1JOAA

Nadh peroxidase with cysteine-sulfenic acid
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
447
structure length
446
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the native cysteine-sulfenic acid redox center of enterococcal NADH peroxidase refined at 2.8 A resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NADH PEROXIDASE
total genus 138
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1996-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1joaA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1joaA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1joaA02
4BJZA 1GV4A 2GAGB 4AP3A 3F8PA 1JNZA 3CGCA 2OALA 3AD9B 2YG4A 3D8XA 5U63A 2VZ2A 2A89A 1GEUA 3ICRA 1ZY8A 4CNKA 1NHSA 1GRGA 3AE2A 1K0LA 4EQRA 4A99A 3AEGA 3GYJA 4FK1C 2XFOA 4DNAA 2HQMA 4Z2RA 1Q1WA 2C67A 2R46A 2C73A 4YT0A 4H4UA 4NEWA 2FBWA 4A6NB 4BK2A 3CN8A 1LJ1A 1CL0A 2BS2A 2GR0A 1JRZA 1YY5A 4E0VA 4MJWA 2PHHA 2ZZCA 1LV0A 3DK8A 2C65A 1ONFA 2XVHA 1B5QA 3AEFA 3EF6A 2E5VA 2J3NA 1GETA 1MO9A 4J31A 2V5ZA 2XLSA 2JK6A 2WP6A 3SFDA 3SFEA 4EIPA 1CHUA 3GD4A 2W0HA 2ZZ0A 1MXTA 3ISHA 4B1BA 3RP7A 4C5OA 1IJHA 1EL7A 1CF3A 3E1TA 1KDGA 1CC4A 3VRBA 1BF3A 3GMBA 1H83A 2YR4A 4J2WA 2YVGA 2BXSA 1PBBA 2WPEA 5JCNA 1E7PA 5CKUA 1IUWA 4EQWA 2WS3A 3LJPA 1H7WA 2WBAA 3UKQA 4JDRA 4CY6A 5IQ4A 2WHDA 5C2TA 1KFYA 5JCLA 2X8HA 3AE7A 1EL9A 3B6DA 1OJCA 2XVFA 3IF9A 3DA1A 4LU6A 2ZZBA 3K7MX 2H89A 2ZBWA 3AYJA 3P4RA 1PBEA 4J56A 4B66A 4FK1A 1NG3A 4Y4LA 4AP1A 1NEKA 2XDOA 2H88A 3OC4A 2GVCA 2VQ7A 1E1NA 5BUKA 1N4UA 2RGJA 1FECA 3DK4A 1CJ4A 2APGA 2B9YA 3PO7A 2C75A 4Z26A 5KVIA 4H4VA 1DOBA 3NNEA 1BKWA 2GMHA 3P4QA 4IVMB 1D4CA 5KOXA 1NHPA 3GRSA 3GDNA 4OVIA 2R4EA 4H4XA 3DJDA 2VVLG 4EQXA 2WESA 4O5UA 1F8SA 4U8KA 1CBOA 2ACZA 2JB3A 3GDPA 1TYTA 1B8SA 3NT6A 1BWCA 2X8CA 1E39A 4CCQA 3P9UA 1H81A 2DKHA 4K2XA 1D7YA 5HY5A 4XWRA 3RHAA 2X8GA 2XVIA 4JN9A 2IVDA 4X4JA 2Z5XA 3FIMB 4OPUA 1FOHA 1QJDA 2B9WA 5HXIA 3D1CA 1GRTA 2GB0A 3UKHA 1NG4A 4K7ZA 1XPQA 4OPLA 2GR1A 1YKJA 1VQWA 3IWAA 4YKFA 4UP3A 3EANA 4H50A 1SEZA 4GDEA 1B4VA 3II4A 1LQTA 3KD9A 1K4QA 4X9MA 3NLCA 1KNPA 1CC2A 4XXGA 2RGOA 2GV8A 1ZMCA 1K0IA 2BYBA 2C70A 5KRQA 2YLSA 3NG7X 2R45A 2CDUA 5FMHA 4CNJA 1IUSA 2WOWA 4D04A 2CFYA 2XLTA 2GMJA 3UTGA 3CTYA 4C3XA 1N4VA 3AXBA 3R9UA 3GSIA 3AYIA 4NTEA 4C3YA 5M10A 2YM2A 2BABA 4H4RA 1TDFA 3C4NA 3AB1A 5KWFA 5L46A 2YM1A 3AE6A 3ZYXA 2WDVA 2WPFA 2QA1A 1GRBA 2V61A 3RP8A 1X31B 3CNSA 2IIDA 4ZCDA 2GH5A 1PXBA 4HA6A 2C72A 2WU2A 4NZHA 3FMWA 2Y6RA 3NRNA 1NAAA 2YLZA 1NDAA 2JAEA 1IUXA 1GREA 2RGHA 1E1MA 2XVEA 3FPZA 3QSMA 4A5LA 4AOXA 3BNMA 3ICTA 2WU5A 3C96A 1FEAA 1O5WA 4K8DA 5FS6A 3KU9A 2Q7VA 1GRFA 2DKIA 3ALJA 3AE3A 5DBJA 1D4EA 2XYOA 2BA9A 2YQUA 2WP5A 3AD8B 4RSLA 4YKGA 4D03A 3CNDA 3GD3A 2EQ6A 5FS8A 1N1PA 4ADWA 1EBDA 4JNAA 3UOYA 1MOKA 1PBCA 3BHKA 3K7TA 1TDKA 2BK3A 1NHQA 1VRQB 1IUVA 5JCIA 1LQUA 5FS9A 2AQJA 4I58A 4OPDA 1Y56A 1ZKQA 2VQBA 3UCLA 1TDOA 4YSXA 4APNA 1H6VA 4I59A 2GAHB 1F8WA 3KPFA 4H2QA 1EL5A 4Y4MA 1DJQA 4J33A 4B64A 5EBKA 4YWOA 4GUVA 1H82A 3NK2X 4BK3A 3UOVA 3AE8A 1KSUA 1PJ6A 2FJDA 3VR8A 1DODA 2BCGG 5GSNA 2B7SA 2VRLA 4EQSA 2BK5A 1ZK7A 1ZOVA 4EIQA 2YWLA 4C77A 1PHHA 3IC9A 2WDRA 2NPXA 1D4DA 2B76A 2VVLA 2BXRA 3NGCX 4EMWA 2E1MA 2RABA 3CPJG 2R4JA 4K5SA 1JRXA 1N4WA 4U2LA 2VOUA 1E1LA 3NIXA 1NENA 1JRYA 2XCGA 4REKA 4U8OA 4TLZA 4AT0A 1RSGA 3M13A 3ICSA 2VRMA 5HYMA 4H4PA 1V59A 4USRA 2WEUA 3Q6JA 2PYXA 3DJJA 3QFBA 2A8XA 1XDIA 4FDCB 1HYUA 1Q9IA 2YG7A 3UKLA 2WOIA 4YSYA 2BS3A 1PBDA 5J7XA 4Z24A 4J57A 1GRHA 3P4PA 1CJ2A 4DGKA 4H2RA 3UTFA 4H4YA 3EAOA 5JCMA 4CBQA 3AEAA 3VR9A 2Q6UA 3NYCA 1H84A 4EMJA 4A9WA 1AOGA 1YQZA 2XVJA 4EM4A 2EQ8A 3UP4A 1L9EA 2V6OA 1VG9A 1GESA 3LZXA 3NN0X 5J60A 1DOCA 3KKJA 2WDQA 3ATQA 4H2NA 3IHGA 3LZWA 4OPGA 1B37A 1KNRA 2YR6A 4RG4A 4RG3A 2C64A 3G5SA 4TM0A 4YTMA 3LADA 3ATRA 3M0OA 5KOWA 1CC6A 3AEBA 3CIRA 3F8DA 3NHOX 3DGZA 3GWDA 4YTNA 1RYIA 5EOWA 1E1KA 1F6MA 4KPRA 2Z5YA 3GWFA 4B63A 1K0JA 1S3BA 3QSEA 2CVJA 4H7UA 1UKVG 3CGDA 1PBFA 4HB9A 3EPTA 3LB8A 3IHMA 4WX1A 3AYLA 3CPIG 2FJEA 3BNUA 2UZZA 3AE4A 4ECHA 1JEHA 4OPIA 1JOAA 3CGEA 1GRAA 4JQ9A 4CCRA 2X3NA 4GF7A 3PVCA 3SQPA 3VQRA 1DNCA 1IUTA 1TDNA 4FX9A 3AEEA 3V3OA 2XFPA 1Y0PA 3QVPA 1PJ7A 1BGJA 3UKPA 3I3LA 2B9XA 2EQ9A 3DJGX 4H4SA 1GOSA 4NTCA 5BRTA 4NEVA 3K30A 2YR5A 4Z2UA 3CPHG 4K5RA 1GERA 4TLXA 2GRTA 4H4WA 1FL2A 3AE9A 5BULA 2YAUA 1ZP0A 4EMIA 3NTAA 3BHFA 4U2SA 1F3PA 1P2HA 2YLTA 5EB4A 2AAQA 1CJCA 2YLXA 5HHFA 4TM4A 2C3CA 4BURA 1YQ4A 1DXLA 2YG5A 2IVEA 4H4TA 3AECA 4U8IA 2FJAA 2BC0A 2C76A 1COYA 1GALA 5GRTA 1BGNA 3UKKA 1DJNA 1Q1RA 4GRTA 4M52A 1W4XA 4C74A 2JBVA 1OJTA 1H7XA 3L8KA 3T37A 4TM1A 4AT2A 1S2YA 3I6DA 4N9XA 3GYIA 2XLUA 1TDEA 2B7RA 5KVHA 5U25A 1CJ3A 2JB1A 3NTDA 1DOEA 1ELIA 3FBSA 4EM3A 1JU2A 1O95A 3ALLA 3DK9A 4WCTA 3RP6A 3UOZA 4DSGA 3VRDB 2XFQA 3UKFA 3QVRA 3NH3X 5C3JA 1E6EA 3P4SA 2BCPA 5BVAA 4OCGA 2VVMA 3V3NA 2TMDA 3HZLA 4U8MA 2YLWA 1OJ9A 1GT8A 4Z25A 2OLOA 2C3DA 5ER0A 2JKCA 3DJEA 3B3RA 1ZOYA 4IVOB 5IPYA 3H8IA 4X9NA 1BZLA 1FEBA 2EQ7A 2E4GA 1H86A 2C66A 5LV9A 2Q0KA 1QLBA 1PN0A 1Y56B 3UP5A 1P2EA 2FJBA 1PJ5A 2YLRA 2TPRA 3CNTA 4GR1A 4ZN0A 4YTPA 1LTXR 2BC1A 4U8JA 2YG6A 4GCMA 1PXAA 2QCUA 4JY3A 3L1RA 2OA1A 3NYEA 3NYFA 1FCDA 1PXCA 4J36A 3AD7B 3VRAA 1KSSA 2XFUA 2NVKX 4IV9A 1LVLA 4B67A 3ZDNA 2WOVA 1XHCA 2V3BA 2Y6QA 1KF6A 3P1WA 4B68A 4TM3A 4USQA 3K7QX 3AEDA 2R0GA 3UOXA 2F5ZA 1RP0A 1VDCA 3ABVA 3NN6X 3DH9A 4GDPA 3BI2A 4PAAA 1D5TA 4A65A 2GEWA 2QA2A 3AE5A 5U1OA 4YSZA 5KXJA 4YXDA 3BI5A 3KA7A 1GNDA 2GQWA 3S5WA 3JSKA 2V3AA 3QJ4A 5IQ1A 3ITJA 3LXDA 1REOA 1LPFA 2BACA 3RNMA 3M12A 2YVFA 3QSSA 3CNPA 4PABA 3PS9A 3REDA 1ZX9A 1QO8A 2XLPA 2BS4A 2GF3A 4BK1A 1NHRA 3O0HA 3C4AA 1OJAA 2X50A 4UDQA 2R9ZA 4DSHA 5FS7A 1EL8A 1ZDLA 4H4QA 4OPTA 3DMEA 4A79A 4IA6A 1PDHA 3UKAA 3COXA 4P9SA 3OZ2A 4O5QA 4Z43A 2GQFA 1JNRA 1VG0A 2QAEA 1M64A 2C7GA 4BJYA 4CY8A 1YQ3A 3AE1A 2Q0LA 2I0ZA 4UDPA 3UTEA 3AWIA 3URHA 4JY2A 4KX6A 2XLRA 5JCKA 1TRBA 1O94A 1D7LA 1GPEA 2O9ZA 2WPCA 3NKSA 3WE0A 4B69A 3UTHA 4ICYA 2OAMA 1GXFA 4H2PA 2BK4A 3QFAA 4U8NA 2R0CA 4JNQA 3DGHA 2YG3A 3GRTA 2JB2A 3S61A 2A87A 2WETA 3GMCA 2CULA 4Z2TA 1Z6LA 3ALMA 5M0ZA 1S2QA 1GTHA 4YSHA 4OPCA 1L9CA 1TYPA 4J34A 3V76A 3LOVA 4K22A 2GR2A 1IUUA 1S3EA 2ARDA 2OLNA 1L0VA 3BI4A 2X99A 4XWZA 2YVJA 4CRTA 2XFNA 3NK1X 3H8LA 4U8LA 3ADAB 3G5RA 3FG2P 3KLJA 2WP9A 1GTEA 3SGLA 3SM8A 1NPXA 3H4KA 1L9DA 3NK0X 2R0PA 4LIIA 3Q9TA 1M6IA 4UDRA 5CQFA 4A7AA 4Z44A 1PS9A 3G5QA 4U2TA 3CGBA 1OJDA 3F8RA 3KVEA 3CNJA 1XANA 1GSNA 4B65A 4AOSA 2AR8A 5EB5A 4NTDA 4U8PA 2GR3A 5TR3A 4LA1A 2V60A 2WQYA 4Y4NA 4BV6A 4H4ZA 4ZCCA 1ZMDA 4A6NA 4IA5A 1F8RA
chains in the Genus database with same CATH superfamily
4HCHA 3NXLA 1JNZA 4G8TA 4CNKA 1GRGA 3GYJA 1MUCA 4K2SA 4YT0A 4BK2A 2BS2A 1JRZA 4E0VA 2ZZCA 1LV0A 1ONFA 3AEFA 4ZCWA 2E5VA 2J3NA 1GETA 2V5ZA 3NS1B 5IDZA 2PU1A 4B1BA 3NZGA 2AKZA 1CF3A 4J1OA 2PP3A 5JCNA 2WHDA 1KFYA 3B6DA 1MNSA 3DA1A 4LU6A 2ZZBA 4HCDA 4B66A 4EWJA 2VQ7A 1E1NA 5BUKA 1W6TA 3DK4A 2APGA 2C75A 1DOBA 2OG9A 3P4QA 4GAVA 1D4CA 3P93A 1NHPA 3B97A 3GDNA 3DJDA 4H19A 2VVLG 3SQSA 2ACZA 2JB3A 2X8CA 2DKHA 4XWRA 2XVIA 4JN9A 4X4JA 1FOHA 2B9WA 5HXIA 1GRTA 2PTXA 4JHMA 4K7ZA 1SEZA 3KD9A 3R11A 3RRAA 1CC2A 3MUCA 2BYBA 5KRQA 3UTGA 3T31A 3GSIA 3C4NA 4IHCA 2YM1A 2WDVA 3CNSA 1PXBA 1MRAA 2WU2A 2PU0A 4NZHA 4IL0A 3DGBA 2YLZA 3RO6A 3TQPA 3C96A 1FEAA 3DG6A 2POZA 2OZ3A 3H8AA 1D4EA 2YQUA 2WP5A 1MDRA 1YEYA 5FS8A 4JNAA 4ADWA 1EBDA 3CAWA 4GGHA 2OO6A 3UCCA 1NHQA 1VRQB 5ENLA 4OPDA 2GAHB 4Y4MA 1EL5A 1DJQA 2XH0A 4B64A 4BK3A 3D47A 3VR8A 2BCGG 2VRLA 1PHHA 2WDRA 2BXRA 3IJLA 2E1MA 4GIRA 3TTEA 3CPJG 1N4WA 3NVYB 4U2LA 1E1LA 3NIXA 3SJNA 3V4BA 3SSZA 1TKKA 4AT0A 1V59A 3DEQA 3Q6JA 3DJJA 2A8XA 4FDCB 1HYUA 3UKLA 2BS3A 4Z24A 4KEMA 3SZFA 3EKGA 2E5AA 1H84A 4EMJA 2V6OA 1VG9A 3NN0X 3LZXA 4H2NA 4Z2RA 3IHGA 2C64A 4YTMA 3G5SA 3SR6B 5FJTA 1RYIA 5EOWA 1F6MA 2GGGA 4KPRA 2Z5YA 1K0JA 4IP4A 4DN1A 3LB8A 3R25A 4G9KA 2XSXA 3AE4A 1JEHA 5KMQA 1JOAA 2O56A 1IUTA 1BGJA 3UKPA 3PK7A 2B9XA 2EQ9A 3DJGX 4H4SA 1GERA 2GRTA 3AE9A 2YAUA 2QJMA 4HCLA 5EB4A 1JCTA 4H4TA 2FJAA 1GALA 3UJ2A 4GRTA 3VA8A 4E6MA 3GYIA 5U25A 3TW9A 3FBSA 4WCTA 3UOZA 2W3SA 3P4SA 5BVAA 2VVMA 4U8MA 1GT8A 4Z25A 4M0XA 3B3RA 5IPYA 1BKHA 3T6CA 3HYXA 1PJ5A 3CK5A 1R6WA 4ZN0A 3ES8A 2QCUA 3NYEA 1FCDA 3AD7B 3VRAA 2XFUA 2NVKX 4B68A 1KF6A 3UJEA 4USQA 3K7QX 1F9CA 3UOXA 3BI2A 4PAAA 2QA2A 4YSZA 5U1OA 1GNDA 2GQWA 2PGEA 1STZA 1VDVA 3ITJA 3M12A 3HW2A 3ENLA 1QO8A 3CT2A 2PSNA 4K1WA 2HXUA 4UDQA 1EL8A 5J04A 1ZDLA 4H4QA 3DMEA 3QLDA 1PDHA 4P9SA 1VG0A 3R07C 1YQ3A 3AWIA 4JY2A 3QFAA 2R0CA 4JNQA 4E4FA 2A87A 4Z2TA 1Z6LA 3ALMA 1JPMA 1L9CA 2GGHA 3LOVA 2XGZA 1L0VA 2HZGA 3BI4A 2YVJA 1TE6A 3NK1X 3G5RA 3FG2P 3KLJA 1GTEA 3SM8A 1NPXA 3H4KA 3VCCA 1PS9A 3CGBA 4G6GA 1XANA 4B65A 4NTDA 2GR3A 2WQYA 2I0ZA 4ZCCA 5HHFA 3SZWA 1GV4A 2GAGB 4AP3A 3F8PA 2XH4A 3CGCA 2A89A 1GEUA 3ICRA 3TWAA 3AE2A 4A99A 2OQHA 4MKSA 2C67A 2R46A 2C73A 4H4UA 4A3RA 3JZUA 1YY5A 3TCSA 1ECQA 2PHHA 3K1GA 2C65A 3OPSA 4J31A 1MO9A 3SFEA 2W0HA 1MXTA 3ISHA 3T0KA 3VRBA 1BF3A 3GMBA 2YR4A 4J2WA 3FV9A 2PP0A 1PBBA 3FXGA 1IUWA 4EQWA 3LJPA 4CY6A 5IQ4A 1EC7A 5C2TA 3H7VA 5JCLA 3AE7A 5FJUA 3IF9A 3P4RA 1PBEA 4AP1A 1NEKA 2XDOA 2H88A 2RDXA 2OZ8A 3ZVHA 2RGJA 5KVIA 1BKWA 2GMHA 3GRSA 4H4XA 3GDPA 1BWCA 1E39A 3P9UA 4K2XA 1D7YA 2Z5XA 3FIMB 3UXLA 3UKHA 3CB3A 1XPQA 1VQWA 3CXBA 4GDEA 3II4A 1K4QA 1KNPA 4XXGA 3UJRA 2RGOA 2GV8A 1ZMCA 1K0IA 3NG7X 3NO1A 5FMHA 4D04A 1XS2A 4J3ZA 1KD0A 3R9UA 4NTEA 4C3YA 5M10A 2BABA 1TDFA 5L46A 3V5FA 2WPFA 1GRBA 3H70A 4ZCDA 3KUMA 2Y6RA 3ES7A 3NRNA 3TWBA 1NAAA 2XVEA 3T2ZA 3BNMA 3ICTA 3DFYA 1EC8A 4K8DA 3KU9A 2Q7VA 1GRFA 2BA9A 3T8QA 4A35A 3UOYA 1MOKA 2BK3A 4I58A 2AQJA 4YSXA 1TDOA 4APNA 1H6VA 3KPFA 3DFHA 4YWOA 2FKPA 1H82A 3UOVA 1KSUA 4FP1A 2FJDA 2B7SA 1ZK7A 4EIQA 4C77A 2NPXA 1D4DA 2B76A 3NGCX 1ELSA 4F4RA 2RABA 2R4JA 1JRXA 4K8GA 2PCEA 1RSGA 3M13A 3ICSA 3QTPA 4USRA 2PYXA 1Q9IA 3R0UA 3CXOA 5JCMA 4HYRA 4JN8A 2Q6UA 4ZOHB 1JRPA 3S5SA 3MWCA 4EM4A 3MSYA 5J60A 1DOCA 3LZWA 1B37A 4ECHA 3S47A 3AM9A 1CC6A 3CIRA 4HN8A 3GWDA 2DW7A 4ZA0A 3QSEA 4H7UA 4HB9A 3EPTA 3AYLA 4OPIA 4IL2A 2X3NA 4GF7A 3VFCA 4GYPC 3PVCA 3N4EA 1DNCA 2OX4A 4FX9A 3V3OA 1P48A 1Y0PA 3I3LA 2C4CA 2YR5A 1ZP0A 3BHFA 1F3PA 2YLTA 2AAQA 2YLXA 4TM4A 1YQ4A 2YG5A 3P0WA 5GRTA 3UKKA 3IK4A 4KPLA 2OZTA 2NQLA 1Q1RA 3DESA 1OEPA 3T37A 4N9XA 3NTDA 4EM3A 3DK9A 3RP6A 3UKFA 3NH3X 3GD6A 2PMQA 2PP1A 3EEZA 4G6HA 1S7MA 5ER0A 2JKCA 1ZOYA 4IVOB 5KMPA 6ENLA 1BZLA 3N6JA 2Q0KA 2GSHA 1P2EA 1JPDX 1LTXR 2YG6A 4JY3A 3UGVA 1SJBA 3NYFA 3OTRA 4TM3A 2F5ZA 1RP0A 2OPJA 3ABVA 4A65A 4GYPA 4YXDA 1ZXIC 2P0IA 3S5WA 3JSKA 2V3AA 3QJ4A 2OQYA 3QSSA 4DWDA 3T2KA 1ZX9A 2PA6A 1OJAA 2R9ZA 1P43A 3DDMA 4A79A 4IA6A 3UKAA 3COXA 3HYWA 3OZ2A 4O5QA 1FFUC 4Z43A 2HXTA 1JNRA 3STPA 2W3RA 1SJDA 1BQGA 3URHA 5JCKA 1O94A 1D7LA 2WPCA 3WE0A 3UTHA 4ICYA 1GXFA 3U9IA 2YG3A 2JB2A 2WETA 3OP2A 2QJNA 3DIPA 3GMCA 5M0ZA 1GTHA 3NVVB 4NNJA 4J34A 2OLNA 1WYGA 3NFUA 4CRTA 2XFNA 4U8LA 3ADAB 1FHUA 3SGLA 2PTYA 1SJCA 1L9DA 3NK0X 3Q9TA 4GGBA 4Z44A 4A7AA 4U2TA 1OJDA 3KPKA 3ZLFA 4LA1A 2V60A 4BV6A 4H4ZA 3THUA 4IA5A 4BJZA 2OALA 5U63A 2VZ2A 2AL1A 3N4FA 3FVDA 2XFOA 4DNAA 2HQMA 2PPGA 2FBWA 3CN8A 1CL0A 1V97A 3ETRB 4MJWA 2XVHA 2XLSA 2JK6A 4EIPA 1CHUA 3GD4A 2ZZ0A 1T3QC 3E1TA 3P3BA 1H83A 5JRBA 3GY1A 1E7PA 2WS3A 3GC2A 3H12A 1N61C 3U4FA 3VC6A 5G5GB 4X2PA 2H89A 3OC4A 2ZC8A 1N4UA 1FECA 1CJ4A 2B9YA 3IJIA 3NNEA 4IVMB 4GAPA 4OVIA 2R4EA 4EQXA 2WESA 4O5UA 3SZ0A 1F8SA 4U8KA 3R10A 1B8SA 4CCQA 1H81A 5HY5A 1FIQB 2X8GA 2IVDA 3D1CA 1NG4A 4OPLA 2GR1A 1N60C 1YKJA 4UP3A 1NELA 3EANA 4H50A 2P8BA 1SJAA 3NLCA 2C70A 2YLSA 2QDDA 2R45A 1N5WC 2CDUA 2CHRA 4CNJA 2WOWA 2GMJA 2W54A 3CTYA 4C3XA 3HRDC 1N4VA 3AYIA 1N62C 2P8CA 4H4RA 5KWFA 2QA1A 2V61A 3RP8A 1X31B 2IIDA 3FMWA 1VQZA 1NDAA 2JAEA 1GREA 2GGIA 1E1MA 2RGHA 4GISA 3FPZA 3QSMA 2WU5A 1L8PA 1O5WA 3SBFA 5FS6A 3ALJA 2DKIA 5DBJA 2ZADA 4YKGA 4RSLA 2GGJA 3GD3A 4KWSA 3K7TA 3BOXA 1LQUA 5FS9A 1Y56A 3UCLA 4I59A 4H2QA 1F8WA 4DX3A 4J33A 5EBKA 3NK2X 2BRAA 1DODA 2E3TA 4MMWA 4IZGA 4EQSA 3V3WA 3IC9A 4EMWA 4K5SA 2DW6A 3QKEA 1JRYA 2OVLA 2XCGA 4TLZA 3T14A 2AL2B 5HYMA 3SY4A 4H4PA 5BOFA 2WEUA 3IJQA 3R1ZA 2PODA 2YG7A 4YSYA 1KKRA 2WOIA 7ENLA 1PBDA 4J57A 1GRHA 3P4PA 4DGKA 4H4YA 4CBQA 3AEAA 3VR9A 3PFRA 3NYCA 3RITA 1AOGA 1YQZA 2XVJA 2OFJA 1KKOA 3TJIA 3KKJA 4RG3A 4RG4A 3LADA 3ATRA 3M0OA 1H2IA 1KN0A 3AEBA 3BSMA 3F8DA 4JN7A 3Q4DA 1UKVG 3CGDA 3D9XA 3IHMA 3CPIG 2FJEA 3DG3A 2UZZA 3GO2A 3SQPA 4E8GA 1TDNA 3QVPA 1R0MA 1IYXA 2QVHA 4NEVA 4Z2UA 3CPHG 3GYXA 1FL2A 4ROPA 5BULA 1EC9A 4EMIA 1JDFA 1P2HA 3NVWB 1FHVA 4HNLA 2C3CA 4BURA 2IVEA 2C76A 2JBVA 1H7XA 3L8KA 3AN1A 1N63C 4TM1A 1JROA 1S2YA 3SN4A 1DOEA 1ELIA 3VDGA 4DHGA 4TVWA 5C3JA 3QPEA 3V3NA 2YLWA 3VC5A 2C3DA 3DJEA 3BJSA 3MY9A 3Q45A 3H8IA 4X9NA 4DYEA 2EQ7A 2XH7A 4E4UA 5FJRA 3SN0A 1PN0A 2QQ6A 1Y56B 3UP5A 2FJBA 3CNTA 2HNEA 3I4KA 4YTPA 2BC1A 4U8JA 1PXAA 3L1RA 2OA1A 3DG7A 1X2GA 2QDEA 1EBGA 2PTZA 1XHCA 2V3BA 3P1WA 3NN6X 1D5TA 3AE5A 3KA7A 1KCZA 5IQ1A 3LXDA 1REOA 1LPFA 3RNMA 2P3ZA 2YVFA 3REDA 4Z1YA 2X50A 2XH2A 4DSHA 5FS7A 3L5OA 2GQFA 2P88A 4GFIA 1M64A 2C7GA 4BJYA 4CY8A 3AE1A 4UDPA 4KX6A 2XLRA 1TRBA 1GPEA 2O9ZA 4B69A 2BK4A 4U8NA 3DGHA 3GRTA 3S61A 3ZVHB 2CULA 4ENLA 4YSHA 1TYPA 3V76A 2GR2A 1S3EA 3UJSA 2ARDA 4XWZA 4LIIA 4UDRA 5CQFA 3G5QA 3F8RA 3KVEA 3CNJA 3A7AA 4U8PA 5TR3A 2MUCA 4Y4NA 3PWIA 1ZMDA 3UXKA 3QN3A 3AD9B 2YG4A 3D8XA 1ZY8A 2MNRA 1NHSA 1K0LA 4EQRA 3SZCA 3TOYA 3AEGA 4FK1C 3T2YA 1Q1WA 4NEWA 4A6NB 4KT2A 1RM6B 1LJ1A 2GR0A 3PG6A 3DK8A 1B5QA 3EF6A 2WP6A 3SFDA 3HPFA 3UCDA 3RP7A 4C5OA 1IJHA 1WUFA 1EL7A 1KDGA 1CC4A 4M6UA 2YVGA 3A7RA 2BXSA 2WPEA 5CKUA 3UKQA 1H7WA 2WBAA 4JDRA 1N5XA 2X8HA 1EL9A 1OJCA 3MQTA 2XVFA 3OZMA 3D46A 3K7MX 1E9IA 4IP5A 4GMEA 2ZBWA 3AYJA 4J56A 4FK1A 1NG3A 4Y4LA 5EU9A 2GVCA 4G73A 1FFVC 4A6GA 3PO7A 4Z26A 4H4VA 5KOXA 3FYYA 2AKMA 1CBOA 1TYTA 3NT6A 4MGGA 3RHAA 2FYMA 4OPUA 2AL2A 1QJDA 2GB0A 2I5QA 1NU5A 3EUB3 3I6TA 3IWAA 4YKFA 1XPYA 1B4VA 1LQTA 5KMRA 4X9MA 3A7UA 3OZYA 3R0KA 1IUSA 2CFYA 2XLTA 2GGEA 3AXBA 4FI4A 2YM2A 3SXIA 3RR1A 3AB1A 3AE6A 3ZYXA 5BOEA 3JVAA 2GH5A 3DERA 2C72A 4HA6A 2PS2A 1IUXA 4A5LA 4IT1A 4AOXA 3FCPA 3AE3A 2XYOA 3AD8B 4D03A 3CNDA 2EQ6A 1N1PA 3SX6A 5FJPA 1PBCA 3BHKA 1TDKA 4H2HA 1IUVA 5JCIA 2PGWA 1ZKQA 2VQBA 1ONEA 4GUVA 4HNCA 4G7FA 3AE8A 1PJ6A 4HPNA 4II3A 5GSNA 2BK5A 1ZOVA 5KNLA 2YWLA 2VVLA 1WUEA 3JW7A 3N6HA 5G5HB 2OLAA 2ONEA 2VOUA 3I6EA 1NENA 4REKA 3AMZA 4U8OA 2VRMA 3MZNA 3RGTA 3QFBA 1XDIA 5FJOA 5J7XA 1CJ2A 4H2RA 3UTFA 3EAOA 1FO4A 3OW1A 4A9WA 2EQ8A 3UP4A 1L9EA 1GESA 2WDQA 3ATQA 4OPGA 2YR6A 1KNRA 4TM0A 5KOWA 1SB3B 3NHOX 3DGZA 4YTNA 1E1KA 3GWFA 4B63A 1S3BA 2CVJA 1MDLA 1PBFA 4G74A 4WX1A 3BNUA 4JQ9A 2QGYA 1GRAA 3CGEA 4CCRA 3VQRA 3FJ4A 3AEEA 2XFPA 3NRZB 1PJ7A 1GOSA 5BRTA 3K30A 4K5RA 4TLXA 4H4WA 3RCYA 3NTAA 4U2SA 1CJCA 1RVKA 1DXLA 3AECA 4U8IA 2BC0A 1COYA 1BGNA 1DJNA 4C74A 1W4XA 4M52A 1OJTA 2BRYA 4AT2A 4H1ZA 3I6DA 2XLUA 1TDEA 3CMMA 2B7RA 5KVHA 1CJ3A 2JB1A 1TZZA 1JU2A 1O95A 3ALLA 4DSGA 3VRDB 2XFQA 3QVRA 1E6EA 2BCPA 4OCGA 2TMDA 3HZLA 1OJ9A 2OLOA 3PWGA 1FEBA 2E4GA 1H86A 2C66A 5LV9A 1QLBA 2YLRA 1DTNA 2TPRA 3ZVIA 4GR1A 4TVYA 3ZLGA 2OKTA 3NVZB 4GCMA 4Z17A 1PXCA 4J36A 1KSSA 4IV9A 1LVLA 4B67A 3ZDNA 2WOVA 2Y6QA 3T4WA 3ZLHA 3AEDA 2R0GA 3CYJA 1VDCA 3DH9A 4GDPA 4NWZA 2GEWA 3V5CA 5KXJA 3BI5A 2PTWA 4H83A 2BACA 3CNPA 4PABA 3PS9A 3TJ4A 2XLPA 2BS4A 2GF3A 4BK1A 1NHRA 3O0HA 3C4AA 4E5TA 1X2HA 3VCNA 4DXKA 4OPTA 2GDQA 2QAEA 2Q0LA 3UTEA 3NKSA 2OAMA 3T9PA 4H2PA 4II2A 3UJFA 1EBHA 1S2QA 4OPCA 3B9JB 3MKCA 1PDZA 4K22A 1IUUA 2X99A 3H8LA 2WP9A 5KMSA 3SN1A 2R0PA 3SYIA 1M6IA 3HYVA 1GSNA 2QJJA 4AOSA 4YWSA 2AR8A 2GL5A 5EB5A 2W55A 4NTCA 4A6NA 1PDYA 1F8RA
chains in the Genus database with same CATH topology
3SZWA 4BJZA 1GV4A 2GAGB 4AP3A 3F8PA 1JNZA 3CGCA 2OALA 3AD9B 2YG4A 3D8XA 5U63A 2VZ2A 2A89A 1GEUA 3ICRA 1ZY8A 4CNKA 1NHSA 1GRGA 3AE2A 1K0LA 4EQRA 3SZCA 4A99A 3AEGA 3GYJA 4FK1C 2XFOA 4DNAA 2HQMA 3T2YA 4Z2RA 1Q1WA 2C67A 2R46A 2C73A 4YT0A 4H4UA 4NEWA 2FBWA 4A6NB 4BK2A 3CN8A 1LJ1A 1CL0A 2BS2A 2GR0A 1JRZA 1YY5A 4E0VA 3PG6A 4MJWA 2PHHA 2ZZCA 1LV0A 3DK8A 2C65A 1ONFA 2XVHA 1B5QA 3AEFA 3EF6A 2E5VA 2J3NA 1GETA 1MO9A 4J31A 2V5ZA 2XLSA 2JK6A 2WP6A 3SFDA 3SFEA 4EIPA 1CHUA 3GD4A 2W0HA 2ZZ0A 1MXTA 3ISHA 4B1BA 3RP7A 4C5OA 3T0KA 1IJHA 1EL7A 1CF3A 3E1TA 1KDGA 1CC4A 3VRBA 1BF3A 3GMBA 1H83A 2YR4A 4J2WA 2YVGA 2BXSA 1PBBA 5JRBA 2WPEA 5JCNA 1E7PA 5CKUA 1IUWA 4EQWA 2WS3A 3LJPA 1H7WA 2WBAA 3UKQA 4JDRA 4CY6A 5IQ4A 2WHDA 5C2TA 1KFYA 5JCLA 2X8HA 3AE7A 1EL9A 3B6DA 1OJCA 2XVFA 3IF9A 3DA1A 4LU6A 2ZZBA 3K7MX 2H89A 2ZBWA 3AYJA 3P4RA 1PBEA 4J56A 4B66A 4FK1A 1NG3A 4Y4LA 4AP1A 1NEKA 2XDOA 2H88A 3OC4A 2GVCA 4G73A 2VQ7A 1E1NA 5BUKA 1N4UA 2RGJA 1FECA 3DK4A 1CJ4A 2APGA 2B9YA 3PO7A 2C75A 4Z26A 5KVIA 4H4VA 1DOBA 3NNEA 1BKWA 2GMHA 3P4QA 4IVMB 4GAPA 4GAVA 1D4CA 5KOXA 1NHPA 3GRSA 3GDNA 4OVIA 2R4EA 4H4XA 3DJDA 2VVLG 4EQXA 2WESA 4O5UA 3SZ0A 1F8SA 4U8KA 1CBOA 2ACZA 2JB3A 3GDPA 1TYTA 1B8SA 3NT6A 1BWCA 2X8CA 1E39A 4CCQA 3P9UA 1H81A 2DKHA 4K2XA 1D7YA 5HY5A 4XWRA 3RHAA 2X8GA 2XVIA 4JN9A 2IVDA 4X4JA 2Z5XA 3FIMB 4OPUA 1FOHA 1QJDA 2B9WA 5HXIA 3D1CA 1GRTA 2GB0A 3UKHA 1NG4A 4K7ZA 1XPQA 4OPLA 2GR1A 1YKJA 1VQWA 3IWAA 4YKFA 4UP3A 3EANA 4H50A 1SEZA 4GDEA 1B4VA 3II4A 1LQTA 5KMRA 3KD9A 1K4QA 4X9MA 3NLCA 1KNPA 1CC2A 4XXGA 2RGOA 2GV8A 1ZMCA 1K0IA 2BYBA 2C70A 5KRQA 2YLSA 3NG7X 2R45A 2CDUA 5FMHA 4CNJA 1IUSA 2WOWA 4D04A 2CFYA 2XLTA 2GMJA 3UTGA 3CTYA 4C3XA 1N4VA 3AXBA 3T31A 3R9UA 3GSIA 3AYIA 4NTEA 4C3YA 5M10A 2YM2A 3SXIA 2BABA 4H4RA 1TDFA 3C4NA 3AB1A 5KWFA 5L46A 2YM1A 3AE6A 3ZYXA 2WDVA 2WPFA 2QA1A 1GRBA 2V61A 3RP8A 1X31B 3CNSA 2IIDA 4ZCDA 2GH5A 1PXBA 4HA6A 2C72A 2WU2A 4NZHA 3FMWA 2Y6RA 3NRNA 1NAAA 2YLZA 1NDAA 2JAEA 1IUXA 1GREA 2RGHA 1E1MA 2XVEA 3FPZA 3QSMA 3T2ZA 4A5LA 4AOXA 3BNMA 3ICTA 2WU5A 3C96A 1FEAA 1O5WA 4K8DA 5FS6A 3KU9A 2Q7VA 1GRFA 2DKIA 3ALJA 3AE3A 5DBJA 1D4EA 2XYOA 2BA9A 2YQUA 2WP5A 3AD8B 4RSLA 4YKGA 4D03A 3CNDA 3GD3A 2EQ6A 5FS8A 1N1PA 4ADWA 1EBDA 4JNAA 3SX6A 1MOKA 3UOYA 1PBCA 3BHKA 3K7TA 1TDKA 2BK3A 1NHQA 1VRQB 1IUVA 5JCIA 1LQUA 5FS9A 2AQJA 4I58A 4OPDA 1Y56A 1ZKQA 2VQBA 3UCLA 1TDOA 4YSXA 4APNA 1H6VA 4I59A 2GAHB 1F8WA 3KPFA 4H2QA 1EL5A 4Y4MA 1DJQA 4J33A 4B64A 5EBKA 4YWOA 4GUVA 1H82A 3NK2X 4BK3A 3UOVA 3AE8A 1KSUA 1PJ6A 2BRAA 2FJDA 3VR8A 1DODA 2BCGG 4II3A 5GSNA 2B7SA 2VRLA 4EQSA 2BK5A 1ZK7A 1ZOVA 4EIQA 2YWLA 4C77A 5KNLA 1PHHA 3IC9A 2WDRA 2NPXA 1D4DA 2B76A 2VVLA 2BXRA 3NGCX 4EMWA 2E1MA 2RABA 3CPJG 2R4JA 4K5SA 1JRXA 1N4WA 4U2LA 2VOUA 1E1LA 3NIXA 1NENA 1JRYA 2XCGA 4REKA 4U8OA 4TLZA 3T14A 4AT0A 1RSGA 3M13A 3ICSA 2VRMA 5HYMA 3SY4A 4H4PA 1V59A 4USRA 2WEUA 3Q6JA 2PYXA 3DJJA 3QFBA 2A8XA 1XDIA 4FDCB 1HYUA 1Q9IA 2YG7A 3UKLA 2WOIA 4YSYA 2BS3A 1PBDA 5J7XA 4Z24A 3SZFA 4J57A 1GRHA 3P4PA 1CJ2A 4DGKA 4H2RA 3UTFA 4H4YA 3EAOA 5JCMA 4CBQA 3AEAA 3VR9A 2Q6UA 3NYCA 1H84A 4EMJA 4A9WA 1AOGA 1YQZA 2XVJA 4EM4A 2EQ8A 3UP4A 1L9EA 2V6OA 1VG9A 1GESA 3LZXA 3NN0X 5J60A 1DOCA 3KKJA 2WDQA 3ATQA 4H2NA 3IHGA 3LZWA 4OPGA 1B37A 1KNRA 2YR6A 4RG4A 4RG3A 2C64A 3G5SA 4TM0A 4YTMA 3LADA 3ATRA 3M0OA 1H2IA 1KN0A 5KOWA 1CC6A 3AEBA 3CIRA 3F8DA 3NHOX 3DGZA 3GWDA 4YTNA 1RYIA 5EOWA 1E1KA 1F6MA 4KPRA 2Z5YA 3GWFA 4B63A 1K0JA 1S3BA 3QSEA 2CVJA 4H7UA 1UKVG 3CGDA 3D9XA 1PBFA 4HB9A 3EPTA 3LB8A 3IHMA 4G74A 4WX1A 3AYLA 3CPIG 2FJEA 3BNUA 4G9KA 2UZZA 3AE4A 4ECHA 1JEHA 4OPIA 5KMQA 1JOAA 3CGEA 1GRAA 4JQ9A 4CCRA 2X3NA 4GF7A 3PVCA 3SQPA 3VQRA 1DNCA 1IUTA 1TDNA 4FX9A 3AEEA 3V3OA 2XFPA 1Y0PA 3QVPA 1PJ7A 1BGJA 3UKPA 3I3LA 2B9XA 2EQ9A 3DJGX 4H4SA 1GOSA 2C4CA 4NTCA 5BRTA 4NEVA 3K30A 2YR5A 4Z2UA 3CPHG 3GYXA 1GERA 4K5RA 4TLXA 2GRTA 4H4WA 1FL2A 3AE9A 5BULA 2YAUA 1ZP0A 4EMIA 3NTAA 3BHFA 4U2SA 1F3PA 1P2HA 2YLTA 5EB4A 2AAQA 1CJCA 2YLXA 5HHFA 4TM4A 2C3CA 4BURA 1YQ4A 1DXLA 2YG5A 2IVEA 4H4TA 3AECA 4U8IA 2FJAA 2BC0A 2C76A 1COYA 1GALA 5GRTA 1BGNA 3UKKA 1DJNA 1Q1RA 4GRTA 4M52A 1W4XA 4C74A 2JBVA 1OJTA 1H7XA 2BRYA 3L8KA 3T37A 4TM1A 4AT2A 1S2YA 3I6DA 4N9XA 3GYIA 2XLUA 1TDEA 3CMMA 2B7RA 5KVHA 5U25A 1CJ3A 2JB1A 3NTDA 1DOEA 1ELIA 3FBSA 4EM3A 1JU2A 1O95A 3ALLA 3DK9A 4WCTA 3RP6A 3UOZA 4DSGA 3VRDB 2XFQA 3UKFA 3QVRA 3NH3X 5C3JA 1E6EA 3P4SA 2BCPA 5BVAA 4OCGA 2VVMA 3V3NA 2TMDA 3HZLA 4U8MA 2YLWA 1OJ9A 1GT8A 4Z25A 2OLOA 4G6HA 2C3DA 1S7MA 5ER0A 2JKCA 3DJEA 3B3RA 1ZOYA 4IVOB 5KMPA 5IPYA 3H8IA 4X9NA 1BZLA 1FEBA 2EQ7A 2E4GA 1H86A 2C66A 5LV9A 3HYXA 2Q0KA 1QLBA 1PN0A 1Y56B 3UP5A 1P2EA 2FJBA 1PJ5A 2YLRA 2TPRA 3CNTA 4GR1A 4ZN0A 4YTPA 1LTXR 2BC1A 4U8JA 2YG6A 4GCMA 1PXAA 2QCUA 4JY3A 3L1RA 2OA1A 3NYEA 3NYFA 1FCDA 1PXCA 4J36A 3AD7B 3VRAA 1KSSA 2XFUA 2NVKX 4IV9A 1LVLA 4B67A 3ZDNA 2WOVA 1XHCA 2V3BA 2Y6QA 1KF6A 3P1WA 4B68A 4TM3A 4USQA 3K7QX 3AEDA 2R0GA 3UOXA 2F5ZA 1RP0A 1VDCA 3ABVA 3NN6X 3DH9A 4GDPA 3BI2A 4PAAA 1D5TA 4NWZA 4A65A 2GEWA 2QA2A 3AE5A 5U1OA 4YSZA 5KXJA 4YXDA 3BI5A 3KA7A 1GNDA 2GQWA 3S5WA 3JSKA 2V3AA 3QJ4A 5IQ1A 3ITJA 3LXDA 1REOA 1LPFA 2BACA 3RNMA 3M12A 2YVFA 3QSSA 3CNPA 4PABA 3PS9A 3T2KA 3REDA 1ZX9A 1QO8A 2XLPA 2BS4A 2GF3A 4BK1A 1NHRA 3O0HA 3C4AA 1OJAA 2X50A 4UDQA 2R9ZA 4DSHA 5FS7A 1EL8A 1ZDLA 4H4QA 4OPTA 3DMEA 3L5OA 4A79A 4IA6A 1PDHA 3UKAA 3COXA 3HYWA 4P9SA 3OZ2A 4O5QA 4Z43A 2GQFA 1JNRA 1VG0A 2QAEA 1M64A 2C7GA 4BJYA 4CY8A 1YQ3A 3AE1A 2Q0LA 2I0ZA 4UDPA 3UTEA 3AWIA 3URHA 4JY2A 4KX6A 2XLRA 5JCKA 1TRBA 1O94A 1D7LA 1GPEA 2O9ZA 2WPCA 3NKSA 3WE0A 4B69A 3UTHA 4ICYA 2OAMA 1GXFA 4H2PA 2BK4A 3QFAA 4U8NA 2R0CA 4JNQA 3DGHA 2YG3A 4II2A 3GRTA 2JB2A 3S61A 2A87A 2WETA 3GMCA 2CULA 4Z2TA 1Z6LA 3ALMA 5M0ZA 1S2QA 1GTHA 4YSHA 4OPCA 4NNJA 1L9CA 1TYPA 4J34A 3V76A 3LOVA 4K22A 2GR2A 1IUUA 1S3EA 2ARDA 2OLNA 1L0VA 3BI4A 2X99A 4XWZA 2YVJA 4CRTA 2XFNA 3NK1X 3H8LA 4U8LA 3ADAB 3G5RA 3FG2P 3KLJA 2WP9A 5KMSA 1GTEA 3SGLA 3SM8A 1NPXA 3H4KA 1L9DA 3NK0X 2R0PA 4LIIA 3Q9TA 3SYIA 1M6IA 4UDRA 5CQFA 4A7AA 3HYVA 4Z44A 1PS9A 3G5QA 4U2TA 3CGBA 1OJDA 3F8RA 3KPKA 3KVEA 3CNJA 1XANA 1GSNA 4G6GA 4AOSA 4B65A 2AR8A 5EB5A 4NTDA 4U8PA 2GR3A 5TR3A 4LA1A 2V60A 2WQYA 4Y4NA 4BV6A 4H4ZA 4ZCCA 1ZMDA 4A6NA 4IA5A 1F8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BJZ A;  1GV4 A;  2GAG B;  4AP3 A;  3F8P A;  1JNZ A;  3CGC A;  2OAL A;  3AD9 B;  2YG4 A;  3D8X A;  5U63 A;  2VZ2 A;  2A89 A;  1GEU A;  3ICR A;  1ZY8 A;  4CNK A;  1NHS A;  1GRG A;  3AE2 A;  1K0L A;  4EQR A;  4A99 A;  3AEG A;  3GYJ A;  4FK1 C;  2XFO A;  4DNA A;  2HQM A;  4Z2R A;  1Q1W A;  2C67 A;  2R46 A;  2C73 A;  4YT0 A;  4H4U A;  4NEW A;  2FBW A;  4A6N B;  4BK2 A;  3CN8 A;  1LJ1 A;  1CL0 A;  2BS2 A;  2GR0 A;  1JRZ A;  1YY5 A;  4E0V A;  4MJW A;  2PHH A;  2ZZC A;  1LV0 A;  3DK8 A;  2C65 A;  1ONF A;  2XVH A;  1B5Q A;  3AEF A;  3EF6 A;  2E5V A;  2J3N A;  1GET A;  1MO9 A;  4J31 A;  2V5Z A;  2XLS A;  2JK6 A;  2WP6 A;  3SFD A;  3SFE A;  4EIP A;  1CHU A;  3GD4 A;  2W0H A;  2ZZ0 A;  1MXT A;  3ISH A;  4B1B A;  3RP7 A;  4C5O A;  1IJH A;  1EL7 A;  1CF3 A;  3E1T A;  1KDG A;  1CC4 A;  3VRB A;  1BF3 A;  3GMB A;  1H83 A;  2YR4 A;  4J2W A;  2YVG A;  2BXS A;  1PBB A;  2WPE A;  5JCN A;  1E7P A;  5CKU A;  1IUW A;  4EQW A;  2WS3 A;  3LJP A;  1H7W A;  2WBA A;  3UKQ A;  4JDR A;  4CY6 A;  5IQ4 A;  2WHD A;  5C2T A;  1KFY A;  5JCL A;  2X8H A;  3AE7 A;  1EL9 A;  3B6D A;  1OJC A;  2XVF A;  3IF9 A;  3DA1 A;  4LU6 A;  2ZZB A;  3K7M X;  2H89 A;  2ZBW A;  3AYJ A;  3P4R A;  1PBE A;  4J56 A;  4B66 A;  4FK1 A;  1NG3 A;  4Y4L A;  4AP1 A;  1NEK A;  2XDO A;  2H88 A;  3OC4 A;  2GVC A;  2VQ7 A;  1E1N A;  5BUK A;  1N4U A;  2RGJ A;  1FEC A;  3DK4 A;  1CJ4 A;  2APG A;  2B9Y A;  3PO7 A;  2C75 A;  4Z26 A;  5KVI A;  4H4V A;  1DOB A;  3NNE A;  1BKW A;  2GMH A;  3P4Q A;  4IVM B;  1D4C A;  5KOX A;  1NHP A;  3GRS A;  3GDN A;  4OVI A;  2R4E A;  4H4X A;  3DJD A;  2VVL G;  4EQX A;  2WES A;  4O5U A;  1F8S A;  4U8K A;  1CBO A;  2ACZ A;  2JB3 A;  3GDP A;  1TYT A;  1B8S A;  3NT6 A;  1BWC A;  2X8C A;  1E39 A;  4CCQ A;  3P9U A;  1H81 A;  2DKH A;  4K2X A;  1D7Y A;  5HY5 A;  4XWR A;  3RHA A;  2X8G A;  2XVI A;  4JN9 A;  2IVD A;  4X4J A;  2Z5X A;  3FIM B;  4OPU A;  1FOH A;  1QJD A;  2B9W A;  5HXI A;  3D1C A;  1GRT A;  2GB0 A;  3UKH A;  1NG4 A;  4K7Z A;  1XPQ A;  4OPL A;  2GR1 A;  1YKJ A;  1VQW A;  3IWA A;  4YKF A;  4UP3 A;  3EAN A;  4H50 A;  1SEZ A;  4GDE A;  1B4V A;  3II4 A;  1LQT A;  3KD9 A;  1K4Q A;  4X9M A;  3NLC A;  1KNP A;  1CC2 A;  4XXG A;  2RGO A;  2GV8 A;  1ZMC A;  1K0I A;  2BYB A;  2C70 A;  5KRQ A;  2YLS A;  3NG7 X;  2R45 A;  2CDU A;  5FMH A;  4CNJ A;  1IUS A;  2WOW A;  4D04 A;  2CFY A;  2XLT A;  2GMJ A;  3UTG A;  3CTY A;  4C3X A;  1N4V A;  3AXB A;  3R9U A;  3GSI A;  3AYI A;  4NTE A;  4C3Y A;  5M10 A;  2YM2 A;  2BAB A;  4H4R A;  1TDF A;  3C4N A;  3AB1 A;  5KWF A;  5L46 A;  2YM1 A;  3AE6 A;  3ZYX A;  2WDV A;  2WPF A;  2QA1 A;  1GRB A;  2V61 A;  3RP8 A;  1X31 B;  3CNS A;  2IID A;  4ZCD A;  2GH5 A;  1PXB A;  4HA6 A;  2C72 A;  2WU2 A;  4NZH A;  3FMW A;  2Y6R A;  3NRN A;  1NAA A;  2YLZ A;  1NDA A;  2JAE A;  1IUX A;  1GRE A;  2RGH A;  1E1M A;  2XVE A;  3FPZ A;  3QSM A;  4A5L A;  4AOX A;  3BNM A;  3ICT A;  2WU5 A;  3C96 A;  1FEA A;  1O5W A;  4K8D A;  5FS6 A;  3KU9 A;  2Q7V A;  1GRF A;  2DKI A;  3ALJ A;  3AE3 A;  5DBJ A;  1D4E A;  2XYO A;  2BA9 A;  2YQU A;  2WP5 A;  3AD8 B;  4RSL A;  4YKG A;  4D03 A;  3CND A;  3GD3 A;  2EQ6 A;  5FS8 A;  1N1P A;  4ADW A;  1EBD A;  4JNA A;  3UOY A;  1MOK A;  1PBC A;  3BHK A;  3K7T A;  1TDK A;  2BK3 A;  1NHQ A;  1VRQ B;  1IUV A;  5JCI A;  1LQU A;  5FS9 A;  2AQJ A;  4I58 A;  4OPD A;  1Y56 A;  1ZKQ A;  2VQB A;  3UCL A;  1TDO A;  4YSX A;  4APN A;  1H6V A;  4I59 A;  2GAH B;  1F8W A;  3KPF A;  4H2Q A;  1EL5 A;  4Y4M A;  1DJQ A;  4J33 A;  4B64 A;  5EBK A;  4YWO A;  4GUV A;  1H82 A;  3NK2 X;  4BK3 A;  3UOV A;  3AE8 A;  1KSU A;  1PJ6 A;  2FJD A;  3VR8 A;  1DOD A;  2BCG G;  5GSN A;  2B7S A;  2VRL A;  4EQS A;  2BK5 A;  1ZK7 A;  1ZOV A;  4EIQ A;  2YWL A;  4C77 A;  1PHH A;  3IC9 A;  2WDR A;  2NPX A;  1D4D A;  2B76 A;  2VVL A;  2BXR A;  3NGC X;  4EMW A;  2E1M A;  2RAB A;  3CPJ G;  2R4J A;  4K5S A;  1JRX A;  1N4W A;  4U2L A;  2VOU A;  1E1L A;  3NIX A;  1NEN A;  1JRY A;  2XCG A;  4REK A;  4U8O A;  4TLZ A;  4AT0 A;  1RSG A;  3M13 A;  3ICS A;  2VRM A;  5HYM A;  4H4P A;  1V59 A;  4USR A;  2WEU A;  3Q6J A;  2PYX A;  3DJJ A;  3QFB A;  2A8X A;  1XDI A;  4FDC B;  1HYU A;  1Q9I A;  2YG7 A;  3UKL A;  2WOI A;  4YSY A;  2BS3 A;  1PBD A;  5J7X A;  4Z24 A;  4J57 A;  1GRH A;  3P4P A;  1CJ2 A;  4DGK A;  4H2R A;  3UTF A;  4H4Y A;  3EAO A;  5JCM A;  4CBQ A;  3AEA A;  3VR9 A;  2Q6U A;  3NYC A;  1H84 A;  4EMJ A;  4A9W A;  1AOG A;  1YQZ A;  2XVJ A;  4EM4 A;  2EQ8 A;  3UP4 A;  1L9E A;  2V6O A;  1VG9 A;  1GES A;  3LZX A;  3NN0 X;  5J60 A;  1DOC A;  3KKJ A;  2WDQ A;  3ATQ A;  4H2N A;  3IHG A;  3LZW A;  4OPG A;  1B37 A;  1KNR A;  2YR6 A;  4RG4 A;  4RG3 A;  2C64 A;  3G5S A;  4TM0 A;  4YTM A;  3LAD A;  3ATR A;  3M0O A;  5KOW A;  1CC6 A;  3AEB A;  3CIR A;  3F8D A;  3NHO X;  3DGZ A;  3GWD A;  4YTN A;  1RYI A;  5EOW A;  1E1K A;  1F6M A;  4KPR A;  2Z5Y A;  3GWF A;  4B63 A;  1K0J A;  1S3B A;  3QSE A;  2CVJ A;  4H7U A;  1UKV G;  3CGD A;  1PBF A;  4HB9 A;  3EPT A;  3LB8 A;  3IHM A;  4WX1 A;  3AYL A;  3CPI G;  2FJE A;  3BNU A;  2UZZ A;  3AE4 A;  4ECH A;  1JEH A;  4OPI A;  1JOA A;  3CGE A;  1GRA A;  4JQ9 A;  4CCR A;  2X3N A;  4GF7 A;  3PVC A;  3SQP A;  3VQR A;  1DNC A;  1IUT A;  1TDN A;  4FX9 A;  3AEE A;  3V3O A;  2XFP A;  1Y0P A;  3QVP A;  1PJ7 A;  1BGJ A;  3UKP A;  3I3L A;  2B9X A;  2EQ9 A;  3DJG X;  4H4S A;  1GOS A;  4NTC A;  5BRT A;  4NEV A;  3K30 A;  2YR5 A;  4Z2U A;  3CPH G;  4K5R A;  1GER A;  4TLX A;  2GRT A;  4H4W A;  1FL2 A;  3AE9 A;  5BUL A;  2YAU A;  1ZP0 A;  4EMI A;  3NTA A;  3BHF A;  4U2S A;  1F3P A;  1P2H A;  2YLT A;  5EB4 A;  2AAQ A;  1CJC A;  2YLX A;  5HHF A;  4TM4 A;  2C3C A;  4BUR A;  1YQ4 A;  1DXL A;  2YG5 A;  2IVE A;  4H4T A;  3AEC A;  4U8I A;  2FJA A;  2BC0 A;  2C76 A;  1COY A;  1GAL A;  5GRT A;  1BGN A;  3UKK A;  1DJN A;  1Q1R A;  4GRT A;  4M52 A;  1W4X A;  4C74 A;  2JBV A;  1OJT A;  1H7X A;  3L8K A;  3T37 A;  4TM1 A;  4AT2 A;  1S2Y A;  3I6D A;  4N9X A;  3GYI A;  2XLU A;  1TDE A;  2B7R A;  5KVH A;  5U25 A;  1CJ3 A;  2JB1 A;  3NTD A;  1DOE A;  1ELI A;  3FBS A;  4EM3 A;  1JU2 A;  1O95 A;  3ALL A;  3DK9 A;  4WCT A;  3RP6 A;  3UOZ A;  4DSG A;  3VRD B;  2XFQ A;  3UKF A;  3QVR A;  3NH3 X;  5C3J A;  1E6E A;  3P4S A;  2BCP A;  5BVA A;  4OCG A;  2VVM A;  3V3N A;  2TMD A;  3HZL A;  4U8M A;  2YLW A;  1OJ9 A;  1GT8 A;  4Z25 A;  2OLO A;  2C3D A;  5ER0 A;  2JKC A;  3DJE A;  3B3R A;  1ZOY A;  4IVO B;  5IPY A;  3H8I A;  4X9N A;  1BZL A;  1FEB A;  2EQ7 A;  2E4G A;  1H86 A;  2C66 A;  5LV9 A;  2Q0K A;  1QLB A;  1PN0 A;  1Y56 B;  3UP5 A;  1P2E A;  2FJB A;  1PJ5 A;  2YLR A;  2TPR A;  3CNT A;  4GR1 A;  4ZN0 A;  4YTP A;  1LTX R;  2BC1 A;  4U8J A;  2YG6 A;  4GCM A;  1PXA A;  2QCU A;  4JY3 A;  3L1R A;  2OA1 A;  3NYE A;  3NYF A;  1FCD A;  1PXC A;  4J36 A;  3AD7 B;  3VRA A;  1KSS A;  2XFU A;  2NVK X;  4IV9 A;  1LVL A;  4B67 A;  3ZDN A;  2WOV A;  1XHC A;  2V3B A;  2Y6Q A;  1KF6 A;  3P1W A;  4B68 A;  4TM3 A;  4USQ A;  3K7Q X;  3AED A;  2R0G A;  3UOX A;  2F5Z A;  1RP0 A;  1VDC A;  3ABV A;  3NN6 X;  3DH9 A;  4GDP A;  3BI2 A;  4PAA A;  1D5T A;  4A65 A;  2GEW A;  2QA2 A;  3AE5 A;  5U1O A;  4YSZ A;  5KXJ A;  4YXD A;  3BI5 A;  3KA7 A;  1GND A;  2GQW A;  3S5W A;  3JSK A;  2V3A A;  3QJ4 A;  5IQ1 A;  3ITJ A;  3LXD A;  1REO A;  1LPF A;  2BAC A;  3RNM A;  3M12 A;  2YVF A;  3QSS A;  3CNP A;  4PAB A;  3PS9 A;  3RED A;  1ZX9 A;  1QO8 A;  2XLP A;  2BS4 A;  2GF3 A;  4BK1 A;  1NHR A;  3O0H A;  3C4A A;  1OJA A;  2X50 A;  4UDQ A;  2R9Z A;  4DSH A;  5FS7 A;  1EL8 A;  1ZDL A;  4H4Q A;  4OPT A;  3DME A;  4A79 A;  4IA6 A;  1PDH A;  3UKA A;  3COX A;  4P9S A;  3OZ2 A;  4O5Q A;  4Z43 A;  2GQF A;  1JNR A;  1VG0 A;  2QAE A;  1M64 A;  2C7G A;  4BJY A;  4CY8 A;  1YQ3 A;  3AE1 A;  2Q0L A;  2I0Z A;  4UDP A;  3UTE A;  3AWI A;  3URH A;  4JY2 A;  4KX6 A;  2XLR A;  5JCK A;  1TRB A;  1O94 A;  1D7L A;  1GPE A;  2O9Z A;  2WPC A;  3NKS A;  3WE0 A;  4B69 A;  3UTH A;  4ICY A;  2OAM A;  1GXF A;  4H2P A;  2BK4 A;  3QFA A;  4U8N A;  2R0C A;  4JNQ A;  3DGH A;  2YG3 A;  3GRT A;  2JB2 A;  3S61 A;  2A87 A;  2WET A;  3GMC A;  2CUL A;  4Z2T A;  1Z6L A;  3ALM A;  5M0Z A;  1S2Q A;  1GTH A;  4YSH A;  4OPC A;  1L9C A;  1TYP A;  4J34 A;  3V76 A;  3LOV A;  4K22 A;  2GR2 A;  1IUU A;  1S3E A;  2ARD A;  2OLN A;  1L0V A;  3BI4 A;  2X99 A;  4XWZ A;  2YVJ A;  4CRT A;  2XFN A;  3NK1 X;  3H8L A;  4U8L A;  3ADA B;  3G5R A;  3FG2 P;  3KLJ A;  2WP9 A;  1GTE A;  3SGL A;  3SM8 A;  1NPX A;  3H4K A;  1L9D A;  3NK0 X;  2R0P A;  4LII A;  3Q9T A;  1M6I A;  4UDR A;  5CQF A;  4A7A A;  4Z44 A;  1PS9 A;  3G5Q A;  4U2T A;  3CGB A;  1OJD A;  3F8R A;  3KVE A;  3CNJ A;  1XAN A;  1GSN A;  4B65 A;  4AOS A;  2AR8 A;  5EB5 A;  4NTD A;  4U8P A;  2GR3 A;  5TR3 A;  4LA1 A;  2V60 A;  2WQY A;  4Y4N A;  4BV6 A;  4H4Z A;  4ZCC A;  1ZMD A;  4A6N A;  4IA5 A;  1F8R A; 
#chains in the Genus database with same CATH topology
 4HCH A;  3NXL A;  1JNZ A;  4G8T A;  4CNK A;  1GRG A;  3GYJ A;  1MUC A;  4K2S A;  4YT0 A;  4BK2 A;  2BS2 A;  1JRZ A;  4E0V A;  2ZZC A;  1LV0 A;  1ONF A;  3AEF A;  4ZCW A;  2E5V A;  2J3N A;  1GET A;  2V5Z A;  3NS1 B;  5IDZ A;  2PU1 A;  4B1B A;  3NZG A;  2AKZ A;  1CF3 A;  4J1O A;  2PP3 A;  5JCN A;  2WHD A;  1KFY A;  3B6D A;  1MNS A;  3DA1 A;  4LU6 A;  2ZZB A;  4HCD A;  4B66 A;  4EWJ A;  2VQ7 A;  1E1N A;  5BUK A;  1W6T A;  3DK4 A;  2APG A;  2C75 A;  1DOB A;  2OG9 A;  3P4Q A;  4GAV A;  1D4C A;  3P93 A;  1NHP A;  3B97 A;  3GDN A;  3DJD A;  4H19 A;  2VVL G;  3SQS A;  2ACZ A;  2JB3 A;  2X8C A;  2DKH A;  4XWR A;  2XVI A;  4JN9 A;  4X4J A;  1FOH A;  2B9W A;  5HXI A;  1GRT A;  2PTX A;  4JHM A;  4K7Z A;  1SEZ A;  3KD9 A;  3R11 A;  3RRA A;  1CC2 A;  3MUC A;  2BYB A;  5KRQ A;  3UTG A;  3T31 A;  3GSI A;  3C4N A;  4IHC A;  2YM1 A;  2WDV A;  3CNS A;  1PXB A;  1MRA A;  2WU2 A;  2PU0 A;  4NZH A;  4IL0 A;  3DGB A;  2YLZ A;  3RO6 A;  3TQP A;  3C96 A;  1FEA A;  3DG6 A;  2POZ A;  2OZ3 A;  3H8A A;  1D4E A;  2YQU A;  2WP5 A;  1MDR A;  1YEY A;  5FS8 A;  4JNA A;  4ADW A;  1EBD A;  3CAW A;  4GGH A;  2OO6 A;  3UCC A;  1NHQ A;  1VRQ B;  5ENL A;  4OPD A;  2GAH B;  4Y4M A;  1EL5 A;  1DJQ A;  2XH0 A;  4B64 A;  4BK3 A;  3D47 A;  3VR8 A;  2BCG G;  2VRL A;  1PHH A;  2WDR A;  2BXR A;  3IJL A;  2E1M A;  4GIR A;  3TTE A;  3CPJ G;  1N4W A;  3NVY B;  4U2L A;  1E1L A;  3NIX A;  3SJN A;  3V4B A;  3SSZ A;  1TKK A;  4AT0 A;  1V59 A;  3DEQ A;  3Q6J A;  3DJJ A;  2A8X A;  4FDC B;  1HYU A;  3UKL A;  2BS3 A;  4Z24 A;  4KEM A;  3SZF A;  3EKG A;  2E5A A;  1H84 A;  4EMJ A;  2V6O A;  1VG9 A;  3NN0 X;  3LZX A;  4H2N A;  4Z2R A;  3IHG A;  2C64 A;  4YTM A;  3G5S A;  3SR6 B;  5FJT A;  1RYI A;  5EOW A;  1F6M A;  2GGG A;  4KPR A;  2Z5Y A;  1K0J A;  4IP4 A;  4DN1 A;  3LB8 A;  3R25 A;  4G9K A;  2XSX A;  3AE4 A;  1JEH A;  5KMQ A;  1JOA A;  2O56 A;  1IUT A;  1BGJ A;  3UKP A;  3PK7 A;  2B9X A;  2EQ9 A;  3DJG X;  4H4S A;  1GER A;  2GRT A;  3AE9 A;  2YAU A;  2QJM A;  4HCL A;  5EB4 A;  1JCT A;  4H4T A;  2FJA A;  1GAL A;  3UJ2 A;  4GRT A;  3VA8 A;  4E6M A;  3GYI A;  5U25 A;  3TW9 A;  3FBS A;  4WCT A;  3UOZ A;  2W3S A;  3P4S A;  5BVA A;  2VVM A;  4U8M A;  1GT8 A;  4Z25 A;  4M0X A;  3B3R A;  5IPY A;  1BKH A;  3T6C A;  3HYX A;  1PJ5 A;  3CK5 A;  1R6W A;  4ZN0 A;  3ES8 A;  2QCU A;  3NYE A;  1FCD A;  3AD7 B;  3VRA A;  2XFU A;  2NVK X;  4B68 A;  1KF6 A;  3UJE A;  4USQ A;  3K7Q X;  1F9C A;  3UOX A;  3BI2 A;  4PAA A;  2QA2 A;  4YSZ A;  5U1O A;  1GND A;  2GQW A;  2PGE A;  1STZ A;  1VDV A;  3ITJ A;  3M12 A;  3HW2 A;  3ENL A;  1QO8 A;  3CT2 A;  2PSN A;  4K1W A;  2HXU A;  4UDQ A;  1EL8 A;  5J04 A;  1ZDL A;  4H4Q A;  3DME A;  3QLD A;  1PDH A;  4P9S A;  1VG0 A;  3R07 C;  1YQ3 A;  3AWI A;  4JY2 A;  3QFA A;  2R0C A;  4JNQ A;  4E4F A;  2A87 A;  4Z2T A;  1Z6L A;  3ALM A;  1JPM A;  1L9C A;  2GGH A;  3LOV A;  2XGZ A;  1L0V A;  2HZG A;  3BI4 A;  2YVJ A;  1TE6 A;  3NK1 X;  3G5R A;  3FG2 P;  3KLJ A;  1GTE A;  3SM8 A;  1NPX A;  3H4K A;  3VCC A;  1PS9 A;  3CGB A;  4G6G A;  1XAN A;  4B65 A;  4NTD A;  2GR3 A;  2WQY A;  2I0Z A;  4ZCC A;  5HHF A;  3SZW A;  1GV4 A;  2GAG B;  4AP3 A;  3F8P A;  2XH4 A;  3CGC A;  2A89 A;  1GEU A;  3ICR A;  3TWA A;  3AE2 A;  4A99 A;  2OQH A;  4MKS A;  2C67 A;  2R46 A;  2C73 A;  4H4U A;  4A3R A;  3JZU A;  1YY5 A;  3TCS A;  1ECQ A;  2PHH A;  3K1G A;  2C65 A;  3OPS A;  4J31 A;  1MO9 A;  3SFE A;  2W0H A;  1MXT A;  3ISH A;  3T0K A;  3VRB A;  1BF3 A;  3GMB A;  2YR4 A;  4J2W A;  3FV9 A;  2PP0 A;  1PBB A;  3FXG A;  1IUW A;  4EQW A;  3LJP A;  4CY6 A;  5IQ4 A;  1EC7 A;  5C2T A;  3H7V A;  5JCL A;  3AE7 A;  5FJU A;  3IF9 A;  3P4R A;  1PBE A;  4AP1 A;  1NEK A;  2XDO A;  2H88 A;  2RDX A;  2OZ8 A;  3ZVH A;  2RGJ A;  5KVI A;  1BKW A;  2GMH A;  3GRS A;  4H4X A;  3GDP A;  1BWC A;  1E39 A;  3P9U A;  4K2X A;  1D7Y A;  2Z5X A;  3FIM B;  3UXL A;  3UKH A;  3CB3 A;  1XPQ A;  1VQW A;  3CXB A;  4GDE A;  3II4 A;  1K4Q A;  1KNP A;  4XXG A;  3UJR A;  2RGO A;  2GV8 A;  1ZMC A;  1K0I A;  3NG7 X;  3NO1 A;  5FMH A;  4D04 A;  1XS2 A;  4J3Z A;  1KD0 A;  3R9U A;  4NTE A;  4C3Y A;  5M10 A;  2BAB A;  1TDF A;  5L46 A;  3V5F A;  2WPF A;  1GRB A;  3H70 A;  4ZCD A;  3KUM A;  2Y6R A;  3ES7 A;  3NRN A;  3TWB A;  1NAA A;  2XVE A;  3T2Z A;  3BNM A;  3ICT A;  3DFY A;  1EC8 A;  4K8D A;  3KU9 A;  2Q7V A;  1GRF A;  2BA9 A;  3T8Q A;  4A35 A;  3UOY A;  1MOK A;  2BK3 A;  4I58 A;  2AQJ A;  4YSX A;  1TDO A;  4APN A;  1H6V A;  3KPF A;  3DFH A;  4YWO A;  2FKP A;  1H82 A;  3UOV A;  1KSU A;  4FP1 A;  2FJD A;  2B7S A;  1ZK7 A;  4EIQ A;  4C77 A;  2NPX A;  1D4D A;  2B76 A;  3NGC X;  1ELS A;  4F4R A;  2RAB A;  2R4J A;  1JRX A;  4K8G A;  2PCE A;  1RSG A;  3M13 A;  3ICS A;  3QTP A;  4USR A;  2PYX A;  1Q9I A;  3R0U A;  3CXO A;  5JCM A;  4HYR A;  4JN8 A;  2Q6U A;  4ZOH B;  1JRP A;  3S5S A;  3MWC A;  4EM4 A;  3MSY A;  5J60 A;  1DOC A;  3LZW A;  1B37 A;  4ECH A;  3S47 A;  3AM9 A;  1CC6 A;  3CIR A;  4HN8 A;  3GWD A;  2DW7 A;  4ZA0 A;  3QSE A;  4H7U A;  4HB9 A;  3EPT A;  3AYL A;  4OPI A;  4IL2 A;  2X3N A;  4GF7 A;  3VFC A;  4GYP C;  3PVC A;  3N4E A;  1DNC A;  2OX4 A;  4FX9 A;  3V3O A;  1P48 A;  1Y0P A;  3I3L A;  2C4C A;  2YR5 A;  1ZP0 A;  3BHF A;  1F3P A;  2YLT A;  2AAQ A;  2YLX A;  4TM4 A;  1YQ4 A;  2YG5 A;  3P0W A;  5GRT A;  3UKK A;  3IK4 A;  4KPL A;  2OZT A;  2NQL A;  1Q1R A;  3DES A;  1OEP A;  3T37 A;  4N9X A;  3NTD A;  4EM3 A;  3DK9 A;  3RP6 A;  3UKF A;  3NH3 X;  3GD6 A;  2PMQ A;  2PP1 A;  3EEZ A;  4G6H A;  1S7M A;  5ER0 A;  2JKC A;  1ZOY A;  4IVO B;  5KMP A;  6ENL A;  1BZL A;  3N6J A;  2Q0K A;  2GSH A;  1P2E A;  1JPD X;  1LTX R;  2YG6 A;  4JY3 A;  3UGV A;  1SJB A;  3NYF A;  3OTR A;  4TM3 A;  2F5Z A;  1RP0 A;  2OPJ A;  3ABV A;  4A65 A;  4GYP A;  4YXD A;  1ZXI C;  2P0I A;  3S5W A;  3JSK A;  2V3A A;  3QJ4 A;  2OQY A;  3QSS A;  4DWD A;  3T2K A;  1ZX9 A;  2PA6 A;  1OJA A;  2R9Z A;  1P43 A;  3DDM A;  4A79 A;  4IA6 A;  3UKA A;  3COX A;  3HYW A;  3OZ2 A;  4O5Q A;  1FFU C;  4Z43 A;  2HXT A;  1JNR A;  3STP A;  2W3R A;  1SJD A;  1BQG A;  3URH A;  5JCK A;  1O94 A;  1D7L A;  2WPC A;  3WE0 A;  3UTH A;  4ICY A;  1GXF A;  3U9I A;  2YG3 A;  2JB2 A;  2WET A;  3OP2 A;  2QJN A;  3DIP A;  3GMC A;  5M0Z A;  1GTH A;  3NVV B;  4NNJ A;  4J34 A;  2OLN A;  1WYG A;  3NFU A;  4CRT A;  2XFN A;  4U8L A;  3ADA B;  1FHU A;  3SGL A;  2PTY A;  1SJC A;  1L9D A;  3NK0 X;  3Q9T A;  4GGB A;  4Z44 A;  4A7A A;  4U2T A;  1OJD A;  3KPK A;  3ZLF A;  4LA1 A;  2V60 A;  4BV6 A;  4H4Z A;  3THU A;  4IA5 A;  4BJZ A;  2OAL A;  5U63 A;  2VZ2 A;  2AL1 A;  3N4F A;  3FVD A;  2XFO A;  4DNA A;  2HQM A;  2PPG A;  2FBW A;  3CN8 A;  1CL0 A;  1V97 A;  3ETR B;  4MJW A;  2XVH A;  2XLS A;  2JK6 A;  4EIP A;  1CHU A;  3GD4 A;  2ZZ0 A;  1T3Q C;  3E1T A;  3P3B A;  1H83 A;  5JRB A;  3GY1 A;  1E7P A;  2WS3 A;  3GC2 A;  3H12 A;  1N61 C;  3U4F A;  3VC6 A;  5G5G B;  4X2P A;  2H89 A;  3OC4 A;  2ZC8 A;  1N4U A;  1FEC A;  1CJ4 A;  2B9Y A;  3IJI A;  3NNE A;  4IVM B;  4GAP A;  4OVI A;  2R4E A;  4EQX A;  2WES A;  4O5U A;  3SZ0 A;  1F8S A;  4U8K A;  3R10 A;  1B8S A;  4CCQ A;  1H81 A;  5HY5 A;  1FIQ B;  2X8G A;  2IVD A;  3D1C A;  1NG4 A;  4OPL A;  2GR1 A;  1N60 C;  1YKJ A;  4UP3 A;  1NEL A;  3EAN A;  4H50 A;  2P8B A;  1SJA A;  3NLC A;  2C70 A;  2YLS A;  2QDD A;  2R45 A;  1N5W C;  2CDU A;  2CHR A;  4CNJ A;  2WOW A;  2GMJ A;  2W54 A;  3CTY A;  4C3X A;  3HRD C;  1N4V A;  3AYI A;  1N62 C;  2P8C A;  4H4R A;  5KWF A;  2QA1 A;  2V61 A;  3RP8 A;  1X31 B;  2IID A;  3FMW A;  1VQZ A;  1NDA A;  2JAE A;  1GRE A;  2GGI A;  1E1M A;  2RGH A;  4GIS A;  3FPZ A;  3QSM A;  2WU5 A;  1L8P A;  1O5W A;  3SBF A;  5FS6 A;  3ALJ A;  2DKI A;  5DBJ A;  2ZAD A;  4YKG A;  4RSL A;  2GGJ A;  3GD3 A;  4KWS A;  3K7T A;  3BOX A;  1LQU A;  5FS9 A;  1Y56 A;  3UCL A;  4I59 A;  4H2Q A;  1F8W A;  4DX3 A;  4J33 A;  5EBK A;  3NK2 X;  2BRA A;  1DOD A;  2E3T A;  4MMW A;  4IZG A;  4EQS A;  3V3W A;  3IC9 A;  4EMW A;  4K5S A;  2DW6 A;  3QKE A;  1JRY A;  2OVL A;  2XCG A;  4TLZ A;  3T14 A;  2AL2 B;  5HYM A;  3SY4 A;  4H4P A;  5BOF A;  2WEU A;  3IJQ A;  3R1Z A;  2POD A;  2YG7 A;  4YSY A;  1KKR A;  2WOI A;  7ENL A;  1PBD A;  4J57 A;  1GRH A;  3P4P A;  4DGK A;  4H4Y A;  4CBQ A;  3AEA A;  3VR9 A;  3PFR A;  3NYC A;  3RIT A;  1AOG A;  1YQZ A;  2XVJ A;  2OFJ A;  1KKO A;  3TJI A;  3KKJ A;  4RG3 A;  4RG4 A;  3LAD A;  3ATR A;  3M0O A;  1H2I A;  1KN0 A;  3AEB A;  3BSM A;  3F8D A;  4JN7 A;  3Q4D A;  1UKV G;  3CGD A;  3D9X A;  3IHM A;  3CPI G;  2FJE A;  3DG3 A;  2UZZ A;  3GO2 A;  3SQP A;  4E8G A;  1TDN A;  3QVP A;  1R0M A;  1IYX A;  2QVH A;  4NEV A;  4Z2U A;  3CPH G;  3GYX A;  1FL2 A;  4ROP A;  5BUL A;  1EC9 A;  4EMI A;  1JDF A;  1P2H A;  3NVW B;  1FHV A;  4HNL A;  2C3C A;  4BUR A;  2IVE A;  2C76 A;  2JBV A;  1H7X A;  3L8K A;  3AN1 A;  1N63 C;  4TM1 A;  1JRO A;  1S2Y A;  3SN4 A;  1DOE A;  1ELI A;  3VDG A;  4DHG A;  4TVW A;  5C3J A;  3QPE A;  3V3N A;  2YLW A;  3VC5 A;  2C3D A;  3DJE A;  3BJS A;  3MY9 A;  3Q45 A;  3H8I A;  4X9N A;  4DYE A;  2EQ7 A;  2XH7 A;  4E4U A;  5FJR A;  3SN0 A;  1PN0 A;  2QQ6 A;  1Y56 B;  3UP5 A;  2FJB A;  3CNT A;  2HNE A;  3I4K A;  4YTP A;  2BC1 A;  4U8J A;  1PXA A;  3L1R A;  2OA1 A;  3DG7 A;  1X2G A;  2QDE A;  1EBG A;  2PTZ A;  1XHC A;  2V3B A;  3P1W A;  3NN6 X;  1D5T A;  3AE5 A;  3KA7 A;  1KCZ A;  5IQ1 A;  3LXD A;  1REO A;  1LPF A;  3RNM A;  2P3Z A;  2YVF A;  3RED A;  4Z1Y A;  2X50 A;  2XH2 A;  4DSH A;  5FS7 A;  3L5O A;  2GQF A;  2P88 A;  4GFI A;  1M64 A;  2C7G A;  4BJY A;  4CY8 A;  3AE1 A;  4UDP A;  4KX6 A;  2XLR A;  1TRB A;  1GPE A;  2O9Z A;  4B69 A;  2BK4 A;  4U8N A;  3DGH A;  3GRT A;  3S61 A;  3ZVH B;  2CUL A;  4ENL A;  4YSH A;  1TYP A;  3V76 A;  2GR2 A;  1S3E A;  3UJS A;  2ARD A;  4XWZ A;  4LII A;  4UDR A;  5CQF A;  3G5Q A;  3F8R A;  3KVE A;  3CNJ A;  3A7A A;  4U8P A;  5TR3 A;  2MUC A;  4Y4N A;  3PWI A;  1ZMD A;  3UXK A;  3QN3 A;  3AD9 B;  2YG4 A;  3D8X A;  1ZY8 A;  2MNR A;  1NHS A;  1K0L A;  4EQR A;  3SZC A;  3TOY A;  3AEG A;  4FK1 C;  3T2Y A;  1Q1W A;  4NEW A;  4A6N B;  4KT2 A;  1RM6 B;  1LJ1 A;  2GR0 A;  3PG6 A;  3DK8 A;  1B5Q A;  3EF6 A;  2WP6 A;  3SFD A;  3HPF A;  3UCD A;  3RP7 A;  4C5O A;  1IJH A;  1WUF A;  1EL7 A;  1KDG A;  1CC4 A;  4M6U A;  2YVG A;  3A7R A;  2BXS A;  2WPE A;  5CKU A;  3UKQ A;  1H7W A;  2WBA A;  4JDR A;  1N5X A;  2X8H A;  1EL9 A;  1OJC A;  3MQT A;  2XVF A;  3OZM A;  3D46 A;  3K7M X;  1E9I A;  4IP5 A;  4GME A;  2ZBW A;  3AYJ A;  4J56 A;  4FK1 A;  1NG3 A;  4Y4L A;  5EU9 A;  2GVC A;  4G73 A;  1FFV C;  4A6G A;  3PO7 A;  4Z26 A;  4H4V A;  5KOX A;  3FYY A;  2AKM A;  1CBO A;  1TYT A;  3NT6 A;  4MGG A;  3RHA A;  2FYM A;  4OPU A;  2AL2 A;  1QJD A;  2GB0 A;  2I5Q A;  1NU5 A;  3EUB 3;  3I6T A;  3IWA A;  4YKF A;  1XPY A;  1B4V A;  1LQT A;  5KMR A;  4X9M A;  3A7U A;  3OZY A;  3R0K A;  1IUS A;  2CFY A;  2XLT A;  2GGE A;  3AXB A;  4FI4 A;  2YM2 A;  3SXI A;  3RR1 A;  3AB1 A;  3AE6 A;  3ZYX A;  5BOE A;  3JVA A;  2GH5 A;  3DER A;  2C72 A;  4HA6 A;  2PS2 A;  1IUX A;  4A5L A;  4IT1 A;  4AOX A;  3FCP A;  3AE3 A;  2XYO A;  3AD8 B;  4D03 A;  3CND A;  2EQ6 A;  1N1P A;  3SX6 A;  5FJP A;  1PBC A;  3BHK A;  1TDK A;  4H2H A;  1IUV A;  5JCI A;  2PGW A;  1ZKQ A;  2VQB A;  1ONE A;  4GUV A;  4HNC A;  4G7F A;  3AE8 A;  1PJ6 A;  4HPN A;  4II3 A;  5GSN A;  2BK5 A;  1ZOV A;  5KNL A;  2YWL A;  2VVL A;  1WUE A;  3JW7 A;  3N6H A;  5G5H B;  2OLA A;  2ONE A;  2VOU A;  3I6E A;  1NEN A;  4REK A;  3AMZ A;  4U8O A;  2VRM A;  3MZN A;  3RGT A;  3QFB A;  1XDI A;  5FJO A;  5J7X A;  1CJ2 A;  4H2R A;  3UTF A;  3EAO A;  1FO4 A;  3OW1 A;  4A9W A;  2EQ8 A;  3UP4 A;  1L9E A;  1GES A;  2WDQ A;  3ATQ A;  4OPG A;  2YR6 A;  1KNR A;  4TM0 A;  5KOW A;  1SB3 B;  3NHO X;  3DGZ A;  4YTN A;  1E1K A;  3GWF A;  4B63 A;  1S3B A;  2CVJ A;  1MDL A;  1PBF A;  4G74 A;  4WX1 A;  3BNU A;  4JQ9 A;  2QGY A;  1GRA A;  3CGE A;  4CCR A;  3VQR A;  3FJ4 A;  3AEE A;  2XFP A;  3NRZ B;  1PJ7 A;  1GOS A;  5BRT A;  3K30 A;  4K5R A;  4TLX A;  4H4W A;  3RCY A;  3NTA A;  4U2S A;  1CJC A;  1RVK A;  1DXL A;  3AEC A;  4U8I A;  2BC0 A;  1COY A;  1BGN A;  1DJN A;  4C74 A;  1W4X A;  4M52 A;  1OJT A;  2BRY A;  4AT2 A;  4H1Z A;  3I6D A;  2XLU A;  1TDE A;  3CMM A;  2B7R A;  5KVH A;  1CJ3 A;  2JB1 A;  1TZZ A;  1JU2 A;  1O95 A;  3ALL A;  4DSG A;  3VRD B;  2XFQ A;  3QVR A;  1E6E A;  2BCP A;  4OCG A;  2TMD A;  3HZL A;  1OJ9 A;  2OLO A;  3PWG A;  1FEB A;  2E4G A;  1H86 A;  2C66 A;  5LV9 A;  1QLB A;  2YLR A;  1DTN A;  2TPR A;  3ZVI A;  4GR1 A;  4TVY A;  3ZLG A;  2OKT A;  3NVZ B;  4GCM A;  4Z17 A;  1PXC A;  4J36 A;  1KSS A;  4IV9 A;  1LVL A;  4B67 A;  3ZDN A;  2WOV A;  2Y6Q A;  3T4W A;  3ZLH A;  3AED A;  2R0G A;  3CYJ A;  1VDC A;  3DH9 A;  4GDP A;  4NWZ A;  2GEW A;  3V5C A;  5KXJ A;  3BI5 A;  2PTW A;  4H83 A;  2BAC A;  3CNP A;  4PAB A;  3PS9 A;  3TJ4 A;  2XLP A;  2BS4 A;  2GF3 A;  4BK1 A;  1NHR A;  3O0H A;  3C4A A;  4E5T A;  1X2H A;  3VCN A;  4DXK A;  4OPT A;  2GDQ A;  2QAE A;  2Q0L A;  3UTE A;  3NKS A;  2OAM A;  3T9P A;  4H2P A;  4II2 A;  3UJF A;  1EBH A;  1S2Q A;  4OPC A;  3B9J B;  3MKC A;  1PDZ A;  4K22 A;  1IUU A;  2X99 A;  3H8L A;  2WP9 A;  5KMS A;  3SN1 A;  2R0P A;  3SYI A;  1M6I A;  3HYV A;  1GSN A;  2QJJ A;  4AOS A;  4YWS A;  2AR8 A;  2GL5 A;  5EB5 A;  2W55 A;  4NTC A;  4A6N A;  1PDY A;  1F8R A; 
#chains in the Genus database with same CATH homology
 3SZW A;  4BJZ A;  1GV4 A;  2GAG B;  4AP3 A;  3F8P A;  1JNZ A;  3CGC A;  2OAL A;  3AD9 B;  2YG4 A;  3D8X A;  5U63 A;  2VZ2 A;  2A89 A;  1GEU A;  3ICR A;  1ZY8 A;  4CNK A;  1NHS A;  1GRG A;  3AE2 A;  1K0L A;  4EQR A;  3SZC A;  4A99 A;  3AEG A;  3GYJ A;  4FK1 C;  2XFO A;  4DNA A;  2HQM A;  3T2Y A;  4Z2R A;  1Q1W A;  2C67 A;  2R46 A;  2C73 A;  4YT0 A;  4H4U A;  4NEW A;  2FBW A;  4A6N B;  4BK2 A;  3CN8 A;  1LJ1 A;  1CL0 A;  2BS2 A;  2GR0 A;  1JRZ A;  1YY5 A;  4E0V A;  3PG6 A;  4MJW A;  2PHH A;  2ZZC A;  1LV0 A;  3DK8 A;  2C65 A;  1ONF A;  2XVH A;  1B5Q A;  3AEF A;  3EF6 A;  2E5V A;  2J3N A;  1GET A;  1MO9 A;  4J31 A;  2V5Z A;  2XLS A;  2JK6 A;  2WP6 A;  3SFD A;  3SFE A;  4EIP A;  1CHU A;  3GD4 A;  2W0H A;  2ZZ0 A;  1MXT A;  3ISH A;  4B1B A;  3RP7 A;  4C5O A;  3T0K A;  1IJH A;  1EL7 A;  1CF3 A;  3E1T A;  1KDG A;  1CC4 A;  3VRB A;  1BF3 A;  3GMB A;  1H83 A;  2YR4 A;  4J2W A;  2YVG A;  2BXS A;  1PBB A;  5JRB A;  2WPE A;  5JCN A;  1E7P A;  5CKU A;  1IUW A;  4EQW A;  2WS3 A;  3LJP A;  1H7W A;  2WBA A;  3UKQ A;  4JDR A;  4CY6 A;  5IQ4 A;  2WHD A;  5C2T A;  1KFY A;  5JCL A;  2X8H A;  3AE7 A;  1EL9 A;  3B6D A;  1OJC A;  2XVF A;  3IF9 A;  3DA1 A;  4LU6 A;  2ZZB A;  3K7M X;  2H89 A;  2ZBW A;  3AYJ A;  3P4R A;  1PBE A;  4J56 A;  4B66 A;  4FK1 A;  1NG3 A;  4Y4L A;  4AP1 A;  1NEK A;  2XDO A;  2H88 A;  3OC4 A;  2GVC A;  4G73 A;  2VQ7 A;  1E1N A;  5BUK A;  1N4U A;  2RGJ A;  1FEC A;  3DK4 A;  1CJ4 A;  2APG A;  2B9Y A;  3PO7 A;  2C75 A;  4Z26 A;  5KVI A;  4H4V A;  1DOB A;  3NNE A;  1BKW A;  2GMH A;  3P4Q A;  4IVM B;  4GAP A;  4GAV A;  1D4C A;  5KOX A;  1NHP A;  3GRS A;  3GDN A;  4OVI A;  2R4E A;  4H4X A;  3DJD A;  2VVL G;  4EQX A;  2WES A;  4O5U A;  3SZ0 A;  1F8S A;  4U8K A;  1CBO A;  2ACZ A;  2JB3 A;  3GDP A;  1TYT A;  1B8S A;  3NT6 A;  1BWC A;  2X8C A;  1E39 A;  4CCQ A;  3P9U A;  1H81 A;  2DKH A;  4K2X A;  1D7Y A;  5HY5 A;  4XWR A;  3RHA A;  2X8G A;  2XVI A;  4JN9 A;  2IVD A;  4X4J A;  2Z5X A;  3FIM B;  4OPU A;  1FOH A;  1QJD A;  2B9W A;  5HXI A;  3D1C A;  1GRT A;  2GB0 A;  3UKH A;  1NG4 A;  4K7Z A;  1XPQ A;  4OPL A;  2GR1 A;  1YKJ A;  1VQW A;  3IWA A;  4YKF A;  4UP3 A;  3EAN A;  4H50 A;  1SEZ A;  4GDE A;  1B4V A;  3II4 A;  1LQT A;  5KMR A;  3KD9 A;  1K4Q A;  4X9M A;  3NLC A;  1KNP A;  1CC2 A;  4XXG A;  2RGO A;  2GV8 A;  1ZMC A;  1K0I A;  2BYB A;  2C70 A;  5KRQ A;  2YLS A;  3NG7 X;  2R45 A;  2CDU A;  5FMH A;  4CNJ A;  1IUS A;  2WOW A;  4D04 A;  2CFY A;  2XLT A;  2GMJ A;  3UTG A;  3CTY A;  4C3X A;  1N4V A;  3AXB A;  3T31 A;  3R9U A;  3GSI A;  3AYI A;  4NTE A;  4C3Y A;  5M10 A;  2YM2 A;  3SXI A;  2BAB A;  4H4R A;  1TDF A;  3C4N A;  3AB1 A;  5KWF A;  5L46 A;  2YM1 A;  3AE6 A;  3ZYX A;  2WDV A;  2WPF A;  2QA1 A;  1GRB A;  2V61 A;  3RP8 A;  1X31 B;  3CNS A;  2IID A;  4ZCD A;  2GH5 A;  1PXB A;  4HA6 A;  2C72 A;  2WU2 A;  4NZH A;  3FMW A;  2Y6R A;  3NRN A;  1NAA A;  2YLZ A;  1NDA A;  2JAE A;  1IUX A;  1GRE A;  2RGH A;  1E1M A;  2XVE A;  3FPZ A;  3QSM A;  3T2Z A;  4A5L A;  4AOX A;  3BNM A;  3ICT A;  2WU5 A;  3C96 A;  1FEA A;  1O5W A;  4K8D A;  5FS6 A;  3KU9 A;  2Q7V A;  1GRF A;  2DKI A;  3ALJ A;  3AE3 A;  5DBJ A;  1D4E A;  2XYO A;  2BA9 A;  2YQU A;  2WP5 A;  3AD8 B;  4RSL A;  4YKG A;  4D03 A;  3CND A;  3GD3 A;  2EQ6 A;  5FS8 A;  1N1P A;  4ADW A;  1EBD A;  4JNA A;  3SX6 A;  1MOK A;  3UOY A;  1PBC A;  3BHK A;  3K7T A;  1TDK A;  2BK3 A;  1NHQ A;  1VRQ B;  1IUV A;  5JCI A;  1LQU A;  5FS9 A;  2AQJ A;  4I58 A;  4OPD A;  1Y56 A;  1ZKQ A;  2VQB A;  3UCL A;  1TDO A;  4YSX A;  4APN A;  1H6V A;  4I59 A;  2GAH B;  1F8W A;  3KPF A;  4H2Q A;  1EL5 A;  4Y4M A;  1DJQ A;  4J33 A;  4B64 A;  5EBK A;  4YWO A;  4GUV A;  1H82 A;  3NK2 X;  4BK3 A;  3UOV A;  3AE8 A;  1KSU A;  1PJ6 A;  2BRA A;  2FJD A;  3VR8 A;  1DOD A;  2BCG G;  4II3 A;  5GSN A;  2B7S A;  2VRL A;  4EQS A;  2BK5 A;  1ZK7 A;  1ZOV A;  4EIQ A;  2YWL A;  4C77 A;  5KNL A;  1PHH A;  3IC9 A;  2WDR A;  2NPX A;  1D4D A;  2B76 A;  2VVL A;  2BXR A;  3NGC X;  4EMW A;  2E1M A;  2RAB A;  3CPJ G;  2R4J A;  4K5S A;  1JRX A;  1N4W A;  4U2L A;  2VOU A;  1E1L A;  3NIX A;  1NEN A;  1JRY A;  2XCG A;  4REK A;  4U8O A;  4TLZ A;  3T14 A;  4AT0 A;  1RSG A;  3M13 A;  3ICS A;  2VRM A;  5HYM A;  3SY4 A;  4H4P A;  1V59 A;  4USR A;  2WEU A;  3Q6J A;  2PYX A;  3DJJ A;  3QFB A;  2A8X A;  1XDI A;  4FDC B;  1HYU A;  1Q9I A;  2YG7 A;  3UKL A;  2WOI A;  4YSY A;  2BS3 A;  1PBD A;  5J7X A;  4Z24 A;  3SZF A;  4J57 A;  1GRH A;  3P4P A;  1CJ2 A;  4DGK A;  4H2R A;  3UTF A;  4H4Y A;  3EAO A;  5JCM A;  4CBQ A;  3AEA A;  3VR9 A;  2Q6U A;  3NYC A;  1H84 A;  4EMJ A;  4A9W A;  1AOG A;  1YQZ A;  2XVJ A;  4EM4 A;  2EQ8 A;  3UP4 A;  1L9E A;  2V6O A;  1VG9 A;  1GES A;  3LZX A;  3NN0 X;  5J60 A;  1DOC A;  3KKJ A;  2WDQ A;  3ATQ A;  4H2N A;  3IHG A;  3LZW A;  4OPG A;  1B37 A;  1KNR A;  2YR6 A;  4RG4 A;  4RG3 A;  2C64 A;  3G5S A;  4TM0 A;  4YTM A;  3LAD A;  3ATR A;  3M0O A;  1H2I A;  1KN0 A;  5KOW A;  1CC6 A;  3AEB A;  3CIR A;  3F8D A;  3NHO X;  3DGZ A;  3GWD A;  4YTN A;  1RYI A;  5EOW A;  1E1K A;  1F6M A;  4KPR A;  2Z5Y A;  3GWF A;  4B63 A;  1K0J A;  1S3B A;  3QSE A;  2CVJ A;  4H7U A;  1UKV G;  3CGD A;  3D9X A;  1PBF A;  4HB9 A;  3EPT A;  3LB8 A;  3IHM A;  4G74 A;  4WX1 A;  3AYL A;  3CPI G;  2FJE A;  3BNU A;  4G9K A;  2UZZ A;  3AE4 A;  4ECH A;  1JEH A;  4OPI A;  5KMQ A;  1JOA A;  3CGE A;  1GRA A;  4JQ9 A;  4CCR A;  2X3N A;  4GF7 A;  3PVC A;  3SQP A;  3VQR A;  1DNC A;  1IUT A;  1TDN A;  4FX9 A;  3AEE A;  3V3O A;  2XFP A;  1Y0P A;  3QVP A;  1PJ7 A;  1BGJ A;  3UKP A;  3I3L A;  2B9X A;  2EQ9 A;  3DJG X;  4H4S A;  1GOS A;  2C4C A;  4NTC A;  5BRT A;  4NEV A;  3K30 A;  2YR5 A;  4Z2U A;  3CPH G;  3GYX A;  1GER A;  4K5R A;  4TLX A;  2GRT A;  4H4W A;  1FL2 A;  3AE9 A;  5BUL A;  2YAU A;  1ZP0 A;  4EMI A;  3NTA A;  3BHF A;  4U2S A;  1F3P A;  1P2H A;  2YLT A;  5EB4 A;  2AAQ A;  1CJC A;  2YLX A;  5HHF A;  4TM4 A;  2C3C A;  4BUR A;  1YQ4 A;  1DXL A;  2YG5 A;  2IVE A;  4H4T A;  3AEC A;  4U8I A;  2FJA A;  2BC0 A;  2C76 A;  1COY A;  1GAL A;  5GRT A;  1BGN A;  3UKK A;  1DJN A;  1Q1R A;  4GRT A;  4M52 A;  1W4X A;  4C74 A;  2JBV A;  1OJT A;  1H7X A;  2BRY A;  3L8K A;  3T37 A;  4TM1 A;  4AT2 A;  1S2Y A;  3I6D A;  4N9X A;  3GYI A;  2XLU A;  1TDE A;  3CMM A;  2B7R A;  5KVH A;  5U25 A;  1CJ3 A;  2JB1 A;  3NTD A;  1DOE A;  1ELI A;  3FBS A;  4EM3 A;  1JU2 A;  1O95 A;  3ALL A;  3DK9 A;  4WCT A;  3RP6 A;  3UOZ A;  4DSG A;  3VRD B;  2XFQ A;  3UKF A;  3QVR A;  3NH3 X;  5C3J A;  1E6E A;  3P4S A;  2BCP A;  5BVA A;  4OCG A;  2VVM A;  3V3N A;  2TMD A;  3HZL A;  4U8M A;  2YLW A;  1OJ9 A;  1GT8 A;  4Z25 A;  2OLO A;  4G6H A;  2C3D A;  1S7M A;  5ER0 A;  2JKC A;  3DJE A;  3B3R A;  1ZOY A;  4IVO B;  5KMP A;  5IPY A;  3H8I A;  4X9N A;  1BZL A;  1FEB A;  2EQ7 A;  2E4G A;  1H86 A;  2C66 A;  5LV9 A;  3HYX A;  2Q0K A;  1QLB A;  1PN0 A;  1Y56 B;  3UP5 A;  1P2E A;  2FJB A;  1PJ5 A;  2YLR A;  2TPR A;  3CNT A;  4GR1 A;  4ZN0 A;  4YTP A;  1LTX R;  2BC1 A;  4U8J A;  2YG6 A;  4GCM A;  1PXA A;  2QCU A;  4JY3 A;  3L1R A;  2OA1 A;  3NYE A;  3NYF A;  1FCD A;  1PXC A;  4J36 A;  3AD7 B;  3VRA A;  1KSS A;  2XFU A;  2NVK X;  4IV9 A;  1LVL A;  4B67 A;  3ZDN A;  2WOV A;  1XHC A;  2V3B A;  2Y6Q A;  1KF6 A;  3P1W A;  4B68 A;  4TM3 A;  4USQ A;  3K7Q X;  3AED A;  2R0G A;  3UOX A;  2F5Z A;  1RP0 A;  1VDC A;  3ABV A;  3NN6 X;  3DH9 A;  4GDP A;  3BI2 A;  4PAA A;  1D5T A;  4NWZ A;  4A65 A;  2GEW A;  2QA2 A;  3AE5 A;  5U1O A;  4YSZ A;  5KXJ A;  4YXD A;  3BI5 A;  3KA7 A;  1GND A;  2GQW A;  3S5W A;  3JSK A;  2V3A A;  3QJ4 A;  5IQ1 A;  3ITJ A;  3LXD A;  1REO A;  1LPF A;  2BAC A;  3RNM A;  3M12 A;  2YVF A;  3QSS A;  3CNP A;  4PAB A;  3PS9 A;  3T2K A;  3RED A;  1ZX9 A;  1QO8 A;  2XLP A;  2BS4 A;  2GF3 A;  4BK1 A;  1NHR A;  3O0H A;  3C4A A;  1OJA A;  2X50 A;  4UDQ A;  2R9Z A;  4DSH A;  5FS7 A;  1EL8 A;  1ZDL A;  4H4Q A;  4OPT A;  3DME A;  3L5O A;  4A79 A;  4IA6 A;  1PDH A;  3UKA A;  3COX A;  3HYW A;  4P9S A;  3OZ2 A;  4O5Q A;  4Z43 A;  2GQF A;  1JNR A;  1VG0 A;  2QAE A;  1M64 A;  2C7G A;  4BJY A;  4CY8 A;  1YQ3 A;  3AE1 A;  2Q0L A;  2I0Z A;  4UDP A;  3UTE A;  3AWI A;  3URH A;  4JY2 A;  4KX6 A;  2XLR A;  5JCK A;  1TRB A;  1O94 A;  1D7L A;  1GPE A;  2O9Z A;  2WPC A;  3NKS A;  3WE0 A;  4B69 A;  3UTH A;  4ICY A;  2OAM A;  1GXF A;  4H2P A;  2BK4 A;  3QFA A;  4U8N A;  2R0C A;  4JNQ A;  3DGH A;  2YG3 A;  4II2 A;  3GRT A;  2JB2 A;  3S61 A;  2A87 A;  2WET A;  3GMC A;  2CUL A;  4Z2T A;  1Z6L A;  3ALM A;  5M0Z A;  1S2Q A;  1GTH A;  4YSH A;  4OPC A;  4NNJ A;  1L9C A;  1TYP A;  4J34 A;  3V76 A;  3LOV A;  4K22 A;  2GR2 A;  1IUU A;  1S3E A;  2ARD A;  2OLN A;  1L0V A;  3BI4 A;  2X99 A;  4XWZ A;  2YVJ A;  4CRT A;  2XFN A;  3NK1 X;  3H8L A;  4U8L A;  3ADA B;  3G5R A;  3FG2 P;  3KLJ A;  2WP9 A;  5KMS A;  1GTE A;  3SGL A;  3SM8 A;  1NPX A;  3H4K A;  1L9D A;  3NK0 X;  2R0P A;  4LII A;  3Q9T A;  3SYI A;  1M6I A;  4UDR A;  5CQF A;  4A7A A;  3HYV A;  4Z44 A;  1PS9 A;  3G5Q A;  4U2T A;  3CGB A;  1OJD A;  3F8R A;  3KPK A;  3KVE A;  3CNJ A;  1XAN A;  1GSN A;  4G6G A;  4AOS A;  4B65 A;  2AR8 A;  5EB5 A;  4NTD A;  4U8P A;  2GR3 A;  5TR3 A;  4LA1 A;  2V60 A;  2WQY A;  4Y4N A;  4BV6 A;  4H4Z A;  4ZCC A;  1ZMD A;  4A6N A;  4IA5 A;  1F8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...