1JOAA

Nadh peroxidase with cysteine-sulfenic acid
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
447
structure length
446
Chain Sequence
b'MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title Structure of the native cysteine-sulfenic acid redox center of enterococcal NADH peroxidase refined at 2.8 A resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 138
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1996-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1joaA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1joaA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1joaA02
1BWCA 5FS7A 3P4RA 4DGKA 3UOVA 5JCKA 4MJWA 2B9YA 1EL5A 5BRTA 2VOUA 2WP5A 4U8JA 2PYXA 1GRAA 4H4SA 3AE1A 3AD9B 3QVPA 1X31B 4YT0A 5BULA 1KSSA 1NG3A 3B6DA 2BK5A 4B63A 3LZWA 2ZZ0A 3CGCA 2FJEA 1Z6LA 3BNMA 2ZZCA 1O94A 4WX1A 4AOSA 1TRBA 3SQPA 1FCDA 1OJAA 3NNEA 2C7GA 1JOAA 1FL2A 3LJPA 2BK4A 2YR4A 3CNPA 3IC9A 2XLSA 3GDPA 3S5WA 4XXGA 3AD8B 1L0VA 2OLNA 1ZK7A 3QFAA 4U8MA 2BS4A 4XWZA 4C3XA 4GCMA 2BC0A 4LU6A 1H83A 1P2EA 4YSXA 2RGJA 1GV4A 1GTEA 1F3PA 3K7QX 4EM3A 1VDCA 1GEUA 2A87A 2C65A 3BI2A 2GEWA 2Z5XA 4D04A 2PHHA 4YKGA 3H8LA 3GWDA 4OPLA 5KOXA 1ZX9A 3ICRA 2JK6A 2BXRA 2GV8A 1DJNA 1PBDA 4USRA 3UTHA 2UZZA 5KWFA 1Q1RA 2O9ZA 3AEAA 2XFUA 1N4WA 3NLCA 2V6OA 2XVEA 3UTGA 4APNA 2EQ7A 5JCIA 1IUTA 1GALA 1H86A 1Y56B 4RG4A 4UDPA 4Z44A 3DJJA 4B64A 2VQ7A 1MOKA 3ATQA 1V59A 1LVLA 1EL8A 2YR5A 3G5QA 2BS2A 1PBCA 4OCGA 1BGJA 1PXAA 3NYEA 3GYJA 3P4SA 2JB3A 2GR3A 2WOWA 3UKAA 3LADA 1K0IA 3UOZA 1S2QA 1O5WA 3DJEA 1EL9A 2YLTA 3KA7A 3AYIA 3CPIG 3D8XA 4B65A 4K2XA 4AT2A 4A5LA 2RGHA 4B68A 2XLRA 2R0GA 2C67A 2YG3A 4B1BA 4GRTA 1DXLA 4YSZA 2YVFA 1DJQA 2DKHA 3B3RA 2WS3A 1IUSA 3IWAA 3EAOA 3NKSA 4CNJA 2GRTA 5C3JA 3CIRA 1ZOYA 2C3DA 5M0ZA 1GOSA 1LPFA 3EANA 1OJDA 2YLWA 4H4TA 1ZDLA 3SFEA 5DBJA 4A7AA 2Q0LA 1BF3A 4U8NA 3AE7A 3AYJA 5U1OA 1TYTA 3DK4A 4HB9A 2YVGA 4H4QA 4ECHA 2WDRA 4H2RA 3NIXA 2BXSA 4WCTA 3DJDA 4BK2A 3FIMB 1GSNA 3AYLA 1GESA 3P4QA 2FBWA 5ER0A 1YQ4A 2C72A 4O5QA 2B76A 3AEDA 2WOIA 1DNCA 2R4JA 2YLZA 2WOVA 2BCGG 3JSKA 1VG0A 2IIDA 1M64A 2ZBWA 3K30A 2VRLA 3I3LA 3URHA 1D4EA 4I59A 1IUXA 2WU5A 1D5TA 1N4VA 3V76A 3KVEA 1OJTA 4NTEA 4YKFA 2C3CA 3QSEA 4YSHA 5FS6A 4J57A 5FS9A 4OPGA 3HZLA 1VQWA 1RYIA 1OJCA 4GR1A 5BVAA 4FX9A 4YWOA 1Y0PA 5HHFA 1RP0A 1K4QA 3GWFA 4AP1A 3VQRA 3NTDA 2XCGA 2BA9A 3UOXA 2TPRA 4XWRA 3NYFA 1BZLA 4AOXA 3Q6JA 3GDNA 3OC4A 4K7ZA 4ZCCA 2GR0A 4DNAA 2Z5YA 3UKKA 3UKPA 1LJ1A 2GAGB 4U8PA 5JCMA 3BI4A 2EQ6A 2ARDA 5EB5A 1OJ9A 2I0ZA 1JRZA 1PBEA 3GD3A 1NG4A 2WP6A 1PJ6A 5KOWA 1HYUA 4NEVA 2WESA 3C4NA 1YQZA 1GXFA 5FS8A 1DOEA 2WDQA 2XVIA 2XFQA 2XYOA 2GH5A 1S2YA 2CDUA 5IQ1A 1JEHA 2JKCA 2YG7A 4J33A 3UTFA 3O0HA 2YG5A 5KVIA 4Z2UA 4AT0A 3NN0X 2VRMA 4BK1A 4DSGA 3DGZA 4BV6A 1KNPA 2Q6UA 3ALLA 3RNMA 3F8RA 1E1NA 3LOVA 4NEWA 3NN6X 4JNAA 1E7PA 4A6NB 3P1WA 4EQSA 4ZCDA 1PN0A 1D4DA 4FDCB 1NENA 3NYCA 1GRTA 3ABVA 4CCRA 2R9ZA 3GYIA 2RGOA 3ICTA 1GERA 3ITJA 4NZHA 3FPZA 1KNRA 2E4GA 4Y4MA 4U2TA 3SGLA 3AE6A 1CHUA 3EPTA 2WDVA 1D7LA 5L46A 5LV9A 3G5RA 2XLPA 2X3NA 4EIQA 3UKFA 4C3YA 1EBDA 3NH3X 2GMJA 2XFOA 4IVMB 3ICSA 2WETA 3VR8A 1GRGA 1TDFA 4A99A 2C76A 3WE0A 3H4KA 4H4ZA 3QJ4A 3NGCX 2BCPA 2C75A 4UP3A 1PDHA 2VQBA 1B5QA 2WU2A 2JBVA 1CJ4A 4TM4A 2R0PA 2GQFA 2V61A 2OLOA 2TMDA 4TM0A 2B7SA 4UDQA 3GMCA 3COXA 2HQMA 4OPDA 3D1CA 1E1MA 4U8KA 3C4AA 4GUVA 3L8KA 4I58A 1H7XA 1VRQB 3AE3A 3QVRA 1CC4A 3H8IA 5U25A 1ZP0A 1UKVG 3M0OA 4OPCA 4JN9A 4EQWA 3M12A 1XANA 3DA1A 2XDOA 1ONFA 3AD7B 5U63A 3T37A 3EF6A 3DGHA 2YG6A 1QO8A 5IQ4A 2OAMA 2BC1A 1CC2A 4GF7A 3CNSA 1W4XA 3GRTA 4YXDA 4U2SA 2XLUA 3GRSA 1VG9A 3V3OA 1AOGA 3AEFA 1NHSA 3NTAA 4KX6A 1M6IA 1DOCA 1JRYA 2VVLG 4CCQA 2B7RA 2A8XA 1N1PA 1NAAA 4K5SA 3RP6A 2YG4A 2DKIA 1TDEA 3AE8A 3KU9A 5M10A 4ADWA 1CJ3A 2VVLA 2YLSA 5GSNA 1NDAA 2GVCA 4Z25A 3PO7A 2YQUA 2FJBA 4CBQA 4D03A 2YWLA 5HY5A 2X8HA 4U8IA 1SEZA 1Y56A 2APGA 2V3BA 2YM1A 3CGDA 1E1LA 1E39A 4H7UA 3DH9A 2JB2A 4OVIA 1CC6A 3PS9A 3ZYXA 3L1RA 3RP7A 2BYBA 2VZ2A 3OZ2A 1D4CA 2NVKX 4H4RA 5TR3A 1B4VA 3CNJA 4TLZA 1CJCA 2BABA 1NHPA 3CGEA 1GRBA 3ALJA 4PAAA 4BURA 1F8SA 2C70A 3VRDB 3BHKA 3ADAB 2EQ9A 4Z2RA 1NEKA 3AEEA 2EQ8A 2QAEA 2YVJA 4H4VA 5EBKA 2R4EA 2NPXA 1PBFA 2Q7VA 1IUWA 3QSSA 4IV9A 1XDIA 3AECA 3RP8A 4ZN0A 3VRBA 5BUKA 3AE4A 1EL7A 5CQFA 2JB1A 4FK1C 3IHGA 2BK3A 3GSIA 3NHOX 4K22A 3FMWA 1PXCA 1K0JA 3VRAA 5J60A 1TDKA 2AQJA 2RABA 4H4YA 4CY6A 5EOWA 1H7WA 4H2QA 1KSUA 1YKJA 4B69A 2WHDA 4E0VA 4USQA 1QLBA 1JRXA 4H4WA 2AR8A 1N4UA 2FJDA 4DSHA 4JY3A 4YTMA 4CNKA 3NG7X 2WQYA 1XHCA 5FMHA 4CRTA 4U8LA 1NPXA 1PXBA 1FEBA 1Q1WA 3ATRA 2XFNA 2GR1A 3DMEA 3SFDA 1H82A 3UP5A 4K8DA 3UOYA 1FOHA 2E1MA 4H4PA 1TYPA 1CBOA 3P9UA 4U2LA 1CF3A 1BKWA 1GPEA 1LQTA 4EMWA 1DOBA 3KKJA 2ACZA 3UKLA 1F8WA 1MXTA 2IVEA 4EMIA 2GF3A 3CTYA 4UDRA 4RSLA 2JAEA 3G5SA 4A65A 4EM4A 2IVDA 1ZMCA 1YQ3A 4HA6A 3UTEA 4BJYA 1S3BA 3C96A 2F5ZA 1CL0A 2CULA 1GRFA 1F6MA 4H4XA 1PBBA 2C64A 4P9SA 2X8CA 3LZXA 4Z24A 1Q9IA 3QFBA 5JCLA 2VVMA 1PS9A 5CKUA 1B37A 5KVHA 4JY2A 3IF9A 2X8GA 4BK3A 4X9MA 3AXBA 3V3NA 2W0HA 3UKQA 3CGBA 3QSMA 1ZOVA 3SM8A 1KF6A 5J7XA 2V3AA 4RG3A 1FECA 3CN8A 4J2WA 2C73A 3K7MX 2GB0A 4EQXA 2Q0KA 4A9WA 4YTNA 1ELIA 4OPTA 4OPIA 1XPQA 3NK2X 1PJ5A 1GT8A 2H89A 3AEGA 1LQUA 1TDOA 1H81A 2OA1A 4LIIA 3CNDA 1L9DA 3P4PA 2CFYA 3GD4A 3KLJA 5KRQA 1H6VA 1LV0A 2GAHB 1K0LA 4X9NA 1KFYA 4Y4LA 5KXJA 3BI5A 2WP9A 3AEBA 2A89A 2C66A 2B9XA 4Y4NA 3I6DA 3NK0X 2GR2A 1P2HA 2B9WA 4YSYA 4O5UA 3ISHA 4A6NA 3S61A 1GETA 1L9EA 1H84A 1JNZA 4Z43A 5C2TA 4IA6A 2E5VA 3FG2P 3AB1A 5IPYA 2YM2A 1GREA 4CY8A 2QA2A 4K5RA 1ZY8A 3NT6A 2R0CA 2YAUA 1BGNA 3UCLA 3UP4A 1LTXR 2XVJA 4EMJA 2ZZBA 4TM1A 1E6EA 3R9UA 1GRHA 2R45A 1ZKQA 4JQ9A 2J3NA 3IHMA 1KDGA 4TM3A 2WEUA 1E1KA 2YLXA 1DODA 5GRTA 2XVHA 3F8PA 3DK8A 2YLRA 3M13A 4FK1A 3DJGX 4AP3A 4BJZA 4H4UA 3NRNA 3E1TA 3KD9A 4U8OA 4H50A 2FJAA 1YY5A 3BNUA 4N9XA 4PABA 2CVJA 4X4JA 4YTPA 3NK1X 3LB8A 2X50A 3LXDA 2Y6QA 1D7YA 2WBAA 3GMBA 4A79A 2V5ZA 2BS3A 1O95A 3REDA 3DK9A 3AE9A 3CNTA 4B67A 4OPUA 4C74A 3AE5A 1NHQA 4NTCA 1GTHA 5JCNA 3ZDNA 1TDNA 3AE2A 4EQRA 3CPHG 4GDPA 4NTDA 5HYMA 5HXIA 4TLXA 5EB4A 4J31A 1L9CA 2WPCA 4Z2TA 2WPFA 1JU2A 2QCUA 4H2PA 1PHHA 4GDEA 2GQWA 1IUVA 3CPJG 3RHAA 4B66A 2R46A 1B8SA 2QA1A 1RSGA 2XLTA 4EIPA 3K7TA 3F8DA 4IA5A 4J36A 1QJDA 1REOA 2Y6RA 2XFPA 3ALMA 3UKHA 3VR9A 2XVFA 3AWIA 1JNRA 1ZMDA 1F8RA 1PJ7A 2GMHA 1MO9A 4REKA 2AAQA 3KPFA 4ICYA 4C77A 4LA1A 3Q9TA 4M52A 4H2NA 1CJ2A 3PVCA 4JDRA 1IUUA 1GNDA 2OALA 3FBSA 1S3EA 2WPEA 2H88A 2V60A 4J34A 4Z26A 4IVOB 4JNQA 2X99A 2BACA 3BHFA 4C5OA 1FEAA 3II4A 4J56A 1COYA 2YR6A 1IJHA 1NHRA 4KPRA
chains in the Genus database with same CATH superfamily
4MJWA 1BKHA 2PYXA 3QVPA 4YT0A 2BK5A 4B63A 3LZWA 4KEMA 1PDZA 1N63C 4G6HA 2FJEA 3BNMA 4WX1A 4AOSA 2PP3A 3SQPA 3NNEA 3IJLA 3CNPA 2PU0A 3S5WA 4XXGA 2OLNA 2P8CA 4GCMA 2BC0A 2RGJA 1GEUA 4JN7A 4G6GA 4ZOHB 2GEWA 3H8LA 3GWDA 4OPLA 3NS1B 2BXRA 3RCYA 3UTHA 2E5AA 2XFUA 3A7AA 3UTGA 4APNA 5JCIA 1Y56B 4RG4A 4Z44A 2PPGA 2BS2A 4YWSA 4DXKA 3LADA 1EC9A 3DJEA 1EL9A 3CPIG 2AKMA 1SJBA 2YG3A 2YVFA 2DKHA 1IUSA 3T6CA 3EAOA 2GRTA 3ES8A 1LPFA 5DBJA 5KMRA 3AE7A 2PTXA 3AYJA 5U1OA 1F9CA 4ECHA 4IP4A 3KPKA 3STPA 1GSNA 3P4QA 5ER0A 1SB3B 1RM6B 3FVDA 3B9JB 3RR1A 1M64A 3EKGA 3K30A 3T31A 3I3LA 1D5TA 2W3SA 4Z17A 3KVEA 2C3CA 4YSHA 4J57A 4IL0A 2CHRA 4YWOA 1K4QA 1N5WC 2FYMA 3GDNA 4K7ZA 4ZCCA 2GR0A 4DNAA 1LJ1A 2GAGB 4U8PA 2I0ZA 1PBEA 1NG4A 2WP6A 3HPFA 2HNEA 3FV9A 1GXFA 5FS8A 1DOEA 2XVIA 1JEHA 4J33A 3AMZA 3DGZA 3A7UA 4GIRA 4ZCDA 1D4DA 1NENA 2R9ZA 1KNRA 3QN3A 2E4GA 2X3NA 3UKFA 4II2A 3RRAA 4C3YA 4HCLA 3DDMA 3VR8A 3H4KA 1FO4A 1NELA 3NGCX 3ZVHB 2GQFA 4HN8A 4U8KA 1KKOA 4I58A 5U25A 1ZP0A 3OZYA 4JN9A 2OPJA 3DA1A 1ONFA 3EF6A 2YG6A 2BC1A 1CC2A 2PTZA 4KWSA 1W4XA 3TCSA 3NTAA 1DOCA 2B7RA 1NAAA 1TDEA 2VVLA 3UJEA 5GSNA 4M6UA 4Z25A 2YQUA 4CBQA 2YWLA 1SEZA 3CGDA 4H7UA 3DH9A 4ZCWA 3R0UA 1D4CA 2NVKX 4H4RA 5TR3A 1B4VA 2BABA 1NHPA 1P48A 1GRBA 2GSHA 3ALJA 3VRDB 2C70A 4Z2RA 1NEKA 3AEEA 2EQ8A 4A3RA 2YVJA 4H4VA 2R4EA 2Q7VA 1PBFA 3HYXA 5CQFA 2JB1A 3ZLHA 3IHGA 2BK3A 1FFUC 3NHOX 4K22A 1K0JA 4H4YA 3S47A 3UJ2A 4H2QA 2WHDA 3DIPA 4H4WA 2AR8A 2FJDA 2QJNA 5FMHA 3VFCA 1PXBA 3ATRA 2XFNA 3PWIA 5FJUA 3UOYA 1N62C 4EMWA 1F8WA 1P43A 2GF3A 2JAEA 3G5SA 4EM4A 1ZMCA 2CULA 4P9SA 2VVMA 4JY2A 2X8GA 3AXBA 2W0HA 2OLAA 2XGZA 3CN8A 3K7MX 3ENLA 1GT8A 1TDOA 3SR6B 2QDEA 1L9DA 3GD4A 1LV0A 3NVWB 3FJ4A 4Y4LA 3BI5A 1R0MA 3R0KA 3I6DA 4O5UA 3ISHA 1L9EA 2YM2A 4DN1A 2QA2A 1ZY8A 3NT6A 3P3BA 1BGNA 3UP4A 1LTXR 4EMJA 4TM1A 3R9UA 1GRHA 3CXOA 5IDZA 5FJOA 4DHGA 3F8PA 3DJGX 3E1TA 2FJAA 4N9XA 4YTPA 2CVJA 2HXTA 1ZXIC 3GMBA 2POZA 3PFRA 3REDA 4B67A 4C74A 1N5XA 1GTHA 3ZDNA 3IJQA 2WPCA 2QJJA 1PHHA 4GDEA 3CPJG 2OKTA 4B66A 2R46A 1RSGA 3K7TA 4IA5A 1JPDX 3VR9A 1JNRA 2AAQA 3KPFA 1EC8A 4IZGA 1CJ2A 1S3EA 2WPEA 3MKCA 4DWDA 1FEAA 1NHRA 1BWCA 5FS7A 4DGKA 1XS2A 2B9YA 4EWJA 5KMSA 2WP5A 1XPYA 4H4SA 3DG7A 1X31B 3RO6A 2OX4A 2ZZ0A 1MUCA 1Z6LA 2PGWA 2C7GA 3IC9A 3R25A 1ZK7A 2BS4A 1H2IA 4XWZA 4J1OA 4GYPC 1F3PA 4EM3A 2C65A 4HPNA 3BI2A 2XH7A 4YKGA 2PHHA 3V3WA 2ONEA 5KOXA 3ICRA 1PBDA 2PMQA 5KWFA 2UZZA 1MNSA 3AEAA 2P3ZA 4ROPA 2XVEA 2EQ7A 1TZZA 2PTYA 1EL8A 1LVLA 2YR5A 1EBHA 2JB3A 2GR3A 2WOWA 3UKAA 5ENLA 2PP0A 5FJRA 1O5WA 2YLTA 3NO1A 3KA7A 3AYIA 3ZVHA 4A5LA 2XLRA 2R0GA 2C67A 3H8AA 4GRTA 4YSZA 1N60C 1DJQA 5BOEA 3N6HA 3IWAA 3NKSA 5C3JA 2C3DA 1GOSA 1OJDA 2PCEA 2PU1A 4HB9A 4H4QA 4H2RA 2BXSA 4BK2A 4FP1A 1GESA 3U9IA 2P0IA 2WOIA 3JSKA 1VG0A 2IIDA 3URHA 4I59A 1IUXA 1N4VA 3V76A 4NTEA 3ZLFA 5FS6A 1OJCA 5BVAA 3TWBA 3GWFA 3VQRA 3NTDA 4XWRA 3NYFA 3PG6A 3OC4A 3UKKA 2ARDA 1JRZA 3GD3A 3EEZA 1PJ6A 3C4NA 1YQZA 2XFQA 2CDUA 2JKCA 2YG7A 4Z2UA 4BK1A 1FFVC 1BQGA 4DSGA 3ALLA 2Q6UA 3H7VA 3F8RA 3DEQA 1E1NA 3SXIA 3T2YA 4JNAA 3P1WA 3DFYA 4EQSA 3GYXA 3DG3A 3ABVA 4CCRA 3GYIA 3ITJA 3FPZA 4U2TA 1PDYA 3AE6A 3TOYA 1JRPA 2WDVA 5LV9A 3G5RA 2XLPA 1EBDA 1WUFA 4IVMB 2XFOA 2WETA 4A99A 3WE0A 4J3ZA 4H4ZA 2BCPA 2C75A 2VQBA 1B5QA 2JBVA 3CT2A 4K2SA 2V61A 4TM0A 4UDQA 3V5FA 3GMCA 1VDVA 3L8KA 2MUCA 1H7XA 3QVRA 3H8IA 1UKVG 3M0OA 3I4KA 4OPCA 1FHUA 3AD7B 5U63A 2QQ6A 3T37A 3DGHA 5IQ4A 4GF7A 2XH0A 3CNSA 3GRTA 4YXDA 2XLUA 3GRSA 1AOGA 4JHMA 4KX6A 2DKIA 2PA6A 3KU9A 2YLSA 2GVCA 2FJBA 4II3A 1E1LA 1E39A 3ZYXA 3T2ZA 3PS9A 3T2KA 3RP7A 3OZ2A 3CNJA 4TLZA 3N4EA 2C4CA 4PAAA 3L5OA 1F8SA 2RDXA 3BHKA 2E3TA 2QAEA 5EBKA 3QSSA 4IV9A 1XDIA 1STZA 3T9PA 3RP8A 3TJIA 4ZN0A 5BUKA 3AE4A 1EL7A 4ENLA 3UXKA 3HYVA 4GYPA 3FMWA 3VRAA 5J60A 1NU5A 2AQJA 4B69A 1QLBA 1JRXA 1N4UA 4YTMA 3BSMA 3NG7X 1XHCA 3QTPA 4U8LA 1Q1WA 1RVKA 3DMEA 4E4FA 6ENLA 2QGYA 4HCHA 3R07C 2E1MA 1CBOA 3P9UA 2OFJA 1DOBA 3KKJA 3UKLA 3CTYA 4UDRA 4RSLA 3HW2A 1E9IA 1YQ3A 4HA6A 2DW7A 3QKEA 3LZXA 1VQZA 5JCLA 3VC6A 3IF9A 2OVLA 2BRAA 3CGBA 4JN8A 3MY9A 3UJRA 2C73A 4EQXA 4OPIA 1XPQA 2NQLA 5J04A 1LQUA 1H81A 3KLJA 5KRQA 2XH2A 2B9XA 3NK0X 2GR2A 4A6NA 3MUCA 3FG2P 3AB1A 5IPYA 1OEPA 4X2PA 4K5RA 3UCLA 2XVJA 2ZZBA 1T3QC 2R45A 1ZKQA 3IHMA 1KDGA 5GRTA 3SQSA 4BJZA 3NRNA 3BNUA 4PABA 2X50A 3LXDA 3MQTA 3MZNA 2WBAA 4A79A 4MKSA 2I5QA 1NHQA 3D46A 4IP5A 3AE2A 5HYMA 5EB4A 3P0WA 2OO6A 4Z2TA 4H2PA 1IUVA 3NZGA 4H19A 2QA1A 3OP2A 3SJNA 2XVFA 3OZMA 2GMHA 3SN1A 4ICYA 5KMPA 1YEYA 1IUUA 2OALA 3VC5A 3BOXA 4DX3A 3ETRB 2V60A 4Z26A 4JNQA 2BACA 3BHFA 3II4A 1COYA 1IJHA 2OZTA 4G7FA 3UOVA 3CMMA 4U8JA 3AD9B 3SN0A 1NG3A 3D9XA 3CGCA 1O94A 1FCDA 1OJAA 3MWCA 1JOAA 2PODA 2YR4A 3GDPA 5KNLA 1L0VA 4U8MA 4GAPA 4LU6A 1H83A 3A7RA 1V97A 1GTEA 3K7QX 2A87A 2W54A 4D04A 2ZADA 4DYEA 1ZX9A 3R11A 1DJNA 2O9ZA 3CAWA 1IUTA 3TW9A 3DJJA 4B64A 3ATQA 1MOKA 3G5QA 1PBCA 4GGHA 3S5SA 3R1ZA 1S2QA 4B65A 4AT2A 2RGHA 4B68A 1JROA 2WS3A 4CNJA 3CIRA 3ZLGA 2PTWA 1SJCA 2O56A 2YLWA 1ZDLA 3SFEA 4A7AA 1BF3A 3QPEA 4HNLA 1TYTA 3DK4A 2YVGA 3NIXA 3DJDA 3FXGA 3FIMB 2QVHA 1YQ4A 3CK5A 3Q45A 2B76A 2OQYA 3AEDA 1DNCA 2ZBWA 3SX6A 1D4EA 2WU5A 1OJTA 4OPGA 3MSYA 1RYIA 4GR1A 5HHFA 1KCZA 1RP0A 4AP1A 3ZVIA 2XCGA 1SJDA 4GFIA 3Q4DA 1BZLA 2GGIA 1FIQB 3RITA 1KD0A 3GO2A 5JCMA 3BI4A 2EQ6A 5EB5A 1OJ9A 4GGBA 4KT2A 2WESA 2OG9A 2XYOA 1S2YA 2GGJA 5IQ1A 2YG5A 4AT0A 3NN0X 3NVVB 2VRMA 3T0KA 2PGEA 3RNMA 2GGGA 3SZCA 4A6NB 3NYCA 3ICTA 3EPTA 1D7LA 4EIQA 3CXBA 3NH3X 1ELSA 1GRGA 2C76A 4G8TA 3QJ4A 3TWAA 4UP3A 1PDHA 1CJ4A 1ONEA 2R0PA 2OLOA 3COXA 4OPDA 3D1CA 3C4AA 4IL2A 3IJIA 3AE3A 1MRAA 3NXLA 4NNJA 1XANA 2OAMA 4U2SA 3AEFA 1NHSA 1M6IA 2HXUA 4CCQA 4KPLA 2YG4A 1WUEA 5M10A 3DERA 4ADWA 3PO7A 4D03A 3I6EA 2APGA 2V3BA 3L1RA 2BYBA 3HRDC 1CJCA 3CGEA 5G5GB 3IK4A 3SN4A 4BURA 3R10A 3UGVA 4MGGA 3TQPA 1X2HA 3THUA 2ZC8A 1PXCA 1TDKA 2RABA 1KSUA 1YKJA 2P8BA 3T14A 4DSHA 4TVWA 1NPXA 1FEBA 3VCNA 1SJAA 2GR1A 3VCCA 4HCDA 4H4PA 1DTNA 1TYPA 4U2LA 1BKWA 1GPEA 3JW7A 1MXTA 3GY1A 2IVEA 4EMIA 3N4FA 4A65A 3UTEA 3H70A 4BJYA 1S3BA 3C96A 2F5ZA 1CL0A 1GRFA 1F6MA 4H4XA 2C64A 2X8CA 4Z24A 1Q9IA 3QFBA 1PS9A 5CKUA 3UJSA 1B37A 3SBFA 4X9MA 3UKQA 3QSMA 4RG3A 2AKZA 1FECA 4J2WA 4YTNA 1PJ5A 2H89A 3AN1A 3P4PA 3CNDA 1H6VA 3B97A 5KXJA 2WP9A 1P2HA 1GETA 5C2TA 1JPMA 4Z43A 2YAUA 4NWZA 1E6EA 1N61C 4ZA0A 3CB3A 4E4UA 3GC2A 1FHVA 1DODA 2XVHA 3DK8A 4FK1A 4AP3A 4H4UA 3KD9A 4U8OA 4H50A 4X4JA 3LB8A 1D7YA 2PS2A 4G73A 2BS3A 3DK9A 3AE9A 3NVZB 3JZUA 4EQRA 4GDPA 4NTDA 3V4BA 5HXIA 2OQHA 3I6TA 1L9CA 2QCUA 1EBGA 3RHAA 1B8SA 4EIPA 4J36A 1REOA 2Y6RA 2XFPA 2XH4A 4E6MA 1PJ7A 1MO9A 2OZ8A 4M52A 4H2NA 2H88A 4IVOB 2X99A 2QJMA 2YR6A 1JDFA 2JB2A 4B1BA 3AD8B 3GD6A 3P4RA 5JCKA 1EL5A 3QLDA 5BRTA 2VOUA 1GRAA 3AE1A 4K1WA 3JVAA 5BULA 1KSSA 3B6DA 3RGTA 3FCPA 2ZZCA 1TRBA 5G5HB 1FL2A 3LJPA 2BK4A 4GAVA 2XLSA 3QFAA 1MDRA 3H12A 4C3XA 1P2EA 3VA8A 4YSXA 1GV4A 1S7MA 3V5CA 1VDCA 2GDQA 2Z5XA 2JK6A 2GV8A 1IYXA 3UCDA 4USRA 1Q1RA 3U4FA 1N4WA 3NLCA 3TJ4A 2AL2A 2V6OA 3VDGA 2DW6A 1H86A 4UDPA 1GALA 5BOFA 2VQ7A 2HZGA 1V59A 4OCGA 1BGJA 4H2HA 1PXAA 3NYEA 3GYJA 3P4SA 3UOZA 1K0IA 3D8XA 4K2XA 4TVYA 1MDLA 1DXLA 3B3RA 4A35A 4GMEA 2OZ3A 1ZOYA 3T8QA 5M0ZA 3EANA 4E8GA 4H4TA 2Q0LA 4U8NA 2WDRA 4WCTA 3AYLA 2FBWA 2C72A 4O5QA 1JCTA 2R4JA 3HYWA 2YLZA 2WOVA 2BCGG 2VRLA 2XSXA 4YKFA 3QSEA 1WYGA 5FS9A 3HZLA 1KN0A 1VQWA 3NVYB 4FX9A 1Y0PA 2BA9A 3UOXA 2TPRA 4AOXA 3Q6JA 5FJTA 5JRBA 2QDDA 2Z5YA 3UKPA 4IT1A 5KOWA 1HYUA 4NEVA 2WDQA 3K1GA 2GH5A 3UTFA 3O0HA 1TKKA 5KVIA 3SZ0A 3N6JA 4BV6A 1TE6A 1KNPA 3LOVA 4NEWA 3NN6X 1E7PA 4F4RA 1PN0A 4FDCB 1GRTA 3T4WA 4NZHA 2RGOA 1GERA 4Y4MA 3SGLA 2GGHA 1CHUA 5L46A 2GMJA 3ICSA 4K8GA 1TDFA 3ES7A 1R6WA 3TTEA 2WU2A 4TM4A 5KMQA 2TMDA 2B7SA 2HQMA 1E1MA 4G74A 4GUVA 1VRQB 1CC4A 1KKRA 4EQWA 3M12A 2XDOA 3UCCA 1QO8A 3V3OA 1VG9A 2GL5A 3EUB3 2GGEA 1JRYA 2VVLG 2A8XA 1N1PA 4K5SA 3RP6A 2PSNA 4MMWA 3AE8A 1CJ3A 1NDAA 4A6GA 3OW1A 5HY5A 2X8HA 4U8IA 1Y56A 4E5TA 2YM1A 4OVIA 3CYJA 3DFHA 2FKPA 3FYYA 1CC6A 4G9KA 2VZ2A 3KUMA 3SY4A 3ADAB 2EQ9A 3OPSA 2NPXA 1IUWA 3AM9A 3AECA 3VRBA 2AL1A 4FK1C 4HYRA 3GSIA 3D47A 1X2GA 4CY6A 5EOWA 2MNRA 1H7WA 4E0VA 7ENLA 4USQA 4JY3A 4CNKA 2WQYA 1EC7A 4CRTA 3UXLA 1H82A 2BRYA 3SFDA 3UP5A 4K8DA 1FOHA 4GISA 4M0XA 1CF3A 1LQTA 3SSZA 2ACZA 2IVDA 1PBBA 2W55A 3SZFA 2AL2B 5KVHA 4BK3A 3V3NA 1ZOVA 3SM8A 1KF6A 5J7XA 2V3AA 2W3RA 2GB0A 2Q0KA 4A9WA 1ELIA 2PP1A 4OPTA 3NK2X 3AEGA 2OA1A 4LIIA 2CFYA 5EU9A 2GAHB 1K0LA 4X9NA 1KFYA 3PK7A 3AEBA 2A89A 2C66A 4Y4NA 4YSYA 2B9WA 3S61A 2P88A 1H84A 1JNZA 4IA6A 2E5VA 5FJPA 1GREA 4CY8A 2R0CA 3DGBA 4JQ9A 2J3NA 4TM3A 2WEUA 1E1KA 2YLXA 4IHCA 4HNCA 2YLRA 3NRZB 3M13A 1L8PA 1YY5A 3DESA 3NK1X 3NFUA 2Y6QA 4FI4A 2V5ZA 3SYIA 1O95A 3CNTA 4OPUA 3AE5A 1W6TA 4NTCA 5JCNA 3UJFA 1TDNA 3CPHG 3OTRA 4TLXA 4J31A 2WPFA 1JU2A 3SZWA 4H1ZA 2GQWA 3P93A 2XLTA 3F8DA 1QJDA 3ALMA 3UKHA 3AWIA 1ZMDA 1F8RA 4REKA 4C77A 4LA1A 3DG6A 3Q9TA 4Z1YA 3PVCA 4JDRA 1GNDA 3PWGA 3FBSA 4J34A 4H83A 3BJSA 4C5OA 1ECQA 4J56A 4KPRA
chains in the Genus database with same CATH topology
1BWCA 5FS7A 3P4RA 4DGKA 3UOVA 5JCKA 4MJWA 2B9YA 1EL5A 3CMMA 5BRTA 2VOUA 2WP5A 4U8JA 2PYXA 1GRAA 4H4SA 3AE1A 5KMSA 3AD9B 3QVPA 1X31B 4YT0A 5BULA 1KSSA 1NG3A 3B6DA 2BK5A 4B63A 3LZWA 3D9XA 2ZZ0A 3CGCA 4G6HA 2FJEA 1Z6LA 3BNMA 2ZZCA 1O94A 4WX1A 4AOSA 1TRBA 3SQPA 1FCDA 1OJAA 3NNEA 2C7GA 1JOAA 1FL2A 3LJPA 2BK4A 2YR4A 3CNPA 3IC9A 4GAVA 2XLSA 3GDPA 3S5WA 4XXGA 3AD8B 5KNLA 1L0VA 2OLNA 1ZK7A 3QFAA 4U8MA 2BS4A 1H2IA 4XWZA 4GAPA 4C3XA 4GCMA 2BC0A 4LU6A 1H83A 1P2EA 4YSXA 2RGJA 1GV4A 1GTEA 1S7MA 1F3PA 3K7QX 4EM3A 1VDCA 1GEUA 2A87A 4G6GA 2C65A 3BI2A 2GEWA 2Z5XA 4D04A 2PHHA 4YKGA 3H8LA 3GWDA 4OPLA 5KOXA 1ZX9A 3ICRA 2JK6A 2BXRA 2GV8A 1DJNA 1PBDA 4USRA 3UTHA 2UZZA 5KWFA 1Q1RA 2O9ZA 3AEAA 2XFUA 1N4WA 3NLCA 2V6OA 2XVEA 3UTGA 4APNA 2EQ7A 5JCIA 1IUTA 1GALA 1H86A 1Y56B 4RG4A 4UDPA 4Z44A 3DJJA 4B64A 2VQ7A 1MOKA 3ATQA 1V59A 1LVLA 1EL8A 2YR5A 3G5QA 2BS2A 1PBCA 4OCGA 1BGJA 1PXAA 3NYEA 3GYJA 3P4SA 2JB3A 2GR3A 2WOWA 3UKAA 3LADA 1K0IA 3UOZA 1S2QA 1O5WA 3DJEA 1EL9A 2YLTA 3KA7A 3AYIA 3CPIG 3D8XA 4B65A 4K2XA 4AT2A 4A5LA 2RGHA 4B68A 2XLRA 2R0GA 2C67A 2YG3A 4B1BA 4GRTA 1DXLA 4YSZA 2YVFA 1DJQA 2DKHA 3B3RA 2WS3A 1IUSA 3IWAA 3EAOA 3NKSA 4CNJA 2GRTA 5C3JA 3CIRA 1ZOYA 2C3DA 5M0ZA 1GOSA 1LPFA 3EANA 1OJDA 2YLWA 4H4TA 1ZDLA 3SFEA 5DBJA 4A7AA 2Q0LA 1BF3A 4U8NA 5KMRA 3AE7A 3AYJA 5U1OA 1TYTA 3DK4A 4HB9A 2YVGA 4H4QA 4ECHA 2WDRA 4H2RA 3NIXA 2BXSA 3KPKA 3DJDA 4WCTA 3FIMB 1GSNA 3AYLA 1GESA 3P4QA 2FBWA 5ER0A 1YQ4A 2C72A 4O5QA 2B76A 3AEDA 2WOIA 1DNCA 2R4JA 3HYWA 2YLZA 2WOVA 2BCGG 3JSKA 1VG0A 2IIDA 1M64A 2ZBWA 3SX6A 3K30A 3T31A 4BK2A 2VRLA 3I3LA 3URHA 1D4EA 4I59A 1IUXA 2WU5A 1D5TA 1N4VA 3V76A 3KVEA 1OJTA 4NTEA 4YKFA 2C3CA 3QSEA 4YSHA 5FS6A 4J57A 5FS9A 4OPGA 3HZLA 1KN0A 1VQWA 1RYIA 1OJCA 4GR1A 5BVAA 4FX9A 4YWOA 1Y0PA 5HHFA 1RP0A 1K4QA 3GWFA 4AP1A 3VQRA 3NTDA 2XCGA 2BA9A 3UOXA 2TPRA 4XWRA 3NYFA 3PG6A 1BZLA 4AOXA 3Q6JA 5JRBA 3GDNA 3OC4A 4K7ZA 4ZCCA 2GR0A 4DNAA 2Z5YA 3UKKA 3UKPA 1LJ1A 2GAGB 4U8PA 5JCMA 3BI4A 2EQ6A 2ARDA 5EB5A 1OJ9A 2I0ZA 1JRZA 1PBEA 3GD3A 1NG4A 2WP6A 1PJ6A 5KOWA 1HYUA 4NEVA 2WESA 3C4NA 1YQZA 1GXFA 5FS8A 1DOEA 2WDQA 2XVIA 2XFQA 2XYOA 2GH5A 1S2YA 2CDUA 5IQ1A 1JEHA 2JKCA 2YG7A 4J33A 3UTFA 3O0HA 2YG5A 5KVIA 4Z2UA 4AT0A 3NN0X 3SZ0A 2VRMA 4BK1A 4DSGA 3DGZA 4BV6A 3T0KA 1KNPA 2Q6UA 3ALLA 3RNMA 3F8RA 1E1NA 3LOVA 4NEWA 3NN6X 3SXIA 3T2YA 4JNAA 1E7PA 3SZCA 4A6NB 3P1WA 4EQSA 4ZCDA 1PN0A 3GYXA 1D4DA 4FDCB 1NENA 3NYCA 1GRTA 3ABVA 4CCRA 2R9ZA 3GYIA 2RGOA 3ICTA 1GERA 3ITJA 4NZHA 3FPZA 1KNRA 2E4GA 4Y4MA 4U2TA 3SGLA 3AE6A 1CHUA 3EPTA 2WDVA 1D7LA 5L46A 5LV9A 3G5RA 2XLPA 2X3NA 4EIQA 3UKFA 4II2A 4C3YA 1EBDA 3NH3X 2GMJA 2XFOA 4IVMB 3ICSA 2WETA 3VR8A 1GRGA 1TDFA 4A99A 2C76A 3WE0A 3H4KA 4H4ZA 3QJ4A 3NGCX 2BCPA 2C75A 4UP3A 1PDHA 2VQBA 1B5QA 2WU2A 2JBVA 1CJ4A 4TM4A 2R0PA 5KMQA 2GQFA 2V61A 2OLOA 2TMDA 4TM0A 2B7SA 4UDQA 3GMCA 3COXA 2HQMA 4OPDA 3D1CA 1E1MA 4U8KA 3C4AA 4G74A 4GUVA 3L8KA 4I58A 1H7XA 1VRQB 3AE3A 3QVRA 1CC4A 3H8IA 4NNJA 5U25A 1ZP0A 1UKVG 3M0OA 4OPCA 4JN9A 4EQWA 3M12A 1XANA 3DA1A 2XDOA 1ONFA 3AD7B 5U63A 3T37A 3EF6A 3DGHA 2YG6A 1QO8A 5IQ4A 2OAMA 2BC1A 1CC2A 4GF7A 3CNSA 1W4XA 3GRTA 4YXDA 4U2SA 2XLUA 3GRSA 1VG9A 3V3OA 1AOGA 3AEFA 1NHSA 3NTAA 4KX6A 1M6IA 1DOCA 1JRYA 2VVLG 4CCQA 2B7RA 2A8XA 1N1PA 1NAAA 4K5SA 3RP6A 2YG4A 2DKIA 1TDEA 3AE8A 3KU9A 5M10A 4ADWA 1CJ3A 2VVLA 2YLSA 5GSNA 1NDAA 2GVCA 4Z25A 3PO7A 2YQUA 2FJBA 4CBQA 4D03A 2YWLA 5HY5A 2X8HA 4U8IA 1SEZA 4II3A 1Y56A 2APGA 2V3BA 2YM1A 3CGDA 1E1LA 1E39A 4H7UA 3DH9A 2JB2A 4OVIA 1CC6A 3PS9A 3T2ZA 3ZYXA 3L1RA 3T2KA 4G9KA 2BYBA 3RP7A 2VZ2A 3OZ2A 1D4CA 2NVKX 4H4RA 5TR3A 1B4VA 3CNJA 4TLZA 1CJCA 2BABA 1NHPA 3SY4A 2C4CA 3CGEA 1GRBA 3ALJA 4PAAA 3L5OA 4BURA 1F8SA 2C70A 3VRDB 3BHKA 3ADAB 2EQ9A 4Z2RA 1NEKA 3AEEA 2EQ8A 2QAEA 2YVJA 4H4VA 5EBKA 2R4EA 2NPXA 1PBFA 2Q7VA 1IUWA 3QSSA 4IV9A 3HYXA 1XDIA 3AECA 3RP8A 4ZN0A 3VRBA 5BUKA 3AE4A 1EL7A 5CQFA 2JB1A 4FK1C 3IHGA 2BK3A 3GSIA 3HYVA 3NHOX 4K22A 3FMWA 1PXCA 1K0JA 3VRAA 5J60A 1TDKA 2AQJA 2RABA 4H4YA 4CY6A 5EOWA 1H7WA 4H2QA 1KSUA 1YKJA 4B69A 2WHDA 4E0VA 4USQA 1QLBA 1JRXA 4H4WA 2AR8A 1N4UA 2FJDA 3T14A 4DSHA 4JY3A 4YTMA 4CNKA 3NG7X 2WQYA 1XHCA 5FMHA 4CRTA 4U8LA 1NPXA 1PXBA 1FEBA 1Q1WA 3ATRA 2XFNA 2GR1A 3DMEA 3SFDA 1H82A 2BRYA 3UP5A 4K8DA 3UOYA 1FOHA 2E1MA 4H4PA 1TYPA 1CBOA 3P9UA 4U2LA 1CF3A 1BKWA 1GPEA 1LQTA 4EMWA 1DOBA 3KKJA 2ACZA 3UKLA 1F8WA 1MXTA 2IVEA 4EMIA 2GF3A 3CTYA 4UDRA 4RSLA 2JAEA 3G5SA 4A65A 4EM4A 2IVDA 1ZMCA 1YQ3A 4HA6A 3UTEA 4BJYA 1S3BA 3C96A 2F5ZA 1CL0A 2CULA 1GRFA 1F6MA 4H4XA 1PBBA 2C64A 4P9SA 3SZFA 2X8CA 3LZXA 4Z24A 1Q9IA 3QFBA 5JCLA 2VVMA 1PS9A 5CKUA 1B37A 5KVHA 4JY2A 3IF9A 2X8GA 4BK3A 4X9MA 3AXBA 3V3NA 2W0HA 2BRAA 3UKQA 3CGBA 3QSMA 1ZOVA 3SM8A 1KF6A 5J7XA 2V3AA 4RG3A 1FECA 3CN8A 4J2WA 2C73A 3K7MX 2GB0A 4EQXA 2Q0KA 4A9WA 4YTNA 1ELIA 4OPTA 4OPIA 1XPQA 3NK2X 1PJ5A 1GT8A 2H89A 3AEGA 1LQUA 1TDOA 1H81A 2OA1A 4LIIA 3CNDA 1L9DA 3P4PA 2CFYA 3GD4A 3KLJA 5KRQA 1H6VA 1LV0A 2GAHB 1K0LA 4X9NA 1KFYA 4Y4LA 5KXJA 3BI5A 2WP9A 3AEBA 2A89A 2C66A 2B9XA 4Y4NA 3I6DA 3NK0X 2GR2A 1P2HA 2B9WA 4YSYA 4O5UA 3ISHA 4A6NA 3S61A 1GETA 1L9EA 1H84A 1JNZA 4Z43A 5C2TA 4IA6A 2E5VA 3FG2P 3AB1A 5IPYA 2YM2A 1GREA 4CY8A 2QA2A 4K5RA 1ZY8A 3NT6A 2R0CA 2YAUA 1BGNA 3UCLA 4NWZA 3UP4A 1LTXR 2XVJA 4EMJA 2ZZBA 4TM1A 1E6EA 3R9UA 1GRHA 2R45A 1ZKQA 4JQ9A 2J3NA 3IHMA 1KDGA 4TM3A 2WEUA 1E1KA 2YLXA 1DODA 5GRTA 2XVHA 3F8PA 3DK8A 2YLRA 3M13A 4FK1A 3DJGX 4AP3A 4BJZA 4H4UA 3NRNA 3E1TA 3KD9A 4U8OA 4H50A 2FJAA 1YY5A 3BNUA 4N9XA 4PABA 2CVJA 4X4JA 4YTPA 3NK1X 3LB8A 2X50A 3LXDA 2Y6QA 1D7YA 2WBAA 3GMBA 4A79A 2V5ZA 4G73A 3SYIA 2BS3A 1O95A 3REDA 3DK9A 3AE9A 3CNTA 4B67A 4OPUA 4C74A 3AE5A 1NHQA 4NTCA 1GTHA 5JCNA 3ZDNA 1TDNA 3AE2A 4EQRA 3CPHG 4GDPA 4NTDA 5HYMA 5HXIA 4TLXA 5EB4A 4J31A 1L9CA 2WPCA 4Z2TA 2WPFA 1JU2A 2QCUA 3SZWA 4H2PA 1PHHA 4GDEA 2GQWA 1IUVA 3CPJG 3RHAA 4B66A 2R46A 1B8SA 2QA1A 1RSGA 2XLTA 4EIPA 3K7TA 3F8DA 4IA5A 4J36A 1QJDA 1REOA 2Y6RA 2XFPA 3ALMA 3UKHA 3VR9A 2XVFA 3AWIA 1JNRA 1ZMDA 1F8RA 1PJ7A 2GMHA 1MO9A 4REKA 2AAQA 3KPFA 4ICYA 4C77A 4LA1A 3Q9TA 4M52A 5KMPA 4H2NA 1CJ2A 3PVCA 4JDRA 1IUUA 1GNDA 2OALA 3FBSA 1S3EA 2WPEA 2H88A 2V60A 4J34A 4Z26A 4IVOB 4JNQA 2X99A 2BACA 3BHFA 4C5OA 1FEAA 3II4A 4J56A 1COYA 2YR6A 1IJHA 1NHRA 4KPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BWC A;  5FS7 A;  3P4R A;  4DGK A;  3UOV A;  5JCK A;  4MJW A;  2B9Y A;  1EL5 A;  5BRT A;  2VOU A;  2WP5 A;  4U8J A;  2PYX A;  1GRA A;  4H4S A;  3AE1 A;  3AD9 B;  3QVP A;  1X31 B;  4YT0 A;  5BUL A;  1KSS A;  1NG3 A;  3B6D A;  2BK5 A;  4B63 A;  3LZW A;  2ZZ0 A;  3CGC A;  2FJE A;  1Z6L A;  3BNM A;  2ZZC A;  1O94 A;  4WX1 A;  4AOS A;  1TRB A;  3SQP A;  1FCD A;  1OJA A;  3NNE A;  2C7G A;  1JOA A;  1FL2 A;  3LJP A;  2BK4 A;  2YR4 A;  3CNP A;  3IC9 A;  2XLS A;  3GDP A;  3S5W A;  4XXG A;  3AD8 B;  1L0V A;  2OLN A;  1ZK7 A;  3QFA A;  4U8M A;  2BS4 A;  4XWZ A;  4C3X A;  4GCM A;  2BC0 A;  4LU6 A;  1H83 A;  1P2E A;  4YSX A;  2RGJ A;  1GV4 A;  1GTE A;  1F3P A;  3K7Q X;  4EM3 A;  1VDC A;  1GEU A;  2A87 A;  2C65 A;  3BI2 A;  2GEW A;  2Z5X A;  4D04 A;  2PHH A;  4YKG A;  3H8L A;  3GWD A;  4OPL A;  5KOX A;  1ZX9 A;  3ICR A;  2JK6 A;  2BXR A;  2GV8 A;  1DJN A;  1PBD A;  4USR A;  3UTH A;  2UZZ A;  5KWF A;  1Q1R A;  2O9Z A;  3AEA A;  2XFU A;  1N4W A;  3NLC A;  2V6O A;  2XVE A;  3UTG A;  4APN A;  2EQ7 A;  5JCI A;  1IUT A;  1GAL A;  1H86 A;  1Y56 B;  4RG4 A;  4UDP A;  4Z44 A;  3DJJ A;  4B64 A;  2VQ7 A;  1MOK A;  3ATQ A;  1V59 A;  1LVL A;  1EL8 A;  2YR5 A;  3G5Q A;  2BS2 A;  1PBC A;  4OCG A;  1BGJ A;  1PXA A;  3NYE A;  3GYJ A;  3P4S A;  2JB3 A;  2GR3 A;  2WOW A;  3UKA A;  3LAD A;  1K0I A;  3UOZ A;  1S2Q A;  1O5W A;  3DJE A;  1EL9 A;  2YLT A;  3KA7 A;  3AYI A;  3CPI G;  3D8X A;  4B65 A;  4K2X A;  4AT2 A;  4A5L A;  2RGH A;  4B68 A;  2XLR A;  2R0G A;  2C67 A;  2YG3 A;  4B1B A;  4GRT A;  1DXL A;  4YSZ A;  2YVF A;  1DJQ A;  2DKH A;  3B3R A;  2WS3 A;  1IUS A;  3IWA A;  3EAO A;  3NKS A;  4CNJ A;  2GRT A;  5C3J A;  3CIR A;  1ZOY A;  2C3D A;  5M0Z A;  1GOS A;  1LPF A;  3EAN A;  1OJD A;  2YLW A;  4H4T A;  1ZDL A;  3SFE A;  5DBJ A;  4A7A A;  2Q0L A;  1BF3 A;  4U8N A;  3AE7 A;  3AYJ A;  5U1O A;  1TYT A;  3DK4 A;  4HB9 A;  2YVG A;  4H4Q A;  4ECH A;  2WDR A;  4H2R A;  3NIX A;  2BXS A;  4WCT A;  3DJD A;  4BK2 A;  3FIM B;  1GSN A;  3AYL A;  1GES A;  3P4Q A;  2FBW A;  5ER0 A;  1YQ4 A;  2C72 A;  4O5Q A;  2B76 A;  3AED A;  2WOI A;  1DNC A;  2R4J A;  2YLZ A;  2WOV A;  2BCG G;  3JSK A;  1VG0 A;  2IID A;  1M64 A;  2ZBW A;  3K30 A;  2VRL A;  3I3L A;  3URH A;  1D4E A;  4I59 A;  1IUX A;  2WU5 A;  1D5T A;  1N4V A;  3V76 A;  3KVE A;  1OJT A;  4NTE A;  4YKF A;  2C3C A;  3QSE A;  4YSH A;  5FS6 A;  4J57 A;  5FS9 A;  4OPG A;  3HZL A;  1VQW A;  1RYI A;  1OJC A;  4GR1 A;  5BVA A;  4FX9 A;  4YWO A;  1Y0P A;  5HHF A;  1RP0 A;  1K4Q A;  3GWF A;  4AP1 A;  3VQR A;  3NTD A;  2XCG A;  2BA9 A;  3UOX A;  2TPR A;  4XWR A;  3NYF A;  1BZL A;  4AOX A;  3Q6J A;  3GDN A;  3OC4 A;  4K7Z A;  4ZCC A;  2GR0 A;  4DNA A;  2Z5Y A;  3UKK A;  3UKP A;  1LJ1 A;  2GAG B;  4U8P A;  5JCM A;  3BI4 A;  2EQ6 A;  2ARD A;  5EB5 A;  1OJ9 A;  2I0Z A;  1JRZ A;  1PBE A;  3GD3 A;  1NG4 A;  2WP6 A;  1PJ6 A;  5KOW A;  1HYU A;  4NEV A;  2WES A;  3C4N A;  1YQZ A;  1GXF A;  5FS8 A;  1DOE A;  2WDQ A;  2XVI A;  2XFQ A;  2XYO A;  2GH5 A;  1S2Y A;  2CDU A;  5IQ1 A;  1JEH A;  2JKC A;  2YG7 A;  4J33 A;  3UTF A;  3O0H A;  2YG5 A;  5KVI A;  4Z2U A;  4AT0 A;  3NN0 X;  2VRM A;  4BK1 A;  4DSG A;  3DGZ A;  4BV6 A;  1KNP A;  2Q6U A;  3ALL A;  3RNM A;  3F8R A;  1E1N A;  3LOV A;  4NEW A;  3NN6 X;  4JNA A;  1E7P A;  4A6N B;  3P1W A;  4EQS A;  4ZCD A;  1PN0 A;  1D4D A;  4FDC B;  1NEN A;  3NYC A;  1GRT A;  3ABV A;  4CCR A;  2R9Z A;  3GYI A;  2RGO A;  3ICT A;  1GER A;  3ITJ A;  4NZH A;  3FPZ A;  1KNR A;  2E4G A;  4Y4M A;  4U2T A;  3SGL A;  3AE6 A;  1CHU A;  3EPT A;  2WDV A;  1D7L A;  5L46 A;  5LV9 A;  3G5R A;  2XLP A;  2X3N A;  4EIQ A;  3UKF A;  4C3Y A;  1EBD A;  3NH3 X;  2GMJ A;  2XFO A;  4IVM B;  3ICS A;  2WET A;  3VR8 A;  1GRG A;  1TDF A;  4A99 A;  2C76 A;  3WE0 A;  3H4K A;  4H4Z A;  3QJ4 A;  3NGC X;  2BCP A;  2C75 A;  4UP3 A;  1PDH A;  2VQB A;  1B5Q A;  2WU2 A;  2JBV A;  1CJ4 A;  4TM4 A;  2R0P A;  2GQF A;  2V61 A;  2OLO A;  2TMD A;  4TM0 A;  2B7S A;  4UDQ A;  3GMC A;  3COX A;  2HQM A;  4OPD A;  3D1C A;  1E1M A;  4U8K A;  3C4A A;  4GUV A;  3L8K A;  4I58 A;  1H7X A;  1VRQ B;  3AE3 A;  3QVR A;  1CC4 A;  3H8I A;  5U25 A;  1ZP0 A;  1UKV G;  3M0O A;  4OPC A;  4JN9 A;  4EQW A;  3M12 A;  1XAN A;  3DA1 A;  2XDO A;  1ONF A;  3AD7 B;  5U63 A;  3T37 A;  3EF6 A;  3DGH A;  2YG6 A;  1QO8 A;  5IQ4 A;  2OAM A;  2BC1 A;  1CC2 A;  4GF7 A;  3CNS A;  1W4X A;  3GRT A;  4YXD A;  4U2S A;  2XLU A;  3GRS A;  1VG9 A;  3V3O A;  1AOG A;  3AEF A;  1NHS A;  3NTA A;  4KX6 A;  1M6I A;  1DOC A;  1JRY A;  2VVL G;  4CCQ A;  2B7R A;  2A8X A;  1N1P A;  1NAA A;  4K5S A;  3RP6 A;  2YG4 A;  2DKI A;  1TDE A;  3AE8 A;  3KU9 A;  5M10 A;  4ADW A;  1CJ3 A;  2VVL A;  2YLS A;  5GSN A;  1NDA A;  2GVC A;  4Z25 A;  3PO7 A;  2YQU A;  2FJB A;  4CBQ A;  4D03 A;  2YWL A;  5HY5 A;  2X8H A;  4U8I A;  1SEZ A;  1Y56 A;  2APG A;  2V3B A;  2YM1 A;  3CGD A;  1E1L A;  1E39 A;  4H7U A;  3DH9 A;  2JB2 A;  4OVI A;  1CC6 A;  3PS9 A;  3ZYX A;  3L1R A;  3RP7 A;  2BYB A;  2VZ2 A;  3OZ2 A;  1D4C A;  2NVK X;  4H4R A;  5TR3 A;  1B4V A;  3CNJ A;  4TLZ A;  1CJC A;  2BAB A;  1NHP A;  3CGE A;  1GRB A;  3ALJ A;  4PAA A;  4BUR A;  1F8S A;  2C70 A;  3VRD B;  3BHK A;  3ADA B;  2EQ9 A;  4Z2R A;  1NEK A;  3AEE A;  2EQ8 A;  2QAE A;  2YVJ A;  4H4V A;  5EBK A;  2R4E A;  2NPX A;  1PBF A;  2Q7V A;  1IUW A;  3QSS A;  4IV9 A;  1XDI A;  3AEC A;  3RP8 A;  4ZN0 A;  3VRB A;  5BUK A;  3AE4 A;  1EL7 A;  5CQF A;  2JB1 A;  4FK1 C;  3IHG A;  2BK3 A;  3GSI A;  3NHO X;  4K22 A;  3FMW A;  1PXC A;  1K0J A;  3VRA A;  5J60 A;  1TDK A;  2AQJ A;  2RAB A;  4H4Y A;  4CY6 A;  5EOW A;  1H7W A;  4H2Q A;  1KSU A;  1YKJ A;  4B69 A;  2WHD A;  4E0V A;  4USQ A;  1QLB A;  1JRX A;  4H4W A;  2AR8 A;  1N4U A;  2FJD A;  4DSH A;  4JY3 A;  4YTM A;  4CNK A;  3NG7 X;  2WQY A;  1XHC A;  5FMH A;  4CRT A;  4U8L A;  1NPX A;  1PXB A;  1FEB A;  1Q1W A;  3ATR A;  2XFN A;  2GR1 A;  3DME A;  3SFD A;  1H82 A;  3UP5 A;  4K8D A;  3UOY A;  1FOH A;  2E1M A;  4H4P A;  1TYP A;  1CBO A;  3P9U A;  4U2L A;  1CF3 A;  1BKW A;  1GPE A;  1LQT A;  4EMW A;  1DOB A;  3KKJ A;  2ACZ A;  3UKL A;  1F8W A;  1MXT A;  2IVE A;  4EMI A;  2GF3 A;  3CTY A;  4UDR A;  4RSL A;  2JAE A;  3G5S A;  4A65 A;  4EM4 A;  2IVD A;  1ZMC A;  1YQ3 A;  4HA6 A;  3UTE A;  4BJY A;  1S3B A;  3C96 A;  2F5Z A;  1CL0 A;  2CUL A;  1GRF A;  1F6M A;  4H4X A;  1PBB A;  2C64 A;  4P9S A;  2X8C A;  3LZX A;  4Z24 A;  1Q9I A;  3QFB A;  5JCL A;  2VVM A;  1PS9 A;  5CKU A;  1B37 A;  5KVH A;  4JY2 A;  3IF9 A;  2X8G A;  4BK3 A;  4X9M A;  3AXB A;  3V3N A;  2W0H A;  3UKQ A;  3CGB A;  3QSM A;  1ZOV A;  3SM8 A;  1KF6 A;  5J7X A;  2V3A A;  4RG3 A;  1FEC A;  3CN8 A;  4J2W A;  2C73 A;  3K7M X;  2GB0 A;  4EQX A;  2Q0K A;  4A9W A;  4YTN A;  1ELI A;  4OPT A;  4OPI A;  1XPQ A;  3NK2 X;  1PJ5 A;  1GT8 A;  2H89 A;  3AEG A;  1LQU A;  1TDO A;  1H81 A;  2OA1 A;  4LII A;  3CND A;  1L9D A;  3P4P A;  2CFY A;  3GD4 A;  3KLJ A;  5KRQ A;  1H6V A;  1LV0 A;  2GAH B;  1K0L A;  4X9N A;  1KFY A;  4Y4L A;  5KXJ A;  3BI5 A;  2WP9 A;  3AEB A;  2A89 A;  2C66 A;  2B9X A;  4Y4N A;  3I6D A;  3NK0 X;  2GR2 A;  1P2H A;  2B9W A;  4YSY A;  4O5U A;  3ISH A;  4A6N A;  3S61 A;  1GET A;  1L9E A;  1H84 A;  1JNZ A;  4Z43 A;  5C2T A;  4IA6 A;  2E5V A;  3FG2 P;  3AB1 A;  5IPY A;  2YM2 A;  1GRE A;  4CY8 A;  2QA2 A;  4K5R A;  1ZY8 A;  3NT6 A;  2R0C A;  2YAU A;  1BGN A;  3UCL A;  3UP4 A;  1LTX R;  2XVJ A;  4EMJ A;  2ZZB A;  4TM1 A;  1E6E A;  3R9U A;  1GRH A;  2R45 A;  1ZKQ A;  4JQ9 A;  2J3N A;  3IHM A;  1KDG A;  4TM3 A;  2WEU A;  1E1K A;  2YLX A;  1DOD A;  5GRT A;  2XVH A;  3F8P A;  3DK8 A;  2YLR A;  3M13 A;  4FK1 A;  3DJG X;  4AP3 A;  4BJZ A;  4H4U A;  3NRN A;  3E1T A;  3KD9 A;  4U8O A;  4H50 A;  2FJA A;  1YY5 A;  3BNU A;  4N9X A;  4PAB A;  2CVJ A;  4X4J A;  4YTP A;  3NK1 X;  3LB8 A;  2X50 A;  3LXD A;  2Y6Q A;  1D7Y A;  2WBA A;  3GMB A;  4A79 A;  2V5Z A;  2BS3 A;  1O95 A;  3RED A;  3DK9 A;  3AE9 A;  3CNT A;  4B67 A;  4OPU A;  4C74 A;  3AE5 A;  1NHQ A;  4NTC A;  1GTH A;  5JCN A;  3ZDN A;  1TDN A;  3AE2 A;  4EQR A;  3CPH G;  4GDP A;  4NTD A;  5HYM A;  5HXI A;  4TLX A;  5EB4 A;  4J31 A;  1L9C A;  2WPC A;  4Z2T A;  2WPF A;  1JU2 A;  2QCU A;  4H2P A;  1PHH A;  4GDE A;  2GQW A;  1IUV A;  3CPJ G;  3RHA A;  4B66 A;  2R46 A;  1B8S A;  2QA1 A;  1RSG A;  2XLT A;  4EIP A;  3K7T A;  3F8D A;  4IA5 A;  4J36 A;  1QJD A;  1REO A;  2Y6R A;  2XFP A;  3ALM A;  3UKH A;  3VR9 A;  2XVF A;  3AWI A;  1JNR A;  1ZMD A;  1F8R A;  1PJ7 A;  2GMH A;  1MO9 A;  4REK A;  2AAQ A;  3KPF A;  4ICY A;  4C77 A;  4LA1 A;  3Q9T A;  4M52 A;  4H2N A;  1CJ2 A;  3PVC A;  4JDR A;  1IUU A;  1GND A;  2OAL A;  3FBS A;  1S3E A;  2WPE A;  2H88 A;  2V60 A;  4J34 A;  4Z26 A;  4IVO B;  4JNQ A;  2X99 A;  2BAC A;  3BHF A;  4C5O A;  1FEA A;  3II4 A;  4J56 A;  1COY A;  2YR6 A;  1IJH A;  1NHR A;  4KPR A; 
#chains in the Genus database with same CATH topology
 4MJW A;  1BKH A;  2PYX A;  3QVP A;  4YT0 A;  2BK5 A;  4B63 A;  3LZW A;  4KEM A;  1PDZ A;  1N63 C;  4G6H A;  2FJE A;  3BNM A;  4WX1 A;  4AOS A;  2PP3 A;  3SQP A;  3NNE A;  3IJL A;  3CNP A;  2PU0 A;  3S5W A;  4XXG A;  2OLN A;  2P8C A;  4GCM A;  2BC0 A;  2RGJ A;  1GEU A;  4JN7 A;  4G6G A;  4ZOH B;  2GEW A;  3H8L A;  3GWD A;  4OPL A;  3NS1 B;  2BXR A;  3RCY A;  3UTH A;  2E5A A;  2XFU A;  3A7A A;  3UTG A;  4APN A;  5JCI A;  1Y56 B;  4RG4 A;  4Z44 A;  2PPG A;  2BS2 A;  4YWS A;  4DXK A;  3LAD A;  1EC9 A;  3DJE A;  1EL9 A;  3CPI G;  2AKM A;  1SJB A;  2YG3 A;  2YVF A;  2DKH A;  1IUS A;  3T6C A;  3EAO A;  2GRT A;  3ES8 A;  1LPF A;  5DBJ A;  5KMR A;  3AE7 A;  2PTX A;  3AYJ A;  5U1O A;  1F9C A;  4ECH A;  4IP4 A;  3KPK A;  3STP A;  1GSN A;  3P4Q A;  5ER0 A;  1SB3 B;  1RM6 B;  3FVD A;  3B9J B;  3RR1 A;  1M64 A;  3EKG A;  3K30 A;  3T31 A;  3I3L A;  1D5T A;  2W3S A;  4Z17 A;  3KVE A;  2C3C A;  4YSH A;  4J57 A;  4IL0 A;  2CHR A;  4YWO A;  1K4Q A;  1N5W C;  2FYM A;  3GDN A;  4K7Z A;  4ZCC A;  2GR0 A;  4DNA A;  1LJ1 A;  2GAG B;  4U8P A;  2I0Z A;  1PBE A;  1NG4 A;  2WP6 A;  3HPF A;  2HNE A;  3FV9 A;  1GXF A;  5FS8 A;  1DOE A;  2XVI A;  1JEH A;  4J33 A;  3AMZ A;  3DGZ A;  3A7U A;  4GIR A;  4ZCD A;  1D4D A;  1NEN A;  2R9Z A;  1KNR A;  3QN3 A;  2E4G A;  2X3N A;  3UKF A;  4II2 A;  3RRA A;  4C3Y A;  4HCL A;  3DDM A;  3VR8 A;  3H4K A;  1FO4 A;  1NEL A;  3NGC X;  3ZVH B;  2GQF A;  4HN8 A;  4U8K A;  1KKO A;  4I58 A;  5U25 A;  1ZP0 A;  3OZY A;  4JN9 A;  2OPJ A;  3DA1 A;  1ONF A;  3EF6 A;  2YG6 A;  2BC1 A;  1CC2 A;  2PTZ A;  4KWS A;  1W4X A;  3TCS A;  3NTA A;  1DOC A;  2B7R A;  1NAA A;  1TDE A;  2VVL A;  3UJE A;  5GSN A;  4M6U A;  4Z25 A;  2YQU A;  4CBQ A;  2YWL A;  1SEZ A;  3CGD A;  4H7U A;  3DH9 A;  4ZCW A;  3R0U A;  1D4C A;  2NVK X;  4H4R A;  5TR3 A;  1B4V A;  2BAB A;  1NHP A;  1P48 A;  1GRB A;  2GSH A;  3ALJ A;  3VRD B;  2C70 A;  4Z2R A;  1NEK A;  3AEE A;  2EQ8 A;  4A3R A;  2YVJ A;  4H4V A;  2R4E A;  2Q7V A;  1PBF A;  3HYX A;  5CQF A;  2JB1 A;  3ZLH A;  3IHG A;  2BK3 A;  1FFU C;  3NHO X;  4K22 A;  1K0J A;  4H4Y A;  3S47 A;  3UJ2 A;  4H2Q A;  2WHD A;  3DIP A;  4H4W A;  2AR8 A;  2FJD A;  2QJN A;  5FMH A;  3VFC A;  1PXB A;  3ATR A;  2XFN A;  3PWI A;  5FJU A;  3UOY A;  1N62 C;  4EMW A;  1F8W A;  1P43 A;  2GF3 A;  2JAE A;  3G5S A;  4EM4 A;  1ZMC A;  2CUL A;  4P9S A;  2VVM A;  4JY2 A;  2X8G A;  3AXB A;  2W0H A;  2OLA A;  2XGZ A;  3CN8 A;  3K7M X;  3ENL A;  1GT8 A;  1TDO A;  3SR6 B;  2QDE A;  1L9D A;  3GD4 A;  1LV0 A;  3NVW B;  3FJ4 A;  4Y4L A;  3BI5 A;  1R0M A;  3R0K A;  3I6D A;  4O5U A;  3ISH A;  1L9E A;  2YM2 A;  4DN1 A;  2QA2 A;  1ZY8 A;  3NT6 A;  3P3B A;  1BGN A;  3UP4 A;  1LTX R;  4EMJ A;  4TM1 A;  3R9U A;  1GRH A;  3CXO A;  5IDZ A;  5FJO A;  4DHG A;  3F8P A;  3DJG X;  3E1T A;  2FJA A;  4N9X A;  4YTP A;  2CVJ A;  2HXT A;  1ZXI C;  3GMB A;  2POZ A;  3PFR A;  3RED A;  4B67 A;  4C74 A;  1N5X A;  1GTH A;  3ZDN A;  3IJQ A;  2WPC A;  2QJJ A;  1PHH A;  4GDE A;  3CPJ G;  2OKT A;  4B66 A;  2R46 A;  1RSG A;  3K7T A;  4IA5 A;  1JPD X;  3VR9 A;  1JNR A;  2AAQ A;  3KPF A;  1EC8 A;  4IZG A;  1CJ2 A;  1S3E A;  2WPE A;  3MKC A;  4DWD A;  1FEA A;  1NHR A;  1BWC A;  5FS7 A;  4DGK A;  1XS2 A;  2B9Y A;  4EWJ A;  5KMS A;  2WP5 A;  1XPY A;  4H4S A;  3DG7 A;  1X31 B;  3RO6 A;  2OX4 A;  2ZZ0 A;  1MUC A;  1Z6L A;  2PGW A;  2C7G A;  3IC9 A;  3R25 A;  1ZK7 A;  2BS4 A;  1H2I A;  4XWZ A;  4J1O A;  4GYP C;  1F3P A;  4EM3 A;  2C65 A;  4HPN A;  3BI2 A;  2XH7 A;  4YKG A;  2PHH A;  3V3W A;  2ONE A;  5KOX A;  3ICR A;  1PBD A;  2PMQ A;  5KWF A;  2UZZ A;  1MNS A;  3AEA A;  2P3Z A;  4ROP A;  2XVE A;  2EQ7 A;  1TZZ A;  2PTY A;  1EL8 A;  1LVL A;  2YR5 A;  1EBH A;  2JB3 A;  2GR3 A;  2WOW A;  3UKA A;  5ENL A;  2PP0 A;  5FJR A;  1O5W A;  2YLT A;  3NO1 A;  3KA7 A;  3AYI A;  3ZVH A;  4A5L A;  2XLR A;  2R0G A;  2C67 A;  3H8A A;  4GRT A;  4YSZ A;  1N60 C;  1DJQ A;  5BOE A;  3N6H A;  3IWA A;  3NKS A;  5C3J A;  2C3D A;  1GOS A;  1OJD A;  2PCE A;  2PU1 A;  4HB9 A;  4H4Q A;  4H2R A;  2BXS A;  4BK2 A;  4FP1 A;  1GES A;  3U9I A;  2P0I A;  2WOI A;  3JSK A;  1VG0 A;  2IID A;  3URH A;  4I59 A;  1IUX A;  1N4V A;  3V76 A;  4NTE A;  3ZLF A;  5FS6 A;  1OJC A;  5BVA A;  3TWB A;  3GWF A;  3VQR A;  3NTD A;  4XWR A;  3NYF A;  3PG6 A;  3OC4 A;  3UKK A;  2ARD A;  1JRZ A;  3GD3 A;  3EEZ A;  1PJ6 A;  3C4N A;  1YQZ A;  2XFQ A;  2CDU A;  2JKC A;  2YG7 A;  4Z2U A;  4BK1 A;  1FFV C;  1BQG A;  4DSG A;  3ALL A;  2Q6U A;  3H7V A;  3F8R A;  3DEQ A;  1E1N A;  3SXI A;  3T2Y A;  4JNA A;  3P1W A;  3DFY A;  4EQS A;  3GYX A;  3DG3 A;  3ABV A;  4CCR A;  3GYI A;  3ITJ A;  3FPZ A;  4U2T A;  1PDY A;  3AE6 A;  3TOY A;  1JRP A;  2WDV A;  5LV9 A;  3G5R A;  2XLP A;  1EBD A;  1WUF A;  4IVM B;  2XFO A;  2WET A;  4A99 A;  3WE0 A;  4J3Z A;  4H4Z A;  2BCP A;  2C75 A;  2VQB A;  1B5Q A;  2JBV A;  3CT2 A;  4K2S A;  2V61 A;  4TM0 A;  4UDQ A;  3V5F A;  3GMC A;  1VDV A;  3L8K A;  2MUC A;  1H7X A;  3QVR A;  3H8I A;  1UKV G;  3M0O A;  3I4K A;  4OPC A;  1FHU A;  3AD7 B;  5U63 A;  2QQ6 A;  3T37 A;  3DGH A;  5IQ4 A;  4GF7 A;  2XH0 A;  3CNS A;  3GRT A;  4YXD A;  2XLU A;  3GRS A;  1AOG A;  4JHM A;  4KX6 A;  2DKI A;  2PA6 A;  3KU9 A;  2YLS A;  2GVC A;  2FJB A;  4II3 A;  1E1L A;  1E39 A;  3ZYX A;  3T2Z A;  3PS9 A;  3T2K A;  3RP7 A;  3OZ2 A;  3CNJ A;  4TLZ A;  3N4E A;  2C4C A;  4PAA A;  3L5O A;  1F8S A;  2RDX A;  3BHK A;  2E3T A;  2QAE A;  5EBK A;  3QSS A;  4IV9 A;  1XDI A;  1STZ A;  3T9P A;  3RP8 A;  3TJI A;  4ZN0 A;  5BUK A;  3AE4 A;  1EL7 A;  4ENL A;  3UXK A;  3HYV A;  4GYP A;  3FMW A;  3VRA A;  5J60 A;  1NU5 A;  2AQJ A;  4B69 A;  1QLB A;  1JRX A;  1N4U A;  4YTM A;  3BSM A;  3NG7 X;  1XHC A;  3QTP A;  4U8L A;  1Q1W A;  1RVK A;  3DME A;  4E4F A;  6ENL A;  2QGY A;  4HCH A;  3R07 C;  2E1M A;  1CBO A;  3P9U A;  2OFJ A;  1DOB A;  3KKJ A;  3UKL A;  3CTY A;  4UDR A;  4RSL A;  3HW2 A;  1E9I A;  1YQ3 A;  4HA6 A;  2DW7 A;  3QKE A;  3LZX A;  1VQZ A;  5JCL A;  3VC6 A;  3IF9 A;  2OVL A;  2BRA A;  3CGB A;  4JN8 A;  3MY9 A;  3UJR A;  2C73 A;  4EQX A;  4OPI A;  1XPQ A;  2NQL A;  5J04 A;  1LQU A;  1H81 A;  3KLJ A;  5KRQ A;  2XH2 A;  2B9X A;  3NK0 X;  2GR2 A;  4A6N A;  3MUC A;  3FG2 P;  3AB1 A;  5IPY A;  1OEP A;  4X2P A;  4K5R A;  3UCL A;  2XVJ A;  2ZZB A;  1T3Q C;  2R45 A;  1ZKQ A;  3IHM A;  1KDG A;  5GRT A;  3SQS A;  4BJZ A;  3NRN A;  3BNU A;  4PAB A;  2X50 A;  3LXD A;  3MQT A;  3MZN A;  2WBA A;  4A79 A;  4MKS A;  2I5Q A;  1NHQ A;  3D46 A;  4IP5 A;  3AE2 A;  5HYM A;  5EB4 A;  3P0W A;  2OO6 A;  4Z2T A;  4H2P A;  1IUV A;  3NZG A;  4H19 A;  2QA1 A;  3OP2 A;  3SJN A;  2XVF A;  3OZM A;  2GMH A;  3SN1 A;  4ICY A;  5KMP A;  1YEY A;  1IUU A;  2OAL A;  3VC5 A;  3BOX A;  4DX3 A;  3ETR B;  2V60 A;  4Z26 A;  4JNQ A;  2BAC A;  3BHF A;  3II4 A;  1COY A;  1IJH A;  2OZT A;  4G7F A;  3UOV A;  3CMM A;  4U8J A;  3AD9 B;  3SN0 A;  1NG3 A;  3D9X A;  3CGC A;  1O94 A;  1FCD A;  1OJA A;  3MWC A;  1JOA A;  2POD A;  2YR4 A;  3GDP A;  5KNL A;  1L0V A;  4U8M A;  4GAP A;  4LU6 A;  1H83 A;  3A7R A;  1V97 A;  1GTE A;  3K7Q X;  2A87 A;  2W54 A;  4D04 A;  2ZAD A;  4DYE A;  1ZX9 A;  3R11 A;  1DJN A;  2O9Z A;  3CAW A;  1IUT A;  3TW9 A;  3DJJ A;  4B64 A;  3ATQ A;  1MOK A;  3G5Q A;  1PBC A;  4GGH A;  3S5S A;  3R1Z A;  1S2Q A;  4B65 A;  4AT2 A;  2RGH A;  4B68 A;  1JRO A;  2WS3 A;  4CNJ A;  3CIR A;  3ZLG A;  2PTW A;  1SJC A;  2O56 A;  2YLW A;  1ZDL A;  3SFE A;  4A7A A;  1BF3 A;  3QPE A;  4HNL A;  1TYT A;  3DK4 A;  2YVG A;  3NIX A;  3DJD A;  3FXG A;  3FIM B;  2QVH A;  1YQ4 A;  3CK5 A;  3Q45 A;  2B76 A;  2OQY A;  3AED A;  1DNC A;  2ZBW A;  3SX6 A;  1D4E A;  2WU5 A;  1OJT A;  4OPG A;  3MSY A;  1RYI A;  4GR1 A;  5HHF A;  1KCZ A;  1RP0 A;  4AP1 A;  3ZVI A;  2XCG A;  1SJD A;  4GFI A;  3Q4D A;  1BZL A;  2GGI A;  1FIQ B;  3RIT A;  1KD0 A;  3GO2 A;  5JCM A;  3BI4 A;  2EQ6 A;  5EB5 A;  1OJ9 A;  4GGB A;  4KT2 A;  2WES A;  2OG9 A;  2XYO A;  1S2Y A;  2GGJ A;  5IQ1 A;  2YG5 A;  4AT0 A;  3NN0 X;  3NVV B;  2VRM A;  3T0K A;  2PGE A;  3RNM A;  2GGG A;  3SZC A;  4A6N B;  3NYC A;  3ICT A;  3EPT A;  1D7L A;  4EIQ A;  3CXB A;  3NH3 X;  1ELS A;  1GRG A;  2C76 A;  4G8T A;  3QJ4 A;  3TWA A;  4UP3 A;  1PDH A;  1CJ4 A;  1ONE A;  2R0P A;  2OLO A;  3COX A;  4OPD A;  3D1C A;  3C4A A;  4IL2 A;  3IJI A;  3AE3 A;  1MRA A;  3NXL A;  4NNJ A;  1XAN A;  2OAM A;  4U2S A;  3AEF A;  1NHS A;  1M6I A;  2HXU A;  4CCQ A;  4KPL A;  2YG4 A;  1WUE A;  5M10 A;  3DER A;  4ADW A;  3PO7 A;  4D03 A;  3I6E A;  2APG A;  2V3B A;  3L1R A;  2BYB A;  3HRD C;  1CJC A;  3CGE A;  5G5G B;  3IK4 A;  3SN4 A;  4BUR A;  3R10 A;  3UGV A;  4MGG A;  3TQP A;  1X2H A;  3THU A;  2ZC8 A;  1PXC A;  1TDK A;  2RAB A;  1KSU A;  1YKJ A;  2P8B A;  3T14 A;  4DSH A;  4TVW A;  1NPX A;  1FEB A;  3VCN A;  1SJA A;  2GR1 A;  3VCC A;  4HCD A;  4H4P A;  1DTN A;  1TYP A;  4U2L A;  1BKW A;  1GPE A;  3JW7 A;  1MXT A;  3GY1 A;  2IVE A;  4EMI A;  3N4F A;  4A65 A;  3UTE A;  3H70 A;  4BJY A;  1S3B A;  3C96 A;  2F5Z A;  1CL0 A;  1GRF A;  1F6M A;  4H4X A;  2C64 A;  2X8C A;  4Z24 A;  1Q9I A;  3QFB A;  1PS9 A;  5CKU A;  3UJS A;  1B37 A;  3SBF A;  4X9M A;  3UKQ A;  3QSM A;  4RG3 A;  2AKZ A;  1FEC A;  4J2W A;  4YTN A;  1PJ5 A;  2H89 A;  3AN1 A;  3P4P A;  3CND A;  1H6V A;  3B97 A;  5KXJ A;  2WP9 A;  1P2H A;  1GET A;  5C2T A;  1JPM A;  4Z43 A;  2YAU A;  4NWZ A;  1E6E A;  1N61 C;  4ZA0 A;  3CB3 A;  4E4U A;  3GC2 A;  1FHV A;  1DOD A;  2XVH A;  3DK8 A;  4FK1 A;  4AP3 A;  4H4U A;  3KD9 A;  4U8O A;  4H50 A;  4X4J A;  3LB8 A;  1D7Y A;  2PS2 A;  4G73 A;  2BS3 A;  3DK9 A;  3AE9 A;  3NVZ B;  3JZU A;  4EQR A;  4GDP A;  4NTD A;  3V4B A;  5HXI A;  2OQH A;  3I6T A;  1L9C A;  2QCU A;  1EBG A;  3RHA A;  1B8S A;  4EIP A;  4J36 A;  1REO A;  2Y6R A;  2XFP A;  2XH4 A;  4E6M A;  1PJ7 A;  1MO9 A;  2OZ8 A;  4M52 A;  4H2N A;  2H88 A;  4IVO B;  2X99 A;  2QJM A;  2YR6 A;  1JDF A;  2JB2 A;  4B1B A;  3AD8 B;  3GD6 A;  3P4R A;  5JCK A;  1EL5 A;  3QLD A;  5BRT A;  2VOU A;  1GRA A;  3AE1 A;  4K1W A;  3JVA A;  5BUL A;  1KSS A;  3B6D A;  3RGT A;  3FCP A;  2ZZC A;  1TRB A;  5G5H B;  1FL2 A;  3LJP A;  2BK4 A;  4GAV A;  2XLS A;  3QFA A;  1MDR A;  3H12 A;  4C3X A;  1P2E A;  3VA8 A;  4YSX A;  1GV4 A;  1S7M A;  3V5C A;  1VDC A;  2GDQ A;  2Z5X A;  2JK6 A;  2GV8 A;  1IYX A;  3UCD A;  4USR A;  1Q1R A;  3U4F A;  1N4W A;  3NLC A;  3TJ4 A;  2AL2 A;  2V6O A;  3VDG A;  2DW6 A;  1H86 A;  4UDP A;  1GAL A;  5BOF A;  2VQ7 A;  2HZG A;  1V59 A;  4OCG A;  1BGJ A;  4H2H A;  1PXA A;  3NYE A;  3GYJ A;  3P4S A;  3UOZ A;  1K0I A;  3D8X A;  4K2X A;  4TVY A;  1MDL A;  1DXL A;  3B3R A;  4A35 A;  4GME A;  2OZ3 A;  1ZOY A;  3T8Q A;  5M0Z A;  3EAN A;  4E8G A;  4H4T A;  2Q0L A;  4U8N A;  2WDR A;  4WCT A;  3AYL A;  2FBW A;  2C72 A;  4O5Q A;  1JCT A;  2R4J A;  3HYW A;  2YLZ A;  2WOV A;  2BCG G;  2VRL A;  2XSX A;  4YKF A;  3QSE A;  1WYG A;  5FS9 A;  3HZL A;  1KN0 A;  1VQW A;  3NVY B;  4FX9 A;  1Y0P A;  2BA9 A;  3UOX A;  2TPR A;  4AOX A;  3Q6J A;  5FJT A;  5JRB A;  2QDD A;  2Z5Y A;  3UKP A;  4IT1 A;  5KOW A;  1HYU A;  4NEV A;  2WDQ A;  3K1G A;  2GH5 A;  3UTF A;  3O0H A;  1TKK A;  5KVI A;  3SZ0 A;  3N6J A;  4BV6 A;  1TE6 A;  1KNP A;  3LOV A;  4NEW A;  3NN6 X;  1E7P A;  4F4R A;  1PN0 A;  4FDC B;  1GRT A;  3T4W A;  4NZH A;  2RGO A;  1GER A;  4Y4M A;  3SGL A;  2GGH A;  1CHU A;  5L46 A;  2GMJ A;  3ICS A;  4K8G A;  1TDF A;  3ES7 A;  1R6W A;  3TTE A;  2WU2 A;  4TM4 A;  5KMQ A;  2TMD A;  2B7S A;  2HQM A;  1E1M A;  4G74 A;  4GUV A;  1VRQ B;  1CC4 A;  1KKR A;  4EQW A;  3M12 A;  2XDO A;  3UCC A;  1QO8 A;  3V3O A;  1VG9 A;  2GL5 A;  3EUB 3;  2GGE A;  1JRY A;  2VVL G;  2A8X A;  1N1P A;  4K5S A;  3RP6 A;  2PSN A;  4MMW A;  3AE8 A;  1CJ3 A;  1NDA A;  4A6G A;  3OW1 A;  5HY5 A;  2X8H A;  4U8I A;  1Y56 A;  4E5T A;  2YM1 A;  4OVI A;  3CYJ A;  3DFH A;  2FKP A;  3FYY A;  1CC6 A;  4G9K A;  2VZ2 A;  3KUM A;  3SY4 A;  3ADA B;  2EQ9 A;  3OPS A;  2NPX A;  1IUW A;  3AM9 A;  3AEC A;  3VRB A;  2AL1 A;  4FK1 C;  4HYR A;  3GSI A;  3D47 A;  1X2G A;  4CY6 A;  5EOW A;  2MNR A;  1H7W A;  4E0V A;  7ENL A;  4USQ A;  4JY3 A;  4CNK A;  2WQY A;  1EC7 A;  4CRT A;  3UXL A;  1H82 A;  2BRY A;  3SFD A;  3UP5 A;  4K8D A;  1FOH A;  4GIS A;  4M0X A;  1CF3 A;  1LQT A;  3SSZ A;  2ACZ A;  2IVD A;  1PBB A;  2W55 A;  3SZF A;  2AL2 B;  5KVH A;  4BK3 A;  3V3N A;  1ZOV A;  3SM8 A;  1KF6 A;  5J7X A;  2V3A A;  2W3R A;  2GB0 A;  2Q0K A;  4A9W A;  1ELI A;  2PP1 A;  4OPT A;  3NK2 X;  3AEG A;  2OA1 A;  4LII A;  2CFY A;  5EU9 A;  2GAH B;  1K0L A;  4X9N A;  1KFY A;  3PK7 A;  3AEB A;  2A89 A;  2C66 A;  4Y4N A;  4YSY A;  2B9W A;  3S61 A;  2P88 A;  1H84 A;  1JNZ A;  4IA6 A;  2E5V A;  5FJP A;  1GRE A;  4CY8 A;  2R0C A;  3DGB A;  4JQ9 A;  2J3N A;  4TM3 A;  2WEU A;  1E1K A;  2YLX A;  4IHC A;  4HNC A;  2YLR A;  3NRZ B;  3M13 A;  1L8P A;  1YY5 A;  3DES A;  3NK1 X;  3NFU A;  2Y6Q A;  4FI4 A;  2V5Z A;  3SYI A;  1O95 A;  3CNT A;  4OPU A;  3AE5 A;  1W6T A;  4NTC A;  5JCN A;  3UJF A;  1TDN A;  3CPH G;  3OTR A;  4TLX A;  4J31 A;  2WPF A;  1JU2 A;  3SZW A;  4H1Z A;  2GQW A;  3P93 A;  2XLT A;  3F8D A;  1QJD A;  3ALM A;  3UKH A;  3AWI A;  1ZMD A;  1F8R A;  4REK A;  4C77 A;  4LA1 A;  3DG6 A;  3Q9T A;  4Z1Y A;  3PVC A;  4JDR A;  1GND A;  3PWG A;  3FBS A;  4J34 A;  4H83 A;  3BJS A;  4C5O A;  1ECQ A;  4J56 A;  4KPR A; 
#chains in the Genus database with same CATH homology
 1BWC A;  5FS7 A;  3P4R A;  4DGK A;  3UOV A;  5JCK A;  4MJW A;  2B9Y A;  1EL5 A;  3CMM A;  5BRT A;  2VOU A;  2WP5 A;  4U8J A;  2PYX A;  1GRA A;  4H4S A;  3AE1 A;  5KMS A;  3AD9 B;  3QVP A;  1X31 B;  4YT0 A;  5BUL A;  1KSS A;  1NG3 A;  3B6D A;  2BK5 A;  4B63 A;  3LZW A;  3D9X A;  2ZZ0 A;  3CGC A;  4G6H A;  2FJE A;  1Z6L A;  3BNM A;  2ZZC A;  1O94 A;  4WX1 A;  4AOS A;  1TRB A;  3SQP A;  1FCD A;  1OJA A;  3NNE A;  2C7G A;  1JOA A;  1FL2 A;  3LJP A;  2BK4 A;  2YR4 A;  3CNP A;  3IC9 A;  4GAV A;  2XLS A;  3GDP A;  3S5W A;  4XXG A;  3AD8 B;  5KNL A;  1L0V A;  2OLN A;  1ZK7 A;  3QFA A;  4U8M A;  2BS4 A;  1H2I A;  4XWZ A;  4GAP A;  4C3X A;  4GCM A;  2BC0 A;  4LU6 A;  1H83 A;  1P2E A;  4YSX A;  2RGJ A;  1GV4 A;  1GTE A;  1S7M A;  1F3P A;  3K7Q X;  4EM3 A;  1VDC A;  1GEU A;  2A87 A;  4G6G A;  2C65 A;  3BI2 A;  2GEW A;  2Z5X A;  4D04 A;  2PHH A;  4YKG A;  3H8L A;  3GWD A;  4OPL A;  5KOX A;  1ZX9 A;  3ICR A;  2JK6 A;  2BXR A;  2GV8 A;  1DJN A;  1PBD A;  4USR A;  3UTH A;  2UZZ A;  5KWF A;  1Q1R A;  2O9Z A;  3AEA A;  2XFU A;  1N4W A;  3NLC A;  2V6O A;  2XVE A;  3UTG A;  4APN A;  2EQ7 A;  5JCI A;  1IUT A;  1GAL A;  1H86 A;  1Y56 B;  4RG4 A;  4UDP A;  4Z44 A;  3DJJ A;  4B64 A;  2VQ7 A;  1MOK A;  3ATQ A;  1V59 A;  1LVL A;  1EL8 A;  2YR5 A;  3G5Q A;  2BS2 A;  1PBC A;  4OCG A;  1BGJ A;  1PXA A;  3NYE A;  3GYJ A;  3P4S A;  2JB3 A;  2GR3 A;  2WOW A;  3UKA A;  3LAD A;  1K0I A;  3UOZ A;  1S2Q A;  1O5W A;  3DJE A;  1EL9 A;  2YLT A;  3KA7 A;  3AYI A;  3CPI G;  3D8X A;  4B65 A;  4K2X A;  4AT2 A;  4A5L A;  2RGH A;  4B68 A;  2XLR A;  2R0G A;  2C67 A;  2YG3 A;  4B1B A;  4GRT A;  1DXL A;  4YSZ A;  2YVF A;  1DJQ A;  2DKH A;  3B3R A;  2WS3 A;  1IUS A;  3IWA A;  3EAO A;  3NKS A;  4CNJ A;  2GRT A;  5C3J A;  3CIR A;  1ZOY A;  2C3D A;  5M0Z A;  1GOS A;  1LPF A;  3EAN A;  1OJD A;  2YLW A;  4H4T A;  1ZDL A;  3SFE A;  5DBJ A;  4A7A A;  2Q0L A;  1BF3 A;  4U8N A;  5KMR A;  3AE7 A;  3AYJ A;  5U1O A;  1TYT A;  3DK4 A;  4HB9 A;  2YVG A;  4H4Q A;  4ECH A;  2WDR A;  4H2R A;  3NIX A;  2BXS A;  3KPK A;  3DJD A;  4WCT A;  3FIM B;  1GSN A;  3AYL A;  1GES A;  3P4Q A;  2FBW A;  5ER0 A;  1YQ4 A;  2C72 A;  4O5Q A;  2B76 A;  3AED A;  2WOI A;  1DNC A;  2R4J A;  3HYW A;  2YLZ A;  2WOV A;  2BCG G;  3JSK A;  1VG0 A;  2IID A;  1M64 A;  2ZBW A;  3SX6 A;  3K30 A;  3T31 A;  4BK2 A;  2VRL A;  3I3L A;  3URH A;  1D4E A;  4I59 A;  1IUX A;  2WU5 A;  1D5T A;  1N4V A;  3V76 A;  3KVE A;  1OJT A;  4NTE A;  4YKF A;  2C3C A;  3QSE A;  4YSH A;  5FS6 A;  4J57 A;  5FS9 A;  4OPG A;  3HZL A;  1KN0 A;  1VQW A;  1RYI A;  1OJC A;  4GR1 A;  5BVA A;  4FX9 A;  4YWO A;  1Y0P A;  5HHF A;  1RP0 A;  1K4Q A;  3GWF A;  4AP1 A;  3VQR A;  3NTD A;  2XCG A;  2BA9 A;  3UOX A;  2TPR A;  4XWR A;  3NYF A;  3PG6 A;  1BZL A;  4AOX A;  3Q6J A;  5JRB A;  3GDN A;  3OC4 A;  4K7Z A;  4ZCC A;  2GR0 A;  4DNA A;  2Z5Y A;  3UKK A;  3UKP A;  1LJ1 A;  2GAG B;  4U8P A;  5JCM A;  3BI4 A;  2EQ6 A;  2ARD A;  5EB5 A;  1OJ9 A;  2I0Z A;  1JRZ A;  1PBE A;  3GD3 A;  1NG4 A;  2WP6 A;  1PJ6 A;  5KOW A;  1HYU A;  4NEV A;  2WES A;  3C4N A;  1YQZ A;  1GXF A;  5FS8 A;  1DOE A;  2WDQ A;  2XVI A;  2XFQ A;  2XYO A;  2GH5 A;  1S2Y A;  2CDU A;  5IQ1 A;  1JEH A;  2JKC A;  2YG7 A;  4J33 A;  3UTF A;  3O0H A;  2YG5 A;  5KVI A;  4Z2U A;  4AT0 A;  3NN0 X;  3SZ0 A;  2VRM A;  4BK1 A;  4DSG A;  3DGZ A;  4BV6 A;  3T0K A;  1KNP A;  2Q6U A;  3ALL A;  3RNM A;  3F8R A;  1E1N A;  3LOV A;  4NEW A;  3NN6 X;  3SXI A;  3T2Y A;  4JNA A;  1E7P A;  3SZC A;  4A6N B;  3P1W A;  4EQS A;  4ZCD A;  1PN0 A;  3GYX A;  1D4D A;  4FDC B;  1NEN A;  3NYC A;  1GRT A;  3ABV A;  4CCR A;  2R9Z A;  3GYI A;  2RGO A;  3ICT A;  1GER A;  3ITJ A;  4NZH A;  3FPZ A;  1KNR A;  2E4G A;  4Y4M A;  4U2T A;  3SGL A;  3AE6 A;  1CHU A;  3EPT A;  2WDV A;  1D7L A;  5L46 A;  5LV9 A;  3G5R A;  2XLP A;  2X3N A;  4EIQ A;  3UKF A;  4II2 A;  4C3Y A;  1EBD A;  3NH3 X;  2GMJ A;  2XFO A;  4IVM B;  3ICS A;  2WET A;  3VR8 A;  1GRG A;  1TDF A;  4A99 A;  2C76 A;  3WE0 A;  3H4K A;  4H4Z A;  3QJ4 A;  3NGC X;  2BCP A;  2C75 A;  4UP3 A;  1PDH A;  2VQB A;  1B5Q A;  2WU2 A;  2JBV A;  1CJ4 A;  4TM4 A;  2R0P A;  5KMQ A;  2GQF A;  2V61 A;  2OLO A;  2TMD A;  4TM0 A;  2B7S A;  4UDQ A;  3GMC A;  3COX A;  2HQM A;  4OPD A;  3D1C A;  1E1M A;  4U8K A;  3C4A A;  4G74 A;  4GUV A;  3L8K A;  4I58 A;  1H7X A;  1VRQ B;  3AE3 A;  3QVR A;  1CC4 A;  3H8I A;  4NNJ A;  5U25 A;  1ZP0 A;  1UKV G;  3M0O A;  4OPC A;  4JN9 A;  4EQW A;  3M12 A;  1XAN A;  3DA1 A;  2XDO A;  1ONF A;  3AD7 B;  5U63 A;  3T37 A;  3EF6 A;  3DGH A;  2YG6 A;  1QO8 A;  5IQ4 A;  2OAM A;  2BC1 A;  1CC2 A;  4GF7 A;  3CNS A;  1W4X A;  3GRT A;  4YXD A;  4U2S A;  2XLU A;  3GRS A;  1VG9 A;  3V3O A;  1AOG A;  3AEF A;  1NHS A;  3NTA A;  4KX6 A;  1M6I A;  1DOC A;  1JRY A;  2VVL G;  4CCQ A;  2B7R A;  2A8X A;  1N1P A;  1NAA A;  4K5S A;  3RP6 A;  2YG4 A;  2DKI A;  1TDE A;  3AE8 A;  3KU9 A;  5M10 A;  4ADW A;  1CJ3 A;  2VVL A;  2YLS A;  5GSN A;  1NDA A;  2GVC A;  4Z25 A;  3PO7 A;  2YQU A;  2FJB A;  4CBQ A;  4D03 A;  2YWL A;  5HY5 A;  2X8H A;  4U8I A;  1SEZ A;  4II3 A;  1Y56 A;  2APG A;  2V3B A;  2YM1 A;  3CGD A;  1E1L A;  1E39 A;  4H7U A;  3DH9 A;  2JB2 A;  4OVI A;  1CC6 A;  3PS9 A;  3T2Z A;  3ZYX A;  3L1R A;  3T2K A;  4G9K A;  2BYB A;  3RP7 A;  2VZ2 A;  3OZ2 A;  1D4C A;  2NVK X;  4H4R A;  5TR3 A;  1B4V A;  3CNJ A;  4TLZ A;  1CJC A;  2BAB A;  1NHP A;  3SY4 A;  2C4C A;  3CGE A;  1GRB A;  3ALJ A;  4PAA A;  3L5O A;  4BUR A;  1F8S A;  2C70 A;  3VRD B;  3BHK A;  3ADA B;  2EQ9 A;  4Z2R A;  1NEK A;  3AEE A;  2EQ8 A;  2QAE A;  2YVJ A;  4H4V A;  5EBK A;  2R4E A;  2NPX A;  1PBF A;  2Q7V A;  1IUW A;  3QSS A;  4IV9 A;  3HYX A;  1XDI A;  3AEC A;  3RP8 A;  4ZN0 A;  3VRB A;  5BUK A;  3AE4 A;  1EL7 A;  5CQF A;  2JB1 A;  4FK1 C;  3IHG A;  2BK3 A;  3GSI A;  3HYV A;  3NHO X;  4K22 A;  3FMW A;  1PXC A;  1K0J A;  3VRA A;  5J60 A;  1TDK A;  2AQJ A;  2RAB A;  4H4Y A;  4CY6 A;  5EOW A;  1H7W A;  4H2Q A;  1KSU A;  1YKJ A;  4B69 A;  2WHD A;  4E0V A;  4USQ A;  1QLB A;  1JRX A;  4H4W A;  2AR8 A;  1N4U A;  2FJD A;  3T14 A;  4DSH A;  4JY3 A;  4YTM A;  4CNK A;  3NG7 X;  2WQY A;  1XHC A;  5FMH A;  4CRT A;  4U8L A;  1NPX A;  1PXB A;  1FEB A;  1Q1W A;  3ATR A;  2XFN A;  2GR1 A;  3DME A;  3SFD A;  1H82 A;  2BRY A;  3UP5 A;  4K8D A;  3UOY A;  1FOH A;  2E1M A;  4H4P A;  1TYP A;  1CBO A;  3P9U A;  4U2L A;  1CF3 A;  1BKW A;  1GPE A;  1LQT A;  4EMW A;  1DOB A;  3KKJ A;  2ACZ A;  3UKL A;  1F8W A;  1MXT A;  2IVE A;  4EMI A;  2GF3 A;  3CTY A;  4UDR A;  4RSL A;  2JAE A;  3G5S A;  4A65 A;  4EM4 A;  2IVD A;  1ZMC A;  1YQ3 A;  4HA6 A;  3UTE A;  4BJY A;  1S3B A;  3C96 A;  2F5Z A;  1CL0 A;  2CUL A;  1GRF A;  1F6M A;  4H4X A;  1PBB A;  2C64 A;  4P9S A;  3SZF A;  2X8C A;  3LZX A;  4Z24 A;  1Q9I A;  3QFB A;  5JCL A;  2VVM A;  1PS9 A;  5CKU A;  1B37 A;  5KVH A;  4JY2 A;  3IF9 A;  2X8G A;  4BK3 A;  4X9M A;  3AXB A;  3V3N A;  2W0H A;  2BRA A;  3UKQ A;  3CGB A;  3QSM A;  1ZOV A;  3SM8 A;  1KF6 A;  5J7X A;  2V3A A;  4RG3 A;  1FEC A;  3CN8 A;  4J2W A;  2C73 A;  3K7M X;  2GB0 A;  4EQX A;  2Q0K A;  4A9W A;  4YTN A;  1ELI A;  4OPT A;  4OPI A;  1XPQ A;  3NK2 X;  1PJ5 A;  1GT8 A;  2H89 A;  3AEG A;  1LQU A;  1TDO A;  1H81 A;  2OA1 A;  4LII A;  3CND A;  1L9D A;  3P4P A;  2CFY A;  3GD4 A;  3KLJ A;  5KRQ A;  1H6V A;  1LV0 A;  2GAH B;  1K0L A;  4X9N A;  1KFY A;  4Y4L A;  5KXJ A;  3BI5 A;  2WP9 A;  3AEB A;  2A89 A;  2C66 A;  2B9X A;  4Y4N A;  3I6D A;  3NK0 X;  2GR2 A;  1P2H A;  2B9W A;  4YSY A;  4O5U A;  3ISH A;  4A6N A;  3S61 A;  1GET A;  1L9E A;  1H84 A;  1JNZ A;  4Z43 A;  5C2T A;  4IA6 A;  2E5V A;  3FG2 P;  3AB1 A;  5IPY A;  2YM2 A;  1GRE A;  4CY8 A;  2QA2 A;  4K5R A;  1ZY8 A;  3NT6 A;  2R0C A;  2YAU A;  1BGN A;  3UCL A;  4NWZ A;  3UP4 A;  1LTX R;  2XVJ A;  4EMJ A;  2ZZB A;  4TM1 A;  1E6E A;  3R9U A;  1GRH A;  2R45 A;  1ZKQ A;  4JQ9 A;  2J3N A;  3IHM A;  1KDG A;  4TM3 A;  2WEU A;  1E1K A;  2YLX A;  1DOD A;  5GRT A;  2XVH A;  3F8P A;  3DK8 A;  2YLR A;  3M13 A;  4FK1 A;  3DJG X;  4AP3 A;  4BJZ A;  4H4U A;  3NRN A;  3E1T A;  3KD9 A;  4U8O A;  4H50 A;  2FJA A;  1YY5 A;  3BNU A;  4N9X A;  4PAB A;  2CVJ A;  4X4J A;  4YTP A;  3NK1 X;  3LB8 A;  2X50 A;  3LXD A;  2Y6Q A;  1D7Y A;  2WBA A;  3GMB A;  4A79 A;  2V5Z A;  4G73 A;  3SYI A;  2BS3 A;  1O95 A;  3RED A;  3DK9 A;  3AE9 A;  3CNT A;  4B67 A;  4OPU A;  4C74 A;  3AE5 A;  1NHQ A;  4NTC A;  1GTH A;  5JCN A;  3ZDN A;  1TDN A;  3AE2 A;  4EQR A;  3CPH G;  4GDP A;  4NTD A;  5HYM A;  5HXI A;  4TLX A;  5EB4 A;  4J31 A;  1L9C A;  2WPC A;  4Z2T A;  2WPF A;  1JU2 A;  2QCU A;  3SZW A;  4H2P A;  1PHH A;  4GDE A;  2GQW A;  1IUV A;  3CPJ G;  3RHA A;  4B66 A;  2R46 A;  1B8S A;  2QA1 A;  1RSG A;  2XLT A;  4EIP A;  3K7T A;  3F8D A;  4IA5 A;  4J36 A;  1QJD A;  1REO A;  2Y6R A;  2XFP A;  3ALM A;  3UKH A;  3VR9 A;  2XVF A;  3AWI A;  1JNR A;  1ZMD A;  1F8R A;  1PJ7 A;  2GMH A;  1MO9 A;  4REK A;  2AAQ A;  3KPF A;  4ICY A;  4C77 A;  4LA1 A;  3Q9T A;  4M52 A;  5KMP A;  4H2N A;  1CJ2 A;  3PVC A;  4JDR A;  1IUU A;  1GND A;  2OAL A;  3FBS A;  1S3E A;  2WPE A;  2H88 A;  2V60 A;  4J34 A;  4Z26 A;  4IVO B;  4JNQ A;  2X99 A;  2BAC A;  3BHF A;  4C5O A;  1FEA A;  3II4 A;  4J56 A;  1COY A;  2YR6 A;  1IJH A;  1NHR A;  4KPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...