4E4FA

Crystal structure of enolase pc1_0802 (target efi-502240) from pectobacterium carotovorum subsp. carotovorum pc1
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
405
structure length
386
Chain Sequence
SMKIVSAEVFVTCPGRNFVTLKITTDSGLTGLGDATLNGRELPVASYLNDHVCPQLIGRDAHQIEDIWQYFYKGAYWRRGPVTMSAISAVDMALWDIKAKAANMPLYQLLGGASRTGVMVYCHTTGHSIDEVLDDYAKHRDQGFKAIRVQCEPATKGSLPEEQLWSTEKYLDFTPKLFEAVRDKFGFNEHLLHDMHHRLTPIEAARFGKSVEDYRLFWMEDPTPAENQACFRLIRQHTVTPIAVGEVFNSIWDCKQLIEEQLIDYIRTTITHAGGITGMRRIADFASLYQVRTGSHGPSDLSPICMAAALHFDLWVPNFGVQEYMGYSEQMLEVFPHSWTFDNGYMHPGEKPGLGIEFDEKLAAKYPYDPAYLPVARLEDGTLWNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ENOLASE PC1_0802 from Pectobacterium carotovorum
rcsb
source organism Pectobacterium carotovorum subsp. carotovorum
molecule tags Isomerase
molecule keywords MANNONATE DEHYDRATASE
total genus 138
structure length 386
sequence length 405
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4e4fA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4e4fA01
2PMQA 3OZYA 1TKKA 2GGJA 4GIRA 1JDFA 3ES7A 3VCNA 3V5CA 2PSNA 2OQHA 3PK7A 4JN8A 2PU1A 3OW1A 3FJ4A 2PTYA 3DIPA 3R10A 3STPA 3UJFA 2MNRA 3MUCA 3RCYA 2PP3A 4MMWA 3T6CA 3DG3A 2FYMA 2QJMA 3MQTA 4HNCA 3SN4A 4A35A 1JCTA 4GFIA 3I4KA 2P8CA 4KEMA 4ZCWA 3ZLHA 3CXOA 4E5TA 4HCLA 4K1WA 3SBFA 3QN3A 1OEPA 2PU0A 3RR1A 4HYRA 3N4FA 2XH0A 1RVKA 1KD0A 5EU9A 4JHMA 3DESA 3N4EA 4F4RA 3PWGA 2AKZA 3JW7A 2PPGA 2GGEA 3H8AA 1SJBA 4Z17A 4K8GA 3BSMA 3GD6A 2GGGA 1TZZA 2OO6A 3UJRA 2HZGA 3I6EA 2QVHA 1E9IA 3VCCA 4DN1A 3Q45A 1ONEA 4H19A 2OVLA 4GGHA 3PWIA 1MDLA 3SSZA 3SN0A 5FJTA 3P93A 4IHCA 3ZVHB 1BKHA 1PDYA 2OX4A 3TWBA 4E4FA 3MKCA 3DERA 2QDEA 4DHGA 1EC7A 4J1OA 3S47A 3UJ2A 1WUEA 1FHUA 1JPDX 3RITA 4DYEA 5BOEA 4MKSA 6ENLA 1MUCA 3DG7A 3I6TA 2AL2A 3D47A 3OPSA 3GC2A 3FV9A 2QJJA 2AKMA 3QLDA 3IJIA 2XH2A 3OP2A 2DW7A 3IJQA 3FYYA 3ZLGA 2GL5A 2OZ8A 2OPJA 2I5QA 3CT2A 2PTWA 4E4UA 4MGGA 2P88A 4H1ZA 3EKGA 2PODA 3DGBA 4GGBA 2XH4A 2PS2A 2PA6A 3Q4DA 2ZADA 4GMEA 4KT2A 3UJEA 4M6UA 2QGYA 1JPMA 1W6TA 3UGVA 2ONEA 3UCCA 4JN7A 3IJLA 3EEZA 3NO1A 4HCDA 1R0MA 3VA8A 4G7FA 3OZMA 2CHRA 1MRAA 3ZVHA 1EBGA 4IZGA 3CAWA 4EWJA 1KCZA 3UXLA 3THUA 3ZLFA 5FJUA 3V4BA 3R11A 3CYJA 3VDGA 3NFUA 4GYPC 4IP4A 1EC9A 1MNSA 1TE6A 3VC6A 1EC8A 3QKEA 4IT1A 1ECQA 2XH7A 3P0WA 2PP0A 4H83A 4FI4A 2PGEA 3T9PA 1L8PA 3V3WA 4H2HA 3H70A 1MDRA 2O56A 4ENLA 3V5FA 2QQ6A 1P48A 4K2SA 2PCEA 4HN8A 2RDXA 5IDZA 2HXTA 3MSYA 4KPLA 2P3ZA 3SJNA 3R25A 1XS2A 3UCDA 3DFHA 3GY1A 4HNLA 2NQLA 3TWAA 3GO2A 3N6JA 1SJDA 4IP5A 2OZTA 2GSHA 3RO6A 2MUCA 3TJIA 3SQSA 3HPFA 3CB3A 5BOFA 3QTPA 2PGWA 1P43A 4FP1A 4A3RA 3DFYA 2XGZA 1XPYA 3TTEA 1SJCA 1IYXA 4DXKA 3KUMA 3UJSA 4IL2A 3MZNA 3UXKA 1PDZA 3DG6A 4KWSA 1FHVA 3FCPA 2OQYA 2AL2B 3U4FA 4DX3A 1F9CA 4HCHA 3K1GA 2GGIA 5FJPA 1SJAA 3R0UA 3JVAA 1R6WA 5FJRA 3R1ZA 1NELA 3QPEA 4DWDA 3CK5A 2FKPA 2XSXA 3TJ4A 2AL1A 3P3BA 3DDMA 3S5SA 3MWCA 3D46A 2OG9A 1EBHA 3N6HA 1KKOA 3TCSA 3NXLA 4GYPA 3VFCA 3BOXA 1WUFA 1NU5A 3ZVIA 2PTZA 3ES8A 3T4WA 1BQGA 4Z1YA 3DEQA 4X2PA 5FJOA 4E6MA 3R0KA 3RRAA 4E8GA 2HXUA 3U9IA 2OFJA 2PTXA 3T8QA 3VC5A 3TW9A 4GISA 3PFRA 4A6GA 3FXGA 3FVDA 3OTRA 3TOYA 3MY9A 2QJNA 3ENLA 4YWSA 2HNEA 3B97A 2GGHA 4J3ZA 3RGTA 3BJSA 1YEYA 3TQPA 4HPNA 2OKTA 1ELSA 2DW6A 2PP1A 3JZUA 2P8BA 2GDQA 4G8TA 2QDDA 2ZC8A 3H7VA 3SN1A 2P0IA 3IK4A 4IL0A 4ROPA 4M0XA 1KKRA 5J04A 5ENLA 1DTNA 2OLAA 3H12A 4ZA0A 2POZA 7ENLA 3NZGA 2OZ3A
chains in the Genus database with same CATH superfamily
4XUYA 1TKKA 5TD4A 4GCAA 4WF7A 1SMAA 1G69A 3LCWA 3E6EA 3IGUA 3BW3A 2W55A 1RPXA 4F0MA 3WENA 5FF0A 2GUBA 2XIJA 1IZJA 2XN1A 3FJ4A 1RP8A 2GR0A 2MNRA 1AA1B 3W22A 3BDKA 4LAZA 1N7KA 2HSAA 4I5RA 2E1DA 3WDRA 4QJ5B 3GX9A 3NVZB 2WOVA 4LBUA 3EOSA 1PTDA 4PUDA 5AZ0A 1GERA 2C19A 5I3HA 1GTEA 1K1DA 3SN4A 2F9RA 3AALA 1E6QM 5LGXA 3E74A 3L68A 1G0CA 1EWDA 1UHVA 3H21A 3LTSA 2OJPA 3O05A 4E5TA 4XVDA 4UWMA 4AYGA 4HQVA 3SCUA 3NYDA 2V5LA 1Y5XA 2XH0A 2X8GA 4Q4RA 3LQGA 3TC3A 2WPGA 5F4WA 2R1KA 3B9EA 1EYWA 5A8OA 1E9LA 4MDOA 3TN5A 2EPOA 2GGEA 1ZJBA 2VHLA 1X7IA 1O5XA 2QV4A 2VXNA 3ARRA 4WKHA 4K8GA 2VKZG 4BFAA 2VCBA 3VIKA 3MYOA 4A4AA 1NHSA 2BC1A 4J40A 3N9RA 4B15A 4UR9A 1EBDA 3M0MA 1STZA 4FMVA 1HO1A 1RH9A 3KOWA 3S83A 2OSWA 1E55A 2GDUA 1DL3A 4GBDA 1SSGA 3PWIA 1KXVA 3RUBL 1RQEA 3GDLA 1ZL1A 1FFVC 4R53A 1C91A 2CERA 1IT0A 1SW3A 3AYRA 4FZIA 1UR9A 4H7VA 1ZJHA 3G6LA 4AWUA 4CNNA 1TUXA 3DAQA 3ZMRA 3QGVA 4AEEA 2AL2A 3H55A 4X9SA 2HROA 4HU8A 3EXSA 3RNDA 3A22A 3GVQA 4UQ9A 1H63A 2VZTA 3CLMA 5LXXA 3NQFA 3QLDA 2Y88A 2ISSA 3LCXA 3H26A 3RM4A 3TZFA 4AEFA 4I7WA 1TPUA 1KM2A 3PULA 2RFGA 4CQDA 1R2SA 4JBRA 2DIEA 4H1ZA 2ZZ4A 3EKGA 4UTKA 2FQIA 4HKPA 3MTWA 2Z0IA 2V68A 1XXXA 4TXEA 1XLFA 1VFOA 3UR5A 4NXSA 1QWKA 3NPXA 1TV8A 5I3DA 2QGYA 4LX4A 1CXEA 4LVBA 5SWUA 1EO7A 1ZS2A 4Z1AA 3UQNA 3IJLA 4KMQA 2GR3A 4LF2A 3FNDA 1JOAA 1S3HA 4MJZA 5HNNA 1DWIM 1Z41A 5ER0A 3W26A 3OZMA 4X0NA 1E3XA 2WQDA 2PDJA 1EBGA 3GRSA 2XDFA 3MDWA 4AIUA 4H9UA 2WCAA 3W29A 5G1TA 1PL9A 2YSWA 3GAYA 2ZIDA 3W88A 3R11A 4AIEA 4I9TA 1J5SA 1ICQA 1TRDA 3DFQA 4CD4A 1EC9A 3A3WA 3LDVA 1J79A 1AW1A 1TR9A 1SQ7A 3EBVA 3CUXA 3NSXA 4Q8MA 2GJXB 3GD4A 1WBHA 3BAKA 3RLUA 4LVDA 2J9XA 2VGFA 3CGTA 3EMCA 3NQEA 3V5FA 2QQ6A 5FEZA 4FNUA 1G4SA 3WH9A 1P48A 1VIWA 3UR8A 4N9BA 4O54A 1VENA 4E2DA 4V1XA 1U33A 4AXKA 2P3ZA 2QMJA 5AC4A 4IMCA 1DIDA 5HR6A 4S3AA 1UMLA 4M52A 5FD0A 3NQCA 1UZ1A 2EQDA 2NQLA 1SVDA 3TWAA 1ITCA 3GTHA 3M07A 2SFPA 4NZJA 4E8DA 4QLLA 4NJJA 3GD3A 4CN4A 1XYLA 1K6WA 4I7UA 2O0TA 4AVFA 2ZX5A 4Q4MA 3VU2A 3QGKC 2WKGA 5FEWA 4GO9A 3PM6A 1P43A 3AYTA 2WMFA 1H2IA 4GQRA 3CLWA 1EJVC 3CH0A 2CU0A 3XISA 2P50A 2BG5A 4Q8VA 4UCFA 2Y4SA 1X8CA 2PLMA 4QHRA 4H4TA 2D3NA 2WMIB 3SURA 2WO5A 1ZB5A 1JYNA 1DQUA 1K3UA 3GAKA 3PSVA 3TROA 2X42A 4L1WA 4JIIX 5IRPA 4HHPA 1V7AA 4NX5A 3NJ3A 4M3PA 2YCKX 3KS6A 3A9BA 3P2VA 2E67A 4WOZA 2CKSA 2ISFA 1OC5A 1DBTA 3R1ZA 3GIQA 3UGRA 2O55A 4JN6A 2GQAA 3VD3A 2FGZA 1FP9A 1NOUA 4AIBA 4HA1A 4DY1A 1DP0A 1GZGA 1W9XA 3N6HA 3RHGA 1FP8A 2OT1A 4KWOA 4LC8A 3BAWA 2PC8A 4KS0A 2E3ZA 1BRLB 3WD1A 3TC6A 5I03A 2V9DA 1LBMA 4DRSA 4W5ZA 3ITXA 3DEQA 1OVDA 3W74A 1SPQA 3A5FA 4IM4A 3W87A 2PTXA 4Q8PA 3ONBA 3F2DA 1F3PA 3W0KA 2Z2BA 2ZA2A 3VYLA 2WBKA 1IT8A 2V3FA 3O6DA 1JNEA 3QVQA 3KLLA 6PTDA 3VO0A 3CTLA 1OZMA 5CBJA 4WRHA 4G56A 4EIVA 2GDQA 2PLJA 3WQWA 3PS7A 1KV8A 2QW5A 4PRTA 4E3TA 1BKSA 1CDGA 4YPJA 4I3GA 4DJEA 1K9EA 3BAXA 2V82A 3VGFA 4FIRA 3A9IA 3GFZA 3KTCA 3ZO9A 4GX8A 5I09A 2INFA 3LMZA 4LGXA 4JFWA 1E4MM 1DWHM 4BCEA 1GOXA 3V0UA 1CB2A 1WV2A 3GW0A 2WBAA 3W75A 4Q4OA 1O1HA 2VL4A 4JXCA 2CXEA 3AZSA 2WNQA 4HA0A 1B0IA 1ZP3A 4TOQA 7REQA 3RCYA 1OC7A 5XINA 4P5UA 3GTIA 2QCDA 3DG3A 3VOFA 5D32A 5KTLA 1QI4A 1FX6A 4A35A 5DCDA 3L0KA 3VZYA 3VOCA 4XZHA 1X96A 3EXTA 3W23A 3VGDA 1FBAA 2ISVA 4LUSA 2BX7A 1W3JA 4UQAA 2XYLA 2E3TA 1FH9A 1DWJM 1L6WA 3QN3A 4O8AA 1U5HA 1PWLA 3EPMA 1LLZA 4GO8A 3G0XA 1B4EA 1RA0A 3ABOA 3IV3A 1E4IA 2WJZA 4WKAA 5LNSA 3FYPA 3RX3A 3G24A 1QFEA 2D20A 3QTGA 1ZAHA 2ISWA 1QR7A 4UTLA 3A21A 3G1XA 2GGGA 2FVKA 1CGUA 1Q1WA 3RPMA 1LBFA 1E1EA 3WEZA 2VENA 2YQUA 2XVLA 4XZ9A 5IFPA 1HP4A 1JXJA 3IVTA 1DE5A 4US5A 1LOLA 2Z00A 4QSFA 3BW2A 3SCRA 2X1IA 2BVWA 3S6TA 1B3ZA 1UWTA 4DAIA 4HIBA 1PO9A 2ESCA 3P93A 4LYPA 1FWBC 1X8FA 1HGWA 1IWPA 3FW6A 1EGZA 3NGFA 2QDEA 3DERA 3L4UA 1E72M 5EFFA 1XRSA 4AVOA 3SY8A 3V0SA 4S38A 8A3HA 3GHSA 3DHUA 3HF3A 1FWCC 1ZBVA 1NJJA 3EWCA 1UR8A 3BSHA 3VI2A 4Z2KA 2R9RA 1VRXA 1P7TA 5K9XA 4F8XA 5C0QA 1GQIA 3K46A 2EGZA 4MJMA 3FJNA 1KGUA 2G50A 3JZEA 1UOZA 3STGA 3NOEA 2ICSA 1EPXA 3ZLGA 4IMGA 1F7BA 3NAVA 3CT2A 3VNIA 3C2VA 4ZQRA 4EQRA 1IEQA 1B3XA 3TQ0A 1XANA 4QTGA 1CGXA 2P5NA 1GKQA 3WQCA 2F61A 2OEKA 3WLRA 2PWFA 2ZZBA 2DVTA 2F7FA 2XJ7A 1JPMA 5AHEA 3EDFA 4GY7A 3VD4A 3RILA 1UH4A 2WC3A 3A6OA 1U1HA 1HKJA 4LPCA 5I0DA 3W7IA 4REQB 4H4IA 4IJRA 5I78A 3O06A 4PMJA 4N7QA 4YL2A 3H4GA 3MWAA 2VQTA 3P0XA 5DRCA 2GVGA 4IZGA 8XIAA 3PTMA 3E12A 1J96A 3LHVA 3LPOA 2BV9A 4EAYA 1QI2A 3ZJ7A 1KFKA 4PE8A 4DXXA 3AHXA 1ESWA 2P53A 4IP4A 3WLMA 5J8LA 3W2KA 2G3FA 3W82A 4WXZA 3ZR6A 3DX5A 1HGYA 1EJ7L 4ZR8A 1XLGA 4EF8A 4GUIA 4LSBA 3M44A 5A2CA 3PY2A 3NL6A 1EF3A 1V3KA 4XSMA 4CEUC 4PTVA 4GD0A 2J7CA 3HG5A 3THQA 1M7XA 4DJED 1J5TA 4V1YA 2YVFA 3UCDA 3IIVA 1IIHA 1MYRA 1ZRQA 3VX0A 1U22A 5C2CA 4DJFC 1TTJA 1DIKA 3NGJA 1DXFA 2VM8A 4RV8A 3VMOA 4H8HA 1WA3A 5GNYA 3S9YA 3EZ4A 1CXIA 1XD1A 2BVYA 2X50A 1JF5A 1VEMA 4H4WA 4BQ5A 3AMCA 2GSHA 4MDPA 4XAFA 4PFHA 4KPRA 1UZ4A 1XBZA 3O0KA 3B8UA 3W3OA 1ZKQA 5BOFA 2VVSA 3W27A 3A4WA 4MPQA 1V97A 3A4AA 4QQ3A 1CZ1A 3P6LA 1JCXA 4FNTA 3LLFA 3CIXA 1OYBA 1EP2A 4AZBA 4N4QA 1SJCA 2YCJA 4QDMA 4X60A 4ZENA 1R87A 1PDZA 1W91A 4AZIA 4KWSA 1GKRA 2QCMA 3BG9A 1R3RA 2BY0A 1MMFA 3STCA 1H1NA 2AGTA 2EPHA 3CL8A 3URQA 3OB8A 4AD5A 3GXFA 3KBJA 5REQA 5A6LA 5FJPA 1VPYA 3PPFA 5EGRA 3W28A 3EWXA 5H1WA 3WZ0E 3BG5A 3M6DA 2NUWA 1F8IA 4HA4A 3QQ1A 1WXJA 1DJQA 1TMLA 2GUUA 4E2OA 4LF1A 2CEQA 1AOGA 3PPHA 4PL1A 2I5GA 3H2EA 1VFHA 4ERGA 2H8XA 1XSKA 4BQ3A 3GKFA 1TYGA 2DVXA 3SQMA 2G8ZA 2NX9A 1XIGA 4JEJA 2ZZ5A 3TTYA 2PGFA 4N9EA 4S39A 1VBJA 5KMYA 3RCNA 4E8GA 2HXUA 3UZYA 2DZTA 1E5NA 4GISA 4FOUA 3M0LA 3EANA 2H9AB 2V6AA 2ZFAA 2HNEA 3CASA 3DUGA 2WYSA 3BLEA 5DFAA 3RPDA 2J77A 3QSTA 1K4QA 4N0RA 3AAMA 1Q6LA 2P8BA 1LWIA 1H1YA 4WDTA 1UCWA 4H3DA 4XVEA 1VHCA 2CWXA 4DF0A 3BLIA 4DYKA 5J04A 1GESA 5ENLA 1OFBA 2XISA 2OLAA 3IIZA 1XIFA 3GXNA 1VCGA 5HANA 4FDCB 4GK8A 3UWWA 1WKEA 5MHBA 3NZGA 3NTYA 4JTGA 2YA0A 3N34A 3OZYA 2J3NA 2DIJA 1LPFA 1W3IA 3E38A 3EOEA 1P7TB 3T4CA 2B7OA 1RJQA 3CMJA 1P0KA 1I2NA 5A6BD 1A47A 4Z2HA 1J0IA 3B8TA 4B5UA 1K03A 4FB7A 4GINA 1A5OC 2FTPA 4GVHA 2EJ1A 4F0KA 2YX0A 3PJXA 1Q4WA 4C60A 1UYQA 2IKHA 1SFTA 1C3FA 2VD9A 2Y85A 2NLYA 4K1WA 1OF6A 2Y2WA 2Y7EA 3II4A 5C54A 1GGOA 4GQBA 2YPIA 2D24A 4PEKA 4QGCA 3R8RA 3IEBA 4J2MA 2VJXA 5C6MA 1EP3A 2UY3A 3FYOA 3PFMA 1TB3A 1JZ3A 1ZLPA 2XSAA 3M7SA 4W7VA 2ZX7A 4FNSA 2X1RA 1OABA 2GJPA 3M0ZA 3CEPA 3B4UA 4WKFA 4UQBA 4R7WA 5T8GA 2ZRZA 4Z17A 1WKDA 4JTIA 1U5JA 4MADA 2QJIA 1H50A 4O16A 1CGWA 1W1PA 3PG9A 1E9IA 3UWZA 4L80A 3ZM8A 2GQ8A 3KBSA 1R9ZA 4HK6A 4P7RA 1DORA 1LOSA 4MY9A 1WDDA 4H4VA 3P82A 1UKOA 4LQ1A 4ADSA 1SFLA 2ZQ0A 1GTHA 1TUFA 5A94A 3AYSA 3A24A 1UR4A 6TAAA 3EOOA 3LMYA 3RITA 3WNNA 3WLTA 1AODA 1QAPA 4URIA 3N2CA 4IIBA 4AZ7A 2ZBTA 3II1A 5EMUA 3AYVA 5A6JA 3E0IA 2RH9A 3W6MA 4IMFA 4QCEA 3GC5A 4NYYA 3OP2A 3FHQA 5AHLA 4CNPA 4NYUA 1OY0A 4EM3A 3AMGA 2OLHA 4WZHA 1OWQA 2J47A 4E2VA 4MGGA 2XWDA 4EWND 2IMRA 5HMFA 2QDGA 3ALFA 3AUJA 3DJGX 1AQHA 2Z26A 1TE1A 4XD4A 1QI0A 3K2GA 1AMYA 3CAKA 1SZEA 3W84A 5CGTA 1KTNA 2BGQA 1NDZA 3AHVA 4H9MA 2GVEA 5K4ZA 3QHMA 3IJ8A 3HQ1A 2DDXA 4IH3A 5AYYA 1UZHA 1VBGA 4DYJA 5FL1A 2W61A 4Z0JA 1EUAA 3EYPA 1DIEA 3FGCA 2ZX8A 3U7BA 2XM1A 3ZLFA 4C6CA 4B5WA 2X7WA 3EOUA 3CYJA 5MF5A 3NFUA 3W7KA 1K9FA 1N2VA 1VLWA 1CB7B 3LM3A 4XBKA 3QKEA 5AHMA 1FRBA 1VH7A 1UD8A 2CBIA 3WMLA 2X0HA 3W1NA 1J2WA 2CXGA 4WSHA 1K4HA 2DEPA 3MKVA 3PG8A 3TDFA 4QISA 4PBFA 1RCOB 2GJLA 4H9YA 1TV7A 1SO4A 3RJYA 3TK7A 3HFYA 1XS2A 5HWJA 1QT1A 5GNXA 1QRQA 4YCOA 5C9UA 1E4LA 2RABA 3IUIA 1FO4A 2BGSA 4O28A 4UFJA 3SRFA 3F4WA 3LK6A 3O16A 3EB3A 4Z2IA 5JIPA 2VDIA 2OZTA 4H6KA 3FFSA 1IT7A 5A6BA 2FGLA 4LW7A 5TQLA 3SQSA 1NM9A 3TMQA 5D09A 4NZ4A 1ZBWA 4ZO9A 4W8BA 2D23A 2FHBA 2IKJA 3QQ0A 4X61A 4QS6A 4QROA 3S5YA 3ITGA 3RG6A 1Q6FA 1BFNA 3URHA 2FTYA 1QDSA 2I1OA 1ADOA 2ZXDA 4O4WA 5AVNA 1JROA 1ZAIA 5C55A 1UD2A 5FJIA 4NJHA 2AMXA 3HV9A 5C9XA 3VTRA 3BG3A 2J74A 1CWYA 1Z3NA 5HJYA 4INFA 5TF0A 2E77A 4HU3A 1OB0A 2Y0FA 4H9TA 1A5UA 4DEFA 1FWRA 4LOCA 4UTHA 3TAKA 3WF4A 1DYSA 1ZENA 2VDHA 3TJXA 3AJXA 4Q3MA 4KEUA 4ALDA 4DO7A 1EDGA 3SR6B 3VFLA 3QV8A 5CZJA 3NUKA 4OT7A 2C79A 3CZ8A 3NEVA 1UBSA 3IJ9A 3ZXWA 3LHUA 5D9MA 5D03A 2FKPA 1GPFA 4MKVA 1V6TA 3WLJA 3DFPA 4V33A 5HULA 4ZZ9A 1WPCA 2XGIA 1W17A 3ITVA 1XLAA 1R3VA 5C9WA 4KBXA 2VEFA 4ZO6A 1RY0A 3MSRA 3IJ6A 3VFCA 1PTGA 3BOXA 1JXKA 1M65A 3KCJA 3OGSA 3O15A 4AF0A 4PH6A 1R9YA 2YAUA 4ZOCA 1WZMA 3UG8A 2FH8A 3DXIA 3TSMA 2PE4A 3GW3A 3KZPA 3DK8A 1NDWA 1OFDA 3VC5A 3SI9A 2V38A 2C0AA 1ADSA 3NS1B 1FCBA 2WHKA 4J35A 3U0HA 1JGMA 5EMMA 3OO2A 4GNKB 4DM1A 2PDIA 1HG3A 5HJLA 3IGHX 4C6PA 3S6DA 2A3EA 1AD4A 3MHUA 2W3SA 1KR0A 1YPIA 1XISA 4UZUA 3W1RA 3GBDA 3IUDA 4K37A 3CT7A 2V0TA 5D8WA 4IL0A 4QR6A 4OGZA 3KCLA 4DPPA 5AECA 3G22A 1GONA 1KFWA 2C8NA 3CS2A 3KHDA 4GH3A 4LWWA 4LUIA 2E6AA 2FH6A 2TYSA 4PEEA 5BMXA 2XN2A 4GVGA 1GSNA 1UUOA 1KBJA 1TPWA 4CNOA 1RAKA 2BXYA 2CLIA 3UG5A 6XIMA 1RM6B 1GYMA 3ITTA 1U2YA 4V28A 3V5CA 1W2PA 7CGTA 5KZ6A 2OQHA 1V3LA 3OW1A 1A3HA 1AVAA 4IOTA 1E0TA 3LRKA 4LEQA 2X8CA 1N55A 3MUAA 4D6DA 3T0TA 3W37A 3B8WA 3T6CA 4NNCA 1JEHA 3AMDA 1FFQA 2ZWYA 2W79A 4ML9A 4L65A 1EA0A 1SW0A 6REQA 4XO6A 3RK8A 2A6LA 1S46A 1JYVA 1FH7A 3DH9A 2VFHA 3LLXA 1TWWA 2R91A 1AW2A 5HA7A 1KLYA 4J56A 1TV3A 4YJ5A 3N4EA 3B8IA 2PDCA 3PWGA 1BLIA 2XWEA 4HTBA 4O1BA 2PPGA 1V0LA 2CLLA 1AQ0A 1H6VA 2WP5A 4DXVA 3H8AA 5H6HA 3P67A 4O0KA 4P2VA 2C71A 4NEWA 4R9OA 1DXLA 2A4AA 3W01A 3WD4A 1B57A 3DBPA 2G4JA 1KM5A 1JD7A 3LSCA 1GQJA 3B9AA 3R13A 3W7QA 1FKWA 2ZKMX 3S1XA 1RK5A 4LY8A 4XTDA 1I0DA 1IEVA 2PBGA 4OQVA 1S38A 1MXDA 1ZFJA 3GZAA 4IG2B 1Y65A 1MEWA 3AZTA 1NY1A 1XJBA 5DF0A 2HEJA 1O6IA 1HVXA 2XFFA 5BU9A 1BKHA 4IWWA 3SUTA 3PZMA 3KCOA 1ZAJA 4GUGA 3RIKA 4LT9A 1B3VA 3W7HA 3PZNA 4JTDA 3N29A 1GVSA 2D69A 4H9ZA 2ZXAA 4TTUA 5BOEA 2GUYA 4GQ0A 1MUCA 4U33A 2ZRXA 4KRZA 1TV5A 2DT2A 4PUJA 7TAAA 3TVAA 1JZ2A 3LNMA 4QLKA 4IMAA 1K4GA 5GQBA 4EACA 4HNOA 2YBUA 3LV6A 2VDGA 1UC4A 4PUKA 4HJWA 4WY0A 4FXJA 4IIFA 3TYBA 5HNTA 1EF2A 1ZUAX 5MKGA 2XH4A 3GDMA 5DQPA 2Y24A 3C4UA 3A7UA 4JQ4A 3WF0A 1UD5A 4LY4A 2X1SA 3IUHA 4JTSA 3HG4A 3H7UA 4ATWA 5CSRA 3ZVHA 3F4DA 2NSOA 4PULA 2V30A 4HNVA 3SJ3A 7REQB 3C56A 2WC4A 3GG1A 2CZFA 3SCWA 3V4BA 4NASA 1HL8A 3LEPA 4JNZA 2DSUA 4GYFA 3G1FA 3VC6A 4R33A 1C29A 3KLJA 2FB2A 1RSCA 1RD5A 2X2YA 1QATA 1VP5A 2XH7A 5I3GA 1U5VA 4NG3A 3ARZA 2DT0A 1L2QA 5CSUA 1BXCA 1TWSA 2CLHA 2O9OA 1TR1A 1NDVA 1WXYA 3ALGA 3LI1A 5PTDA 5BRQA 1IGWA 4FNRA 4RZBA 2RDXA 3WBAA 2HXTA 3VVGA 4FSAA 5K9DA 4AZCB 4AD4A 5TR3A 3GY1A 1B4KA 2EQ9A 2QUMA 1VRDA 1H62A 2WWDA 1TVPA 3UPWA 3MVTA 2FDMA 9CGTA 1O5KA 4IGNA 4XZLX 3WK1A 3TZNA 6CGTA 1LYXA 1XCWA 3TUUA 4I9AA 3W86A 2D2JA 3M1ZA 1X6LA 3WO8A 1QUMA 2PUZA 1YNPA 3MUXA 1PVNA 4NZFA 3SRKA 3DFYA 1GYNA 1R8LA 2IQ0A 2PB1A 4YCPA 1O12A 3NZ1A 4MWAE 5CJNA 3LI0A 3KUMA 2Z1WA 1XI3A 3MZNA 3TYCA 1LT7A 1TMQA 2YXOA 3WF3A 3CTTA 4NNBA 4M1RA 2ON3A 2HPIA 1OYAA 4IQDA 3P5YA 4KESA 4NIRA 4E0CA 3CUJA 2Z28A 4GWEA 1HX0A 3T08A 5I2UA 4DX3A 3F7JA 3ANUA 4V15A 3S9IA 4R7OA 4DUOA 4ZVJA 3VE9A 3OLIA 3WLSA 3G6MA 3WH6A 4DJDA 2EKGA 4ZOHB 1K70A 2EQ7A 1R85A 3B0PA 1YBQB 3VNZA 3CK5A 2VC5A 3IAQA 1QVBA 4CU8A 1H51A 3CZKA 1LG2A 4GZ7A 3V16A 1HFBA 5F2LA 2J8TA 2IQDA 3NXLA 3WH8A 3L5OA 3UA3A 3W7RA 4FF7A 1GOKA 3WQVA 3EB2A 4RUBA 4H4PA 3DGRA 4P8VA 2JGQA 1JZ4A 3RR4A 1BQGA 2GOKA 1BZLA 1EJWC 2E9LA 4C6EA 2RJHA 3ITLA 4MF4A 2OFJA 3HJEA 2E4TA 3PTDA 1KTBA 4L64A 2NQZA 2QJNA 2V69A 1M41A 4WSJA 3WDQA 4GJJA 1XDMA 5M03A 3SDOA 3IARA 3G2GA 5REQB 2J6XA 1ELSA 2CCRA 4NRSA 4RNHA 4XZIA 2X1TA 5DY3A 1VQZA 2WC7A 5ABFB 4GBUA 3EDEA 3AIEA 3EX4A 2WM0A 3J7HA 3ECQA 3S42A 3ZWSA 2POZA 5HOSA 3G5EA 3UVAA 4JIPA 3W6YA 3MP3A 4DBUA 2GWNA 4ERAA 1XR2A 3MVIA 4DUWA 3LG3A 3EWYA 3UETA 1ZJIA 1ICSA 3ARUA 3QR1A 4HPHA 3SFKA 1YW1A 3P5ZA 2E40A 1R47A 3MI2A 5LKYA 2H6RA 3LNPA 4XZWA 4M56A 1TJ0A 5A8MA 4GUFA 2RJGA 4ICMA 5FAGA 1TMHA 1QPRA 1JCYA 1S5VA 3B8SA 2IKIA 4JX5A 3UZWA 3A7RA 3TMLA 3H2OA 3BICA 1LM1A 4C6QA 3TONA 1SGJA 2TPRA 2DZXA 4B9YA 2UV8G 3WEMA 2FGBA 4L4MA 2ZZ6A 3VKJA 5AYZA 4NY2A 3SCNA 9XIAA 2Y5SA 4FLQA 2ISDA 1CXHA 3V5OA 1RVKA 3N12A 4J4KA 2R14A 3OVRA 3TW7A 5HQEA 3VKBA 1V02A 3TA9A 2EF9A 2W27A 3T78A 3JW7A 4PTXA 3DECA 4XD5A 3S1VA 4EQWA 3FAWA 4B4FA 4NU7A 1PCWA 3ARSA 1YDYA 1TZZA 5AB3A 2CZVA 3GH7A 3FOKA 1VJZA 1FCVA 4UNKA 4ADUA 3SY1A 1MSSA 1LLWA 3AXMA 4H8UA 3OEXA 4B5XA 4D8AA 4JFVA 4MTVA 3VCCA 4DN1A 4XD3A 2YJQA 4PBGA 1IE7C 2WMGA 3SSZA 1FKXA 3SN0A 3KVLA 4QLJA 3BV4A 4GXWA 1VFLA 1E73M 1ME7A 3LGGA 1D9EA 3RX2A 4MSSA 3AHZA 1GT8A 3K4WA 5A5WA 3WUEA 1YNQA 1EC7A 1K8YA 3GXPA 4BWLA 2VOMA 1P0EA 4ZOBA 4DIAA 1XYBA 1A5CA 4DO6A 1HJQA 4ATDA 3WK2A 4M5PA 3NZPA 3D47A 1SO3A 3GC2A 2XGBA 3WL0A 4DNHA 2PLKA 1A5BA 1Q3NA 4CGTA 2D1ZA 2PDHA 3BARA 3R2GA 3T2OA 4IQLA 4CU6A 5JUVA 1GG1A 4UTMA 2PTWA 3QFEA 1VFMA 4H9VA 2OYLA 1WCGA 1JFHA 4BF7A 2A21A 1ZSXA 4BZYA 4GZIA 2WHLA 2Y89A 1FWHC 3CBWA 5C71A 4WD0A 5M2FX 4W93A 1FEBA 1O4UA 2CLFA 1KM4A 3TN3A 4G2DA 4IMDA 3G0UA 5E0KA 2WNWA 3QLLA 2F6XA 5JCNA 1L6GA 4O0ZA 1CNVA 4NI8A 5C5YA 4AG0A 2Z7GA 3WMCA 2XIIA 1F3XA 2XVKA 4AAJA 2WCGA 1NTHA 5DMMA 2FHFA 2NQJA 1IHIA 2VTFA 4BF5A 2A3LA 4DELA 1MNSA 1GHSA 1T5AA 3UYCA 3TLQA 2QF8A 3VNJA 3FXYA 4C6BA 3QBUA 1GVQA 1F4HA 4IT1A 3QPYA 3SRHA 4MWAB 3VNMA 4H4ZA 4G1NA 1N63C 5D2YA 3RCMA 3AU6A 5EMLA 1DEDA 2JBMA 2CKRA 4BS0A 4K2SA 4ZFCA 3THCA 3BTNA 3ATZA 3E3HA 4KKXA 1TPFA 2QJHA 1EO5A 1TTPA 1RD6A 3HW2A 4PMXA 1P1XA 3L4ZA 5EBKA 4PMRA 5DT7A 4N2YA 4DJDC 2YCLB 1VCVA 3PJUA 3PB2A 3W85A 3P8JA 3DFTA 4YIWA 1G7UA 2DV0A 5CSSA 2OWCA 1JRBA 4PB3A 8TIMA 3CMFA 3HU7A 1XLHA 3TJIA 1VIZA 3IJDA 3ETRB 3M64A 3AUOA 1UWQA 4KF1A 5DANA 2I9EA 1JG9A 1HN1A 3M41A 1M1BA 4RL3A 5AYXA 2OSYA 4Q8WA 2YVGA 1XIBA 4W7WA 4A2RA 1UP3A 1C8XA 2PRLA 4LCRA 3GDBA 2R1MA 4E8CA 4D6IA 4RNIA 3UJSA 4LAOA 3TX9A 2PGRA 2B7NA 3JU2A 5FAJA 1QNPA 3BWWA 5BRPA 3LCLA 2FHCA 5DMYA 3KBNA 3CGDA 3KFTA 4KGLA 4MKNA 3KVKA 2BB0A 1QWGA 1IXNA 3RNMA 3PZTA 4IFKB 3ZT5A 1A5KC 1JZ8A 2TAAA 3GR7A 2C3ZA 4GYKA 3BLFA 5AC8A 4C6DA 4IPIA 1R6WA 1EUNA 4IMEA 3SCVA 5AFDA 3W7OA 4DI9A 2VR5A 1ONFA 1FOBA 4U28A 4OJYA 4S23A 3VAVA 2Q02A 2OTDA 3VZZA 2VT0A 2JE8A 4D72A 4YN5A 1NP0A 3TH6A 3GG8A 3U2ZA 3B8VA 3DDMA 4WQ6A 4O1AA 3FSTA 4M1BA 2V3BA 1AMKA 2G97A 4B92A 2E5BA 4S1FA 1Y0EA 4OOUA 1BHGA 2QMKA 4X2PA 1QJWA 3R0KA 2BHYA 3S5ZA 4C6MA 5CPOA 1PZ3A 3U4AA 3N19B 1KFCA 3OQ8A 1D3CA 3LGEA 4O13A 1ME8A 3FXGA 4W9TA 4PODA 3WUGA 1XLLA 4WVXA 2A6NA 5JCIA 1S2CA 1XQLA 5CKSA 3BH4A 1DJYA 1TV2A 3H2FA 1KTCA 1JQVA 3HO8A 1FY6A 2ZC8A 1JZ6A 5HDRA 4XISA 4DWSC 3EB4A 1QNVA 1XPGA 5T9CE 3GVWA 3H12A 2ZOXA 3SEPA 3AS3A 4TVYA 1UWRA 5E0FA 1GVEA 4GC4A 3WLQA 1YYAA 4RE4A 2EG8A 2GRTA 1QNRA 1BD0A 1I6NA 2ACSA 4PMVA 4XIMA 4HMDA 2VFEA 2RAGA 4PUMA 1T8XA 4NZ5A 2ANUA 4JN8A 2PU1A 4AW7A 4MG4A 5JBFA 2HDJA 4MNLA 4UTTA 2QCLA 4D6EA 2E09A 1L2UA 3BK0A 4AD3A 5H8MA 1Q8JA 2GJRA 2QVNA 1QK2A 1Q6QA 4DZHA 4GFIA 4F0LA 4O4VA 3LX9A 3WQEA 3GXMA 4KGJA 3H53A 4XUGA 4MYAA 4JAWA 1VBRA 4WY0B 3F2CA 1G67A 1Q8AA 4G9PA 1NFGA 3B0XA 1EJTC 3AHYA 2AKZA 3U2EA 3UZZA 3B0YA 1XGDA 3VKCA 2GVJA 1GEHA 2VD8A 4WEVX 3GXIA 2OX1A 2HVOA 1VHNA 3D0CA 1Q63A 1AH0A 2VEPA 2QR6A 1OG6A 4O18A 1HL9A 3S8HA 3V0TA 3O1NA 4HP5A 4AWTA 1AL8A 1ITXA 1C8QA 1KGWA 3CAVA 2BNJA 3AWOA 1ZTVA 3UWYA 1OFRA 3OBKA 1VYRA 3KRBA 3OZPA 4L9ZA 4KFNA 1KM1A 2ZYFA 2YBTA 3NYZA 1ADDA 3FY1A 1M5WA 4TO8A 1WDSA 1B1YA 1BPLB 2J9YA 2FMOA 2WW5A 3KWXA 2PEVA 1GJUA 4IUGA 1FWGC 1PYFA 4KCTA 3BGJA 1W9UA 4H50A 4NJIA 2ZXBA 1DOSA 3T7VA 5A8PA 3MU7A 3UWUA 2QJJA 1DHKA 3F5KA 4PSPA 3MMUA 1F3TA 3HV8A 1XUUA 2E8YA 2PDLA 4LJ3A 3OOQA 4J3XA 1Q2SA 2YW4A 3WL1A 3F2BA 5CBBA 3WUFA 3NL3A 3R8HA 3L5MA 2B7PA 3GFXA 5AZ1A 1E51A 3MCMA 2QXWA 8CGTA 3GRTA 5D2WA 2EAWA 5CPLA 3CJPA 5CBIA 1ISXA 1ONWA 1FVPA 2DSWA 3BURA 3UBPC 4GQGA 1EXPA 4HBKA 3APGA 3RXZA 4QAIA 3JRKA 3ABZA 1UQYA 3ZT7A 3W6LA 1NFBA 2NQ5A 4L6OA 4GZEA 3IRDA 3LHTA 4L56A 2HISA 3GC4A 1IXQA 1YBQA 1NF7A 5EMJA 3RMEA 1FWDC 4GZJA 1GKPA 3PZGA 1TPEA 2XU2A 2DFAA 3HPXA 4AF0B 4HVXA 2TPSA 1JYXA 2CPUA 1GVIA 2R8WA 1VFUA 5I3IA 1C92A 2WNZA 4UUIA 5ABHA 1LWJA 2DT3A 1CGVA 5BOOA 1GZ1A 2PD5A 4ZTXA 2HVMA 3LM7A 4FO4A 4HB7A 3HIJA 4JHOA 1H09A 5G1YA 1EEXA 1PX3A 2PCEA 1XLBA 4QJ3B 1DJXA 4GUHA 3MSDA 1IXOA 4UOQA 4BI6A 2QAFA 3UNDA 2ZTKA 1KV5A 1U83A 2E5AA 4KIRA 1P5BA 1B31A 1VFFA 3TV8A 3UZJA 1LL4A 3AS2A 1GXFA 3EMZA 3N6JA 4PB4A 3HZ3A 1F3WA 4LNYA 4O57A 3EUB3 3ONCA 3GM8A 2BBFA 3B3DA 2MUCA 1AW5A 1UQZA 4OFCA 1E0VA 1UP2A 4ZB2A 4Y7EA 3CPRA 1Q13A 4QCFA 3P62A 1TO3A 4IXHA 3NQAA 4W5UA 1AJ2A 4C6NA 3BV7A 1A5NC 1B3YA 4IP7A 5J5DA 3TTSA 2XGZA 2TMDA 5XIMA 1XPYA 3N6QA 3URAA 4NT0A 4I90A 1FA2A 1MW3A 2FZ9A 1YDNA 1YQ2A 3M0YA 3FLUA 1H7RA 5FACA 3JUGA 2XSBA 4LAUA 1EIBA 3MJYA 4MAVA 3U6WA 2G3JA 4HNTA 4JHZA 1MW2A 4HMNA 1I2RA 3M5ZA 3VKAA 5F7UA 4BJHA 2ZVRA 4Q32A 3WK0A 5LIKX 1NWUA 3MUZ1 2VCCA 3BCDA 4QE4A 3PN8A 1OCNA 3TJ4A 4Z42C 4WDWA 1UW9A 3OBEA 2YL6A 3MWCA 3OVGA 1V02E 1J0JA 5EKYA 3RM9A 4Q8TA 3G8RA 2G3MA 1CGYA 5HQMA 2QF7A 3O07A 4N02A 3KTSA 5U25A 1GK8A 3R0DA 3T0AA 1TV4A 4J3WA 4CCEA 5HMEA 1WE5A 2R9ZA 4JZ5A 3T0DA 3QYQA 1PXGA 3P14A 4QP0A 4A8NA 4H6RA 4OUIA 4GI4A 3TNOA 4NNAA 3APTA 5D4YA 4H4YA 1S5MA 4LRSA 1KC7A 1GVRA 1YEYA 1V08A 1V0MA 1V3IA 4WUIA 3SGGA 1FWEC 4CD5A 2J9ZA 3SN1A 2JIEA 3IK4A 4ROPA 3KBVA 5CZSA 2Z2AA 4AH7A 5IHSA 4O8RA 4ZO7A 4M6QA 3FJLA 7ENLA 1Z44A 2NXHA 2BXZA 2FZ8A 4PRRA 1MOKA 1F6PA 4HN4A 4DO4A 1YXYA 3F5JA 1JDFA 3UWEA 4B91A 3QM3A 4GNVA 3ANVA 1GOMA 1EX5A 1V3JA 4UCGA 3UPMA 3OLDA 3AIRA 1TSIA 2W4XA 4US5D 1E3ZA 5IOBA 5EMYA 2F2KA 1HQTA 3KLKA 1R38A 1JCTA 1RQBA 2VX7A 1YMYA 4KEMA 2GJNA 4AC7C 4EP8C 3AZRA 3GTXA 2ACRA 1VQTA 4OUEA 2G5WA 4CEXC 4RR4A 2HK1A 4OE7A 2JGYA 2HCVA 5L6UA 3TXZA 1ALDA 3DI0A 1R5YA 1OEPA 2C6QA 4JTLA 5FSDC 1OJTA 3H22A 1GZJA 3BSGA 1WKFA 1JDCA 1QPQA 1JDAA 3OYZA 2KZHA 2YZ5A 3MDUA 4DI8A 4S2CA 3LXAA 3VD9A 3GD6A 3GYEA 1YE6A 5K4XA 4JCLA 2G95A 2YYTA 4F2TA 2HZGA 5JVLA 3B8DA 3UP8A 1OYCA 5HWMA 1Q7MA 1JVNA 3Q45A 3LS9A 2YA2A 3PBWA 3QV6A 3UESA 4GGHA 2OVLA 2PZ0A 2ZZ1A 3GBEA 5FS6A 1VFSA 3R8GA 3IV8A 5KEZA 5RUBA 1NEYA 4E4FA 1CENA 1Q7ZA 3SCOA 3CUFA 1FDZA 4QDPA 1V5XA 3S47A 5HUPA 4Q4SA 1NQ6A 1J0HA 4GA8A 3AXKA 6TIMA 1Q4NX 3ABXA 1D7KA 2A3HA 1E6PA 3HGJA 3L7RA 3KE0A 1JIBA 4EPEC 1SFJA 3H6OA 2VRKA 1W2VA 1XLIA 3CGBA 4RK8A 5F1VA 5G5IA 1H61A 1Y5WA 4UMCA 3WFAA 2I5IA 4I8YA 3IJIA 4W85A 4FR1A 3T55A 2DW7A 2J7HA 2Y5EA 2DJLA 5CPSA 4QXIA 3HTWA 1XINA 1IEWA 3APYA 3MYPA 3E2VA 3WQ8A 4IICA 3SY5A 4GIYA 5H2ZA 3ANYA 2Q6ZA 4JYEA 2WB5A 2NQHA 5HJXA 2AMGA 2WBGA 2ZRWA 3W76A 3EEZA 4L4LA 3NRZB 2RDTA 5AC5A 1M9HA 2INEA 3VA8A 1XGEA 2WMHA 3E0VA 5I7GA 4ZB0A 4GACA 4G7FA 3G3MA 5BXSA 2QCFA 4XSLA 4H4RA 1F8MA 3RJXA 3BZJA 1YADA 4PCNA 4HOZA 3MUIA 3UXLA 4M7TA 2FPVA 5E09A 1JQXA 4KERA 2A2IA 1XIHA 1KLZA 4B2DA 5JH1A 1WDWA 3EF6A 2EG7A 1ECQA 2OELA 4UFHA 3ATYA 3HBLA 1OCJA 3QZ6A 1ZY8A 3ZIZA 1NOWA 1DHPA 3ZS4A 3V3WA 4TQTA 2ZZ7A 3FSUA 5LHFA 2ZVIA 2YDAA 5CQ1A 3DCPA 5I5RA 1TYTA 2Z27A 1SYTA 3DH7A 4KPLA 3WEOA 3EDDA 4HT3A 5GPRA 3N17A 1M7JA 1UPMB 2WJFA 4GYJA 2ZRUA 5C2GA 3PB0A 4FF5A 3NZRA 1X97A 1D2KA 3VGGA 1KRAC 4TX9A 3W81A 4RDZA 3TN6A 2L5HA 3UR7A 4ZBCA 3I7QA 4GI9A 1DTUA 5C9ZA 2W3RA 1H4PA 4NILA 1MI3A 5IFTA 1PSCA 1RK6A 1IF2A 3CO4A 1U1JA 3C8FA 4TTGA 4QDWA 1CT5A 3NL5A 4Y96A 4U10A 1QOQA 3ORWA 3I65A 4MY1A 4YTSA 5CG0A 2BTMA 3W1AA 1EEPA 4HSHA 2PRHA 4D6CA 4XWUA 3FCPA 2OQYA 5JCKA 3BQ6A 1DPMA 3AMZA 5EBUA 3GNXA 4KRTA 1XL9A 3SW6A 3C2RA 1UKQA 5A2BA 3WDIA 3CHFA 5G2HA 1EKOA 2WVTA 4J57A 5KETA 3U57A 3CQ0A 2VELA 1KQZA 2ZRYA 3Q67A 2EPLX 4H7CA 2CDUA 3GVRA 1I9CB 2NVAA 1XRVA 1HXJA 4M7SA 3ZT6A 4R9XA 4QJ4B 1J6OA 1W1B1 3VOJA 4EXBA 1ZHAA 3GVGA 2BASA 1NH6A 2OG9A 3TCSA 2AGKA 3E5PA 3I3EA 3WLLA 4S3EA 4HNNA 1WX0A 4F0SA 4ICCX 1Q5MA 3WQ4A 1HW6A 3DHPA 1SSDA 2O9PA 3TYDA 3U5YA 2V3EA 1JF6A 1BWVA 2YCEA 2GZXA 3DGHA 1V93A 5FSEC 2GOUA 2QCEA 5CSYA 5DXXA 3TOYA 3ENLA 1YE4A 2R6OA 2Q8LA 3AOFA 4O1EA 2GLKA 3QMSA 4YU1A 1ENUA 3AQUA 2WMIA 2D73A 3W7LA 2PWEA 3OVPA 1HJXA 4OECA 2VQUA 4K8DA 4FXRA 3BOLA 4B5SA 4OHQA 2R94A 3O8AA 1FHLA 4HSOA 2Q8XA 1WZKA 3DKJA 3HJZA 3NQBA 3UXAA 5FS9A 3MW7A 4EMWA 5F4XA 3ZJKA 3NVWB 4P7LA 4NUWA 2PDGA 1XYAA 3BAYA 3AIVA 3QC3A 3V1PA 3O0HA 1W56A 4GIRA 2KX9A 4JDBA 2H3BA 2Z1KA 2JKPA 4UQDA 1WKYA 3PK7A 3M0VA 3DIPA 3R10A 4Q7IA 1OIMA 2QCCA 1MFVA 3D3FA 3NG3A 3WLHA 4WSKA 3C3NA 3HFTA 3VUPA 3CMGA 3DK4A 3NXFA 1EZWA 4QQUA 3S0CA 1Q65A 2W9MA 2XUCA 4TR9A 4LH8A 3WLKX 4IGSA 3UW6A 2QIWA 5DY2A 4QG8A 1BSIA 1M6JA 4JTFA 3DYMA 4HK7A 3B4YA 3A5VA 3ZQ9A 1HKVA 1J01A 2PU0A 1LDCA 1QPKA 2ACUA 3LB8A 1A5LC 3C6CA 4NP7A 5EU9A 4Y9OA 3RN6A 4EM4A 1I2QA 3W9ZA 2XPKA 2ZXQA 5M5DA 3NPVA 3WMSA 1LT8A 2XIMA 4GH1A 3W83A 2YR1A 1HZYA 2Y62A 3DYOA 2EHHA 2XFWA 1DXEA 1TWDA 3P60A 2GSEA 3WN6A 1TPC1 1Z6KA 3LGDA 1F61A 3M9YA 3GXDA 1MUMA 4MVAA 3P7YA 1S2UA 4EANA 3POHA 2QCGA 3CV2A 1H2JA 2WV8A 3G1DA 4PR4A 2NVDA 3AS0A 1XFCA 3MMWA 5CPTA 3MB9A 2Z1SA 4I6VA 3GFYA 1PX4A 2YXXA 3UJ2A 1OBAA 3HQPA 1FHUA 3NNTA 3NIYA 3VUSA 3O0FA 3UZ5A 4B90A 4Z2JA 3BQ5A 3I6TA 2DH2A 2CYGA 4G1KA 1TG7A 2WM1A 1S5WA 4Q4QA 3R94A 1IQ8A 4AISA 3M4HA 1KQYA 4PBEA 1IGSA 3QHOA 2Z1XA 2ZE0A 3LPFA 2ZUWA 4UMAA 4I6KA 1NWTA 1XIIA 2OR2A 2XH2A 3JS3A 1OJXA 3POCA 1PX8A 4TU1A 1S3TC 1B54A 3FYYA 1AZ1A 2Z6IA 5A6MA 4IJBA 1S2TA 3WLNA 2YKKA 2WVVB 3P81A 3RRXA 4BKNA 3UGVA 3WF1A 4O1DA 3EDKA 5FCZA 2FDSA 3BW4A 2PDKA 3NQDA 1JCLA 4JKLA 1UASA 4Z0SA 1GQNA 1GOOA 2QZRA 5IXEA 4NZ1A 1TJPA 4C91A 4GNJA 1JPKA 2E5DA 3BGGA 5I3FA 3QHNA 3G1AA 3QF0A 3TE9A 3LQLA 1KM3A 5IDIA 3SAZA 1AQFA 1S39A 4NSBA 3KOZA 2AOSA 2IPWA 4ZQCA 1UJPA 1AL7A 4LYRA 1EYEA 3CWHA 3BLLA 5A6KA 2PDUA 4KH2A 1Q6EA 3MMTA 1MW1A 3WQGA 3LCFA 5F2GA 3DHFA 3KL3A 1KFBA 2WZHA 4AWSA 4LUJA 1Q85A 3IWPA 5LIWX 4BI5A 4XK2A 3FG2P 5IDZA 1US0A 3CAQA 2AAMA 2XHYA 5BYWA 3ZR4A 4ZEPA 2YB4A 4AHOA 1DKWA 3URNA 1PKMA 3LLDA 4IGMA 3PZOA 1BYAA 4C6FA 1SZFA 1JUEA 4H41A 1TA3B 4QBXA 1BWCA 3G1YA 3KTXA 2VEIA 4GQQA 1X1ZA 1VYSX 3F1QA 5G5HB 1RVGA 4XO7A 4LCQA 4E3VA 3MP5A 4LANA 2J75A 3WELA 1QPOA 1ML1A 3QEZA 4PTMA 4XBSA 3MV11 2WSRA 5HUOA 1XC4A 3FVMA 4PL2A 1TWZA 1H7NA 4DXKA 3BUVA 3L4YA 4ES4A 2X99A 3OLEA 2QAPA 2J7GA 4UFMA 3NQ2A 3GDTA 4FX9A 2XN0A 4JX4A 1F9CA 1NHRA 1M04A 2OOFA 3NQ7A 4DZAA 1RY8A 2G4FA 5A8NA 1KGXA 1YTEA 3PUEA 4X22A 3BCJA 4CQBA 3OA5A 1H0IA 1NELA 2DPEA 3ITOA 1Y7VA 1W8SA 2A79A 2JIWA 4WGHA 2OYMA 4W84A 3R5EA 1XCFA 4K39A 4EQXA 2C3DA 2Z7KA 3UNTA 2VURA 4J3VA 3EA3A 2W6RA 2A3AA 4U5IA 3W4RA 4JIRA 4JD4A 3LHZA 4MPKA 2J7DA 3TEVA 4LB4A 1TCDA 1GCYA 5FL0A 3GG7A 1ZPTA 4UOJA 4Z1YA 3G1HA 1B3OA 1Y8BA 1XYZA 4LC6A 2PAJA 1I1XA 3TQVA 3TW9A 3EPOA 2IW0A 3K30A 3T42A 1MXSA 4A6GA 4CQAA 3A3XA 3PBVA 2YIHA 3CEUA 3MY9A 2O9RA 4NX0A 3SRDA 4UFLA 4J3ZA 3U2OA 2YL8A 2FJUB 4QG6A 3OJGA 4IIGA 3PP7A 3C61A 3SCTA 4F40A 4G8TA 1L9WA 2QDDA 3EDJA 4O1CA 2EKCA 4L61A 3QH2A 4CQ8A 5FKYA 2VZVA 1KKRA 3TKFA 3VIPA 4MLJA 3LA4A 4R5EA 3VE7A 1DQXA 2Q01A 3WQDA 1ZXIC 4MJ4A 1XSIA 3SQPA 2J4GA 2V5CA 5HPCA 5FOOA 1D7FA 1OQFA 2B7QA 4O0QA 4DQWA 4IFKA 4L1XA 1I75A 1JPHA 2VC6A 3ES7A 3H2NA 5ABFA 1V3HA 2PC4A 4A3UA 1S2AA 1EZ2A 4FR6A 2PFHA 1XX1A 4W8AA 4GXMA 3LCGA 2BZNA 3MBDA 1W9VA 1UH2A 3VD5A 3VD7A 1OX6A 3BE7A 3EGJA 2ZZ0A 3TR2A 3FA5A 3DFNA 2IPJA 2WPFA 3A12A 3CV7A 1MZHA 1GORA 4CVWA 5FESA 1JCMP 3RX4A 1B3WA 4I9MA 4ERIA 4JQ1A 4UTWC 2NV9A 4J28A 3SBFA 4PSRA 3OG2A 1SO6A 3RR1A 5BWFA 1KWGA 1XLKA 1BTMA 3CNYA 4OVXA 4D8LA 1M7OA 4PFMA 5DBTA 1ZU8A 1DVJA 1E9ZB 2Y7DA 3VM7A 4W7UA 4JTUA 1YRRA 4IF2A 1A80A 3CGCA 2H90A 1BXBA 4MNJA 5CC3A 2G0WA 2QUVA 3W1QA 3TN4A 4GRSA 1HVQA 4LUTA 4RZ5A 3WBYA 3WNOA 1PYMA 2E8ZA 4NAEA 4E2BA 1T41A 3KRUA 1K7FA 2FVMA 4C1NA 2F6KA 1LUCB 2WKJA 5BMWA 1XGZA 2YLLA 3EWZA 4H19A 4IJCA 5HMDA 3KP1A 3EAUA 3W73A 2YBVA 3N2OA 5E93A 1C7TA 3ZOAA 3C2FA 4O17A 3NQMA 5A6SA 1OHLA 1T40A 3O6YX 3VIOA 3NURA 4C1KA 4LTSA 1X2HA 4P61A 3W2UA 1PAMA 1HUVA 3GHTA 2R1PA 1O5RA 1Z32X 4CUCA 2DY3A 2VC7A 4X2RA 2YCIX 3TOPA 3VDHA 4XZBA 2GL5A 3GNOA 3BL3A 1W9DM 2XVGA 3KOFA 8XIMA 3L2IA 3W00A 1QMLA 3CUZA 5CPQA 4EKJA 2PA6A 4AYSA 2Y7FA 1XIEA 4ML4A 4M6UA 4DJFA 2YA1A 4XZNX 3HN3A 2BY2A 3UCCA 4M82A 3AIWA 5CH9A 5G5GB 4D9PA 2FVLA 1GRHA 4J9JA 3W7PA 4GXPA 2VWSA 5EBAA 4G6CA 4F48A 2FPYA 1PHWA 4N9DA 4RKAA 3LPGA 4EWJA 3T81A 3IVUA 1QO5A 2QIIA 4HK5A 1UKPA 3DOPA 2P10A 2VX6A 1RP9A 2F2HA 6REQB 3NQGA 4C7FA 1WQ5A 1TQXA 5HXMA 3I3DA 3IANA 3T9PA 3SUVA 4HMEA 1CI1A 5D37A 5KZMA 4AY7A 1KBKA 1L8PA 4U2ZA 1GRTA 4KW2A 4X0VA 1PS9A 4WX2A 1JI1A 4ZTYA 3DC8A 1UC5A 2X0SA 3AWNA 1HKKA 2JQXA 2ZTJA 2A7NA 2XM2A 3VGEA 3MKKA 4LNCA 2VFDA 5D8ZA 4CD7A 4PCFA 1E0UA 3BAJA 1QW8A 3UZXA 1X1OA 5BXTA 3SUUA 3Q94A 4WJ8A 2ACQA 1I60A 4P8WA 3LBMA 2ZZ2A 3EWUA 1BWLA 1E9YB 4DJFD 3OIHA 3N2MA 4GJIA 2C15A 1DIOA 4PUWA 1C7SA 4KRUA 1LWHA 2YFNA 3SO7A 1F73A 4LRTA 4Z1DA 2QEZA 4B2DD 3CB3A 2WAGA 1ISZA 4Z08A 1LL7A 1T7LA 5GRTA 3ARWA 3DENA 2O7SA 1AH4A 3F4VA 3L4XA 1GV4A 3ID7A 3GR4A 2QPUA 3S6OA 1MO9A 2PDNA 4JFTA 3QY7A 1P4CA 2HMCA 4AWEA 2O7QA 4QFUA 3QFBA 1IYXA 1GREA 1OCQA 5BWAA 4OWGA 4BWLC 3GQYA 4DUVA 4MUZA 3PSWA 5BCAA 5LYRA 1R46A 1FHVA 5CGQA 4MWAC 5D9PA 4LBSA 3C2OA 4ORMA 2Y1HA 2YDSA 5BU6A 4CCCA 4ASTA 2R1LA 3K1GA 2GGIA 1C8VA 4WIWA 3PZIA 1F4AA 2CZDA 3R0UA 5BZAA 3D9XA 1JYWA 5JCLA 3UCQA 3L4WA 1YHTA 3TCEA 3LHYA 1GRFA 3CZEA 4YLWA 3T1GA 3MMDA 2DUXA 1V6UA 3CZJA 1DQWA 1T3QC 4HJFA 2OWXA 3H7RA 5ECUA 2AL1A 2AAQA 3R58A 4LU0A 1FWWA 3H2CA 1EBHA 4JTKA 3GIYA 3OYXA 3ZFHA 4GYPA 5CXPA 4AZCA 2YFOA 5DXYA 3T4WA 3T0CA 4A3YA 3KVJA 1VAHA 4GFSA 2XIOA 1BTCA 3U9IA 1W1IE 3AS1A 4R85A 1NVMA 3USZA 4P8XA 3N15A 5D04C 4FS9A 5XIAA 4K36A 2Y7GA 2NT1A 2H8ZA 1IV8A 1UB3A 3H7VA 3WQPA 4LV9A 3BXWA 3QYSA 1S1RA 5JH2A 2EBNA 1REQB 3N1AA 4JIQA 3CO8A 4EVZA 1EP1A 5LIXX 2WSKA 3CV1A 1Z42A 2DZPA 1EA9C 3VKDA 2G41A 1V0NA 3QGAC 2QPSA 5IBXC 2OZ3A 5DELA 4B3ZA 4QNEA 3VM5A 1MO0A 4MNKA 3PAOA 3WQOA 4LIIA 1RCXB 2QPXA 3VCNA 4DJEC 2NV2A 4K3ZA 4FOJA 1NARA 2PDPA 1NQKA 3MHFA 3FK4A 5DCEA 1Z69A 4J3TA 4Y9NA 4C6KA 3ITCA 2PTYA 1B9BA 2HRWA 3UJFA 2ZUSA 1HKIA 3T8LA 2GQWA 1KFEA 1LZOA 1UOKA 4PYSA 4DWSA 3V36A 3DYPA 1QI3A 4FNPA 4DNMA 1MZRA 1Y5VA 5C2XA 1F74A 4AX6A 4JFUA 2J7FA 2EEXA 1JFXA 1PHQA 3CXOA 3INPA 3R07C 3DN5A 4GKLA 1A0EA 3N18A 4Q33A 5E0CA 4RW3A 2WZMA 1D7YA 4MB4A 4AZHA 3HPSA 3TYAA 4WJEA 3LZ5A 4K7ZA 1W3NA 4U4MA 2Q71A 3PZUA 1RCQA 1BF2A 3BSMA 1XLJA 5MKGB 4MNMA 1NPXA 4H00A 4XV0A 4UC5A 4JYDA 3EX2A 4RCXA 3H4XA 2VCAA 4IPJA 1YTDA 3L5AA 4Q6JA 4IHCA 4KEVA 5LNUA 1PDYA 1AZ2A 3TWBA 1J6PA 4D71A 2POTA 1DWGM 5C8BB 4H04A 1XRFA 4US6A 1H7XA 1WZAA 2J8FA 3PPGA 4UXDA 2BY3A 1U1UA 4YXGA 4ZL1A 5D33A 3EA1A 4TMCA 4XG1A 1DV7A 1VEPA 3WNLA 3TYUA 3YPIA 4R88A 1W1TA 4UQCA 1HT6A 3HURA 4LVGA 5FF7A 1DXIA 1VD6A 3WJZA 4D1JA 3RYSA 1UJQA 1V77A 3W1UA 1PEZA 2PWUA 1CTNA 2CLEA 1NOFA 3SADA 2YXGA 4TV6A 1Q66A 2B31A 2B81A 2PS2A 2X05A 1HKWA 2DZAA 3OLGA 3K4AA 2HQMA 5KVHA 3L4TA 3WBEA 1R2RA 1QASA 2P76A 5F2IA 4HCDA 3WUBA 3Q2DA 1R0MA 1T0OA 1VKFA 1EOKA 4EF9A 2P0OA 4NZ3A 3I68A 2C0HA 5CPMA 4O19A 3S2LA 5EY5A 1ZMCA 2E25A 2ZX9A 3W7GA 4QNWA 2X8HA 1TVLA 3ME3A 1ZGDA 1LORA 3VIFA 1O7AA 4O10A 1KCZA 2J6VA 2DQWA 5GJPA 1TX2A 2BGNE 5AVHA 3UT0A 4M19A 1DE6A 4L9YA 2I16A 4CU7A 3E9AA 2PWGA 1MW0A 1H5VA 2JF6A 1CGTA 1ME9A 4LUTB 4XAPA 1QI5A 1W5PA 1HJUA 3RF9A 4AEOA 2QKFA 1GQLA 2ALRA 3HPZA 3QQWA 2IQTA 1ZX9A 5D9NA 3L21A 3VGHA 4IIHA 3MO4A 5HBFA 1WYGA 3S2MA 2FZDA 3OHIA 2GVLA 1DWAM 3W7EA 4V27A 3T2QA 1QW7A 3NSNA 4JEQA 1IXPA 2FZNA 1HL2A 2CLOA 4HZ6A 3DFHA 1OM0A 4HNLA 2V63A 4H4UA 5G4WA 4A8RA 5FJJA 2F84A 1C93A 3LRLA 1RLDA 1GEQA 4IP5A 3IAPA 4TV5A 3ARTA 3L8KA 5DT5A 2ZUNA 3TQKA 1DJGA 4Q7NA 4JY9A 4RNFA 3L0NA 1AG1O 3AU2A 5HMSA 2R1NA 1WOAA 1HF6A 3HPFA 1OGBA 4O1FA 1QNSA 1HP5A 2I9UA 1KN0A 5T9BG 1E6SM 1RBLA 1OK6A 5JBEA 4XTIA 5E1QA 3M47A 4V2XA 4AMAA 3C2EA 4LUSB 2FFCA 1K9TA 1S2WA 3A64A 1XHGA 1QBBA 3RU6A 1X98A 3DG6A 1W1YA 3VZXA 2VC9A 1A5MC 3T0BA 1WYIA 3N14A 4MYXA 4JX6A 3GU1A 3Q37A 3W7CA 4QSHA 4XIAA 1FHDA 3VGBA 1SJAA 1K8ZA 2UWFA 2A3CA 4ZGYA 1BVNP 4ZODA 1YTKA 3NL2A 5I79A 3EMQA 5CJ5A 1LVLA 1F2JA 3HMCA 3CV6A 4UTIA 3NQVA 4F0HA 5LHEA 1TJ2A 1FIQB 4Y8FA 3A47A 1FWAC 4XX6A 4N9CA 5ABEA 1E15A 2WHJA 3S5SA 2PF0A 1B90A 2NVKX 1SO5A 3BOFA 1G94A 3CWOX 1EQPA 5DN1A 3ZWTA 1WUFA 1OFPA 4UZSA 3VDCA 3LPPA 3ZVIA 2CLPA 1D3GA 1JDDA 1US3A 5E6YA 1J0YA 4QM1A 1K9DA 4MWAD 4E6MA 4UIOA 3RRAA 1RPKA 4HPGA 2D2HA 2W62A 1P1MA 5FS8A 1WBJA 2CFYA 3B40A 3LRMA 5EB8A 1SFSA 1EB3A 3XIMA 1J18A 1UR1A 4LB3A 5G2WA 1EHNA 2EO7A 4FK9A 2OT0A 3B97A 3RGTA 5CZTA 4AD2A 4ZXLA 5LNWA 4FXFA 2J13A 3IJ7A 4XD6A 4LAKA 4JIHA 3BLPX 4W86A 4XZMX 3WDPP 4J5NA 5JXQA 5CG7A 2OEMA 2DSZA 3ABSA 4JL1A 2BMBA 3KM8A 3S5NA 1M53A 1XWYA 2X16A 1L6FA 1ODZA 1XLCA 4EPDC 2REQB 1LQ2A 3ARPA 5C7HA 1YDOA 2GPTA 3TFXA 4MAZA 3LCIA 1JUBA 1XM3A 3KHJA 1JDEA 4QE5A 5JRBA 1L6SA 1XDJA 3VDAA 3B06A 4KCWA 4JTEA 2W92A 5I02A 1I8JA 4AVNA 3WNPA 4DB7A 3W7JA 3SR7A 1EFZA 4MLRA 2HVNA 5CPNA 4HNUA 4IFOA 4U3CA 3BMVA 1Q2RA 1EJXC 3GKAA 1JNDA 3RLGA 5AKQA 1XLMA 3NCOA 5IM51 3GDKA 1M68A 3W72A 3UERA 1MQPA 5G2IA 3AHTA 4XKMA 3W25A 1YXDA 1O95A 3A13A 4FHAA 3U5UA 5C9RA 3FX4A 1WDPA 1OX4B 3CGEA 2HTMA 4MM1A 4O14A 5IBXA 3NDOA 2W0HA 3LHWA 4K1GA 4JGDA 3NVYB 2Q3OA 3LUTA 3PUGA 2FJKA 4ZMGA 1B30A 2HE5A 1BXNA 1KW1A 2BSLA 2OEJA 2JFEX 3AISA 1JUKA 2UY2A 3L12A 5CJMA 4JYFA 1Z48A 1ZMDA 3WNMA 2GR2A 2PBOA 2B4GA 4GLEA 4MIMA 4A29A 5U1OA 4AC1X 3VOHA 2ZICA 3IRSA 4MZYA 5BRBA 3ZSSA 2JF7A 4LXFA 4KCUA 3EPNA 1LP6A 3AIQA 1WUEA 3WD3A 4DYEA 4RLIA 1CLKA 1JRCA 1R7AA 2W67A 2WZEA 4C6IA 4DWSB 4MKSA 1DJNA 1BGAA 3OPSA 4ROQA 3ABQA 2INZA 2GSJA 3HMJG 1W37A 3LSBA 3W7DA 4Q6XA 3W2LA 5BROA 2VX4A 4F66A 1PV8A 1XW8A 2H3DA 3QRHA 2OZ8A 4G7EB 4UBPC 1AUSL 4ZE5A 2HBXA 5AHFA 4IX2A 1XIMA 4KT2A 1V6YA 2EPKX 2DZUA 1RJPA 1I2OA 2VYOA 4L9XA 4KFOA 1XSJA 2Z4GA 1J8VA 4POCA 3RFAA 1VF8A 4DBSA 2V3GA 3HOJA 2V6OA 1IEIA 2BODX 2FMNA 2QYGA 1NP2A 2DSVA 1J12A 2Y8UA 4LVFA 3N25A 4FEZA 5CZ0A 2DUZA 4Y8EA 1JD9A 3PC0A 3OIXA 2RUSA 4GJ1A 2J88A 2PDYA 4GYPC 1PCKA 1TE6A 4XBJA 2ZUTA 3PBUA 4FOKA 3ZSTA 2GR1A 2BVDA 2XG9A 1Q6GA 4W4QA 1RJRA 3LXDA 3I7RA 3KZSA 3SCQA 2DIKA 3DU0A 1W3KA 3AM9A 5TBOA 3VIHA 3M0IA 1W0MA 3C8NA 4EAMA 2HV5A 5AN7A 3PBGA 1AJZA 3VINA 5HPOA 1GG0A 5F4SA 1RHCA 3QOMA 3WDJA 4BQ4A 1TZ7A 1KFJA 2QAEA 1TPDA 1E1CA 3W2JA 2PDXA 1TTQA 5K3VA 3IPWA 3N3TA 3D5HA 2WK2A 3N4AA 4JQ2A 3M6YA 2GK1B 2PDWA 3RMJA 1UWIA 3TAOA 2PI6A 3VNDA 3LU2A 4K8EA 3C0QA 5D02A 3IC9A 3D6NA 3CC1A 2BDQA 1B9ZA 4OBRA 1BSLA 2C7FA 4FP1A 3A7AA 1O94A 3E96A 3RO8A 1UZDA 1OZQA 3VK5A 2JEQA 3WBWA 4PCPA 4AHPA 2BOFX 4L4PA 4ONVA 2WOWA 3KL0A 4GOAA 3DZ1A 4DM2A 2VNCA 4XKYA 2HWGA 2NUXA 1UWAA 2WZTA 3HG2A 2EXOA 1XF0A 4JTAA 3AO0A 4NI3A 4GVFA 1QW9A 1E1CB 4JQ9A 2VVNA 4PMZA 3WK3A 4LYQA 4K7YA 4X3ZA 5I6SA 4Y2WA 1RV8A 3UR2A 5K7JA 3GH5A 3QC0A 3S3GA 3JVAA 1TJ1A 4GIEA 1KFLA 3T05A 4L6HA 3LENA 5KITA 2BCPA 2CWNA 2X8RA 1VLIA 1BYCA 1PKYA 2FZBA 5DX7A 4TVUA 5BXPA 1OT1A 4HYWA 1EL3A 1SMDA 4H4SA 4R3UA 4B5TA 3FIGA 3VNLA 5HATA 3DJJA 3PNZA 1I0BA 3C0SA 1FWSA 4DZ5A 3VKKA 5D2XA 2EPNA 1NU5A 3GVVA 3L5LA 3DBNA 3GB6A 4MFDA 3DC0A 2O92A 2GQ9A 2WKLA 2WQPA 4ECLA 1XYMA 3ZR5A 1OGSA 4HGXA 1AH3A 4Q8OA 1XIDA 2JKAA 1RBAA 2UZ9A 4K38A 3KEHA 5E70A 3GE7A 3CZLA 2EQ8A 2Z25A 4W89A 2ALDA 4A05A 1X6UA 2NXIA 2A3BA 1VDVA 4RJEA 3JZUA 1IWBA 4XAYA 4YNGA 4M8UA 1F3EA 1Q6OA 1ZDLA 1KXQA 2LLEA 3CHVA 2PLCA 5D2TA 3C86A 3W2NA 4AZ5A 5A6AA 1KXTA 1QO2A 1PUDA 2BP1A 1WDRA 1VS1A 3S2NA 3K13A 4DF1A 3UEQA 3NPWA 4QG9A 4DLFA 1HO4A 2E9BA 2ZCGA 1KRBC 3A4XA 3F5LA 1PKLA 1XHCA 5ECVA 4WLCA 3NO3A 1QCWA 1O60A 1V6XA 2ZA3A 2D3LA 3LCHA 1FWFC 4HTYA 1F6KA 3HB9A 1FWIC 1QOXA 2TSYA 1OF8A 2FYMA 3M43A 1OG0A 1IWAA 3NQ6A 1POKA 1ZY9A 1UWSA 1EGMA 2VZUA 1H60A 3DI1A 3LBCA 1G4EA 4L5ZA 4D1IA 4ZCWA 4OTKA 5JIWA 1PPIA 4LS1A 4KEZA 1WAWA 3B9DA 3VPLA 3O7UA 3N13A 4HSNA 4CKQA 3UG3A 2ATSA 1SR9A 4ZE4A 4EMIA 4F9JA 3PVFA 4RDVA 4HYRA 2QUUA 3I7SA 4UTUA 4PTNA 3W71A 5ABGA 4GKTA 2O9TA 1JCJA 2VGBA 3VOIA 3VNKA 5FMHA 2P3EA 4HZMA 1KCLA 5I3KA 3GH4A 2D2GA 5D30A 2XFRA 1S7MA 4YTTA 2PRMA 4JTHA 2RGLA 4M80A 3V35A 1YQZA 3I6EA 4BQ2A 4DBDA 4GY1A 4OKDA 4BI7A 1OADA 3CQHA 5M17A 4GX9A 3VX1A 3HRDC 4KETA 3BAIA 2OYKA 4JOMA 1XLEA 1ICPA 4K6AA 1YNYA 3G8EA 1EDTA 5FJTA 3ABRA 2NPXA 3EX3A 1W5MA 3LD5A 4Y9PA 2QUNA 1SUXA 4J3UA 3LXBA 3FGCB 3JR2A 2DSKA 2XINA 2NX1A 1OINA 1JPDX 2PWVA 5EYWA 5AYIA 3AI0A 3PTQA 3CB8A 3ZJ6A 6ENLA 1M7PA 3M0KA 4S2BA 4PMNA 4FAMA 3FV9A 1RLCL 3UVIA 3E49A 5GVJA 4KWVA 1L6YA 2ZE3A 4IX0A 4DBEA 3N04A 1UD4A 3WMBA 1YKWA 1R3YA 5FA5A 2I5QA 3RU8X 4D6FA 4QX4A 4DPQA 3E0LA 3G77A 5HINA 3QV7A 2BHUA 1NFPA 3K8MA 1E6XM 3M5YA 1H3GA 1UR2A 2FIQA 3DGBA 2XZ7A 5EA9A 1HIZA 2OOGA 1JCNA 4CNTA 4GMEA 3BZGA 1FFUC 1F8WA 2G96A 4XKYB 1TPB1 1EJRC 3O2LA 4TVCA 3UY8A 4JFSA 3WG6A 3OGVA 5E9AA 4JN7A 4EPKA 1LROA 4Z1BA 3VXGA 3FDGA 4A8IA 2AQOA 1CX9A 3GTFA 2X30A 1GJWA 1MRAA 2Q8ZA 2J25A 3U48A 2Z1VA 2Z2UA 5T26A 1AFSA 1W3HA 3OVQA 1JR1A 3FEQA 3MHGA 2OODA 2HS8A 3WQ6A 3M5VA 3G1VA 3REQA 3L67A 1ISWA 5HNRA 4M24A 1PJ9A 4DBWA 3THUA 2GQ3A 3ZZ1A 3NDYA 5CCZA 1LJYA 2YZRA 1LF1A 3ARXA 2NWSA 2J62A 1OX4A 3UA4A 4AY1A 1E4NA 4HOWA 1XDLA 2ZC1A 4IIEA 1TREA 3HA1A 4MUPA 1RR2A 4H83A 3CPUA 1CXKA 3O9NA 1VEOA 3QSRA 1MDRA 2O56A 2WVUA 4AUBA 3T07A 3PZ9A 4MFEA 1GEUA 3IIXA 1A5AA 3W07A 4HN8A 1K7EA 1Q7QA 4LEFA 2DORA 3EWDA 2PCQA 4Q8UA 3R25A 5U4NA 4FNQA 2GH5A 1RXOB 4JIEA 1OK4A 2NSXA 7PTDA 3CXBA 3L65A 5D2VA 2QNEA 3B03A 4PCSA 3M46A 4GRTA 2A0NA 2W3ZA 4B5VA 2ZUUA 3UF9A 1SJDA 1E6ZA 1EXBA 4AZGA 3V18A 1JRPA 4YWOA 1TQJA 1W3LA 3NSMA 4PMDA 5EL1A 1J2BA 1XUZA 5LXEA 1G01A 1SW7A 1E1FA 5K2ZA 1XH1A 3WD0A 1BVWA 3UY7A 3QMRA 2ZDSA 5LSMA 1QNQA 2OKOA 4LBRA 2VUYA 3VABA 5KZEA 4PUNA 5M1TA 4REQA 2QGHA 1THFD 3N2TA 1RZMA 3NDZA 4P8UA 3VIMA 2OXNA 2YOCA 3UXDA 3WLIA 1N82A 3N3MA 2NLIA 2PDFA 3EX1A 5LA1A 1ITQA 1XKJA 1ZCCA 1REQA 5DEZA 2JK6A 2G3IA 2FB3A 3QPEA 5E5CA 3PPCA 5DBUA 1BF6A 2HK0A 2XSXA 1QBAA 3P61A 5A6TC 1OFOA 1XYCA 2WVVA 4MZ1A 1KKOA 4WJXA 5DLCA 4DWSD 3G1RA 2J27A 2Y61A 2CZEA 2HBVA 3HGOA 4NVTA 2VGGA 4N6EA 3BJTA 1FDYA 1FCUA 3GSMA 5G4HC 3BLKA 1RQHA 4JKMA 1XP3A 2ZX6A 1XKYA 1KM0A 3SQLA 1UA3A 2REQA 4X9YA 3SGUA 1VFTA 3N11A 3NR0A 3BPWA 2QLYA 2WLYA 1T6MA 2VOTA 4WCJA 5KVIA 2HNHA 3TQPA 4S3JA 4EE9A 4NZCA 1AD1A 2KAUC 4PMUA 1B2YA 1SZGA 2CC0A 4FA3A 2BS9A 3V1HA 3VCRA 1FWTA 1CIUA 2I14A 2PD9A 3PAJA 4C6LA 2WJEA 4OV9A 1W54A 3W24A 3MANA 1HJWA 2PMQA 4O53A 5CLWA 2P1FA 1UBPC 4O52A 1ZNNA 4RE0A 4PC8A 2WWCA 4NAFA 4LS2A 2PSNA 2WMKA 4M81A 4PCTA 2E6DA 5T91A 2F38A 1N60C 3F4CA 2PP3A 4D6GA 2DZWA 4MMWA 1YPXA 3PTKA 2JKEA 3MQTA 4L1GA 2FPTA 3DFOA 2ZZ3A 3AIBA 2IXUA 3KDNA 2WZIA 3PG6A 1A0DA 2RDWA 2YYUA 1KWKA 4C5YA 1J10A 3N4FA 1W1ZA 1VJSA 4G5DA 4XQ6A 4JHMA 1ISYA 1KB3A 1B5TA 1UD6A 4I9JA 4FX8A 1N5WC 4YYFA 3SGZA 4FPSA 2Q3RA 4K68A 4GI8A 3EAOA 2VRJA 3DHDA 3B9OA 2NT0A 4BF9A 3CM4A 1GUVA 1W5OA 4AXNA 3WFLA 3BCFA 3WIJA 3L2LA 2X40A 4UTFA 2CESA 2Y8VA 1BQCA 1XIJA 3PJTA 3QY6A 3KBMA 1H5YA 3IK2A 3S2JA 4MB5A 9RUBA 3OBAA 1CYGA 3S5OA 4FX6M 5M3WA 3MC5A 4HYVA 1P6CA 1TTIA 2QULA 3TC7A 5CGMA 3A3HA 3UD6A 1MDLA 4D6JA 3SM0A 4HOXA 2V5BA 3AXXA 1BYBA 3ITYA 1GRGA 4H01A 4ICNA 3FKRA 1FTXA 4MB3A 1WZLA 2Y63A 1NF0A 4RW5A 3K8LA 3DG7A 1O68A 1V6WA 1NDAA 4OBSA 2V5DA 1J93A 1G7VA 2TRSA 1KO0A 1TWIA 2BC0A 3TTQA 2QJGA 5IHRA 4A3HA 3PHAA 5B7YA 1J4EA 4DNAA 3VIJA 1A0CA 4IG2A 4E4UA 3L2MA 1LG1A 1H41A 2J8GA 1VR6A 3RLHA 5EMKA 3Q4DA 4YTUA 4MY8A 4MZ8A 4J2PA 5DCBA 2WPCA 1IR1A 1XQKA 4NL1A 5LA2A 3WJYA 2VZSA 3BO9A 3MP4A 4YS1A 3R43A 4G7EA 2V81A 1QK0A 1IEXA 4HZ7A 5EFDA 5KINA 1RUSA 4Q4PA 5HR7A 3KRSA 1HKMA 4YHGA 5DO8A 4CLMA 2VFGA 1PIGA 1JPIA 1EOMA 2XVPA 3MI3A 1O66A 3H54A 1UG6A 3CL7A 5FJUA 1GW9A 3R4IA 2I56A 1GJPA 5A69A 4S3BA 2JK2A 3IIPA 3SFWA 1XD0A 1SB3B 4GCXA 4PZVA 1S2VA 7A3HA 1Q6CA 2BFGA 2AQWA 1TZ9A 2HJPA 2CFFA 3N2BA 1T96A 3ARQA 3E1F1 4NHVA 1MRQA 1S5NA 4LCSA 3H70A 4AY8A 5FEXA 5H8UA 2E6FA 5L9FA 1NAL1 3ISIX 3U2CA 4YWIA 1KBLA 2DP3A 2V8ZA 4CD8A 4ADWA 4U3AA 3EKZA 3WH5A 5BW6A 1J9YA 4DLMA 1FWJC 2C13A 1R86A 4NF7A 1ZP4A 1KRMA 4PTDA 4UFKA 2BLEA 4CNSA 4XAZA 3WJXA 2OSXA 2WOIA 4ACZA 1Z7AA 2J66A 2Z24A 2YL5A 3EWWA 4Q7BA 3STEA 1EQCA 4PUUA 3N73A 3BMWA 1YX1A 3P8IA 4LUYA 4GC3A 1E70M 2YDRA 4Q8QA 1VC4A 1BWKA 2DQXA 3CQIA 2QCHA 4CQ9A 4TIMA 5TNVA 3A4JA 4RDYA 3TYZA 3IIOA 1CPUA 1UKSA 5HK4A 3CQKA 4P7OA 4KFPA 2UY4A 4IL2A 2BXVA 1YXCA 1P6BA 3C5QA 3L23A 1XBXA 5E6ZA 3P80A 3GHRA 3G0SA 2EQ6A 3XINA 4AQLA 1WOBA 3RM8A 4HCHA 4FX7A 4J7RA 4NQ1A 4UQEA 5FI8A 1GYLA 2YGYA 3RDKA 4IPLA 1JJKA 2IUZA 2VR4A 2V3DA 4IPPA 3FEMA 1J0ZA 3FS2A 1ZALA 1ONXA 3L4VA 3MZ2A 5AC6A 3GG0A 3KDOA 1X6NA 5CC6A 3MPGA 1LRTA 1A53A 3TA6A 2PURA 3AIUA 2DT1A 3CHEA 3PBYA 5CLTA 1V03A 3GWQA 3W7MA 3NEHA 4NRRA 1PKNA 1T8QA 2CLMA 1GVFA 1NSJA 5CZKA 4PA8A 4YHEA 5CEWA 2PTZA 6A3HA 3BLDA 3SCPA 4QRNA 3OC4A 3AXIA 4F2BA 1Z8AA 4WY0F 4C90A 3M7WA 1PB0A 7XIMA 1UR0A 2NXGA 3PUOA 3HGRA 1IZKA 1T99A 1LTDA 2IKGA 4YWSA 3KS5A 3BJSA 2FZMA 2OKTA 4C6OA 3QOKA 3CU2A 3MUY1 2A5HA 5DRIA 4E4PA 5I06A 3K1DA 4UOZA 4M51A 3KX6A 4CD6A 1J0KA 4S3DA 4OIFA 1D3HA 1H7OA 3MO7A 5B7ZA 1DJZA 3E02A 3ZYZA 2DJXA 4UTJA 1PZ2A 3NVVB 1UH3A 3THDA 3U8GA 4FALA 2VX5A 4TVWA 2G37A 2ZDRA 3GNRA 3STPA 3N2XA 2NW0A 4F3HA 3OQEA 3E5BA 1LLOA 4I7VA 1N5XA 3I3BA 3L0GA 1R3TA 2CBJA 4JTRA 1V51A 2VEGA 4APNA 2E7FA 5LGZA 1K8CA 1H1ZA 2D0HA 3ZLHA 4B3KA 1LUCA 4Z1CA 1YDVA 1K6AA 2OCZA 9XIMA 2YLAA 1FECA 2QDHA 1A49A 2WANA 3NWRA 2PWDA 3SCSA 3M0JA 2W91A 3AMKA 4DAFA 1SJBA 3FA3A 4HD5A 1KNWA 1XYFA 1MQRA 5G4EA 4IUOA 2AQVA 3FJ6A 4BR1A 3TFCA 4EOUA 2VO5A 1JGIA 3PJWA 3QJAA 3HQNA 5LZLA 2ZRVA 1Q6RA 1OD0A 2WPBA 2QVHA 5AHNA 3C2YA 4BY3A 1GWJA 2C16A 5HAOA 1FEAA 1FCQA 5HQLA 1JI2A 3WFZA 3GK0A 1EJUC 3NQ8A 1PZ1A 3KW3A 3LXCA 1K77A 1RA5A 4JTQA 3W02A 1G4PA 2V3AA 4HU4A 1H49A 2OZ0A 2EJAA 2F6UA 1QNOA 2HPMA 3AFBA 1TELA 5GJMA 1TFVA 3N9SA 3NM1A 3UWQA 4D6HA 3TSBA 6ALDA 4ZSUA 3OG3A 4BURA 1CECA 5D05A 5TIMA 4TUFA 1N8IA 2WSQA 3F4NA 3EOLA 3KVMA 2AKMA 3OHMB 4B9ZA 3DGZA 1MQQA 4FXSA 1XC6A 4QEEA 3SSJA 1WB0A 4KCVA 1EHAA 1E6RA 4B3LA 2A8XA 4F2UA 2P88A 2F5ZA 4CVUA 2PODA 3VMPA 3UPBA 1TRIA 2WP6A 2ZADA 4KIEA 4LVAA 1H0GA 1R30A 4JNYA 3QFWA 4ILSA 4RE3A 4ACZB 1I45A 1W8GA 5CC5A 4LAMA 3E0FA 5KZDA 5DMNA 1A4LA 1HNYA 5JBDA 5JMUA 2QS8A 1TYPA 3MCNA 1UD3A 1EWEA 3QW4B 4AMCA 4AD0A 1F5ZA 4WHBA 2QCNA 3QY8A 3GNPA 1QPNA 2CBUA 4R27A 1AK5A 3W38A 2C1HA 1UP0A 4NJKA 4C1LA 1G4TA 1KA9F 1UWUA 3MV01 2GVYA 1TX0A 1N8FA 5C70A 3BJFA 4QS5A 3IVSA 4TMBA 1XICA 2WCSA 3TJLA 5U7SA 1EC8A