3TJIA

Crystal structure of an enolase from enterobacter sp. 638 (efi target efi-501662) with bound mg
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
399
structure length
399
Chain Sequence
MTPVIIKNIECFITRPDRHNLVTVRVTTEQGITGHGCATFQQRPLAVKTLVDEYLQPLMIGRDANNIEDLWQMMNVNAYWRNGPLMNNAISGVDMALWDIKGQLAGMPLYQLFGGKSRDAIPAYSHASGETLEALFASVDALIAQGYRHIRCQLGFYGGTPSALHAPDNPTPGAWFDQQEYMSNTVEMFHALREKYGWKLHILHDVHERLFPQQAVQLAKQLEPFQPYFIEDILPPQQSAWLEQVRQQSCVPLALGELFNNPAEWHDLIVNRRIDFIRCHVSQIGGITPALKLAHLCQAFGVRLAWHGPGDMTPIGVAVNTHLNIHLHNAAIQEFIPRSATTNDVFPGAPEVKEGFVYPPVQPGIGVGFNEALALAHPVLYRPHEWTQSRLPDGTIHTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Mandelate racemase/muconate lactonizing enzyme, N-terminal d
publication title Crystal structure of an enolase from enterobacter sp. 638 (efi target efi-501662) with boung mg
rcsb
source organism Enterobacter sp. 638
total genus 140
structure length 399
sequence length 399
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3tjiA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3tjiA01
3RCYA 2ZADA 3OTRA 4K2SA 4KT2A 2OPJA 5FJRA 2PMQA 3SJNA 4E4UA 3JW7A 3THUA 3SQSA 2XH4A 3R1ZA 4J3ZA 4ZA0A 1SJDA 4J1OA 3N4FA 4GGBA 2PTYA 4IL0A 3DG3A 2PP0A 3UJSA 1E9IA 3NXLA 3ES7A 1KKOA 2PTWA 2OO6A 2QJJA 4IZGA 5IDZA 3VFCA 3N4EA 3T6CA 5BOEA 5J04A 3UXLA 3UCDA 3VC5A 2DW6A 4Z17A 3VA8A 3VCCA 1TZZA 3NZGA 4MMWA 4DYEA 2OZ3A 4DWDA 4G7FA 2DW7A 2PU0A 4DHGA 4KEMA 2FKPA 2AL2A 1JCTA 2GGEA 3H12A 3DG7A 4DN1A 2P8BA 3GO2A 1SJAA 1MNSA 4H83A 4GYPA 3P93A 3HPFA 3BOXA 2PP3A 3OZYA 3CXOA 3TCSA 1SJBA 3N6HA 4EWJA 2XH7A 2PSNA 1MDRA 2HNEA 3UJRA 3QKEA 3FCPA 3PWIA 3ZLGA 4IP4A 3MUCA 2FYMA 4E8GA 4IL2A 1BKHA 3PWGA 3GY1A 2XSXA 2HZGA 2O56A 3R25A 2OKTA 5BOFA 3V3WA 3UGVA 3SN0A 3TJIA 3ZVHB 2OVLA 3OP2A 4GMEA 4E5TA 2ONEA 3BJSA 1R6WA 1ONEA 5EU9A 3CT2A 2QQ6A 1XPYA 7ENLA 3Q45A 3TJ4A 2MNRA 3ZLFA 4ZCWA 2PU1A 4HPNA 2QVHA 4GFIA 3JVAA 3V5FA 4HCDA 1EBGA 3MKCA 3DEQA 3VC6A 2PTZA 3NFUA 6ENLA 3QLDA 5FJOA 3UJEA 3ENLA 2OZTA 2PPGA 2OLAA 3KUMA 3MZNA 3GC2A 3FYYA 3P0WA 2CHRA 3EKGA 1EC7A 2PA6A 3CB3A 4ENLA 2GSHA 4E4FA 4A3RA 3R0KA 3D46A 2ZC8A 4HNCA 3R0UA 4FI4A 3UJ2A 1TKKA 4F4RA 3CYJA 3DGBA 1ELSA 4H1ZA 3Q4DA 2GGHA 2PS2A 3I6TA 4KWSA 1MUCA 3S5SA 4Z1YA 4MKSA 2QGYA 2GGIA 3OPSA 2PTXA 3EEZA 3PK7A 4FP1A 3CAWA 2XGZA 1L8PA 2GDQA 3VDGA 3N6JA 3TW9A 3U9IA 3P3BA 1DTNA 3RITA 3D47A 1YEYA 3ZVIA 1SJCA 2PODA 3DESA 4HCHA 3RO6A 3DIPA 2OFJA 3V4BA 4HN8A 1P43A 3I4KA 2MUCA 3PFRA 1JDFA 2PCEA 3FVDA 3U4FA 5FJUA 2HXUA 3R11A 3H8AA 4H2HA 1NU5A 3SN1A 2I5QA 1BQGA 3TTEA 1MDLA 3SN4A 2PGEA 4H19A 3DDMA 3OW1A 4MGGA 1OEPA 1WUFA 2GGGA 5FJTA 3DG6A 4GGHA 2AKMA 3MSYA 1F9CA 3K1GA 4ROPA 4G8TA 3QN3A 4IP5A 2QJNA 3DFHA 1TE6A 2AKZA 3BSMA 1XS2A 2AL2B 3TOYA 3H70A 1KCZA 3UCCA 4M0XA 1EBHA 3RRAA 3VCNA 2POZA 3IK4A 3GD6A 4HYRA 3STPA 3SBFA 1JPMA 4DX3A 2GL5A 2P0IA 4JN8A 3QTPA 1MRAA 2NQLA 3MQTA 4A6GA 4GYPC 2AL1A 4K8GA 3ZVHA 1PDYA 4IT1A 2QJMA 2PGWA 3V5CA 3FXGA 3UXKA 2QDDA 4HNLA 3UJFA 1PDZA 2RDXA 3MY9A 2OX4A 3T4WA 4DXKA 3T9PA 4GIRA 4E6MA 4YWSA 4A35A 3S47A 2OQYA 4X2PA 1P48A 3JZUA 4M6UA 1WUEA 3ZLHA 1JPDX 3TQPA 2OG9A 1FHVA 3IJIA 3TWBA 2P3ZA 3DERA 2P8CA 3ES8A 3TWAA 2PP1A 2OZ8A 3FJ4A 3CK5A 3SSZA 1IYXA 4JHMA 3NO1A 3RR1A 3FV9A 2P88A 2GGJA 5ENLA 1KKRA 3DFYA 3IJQA 4KPLA 4HCLA 3T8QA 2HXTA 1RVKA 3R10A 3B97A 3RGTA 4K1WA 3H7VA 3MWCA 1NELA 1W6TA 3QPEA 1FHUA 1R0MA 2OQHA 4IHCA 3I6EA 1EC8A 5FJPA 3IJLA 3OZMA 2QDEA 1EC9A 4JN7A 2XH0A 1ECQA 2XH2A 1KD0A 4GISA
chains in the Genus database with same CATH superfamily
4JTFA 1E51A 4KT2A 2WNQA 3UWVA 3UR2A 2C14A 3MV01 1VBGA 4H9UA 1F3XA 2A3LA 1OM0A 1B54A 4O8AA 2VENA 1BXBA 3VMNA 2PTYA 1T0OA 1PKLA 1X1OA 2Q3OA 3RM9A 2BCPA 4ADSA 4AEFA 2J7BA 2BVDA 3EB4A 1VHNA 5A8NA 5F4WA 2F9RA 3LSCA 2ZA2A 3GC4A 1Q4NX 3COTA 4Q32A 1ZJIA 4LUJA 2PWUA 1UBPC 2DIKA 3VKKA 3SRFA 2X1SA 1YNYA 2NVDA 4D6FA 3BUVA 1JZ8A 4OBSA 1E70M 1S2VA 2VDIA 3O2LA 4AAJA 3ZYZA 4NSBA 4DWDA 2QCNA 4CCEA 2P3EA 2GSJA 1N8IA 4GINA 3V1HA 3W01A 1JCTA 4IPIA 1ZMDA 3N18A 1JQVA 4Z1DA 1V0KA 3C8NA 3ALGA 3SIMA 3A4AA 2Z00A 4Q8NA 3NM1A 1MQPA 3AZTA 3OZYA 1D8WA 1EOKA 2JBMA 3UBPC 3CHCA 1VAHA 4HT3A 1OZMA 3UNTA 1EYEA 4QHRA 3SCTA 2J78A 3JR2A 2DT1A 4E8GA 4EMJA 2ZIDA 2RGMA 3NYZA 3BLOA 4Q3MA 2BGNE 5LIKX 3H7RA 4PMJA 1KTNA 4U3CA 4CCDA 2UY3A 2VD8A 3B9DA 2C0AA 4GMEA 3LUTA 1RBLA 2QCEA 3IGUA 4XBKA 3TIMA 1BRLA 2FB3A 2VXNA 1R85A 2Z6IA 1J4EA 5HJXA 2VDGA 3BCDA 5EU9A 3ZWTA 1JNEA 1XYAA 2X2GA 4NJKA 3M41A 3TQ0A 3MUIA 1TMHA 2Q3RA 4EK7A 2J9ZA 2Z29A 3SFKA 2CITA 3VCRA 2V2HA 1QXLA 3UZXA 4QLKA 2CWXA 4J5NA 4AX6A 1PE1A 1PL9A 3C2OA 1FH9A 1GYNA 5CAHA 3M5XA 3WFZA 3G2GA 4ZQMA 1XIBA 4ZO9A 3DHPA 3PUOA 3ATZA 3WQ4A 5TBOA 2YKKA 4FNUA 4IISA 1O7AA 5C9WA 3ICJA 3A4JA 6XIAA 5AYBA 3ARYA 1FWAC 3HPZA 3EMCA 4H8NA 2CZ5A 3VGBA 9RUBA 1S7MA 4CLMA 2AMXA 1Q8JA 3WQEA 2ZC8A 5AVNA 2EPHA 5H6HA 4C1NB 4H00A 4KKXA 2QPXA 4C1KA 1EBDA 2IQDA 4BI5A 1B30A 1KFCA 2NVAA 4N02A 5DT7A 4DJFC 3OIHA 1H7OA 5LIXX 4AWEA 3QQ1A 5BWAA 1IGWA 4KIRA 4HSHA 5A6SA 2WANA 2ZXDA 1AJ0A 2BHZA 3ZR4A 2ATSA 4N7QA 1JCJA 4W4QA 5D09A 4U5IA 2G4JA 4XUGA 1HIZA 1H2JA 2WV8A 1FUYA 3DUGA 3VFLA 4HTYA 1RVGA 3SQLA 3W6LA 4D1JA 4LAMA 3CL7A 4HKPA 1AW1A 3GLCA 1SJCA 4JCMA 2EQ6A 1FEAA 1ME7A 3EB3A 1LT8A 4FB7A 2R82A 4MSSA 1XDIA 5G4EA 1R3VA 3DCPA 4HK5A 2OYMA 5MKGA 4WQ6A 4KQNA 3RU6A 2AQWA 1N62C 4JDRA 1KM6A 3PAOA 3IANA 1X97A 1W31A 1OFPA 4IGSA 3B40A 1LT7A 1S2TA 2PF8A 4HNNA 3NO5A 3AU2A 1L9WA 2QDHA 4W84A 1GVOA 3QV9A 3A6OA 1HL9A 3PBYA 1NY1A 5CKSA 3TLQA 3K1GA 3WELA 3EPOA 2Z2UA 1I60A 1GVEA 3DI0A 1FKXA 1VCFA 1AD4A 3TOPA 3BSMA 3SADA 4RNFA 4MDOA 4HJFA 3TA9A 3UCQA 2H90A 5FL1A 1SMDA 4LS0A 1YDVA 3LCXA 4JKKA 4X60A 4ACZB 3WBWA 3N13A 3VYLA 4D6IA 5I3DA 3EOEA 3AIBA 2WVVB 4XK2A 1F2JA 7PTDA 3N1AA 1MWOA 2CIPA 1SO4A 3AI0A 5AFDA 2C15A 3TCEA 1TPH1 2Z26A 2ZBTA 3P6LA 2NUYA 1N2VA 1LCOA 1Z3NA 4LS1A 1XIEA 5FEXA 3BOFA 4PZVA 5I79A 1V0MA 3IJ7A 1IGSA 1J01A 2VR5A 1S2AA 1XJBA 2B0MA 2NWSA 3HQ1A 1KQZA 3NPVA 2C1GA 5JCKA 1KM3A 3AMCA 3CAVA 4GRSA 3RPMA 1GV4A 3LV5A 2FB2A 1M7PA 2CNCA 4UR7A 4WY0A 3M5ZA 2Z7KA 4ZO6A 2B31A 1QI0A 3TONA 2ATMA 5IBXA 1X98A 2CERA 1JYVA 3G1VA 1E71M 4N0RA 3T07A 3LBOA 4KFPA 1UIPA 3WQGA 3W37A 3OLGA 3CUJA 4XV0A 3GNNA 2ZA1A 3GC5A 2P88A 5KZDA 1QI5A 1IR1A 1OHLA 3GW3A 5HAOA 3OBEA 3M0MA 4K8DA 1E6XM 3BWWA 1B3VA 1CGTA 2WW5A 1W54A 3MW7A 3QH2A 1JNDA 2ZE0A 1EX5A 5D32A 5BW6A 2YPIA 4RXGA 5C8BB 3PB0A 2HQMA 2E9MA 3B4UA 4J40A 4IHCA 2Y62A 1BYCA 1B9BA 4GABA 1P6WA 5HATA 4XISA 4FOUA 1J8VA 3JZEA 4Y96A 1TX0A 4D6GA 4K2SA 5CH9A 2AGKA 3SJNA 3VDCA 5HWMA 3O6DA 1F73A 4HZ6A 1ZL1A 2EXOA 3N4FA 2PI6A 1QPQA 2YL6A 2XISA 6REQB 4F2TA 5JVLA 4AB4A 4C6CA 4LX4A 4H4ZA 4JN6A 1LUCA 1QI2A 1GT8A 1QBAA 2Q6ZA 2PTWA 3WF4A 4NJIA 4S2BA 5ABFB 2OJPA 1VFTA 2WC4A 1PIIA 4ERIA 2J75A 3ISIX 1R9YA 3H21A 3HG2A 3GDBA 3UCDA 3NAVA 3VNIA 5LXEA 3VC5A 2QUNA 2DW6A 4UTTA 3EZ4A 1UPMB 5TIMA 3BW2A 1WXJA 1GOIA 6TIMA 3GVVA 4B91A 3VCCA 3IIVA 4QROA 3OBAA 3TNBA 5GNXA 3N9KA 2G37A 5D2VA 2DORA 2CETA 3C3UA 2ZE3A 1HJXA 4NJJA 2VFIA 3M0ZA 3W7JA 2NVKX 1W17A 1WNOA 1MNSA 1R7AA 3N3TA 3IACA 1GRFA 4EMWA 4EXAA 4F40A 3HPAA 2QULA 4WX2A 2XH7A 3TYEA 2PSNA 3DH9A 4C7FA 2RDUA 5A8GA 3HZ3A 5AN7A 2BLEA 4XWUA 4CN1A 4OKDA 1W56A 4JIEA 8A3HA 1W3NA 2WCSA 2JK6A 8XIMA 4HPXA 2GYIA 1X38A 3W7LA 4OGZA 3EOUA 1XBVA 1GOMA 3UR7A 1V77A 3GTHA 4DWSD 2WHLA 3UGVA 2OVLA 1PAMA 2BV9A 1W1YA 4CNOA 2YW3A 4BWLA 1R9XA 4QAWA 1N82A 2FZ8A 4AZIA 1ITXA 4JIPA 4ZCWA 3T81A 2VRKA 4MWAD 4QQUA 3PVFA 2VZUA 2WP5A 1G1YA 4Q7IA 1KXHA 1XRSA 3WD4A 4PBGA 1EJWC 1XLBA 2A0NA 3N17A 4PB3A 2GRTA 3O07A 4KRZA 3MZ2A 1S5TA 3K8LA 4K7YA 2RAGA 4FXRA 2V3EA 5DMNA 2I5IA 1W3JA 1V97A 3WK2A 4IFRA 5LIUX 1U1HA 3MU7A 3WLOA 4UR8A 4R33A 1GHSA 4WSKA 3GC2A 3G1RA 1V93A 2F84A 2UWFA 1TZ7A 1ZAJA 1GZ1A 4PTWA 3H2FA 1DV7A 3CB3A 1TWIA 2UZ9A 2CLIA 5F4SA 1O95A 3BPWA 1IEVA 3E2QA 4XSMA 1YTDA 1EDTA 4CQAA 2Y7EA 3TC7A 4JIIX 4O8RA 1XLAA 4F4RA 3NZRA 3NOYA 1WKFA 1LG1A 3WG6A 1J79A 3VZYA 5I07A 3MT1A 3S5OA 4BFAA 4Z2HA 4UOZA 1X2GA 3EMQA 4YNGA 2DUAA 4Y2WA 1ITQA 2DU2A 3CO8A 1PZ2A 1FX6A 4RPPA 4O0QA 3R07C 3W27A 4MWAA 4HNTA 2ZUWA 3RITA 1ONFA 2DFAA 5J5DA 1FVPA 1TWSA 3VNYA 4DUOA 1EQPA 4JNMA 5JMUA 3S83A 1TJ2A 2A1YA 4ADTA 1ICQA 3QOKA 2PLKA 1NPXA 1DIKA 2QCFA 3HOJA 4Q8WA 3WLJA 3B9EA 3URBA 1YTKA 1X6LA 2C0HA 2VC7A 4QLLA 4IQEA 1AA1B 1WQ5A 5B7ZA 3BMVA 4H19A 4MLRA 3WLPA 3UXIA 3SCNA 1UZDA 2GLKA 4CD6A 4MYXA 1GTHA 3ZWSA 3A3WA 2ZVIA 1TYPA 2FTWA 1PTGA 1GQIA 2W66A 3QN3A 3KHDA 3E5BA 2I16A 4D1IA 4NQ1A 3WUFA 1A3WA 2PDXA 3CUGA 3TN3A 3ARSA 1B90A 5EMJA 3U57A 1ZSXA 3VX1A 3CWNA 3RRAA 2VOTA 1DNCA 5L9FA 1G4TA 4AF0A 4IUGA 5IOBA 4CN4A 1H7PA 3LD5A 4QDPA 3IV3A 3MUAA 2DZWA 1X96A 3NVDA 4UTIA 1MOKA 3MBDA 3RLGA 3T1GA 3NQMA 3TMQA 4B92A 1ZB5A 4GVFA 3FA5A 2V69A 1BWKA 1JEZA 4ZB2A 5CBJA 4Q7NA 1DBTA 3WKZA 1TV3A 1UYQA 1RJPA 3TQVA 2FIQA 5I00A 4I7VA 2QMKA 3GR7A 3M0VA 4I6KA 2VDHA 3RCMA 1CW2A 1P48A 4L9ZA 1VBJA 3S9IA 3KFTA 4YVXA 2HK1A 4HZMA 4LANA 4F0RA 3QMSA 5FS6A 3VKBA 3F7JA 4W89A 5KSWA 3KCOA 2TPRA 4QM1A 1VRXA 3ABQA 1NARA 4QG9A 3NXFA 1TPVA 3FJ4A 3EX6A 1IYXA 2I7GA 1AQFA 1YX1A 3NO1A 3EWBX 4N4PA 1W37A 1CGYA 1GEQA 5C2XA 3W1PA 4J3UA 2QVNA 1LROA 1XR2A 2ZZBA 5HR6A 3FA4A 1CZ1A 3TJLA 2FJUB 3RK8A 2C1HA 2J24A 4ALDA 2J9XA 4QQ3A 1CGVA 3B9AA 3I3EA 1SZNA 1XKYA 2ZZ0A 1LQ2A 2CBUA 1J0JA 1I8JA 3LHUA 4PE8A 1KBBA 1DPMA 3DK8A 2FZDA 3IJLA 5C2GA 2OLHA 1QPOA 4V1YA 5LZLA 4H4UA 1EC9A 4M19A 2XH0A 4FA3A 3AS1A 4ZGYA 2F5ZA 3S2CA 2O4MA 1XI3A 5FJRA 5E9XA 1RD5A 4E4UA 1OFBA 3UD6A 1TREA 1IT0A 1O6IA 2GWNA 3NDYA 3LLFA 1K4QA 5LNSA 2FZBA 4IL0A 4I5XA 4B5SA 4O54A 4X61A 2OMAA 2PDIA 4M81A 1GRBA 3GD4A 3AN1A 3QHMA 3UWUA 1SFSA 1KKOA 2Y8KA 2UY5A 2D0HA 3USZA 5EYWA 1A4MA 1QI3A 4IZGA 3M7SA 4UTKA 4LCRA 2F6KA 3FDKA 4L4PA 5A6TC 2E28A 1LL6A 1V7AA 3S1UA 3T44A 3GTIA 3IIXA 3RF9A 3C4UA 3N19B 2VNCA 4QEEA 5DCDA 3V75A 2ISFA 4NRSA 2PU0A 3E3HA 5A95A 4D8AA 3OGRA 4Q8PA 3SSJA 2GJNA 1FFQA 3EDEA 2NT1A 1EUAA 1ZPTA 2Q02A 4GQQA 1NVMA 3CZGA 4IMFA 2EPNA 1UUQA 3L9CA 4V27A 1J6PA 3LXAA 5I03A 3BO9A 1W1VA 4O13A 4BR1A 2RABA 1ZJHA 2D23A 2ZC1A 3TK7A 4DO6A 1YPIA 2QCCA 1F3PA 1C7SA 1MQRA 1PB0A 3A24A 2WJEA 4IP4A 3VUSA 2A4AA 2XZ7A 4S1FA 4GVHA 4G1NA 1JXJA 4G2DA 2IKIA 4GX9A 3EPMA 4B4HA 1DJQA 1UZ4A 3P61A 3FLUA 3ZVHB 2HPMA 1EGZA 2QPSA 4NAEB 1XQKA 4JIHA 5FS8A 3AUJA 4B5VA 1F05A 1H7NA 2W3ZA 3QR0A 1JXKA 3T55A 1QNRA 2KAUC 1FWFC 1BXCA 5HK4A 1MUWA 3PWAA 3B05A 2XG9A 5M1TA 3ID7A 3AXMA 3PP7A 1GEHA 3K1DA 1FWCC 4PULA 4JFWA 4H7ZA 5A6KA 5CBBA 1FIQB 5CGTA 2J7FA 1EWEA 4HCDA 5AHLA 5HMDA 1EBGA 4O16A 2NUWA 3PPHA 2Y4SA 1SO3A 3NQVA 3AJ7A 5G2WA 3VIMA 5C9ZA 2XFYA 2GQWA 3QOMA 2OZTA 3CV1A 2Y89A 2VX7A 2ZXAA 2J79A 1E4NA 5ABGA 3L0KA 4LJ3A 1XKJA 4GO8A 3URQA 3GFXA 4PCPA 1XIIA 4BF7A 2WLZA 2WSPA 4C5ZA 3R0UA 4FI4A 1G6CA 3VIFA 4EXQA 4Z1AA 1ZS2A 4PBEA 3EF6A 4GQBA 3LCWA 2C13A 3BG5A 3MDWA 3T0TA 3C2RA 1V6YA 4J7RA 3LMZA 4K6AA 2J66A 2VGBA 3ZSTA 1W9DM 3TZFA 1HT6A 3QY6A 4H04A 5D2WA 4IM4A 1ZNNA 4O1DA 4B5UA 2Z1BA 4PC8A 1IXOA 4Z2KA 2PTXA 4ILSA 1NHSA 1BYBA 2ZX6A 4IJRA 4OHQA 1RZMA 2XGZA 1TJRA 4LV9A 1JCNA 3HG5A 3EGJA 3WH8A 3OYXA 1TR9A 3BLKA 1DKWA 2TMDA 1RQEA 1WO2A 3NQBA 2PODA 4PMUA 2I9EA 1KGXA 1TIMA 3HBLA 1TVLA 3FY1A 4GOAA 1HJSA 3V35A 3WD0A 3VDAA 3R13A 4U2ZA 2I5QA 4PCTA 1VD6A 2G3NA 4QP0A 2PWEA 3QGAC 2DJXA 3B9OA 5KINA 2H8ZA 5D8ZA 1L6SA 4JTLA 4GY0A 4P7RA 3UU0A 4JFVA 4MJ2A 4B90A 3HRDC 1PPIA 4AIEA 2VUNA 3QFBA 2AOSA 2FFCA 1M04A 3TOYA 3CLWA 3V16A 2BG5A 3VIKA 4MZYA 4W88A 3TKFA 1VYPX 3UCCA 2BY2A 2WP6A 1A5UA 4IQJA 3HN3A 4K68A 2POZA 4QEHA 1FDZA 2PLMA 2ZQ0A 3PS7A 3R43A 3VIHA 1QASA 2QCGA 4B3ZA 5M03A 1B1YA 4A21A 2PUZA 3OVGA 1EIBA 5GPRA 4RPQA 3V5CA 1TA3A 4K38A 1B31A 1OVDA 3WH9A 5DBTA 2E09A 1HO4A 2RDXA 3MY9A 4UTJA 1Y8BA 3E5PA 4DAIA 2CEQA 1J2BA 1LWIA 1CB7B 1RP8A 1BRLB 1TRDA 4GZ7A 3W07A 5TF0A 3T05A 3P8IA 4NZ3A 3S47A 4A35A 5FF0A 5C6MA 2DZBA 2ZRXA 1TPUA 1DL3A 4W8LA 1N5WC 3ZLHA 1RJQA 1T99A 1UD4A 3NQ7A 1OYBA 4DYJA 3KZPA 1VYRA 4OECA 3AAMA 4JIQA 4ZB0A 2PP1A 5FIPA 3P67A 4JCLA 3TAOA 3G1HA 1EH9A 2D24A 5CQ1A 3RR1A 2PTDA 1CNVA 1V3IA 3T8QA 4ZB5A 2OR2A 1RVKA 2OWCA 1Q1RA 3AIUA 4NZ1A 3EX2A 1W3KA 1RH9A 4WJEA 3EWXA 4GI4A 3L66A 2W4XA 4V1XA 3H26A 1I75A 3VKAA 4JY8A 2E3TA 3TR2A 1Y5XA 4LYPA 4GY7A 4WOQA 2QDEA 1WDDA 4GISA 3NIYA 4AZCA 1KM4A 1OFRA 4QISA 3OG2A 3CC1A 3L0GA 4Y90A 3WENA 3NVZB 3IAPA 3THUA 2QIWA 3R1ZA 4CNNA 1PHWA 1AK5A 3SW6A 1UP2A 1XISA 4GZEA 3TAKA 1E1CB 1UPPA 4DZHA 3NXLA 2PWVA 3GM8A 3ZT6A 4LU0A 3P81A 1FXQA 2I5GA 3BAYA 4DELA 2A5HA 4CQDA 3LX9A 4QBXA 4F0LA 5IDZA 4RDZA 2WVSA 5MKGB 1XIFA 3W2JA 3UXAA 4KEUA 4R7WA 3A64A 4PR4A 4DO5A 4C1LA 4GKTA 1J6OA 4Z17A 1WDSA 3VA8A 4AIUA 4EQSA 3H2EA 4QS6A 1TZZA 2ZX8A 3ERPA 2YIHA 2F7FA 1FY6A 2J13A 4XTDA 1BTMA 1DQXA 4DUVA 4GLEA 2BZNA 1QT1A 1KQYA 5C9XA 4X22A 4DUWA 3EX4A 2W27A 1WE5A 1LL4A 2FPYA 2R1MA 1UR3M 1WDPA 4WF7A 1TPFA 1V4YA 3GXPA 1BYAA 1XBZA 1FWDC 2BOFX 3SQPA 3QKEA 4G5DA 4ADUA 3MUCA 4MYAA 4EM4A 2D2JA 3STGA 5SWUA 3KS6A 5EFDA 4DLFA 1KCKA 4PUUA 1I2QA 1LORA 4C6KA 1R30A 2HZGA 3XISA 1HXJA 4HBKA 4A3HA 3GTNA 1OF6A 4OUIA 5TD4A 5CLTA 1XCWA 1Q3NA 1BF2A 2X0HA 1TE1A 1STZA 1VYSX 1W91A 3GG7A 4ATLA 2D3NA 4DJED 3E49A 1XLKA 2IKGA 3CGBA 1CPUA 3HJEA 3ITYA 2VZOA 1EJSC 1W9BM 3BAKA 4GUHA 2ZWYA 1XSIA 2NLYA 2W79A 3LADA 2YCLA 3DC8A 4KRUA 3G22A 2OQLA 4NP7A 4ZOAA 4DWSC 5FEPA 4RNJA 5F1UA 3ZIZA 4QJ5B 1SFTA 3WEZA 3VC6A 2O7QA 4WY0B 4J2MA 3AS3A 4CN6A 2GJPA 4KWWA 2EHHA 3NEHA 3MZNA 3AOFA 3PZTA 3BAXA 1XH2A 3P0WA 4LSBA 1N63C 3ITGA 3MI3A 2DSKA 2EPLX 4FXJA 1ISYA 2H9AA 1ISVA 2D0GA 2R6OA 4CD4A 5AYXA 4YL2A 1KGWA 3F5JA 3D46A 3H2AA 3NOEA 3QFEA 3SDOA 1ODZA 2VEMA 3WDQA 1KWGA 1ELSA 1CYGA 3HO8A 4Z1YA 1R86A 1MUCA 5LIYX 3GX9A 2YZRA 3NZPA 3W02A 3TH6A 3CZJA 3QPZA 4NAFA 4BEUA 3OC4A 1R2RA 3W83A 1XYLA 4CNPA 2OODA 1H7RA 4K3ZA 1YNPA 2ZRYA 3T40A 1EOMA 2PBOA 2XVKA 3BCJA 2VFHA 3UZ5A 4UFJA 3QW3A 1OINA 1W5MA 1KNWA 1UW9A 2BODX 3P62A 5KZEA 3U3HA 2PGRA 2G95A 3PZUA 1LUCB 4LVBA 3A21A 3H8AA 4U2YA 3MUZ1 4S3KA 4JTSA 5E0FA 4A2RA 3L4XA 3EOLA 1V8EA 2QDGA 2ZRWA 2KX9A 4FF5A 3IGSA 1R2SA 1BEUA 4H8VA 2PFHA 3GXMA 1S1PA 3LDVA 3QHOA 3UW6A 3RIKA 1RBOB 4D71A 1K7XA 2D22A 3I3BA 3UESA 2QJNA 1ONWA 2CBIA 2ZZ1A 2F6UA 3H70A 4H6KA 4F48A 4IFKA 2YXGA 1VBUA 1B9ZA 4AWUA 2V67A 1VS1A 5IHRA 3OA5A 3AJXA 2YCIX 1UD2A 1FCVA 3O3RA 4FR6A 4EQRA 2NXIA 2ZZ5A 4NEVA 2CWNA 2ZUVA 3ONCA 4EACA 2EAWA 2ZFAA 1UD3A 3CIVA 3T4CA 1R87A 1UWAA 4US5D 4IG2B 4EMIA 2QDDA 1V3HA 4HNLA 1LQAA 1UC5A 4PEEA 1M9HA 3WNMA 3IVSA 1UOZA 3SRHA 3FYOA 2G3JA 1CGWA 3GNRA 2FVLA 4BY3A 4JDYA 1D3HA 3N2TA 1NOFA 4KBXA 1ISXA 3JZUA 3E74A 1SR9A 1NWTA 2HEJA 1D8CA 1CENA 1LBLA 2ZXBA 2J74A 3BDKA 3TWBA 3F5LA 1CEOA 4C6LA 3PPCA 3TX9A 2GOUA 4IP7A 1H41A 3SRKA 2VGFA 1K8CA 3CZLA 4WDXA 3KLLA 4MNMA 3B4YA 3CTLA 3UZJA 1Q6OA 4E0CA 1KBJA 1B4EA 3NWRA 1ZAIA 1JYXA 5TR3A 3OHIA 1UA3A 3S5NA 1CB2A 4JTRA 1FHUA 3CQJA 1YDNA 2BTMA 4XAPA 3CHDA 2Z1WA 2X2YA 5FJIA 4IXHA 4US5A 1TTPA 4ATDA 2O9RA 4HPGA 4JN7A 3T09A 4CQCA 1SZEA 3QFWA 1GSNA 2G50A 2XINA 2QUUA 2Y6ZA 3DKJA 2EPOA 4DM1A 3JW7A 4PTDA 3SUWA 3R2GA 3KRBA 5CC3A 5A6AA 3VM7A 3H23A 4J1OA 1F6KA 1Z32X 1UUOA 3W24A 3WNKA 1HTIA 3IIZA 3P82A 1OCBA 3UJSA 3G0UA 3GKAA 2PWFA 2WVUA 3T8LA 5K9XA 5G2HA 4XD6A 3WLHA 1VCVA 2GR0A 2IUZA 1FOBA 1D7YA 3T6CA 1OYCA 4PA8A 7A3HA 1R46A 1J10A 1V3LA 4IIEA 3FA3A 5JU6A 4F2UA 2XIIA 3CJPA 3QC3A 1XIDA 1WOAA 1KTCA 4EKJA 1EL3A 4XZIA 4J3XA 2CHOA 1KM2A 2W0HA 4FNQA 3N9SA 3W7IA 1NFBA 1G7VA 4IQLA 4L6HA 3WK0A 2P8BA 3PJUA 4GYFA 1I2OA 2ACRA 2VZTA 1ESWA 4FOJA 4JTEA 2E3ZA 3SGZA 1JUEA 4NEWA 3W6YA 3M0KA 1X2HA 1V02E 3PWIA 3WLKX 1HP4A 4N42A 3LGEA 2ZX9A 3QMRA 3P14A 1RCXB 3B8VA 5FF4A 3GNXA 3CB8A 4AF0B 4X3ZA 1MFVA 4GH1A 4ZQCA 3G6LA 1MZHA 3E0VA 1H1YA 3AO0A 3OA3A 3HIJA 3TJIA 3OP2A 4AEOA 1UZ1A 4JR5A 4AD0A 1U22A 3KP0A 1K8XA 3GDMA 1CLKA 4UZSA 3BH4A 1E5NA 1EX1A 2V63A 2JQXA 5IM51 1I0DA 7ENLA 1X7IA 4PGLA 5E93A 4NU7A 3EANA 3WLRA 5HUOA 2GR2A 2P76A 5EBKA 3QYQA 5JQ9A 3W1QA 5CBIA 5D03A 2E1WA 4JAWA 4YIWA 3NPUA 4N9DA 3WMCA 4UQCA 4S3GA 1V0LA 2DZPA 4S3BA 4ICNA 2Z7GA 3SECA 5LHEA 3DHDA 1R3YA 1AH4A 1OADA 4AG0A 2F2HA 2WQPA 1P1XA 3VD5A 4K1GA 4M7SA 3KUMA 2E5AA 3LERA 3E0IA 4D8LA 3NEVA 2C3CA 3LTSA 2PDBA 4LY8A 2EQ9A 4O0ZA 2VO5A 1M6IA 3KDOA 1IIHA 3CEPA 4EWND 3ZO9A 5AOUA 4BEQA 3HGJA 1P0BA 4RE0A 3W2KA 3VU2A 1ZENA 3SY5A 3SCPA 4LAUA 4JFSA 4L1WA 3CV7A 1RAKA 3RILA 4PMRA 4G7EA 3BG9A 4L7ZA 4ZOCA 4FR1A 1E6PA 4YTUA 4IMCA 3EEGA 3MWAA 1K9TA 1HKVA 3ITTA 3HM7A 1R47A 1ZCCA 3O06A 3ZJ6A 1FP9A 2FVMA 1WBHA 3ZT5A 3U9IA 2CBJA 4H4TA 3NQDA 3W38A 1YPXA 4GUIA 2YJQA 3S2JA 3EX3A 2NXGA 2IPJA 4NNAA 1UR4A 3B0PA 3HA1A 3PBVA 1IEIA 1GOQA 1LRNA 3B8IA 3AM9A 4IX0A 4JL2A 2DIJA 3L2LA 4XVDA 2XSBA 1QNVA 2X8RA 3POHA 1G4PA 1SB3B 2PC4A 1WZMA 3S5ZA 4C1NA 2VP8A 4QIUA 4XZHA 3SR7A 3DYPA 3O0HA 3FYPA 2JGQA 3QSRA 4CD5A 1F9CA 4ICMA 3FEQA 4PRRA 4RZBA 1R3TA 3TYAA 3GH4A 4YTQA 4JD4A 2FGBA 1MYRA 1I2PA 3DJJA 1H50A 4H4SA 3TROA 2J8GA 1EBHA 1O5XA 5FACA 3OZOA 4D72A 4U33A 1LBMA 3F4NA 4TUFA 1U83A 5BWFA 3GDRA 1XLGA 3CWHA 4AWSA 4QNEA 3W1XA 3G24A 3LPPA 2P0IA 3UWYA 2BFGA 1G69A 5HMSA 2ON3A 3ZQ9A 4INFA 1PDYA 2RJHA 4R9XA 1XP3A 1ZRQA 2VC6A 4XVEA 5TQLA 2C16A 2HVNA 2Z24A 3KL3A 3UXKA 2PDNA 3S0CA 1PV8A 4H6QA 2HBVA 1EWDA 4CU8A 3A4XA 2OX4A 3T4WA 4ML4A 4Y9OA 4FPSA 1Q4WA 4NKCA 2YYTA 3TXZA 1S38A 2FHCA 2WJDA 4X0NA 3AYRA 4KERA 1K9FA 3L4WA 5FOOA 2QUMA 1JL8A 1TTQA 2A7PA 2WOWA 2YLAA 1PCKA 2HTMA 2XJ7A 3QM3A 5G1YA 3U5UA 2TAAA 1Q7MA 4QCFA 1UZHA 1OK4A 5HPOA 4HOWA 1Q6QA 2P8CA 3H2MA 3VD3A 5LNUA 3IJDA 4DO7A 4QSFA 4YN5A 2QJHA 2HBXA 2GGJA 4FXSA 3BANA 4DF2A 1VEPA 3K4AA 4N6FA 2DSUA 3N11A 2HDJA 2OT1A 2VFFA 4GNVA 4JXCA 1POKA 1VIWA 2A3BA 2ZZ3A 4OTKA 3SJ3A 4EAYA 4PEKA 4GXPA 2IXUA 1ZP4A 5K9DA 1V08A 1XC4A 2OQHA 3GHRA 3MI6A 1A5NC 2ZX7A 1LDCA 1P0EA 1ICPA 3SURA 2HE5A 1W9VA 3GDLA 1LYXA 3GRSA 4WGXA 2EG8A 4DJDD 1CBGA 3W2UA 3WDJA 1KD0A 4B15A 2Z1KA 2ZTKA 4QSHA 2Z6JA 5JRBA 1C92A 2WKJA 2C6QA 2YBUA 3NL6A 1MEIA 3KAOA 1HZYA 4P5UA 5AHEA 4DBWA 7TAAA 2YDAA 3W70A 2QCDA 3LCHA 4I9AA 3UF9A 3TMLA 3S1GA 1OX5A 4UFHA 4UQDA 3PG6A 5BXRA 1CLXA 1R2TA 3W73A 1KXVA 4S38A 1D7KA 3AZRA 3UVIA 1VR6A 4LUSA 4Q4MA 5DT5A 1XG4A 2E5BA 1ME8A 1I45A 1K77A 4L9YA 2V6AA 3SY1A 4O1BA 1E9ZB 4MFDA 1PCWA 2CXGA 1DJWA 4HIBA 2V5DA 1YE4A 1HP5A 3T42A 2OOFA 2V3BA 1ZDLA 5HR7A 5DO8A 1PWLA 4IMDA 4KMQA 4XZNX 2WOIA 3GAKA 4EXBA 6REQA 1UROA 3ZLGA 1TV7A 3QSTA 3R12A 4E2OA 5LNVA 2VM8A 3IRDA 2O55A 2WC3A 1FHLA 2WSKA 3IJ9A 4PMQA 4MAZA 4H41A 4WDTA 3RX2A 2DT0A 5EMLA 4H8HA 3UERA 1EDGA 1JJKA 3GYEA 1TJPA 1ZGDA 4XZMX 4OT7A 3SUVA 4XTIA 2E5DA 4JHZA 5A3HA 1KM1A 1SFJA 2Q09A 1AZ2A 1TA3B 5EB8A 2VCAA 3RO8A 1HG3A 2H3DA 2Y8UA 1Z9AA 1RSCA 1IXQA 3F4DA 4A8NA 4R34A 1XV8A 3LNMA 1RV8A 2BVYA 3QZ6A 3VOCA 6ENLA 1UOKA 3R5EA 4DJEC 3HPXA 1YTEA 2JFEX 3LK6A 3TYCA 4C5YA 3ENLA 2QNEA 3UXDA 2XM1A 2Z1VA 2J25A 3C2YA 2AAMA 1UH4A 3L4ZA 4XG1A 1TMLA 3OEXA 4AX7A 1Q2SA 2NQ5A 5LNRA 1GJUA 4EPEC 3UG3A 2HS6A 3UWQA 4LF1A 3LPGA 4O19A 5HULA 3JUGA 1JGMA 3UJ2A 1TKKA 4PSRA 1GRAA 2X8HA 5BU9A 4ICCX 1A5BA 4MJMA 4O0KA 8TIMA 1E72M 1P0KA 2ZKMX 3WY1A 3I6TA 4O4WA 3LB0A 3GNPA 3W0KA 4ZZ9A 3DK4A 3T2QA 4UQAA 1DORA 1ZHAA 3AXXA 2X30A 5DMYA 1W5QA 3SB0A 1M5WA 2WKLA 4ORMA 4AZCB 3C2EA 2ZXQA 3W7KA 1WBJA 3TP4A 5DRIA 3NCOA 3SAZA 4PB5A 2GPTA 1BKSA 2I57A 1YEYA 3PBMA 4H9MA 2ZDSA 1RCQA 4OU1A 4OWGA 3RO6A 3DIPA 4IIGA 4M5PA 1LLZA 1SSDA 3M5YA 4AYGA 4W5UA 2BXZA 1G4SA 2FLIA 4D6HA 2PDUA 3PZIA 3SN4A 3UQNA 4UQ9A 1W1A1 1EB3A 2WMFA 5FEWA 3U4AA 1S5VA 4UTWA 1OEPA 3FJ6A 2GGGA 4RL3A 4GGHA 5CJ5A 5A6JA 1XIJA 5KITA 1US2A 2YDQA 1OBAA 4G8TA 3DX5A 5D8WA 4E4PA 3OVQA 2ISSA 2C8NA 3WD2A 3N3MA 3G18A 1W1TA 2HJPA 3N73A 3P74A 3IK4A 3U2EA 3G3MA 1JCLA 2V68A 1S2CA 4YVPA 4KH2A 2Z0IA 1YADA 3OJGA 1P6BA 4A6GA 4GYPC 2NVCA 1JZ5A 2HVMA 4I9TA 3KLKA 5CSSA 2F8QA 4E2DA 2FH8A 2YOCA 2FZ9A 1NIUA 1EF3A 1NEYA 2FGLA 4RK8A 1GVQA 4MZ8A 1U1UA 4LFYA 2XHYA 1HKIA 1IWBA 2BC1A 3A7RA 1RLCL 4PUMA 1NHRA 3K4WA 4HHMA 4IIHA 4K8HA 1VQZA 1VB9A 2OT0A 4F0MA 5J5RA 5DF0A 5FA5A 1DJIA 3POCA 1Q7QA 5ABTA 5F2MA 4DBEA 1XSJA 2QF8A 5CPTA 5A94A 1TUXA 3TQPA 3QBUA 2BXYA 2BOGX 4ZFCA 2P3ZA 3CT7A 3KEHA 3DERA 1LLWA 4K39A 3PSVA 1OYAA 3VOHA 4FS9A 1GW9A 4JQ2A 5JXQA 1ZK7A 2NPXA 4LVGA 3UG8A 3O7UA 5ENLA 4KPLA 1UD8A 5CPLA 3RX4A 5CG0A 3AXKA 5FAJA 2YFOA 4WXYA 5T9BG 1OC7A 3PTQA 5DBUA 3SCUA 1A5KC 2ZOXA 3QTGA 1W6TA 1YDOA 3GFZA 7CGTA 1WYIA 1XF0A 2DT3A 1T40A 4ZTYA 3M0LA 2Z2BA 1B3ZA 1DQWA 3G0XA 5FF7A 4ORIA 4E8CA 2V5JA 3SM0A 1UWQA 3AFBA 1M7XA 1EZ2A 5EKYA 1Q5MA 1XHGA 5H8PA 4DZAA 1GCYA 3PBGA 1QRQA 4EAMA 2VFGA 1LRQA 4O12A 2NXHA 3VABA 1TX2A 2PDKA 3A9IA 4NAFB 2ZUMA 1SJDA 1B5TA 1Q6RA 4KPRA 3CGTA 5K3VA 2FMNA 2WK2A 1B4KA 3QQWA 4NNCA 1U5VA 3K2GA 2B4GA 1YBQA 4YHEA 2A2IA 4HHPA 3LN3A 3KOZA 2DDXA 3VIPA 3O6YX 3W86A 3O0FA 3P7YA 4AFYA 4X9SA 3AIVA 5BOEA 2HVOA 1MNZA 3SY8A 1QI4A 4Q4KA 2ACSA 4I5RA 4DEFA 3NL3A 2V3GA 4ERGA 2Y2WA 1VH7A 3NGJA 1F3TA 1F3EA 3LGDA 2VJXA 3BAJA 3TZNA 9XIAA 1H0GA 1C7TA 3ZJKA 1H2IA 2FHFA 5AC5A 4JS3A 4CEXC 2X42A 1US0A 2PURA 1S39A 4FX9A 1E4IA 4DN1A 1UR8A 1Q85A 3GO2A 1KRCC 1SJAA 3ZJ8A 2X8GA 3SCWA 1RJRA 4OZOA 4B9YA 4IJCA 3BVJA 4EWJA 1FBAA 1M53A 4IFKB 1ISZA 2PGFA 1RR2A 3LHZA 2TODA 4TVDA 2V2DA 1CXHA 3DU0A 5E5CA 1TZ9A 1FHDA 3WN6A 4MPKA 4WSHA 2D2OA 1LP6A 3QV8A 1BKHA 2B81A 4IPLA 5LIWX 3BLFA 5G4HC 3R25A 4NXKA 1LG2A 2OKTA 3WLNA 1R5YA 5LXXA 4J56A 4DQWA 3L4UA 1OFAA 2CW6A 2ONEA 4UTMA 3VX0A 3M5VA 3VUPA 4CGTA 2R14A 1ZZMA 3CPGA 4U28A 1AG1O 2PBGA 3E96A 5JH2A 4HHLA 1AW2A 1AMKA 1PZ0A 4F0SA 4YHGA 4B2DD 2A6LA 4QXIA 5C9UA 1FEBA 9CGTA 4FZIA 3V7PA 1QNPA 4XZLX 4HPHA 1LM1A 1IF2A 4XD4A 1CXEA 3EX1A 3C5QA 1R3QA 2QJGA 1NF7A 2BS9A 3AU6A 3A5FA 4PRTA 1BZLA 5AYIA 3UJEA 3UYCA 1FRBA 2JE8A 4GK8A 2OOGA 4UFMA 4S3FA 3WCZA 3NZQA 2OLAA 4YWIA 3RM8A 3L5LA 3UY7A 3FYYA 4XX6A 3CM4A 1BQCA 1F61A 2OLSA 2ISWA 4O28A 1YXDA 4OJYA 3V0SA 1V03A 3GTXA 3RDKA 3WLMA 4E4FA 1K7EA 3MDUA 4PFHA 3WBAA 1CCWB 1RD6A 3N2OA 5JBFA 3H4KA 3G1XA 1L6GA 4GBUA 3GB6A 2VQUA 1TV8A 1DE6A 3KX6A 5D2XA 2R1KA 5CPMA 1X1ZA 1Q65A 4I8YA 3S6OA 4JEJA 3G77A 1X1NA 3ARRA 1RALA 3O63A 3UNDA 2WQDA 4KS0A 3OPSA 3VOJA 4D6EA 1ITUA 2V5BA 3P80A 3TSDA 2E40A 1VC4A 3LSBA 2VKZG 2YB1A 3DGHA 4NI8A 1O5QA 1JRCA 2ZUNA 4B2DA 2ZA3A 1UR2A 2WWCA 4IIFA 4NI3A 1X6UA 1GKRA 3W85A 5KZMA 2KZHA 1M6JA 2MUCA 5XIAA 4MADA 4NX0A 1E6QM 3SN1A 4C6NA 3TTEA 3GBDA 5GJNA 1XLIA 3WF3A 4GX8A 3DFSA 3OW1A 4MGGA 3W3OA 5I3JA 1EUNA 3VOGA 1GGOA 3NQ6A 3CGDA 3C3NA 3BGJA 4AIOA 2YBVA 3GU1A 1I4NA 3SFWA 3PNZA 2VI0A 1J0ZA 1GVRA 2XIMA 1UR9A 2GQ3A 3ARWA 2YAUA 3TQKA 3NVVB 2NWRA 1BSIA 4DM2A 4JTKA 5A6MA 2WB5A 3W1MA 4PSPA 5BCAA 4Y9NA 5LA0A 3STPA 1DHKA 4WR3A 4TVYA 4H7VA 1P7TB 2YVFA 4DX3A 4GIAA 3AISA 3K5XA 1DIEA 1MRAA 3SRDA 2WMHA 2X7WA 1TTIA 3VD4A 1VPXA 3MV11 2Z4GA 3ECQA 3CGEA 3DENA 3FK4A 4YYFA 1GPWA 2PDPA 1IT7A 1YQ2A 3GU2A 2ZUSA 4DIAA 4P2VA 4FLRA 3QV7A 1O68A 3MYOA 4XAYA 1GEUA 1PX4A 4BQ4A 2HNHA 2WPBA 1NDZA 4ADWA 1R3RA 3W71A 3WDPP 3VOFA 3VDHA 5A2AA 4JOMA 4HP5A 4WKHA 4HSNA 4EIVA 3CU2A 3DBNA 3CL6A 1YKWA 3AHYA 3QRHA 2CYGA 2YBTA 5CZJA 3PANA 3G3DA 4BZYA 1PIFA 5HNTA 2WPFA 4KIEA 4Z2LA 4GIYA 1KKRA 1OGGA 3M7WA 2F61A 1WKDA 3KVJA 3B0VC 4HCLA 2IPGA 1ADOA 5E9AA 1GVIA 1ZBKA 3BMWA 2GDVA 4K36A 4UB9A 4A3QA 5AC4A 2J4GA 1UBSA 3PBWA 1IQ8A 3W29A 1V6UA 1WCGA 5A8QA 3Q58A 3NM3A 2XN0A 2H6RA 1KXQA 2DUZA 1NFPA 5F2GA 4A3YA 4Q4RA 3WLTA 3BG3A 4F9JA 4Q8TA 2CPUA 1R7OA 3R4IA 3KVLA 3OLEA 6CGTA 2OEMA 4DXXA 4G7EB 5I02A 2CU0A 3TFCA 3KCLA 4MY8A 3FJLA 3E2VA 3QY8A 4HYVA 3ZT7A 4ZA0A 3GDTA 3WL0A 1ZFJA 1N55A 1B0IA 5K4ZA 2G3MA 4YTTA 3LI0A 3CHFA 4CD8A 4DAFA 4DJDC 2RGLA 1RQBA 1E55A 2QLYA 4Y8EA 3R58A 4H6RA 4ZE5A 4E2VA 5A6LA 3S6TA 4L4MA 5I6SA 5GJMA 4LBSA 4MB3A 1EP2A 1OFQA 4L65A 3LHTA 2QUTA 3BQ5A 1HN1A 2CZFA 1XH1A 4CQBA 3L4YA 1RA0A 3U48A 3Q6JA 4MMWA 2OZ3A 2WNNA 3WJXA 1TSIA 3CL8A 2DH3A 3CZ8A 4U4MA 3EWZA 3TN5A 2X1RA 4JQAA 4O1EA 5D2YA 1XRFA 1B3YA 3TJXA 3T2OA 3U0HA 1LWJA 1CGXA 5BXPA 2WMIA 1V6WA 3M16A 2QAFA 2QS8A 2DQXA 1SW7A 3G0SA 1E1CA 3QVQA 2J77A 2YA0A 5LGXA 2EG6A 1RY0A 2G8ZA 2OO0A 4RDYA 4Y7EA 3TSBA 1GG0A 3G1FA 3IARA 1VF8A 3WFAA 3GY1A 3OQEA 5C70A 2XSXA 3BL3A 1JDAA 2O56A 5BOFA 3SN0A 3RLHA 2DGAA 2VELA 3HB9A 3DK9A 2V5KA 4F66A 3S5YA 3KRSA 4PODA 4XBJA 1ITCA 5DX7A 2DZXA 3ZOAA 1W3IA 5EMMA 1OCJA 4ZENA 3C6CA 4QJ4B 2G4FA 3NQEA 3PZVA 4MOZA 3GZ3A 4Z1BA 3V5FA 1FWTA 3HFYA 1W3TA 4TR9A 3QLDA 1SO5A 1XYCA 2A3CA 1I9CB 1XLMA 1UHVA 3AWOA 3B3DA 3ORWA 3DBPA 2EKGA 3WLIA 2PRLA 5AHNA 3VKDA 5FD0A 1PKMA 3OHMB 3LLDA 2NT0A 4JQ1A 4JTCA 3BGAA 4ZQRA 2E6DA 2AQVA 3E02A 5U1OA 2PDWA 3UP8A 4R7JA 3N12A 1AMYA 1CTNA 1FXPA 1TPC1 3GVRA 5GNYA 3O0KA 4Z2IA 5C54A 3S9YA 2C1IA 3A13A 4YS1A 3SCSA 4L4LA 4A8LA 4AZ6A 4A3RA 3R0KA 1R9ZA 4H9VA 4FNTA 3EOOA 3EWUA 3C8FA 3KVKA 4UFKA 2P50A 1PWMA 1CX9A 1OCNA 5B80A 4IIBA 1EFZA 2GQAA 1JPIA 3AICA 1JPHA 4LQ1A 3GG1A 3Q4DA 3W72A 1W32A 1XRVA 3GBEA 3R79A 1GWJA 3GRIA 1AL8A 3DKLA 1ZBCA 3CUHA 5I3FA 4L56A 4MNLA 1L8PA 2ZVRA 2YXXA 4HD5A 3TV8A 3W7QA 4AEEA 3UEQA 4Z2GA 3CUXA 4L61A 1ZUAX 3GYCA 1OT2A 2PRMA 3ABRA 1NFGA 4TVUA 1FKWA 3OGVA 3D3AA 2FH6A 3DESA 3C2VA 1OGBA 1VJZA 2QCDB 3WQDA 1EPXA 1SO6A 1F76A 2P53A 1QPKA 4JKLA 5K2ZA 2ZZ6A 1KFLA 1S5WA 3U4FA 2VGGA 4EP8C 4H9ZA 1MXGA 4C6DA 3C56A 1NP2A 4TVWA 5D37A 3GU9A 1KN0A 1SPQA 4IMAA 1WZLA 4M82A 1V0NA 3NRZB 1EYWA 1N60C 1QWKA 4LUSB 2J8FA 4PMDA 4IQDA 4S3EA 2DH2A 2IQ0A 2VFDA 3TTQA 3OLDA 3G1YA 3UZWA 1TIWA 3PG8A 4TMBA 5LA1A 3P8JA 3D5HA 2E68A 2FZMA 1GOKA 3MYPA 3LS9A 2DV0A 4N6EA 1T96A 4L9XA 1W2PA 1ADDA 3TFXA 2DVTA 4WSJA 4AD4A 4ASTA 1K02A 5CEWA 3DH7A 2E6YA 3NQ8A 1XLEA 1K9DA 4KWOA 1FWEC 2Q8XA 4GJ1A 3M4HA 5HBFA 4IT1A 5CG7A 3CIWA 2WPGA 2YCJA 5EMKA 3FXGA 3DECA 1LBFA 1YYAA 4FLQA 3CH0A 3UJFA 3EYPA 3UR5A 1JAKA 3ZMRA 5M2FX 1VEMA 3T0AA 4AD3A 2BY3A 1R8LA 4XKYB 1DJYA 2IPFA 2E6AA 3VPLA 3V1PA 2J7HA 2OQYA 3FG2P 1PTDA 7REQA 2L5HA 4O18A 3H54A 4Q22A 4CNTA 4UBPC 1JR1A 4JTUA 2R94A 3B8SA 5ABHA 2OSXA 3QV6A 4A22A 1BSLA 1SGJA 1WDQA 2VR2A 1K7FA 1C8QA 3WNNA 3PTKA 2W9MA 4YYCA 3C0SA 3GVGA 1XDJA 5FS9A 1QW9A 4P7OA 2A7RA 1H49A 1O94A 1XYMA 4JHOA 3F4WA 3LLXA 3IS4A 1GQJA 4AY1A 3MPGA 4J9JA 4IG2A 1XH0A 2CZEA 2PRHA 4AISA 4DJFA 3SIZA 4CCZA 1O5KA 1FFUC 1ONXA 1TV5A 4HU0A 1TVPA 4JQ4A 5CSRA 2V3DA 2EEXA 3OODA 5FJPA 3RPDA 1AJ2A 3SGUA 1HL8A 1A0CA 3L7RA 2X8CA 3PB2A 1NJJA 1UWUA 2DJLA 4RW5A 1OX4A 3AXIA 4LY4A 1VGAA 4AHQA 4HA0A 1LQ0A 3IV8A 4PCNA 4W8BA 2PMQA 1H51A 5LA2A 3WDIA 1E0UA 3L5MA 3T7VA 3G8RA 4LPCA 3SQSA 4J3ZA 1AD1A 1QAPA 3RNDA 1MW1A 2XYLA 2WHKA 1JI1A 4HPJA 2FTPA 3S8HA 3GFYA 5D9MA 1QU4A 1FH8A 1LTDA 1TUFA 2PD9A 4H01A 2E8YA 1W1IE 3APYA 1H4PA 4GQRA 4U3AA 5JH1A 4O17A 4XIAA 3VFCA 3EWWA 2YA1A 1G67A 3EUB3 2DSZA 5I7GA 2R1LA 2X1IA 1DWHM 3GRTA 4REQB 2Y5SA 2GVJA 5JCIA 2VUYA 4WJ8A 3VNJA 2NX3A 4FO4A 4GHRA 3HV9A 3VIOA 3ITCA 4WRHA 2AL2A 5LGZA 2XIBA 3APGA 2JF6A 1QNQA 3BOLA 3EA2A 3K30A 4JX5A 4J2PA 1RLDA 1YE6A 1VLIA 4H83A 4H4VA 3P93A 1XG3A 2E9BA 2WAGA 4FNRA 1DHPA 3APTA 1IXNA 2VTFA 3TYUA 5CSYA 1XDLA 3USBA 1M68A 4O52A 5FF2A 2VX4A 2PLCA 2NLIA 4HA1A 3DZ1A 1PZ1A 1XC6A 3NUKA 5CC5A 4IL2A 3KXQA 1DWJM 5H1WA 1MRQA 1TYGA 1XIMA 4H4WA 4QNWA 3CHVA 1ZQ5A 3BJSA 4KWVA 1K3UA 4LEFA 2IQTA 2V38A 4PMOA 1ONEA 1CGUA 4R7OA 5M17A 2RH9A 1XPYA 3LCLA 3ZLFA 3VOIA 2PU1A 4M1RA 3D0CA 2V0TA 3WL1A 2H3BA 4S23A 2PDYA 3CZKA 3JVAA 2HS8A 4M52A 2E77A 5AHFA 3W87A 5F7UA 5D9PA 5KVIA 1TPB1 5CPQA 1JUKA 2A3EA 3KL0A 4AUBA 4DF0A 3M0IA 3URAA 1MMFA 1NWSA 4PTXA 1TFVA 1VFFA 5HNNA 3VGDA 3VGGA 2WM0A 2QPUA 5JBEA 3GH7A 3TU9A 3IEBA 4D9PA 1BHGA 2A3AA 1T8QA 1XDMA 4IPNB 4GCXA 3EA1A 1V3MA 3SCVA 4B9ZA 1Z41A 4WKFA 1LRTA 1M41A 3VNDA 3HGSA 1FO4A 5AHIA 3LGGA 3XIMA 3BGGA 2VYOA 4M3PA 1JCYA 3QPYA 4MPQA 2GR3A 4AW7A 2VZSA 1O5RA 1VIZA 3O6AA 1QFEA 1VKFA 2E1DA 3N2BA 5F2IA 3W84A 2FPVA 5JIPA 3DGBA 1E3XA 4H1ZA 2W54A 1X8FA 1MW0A 4KWSA 2QGYA 2GGIA 3MP3A 3PK7A 3IUIA 2EJAA 3RJXA 4OOZA 1ICSA 1YMYA 2DZVA 2Y7GA 4PFMA 4AU0A 3W2MA 4BURA 2PWDA 3DJGX 3P3BA 4MB1A 2W61A 1BF6A 3D47A 3AMDA 4FXFA 3UPMA 4PYSA 4NVTA 3WDHA 5FSEC 3LY0A 4BKNA 4TIMA 2R1PA 3BQ6A 3LBMA 5G5HB 2HK0A 4URIA 2OFJA 3QR1A 2PCEA 1Y0EA 2XUCA 1C9WA 1GOWA 2PWGA 4YWOA 4S2CA 1YBQB 2YL5A 2YVJA 5U7SA 4LRTA 2AMGA 3DDMA 1OK6A 1ZP3A 5EMUA 1T3QC 1JFXA 1Q6FA 1CI1A 3UWEA 1J5TA 1JZ7A 1H6VA 3TDFA 4AD2A 2XZ9A 3QQ0A 5U25A 2Q71A 4HTBA 1F3WA 3LXCA 1UWTA 4I7WA 2JIWA 4AHOA 3YPIA 5C7VA 5A69A 1UIOA 4PUKA 2GVGA 5FAGA 1KRAC 3FX4A 3W1TA 1KW1A 3L4TA 4Q8VA 3NL5A 3KM8A 2DUXA 2GL5A 1P0DA 4JN8A 5T26A 3W23A 4LVDA 2NQLA 1CLVA 1C8VA 2C3ZA 1JULA 1ZJAA 5IXEA 4PTMA 1C9DA 4WEVX 3UPWA 3GQYA 3NSMA 3VMOA 2PGWA 1Z89A 4KGLA 3CV2A 1A5CA 1QCWA 5HPCA 1HKMA 1CIUA 3A47A 4YCOA 4O10A 4KESA 2O92A 4Q4PA 3GNDA 2YDRA 4XD3A 2IS7A 4P8WA 2C71A 3T9PA 1UMYA 4RDWA 1ZXIC 3E1F1 1V79A 1UJQA 3AIEA 1GETA 1XPGA 3ZSSA 4N9EA 3EXTA 5K9CA 2BB0A 1E9YB 4J3SA 4BA0A 3TN6A 1XLJA 5BU6A 4Q4SA 4CUCA 5I0DA 3F1QA 1I6NA 1NH6A 1VPYA 1CECA 2ISDA 3SCQA 3TA6A 4X0VA 2OZ8A 4JZ5A 3CK5A 4DBUA 5LYRA 2Q01A 4EPBC 4AXNA 1KBKA 2UY4A 1OZQA 3UGRA 2A21A 4XO6A 3M6DA 3UA3A 2VCBA 2XFRA 1DWFM 4MVAA 2BDQA 5DY3A 1QR7A 2BNJA 1QO5A 1P5BA 3BLDA 3HF3A 3NVTA 1E0TA 4TXEA 2Y0FA 1BVNP 2WJZA 1V51A 2G3IA 3UY8A 3CMFA 4JNYA 1VFLA 4W5ZA 4FNSA 2HV5A 1TWZA 4QR6A 3KBSA 4GRTA 1VRDA 1TYTA 4K8EA 2NV2A 5IFPA 3RCYA 2J7CA 2JKPA 3GXNA 2ZADA 2OPJA 3GVQA 2V3AA 2GVLA 4Y6GA 1ZBWA 1UKTA 4I7UA 4NF7A 2XU2A 4K7VA 4MAVA 3WJWA 1UWRA 3WLSA 1K4GA 3RXZA 4HOZA 3GXFA 6TAAA 1XIGA 2V5CA 5BYWA 4I6VA 3F4CA 2OO6A 5AC7A 1LOSA 1WXYA 1IEWA 2JALA 4OBTA 1DVJA 5CZKA 2V81A 4FIRA 1GZJA 3QLLA 3N4EA 3UXLA 3E6EA 1CT5A 4GYJA 4FK9A 3B06A 4JYEA 2J7DA 5IDIA 1EGVA 1YLVA 1BPLB 4AVNA 1P6CA 5DMMA 1JUBA 3FW6A 4F3HA 1TG7A 1JZ6A 1GVFA 3DFPA 1GW1A 5CLWA 2JEPA 3U6WA 4ZBCA 2G3FA 2XWDA 2WSRA 1DWAM 1NDWA 1H09A 3TN4A 3I10A 1S3TC 1MO9A 1H7XA 1E73M 3I65A 4GUJA 4NL1A 1L8NA 2PP3A 4FHAA 4O14A 5HDRA 4O4VA 2LLEA 4B16A 3W22A 1MDRA 4RR4A 4IICA 2XVNA 2XPKA 4PUWA 3HU7A 3TE9A 3ITVA 1XD0A 1YXYA 2NZLA 4B4FA 3UWZA 3T0DA 2QZRA 3CUIA 2ACQA 3IRSA 5CPOA 2OTDA 5EGRA 4C6MA 4A2SA 3AALA 1J12A 2ESCA 4IF2A 3GNOA 1PVNA 4OV4A 2XWEA 4WOZA 3HQPA 1XD1A 3AMGA 1DWIM 1TB3A 1GJPA 1N5XA 2CKRA 1OFDA 2O9OA 1EXPA 3W9ZA 3L68A 3GK0A 4PUJA 1Z48A 1ISWA 3PF3A 4MKVA 1WXZA 3M44A 2EPMX 4AH7A 4KFNA 3NQ2A 2VR4A 5I5RA 2X1TA 3MBFA 1XLFA 3PJXA 5G2IA 2PPGA 1VFUA 3AYTA 1KTBA 4QTGA 5IBXC 3LOTA 1OFOA 1AL7A 1Q66A 1FWSA 1C91A 2V8ZA 1ZTVA 4FX6M 6PTDA 2Q8LA 3OVPA 1VJSA 1XM3A 4RCXA 1NAL1 1XBYA 5KTLA 2UY2A 4WUIA 1K03A 4QGCA 1G7UA 2IW0A 2POTA 4LYRA 1LVLA 4AZ5A 2YSWA 2GGHA 1EEXA 2Y5JA 4XZBA 2P0OA 1X7FA 1QPRA 3LZ5A 2A3HA 1IZCA 3UYIA 3SZ8A 2GDQA 3H2CA 1WPCA 2AGTA 3KCJA 3AWNA 4QDMA 3VO0A 1EA0A 5G4WA 3ZVIA 3DFOA 1IXPA 5HQLA 3VNKA 4S3CA 5A6BD 3WYZA 3NURA 3E38A 3SCRA 4HK7A 1G0CA 2WZEA 3VE7A 3RYSA 5LKYA 1UQYA 1XGDA 3STEA 2WWDA 5EL1A 2ZRVA 4J28A 4LB3A 1KBLA 4YMZA 2ZWZA 4NX5A 1QTWA 2QUVA 1JVNA 3BV4A 3ONBA 2WBGA 4GI8A 4Q4QA 2ZYFA 4IJBA 1YQZA 2ZRUA 4J3WA 1PSCA 5HMEA 4N9CA 3KOWA 3DFHA 4UTTC 3NDZA 1QHPA 5AC8A 2WLYA 1A53A 3W76A 3E0FA 4ONVA 3U7BA 3CUFA 1KM5A 1EZWA 2TRSA 4O1AA 1MQQA 1DXFA 2QHAA 3C0JA 3LXBA 4BQ2A 3SBFA 4LS2A 2WMIB 3ANUA 3MJMA 1WZKA 4AXKA 3VMPA 1EJXC 3WBYA 1OCQA 4GNJA 3HG3A 4LT9A 1IE7C 1C29A 1OIMA 5CC7A 2OCZA 3R89A 1W1PA 1I1WA 2GJXA 1SQ7A 3W7EA 4LVAA 2PZNA 4J35A 1IWAA 4IMEA 1MW3A 4JY9A 4NY2A 4H4YA 3LZ3A 5A6BA 3L0NA 3TUUA 4JTDA 3W2NA 3FKKA 4HMCA 4B3KA 2EBNA 1EP1A 3U7VA 4HK6A 1WYGA 3SEPA 1FFVC 1XGEA 1PS9A 3W7HA 2FQIA 3DFQA 4F9DA 3GS6A 2G5WA 1H1ZA 4QLJA 5C9RA 4MF4A 3VM5A 5KZ6A 4BWLC 4YU1A 1C90A 2XIJA 1DJHA 4LNCA 4LV4A 2D1ZA 5L6UA 2R1NA 1FCQA 1Q8AA 4XB3A 1EQCA 4J27A 2ACUA 1A3HA 1N8FA 2NX9A 3EAOA 2FTYA 4LEQA 4HMNA 2ZDRA 3A7AA 4RXFA 3L2IA 3O9NA 1JAEA 3ZS4A 3NVWB 1N61C 2NV1A 1RCOB 3GE7A 1L6FA 1QBBA 2A85A 1GRHA 3DGZA 2XVGA 2VVNA 2C7FA 1T6MA 4JFTA 3WBXA 3PM6A 1RHCA 2WBKA 4OUEA 2CLOA 3NPXA 5AYZA 4MNKA 2J27A 1EC8A 2IKHA 4XZWA 2BVWA 5HWJA 3CT2A 1OFEA 1GQNA 3M46A 1FWRA 3MJYA 2QW5A 4US6A 4CQ8A 4MB5A 3UZZA 2YZ5A 3BE7A 2OYLA 4MY1A 1UKOA 1KFJA 2W62A 1DE5A 3VAVA 3LNPA 1DXEA 1BG4A 1EJRC 4GH3A 3PUEA 1QHOA 2Y24A 4KGJA 4YPJA 3SCOA 2XVPA 2VHLA 3W53A 1FWJC 4LTSA 4DXVA 3VGFA 1BTCA 4JDBA 1JZ3A 1PO9A 4MWAC 4A29A 3BC9A 3GR8A 1C93A 4A05A 1F5ZA 1KFEA 2P5NA 4GQ0A 3EA3A 5HNRA 4AYSA 3QY7A 4Z1CA 2BBFA 4HB7A 1JF6A 4CNUA 2D2HA 3UT0A 5D02A 1E0VA 4G7FA 5A8MA 4ECLA 4RDVA 4TX9A 2WNZA 3L4VA 2PF0A 2CXEA 1VEOA 1HVXA 4BQ5A 1UKSA 3DI1A 2FDSA 2B7PA 1QDSA 2C3DA 1GOXA 1D2KA 3SI9A 3VNZA 4NZCA 5I3HA 3UR8A 4FOKA 2BY0A 1US3A 2XSAA 3FCPA 3N9RA 4PUDA 2CDUA 3HTWA 3NDOA 2ALRA 2ZCGA 4Y9PA 1BVZA 3CLMA 3MUY1 1K8ZA 3EXRA 4O1FA 1BYDA 2J7GA 3MVIA 5CZ0A 1R3SA 5JCNA 1V02A 3NYDA 2X09A 1LL7A 3L2MA 1D3CA 4UOQA 4LYKA 4LAKA 1BD0A 2JEQA 1XXXA 1SZFA 4YTRA 3BZGA 1KB3A 1PTAA 1YNQA 3F2BA 2AAAA 3KBVA 3EKLA 3QF0A 1J2WA 1CWYA 3TJ4A 1HKKA 3FGCA 3SR6B 1LJYA 3PULA 4MG4A 1BG9A 3GXDA 4GCAA 2FGZA 3DYMA 3H4GA 3VD9A 3NSNA 1MEWA 7REQB 1OX6A 1W8GA 1M7OA 4BF9A 1ECEA 2I1OA 2QAEA 2XN2A 2Y7FA 2DIEA 2Z1XA 2GQ9A 4DNMA 3BMXA 3W26A 3LTPA 1ZJBA 4EE9A 3WK3A 3K13A 1V6XA 3M0XA 2HROA 1P4CA 3AMZA 4WD0A 4FALA 5CZTA 3S1WA 3NZ1A 2CHRA 1UH2A 5CZSA 4AC1X 1EC7A 5G5IA 3NL2A 2ISVA 3T0BA 4WY0F 3N04A 3FJNA 2FVKA 2R24A 2PDGA 1YPFA 3B8DA 1YDYA 4UMAA 4GY1A 3MMUA 4C7DA 2V3FA 3O15A 3MC5A 3E2RA 5FKYA 1OC6A 2PS2A 1PYFA 4MKSA 1BVWA 1UWSA 3U5YA 1A49A 1B3WA 2TPSA 2C91A 1A80A 3IGXA 3VGHA 1OX4B 2EF9A 4ERAA 2W3RA 4AQLA 4C7GA 1W9XA 3I7RA 1E56A 3KWXA 3TC6A 4C6FA 1QK0A 2B7QA 3MO7A 5DELA 4UCGA 3WH5A 4M24A 1DOSA 2VEKA 3R6IA 4JPGA 2QAPA 4U10A 3FAXA 4MDPA 1MFUA 1LF1A 3BLPX 3W7RA 1NWUA 1JDCA 1O12A 5DY2A 3IC9A 3IUDA 2E9LA 3TTYA 2ZZ2A 3QR3A 3EXSA 4I9MA 4LUYA 4H4PA 1CXKA 4PMXA 1XGZA 1IR2A 2WO5A 1F6YA 2AKZA 4Z2JA 3SGGA 2WOQA 2AL2B 1WKYA 3A3HA 4RUBA 1VJIA 1UR1A 1AH3A 2JK2A 2UBPC 3OB8A 4FDCB 4M6VA 1AW5A 1P0NA 1VP5A 3EDFA 1FCBA 2CLFA 3GD6A 3MANA 3BK0A 1ZKQA 4AWTA 3BJFA 2F6XA 3TW6A 4QAIA 3CMJA 2W6RA 3A3XA 2NV9A 3S1XA 1UH3A 4BCEA 1H63A 4POCA 1TV4A 2AL1A 2PDHA 4TV6A 1Q7ZA 3WMBA 4W87A 2DSWA 1UQZA 3TC3A 3WO8A 4HU4A 4J3TA 4PCFA 2O9PA 4OQVA 5C55A 3FNDA 2GUBA 4YTSA 5AC6A 2GSEA 4DWSA 4D6DA 3W4RA 3WX7A 4LW7A 1TELA 2IXVA 4Q8UA 2I9UA 1TJ0A 2YLLA 3DHFA 1AQ0A 4FF7A 2GQ8A 2EJ1A 4F0HA 3AHVA 4GR1A 4H2CA 3WMSA 1JG9A 5HJYA 4M6UA 3A12A 3S9ZA 2E25A 4FSAA 2F38A 3HJZA 3FHQA 4LA1A 1K1DA 3O6CA 1FHVA 1P7TA 3PZOA 4Y9AA 1QATA 4FX8A 3INPA 4CVUA 1GYLA 4ZO7A 3DFYA 3V18A 4Q8OA 2HXTA 3PNUA 3G6MA 1KLYA 4ZTXA 1I2NA 1IEXA 3H7VA 1J0HA 1VFSA 3DHUA 3WMLA 1R0MA 5I3KA 4LC8A 1JRBA 4GZIA 3BLIA 2QV5A 3I6EA 1A5MC 4P7QA 3OG3A 1U2YA 2YVGA 3D9XA 3O1NA 1F8WA 1DJXA 5E70A 1HX0A 4ES4A 1HGWA 4NG3A 3FAWA 3OTRA 2HQAA 3GZAA 1L2UA 1KM0A 3FXYA 4GZJA 4ZOHB 1T41A 3GXTA 1KCLA 3C2FA 3EWDA 1GVSA 3MTWA 1FWHC 4EQWA 3DG3A 5G1TA 4DVOA 4ZODA 4K7ZA 3BJTA 4JX6A 3V5OA 1H1NA 1S46A 1S3HA 1F8IA 2C18A 1NQ6A 1IWPA 1K6AA 5BRQA 1R3WA 1QW8A 4LH8A 2QJJA 1Z7AA 2G41A 4GFSA 3LMYA 1C8YA 2QJIA 3VXGA 4UTFA 4UNLA 1XFBA 1EEPA 4Q7BA 3R8RA 1J18A 1JOAA 1MZRA 4RZ5A 5H2ZA 1EJUC 1UUMA 2J7EA 4CEUC 2W67A 1J0KA 4O15A 4UCFA 4W85A 3M1ZA 3R8HA 1O1ZA 3G1DA 2BC0A 3NZGA 3HFTA 3QEZA 2C19A 1QK2A 4LXFA 3PPFA 1VBHA 3REQA 4BHYA 2A7NA 1MXDA 3NVYB 1AODA 4R3UA 4G9PA 3TCSA 2PDFA 3N6HA 3MSGA 4DBSA 1B3XA 4B5TA 4E3VA 2HNEA 3S42A 2YL8A 4H3DA 5REQA 4B5NA 1XLCA 1K4HA 1IEQA 4J4KA 1QVBA 3VIGA 1VLWA 4JFUA 3V3WA 3VILA 3WQOA 4E5TA 4W9TA 1E6ZA 1RPKA 3GUGA 1UKPA 2XFFA 2BHUA 3CPUA 1NSJA 1WDWA 1UA7A 4OE7A 5FS7A 2QR6A 1A5AA 4JICA 1T8XA 2ZZ4A 3PTDA 5ECVA 1EF2A 2V6OA 4QCEA 4HNOA 2E4TA 5FF3A 2CESA 1RY8A 5GJPA 3VTRA 4IFOA 2V82A 3DEQA 5IRPA 3DYOA 3GIQA 3HV8A 2CLHA 4Y8FA 3R94A 1W9UA 1LZOA 2YB4A 3GHUA 5D05A 1E9LA 1H5VA 3U2CA 5FJOA 1NHQA 5CXPA 1E6SM 2D20A 3EBVA 4DUXA 1Q6LA 3PTMA 1A5LC 3UWWA 4GE8A 2Y1HA 5HANA 1FWIC 4WCJA 3KS5A 1K6WA 2Z25A 1WAWA 3EDKA 1E6NA 2BXVA 3CBWA 2WCGA 4MJ4A 4ZR8A 3THCA 1PBGA 1WKEA 5BXTA 4WDWA 3EOSA 2J88A 4J3VA 3II1A 2VL4A 3EKGA 1HGYA 1W3HA 4HVXA 1UC4A 4Q33A 4H6EA 4IGNA 1NDYA 3CGCA 2QEZA 4GG9A 2X40A 1BGAA 4JKMA 3CYJA 4UR9A 2VOMA 3NGFA 3AHTA 1ENUA 3CUZA 2XN1A 2WHJA 3QZAA 1QOPA 4MWAE 3IIOA 3MCMA 5H8UA 3KOFA 3WK1A 2TYSA 3RAOA 4Z42C 4LWWA 5HQMA 3GG8A 1FWBC 1XYZA 2WMJA 3M47A 1DJZA 3N6JA 3W88A 4H4QA 1DTNA 3GVWA 4IX2A 1XL9A 3W7DA 2E7FA 1JYNA 4MLJA 3WF1A 3LU2A 4PH6A 3GAYA 5C7HA 3MMWA 4HN8A 3AHXA 3WBEA 5CSUA 4S39A 3HW2A 4GKLA 3QW4B 2HXUA 3F2DA 4WDUA 4PMNA 4HA3A 4LNYA 1NU5A 3THDA 3B0UX 4Z08A 1W5PA 4C91A 1FP8A 1MSSA 1GPFA 4B3LA 3VINA 3KLJA 4C6QA 2W63A 1AZ1A 4ZE4A 1WUFA 5FJTA 3GTFA 4F2BA 1PKNA 2GUYA 1J93A 1GRGA 5A5WA 1AVAA 1HF6A 1W9PA 4IP5A 1D9EA 1MXSA 2PDJA 1AH0A 4F0KA 2DT2A 1QPNA 4RJEA 1MO0A 4GXMA 5AZ1A 1Z42A 4M0XA 3ARPA 3M6YA 2G0WA 4K37A 4HU3A 4C6IA 3DGRA 2AQOA 4HN4A 4KCVA 4H9YA 1YW1A 5LHFA 1TCMA 2X0YA 5DRCA 2YR1A 2VD9A 4DLMA 3LI1A 5H8MA 4LAOA 1SSGA 1A5SA 2BVTA 1XW8A 4Q6JA 1XFCA 4NZJA 4L80A 1UMLA 7XIMA 3WQ5A 2VEIA 4KF1A 3PN8A 2YFNA 3MSDA 1H0IA 4AZBA 2J8TA 5M5DA 5FL0A 1Q63A 1X39A 2OWXA 2REQA 4MY9A 1OD0A 1QWGA 1BGGA 3HQNA 3N34A 2GJRA 1XHCA 3WLLA 4X63A 5AHMA 4G6CA 1JYWA 5TNVA 4PBFA 4UFLA 1OJXA 2I56A 1Z69A 1SZRA 3H53A 4TU1A 3ZJ7A 1SMAA 2HISA 3ES8A 1MEHA 4P8XA 4PUEA 3TWAA 2ZTJA 3CHEA 4ZSUA 4AHPA 4D2JA 4JTAA 4KETA 4WK9A 2WBAA 4AC7C 2EKCA 1TWWA 4A8RA 1L6WA 2XIOA 3B0XA 3KBJA 4N4QA 1O60A 3IJQA 2YCKX 3CWOX 2INFA 2WYSA 4XD5A 3WLQA 4EANA 1K9EA 3LCGA 3W28A 3MCNA 5HOSA 1Y65A 3MWCA 1ZCOA 3UFYA 3QPEA 4DI9A 4LB4A 1ZAHA 4FIQA 3E12A 4GIEA 5B7YA 1W5OA 2DQWA 4XKYA 3KBMA 4GVIA 1EHAA 1A4LA 3LEPA 3WD3A 3Q65A 3M0JA 1F4HA 1VZWA 4TX8A 4RV3A 4JL1A 3OQ8A 4PMYA 5AZ0A 2ZZCA 1VFMA 4FLOA 3UPBA 1NDAA 3BSGA 4DI8A 2J47A 2VEGA 3I6RA 2NQZA 4MM1A 1CDGA 3BW3A 4XAGA 2INEA 3CZEA 5EFFA 3QKZA 5T8GA 3TEVA 2G97A 3ES7A 2VEPA 1VBRA 3I7QA 5BXSA 1QW7A 2DPEA 2CKSA 3GDKA 7ODCA 1V59A 1J96A 1CXLA 4PUNA 4M8UA 1QMLA 3OYZA 3GH5A 2I14A 4GJIA 4DYEA 1M1BA 1EO5A 4P8VA 4AD1A 2GDUA 3BV7A 4AIBA 5BRBA 1PHQA 5I78A 2BHYA 3H12A 2H8XA 2O0TA 2HMCA 3E0LA 3BW4A 1QHZA 5K7JA 4BV6A 3S2LA 3A23A 1ME9A 3R0DA 3NPWA 1G5AA 1A0EA 3CXOA 4MZ1A 3TTSA 3FSUA 1B3OA 4GPNA 1N7KA 4BI6A 3NNTA 5D9OA 4QS5A 2ZRZA 1GUVA 3E9AA 3L5AA 4TTGA 1PJ9A 3SO7A 3THAA 4GNKB 1MUMA 1DIDA 1VFHA 5E6ZA 2DVXA 3K8MA 3TTOA 4UTLA 5CPSA 2TSYA 3WDRA 2GJXB 3B9NA 2XFWA 2XIQA 3RRXA 1L6YA 2GH5A 3W7MA 3L12A 3RMEA 4DO4A 4REQA 1KA9F 3RFAA 4FAMA 5HMFA 1Q45A 2WPCA 4JEQA 4NXSA 4S3JA 4RE3A 1AJZA 5C71A 2QQ6A 4BF5A 3L23A 3WJYA 1QO2A 1LOQA 3CPRA 2MNRA 3ITLA 3PUDA 4E3TA 5I23A 5HUPA 5J8LA 3NQCA 2V5LA 2W92A 1EA9C 2DVUA 2J6XA 4R88A 2D73A 3MP4A 4KFOA 1IZJA 1RXOB 4L64A 3RJYA 1KV8A 2X99A 1GKPA 4FLSA 5HA7A 5CJNA 3MKCA 4HOXA 4L5ZA 4GBDA 4A3UA 3DFNA 2PC8A 1S5NA 1UCWA 3IVTA 1V7YA 5DMLA 4FEZA 3LQLA 1EKOA 3LPFA 1FECA 3AMLA 1PYMA 3GD3A 1J0YA 4LVFA 1K8YA 3U2OA 1M7JA 2VEFA 3KW3A 5FCZA 4UQBA 2CLPA 4QG6A 3WQCA 4UC5A 1OT1A 3NTYA 3A7UA 1FDJA 5HWNA 3W7CA 5I3GA 4ENLA 2YXOA 3RM4A 1JEHA 4UMCA 1W3LA 4HNCA 3ETRB 3QMTA 3AYVA 2V30A 3STCA 4TMCA 1TR1A 3AIRA 3H6OA 2Y88A 3S5SA 4GQGA 2DY3A 4XKMA 4YCPA 4TQTA 1HJQA 3LXDA 1Q6CA 3EEZA 4FP1A 3PZNA 4GWEA 1GOOA 5PTDA 3PZQA 3U2ZA 3IIPA 5I24A 1EDQA 1A0DA 3RLVA 3AYSA 2Y8VA 1HJVA 4WHBA 5AVHA 1REQA 1KFWA 3EMZA 3LV6A 1O4UA 4TX6A 5JBDA 4DZ5A 1E4MM 4MTVA 5MF5A 1OD8A 2JKEA 4XQ6A 1EXBA 4ACYA 1SW0A 1U5HA 3TYDA 3N14A 2QF7A 4KCWA 4LBRA 4LUTA 1AOGA 3V4BA 2OSYA 3ZFHA 5FJUA 3L5OA 4DB7A 5BMXA 1PXGA 1RK5A 3ZR5A 4JGDA 4AZ7A 1Q6EA 5K4XA 5EMYA 2WMKA 4ZOBA 4HA4A 1IV8A 2WZIA 4BI7A 4MB4A 3DG6A 2B7OA 4DPPA 3URNA 3BAWA 2BX7A 3M0YA 4ROPA 4UTUA 4LOCA 3WQPA 2WKGA 3MCOA 4C6EA 1H61A 2QV4A 2OWWA 1NM9A 1FWNA 3EKZA 4PN2A 5I2UA 1KCZA 3VCNA 9XIMA 2PE4A 5AYYA 1QOXA 3Q67A 1HUVA 1UJPA 3E0WA 3SUTA 2GFTA 4W7VA 1QOQA 4LALA 1WAUA 5M3WA 4K8GA 3VDBA 2X41A 3PHAA 2QJMA 4MKNA 4LBUA 4DZIA 4HZ8A 1GKQA 4G1KA 4YJ5A 3BTNA 1VENA 4HMDA 2QIIA 4X2RA 1G9HA 3S2MA 4H4XA 3WQFA 4WVXA 5IHSA 4GIRA 1KWKA 4E6MA 2J6VA 3SUSA 1JFHA 5LNWA 1GRTA 3KDNA 4NASA 4LGXA 4YWSA 4EOUA 3F03K 1EJ7L 2GK1A 3W7OA 3UA4A 1GQLA 2Y70A 1K70A 4DJEA 3M64A 5EPDA 2X05A 1B57A 4QFUA 2NQHA 4X2PA 1XLDA 1LOLA 2QCMA 1ZALA 4WZHA 2I17A 3H24A 1I1XA 3FGCB 1HFBA 1WUEA 5ECUA 3BICA 4DRSA 5ER0A 1DEDA 1E1EA 4GC4A 1KXTA 3ARXA 4GC3A 4CVWA 5CJMA 1HKWA 3ZM8A 5FSDC 2XGIA 1JI2A 4XZ9A 3WQVA 1GXFA 2NSOA 1TJ1A 2WZHA 2WVTA 3SSZA 4PMVA 3T0CA 3C86A 3FV9A 2OGJA 2CZVA 5DLCA 2PEVA 4QE4A 1UB3A 4K1WA 1WB0A 4RV8A 1NELA 1RK6A 3EPNA 1V3KA 4PTNA 1FQ0A 4JX4A 5HINA 2VVSA 3QGVA 4PRWA 1XINA 3BAIA 3WEOA 3WUBA 3PZMA 1KBIA 4LF2A 4XAZA 4HNUA 2X1UA 1ECQA 2XH2A 4JQ9A 2BWGA 1J0IA 1GVYA 3QGKC 4ZOEA 4C90A 1G4EA 2WSYA 1FTXA 4ZXLA 4UTHA 2FFIA 1FWGC 3LA4A 2YDSA 3B8WA 5BNKA 1GZGA 1WOBA 2WZMA 3W1RA 1THFD 1BXNA 2VRQA 5I77A 4GGBA 3PR2A 2OEJA 2O7SA 3I4EA 4JTJA 3NQAA 3V36A 3VKCA 4A8IA 4GACA 3PSWA 3WZ0E 3GIYA 2ADAA 3CAQA 1AUSL 4H8UA 1G01A 3FVMA 1SR0A 3CAKA 1IZKA 3FFSA 3DOPA 5J04A 1M3UA 1XUZA 3FHAA 4MFEA 3Q37A 1X8CA 1EP3A 1WP6A 1RPXA 2CBVA 2ABBA 3ANVA 4ZXOA 3ITXA 5JUVA 4GA8A 5JCLA 4KEMA 2FKPA 3W7PA 3AROA 4UNKA 4CQ9A 3BLEA 3B8UA 4DNHA 4PMZA 3H2OA 3QFAA 1TPEA 3LM7A 4RLIA 4GYPA 3IAQA 3AHZA 4ZSTA 3GG0A 3GUWA 3O16A 3ANYA 3O8AA 5MHBA 1HNYA 4L1XA 5A1AA 1UP0A 2E5CA 4V33A 2FYMA 3N2CA 5BMWA 5I06A 1S1RA 1TWDA 5LSMA 1ML1A 3JS3A 4UXDA 5A2BA 3KRZA 4NZ5A 5XIMA 3WQ6A 4XAFA 3VK5A 1OB0A 3BCFA 1KO0A 4MUZA 3MKKA 3D3FA 2EO7A 2VZVA 3RG6A 5E0KA 2GUUA 5U4NA 1V6TA 4HU8A 4O53A 4DWSB 1TV2A 3TLLA 1W2VA 4UFIA 4J57A 2ZUTA 3PPGA 3W82A 4IWWA 1WX0A 3LHYA 1A3XA 4EVZA 5AECA 7TIMA 3MSRA 1O1HA 2WHMA 3NA8A 2HCVA 3G1SA 3NFUA 3UZYA 4Z0SA 5TAOA 4MWAB 3HQOA 2A8XA 4XO7A 3CQKA 2VFEA 1Y7VA 4RE4A 4H7CA 1XANA 2RUSA 5FI8A 3LHVA 1L0PA 2P1FA 1XLLA 2PAJA 3MP5A 2V2CA 2BP1A 3PC0A 4ZQPA 2RFGA 3ZZ1A 4Q6XA 3GXIA 5KMYA 2W91A 2WMGA 4IH3A 3C0QA 1H11A 5I09A 3AIWA 4RX0A 3EWYA 2OB3A 1E1FA 5E09A 3LCFA 4I8DA 4AZGA 1LWHA 1OJTA 4GJJA 1BFNA 1UD6A 1QUMA 1SYTA 1U30A 1UR0A 1GQKA 3WNOA 5D2TA 5JIWA 2WSQA 4OOUA 4LC6A 4F8XA 4F79A 4JYFA 1RQHA 4V15A 3VDGA 1I2RA 3B03A 1DIOA 4OFCA 3RN6A 1POJA 4MJZA 2E8ZA 4YLWA 3MVTA 5H91A 5DXYA 4KWUA 2PDLA 4HYWA 3TR9A 4RZ6A 3G8EA