4E4FA

Crystal structure of enolase pc1_0802 (target efi-502240) from pectobacterium carotovorum subsp. carotovorum pc1
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
405
structure length
386
Chain Sequence
SMKIVSAEVFVTCPGRNFVTLKITTDSGLTGLGDATLNGRELPVASYLNDHVCPQLIGRDAHQIEDIWQYFYKGAYWRRGPVTMSAISAVDMALWDIKAKAANMPLYQLLGGASRTGVMVYCHTTGHSIDEVLDDYAKHRDQGFKAIRVQCEPATKGSLPEEQLWSTEKYLDFTPKLFEAVRDKFGFNEHLLHDMHHRLTPIEAARFGKSVEDYRLFWMEDPTPAENQACFRLIRQHTVTPIAVGEVFNSIWDCKQLIEEQLIDYIRTTITHAGGITGMRRIADFASLYQVRTGSHGPSDLSPICMAAALHFDLWVPNFGVQEYMGYSEQMLEVFPHSWTFDNGYMHPGEKPGLGIEFDEKLAAKYPYDPAYLPVARLEDGTLWNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords MANNONATE DEHYDRATASE
publication title Crystal structure of ENOLASE PC1_0802 from Pectobacterium carotovorum
rcsb
source organism Pectobacterium carotovorum subsp. carotovorum
total genus 138
structure length 386
sequence length 405
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4e4fA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4e4fA01
2DW7A 2GGHA 3DDMA 3GO2A 3GD6A 3IJQA 1KKOA 3P93A 3RO6A 3DG7A 2PP1A 4H19A 3VCCA 4ZA0A 5BOEA 3OZYA 3ZLGA 1KD0A 4HNCA 3U9IA 2PTWA 2ZADA 2AKZA 3P3BA 1NELA 3CAWA 3SQSA 1SJCA 3UXLA 3D47A 3SSZA 3SN0A 4ENLA 3VDGA 3UCDA 3TW9A 3QN3A 2PU1A 3QPEA 1L8PA 3CT2A 4K2SA 3UCCA 2OVLA 5J04A 2AL2A 3FCPA 3OW1A 2ONEA 3U4FA 2HZGA 2GGIA 2QDDA 1EC8A 1F9CA 2GGEA 3STPA 1TE6A 1R6WA 3TWBA 1KCZA 4JN8A 3B97A 5ENLA 3S47A 3V5FA 2QJNA 1E9IA 2HNEA 3TJIA 1ONEA 1EBGA 1SJDA 7ENLA 2FYMA 3BJSA 1OEPA 4GGBA 4E4UA 1JPMA 2OO6A 4Z17A 3JZUA 3TJ4A 3R0UA 4GYPC 4G7FA 3R0KA 2PMQA 3DESA 3UXKA 2FKPA 4FI4A 4ROPA 1P43A 3R1ZA 3FVDA 2QJMA 2P0IA 3BSMA 3NZGA 3V3WA 3UJFA 4IL2A 3MSYA 3NXLA 3JVAA 3MKCA 3ZLFA 3N4FA 3V5CA 4IP4A 4FP1A 3PK7A 1MDRA 3UJSA 2GSHA 2XH2A 3I6TA 3VFCA 4E4FA 2QJJA 4F4RA 4GIRA 3TWAA 1MDLA 3DG6A 3NO1A 1RVKA 3OP2A 2AKMA 6ENLA 4H1ZA 1JPDX 1P48A 4MKSA 3MQTA 2PS2A 3TQPA 2XH7A 1PDYA 3N6JA 1ELSA 1PDZA 1JDFA 3RR1A 3H12A 2MUCA 2P3ZA 2PTZA 2OPJA 3DFHA 1WUEA 4E5TA 3VC6A 3SBFA 1YEYA 2ZC8A 3ZVIA 4K1WA 1JCTA 3N4EA 4DN1A 3N6HA 3RCYA 2PCEA 1WUFA 4DWDA 2OQHA 1EBHA 3GY1A 1XS2A 3UJ2A 1MNSA 2AL2B 4IL0A 5BOFA 3I4KA 1BKHA 2O56A 4MMWA 3P0WA 3S5SA 3IK4A 2PU0A 4HCLA 3UJEA 4E6MA 2XH4A 4HNLA 3R10A 3T6CA 2OKTA 3CK5A 4A6GA 1FHVA 3FV9A 3RRAA 4KWSA 1BQGA 4HN8A 1SJBA 3IJLA 4ZCWA 2P8CA 3FYYA 3SN4A 3H70A 3GC2A 3QTPA 4A3RA 4HPNA 3OTRA 4DHGA 1FHUA 2XH0A 4JN7A 3OPSA 3DERA 2NQLA 3OZMA 2PA6A 3Q4DA 5FJOA 2HXTA 3D46A 2OLAA 4J1OA 3NFUA 4IZGA 4GGHA 4KPLA 3CYJA 4MGGA 3DGBA 3TCSA 1W6TA 3SN1A 3ZVHB 1DTNA 2GGGA 3BOXA 3DFYA 2GDQA 4H2HA 2GL5A 4A35A 4HCHA 3DEQA 2GGJA 4DYEA 3MUCA 2POZA 1KKRA 1XPYA 1IYXA 2PP3A 2MNRA 3JW7A 3CB3A 2PPGA 4IHCA 1MUCA 2PGWA 2PSNA 3SJNA 4DXKA 2QGYA 2PTXA 3H7VA 3UJRA 3VC5A 3V4BA 3H8AA 4HYRA 3TTEA 3CXOA 3I6EA 2XGZA 1R0MA 3ENLA 1SJAA 4J3ZA 2I5QA 3MZNA 1TZZA 4GFIA 1EC9A 4GISA 3T9PA 3FXGA 3ES8A 2OFJA 4G8TA 2AL1A 4JHMA 3Q45A 4E8GA 4HCDA 2PP0A 3KUMA 4EWJA 4M6UA 3QKEA 4GYPA 3MY9A 3QLDA 5IDZA 2OZ3A 3DG3A 2DW6A 3R25A 4KT2A 2OQYA 3VCNA 4IT1A 3HPFA 3T8QA 2QVHA 2RDXA 3PFRA 4K8GA 2OZ8A 3ES7A 3IJIA 3PWIA 2XSXA 3MWCA 1TKKA 4DX3A 5FJRA 5EU9A 3EEZA 2PGEA 3TOYA 3DIPA 3RGTA 2OZTA 4YWSA 4IP5A 4Z1YA 2PODA 2OX4A 3K1GA 1ECQA 4X2PA 3R11A 2OG9A 4KEMA 3UGVA 3ZLHA 2QDEA 1MRAA 1NU5A 3ZVHA 1EC7A 4M0XA 3VA8A 3THUA 2QQ6A 4H83A 5FJTA 3T4WA 3FJ4A 2CHRA 2P8BA 2HXUA 3RITA 5FJUA 5FJPA 2P88A 3EKGA 4GMEA 2PTYA 3PWGA
chains in the Genus database with same CATH superfamily
4HHPA 2PWHA 3LGDA 2E6YA 3DDMA 5XIMA 3WF4A 3GVRA 4E38A 1FY6A 1TPH1 2DY3A 2A3LA 3P93A 2ZQ0A 3S2MA 2PDLA 1NP0A 5C70A 2WJEA 2EHHA 3PVFA 1RVGA 1O94A 5FSDC 4E4PA 4IM4A 5FD0A 1R87A 2ZADA 1X1OA 4H01A 4GUGA 1Q6FA 1VP5A 4MKNA 4CEXC 3O6AA 1UD8A 1HO1A 1BZLA 1U1JA 2BY2A 2ZZ0A 4IQEA 1REQA 3GUWA 1V0MA 4FXSA 4OZOA 4MY9A 1XP3A 2AL2A 4ILSA 4C6DA 4LUTB 4WSJA 3U0HA 4JTCA 2PWFA 1TJ1A 3CTLA 4R88A 1LYXA 5FMHA 2A6LA 1W1B1 4RNFA 2G97A 1R2TA 4PB3A 1KCZA 3K8KA 4IIBA 2IS7A 5TD4A 3T78A 1GVQA 4Q4QA 2XM1A 3HMCA 1BHGA 3CMFA 2OYKA 1VPYA 4GC4A 4EQWA 5TAOA 3WJXA 2ISWA 1QOQA 5DMMA 4CN4A 1RPXA 2EQ7A 2G4JA 2PDKA 3LI0A 5B7YA 6REQB 3U2EA 1YMYA 2GQ8A 4QNWA 4FOUA 1QNQA 5IFPA 5F2GA 3OHIA 2UY4A 2GK1A 1TUFA 4PMDA 1UD2A 4DAFA 2WCSA 3BLDA 4C6LA 3B40A 4UOZA 3EA2A 4L56A 3UXKA 3OG3A 4JFWA 4KGLA 4JQ1A 3FIGA 1OK6A 4Y8EA 3NZQA 2ODOA 3LBOA 4FMVA 4HK7A 5IXEA 4KCWA 2P0IA 2Y63A 3UG3A 1LBMA 1T41A 1TIWA 2C14A 4CN1A 2VEPA 4H41A 3ZM8A 4UB9A 4BI7A 3HO8A 4O1DA 5TBOA 2X09A 1PCKA 2J7CA 2WSPA 3ONCA 3WNMA 4JKKA 2WB5A 3GR4A 2WAGA 1UR1A 1OM0A 1JZ2A 2ALRA 1A5NC 3WO8A 2VM8A 5G1YA 3AMCA 3NQBA 3W1LA 2YBVA 1MXGA 3AYVA 3L21A 3TONA 5G1MA 4WSHA 3S1XA 2R24A 1XC6A 1EJRC 3GVVA 3W9ZA 1XGEA 1UPMB 4MTVA 3MUIA 2PAJA 1BQCA 4MFEA 1N63C 3AO0A 3PNUA 2GH5A 3SUTA 4IMDA 1W3LA 5LNRA 1D7YA 2PFHA 1WXYA 3GXTA 3RR1A 1WZKA 3BLKA 3PY2A 1ISWA 3GHSA 4QITA 3KP0A 2V5JA 3K4AA 4UQBA 4D72A 2V8ZA 4J2PA 2UY2A 3IJ6A 4HZ8A 3ZVIA 3BURA 4HNUA 3B4UA 2WKLA 4NQ1A 5EKYA 3W7PA 4D6FA 5C8BB 2CLFA 5IHRA 1VD6A 1TRDA 3EWWA 3RLUA 3WH5A 1W91A 1PYMA 2EG7A 1GESA 1MNSA 3GNXA 3PUEA 3R5EA 3VZXA 3W24A 4AVOA 3GRTA 1C8YA 2V69A 2VC5A 4PMQA 4QQ3A 3W86A 3IACA 4HD5A 3NA8A 2QF7A 4LT9A 3LXCA 3VNZA 4GQQA 2JE8A 3IK4A 1EO7A 3ABQA 3DFPA 1C7TA 1K9FA 3GFZA 4QCFA 5BRQA 3UESA 1E6PA 2ZZCA 5JH1A 4EXQA 1XLEA 4PMNA 3PPFA 4BF7A 5J8LA 1VR6A 1XQLA 1RAKA 4UOJA 3Q2DA 4QBXA 2XN2A 3FDGA 2VP8A 5D32A 4Z1CA 1EA0A 3NL5A 1GEUA 3W7CA 2DP3A 2Q09A 3W29A 1MW2A 3MTWA 5EB8A 3NSMA 1HNYA 3IC9A 3G6LA 4MLRA 2J8FA 3DERA 4H8HA 2NQLA 3M16A 1KM6A 3LPPA 4HK6A 1S38A 1FEBA 4KERA 4J57A 3E0IA 2WHMA 3LCIA 5T9CE 2O7SA 3SIZA 2FPTA 3W3OA 1KTBA 5T8GA 2X05A 3RLHA 3C2OA 4IPIA 5I02A 1A0CA 4MIMA 5CPLA 2QIWA 2JIWA 3E12A 4CQ8A 3L5MA 3RAOA 4ZQNA 4W86A 1UASA 1QK0A 3CNYA 2WHLA 2ZICA 1EX1A 4LCSA 3W2KA 3TJLA 5HOSA 3M46A 2WPGA 4LUTA 1U22A 3WMCA 5EPDA 4GRTA 4LB4A 1BYDA 3CB3A 3SCPA 1KLZA 1TWWA 2E09A 3UJRA 3F03K 4KWVA 4RZ5A 5BXTA 3VVGA 4MNKA 1BSIA 1ZJAA 4WVXA 2VZTA 4J7RA 2WMFA 3C5QA 4HMDA 3WL1A 4LVDA 4JIRA 4EVZA 4ZL1A 1E6NA 4K8HA 6REQA 4MDPA 4EPEC 1ISXA 1NDYA 1TZ7A 1V79A 4LYQA 2OFJA 1EXBA 2VX5A 4G8TA 2BWGA 3ZZ1A 3LNPA 2AOSA 5CQ1A 3P8IA 4RPQA 3IIPA 4GR1A 4M8UA 1UPPA 1OY0A 4GO8A 3W76A 4GYPA 3QLDA 2O55A 3TR9A 5EGRA 1EKOA 3IAQA 3BZGA 3KHDA 3EWCA 1M7PA 1OF6A 3S9ZA 4P8WA 3PJWA 1WKDA 4L4LA 4MJMA 1QASA 3FK4A 4S3GA 4W85A 5AYZA 1WAWA 5DCDA 1GRAA 3ZMRA 3AXMA 1OGGA 3K1GA 2QCCA 3L4ZA 3G1FA 3VD5A 3CWHA 4PB5A 3GRIA 3WMBA 2QDEA 2ZDSA 4GKTA 2FB2A 1E4MM 3UU0A 1CWYA 3KAOA 4LJ3A 2E1WA 4RZBA 3VINA 4ZOEA 4JQ9A 1H7XA 4L80A 3LHTA 3QY7A 1ZL1A 3UFYA 4DJFC 5AHNA 1Q6OA 4NIRA 3W38A 3A6OA 4ZMGA 1QPOA 4F2UA 3WLNA 3NVVB 4UMAA 3WQ6A 4L1XA 3AU6A 2Z2AA 2FTWA 4ZBCA 2J6VA 4UZUA 4A3UA 1V51A 4ADTA 3OVGA 3HQOA 1X39A 1MW1A 4EOUA 4AFYA 4U4MA 1FDZA 3P3BA 3T4CA 3WBEA 3O9NA 3NVYB 3CQIA 3IRDA 2VI0A 4OV4A 1IWAA 4J3XA 3VKAA 4UTKA 3WNKA 3IIXA 1IE7C 3P0XA 3VO0A 3BW2A 2YJQA 1XBXA 3P7YA 5EBUA 3AICA 3N25A 3G1VA 2VDIA 1HKMA 2H9AB 1KM5A 2OXNA 3TU9A 2GGIA 5EMJA 3AN1A 5CLTA 1FDJA 1GYLA 4KIEA 1SSGA 4S1FA 3JUGA 1QJWA 3TJIA 3VXGA 1H1ZA 4FB7A 2NQZA 3AZRA 5K9DA 4RUBA 4GY0A 3HM7A 4WY0B 5HQMA 3ITLA 5FF4A 2XSBA 5HXMA 4BHYA 2X8HA 2CESA 2E9MA 2VGBA 3G1DA 3GHRA 1PBGA 3I7QA 2OO6A 1Q8JA 3UW6A 1IV8A 1I2NA 4H3DA 1VJIA 4HYVA 4DO4A 1IWPA 3C52A 3ETRB 1RLDA 2WSKA 4JFSA 4A3HA 3KOXA 4F8XA 3IUIA 4WDWA 1C9DA 3FVDA 1BXCA 4Q7BA 2JF7A 2PI6A 2VFGA 4KH2A 4JTDA 3VGEA 1JYXA 1YDVA 2VNCA 4AC7C 1TE1A 1QATA 3G1HA 2V3FA 1M04A 2XIQA 2VUNA 3S2CA 2G8ZA 1ITCA 3P14A 2X99A 5JVLA 4OGZA 3HV9A 5I7GA 1KM0A 3QMRA 4RNJA 4F9DA 1QMLA 2WM0A 5M2FX 1PTDA 2IPJA 2XVNA 5EFFA 4M6PA 4WOZA 2FH6A 3VIMA 3TDFA 4EXBA 4NL1A 1XIMA 1Z41A 1TO3A 2AKMA 3OP2A 3OVQA 2Z1KA 1HQTA 3CUHA 4JY8A 5HR6A 2OLSA 3KLLA 4NZ5A 4ACYA 1XX1A 4N9DA 4ZGYA 4CNUA 2NT1A 1F73A 3IARA 4WEVX 2HE5A 1QPQA 2XH7A 2GQAA 1TYGA 3CGEA 1JZ4A 1DJIA 3LG3A 2QJHA 1WDPA 2X7VA 3CWNA 3NEVA 1TTPA 3W73A 3MI3A 4ZSUA 1KLYA 1OCBA 4E5TA 2V5KA 3ELFA 3ICJA 3LU2A 3FOKA 1JCNA 3MJMA 3M7SA 3WD1A 4X60A 4DWDA 4OFCA 1TQJA 4CD8A 4B2DD 4DJEA 2D20A 2CCRA 3CYVA 2CHOA 3B0UX 2GDUA 1H7OA 3TN5A 2XVKA 3HRDC 2UY3A 3TYBA 1EJXC 1UW9A 1TA3B 5DT5A 1X2HA 2NSOA 2CIPA 3QY6A 1RA0A 5REQB 3LS9A 4DUVA 4IGNA 4XIMA 3PHAA 1A53A 1WCGA 1NTHA 1UD3A 4BKNA 4HVXA 3B8DA 4OU1A 1V97A 4J40A 4AIEA 1E0WA 4JN7A 3QV6A 3O06A 2OGJA 1CXLA 4TO8A 3SRDA 2GFTA 3PZNA 3NVTA 4Q33A 5CAKA 3KCOA 3DK9A 4W7VA 1VFLA 1MQRA 5JCMA 2R82A 1EGZA 4H8VA 2V6OA 3CL8A 3LSCA 1NQ6A 5GQBA 1G4PA 2YB4A 1MXDA 3KW3A 3O7UA 1I4NA 3QRHA 4MAZA 3Q37A 5LNVA 2NX3A 4QE4A 2QMJA 4A3QA 1NDVA 3M0JA 3WLHA 1XSKA 3LV5A 2H9AA 3WQWA 1POJA 1AA1B 4WD0A 1TCMA 3TQ0A 1ONRA 3IVTA 2Z2BA 4YJ5A 4UFHA 1Q6GA 3ARWA 3HFTA 2C3ZA 2FZ8A 3PZGA 3HU7A 4J3ZA 3NQ6A 4HYWA 2CBIA 4IX2A 4LAKA 1LWJA 3TN4A 5E6ZA 3N11A 4WY0A 4NNCA 4AF0B 3RM9A 3OGSA 1HGYA 2BC1A 1XSIA 1IGSA 3PTKA 4Q4MA 2Y8KA 1OJTA 3VABA 3QGAC 2DT1A 5EMUA 3CZ8A 1ZJIA 5IDZA 5JUVA 1JDAA 4RDZA 3W83A 3H4KA 4D8LA 5C9WA 2RGLA 4IGSA 3SCWA 1E3XA 2OEJA 3WH8A 4RXFA 3E0VA 3IJIA 5E1QA 3MWCA 1FH8A 5LIUX 4F3HA 4YS1A 4YWSA 4M3PA 4LS2A 2QZRA 3CBWA 3GS6A 3E9AA 1QUMA 5U7SA 2F5ZA 3SCQA 1S1PA 4O1BA 1HL2A 4P7NA 4F9JA 1GTHA 4DPQA 5JU6A 1PX8A 1KW1A 4J3WA 4M7TA 2NUXA 4PMRA 1C8QA 3EA1A 4HMEA 4DB7A 3WQOA 5HBFA 4DJDA 2P0OA 4NZJA 1TB3A 2H3DA 4GFSA 1QW7A 4JTQA 3PANA 1TV5A 3S0CA 2VHLA 2E4TA 4FF5A 3NNTA 4D9PA 3CZLA 3BJTA 3QR1A 1DJZA 3OBAA 1JXJA 2FFIA 5CPMA 1GK8A 1DIEA 1I0DA 4AEEA 1IXNA 3GTNA 4C90A 2AKZA 1KV8A 5K4XA 1NF0A 3O16A 5FJIA 3WQ5A 2GUYA 1EF2A 5D2VA 1NM9A 4DBEA 2ZZ1A 3BDKA 1W5MA 5A2CA 3N29A 2BHUA 2WANA 1VZWA 1GJWA 4LRSA 3OW1A 4HU0A 1TR1A 4ZOAA 4GD0A 1HJSA 1ZUAX 4TMBA 2WLYA 3DI1A 3LX9A 1OG0A 4K7YA 1TA3A 1NHSA 3O0HA 2C7FA 3S6TA 2EPNA 2WNZA 5REQA 1HL8A 4RNHA 2TSYA 4WR3A 5FF0A 5AZ0A 3K1DA 4JTAA 2GSJA 2BSLA 1N8FA 4GIEA 1FH9A 1KRBC 1N8WA 1UZHA 5D30A 5FL0A 2NX1A 4PRWA 2QUVA 4CNPA 5L6UA 2C1GA 1CXIA 2VZVA 4RE2A 4EP8C 1VFMA 4AY8A 3GH5A 1UD5A 2OOGA 4G7FA 3TTSA 2CETA 4RDWA 2DSVA 3DESA 2FKPA 1JAKA 2XIOA 1BGAA 3GXDA 3ZYZA 4DZHA 1S46A 4F0RA 2IKGA 3W6YA 1L6GA 2H3BA 4CU7A 4NRSA 3GNNA 3V3WA 3NTYA 1BYCA 1P4CA 3MSYA 1VHNA 1UOZA 4FNUA 1RD6A 3V5CA 2V5DA 3TW6A 2YXOA 1TWIA 1EYEA 4I6VA 1SVDA 2EO7A 4P61A 3ZOAA 1SMDA 3QPYA 4S3KA 3TQVA 2Z1BA 4QM1A 1LLOA 2ZX6A 1NH6A 4H9VA 5C71A 4IJCA 3VNIA 2R1LA 1DJWA 4H1ZA 2X8RA 1EPVA 3P84A 5EMYA 1RY0A 3HB9A 3N2MA 2FLIA 1PDYA 1DWJM 1EWEA 1J4EA 3BQ6A 3W7JA 1JDFA 4NASA 4QR6A 4AF0A 1W0MA 2D2GA 2YPIA 1NJJA 3H53A 5BXRA 1NHQA 4GO9A 2QJGA 1US0A 2X2GA 4B9YA 2QVNA 1DWAM 2NUYA 4KCVA 5GJNA 1A0EA 3RPMA 3EF6A 1FWFC 5HWJA 4S2BA 3QW3A 3QMTA 1XIIA 2EKCA 4ECLA 3BW4A 1TPFA 4NZ4A 2POTA 1KA9F 4LUJA 1W9BM 1ITXA 3OC4A 3LV6A 2R6OA 1AJZA 3MYPA 4P7RA 5A69A 3UY8A 5AC4A 2E5AA 2ANUA 1PEZA 3EDKA 1IZKA 2ZE0A 3FYOA 3CHVA 1K4GA 3TUUA 3TYEA 1XYBA 3W6LA 2V38A 3T6CA 4C6JA 2PC4A 5FF2A 3S6OA 1EP3A 3CH0A 3GG7A 1SGJA 5DF0A 1K7FA 4PUWA 3GNRA 3Q94A 1FWCC 2Y24A 1UKOA 1VS1A 1G9HA 3SN4A 4RZ4A 3KWSA 2HWGA 1CZ1A 4CNNA 3OPSA 1FP8A 4DF0A 3NPVA 2E6AA 3LERA 5ECVA 1QFEA 2NQ9A 4HOWA 1RZMA 3SJ3A 1V8EA 5IBXA 1GQNA 5D04C 1NDWA 6ALDA 1CI1A 2GGGA 3R8GA 3DHFA 3VX1A 2F38A 1GQLA 3HG3A 3IAPA 4EX4A 4GXMA 3F1QA 4WJEA 4A35A 4HCHA 4UFIA 1R7AA 3VGDA 1PTAA 4M1RA 2QUMA 4KEZA 2V81A 2QGHA 4BQ3A 3TX9A 3LRKA 4O4VA 1IYXA 3G1SA 3JW7A 5CC3A 1DJQA 3W0KA 2V3EA 3M0MA 1VCGA 2CZDA 2VFFA 3AHVA 4I9MA 1V7YA 2Z1SA 1FWRA 4GUJA 1EHAA 3K8MA 4ADWA 1GXFA 3WLQA 2INEA 3I65A 1UIOA 4HOXA 3T81A 4AB4A 2BMBA 2H90A 2KZHA 3AIVA 3GBEA 3N73A 1KRMA 2W0HA 3M6DA 4EXAA 3WLLA 1LOQA 4C7DA 3YPIA 1MWOA 3AMZA 1XDMA 3KP1A 2GYIA 4Y2WA 4NYUA 4RV8A 3Q45A 4LS0A 5JMUA 3QKEA 1UMYA 3MY9A 5FKYA 3QKZA 3T8QA 2ZXQA 3WH6A 4FALA 2ZDRA 4K8GA 5G4HC 4IP7A 3PWIA 1NWSA 1YE6A 3H2CA 1UH2A 2DFAA 4IJRA 5HATA 5I3FA 4HU3A 1GVOA 4LPCA 2EPLX 4U3AA 2WSYA 3QFEA 4FNPA 3BGAA 4KEMA 3I3EA 1GRGA 4JIIX 2ABBA 3SCOA 3IUHA 5B7ZA 3CLMA 2WWCA 3PJUA 1FKXA 3MP4A 3A21A 1LORA 4CVWA 2CHRA 3G0UA 2A6NA 5IDIA 2ZRWA 2P88A 4MNMA 2D2HA 4Q8TA 3H4GA 3W28A 3ZJ7A 3LUTA 2W3RA 2I17A 4DLMA 1YRRA 2I1OA 2X42A 4NNBA 4H19A 5FEZA 2FDSA 2YCJA 1XBYA 1E4IA 1QNPA 1G4TA 3L12A 3URHA 3WH7A 3ARZA 1I2QA 4HBKA 3VUPA 1ZAIA 2X30A 3T40A 4DBWA 1C3FA 4FR1A 3RXZA 2C6QA 4CNTA 1NELA 2PWDA 3L4UA 2PDWA 5D05A 4EF8A 2GVEA 3CL7A 4AD5A 1KBBA 1ZU8A 1JG9A 2B0MA 2AQVA 3DAQA 2QJIA 1X7IA 4RV3A 3VIKA 3E0LA 1NOFA 4YL2A 4QJ1A 4S3DA 3TYCA 3WF2A 4BR1A 2VRQA 4GC3A 4JXCA 1E9YB 3U4FA 1LL4A 3FAXA 1TIMA 3LMYA 4LBUA 2FVLA 3CHDA 1EC8A 1IIGA 4JTGA 1NP2A 3KVKA 5ENLA 2NV2A 4H9YA 2XSAA 3V5FA 2B7NA 2CITA 4O17A 4XZBA 1EZWA 3IS4A 2NV9A 6A3HA 2QJNA 3PSVA 1W9VA 3QPZA 1SYTA 1EJWC 3EAUA 1MI3A 4HHLA 2DPEA 4H50A 1O1ZA 2O9RA 1OEPA 2VYOA 3VPLA 1ONXA 4KPRA 2V3GA 3BAWA 5CBJA 1Q3NA 3PS7A 5HNTA 5I3DA 1JPIA 3H2FA 2PMQA 1HUVA 4LBSA 2TMDA 1R9ZA 1VAHA 1E6ZA 3RG6A 3BSMA 3CM4A 3PNZA 4G5DA 4X2RA 3S1UA 3SR6B 1ZBWA 4GZEA 1TWDA 2WSRA 1EIBA 2JALA 3JVAA 1TTIA 3SCTA 1R85A 4DPPA 1GOKA 1FWEC 2G3NA 2Q3RA 3BAKA 3NL2A 3UNTA 3QFWA 2DZUA 1SSDA 5A8MA 3B9NA 3GVWA 2W4XA 4PFMA 3KL5A 5HQEA 1XH0A 5E0CA 4GOAA 3W6MA 4UTHA 1SB3B 1FWIC 3SCRA 4UTLA 5FJJA 1L0PA 1JD7A 3CC1A 4QRNA 3MP3A 1V4YA 3STFA 2QLYA 3OQEA 4LUYA 1AQ0A 4BK9A 5BWFA 4WZHA 1FTXA 1F4HA 3EBVA 4GUFA 5I06A 4MLJA 3PBUA 2PDCA 3PBYA 4J35A 2OODA 1E6QM 2QXWA 2V6AA 5DMNA 3UYIA 1R3YA 1VFTA 1QI0A 2Y5EA 2ATMA 2INFA 2NWRA 3FAWA 4DM1A 2QS8A 2PE4A 1BLIA 3NQFA 4IMGA 2A2IA 3PZIA 1V6WA 3AUJA 2B7OA 3MVTA 5E0KA 2AQWA 4LX4A 5DMYA 3U2CA 5A8PA 2W91A 3PG9A 3VGFA 2V68A 4L65A 3APYA 3N15A 1P1MA 3S1GA 2TPSA 1LUCB 4QCEA 3WD0A 1KO0A 1FCUA 3W1PA 1PX3A 1K02A 1VGAA 3RM8A 2FTPA 4LVBA 3A3HA 1GCYA 1VEMA 3L67A 2WVUA 4CKQA 1M5WA 2ZVRA 3CQHA 4G2DA 3WH9A 2W79A 3JRKA 4XBSA 3PFMA 3IJ9A 7TIMA 1RQHA 1TVNA 1CXHA 3XIMA 1YXCA 4HN8A 1WQ5A 1OZMA 3WFZA 4JTRA 1ZB5A 2P8CA 1ADOA 1FOBA 3VZYA 1ONWA 3BGJA 2Q71A 3NDOA 3NL3A 1FO4A 2OZ0A 1Q4WA 3RJXA 3L4VA 4FXRA 5FJOA 1BSLA 3WJWA 1HJXA 5KMYA 1L6YA 1QW9A 4IOTA 3F4VA 3K5XA 4Z2IA 1Q13A 4MGGA 4TVWA 1GJPA 1S5VA 2DT2A 2Y5JA 3EXSA 1W6TA 5G5HB 4BFAA 3R79A 1DTNA 2WNWA 3W27A 2OO0A 2GWNA 3H7UA 2PDGA 2QEZA 4RPPA 3W37A 1YADA 4MSSA 3MW7A 4GI9A 3SEPA 2GJNA 4JTIA 4LEFA 3VCRA 4DXKA 2G3IA 1SO3A 1Q7MA 3TTEA 1AL8A 2CXEA 5F4XA 3I6EA 2EG6A 4JFUA 2XGZA 3PN8A 2ISSA 1PV8A 1BYBA 2DEPA 3ENLA 4A8NA 4OQVA 4NUWA 2HROA 4Q8UA 2OMAA 2I5QA 5A94A 4DI9A 3C2VA 4FLRA 1UWIA 2G5WA 1ZGDA 2V5BA 4O10A 1OC7A 4AEFA 1ZMDA 3UVIA 3V35A 1FBAA 3KTXA 2PDMA 3BQ5A 1ZCOA 4EM4A 3WX7A 1HXJA 3KZPA 4XO7A 2G96A 4UCGA 3CEUA 1Q1WA 1UUMA 1RXOB 4RX0A 3W1NA 1WOBA 2F6UA 1O66A 3QGKC 1TREA 3M64A 3L0KA 1HKWA 2D69A 2PRHA 3BXWA 4AIUA 2DUXA 4IGMA 4HP5A 3VDCA 1F3XA 3EOSA 5I07A 1U1HA 2OZTA 3UWZA 2G3FA 1MRQA 3PUGA 3LRLA 3UXAA 5DO8A 1PTGA 4PTVA 3R11A 3ZR6A 2B7QA 2V3DA 3SCNA 1D9EA 2PDHA 3WQFA 4XWUA 1WKYA 2DZWA 4KW2A 1V3HA 3L23A 2GR2A 3M41A 1QW8A 5JCNA 1QTWA 3VOGA 1V3MA 4R27A 2V9DA 1U30A 3N17A 5C54A 1XYCA 1XLLA 5FJPA 3UA4A 4GMEA 4NZ3A 4YCOA 4LCQA 1AW2A 3AROA 4X61A 2DQXA 1A5LC 3HG2A 1PPIA 1DXLA 2V3AA 1XLAA 1OVDA 2INZA 3QFAA 3SFWA 3VCCA 3OVRA 3IGUA 2ZZ7A 4BF9A 1QOPA 1WB0A 1X7FA 3H4WA 4D6IA 3QJAA 3ORWA 2G4FA 3U5UA 3STGA 1UWQA 1R9YA 4NT0A 2EJ1A 2BASA 2Q01A 4QG8A 4XKYB 1K03A 1W5OA 4L4OA 4REQB 2VFHA 1V3JA 1L8PA 1OGBA 2KX9A 1EDTA 1LWHA 1BG4A 1JQVA 1Q7ZA 4QX4A 3IUDA 1LUCA 3QOKA 4XIAA 3TP4A 3GYEA 4XD6A 2DZSA 1UYQA 4Z0SA 3RU6A 5A3HA 3STPA 3GU2A 3ARTA 2Q8LA 2DDXA 1GKRA 4JN8A 2QCMA 4NP7A 4B5NA 4RW3A 2CLPA 3VGGA 4XZHA 1FFRA 9CGTA 1VJSA 4Z0JA 2HNEA 3P2VA 1R46A 2DJLA 2OOFA 1YTKA 1V6YA 3SZ8A 3LCLA 4ORIA 1FA2A 4RR4A 2XIIA 1JF5A 3UA3A 3E0FA 3CV2A 3HTWA 2WBAA 5FF7A 4DWSD 5E9AA 4AWTA 4DZIA 3MCOA 4FI4A 2FMOA 1J8VA 4UTUA 3ARUA 4MWAE 1S2UA 4MZYA 3WIJA 1R2SA 3B8TA 2YX0A 3NYDA 1S3HA 1MZRA 1V08A 1VLWA 3BH4A 4G1NA 3GTFA 3ZJKA 2PWUA 5LIXX 2IQDA 1MXSA 4W7UA 4FO4A 3SDOA 4YHGA 5EMLA 1QT1A 1UUQA 2AAQA 4PYSA 1N8IA 1R3SA 2GSHA 2X0SA 4QLLA 3L9CA 1E5NA 3CASA 4FA3A 4F4RA 1RR2A 3I3DA 1KTCA 4UWMA 4RDVA 2WVTA 1A3XA 3DG6A 5HUOA 4PFHA 1K6WA 3NQMA 3B8SA 1SUXA 4UNLA 2BGNE 4IUGA 4NXKA 1MQPA 2VQTA 4Y9NA 2CU0A 2FZBA 2YCIX 3IJ7A 2X50A 4H7CA 2VD8A 2OJPA 2DSUA 1D7FA 1IQ8A 1OX4B 3FLUA 3FDKA 1XLDA 4XSMA 4JY9A 1BWKA 1LG2A 4RK8A 2F2KA 2F6KA 3P5YA 1F8MA 4ZO8A 3PZQA 5CG7A 4WCJA 4MNJA 5FAJA 1K7EA 3TLLA 3ONBA 2ZC8A 3T44A 4Z2GA 4PCPA 3UY7A 5HA7A 1UA3A 3MO7A 3RK8A 4M1BA 4B3KA 4JL2A 2OSWA 5F2LA 3LHVA 2JGQA 5CZKA 3N2CA 2OQHA 5TIMA 4CQAA 2C79A 3DK8A 4M81A 3BOLA 1EDQA 1L2UA 5E0FA 4AG0A 1P0DA 1WX0A 1JF6A 3FEQA 4GQRA 5K9XA 3T8LA 1AG1O 3CGCA 8RUCA 9XIAA 4C65A 2Q8ZA 2GJPA 3LLXA 1AJ2A 1K70A 3R4IA 2F2HA 4S3FA 4AMCA 1M41A 4H7ZA 1BQGA 3CGDA 5AHFA 4WKAA 3Q67A 3AMLA 4C6FA 1DVJA 3GTHA 1OYCA 5U25A 3QTPA 2PZNA 4C7FA 2YBTA 4B5TA 4JX4A 3WZ0E 2UZ9A 4G9PA 2PA6A 3CIVA 2HXTA 2DZBA 4V2XA 1UR0A 3MANA 1QPKA 3DGRA 3KDOA 5MHBA 1XICA 5EYWA 2PLJA 3FA5A 2E8ZA 4GYKA 3TTYA 4JTLA 1FUYA 1HZYA 2WHKA 2WQPA 1M6JA 5A6TC 5JCIA 3MMUA 1ISZA 3WLKX 2ZZ6A 4OT7A 3VGBA 3ARQA 3PZVA 2F84A 5XIAA 2A5HA 2ZX5A 4REQA 3EUB3 1IXQA 1T5AA 4OOUA 5DXYA 1XXXA 1XPYA 5CH9A 4O54A 3GSMA 4Y6GA 1RCXB 2VGFA 4NAFB 3SJNA 1ZAJA 2VEGA 3BGGA 2HE8A 1XINA 1LOSA 4JL1A 4HTYA 3CXOA 3TV8A 4I8DA 2V63A 1GOXA 3GG0A 3AIEA 1VB9A 2Z4GA 3PTQA 3KE0A 4WIWA 1EOKA 1OWQA 1UCWA 5D03A 1TMHA 4PEEA 5J5RA 3N6QA 4GI8A 1UJPA 3DZ1A 3VNLA 2QAPA 3R13A 3MI2A 2J9YA 3LHYA 3II1A 4AYGA 4LNCA 3HW2A 1GEHA 1FWTA 2PP0A 4AWUA 1F2JA 3WNNA 3NCOA 4MB3A 1RH9A 3EEGA 3BG9A 4WK9A 1OSEA 1W1IE 4AD1A 3UGRA 2BXZA 4Q6XA 3C61A 2RDXA 3M0IA 1O7AA 4UFLA 1BRLB 4H6RA 4UR8A 3WQEA 3WENA 3ZWSA 3DHUA 2Z27A 2O92A 4CD7A 1N82A 1WKEA 4IP5A 1XLIA 3NQAA 4H4IA 1KRCC 4H9ZA 2BXVA 3T55A 1KBKA 5LSMA 4ZTYA 1KTNA 3OJGA 1NU5A 2BDQA 5D9OA 3KOYA 5LA0A 4JEJA 3FJ4A 3MYOA 3B9AA 2OT0A 4FSAA 2PUZA 1XANA 1XRVA 2WBKA 3WELA 3DUGA 1LCOA 2ZRVA 2ISDA 4ZFCA 3TWBA 4QS5A 5HWMA 3BC9A 3NR0A 3TA9A 2O0TA 3UXIA 4X0NA 3FJNA 2HVNA 1KN0A 2X1RA 3AHXA 3OYXA 1KFBA 2BODX 1M7JA 4I5RA 1KD0A 3C0LA 1DNCA 1XR2A 1Z7AA 4L4PA 1WXJA 1OG6A 5BROA 4X9YA 4TVDA 3SQSA 2ZA3A 1ICSA 1AVAA 4P2VA 3DBNA 4I9TA 2D3NA 4U3CA 3SM0A 3NJ3A 1KFCA 4K2SA 7TAAA 1JD9A 3L2LA 1RSCA 1YX1A 4C6OA 1EL3A 2JQXA 3SAZA 2FGBA 1OIMA 1LWIA 4YIWA 1YNQA 4OECA 2H6RA 3GUGA 3W82A 4AHPA 3IIVA 4FX6M 3NS1B 4L6HA 5DCEA 2H8XA 1H1YA 4R7OA 2ZZ3A 3TYDA 4AZIA 3AIUA 4LSBA 1IT8A 4O52A 4P8VA 3W1RA 4CCEA 1UHVA 3WDPP 3HPZA 1SW0A 2E9LA 4DWSB 1BKSA 1TV2A 4O8AA 3OU8A 4R9OA 2WXDM 4B3LA 1OB0A 1RLCL 2W6RA 1EJUC 3A7RA 5EL1A 5KTLA 2RDWA 3IJDA 1VQZA 4NJIA 1J01A 4LEQA 3NOYA 4PMZA 2CKRA 3EWUA 2Z7KA 4AVNA 3H2NA 1W56A 1YQ2A 5CPTA 5KSWA 1AQMA 3F4CA 1FCBA 1SZNA 1KR0A 1YTDA 4MWAD 3PK7A 3HBLA 2OYMA 2DU2A 3ZJ6A 2YLLA 2C16A 4PUNA 3JZEA 2AMXA 2VJXA 1E72M 4M7SA 2WPFA 4NAFA 3BUVA 3ITYA 1JZ6A 1U1UA 3ARYA 4KWOA 4W5ZA 4Q8PA 3DJJA 4HPHA 4CQBA 3H23A 1MEHA 1JPDX 4XQ6A 2OEKA 1T8QA 5FI8A 4IFKB 4GA8A 3KHJA 1FFVC 1ZAHA 4XKMA 3WLRA 5G2IA 1WBJA 1JRBA 3MHUA 4WOQA 4WKHA 2R91A 5U1OA 2E77A 3A4XA 1W1PA 5DMLA 1KXVA 1ZSXA 5GJPA 4XV0A 1E0XA 1E40A 4DI8A 3G8RA 2CLLA 2NXIA 4E2DA 4BI6A 2PDUA 5LA1A 1V0KA 3WEZA 1Q5MA 4WF7A 3L2IA 1JULA 1G69A 1LRNA 2JKEA 3CUFA 3GC4A 3GBDA 3EMCA 2I5IA 1ZZMA 3L2MA 1CECA 3A4WA 4GQ0A 1CBGA 5AC6A 1X6LA 2VR4A 1BRLA 1XISA 4H4RA 1F3WA 2XHYA 5LYRA 2YA1A 3DXIA 3P0WA 1NARA 3R07C 2GVLA 4PRTA 1OBAA 3DFSA 1ADDA 4ICMA 6PTDA 4ZOCA 1UP2A 2WQDA 1B4KA 3PZ9A 1V3KA 2REQB 4NYYA 5HPOA 3QLLA 1GV4A 4CQ9A 3BOFA 4GVFA 3U7BA 3EWXA 3IJLA 4ZCWA 3HG5A 5ABHA 3GIQA 2O9OA 3GC2A 4M6VA 2PD5A 2XU2A 2UWFA 4A3RA 4DHGA 2VVNA 2D73A 3U5YA 3JS3A 4ES4A 3URAA 1UKQA 3OZMA 5DELA 1D3GA 3AS0A 4J1OA 1E70M 1B0IA 4Y96A 5KZEA 4Q8MA 3D5HA 3MS8A 1A4LA 1QI5A 1FWGC 4MPKA 3DOPA 1T3QC 2PGFA 3M7WA 1F6YA 1LL7A 1Q6CA 2YOCA 3HIJA 4O14A 3AISA 3RCNA 3V1PA 1F3EA 3U3HA 3AIQA 1AFSA 3J7HA 2NZLA 2E7FA 4N2YA 4LW7A 4FF7A 5LIWX 3I10A 2IKHA 1QBBA 2CWXA 1OC5A 3CJPA 1M9HA 2FIQA 2GSEA 4WLCA 3SGUA 2OGYA 2E9BA 1UQYA 4UZSA 3V4BA 3B0XA 1R47A 4GE8A 2HTMA 3NZPA 1Z32X 1GOMA 5C2GA 5DRCA 5LA2A 5A6BD 2G3JA 1XGDA 1Y5VA 3O8AA 4NAEB 3KOZA 2A7PA 2VZUA 4GXWA 4AHQA 4AD2A 3BO9A 3AZTA 2DV0A 1Q6EA 2CBVA 4DUOA 4DXVA 1E0TA 1R3WA 3KBWA 3FEMA 3NGJA 3W2UA 3V16A 2HMCA 3TFXA 1OFDA 2YKKA 3M0XA 4UR7A 2ZXBA 3DG3A 3N34A 5E9XA 4Q7IA 1WO2A 2QDHA 2QPSA 3LDVA 4DWSC 1ZHAA 3VUSA 3CO4A 3E2VA 2EEXA 2PBOA 1UR3M 1N60C 1RP8A 3LADA 4OBTA 2J27A 2ON3A 2BG5A 2PGEA 5E5CA 2W62A 2WZMA 3DIPA 2Y0FA 2J77A 1PWMA 4LV9A 5CZ0A 4A05A 3WEMA 3L7RA 5JCKA 1E55A 3WBYA 2J66A 1BTMA 4E2VA 2E28A 4UNKA 3ALFA 3EMQA 4LF2A 3E2RA 2D1ZA 4H83A 4Y7EA 4WGHA 4L64A 3IGHX 4JX5A 1G4EA 1TX2A 4Q22A 5FJUA 1OFBA 3AM9A 4ZOHB 4OV9A 4IFKA 1UKSA 3W81A 3ZSTA 3CGTA 1RBAA 2A0NA 3GG1A 4XAGA 1XYAA 3RDKA 1DE6A 3OHMB 1JROA 4QE5A 3VFLA 4R5EA 1J0HA 5BOEA 3ZLGA 1ITUA 2ZX8A 3R7MA 5D2XA 3CV7A 5A6KA 1Z6KA 2D0HA 3ARXA 1AH3A 3IEBA 1Z8AA 4F79A 1CIUA 1K4HA 4BA0A 2NQHA 1K7XA 2VGGA 4BY3A 3LA4A 1UROA 1RJRA 1B31A 4ENLA 1HGWA 4EACA 1F74A 1FWBC 2W3ZA 2CERA 3UCCA 7A3HA 2YW3A 5LGZA 2W3SA 1XFCA 4TVCA 2BFGA 2G41A 4KRUA 3W2MA 1F07A 3FHAA 3LCWA 2VX4A 4L6DA 4AVFA 1TE6A 8A3HA 3W70A 4B91A 1OT1A 3VDBA 4TVUA 2Y1HA 1PVNA 1O5QA 2Z29A 3UPWA 2HBXA 1KBIA 5AOUA 7ODCA 3QEZA 3VKKA 2WV8A 2QPXA 1ONEA 2BXYA 2REQA 4TXEA 2QAEA 4O8RA 2WM1A 1EUAA 4CEUC 4NJHA 2YA0A 3H7RA 1KWKA 2ZA1A 3GX9A 3DC8A 1ZMCA 1J12A 1QK2A 4NJJA 4LYKA 3W7NA 1K9TA 5JH2A 1UR4A 2YL5A 1P7TB 4J3UA 3A5FA 4HMCA 3UG5A 1YTEA 1VBHA 4MUPA 4C6MA 3G3DA 1JNDA 3F2BA 4NVTA 4CGTA 4IMCA 1AQFA 3AMGA 3AHTA 4MWAB 1JGIA 4V1XA 4B5SA 1XYMA 3MKCA 1CB7B 4GNVA 5FS8A 4NEVA 2OWXA 3GAYA 4AAJA 1KM3A 3F4WA 3P82A 1DXFA 1ZLPA 2CLOA 1UBPC 3P81A 3WK0A 2QJJA 4NZ1A 5D09A 4PTMA 4GIRA 3RMEA 4ATWA 4AWEA 3P5ZA 4QEHA 2ZTJA 1EXPA 3N9KA 3E6EA 4FEZA 1TPUA 1R8LA 1GPWA 1DJYA 4B4FA 4C7GA 1JCYA 3SUVA 1VYSX 1VCFA 1XG4A 3BARA 3BAXA 3N12A 2DSWA 4PUEA 3B8UA 4AHOA 4B90A 3MB9A 3KEHA 2XFRA 3KOFA 4JPGA 2PCQA 4IIGA 1DL3A 1B90A 3SUUA 1PDZA 1LPFA 4RE0A 1HFBA 3AJXA 1I8JA 3NQ2A 1SZGA 2WOIA 2HNHA 3E49A 1DJNA 2UBPC 4DNMA 2VFEA 1ML1A 3QV7A 3ERPA 3WLJA 4AW7A 4F0MA 3W7OA 4K1WA 2E68A 1JCTA 2WPEA 3ATZA 5E6YA 1EUNA 1QVBA 5T91A 1CXEA 4US5A 1D3HA 3LHZA 3UJ2A 3QZ6A 1X98A 2XINA 3W71A 8XIAA 3MSDA 1TPWA 3G1YA 1I6NA 3GKFA 4Z08A 3HQPA 3WEOA 2Z26A 3MV11 1A80A 4I7UA 3SECA 4FXFA 1MEIA 2FDMA 3W53A 1YDOA 2GUBA 3O05A 3UWWA 5CCZA 3NDZA 3C8FA 3CK5A 3W25A 1XDIA 2X1IA 3BSHA 4PGLA 1ME7A 4NILA 1QNOA 1XLMA 2GVGA 3NSNA 3S1VA 3B0VC 2PF8A 4GCXA 2QUNA 3XINA 3PAOA 4GCAA 3B4YA 4GQBA 3B9EA 1SO4A 4KFPA 3VILA 4MYAA 5J5DA 1Z69A 1BAGA 2VOTA 2UV8G 3O3RA 1CGTA 4YN5A 3SGGA 5AYBA 4JNMA 1SFLA 2QCDA 1LT8A 1GHSA 1Q1RA 1LBFA 3H2OA 3M5ZA 3WQ4A 1ZALA 2X1TA 4GGHA 1I1WA 3H2AA 1DHKA 3MMWA 3UZXA 4NEWA 3FW6A 5TNVA 3TMLA 3W75A 1JYWA 2AQOA 3TJXA 3ABXA 3EXTA 4MJZA 3UZ5A 4DXXA 4HA4A 3C2YA 3E38A 3NUKA 3DEQA 3AI0A 3C3NA 2ZUUA 2GJRA 2X41A 1Q6LA 4GX9A 3ANYA 4D6CA 1R3QA 3BG5A 4ZR8A 3KDNA 1W37A 4QJ4B 3W1TA 4QFUA 1W2PA 3SB0A 1V02E 5D9PA 2Y61A 3LXDA 3CT7A 2WOVA 1L6WA 1RCQA 1R0MA 5I3HA 3RFAA 4URIA 2YL8A 3M4HA 1HVXA 4RNIA 3ES8A 5BU6A 5CC6A 1UKPA 4JIEA 1VRXA 3KBVA 4XAYA 2F7FA 2BNJA 4LYRA 5JBDA 1TV3A 3EB4A 4FX9A 5I3JA 3DC0A 1P7TA 4U5KA 4GZJA 4JTUA 2BY1A 3T7VA 4PMOA 2WYSA 5I6SA 5FS6A 1C8XA 1B3WA 4OIFA 5LIKX 2QVHA 5JRBA 3BWWA 4AXKA 1R30A 3AMKA 1Z48A 1QNSA 3WKZA 2XSXA 3W7RA 4AZGA 2CHNA 4DX3A 5G4WA 5FJRA 1GVIA 3VMPA 4JD4A 2JK6A 1FXQA 4UXDA 5H8UA 5M3WA 4LVFA 2WP6A 1NY1A 1GHRA 5AZ1A 3TZNA 3LCXA 3G0SA 1AH0A 4M0XA 4YMZA 4XTDA 4MWAC 3UZZA 2D24A 4ROQA 2Z0IA 1KGUA 2D0GA 3DFQA 2A3EA 2PWEA 1QO5A 2BLEA 4BWLC 4UTWC 1W3IA 4MZ8A 1XDJA 2HXUA 1BXNA 4IISA 3WLPA 4DBUA 3AHYA 4ATLA 4JQ3A 1EJVC 1Y8BA 2VMFA 4J4KA 1F7BA 3KBSA 1KKOA 3KBNA 4V15A 4IQLA 4ALDA 3N3MA 1QI4A 4HNCA 3QSTA 5KVHA 2QULA 2X7WA 2ZE3A 4QAIA 2DUZA 3BE7A 3NQGA 3S2NA 1YW1A 1KGXA 4GI6A 1WKFA 3ITVA 3W07A 3TW9A 4O1AA 2QIIA 3LTSA 2W54A 3SW6A 1XF0A 4S39A 4KWUA 2XPKA 1ENUA 2HZGA 1XIEA 3M9YA 3FA3A 3U7VA 1DYSA 3NPWA 2QDDA 4JNZA 1GVRA 1WDQA 2QAFA 3TEVA 1FWDC 3B97A 4A29A 3ZXWA 3S47A 3M0LA 1ONFA 2BHYA 2FPYA 2ZX9A 3EDFA 3T2PA 1CGVA 1C91A 3BMWA 3SCSA 1O4UA 2WJDA 3AZSA 3TYUA 1J5SA 3QXBA 2D2JA 4ZOBA 2NXGA 2EKGA 4DYJA 5LIYX 3JZUA 4DY1A 4IXXA 4LS1A 3FFSA 3R0KA 1QNVA 4EKJA 2R1NA 4GUHA 4ROPA 4B5UA 5G5GB 2WZTA 2IKIA 2YVGA 1S5NA 4MF4A 3GXMA 2W27A 3QR3A 4BQ4A 2E8YA 1GREA 4H9XA 7CGTA 5HDRA 3ARVA 1PIIA 2RKXA 1YXDA 4GG9A 1JL8A 4QLJA 1US2A 5BYWA 1V6TA 4AY1A 4YPJA 3UJSA 4Z42C 2YDRA 3STEA 3FKKA 4YHEA 1D3CA 2OR2A 4W5UA 2EJAA 3E2QA 3GHUA 4LC8A 4A8LA 5A6BA 2XG9A 1UOKA 3O07A 2YB1A 1EEXA 2X0HA 3MA8A 4OTKA 1TELA 3VNKA 2QYGA 3CIXA 2OWWA 3SR7A 1UA7A 4Q4KA 1BF2A 1UP3A 3FHQA 4MKSA 5M5DA 2PS2A 1ISVA 3TOPA 1BVZA 4IWWA 3T08A 5PTDA 2EG8A 3OBEA 5JIPA 3FSUA 4CLMA 2PDJA 1J9YA 4H4ZA 1TPDA 2WPBA 3BMXA 3OIHA 3R89A 3QH2A 1JFHA 4R7JA 1K9EA 2NXHA 3UZYA 5DX7A 4U2YA 3NEHA 3Q65A 4LAZA 1SZEA 1CXKA 1NDZA 3N3TA 1M1BA 3HPAA 4AISA 1NWUA 1TVLA 4LAMA 1FH7A 2ISVA 4KBXA 1OIFA 2CZVA 2CLKA 5KVIA 4RW5A 3C2FA 5HANA 3QFBA 1XIHA 3VE9A 1IZCA 4PCSA 2V30A 1QO2A 4W84A 3RRAA 4CQCA 4YWOA 5FEPA 3QR0A 1RPKA 3L0NA 3LEPA 1OK4A 4DJFA 4N42A 3LGGA 1CW2A 3W2LA 5CZJA 2NPXA 3HFYA 4MFDA 3CS2A 1SFJA 4P7OA 4J27A 3TXZA 1RK6A 2OLAA 2QV5A 1OX6A 4C6KA 1J93A 1VH7A 2EQDA 3WY1A 2CFFA 2KAUC 4JIHA 4PUKA 1HKIA 2VEKA 4R33A 5CLWA 4F0LA 5D9NA 1FWAC 2OSXA 3OLDA 1V0LA 1AW1A 4HJFA 2YZ5A 4U2ZA 4W88A 3AXKA 9XIMA 7REQB 3M5XA 4QQUA 3M44A 4M24A 4DQWA 2YCLB 4FLSA 3O15A 2OWCA 3WD2A 3L4XA 1NEYA 1OJXA 5FACA 5XINA 4R53A 2XFFA 5DXXA 2RHGA 1Z3NA 4N9EA 2PSNA 3WF1A 1H09A 1I2RA 2DZVA 2Y62A 2IQ0A 3MZ2A 1XH1A 3WLTA 3U57A 1UMLA 3W7IA 1CPUA 1Q2SA 3RRXA 4GHRA 1SJAA 3WQDA 2Q6ZA 1EBDA 1FKWA 4M51A 1PKMA 1H50A 1ZK7A 3V36A 3ISIX 4CVUA 5I03A 1SZFA 4ML4A 5JCLA 4UCFA 3THAA 1AJ0A 2V5LA 4FHAA 4ADUA 1GQIA 3HGRA 2ZVIA 2X1SA 4M6UA 1XKYA 2HPMA 4KT2A 3VCNA 3PM6A 4GX8A 3FN9A 3M0HA 1OF8A 1XWYA 3UWVA 4J56A 3APTA 4F48A 4HKPA 3D3AA 4K39A 1YE4A 4AH7A 3AXXA 3EDEA 4ASTA 1A5CA 1TPB1 3D9XA 1W3KA 1XDLA 4H00A 1PKYA 3S3GA 3EEZA 4U28A 1R38A 3M0ZA 1I2PA 1DIOA 4HA1A 5CAHA 1VF8A 2RH9A 2HBVA 2IMRA 5H6HA 3MP5A 3BV7A 2XTKA 3KRBA 3GIPA 2WZIA 1GERA 5BMWA 5CG0A 3MCMA 3A3WA 1F05A 4YWIA 4D6EA 4D71A 5ABTA 1JPKA 2YR1A 1VRDA 1DXEA 1DWGM 3WK3A 2BP1A 2VUYA 5I2UA 4XBKA 1TMQA 3NZRA 5K7JA 1F8IA 3VYLA 2J24A 4O50A 4W7WA 3I4EA 4J2MA 1W5PA 4GUIA 3G3MA 1A3WA 1KB3A 1EO5A 2E5CA 4I9JA 2WMJA 1QCWA 3LQGA 3POCA 4EAMA 3NQ7A 1JVNA 2IPGA 3HV8A 3INPA 1HKKA 3OZYA 3AJ7A 1V3IA 2QPUA 2GJXB 3VNMA 1W3NA 5I3GA 4QDMA 2PDXA 1XRTA 2PTWA 1FXPA 4O19A 2W92A 1DE5A 1SJCA 1H7PA 3G77A 3O6YX 1JRCA 1JQXA 5AVNA 1W31A 3NURA 2BGQA 3H2EA 2E0PA 3WJYA 2PGRA 4KFNA 1EX5A 3L0GA 2Z00A 5E70A 1XHGA 4H6KA 2E1DA 3GDRA 2XVLA 1RUSA 3LB0A 3AHZA 1X1ZA 3T1GA 1OGSA 2FH8A 4PTWA 3WBXA 2CW6A 2P76A 4H9MA 1PZ3A 4J3VA 1R6WA 2BOEX 3UZJA 3W7KA 4JEQA 3VU2A 1P6BA 4EE9A 2XVGA 4PA8A 3FKRA 2C71A 1U5VA 2VWTA 1S2WA 2FYMA 3SRHA 3DYPA 3DBPA 3TC3A 3TYAA 2C18A 1R7OA 4MY1A 1JPMA 4J5NA 1DJGA 4G6CA 4Z17A 3EOUA 4S3AA 5MF5A 3RR4A 1WZLA 4O15A 4XUYA 4W93A 1U5HA 5C7HA 2WCAA 1LROA 4DNAA 3GDBA 2DGAA 1CYGA 2PWGA 5A8OA 3EPMA 3QYQA 3FNDA 1RHCA 4BV6A 3MVIA 4Q8OA 4EANA 5FCZA 3GH4A 3QC3A 4PR4A 3VOCA 4Y9PA 4ML9A 3MJYA 3B8IA 1B4EA 3GR8A 7REQA 4NI8A 2G37A 4L6OA 1KQYA 3RU8X 3TIMA 2YCLA 3GDKA 2XH2A 1PCWA 5I23A 1SMAA 5CSUA 3TWAA 1A3HA 3HQ1A 3TNOA 2F8QA 4LVAA 1J79A 5CKSA 1S1RA 3WNPA 4DAIA 3BLOA 4A2SA 4Q4RA 3IGSA 1P48A 4G56A 4MHBA 4XVEA 3B9JB 3AS1A 3N14A 2GOUA 2WC3A 1XCFA 2VC7A 3KVLA 2YFNA 2A7NA 2OPJA 1EDGA 1CGUA 1WUEA 4IIFA 1RALA 5EMKA 1PAMA 3W1XA 1S39A 2E25A 1PXGA 4K8DA 3RLVA 4R9XA 1ZFJA 2P50A 4IPPA 1W17A 3DHDA 4KMQA 5D9MA 1F4AA 1GYNA 3C0QA 2HVOA 4V27A 3LGEA 4AQLA 1GVSA 1GVFA 1U5JA 5M03A 2WVVB 2X2YA 1K8YA 1YHTA 3WF0A 4GBUA 2BB0A 2PLMA 3BZJA 2W63A 2PU0A 2HCVA 4HIBA 3CAKA 3C8NA 4JTTA 3WSUA 4HNLA 2W61A 3B06A 3CIWA 2A3BA 2GRTA 1Y5WA 3B8VA 3UWYA 2XIMA 4GH3A 3GXFA 3UG8A 3C6CA 3L4TA 5K4ZA 4FK9A 2RDUA 2VWSA 4QTGA 1E15A 4HN4A 4PTDA 3OTRA 5HMFA 4HNTA 3Q4DA 1V6XA 4F0HA 1VBUA 2Q3OA 3LXAA 2NQJA 4TU1A 4W4QA 4IICA 2VURA 5AFDA 3O0FA 1HIZA 2BBFA 3DGBA 2GJXA 3TCSA 5I00A 1B57A 3FSTA 4JHZA 1E1CB 3ZVHB 1G5AA 1NDAA 1H60A 1QI2A 3AAMA 4R34A 3DH9A 2VZSA 2XYLA 5DANA 3VZZA 5D4YA 3IGXA 2GGJA 2BX7A 2ATSA 3S1WA 1Y65A 3QMSA 2Z28A 4Q3MA 1SW3A 3A23A 1VKFA 3VKJA 4XD5A 5IHSA 3LCFA 1MUCA 1ZPTA 3GAKA 3VC5A 2JEPA 1A5UA 3WJZA 2ABAA 2FFCA 2Y2WA 2ZZBA 4CU8A 3ZT7A 2QCFA 4E8DA 4C1LA 4N9CA 1KGWA 3OLEA 1QI3A 5AHMA 3NQDA 2QW5A 2J7EA 3PULA 4JX6A 4QG9A 1UD4A 4KCUA 2ZUNA 5CXPA 8CGTA 4ZO9A 3TAOA 1J5TA 3FXGA 3AYSA 3PUDA 1JPHA 3WQ8A 1FHLA 2AL1A 2ACQA 3GC5A 1Q6RA 3Q6JA 4CN6A 3DFOA 5C9XA 3MBFA 4EWJA 1QWGA 4PUUA 4S2CA 3ZT6A 5FESA 1J0JA 1W9UA 3VDHA 3ZSSA 2PLKA 1XKJA 1JJKA 4ZSTA 4X22A 4OHQA 2EQ6A 4JHOA 1KM1A 2ZRYA 1QWKA 3ES7A 4UQCA 2RFGA 3GVQA 4FDCB 3BLPX 3PWAA 1BF6A 3EOOA 5HULA 3GDMA 2PODA 2ZWZA 4FLOA 1ECQA 2GQWA 1XQKA 3LBMA 4FR6A 3UXDA 3TTQA 3A9BA 1UR9A 4N7QA 1T8XA 3G8EA 2PZ0A 4JZ5A 1GRFA 1MYRA 2ZZ2A 2EPOA 1EQCA 5D2TA 4FPSA 5C7VA 1SFTA 4HSNA 3UR7A 1FEAA 4AC1X 4H4VA 4C91A 1JI1A 1VEPA 4O57A 3MDUA 1P6WA 3ITOA 1Z89A 1P0NA 4YTQA 4ZB2A 4XD3A 5C55A 1J6PA 3S2JA 2P5NA 4OUEA 1UIPA 3UR8A 4AZ6A 1Q66A 1TX0A 4LRTA 3PAJA 3CEPA 1E43A 1C9WA 1H5VA 4IQJA 1VQTA 1A5BA 1VBJA 1Z42A 4PMUA 3GR7A 2A3HA 1LG1A 3CAWA 4B5WA 3BJFA 2WSQA 3TAKA 2W0UA 4HJWA 3NYZA 5AC7A 2QT3A 3EB2A 3PC0A 4MUZA 3PSWA 2WP5A 3LRMA 1CENA 1KCLA 4WSKA 1LDCA 1MUMA 2EPMX 3SADA 3C2EA 1XUZA 4HTBA 3E1F1 2WVVA 4R3UA 3MBDA 4JGDA 1DPMA 2VVSA 3LCGA 3GD4A 3GK0A 1BWLA 1SZRA 4OBRA 1JR1A 1YPFA 2WPCA 1CEOA 1KFJA 4BQ5A 1EBGA 1FHDA 1CB2A 7ENLA 2QHAA 4PUDA 4YU1A 1EWDA 4MAVA 3NZ1A 3T2QA 3MMDA 3W74A 3NQVA 1GYMA 1R5YA 3UBPC 4C1KA 1G7UA 3R2GA 5KITA 4J3SA 2HEJA 2WWDA 3EWDA 5G1TA 3R0UA 1YQZA 2P53A 1NHPA 4DJED 3A24A 5A8QA 1E9LA 3A7UA 4LFYA 1GZGA 2DZPA 3POHA 2TRSA 2GUUA 1UWTA 1XCXA 3AXHA 3WG6A 1E1CA 3R8RA 3NZGA 4ACZB 2J9ZA 2ZUMA 2WOQA 2NVCA 7PTDA 3ZLFA 1YDYA 3N2OA 2CZFA 3HZ3A 5G5IA 4FP1A 1NFPA 1YIXA 4NRRA 3Q58A 2YBUA 4HPXA 2VCBA 5KETA 4V28A 2E67A 3HN3A 1G7VA 2IW0A 5CJNA 3GU9A 5LNSA 1YNYA 4POCA 2VC9A 4ZZ9A 2FZ9A 3URBA 4DEFA 3WLIA 2F9RA 3UR5A 3O2LA 5ER0A 2YXXA 3M0VA 2HS6A 4GY1A 1QHZA 4GLEA 4WDTA 2DVTA 4AMAA 4CNOA 4PCFA 2VCAA 2C1HA 1V02A 4QLKA 1J0KA 1DXIA 2BY3A 3GZ3A 1IXPA 3H12A 1FQ0A 1NOUA 4KEUA 2I14A 4EMWA 1JNEA 3NQEA 3PBMA 1F5ZA 4AZHA 3V1HA 3N4EA 2XZ7A 1OFOA 1PZ2A 5HQLA 2PCEA 3I7RA 3ABZA 3GY1A 4RL3A 4IL0A 3TC7A 5A6LA 3PBVA 4PTNA 3VIHA 3R94A 1J18A 4AX7A 4J9JA 1PKLA 5CSRA 4QNEA 4M52A 1M7OA 1X97A 1RJPA 2E6FA 1KFWA 3GB6A 4YTTA 4AD4A 3L65A 2XJ7A 4HNNA 1SPQA 4MJ2A 3R10A 4KIRA 3PR2A 3QOMA 2OKTA 1BGGA 4UQEA 3AYTA 1DWFM 1FHVA 3LMZA 1YPIA 3GYCA 5TQLA 1ODUA 2TODA 3S9IA 4NX0A 5K9CA 3ZT5A 4FNRA 3CGBA 3TFCA 3EYPA 3GM8A 1MQQA 4LGXA 3CUGA 3WLSA 3B0YA 3KL0A 1OFAA 1FHUA 1WDWA 3OZPA 4GWEA 5F2MA 3KCLA 4F40A 1O1HA 3R43A 4IXHA 4IFRA 4KFOA 1MO9A 1GQKA 4QDPA 3APGA 2X0YA 1GSNA 1EGVA 3VD3A 3VD9A 4B5XA 2Y89A 3VIPA 3KRZA 4H9TA 2DQWA 3HOJA 1OHLA 5EY5A 4BURA 4RLIA 3GTIA 5I77A 4GVGA 2NT0A 2GL5A 2GLKA 4ZQOA 1QNRA 2FGZA 3VMOA 1XD1A 1V93A 3TQKA 4MB5A 3MUCA 5GNZA 1KKRA 3UETA 2XVPA 5BCAA 3BSGA 1TPVA 4QGCA 1XYZA 4ZB0A 4DJDD 2CEQA 1ZBKA 1YBQB 4ZQPA 1WE5A 3LZ3A 5CGMA 3QYSA 1M65A 4WXYA 3UR2A 4B2DA 3W2JA 2WOWA 3CH9A 4ONVA 4H4QA 3W1UA 3EWZA 3EWYA 1V6VA 4KRTA 3CWOX 1AD1A 1F6PA 1TV8A 2Y5SA 1XLFA 2ZXDA 3ZR4A 3G0XA 1AODA 2ISFA 1IEVA 4C1NB 2WJZA 1W3TA 4W8BA 2JKAA 3OLIA 3QHMA 4H8NA 4RXGA 4HSHA 3LD5A 1CLVA 3WNLA 1UR2A 2Z25A 3VOJA 1R3VA 4LCRA 2WK2A 4IT1A 2V2CA 1S2TA 3WJSA 3TSBA 5C9ZA 4GRSA 1FWNA 2HVMA 3UPBA 3MDWA 4O1FA 3WQGA 1UWAA 4ATDA 4ACZA 1H6VA 4FNSA 1ZXIC 1KXTA 2YQUA 3NIYA 4PCTA 5EU9A 5CPNA 2ALDA 2W5FA 1PE1A 4IG2B 3KZSA 3R58A 4EK7A 5LNWA 4KESA 1K6AA 3UG4A 2BOFX 6XIMA 1FP9A 4NZFA 5D8WA 2HV5A 4K36A 1NFGA 1W1TA 4OWGA 2J7FA 3THUA 3QHOA 3B0PA 4EQSA 2W66A 3G2GA 1IEXA 5BRPA 3SY1A 3PZTA 4P7LA 1K8XA 1XBVA 2P8BA 4N4QA 1D2KA 5H91A 3DK4A 5FSEC 1G0CA 3T2OA 3CO8A 2PTYA 1JDCA 3WDQA 5FS9A 1P0BA 3ARPA 3CV1A 1US3A 2AGKA 4CCDA 3VI2A 2HJPA 3GD6A 1JIBA 2R94A 3IJQA 5G2HA 1X38A 3DG7A 4NJGA 3RNDA 1WXZA 3AS2A 4OBSA 1VBGA 2DIKA 3PG8A 2IXVA 1E3ZA 2XISA 1A50A 1HT6A 3IVUA 3N9RA 3U9IA 3ZJ8A 1XIFA 3MT1A 3L5AA 3VMNA 4JTJA 4XUGA 5F2IA 1GG1A 1VFFA 2DZXA 1HP5A 3LPGA 1EA9C 5CZTA 5M1TA 4C6CA 2WNNA 3NGFA 4ZXOA 4ERGA 3L5LA 4IJBA 4Y8FA 2XWDA 1L6FA 3S5OA 4WQ6A 1V77A 3NO3A 5T26A 4GKLA 3QTGA 4AD0A 3S46A 1IR2A 3PPHA 1F9CA 1Z44A 4JQ4A 2DH2A 1GORA 1IR1A 4V1YA 1CNVA 1WZAA 1ICPA 3FJLA 1ZENA 1Q45A 4H4YA 1QXLA 2PDBA 1JYVA 5EA9A 1TUXA 3IWPA 3WMSA 2D2OA 1W1YA 4E4UA 4LTSA 1JOAA 5D8ZA 1W9XA 3TJ4A 1DQUA 4GH1A 4D6JA 1MOKA 1PIGA 3THCA 1TJ0A 1ME9A 2GDVA 2ZUSA 4GYPC 1Y5XA 3G18A 1G1YA 1E6XM 1XIDA 3E3HA 2ZFAA 5BMXA 1WNOA 3TZFA 3AUOA 2CLEA 1HN1A 2VXNA 1GQJA 3G1AA 3FVMA 4PSPA 3HA1A 4HPJA 3S42A 2J75A 4XZ9A 4Z1AA 2RUSA 1A5OC 2WHJA 1MDRA 3I6TA 4Q4SA 3U8GA 2L5HA 2J8GA 3HG4A 1WOAA 1PJ9A 5CBIA 3CB8A 1YBQA 4BEUA 4J28A 1RVKA 4D2JA 1XIJA 5JBEA 1N5XA 3NAVA 3CUXA 3WDHA 1CGWA 3IVSA 1LL6A 5DT7A 2ICSA 3IJ8A 3CHEA 3WD3A 4HA0A 2CC0A 3MHGA 3U48A 1IF2A 3EX3A 3R8HA 3JU2A 2CKSA 2Q02A 4C1NA 3N04A 4C6QA 1XC4A 1WYGA 2QCLA 4JTFA 1IEIA 3WDIA 4CD5A 4XB3A 1SFSA 5IM51 2YGYA 3ID7A 3SBFA 4H4SA 1FIQB 3B9DA 3C86A 3AWOA 3BAIA 3A3XA 3WL0A 4MPQA 1QOXA 4JKMA 4M80A 4DN1A 4W8AA 4O18A 1GJUA 1T6MA 4PODA 2O4MA 2D3LA 1H49A 2DZAA 2PTDA 2OQLA 4S3CA 3W1MA 4IG2A 1YKWA 1FECA 3EKLA 4YYFA 3CUJA 2QCNA 1CXFA 2WMGA 1VFOA 3LLDA 4NU7A 4TVYA 4WX2A 4UQAA 1LZOA 4M19A 5A8GA 1S3TC 6CGTA 4L7ZA 4DM2A 4GY7A 4OUIA 3LPFA 1BXBA 5CJMA 1H0GA 4AWSA 1EQPA 1EEPA 4JDRA 4V33A 2F6XA 4BZYA 3SCVA 3KOWA 3ANVA 4PZVA 5HNRA 4HPNA 1TR9A 2ZRXA 2R14A 3QSRA 4U33A 4LAOA 3T0TA 4NG3A 3PPGA 1F8WA 4JIPA 2E3TA 2Z2UA 4UBPC 2VR5A 4IZGA 4KPLA 3C3UA 3GDTA 1MEWA 4PE8A 4IPLA 3PTDA 4PC8A 1FWHC 3F4DA 5D37A 2A21A 2BS9A 3N2BA 4O28A 2GWGA 1A47A 3LM7A 4J3TA 3SI9A 3C56A 2WCGA 4D1JA 4Z2HA 1I75A 1IWBA 1E5JA 1ICQA 2WC7A 2BVYA 3GXNA 2GVJA 2V3BA 1Q4NX 2MNRA 1OINA 4Q8NA 1LRTA 3WFLA 2I9EA 3DFTA 4X9SA 1VHCA 4HYRA 3SUSA 4Z1DA 2A3AA 3MUXA 5CSSA 3VOHA 1DQWA 4XZIA 2FHBA 2Z1VA 5GPRA 1TV7A 2NLYA 5HJYA 4GISA 3NVDA 4TX6A 3CMGA 4DO6A 4TX9A 2PLCA 2VT0A 1YYAA 2P3EA 1UZ1A 5A6MA 4GQGA 1U33A 3C0JA 3M0YA 2WBGA 1AD4A 1XIBA 1CTNA 2GOKA 1JCXA 1IEQA 1J0YA 2YYUA 3GFYA 2DW6A 3CL6A 2WMKA 3BTNA 2YCEA 2EF9A 2VO5A 3W23A 3OGVA 1GW1A 3EZ4A 4DJEC 1XLGA 4DF1A 1CLKA 4IMEA 1H41A 4GK8A 4W89A 1TZ9A 4QIUA 3B3DA 4H4UA 3XISA 2DSKA 4M6QA 5H2ZA 3RGTA 4AZ7A 1DOSA 2XIBA 4YVPA 4PB4A 1Q65A 4X2PA 4HOZA 3G22A 3KCJA 1BD0A 2DZTA 3PF3A 4ZE4A 2FB3A 1ZBCA 3W22A 3N2TA 3T0CA 2YAUA 3B05A 3T4WA 2O7QA 3GVGA 3VDAA 1HF6A 4PMJA 1D8CA 4UNIA 1M7XA 4WJ8A 1LQ0A 1OCQA 3ZR5A 1XI3A 4HT3A 3WBWA 3PWGA 1H63A 4FNTA 2DW7A 3ECQA 5I0DA 1KFKA 4H04A 1UB3A 2FZDA 4C60A 4YNGA 2PP1A 2Y8VA 4IFOA 4K8EA 1ZNNA 1H7NA 1H61A 2Z7GA 4P5UA 3PJXA 1M6IA 2WO5A 1AK5A 1GG0A 2VELA 1BWCA 2VFIA 3A13A 1T7LA 4D8ZA 4ZEPA 1W54A 3CV6A 3ANUA 4C6IA 3WQCA 2IXUA 2FJUB 1GONA 3QN3A 3URQA 3QPEA 4EMIA 3EWBX 3CT2A 3N19B 4O16A 3WUEA 5G4EA 2ZUWA 1PZ0A 3GXPA 3N4AA 3VNDA 3GXIA 1SQ7A 4HZ7A 3E96A 2GGEA 2CFYA 1TG7A 3R0DA 2NWSA 4X0VA 3RF9A 4LC6A 1F3TA 1CDGA 4LXFA 1KV5A 4DBSA 1SJDA 4JICA 3EX6A 3CMJA 5A8NA 3UYCA 4YTSA 4KETA 1E73M 3RILA 4KQNA 3WCZA 3CUIA 1QPNA 2G0WA 2DUAA 2BHZA 2DT3A 1LQ2A 1J10A 4EQRA 2VKZG 4IPNB 5A6AA 8XIMA 4A2RA 3SURA 2XUCA 3BLFA 1G6CA 2W67A 4ZTXA 5ABEA 3A22A 7XIMA 1XV8A 5H8MA 3U6WA 1EZ2A 2A85A 2I9UA 2WMIB 1TCDA 4NI3A 3P80A 1W9DM 1QPRA 1XHCA 5I09A 3PZUA 1Y7VA 4N02A 4RKAA 1PZ1A 4AZ5A 2W55A 1X96A 2YIHA 3E5PA 1MDLA 1SR9A 1H3GA 1XM3A 4ERIA 3FGCB 1DEDA 6ENLA 4AIBA 1GWJA 4DJDC 1L9WA 1XLCA 3CZGA 4UFMA 4XKYA 2JK2A 4PN2A 3EANA 2PDQA 1O95A 2J8TA 3MC5A 4FX8A 3TQPA 1EYWA 3OA3A 1E0VA 5HWNA 1BG9A 4XAZA 4LH8A 3NQCA 1B9BA 4AD3A 2ZC1A 3BCDA 4FOKA 2ZOXA 3CQKA 4EPBC 3TN6A 2PDFA 3DGHA 1YXYA 4G1KA 3RCMA 1GRTA 3G6MA 5LKYA 1NF7A 3VC6A 1JCMP 2XM2A 3AC0A 5CBBA 4I90A 2WJFA 4RDYA 4LYPA 4QAWA 3KTSA 5EMMA 1ZRQA 4E3VA 3QVQA 2J79A 2RABA 4Z2KA 1Q6DA 1BKHA 1D7KA 1QR7A 4DNHA 2BVDA 2FTYA 2YLAA 1OFPA 1UC4A 2DIJA 4N4PA 3CAVA 4I5UA 4H6QA 3USZA 4IF2A 4MDOA 4WY0F 1GNXA 4Y90A 4LU0A 4ADSA 1MFUA 3GE7A 1OZQA 4RCXA 1I2OA 4KWWA 3PJTA 2G95A 3E5BA 3FV9A 1G94A 1T40A 5A95A 4E2BA 1NQKA 5AB3A 2Y70A 3MKVA 2QF8A 3AYRA 3GLCA 2YFOA 3AALA 5I78A 4F66A 1RP9A 4S3EA 4OVXA 1S7MA 3LTYA 1HVQA 3WUGA 1QHPA 4ZQRA 4PBFA 2QDGA 5CEWA 4QDWA 4QS6A 4HNOA 3G1XA 3H55A 5HK4A 1CGYA 3SN1A 4K38A 2ZUTA 4XG1A 3F5JA 3FXYA 1OX4A 3BL3A 3HMJG 5A6SA 4DYEA 4A8RA 1O12A 4Z2JA 1ZDLA 3M1ZA 2VDGA 3DFNA 3MWAA 2GZXA 4H8UA 1ITQA 2P10A 5AECA 3OBKA 2PTXA 3W7QA 4K1GA 4TUFA 3MPGA 1RJQA 3E74A 2YDSA 2IKJA 4O0ZA 3EPOA 3RNMA 3T05A 1TTJA 1ZJBA 4AIOA 3VX0A 4JS3A 4CU6A 4KEVA 4LVGA 3HF3A 2X1UA 3PBWA 3GIYA 1AL7A 2WMHA 4BS0A 1TSIA 3TC6A 4NKCA 5CZSA 5KZDA 4WDXA 4YCPA 2X40A 4TTUA 4N9BA 3KS5A 4JIQA 3UT0A 1VYRA 1H51A 2QCGA 2NVDA 3CXBA 3LPOA 2Z1WA 3VM7A 3LB8A 4GNJA 3UEQA 3HPFA 3MUZ1 1KCKA 1DKWA 3C2RA 2OZ8A 4O0KA 2WMIA 4L4MA 3W7LA 1UH3A 3LQLA 2ZUVA 3CQJA 4BI5A 3TMQA 5KZ6A 2OX4A 4S23A 1EPXA 2C0HA 2PF0A 4C6PA 4NXSA 3ZLHA 3HJEA 5HINA 4HPGA 4I9AA 2QQ6A 4IPJA 2D23A 4I8YA 2ZRZA 1Q63A 4JTKA 3FGCA 2NV1A 3VOIA 1UBSA 1NWRA 4GPNA 1E4LA 3NM3A 5AYXA 6TIMA 2C0AA 3QZEA 2Y7DA 3EKGA 3LLFA 3IV8A 3WFAA 1STZA 1GTEA 3W1QA 4B16A 4ERAA 2YW4A 4A8IA 1ESWA 1IT0A 1R86A 3GU1A 4P8XA 1TJPA 3VKBA 4U10A 4ZA0A 1NWTA 5IBXC 2ZZ5A 1JYNA 3EGJA 5EBKA 3UVAA 4D6HA 6TAAA 1NVMA 3PPCA 1A5AA 2GPTA 3OEXA 3UCQA 1OCNA 3SN0A 4K3ZA 5DY2A 3KBJA 2EPHA 5F1VA 3QV8A 1WYIA 1ODZA 3MSRA 4I7WA 3W1AA 2BTMA 3MSGA 5AHEA 3L68A 3FCPA 1PIFA 4JYDA 3THQA 5BNKA 1F3PA 4H9UA 4AU0A 2CYGA 4QSHA 1VBRA 4JYEA 1E6RA 3OG2A 1JZ3A 5DQPA 2XN0A 1PSCA 2QV4A 4B9ZA 4HZ6A 2VL4A 2QMKA 1ZP3A 3MUY1 1EP1A 1K9DA 5F4WA 1XRSA 5AN7A 1J2WA 3WUFA 3WDJA 2RJGA 1FVPA 5LXXA 1S5WA 4ZO6A 3A9IA 2I57A 1LLWA 4LUIA 3QQ0A 3V18A 1S2AA 4HQVA 4JDYA 3DCPA 5C2XA 4JAWA 5C0QA 3RHGA 2HK1A 3H22A 3DJGX 4WKFA 3LI1A 1H2IA 2WLZA 1TRIA 1LOLA 1YPXA 3KTCA 3WLMA 1W8GA 1Y0EA 3R1ZA 3FYPA 2ADAA 1JEZA 2CXGA 1TWZA 1XG3A 1IXOA 3HGSA 5G2WA 3OIXA 5KINA 3RM4A 3UJFA 3SY5A 3UQNA 3DENA 1VPXA 4DVOA 5I79A 4ZQMA 3QY8A 3CPGA 1KFLA 5FIPA 3RJYA 4F2TA 4QXIA 2GJLA 4IIHA 3N4FA 1C8VA 5E93A 2G50A 3EA3A 5L9FA 1FFQA 3VFCA 1TYTA 3IK2A 3BLIA 5HMEA 1DQXA 5HNNA 2ZXAA 1ZX9A 1TPEA 3VD7A 1XW8A 3K4WA 4JTSA 1OC6A 5HJLA 1TV4A 1RK5A 3M6YA 3I3BA 4FAMA 1KQZA 3UD6A 4EWND 1KWGA 1QDSA 4UFKA 4AUBA 1SO6A 2RAGA 2FHCA 4WGXA 1S5MA 3TA6A 1V7AA 1NSJA 5TR3A 4HNVA 4JQ2A 4JQAA 1JRPA 1HX0A 1CX9A 3VNJA 1N61C 1UR8A 1EJ7L 3VGHA 3LENA 3OQ8A 5JXQA 1R2RA 1WV2A 3DKJA 2DVXA 1GZJA 3TXVA 1GOOA 4MADA 1PL9A 3K4DA 4AY7A 5CGTA 4WXZA 4TX8A 2ACUA 2Y8UA 3N6HA 3HQNA 3RCYA 4XZLX 1ZBVA 2YVJA 1EBHA 1A0DA 4AEOA 1XS2A 1EIXA 5A2AA 4C5ZA 2YVFA 4DWSA 4GJIA 4MYXA 4H2CA 3QF0A 4NJKA 1V5XA 2J88A 3I4KA 4ZVJA 2XDFA 1WAUA 3DH7A 4MMWA 4QEEA 5DCBA 3UZWA 1F76A 2SFPA 3S5SA 1VFUA 3LY0A 5HMDA 2JGYA 3OVPA 1XL9A 2VCCA 5HNUA 2A79A 5FEWA 2PURA 4E6MA 2G3MA 1ZKQA 1OFRA 3C4UA 1TTQA 2QUTA 1UKTA 2QCHA 1YDNA 1W8SA 4PCNA 1G4SA 2GVYA 2C1IA 3EX4A 3WN6A 3W2NA 4QG6A 1RM6B 5ECUA 3H70A 4L1GA 4H4TA 3II4A 3WLOA 4TV6A 1NHRA 1XUUA 4GVHA 2VR2A 4MVAA 3HPSA 3FY1A 3D46A 4TTGA 3VAVA 1NIUA 5IFTA 3RX4A 3LN3A 2NW0A 3A7AA 3S5NA 1VENA 1MO0A 4HHHA 3TR2A 3AMDA 3TH6A 4YLWA 2OLHA 1P5BA 1OFQA 1ZY9A 3DFYA 3EOEA 4H2HA 4KRZA 4Y9MA 3VE7A 3SSJA 4S38A 1OX5A 1VLIA 1DJXA 1KCXA 3WF3A 1H2JA 1POKA 5CC5A 4P7QA 2QGYA 3MU7A 1SU5A 3SGZA 1BTCA 4FS9A 4BJHA 2ZYFA 3ZFHA 3RPDA 2QUUA 2TYSA 5GVJA 5C6MA 4JOMA 3QQ1A 3R12A 1VIWA 4S3JA 4YVVA 3STCA 3LBCA 1SR0A 3MZNA 2B31A 4GINA 4Q4OA 3W7MA 1EC9A 4GJ1A 4FLQA 3T9PA 3LYEA 2XFYA 1W9PA 3TTOA 2R1MA 1UH4A 3AIWA 4Q4PA 4ICNA 3JR2A 3E2SA 4AZBA 4JHMA 1A5KC 4AYSA 4A3YA 4MNLA 4UMBA 4W9TA 4UIOA 1UZDA 5LXEA 1PS9A 4Z2LA 4GXPA 2HRWA 5A6JA 2O9TA 2PRMA 3M0KA 3ALGA 3LXBA 5C9UA 1GKQA 5DFAA 4IIDA 1P0EA 1KBLA 3TYZA 2VRKA 1SM9A 3PB0A 1TQXA 3IRSA 3SQPA 3EPNA 1CT5A 2VENA 4XAFA 1R9XA 3ZWTA 1R3TA 2JIEA 3OLGA 4DELA 4YYCA 4PRRA 1G01A 4NZCA 4XO6A 4UMCA 2OG9A 1DWIM 3CLWA 1A49A 3DHPA 4HMNA 4E2OA 1JUEA 1MRAA 1EC7A 3VA8A 3WBAA 1JZ7A 4FZIA 2I56A 2WZHA 3SRKA 5H8PA 3FS2A 2IPWA 5C9RA 1GOIA 3IIOA 3EX1A 3A64A 4H7VA 3MMTA 1K8CA 1T99A 1C93A 3GTXA 4M5PA 1VC4A 2DORA 1K77A 3HGOA 2VX7A 1WPCA 5D33A 4XVDA 4IX0A 4LAUA 3NPUA 4ZE5A 5DLCA 3RO6A 4O12A 1XSJA 4HSOA 5DEZA 2PDIA 3EMZA 1S2VA 2GR1A 2XN1A 4Q32A 4JTEA 3QV9A 4PMYA 5AYYA 1DIDA 1H7WA 1L6SA 4GVIA 9RUBA 2WVSA 3RMJA 5HJXA 3UP8A 1AZ1A 4UTMA 4NAEA 1AMKA 3SSZA 2IPFA 4KF1A 2PRLA 3VDGA 2XGBA 4XK2A 2PU1A 4P8UA 4C5YA 2HSAA 4I5XA 4JNYA 1E56A 4CCCA 5J04A 1QAPA 1B3XA 4LB3A 2CBUA 1V0NA 1EP2A 1H1NA 3DU0A 1LF1A 1EJSC 1ZS2A 3L66A 3TW7A 2NUWA 1GEQA 4JTHA 1XD0A 1LBLA 2C3DA 3GW3A 3RPTA 2X8GA 1H4PA 3NM1A 3LCHA 2EAWA 3NO5A 4HZMA 4ZODA 1GOWA 3T07A 4LOCA 4I3GA 3ZQ9A 3EOLA 1O5RA 3WK1A 3A4AA 1GUVA 3M47A 4DO5A 4F0KA 4KKXA 3HJZA 5CC7A 1N5WC 3UNDA 3CUZA 4TQTA 3KRUA 3VM5A 1BWVA 3ABRA 4US6A 5DBUA 3GKAA 1P43A 1Q8AA 3FG2P 1RA5A 1VIZA 4TR9A 3T42A 3WUBA 2VTFA 4E8CA 1HJWA 1M53A 2QJMA 1MNZA 2Z24A 4Q6JA 5CPSA 4W8LA 3NRZB 2GR3A 4FIRA 1C7SA 4IP4A 1BPLB 4UUIA 4H4XA 4W87A 5ABGA 3S83A 3AXIA 1GGOA 3P8JA 3CZEA 1W2VA 5B80A 4O0QA 2AAMA 4HB7A 3W7EA 4D8AA 5AY7A 4E4FA 1UUOA 4H4WA 5BOOA 1IIHA 2PEVA 3BMVA 8TIMA 3T0DA 3H26A 3GH7A 1WDRA 2OEMA 3COTA 3MKKA 3CZJA 2J4GA 3U2ZA 4KCTA 2ZTKA 1THFD 3KVJA 3MQTA 3LTPA 4ZB5A 4HU4A 4ICCX 4IQDA 1VFSA 3D3FA 3DN5A 2PTZA 1OCJA 2A3CA 4DIAA 1GPFA 1F61A 3H24A 1AQHA 5I3IA 3V0SA 2ZBTA 2CLMA 2CNCA 2PB1A 2PD9A 1SO5A 3G1RA 2J7BA 1AW5A 4PBGA 1AOGA 2C19A 4Q8WA 1KM4A 1HP4A 3AIRA 1JUKA 4ZXLA 3KS6A 3ME3A 4DZAA 1FRBA 1KXHA 5DN1A 5GJMA 2ZKMX 4IMFA 1S5TA 5BOFA 3M5VA 3USBA 2BVTA 3BPWA 1IGWA 2R9ZA 5FF3A 3ITXA 3O0KA 3CPUA 3L8KA 3ZIZA 3AU2A 3UJEA 2XH4A 4HA3A 1B5TA 1DWHM 2J25A 1FX6A 3EX2A 5A1AA 4A6GA 2ASHA 1LTDA 3R6IA 4MWAA 1I9CB 1M68A 4KWSA 4AX6A 5KZMA 1SJBA 4BWLA 3SIMA 5CPQA 3BLEA 4UTWA 2HK0A 3QGVA