4E4FA

Crystal structure of enolase pc1_0802 (target efi-502240) from pectobacterium carotovorum subsp. carotovorum pc1
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
405
structure length
386
Chain Sequence
b'SMKIVSAEVFVTCPGRNFVTLKITTDSGLTGLGDATLNGRELPVASYLNDHVCPQLIGRDAHQIEDIWQYFYKGAYWRRGPVTMSAISAVDMALWDIKAKAANMPLYQLLGGASRTGVMVYCHTTGHSIDEVLDDYAKHRDQGFKAIRVQCEPATKGSLPEEQLWSTEKYLDFTPKLFEAVRDKFGFNEHLLHDMHHRLTPIEAARFGKSVEDYRLFWMEDPTPAENQACFRLIRQHTVTPIAVGEVFNSIWDCKQLIEEQLIDYIRTTITHAGGITGMRRIADFASLYQVRTGSHGPSDLSPICMAAALHFDLWVPNFGVQEYMGYSEQMLEVFPHSWTFDNGYMHPGEKPGLGIEFDEKLAAKYPYDPAYLPVARLEDGTLWNW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANNONATE DEHYDRATASE
publication title Crystal structure of ENOLASE PC1_0802 from Pectobacterium carotovorum
rcsb
source organism Pectobacterium carotovorum subsp. carotovorum
molecule tags Isomerase
total genus 138
structure length 386
sequence length 405
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2012-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4e4fA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4e4fA01
4GYPC 4ZA0A 1TKKA 3NXLA 3NFUA 3SN1A 2ZC8A 4IZGA 2RDXA 1MRAA 4IL2A 1L8PA 2AKMA 4HNLA 4GISA 4DWDA 4ENLA 3CT2A 3CXOA 1MDRA 3D46A 1JPMA 3RRAA 3VCCA 2PTWA 3DERA 3V5CA 3I4KA 3TOYA 2DW6A 3U9IA 4MGGA 3V5FA 2AL2B 2O56A 3MUCA 3N6JA 3V3WA 2PP0A 3GY1A 1SJAA 4KPLA 3TW9A 2OZ8A 3MQTA 2GL5A 3KUMA 2ONEA 2GSHA 4HNCA 3CYJA 1YEYA 2HXTA 4E4UA 2PP3A 3FYYA 2P8CA 3S5SA 3RITA 4E5TA 3DIPA 4J3ZA 5BOFA 3ES8A 3B97A 1SJBA 1ECQA 5FJUA 2HZGA 3OP2A 1JPDX 2I5QA 3H8AA 2GGGA 2GGIA 5FJPA 2P8BA 3SN0A 4X2PA 3TQPA 3GO2A 5FJOA 1W6TA 1MUCA 2XH0A 2OVLA 3ZVIA 1MDLA 3N4EA 1ELSA 3SSZA 2OKTA 3BJSA 1KCZA 4Z17A 4GGHA 2PSNA 3OZYA 4EWJA 2XH7A 4IT1A 3ZLFA 3FCPA 2OQHA 4MMWA 4A3RA 1JDFA 3RO6A 3TWAA 3SJNA 3TJIA 2MUCA 4ZCWA 3VA8A 3GD6A 4IL0A 2OX4A 2PU0A 2CHRA 2QQ6A 4GGBA 2QGYA 4DYEA 3UJFA 3DESA 4A6GA 2XH2A 3N6HA 3ZLGA 3PWIA 4J1OA 4JHMA 3THUA 4IP4A 1MNSA 1DTNA 2PTXA 3NO1A 3UJEA 2XSXA 2AL1A 3QLDA 3TCSA 3FXGA 2PTZA 3OTRA 3ES7A 3STPA 3GC2A 4H1ZA 2OZTA 6ENLA 3S47A 4KT2A 2AKZA 2XH4A 3MWCA 3ZVHA 2PPGA 3D47A 4KWSA 4GYPA 2GGEA 3V4BA 1EC8A 3K1GA 3MSYA 3RGTA 4MKSA 3MKCA 4DX3A 3ZLHA 5FJRA 1IYXA 3I6EA 4IHCA 1NU5A 7ENLA 1BKHA 2DW7A 1XS2A 4H19A 4F4RA 3EKGA 3UXLA 3DGBA 2GGJA 2HNEA 1WUFA 1OEPA 2QJJA 3UXKA 3DFYA 3TJ4A 1PDYA 3PWGA 3FJ4A 3DEQA 4H83A 3P3BA 3R0KA 3P0WA 3T9PA 1F9CA 3Q45A 4JN7A 2MNRA 3RCYA 1XPYA 4G7FA 3IJQA 1TE6A 4K2SA 1R6WA 3H12A 4HCHA 4HCLA 3PK7A 4H2HA 4ROPA 1KKOA 5EU9A 1JCTA 2QDDA 3FV9A 1SJDA 1EBGA 3U4FA 1P48A 5J04A 2OZ3A 2P88A 2OO6A 3QPEA 3T6CA 4DHGA 3PFRA 4M6UA 3OZMA 3TWBA 3VCNA 4DXKA 3IJIA 2GDQA 2P0IA 4G8TA 4E6MA 1KKRA 2NQLA 3I6TA 4K8GA 5FJTA 3DDMA 1EBHA 2ZADA 3VFCA 3R25A 2QDEA 3SQSA 3DG7A 3MY9A 5IDZA 2QVHA 4E8GA 4HYRA 5ENLA 4DN1A 3VDGA 1TZZA 2QJMA 2AL2A 2OLAA 1FHVA 3MZNA 1NELA 4HCDA 1EC9A 3UJRA 4GFIA 3QKEA 3N4FA 3QN3A 4GIRA 4FI4A 3JVAA 2XGZA 3IJLA 4HN8A 2QJNA 2PP1A 3UCCA 3H70A 3TTEA 2PGWA 3NZGA 3FVDA 3SN4A 3Q4DA 1WUEA 4K1WA 3ZVHB 2OFJA 3JW7A 4FP1A 3UJ2A 3OW1A 3T8QA 4KEMA 4GMEA 2OQYA 3SBFA 3DG3A 3HPFA 3R11A 3CK5A 1SJCA 1PDZA 3VC5A 2OG9A 2PTYA 3CAWA 3UJSA 1BQGA 1R0MA 2FYMA 3ENLA 2OPJA 1ONEA 5BOEA 2PS2A 1KD0A 3UGVA 2POZA 3RR1A 3R10A 4YWSA 1EC7A 3DFHA 2GGHA 4JN8A 3JZUA 2P3ZA 3BOXA 3P93A 2PODA 3QTPA 4HPNA 3BSMA 4M0XA 2PA6A 3R0UA 4E4FA 2PU1A 1P43A 1E9IA 3T4WA 4IP5A 3EEZA 3VC6A 1FHUA 1RVKA 2HXUA 3OPSA 3CB3A 3H7VA 3UCDA 2PMQA 3R1ZA 3IK4A 4A35A 2PCEA 2PGEA 4Z1YA 2FKPA 3DG6A
chains in the Genus database with same CATH superfamily
4W84A 4LB4A 2BDQA 3PUOA 4IXXA 4CD6A 3A3XA 4C5YA 1YADA 1FDYA 2CLHA 1V3JA 1OCQA 2PDHA 4D6HA 3WLNA 8XIMA 2HBVA 4H7VA 1Q66A 2QCNA 4DWDA 4ES4A 4DJDC 4X60A 2E6AA 2V38A 3HQOA 1V51A 3KZSA 3VM5A 4Q7IA 2DEPA 3ZO9A 2GDUA 5FF3A 3M0VA 3R13A 1YRRA 1KQYA 2RJHA 1PE1A 5I3FA 4ZTXA 2GQWA 2WMIA 3UW6A 3VUPA 3SCQA 2UY5A 4GRTA 4Q8QA 3MUCA 2GPTA 2HJPA 3PAJA 4C90A 4W89A 1VEOA 3L68A 4KPLA 4FNTA 2EPLX 2BXZA 2GSJA 2VRJA 2PTDA 2XVGA 4AW7A 2Z24A 1M03A 4DF0A 2PLJA 1W9UA 2INFA 4HNCA 1BG9A 2V67A 5ABTA 1BAGA 2EPOA 1WOAA 3AWOA 3I7SA 2OKOA 5KVIA 4YYFA 3PBUA 4JIPA 5G1MA 1YBQA 3GIQA 3LLDA 3LZ5A 4S3AA 3RCNA 3RITA 3TJXA 5C55A 1SO4A 2Y7FA 3Q58A 3ES8A 3N6QA 4UTFA 2TMDA 3C2VA 1XIEA 4M5PA 2ODOA 3VPLA 2HZGA 2VX6A 1K4GA 4XZWA 3ZIZA 3LXDA 2D0HA 3AXIA 4CGTA 3THQA 5AYIA 2P8BA 2QCEA 3N2MA 5FI8A 3GXDA 2QV5A 2XSAA 1OX4A 2QULA 2ZZ0A 4XKYA 3BQ5A 1GQJA 3FDGA 6XIAA 3RPDA 2Y8UA 1MUCA 4J3TA 3W85A 2YBVA 1UC4A 1X97A 1OHLA 3T2QA 3GR4A 3G22A 2XH0A 4AXKA 3AAMA 2YVJA 5JH1A 3GYEA 5A3HA 1B2YA 1E0WA 4LYKA 1XD1A 2E7FA 3QR1A 3BLOA 3LM3A 2PSNA 3LD5A 3PZVA 2H8ZA 3R0DA 5D9PA 2NX9A 1XSIA 3HTWA 3AXMA 4IFKB 2BBFA 3TJIA 1C9WA 5E6ZA 1ZDLA 3EYPA 3A4XA 5F1UA 3HG4A 4MWAD 4GGBA 4AYSA 3Q67A 4H8UA 2YDAA 4A6GA 1XKYA 3NGJA 1Z3NA 3SUTA 2OX1A 1GG1A 4X2RA 4I90A 5DBTA 1H0GA 4NAEA 3QH2A 2VEKA 1FWEC 4PUKA 1W3IA 4ZQNA 3URAA 2J7GA 1C29A 2CKRA 3DHUA 1E9ZB 1XGDA 1OG6A 2ISSA 1X7FA 3CPGA 5JVLA 2NPXA 3L4YA 1UWQA 2AAMA 1GYNA 4LAUA 2PDXA 1Q7QA 2ZX6A 2A7PA 3BZJA 2C3DA 1LVLA 2XSBA 4PODA 5AZ0A 5A8GA 2GVYA 3WSUA 1ISXA 3DHFA 3E5BA 3SSJA 1DXIA 5EBKA 3AOFA 1HN1A 3C8NA 3E49A 2NVAA 1PUDA 4KIRA 4O1CA 5EPDA 1EC8A 1H7PA 2O4MA 3QFEA 3TYBA 4WUIA 5FJRA 2PDFA 4H6EA 4AX7A 3VKJA 1PHQA 1WE5A 2C1IA 4X61A 1A3WA 3P81A 1WDWA 3FIGA 3IRDA 8XIAA 3O0FA 1VIZA 2Q8XA 2WP6A 3SIMA 4OGZA 3C2OA 2E40A 4MB3A 2WZIA 2IQ0A 3I3EA 5E70A 3V1HA 1KM3A 1OC7A 5EMYA 3B8SA 4MJ4A 1SZEA 3NQAA 2PUZA 1NOUA 4I8YA 3RCYA 2G8ZA 3T08A 1XPYA 1PYMA 5HK4A 1K7FA 5C54A 2C8NA 3B3DA 4AHPA 3R94A 1XM3A 2R6OA 4ROPA 1HGYA 2VEFA 1SJDA 5I3IA 3EPOA 4RPQA 2C1GA 1QNOA 1TWIA 4GQBA 2X8RA 1GQNA 5GVJA 1AOGA 3DHPA 3WLMA 3G1YA 5AC8A 3OZMA 4UTMA 1NFBA 3WIJA 2CZDA 3L2MA 1U1HA 1OQFA 4JDYA 3WQCA 2QHAA 4FS9A 5I5RA 5FMHA 3GHTA 4CEUC 2Z1VA 3GNXA 1J0HA 1RXOB 4WSJA 5JH2A 4J40A 2UY4A 4P8UA 1G7UA 4GKLA 4OVXA 3V75A 1OIMA 2WMKA 3GVGA 3JR2A 3IANA 1ZTVA 2BVWA 2YXGA 3LHWA 2YL6A 3GZAA 5CZ0A 3N18A 3V0UA 1FH9A 3SAZA 3AMZA 2YSWA 3A9IA 1LG1A 3VGHA 3CGBA 2A3EA 3LB0A 2YIHA 3EXSA 4MZ1A 2FMOA 2Q01A 1UCWA 3T55A 2PWDA 1R8LA 5MHBA 1JZ3A 2DJXA 1K8ZA 3Q37A 4NJJA 1KFWA 3TR9A 4UNIA 3W02A 4HJWA 4F0LA 2OO0A 3M5XA 3GFXA 1M41A 4LAZA 1MQPA 1AL8A 4AD4A 3HN3A 4JIIX 3WUGA 3KOWA 1RCQA 4H04A 3ATZA 3N11A 2D2OA 1HKIA 3ALFA 3VFLA 1VFTA 1CGVA 1VDVA 2E68A 7TAAA 4INFA 2WKLA 1KGXA 1EHNA 3U3HA 1ISWA 1WV2A 2POTA 3UG4A 3E2VA 3H2FA 3P67A 4YU1A 4XZIA 3I4EA 2DUZA 3ERPA 4FDCB 1GWJA 1ZB5A 3NRZB 1JD9A 3WNPA 3NS1B 3KAOA 2VFHA 1ZENA 3GG7A 1GERA 1WBHA 3MUXA 1RQBA 3FW6A 3C0LA 4DVOA 1BFNA 5D38A 3CHVA 3LLFA 4HKPA 4C91A 4O4WA 3IK4A 4A35A 5FS9A 3CH0A 1BTCA 1DV7A 3CZLA 3WLIA 4Z1YA 1H7NA 2FKPA 4HYWA 1AUSL 3EDDA 3ARXA 3DFSA 4U2ZA 1XUUA 3N25A 4TU1A 3UA4A 1NEYA 5MKGB 1YTDA 1JRCA 1P7TA 1MW3A 4AZ6A 4LY4A 1EX1A 1MUMA 4BQ4A 1QUMA 3UY8A 4AFYA 1TTQA 1MDRA 2QCLA 2VX4A 4AXNA 2WPFA 3PPCA 5HMSA 5DF0A 5A2BA 4RKAA 1QHZA 2V30A 2YAUA 3SJ3A 1ITXA 3CJPA 3TOYA 1W3KA 1XPGA 2I14A 1R3VA 3A4JA 2DP3A 2DT1A 2JKPA 4ICNA 3AIRA 3NIYA 4DPQA 2WOQA 5ECUA 2HS6A 1FXPA 3MBDA 4H4XA 4LBRA 4AD2A 4LCQA 4XBSA 3BO9A 2Z25A 4S39A 4CCZA 4H4ZA 4MJZA 1VKFA 4AC7C 2ZKMX 3DIPA 1K8YA 1S3TC 1D8WA 3TK7A 1VBRA 1UOZA 1GG0A 1KCXA 5CZJA 1RQHA 1J12A 3DOPA 4Q8TA 1Q1WA 1CGYA 3F4WA 2AQVA 4YWOA 2W9MA 1FTXA 4JTCA 4AISA 1L8NA 3UY7A 4DJEA 3KCOA 3SIZA 1B3OA 1SUXA 3WX7A 2FZMA 4LT9A 1G7VA 2H9AB 4QGCA 2J77A 2TRSA 1VP5A 3I7RA 2JKAA 1F07A 5AVNA 1B9BA 4IJBA 3S5YA 1XLBA 1KCZA 2JALA 3HMCA 4PMRA 3W22A 1XWYA 3GXNA 3SQMA 2NW0A 5FS8A 5AHFA 1R87A 1DOSA 2HK0A 1IWPA 3TOPA 1EWDA 3OVPA 4B16A 3WBXA 4H00A 3G1XA 5A1AA 4H4WA 3RFAA 3PZQA 2D2HA 3LPGA 5H91A 1QW7A 4NZJA 4M82A 1R7OA 3AS2A 1B3VA 2QQ6A 1F73A 2QGYA 1OJXA 5I3GA 4C65A 1YLVA 1EJ7L 2X99A 2XH2A 2CU0A 2Y4SA 1FEAA 1VEMA 3PWIA 2A2IA 4W4QA 4IPJA 4DELA 5C7HA 4LVAA 1PZ2A 4DWSB 4GABA 5TD4A 2R91A 1M6JA 2VM8A 2R1LA 2REQB 2V3FA 3USZA 4K39A 6ENLA 1I6NA 4KT2A 1JCMP 3MBFA 1ZHAA 2HNHA 1B4EA 4ATDA 1Q6LA 3WLKX 4XTIA 3SGUA 1FWSA 3HURA 1XG3A 4WIWA 4XUYA 1K70A 3VMOA 4F0KA 2D2JA 3RLHA 5TQLA 1AW1A 1E0XA 1GVFA 4UQBA 4JY8A 1H61A 1PTAA 1BKHA 3WQGA 2F6KA 3LENA 1XS2A 2WZMA 2DT3A 3O6DA 4ATWA 3DGBA 2E3ZA 1RJPA 4C6FA 1A5LC 4AD1A 3CL7A 4S2CA 1G6CA 1PIGA 2DT2A 2GK1A 4PSRA 1FO4A 1K4QA 2OLHA 4EANA 5HA7A 2HS8A 3MP4A 1M04A 1TB3A 3HW2A 3W72A 1K8XA 4GY1A 1UKOA 5I00A 2W0UA 1XC4A 3F5KA 1FWFC 3VIGA 4GY0A 4WSKA 4H2HA 1Q85A 4W5UA 3SRFA 3KOFA 1CXKA 1ZBWA 2BP1A 3LSBA 3HG3A 1KM4A 2V8ZA 4HPJA 3H26A 2WOVA 3LLXA 3P61A 2B7QA 1SO6A 4GC3A 4GK8A 1J5TA 3VKBA 1R5YA 2JIEA 1D3HA 3U48A 4TXEA 1KKRA 3P84A 4ZODA 2O9RA 1CIUA 2VZTA 5IRPA 1EJUC 4K8GA 5FJTA 3R25A 3LHYA 1JDCA 1XICA 3N3TA 4QISA 2BC0A 1YDOA 4KCUA 3W6MA 2EQ7A 6REQA 2XFWA 3TQ0A 4UFJA 2QUNA 1IR2A 4JGDA 2J6VA 2DVUA 3RLGA 1JPHA 4UMAA 4RV3A 4JHOA 1GOOA 3MC5A 3ARSA 4JOMA 3UPWA 2FDSA 3RK8A 3W7GA 4M56A 1TPB1 2FFIA 3JVAA 1FECA 2XGZA 4FALA 2FZNA 3GBDA 4JFTA 1FWDC 1U30A 1E4LA 3UPMA 1I2PA 4UB9A 4Q22A 4JIQA 3KBVA 1V79A 1DHPA 3OW1A 3MSGA 4IIBA 4QLKA 4LUIA 4ZQRA 4REQB 1LT7A 4LS0A 4HSNA 3FEMA 3L67A 1F7BA 1VIWA 4JN6A 2OYLA 3BVJA 2CLPA 3W2UA 2F2KA 3W1AA 1AW5A 4DYKA 1TE1A 4GHRA 1GOQA 3SEPA 4K6AA 1JAKA 1RD6A 4B4HA 3S2NA 3QTPA 1KN0A 3EEGA 3PZMA 1KR0A 2PA6A 2WC4A 1H0IA 3FOKA 3E38A 3VNLA 1GESA 5C9RA 1WZKA 4JFUA 5HJXA 1H1YA 5CPSA 3EOEA 4TMCA 1SM9A 4JKKA 2BSLA 1JI1A 4BY3A 4WVXA 2PGEA 3VNYA 4LC6A 4JAWA 5AC6A 2YCKX 1UBPC 1W37A 3KTXA 1DEDA 1IHIA 3A21A 3VABA 3TSDA 2J9ZA 1XGZA 5E1QA 1OX5A 1IWBA 3RU6A 4FO4A 1GVQA 4PFHA 4KEVA 3QSTA 1RVGA 1ZCOA 1XLLA 1X1NA 2WPEA 1EH9A 1A49A 4HU0A 2ZRZA 3DK4A 1MUWA 4KFPA 1MRQA 3BAKA 5T9CE 1DJZA 2ISVA 3NYZA 4Z42C 3MUIA 4EQWA 2CZ5A 4YN5A 1KFEA 5C2GA 3NQ7A 4FNRA 4MTVA 4KRZA 5C2XA 3TN3A 2NXGA 1RUSA 4PTXA 3NQGA 4D72A 4PC8A 3TZNA 5DFAA 3LN3A 1KFCA 5KZEA 5BXTA 1LQ2A 3PPHA 3VE9A 3L4UA 3ANUA 4KKXA 4E3VA 4L7ZA 1Q13A 1L6FA 3TYDA 1ECEA 1TVPA 4GZJA 2E8ZA 1SJBA 4XBKA 1JXKA 4UR9A 3A6OA 2F61A 3NQ2A 5LXXA 2RGLA 2WCAA 1US0A 3GTIA 3QYSA 2QJIA 3KVMA 3JRKA 3B06A 9XIMA 5HQMA 2D3LA 3KDOA 3HOJA 4B5SA 2JEQA 4JPGA 4H4SA 3UA3A 3SCOA 1JG9A 1EQPA 2O9TA 1TPDA 1TPUA 1RM6B 4EPKA 4HNNA 3LGDA 1U5VA 4F40A 4AG0A 3OQEA 2OKTA 1TPVA 3G1AA 2CLEA 8CGTA 2WANA 4WJEA 2ISFA 4OKDA 5LIUX 2RKXA 4RZBA 3TJLA 2DQXA 1IEQA 1Z44A 5G4HC 2TODA 4A3RA 2ZICA 1TR9A 3HGSA 1C8YA 4OWGA 2OGJA 3KFTA 2OYKA 2QCCA 4LB3A 3T4CA 4O10A 5HWNA 3UPBA 3N34A 5CJMA 1IT8A 3QR0A 2E6YA 2P76A 1OY0A 3A22A 5ECVA 4J35A 2CLMA 2PDYA 3N9RA 3HRDC 4MDOA 3ORWA 3BV7A 2ZX5A 1OFAA 4C6MA 4WDXA 2OXNA 4EOUA 3LXBA 4RLIA 2PDPA 3NGFA 1A4MA 3NEVA 3T7VA 3WJWA 3WBAA 1NFPA 2BGSA 3CZGA 3TCSA 4WZHA 1HP5A 2AQOA 3KRUA 3VDCA 2VFEA 2OZTA 3CZKA 3N2CA 4PCSA 1C90A 4E38A 1OCNA 1QW9A 3LI0A 4DI8A 3W1RA 3GIYA 2F5ZA 1O4UA 1XYFA 4PMZA 3RUBL 5IFTA 1LLZA 1KLZA 5CJNA 4MKSA 1WB0A 4NAFB 3DFTA 5DMNA 4FK9A 3W7EA 3ZT6A 1Y5XA 3R07C 3I6EA 5G5IA 2YCLB 4XIMA 1SFLA 4F4RA 1L6GA 1XYZA 4Q4RA 2D0FA 3GVRA 3AMLA 1MW0A 3FJ4A 3GUWA 3M5YA 3KEHA 1FDZA 1FP9A 2QUMA 2V81A 3NR0A 1YDYA 3MKVA 2ZRXA 4AMCA 4K2SA 4QG8A 4DWSD 1R2TA 2ZZCA 3QFAA 1S1PA 5JBFA 4HCLA 3NO3A 3PK7A 4LVGA 5BWAA 3LRLA 3F4CA 4Z1DA 4NILA 2IW0A 1F3TA 2JGQA 4PFMA 4AY7A 3VGEA 2GJRA 3OZOA 1ME9A 3LI1A 4AMAA 2DSZA 2OWWA 1P48A 2CDUA 1XQLA 3KRZA 3LCHA 1TTPA 2CBVA 2BOFX 4ZFCA 4DXKA 4QSFA 3FJLA 3LTPA 3W1TA 3WKZA 2VEIA 1N7KA 1UD4A 1WNOA 4LUSB 2DUAA 1NFGA 1TMLA 1ZMCA 1BGAA 4BQ5A 4S38A 5F4WA 1L0PA 1MSSA 4QS6A 3EMZA 4GO8A 1KM2A 3CUHA 1XI3A 3CNYA 7XIMA 3QSRA 1K9EA 2DSWA 1LRNA 4DJEC 1TELA 3UBPC 3QKEA 1TV7A 1FQ0A 3IUHA 3O9NA 2HVNA 3B9DA 1GREA 1WP6A 3IJLA 2PP1A 2XYLA 3I10A 2FPVA 1DORA 1W3HA 4EPDC 3ITYA 2CXEA 3QC0A 1IIGA 3WLPA 3CEUA 4GMEA 4BR1A 4GYJA 2QW5A 1NWUA 3EOUA 3URQA 2G3NA 1GSNA 1ZX9A 4JTGA 3VOCA 3TTYA 1AMYA 5HWMA 1KO0A 4X3ZA 2IKHA 3UFYA 1J2WA 2W3SA 5CPMA 4UQEA 3G1SA 1VYRA 4CLMA 2OPJA 4IX2A 1G67A 4PMOA 1KD0A 3PNUA 3A9BA 3CGEA 3SCPA 3N19B 3MSRA 1ZL1A 1UR4A 5U1OA 4LVFA 4OOZA 1IQ8A 4H4IA 1HG3A 4PL2A 1EPVA 4IP5A 4D1IA 3DKJA 4M24A 4KWWA 1E0VA 1ALDA 1FEBA 3G18A 2Y63A 1V97A 1AJ2A 1STZA 2D23A 5ABFA 1PKNA 3CB3A 3MJYA 3I68A 2GLKA 4H4PA 4K3ZA 2R1KA 1X7IA 3O6YX 3UZXA 1OZMA 3G77A 1Q5MA 2DPEA 1Y65A 3NZPA 2FVMA 1ZXIC 4CNPA 1M5WA 1PAMA 4B9ZA 4UTHA 4LV4A 3LZ3A 3EWZA 4GQQA 4O28A 4Q6XA 4R5EA 4V1YA 2E5BA 4RJEA 4YLWA 1IEXA 2NSXA 1Q4WA 1OFQA 2CLOA 1GGOA 3H2NA 2DZUA 1EDGA 1BVNP 1H5VA 4G1NA 4W8BA 1O68A 1EP2A 5AHLA 2HBXA 2O92A 3LCLA 4XZMX 2W63A 2X1IA 4BQ2A 4CCEA 2QF8A 1UUMA 4E8CA 4Q8MA 4KEUA 3RX4A 1HZYA 4QE5A 4O1BA 4XG1A 4UFLA 1JUEA 2WVTA 4EQRA 1Q63A 3WQFA 3VO0A 3VI2A 4US5D 3Q6JA 3MSDA 4XKMA 5CSUA 1YEYA 1DXLA 1W1ZA 1XINA 4UTJA 2IPFA 4IMGA 1BVWA 3S1UA 3KS6A 5F2GA 1BKSA 3NDYA 4MAZA 1Z9AA 4M1BA 3QQ1A 4FSAA 2G97A 1GT8A 4PTNA 3R8HA 4AUBA 3OLIA 1UR1A 2XIBA 2GGIA 5FJPA 2XN2A 3C2FA 5M5DA 3B0VC 3TR2A 1VFUA 1NH6A 2RJGA 1XRVA 3VZZA 4FX6M 2OB3A 3SO7A 1KXVA 4NRRA 2ZFAA 1AD4A 3W84A 2IKGA 3NVYB 4N02A 1EX5A 4HNTA 3HPZA 4RE4A 1UA7A 1XRFA 3V36A 4JNYA 4AZHA 3LB8A 3ZVIA 3BZGA 3F2CA 4MHBA 5FEWA 3SSZA 3GTXA 3LXCA 1R85A 1GVSA 4M1RA 3VX1A 4J3SA 1HJSA 5I7GA 3VIOA 4RNJA 1H4PA 1WKFA 1O1ZA 2PBOA 3SECA 3QPZA 3SI9A 3OLDA 1H6VA 3NEHA 2QUTA 3GM8A 4RUBA 3CQIA 4BCEA 3VIKA 4PBFA 2OX4A 3SCUA 5B7YA 4P2VA 3VKKA 1ZU8A 5AVHA 4DYEA 3EAUA 4KFNA 5KZ6A 4DBEA 4F9JA 3ZLGA 5CC7A 2I5IA 5EMMA 5CPQA 4AVOA 1HF6A 3DFQA 1K6WA 2DZSA 4JD4A 1G94A 3BG9A 5JIWA 1VFOA 5G4WA 1WDSA 2VNCA 4O16A 3VZXA 4TUFA 4GI8A 3KVJA 3UWZA 3F2BA 3S5NA 1Q8JA 5FL1A 4JQ3A 1EP1A 2PAJA 1SYTA 4Q7BA 3H7UA 3W53A 1NIUA 5D2XA 2W0HA 4LANA 2P0OA 2ZUSA 1J93A 5J5RA 2BY3A 2PFHA 4WLCA 1LL6A 2VFDA 1DNCA 7ODCA 3RJYA 1VJIA 1F76A 3QMTA 4IJRA 3QJAA 3M4HA 1O1HA 1JZ4A 3LGEA 4ATLA 2DY3A 4I9JA 3VNMA 2QJJA 4LS1A 1KB3A 1UKTA 1US3A 4JBRA 4S23A 3TJ4A 2DORA 2WZHA 5A94A 1J5SA 5EMKA 1TX2A 4KGJA 2X30A 3P0WA 4LF2A 3XIMA 1XCWA 1XH2A 1X96A 1EOKA 1S38A 4FXSA 2GOUA 1XR2A 1TE6A 2WPGA 1TCMA 1M9HA 5D02A 3LU2A 3VIJA 3W86A 5I3HA 1UIOA 2YBUA 2J66A 3NPWA 2PI6A 4S3FA 4AU0A 3LTSA 5DRCA 1F05A 1QJWA 3RNMA 1XCXA 1RALA 4D6FA 5AY7A 3H7RA 1QDSA 1DJGA 1XLKA 1JPKA 2VR2A 1VLWA 1DTUA 4G8TA 1W8GA 3MV11 3WDIA 4LVBA 3CGCA 3GZ3A 3EX3A 1GVIA 1FWRA 3LERA 2QNEA 3DDMA 3QOMA 2G0WA 1M7OA 4M80A 1TO3A 4L5ZA 1T0OA 2QGHA 1IEIA 2RFGA 3GDBA 5DELA 4RZ5A 5ENLA 3W2LA 3S4TA 3REQA 4UIOA 4QDMA 3TN5A 3WFLA 1EBDA 4X63A 4I7WA 4AY8A 1CTNA 4Y2WA 3WQ8A 3GXTA 1E0TA 2PWUA 3CV7A 2BLEA 3B03A 3GVVA 3VAVA 3EPMA 4UNLA 3VGBA 4YTUA 2V3DA 3MI6A 1DKWA 2UY3A 1TWDA 3L66A 1KFJA 1A5UA 3W75A 4EMJA 2YDSA 1KBIA 2J25A 4GIEA 3GH7A 2EPKX 3IGHX 3WH9A 3ID7A 4M51A 4RE2A 1EO5A 5AN7A 4XAFA 1N8FA 2IQTA 4MWAA 4DNHA 1AH0A 1QW8A 1RLCL 3GTFA 1ONEA 2PS2A 3UGVA 4OUIA 2BGQA 1VFMA 3KLLA 4HTBA 2Y88A 2NVKX 3G2GA 2VDIA 1D9EA 4FMVA 2YX0A 1RP9A 3N2OA 5CJ5A 3CUZA 4GA8A 4NUWA 1H2IA 3PVFA 3EEZA 3HU7A 1FHUA 3VC6A 4CD5A 4IOTA 3DC0A 1IR1A 2QMKA 1Q7ZA 4JTTA 1BG4A 4IGSA 1YYAA 2GUUA 4AIUA 3W01A 3O1NA 2P53A 5FACA 1C8QA 3TE9A 3RJXA 4B5VA 4LUTB 1PKMA 7A3HA 1P6WA 1E9LA 4ZA0A 1GQKA 4J3UA 3R79A 5HPCA 2JK2A 1FFRA 2FVKA 3MZ2A 4UTTC 2OWXA 3S6TA 3TTOA 3WBEA 3CQJA 3IARA 3ARUA 3EXTA 4HSOA 3R89A 2JIWA 3CHFA 1C7SA 3EX4A 3W7HA 3D46A 3OIHA 2WNWA 4G5DA 1Z7AA 3MT1A 1KM1A 4N7QA 1TV8A 1ZSXA 4JX6A 1LBMA 4RDWA 3WMSA 1R3WA 1GXFA 4NEWA 4O54A 1HJWA 1KW1A 3V5CA 3CIWA 4V2XA 1UWSA 4ZO9A 4FX7A 1P0EA 1Q2SA 4R34A 1VFFA 3S5OA 4GH3A 4QR6A 1NDVA 5AC7A 4AVFA 1NP0A 2GJXB 1GHSA 4O52A 4W7UA 5LGZA 1A80A 4R7JA 2GSHA 4AZCB 3P60A 1M7JA 3U2EA 3L4ZA 1I60A 4O18A 5A6MA 3HQPA 4ZL1A 3QXBA 2X1SA 4LTSA 3UG3A 1NHRA 1QT1A 5JCIA 4OJYA 1F3WA 3NM3A 1WDQA 3L0NA 1QPKA 4FPSA 5DCEA 2VVNA 5CPOA 1QBAA 5FJUA 5EFFA 5HUPA 4A21A 4XK2A 3U2CA 3UNTA 4KRTA 4TOQA 2NV1A 1JEHA 3RXZA 1VQTA 3SDOA 1FFVC 5HNTA 3TYUA 4PUWA 4AHQA 2G3JA 4IP7A 4KS0A 4EXAA 2Z6JA 1DJQA 5LNSA 2DH2A 5HMEA 6A3HA 2WP5A 4W86A 1B57A 3O63A 4RE0A 3K1DA 5DRIA 4CCDA 2OVLA 1T7LA 4DUWA 1F2JA 1GRBA 3IV3A 2WJDA 3SRHA 4O14A 2VUNA 4YTTA 1DJIA 1YX1A 3TVAA 4EWJA 1S2VA 1YDVA 4JTQA 3TN6A 2HROA 1CI1A 4GWEA 2GWGA 1R2RA 3JS3A 2X1UA 5M3WA 4JQ2A 3W7RA 5CGQA 5HNUA 1SMAA 2DQWA 3AS3A 1LROA 3LS9A 1B30A 2VFIA 3KS5A 1C8XA 4HGXA 3BMWA 5DANA 1OIFA 3M1ZA 2R1NA 1RBAA 2Z4GA 1M53A 3FGCB 2V5CA 3CYVA 2HQAA 3AZRA 4WGXA 3UJEA 1BPLB 1R3QA 1ZY9A 3G3MA 2AL1A 4NZ4A 2GQ3A 1UC5A 1TZ9A 1E43A 1AVAA 4PB4A 1EJRC 1FUYA 2C79A 4CNOA 3FJNA 4QCEA 1OFOA 4AB4A 2VCCA 2VP8A 2ZUVA 1AK5A 4UOJA 1RV8A 3TFCA 2DVXA 5FJIA 3PJXA 1EQCA 3H55A 3RMJA 4FHAA 4S3BA 4U3CA 1N60C 1IYXA 1I8JA 5AZ1A 3TU9A 1B31A 5GQBA 2OR2A 1GRGA 1AA1B 2VC6A 4GQGA 4LBUA 1JEZA 5AYYA 3E0LA 2ZXBA 6ALDA 1GRFA 3NQVA 1W2VA 4N9DA 3WELA 2BV9A 3QOKA 3DEQA 4G1KA 3W3OA 2GOKA 4ZXLA 4F0RA 2WNQA 3P3BA 1JR1A 1UR0A 2E5CA 3TA6A 3T9PA 1HL8A 4RXFA 2G96A 2QEZA 4A05A 4G7FA 4K8EA 3M47A 3NPVA 3BSHA 4AQLA 4D8AA 3W88A 4L1XA 5GNZA 4JDRA 1UPMB 3NUKA 4LY8A 3ARYA 5REQB 3OOQA 4MLJA 3GXPA 3VDBA 1JRPA 3R58A 4WHBA 3LV5A 3URHA 1JCNA 3UR7A 3CEPA 5TNVA 1HNYA 3TSMA 1CW2A 1V02E 1LYXA 1YTEA 1SFSA 1TJ2A 1C93A 2GDQA 1N8IA 3VGDA 1OB0A 2MANA 2NQLA 1AD1A 1PXGA 4A2RA 4LOCA 5D2VA 2E1DA 2Z6IA 4ADUA 2QVHA 4H9VA 1QHOA 2BGNE 2W6RA 2UV8G 4Q6JA 3HZ3A 1Z89A 4PMQA 4AZ5A 1VFLA 2GZXA 5GNYA 2O7QA 1RAKA 5E0KA 5JQ9A 2Z29A 3B4YA 1ZBCA 4NJGA 4H6RA 2QR6A 4DZAA 4PR4A 2ZZ5A 2QLYA 2VGBA 2WQPA 2G37A 1GRAA 4TVWA 1O5KA 3M64A 3W82A 2OFJA 3VYLA 4IPIA 3O6AA 1HKVA 3BE7A 3IAQA 1BRLB 5DMLA 3W00A 4Z2JA 5CPTA 4EVZA 3M0YA 1E72M 2E67A 4TTGA 1CXEA 2BX7A 2OMAA 1I2OA 1GPFA 4RXGA 3AN1A 2ANUA 1X1ZA 3MP5A 3L5MA 1OX4B 1ICQA 2WM1A 4XKYB 2QDGA 5GJPA 3VIPA 4CQ9A 2B7OA 4HPNA 3QR3A 3SCRA 4Z2GA 4A8NA 4Q33A 2ZRYA 3N04A 5CC3A 1HJQA 3SW6A 3ZR6A 2I7GA 1FIQB 3BLIA 1KFBA 4C6PA 1NARA 3VMPA 4QM1A 1J79A 2PDCA 1HFBA 1TWWA 4LIIA 2PCEA 1KXHA 1E56A 1S2WA 2VO5A 4ZQCA 1HW6A 2OYMA 2NZLA 3HJEA 4IFKA 3SUSA 2O0TA 3QV6A 2QT3A 4HK6A 1JCJA 1QWGA 1CGUA 3NQCA 3PWAA 2XIMA 4EMWA 1RJQA 3S2JA 2PWEA 3WD4A 1P6BA 2EAWA 1UWTA 4IIFA 3C2YA 3FHQA 1BXBA 1H7RA 4IJCA 1AFSA 4PRRA 2Y89A 4QE4A 3G6LA 4GVFA 2Z27A 1EP3A 4QJ4B 5A8PA 4NAEB 3WNKA 2E77A 3DJGX 5LKYA 4QEHA 1BQCA 2BHZA 3C4UA 3IIPA 2O56A 4Q8UA 3SY1A 1RBLA 2CWNA 1V3KA 4MKNA 2J9YA 3ITCA 4A8IA 3HMJG 4CVWA 3QM3A 1G01A 4MNKA 3CC1A 2VTFA 2VOTA 3W24A 1TMQA 1ISYA 3R4IA 1G5AA 5J8LA 3RR4A 2V2DA 4H8VA 3P62A 4DQWA 1VF8A 5HBFA 4BWLC 3N13A 2WCGA 5HJYA 2W91A 1PZ0A 2D22A 2GQAA 3VOHA 1HKKA 2YXXA 5FF4A 2VGGA 2E4TA 1GW9A 1VCGA 4ZEPA 4GUHA 1ZRQA 4MKVA 4L9ZA 2Z2AA 4TVUA 4GFSA 4ZXOA 1TX0A 2I5QA 1W1YA 4J56A 3PR2A 3NQDA 2WKJA 4MB1A 4U10A 4DZHA 4EQSA 1EYWA 3GAYA 4N6EA 4CU6A 1E1CA 2DH3A 1DJHA 3UGRA 4L56A 4PRWA 4YVXA 3RCMA 5HAOA 3WL0A 5G5GB 3HGOA 5FEPA 5HPOA 2OSXA 3PC0A 1LL4A 4AH7A 1UR2A 2X41A 3GRIA 3PPGA 3FYOA 3TCEA 3EA1A 1EHAA 4QAIA 2Q3RA 5BCAA 4PTDA 2EF9A 2EG7A 3W38A 2J47A 3ARZA 2I5GA 1B90A 4PA8A 1FWBC 3UZYA 2J62A 1M6IA 1YPFA 3WDJA 3B04A 3K4DA 4QNWA 3C2RA 1F4AA 5PTDA 2XH7A 4GNVA 1TQJA 3GWQA 1BWCA 4BF7A 2TPSA 8A3HA 3FDKA 1QATA 1L2QA 5D05A 2XN1A 1V5XA 3GHUA 2VC5A 4L4OA 4MNJA 5FA5A 4EF8A 4MWAC 4J7RA 3KM8A 1JZ2A 1IIHA 3WQPA 2NWRA 4B5TA 3R12A 5D2WA 3PTQA 1HJUA 4B5XA 1ITCA 3F4NA 3LSCA 5JCLA 4F66A 4JHMA 2AMGA 3THUA 4EPEC 4ADTA 2ZOXA 3TTQA 4GCXA 1PWMA 1GRHA 2ZUNA 2IQDA 2WWDA 3GD3A 3N14A 1TPEA 1IXNA 2YKKA 2VUYA 4WRHA 1YW1A 2AKZA 1TJ1A 2RDUA 2XH4A 3A3HA 4DI9A 3GRTA 1RA0A 3OG3A 5B80A 3D47A 1ADSA 4WX2A 1BWVA 4R33A 4L4PA 5E9XA 4YTSA 4GJJA 1ZBKA 3LTYA 3KOZA 4LW7A 1IV8A 4DX3A 1TSIA 3G1HA 4HA0A 3WLLA 4GBDA 2QMJA 3WFAA 5CSRA 4H4RA 5U25A 2ZQ0A 3H4KA 3CWNA 1XD0A 3VCRA 1JDEA 3HBLA 4NSBA 4QG6A 2YLLA 2Y62A 2XWEA 3GR8A 2XINA 5CQ1A 2ABAA 3JUGA 3DFYA 1VRDA 1X6LA 3IJ7A 2V9DA 4H83A 2FGBA 1F61A 2W62A 3WDQA 4NKCA 4GX8A 4ZBCA 2OOGA 1U2YA 2J8GA 4KF1A 3UWWA 4BZYA 4MJ2A 1VBUA 3NPUA 1SPQA 5JUVA 1AH4A 2DZBA 1JVNA 2G95A 3WLHA 1V6VA 3FJ6A 1OX6A 3A13A 1KKOA 3C56A 3PTDA 1HO1A 5IHRA 4Z1BA 1AZ2A 2HVOA 4AD5A 5CGTA 2RAGA 2WHMA 3MTWA 2OLSA 7TIMA 1XGEA 5J04A 4C7DA 1QOPA 2XM1A 4IQEA 3UESA 3TN4A 1D3CA 4HU4A 2YXOA 5LA2A 1ENUA 1OCJA 3NCOA 4XD4A 2CZEA 1P7TB 3HM7A 1ITUA 2PDLA 5MKGA 1B3YA 1PEZA 1R86A 3QQ0A 4MSSA 2QAPA 4Y9MA 4RE3A 1SZGA 3M0KA 3BG3A 3MY9A 4HMCA 3M9YA 2YYTA 1UA3A 4ILSA 4NP7A 1E70M 4LNCA 3KHJA 1KFLA 3PM6A 3AQUA 4MPQA 2VZVA 3H4WA 1A50A 1R9ZA 1W5MA 2VD9A 1P0DA 1XRSA 2VWTA 3Q2DA 1JAEA 1PX4A 1C91A 4ADWA 4FXRA 3T05A 3EDKA 4R7OA 1FWHC 4AD3A 1RR2A 2E1WA 3GVWA 4LGXA 5E93A 2ZE0A 3OHMB 3ZVHB 3W7NA 2OCZA 3DG3A 4H9ZA 4JTRA 1H11A 3SGGA 3W29A 3UZJA 3QZAA 1SO5A 1EYEA 5RUBA 2B7PA 3MMDA 3HQ1A 2POZA 5BOOA 1XXXA 1EC7A 3DFHA 2GGHA 5D37A 3E6EA 4GIAA 2IPGA 3S2MA 4BF5A 3IJ9A 3E02A 3ZJ8A 1W9BM 5SWUA 3BCJA 3ARWA 5F1VA 4MFEA 5EBAA 3RN6A 3WLSA 3ZT5A 2NQHA 2H9AA 1R3YA 2YOCA 2NWSA 4QJ5B 3PF3A 3CUIA 2BHUA 3BTNA 1P0NA 3ZJKA 2PMQA 2NQ5A 1UD6A 4CU7A 4OV4A 1TQXA 1U1UA 3IC9A 2C3CA 3SZ8A 2PCQA 3LG3A 1FBAA 4O12A 3IEBA 3W7KA 3A7UA 4DF1A 3MA8A 4H9UA 4PCFA 1GJUA 5C6MA 1BWKA 4IZGA 1OWQA 2GVGA 5BYWA 5CBJA 4ZQPA 5I09A 3UWEA 1DQUA 1ZY8A 2GYIA 3KTSA 1L6YA 4B91A 4LEQA 3GDLA 3G8RA 6XIMA 1K9FA 3FX4A 3BDKA 4WGHA 2FTPA 3RRAA 5JRBA 2R9RA 1SW0A 4E4PA 2BZNA 3QBUA 2TAAA 2D69A 1J6PA 4GD0A 5E9AA 4Z1AA 2WBGA 1G4SA 1E73M 4JDBA 4DWSA 3VD3A 3BSGA 1IXOA 1ZK7A 4GO9A 3AO0A 1LWJA 4GYKA 4NVTA 2CNCA 5DN1A 3NL2A 2REQA 3MI2A 4FOKA 1E1FA 1RP8A 1XIHA 2B31A 1W5OA 3VGGA 3N9SA 1LL7A 4LYPA 3WJZA 4BJHA 1FHLA 2V5DA 3TW7A 4X9SA 3CV1A 2VELA 1OJTA 1GZGA 4WY0B 1EXPA 3H4XA 5E0FA 4UFIA 2GVLA 3B8WA 1SMDA 2E6DA 3AISA 3NZ1A 1PCKA 5CAHA 3HGRA 4B5UA 3RX3A 4KQNA 1W9DM 2V5LA 1FH7A 3DFPA 3C2EA 3O3RA 1YXDA 1CGTA 1HX0A 3AHYA 4LAOA 2GK1B 1QI3A 1KV8A 2J7CA 1M01A 2R1PA 4AY1A 3W73A 1UWIA 5D8ZA 4OT7A 4BURA 9XIAA 3W7QA 2J78A 2YJQA 1W1B1 4QITA 1TV4A 2Y61A 3WMLA 5IBXA 1LPFA 4NX5A 3PBGA 2Z2UA 1L9WA 2CITA 1RQEA 4Y8EA 4OU1A 1CYGA 5HUOA 1LWIA 3LHTA 1SW7A 5HR6A 3F4DA 2WZEA 1BWLA 2WQDA 1UD8A 2CLIA 2WYSA 3NQMA 4N9EA 4PMYA 1W9VA 1V59A 8TIMA 2QCFA 4ZCWA 4MZ8A 3VA8A 3LDVA 4EIVA 4L80A 1TA3A 3PANA 3M0MA 4HPXA 3KBNA 1AMKA 4H4UA 1TYTA 1EFZA 3G8EA 4FLQA 1IGSA 4O19A 2OSWA 3QHMA 4ROQA 3WNMA 1OBAA 1T6MA 3CZJA 1YPIA 1BVZA 1X6UA 4LU0A 4IGMA 3PZNA 5CH9A 1LDCA 4O0QA 5FF0A 1H60A 1VHNA 3OHIA 1OK4A 4WKAA 3LM7A 4W88A 4FF5A 5A8MA 5K7JA 4K38A 2ZRVA 3KCLA 5F7UA 2XVLA 3AHVA 4NL1A 2C0HA 1GVYA 1O66A 3L65A 4JKLA 1ZJAA 2C19A 4GYPA 4ZB2A 1LOQA 2ZIDA 1E3XA 3MSYA 1EZWA 5HDRA 3XINA 1SR0A 4REQA 2IS7A 4LNYA 2BNJA 4AWSA 3DGRA 1RZMA 2PDWA 1OFBA 2EKGA 1GVEA 1ONFA 1XDIA 1HT6A 4I5XA 2DW7A 5TAOA 3MYPA 2AOSA 4RL3A 3GNRA 3B8UA 4QAWA 3BJTA 2VT0A 1TV5A 2NV9A 1Q4NX 5I3JA 3STFA 3CQ0A 1MQQA 2I9EA 4ZOHB 1J8VA 3SCSA 2J7EA 4JX4A 2DFAA 2YFNA 1F8MA 2QUUA 1D7FA 2J3NA 5AHEA 5LIWX 2W92A 4HCHA 1CECA 4US5A 1BLIA 3LNMA 4GH1A 1HL9A 3T2OA 3SCWA 1KLYA 2WV8A 5E5CA 4IX0A 4F3HA 3DX5A 3F4VA 3LOTA 2P88A 4DUXA 3MDWA 3T6CA 3WF3A 3EDEA 5IDIA 1YIXA 3PFRA 3VGFA 3W6YA 4O4VA 3C61A 3BWWA 2D73A 2HPIA 5E6YA 3DH9A 3WO8A 3NVZB 4JNMA 3QPYA 3BLPX 3H2AA 3HG2A 3DG7A 3CM4A 3RG6A 1R47A 3PG9A 1F74A 4DB7A 2E09A 1HKMA 4O8RA 4N2YA 1UR9A 4E8GA 1U5JA 1NDAA 1I0BA 1FFUC 3UR5A 1H3GA 1LOSA 2ISDA 3QLLA 1E6QM 1WYIA 4PTVA 3EBVA 3WLTA 1S3HA 4UFMA 1MFUA 4C7FA 4DBUA 1F6KA 3CIXA 4MPKA 1EKOA 1QI4A 4XBJA 3CMGA 3FVDA 4DO6A 3IAPA 1IZJA 3BL3A 4Z0JA 5AHIA 5FAJA 4U2YA 5DBUA 3L23A 3UP8A 1R30A 1N62C 3N29A 3N1AA 1JYXA 4DO7A 1GETA 9RUBA 1XLIA 1XDLA 2J8FA 3GH5A 3P0XA 1OZQA 3LCGA 1OVDA 2G41A 3BOLA 4KETA 1PO9A 3DXIA 4NZ3A 4HOZA 1V6UA 4J2PA 3CMFA 4NZ5A 3R10A 2X8CA 1OT2A 4MLRA 1FWGC 5HQLA 4OUEA 1DJNA 3F2DA 2VQTA 3TIMA 4JTAA 3GHSA 2WSQA 4B2DA 3HIJA 1E6XM 3UNDA 3PZGA 1H5YA 2AAAA 5GJNA 1AQHA 1DBTA 3E9AA 4AWUA 2ATMA 3ITXA 3R1ZA 1DL3A 2F6XA 4P8VA 4O8AA 3LGGA 1A5NC 4L6OA 1W1TA 4GZEA 4D6IA 3DI1A 4PMUA 1V0KA 2G5WA 2PRMA 3BLDA 2V0TA 3VM7A 4IIEA 3EOSA 1JCXA 2NV2A 3MWAA 3WK1A 3WQOA 1JYWA 3VOIA 5G4EA 2HE8A 5LXEA 3FAXA 1IEWA 4DJFD 1OC5A 1W17A 3G1FA 3TYEA 1YTKA 4GISA 1ZKQA 4U3AA 3KDNA 5C9XA 4IUOA 3NOEA 4Q8WA 4XAPA 1VR6A 4MNLA 2XN0A 3BURA 3FA5A 2L5HA 3EWYA 3S1XA 1GCYA 1MXGA 1OFRA 5LNVA 2QAFA 1JZ7A 1W3JA 2PTWA 4GQRA 3DERA 3THAA 2PDIA 4ORMA 3BMXA 3ABOA 1VBHA 4AIBA 3SUUA 1X39A 1O5XA 4UOZA 1N8WA 4LAMA 2PP0A 1XANA 1H63A 1QAPA 4L61A 2VR4A 3TXVA 2A7RA 1V8EA 4J3XA 1NHSA 3P8JA 1L2UA 1DIDA 3KUMA 2ZDSA 2Z7GA 2W66A 4W87A 1TJPA 4NY2A 2PRHA 3KE0A 2PP3A 3FYYA 4XSMA 4HOXA 2YL8A 4WF7A 4QFUA 3RRXA 1PWLA 4NAFA 1V6YA 1Z41A 2JE8A 4NQ1A 4PEKA 4GJIA 1UYQA 2YCLA 2WPBA 4C6EA 1ECQA 3NVDA 2VMFA 3NL6A 4GI9A 3M0JA 4I7VA 4R3UA 4PUEA 4GRSA 4H3DA 4PBGA 3EDJA 3W37A 2Y5SA 3QV8A 3EMCA 4J27A 1QNSA 2RDTA 1JL8A 1QI2A 5T26A 5C9UA 4LYQA 3AZSA 4BEQA 3MVTA 4DNAA 3DBPA 4LFYA 4TVCA 3RPMA 4QQUA 4TR9A 2QPUA 2QVNA 3TTSA 3BJSA 1PS9A 1HUVA 2ACQA 2IPWA 4MOZA 3WQWA 2FZ9A 1QFEA 4EQXA 4JICA 1CGWA 2EJ1A 3FCPA 3W2KA 3LA4A 3A23A 1KNWA 1OFDA 1VENA 3BLEA 3STEA 4F0MA 3OO2A 3DN5A 4P7NA 4LV9A 1VYSX 4GXPA 1XRTA 2GJLA 4LUSA 4ZSUA 2PU0A 3TYCA 1B5TA 4WY0F 4QXIA 3PG6A 1LRQA 2V3BA 3UJFA 3MP3A 1GUVA 3NQ6A 1E71M 2OELA 2DJLA 1MO9A 3LYEA 3ZR5A 1EDTA 4FLSA 4LS2A 5CPLA 1J4EA 2BTMA 1GEQA 2XJ7A 2PTZA 4GUGA 4MIMA 2X0YA 3GC2A 4W7WA 4QE1A 1UJQA 2YL5A 3UZZA 1X98A 3AYTA 2WSYA 2GDVA 4M6PA 4DZIA 4PGLA 5DY3A 4A3QA 1H51A 1E51A 2VR5A 4HU3A 1Y5VA 1UBSA 4JQAA 3PUGA 1N82A 3MKCA 1HO4A 4F2BA 2EQDA 1ADOA 4GY7A 4L6DA 3A4AA 5A6JA 3H4GA 3H24A 3KL5A 4UFKA 1F4HA 4LF1A 3ZJ6A 3UXLA 4NZCA 1V0MA 5KETA 1JROA 4LC8A 1VFHA 2VHLA 3N17A 3TC7A 4JTJA 1CCWB 3BV4A 3W2NA 5MF5A 4XAZA 2EPMX 3QV7A 1GKPA 3N2XA 3CL8A 3FVMA 1KWKA 4JIHA 4S3GA 3ZOAA 3PZUA 4F0SA 1J10A 1B3ZA 4UZSA 5ABFB 4IQLA 3W1LA 3K8LA 1XLAA 2J8TA 1Q6FA 3RM4A 2X8GA 4ICCX 2A7NA 4GLEA 2HDJA 3CGTA 4XD3A 4CNNA 1GHRA 3P5YA 2WLYA 4K68A 1T5AA 3DH7A 2YLAA 1TWZA 2I16A 1UP3A 4DHGA 1Q7MA 4XV0A 1A5KC 4QTGA 2DIEA 1FWWA 1MXSA 2FHBA 4PE8A 3AM9A 3FK4A 3V0TA 1S5VA 2H3DA 4BEUA 3O7UA 3TQKA 2XPKA 5LNUA 3I6TA 4R88A 2QXWA 3PULA 1TYGA 1POKA 2QUVA 1TTJA 3VUSA 2J7HA 2WO5A 4MUZA 2XIJA 3W27A 4ZQMA 2Q71A 2UY2A 3B8DA 4HN4A 3UXAA 2A21A 4H4QA 3O05A 2BVDA 2OSYA 3UJRA 3T0DA 1V0NA 3WD3A 4QRNA 4NG3A 4WOQA 3POHA 1PSCA 1MEWA 4HN8A 1SZFA 2G3MA 2CIPA 2C0AA 4XSLA 3OEXA 3BJFA 3POCA 3BAXA 1S5TA 4CKQA 1W31A 4IG2A 4FOJA 4HZ8A 4W8AA 3BG5A 3HQNA 1Q6OA 4UTWC 4IPNB 3IGXA 3KBSA 4H4YA 2AAQA 1LRTA 1G9HA 4C1KA 3PFMA 4POCA 2PF0A 4U5IA 2JKEA 4DJDA 4KFOA 3V35A 2PTYA 1UB3A 3UJSA 5I02A 1S2TA 3PUDA 3AS1A 3BXWA 5CCZA 5DMYA 5C71A 2B0MA 4NYUA 4YTQA 4WOZA 5HATA 1UR3M 4PL1A 2H6RA 4PMXA 4PCPA 5GJMA 3UG8A 4JEQA 1TRDA 3VZYA 2EEXA 4Z2IA 4M7SA 4AAJA 1V77A 1GQIA 3R0UA 5BXPA 1OSEA 3F1QA 1J0JA 1PBGA 4RDYA 2WAGA 4H01A 5U4NA 4MJMA 3ZFHA 2D24A 1BD0A 4D8ZA 4H6KA 5A6TC 1I9CB 3B9EA 4NEVA 1NAL1 3RMEA 4EWND 1IT7A 2ON3A 2P5NA 1VPXA 5BXRA 3O15A 2D1ZA 2WPCA 2D3NA 4QIUA 4GYPC 3PJUA 2WOIA 1TKKA 3NXLA 3M5VA 1UP2A 5HOSA 4XZ9A 3WQVA 3O8AA 2VVSA 3EX6A 2QKFA 1NTHA 1XQKA 2QV4A 3A47A 3CT2A 2V3GA 3CXOA 1DJYA 4GI6A 5I3KA 3W1MA 3WLOA 2I1OA 1BYCA 4KCTA 1VCVA 1KTCA 5CAKA 1AJ0A 2RGMA 1W2PA 1CENA 2JBMA 3G24A 3LPFA 4M19A 3WNLA 4IM4A 1M7PA 3RNDA 4Q8PA 2PDBA 3F7JA 4JTSA 3BCFA 1C3FA 1UZDA 5DCBA 4KEZA 4ALDA 1LTDA 1SW3A 1SZRA 3WD0A 4GVIA 3SR7A 2RHGA 1A5CA 1GVRA 3B97A 4OFCA 3A4WA 3GW0A 2DT0A 5L6UA 3T1GA 2GR2A 4UUIA 4YL2A 1QASA 3H8AA 2X1RA 5CZTA 2BOGX 3MUZ1 5JCKA 4X22A 3BAWA 3UF9A 3TQPA 3M0HA 4IPPA 2WMHA 2EHHA 3VIIA 3B4UA 4QSHA 5LIYX 1GZ1A 4JTKA 1RK5A 3AIEA 4UCGA 2XIIA 4FNUA 1SFTA 1POJA 4F48A 1W54A 3QW3A 2WNNA 3IVSA 3TW6A 5A6LA 4LEFA 2ZCGA 3NSXA 1MWOA 4HPGA 4PUJA 3LCWA 3HPAA 4W93A 5FCZA 2W67A 3W70A 3BH4A 3J7HA 1GOWA 2F7FA 3URBA 4YMZA 4U4MA 2Y5EA 3I6RA 3DFNA 4ZE4A 1FHDA 3SM0A 1DIOA 1FCBA 5G2WA 2B4GA 3B9JB 3KVLA 2CKSA 3OU8A 1XX1A 3ZSTA 3L21A 4FIRA 4Q8OA 1G1YA 3MYOA 3CHCA 1KBJA 1QI5A 3ZYZA 4GOAA 3P80A 4IUGA 3GXMA 4KH2A 4J1OA 5LGXA 3RYSA 2CCRA 4HD5A 2W54A 1GONA 4U31A 4JQ1A 2XSXA 4RDVA 3WZ0E 4CU8A 3N9KA 3QLDA 3CUGA 1V0LA 3UWVA 4UR7A 3KX6A 2VQUA 3CTTA 3OLEA 3T0AA 3PG8A 3S47A 4UQCA 1Q6EA 2W27A 2ABBA 2ZBTA 3MWCA 3CH9A 1UH4A 1LZOA 5E0CA 3MCOA 1WDDA 3ALGA 2DSKA 5IOBA 2FH6A 1S5MA 3QYQA 1S2UA 2BB0A 4MWAB 2OT1A 2DSVA 3LQGA 2ZA3A 4XAYA 1UMLA 5I78A 3BAJA 1DQXA 1LWHA 1YXCA 2P3EA 2V6OA 4YIWA 1JQVA 1UD3A 3KOYA 1V7AA 2HVMA 3NZQA 1GKQA 2WVUA 3VIMA 4OHQA 1EGZA 3EKGA 5LHEA 5CLTA 3DYPA 2HNEA 5GRTA 3TAOA 2V68A 1J0IA 3MUAA 2FDMA 3VNDA 1UG6A 4N9BA 3DHDA 1PX3A 4HSHA 4I7UA 1C92A 1VHCA 2G50A 4CQDA 4JXCA 3L12A 4JFWA 4TX9A 4JN7A 2BHYA 3DENA 4A29A 5BU9A 3IJQA 4HZ6A 2QJHA 4OBSA 1LQAA 4PMVA 5A6BD 4WKHA 5AHNA 3W23A 3GQYA 1JUBA 1JCTA 3NNTA 3W1XA 4YVVA 4EF9A 2OZ0A 3NXFA 4B3LA 2OO6A 2A5HA 4IMEA 3WLRA 4F2TA 1N5XA 1SO3A 2VFGA 1K7XA 1TTIA 4JL2A 1MXDA 4ACZB 2XIOA 1Z48A 4E6MA 3VNZA 4A8RA 4B9YA 1VEPA 4HPHA 2V3AA 2A3BA 3T07A 4PUMA 3EB3A 4URIA 4YYCA 4BF9A 3XISA 1OF8A 2ZXDA 5HNNA 3FSUA 5AFDA 4GINA 1E6SM 2PD9A 3HV9A 4Y96A 2IKJA 1FKWA 2GSEA 3O16A 4FLRA 1FWNA 3MZNA 1A4LA 4EACA 1W91A 3G0UA 5G2HA 1QXLA 1TG7A 1PJ9A 1EJWC 1MEIA 4GIYA 5BRBA 2VCAA 2YW4A 2GJXA 3H70A 4P8WA 3W6LA 3Q4DA 1WUEA 1EZ2A 5HMDA 4D6CA 1Q6DA 3OG2A 3EF6A 3LHZA 3AU6A 4NJIA 4AX6A 5CG7A 4P8XA 4I5RA 7REQB 2I56A 1S46A 4KRUA 1K03A 5KVHA 3WMCA 3G1DA 2DV0A 2GJNA 1ZPTA 3BPWA 3U57A 4GNKB 3GNPA 4XB3A 3UEQA 4BI5A 3EPNA 3TQVA 1JF5A 1VBJA 4XISA 4XZHA 1X38A 2P3ZA 4JKMA 1MMFA 2E5AA 2J9XA 4ZQOA 3B0YA 4PUUA 3TZFA 1XIMA 3HPXA 4V1XA 3E2QA 3DECA 1S2AA 3S9IA 4TX6A 3FYPA 1PCWA 2HXUA 2C14A 2ICSA 3H2CA 3K46A 2GUYA 4PN2A 4H4TA 2VI0A 3PBYA 1O12A 1W32A 3VDHA 1N55A 2H90A 4WDTA 2X7VA 1J9YA 3DG6A 3CZ8A 2BY0A 1ITQA 4JQ4A 3LCFA 2O55A 4W8LA 2PD5A 2PWHA 1E6PA 2FZ8A 2V63A 4NXSA 1R9XA 4O11A 2B7NA 3O0KA 1WKDA 4GXMA 4UTIA 2BXVA 3V5OA 4BI7A 3VCCA 4KIEA 3EX1A 1TRIA 1B54A 1UQZA 1Z69A 4LRTA 1Y7VA 2J6XA 4XZLX 4DLFA 1RPKA 3GFYA 4HHPA 3TLLA 3WCZA 1SJAA 1QR7A 5XIMA 3ZT7A 3NURA 1UWRA 1ZNNA 2NX1A 3LPOA 1C7TA 3O07A 1P4CA 4QROA 1TVNA 3KBJA 3P14A 1ONRA 4FNSA 1E4NA 3GK0A 2ZZ6A 4CNTA 2HXTA 3W71A 3E3HA 2WLZA 4GUJA 3ZWSA 2P8CA 1O5RA 1C8VA 4HTYA 3QF0A 5H6HA 1YQ2A 3A5FA 1UR8A 5E09A 2X05A 1KGUA 3GDRA 3UT0A 3NA8A 3P82A 2ZVRA 3IV8A 3EANA 2BVYA 5AYBA 5DX7A 1KTBA 2QJGA 1ESWA 2C71A 3OA5A 1RPXA 4A3HA 4NZ1A 5G5HB 1WDPA 1EWEA 1YE6A 4ZGYA 1T8XA 1W9XA 3CUFA 4TTUA 4F2UA 5A2AA 3G5EA 3ZSSA 2WK2A 3THCA 2EJAA 4EXBA 4K37A 2XVNA 3LNPA 4PCTA 2X2YA 5REQA 1A3XA 4DYJA 3EDFA 4Z17A 4GGHA 4K36A 5D4YA 1UKQA 2ATSA 4Y9NA 3AXHA 4YHEA 5C0QA 4IT1A 3M6DA 5LA0A 5KITA 3W7IA 5LYRA 5JIPA 4O0KA 2WVVA 4Y9OA 3S8HA 4S2BA 1D2KA 1EXBA 2R9ZA 3ITGA 3S0CA 4S3JA 4L9XA 1W5PA 4C6QA 2DZXA 1R7AA 1O6IA 2Y70A 2ESCA 4MG4A 4UMBA 4DAFA 2WB5A 1T40A 3E2SA 1S5NA 3IVTA 4M3PA 1REQB 4Y8FA 7CGTA 1VS1A 3TLQA 2EXOA 4IP4A 3DKLA 3KLKA 3RX2A 1XP3A 1R3RA 1G69A 1XSJA 1DTNA 4GE8A 4TV6A 2PGFA 3OTRA 3ES7A 5DQPA 4O1AA 4EM4A 3D9XA 4K8DA 1QNPA 1KBLA 4PTWA 4US6A 3R5EA 3V4BA 1BRLA 2YZRA 3K1GA 2Y8KA 3FXYA 5FJJA 4HMNA 1OINA 2C7FA 4M6VA 1GW1A 4LVDA 1OFEA 1V6TA 2X7WA 1W3LA 1F6PA 3ITVA 1SSDA 1MEHA 2ACRA 4ONVA 1AW2A 1TPH1 1IE7C 3AJXA 4DXVA 4HK7A 4K7ZA 5AC4A 1JF6A 3SCVA 1EF3A 3ECQA 3EX2A 5GPRA 2EQ9A 2HRWA 3R2GA 3II1A 4JZ5A 2JFEX 2QAEA 5HR7A 3BLLA 3PZOA 3IS4A 4O15A 2PC4A 1G0CA 4ZOAA 2D20A 2YVGA 1NWRA 4UXDA 5BWFA 3H12A 3WQ5A 1PIIA 5EU9A 1MQRA 2QDDA 3CO4A 4C6OA 1T41A 4AEOA 1LUCA 1NOFA 1VC4A 4MDPA 2OTDA 2NVDA 1XH0A 3VCNA 4CN4A 2UBPC 3OGSA 4XVEA 1A5AA 3ARRA 1PV8A 3H2OA 3SQLA 3NQEA 4ZOCA 3EWUA 3B40A 3AIWA 3VX0A 3A7RA 2LLEA 2DU2A 1ONXA 4ZO6A 5A6KA 1GOKA 3EUB3 4UMCA 3VFCA 3WJSA 3WEOA 5KZMA 1EA9C 2YDQA 3S83A 3UXIA 3LXAA 3NYDA 1E4MM 3V0SA 1HIZA 3NJ3A 4ADSA 4L6HA 3PZIA 3WK0A 1EEPA 5DLCA 1FHVA 1VAHA 3K30A 4HCDA 1HJVA 1FCQA 3QN3A 4XWUA 3CAVA 4DF2A 3M0LA 4K7VA 1FWCC 3GD4A 3M0ZA 3UERA 1XJBA 2QJNA 2FTYA 1W0MA 1ML1A 2PGWA 2DVTA 1FX6A 1OCBA 1I45A 3ATYA 1BTMA 1MO0A 3KZPA 3R11A 2YVFA 3S6OA 3PBWA 4WCJA 3I65A 2BG5A 1TR1A 2WNZA 3C0QA 2OOFA 4TMBA 3ENLA 1QPNA 2PBGA 3VOGA 2PDUA 1WXZA 5FESA 4IIDA 4FOUA 1KWGA 4MADA 1KTNA 1E1CB 3E0FA 1QHPA 2QCDB 4JCLA 5JBDA 2VEMA 2V5JA 4CQCA 4Q7NA 3IJ6A 3BW3A 1XCFA 4IMDA 2PE4A 3G0SA 2UWFA 4E4FA 2Z28A 1NDYA 3CHDA 4ZOEA 2F84A 1B9ZA 4BHYA 1NJJA 1XLMA 1RVKA 2WWCA 4Q8NA 5F2LA 1WYGA 4U28A 1I2QA 1DIKA 1QU4A 3W1NA 3QW4B 3LRKA 1TUFA 4Y90A 5K3VA 2VEGA 4HQVA 3T2PA 4FX8A 2BXYA 1LBLA 1YMYA 2D0GA 4G6CA 2WSPA 1VJSA 2ZZBA 3LBMA 3CTLA 5DMMA 4XO7A 3NFUA 4GX9A 3CAQA 4EXQA 4AYGA 3W26A 1LM1A 5JMUA 2QIIA 3AU2A 3UR2A 1XG4A 4YJ5A 1UH3A 2XIQA 1UWAA 3M7SA 4MZYA 1OG0A 4O0ZA 1FWAC 4M7TA 1BF6A 5D03A 1GTHA 3CQKA 2WC7A 1HKJA 3M41A 4HHLA 1DE5A 4HNVA 4OBRA 2ADAA 2C18A 3I4KA 4MGGA 1H49A 2AL2B 1XLHA 1ZJBA 3A64A 4ZB0A 1KRAC 1QOQA 2X09A 3BICA 4HNOA 3M07A 1JYVA 2OZ8A 2YDRA 2DZVA 5CKSA 1PHWA 1S1RA 3IWPA 2BOEX 1XISA 4H8NA 1DE6A 1F8IA 4JFSA 4B2DD 1BZLA 5HQEA 4O1EA 1W56A 2WSRA 2GQ9A 1XLFA 3AJ7A 4IXHA 4QP0A 3AC0A 5JBEA 4E4UA 4XAGA 3D0CA 2CHOA 1AQMA 3OBAA 5H8UA 3KOXA 3W07A 2WSKA 1JZ8A 4G2DA 3II4A 3MMTA 4LX4A 4LJ3A 1CBGA 3PTMA 2V2HA 5ER0A 1KC7A 1E15A 2Y2WA 2YCEA 3O0HA 4IF2A 4TVDA 4HT3A 5G2IA 2V5BA 4PH6A 4B4FA 4NX0A 1F8WA 1F3XA 2W5FA 1XYLA 3NSNA 5CPNA 3DJJA 1K1DA 4H50A 2BC1A 5H8PA 3LADA 3EB4A 1IEVA 1H7OA 1GORA 1YPXA 1NF7A 1EO7A 4OE7A 3L5LA 4NI3A 3GRSA 1JOAA 3NWRA 1GOIA 1XYBA 2XISA 1BF2A 2QIWA 1YHTA 3W4RA 4WKFA 3GFZA 3CUJA 3VMNA 3CAKA 4GI4A 2YFOA 4WJ8A 1TV3A 3ABSA 3L0GA 4D71A 5BU6A 3CQHA 1CB7B 3LBCA 3GC4A 4E3TA 1K3UA 1JDDA 4LCRA 5KTLA 2GUBA 2ZX9A 4PSPA 4YCOA 3DESA 5BRQA 4E0CA 4P7LA 2RH9A 3D5HA 3WNNA 4UCFA 3WUFA 1V3MA 3G1RA 2FQIA 2FJUB 3AFBA 3RPTA 1GTEA 4MAVA 3NO5A 3N15A 3FY1A 2UZ9A 2VX5A 2CLFA 4AIOA 3L0KA 5I24A 1FKXA 1D3GA 4QLLA 1NVMA 1UD5A 2A3HA 1RY0A 3SUVA 2CESA 3GU1A 3ZVHA 3LX9A 3B0PA 3W7PA 2Q02A 4H41A 3MHFA 3GTNA 4KWVA 1FDJA 4DJFA 1R3SA 3AALA 1T99A 2QPXA 4G7EB 2OT0A 4D6EA 5JXQA 1R2SA 5K2ZA 2PLKA 4WXYA 2A3AA 4R85A 2XFYA 5IFPA 2ZZ7A 1ZP3A 4Y9PA 3GYCA 1A5BA 3KRSA 2EBNA 4Z08A 3QHNA 3WDPP 3KTCA 3UXKA 5H2ZA 2WXDM 1E55A 1D8CA 1P0BA 1V6WA 3PAOA 3D3FA 1XW8A 4UBPC 1UQYA 3K8KA 2EQ6A 3UCQA 2Z1BA 3ARQA 1KR1A 1R3TA 4ZFMA 1NHPA 2DDXA 2WBAA 1VGAA 1UKSA 4AZ7A 5HINA 3NZRA 3IUIA 3W1PA 3L5OA 3V16A 1ZJHA 5CXPA 4AF0B 2O7SA 3LHVA 4FNPA 3U7VA 1HVQA 1VCFA 1P1MA 5FEXA 4D1JA 1W8SA 3OQ8A 1GKRA 3AHTA 3MU7A 2YA0A 3WMBA 3ME3A 3M0IA 3K2GA 1R9YA 4XIAA 5H1WA 3R6IA 3PNZA 4MB5A 4W85A 3U5YA 3WF4A 3ABRA 1SQ7A 4EAMA 3FG2P 3DU0A 3ONCA 1O94A 3C0SA 4I8DA 3HJZA 2QJMA 4NASA 4KCWA 4AC1X 1TREA 5JCNA 3UXDA 1OD8A 3SY8A 4KCVA 1DJXA 5FSDC 1OT1A 3WFZA 1EC9A 5BMXA 1XHCA 4GFIA 4N42A 3S9ZA 4GIRA 4FI4A 3NVWB 4BKNA 1EGVA 3W7CA 3UCCA 1THFD 3WH7A 2ZE3A 2VEPA 2VDGA 1EUAA 4BI6A 3S5ZA 5D09A 1PX8A 3W0KA 2DZAA 1KFKA 2F8QA 3PBVA 4R53A 2FZDA 4M6QA 5LSMA 1GOXA 4KW2A 4JTFA 4WY0A 3LEPA 4F8XA 4O53A 2OU4A 1KBBA 3OC4A 3UETA 3HPSA 4NIRA 1I2NA 2CHNA 2W3RA 1YNQA 5DXXA 4I9MA 4Z2KA 2YA1A 1LJYA 3C6CA 4YWSA 1H1ZA 5H8MA 4YVPA 4FR1A 3I3BA 2CFYA 5CSSA 4HMDA 1JFXA 4J3WA 1E9IA 3QY6A 2ZVIA 4PEEA 5BZAA 1B0IA 4HBKA 4I3GA 4PUDA 1X1OA 3TUUA 4NHVA 4JL1A 2PURA 3MPGA 1WKYA 2ASHA 1UZHA 1H09A 2WJZA 5EB8A 4WD0A 1WZMA 3T42A 1IXPA 5EKYA 3NG3A 3E2RA 1TCDA 2AGTA 2F6UA 1WAUA 1JDAA 4ZOBA 3AIBA 1XDMA 5AECA 4H9YA 4MYAA 1C9DA 1TUXA 1TPC1 5AHMA 3EWWA 4O50A 4IIHA 4H9MA 4PMNA 1TA3B 1L8PA 2EGZA 4B5WA 2PC8A 1OFPA 2ACSA 4HNLA 1W1A1 4AVNA 3KRBA 3AI0A 3VKAA 4JIRA 2ZUWA 4DJDD 1XBYA 1XIFA 1NSJA 2Y5JA 1JPMA 4CN1A 4H2CA 3QMRA 4IISA 1ZUAX 3QMSA 4EPBC 3GIPA 4ZE5A 2RUSA 4MWAE 3UQNA 3TW9A 2PDJA 3C52A 2PZ0A 3MQTA 4QG9A 2VURA 3WF1A 2FHCA 4GJ1A 3ARVA 4X9YA 1F3PA 1QVBA 1NY1A 4EP8C 5LZLA 1A0CA 3UVAA 1ADDA 1GEUA 1J0ZA 1DHKA 4Q8VA 4ASTA 2Z7KA 3ANVA 4J3ZA 5BOFA 4V33A 5A5WA 1B3WA 3TXZA 1E5NA 1NM9A 1M7XA 1YKWA 3RDKA 5DCDA 4NYYA 3OP2A 1EIBA 1UOKA 2X42A 3COTA 1BYBA 1MW1A 1WBJA 1WXJA 4X2PA 1D7YA 5TBOA 2HPMA 1VB9A 5T9BG 5KZDA 3CXBA 3WBYA 2WHJA 3MO4A 3NAVA 5FJOA 1TJRA 4IWWA 1Q3NA 4UTKA 3CLWA 4L65A 5D9MA 2VZOA 4IH3A 4LAKA 2X40A 2E3TA 2Y7EA 4GXWA 1FY6A 3VVGA 3H6OA 3CS2A 2YGYA 1GVOA 2X50A 4C1NB 2VD8A 4JYDA 2CETA 5EA9A 2INZA 1ZLPA 4PCNA 3BUVA 3QQWA 2VJXA 1GZJA 2GR0A 1YE4A 4IMCA 4V28A 3WLJA 6CGTA 1S7MA 1UJPA 3QC3A 2WM0A 4EMIA 3TWAA 3EB2A 1J6OA 4CN6A 4CQAA 1F6YA 3KWXA 4FEZA 1OC6A 1AODA 1I2RA 2E25A 2JGYA 3LY0A 4DEFA 3AS0A 4L4LA 3FLUA 2C91A 2FB2A 2FPTA 1W5QA 3IIZA 1XV8A 3CU2A 1AL7A 2WMIB 4N4PA 3VTRA 1F3EA 1MNSA 2DZTA 4D9PA 4P5UA 1S5WA 3OLGA 1CNVA 5A8OA 2YB4A 2R8WA 3AYRA 1K6AA 3FXGA 4NT0A 3GAKA 3NDOA 1RD5A 2JEPA 2Q09A 3EA3A 3USBA 2CXGA 1BXCA 3WG6A 1KQZA 1HJXA 3TEVA 3MMWA 1A5MC 1UUOA 2CBIA 3AMGA 3H2MA 3CWOX 3P74A 2GGEA 3S2LA 2YCIX 1QPOA 3O2LA 4JY9A 3C0JA 4N6FA 1YBQB 2J24A 5XIAA 5BROA 4MY9A 3WQ4A 3BGGA 2QS8A 3QFWA 5A6SA 4OV9A 1NU5A 2CZVA 2WBKA 4ML9A 3S2CA 2P10A 3GDTA 4TIMA 1V3HA 5CLWA 1QNVA 4L64A 1WUFA 1OEPA 2BFGA 2PDKA 5T91A 3DCPA 2CFFA 2G4FA 3NQ8A 3PWGA 3UD6A 3LRMA 2OEKA 1OGSA 4IFRA 3NL3A 3HG5A 1PL9A 2MNRA 1XBZA 1XYAA 1E5JA 3N3MA 5HANA 1ZGDA 1LG2A 3HB9A 1UKPA 3IJ8A 1ZALA 1J2BA 4XUGA 2FFCA 2BMBA 1TIWA 2EO7A 3FFSA 1AG1O 1EBGA 2A8XA 1WZAA 3IACA 3TV8A 5DT5A 4QBXA 2QCGA 2IMRA 3WL1A 4QHRA 4YTRA 3IGSA 3OBEA 2V82A 4WK9A 3WK3A 1XLCA 1QO5A 4GUFA 5BXSA 3PP7A 4HK5A 5LNWA 3IJDA 1TIMA 4NRSA 5FKYA 4DO5A 1HQTA 1VQZA 4UZUA 4HYRA 1N5WC 3WDHA 4Z2LA 3SY5A 1CLXA 2A6LA 3WEZA 3TAKA 2VC7A 2XUCA 3TKFA 3WENA 1NELA 1DXEA 4QJ1A 4FF7A 3F5JA 3N4FA 4CEXC 2WW5A 4C60A 4G56A 3OA3A 1X2GA 2ALDA 2VZSA 1ODUA 3LPPA 1Q6CA 4HJFA 4WR3A 5D8WA 3NZGA 2ZWYA 3ARPA 3GKFA 2Z0IA 1NDWA 3CPUA 4R7WA 2WMFA 3ZJ7A 3PTKA 3T8QA 2JK6A 1JZ6A 4TX8A 3STGA 2ALRA 1CLVA 4UTTA 4NI8A 3LUTA 2HISA 1TPFA 3E0IA 2OG9A 2HWGA 1QBBA 2A79A 2OGYA 1DVJA 3FKKA 3SCNA 5D2YA 2P50A 3MS8A 3RR1A 4DIAA 2Q6ZA 3JZUA 1AQFA 4X0NA 4C6NA 4C6IA 4D2JA 1MYRA 4MNMA 2PODA 4C6KA 3ZQ9A 3HFTA 4JEJA 2FVLA 3ZMRA 3RLUA 3E1F1 1PTDA 3ELFA 2R1MA 5T8GA 3UWUA 3G6MA 4PB5A 5AC5A 2NUWA 3UCDA 1GQLA 1BHGA 1ZZMA 1FWTA 3ZZ1A 3CBWA 4IGNA 2C6QA 4UFHA 4IIGA 1EUNA 2JF6A 2KAUC 2OWCA 1V93A 4O13A 1WA3A 5CG0A 3DGZA 4UOQA 4DRSA 3PSWA 1VPQA 4MB4A 2PZNA 3VD4A 1KA9F 4CD7A 3H22A 2TSYA 1O60A 2ZC8A 3WN6A 1E40A 1JYNA 4YNGA 1MRAA 4DJFC 1Z42A 2GH5A 3I7QA 1A0EA 5FD0A 4E2OA 2X16A 3HGJA 3EWXA 2EG8A 4PRTA 5GNXA 4AHOA 3KLJA 5C2CA 4JFVA 3B9OA 1W3NA 1JPIA 1YXYA 3VKDA 3MANA 3ITLA 2XZ7A 3V5FA 3MDUA 5F2IA 4CVUA 3GDKA 2J7FA 5C9ZA 3T0TA 3N6JA 3V3WA 4GC4A 5CC5A 2ISWA 5A6BA 2VGIA 2FZBA 1QRQA 3L8KA 2VXNA 2Y24A 5G1TA 2X8HA 4Y9AA 3CV2A 3DZ1A 1VD6A 5LIKX 2J75A 4LALA 2HEJA 3GHRA 3PJWA 3VNKA 3GG1A 5CZSA 2Y7DA 5M2FX 3NL5A 5HMFA 3M16A 4A3YA 3WF0A 2IUZA 3TX9A 2C3ZA 3BGJA 2NSOA 1JIBA 2GVJA 8RUCA 3WEMA 2FHFA 3KCJA 1RCXB 3W28A 1VYPX 4M52A 4LWWA 3VKCA 3ETRB 4MY1A 3U4AA 3AIQA 1JNEA 4H7ZA 4A4AA 2NQZA 4EAYA 1GYMA 1JPDX 5EGRA 2GGGA 2VENA 4ZO8A 3L2IA 3RLVA 3SGZA 1TMHA 1RSCA 1V3LA 1RY8A 2FPYA 1Q65A 3PY2A 3DK8A 1IWAA 3CASA 1LP6A 4HOWA 1ZP4A 2QF7A 1JFHA 3ZWTA 3UWQA 4GNJA 1V6XA 1ZMDA 1NQKA 5CBIA 2BVTA 1U83A 2J4GA 1K8CA 1LOLA 3SUWA 3TA9A 1WDRA 1OYBA 4OQVA 3TC3A 4APNA 4LPCA 3WF2A 4FAMA 1XHGA 3RAOA 1MDLA 3N4EA 4JS3A 4NZFA 3O6CA 2A1YA 3SURA 3DBNA 4IFOA 4N0RA 1DWFM 1K77A 3ZLFA 2OQHA 2GWNA 4MYXA 2FGZA 1JJKA 3MCMA 1JDFA 3FNDA 5EY5A 2Z1SA 3TH6A 4O1FA 4K7YA 2ZA1A 3WNOA 2IKIA 4HA1A 3AUOA 3GD6A 4E2VA 3MO7A 3T0BA 5FAGA 3EOLA 1V4YA 4YPJA 3S1VA 1FA2A 1JRBA 4XZBA 2V69A 1OABA 2RABA 5I79A 3PSVA 3S1WA 1X8CA 2XGIA 2ZTJA 4JR5A 3MW7A 1VRXA 1WAWA 3D6NA 4AIEA 4ZMGA 2PTXA 1ICPA 4XTDA 3VU2A 2BY1A 2F38A 4PB3A 4XO6A 3U5UA 4WXZA 4JYEA 1NQ6A 3QV9A 3A7AA 2P1FA 5C70A 1QWKA 1MW2A 3GB6A 4IG2B 3EWDA 1F5ZA 2E5DA 4C1LA 1GYLA 3A24A 2OODA 2PPGA 4KWSA 3PJTA 3QRHA 4ICMA 2ZTKA 5K4XA 2PGRA 2DIKA 3CLMA 4LH8A 4GCAA 3MV01 3CMJA 1LCOA 2JF7A 2QPSA 4ZSTA 1KRCC 1UD2A 3CO8A 3OYZA 1FCUA 3G3DA 2NUXA 3TNBA 3TC6A 1A47A 2R82A 4OOUA 3U8GA 4O57A 3V1PA 4DBDA 1EPXA 3KBMA 4F9DA 3QTGA 1ZAJA 2X2GA 4RZ6A 1G4EA 1J96A 4RPPA 4QCFA 2A6NA 3R0KA 1QK2A 3E0WA 3WDRA 3AIUA 3WJXA 1OADA 3OZPA 4BQ3A 1KV5A 4EX4A 3V18A 4WEVX 3MUY1 4ERGA 4FA3A 1BGGA 4LQ1A 3UWYA 2Z00A 1LORA 1EJSC 5DY2A 5K9XA 3U4FA 3B0XA 4Z0SA 3QPEA 1VBGA 1IT0A 4ZENA 3TWBA 2AGKA 5I07A 3IJIA 1OK6A 2BWGA 1AZ1A 2J7DA 4RCXA 5L9FA 4KESA 4XZNX 1J11A 3B9AA 2ZYFA 3GKAA 2ZADA 3INPA 1DWJM 1E0UA 3CB8A 3EKLA 4QDWA 5IDZA 4KGLA 1UP0A 1XIIA 4RNHA 3R8RA 3O06A 5TIMA 1A0DA 1NOWA 3UZWA 3GG8A 3MCNA 2VDHA 4LRSA 3B05A 3RO8A 2QYGA 4B3KA 3CL6A 4J4KA 4NU7A 5ABHA 3VD5A 1SU5A 3CWHA 2H3BA 3G1VA 6TAAA 1US2A 4OBTA 4O17A 3TTEA 2W55A 1W1IE 1I1XA 2NLIA 4ZVJA 1CZ1A 4S1FA 4B3ZA 1OF6A 1X6NA 1QMLA 1DJWA 3Q94A 2V6AA 3BCDA 1KM0A 1PB0A 1TPWA 5C7VA 1IGWA 4KEMA 5K9CA 5JU6A 1JQXA 3CK5A 2YB1A 3WH6A 5AKQA 1ISZA 1LF1A 4S3CA 3WLQA 4D6JA 2XFRA 3ZR4A 4RNIA 4NNBA 3VK5A 1BSLA 2GQ8A 2FYMA 4WSHA 3EKZA 1WPCA 5BNKA 1ZCCA 3P8IA 1PIFA 4P7OA 4J2MA 1HKWA 1Q6GA 4E2BA 1XKJA 3VNJA 4LA1A 3MHGA 1VFSA 2ZRWA 1B3XA 3BOXA 1ZAHA 2ZUMA 4CQ8A 2HTMA 2VC9A 3CHEA 3MHUA 1XFCA 3DUGA 1WO2A 2Q8ZA 4CNSA 3OPSA 4XX6A 1W1PA 4MUPA 3NSMA 4BWLA 2VRKA 5EMJA 4TVYA 3T44A 1T8QA 2OEJA 3E5PA 3S9YA 4QJ3B 3BGAA 3GE7A 4RV8A 2W79A 1JGMA 4Q3MA 4ERIA 1MZRA 3P5ZA 1UIPA 2Y7GA 2GVEA 2Z26A 4U33A 2RDXA 2YR1A 1PPIA 4GQ0A 3IVUA 1QNRA 3HFYA 2EPHA 3TSBA 2QCMA 6PTDA 5CGMA 2BS9A 1TWSA 3AXKA 6REQB 2WMGA 3GLCA 3K4WA 5A69A 2YA2A 1RCOB 4IMFA 1FOBA 4X0VA 3QHOA 1UZ1A 4H4VA 3U9IA 4ZO7A 4J3VA 4UC5A 4L1GA 2PDGA 2XHYA 5FL0A 1KRMA 5BMWA 1LLWA 5EBUA 1MI3A 3EWCA 1XLEA 1T3QC 2XTKA 1WKEA 3U2OA 3GNOA 3S42A 4R9OA 1CT5A 3H2EA 2FGLA 3CYJA 3DAQA 4O1DA 1E6ZA 2J74A 2XGBA 1O7AA 3LCIA 1VPYA 2OJPA 3BMVA 3S5SA 4BA0A 1XC6A 3QY8A 1E3ZA 2O4QA 3PZ9A 2C1HA 3L7RA 4QEEA 2ZXAA 1ME8A 2ZZ2A 3IGUA 1O95A 2EQ8A 2EKCA 2Y85A 1KM6A 1QNQA 1I75A 3UR8A 4DBSA 4I6VA 4UTLA 4H7CA 4M8UA 1PVNA 2NLYA 4FX9A 3B8VA 4OECA 1FP8A 1XLDA 1UASA 1H50A 1ODZA 4PZVA 4MF4A 1EOMA 3CPRA 2GJPA 3N2BA 1H7WA 2PDQA 3DYMA 2BY2A 1ZAIA 1Q6QA 1DWIM 1CB2A 1ELSA 4LUJA 2E8YA 2FMNA 1P0KA 4DUOA 1CEOA 3OBKA 1V7YA 4S3DA 4EKJA 4H9TA 4H8HA 1H2JA 4MY8A 3LCXA 2W61A 2G3FA 1LQ0A 1XF0A 3VOFA 2MUCA 3AUJA 4ACZA 3DK9A 4ORIA 3K13A 3GNDA 1GK8A 5C5YA 3U6WA 4IL0A 3N12A 3VOJA 3W81A 3QZEA 3RU8X 4Z2HA 4PULA 4DNMA 1H1NA 4WDUA 3ABQA 2WCSA 2YCJA 3GG0A 3ARTA 2CZFA 4AZBA 4RK8A 4GYFA 4L4MA 1V02A 5IHSA 3NO1A 4JTLA 4QDPA 1EIXA 3TYAA 3GDMA 3M5ZA 3VILA 1UZ4A 3SRKA