3TJIA

Crystal structure of an enolase from enterobacter sp. 638 (efi target efi-501662) with bound mg
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
399
structure length
399
Chain Sequence
MTPVIIKNIECFITRPDRHNLVTVRVTTEQGITGHGCATFQQRPLAVKTLVDEYLQPLMIGRDANNIEDLWQMMNVNAYWRNGPLMNNAISGVDMALWDIKGQLAGMPLYQLFGGKSRDAIPAYSHASGETLEALFASVDALIAQGYRHIRCQLGFYGGTPSALHAPDNPTPGAWFDQQEYMSNTVEMFHALREKYGWKLHILHDVHERLFPQQAVQLAKQLEPFQPYFIEDILPPQQSAWLEQVRQQSCVPLALGELFNNPAEWHDLIVNRRIDFIRCHVSQIGGITPALKLAHLCQAFGVRLAWHGPGDMTPIGVAVNTHLNIHLHNAAIQEFIPRSATTNDVFPGAPEVKEGFVYPPVQPGIGVGFNEALALAHPVLYRPHEWTQSRLPDGTIHTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an enolase from enterobacter sp. 638 (efi target efi-501662) with boung mg
rcsb
source organism Enterobacter sp. 638
molecule tags Lyase
molecule keywords Mandelate racemase/muconate lactonizing enzyme, N-terminal d
total genus 140
structure length 399
sequence length 399
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3tjiA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3tjiA01
2GGIA 2ZADA 1ONEA 5ENLA 2POZA 3FV9A 3CT2A 1EBHA 3TCSA 2HNEA 1FHUA 1KCZA 5IDZA 3ZLGA 3TTEA 2PU0A 3UJ2A 1EC8A 2OFJA 3Q45A 5BOFA 4K8GA 1MRAA 3ES7A 3SN4A 3P3BA 4IZGA 3JW7A 3VC6A 2QJJA 2XSXA 4G8TA 1JPDX 4GMEA 3NZGA 3SN0A 3MY9A 1JPMA 3S5SA 2AKZA 3DEQA 1YEYA 2P8CA 4H19A 2P0IA 4IP5A 3UJFA 3I6TA 3R0KA 2OLAA 4GGBA 3S47A 3DDMA 3MUCA 2OO6A 4Z1YA 3T4WA 5J04A 1TKKA 4E8GA 4M0XA 3FXGA 5BOEA 2OZ3A 3PFRA 2MUCA 3DFHA 3STPA 4IL2A 3ZVHB 3ZLHA 7ENLA 3NXLA 3BSMA 4ZCWA 3BOXA 3H8AA 2HXTA 1P48A 3JVAA 1ECQA 3CYJA 2CHRA 4H1ZA 5FJPA 1XPYA 1P43A 4DWDA 1SJBA 2OKTA 4IL0A 3DFYA 3GD6A 5FJUA 1NELA 3V5CA 3N6HA 3PWIA 3HPFA 3QPEA 1JCTA 3H12A 3SBFA 1BQGA 4JN8A 3VDGA 3JZUA 2MNRA 3ZVIA 5EU9A 3T6CA 3KUMA 4J1OA 3GC2A 3FJ4A 2P88A 1KKOA 3P93A 3CB3A 3CAWA 3U4FA 4M6UA 2O56A 4J3ZA 2FYMA 4KEMA 4E5TA 3N6JA 3TJ4A 4E4FA 2AKMA 4YWSA 3VFCA 1R0MA 3DESA 2PP0A 3OZYA 4E4UA 2QDEA 1EC9A 2AL2B 2QDDA 2GGEA 4MGGA 1PDYA 2OVLA 3PK7A 4KWSA 2OPJA 2PS2A 3UXKA 3SJNA 4DX3A 3SQSA 2AL1A 4HCDA 3UJEA 3QTPA 3OP2A 3UJRA 4GYPC 1XS2A 3UCDA 2PTYA 4Z17A 3VA8A 3ZLFA 3Q4DA 4HNCA 4DXKA 4EWJA 4FI4A 2FKPA 4JN7A 2GL5A 2PTWA 3H70A 3TWBA 3TJIA 3ZVHA 3RR1A 3RRAA 2GDQA 2PTZA 4JHMA 3VC5A 4ROPA 3R11A 3R0UA 2QQ6A 3MSYA 2HZGA 3DG6A 2GGJA 4GGHA 3TQPA 3NO1A 3DIPA 1KKRA 4GFIA 3CXOA 4F4RA 3U9IA 3GY1A 4HNLA 4HPNA 3OTRA 3TW9A 2QGYA 1L8PA 1TE6A 3IK4A 4X2PA 4FP1A 2DW6A 3UCCA 4H2HA 3OW1A 3DG7A 4H83A 1SJCA 4ENLA 3QN3A 4HN8A 1ELSA 2P8BA 3DG3A 4DN1A 3SSZA 3EEZA 5FJTA 2OQYA 3P0WA 1EBGA 1F9CA 1MDLA 3IJIA 3OPSA 2OX4A 1MDRA 3CK5A 3I4KA 4DYEA 3RCYA 1R6WA 4A3RA 4HCLA 2PSNA 3R10A 2AL2A 1NU5A 3DERA 1RVKA 4K2SA 1WUFA 1KD0A 4KT2A 3BJSA 3QLDA 3UJSA 3PWGA 3MZNA 2GSHA 3GO2A 3UXLA 4IP4A 2ZC8A 3FCPA 3B97A 4GIRA 2QJMA 3T9PA 4GISA 4E6MA 3VCNA 5FJOA 1MUCA 4IT1A 3IJQA 2RDXA 3V5FA 3MWCA 2XH4A 3ES8A 1W6TA 3D47A 3ENLA 2QVHA 2PGEA 2XGZA 3V4BA 1FHVA 3DGBA 2OZTA 2HXUA 2OG9A 3V3WA 3NFUA 3T8QA 4IHCA 4DHGA 2NQLA 3R25A 1BKHA 1TZZA 2OZ8A 3FYYA 3SN1A 3THUA 4ZA0A 1SJDA 4A35A 4MKSA 3OZMA 3TOYA 3FVDA 2PODA 2GGGA 3RITA 3QKEA 3H7VA 3I6EA 2XH2A 2PU1A 3D46A 4MMWA 6ENLA 4KPLA 2XH7A 3K1GA 3MKCA 1SJAA 2ONEA 1DTNA 2PP3A 3RO6A 3N4FA 4G7FA 3VCCA 1MNSA 2PGWA 4A6GA 3TWAA 3IJLA 1EC7A 2PA6A 4HCHA 4K1WA 4HYRA 1E9IA 2PP1A 3MQTA 2QJNA 2P3ZA 3UGVA 2DW7A 5FJRA 2PCEA 3R1ZA 1JDFA 2GGHA 4GYPA 2XH0A 2I5QA 3N4EA 1IYXA 1OEPA 3RGTA 2PMQA 1WUEA 2PPGA 3EKGA 2OQHA 1PDZA 2PTXA
chains in the Genus database with same CATH superfamily
4HNUA 1FXPA 4MZ1A 3T81A 3IIVA 4FNTA 5C9WA 3L4YA 4I6KA 4QE5A 1F8IA 4IGHA 2BVWA 3SZ8A 3VKCA 4MFDA 4AHOA 1BTMA 1ONXA 2WZMA 1EX1A 4BY3A 1N62C 1Q63A 1VR6A 2KZHA 2VOTA 2V63A 3PVFA 3W4RA 4X63A 5G2IA 5DO8A 5AFDA 3UQNA 1G7UA 2ZFAA 3TMQA 3LLDA 5A6TC 2EG8A 4N9BA 4POCA 1ZU8A 1E43A 2ZRVA 2J9YA 4Y9MA 3GTFA 1XYMA 4G56A 1XIEA 5C6MA 1O5KA 1AOGA 3IVUA 3H53A 3GG1A 1BQCA 4J3VA 2XN1A 2V8ZA 3GR4A 4GJJA 1BAGA 1LDCA 1GREA 1QVBA 4QITA 4AD3A 2I56A 5C9XA 2GUYA 4S3DA 1PEZA 1R3SA 1QRQA 2WBKA 1QI0A 3WQGA 3ZLHA 4Q3MA 4GC4A 4MDPA 3VIKA 1HFBA 3UPMA 3A9BA 3BCJA 3VI2A 1PVNA 3VKJA 3GNOA 4LCQA 3LK6A 2OX1A 4LUTA 4JTLA 4OOZA 4IQDA 2H8ZA 4D6IA 4IIEA 3BSHA 2DSZA 1XDJA 4CQCA 2CWNA 4FDCB 3T44A 3HQNA 1ZDLA 3A7UA 1PL9A 1EQPA 5F4SA 2JE8A 1D7KA 3L0NA 3TH6A 2DFAA 4J1OA 4PMNA 3UWYA 1E4NA 4EM3A 5DXXA 3ONBA 1X2HA 3R07C 1DPMA 2X16A 2QF8A 2ASHA 1JF5A 3TN3A 2VEMA 3WQ5A 1DE5A 1C90A 1JCYA 2RAGA 3ITYA 5D09A 1VIWA 4O19A 3HW2A 1OD0A 2J3NA 4ATLA 5I5RA 1UYQA 2X2GA 3RPMA 4OIFA 2C0HA 2A6NA 4GNVA 3UG5A 4QCEA 3STEA 3DFSA 3EPMA 5E6ZA 1PCKA 2CWXA 1EGZA 3RXZA 2WVVA 4AD1A 4HCDA 1RH9A 4XZHA 1TX2A 4JY9A 1UW9A 4O1CA 4DO6A 2XIJA 2D69A 1GW9A 5FACA 1UC4A 3RFAA 3HG4A 3RX3A 3M0ZA 2V82A 2YL9A 2ZX7A 3KOYA 5TR3A 4FLQA 1IZCA 1VS1A 3WMCA 4MHBA 2FKPA 2OMAA 3LHUA 3NXFA 3WDPP 4AD4A 2PZ0A 3TJIA 4OE7A 1HKWA 2BXZA 4F8XA 2RHGA 3EYPA 4YCOA 1LBFA 3O1NA 4XUGA 2HZGA 1UD3A 1RPKA 1MQRA 5GPRA 1SW7A 4ILSA 3CH9A 3NVTA 3NO1A 5CBBA 3HQOA 1B5TA 5C9ZA 2O9RA 3KM8A 4CNPA 3W2MA 3UT0A 1FCQA 2QR6A 1JZ5A 3LCFA 1YPIA 1P7TB 1Q8JA 3LXDA 3IJ6A 2A3HA 3BLPX 4QG6A 1UBPC 4WKFA 1ZP3A 3LS9A 4ACYA 3L67A 3OA3A 5REQA 4JL1A 4JY8A 1GJWA 1NPXA 1LOSA 1ELSA 1LL6A 4HNTA 1C92A 4ML4A 4HPHA 1F9CA 1HKMA 3GLCA 4GQGA 2QVNA 3VZXA 1R8LA 5ABTA 1U5JA 1TWWA 5D4YA 3NJ3A 1LROA 4WJ8A 5CLWA 3TQKA 4L9XA 4PRRA 4Z2GA 3C0SA 3GDTA 3ZSSA 2V0TA 2XPKA 4W89A 5AKQA 5ABHA 3AYSA 4HNNA 4IMGA 4CN6A 3LZ5A 5H8MA 4INFA 2GDVA 3MMWA 2QCCA 2Q3OA 1HP4A 1VQTA 2PDFA 4QBXA 3HA1A 2D0FA 2WHMA 1WKDA 4FF7A 4LUJA 3MYPA 1J96A 4ORIA 3B4YA 4QHRA 3P82A 1OWQA 3WMLA 3KOWA 3B8TA 3PZVA 3PM6A 3MDUA 1JF6A 1SFJA 1DNCA 3O3RA 1F8MA 1OZMA 1FTXA 1NOUA 3LBOA 4JQAA 3TTOA 3VD4A 3STGA 4FXJA 5M1TA 4CQBA 4Y8EA 1OGGA 1F6KA 2Y6ZA 1QCWA 1VP5A 3KRSA 3WH5A 4UQEA 2ZYFA 2NQLA 4HMEA 1W3HA 1G4TA 4RDYA 4CCZA 3GZAA 3GH7A 4ACZA 5LIYX 4ZA0A 2OODA 4LVDA 6TIMA 1IE7C 3TQ0A 4ZQCA 5M3WA 2Y4SA 3AIBA 2F8QA 6XIAA 3V7PA 1H0IA 3ORWA 6ENLA 5K9DA 2YVGA 2CZDA 3NQ7A 1G4SA 2XUCA 3EDKA 1E5JA 3CL7A 2V6AA 3B05A 1HT6A 3PBWA 3ITVA 4ALDA 4WQ6A 4A22A 3N9SA 3QMRA 4XUYA 1BLIA 4JBRA 3S5ZA 3KVKA 4UNKA 5KZ6A 1SVDA 2NXHA 1AJ2A 4CQDA 1UQYA 2WPGA 3ETRB 4IIBA 4YLWA 2Z7GA 3VE7A 1MO9A 1E9IA 1H5VA 3QGAC 1V51A 4EQXA 3WJYA 3MP3A 1VGAA 3VOIA 3T0CA 1GOQA 1OADA 3N4EA 1XDLA 3GS6A 3A5VA 1KFCA 3BMVA 3DI1A 4Z2HA 1LWJA 3MI6A 3THQA 2PLJA 5JQ9A 1WZKA 2R14A 3OLIA 4LF2A 3M7WA 5AY7A 1KCZA 1GOOA 3LPOA 3SFKA 3WNPA 1W1B1 5D02A 1FWWA 2DZXA 2DZAA 4KFPA 2XIOA 1V0MA 4TVYA 1ISWA 2QPSA 4H9XA 1EL3A 2PC4A 4CU6A 2ZRWA 1TV7A 4CEXC 4LW7A 5HJXA 4HSNA 3EX4A 4EXAA 3RHGA 5HINA 1L2UA 3KHDA 4YHGA 2IPJA 3S1WA 2PDLA 4D6JA 4C7DA 4WKAA 4EMWA 3EWXA 3PN8A 1XG4A 3I6TA 4CQ9A 1A5AA 4GUFA 5M5DA 1P7TA 2WOWA 1MZRA 1JNEA 2WZTA 4XD6A 1NWUA 3WDHA 3LQLA 3GDLA 1Q66A 1GVYA 4JKMA 1UP2A 3HN3A 4AW7A 1E6SM 2B81A 4MPQA 2WM1A 3QV9A 2YFNA 4JGDA 4MVAA 3WDJA 1S5VA 2ZZCA 2G0WA 4Q7BA 7XIMA 4LY4A 4UFKA 3BLOA 3H7RA 3CEPA 3GM8A 5D2WA 3TR9A 2PWVA 4ZCWA 3IGXA 3GVVA 2QHAA 3AZRA 4GO9A 1J01A 1SW3A 1Q6EA 3NDYA 3BOXA 1BGGA 4RV8A 3M07A 4DWSC 3IJ9A 1V3KA 4ZQRA 2V3EA 2GUBA 4AZHA 5DEZA 2ZWZA 1YHTA 4MWAE 4ZB0A 3GD6A 1F05A 4GJIA 5DX7A 2A3CA 2XIIA 1VYSX 1S1PA 2NZLA 3NSNA 1DJXA 1J10A 4BI6A 1J93A 1CXFA 1R9XA 3ABRA 5A8QA 1HJSA 3O63A 2WBAA 1MEIA 1OY0A 1N55A 3VXGA 4WJEA 3T6CA 3VAVA 3GC2A 4PA8A 3B0VC 1DXEA 4DBSA 3FIGA 1E1FA 3BJFA 3I68A 3WQFA 4YVXA 2BS9A 3T8LA 1R3YA 1Q6GA 2YDQA 4ML9A 4KCUA 1SZFA 1UWAA 2J9XA 3A21A 2VC7A 5F2GA 4EANA 1RJPA 2AGKA 2WM0A 2FVKA 3ARPA 2GGEA 2OB3A 3BLEA 4MGGA 4A8NA 2PWGA 2DZBA 4Q4OA 4ZL1A 1SR0A 2QIIA 4YWOA 2WSQA 3EOUA 3V35A 4ACZB 3O6CA 4Y9OA 3GNNA 3GTXA 1BRLB 4RZ5A 3HG2A 1AL8A 3ZWTA 2GQWA 2YCEA 3PZIA 4KF1A 1K8ZA 3CPUA 1NDYA 1L6YA 3SIMA 2BASA 4RZ4A 3CTLA 5LIUX 4GKLA 5AC7A 1XLLA 2NQ5A 3R0UA 5A2CA 1XUUA 5JCMA 2QQ6A 3LCXA 1ZS2A 2QJHA 3GSMA 1TA3B 3G22A 4ORMA 4UUIA 3FYOA 1Z3NA 1GONA 4DPPA 4HNLA 4HPNA 3LRLA 4HA0A 3S3GA 3ALGA 1W1ZA 4H4IA 4BHYA 2ATMA 3B8SA 2P8BA 3TEVA 3B8VA 2W3SA 2G4FA 5CAHA 1KR0A 1NHRA 2VCBA 1M68A 2E09A 3WLTA 3NEHA 4L64A 1YNPA 1FKXA 4LVBA 3PUDA 2VX6A 3O6AA 3L5MA 4AHQA 4JCMA 1DQWA 2BY1A 1M5WA 2IUZA 1GGOA 3GU2A 2WPFA 1EPVA 4A21A 4KEVA 2PB1A 3W73A 3P61A 4BWLC 5FCZA 2V5KA 2WMFA 5EBAA 1XH0A 1N5WC 3CMGA 4PRWA 1UWTA 3VTRA 4ZO7A 3B97A 3S5YA 4C1NB 4UR8A 1GQLA 4WHBA 4NEVA 2D3NA 3KHJA 3G1YA 1OJXA 4AX6A 2GJNA 3GW0A 1PIGA 4XZBA 3T0AA 5I07A 2QUNA 1HL8A 4PN2A 2J9ZA 5GNZA 3QTGA 3V4BA 1W17A 2JF6A 4DWSD 4PBEA 1POKA 4BK9A 4UCGA 4L6OA 2DUAA 1VC4A 2NVCA 1N61C 1QMLA 3BLLA 4XBJA 3S9ZA 1F74A 2XSBA 4KKXA 3OZMA 4AZ5A 4D6EA 3TU9A 1CECA 1I1XA 4FB7A 2I1OA 4YTTA 2C3CA 4NJHA 1PS9A 2XSAA 3QKEA 1B3VA 3NQMA 1RHCA 3O0FA 5E0FA 4E8DA 3DC0A 4OBTA 1WAWA 2NSXA 4C7FA 1LM1A 2J47A 3K1GA 1GYLA 1UMLA 1B2YA 4RPPA 3L65A 3N9RA 4XKYB 2A4AA 3W7HA 1Q2SA 2FJUB 1V6VA 3C86A 4O0ZA 1W9VA 4M5PA 3UR7A 2YB1A 4AXKA 1MEHA 3MV01 4C1LA 4C6FA 3U5UA 1DORA 2BLEA 3FK4A 1NOFA 3QY6A 5H8PA 1Q6CA 4EPEC 1VHNA 3N25A 4D1JA 3D3AA 5G2WA 3O9NA 1HQTA 1FDZA 1K6WA 5I3GA 3IIXA 2ZXDA 3BMWA 3GC5A 4B3LA 5GVJA 4GYPA 4WEVX 5A5WA 3FSUA 3WQ8A 3BO9A 4LNCA 1VFTA 1PDZA 1MNZA 1OCBA 1HZYA 5AZ1A 3SAZA 4FO4A 2E7FA 3W0KA 2ZZ4A 4JDBA 3VPLA 2FFCA 3H2CA 3N73A 4DI9A 1B31A 3NPVA 1K4GA 2YFOA 1BRLA 3T42A 3UFYA 3Q45A 2UY5A 2WP5A 1MRAA 4O12A 3RDKA 1BTCA 4XV0A 3GKFA 4QLKA 1V6WA 2QJJA 4N42A 3OB8A 3OLDA 2QPUA 3AXKA 3WD4A 5I02A 3WD3A 4RLIA 1KV5A 3O6DA 4PUUA 3W86A 4B4FA 3KEHA 1WOAA 5F2LA 3DH9A 3NQDA 4RPQA 3CHCA 4NAEA 2OYLA 4ZTYA 2OO6A 3WK2A 3R5EA 4JS3A 3WX7A 4B3ZA 4Z1YA 1G67A 3VUPA 1HJQA 5J04A 4LNYA 5G5HB 3SCTA 1I6NA 1XDMA 3WIJA 1GG0A 3S8HA 4NY2A 3WEMA 2FPTA 3WQVA 5IOBA 4UQ9A 1B4KA 3EANA 5HUOA 2VDHA 3Q65A 1X98A 3DX5A 1LVLA 2WZIA 1CXIA 2CHRA 3UR5A 5FJPA 1P4CA 4ONVA 1JCLA 4B5VA 1RBLA 3LHWA 2NVDA 3BW3A 3LBMA 2I16A 3H2EA 1W9DM 3CV6A 3HF3A 1ITQA 2Z1XA 2BFGA 3BUVA 6ALDA 1EF2A 3JZUA 1XF0A 1UR8A 4G7EB 3UPBA 1KRBC 3SIZA 2YZRA 1W5OA 4H7ZA 1FH9A 3U4FA 4J3ZA 2VEGA 2QCMA 1W3TA 4KIRA 5ER0A 4OQVA 3JR2A 3NQEA 1Z9AA 4IICA 3NQVA 2E8YA 5I3DA 3GNDA 3QFBA 4HMNA 3DESA 3VK5A 2OXNA 1H7RA 1GQIA 2V30A 4ZXLA 1LBMA 1YE6A 3IANA 3WELA 2OVLA 4KRUA 2J6XA 1QW9A 2R24A 4UFMA 5D38A 2ZUNA 4PUKA 3M0HA 4M7TA 1HO1A 4S3KA 3QTPA 1QW8A 3WLIA 2YXOA 5ABFA 1HJWA 5DLCA 1XS2A 1EEXA 5CZKA 2WPEA 1NQKA 1ZQ5A 4Q8PA 3E49A 3BJTA 3GFXA 5CAKA 3LXAA 1NSJA 3ID7A 4R7WA 1WQ5A 1K7EA 5K7JA 4H4QA 3K46A 3W1UA 4GQQA 3NQGA 3H70A 2HQAA 3KOZA 3QV7A 4H9VA 1MW0A 1JCXA 2RDWA 2WNNA 1Q45A 4PMYA 3T0TA 4WF7A 3LG3A 4CD6A 5FEXA 1JEZA 3H26A 1E4MM 3ZJ8A 4BKNA 4DJEC 3A4JA 3E96A 3KRBA 1UR0A 3SQLA 1P6BA 3DK8A 4PB4A 1BVNP 2VGFA 5E9AA 3IK4A 2XVNA 3KOXA 4PTNA 5CZ0A 4GQBA 1YQ2A 4L9YA 4GY7A 2BOGX 3BDKA 4Y9PA 1ONFA 2J79A 4O0KA 2HJPA 2EPLX 2NWSA 4WDWA 5D2YA 1KCLA 5EMLA 4Q4KA 1ZHAA 2FZNA 2R1MA 3A24A 2OYMA 3FVMA 3B06A 1ZBWA 1M41A 3CIXA 4AQLA 3KL5A 1HW6A 1WCGA 1E72M 2ISSA 1WDQA 1MDLA 1QO5A 4QG9A 1MDRA 1RPXA 3PPFA 4ZVJA 3WF3A 3M47A 1E56A 2DZWA 3E2SA 3NQFA 3URQA 5L6UA 2WKLA 1SFLA 2WVSA 3WJXA 3VMNA 3DERA 3LI1A 1AH0A 1AW2A 3LHVA 1MWOA 1XSJA 4Z08A 2CLLA 1KD0A 1QTWA 3N9KA 4FR6A 4B4HA 4GNKB 1VIZA 1K02A 2WPBA 3AN1A 4DO7A 1IWBA 3F5KA 4RZ6A 4H9ZA 1Q6DA 3IS4A 3GNRA 4GI8A 1S1RA 2XDFA 1C8YA 2XYLA 2YL6A 1FP9A 1RZMA 3RMEA 1S5NA 3UW6A 3CZJA 3W6MA 1A3HA 2VDGA 3VUSA 2XIQA 3U2EA 3D47A 3NZPA 3ENLA 3LI0A 1W56A 3W1QA 1D3HA 3KLKA 1EEPA 3CU2A 1XRSA 4S3BA 2AMGA 4GZIA 1QHPA 5LA0A 3TK7A 2XGZA 3W88A 3AXMA 5EMMA 2F9RA 1U5HA 3W85A 3MHGA 5BXRA 1HJXA 3KVMA 1FBAA 4IUOA 1JZ6A 2CC0A 1Y5WA 4L1GA 1XLJA 1YDVA 1T96A 4MKSA 5TBOA 3LPGA 3PBUA 2X09A 4YWIA 4AF0A 3WCZA 2YL5A 4L4OA 4C6MA 3DFPA 4TQTA 3PJTA 1VQZA 2R6OA 1L6GA 3U57A 4DIAA 2ANUA 2NUYA 2OSYA 1ZSXA 2GZXA 4DWSB 1IZJA 1XHCA 3GXNA 3SCVA 4PMDA 4TTUA 3LB0A 3KOFA 2HDJA 2AQOA 3W7DA 4I90A 1S46A 4GH1A 4Q4SA 5JCNA 3DBPA 1EJUC 5LXXA 4OKDA 5AC5A 4BQ3A 3URBA 4YTSA 4I5UA 4PTXA 1GXFA 4V1XA 5D32A 2YA2A 2WBGA 1BD0A 3OGRA 1FY6A 1SMAA 3R4IA 2D23A 1LRQA 1TTQA 3W28A 4P7NA 1S5WA 3IGHX 4FMVA 2BVYA 3QC0A 1PE1A 4DEFA 1OF8A 2CHOA 1OD8A 1A4LA 5G1YA 4ZR8A 2FJKA 2VC9A 1XV8A 1ONEA 3LHZA 3OHIA 5IBXC 3A23A 2WO5A 4L6DA 1FWJC 3UZJA 1T40A 1SO6A 3UPWA 1PB0A 2YW3A 5CJNA 5KZDA 1OYAA 1VYRA 2Z28A 1T5AA 4LRTA 2OEKA 1KM5A 3OBEA 1GK8A 3LPPA 3CHFA 2JKPA 3TV8A 3E0LA 3WH7A 4DM1A 1LT7A 3W1TA 3CZGA 4NSBA 1VLIA 1PYMA 4BQ2A 1ECEA 1NJJA 1S39A 1M7JA 3UCQA 3W37A 2C1GA 2WCAA 3D9XA 1I2RA 1KCKA 3G2GA 1YEYA 1FDYA 1QPNA 4IM4A 4LGXA 5CPOA 3VIHA 3GB6A 4MDOA 1X7IA 5D9MA 3R0KA 4TVCA 3OC4A 2PURA 4AISA 1LLZA 3ARTA 2C1IA 5LNRA 3RK8A 2A1YA 3SY5A 3KLLA 1DXIA 1W5PA 2O92A 2ACUA 1P0BA 4WZHA 3TNOA 2WW5A 4FHAA 5T9BG 1A5NC 4UTWA 1C9DA 5JBFA 1GG1A 5HJYA 2QUMA 4M6PA 1Q6OA 1NTHA 1K6AA 1EJTC 2OZ3A 3M6YA 2VP8A 5U4NA 3VNKA 4JPGA 2O4QA 1HGWA 3H8AA 2V69A 1ONRA 1XBVA 3HFYA 3RIKA 4H1ZA 2VFGA 1P43A 2G3IA 3BXWA 4UFHA 4UQCA 4PB3A 5CSRA 5AZ0A 3R89A 1EH9A 2JEQA 4L65A 1B3ZA 1JCTA 3I6RA 1O95A 3AS3A 1FWSA 3U7BA 5EMYA 4UR9A 5F7UA 1EKOA 3PPHA 3GVQA 2ZZ2A 3AXXA 3IJ7A 5JRBA 3L23A 1G94A 3F4CA 4OU1A 3GH4A 4DUVA 2P10A 1X39A 5BRQA 3B0XA 2ZICA 4MAZA 2PP0A 4PUNA 4L6HA 2ZUUA 2DT3A 2QDEA 4D6DA 1KLZA 2ZDSA 2XINA 4J35A 1NVMA 3WNLA 4QX4A 1BYCA 5FEPA 2XJ7A 5A1AA 5GJMA 1I75A 2QDGA 1JNDA 1IEXA 1UOZA 2QPXA 3AM9A 1S3TC 1A5KC 4F2TA 3PSWA 2NX3A 4KEZA 2ZA2A 4ZO9A 5LNUA 4ZMGA 2PEVA 3NL5A 4HNCA 3UWQA 1ZBKA 3BLIA 3ATYA 4Q7IA 2GR2A 4GG9A 4PB5A 1QNRA 2D73A 3ZVHA 3KBMA 1SM9A 3E2RA 1GOWA 1GWJA 1CXHA 2XM1A 1T7LA 2F7FA 4KGLA 3UWUA 2VZVA 2GJXB 4IMCA 1TX0A 3URNA 1FCUA 1IIGA 2VX7A 4LANA 3CB8A 1XG3A 4Z2KA 3WNOA 4J2PA 2O7SA 4O17A 4O57A 1UR2A 3I7SA 4GZEA 1JULA 3BAJA 4IPLA 4D72A 1VFHA 2NV9A 1NWSA 2GVYA 2V5JA 4K39A 3HPAA 3LLXA 1NFGA 3H23A 2YCLA 3CHDA 1Q13A 2WMKA 2J27A 4Q8NA 1NDVA 1W2VA 3I3EA 4NX5A 3MBFA 1N82A 4OTKA 3LB8A 4NAFB 1ZZMA 2I9EA 2V3FA 5CSUA 5CH9A 2XN0A 2H9AB 1H2IA 1N60C 4OZOA 2AL2A 1BWVA 1UA7A 4S39A 1V4YA 2Z2AA 2JKEA 3WNMA 4O50A 3G1DA 5HUPA 4LEQA 4JTJA 2FLIA 7REQA 3MO7A 9CGTA 4W8BA 4IWWA 1PZ2A 4LBRA 4UTKA 1FWCC 4LYKA 4OBRA 2W66A 1TIMA 3PNUA 1C7SA 1Q2RA 1MOKA 4JTAA 1UHVA 1LL7A 2EQ7A 5IRPA 2FTYA 3OBKA 4EKJA 1QNSA 2WOQA 8A3HA 1V0KA 1HVQA 1FWDC 3V5FA 2DPEA 2DT0A 3AS2A 3MI3A 4CCCA 1X38A 4ADSA 1V03A 1PSCA 3RM4A 3FLUA 1FHVA 3F2CA 3ABQA 3DYPA 1R9YA 4JTHA 2HCVA 4IHCA 4I7UA 3PZ9A 5A6BD 4XBKA 4X9SA 2PLMA 4UWMA 4L4MA 4V15A 3GFZA 4JXCA 3AFBA 2R82A 1ISVA 1OX4A 4PMRA 3W25A 4MJZA 4QEEA 3N19B 4EX4A 2VVNA 3W2UA 1KFWA 1QBAA 4R3UA 1KFJA 1QDSA 4L9ZA 1XP3A 3AYTA 2PDUA 3WQPA 4O16A 4H4UA 4JHZA 3E0WA 3EF6A 3N4FA 1CENA 1HL2A 2YYUA 4JTDA 2PDHA 1EQCA 1EP2A 5BRPA 5HQEA 2CETA 4Z42C 5CC7A 3TN4A 3O05A 4FNRA 3LPFA 4JTGA 4Q7NA 3KZPA 5KZEA 4N2YA 2C13A 2DVUA 4WRHA 3SR7A 2H6RA 3G6LA 4M24A 4NNBA 1VCGA 3UGVA 4IMDA 3R1ZA 2GLKA 4URIA 4QRNA 3DHFA 3B8WA 3H22A 1HVXA 5IHSA 7REQB 3USBA 4AMAA 3OODA 3RGTA 2OQHA 3C6CA 1JQVA 1AUSL 4ZBCA 1AJZA 4YJ5A 4UOZA 2POZA 3CT2A 4B16A 1J0ZA 1VBUA 1VBGA 3BOFA 3H4GA 5IDZA 3QW4B 1KC7A 3WSUA 1AFSA 4B2DD 1KM3A 5M03A 1UD8A 1WXJA 3LV6A 3OZPA 4DI8A 1H51A 1XISA 2HRWA 1R47A 1GQNA 2XSXA 2X42A 4GCXA 3FJ6A 1TRIA 1W1VA 4MLRA 1XBZA 4WK9A 1KRMA 3ZMRA 3N18A 4J27A 1KM6A 2YDSA 3S2NA 5DF0A 2Z26A 4IP5A 3UETA 4HK7A 1GPFA 3S47A 1HJVA 1NIUA 1EJRC 3QVQA 4FIQA 2DSWA 1QPRA 3WFAA 1NARA 3L12A 1VENA 1IEWA 3CTTA 1S38A 2QCFA 4M51A 5JCKA 3NM1A 1SQ7A 3CHEA 3FXGA 3EB3A 3KP1A 2VVSA 1IV8A 4XTIA 2MUCA 2UY3A 3DFHA 3NXLA 5I3JA 2ZX9A 3RJYA 1M6IA 3CXBA 4YPJA 3WLMA 2HSAA 4UTIA 1CBGA 4AFYA 2HXTA 3VD5A 4TVWA 3G0UA 1EJVC 5D2VA 3GTHA 5LIKX 4DWDA 4AC1X 5D8ZA 1A5UA 1NH6A 3DFYA 1D8CA 5DY2A 2VWTA 3VDBA 2Z29A 2FTWA 1O60A 1B57A 2HVNA 3HQPA 3LA4A 1F4AA 3ZIZA 4MSSA 3ZVIA 2Q01A 1V02E 4R53A 3AROA 1W37A 3TZFA 3KWXA 3CWHA 2BB0A 4JDYA 4O1EA 5FJJA 3H4WA 1FHLA 2Z24A 2I57A 4YU1A 5I0DA 4B5XA 3WF2A 1OYCA 1DQXA 2IKHA 3P81A 1I0BA 1CDGA 3ABZA 1Z42A 3S2LA 4JNZA 2PGRA 1YDNA 3MUAA 3TJ4A 1PWMA 3GDMA 3MMUA 1RK6A 2Z2BA 3U2CA 3AIVA 4W88A 1PIIA 4IUGA 3B9NA 4IMAA 3G77A 3PB2A 4R9XA 3VDAA 1PKLA 1DWIM 2AL1A 1IXPA 3A4AA 4Z1DA 2QCLA 3B8UA 4IJRA 3WFZA 5HK4A 1CGXA 4AY7A 3N34A 4HU3A 3GC4A 1CB2A 3WLHA 5A95A 2D0HA 3ALFA 4U31A 3Q4DA 1W5NA 4X9YA 1TRDA 3GYCA 3ZXWA 5FJIA 2EBNA 1Z41A 2C1HA 5A94A 1UJQA 1ITCA 3SURA 1SO4A 1RUSA 1ZB5A 3B0UX 4JTCA 2DZTA 3VYLA 2BSLA 3QR3A 2C6QA 3LBCA 4C6PA 3OU8A 2IPWA 4K38A 1KTCA 1JGIA 1AMKA 2BXYA 4ZQNA 3IIZA 3CXOA 5FOOA 2GWNA 1K9DA 3TOPA 4RE2A 1C29A 1TO3A 3LRMA 1A50A 2QGYA 3ANYA 3M0JA 5AYBA 1XLHA 4LS2A 2WLYA 4AF0B 4W8AA 3GVWA 1DIKA 2R1KA 1KBLA 2CBUA 1LTDA 2BMBA 2CYGA 1UKQA 3HFTA 3OW1A 4I7VA 1POJA 2BC1A 1SJCA 1W0MA 4ENLA 1RCOB 3KCOA 5FS6A 3KVJA 4A05A 1ME9A 5HQLA 1CGYA 3K4WA 3WD1A 1LZOA 1XD0A 2VCCA 4GFSA 1THFD 3MP4A 1UWIA 4KWVA 3MBDA 2PF8A 1UROA 4Q4QA 2J7BA 4F0SA 1JYNA 3OLEA 1GEUA 3BSGA 3KX6A 1VFMA 5FA5A 4MG4A 3U48A 4B2DA 3MVIA 4WKHA 4A2RA 3MW7A 2BHZA 3UJSA 3POCA 4QJ1A 3DYOA 4LS1A 3C0LA 1SW0A 4LYRA 4Q32A 2PWFA 3APGA 2GFTA 3T9PA 4Q4RA 4P2VA 2DH3A 1GKQA 4XZLX 4E6MA 4CN4A 2C79A 2BC0A 4KS0A 3LNPA 3WMBA 5HAOA 4MB3A 1M04A 3W72A 4CKQA 1XCXA 1A49A 3MB9A 4LAKA 4PRTA 1LCOA 4IPIA 1IT8A 2YSWA 1G0CA 1SO5A 4LCRA 3GKAA 3M9YA 2Y88A 3VIOA 5M2FX 1DJNA 1UQZA 2P5NA 1YADA 4LC8A 4WSKA 4B91A 4G5DA 2G4JA 4NNAA 1SSGA 5I3FA 4IGSA 2W54A 1JCMP 2XFFA 3LADA 4GNJA 5H91A 3W6YA 1OGBA 4FX9A 1O7AA 4WLCA 1XUZA 5LGXA 3RITA 1R2TA 3E3HA 2C15A 3SSJA 3RNMA 4D71A 1SJAA 2ONEA 3JZEA 2E1WA 2ZX5A 5A6BA 2GJXA 3WK0A 4DY1A 3CBWA 3U0HA 3GRIA 2HTMA 3CMFA 2HROA 1KM1A 2YDAA 3AMDA 4JAWA 5C2GA 4S3GA 4N7QA 1EC7A 1WDSA 2YDRA 3DC8A 3S5OA 1ZRQA 1VEMA 1MUMA 3EXSA 4XB3A 1V79A 4ZTXA 3EKZA 5I3IA 1XLKA 1XC4A 2P3ZA 1Y0EA 3PULA 1ODZA 1H1NA 1QBBA 1TPH1 3OVRA 4YVPA 1UWSA 2PPGA 3CUZA 1FFQA 3EKGA 3NO3A 2VHLA 3AMZA 1XRTA 4GZ7A 4GHRA 1LYXA 2GYIA 1XYAA 3WFLA 3M1ZA 2XFYA 1FHUA 3NGFA 3QFAA 3GRTA 2E8ZA 2WQPA 1D7FA 2NQ9A 1MQQA 3O0HA 3ELFA 2DZPA 5AHEA 3VC6A 3U7VA 4MB4A 3NCOA 4E4PA 4XVEA 4HU4A 3GIQA 1UZ1A 1BVZA 4NAFA 3S5SA 4FOJA 1ITXA 1FECA 3LM7A 4P61A 3UZXA 4J56A 2WAGA 2P8CA 4M8UA 2IXVA 1MYRA 4H19A 2P0IA 3CHVA 4C6DA 3N2XA 5A6SA 2R94A 3SADA 1U33A 3YPIA 3TYDA 4FSAA 5I3HA 4BS0A 4LC6A 1ICQA 4UTWC 2Y7FA 5DCBA 3GXMA 4ECLA 1KGUA 3OG2A 3VZZA 3P74A 3UF9A 4E8GA 1HXJA 1BG4A 3IPWA 3ARVA 5LHFA 3H2AA 3QMSA 4NASA 1C91A 1VAHA 4JHOA 4UBPC 4M3PA 3WNKA 3AWOA 1ME7A 5LKYA 3KRUA 1CEOA 4FXRA 5E6YA 1VHCA 3CUXA 4IL0A 1XGZA 1G7VA 5IDIA 1W1IE 3M5VA 2QXWA 3PWIA 4M1BA 1UWUA 4H9UA 1A0CA 4YMZA 3EA2A 3W1AA 3QHOA 2G3NA 4J7RA 2MNRA 2Y5SA 3QR1A 4M6UA 1H63A 4ATDA 2FYMA 3EWUA 1W9UA 3N13A 4KEMA 8RUCA 2PTDA 1GKRA 1UIOA 1YYAA 3L2IA 3ZQ9A 4JFUA 1XR2A 4NI8A 4XZNX 4TV5A 1WA3A 2Q8ZA 3SR6B 3HPZA 4D6FA 4HD5A 4JIIX 4DELA 3M4HA 2ZBTA 1IZKA 1PDYA 2XM2A 1EBDA 2ATSA 4CVWA 1VKFA 2BNJA 3SJNA 4GABA 1V7YA 3LCIA 4M82A 3F4DA 3W1RA 2J75A 1I0DA 2J62A 3OVQA 4IPPA 4DWSA 4JFTA 1TR1A 4PTDA 3LN3A 2BHUA 3BTNA 4LUTB 2VRKA 5IXEA 5BYWA 3IACA 3UZ5A 3VO0A 1DJIA 2Z1VA 4QQ3A 4N9CA 1FWTA 4PMZA 4QDWA 3TUUA 3DZ1A 4M80A 4R85A 1XIGA 1OFPA 4C91A 4YTUA 4TIMA 4I8DA 3HGSA 2WQDA 3WD2A 5E93A 1C3FA 5AHIA 4FF5A 2WYSA 4H7CA 1WKYA 1UR1A 1IT7A 2H90A 3EDEA 1EHNA 3CZEA 4NZCA 1GQKA 2B4GA 4GFIA 1SB3B 3IRDA 1ZMCA 4GVIA 5D9PA 2X30A 2GOKA 3B9AA 2H8XA 4HSOA 4K68A 1XL9A 1NDWA 4I8YA 4JX6A 4QDMA 4KCVA 1OK6A 2VI0A 1YKWA 1VF8A 5MKGB 4AZGA 2ALRA 1TIWA 5GQBA 5AC4A 5K2ZA 3AS0A 4W7WA 4I5RA 1VFOA 5A3HA 1HKIA 1PKYA 1TELA 4AWTA 4CD4A 1XQKA 1JVNA 4RDVA 1PAMA 4H4VA 1EBGA 2IPFA 1DWHM 3QM3A 2Q8LA 1M7XA 2VGGA 3LD5A 1RBOB 3I4KA 4O14A 5DT5A 1TUFA 4A3UA 3GUGA 4PMXA 4R34A 2PC8A 3B03A 3QW3A 1SUXA 2I9UA 3EA3A 2C14A 4DJFA 4KERA 2VFDA 3D3FA 5F1UA 4Y2WA 3MZNA 1SPQA 4JTFA 4LBUA 1JUBA 1VPQA 5CG7A 3W53A 3WH6A 1DJGA 4TOQA 4GYKA 3AHTA 3O8AA 3S1UA 3QYQA 5C7HA 5MKGA 5FJOA 3A7RA 2E1DA 4NAEB 2VGIA 5IM51 5FI8A 3ZO9A 8TIMA 4O13A 3C2YA 1XM3A 1Q85A 2CZEA 4XAZA 3GRSA 5K9CA 2V3AA 3F03K 2DIKA 3N11A 2ZA3A 3WLLA 3A5FA 5JU6A 1MFUA 3B3DA 3LXBA 4DBDA 2ZXQA 1LJYA 4FX7A 2I17A 4IG2A 3RCNA 1TVNA 5E1QA 2Q09A 3TA9A 3WLNA 1TPDA 1SFTA 1TPC1 7ODCA 5I06A 1OIMA 3SQMA 2OZ8A 3WJSA 3R7MA 2QIWA 3EWZA 3H7VA 1NHPA 1A3XA 4I7WA 3N2BA 1JEHA 1MW3A 3AISA 2WNQA 1JPHA 4L7ZA 1P6CA 4MYXA 1W1YA 4WJXA 4AVOA 4BF7A 4QXIA 1CX9A 1PTAA 1MXDA 4ADTA 1E9YB 4DUOA 4C7GA 3ME3A 3TJLA 1R7AA 1RQEA 4JFWA 4P5UA 1MMFA 3UYIA 2V6OA 4B15A 2Z1SA 5AHLA 2JIWA 3WL0A 3UP8A 1XLIA 2XZ7A 1XBYA 4F3HA 4WGHA 3II4A 4S3CA 3H2OA 2FVLA 1E0WA 2PP1A 2CLFA 5LIWX 1Z69A 2HE5A 4QCFA 5FJRA 2BGNE 4GC3A 4GINA 3QQ1A 3R2GA 3RM9A 3NG3A 4RNHA 3CL8A 2ON3A 1WUEA 2VC5A 5BWFA 3QQ0A 2F2KA 1TV5A 4GX9A 3ZR4A 2DSUA 2YA0A 3PP7A 1M3UA 2OZ0A 4CD7A 1KN0A 3GVGA 1L8NA 3UJ2A 1H11A 3WENA 3U8GA 4W85A 4F79A 3LM3A 1I2NA 3TYBA 1RA0A 3DCPA 3CZ8A 2OO0A 3CGBA 4PH6A 3P3BA 3SN4A 4DYKA 2J4GA 2XWEA 5CJMA 1F76A 1FP8A 2PDIA 3EOLA 1R9ZA 1J4EA 2VYOA 3EWWA 4EP8C 1O94A 3WQWA 1P0DA 4LTSA 3VOHA 4NXSA 4APNA 3SN0A 1X96A 3C2FA 3L8KA 4UB9A 4L61A 4TX6A 1K9FA 2V2DA 3U5YA 2HWGA 2WWCA 3SRDA 5JIPA 2ZVIA 5A2BA 2QEZA 5HQMA 4HMDA 2NPXA 4X61A 2OT0A 2WCSA 3GU1A 1R2SA 3THDA 4ZOAA 4NZJA 4J28A 3HV8A 4GGBA 2QMKA 1TPVA 3GNPA 4QS6A 5DMNA 4C6NA 2UZ9A 2YGYA 1LQ0A 3M5XA 4XZIA 4UZUA 2X1UA 4UMBA 3W71A 3ZM8A 5BW6A 2ACSA 3EDJA 5DCEA 5C5YA 3V1HA 2ABBA 4Q8QA 3GHRA 2YAUA 1TVLA 3G1RA 3AHYA 4X2RA 1VJIA 4GVHA 4E0CA 4EXQA 4HBKA 1RP9A 1E6ZA 1A0DA 1EZWA 5DBTA 4KWOA 4FAMA 4J4KA 5EFDA 1K4QA 1PHQA 1DHKA 1IQ8A 3W83A 3H12A 1FHDA 3W07A 2HS8A 3M7SA 3FYPA 1E6XM 3TC6A 4OUIA 4CEUC 2DORA 5H8UA 4IXHA 3AU6A 3ZT6A 1OC7A 2WJEA 3CS2A 2Q6ZA 3OVPA 3AHVA 1WO2A 4FX8A 1LL4A 2OT1A 3MSRA 1GVFA 3RU8X 3UY7A 3R12A 2JF7A 4Y9AA 4ZO6A 4H9MA 4AWSA 2D1ZA 4R27A 4YWSA 3FHQA 1R0MA 2VEKA 1J9YA 1O1ZA 2PBGA 2ZX8A 2QUTA 1VYPX 3N3MA 4QSHA 1OK4A 3FA4A 4LUYA 1BYDA 4O8AA 2NLYA 1GORA 4DX3A 1A53A 1UKTA 5EGRA 3TSBA 2WB5A 2HV5A 2WVUA 1CIUA 4AG0A 1KA9F 3SUWA 3STFA 2X7VA 2J7FA 4HPGA 2EG7A 2LLEA 2E5BA 4DXKA 3HBLA 2V5BA 4FI4A 1H0GA 4GACA 3W7EA 5KTLA 2GL5A 3ARRA 3EPNA 4FLOA 4YTQA 1OFAA 5CC6A 4DQWA 3GXIA 3UG3A 4UIOA 1XIFA 5HANA 4PYSA 4UQDA 2A79A 1KGXA 2D22A 2CESA 2ZIDA 4F0MA 2RFGA 3AALA 1J0JA 3MSYA 2PUZA 3REQB 4HZ6A 1LUCA 3DI0A 2FB2A 4F9DA 3U9IA 1W3JA 1R7OA 2I14A 4JR5A 3UXIA 3HG3A 1H7NA 2E0PA 4UOJA 3CWOX 3PG9A 4O1AA 4ADWA 1M01A 3P8JA 1XX1A 3VIGA 3WF1A 3LTYA 3VABA 3E2VA 4HU0A 4A2SA 5A8OA 1WOBA 3H2MA 4YS1A 4HN8A 1G6CA 2V3GA 5K4XA 3E02A 2WC7A 4NZ4A 4XISA 5HWNA 4I6VA 2V68A 1TFVA 4EF8A 4TMBA 3NS1B 2QS8A 4V33A 4L80A 3CLMA 2VENA 1QFEA 2O0TA 3AC0A 1FFRA 3ZFHA 1KFKA 3HMCA 4HCLA 4ERAA 3T0BA 2EPHA 3AMKA 1KTNA 4RKAA 3BJSA 3A3XA 3MJYA 2OJPA 2JEPA 4QNWA 3N2OA 1KWGA 1ZALA 3E1F1 4DBWA 3NVWB 2ZC8A 1H7XA 2A3LA 4UMCA 4M52A 5HA7A 3AIEA 2QAPA 1MUCA 3KTSA 2YLAA 3XIMA 2EGZA 1ADOA 3LSBA 3DHUA 2XH4A 1EA9C 1CWYA 1TYTA 2R9RA 3QHMA 2DIEA 1IEVA 2QW5A 2XIMA 1JDDA 4GWEA 4TO8A 3PTQA 2HQMA 1KV8A 4PUDA 4HU8A 4DJEA 1H60A 3LYEA 1KBBA 1F8WA 3DK4A 1TPUA 1PZ0A 3AHXA 1GTEA 4UZSA 2A7RA 1R38A 2H3BA 3QC3A 1Q5MA 2NV2A 2ZRXA 4U3AA 2PODA 5C2XA 2GGGA 4TUFA 1Y65A 1AQFA 2FH6A 4LVGA 4I9MA 1K8CA 4PCFA 3T40A 4P8VA 1E71M 1EOKA 3HGOA 2E6YA 4H8VA 4G7FA 4NZ5A 1QATA 3SECA 3PTKA 1C7TA 3A22A 4KETA 2PWEA 4C5YA 5BROA 3OIXA 2GQ8A 4GIYA 3G3DA 4AZCA 1UR4A 2C19A 4J3WA 3Q6JA 5LGZA 3SUSA 2VRJA 4DLMA 3G1FA 4LAZA 4LXFA 1SZGA 2YA1A 3UERA 4TVUA 1AZ2A 1TJ2A 2JALA 1O5RA 2OQLA 3VDHA 4GQRA 4O4WA 3KDNA 1JYVA 5AVHA 3BH4A 1ZX9A 1EIBA 3B9JB 2O9PA 3MKVA 1SSDA 5TF0A 5IBXA 2OLHA 2WVVB 3UWVA 5FF3A 1MW2A 2F5ZA 2PFHA 4W4QA 2YIHA 4LB4A 4IGNA 2KAUC 2F84A 3GYEA 4MJ4A 4O0QA 2YX0A 4MTVA 4J9JA 3JW7A 3HO8A 2V5CA 3R79A 2XGIA 2ISDA 3TVAA 1E9LA 1RLDA 4NXKA 3PTMA 4CCDA 4AX7A 1ZCCA 4X3ZA 3FHAA 4IJCA 1W9PA 2D2HA 3RMJA 3HQ1A 3DN5A 5CBJA 3VOFA 4FLRA 4PR4A 1E0UA 2JQXA 3IC9A 1YTKA 1K7XA 3NOEA 5FD0A 1V8EA 1GOMA 1DE6A 2EKGA 3UU0A 2RDUA 1XIBA 1JD9A 1Y8BA 1LUCB 4CNSA 4RNJA 2AGTA 1JJKA 4GBUA 3BANA 2YYTA 1FWEC 4H4WA 4PZVA 3I3DA 4W8LA 1BWCA 4CVUA 7ENLA 3BSMA 5CSYA 3KBVA 1Z8AA 4DF0A 5F2MA 4C6BA 1W1PA 1Y7VA 5AHFA 1ZKQA 3RM8A 1ZL1A 2J7EA 4C6KA 4AU0A 1HKVA 4FA3A 5FJUA 1V3MA 2IKIA 2CLIA 4FLSA 3O06A 4BQ5A 2OGYA 1BQGA 2E5AA 3N1AA 4WDUA 4D8ZA 4P7QA 4UTLA 4UFIA 1O5XA 4WCJA 1ZAJA 3R94A 3PBVA 1Q1WA 3KUMA 2GH5A 4RCXA 3FJ4A 2P88A 3K2GA 3WLRA 3KW3A 3FGCB 2J13A 2X8CA 3CAWA 1X1OA 4OV9A 3F4WA 2J6VA 3RR4A 2R1PA 2V38A 5AHMA 1TE1A 3HTWA 1IHIA 1WXZA 4QDPA 3R8HA 5CGMA 1UZHA 3L4TA 1OGSA 3UBPC 4PC8A 2VMFA 3ZS4A 2DY3A 4XD5A 3NPWA 3N04A 4FS9A 4UTUA 4Q22A 2BOFX 2TODA 3BGAA 1EP1A 1YBQB 3L4WA 2PS2A 3EPOA 3LERA 3S1XA 2CHNA 2WOVA 3P2VA 1FEAA 2I5IA 3F4NA 4GPNA 4WSHA 2Z4GA 1KB3A 1JR1A 2HMCA 3BG5A 1Q7QA 3BARA 1UJPA 2BXVA 2VZUA 2B0MA 4Z17A 4F2UA 1KQYA 3GBDA 1L6WA 3BGGA 2GWGA 2BY0A 4GXWA 4YN5A 4NZ1A 2CBVA 2FHBA 1X97A 1UWQA 2GVLA 3K4AA 3PG8A 2B7QA 1DOSA 2Z0IA 2IS7A 4EIVA 3PUOA 1EUAA 2UY2A 3RRAA 1NOWA 4Q8UA 3P84A 1KM2A 4IFRA 5CJ5A 3R11A 3GR8A 3HGRA 3PZQA 1LOQA 2E67A 4RDWA 2CLPA 5M17A 3VNJA 3AAMA 5ECVA 3QHNA 4E2OA 3DFOA 1ZP4A 3BZGA 1Q65A 4LH8A 3GY1A 5HMFA 3GDRA 3MTWA 4GQ0A 3WK3A 1YRRA 1F3WA 4K8DA 2ZOXA 4BURA 2DW6A 5D05A 4O52A 5T91A 3TZNA 3UCCA 4H2HA 4LVFA 4RE0A 3DG7A 3D5HA 4ES4A 2CBIA 1GQJA 1GOKA 3W7OA 1DJWA 3NGJA 4ZXOA 2NVAA 1H7WA 3H7UA 1JRPA 1TR9A 3FG2P 2HEJA 2OQYA 3LMZA 4MWAD 1JIBA 4CD5A 5DMMA 5KMYA 4AIUA 3N17A 1OC5A 1JYWA 1OT1A 2VUYA 4IQJA 5D04C 4PTVA 3MC5A 2NUXA 4TMCA 3C4UA 4KFNA 4E8CA 1OQFA 3O6YX 2PE4A 1EDTA 1NU5A 4ZQMA 2OKOA 2X05A 4MNLA 4H6QA 3H4KA 3TN6A 4IIHA 3PF3A 4G1KA 2QAEA 1GHSA 3PZMA 2Y8KA 3SCSA 3I10A 3SRKA 4UTTA 2RGLA 5LSMA 2FTPA 2QZRA 3GX9A 3BCFA 4AB4A 1ZTVA 3M0LA 4LPCA 5EA9A 4EQRA 3CO8A 3DKJA 2DIJA 1GZ1A 2IKGA 2X99A 4S3JA 5JBEA 2QVHA 3GHUA 3BQ5A 2NSOA 2PCQA 1V08A 4WX2A 4WY0F 3DGBA 1H1ZA 3KBNA 3W82A 2W55A 3A3HA 4OHQA 4AD5A 3T07A 5DQPA 1OYBA 4AZCB 1G69A 3W7GA 4PUMA 4W86A 1S2CA 1X2GA 3LMYA 5BWAA 3CV2A 3FVDA 1Q4WA 1AD1A 1YW1A 5K4ZA 4BZYA 4M56A 2E9LA 3N2TA 3WF0A 4FNPA 3RN6A 3LV5A 4PTMA 1EWDA 2PU1A 3M0MA 1QXLA 2FZMA 4HHLA 3M16A 2YCJA 4Z1BA 4K7ZA 4YVVA 1HIZA 1R3QA 1NHSA 1GEHA 4QJ5B 1PKMA 3WEOA 4NZ3A 3LCGA 2FGLA 2Q71A 2VXNA 3F5JA 4M1RA 1DEDA 3UR8A 4NZFA 2NT0A 1GVEA 3IJLA 5I77A 3FS2A 4ZB2A 1DTUA 1T3QC 1QJWA 4GVGA 4HYRA 5F2IA 2ZUWA 3CZKA 4QGCA 1C8QA 2QJNA 1ESWA 3GXTA 3BZJA 2GVJA 2GGHA 2E3TA 1LP6A 2G97A 1E6PA 1OFEA 3E38A 1LLWA 4WDTA 1OEPA 4HK5A 3EAUA 1OHLA 2WNZA 1M65A 4JEJA 3NNTA 2AQVA 5LZLA 1ZK7A 1RJRA 1XYCA 3II1A 4XQ6A 4ROQA 1K7FA 3SGGA 5C70A 3ABXA 4L1XA 4S3FA 4XD3A 1K03A 4LBSA 4M6VA 1LG1A 1MRQA 2PU0A 2PF0A 3NSXA 4AWEA 3TYZA 1DXLA 4K8GA 2CFYA 3DGZA 1YNYA 1UOKA 4PCSA 2ZRUA 4S38A 3WZ0E 2G50A 1G01A 2WVTA 1GHRA 5C71A 4ATWA 2OEJA 3TW6A 3RAOA 2YKKA 3MY9A 3VNIA 3COTA 5C9UA 3DEQA 3MSDA 4H4PA 4CU7A 1DYSA 3S4TA 3DK9A 1ZUAX 4DAFA 5DMYA 2ISWA 4PUEA 3TC3A 3S6DA 4JIPA 2J78A 2DSVA 3ZJKA 3DXIA 3WH9A 2ZZ7A 1UR3M 3MUCA 4RX0A 2Y61A 1JRCA 4XZMX 1CGUA 2YOCA 4AVNA 3OQ8A 2CLKA 1KXHA 4S2CA 4I9AA 2E5CA 4QLLA 5U25A 1XGEA 2GDUA 1ZPTA 1ISZA 2IPGA 4GCAA 3UXDA 4JQ9A 4ERIA 4WY0A 6REQB 3C3NA 2Q8XA 1AODA 1L6SA 2X1RA 1F61A 1Z7AA 2RJHA 5A8GA 3N3TA 5TQLA 3KWSA 3VNMA 2HVOA 1OJTA 3WJWA 1CW2A 1AL7A 5HULA 1ECQA 4FPSA 3BGJA 2QJGA 4K8EA 4MOZA 4A29A 3EOEA 1SJBA 1STZA 1UP0A 5BOOA 3VNLA 3PSVA 3DGHA 1NELA 2X1TA 3R0DA 1QHZA 1MFVA 3B0PA 3IGUA 3C2RA 3TTSA 4JN8A 4MF4A 2WPCA 3MMDA 5D33A 3W24A 3CZLA 3ARZA 1WYGA 5A8NA 3AJ7A 3S83A 2WK2A 3B40A 1CXLA 1JDAA 4G6CA 2E5DA 1I2PA 3RNDA 4PCPA 2FB3A 3ERPA 3ITXA 1XLBA 4E3TA 7PTDA 3GK0A 3N6JA 3PS7A 4E4FA 5HOSA 2A0NA 3LGEA 3F2DA 2A7NA 1OX5A 5G2HA 5C8BB 1TTPA 2QCNA 4AZIA 2HK1A 5BU6A 3WF4A 4KWSA 3C0JA 9RUBA 1PX3A 1CGWA 3NQ8A 4H4ZA 1H5YA 1X6UA 4V28A 1VH7A 2CDUA 2O7QA 4HPXA 2HK0A 1JAKA 1Q6LA 3IVTA 4L4PA 4D9PA 3L66A 3MKKA 3UCDA 2BZNA 3HPXA 1BYAA 1VD6A 4LUIA 4EPDC 1VBHA 3CAVA 2XISA 3MANA 3OVGA 2DJLA 1PTGA 1VPYA 3KBJA 2FH8A 1D8WA 2F6KA 2ZQ0A 1BPLB 4FALA 1AG1O 3QGKC 1VZWA 2XTKA 2OGJA 3WLPA 2GK1B 1GKPA 3PBMA 1KM0A 3W23A 3CM4A 4O1FA 3LEPA 3NQ6A 1JXJA 5KSWA 1WDWA 1WP6A 1VFFA 2WHJA 1KLYA 4FK9A 4IMEA 4S1FA 1S2WA 5FL0A 3NTYA 1YPXA 4MY8A 3TTQA 1EA0A 2F6XA 3RLUA 2CKRA 3TSDA 2PAJA 3FA5A 3VM7A 2A5HA 3FN9A 4JQ3A 3UG8A 4JTEA 2BX7A 5A2AA 4X2PA 4KCWA 3RX4A 4IPJA 2Y70A 4PUWA 4CNNA 2ZX6A 2C3ZA 5D30A 3JS3A 4HHPA 3M64A 5H2ZA 1V6UA 3EEGA 2ZUTA 3V0TA 4LAUA 2YR1A 1H3GA 1MSSA 1GNXA 1XLCA 2WZEA 4QLJA 2PDNA 2V2CA 1B90A 1OCNA 1XLMA 1AW1A 1EXBA 3OG3A 5HWJA 3M0KA 4KIEA 3OPSA 4IOTA 5B7ZA 3BW2A 4IQLA 2WP6A 3MT1A 1IR1A 3G3MA 4RJEA 1MXGA 3CUIA 3B04A 3TW7A 4F66A 3QSRA 4BQ4A 4AWUA 4PSPA 2OU4A 5TIMA 3UXLA 1IWPA 4IP4A 3SRFA 4DYJA 4F0RA 4GISA 1F6PA 2QCEA 3ISIX 1F3EA 2PBOA 3PZNA 2WMJA 3O07A 4I9JA 3FOKA 2W9MA 1E3ZA 3RG6A 1UZ4A 1A4MA 3GIYA 4CN1A 2DVTA 2PGFA 3QV6A 4F0KA 4JTUA 1GRTA 5JBDA 1AK5A 3GG0A 1B3YA 1VRDA 2X1IA 3W76A 1TUXA 2PGEA 2DT1A 2EKCA 4C1NA 3M41A 3EB2A 5DY3A 1BF2A 4QAWA 1KBIA 3OQEA 5B7YA 4HHMA 1J2BA 4AZ7A 1W5MA 5C54A 1CXEA 4CNOA 2F6UA 4QM1A 2J7DA 4D1IA 1Z89A 2ALDA 2JGYA 3VDCA 2QV4A 4HB7A 4K3ZA 2FPYA 1Q6QA 2W3ZA 2PWDA 2VFFA 2C16A 3RF9A 3WDIA 3EBVA 5HNRA 3A4WA 3H4XA 1PX4A 4MNMA 8CGTA 4DJDA 1TTIA 2V81A 1W1A1 2WANA 4DBEA 4FR1A 4EQSA 2PP3A 4BA0A 1B3OA 1U1JA 1RALA 1BEUA 1JDEA 4MNKA 3HZ3A 3FKKA 3O15A 2V3BA 1TWZA 4ZOHB 1WE5A 3G1HA 4PCTA 1RCXB 3VU2A 3EDFA 3NQ2A 2EPNA 1FWIC 3WH8A 3BW4A 1RK5A 1HO4A 1S2VA 4V1YA 3BCDA 3FXYA 2BV9A 4AIOA 3GQYA 4C60A 3G8RA 3M5ZA 3MS8A 5FF7A 2ZRZA 1FWHC 3LU2A 8XIAA 4FNQA 3C2OA 1JDFA 3FA3A 3SUUA 4H00A 4JIQA 1S7MA 4MUZA 3ZWSA 3U6WA 2VOMA 3W7RA 4EXBA 5DN1A 1CLVA 2E40A 1JUEA 2ZADA 2XU2A 3T2QA 4LAMA 4X60A 1EBHA 2JGQA 3H6OA 4BI5A 4ZZ9A 2ZDRA 4O54A 1QT1A 4LQ1A 1M9HA 1R3RA 1QOQA 4REQA 2DU2A 2Y8UA 3O0KA 4UTFA 1TJ1A 5K9XA 5DRCA 4EE9A 2RUSA 2D0GA 5CLTA 3KBSA 2FPVA 3S9YA 2PDBA 3SCWA 1B0IA 1PV8A 3THAA 1GOXA 4WY0B 1GPWA 3W7PA 4P8XA 1CZ1A 1GSNA 1K8XA 3OA5A 2XIBA 1XW8A 4WVXA 1GVOA 1AVAA 1AH3A 1Q6RA 1LQ2A 1PHWA 2CKSA 5FF2A 4DM2A 2QUUA 1TB3A 3KL3A 1XIMA 3TE9A 4W9TA 1Q4NX 1QHOA 4X0NA 1YTEA 2Z6JA 2ODOA 3W7JA 3PR2A 1AQHA 3HPSA 1V77A 3STPA 3CMJA 2X8GA 2IW0A 3CGTA 3WLQA 1ODUA 1YTDA 4HIBA 5E70A 2BP1A 2PI6A 2NX9A 1TREA 1E51A 4Z1CA 1EGVA 4HQVA 2PDMA 3WYZA 1TPB1 3TNBA 3NQCA 1IGSA 5KVHA 4J3UA 4JCLA 2EHHA 1F5ZA 4W7VA 1US0A 2GJRA 3FAWA 2J8FA 3CPRA 3DUGA 3GTIA 3GE7A 3EOSA 4JYEA 3BG9A 1QPKA 4ICCX 2PWHA 3NQBA 1VCVA 1IXNA 5I03A 3LUTA 1ZJBA 4QTGA 1KBKA 4FZIA 3W01A 3W1NA 1L0PA 5EFFA 1SGJA 4GX8A 3W1XA 3S0CA 1UUMA 2OSWA 4MB1A 3U4AA 1YXYA 3FNDA 4GZJA 4PL2A 2WJDA 7CGTA 4E4UA 1B3WA 4PCNA 4JQ2A 3VM5A 5H6HA 3PK7A 4RL3A 1V7AA 4JTIA 1C93A 5FMHA 5G5GB 1JCNA 3MVTA 2REQB 3UJRA 5G4WA 5HATA 1TQJA 1FWBC 5GNYA 2O9TA 3EGJA 3F7JA 4H4SA 2IQTA 3NVVB 3NVYB 3SCPA 2EPMX 3FDKA 2DQWA 4AYGA 3ZLFA 3CL6A 4B90A 1VB9A 2FDMA 1J0HA 3M43A 1CGTA 1TV4A 1FOBA 4PGLA 1AW5A 4DF1A 3SCNA 3WK1A 4LX4A 4XVDA 1CLXA 4XAPA 1EIXA 1GT8A 4D8LA 3L21A 1FO4A 3LDVA 6REQA 2GDQA 4FX6M 4ROPA 4TTGA 3W87A 2ISVA 3L4XA 3B8DA 5FF0A 2CXGA 3DG6A 2FDSA 1XXXA 4U2ZA 3AWNA 3BK0A 3ARSA 4JKKA 3DIPA 1ICSA 3FW6A 3OO2A 1P1MA 3CGDA 8XIMA 3UWZA 1TPWA 1AQ0A 2ZTKA 4MYAA 3HB9A 3QZEA 1ALDA 3D0CA 5BMWA 4ZFMA 4XX6A 4Q8TA 4ERGA 5I2UA 3BPWA 5A6LA 1EWEA 1W3KA 3GR7A 5ECUA 3WBEA 1CNVA 2XG9A 2CW6A 4DUWA 4UMAA 4HZ8A 1NFBA 3ARUA 3UA3A 5LHEA 1JZ3A 3RLVA 5I24A 4ZB5A 3TX9A 3P0WA 1YXCA 4K36A 3OBAA 1HKKA 2OX4A 2VZSA 4EPBC 2E9MA 5CBIA 4JIEA 2FHFA 3USZA 1JROA 2CLMA 3SDOA 4O4VA 2VFIA 4QE4A 3DHPA 1CXKA 3DJGX 1AD4A 3SGUA 1OC6A 4N4PA 1VJZA 1QR7A 4RE4A 4TXEA 4LAOA 3T55A 4XAYA 3B4UA 1BF6A 2EQ9A 2GSHA 3Q37A 3E6EA 1W31A 2BDQA 4GIRA 3VD3A 1D7YA 5GJPA 3AJXA 3IV8A 3MSGA 3NPUA 3WEZA 2VC6A 2GUUA 4JQ4A 3BV4A 4DXVA 4LALA 3TSMA 5DELA 2VEIA 2AAQA 5CXPA 3W7MA 2EXOA 1WBHA 2BODX 2FZ8A 1YDYA 4GY0A 2J7GA 2YW4A 1F6YA 1DWFM 3EMQA 1ZY8A 1GW1A 1UH3A 2OZTA 4N6FA 2PDPA 3TONA 5K3VA 1K8YA 4CQ8A 2EG6A 1DXFA 1W32A 3NFUA 2YQUA 4QIUA 1X1ZA 2ZWYA 4K6AA 1BKHA 3E74A 3W00A 1GOIA 4A35A 1GYMA 5XINA 3IAPA 1UKPA 4P7LA 3VCRA 1HUVA 3I4EA 2CBJA 2IQ0A 3W81A 1F73A 5XIMA 5EKYA 1H4PA 4LEFA 3WJZA 4PMOA 3FEMA 2ACQA 3GXDA 1XYBA 4MMWA 3S1GA 2YCLB 4W7UA 1CTNA 2WOIA 3ZT5A 3VCCA 3VGFA 1S5TA 2D24A 1MNSA 2YXGA 1GRGA 3TWAA 2QV5A 1W3IA 4E2DA 4Q6JA 5CG0A 1XPGA 3URAA 4XD4A 3TTYA 3V75A 2H9AA 1NAL1 1OT2A 3KS5A 4ZSTA 4MJ2A 4HCHA 4W5ZA 3T2OA 5AC6A 1G4EA 3L7RA 5BNKA 4AEFA 1M6JA 5D8WA 4ZO8A 2AMXA 5I3KA 2PDCA 2VZOA 2I5QA 1BYBA 1CT5A 2GVGA 2VM8A 4MUPA 5HNUA 2PTXA 3DFNA 3H24A 4UOQA 3DJJA 4H9YA 2GGIA 4HPJA 4S3EA 4QQUA 2C3DA 2WZHA 3QZAA 4LUSB 2YCKX 5D03A 4QFUA 1UP3A 2EAWA 2R1NA 1JYXA 3I3BA 4QS5A 3FDGA 4PUJA 4J3XA 2INEA 1F07A 4XK2A 1GZGA 1TQXA 3CGEA 4ICNA 1TYPA 3CAKA 4P7OA 3P0XA 4P8WA 4NHVA 2HBVA 2WLZA 4GXMA 2D2JA 2D2GA 2E28A 1TZ7A 3UD6A 2ZZ3A 1H1YA 4OOUA 2O55A 4H50A 5AYIA 3RPTA 1RV8A 1O1HA 3MDWA 3LNMA 1UKSA 4US5D 4ZE4A 5C7VA 4P8UA 1J79A 5FESA 2PDKA 1CI1A 5CGQA 5EBUA 2W3RA 2P50A 4C90A 1GYNA 3TROA 5BMXA 1AQMA 5EYWA 1XINA 3HJEA 3QR0A 2VR5A 2QCDB 4DPQA 2P0OA 5HDRA 1TCDA 4ADUA 2QJIA 1F4HA 4TX8A 4PMQA 1EYWA 3WQCA 3HMJG 2FGBA 4JEQA 4D2JA 3G6MA 3M0YA 4EOUA 1SFSA 4XBSA 1F3PA 1ICPA 5HNNA 5D37A 5G4HC 2OLSA 4PTWA 4FOUA 1TG7A 3CYJA 1IGWA 3A3WA 3WL1A 1QNVA 2VURA 1M53A 2OTDA 2CITA 3QV8A 4AEEA 3TP4A 5XIAA 3SUTA 3V5CA 3N6HA 4AIEA 4J2MA 4QEHA 1KM4A 3UVIA 3VGDA 1UMYA 1V6TA 3K4DA 2IQDA 2R8WA 1VPXA 1ENUA 4AVFA 4U2YA 1GRFA 4F0HA 3V5OA 3PPCA 4JTKA 3PWAA 2BVDA 1A5MC 4GUIA 3E9AA 2A3EA 3QY8A 3FY1A 1ZNNA 1U83A 2PD5A 3GD3A 1KKOA 3CGCA 4M19A 5HR7A 4OUEA 1KXQA 3G5EA 3LTSA 5A8MA 1O68A 2W91A 4E5TA 2UY4A 4IGMA 5E09A 1Q1RA 1RLCL 2DUZA 2QF7A 4H04A 4KWUA 4JZ5A 2AKMA 1R2RA 4IP7A 3WBAA 2BTMA 5C0QA 3CUGA 2W67A 3MO4A 4IX2A 4O28A 2A21A 3E0FA 3B9OA 4HN4A 4KMQA 1TJPA 1EJSC 1TV3A 1XH1A 2CZVA 1WX0A 2HPIA 3MCNA 1REQB 1KFEA 3CV1A 3H54A 3TJXA 4QJ3B 4YXGA 3B0YA 2XVLA 5FIPA 1Q3NA 4N6EA 4GYPC 3QFWA 4NI3A 1GERA 3UWEA 4B9ZA 3R13A 1E9ZB 2ICSA 1XHGA 1N8WA 4JN7A 1QWKA 3LRKA 2VUNA 1EYEA 4KPRA 3MPGA 4NYYA 1UA3A 1JOAA 1U22A 3RR1A 4RDZA 1VBJA 3W7KA 1EJWC 3IAQA 3OGSA 4HZ7A 2DP3A 2PLKA 2VEPA 4FEZA 2ZKMX 2D2OA 4UQAA 1UB3A 3G1AA 3F5LA 3VKDA 3RLHA 1KCXA 2Z1BA 1DBTA 4K1GA 3BMXA 3FGCA 1S2TA 3QY7A 1RD5A 4GUHA 2V67A 3UG4A 4GI6A 3P60A 4OWGA 2C91A 1UG6A 2WWDA 3O7UA 1W9BM 4HVXA 6XIMA 3K13A 2DV0A 2V5LA 1SZRA 3QN3A 4D6GA 4MB5A 1H49A 1LPFA 3DG3A 1ADSA 5E9XA 4GY1A 1KRAC 4IQEA 3U3HA 2J8GA 3AXHA 1Q8AA 4YNGA 3UY8A 4RNIA 4GH3A 3BC9A 5ABEA 1JZ4A 2PWUA 2W79A 1U30A 2W0HA 5T26A 2ISFA 1DQUA 3LGGA 5TNVA 3QLDA 3PWGA 1BVWA 4MAVA 2IKJA 1XIJA 4E38A 1TMQA 2OSXA 1QASA 4G2DA 3NVDA 1E15A 4MJMA 4H4RA 4QAIA 4CQAA 4GXPA 5KITA 1GETA 3W38A 1EZ2A 3CUHA 3OLGA 3QRHA 1O5QA 1XDIA 1MUWA 5U1OA 1IWAA 1DP0A 1E55A 3EX1A 3T2PA 3MWCA 3MP5A 3JRKA 3WO8A 1YPFA 4NF7A 2Y7DA 4ZQPA 4Y90A 1Y5XA 4U3CA 3W6LA 1VFLA 2HXUA 4B9YA 4UC5A 1B54A 1JG9A 4KH2A 3ZT7A 1JPIA 3T8QA 4DHGA 3F2BA 3SI9A 1LT8A 3THUA 4WD0A 1B9ZA 1EO7A 3NDZA 3W7IA 3M0IA 4KWWA 3NDOA 5FAGA 3P7YA 3CT7A 3KZSA 1E73M 1QI3A 2GSEA 2FZDA 1JQXA 1TPFA 2UV8G 1N8IA 1RVGA 4KPLA 5AB3A 1QPOA 4C6OA 1A5SA 4EAYA 4AYSA 3E5BA 4JTQA 5J5DA 5TD4A 2PGWA 1ZAHA 5JH2A 1LRNA 2BGQA 3EMZA 4HNOA 3EWCA 2G95A 1XGDA 4RXGA 2RKXA 3EB4A 3HM7A 3VKAA 4GYFA 1ZLPA 1JCJA 3EUB3 3OEXA 1HTIA 3PNZA 3QOKA 2WSKA 5EB8A 2Y5JA 2FGZA 1A3WA 4N4QA 2BCPA 1DIDA 1UUOA 1A47A 3CUFA 2CPUA 1IYXA 5T8GA 2RDTA 2WMHA 2XHYA 3NWRA 1R46A 4JICA 1XYZA 2W6RA 2JFEX 4DLFA 4BV6A 3T1GA 2G41A 1RQHA 1N2VA 1NQ6A 3F4VA 4WR3A 1JD7A 1ONWA 2W63A 1CPUA 4DXXA 3WG6A 1XIDA 2VZTA 3DBNA 4PEKA 4GVFA 3GHSA 3HJZA 1QI2A 4G8TA 1ZJHA 4OT7A 3SY8A 5JCIA 3NZGA 1EDQA 1FH7A 1HNYA 3VGEA 3APTA 4ZENA 3L4VA 1DWGM 1EUNA 1NFPA 1BXCA 5CZSA 2OLAA 1JL8A 3ARWA 4RW3A 3NYDA 4KRZA 2CNCA 3LGDA 1DVJA 4HT3A 4O18A 1A5OC 1UD2A 3EWDA 2V2HA 1XC6A 3QSTA 3SCOA 1A5BA 3M6DA 1TJ0A 3GIPA 2QULA 4MKVA 3WLKX 4HGXA 5A6AA 2ZUSA 3UESA 3PTDA 3L2LA 4RV3A 1H50A 5GNXA 1R5YA 4UXDA 2E68A 5FEWA 1PUDA 2PRHA 1EJXC 2TMDA 2GR0A 1ME8A 3TLLA 5C55A 1B3XA 5BU9A 4UTHA 3IIPA 1U1UA 4XAFA 2WMIA 1OCQA 1MI3A 1CYGA 2WMGA 2A8XA 4JTSA 1KFLA 2YPIA 3PZUA 4C6EA 3OHMB 5A6MA 2Z00A 3HPFA 1EGMA 4H4XA 1RY0A 2QT3A 1XLGA 4Q6XA 1FIQB 3L4UA 3MUY1 4DZ5A 1I8JA 4AZBA 1GVIA 1VDVA 2FFIA 3P93A 4OECA 1FWGC 3K8MA 1IEQA 3JU2A 1XKYA 3C5QA 2WC3A 5JUVA 1OIFA 1RBAA 3TYEA 4JFVA 1XLFA 4G1NA 3Q2DA 1CCWB 3SEPA 3GFYA 2W61A 2TYSA 3IUIA 4ICMA 1DL3A 5DT7A 4IXXA 3SO7A 5KETA 3L9CA 2AL2B 3BE7A 5L9FA 4NRSA 4DZAA 3LHYA 3QBUA 2VT0A 5CPTA 2GR3A 1YX1A 1FCBA 1FWNA 1UC5A 1BG9A 4LF1A 3PB0A 1J18A 2BWGA 4D6CA 4AZ6A 2F38A 4AD0A 3NYZA 3J7HA 4LWWA 4H2CA 5CPMA 4H3DA 2VNCA 5CPNA 2B7OA 1DIEA 4XG1A 4B92A 2PTWA 3RJXA 2ZUVA 2TPSA 2VKZG 1PX8A 1QI5A 4S3AA 2MANA 3WMSA 1TWSA 2ZA1A 2PTZA 1YMYA 3W70A 4O15A 2OWWA 3WQ4A 5JH1A 3BLKA 2FQIA 2YXXA 2XFWA 2GGJA 5KINA 5HMDA 1TA3A 4TU1A 1RY8A 3WUEA 1GJUA 3DOPA 3W1MA 3OTRA 1H2JA 4JOMA 1BWLA 1E1CA 1Z44A 3MU7A 4PE8A 2EJAA 4GRSA 4NT0A 4BF5A 1AZ1A 5D9OA 1N8FA 3W2NA 1XQLA 4NVTA 4S23A 3I65A 4HK6A 3FKRA 1DKWA 3L0GA 3V36A 4S2BA 1GVSA 1HG3A 2ZXAA 3Q94A 1KXVA 4LRSA 2Y2WA 2GRTA 1VEPA 3WQ6A 3AMGA 5A6KA 3OIHA 3ONCA 1BHGA 2OELA 3R10A 4XIMA 1ZCOA 4AUBA 3GNXA 2IMRA 3ZZ1A 1PKNA 3DENA 2CEQA 3CQIA 3GO2A 3DGRA 3MZ2A 3T08A 1DIOA 4UTMA 1NF7A 1P5BA 2FMOA 2PDWA 3PUEA 4MWAB 2DDXA 5DBUA 4IT1A 4DJED 3KE0A 3VKKA 1RXOB 4IFOA 4RW5A 4H8NA 4JN6A 1IXOA 2EF9A 2B7NA 3C61A 1XFBA 3MI2A 5LA2A 3WLSA 3V3WA 2Q02A 3LSCA 5AC8A 6CGTA 1S3HA 3H2FA 1TZZA 3WBYA 3A7AA 1NDZA 3W9ZA 2X0SA 2J24A 3BLFA 2O4MA 3UR2A 3KS6A 3TOYA 2UBPC 4YL2A 1LOLA 1YNQA 3VOGA 1L2QA 4A8IA 1FFVC 2I7GA 2W0UA 1F3TA 1JZ8A 4UTJA 1RP8A 3TYUA 4X0VA 1W8GA 4AD2A 3VNZA 4MKNA 3C56A 1E4IA 3RO6A 2A3AA 1GVRA 4D6HA 3VIPA 4CD8A 1UR9A 3G8EA 4CNTA 1XI3A 3PJUA 4G9PA 3ITOA 3UYCA 1TMHA 4B5UA 1U2YA 3P62A 3R6IA 2PA6A 2OWCA 1J5SA 3BLDA 1OBAA 3A12A 3NQAA 4AXNA 3P5ZA 4HNVA 1YDOA 3PC0A 1Y5VA 5I79A 3C2EA 3HIJA 4Q8WA 5HWMA 1D9EA 4W5UA 5G5IA 3N29A 4R9OA 3CH0A 1EDGA 2ZVRA 1PYFA 3ITLA 3EA1A 1WNOA 5CSSA 5ENLA 1FKWA 1QNOA 2Y85A 1K77A 2VD8A 1OG0A 2Y7GA 5I6SA 5KEZA 1G9HA 3TXZA 2E4TA 2NX1A 5A69A 4CUCA 3GWQA 3UXAA 2YB4A 3TQVA 1B9BA 3MJMA 2A2IA 4DNHA 3ES7A 4IPNB 4IZGA 3WBWA 4J5NA 4O10A 3W26A 4GI9A 4IFKA 3M0XA 1RJQA 2W27A 3MWAA 2X8RA 1YQZA 4RR4A 3PAJA 3VMPA 3Q58A 3QZ6A 5U7SA 3VFLA 1YLVA 4IH3A 4UNIA 1TYGA 4LT9A 4NKCA 4GIAA 4IG2B 4PSRA 1V02A 1H41A 2Y5EA 4LS0A 2X1SA 5A8PA 1JFXA 4UTTC 1XIIA 1XJBA 1AA1B 4J3TA 5BXTA 5EMUA 4HTBA 3EWYA 1XH2A 4ASTA 4UNLA 4JYFA 3H2NA 4IL2A 2VR4A 3NZ1A 3OOQA 4ZODA 2HISA 1W3LA 1UH4A 3A9IA 3OZOA 4R5EA 4QROA 4U10A 1GRHA 2GOUA 2EO7A 1OSEA 1FA2A 2EPOA 4IFKB 5CZTA 3WD0A 4HTYA 5FF4A 4EM4A 3BAKA 1JUKA 1ZFJA 4JTTA 3M5YA 1C8VA 3TFXA 3KCJA 3FEQA 4DO4A 3T09A 1W3NA 5BXPA 3QPEA 5HPCA 2FHCA 1H09A 3K5XA 1EXPA 1XWYA 1E6NA 3BV7A 1FWRA 1NP0A 3BURA 2A85A 3L68A 2WJZA 3CB3A 4KQNA 4ZOCA 2HPMA 5FAJA 1PZ1A 1V6XA 2ZCGA 3CEUA 3QFEA 3VINA 1GRBA 1ISYA 2V9DA 1R87A 4XAGA 1EOMA 3NA8A 7TIMA 1HKJA 1E5NA 1D3GA 1FQ0A 4J40A 3TYAA 1EC9A 1ZJIA 1P6WA 3K30A 1ADDA 3WKZA 1IIHA 2WXDM 4NJIA 4MADA 3UXKA 1C8XA 2X0YA 3VNDA 3EZ4A 3ICJA 4XZWA 3IUHA 3EOOA 4Z1AA 3W7NA 1X1NA 3C0QA 4XZ9A 3EXRA 3ITTA 2C71A 4NEWA 3VX1A 2INFA 5AYYA 1KW1A 1J5TA 3TAOA 3C52A 1VBRA 4BFAA 2CLHA 4EWJA 3S46A 3CNYA 1NDAA 1UPPA 2NT1A 3NO5A 1OFDA 3LENA 3M46A 1SYTA 3IIOA 3SW6A 4I9TA 1VLWA 1KNWA 1T6MA 1YBQA 1O66A 4MFEA 5HR6A 4W93A 1UH2A 1VEOA 1BZLA 1BXNA 4F9JA 3NL3A 1JZ2A 1JRBA 1ZGDA 4C6CA 1W91A 4GI4A 3TQPA 4K7YA 1F7BA 3FJNA 3HURA 3BVJA 1R3TA 2C18A 4F4RA 3LQGA 3TW9A 2ABAA 4XSMA 1W8SA 2DT2A 1YE4A 4O1DA 4XO6A 3MUZ1 1N63C 3F1QA 3T4CA 2A6LA 3MUXA 2HS6A 3NZQA 4H83A 2CZFA 5RUBA 3SM0A 2Q3RA 3WNNA 4DNMA 4EAMA 4CGTA 5MHBA 3IJIA 3V0SA 3CK5A 3UA4A 3PG6A 4DUXA 1M7OA 2ZE0A 3QLLA 1ZY9A 2GQ3A 1V3IA 1X6NA 4QJ4B 3V18A 5BZAA 1BWKA 5EY5A 3W29A 5FKYA 2Y1HA 3UVAA 2PSNA 4NIRA 2WHKA 1XKJA 1RVKA 5DFAA 4K2SA 3P8IA 1WUFA 4H8HA 1ZXIC 2KX9A 3AS1A 3ABOA 2VTFA 4O1BA 3VGHA 2QCDA 4IX0A 4NJKA 4XWUA 3THCA 2JK6A 5D9NA 1DJQA 1NM9A 1DHPA 5LA1A 3IV3A 2XVGA 4DB7A 2G37A 2PD9A 3WQOA 1J6PA 1E0XA 2J66A 4WOZA 3G18A 3ARXA 4JIHA 2NQJA 4RE3A 1LWIA 2RDXA 4FXSA 2Z25A 1DJZA 1DJYA 3ES8A 5JIWA 4LY8A 3H55A 3CQKA 4R7JA 3AZSA 3WBXA 4QNEA 4QG8A 3REQA 3AIWA 1TV2A 3CQ0A 3A64A 4Q4MA 4MZYA 2AAMA 4W84A 4LOCA 1QI4A 4K37A 4H01A 3POHA 2VO5A 3R8GA 3GTNA 3SQPA 2DQXA 1EO5A 1EB3A 2ZZBA 1EX5A 4F40A 4PBGA 4KW2A 1SJDA 1J11A 4A3YA 5FL1A 4XKYA 3GW3A 2V5DA 3R43A 1JFHA 2DVXA 3KL0A 4A8RA 5HXMA 4DBUA 3E2QA 5FSEC 3P14A 5I00A 2XH7A 1BSLA 1XBXA 3WDQA 4DJDC 4LVAA 4AIBA 1GJPA 1TV8A 1HGYA 4DRSA 2D20A 4Q8MA 5H1WA 1WKEA 4Y9NA 2PDJA 2QCHA 2OYKA 3NR0A 3NURA 3PBGA 1UASA 4HA3A 1L9WA 5BXSA 4U5IA 1QW7A 1IEIA 4HYVA 2HE8A 3MHFA 4HJWA 3N6QA 4EACA 3W22A 3V1PA 3QMTA 2DW7A 3WN6A 1V5XA 3ZR6A 1OG6A 2O9OA 3VOCA 3CYVA 5DANA 4GR1A 4TV6A 1J0KA 5E0KA 2BOEX 2ZXBA 5F4XA 4IISA 2W5FA 5AHNA 2EQ8A 2Z1WA 1TTJA 2HNEA 4MWAA 3QEZA 1K1DA 3WLJA 3TTEA 1IT0A 3MCOA 3S42A 1EC8A 5BOFA 1KXTA 3W27A 3B8IA 1J6OA 3PANA 4RZBA 1J12A 1TSIA 2WC4A 3W1PA 2C7FA 1I2QA 1O6IA 1EHAA 2XWDA 3S2JA 1PCWA 4AY8A 1W5QA 1JPDX 2JKAA 2XZ9A 4GMEA 4M29A 3PPGA 4GD0A 1WBJA 3RLGA 4LYPA 1IF2A 2TPRA 2AKZA 3TMLA 1XLEA 1GCYA 1RQBA 2XN2A 3PZOA 3PZGA 1CB7B 1PZ3A 3QYSA 3TCEA 4MNJA 4C6IA 2G96A 3MA8A 4BI7A 1XD1A 2PDXA 3KFTA 1KBJA 4F48A 3AHZA 1UD6A 2E6AA 1WKFA 3AMLA 3VIJA 1XRFA 2P76A 4H7VA 3KBWA 4UFJA 2WJFA 3FSTA 1MO0A 3PZTA 4M0XA 5BOEA 4KBXA 4PMVA 3CPGA 4RK8A 2R9ZA 1R30A 2NXGA 3UEQA 3W2LA 1QNQA 2PRMA 2QKFA 1V3LA 4U28A 4K8HA 3ZVHB 1I1WA 1KRCC 1KWKA 3K8KA 4BR1A 3MCMA 3JVAA 1SR9A 1F2JA 3W7QA 3GAYA 5C9RA 5FSDC 4B5SA 3EAOA 2VFHA 2OKTA 2GJLA 1WDPA 2WMIB 1RAKA 4EWND 1PBGA 1G4PA 1OZQA 4IJBA 1K70A 1PPIA 3APYA 5IFPA 4L1WA 1NEYA 3UZYA 3A4XA 4JTRA 4H6EA 5CZJA 1ZMDA 1P0NA 5EU9A 1GVQA 1E1CB 3CV7A 3KP0A 2PLCA 1RD6A 3ZOAA 1MXSA 1IR2A 3QGVA 4JIRA 3CJPA 5SWUA 5HPOA 1AH4A 4Z2JA 4HA1A 1QOXA 5EMJA 3ATZA 4GE8A 4H8UA 2ZZ0A 1P0EA 2EQDA 2X50A 2XVKA 1ZAIA 4JNYA 2VWSA 1M1BA 1HF6A 3VFCA 3IVSA 4Q33A 2FZ9A 2ZE3A 3NZRA 3IGSA 5LXEA 3PBYA 3WLOA 2WSRA 3GZ3A 2FIQA 4EPKA 3DH7A 9XIAA 1X8CA 2WHLA 4EQWA 2CZ5A 2G3MA 5I23A 1B1YA 3UGRA 3N14A 4I5XA 7A3HA 1RR2A 3HU7A 3UJEA 3CQHA 3W74A 2XVPA 2PTYA 3OYZA 2X7WA 4GKTA 1D2KA 4E2VA