3TJIA

Crystal structure of an enolase from enterobacter sp. 638 (efi target efi-501662) with bound mg
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
399
structure length
399
Chain Sequence
b'MTPVIIKNIECFITRPDRHNLVTVRVTTEQGITGHGCATFQQRPLAVKTLVDEYLQPLMIGRDANNIEDLWQMMNVNAYWRNGPLMNNAISGVDMALWDIKGQLAGMPLYQLFGGKSRDAIPAYSHASGETLEALFASVDALIAQGYRHIRCQLGFYGGTPSALHAPDNPTPGAWFDQQEYMSNTVEMFHALREKYGWKLHILHDVHERLFPQQAVQLAKQLEPFQPYFIEDILPPQQSAWLEQVRQQSCVPLALGELFNNPAEWHDLIVNRRIDFIRCHVSQIGGITPALKLAHLCQAFGVRLAWHGPGDMTPIGVAVNTHLNIHLHNAAIQEFIPRSATTNDVFPGAPEVKEGFVYPPVQPGIGVGFNEALALAHPVLYRPHEWTQSRLPDGTIHTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme, N-terminal d
publication title Crystal structure of an enolase from enterobacter sp. 638 (efi target efi-501662) with boung mg
rcsb
source organism Enterobacter sp. 638
molecule tags Lyase
total genus 140
structure length 399
sequence length 399
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3tjiA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3tjiA01
2OZ3A 3H70A 5FJRA 4K1WA 4K8GA 4E6MA 1JCTA 4GISA 3STPA 3SN4A 3ZVHB 4FI4A 5IDZA 1KKOA 3CK5A 4IZGA 3VCNA 4GYPA 1EBGA 3SN1A 5J04A 2QJMA 2PA6A 5FJUA 3JVAA 1SJCA 3SQSA 3N6HA 3SN0A 4M6UA 1R6WA 3BOXA 3ENLA 3GC2A 5FJTA 3DG6A 4E4UA 3T6CA 2AL1A 4J1OA 3V5FA 3I6TA 4GMEA 2PU0A 3MY9A 4HNCA 3TWAA 3BJSA 4HYRA 2PGWA 2QJNA 1TE6A 2PP0A 4E5TA 3CT2A 2GL5A 4DN1A 2ZADA 3T9PA 3B97A 3EKGA 4FP1A 3RGTA 3V5CA 1XPYA 1KKRA 4IP4A 2PTZA 2QDDA 2ONEA 2ZC8A 1L8PA 1BQGA 3TW9A 4IL0A 3FCPA 3FJ4A 2FYMA 5FJOA 3R10A 4JN8A 4KPLA 3Q45A 3GD6A 1XS2A 3UJ2A 3TQPA 1MDRA 4H83A 3DG7A 2I5QA 3QTPA 1FHUA 3SSZA 3UCCA 1NU5A 3PFRA 2AL2A 3FXGA 2AKMA 2DW6A 5BOFA 3T4WA 2XGZA 3MZNA 2P8BA 4H2HA 5BOEA 3R25A 2PU1A 2OKTA 1JDFA 2XH4A 3ZLFA 3RCYA 4DHGA 3R11A 2OO6A 3DG3A 3MKCA 2GGJA 2PTXA 4DYEA 2MNRA 3P0WA 1DTNA 1EBHA 4KT2A 2PCEA 2XSXA 3NO1A 4HPNA 3PWIA 4ZCWA 3VFCA 4GIRA 3GY1A 3DIPA 3ZVHA 3SBFA 3TWBA 2DW7A 3RR1A 4M0XA 3UJEA 4H19A 3TCSA 2PGEA 3ES7A 1EC8A 3NZGA 2POZA 1WUFA 3ZLHA 1P43A 2P0IA 2QDEA 4X2PA 3VCCA 3CAWA 3FYYA 1ELSA 2P3ZA 3OW1A 4ENLA 3UJRA 4A3RA 2PODA 3S5SA 1MDLA 2FKPA 4GFIA 2AKZA 2GDQA 3IJLA 2HNEA 3S47A 3U4FA 2PP1A 3OTRA 1R0MA 2HXTA 3PK7A 5ENLA 2PPGA 3I6EA 3QPEA 2PP3A 6ENLA 4JHMA 3MWCA 1JPDX 2O56A 3IJQA 4MGGA 4F4RA 1MRAA 3BSMA 3T8QA 1TKKA 1ECQA 2CHRA 3THUA 1SJBA 3IK4A 3JW7A 4HCDA 3R0UA 1NELA 1EC9A 3N4FA 1KCZA 3TOYA 3OP2A 4MKSA 3SJNA 1WUEA 2QQ6A 3DGBA 1IYXA 3MUCA 4IHCA 3OZMA 3I4KA 4HCLA 2AL2B 3DESA 2OQHA 3UXKA 1F9CA 2OG9A 3DFHA 1W6TA 3NFUA 3N4EA 3QN3A 3VC6A 1EC7A 1KD0A 2NQLA 4H1ZA 3CXOA 3H7VA 4A6GA 3UJFA 4HCHA 2OX4A 1OEPA 2XH7A 1PDYA 4KWSA 3VDGA 4DWDA 3EEZA 2OVLA 3UXLA 4DX3A 1TZZA 1FHVA 3FV9A 3ZVIA 5EU9A 2OFJA 1E9IA 3DEQA 2OPJA 3K1GA 2QVHA 3NXLA 3DFYA 4IL2A 3UGVA 1ONEA 2OLAA 2PS2A 2XH2A 3N6JA 2MUCA 3P3BA 1SJDA 3CB3A 4GGHA 4HNLA 2PMQA 3V3WA 2GGIA 3D46A 4KEMA 1MNSA 3TTEA 2GSHA 2GGHA 7ENLA 3JZUA 3QKEA 2PTYA 2GGEA 2P8CA 4EWJA 4YWSA 2RDXA 1MUCA 1BKHA 3RRAA 1JPMA 3KUMA 3GO2A 3MSYA 3H8AA 3OPSA 2GGGA 1PDZA 2OZTA 3R1ZA 3ES8A 3DDMA 3UCDA 5FJPA 2PTWA 3RO6A 1YEYA 3VC5A 2HXUA 4K2SA 4GYPC 3IJIA 4GGBA 2OQYA 3PWGA 3V4BA 2XH0A 3ZLGA 4Z17A 1SJAA 4DXKA 3P93A 4HN8A 3TJIA 4J3ZA 2OZ8A 3OZYA 3FVDA 2PSNA 3D47A 3CYJA 3MQTA 4G8TA 1RVKA 3H12A 4IT1A 3VA8A 4A35A 3QLDA 3Q4DA 2QGYA 3DERA 2P88A 3HPFA 4ZA0A 4E4FA 3TJ4A 2HZGA 4IP5A 2QJJA 3U9IA 4Z1YA 3RITA 3UJSA 4MMWA 1P48A 3R0KA 4E8GA 4ROPA 4G7FA 4JN7A
chains in the Genus database with same CATH superfamily
3FAWA 3QV7A 6XIMA 3FDGA 2PWEA 1KN0A 3OC4A 2V6AA 5EB8A 1V08A 3RPDA 1PV8A 1GVIA 2HQMA 3ZVHB 2Z27A 1ZBKA 3HG2A 3DGRA 4MYXA 4PUWA 1TPEA 1FA2A 3QFAA 4ATDA 3M9YA 3GG0A 4M6UA 3ENLA 2W55A 2PC8A 2WZHA 4MG4A 4NAFA 2JK6A 5FI8A 1VCFA 3CMJA 5IM51 3MP3A 3K8LA 1PX8A 1PL9A 1XIGA 4Q7NA 3IEBA 1NP2A 1PXGA 3QLLA 1EHAA 4IWWA 3CT2A 1OGBA 5KZDA 4IPIA 2ZADA 2WZEA 3MDWA 4FP1A 6XIAA 4I6VA 4U4MA 3CV1A 4ZQRA 3U5UA 3T42A 3M16A 3K1DA 1E51A 3BMVA 3WLHA 3CZJA 1LJYA 5D9NA 1CTNA 3W27A 1O4UA 4O10A 1M7PA 4HPGA 5CJMA 2Y63A 2O9PA 5LHFA 4DJDD 1FWTA 3TTQA 1HF6A 4O1FA 2DU2A 3T7VA 3GVQA 2AGTA 3DG7A 3ZMRA 4CLMA 1XRVA 5A94A 2J47A 3DHFA 3VGGA 3WUFA 3WD0A 2NSOA 1NFPA 2D1ZA 4X3ZA 1LLWA 4YMZA 1LRTA 3KL5A 4PMVA 4AAJA 2ACRA 2I17A 3P60A 4N9EA 2MANA 2CBUA 3MBDA 2AAQA 1EJ7L 1KXTA 3ITLA 3LMYA 1XGZA 1X8CA 3GU2A 3EOSA 2R82A 1BSLA 1JYWA 4S1FA 4PRWA 5HUPA 1S2WA 3QW3A 1YW1A 1GPFA 4HPNA 4Z2LA 3TYBA 5JH1A 2QIIA 4FXSA 3A4JA 4LSBA 4HU3A 4YU1A 2RDUA 1RAKA 3UEQA 3NQCA 2OTDA 1EA0A 2X1SA 3P61A 1K9EA 4QX4A 1JFHA 1TTJA 3SRHA 2E3TA 2OKOA 3TVAA 2YDQA 3TN6A 1QPNA 4ZSUA 3ERPA 3ARRA 3BSHA 1W5OA 4O1EA 1NF0A 1M6IA 4A3RA 3AICA 1ZB5A 7TAAA 4M6QA 3CEUA 5D9MA 1PJ9A 1NDZA 1FDZA 5ABHA 5BU6A 1MWOA 3LCGA 7ODCA 4NZJA 4MB3A 5DX7A 3EZ4A 1FWJC 5C54A 2ALDA 4JHMA 2D2OA 5D09A 4KPRA 1R2RA 2V2CA 4AZCA 3WBXA 2C91A 3RX3A 1YRRA 4Q4OA 5BMWA 4ZQMA 4DJDC 4GI6A 3OQEA 3LTPA 4P7RA 1ZDLA 1OY0A 4BURA 4BK9A 1NM9A 4Q8MA 4H7VA 1H11A 1M03A 1QWKA 3RFAA 1WDRA 3B9DA 1OSEA 3THUA 4NASA 5EMKA 3MC5A 5CBJA 5RUBA 3GDBA 3R0UA 2NX3A 4A2RA 3G6MA 5DF0A 2J78A 3K4AA 1DJQA 1OYCA 3IIOA 4GNVA 2P3EA 5LIKX 4R27A 4G7EA 1FQ0A 3ZWTA 4OZOA 3DGBA 4PZVA 4B3KA 2W9MA 4N7QA 4PUUA 1EX5A 5DFAA 4Q7IA 1KR1A 1TWDA 1EJVC 3DHPA 2JF6A 1GREA 2CZVA 3NCOA 1JJKA 4PUNA 4PUEA 1OGSA 4W4QA 4GVIA 3DFHA 1WE5A 1EJXC 3KBSA 5U4NA 4NZ1A 1EFZA 3MU7A 3TE9A 3Q37A 4IIGA 1I75A 4H1ZA 1OFOA 1Q6DA 4UFLA 4JTKA 3DKJA 1J0HA 4A6GA 1H0GA 3G24A 3W02A 2WMIB 3NJ3A 4JTTA 3GDLA 1TG7A 2CBVA 3MPGA 5GNXA 1LOQA 3MUZ1 3ALFA 3GHRA 4OUIA 3KBVA 2D3LA 3QYSA 3HQPA 4QNWA 3FV9A 3CPGA 3W1MA 2QPUA 2IKHA 3WF1A 1XLAA 3F03K 1T0OA 1LLOA 3E3HA 3K1GA 4PCFA 3KRZA 4EP8C 1ZHAA 1B9ZA 3W1PA 3QMTA 2PS2A 1B4KA 1MEHA 2NV1A 3GRSA 3BW2A 4HT3A 4XB3A 3HJZA 1SJDA 1EP2A 2BY3A 2X42A 4QCEA 4JL1A 2WM0A 1Y7VA 3O6CA 4REQB 4DZIA 3TH6A 4DLMA 3W0KA 1QPRA 4JICA 1BXNA 1PWLA 3SO7A 5K9XA 7ENLA 1RUSA 3O6AA 5J8LA 3LUTA 3VUSA 4NZFA 3BK0A 2VFEA 7CGTA 1NWTA 2GZXA 3IC9A 4FZIA 4PMUA 1CXHA 2ISDA 3VKDA 1WDSA 4F0RA 4OOUA 1YEYA 3UNTA 1NVMA 1QNSA 4LJ3A 2XZ9A 3RDKA 2OQYA 3PWGA 3O07A 1LRQA 5BXSA 4GJIA 3OBKA 1FKWA 3GTFA 1SZGA 3WDIA 1X6LA 1PCWA 3VGFA 1ADDA 2PWVA 3TA9A 3G6LA 1V03A 3CZ8A 3KFTA 6REQA 4AWSA 3LLFA 4TQTA 4CD8A 2CWNA 2Z6JA 4ZO6A 5EFFA 2ISFA 2WOWA 1BHGA 3GW3A 1QI0A 3K8KA 3M5VA 1RK6A 3PS7A 2E68A 3AMGA 4KWVA 3VNKA 4BR1A 2J9YA 3EBVA 2AAAA 1XKJA 4E4PA 4YCPA 1LQ2A 1VQTA 1E0UA 3MP4A 5IRPA 3LCWA 4PCNA 4FB7A 1C8QA 1V3IA 2V3DA 1GYLA 5AHFA 3GDMA 1BVZA 3B05A 3DC0A 5EBKA 1LG2A 3LBCA 2J9ZA 3NXFA 1MYRA 3VCRA 1SJCA 7XIMA 3LNPA 4JX4A 2V82A 3EKLA 1Q6CA 2VWTA 3HA1A 4P8VA 4ORMA 3NS1B 2A3CA 3QSTA 4MB1A 1N7KA 3HW2A 3ICJA 3NO3A 2WPGA 3XISA 4RK8A 1ADSA 3MUAA 2PGWA 5EMMA 3SCWA 3WL0A 3NQEA 1A3HA 3CWNA 1L2UA 1XYCA 3M6DA 5T26A 1PVNA 4TX8A 1UQYA 2BY0A 2GL5A 4GUFA 4MNJA 1ENUA 5BWAA 3MANA 3A4AA 1IT8A 2XVNA 4KW2A 3L4TA 3CLWA 1LCOA 2PBOA 2PTZA 3IAQA 2BY1A 3TX9A 4WY0B 3W6MA 3FHAA 1ZNNA 3VMPA 4O15A 3N2TA 3LXBA 3POCA 1K70A 3ZWSA 3G77A 3KOXA 1V59A 3TQPA 3EOOA 1MDRA 1NDWA 1VBHA 4AYSA 5M2FX 3GXDA 4KIEA 1QU4A 3UCCA 2ZX7A 1RBOB 4JY9A 3C5QA 1C8YA 2J6XA 5DMMA 5DMLA 4B16A 1V0MA 3N19B 2WSYA 5CC6A 1QO2A 4NNCA 4DHGA 1SFJA 3REQA 1RVGA 3HQNA 4AMAA 3GXTA 2NW0A 1GZ1A 1C93A 1ALDA 1HL9A 3C2YA 3URNA 1ISYA 1QBBA 1ISXA 1ZSXA 2VFFA 3WQWA 2DDXA 4H9UA 4WOZA 1AZ1A 1ML1A 4H00A 4YN5A 2HSAA 3ZVHA 2A7RA 2J7DA 4EPEC 4I7VA 1XDJA 4PH6A 3CWHA 2YZRA 4N2YA 5IXEA 2J66A 2IXVA 2Q3OA 2F8QA 4HTYA 2C3ZA 4DJDA 4AD4A 2J7BA 3QHNA 3RG6A 3VUPA 2EG7A 4YTQA 1JFXA 1US2A 2P0IA 1UKQA 4GXPA 1DE6A 5D32A 4AIEA 3ARVA 2YA1A 3ZJ8A 1VGAA 2BOGX 1UWIA 1CB7B 1W1A1 2ZX8A 4Y9NA 2J6VA 2WNNA 2DVXA 5AC7A 6ALDA 4RZBA 3BICA 3B8VA 4J5NA 5BRQA 4XIMA 5I6SA 3C86A 5G4WA 1K8CA 1ZMCA 3UF9A 4I6KA 3VVGA 1KM6A 3SCVA 4V2XA 4L6DA 4X2RA 2OYLA 3QY7A 2GQ9A 4U28A 1FWHC 1XX1A 3QSRA 4LB3A 1QR7A 3DAQA 4P7QA 1MRAA 3TZNA 3R8RA 1DWGM 2R1PA 3LPGA 4JXCA 2GOUA 3GWQA 3LENA 2A6LA 1TQJA 1N8FA 3WK2A 2Y8UA 4GA8A 3OIXA 3TAKA 4L7ZA 1H1NA 3KVMA 3GS6A 3RLVA 4MY8A 3A4XA 5EA9A 3U2EA 3MMUA 1XLBA 4MZYA 5FKYA 2X2GA 3BV4A 1QW7A 1O94A 5AZ0A 4Q8NA 4H4PA 1E0XA 4C6BA 4G5DA 1V51A 1BFNA 4JTGA 2WKJA 3GX9A 1JR1A 2EGZA 4Z2KA 3B9AA 1JRBA 1RBAA 4XD5A 4XBSA 5AZ1A 5FF3A 1BTCA 1BYBA 1XYMA 2E09A 2PDFA 2Z6IA 1LUCB 7REQA 4LYPA 2PDJA 4H8HA 4RNJA 1EX1A 4MLJA 1ZP3A 2B4GA 3E2RA 3FXYA 4JIRA 4ZGYA 1E72M 1VDVA 1Y0EA 1FFUC 3VIHA 4AEEA 5B7ZA 1MEIA 4Y9AA 2WBKA 4QM1A 2C1GA 5G2HA 3GHTA 4O52A 3LV5A 5E0KA 5EU9A 2PDQA 3W70A 2E6AA 1AUSL 4D6FA 1QI3A 4C5ZA 3B0VC 2EO7A 1NDAA 3UZ5A 3B4UA 3L8KA 1CB2A 3IJDA 4GJJA 2X1RA 1W1PA 2Z1XA 4UCFA 3MTWA 1V6VA 3LD5A 2OODA 2WQDA 4RL3A 3HG5A 1OFEA 4HNLA 4GC4A 1UP3A 1IHIA 2O4MA 1C92A 4M52A 1E6SM 1ZGDA 4JQ3A 3AXHA 3GVVA 4IPLA 3HRDC 2YXOA 4G2DA 4XZBA 5HQLA 3OYZA 1FH7A 3RMJA 1SGJA 1XH0A 3SZ8A 2Y85A 4WDWA 2QR6A 2QV4A 3CB8A 1LWJA 3SY8A 3TLLA 2NPXA 1EDQA 5AC6A 3TYAA 1B3VA 4A21A 3V75A 2ICSA 1XD0A 2OWCA 4PTVA 3R89A 3WQFA 1KQZA 2EAWA 3L5AA 3M0LA 5C55A 4GQGA 2YA2A 4O0QA 3RUBL 1EB3A 3MA8A 3RCNA 3S8HA 3W87A 1GSNA 3BG5A 1UWUA 4RPQA 3M7WA 3CIWA 3MB9A 4IGMA 1F6KA 3LLXA 1X8FA 1W9XA 4PFHA 5CGQA 4UQ9A 1RVKA 3PG9A 3CGEA 4N9DA 5A6BD 3WSUA 2H3BA 2ZWYA 3T05A 1MSSA 4N4PA 3S2LA 4F2UA 3A47A 3LCHA 4E4FA 4A22A 1XIJA 4H4WA 2FVMA 3E0FA 3G1VA 3QM3A 4HK7A 4IP5A 3VNDA 2QZRA 2HPMA 2ZTJA 2ZUNA 1GKPA 4JTIA 1T8QA 4HZMA 2BVDA 4ZL1A 2WANA 2DP3A 1R30A 1S1RA 1VP5A 3I3EA 3N3TA 3N15A 3Q58A 1KTBA 3GKAA 5CKSA 5DO8A 1C3FA 3VO0A 2EPOA 4N02A 3IARA 4N42A 4ZZ9A 2XSBA 2QAPA 3L67A 3N2CA 4I9TA 4UFHA 3PVFA 4XG1A 2OXNA 3URHA 2UBPC 1KGWA 4YVVA 2ZZ5A 4YHEA 5FL0A 1E15A 4AU0A 1L0PA 3QF0A 1XPGA 2NQ5A 3KBWA 3C3UA 1EOMA 1A3WA 2A1YA 1Q2SA 4QBXA 3VIPA 1LDCA 2CHNA 1TE6A 3CH0A 2ASHA 2X30A 2X8HA 4HSHA 1XM3A 3IGXA 2CHOA 3NEHA 3RO8A 5D37A 4EPBC 2ACUA 3NGJA 4LUSB 4Q8PA 1A0EA 5BXPA 3CJPA 3GIPA 2EPNA 4IQLA 3OYXA 1W9VA 4OECA 2WJEA 2YXGA 2X8RA 3APGA 4JEQA 2FHFA 3ALGA 1NFGA 1J9YA 2ZC8A 4MPKA 3CT7A 3NZQA 1QCWA 1DVJA 2EJAA 3VX1A 3FJ4A 1WZLA 1B1YA 1ZALA 3GD6A 4HBKA 3CM4A 1OG0A 2ZCGA 1K6WA 2WOIA 3TZFA 1UR2A 4N6FA 4KH2A 3W38A 1GETA 2VZUA 3NQMA 1X1NA 3TONA 1L6WA 3W26A 5A2AA 5LIUX 2XGZA 2CNCA 1BRLA 2Y4SA 3CUXA 3BGAA 4C7DA 1KBLA 1GZJA 3E38A 3H4GA 1QVBA 2V63A 3R11A 1CDGA 4QG8A 1UR9A 5AC5A 1VHNA 3UETA 3GW0A 1ZK7A 1OBAA 4NI3A 4O0KA 2W79A 1A5LC 2J7HA 2VENA 4GZEA 4XVEA 3M44A 1N8WA 4Q8QA 2CFYA 2EKGA 2E25A 1H2IA 3P8JA 4GACA 3KP0A 3VOCA 1IF2A 4H19A 4KFNA 4ALDA 1RALA 4PL2A 3SQMA 1VFMA 1OK4A 3QFBA 3M0MA 3AUJA 3EWCA 1EC8A 2XGIA 4PUDA 1WUFA 4K38A 2QDEA 5KITA 3OGSA 4QTGA 4YYCA 2JKEA 1ELSA 4ML9A 3BAKA 4CCCA 3CO4A 4EACA 3D3AA 1H7WA 2FKPA 1FP8A 1NARA 1AA1B 2RH9A 3ARXA 3NPWA 4HYWA 4M8UA 3MZ2A 3PUOA 1UKPA 5C71A 4MFDA 3T2PA 3F1QA 4EQWA 3KOFA 2HE5A 2VRQA 2YSWA 4EAYA 2XIMA 3EUB3 4NRSA 3MMWA 4ZFMA 1JL8A 4NVTA 2W62A 4WY0A 2RKXA 1K4QA 2RAGA 3PNZA 1LBLA 5GJMA 1SO3A 3C2RA 2ZXAA 5G1YA 4JNYA 3LMZA 4GX9A 3LXAA 4LUTA 4I3GA 4LYRA 2PUZA 1ONRA 2RUSA 1XV8A 4HZ6A 4O4WA 3V1PA 3KW3A 2E1WA 3QQ0A 4FOKA 3ZT6A 3T55A 4ECLA 2FTWA 1VFOA 2Y24A 3NURA 3GXPA 1DEDA 3FW6A 2BXZA 1E56A 5EMJA 4Q8UA 3BQ6A 4DAIA 4NQ1A 5A3HA 1PIFA 4NY2A 2V5LA 4NZ4A 1WXJA 1NEYA 5JMUA 3UZYA 4QRNA 2OYMA 2EG8A 1NTHA 2WJFA 2NQLA 3AOFA 1U30A 1W2VA 3M0IA 4PTDA 2VMFA 2VGBA 4NI8A 3LRMA 1QUMA 3P0XA 1AMKA 1P0KA 1GYNA 1FHVA 3G3DA 4A8LA 1N60C 3LZ3A 3B03A 1QT1A 2WMJA 3AHZA 3PN8A 4HZ8A 4UBPC 1UC4A 3EOLA 1PKLA 3UGVA 2NVDA 2OLAA 4QE5A 2P50A 3WQDA 3VM7A 2VZVA 3HG4A 3U57A 5K9CA 1UWRA 1EEXA 4MAVA 1H2JA 2QUMA 2NUWA 4JTCA 1DJHA 4R34A 1EEPA 1XIFA 1TVNA 4ZO8A 4Z2HA 1REQA 2P8CA 1Z89A 3GZAA 2WCGA 4NHVA 1E9ZB 2QUVA 4XKYB 6PTDA 1VPXA 3OPSA 5HBFA 2UZ9A 5FS8A 1K6AA 1KRMA 2HK1A 3H4XA 3VC5A 3KX6A 1AZ2A 2VVSA 1R9XA 1RY8A 3OZOA 1EO7A 4MWAB 5LHEA 2GVLA 1I2NA 3JRKA 1FKXA 4TVDA 1N8IA 5C9XA 4OTKA 2CXEA 3TK7A 3DBPA 4O18A 3CV2A 4GBDA 1G94A 2J13A 5TQLA 5HJLA 5MHBA 1SMAA 2E5AA 1JF6A 3TSBA 3R94A 1MO9A 3D0CA 2HDJA 4OV9A 4FO4A 1KV8A 1K4GA 5KTLA 3U7VA 2QCHA 4KGJA 4MMWA 3DX5A 5AHNA 3VDAA 1M04A 1SMDA 4R9OA 4K39A 4XZLX 4LBUA 2JGQA 1J0KA 5CC3A 1FWNA 2HK0A 3BH4A 1TV2A 2VC6A 3UY7A 1W1VA 3AFBA 4GZIA 3ITVA 4ES4A 3QRHA 1EIXA 3WDPP 1RLDA 4IOTA 1ZS2A 2EQ8A 3S9YA 1WDPA 8A3HA 3R13A 2XIOA 3BAYA 3GFXA 2GRTA 3AS0A 3PBVA 3WH5A 4WDUA 5CPNA 1CXLA 4MNMA 3B0PA 5AYIA 1JGIA 1P6WA 1QXLA 4RCXA 5I3IA 3WNLA 2XFYA 3BLEA 4GLEA 4GOAA 5CC5A 5A6BA 1O68A 2DFAA 1XC4A 4WSHA 1UP0A 2BXYA 2FFIA 4AZHA 5DMNA 5F2LA 2Z1SA 3UR7A 2WNZA 4HHMA 4AF0A 4E5TA 3AXKA 3P6LA 4IFKB 2WOVA 5A6TC 3GDKA 1LYXA 1EF2A 2EKCA 3WFLA 4OT7A 3O0HA 3PZNA 3LB0A 1GOXA 3GD4A 1LZOA 1MO0A 2OZ0A 3WFAA 1YQ2A 5BYWA 2QYGA 1NP0A 5I2UA 1QNOA 2WKLA 3IV8A 1I8JA 1NWRA 5G5HB 2YCJA 2YGYA 2XDFA 1IV8A 3PPCA 5DXYA 4H83A 4EMWA 2P1FA 1F05A 3C2FA 1VBGA 2AKMA 1P0NA 4UOQA 1IEXA 1N55A 2DW6A 1WZMA 4UFIA 1J79A 1FFQA 2VURA 4LIIA 2XN2A 2D0HA 1D8CA 1H7PA 3R58A 2W92A 5CSUA 5A6JA 3PZVA 1A0CA 4LFYA 2I56A 1TPDA 1TWIA 5AECA 4IIFA 4UTHA 2GSJA 1A5NC 2ZXDA 3ORWA 3G8RA 5JQ9A 3HTWA 1F8WA 1NQ6A 3VNYA 3KBJA 3GD3A 3VKAA 5HJYA 1S2AA 4X9SA 4EQSA 4TVCA 3BWWA 1ISVA 5U1OA 3RX2A 3TNOA 1KFBA 3W82A 2Y7GA 3TCSA 3WLOA 4CN1A 3NZGA 4NEVA 5IHSA 2GJLA 2Z0IA 1TV4A 3ZLHA 1ME9A 8RUCA 1XINA 5HK4A 3UJRA 3TN5A 2XU2A 3S5SA 3AROA 2EPMX 4QSHA 2HNEA 1LBFA 2ZDSA 5LIWX 1VPYA 2YA0A 4KCVA 1Z44A 4O57A 3OTRA 2BNJA 2PAJA 3FOKA 2ZUWA 1EJRC 4MUZA 3PAOA 2PP3A 4N9BA 1IQ8A 4JIPA 1ZY8A 1QPKA 3GZ3A 3QPYA 3I7RA 1UA3A 1T7LA 4FX9A 5XINA 2W27A 3E5BA 3AHYA 3VFLA 4Q6JA 2G96A 5I3JA 1H60A 2GFTA 3NQ8A 4BZYA 1QNVA 4MWAE 1X7IA 2QCNA 1IZJA 1SQ7A 4HPXA 4GVFA 2OEMA 3CIXA 1UBPC 3W7IA 3IK4A 1JUKA 4JOMA 1ZTVA 2XWDA 4W7WA 3A4WA 2PDGA 2DSUA 4WVXA 2WNQA 4QGCA 1M3UA 4QJ3B 3F5LA 1K3UA 3W24A 3RPMA 1OF6A 1OX4B 3NQDA 3BCJA 2VEPA 4ERGA 5I03A 1GOKA 1R3RA 1H3GA 3P84A 3MUCA 1US3A 5E1QA 1NFBA 1XQKA 5I24A 2QT3A 4OBTA 3WELA 1D7YA 1V02A 4MJ4A 2YKKA 1M9HA 2PDIA 1DIKA 1UC5A 2NQZA 5HJXA 4PTXA 2VFHA 4W7VA 4CEUC 5M03A 4ACZA 4UMBA 3VZXA 4Y9OA 1GG1A 1KXVA 1DJZA 3OBEA 3NTYA 3W86A 4HZ7A 4MJ2A 2OO0A 1M41A 1FFRA 2XH7A 3FY1A 4MTVA 4BWLC 4KEZA 3TKFA 3L65A 4PB4A 2AQVA 2IQTA 2FPVA 4NZ5A 3WLQA 3L4WA 3E5PA 2VTFA 2BWGA 1KRAC 1P5BA 3W7MA 2QJIA 4M24A 4MSSA 2EPHA 1GVRA 2FZNA 3EB3A 1XYZA 3LRLA 2VCAA 4LOCA 1EBDA 3LHTA 5CPSA 2C3DA 1UOZA 3TDFA 2NXGA 2WCAA 1UD6A 4ZODA 4CQAA 1V93A 3SGGA 4UQAA 2XIBA 1TE1A 1DOSA 3KOYA 2GSHA 2HNHA 3UY8A 1IWPA 3NYZA 2VR5A 3ARPA 1F8IA 4MZ1A 1GRTA 4UR8A 5BMXA 4D6CA 1YNQA 3UQNA 2QAEA 2Q8ZA 1E4IA 4W93A 2FGLA 1UWSA 3MCNA 3I10A 3MUIA 5E6YA 2NZLA 1YX1A 1RJQA 2PDCA 3M5YA 1FH8A 2GVJA 4ICCX 4DZ5A 1Y8BA 3QV9A 4V33A 3WLIA 3BUVA 2G3IA 4GK8A 1VKFA 4MFEA 1J12A 4UTMA 1US0A 2ZZ6A 2ZUUA 4PN2A 1XDMA 3DK9A 1A4MA 2DH2A 3S0CA 1J4EA 2GR0A 4GBUA 2D0FA 4IPJA 3AS1A 5FESA 3G1FA 2ABBA 4LF1A 2V3FA 4J3ZA 2ZZCA 5E0CA 4L5ZA 4N0RA 1LROA 2R9RA 2BHZA 4WHBA 3CYJA 4S38A 1BQCA 2VR2A 2FFCA 1A47A 2FHCA 3W2JA 5C2GA 3NM1A 3E0WA 3RU8X 2HQAA 4DO4A 1Z9AA 2RDWA 1O7AA 2BFGA 3NAVA 3U9IA 1EQCA 5B7YA 2EBNA 1BAGA 2W67A 2J7EA 4G7FA 1BEUA 4RUBA 3UWYA 3H70A 1BWCA 1V7YA 1R47A 4V15A 4IMGA 1A50A 1SPQA 4NF7A 3RCMA 5A6SA 4FSAA 2F2KA 1CLXA 1FWWA 4YL2A 1V0KA 3AZSA 4GG9A 5AHLA 1G4EA 1RJRA 4OBSA 1TJRA 2GR3A 2VVNA 2NUXA 4XIAA 4C1NA 1DYSA 1CCWB 2BB0A 4HTBA 3SQSA 3FN9A 3FSTA 4NXSA 1C8XA 2HROA 4Y8EA 3V16A 1B3XA 1X96A 2GR2A 2ALRA 2C8NA 1E1FA 3F5KA 3V5FA 3EWUA 4PCPA 4JTUA 4LS0A 2JALA 4EPDC 1V6TA 1SSGA 4IMDA 4IUOA 4LVGA 5A6AA 1E6ZA 4XKYA 3C52A 1XW8A 3W00A 2JKPA 3EKGA 1FBAA 4OWGA 1ODUA 1PZ0A 4O54A 4LUJA 1KKRA 1RD6A 4WLCA 4XAZA 3TW7A 1ZENA 4KMQA 1BQGA 1MXSA 4B4HA 4GNKB 1L6SA 1ICSA 1OF8A 1BG9A 4S2CA 3L9CA 2GK1A 1YE4A 4JD4A 2A3AA 1K8XA 1OZMA 1QI4A 4O50A 1HZYA 3LX9A 4XVDA 2E6YA 4GQQA 1U5VA 4QJ5B 1VF8A 5JUVA 1GEHA 2PWUA 1K4HA 2C19A 1O95A 4GUHA 2GJXB 5LNSA 3H2CA 1IT0A 3R7MA 1P1XA 4PA8A 3KXQA 3SR7A 4DF1A 3TQVA 3PG8A 1VYRA 4H2HA 4HNOA 3MKCA 2VGIA 4HK6A 5JXQA 3CUJA 4H8VA 1KCKA 1GVEA 3SUTA 4KEUA 4A3HA 2TRSA 2WC4A 3AYVA 3B9JB 2CFFA 3AI0A 3VOHA 4KESA 4U2ZA 3SBFA 2FDSA 1VLWA 3W1UA 2G3NA 4PFMA 1EWEA 1SB3B 1FX6A 2YCIX 3ATZA 3E02A 3WJSA 3TN3A 2O9TA 2BODX 1XIBA 4C6EA 1GXFA 1YTEA 4AY7A 1I1XA 3NIYA 4B5WA 3PPGA 3OODA 4X2PA 3MV11 5XIAA 4LAMA 4NUWA 2OB3A 4H9VA 1YHTA 2QAFA 3OLGA 4HA0A 3S47A 4KWUA 2DUZA 3PZUA 2WV8A 2EHHA 3BE7A 1E55A 2EQ7A 1EXBA 3W81A 1E6XM 5AVNA 3WDJA 3L2MA 3VIOA 1S2TA 3DFPA 1OT2A 1WBJA 2V5CA 3APYA 3IJQA 4F4RA 1GVSA 4AZBA 3MO4A 3DGHA 2J62A 2DZTA 2OU4A 3PF3A 2FJUB 2XVKA 2BGQA 1KLZA 4JQ2A 3W7RA 4ACYA 4UR7A 1WP6A 1QASA 2NVKX 1RR2A 3QZ6A 2VP8A 2BP1A 3FIGA 1NHPA 1H6VA 1SJBA 3LQGA 3IUHA 4NX5A 4HA3A 3OLIA 4NJHA 3BW3A 1KCZA 3A3HA 4BFAA 2V81A 4NYUA 4BWLA 3F4DA 4I9MA 1TV8A 1T96A 2I57A 4PRTA 1RCXB 2VEMA 4KWWA 2XYLA 1TPUA 4NNBA 1XBZA 1TREA 4O28A 3I4KA 1H4PA 4TR9A 1ZX9A 4PCTA 2OQHA 1KGXA 3QMSA 4CN4A 2P10A 2ZTKA 1E1EA 1D3CA 5CZSA 5EYWA 4XD3A 3A3XA 1KWKA 1JXJA 1JYNA 1B2YA 2R8WA 5C70A 1VCVA 1Q8JA 1VAHA 4G56A 3EWYA 4B5NA 4XV0A 4DWDA 2GH5A 1XIIA 3AIWA 1JZ5A 1A49A 1CPUA 5CJ5A 1B57A 1W5NA 2C1HA 3NPXA 4MJMA 2QJGA 4WOQA 1BXBA 1ISWA 1FWFC 4IL2A 1UP2A 1ONEA 2EXOA 1XH2A 1JROA 3N73A 4Q32A 2IUZA 1T5AA 3ARQA 3RX4A 1LL6A 1AH4A 3BMXA 3MI6A 4OOZA 5HMSA 2YJQA 3K4WA 4H4ZA 4H4XA 4KCTA 4RPPA 4S3CA 1JD7A 3AHXA 3QOKA 2YR1A 5FF4A 5GRTA 5M3WA 4F0MA 4BI5A 2VX6A 4GJ1A 2PLJA 4LNYA 1XRSA 2PTYA 3TYEA 1VENA 4K1GA 2VFGA 5SWUA 2OWXA 4US5A 3OVRA 2ZZBA 3EDDA 4MHBA 4Y6GA 2DGAA 1BXCA 3EMQA 4U10A 3S2MA 3TYUA 4O1DA 3VZZA 4QFUA 1FVPA 3TFCA 3RO6A 1P4CA 3QYQA 4ONVA 2HXUA 5DRIA 3OOQA 1SFSA 1ESWA 1W56A 4XAFA 3WMBA 4F0SA 3WD2A 3I68A 3NO5A 5CZKA 1V0NA 4JTHA 3R43A 3MP5A 1DE5A 3W2KA 2C6QA 1EOKA 3D47A 2FZDA 4AXKA 4PEKA 1DIDA 1TTQA 3TQ0A 3UWVA 4MJZA 4MKVA 3CUGA 5FJJA 4A35A 3FFSA 1KRBC 1CNVA 4K8DA 1DIOA 3AXMA 3W2LA 3U4AA 2R1MA 3KP1A 1F3EA 5I7GA 5ABTA 2GPTA 1XUUA 3GBDA 1Y5XA 4FNTA 1MW1A 2J75A 2GOKA 5HULA 3SSJA 4AX7A 4AXNA 3FEMA 5DEZA 4R88A 3M0HA 3E0LA 4FF5A 5C2XA 2H8XA 2ZICA 3QJAA 4MOZA 3SDOA 4RLIA 1WBHA 1B4EA 1TPVA 3CHEA 5D8WA 1A3XA 2G3JA 3ARTA 2WZMA 9CGTA 1MUWA 4FR6A 2CBIA 3BDKA 1IXOA 3NQVA 1J0JA 5FJIA 3UR5A 3K2GA 4PTNA 3DH9A 2PFHA 4NJIA 1MVYA 4DB7A 2WVUA 3NL5A 3M0ZA 2A79A 5I07A 1CGYA 3W3OA 1HKMA 2AAMA 1RCOB 3TWAA 3GH5A 1W1B1 2G50A 4FXRA 1LORA 2Q01A 3LHYA 1KR0A 3H26A 3IK2A 4M51A 1AH0A 1DJNA 4H9ZA 4D71A 1XH1A 3VX0A 2YFNA 3BGGA 4IP4A 3G0SA 3O8AA 4AH7A 3SEPA 1P7TA 1SW0A 4URIA 4CD5A 3DFTA 1XCFA 1KNWA 5F4SA 4FHAA 3S5YA 3T09A 1I2RA 1J01A 2HS6A 3VOIA 4TVUA 4TMBA 3A7UA 2RHGA 3CGBA 4NEWA 1PCKA 3MHGA 1JDCA 5JU6A 1RPKA 3WH9A 4R85A 4IICA 3MZNA 3WLKX 4XD6A 3R25A 1YKWA 1LPFA 4RX0A 5T91A 3RCYA 1N2VA 1R38A 1TX2A 3S5ZA 5CPTA 3DG3A 4AB4A 3R8HA 1E6RA 4GIEA 4F48A 3NO1A 4WIWA 3OEXA 1JF5A 3GNOA 4UMAA 5I23A 1PKNA 4WJXA 3EMZA 1KTCA 2R1LA 2CZFA 4MDOA 3TWBA 3R79A 2OLSA 3NPVA 2Q09A 2ZA3A 3ZJKA 2ZWZA 2EG6A 5D04C 1V3LA 1W3KA 3W6YA 2XIIA 1D7FA 4LTSA 5HQMA 4E2VA 2FTYA 2CWXA 3DC8A 4TX9A 2F61A 3O1NA 3N29A 1U83A 5DCBA 3TMLA 3WQOA 3E49A 5E09A 3KLLA 4HB7A 2ZRWA 2WWDA 4UQDA 1TJPA 4JGDA 5CZJA 4P8WA 1ONWA 2AKZA 4JTEA 4WF7A 1WPCA 1WXZA 5DN1A 4LQ1A 2DZPA 4J3WA 4NNAA 4B5VA 3EYPA 2E7FA 1NOUA 5FF2A 1UYQA 5A95A 1O66A 3NQ6A 4FIQA 2LLEA 4RE3A 1ZCCA 5E93A 2DIEA 1XLKA 3GHUA 3WQEA 2Z25A 2E28A 3N17A 3EWZA 2G97A 3R6IA 3QY8A 5D33A 4LT9A 4B5SA 4GVGA 4DWSB 5FEXA 1BTMA 4D6GA 3E1F1 4QHRA 3BSGA 2WMGA 4M6VA 4H9XA 2GUYA 3W7JA 3VK5A 5HA7A 3W4RA 4O1BA 5DCEA 1QWGA 5FAJA 2VWSA 3WO8A 4BKNA 3MUY1 3V0TA 2D73A 3EGJA 2FHBA 2FH6A 4MB4A 2GJXA 3LHZA 3SIMA 2FH8A 4Z0JA 1DWHM 4J35A 4F79A 1M7OA 4R7WA 4JDBA 2PLKA 3LHVA 3NSNA 5KZ6A 1VRDA 4KIRA 4UXDA 3KS6A 1F3XA 3LGGA 4JCMA 4Q7BA 1YIXA 1GERA 1TYPA 3SCNA 3BVJA 4B2DD 5CXPA 3W07A 3B8DA 4DWSD 4FR1A 3WLJA 4FLOA 2YCKX 3W83A 2GR1A 4YNGA 1E0TA 2PCQA 2WCSA 3UNDA 1HXJA 4EF8A 4MF4A 2JIEA 2WMKA 2PD9A 3W75A 1G1YA 1C90A 3VILA 4AUBA 4FIRA 4FX7A 2IQ0A 3WQ6A 3IJ8A 3ZR6A 5LA1A 3W2UA 2JK2A 2DH3A 2V68A 3DEQA 4Q8TA 3S2CA 1G6CA 1OVDA 4QITA 5KVHA 3LB8A 2GVGA 1O5RA 2E6DA 1XP3A 4Y2WA 1H7RA 5K9DA 1XF0A 3FJNA 4FNSA 5LNRA 2CLMA 4V27A 1J10A 4XUYA 4L4LA 2E77A 4MIMA 3IIPA 4LBSA 1R3YA 3VMOA 2OT0A 2CBJA 4U3AA 2TPRA 3BC9A 1W37A 3OLDA 1Q6FA 5BRBA 3CV7A 3EPNA 3PUDA 4YWSA 4DPQA 4E38A 3SUSA 2REQB 3G1DA 2IXUA 5I78A 4R3UA 4L80A 4I5XA 4AZCB 3IJ7A 3IJIA 4QJ1A 3VI2A 4FEZA 3WDHA 2GQ8A 3GVWA 3KOWA 2UY2A 4ZTYA 1X6UA 2A21A 1UZ1A 2QDGA 2OZ8A 2HEJA 3CC1A 3W25A 3F4WA 3WQPA 4D72A 5BROA 1PPIA 1VFUA 3ANUA 3KS5A 1WZAA 3CAQA 3BCDA 1TZ7A 3A23A 3CAVA 4OE7A 3PULA 1R46A 4H50A 4G7EB 2P88A 4DWSC 4PEEA 2J77A 3HPFA 1QRQA 2YIHA 4ILSA 4IH3A 4G9PA 2Q71A 5DCDA 3WLLA 1OC6A 3UJSA 4DAFA 1UD5A 3PNUA 4CQCA 2VC9A 5HWNA 4OU1A 4E8GA 1GCYA 4G1NA 2VDHA 3SCPA 1E5NA 3H6OA 3BARA 2D69A 3H2NA 3GXMA 1DHKA 2BZNA 4F8XA 3FK4A 4AVOA 1GTEA 3VYLA 4YLWA 1XANA 4QG6A 2YPIA 3SQPA 1KCLA 4DLFA 2VEFA 1AJ2A 2GJPA 3W9ZA 3CK5A 1QMLA 5K2ZA 4IUGA 3LERA 3OQ8A 4LC8A 1W1IE 1B9BA 1OHLA 3OVQA 2IKJA 4LV9A 3B9OA 1GYMA 3JVAA 4EXQA 3ZR4A 3PY2A 4GHRA 4P5UA 3S6OA 1Q6LA 1JDDA 2QCDB 2WOQA 4RDVA 4K7VA 5E5CA 4CN6A 4GMEA 3VZYA 2WVSA 3FHQA 1NH6A 2ZRUA 4WUIA 4M7TA 1XIDA 3B0YA 1DJXA 3NVTA 4IIHA 4QQUA 4QXIA 3LS9A 4QP0A 3EWBX 1W9BM 3HIJA 1UR8A 2QLYA 3ABXA 2G0WA 2QMKA 1D3HA 2YFOA 1AH3A 4BCEA 2KAUC 3JS3A 1F8MA 4LEFA 2Y8VA 1XIEA 1XPYA 1QW9A 1EQPA 1FTXA 3O05A 2UY5A 3IWPA 3VOGA 5JCNA 4J27A 4AD3A 4LAKA 2VT0A 3NOYA 3W7OA 1JAEA 4KPLA 1V3HA 2IW0A 4H04A 1K8YA 4HYVA 2J9XA 2CKSA 3PG6A 4GR1A 3WNKA 3G2GA 1Z48A 1GRGA 5DLCA 2XFRA 3AAMA 3XIMA 3TXVA 1UJQA 2Y5EA 4HU4A 1I0BA 3AXIA 3H2OA 1OD8A 3TSDA 1EPVA 1HKWA 3SUWA 2GUUA 1E0VA 1TQXA 2RABA 3UG3A 4JDYA 2X1UA 4IMCA 1E40A 3E2SA 5HPCA 3UVIA 2CESA 3UGRA 1YNPA 4Q4PA 1KFLA 3SCUA 3P81A 3IVSA 3PUEA 1GTHA 1AQFA 3N1AA 1Z6KA 1V6WA 4WD0A 1XL9A 4QCFA 4JYFA 5D02A 1XSIA 3PAJA 3THCA 2C0AA 1GQLA 5MKGA 1NSJA 2FB3A 1ZBWA 2VOTA 1UQZA 1EF3A 3LHWA 3A3WA 3QFWA 3FSUA 2VUNA 5HOSA 3O9NA 4LANA 3B06A 4KEVA 3CYVA 3O6DA 1W1YA 4PTWA 2V2HA 4HN4A 2YW3A 1JDAA 4UZUA 1P6BA 5K4XA 2I9EA 3OW1A 4HMNA 3W85A 3ATYA 3SECA 3CNYA 3GC5A 3STGA 2BLEA 3QQ1A 1SFTA 1SZFA 1A53A 1NHSA 1PS9A 2PP1A 2XVGA 3UZXA 3DK8A 2VX5A 2X1IA 4GE8A 2J4GA 1BVNP 3I6EA 4C6KA 3UU0A 1GG0A 3LM3A 2V8ZA 2V5DA 3KL0A 5DANA 3UXDA 5GNYA 1B30A 2Y6ZA 3WMLA 4UNLA 4M1BA 4I9JA 1HL2A 1O60A 3M5XA 3VXGA 5CEWA 5JIWA 1K9DA 3NQGA 3HV9A 1OK6A 4CD6A 1HJVA 2DT0A 4Q4MA 3WJYA 1QNQA 3W01A 1Z8AA 3WZ0E 4DO7A 2DQWA 3VNLA 5BNKA 2YW4A 3CXBA 1UUQA 1V6XA 4JIHA 4E2OA 2VHLA 3DI0A 1W17A 3GAYA 3N11A 3SJNA 2QQ6A 4ZXLA 1GVOA 1GJUA 1TMQA 4D8AA 2IPGA 1WDDA 3E2VA 5DY3A 4P8UA 3C6CA 1QBAA 2IPFA 1MFUA 4JY8A 2YB1A 1PUDA 1L8NA 2BBFA 3WF0A 4L6HA 1FECA 6A3HA 3WFZA 3QN3A 1JQXA 2ZZ3A 5DY2A 1XLJA 1A0DA 1EC7A 2NUYA 3UESA 3AZTA 3REQB 1XQLA 3GNXA 6TAAA 2VDIA 3T08A 3TTYA 2EQ6A 1G9HA 1XLHA 5L6UA 1W3LA 1MI3A 3NM3A 2XFWA 2Z24A 3IIZA 4J3SA 5CSSA 2V0TA 5D03A 3N2XA 3ARSA 3O15A 5LNWA 4IIDA 2QVHA 1EJSC 3CL8A 2X0HA 1TELA 4GKTA 2CLIA 4Z1DA 1FWSA 1V0LA 3LI0A 3N6JA 4C6DA 3A21A 4XK2A 4KETA 3L5LA 1QO5A 1XFCA 2AQWA 4GZJA 2GGIA 5FOOA 4NU7A 1KM3A 4QDWA 3IV3A 3NQ2A 3FJLA 2F6XA 5HNTA 4I5UA 4MAZA 1VBUA 3O16A 3S1XA 4XBJA 1QTWA 1VD6A 1VFSA 3NA8A 4CNPA 3QKEA 4B2DA 1TWSA 5AYYA 3TSMA 3TOPA 4NRRA 4DWSA 3BZGA 4I7WA 3VD7A 3UERA 3KUMA 3M47A 1FEAA 1VFLA 1U1UA 4GPNA 4BY3A 3A7RA 5HNRA 2VM8A 4BI6A 2YBVA 1MQRA 5GJPA 3GK0A 4K2SA 1OC7A 1KB3A 3WG6A 5LXXA 2V3EA 2DT1A 3LCIA 3C2OA 2WW5A 3V4BA 3HQOA 4DPPA 4L4PA 4ZE5A 3IGHX 1J96A 1GVFA 4NJGA 2CKRA 5CPOA 4H9TA 1OD0A 4R53A 4G8TA 1POJA 3N9RA 1XSJA 4S3FA 3PBGA 1LF1A 4RNHA 1UR1A 1SZNA 4JBRA 3USBA 3WNMA 4B92A 3KZPA 3NQAA 2BVTA 1LBMA 1YNYA 3NZRA 3QHMA 3ITTA 2QJJA 1QDSA 3DHDA 3CUFA 2Z26A 1MZHA 3D3FA 4XAYA 3VM5A 1Z69A 5M5DA 4US6A 5EMYA 2QMJA 4K8GA 2BOEX 1AOGA 3S1WA 1AD4A 1JIBA 3O6YX 3E0IA 1G69A 4JS3A 3AIRA 3AMCA 7REQB 4UZSA 3BLKA 1R3VA 1TUXA 3PTKA 3H4KA 1IR1A 4HA4A 2EEXA 1J18A 2W3SA 4IZGA 3NL3A 3VD9A 4B90A 3RR4A 2YLLA 3GLCA 5H91A 3CIVA 1M7XA 1UZDA 4ADTA 4RZ4A 3VKJA 3GBEA 1GJWA 3MS8A 4IGHA 1R6WA 1ONXA 4G6CA 4LH8A 4WSJA 3C2VA 3EAOA 2PRHA 3H2FA 1GORA 2EQ9A 1WKYA 4H2CA 1UASA 2AMGA 1H1ZA 4YJ5A 3CMFA 5A1AA 4H4YA 4JKMA 3T1GA 3VIFA 5D2WA 3QGAC 5I0DA 4UTWA 4G1KA 2REQA 3VAVA 1OIMA 3PZ9A 4ZQCA 1I0DA 1X2GA 1J6PA 4IIBA 3VE7A 1FWEC 3V5CA 1E43A 1PZ1A 3SCTA 3VKBA 4CQ8A 1TRIA 3EDKA 2WP6A 3TFXA 2BGNE 1MEWA 2WWCA 1EDTA 1J5TA 1RV8A 3VNIA 4ZMGA 1TPWA 1PZ3A 2F7FA 3RU6A 1BVWA 1WA3A 5CBIA 3WNPA 1UR3M 4UMCA 3B8IA 2G3FA 4BQ3A 4DZHA 1V77A 2ATSA 4R7JA 5C0QA 1BKSA 4BF9A 1R5YA 3S9ZA 1BSIA 1DWJM 1XYLA 2XH4A 1XFBA 5F4XA 3ZLFA 3A12A 4XZHA 5ABEA 2O7QA 2OO6A 1FWBC 4Z1CA 5EGRA 4Y7EA 3DGZA 4AX6A 8CGTA 1WYIA 3EB4A 1S5NA 2F84A 4PODA 4CCEA 4LAZA 4S3KA 2ISVA 4BF7A 4RR4A 4DI9A 2WAGA 2J8TA 2XN1A 4GH1A 3N13A 4HQVA 3VDBA 1AQMA 2W66A 1OYAA 4QEEA 1W2PA 4M0XA 2INZA 3AYSA 4JL2A 3NOEA 4R7OA 4D6IA 1ZXIC 2A8XA 2CLLA 4JQ4A 1BGGA 3WUGA 1OCQA 4E0CA 2ZBTA 4AZIA 3CAWA 3L4VA 2QCDA 3FYYA 4L4MA 3WBYA 1SFLA 3BW4A 1DJYA 3U48A 1AW1A 3M0YA 1QPQA 2UV8G 1UUOA 1FWRA 1FWIC 1R7AA 2RFGA 4KRTA 3VD5A 2GQ3A 2INEA 1ISZA 4C5YA 4GC3A 3OGVA 5ENLA 3STEA 2BVYA 1PAMA 1H7NA 3COTA 4Z08A 2PDKA 4W84A 3WQCA 2ZA1A 1H1YA 3SURA 2WM1A 2YYTA 3VIGA 1FCBA 1LTDA 1UHVA 1KXHA 4AMCA 1NHQA 3TC7A 1SW3A 4WGXA 4UFKA 1W54A 4H6KA 2QF7A 1EWDA 1XD1A 3C0SA 1LQ0A 2G41A 1DORA 3JW7A 1ZUAX 1W9DM 2A0NA 2ZE0A 3LADA 1CT5A 3N4FA 3IUDA 2X50A 3W29A 1B3OA 4S23A 3B8SA 1RBLA 1GQIA 1PE1A 2WC7A 3LLDA 3AISA 5AHMA 1R87A 3QGVA 1EJWC 1B5TA 1YPFA 2YYUA 2A2IA 3OA3A 1ZFJA 1HTIA 1VFTA 1HKKA 5DBTA 3OZMA 4ZTXA 1K77A 3KDOA 1JCNA 1NDVA 2NLYA 3WH7A 3URQA 2CEQA 2TODA 1J5SA 3N4EA 1BRLB 3CMGA 2I14A 3F2DA 3TV8A 3IRDA 3DFNA 4EQXA 2G8ZA 1OJTA 3CXOA 1UOKA 4OGZA 1OCNA 1SM9A 2A3HA 3ELFA 3F2BA 4UFJA 3HPAA 1HT6A 3ZM8A 4LY4A 4JQ9A 5A6LA 4GY0A 4H6EA 4ML4A 3KWXA 4UQEA 4A8RA 3F4CA 4AWTA 4XZWA 2VFIA 5D9PA 1E9LA 1I2OA 2VKZG 3GKFA 1WKEA 3UP8A 2PURA 3U7BA 3AU6A 3IVTA 4LNCA 3SY5A 3G5EA 3UPWA 1VS1A 4Q4RA 3F4NA 5CG7A 1Q85A 3UZZA 4PMNA 4KEMA 4DIAA 3QMRA 1BG4A 1XBYA 4LEQA 2VCCA 1MXGA 1WDQA 3JZUA 4F0HA 1H7XA 2AMXA 2F5ZA 2X40A 3NNTA 4IP7A 2WZTA 3PSWA 3EA1A 3ZQ9A 3HGRA 3RPTA 1I2QA 2WP5A 3CO8A 3WBEA 4ZBCA 3ZT7A 1IZKA 4J40A 1X1ZA 5JCIA 2HBXA 3RM8A 4EXAA 4LVDA 4D1IA 4UIOA 2Y7EA 1XG4A 4O11A 3FVDA 4LUTB 4V1YA 2FLIA 1S2VA 2PTDA 3VGBA 4MZ8A 3VA8A 1HKVA 1KTNA 1YXCA 2PLMA 2W61A 1XRFA 4ZENA 5LKYA 3UCQA 4W85A 4GUGA 3WL1A 1D7KA 2HZGA 3G22A 1E4MM 3VABA 2FMNA 3RM9A 1MQQA 3KCOA 1RH9A 3DJJA 1P48A 3RYSA 2NX9A 3HJEA 2Q8LA 1MW0A 5AVHA 1JYXA 5KVIA 4AWEA 2X2YA 1RA5A 5REQA 2J8FA 1KO0A 2E3ZA 4W87A 5IDZA 4NJKA 4BEUA 1AL8A 2XHYA 4CVWA 3VCNA 2Z2AA 3U8GA 1KBJA 2A5HA 3FGCB 1ZP4A 2R91A 1KRCC 4HNNA 4XISA 1MW3A 3N6HA 1ZJBA 3GC2A 4GUIA 5FJTA 2F2HA 3T6CA 2JEPA 4IM4A 1V6UA 4NG3A 2YL6A 4HNCA 1CGTA 1QK2A 3BJSA 1UKTA 1KM0A 4CVUA 4QDPA 4F66A 2QVNA 3U2OA 3SB0A 2GYIA 3SQLA 5AN7A 4DN1A 2ZDRA 1E6NA 3BJFA 3UWEA 4QSFA 1NPXA 4H8NA 3CUIA 4CNOA 4LB4A 3WK0A 1REQB 1ZJIA 3NG3A 2G3MA 4DUWA 4LCSA 3WF2A 1CW2A 2V3BA 3NDYA 5CLWA 1S3TC 3G0UA 2JE8A 2G95A 1PYFA 1E6PA 3MJMA 5JIPA 1SSDA 1JZ3A 4YWOA 1CXFA 2I5QA 3SRDA 3URBA 4AVFA 2E5BA 5A8GA 3DJGX 4JHZA 1HNYA 3GC4A 3WQGA 3MVIA 1EL3A 1JOAA 1M01A 4DI8A 3M5ZA 4CQ9A 5HXMA 3AJXA 2W0UA 3HQ1A 5E0FA 1V6YA 2YXXA 1Q63A 4PSRA 2OKTA 1R3TA 5KEZA 2ISSA 4LA1A 4AZ5A 1GRBA 2I9UA 4C6OA 1YDOA 4KT2A 1M5WA 1O1ZA 4YWIA 1XGDA 1LRNA 1NOWA 3BV7A 3GR8A 1ECEA 2FZ9A 3LBOA 1V3MA 3FVMA 4O12A 3RHGA 3DYMA 1F7BA 4RV3A 2XPKA 5T8GA 3RR1A 2HS8A 3NZ1A 4AYGA 2Q02A 3W7LA 5BCAA 1TPFA 1XI3A 1L9WA 2AGKA 4FS9A 4DNMA 3NYDA 5A8QA 2YL8A 3R12A 2L5HA 4BS0A 3L12A 1N5WC 3LGEA 3N14A 3VCCA 4XZNX 2OX1A 2A7PA 4X63A 1RHCA 2Y70A 5JBDA 3CLMA 3BQ5A 4QG9A 2PRLA 3NR0A 3A64A 4FK9A 3QC3A 3TJXA 1K7EA 2V6OA 4ROQA 3KRBA 1CBGA 3VNZA 4KBXA 1SR9A 3TMQA 1JPIA 1DHPA 4PUKA 4EWND 4L1XA 4XO6A 1Q65A 2OR2A 2O56A 3OVPA 1IWAA 1KM5A 2NXHA 5GNZA 4AF0B 1UG6A 3KTCA 1RK5A 1QHOA 3EXRA 3VIKA 3RMEA 3GIQA 3TXZA 2A7NA 4DJED 1V3KA 3EDEA 1V97A 2WLYA 4HCDA 1NAL1 1EC9A 1OC5A 5LYRA 4ADWA 2OGYA 2FTPA 4HNTA 1I1WA 2Y89A 4LY8A 4F2TA 3EEGA 4RDWA 2HRWA 3GDTA 3HG3A 4N9CA 2J7CA 2UY3A 4BQ2A 5IFTA 1MUMA 3GRIA 3GIYA 4UB9A 3F7JA 2JKAA 5CPQA 1WOAA 1LT8A 2QKFA 3B8TA 4C6IA 4QDMA 2BY2A 1F9CA 1D3GA 1IGWA 3OHMB 2WSRA 1O5XA 4NILA 2BG5A 3UPBA 3V0SA 4UTUA 3A7AA 9RUBA 4K6AA 3MKVA 3FEQA 4C6NA 4HCHA 3KBNA 1H5YA 1DPMA 1ZJHA 4HIBA 4YTUA 2C14A 3G1RA 2VOMA 3MVTA 4J3TA 1WO2A 1I2PA 3BANA 3PZQA 3PANA 2D24A 2DVUA 2Y2WA 1RD5A 4XTDA 1FO4A 5JCLA 3H2EA 2DJLA 1A5AA 1FHDA 3CB3A 4NAEA 1TV5A 4JTDA 3V3WA 1F5ZA 1J8VA 3KM8A 5HMFA 1PWMA 1FIQB 1JG9A 1XR2A 1MNSA 3W7EA 2DVTA 4TUFA 2GGHA 4AEOA 2VQTA 5I5RA 1HUVA 5AHEA 2PDNA 4W5UA 4GO9A 4EWJA 4F3HA 3BLLA 5EFDA 2D3NA 4DJEC 4WEVX 2PDLA 4XX6A 3Q65A 4FXFA 2QPSA 3DBNA 2HVMA 2YDSA 3GFZA 3HM7A 4HHLA 4PE8A 2QEZA 1IXPA 1EO5A 1M53A 3N18A 4JFUA 1STZA 1LLZA 3M0JA 1OYBA 2HPIA 1A5OC 3UVAA 3IUIA 3UD6A 4PGLA 4XKMA 1SVDA 3MQTA 3KVKA 3H12A 4IT1A 3RF9A 3GQYA 3R07C 3ECQA 2FPTA 4HJWA 1DL3A 3VDCA 4CU8A 3HPZA 4KERA 1XDIA 3RNDA 2Z1VA 1XLFA 2YDRA 3UW6A 3DHUA 2WVVA 5D2XA 5U7SA 3BLIA 4Z1YA 4RDZA 1Z7AA 4DY1A 2ON3A 3CUHA 3C8NA 1AFSA 1XXXA 5J5DA 3CZLA 4F40A 4HSOA 1UD2A 2W63A 5FJRA 2GDUA 3W28A 4ACZB 4DRSA 3CQHA 3WK3A 3C56A 3GG7A 5LA0A 1CGUA 1W0MA 3K30A 3ISIX 1EZ2A 4YVPA 3CGDA 4GY1A 2J7FA 4GYPA 4JYEA 4QAIA 5G1MA 3SN1A 4I9AA 4S3AA 2VFDA 2TSYA 1C9DA 1TWZA 2GJNA 4DM2A 5A8NA 4DUOA 2SFPA 3BAWA 4B3LA 5AY7A 3MMTA 4H7ZA 3KHJA 1M65A 4LPCA 4HU8A 3GXFA 2PWHA 3LV6A 4MY1A 3URAA 4XBKA 1KFJA 3UWQA 4EQRA 3NVVB 3ZSTA 4KFOA 1ZL1A 1DJGA 3A6OA 5KMYA 3BCFA 3OLEA 5K3VA 2G37A 4A05A 2R1NA 4HA1A 3C0LA 3T9PA 4XSLA 3WLNA 1OQFA 3RGTA 5HATA 1T8XA 3NVZB 4YS1A 3PR2A 2QDDA 1QOXA 3TW9A 3BJTA 1LT7A 1SO5A 2DZBA 4RW3A 4R5EA 3MW7A 1H62A 4A2SA 1M1BA 3CL7A 5FD0A 3NRZB 4NT0A 1DP0A 2FB2A 3LBMA 5M17A 2J27A 4HVXA 2VJXA 5G5IA 1RQBA 2AL2A 1G7VA 1W3HA 2YBTA 4TOQA 2O55A 3S5NA 1JCYA 3N6QA 2HJPA 3UYCA 3AN1A 1AMYA 3U2CA 3KAOA 4GX8A 1H5VA 2VUYA 4J3UA 2HVNA 3DKLA 1VIWA 3TU9A 1OWQA 3L7RA 2DSZA 3H23A 4DYEA 5HMDA 4HU0A 4Q4KA 3LK6A 1SUXA 2D2GA 5IOBA 2CLOA 4ZR8A 3TUUA 4ZCWA 2XGBA 4J2PA 1W8SA 1X38A 3NEVA 3ABZA 3E6EA 3P2VA 3O63A 2AQOA 3A9IA 2BC0A 4WZHA 1T99A 4J7RA 3W1XA 3VKKA 4W8BA 4DM1A 1VFHA 1XIHA 3GE7A 4PBFA 1A5CA 2WPFA 3FGCA 4C7GA 3S3GA 1GW1A 3HGOA 3ZO9A 2DORA 2ODOA 3KTSA 1IEQA 4JZ5A 5HPOA 2ZRVA 3AMZA 2NVAA 3SR6B 4UTFA 1CIUA 3BOLA 4K8HA 1EYWA 3ZXWA 2Z2UA 3HPSA 5H1WA 3N04A 2YDAA 2GDQA 5A6MA 4XSMA 4C1NB 4LALA 3MSRA 3VD3A 4DUXA 5XIMA 5JRBA 2H9AA 1V7AA 2VX7A 3BG9A 1W3TA 5FS6A 6ENLA 4UTTC 1UWTA 3CV6A 3ABRA 2NLIA 1H51A 2EPLX 3E9AA 4NSBA 4AHQA 2DSWA 4WJ8A 4HMCA 3CBWA 1TYTA 3GVGA 4BI7A 3T0DA 4DYKA 2WLZA 4FPSA 1R7OA 1JULA 3LNMA 4B5TA 1Y5WA 1E4NA 3UR2A 2V30A 5DT5A 2QULA 2PDXA 4C6CA 2V69A 1OX5A 3ZZ1A 1S5WA 3FA3A 4ZOAA 2GK1B 3B9NA 5I3DA 1ICPA 4QS6A 2GVYA 3RXZA 1J2WA 1W5QA 4L9YA 4CEXC 3GNDA 3L4YA 4LRTA 1V02E 2WZIA 3CZKA 4BF5A 3MWAA 2CCRA 4ZQOA 2CPUA 1KV5A 2OG9A 1HO1A 2OYKA 4RXGA 3M43A 3EB2A 3G1AA 4LV4A 3BLPX 2VI0A 3LA4A 1N82A 2PD5A 1VYSX 3L5MA 1OEPA 1W3JA 4D1JA 4O4VA 1NJJA 3EEZA 3UXLA 1UD3A 5ABFB 1EXPA 3MMDA 3P67A 2FVKA 4M19A 3U5YA 5HNUA 4DJEA 3TW6A 2OPJA 3PC0A 2V67A 3L21A 1DNCA 4YIWA 2MUCA 4CNSA 1JI2A 4IJBA 4A29A 4TVWA 2ZQ0A 4POCA 1F73A 1WQ5A 2DEPA 3AZRA 2X09A 4LF2A 2HISA 3D46A 3ME3A 1UUMA 3KRSA 3CHVA 3PFMA 1EZWA 3GG1A 1CEOA 4FAMA 1CGVA 3M0KA 1GWJA 1TR9A 3S83A 1YXYA 4QR6A 2DZXA 1Q45A 2RDXA 3MUXA 3S46A 1BKHA 2PWGA 4UQCA 3QTGA 1FHLA 3OVGA 4RNFA 4Q33A 2ABAA 1Q1WA 2HWGA 4H9MA 2PTWA 1VIZA 3FYOA 4GVHA 4KCWA 3W76A 3PZOA 1PX4A 3DOPA 3FLUA 3QR0A 4H4IA 1EUAA 2WNWA 4EAMA 4Z17A 4O14A 4LYQA 4HN8A 4P61A 2TYSA 5EBAA 3TJLA 2ZIDA 5FAGA 4DYJA 4UOZA 4PMXA 1XLGA 4LVFA 4ZE4A 3WUBA 3A13A 2YCLB 1EH9A 1UR0A 1Z42A 1O6IA 4O13A 5LIXX 2VZSA 3AIQA 1Q7QA 1XYFA 3EX2A 3OHIA 3QHOA 1HGWA 4ZQPA 3HMCA 2IMRA 2UWFA 1VHCA 3VNMA 3W7QA 4ZOHB 3HFTA 3CQKA 3W53A 4NL1A 1IE7C 2OZ3A 1JI1A 1B54A 1AQHA 4UUIA 4X22A 1LWIA 2WPBA 4C6FA 3STPA 4AD2A 1BWKA 3MYPA 3UA3A 3KTXA 3H54A 2RJGA 4K3ZA 3EXSA 4UQBA 1EGVA 2WKGA 4KKXA 1AK5A 3INPA 1YYAA 2DUXA 2A3BA 2IS7A 5BRPA 2WO5A 2A3EA 1GESA 4H8UA 5FJUA 2RGMA 2UY4A 3WH8A 3AIUA 3HF3A 3TEVA 1U33A 3WJXA 5E70A 3USZA 4XO7A 4HYRA 2VD8A 3N12A 4EMIA 3RK8A 2PP0A 3LTYA 3OA5A 2J8GA 3KHDA 3CH9A 4FNUA 5FA5A 1LOSA 5CQ1A 3HU7A 1D9EA 1EYEA 2PDWA 1ONFA 4KF1A 3L66A 1DQWA 3B3DA 3WQ5A 2BTMA 5G1TA 1GPWA 3K4DA 2XVPA 5H8UA 1GHSA 3LXCA 3SAZA 3C8FA 1GT8A 4W9TA 4L9XA 4A3UA 4W86A 1IIHA 3CGCA 2WK2A 3R10A 5FJOA 5I3KA 3UJ2A 1XS2A 3WF4A 1K9TA 1LWHA 5BZAA 3QTPA 1IWBA 3P7YA 1HJWA 1U5JA 4C6QA 1XYAA 3IGUA 4WXYA 2DIJA 1S46A 1GZGA 5E9XA 3UXIA 3EX4A 3VINA 2NQ9A 2IKIA 3T4WA 2CLPA 4JDRA 1CX9A 5CCZA 1X6NA 1ZU8A 3P74A 1Q6RA 1P0EA 2ZX5A 3JUGA 4A3YA 1TSIA 6TIMA 3PBUA 1OIFA 2FPYA 1PZ2A 3CGTA 2GGJA 2PTXA 5JCMA 3EX6A 2Z2BA 3SFWA 2PRMA 2MNRA 5DT7A 4Q8VA 1EBHA 2FVLA 3UWZA 1WZKA 4R33A 5I02A 4JN6A 2ZUTA 3BO9A 1VR6A 3GY1A 4MUPA 4M82A 3AYRA 3QR1A 4UTTA 1J2BA 2PI6A 3SM0A 3HN3A 2Y0FA 1MQPA 1JVNA 1G4TA 5KZMA 2OOGA 1C9WA 3EWWA 1TPC1 3CHFA 2E9BA 1BPLB 2B7PA 3O2LA 1P43A 4PMDA 1E1CB 1PO9A 4WX2A 4AY1A 4P7NA 1QJWA 2PE4A 3SUVA 2P3ZA 1ZBCA 1YADA 4B4FA 3WLMA 2CLFA 3RJXA 1S5MA 5CAKA 4ZSTA 2V5BA 2IPJA 3ONBA 3FKKA 4Y8FA 1CECA 1DKWA 1FOBA 3I3BA 1E4LA 3SCQA 4LC6A 4XAGA 2QUTA 1SZEA 2VCBA 3GYEA 2D0GA 3H24A 5BXTA 4PUMA 3EOEA 4W8LA 1HX0A 5IFPA 2J25A 3CQ0A 1JPDX 3MCMA 4PMOA 4Q4QA 1W5MA 1H09A 2FJKA 2FGZA 3IIXA 5A8PA 5CH9A 2YVFA 1TKKA 3DU0A 4NX0A 4FNQA 2ZZ0A 4O17A 3LSCA 1CYGA 3O0FA 5FIPA 2XWEA 2GVEA 2H3DA 2H6RA 1RZMA 3R4IA 4QIUA 4MADA 4FX8A 2I5GA 5JBEA 2XIJA 2WPCA 2GJRA 4ZB2A 4OKDA 3M0XA 4O53A 1P7TB 4ADUA 4JAWA 1TA3B 3TOYA 3WEZA 4W7UA 1VYPX 3L4ZA 3MSGA 1PTDA 1VC4A 1W5PA 3HBLA 4LAOA 3RN6A 1R3WA 1PB0A 3S5OA 5HINA 1QATA 4U5KA 5K4ZA 4M29A 3E12A 4EANA 3VIIA 3RRXA 4WCJA 1HGYA 4HCLA 2CLKA 4DELA 2B31A 1FP9A 3DESA 2VEKA 1CI1A 4Z2JA 4HP5A 2A4AA 1RXOB 2PBGA 5LZLA 3SRKA 3PBYA 5LNVA 1LVLA 5F1VA 1DTUA 2Y61A 4XZ9A 1EGZA 2GSEA 3C0JA 4H3DA 2WQPA 1JZ2A 1MW2A 4N4QA 3BL3A 3VIMA 4GIYA 2QUUA 4Y90A 1QAPA 1LM1A 2WJDA 4U3CA 3FG2P 1EUNA 2QCEA 3LRKA 3UJFA 4MYAA 2J88A 4O16A 3TROA 1EHNA 3W74A 1VCGA 3RJYA 2CXGA 4S3GA 3LCXA 3LCLA 4NZ3A 2BSLA 1XSKA 4NZCA 3THQA 2OFJA 3TCEA 3UZWA 3RILA 1PTGA 3ABOA 4U31A 4MKNA 4J3VA 2OSYA 3ITCA 1L6GA 4JTRA 2ADAA 2OEJA 1KFEA 3LI1A 3PTQA 2BVWA 4GABA 2FMOA 3TTEA 5L9FA 1OCJA 4MVAA 3WLTA 2WHLA 1YDYA 5KETA 4IQEA 3ETRB 1XIMA 2DZUA 2RJHA 1CXIA 2B7QA 2VZTA 1ZAIA 1F2JA 1A5BA 1TUFA 3P5ZA 2YB4A 3DXIA 4QLKA 3ABQA 3L23A 4TV5A 3UR8A 1GVYA 3R1ZA 4LW7A 4C65A 5CGMA 3ES8A 5FF0A 3NWRA 4YPJA 1EPXA 1VPQA 1E3XA 3T0AA 4E3VA 1JZ8A 3WLRA 2DZSA 2IKGA 5FEPA 1HP4A 1GOQA 1PYMA 2NT0A 4QQ3A 1W8GA 1HW6A 2V5KA 5I00A 3GTHA 2PSNA 1KM1A 2EQDA 2V3GA 1PKMA 2DT2A 3FKRA 4LGXA 2HE8A 2NWRA 3W1NA 2X16A 3OB8A 2ISWA 1XGEA 5A2CA 3E74A 2FIQA 3ITYA 3QV8A 3L0GA 1V8EA 4RKAA 3IJ9A 1JNDA 3G1SA 3PHAA 2PZ0A 3CU2A 5HMEA 1CXKA 3T0TA 4GYKA 3KLJA 3KVJA 1C8VA 4WDXA 4M1RA 3R0KA 2J7GA 3CAKA 1UH4A 4H6QA 1IZCA 3W7KA 4K1WA 5ABFA 1ZZMA 2X0SA 1W9PA 1HG3A 4O19A 4W8AA 5A6KA 5M1TA 3OG2A 1DV7A 1Q66A 2I16A 3PPFA 4X9YA 1KM4A 1F4HA 4ZEPA 3PZGA 1H61A 1VH7A 4B9ZA 2JBMA 2IPWA 2W3ZA 3N4AA 1JUEA 3A5FA 3T0BA 2YAUA 3H7UA 3SIZA 3NGFA 1ITUA 2AL1A 3M46A 1G4PA 4HKPA 3W7DA 1CZ1A 2R9ZA 1W91A 3LCFA 2VEGA 4KRUA 3II1A 2ATMA 5BW6A 2EF9A 1P0BA 3P82A 3DFSA 4PYSA 3ZFHA 7PTDA 1EA9C 3QV6A 1GKQA 1KC7A 4ZOCA 1FWGC 1TIMA 1GOIA 3CWOX 3DUGA 3B97A 3SI9A 1OFDA 1YPXA 4XWUA 2G5WA 3EA3A 1FXQA 3NQBA 4Y96A 4O1AA 4EVZA 4GUJA 5DELA 5J5RA 1HO4A 4GH3A 4I8DA 2W91A 4JNMA 2BDQA 4GQRA 4FA3A 2VD9A 3THAA 3S4TA 3PZIA 1XLDA 1ITXA 1V5XA 3U2ZA 5D2YA 3WNOA 1NU5A 2C0HA 3VGHA 2VXNA 3W7PA 4W89A 3DH7A 2YCLA 3B9EA 3FJ6A 3HV8A 1UWQA 2GWNA 4FMVA 3PJWA 2CIPA 3W84A 4F0LA 1NHRA 2D22A 4AHPA 4DUVA 5I3FA 3DYOA 1N62C 3EDFA 5D4YA 1TCMA 2NV9A 3S1UA 1IEVA 4YHGA 1V4YA 3GDRA 5TR3A 2WMIA 1G4SA 1T41A 3GNNA 4ORIA 2XSXA 4DZAA 1R2TA 2WJZA 3U0HA 2D2HA 2H8ZA 5B80A 1UROA 2DW7A 4EF9A 5DXXA 2PF0A 4ICNA 4Q6XA 2YL9A 2QW5A 1BGAA 2Z7GA 3ES7A 1Q4NX 1C7TA 1KBKA 1HKIA 2ZZ1A 1KFWA 1XRTA 1TFVA 4IMAA 3FA4A 2IQDA 1TVPA 4REQA 4Z1AA 1BD0A 1MFVA 2GWGA 3SCRA 4J57A 3W1LA 2XFFA 1JGMA 3VIJA 3IJLA 3N25A 3MT1A 1AW2A 3HOJA 3CQIA 5HWMA 3CTLA 1FWDC 2QCLA 4C91A 2HXTA 3KVLA 2DT3A 2ACQA 3GYCA 4ZO7A 4MNKA 3UT0A 3T44A 1S2CA 3O3RA 4QE4A 1I4NA 4GCXA 4JIIX 4U33A 3TYCA 4DBSA 2NQHA 3IGSA 5IHRA 4IF2A 3BSMA 4UTLA 4AWUA 4HOZA 1AD1A 4L56A 4HSNA 4FLQA 1Q6GA 2INFA 2FZMA 5A8OA 3H4WA 1SYTA 4NXKA 4B5UA 4NYYA 2ZZ7A 4AIUA 1C29A 1LL4A 5C9UA 1NELA 1WV2A 5HR7A 1NY1A 3C4UA 1M7JA 1XHGA 3W23A 2JEQA 4L6OA 1Q1RA 4RZ5A 4L1WA 1OG6A 2BGSA 3SGZA 5D8ZA 5BOOA 3L4UA 1SO6A 5CJNA 1JDEA 3ITXA 3T81A 1I60A 4RXFA 4LCRA 5KSWA 4C6JA 2OELA 1D2KA 4BQ5A 1UKSA 3NVYB 4LS1A 4UOJA 1E9YB 2ZRYA 5D9OA 4JFSA 2KZHA 3WUEA 2QGHA 2YQUA 3NVWB 1YXDA 2JGYA 2J3NA 1UIPA 2ZX9A 1PDYA 3T2OA 4WJEA 3TAOA 1OM0A 1Z41A 5DRCA 3ZOAA 1E9IA 1E1CA 4O0ZA 2XJ7A 4H4VA 4D6DA 2VNCA 5MKGB 3HZ3A 2NWSA 1AJZA 4CQBA 1W32A 1KGUA 3A5VA 2C7FA 4RE0A 3D6NA 1VJIA 1FCVA 2NVCA 3LXDA 2R1KA 2DZVA 3LYEA 3RM4A 1AVAA 4JYDA 2WHJA 3NL6A 3W72A 1YLVA 2ZVRA 2O4QA 4X0NA 4PMQA 2GGEA 4K36A 3IIVA 4XAPA 4YTRA 4AD0A 5AYBA 1HVXA 2Z1BA 4GI4A 1PDZA 2OZTA 4ATLA 2D20A 3ANYA 4ATWA 1X2HA 3V1HA 4YYFA 1EKOA 4TV6A 3WEMA 1TA3A 1UPPA 2E0PA 3VOJA 2QIWA 4WK9A 3NVDA 4QAWA 5LGZA 3W88A 4JCLA 4QNEA 5EPDA 4CQDA 1JNEA 4KCUA 2GLKA 4IX0A 4GCAA 4JQAA 3ZT5A 1PKYA 3Q2DA 1E73M 3I7QA 1VB9A 4MB5A 4ZVJA 3QLDA 1EP3A 1XICA 4FDCB 4WSKA 4CU7A 4LYKA 5AOUA 4JTAA 3IJ6A 3L2IA 4AW7A 3PTDA 4P7OA 2Y5SA 2WC3A 3QZAA 2A6NA 3GU9A 3DI1A 1BLIA 4EMJA 2X8CA 4M80A 1DIEA 3RITA 4HGXA 4IMEA 4MDPA 1VZWA 4ICMA 2YX0A 3AHVA 4LUYA 2F9RA 4ROPA 3SJ3A 1S7MA 5A2BA 4IXHA 2BHUA 9XIMA 2NSXA 4KWOA 1JCTA 2Y1HA 2POTA 3VMNA 2Z28A 1NIUA 1JPKA 3ZSSA 3PBMA 4H9YA 3SN4A 1WAUA 3AYTA 1XJBA 2BASA 4LVAA 5CPLA 4O8RA 3OJGA 4ZOEA 3GNRA 4FOUA 1TRDA 3EX1A 3G18A 3N9KA 5CSYA 3JZEA 2PLCA 5LXEA 4GYJA 1BZLA 1K9FA 2X1TA 3WD3A 4CD7A 2W5FA 3TYDA 3G1XA 3I6TA 5HANA 4AHOA 3A9BA 4AZ7A 1LG1A 4IGNA 3M4HA 4TU1A 3U3HA 2XUCA 3QZEA 4H41A 3VOFA 3WQ4A 3CEPA 1SW7A 1IXNA 4V28A 3A24A 5CLTA 3I7SA 2B7OA 5FACA 3CPRA 1J0YA 3UYIA 3WMSA 3OZPA 4DQWA 4JNZA 1WKFA 3VKCA 3EXTA 4M5PA 2VYOA 1J0ZA 4GIAA 3C2EA 2ZX6A 1G7UA 4WKFA 4ZB0A 5AYZA 4BJHA 5MF5A 2BCPA 5EKYA 3FCPA 2E1DA 3N2MA 1JCLA 4S3JA 3WY1A 4EKJA 1I9CB 2B0MA 4TXEA 3G3MA 4GI8A 3KBMA 5EMUA 4J2MA 3I3DA 2Z1WA 2PC4A 2QDHA 2HTMA 1EIBA 3VU2A 2DY3A 3ZYZA 1O5KA 3TA6A 3BOFA 3MHFA 4NIRA 4X60A 3UG8A 2FZBA 1TJ0A 2CZEA 2PEVA 4QROA 1OX6A 4W5ZA 2OEKA 4DBWA 2QPXA 5BOEA 1LUCA 4HHPA 1O12A 2PU1A 1XLIA 5FEZA 3TR2A 1JD9A 3WDRA 1HIZA 3KEHA 1CXEA 4FNPA 2W4XA 3P0WA 3UXAA 1D8WA 4N6EA 1F6PA 4WKHA 1DXIA 3PWIA 4MLRA 2A85A 4MWAD 3B8UA 3VFCA 4GIRA 1KXQA 4JFVA 3RIKA 1IR2A 5F2IA 2HCVA 1OCBA 1ZCOA 3UJEA 2CYGA 2VX4A 3BTNA 3QW4B 3S1VA 3GRTA 1GOWA 3W2MA 4IPPA 2VL4A 3GB6A 1BYCA 3W37A 4DBDA 4E8CA 5T9CE 1S5TA 5DMYA 4FNRA 2WMHA 4J9JA 5HAOA 2OJPA 3G0XA 3WD1A 3QQWA 1RQHA 4PMRA 2O9OA 5CG0A 3PK7A 2CZDA 4ERAA 3QPEA 3OO2A 3GTXA 1Z3NA 5LIYX 3E2QA 3WJZA 2E5CA 5AC8A 3LY0A 2R14A 2PDYA 3EOUA 4PBEA 4WRHA 1AQ0A 5H2ZA 2NX1A 2DJXA 2Z00A 1ECQA 1JAKA 2BMBA 2WYSA 2BC1A 2VDGA 4L65A 4IQJA 1Q7MA 1P6CA 3V36A 2ZE3A 3LGDA 3JR2A 3L0KA 3QY6A 4PB5A 3LPPA 4KS0A 1VEPA 4D6EA 2O9RA 4P8XA 3GU1A 1J11A 3J7HA 3ONCA 3AIBA 2PDBA 2QCGA 3OP2A 3VGEA 2P0OA 1ICQA 1WUEA 1IYXA 3LM7A 1RPXA 1S38A 2YZ5A 1LL7A 1OABA 1W3IA 2PDMA 1K7FA 3I6RA 3N2OA 5D38A 1T6MA 2XG9A 3A22A 4EOUA 5I09A 4AEFA 1Q4WA 4BV6A 4Q4SA 2PB1A 2BS9A 3AO0A 4H6RA 8XIAA 3IVUA 4MWAC 4KQNA 3P5YA 1GVQA 3NFUA 1FDYA 3GFYA 2TPSA 4JPGA 3LHUA 1KD0A 4GKLA 4H7CA 4MY9A 4J56A 1TJ2A 3E96A 2VRJA 3PP7A 1X1OA 3WENA 4XD4A 3OGRA 4E2BA 5FEWA 3PJUA 2CITA 2V38A 1DQXA 3QXBA 2QV5A 5C6MA 1XBVA 1ODZA 4Z2IA 3TNBA 2Y5JA 2YLAA 5H8MA 3SGUA 4Y9PA 4HK5A 4KFPA 3DFYA 1Q8AA 1R9YA 4GO8A 1CLVA 1HFBA 2J74A 3ZR5A 3HGSA 3O0KA 3KL3A 4WQ6A 1LP6A 2PWDA 3LG3A 4YTTA 2WXDM 4CCDA 1H7OA 1TV3A 3LN3A 3LDVA 3B04A 2BHYA 4F9JA 2DUAA 4LUSA 5FF7A 4U5IA 1OFPA 4C7FA 1FH9A 2Y8KA 1Y65A 1XLEA 2FZ8A 2PZNA 1MUCA 1NDYA 2TMDA 3MSYA 3DFOA 3H8AA 4RE4A 1OB0A 2GGGA 1W1TA 3OU8A 4PUJA 5I3HA 3VPLA 2GQWA 3BPWA 1J6OA 4UNKA 1B3ZA 3UCDA 1DJWA 3STCA 1CGWA 3C3NA 1ITCA 1UH2A 2OSWA 1TPH1 3R2GA 4J4KA 4JTQA 1A5KC 1RQEA 4L9ZA 1HKJA 3K46A 1AL7A 3BLFA 1LOLA 2Q3RA 2XH0A 3ZLGA 3P93A 4X0VA 5FSDC 3EMCA 4C1KA 1E70M 3HFYA 3K5XA 1Q6OA 2O92A 4BHYA 3EANA 5C5YA 3GM8A 1VEOA 4ERIA 2Q6ZA 3W71A 1YTKA 5AFDA 3MJYA 4UTWC 2WHMA 4US5D 3TJ4A 3WQ8A 3PSVA 4EM4A 4NP7A 4QLJA 1OADA 2E9MA 3PUGA 1FEBA 2W3RA 1MMFA 4LUIA 3HB9A 2DZAA 2QXWA 2E67A 3NPUA 1L6FA 2G4JA 2EJ1A 2ZOXA 4EM3A 1F4AA 4CUCA 5HWJA 4L64A 1W9UA 5LGXA 4ZB5A 4GYFA 3W7NA 1ZMDA 1EGMA 3S6TA 1XISA 5AC4A 4D8LA 4NKCA 3AALA 4MNLA 1Q13A 1KKOA 4I5RA 4WXZA 4TIMA 4LAUA 2NXIA 1EBGA 1E71M 3AS3A 3QEZA 2Z7KA 4IQDA 3R8GA 4CKQA 2PA6A 4S39A 3SN0A 3BOXA 4B9YA 4JFTA 1SO4A 2V5JA 3DG6A 3WMCA 4GD0A 4OV4A 3HPXA 3LEPA 2C79A 2DZWA 1YQZA 4JQ1A 3V7PA 4DO6A 5FL1A 3TTSA 1NOFA 1R86A 1IEWA 3MY9A 4BA0A 4L1GA 3TC3A 4CNUA 3NSXA 2ZA2A 3V0UA 4HHHA 1WYGA 5I06A 1HJSA 5EBUA 5EMLA 4H4QA 4Z42C 2XSAA 2GUBA 3II4A 1TMLA 4EIVA 5BU9A 1Q5MA 4IXXA 4P7LA 1M6JA 4JEJA 1MRQA 4AFYA 3UG4A 4F2BA 2V3AA 1L8PA 1RY0A 3GTIA 4OUEA 3P80A 1GKRA 4K7ZA 1QI2A 1MNZA 3NSMA 1U5HA 2FYMA 2BX7A 4D8ZA 3LU2A 3Q45A 3TTOA 2JQXA 1BWLA 1ITQA 3ID7A 4K8EA 4K37A 4U2YA 4JIQA 3PWAA 4QJ4B 1FHUA 3TYZA 4OIFA 2PWFA 4A4AA 4Q3MA 4PL1A 3AWNA 4GY7A 3DZ1A 1JZ7A 1W1ZA 1GV4A 1RLCL 1N63C 1KBIA 1ZLPA 3S6DA 4JKKA 3WDQA 1T3QC 4IJCA 2HV5A 1A80A 2P76A 1OFQA 5TAOA 3NUKA 1GRAA 2ESCA 1KQYA 3GUWA 4O8AA 4S3DA 3MSDA 2I1OA 4C1LA 4PSPA 3G8EA 4C90A 1FXPA 1VRXA 2F38A 3W22A 4PCSA 1Q2RA 3QOMA 3TQKA 3VGDA 1KCXA 5HNNA 3ITOA 3QPZA 1GEQA 4JTJA 1JCMP 1POKA 2VRKA 4LCQA 3L0NA 4A8IA 4INFA 4XTIA 5H6HA 3QBUA 1H0IA 2E6FA 1HL8A 5G4HC 1HVQA 3QH2A 5REQB 4B15A 4AZ6A 5C9RA 4LVBA 1IT7A 4L4OA 1ZAJA 4ENLA 3S2NA 2X7VA 2OMAA 3OBAA 1WCGA 1F3PA 3BG3A 3IANA 1OZQA 1PIIA 2DQXA 3T07A 1CENA