EL5A 2YM1A 3ZVHB 3R1ZA 1S2YA 3T9PA 4EQRA 3KLJA 2NPXA 4HCHA 3O0HA 3CXOA 1JRZA 2GR3A 3TJIA 1PJ5A 3RP7A 4HPNA 4UP3A 3NRNA 4EMJA 1H6VA 1PS9A 2Y6QA 1FEBA 4EM3A 2UZZA 1CJ2A 2R46A 2QJNA 3SSZA 3CAWA 3DEQA 2HXUA 5KOWA 1ELSA 1VG0A 4NWZA 2XFUA 2OLAA 3N6JA 3KD9A 3LXDA 1EL7A 1S2QA 1D7LA 1D4EA 1O95A 1DODA 2YWLA 3AD7B 4KX6A 2XLSA 3AN1A 4U8MA 4B1BA 3UXLA 3P93A 4U2LA 3EPTA 4J33A 1BQGA 1HYUA 1KCZA 2EQ8A 1JNRA 1WUFA 1FL2A 2YLRA 3NTAA 3GYJA 2TMDA 3GO2A 3SQPA 4MMWA 4AT0A 1IUVA 3U4FA 3Q9TA 1GRTA 3DA1A 3IK4A 4IHCA 2WOIA 4A6GA 1SB3B 3AE4A 1LV0A 4Z17A 1F6MA 3T8QA 4KPRA 2JK6A 4K5RA 3ENLA 1X2GA 5LV9A 4CNJA 3P0WA 3QFBA 4K7ZA 3IHGA 1GEUA 5J04A 1FIQB 1RSGA 4GGHA 3CNDA 2C64A 3NRZB 2X50A 1PXBA 4AP1A 1MDRA 1CC6A 2OKTA 2VQBA 3GMCA 2PMQA 5U1OA 4A99A 1CC2A 5FJRA 4JY3A 1PBDA 1ZY8A 2QAEA 3K7QX 1IUUA 5IQ1A
chains in the Genus database with same CATH topology
4EQSA 1BKWA 3ALLA 3C4NA 3UTFA 5M10A 2C67A 1KDGA 4BK1A 1S3BA 2YG6A 4Y4MA 2A87A 3SYIA 3L8KA 2NVKX 1DOBA 1E7PA 1NDAA 2YAUA 3CPIG 3DJGX 4IV9A 2R9ZA 2TPRA 4H4VA 2R0CA 5EB5A 1NHQA 1O5WA 2XVJA 3H8IA 3P9UA 2ACZA 2GMJA 1ZMDA 5JCMA 3E1TA 3SZFA 3NYEA 4BJYA 5L46A 1GESA 1DOEA 1GTHA 2E5VA 1E1NA 4CY6A 2GAHB 2BS4A 3UTHA 1K0IA 2BXSA 3G5RA 3LZWA 2GVCA 2VVLG 3QJ4A 3UP4A 1GV4A 1TDEA 2B9YA 2RGHA 1DXLA 2WPEA 1NG4A 1YQZA 3NN6X 1N4WA 4Z24A 3KA7A 4U8NA 4YWOA 3D9XA 2BS2A 2VVMA 3NT6A 4ZN0A 2YR5A 3NK1X 2GQFA 4IA5A 2YG7A 3VRAA 4J2WA 1JNZA 4J34A 3P4PA 3ITJA 4CRTA 5JRBA 3F8PA 3SFEA 4UDRA 4B63A 4GF7A 3EANA 3NYFA 1ZOYA 3UKQA 4YSHA 1S7MA 2FBWA 2BA9A 3M13A 4G73A 3G5SA 1ZOVA 1PBEA 2B7SA 2EQ7A 1JRXA 2C3DA 1NHSA 2Q7VA 2YG4A 2XLRA 4H4SA 4Z2UA 2GH5A 1KF6A 3CIRA 3NH3X 3M12A 3T14A 3V3NA 2BC1A 4H2RA 3DH9A 1IUWA 1GSNA 4Z25A 4II3A 1JEHA 2WQYA 2J3NA 1ZK7A 2JAEA 4J56A 2RGJA 4XXGA 3WE0A 2GR0A 4AOSA 4GCMA 1B37A 1Q9IA 4E0VA 4OPIA 3LJPA 1OJCA 1XANA 4H7UA 2GB0A 4PABA 2YQUA 2X8GA 2GV8A 4JY2A 1GRGA 4BJZA 4B65A 1DOCA 3QSSA 1N4VA 4NTCA 2JB3A 3JSKA 4B68A 3AE5A 4Z43A 3QVRA 1CJ3A 5C2TA 1LQUA 3AXBA 4RG4A 2RABA 2B9XA 4IA6A 1NEKA 3LZXA 3ZYXA 2WU5A 3FPZA 1E1LA 4H4UA 1CC4A 1NHPA 2XFQA 3ABVA 4H4WA 3ICTA 4REKA 3SY4A 2ARDA 4G9KA 3AEBA 1IJHA 3F8RA 4BK2A 4BV6A 1DJQA 3AECA 1H86A 2XFOA 3UP5A 5TR3A 3GMBA 1F8RA 4Y4NA 3NN0X 4USQA 1YQ4A 1VQWA 3NK0X 2WOWA 3ZDNA 3UKPA 2X8HA 1E39A 1TDFA 3SFDA 4AP3A 3AEDA 1P2HA 5IPYA 2C3CA 2FJEA 1PXAA 4EIQA 4H4ZA 1LVLA 2JB2A 3DJEA 3FBSA 3SM8A 2C70A 1TDOA 3P4QA 3UOXA 2GF3A 2FJDA 1V59A 2XVEA 4D03A 4M52A 4J31A 1FECA 5EOWA 2WU2A 4H2QA 3V76A 4JDRA 2WPCA 2YLSA 4NEWA 4TLXA 2V60A 1FCDA 1S3EA 3AYJA 2ZZBA 2WP9A 1ZKQA 4OPUA 3LB8A 4APNA 4AOXA 5KWFA 1SEZA 4N9XA 4NTDA 1CF3A 1YQ3A 1ZP0A 4RSLA 4K2XA 4C5OA 3PVCA 3BI2A 2WEUA 2YR4A 2BK5A 4PAAA 3VRBA 3I3LA 3EAOA 5KMPA 1GRFA 3HYVA 1YKJA 4OPDA 1M6IA 1BGNA 5BVAA 2BACA 1K4QA 3ICRA 4Z2RA 3I6DA 2E1MA 3S61A 3UOYA 5BUKA 2CDUA 2WDQA 2YLXA 1B5QA 5KXJA 2GQWA 3CPHG 5GRTA 5FS9A 3UKLA 1M64A 5CQFA 3DJJA 1REOA 3BHKA 2FJBA 1Y0PA 4H4QA 3GRSA 1KNPA 3VR8A 2XYOA 2GRTA 3UKAA 1CJ4A 2BK3A 4OPGA 4LU6A 2PHHA 5U63A 4A9WA 2EQ6A 5JCIA 1KSUA 2C73A 4NZHA 3L1RA 3DK9A 4YTPA 3AE3A 2XLPA 4JNAA 1F8WA 1GOSA 3AE1A 3KU9A 4C74A 4H4PA 4OVIA 1H84A 2X3NA 3GSIA 4WX1A 1H2IA 5KVIA 4IVMB 5KNLA 1GREA 5KMSA 5ER0A 1H82A 1TYTA 5JCKA 3T2ZA 1FEAA 4U8JA 1NG3A 3AE7A 1JOAA 3BI5A 4A79A 3KVEA 2BRAA 3URHA 1AOGA 3ALJA 4CCQA 1GERA 3DK8A 4LA1A 1Y56B 1EBDA 1GT8A 2BYBA 3BHFA 1DJNA 3CNTA 4DGKA 2QA1A 2C66A 4A5LA 4CY8A 1E6EA 1E1KA 1MOKA 3GDNA 1D5TA 3NTDA 3ATRA 3DGHA 4X9MA 2W0HA 3BNMA 4EQXA 3CGDA 4U8LA 1PBBA 4B66A 1NPXA 2WPFA 2E4GA 1K0JA 3UOVA 3GWDA 4YTNA 4LIIA 3UTEA 2CFYA 4P9SA 4GR1A 2BK4A 4ICYA 3HYXA 2YG3A 2PYXA 3NK2X 2QCUA 3ADAB 4H2NA 3H4KA 1Y56A 2RGOA 4NTEA 3CGEA 3CGBA 2WETA 2XVFA 3KPKA 3BNUA 4Z26A 2YVGA 2B9WA 2H89A 4NEVA 5GSNA 4Z44A 4YT0A 4TM1A 1D7YA 3IWAA 3DJDA 1RP0A 3NIXA 3K7TA 4YXDA 2I0ZA 3GD4A 2APGA 1QO8A 5CKUA 1GRBA 3CGCA 2R4EA 3T2KA 4OCGA 3LOVA 3F8DA 4O5UA 3RP6A 4FX9A 5HHFA 4BK3A 2XVIA 2JKCA 3BI4A 2WP6A 4J57A 4EMWA 2C4CA 4FK1A 1PJ7A 4JN9A 4G6GA 3DMEA 1QJDA 2Q0KA 2Y6RA 3GD3A 2X99A 4A7AA 3AWIA 4B64A 1PHHA 3AD8B 3S5WA 4AT2A 2WHDA 3NKSA 2BXRA 1GALA 1L9CA 1N1PA 1GNDA 3AE8A 1JU2A 1PXCA 2XLUA 1KSSA 2CVJA 2XCGA 2JB1A 2IVEA 1OJDA 4GAPA 4UDPA 1Z6LA 2XVHA 4GDPA 4H4YA 2YLZA 2BC0A 4YTMA 4G6HA 2WOVA 2VZ2A 4H4RA 5J60A 5EBKA 2V3BA 2WDRA 1YY5A 2OALA 1PBFA 3UCLA 4G74A 1PBCA 4B67A 2C75A 3B6DA 1CJCA 2B7RA 1B4VA 2EQ9A 3SGLA 4H4TA 3COXA 5J7XA 3CNPA 1IUSA 4FK1C 3UKKA 2YVJA 3R9UA 1KNRA 1ZDLA 2ZZCA 3RNMA 2OLNA 3OC4A 1VRQB 2R0PA 3H8LA 4K5SA 2GEWA 2WESA 3PG6A 2IIDA 4GRTA 3ISHA 4TM0A 3NGCX 5M0ZA 2C76A 5KOXA 3SZCA 4ECHA 4I58A 1NENA 5FS8A 2VVLA 2OLOA 3NLCA 4NNJA 3CMMA 2Z5XA 2A89A 2B76A 4A65A 4YSYA 3AE6A 3AEAA 3UTGA 1GPEA 3AE2A 2VRLA 2BRYA 1GTEA 4HB9A 5C3JA 3CNJA 5KRQA 1XDIA 4A6NB 1MXTA 3VRDB 3CTYA 4OPLA 4DSHA 1QLBA 4U8PA 3P1WA 3C4AA 4TM4A 3L5OA 1D4CA 2CULA 2GAGB 2JBVA 2WS3A 2XLTA 3VQRA 3B3RA 4U2SA 4YSXA 3CN8A 4C3YA 5BULA 2QA2A 2GR1A 3GDPA 3T0KA 2WP5A 5HY5A 2WDVA 3T31A 1EL5A 1LJ1A 2YM1A 4IVOB 3NYCA 3SXIA 3NNEA 1PJ6A 1S2YA 3UKFA 4EQRA 4EIPA 1ZMCA 2NPXA 3KLJA 2BABA 4A6NA 3O0HA 2XFNA 4CBQA 2DKHA 3ICSA 2YM2A 3QSEA 3II4A 1GRAA 1JRZA 2OAMA 2V3AA 1IUTA 2YVFA 1H7WA 2V5ZA 3D8XA 2GR3A 2R4JA 1RYIA 4X4JA 2AR8A 1OJ9A 1PJ5A 1UKVG 4RG3A 3RP7A 4UP3A 1VDCA 1CL0A 1MO9A 3KPFA 4TM3A 3NRNA 1GETA 5BRTA 1ZX9A 5FS7A 1W4XA 2XDOA 4OPCA 3SX6A 4MJWA 2X8CA 4TLZA 1CHUA 4EMJA 4H50A 2F5ZA 1H6VA 1PS9A 5FS6A 2R0GA 2VQ7A 2Y6QA 3SZ0A 4FDCB 3GWFA 4DSGA 4Z2TA 3UKHA 1FEBA 3V3OA 4EM3A 2UZZA 1EL8A 1CJ2A 1NHRA 2R46A 3RHAA 5FMHA 4K8DA 2YG5A 5IQ4A 4U8IA 4II2A 4H4XA 1OJAA 1NAAA 5EB4A 1TYPA 1H83A 3AYLA 4CCRA 1K0LA 2C7GA 2V61A 4HA6A 2AAQA 2IVDA 2VRMA 1Q1RA 3DGZA 1VG0A 5KOWA 1L0VA 3GRTA 1XPQA 4NWZA 2XFUA 4XWZA 4U8OA 3HZLA 1B8SA 1OJTA 1ELIA 4GUVA 2VOUA 2Z5YA 3KKJA 3KD9A 3LXDA 1EL7A 3CNSA 2Q6UA 4YKGA 1S2QA 3VR9A 1D7LA 1D4EA 1O95A 1TRBA 3T2YA 3FG2P 1DODA 2YWLA 3AD7B 1X31B 4KX6A 3HYWA 3K30A 3CPJG 3AEEA 3Q6JA 2XLSA 2YLTA 4XWRA 4U8MA 5KVHA 2GMHA 4WCTA 4B1BA 3QSMA 5KMQA 5JCNA 1XHCA 4U2LA 3GYIA 3EPTA 2FJAA 4J33A 5JCLA 1HYUA 1COYA 1L9DA 4ZCDA 1L9EA 2ZZ0A 1H7XA 1GRHA 2Q0LA 3G5QA 3AEGA 3C96A 4GDEA 1BZLA 2EQ8A 1JNRA 5DBJA 4EM4A 4JNQA 3RP8A 1N4UA 4O5QA 1FL2A 3AEFA 3GYXA 2YLRA 3IF9A 3GYJA 1LQTA 3K7MX 2C72A 3NTAA 2TMDA 3T37A 3LADA 3FMWA 2BCPA 2HQMA 3SQPA 3AE9A 3AYIA 3PO7A 2V6OA 4JQ9A 4ADWA 4AT0A 1E1MA 1IUVA 1CBOA 2C65A 1TDNA 2YR6A 4H2PA 4B69A 5U25A 3Q9TA 1PDHA 2DKIA 1GRTA 1LTXR 3QFAA 1BWCA 3DA1A 4DNAA 1Q1WA 2WOIA 1EL9A 2H88A 2XFPA 3PS9A 4USRA 3AE4A 4I59A 1LV0A 1F6MA 1BGJA 1GXFA 4YKFA 3ATQA 4KPRA 2AQJA 2JK6A 4K5RA 1O94A 4C77A 2ZBWA 5LV9A 4ZCCA 4CNJA 3QFBA 4K7ZA 3IHGA 4OPTA 4UDQA 1F3PA 1GEUA 1RSGA 1F8SA 3M0OA 1DNCA 1P2EA 3CNDA 1H81A 2C64A 3AB1A 2X50A 1PXBA 4X9NA 4BURA 1VG9A 4AP1A 1ONFA 4YSZA 4D04A 1IUXA 4EQWA 1KFYA 5KMRA 2GR2A 3DK4A 3FIMB 4J36A 1FOHA 1CC6A 3OZ2A 2OA1A 2VQBA 3GMCA 5HYMA 3P4SA 2WBAA 3QVPA 5U1OA 2BS3A 1D4DA 4A99A 4GAVA 3AD9B 1CC2A 1TDKA 1BF3A 5HXIA 3IC9A 2R45A 4JY3A 3SZWA 1JRYA 3P4RA 1KN0A 3ALMA 1PBDA 4U2TA 3NG7X 4U8KA 2A8XA 2BCGG 1ZY8A 2QAEA 1LPFA 1PN0A 2O9ZA 3UOZA 3K7QX 4EMIA 3EF6A 1IUUA 2YLWA 3IHMA 4K22A 3REDA 4C3XA 4CNKA 4Y4LA 3NHOX 3D1CA 5IQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQS A;  1BKW A;  3ALL A;  3C4N A;  3UTF A;  5M10 A;  2C67 A;  1KDG A;  4BK1 A;  1S3B A;  2YG6 A;  4Y4M A;  2A87 A;  3L8K A;  2NVK X;  1DOB A;  1E7P A;  1NDA A;  2YAU A;  3CPI G;  3DJG X;  4IV9 A;  2R9Z A;  2TPR A;  4H4V A;  2R0C A;  5EB5 A;  1NHQ A;  1O5W A;  2XVJ A;  3H8I A;  3P9U A;  2ACZ A;  2GMJ A;  1ZMD A;  5JCM A;  3E1T A;  3NYE A;  4BJY A;  5L46 A;  1GES A;  1DOE A;  1GTH A;  2E5V A;  1E1N A;  4CY6 A;  2GAH B;  2BS4 A;  3UTH A;  1K0I A;  2BXS A;  3G5R A;  3LZW A;  2GVC A;  2VVL G;  3QJ4 A;  3UP4 A;  1GV4 A;  1TDE A;  2B9Y A;  2RGH A;  1DXL A;  2WPE A;  1NG4 A;  1YQZ A;  3NN6 X;  1N4W A;  4Z24 A;  3KA7 A;  4U8N A;  4YWO A;  2BS2 A;  2VVM A;  3NT6 A;  4ZN0 A;  2YR5 A;  3NK1 X;  2GQF A;  4IA5 A;  2YG7 A;  3VRA A;  4J2W A;  1JNZ A;  4J34 A;  3P4P A;  3ITJ A;  4CRT A;  4B63 A;  3F8P A;  3SFE A;  4UDR A;  4GF7 A;  3EAN A;  3NYF A;  1ZOY A;  3UKQ A;  4YSH A;  2FBW A;  2BA9 A;  3M13 A;  3G5S A;  1ZOV A;  1PBE A;  2B7S A;  2EQ7 A;  1JRX A;  2C3D A;  1NHS A;  2Q7V A;  2YG4 A;  2XLR A;  4H4S A;  4Z2U A;  2GH5 A;  1KF6 A;  3CIR A;  3NH3 X;  3M12 A;  3V3N A;  2BC1 A;  4H2R A;  3DH9 A;  1IUW A;  1GSN A;  4Z25 A;  1JEH A;  2WQY A;  2J3N A;  1ZK7 A;  2JAE A;  4J56 A;  2RGJ A;  4XXG A;  3WE0 A;  2GR0 A;  4AOS A;  4GCM A;  1B37 A;  1Q9I A;  4E0V A;  4OPI A;  3LJP A;  1OJC A;  1XAN A;  4H7U A;  2GB0 A;  4PAB A;  2YQU A;  2X8G A;  2GV8 A;  4JY2 A;  1GRG A;  4BJZ A;  4B65 A;  1DOC A;  3QSS A;  1N4V A;  4NTC A;  2JB3 A;  3JSK A;  4B68 A;  3AE5 A;  4Z43 A;  3QVR A;  1CJ3 A;  5C2T A;  1LQU A;  3AXB A;  4RG4 A;  2RAB A;  2B9X A;  4IA6 A;  1NEK A;  3LZX A;  3ZYX A;  2WU5 A;  3FPZ A;  1E1L A;  4H4U A;  1CC4 A;  1NHP A;  2XFQ A;  3ABV A;  4H4W A;  3ICT A;  4REK A;  2ARD A;  3AEB A;  1IJH A;  3F8R A;  4BK2 A;  4BV6 A;  1DJQ A;  3AEC A;  1H86 A;  2XFO A;  3UP5 A;  5TR3 A;  3GMB A;  1F8R A;  4Y4N A;  3NN0 X;  4USQ A;  1YQ4 A;  1VQW A;  3NK0 X;  2WOW A;  3ZDN A;  3UKP A;  2X8H A;  1E39 A;  1TDF A;  3SFD A;  4AP3 A;  3AED A;  1P2H A;  5IPY A;  2C3C A;  2FJE A;  1PXA A;  4EIQ A;  4H4Z A;  1LVL A;  2JB2 A;  3DJE A;  3FBS A;  3SM8 A;  2C70 A;  1TDO A;  3P4Q A;  3UOX A;  2GF3 A;  2FJD A;  1V59 A;  2XVE A;  4D03 A;  4M52 A;  4J31 A;  1FEC A;  5EOW A;  2WU2 A;  4H2Q A;  3V76 A;  4JDR A;  2WPC A;  2YLS A;  4NEW A;  4TLX A;  2V60 A;  1FCD A;  1S3E A;  3AYJ A;  2ZZB A;  2WP9 A;  1ZKQ A;  4OPU A;  3LB8 A;  4APN A;  4AOX A;  5KWF A;  1SEZ A;  4N9X A;  4NTD A;  1CF3 A;  1YQ3 A;  1ZP0 A;  4RSL A;  4K2X A;  4C5O A;  3PVC A;  3BI2 A;  2WEU A;  2YR4 A;  2BK5 A;  4PAA A;  3VRB A;  3I3L A;  3EAO A;  1GRF A;  1YKJ A;  4OPD A;  1M6I A;  1BGN A;  5BVA A;  2BAC A;  1K4Q A;  3ICR A;  4Z2R A;  3I6D A;  2E1M A;  3S61 A;  3UOY A;  5BUK A;  2CDU A;  2WDQ A;  2YLX A;  1B5Q A;  5KXJ A;  2GQW A;  3CPH G;  5GRT A;  5FS9 A;  3UKL A;  1M64 A;  5CQF A;  3DJJ A;  1REO A;  3BHK A;  2FJB A;  1Y0P A;  4H4Q A;  3GRS A;  1KNP A;  3VR8 A;  2XYO A;  2GRT A;  3UKA A;  1CJ4 A;  2BK3 A;  4OPG A;  4LU6 A;  2PHH A;  5U63 A;  4A9W A;  2EQ6 A;  5JCI A;  1KSU A;  2C73 A;  4NZH A;  3L1R A;  3DK9 A;  4YTP A;  3AE3 A;  2XLP A;  4JNA A;  1F8W A;  1GOS A;  3AE1 A;  3KU9 A;  4C74 A;  4H4P A;  4OVI A;  1H84 A;  2X3N A;  3GSI A;  4WX1 A;  4IVM B;  5KVI A;  1GRE A;  5ER0 A;  1H82 A;  1TYT A;  5JCK A;  1FEA A;  4U8J A;  1NG3 A;  3AE7 A;  1JOA A;  3BI5 A;  4A79 A;  3KVE A;  3URH A;  1AOG A;  3ALJ A;  4CCQ A;  1GER A;  3DK8 A;  4LA1 A;  1Y56 B;  1EBD A;  1GT8 A;  2BYB A;  3BHF A;  1DJN A;  3CNT A;  4DGK A;  2QA1 A;  2C66 A;  4A5L A;  4CY8 A;  1E6E A;  1E1K A;  1MOK A;  3GDN A;  1D5T A;  3NTD A;  3ATR A;  3DGH A;  4X9M A;  2W0H A;  3BNM A;  4EQX A;  3CGD A;  4U8L A;  1PBB A;  4B66 A;  1NPX A;  2WPF A;  2E4G A;  1K0J A;  3UOV A;  3GWD A;  4YTN A;  4LII A;  3UTE A;  2CFY A;  4P9S A;  4GR1 A;  2BK4 A;  4ICY A;  2YG3 A;  2PYX A;  3NK2 X;  2QCU A;  3ADA B;  4H2N A;  3H4K A;  1Y56 A;  2RGO A;  4NTE A;  3CGE A;  3CGB A;  2WET A;  2XVF A;  3BNU A;  4Z26 A;  2YVG A;  2B9W A;  2H89 A;  4NEV A;  5GSN A;  4Z44 A;  4YT0 A;  4TM1 A;  1D7Y A;  3IWA A;  3DJD A;  1RP0 A;  3NIX A;  3K7T A;  4YXD A;  2I0Z A;  3GD4 A;  2APG A;  1QO8 A;  5CKU A;  1GRB A;  3CGC A;  2R4E A;  4OCG A;  3LOV A;  3F8D A;  4O5U A;  3RP6 A;  4FX9 A;  5HHF A;  4BK3 A;  2XVI A;  2JKC A;  3BI4 A;  2WP6 A;  4J57 A;  4EMW A;  4FK1 A;  4JN9 A;  1PJ7 A;  3DME A;  1QJD A;  2Q0K A;  2Y6R A;  3GD3 A;  2X99 A;  4A7A A;  3AWI A;  4B64 A;  1PHH A;  3AD8 B;  3S5W A;  4AT2 A;  2WHD A;  3NKS A;  2BXR A;  1GAL A;  1L9C A;  1N1P A;  1GND A;  3AE8 A;  1JU2 A;  1PXC A;  2XLU A;  1KSS A;  2CVJ A;  2XCG A;  2JB1 A;  2IVE A;  1OJD A;  4UDP A;  1Z6L A;  2XVH A;  4GDP A;  4H4Y A;  2YLZ A;  2BC0 A;  4YTM A;  2WOV A;  2VZ2 A;  4H4R A;  5J60 A;  5EBK A;  2V3B A;  2WDR A;  1YY5 A;  2OAL A;  1PBF A;  3UCL A;  1PBC A;  4B67 A;  2C75 A;  3B6D A;  1CJC A;  2B7R A;  1B4V A;  2EQ9 A;  3SGL A;  4H4T A;  3COX A;  5J7X A;  3CNP A;  1IUS A;  4FK1 C;  3UKK A;  2YVJ A;  3R9U A;  1KNR A;  1ZDL A;  2ZZC A;  3RNM A;  2OLN A;  3OC4 A;  1VRQ B;  2R0P A;  3H8L A;  4K5S A;  2GEW A;  2WES A;  2IID A;  4GRT A;  3ISH A;  4TM0 A;  3NGC X;  5M0Z A;  2C76 A;  5KOX A;  4ECH A;  4I58 A;  1NEN A;  5FS8 A;  2VVL A;  2OLO A;  3NLC A;  4A65 A;  2Z5X A;  2A89 A;  2B76 A;  4YSY A;  3AE6 A;  3AEA A;  3UTG A;  1GPE A;  3AE2 A;  2VRL A;  1GTE A;  4HB9 A;  5C3J A;  3CNJ A;  5KRQ A;  1XDI A;  4A6N B;  1MXT A;  3VRD B;  3CTY A;  4OPL A;  4DSH A;  1QLB A;  4U8P A;  3P1W A;  3C4A A;  4TM4 A;  1D4C A;  2GAG B;  2CUL A;  2JBV A;  2WS3 A;  2XLT A;  3VQR A;  3B3R A;  4U2S A;  4YSX A;  3CN8 A;  4C3Y A;  5BUL A;  2QA2 A;  2GR1 A;  3GDP A;  2WP5 A;  5HY5 A;  2WDV A;  1EL5 A;  1LJ1 A;  2YM1 A;  4IVO B;  3NYC A;  3NNE A;  1PJ6 A;  1S2Y A;  3UKF A;  4EQR A;  4EIP A;  1ZMC A;  2NPX A;  3KLJ A;  2BAB A;  4A6N A;  3O0H A;  2XFN A;  4CBQ A;  2DKH A;  3ICS A;  2YM2 A;  3QSE A;  3II4 A;  1GRA A;  1JRZ A;  2OAM A;  2V3A A;  1IUT A;  2YVF A;  1H7W A;  2V5Z A;  3D8X A;  2GR3 A;  2R4J A;  1RYI A;  4X4J A;  2AR8 A;  1OJ9 A;  1PJ5 A;  1UKV G;  4RG3 A;  3RP7 A;  4UP3 A;  1VDC A;  1CL0 A;  1MO9 A;  3KPF A;  4TM3 A;  3NRN A;  1GET A;  5BRT A;  1ZX9 A;  5FS7 A;  1W4X A;  2XDO A;  4OPC A;  4MJW A;  2X8C A;  4TLZ A;  1CHU A;  4EMJ A;  4H50 A;  2F5Z A;  1H6V A;  1PS9 A;  5FS6 A;  2R0G A;  2VQ7 A;  2Y6Q A;  4FDC B;  3GWF A;  4DSG A;  4Z2T A;  3UKH A;  1FEB A;  3V3O A;  4EM3 A;  2UZZ A;  1EL8 A;  1CJ2 A;  1NHR A;  2R46 A;  3RHA A;  5FMH A;  4K8D A;  2YG5 A;  5IQ4 A;  4U8I A;  4H4X A;  1OJA A;  1NAA A;  5EB4 A;  1TYP A;  1H83 A;  3AYL A;  4CCR A;  1K0L A;  2C7G A;  2V61 A;  4HA6 A;  2AAQ A;  2IVD A;  2VRM A;  1Q1R A;  3DGZ A;  1VG0 A;  5KOW A;  1L0V A;  3GRT A;  1XPQ A;  2XFU A;  4XWZ A;  4U8O A;  3HZL A;  1B8S A;  1OJT A;  1ELI A;  4GUV A;  2VOU A;  2Z5Y A;  3KKJ A;  3KD9 A;  3LXD A;  1EL7 A;  3CNS A;  2Q6U A;  4YKG A;  1S2Q A;  3VR9 A;  1D7L A;  1D4E A;  1O95 A;  1TRB A;  3FG2 P;  1DOD A;  2YWL A;  3AD7 B;  1X31 B;  4KX6 A;  3K30 A;  3CPJ G;  3AEE A;  3Q6J A;  2XLS A;  2YLT A;  4XWR A;  4U8M A;  5KVH A;  2GMH A;  4WCT A;  4B1B A;  3QSM A;  5JCN A;  1XHC A;  4U2L A;  3GYI A;  3EPT A;  2FJA A;  4J33 A;  5JCL A;  1HYU A;  1COY A;  1L9D A;  4ZCD A;  1L9E A;  2ZZ0 A;  1H7X A;  1GRH A;  2Q0L A;  3G5Q A;  3AEG A;  3C96 A;  4GDE A;  1BZL A;  2EQ8 A;  1JNR A;  5DBJ A;  4EM4 A;  4JNQ A;  3RP8 A;  1N4U A;  4O5Q A;  1FL2 A;  3AEF A;  2YLR A;  3IF9 A;  3GYJ A;  1LQT A;  3K7M X;  2C72 A;  3NTA A;  2TMD A;  3T37 A;  3LAD A;  3FMW A;  2BCP A;  2HQM A;  3SQP A;  3AE9 A;  3AYI A;  3PO7 A;  2V6O A;  4JQ9 A;  4ADW A;  4AT0 A;  1E1M A;  1IUV A;  1CBO A;  2C65 A;  1TDN A;  2YR6 A;  4H2P A;  4B69 A;  5U25 A;  3Q9T A;  1PDH A;  2DKI A;  1GRT A;  1LTX R;  3QFA A;  1BWC A;  3DA1 A;  4DNA A;  1Q1W A;  2WOI A;  1EL9 A;  2H88 A;  2XFP A;  3PS9 A;  4USR A;  3AE4 A;  4I59 A;  1LV0 A;  1F6M A;  1BGJ A;  1GXF A;  4YKF A;  3ATQ A;  4KPR A;  2AQJ A;  2JK6 A;  4K5R A;  1O94 A;  4C77 A;  2ZBW A;  5LV9 A;  4ZCC A;  4CNJ A;  3QFB A;  4K7Z A;  3IHG A;  4OPT A;  4UDQ A;  1F3P A;  1GEU A;  1RSG A;  1F8S A;  3M0O A;  1DNC A;  1P2E A;  3CND A;  1H81 A;  2C64 A;  3AB1 A;  2X50 A;  1PXB A;  4X9N A;  4BUR A;  1VG9 A;  4AP1 A;  1ONF A;  4YSZ A;  4D04 A;  1IUX A;  4EQW A;  1KFY A;  2GR2 A;  3DK4 A;  3FIM B;  4J36 A;  1FOH A;  1CC6 A;  3OZ2 A;  2OA1 A;  2VQB A;  3GMC A;  5HYM A;  3P4S A;  2WBA A;  3QVP A;  5U1O A;  2BS3 A;  1D4D A;  4A99 A;  3AD9 B;  1CC2 A;  1TDK A;  1BF3 A;  5HXI A;  3IC9 A;  2R45 A;  4JY3 A;  1JRY A;  3P4R A;  3ALM A;  1PBD A;  4U2T A;  3NG7 X;  4U8K A;  2A8X A;  2BCG G;  1ZY8 A;  2QAE A;  1LPF A;  1PN0 A;  2O9Z A;  3UOZ A;  3K7Q X;  4EMI A;  3EF6 A;  1IUU A;  2YLW A;  3IHM A;  4K22 A;  3RED A;  4C3X A;  4CNK A;  4Y4L A;  3NHO X;  3D1C A;  5IQ1 A; 
#chains in the Genus database with same CATH topology
 4EQS A;  3OPS A;  4H1Z A;  3L8K A;  1E7P A;  3CPI G;  3DJG X;  4H4V A;  1NHQ A;  3P9U A;  3E1T A;  5L46 A;  1GES A;  1E1N A;  3NVW B;  2GAH B;  2BS4 A;  3QJ4 A;  2VVL G;  2OQY A;  3UP4 A;  3R10 A;  1N4W A;  4YWO A;  2BS2 A;  3NK1 X;  2GQF A;  4HCD A;  3F8P A;  3SFE A;  4UDR A;  3UKQ A;  4HYR A;  3M13 A;  3V5C A;  3G5S A;  1ZOV A;  2Q7V A;  1KF6 A;  3DES A;  3DH9 A;  1IUW A;  1GSN A;  2WQY A;  2J3N A;  2PU0 A;  2GR0 A;  3JZU A;  4GCM A;  3D47 A;  3VDG A;  4B65 A;  4YWS A;  3QSS A;  4NTC A;  1MDL A;  3AE5 A;  3LZX A;  3ZYX A;  6ENL A;  2PTZ A;  1NHP A;  1YEY A;  2XFQ A;  3ABV A;  2ARD A;  1IJH A;  4BK2 A;  4BV6 A;  1DJQ A;  3R25 A;  3UP5 A;  1F8R A;  4USQ A;  3NK0 X;  1JCT A;  3SQS A;  1E39 A;  4AP3 A;  5IPY A;  3IJQ A;  1PXA A;  1FO4 A;  2JB2 A;  3FVD A;  3DJE A;  5G5G B;  2OX4 A;  4J31 A;  1FEC A;  2W54 A;  4KWS A;  3V76 A;  2WPC A;  2YLS A;  1R6W A;  4TLX A;  2WP9 A;  1SEZ A;  1CF3 A;  4C5O A;  2YR4 A;  5KMP A;  3HYV A;  3VCC A;  4OPD A;  2BAC A;  3SBF A;  2WDQ A;  2YLX A;  3CPH G;  3QKE A;  3RR1 A;  3QPE A;  3DJJ A;  3SN1 A;  3BHK A;  2FJB A;  2GRT A;  2EQ6 A;  4JNA A;  4A35 A;  2AL2 A;  4C74 A;  3R11 A;  1GRE A;  5ER0 A;  1H82 A;  1ECQ A;  1FEA A;  4EWJ A;  2OG9 A;  2BRA A;  1E9I A;  3DK8 A;  3ZVI A;  3VA8 A;  4HNL A;  1ZXI C;  2C66 A;  3GDN A;  3ATR A;  4U8L A;  1PBB A;  3N6H A;  2P88 A;  2XH2 A;  4YTN A;  4P9S A;  2PS2 A;  4GR1 A;  3HYX A;  2PYX A;  3ADA B;  2GGE A;  4NTE A;  2WET A;  2XVF A;  3TJ4 A;  4TM1 A;  1D7Y A;  4O5U A;  2XVI A;  2XH4 A;  2C4C A;  4JN9 A;  3DIP A;  3DME A;  2Q0K A;  2X99 A;  4DYE A;  2QJM A;  1N1P A;  5FJT A;  2JB1 A;  4IP5 A;  1OJD A;  4H4Y A;  2WOV A;  2VZ2 A;  2WDR A;  1PBF A;  1IUS A;  2YVJ A;  3UGV A;  1KNR A;  3RNM A;  2OLN A;  3V4B A;  4IZG A;  3TCS A;  5FS8 A;  2OLO A;  2W55 A;  4A65 A;  2A89 A;  1GPE A;  3AE2 A;  3NVY B;  2BRY A;  2QVH A;  1XDI A;  4A6N B;  4DSH A;  3CTY A;  4OPL A;  3C4A A;  2CUL A;  7ENL A;  3A7R A;  4C3Y A;  3GDP A;  3CK5 A;  1LJ1 A;  3SXI A;  3NYC A;  3OZY A;  3UKF A;  4EIP A;  1ZMC A;  2XFN A;  2DKH A;  2V3A A;  1IUT A;  2V5Z A;  1JPD X;  2R4J A;  3JW7 A;  3I4K A;  1GET A;  5FS7 A;  1W4X A;  3ZVH A;  4MJW A;  1PDZ A;  2F5Z A;  2VQ7 A;  3SZ0 A;  4FDC B;  3V3O A;  3OTR A;  1N5W C;  3UJ2 A;  4K8D A;  2YG5 A;  3DFY A;  2PGE A;  4IT1 A;  4II2 A;  1OJA A;  2PTW A;  1FFU C;  2AAQ A;  4MKS A;  2VRM A;  1Q1R A;  3DGZ A;  1L0V A;  3GRT A;  4XWZ A;  4U8O A;  2OZ8 A;  3HZL A;  1TE6 A;  4GUV A;  2QQ6 A;  3FXG A;  4YKG A;  1X31 B;  3HYW A;  3K30 A;  3AEE A;  4J3Z A;  2P0I A;  2YLT A;  3QSM A;  5JCN A;  3GYI A;  2FJA A;  1COY A;  1L9D A;  2DW6 A;  1L9E A;  4ZCW A;  2OQH A;  1GRH A;  3G5Q A;  3AEG A;  3U9I A;  1N4U A;  4O5Q A;  3AEF A;  3IF9 A;  4JN8 A;  3LAD A;  3AYI A;  2V6O A;  2C65 A;  4FP1 A;  1XS2 A;  1TDN A;  5U25 A;  1BWC A;  3H7V A;  3GC2 A;  2XFP A;  4USR A;  2OVL A;  1GXF A;  3GD6 A;  2ZBW A;  3UJE A;  1F8S A;  1P2E A;  1H81 A;  1VG9 A;  4EQW A;  1KFY A;  2GR2 A;  3FIM B;  3OZ2 A;  2BS3 A;  4GAV A;  3AD9 B;  1TDK A;  1BF3 A;  2CHR A;  2R45 A;  3SZW A;  3NG7 X;  2BCG G;  3PK7 A;  1RVK A;  3MSY A;  4N9X A;  3NHO X;  1BKW A;  3QLD A;  2P8B A;  3UTF A;  5M10 A;  4IP4 A;  1S3B A;  2A87 A;  1DOB A;  5FJP A;  1NDA A;  2R0C A;  5EB5 A;  2XVJ A;  1ZMD A;  5JCM A;  3SZF A;  4BJY A;  1EC7 A;  1GTH A;  4ZOH B;  3G5R A;  3LZW A;  1TDE A;  3MWC A;  2B9Y A;  2RGH A;  1NG4 A;  2WPE A;  1YQZ A;  4U8N A;  4GGB A;  4IA5 A;  2YG7 A;  2P8C A;  4J2W A;  3RO6 A;  4J34 A;  3ITJ A;  4CRT A;  5JRB A;  4GF7 A;  1OEP A;  2XH0 A;  2BA9 A;  1KKR A;  1PBE A;  2EQ7 A;  4HN8 A;  1NHS A;  3RGT A;  4Z2U A;  2GH5 A;  3T14 A;  1JEH A;  4J56 A;  1Q9I A;  3CB3 A;  4PAB A;  2YQU A;  4JY2 A;  1GRG A;  1DOC A;  1N4V A;  4Z43 A;  5C2T A;  4RG4 A;  2RAB A;  3HPF A;  2GGI A;  3UXK A;  3SY4 A;  3VC5 A;  4DN1 A;  3VCN A;  3NN0 X;  3ZDN A;  1VQW A;  2WOW A;  3UKP A;  3SFD A;  1P2H A;  2C3C A;  2FJE A;  4EIQ A;  2FJD A;  1V59 A;  4GIR A;  4M52 A;  2WU2 A;  4F4R A;  1MNS A;  4JDR A;  3KUM A;  4NEW A;  1F9C A;  4OPU A;  3NFU A;  3LB8 A;  4RSL A;  1ZP0 A;  1YQ3 A;  3PVC A;  3BI2 A;  3AM9 A;  3I3L A;  1GRF A;  5BVA A;  3S61 A;  4E6M A;  3TW9 A;  2GQW A;  3UKL A;  2QDD A;  1REO A;  1L8P A;  5G5H B;  3AMZ A;  2XYO A;  2BK3 A;  5U63 A;  2PHH A;  5JCI A;  4NZH A;  4M0X A;  1GOS A;  3GSI A;  1H2I A;  5KVI A;  5KNL A;  1TYT A;  5JCK A;  2DW7 A;  1JOA A;  3URH A;  2PA6 A;  2MUC A;  4CCQ A;  1GER A;  1XPY A;  1EBD A;  1GT8 A;  2BYB A;  3CNT A;  2QA1 A;  2POZ A;  2PP1 A;  1EBG A;  2W0H A;  3BNM A;  3CGD A;  1NPX A;  3SJN A;  2E4G A;  1K0J A;  3UOV A;  3UTE A;  1R0M A;  3H70 A;  3JVA A;  4ICY A;  2YG3 A;  3H4K A;  2RGO A;  3S47 A;  3BNU A;  4YT0 A;  5GSN A;  4Z44 A;  4K8G A;  3R07 C;  1FHV A;  3V3W A;  3GD4 A;  3LOV A;  4FX9 A;  3BI4 A;  2WP6 A;  4EMW A;  2Y6R A;  3N4E A;  4KPL A;  4A7A A;  3AWI A;  1PHH A;  2OZ3 A;  3AD8 B;  3NKS A;  1DTN A;  1N60 C;  3I6T A;  2BXR A;  2WHD A;  1JU2 A;  1PXC A;  1KSS A;  2CVJ A;  2IVE A;  3DG7 A;  3R0K A;  3VFC A;  5BOF A;  5J60 A;  4G74 A;  1PBC A;  1SJB A;  2C75 A;  1CJC A;  2HNE A;  3SGL A;  3UKK A;  2ZZC A;  3OC4 A;  1VRQ B;  3H8L A;  2PGW A;  2GEW A;  1JPM A;  4ZA0 A;  3NGC X;  4TVY A;  2C76 A;  4I58 A;  4NNJ A;  3CMM A;  2Z5X A;  2GSH A;  4YSY A;  1GTE A;  4HB9 A;  2OPJ A;  1QLB A;  1KD0 A;  4K2S A;  3P1W A;  4E4F A;  2JBV A;  2XLT A;  3HW2 A;  3B3R A;  3CN8 A;  3T0K A;  2WP5 A;  5HY5 A;  2WDV A;  3T31 A;  4KT2 A;  3HRD C;  1PJ6 A;  3STP A;  2BAB A;  4A6N A;  4CBQ A;  2YM2 A;  3QSE A;  2OAM A;  1H7W A;  2YVF A;  1P43 A;  2AKZ A;  1OJ9 A;  4RG3 A;  4TM3 A;  4OPC A;  4H19 A;  2X8C A;  1CHU A;  2R0G A;  2PPG A;  4JN7 A;  3GWF A;  3UKH A;  4Z2T A;  1N62 C;  3RHA A;  5FMH A;  4U8I A;  1NAA A;  5EB4 A;  1TYP A;  4JHM A;  1H83 A;  1K0L A;  2C7G A;  2V61 A;  4HA6 A;  1XPQ A;  1B8S A;  3MQT A;  5FJO A;  1OJT A;  2MNR A;  2PU1 A;  3VR9 A;  1TRB A;  2OZT A;  2GDQ A;  3FG2 P;  3TQP A;  2XGZ A;  3UJR A;  3Q6J A;  4XWR A;  5KVH A;  2GMH A;  4WCT A;  5KMQ A;  5JCL A;  4ZCD A;  1PDY A;  2ZZ0 A;  1H7X A;  3C96 A;  4JNQ A;  1NU5 A;  3CYJ A;  3GYX A;  1LQT A;  2C72 A;  3NXL A;  3FMW A;  3PO7 A;  2HQM A;  3AE9 A;  1CBO A;  3ZLH A;  2YR6 A;  4B69 A;  4MGG A;  1STZ A;  1PDH A;  4GYP A;  2DKI A;  3GY1 A;  1LTX R;  2POD A;  3OZM A;  3VC6 A;  3OW1 A;  4I59 A;  1BGJ A;  4YKF A;  3ATQ A;  2AQJ A;  4E4U A;  4OPT A;  3M0O A;  1F3P A;  3SN4 A;  3SR6 B;  5KMR A;  1EBH A;  3DK4 A;  5BOE A;  1FOH A;  3FYY A;  2OA1 A;  3P4S A;  3FCP A;  2QDE A;  5HXI A;  1JRY A;  3P4R A;  1VDV A;  3ALM A;  4U8K A;  2A8X A;  1LPF A;  3OP2 A;  4EMI A;  3EF6 A;  3IHM A;  4CNK A;  3RED A;  2C67 A;  4BK1 A;  2YG6 A;  2YAU A;  1FHU A;  2R9Z A;  3H8I A;  2ACZ A;  2GMJ A;  1WUE A;  3NYE A;  4G7F A;  3NS1 B;  1DOE A;  4GIS A;  1K0I A;  1DXL A;  2E3T A;  3NN6 X;  4Z24 A;  2YR5 A;  3B97 A;  1JNZ A;  3P4P A;  3EAN A;  4YSH A;  2FBW A;  1W6T A;  4G73 A;  2B7S A;  1JRX A;  2YG4 A;  3MY9 A;  4H4S A;  3M12 A;  3V3N A;  4H2R A;  4GME A;  1ZK7 A;  2JAE A;  4XXG A;  3WE0 A;  1EC8 A;  4AOS A;  4E0V A;  4OPI A;  3QTP A;  1OJC A;  1XAN A;  2RDX A;  4H7U A;  2GV8 A;  4Z1Y A;  3DER A;  3JSK A;  4B68 A;  3QVR A;  1LQU A;  2B9X A;  4IA6 A;  2PP0 A;  4IL0 A;  2WU5 A;  3FPZ A;  1E1L A;  1CC4 A;  3EKG A;  4H4W A;  4DWD A;  4REK A;  4G9K A;  3AEC A;  1H86 A;  3IJL A;  2XFO A;  1YQ4 A;  3PFR A;  4DX3 A;  2C70 A;  1TDO A;  3P4Q A;  2GGJ A;  5EOW A;  4H2Q A;  1MRA A;  3AYJ A;  1FCD A;  1S3E A;  2GL5 A;  4APN A;  4AOX A;  3ZLF A;  4K2X A;  2WEU A;  3VRB A;  3H8A A;  3EEZ A;  1M6I A;  4TVW A;  4Z2R A;  2E1M A;  3TTE A;  1M64 A;  1NEL A;  1Y0P A;  4H4Q A;  3GRS A;  1KNP A;  3UKA A;  2NQL A;  1CJ4 A;  4OPG A;  1KSU A;  2C73 A;  3L1R A;  3DK9 A;  3AE3 A;  2XLP A;  3THU A;  3ES7 A;  1F8W A;  3AE1 A;  4OVI A;  1H84 A;  3Q4D A;  4DXK A;  3DFH A;  4X2P A;  4IVM B;  3CXB A;  3T2Z A;  4IL2 A;  3MUC A;  3AE7 A;  4A79 A;  3ALJ A;  4LA1 A;  1Y56 B;  3BHF A;  4DGK A;  1RM6 B;  3SN0 A;  4A5L A;  1MOK A;  1T3Q C;  2OFJ A;  2W3S A;  3P3B A;  3DGH A;  4B66 A;  2BK4 A;  2XSX A;  3CGE A;  3CGB A;  3DJD A;  4YXD A;  2FYM A;  1QO8 A;  1GRB A;  3CGC A;  3RP6 A;  2JKC A;  3MKC A;  1TZZ A;  1PJ7 A;  4G6G A;  1QJD A;  3I6E A;  3RCY A;  1GND A;  2XLU A;  2P3Z A;  2XCG A;  4GAP A;  4UDP A;  1VQZ A;  3T4W A;  2BC0 A;  4YTM A;  4G6H A;  1YY5 A;  4GFI A;  2B7R A;  1B4V A;  1WYG A;  4H4T A;  2GGG A;  3CT2 A;  3R9U A;  4ENL A;  4FI4 A;  3PG6 A;  2IID A;  4ECH A;  3DG6 A;  3AEA A;  3DGB A;  3A7U A;  5C3J A;  3CNJ A;  5KRQ A;  3PWG A;  3VRD B;  3BJS A;  4U8P A;  3NVV B;  3K1G A;  3L5O A;  1D4C A;  2PTY A;  3A7A A;  2GAG B;  2WS3 A;  3VQR A;  5BUL A;  2GR1 A;  4IVO B;  1KKO A;  5EU9 A;  3NNE A;  2AL1 A;  3ETR B;  3UJS A;  2HZG A;  3ICS A;  3MZN A;  3II4 A;  1GRA A;  3D8X A;  1RYI A;  4X4J A;  2AR8 A;  1UKV G;  1VDC A;  1CL0 A;  1MO9 A;  3KPF A;  5BRT A;  1ZX9 A;  2XDO A;  3SX6 A;  3FV9 A;  1SJA A;  4TLZ A;  4H50 A;  5FS6 A;  1X2H A;  4DSG A;  2PP3 A;  1EL8 A;  1NHR A;  5IQ4 A;  4H4X A;  4A3R A;  3AYL A;  4CCR A;  3H12 A;  2IVD A;  3NVZ B;  1ELI A;  2VOU A;  2Z5Y A;  3KKJ A;  3CNS A;  2Q6U A;  3T2Y A;  3CPJ G;  3B9J B;  1XHC A;  3S5S A;  2Q0L A;  4GDE A;  1BZL A;  5DBJ A;  4EM4 A;  2ONE A;  3RP8 A;  3K7M X;  3T37 A;  2QJJ A;  2BCP A;  4ADW A;  4JQ9 A;  1E1M A;  4H2P A;  1EC9 A;  3QFA A;  4DNA A;  1Q1W A;  1EL9 A;  2H88 A;  3PS9 A;  4E8G A;  1O94 A;  4C77 A;  2FKP A;  4ZCC A;  4UDQ A;  1DNC A;  3AB1 A;  4X9N A;  2HXT A;  4BUR A;  1ONF A;  4YSZ A;  4D04 A;  1IUX A;  4J36 A;  1TKK A;  5HYM A;  1BKH A;  2WBA A;  3QVP A;  1D4D A;  3IC9 A;  1KN0 A;  4U2T A;  2O9Z A;  1PN0 A;  3UOZ A;  2YLW A;  4K22 A;  4C3X A;  1FFV C;  4Y4L A;  3D1C A;  3R0U A;  1ONE A;  3UCD A;  3ALL A;  3C4N A;  1KDG A;  4Y4M A;  3SYI A;  2NVK X;  4IV9 A;  2TPR A;  1O5W A;  1JRP A;  4HCL A;  2I5Q A;  2E5V A;  4CY6 A;  2GGH A;  3UTH A;  4J1O A;  2BXS A;  2GVC A;  1GV4 A;  3QN3 A;  4G8T A;  3KA7 A;  4ROP A;  3D9X A;  2VVM A;  3NT6 A;  4ZN0 A;  3BOX A;  3VRA A;  3V5F A;  4B63 A;  3NYF A;  1ZOY A;  3TWB A;  1S7M A;  2C3D A;  2XLR A;  3CIR A;  4H83 A;  3NH3 X;  3BSM A;  2BC1 A;  4Z25 A;  4II3 A;  3DDM A;  2RGJ A;  1B37 A;  4KEM A;  3LJP A;  2GB0 A;  2X8G A;  4BJZ A;  2JB3 A;  1CJ3 A;  3AXB A;  1NEK A;  5FJU A;  3UJF A;  3ZLG A;  4H4U A;  3ICT A;  1IYX A;  3AEB A;  3F8R A;  1V97 A;  2W3R A;  5TR3 A;  3GMB A;  4Y4N A;  2X8H A;  1TDF A;  3AED A;  3TWA A;  4H4Z A;  1MUC A;  1LVL A;  3FBS A;  3SM8 A;  3UOX A;  2GF3 A;  2XVE A;  4D03 A;  1JRO A;  2AKM A;  1SJD A;  4GYP C;  2V60 A;  2ZZB A;  1ZKQ A;  1N63 C;  5KWF A;  4NTD A;  2E5A A;  3N4F A;  4HNC A;  2BK5 A;  4PAA A;  3EAO A;  1P48 A;  1YKJ A;  2O56 A;  1BGN A;  3ICR A;  1K4Q A;  2AL2 B;  3I6D A;  3UOY A;  5BUK A;  2QGY A;  4K1W A;  2CDU A;  3NZG A;  1B5Q A;  5KXJ A;  5GRT A;  5FS9 A;  5CQF A;  3VR8 A;  4H2H A;  3T6C A;  4LU6 A;  4M6U A;  4A9W A;  4YTP A;  1N61 C;  3KU9 A;  4H4P A;  2X3N A;  4WX1 A;  5KMS A;  3NO1 A;  4U8J A;  3TOY A;  3IJI A;  1NG3 A;  3BI5 A;  3KVE A;  1AOG A;  1DJN A;  4CY8 A;  1E6E A;  1E1K A;  1D5T A;  2ZAD A;  3NTD A;  4X9M A;  4EQX A;  3RIT A;  2WPF A;  3GWD A;  4LII A;  2CFY A;  5IDZ A;  3FJ4 A;  3NK2 X;  2QCU A;  4H2N A;  1Y56 A;  3KPK A;  4Z26 A;  2YVG A;  2B9W A;  2H89 A;  4NEV A;  3IWA A;  3NIX A;  1RP0 A;  3K7T A;  2I0Z A;  2APG A;  3D46 A;  5CKU A;  2R4E A;  3T2K A;  4OCG A;  3F8D A;  2PTX A;  5HHF A;  3DG3 A;  4BK3 A;  4J57 A;  4FK1 A;  3GD3 A;  4B64 A;  3S5W A;  4AT2 A;  3EUB 3;  1GAL A;  1L9C A;  3AE8 A;  1Z6L A;  2XVH A;  4GDP A;  2YLZ A;  4H4R A;  5EBK A;  2V3B A;  1SJC A;  2OAL A;  3UCL A;  4B67 A;  3B6D A;  2EQ9 A;  2ZC8 A;  3COX A;  5J7X A;  2XH7 A;  4E5T A;  2PCE A;  3CNP A;  3Q45 A;  4FK1 C;  1ZDL A;  4K5S A;  2R0P A;  2PSN A;  2WES A;  4GRT A;  3ISH A;  4TM0 A;  5ENL A;  5M0Z A;  5KOX A;  3SZC A;  1NEN A;  2VVL A;  3NLC A;  1JDF A;  2B76 A;  3PWI A;  3AE6 A;  1N5X A;  3UTG A;  4DHG A;  2VRL A;  1MXT A;  3RRA A;  4TM4 A;  4U2S A;  4YSX A;  3ES8 A;  3UCC A;  2QA2 A;  2OO6 A;  1EL5 A;  2YM1 A;  3ZVH B;  3R1Z A;  1S2Y A;  3T9P A;  4EQR A;  3KLJ A;  2NPX A;  4HCH A;  3O0H A;  3CXO A;  1JRZ A;  2GR3 A;  3TJI A;  1PJ5 A;  3RP7 A;  4HPN A;  4UP3 A;  3NRN A;  4EMJ A;  1H6V A;  1PS9 A;  2Y6Q A;  1FEB A;  4EM3 A;  2UZZ A;  1CJ2 A;  2R46 A;  2QJN A;  3SSZ A;  3CAW A;  3DEQ A;  2HXU A;  5KOW A;  1ELS A;  1VG0 A;  4NWZ A;  2XFU A;  2OLA A;  3N6J A;  3KD9 A;  3LXD A;  1EL7 A;  1S2Q A;  1D7L A;  1D4E A;  1O95 A;  1DOD A;  2YWL A;  3AD7 B;  4KX6 A;  2XLS A;  3AN1 A;  4U8M A;  4B1B A;  3UXL A;  3P93 A;  4U2L A;  3EPT A;  4J33 A;  1BQG A;  1HYU A;  1KCZ A;  2EQ8 A;  1JNR A;  1WUF A;  1FL2 A;  2YLR A;  3NTA A;  3GYJ A;  2TMD A;  3GO2 A;  3SQP A;  4MMW A;  4AT0 A;  1IUV A;  3U4F A;  3Q9T A;  1GRT A;  3DA1 A;  3IK4 A;  4IHC A;  2WOI A;  4A6G A;  1SB3 B;  3AE4 A;  1LV0 A;  4Z17 A;  1F6M A;  3T8Q A;  4KPR A;  2JK6 A;  4K5R A;  3ENL A;  1X2G A;  5LV9 A;  4CNJ A;  3P0W A;  3QFB A;  4K7Z A;  3IHG A;  1GEU A;  5J04 A;  1FIQ B;  1RSG A;  4GGH A;  3CND A;  2C64 A;  3NRZ B;  2X50 A;  1PXB A;  4AP1 A;  1MDR A;  1CC6 A;  2OKT A;  2VQB A;  3GMC A;  2PMQ A;  5U1O A;  4A99 A;  1CC2 A;  5FJR A;  4JY3 A;  1PBD A;  1ZY8 A;  2QAE A;  3K7Q X;  1IUU A;  5IQ1 A; 
#chains in the Genus database with same CATH homology
 4EQS A;  1BKW A;  3ALL A;  3C4N A;  3UTF A;  5M10 A;  2C67 A;  1KDG A;  4BK1 A;  1S3B A;  2YG6 A;  4Y4M A;  2A87 A;  3SYI A;  3L8K A;  2NVK X;  1DOB A;  1E7P A;  1NDA A;  2YAU A;  3CPI G;  3DJG X;  4IV9 A;  2R9Z A;  2TPR A;  4H4V A;  2R0C A;  5EB5 A;  1NHQ A;  1O5W A;  2XVJ A;  3H8I A;  3P9U A;  2ACZ A;  2GMJ A;  1ZMD A;  5JCM A;  3E1T A;  3SZF A;  3NYE A;  4BJY A;  5L46 A;  1GES A;  1DOE A;  1GTH A;  2E5V A;  1E1N A;  4CY6 A;  2GAH B;  2BS4 A;  3UTH A;  1K0I A;  2BXS A;  3G5R A;  3LZW A;  2GVC A;  2VVL G;  3QJ4 A;  3UP4 A;  1GV4 A;  1TDE A;  2B9Y A;  2RGH A;  1DXL A;  2WPE A;  1NG4 A;  1YQZ A;  3NN6 X;  1N4W A;  4Z24 A;  3KA7 A;  4U8N A;  4YWO A;  3D9X A;  2BS2 A;  2VVM A;  3NT6 A;  4ZN0 A;  2YR5 A;  3NK1 X;  2GQF A;  4IA5 A;  2YG7 A;  3VRA A;  4J2W A;  1JNZ A;  4J34 A;  3P4P A;  3ITJ A;  4CRT A;  5JRB A;  3F8P A;  3SFE A;  4UDR A;  4B63 A;  4GF7 A;  3EAN A;  3NYF A;  1ZOY A;  3UKQ A;  4YSH A;  1S7M A;  2FBW A;  2BA9 A;  3M13 A;  4G73 A;  3G5S A;  1ZOV A;  1PBE A;  2B7S A;  2EQ7 A;  1JRX A;  2C3D A;  1NHS A;  2Q7V A;  2YG4 A;  2XLR A;  4H4S A;  4Z2U A;  2GH5 A;  1KF6 A;  3CIR A;  3NH3 X;  3M12 A;  3T14 A;  3V3N A;  2BC1 A;  4H2R A;  3DH9 A;  1IUW A;  1GSN A;  4Z25 A;  4II3 A;  1JEH A;  2WQY A;  2J3N A;  1ZK7 A;  2JAE A;  4J56 A;  2RGJ A;  4XXG A;  3WE0 A;  2GR0 A;  4AOS A;  4GCM A;  1B37 A;  1Q9I A;  4E0V A;  4OPI A;  3LJP A;  1OJC A;  1XAN A;  4H7U A;  2GB0 A;  4PAB A;  2YQU A;  2X8G A;  2GV8 A;  4JY2 A;  1GRG A;  4BJZ A;  4B65 A;  1DOC A;  3QSS A;  1N4V A;  4NTC A;  2JB3 A;  3JSK A;  4B68 A;  3AE5 A;  4Z43 A;  3QVR A;  1CJ3 A;  5C2T A;  1LQU A;  3AXB A;  4RG4 A;  2RAB A;  2B9X A;  4IA6 A;  1NEK A;  3LZX A;  3ZYX A;  2WU5 A;  3FPZ A;  1E1L A;  4H4U A;  1CC4 A;  1NHP A;  2XFQ A;  3ABV A;  4H4W A;  3ICT A;  4REK A;  3SY4 A;  2ARD A;  4G9K A;  3AEB A;  1IJH A;  3F8R A;  4BK2 A;  4BV6 A;  1DJQ A;  3AEC A;  1H86 A;  2XFO A;  3UP5 A;  5TR3 A;  3GMB A;  1F8R A;  4Y4N A;  3NN0 X;  4USQ A;  1YQ4 A;  1VQW A;  3NK0 X;  2WOW A;  3ZDN A;  3UKP A;  2X8H A;  1E39 A;  1TDF A;  3SFD A;  4AP3 A;  3AED A;  1P2H A;  5IPY A;  2C3C A;  2FJE A;  1PXA A;  4EIQ A;  4H4Z A;  1LVL A;  2JB2 A;  3DJE A;  3FBS A;  3SM8 A;  2C70 A;  1TDO A;  3P4Q A;  3UOX A;  2GF3 A;  2FJD A;  1V59 A;  2XVE A;  4D03 A;  4M52 A;  4J31 A;  1FEC A;  5EOW A;  2WU2 A;  4H2Q A;  3V76 A;  4JDR A;  2WPC A;  2YLS A;  4NEW A;  4TLX A;  2V60 A;  1FCD A;  1S3E A;  3AYJ A;  2ZZB A;  2WP9 A;  1ZKQ A;  4OPU A;  3LB8 A;  4APN A;  4AOX A;  5KWF A;  1SEZ A;  4N9X A;  4NTD A;  1CF3 A;  1YQ3 A;  1ZP0 A;  4RSL A;  4K2X A;  4C5O A;  3PVC A;  3BI2 A;  2WEU A;  2YR4 A;  2BK5 A;  4PAA A;  3VRB A;  3I3L A;  3EAO A;  5KMP A;  1GRF A;  3HYV A;  1YKJ A;  4OPD A;  1M6I A;  1BGN A;  5BVA A;  2BAC A;  1K4Q A;  3ICR A;  4Z2R A;  3I6D A;  2E1M A;  3S61 A;  3UOY A;  5BUK A;  2CDU A;  2WDQ A;  2YLX A;  1B5Q A;  5KXJ A;  2GQW A;  3CPH G;  5GRT A;  5FS9 A;  3UKL A;  1M64 A;  5CQF A;  3DJJ A;  1REO A;  3BHK A;  2FJB A;  1Y0P A;  4H4Q A;  3GRS A;  1KNP A;  3VR8 A;  2XYO A;  2GRT A;  3UKA A;  1CJ4 A;  2BK3 A;  4OPG A;  4LU6 A;  2PHH A;  5U63 A;  4A9W A;  2EQ6 A;  5JCI A;  1KSU A;  2C73 A;  4NZH A;  3L1R A;  3DK9 A;  4YTP A;  3AE3 A;  2XLP A;  4JNA A;  1F8W A;  1GOS A;  3AE1 A;  3KU9 A;  4C74 A;  4H4P A;  4OVI A;  1H84 A;  2X3N A;  3GSI A;  4WX1 A;  1H2I A;  5KVI A;  4IVM B;  5KNL A;  1GRE A;  5KMS A;  5ER0 A;  1H82 A;  1TYT A;  5JCK A;  3T2Z A;  1FEA A;  4U8J A;  1NG3 A;  3AE7 A;  1JOA A;  3BI5 A;  4A79 A;  3KVE A;  2BRA A;  3URH A;  1AOG A;  3ALJ A;  4CCQ A;  1GER A;  3DK8 A;  4LA1 A;  1Y56 B;  1EBD A;  1GT8 A;  2BYB A;  3BHF A;  1DJN A;  3CNT A;  4DGK A;  2QA1 A;  2C66 A;  4A5L A;  4CY8 A;  1E6E A;  1E1K A;  1MOK A;  3GDN A;  1D5T A;  3NTD A;  3ATR A;  3DGH A;  4X9M A;  2W0H A;  3BNM A;  4EQX A;  3CGD A;  4U8L A;  1PBB A;  4B66 A;  1NPX A;  2WPF A;  2E4G A;  1K0J A;  3UOV A;  3GWD A;  4YTN A;  4LII A;  3UTE A;  2CFY A;  4P9S A;  4GR1 A;  2BK4 A;  4ICY A;  3HYX A;  2YG3 A;  2PYX A;  3NK2 X;  2QCU A;  3ADA B;  4H2N A;  3H4K A;  1Y56 A;  2RGO A;  4NTE A;  3CGE A;  3CGB A;  2WET A;  2XVF A;  3KPK A;  3BNU A;  4Z26 A;  2YVG A;  2B9W A;  2H89 A;  4NEV A;  5GSN A;  4Z44 A;  4YT0 A;  4TM1 A;  1D7Y A;  3IWA A;  3DJD A;  1RP0 A;  3NIX A;  3K7T A;  4YXD A;  2I0Z A;  3GD4 A;  2APG A;  1QO8 A;  5CKU A;  1GRB A;  3CGC A;  2R4E A;  3T2K A;  4OCG A;  3LOV A;  3F8D A;  4O5U A;  3RP6 A;  4FX9 A;  5HHF A;  4BK3 A;  2XVI A;  2JKC A;  3BI4 A;  2WP6 A;  4J57 A;  4EMW A;  2C4C A;  4FK1 A;  1PJ7 A;  4JN9 A;  4G6G A;  3DME A;  1QJD A;  2Q0K A;  2Y6R A;  3GD3 A;  2X99 A;  4A7A A;  3AWI A;  4B64 A;  1PHH A;  3AD8 B;  3S5W A;  4AT2 A;  2WHD A;  3NKS A;  2BXR A;  1GAL A;  1L9C A;  1N1P A;  1GND A;  3AE8 A;  1JU2 A;  1PXC A;  2XLU A;  1KSS A;  2CVJ A;  2XCG A;  2JB1 A;  2IVE A;  1OJD A;  4GAP A;  4UDP A;  1Z6L A;  2XVH A;  4GDP A;  4H4Y A;  2YLZ A;  2BC0 A;  4YTM A;  4G6H A;  2WOV A;  2VZ2 A;  4H4R A;  5J60 A;  5EBK A;  2V3B A;  2WDR A;  1YY5 A;  2OAL A;  1PBF A;  3UCL A;  4G74 A;  1PBC A;  4B67 A;  2C75 A;  3B6D A;  1CJC A;  2B7R A;  1B4V A;  2EQ9 A;  3SGL A;  4H4T A;  3COX A;  5J7X A;  3CNP A;  1IUS A;  4FK1 C;  3UKK A;  2YVJ A;  3R9U A;  1KNR A;  1ZDL A;  2ZZC A;  3RNM A;  2OLN A;  3OC4 A;  1VRQ B;  2R0P A;  3H8L A;  4K5S A;  2GEW A;  2WES A;  3PG6 A;  2IID A;  4GRT A;  3ISH A;  4TM0 A;  3NGC X;  5M0Z A;  2C76 A;  5KOX A;  3SZC A;  4ECH A;  4I58 A;  1NEN A;  5FS8 A;  2VVL A;  2OLO A;  3NLC A;  4NNJ A;  3CMM A;  2Z5X A;  2A89 A;  2B76 A;  4A65 A;  4YSY A;  3AE6 A;  3AEA A;  3UTG A;  1GPE A;  3AE2 A;  2VRL A;  2BRY A;  1GTE A;  4HB9 A;  5C3J A;  3CNJ A;  5KRQ A;  1XDI A;  4A6N B;  1MXT A;  3VRD B;  3CTY A;  4OPL A;  4DSH A;  1QLB A;  4U8P A;  3P1W A;  3C4A A;  4TM4 A;  3L5O A;  1D4C A;  2CUL A;  2GAG B;  2JBV A;  2WS3 A;  2XLT A;  3VQR A;  3B3R A;  4U2S A;  4YSX A;  3CN8 A;  4C3Y A;  5BUL A;  2QA2 A;  2GR1 A;  3GDP A;  3T0K A;  2WP5 A;  5HY5 A;  2WDV A;  3T31 A;  1EL5 A;  1LJ1 A;  2YM1 A;  4IVO B;  3NYC A;  3SXI A;  3NNE A;  1PJ6 A;  1S2Y A;  3UKF A;  4EQR A;  4EIP A;  1ZMC A;  2NPX A;  3KLJ A;  2BAB A;  4A6N A;  3O0H A;  2XFN A;  4CBQ A;  2DKH A;  3ICS A;  2YM2 A;  3QSE A;  3II4 A;  1GRA A;  1JRZ A;  2OAM A;  2V3A A;  1IUT A;  2YVF A;  1H7W A;  2V5Z A;  3D8X A;  2GR3 A;  2R4J A;  1RYI A;  4X4J A;  2AR8 A;  1OJ9 A;  1PJ5 A;  1UKV G;  4RG3 A;  3RP7 A;  4UP3 A;  1VDC A;  1CL0 A;  1MO9 A;  3KPF A;  4TM3 A;  3NRN A;  1GET A;  5BRT A;  1ZX9 A;  5FS7 A;  1W4X A;  2XDO A;  4OPC A;  3SX6 A;  4MJW A;  2X8C A;  4TLZ A;  1CHU A;  4EMJ A;  4H50 A;  2F5Z A;  1H6V A;  1PS9 A;  5FS6 A;  2R0G A;  2VQ7 A;  2Y6Q A;  3SZ0 A;  4FDC B;  3GWF A;  4DSG A;  4Z2T A;  3UKH A;  1FEB A;  3V3O A;  4EM3 A;  2UZZ A;  1EL8 A;  1CJ2 A;  1NHR A;  2R46 A;  3RHA A;  5FMH A;  4K8D A;  2YG5 A;  5IQ4 A;  4U8I A;  4II2 A;  4H4X A;  1OJA A;  1NAA A;  5EB4 A;  1TYP A;  1H83 A;  3AYL A;  4CCR A;  1K0L A;  2C7G A;  2V61 A;  4HA6 A;  2AAQ A;  2IVD A;  2VRM A;  1Q1R A;  3DGZ A;  1VG0 A;  5KOW A;  1L0V A;  3GRT A;  1XPQ A;  4NWZ A;  2XFU A;  4XWZ A;  4U8O A;  3HZL A;  1B8S A;  1OJT A;  1ELI A;  4GUV A;  2VOU A;  2Z5Y A;  3KKJ A;  3KD9 A;  3LXD A;  1EL7 A;  3CNS A;  2Q6U A;  4YKG A;  1S2Q A;  3VR9 A;  1D7L A;  1D4E A;  1O95 A;  1TRB A;  3T2Y A;  3FG2 P;  1DOD A;  2YWL A;  3AD7 B;  1X31 B;  4KX6 A;  3HYW A;  3K30 A;  3CPJ G;  3AEE A;  3Q6J A;  2XLS A;  2YLT A;  4XWR A;  4U8M A;  5KVH A;  2GMH A;  4WCT A;  4B1B A;  3QSM A;  5KMQ A;  5JCN A;  1XHC A;  4U2L A;  3GYI A;  3EPT A;  2FJA A;  4J33 A;  5JCL A;  1HYU A;  1COY A;  1L9D A;  4ZCD A;  1L9E A;  2ZZ0 A;  1H7X A;  1GRH A;  2Q0L A;  3G5Q A;  3AEG A;  3C96 A;  4GDE A;  1BZL A;  2EQ8 A;  1JNR A;  5DBJ A;  4EM4 A;  4JNQ A;  3RP8 A;  1N4U A;  4O5Q A;  1FL2 A;  3AEF A;  3GYX A;  2YLR A;  3IF9 A;  3GYJ A;  1LQT A;  3K7M X;  2C72 A;  3NTA A;  2TMD A;  3T37 A;  3LAD A;  3FMW A;  2BCP A;  2HQM A;  3SQP A;  3AE9 A;  3AYI A;  3PO7 A;  2V6O A;  4JQ9 A;  4ADW A;  4AT0 A;  1E1M A;  1IUV A;  1CBO A;  2C65 A;  1TDN A;  2YR6 A;  4H2P A;  4B69 A;  5U25 A;  3Q9T A;  1PDH A;  2DKI A;  1GRT A;  1LTX R;  3QFA A;  1BWC A;  3DA1 A;  4DNA A;  1Q1W A;  2WOI A;  1EL9 A;  2H88 A;  2XFP A;  3PS9 A;  4USR A;  3AE4 A;  4I59 A;  1LV0 A;  1F6M A;  1BGJ A;  1GXF A;  4YKF A;  3ATQ A;  4KPR A;  2AQJ A;  2JK6 A;  4K5R A;  1O94 A;  4C77 A;  2ZBW A;  5LV9 A;  4ZCC A;  4CNJ A;  3QFB A;  4K7Z A;  3IHG A;  4OPT A;  4UDQ A;  1F3P A;  1GEU A;  1RSG A;  1F8S A;  3M0O A;  1DNC A;  1P2E A;  3CND A;  1H81 A;  2C64 A;  3AB1 A;  2X50 A;  1PXB A;  4X9N A;  4BUR A;  1VG9 A;  4AP1 A;  1ONF A;  4YSZ A;  4D04 A;  1IUX A;  4EQW A;  1KFY A;  5KMR A;  2GR2 A;  3DK4 A;  3FIM B;  4J36 A;  1FOH A;  1CC6 A;  3OZ2 A;  2OA1 A;  2VQB A;  3GMC A;  5HYM A;  3P4S A;  2WBA A;  3QVP A;  5U1O A;  2BS3 A;  1D4D A;  4A99 A;  4GAV A;  3AD9 B;  1CC2 A;  1TDK A;  1BF3 A;  5HXI A;  3IC9 A;  2R45 A;  4JY3 A;  3SZW A;  1JRY A;  3P4R A;  1KN0 A;  3ALM A;  1PBD A;  4U2T A;  3NG7 X;  4U8K A;  2A8X A;  2BCG G;  1ZY8 A;  2QAE A;  1LPF A;  1PN0 A;  2O9Z A;  3UOZ A;  3K7Q X;  4EMI A;  3EF6 A;  1IUU A;  2YLW A;  3IHM A;  4K22 A;  3RED A;  4C3X A;  4CNK A;  4Y4L A;  3NHO X;  3D1C A;  5IQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...