3TJIA

Crystal structure of an enolase from enterobacter sp. 638 (efi target efi-501662) with bound mg
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
399
structure length
399
Chain Sequence
MTPVIIKNIECFITRPDRHNLVTVRVTTEQGITGHGCATFQQRPLAVKTLVDEYLQPLMIGRDANNIEDLWQMMNVNAYWRNGPLMNNAISGVDMALWDIKGQLAGMPLYQLFGGKSRDAIPAYSHASGETLEALFASVDALIAQGYRHIRCQLGFYGGTPSALHAPDNPTPGAWFDQQEYMSNTVEMFHALREKYGWKLHILHDVHERLFPQQAVQLAKQLEPFQPYFIEDILPPQQSAWLEQVRQQSCVPLALGELFNNPAEWHDLIVNRRIDFIRCHVSQIGGITPALKLAHLCQAFGVRLAWHGPGDMTPIGVAVNTHLNIHLHNAAIQEFIPRSATTNDVFPGAPEVKEGFVYPPVQPGIGVGFNEALALAHPVLYRPHEWTQSRLPDGTIHTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an enolase from enterobacter sp. 638 (efi target efi-501662) with boung mg
rcsb
source organism Enterobacter sp. 638
molecule tags Lyase
molecule keywords Mandelate racemase/muconate lactonizing enzyme, N-terminal d
total genus 140
structure length 399
sequence length 399
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3tjiA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3tjiA01
4IHCA 3D46A 3T8QA 3PFRA 4H83A 4A35A 3TCSA 2GGEA 3I4KA 3V5CA 2XH0A 2I5QA 4YWSA 3FYYA 3SN1A 1MNSA 2PGWA 4E8GA 2GDQA 2QQ6A 3FV9A 1XS2A 2PCEA 2GGGA 2AL2A 1KD0A 5ENLA 2OX4A 3QKEA 4GIRA 3NZGA 4G7FA 3QLDA 3UXLA 1JPMA 1MUCA 3T4WA 3IJIA 3ZLFA 4FP1A 3VC6A 3CYJA 3U9IA 1PDZA 3UCCA 3TWBA 3CT2A 3DG3A 2OKTA 3H7VA 1KKOA 3QPEA 3ZLGA 3EKGA 1XPYA 4HNLA 3DGBA 3SBFA 1SJDA 2PTZA 4GFIA 3UXKA 2QJJA 4DXKA 4IL2A 3BOXA 4HCLA 4GISA 4MKSA 2OFJA 1YEYA 3DERA 4HNCA 3N6JA 3NFUA 3BSMA 4Z17A 3R11A 2OZ8A 4J1OA 3JVAA 2QGYA 3MY9A 3CB3A 3R25A 2ZADA 2FYMA 3MSYA 3RO6A 4JN8A 3B97A 3GO2A 3TOYA 7ENLA 4DX3A 4E4UA 4IZGA 5BOFA 3OP2A 1EC8A 4HCHA 3VA8A 3TW9A 3V4BA 1JDFA 4M6UA 2DW6A 4DHGA 3RGTA 3RCYA 4IP4A 3OZYA 3THUA 4E6MA 1TZZA 2CHRA 2PODA 3I6EA 1KKRA 5BOEA 2GL5A 2OO6A 2HNEA 3TJ4A 4A6GA 3GC2A 2GSHA 2O56A 3GD6A 3SQSA 1TE6A 1R0MA 2QDEA 4ZA0A 1BKHA 2PGEA 1TKKA 3P0WA 4F4RA 4K8GA 2P88A 3SN0A 3PWIA 2HXTA 2PP3A 1FHUA 3ZLHA 2QJNA 2MUCA 3DIPA 2RDXA 1NELA 4EWJA 4GGBA 4GMEA 1P48A 3H12A 5EU9A 1F9CA 3FJ4A 4H2HA 3N4FA 3P93A 4KPLA 5FJUA 1EBGA 3ENLA 3CK5A 2PU1A 3DEQA 3GY1A 1KCZA 3IJLA 3H70A 4JHMA 3CXOA 1JPDX 4X2PA 3UCDA 2OLAA 1RVKA 3QN3A 4K1WA 1EC9A 2QJMA 2GGHA 2PTYA 1EC7A 3DESA 3DG6A 4MMWA 2XSXA 4MGGA 3V5FA 1R6WA 1L8PA 3ZVHB 4E4FA 3TWAA 5FJPA 3TJIA 4DN1A 3Q45A 3RR1A 3T9PA 3SN4A 3OZMA 2MNRA 3T6CA 1WUEA 3HPFA 3R0KA 6ENLA 5FJRA 3DDMA 4HYRA 4KEMA 2POZA 2OZTA 3U4FA 4H19A 2PSNA 3P3BA 1P43A 2DW7A 4IT1A 4IL0A 1EBHA 1MDLA 4DWDA 2QDDA 2ONEA 3ZVHA 2OZ3A 2P0IA 4A3RA 3VCCA 1JCTA 3RRAA 4H1ZA 3MUCA 4GGHA 2P3ZA 2QVHA 3N4EA 3EEZA 3UJRA 3MWCA 2P8CA 1SJCA 3IK4A 3SJNA 2P8BA 5FJOA 3CAWA 3R0UA 1SJBA 4JN7A 4ENLA 4DYEA 1MDRA 3PK7A 3VDGA 3UJEA 2XH7A 3MKCA 3OPSA 3K1GA 2AL2B 2PTWA 4ZCWA 3RITA 4HPNA 3FXGA 4M0XA 4J3ZA 1E9IA 2PMQA 3UJ2A 1IYXA 3R1ZA 2OQHA 2PTXA 3TTEA 4G8TA 4K2SA 1WUFA 3QTPA 2PP1A 4KT2A 3H8AA 2PP0A 2AL1A 3DFYA 2NQLA 2ZC8A 3UJSA 2XH2A 1W6TA 3JZUA 3V3WA 4ROPA 2PPGA 2XGZA 3ES7A 4IP5A 3MQTA 3OW1A 5IDZA 3FVDA 3VC5A 1PDYA 2HZGA 1FHVA 2PS2A 4Z1YA 2AKZA 3DG7A 3UGVA 3UJFA 3SSZA 2GGJA 3IJQA 3ZVIA 1BQGA 4GYPC 4E5TA 2XH4A 3FCPA 3S5SA 3NO1A 3BJSA 3ES8A 2GGIA 2FKPA 1ELSA 3PWGA 4HN8A 1OEPA 2PA6A 3VCNA 3VFCA 2OQYA 2OVLA 3R10A 4KWSA 5J04A 1DTNA 2PU0A 3D47A 3I6TA 3NXLA 3TQPA 3OTRA 3Q4DA 2OG9A 1NU5A 3STPA 2AKMA 3MZNA 1ONEA 3S47A 1ECQA 2HXUA 4HCDA 3DFHA 3JW7A 1SJAA 2OPJA 3KUMA 4GYPA 4FI4A 1MRAA 3N6HA 5FJTA
chains in the Genus database with same CATH superfamily
1ZCCA 4BI5A 3O15A 5FJIA 3AS2A 4C6DA 3GVQA 4F0SA 3PBVA 2GVYA 2FPVA 4DUWA 1MNSA 1RP8A 2GSJA 3WENA 3BLLA 2ZC1A 1UWRA 2DY3A 2J78A 4EXQA 2VWSA 4G7EB 1GVFA 3WSUA 3AXIA 4XD5A 3VIJA 3CZ8A 3U3HA 2YBVA 3NURA 4AFYA 4GBDA 2RAGA 4JHOA 3M1ZA 4W5ZA 4CU7A 3LI0A 3VIHA 1J0ZA 4QG6A 1EX5A 1NWTA 4Y9AA 3H7VA 3CHEA 1W32A 5CPMA 1KKOA 2PDGA 1XBXA 1XCXA 3R7MA 1XD0A 3A13A 1EBDA 1F5ZA 3PSWA 1LUCA 4UR7A 5HULA 2WXDM 3OEXA 4AY8A 3DYMA 5CJ5A 4IMGA 1OB0A 3SCSA 5HJYA 1VYSX 5C5YA 4CD4A 4JQ9A 4YPJA 2YR1A 2XUCA 1DQXA 4E4PA 3NEVA 3N6JA 2VUNA 4CNPA 3WD1A 4K37A 2FDMA 4XBJA 4ZSTA 1L0PA 1HNYA 2OELA 3KVLA 3ZIZA 3EMQA 3JVAA 3HJEA 1AUSL 4A3HA 1QI2A 1Z44A 3R25A 3UWVA 3V7PA 1DWFM 1CGXA 3WNMA 3W2JA 3H2AA 4AEEA 5C8BB 3TOYA 1DWHM 3GM8A 1KWGA 4LEQA 2G97A 3KS5A 1BYBA 4XUYA 4A2SA 1LORA 3FA3A 1CXEA 3SUWA 3P8JA 4DHGA 1NHSA 1GCYA 4MLRA 4ZXLA 4M7TA 4U10A 5CC6A 5G1MA 1D3HA 5D04C 5RUBA 3GD3A 1TZ7A 3E2VA 3QGVA 4JNZA 4EK7A 3RJXA 2BWGA 3TAKA 1FA2A 1GRBA 2YVGA 1QR7A 1JRCA 4EF8A 1AODA 3CGCA 2A3AA 2Z6IA 2X8GA 1MEIA 4D71A 3HGJA 3FEQA 4M3PA 5AHNA 1M65A 4WGXA 1IXNA 4O13A 4LB3A 5FF4A 2CC0A 3NRZB 2WNZA 4XAZA 1WPCA 3H7UA 2C6QA 1OT1A 3OHIA 4UTJA 1VFUA 4JIRA 5H8MA 2WLZA 2YCJA 1TUXA 3BANA 4AMAA 4UUIA 1K7EA 5KMYA 4JTCA 1EXPA 1UZDA 1AD1A 1KM4A 3N9SA 3ITYA 1J79A 1J5TA 2QF8A 3URAA 3UFYA 1EIXA 4M7SA 3KOFA 2WLYA 3LHZA 4N4PA 2ANUA 1F8MA 3AXKA 4FLSA 1WKDA 3H55A 5EFDA 3SCPA 5HOSA 3ARQA 2GRTA 3LBOA 4TUFA 1EC7A 2R9RA 5TQLA 1Q3NA 1Q63A 2WJZA 4RW3A 4R7OA 3QC0A 3FHAA 5FL1A 3WEZA 2JF6A 3SN4A 4TVWA 3K4DA 1H2JA 1PTDA 1ZFJA 4A8IA 2ALRA 5HMDA 2F2KA 1R87A 4RZ5A 1M1BA 2WNWA 2FHBA 1A4LA 1ME9A 3DHUA 4C6PA 3NZ1A 1AW2A 3LERA 1OG6A 4OVXA 1BWLA 3S42A 5GNZA 2ACQA 2E3ZA 1FWJC 5HJXA 3F4WA 2WV8A 4IH3A 4A3RA 3UXIA 2OYLA 4LJ3A 1RD5A 1YBQB 5LHFA 3TTSA 4Q22A 5H91A 3QEZA 4G7EA 2BOEX 2P3ZA 2UWFA 4AD2A 3H4WA 1HN1A 4GQGA 1A3XA 2OKOA 3MWCA 4UQAA 1H4PA 3BAWA 4ZQPA 1PYMA 4JX5A 1WKYA 3NQAA 4FMVA 4Z0JA 3V0TA 5DLCA 4ASTA 5IRPA 2O0TA 4KFOA 1SMAA 4O4WA 2ZUSA 3R6IA 1OCBA 3LM3A 3PNUA 4IQLA 2B7PA 5XIMA 1R47A 5GNYA 3CEUA 1G7VA 3U0HA 2CCRA 3AIEA 2Y6ZA 3M43A 1U2YA 2JK2A 3AO0A 3O6CA 3UJ2A 1QK0A 3TYDA 4DBWA 1W3TA 3ALFA 3T0AA 4I7WA 4KT2A 1LOSA 1VBUA 2O9OA 2PP0A 5E6YA 3NVWB 1Z6KA 4JL1A 4W93A 4D6DA 3VX0A 4MB5A 2VX7A 1DE5A 3FEMA 4L1GA 3WG6A 1SU5A 3ES7A 5IDZA 3A64A 1A49A 3PAJA 3VO0A 4CN4A 3ELFA 1SW3A 3DG7A 5BXPA 2QMKA 4P8WA 3NR0A 1G6CA 1NPXA 2E68A 4UFIA 2VYOA 1JZ4A 2LLEA 4EX4A 5CC3A 1CGYA 3BWWA 1IXOA 4IOTA 2QNEA 1SO5A 3DYOA 3OVPA 1GOIA 5FS9A 1XHCA 3LCLA 3G22A 4FEZA 3FNDA 2JEPA 3DHDA 4WJEA 3W07A 3U8GA 1RY0A 1CENA 3T8LA 3UWYA 3W3OA 1XFBA 3C0JA 3SRFA 5EL1A 4TOQA 1XDJA 2R91A 2BZNA 4Q6XA 3WFZA 3BAKA 4HU3A 1H7NA 1OGGA 3PSVA 1UH3A 3LLDA 3GDKA 5AYZA 4GNVA 4M6PA 1TTQA 2QCNA 3W26A 3JS3A 2BGSA 4F0RA 3OU8A 1N61C 3QMSA 5D2YA 3D46A 3C8FA 1Z69A 3C3NA 3Q94A 3PB0A 1KW1A 1WCGA 3EWBX 3B4UA 1KFCA 2FTWA 3SN1A 4KERA 4R85A 2ACRA 2ZUMA 3LSBA 1CXIA 3AYSA 3SUSA 4DBSA 2NPXA 3N1AA 2DT0A 3APGA 2ISVA 4GY7A 3L23A 2FJUB 2CLPA 2WSQA 4GPNA 1XCWA 1ONFA 1IXQA 1LRQA 3UXLA 1XYLA 3UXAA 2OYMA 1S2AA 4WJ8A 3WF4A 1RQBA 3VC6A 3ARTA 4J35A 3QW4B 1FVPA 3UNDA 2DDXA 4DM1A 2GJXB 4JIQA 4S3KA 2PD5A 1MO0A 2PDMA 1XL9A 2HQAA 4NZ3A 3PUOA 5K9DA 4GO9A 2PTZA 1KGXA 1RJRA 2EHHA 5J5RA 3M5ZA 1DJZA 4NI3A 4S3CA 2HVNA 2YW3A 3C8NA 2BBFA 2B31A 3YPIA 4HNCA 1YHTA 4HNUA 2F9RA 1RQHA 2O4QA 1ZB5A 2W3RA 3TE9A 5FA5A 4XBKA 1XRTA 1UZ1A 3UZZA 2IXUA 3IPWA 2WMJA 4OT7A 4YHEA 3QW3A 4S3GA 2YIHA 3BMVA 3VKJA 3FX4A 1JZ5A 2NV9A 4ZOEA 3SCVA 3BGGA 1EEXA 5KTLA 1V79A 2GJNA 2QAPA 4LYKA 1ZBVA 5E70A 1TRDA 3POCA 2I1OA 3RGTA 2W0UA 2BX7A 3EXSA 2G4FA 2J3NA 3C0LA 1FWRA 1EOMA 3AUJA 1L6SA 1DPMA 3QQWA 5I07A 4V28A 3GR8A 3OGSA 2ZRXA 2XVNA 2Q3OA 2C3DA 2W91A 2WMIA 4IXXA 4ORIA 1GPFA 1NQ6A 5AHLA 2PWFA 4WGHA 5JMUA 2GR0A 1JNEA 4RZ6A 5I09A 2XFRA 3ICJA 5K7JA 4O0KA 4JY9A 2GUYA 3P80A 3ZJ7A 3W86A 3SQSA 4GZIA 3W2UA 4UTHA 1VH7A 2A79A 4M80A 1E15A 4W7VA 3P14A 2GUUA 1B3VA 2V3AA 1XIIA 3PB2A 4XAGA 3ZLHA 3NDOA 3NOYA 3AIUA 1JOAA 5CPLA 5C7HA 1ISWA 4Q7BA 2Z1WA 3CWOX 4BF5A 1FDJA 2PCQA 2VGBA 1W3KA 5HMSA 3E5PA 4LC8A 3ZYZA 4O18A 2WKLA 4HA1A 2ZWZA 1A5AA 1BTMA 5FMHA 2PWGA 3DK4A 4V15A 5M03A 5GNXA 3M9YA 1C92A 4N2YA 4QEEA 2ZDRA 3PN8A 1E3ZA 1KV5A 1KCZA 5DBUA 3R8RA 4EKJA 5LNRA 4NXKA 3QV7A 4GC4A 2OO0A 3SGUA 2OSWA 4EPDC 5G1YA 1EB3A 5FEXA 4PUNA 5D33A 1JGIA 1GRHA 1FWFC 3BW4A 4P7QA 1MEWA 4UWMA 2PTYA 4IXHA 4FXFA 4MWAD 2D0HA 4XKYA 1F05A 5HNNA 2A5HA 2A4AA 1ZJIA 3BQ6A 5FJPA 1TVLA 4B91A 1FWDC 1YE6A 3RR1A 3TYZA 4DELA 4GBUA 1KBIA 1GZ1A 3AHTA 5AY7A 5C9ZA 1J10A 1CLXA 1IEWA 4JFSA 1WUEA 2Y5JA 2G41A 4UOJA 3S5YA 4ICNA 4LC6A 1T8XA 5D30A 3CHCA 4AY7A 4UTWC 1QO2A 2WZTA 3P67A 1RPKA 1PTGA 2GJPA 1MDLA 3S1WA 4ACZB 1YYAA 1QWKA 2ZZ2A 1C29A 4J3XA 1RBLA 3W1LA 1NDWA 2P10A 2ZVIA 3GNXA 4L6DA 3QPYA 2E5BA 2QPSA 2XGIA 1LDCA 1JDEA 2J9XA 2C0HA 1REQA 3N9RA 1S5WA 1SJCA 3VK5A 5TAOA 2P8BA 3ZT5A 3N9KA 4D6GA 2EJ1A 3NXFA 4Z2HA 2IQTA 5JCIA 5A6MA 2HVOA 1TPWA 2FVLA 1K4QA 3NO5A 1FCBA 4JYDA 4F79A 3WLOA 1SVDA 3B8SA 4C65A 3FXGA 1XH0A 5I3JA 1JG9A 3CH0A 2VOTA 1TWIA 3PG6A 1SFJA 3Q58A 4LUTB 4HZ8A 3STFA 5LHEA 1R2TA 5ABGA 1UMYA 2A3LA 4YU1A 2EG6A 3LLXA 5D38A 5K9XA 4PUUA 1JCLA 2X7VA 2BSLA 5DMLA 3S1XA 4ICMA 1W5NA 3MCOA 2V30A 4GXMA 5IDIA 1BAGA 4H4ZA 5I00A 3TR2A 3MQTA 2QUUA 3TROA 4ADUA 1PDYA 2HZGA 1UWIA 3OIXA 1Q66A 4BQ4A 2VMFA 4LYPA 4BEUA 3MYOA 1UMLA 4OIFA 5D02A 3AM9A 3O0FA 1DJYA 1A0EA 3EDFA 3F1QA 2H3DA 1W1A1 2J25A 4MYAA 3PPGA 5AYYA 2Z7KA 2Q8LA 3GTHA 1UIOA 1MMFA 3RM8A 2VL4A 3IEBA 3G24A 4JOMA 3NTYA 3AZSA 3USBA 2H90A 3G8EA 2NWSA 1ICSA 3P74A 4W8AA 3VM7A 1RJQA 1N8FA 2PA6A 5HR6A 2XVKA 3RO8A 2F5ZA 1P0EA 4TV6A 3VD9A 3MP5A 3L7RA 2FDSA 4IPPA 1KXHA 3QM3A 1TPFA 4HOXA 4Z2IA 2X2YA 3AN1A 1JR1A 1VIZA 4MNKA 2HBXA 5AZ1A 3VNYA 4UFMA 3B0PA 1IR2A 1V3MA 3KBNA 2DUXA 3MZNA 1XISA 4DIAA 3FHQA 1HQTA 1RCQA 4NJGA 3S46A 2Z1XA 3PFRA 3E1F1 1D8WA 1JULA 2QDGA 3LQGA 3L4UA 3VGHA 5LYRA 2NT0A 4KF1A 3VMNA 3IJDA 2UV8G 3IJ9A 3T2PA 1MW2A 2FHCA 3SCQA 3N11A 3WMCA 2J79A 2A3EA 4R27A 1RR2A 3STCA 4RNFA 4BFAA 2R14A 5DQPA 1X96A 4JQ2A 2BASA 1PWMA 2XGBA 4Q4MA 4X61A 3VIIA 3KLJA 4ZQMA 1S2VA 4WK9A 3SADA 3TJLA 2EG8A 3NZQA 1GHSA 4D2JA 3KZSA 3UA3A 3BICA 4JDRA 4QAWA 1PDZA 3TWBA 3QGKC 1A3HA 4AD3A 2WP5A 3WK3A 3UR7A 4M19A 4JIPA 2HJPA 4PUKA 1FXQA 1KM3A 3W7PA 1VLWA 4QRNA 4OWGA 1XLLA 3DKJA 4GKTA 3WK2A 3AQUA 4ICCX 3N13A 1P7TB 3S9IA 3UR2A 3POHA 1MW1A 3UF9A 1F6KA 4PFMA 5CJMA 3RHGA 4L4OA 1XRFA 4UOZA 1LWHA 2WVTA 5IXEA 5GVJA 3NSMA 3B9OA 3SI9A 2NX9A 2VVNA 5ABFA 4CKQA 4H4VA 3LOTA 2ZADA 4MUZA 1OZQA 2BVYA 4F2TA 4F3HA 2QS8A 4ZE4A 5FS7A 3HZ3A 4PMOA 2CLEA 5TR3A 4DEFA 2I5IA 1D3GA 1LL4A 1XLEA 1H41A 2E9MA 4LIIA 4RV8A 1OD8A 2H6RA 1HJWA 2VFHA 1NWSA 4L9XA 3Q6JA 3BW3A 2KZHA 4ZENA 2YLAA 2WP6A 2CHRA 3ONCA 3VDCA 3MYPA 2VFEA 3BTNA 4JBRA 3GHRA 4A22A 4DJDC 2EF9A 1R3VA 1BYAA 3GD6A 4R5EA 2BLEA 1EZ2A 1UBPC 1Y5VA 2Y63A 3EF6A 4HNOA 5FS8A 2QUNA 2BY1A 3H53A 4QR6A 1E40A 1LF1A 3ZQ9A 2XIJA 5DXYA 2GK1A 1GGOA 1JF6A 2CITA 3L5LA 3VGEA 4XBSA 2IPJA 4EWJA 3GFZA 3RLHA 3CQHA 2PAJA 3B8DA 3USZA 1GSNA 3AISA 3VD5A 3LHWA 4KPLA 1Q1RA 2X8HA 1EBGA 3CK5A 1X8CA 2NLIA 2FZMA 1X39A 4K1GA 2QCDA 1RVGA 2GJLA 1GV4A 4MFDA 3NZRA 3VKKA 4KWWA 3BK0A 3UCDA 3F7JA 4MKVA 2D20A 4QJ5B 3I3EA 1CDGA 3FOKA 4DNMA 3LBCA 1KTBA 2XSXA 2JGQA 1L8PA 1R3YA 2X0HA 3H6OA 3EEGA 2FH6A 5KZEA 3W38A 2I9EA 3OZMA 4DF0A 5LIWX 3BLOA 4DNAA 1GK8A 3L2MA 3R0KA 3QLLA 2VHLA 3AMDA 3HQ1A 4KEMA 4HYRA 3WNKA 1ME7A 1VD6A 2RHGA 3C4UA 5BMWA 1GW9A 1CYGA 3S9YA 1JEZA 2DZAA 4EMJA 5FOOA 1LJYA 1SMDA 1O95A 1WXJA 4TVDA 1CGTA 2CETA 1JCTA 3B8IA 1UR2A 4PN2A 3LXBA 1PS9A 3XINA 4JTAA 1UD2A 1H7OA 2BOGX 3MDUA 3CYVA 4A3YA 1ZQ5A 4FAMA 2J8FA 4MHBA 1GVSA 2B0MA 2VR5A 1JL8A 3RNMA 4IFRA 3EB3A 4JIEA 2AQWA 1GW1A 2ALDA 1SPQA 1WDWA 2AL2B 3CMJA 4HHLA 1UWSA 1TTIA 2PDWA 2Y7EA 3KCJA 3E49A 4L56A 1F8IA 2EEXA 1VQTA 4JTKA 3PBGA 5DCEA 2C91A 1YXDA 4X63A 2VEFA 4IQEA 3ZR6A 4JTHA 3PJXA 4L5ZA 4B5WA 1VLIA 5T9BG 1Q6LA 1LYXA 3JZEA 2QT3A 3S3GA 3VCRA 5KVHA 3TP4A 1V6UA 1JPHA 2CZEA 4ZZ9A 1GQKA 2OEMA 1TR9A 3WNLA 3SQPA 3A9IA 3WUBA 2WBGA 2OLHA 3VE9A 1JCYA 3VC5A 5J5DA 1MSSA 2B81A 1EOKA 4JFUA 3CEPA 4S39A 4PCSA 3CZGA 3CIXA 3M44A 4Q8PA 3MP3A 3OG2A 1XGDA 4J27A 1SZFA 3WQWA 4JHZA 4XVDA 4CD6A 2ZUUA 4FZIA 3GVRA 2QCFA 1GOWA 3QSTA 4IMFA 5JH1A 1VFMA 3KAOA 1R85A 3UG3A 5AC8A 5D9OA 4MAZA 1CGUA 1JCJA 1H3GA 4AX7A 3QYQA 1XSIA 3ARRA 1JROA 5F4XA 1BYDA 4HNNA 4OGZA 2PZNA 1WOAA 3A47A 1P5BA 1H5YA 4R88A 1DL3A 3MT1A 2BHZA 3WLJA 4LNYA 3VABA 3WBYA 1PO9A 4M24A 3NOEA 1WAWA 1ONEA 2PEVA 4OBSA 3JW7A 4GHRA 1B30A 2ZUVA 1JCXA 2D2JA 1U30A 4UMAA 1TUFA 2NVAA 5EPDA 1IT0A 4MLJA 2CFYA 2YPIA 3S4TA 3RDKA 3VFLA 2NVCA 4AZCA 4PYSA 5CBJA 4ATDA 2YLLA 2Z00A 1NTHA 1GOMA 2G8ZA 4X22A 2GDQA 4H8VA 3FV9A 2AMGA 3GB6A 3DJJA 1POJA 5FJJA 3W85A 3L66A 3HG4A 3QV9A 3QLDA 3N29A 4IUGA 1NP0A 2FLIA 3LN3A 1W1YA 5BRBA 2EPLX 4US5A 5K2ZA 4CQBA 3NQMA 1H7RA 4W89A 2PC4A 2J7GA 3M7SA 3ZZ1A 4HSOA 1WYGA 2Y24A 1M6JA 1QBAA 1HKMA 4JFVA 2QUVA 3T40A 3VPLA 3ITTA 1EJUC 3UXKA 3GZ3A 1OK4A 2QJJA 5I3KA 1ODZA 4GISA 4RXFA 1T41A 2HNHA 5I24A 3GXPA 4ROQA 4ATWA 3MUIA 1A0CA 4DLMA 3WDRA 4PSRA 4Z17A 1K6WA 2OLSA 1G4SA 4OJYA 4NAFB 3N2XA 1PKLA 3WD0A 2PGRA 4DZHA 4I5RA 1P0NA 4R7JA 3L12A 1TVNA 1R2RA 1X97A 3APTA 4C6IA 4MF4A 5FD0A 4RPPA 1RP9A 4BWLA 4E4UA 3EWWA 3CZEA 3C86A 1WBHA 1QW7A 5EMYA 2ZDSA 4QCEA 1BVNP 2NV2A 1QCWA 2R1LA 3OZYA 4IIGA 4RPQA 1V0KA 5AFDA 4AWEA 5EKYA 1TZZA 1UB3A 3I6EA 1TPC1 1KLYA 2PBGA 2BB0A 3ECQA 2GL5A 2C3ZA 3CU2A 3I10A 2Y7FA 4XWUA 4AZBA 2VDIA 4C6FA 5I23A 3A23A 4H00A 2AQOA 2QCLA 1MZHA 4ATLA 2B7OA 1EJ7L 1AL8A 4P8VA 4C90A 3SN0A 3LS9A 4X3ZA 3AJXA 1P6CA 3LLFA 1I2PA 2I16A 1DORA 3N04A 1GEHA 4EQSA 4JKKA 1EP2A 3ZR4A 4GOAA 3HF3A 3VIGA 3II1A 1VF8A 3OZPA 1Q7QA 3ENLA 4B2DA 4B4HA 9XIMA 3ANUA 1LBLA 3WEMA 1FP8A 5A8QA 3H4XA 4JHMA 3VNDA 4KETA 3AS0A 3EXRA 2OWXA 1XV8A 1QRQA 1I1WA 5EMLA 4Y96A 3ZWSA 2G4JA 5CGTA 5SWUA 4DLFA 3TYCA 2PDCA 1CXLA 3QJAA 1LUCB 4I8YA 4I3GA 2VKZG 1EWDA 3ZVHB 2PDBA 3BAJA 2Z0IA 4H41A 5A6TC 4XD4A 4GIYA 4GKLA 4GI4A 4JTFA 4WXZA 1VJZA 1H0GA 1ZBWA 4US5D 4E8DA 4E2VA 4MY9A 3B06A 3ABZA 4B5TA 3OB8A 1JZ8A 4F8XA 4HSHA 1A5MC 3P60A 3K1DA 1EJRC 1J4EA 2WJFA 3LMZA 3F5JA 5CG7A 3NGFA 3RX3A 1JZ3A 1HG3A 2AGKA 1HF6A 2W63A 1S5NA 1FXPA 1YPIA 4GGHA 2QVHA 4NAEB 1MO9A 1KM0A 4G56A 4WJXA 4A3UA 3A4JA 1UD6A 3MDWA 4BZYA 1NDYA 2GQ3A 4YVVA 1XLCA 3T1GA 1MDRA 2EXOA 4DJFC 2AGTA 4MOZA 4BA0A 4KWOA 5CPOA 2HK0A 2Z2UA 1B0IA 1K8XA 3E0VA 3WJZA 3LCHA 1CX9A 2D0GA 4FNUA 4I90A 1FH9A 5HDRA 3W27A 1K7FA 3R1ZA 2J6XA 4I9TA 3VNKA 4Q32A 5AECA 3HGSA 2OQHA 4B3ZA 1GPWA 4EMIA 4ZQNA 2V3FA 2FHFA 4K2SA 1YE4A 1S5MA 3ARVA 1FH7A 3EDKA 4QFUA 1YRRA 1RM6B 3O1NA 1TYPA 1FWWA 4C1LA 1FUYA 2VR4A 2EG7A 3GU9A 1OYAA 2ZX8A 2PPGA 2TPRA 3L2LA 4GCAA 1E6SM 1QMLA 3QXBA 4GUFA 3B0UX 4ZFCA 1PL9A 2R1MA 1UPMB 1PKMA 1ZAIA 1G9HA 1W9XA 3O8AA 4GYPC 4NZJA 1TYGA 2ZFAA 2DZTA 4NY2A 3S5SA 5E0KA 3N15A 4YNGA 1KTCA 3TUUA 3BJSA 4ADTA 2NXGA 1OC6A 4DYKA 3T42A 5AHMA 4IJBA 2ZE3A 4LVFA 1MXSA 4O1AA 2E25A 3QFWA 1EO7A 3LV5A 4LW7A 1W3HA 3DFPA 3UWEA 4CCZA 2JF7A 2X1SA 1R7AA 2DEPA 1RAKA 3KBSA 1V77A 2E77A 4LF2A 3NYZA 3PZQA 3BURA 3OOQA 1WZLA 2V2CA 5EYWA 1ECQA 3EOLA 4B9ZA 4O19A 2HCVA 3E2RA 4V27A 4XAPA 2QGHA 3NDYA 4QBXA 3HA1A 5BXTA 4QEHA 4HD5A 3UZYA 3HW2A 3S8HA 1KC7A 3HB9A 3VUSA 2ASHA 5CZJA 3HOJA 4DWSD 3LGDA 4PMUA 3R5EA 1WDDA 1JPIA 1I6NA 2EAWA 3ABOA 3G1RA 2BCPA 4U2ZA 2E5CA 2VGIA 1A4MA 1PCWA 4NNAA 4UMCA 4K39A 3K8MA 1JI1A 4YCPA 1VFSA 5A3HA 4FNPA 3ABSA 4RKAA 1TV4A 5ENLA 4IFKB 3C2RA 3SB0A 3NL5A 4GIRA 4LUSB 5DMMA 3U5YA 4J3VA 4PTXA 1UOZA 1Q2RA 1S39A 3RCNA 1ZBCA 1P0DA 2H9AB 3ITLA 3B9DA 3CT2A 4NAFA 2VJXA 4CQAA 3R4IA 2OOGA 3NPUA 2ATMA 1YKWA 4A8LA 7CGTA 5AYBA 1GTHA 2RDUA 5MHBA 4GI6A 1VZWA 4XSLA 3UG4A 3A4AA 3OIHA 3OZOA 1GQJA 1W31A 1S1RA 2IPGA 2FFIA 4HN4A 4WXYA 1FCUA 3WELA 3PBUA 2HISA 1OCJA 3IGHX 4AIEA 4GZJA 1ZU8A 1TWSA 4Q8MA 2DT2A 3CUIA 3SY1A 3K5XA 4E2OA 5JCMA 1FQ0A 2WZHA 4Q8UA 3VXGA 2WPGA 3R11A 4ZB5A 1O7AA 2QGYA 5HNRA 4KEZA 4YTSA 5FESA 1DWIM 3MSYA 1IXPA 3HURA 4AVOA 4JKLA 1V02E 1E70M 2DVXA 4KBXA 1UWTA 4CVUA 2YCLB 1H62A 1LP6A 5DELA 2YCKX 4QE5A 2QV5A 2HTMA 4YMZA 1ZY8A 2GOUA 1WKEA 3URBA 4BQ2A 5KVIA 2PDHA 1OCNA 1OWQA 3O2LA 4RE3A 1XYZA 4F0HA 1MNZA 3W02A 1AJ2A 2NQZA 1BPLB 1MW0A 7ODCA 2R1PA 4C60A 3UY7A 2XIIA 4IG2B 2V3BA 4XAFA 5JIWA 1EGZA 3VGFA 4Q8TA 3WQPA 3OBKA 3S6OA 6XIMA 1T5AA 3B0VC 3GDTA 1OX6A 2DZXA 2QAEA 1QW9A 4CQ8A 1NJJA 3AZRA 4QM1A 1E0TA 4TVCA 2ZZ7A 2VDGA 3M0LA 1D7FA 2CXGA 4RDVA 5JCLA 1OINA 3ANVA 3CQKA 1FKXA 2XSBA 1A5NC 2CBVA 1PCKA 1J96A 1FCQA 3NPXA 4HA4A 4S3EA 3OLEA 2QIIA 3AIQA 3LNMA 3VIPA 5F1UA 2WHKA 1XG4A 3QR0A 1CLVA 2YDQA 6REQB 3W9ZA 1KV8A 3VZYA 3WLNA 3GS6A 4DF2A 1QOPA 2F6KA 2WMHA 4UQ9A 3VI2A 4H4TA 3QN3A 1KM1A 3VD7A 2BVDA 5MKGB 2ZCGA 5HBFA 4CVWA 3ERPA 4V33A 3EWCA 1VENA 3M47A 1J0YA 2C0AA 4MGGA 1UD3A 2CLFA 3BGJA 2PWEA 4RUBA 2G3MA 2OCZA 1NM9A 3T6CA 1QASA 1KXTA 2CLIA 3QR1A 1IT8A 1E5NA 4J5NA 1JIBA 4Q8QA 3GKAA 1RA0A 1LWIA 1B3YA 1TJ1A 3PANA 2QUTA 3N3MA 1G4PA 1VBHA 1YTDA 2QF7A 2DW7A 3WQOA 4IT1A 3DI1A 4PTNA 1C9WA 1G4EA 2DU2A 3AMCA 3BCJA 3WDQA 3WLIA 4EWND 4XUGA 4C6JA 1ONXA 3RRAA 1JQVA 4MZYA 2V81A 2WOIA 2TRSA 4HU4A 4S2CA 4O57A 3W1PA 3KP1A 3IVUA 4DO7A 1ZP4A 2E5AA 1LCOA 4EXBA 3W83A 4BURA 1E0UA 5GRTA 4N02A 2ACUA 3KTSA 3LMYA 3W6MA 1SJBA 3W7QA 2DH2A 5CPQA 4CD8A 3O05A 4U3CA 3EOSA 3EA3A 1FFVC 2J7CA 3FG2P 3ME3A 1BRLB 1ZALA 1T40A 2GZXA 1FWTA 4ZOAA 2GQ8A 3EPOA 1KFWA 3EANA 2CZ5A 2PMQA 4U31A 5DRCA 1JYXA 1P0KA 4B4FA 4PUWA 3PZUA 1JFXA 1HVQA 4NKCA 4KIEA 1ML1A 3NQFA 3IJ6A 4H9ZA 1TZ9A 2AL1A 1TO3A 2OEJA 3CGDA 1EH9A 4DBDA 1F07A 1X1OA 3RYSA 4PMQA 4TX9A 1AD4A 2X8CA 5C54A 4A21A 3IAPA 3GBEA 3P82A 5I3FA 1K9TA 3DI0A 2XVLA 5FF7A 3DUGA 2CZDA 5FKYA 3LHTA 2O9RA 1E9YB 4YN5A 1IZKA 2CFFA 3ZVIA 2V69A 3CV6A 4H7ZA 2DZPA 2E8YA 5I3DA 5EBUA 2IPWA 1H7WA 4FXRA 4TR9A 4JICA 1P6BA 3NQ6A 3M46A 3NO1A 4XKYB 1XPGA 3UYCA 3TN5A 1VEPA 2YVJA 1RBAA 3L8KA 5AHIA 2WSKA 5G4EA 4LA1A 1LTDA 5BCAA 1D8CA 2DZSA 4PTWA 2PU0A 3OODA 4LUJA 3M0VA 2OJPA 4K8HA 4Q4QA 4NZCA 5JXQA 3TQPA 1KB3A 3W1QA 1US3A 2OG9A 3DFSA 2OSXA 4HPGA 1AJ0A 4WEVX 3GYEA 1B9BA 2AAAA 3O6YX 3B8WA 2J7EA 1G7UA 4AC1X 2H3BA 5A8PA 3PS7A 1E4NA 4MUPA 2XYLA 1EJTC 3VOIA 3LB8A 3GDMA 2YA0A 3W7NA 1OZMA 1H2IA 1WAUA 4W88A 1IEIA 1J12A 4YWSA 4W5UA 1UP2A 4Z42C 1ITUA 3PZVA 4ZGYA 4NZFA 3DFOA 5T91A 2C18A 1VIWA 1PKNA 3U2OA 3LCXA 4Z2GA 1M7OA 2BXVA 3MMUA 1GJUA 4IJCA 1HZYA 1V6VA 1PVNA 3LZ3A 4QROA 3R89A 3QFEA 2XG9A 5IFTA 3PUDA 3OYXA 3BLFA 1OFDA 3FGCA 1PZ1A 2V3EA 4LUTA 3EWXA 1TTPA 1A5OC 2VURA 1RLCL 4AYGA 2EQ6A 4LAZA 4HZ6A 4DUXA 2FGZA 3WQDA 4GC3A 3UZ5A 4LGXA 1P6WA 5TNVA 4D72A 2CLKA 3WJSA 5U1OA 3QQ1A 1XCFA 2BTMA 2POTA 3QMRA 5A1AA 4AZGA 3GXIA 4GINA 1ALDA 3DERA 3VNIA 4XZMX 3K8LA 1QNRA 3BSMA 1MW3A 1ISXA 2WANA 4C6BA 4J2PA 2P76A 2QLYA 3PUEA 4PEEA 2CLHA 1AQHA 2FYMA 2DT1A 2UY5A 6CGTA 4FX6M 5D9MA 3RO6A 3I7SA 4PMRA 3PUGA 2NLYA 3B97A 3NM3A 3IIZA 1H1NA 4J3UA 4N9BA 4P5UA 2WOQA 4PULA 4QISA 1E4MM 2ZICA 2TPSA 4QJ1A 1K4GA 1LL7A 5C70A 1E5JA 1AMYA 3H26A 3IVSA 4PL2A 2R9ZA 4Q3MA 4WRHA 1IF2A 3W29A 4CQ9A 1K9DA 4CUCA 3RAOA 2XINA 4BKNA 1R5YA 2PBOA 2ZTKA 3VNJA 2G5WA 5BOEA 3EWZA 5LXXA 3GD4A 1XIDA 4MPKA 3W1XA 1GOKA 3MO4A 3MSGA 3G1YA 2CXEA 3UY8A 4JTJA 3PP7A 4WDTA 1GNXA 2YFNA 3AYTA 3T09A 2X41A 1XC6A 2J9YA 4GABA 4FNRA 6REQA 1UR3M 4Q33A 2BGQA 4F4RA 2DSKA 1K8CA 5I2UA 2OOFA 3UU0A 3PWAA 4IIHA 1UKPA 1VC4A 4U28A 3SECA 1CWYA 4GMEA 3F2BA 2I57A 1QI0A 3BLIA 4AD0A 1UR0A 5B80A 3OHMB 4FIRA 1Q4WA 1VPYA 3DEQA 5HR7A 1XD1A 5BWAA 2VQUA 1VQZA 4YS1A 5B7YA 3IJLA 1EKOA 4YYFA 3GHUA 3KE0A 4MJ2A 3WJWA 1WE5A 1LT8A 2A3HA 5EMMA 2NQHA 4JTUA 1TWDA 3GK0A 1C3FA 2VQTA 3EMZA 2Z1KA 4HVXA 4PUDA 3W4RA 1VGAA 1VDVA 3E0FA 5FAGA 4P7NA 1Z32X 1ZHAA 3TTYA 1VPQA 1OIFA 4NX5A 3TYUA 2G0WA 3CC1A 3FA5A 2IKGA 2RDWA 4U4MA 4QAIA 3M7WA 4Z1DA 2POZA 4K7ZA 4LVBA 3BG9A 4H19A 3C3UA 3QV6A 4IIDA 1JD7A 1P43A 3KDNA 4JGDA 3AOFA 1JAKA 1Z8AA 4KESA 2Z1BA 4AU0A 4G5DA 3UWWA 2OZ3A 3FJ6A 1XLFA 2VT0A 1CTNA 4TMCA 3EZ4A 4M6VA 2P53A 5ABFB 7TIMA 4RE4A 1AW5A 4ZO6A 5CSUA 4LAMA 3CTLA 3ZJKA 2PDJA 4D6EA 4QXIA 3FDKA 4I9MA 3TONA 2P8CA 1SUXA 1H61A 1E56A 8RUCA 2QHAA 3AHYA 1GZGA 3DGRA 3BLDA 2PTDA 3CL7A 2VZTA 3IGSA 3S2CA 3WQGA 1N7KA 4RNIA 4PMJA 3V0UA 2V2HA 3K1GA 4HSNA 4C6CA 1HJXA 1UD5A 5CZKA 1E0XA 1UH4A 2GQWA 4IGHA 1GG0A 3CV1A 3DX5A 4QG9A 3R8GA 1W1PA 3TYAA 2XIMA 5AC6A 4HZMA 4UNLA 4XZBA 2O55A 5BU9A 1CCWB 1U83A 3K2GA 4JY8A 4OBTA 5HNTA 3VOCA 3OJGA 2VC9A 1MQRA 3RPTA 3H8AA 2CLOA 3PPFA 3GUGA 4UTTC 4YCOA 4ZOCA 5JVLA 5XIAA 2NUYA 1DOSA 2Z25A 3AXHA 4IP5A 4DJFA 3FVDA 5AC5A 3TYBA 5D2XA 1SM9A 4DJED 4XD6A 1JEHA 2ZE0A 2A3BA 3BZGA 3BCDA 3UPMA 1O5KA 4AZ7A 4ZTXA 4HBKA 4UXDA 1KA9F 4P8XA 5FEPA 4Y8FA 2FIQA 3I3BA 3G3DA 5HQLA 2WYSA 2B7QA 3NQDA 3PZ9A 4O54A 2GYIA 3R10A 3L0GA 1YQ2A 1I8JA 4S38A 2QDHA 4P7LA 4UC5A 2VRKA 2Z24A 3M6DA 3KHJA 1FECA 3SSJA 3STPA 4FR6A 4BR1A 4ADWA 3FAWA 3QHOA 5I3GA 1OCQA 1OF8A 1SJAA 1ZS2A 1BYCA 3GTFA 2X42A 3G6LA 4NU7A 5EB8A 1N2VA 4L1XA 3T8QA 2INFA 3TDFA 4Z2JA 1GQNA 2C7FA 2Q3RA 3I4KA 3V5CA 4NP7A 2X1IA 1LBMA 2WZEA 3TMQA 1W3NA 4XZIA 3M64A 2HV5A 2OT1A 2G3JA 2OODA 1LLZA 1DE6A 3S6TA 2IKIA 1AQMA 3HGOA 1XS2A 1MRQA 2VGFA 2AL2A 1RPXA 4BWLC 3S9ZA 1W1VA 1KD0A 3N14A 4YWOA 1Y5XA 3AAMA 1UQYA 1EA0A 2QPXA 3H2MA 5DBTA 3RXZA 3WY1A 5IHRA 3LEPA 2WJEA 4Q8NA 3UCCA 4WD0A 3DG3A 4Q6JA 2OKTA 3WQFA 1XHGA 3QR3A 4PTDA 3VAVA 3ZLGA 3EKGA 4HZ7A 4H9UA 1KFBA 5I5RA 2GWGA 2EGZA 1UKTA 2PDLA 3EX3A 4MZ1A 4IL2A 5EBAA 3DFTA 3VOJA 3WNOA 3AMZA 4F0KA 2GOKA 3CO4A 2ZRVA 1KXVA 1CB2A 2HK1A 2V8ZA 4CNUA 5TIMA 2UY2A 2YBTA 3B05A 4WY0F 1QOXA 1IIHA 2WHJA 1QI3A 1S2CA 3PTDA 5AYXA 2QJGA 2ZUNA 4D6JA 5D9NA 1VFLA 4WVXA 3H2EA 4KKXA 3U5UA 3RLUA 3WNPA 3GLCA 1KN0A 1UKSA 3HPAA 1B4EA 2X1UA 4PH6A 2PDUA 3G3MA 1EDGA 3EOUA 5KZ6A 4AVNA 3M5YA 5L9FA 4MDPA 3OVGA 3CQ0A 3W37A 1WP6A 1XUUA 2E1WA 3UCQA 4CD7A 1HO1A 5A69A 5IFPA 4JDBA 5M1TA 1LL6A 1CW2A 2AMXA 1LROA 5XINA 4KW2A 3CPUA 4G6CA 2VFFA 3TJ4A 3S6DA 5G4HC 3MCMA 3S2MA 2ZQ0A 3GXNA 4FLQA 3AHZA 3A3XA 1PB0A 3VKBA 2BOFX 2QDEA 3S2JA 3IGXA 5BRQA 2BS9A 5LA1A 3C56A 4NL1A 2QULA 4Y9NA 1ZBKA 1BQCA 3ZS4A 4YHGA 3EX2A 2EKGA 3RILA 5A94A 4GVGA 3C6CA 1PHWA 5H2ZA 3DAQA 3WYZA 2NUWA 4LS2A 3VIKA 3AICA 3DH7A 5A6SA 3BE7A 4GUIA 3E9AA 3FJNA 3KTXA 1NIUA 3W01A 3V16A 3I4EA 3O3RA 3GY1A 1EUAA 5J8LA 3CGTA 3HQOA 2FZBA 4B5XA 2A3CA 2XTKA 3AWNA 3P5YA 2CHOA 2IMRA 1XBVA 4LS1A 5DFAA 2XN2A 2H8XA 3VU2A 4BF7A 4IQJA 4K1WA 4YTUA 4X60A 2QMJA 1HP4A 1ZXIC 2ON3A 3WQ8A 1EL3A 1XM3A 3LCIA 1OJTA 2YW4A 1OIMA 2BG5A 4EM4A 4B5UA 4DJEC 3W7HA 1OC7A 3Q45A 6PTDA 1XLGA 1BSIA 2Z7GA 2EPNA 2YZ5A 1EJWC 3KOYA 2Y0FA 2D2HA 4C91A 1Z3NA 3EDDA 2Q71A 5G1TA 1VCFA 2IKHA 3DC8A 2VCAA 3N3TA 3WD4A 4FALA 1CI1A 2DVUA 3NQ2A 4LUYA 1NOWA 1ISYA 3NPWA 3VCCA 2Y70A 3EWUA 5AYIA 4LV9A 3W88A 3MUCA 4HOZA 4KRUA 2YYTA 5HK4A 2GR2A 4O1EA 1V3JA 4QQ3A 1NF0A 1GETA 3UZXA 4HT3A 1ZJBA 3IK4A 3KBVA 3IARA 2Q8XA 4WQ6A 2EQ7A 1S38A 1R3SA 3R0UA 3EDJA 4BI6A 4WSHA 4F48A 4DYEA 4YXGA 3MWAA 5LIKX 1TPUA 3G1AA 3OGVA 4C6EA 1EWEA 1K8ZA 4LF1A 2BMBA 1LWJA 4XO7A 2C79A 1HL8A 2ZBTA 1IEXA 3W76A 1UZHA 4UQCA 5EGRA 1DJHA 1TJ0A 3NQBA 3OQ8A 1CXHA 1H5VA 4LQ1A 4J3TA 2YQUA 3VILA 5KINA 3V36A 1SO6A 3MI3A 3OVQA 2D73A 2E67A 1L8NA 5BROA 3QTPA 2V82A 1IEQA 2PF0A 1UJQA 1DHKA 2YZRA 1GZJA 3N34A 3UT0A 1FWCC 1XJBA 1WOBA 3P0XA 3JZUA 3V3WA 1XQKA 3WLMA 3T05A 4V2XA 2Z6JA 4NHVA 2OU4A 2E3TA 3C2VA 4H4WA 3M0YA 3THAA 3T55A 3L0NA 1HKIA 1BXBA 3WBWA 2XDFA 4H8UA 3EKLA 3WDPP 3IJQA 1L9WA 1W9VA 4DJFD 5A6BA 1DVJA 3PVFA 3DU0A 4MJMA 7PTDA 1PIFA 3E12A 1V59A 1U5JA 3DH9A 2A8XA 1TIWA 1XLHA 3GW3A 4J28A 2VP8A 4GD0A 2ZXAA 3CL8A 3FDGA 1G0CA 4YWIA 5BWFA 7REQB 1GERA 1B31A 1DXLA 3DGZA 3G1SA 1VCVA 3R2GA 3LTYA 3LBMA 1ONRA 2E4TA 3B8UA 1VHCA 3CPRA 3QPZA 4PUMA 1B3XA 4AZIA 3W81A 5AC4A 3DXIA 3ABRA 3EX6A 5C71A 3W75A 3MBFA 5A6JA 2YXGA 2WM0A 1MWOA 2GSEA 2V5JA 2Z28A 2PWVA 5HINA 5FJTA 3SRKA 2F84A 3W23A 4ZE5A 1KFJA 2GUBA 4JTEA 5CAHA 1FCVA 3LHUA 1QU4A 1TWWA 1FHDA 1W5PA 1J11A 1GTEA 3TXZA 1PEZA 4PUJA 1W2VA 2E0PA 3O63A 2FQIA 2JKPA 4LX4A 2QQ6A 4NQ1A 1FY6A 4K8EA 5CEWA 4OUIA 3F4DA 5DT5A 3H4GA 1AA1B 3QKEA 4G7FA 1QNQA 2XM1A 3S5OA 1V02A 5CGMA 1O68A 1XIMA 4O17A 1CXKA 1V5XA 4FP1A 4MKNA 1GOOA 2VEKA 1XF0A 3BAXA 4KRTA 3B9NA 4RDYA 1BVWA 2XSAA 1M3UA 1XYFA 2CEQA 3BOFA 4L9ZA 4UOQA 2J7BA 1E4IA 4O12A 1W37A 3PFMA 1GREA 3AI0A 1LQ0A 1QVBA 2NQ5A 3L5OA 1CGVA 2VZVA 1D9EA 1QHPA 1GVYA 3UERA 1UJPA 1YEYA 2WMIB 1XICA 3O0HA 3U2ZA 1DTUA 4HHMA 4QHRA 5HXMA 3BMXA 1PIIA 2O7QA 3VGGA 4LRTA 5C0QA 4MPQA 3WCZA 2OSYA 4H4YA 2PFHA 2PDFA 2VEMA 2VM8A 5JRBA 3B04A 4HU0A 1OC5A 2CBJA 1DIEA 7ENLA 4JKMA 3BMWA 4IZGA 3TTOA 4DNHA 3OP2A 1EX1A 3W2MA 1OFPA 4GWEA 1X6LA 4N9DA 1JXJA 5DT7A 1B1YA 3TW9A 1GOXA 2V63A 3EXTA 1TB3A 2W27A 7XIMA 1EHNA 3B8TA 4MAVA 3ITGA 1ZCOA 4B3LA 2VTFA 4IM4A 1VYPX 4XD3A 3ISIX 3AIBA 2YL9A 5T9CE 1UCWA 3L68A 3QFAA 3AWOA 3SY5A 1A47A 2OO6A 3O07A 3ZSSA 1J0KA 1GT8A 2C1GA 4XSMA 3AIVA 1ICQA 3VDBA 1H1ZA 4QCFA 1XRSA 5DXXA 4DPQA 1T3QC 3EB4A 4Q4OA 3E3HA 3NVYB 3WLTA 2PGFA 5C2XA 4EPBC 1ZX9A 4J57A 1EDQA 4K3ZA 1IGWA 3RN6A 4AD5A 3BPWA 4B9YA 4WLCA 2V38A 1NELA 2FGBA 2Z2AA 1BGGA 1EP3A 1W56A 4N7QA 4KCTA 2ZZ3A 3SO7A 4H2HA 4FXSA 1W3JA 4P7RA 1TV8A 1QHOA 3WH6A 3WQEA 1V0LA 3W6LA 1TIMA 4LSBA 3KW3A 4AWUA 3PZGA 2J88A 3WJYA 1LBFA 4MDOA 5CG0A 4GG9A 4NRRA 7TAAA 2D3NA 1GKPA 2ABAA 4J9JA 1Z42A 3EYPA 4EAMA 3PG9A 4WUIA 3V5FA 2PZ0A 4AX6A 4QLLA 3T44A 3DCPA 1QXLA 3R13A 2QZRA 2WAGA 1W1IE 1BF6A 2VC5A 1BD0A 3WD2A 2AAQA 1A0DA 4GY0A 3M5XA 1M04A 4QSFA 2FVMA 1X6UA 5CSYA 4FNQA 4XKMA 3W87A 3SQLA 1E0WA 2GDVA 2PSNA 2WSPA 3WUFA 5CLTA 1NFBA 1POKA 1XSJA 1X1NA 2R24A 4LS0A 1FP9A 1I60A 2VELA 3OA5A 3M0XA 1FDYA 4NIRA 2P3EA 4DF1A 4H7VA 2ZX9A 4UB9A 4JN6A 4HQVA 1JZ6A 3CGBA 5F4WA 2EQ9A 3M5VA 4NI8A 1EPXA 1UG6A 2DORA 2OTDA 5E0CA 1ADSA 3G0UA 3QZ6A 4Z2KA 2I9UA 3SJNA 3SURA 2PRLA 5FJOA 1TYTA 4HMEA 4JN7A 4PRRA 4ENLA 3IRDA 4WOQA 3UNTA 1DJNA 3MKCA 2I17A 3CGEA 1GVQA 1F4HA 4XB3A 2Y62A 1DIDA 4PC8A 1KQZA 3FXYA 2I5GA 4YYCA 3RU6A 2P0OA 3QGAC 3ITVA 1L6FA 1GJPA 4GACA 3EAOA 4NUWA 4NILA 2D3LA 2C1IA 1BF2A 2QW5A 5HNUA 4LYRA 2NQLA 3UJSA 1X7FA 2V5LA 4S3AA 2ZZCA 1J6OA 3SGGA 3GVGA 4ROPA 4YTQA 4A29A 2F7FA 3TFXA 2YL5A 5JBDA 2UY3A 4AF0A 4GO8A 2WOWA 3WBXA 2P1FA 1WBJA 3BOLA 3N25A 1TPVA 3MHFA 2PS2A 4JTGA 4UZSA 2BVTA 1KTNA 4BHYA 1FWNA 1LPFA 3W24A 4E5TA 2W92A 2V6OA 1RCXB 2JIEA 1QI5A 3HN3A 4DUOA 1XINA 4KFNA 1I2NA 2CLMA 2E9LA 3MANA 3HPXA 1ZRQA 1ELSA 3GU2A 1HKJA 1PUDA 3AXXA 3FS2A 1TMLA 2OVLA 1AG1O 2PRHA 5GJMA 5DY2A 2XISA 1PTAA 3CJPA 3SUUA 2Q6ZA 1XKYA 5C2GA 3TQ0A 5LGZA 4IQDA 4H6QA 2DZWA 2Z27A 2X8RA 5K3VA 2I14A 3E96A 3S47A 4Q4RA 1QO5A 5A5WA 3W1TA 3RCMA 1EF3A 2Y8VA 1O5QA 3UPBA 3VDAA 3FY1A 1H60A 5LA0A 2EO7A 1Q6QA 5LNUA 1K7XA 2YAUA 5CZ0A 3S1VA 3W82A 1KFKA 2QUMA 1QT1A 4M81A 3FYYA 1FTXA 1OX4A 2VZOA 1E73M 4EIVA 5H1WA 1AQ0A 3C2OA 1AMKA 3ID7A 2WVSA 3EDEA 3VKDA 1VB9A 1EGMA 1L6GA 1MUCA 3FSTA 1F2JA 3IAQA 2RFGA 1CGWA 3S1UA 3GYCA 1H51A 3SJ3A 3U7BA 2XVGA 1MYRA 1BRLA 3WK1A 5AOUA 1FWHC 3KVJA 1W91A 4LALA 5FL0A 3LB0A 2H8ZA 6TIMA 2YBUA 2J62A 3B9AA 4WY0A 5LA2A 3WX7A 1VFOA 1DJGA 1AFSA 3ARXA 3GAYA 4REQA 1H0IA 1H09A 4HJFA 4YVPA 1JRBA 3WH8A 1N63C 1SFLA 3DBPA 4I5XA 5AB3A 1TPDA 4NJJA 4DRSA 4B5NA 1BTCA 2Y85A 4L80A 3DFQA 3CXBA 2WJDA 1IIGA 2ZZBA 5EBKA 1XG3A 2TODA 1MXDA 2FZ9A 4JAWA 3N2CA 2O92A 5FF3A 3W7JA 1YTKA 4QDWA 4KPRA 2AAMA 1UC4A 1OFBA 1W8GA 4MIMA 2X0YA 1I2RA 3QZAA 4UQDA 2B7NA 2ISDA 1IWBA 5JBEA 1DIOA 4H6KA 4JTRA 2QJIA 4PMYA 1O1HA 1V0NA 3C61A 3IUDA 3EOEA 1M7JA 1JNDA 1IR1A 1B2YA 3SRDA 2FH8A 3WLHA 5HJLA 3H24A 2WHMA 2VNCA 4EAYA 1QNOA 3H7RA 3OGRA 3WK0A 2O56A 1SFTA 1ITCA 1TE6A 4MB1A 3QYSA 3NQEA 4ZXOA 3TC6A 2C1HA 1R3QA 1AL7A 4FX9A 2V3GA 2BY0A 3HPZA 4N0RA 3F5LA 2DJXA 2PP3A 1FHUA 3VYLA 5CQ1A 2WNQA 3MV11 3Q37A 4F9JA 1ZKQA 3D9XA 4LPCA 4H9VA 4JFTA 5K4XA 4RXGA 1FFRA 3FJ4A 4WZHA 4I6KA 4QJ3B 4JTSA 4XZHA 3CIVA 3K46A 4WSKA 3SR6B 5KZDA 2VFGA 1JYWA 1UA7A 3QC3A 3TZFA 3H70A 3CXOA 2QXWA 3CB8A 1AQFA 3M41A 2VZSA 1A3WA 4M6QA 1TELA 4N6EA 2WKJA 3R12A 4GYJA 3TMLA 5KSWA 3AZTA 3QV8A 4Z1BA 4UIOA 3RG6A 4MNLA 4B90A 2J9ZA 4M52A 5D2WA 3MS8A 1TE1A 4FX8A 4OE7A 4E4FA 5T8GA 1KRBC 3TWAA 3TJIA 3GTXA 3VE7A 9CGTA 3LU2A 4ZTYA 1V6YA 3RPMA 3ABXA 2YOCA 4U2YA 1SR9A 3D6NA 3A5VA 3Q67A 1LQ2A 4H7CA 1NVMA 3W1AA 1HGWA 1VJSA 3U4FA 3AU6A 4PBGA 4JFWA 4AWTA 3CZLA 4POCA 4E8CA 3EUB3 1UD4A 1GG1A 4EM3A 3O16A 2SFPA 3LM7A 4IMAA 4W9TA 4Y8EA 3MC5A 3E38A 4AZ5A 2HMCA 4H6RA 3DKLA 2WWCA 5HQEA 2PWDA 2QCMA 4K7VA 4N9EA 1NP2A 2G3IA 3MB9A 1DQWA 4GXPA 2Z2BA 4ZMGA 4PB4A 2VVSA 3MO7A 2PB1A 3OPSA 1ZZMA 2YCIX 1FWSA 1TREA 3NCOA 1F73A 5CGQA 1VEOA 4HPNA 4A8RA 3GDRA 2B4GA 3SW6A 3CUXA 3LRMA 3BH4A 4Q7NA 3QFBA 3R94A 2TMDA 1IYXA 3VGDA 1J93A 1C91A 3LXAA 3TTEA 1VRXA 2OX1A 4TVYA 4P2VA 2XM2A 5KZMA 3TU9A 1XIHA 3L21A 1TV3A 1ZUAX 1TR1A 5C9XA 2V5BA 5BOOA 3LENA 4PMVA 5LGXA 3DHFA 3CTTA 3ABQA 3J7HA 1J2BA 1UH2A 4LCSA 3E74A 2WOVA 3BC9A 4H9XA 4XIMA 1DJQA 2XGZA 3OW1A 3N12A 2ZVRA 2WPEA 5B7ZA 1GVIA 4P8UA 4LAOA 4HOWA 1KGUA 1PE1A 2GGJA 1KM6A 4W85A 2QVNA 5CCZA 3EGJA 3CMGA 2RGMA 1YXYA 2GR1A 2XVPA 4MNMA 4PGLA 3L4VA 3NDZA 3GR4A 4K36A 3UEQA 1F7BA 3BSGA 4EQWA 5I78A 4XV0A 3R58A 4XZ9A 4AZ6A 8XIMA 3TN4A 5DEZA 3A7UA 2VGGA 4O0ZA 1VBRA 1C7SA 1OVDA 2WZIA 3CQIA 3TJXA 1MZRA 1OX4B 3NGJA 3GH5A 4GA8A 3Q4DA 2JK6A 2I7GA 3PNZA 2QKFA 2DSWA 2PDYA 3ARYA 1L2UA 4JNMA 4HCDA 1KLZA 4KGJA 5E09A 4GYPA 2EQ8A 4AAJA 3CIWA 2YDRA 1UWAA 4A35A 1AVAA 4NJKA 1OM0A 3UVIA 5HUOA 3LPGA 4GNKB 3KTCA 3MMDA 4AD1A 1NFPA 3SUTA 2XU2A 5DX7A 4KS0A 5LKYA 2GR3A 3SCRA 5CBBA 3LY0A 2X0SA 2TSYA 2WHLA 4FB7A 3ARSA 3PBYA 1CECA 2PDQA 1AOGA 1RALA 3QMTA 4N42A 4DWSC 2J7FA 1O1ZA 1JPMA 3V75A 3U57A 4OTKA 1ZSXA 1LRNA 1UP0A 1ME8A 2XFFA 3SM0A 3CYJA 1WA3A 4Z2LA 1LG1A 4PSPA 1UP3A 3W70A 2P50A 4H6EA 2YJQA 3VM5A 1V97A 3MJYA 2DQWA 5CPSA 3GDLA 1K9FA 2R94A 3P61A 2WSRA 2E6AA 3GZAA 3N73A 2JKAA 4HCLA 1EJVC 2BVWA 3WF3A 4DYJA 2UY4A 3WDJA 2QCEA 2W66A 4HB7A 3NIYA 1WZMA 2WQPA 3BLKA 2HS6A 1K1DA 3CNYA 4XG1A 1GYMA 1UKQA 4ZB0A 2EKCA 4J1OA 1R9ZA 2XWDA 3SAZA 3NVTA 2V5DA 3VDHA 5HPOA 3W7EA 3G1FA 1IQ8A 1BWKA 3N6QA 2Y2WA 3MSDA 1XH2A 2CNCA 1XR2A 4DO6A 3VOHA 3P84A 3CHDA 3OLDA 2YXOA 4D6FA 5E9AA 1JDFA 1WX0A 1MQPA 2IQDA 4GQRA 4PEKA 3LCWA 4OKDA 3THQA 4F9DA 1UUQA 3ARPA 3MSRA 2J7HA 5E5CA 5HAOA 1TMQA 4H9MA 2FJKA 4B5VA 4YTTA 1J2WA 4RK8A 3AHVA 2ICSA 1SZGA 3KRSA 3CBWA 3SY8A 1M03A 4XZWA 3GQYA 1GONA 1YMYA 4A6GA 1K70A 4RE2A 2WKGA 4US6A 3IRSA 1QNPA 1XIFA 2DZBA 4I5UA 2VENA 3AFBA 3DBNA 4WX2A 4B15A 3AIRA 3HGRA 1KGWA 1H49A 4H9TA 4B3KA 4EQRA 3GU1A 2HEJA 5F2LA 5CLWA 2D69A 5MKGA 2MUCA 1WYIA 3QHMA 5JIPA 1KBJA 1P48A 2ZXQA 4GFSA 4AB4A 2YL8A 2PUZA 5TD4A 4QP0A 1LOLA 1YADA 1UIPA 3P93A 4XISA 3VIFA 1A50A 3UG8A 1S5VA 5FSDC 3S5ZA 5A6AA 1KFLA 2IUZA 5JQ9A 2PDIA 3D5HA 2NVKX 4CEUC 1UR9A 4ALDA 4PTVA 4XAYA 3ZMRA 4CGTA 2HE8A 2YB1A 4JIIX 5EY5A 2Y7GA 1XYMA 1B57A 1DJIA 1CBGA 3R8HA 3MA8A 2D22A 4DM2A 2OLAA 3QOMA 1OJXA 2Q09A 1M01A 1PX8A 2CBIA 3BQ5A 4O50A 5IHSA 4NAEA 4DBUA 4K8DA 1G94A 5FF0A 4JNYA 4H8NA 3TC3A 1B9ZA 1P7TA 3NVVB 5GPRA 5DCBA 3NQ8A 3QY8A 2ZZ0A 1RSCA 1JYNA 4LWWA 3GG1A 4OHQA 3TW7A 3BLEA 5FACA 3O6AA 5JCKA 4FF7A 2C16A 1QWGA 2HWGA 4BF9A 3BW2A 4HMCA 1ADDA 4O15A 4F40A 3H4KA 1VFTA 2BGNE 1NY1A 3KRBA 1XI3A 5G2HA 2XJ7A 5A2CA 3LZ5A 2NVDA 3COTA 3DECA 3L65A 1IHIA 1U5VA 1VYRA 1G67A 4QG8A 2PWHA 3NVDA 8XIAA 2Y4SA 3HQNA 3PZOA 3KBWA 1O60A 1QOQA 1TV7A 1ITXA 1KCXA 4INFA 3ITXA 5CPNA 4UFLA 2IQ0A 5CJNA 3MMTA 1UR8A 3FFSA 4AG0A 3UJEA 2BNJA 1L6YA 2E5DA 4QLJA 3RMJA 3C2EA 1XLAA 4G9PA 3JR2A 4UFKA 5BW6A 2DT3A 1K9EA 4LU0A 4Q8VA 3GFYA 2G96A 3LYEA 2CZVA 3HM7A 3RU8X 4X0VA 2A6LA 3R0DA 4GVIA 3LX9A 1F3WA 2KX9A 3KS6A 1WUFA 1S1PA 1XLJA 2BV9A 3KVKA 4RV3A 2GDUA 2DZUA 3FSUA 1Q8AA 3D3AA 5D8WA 4R9OA 1WQ5A 3RX2A 1JFHA 1TV2A 3KL5A 3HG5A 3TAOA 2V9DA 2W5FA 3CUGA 5LIYX 4O53A 1EGVA 4FIQA 2WVUA 4Z1YA 3RMEA 3A3HA 1N55A 2VCCA 3SSZA 3N2TA 5REQB 4O4VA 2G3NA 3PJUA 4JD4A 3H2FA 2XIBA 3A5FA 1R38A 1Q7MA 1YNQA 5G5IA 2YGYA 3WLQA 3W28A 3WKZA 4DVOA 2J66A 3QY7A 4PMZA 3KL0A 3ES8A 2FKPA 4MSSA 4NNBA 1OF6A 1W9PA 1OEPA 2BP1A 3AIWA 1TMHA 4X9SA 5FF2A 3TFCA 4C5ZA 4KWSA 1H63A 2NXHA 1VR6A 5I0DA 4NYUA 5FSEC 5ECVA 3VZZA 3BGAA 2QV4A 1PYFA 4M1BA 4U5KA 3LNPA 2RJHA 4OZOA 2ZUTA 3ZJ6A 1AH3A 3NL6A 2WB5A 4BK9A 1I45A 6TAAA 1BLIA 4DZIA 3DFHA 4CNOA 4CU8A 2FPYA 1XXXA 3BLPX 1KBBA 3ZJ8A 3BSHA 1HVXA 3RX4A 3VX1A 2QPUA 5IBXA 1HXJA 3ZT7A 4EE9A 4I7UA 2NSOA 5F4SA 3IJ7A 1PIGA 1ODUA 1OQFA 4IPLA 4F66A 1IT7A 4RNHA 1PXGA 3U2CA 3TA6A 4J56A 2JQXA 4REQB 3KLKA 1Z89A 4IX0A 1XDIA 1YLVA 5IOBA 1QNVA 4M82A 4UR9A 1KCKA 2J27A 1IEVA 1LRTA 1LLWA 1W3LA 4PE8A 3BVJA 2NXIA 4CN6A 4D6CA 3GNPA 1W17A 4W8LA 1VEMA 4L6HA 2C8NA 1HFBA 3CH9A 3JU2A 1WDSA 3AMLA 4PRWA 3DC0A 4H4QA 2YCLA 3TC7A 5IBXC 4WF7A 3H54A 3TOPA 2ZOXA 3GKFA 3TV8A 2JGYA 2NUXA 1PAMA 5ABEA 3DFNA 1ISZA 3BARA 3WQCA 3SBFA 1GESA 1RHCA 3N17A 2NX1A 4CNNA 4AHOA 3NL3A 3ZFHA 3FK4A 1MVYA 4W7WA 4JTQA 1A5LC 5F7UA 3R07C 3EX4A 4LOCA 3NFUA 4ZB2A 4JTIA 4IG2A 1SZNA 4N4QA 4L9YA 1QPRA 1W9UA 3CAQA 2YA2A 3VTRA 2Y89A 5DO8A 4KGLA 1T99A 3U4AA 4FNSA 3T08A 1JDDA 1IZCA 2R1NA 3TVAA 1JZ7A 5A8NA 2DIKA 1OY0A 3QH2A 4C5YA 4CCCA 1XH1A 4M6UA 1RV8A 2J74A 3M0KA 3MPGA 4IP4A 4GVFA 2X7WA 1FFQA 3W0KA 3GBDA 3GXFA 3V1HA 1Q6DA 3LHYA 3OBAA 3APYA 5E1QA 1DEDA 4Q8WA 2VD9A 3KVMA 3MVTA 4GVHA 4I6VA 1OYCA 4NNCA 1ECEA 3LHVA 4DZ5A 3B0YA 1R0MA 1OFQA 4QE4A 3LG3A 1XANA 1BKHA 3P0WA 3LPPA 1M9HA 5E93A 2P88A 1IWAA 4ZO9A 2ZIDA 5D37A 4TTGA 3OG3A 1JUBA 5DCDA 3TW6A 4HK7A 2DSUA 4LYQA 3PZNA 3LRLA 3OA3A 5FEWA 2A7PA 4CEXC 3GG7A 2ACSA 2OT0A 5FI8A 4EF9A 2DQXA 2HPIA 4O16A 4UZUA 3IIPA 1FX6A 3TN6A 3W2KA 1MOKA 4D6HA 4TMBA 3EKZA 1LG2A 2FFCA 1P4CA 4NEWA 3CAVA 3HO8A 1YDOA 1J0HA 3TK7A 4PCFA 1EC9A 2ZRUA 3GH7A 3GRTA 4XK2A 4JYFA 3UETA 1PJ9A 3KCLA 4GI9A 4RE0A 4R9XA 3N2OA 3W84A 5A95A 4JPGA 1GHRA 4TX8A 2F6XA 4R7WA 1Z48A 3T9PA 1N60C 1GORA 4Z1CA 3LA4A 2E6DA 4XTDA 2G3FA 3KRUA 2V68A 2BODX 2BY3A 5FS6A 1J18A 4O1BA 1KR0A 3OLGA 3AJ7A 3W7GA 4UCGA 1YNYA 3IIXA 3KWXA 2TYSA 3WLPA 4RX0A 1NAL1 4FX7A 4GQBA 3QRHA 3UWQA 1CIUA 3GR7A 4QDMA 3F5KA 1FBAA 1RK5A 2ONEA 2WBKA 1MQQA 3UGRA 2PDPA 3TX9A 4H1ZA 4J40A 2Y5SA 3HJZA 2FPTA 4UCFA 2A2IA 1ZAHA 4DI8A 3GDBA 3DGHA 2QIWA 1LT7A 1E55A 5BMXA 1ITQA 4XX6A 5ABHA 1DXEA 4GK8A 3WLSA 3TZNA 3TQKA 1OX5A 2W6RA 5ABTA 3CAWA 2VI0A 3KXQA 3LCGA 1TA3B 1TG7A 4U5IA 3PK7A 2CLLA 4QIUA 2PF8A 1QAPA 5DMNA 2X16A 2C19A 5LNSA 1J01A 4H8HA 2NV1A 3CQJA 3BDKA 1D7KA 1XC4A 3AMKA 3RITA 2OGYA 3I7RA 4I8DA 4M0XA 1V7AA 2ZX5A 3Q65A 3I65A 2W67A 3BAIA 1OADA 4PCNA 1W2PA 3M07A 2J24A 4BCEA 3UR8A 4PFHA 2PTXA 4G8TA 3M0IA 4LTSA 1FRBA 3G6MA 4NZ1A 2FVKA 1GRFA 3ETRB 1B5TA 1JI2A 1C8VA 3IACA 1LQAA 1NHRA 4ML4A 3RM9A 1NQKA 4EMWA 4P7OA 1CXFA 5C7VA 3G1HA 1V6TA 1B3ZA 1X38A 4C6OA 1FFUC 4DY1A 6A3HA 1U1UA 3W1NA 1YIXA 3BXWA 3A7RA 1XBYA 1STZA 4AXKA 4X0NA 1BG9A 5BRPA 1Q65A 5CC7A 1ZDLA 2XH4A 3DK9A 1A53A 1A5BA 2Z29A 1DHPA 2OXNA 4A4AA 1B3OA 1T96A 2GGIA 1JDCA 3OC4A 3KWSA 2HSAA 4O1FA 4W4QA 2WWDA 3VCNA 1WO2A 2CPUA 3VFCA 2QAFA 1CEOA 3VMPA 4C7GA 4FOUA 1DTNA 2HVMA 4UTMA 5IM51 1Z9AA 4PCPA 1GOQA 3OTRA 3ZSTA 3QVQA 1WB0A 5F2IA 3PBWA 4HP5A 3T0BA 1ESWA 4CD5A 3UESA 4D8ZA 3B3DA 2JKEA 4FI4A 4AHPA 1OK6A 2EPHA 2DFAA 3LQLA 4GXWA 4JEQA 4H83A 2X09A 3SUVA 3CLWA 3GXTA 4UTWA 4NZ4A 4BJHA 4GZ7A 1S2UA 4AMCA 1MUWA 1UBSA 2YX0A 3GRSA 3NUKA 1VRDA 2HBVA 3ANYA 3PZMA 5GQBA 3A4XA 3W53A 4H4XA 4U33A 2WPCA 1Y65A 3VVGA 2DZVA 5C9RA 1MFUA 3D3FA 4XVEA 2GGGA 4K68A 3L4YA 1V93A 5AVNA 3A12A 3TQVA 1B90A 4KFPA 3T07A 4IX2A 3UVAA 3A7AA 5CAKA 3G8RA 5D09A 5K9CA 1M53A 4IISA 3T4WA 4IMEA 4TVUA 3VOFA 1T8QA 3LI1A 5D03A 1E9LA 3WMSA 3EWYA 5EMKA 3L4TA 3LV6A 2NW0A 1XYCA 1F3XA 3DGBA 3ARWA 4EVZA 3WJXA 4CNTA 4EACA 2Q01A 3AC0A 4A8NA 3TYEA 4EPEC 2A6NA 3WF1A 1Y7VA 2WSYA 3B9EA 2OFJA 3QF0A 3WQ5A 1TCMA 4BV6A 3CL6A 5CKSA 2RH9A 3RIKA 4D1IA 2AQVA 4UNIA 1VCGA 1DWJM 4EQXA 1RUSA 1XGZA 1RD6A 4FOKA 5DY3A 1VPXA 1QBBA 1S2WA 3MY9A 2EPOA 4Z1AA 3T4CA 2FB3A 3NVZB 1GVRA 4JN8A 2DUZA 3MV01 3GO2A 1T7LA 1FEAA 3CZKA 1O4UA 4L61A 1WZKA 4DX3A 4U3AA 4O8AA 4LANA 4AEFA 1LVLA 1TA3A 3GSMA 5CSRA 4V1XA 3HPSA 1V03A 4HNVA 4L1WA 3ZO9A 5FCZA 1CT5A 1RCOB 3SDOA 1KM2A 1I9CB 4ZQRA 3FLUA 1Y8BA 1Q6GA 4OQVA 1V4YA 4HK6A 5HMFA 3WFAA 1QTWA 1UWQA 2GWNA 3QY6A 5TF0A 3V35A 2Q8ZA 2QJHA 5A8OA 3RRXA 2W3ZA 2PODA 3WL1A 4GX8A 4GYKA 4AVFA 2OMAA 5I3HA 3UR5A 3KEHA 1W8SA 5ER0A 4G1KA 5LIUX 1V3IA 4C6NA 1XIGA 4DQWA 1W1TA 4EXAA 2MANA 4K38A 3N19B 1J5SA 2PI6A 1E51A 3B9JB 1EO5A 4O8RA 3BCFA 4M29A 3CT7A 2PDKA 1MFVA 3HBLA 4L64A 3UW6A 1RZMA 2CKRA 2EBNA 3CPGA 1TSIA 4F2BA 3B4YA 3L4XA 1FKWA 4ORMA 2JIWA 3AYVA 4RNJA 4ADSA 5KETA 2FB2A 3RK8A 2E28A 3B0XA 2IKJA 4APNA 4QGCA 1R9YA 4ZEPA 1FWIC 4L7ZA 4HMNA 2H9AA 5M5DA 3FIGA 4OOZA 1I1XA 3H22A 3MZ2A 1RXOB 1SW7A 2XIQA 3W1MA 1JPDX 4AIBA 4ERAA 2EJAA 3BO9A 1E4LA 3WF0A 1UD8A 3MJMA 3UPWA 3DG6A 2KAUC 1P1MA 3IJ8A 3SCNA 4JQ1A 4R34A 4Y2WA 4DN1A 4ML9A 3DZ1A 2MNRA 3GNNA 2WPFA 1NOFA 4S2BA 3PC0A 3TSBA 5I6SA 1AH4A 4MWAB 1NHQA 4H4PA 2PLCA 2XZ7A 4GUGA 2G95A 1HKWA 1V0MA 4MADA 3IUHA 1EBHA 4DWDA 4Y9MA 4H01A 4LT9A 2ZA3A 2P0IA 1WDPA 1K4HA 3KOXA 1HL9A 4FS9A 1U33A 1KRCC 3LTSA 3N4EA 1FH8A 3W1RA 3UJRA 4DPPA 4PR4A 2IPFA 4AZCB 3MUY1 4YIWA 9RUBA 1A5UA 4X9YA 4LCRA 2WCGA 1DJXA 2A21A 3GIQA 2BFGA 3HIJA 1UASA 3GHSA 1VFHA 3ZOAA 4JIHA 5HPCA 1UKOA 1I2QA 3G2GA 1DWAM 1M7XA 3THCA 3CLMA 4CNSA 2ZRWA 3TNBA 4GQQA 4HU8A 4N9CA 4LV4A 4QJ4B 4C6LA 1ZENA 1PKYA 3FVMA 1JYVA 2BXYA 1E6PA 3MUZ1 1ZPTA 1HJUA 1XYAA 3L5MA 3EWDA 4UTUA 4UQBA 3IIVA 1J0IA 5I3IA 2GVLA 4ACYA 3SCOA 1P1XA 4HTYA 3A4WA 3VIOA 4ZOHB 3RLGA 2ZC8A 4IIEA 1W6TA 4PUEA 1D2KA 3REQA 1REQB 2XFYA 3WL0A 4NX0A 1PV8A 3P81A 4H2CA 3MKKA 4UQEA 3UYIA 3NYDA 7REQA 4K6AA 4LAKA 3W2LA 1XLDA 2A0NA 1A5CA 4KCVA 4IF2A 1SO4A 2INZA 3BL3A 3TLQA 3OLIA 3PJTA 4QSHA 2ZX6A 3NS1B 1W5MA 2D1ZA 3UGVA 5JBFA 1BGAA 1BQGA 2GPTA 4ZVJA 5F1VA 1EP1A 1Q4NX 5E6ZA 3NSNA 2CIPA 2OR2A 1G4TA 3O7UA 2BC1A 2BHUA 3F03K 3N4AA 4CCDA 4UTFA 3MUAA 5BU6A 2VD8A 2WNNA 4MJ4A 2VXNA 1W5QA 4OU1A 4AWSA 1UZ4A 1O66A 2JBMA 4JQAA 4J7RA 4A05A 1FWAC 3HFYA 5MF5A 2VDHA 2E6YA 2XN1A 2ISSA 3CUZA 4IGMA 2DH3A 2HS8A 2O4MA 3O06A 5LXEA 3WFLA 4CQDA 2VEGA 2OPJA 1D3CA 2WM1A 3LPFA 1R3RA 1GJWA 3MHUA 2OWWA 1SSDA 2PRMA 5GJPA 3N6HA 3HV8A 1FO4A 3W7LA 1UROA 2BXZA 3SR7A 3SCWA 3TCSA 5I02A 7A3HA 2XH0A 3A3WA 2D23A 2DP3A 2QCCA 1HO4A 2CYGA 4MFEA 4D9PA 4WCJA 3VNLA 3B8VA 2QCHA 3URHA 2YB4A 4DUVA 2P5NA 3SGZA 1WNOA 1R2SA 2VRJA 2XHYA 5A6KA 5K4ZA 1YW1A 1SZEA 4F2UA 4LAUA 2WCAA 1XRVA 3QKZA 3WUEA 2DSZA 3NZGA 5BNKA 4AYSA 3IJIA 5H8PA 1SW0A 3LUTA 4GX9A 1DQUA 2BHYA 2E8ZA 3BUVA 3CM4A 3U9IA 1R8LA 1ADOA 1AW1A 3QOKA 1VBGA 1ZAJA 4YL2A 1CB7B 3VNMA 3NQ7A 1EFZA 3ORWA 1FIQB 1N82A 3DYPA 3NO3A 4GFIA 3WH9A 3HU7A 2EQDA 5ECUA 1BXNA 3BOXA 3W6YA 1Q7ZA 3BJTA 4GCXA 1I4NA 5DANA 1M41A 5L6UA 1KQYA 1XFCA 1Q6FA 1CLKA 4YLWA 4DJEA 1SZRA 1VKFA 4XZNX 5G2WA 2X30A 3ARUA 1WV2A 4O10A 3GC5A 1KR1A 2OWCA 2OZ8A 5C6MA 4LBSA 5GJNA 4DO4A 2DUAA 5D32A 4PRTA 4ZL1A 2TAAA 2Y5EA 2FZDA 4E2DA 4EANA 1TPEA 2Z26A 4HCHA 1DXIA 3IGUA 4B2DD 1WZAA 4UFJA 1O5RA 1XIJA 4IPJA 1F76A 1NOUA 2DW6A 3R43A 1GRAA 3RCYA 1FWGC 3TCEA 5LNVA 3A24A 4E6MA 1X8FA 1HL2A 2OB3A 5CPTA 1KKRA 1W1ZA 1XDLA 4LNCA 1I75A 4E2BA 4GIAA 3WEOA 4TV5A 1OFOA 4OOUA 5EMJA 2GSHA 4TU1A 1GKQA 3PR2A 4ZSUA 2RJGA 3BZJA 2CBUA 2VX5A 2E09A 1YTEA 1VAHA 1M5WA 2PGEA 3C52A 1TKKA 1E0VA 1Q2SA 4UTLA 5C9UA 1A5KC 3PWIA 2D24A 4GIEA 4O1DA 5JU6A 1K03A 2RDXA 5FAJA 1GRGA 1KCLA 1C93A 5EU9A 4KIRA 3N4FA 1C9DA 1TRIA 3W7DA 1X2GA 2GFTA 4HA0A 3W7MA 3FGCB 5I79A 1Q6EA 3WLKX 2XIOA 4D6IA 1U5HA 3GRIA 1B3WA 3WNNA 1QJWA 1FOBA 1D7YA 5HUPA 5U4NA 2QJMA 1S7MA 4ILSA 1UC5A 3PZTA 2X05A 2YXXA 1R6WA 2PLMA 4L65A 4Z0SA 3W7RA 4IGNA 5HWJA 1V3KA 2VO5A 1M7PA 4CN1A 4E3TA 4GLEA 4S3JA 3UWUA 1WXZA 1X98A 1J0JA 2WVVB 3HPFA 3VD3A 3SIZA 3EAUA 2Z4GA 3W25A 3OQEA 4L4MA 4JZ5A 4JQ3A 4RLIA 4ZOBA 4HHHA 3IVTA 4QLKA 1SO3A 2V3DA 3UZJA 1S3TC 1EZWA 3TSMA 1JJKA 1JVNA 2RKXA 4UTIA 1V3LA 5KEZA 1E1CB 5AKQA 4DJDD 4MG4A 3QSRA 3M0MA 2ZRZA 1JF5A 4O0QA 4GQ0A 4QTGA 3LXDA 2O9TA 3OYZA 4JTDA 1KWKA 4GNJA 4IMDA 4I7VA 3XISA 4NRSA 3PTQA 2RDTA 3LXCA 1V6WA 1DKWA 3E0LA 3W71A 1UOKA 3UWZA 1I2OA 4IIFA 3HFTA 3CHVA 1E1EA 2CU0A 4IFKA 1W9BM 3L5AA 3H2CA 2WC4A 4H4UA 1IE7C 1E6RA 1E9IA 3RPDA 2W4XA 1KFEA 2WCSA 1C8YA 3C5QA 4PMNA 1E71M 2Y61A 1C8XA 2J47A 4LVAA 2A1YA 3M4HA 3RUBL 1BZLA 3E6EA 2PDXA 2PP1A 2XPKA 5AHFA 1J9YA 3GNRA 3QZEA 4JYEA 3N2MA 1EDTA 3E5BA 2ZTJA 2CDUA 5PTDA 1VHNA 2WK2A 2DV0A 1UR1A 1O94A 3S2NA 1EF2A 3FN9A 4JL2A 4O14A 2X1RA 2WZMA 3PJWA 4C1KA 2ZWYA 2QYGA 1DYSA 2J4GA 8A3HA 5I06A 4MWAC 1Q8JA 1GVOA 4ECLA 2V6AA 2XFWA 1ENUA 4JS3A 2YVFA 2ZZ6A 2C71A 4PBEA 1E6QM 3HG3A 3IUIA 3LPOA 3M6YA 2A7RA 2CZFA 4W8BA 5LIXX 3BG3A 3T7VA 5U25A 2FMOA 4GJIA 4IMCA 3C2YA 1RBOB 2W0HA 1S46A 4D8AA 3PWGA 4MYXA 4OBRA 3W7CA 1KBKA 4FDCB 4FF5A 1XP3A 2XN0A 1S5TA 1DJWA 4UBPC 5J04A 1R46A 1JUKA 3DENA 1GXFA 4O1CA 2Y1HA 3P2VA 1PHQA 4Q8OA 1AJZA 2ZUWA 2V5CA 2AKMA 4H3DA 1UR4A 2DSVA 2XZ9A 1VS1A 2V2DA 4LH8A 4IHCA 3AALA 3WQVA 2VCBA 4MY8A 4HYWA 3C0SA 3W7OA 1TQXA 2GQ9A 4GJJA 1N8IA 1OYBA 1R7OA 4N6FA 3WO8A 1BWCA 5FEZA 3GC4A 5A8GA 1ZGDA 2R82A 3E0IA 4C6KA 4E8GA 1RK6A 1E72M 4WHBA 4FNTA 1E6NA 1NWUA 1N8WA 2NSXA 3KP0A 2J8TA 3Q2DA 3HRDC 4MY1A 1OFEA 3A22A 1OD0A 5CZSA 2WMKA 1JXKA 2R6OA 3ZLFA 3WUGA 3V5OA 1QDSA 3O0KA 2ATSA 5G2IA 5HWMA 4IPNB 3QPEA 4LBUA 4IFOA 1N5WC 3TTQA 1SJDA 3LGGA 1R3WA 1OABA 4AW7A 3L4ZA 2FZNA 2O9PA 1XW8A 4DBEA 3PF3A 4ZR8A 5AVHA 5D2VA 4S3BA 5G5HB 3N18A 4HK5A 1E6ZA 2INEA 4LXFA 3TKFA 1TTJA 4C6MA 5D05A 3L9CA 1W9DM 3PTMA 1GQIA 1E43A 2J7DA 1BKSA 1TPB1 1AZ1A 2W54A 2FTYA 4GUHA 2VZUA 1RJPA 3EB2A 1PX3A 5CH9A 4QITA 4TXEA 4CCEA 2XWEA 1YBQA 4KCWA 3VA8A 3JUGA 4AIOA 4TIMA 3LADA 1PZ0A 5E0FA 3WQ4A 4B92A 4NF7A 3THUA 2BDQA 2GVGA 3CZJA 3GG0A 3LD5A 1CZ1A 1H1YA 1EQCA 2DIJA 3P6LA 4AEOA 3UD6A 3F4VA 4MB3A 5LZLA 1AH0A 1DXFA 4KQNA 4Q7IA 2WPBA 3FA4A 4ZQOA 1E1FA 1EQPA 2W3SA 3VD4A 4GYFA 1G1YA 1HIZA 3WIJA 4HIBA 3LRKA 1N5XA 2IS7A 4H9YA 3GWQA 1T0OA 4PB3A 1JD9A 2J6VA 4LB4A 5A2AA 4H04A 2YKKA 3LSCA 2QJNA 3KHDA 3MUXA 4GGBA 1Q6CA 2JFEX 1UHVA 4G2DA 4TQTA 2V5KA 1X6NA 3S83A 4S3FA 3CAKA 1JQXA 2FTPA 1C8QA 1I0DA 2E40A 2IW0A 2WVVA 5M2FX 1G01A 2GK1B 1F61A 3G1VA 2YFOA 4OFCA 1CNVA 1HKKA 2HPMA 2GGHA 3IS4A 1KM5A 4R53A 4M56A 4NZ5A 3XIMA 1XWYA 1G5AA 1XGEA 4NJHA 3VGBA