1JOAA

Nadh peroxidase with cysteine-sulfenic acid
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
447
structure length
446
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH PEROXIDASE
publication title Structure of the native cysteine-sulfenic acid redox center of enterococcal NADH peroxidase refined at 2.8 A resolution.
pubmed doi rcsb
total genus 138
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1996-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1joaA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1joaA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1joaA02
2RGHA 4DNAA 4JNQA 1N4UA 3Q9TA 5LV9A 1PBEA 1CC2A 1GPEA 1GRFA 3AEEA 4X9NA 3RP6A 1XHCA 2XVJA 3AEAA 2TPRA 1S2YA 3GD3A 4A6NA 3P9UA 4YXDA 3EPTA 4GCMA 4EM3A 2OLOA 3C96A 2GR3A 3F8DA 1NG4A 2YAUA 2FJDA 3UKQA 5KOXA 3P4PA 3BNMA 3AE4A 2RGJA 3AD7B 3QJ4A 1PJ5A 3DK9A 5IPYA 2GQWA 1GRGA 3GMCA 4OPCA 3F8RA 1QJDA 3ISHA 3VR8A 3HZLA 4Z2RA 1CJ3A 2R0PA 4XWRA 1E1LA 1S3BA 4YSZA 5EB4A 1DJQA 2E5VA 2JB1A 3COXA 1BKWA 2V3BA 2BCGG 5IQ4A 3IWAA 3G5QA 2CVJA 2I0ZA 2X8GA 3VQRA 2GRTA 1GNDA 1PHHA 2WS3A 1TYPA 1DJNA 5GSNA 2WHDA 4WX1A 2ZZBA 1NDAA 3UOXA 4JDRA 3GYJA 2BACA 3JSKA 5L46A 4D04A 1ZOVA 1CL0A 1TDOA 3ICTA 3QSEA 4GDEA 4BJZA 3S61A 1TDNA 2JBVA 2ARDA 3C4AA 3CPJG 4KPRA 3ALLA 4GDPA 2UZZA 3P4QA 2YR6A 3AE7A 2HQMA 2YLTA 1MO9A 3IF9A 2FBWA 4N9XA 1QLBA 2WU5A 3UKHA 1K4QA 1FECA 2WDQA 1M6IA 3Q6JA 1GEUA 2WOWA 2Z5YA 1HYUA 1VQWA 3UKPA 2YLRA 2C3CA 1KSSA 1Y56B 3UP4A 1W4XA 2WOVA 2WP5A 2H89A 3GWDA 2Q0LA 1ZK7A 4FDCB 1JNZA 3LXDA 2C3DA 3DJJA 5TR3A 1E1MA 2DKIA 4IA6A 3FPZA 2XVEA 3CNPA 1OJDA 1B5QA 1PS9A 4IA5A 3WE0A 2A8XA 4C5OA 4A7AA 3LZXA 3I3LA 2OLNA 2XFOA 3ALMA 4GF7A 4Z2TA 1EBDA 1NPXA 4H4XA 1L9CA 1ZOYA 3RP7A 1GSNA 2GVCA 3AD9B 1E7PA 1CBOA 1UKVG 4C77A 5DBJA 2GB0A 4J56A 2YLZA 3KU9A 1K0IA 4K7ZA 1RYIA 1CJ2A 2YR4A 3M12A 2Y6QA 1GREA 1F8SA 4FX9A 4K8DA 4WCTA 3EF6A 2JKCA 3V76A 2C76A 4AOXA 3UTHA 2YLSA 1JNRA 1MXTA 1DOCA 2XFNA 2YWLA 4NTEA 3DJDA 4I58A 4OPIA 4AOSA 4B69A 4H4YA 4BV6A 2C64A 2QA1A 4B1BA 1PN0A 2WDVA 2WOIA 4JY3A 3NK1X 4NZHA 5KXJA 3SFEA 4IVOB 2YQUA 2YG6A 5CQFA 1YQ3A 2WQYA 4Z43A 1BF3A 4YTNA 1PBFA 4OPLA 2XVIA 3DH9A 4K5SA 4OVIA 1H82A 3UKFA 2R45A 2IVDA 4CNJA 1D4CA 4YWOA 1BGNA 2BC1A 2QA2A 3DGZA 4H50A 1CC6A 1VRQB 1VDCA 3UTEA 4A5LA 2XVHA 4U8IA 4IVMB 5BVAA 3NIXA 5FS8A 2X99A 4A99A 4A9WA 4Z25A 5M10A 1B4VA 4J36A 5EBKA 2CDUA 4A6NB 2VRMA 2V3AA 2C67A 1SEZA 4U8LA 3GWFA 2Q0KA 2B9WA 2X3NA 2YR5A 3RHAA 4A65A 1NHPA 1LJ1A 2WP6A 3CPHG 1YQ4A 1B8SA 3NTAA 3QVRA 4C3XA 3LZWA 1PBBA 3NYEA 3G5RA 3L1RA 2C70A 3S5WA 3GDPA 2AQJA 2H88A 4OPUA 2EQ7A 2BK4A 2XYOA 1IUTA 3CPIG 2X8HA 2NVKX 1DOBA 2OAMA 3AE3A 4Z26A 4CRTA 3DJGX 3LADA 4JN9A 3K7MX 1H84A 5J60A 2BC0A 1VG0A 1OJ9A 3ZYXA 4TM4A 4P9SA 4CY6A 4OPDA 4H4SA 3CIRA 3RP8A 3NYCA 3UTFA 3VR9A 1JOAA 2APGA 1D5TA 4J34A 2X50A 1E1NA 1GALA 1N1PA 3AEDA 4OCGA 5BULA 1P2EA 2YG5A 3NK0X 2XFPA 3KA7A 1F6MA 3AB1A 3BI4A 2BCPA 1LPFA 5EOWA 1VG9A 4USQA 5HYMA 1TDFA 1N4VA 3NGCX 3LB8A 1GRAA 5KWFA 3NNEA 3FIMB 4GRTA 2R4EA 2ZBWA 4UDRA 3VRBA 1KNPA 3H4KA 2B9YA 4BK3A 3UKLA 3UOYA 1QO8A 3CGCA 2R0GA 3DGHA 2Q7VA 3II4A 3F8PA 3H8LA 1PXBA 2C7GA 3AE9A 3NHOX 1E39A 2V61A 4U2TA 4B64A 4BURA 4Y4NA 1NHQA 1M64A 3V3OA 2XCGA 3UKAA 3P4SA 4O5QA 1ZX9A 3SGLA 2JK6A 1NEKA 3IHMA 2B7SA 3ALJA 4TM3A 2BK5A 1E6EA 5HXIA 1AOGA 2WP9A 3C4NA 2JAEA 4EQSA 2VQ7A 2JB3A 1YKJA 4GR1A 4YTMA 3P4RA 1PXCA 2BA9A 3AEFA 1XPQA 4RSLA 4AP1A 4J31A 5JCIA 2A87A 1PJ6A 1GESA 1JRYA 3FG2P 4U8JA 4Y4LA 2A89A 2V6OA 5HHFA 3OZ2A 1DNCA 1ZY8A 1TDEA 2XLRA 2Q6UA 4Y4MA 3URHA 3PO7A 1LVLA 2XLSA 2R9ZA 3V3NA 1COYA 4ICYA 1JEHA 2BYBA 2C75A 3ADAB 5KVIA 2GF3A 2CULA 4E0VA 1Y0PA 2GAHB 1BZLA 3EAOA 3AYLA 3ICRA 5C3JA 3KLJA 3CGBA 4JNAA 3KD9A 5JCKA 1KF6A 4H7UA 4RG4A 3IHGA 1F8RA 1LV0A 3EANA 1FEAA 1RSGA 2RABA 1GERA 2GH5A 1DXLA 1DODA 2NPXA 1EL8A 2BXRA 2GV8A 2VVLA 3ATRA 2YLXA 3CNTA 4H4WA 1H81A 1O94A 2XDOA 3GYIA 4U2SA 3NH3X 2OALA 3CGDA 3B6DA 2VQBA 3GRTA 1ZP0A 4NTDA 4Z2UA 3CGEA 4EIQA 3BI2A 3ZDNA 2VRLA 3B3RA 1N4WA 2R46A 3AXBA 3BNUA 1K0LA 4UDPA 4PABA 2FJEA 1PBCA 3I6DA 4O5UA 3K30A 3REDA 2GQFA 4X4JA 1GRTA 3VRAA 5IQ1A 2AR8A 2YG3A 3NN0X 1TRBA 2WESA 1KDGA 2W0HA 2WBAA 4CBQA 5BUKA 3K7TA 2Y6RA 1O5WA 3ICSA 3DJEA 4H4UA 1KFYA 4LA1A 3FMWA 3DMEA 4UDQA 5M0ZA 5JCLA 3AYIA 1EL7A 3D8XA 4C74A 4K22A 4K2XA 1GTHA 4H4QA 3E1TA 1NHRA 4OPTA 1GV4A 2PYXA 2VZ2A 3AD8B 3CN8A 3DA1A 3UOZA 2FJBA 4LU6A 1KSUA 4EMJA 2GMJA 1MOKA 4B66A 3AEGA 2B7RA 3KVEA 3FBSA 4YTPA 4EMWA 3NLCA 1LTXR 1IJHA 2C72A 3SFDA 4JY2A 1F3PA 3UP5A 1XDIA 3RNMA 5JCNA 1NAAA 2C65A 2V60A 4AP3A 1EL9A 2BS4A 2QCUA 3VRDB 5U1OA 1H7XA 2WEUA 3CNDA 4H4TA 1NENA 5FS7A 2GR2A 3BI5A 2EQ9A 4U8OA 3AYJA 4EIPA 1V59A 1Q1RA 3AECA 1ZMDA 4YSXA 4K5RA 4U8MA 4J57A 2EQ8A 4XXGA 1PDHA 1Q1WA 3K7QX 2WPCA 1XANA 4XWZA 2XLTA 5EB5A 4X9MA 1S2QA 4NTCA 4MJWA 4CCRA 1EL5A 1B37A 3D1CA 2WPEA 1GRBA 3DK4A 4EQRA 3G5SA 3KKJA 1GTEA 5FS9A 3OC4A 4J2WA 4NEVA 3AE6A 2E4GA 2GR0A 4Z24A 1YQZA 4B67A 2YM2A 3QSSA 1OJAA 2GMHA 4H4ZA 1FOHA 1TDKA 3BHFA 4YT0A 5KRQA 4U8PA 2WPFA 1ZDLA 3M0OA 2CFYA 2C66A 5U25A 2WU2A 1D4DA 2OA1A 3T37A 4H4PA 5FMHA 2BS2A 3GSIA 1D7LA 1H86A 4TLXA 3GRSA 1L0VA 3BHKA 3P1WA 1NG3A 1LQTA 1IUSA 3NG7X 4CCQA 2ZZ0A 4H2QA 2E1MA 4A79A 3GDNA 5FS6A 1JRXA 4LIIA 3AE2A 1LQUA 4U8NA 2IVEA 3AWIA 3SQPA 3CNJA 2IIDA 4TM0A 2YLWA 2C73A 1P2HA 4APNA 3GD4A 3UTGA 4UP3A 3KPFA 3PVCA 1ZKQA 3NYFA 1KNRA 4JQ9A 3AEBA 2J3NA 2EQ6A 4U8KA 3QSMA 1FEBA 4NEWA 4FK1A 3NK2X 4B68A 2R4JA 3R9UA 3NN6X 2VVLG 3UOVA 1RP0A 4H4VA 2B76A 1PXAA 4BK2A 1NHSA 1OJTA 1S3EA 2YG7A 4AT2A 1ONFA 1CHUA 1H6VA 4CY8A 4USRA 4AT0A 1H83A 2VVMA 2YVFA 3H8IA 4U2LA 3UCLA 1IUXA 4CNKA 5C2TA 1PBDA 4EMIA 1OJCA 3PS9A 2XLUA 1ZMCA 2B9XA 2TMDA 2DKHA 3L8KA 3NRNA 1YY5A 4D03A 1E1KA 5JCMA 3QFAA 2BS3A 1PJ7A 3LJPA 2Z5XA 4YSHA 1H7WA 2X8CA 5J7XA 1Y56A 2GEWA 2ZZCA 4RG3A 4EQWA 4ZCDA 4KX6A 1BWCA 4GUVA 1CJCA 4REKA 5BRTA 2ACZA 2XFUA 1GT8A 2YVGA 1D4EA 1CF3A 2XLPA 4TM1A 4B65A 4J33A 2XVFA 2YM1A 4YSYA 2YG4A 3CTYA 4H2NA 5KVHA 4ZN0A 2YVJA 3GMBA 5GRTA 2WDRA 1FL2A 2GAGB 1IUWA 2BXSA 3SM8A 3AE1A 3AE8A 4EM4A 3ABVA 4I59A 3DK8A 3ITJA 1IUVA 4B63A 1GETA 5KOWA 2R0CA 3NKSA 3AE5A 3UKKA 4ECHA 1Z6LA 4FK1C 2PHHA 4DSGA 1CC4A 3QVPA 1GRHA 4BJYA 5CKUA 1GOSA 4YKGA 4HA6A 4DGKA 2GR1A 1GXFA 5ER0A 4H4RA 1L9DA 4YKFA 2RGOA 3ATQA 1BGJA 1F8WA 3LOVA 2QAEA 5HY5A 3O0HA 2BABA 4H2RA 4ADWA 4OPGA 3M13A 2AAQA 2FJAA 2JB2A 1CJ4A 1JRZA 1ELIA 2O9ZA 1TYTA 4IV9A 4EQXA 4H2PA 1X31B 1Q9IA 2XFQA 4HB9A 1DOEA 5U63A 3IC9A 1REOA 1D7YA 4ZCCA 1L9EA 2F5ZA 4TLZA 1K0JA 2BK3A 3NTDA 1O95A 1IUUA 2V5ZA 2WETA 4Z44A 2VOUA 4DSHA 3NT6A 1JU2A 1FCDA 4PAAA 3QFBA 4M52A 4BK1A 3CNSA 4C3YA
chains in the Genus database with same CATH superfamily
2P0IA 5LV9A 2P8CA 3NZGA 1S2YA 4YXDA 3EPTA 4GCMA 3PFRA 4F4RA 3C96A 3CXBA 3F8DA 2YAUA 4HNCA 3AD7B 2GQWA 4E4UA 3F8RA 4OPCA 5EB4A 4M6UA 3CXOA 3RCYA 5IQ4A 2I0ZA 3VQRA 3K1GA 2WS3A 1JPMA 5GSNA 1PDYA 5L46A 1DTNA 4D04A 3ALLA 2YR6A 2HQMA 2FBWA 4N9XA 2CHRA 3UKHA 1K4QA 1FECA 4ZA0A 1JPDX 1VQWA 1RM6B 3UP4A 3FJ4A 2WOVA 2PS2A 2Q0LA 3OP2A 3LXDA 4IA6A 3FPZA 4IA5A 2PU0A 4C5OA 3LZXA 4A35A 4GF7A 3DEQA 1NPXA 5JRBA 1CBOA 1UKVG 4J56A 3V5CA 3ZVHB 5KNLA 3V76A 1JNRA 2XFNA 2C64A 2QA1A 4MKSA 4B1BA 3PWGA 2O56A 2YG6A 4DHGA 1BF3A 2XVIA 3DH9A 4OVIA 4YWOA 3DGZA 4U8IA 5FS8A 2X99A 4A99A 4A9WA 4Z25A 3TCSA 4A6NB 4A3RA 3GWFA 3TW9A 4A65A 2XGZA 1LJ1A 2WP6A 3CPHG 1YQ4A 3NRZB 3L1RA 2C70A 4OPUA 1ONEA 3CK5A 3CPIG 2X8HA 2NVKX 1DOBA 5KMQA 4CRTA 3QTPA 3LADA 4JN9A 3K7MX 3AMZA 3FCPA 3V4BA 4OPDA 2PGEA 2X50A 3NK0X 3AB1A 1LPFA 5EOWA 4USQA 5HYMA 3NGCX 3LB8A 2QDDA 3QPEA 4FI4A 2R4EA 3H4KA 3QKEA 1QO8A 3F8PA 3I6TA 2OZ3A 3HRDC 3RITA 2V61A 1M64A 3UKAA 1ZX9A 2MUCA 3SGLA 1NEKA 1E6EA 3Q4DA 2JAEA 3TJIA 3P4RA 4RSLA 3AEFA 4EWJA 4AP1A 4J31A 5JCIA 5KMRA 1PJ6A 3T9PA 1JRYA 2AL1A 2A89A 2ZADA 3QN3A 4MGGA 1TDEA 4Y4MA 3TJ4A 3MUCA 1JEHA 3H7VA 2GAHB 3CGBA 1F8RA 4G7FA 2RABA 2VVLA 1DODA 2NPXA 3KPKA 1H81A 4Z2UA 3CGEA 3BI2A 2VRLA 3AXBA 3BNUA 3OW1A 3SZCA 5BOFA 1PBCA 2FJEA 1S7MA 3K30A 3R1ZA 2YG3A 2GGGA 2WESA 2WBAA 3UJRA 1KFYA 4UDQA 5M0ZA 5KMPA 2E3TA 4K22A 3IJQA 3DERA 3E1TA 4OPTA 2GGIA 2FJBA 4LU6A 2PGWA 3AEGA 2B7RA 5FJTA 2QQ6A 1IJHA 1F3PA 2AL2B 1XDIA 3RNMA 2V60A 4AP3A 2BS4A 2QCUA 2WEUA 3T6CA 3CNDA 3AYJA 4DXKA 1V59A 1Q1RA 4U8MA 3NS1B 4J57A 1Q1WA 1XANA 5EB5A 3D1CA 3DK4A 4EQRA 1GTEA 4G74A 3QSSA 1OJAA 2GMHA 1FOHA 2HZGA 3BHFA 3M0OA 2CFYA 7ENLA 5U25A 2OA1A 3T37A 1D7LA 3TWAA 3P1WA 1IUSA 5ENLA 4LIIA 1LQUA 2IIDA 2PTXA 2P8BA 1ECQA 1ZKQA 1KNRA 2EQ6A 3QSMA 3SY4A 2R4JA 1RP0A 4H4VA 1PXAA 4BK2A 4GYPA 1OJTA 1CHUA 4CY8A 3VDGA 4E8GA 1H83A 2VVMA 2C4CA 5C2TA 4EMIA 3R10A 1YY5A 1WUFA 1E1KA 2XH2A 2X8CA 2GEWA 4RG3A 4GUVA 3GC2A 1CJCA 5BRTA 2XFUA 3FYYA 2YG4A 1FHVA 3SJNA 1FL2A 3SM8A 3UJEA 3ABVA 4EM4A 5IDZA 2R0CA 3UKKA 1SJBA 1EC9A 1GOSA 4HA6A 1XPYA 1GXFA 4GYPC 4H4RA 2PP1A 5G5HB 3SSZA 3ZVHA 3LOVA 5HY5A 3GD6A 4H2RA 4ADWA 1JDFA 1CJ4A 1JRZA 1ELIA 1TYTA 3UGVA 1DOEA 1D7YA 4ZCCA 4TLZA 3SZFA 3NTDA 1O95A 2PPGA 2V5ZA 4Z44A 2VOUA 3NT6A 2P3ZA 3QFBA 3DIPA 1N4UA 3Q9TA 3IJIA 1XHCA 2XVJA 4A6NA 2GDQA 4EM3A 3U9IA 3B9JB 3UKQA 3BNMA 2QJJA 1MNSA 3GMCA 1QJDA 3ISHA 3VR8A 3N4EA 3HZLA 1CJ3A 3ZLHA 2E5VA 1KKOA 3COXA 3A7AA 3IWAA 3G5QA 2CVJA 2XH7A 1PHHA 3N4FA 1NDAA 4GIRA 4JDRA 3RGTA 2BACA 1ZOVA 3ICTA 3QSEA 3ZLGA 1TDNA 4KPRA 5J04A 4GDPA 3P4QA 2W54A 2PP0A 3RRAA 3Q6JA 1GEUA 2Z5YA 1HYUA 3UKPA 3JW7A 1KSSA 1Y56B 1W4XA 3GWDA 1ZK7A 4FDCB 3SX6A 2C3DA 3DJJA 2DKIA 4NNJA 1OJDA 1B5QA 1FHUA 1PS9A 3WE0A 4HCLA 3T2YA 2OLNA 2PTZA 1TKKA 4Z2TA 1EBDA 1L9CA 3NVZB 3HW2A 1E7PA 2GB0A 3IJLA 1RYIA 1CJ2A 1GREA 1F8SA 2AKMA 2JKCA 4ROPA 3UTHA 2YLSA 1MXTA 3L5OA 2PODA 4I58A 1SJDA 4H4YA 4BV6A 5BOEA 4HN8A 2WDVA 1P48A 2YQUA 4IVOB 5CQFA 1YQ3A 2WQYA 4Z43A 1PBFA 4K5SA 1T3QC 2QA2A 4H50A 1CC6A 1VDCA 5BVAA 3NIXA 1B4VA 2VRMA 2FKPA 2QVHA 3UXLA 1ZXIC 3RHAA 2AL2A 3QVRA 1B8SA 3LZWA 1PBBA 3CYJA 1R6WA 2ZC8A 3EKGA 1IUTA 3A7RA 4Z26A 4GAVA 2BC0A 1VG0A 4TM4A 1EC7A 3UCCA 4P9SA 4H4SA 3CIRA 3RP8A 1D5TA 3R0UA 4J1OA 1GALA 1N1PA 3AEDA 1P2EA 2XFPA 1F6MA 3IK4A 3BI4A 2BCPA 1SJAA 1TDFA 3NNEA 3FIMB 3VRBA 1WYGA 2OZ8A 2B9YA 3UKLA 3P3BA 5KMSA 1KCZA 2R0GA 3NHOX 3DGHA 3II4A 1PXBA 3AE9A 1E39A 4U2TA 4Y4NA 4TVWA 3S47A 3P4SA 4O5QA 2PA6A 2JK6A 4M0XA 5HXIA 4G73A 1AOGA 4EQSA 2JB3A 1YKJA 4GR1A 2BA9A 1XPQA 1GESA 4U8JA 4Y4LA 3OZ2A 3VC6A 2Q6UA 2OFJA 3V3NA 1COYA 4ICYA 1Y0PA 1BZLA 3ICRA 1KD0A 4JNAA 4H7UA 5JCKA 1LV0A 1RSGA 1EBGA 3MQTA 1GERA 1DXLA 3ATRA 1O94A 3GYIA 2XDOA 2VQBA 3B3RA 4JHMA 4UDPA 4O5UA 1N60C 2OVLA 3REDA 1GRTA 2PP3A 3VRAA 2AR8A 2AKZA 2W0HA 4CBQA 1O5WA 4LA1A 3THUA 3NVVB 5JCLA 3AYIA 6ENLA 3D8XA 4ZCWA 4H4QA 1GV4A 2PYXA 2VZ2A 3UOZA 4YTPA 3HYXA 2C65A 5U1OA 4H4TA 1NENA 5FS7A 2GR2A 3T31A 2EQ9A 1ZMDA 4K5RA 4XXGA 1PDHA 3S5SA 4XWZA 2GL5A 2POZA 4NTCA 1TE6A 1B37A 3T0KA 2WPEA 1GRBA 2OG9A 2W55A 3UCDA 1W6TA 1EC8A 5KRQA 4U8PA 1TZZA 1XS2A 1D4DA 1WUEA 3SZWA 4H4PA 5FMHA 2BS2A 4DYEA 4TLXA 3GRSA 1NG3A 1LQTA 4H2QA 3GDNA 3AE2A 3MY9A 3BSMA 2GGJA 4Z1YA 1P2HA 3UTGA 2RDXA 4JQ9A 2QJNA 1VDVA 1FEBA 3MKCA 3NN6X 2VVLG 2B76A 1S3EA 1ONFA 4GGHA 1H6VA 4JN8A 3CB3A 4AT0A 3H8IA 3PS9A 3DESA 2B9XA 3HYWA 3NRNA 4D03A 2GGHA 3QFAA 3LJPA 4YSHA 1Y56A 4ZCDA 4B65A 2XLPA 1CF3A 4YSYA 3CTYA 2PTWA 3MZNA 3GMBA 2GAGB 3DFYA 3ITJA 4JN7A 1IUVA 4B63A 5KOWA 3NKSA 3SXIA 2PHHA 4KPLA 1GRHA 4YKGA 1KN0A 4DGKA 1PDZA 2GR1A 5ER0A 4YKFA 3U4FA 3R0KA 1F8WA 2BABA 2BRAA 4OPGA 3M13A 4II3A 2XFQA 2F5ZA 3H70A 1IUUA 4Z17A 3PG6A 4IL0A 4PAAA 4CNJA 3AM9A 2QGYA 1PBEA 1CC2A 1GPEA 1GRFA 3AEEA 4X9NA 4KWSA 3GD3A 2GR3A 1NG4A 2FJDA 3P4PA 3QJ4A 3EUB3 3V3WA 4Z2RA 2R0PA 1DJQA 2JB1A 3ZVIA 2V3BA 2BCGG 2X8GA 2GRTA 1TYPA 2WHDA 4WX1A 2ZZBA 3GYJA 3JSKA 1CL0A 3ENLA 4BJZA 3S61A 3C4AA 3NO1A 2UZZA 5FJPA 3EEZA 3D9XA 2WDQA 1M6IA 2GGEA 2YLRA 4K2SA 5FJRA 2WP5A 1VQZA 5TR3A 2XVEA 2P88A 2A8XA 2XFOA 1ZOYA 3RP7A 1GSNA 2GVCA 4GFIA 5DBJA 2GSHA 1K0IA 4K7ZA 1IYXA 3M12A 4X2PA 2HXTA 2Y6QA 4K8DA 3VCNA 3EF6A 2C76A 4AOXA 3NXLA 4IL2A 3DJDA 3NK1X 5KXJA 3TOYA 1X2HA 4YTNA 4OPLA 3UKFA 1H82A 2IVDA 2BC1A 1VRQB 4A5LA 2XVHA 1X2GA 3FVDA 5EBKA 2CDUA 4U8LA 2V3AA 1SEZA 4G6GA 1STZA 2B9WA 2X3NA 2YR5A 1NHPA 3NYEA 2H88A 2EQ7A 2BK4A 3SR6B 2OAMA 2PCEA 4ZOHB 3AE3A 1H84A 5J60A 3T8QA 3T2ZA 1OJ9A 3ZYXA 3T4WA 5FJUA 3NYCA 3UTFA 3VR9A 3VFCA 5BULA 2YG5A 3KA7A 1N4VA 5KWFA 4IT1A 4UDRA 4BK3A 3CAWA 4H83A 3UOYA 3B97A 3H8LA 3CGCA 2Q7VA 2C7GA 1N5WC 4BURA 2XCGA 2XH4A 4H19A 4HCHA 1N62C 2B7SA 2VQ7A 4YTMA 1PXCA 2A87A 3FG2P 3NVYB 1DNCA 1ZY8A 3SYIA 3OPSA 3T2KA 3STPA 3D46A 3OZYA 1BKHA 2R9ZA 3ADAB 5KVIA 3TTEA 2CULA 3EAOA 3AYLA 1MDRA 5C3JA 3KD9A 4DN1A 1KF6A 2PMQA 3EANA 1FEAA 5FJOA 2GH5A 2GV8A 2BXRA 4DX3A 3VA8A 3NH3X 4NTDA 2HNEA 3CGDA 3B6DA 1ZP0A 4GISA 2R46A 4KT2A 4PABA 3PWIA 1F9CA 1L8PA 2OQYA 3GY1A 5IQ1A 3NN0X 5BUKA 3K7TA 2Y6RA 3DJEA 2NQLA 4MMWA 1NHRA 4EMJA 1MOKA 3KVEA 3FBSA 2C72A 1NAAA 5JCNA 1ELSA 3VRDB 4J3ZA 1OEPA 3BI5A 4GMEA 4U8OA 3AECA 4YSXA 2EQ8A 3CMMA 2W3SA 3K7QX 2WPCA 1S2QA 4CCRA 3FXGA 3KKJA 4G6HA 5FS9A 3OC4A 4NEVA 3AE6A 2E4GA 2GR0A 4Z24A 1YQZA 4DWDA 4B67A 2YM2A 1SB3B 4H4ZA 1TDKA 4YT0A 2WPFA 2XH0A 2C66A 3CT2A 3R07C 3SBFA 3BHKA 1R0MA 4CCQA 1JCTA 3VC5A 5FS6A 1N5XA 3SN0A 3HYVA 3AWIA 3CNJA 2C73A 4E4FA 4UP3A 3NYFA 3D47A 2J3NA 4U8KA 3KUMA 4FK1A 3NK2X 3GYXA 1FFVC 1NHSA 4AT2A 4HYRA 1MDLA 3UCLA 4HPNA 1IUXA 4CNKA 1PBDA 4HNLA 3BOXA 4IP4A 1ZMCA 3DFHA 2TMDA 3L8KA 5JCMA 2BS3A 4TVYA 2ZZCA 4EQWA 4KX6A 1BWCA 4REKA 2ACZA 2YVGA 4TM1A 1N61C 4KEMA 1D4EA 4J33A 2XVFA 2YM1A 3NVWB 4ZN0A 2WDRA 3AE8A 4I59A 1GETA 3AE5A 1Z6LA 4FK1C 4DSGA 3QVPA 4BJYA 5CKUA 2FYMA 2RGOA 3ATQA 1FO4A 2O9ZA 4IV9A 5U63A 1REOA 1K0JA 3H8AA 2BK3A 2WETA 3I4KA 1JU2A 1FCDA 4BK1A 4C3YA 4E5TA 2RGHA 4DNAA 4JNQA 3RP6A 1V97A 3AEAA 1FFUC 2TPRA 3NFUA 3P9UA 3UXKA 3N6JA 2OLOA 2DW6A 5KOXA 3AE4A 2RGJA 1PJ5A 3DK9A 5IPYA 1GRGA 2OX4A 4GAPA 3DGBA 4K1WA 2PTYA 4XWRA 4YSZA 1E1LA 1BQGA 1S3BA 1BKWA 3T14A 1GNDA 1DJNA 3UOXA 1TDOA 4GDEA 2JBVA 3I6EA 2ARDA 3CPJG 3SQSA 3A7UA 3AE7A 2YLTA 1MO9A 3IF9A 1QLBA 2WU5A 2WOWA 2C3CA 2H89A 1JNZA 4IHCA 1E1MA 3CNPA 2OO6A 4A7AA 2OLAA 3I3LA 3ALMA 4H4XA 3OZMA 3AD9B 3DG7A 4C77A 2YLZA 3KU9A 2YR4A 4G8TA 4FX9A 1SJCA 4GGBA 4WCTA 2YWLA 1DOCA 4NTEA 4OPIA 4AOSA 4B69A 4IZGA 1MRAA 2DW7A 1PN0A 2BRYA 2WOIA 4JY3A 2OKTA 4NZHA 3SFEA 2R45A 1D4CA 1BGNA 3UTEA 4IVMB 3UJSA 4J36A 4K8GA 4HCDA 2C67A 3DG6A 2Q0KA 1KKRA 1YEYA 3NTAA 4C3XA 3PK7A 3G5RA 3S5WA 3GDPA 2AQJA 3MWCA 2XYOA 3DJGX 3UJ2A 2OQHA 1EBHA 4CY6A 3GO2A 5M10A 1JOAA 2APGA 4J34A 3SZ0A 1E1NA 4OCGA 4H2HA 4IP5A 1VG9A 1GRAA 4GRTA 2ZBWA 1KNPA 2E5AA 4B64A 3V3OA 1NHQA 2MNRA 4II2A 3IHMA 3ALJA 4TM3A 2BK5A 2WP9A 3C4NA 3P93A 4ENLA 3P0WA 3RR1A 3BJSA 2V6OA 5HHFA 5EU9A 2XLRA 2HXUA 2W3RA 3ZLFA 3URHA 3PO7A 1LVLA 2XLSA 3DDMA 3JVAA 2BYBA 2C75A 2GF3A 4E0VA 3KLJA 3TWBA 1FIQB 4RG4A 3IHGA 2ONEA 1NU5A 3N6HA 1EL8A 3CNTA 2YLXA 4H4WA 4U2SA 3HPFA 1RVKA 2OALA 3GRTA 4EIQA 3ZDNA 1MUCA 5G5GB 1N4WA 1K0LA 3MSYA 2I5QA 3UJFA 3I6DA 2GQFA 4X4JA 1TRBA 1KDGA 3ICSA 4H4UA 3FMWA 3DMEA 1H2IA 2XSXA 1EL7A 4C74A 3VCCA 4K2XA 1GTHA 4FP1A 3FV9A 3AD8B 3CN8A 3DA1A 3TQPA 1KSUA 2GMJA 4B66A 4H1ZA 4E6MA 4EMWA 3NLCA 1JROA 1LTXR 3SFDA 4JY2A 3UP5A 1EL9A 1H7XA 4EIPA 3H12A 2XLTA 4X9MA 4MJWA 1EL5A 3JZUA 3R11A 3G5SA 4J2WA 3SN4A 2OZTA 3SN1A 3Q45A 1ZDLA 2WU2A 3GSIA 1H86A 1L0VA 3RO6A 3NG7X 2ZZ0A 4A79A 2E1MA 4G9KA 1JRXA 2QJMA 4U8NA 2IVEA 3SQPA 4TM0A 2PSNA 2YLWA 4APNA 3GD4A 3KPFA 3PVCA 3AEBA 1P43A 1JRPA 4NEWA 4B68A 3R9UA 3UOVA 2YG7A 2QDEA 4USRA 2YVFA 4U2LA 1OJCA 2XLUA 2DKHA 1PJ7A 2Z5XA 4A6GA 1H7WA 5J7XA 3R25A 1GT8A 4NWZA 4H2NA 5KVHA 3ES7A 2YVJA 5GRTA 1IUWA 3AN1A 4YWSA 2BXSA 3AE1A 3DG3A 3DK8A 1E9IA 4ECHA 1CC4A 2OPJA 1N63C 2PU1A 1L9DA 3ETRB 1BGJA 2QAEA 3O0HA 2AAQA 2FJAA 2JB2A 4EQXA 4H2PA 1X31B 1NELA 1Q9IA 4HB9A 3IC9A 3QLDA 3OTRA 1L9EA 3V5FA 3ES8A 4DSHA 4M52A 3CNSA
chains in the Genus database with same CATH topology
2RGHA 4DNAA 4JNQA 1N4UA 3Q9TA 5LV9A 1PBEA 1CC2A 1GPEA 1GRFA 3AEEA 4X9NA 3RP6A 1XHCA 2XVJA 3AEAA 2TPRA 1S2YA 3GD3A 4A6NA 3P9UA 4YXDA 3EPTA 4GCMA 4EM3A 2OLOA 3C96A 2GR3A 3F8DA 1NG4A 2YAUA 2FJDA 3UKQA 5KOXA 3P4PA 3BNMA 3AE4A 2RGJA 3AD7B 3QJ4A 1PJ5A 3DK9A 5IPYA 2GQWA 1GRGA 3GMCA 4OPCA 3F8RA 1QJDA 3ISHA 4GAPA 3VR8A 3HZLA 4Z2RA 1CJ3A 2R0PA 4XWRA 1E1LA 1S3BA 4YSZA 5EB4A 1DJQA 2E5VA 2JB1A 3COXA 2V3BA 1BKWA 2BCGG 5IQ4A 3IWAA 3G5QA 2CVJA 2I0ZA 2X8GA 3VQRA 3T14A 2GRTA 1GNDA 1PHHA 2WS3A 1TYPA 1DJNA 5GSNA 2WHDA 4WX1A 2ZZBA 1NDAA 3UOXA 4JDRA 3GYJA 2BACA 3JSKA 5L46A 4D04A 1ZOVA 1CL0A 1TDOA 3ICTA 3QSEA 4GDEA 4BJZA 3S61A 1TDNA 2JBVA 2ARDA 3C4AA 3CPJG 4KPRA 3ALLA 4GDPA 2UZZA 3P4QA 2YR6A 3AE7A 2HQMA 2YLTA 1MO9A 3IF9A 2FBWA 4N9XA 1QLBA 2WU5A 3UKHA 1K4QA 3D9XA 1FECA 2WDQA 1M6IA 3Q6JA 1GEUA 2WOWA 2Z5YA 1HYUA 1VQWA 3UKPA 2YLRA 2C3CA 1KSSA 1Y56B 3UP4A 1W4XA 2WOVA 2WP5A 2H89A 3GWDA 2Q0LA 1ZK7A 4FDCB 3SX6A 1JNZA 3LXDA 2C3DA 3DJJA 5TR3A 1E1MA 2DKIA 4IA6A 3FPZA 2XVEA 3CNPA 1OJDA 4NNJA 1B5QA 1PS9A 4IA5A 3WE0A 2A8XA 4C5OA 3T2YA 4A7AA 3LZXA 3I3LA 2OLNA 2XFOA 3ALMA 4GF7A 4Z2TA 1EBDA 1NPXA 4H4XA 1L9CA 1ZOYA 3RP7A 1GSNA 2GVCA 3AD9B 1E7PA 5JRBA 1CBOA 1UKVG 4C77A 5DBJA 2GB0A 4J56A 2YLZA 3KU9A 1K0IA 4K7ZA 1RYIA 1CJ2A 2YR4A 3M12A 2Y6QA 1GREA 1F8SA 4FX9A 4K8DA 4WCTA 3EF6A 5KNLA 2JKCA 3V76A 2C76A 4AOXA 3UTHA 2YLSA 1JNRA 1MXTA 3L5OA 1DOCA 2XFNA 2YWLA 3DJDA 4I58A 4NTEA 4OPIA 4AOSA 4B69A 4H4YA 4BV6A 2C64A 2QA1A 4B1BA 1PN0A 2BRYA 2WDVA 2WOIA 4JY3A 3NK1X 4NZHA 5KXJA 3SFEA 4IVOB 2YQUA 2YG6A 5CQFA 1YQ3A 2WQYA 4Z43A 1BF3A 4YTNA 1PBFA 4OPLA 2XVIA 3DH9A 4K5SA 4OVIA 1H82A 3UKFA 2R45A 2IVDA 4CNJA 1D4CA 4YWOA 1BGNA 2BC1A 2QA2A 3DGZA 4H50A 1CC6A 1VRQB 1VDCA 3UTEA 4A5LA 2XVHA 4U8IA 4IVMB 5BVAA 3NIXA 5FS8A 2X99A 4A99A 4A9WA 4Z25A 5M10A 1B4VA 4J36A 5EBKA 2CDUA 4A6NB 2VRMA 2V3AA 2C67A 1SEZA 4U8LA 4G6GA 3GWFA 2Q0KA 2B9WA 2X3NA 2YR5A 3RHAA 4A65A 1NHPA 1LJ1A 2WP6A 3CPHG 1YQ4A 1B8SA 3NTAA 3QVRA 4C3XA 3LZWA 1PBBA 3NYEA 3G5RA 3L1RA 2C70A 3S5WA 3GDPA 2AQJA 2H88A 4OPUA 2EQ7A 2BK4A 2XYOA 1IUTA 3CPIG 2X8HA 2NVKX 1DOBA 2OAMA 3AE3A 4Z26A 5KMQA 4CRTA 3DJGX 3LADA 4GAVA 4JN9A 3K7MX 1H84A 5J60A 3T2ZA 2BC0A 1VG0A 1OJ9A 3ZYXA 4TM4A 4P9SA 4CY6A 4OPDA 4H4SA 3CIRA 3RP8A 3NYCA 3UTFA 3VR9A 1JOAA 2APGA 1D5TA 4J34A 3SZ0A 2X50A 1E1NA 1GALA 1N1PA 3AEDA 4OCGA 5BULA 1P2EA 2YG5A 3NK0X 2XFPA 3KA7A 1F6MA 3AB1A 3BI4A 2BCPA 1LPFA 5EOWA 1VG9A 4USQA 5HYMA 1TDFA 1N4VA 3NGCX 3LB8A 1GRAA 5KWFA 3NNEA 3FIMB 4GRTA 2R4EA 2ZBWA 4UDRA 3VRBA 1KNPA 3H4KA 2B9YA 4BK3A 3UKLA 5KMSA 3UOYA 1QO8A 3CGCA 2R0GA 3DGHA 2Q7VA 3II4A 3F8PA 3H8LA 1PXBA 2C7GA 3AE9A 3NHOX 1E39A 2V61A 4U2TA 4B64A 4BURA 4Y4NA 1NHQA 1M64A 3V3OA 2XCGA 3UKAA 3P4SA 4II2A 1ZX9A 4O5QA 3SGLA 2JK6A 1NEKA 3IHMA 2B7SA 3ALJA 4TM3A 2BK5A 1E6EA 4G73A 1AOGA 5HXIA 2WP9A 3C4NA 2JAEA 4EQSA 2VQ7A 2JB3A 1YKJA 4GR1A 4YTMA 3P4RA 1PXCA 2BA9A 3AEFA 1XPQA 4RSLA 4AP1A 4J31A 5JCIA 2A87A 5KMRA 1PJ6A 1GESA 1JRYA 3FG2P 4U8JA 4Y4LA 2A89A 2V6OA 5HHFA 3OZ2A 1DNCA 1ZY8A 1TDEA 2XLRA 3SYIA 3T2KA 2Q6UA 4Y4MA 3URHA 3PO7A 1LVLA 2XLSA 2R9ZA 3V3NA 1COYA 4ICYA 1JEHA 2BYBA 2C75A 3ADAB 5KVIA 2GF3A 2CULA 4E0VA 1Y0PA 2GAHB 1BZLA 3EAOA 3AYLA 3ICRA 5C3JA 3KLJA 3CGBA 4JNAA 3KD9A 5JCKA 1KF6A 4H7UA 4RG4A 3IHGA 1F8RA 1LV0A 3EANA 1FEAA 1RSGA 2RABA 1GERA 2GH5A 1DXLA 1DODA 2NPXA 1EL8A 2BXRA 2GV8A 2VVLA 3ATRA 2YLXA 3CNTA 3KPKA 4H4WA 1H81A 1O94A 2XDOA 3GYIA 4U2SA 3NH3X 2OALA 3CGDA 3B6DA 2VQBA 3GRTA 1ZP0A 4NTDA 4Z2UA 3CGEA 4EIQA 3BI2A 3ZDNA 2VRLA 3B3RA 1N4WA 2R46A 3AXBA 3BNUA 1K0LA 4UDPA 4PABA 3SZCA 2FJEA 1PBCA 1S7MA 3I6DA 4O5UA 3K30A 3REDA 2GQFA 4X4JA 1GRTA 3VRAA 5IQ1A 2AR8A 2YG3A 3NN0X 1TRBA 2WESA 1KDGA 2W0HA 2WBAA 4CBQA 5BUKA 3K7TA 2Y6RA 1O5WA 3ICSA 3DJEA 4H4UA 1KFYA 4LA1A 3FMWA 3DMEA 4UDQA 5M0ZA 5JCLA 1H2IA 3AYIA 5KMPA 1EL7A 3D8XA 4C74A 4K22A 4K2XA 1GTHA 4H4QA 3E1TA 1NHRA 4OPTA 1GV4A 2PYXA 2VZ2A 3AD8B 3CN8A 3DA1A 3UOZA 2FJBA 4LU6A 1KSUA 4EMJA 2GMJA 1MOKA 4B66A 3AEGA 2B7RA 3KVEA 3FBSA 4YTPA 4EMWA 3NLCA 1LTXR 1IJHA 2C72A 3SFDA 3HYXA 4JY2A 1F3PA 3UP5A 1XDIA 3RNMA 5JCNA 1NAAA 2C65A 2V60A 4AP3A 1EL9A 2BS4A 2QCUA 3VRDB 5U1OA 1H7XA 2WEUA 3CNDA 4H4TA 1NENA 5FS7A 2GR2A 3BI5A 3T31A 2EQ9A 4U8OA 3AYJA 4EIPA 1V59A 1Q1RA 3AECA 1ZMDA 4YSXA 4K5RA 4U8MA 4J57A 2EQ8A 4XXGA 1PDHA 1Q1WA 3CMMA 3K7QX 2WPCA 1XANA 4XWZA 2XLTA 5EB5A 4X9MA 1S2QA 4NTCA 4MJWA 4CCRA 1EL5A 1B37A 3D1CA 3T0KA 2WPEA 1GRBA 3DK4A 4EQRA 3G5SA 3KKJA 4G6HA 1GTEA 5FS9A 3OC4A 4G74A 4J2WA 4NEVA 3AE6A 2E4GA 2GR0A 4Z24A 1YQZA 4B67A 2YM2A 3QSSA 1OJAA 2GMHA 4H4ZA 1FOHA 1TDKA 3BHFA 4YT0A 5KRQA 4U8PA 2WPFA 1ZDLA 3M0OA 2CFYA 2C66A 5U25A 2WU2A 1D4DA 2OA1A 3SZWA 3T37A 4H4PA 5FMHA 2BS2A 3GSIA 1D7LA 1H86A 4TLXA 3GRSA 1L0VA 3BHKA 3P1WA 1NG3A 1LQTA 1IUSA 3NG7X 4CCQA 2ZZ0A 4H2QA 2E1MA 4A79A 3GDNA 4G9KA 5FS6A 1JRXA 4LIIA 3AE2A 1LQUA 4U8NA 2IVEA 3HYVA 3AWIA 3SQPA 3CNJA 2IIDA 4TM0A 2YLWA 2C73A 1P2HA 4APNA 3GD4A 3UTGA 4UP3A 3KPFA 3PVCA 1ZKQA 3NYFA 1KNRA 4JQ9A 3AEBA 2J3NA 2EQ6A 4U8KA 3QSMA 1FEBA 4NEWA 4FK1A 3SY4A 3NK2X 4B68A 2R4JA 3R9UA 3NN6X 2VVLG 3GYXA 3UOVA 1RP0A 4H4VA 2B76A 1PXAA 4BK2A 1NHSA 1OJTA 1S3EA 2YG7A 4AT2A 1ONFA 1CHUA 1H6VA 4CY8A 4USRA 4AT0A 1H83A 2VVMA 2YVFA 3H8IA 2C4CA 4U2LA 1IUXA 3UCLA 4CNKA 1PBDA 5C2TA 4EMIA 1OJCA 3PS9A 2XLUA 1ZMCA 2B9XA 2TMDA 2DKHA 3L8KA 3HYWA 3NRNA 1YY5A 4D03A 1E1KA 5JCMA 3QFAA 2BS3A 1PJ7A 3LJPA 2Z5XA 4YSHA 1H7WA 2X8CA 5J7XA 1Y56A 2GEWA 2ZZCA 4RG3A 4EQWA 4ZCDA 4KX6A 1BWCA 4GUVA 1CJCA 4REKA 5BRTA 2ACZA 2XFUA 1GT8A 2YVGA 1D4EA 1CF3A 2XLPA 4TM1A 4B65A 4NWZA 4J33A 2XVFA 2YM1A 4YSYA 2YG4A 3CTYA 4H2NA 5KVHA 4ZN0A 2YVJA 3GMBA 5GRTA 2WDRA 1FL2A 2GAGB 1IUWA 2BXSA 3SM8A 3AE1A 3AE8A 4EM4A 3ABVA 4I59A 3DK8A 3ITJA 1IUVA 4B63A 1GETA 5KOWA 2R0CA 3NKSA 3AE5A 3SXIA 3UKKA 4ECHA 1Z6LA 4FK1C 2PHHA 4DSGA 1CC4A 3QVPA 1GRHA 4BJYA 5CKUA 1GOSA 4YKGA 4HA6A 1KN0A 4DGKA 2GR1A 1GXFA 5ER0A 4H4RA 1L9DA 4YKFA 2RGOA 3ATQA 1BGJA 1F8WA 3LOVA 2QAEA 5HY5A 3O0HA 2BABA 2BRAA 4H2RA 4ADWA 4OPGA 3M13A 2AAQA 2FJAA 2JB2A 1CJ4A 4II3A 1JRZA 1ELIA 2O9ZA 1TYTA 4IV9A 4EQXA 4H2PA 1X31B 1Q9IA 2XFQA 4HB9A 1DOEA 5U63A 3IC9A 1REOA 1D7YA 4ZCCA 1L9EA 2F5ZA 4TLZA 3SZFA 1K0JA 2BK3A 3NTDA 1O95A 1IUUA 2V5ZA 2WETA 4Z44A 2VOUA 4DSHA 3NT6A 1JU2A 1FCDA 3PG6A 4PAAA 3QFBA 4M52A 4BK1A 3CNSA 4C3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RGH A;  4DNA A;  4JNQ A;  1N4U A;  3Q9T A;  5LV9 A;  1PBE A;  1CC2 A;  1GPE A;  1GRF A;  3AEE A;  4X9N A;  3RP6 A;  1XHC A;  2XVJ A;  3AEA A;  2TPR A;  1S2Y A;  3GD3 A;  4A6N A;  3P9U A;  4YXD A;  3EPT A;  4GCM A;  4EM3 A;  2OLO A;  3C96 A;  2GR3 A;  3F8D A;  1NG4 A;  2YAU A;  2FJD A;  3UKQ A;  5KOX A;  3P4P A;  3BNM A;  3AE4 A;  2RGJ A;  3AD7 B;  3QJ4 A;  1PJ5 A;  3DK9 A;  5IPY A;  2GQW A;  1GRG A;  3GMC A;  4OPC A;  3F8R A;  1QJD A;  3ISH A;  3VR8 A;  3HZL A;  4Z2R A;  1CJ3 A;  2R0P A;  4XWR A;  1E1L A;  1S3B A;  4YSZ A;  5EB4 A;  1DJQ A;  2E5V A;  2JB1 A;  3COX A;  1BKW A;  2V3B A;  2BCG G;  5IQ4 A;  3IWA A;  3G5Q A;  2CVJ A;  2I0Z A;  2X8G A;  3VQR A;  2GRT A;  1GND A;  1PHH A;  2WS3 A;  1TYP A;  1DJN A;  5GSN A;  2WHD A;  4WX1 A;  2ZZB A;  1NDA A;  3UOX A;  4JDR A;  3GYJ A;  2BAC A;  3JSK A;  5L46 A;  4D04 A;  1ZOV A;  1CL0 A;  1TDO A;  3ICT A;  3QSE A;  4GDE A;  4BJZ A;  3S61 A;  1TDN A;  2JBV A;  2ARD A;  3C4A A;  3CPJ G;  4KPR A;  3ALL A;  4GDP A;  2UZZ A;  3P4Q A;  2YR6 A;  3AE7 A;  2HQM A;  2YLT A;  1MO9 A;  3IF9 A;  2FBW A;  4N9X A;  1QLB A;  2WU5 A;  3UKH A;  1K4Q A;  1FEC A;  2WDQ A;  1M6I A;  3Q6J A;  1GEU A;  2WOW A;  2Z5Y A;  1HYU A;  1VQW A;  3UKP A;  2YLR A;  2C3C A;  1KSS A;  1Y56 B;  3UP4 A;  1W4X A;  2WOV A;  2WP5 A;  2H89 A;  3GWD A;  2Q0L A;  1ZK7 A;  4FDC B;  1JNZ A;  3LXD A;  2C3D A;  3DJJ A;  5TR3 A;  1E1M A;  2DKI A;  4IA6 A;  3FPZ A;  2XVE A;  3CNP A;  1OJD A;  1B5Q A;  1PS9 A;  4IA5 A;  3WE0 A;  2A8X A;  4C5O A;  4A7A A;  3LZX A;  3I3L A;  2OLN A;  2XFO A;  3ALM A;  4GF7 A;  4Z2T A;  1EBD A;  1NPX A;  4H4X A;  1L9C A;  1ZOY A;  3RP7 A;  1GSN A;  2GVC A;  3AD9 B;  1E7P A;  1CBO A;  1UKV G;  4C77 A;  5DBJ A;  2GB0 A;  4J56 A;  2YLZ A;  3KU9 A;  1K0I A;  4K7Z A;  1RYI A;  1CJ2 A;  2YR4 A;  3M12 A;  2Y6Q A;  1GRE A;  1F8S A;  4FX9 A;  4K8D A;  4WCT A;  3EF6 A;  2JKC A;  3V76 A;  2C76 A;  4AOX A;  3UTH A;  2YLS A;  1JNR A;  1MXT A;  1DOC A;  2XFN A;  2YWL A;  4NTE A;  3DJD A;  4I58 A;  4OPI A;  4AOS A;  4B69 A;  4H4Y A;  4BV6 A;  2C64 A;  2QA1 A;  4B1B A;  1PN0 A;  2WDV A;  2WOI A;  4JY3 A;  3NK1 X;  4NZH A;  5KXJ A;  3SFE A;  4IVO B;  2YQU A;  2YG6 A;  5CQF A;  1YQ3 A;  2WQY A;  4Z43 A;  1BF3 A;  4YTN A;  1PBF A;  4OPL A;  2XVI A;  3DH9 A;  4K5S A;  4OVI A;  1H82 A;  3UKF A;  2R45 A;  2IVD A;  4CNJ A;  1D4C A;  4YWO A;  1BGN A;  2BC1 A;  2QA2 A;  3DGZ A;  4H50 A;  1CC6 A;  1VRQ B;  1VDC A;  3UTE A;  4A5L A;  2XVH A;  4U8I A;  4IVM B;  5BVA A;  3NIX A;  5FS8 A;  2X99 A;  4A99 A;  4A9W A;  4Z25 A;  5M10 A;  1B4V A;  4J36 A;  5EBK A;  2CDU A;  4A6N B;  2VRM A;  2V3A A;  2C67 A;  1SEZ A;  4U8L A;  3GWF A;  2Q0K A;  2B9W A;  2X3N A;  2YR5 A;  3RHA A;  4A65 A;  1NHP A;  1LJ1 A;  2WP6 A;  3CPH G;  1YQ4 A;  1B8S A;  3NTA A;  3QVR A;  4C3X A;  3LZW A;  1PBB A;  3NYE A;  3G5R A;  3L1R A;  2C70 A;  3S5W A;  3GDP A;  2AQJ A;  2H88 A;  4OPU A;  2EQ7 A;  2BK4 A;  2XYO A;  1IUT A;  3CPI G;  2X8H A;  2NVK X;  1DOB A;  2OAM A;  3AE3 A;  4Z26 A;  4CRT A;  3DJG X;  3LAD A;  4JN9 A;  3K7M X;  1H84 A;  5J60 A;  2BC0 A;  1VG0 A;  1OJ9 A;  3ZYX A;  4TM4 A;  4P9S A;  4CY6 A;  4OPD A;  4H4S A;  3CIR A;  3RP8 A;  3NYC A;  3UTF A;  3VR9 A;  1JOA A;  2APG A;  1D5T A;  4J34 A;  2X50 A;  1E1N A;  1GAL A;  1N1P A;  3AED A;  4OCG A;  5BUL A;  1P2E A;  2YG5 A;  3NK0 X;  2XFP A;  3KA7 A;  1F6M A;  3AB1 A;  3BI4 A;  2BCP A;  1LPF A;  5EOW A;  1VG9 A;  4USQ A;  5HYM A;  1TDF A;  1N4V A;  3NGC X;  3LB8 A;  1GRA A;  5KWF A;  3NNE A;  3FIM B;  4GRT A;  2R4E A;  2ZBW A;  4UDR A;  3VRB A;  1KNP A;  3H4K A;  2B9Y A;  4BK3 A;  3UKL A;  3UOY A;  1QO8 A;  3CGC A;  2R0G A;  3DGH A;  2Q7V A;  3II4 A;  3F8P A;  3H8L A;  1PXB A;  2C7G A;  3AE9 A;  3NHO X;  1E39 A;  2V61 A;  4U2T A;  4B64 A;  4BUR A;  4Y4N A;  1NHQ A;  1M64 A;  3V3O A;  2XCG A;  3UKA A;  3P4S A;  4O5Q A;  1ZX9 A;  3SGL A;  2JK6 A;  1NEK A;  3IHM A;  2B7S A;  3ALJ A;  4TM3 A;  2BK5 A;  1E6E A;  5HXI A;  1AOG A;  2WP9 A;  3C4N A;  2JAE A;  4EQS A;  2VQ7 A;  2JB3 A;  1YKJ A;  4GR1 A;  4YTM A;  3P4R A;  1PXC A;  2BA9 A;  3AEF A;  1XPQ A;  4RSL A;  4AP1 A;  4J31 A;  5JCI A;  2A87 A;  1PJ6 A;  1GES A;  1JRY A;  3FG2 P;  4U8J A;  4Y4L A;  2A89 A;  2V6O A;  5HHF A;  3OZ2 A;  1DNC A;  1ZY8 A;  1TDE A;  2XLR A;  2Q6U A;  4Y4M A;  3URH A;  3PO7 A;  1LVL A;  2XLS A;  2R9Z A;  3V3N A;  1COY A;  4ICY A;  1JEH A;  2BYB A;  2C75 A;  3ADA B;  5KVI A;  2GF3 A;  2CUL A;  4E0V A;  1Y0P A;  2GAH B;  1BZL A;  3EAO A;  3AYL A;  3ICR A;  5C3J A;  3KLJ A;  3CGB A;  4JNA A;  3KD9 A;  5JCK A;  1KF6 A;  4H7U A;  4RG4 A;  3IHG A;  1F8R A;  1LV0 A;  3EAN A;  1FEA A;  1RSG A;  2RAB A;  1GER A;  2GH5 A;  1DXL A;  1DOD A;  2NPX A;  1EL8 A;  2BXR A;  2GV8 A;  2VVL A;  3ATR A;  2YLX A;  3CNT A;  4H4W A;  1H81 A;  1O94 A;  2XDO A;  3GYI A;  4U2S A;  3NH3 X;  2OAL A;  3CGD A;  3B6D A;  2VQB A;  3GRT A;  1ZP0 A;  4NTD A;  4Z2U A;  3CGE A;  4EIQ A;  3BI2 A;  3ZDN A;  2VRL A;  3B3R A;  1N4W A;  2R46 A;  3AXB A;  3BNU A;  1K0L A;  4UDP A;  4PAB A;  2FJE A;  1PBC A;  3I6D A;  4O5U A;  3K30 A;  3RED A;  2GQF A;  4X4J A;  1GRT A;  3VRA A;  5IQ1 A;  2AR8 A;  2YG3 A;  3NN0 X;  1TRB A;  2WES A;  1KDG A;  2W0H A;  2WBA A;  4CBQ A;  5BUK A;  3K7T A;  2Y6R A;  1O5W A;  3ICS A;  3DJE A;  4H4U A;  1KFY A;  4LA1 A;  3FMW A;  3DME A;  4UDQ A;  5M0Z A;  5JCL A;  3AYI A;  1EL7 A;  3D8X A;  4C74 A;  4K22 A;  4K2X A;  1GTH A;  4H4Q A;  3E1T A;  1NHR A;  4OPT A;  1GV4 A;  2PYX A;  2VZ2 A;  3AD8 B;  3CN8 A;  3DA1 A;  3UOZ A;  2FJB A;  4LU6 A;  1KSU A;  4EMJ A;  2GMJ A;  1MOK A;  4B66 A;  3AEG A;  2B7R A;  3KVE A;  3FBS A;  4YTP A;  4EMW A;  3NLC A;  1LTX R;  1IJH A;  2C72 A;  3SFD A;  4JY2 A;  1F3P A;  3UP5 A;  1XDI A;  3RNM A;  5JCN A;  1NAA A;  2C65 A;  2V60 A;  4AP3 A;  1EL9 A;  2BS4 A;  2QCU A;  3VRD B;  5U1O A;  1H7X A;  2WEU A;  3CND A;  4H4T A;  1NEN A;  5FS7 A;  2GR2 A;  3BI5 A;  2EQ9 A;  4U8O A;  3AYJ A;  4EIP A;  1V59 A;  1Q1R A;  3AEC A;  1ZMD A;  4YSX A;  4K5R A;  4U8M A;  4J57 A;  2EQ8 A;  4XXG A;  1PDH A;  1Q1W A;  3K7Q X;  2WPC A;  1XAN A;  4XWZ A;  2XLT A;  5EB5 A;  4X9M A;  1S2Q A;  4NTC A;  4MJW A;  4CCR A;  1EL5 A;  1B37 A;  3D1C A;  2WPE A;  1GRB A;  3DK4 A;  4EQR A;  3G5S A;  3KKJ A;  1GTE A;  5FS9 A;  3OC4 A;  4J2W A;  4NEV A;  3AE6 A;  2E4G A;  2GR0 A;  4Z24 A;  1YQZ A;  4B67 A;  2YM2 A;  3QSS A;  1OJA A;  2GMH A;  4H4Z A;  1FOH A;  1TDK A;  3BHF A;  4YT0 A;  5KRQ A;  4U8P A;  2WPF A;  1ZDL A;  3M0O A;  2CFY A;  2C66 A;  5U25 A;  2WU2 A;  1D4D A;  2OA1 A;  3T37 A;  4H4P A;  5FMH A;  2BS2 A;  3GSI A;  1D7L A;  1H86 A;  4TLX A;  3GRS A;  1L0V A;  3BHK A;  3P1W A;  1NG3 A;  1LQT A;  1IUS A;  3NG7 X;  4CCQ A;  2ZZ0 A;  4H2Q A;  2E1M A;  4A79 A;  3GDN A;  5FS6 A;  1JRX A;  4LII A;  3AE2 A;  1LQU A;  4U8N A;  2IVE A;  3AWI A;  3SQP A;  3CNJ A;  2IID A;  4TM0 A;  2YLW A;  2C73 A;  1P2H A;  4APN A;  3GD4 A;  3UTG A;  4UP3 A;  3KPF A;  3PVC A;  1ZKQ A;  3NYF A;  1KNR A;  4JQ9 A;  3AEB A;  2J3N A;  2EQ6 A;  4U8K A;  3QSM A;  1FEB A;  4NEW A;  4FK1 A;  3NK2 X;  4B68 A;  2R4J A;  3R9U A;  3NN6 X;  2VVL G;  3UOV A;  1RP0 A;  4H4V A;  2B76 A;  1PXA A;  4BK2 A;  1NHS A;  1OJT A;  1S3E A;  2YG7 A;  4AT2 A;  1ONF A;  1CHU A;  1H6V A;  4CY8 A;  4USR A;  4AT0 A;  1H83 A;  2VVM A;  2YVF A;  3H8I A;  4U2L A;  3UCL A;  1IUX A;  4CNK A;  5C2T A;  1PBD A;  4EMI A;  1OJC A;  3PS9 A;  2XLU A;  1ZMC A;  2B9X A;  2TMD A;  2DKH A;  3L8K A;  3NRN A;  1YY5 A;  4D03 A;  1E1K A;  5JCM A;  3QFA A;  2BS3 A;  1PJ7 A;  3LJP A;  2Z5X A;  4YSH A;  1H7W A;  2X8C A;  5J7X A;  1Y56 A;  2GEW A;  2ZZC A;  4RG3 A;  4EQW A;  4ZCD A;  4KX6 A;  1BWC A;  4GUV A;  1CJC A;  4REK A;  5BRT A;  2ACZ A;  2XFU A;  1GT8 A;  2YVG A;  1D4E A;  1CF3 A;  2XLP A;  4TM1 A;  4B65 A;  4J33 A;  2XVF A;  2YM1 A;  4YSY A;  2YG4 A;  3CTY A;  4H2N A;  5KVH A;  4ZN0 A;  2YVJ A;  3GMB A;  5GRT A;  2WDR A;  1FL2 A;  2GAG B;  1IUW A;  2BXS A;  3SM8 A;  3AE1 A;  3AE8 A;  4EM4 A;  3ABV A;  4I59 A;  3DK8 A;  3ITJ A;  1IUV A;  4B63 A;  1GET A;  5KOW A;  2R0C A;  3NKS A;  3AE5 A;  3UKK A;  4ECH A;  1Z6L A;  4FK1 C;  2PHH A;  4DSG A;  1CC4 A;  3QVP A;  1GRH A;  4BJY A;  5CKU A;  1GOS A;  4YKG A;  4HA6 A;  4DGK A;  2GR1 A;  1GXF A;  5ER0 A;  4H4R A;  1L9D A;  4YKF A;  2RGO A;  3ATQ A;  1BGJ A;  1F8W A;  3LOV A;  2QAE A;  5HY5 A;  3O0H A;  2BAB A;  4H2R A;  4ADW A;  4OPG A;  3M13 A;  2AAQ A;  2FJA A;  2JB2 A;  1CJ4 A;  1JRZ A;  1ELI A;  2O9Z A;  1TYT A;  4IV9 A;  4EQX A;  4H2P A;  1X31 B;  1Q9I A;  2XFQ A;  4HB9 A;  1DOE A;  5U63 A;  3IC9 A;  1REO A;  1D7Y A;  4ZCC A;  1L9E A;  2F5Z A;  4TLZ A;  1K0J A;  2BK3 A;  3NTD A;  1O95 A;  1IUU A;  2V5Z A;  2WET A;  4Z44 A;  2VOU A;  4DSH A;  3NT6 A;  1JU2 A;  1FCD A;  4PAA A;  3QFB A;  4M52 A;  4BK1 A;  3CNS A;  4C3Y A; 
#chains in the Genus database with same CATH topology
 2P0I A;  5LV9 A;  2P8C A;  3NZG A;  1S2Y A;  4YXD A;  3EPT A;  4GCM A;  3PFR A;  4F4R A;  3C96 A;  3CXB A;  3F8D A;  2YAU A;  4HNC A;  3AD7 B;  2GQW A;  4E4U A;  3F8R A;  4OPC A;  5EB4 A;  4M6U A;  3CXO A;  3RCY A;  5IQ4 A;  2I0Z A;  3VQR A;  3K1G A;  2WS3 A;  1JPM A;  5GSN A;  1PDY A;  5L46 A;  1DTN A;  4D04 A;  3ALL A;  2YR6 A;  2HQM A;  2FBW A;  4N9X A;  2CHR A;  3UKH A;  1K4Q A;  1FEC A;  4ZA0 A;  1JPD X;  1VQW A;  1RM6 B;  3UP4 A;  3FJ4 A;  2WOV A;  2PS2 A;  2Q0L A;  3OP2 A;  3LXD A;  4IA6 A;  3FPZ A;  4IA5 A;  2PU0 A;  4C5O A;  3LZX A;  4A35 A;  4GF7 A;  3DEQ A;  1NPX A;  5JRB A;  1CBO A;  1UKV G;  4J56 A;  3V5C A;  3ZVH B;  5KNL A;  3V76 A;  1JNR A;  2XFN A;  2C64 A;  2QA1 A;  4MKS A;  4B1B A;  3PWG A;  2O56 A;  2YG6 A;  4DHG A;  1BF3 A;  2XVI A;  3DH9 A;  4OVI A;  4YWO A;  3DGZ A;  4U8I A;  5FS8 A;  2X99 A;  4A99 A;  4A9W A;  4Z25 A;  3TCS A;  4A6N B;  4A3R A;  3GWF A;  3TW9 A;  4A65 A;  2XGZ A;  1LJ1 A;  2WP6 A;  3CPH G;  1YQ4 A;  3NRZ B;  3L1R A;  2C70 A;  4OPU A;  1ONE A;  3CK5 A;  3CPI G;  2X8H A;  2NVK X;  1DOB A;  5KMQ A;  4CRT A;  3QTP A;  3LAD A;  4JN9 A;  3K7M X;  3AMZ A;  3FCP A;  3V4B A;  4OPD A;  2PGE A;  2X50 A;  3NK0 X;  3AB1 A;  1LPF A;  5EOW A;  4USQ A;  5HYM A;  3NGC X;  3LB8 A;  2QDD A;  3QPE A;  4FI4 A;  2R4E A;  3H4K A;  3QKE A;  1QO8 A;  3F8P A;  3I6T A;  2OZ3 A;  3HRD C;  3RIT A;  2V61 A;  1M64 A;  3UKA A;  1ZX9 A;  2MUC A;  3SGL A;  1NEK A;  1E6E A;  3Q4D A;  2JAE A;  3TJI A;  3P4R A;  4RSL A;  3AEF A;  4EWJ A;  4AP1 A;  4J31 A;  5JCI A;  5KMR A;  1PJ6 A;  3T9P A;  1JRY A;  2AL1 A;  2A89 A;  2ZAD A;  3QN3 A;  4MGG A;  1TDE A;  4Y4M A;  3TJ4 A;  3MUC A;  1JEH A;  3H7V A;  2GAH B;  3CGB A;  1F8R A;  4G7F A;  2RAB A;  2VVL A;  1DOD A;  2NPX A;  3KPK A;  1H81 A;  4Z2U A;  3CGE A;  3BI2 A;  2VRL A;  3AXB A;  3BNU A;  3OW1 A;  3SZC A;  5BOF A;  1PBC A;  2FJE A;  1S7M A;  3K30 A;  3R1Z A;  2YG3 A;  2GGG A;  2WES A;  2WBA A;  3UJR A;  1KFY A;  4UDQ A;  5M0Z A;  5KMP A;  2E3T A;  4K22 A;  3IJQ A;  3DER A;  3E1T A;  4OPT A;  2GGI A;  2FJB A;  4LU6 A;  2PGW A;  3AEG A;  2B7R A;  5FJT A;  2QQ6 A;  1IJH A;  1F3P A;  2AL2 B;  1XDI A;  3RNM A;  2V60 A;  4AP3 A;  2BS4 A;  2QCU A;  2WEU A;  3T6C A;  3CND A;  3AYJ A;  4DXK A;  1V59 A;  1Q1R A;  4U8M A;  3NS1 B;  4J57 A;  1Q1W A;  1XAN A;  5EB5 A;  3D1C A;  3DK4 A;  4EQR A;  1GTE A;  4G74 A;  3QSS A;  1OJA A;  2GMH A;  1FOH A;  2HZG A;  3BHF A;  3M0O A;  2CFY A;  7ENL A;  5U25 A;  2OA1 A;  3T37 A;  1D7L A;  3TWA A;  3P1W A;  1IUS A;  5ENL A;  4LII A;  1LQU A;  2IID A;  2PTX A;  2P8B A;  1ECQ A;  1ZKQ A;  1KNR A;  2EQ6 A;  3QSM A;  3SY4 A;  2R4J A;  1RP0 A;  4H4V A;  1PXA A;  4BK2 A;  4GYP A;  1OJT A;  1CHU A;  4CY8 A;  3VDG A;  4E8G A;  1H83 A;  2VVM A;  2C4C A;  5C2T A;  4EMI A;  3R10 A;  1YY5 A;  1WUF A;  1E1K A;  2XH2 A;  2X8C A;  2GEW A;  4RG3 A;  4GUV A;  3GC2 A;  1CJC A;  5BRT A;  2XFU A;  3FYY A;  2YG4 A;  1FHV A;  3SJN A;  1FL2 A;  3SM8 A;  3UJE A;  3ABV A;  4EM4 A;  5IDZ A;  2R0C A;  3UKK A;  1SJB A;  1EC9 A;  1GOS A;  4HA6 A;  1XPY A;  1GXF A;  4GYP C;  4H4R A;  2PP1 A;  5G5H B;  3SSZ A;  3ZVH A;  3LOV A;  5HY5 A;  3GD6 A;  4H2R A;  4ADW A;  1JDF A;  1CJ4 A;  1JRZ A;  1ELI A;  1TYT A;  3UGV A;  1DOE A;  1D7Y A;  4ZCC A;  4TLZ A;  3SZF A;  3NTD A;  1O95 A;  2PPG A;  2V5Z A;  4Z44 A;  2VOU A;  3NT6 A;  2P3Z A;  3QFB A;  3DIP A;  1N4U A;  3Q9T A;  3IJI A;  1XHC A;  2XVJ A;  4A6N A;  2GDQ A;  4EM3 A;  3U9I A;  3B9J B;  3UKQ A;  3BNM A;  2QJJ A;  1MNS A;  3GMC A;  1QJD A;  3ISH A;  3VR8 A;  3N4E A;  3HZL A;  1CJ3 A;  3ZLH A;  2E5V A;  1KKO A;  3COX A;  3A7A A;  3IWA A;  3G5Q A;  2CVJ A;  2XH7 A;  1PHH A;  3N4F A;  1NDA A;  4GIR A;  4JDR A;  3RGT A;  2BAC A;  1ZOV A;  3ICT A;  3QSE A;  3ZLG A;  1TDN A;  4KPR A;  5J04 A;  4GDP A;  3P4Q A;  2W54 A;  2PP0 A;  3RRA A;  3Q6J A;  1GEU A;  2Z5Y A;  1HYU A;  3UKP A;  3JW7 A;  1KSS A;  1Y56 B;  1W4X A;  3GWD A;  1ZK7 A;  4FDC B;  3SX6 A;  2C3D A;  3DJJ A;  2DKI A;  4NNJ A;  1OJD A;  1B5Q A;  1FHU A;  1PS9 A;  3WE0 A;  4HCL A;  3T2Y A;  2OLN A;  2PTZ A;  1TKK A;  4Z2T A;  1EBD A;  1L9C A;  3NVZ B;  3HW2 A;  1E7P A;  2GB0 A;  3IJL A;  1RYI A;  1CJ2 A;  1GRE A;  1F8S A;  2AKM A;  2JKC A;  4ROP A;  3UTH A;  2YLS A;  1MXT A;  3L5O A;  2POD A;  4I58 A;  1SJD A;  4H4Y A;  4BV6 A;  5BOE A;  4HN8 A;  2WDV A;  1P48 A;  2YQU A;  4IVO B;  5CQF A;  1YQ3 A;  2WQY A;  4Z43 A;  1PBF A;  4K5S A;  1T3Q C;  2QA2 A;  4H50 A;  1CC6 A;  1VDC A;  5BVA A;  3NIX A;  1B4V A;  2VRM A;  2FKP A;  2QVH A;  3UXL A;  1ZXI C;  3RHA A;  2AL2 A;  3QVR A;  1B8S A;  3LZW A;  1PBB A;  3CYJ A;  1R6W A;  2ZC8 A;  3EKG A;  1IUT A;  3A7R A;  4Z26 A;  4GAV A;  2BC0 A;  1VG0 A;  4TM4 A;  1EC7 A;  3UCC A;  4P9S A;  4H4S A;  3CIR A;  3RP8 A;  1D5T A;  3R0U A;  4J1O A;  1GAL A;  1N1P A;  3AED A;  1P2E A;  2XFP A;  1F6M A;  3IK4 A;  3BI4 A;  2BCP A;  1SJA A;  1TDF A;  3NNE A;  3FIM B;  3VRB A;  1WYG A;  2OZ8 A;  2B9Y A;  3UKL A;  3P3B A;  5KMS A;  1KCZ A;  2R0G A;  3NHO X;  3DGH A;  3II4 A;  1PXB A;  3AE9 A;  1E39 A;  4U2T A;  4Y4N A;  4TVW A;  3S47 A;  3P4S A;  4O5Q A;  2PA6 A;  2JK6 A;  4M0X A;  5HXI A;  4G73 A;  1AOG A;  4EQS A;  2JB3 A;  1YKJ A;  4GR1 A;  2BA9 A;  1XPQ A;  1GES A;  4U8J A;  4Y4L A;  3OZ2 A;  3VC6 A;  2Q6U A;  2OFJ A;  3V3N A;  1COY A;  4ICY A;  1Y0P A;  1BZL A;  3ICR A;  1KD0 A;  4JNA A;  4H7U A;  5JCK A;  1LV0 A;  1RSG A;  1EBG A;  3MQT A;  1GER A;  1DXL A;  3ATR A;  1O94 A;  3GYI A;  2XDO A;  2VQB A;  3B3R A;  4JHM A;  4UDP A;  4O5U A;  1N60 C;  2OVL A;  3RED A;  1GRT A;  2PP3 A;  3VRA A;  2AR8 A;  2AKZ A;  2W0H A;  4CBQ A;  1O5W A;  4LA1 A;  3THU A;  3NVV B;  5JCL A;  3AYI A;  6ENL A;  3D8X A;  4ZCW A;  4H4Q A;  1GV4 A;  2PYX A;  2VZ2 A;  3UOZ A;  4YTP A;  3HYX A;  2C65 A;  5U1O A;  4H4T A;  1NEN A;  5FS7 A;  2GR2 A;  3T31 A;  2EQ9 A;  1ZMD A;  4K5R A;  4XXG A;  1PDH A;  3S5S A;  4XWZ A;  2GL5 A;  2POZ A;  4NTC A;  1TE6 A;  1B37 A;  3T0K A;  2WPE A;  1GRB A;  2OG9 A;  2W55 A;  3UCD A;  1W6T A;  1EC8 A;  5KRQ A;  4U8P A;  1TZZ A;  1XS2 A;  1D4D A;  1WUE A;  3SZW A;  4H4P A;  5FMH A;  2BS2 A;  4DYE A;  4TLX A;  3GRS A;  1NG3 A;  1LQT A;  4H2Q A;  3GDN A;  3AE2 A;  3MY9 A;  3BSM A;  2GGJ A;  4Z1Y A;  1P2H A;  3UTG A;  2RDX A;  4JQ9 A;  2QJN A;  1VDV A;  1FEB A;  3MKC A;  3NN6 X;  2VVL G;  2B76 A;  1S3E A;  1ONF A;  4GGH A;  1H6V A;  4JN8 A;  3CB3 A;  4AT0 A;  3H8I A;  3PS9 A;  3DES A;  2B9X A;  3HYW A;  3NRN A;  4D03 A;  2GGH A;  3QFA A;  3LJP A;  4YSH A;  1Y56 A;  4ZCD A;  4B65 A;  2XLP A;  1CF3 A;  4YSY A;  3CTY A;  2PTW A;  3MZN A;  3GMB A;  2GAG B;  3DFY A;  3ITJ A;  4JN7 A;  1IUV A;  4B63 A;  5KOW A;  3NKS A;  3SXI A;  2PHH A;  4KPL A;  1GRH A;  4YKG A;  1KN0 A;  4DGK A;  1PDZ A;  2GR1 A;  5ER0 A;  4YKF A;  3U4F A;  3R0K A;  1F8W A;  2BAB A;  2BRA A;  4OPG A;  3M13 A;  4II3 A;  2XFQ A;  2F5Z A;  3H70 A;  1IUU A;  4Z17 A;  3PG6 A;  4IL0 A;  4PAA A;  4CNJ A;  3AM9 A;  2QGY A;  1PBE A;  1CC2 A;  1GPE A;  1GRF A;  3AEE A;  4X9N A;  4KWS A;  3GD3 A;  2GR3 A;  1NG4 A;  2FJD A;  3P4P A;  3QJ4 A;  3EUB 3;  3V3W A;  4Z2R A;  2R0P A;  1DJQ A;  2JB1 A;  3ZVI A;  2V3B A;  2BCG G;  2X8G A;  2GRT A;  1TYP A;  2WHD A;  4WX1 A;  2ZZB A;  3GYJ A;  3JSK A;  1CL0 A;  3ENL A;  4BJZ A;  3S61 A;  3C4A A;  3NO1 A;  2UZZ A;  5FJP A;  3EEZ A;  3D9X A;  2WDQ A;  1M6I A;  2GGE A;  2YLR A;  4K2S A;  5FJR A;  2WP5 A;  1VQZ A;  5TR3 A;  2XVE A;  2P88 A;  2A8X A;  2XFO A;  1ZOY A;  3RP7 A;  1GSN A;  2GVC A;  4GFI A;  5DBJ A;  2GSH A;  1K0I A;  4K7Z A;  1IYX A;  3M12 A;  4X2P A;  2HXT A;  2Y6Q A;  4K8D A;  3VCN A;  3EF6 A;  2C76 A;  4AOX A;  3NXL A;  4IL2 A;  3DJD A;  3NK1 X;  5KXJ A;  3TOY A;  1X2H A;  4YTN A;  4OPL A;  3UKF A;  1H82 A;  2IVD A;  2BC1 A;  1VRQ B;  4A5L A;  2XVH A;  1X2G A;  3FVD A;  5EBK A;  2CDU A;  4U8L A;  2V3A A;  1SEZ A;  4G6G A;  1STZ A;  2B9W A;  2X3N A;  2YR5 A;  1NHP A;  3NYE A;  2H88 A;  2EQ7 A;  2BK4 A;  3SR6 B;  2OAM A;  2PCE A;  4ZOH B;  3AE3 A;  1H84 A;  5J60 A;  3T8Q A;  3T2Z A;  1OJ9 A;  3ZYX A;  3T4W A;  5FJU A;  3NYC A;  3UTF A;  3VR9 A;  3VFC A;  5BUL A;  2YG5 A;  3KA7 A;  1N4V A;  5KWF A;  4IT1 A;  4UDR A;  4BK3 A;  3CAW A;  4H83 A;  3UOY A;  3B97 A;  3H8L A;  3CGC A;  2Q7V A;  2C7G A;  1N5W C;  4BUR A;  2XCG A;  2XH4 A;  4H19 A;  4HCH A;  1N62 C;  2B7S A;  2VQ7 A;  4YTM A;  1PXC A;  2A87 A;  3FG2 P;  3NVY B;  1DNC A;  1ZY8 A;  3SYI A;  3OPS A;  3T2K A;  3STP A;  3D46 A;  3OZY A;  1BKH A;  2R9Z A;  3ADA B;  5KVI A;  3TTE A;  2CUL A;  3EAO A;  3AYL A;  1MDR A;  5C3J A;  3KD9 A;  4DN1 A;  1KF6 A;  2PMQ A;  3EAN A;  1FEA A;  5FJO A;  2GH5 A;  2GV8 A;  2BXR A;  4DX3 A;  3VA8 A;  3NH3 X;  4NTD A;  2HNE A;  3CGD A;  3B6D A;  1ZP0 A;  4GIS A;  2R46 A;  4KT2 A;  4PAB A;  3PWI A;  1F9C A;  1L8P A;  2OQY A;  3GY1 A;  5IQ1 A;  3NN0 X;  5BUK A;  3K7T A;  2Y6R A;  3DJE A;  2NQL A;  4MMW A;  1NHR A;  4EMJ A;  1MOK A;  3KVE A;  3FBS A;  2C72 A;  1NAA A;  5JCN A;  1ELS A;  3VRD B;  4J3Z A;  1OEP A;  3BI5 A;  4GME A;  4U8O A;  3AEC A;  4YSX A;  2EQ8 A;  3CMM A;  2W3S A;  3K7Q X;  2WPC A;  1S2Q A;  4CCR A;  3FXG A;  3KKJ A;  4G6H A;  5FS9 A;  3OC4 A;  4NEV A;  3AE6 A;  2E4G A;  2GR0 A;  4Z24 A;  1YQZ A;  4DWD A;  4B67 A;  2YM2 A;  1SB3 B;  4H4Z A;  1TDK A;  4YT0 A;  2WPF A;  2XH0 A;  2C66 A;  3CT2 A;  3R07 C;  3SBF A;  3BHK A;  1R0M A;  4CCQ A;  1JCT A;  3VC5 A;  5FS6 A;  1N5X A;  3SN0 A;  3HYV A;  3AWI A;  3CNJ A;  2C73 A;  4E4F A;  4UP3 A;  3NYF A;  3D47 A;  2J3N A;  4U8K A;  3KUM A;  4FK1 A;  3NK2 X;  3GYX A;  1FFV C;  1NHS A;  4AT2 A;  4HYR A;  1MDL A;  3UCL A;  4HPN A;  1IUX A;  4CNK A;  1PBD A;  4HNL A;  3BOX A;  4IP4 A;  1ZMC A;  3DFH A;  2TMD A;  3L8K A;  5JCM A;  2BS3 A;  4TVY A;  2ZZC A;  4EQW A;  4KX6 A;  1BWC A;  4REK A;  2ACZ A;  2YVG A;  4TM1 A;  1N61 C;  4KEM A;  1D4E A;  4J33 A;  2XVF A;  2YM1 A;  3NVW B;  4ZN0 A;  2WDR A;  3AE8 A;  4I59 A;  1GET A;  3AE5 A;  1Z6L A;  4FK1 C;  4DSG A;  3QVP A;  4BJY A;  5CKU A;  2FYM A;  2RGO A;  3ATQ A;  1FO4 A;  2O9Z A;  4IV9 A;  5U63 A;  1REO A;  1K0J A;  3H8A A;  2BK3 A;  2WET A;  3I4K A;  1JU2 A;  1FCD A;  4BK1 A;  4C3Y A;  4E5T A;  2RGH A;  4DNA A;  4JNQ A;  3RP6 A;  1V97 A;  3AEA A;  1FFU C;  2TPR A;  3NFU A;  3P9U A;  3UXK A;  3N6J A;  2OLO A;  2DW6 A;  5KOX A;  3AE4 A;  2RGJ A;  1PJ5 A;  3DK9 A;  5IPY A;  1GRG A;  2OX4 A;  4GAP A;  3DGB A;  4K1W A;  2PTY A;  4XWR A;  4YSZ A;  1E1L A;  1BQG A;  1S3B A;  1BKW A;  3T14 A;  1GND A;  1DJN A;  3UOX A;  1TDO A;  4GDE A;  2JBV A;  3I6E A;  2ARD A;  3CPJ G;  3SQS A;  3A7U A;  3AE7 A;  2YLT A;  1MO9 A;  3IF9 A;  1QLB A;  2WU5 A;  2WOW A;  2C3C A;  2H89 A;  1JNZ A;  4IHC A;  1E1M A;  3CNP A;  2OO6 A;  4A7A A;  2OLA A;  3I3L A;  3ALM A;  4H4X A;  3OZM A;  3AD9 B;  3DG7 A;  4C77 A;  2YLZ A;  3KU9 A;  2YR4 A;  4G8T A;  4FX9 A;  1SJC A;  4GGB A;  4WCT A;  2YWL A;  1DOC A;  4NTE A;  4OPI A;  4AOS A;  4B69 A;  4IZG A;  1MRA A;  2DW7 A;  1PN0 A;  2BRY A;  2WOI A;  4JY3 A;  2OKT A;  4NZH A;  3SFE A;  2R45 A;  1D4C A;  1BGN A;  3UTE A;  4IVM B;  3UJS A;  4J36 A;  4K8G A;  4HCD A;  2C67 A;  3DG6 A;  2Q0K A;  1KKR A;  1YEY A;  3NTA A;  4C3X A;  3PK7 A;  3G5R A;  3S5W A;  3GDP A;  2AQJ A;  3MWC A;  2XYO A;  3DJG X;  3UJ2 A;  2OQH A;  1EBH A;  4CY6 A;  3GO2 A;  5M10 A;  1JOA A;  2APG A;  4J34 A;  3SZ0 A;  1E1N A;  4OCG A;  4H2H A;  4IP5 A;  1VG9 A;  1GRA A;  4GRT A;  2ZBW A;  1KNP A;  2E5A A;  4B64 A;  3V3O A;  1NHQ A;  2MNR A;  4II2 A;  3IHM A;  3ALJ A;  4TM3 A;  2BK5 A;  2WP9 A;  3C4N A;  3P93 A;  4ENL A;  3P0W A;  3RR1 A;  3BJS A;  2V6O A;  5HHF A;  5EU9 A;  2XLR A;  2HXU A;  2W3R A;  3ZLF A;  3URH A;  3PO7 A;  1LVL A;  2XLS A;  3DDM A;  3JVA A;  2BYB A;  2C75 A;  2GF3 A;  4E0V A;  3KLJ A;  3TWB A;  1FIQ B;  4RG4 A;  3IHG A;  2ONE A;  1NU5 A;  3N6H A;  1EL8 A;  3CNT A;  2YLX A;  4H4W A;  4U2S A;  3HPF A;  1RVK A;  2OAL A;  3GRT A;  4EIQ A;  3ZDN A;  1MUC A;  5G5G B;  1N4W A;  1K0L A;  3MSY A;  2I5Q A;  3UJF A;  3I6D A;  2GQF A;  4X4J A;  1TRB A;  1KDG A;  3ICS A;  4H4U A;  3FMW A;  3DME A;  1H2I A;  2XSX A;  1EL7 A;  4C74 A;  3VCC A;  4K2X A;  1GTH A;  4FP1 A;  3FV9 A;  3AD8 B;  3CN8 A;  3DA1 A;  3TQP A;  1KSU A;  2GMJ A;  4B66 A;  4H1Z A;  4E6M A;  4EMW A;  3NLC A;  1JRO A;  1LTX R;  3SFD A;  4JY2 A;  3UP5 A;  1EL9 A;  1H7X A;  4EIP A;  3H12 A;  2XLT A;  4X9M A;  4MJW A;  1EL5 A;  3JZU A;  3R11 A;  3G5S A;  4J2W A;  3SN4 A;  2OZT A;  3SN1 A;  3Q45 A;  1ZDL A;  2WU2 A;  3GSI A;  1H86 A;  1L0V A;  3RO6 A;  3NG7 X;  2ZZ0 A;  4A79 A;  2E1M A;  4G9K A;  1JRX A;  2QJM A;  4U8N A;  2IVE A;  3SQP A;  4TM0 A;  2PSN A;  2YLW A;  4APN A;  3GD4 A;  3KPF A;  3PVC A;  3AEB A;  1P43 A;  1JRP A;  4NEW A;  4B68 A;  3R9U A;  3UOV A;  2YG7 A;  2QDE A;  4USR A;  2YVF A;  4U2L A;  1OJC A;  2XLU A;  2DKH A;  1PJ7 A;  2Z5X A;  4A6G A;  1H7W A;  5J7X A;  3R25 A;  1GT8 A;  4NWZ A;  4H2N A;  5KVH A;  3ES7 A;  2YVJ A;  5GRT A;  1IUW A;  3AN1 A;  4YWS A;  2BXS A;  3AE1 A;  3DG3 A;  3DK8 A;  1E9I A;  4ECH A;  1CC4 A;  2OPJ A;  1N63 C;  2PU1 A;  1L9D A;  3ETR B;  1BGJ A;  2QAE A;  3O0H A;  2AAQ A;  2FJA A;  2JB2 A;  4EQX A;  4H2P A;  1X31 B;  1NEL A;  1Q9I A;  4HB9 A;  3IC9 A;  3QLD A;  3OTR A;  1L9E A;  3V5F A;  3ES8 A;  4DSH A;  4M52 A;  3CNS A; 
#chains in the Genus database with same CATH homology
 2RGH A;  4DNA A;  4JNQ A;  1N4U A;  3Q9T A;  5LV9 A;  1PBE A;  1CC2 A;  1GPE A;  1GRF A;  3AEE A;  4X9N A;  3RP6 A;  1XHC A;  2XVJ A;  3AEA A;  2TPR A;  1S2Y A;  3GD3 A;  4A6N A;  3P9U A;  4YXD A;  3EPT A;  4GCM A;  4EM3 A;  2OLO A;  3C96 A;  2GR3 A;  3F8D A;  1NG4 A;  2YAU A;  2FJD A;  3UKQ A;  5KOX A;  3P4P A;  3BNM A;  3AE4 A;  2RGJ A;  3AD7 B;  3QJ4 A;  1PJ5 A;  3DK9 A;  5IPY A;  2GQW A;  1GRG A;  3GMC A;  4OPC A;  3F8R A;  1QJD A;  3ISH A;  4GAP A;  3VR8 A;  3HZL A;  4Z2R A;  1CJ3 A;  2R0P A;  4XWR A;  1E1L A;  1S3B A;  4YSZ A;  5EB4 A;  1DJQ A;  2E5V A;  2JB1 A;  3COX A;  2V3B A;  1BKW A;  2BCG G;  5IQ4 A;  3IWA A;  3G5Q A;  2CVJ A;  2I0Z A;  2X8G A;  3VQR A;  3T14 A;  2GRT A;  1GND A;  1PHH A;  2WS3 A;  1TYP A;  1DJN A;  5GSN A;  2WHD A;  4WX1 A;  2ZZB A;  1NDA A;  3UOX A;  4JDR A;  3GYJ A;  2BAC A;  3JSK A;  5L46 A;  4D04 A;  1ZOV A;  1CL0 A;  1TDO A;  3ICT A;  3QSE A;  4GDE A;  4BJZ A;  3S61 A;  1TDN A;  2JBV A;  2ARD A;  3C4A A;  3CPJ G;  4KPR A;  3ALL A;  4GDP A;  2UZZ A;  3P4Q A;  2YR6 A;  3AE7 A;  2HQM A;  2YLT A;  1MO9 A;  3IF9 A;  2FBW A;  4N9X A;  1QLB A;  2WU5 A;  3UKH A;  1K4Q A;  3D9X A;  1FEC A;  2WDQ A;  1M6I A;  3Q6J A;  1GEU A;  2WOW A;  2Z5Y A;  1HYU A;  1VQW A;  3UKP A;  2YLR A;  2C3C A;  1KSS A;  1Y56 B;  3UP4 A;  1W4X A;  2WOV A;  2WP5 A;  2H89 A;  3GWD A;  2Q0L A;  1ZK7 A;  4FDC B;  3SX6 A;  1JNZ A;  3LXD A;  2C3D A;  3DJJ A;  5TR3 A;  1E1M A;  2DKI A;  4IA6 A;  3FPZ A;  2XVE A;  3CNP A;  1OJD A;  4NNJ A;  1B5Q A;  1PS9 A;  4IA5 A;  3WE0 A;  2A8X A;  4C5O A;  3T2Y A;  4A7A A;  3LZX A;  3I3L A;  2OLN A;  2XFO A;  3ALM A;  4GF7 A;  4Z2T A;  1EBD A;  1NPX A;  4H4X A;  1L9C A;  1ZOY A;  3RP7 A;  1GSN A;  2GVC A;  3AD9 B;  1E7P A;  5JRB A;  1CBO A;  1UKV G;  4C77 A;  5DBJ A;  2GB0 A;  4J56 A;  2YLZ A;  3KU9 A;  1K0I A;  4K7Z A;  1RYI A;  1CJ2 A;  2YR4 A;  3M12 A;  2Y6Q A;  1GRE A;  1F8S A;  4FX9 A;  4K8D A;  4WCT A;  3EF6 A;  5KNL A;  2JKC A;  3V76 A;  2C76 A;  4AOX A;  3UTH A;  2YLS A;  1JNR A;  1MXT A;  3L5O A;  1DOC A;  2XFN A;  2YWL A;  3DJD A;  4I58 A;  4NTE A;  4OPI A;  4AOS A;  4B69 A;  4H4Y A;  4BV6 A;  2C64 A;  2QA1 A;  4B1B A;  1PN0 A;  2BRY A;  2WDV A;  2WOI A;  4JY3 A;  3NK1 X;  4NZH A;  5KXJ A;  3SFE A;  4IVO B;  2YQU A;  2YG6 A;  5CQF A;  1YQ3 A;  2WQY A;  4Z43 A;  1BF3 A;  4YTN A;  1PBF A;  4OPL A;  2XVI A;  3DH9 A;  4K5S A;  4OVI A;  1H82 A;  3UKF A;  2R45 A;  2IVD A;  4CNJ A;  1D4C A;  4YWO A;  1BGN A;  2BC1 A;  2QA2 A;  3DGZ A;  4H50 A;  1CC6 A;  1VRQ B;  1VDC A;  3UTE A;  4A5L A;  2XVH A;  4U8I A;  4IVM B;  5BVA A;  3NIX A;  5FS8 A;  2X99 A;  4A99 A;  4A9W A;  4Z25 A;  5M10 A;  1B4V A;  4J36 A;  5EBK A;  2CDU A;  4A6N B;  2VRM A;  2V3A A;  2C67 A;  1SEZ A;  4U8L A;  4G6G A;  3GWF A;  2Q0K A;  2B9W A;  2X3N A;  2YR5 A;  3RHA A;  4A65 A;  1NHP A;  1LJ1 A;  2WP6 A;  3CPH G;  1YQ4 A;  1B8S A;  3NTA A;  3QVR A;  4C3X A;  3LZW A;  1PBB A;  3NYE A;  3G5R A;  3L1R A;  2C70 A;  3S5W A;  3GDP A;  2AQJ A;  2H88 A;  4OPU A;  2EQ7 A;  2BK4 A;  2XYO A;  1IUT A;  3CPI G;  2X8H A;  2NVK X;  1DOB A;  2OAM A;  3AE3 A;  4Z26 A;  5KMQ A;  4CRT A;  3DJG X;  3LAD A;  4GAV A;  4JN9 A;  3K7M X;  1H84 A;  5J60 A;  3T2Z A;  2BC0 A;  1VG0 A;  1OJ9 A;  3ZYX A;  4TM4 A;  4P9S A;  4CY6 A;  4OPD A;  4H4S A;  3CIR A;  3RP8 A;  3NYC A;  3UTF A;  3VR9 A;  1JOA A;  2APG A;  1D5T A;  4J34 A;  3SZ0 A;  2X50 A;  1E1N A;  1GAL A;  1N1P A;  3AED A;  4OCG A;  5BUL A;  1P2E A;  2YG5 A;  3NK0 X;  2XFP A;  3KA7 A;  1F6M A;  3AB1 A;  3BI4 A;  2BCP A;  1LPF A;  5EOW A;  1VG9 A;  4USQ A;  5HYM A;  1TDF A;  1N4V A;  3NGC X;  3LB8 A;  1GRA A;  5KWF A;  3NNE A;  3FIM B;  4GRT A;  2R4E A;  2ZBW A;  4UDR A;  3VRB A;  1KNP A;  3H4K A;  2B9Y A;  4BK3 A;  3UKL A;  5KMS A;  3UOY A;  1QO8 A;  3CGC A;  2R0G A;  3DGH A;  2Q7V A;  3II4 A;  3F8P A;  3H8L A;  1PXB A;  2C7G A;  3AE9 A;  3NHO X;  1E39 A;  2V61 A;  4U2T A;  4B64 A;  4BUR A;  4Y4N A;  1NHQ A;  1M64 A;  3V3O A;  2XCG A;  3UKA A;  3P4S A;  4II2 A;  1ZX9 A;  4O5Q A;  3SGL A;  2JK6 A;  1NEK A;  3IHM A;  2B7S A;  3ALJ A;  4TM3 A;  2BK5 A;  1E6E A;  4G73 A;  1AOG A;  5HXI A;  2WP9 A;  3C4N A;  2JAE A;  4EQS A;  2VQ7 A;  2JB3 A;  1YKJ A;  4GR1 A;  4YTM A;  3P4R A;  1PXC A;  2BA9 A;  3AEF A;  1XPQ A;  4RSL A;  4AP1 A;  4J31 A;  5JCI A;  2A87 A;  5KMR A;  1PJ6 A;  1GES A;  1JRY A;  3FG2 P;  4U8J A;  4Y4L A;  2A89 A;  2V6O A;  5HHF A;  3OZ2 A;  1DNC A;  1ZY8 A;  1TDE A;  2XLR A;  3SYI A;  3T2K A;  2Q6U A;  4Y4M A;  3URH A;  3PO7 A;  1LVL A;  2XLS A;  2R9Z A;  3V3N A;  1COY A;  4ICY A;  1JEH A;  2BYB A;  2C75 A;  3ADA B;  5KVI A;  2GF3 A;  2CUL A;  4E0V A;  1Y0P A;  2GAH B;  1BZL A;  3EAO A;  3AYL A;  3ICR A;  5C3J A;  3KLJ A;  3CGB A;  4JNA A;  3KD9 A;  5JCK A;  1KF6 A;  4H7U A;  4RG4 A;  3IHG A;  1F8R A;  1LV0 A;  3EAN A;  1FEA A;  1RSG A;  2RAB A;  1GER A;  2GH5 A;  1DXL A;  1DOD A;  2NPX A;  1EL8 A;  2BXR A;  2GV8 A;  2VVL A;  3ATR A;  2YLX A;  3CNT A;  3KPK A;  4H4W A;  1H81 A;  1O94 A;  2XDO A;  3GYI A;  4U2S A;  3NH3 X;  2OAL A;  3CGD A;  3B6D A;  2VQB A;  3GRT A;  1ZP0 A;  4NTD A;  4Z2U A;  3CGE A;  4EIQ A;  3BI2 A;  3ZDN A;  2VRL A;  3B3R A;  1N4W A;  2R46 A;  3AXB A;  3BNU A;  1K0L A;  4UDP A;  4PAB A;  3SZC A;  2FJE A;  1PBC A;  1S7M A;  3I6D A;  4O5U A;  3K30 A;  3RED A;  2GQF A;  4X4J A;  1GRT A;  3VRA A;  5IQ1 A;  2AR8 A;  2YG3 A;  3NN0 X;  1TRB A;  2WES A;  1KDG A;  2W0H A;  2WBA A;  4CBQ A;  5BUK A;  3K7T A;  2Y6R A;  1O5W A;  3ICS A;  3DJE A;  4H4U A;  1KFY A;  4LA1 A;  3FMW A;  3DME A;  4UDQ A;  5M0Z A;  5JCL A;  1H2I A;  3AYI A;  5KMP A;  1EL7 A;  3D8X A;  4C74 A;  4K22 A;  4K2X A;  1GTH A;  4H4Q A;  3E1T A;  1NHR A;  4OPT A;  1GV4 A;  2PYX A;  2VZ2 A;  3AD8 B;  3CN8 A;  3DA1 A;  3UOZ A;  2FJB A;  4LU6 A;  1KSU A;  4EMJ A;  2GMJ A;  1MOK A;  4B66 A;  3AEG A;  2B7R A;  3KVE A;  3FBS A;  4YTP A;  4EMW A;  3NLC A;  1LTX R;  1IJH A;  2C72 A;  3SFD A;  3HYX A;  4JY2 A;  1F3P A;  3UP5 A;  1XDI A;  3RNM A;  5JCN A;  1NAA A;  2C65 A;  2V60 A;  4AP3 A;  1EL9 A;  2BS4 A;  2QCU A;  3VRD B;  5U1O A;  1H7X A;  2WEU A;  3CND A;  4H4T A;  1NEN A;  5FS7 A;  2GR2 A;  3BI5 A;  3T31 A;  2EQ9 A;  4U8O A;  3AYJ A;  4EIP A;  1V59 A;  1Q1R A;  3AEC A;  1ZMD A;  4YSX A;  4K5R A;  4U8M A;  4J57 A;  2EQ8 A;  4XXG A;  1PDH A;  1Q1W A;  3CMM A;  3K7Q X;  2WPC A;  1XAN A;  4XWZ A;  2XLT A;  5EB5 A;  4X9M A;  1S2Q A;  4NTC A;  4MJW A;  4CCR A;  1EL5 A;  1B37 A;  3D1C A;  3T0K A;  2WPE A;  1GRB A;  3DK4 A;  4EQR A;  3G5S A;  3KKJ A;  4G6H A;  1GTE A;  5FS9 A;  3OC4 A;  4G74 A;  4J2W A;  4NEV A;  3AE6 A;  2E4G A;  2GR0 A;  4Z24 A;  1YQZ A;  4B67 A;  2YM2 A;  3QSS A;  1OJA A;  2GMH A;  4H4Z A;  1FOH A;  1TDK A;  3BHF A;  4YT0 A;  5KRQ A;  4U8P A;  2WPF A;  1ZDL A;  3M0O A;  2CFY A;  2C66 A;  5U25 A;  2WU2 A;  1D4D A;  2OA1 A;  3SZW A;  3T37 A;  4H4P A;  5FMH A;  2BS2 A;  3GSI A;  1D7L A;  1H86 A;  4TLX A;  3GRS A;  1L0V A;  3BHK A;  3P1W A;  1NG3 A;  1LQT A;  1IUS A;  3NG7 X;  4CCQ A;  2ZZ0 A;  4H2Q A;  2E1M A;  4A79 A;  3GDN A;  4G9K A;  5FS6 A;  1JRX A;  4LII A;  3AE2 A;  1LQU A;  4U8N A;  2IVE A;  3HYV A;  3AWI A;  3SQP A;  3CNJ A;  2IID A;  4TM0 A;  2YLW A;  2C73 A;  1P2H A;  4APN A;  3GD4 A;  3UTG A;  4UP3 A;  3KPF A;  3PVC A;  1ZKQ A;  3NYF A;  1KNR A;  4JQ9 A;  3AEB A;  2J3N A;  2EQ6 A;  4U8K A;  3QSM A;  1FEB A;  4NEW A;  4FK1 A;  3SY4 A;  3NK2 X;  4B68 A;  2R4J A;  3R9U A;  3NN6 X;  2VVL G;  3GYX A;  3UOV A;  1RP0 A;  4H4V A;  2B76 A;  1PXA A;  4BK2 A;  1NHS A;  1OJT A;  1S3E A;  2YG7 A;  4AT2 A;  1ONF A;  1CHU A;  1H6V A;  4CY8 A;  4USR A;  4AT0 A;  1H83 A;  2VVM A;  2YVF A;  3H8I A;  2C4C A;  4U2L A;  1IUX A;  3UCL A;  4CNK A;  1PBD A;  5C2T A;  4EMI A;  1OJC A;  3PS9 A;  2XLU A;  1ZMC A;  2B9X A;  2TMD A;  2DKH A;  3L8K A;  3HYW A;  3NRN A;  1YY5 A;  4D03 A;  1E1K A;  5JCM A;  3QFA A;  2BS3 A;  1PJ7 A;  3LJP A;  2Z5X A;  4YSH A;  1H7W A;  2X8C A;  5J7X A;  1Y56 A;  2GEW A;  2ZZC A;  4RG3 A;  4EQW A;  4ZCD A;  4KX6 A;  1BWC A;  4GUV A;  1CJC A;  4REK A;  5BRT A;  2ACZ A;  2XFU A;  1GT8 A;  2YVG A;  1D4E A;  1CF3 A;  2XLP A;  4TM1 A;  4B65 A;  4NWZ A;  4J33 A;  2XVF A;  2YM1 A;  4YSY A;  2YG4 A;  3CTY A;  4H2N A;  5KVH A;  4ZN0 A;  2YVJ A;  3GMB A;  5GRT A;  2WDR A;  1FL2 A;  2GAG B;  1IUW A;  2BXS A;  3SM8 A;  3AE1 A;  3AE8 A;  4EM4 A;  3ABV A;  4I59 A;  3DK8 A;  3ITJ A;  1IUV A;  4B63 A;  1GET A;  5KOW A;  2R0C A;  3NKS A;  3AE5 A;  3SXI A;  3UKK A;  4ECH A;  1Z6L A;  4FK1 C;  2PHH A;  4DSG A;  1CC4 A;  3QVP A;  1GRH A;  4BJY A;  5CKU A;  1GOS A;  4YKG A;  4HA6 A;  1KN0 A;  4DGK A;  2GR1 A;  1GXF A;  5ER0 A;  4H4R A;  1L9D A;  4YKF A;  2RGO A;  3ATQ A;  1BGJ A;  1F8W A;  3LOV A;  2QAE A;  5HY5 A;  3O0H A;  2BAB A;  2BRA A;  4H2R A;  4ADW A;  4OPG A;  3M13 A;  2AAQ A;  2FJA A;  2JB2 A;  1CJ4 A;  4II3 A;  1JRZ A;  1ELI A;  2O9Z A;  1TYT A;  4IV9 A;  4EQX A;  4H2P A;  1X31 B;  1Q9I A;  2XFQ A;  4HB9 A;  1DOE A;  5U63 A;  3IC9 A;  1REO A;  1D7Y A;  4ZCC A;  1L9E A;  2F5Z A;  4TLZ A;  3SZF A;  1K0J A;  2BK3 A;  3NTD A;  1O95 A;  1IUU A;  2V5Z A;  2WET A;  4Z44 A;  2VOU A;  4DSH A;  3NT6 A;  1JU2 A;  1FCD A;  3PG6 A;  4PAA A;  3QFB A;  4M52 A;  4BK1 A;  3CNS A;  4C3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...