1JOAA

Nadh peroxidase with cysteine-sulfenic acid
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
447
structure length
446
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the native cysteine-sulfenic acid redox center of enterococcal NADH peroxidase refined at 2.8 A resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NADH PEROXIDASE
total genus 138
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1996-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1joaA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1joaA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1joaA02
5JCIA 2WPFA 3AE4A 4Z43A 3ALJA 3IC9A 5FS8A 5TR3A 2PYXA 2JB3A 2YLTA 2FJBA 3C96A 4J33A 4XWZA 1ZK7A 4C77A 4OPCA 2ARDA 2B7RA 5JCMA 4ZN0A 5KOWA 3WE0A 4GRTA 3UP4A 2WEUA 2C72A 3AYLA 1CL0A 2WS3A 1B4VA 2C3DA 1TDEA 3M12A 4OPDA 5IPYA 1IUWA 1OJ9A 1Y56B 4A79A 2YG3A 1D7LA 4YWOA 2X3NA 2R46A 3GD4A 2V6OA 2R4EA 5LV9A 1OJTA 2C73A 3SFEA 4D03A 1QO8A 3NIXA 4U8MA 2AR8A 1IUTA 4GDEA 4XWRA 1E1KA 3CNSA 1H7XA 2XLTA 4Y4NA 3G5SA 3URHA 4CNKA 3GWFA 4LU6A 4GCMA 4YKGA 4HB9A 3CGEA 2A89A 2YLXA 4REKA 4M52A 1GRFA 2GQFA 1CF3A 1TYTA 1W4XA 3QSSA 3AD8B 2B76A 4TM3A 4GDPA 3NNEA 5FS9A 2YG5A 4WX1A 2YLRA 3QVRA 2Y6RA 4Z24A 3UCLA 2WPCA 4APNA 2UZZA 3COXA 5KVHA 4EIQA 4J57A 2BK3A 1O5WA 2E4GA 1ZY8A 3QVPA 3IF9A 2GAGB 4YKFA 2X99A 4J56A 3LZXA 3AWIA 4U8NA 2WBAA 2XLSA 5L46A 4Z2TA 1IUXA 5ER0A 3VQRA 2VRLA 5GRTA 4C3XA 1FCDA 1CJ3A 1YQ4A 2GV8A 1F8SA 2GEWA 4Y4MA 4A6NB 2IIDA 2Z5XA 3KLJA 2B9YA 2BS2A 2CULA 2F5ZA 3DJEA 4YTMA 2EQ7A 1ZX9A 4USRA 5EBKA 2BS3A 2JBVA 2A87A 1BGJA 1N1PA 2Q7VA 3EANA 2BABA 4OPUA 2BC0A 4PAAA 1Q1WA 4BK1A 3ABVA 1H82A 3JSKA 3OZ2A 1QJDA 3H8LA 3H4KA 1IJHA 3HZLA 3CPIG 3DA1A 1YQ3A 1ZMDA 2X8GA 3AE9A 2AQJA 1H6VA 3UKHA 3V3NA 2XYOA 1DNCA 2CDUA 5J7XA 3UKPA 2XFUA 5CKUA 3ICTA 3NK2X 4Z44A 3II4A 2WETA 1GREA 1PXBA 4H4VA 1EL8A 4H4RA 2GQWA 1M6IA 1E1MA 1OJAA 3NRNA 4J31A 3FPZA 1GOSA 4U8PA 1FOHA 1NAAA 2X8CA 1VG0A 1LQTA 1L9CA 4X9NA 3SGLA 1PHHA 2QA2A 1S2QA 3AEFA 4CNJA 2NVKX 1K0LA 4OPIA 2C65A 3DGHA 1OJCA 1NHQA 4I59A 4OVIA 2YM1A 3NGCX 3NTDA 3AE2A 1GTEA 4CY6A 1F8RA 1PJ5A 1LVLA 2XFQA 4OCGA 3GWDA 2B9WA 2XLUA 3AD7B 3AEAA 2NPXA 1PXCA 2WQYA 4EMIA 4O5QA 4UP3A 1E39A 4AP3A 4ADWA 3EAOA 2C75A 3AYIA 2WDVA 1CBOA 2YAUA 2XVEA 1TDOA 4Z25A 1GXFA 1E6EA 3K30A 3AB1A 4CBQA 3GDNA 4BJYA 2J3NA 2BS4A 1KFYA 2H89A 3QSMA 1BKWA 2FJDA 2Z5YA 3CNDA 5BRTA 4IVOB 3Q9TA 2FJAA 4KPRA 5U25A 2WPEA 1B5QA 3C4NA 5GSNA 2V61A 1L9DA 1ZOYA 3VRBA 2WU5A 2Q0KA 2A8XA 4ICYA 3RHAA 4J34A 3UKQA 2W0HA 3DMEA 1KNRA 3REDA 1Z6LA 2YVJA 4H4SA 4Z2RA 4A7AA 5KOXA 2XCGA 2GR0A 4YSZA 5JCLA 4A6NA 2YG7A 4AT0A 3RNMA 1ZOVA 1CC4A 4FDCB 3AEBA 2GVCA 1DJQA 1O95A 2C76A 3BI5A 1LV0A 3UKAA 3D1CA 1D7YA 4EMWA 3ATRA 4MJWA 1GERA 3UTHA 4U8OA 2TPRA 3AEGA 2BC1A 5FS7A 3F8DA 2GF3A 4BK2A 2R0PA 4CCQA 4Y4LA 3T37A 5KRQA 3CPHG 3NT6A 1PBDA 2BXSA 1D4DA 2C67A 4P9SA 3GMCA 3AYJA 1D5TA 3VR9A 2VVLG 2XVHA 4H4PA 2GR3A 3VRDB 2C7GA 4K5RA 3P4QA 1JRYA 3H8IA 4B1BA 5BUKA 3UOXA 1N4VA 3RP7A 3DJGX 2RGJA 3K7QX 2BCPA 2ACZA 5JCNA 2XLPA 3ITJA 2E5VA 3AE8A 2QA1A 1DODA 2JB1A 3F8RA 4RG4A 4EMJA 2YQUA 2EQ8A 2VVMA 5HHFA 2WHDA 3VR8A 3UTEA 2VQBA 4UDRA 1AOGA 3LZWA 3UOVA 5U63A 1P2HA 1K4QA 3GDPA 2PHHA 1YKJA 3GYJA 1ELIA 1BZLA 5CQFA 2ZBWA 3BNMA 2JAEA 1GETA 1GALA 1GT8A 1Q1RA 3KD9A 3Q6JA 2TMDA 4RG3A 4GR1A 1GRTA 3SFDA 4NTDA 3P4SA 4H4QA 2EQ9A 1PXAA 2BYBA 4EQXA 1PN0A 1IUVA 1JNZA 1KF6A 2XFNA 2WESA 4ZCCA 4Z26A 2JKCA 4JNQA 4DNAA 4UDQA 1TDNA 3GYIA 4E0VA 3NK0X 4K8DA 1TDKA 2RGOA 1O94A 4TM4A 1NDAA 4UDPA 3CNJA 4B68A 2Y6QA 3EPTA 1NPXA 5JCKA 4JDRA 1P2EA 2R0CA 3KVEA 3CN8A 4H4YA 2GMJA 3D8XA 4AOXA 1IUSA 1FEAA 1K0IA 5C3JA 3CIRA 5KXJA 2ZZCA 2YWLA 3ZDNA 2IVEA 3KU9A 2R9ZA 2I0ZA 2R4JA 3CNTA 4GUVA 1JEHA 2FJEA 1EL5A 2V60A 3EF6A 2YLSA 3NHOX 5IQ4A 2YR4A 2OA1A 4IA6A 1B37A 3UP5A 1HYUA 3QJ4A 2GR2A 2QCUA 3GSIA 3UKKA 5EB4A 1CJ4A 1Y0PA 4CRTA 2BK5A 4H2QA 4TLXA 3DGZA 3BI4A 3K7TA 2GMHA 2GH5A 1DXLA 3BHKA 1GEUA 1H83A 2DKHA 1FEBA 4IV9A 4A9WA 3UOYA 2YM2A 4B66A 1VG9A 1TYPA 3QFAA 5BVAA 2IVDA 2R45A 5HYMA 1H7WA 4YTNA 2WP6A 5M10A 4YSHA 4U2LA 3OC4A 3IWAA 1N4WA 4JY3A 4OPTA 1NG3A 2JB2A 3GD3A 2XFOA 2X8HA 3P9UA 2JK6A 4H4ZA 2YG4A 1B8SA 5KVIA 4U8KA 2WOIA 3LB8A 4AP1A 3DK8A 1S3BA 1XPQA 1GRBA 1NHSA 3CTYA 4FK1C 4U8LA 2GB0A 3NK1X 1GSNA 3ICSA 2GR1A 1PDHA 1DOEA 1JNRA 2GRTA 4H4TA 3UOZA 1VRQB 4D04A 1XHCA 4KX6A 4U8IA 4TM1A 4DSHA 2E1MA 4RSLA 4EQRA 4YT0A 1REOA 2YR5A 3V76A 3DJJA 3L8KA 2BK4A 1PBCA 1CJCA 3QSEA 5EOWA 2YVFA 1NG4A 4EQWA 3DH9A 3LADA 3QFBA 4H2PA 4GF7A 1S3EA 4H4WA 1CC6A 1KSUA 4YTPA 4EIPA 5HXIA 3FG2P 2CFYA 3AE7A 3F8PA 1N4UA 4H4XA 3O0HA 2V3BA 3AE5A 5J60A 5FS6A 4IVMB 4USQA 2WP5A 3NKSA 4JY2A 4LA1A 1YY5A 3S5WA 2Q0LA 3ADAB 3CGDA 4X4JA 1F8WA 3C4AA 2ZZBA 1DOBA 3CNPA 4YSYA 1QLBA 2EQ6A 5IQ1A 2X50A 1BGNA 2YG6A 3NG7X 4C74A 2AAQA 2V5ZA 4EQSA 3AEDA 1LQUA 2XFPA 1D4CA 3G5QA 4NTCA 3NTAA 4XXGA 2C66A 3AE1A 4B64A 4ECHA 3LOVA 3IHMA 3V3OA 3B3RA 3GRSA 1KNPA 3DK9A 1E1NA 2VOUA 1BWCA 1EL9A 1M64A 4FX9A 2OLOA 2Q6UA 4TLZA 3UKFA 2WP9A 4B67A 4YXDA 4JN9A 3M13A 1GRGA 3K7MX 2O9ZA 1YQZA 1H81A 3E1TA 3I3LA 3VRAA 2C70A 4TM0A 1DOCA 1EL7A 2ZZ0A 1RYIA 1NENA 2XVJA 1KSSA 1VDCA 3FMWA 1MO9A 1GTHA 2VRMA 4B69A 4CY8A 1H86A 2BCGG 3KPFA 4FK1A 4ZCDA 3BNUA 4O5UA 2BACA 1PBEA 1LTXR 2XLRA 1F6MA 2YR6A 3PS9A 2V3AA 3NN0X 1F3PA 1XDIA 4C3YA 3B6DA 2YVGA 2C3CA 4BV6A 1COYA 2YLWA 3AEEA 3AD9B 3CGBA 2HQMA 1D4EA 4K5SA 1NHRA 1CC2A 4BJZA 1GPEA 3G5RA 4AT2A 1FECA 3UKLA 1PJ6A 4JQ9A 3DK4A 1X31B 3I6DA 3UTFA 2BA9A 3ATQA 3M0OA 3ZYXA 3P4RA 2B9XA 2BXRA 3SM8A 5DBJA 3DJDA 2C64A 3IHGA 2GAHB 2WDRA 4OPGA 1V59A 2VQ7A 1GRHA 2OALA 5M0ZA 2RGHA 1JRXA 4U2SA 4B63A 1XANA 3S61A 2RABA 1E1LA 1PS9A 3KKJA 1UKVG 3P1WA 4A99A 3NYFA 1L9EA 5KWFA 4DSGA 4EM4A 3NH3X 1KDGA 4H7UA 3RP6A 1GESA 4H2NA 3AECA 1MOKA 2APGA 1K0JA 1RSGA 4K7ZA 4YSXA 4C5OA 2R0GA 4BK3A 3FBSA 2XDOA 4K2XA 4X9MA 2VZ2A 3AXBA 1Q9IA 3ALLA 1GNDA 2XVFA 1JOAA 4OPLA 4AOSA 4B65A 1H84A 1RP0A 4J36A 2WOVA 4Z2UA 3AE6A 5C2TA 3AE3A 4H2RA 3BHFA 4WCTA 4U2TA 3LXDA 3NYEA 5HY5A 4NEWA 1ZDLA 1TRBA 1LJ1A 1JRZA 2OLNA 3NLCA 5EB5A 1BF3A 5FMHA 3SQPA 1ZKQA 1Y56A 1ZMCA 1L0VA 2FBWA 3GRTA 4I58A 1VQWA 1PBFA 4CCRA 1PJ7A 3UTGA 2WDQA 3FIMB 2YLZA 1CHUA 2VVLA 4IA5A 2B7SA 1S2YA 3L1RA 4HA6A 3BI2A 1JU2A 4PABA 4U8JA 1ONFA 3ICRA 1NEKA 1DJNA 3GMBA 3PVCA 3PO7A 1IUUA 1MXTA 3CGCA 4NZHA 4H50A 1NHPA 1LPFA 5BULA 1FL2A 4A5LA 1OJDA 4K22A 2H88A 1PBBA 3LJPA 1EBDA 2WOWA 1E7PA 4N9XA 1GRAA 3CPJG 3ISHA 3KA7A 4DGKA 4J2WA 4NTEA 2XVIA 1ZP0A 3NN6X 3NYCA 2QAEA 2DKIA 2CVJA 2WU2A 3R9UA 3ALMA 4JNAA 3RP8A 3P4PA 4LIIA 1GV4A 4NEVA 4EM3A 1SEZA 1CJ2A 5U1OA 1TDFA 4A65A 4BURA 4H4UA 2OAMA
chains in the Genus database with same CATH superfamily
3SXIA 5FS8A 2YLTA 1FHUA 4M0XA 4OPCA 1STZA 2C72A 2P3ZA 2WS3A 2W55A 3BJSA 3GD4A 3T31A 5LV9A 3DIPA 4GDEA 4XWRA 4CNKA 4YKGA 2A89A 4G73A 3FCPA 4GDPA 4G6HA 5FS9A 2YLRA 3QVRA 5FJUA 3UCLA 2PU0A 4APNA 2UZZA 4EIQA 2GAGB 4YKFA 3SJNA 4IT1A 2X99A 1EC7A 1IUXA 3VQRA 2VRLA 1CJ3A 2GV8A 2IIDA 2QDEA 2OPJA 2BRAA 2BS2A 3T9PA 1ZX9A 2BS3A 2JBVA 1EC9A 4OPUA 3JSKA 3OZ2A 3NS1B 3CPIG 1ZMDA 2XYOA 2CDUA 5CKUA 4Z44A 1M6IA 2PMQA 2X8CA 1VG0A 1LQTA 1F9CA 3SGLA 1PHHA 1S2QA 3AEFA 2C65A 3P0WA 3DGHA 1NHQA 4I59A 3NTDA 3AE2A 1PJ5A 3GWDA 2B9WA 3AD7B 2NPXA 3AM9A 2WQYA 4ADWA 3EAOA 2C75A 3NFUA 3TJ4A 3GDNA 2GGGA 3T2KA 1BKWA 2FJAA 5U25A 2V61A 4E4FA 4GAPA 3RHAA 4J34A 2W0HA 3DMEA 1KNRA 1XS2A 2YVJA 4A7AA 2YG7A 1SJDA 5ENLA 4E5TA 4FDCB 3AEBA 2C76A 3BI5A 1WYGA 3UTHA 1GERA 3H8AA 4U8OA 3N4EA 3TW9A 2GF3A 2P0IA 4Y4LA 3T37A 3CPHG 3NT6A 2BXSA 2C67A 2GL5A 3AYJA 3UJRA 3VR9A 4E6MA 4H4PA 1ECQA 3RITA 2C7GA 4E8GA 1H2IA 1W6TA 3UOXA 1N4VA 2RGJA 2HXUA 3VFCA 5JCNA 2QA1A 3HPFA 4EMJA 2GGIA 2WHDA 3MKCA 2PHHA 5CQFA 2JAEA 1WUEA 4RG3A 3SFDA 4GR1A 1GRTA 3FVDA 4EQXA 1X2HA 4JNQA 4DNAA 4UDQA 3NK0X 2RGOA 1O94A 4HCDA 1NDAA 4TM4A 4B68A 3FJ4A 3KVEA 3CN8A 5FJRA 3D8XA 5C3JA 2ZZCA 3BSMA 2ZADA 3A7AA 2V60A 3EF6A 1B37A 1HYUA 3QJ4A 1DTNA 3PFRA 2GH5A 4A9WA 3UOYA 1VG9A 3QFAA 5BVAA 2IVDA 3Q45A 5M10A 7ENLA 3UXKA 2X8HA 3P9UA 2YG4A 1B8SA 5KVIA 3LB8A 1S3BA 1XPQA 1MNSA 3CTYA 4ZCWA 1ZXIC 1JNRA 3CAWA 1XHCA 3PG6A 1MDRA 1PBCA 3D9XA 2HXTA 4GISA 3TJIA 3CMMA 3LADA 3QFBA 1CC6A 1KSUA 3FG2P 3O0HA 3EUB3 1F8WA 1DOBA 3NG7X 2YG6A 4C74A 2V5ZA 1LQUA 2O56A 4NTCA 4XXGA 3TOYA 4B64A 3IHMA 3V3OA 2VOUA 1BWCA 2Q6UA 3VC6A 4FX9A 2OLOA 4TLZA 3M13A 1GRGA 3K7MX 1YQZA 4Z17A 1H81A 3R0UA 3VRAA 2C70A 1RYIA 3HW2A 1H86A 4O5UA 2BACA 3N4FA 3PS9A 2YVGA 1COYA 2QJMA 1MUCA 1JDFA 4K5SA 4A6GA 1GPEA 4AT2A 1V97A 4JQ9A 3RRAA 3ATQA 1X2GA 3M0OA 2ZC8A 4OPGA 1N5WC 4F4RA 1EBHA 1XANA 2RABA 3DG7A 2PODA 4HPNA 1JRPA 1KDGA 3RP6A 1K0JA 4K7ZA 4C5OA 2R0GA 2XDOA 2VZ2A 2XVFA 1H84A 1RP0A 4H2RA 3NYEA 1ZDLA 1TRBA 1BF3A 5FMHA 1ZKQA 1ZMCA 1L0VA 1PBFA 1CHUA 3L1RA 3ZLGA 4JN7A 1JU2A 3NRZB 3PVCA 3PO7A 4NZHA 1WUFA 1LPFA 4A5LA 3DGBA 1PBBA 1PDYA 2WOWA 6ENLA 3NYCA 2QAEA 2DKIA 3GD6A 2WU2A 1KKOA 4EM3A 1SEZA 1TDFA 4BURA 1JPDX 3AMZA 2OAMA 2PYXA 1ZK7A 4C77A 3RR1A 5JCMA 3ZVHA 3WE0A 3UP4A 3SZCA 2C3DA 4OPDA 1VQZA 2YG3A 4A79A 5G5GB 2R46A 1N5XA 1OJTA 2PP1A 2C73A 3NIXA 3P3BA 2AR8A 1E1KA 2XLTA 3URHA 3SZ0A 1KD0A 1TZZA 3QTPA 1CF3A 1W4XA 3AD8B 2PCEA 2B76A 4DN1A 4WX1A 3RO6A 3SBFA 1O5WA 1ZY8A 3QVPA 4II2A 3LZXA 3AWIA 2XLSA 5L46A 5ER0A 3S5SA 5GRTA 3R11A 1NU5A 1FCDA 2QQ6A 4Y4MA 4A6NB 3DG3A 2QDDA 3DJEA 4HNLA 4YTMA 4USRA 2W3SA 2Q7VA 1BGJA 1R6WA 3EANA 4PAAA 1Q1WA 1H82A 4ZA0A 3H8LA 2MNRA 3HZLA 4KT2A 3R1ZA 3UKHA 3JW7A 3V3NA 2XH7A 5J7XA 3UKPA 4YWSA 2WETA 1PXBA 1E1MA 1OJAA 4U8PA 3TWAA 2AKZA 4CNJA 2HNEA 2GGHA 4GGHA 2YM1A 1F8RA 3AEAA 1PXCA 3TQPA 4EMIA 4O5QA 4UP3A 4AP3A 2OVLA 4BJYA 4G6GA 1SJCA 2J3NA 1KFYA 2Z5YA 5BRTA 4IVOB 2WPEA 3VRBA 1L9DA 3EKGA 2A8XA 3UKQA 4Z2RA 2GR0A 5JCLA 3RNMA 4GYPC 1O95A 3UCCA 4EWJA 1D7YA 4EMWA 3NVVB 2BC1A 4CCQA 1PBDA 3CXBA 1D4DA 3R0KA 3IJLA 2VVLG 1MDLA 4K5RA 3P4QA 1JRYA 3H8IA 3RP7A 3SYIA 3B9JB 2ACZA 3FV9A 3ITJA 2E5VA 3F8RA 1DODA 5HHFA 3VR8A 3DFHA 1FIQB 2VQBA 1K4QA 1ELIA 3BNMA 1GT8A 3KD9A 2TMDA 1IYXA 1N63C 3P4SA 4H4QA 2EQ9A 2BYBA 3SN4A 1IUVA 2XFNA 4ZCCA 1OEPA 4E0VA 3GYIA 4GMEA 5JCKA 4JDRA 4H4YA 2FKPA 4AOXA 3I4KA 1FEAA 3KUMA 1P43A 2YWLA 3ZDNA 4H2HA 2R9ZA 2FJEA 5KMPA 3ZVIA 5IQ4A 3OPSA 2QCUA 3UKKA 5EB4A 1CJ4A 1Y0PA 3SSZA 1DXLA 4IV9A 3Q4DA 2YM2A 5G5HB 4U2LA 1N4WA 4JY3A 2JB2A 2NQLA 2WOIA 3DK8A 1NHSA 3MUCA 3NK1X 2GRTA 2OZ3A 3U9IA 3UOZA 3OW1A 1N60C 4TM1A 4DSHA 2E1MA 3B97A 4TVWA 3V76A 3DJJA 3L8KA 3QSEA 3IK4A 4GF7A 3F8PA 3QLDA 4H4XA 2GSHA 2PTXA 2V3BA 5J60A 4IVMB 3ZLHA 4GIRA 2ZZBA 4YSYA 1QLBA 5IQ1A 3H70A 3THUA 3T4WA 3G5QA 3AE1A 4ECHA 2DW7A 1NELA 1KNPA 1EL9A 3UKFA 4B67A 4JN9A 2O9ZA 3E1TA 4IZGA 1EC8A 3I3LA 4TM0A 2ZZ0A 2XVJA 3FMWA 1VDCA 1MO9A 4DYEA 4CY8A 3MY9A 2BCGG 4FK1A 2XLRA 2QJJA 2YR6A 1F3PA 4C3YA 4BV6A 2YLWA 3AEEA 2HQMA 3G5RA 5J04A 3DK4A 2OLAA 2E5AA 3ZYXA 1KN0A 1YEYA 2QGYA 2B9XA 3SM8A 3NZGA 5DBJA 2OFJA 3IHGA 2GAHB 1V59A 2OALA 2AL1A 3V4BA 4A99A 3UXLA 5KWFA 4K8GA 3AECA 1RSGA 4YSXA 3K1GA 3HYWA 4X9MA 3AXBA 3RGTA 1Q9IA 1GNDA 2P88A 2WOVA 4Z2UA 3DESA 3AE3A 4U2TA 2OLNA 5EB5A 2FBWA 3T8QA 3GRTA 1PJ7A 3FIMB 4IHCA 2VVLA 4GFIA 4X2PA 3CGCA 1SJBA 3UJFA 4K22A 3LJPA 4N9XA 1GRAA 3ISHA 4J2WA 2XVIA 3NN6X 2CVJA 3NVYB 2AL2A 3P4PA 1BKHA 1CJ2A 5U1OA 4MKSA 5JCIA 3AE4A 4Z43A 4XWZA 5TR3A 3C96A 2JB3A 2FJBA 3FYYA 2ARDA 2B7RA 3QN3A 3SZFA 2E3TA 3M12A 1Y56B 4NWZA 3ES8A 2P8BA 2X3NA 2R4EA 4D03A 1QO8A 4Z26A 2XH4A 3CNSA 1H7XA 4Y4NA 4GCMA 3CGEA 2YLXA 4REKA 4M52A 1GRFA 2GQFA 1TYTA 3QSSA 4TM3A 2GGJA 3NNEA 4JHMA 2POZA 3T2YA 2Y6RA 2WPCA 3COXA 5KVHA 2E4GA 3IF9A 1SJAA 4U8NA 2WBAA 1F8SA 2Z5XA 3KLJA 2B9YA 4FI4A 2F5ZA 2CULA 3SZWA 5EBKA 1KKRA 3HRDC 3SN1A 2A87A 1N1PA 3TCSA 2BC0A 4KPLA 1XPYA 3D46A 3AE9A 2X8GA 2AQJA 1H6VA 1DNCA 2MUCA 3II4A 1EL8A 4H4RA 2GQWA 3VC5A 3NRNA 4J31A 3FPZA 1GOSA 1FOHA 1NAAA 4X9NA 2QA2A 3L5OA 4J1OA 4NNJA 1K0LA 3PWIA 4OPIA 1GTEA 2XFQA 4OCGA 3AYIA 3SQSA 1CBOA 2YAUA 2XVEA 4Z25A 2OQHA 1GXFA 3K30A 3AB1A 4CBQA 1SB3B 2H89A 3KPKA 2FJDA 5GSNA 4KPRA 1B5QA 1ZOYA 2Q0KA 3AN1A 3GC2A 2QJNA 4DX3A 2PP3A 1ZOVA 1CC4A 3JZUA 1DJQA 4G8TA 3RCYA 3UKAA 3R10A 3MWCA 3AEGA 3F8DA 4JN8A 4P9SA 3GMCA 3HYXA 5BUKA 3DJGX 2XH2A 3K7QX 4ROPA 3NXLA 2BCPA 3CB3A 2XLPA 2JB1A 1JCTA 2YQUA 3UTEA 4DXKA 1AOGA 3LZWA 5FJTA 1P2HA 1BZLA 2ZBWA 1GETA 1GALA 3UJSA 2GDQA 3CYJA 4NTDA 3CXOA 1PXAA 1KF6A 2WESA 1TDNA 3VCNA 1TDKA 3H12A 2Y6QA 3EPTA 5IDZA 1IUSA 3CIRA 2IVEA 2OZTA 2I0ZA 2R4JA 3CNTA 4GUVA 1JEHA 1EL5A 4G9KA 2YR4A 2OA1A 3UP5A 2GR2A 3GSIA 4CRTA 3DDMA 2CHRA 3BI4A 2GMHA 3BHKA 4KEMA 1H83A 1FEBA 4B66A 2PPGA 1TYPA 2R45A 5HYMA 2DW6A 1H7WA 4YTNA 3OC4A 4H4ZA 3N6JA 4FK1C 4U8LA 2GB0A 1DOEA 3HYVA 1VRQB 4D04A 4KX6A 4EQRA 4YT0A 2YR5A 4GYPA 2YVFA 2PU1A 4HYRA 4YTPA 4EIPA 2OKTA 1N4UA 5FS6A 2WP5A 4LA1A 1YY5A 3S5WA 3ADAB 3C4AA 3CNPA 2X50A 1BGNA 3AEDA 2PA6A 4A3RA 3EEZA 1D4CA 3NTAA 2C66A 4G74A 3LOVA 5FJPA 4G7FA 1E1NA 1M64A 4IL0A 1DOCA 4Z2TA 1NENA 3STPA 4B69A 4ZCDA 2W3RA 1LTXR 3NN0X 2C3CA 2PP0A 3AD9B 3CGBA 4BJZA 3D47A 3UKLA 1X31B 2OX4A 1KCZA 1GRHA 2C4CA 2RGHA 1JRXA 4U2SA 4B63A 3S61A 1VDVA 1E1LA 3KKJA 1UKVG 3SN0A 1L9EA 2PTWA 4DSGA 4EM4A 4H7UA 1GESA 4H2NA 1MOKA 2APGA 4K1WA 5BOFA 1JOAA 4OPLA 4B65A 4J36A 3AE6A 5C2TA 3ETRB 3GO2A 4WCTA 5HY5A 4NEWA 3QKEA 1JRZA 1LJ1A 4M6UA 1Y56A 3ZVHB 1VQWA 4CCRA 3UTGA 2YLZA 1S2YA 4IL2A 1ONEA 4PABA 4U8JA 1ONFA 5EU9A 1NEKA 3ICRA 4K2SA 1DJNA 3GMBA 4H50A 5BULA 1FL2A 4ZOHB 1EBDA 2AL2B 3OP2A 3KA7A 4DGKA 4J3ZA 1ZP0A 2I5QA 3R9UA 4E4UA 4JNAA 3RP8A 3OZYA 3DERA 2WPFA 3QPEA 3ALJA 3IC9A 4A65A 4J33A 4ZN0A 5KOWA 4GRTA 2WEUA 2GGEA 1CL0A 3AYLA 1B4VA 1TDEA 5IPYA 1IUWA 1OJ9A 1D7LA 4YWOA 2V6OA 3SFEA 4U8MA 1IUTA 3G5SA 2XGZA 3GWFA 4LU6A 3SY4A 4HB9A 3V5FA 1TE6A 3DG6A 3A7RA 2AKMA 3U4FA 3MZNA 2YG5A 3TWBA 1RM6B 4Z24A 4J57A 2BK3A 2PTZA 4J56A 4C3XA 1YQ4A 2GEWA 4H1ZA 2EQ7A 4MMWA 1P48A 2BABA 4BK1A 3ABVA 1QJDA 5KNLA 3H4KA 3VA8A 3T2ZA 3ENLA 1IJHA 4DHGA 1YQ3A 3DA1A 3OZMA 4ENLA 3P93A 2XFUA 3ICTA 2PS2A 3NK2X 2HZGA 1GREA 4H4VA 3I6TA 4H83A 1L9CA 5KMRA 2NVKX 1OJCA 4OVIA 3NGCX 4CY6A 1LVLA 2XLUA 3T6CA 3CK5A 3N6HA 1S7MA 1E39A 4FP1A 3A7UA 2WDVA 3PK7A 1TDOA 3MQTA 1E6EA 2BS4A 3QSMA 3CNDA 3Q9TA 3C4NA 3R07C 1FHVA 2WU5A 4ICYA 3REDA 1Z6LA 4H4SA 5KOXA 2XCGA 4YSZA 4A6NA 4AT0A 2GVCA 3V3WA 1LV0A 1MRAA 3D1CA 3ATRA 4MJWA 3GY1A 2TPRA 3UCDA 5FS7A 3PWGA 4BK2A 2R0PA 3R25A 5KRQA 2BRYA 4GGBA 1D5TA 3NVWB 2XVHA 2GR3A 3VRDB 4B1BA 3CT2A 3SR6B 3AE8A 4RG4A 1RVKA 4H19A 2EQ8A 2VVMA 3DFYA 4UDRA 3UOVA 5U63A 3GDPA 3GYJA 1YKJA 1Q1RA 3Q6JA 3NVZB 1PN0A 1JNZA 3MSYA 2JKCA 3IJQA 4K8DA 3ES7A 4UDPA 3CNJA 3ZLFA 1NPXA 1P2EA 2R0CA 3JVAA 5BOEA 2GMJA 5KMQA 5KXJA 1K0IA 1L8PA 3KU9A 1TKKA 2YLSA 3NHOX 4IA6A 4A35A 2PSNA 4H2QA 2BK5A 4TLXA 3DGZA 3K7TA 1GEUA 2DKHA 2WP6A 4YSHA 4OPTA 3IWAA 2OO6A 1FFVC 5JRBA 1N62C 4HNCA 1NG3A 3GD3A 2XFOA 2OG9A 1T3QC 2JK6A 4U8KA 4AP1A 1GRBA 4HN8A 3SX6A 1GSNA 3ICSA 2GR1A 1PDHA 4H4TA 1PDZA 4KWSA 4U8IA 4HCLA 4DWDA 4RSLA 1REOA 2BK4A 1CJCA 5EOWA 2PGWA 1NG4A 4EQWA 3DH9A 4MGGA 4H2PA 1S3EA 4H4WA 5HXIA 3VDGA 2CFYA 3AE7A 4Z1YA 5FJOA 3AE5A 3NO1A 4USQA 1N61C 3NKSA 4JY2A 2Q0LA 4X4JA 3CGDA 2EQ6A 4IP4A 2AAQA 4EQSA 2XFPA 2XH0A 3BOXA 3B3RA 3GRSA 2PGEA 3DK9A 4YXDA 2WP9A 2ONEA 3UJ2A 2OQYA 1E9IA 1EL7A 1KSSA 1GTHA 2VRMA 2XSXA 3KPFA 3BNUA 1PBEA 2RDXA 1F6MA 2V3AA 1XDIA 3B6DA 1D4EA 1NHRA 1CC2A 2P8CA 4TVYA 1FECA 4GAVA 1PJ6A 3I6DA 3UTFA 2BA9A 1BQGA 3P4RA 2BXRA 3S47A 3DJDA 2C64A 4II3A 2WDRA 3V5CA 2VQ7A 5M0ZA 3GYXA 3TTEA 1PS9A 3P1WA 3NYFA 1EBGA 3NH3X 3OTRA 5KMSA 4BK3A 3FBSA 4K2XA 2PTYA 3UJEA 3ALLA 4AOSA 3BHFA 3LXDA 3NLCA 3SQPA 2FYMA 1JPMA 4I58A 1R0MA 2WDQA 4IA5A 2B7SA 4HA6A 3BI2A 1FFUC 2W54A 1IUUA 1MXTA 1NHPA 1JROA 1OJDA 2H88A 3T0KA 3T14A 1E7PA 3FXGA 3CPJG 3UGVA 4NTEA 3I6EA 3VCCA 3H7VA 2QVHA 4IP5A 3ALMA 4LIIA 1GV4A 4NEVA 3DEQA 3IJIA 4HCHA 2OZ8A 1FO4A 1ELSA 4H4UA
chains in the Genus database with same CATH topology
5JCIA 2WPFA 3AE4A 3SXIA 4Z43A 3ALJA 3IC9A 5FS8A 5TR3A 2PYXA 2JB3A 2YLTA 2FJBA 3C96A 4J33A 4XWZA 1ZK7A 4C77A 4OPCA 2ARDA 2B7RA 5JCMA 4ZN0A 5KOWA 3WE0A 4GRTA 3UP4A 2WEUA 2C72A 3SZCA 3AYLA 1CL0A 2WS3A 1B4VA 2C3DA 3SZFA 1TDEA 3M12A 4OPDA 5IPYA 1IUWA 1OJ9A 1Y56B 4NWZA 4A79A 2YG3A 1D7LA 4YWOA 2X3NA 2R46A 3GD4A 2V6OA 2R4EA 3T31A 1OJTA 5LV9A 2C73A 3SFEA 4D03A 1QO8A 3NIXA 4U8MA 2AR8A 1IUTA 4GDEA 4XWRA 1E1KA 3CNSA 1H7XA 2XLTA 4Y4NA 3G5SA 3URHA 3SZ0A 3GWFA 4LU6A 3SY4A 4CNKA 4GCMA 4YKGA 4HB9A 3CGEA 2A89A 2YLXA 4G73A 4REKA 4M52A 1GRFA 2GQFA 1CF3A 1TYTA 1W4XA 3QSSA 3AD8B 2B76A 4TM3A 4GDPA 4G6HA 3NNEA 5FS9A 2YG5A 4WX1A 2YLRA 3QVRA 2Y6RA 3T2YA 4Z24A 3UCLA 2WPCA 4APNA 2UZZA 3COXA 5KVHA 4EIQA 4J57A 2BK3A 1O5WA 2E4GA 1ZY8A 3QVPA 3IF9A 2GAGB 4YKFA 2X99A 4J56A 4II2A 3LZXA 3AWIA 4U8NA 2WBAA 2XLSA 5L46A 4Z2TA 1IUXA 5ER0A 3VQRA 2VRLA 5GRTA 4C3XA 1FCDA 1CJ3A 1YQ4A 2GV8A 1F8SA 2GEWA 4Y4MA 4A6NB 2IIDA 2Z5XA 3KLJA 2B9YA 2BRAA 2BS2A 2CULA 2F5ZA 3DJEA 4YTMA 2EQ7A 1ZX9A 4USRA 3SZWA 5EBKA 2BS3A 2JBVA 2A87A 1BGJA 1N1PA 2Q7VA 3EANA 2BABA 4OPUA 2BC0A 4PAAA 1Q1WA 4BK1A 3ABVA 1H82A 3JSKA 3OZ2A 1QJDA 5KNLA 3H8LA 3H4KA 1IJHA 3HZLA 3T2ZA 3CPIG 3DA1A 1YQ3A 1ZMDA 2X8GA 3AE9A 2AQJA 1H6VA 3UKHA 3V3NA 2XYOA 1DNCA 2CDUA 5J7XA 3UKPA 2XFUA 5CKUA 3ICTA 3NK2X 4Z44A 3II4A 2WETA 1GREA 1PXBA 4H4VA 1EL8A 4H4RA 2GQWA 1M6IA 1E1MA 1OJAA 3NRNA 4J31A 3FPZA 1GOSA 4U8PA 1FOHA 1NAAA 2X8CA 1VG0A 1LQTA 1L9CA 4X9NA 5KMRA 3SGLA 1PHHA 2QA2A 1S2QA 3AEFA 4CNJA 3L5OA 4NNJA 2NVKX 1K0LA 4OPIA 2C65A 3DGHA 1OJCA 1NHQA 4I59A 4OVIA 2YM1A 3NGCX 3NTDA 3AE2A 1GTEA 4CY6A 1F8RA 1PJ5A 1LVLA 2XFQA 4OCGA 3GWDA 2B9WA 2XLUA 3AD7B 3AEAA 2NPXA 1PXCA 2WQYA 4EMIA 4O5QA 4UP3A 1S7MA 1E39A 4AP3A 4ADWA 3EAOA 2C75A 3AYIA 2WDVA 1CBOA 2YAUA 2XVEA 1TDOA 4Z25A 1GXFA 1E6EA 3K30A 3AB1A 4CBQA 3GDNA 4BJYA 4G6GA 2J3NA 2BS4A 1KFYA 2H89A 3KPKA 3QSMA 1BKWA 2FJDA 2Z5YA 3T2KA 3CNDA 5BRTA 4IVOB 3Q9TA 2FJAA 4KPRA 5U25A 2WPEA 1B5QA 3C4NA 5GSNA 2V61A 1L9DA 1ZOYA 3VRBA 2WU5A 2Q0KA 4GAPA 2A8XA 4ICYA 3RHAA 4J34A 3UKQA 2W0HA 3DMEA 1KNRA 3REDA 1Z6LA 2YVJA 4H4SA 4Z2RA 4A7AA 5KOXA 2XCGA 2GR0A 4YSZA 5JCLA 4A6NA 2YG7A 4AT0A 3RNMA 1ZOVA 1CC4A 4FDCB 3AEBA 2GVCA 1DJQA 1O95A 2C76A 3BI5A 1LV0A 3UKAA 3D1CA 1D7YA 4EMWA 3ATRA 4MJWA 1GERA 3UTHA 4U8OA 2TPRA 3AEGA 2BC1A 5FS7A 3F8DA 2GF3A 4BK2A 2R0PA 4CCQA 4Y4LA 3T37A 5KRQA 3CPHG 2BRYA 3NT6A 1PBDA 2BXSA 1D4DA 2C67A 4P9SA 3GMCA 3AYJA 1D5TA 3HYXA 3VR9A 2VVLG 2XVHA 4H4PA 2GR3A 3VRDB 2C7GA 4K5RA 3P4QA 1H2IA 1JRYA 3H8IA 4B1BA 5BUKA 3UOXA 1N4VA 3RP7A 3SYIA 3DJGX 2RGJA 3K7QX 2BCPA 2ACZA 5JCNA 2XLPA 3ITJA 2E5VA 3AE8A 2QA1A 1DODA 2JB1A 3F8RA 4RG4A 4EMJA 2YQUA 2EQ8A 2VVMA 5HHFA 2WHDA 3VR8A 3UTEA 2VQBA 4UDRA 1AOGA 3LZWA 3UOVA 5U63A 1P2HA 1K4QA 3GDPA 2PHHA 1YKJA 3GYJA 1ELIA 1BZLA 5CQFA 2ZBWA 3BNMA 2JAEA 1GETA 1GALA 1GT8A 1Q1RA 3KD9A 3Q6JA 2TMDA 4RG3A 4GR1A 1GRTA 3SFDA 4NTDA 3P4SA 4H4QA 2EQ9A 1PXAA 2BYBA 4EQXA 1PN0A 1IUVA 1JNZA 1KF6A 2XFNA 2WESA 4ZCCA 4Z26A 2JKCA 4JNQA 4DNAA 4UDQA 1TDNA 3GYIA 4E0VA 3NK0X 4K8DA 1TDKA 2RGOA 1O94A 4TM4A 1NDAA 4UDPA 3CNJA 4B68A 2Y6QA 3EPTA 1NPXA 5JCKA 4JDRA 1P2EA 2R0CA 3KVEA 3CN8A 4H4YA 2GMJA 3D8XA 4AOXA 1IUSA 1FEAA 1K0IA 5KMQA 3CIRA 5C3JA 5KXJA 2ZZCA 2YWLA 3ZDNA 2IVEA 3KU9A 2R9ZA 2I0ZA 2R4JA 3CNTA 4GUVA 1JEHA 2FJEA 1EL5A 2V60A 5KMPA 3EF6A 4G9KA 2YLSA 3NHOX 5IQ4A 2YR4A 2OA1A 4IA6A 1B37A 3UP5A 1HYUA 3QJ4A 2GR2A 2QCUA 3GSIA 3UKKA 5EB4A 1CJ4A 1Y0PA 4CRTA 2BK5A 4H2QA 4TLXA 3DGZA 3BI4A 3K7TA 2GMHA 2GH5A 1DXLA 3BHKA 1GEUA 1H83A 2DKHA 1FEBA 4IV9A 4A9WA 3UOYA 2YM2A 4B66A 1VG9A 1TYPA 3QFAA 5BVAA 2IVDA 2R45A 5HYMA 1H7WA 4YTNA 2WP6A 5M10A 4YSHA 4U2LA 3OC4A 3IWAA 1N4WA 4JY3A 4OPTA 5JRBA 1NG3A 2JB2A 3GD3A 2XFOA 2X8HA 3P9UA 2JK6A 4H4ZA 2YG4A 1B8SA 5KVIA 4U8KA 2WOIA 3LB8A 4AP1A 3DK8A 1S3BA 1XPQA 1GRBA 1NHSA 3CTYA 4FK1C 4U8LA 2GB0A 3NK1X 3SX6A 1GSNA 3ICSA 2GR1A 1PDHA 1DOEA 1JNRA 3HYVA 2GRTA 4H4TA 3UOZA 1VRQB 4D04A 1XHCA 4KX6A 4U8IA 4TM1A 4DSHA 2E1MA 3PG6A 4RSLA 4EQRA 4YT0A 1REOA 2YR5A 3V76A 3DJJA 3L8KA 2BK4A 1PBCA 1CJCA 3QSEA 5EOWA 2YVFA 3D9XA 1NG4A 4EQWA 3DH9A 3CMMA 3LADA 3QFBA 4H2PA 4GF7A 1S3EA 4H4WA 1CC6A 1KSUA 4YTPA 4EIPA 5HXIA 3FG2P 2CFYA 3AE7A 3F8PA 1N4UA 4H4XA 3O0HA 2V3BA 3AE5A 5J60A 5FS6A 4IVMB 4USQA 2WP5A 3NKSA 4JY2A 4LA1A 1YY5A 3S5WA 2Q0LA 3ADAB 3CGDA 4X4JA 1F8WA 3C4AA 2ZZBA 1DOBA 3CNPA 4YSYA 1QLBA 2EQ6A 5IQ1A 2X50A 1BGNA 2YG6A 3NG7X 4C74A 2AAQA 2V5ZA 4EQSA 3AEDA 1LQUA 2XFPA 1D4CA 3G5QA 4NTCA 3NTAA 4XXGA 2C66A 4G74A 3AE1A 4B64A 4ECHA 3LOVA 3IHMA 3V3OA 3B3RA 3GRSA 1KNPA 3DK9A 1E1NA 2VOUA 1BWCA 1EL9A 1M64A 4FX9A 2OLOA 2Q6UA 4TLZA 3UKFA 2WP9A 4B67A 4YXDA 4JN9A 3M13A 1GRGA 3K7MX 2O9ZA 1YQZA 1H81A 3E1TA 3I3LA 3VRAA 2C70A 4TM0A 1DOCA 1EL7A 2ZZ0A 1RYIA 1NENA 2XVJA 1KSSA 1VDCA 3FMWA 1MO9A 1GTHA 2VRMA 4B69A 4CY8A 1H86A 2BCGG 3KPFA 4FK1A 4ZCDA 3BNUA 4O5UA 2BACA 1PBEA 1LTXR 2XLRA 1F6MA 2YR6A 3PS9A 2V3AA 3NN0X 1F3PA 1XDIA 4C3YA 3B6DA 2YVGA 2C3CA 4BV6A 1COYA 2YLWA 3AEEA 3AD9B 3CGBA 2HQMA 1D4EA 4K5SA 1NHRA 1CC2A 4BJZA 1GPEA 3G5RA 4AT2A 1FECA 3UKLA 4GAVA 1PJ6A 4JQ9A 3DK4A 1X31B 3I6DA 3UTFA 2BA9A 3ATQA 3M0OA 3ZYXA 1KN0A 3P4RA 2B9XA 2BXRA 3SM8A 5DBJA 3DJDA 2C64A 4II3A 3IHGA 2GAHB 2WDRA 4OPGA 1V59A 2VQ7A 1GRHA 2OALA 5M0ZA 3GYXA 2C4CA 2RGHA 1JRXA 4U2SA 4B63A 1XANA 3S61A 2RABA 1E1LA 1PS9A 3KKJA 1UKVG 3P1WA 4A99A 3NYFA 1L9EA 5KWFA 4DSGA 4EM4A 3NH3X 1KDGA 4H7UA 3RP6A 1GESA 4H2NA 3AECA 1MOKA 2APGA 1K0JA 1RSGA 5KMSA 4K7ZA 4YSXA 4C5OA 2R0GA 4BK3A 3FBSA 2XDOA 3HYWA 4K2XA 2VZ2A 3AXBA 4X9MA 1Q9IA 3ALLA 1GNDA 2XVFA 1JOAA 4OPLA 4AOSA 4B65A 1H84A 1RP0A 4J36A 2WOVA 4Z2UA 3AE6A 5C2TA 3AE3A 4H2RA 3BHFA 4WCTA 4U2TA 3LXDA 3NYEA 5HY5A 4NEWA 1ZDLA 1TRBA 1LJ1A 1JRZA 2OLNA 3NLCA 5EB5A 1BF3A 5FMHA 3SQPA 1ZKQA 1Y56A 1ZMCA 1L0VA 2FBWA 3GRTA 4I58A 1VQWA 1PBFA 4CCRA 1PJ7A 3UTGA 2WDQA 3FIMB 2YLZA 1CHUA 2VVLA 4IA5A 2B7SA 1S2YA 3L1RA 4HA6A 3BI2A 1JU2A 4PABA 4U8JA 1ONFA 3ICRA 1NEKA 1DJNA 3GMBA 3PVCA 3PO7A 1IUUA 1MXTA 3CGCA 4NZHA 4H50A 1NHPA 1LPFA 5BULA 1FL2A 4A5LA 1OJDA 4K22A 2H88A 1PBBA 3LJPA 1EBDA 2WOWA 3T0KA 3T14A 1E7PA 4N9XA 1GRAA 3CPJG 3ISHA 3KA7A 4DGKA 4J2WA 4NTEA 2XVIA 1ZP0A 3NN6X 3NYCA 2QAEA 2DKIA 2CVJA 2WU2A 3R9UA 3ALMA 4JNAA 3RP8A 3P4PA 4LIIA 1GV4A 4NEVA 4EM3A 1SEZA 1CJ2A 5U1OA 1TDFA 4A65A 4BURA 4H4UA 2OAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JCI A;  2WPF A;  3AE4 A;  4Z43 A;  3ALJ A;  3IC9 A;  5FS8 A;  5TR3 A;  2PYX A;  2JB3 A;  2YLT A;  2FJB A;  3C96 A;  4J33 A;  4XWZ A;  1ZK7 A;  4C77 A;  4OPC A;  2ARD A;  2B7R A;  5JCM A;  4ZN0 A;  5KOW A;  3WE0 A;  4GRT A;  3UP4 A;  2WEU A;  2C72 A;  3AYL A;  1CL0 A;  2WS3 A;  1B4V A;  2C3D A;  1TDE A;  3M12 A;  4OPD A;  5IPY A;  1IUW A;  1OJ9 A;  1Y56 B;  4A79 A;  2YG3 A;  1D7L A;  4YWO A;  2X3N A;  2R46 A;  3GD4 A;  2V6O A;  2R4E A;  5LV9 A;  1OJT A;  2C73 A;  3SFE A;  4D03 A;  1QO8 A;  3NIX A;  4U8M A;  2AR8 A;  1IUT A;  4GDE A;  4XWR A;  1E1K A;  3CNS A;  1H7X A;  2XLT A;  4Y4N A;  3G5S A;  3URH A;  4CNK A;  3GWF A;  4LU6 A;  4GCM A;  4YKG A;  4HB9 A;  3CGE A;  2A89 A;  2YLX A;  4REK A;  4M52 A;  1GRF A;  2GQF A;  1CF3 A;  1TYT A;  1W4X A;  3QSS A;  3AD8 B;  2B76 A;  4TM3 A;  4GDP A;  3NNE A;  5FS9 A;  2YG5 A;  4WX1 A;  2YLR A;  3QVR A;  2Y6R A;  4Z24 A;  3UCL A;  2WPC A;  4APN A;  2UZZ A;  3COX A;  5KVH A;  4EIQ A;  4J57 A;  2BK3 A;  1O5W A;  2E4G A;  1ZY8 A;  3QVP A;  3IF9 A;  2GAG B;  4YKF A;  2X99 A;  4J56 A;  3LZX A;  3AWI A;  4U8N A;  2WBA A;  2XLS A;  5L46 A;  4Z2T A;  1IUX A;  5ER0 A;  3VQR A;  2VRL A;  5GRT A;  4C3X A;  1FCD A;  1CJ3 A;  1YQ4 A;  2GV8 A;  1F8S A;  2GEW A;  4Y4M A;  4A6N B;  2IID A;  2Z5X A;  3KLJ A;  2B9Y A;  2BS2 A;  2CUL A;  2F5Z A;  3DJE A;  4YTM A;  2EQ7 A;  1ZX9 A;  4USR A;  5EBK A;  2BS3 A;  2JBV A;  2A87 A;  1BGJ A;  1N1P A;  2Q7V A;  3EAN A;  2BAB A;  4OPU A;  2BC0 A;  4PAA A;  1Q1W A;  4BK1 A;  3ABV A;  1H82 A;  3JSK A;  3OZ2 A;  1QJD A;  3H8L A;  3H4K A;  1IJH A;  3HZL A;  3CPI G;  3DA1 A;  1YQ3 A;  1ZMD A;  2X8G A;  3AE9 A;  2AQJ A;  1H6V A;  3UKH A;  3V3N A;  2XYO A;  1DNC A;  2CDU A;  5J7X A;  3UKP A;  2XFU A;  5CKU A;  3ICT A;  3NK2 X;  4Z44 A;  3II4 A;  2WET A;  1GRE A;  1PXB A;  4H4V A;  1EL8 A;  4H4R A;  2GQW A;  1M6I A;  1E1M A;  1OJA A;  3NRN A;  4J31 A;  3FPZ A;  1GOS A;  4U8P A;  1FOH A;  1NAA A;  2X8C A;  1VG0 A;  1LQT A;  1L9C A;  4X9N A;  3SGL A;  1PHH A;  2QA2 A;  1S2Q A;  3AEF A;  4CNJ A;  2NVK X;  1K0L A;  4OPI A;  2C65 A;  3DGH A;  1OJC A;  1NHQ A;  4I59 A;  4OVI A;  2YM1 A;  3NGC X;  3NTD A;  3AE2 A;  1GTE A;  4CY6 A;  1F8R A;  1PJ5 A;  1LVL A;  2XFQ A;  4OCG A;  3GWD A;  2B9W A;  2XLU A;  3AD7 B;  3AEA A;  2NPX A;  1PXC A;  2WQY A;  4EMI A;  4O5Q A;  4UP3 A;  1E39 A;  4AP3 A;  4ADW A;  3EAO A;  2C75 A;  3AYI A;  2WDV A;  1CBO A;  2YAU A;  2XVE A;  1TDO A;  4Z25 A;  1GXF A;  1E6E A;  3K30 A;  3AB1 A;  4CBQ A;  3GDN A;  4BJY A;  2J3N A;  2BS4 A;  1KFY A;  2H89 A;  3QSM A;  1BKW A;  2FJD A;  2Z5Y A;  3CND A;  5BRT A;  4IVO B;  3Q9T A;  2FJA A;  4KPR A;  5U25 A;  2WPE A;  1B5Q A;  3C4N A;  5GSN A;  2V61 A;  1L9D A;  1ZOY A;  3VRB A;  2WU5 A;  2Q0K A;  2A8X A;  4ICY A;  3RHA A;  4J34 A;  3UKQ A;  2W0H A;  3DME A;  1KNR A;  3RED A;  1Z6L A;  2YVJ A;  4H4S A;  4Z2R A;  4A7A A;  5KOX A;  2XCG A;  2GR0 A;  4YSZ A;  5JCL A;  4A6N A;  2YG7 A;  4AT0 A;  3RNM A;  1ZOV A;  1CC4 A;  4FDC B;  3AEB A;  2GVC A;  1DJQ A;  1O95 A;  2C76 A;  3BI5 A;  1LV0 A;  3UKA A;  3D1C A;  1D7Y A;  4EMW A;  3ATR A;  4MJW A;  1GER A;  3UTH A;  4U8O A;  2TPR A;  3AEG A;  2BC1 A;  5FS7 A;  3F8D A;  2GF3 A;  4BK2 A;  2R0P A;  4CCQ A;  4Y4L A;  3T37 A;  5KRQ A;  3CPH G;  3NT6 A;  1PBD A;  2BXS A;  1D4D A;  2C67 A;  4P9S A;  3GMC A;  3AYJ A;  1D5T A;  3VR9 A;  2VVL G;  2XVH A;  4H4P A;  2GR3 A;  3VRD B;  2C7G A;  4K5R A;  3P4Q A;  1JRY A;  3H8I A;  4B1B A;  5BUK A;  3UOX A;  1N4V A;  3RP7 A;  3DJG X;  2RGJ A;  3K7Q X;  2BCP A;  2ACZ A;  5JCN A;  2XLP A;  3ITJ A;  2E5V A;  3AE8 A;  2QA1 A;  1DOD A;  2JB1 A;  3F8R A;  4RG4 A;  4EMJ A;  2YQU A;  2EQ8 A;  2VVM A;  5HHF A;  2WHD A;  3VR8 A;  3UTE A;  2VQB A;  4UDR A;  1AOG A;  3LZW A;  3UOV A;  5U63 A;  1P2H A;  1K4Q A;  3GDP A;  2PHH A;  1YKJ A;  3GYJ A;  1ELI A;  1BZL A;  5CQF A;  2ZBW A;  3BNM A;  2JAE A;  1GET A;  1GAL A;  1GT8 A;  1Q1R A;  3KD9 A;  3Q6J A;  2TMD A;  4RG3 A;  4GR1 A;  1GRT A;  3SFD A;  4NTD A;  3P4S A;  4H4Q A;  2EQ9 A;  1PXA A;  2BYB A;  4EQX A;  1PN0 A;  1IUV A;  1JNZ A;  1KF6 A;  2XFN A;  2WES A;  4ZCC A;  4Z26 A;  2JKC A;  4JNQ A;  4DNA A;  4UDQ A;  1TDN A;  3GYI A;  4E0V A;  3NK0 X;  4K8D A;  1TDK A;  2RGO A;  1O94 A;  4TM4 A;  1NDA A;  4UDP A;  3CNJ A;  4B68 A;  2Y6Q A;  3EPT A;  1NPX A;  5JCK A;  4JDR A;  1P2E A;  2R0C A;  3KVE A;  3CN8 A;  4H4Y A;  2GMJ A;  3D8X A;  4AOX A;  1IUS A;  1FEA A;  1K0I A;  5C3J A;  3CIR A;  5KXJ A;  2ZZC A;  2YWL A;  3ZDN A;  2IVE A;  3KU9 A;  2R9Z A;  2I0Z A;  2R4J A;  3CNT A;  4GUV A;  1JEH A;  2FJE A;  1EL5 A;  2V60 A;  3EF6 A;  2YLS A;  3NHO X;  5IQ4 A;  2YR4 A;  2OA1 A;  4IA6 A;  1B37 A;  3UP5 A;  1HYU A;  3QJ4 A;  2GR2 A;  2QCU A;  3GSI A;  3UKK A;  5EB4 A;  1CJ4 A;  1Y0P A;  4CRT A;  2BK5 A;  4H2Q A;  4TLX A;  3DGZ A;  3BI4 A;  3K7T A;  2GMH A;  2GH5 A;  1DXL A;  3BHK A;  1GEU A;  1H83 A;  2DKH A;  1FEB A;  4IV9 A;  4A9W A;  3UOY A;  2YM2 A;  4B66 A;  1VG9 A;  1TYP A;  3QFA A;  5BVA A;  2IVD A;  2R45 A;  5HYM A;  1H7W A;  4YTN A;  2WP6 A;  5M10 A;  4YSH A;  4U2L A;  3OC4 A;  3IWA A;  1N4W A;  4JY3 A;  4OPT A;  1NG3 A;  2JB2 A;  3GD3 A;  2XFO A;  2X8H A;  3P9U A;  2JK6 A;  4H4Z A;  2YG4 A;  1B8S A;  5KVI A;  4U8K A;  2WOI A;  3LB8 A;  4AP1 A;  3DK8 A;  1S3B A;  1XPQ A;  1GRB A;  1NHS A;  3CTY A;  4FK1 C;  4U8L A;  2GB0 A;  3NK1 X;  1GSN A;  3ICS A;  2GR1 A;  1PDH A;  1DOE A;  1JNR A;  2GRT A;  4H4T A;  3UOZ A;  1VRQ B;  4D04 A;  1XHC A;  4KX6 A;  4U8I A;  4TM1 A;  4DSH A;  2E1M A;  4RSL A;  4EQR A;  4YT0 A;  1REO A;  2YR5 A;  3V76 A;  3DJJ A;  3L8K A;  2BK4 A;  1PBC A;  1CJC A;  3QSE A;  5EOW A;  2YVF A;  1NG4 A;  4EQW A;  3DH9 A;  3LAD A;  3QFB A;  4H2P A;  4GF7 A;  1S3E A;  4H4W A;  1CC6 A;  1KSU A;  4YTP A;  4EIP A;  5HXI A;  3FG2 P;  2CFY A;  3AE7 A;  3F8P A;  1N4U A;  4H4X A;  3O0H A;  2V3B A;  3AE5 A;  5J60 A;  5FS6 A;  4IVM B;  4USQ A;  2WP5 A;  3NKS A;  4JY2 A;  4LA1 A;  1YY5 A;  3S5W A;  2Q0L A;  3ADA B;  3CGD A;  4X4J A;  1F8W A;  3C4A A;  2ZZB A;  1DOB A;  3CNP A;  4YSY A;  1QLB A;  2EQ6 A;  5IQ1 A;  2X50 A;  1BGN A;  2YG6 A;  3NG7 X;  4C74 A;  2AAQ A;  2V5Z A;  4EQS A;  3AED A;  1LQU A;  2XFP A;  1D4C A;  3G5Q A;  4NTC A;  3NTA A;  4XXG A;  2C66 A;  3AE1 A;  4B64 A;  4ECH A;  3LOV A;  3IHM A;  3V3O A;  3B3R A;  3GRS A;  1KNP A;  3DK9 A;  1E1N A;  2VOU A;  1BWC A;  1EL9 A;  1M64 A;  4FX9 A;  2OLO A;  2Q6U A;  4TLZ A;  3UKF A;  2WP9 A;  4B67 A;  4YXD A;  4JN9 A;  3M13 A;  1GRG A;  3K7M X;  2O9Z A;  1YQZ A;  1H81 A;  3E1T A;  3I3L A;  3VRA A;  2C70 A;  4TM0 A;  1DOC A;  1EL7 A;  2ZZ0 A;  1RYI A;  1NEN A;  2XVJ A;  1KSS A;  1VDC A;  3FMW A;  1MO9 A;  1GTH A;  2VRM A;  4B69 A;  4CY8 A;  1H86 A;  2BCG G;  3KPF A;  4FK1 A;  4ZCD A;  3BNU A;  4O5U A;  2BAC A;  1PBE A;  1LTX R;  2XLR A;  1F6M A;  2YR6 A;  3PS9 A;  2V3A A;  3NN0 X;  1F3P A;  1XDI A;  4C3Y A;  3B6D A;  2YVG A;  2C3C A;  4BV6 A;  1COY A;  2YLW A;  3AEE A;  3AD9 B;  3CGB A;  2HQM A;  1D4E A;  4K5S A;  1NHR A;  1CC2 A;  4BJZ A;  1GPE A;  3G5R A;  4AT2 A;  1FEC A;  3UKL A;  1PJ6 A;  4JQ9 A;  3DK4 A;  1X31 B;  3I6D A;  3UTF A;  2BA9 A;  3ATQ A;  3M0O A;  3ZYX A;  3P4R A;  2B9X A;  2BXR A;  3SM8 A;  5DBJ A;  3DJD A;  2C64 A;  3IHG A;  2GAH B;  2WDR A;  4OPG A;  1V59 A;  2VQ7 A;  1GRH A;  2OAL A;  5M0Z A;  2RGH A;  1JRX A;  4U2S A;  4B63 A;  1XAN A;  3S61 A;  2RAB A;  1E1L A;  1PS9 A;  3KKJ A;  1UKV G;  3P1W A;  4A99 A;  3NYF A;  1L9E A;  5KWF A;  4DSG A;  4EM4 A;  3NH3 X;  1KDG A;  4H7U A;  3RP6 A;  1GES A;  4H2N A;  3AEC A;  1MOK A;  2APG A;  1K0J A;  1RSG A;  4K7Z A;  4YSX A;  4C5O A;  2R0G A;  4BK3 A;  3FBS A;  2XDO A;  4K2X A;  4X9M A;  2VZ2 A;  3AXB A;  1Q9I A;  3ALL A;  1GND A;  2XVF A;  1JOA A;  4OPL A;  4AOS A;  4B65 A;  1H84 A;  1RP0 A;  4J36 A;  2WOV A;  4Z2U A;  3AE6 A;  5C2T A;  3AE3 A;  4H2R A;  3BHF A;  4WCT A;  4U2T A;  3LXD A;  3NYE A;  5HY5 A;  4NEW A;  1ZDL A;  1TRB A;  1LJ1 A;  1JRZ A;  2OLN A;  3NLC A;  5EB5 A;  1BF3 A;  5FMH A;  3SQP A;  1ZKQ A;  1Y56 A;  1ZMC A;  1L0V A;  2FBW A;  3GRT A;  4I58 A;  1VQW A;  1PBF A;  4CCR A;  1PJ7 A;  3UTG A;  2WDQ A;  3FIM B;  2YLZ A;  1CHU A;  2VVL A;  4IA5 A;  2B7S A;  1S2Y A;  3L1R A;  4HA6 A;  3BI2 A;  1JU2 A;  4PAB A;  4U8J A;  1ONF A;  3ICR A;  1NEK A;  1DJN A;  3GMB A;  3PVC A;  3PO7 A;  1IUU A;  1MXT A;  3CGC A;  4NZH A;  4H50 A;  1NHP A;  1LPF A;  5BUL A;  1FL2 A;  4A5L A;  1OJD A;  4K22 A;  2H88 A;  1PBB A;  3LJP A;  1EBD A;  2WOW A;  1E7P A;  4N9X A;  1GRA A;  3CPJ G;  3ISH A;  3KA7 A;  4DGK A;  4J2W A;  4NTE A;  2XVI A;  1ZP0 A;  3NN6 X;  3NYC A;  2QAE A;  2DKI A;  2CVJ A;  2WU2 A;  3R9U A;  3ALM A;  4JNA A;  3RP8 A;  3P4P A;  4LII A;  1GV4 A;  4NEV A;  4EM3 A;  1SEZ A;  1CJ2 A;  5U1O A;  1TDF A;  4A65 A;  4BUR A;  4H4U A;  2OAM A; 
#chains in the Genus database with same CATH topology
 3SXI A;  5FS8 A;  2YLT A;  1FHU A;  4M0X A;  4OPC A;  1STZ A;  2C72 A;  2P3Z A;  2WS3 A;  2W55 A;  3BJS A;  3GD4 A;  3T31 A;  5LV9 A;  3DIP A;  4GDE A;  4XWR A;  4CNK A;  4YKG A;  2A89 A;  4G73 A;  3FCP A;  4GDP A;  4G6H A;  5FS9 A;  2YLR A;  3QVR A;  5FJU A;  3UCL A;  2PU0 A;  4APN A;  2UZZ A;  4EIQ A;  2GAG B;  4YKF A;  3SJN A;  4IT1 A;  2X99 A;  1EC7 A;  1IUX A;  3VQR A;  2VRL A;  1CJ3 A;  2GV8 A;  2IID A;  2QDE A;  2OPJ A;  2BRA A;  2BS2 A;  3T9P A;  1ZX9 A;  2BS3 A;  2JBV A;  1EC9 A;  4OPU A;  3JSK A;  3OZ2 A;  3NS1 B;  3CPI G;  1ZMD A;  2XYO A;  2CDU A;  5CKU A;  4Z44 A;  1M6I A;  2PMQ A;  2X8C A;  1VG0 A;  1LQT A;  1F9C A;  3SGL A;  1PHH A;  1S2Q A;  3AEF A;  2C65 A;  3P0W A;  3DGH A;  1NHQ A;  4I59 A;  3NTD A;  3AE2 A;  1PJ5 A;  3GWD A;  2B9W A;  3AD7 B;  2NPX A;  3AM9 A;  2WQY A;  4ADW A;  3EAO A;  2C75 A;  3NFU A;  3TJ4 A;  3GDN A;  2GGG A;  3T2K A;  1BKW A;  2FJA A;  5U25 A;  2V61 A;  4E4F A;  4GAP A;  3RHA A;  4J34 A;  2W0H A;  3DME A;  1KNR A;  1XS2 A;  2YVJ A;  4A7A A;  2YG7 A;  1SJD A;  5ENL A;  4E5T A;  4FDC B;  3AEB A;  2C76 A;  3BI5 A;  1WYG A;  3UTH A;  1GER A;  3H8A A;  4U8O A;  3N4E A;  3TW9 A;  2GF3 A;  2P0I A;  4Y4L A;  3T37 A;  3CPH G;  3NT6 A;  2BXS A;  2C67 A;  2GL5 A;  3AYJ A;  3UJR A;  3VR9 A;  4E6M A;  4H4P A;  1ECQ A;  3RIT A;  2C7G A;  4E8G A;  1H2I A;  1W6T A;  3UOX A;  1N4V A;  2RGJ A;  2HXU A;  3VFC A;  5JCN A;  2QA1 A;  3HPF A;  4EMJ A;  2GGI A;  2WHD A;  3MKC A;  2PHH A;  5CQF A;  2JAE A;  1WUE A;  4RG3 A;  3SFD A;  4GR1 A;  1GRT A;  3FVD A;  4EQX A;  1X2H A;  4JNQ A;  4DNA A;  4UDQ A;  3NK0 X;  2RGO A;  1O94 A;  4HCD A;  1NDA A;  4TM4 A;  4B68 A;  3FJ4 A;  3KVE A;  3CN8 A;  5FJR A;  3D8X A;  5C3J A;  2ZZC A;  3BSM A;  2ZAD A;  3A7A A;  2V60 A;  3EF6 A;  1B37 A;  1HYU A;  3QJ4 A;  1DTN A;  3PFR A;  2GH5 A;  4A9W A;  3UOY A;  1VG9 A;  3QFA A;  5BVA A;  2IVD A;  3Q45 A;  5M10 A;  7ENL A;  3UXK A;  2X8H A;  3P9U A;  2YG4 A;  1B8S A;  5KVI A;  3LB8 A;  1S3B A;  1XPQ A;  1MNS A;  3CTY A;  4ZCW A;  1ZXI C;  1JNR A;  3CAW A;  1XHC A;  3PG6 A;  1MDR A;  1PBC A;  3D9X A;  2HXT A;  4GIS A;  3TJI A;  3CMM A;  3LAD A;  3QFB A;  1CC6 A;  1KSU A;  3FG2 P;  3O0H A;  3EUB 3;  1F8W A;  1DOB A;  3NG7 X;  2YG6 A;  4C74 A;  2V5Z A;  1LQU A;  2O56 A;  4NTC A;  4XXG A;  3TOY A;  4B64 A;  3IHM A;  3V3O A;  2VOU A;  1BWC A;  2Q6U A;  3VC6 A;  4FX9 A;  2OLO A;  4TLZ A;  3M13 A;  1GRG A;  3K7M X;  1YQZ A;  4Z17 A;  1H81 A;  3R0U A;  3VRA A;  2C70 A;  1RYI A;  3HW2 A;  1H86 A;  4O5U A;  2BAC A;  3N4F A;  3PS9 A;  2YVG A;  1COY A;  2QJM A;  1MUC A;  1JDF A;  4K5S A;  4A6G A;  1GPE A;  4AT2 A;  1V97 A;  4JQ9 A;  3RRA A;  3ATQ A;  1X2G A;  3M0O A;  2ZC8 A;  4OPG A;  1N5W C;  4F4R A;  1EBH A;  1XAN A;  2RAB A;  3DG7 A;  2POD A;  4HPN A;  1JRP A;  1KDG A;  3RP6 A;  1K0J A;  4K7Z A;  4C5O A;  2R0G A;  2XDO A;  2VZ2 A;  2XVF A;  1H84 A;  1RP0 A;  4H2R A;  3NYE A;  1ZDL A;  1TRB A;  1BF3 A;  5FMH A;  1ZKQ A;  1ZMC A;  1L0V A;  1PBF A;  1CHU A;  3L1R A;  3ZLG A;  4JN7 A;  1JU2 A;  3NRZ B;  3PVC A;  3PO7 A;  4NZH A;  1WUF A;  1LPF A;  4A5L A;  3DGB A;  1PBB A;  1PDY A;  2WOW A;  6ENL A;  3NYC A;  2QAE A;  2DKI A;  3GD6 A;  2WU2 A;  1KKO A;  4EM3 A;  1SEZ A;  1TDF A;  4BUR A;  1JPD X;  3AMZ A;  2OAM A;  2PYX A;  1ZK7 A;  4C77 A;  3RR1 A;  5JCM A;  3ZVH A;  3WE0 A;  3UP4 A;  3SZC A;  2C3D A;  4OPD A;  1VQZ A;  2YG3 A;  4A79 A;  5G5G B;  2R46 A;  1N5X A;  1OJT A;  2PP1 A;  2C73 A;  3NIX A;  3P3B A;  2AR8 A;  1E1K A;  2XLT A;  3URH A;  3SZ0 A;  1KD0 A;  1TZZ A;  3QTP A;  1CF3 A;  1W4X A;  3AD8 B;  2PCE A;  2B76 A;  4DN1 A;  4WX1 A;  3RO6 A;  3SBF A;  1O5W A;  1ZY8 A;  3QVP A;  4II2 A;  3LZX A;  3AWI A;  2XLS A;  5L46 A;  5ER0 A;  3S5S A;  5GRT A;  3R11 A;  1NU5 A;  1FCD A;  2QQ6 A;  4Y4M A;  4A6N B;  3DG3 A;  2QDD A;  3DJE A;  4HNL A;  4YTM A;  4USR A;  2W3S A;  2Q7V A;  1BGJ A;  1R6W A;  3EAN A;  4PAA A;  1Q1W A;  1H82 A;  4ZA0 A;  3H8L A;  2MNR A;  3HZL A;  4KT2 A;  3R1Z A;  3UKH A;  3JW7 A;  3V3N A;  2XH7 A;  5J7X A;  3UKP A;  4YWS A;  2WET A;  1PXB A;  1E1M A;  1OJA A;  4U8P A;  3TWA A;  2AKZ A;  4CNJ A;  2HNE A;  2GGH A;  4GGH A;  2YM1 A;  1F8R A;  3AEA A;  1PXC A;  3TQP A;  4EMI A;  4O5Q A;  4UP3 A;  4AP3 A;  2OVL A;  4BJY A;  4G6G A;  1SJC A;  2J3N A;  1KFY A;  2Z5Y A;  5BRT A;  4IVO B;  2WPE A;  3VRB A;  1L9D A;  3EKG A;  2A8X A;  3UKQ A;  4Z2R A;  2GR0 A;  5JCL A;  3RNM A;  4GYP C;  1O95 A;  3UCC A;  4EWJ A;  1D7Y A;  4EMW A;  3NVV B;  2BC1 A;  4CCQ A;  1PBD A;  3CXB A;  1D4D A;  3R0K A;  3IJL A;  2VVL G;  1MDL A;  4K5R A;  3P4Q A;  1JRY A;  3H8I A;  3RP7 A;  3SYI A;  3B9J B;  2ACZ A;  3FV9 A;  3ITJ A;  2E5V A;  3F8R A;  1DOD A;  5HHF A;  3VR8 A;  3DFH A;  1FIQ B;  2VQB A;  1K4Q A;  1ELI A;  3BNM A;  1GT8 A;  3KD9 A;  2TMD A;  1IYX A;  1N63 C;  3P4S A;  4H4Q A;  2EQ9 A;  2BYB A;  3SN4 A;  1IUV A;  2XFN A;  4ZCC A;  1OEP A;  4E0V A;  3GYI A;  4GME A;  5JCK A;  4JDR A;  4H4Y A;  2FKP A;  4AOX A;  3I4K A;  1FEA A;  3KUM A;  1P43 A;  2YWL A;  3ZDN A;  4H2H A;  2R9Z A;  2FJE A;  5KMP A;  3ZVI A;  5IQ4 A;  3OPS A;  2QCU A;  3UKK A;  5EB4 A;  1CJ4 A;  1Y0P A;  3SSZ A;  1DXL A;  4IV9 A;  3Q4D A;  2YM2 A;  5G5H B;  4U2L A;  1N4W A;  4JY3 A;  2JB2 A;  2NQL A;  2WOI A;  3DK8 A;  1NHS A;  3MUC A;  3NK1 X;  2GRT A;  2OZ3 A;  3U9I A;  3UOZ A;  3OW1 A;  1N60 C;  4TM1 A;  4DSH A;  2E1M A;  3B97 A;  4TVW A;  3V76 A;  3DJJ A;  3L8K A;  3QSE A;  3IK4 A;  4GF7 A;  3F8P A;  3QLD A;  4H4X A;  2GSH A;  2PTX A;  2V3B A;  5J60 A;  4IVM B;  3ZLH A;  4GIR A;  2ZZB A;  4YSY A;  1QLB A;  5IQ1 A;  3H70 A;  3THU A;  3T4W A;  3G5Q A;  3AE1 A;  4ECH A;  2DW7 A;  1NEL A;  1KNP A;  1EL9 A;  3UKF A;  4B67 A;  4JN9 A;  2O9Z A;  3E1T A;  4IZG A;  1EC8 A;  3I3L A;  4TM0 A;  2ZZ0 A;  2XVJ A;  3FMW A;  1VDC A;  1MO9 A;  4DYE A;  4CY8 A;  3MY9 A;  2BCG G;  4FK1 A;  2XLR A;  2QJJ A;  2YR6 A;  1F3P A;  4C3Y A;  4BV6 A;  2YLW A;  3AEE A;  2HQM A;  3G5R A;  5J04 A;  3DK4 A;  2OLA A;  2E5A A;  3ZYX A;  1KN0 A;  1YEY A;  2QGY A;  2B9X A;  3SM8 A;  3NZG A;  5DBJ A;  2OFJ A;  3IHG A;  2GAH B;  1V59 A;  2OAL A;  2AL1 A;  3V4B A;  4A99 A;  3UXL A;  5KWF A;  4K8G A;  3AEC A;  1RSG A;  4YSX A;  3K1G A;  3HYW A;  4X9M A;  3AXB A;  3RGT A;  1Q9I A;  1GND A;  2P88 A;  2WOV A;  4Z2U A;  3DES A;  3AE3 A;  4U2T A;  2OLN A;  5EB5 A;  2FBW A;  3T8Q A;  3GRT A;  1PJ7 A;  3FIM B;  4IHC A;  2VVL A;  4GFI A;  4X2P A;  3CGC A;  1SJB A;  3UJF A;  4K22 A;  3LJP A;  4N9X A;  1GRA A;  3ISH A;  4J2W A;  2XVI A;  3NN6 X;  2CVJ A;  3NVY B;  2AL2 A;  3P4P A;  1BKH A;  1CJ2 A;  5U1O A;  4MKS A;  5JCI A;  3AE4 A;  4Z43 A;  4XWZ A;  5TR3 A;  3C96 A;  2JB3 A;  2FJB A;  3FYY A;  2ARD A;  2B7R A;  3QN3 A;  3SZF A;  2E3T A;  3M12 A;  1Y56 B;  4NWZ A;  3ES8 A;  2P8B A;  2X3N A;  2R4E A;  4D03 A;  1QO8 A;  4Z26 A;  2XH4 A;  3CNS A;  1H7X A;  4Y4N A;  4GCM A;  3CGE A;  2YLX A;  4REK A;  4M52 A;  1GRF A;  2GQF A;  1TYT A;  3QSS A;  4TM3 A;  2GGJ A;  3NNE A;  4JHM A;  2POZ A;  3T2Y A;  2Y6R A;  2WPC A;  3COX A;  5KVH A;  2E4G A;  3IF9 A;  1SJA A;  4U8N A;  2WBA A;  1F8S A;  2Z5X A;  3KLJ A;  2B9Y A;  4FI4 A;  2F5Z A;  2CUL A;  3SZW A;  5EBK A;  1KKR A;  3HRD C;  3SN1 A;  2A87 A;  1N1P A;  3TCS A;  2BC0 A;  4KPL A;  1XPY A;  3D46 A;  3AE9 A;  2X8G A;  2AQJ A;  1H6V A;  1DNC A;  2MUC A;  3II4 A;  1EL8 A;  4H4R A;  2GQW A;  3VC5 A;  3NRN A;  4J31 A;  3FPZ A;  1GOS A;  1FOH A;  1NAA A;  4X9N A;  2QA2 A;  3L5O A;  4J1O A;  4NNJ A;  1K0L A;  3PWI A;  4OPI A;  1GTE A;  2XFQ A;  4OCG A;  3AYI A;  3SQS A;  1CBO A;  2YAU A;  2XVE A;  4Z25 A;  2OQH A;  1GXF A;  3K30 A;  3AB1 A;  4CBQ A;  1SB3 B;  2H89 A;  3KPK A;  2FJD A;  5GSN A;  4KPR A;  1B5Q A;  1ZOY A;  2Q0K A;  3AN1 A;  3GC2 A;  2QJN A;  4DX3 A;  2PP3 A;  1ZOV A;  1CC4 A;  3JZU A;  1DJQ A;  4G8T A;  3RCY A;  3UKA A;  3R10 A;  3MWC A;  3AEG A;  3F8D A;  4JN8 A;  4P9S A;  3GMC A;  3HYX A;  5BUK A;  3DJG X;  2XH2 A;  3K7Q X;  4ROP A;  3NXL A;  2BCP A;  3CB3 A;  2XLP A;  2JB1 A;  1JCT A;  2YQU A;  3UTE A;  4DXK A;  1AOG A;  3LZW A;  5FJT A;  1P2H A;  1BZL A;  2ZBW A;  1GET A;  1GAL A;  3UJS A;  2GDQ A;  3CYJ A;  4NTD A;  3CXO A;  1PXA A;  1KF6 A;  2WES A;  1TDN A;  3VCN A;  1TDK A;  3H12 A;  2Y6Q A;  3EPT A;  5IDZ A;  1IUS A;  3CIR A;  2IVE A;  2OZT A;  2I0Z A;  2R4J A;  3CNT A;  4GUV A;  1JEH A;  1EL5 A;  4G9K A;  2YR4 A;  2OA1 A;  3UP5 A;  2GR2 A;  3GSI A;  4CRT A;  3DDM A;  2CHR A;  3BI4 A;  2GMH A;  3BHK A;  4KEM A;  1H83 A;  1FEB A;  4B66 A;  2PPG A;  1TYP A;  2R45 A;  5HYM A;  2DW6 A;  1H7W A;  4YTN A;  3OC4 A;  4H4Z A;  3N6J A;  4FK1 C;  4U8L A;  2GB0 A;  1DOE A;  3HYV A;  1VRQ B;  4D04 A;  4KX6 A;  4EQR A;  4YT0 A;  2YR5 A;  4GYP A;  2YVF A;  2PU1 A;  4HYR A;  4YTP A;  4EIP A;  2OKT A;  1N4U A;  5FS6 A;  2WP5 A;  4LA1 A;  1YY5 A;  3S5W A;  3ADA B;  3C4A A;  3CNP A;  2X50 A;  1BGN A;  3AED A;  2PA6 A;  4A3R A;  3EEZ A;  1D4C A;  3NTA A;  2C66 A;  4G74 A;  3LOV A;  5FJP A;  4G7F A;  1E1N A;  1M64 A;  4IL0 A;  1DOC A;  4Z2T A;  1NEN A;  3STP A;  4B69 A;  4ZCD A;  2W3R A;  1LTX R;  3NN0 X;  2C3C A;  2PP0 A;  3AD9 B;  3CGB A;  4BJZ A;  3D47 A;  3UKL A;  1X31 B;  2OX4 A;  1KCZ A;  1GRH A;  2C4C A;  2RGH A;  1JRX A;  4U2S A;  4B63 A;  3S61 A;  1VDV A;  1E1L A;  3KKJ A;  1UKV G;  3SN0 A;  1L9E A;  2PTW A;  4DSG A;  4EM4 A;  4H7U A;  1GES A;  4H2N A;  1MOK A;  2APG A;  4K1W A;  5BOF A;  1JOA A;  4OPL A;  4B65 A;  4J36 A;  3AE6 A;  5C2T A;  3ETR B;  3GO2 A;  4WCT A;  5HY5 A;  4NEW A;  3QKE A;  1JRZ A;  1LJ1 A;  4M6U A;  1Y56 A;  3ZVH B;  1VQW A;  4CCR A;  3UTG A;  2YLZ A;  1S2Y A;  4IL2 A;  1ONE A;  4PAB A;  4U8J A;  1ONF A;  5EU9 A;  1NEK A;  3ICR A;  4K2S A;  1DJN A;  3GMB A;  4H50 A;  5BUL A;  1FL2 A;  4ZOH B;  1EBD A;  2AL2 B;  3OP2 A;  3KA7 A;  4DGK A;  4J3Z A;  1ZP0 A;  2I5Q A;  3R9U A;  4E4U A;  4JNA A;  3RP8 A;  3OZY A;  3DER A;  2WPF A;  3QPE A;  3ALJ A;  3IC9 A;  4A65 A;  4J33 A;  4ZN0 A;  5KOW A;  4GRT A;  2WEU A;  2GGE A;  1CL0 A;  3AYL A;  1B4V A;  1TDE A;  5IPY A;  1IUW A;  1OJ9 A;  1D7L A;  4YWO A;  2V6O A;  3SFE A;  4U8M A;  1IUT A;  3G5S A;  2XGZ A;  3GWF A;  4LU6 A;  3SY4 A;  4HB9 A;  3V5F A;  1TE6 A;  3DG6 A;  3A7R A;  2AKM A;  3U4F A;  3MZN A;  2YG5 A;  3TWB A;  1RM6 B;  4Z24 A;  4J57 A;  2BK3 A;  2PTZ A;  4J56 A;  4C3X A;  1YQ4 A;  2GEW A;  4H1Z A;  2EQ7 A;  4MMW A;  1P48 A;  2BAB A;  4BK1 A;  3ABV A;  1QJD A;  5KNL A;  3H4K A;  3VA8 A;  3T2Z A;  3ENL A;  1IJH A;  4DHG A;  1YQ3 A;  3DA1 A;  3OZM A;  4ENL A;  3P93 A;  2XFU A;  3ICT A;  2PS2 A;  3NK2 X;  2HZG A;  1GRE A;  4H4V A;  3I6T A;  4H83 A;  1L9C A;  5KMR A;  2NVK X;  1OJC A;  4OVI A;  3NGC X;  4CY6 A;  1LVL A;  2XLU A;  3T6C A;  3CK5 A;  3N6H A;  1S7M A;  1E39 A;  4FP1 A;  3A7U A;  2WDV A;  3PK7 A;  1TDO A;  3MQT A;  1E6E A;  2BS4 A;  3QSM A;  3CND A;  3Q9T A;  3C4N A;  3R07 C;  1FHV A;  2WU5 A;  4ICY A;  3RED A;  1Z6L A;  4H4S A;  5KOX A;  2XCG A;  4YSZ A;  4A6N A;  4AT0 A;  2GVC A;  3V3W A;  1LV0 A;  1MRA A;  3D1C A;  3ATR A;  4MJW A;  3GY1 A;  2TPR A;  3UCD A;  5FS7 A;  3PWG A;  4BK2 A;  2R0P A;  3R25 A;  5KRQ A;  2BRY A;  4GGB A;  1D5T A;  3NVW B;  2XVH A;  2GR3 A;  3VRD B;  4B1B A;  3CT2 A;  3SR6 B;  3AE8 A;  4RG4 A;  1RVK A;  4H19 A;  2EQ8 A;  2VVM A;  3DFY A;  4UDR A;  3UOV A;  5U63 A;  3GDP A;  3GYJ A;  1YKJ A;  1Q1R A;  3Q6J A;  3NVZ B;  1PN0 A;  1JNZ A;  3MSY A;  2JKC A;  3IJQ A;  4K8D A;  3ES7 A;  4UDP A;  3CNJ A;  3ZLF A;  1NPX A;  1P2E A;  2R0C A;  3JVA A;  5BOE A;  2GMJ A;  5KMQ A;  5KXJ A;  1K0I A;  1L8P A;  3KU9 A;  1TKK A;  2YLS A;  3NHO X;  4IA6 A;  4A35 A;  2PSN A;  4H2Q A;  2BK5 A;  4TLX A;  3DGZ A;  3K7T A;  1GEU A;  2DKH A;  2WP6 A;  4YSH A;  4OPT A;  3IWA A;  2OO6 A;  1FFV C;  5JRB A;  1N62 C;  4HNC A;  1NG3 A;  3GD3 A;  2XFO A;  2OG9 A;  1T3Q C;  2JK6 A;  4U8K A;  4AP1 A;  1GRB A;  4HN8 A;  3SX6 A;  1GSN A;  3ICS A;  2GR1 A;  1PDH A;  4H4T A;  1PDZ A;  4KWS A;  4U8I A;  4HCL A;  4DWD A;  4RSL A;  1REO A;  2BK4 A;  1CJC A;  5EOW A;  2PGW A;  1NG4 A;  4EQW A;  3DH9 A;  4MGG A;  4H2P A;  1S3E A;  4H4W A;  5HXI A;  3VDG A;  2CFY A;  3AE7 A;  4Z1Y A;  5FJO A;  3AE5 A;  3NO1 A;  4USQ A;  1N61 C;  3NKS A;  4JY2 A;  2Q0L A;  4X4J A;  3CGD A;  2EQ6 A;  4IP4 A;  2AAQ A;  4EQS A;  2XFP A;  2XH0 A;  3BOX A;  3B3R A;  3GRS A;  2PGE A;  3DK9 A;  4YXD A;  2WP9 A;  2ONE A;  3UJ2 A;  2OQY A;  1E9I A;  1EL7 A;  1KSS A;  1GTH A;  2VRM A;  2XSX A;  3KPF A;  3BNU A;  1PBE A;  2RDX A;  1F6M A;  2V3A A;  1XDI A;  3B6D A;  1D4E A;  1NHR A;  1CC2 A;  2P8C A;  4TVY A;  1FEC A;  4GAV A;  1PJ6 A;  3I6D A;  3UTF A;  2BA9 A;  1BQG A;  3P4R A;  2BXR A;  3S47 A;  3DJD A;  2C64 A;  4II3 A;  2WDR A;  3V5C A;  2VQ7 A;  5M0Z A;  3GYX A;  3TTE A;  1PS9 A;  3P1W A;  3NYF A;  1EBG A;  3NH3 X;  3OTR A;  5KMS A;  4BK3 A;  3FBS A;  4K2X A;  2PTY A;  3UJE A;  3ALL A;  4AOS A;  3BHF A;  3LXD A;  3NLC A;  3SQP A;  2FYM A;  1JPM A;  4I58 A;  1R0M A;  2WDQ A;  4IA5 A;  2B7S A;  4HA6 A;  3BI2 A;  1FFU C;  2W54 A;  1IUU A;  1MXT A;  1NHP A;  1JRO A;  1OJD A;  2H88 A;  3T0K A;  3T14 A;  1E7P A;  3FXG A;  3CPJ G;  3UGV A;  4NTE A;  3I6E A;  3VCC A;  3H7V A;  2QVH A;  4IP5 A;  3ALM A;  4LII A;  1GV4 A;  4NEV A;  3DEQ A;  3IJI A;  4HCH A;  2OZ8 A;  1FO4 A;  1ELS A;  4H4U A; 
#chains in the Genus database with same CATH homology
 5JCI A;  2WPF A;  3AE4 A;  3SXI A;  4Z43 A;  3ALJ A;  3IC9 A;  5FS8 A;  5TR3 A;  2PYX A;  2JB3 A;  2YLT A;  2FJB A;  3C96 A;  4J33 A;  4XWZ A;  1ZK7 A;  4C77 A;  4OPC A;  2ARD A;  2B7R A;  5JCM A;  4ZN0 A;  5KOW A;  3WE0 A;  4GRT A;  3UP4 A;  2WEU A;  2C72 A;  3SZC A;  3AYL A;  1CL0 A;  2WS3 A;  1B4V A;  2C3D A;  3SZF A;  1TDE A;  3M12 A;  4OPD A;  5IPY A;  1IUW A;  1OJ9 A;  1Y56 B;  4NWZ A;  4A79 A;  2YG3 A;  1D7L A;  4YWO A;  2X3N A;  2R46 A;  3GD4 A;  2V6O A;  2R4E A;  3T31 A;  1OJT A;  5LV9 A;  2C73 A;  3SFE A;  4D03 A;  1QO8 A;  3NIX A;  4U8M A;  2AR8 A;  1IUT A;  4GDE A;  4XWR A;  1E1K A;  3CNS A;  1H7X A;  2XLT A;  4Y4N A;  3G5S A;  3URH A;  3SZ0 A;  3GWF A;  4LU6 A;  3SY4 A;  4CNK A;  4GCM A;  4YKG A;  4HB9 A;  3CGE A;  2A89 A;  2YLX A;  4G73 A;  4REK A;  4M52 A;  1GRF A;  2GQF A;  1CF3 A;  1TYT A;  1W4X A;  3QSS A;  3AD8 B;  2B76 A;  4TM3 A;  4GDP A;  4G6H A;  3NNE A;  5FS9 A;  2YG5 A;  4WX1 A;  2YLR A;  3QVR A;  2Y6R A;  3T2Y A;  4Z24 A;  3UCL A;  2WPC A;  4APN A;  2UZZ A;  3COX A;  5KVH A;  4EIQ A;  4J57 A;  2BK3 A;  1O5W A;  2E4G A;  1ZY8 A;  3QVP A;  3IF9 A;  2GAG B;  4YKF A;  2X99 A;  4J56 A;  4II2 A;  3LZX A;  3AWI A;  4U8N A;  2WBA A;  2XLS A;  5L46 A;  4Z2T A;  1IUX A;  5ER0 A;  3VQR A;  2VRL A;  5GRT A;  4C3X A;  1FCD A;  1CJ3 A;  1YQ4 A;  2GV8 A;  1F8S A;  2GEW A;  4Y4M A;  4A6N B;  2IID A;  2Z5X A;  3KLJ A;  2B9Y A;  2BRA A;  2BS2 A;  2CUL A;  2F5Z A;  3DJE A;  4YTM A;  2EQ7 A;  1ZX9 A;  4USR A;  3SZW A;  5EBK A;  2BS3 A;  2JBV A;  2A87 A;  1BGJ A;  1N1P A;  2Q7V A;  3EAN A;  2BAB A;  4OPU A;  2BC0 A;  4PAA A;  1Q1W A;  4BK1 A;  3ABV A;  1H82 A;  3JSK A;  3OZ2 A;  1QJD A;  5KNL A;  3H8L A;  3H4K A;  1IJH A;  3HZL A;  3T2Z A;  3CPI G;  3DA1 A;  1YQ3 A;  1ZMD A;  2X8G A;  3AE9 A;  2AQJ A;  1H6V A;  3UKH A;  3V3N A;  2XYO A;  1DNC A;  2CDU A;  5J7X A;  3UKP A;  2XFU A;  5CKU A;  3ICT A;  3NK2 X;  4Z44 A;  3II4 A;  2WET A;  1GRE A;  1PXB A;  4H4V A;  1EL8 A;  4H4R A;  2GQW A;  1M6I A;  1E1M A;  1OJA A;  3NRN A;  4J31 A;  3FPZ A;  1GOS A;  4U8P A;  1FOH A;  1NAA A;  2X8C A;  1VG0 A;  1LQT A;  1L9C A;  4X9N A;  5KMR A;  3SGL A;  1PHH A;  2QA2 A;  1S2Q A;  3AEF A;  4CNJ A;  3L5O A;  4NNJ A;  2NVK X;  1K0L A;  4OPI A;  2C65 A;  3DGH A;  1OJC A;  1NHQ A;  4I59 A;  4OVI A;  2YM1 A;  3NGC X;  3NTD A;  3AE2 A;  1GTE A;  4CY6 A;  1F8R A;  1PJ5 A;  1LVL A;  2XFQ A;  4OCG A;  3GWD A;  2B9W A;  2XLU A;  3AD7 B;  3AEA A;  2NPX A;  1PXC A;  2WQY A;  4EMI A;  4O5Q A;  4UP3 A;  1S7M A;  1E39 A;  4AP3 A;  4ADW A;  3EAO A;  2C75 A;  3AYI A;  2WDV A;  1CBO A;  2YAU A;  2XVE A;  1TDO A;  4Z25 A;  1GXF A;  1E6E A;  3K30 A;  3AB1 A;  4CBQ A;  3GDN A;  4BJY A;  4G6G A;  2J3N A;  2BS4 A;  1KFY A;  2H89 A;  3KPK A;  3QSM A;  1BKW A;  2FJD A;  2Z5Y A;  3T2K A;  3CND A;  5BRT A;  4IVO B;  3Q9T A;  2FJA A;  4KPR A;  5U25 A;  2WPE A;  1B5Q A;  3C4N A;  5GSN A;  2V61 A;  1L9D A;  1ZOY A;  3VRB A;  2WU5 A;  2Q0K A;  4GAP A;  2A8X A;  4ICY A;  3RHA A;  4J34 A;  3UKQ A;  2W0H A;  3DME A;  1KNR A;  3RED A;  1Z6L A;  2YVJ A;  4H4S A;  4Z2R A;  4A7A A;  5KOX A;  2XCG A;  2GR0 A;  4YSZ A;  5JCL A;  4A6N A;  2YG7 A;  4AT0 A;  3RNM A;  1ZOV A;  1CC4 A;  4FDC B;  3AEB A;  2GVC A;  1DJQ A;  1O95 A;  2C76 A;  3BI5 A;  1LV0 A;  3UKA A;  3D1C A;  1D7Y A;  4EMW A;  3ATR A;  4MJW A;  1GER A;  3UTH A;  4U8O A;  2TPR A;  3AEG A;  2BC1 A;  5FS7 A;  3F8D A;  2GF3 A;  4BK2 A;  2R0P A;  4CCQ A;  4Y4L A;  3T37 A;  5KRQ A;  3CPH G;  2BRY A;  3NT6 A;  1PBD A;  2BXS A;  1D4D A;  2C67 A;  4P9S A;  3GMC A;  3AYJ A;  1D5T A;  3HYX A;  3VR9 A;  2VVL G;  2XVH A;  4H4P A;  2GR3 A;  3VRD B;  2C7G A;  4K5R A;  3P4Q A;  1H2I A;  1JRY A;  3H8I A;  4B1B A;  5BUK A;  3UOX A;  1N4V A;  3RP7 A;  3SYI A;  3DJG X;  2RGJ A;  3K7Q X;  2BCP A;  2ACZ A;  5JCN A;  2XLP A;  3ITJ A;  2E5V A;  3AE8 A;  2QA1 A;  1DOD A;  2JB1 A;  3F8R A;  4RG4 A;  4EMJ A;  2YQU A;  2EQ8 A;  2VVM A;  5HHF A;  2WHD A;  3VR8 A;  3UTE A;  2VQB A;  4UDR A;  1AOG A;  3LZW A;  3UOV A;  5U63 A;  1P2H A;  1K4Q A;  3GDP A;  2PHH A;  1YKJ A;  3GYJ A;  1ELI A;  1BZL A;  5CQF A;  2ZBW A;  3BNM A;  2JAE A;  1GET A;  1GAL A;  1GT8 A;  1Q1R A;  3KD9 A;  3Q6J A;  2TMD A;  4RG3 A;  4GR1 A;  1GRT A;  3SFD A;  4NTD A;  3P4S A;  4H4Q A;  2EQ9 A;  1PXA A;  2BYB A;  4EQX A;  1PN0 A;  1IUV A;  1JNZ A;  1KF6 A;  2XFN A;  2WES A;  4ZCC A;  4Z26 A;  2JKC A;  4JNQ A;  4DNA A;  4UDQ A;  1TDN A;  3GYI A;  4E0V A;  3NK0 X;  4K8D A;  1TDK A;  2RGO A;  1O94 A;  4TM4 A;  1NDA A;  4UDP A;  3CNJ A;  4B68 A;  2Y6Q A;  3EPT A;  1NPX A;  5JCK A;  4JDR A;  1P2E A;  2R0C A;  3KVE A;  3CN8 A;  4H4Y A;  2GMJ A;  3D8X A;  4AOX A;  1IUS A;  1FEA A;  1K0I A;  5KMQ A;  3CIR A;  5C3J A;  5KXJ A;  2ZZC A;  2YWL A;  3ZDN A;  2IVE A;  3KU9 A;  2R9Z A;  2I0Z A;  2R4J A;  3CNT A;  4GUV A;  1JEH A;  2FJE A;  1EL5 A;  2V60 A;  5KMP A;  3EF6 A;  4G9K A;  2YLS A;  3NHO X;  5IQ4 A;  2YR4 A;  2OA1 A;  4IA6 A;  1B37 A;  3UP5 A;  1HYU A;  3QJ4 A;  2GR2 A;  2QCU A;  3GSI A;  3UKK A;  5EB4 A;  1CJ4 A;  1Y0P A;  4CRT A;  2BK5 A;  4H2Q A;  4TLX A;  3DGZ A;  3BI4 A;  3K7T A;  2GMH A;  2GH5 A;  1DXL A;  3BHK A;  1GEU A;  1H83 A;  2DKH A;  1FEB A;  4IV9 A;  4A9W A;  3UOY A;  2YM2 A;  4B66 A;  1VG9 A;  1TYP A;  3QFA A;  5BVA A;  2IVD A;  2R45 A;  5HYM A;  1H7W A;  4YTN A;  2WP6 A;  5M10 A;  4YSH A;  4U2L A;  3OC4 A;  3IWA A;  1N4W A;  4JY3 A;  4OPT A;  5JRB A;  1NG3 A;  2JB2 A;  3GD3 A;  2XFO A;  2X8H A;  3P9U A;  2JK6 A;  4H4Z A;  2YG4 A;  1B8S A;  5KVI A;  4U8K A;  2WOI A;  3LB8 A;  4AP1 A;  3DK8 A;  1S3B A;  1XPQ A;  1GRB A;  1NHS A;  3CTY A;  4FK1 C;  4U8L A;  2GB0 A;  3NK1 X;  3SX6 A;  1GSN A;  3ICS A;  2GR1 A;  1PDH A;  1DOE A;  1JNR A;  3HYV A;  2GRT A;  4H4T A;  3UOZ A;  1VRQ B;  4D04 A;  1XHC A;  4KX6 A;  4U8I A;  4TM1 A;  4DSH A;  2E1M A;  3PG6 A;  4RSL A;  4EQR A;  4YT0 A;  1REO A;  2YR5 A;  3V76 A;  3DJJ A;  3L8K A;  2BK4 A;  1PBC A;  1CJC A;  3QSE A;  5EOW A;  2YVF A;  3D9X A;  1NG4 A;  4EQW A;  3DH9 A;  3CMM A;  3LAD A;  3QFB A;  4H2P A;  4GF7 A;  1S3E A;  4H4W A;  1CC6 A;  1KSU A;  4YTP A;  4EIP A;  5HXI A;  3FG2 P;  2CFY A;  3AE7 A;  3F8P A;  1N4U A;  4H4X A;  3O0H A;  2V3B A;  3AE5 A;  5J60 A;  5FS6 A;  4IVM B;  4USQ A;  2WP5 A;  3NKS A;  4JY2 A;  4LA1 A;  1YY5 A;  3S5W A;  2Q0L A;  3ADA B;  3CGD A;  4X4J A;  1F8W A;  3C4A A;  2ZZB A;  1DOB A;  3CNP A;  4YSY A;  1QLB A;  2EQ6 A;  5IQ1 A;  2X50 A;  1BGN A;  2YG6 A;  3NG7 X;  4C74 A;  2AAQ A;  2V5Z A;  4EQS A;  3AED A;  1LQU A;  2XFP A;  1D4C A;  3G5Q A;  4NTC A;  3NTA A;  4XXG A;  2C66 A;  4G74 A;  3AE1 A;  4B64 A;  4ECH A;  3LOV A;  3IHM A;  3V3O A;  3B3R A;  3GRS A;  1KNP A;  3DK9 A;  1E1N A;  2VOU A;  1BWC A;  1EL9 A;  1M64 A;  4FX9 A;  2OLO A;  2Q6U A;  4TLZ A;  3UKF A;  2WP9 A;  4B67 A;  4YXD A;  4JN9 A;  3M13 A;  1GRG A;  3K7M X;  2O9Z A;  1YQZ A;  1H81 A;  3E1T A;  3I3L A;  3VRA A;  2C70 A;  4TM0 A;  1DOC A;  1EL7 A;  2ZZ0 A;  1RYI A;  1NEN A;  2XVJ A;  1KSS A;  1VDC A;  3FMW A;  1MO9 A;  1GTH A;  2VRM A;  4B69 A;  4CY8 A;  1H86 A;  2BCG G;  3KPF A;  4FK1 A;  4ZCD A;  3BNU A;  4O5U A;  2BAC A;  1PBE A;  1LTX R;  2XLR A;  1F6M A;  2YR6 A;  3PS9 A;  2V3A A;  3NN0 X;  1F3P A;  1XDI A;  4C3Y A;  3B6D A;  2YVG A;  2C3C A;  4BV6 A;  1COY A;  2YLW A;  3AEE A;  3AD9 B;  3CGB A;  2HQM A;  1D4E A;  4K5S A;  1NHR A;  1CC2 A;  4BJZ A;  1GPE A;  3G5R A;  4AT2 A;  1FEC A;  3UKL A;  4GAV A;  1PJ6 A;  4JQ9 A;  3DK4 A;  1X31 B;  3I6D A;  3UTF A;  2BA9 A;  3ATQ A;  3M0O A;  3ZYX A;  1KN0 A;  3P4R A;  2B9X A;  2BXR A;  3SM8 A;  5DBJ A;  3DJD A;  2C64 A;  4II3 A;  3IHG A;  2GAH B;  2WDR A;  4OPG A;  1V59 A;  2VQ7 A;  1GRH A;  2OAL A;  5M0Z A;  3GYX A;  2C4C A;  2RGH A;  1JRX A;  4U2S A;  4B63 A;  1XAN A;  3S61 A;  2RAB A;  1E1L A;  1PS9 A;  3KKJ A;  1UKV G;  3P1W A;  4A99 A;  3NYF A;  1L9E A;  5KWF A;  4DSG A;  4EM4 A;  3NH3 X;  1KDG A;  4H7U A;  3RP6 A;  1GES A;  4H2N A;  3AEC A;  1MOK A;  2APG A;  1K0J A;  1RSG A;  5KMS A;  4K7Z A;  4YSX A;  4C5O A;  2R0G A;  4BK3 A;  3FBS A;  2XDO A;  3HYW A;  4K2X A;  2VZ2 A;  3AXB A;  4X9M A;  1Q9I A;  3ALL A;  1GND A;  2XVF A;  1JOA A;  4OPL A;  4AOS A;  4B65 A;  1H84 A;  1RP0 A;  4J36 A;  2WOV A;  4Z2U A;  3AE6 A;  5C2T A;  3AE3 A;  4H2R A;  3BHF A;  4WCT A;  4U2T A;  3LXD A;  3NYE A;  5HY5 A;  4NEW A;  1ZDL A;  1TRB A;  1LJ1 A;  1JRZ A;  2OLN A;  3NLC A;  5EB5 A;  1BF3 A;  5FMH A;  3SQP A;  1ZKQ A;  1Y56 A;  1ZMC A;  1L0V A;  2FBW A;  3GRT A;  4I58 A;  1VQW A;  1PBF A;  4CCR A;  1PJ7 A;  3UTG A;  2WDQ A;  3FIM B;  2YLZ A;  1CHU A;  2VVL A;  4IA5 A;  2B7S A;  1S2Y A;  3L1R A;  4HA6 A;  3BI2 A;  1JU2 A;  4PAB A;  4U8J A;  1ONF A;  3ICR A;  1NEK A;  1DJN A;  3GMB A;  3PVC A;  3PO7 A;  1IUU A;  1MXT A;  3CGC A;  4NZH A;  4H50 A;  1NHP A;  1LPF A;  5BUL A;  1FL2 A;  4A5L A;  1OJD A;  4K22 A;  2H88 A;  1PBB A;  3LJP A;  1EBD A;  2WOW A;  3T0K A;  3T14 A;  1E7P A;  4N9X A;  1GRA A;  3CPJ G;  3ISH A;  3KA7 A;  4DGK A;  4J2W A;  4NTE A;  2XVI A;  1ZP0 A;  3NN6 X;  3NYC A;  2QAE A;  2DKI A;  2CVJ A;  2WU2 A;  3R9U A;  3ALM A;  4JNA A;  3RP8 A;  3P4P A;  4LII A;  1GV4 A;  4NEV A;  4EM3 A;  1SEZ A;  1CJ2 A;  5U1O A;  1TDF A;  4A65 A;  4BUR A;  4H4U A;  2OAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...