1JOAA

Nadh peroxidase with cysteine-sulfenic acid
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
447
structure length
446
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title Structure of the native cysteine-sulfenic acid redox center of enterococcal NADH peroxidase refined at 2.8 A resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 138
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1996-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1joaA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1joaA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1joaA02
1H7XA 3E1TA 2X8GA 3DK8A 1CF3A 1YQZA 1GRBA 2X50A 1OJCA 1HYUA 3C4AA 5HY5A 4GDPA 5FS6A 2V3AA 2V5ZA 3CNDA 3IF9A 1DXLA 4X9MA 1V59A 4BK1A 3VQRA 3VR9A 4H4XA 2C66A 4H4ZA 4I58A 4J33A 3B3RA 2XYOA 3UTGA 1GRAA 1E7PA 3CPHG 4TM0A 4WCTA 4A9WA 2WDVA 2IVEA 3NLCA 4H2RA 3HZLA 3V76A 5EOWA 1CC4A 2OLNA 1PBCA 2GMJA 3UKLA 2IIDA 3EF6A 2JBVA 1JNZA 3CGDA 3LJPA 4BJYA 3K7MX 2UZZA 3ALMA 5KVIA 2QA1A 1XPQA 4A65A 1GRFA 1GPEA 2WOVA 4Y4MA 4NZHA 1COYA 3AYLA 1ONFA 1W4XA 4U8OA 2GB0A 4YSYA 3I3LA 3DH9A 1PXCA 3ZYXA 3UOXA 3L8KA 3FIMB 4A6NB 5KOWA 2TPRA 1VG9A 2GR3A 3VRDB 3M12A 3NK2X 4YTPA 2R0PA 2YR4A 4RG4A 2WHDA 2WPCA 4M52A 4C3YA 5FS9A 1E39A 3QSMA 2WESA 1JRZA 2BK4A 4CY8A 3R9UA 1PJ6A 3UKPA 3RNMA 4RG3A 3GMBA 3ALJA 4U8IA 4NEWA 2WPFA 2YQUA 3UP5A 3QSSA 2YG7A 2C73A 1ZY8A 2R0CA 5JCNA 4K5RA 4OPCA 2YVJA 3SQPA 1EL9A 4FK1C 1ZP0A 1DNCA 3DGHA 2HQMA 3AECA 3GWFA 1BGJA 3KD9A 4OPLA 3CGEA 4OCGA 4ADWA 2H89A 2GQFA 1CC2A 4YTMA 4EIPA 4Z2TA 3CNJA 4H4TA 3GSIA 2Y6RA 3SM8A 3SFEA 5EB4A 1L9CA 3DJDA 2YVFA 2WP5A 2B76A 2V6OA 2Q0LA 3BNMA 2BACA 1TDNA 1B37A 2VVLG 2WOIA 2ZZBA 2XVEA 2YAUA 2DKIA 3AE1A 3BI4A 2C72A 3AEFA 3BNUA 3GRTA 3FPZA 4J56A 1DOCA 5KOXA 4U8NA 3DMEA 3UOZA 5JCIA 1OJTA 2R0GA 3I6DA 2ZBWA 2JK6A 1AOGA 1DODA 3GYJA 2W0HA 2JB3A 4B64A 2Z5XA 1K4QA 2IVDA 3VR8A 3UTHA 4GR1A 1S2QA 3AE3A 5EB5A 1H84A 1MXTA 4B66A 2PHHA 1CJ2A 3AEEA 2WP6A 4OPDA 3OZ2A 3NYCA 4AT2A 3AE4A 1YQ3A 5L46A 2BYBA 1IUWA 1O95A 3M13A 3AWIA 4E0VA 4DGKA 3CPIG 1CHUA 2WS3A 3CTYA 3K7TA 5U63A 1TRBA 2FJDA 2JAEA 2XDOA 3AD7B 2GR0A 4REKA 2CDUA 5GRTA 1S3EA 1RP0A 2XVHA 3AE5A 4GCMA 5CQFA 3VRAA 4YXDA 4JQ9A 5KWFA 1YY5A 4J2WA 1MOKA 2YLZA 5FS8A 1M64A 4EQWA 1Y0PA 4EM3A 2BXRA 2WDQA 1DJNA 4H4PA 3AE6A 1L0VA 2GH5A 2GQWA 3NTAA 1NHRA 4JN9A 5BRTA 3ICTA 3VRBA 2FJAA 4N9XA 1BWCA 5KVHA 4B65A 1UKVG 1KF6A 2NVKX 4NEVA 1ZDLA 1VDCA 2A87A 3G5RA 3RP6A 4IA5A 2ZZCA 2XFQA 4OPIA 2YM2A 4H2NA 1IUXA 2BS2A 4PAAA 1L9EA 1PBEA 1ZMDA 3ICSA 1EL5A 4Z2RA 2QA2A 3FG2P 4IA6A 1O5WA 1D7YA 3DJJA 2YLWA 3JSKA 3ATRA 4TM1A 1IUTA 3T37A 3P1WA 4DNAA 1QO8A 2CVJA 1K0JA 3NN0X 1D5TA 3QFBA 1K0IA 2TMDA 2FJEA 2EQ7A 1K0LA 3NYFA 4P9SA 2XVIA 3KVEA 4AOSA 2X8CA 4B69A 1GRTA 1QLBA 4GUVA 4H4VA 4CBQA 2BK5A 4JY2A 4TLZA 4Z25A 4APNA 2H88A 1TDFA 4NTCA 1ZOYA 5J7XA 1GREA 3UCLA 1GXFA 1E1LA 4Z2UA 2RGJA 3AYJA 1GTHA 4CCQA 2YVGA 3URHA 1D4EA 2WPEA 4B68A 1BZLA 1RSGA 5IQ4A 2YG4A 1E1NA 1RYIA 4OPTA 4CY6A 3REDA 1CL0A 1GETA 3C96A 1P2HA 3AEBA 3COXA 3NK1X 3NN6X 4MJWA 2YWLA 1GESA 3QSEA 3P4RA 1LQUA 2WP9A 4O5UA 5DBJA 1IJHA 5BVAA 4IV9A 4KX6A 4J34A 1OJDA 2C65A 3C4NA 3L1RA 2E1MA 1JEHA 4ZCCA 3ZDNA 1PN0A 4U2SA 1ZMCA 1CJ4A 3GD3A 4XWRA 1M6IA 1H83A 4HB9A 1LVLA 3Q6JA 2GMHA 2GVCA 4TLXA 4A99A 5KRQA 4DSHA 3H4KA 2F5ZA 2EQ8A 1EL7A 1Y56B 2XFPA 3FMWA 4FK1A 4B67A 1KDGA 2VQBA 3KU9A 4UDPA 2I0ZA 1E1MA 1GT8A 4EMIA 2C64A 5TR3A 1CBOA 1ZOVA 4YTNA 2FJBA 2GF3A 4K22A 2GR1A 4AP1A 4LIIA 1JOAA 3AE7A 2R9ZA 3IHGA 4H4YA 3KA7A 1TDKA 4H4RA 4CRTA 2BCPA 3CGBA 3WE0A 4BJZA 3AEDA 1N4VA 4D04A 1P2EA 4UDQA 1OJAA 3D8XA 4O5QA 1F8RA 1TYPA 2ACZA 4IVMB 3II4A 2YLXA 4EQSA 1GERA 1YQ4A 4FDCB 2VQ7A 3BI2A 4JY3A 4X9NA 1ZK7A 4Y4NA 4YKGA 5M0ZA 1Q1RA 1B8SA 2OLOA 2E5VA 3EPTA 3AYIA 3K30A 2YLRA 2DKHA 2WU5A 5HHFA 5EBKA 2BA9A 2XLTA 3D1CA 3AB1A 2AAQA 2WOWA 1KNPA 3GDNA 4FX9A 1QJDA 2XVFA 1S3BA 3UOVA 4BK3A 3NTDA 4ECHA 2GRTA 4YSXA 5JCKA 4ZN0A 2C76A 2PYXA 2XFUA 4K8DA 1KFYA 3DK9A 3AE9A 1LV0A 3H8IA 4OPGA 2VZ2A 4BURA 3G5SA 3NGCX 4AT0A 4DSGA 3LOVA 2Q6UA 1FL2A 2R4JA 3AD8B 4A5LA 3UTFA 3UKKA 4CCRA 1F6MA 3AXBA 3DGZA 1TDEA 3NT6A 2J3NA 1PDHA 1PJ7A 1YKJA 4X4JA 3F8RA 1S2YA 2WDRA 1H86A 2R46A 4Z44A 4ZCDA 1PXBA 1NPXA 1GTEA 5BUKA 2Y6QA 5ER0A 1CJ3A 4YKFA 2EQ9A 4AP3A 5LV9A 3B6DA 4H4QA 4A7AA 2GV8A 2VVLA 3G5QA 4J57A 1REOA 1NAAA 5IQ1A 2ZZ0A 2OA1A 2A8XA 4HA6A 2XVJA 1BF3A 1XHCA 4BK2A 2BXSA 2CFYA 2YG5A 4LU6A 3QVRA 1H81A 4D03A 3EANA 1B4VA 2WBAA 3DK4A 1BKWA 1KNRA 1FOHA 4UDRA 3NKSA 3NYEA 1ZKQA 2WU2A 2XLUA 3QVPA 2GR2A 2YM1A 3ATQA 1IUVA 1H6VA 3LB8A 5CKUA 2BC1A 2WEUA 1H82A 5FMHA 4H2QA 4H4WA 1E1KA 1FEAA 5IPYA 2V61A 1GRHA 2R45A 2B9XA 1DJQA 3GYIA 1F8SA 1PBDA 2OALA 3O0HA 3P4PA 2C75A 2OAMA 4GDEA 4OPUA 5C2TA 1GEUA 4EM4A 1GRGA 1GV4A 4AOXA 3P4QA 2YLSA 1XDIA 5M10A 1NG4A 1X31B 3NG7X 3GD4A 2BC0A 1NHPA 2R4EA 1TDOA 3IC9A 1N1PA 2X99A 2B7SA 3LZWA 1TYTA 1GOSA 2B9WA 3AD9B 3ICRA 4U8LA 2BS4A 5FS7A 4U8MA 3UTEA 4C3XA 1F8WA 2B9YA 3AE2A 3NHOX 3SFDA 2JB1A 4H50A 2XFNA 1PBBA 4EIQA 2C3CA 1KSSA 3DJEA 3NNEA 1KSUA 3CIRA 4JDRA 1PS9A 1IUSA 4CNKA 3AEGA 2AQJA 4PABA 2V60A 2E4GA 3CNTA 2BCGG 2RGHA 3AEAA 2C70A 2BABA 2QCUA 3IWAA 4EQRA 1PXAA 1LQTA 4WX1A 3UKQA 3ITJA 3UP4A 4TM4A 3KLJA 3V3OA 4GF7A 3ADAB 4TM3A 4JNQA 2C7GA 3DA1A 3P4SA 1N4WA 2VVMA 5HYMA 4H2PA 4U8KA 4K2XA 4I59A 3LADA 4GRTA 1VRQB 2V3BA 1DOEA 2XFOA 2VRMA 2BK3A 3BHKA 3K7QX 1IUUA 3AE8A 2C3DA 1LJ1A 1PBFA 4J36A 1JRXA 3PS9A 2RABA 2YLTA 4K7ZA 2JB2A 2YG6A 3GRSA 4Z43A 2A89A 1NHQA 1Q9IA 4H4SA 2VRLA 2YG3A 1PJ5A 2VOUA 1GSNA 3GWDA 1N4UA 1VQWA 3LZXA 1NHSA 3NRNA 3BI5A 3ABVA 3S5WA 4A6NA 2ARDA 4YWOA 2WQYA 2YR5A 3ISHA 3QJ4A 4NTDA 3UKAA 1D4CA 3KPFA 1SEZA 3F8PA 1DOBA 3V3NA 3NH3X 3CNSA 3F8DA 2APGA 4B1BA 4LA1A 2B7RA 4H7UA 4U8PA 5J60A 3CNPA 1LPFA 4H4UA 2YR6A 4YSZA 4Y4LA 3GMCA 1GNDA 2GAHB 5C3JA 2Q0KA 1ELIA 2JKCA 2XLPA 5JCLA 3EAOA 3LXDA 3GDPA 4C77A 1CC6A 1B5QA 1O94A 1BGNA 2XLSA 4U8JA 2X8HA 4C74A 1Y56A 4U2TA 1FECA 4XXGA 1L9DA 4C5OA 1NEKA 4Z24A 3KKJA 3H8LA 4BV6A 1JNRA 3NK0X 4CNJA 2FBWA 2NPXA 4A79A 3FBSA 1E6EA 3S61A 3PVCA 1LTXR 5GSNA 2AR8A 4OVIA 3OC4A 1NG3A 3UKHA 4YSHA 4B63A 4KPRA 2Z5YA 1F3PA 5U25A 1VG0A 1XANA 5U1OA 3IHMA 4EQXA 4Z26A 5JCMA 2O9ZA 4USRA 3RP8A 1NENA 1Z6LA 5HXIA 5KXJA 3CPJG 3CN8A 3QFAA 3PO7A 1EBDA 4J31A 4USQA 1OJ9A 3RP7A 4YT0A 1D7LA 2EQ6A 3ALLA 2Q7VA 1NDAA 1GALA 3DJGX 3NIXA 4EMJA 3SGLA 1MO9A 2X3NA 1Q1WA 1D4DA 2WETA 4RSLA 1JU2A 3Q9TA 4U2LA 1CJCA 2QAEA 5BULA 3BHFA 1H7WA 2C67A 2CULA 1JRYA 3P9UA 2BS3A 3M0OA 1PHHA 4IVOB 4ICYA 4JNAA 4K5SA 4NTEA 4XWZA 3CGCA 2GAGB 2RGOA 3UOYA 4EMWA 1FCDA 4UP3A 1FEBA 3RHAA 1EL8A 3UKFA 2XLRA 2GEWA 2XCGA 1ZX9A
chains in the Genus database with same CATH superfamily
2GL5A 3H70A 3DK8A 1GRBA 3R10A 2MNRA 2V3AA 2V5ZA 3IF9A 4X9MA 1V59A 3PWIA 3VR9A 4H4ZA 2OO6A 3CPHG 4A9WA 3NLCA 4HNLA 3HZLA 1PBCA 3UKLA 2IIDA 2JBVA 2UZZA 1GRFA 4Y4MA 1ONFA 4YSYA 4II3A 3ZYXA 5KOWA 4YTPA 4H2HA 4C3YA 3UGVA 2BK4A 4EWJA 3R9UA 4RG3A 3UP5A 1N62C 2YVJA 3GWFA 1BGJA 3KD9A 3CGEA 1CC2A 4M6UA 3IJIA 5EB4A 1L9CA 3DJDA 3BNMA 1TDNA 2VVLG 1JPMA 2XVEA 3BI4A 2C72A 3FPZA 3MWCA 3UOZA 3I6DA 1AOGA 3SXIA 4B64A 5EB5A 1H84A 5G5HB 2FKPA 3NYCA 4AT2A 1JROA 5L46A 2GGIA 2W3RA 5ENLA 3M13A 3CTYA 3ZLFA 3K7TA 1TRBA 2XDOA 4K8GA 2CDUA 1RP0A 5CQFA 4EQWA 4H4PA 3MSYA 1L0VA 3I6EA 2GH5A 4ZA0A 1UKVG 1ZDLA 3OW1A 2ZZCA 2YM2A 4H2NA 2BS2A 1PBEA 3ICSA 1EL5A 3T2ZA 3JSKA 4TM1A 3FXGA 3P1WA 3HW2A 5BOFA 3TJ4A 1K0IA 2BRAA 1K0LA 4P9SA 3R25A 4H4VA 2BK5A 4CBQA 1R0MA 1MRAA 3UCLA 1GTHA 2YVGA 1RSGA 3D9XA 3N6JA 3U9IA 3RO6A 4CY6A 3CAWA 4JHMA 4MJWA 1GESA 3QSEA 2WP9A 1IJHA 5BVAA 2E3TA 1OJDA 3C4NA 4M0XA 2GMHA 5KRQA 1FFVC 1E1MA 4EMIA 3VDGA 4H19A 1ZOVA 2FJBA 1KKOA 2GF3A 1JOAA 3PK7A 2R9ZA 4H4YA 3WE0A 4D04A 5FJTA 1P2EA 4UDQA 3T37A 2YLXA 4IL2A 3K30A 4IHCA 4IL0A 1KNPA 1RM6B 2XVFA 1S3BA 3UOVA 2GRTA 4ZN0A 4K8DA 1KFYA 3DK9A 1LV0A 3H8IA 3NGCX 3G5SA 4DSGA 2Q6UA 1FL2A 3AD8B 3DGZA 1TDEA 1TE6A 3P93A 4JN8A 3UXLA 4H83A 3QN3A 2Y6QA 5ER0A 2OZTA 2OA1A 2XVJA 4BK2A 2BXSA 1RVKA 4LU6A 4D03A 3EANA 3SN4A 3U4FA 2WU2A 2XLUA 3QVPA 3ZVHB 2YM1A 3LB8A 5CKUA 1E1KA 1DTNA 1F8SA 3A7RA 2OAMA 5C2TA 3EKGA 1GRGA 1GV4A 3P4QA 2YLSA 1XDIA 1X31B 1TYTA 1GOSA 3UTEA 3AD9B 4U8LA 4U8MA 4A6GA 1MDRA 1KSUA 4JDRA 4CNKA 3OZYA 4G6HA 3EUB3 4PABA 2V60A 3CNTA 3AEAA 2C70A 1P43A 2W55A 3UP4A 4TM4A 3KLJA 4GF7A 4Z17A 3GC2A 4JNQA 3DA1A 2VVMA 5HYMA 4U8KA 5KMQA 4I59A 4GRTA 2W54A 4E4FA 2BK3A 2PA6A 3AE8A 4J36A 1JRXA 1EBHA 2YLTA 4K7ZA 3TTEA 2JB2A 3NS1B 3IK4A 1NHQA 4H4SA 2YG3A 1PJ5A 3GWDA 3ABVA 4A6NA 4GYPC 2YR5A 2PP3A 4NTDA 3V3NA 3CNSA 2APGA 4B1BA 4U8PA 5J60A 4MMWA 4Y4LA 3GMCA 2GAHB 5JCLA 3LXDA 3ES8A 5KNLA 1FECA 4DN1A 1PDZA 1H2IA 3KKJA 2FBWA 3PVCA 1LTXR 3OC4A 1NG3A 3DGBA 2OPJA 4KPRA 1WUEA 1F3PA 1VG0A 1XANA 1MDLA 4USRA 3D47A 5KXJA 2Q7VA 3RGTA 1MO9A 2X3NA 2QDEA 2OVLA 2P0IA 1D4DA 3Q9TA 3BHFA 4KWSA 3P9UA 2BS3A 3MUCA 1JDFA 4GMEA 3CGCA 4EMWA 2RDXA 1EC9A 1FCDA 4F4RA 3RHAA 1EL8A 4MKSA 2XCGA 4H2PA 1ZX9A 3JVAA 1V97A 3FJ4A 1CF3A 1YQZA 1HYUA 5HY5A 3OTRA 3HYVA 2BRYA 1DXLA 3VQRA 1GRAA 3BSMA 1E7PA 4TM0A 2WDVA 3CB3A 1PDYA 4H2RA 3V76A 5KMPA 1CC4A 2OLNA 3B9JB 3LJPA 3ZVHA 5KVIA 2QA1A 4A65A 3V5CA 1GPEA 2WOVA 3AYLA 1PXCA 2TPRA 1VG9A 3VRDB 2OG9A 5IDZA 2PP0A 4RG4A 3ZLGA 1JRZA 4CY8A 3Q4DA 4DHGA 3UKPA 3T31A 1NELA 3TJIA 2QJMA 3QSSA 2C73A 3CXOA 3SQPA 3FCPA 3DGHA 4OCGA 4ADWA 1FHVA 3CNJA 2PGEA 3T6CA 1TZZA 4YWSA 2WP5A 2QDDA 2V6OA 4BK1A 3GSIA 3AEFA 3SBFA 3BNUA 3NVZB 1X2GA 5JCIA 4E8GA 1DODA 2W0HA 3AN1A 2JB3A 2Z5XA 3UTHA 4GR1A 3AE3A 2AKZA 1MUCA 1MXTA 2PHHA 1CJ2A 1N61C 5FJOA 3AE4A 2GGEA 2BYBA 3A7UA 1O95A 1CHUA 5U63A 2FJDA 3AD7B 1S3EA 4FI4A 4YXDA 2YLZA 3I6TA 4EM3A 3GD6A 3AE6A 3NTAA 3JZUA 3ICTA 3VRBA 3GY1A 5KVHA 4B65A 1KF6A 4NEVA 1VDCA 3RP6A 4IA5A 2P8BA 1IUXA 2QA2A 1ONEA 1O5WA 1D7YA 3DJJA 2YLWA 3CT2A 3N4EA 3MZNA 3AMZA 3ZLHA 3QFBA 1SJBA 3CYJA 3KVEA 2X8CA 1GRTA 4JY2A 1KCZA 4NWZA 3R07C 4NTCA 1ZOYA 1GXFA 1E1LA 3VFCA 4CCQA 2WPEA 4B68A 1BZLA 1E1NA 3COXA 3KUMA 4DX3A 2YWLA 2P8CA 1LQUA 3T8QA 4IV9A 2C65A 2ONEA 1JEHA 3ZDNA 1ZMCA 1CJ4A 2QGYA 2OZ8A 1M6IA 1H83A 2GVCA 4A99A 2NQLA 4DSHA 3FMWA 1EL7A 4FK1A 4A35A 1CBOA 2GR1A 4LIIA 4CRTA 3D8XA 4II2A 2HNEA 4O5QA 2O56A 3II4A 4EQSA 1YQ4A 4FDCB 1ZK7A 2OLOA 3EPTA 2PTYA 3FYYA 2DKHA 2WU5A 3AB1A 2AAQA 2WOWA 4ECHA 2QJNA 2PYXA 4BURA 3LOVA 2R4JA 4CCRA 4K1WA 3AXBA 3KPKA 1S2YA 1R6WA 2XSXA 4Z44A 5FJRA 1GTEA 5BUKA 4YKFA 2EQ9A 4AP3A 5LV9A 3B6DA 3CMMA 2GV8A 2VVLA 2CFYA 2OLAA 4DYEA 6ENLA 1B4VA 2WBAA 4ROPA 1KNRA 3NYEA 1ZKQA 3AM9A 2GR2A 1KN0A 3DERA 2WEUA 1H82A 4H2QA 4H4WA 2R45A 3GYIA 2HXUA 3P4PA 2C75A 4GDEA 1GEUA 4EM4A 5M10A 3GD4A 2CHRA 1NHPA 1TDOA 3IC9A 4GISA 3R0KA 2JB1A 1EBGA 2XFNA 3NNEA 3NXLA 1ECQA 2E4GA 3VC6A 2BCGG 2RGHA 2BABA 4WX1A 4TM3A 1N4WA 3IJLA 3LADA 2POZA 2V3BA 1DOEA 1LJ1A 2PMQA 3R1ZA 4HCDA 4Z43A 3DFHA 1FIQB 3NFUA 1NHSA 3NRNA 3DEQA 3S5WA 4YWOA 2WQYA 2GDQA 3UKAA 3SSZA 1D4CA 3KPFA 1DOBA 3F8DA 3CK5A 2YR6A 5C3JA 3UJEA 4C74A 3GDPA 1O94A 1B5QA 2XLSA 5FJUA 3S47A 4C5OA 4Z24A 4A79A 3FBSA 3EEZA 3HYXA 2AR8A 3SZWA 4YSHA 4B63A 4EQXA 3TW9A 1NENA 5HXIA 3QFAA 5EU9A 4USQA 1STZA 3NVYB 4YT0A 3ALLA 3V3WA 1NDAA 4HPNA 3RCYA 4EMJA 1JU2A 1CJCA 5BULA 3M0OA 4K5SA 3RITA 1PHHA 4JNAA 4NNJA 3DESA 3SZ0A 3UOYA 2PU0A 5KMRA 1FEBA 4HYRA 3UKFA 4GGHA 2XLRA 1N63C 3HPFA 1H7XA 3E1TA 1OJCA 5FS6A 1N5WC 4G73A 3B3RA 4WCTA 2PTXA 2E5AA 2OFJA 3P3BA 3EF6A 1JNZA 4BJYA 3K7MX 1XPQA 3SJNA 1W4XA 4U8OA 4E6MA 1X2HA 3UOXA 3L8KA 3FIMB 3OZMA 3M12A 2YR4A 2WPCA 2GGGA 1E39A 2WESA 4J3ZA 1PJ6A 3RNMA 3GMBA 3ALJA 4U8IA 3UJRA 2YQUA 2YG7A 5JCNA 4OPCA 1EC7A 3TQPA 1EL9A 4FK1C 1ZP0A 1DNCA 2H89A 2GQFA 4Z2TA 4KPLA 2Y6RA 1E9IA 3SFEA 1FHUA 2B76A 3UCCA 1JPDX 2WOIA 2DKIA 3AE1A 3GRTA 1FFUC 4J56A 3SR6B 3RR1A 3DMEA 1OJTA 1K4QA 3VR8A 3H7VA 1S2QA 4B66A 3NO1A 3AEEA 2HZGA 4OPDA 2GGJA 3CXBA 4G9KA 4E0VA 3CPIG 2WS3A 7ENLA 2JAEA 2GR0A 5GRTA 2XVHA 3AE5A 4GCMA 4JQ9A 5KWFA 1YY5A 4J2WA 5FS8A 2BXRA 2WDQA 1IYXA 2GQWA 3FV9A 2FJAA 5G5GB 1BWCA 2A87A 2NVKX 5JRBA 4OPIA 1L9EA 3FG2P 4IA6A 2PP1A 4DWDA 4A3RA 4DNAA 1QO8A 1K0JA 2P88A 1D5TA 3DIPA 1JCTA 2FJEA 2TMDA 2EQ7A 4K2SA 3SN0A 3L5OA 4B69A 1QLBA 4GUVA 4TLZA 2MUCA 1S7MA 1GREA 4Z2UA 3BOXA 2P3ZA 5IQ4A 1SB3B 3REDA 3AEBA 3NK1X 3NN6X 4O5UA 4J34A 1WUFA 3SQSA 3UJSA 3NVVB 3THUA 4ZCCA 4U2SA 2QVHA 3TOYA 4XWRA 1LVLA 3Q6JA 4DXKA 3H4KA 4B67A 1Y56B 3KU9A 3T2KA 2XH4A 5TR3A 3VA8A 4AP1A 2GSHA 3AE7A 4H4RA 2BCPA 3T0KA 2OX4A 3AEDA 4G7FA 4G6GA 4IVMB 1GERA 4Y4NA 4GIRA 1BQGA 5M0ZA 1B8SA 3AYIA 5HHFA 5EBKA 2BA9A 2XLTA 3D1CA 3GO2A 3GDNA 2PSNA 4Z1YA 3NTDA 4YSXA 5JCKA 2XFUA 1SJDA 4G74A 3OPSA 4OPGA 2PGWA 4AT0A 2J3NA 1PDHA 2W3SA 1PJ7A 2WDRA 4IZGA 3STPA 1PXBA 1CJ3A 3D46A 3G5QA 1JRPA 1NAAA 5IQ1A 2ZZ0A 1EC8A 2PU1A 2A8XA 4HA6A 1XHCA 1VQZA 2YG5A 1H81A 3DK4A 3NKSA 4JN7A 2PODA 2BC1A 5FMHA 2V61A 1DJQA 1PBDA 3ZVIA 3O0HA 4OPUA 2DW7A 3VCCA 1NG4A 3NG7X 2X99A 2B7SA 2BS4A 4C3XA 1F8WA 3PG6A 2C3CA 3ES7A 1KSSA 3DJEA 3DG6A 3R11A 3CIRA 1PS9A 1IUSA 5BOEA 2AQJA 3T14A 3N6HA 2QCUA 3IWAA 4TVYA 4EQRA 3GYXA 1LQTA 3UKQA 3ITJA 3QPEA 2C7GA 3RRAA 2HXTA 3MQTA 4K2XA 1TKKA 2XFOA 1VRQB 2VRMA 3N4FA 2C3DA 1PBFA 2OQHA 1ZXIC 2YG6A 3UCDA 1N60C 3ETRB 3IJQA 1KKRA 1Q9IA 2VRLA 2VOUA 1GSNA 1N4UA 1VQWA 1XS2A 3QJ4A 2XH7A 3UJFA 4GYPA 3V5FA 2AL2B 4LA1A 2B7RA 4H7UA 1LPFA 4YSZA 2PTZA 3EAOA 5J04A 4U8JA 1Y56A 4U2TA 3QLDA 1NEKA 1MNSA 3QKEA 4BV6A 3NK0X 1E6EA 3S61A 5GSNA 2OKTA 4OVIA 3NZGA 3UKHA 2Z5YA 5U25A 5U1OA 4IT1A 3IHMA 4Z26A 1Z6LA 3PO7A 1KD0A 4J31A 1FO4A 1D7LA 4MGGA 3I4KA 1GALA 1W6TA 2C4CA 4RSLA 4KEMA 3A7AA 1H7WA 4IVOB 4GAPA 2GAGB 2RGOA 2GEWA 2X8GA 4GGBA 3DG3A 2X50A 3C4AA 4GDPA 3CNDA 4H4XA 2C66A 4I58A 4J33A 2XYOA 3UTGA 2IVEA 5EOWA 3TWBA 2GMJA 3CGDA 3HRDC 3ALMA 4NZHA 1COYA 2QQ6A 3T2YA 2GB0A 3UXKA 3I3LA 3DH9A 2OQYA 4A6NB 1F9CA 2GR3A 1P48A 3NK2X 2R0PA 3B97A 2WHDA 4M52A 5FS9A 3QSMA 4NEWA 2WPFA 1ZY8A 2R0CA 4K5RA 3AECA 2HQMA 4OPLA 4EIPA 4YTMA 4H4TA 3SM8A 2YVFA 2Q0LA 3SZFA 2BACA 1B37A 1XPYA 2ZZBA 5FJPA 2YAUA 1DOCA 5KOXA 4U8NA 3DG7A 2R0GA 2ZBWA 2JK6A 3GYJA 2IVDA 3QTPA 3FVDA 2WP6A 3SN1A 3OZ2A 4E5TA 4TVWA 1YQ3A 1IUWA 4GFIA 3AWIA 2XGZA 1BKHA 4DGKA 4REKA 2AL2A 3VRAA 3PFRA 3V4BA 3TWAA 2GGHA 1MOKA 1M64A 4G8TA 1Y0PA 1DJNA 4E4UA 3MY9A 4ZOHB 1NHRA 2ZC8A 4JN9A 5BRTA 3SZCA 4N9XA 3G5RA 2XFQA 1T3QC 4PAAA 1ZMDA 3T9PA 4Z2RA 3ATRA 1IUTA 3Q45A 2CVJA 3NN0X 3NYFA 2XVIA 2PTWA 4AOSA 4Z25A 3SX6A 4APNA 2H88A 1TDFA 5J7XA 2RGJA 3AYJA 3URHA 1D4EA 2YG4A 1RYIA 4OPTA 1CL0A 1GETA 3DFYA 1P2HA 3C96A 1SJAA 3P4RA 5DBJA 4KX6A 2PPGA 3L1RA 2E1MA 3SY4A 1PN0A 3NRZB 3GD3A 1OEPA 4HB9A 4TLXA 2F5ZA 2EQ8A 2XFPA 4ENLA 4IP5A 3ENLA 1KDGA 2VQBA 4UDPA 2I0ZA 3K1GA 3H12A 1GT8A 2C64A 2I5QA 4YTNA 4K22A 1WYGA 3VC5A 3IHGA 3KA7A 1TDKA 3CGBA 4BJZA 1N4VA 3NVWB 1OJAA 1F8RA 1TYPA 2ACZA 3T4WA 2VQ7A 3BI2A 4JY3A 4YKGA 4X9NA 1Q1RA 2XH0A 2E5VA 2YLRA 2AL1A 2AKMA 4FX9A 1QJDA 4BK3A 2C76A 1YEYA 3AE9A 2VZ2A 4A5LA 3UTFA 3UKKA 1F6MA 3NT6A 1YKJA 4X4JA 3F8RA 1NU5A 1H86A 2R46A 4ZCDA 1NPXA 1ELSA 4H4QA 4A7AA 4J57A 1L8PA 1REOA 4ZCWA 2ZADA 1BF3A 3QVRA 4FP1A 1BKWA 1FOHA 4UDRA 3ATQA 1IUVA 1H6VA 4IP4A 4HCLA 1FEAA 5IPYA 1GRHA 2B9XA 2OALA 1VDVA 4AOXA 2OZ3A 4HCHA 2BC0A 2R4EA 1N1PA 3LZWA 2B9WA 3ICRA 5FS7A 2B9YA 3AE2A 3NHOX 3SFDA 4H50A 1PBBA 4EIQA 1SJCA 3AEGA 3PWGA 3MKCA 3S5SA 3BJSA 1PXAA 3SYIA 3V3OA 3ADAB 3P4SA 3R0UA 4J1OA 3BHKA 3K7QX 1IUUA 2DW6A 2FYMA 3PS9A 2RABA 3GRSA 4KT2A 4HNCA 2A89A 2QJJA 3LZXA 3BI5A 2PS2A 3DDMA 2ARDA 3ISHA 2PCEA 1SEZA 3F8PA 3NH3X 4HN8A 3CNPA 4H4UA 1GNDA 2Q0KA 1ELIA 2JKCA 2XLPA 4C77A 1CC6A 1BGNA 2X8HA 3HYWA 4X2PA 4XXGA 1L9DA 3H8LA 1JNRA 4CNJA 2NPXA 5JCMA 2O9ZA 3RP8A 3VCNA 3UJ2A 3CPJG 3CN8A 1EBDA 3RP7A 1OJ9A 2EQ6A 5KMSA 1N5XA 3DJGX 3NIXA 4H1ZA 3SGLA 3H8AA 1Q1WA 2WETA 4U2LA 3TCSA 2QAEA 2C67A 2CULA 1JRYA 4GAVA 4ICYA 2XH2A 4NTEA 4XWZA 3P0WA 4UP3A 3OP2A 3JW7A
chains in the Genus database with same CATH topology
1H7XA 3E1TA 2X8GA 3DK8A 1CF3A 1YQZA 1GRBA 2X50A 1OJCA 1HYUA 3C4AA 5HY5A 4GDPA 5FS6A 3HYVA 2V3AA 2V5ZA 2BRYA 3CNDA 3IF9A 1DXLA 4X9MA 1V59A 4BK1A 3VQRA 3VR9A 4H4XA 2C66A 4H4ZA 4I58A 4J33A 4G73A 3B3RA 2XYOA 3UTGA 1GRAA 1E7PA 3CPHG 4TM0A 4WCTA 4A9WA 2WDVA 2IVEA 3NLCA 4H2RA 3HZLA 3V76A 5EOWA 5KMPA 1CC4A 2OLNA 1PBCA 2GMJA 3UKLA 2IIDA 3EF6A 2JBVA 1JNZA 3CGDA 3LJPA 4BJYA 3K7MX 2UZZA 3ALMA 5KVIA 2QA1A 1XPQA 4A65A 1GRFA 1GPEA 2WOVA 4Y4MA 4NZHA 1COYA 3AYLA 1ONFA 3T2YA 1W4XA 4U8OA 2GB0A 4YSYA 4II3A 3I3LA 3DH9A 1PXCA 3ZYXA 3UOXA 3L8KA 3FIMB 4A6NB 5KOWA 2TPRA 1VG9A 2GR3A 3VRDB 3M12A 3NK2X 4YTPA 2R0PA 2YR4A 4RG4A 2WHDA 2WPCA 4M52A 4C3YA 5FS9A 1E39A 3QSMA 2WESA 1JRZA 2BK4A 4CY8A 3R9UA 1PJ6A 3UKPA 3RNMA 4RG3A 3T31A 3GMBA 3ALJA 4U8IA 4NEWA 2WPFA 2YQUA 3UP5A 3QSSA 2YG7A 2C73A 1ZY8A 2R0CA 5JCNA 4K5RA 4OPCA 2YVJA 3SQPA 1EL9A 4FK1C 1ZP0A 1DNCA 3DGHA 2HQMA 3AECA 3GWFA 1BGJA 3KD9A 4OPLA 3CGEA 4OCGA 4ADWA 2H89A 2GQFA 1CC2A 4YTMA 4EIPA 4Z2TA 3CNJA 4H4TA 3GSIA 2Y6RA 3SM8A 3SFEA 5EB4A 1L9CA 3DJDA 2YVFA 2WP5A 2B76A 2V6OA 2Q0LA 3BNMA 3SZFA 2BACA 1TDNA 1B37A 2VVLG 2WOIA 2ZZBA 2XVEA 2YAUA 2DKIA 3AE1A 3BI4A 2C72A 3AEFA 3BNUA 3GRTA 3FPZA 4J56A 1DOCA 5KOXA 4U8NA 3DMEA 3UOZA 5JCIA 1OJTA 2R0GA 3I6DA 2ZBWA 2JK6A 1AOGA 1DODA 3GYJA 2W0HA 3SXIA 2JB3A 4B64A 2Z5XA 1K4QA 2IVDA 3VR8A 3UTHA 4GR1A 1S2QA 3AE3A 5EB5A 1H84A 1MXTA 4B66A 2PHHA 1CJ2A 3AEEA 2WP6A 4OPDA 3OZ2A 3NYCA 4AT2A 3AE4A 1YQ3A 5L46A 2BYBA 1IUWA 1O95A 3M13A 4G9KA 3AWIA 4E0VA 4DGKA 3CPIG 1CHUA 2WS3A 3CTYA 3K7TA 5U63A 1TRBA 2FJDA 2JAEA 2XDOA 3AD7B 2GR0A 4REKA 2CDUA 5GRTA 1S3EA 1RP0A 2XVHA 3AE5A 4GCMA 5CQFA 3VRAA 4YXDA 4JQ9A 5KWFA 1YY5A 4J2WA 1MOKA 2YLZA 5FS8A 1M64A 4EQWA 1Y0PA 4EM3A 2BXRA 2WDQA 1DJNA 4H4PA 3AE6A 1L0VA 2GH5A 2GQWA 3NTAA 1NHRA 4JN9A 5BRTA 3ICTA 3VRBA 3SZCA 2FJAA 4N9XA 1BWCA 5KVHA 4B65A 1UKVG 1KF6A 2NVKX 4NEVA 1ZDLA 1VDCA 2A87A 3G5RA 3RP6A 5JRBA 4IA5A 2ZZCA 2XFQA 4OPIA 2YM2A 4H2NA 1IUXA 2BS2A 4PAAA 1L9EA 1PBEA 1ZMDA 3ICSA 1EL5A 4Z2RA 2QA2A 3FG2P 4IA6A 1O5WA 1D7YA 3DJJA 2YLWA 3JSKA 3ATRA 4TM1A 1IUTA 3T2ZA 3P1WA 4DNAA 1QO8A 2CVJA 1K0JA 3NN0X 1D5TA 3QFBA 1K0IA 2TMDA 2BRAA 2FJEA 2EQ7A 1K0LA 3NYFA 4P9SA 2XVIA 3KVEA 3L5OA 4AOSA 2X8CA 4B69A 1GRTA 1QLBA 4GUVA 4H4VA 4CBQA 2BK5A 4JY2A 4TLZA 3SX6A 4NWZA 4Z25A 4APNA 2H88A 1TDFA 4NTCA 1ZOYA 1S7MA 5J7XA 1GREA 3UCLA 1GXFA 1E1LA 4Z2UA 2RGJA 3AYJA 1GTHA 4CCQA 2YVGA 3URHA 1D4EA 2WPEA 4B68A 1BZLA 1RSGA 5IQ4A 3D9XA 2YG4A 1E1NA 1RYIA 4OPTA 4CY6A 3REDA 1CL0A 1GETA 3C96A 1P2HA 3AEBA 3COXA 3NK1X 3NN6X 4MJWA 2YWLA 1GESA 3QSEA 3P4RA 1LQUA 2WP9A 4O5UA 5DBJA 1IJHA 5BVAA 4IV9A 4KX6A 4J34A 1OJDA 2C65A 3C4NA 3L1RA 2E1MA 3SY4A 1JEHA 4ZCCA 3ZDNA 1PN0A 4U2SA 1ZMCA 1CJ4A 3GD3A 4XWRA 1M6IA 1H83A 4HB9A 1LVLA 3Q6JA 2GMHA 2GVCA 4TLXA 4A99A 5KRQA 4DSHA 3H4KA 2F5ZA 2EQ8A 1EL7A 1Y56B 2XFPA 3FMWA 4FK1A 4B67A 1KDGA 2VQBA 3KU9A 3T2KA 4UDPA 2I0ZA 1E1MA 1GT8A 4EMIA 2C64A 5TR3A 1CBOA 1ZOVA 4YTNA 2FJBA 2GF3A 4K22A 2GR1A 4AP1A 4LIIA 1JOAA 3AE7A 2R9ZA 3IHGA 4H4YA 3KA7A 1TDKA 4H4RA 4CRTA 2BCPA 3CGBA 3T0KA 3WE0A 4BJZA 3AEDA 1N4VA 4D04A 1P2EA 4UDQA 1OJAA 3D8XA 4II2A 4O5QA 1F8RA 1TYPA 2ACZA 4G6GA 3II4A 2YLXA 4EQSA 1GERA 1YQ4A 4FDCB 2VQ7A 3BI2A 4JY3A 4X9NA 1ZK7A 4Y4NA 4YKGA 5M0ZA 1Q1RA 1B8SA 2OLOA 2E5VA 3EPTA 3AYIA 3K30A 2YLRA 2DKHA 2WU5A 5HHFA 5EBKA 2BA9A 2XLTA 3D1CA 3AB1A 2AAQA 2WOWA 1KNPA 3GDNA 4FX9A 1QJDA 2XVFA 1S3BA 3UOVA 4BK3A 3NTDA 4ECHA 2GRTA 4YSXA 5JCKA 4ZN0A 2C76A 2PYXA 2XFUA 4G74A 4K8DA 1KFYA 3DK9A 3AE9A 1LV0A 3H8IA 4OPGA 2VZ2A 4BURA 3G5SA 3NGCX 4AT0A 4DSGA 3LOVA 2Q6UA 1FL2A 2R4JA 3AD8B 4A5LA 3UTFA 3UKKA 4CCRA 1F6MA 3AXBA 3DGZA 1TDEA 3NT6A 2J3NA 1PDHA 1PJ7A 1YKJA 4X4JA 3F8RA 3KPKA 1S2YA 2WDRA 1H86A 2R46A 4Z44A 4ZCDA 1PXBA 1NPXA 1GTEA 5BUKA 2Y6QA 5ER0A 1CJ3A 4YKFA 2EQ9A 4AP3A 5LV9A 3B6DA 4H4QA 3CMMA 4A7AA 2GV8A 2VVLA 3G5QA 4J57A 1REOA 1NAAA 5IQ1A 2ZZ0A 2OA1A 2A8XA 4HA6A 2XVJA 1BF3A 1XHCA 4BK2A 2BXSA 2CFYA 2YG5A 4LU6A 3QVRA 1H81A 4D03A 3EANA 1B4VA 2WBAA 3DK4A 1BKWA 1KNRA 1FOHA 4UDRA 3NKSA 3NYEA 1ZKQA 2WU2A 2XLUA 3QVPA 2GR2A 2YM1A 3ATQA 1KN0A 1IUVA 1H6VA 3LB8A 5CKUA 2BC1A 2WEUA 1H82A 5FMHA 4H2QA 4H4WA 1E1KA 1FEAA 5IPYA 2V61A 1GRHA 2R45A 2B9XA 1DJQA 3GYIA 1F8SA 1PBDA 2OALA 3O0HA 3P4PA 2C75A 2OAMA 4GDEA 4OPUA 5C2TA 1GEUA 4EM4A 1GRGA 1GV4A 4AOXA 3P4QA 2YLSA 1XDIA 5M10A 1NG4A 1X31B 3NG7X 3GD4A 2BC0A 1NHPA 2R4EA 1TDOA 3IC9A 1N1PA 2X99A 2B7SA 3LZWA 1TYTA 1GOSA 2B9WA 3AD9B 3ICRA 4U8LA 2BS4A 5FS7A 4U8MA 3UTEA 4C3XA 1F8WA 2B9YA 3PG6A 3AE2A 3NHOX 3SFDA 2JB1A 4H50A 2XFNA 1PBBA 4EIQA 2C3CA 1KSSA 3DJEA 3NNEA 1KSUA 3CIRA 4JDRA 1PS9A 1IUSA 4CNKA 3AEGA 2AQJA 4G6HA 4PABA 2V60A 2E4GA 3CNTA 2BCGG 2RGHA 3AEAA 3T14A 2C70A 2BABA 2QCUA 3IWAA 4EQRA 3GYXA 1PXAA 1LQTA 4WX1A 3UKQA 3ITJA 3UP4A 4TM4A 3T37A 3KLJA 3SYIA 3V3OA 4GF7A 3ADAB 4TM3A 4JNQA 2C7GA 3DA1A 3P4SA 1N4WA 4IVMB 2VVMA 5HYMA 4H2PA 4U8KA 4K2XA 5KMQA 4I59A 3LADA 4GRTA 2V3BA 1VRQB 1DOEA 2XFOA 2VRMA 2BK3A 3BHKA 3K7QX 1IUUA 3AE8A 2C3DA 1LJ1A 1PBFA 4J36A 1JRXA 3PS9A 2RABA 2YLTA 4K7ZA 2JB2A 2YG6A 3GRSA 4Z43A 2A89A 1NHQA 1Q9IA 4H4SA 2VRLA 2YG3A 1PJ5A 2VOUA 1GSNA 3GWDA 1N4UA 1VQWA 3LZXA 1NHSA 3NRNA 3BI5A 3ABVA 3S5WA 4A6NA 2ARDA 4YWOA 2WQYA 2YR5A 3ISHA 3QJ4A 4NTDA 3UKAA 1D4CA 3KPFA 1SEZA 3F8PA 1DOBA 3V3NA 3NH3X 3CNSA 3F8DA 2APGA 4B1BA 4LA1A 2B7RA 4H7UA 4U8PA 5J60A 3CNPA 1LPFA 4H4UA 2YR6A 4YSZA 4Y4LA 3GMCA 1GNDA 2GAHB 5C3JA 2Q0KA 1ELIA 2JKCA 2XLPA 5JCLA 3EAOA 3LXDA 3GDPA 4C77A 1CC6A 1B5QA 1O94A 1BGNA 2XLSA 4U8JA 2X8HA 3HYWA 4C74A 5KNLA 1Y56A 4U2TA 1FECA 4XXGA 1L9DA 4C5OA 1NEKA 1H2IA 4Z24A 3KKJA 3H8LA 4BV6A 1JNRA 3NK0X 4CNJA 2FBWA 2NPXA 4A79A 3FBSA 1E6EA 3S61A 3PVCA 1LTXR 5GSNA 3HYXA 2AR8A 4OVIA 3SZWA 3OC4A 1NG3A 3UKHA 4YSHA 4B63A 4KPRA 2Z5YA 1F3PA 5U25A 1VG0A 1XANA 5U1OA 3IHMA 4EQXA 4Z26A 5JCMA 2O9ZA 4USRA 3RP8A 1NENA 1Z6LA 5HXIA 5KXJA 3CPJG 3CN8A 3QFAA 3PO7A 1EBDA 4J31A 4USQA 1OJ9A 3RP7A 4YT0A 1D7LA 2EQ6A 3ALLA 5KMSA 2Q7VA 1NDAA 1GALA 3DJGX 3NIXA 4EMJA 3SGLA 1MO9A 2X3NA 1Q1WA 1D4DA 2C4CA 2WETA 4RSLA 1JU2A 3Q9TA 4U2LA 1CJCA 2QAEA 5BULA 3BHFA 1H7WA 2C67A 2CULA 1JRYA 3P9UA 2BS3A 3M0OA 1PHHA 4GAVA 4ICYA 4IVOB 4GAPA 4JNAA 4K5SA 4NTEA 4NNJA 4XWZA 3SZ0A 3CGCA 2GAGB 2RGOA 3UOYA 4EMWA 1FCDA 5KMRA 4UP3A 1FEBA 3RHAA 1EL8A 3UKFA 2XLRA 2GEWA 2XCGA 1ZX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7X A;  3E1T A;  2X8G A;  3DK8 A;  1CF3 A;  1YQZ A;  1GRB A;  2X50 A;  1OJC A;  1HYU A;  3C4A A;  5HY5 A;  4GDP A;  5FS6 A;  2V3A A;  2V5Z A;  3CND A;  3IF9 A;  1DXL A;  4X9M A;  1V59 A;  4BK1 A;  3VQR A;  3VR9 A;  4H4X A;  2C66 A;  4H4Z A;  4I58 A;  4J33 A;  3B3R A;  2XYO A;  3UTG A;  1GRA A;  1E7P A;  3CPH G;  4TM0 A;  4WCT A;  4A9W A;  2WDV A;  2IVE A;  3NLC A;  4H2R A;  3HZL A;  3V76 A;  5EOW A;  1CC4 A;  2OLN A;  1PBC A;  2GMJ A;  3UKL A;  2IID A;  3EF6 A;  2JBV A;  1JNZ A;  3CGD A;  3LJP A;  4BJY A;  3K7M X;  2UZZ A;  3ALM A;  5KVI A;  2QA1 A;  1XPQ A;  4A65 A;  1GRF A;  1GPE A;  2WOV A;  4Y4M A;  4NZH A;  1COY A;  3AYL A;  1ONF A;  1W4X A;  4U8O A;  2GB0 A;  4YSY A;  3I3L A;  3DH9 A;  1PXC A;  3ZYX A;  3UOX A;  3L8K A;  3FIM B;  4A6N B;  5KOW A;  2TPR A;  1VG9 A;  2GR3 A;  3VRD B;  3M12 A;  3NK2 X;  4YTP A;  2R0P A;  2YR4 A;  4RG4 A;  2WHD A;  2WPC A;  4M52 A;  4C3Y A;  5FS9 A;  1E39 A;  3QSM A;  2WES A;  1JRZ A;  2BK4 A;  4CY8 A;  3R9U A;  1PJ6 A;  3UKP A;  3RNM A;  4RG3 A;  3GMB A;  3ALJ A;  4U8I A;  4NEW A;  2WPF A;  2YQU A;  3UP5 A;  3QSS A;  2YG7 A;  2C73 A;  1ZY8 A;  2R0C A;  5JCN A;  4K5R A;  4OPC A;  2YVJ A;  3SQP A;  1EL9 A;  4FK1 C;  1ZP0 A;  1DNC A;  3DGH A;  2HQM A;  3AEC A;  3GWF A;  1BGJ A;  3KD9 A;  4OPL A;  3CGE A;  4OCG A;  4ADW A;  2H89 A;  2GQF A;  1CC2 A;  4YTM A;  4EIP A;  4Z2T A;  3CNJ A;  4H4T A;  3GSI A;  2Y6R A;  3SM8 A;  3SFE A;  5EB4 A;  1L9C A;  3DJD A;  2YVF A;  2WP5 A;  2B76 A;  2V6O A;  2Q0L A;  3BNM A;  2BAC A;  1TDN A;  1B37 A;  2VVL G;  2WOI A;  2ZZB A;  2XVE A;  2YAU A;  2DKI A;  3AE1 A;  3BI4 A;  2C72 A;  3AEF A;  3BNU A;  3GRT A;  3FPZ A;  4J56 A;  1DOC A;  5KOX A;  4U8N A;  3DME A;  3UOZ A;  5JCI A;  1OJT A;  2R0G A;  3I6D A;  2ZBW A;  2JK6 A;  1AOG A;  1DOD A;  3GYJ A;  2W0H A;  2JB3 A;  4B64 A;  2Z5X A;  1K4Q A;  2IVD A;  3VR8 A;  3UTH A;  4GR1 A;  1S2Q A;  3AE3 A;  5EB5 A;  1H84 A;  1MXT A;  4B66 A;  2PHH A;  1CJ2 A;  3AEE A;  2WP6 A;  4OPD A;  3OZ2 A;  3NYC A;  4AT2 A;  3AE4 A;  1YQ3 A;  5L46 A;  2BYB A;  1IUW A;  1O95 A;  3M13 A;  3AWI A;  4E0V A;  4DGK A;  3CPI G;  1CHU A;  2WS3 A;  3CTY A;  3K7T A;  5U63 A;  1TRB A;  2FJD A;  2JAE A;  2XDO A;  3AD7 B;  2GR0 A;  4REK A;  2CDU A;  5GRT A;  1S3E A;  1RP0 A;  2XVH A;  3AE5 A;  4GCM A;  5CQF A;  3VRA A;  4YXD A;  4JQ9 A;  5KWF A;  1YY5 A;  4J2W A;  1MOK A;  2YLZ A;  5FS8 A;  1M64 A;  4EQW A;  1Y0P A;  4EM3 A;  2BXR A;  2WDQ A;  1DJN A;  4H4P A;  3AE6 A;  1L0V A;  2GH5 A;  2GQW A;  3NTA A;  1NHR A;  4JN9 A;  5BRT A;  3ICT A;  3VRB A;  2FJA A;  4N9X A;  1BWC A;  5KVH A;  4B65 A;  1UKV G;  1KF6 A;  2NVK X;  4NEV A;  1ZDL A;  1VDC A;  2A87 A;  3G5R A;  3RP6 A;  4IA5 A;  2ZZC A;  2XFQ A;  4OPI A;  2YM2 A;  4H2N A;  1IUX A;  2BS2 A;  4PAA A;  1L9E A;  1PBE A;  1ZMD A;  3ICS A;  1EL5 A;  4Z2R A;  2QA2 A;  3FG2 P;  4IA6 A;  1O5W A;  1D7Y A;  3DJJ A;  2YLW A;  3JSK A;  3ATR A;  4TM1 A;  1IUT A;  3T37 A;  3P1W A;  4DNA A;  1QO8 A;  2CVJ A;  1K0J A;  3NN0 X;  1D5T A;  3QFB A;  1K0I A;  2TMD A;  2FJE A;  2EQ7 A;  1K0L A;  3NYF A;  4P9S A;  2XVI A;  3KVE A;  4AOS A;  2X8C A;  4B69 A;  1GRT A;  1QLB A;  4GUV A;  4H4V A;  4CBQ A;  2BK5 A;  4JY2 A;  4TLZ A;  4Z25 A;  4APN A;  2H88 A;  1TDF A;  4NTC A;  1ZOY A;  5J7X A;  1GRE A;  3UCL A;  1GXF A;  1E1L A;  4Z2U A;  2RGJ A;  3AYJ A;  1GTH A;  4CCQ A;  2YVG A;  3URH A;  1D4E A;  2WPE A;  4B68 A;  1BZL A;  1RSG A;  5IQ4 A;  2YG4 A;  1E1N A;  1RYI A;  4OPT A;  4CY6 A;  3RED A;  1CL0 A;  1GET A;  3C96 A;  1P2H A;  3AEB A;  3COX A;  3NK1 X;  3NN6 X;  4MJW A;  2YWL A;  1GES A;  3QSE A;  3P4R A;  1LQU A;  2WP9 A;  4O5U A;  5DBJ A;  1IJH A;  5BVA A;  4IV9 A;  4KX6 A;  4J34 A;  1OJD A;  2C65 A;  3C4N A;  3L1R A;  2E1M A;  1JEH A;  4ZCC A;  3ZDN A;  1PN0 A;  4U2S A;  1ZMC A;  1CJ4 A;  3GD3 A;  4XWR A;  1M6I A;  1H83 A;  4HB9 A;  1LVL A;  3Q6J A;  2GMH A;  2GVC A;  4TLX A;  4A99 A;  5KRQ A;  4DSH A;  3H4K A;  2F5Z A;  2EQ8 A;  1EL7 A;  1Y56 B;  2XFP A;  3FMW A;  4FK1 A;  4B67 A;  1KDG A;  2VQB A;  3KU9 A;  4UDP A;  2I0Z A;  1E1M A;  1GT8 A;  4EMI A;  2C64 A;  5TR3 A;  1CBO A;  1ZOV A;  4YTN A;  2FJB A;  2GF3 A;  4K22 A;  2GR1 A;  4AP1 A;  4LII A;  1JOA A;  3AE7 A;  2R9Z A;  3IHG A;  4H4Y A;  3KA7 A;  1TDK A;  4H4R A;  4CRT A;  2BCP A;  3CGB A;  3WE0 A;  4BJZ A;  3AED A;  1N4V A;  4D04 A;  1P2E A;  4UDQ A;  1OJA A;  3D8X A;  4O5Q A;  1F8R A;  1TYP A;  2ACZ A;  4IVM B;  3II4 A;  2YLX A;  4EQS A;  1GER A;  1YQ4 A;  4FDC B;  2VQ7 A;  3BI2 A;  4JY3 A;  4X9N A;  1ZK7 A;  4Y4N A;  4YKG A;  5M0Z A;  1Q1R A;  1B8S A;  2OLO A;  2E5V A;  3EPT A;  3AYI A;  3K30 A;  2YLR A;  2DKH A;  2WU5 A;  5HHF A;  5EBK A;  2BA9 A;  2XLT A;  3D1C A;  3AB1 A;  2AAQ A;  2WOW A;  1KNP A;  3GDN A;  4FX9 A;  1QJD A;  2XVF A;  1S3B A;  3UOV A;  4BK3 A;  3NTD A;  4ECH A;  2GRT A;  4YSX A;  5JCK A;  4ZN0 A;  2C76 A;  2PYX A;  2XFU A;  4K8D A;  1KFY A;  3DK9 A;  3AE9 A;  1LV0 A;  3H8I A;  4OPG A;  2VZ2 A;  4BUR A;  3G5S A;  3NGC X;  4AT0 A;  4DSG A;  3LOV A;  2Q6U A;  1FL2 A;  2R4J A;  3AD8 B;  4A5L A;  3UTF A;  3UKK A;  4CCR A;  1F6M A;  3AXB A;  3DGZ A;  1TDE A;  3NT6 A;  2J3N A;  1PDH A;  1PJ7 A;  1YKJ A;  4X4J A;  3F8R A;  1S2Y A;  2WDR A;  1H86 A;  2R46 A;  4Z44 A;  4ZCD A;  1PXB A;  1NPX A;  1GTE A;  5BUK A;  2Y6Q A;  5ER0 A;  1CJ3 A;  4YKF A;  2EQ9 A;  4AP3 A;  5LV9 A;  3B6D A;  4H4Q A;  4A7A A;  2GV8 A;  2VVL A;  3G5Q A;  4J57 A;  1REO A;  1NAA A;  5IQ1 A;  2ZZ0 A;  2OA1 A;  2A8X A;  4HA6 A;  2XVJ A;  1BF3 A;  1XHC A;  4BK2 A;  2BXS A;  2CFY A;  2YG5 A;  4LU6 A;  3QVR A;  1H81 A;  4D03 A;  3EAN A;  1B4V A;  2WBA A;  3DK4 A;  1BKW A;  1KNR A;  1FOH A;  4UDR A;  3NKS A;  3NYE A;  1ZKQ A;  2WU2 A;  2XLU A;  3QVP A;  2GR2 A;  2YM1 A;  3ATQ A;  1IUV A;  1H6V A;  3LB8 A;  5CKU A;  2BC1 A;  2WEU A;  1H82 A;  5FMH A;  4H2Q A;  4H4W A;  1E1K A;  1FEA A;  5IPY A;  2V61 A;  1GRH A;  2R45 A;  2B9X A;  1DJQ A;  3GYI A;  1F8S A;  1PBD A;  2OAL A;  3O0H A;  3P4P A;  2C75 A;  2OAM A;  4GDE A;  4OPU A;  5C2T A;  1GEU A;  4EM4 A;  1GRG A;  1GV4 A;  4AOX A;  3P4Q A;  2YLS A;  1XDI A;  5M10 A;  1NG4 A;  1X31 B;  3NG7 X;  3GD4 A;  2BC0 A;  1NHP A;  2R4E A;  1TDO A;  3IC9 A;  1N1P A;  2X99 A;  2B7S A;  3LZW A;  1TYT A;  1GOS A;  2B9W A;  3AD9 B;  3ICR A;  4U8L A;  2BS4 A;  5FS7 A;  4U8M A;  3UTE A;  4C3X A;  1F8W A;  2B9Y A;  3AE2 A;  3NHO X;  3SFD A;  2JB1 A;  4H50 A;  2XFN A;  1PBB A;  4EIQ A;  2C3C A;  1KSS A;  3DJE A;  3NNE A;  1KSU A;  3CIR A;  4JDR A;  1PS9 A;  1IUS A;  4CNK A;  3AEG A;  2AQJ A;  4PAB A;  2V60 A;  2E4G A;  3CNT A;  2BCG G;  2RGH A;  3AEA A;  2C70 A;  2BAB A;  2QCU A;  3IWA A;  4EQR A;  1PXA A;  1LQT A;  4WX1 A;  3UKQ A;  3ITJ A;  3UP4 A;  4TM4 A;  3KLJ A;  3V3O A;  4GF7 A;  3ADA B;  4TM3 A;  4JNQ A;  2C7G A;  3DA1 A;  3P4S A;  1N4W A;  2VVM A;  5HYM A;  4H2P A;  4U8K A;  4K2X A;  4I59 A;  3LAD A;  4GRT A;  1VRQ B;  2V3B A;  1DOE A;  2XFO A;  2VRM A;  2BK3 A;  3BHK A;  3K7Q X;  1IUU A;  3AE8 A;  2C3D A;  1LJ1 A;  1PBF A;  4J36 A;  1JRX A;  3PS9 A;  2RAB A;  2YLT A;  4K7Z A;  2JB2 A;  2YG6 A;  3GRS A;  4Z43 A;  2A89 A;  1NHQ A;  1Q9I A;  4H4S A;  2VRL A;  2YG3 A;  1PJ5 A;  2VOU A;  1GSN A;  3GWD A;  1N4U A;  1VQW A;  3LZX A;  1NHS A;  3NRN A;  3BI5 A;  3ABV A;  3S5W A;  4A6N A;  2ARD A;  4YWO A;  2WQY A;  2YR5 A;  3ISH A;  3QJ4 A;  4NTD A;  3UKA A;  1D4C A;  3KPF A;  1SEZ A;  3F8P A;  1DOB A;  3V3N A;  3NH3 X;  3CNS A;  3F8D A;  2APG A;  4B1B A;  4LA1 A;  2B7R A;  4H7U A;  4U8P A;  5J60 A;  3CNP A;  1LPF A;  4H4U A;  2YR6 A;  4YSZ A;  4Y4L A;  3GMC A;  1GND A;  2GAH B;  5C3J A;  2Q0K A;  1ELI A;  2JKC A;  2XLP A;  5JCL A;  3EAO A;  3LXD A;  3GDP A;  4C77 A;  1CC6 A;  1B5Q A;  1O94 A;  1BGN A;  2XLS A;  4U8J A;  2X8H A;  4C74 A;  1Y56 A;  4U2T A;  1FEC A;  4XXG A;  1L9D A;  4C5O A;  1NEK A;  4Z24 A;  3KKJ A;  3H8L A;  4BV6 A;  1JNR A;  3NK0 X;  4CNJ A;  2FBW A;  2NPX A;  4A79 A;  3FBS A;  1E6E A;  3S61 A;  3PVC A;  1LTX R;  5GSN A;  2AR8 A;  4OVI A;  3OC4 A;  1NG3 A;  3UKH A;  4YSH A;  4B63 A;  4KPR A;  2Z5Y A;  1F3P A;  5U25 A;  1VG0 A;  1XAN A;  5U1O A;  3IHM A;  4EQX A;  4Z26 A;  5JCM A;  2O9Z A;  4USR A;  3RP8 A;  1NEN A;  1Z6L A;  5HXI A;  5KXJ A;  3CPJ G;  3CN8 A;  3QFA A;  3PO7 A;  1EBD A;  4J31 A;  4USQ A;  1OJ9 A;  3RP7 A;  4YT0 A;  1D7L A;  2EQ6 A;  3ALL A;  2Q7V A;  1NDA A;  1GAL A;  3DJG X;  3NIX A;  4EMJ A;  3SGL A;  1MO9 A;  2X3N A;  1Q1W A;  1D4D A;  2WET A;  4RSL A;  1JU2 A;  3Q9T A;  4U2L A;  1CJC A;  2QAE A;  5BUL A;  3BHF A;  1H7W A;  2C67 A;  2CUL A;  1JRY A;  3P9U A;  2BS3 A;  3M0O A;  1PHH A;  4IVO B;  4ICY A;  4JNA A;  4K5S A;  4NTE A;  4XWZ A;  3CGC A;  2GAG B;  2RGO A;  3UOY A;  4EMW A;  1FCD A;  4UP3 A;  1FEB A;  3RHA A;  1EL8 A;  3UKF A;  2XLR A;  2GEW A;  2XCG A;  1ZX9 A; 
#chains in the Genus database with same CATH topology
 2GL5 A;  3H70 A;  3DK8 A;  1GRB A;  3R10 A;  2MNR A;  2V3A A;  2V5Z A;  3IF9 A;  4X9M A;  1V59 A;  3PWI A;  3VR9 A;  4H4Z A;  2OO6 A;  3CPH G;  4A9W A;  3NLC A;  4HNL A;  3HZL A;  1PBC A;  3UKL A;  2IID A;  2JBV A;  2UZZ A;  1GRF A;  4Y4M A;  1ONF A;  4YSY A;  4II3 A;  3ZYX A;  5KOW A;  4YTP A;  4H2H A;  4C3Y A;  3UGV A;  2BK4 A;  4EWJ A;  3R9U A;  4RG3 A;  3UP5 A;  1N62 C;  2YVJ A;  3GWF A;  1BGJ A;  3KD9 A;  3CGE A;  1CC2 A;  4M6U A;  3IJI A;  5EB4 A;  1L9C A;  3DJD A;  3BNM A;  1TDN A;  2VVL G;  1JPM A;  2XVE A;  3BI4 A;  2C72 A;  3FPZ A;  3MWC A;  3UOZ A;  3I6D A;  1AOG A;  3SXI A;  4B64 A;  5EB5 A;  1H84 A;  5G5H B;  2FKP A;  3NYC A;  4AT2 A;  1JRO A;  5L46 A;  2GGI A;  2W3R A;  5ENL A;  3M13 A;  3CTY A;  3ZLF A;  3K7T A;  1TRB A;  2XDO A;  4K8G A;  2CDU A;  1RP0 A;  5CQF A;  4EQW A;  4H4P A;  3MSY A;  1L0V A;  3I6E A;  2GH5 A;  4ZA0 A;  1UKV G;  1ZDL A;  3OW1 A;  2ZZC A;  2YM2 A;  4H2N A;  2BS2 A;  1PBE A;  3ICS A;  1EL5 A;  3T2Z A;  3JSK A;  4TM1 A;  3FXG A;  3P1W A;  3HW2 A;  5BOF A;  3TJ4 A;  1K0I A;  2BRA A;  1K0L A;  4P9S A;  3R25 A;  4H4V A;  2BK5 A;  4CBQ A;  1R0M A;  1MRA A;  3UCL A;  1GTH A;  2YVG A;  1RSG A;  3D9X A;  3N6J A;  3U9I A;  3RO6 A;  4CY6 A;  3CAW A;  4JHM A;  4MJW A;  1GES A;  3QSE A;  2WP9 A;  1IJH A;  5BVA A;  2E3T A;  1OJD A;  3C4N A;  4M0X A;  2GMH A;  5KRQ A;  1FFV C;  1E1M A;  4EMI A;  3VDG A;  4H19 A;  1ZOV A;  2FJB A;  1KKO A;  2GF3 A;  1JOA A;  3PK7 A;  2R9Z A;  4H4Y A;  3WE0 A;  4D04 A;  5FJT A;  1P2E A;  4UDQ A;  3T37 A;  2YLX A;  4IL2 A;  3K30 A;  4IHC A;  4IL0 A;  1KNP A;  1RM6 B;  2XVF A;  1S3B A;  3UOV A;  2GRT A;  4ZN0 A;  4K8D A;  1KFY A;  3DK9 A;  1LV0 A;  3H8I A;  3NGC X;  3G5S A;  4DSG A;  2Q6U A;  1FL2 A;  3AD8 B;  3DGZ A;  1TDE A;  1TE6 A;  3P93 A;  4JN8 A;  3UXL A;  4H83 A;  3QN3 A;  2Y6Q A;  5ER0 A;  2OZT A;  2OA1 A;  2XVJ A;  4BK2 A;  2BXS A;  1RVK A;  4LU6 A;  4D03 A;  3EAN A;  3SN4 A;  3U4F A;  2WU2 A;  2XLU A;  3QVP A;  3ZVH B;  2YM1 A;  3LB8 A;  5CKU A;  1E1K A;  1DTN A;  1F8S A;  3A7R A;  2OAM A;  5C2T A;  3EKG A;  1GRG A;  1GV4 A;  3P4Q A;  2YLS A;  1XDI A;  1X31 B;  1TYT A;  1GOS A;  3UTE A;  3AD9 B;  4U8L A;  4U8M A;  4A6G A;  1MDR A;  1KSU A;  4JDR A;  4CNK A;  3OZY A;  4G6H A;  3EUB 3;  4PAB A;  2V60 A;  3CNT A;  3AEA A;  2C70 A;  1P43 A;  2W55 A;  3UP4 A;  4TM4 A;  3KLJ A;  4GF7 A;  4Z17 A;  3GC2 A;  4JNQ A;  3DA1 A;  2VVM A;  5HYM A;  4U8K A;  5KMQ A;  4I59 A;  4GRT A;  2W54 A;  4E4F A;  2BK3 A;  2PA6 A;  3AE8 A;  4J36 A;  1JRX A;  1EBH A;  2YLT A;  4K7Z A;  3TTE A;  2JB2 A;  3NS1 B;  3IK4 A;  1NHQ A;  4H4S A;  2YG3 A;  1PJ5 A;  3GWD A;  3ABV A;  4A6N A;  4GYP C;  2YR5 A;  2PP3 A;  4NTD A;  3V3N A;  3CNS A;  2APG A;  4B1B A;  4U8P A;  5J60 A;  4MMW A;  4Y4L A;  3GMC A;  2GAH B;  5JCL A;  3LXD A;  3ES8 A;  5KNL A;  1FEC A;  4DN1 A;  1PDZ A;  1H2I A;  3KKJ A;  2FBW A;  3PVC A;  1LTX R;  3OC4 A;  1NG3 A;  3DGB A;  2OPJ A;  4KPR A;  1WUE A;  1F3P A;  1VG0 A;  1XAN A;  1MDL A;  4USR A;  3D47 A;  5KXJ A;  2Q7V A;  3RGT A;  1MO9 A;  2X3N A;  2QDE A;  2OVL A;  2P0I A;  1D4D A;  3Q9T A;  3BHF A;  4KWS A;  3P9U A;  2BS3 A;  3MUC A;  1JDF A;  4GME A;  3CGC A;  4EMW A;  2RDX A;  1EC9 A;  1FCD A;  4F4R A;  3RHA A;  1EL8 A;  4MKS A;  2XCG A;  4H2P A;  1ZX9 A;  3JVA A;  1V97 A;  3FJ4 A;  1CF3 A;  1YQZ A;  1HYU A;  5HY5 A;  3OTR A;  3HYV A;  2BRY A;  1DXL A;  3VQR A;  1GRA A;  3BSM A;  1E7P A;  4TM0 A;  2WDV A;  3CB3 A;  1PDY A;  4H2R A;  3V76 A;  5KMP A;  1CC4 A;  2OLN A;  3B9J B;  3LJP A;  3ZVH A;  5KVI A;  2QA1 A;  4A65 A;  3V5C A;  1GPE A;  2WOV A;  3AYL A;  1PXC A;  2TPR A;  1VG9 A;  3VRD B;  2OG9 A;  5IDZ A;  2PP0 A;  4RG4 A;  3ZLG A;  1JRZ A;  4CY8 A;  3Q4D A;  4DHG A;  3UKP A;  3T31 A;  1NEL A;  3TJI A;  2QJM A;  3QSS A;  2C73 A;  3CXO A;  3SQP A;  3FCP A;  3DGH A;  4OCG A;  4ADW A;  1FHV A;  3CNJ A;  2PGE A;  3T6C A;  1TZZ A;  4YWS A;  2WP5 A;  2QDD A;  2V6O A;  4BK1 A;  3GSI A;  3AEF A;  3SBF A;  3BNU A;  3NVZ B;  1X2G A;  5JCI A;  4E8G A;  1DOD A;  2W0H A;  3AN1 A;  2JB3 A;  2Z5X A;  3UTH A;  4GR1 A;  3AE3 A;  2AKZ A;  1MUC A;  1MXT A;  2PHH A;  1CJ2 A;  1N61 C;  5FJO A;  3AE4 A;  2GGE A;  2BYB A;  3A7U A;  1O95 A;  1CHU A;  5U63 A;  2FJD A;  3AD7 B;  1S3E A;  4FI4 A;  4YXD A;  2YLZ A;  3I6T A;  4EM3 A;  3GD6 A;  3AE6 A;  3NTA A;  3JZU A;  3ICT A;  3VRB A;  3GY1 A;  5KVH A;  4B65 A;  1KF6 A;  4NEV A;  1VDC A;  3RP6 A;  4IA5 A;  2P8B A;  1IUX A;  2QA2 A;  1ONE A;  1O5W A;  1D7Y A;  3DJJ A;  2YLW A;  3CT2 A;  3N4E A;  3MZN A;  3AMZ A;  3ZLH A;  3QFB A;  1SJB A;  3CYJ A;  3KVE A;  2X8C A;  1GRT A;  4JY2 A;  1KCZ A;  4NWZ A;  3R07 C;  4NTC A;  1ZOY A;  1GXF A;  1E1L A;  3VFC A;  4CCQ A;  2WPE A;  4B68 A;  1BZL A;  1E1N A;  3COX A;  3KUM A;  4DX3 A;  2YWL A;  2P8C A;  1LQU A;  3T8Q A;  4IV9 A;  2C65 A;  2ONE A;  1JEH A;  3ZDN A;  1ZMC A;  1CJ4 A;  2QGY A;  2OZ8 A;  1M6I A;  1H83 A;  2GVC A;  4A99 A;  2NQL A;  4DSH A;  3FMW A;  1EL7 A;  4FK1 A;  4A35 A;  1CBO A;  2GR1 A;  4LII A;  4CRT A;  3D8X A;  4II2 A;  2HNE A;  4O5Q A;  2O56 A;  3II4 A;  4EQS A;  1YQ4 A;  4FDC B;  1ZK7 A;  2OLO A;  3EPT A;  2PTY A;  3FYY A;  2DKH A;  2WU5 A;  3AB1 A;  2AAQ A;  2WOW A;  4ECH A;  2QJN A;  2PYX A;  4BUR A;  3LOV A;  2R4J A;  4CCR A;  4K1W A;  3AXB A;  3KPK A;  1S2Y A;  1R6W A;  2XSX A;  4Z44 A;  5FJR A;  1GTE A;  5BUK A;  4YKF A;  2EQ9 A;  4AP3 A;  5LV9 A;  3B6D A;  3CMM A;  2GV8 A;  2VVL A;  2CFY A;  2OLA A;  4DYE A;  6ENL A;  1B4V A;  2WBA A;  4ROP A;  1KNR A;  3NYE A;  1ZKQ A;  3AM9 A;  2GR2 A;  1KN0 A;  3DER A;  2WEU A;  1H82 A;  4H2Q A;  4H4W A;  2R45 A;  3GYI A;  2HXU A;  3P4P A;  2C75 A;  4GDE A;  1GEU A;  4EM4 A;  5M10 A;  3GD4 A;  2CHR A;  1NHP A;  1TDO A;  3IC9 A;  4GIS A;  3R0K A;  2JB1 A;  1EBG A;  2XFN A;  3NNE A;  3NXL A;  1ECQ A;  2E4G A;  3VC6 A;  2BCG G;  2RGH A;  2BAB A;  4WX1 A;  4TM3 A;  1N4W A;  3IJL A;  3LAD A;  2POZ A;  2V3B A;  1DOE A;  1LJ1 A;  2PMQ A;  3R1Z A;  4HCD A;  4Z43 A;  3DFH A;  1FIQ B;  3NFU A;  1NHS A;  3NRN A;  3DEQ A;  3S5W A;  4YWO A;  2WQY A;  2GDQ A;  3UKA A;  3SSZ A;  1D4C A;  3KPF A;  1DOB A;  3F8D A;  3CK5 A;  2YR6 A;  5C3J A;  3UJE A;  4C74 A;  3GDP A;  1O94 A;  1B5Q A;  2XLS A;  5FJU A;  3S47 A;  4C5O A;  4Z24 A;  4A79 A;  3FBS A;  3EEZ A;  3HYX A;  2AR8 A;  3SZW A;  4YSH A;  4B63 A;  4EQX A;  3TW9 A;  1NEN A;  5HXI A;  3QFA A;  5EU9 A;  4USQ A;  1STZ A;  3NVY B;  4YT0 A;  3ALL A;  3V3W A;  1NDA A;  4HPN A;  3RCY A;  4EMJ A;  1JU2 A;  1CJC A;  5BUL A;  3M0O A;  4K5S A;  3RIT A;  1PHH A;  4JNA A;  4NNJ A;  3DES A;  3SZ0 A;  3UOY A;  2PU0 A;  5KMR A;  1FEB A;  4HYR A;  3UKF A;  4GGH A;  2XLR A;  1N63 C;  3HPF A;  1H7X A;  3E1T A;  1OJC A;  5FS6 A;  1N5W C;  4G73 A;  3B3R A;  4WCT A;  2PTX A;  2E5A A;  2OFJ A;  3P3B A;  3EF6 A;  1JNZ A;  4BJY A;  3K7M X;  1XPQ A;  3SJN A;  1W4X A;  4U8O A;  4E6M A;  1X2H A;  3UOX A;  3L8K A;  3FIM B;  3OZM A;  3M12 A;  2YR4 A;  2WPC A;  2GGG A;  1E39 A;  2WES A;  4J3Z A;  1PJ6 A;  3RNM A;  3GMB A;  3ALJ A;  4U8I A;  3UJR A;  2YQU A;  2YG7 A;  5JCN A;  4OPC A;  1EC7 A;  3TQP A;  1EL9 A;  4FK1 C;  1ZP0 A;  1DNC A;  2H89 A;  2GQF A;  4Z2T A;  4KPL A;  2Y6R A;  1E9I A;  3SFE A;  1FHU A;  2B76 A;  3UCC A;  1JPD X;  2WOI A;  2DKI A;  3AE1 A;  3GRT A;  1FFU C;  4J56 A;  3SR6 B;  3RR1 A;  3DME A;  1OJT A;  1K4Q A;  3VR8 A;  3H7V A;  1S2Q A;  4B66 A;  3NO1 A;  3AEE A;  2HZG A;  4OPD A;  2GGJ A;  3CXB A;  4G9K A;  4E0V A;  3CPI G;  2WS3 A;  7ENL A;  2JAE A;  2GR0 A;  5GRT A;  2XVH A;  3AE5 A;  4GCM A;  4JQ9 A;  5KWF A;  1YY5 A;  4J2W A;  5FS8 A;  2BXR A;  2WDQ A;  1IYX A;  2GQW A;  3FV9 A;  2FJA A;  5G5G B;  1BWC A;  2A87 A;  2NVK X;  5JRB A;  4OPI A;  1L9E A;  3FG2 P;  4IA6 A;  2PP1 A;  4DWD A;  4A3R A;  4DNA A;  1QO8 A;  1K0J A;  2P88 A;  1D5T A;  3DIP A;  1JCT A;  2FJE A;  2TMD A;  2EQ7 A;  4K2S A;  3SN0 A;  3L5O A;  4B69 A;  1QLB A;  4GUV A;  4TLZ A;  2MUC A;  1S7M A;  1GRE A;  4Z2U A;  3BOX A;  2P3Z A;  5IQ4 A;  1SB3 B;  3RED A;  3AEB A;  3NK1 X;  3NN6 X;  4O5U A;  4J34 A;  1WUF A;  3SQS A;  3UJS A;  3NVV B;  3THU A;  4ZCC A;  4U2S A;  2QVH A;  3TOY A;  4XWR A;  1LVL A;  3Q6J A;  4DXK A;  3H4K A;  4B67 A;  1Y56 B;  3KU9 A;  3T2K A;  2XH4 A;  5TR3 A;  3VA8 A;  4AP1 A;  2GSH A;  3AE7 A;  4H4R A;  2BCP A;  3T0K A;  2OX4 A;  3AED A;  4G7F A;  4G6G A;  4IVM B;  1GER A;  4Y4N A;  4GIR A;  1BQG A;  5M0Z A;  1B8S A;  3AYI A;  5HHF A;  5EBK A;  2BA9 A;  2XLT A;  3D1C A;  3GO2 A;  3GDN A;  2PSN A;  4Z1Y A;  3NTD A;  4YSX A;  5JCK A;  2XFU A;  1SJD A;  4G74 A;  3OPS A;  4OPG A;  2PGW A;  4AT0 A;  2J3N A;  1PDH A;  2W3S A;  1PJ7 A;  2WDR A;  4IZG A;  3STP A;  1PXB A;  1CJ3 A;  3D46 A;  3G5Q A;  1JRP A;  1NAA A;  5IQ1 A;  2ZZ0 A;  1EC8 A;  2PU1 A;  2A8X A;  4HA6 A;  1XHC A;  1VQZ A;  2YG5 A;  1H81 A;  3DK4 A;  3NKS A;  4JN7 A;  2POD A;  2BC1 A;  5FMH A;  2V61 A;  1DJQ A;  1PBD A;  3ZVI A;  3O0H A;  4OPU A;  2DW7 A;  3VCC A;  1NG4 A;  3NG7 X;  2X99 A;  2B7S A;  2BS4 A;  4C3X A;  1F8W A;  3PG6 A;  2C3C A;  3ES7 A;  1KSS A;  3DJE A;  3DG6 A;  3R11 A;  3CIR A;  1PS9 A;  1IUS A;  5BOE A;  2AQJ A;  3T14 A;  3N6H A;  2QCU A;  3IWA A;  4TVY A;  4EQR A;  3GYX A;  1LQT A;  3UKQ A;  3ITJ A;  3QPE A;  2C7G A;  3RRA A;  2HXT A;  3MQT A;  4K2X A;  1TKK A;  2XFO A;  1VRQ B;  2VRM A;  3N4F A;  2C3D A;  1PBF A;  2OQH A;  1ZXI C;  2YG6 A;  3UCD A;  1N60 C;  3ETR B;  3IJQ A;  1KKR A;  1Q9I A;  2VRL A;  2VOU A;  1GSN A;  1N4U A;  1VQW A;  1XS2 A;  3QJ4 A;  2XH7 A;  3UJF A;  4GYP A;  3V5F A;  2AL2 B;  4LA1 A;  2B7R A;  4H7U A;  1LPF A;  4YSZ A;  2PTZ A;  3EAO A;  5J04 A;  4U8J A;  1Y56 A;  4U2T A;  3QLD A;  1NEK A;  1MNS A;  3QKE A;  4BV6 A;  3NK0 X;  1E6E A;  3S61 A;  5GSN A;  2OKT A;  4OVI A;  3NZG A;  3UKH A;  2Z5Y A;  5U25 A;  5U1O A;  4IT1 A;  3IHM A;  4Z26 A;  1Z6L A;  3PO7 A;  1KD0 A;  4J31 A;  1FO4 A;  1D7L A;  4MGG A;  3I4K A;  1GAL A;  1W6T A;  2C4C A;  4RSL A;  4KEM A;  3A7A A;  1H7W A;  4IVO B;  4GAP A;  2GAG B;  2RGO A;  2GEW A;  2X8G A;  4GGB A;  3DG3 A;  2X50 A;  3C4A A;  4GDP A;  3CND A;  4H4X A;  2C66 A;  4I58 A;  4J33 A;  2XYO A;  3UTG A;  2IVE A;  5EOW A;  3TWB A;  2GMJ A;  3CGD A;  3HRD C;  3ALM A;  4NZH A;  1COY A;  2QQ6 A;  3T2Y A;  2GB0 A;  3UXK A;  3I3L A;  3DH9 A;  2OQY A;  4A6N B;  1F9C A;  2GR3 A;  1P48 A;  3NK2 X;  2R0P A;  3B97 A;  2WHD A;  4M52 A;  5FS9 A;  3QSM A;  4NEW A;  2WPF A;  1ZY8 A;  2R0C A;  4K5R A;  3AEC A;  2HQM A;  4OPL A;  4EIP A;  4YTM A;  4H4T A;  3SM8 A;  2YVF A;  2Q0L A;  3SZF A;  2BAC A;  1B37 A;  1XPY A;  2ZZB A;  5FJP A;  2YAU A;  1DOC A;  5KOX A;  4U8N A;  3DG7 A;  2R0G A;  2ZBW A;  2JK6 A;  3GYJ A;  2IVD A;  3QTP A;  3FVD A;  2WP6 A;  3SN1 A;  3OZ2 A;  4E5T A;  4TVW A;  1YQ3 A;  1IUW A;  4GFI A;  3AWI A;  2XGZ A;  1BKH A;  4DGK A;  4REK A;  2AL2 A;  3VRA A;  3PFR A;  3V4B A;  3TWA A;  2GGH A;  1MOK A;  1M64 A;  4G8T A;  1Y0P A;  1DJN A;  4E4U A;  3MY9 A;  4ZOH B;  1NHR A;  2ZC8 A;  4JN9 A;  5BRT A;  3SZC A;  4N9X A;  3G5R A;  2XFQ A;  1T3Q C;  4PAA A;  1ZMD A;  3T9P A;  4Z2R A;  3ATR A;  1IUT A;  3Q45 A;  2CVJ A;  3NN0 X;  3NYF A;  2XVI A;  2PTW A;  4AOS A;  4Z25 A;  3SX6 A;  4APN A;  2H88 A;  1TDF A;  5J7X A;  2RGJ A;  3AYJ A;  3URH A;  1D4E A;  2YG4 A;  1RYI A;  4OPT A;  1CL0 A;  1GET A;  3DFY A;  1P2H A;  3C96 A;  1SJA A;  3P4R A;  5DBJ A;  4KX6 A;  2PPG A;  3L1R A;  2E1M A;  3SY4 A;  1PN0 A;  3NRZ B;  3GD3 A;  1OEP A;  4HB9 A;  4TLX A;  2F5Z A;  2EQ8 A;  2XFP A;  4ENL A;  4IP5 A;  3ENL A;  1KDG A;  2VQB A;  4UDP A;  2I0Z A;  3K1G A;  3H12 A;  1GT8 A;  2C64 A;  2I5Q A;  4YTN A;  4K22 A;  1WYG A;  3VC5 A;  3IHG A;  3KA7 A;  1TDK A;  3CGB A;  4BJZ A;  1N4V A;  3NVW B;  1OJA A;  1F8R A;  1TYP A;  2ACZ A;  3T4W A;  2VQ7 A;  3BI2 A;  4JY3 A;  4YKG A;  4X9N A;  1Q1R A;  2XH0 A;  2E5V A;  2YLR A;  2AL1 A;  2AKM A;  4FX9 A;  1QJD A;  4BK3 A;  2C76 A;  1YEY A;  3AE9 A;  2VZ2 A;  4A5L A;  3UTF A;  3UKK A;  1F6M A;  3NT6 A;  1YKJ A;  4X4J A;  3F8R A;  1NU5 A;  1H86 A;  2R46 A;  4ZCD A;  1NPX A;  1ELS A;  4H4Q A;  4A7A A;  4J57 A;  1L8P A;  1REO A;  4ZCW A;  2ZAD A;  1BF3 A;  3QVR A;  4FP1 A;  1BKW A;  1FOH A;  4UDR A;  3ATQ A;  1IUV A;  1H6V A;  4IP4 A;  4HCL A;  1FEA A;  5IPY A;  1GRH A;  2B9X A;  2OAL A;  1VDV A;  4AOX A;  2OZ3 A;  4HCH A;  2BC0 A;  2R4E A;  1N1P A;  3LZW A;  2B9W A;  3ICR A;  5FS7 A;  2B9Y A;  3AE2 A;  3NHO X;  3SFD A;  4H50 A;  1PBB A;  4EIQ A;  1SJC A;  3AEG A;  3PWG A;  3MKC A;  3S5S A;  3BJS A;  1PXA A;  3SYI A;  3V3O A;  3ADA B;  3P4S A;  3R0U A;  4J1O A;  3BHK A;  3K7Q X;  1IUU A;  2DW6 A;  2FYM A;  3PS9 A;  2RAB A;  3GRS A;  4KT2 A;  4HNC A;  2A89 A;  2QJJ A;  3LZX A;  3BI5 A;  2PS2 A;  3DDM A;  2ARD A;  3ISH A;  2PCE A;  1SEZ A;  3F8P A;  3NH3 X;  4HN8 A;  3CNP A;  4H4U A;  1GND A;  2Q0K A;  1ELI A;  2JKC A;  2XLP A;  4C77 A;  1CC6 A;  1BGN A;  2X8H A;  3HYW A;  4X2P A;  4XXG A;  1L9D A;  3H8L A;  1JNR A;  4CNJ A;  2NPX A;  5JCM A;  2O9Z A;  3RP8 A;  3VCN A;  3UJ2 A;  3CPJ G;  3CN8 A;  1EBD A;  3RP7 A;  1OJ9 A;  2EQ6 A;  5KMS A;  1N5X A;  3DJG X;  3NIX A;  4H1Z A;  3SGL A;  3H8A A;  1Q1W A;  2WET A;  4U2L A;  3TCS A;  2QAE A;  2C67 A;  2CUL A;  1JRY A;  4GAV A;  4ICY A;  2XH2 A;  4NTE A;  4XWZ A;  3P0W A;  4UP3 A;  3OP2 A;  3JW7 A; 
#chains in the Genus database with same CATH homology
 1H7X A;  3E1T A;  2X8G A;  3DK8 A;  1CF3 A;  1YQZ A;  1GRB A;  2X50 A;  1OJC A;  1HYU A;  3C4A A;  5HY5 A;  4GDP A;  5FS6 A;  3HYV A;  2V3A A;  2V5Z A;  2BRY A;  3CND A;  3IF9 A;  1DXL A;  4X9M A;  1V59 A;  4BK1 A;  3VQR A;  3VR9 A;  4H4X A;  2C66 A;  4H4Z A;  4I58 A;  4J33 A;  4G73 A;  3B3R A;  2XYO A;  3UTG A;  1GRA A;  1E7P A;  3CPH G;  4TM0 A;  4WCT A;  4A9W A;  2WDV A;  2IVE A;  3NLC A;  4H2R A;  3HZL A;  3V76 A;  5EOW A;  5KMP A;  1CC4 A;  2OLN A;  1PBC A;  2GMJ A;  3UKL A;  2IID A;  3EF6 A;  2JBV A;  1JNZ A;  3CGD A;  3LJP A;  4BJY A;  3K7M X;  2UZZ A;  3ALM A;  5KVI A;  2QA1 A;  1XPQ A;  4A65 A;  1GRF A;  1GPE A;  2WOV A;  4Y4M A;  4NZH A;  1COY A;  3AYL A;  1ONF A;  3T2Y A;  1W4X A;  4U8O A;  2GB0 A;  4YSY A;  4II3 A;  3I3L A;  3DH9 A;  1PXC A;  3ZYX A;  3UOX A;  3L8K A;  3FIM B;  4A6N B;  5KOW A;  2TPR A;  1VG9 A;  2GR3 A;  3VRD B;  3M12 A;  3NK2 X;  4YTP A;  2R0P A;  2YR4 A;  4RG4 A;  2WHD A;  2WPC A;  4M52 A;  4C3Y A;  5FS9 A;  1E39 A;  3QSM A;  2WES A;  1JRZ A;  2BK4 A;  4CY8 A;  3R9U A;  1PJ6 A;  3UKP A;  3RNM A;  4RG3 A;  3T31 A;  3GMB A;  3ALJ A;  4U8I A;  4NEW A;  2WPF A;  2YQU A;  3UP5 A;  3QSS A;  2YG7 A;  2C73 A;  1ZY8 A;  2R0C A;  5JCN A;  4K5R A;  4OPC A;  2YVJ A;  3SQP A;  1EL9 A;  4FK1 C;  1ZP0 A;  1DNC A;  3DGH A;  2HQM A;  3AEC A;  3GWF A;  1BGJ A;  3KD9 A;  4OPL A;  3CGE A;  4OCG A;  4ADW A;  2H89 A;  2GQF A;  1CC2 A;  4YTM A;  4EIP A;  4Z2T A;  3CNJ A;  4H4T A;  3GSI A;  2Y6R A;  3SM8 A;  3SFE A;  5EB4 A;  1L9C A;  3DJD A;  2YVF A;  2WP5 A;  2B76 A;  2V6O A;  2Q0L A;  3BNM A;  3SZF A;  2BAC A;  1TDN A;  1B37 A;  2VVL G;  2WOI A;  2ZZB A;  2XVE A;  2YAU A;  2DKI A;  3AE1 A;  3BI4 A;  2C72 A;  3AEF A;  3BNU A;  3GRT A;  3FPZ A;  4J56 A;  1DOC A;  5KOX A;  4U8N A;  3DME A;  3UOZ A;  5JCI A;  1OJT A;  2R0G A;  3I6D A;  2ZBW A;  2JK6 A;  1AOG A;  1DOD A;  3GYJ A;  2W0H A;  3SXI A;  2JB3 A;  4B64 A;  2Z5X A;  1K4Q A;  2IVD A;  3VR8 A;  3UTH A;  4GR1 A;  1S2Q A;  3AE3 A;  5EB5 A;  1H84 A;  1MXT A;  4B66 A;  2PHH A;  1CJ2 A;  3AEE A;  2WP6 A;  4OPD A;  3OZ2 A;  3NYC A;  4AT2 A;  3AE4 A;  1YQ3 A;  5L46 A;  2BYB A;  1IUW A;  1O95 A;  3M13 A;  4G9K A;  3AWI A;  4E0V A;  4DGK A;  3CPI G;  1CHU A;  2WS3 A;  3CTY A;  3K7T A;  5U63 A;  1TRB A;  2FJD A;  2JAE A;  2XDO A;  3AD7 B;  2GR0 A;  4REK A;  2CDU A;  5GRT A;  1S3E A;  1RP0 A;  2XVH A;  3AE5 A;  4GCM A;  5CQF A;  3VRA A;  4YXD A;  4JQ9 A;  5KWF A;  1YY5 A;  4J2W A;  1MOK A;  2YLZ A;  5FS8 A;  1M64 A;  4EQW A;  1Y0P A;  4EM3 A;  2BXR A;  2WDQ A;  1DJN A;  4H4P A;  3AE6 A;  1L0V A;  2GH5 A;  2GQW A;  3NTA A;  1NHR A;  4JN9 A;  5BRT A;  3ICT A;  3VRB A;  3SZC A;  2FJA A;  4N9X A;  1BWC A;  5KVH A;  4B65 A;  1UKV G;  1KF6 A;  2NVK X;  4NEV A;  1ZDL A;  1VDC A;  2A87 A;  3G5R A;  3RP6 A;  5JRB A;  4IA5 A;  2ZZC A;  2XFQ A;  4OPI A;  2YM2 A;  4H2N A;  1IUX A;  2BS2 A;  4PAA A;  1L9E A;  1PBE A;  1ZMD A;  3ICS A;  1EL5 A;  4Z2R A;  2QA2 A;  3FG2 P;  4IA6 A;  1O5W A;  1D7Y A;  3DJJ A;  2YLW A;  3JSK A;  3ATR A;  4TM1 A;  1IUT A;  3T2Z A;  3P1W A;  4DNA A;  1QO8 A;  2CVJ A;  1K0J A;  3NN0 X;  1D5T A;  3QFB A;  1K0I A;  2TMD A;  2BRA A;  2FJE A;  2EQ7 A;  1K0L A;  3NYF A;  4P9S A;  2XVI A;  3KVE A;  3L5O A;  4AOS A;  2X8C A;  4B69 A;  1GRT A;  1QLB A;  4GUV A;  4H4V A;  4CBQ A;  2BK5 A;  4JY2 A;  4TLZ A;  3SX6 A;  4NWZ A;  4Z25 A;  4APN A;  2H88 A;  1TDF A;  4NTC A;  1ZOY A;  1S7M A;  5J7X A;  1GRE A;  3UCL A;  1GXF A;  1E1L A;  4Z2U A;  2RGJ A;  3AYJ A;  1GTH A;  4CCQ A;  2YVG A;  3URH A;  1D4E A;  2WPE A;  4B68 A;  1BZL A;  1RSG A;  5IQ4 A;  3D9X A;  2YG4 A;  1E1N A;  1RYI A;  4OPT A;  4CY6 A;  3RED A;  1CL0 A;  1GET A;  3C96 A;  1P2H A;  3AEB A;  3COX A;  3NK1 X;  3NN6 X;  4MJW A;  2YWL A;  1GES A;  3QSE A;  3P4R A;  1LQU A;  2WP9 A;  4O5U A;  5DBJ A;  1IJH A;  5BVA A;  4IV9 A;  4KX6 A;  4J34 A;  1OJD A;  2C65 A;  3C4N A;  3L1R A;  2E1M A;  3SY4 A;  1JEH A;  4ZCC A;  3ZDN A;  1PN0 A;  4U2S A;  1ZMC A;  1CJ4 A;  3GD3 A;  4XWR A;  1M6I A;  1H83 A;  4HB9 A;  1LVL A;  3Q6J A;  2GMH A;  2GVC A;  4TLX A;  4A99 A;  5KRQ A;  4DSH A;  3H4K A;  2F5Z A;  2EQ8 A;  1EL7 A;  1Y56 B;  2XFP A;  3FMW A;  4FK1 A;  4B67 A;  1KDG A;  2VQB A;  3KU9 A;  3T2K A;  4UDP A;  2I0Z A;  1E1M A;  1GT8 A;  4EMI A;  2C64 A;  5TR3 A;  1CBO A;  1ZOV A;  4YTN A;  2FJB A;  2GF3 A;  4K22 A;  2GR1 A;  4AP1 A;  4LII A;  1JOA A;  3AE7 A;  2R9Z A;  3IHG A;  4H4Y A;  3KA7 A;  1TDK A;  4H4R A;  4CRT A;  2BCP A;  3CGB A;  3T0K A;  3WE0 A;  4BJZ A;  3AED A;  1N4V A;  4D04 A;  1P2E A;  4UDQ A;  1OJA A;  3D8X A;  4II2 A;  4O5Q A;  1F8R A;  1TYP A;  2ACZ A;  4G6G A;  3II4 A;  2YLX A;  4EQS A;  1GER A;  1YQ4 A;  4FDC B;  2VQ7 A;  3BI2 A;  4JY3 A;  4X9N A;  1ZK7 A;  4Y4N A;  4YKG A;  5M0Z A;  1Q1R A;  1B8S A;  2OLO A;  2E5V A;  3EPT A;  3AYI A;  3K30 A;  2YLR A;  2DKH A;  2WU5 A;  5HHF A;  5EBK A;  2BA9 A;  2XLT A;  3D1C A;  3AB1 A;  2AAQ A;  2WOW A;  1KNP A;  3GDN A;  4FX9 A;  1QJD A;  2XVF A;  1S3B A;  3UOV A;  4BK3 A;  3NTD A;  4ECH A;  2GRT A;  4YSX A;  5JCK A;  4ZN0 A;  2C76 A;  2PYX A;  2XFU A;  4G74 A;  4K8D A;  1KFY A;  3DK9 A;  3AE9 A;  1LV0 A;  3H8I A;  4OPG A;  2VZ2 A;  4BUR A;  3G5S A;  3NGC X;  4AT0 A;  4DSG A;  3LOV A;  2Q6U A;  1FL2 A;  2R4J A;  3AD8 B;  4A5L A;  3UTF A;  3UKK A;  4CCR A;  1F6M A;  3AXB A;  3DGZ A;  1TDE A;  3NT6 A;  2J3N A;  1PDH A;  1PJ7 A;  1YKJ A;  4X4J A;  3F8R A;  3KPK A;  1S2Y A;  2WDR A;  1H86 A;  2R46 A;  4Z44 A;  4ZCD A;  1PXB A;  1NPX A;  1GTE A;  5BUK A;  2Y6Q A;  5ER0 A;  1CJ3 A;  4YKF A;  2EQ9 A;  4AP3 A;  5LV9 A;  3B6D A;  4H4Q A;  3CMM A;  4A7A A;  2GV8 A;  2VVL A;  3G5Q A;  4J57 A;  1REO A;  1NAA A;  5IQ1 A;  2ZZ0 A;  2OA1 A;  2A8X A;  4HA6 A;  2XVJ A;  1BF3 A;  1XHC A;  4BK2 A;  2BXS A;  2CFY A;  2YG5 A;  4LU6 A;  3QVR A;  1H81 A;  4D03 A;  3EAN A;  1B4V A;  2WBA A;  3DK4 A;  1BKW A;  1KNR A;  1FOH A;  4UDR A;  3NKS A;  3NYE A;  1ZKQ A;  2WU2 A;  2XLU A;  3QVP A;  2GR2 A;  2YM1 A;  3ATQ A;  1KN0 A;  1IUV A;  1H6V A;  3LB8 A;  5CKU A;  2BC1 A;  2WEU A;  1H82 A;  5FMH A;  4H2Q A;  4H4W A;  1E1K A;  1FEA A;  5IPY A;  2V61 A;  1GRH A;  2R45 A;  2B9X A;  1DJQ A;  3GYI A;  1F8S A;  1PBD A;  2OAL A;  3O0H A;  3P4P A;  2C75 A;  2OAM A;  4GDE A;  4OPU A;  5C2T A;  1GEU A;  4EM4 A;  1GRG A;  1GV4 A;  4AOX A;  3P4Q A;  2YLS A;  1XDI A;  5M10 A;  1NG4 A;  1X31 B;  3NG7 X;  3GD4 A;  2BC0 A;  1NHP A;  2R4E A;  1TDO A;  3IC9 A;  1N1P A;  2X99 A;  2B7S A;  3LZW A;  1TYT A;  1GOS A;  2B9W A;  3AD9 B;  3ICR A;  4U8L A;  2BS4 A;  5FS7 A;  4U8M A;  3UTE A;  4C3X A;  1F8W A;  2B9Y A;  3PG6 A;  3AE2 A;  3NHO X;  3SFD A;  2JB1 A;  4H50 A;  2XFN A;  1PBB A;  4EIQ A;  2C3C A;  1KSS A;  3DJE A;  3NNE A;  1KSU A;  3CIR A;  4JDR A;  1PS9 A;  1IUS A;  4CNK A;  3AEG A;  2AQJ A;  4G6H A;  4PAB A;  2V60 A;  2E4G A;  3CNT A;  2BCG G;  2RGH A;  3AEA A;  3T14 A;  2C70 A;  2BAB A;  2QCU A;  3IWA A;  4EQR A;  3GYX A;  1PXA A;  1LQT A;  4WX1 A;  3UKQ A;  3ITJ A;  3UP4 A;  4TM4 A;  3T37 A;  3KLJ A;  3SYI A;  3V3O A;  4GF7 A;  3ADA B;  4TM3 A;  4JNQ A;  2C7G A;  3DA1 A;  3P4S A;  1N4W A;  4IVM B;  2VVM A;  5HYM A;  4H2P A;  4U8K A;  4K2X A;  5KMQ A;  4I59 A;  3LAD A;  4GRT A;  2V3B A;  1VRQ B;  1DOE A;  2XFO A;  2VRM A;  2BK3 A;  3BHK A;  3K7Q X;  1IUU A;  3AE8 A;  2C3D A;  1LJ1 A;  1PBF A;  4J36 A;  1JRX A;  3PS9 A;  2RAB A;  2YLT A;  4K7Z A;  2JB2 A;  2YG6 A;  3GRS A;  4Z43 A;  2A89 A;  1NHQ A;  1Q9I A;  4H4S A;  2VRL A;  2YG3 A;  1PJ5 A;  2VOU A;  1GSN A;  3GWD A;  1N4U A;  1VQW A;  3LZX A;  1NHS A;  3NRN A;  3BI5 A;  3ABV A;  3S5W A;  4A6N A;  2ARD A;  4YWO A;  2WQY A;  2YR5 A;  3ISH A;  3QJ4 A;  4NTD A;  3UKA A;  1D4C A;  3KPF A;  1SEZ A;  3F8P A;  1DOB A;  3V3N A;  3NH3 X;  3CNS A;  3F8D A;  2APG A;  4B1B A;  4LA1 A;  2B7R A;  4H7U A;  4U8P A;  5J60 A;  3CNP A;  1LPF A;  4H4U A;  2YR6 A;  4YSZ A;  4Y4L A;  3GMC A;  1GND A;  2GAH B;  5C3J A;  2Q0K A;  1ELI A;  2JKC A;  2XLP A;  5JCL A;  3EAO A;  3LXD A;  3GDP A;  4C77 A;  1CC6 A;  1B5Q A;  1O94 A;  1BGN A;  2XLS A;  4U8J A;  2X8H A;  3HYW A;  4C74 A;  5KNL A;  1Y56 A;  4U2T A;  1FEC A;  4XXG A;  1L9D A;  4C5O A;  1NEK A;  1H2I A;  4Z24 A;  3KKJ A;  3H8L A;  4BV6 A;  1JNR A;  3NK0 X;  4CNJ A;  2FBW A;  2NPX A;  4A79 A;  3FBS A;  1E6E A;  3S61 A;  3PVC A;  1LTX R;  5GSN A;  3HYX A;  2AR8 A;  4OVI A;  3SZW A;  3OC4 A;  1NG3 A;  3UKH A;  4YSH A;  4B63 A;  4KPR A;  2Z5Y A;  1F3P A;  5U25 A;  1VG0 A;  1XAN A;  5U1O A;  3IHM A;  4EQX A;  4Z26 A;  5JCM A;  2O9Z A;  4USR A;  3RP8 A;  1NEN A;  1Z6L A;  5HXI A;  5KXJ A;  3CPJ G;  3CN8 A;  3QFA A;  3PO7 A;  1EBD A;  4J31 A;  4USQ A;  1OJ9 A;  3RP7 A;  4YT0 A;  1D7L A;  2EQ6 A;  3ALL A;  5KMS A;  2Q7V A;  1NDA A;  1GAL A;  3DJG X;  3NIX A;  4EMJ A;  3SGL A;  1MO9 A;  2X3N A;  1Q1W A;  1D4D A;  2C4C A;  2WET A;  4RSL A;  1JU2 A;  3Q9T A;  4U2L A;  1CJC A;  2QAE A;  5BUL A;  3BHF A;  1H7W A;  2C67 A;  2CUL A;  1JRY A;  3P9U A;  2BS3 A;  3M0O A;  1PHH A;  4GAV A;  4ICY A;  4IVO B;  4GAP A;  4JNA A;  4K5S A;  4NTE A;  4NNJ A;  4XWZ A;  3SZ0 A;  3CGC A;  2GAG B;  2RGO A;  3UOY A;  4EMW A;  1FCD A;  5KMR A;  4UP3 A;  1FEB A;  3RHA A;  1EL8 A;  3UKF A;  2XLR A;  2GEW A;  2XCG A;  1ZX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...