4E4FA

Crystal structure of enolase pc1_0802 (target efi-502240) from pectobacterium carotovorum subsp. carotovorum pc1
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
405
structure length
386
Chain Sequence
SMKIVSAEVFVTCPGRNFVTLKITTDSGLTGLGDATLNGRELPVASYLNDHVCPQLIGRDAHQIEDIWQYFYKGAYWRRGPVTMSAISAVDMALWDIKAKAANMPLYQLLGGASRTGVMVYCHTTGHSIDEVLDDYAKHRDQGFKAIRVQCEPATKGSLPEEQLWSTEKYLDFTPKLFEAVRDKFGFNEHLLHDMHHRLTPIEAARFGKSVEDYRLFWMEDPTPAENQACFRLIRQHTVTPIAVGEVFNSIWDCKQLIEEQLIDYIRTTITHAGGITGMRRIADFASLYQVRTGSHGPSDLSPICMAAALHFDLWVPNFGVQEYMGYSEQMLEVFPHSWTFDNGYMHPGEKPGLGIEFDEKLAAKYPYDPAYLPVARLEDGTLWNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ENOLASE PC1_0802 from Pectobacterium carotovorum
rcsb
source organism Pectobacterium carotovorum subsp. carotovorum
molecule tags Isomerase
molecule keywords MANNONATE DEHYDRATASE
total genus 138
structure length 386
sequence length 405
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4e4fA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4e4fA01
3CXOA 4ZCWA 2GGGA 3RITA 1ECQA 2HNEA 5FJUA 1SJCA 3Q45A 1NU5A 1MUCA 2QJMA 3CK5A 3D46A 2PU0A 2ZC8A 4A6GA 4HNCA 3ZVIA 3T9PA 3FVDA 3QTPA 1E9IA 4HYRA 3EKGA 2O56A 3EEZA 3VFCA 5IDZA 3SN0A 4E5TA 4KT2A 2AL1A 2PS2A 1W6TA 3TJIA 1P48A 3FJ4A 4JN8A 1EC9A 3D47A 4ENLA 2OG9A 3DERA 2P8BA 3N6HA 1L8PA 3I6TA 4GMEA 2QJNA 2P3ZA 4Z1YA 5BOFA 3T4WA 3ZVHB 3UCCA 1KCZA 3OW1A 3T8QA 3UJSA 3QPEA 3DG3A 4E8GA 3VCNA 1MDLA 2PA6A 2PGWA 1JDFA 1KKOA 3B97A 3TJ4A 3GO2A 2PTZA 3IJLA 3RRAA 2OKTA 2OZ3A 3VDGA 2GGIA 2OQYA 3UJ2A 3VCCA 3DDMA 2QGYA 3MKCA 4H19A 1WUEA 2GDQA 3UXLA 3V4BA 3H12A 4HNLA 2OZ8A 3DESA 3R11A 5BOEA 2PU1A 1BQGA 2PODA 3ZLGA 2P0IA 2QJJA 2HXTA 2XH4A 2POZA 4H1ZA 2QDDA 3K1GA 3PFRA 2GL5A 4G8TA 3VC6A 2PTXA 3R0UA 2HXUA 4J1OA 3CB3A 2CHRA 3VA8A 4DX3A 3ES8A 3DEQA 4M0XA 3ZLHA 1MNSA 2PTWA 1R6WA 2OFJA 2PSNA 4K2SA 2AL2B 1DTNA 5FJRA 3MWCA 4KPLA 1SJAA 4H83A 3UGVA 3UJEA 3PWIA 2QVHA 2DW7A 2XH0A 2P88A 3JW7A 3UXKA 2OZTA 2AL2A 2PCEA 2PP1A 3OP2A 3TCSA 4ZA0A 2P8CA 3STPA 3N4FA 3RCYA 3S5SA 3I4KA 1RVKA 2PP3A 4E4FA 1XPYA 4K8GA 3R10A 3MUCA 4X2PA 1SJDA 3CAWA 3MQTA 3UCDA 3U9IA 4A3RA 4JN7A 2PPGA 2XH7A 4IL2A 4FI4A 3R1ZA 1PDYA 3R25A 3I6EA 2OVLA 3NZGA 3RR1A 2GSHA 4MKSA 3TQPA 2OLAA 1ONEA 3PWGA 3GD6A 2AKMA 3TTEA 1F9CA 4HCDA 4GYPC 2OQHA 1IYXA 3MZNA 3H7VA 3TOYA 4DWDA 1YEYA 3H8AA 3T6CA 3DFYA 2OPJA 2XGZA 3MY9A 3QKEA 2OX4A 3UJFA 4HCHA 2PP0A 1NELA 1EC8A 4IL0A 3ZVHA 2NQLA 4HCLA 3OZYA 5ENLA 4HPNA 3OPSA 3P93A 3PK7A 4IZGA 4MGGA 4DYEA 3FYYA 3DIPA 3R0KA 3JVAA 3DGBA 4HN8A 3U4FA 4YWSA 3NO1A 3UJRA 3SSZA 4A35A 3RO6A 2FKPA 3IK4A 2PMQA 3HPFA 5EU9A 4Z17A 1MRAA 1MDRA 1TZZA 1EC7A 3CYJA 3V5FA 3SJNA 1TE6A 3IJIA 2RDXA 1P43A 3SN4A 2QQ6A 1KKRA 3DFHA 4J3ZA 2XSXA 3MSYA 4GIRA 3KUMA 2PGEA 3NXLA 5FJPA 4KEMA 1FHVA 4H2HA 1JPDX 1WUFA 3QN3A 3SBFA 4E6MA 3DG6A 4DN1A 2OO6A 4KWSA 3N6JA 3ZLFA 3ES7A 3JZUA 4IHCA 3OTRA 5FJTA 1TKKA 4G7FA 3GY1A 3SN1A 3P0WA 4DHGA 2MUCA 1SJBA 1BKHA 1OEPA 3FCPA 2I5QA 2GGHA 3OZMA 3VC5A 3Q4DA 1JPMA 2ONEA 3FXGA 5FJOA 2FYMA 3N4EA 3BJSA 3TWAA 1PDZA 1KD0A 1EBGA 2QDEA 1EBHA 3V3WA 4MMWA 2GGEA 1XS2A 2XH2A 4ROPA 4IP4A 6ENLA 4IT1A 2MNRA 3GC2A 3ENLA 1R0MA 3TWBA 4K1WA 3S47A 4IP5A 3IJQA 3TW9A 3RGTA 4GGHA 3SQSA 4GISA 3P3BA 3CT2A 4GGBA 3H70A 1FHUA 4F4RA 4GYPA 4JHMA 2DW6A 3FV9A 2GGJA 5J04A 3BSMA 2ZADA 3V5CA 2HZGA 2AKZA 4GFIA 4DXKA 3NFUA 4E4UA 3THUA 7ENLA 1JCTA 1ELSA 2PTYA 3QLDA 4FP1A 3DG7A 3BOXA 4EWJA 4M6UA
chains in the Genus database with same CATH superfamily
3CXOA 3VXGA 2GGGA 2XZ9A 4DJFC 2VC7A 4HIBA 4HZ7A 5CZTA 4UOZA 2ZZ7A 9XIMA 4R33A 3ITXA 4J56A 1WXZA 2ZXAA 2J75A 3MZ2A 2QJMA 3AMKA 1IEVA 3UG3A 4JDBA 4LCSA 1AJ2A 4W7WA 3WQFA 3CTLA 1WZAA 4AMCA 4AD0A 3BXWA 1OFRA 3B40A 5K4XA 2AQWA 5I78A 4C6CA 5T26A 4ZOCA 5EFDA 2TPRA 1Z8AA 6PTDA 4DZAA 2VGGA 2RDUA 2O7QA 5G4HC 2HVNA 1S2TA 1JCJA 5TQLA 5LNWA 3DECA 2XZ7A 4YU1A 2GJXA 1ZBCA 5LNUA 2YL6A 3CIVA 4JTRA 4HMCA 3H7RA 2BXYA 3EDEA 3HFYA 2WOQA 4F8XA 3PBYA 4JIPA 2J9XA 3TTSA 3QTGA 5D09A 3WBYA 3OHMB 2DH3A 3VDGA 2J62A 2OQYA 4D1IA 3NDYA 3AYSA 2TYSA 4GC3A 5AN7A 2FHFA 2E40A 4FZIA 3NURA 3MKCA 3CQHA 3QMSA 1H1YA 2B31A 1K7EA 3V4BA 4HNLA 3N9RA 1UWSA 2DQXA 2POTA 2ZX6A 2PU1A 5I79A 3VKDA 2G3NA 1PEZA 2G97A 3W2KA 4DELA 5D8ZA 1QOQA 1FWJC 4LUSA 1J79A 3CQKA 3UW6A 3BAKA 2W4XA 4JX4A 2QCEA 2PE4A 3B8UA 2HQMA 3WQOA 5XIMA 3CUXA 1RPXA 3PY2A 1LWHA 5CPMA 4WSJA 4RE0A 3VC6A 2PTXA 5TR3A 3PM6A 1Q2RA 1F4HA 4J3XA 3SURA 1IIHA 2HXUA 1YPXA 2C15A 5BNKA 1RCQA 1VIZA 1HFBA 2I14A 4B4HA 2WK2A 4H4UA 4B91A 3ARSA 3FA5A 3LX9A 4W8BA 2ATMA 2VZTA 4EXAA 5EMMA 2J7GA 1J9YA 1N5WC 1FWFC 4HU8A 5C54A 3W38A 3VNYA 5E6ZA 4EM3A 1CXHA 2EBNA 5BMWA 3N15A 2GJLA 1MW1A 3N9SA 5BROA 3RN6A 3M1ZA 3MUCA 1VQZA 2V3FA 5CC3A 5JBFA 1S1RA 1WBHA 1XDMA 2JALA 3QV6A 4E0CA 5FF4A 3GM8A 3OGSA 2YVGA 3M0YA 2YL8A 1WOBA 1PKMA 1NPXA 2BOEX 1T5AA 5BXPA 1VFTA 3QC0A 3W7GA 3BLOA 3VOCA 4MAZA 4CEUC 1EPXA 2OTDA 4I9TA 1WYGA 1DQWA 3NQGA 1TTPA 3BK0A 1P0BA 5CZKA 1ONXA 3F4WA 3L2LA 3WLRA 3TUUA 1W1B1 3LDVA 4NAEA 1B30A 1OG6A 3HB9A 3O0FA 3ABSA 1LBFA 3FDKA 1DJIA 1GOIA 1B3OA 3B8WA 1RH9A 1SO6A 3QZEA 4C7DA 1TPWA 2E3TA 2Q71A 1G9HA 4CD7A 3WYZA 1S3TC 4IL0A 1HVXA 1KXTA 3CZGA 3DYMA 3OOQA 3QHOA 3VGFA 4AZBA 2J3NA 1VF8A 5IFTA 2RKXA 2PDHA 1AODA 1TPC1 4LQ1A 3KBMA 2FQIA 3W22A 4NZFA 3KBJA 4CEXC 2PWVA 1QNVA 2IPJA 4N7QA 4IIDA 3GHSA 3WQ6A 3MPGA 4D2JA 4D71A 3M5ZA 3RO6A 1KM2A 3BG3A 2DSKA 4B3KA 3GG0A 1O1HA 4TVUA 5G5IA 1LLWA 3W85A 5EU9A 1LT7A 2QUNA 1VBJA 3HPAA 2OWWA 1TZZA 2WZEA 3EWZA 4WUIA 2JIWA 1UD8A 1VP5A 1NWSA 1WX0A 2FHBA 2RDXA 2A3BA 1PE1A 1U5JA 3W2JA 1FH9A 3KUMA 4Q8WA 3DFPA 5HATA 4CVUA 4KEMA 2BWGA 4DBWA 1VQTA 4W8LA 4H2HA 2CZVA 2UY2A 3W76A 4A3QA 1CIUA 2QS8A 1WKFA 4NAEB 2OX1A 1TPB1 2YDRA 3T05A 5U1OA 1VLIA 2RDTA 1TIWA 2A85A 1QPKA 3UNTA 3AM9A 1CENA 1H0GA 1BXNA 3TK7A 1V51A 4AX7A 1EPVA 3G6LA 2WPEA 1KRAC 3VMOA 4I7VA 4JDRA 1HJVA 1MXDA 3VZYA 4L9XA 3DGRA 4UTIA 1JFHA 4Z2HA 1OC5A 3VD7A 4ALDA 1HXJA 3GHTA 1ZAHA 5FOOA 2UBPC 2HVMA 3FW6A 7CGTA 5D9NA 3WD1A 4OUEA 2OYMA 3W2NA 2VFEA 3NZQA 3RCNA 3KLJA 4B5XA 4JDYA 2P53A 1JCNA 2R82A 2VX5A 5C8BB 1IR1A 6TAAA 3W7OA 4IP5A 4NNCA 4TVYA 3IJQA 3MDWA 3TW9A 1O60A 4GISA 3VIFA 4O18A 1QT1A 1XUUA 1WCGA 5BCAA 2DT3A 2VEIA 2H8ZA 4A8LA 2QT3A 4EX4A 9RUBA 2GQ3A 2VWTA 4L6DA 3WH8A 3ABZA 2C0HA 4WR3A 4DXKA 1G4PA 4AIBA 4EPEC 1XV8A 4OE7A 4BURA 1ELSA 2REQB 5G1YA 2NWRA 3RO8A 4RZ4A 1CT5A 2A3HA 2F38A 1LOLA 2E5AA 2PRLA 8XIMA 2QJIA 1RP8A 2BDQA 4AW7A 5CC7A 1EA0A 4B2DA 3VOFA 1XH2A 2B4GA 3CZEA 5KMYA 2A3LA 3PZMA 4AZCB 1OWQA 3U57A 2NVKX 3IV3A 4UNKA 3L2IA 4XTDA 1CXKA 2NUYA 4B16A 2P50A 4BA0A 3DBPA 4HHPA 3AMDA 1VHNA 4WSKA 4P5UA 5ECUA 4PTWA 5C71A 3IJ7A 3ISIX 4BI6A 2ZUUA 4DM2A 5JBDA 4ENLA 3KTSA 1CECA 1E43A 4B9ZA 5D32A 1G4EA 3EOOA 3RLUA 1B3XA 5I23A 5BOFA 3W28A 1BTMA 1EJWC 1ZSXA 3WH6A 4FA3A 3ITOA 4NKCA 3MA8A 1L6SA 3TR9A 4F79A 2Y0FA 4O13A 1TJRA 2XFYA 5KEZA 1EJRC 1UD4A 3BARA 1KBLA 3M5VA 2O4MA 2ZDRA 1GJUA 2GGIA 3BLDA 1RJQA 2DH2A 4H4RA 3O2LA 2EF9A 1RY8A 4UQCA 4DJED 5U25A 2Q3OA 1LL7A 1UKTA 3HMCA 1GGOA 5DT7A 3LLDA 3UXLA 3WDQA 1XGZA 4J9JA 4QNWA 4G1KA 4QLKA 3EMQA 5E9XA 1JULA 3ZJ6A 1E0XA 1Q7MA 3MUIA 3VIPA 1Z3NA 2POZA 2W3SA 2NQ5A 1ADDA 1V93A 3HO8A 3ZMRA 1TX2A 4KEVA 3GSMA 3CV1A 1ZAIA 4R85A 4AF0A 3WQ8A 4D1JA 1ADOA 4LIIA 4K36A 3CLMA 3W72A 2OJPA 4AAJA 1YPFA 2CHRA 4LF1A 4OBTA 4MOZA 3MUY1 3EA1A 4MJ4A 2CLOA 3DBNA 4DUXA 3T55A 4QEEA 3W4RA 3NDOA 2AL2B 2QUUA 3EAOA 3MWCA 4HSOA 1CEOA 3G8EA 2XVKA 2PURA 2ABAA 4FXFA 4UTKA 1G5AA 4JBRA 1H2IA 5C0QA 1TPDA 1XYFA 4IFRA 5BRQA 3RCYA 1IZJA 3ZO9A 4E38A 4RDWA 3NQFA 4I8DA 4EPKA 3E3HA 2WHJA 4J28A 2DUXA 2WO5A 5C7HA 3GVGA 1JD7A 4MFEA 3IWPA 1R3VA 1GVFA 4UUIA 3L66A 3OBEA 3WLHA 1XANA 3CTTA 3PJXA 3L5LA 3QMTA 4A3RA 3CB8A 4FI4A 4AXKA 3TC6A 2X1RA 3I6EA 1XIHA 2OVLA 1HKVA 1GOMA 4EP8C 2ZKMX 1JUKA 1R87A 3TQPA 2OLAA 4WXZA 2DU2A 2VX4A 4JTUA 3PWGA 5E70A 1K4QA 1QW9A 4HCDA 4CNNA 1W9BM 4H4IA 4MSSA 4FOJA 5LIYX 3TTOA 3MBFA 1VBHA 2F8QA 3TR2A 3N2BA 2XGZA 1WBJA 4MF4A 3CAKA 3C5QA 4NZ1A 4IGSA 4AVFA 4IPJA 1GERA 1OT2A 4IIHA 2HWGA 1RJRA 4GZEA 4HCLA 3O3RA 5E0CA 1C93A 2NQ9A 4GUGA 4WKAA 5JCMA 1AH0A 4NX0A 4CQBA 2I5IA 1PZ2A 2X30A 3TQ0A 5AHMA 2ZA2A 3SCUA 2X05A 1SYTA 3R0KA 4OBRA 1ITQA 4ZOBA 2J27A 2OEJA 4EQXA 1JYVA 5CPLA 5LIUX 3L7RA 1K8YA 2CW6A 4HN8A 3BMXA 3LG3A 2OT0A 4Y9PA 3FA3A 3STFA 4UCFA 5D9MA 4J4KA 1PKNA 3KCLA 4XG1A 1LUCB 1SMDA 1ZMCA 5AYYA 4S2CA 3IJ8A 3QGVA 2NQHA 4AC7C 1CX9A 2C0AA 4WGHA 3ANVA 4DF0A 3OG3A 5C9WA 4KWWA 3OZPA 3NQ8A 1GTEA 1KLZA 2YCKX 1A53A 4NVTA 1BYBA 3EAUA 1EUNA 4L64A 1DXFA 1K1DA 4E6MA 1PL9A 3C2FA 4JIIX 2DZTA 4TVWA 2PUZA 3WD2A 1KM4A 4P8VA 3ONCA 3VE7A 4JIQA 1HF6A 4ZB0A 1EDQA 4WRHA 2CERA 2A0NA 4F0SA 1KR0A 3CHEA 4GQQA 1LM1A 1E55A 4XD4A 1XRVA 4ASTA 2O92A 1QR7A 3VZXA 2GOKA 2PF8A 1S38A 3W74A 3VDCA 2ONEA 2X8GA 5KITA 3HPXA 1HVQA 5HMDA 1S2VA 3NO3A 2AGTA 4RKAA 4JAWA 3QPYA 4PCPA 4GUHA 3A5FA 4GINA 4QFUA 2EAWA 4LWWA 1Q5MA 4XVDA 5HBFA 1KV5A 2ZZ4A 4ROPA 3KTCA 2Z7KA 1HJQA 3LQLA 4B92A 3KFTA 3ENLA 2BY3A 4QG9A 3TWBA 4K1WA 2JF7A 1ZAJA 1WAWA 3SFKA 4C6BA 5ABGA 4UTFA 3LLXA 5LIWX 4DI8A 3KDNA 3GUGA 4D6DA 3AU2A 3WD4A 3BSMA 4UFHA 4QLJA 4MUPA 3KBSA 2PEVA 2YXXA 2WKLA 3AYTA 2EQ6A 5GJMA 4MWAD 5HAOA 2EG6A 4RV8A 2H6RA 3H2OA 3M0IA 4O12A 2XM1A 1KLYA 9CGTA 1B1YA 1PKYA 1ZZMA 3PPFA 4AX6A 3UZJA 1GQIA 4YJ5A 3ZT7A 3QY8A 1N55A 4S1FA 2A4AA 4L9YA 1MNZA 4W89A 1L8NA 1CXFA 1GVQA 1O6IA 2ABBA 4ZO6A 1PX3A 5A8PA 3VKJA 2AAQA 1M7OA 3QTPA 4XWUA 1R9ZA 2X2YA 4HYRA 4X60A 1XDLA 1YX1A 4GUJA 2FHCA 1ZCCA 5L6UA 3SN0A 3U4AA 2EG8A 3F1QA 3E74A 4D6CA 1Y8BA 2VFDA 3HA1A 4GR1A 1ZFJA 5CPOA 3WF4A 4FXJA 4FX6M 1PZ0A 2X8RA 3SUUA 1PSCA 1FP8A 3KVMA 3GDTA 3DCPA 5JCIA 5CG7A 4H6EA 3SSJA 3I10A 2QIIA 3AXMA 3H55A 2KAUC 5GQBA 2VZUA 3ARVA 3BQ6A 1HL9A 2PGWA 3LADA 1S5NA 5HANA 3QGAC 2DVUA 2VYOA 2YCLA 2PTZA 1MUMA 5D9OA 3S46A 8TIMA 2BOGX 2WM1A 4FDCB 4AB4A 4PMQA 1F3EA 2WZTA 3U2CA 2GFTA 1LQAA 1Y5WA 4FX8A 3QW4B 1N7KA 3MKVA 3QQ1A 4CD8A 4JTEA 1S1PA 5GNZA 2A3CA 3F2DA 1MQRA 4XB3A 4H7ZA 3N29A 1BHGA 1EJVC 1PUDA 2I1OA 4H01A 1YDVA 2FGZA 4C1NA 1O4UA 3PAOA 3LERA 2VKZG 4IMEA 2XH4A 3LTPA 2GDUA 1Q13A 4PBEA 1YE4A 3AHXA 3LRKA 3GRIA 1XBXA 3F2CA 1TELA 3M16A 1H09A 1GV4A 3FK4A 5CZJA 2EPMX 3CU2A 1XYAA 2Y8KA 3MUXA 5REQB 3UP8A 4JTJA 1QK0A 1MEWA 2WCGA 2IKJA 3H4KA 4B5UA 4NJIA 4O0ZA 4RDYA 5GNYA 3T44A 1RXOB 3SR6B 2ESCA 5DN1A 4B15A 3P5ZA 2E4TA 4Q4PA 2V81A 3UGVA 1IXNA 3CO8A 1V79A 1S5MA 4RXFA 1W9PA 1HKIA 4MM1A 3WD3A 3H2MA 2PTDA 2UY4A 4AIOA 3ITCA 3H4XA 5H8UA 2EXOA 5FF7A 1OD0A 1O5XA 2VQUA 4ZE4A 4WF7A 4WOQA 2QCDA 2FDMA 4GQGA 3II1A 4YXGA 1QVBA 4NXKA 3U9IA 5DMMA 1I2OA 4DZHA 4J27A 1KC7A 1TMLA 2ZRZA 3WDPP 4QGCA 3H2AA 4PCNA 3VGEA 5E93A 1CLKA 4I9JA 5IM51 3QXBA 1XFBA 3VDBA 1DBTA 5AC7A 5CQ1A 2BB0A 2AKMA 4TMCA 3L4XA 4P7OA 3WFZA 1VH7A 5FACA 4M1BA 4BQ2A 3ITYA 3EDDA 3S8HA 1YEYA 3V7PA 4GKLA 1J0YA 3W2MA 3PN8A 4R88A 3MW7A 3P82A 4ADWA 3GDKA 3WK0A 3GXMA 2Z6JA 1DVJA 4DWSA 3C0QA 3W1AA 1UR4A 2R8WA 3I7SA 4N9EA 1MZHA 2C3DA 4Q22A 1ZKQA 2TPSA 1XIEA 3A3HA 4LOCA 1GJPA 1UW9A 2GR1A 1KTBA 2QMJA 2D24A 2VGIA 3E5BA 3VNMA 2WOIA 1TZ7A 4AXNA 2PB1A 2NLYA 3RYSA 1Q6FA 2X09A 4KBXA 3AALA 2NWSA 4RW3A 2VZVA 2XYLA 2ZZ2A 4WHBA 3W53A 4DI9A 2Y88A 1RCXB 2DUZA 3BW2A 2DT2A 4TOQA 1GQJA 3W1XA 1DIDA 1NDAA 3BCJA 4JD4A 1E6QM 3MP3A 4S3EA 2DFAA 3THAA 3VX0A 3HU7A 4QITA 1ISZA 3SADA 5A8GA 5FJPA 3KEHA 3PJTA 3M43A 7ODCA 2G95A 5JXQA 4LCRA 3RLGA 3UFYA 3WG6A 5A2BA 3ITTA 4MNLA 1TV3A 5TBOA 3EDFA 4ERGA 2GOUA 3R8RA 1B54A 1SZRA 1JR1A 2P1FA 4ZQRA 4AVNA 1I0DA 5A8QA 2ZZ3A 3AMGA 3W6MA 1G67A 2HK0A 2XU2A 3QMRA 4JCMA 4O57A 1N8WA 4KW2A 1E72M 3L4UA 3MSGA 3KCJA 3FCPA 2WANA 4NJHA 5F4SA 3OIXA 1MVYA 2A5HA 1OFPA 3QFBA 6XIAA 4DLFA 1R3TA 3LV5A 2IQTA 4RDVA 1FVPA 1E5JA 1Z32X 3TCEA 1UR9A 5F1UA 5H8MA 3FOKA 3ZQ9A 4MDPA 4GZIA 4UFMA 4HP5A 3V3WA 3IRDA 3NCOA 2OYLA 1ISVA 4HSNA 1E6NA 4H9MA 3WQEA 3WBAA 3STEA 3WJWA 2CLLA 4MLRA 1BRLB 2C71A 2VI0A 2XIOA 3MSDA 5F7UA 4PB5A 2G3JA 3M64A 1ZX9A 1Q6GA 1OGGA 2ISVA 3STGA 3BLFA 4PCTA 3H70A 4XO6A 3GHUA 4IJBA 5I09A 3W86A 2G5WA 2HDJA 1B31A 2D22A 1XQKA 5ABFA 4IMAA 1FX6A 3RM9A 4U5IA 1DJWA 4DJEC 3THUA 3L68A 3NEVA 3BV7A 2WWDA 2OGJA 3QLDA 4FP1A 3CT7A 2WAGA 3MV01 3R2GA 4LVDA 3VO0A 4AZGA 3RITA 5E0FA 3USZA 2O9OA 2WW5A 4B5WA 1IT8A 4GIAA 5FS8A 1TYGA 3DK8A 3ARYA 3D46A 4LUTB 1U5VA 1EZ2A 4I5UA 3PG6A 4OKDA 3PZOA 4IQLA 1E40A 3FSTA 4MAVA 1HJXA 2E6FA 2NVCA 4Y9NA 1IZKA 3KS6A 3VFCA 3W24A 3LXBA 1RBAA 1O94A 2QJGA 4JY9A 1ZRQA 5LHEA 2Z1BA 1NDZA 1TSIA 4B4FA 2FH6A 1STZA 4MJZA 4U2YA 2P10A 3WUFA 1FQ0A 4CNTA 2QJNA 1X6NA 7PTDA 5CCZA 1R30A 1MWOA 1H7OA 3A24A 1UP3A 3AIRA 4Y9AA 3WSUA 4AU0A 1XXXA 3GNXA 4Q8OA 4U3CA 3TSDA 4JTKA 3PS7A 1O5KA 3IJLA 4Z2GA 3S3GA 4ZTYA 2E9BA 5C2XA 4X63A 4GG9A 4GY0A 1TCDA 3B0VC 2YAUA 2YZ5A 1J2WA 3NSXA 4HBKA 1NDYA 3W7RA 1TJ1A 3WQPA 2EKGA 4LC6A 1J0JA 3N14A 2NXGA 3IIPA 4CVWA 3E0VA 3N18A 3NPWA 3ARRA 4H00A 2XIIA 3TJLA 3ZLGA 2JGYA 4RCXA 3AMCA 3KBVA 4IQJA 2VX6A 1QCWA 1P6BA 2QJJA 1GEQA 2HBVA 5K9XA 5A6LA 4H1ZA 1A5NC 1FWEC 4EPBC 3FS2A 1UJQA 1LOQA 5F2LA 4K38A 1IWBA 2P76A 4MY8A 4ATDA 4EMWA 1H11A 2E8ZA 1V3KA 2DDXA 2DVXA 3PPHA 2D0FA 3V1HA 5HR7A 4NHVA 3TJXA 1GOOA 3SGGA 3ITGA 1QTWA 2HPMA 2XVNA 2VOMA 4ORMA 1TA3B 1DPMA 1TWIA 2XISA 5FJRA 4OUIA 1XC6A 4H8HA 1FEBA 4YNGA 1UR8A 3BSHA 4YHGA 2EPNA 3G1VA 2AL2A 1H3GA 1HL8A 4D72A 4QE5A 3VKBA 3BL3A 3AO0A 4W7VA 3E2VA 4QRNA 2B7OA 1W9DM 1UWQA 1WXJA 4E4FA 1KFEA 1B2YA 3PUEA 3R10A 1EGZA 2CZDA 3ABQA 4HNNA 4DNMA 1W5NA 3VILA 2NLIA 5LIXX 2Z1XA 1CDGA 1KWGA 7XIMA 2GJRA 4HK6A 3UCDA 3MI6A 1J01A 2W67A 4XZWA 1DIEA 4MY9A 4CN4A 4V33A 3SCNA 3S2JA 1L2UA 1LTDA 4JN7A 2J88A 2XH7A 3R25A 3HURA 3CMFA 2NW0A 2NXIA 3EWDA 4DJDD 1UQZA 3F5JA 3SQPA 2C79A 2NX9A 1V6YA 3TTEA 1EWEA 3WLTA 1HGYA 2X16A 3TOYA 1UOKA 3NVYB 3LHZA 4XZLX 3WK2A 4PGLA 4K68A 1SZFA 5BZAA 4LALA 4WDWA 4QS5A 1U1HA 4PMOA 2E5BA 1ZQ5A 2J25A 3QGKC 2ZTJA 1R5YA 1ITUA 3LYEA 2CZFA 3M0ZA 3WLSA 1V0NA 4LUYA 4B5SA 1J4EA 3WNMA 3VNZA 4FNQA 1BD0A 3AIUA 1JCXA 3LTYA 4BCEA 5DQPA 1F8WA 5F1VA 1SO4A 2WZHA 4UMAA 3OIHA 4Q33A 4XSLA 3WKZA 2VCBA 1N62C 4PH6A 3CWHA 4FLSA 3LV6A 4A35A 2WC7A 3P60A 4RUBA 4NZCA 1GWJA 3B03A 3WZ0E 3TAOA 1GSNA 3II4A 5A8NA 3NDZA 4C91A 5I6SA 3TN6A 3L21A 4LTSA 4DWSD 3VD3A 2GVYA 1D7YA 4J3ZA 1U22A 2O9PA 1K9DA 4YTTA 3GC4A 3BLEA 1QW7A 5EKYA 5AFDA 2CXEA 1TUFA 1RY0A 5I06A 3O15A 1UHVA 2GQ8A 4EM4A 1TR9A 4S3GA 3VNKA 3K4DA 4AZHA 3GK0A 3DG6A 2OODA 1K8XA 4H4ZA 4JFVA 2RJGA 1PHQA 4TX6A 1B0IA 3ARPA 3DYOA 4U2ZA 4GBDA 3S6TA 3LXCA 4HHLA 2XSAA 2C3ZA 5FJTA 2CLIA 1DOSA 2GJNA 1IHIA 3A6OA 4MJ2A 1ZK7A 4ERAA 4B5NA 1XG4A 4JQ2A 5IBXA 3Q58A 1GOQA 1NDVA 1ZTVA 5BXTA 1FEAA 4G9PA 2CC0A 3GDMA 3RNDA 2DORA 3ERPA 1R2RA 4XAZA 4FNRA 3BJSA 1GJWA 3QQ0A 3TWAA 1XLMA 3S6DA 3HJEA 4O19A 2GR3A 2J24A 4IMCA 4M56A 1OC7A 1VBUA 5E6YA 2VC6A 4IP4A 2WMFA 1V3LA 4ATWA 1A0CA 2OR2A 4JICA 1YHTA 2YXOA 3MJYA 2BHUA 4K39A 1FWNA 3MVIA 1K9FA 1FP9A 1OGSA 3AZSA 3PZIA 5LZLA 1UIOA 5FKYA 3CT2A 4KETA 1EF3A 1E9YB 3FV9A 1TPH1 1CNVA 5AZ1A 4S3DA 4XAFA 4IPPA 3NZ1A 1OYBA 5AVHA 1OYAA 1OABA 1TTIA 4FX7A 5AYIA 2G50A 3TKFA 3NFUA 4E4UA 2WNWA 4E8DA 1H41A 1OZQA 3V0SA 1TWWA 1V77A 1UASA 3LB0A 2Y5SA 4ZL1A 5EBAA 4KWUA 4M6UA 1JZ3A 2J8GA 4ZMGA 1ME7A 4XV0A 3WBXA 4EXQA 4ATLA 1C9WA 5FJUA 4F40A 1YMYA 2YCEA 1E9ZB 2J79A 4M6VA 3CHCA 3GG7A 3WL1A 4D6IA 1B9BA 2PU0A 5G2IA 5U4NA 1TJPA 1EZWA 1TV4A 3D6NA 1W8GA 4GUIA 2PGRA 2YFNA 3Q67A 4CQCA 3EKGA 1C8YA 3TFXA 2QCCA 2X8CA 4U33A 1J93A 1H49A 3E49A 3N11A 2PS2A 3N6QA 4EANA 4LAOA 3AZRA 3EKZA 1P48A 1XLGA 3B9EA 2HEJA 2QCDB 1UD5A 2V8ZA 3ZVHB 2V9DA 2ZXDA 4L1GA 4TTUA 4IIGA 1ODZA 3UJSA 1I1XA 2VRJA 1NWTA 2X7VA 1ZCOA 3NL5A 1XPGA 3LLFA 4YTSA 3CM4A 1UA3A 1Z44A 3VZZA 1VGAA 4IGMA 1W1IE 1J0ZA 5JIPA 4S3CA 3DDMA 4Q4KA 5CGMA 1J2BA 3MCNA 1NOUA 3MCOA 4M81A 2GJXB 5HULA 2ZRWA 5HNNA 3FJ6A 3NVTA 4PUEA 1BWCA 3CUIA 1YDNA 3HGOA 3QFWA 5CC6A 4KQNA 5AKQA 3S2MA 1TYPA 1YADA 4WY0F 3MSRA 3UZYA 3W7DA 3EX2A 1YIXA 3MI3A 1JCLA 5HXMA 3QH2A 4NILA 1DE5A 3R43A 1H7PA 2FTPA 3G1XA 3W70A 4X0VA 1YBQA 1V3JA 1VRXA 4RNHA 2DJLA 2GVEA 1FCUA 3L23A 4LVGA 1HL2A 4O10A 1R6WA 1X39A 5K7JA 1OCNA 1YLVA 4DLMA 3GB6A 2ON3A 4O50A 1JPKA 3OQ8A 2WSPA 3TW6A 3UJEA 3VDAA 4IXHA 3WENA 3JW7A 4M1RA 1MI3A 2VL4A 9XIAA 3K8KA 3OP2A 7TIMA 2VHLA 3UETA 1XDIA 4RE3A 3ITLA 3B8DA 2BZNA 4C6KA 4R5EA 3CBWA 2R91A 4PA8A 3UT0A 3KRSA 2QCGA 3LCGA 4G2DA 1M6JA 2HS8A 3EPNA 2J6XA 4L80A 3MQTA 2ZA1A 4QDMA 4PZVA 2Q8LA 3E12A 4IL2A 2Y2WA 1XRTA 2PDLA 1H7XA 2INFA 1MEHA 2VP8A 4FIQA 2KX9A 4BZYA 2HE8A 2GSHA 3AS1A 4GX8A 5TD4A 3T2OA 4NYUA 3HJZA 3NVWB 1VFUA 3MUZ1 2G0WA 4ZFCA 4N42A 1F9CA 2OEKA 2QYGA 3KP0A 3T08A 1DJHA 2OQHA 3TN3A 2Y63A 4Z0JA 3ARUA 2VTFA 2WYSA 1A3XA 3RFAA 4GYKA 4JL1A 4LUIA 1F05A 3LTSA 5DF0A 3O16A 3U0HA 1GW1A 4PTNA 3WQWA 2C13A 3G1FA 3KOXA 2DZSA 3EMZA 2HK1A 2PP0A 3AISA 1XIFA 3DXIA 3NAVA 1FDJA 1XWYA 2V68A 1SZEA 1IR2A 2E6YA 4HN4A 3ZSSA 2WLYA 4XD6A 1XRSA 2J13A 3CUFA 2VRKA 1VFHA 1O5QA 3JU2A 1K8ZA 4IG2A 3C6CA 4HOWA 4ZSUA 4KRZA 1S3HA 3PSVA 3VPLA 2FZMA 1GEHA 1VCFA 3CHFA 1P0KA 1ISXA 4MKVA 4CKQA 2G3FA 5HR6A 3MTWA 3WEMA 1EC7A 2ISWA 3B8TA 4PMDA 3VVGA 1RQHA 3CV7A 5AHIA 1KNWA 2XSBA 1SB3B 3DYPA 1J0KA 4XUYA 1JF5A 3OG2A 3KDOA 1NWRA 4ICMA 5BW6A 2X1IA 4RJEA 4QAIA 3SUSA 3EKLA 1ITXA 4RNIA 3PFMA 5T8GA 3SCQA 2O55A 7TAAA 1IEWA 4GQBA 4PMUA 1Q4WA 3A4JA 2XG9A 3EX3A 3L4TA 2QCFA 4KCVA 3K2GA 2I57A 5GVJA 3F4NA 1WV2A 1XDJA 3ARWA 1A4MA 3OYXA 1EHAA 3N2OA 1QXLA 3AI0A 3HPSA 4KIEA 1ENUA 3G22A 3E0LA 3FSUA 1E6ZA 1TB3A 1I9CB 4LW7A 4LCQA 1C3FA 4LU0A 4Z42C 4C60A 2I5QA 4IMDA 3P8IA 3BAXA 1K3UA 4O1FA 1UOZA 3GRSA 1QK2A 3FHQA 4GO9A 4IIFA 1ZENA 3FY1A 5LNSA 5FSEC 4D8LA 1JGIA 3O9NA 1E6PA 3TZNA 3WMBA 1TRDA 3S9YA 1Q7ZA 2WNNA 3UWUA 4KH2A 4L4MA 5ABEA 4ZQPA 1YPIA 4H4XA 1V8EA 4BI5A 1R0MA 1P4CA 4A8RA 3NG3A 1MO0A 5CZ0A 3T42A 1NHQA 4S23A 1OYCA 2YLLA 1Q3NA 3VOGA 4IQDA 3VIOA 4F4RA 3EEGA 5E5CA 2C19A 4UQBA 4HKPA 4ZOHB 1SM9A 4HK5A 3L0NA 4ZTXA 1AW1A 4AD1A 2YBTA 3ABOA 2UZ9A 2QCNA 1G4TA 1OHLA 4RZBA 4HU3A 1JQVA 4GFIA 3OLEA 1KBKA 2YQUA 2Z2AA 3GS6A 3GAYA 1H5YA 5JRBA 1NOFA 1UKPA 4PRTA 2JKAA 1E4LA 3CAVA 1QAPA 2VQTA 1OFQA 4W8AA 1F74A 1ECQA 3P84A 1NU5A 3WQ5A 1KM6A 2VC5A 3CGDA 1GW9A 4DZIA 1HGWA 4MZ8A 4TUFA 3GX9A 3OU8A 3U5UA 3O6DA 3QW3A 4HNCA 1SPQA 1EQPA 1XLEA 3WMCA 3QSTA 4PMXA 1DE6A 2YBVA 2VFIA 4H8UA 1TIMA 1WYIA 4H4SA 5FL1A 3UCQA 4OZOA 2PDIA 2OG9A 3I3EA 2P8BA 1KO0A 3E0WA 4EAMA 2WPGA 1L8PA 3I6TA 1P7TA 3BOLA 1BFNA 2QPXA 1F3XA 3MHFA 1HO1A 4EACA 1MDLA 1RBOB 3GH5A 2YB4A 1JDFA 4WOZA 3EA3A 4DBSA 4R53A 4QS6A 1FH7A 1W1YA 3ABRA 2CETA 6TIMA 1GESA 5KZMA 4JTAA 3RM4A 4IG2B 3PZNA 3KLLA 4MFDA 1V6WA 3SCTA 4IGHA 3SY8A 4XZBA 4IUOA 2ZCGA 2V3DA 3W1RA 2WC3A 4JOMA 4K8DA 4P8XA 1FWWA 4GJJA 4DYJA 4WJXA 4AWSA 3DESA 2XJ7A 4XAGA 5KETA 1AD1A 4TVDA 3QSRA 3RLHA 3LCFA 3BW3A 4HQVA 4NY2A 2WMJA 4GJ1A 4ICNA 4GIEA 3KWXA 2ZX9A 5IBXC 1US0A 5CJMA 3GR4A 4OBSA 1GG1A 4DXXA 4DAFA 3UR5A 4M82A 3W02A 3FYOA 3TE9A 3BGJA 3GXTA 1QNRA 5ABHA 2PLJA 3F4CA 4IPNB 4QDWA 3NOYA 3NS1B 2GJPA 3IVUA 3KRZA 1ODUA 4JTQA 2WOVA 4KKXA 1FWGC 5FL0A 4GK8A 1SJAA 2F61A 3WQ4A 6CGTA 1O1ZA 3W7HA 2QVHA 4Q32A 3LCIA 3ME3A 2DIKA 3DOPA 2PCEA 1TV8A 2OQLA 1OC6A 3CH0A 4MWAA 2P8CA 1M1BA 4LAUA 4DUVA 1UUOA 1BAGA 1NF0A 4AC1X 1RVKA 5MHBA 3G1YA 5AC5A 1WZMA 4G1NA 1JYXA 4LB4A 3EA2A 4URIA 1XH0A 4O1AA 3DFNA 4X2PA 2ZRUA 2W62A 4L1XA 1QI4A 3WJZA 1J5TA 4ML4A 4PC8A 4JIHA 3VYLA 2YOCA 4JHOA 3VDHA 4DBDA 1XI3A 3TYUA 1I2PA 5FEWA 1NFBA 1RALA 1IXPA 3FDGA 1GZ1A 3MB9A 3I68A 3R89A 3H7VA 5CZSA 2XFFA 4O14A 5EMJA 3T09A 1JXKA 1LROA 1UKQA 1KB3A 2OB3A 3TN5A 1MQPA 2QUMA 4O52A 2IKGA 3N1AA 1VYPX 2OSWA 3IANA 1W5QA 1T6MA 3UA4A 2I9UA 4IGNA 3OPSA 1HJUA 2X40A 1EF2A 2HROA 3HOJA 2V69A 2QZRA 1E3XA 2FJKA 4FF5A 2Q8ZA 1HJWA 2ZA3A 2INZA 1PTDA 3WLQA 4YYFA 3DIPA 2NSXA 2BASA 1XCXA 4QCFA 5HQLA 3WNOA 4PR4A 2VEGA 4K3ZA 4N9BA 2VCCA 4GHRA 5M2FX 3R07C 2BVYA 3ARZA 2O9TA 3D5HA 1MRAA 1MDRA 2XM2A 3LMYA 2JKPA 4HNTA 1E1EA 3DFHA 3LBCA 1UWUA 4HD5A 4AEOA 1Q6DA 2FVLA 3L2MA 1REQB 4R27A 3EWCA 1P6WA 1FDYA 3RHGA 3E02A 3WH7A 3CUZA 4PULA 3HPZA 1LWJA 4ONVA 5A6SA 2Q6ZA 4F2UA 1S5VA 1L9WA 5A6BD 1VS1A 3ZLFA 1E4IA 3P80A 4AZCA 4EIVA 5E0KA 4NZ3A 3NQVA 3BURA 3FJNA 3E9AA 3WNNA 5AC4A 3LXDA 4WLCA 2V5CA 4REQA 1UH3A 3S1GA 3ANUA 3AMLA 4HU4A 2E77A 1A80A 1UKSA 2BS9A 3VINA 3KS5A 2XN2A 2CKSA 4Y6GA 2EQ7A 2F6XA 2FTYA 1EDGA 3EB3A 3IUIA 4GE8A 2PFHA 2J47A 2X8HA 2VMFA 3P2VA 2MANA 2HISA 1E56A 1KD0A 4NEVA 3OO2A 1MRQA 1GYLA 4MMWA 4UTWA 2TAAA 3WFAA 1X38A 3QV7A 2OLSA 1G6CA 1PIGA 4Y9MA 4UFJA 3GC2A 1W3TA 1D9EA 4HNOA 2C3CA 1HUVA 1W37A 4IFKA 2WPFA 2Q8XA 3QLLA 4JKMA 1H5VA 2JF6A 3V36A 1UH4A 3RDKA 3M9YA 1U30A 4P7NA 4QP0A 4DJEA 4QQ3A 3S1XA 4O0QA 5HMFA 2NVAA 3OHIA 3LGGA 1JZ7A 1G7UA 3AS0A 4O11A 1EKOA 1C91A 4HA0A 3GHRA 3V5CA 3CEUA 3W00A 4KEZA 3LPFA 4MWAC 3UF9A 1FWDC 2DY3A 4H9VA 3S5ZA 2W79A 3EPMA 1MOKA 4QLLA 3KCOA 1UWAA 4F2TA 3PBGA 2WXDM 1FRBA 3KOWA 3LCHA 3LRLA 2V2HA 4CQ9A 3WLIA 1SJCA 4CU6A 4GUFA 5AY7A 1YDOA 2ZVIA 3GG8A 4UC5A 1XISA 1H1ZA 2VURA 1K03A 2I16A 1JAKA 3AYVA 1H63A 4GZJA 1XYCA 1GZJA 2V3GA 3N73A 1KGXA 1FWSA 3VIJA 5KVIA 1PB0A 4L1WA 4XZHA 4A8NA 2Q09A 1N63C 2CLFA 3B0YA 1W5OA 4LUTA 1F6PA 4S3KA 1EC9A 3O0KA 1UMYA 4W5ZA 1T96A 3GNOA 4NSBA 1ZGDA 1KA9F 3KTXA 4WKFA 3TYZA 3UCCA 1O5RA 1ZP4A 1EOKA 1K9TA 4MG4A 2FZ9A 2PC4A 4Q4OA 3GYEA 4MNJA 1B5TA 4UMCA 3NNTA 3LHUA 1ICPA 4Q7NA 5CXPA 3B97A 4AEFA 1LORA 1OIMA 1RP9A 1LBMA 2XVPA 4H9YA 3BLLA 1T3QC 3RJXA 3REQB 2F7FA 2ZUWA 3BJFA 5CC5A 1LQ0A 3CUHA 3DHFA 5D05A 4JTTA 3KHJA 2BP1A 2ASHA 1BWVA 5CLWA 1FWIC 3B3DA 2QDHA 1KFWA 3W7KA 3AFBA 4O8RA 5EBKA 1UP2A 2IQDA 1XSKA 5D38A 2R6OA 1V7YA 3N34A 3BANA 3U3HA 3DFTA 4NEWA 3QVQA 2PDQA 4LSBA 4ILSA 3N13A 3A3WA 1VD6A 4ZOEA 4US5A 3V0TA 2CLKA 1TA3A 5HQEA 2D0GA 4JCLA 1R9XA 1XQLA 1IIGA 3G5EA 1E1FA 1F73A 4HYWA 1IEIA 1GOXA 1EUAA 3GDBA 5FAJA 4LBRA 3IARA 2Z1WA 1OGBA 3VA8A 3GVVA 1U1UA 3SCVA 4IFKB 1A3WA 4CD4A 2BG5A 1H51A 3KVKA 4PE8A 3URAA 1AL8A 3JZEA 2FPTA 2BLEA 3G2GA 1PWLA 4FSAA 4LS2A 2PWFA 3GIPA 3WJYA 2VFFA 1ZXIC 4ZA0A 2YA2A 4GVIA 3BQ5A 1XYMA 3RPTA 3GH4A 4UTUA 1BXBA 3S1VA 3TNBA 3TYEA 3R12A 8RUCA 1GVOA 1XPYA 3WBEA 3EOLA 1WAUA 4YCPA 1PXGA 3W7LA 4JQ9A 4LVBA 1TYTA 8CGTA 1AZ1A 1MYRA 5DT5A 1IT0A 2C18A 1C29A 1OQFA 1DTUA 3GXDA 4NQ1A 3KRUA 3A3XA 5AHLA 3CL8A 4K7VA 4IP7A 3CYVA 3RR1A 3GFYA 1TQXA 4AZ7A 3TU9A 4V15A 2A7NA 1KN0A 4JTIA 2HS6A 3DKJA 3EB2A 5MF5A 4XVEA 2JK6A 1DJYA 3VNDA 1UC4A 2YA1A 3G1SA 1XG3A 3GR8A 4OFCA 2Z00A 3H26A 1XD0A 4TTGA 3ABXA 4Z2LA 2FMOA 3UYCA 3IIVA 1I4NA 3PZQA 1N5XA 3MC5A 2RDWA 1RBLA 1EP2A 3BZJA 1QBBA 1BVWA 1EC8A 3EXTA 3WEZA 2NQLA 3TN4A 3TXVA 2XWDA 4UTHA 1EX1A 3PUDA 2ZIDA 1W2PA 1V02A 4HPNA 3M6YA 1WXYA 3HBLA 3IC9A 3QJAA 4S3AA 2WB5A 1VIWA 4HMDA 2PBGA 3A23A 3KL5A 3I65A 1R7OA 1TFVA 4I8YA 3R0DA 3PZ9A 2V3BA 3M07A 5FS9A 2G41A 4LS1A 3TX9A 3W73A 2PLCA 4L6HA 4LY8A 3IVTA 2C1HA 3QY7A 4AHPA 1W3HA 4V27A 2DP3A 1FWAC 3RNMA 2FGLA 3R8GA 4NJKA 4UQ9A 3EF6A 2OZ0A 2V67A 1GQLA 4TX9A 5K9DA 4IH3A 3FGCA 3VX1A 1F4AA 3G77A 3OQEA 2VGFA 3PZTA 2ISDA 1S39A 1PZ1A 1YXYA 1WUFA 1AVAA 4PMVA 4W93A 4UR7A 5BXRA 1UWIA 3DZ1A 1GVSA 2PC8A 1W32A 3GUWA 3SO7A 4PFHA 4DJFA 1PYFA 4ZQNA 1E0VA 1HW6A 5T9BG 1TKKA 1FWTA 4EK7A 1RD6A 2W5FA 3AUOA 1OX6A 4MHBA 1QNSA 2VRQA 4IMFA 4M6QA 3SN1A 3WQCA 4PSRA 1PX4A 3P0WA 3K8LA 4OT7A 4DHGA 3CPGA 4QE1A 1M03A 4OWGA 3L67A 3T2QA 4QHRA 3PNUA 5KZEA 4TVCA 1Q63A 1KBJA 5FD0A 1ZY8A 4C6LA 1IWPA 3A4AA 5BWAA 1RD5A 4YIWA 5FJOA 3P6LA 5CAHA 3L4YA 2GH5A 3KBNA 3EWWA 4LV4A 2Q02A 2XPKA 2BGNE 4KFPA 3UXDA 1JCYA 4HA1A 4L7ZA 2J8TA 4W7UA 1QO2A 4IQEA 1Q85A 1S2WA 2UV8G 2D0HA 2XHYA 2GVLA 5D2XA 3EPOA 4PODA 2ZVRA 3MYOA 5FIPA 6REQB 2YDAA 4EQSA 2X99A 1JXJA 1J18A 3CWOX 5EB8A 4BEUA 4QTGA 3G3MA 4JHMA 1GYMA 3HIJA 4PB3A 4E2DA 5I3KA 1Q45A 2JEPA 5I5RA 1JYWA 3EWXA 3TLLA 5DBUA 2WZIA 3THQA 5D30A 2NZLA 1R46A 5HUPA 2FZBA 3BMWA 3PBVA 1XLAA 1ZLPA 4TX8A 3DK4A 3A22A 2FZ8A 4QJ4B 3H24A 4K6AA 4J3TA 1DJZA 4O1CA 3AHZA 3O0HA 3VM7A 3BSGA 1V4YA 2CFFA 4IOTA 3DJGX 2PDWA 3W1NA 3TTQA 3W25A 2D1ZA 2HNEA 4ORIA 3EYPA 2X0SA 3SCWA 2ZZBA 4G6CA 2J7DA 2YDQA 4A6GA 1DP0A 3NYZA 1DNCA 4JQ1A 4YLWA 3BUVA 5B7ZA 3K46A 2WHLA 3BC9A 4LUSB 1R86A 3WJSA 3C86A 3NQMA 3WD0A 3RX3A 1BWKA 2OYKA 2IMRA 1VRDA 3DI0A 2P3EA 2R14A 3AMZA 1W6TA 1QFEA 3PF3A 4Q8UA 2W27A 3CGTA 4J3SA 1GT8A 5H6HA 1JFXA 1TWSA 4EWND 1T8XA 1EIXA 3UZWA 2DJXA 4TU1A 1R3WA 2DZAA 3WNPA 4GI9A 5I07A 4FMVA 4OOUA 1W2VA 1UD3A 4UR8A 1FECA 3GO2A 3UY8A 5A8OA 3N12A 3CJPA 5ABTA 2Z26A 2X1TA 1D3GA 2WJZA 4N0RA 2QF8A 1FA2A 3UWEA 2VEPA 3TH6A 1W1ZA 3G0XA 2Z4GA 3GD4A 4MZ1A 2GDQA 3T0AA 1QI5A 2E0PA 1L2QA 1KXHA 1A5BA 1EYEA 3IEBA 1S2AA 5FS7A 4WQ6A 2BOFX 1ZL1A 4H2CA 2PDNA 4MUZA 1JF6A 5J8LA 2YXGA 1QPNA 3VM5A 2ZWZA 1US3A 4ZXOA 3M4HA 2XINA 3RX4A 3PFRA 4PUNA 3WCZA 2D23A 1RAKA 4Z1BA 1Q2SA 1OD8A 5HWMA 1DJQA 3QKZA 2Z29A 1P0EA 4R9XA 1W3JA 2WNQA 3L4VA 3PHAA 2NV2A 4Q7IA 1OFDA 3CB3A 2O4QA 1BWLA 3KHDA 4IX0A 2FB2A 3AYRA 5CLTA 1ONRA 5G5GB 4Y8FA 3PBUA 1KM1A 6A3HA 1UD2A 1KCXA 5I03A 4Q8PA 3UR8A 3HGRA 4LBSA 2E5DA 1YQZA 4GLEA 1NF7A 3QR3A 3M47A 2D2GA 4AIUA 4A29A 1VPQA 4CD5A 3CQJA 3I4KA 3K1DA 4U31A 5BOOA 4K8GA 2WKJA 1V3IA 3GDLA 3TFCA 1JJKA 5TF0A 1XGEA 3RLVA 3VE9A 1KGWA 3SCSA 2Z2BA 4H6QA 1SJDA 3C4UA 1AL7A 3RMJA 2X50A 3PNZA 1Z42A 3SRKA 2CBIA 5D2YA 4EF9A 5A5WA 3AIWA 3ATZA 5IRPA 1SO3A 1UQYA 1PPIA 2J6VA 1JQXA 4MKSA 4XZNX 4EOUA 5BMXA 2ZRYA 2CLEA 4W5UA 3AXKA 4J5NA 1TWDA 4JR5A 1W56A 2BCPA 1JUEA 3NRZB 2YCIX 3CZJA 3RAOA 4Q6JA 1QO5A 1KFCA 3QZAA 3GBDA 3NPUA 2VR4A 1OFOA 3QKEA 1J0IA 3FEMA 3UJFA 2CPUA 3AS3A 1BLIA 3ZR6A 1BTCA 5EFFA 4LEQA 1PJ9A 1SR9A 3ZVHA 1HKKA 1RV8A 4JQ3A 3AXXA 3AJ7A 1MFUA 2BVDA 1YTEA 3IJ9A 1NEYA 2CYGA 4GIYA 4R7JA 1U5HA 3EWBX 1H62A 1DYSA 1FKWA 1D8WA 3VIGA 3S6OA 3NO1A 1N60C 3A64A 4BQ4A 3D0CA 2FKPA 3N04A 3LUTA 2QV5A 1K4GA 2X1UA 1WB0A 3PJWA 3W6LA 2PDXA 4OV9A 3ARTA 2QQ6A 2C6QA 2D73A 2DSVA 1XLFA 5HMSA 3LEPA 3QYQA 3SW6A 4GVFA 4A21A 3C61A 3T4CA 1A50A 1GORA 3PTMA 5JCKA 1WDQA 1FXPA 2C14A 4PUDA 1VLWA 3NQ2A 1R8LA 3H21A 2W63A 4MB4A 4PUJA 1ZPTA 1OK4A 3GU1A 2DGAA 2WVVA 1KFJA 1EJTC 4LS0A 4K7ZA 1OADA 3OVGA 1DEDA 2ZUVA 4MIMA 4JFUA 4KCWA 4A05A 1SJBA 2FJUB 2CLPA 3LNMA 2CZEA 1E1CB 4XZIA 3GIYA 4MPQA 3N3TA 3G1AA 1HN1A 3U5YA 1XIIA 4X2RA 3PZUA 3HM7A 4HPXA 4IFOA 4ADUA 2ZZ1A 3FAXA 2NQZA 3FNDA 3W75A 3M0VA 4GKTA 3SGUA 2ALRA 5JCLA 3UQNA 1B3ZA 1UZ1A 2DZBA 1SGJA 1MZRA 3W7EA 2ZZCA 2VEMA 4QSFA 2C16A 2HE5A 3QFAA 4EF8A 3IGUA 2JGQA 1LL4A 4DO4A 3O07A 1XC4A 2CBVA 4GGBA 4NG3A 2Z7GA 3EZ4A 4GYPA 4KMQA 3GXIA 1BQCA 2W0HA 3KXQA 3AIQA 3ZT5A 2C1IA 3THDA 3WUEA 1E3ZA 4HJFA 1TPEA 2ZADA 3B0XA 3R7MA 3CIWA 3O6YX 3T7VA 2VFHA 4TQTA 2Z0IA 4FR1A 2QAEA 4UNIA 1YNQA 3T0TA 4EWJA 1OX4A 5DANA 1V0MA 3VK5A 1GXFA 5DBTA 2I5GA 1LG1A 4WZHA 2BC0A 5CSSA 1NTHA 3MBDA 3NWRA 4C5YA 1EO5A 4C6OA 3CK5A 3CUJA 1ZBWA 3WNLA 4TO8A 4PYSA 3U2EA 4F0MA 4M52A 3W6YA 1OF6A 2R1KA 2QVNA 4GO8A 2XFWA 3EEZA 4LFYA 2VFGA 1FWCC 1JDAA 1GPFA 5IDZA 2YKKA 1KXVA 1WDDA 2VUYA 2XIJA 4AQLA 3ORWA 3A5VA 2OT1A 1WDWA 5HWJA 3CH9A 3LCWA 1VYSX 3MANA 3M5YA 2Q01A 1HKWA 3POHA 3MT1A 1AA1B 1X1OA 1GZGA 4AZ5A 2WCAA 3ONBA 5GRTA 3SCPA 5C9RA 1W1A1 5G2WA 2IPFA 3MDUA 4IMGA 3NQEA 3E1F1 3L5OA 2XIQA 3FKRA 2HCVA 1U1JA 3BVJA 4D8ZA 3G24A 1X6LA 3PSWA 2W6RA 1RHCA 4YVPA 2OZ8A 3MU7A 1BQGA 3A4XA 4MZYA 2XUCA 1BGGA 2PODA 4FF7A 1XIGA 3SZ8A 2H8XA 1J0HA 1K7XA 3UPWA 2RABA 1XBVA 3KOFA 1OK6A 5HPOA 2QDDA 1JNDA 4EPDC 1Q6OA 5PTDA 1FOBA 3UYIA 3T8LA 3CZ8A 2EEXA 1NQ6A 2F6UA 2GVGA 1FWRA 2BC1A 2HTMA 5XIAA 1SFJA 2WVTA 3LI1A 3NL2A 2NSOA 4WJ8A 1EIBA 1ZNNA 3OGVA 4O17A 1E4NA 2HMCA 3EXSA 3P5YA 1PHWA 4AF0B 3M7SA 3G0SA 4J3WA 5HJYA 4FR6A 5D2WA 4CCCA 2TRSA 1P0NA 3W1QA 2PP1A 4QNEA 1MQQA 4L4OA 2V38A 3HZ3A 3NGJA 2FDSA 3N4FA 3LM7A 1K9EA 4LYQA 3LPOA 3EOUA 1A5UA 4DY1A 2PZNA 4GVHA 4HHMA 1V0LA 2PDMA 3A7UA 3LNPA 1J96A 4HA4A 4JEJA 3AN1A 3HF3A 5U7SA 3APYA 4RE2A 3L5AA 4PRRA 1BSIA 3S1WA 1X6UA 4P7LA 5ABFB 1XICA 5DCBA 1ESWA 2FVKA 4DO7A 1UWTA 3ZJ7A 3VD5A 3ALFA 4APNA 4RK8A 2H9AB 4NT0A 1SW7A 2AAMA 2BBFA 3HFTA 1L6YA 4UBPC 2QR6A 4H9TA 2AGKA 2A7RA 3WQGA 5LA2A 3LZ3A 2YW4A 1RZMA 2D3NA 3VD4A 1G69A 3AROA 1R7AA 3GW3A 2DZUA 3OA5A 4GC4A 4K37A 3C2EA 1KQZA 4E2VA 1JDEA 3GAKA 2OEMA 3KRBA 1OT1A 1XBZA 4MLJA 4YCOA 3DGBA 4YTQA 5J5RA 2H9AA 3PZVA 4UNLA 2H90A 4YWSA 3UJRA 1G7VA 1XSIA 3MUAA 4I5RA 4EMIA 3TONA 3W0KA 3IK4A 3G1RA 1W5PA 1TPFA 4L56A 4WXYA 5DRCA 4PMNA 4JN6A 4A4AA 1U2YA 4D6GA 4UXDA 4KRTA 1UWRA 1TE6A 3IJIA 3RILA 1QOXA 3UWVA 4GIRA 3EX1A 2BY0A 1R3SA 3D9XA 4W9TA 5FF2A 4YL2A 2NXHA 5A6MA 3QN3A 3QOKA 5I3DA 5DO8A 3CV2A 3AU6A 2PLMA 5EY5A 3LPPA 5H91A 4K1GA 1SUXA 3UA3A 1OM0A 1VAHA 1SZGA 2B7PA 2VZSA 1ECEA 3VTRA 4H3DA 3BE7A 1LPFA 2HPIA 3DAQA 2Q3RA 1UC5A 4R9OA 2TMDA 1YE6A 4HJWA 5DFAA 1BKHA 4G56A 1OCJA 1POKA 2VT0A 1XM3A 4DWSC 2REQA 4DYKA 1EJ7L 2VO5A 4IX2A 3BG9A 2E09A 3AJXA 2FFCA 3U2ZA 2PLKA 5G4WA 1SW3A 1PDZA 1PTGA 2JE8A 3NQCA 5FSDC 3HGSA 2YPIA 4GWEA 1PVNA 3UY7A 3M46A 2W3RA 2HRWA 3HG2A 1NWUA 1T7LA 3N4AA 4HT3A 3GKFA 6ENLA 1L6GA 5F2GA 3GFXA 2ODOA 4N4PA 1UA7A 1AW2A 1ZMDA 3LHWA 4LRTA 4F9DA 4MB1A 2DSWA 1NARA 3LPGA 3ZJ8A 4IIEA 5J04A 3IRSA 3UG8A 3XIMA 4MADA 1K6AA 1HJSA 2O0TA 2WBKA 2AQOA 1UZ4A 3UU0A 3H4GA 3OA3A 1W91A 2ZX7A 4S3BA 3FYPA 2Z1KA 1P1MA 4LB3A 3BLPX 3M0MA 3WLMA 1SZNA 1LDCA 4UMBA 3LQGA 4FNPA 3T1GA 1Q4NX 4US6A 1QMLA 1NJJA 4U28A 1XH1A 2AMGA 2FB3A 2A3EA 3H53A 1DJNA 4U10A 3MP4A 3DENA 3ZVIA 3TSBA 2FH8A 3GZ3A 5C2CA 1V7AA 5A6AA 1RLDA 2IUZA 1E15A 3R94A 4Q7BA 3QR1A 1RQEA 1CLVA 1FFUC 3FJ4A 4ZQMA 1DJGA 3PAJA 1J5SA 4M6PA 1Z89A 3CPRA 3DERA 2FPYA 2EQDA 1WA3A 3T40A 3DH7A 3ANYA 4NJJA 4WDTA 5E09A 3EGJA 1F61A 3V18A 1G01A 2GLKA 2YJQA 3S5OA 3T8QA 1XFCA 1R9YA 1OX5A 3QV8A 1QHOA 2V5JA 3PANA 5A2CA 3UBPC 2W0UA 1WDPA 5KZDA 3RRAA 2NT1A 3ZWSA 4HB7A 4N4QA 3VCCA 1QHPA 3DGZA 1NIUA 1JDCA 3TA6A 3W7CA 4EAYA 2QF7A 5HNTA 1BRLA 3VOJA 3FKKA 4H9UA 3B8SA 4IWWA 1OFAA 1G1YA 3T78A 1XYZA 1WUEA 3GTNA 1XR2A 2WSRA 3MMUA 4UCGA 4OTKA 5FAGA 1UH2A 5HMEA 5A6TC 3AHTA 4MDOA 1V03A 6ALDA 4BHYA 1OFEA 4M3PA 3B4UA 3FJLA 2P0IA 3WX7A 1MW2A 4CNSA 2CNCA 1C9DA 1UR3M 5A6KA 4JTCA 1M7PA 2PWEA 3UZXA 3VU2A 3F2BA 2GL5A 3PP7A 1LBLA 5JH1A 4GD0A 4G8TA 3S9ZA 3TTYA 2V82A 2A3AA 1BPLB 5JBEA 1GPWA 1MUWA 3A13A 1K70A 4P7QA 5JCNA 1CYGA 1ZJIA 1LRTA 5CAKA 4A2RA 2YL9A 3R58A 4FLQA 3ES8A 4JTFA 3TXZA 2PTWA 4P61A 3BGGA 1NY1A 4B3LA 3UZZA 3TYDA 2J9YA 3PBMA 2BODX 1I60A 1KCLA 4GYJA 4F2BA 3WF3A 1D7KA 2XH0A 1GVYA 4KF1A 5AYXA 2BVTA 2F2HA 2EQ9A 4RXGA 2GQWA 3B9NA 4IM4A 3TCSA 3TW7A 4O53A 3UWQA 4CNUA 3P81A 2OWXA 4N9DA 1NHSA 3WO8A 2OWCA 1FXQA 5LNRA 3FXYA 5D8WA 2P5NA 1ZP3A 4N02A 3NO5A 4KFOA 3O6CA 1CCWB 2V5DA 1AQFA 3GVRA 4C1NB 3H6OA 2IXVA 1IWAA 1IGSA 3GC5A 5HNRA 4J40A 2DV0A 2YSWA 4H8VA 5AYZA 5DMLA 2Y1HA 4PSPA 1XINA 5CPTA 4L65A 4FOKA 4DVOA 3MJMA 1R3QA 4F0HA 2IKHA 3S4TA 2VM8A 3GTFA 1DWAM 3AXHA 4K7YA 1OZMA 4AWEA 4BS0A 1ONFA 4M80A 3S83A 2FLIA 2O9RA 1A49A 4HNUA 1IGWA 4OOZA 4XD5A 3KWSA 2Z25A 4MY1A 1VPXA 1L6FA 3FIGA 4UTMA 5IFPA 2RJHA 4LGXA 3W1PA 3WBWA 2NV1A 4TV6A 1FFVC 4Z2JA 3O06A 3JVAA 4QAWA 1XIDA 1J10A 1JOAA 1HO4A 3BZGA 5A6JA 1REQA 2CESA 5GJNA 2ACSA 4UTTC 3EUB3 3WK1A 3MMDA 4LJ3A 1JUBA 1JEHA 4LAKA 4QSHA 2XTKA 5FF0A 4TMBA 2Y7DA 3N19B 2XWEA 5J5DA 2WSKA 4E2OA 3W7NA 3B0PA 4XD3A 3AQUA 4JKLA 1UROA 2VEFA 4LF2A 1GOWA 3K13A 2CDUA 1BYCA 3SUWA 3IAQA 1M41A 1P6CA 1DWFM 4A3UA 1K02A 1WKDA 1AJ0A 4FHAA 4AISA 5MKGB 1H7RA 1PYMA 3QBUA 4RZ6A 3GY1A 4FNSA 4LT9A 3S42A 1ONWA 1FH8A 3S5YA 3IIXA 4GZ7A 4AHOA 3EDJA 1SFSA 4C5ZA 2DPEA 2RFGA 5BXSA 4BF7A 4LUJA 1O7AA 3VC5A 1IEQA 4W87A 5C2GA 4M19A 1ADSA 4HMEA 3ALGA 2H3BA 1EYWA 3KAOA 2WJDA 4PMZA 2EHHA 3W1TA 3N4EA 4WEVX 5BWFA 1NP0A 4EKJA 1XIBA 3B04A 3CO4A 4Q8QA 4ZFMA 3VGDA 4XAPA 5I77A 1W1PA 4C1LA 3EOSA 4PEKA 4I7WA 2WKGA 2X0HA 3H2FA 3VD9A 3NQAA 1W3NA 2R1LA 3PB0A 3A21A 5HINA 1YTDA 2PDGA 1GHRA 3QZ6A 4RDZA 3INPA 1GRGA 1KRCC 4B90A 5KINA 1NVMA 3L0GA 4HMNA 3DHDA 3DJJA 1RQBA 1AUSL 1OSEA 4BF9A 3VIIA 4C7GA 2NV9A 4FLOA 3TMLA 3WDRA 2IKIA 4WIWA 2OU4A 1RVGA 1UUMA 4PMJA 4GABA 3GH7A 5D02A 1H60A 2J8FA 1WQ5A 1P1XA 1LUCA 3B06A 4DJDC 4ML9A 4RNFA 1DXLA 1JPIA 2D69A 1PCWA 3KW3A 3CGBA 1WNOA 1WDSA 2ACQA 3IGXA 4G5DA 4AWUA 4DXVA 1MW0A 3BPWA 3IVSA 3MVTA 3BOXA 3U7VA 4ERIA 2Y6ZA 2WLZA 2WZMA 1D7FA 3OZOA 2J7HA 2QAFA 5C7VA 1XLBA 3NM1A 1O12A 5KZ6A 4GY7A 4WDXA 2WCSA 4WGXA 4FLRA 1KGUA 5M5DA 4WSHA 1UZHA 1LYXA 4L5ZA 2ZC8A 5AECA 5DY3A 2R1MA 1HKJA 2C1GA 3OODA 2GSEA 3ZJKA 1EH9A 3MYPA 3HN3A 2X0YA 2CLMA 4JQAA 1X2HA 2QXWA 5CG0A 3VOHA 5FJJA 1ICQA 4C6JA 2X7WA 4KT2A 1EGMA 1OVDA 3LM3A 2VEKA 3E2RA 4NAFB 2G37A 4JN8A 4L4LA 1XLKA 1TWZA 2VGBA 5EYWA 4JYEA 4O1EA 1BG4A 3DX5A 2GQ9A 2Z2UA 4MB3A 3R6IA 2OXNA 1QHZA 3MS8A 3W3OA 1M7XA 3JS3A 1JZ4A 1UB3A 3W83A 4E8GA 5DXXA 4DUOA 3F5KA 3VNLA 4AZIA 3KE0A 2JK2A 1BEUA 5HK4A 3TJ4A 4CUCA 2EPLX 4JY8A 5D03A 3OEXA 4O54A 1K4HA 3RR4A 3POCA 3E2SA 1DWJM 4JNYA 3LN3A 1SR0A 4YHEA 2BXZA 4O1BA 2GWGA 1VJZA 2TODA 2BY2A 2EPHA 3E5PA 1V6VA 2CCRA 3V0UA 2PDKA 4HYVA 4NZJA 5LSMA 1OJXA 1IF2A 3TIMA 1JZ6A 1VFOA 3CZLA 4R3UA 4DRSA 3R13A 2FGBA 2E68A 1AK5A 4TV5A 4XAYA 5IOBA 3LENA 1RR2A 3MO4A 4J35A 1FBAA 3VIMA 3W29A 1H2JA 1NH6A 4UWMA 3WNKA 1EOMA 2VJXA 3GXNA 5CJ5A 4JHZA 3LSCA 3SIZA 1T40A 3DFOA 3L5MA 3UWYA 2WMIA 1KTNA 1Q65A 4NZ4A 2P88A 1QI2A 1T99A 4Z2IA 3TC7A 1YBQB 4CLMA 3O7UA 3NVDA 3TEVA 4NIRA 2G4JA 2WJEA 4JFSA 1XYBA 5LGXA 1EJXC 3P14A 1W54A 1Q6CA 3ICJA 2NUWA 3BO9A 3TC3A 1VB9A 2VENA 2GUUA 3CAWA 3A12A 2WSYA 4GPNA 2HNHA 4NXSA 1Z7AA 4NRSA 4I6KA 2V3EA 1XYLA 5H2ZA 1SSGA 1AQMA 1B3VA 2ZBTA 1X96A 3O63A 3NZGA 3V35A 1TUXA 1HIZA 3DKLA 4ZO9A 3UG5A 3NQDA 5DMYA 2RGMA 2ICSA 3WF2A 2VD8A 4TR9A 1JRBA 1TE1A 1XIJA 1DQXA 5TIMA 2F5ZA 4W88A 4DNHA 3HRDC 1VR6A 5D2TA 3VUSA 1ZBKA 1JRPA 1XLHA 3W26A 4XSMA 3WLNA 6XIMA 1BXCA 3TAKA 3NUKA 1V3MA 4QR6A 1YKWA 3QEZA 3PK7A 4ZXLA 3ITVA 1EA9C 3CMGA 3C2RA 4GXWA 1G94A 1J6OA 1Z6KA 2O7SA 4B5TA 2AMXA 2XIBA 4Z08A 1ZALA 3IUDA 5G1MA 3U4FA 3VMNA 5I3FA 4N6FA 4U5KA 1KM3A 3F4VA 4UQDA 1Y0EA 1V0KA 1OG0A 1PX8A 4BV6A 4B9YA 1GRFA 5A2AA 1DL3A 1KRBC 3BAIA 3GNDA 3NIYA 4HOZA 4JS3A 3T0DA 4XKMA 5JVLA 3SUVA 5GNXA 5EL1A 4TIMA 4S3JA 3ARXA 3FEQA 5CSRA 1TRIA 2GK1B 4B5VA 3W84A 3L0KA 1LJYA 1YNPA 1H4PA 3K5XA 5HNUA 3GFZA 5F2MA 3TQVA 4OGZA 2QULA 5EPDA 3APGA 2VDIA 3GU2A 1SMAA 2EQ8A 3GXFA 4LNCA 2E28A 2VDHA 3B05A 2J7EA 4NI8A 3W82A 4PTDA 3C8FA 2GRTA 4JXCA 2E1DA 3SFWA 4BFAA 2OOGA 1U83A 2JFEX 4YTRA 3IGSA 3VGBA 4JIEA 4F0LA 3F5LA 5A3HA 1RA5A 1W9XA 1A0DA 2WSQA 3GR7A 1CGWA 1XGDA 5ER0A 3ARQA 2V30A 3ZR4A 3M44A 5G4EA 4AUBA 1EBGA 3NGFA 2QDEA 1N8FA 2Y24A 1EBHA 4IIBA 1N82A 1UD6A 4Z1CA 2GGEA 5AZ0A 4CNPA 1B3WA 2PDUA 3V1PA 1NAL1 3VMPA 5BRPA 1P0DA 3P74A 4E4PA 3PJUA 1ALDA 1TX0A 1GKPA 2A6NA 1T0OA 1JZ5A 3UWWA 4QIUA 3GE7A 3H2CA 4E3VA 5HDRA 3DHUA 4FK9A 3QRHA 1S46A 3RGTA 2DT1A 4D6HA 4UQAA 2QCHA 3GTXA 1XCFA 2Y89A 1R47A 1RJPA 2BSLA 2J74A 3CPUA 4PBGA 3Q6JA 4B2DD 4ADTA 3ZM8A 1Z69A 1PWMA 1B9ZA 3E0IA 3W9ZA 2XGBA 2Y7FA 1DV7A 1VJIA 4BJHA 4JNMA 4XKYA 3QOMA 3BWWA 2AOSA 1YRRA 3KZSA 4ADSA 3GNPA 1JYNA 2W55A 3LZ5A 3R79A 5HJLA 1Z9AA 4E3TA 4QG8A 2KZHA 3W1UA 2DIEA 3W88A 4Y7EA 1B4EA 5I2UA 2W66A 1J11A 5I00A 4ZENA 3T0BA 2DZVA 2WC4A 4KGJA 2NT0A 3Q2DA 1W3LA 4UZUA 2V5BA 3PC0A 1CXEA 3PPCA 3C2OA 4GRSA 2BXVA 1TV2A 2ZUTA 3QFEA 1R3RA 3TJIA 5FEXA 3D47A 1E1CA 3V5OA 2FMNA 3SY5A 1D2KA 2WNZA 3BCFA 1XW8A 3T4WA 2F9RA 4H7CA 7REQB 3TYAA 1GYNA 5FMHA 1FO4A 2ACRA 4JZ5A 3UESA 4JTHA 2BNJA 2GZXA 1HZYA 3BICA 1JNEA 2V5LA 4AFYA 4NASA 4YPJA 5B7YA 1X7IA 2OZ3A 5IXEA 4UZSA 1XHCA 1MMFA 2QV4A 3B9DA 4DPPA 1AG1O 1JEZA 1E9LA 2QHAA 3M0HA 2QNEA 2ZICA 3OLDA 4RPQA 2YDSA 3BTNA 3CASA 2WM0A 1TREA 4DIAA 4I6VA 4AY1A 5SWUA 3UXAA 4PTVA 4XBKA 1XUZA 1JAEA 2J66A 3ZT6A 3LBOA 3SIMA 3P0XA 2V5KA 3I3BA 2R1NA 2IQ0A 3T81A 2WQPA 5TNVA 1QDSA 3ZZ1A 2CBUA 1GOKA 1LQ2A 3M6DA 2QLYA 4QJ3B 2E6DA 2ACUA 4LXFA 2V6AA 4LYPA 1NHPA 4H6KA 2HQAA 4I9MA 1V6TA 3NEHA 4M0XA 3IUHA 1XBYA 3WLJA 2A2IA 4JYDA 2PSNA 1EEXA 3UGRA 5DX7A 5HOSA 5I7GA 5AYBA 2E7FA 1WKEA 4GNVA 3PWAA 3QM3A 1RA0A 1XLDA 2PD9A 4O16A 2OZTA 3UR2A 1W0MA 1ISWA 2DZWA 2PDJA 1NDWA 4HZ8A 2XFRA 3RUBL 1XLIA 1NOWA 2ZYFA 2YYUA 1TPVA 2PP3A 2IPWA 3QY6A 4FIRA 4D6JA 1FDZA 3WJXA 2XDFA 1WKYA 1CB2A 5M17A 2VXNA 2YYTA 3R4IA 4R7WA 1I6NA 2B7QA 1C8VA 4KEUA 4QROA 3FHAA 4NYYA 3S2NA 4LYKA 4GJIA 4POCA 2GR0A 3W87A 4E8CA 2VELA 1NFPA 3AIEA 4G7EB 4UIOA 1NQKA 4Q4QA 4J7RA 3COTA 3GD6A 2WBAA 3KLKA 2PDYA 3WEOA 3ZOAA 3SCOA 1DWIM 3MZNA 1Q7QA 3PG9A 1WDRA 4DWDA 1HKMA 4BF5A 1M04A 3QYSA 1WZKA 3DFYA 3MY9A 1I8JA 3GU9A 2BHZA 1TCMA 5I3GA 1XRFA 5FESA 1HP5A 1KM0A 1CWYA 1NELA 4QJ5B 4XKYB 2YVFA 1M68A 1FHDA 4DPQA 1M9HA 1TTJA 2GQAA 4A3YA 4W84A 1EX5A 4RE4A 1KV8A 4ZGYA 5I3JA 3JRKA 2ATSA 5EMYA 4Q3MA 3KM8A 4HTYA 1ZJAA 2E9LA 1GKRA 1H7NA 4F0KA 4WX2A 1SFLA 2YCJA 2FZNA 4CQ8A 4HPHA 1EHNA 1CGTA 1LLZA 1FCBA 2ZTKA 1JRCA 4H9ZA 5C9UA 3SSZA 1CBGA 4FXSA 2CBJA 3IJ6A 2PMQA 3HPFA 2UY3A 4NI3A 4Z17A 1E0UA 4ZR8A 3RM8A 2A21A 3WY1A 2ZX5A 5CH9A 1RPKA 4JX6A 4LPCA 1KKRA 1UPMB 2Y61A 3PZGA 5KSWA 1J6PA 2YW3A 1RSCA 1GRAA 4U3AA 1C8QA 3PPGA 3G18A 3SGZA 3WN6A 3BLIA 4JTDA 3BAYA 4YWOA 4OU1A 4OECA 5JUVA 5L9FA 3RG6A 1DWGM 3W7IA 3Q65A 4WK9A 4BKNA 5K2ZA 3N6JA 2I9EA 2OSYA 3IIOA 3JZUA 4GI8A 4KERA 2HVOA 1OFBA 2DQWA 3LHTA 4O8AA 3A4WA 5C55A 4YYCA 1HTIA 1EDTA 4FXRA 4CNOA 4KCUA 4F66A 4INFA 2ZXBA 4BWLC 4O28A 1AH3A 2ZRVA 5DEZA 1VFFA 3BDKA 5LNVA 5ECVA 1OEPA 3S5NA 2E67A 3GNRA 3PB2A 3WQDA 3WUBA 4H4QA 3URNA 1LF1A 3FFSA 4B3ZA 1UR1A 4AD4A 5CPNA 2YCLB 4M5PA 3U7BA 4J2MA 3VAVA 3D3AA 1QWKA 2E5CA 2ALDA 3GDRA 1TVLA 4DZ5A 1CB7B 4ROQA 5EMKA 1UR2A 1S5TA 2NPXA 3C0LA 3DU0A 3AICA 3BW4A 3SUTA 4AH7A 4Q4SA 2MNRA 5C9ZA 3HQPA 1GRBA 4ZO7A 3W27A 3S47A 1CI1A 4GNKB 4CCDA 4ICCX 3V16A 4ZB5A 1RUSA 2WOWA 2PWHA 1VFSA 5A69A 2W9MA 3DH9A 3QHMA 2GGJA 2VOTA 5DLCA 4FB7A 3H2NA 3L9CA 1IXQA 4DF2A 3LGEA 4J57A 4HNVA 2GVJA 2D2OA 1C7SA 1UR0A 2HZGA 1WOAA 3TYBA 2B7NA 1PV8A 3VNIA 1JCTA 3OJGA 3TQKA 4L6OA 4K8HA 2BGSA 3NVZB 5FA5A 2C7FA 3DG7A 1JVNA 1H7WA 4QE4A 2Z6IA 4GACA 2YGYA 1V02E 5AB3A 3URHA 2J77A 1QI0A 1BF2A 1VJSA 1MUCA 3BAWA 4AY8A 3B4YA 4C6PA 4Q8TA 3B9OA 1D3HA 1AMYA 3G6MA 3FVDA 1E9IA 2XGIA 3C2YA 4QDPA 3S2CA 3NZPA 3RPDA 2QDGA 4C6QA 1IEXA 1DKWA 4FOUA 4S3FA 1THFD 2ZZ6A 4CN6A 2L5HA 4NF7A 2OLHA 3RMEA 4DUWA 1EP3A 4NX5A 3GQYA 1F07A 4JEQA 3M41A 2CU0A 4C6EA 4RL3A 4KFNA 3WMSA 4UTWC 4GMEA 4GI4A 4ZBCA 2OOFA 1IT7A 1Z41A 3OW1A 3AZTA 2BHYA 4IF2A 1TMHA 3VCNA 3DK9A 4GH1A 3NQ6A 2PA6A 8XIAA 4RV3A 2V0TA 3KZPA 5EBUA 1KKOA 1LVLA 5LXEA 2VR2A 1CPUA 5G2HA 4IJCA 2V3AA 4PCSA 2D2JA 1TVNA 1OX4B 1BGAA 4LANA 7REQA 3CMJA 4MYXA 4KS0A 5E1QA 3GKAA 1N8IA 2QCLA 1JROA 4HGXA 5AVNA 1EQCA 4CU8A 1B57A 2GWNA 5CGTA 1OF8A 2HXTA 1TMQA 2G96A 3ZR5A 1KQYA 4GCXA 4LNYA 3LK6A 3P62A 3UG4A 3WK3A 1X97A 1GQNA 4D6EA 2CITA 3CAQA 3KVLA 1LRNA 2AAAA 3GVQA 4DEFA 3BMVA 2UY5A 1A4LA 1E51A 2F2KA 3MMTA 1W3IA 1QNPA 1TQJA 3QR0A 2J4GA 2BV9A 5CGQA 3VIHA 2WMIB 2WVVB 4QXIA 1QBAA 3DEQA 3N2TA 2ZXQA 2AQVA 2OFJA 1XP3A 3IK2A 3RPMA 4PUKA 5DY2A 4LEFA 1VFLA 2YZRA 1E6SM 2OCZA 1Q1RA 2WV8A 3SB0A 1QOPA 4EQRA 4BR1A 1IV8A 3EWUA 2OELA 5EGRA 3UXKA 1V97A 4JFWA 2X1SA 1VKFA 3UD6A 3LS9A 3STPA 3DHPA 3AWNA 1W17A 1YXCA 1E4MM 1TV7A 2HSAA 1AQHA 2RUSA 3BG5A 3F7JA 2FIQA 4XQ6A 1UJPA 3WLKX 3R8HA 4L9ZA 2Z1VA 2EGZA 1XCWA 4U4MA 3WUGA 3WMLA 3GBEA 4RR4A 5LIKX 5LGZA 4DJFD 1CXIA 2ANUA 1Y5VA 1DIOA 4P8WA 1PZ3A 1GHSA 2DUAA 3EANA 1W1VA 1UCWA 4GXMA 4AVOA 1TR1A 1AQ0A 4GYPC 2OGYA 1KBBA 3PVFA 3WDJA 4GX9A 3NPXA 3HV8A 4Y9OA 2HBXA 3EX4A 5M1TA 5IHRA 3G8RA 1ISYA 3A7AA 3H7UA 4N2YA 3NVVB 4I90A 4AYGA 1RM6B 3BGAA 2E8YA 5CSUA 2RAGA 3OVQA 3QF0A 1KR1A 3F4DA 3G1DA 3ZS4A 5C70A 1QU4A 4J2PA 1LZOA 2BVWA 4KESA 3RU6A 3LHVA 2PZ0A 2W92A 4M7SA 3MKKA 1KRMA 1OB0A 4FX9A 2B81A 2Y5JA 1L0PA 2IW0A 1OIFA 2CLHA 4PTXA 4HSHA 2VDGA 1O66A 4JNZA 1TV5A 4XUGA 5CJNA 4DJDA 2QW5A 4DWSB 1EJUC 4BEQA 2A7PA 3DC0A 1QRQA 3L4WA 1Q8AA 4L61A 3ID7A 3TLQA 3ETRB 2D3LA 3CYJA 1CZ1A 3CXBA 4IPIA 2I17A 4ZEPA 3TNOA 1UYQA 2B0MA 2VZOA 1H61A 2JIEA 3RCMA 3A9IA 3EOEA 4JL2A 1FHVA 3CZKA 3AXIA 1B4KA 3MP5A 3JUGA 3SBFA 3S1UA 1CTNA 2CZ5A 3P7YA 3NQBA 2RGLA 5FEPA 3AAMA 3DFQA 3EWYA 2OO6A 4H6RA 3FLUA 2XN1A 4NUWA 4CN1A 3OTRA 1O95A 4O0KA 2ZWYA 1VYRA 3TDFA 2ZRXA 2ZC1A 4MB5A 1JL8A 3VCRA 2GR2A 2R9ZA 2SFPA 1H0IA 2QPSA 3OGRA 4PTMA 2VX7A 1E71M 4JYFA 3PR2A 2YFOA 4C7FA 3Q37A 2E1WA 2UWFA 2GGHA 3NSNA 3L65A 3OZMA 1S5WA 3L4ZA 2VCAA 1LL6A 3W71A 4Q8VA 4HHHA 4TXEA 3GVWA 3K4AA 3B9JB 4JIRA 5A95A 3WFLA 1M01A 4WD0A 3AUJA 2QGHA 1D8CA 3CGEA 1I1WA 2PF0A 5K3VA 4AYSA 4CGTA 3IJDA 1JD9A 1YW1A 4FAMA 2G8ZA 1MSSA 1XS2A 4Y90A 3KBWA 1GREA 2XH2A 1PCKA 4NNAA 2PCQA 4WY0B 4X3ZA 1TG7A 3ZIZA 3MHUA 4DO6A 1UPPA 2BGQA 2Y85A 3UVAA 3SQSA 4XIAA 2IPGA 4ZO8A 5FF3A 3GD3A 4AD3A 3W7JA 1V3HA 4JKKA 4R7OA 3SM0A 1ZU8A 3THCA 1TPUA 1R3YA 5MKGA 3TP4A 3NSMA 3JR2A 3T0CA 2GUBA 5FJIA 1X8CA 2P0OA 1R38A 3M5XA 1JG9A 2GDVA 3SAZA 3VKCA 4ZCWA 3CQ0A 4PMRA 3C0SA 3RIKA 1BF6A 1E73M 1UP0A 3O1NA 4JQ4A 1RK5A 1PAMA 4KIRA 2ZQ0A 3Q45A 4R34A 1S2CA 3EXRA 4QM1A 4AIEA 1GK8A 3QC3A 1NM9A 3SY1A 3LHYA 3T9PA 5HA7A 2NVDA 5RUBA 3AIBA 5FEZA 1FY6A 2GYIA 5I24A 2R24A 2ZX8A 3BLKA 2W61A 2QUTA 4Z0SA 1MXGA 3TOPA 3C56A 3MWAA 4N9CA 1FKXA 1IZCA 3CS2A 4PCFA 5M03A 3YPIA 1XHGA 4NU7A 1XX1A 3LU2A 3AS2A 4Z1YA 1M53A 3L12A 3DG3A 3W2UA 2C8NA 3W2LA 2G3IA 1PIFA 1QWGA 1V08A 3CHVA 1JDDA 2ZZ5A 3CHDA 2PGFA 1DXEA 1DIKA 4V1YA 2QGYA 4GYFA 3VFLA 1Q6QA 2PI6A 4XBJA 5T91A 3IGHX 4DB7A 4C6FA 3NPVA 5BOEA 4DBUA 1TJ0A 7A3HA 2E25A 4O4VA 1ZJBA 4WJEA 4ACZA 4EE9A 1C90A 5EMUA 2QKFA 1KFKA 5FI8A 2EG7A 4BWLA 3STCA 5CKSA 3ZYZA 1DHKA 4EMJA 5BYWA 3TSMA 3GTHA 3S9IA 2PD5A 1Y5XA 3K1GA 3CL6A 5D2VA 4H9XA 2RHGA 1EP1A 3DUGA 2YBUA 4J1OA 3C3UA 3WELA 3NM3A 1YXDA 5F4XA 3ZSTA 4NAFA 2XIMA 2FTWA 1ME9A 3MHGA 5HUOA 5CSYA 1GUVA 2CXGA 3E6EA 4ZE5A 4ZZ9A 5D33A 1JPHA 4IICA 2DW7A 1VPYA 2CHOA 4ES4A 4AD5A 3E0FA 3NA8A 2JKEA 1UBSA 5KTLA 3S5SA 4AHQA 3HTWA 3B8IA 3IS4A 5CBBA 2Z27A 1K77A 1B90A 3WLLA 1ML1A 4C6MA 3PTQA 1W31A 2ZUNA 4LAZA 4ZSTA 4NNBA 5EMLA 5H1WA