1JOAA

Nadh peroxidase with cysteine-sulfenic acid
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
447
structure length
446
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title Structure of the native cysteine-sulfenic acid redox center of enterococcal NADH peroxidase refined at 2.8 A resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 138
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1996-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1joaA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1joaA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1joaA02
4H2QA 1KNRA 3QFBA 4USRA 3REDA 4H4PA 3IHMA 3AE8A 3ATRA 1PJ5A 3AEFA 1YY5A 2PYXA 3IWAA 2JKCA 2Q0KA 2E5VA 4TM1A 4OCGA 2C65A 3ALMA 2QA1A 3COXA 1FL2A 2XFQA 3QFAA 4XWZA 3VR9A 1Y56B 3VRAA 3GYIA 3NKSA 1LQUA 4J31A 2X3NA 1LTXR 2YLZA 3AE6A 3GSIA 4GF7A 3I6DA 4H4XA 2GQWA 4RG3A 4UP3A 3KKJA 5GSNA 3HZLA 3VRDB 5KOWA 2W0HA 1F6MA 3M12A 4N9XA 3DMEA 3ICRA 2Z5YA 3AE7A 5KRQA 1F3PA 4GR1A 2EQ7A 3BI4A 4YKGA 1S3BA 1TDKA 1VQWA 3AE4A 1GXFA 4Z24A 1DOCA 2O9ZA 3CNDA 2YVFA 1CJ4A 1Q9IA 1NEKA 1D7LA 3NIXA 4U8OA 3GWDA 3IHGA 1TYTA 2C72A 2C76A 1CJCA 4ICYA 2BCGG 4C3YA 1IUUA 4BJZA 2WPCA 2YQUA 3NYCA 1H6VA 3OZ2A 1OJAA 1GRFA 1S3EA 3LB8A 3ICTA 2R0CA 2GR1A 4H4ZA 3UCLA 2XVIA 2X8CA 3AD9B 3GD3A 1GRBA 1FCDA 1EL9A 4OPLA 5KXJA 2BC1A 4GRTA 1DOEA 3D8XA 4FK1A 4TLXA 4JY2A 2YG4A 3NK1X 1PHHA 4H2PA 4GUVA 2QAEA 2RABA 2GEWA 4A99A 1CC4A 1PBDA 1E7PA 2OLNA 2BYBA 1JNZA 1N4VA 3CNPA 4YTMA 2VVLG 3SFDA 2R46A 1BWCA 2BK5A 3PVCA 1B5QA 2J3NA 2XFPA 3NT6A 4WCTA 4Y4NA 4LIIA 2GF3A 2XYOA 3AE2A 1CF3A 3BHFA 2C7GA 4AP3A 3UKKA 5BVAA 2A8XA 2B9XA 3QVRA 4CRTA 4K8DA 3CNSA 3AE9A 3P4SA 1EL8A 4Z2TA 4NEWA 2X99A 4YSXA 1N4WA 3UP5A 1H83A 2Y6QA 2R4JA 5DBJA 5M0ZA 2V61A 3T37A 4AP1A 4CCRA 1GRAA 1M6IA 2B7SA 3C96A 3NYEA 4WX1A 2WESA 2VOUA 3NTAA 2Q7VA 4OPIA 5BULA 1GNDA 1PXAA 3K30A 3NG7X 4X9NA 2VVMA 2JB1A 2ZBWA 2JBVA 3UKQA 4BV6A 4TM4A 4A9WA 3BI2A 4IVOB 4JNQA 2V6OA 2FJDA 2AQJA 4FX9A 3CGDA 1GTHA 2BXSA 4B66A 3C4NA 3NH3X 3UKPA 1GETA 4U2TA 3VRBA 1Y0PA 3V3OA 3UTGA 4A65A 2FBWA 2XLSA 1GRGA 3BNUA 3JSKA 4J34A 3ZDNA 2YAUA 3DJEA 3DJJA 1LJ1A 4YKFA 2YVJA 3UOXA 3GDPA 4I59A 3UP4A 3ZYXA 2X50A 3AYJA 1KSSA 1FEAA 4M52A 2VRMA 2WDRA 2XVJA 1H81A 1JU2A 3ADAB 3GDNA 2B7RA 4AOSA 1GRTA 4YT0A 3SM8A 1GEUA 1KDGA 2AAQA 2PHHA 3P4RA 4C5OA 1DJNA 2BK4A 2XFNA 2GV8A 2Q0LA 2IVEA 4U8IA 2YLWA 2BCPA 3E1TA 2ZZ0A 4H7UA 4APNA 2JK6A 1H7WA 2XFUA 5EOWA 2GRTA 2NPXA 2XDOA 3P9UA 1F8WA 1GERA 2C3CA 2YM1A 1JNRA 1HYUA 3CTYA 2JB2A 1CC6A 3LOVA 1GESA 4DGKA 4Z43A 4YXDA 3C4AA 1LVLA 1EL7A 1NG4A 1L9DA 4UDRA 1ZKQA 4U8MA 3NTDA 4XWRA 1RYIA 1BZLA 2YLSA 3AECA 2WOVA 4K5SA 3VR8A 1ZK7A 5KOXA 3DK8A 2XFOA 1IUVA 4C3XA 4LA1A 2VQ7A 2GQFA 5KWFA 4JY3A 1NHSA 1CJ2A 2TMDA 3F8DA 3NK0X 2ACZA 1VG9A 3CNTA 4OPDA 1H86A 1W4XA 1QJDA 2WBAA 3KA7A 1XDIA 4HB9A 2R9ZA 2C70A 2FJEA 3ISHA 3EAOA 3UKAA 3G5SA 4AOXA 2C3DA 4EMJA 4NTCA 4PAAA 1D4EA 3ABVA 1D7YA 4A7AA 2FJAA 2Y6RA 1CJ3A 1Z6LA 5EB4A 1XPQA 2C75A 3BNMA 2V3AA 3IF9A 3DGZA 1GPEA 1YKJA 1NPXA 3NRNA 4P9SA 3NK2X 3K7TA 3RP7A 4FK1C 3ALLA 5JCLA 3ATQA 3F8PA 1ZY8A 3B3RA 3NHOX 1K4QA 1CC2A 3GWFA 2CVJA 3AWIA 3GD4A 3G5RA 2BS4A 4B67A 1QO8A 3NN6X 4H4TA 4K2XA 4Z44A 5C2TA 4YSHA 2APGA 1COYA 2DKIA 3D1CA 3DA1A 1RP0A 3KPFA 1MXTA 1JOAA 1Q1WA 1BGNA 1NENA 1TDOA 2WU5A 4GDEA 5JCIA 1E39A 3RNMA 1EBDA 1KNPA 2R45A 4H2NA 1DOBA 1ZMDA 4EQRA 1F8RA 2WS3A 3KD9A 4MJWA 1PN0A 1Y56A 3P4PA 3FG2P 1NDAA 4OPTA 4EQSA 2WEUA 3QVPA 4BURA 5J60A 3ICSA 3DK9A 5LV9A 3QSMA 1NAAA 1RSGA 4K7ZA 1PBEA 1PBBA 2BK3A 3LADA 2YVGA 2QCUA 4J33A 4GCMA 4JN9A 2YG7A 2OALA 2H89A 2C67A 4I58A 4D03A 3DH9A 3H4KA 1OJDA 3GRSA 3I3LA 4H4RA 2E1MA 3V76A 1FOHA 1GV4A 3AE1A 2YR5A 3M0OA 4BK3A 3CPJG 1GRHA 1Q1RA 3ITJA 1FEBA 1XHCA 4U8KA 1PDHA 2WHDA 1PBCA 1LV0A 3LZWA 4NTDA 4CBQA 1IUTA 4U8NA 2YWLA 2VQBA 1B8SA 1XANA 1MO9A 3QSEA 2V3BA 5CQFA 1DNCA 1O94A 4TM3A 5C3JA 2YR4A 2FJBA 3KVEA 5EBKA 3AEEA 1KFYA 3H8IA 1AOGA 2XCGA 4KX6A 2WQYA 4AT2A 1BGJA 4YSYA 3AD8B 4O5QA 2GH5A 2GR0A 4NEVA 1B4VA 1L0VA 3QJ4A 4A6NB 4H4SA 1GT8A 2I0ZA 2GMHA 3KLJA 4CY8A 2B76A 2BS2A 3NGCX 1H82A 1TRBA 1LPFA 2WETA 3CNJA 5U1OA 3FBSA 3PO7A 1DXLA 2TPRA 3F8RA 4NZHA 4IVMB 5HY5A 5FS6A 5HHFA 3DGHA 4U2SA 3EANA 2E4GA 1MOKA 4OPUA 4UDPA 3S5WA 1D4DA 4B63A 3UOVA 3AEAA 1VG0A 1D4CA 1SEZA 3UKFA 3DJGX 3L1RA 2WP9A 4D04A 4K5RA 2Q6UA 3EF6A 4H4WA 1BKWA 3P4QA 4FDCB 4EIPA 5IPYA 3VQRA 5U63A 1DJQA 1L9EA 2ZZCA 4A5LA 2XLTA 1CBOA 2EQ6A 3NLCA 1ZMCA 3CN8A 3URHA 1ZP0A 2C73A 2GR2A 3K7QX 4JNAA 4O5UA 1TDNA 4BK2A 5BRTA 2IVDA 1V59A 1GOSA 1LQTA 4H4YA 4C74A 4X9MA 4TM0A 4H2RA 1OJCA 4ZCDA 2XLPA 3OC4A 1ZOYA 1UKVG 2B9YA 3O0HA 1EL5A 5J7XA 1CL0A 3AYLA 5KVHA 2BXRA 3AD7B 2ARDA 4Z2RA 1D5TA 4B69A 1E1KA 2B9WA 3UOZA 4DSHA 4CY6A 4DNAA 2A87A 2VRLA 2OAMA 5L46A 1TDFA 3BHKA 1S2YA 2RGHA 3UTEA 2WPEA 3CGEA 5FS8A 1B37A 3II4A 1JEHA 4EM4A 1OJ9A 3NYFA 1BF3A 3CGCA 3SFEA 2GMJA 1VRQB 4IA5A 4K22A 1NHRA 1ZX9A 1REOA 1GALA 4UDQA 5HYMA 3BI5A 4OVIA 2YM2A 5JCNA 3RP6A 4ADWA 3DK4A 3SGLA 4YTNA 5KVIA 1NG3A 2CFYA 3GMCA 3GMBA 1O95A 1IUWA 3Q6JA 2XVHA 3AXBA 3FPZA 4BK1A 4C77A 1DODA 1IJHA 1KF6A 3G5QA 1E1NA 2AR8A 1E1MA 4EIQA 5U25A 2BC0A 1S2QA 2WP5A 4REKA 1PXBA 1IUSA 2RGJA 3AE5A 1K0LA 2X8GA 1K0IA 1VDCA 4BJYA 3IC9A 2GVCA 1F8SA 2R0GA 2VVLA 2BS3A 4U2LA 2YG5A 1GSNA 2F5ZA 1X31B 2BACA 2OA1A 2NVKX 3GRTA 2BA9A 1H7XA 2BABA 2JB3A 1TYPA 2WOWA 1ELIA 4J57A 2WDQA 2YG3A 3AB1A 1GREA 3NNEA 2YG6A 4KPRA 1FECA 4EQXA 1L9CA 2DKHA 3FMWA 4XXGA 4GDPA 3AEGA 3M13A 1PS9A 4Z26A 4H4UA 5ER0A 5JCMA 2YLTA 3ALJA 4J36A 2WOIA 4Y4MA 4CNKA 2XLUA 2YLRA 4H4QA 1IUXA 2XVFA 4H4VA 3CPHG 1KSUA 4HA6A 2EQ9A 2WDVA 5GRTA 2QA2A 4IA6A 4PABA 2WP6A 1GTEA 2R0PA 5FMHA 4AT0A 3SQPA 5FS9A 1PJ7A 3K7MX 3P1WA 3UTHA 3S61A 2ZZBA 3R9UA 4ECHA 4B1BA 3H8LA 3L8KA 4Y4LA 1N4UA 3LZXA 2XVEA 5CKUA 4ZCCA 4LU6A 4IV9A 3Q9TA 4CNJA 1JRYA 5HXIA 2YR6A 1YQZA 1JRXA 5EB5A 4U8PA 1NHQA 2GAGB 4B65A 2CULA 3CGBA 4EMIA 2IIDA 4Z2UA 5FS7A 3NN0X 1E6EA 4U8JA 3LXDA 2GB0A 3B6DA 3EPTA 4ZN0A 1ZDLA 1N1PA 1TDEA 4A79A 1JRZA 3CIRA 1YQ4A 2H88A 4JDRA 5TR3A 2GAHB 4EQWA 2R4EA 2HQMA 2JAEA 1PJ6A 2X8HA 3UKLA 2UZZA 3DJDA 1OJTA 3UKHA 4OPGA 4NTEA 4DSGA 2GR3A 3UTFA 1M64A 2A89A 2C66A 2XLRA 3AEDA 3CPIG 2EQ8A 4X4JA 3UOYA 4B68A 1YQ3A 4J2WA 3AE3A 4CCQA 3FIMB 1PXCA 3PS9A 4YSZA 5M10A 4A6NA 2Z5XA 4EMWA 3KU9A 4J56A 3QSSA 1CHUA 4RG4A 4USQA 4E0VA 2VZ2A 4TLZA 4YTPA 4B64A 3LJPA 1P2EA 3RHAA 2WPFA 4YWOA 1K0JA 1ONFA 2RGOA 5IQ4A 3V3NA 2CDUA 3RP8A 4Z25A 4OPCA 1E1LA 4EM3A 2YLXA 1PBFA 1QLBA 1H84A 3AEBA 4RSLA 5JCKA 2V60A 1NHPA 2WU2A 1ZOVA 4JQ9A 2C64A 3GYJA 2OLOA 1O5WA 1P2HA 2V5ZA 3AYIA 5IQ1A 4H50A 4U8LA 5BUKA 3WE0A
chains in the Genus database with same CATH superfamily
4H2QA 2FKPA 3QFBA 3P93A 2PYXA 2JKCA 4TM1A 2E3TA 3ALMA 2OQYA 3AE6A 4RG3A 3P3BA 3VRDB 3DMEA 2Z5YA 5BOFA 2QDDA 1CJ4A 1D7LA 4YWSA 1TYTA 4ICYA 3GO2A 2YQUA 1H6VA 3LB8A 2X8CA 2NQLA 3D8XA 2QAEA 2RABA 1N5XA 4A99A 1PDZA 2BYBA 3SFDA 3PVCA 2XFPA 4IL2A 1CF3A 2C7GA 4AP3A 3D9XA 2A8XA 3QVRA 2PGWA 3CNSA 1EL8A 3S5SA 4YSXA 1IYXA 1H83A 5M0ZA 1GRAA 4K1WA 2B7SA 2WESA 2VOUA 4OPIA 2Q7VA 5BULA 1PXAA 2P3ZA 3K30A 2JB1A 4BV6A 4TM4A 3BI2A 4IVOB 4JNQA 3CGDA 1GTHA 4B66A 2QDEA 3NH3X 3UKPA 1N60C 1Y0PA 2OZ3A 3UXLA 1KSSA 4M52A 1JU2A 2B7RA 1GRTA 3T9PA 4G8TA 4C5OA 2AAQA 3P4RA 2IVEA 2YLWA 2ZADA 4APNA 2JK6A 5EOWA 1BKHA 2GRTA 2PCEA 3ZVHA 1JNRA 1FHUA 1HYUA 2JB2A 3GD6A 1LVLA 1NG4A 4UDRA 3L5OA 2YLSA 3AECA 4E4FA 3VR8A 3T31A 2XFOA 1IUVA 4C3XA 1L8PA 2GQFA 3VA8A 3NK0X 1VG9A 4OPDA 5KNLA 1XDIA 2R9ZA 3ISHA 3UKAA 3EAOA 4PAAA 3ABVA 4A7AA 3OTRA 3D46A 1CJ3A 5EB4A 3ZVIA 1GPEA 2XSXA 3NK2X 3RP7A 3F8PA 1K4QA 1CC2A 4KT2A 3G5RA 3NN6X 1MDLA 3ZLFA 1COYA 3D1CA 1RP0A 1H2IA 1BGNA 4GDEA 1ZMDA 4EQRA 3RGTA 3P4PA 4OPTA 2WEUA 3DK9A 5EU9A 1RSGA 4K7ZA 1PBBA 3LADA 4J33A 2XH4A 3DH9A 2AL1A 3GRSA 3I3LA 4H4RA 2YR5A 3CPJG 4IT1A 4GMEA 4U8KA 1LV0A 2YWLA 2VQBA 1FFVC 3QSEA 3MWCA 3CXOA 3AEEA 2XCGA 4KX6A 1SJCA 3AD8B 1B4VA 3DG7A 4CY8A 2W55A 4F4RA 1TRBA 1LPFA 3H7VA 1DXLA 2TPRA 4HYRA 3DGBA 4U2SA 4UDPA 1D4DA 4E6MA 1KD0A 3UOVA 1W6TA 4K5RA 3AN1A 4GGBA 3VQRA 5KMSA 3TW9A 2C73A 1VQZA 2GGJA 1V59A 1LQTA 3BOXA 2W3SA 1CL0A 3AYLA 4Z2RA 1D5TA 1S7MA 2A87A 1JPMA 3Q4DA 2WPEA 4K22A 5J04A 4UDQA 2YM2A 5JCNA 2PSNA 2C4CA 1NG3A 2CFYA 4IHCA 1R0MA 2XVHA 4C77A 3FPZA 2O56A 5ENLA 1KF6A 3CXBA 4E5TA 5U25A 1ECQA 1JRPA 2BC0A 1X2GA 1PXBA 4J1OA 4M0XA 3AE5A 1K0IA 1VDCA 3EEZA 3IC9A 1F8SA 2VVLA 2BS3A 2YG5A 1X31B 1WUFA 1L9CA 3TJIA 3FMWA 4Z26A 1PS9A 7ENLA 4H4QA 4H4VA 3D47A 3NO1A 2WDVA 1WYGA 2QA2A 1SJAA 4HPNA 4IA6A 2WP6A 3SQPA 3P1WA 4GYPC 5FJRA 1MUCA 5CKUA 2XVEA 4ZCCA 1JROA 4IV9A 3R0KA 1JRYA 1JRXA 5EB5A 4H83A 2P88A 2CULA 3SN0A 3CGBA 2IIDA 4G6HA 4Z2UA 5FS7A 3T2ZA 5KMRA 3EPTA 3QPEA 1ZDLA 3CIRA 5TR3A 4EQWA 2R4EA 3CYJA 2JAEA 1PJ6A 4DSGA 2GR3A 3RR1A 2BRAA 1M64A 2XLRA 3AEDA 5M10A 3FIMB 5FJUA 3I4KA 1ONFA 2RGOA 3T8QA 2CDUA 3T2YA 3RP8A 1VDVA 3EUB3 2YLXA 1QLBA 4RSLA 4GISA 2WU2A 2C64A 3AYIA 2V5ZA 5IQ1A 4H50A 5BUKA 2PTXA 2BRYA 1KNRA 4USRA 3R10A 4H4PA 2E5VA 4HNLA 4OCGA 4XWZA 2QA1A 3T4WA 1Y56B 3B9JB 4J31A 2P8CA 2YLZA 2MNRA 4GF7A 4H4XA 2GQWA 1F6MA 3AE7A 5KRQA 1F3PA 2HZGA 4YKGA 1S3BA 4Z24A 3AE4A 1GXFA 1DOCA 2O9ZA 1Q9IA 4DN1A 3SZCA 3IHGA 2C76A 2BCGG 4BJZA 3NYCA 3OZ2A 2PP0A 1GRFA 2R0CA 2GR1A 4H4ZA 3SXIA 4A35A 4G74A 4II2A 3GD3A 1FCDA 3NK1X 1PHHA 4H2PA 4GUVA 4NNJA 2FYMA 2GEWA 2OLNA 3FV9A 1JNZA 3CNPA 2VVLG 1BWCA 1B5QA 4NWZA 2XYOA 1ONEA 4CRTA 3QN3A 2X99A 3UP5A 2Y6QA 4J3ZA 3T37A 4CCRA 5KMPA 1M6IA 2OPJA 3NTAA 1GNDA 3NVVB 3TWAA 3UKQA 2ZBWA 1RM6B 2FJDA 4FX9A 3UTGA 2XLSA 1GRGA 3BNUA 3JSKA 1TE6A 3UOXA 3UGVA 2QQ6A 4I59A 1EC8A 2XVJA 2VRMA 3SYIA 3DFYA 2XFNA 3JW7A 4U8IA 3VC6A 2NPXA 3P9UA 1F8WA 1GERA 3VDGA 3DEQA 4YXDA 1CC6A 2XH0A 1EL7A 1RYIA 2WOVA 4EWJA 1ZK7A 3DK8A 2P8BA 4LA1A 3R1ZA 3F8DA 2ACZA 4MKSA 2QJNA 3MQTA 2HXUA 1W4XA 1QJDA 2PP3A 3MKCA 3HYXA 3KA7A 3G5SA 2C75A 4M6UA 3DGZA 1NPXA 3K7TA 4GAVA 3ATQA 1ZY8A 2CVJA 3AWIA 2OO6A 4K2XA 2PS2A 4ROPA 5C2TA 2APGA 3KPFA 1Q1WA 2WU5A 1NENA 4H2NA 1DOBA 1F8RA 3SQSA 2WS3A 1Y56A 1R6WA 1NDAA 3V3WA 5J60A 5LV9A 3QSMA 1ZXIC 1FHVA 2BK3A 2QCUA 4GCMA 2OALA 1EBHA 3PWGA 3TTEA 5KMQA 1FOHA 4BK3A 4GFIA 3NZGA 3K1GA 2WHDA 3LZWA 4NTDA 1XANA 2OX4A 4TM3A 3V4BA 2FJBA 3KVEA 1P43A 1SJDA 2WQYA 4AT2A 1BGJA 2GR0A 4II3A 4A6NB 3IJQA 3KLJA 3FBSA 3PO7A 5U1OA 3F8RA 5FS6A 2E4GA 4GYPA 5FJPA 3S5WA 4K2SA 1D4CA 4G7FA 4D04A 3P4QA 4H4WA 3HRDC 3GYXA 2XLTA 3RCYA 3URHA 1ZP0A 3FJ4A 1TDNA 5BRTA 2IVDA 4C74A 4X9MA 4TM0A 2XLPA 4TVWA 3O0HA 1EL5A 4DX3A 4ENLA 2ARDA 4B69A 5G5GB 3UOZA 4CY6A 2VRLA 5L46A 3BHKA 1S2YA 5FS8A 3II4A 3NYFA 3CGCA 1FFUC 1VRQB 5HYMA 3BI5A 3RP6A 4ADWA 4YTNA 2W54A 3MY9A 1O95A 3N6HA 1E1NA 1E1MA 4G6GA 3NXLA 3UCCA 3ES7A 2GVCA 2ONEA 2NVKX 3GRTA 2BA9A 1H7XA 2BABA 2JB3A 1TYPA 3AB1A 2YG6A 2DKHA 4XXGA 1N63C 4GDPA 2OZTA 3OW1A 3AEGA 5ER0A 3UJSA 3ALJA 4J36A 5BOEA 1NELA 2XLUA 4MGGA 1IUXA 2XVFA 5GRTA 3K7MX 3V5FA 1EC7A 3CK5A 3S61A 3R9UA 3SJNA 3H8LA 2DW6A 4CNJA 5HXIA 2YR6A 4GAPA 3SR6B 5FJTA 3PWIA 1E6EA 3CMMA 3B6DA 3JZUA 1TDEA 3U4FA 4A79A 2GAHB 2QGYA 2HQMA 4DYEA 2UZZA 3DJDA 3UKHA 2PTWA 3UJ2A 2W3RA 4NTEA 3UTFA 1EC9A 3GC2A 2C66A 2GL5A 1V97A 4YSZA 1PXCA 3PS9A 4A6NA 3KU9A 3QSSA 4RG4A 4E0VA 2VZ2A 4TLZA 1FIQB 4YTPA 1P2EA 3RHAA 3DG3A 4Z1YA 5IQ4A 4OPCA 1H84A 3AEBA 3HYWA 2OLOA 3PFRA 1O5WA 2P0IA 3REDA 1PJ5A 3AEFA 4GIRA 1YY5A 3NRZB 2Q0KA 3COXA 2XFQA 3QFAA 3VR9A 3VRAA 3GYIA 3NKSA 1LQUA 3GSIA 4UP3A 5JRBA 3KKJA 5GSNA 3HZLA 3M12A 4N9XA 4GR1A 2EQ7A 3NVYB 4KEMA 1TDKA 1VQWA 2YVFA 3I6EA 4U8OA 4DXKA 3GWDA 4C3YA 3IJIA 1OJAA 2QVHA 3TWBA 1S3EA 3ICTA 4KWSA 1GRBA 3STPA 2BC1A 1CC4A 1E7PA 1N4VA 3R07C 3PG6A 4YTMA 2PTZA 3DG6A 2GF3A 3AE2A 3BHFA 3HPFA 4IP5A 5BVAA 2AL2B 4K8DA 3P4SA 3AE9A 2HXTA 5DBJA 2QJMA 4AP1A 3NYEA 1TZZA 3NG7X 2VVMA 2JBVA 1XS2A 2GGGA 2V6OA 4HNCA 4H1ZA 3IK4A 1GETA 3VRBA 3V3OA 4A65A 4J34A 3ZDNA 2YAUA 3DJEA 1LJ1A 2YVJA 3GDPA 3AYJA 3RRAA 1N5WC 1FEAA 3GDNA 2WDRA 4AOSA 3SM8A 1KDGA 2PHHA 2MUCA 2GV8A 2Q0LA 3E1TA 4H7UA 2PPGA 2C3CA 3CTYA 4DGKA 3LOVA 1GESA 4Z43A 3C4AA 1STZA 1L9DA 1ZKQA 4U8MA 3NTDA 1BZLA 5KWFA 4JY3A 1NHSA 3CNTA 1H86A 2PP1A 3N4FA 3TCSA 2WBAA 4HCLA 3TOYA 2C70A 3A7AA 2FJEA 1D7YA 3NVWB 2FJAA 2POZA 2V3AA 1N61C 3SZFA 4FK1C 3QKEA 3B3RA 3NHOX 3GD4A 2BS4A 2DKIA 3DA1A 3ZLGA 3RNMA 1KNPA 2R45A 1PN0A 4IZGA 3FG2P 3DFHA 3GY1A 3ICSA 1JCTA 1KCZA 1PBEA 4IL0A 1P48A 4JN9A 4D03A 2H89A 3H4KA 3M0OA 3AE1A 1GRHA 1XHCA 3ETRB 2QJJA 1PDHA 1PBCA 3BJSA 1B8SA 1MO9A 3TJ4A 1DNCA 1O94A 5C3JA 2YR4A 5EBKA 4A6GA 3RO6A 4JHMA 4O5QA 2GH5A 1L0VA 3QJ4A 4H4SA 1YEYA 2GMHA 2BS2A 3R25A 3NGCX 1H82A 2WETA 3I6TA 3P0WA 2AL2A 2HNEA 3DGHA 1MOKA 2GDQA 3H12A 2I5QA 3DJGX 3L1RA 2WP9A 2Q6UA 3OZYA 4FDCB 3VFCA 5U63A 1DJQA 2PMQA 4A5LA 4JNAA 1ZMCA 5FJOA 4BK2A 1TKKA 1GOSA 4H4YA 3ZLHA 4H2RA 1OJCA 4ZCDA 3CB3A 1ZOYA 1UKVG 2OFJA 2PA6A 5J7XA 3AD7B 1E1KA 1X2HA 4DSHA 4DNAA 2OAMA 2RGHA 3UTEA 1B37A 4EM4A 1OJ9A 1NHRA 3NS1B 3SSZA 4OVIA 3GMCA 3GMBA 4ZCWA 1IUWA 3Q6JA 3AXBA 3V5CA 4K8GA 2AR8A 2WP5A 1OEPA 2RGJA 1IUSA 4BJYA 2X8GA 4U2LA 3FCPA 2BACA 2OA1A 1ELIA 2WDQA 2YG3A 1GREA 3OP2A 3NNEA 4EQXA 1FECA 3SN4A 2PGEA 3M13A 4H4UA 4CNKA 4Y4MA 2WOIA 4ZOHB 4HA6A 3A7UA 3JVAA 1F9CA 2E5AA 5FMHA 4AT0A 5FS9A 3UTHA 2ZZBA 4B1BA 3L8KA 1SJBA 3FXGA 1N4UA 1N62C 3U9IA 3Q9TA 1JPDX 4B65A 4EMIA 1DTNA 3NN0X 4U8JA 3LXDA 3QTPA 2GB0A 4ZN0A 2H88A 4JDRA 1EBGA 2X8HA 4GGHA 3UKLA 2GGIA 2A89A 2EQ8A 4X4JA 1WUEA 3PK7A 4CCQA 3T0KA 2Z5XA 4J56A 4USQA 4B64A 4IP4A 2GSHA 4YWOA 1K0JA 2AKZA 4Z25A 1E1LA 4EM3A 5JCKA 1E9IA 1ZOVA 4JQ9A 3GYJA 3UXKA 3ES8A 3A7RA 3IHMA 3AE8A 3ATRA 3VCNA 3IWAA 2OG9A 2C65A 1FL2A 2OZ8A 2PTYA 1T3QC 2X3NA 1LTXR 3I6DA 3KUMA 3N6JA 4H2HA 5KOWA 2W0HA 3ICRA 3BI4A 1PDYA 3CNDA 3AM9A 1KN0A 1NEKA 3NIXA 3CAWA 2C72A 3FYYA 1CJCA 3HW2A 4HCHA 1IUUA 4FI4A 2WPCA 3UCLA 1ELSA 2XVIA 3AD9B 1SB3B 3MSYA 3UJRA 1EL9A 4E4UA 4OPLA 5KXJA 4GRTA 1DOEA 4FK1A 4TLXA 4JY2A 2YG4A 3MUCA 1PBDA 2R46A 2BK5A 3NT6A 2J3NA 4Y4NA 4WCTA 4LIIA 3UKKA 2B9XA 4Z2TA 4Z17A 4NEWA 1N4WA 2R4JA 2V61A 2OKTA 3R0UA 3SY4A 3C96A 4WX1A 4X9NA 4A9WA 3DERA 3H8AA 2AQJA 2BXSA 3C4NA 4U2TA 2FBWA 4YKFA 3DJJA 2DW7A 3CT2A 3UP4A 3ZYXA 2X50A 3ADAB 4YT0A 1H81A 1GEUA 1DJNA 2BK4A 2BCPA 2ZZ0A 1H7WA 2XFUA 2XDOA 3NFUA 3TQPA 2GGEA 2YM1A 2OLAA 2XGZA 3SX6A 4XWRA 3MZNA 4K5SA 1RVKA 5KOXA 2VQ7A 2OVLA 3DIPA 1CJ2A 2TMDA 3NVZB 3OPSA 1MRAA 4HB9A 4AOXA 2C3DA 4EMJA 4NTCA 1D4EA 1NU5A 2Y6RA 1Z6LA 1XPQA 3BNMA 2ZC8A 2RDXA 3IF9A 3ENLA 1YKJA 3NRNA 4P9SA 4G9KA 4KPLA 3ALLA 5JCLA 3QLDA 3GWFA 4A3RA 3DESA 4B67A 1QO8A 4Z44A 4H4TA 3UCDA 4YSHA 1MXTA 1JOAA 1TDOA 5JCIA 1E39A 2XH7A 3HYVA 1EBDA 4H19A 3KD9A 4MJWA 4EQSA 3QVPA 3B97A 4BURA 3T14A 1NAAA 2PU0A 4ZA0A 2YVGA 3OZMA 2YG7A 4I58A 2C67A 1OJDA 3EKGA 2E1MA 3V76A 1GV4A 1Q1RA 3ITJA 1FEBA 3THUA 4CBQA 1IUTA 4U8NA 2PODA 1KKRA 2V3BA 5CQFA 1KFYA 3H8IA 1AOGA 4YSYA 4NEVA 4HN8A 3H70A 1GT8A 2I0ZA 2B76A 3CNJA 4NZHA 5HY5A 1JDFA 4IVMB 5HHFA 3EANA 4OPUA 4B63A 3AEAA 1VG0A 1SEZA 3UKFA 3EF6A 5IPYA 1BKWA 4EIPA 1L9EA 3N4EA 2ZZCA 1CBOA 2EQ6A 3NLCA 3K7QX 3CN8A 4O5UA 2GR2A 4HCDA 4JN8A 2CHRA 5G5HB 3UJFA 3OC4A 2B9YA 3BSMA 3SBFA 5KVHA 2BXRA 1XPYA 2B9WA 1BQGA 3T2KA 3VC5A 3SZWA 2GGHA 1TDFA 3CGEA 3SN1A 1JEHA 3SFEA 1BF3A 2GMJA 4TVYA 4IA5A 1ZX9A 1REOA 1GALA 2PU1A 3UJEA 3SZ0A 3DK4A 3SGLA 5KVIA 3IJLA 4BK1A 4E8GA 1KKOA 2AKMA 1DODA 1IJHA 3G5QA 4EIQA 4REKA 1S2QA 1K0LA 4DWDA 2R0GA 1GSNA 2F5ZA 3RITA 2WOWA 4J57A 4KPRA 4FP1A 2OQHA 5JCMA 2YLTA 2YLRA 3CPHG 1KSUA 2EQ9A 4PABA 1GTEA 2R0PA 1PJ7A 2XH2A 4ECHA 3KPKA 4Y4LA 3LZXA 4LU6A 3T6CA 1YQZA 4U8PA 1NHQA 2GAGB 1FO4A 4X2PA 6ENLA 3FVDA 3ZVHB 1MDRA 3DDMA 1N1PA 1JRZA 1YQ4A 4G73A 3R11A 1OJTA 3AMZA 4DHGA 1MNSA 4OPGA 3Q45A 3CPIG 3UOYA 4MMWA 4B68A 1YQ3A 4J2WA 3AE3A 4EMWA 1CHUA 3VCCA 3LJPA 2WPFA 3V3NA 1PBFA 2V60A 1NHPA 5IDZA 1P2HA 4U8LA 3S47A 4JN7A 3WE0A
chains in the Genus database with same CATH topology
4H2QA 1KNRA 3QFBA 4USRA 3REDA 4H4PA 3IHMA 3AE8A 3ATRA 1PJ5A 3AEFA 1YY5A 2PYXA 3IWAA 2JKCA 2Q0KA 2E5VA 4TM1A 4OCGA 2C65A 3ALMA 2QA1A 3COXA 1FL2A 2XFQA 3QFAA 4XWZA 3VR9A 1Y56B 3VRAA 3GYIA 3NKSA 1LQUA 4J31A 2X3NA 1LTXR 2YLZA 3AE6A 3GSIA 4GF7A 5JRBA 4H4XA 2GQWA 3I6DA 4RG3A 4UP3A 3KKJA 5GSNA 3HZLA 3VRDB 5KOWA 2W0HA 1F6MA 3M12A 4N9XA 3DMEA 3ICRA 2Z5YA 3AE7A 5KRQA 1F3PA 4GR1A 2EQ7A 3BI4A 4YKGA 1S3BA 1TDKA 1VQWA 3AE4A 1GXFA 4Z24A 1DOCA 2O9ZA 3CNDA 2YVFA 1KN0A 1CJ4A 1Q9IA 1NEKA 1D7LA 3NIXA 4U8OA 3GWDA 3SZCA 3IHGA 1TYTA 2C72A 2C76A 1CJCA 4ICYA 2BCGG 4C3YA 1IUUA 4BJZA 2WPCA 2YQUA 3NYCA 4Y4NA 1H6VA 3OZ2A 1OJAA 1GRFA 1S3EA 3LB8A 3ICTA 2R0CA 2GR1A 4H4ZA 3SXIA 3UCLA 2XVIA 2X8CA 3AD9B 4G74A 4II2A 3GD3A 1GRBA 1FCDA 1EL9A 4OPLA 5KXJA 2BC1A 4GRTA 1DOEA 3D8XA 4FK1A 4TLXA 4JY2A 2YG4A 3NK1X 1PHHA 4H2PA 4GUVA 4NNJA 2QAEA 2RABA 2GEWA 4A99A 1CC4A 1PBDA 1E7PA 2OLNA 2BYBA 1JNZA 1N4VA 3CNPA 3PG6A 2VVLG 4YTMA 3SFDA 2R46A 1BWCA 2BK5A 3PVCA 1B5QA 2J3NA 2XFPA 3NT6A 4NWZA 4WCTA 4LIIA 2GF3A 2XYOA 3AE2A 1CF3A 3BHFA 2C7GA 4AP3A 3D9XA 3UKKA 5BVAA 2A8XA 2B9XA 3QVRA 4CRTA 4K8DA 3CNSA 3AE9A 3P4SA 1EL8A 4Z2TA 4NEWA 2X99A 4YSXA 1N4WA 3UP5A 1H83A 2Y6QA 2R4JA 5DBJA 5M0ZA 2V61A 3T37A 4AP1A 4CCRA 5KMPA 1GRAA 3SY4A 1M6IA 2B7SA 3C96A 3NYEA 4WX1A 2WESA 2VOUA 3NTAA 2Q7VA 4OPIA 5BULA 1GNDA 1PXAA 3K30A 3NG7X 4X9NA 2VVMA 2JB1A 2ZBWA 2JBVA 3UKQA 4BV6A 4TM4A 4A9WA 3BI2A 4IVOB 4JNQA 2V6OA 2FJDA 2AQJA 4FX9A 3CGDA 1GTHA 2BXSA 4B66A 3C4NA 3NH3X 3UKPA 1GETA 4U2TA 3VRBA 1Y0PA 3V3OA 3UTGA 4A65A 2FBWA 2XLSA 1GRGA 3BNUA 3JSKA 4J34A 3ZDNA 2YAUA 3DJEA 3DJJA 1LJ1A 4YKFA 2YVJA 3UOXA 3GDPA 4I59A 3UP4A 3ZYXA 2X50A 3AYJA 1KSSA 1FEAA 4M52A 2VRMA 2WDRA 2XVJA 1H81A 1JU2A 3ADAB 3GDNA 2B7RA 3SYIA 1GRTA 4AOSA 4YT0A 3SM8A 1GEUA 1KDGA 2AAQA 2PHHA 3P4RA 4C5OA 1DJNA 2BK4A 2XFNA 2GV8A 2Q0LA 2IVEA 4U8IA 2YLWA 2BCPA 3E1TA 2ZZ0A 4H7UA 4APNA 2JK6A 1H7WA 2XFUA 5EOWA 2GRTA 2NPXA 2XDOA 3P9UA 1F8WA 1GERA 2C3CA 2YM1A 1JNRA 1HYUA 3CTYA 2JB2A 1CC6A 3LOVA 1GESA 4DGKA 4Z43A 4YXDA 3C4AA 1LVLA 3SX6A 1EL7A 1NG4A 1L9DA 4UDRA 1ZKQA 3L5OA 3NTDA 4U8MA 4XWRA 1RYIA 1BZLA 2YLSA 3AECA 2WOVA 4K5SA 3VR8A 1ZK7A 3T31A 5KOXA 3DK8A 2XFOA 1IUVA 4C3XA 4LA1A 2VQ7A 2GQFA 5KWFA 4JY3A 1NHSA 1CJ2A 2TMDA 3F8DA 3NK0X 2ACZA 1VG9A 3CNTA 4OPDA 1H86A 1W4XA 1QJDA 5KNLA 3HYXA 2WBAA 3KA7A 1XDIA 4HB9A 2R9ZA 2C70A 2FJEA 3ISHA 3EAOA 3UKAA 3G5SA 4AOXA 2C3DA 4EMJA 4NTCA 4PAAA 1D4EA 3ABVA 1D7YA 4A7AA 2FJAA 2Y6RA 1CJ3A 1Z6LA 5EB4A 1XPQA 2C75A 3BNMA 2V3AA 3IF9A 3DGZA 1GPEA 1YKJA 1NPXA 3NRNA 4P9SA 3SZFA 3NK2X 3K7TA 3RP7A 4FK1C 4GAVA 4G9KA 3ALLA 5JCLA 3ATQA 3F8PA 1ZY8A 3B3RA 3NHOX 1K4QA 1CC2A 3GWFA 2CVJA 3AWIA 3GD4A 3G5RA 2BS4A 4B67A 1QO8A 3NN6X 4H4TA 4K2XA 4Z44A 5C2TA 4YSHA 2APGA 1COYA 2DKIA 3D1CA 3DA1A 1RP0A 3KPFA 1MXTA 1JOAA 1H2IA 1Q1WA 1BGNA 1NENA 1TDOA 2WU5A 5JCIA 1E39A 3HYVA 4GDEA 3RNMA 1EBDA 1KNPA 2R45A 4H2NA 1DOBA 1ZMDA 4EQRA 1F8RA 2WS3A 3KD9A 4MJWA 1PN0A 1Y56A 3P4PA 3FG2P 1NDAA 4OPTA 4EQSA 2WEUA 3QVPA 4BURA 5J60A 3ICSA 3DK9A 3T14A 5LV9A 3QSMA 1NAAA 1RSGA 4K7ZA 1PBEA 1PBBA 2BK3A 3LADA 2YVGA 2QCUA 4J33A 4GCMA 4JN9A 2YG7A 2OALA 2H89A 2C67A 4I58A 4D03A 3DH9A 3H4KA 1OJDA 3GRSA 3I3LA 4H4RA 5KMQA 2E1MA 3V76A 1FOHA 1GV4A 3AE1A 2YR5A 3M0OA 4BK3A 3CPJG 1GRHA 1Q1RA 3ITJA 1FEBA 1XHCA 4U8KA 1PDHA 2WHDA 1PBCA 1LV0A 3LZWA 4NTDA 4CBQA 1IUTA 4U8NA 2YWLA 2VQBA 1B8SA 1XANA 1MO9A 3QSEA 2V3BA 5CQFA 1DNCA 1O94A 4TM3A 5C3JA 2YR4A 2FJBA 3KVEA 5EBKA 3AEEA 1KFYA 3H8IA 1AOGA 2XCGA 4KX6A 2WQYA 4AT2A 1BGJA 4YSYA 3AD8B 4O5QA 2GH5A 2GR0A 4NEVA 1B4VA 4II3A 3QJ4A 1L0VA 4A6NB 4H4SA 1GT8A 2I0ZA 2GMHA 3KLJA 4CY8A 2B76A 2BS2A 3NGCX 1H82A 1TRBA 1LPFA 2WETA 3CNJA 5U1OA 3FBSA 3PO7A 1DXLA 2TPRA 3F8RA 4NZHA 4IVMB 5HY5A 5FS6A 5HHFA 3DGHA 4U2SA 3EANA 2E4GA 1MOKA 4OPUA 4UDPA 3S5WA 1D4DA 4B63A 3UOVA 3AEAA 1VG0A 1D4CA 1SEZA 3UKFA 3DJGX 3L1RA 2WP9A 4D04A 4K5RA 2Q6UA 3EF6A 4H4WA 1BKWA 3P4QA 4FDCB 4EIPA 5IPYA 3VQRA 5U63A 5KMSA 1DJQA 1L9EA 3GYXA 2ZZCA 4A5LA 2XLTA 1CBOA 2EQ6A 3NLCA 1ZMCA 3CN8A 3URHA 1ZP0A 2C73A 2GR2A 3K7QX 4JNAA 4O5UA 1TDNA 4BK2A 5BRTA 2IVDA 1V59A 1GOSA 1LQTA 4H4YA 4C74A 4X9MA 4TM0A 4H2RA 1OJCA 4ZCDA 2XLPA 3OC4A 1ZOYA 1UKVG 2B9YA 3O0HA 1EL5A 5J7XA 1CL0A 3AYLA 5KVHA 2BXRA 3AD7B 2ARDA 4Z2RA 1D5TA 4B69A 1E1KA 2B9WA 3UOZA 3T2KA 4DSHA 4CY6A 1S7MA 4DNAA 2A87A 2VRLA 2OAMA 5L46A 3SZWA 1TDFA 3BHKA 1S2YA 2RGHA 3UTEA 2WPEA 3CGEA 5FS8A 1B37A 3II4A 1JEHA 4EM4A 1OJ9A 3NYFA 1BF3A 3CGCA 3SFEA 2GMJA 1VRQB 4IA5A 4K22A 1NHRA 1ZX9A 1REOA 1GALA 4UDQA 5HYMA 3BI5A 4OVIA 2YM2A 5JCNA 3SZ0A 3RP6A 4ADWA 3DK4A 3SGLA 2C4CA 5KVIA 1NG3A 2CFYA 4YTNA 3GMCA 3GMBA 1O95A 1IUWA 3Q6JA 2XVHA 3AXBA 3FPZA 4BK1A 4C77A 1DODA 1IJHA 1KF6A 3G5QA 1E1NA 2AR8A 1E1MA 4EIQA 4G6GA 5U25A 2BC0A 1S2QA 2WP5A 4REKA 1PXBA 1IUSA 2RGJA 3AE5A 1K0LA 2X8GA 1K0IA 1VDCA 4BJYA 3IC9A 2GVCA 1F8SA 2R0GA 2VVLA 2BS3A 4U2LA 2YG5A 1GSNA 2F5ZA 1X31B 2BACA 2OA1A 2NVKX 3GRTA 2BA9A 1H7XA 2BABA 2JB3A 1TYPA 2WOWA 1ELIA 4J57A 2WDQA 2YG3A 3AB1A 1GREA 3NNEA 2YG6A 4KPRA 1FECA 4EQXA 1L9CA 2DKHA 3FMWA 4XXGA 4GDPA 3AEGA 3M13A 1PS9A 4Z26A 4H4UA 5ER0A 5JCMA 2YLTA 3ALJA 4J36A 2WOIA 4Y4MA 4CNKA 2XLUA 2YLRA 4H4QA 1IUXA 2XVFA 4H4VA 3CPHG 1KSUA 4HA6A 2EQ9A 2WDVA 5GRTA 2QA2A 4IA6A 4PABA 2WP6A 1GTEA 2R0PA 5FMHA 4AT0A 3SQPA 5FS9A 1PJ7A 3K7MX 3P1WA 3UTHA 3S61A 2ZZBA 3R9UA 4ECHA 4B1BA 3H8LA 3KPKA 3L8KA 4Y4LA 1N4UA 3LZXA 2XVEA 5CKUA 4ZCCA 4LU6A 4IV9A 3Q9TA 4CNJA 1JRYA 5HXIA 2YR6A 1YQZA 1JRXA 5EB5A 4U8PA 1NHQA 2GAGB 4B65A 4GAPA 2CULA 3CGBA 4EMIA 2IIDA 4G6HA 4Z2UA 5FS7A 3NN0X 1E6EA 3CMMA 3T2ZA 4U8JA 3LXDA 2GB0A 5KMRA 3B6DA 3EPTA 4ZN0A 1ZDLA 1N1PA 1TDEA 4A79A 1JRZA 3CIRA 1YQ4A 2H88A 4JDRA 5TR3A 2GAHB 4G73A 4EQWA 2R4EA 2HQMA 2JAEA 1PJ6A 2X8HA 3UKLA 2UZZA 3DJDA 1OJTA 3UKHA 4OPGA 4NTEA 4DSGA 2GR3A 3UTFA 2BRAA 1M64A 2A89A 2C66A 2XLRA 3AEDA 3CPIG 2EQ8A 4X4JA 3UOYA 4B68A 1YQ3A 4J2WA 3AE3A 4CCQA 3FIMB 1PXCA 3PS9A 4YSZA 3T0KA 5M10A 4A6NA 2Z5XA 4EMWA 3KU9A 4J56A 3QSSA 1CHUA 4RG4A 4USQA 4E0VA 2VZ2A 4TLZA 4YTPA 4B64A 3LJPA 1P2EA 3RHAA 2WPFA 4YWOA 1K0JA 1ONFA 2RGOA 5IQ4A 3V3NA 2CDUA 3T2YA 3RP8A 4Z25A 4OPCA 1E1LA 4EM3A 2YLXA 1PBFA 1QLBA 1H84A 3AEBA 4RSLA 5JCKA 2V60A 1NHPA 2WU2A 1ZOVA 4JQ9A 2C64A 3HYWA 3GYJA 2OLOA 1O5WA 1P2HA 2V5ZA 3AYIA 5IQ1A 4H50A 4U8LA 5BUKA 3WE0A 2BRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2Q A;  1KNR A;  3QFB A;  4USR A;  3RED A;  4H4P A;  3IHM A;  3AE8 A;  3ATR A;  1PJ5 A;  3AEF A;  1YY5 A;  2PYX A;  3IWA A;  2JKC A;  2Q0K A;  2E5V A;  4TM1 A;  4OCG A;  2C65 A;  3ALM A;  2QA1 A;  3COX A;  1FL2 A;  2XFQ A;  3QFA A;  4XWZ A;  3VR9 A;  1Y56 B;  3VRA A;  3GYI A;  3NKS A;  1LQU A;  4J31 A;  2X3N A;  1LTX R;  2YLZ A;  3AE6 A;  3GSI A;  4GF7 A;  3I6D A;  4H4X A;  2GQW A;  4RG3 A;  4UP3 A;  3KKJ A;  5GSN A;  3HZL A;  3VRD B;  5KOW A;  2W0H A;  1F6M A;  3M12 A;  4N9X A;  3DME A;  3ICR A;  2Z5Y A;  3AE7 A;  5KRQ A;  1F3P A;  4GR1 A;  2EQ7 A;  3BI4 A;  4YKG A;  1S3B A;  1TDK A;  1VQW A;  3AE4 A;  1GXF A;  4Z24 A;  1DOC A;  2O9Z A;  3CND A;  2YVF A;  1CJ4 A;  1Q9I A;  1NEK A;  1D7L A;  3NIX A;  4U8O A;  3GWD A;  3IHG A;  1TYT A;  2C72 A;  2C76 A;  1CJC A;  4ICY A;  2BCG G;  4C3Y A;  1IUU A;  4BJZ A;  2WPC A;  2YQU A;  3NYC A;  1H6V A;  3OZ2 A;  1OJA A;  1GRF A;  1S3E A;  3LB8 A;  3ICT A;  2R0C A;  2GR1 A;  4H4Z A;  3UCL A;  2XVI A;  2X8C A;  3AD9 B;  3GD3 A;  1GRB A;  1FCD A;  1EL9 A;  4OPL A;  5KXJ A;  2BC1 A;  4GRT A;  1DOE A;  3D8X A;  4FK1 A;  4TLX A;  4JY2 A;  2YG4 A;  3NK1 X;  1PHH A;  4H2P A;  4GUV A;  2QAE A;  2RAB A;  2GEW A;  4A99 A;  1CC4 A;  1PBD A;  1E7P A;  2OLN A;  2BYB A;  1JNZ A;  1N4V A;  3CNP A;  4YTM A;  2VVL G;  3SFD A;  2R46 A;  1BWC A;  2BK5 A;  3PVC A;  1B5Q A;  2J3N A;  2XFP A;  3NT6 A;  4WCT A;  4Y4N A;  4LII A;  2GF3 A;  2XYO A;  3AE2 A;  1CF3 A;  3BHF A;  2C7G A;  4AP3 A;  3UKK A;  5BVA A;  2A8X A;  2B9X A;  3QVR A;  4CRT A;  4K8D A;  3CNS A;  3AE9 A;  3P4S A;  1EL8 A;  4Z2T A;  4NEW A;  2X99 A;  4YSX A;  1N4W A;  3UP5 A;  1H83 A;  2Y6Q A;  2R4J A;  5DBJ A;  5M0Z A;  2V61 A;  3T37 A;  4AP1 A;  4CCR A;  1GRA A;  1M6I A;  2B7S A;  3C96 A;  3NYE A;  4WX1 A;  2WES A;  2VOU A;  3NTA A;  2Q7V A;  4OPI A;  5BUL A;  1GND A;  1PXA A;  3K30 A;  3NG7 X;  4X9N A;  2VVM A;  2JB1 A;  2ZBW A;  2JBV A;  3UKQ A;  4BV6 A;  4TM4 A;  4A9W A;  3BI2 A;  4IVO B;  4JNQ A;  2V6O A;  2FJD A;  2AQJ A;  4FX9 A;  3CGD A;  1GTH A;  2BXS A;  4B66 A;  3C4N A;  3NH3 X;  3UKP A;  1GET A;  4U2T A;  3VRB A;  1Y0P A;  3V3O A;  3UTG A;  4A65 A;  2FBW A;  2XLS A;  1GRG A;  3BNU A;  3JSK A;  4J34 A;  3ZDN A;  2YAU A;  3DJE A;  3DJJ A;  1LJ1 A;  4YKF A;  2YVJ A;  3UOX A;  3GDP A;  4I59 A;  3UP4 A;  3ZYX A;  2X50 A;  3AYJ A;  1KSS A;  1FEA A;  4M52 A;  2VRM A;  2WDR A;  2XVJ A;  1H81 A;  1JU2 A;  3ADA B;  3GDN A;  2B7R A;  4AOS A;  1GRT A;  4YT0 A;  3SM8 A;  1GEU A;  1KDG A;  2AAQ A;  2PHH A;  3P4R A;  4C5O A;  1DJN A;  2BK4 A;  2XFN A;  2GV8 A;  2Q0L A;  2IVE A;  4U8I A;  2YLW A;  2BCP A;  3E1T A;  2ZZ0 A;  4H7U A;  4APN A;  2JK6 A;  1H7W A;  2XFU A;  5EOW A;  2GRT A;  2NPX A;  2XDO A;  3P9U A;  1F8W A;  1GER A;  2C3C A;  2YM1 A;  1JNR A;  1HYU A;  3CTY A;  2JB2 A;  1CC6 A;  3LOV A;  1GES A;  4DGK A;  4Z43 A;  4YXD A;  3C4A A;  1LVL A;  1EL7 A;  1NG4 A;  1L9D A;  4UDR A;  1ZKQ A;  4U8M A;  3NTD A;  4XWR A;  1RYI A;  1BZL A;  2YLS A;  3AEC A;  2WOV A;  4K5S A;  3VR8 A;  1ZK7 A;  5KOX A;  3DK8 A;  2XFO A;  1IUV A;  4C3X A;  4LA1 A;  2VQ7 A;  2GQF A;  5KWF A;  4JY3 A;  1NHS A;  1CJ2 A;  2TMD A;  3F8D A;  3NK0 X;  2ACZ A;  1VG9 A;  3CNT A;  4OPD A;  1H86 A;  1W4X A;  1QJD A;  2WBA A;  3KA7 A;  1XDI A;  4HB9 A;  2R9Z A;  2C70 A;  2FJE A;  3ISH A;  3EAO A;  3UKA A;  3G5S A;  4AOX A;  2C3D A;  4EMJ A;  4NTC A;  4PAA A;  1D4E A;  3ABV A;  1D7Y A;  4A7A A;  2FJA A;  2Y6R A;  1CJ3 A;  1Z6L A;  5EB4 A;  1XPQ A;  2C75 A;  3BNM A;  2V3A A;  3IF9 A;  3DGZ A;  1GPE A;  1YKJ A;  1NPX A;  3NRN A;  4P9S A;  3NK2 X;  3K7T A;  3RP7 A;  4FK1 C;  3ALL A;  5JCL A;  3ATQ A;  3F8P A;  1ZY8 A;  3B3R A;  3NHO X;  1K4Q A;  1CC2 A;  3GWF A;  2CVJ A;  3AWI A;  3GD4 A;  3G5R A;  2BS4 A;  4B67 A;  1QO8 A;  3NN6 X;  4H4T A;  4K2X A;  4Z44 A;  5C2T A;  4YSH A;  2APG A;  1COY A;  2DKI A;  3D1C A;  3DA1 A;  1RP0 A;  3KPF A;  1MXT A;  1JOA A;  1Q1W A;  1BGN A;  1NEN A;  1TDO A;  2WU5 A;  4GDE A;  5JCI A;  1E39 A;  3RNM A;  1EBD A;  1KNP A;  2R45 A;  4H2N A;  1DOB A;  1ZMD A;  4EQR A;  1F8R A;  2WS3 A;  3KD9 A;  4MJW A;  1PN0 A;  1Y56 A;  3P4P A;  3FG2 P;  1NDA A;  4OPT A;  4EQS A;  2WEU A;  3QVP A;  4BUR A;  5J60 A;  3ICS A;  3DK9 A;  5LV9 A;  3QSM A;  1NAA A;  1RSG A;  4K7Z A;  1PBE A;  1PBB A;  2BK3 A;  3LAD A;  2YVG A;  2QCU A;  4J33 A;  4GCM A;  4JN9 A;  2YG7 A;  2OAL A;  2H89 A;  2C67 A;  4I58 A;  4D03 A;  3DH9 A;  3H4K A;  1OJD A;  3GRS A;  3I3L A;  4H4R A;  2E1M A;  3V76 A;  1FOH A;  1GV4 A;  3AE1 A;  2YR5 A;  3M0O A;  4BK3 A;  3CPJ G;  1GRH A;  1Q1R A;  3ITJ A;  1FEB A;  1XHC A;  4U8K A;  1PDH A;  2WHD A;  1PBC A;  1LV0 A;  3LZW A;  4NTD A;  4CBQ A;  1IUT A;  4U8N A;  2YWL A;  2VQB A;  1B8S A;  1XAN A;  1MO9 A;  3QSE A;  2V3B A;  5CQF A;  1DNC A;  1O94 A;  4TM3 A;  5C3J A;  2YR4 A;  2FJB A;  3KVE A;  5EBK A;  3AEE A;  1KFY A;  3H8I A;  1AOG A;  2XCG A;  4KX6 A;  2WQY A;  4AT2 A;  1BGJ A;  4YSY A;  3AD8 B;  4O5Q A;  2GH5 A;  2GR0 A;  4NEV A;  1B4V A;  1L0V A;  3QJ4 A;  4A6N B;  4H4S A;  1GT8 A;  2I0Z A;  2GMH A;  3KLJ A;  4CY8 A;  2B76 A;  2BS2 A;  3NGC X;  1H82 A;  1TRB A;  1LPF A;  2WET A;  3CNJ A;  5U1O A;  3FBS A;  3PO7 A;  1DXL A;  2TPR A;  3F8R A;  4NZH A;  4IVM B;  5HY5 A;  5FS6 A;  5HHF A;  3DGH A;  4U2S A;  3EAN A;  2E4G A;  1MOK A;  4OPU A;  4UDP A;  3S5W A;  1D4D A;  4B63 A;  3UOV A;  3AEA A;  1VG0 A;  1D4C A;  1SEZ A;  3UKF A;  3DJG X;  3L1R A;  2WP9 A;  4D04 A;  4K5R A;  2Q6U A;  3EF6 A;  4H4W A;  1BKW A;  3P4Q A;  4FDC B;  4EIP A;  5IPY A;  3VQR A;  5U63 A;  1DJQ A;  1L9E A;  2ZZC A;  4A5L A;  2XLT A;  1CBO A;  2EQ6 A;  3NLC A;  1ZMC A;  3CN8 A;  3URH A;  1ZP0 A;  2C73 A;  2GR2 A;  3K7Q X;  4JNA A;  4O5U A;  1TDN A;  4BK2 A;  5BRT A;  2IVD A;  1V59 A;  1GOS A;  1LQT A;  4H4Y A;  4C74 A;  4X9M A;  4TM0 A;  4H2R A;  1OJC A;  4ZCD A;  2XLP A;  3OC4 A;  1ZOY A;  1UKV G;  2B9Y A;  3O0H A;  1EL5 A;  5J7X A;  1CL0 A;  3AYL A;  5KVH A;  2BXR A;  3AD7 B;  2ARD A;  4Z2R A;  1D5T A;  4B69 A;  1E1K A;  2B9W A;  3UOZ A;  4DSH A;  4CY6 A;  4DNA A;  2A87 A;  2VRL A;  2OAM A;  5L46 A;  1TDF A;  3BHK A;  1S2Y A;  2RGH A;  3UTE A;  2WPE A;  3CGE A;  5FS8 A;  1B37 A;  3II4 A;  1JEH A;  4EM4 A;  1OJ9 A;  3NYF A;  1BF3 A;  3CGC A;  3SFE A;  2GMJ A;  1VRQ B;  4IA5 A;  4K22 A;  1NHR A;  1ZX9 A;  1REO A;  1GAL A;  4UDQ A;  5HYM A;  3BI5 A;  4OVI A;  2YM2 A;  5JCN A;  3RP6 A;  4ADW A;  3DK4 A;  3SGL A;  4YTN A;  5KVI A;  1NG3 A;  2CFY A;  3GMC A;  3GMB A;  1O95 A;  1IUW A;  3Q6J A;  2XVH A;  3AXB A;  3FPZ A;  4BK1 A;  4C77 A;  1DOD A;  1IJH A;  1KF6 A;  3G5Q A;  1E1N A;  2AR8 A;  1E1M A;  4EIQ A;  5U25 A;  2BC0 A;  1S2Q A;  2WP5 A;  4REK A;  1PXB A;  1IUS A;  2RGJ A;  3AE5 A;  1K0L A;  2X8G A;  1K0I A;  1VDC A;  4BJY A;  3IC9 A;  2GVC A;  1F8S A;  2R0G A;  2VVL A;  2BS3 A;  4U2L A;  2YG5 A;  1GSN A;  2F5Z A;  1X31 B;  2BAC A;  2OA1 A;  2NVK X;  3GRT A;  2BA9 A;  1H7X A;  2BAB A;  2JB3 A;  1TYP A;  2WOW A;  1ELI A;  4J57 A;  2WDQ A;  2YG3 A;  3AB1 A;  1GRE A;  3NNE A;  2YG6 A;  4KPR A;  1FEC A;  4EQX A;  1L9C A;  2DKH A;  3FMW A;  4XXG A;  4GDP A;  3AEG A;  3M13 A;  1PS9 A;  4Z26 A;  4H4U A;  5ER0 A;  5JCM A;  2YLT A;  3ALJ A;  4J36 A;  2WOI A;  4Y4M A;  4CNK A;  2XLU A;  2YLR A;  4H4Q A;  1IUX A;  2XVF A;  4H4V A;  3CPH G;  1KSU A;  4HA6 A;  2EQ9 A;  2WDV A;  5GRT A;  2QA2 A;  4IA6 A;  4PAB A;  2WP6 A;  1GTE A;  2R0P A;  5FMH A;  4AT0 A;  3SQP A;  5FS9 A;  1PJ7 A;  3K7M X;  3P1W A;  3UTH A;  3S61 A;  2ZZB A;  3R9U A;  4ECH A;  4B1B A;  3H8L A;  3L8K A;  4Y4L A;  1N4U A;  3LZX A;  2XVE A;  5CKU A;  4ZCC A;  4LU6 A;  4IV9 A;  3Q9T A;  4CNJ A;  1JRY A;  5HXI A;  2YR6 A;  1YQZ A;  1JRX A;  5EB5 A;  4U8P A;  1NHQ A;  2GAG B;  4B65 A;  2CUL A;  3CGB A;  4EMI A;  2IID A;  4Z2U A;  5FS7 A;  3NN0 X;  1E6E A;  4U8J A;  3LXD A;  2GB0 A;  3B6D A;  3EPT A;  4ZN0 A;  1ZDL A;  1N1P A;  1TDE A;  4A79 A;  1JRZ A;  3CIR A;  1YQ4 A;  2H88 A;  4JDR A;  5TR3 A;  2GAH B;  4EQW A;  2R4E A;  2HQM A;  2JAE A;  1PJ6 A;  2X8H A;  3UKL A;  2UZZ A;  3DJD A;  1OJT A;  3UKH A;  4OPG A;  4NTE A;  4DSG A;  2GR3 A;  3UTF A;  1M64 A;  2A89 A;  2C66 A;  2XLR A;  3AED A;  3CPI G;  2EQ8 A;  4X4J A;  3UOY A;  4B68 A;  1YQ3 A;  4J2W A;  3AE3 A;  4CCQ A;  3FIM B;  1PXC A;  3PS9 A;  4YSZ A;  5M10 A;  4A6N A;  2Z5X A;  4EMW A;  3KU9 A;  4J56 A;  3QSS A;  1CHU A;  4RG4 A;  4USQ A;  4E0V A;  2VZ2 A;  4TLZ A;  4YTP A;  4B64 A;  3LJP A;  1P2E A;  3RHA A;  2WPF A;  4YWO A;  1K0J A;  1ONF A;  2RGO A;  5IQ4 A;  3V3N A;  2CDU A;  3RP8 A;  4Z25 A;  4OPC A;  1E1L A;  4EM3 A;  2YLX A;  1PBF A;  1QLB A;  1H84 A;  3AEB A;  4RSL A;  5JCK A;  2V60 A;  1NHP A;  2WU2 A;  1ZOV A;  4JQ9 A;  2C64 A;  3GYJ A;  2OLO A;  1O5W A;  1P2H A;  2V5Z A;  3AYI A;  5IQ1 A;  4H50 A;  4U8L A;  5BUK A;  3WE0 A; 
#chains in the Genus database with same CATH topology
 4H2Q A;  2FKP A;  3QFB A;  3P93 A;  2PYX A;  2JKC A;  4TM1 A;  2E3T A;  3ALM A;  2OQY A;  3AE6 A;  4RG3 A;  3P3B A;  3VRD B;  3DME A;  2Z5Y A;  5BOF A;  2QDD A;  1CJ4 A;  1D7L A;  4YWS A;  1TYT A;  4ICY A;  3GO2 A;  2YQU A;  1H6V A;  3LB8 A;  2X8C A;  2NQL A;  3D8X A;  2QAE A;  2RAB A;  1N5X A;  4A99 A;  1PDZ A;  2BYB A;  3SFD A;  3PVC A;  2XFP A;  4IL2 A;  1CF3 A;  2C7G A;  4AP3 A;  3D9X A;  2A8X A;  3QVR A;  2PGW A;  3CNS A;  1EL8 A;  3S5S A;  4YSX A;  1IYX A;  1H83 A;  5M0Z A;  1GRA A;  4K1W A;  2B7S A;  2WES A;  2VOU A;  4OPI A;  2Q7V A;  5BUL A;  1PXA A;  2P3Z A;  3K30 A;  2JB1 A;  4BV6 A;  4TM4 A;  3BI2 A;  4IVO B;  4JNQ A;  3CGD A;  1GTH A;  4B66 A;  2QDE A;  3NH3 X;  3UKP A;  1N60 C;  1Y0P A;  2OZ3 A;  3UXL A;  1KSS A;  4M52 A;  1JU2 A;  2B7R A;  1GRT A;  3T9P A;  4G8T A;  4C5O A;  2AAQ A;  3P4R A;  2IVE A;  2YLW A;  2ZAD A;  4APN A;  2JK6 A;  5EOW A;  1BKH A;  2GRT A;  2PCE A;  3ZVH A;  1JNR A;  1FHU A;  1HYU A;  2JB2 A;  3GD6 A;  1LVL A;  1NG4 A;  4UDR A;  3L5O A;  2YLS A;  3AEC A;  4E4F A;  3VR8 A;  3T31 A;  2XFO A;  1IUV A;  4C3X A;  1L8P A;  2GQF A;  3VA8 A;  3NK0 X;  1VG9 A;  4OPD A;  5KNL A;  1XDI A;  2R9Z A;  3ISH A;  3UKA A;  3EAO A;  4PAA A;  3ABV A;  4A7A A;  3OTR A;  3D46 A;  1CJ3 A;  5EB4 A;  3ZVI A;  1GPE A;  2XSX A;  3NK2 X;  3RP7 A;  3F8P A;  1K4Q A;  1CC2 A;  4KT2 A;  3G5R A;  3NN6 X;  1MDL A;  3ZLF A;  1COY A;  3D1C A;  1RP0 A;  1H2I A;  1BGN A;  4GDE A;  1ZMD A;  4EQR A;  3RGT A;  3P4P A;  4OPT A;  2WEU A;  3DK9 A;  5EU9 A;  1RSG A;  4K7Z A;  1PBB A;  3LAD A;  4J33 A;  2XH4 A;  3DH9 A;  2AL1 A;  3GRS A;  3I3L A;  4H4R A;  2YR5 A;  3CPJ G;  4IT1 A;  4GME A;  4U8K A;  1LV0 A;  2YWL A;  2VQB A;  1FFV C;  3QSE A;  3MWC A;  3CXO A;  3AEE A;  2XCG A;  4KX6 A;  1SJC A;  3AD8 B;  1B4V A;  3DG7 A;  4CY8 A;  2W55 A;  4F4R A;  1TRB A;  1LPF A;  3H7V A;  1DXL A;  2TPR A;  4HYR A;  3DGB A;  4U2S A;  4UDP A;  1D4D A;  4E6M A;  1KD0 A;  3UOV A;  1W6T A;  4K5R A;  3AN1 A;  4GGB A;  3VQR A;  5KMS A;  3TW9 A;  2C73 A;  1VQZ A;  2GGJ A;  1V59 A;  1LQT A;  3BOX A;  2W3S A;  1CL0 A;  3AYL A;  4Z2R A;  1D5T A;  1S7M A;  2A87 A;  1JPM A;  3Q4D A;  2WPE A;  4K22 A;  5J04 A;  4UDQ A;  2YM2 A;  5JCN A;  2PSN A;  2C4C A;  1NG3 A;  2CFY A;  4IHC A;  1R0M A;  2XVH A;  4C77 A;  3FPZ A;  2O56 A;  5ENL A;  1KF6 A;  3CXB A;  4E5T A;  5U25 A;  1ECQ A;  1JRP A;  2BC0 A;  1X2G A;  1PXB A;  4J1O A;  4M0X A;  3AE5 A;  1K0I A;  1VDC A;  3EEZ A;  3IC9 A;  1F8S A;  2VVL A;  2BS3 A;  2YG5 A;  1X31 B;  1WUF A;  1L9C A;  3TJI A;  3FMW A;  4Z26 A;  1PS9 A;  7ENL A;  4H4Q A;  4H4V A;  3D47 A;  3NO1 A;  2WDV A;  1WYG A;  2QA2 A;  1SJA A;  4HPN A;  4IA6 A;  2WP6 A;  3SQP A;  3P1W A;  4GYP C;  5FJR A;  1MUC A;  5CKU A;  2XVE A;  4ZCC A;  1JRO A;  4IV9 A;  3R0K A;  1JRY A;  1JRX A;  5EB5 A;  4H83 A;  2P88 A;  2CUL A;  3SN0 A;  3CGB A;  2IID A;  4G6H A;  4Z2U A;  5FS7 A;  3T2Z A;  5KMR A;  3EPT A;  3QPE A;  1ZDL A;  3CIR A;  5TR3 A;  4EQW A;  2R4E A;  3CYJ A;  2JAE A;  1PJ6 A;  4DSG A;  2GR3 A;  3RR1 A;  2BRA A;  1M64 A;  2XLR A;  3AED A;  5M10 A;  3FIM B;  5FJU A;  3I4K A;  1ONF A;  2RGO A;  3T8Q A;  2CDU A;  3T2Y A;  3RP8 A;  1VDV A;  3EUB 3;  2YLX A;  1QLB A;  4RSL A;  4GIS A;  2WU2 A;  2C64 A;  3AYI A;  2V5Z A;  5IQ1 A;  4H50 A;  5BUK A;  2PTX A;  2BRY A;  1KNR A;  4USR A;  3R10 A;  4H4P A;  2E5V A;  4HNL A;  4OCG A;  4XWZ A;  2QA1 A;  3T4W A;  1Y56 B;  3B9J B;  4J31 A;  2P8C A;  2YLZ A;  2MNR A;  4GF7 A;  4H4X A;  2GQW A;  1F6M A;  3AE7 A;  5KRQ A;  1F3P A;  2HZG A;  4YKG A;  1S3B A;  4Z24 A;  3AE4 A;  1GXF A;  1DOC A;  2O9Z A;  1Q9I A;  4DN1 A;  3SZC A;  3IHG A;  2C76 A;  2BCG G;  4BJZ A;  3NYC A;  3OZ2 A;  2PP0 A;  1GRF A;  2R0C A;  2GR1 A;  4H4Z A;  3SXI A;  4A35 A;  4G74 A;  4II2 A;  3GD3 A;  1FCD A;  3NK1 X;  1PHH A;  4H2P A;  4GUV A;  4NNJ A;  2FYM A;  2GEW A;  2OLN A;  3FV9 A;  1JNZ A;  3CNP A;  2VVL G;  1BWC A;  1B5Q A;  4NWZ A;  2XYO A;  1ONE A;  4CRT A;  3QN3 A;  2X99 A;  3UP5 A;  2Y6Q A;  4J3Z A;  3T37 A;  4CCR A;  5KMP A;  1M6I A;  2OPJ A;  3NTA A;  1GND A;  3NVV B;  3TWA A;  3UKQ A;  2ZBW A;  1RM6 B;  2FJD A;  4FX9 A;  3UTG A;  2XLS A;  1GRG A;  3BNU A;  3JSK A;  1TE6 A;  3UOX A;  3UGV A;  2QQ6 A;  4I59 A;  1EC8 A;  2XVJ A;  2VRM A;  3SYI A;  3DFY A;  2XFN A;  3JW7 A;  4U8I A;  3VC6 A;  2NPX A;  3P9U A;  1F8W A;  1GER A;  3VDG A;  3DEQ A;  4YXD A;  1CC6 A;  2XH0 A;  1EL7 A;  1RYI A;  2WOV A;  4EWJ A;  1ZK7 A;  3DK8 A;  2P8B A;  4LA1 A;  3R1Z A;  3F8D A;  2ACZ A;  4MKS A;  2QJN A;  3MQT A;  2HXU A;  1W4X A;  1QJD A;  2PP3 A;  3MKC A;  3HYX A;  3KA7 A;  3G5S A;  2C75 A;  4M6U A;  3DGZ A;  1NPX A;  3K7T A;  4GAV A;  3ATQ A;  1ZY8 A;  2CVJ A;  3AWI A;  2OO6 A;  4K2X A;  2PS2 A;  4ROP A;  5C2T A;  2APG A;  3KPF A;  1Q1W A;  2WU5 A;  1NEN A;  4H2N A;  1DOB A;  1F8R A;  3SQS A;  2WS3 A;  1Y56 A;  1R6W A;  1NDA A;  3V3W A;  5J60 A;  5LV9 A;  3QSM A;  1ZXI C;  1FHV A;  2BK3 A;  2QCU A;  4GCM A;  2OAL A;  1EBH A;  3PWG A;  3TTE A;  5KMQ A;  1FOH A;  4BK3 A;  4GFI A;  3NZG A;  3K1G A;  2WHD A;  3LZW A;  4NTD A;  1XAN A;  2OX4 A;  4TM3 A;  3V4B A;  2FJB A;  3KVE A;  1P43 A;  1SJD A;  2WQY A;  4AT2 A;  1BGJ A;  2GR0 A;  4II3 A;  4A6N B;  3IJQ A;  3KLJ A;  3FBS A;  3PO7 A;  5U1O A;  3F8R A;  5FS6 A;  2E4G A;  4GYP A;  5FJP A;  3S5W A;  4K2S A;  1D4C A;  4G7F A;  4D04 A;  3P4Q A;  4H4W A;  3HRD C;  3GYX A;  2XLT A;  3RCY A;  3URH A;  1ZP0 A;  3FJ4 A;  1TDN A;  5BRT A;  2IVD A;  4C74 A;  4X9M A;  4TM0 A;  2XLP A;  4TVW A;  3O0H A;  1EL5 A;  4DX3 A;  4ENL A;  2ARD A;  4B69 A;  5G5G B;  3UOZ A;  4CY6 A;  2VRL A;  5L46 A;  3BHK A;  1S2Y A;  5FS8 A;  3II4 A;  3NYF A;  3CGC A;  1FFU C;  1VRQ B;  5HYM A;  3BI5 A;  3RP6 A;  4ADW A;  4YTN A;  2W54 A;  3MY9 A;  1O95 A;  3N6H A;  1E1N A;  1E1M A;  4G6G A;  3NXL A;  3UCC A;  3ES7 A;  2GVC A;  2ONE A;  2NVK X;  3GRT A;  2BA9 A;  1H7X A;  2BAB A;  2JB3 A;  1TYP A;  3AB1 A;  2YG6 A;  2DKH A;  4XXG A;  1N63 C;  4GDP A;  2OZT A;  3OW1 A;  3AEG A;  5ER0 A;  3UJS A;  3ALJ A;  4J36 A;  5BOE A;  1NEL A;  2XLU A;  4MGG A;  1IUX A;  2XVF A;  5GRT A;  3K7M X;  3V5F A;  1EC7 A;  3CK5 A;  3S61 A;  3R9U A;  3SJN A;  3H8L A;  2DW6 A;  4CNJ A;  5HXI A;  2YR6 A;  4GAP A;  3SR6 B;  5FJT A;  3PWI A;  1E6E A;  3CMM A;  3B6D A;  3JZU A;  1TDE A;  3U4F A;  4A79 A;  2GAH B;  2QGY A;  2HQM A;  4DYE A;  2UZZ A;  3DJD A;  3UKH A;  2PTW A;  3UJ2 A;  2W3R A;  4NTE A;  3UTF A;  1EC9 A;  3GC2 A;  2C66 A;  2GL5 A;  1V97 A;  4YSZ A;  1PXC A;  3PS9 A;  4A6N A;  3KU9 A;  3QSS A;  4RG4 A;  4E0V A;  2VZ2 A;  4TLZ A;  1FIQ B;  4YTP A;  1P2E A;  3RHA A;  3DG3 A;  4Z1Y A;  5IQ4 A;  4OPC A;  1H84 A;  3AEB A;  3HYW A;  2OLO A;  3PFR A;  1O5W A;  2P0I A;  3RED A;  1PJ5 A;  3AEF A;  4GIR A;  1YY5 A;  3NRZ B;  2Q0K A;  3COX A;  2XFQ A;  3QFA A;  3VR9 A;  3VRA A;  3GYI A;  3NKS A;  1LQU A;  3GSI A;  4UP3 A;  5JRB A;  3KKJ A;  5GSN A;  3HZL A;  3M12 A;  4N9X A;  4GR1 A;  2EQ7 A;  3NVY B;  4KEM A;  1TDK A;  1VQW A;  2YVF A;  3I6E A;  4U8O A;  4DXK A;  3GWD A;  4C3Y A;  3IJI A;  1OJA A;  2QVH A;  3TWB A;  1S3E A;  3ICT A;  4KWS A;  1GRB A;  3STP A;  2BC1 A;  1CC4 A;  1E7P A;  1N4V A;  3R07 C;  3PG6 A;  4YTM A;  2PTZ A;  3DG6 A;  2GF3 A;  3AE2 A;  3BHF A;  3HPF A;  4IP5 A;  5BVA A;  2AL2 B;  4K8D A;  3P4S A;  3AE9 A;  2HXT A;  5DBJ A;  2QJM A;  4AP1 A;  3NYE A;  1TZZ A;  3NG7 X;  2VVM A;  2JBV A;  1XS2 A;  2GGG A;  2V6O A;  4HNC A;  4H1Z A;  3IK4 A;  1GET A;  3VRB A;  3V3O A;  4A65 A;  4J34 A;  3ZDN A;  2YAU A;  3DJE A;  1LJ1 A;  2YVJ A;  3GDP A;  3AYJ A;  3RRA A;  1N5W C;  1FEA A;  3GDN A;  2WDR A;  4AOS A;  3SM8 A;  1KDG A;  2PHH A;  2MUC A;  2GV8 A;  2Q0L A;  3E1T A;  4H7U A;  2PPG A;  2C3C A;  3CTY A;  4DGK A;  3LOV A;  1GES A;  4Z43 A;  3C4A A;  1STZ A;  1L9D A;  1ZKQ A;  4U8M A;  3NTD A;  1BZL A;  5KWF A;  4JY3 A;  1NHS A;  3CNT A;  1H86 A;  2PP1 A;  3N4F A;  3TCS A;  2WBA A;  4HCL A;  3TOY A;  2C70 A;  3A7A A;  2FJE A;  1D7Y A;  3NVW B;  2FJA A;  2POZ A;  2V3A A;  1N61 C;  3SZF A;  4FK1 C;  3QKE A;  3B3R A;  3NHO X;  3GD4 A;  2BS4 A;  2DKI A;  3DA1 A;  3ZLG A;  3RNM A;  1KNP A;  2R45 A;  1PN0 A;  4IZG A;  3FG2 P;  3DFH A;  3GY1 A;  3ICS A;  1JCT A;  1KCZ A;  1PBE A;  4IL0 A;  1P48 A;  4JN9 A;  4D03 A;  2H89 A;  3H4K A;  3M0O A;  3AE1 A;  1GRH A;  1XHC A;  3ETR B;  2QJJ A;  1PDH A;  1PBC A;  3BJS A;  1B8S A;  1MO9 A;  3TJ4 A;  1DNC A;  1O94 A;  5C3J A;  2YR4 A;  5EBK A;  4A6G A;  3RO6 A;  4JHM A;  4O5Q A;  2GH5 A;  1L0V A;  3QJ4 A;  4H4S A;  1YEY A;  2GMH A;  2BS2 A;  3R25 A;  3NGC X;  1H82 A;  2WET A;  3I6T A;  3P0W A;  2AL2 A;  2HNE A;  3DGH A;  1MOK A;  2GDQ A;  3H12 A;  2I5Q A;  3DJG X;  3L1R A;  2WP9 A;  2Q6U A;  3OZY A;  4FDC B;  3VFC A;  5U63 A;  1DJQ A;  2PMQ A;  4A5L A;  4JNA A;  1ZMC A;  5FJO A;  4BK2 A;  1TKK A;  1GOS A;  4H4Y A;  3ZLH A;  4H2R A;  1OJC A;  4ZCD A;  3CB3 A;  1ZOY A;  1UKV G;  2OFJ A;  2PA6 A;  5J7X A;  3AD7 B;  1E1K A;  1X2H A;  4DSH A;  4DNA A;  2OAM A;  2RGH A;  3UTE A;  1B37 A;  4EM4 A;  1OJ9 A;  1NHR A;  3NS1 B;  3SSZ A;  4OVI A;  3GMC A;  3GMB A;  4ZCW A;  1IUW A;  3Q6J A;  3AXB A;  3V5C A;  4K8G A;  2AR8 A;  2WP5 A;  1OEP A;  2RGJ A;  1IUS A;  4BJY A;  2X8G A;  4U2L A;  3FCP A;  2BAC A;  2OA1 A;  1ELI A;  2WDQ A;  2YG3 A;  1GRE A;  3OP2 A;  3NNE A;  4EQX A;  1FEC A;  3SN4 A;  2PGE A;  3M13 A;  4H4U A;  4CNK A;  4Y4M A;  2WOI A;  4ZOH B;  4HA6 A;  3A7U A;  3JVA A;  1F9C A;  2E5A A;  5FMH A;  4AT0 A;  5FS9 A;  3UTH A;  2ZZB A;  4B1B A;  3L8K A;  1SJB A;  3FXG A;  1N4U A;  1N62 C;  3U9I A;  3Q9T A;  1JPD X;  4B65 A;  4EMI A;  1DTN A;  3NN0 X;  4U8J A;  3LXD A;  3QTP A;  2GB0 A;  4ZN0 A;  2H88 A;  4JDR A;  1EBG A;  2X8H A;  4GGH A;  3UKL A;  2GGI A;  2A89 A;  2EQ8 A;  4X4J A;  1WUE A;  3PK7 A;  4CCQ A;  3T0K A;  2Z5X A;  4J56 A;  4USQ A;  4B64 A;  4IP4 A;  2GSH A;  4YWO A;  1K0J A;  2AKZ A;  4Z25 A;  1E1L A;  4EM3 A;  5JCK A;  1E9I A;  1ZOV A;  4JQ9 A;  3GYJ A;  3UXK A;  3ES8 A;  3A7R A;  3IHM A;  3AE8 A;  3ATR A;  3VCN A;  3IWA A;  2OG9 A;  2C65 A;  1FL2 A;  2OZ8 A;  2PTY A;  1T3Q C;  2X3N A;  1LTX R;  3I6D A;  3KUM A;  3N6J A;  4H2H A;  5KOW A;  2W0H A;  3ICR A;  3BI4 A;  1PDY A;  3CND A;  3AM9 A;  1KN0 A;  1NEK A;  3NIX A;  3CAW A;  2C72 A;  3FYY A;  1CJC A;  3HW2 A;  4HCH A;  1IUU A;  4FI4 A;  2WPC A;  3UCL A;  1ELS A;  2XVI A;  3AD9 B;  1SB3 B;  3MSY A;  3UJR A;  1EL9 A;  4E4U A;  4OPL A;  5KXJ A;  4GRT A;  1DOE A;  4FK1 A;  4TLX A;  4JY2 A;  2YG4 A;  3MUC A;  1PBD A;  2R46 A;  2BK5 A;  3NT6 A;  2J3N A;  4Y4N A;  4WCT A;  4LII A;  3UKK A;  2B9X A;  4Z2T A;  4Z17 A;  4NEW A;  1N4W A;  2R4J A;  2V61 A;  2OKT A;  3R0U A;  3SY4 A;  3C96 A;  4WX1 A;  4X9N A;  4A9W A;  3DER A;  3H8A A;  2AQJ A;  2BXS A;  3C4N A;  4U2T A;  2FBW A;  4YKF A;  3DJJ A;  2DW7 A;  3CT2 A;  3UP4 A;  3ZYX A;  2X50 A;  3ADA B;  4YT0 A;  1H81 A;  1GEU A;  1DJN A;  2BK4 A;  2BCP A;  2ZZ0 A;  1H7W A;  2XFU A;  2XDO A;  3NFU A;  3TQP A;  2GGE A;  2YM1 A;  2OLA A;  2XGZ A;  3SX6 A;  4XWR A;  3MZN A;  4K5S A;  1RVK A;  5KOX A;  2VQ7 A;  2OVL A;  3DIP A;  1CJ2 A;  2TMD A;  3NVZ B;  3OPS A;  1MRA A;  4HB9 A;  4AOX A;  2C3D A;  4EMJ A;  4NTC A;  1D4E A;  1NU5 A;  2Y6R A;  1Z6L A;  1XPQ A;  3BNM A;  2ZC8 A;  2RDX A;  3IF9 A;  3ENL A;  1YKJ A;  3NRN A;  4P9S A;  4G9K A;  4KPL A;  3ALL A;  5JCL A;  3QLD A;  3GWF A;  4A3R A;  3DES A;  4B67 A;  1QO8 A;  4Z44 A;  4H4T A;  3UCD A;  4YSH A;  1MXT A;  1JOA A;  1TDO A;  5JCI A;  1E39 A;  2XH7 A;  3HYV A;  1EBD A;  4H19 A;  3KD9 A;  4MJW A;  4EQS A;  3QVP A;  3B97 A;  4BUR A;  3T14 A;  1NAA A;  2PU0 A;  4ZA0 A;  2YVG A;  3OZM A;  2YG7 A;  4I58 A;  2C67 A;  1OJD A;  3EKG A;  2E1M A;  3V76 A;  1GV4 A;  1Q1R A;  3ITJ A;  1FEB A;  3THU A;  4CBQ A;  1IUT A;  4U8N A;  2POD A;  1KKR A;  2V3B A;  5CQF A;  1KFY A;  3H8I A;  1AOG A;  4YSY A;  4NEV A;  4HN8 A;  3H70 A;  1GT8 A;  2I0Z A;  2B76 A;  3CNJ A;  4NZH A;  5HY5 A;  1JDF A;  4IVM B;  5HHF A;  3EAN A;  4OPU A;  4B63 A;  3AEA A;  1VG0 A;  1SEZ A;  3UKF A;  3EF6 A;  5IPY A;  1BKW A;  4EIP A;  1L9E A;  3N4E A;  2ZZC A;  1CBO A;  2EQ6 A;  3NLC A;  3K7Q X;  3CN8 A;  4O5U A;  2GR2 A;  4HCD A;  4JN8 A;  2CHR A;  5G5H B;  3UJF A;  3OC4 A;  2B9Y A;  3BSM A;  3SBF A;  5KVH A;  2BXR A;  1XPY A;  2B9W A;  1BQG A;  3T2K A;  3VC5 A;  3SZW A;  2GGH A;  1TDF A;  3CGE A;  3SN1 A;  1JEH A;  3SFE A;  1BF3 A;  2GMJ A;  4TVY A;  4IA5 A;  1ZX9 A;  1REO A;  1GAL A;  2PU1 A;  3UJE A;  3SZ0 A;  3DK4 A;  3SGL A;  5KVI A;  3IJL A;  4BK1 A;  4E8G A;  1KKO A;  2AKM A;  1DOD A;  1IJH A;  3G5Q A;  4EIQ A;  4REK A;  1S2Q A;  1K0L A;  4DWD A;  2R0G A;  1GSN A;  2F5Z A;  3RIT A;  2WOW A;  4J57 A;  4KPR A;  4FP1 A;  2OQH A;  5JCM A;  2YLT A;  2YLR A;  3CPH G;  1KSU A;  2EQ9 A;  4PAB A;  1GTE A;  2R0P A;  1PJ7 A;  2XH2 A;  4ECH A;  3KPK A;  4Y4L A;  3LZX A;  4LU6 A;  3T6C A;  1YQZ A;  4U8P A;  1NHQ A;  2GAG B;  1FO4 A;  4X2P A;  6ENL A;  3FVD A;  3ZVH B;  1MDR A;  3DDM A;  1N1P A;  1JRZ A;  1YQ4 A;  4G73 A;  3R11 A;  1OJT A;  3AMZ A;  4DHG A;  1MNS A;  4OPG A;  3Q45 A;  3CPI G;  3UOY A;  4MMW A;  4B68 A;  1YQ3 A;  4J2W A;  3AE3 A;  4EMW A;  1CHU A;  3VCC A;  3LJP A;  2WPF A;  3V3N A;  1PBF A;  2V60 A;  1NHP A;  5IDZ A;  1P2H A;  4U8L A;  3S47 A;  4JN7 A;  3WE0 A; 
#chains in the Genus database with same CATH homology
 4H2Q A;  1KNR A;  3QFB A;  4USR A;  3RED A;  4H4P A;  3IHM A;  3AE8 A;  3ATR A;  1PJ5 A;  3AEF A;  1YY5 A;  2PYX A;  3IWA A;  2JKC A;  2Q0K A;  2E5V A;  4TM1 A;  4OCG A;  2C65 A;  3ALM A;  2QA1 A;  3COX A;  1FL2 A;  2XFQ A;  3QFA A;  4XWZ A;  3VR9 A;  1Y56 B;  3VRA A;  3GYI A;  3NKS A;  1LQU A;  4J31 A;  2X3N A;  1LTX R;  2YLZ A;  3AE6 A;  3GSI A;  4GF7 A;  5JRB A;  4H4X A;  2GQW A;  3I6D A;  4RG3 A;  4UP3 A;  3KKJ A;  5GSN A;  3HZL A;  3VRD B;  5KOW A;  2W0H A;  1F6M A;  3M12 A;  4N9X A;  3DME A;  3ICR A;  2Z5Y A;  3AE7 A;  5KRQ A;  1F3P A;  4GR1 A;  2EQ7 A;  3BI4 A;  4YKG A;  1S3B A;  1TDK A;  1VQW A;  3AE4 A;  1GXF A;  4Z24 A;  1DOC A;  2O9Z A;  3CND A;  2YVF A;  1KN0 A;  1CJ4 A;  1Q9I A;  1NEK A;  1D7L A;  3NIX A;  4U8O A;  3GWD A;  3SZC A;  3IHG A;  1TYT A;  2C72 A;  2C76 A;  1CJC A;  4ICY A;  2BCG G;  4C3Y A;  1IUU A;  4BJZ A;  2WPC A;  2YQU A;  3NYC A;  4Y4N A;  1H6V A;  3OZ2 A;  1OJA A;  1GRF A;  1S3E A;  3LB8 A;  3ICT A;  2R0C A;  2GR1 A;  4H4Z A;  3SXI A;  3UCL A;  2XVI A;  2X8C A;  3AD9 B;  4G74 A;  4II2 A;  3GD3 A;  1GRB A;  1FCD A;  1EL9 A;  4OPL A;  5KXJ A;  2BC1 A;  4GRT A;  1DOE A;  3D8X A;  4FK1 A;  4TLX A;  4JY2 A;  2YG4 A;  3NK1 X;  1PHH A;  4H2P A;  4GUV A;  4NNJ A;  2QAE A;  2RAB A;  2GEW A;  4A99 A;  1CC4 A;  1PBD A;  1E7P A;  2OLN A;  2BYB A;  1JNZ A;  1N4V A;  3CNP A;  3PG6 A;  2VVL G;  4YTM A;  3SFD A;  2R46 A;  1BWC A;  2BK5 A;  3PVC A;  1B5Q A;  2J3N A;  2XFP A;  3NT6 A;  4NWZ A;  4WCT A;  4LII A;  2GF3 A;  2XYO A;  3AE2 A;  1CF3 A;  3BHF A;  2C7G A;  4AP3 A;  3D9X A;  3UKK A;  5BVA A;  2A8X A;  2B9X A;  3QVR A;  4CRT A;  4K8D A;  3CNS A;  3AE9 A;  3P4S A;  1EL8 A;  4Z2T A;  4NEW A;  2X99 A;  4YSX A;  1N4W A;  3UP5 A;  1H83 A;  2Y6Q A;  2R4J A;  5DBJ A;  5M0Z A;  2V61 A;  3T37 A;  4AP1 A;  4CCR A;  5KMP A;  1GRA A;  3SY4 A;  1M6I A;  2B7S A;  3C96 A;  3NYE A;  4WX1 A;  2WES A;  2VOU A;  3NTA A;  2Q7V A;  4OPI A;  5BUL A;  1GND A;  1PXA A;  3K30 A;  3NG7 X;  4X9N A;  2VVM A;  2JB1 A;  2ZBW A;  2JBV A;  3UKQ A;  4BV6 A;  4TM4 A;  4A9W A;  3BI2 A;  4IVO B;  4JNQ A;  2V6O A;  2FJD A;  2AQJ A;  4FX9 A;  3CGD A;  1GTH A;  2BXS A;  4B66 A;  3C4N A;  3NH3 X;  3UKP A;  1GET A;  4U2T A;  3VRB A;  1Y0P A;  3V3O A;  3UTG A;  4A65 A;  2FBW A;  2XLS A;  1GRG A;  3BNU A;  3JSK A;  4J34 A;  3ZDN A;  2YAU A;  3DJE A;  3DJJ A;  1LJ1 A;  4YKF A;  2YVJ A;  3UOX A;  3GDP A;  4I59 A;  3UP4 A;  3ZYX A;  2X50 A;  3AYJ A;  1KSS A;  1FEA A;  4M52 A;  2VRM A;  2WDR A;  2XVJ A;  1H81 A;  1JU2 A;  3ADA B;  3GDN A;  2B7R A;  3SYI A;  1GRT A;  4AOS A;  4YT0 A;  3SM8 A;  1GEU A;  1KDG A;  2AAQ A;  2PHH A;  3P4R A;  4C5O A;  1DJN A;  2BK4 A;  2XFN A;  2GV8 A;  2Q0L A;  2IVE A;  4U8I A;  2YLW A;  2BCP A;  3E1T A;  2ZZ0 A;  4H7U A;  4APN A;  2JK6 A;  1H7W A;  2XFU A;  5EOW A;  2GRT A;  2NPX A;  2XDO A;  3P9U A;  1F8W A;  1GER A;  2C3C A;  2YM1 A;  1JNR A;  1HYU A;  3CTY A;  2JB2 A;  1CC6 A;  3LOV A;  1GES A;  4DGK A;  4Z43 A;  4YXD A;  3C4A A;  1LVL A;  3SX6 A;  1EL7 A;  1NG4 A;  1L9D A;  4UDR A;  1ZKQ A;  3L5O A;  3NTD A;  4U8M A;  4XWR A;  1RYI A;  1BZL A;  2YLS A;  3AEC A;  2WOV A;  4K5S A;  3VR8 A;  1ZK7 A;  3T31 A;  5KOX A;  3DK8 A;  2XFO A;  1IUV A;  4C3X A;  4LA1 A;  2VQ7 A;  2GQF A;  5KWF A;  4JY3 A;  1NHS A;  1CJ2 A;  2TMD A;  3F8D A;  3NK0 X;  2ACZ A;  1VG9 A;  3CNT A;  4OPD A;  1H86 A;  1W4X A;  1QJD A;  5KNL A;  3HYX A;  2WBA A;  3KA7 A;  1XDI A;  4HB9 A;  2R9Z A;  2C70 A;  2FJE A;  3ISH A;  3EAO A;  3UKA A;  3G5S A;  4AOX A;  2C3D A;  4EMJ A;  4NTC A;  4PAA A;  1D4E A;  3ABV A;  1D7Y A;  4A7A A;  2FJA A;  2Y6R A;  1CJ3 A;  1Z6L A;  5EB4 A;  1XPQ A;  2C75 A;  3BNM A;  2V3A A;  3IF9 A;  3DGZ A;  1GPE A;  1YKJ A;  1NPX A;  3NRN A;  4P9S A;  3SZF A;  3NK2 X;  3K7T A;  3RP7 A;  4FK1 C;  4GAV A;  4G9K A;  3ALL A;  5JCL A;  3ATQ A;  3F8P A;  1ZY8 A;  3B3R A;  3NHO X;  1K4Q A;  1CC2 A;  3GWF A;  2CVJ A;  3AWI A;  3GD4 A;  3G5R A;  2BS4 A;  4B67 A;  1QO8 A;  3NN6 X;  4H4T A;  4K2X A;  4Z44 A;  5C2T A;  4YSH A;  2APG A;  1COY A;  2DKI A;  3D1C A;  3DA1 A;  1RP0 A;  3KPF A;  1MXT A;  1JOA A;  1H2I A;  1Q1W A;  1BGN A;  1NEN A;  1TDO A;  2WU5 A;  5JCI A;  1E39 A;  3HYV A;  4GDE A;  3RNM A;  1EBD A;  1KNP A;  2R45 A;  4H2N A;  1DOB A;  1ZMD A;  4EQR A;  1F8R A;  2WS3 A;  3KD9 A;  4MJW A;  1PN0 A;  1Y56 A;  3P4P A;  3FG2 P;  1NDA A;  4OPT A;  4EQS A;  2WEU A;  3QVP A;  4BUR A;  5J60 A;  3ICS A;  3DK9 A;  3T14 A;  5LV9 A;  3QSM A;  1NAA A;  1RSG A;  4K7Z A;  1PBE A;  1PBB A;  2BK3 A;  3LAD A;  2YVG A;  2QCU A;  4J33 A;  4GCM A;  4JN9 A;  2YG7 A;  2OAL A;  2H89 A;  2C67 A;  4I58 A;  4D03 A;  3DH9 A;  3H4K A;  1OJD A;  3GRS A;  3I3L A;  4H4R A;  5KMQ A;  2E1M A;  3V76 A;  1FOH A;  1GV4 A;  3AE1 A;  2YR5 A;  3M0O A;  4BK3 A;  3CPJ G;  1GRH A;  1Q1R A;  3ITJ A;  1FEB A;  1XHC A;  4U8K A;  1PDH A;  2WHD A;  1PBC A;  1LV0 A;  3LZW A;  4NTD A;  4CBQ A;  1IUT A;  4U8N A;  2YWL A;  2VQB A;  1B8S A;  1XAN A;  1MO9 A;  3QSE A;  2V3B A;  5CQF A;  1DNC A;  1O94 A;  4TM3 A;  5C3J A;  2YR4 A;  2FJB A;  3KVE A;  5EBK A;  3AEE A;  1KFY A;  3H8I A;  1AOG A;  2XCG A;  4KX6 A;  2WQY A;  4AT2 A;  1BGJ A;  4YSY A;  3AD8 B;  4O5Q A;  2GH5 A;  2GR0 A;  4NEV A;  1B4V A;  4II3 A;  3QJ4 A;  1L0V A;  4A6N B;  4H4S A;  1GT8 A;  2I0Z A;  2GMH A;  3KLJ A;  4CY8 A;  2B76 A;  2BS2 A;  3NGC X;  1H82 A;  1TRB A;  1LPF A;  2WET A;  3CNJ A;  5U1O A;  3FBS A;  3PO7 A;  1DXL A;  2TPR A;  3F8R A;  4NZH A;  4IVM B;  5HY5 A;  5FS6 A;  5HHF A;  3DGH A;  4U2S A;  3EAN A;  2E4G A;  1MOK A;  4OPU A;  4UDP A;  3S5W A;  1D4D A;  4B63 A;  3UOV A;  3AEA A;  1VG0 A;  1D4C A;  1SEZ A;  3UKF A;  3DJG X;  3L1R A;  2WP9 A;  4D04 A;  4K5R A;  2Q6U A;  3EF6 A;  4H4W A;  1BKW A;  3P4Q A;  4FDC B;  4EIP A;  5IPY A;  3VQR A;  5U63 A;  5KMS A;  1DJQ A;  1L9E A;  3GYX A;  2ZZC A;  4A5L A;  2XLT A;  1CBO A;  2EQ6 A;  3NLC A;  1ZMC A;  3CN8 A;  3URH A;  1ZP0 A;  2C73 A;  2GR2 A;  3K7Q X;  4JNA A;  4O5U A;  1TDN A;  4BK2 A;  5BRT A;  2IVD A;  1V59 A;  1GOS A;  1LQT A;  4H4Y A;  4C74 A;  4X9M A;  4TM0 A;  4H2R A;  1OJC A;  4ZCD A;  2XLP A;  3OC4 A;  1ZOY A;  1UKV G;  2B9Y A;  3O0H A;  1EL5 A;  5J7X A;  1CL0 A;  3AYL A;  5KVH A;  2BXR A;  3AD7 B;  2ARD A;  4Z2R A;  1D5T A;  4B69 A;  1E1K A;  2B9W A;  3UOZ A;  3T2K A;  4DSH A;  4CY6 A;  1S7M A;  4DNA A;  2A87 A;  2VRL A;  2OAM A;  5L46 A;  3SZW A;  1TDF A;  3BHK A;  1S2Y A;  2RGH A;  3UTE A;  2WPE A;  3CGE A;  5FS8 A;  1B37 A;  3II4 A;  1JEH A;  4EM4 A;  1OJ9 A;  3NYF A;  1BF3 A;  3CGC A;  3SFE A;  2GMJ A;  1VRQ B;  4IA5 A;  4K22 A;  1NHR A;  1ZX9 A;  1REO A;  1GAL A;  4UDQ A;  5HYM A;  3BI5 A;  4OVI A;  2YM2 A;  5JCN A;  3SZ0 A;  3RP6 A;  4ADW A;  3DK4 A;  3SGL A;  2C4C A;  5KVI A;  1NG3 A;  2CFY A;  4YTN A;  3GMC A;  3GMB A;  1O95 A;  1IUW A;  3Q6J A;  2XVH A;  3AXB A;  3FPZ A;  4BK1 A;  4C77 A;  1DOD A;  1IJH A;  1KF6 A;  3G5Q A;  1E1N A;  2AR8 A;  1E1M A;  4EIQ A;  4G6G A;  5U25 A;  2BC0 A;  1S2Q A;  2WP5 A;  4REK A;  1PXB A;  1IUS A;  2RGJ A;  3AE5 A;  1K0L A;  2X8G A;  1K0I A;  1VDC A;  4BJY A;  3IC9 A;  2GVC A;  1F8S A;  2R0G A;  2VVL A;  2BS3 A;  4U2L A;  2YG5 A;  1GSN A;  2F5Z A;  1X31 B;  2BAC A;  2OA1 A;  2NVK X;  3GRT A;  2BA9 A;  1H7X A;  2BAB A;  2JB3 A;  1TYP A;  2WOW A;  1ELI A;  4J57 A;  2WDQ A;  2YG3 A;  3AB1 A;  1GRE A;  3NNE A;  2YG6 A;  4KPR A;  1FEC A;  4EQX A;  1L9C A;  2DKH A;  3FMW A;  4XXG A;  4GDP A;  3AEG A;  3M13 A;  1PS9 A;  4Z26 A;  4H4U A;  5ER0 A;  5JCM A;  2YLT A;  3ALJ A;  4J36 A;  2WOI A;  4Y4M A;  4CNK A;  2XLU A;  2YLR A;  4H4Q A;  1IUX A;  2XVF A;  4H4V A;  3CPH G;  1KSU A;  4HA6 A;  2EQ9 A;  2WDV A;  5GRT A;  2QA2 A;  4IA6 A;  4PAB A;  2WP6 A;  1GTE A;  2R0P A;  5FMH A;  4AT0 A;  3SQP A;  5FS9 A;  1PJ7 A;  3K7M X;  3P1W A;  3UTH A;  3S61 A;  2ZZB A;  3R9U A;  4ECH A;  4B1B A;  3H8L A;  3KPK A;  3L8K A;  4Y4L A;  1N4U A;  3LZX A;  2XVE A;  5CKU A;  4ZCC A;  4LU6 A;  4IV9 A;  3Q9T A;  4CNJ A;  1JRY A;  5HXI A;  2YR6 A;  1YQZ A;  1JRX A;  5EB5 A;  4U8P A;  1NHQ A;  2GAG B;  4B65 A;  4GAP A;  2CUL A;  3CGB A;  4EMI A;  2IID A;  4G6H A;  4Z2U A;  5FS7 A;  3NN0 X;  1E6E A;  3CMM A;  3T2Z A;  4U8J A;  3LXD A;  2GB0 A;  5KMR A;  3B6D A;  3EPT A;  4ZN0 A;  1ZDL A;  1N1P A;  1TDE A;  4A79 A;  1JRZ A;  3CIR A;  1YQ4 A;  2H88 A;  4JDR A;  5TR3 A;  2GAH B;  4G73 A;  4EQW A;  2R4E A;  2HQM A;  2JAE A;  1PJ6 A;  2X8H A;  3UKL A;  2UZZ A;  3DJD A;  1OJT A;  3UKH A;  4OPG A;  4NTE A;  4DSG A;  2GR3 A;  3UTF A;  2BRA A;  1M64 A;  2A89 A;  2C66 A;  2XLR A;  3AED A;  3CPI G;  2EQ8 A;  4X4J A;  3UOY A;  4B68 A;  1YQ3 A;  4J2W A;  3AE3 A;  4CCQ A;  3FIM B;  1PXC A;  3PS9 A;  4YSZ A;  3T0K A;  5M10 A;  4A6N A;  2Z5X A;  4EMW A;  3KU9 A;  4J56 A;  3QSS A;  1CHU A;  4RG4 A;  4USQ A;  4E0V A;  2VZ2 A;  4TLZ A;  4YTP A;  4B64 A;  3LJP A;  1P2E A;  3RHA A;  2WPF A;  4YWO A;  1K0J A;  1ONF A;  2RGO A;  5IQ4 A;  3V3N A;  2CDU A;  3T2Y A;  3RP8 A;  4Z25 A;  4OPC A;  1E1L A;  4EM3 A;  2YLX A;  1PBF A;  1QLB A;  1H84 A;  3AEB A;  4RSL A;  5JCK A;  2V60 A;  1NHP A;  2WU2 A;  1ZOV A;  4JQ9 A;  2C64 A;  3HYW A;  3GYJ A;  2OLO A;  1O5W A;  1P2H A;  2V5Z A;  3AYI A;  5IQ1 A;  4H50 A;  4U8L A;  5BUK A;  3WE0 A;  2BRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...