4HNCA

P. putida c92s/k166c/c264s mandelate racemase co-crystallized with benzilic acid
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
357
structure length
357
Chain Sequence
EVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALKSLKQLLDDMAAMIVNEPLAPVSLEAMLAKRFSLAGYTGLIRMAAAGIDMAAWDALGKVHETPLVKLLGANARPVQAYDSHSLDGVKLATERAVTAAELGFRAVKTCIGYPALDQDLAVVRSIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMFKALSIGASRLAMPDAMKIGGVTGWIRASALAQQFGIPMSSHLFQEISAHLLAATPTAHWLERLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWREKEIGKYLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent inhibition of mandelate racemase by a fluorinated substrate-product analogue with a novel binding mode.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
molecule keywords Mandelate racemase
total genus 133
structure length 357
sequence length 357
chains with identical sequence B
ec nomenclature ec 5.1.2.2: Mandelate racemase.
pdb deposition date 2012-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hncA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hncA01
4KPLA 3FVDA 3MSYA 3TW9A 3P93A 2HXTA 3EKGA 4GYPC 2PTXA 3GY1A 2AKMA 3K1GA 3TOYA 4DYEA 2OFJA 3ES7A 1MNSA 1BQGA 2GGGA 3FYYA 2AKZA 2QJJA 2GGJA 2XH2A 1E9IA 2PS2A 3H7VA 2PP1A 3QKEA 2DW6A 2PP0A 2PCEA 3OW1A 2FYMA 2AL1A 2PGWA 5BOFA 3FJ4A 3IJIA 4FI4A 2XH7A 3T6CA 1FHVA 4M0XA 3DFHA 4K8GA 3I6EA 3DIPA 4G8TA 3CK5A 1SJCA 1BKHA 3TTEA 4M6UA 4IL0A 3VCCA 4ZCWA 3DG3A 2P0IA 3Q4DA 4H2HA 3CYJA 4F4RA 4HCLA 1JPMA 3OTRA 4GGHA 4DHGA 2OG9A 2CHRA 3H70A 2FKPA 3PFRA 1TE6A 4IZGA 3UJRA 2PTYA 1NELA 2GSHA 4MKSA 1L8PA 2OKTA 2P8BA 3D46A 3TJIA 2OQHA 5ENLA 4H1ZA 4HN8A 3T8QA 4KT2A 3GD6A 1IYXA 4A35A 3TWBA 4E8GA 4K2SA 4G7FA 4H83A 2GGHA 3OZMA 3V5FA 2XH4A 3ZVHB 1P48A 4E6MA 1XS2A 2PTZA 4GFIA 3DGBA 2QDEA 4GYPA 3PWIA 3P3BA 5FJRA 3SJNA 3N4FA 2HXUA 3NXLA 2POZA 2QJMA 2QVHA 4GIRA 3UXKA 3OZYA 3ENLA 2HNEA 3HPFA 3FCPA 4GGBA 1RVKA 3MUCA 4GISA 3THUA 4JN7A 1WUEA 4KWSA 2PGEA 4HYRA 2AL2B 3MKCA 4ROPA 3UJ2A 1DTNA 1PDYA 3VDGA 3S5SA 3SN4A 3DEQA 2OX4A 4IP4A 4MGGA 2I5QA 2OZ8A 3I4KA 3ZLHA 1EBGA 1MRAA 3EEZA 4GMEA 4X2PA 4DN1A 3BJSA 3SSZA 3GC2A 2AL2A 3I6TA 3TJ4A 2XSXA 3P0WA 3SQSA 3TWAA 2P88A 1EC9A 1SJBA 5FJOA 3VFCA 3U9IA 4JHMA 4HCDA 4MMWA 4J3ZA 4E5TA 3NFUA 2PU1A 4J1OA 4ENLA 3DG6A 7ENLA 4IT1A 4DX3A 1ELSA 5FJUA 4E4UA 1KCZA 3IJQA 2OQYA 3N6JA 3R0UA 3QPEA 3IJLA 4ZA0A 1TZZA 2PP3A 2GGIA 3B97A 3T9PA 3PK7A 1KKOA 3MY9A 3T4WA 3RO6A 1OEPA 4KEMA 3V5CA 3ZVIA 2PA6A 3R10A 3GO2A 3STPA 3RGTA 5FJTA 2O56A 2QDDA 1EC8A 5J04A 1SJDA 3MWCA 1EBHA 2OZ3A 3RR1A 3TCSA 3JW7A 5FJPA 2QJNA 4IL2A 3CB3A 3JVAA 2XGZA 5BOEA 3Q45A 3DFYA 1PDZA 3NO1A 3N6HA 2GGEA 1YEYA 4YWSA 3RRAA 3NZGA 6ENLA 2XH0A 1R0MA 3R0KA 3VC6A 3S47A 3R25A 1W6TA 4FP1A 4A6GA 1P43A 3UGVA 3N4EA 2PSNA 1MDRA 3V4BA 2ZC8A 3H12A 3DESA 3BSMA 4E4FA 3D47A 2OO6A 2GDQA 2RDXA 3UCCA 3CT2A 4HNCA 3CXOA 5EU9A 3DERA 4JN8A 3MZNA 4IHCA 1TKKA 3VC5A 1JPDX 1KKRA 3FXGA 1MUCA 3MQTA 4HCHA 4DXKA 3H8AA 2OLAA 3UJSA 3CAWA 3ZLGA 2QQ6A 3UXLA 3DDMA 4Z1YA 3UJFA 1ONEA 3OPSA 3ES8A 3V3WA 3UJEA 3TQPA 2PODA 4IP5A 3BOXA 2NQLA 3VCNA 4HPNA 4K1WA 1KD0A 3VA8A 4EWJA 4DWDA 3QTPA 2P3ZA 3FV9A 1WUFA 3RCYA 1FHUA 3DG7A 2OZTA 5IDZA 2PMQA 3U4FA 3RITA 1XPYA 2PU0A 3R1ZA 2ONEA 2ZADA 4H19A 1SJAA 2PPGA 2MUCA 1EC7A 3IK4A 3QN3A 4HNLA 2GL5A 4Z17A 3QLDA 3UCDA 3SN1A 2DW7A 1F9CA 3OP2A 3ZLFA 2MNRA 1MDLA 1JDFA 2OVLA 1JCTA 3KUMA 2P8CA 3R11A 2OPJA 3SBFA 1R6WA 3PWGA 3SN0A 3ZVHA 1ECQA 2QGYA 1NU5A 2HZGA 2PTWA 4A3RA 3JZUA
chains in the Genus database with same CATH superfamily
5DCEA 3QC3A 1DWFM 4F0KA 2NZLA 3H2EA 4V33A 4I5XA 3DYPA 3K1GA 1EHNA 4L80A 3RM9A 2BY1A 1FFRA 4HPXA 1QI0A 3W74A 1LROA 2RDTA 3DC0A 1XYMA 4Q8OA 5E70A 4XX6A 5A6BD 3F5KA 5LHFA 3H7VA 3VNJA 2VC7A 1A5CA 2R1NA 3M4HA 2YPIA 2V6OA 3RFAA 1MEWA 3VE9A 3LB0A 3OQEA 5C9ZA 4XZIA 3WMLA 1G67A 3OYZA 4G7EA 5CPNA 2UBPC 4IMAA 1QW7A 4LB3A 4O57A 1KTBA 5CZTA 2HJPA 4QQ3A 3EGJA 3TXVA 4Y8EA 3GM8A 3KRZA 4QGCA 1WKDA 3PB0A 4GK8A 5J8LA 4ZOHB 1OFPA 4N6EA 1HL2A 3BXWA 5D30A 1AZ2A 4DEFA 4WF7A 2Y7DA 4AFYA 1EIXA 4X0NA 5AY7A 1RLDA 2GSJA 1LCOA 4O19A 2QDHA 4HD5A 4F40A 1GVYA 3GNPA 1GVFA 1BG9A 4JX6A 3VNMA 3GNXA 2NXGA 3VNKA 3M7SA 1AA1B 3CPUA 1FWNA 3GQYA 3OGRA 1LLOA 1J0ZA 1LUCB 3LTPA 4QITA 3TN4A 3WO8A 3TVAA 2O9TA 3CUHA 4KWWA 2E77A 2WHLA 2A1YA 3KOFA 1TG7A 2IKIA 1YQZA 1E3ZA 2UY3A 2W5FA 3VIJA 1PZ1A 1QI2A 5BXRA 4E8GA 6REQB 4LYRA 4G7FA 4C6EA 1UW9A 2IPJA 5FJIA 2BGSA 2VC5A 4R53A 1B31A 3KCJA 3OGVA 1P1MA 1IWAA 3USBA 1JAEA 4GYPA 4WLCA 5F4XA 2O9RA 1TCMA 1ADSA 3N4FA 4D1JA 2QVHA 3BJTA 1UPMB 2DUXA 3IRDA 3TMLA 3CUXA 4EXQA 3C2EA 5H8MA 4L64A 1VZWA 3BTNA 4AZBA 3JU2A 5F4SA 4NF7A 1VHCA 1TZ9A 1B3VA 5TAOA 4A3QA 5I3KA 2JEPA 3DX5A 3L2LA 3TSMA 3LNPA 3CEUA 3WNLA 1EBGA 1MRAA 4OBRA 5C2GA 2Z28A 2Y2WA 1D8WA 1H2IA 3IJ9A 3I7SA 3EOLA 2A6LA 1AW5A 2PGFA 5FJOA 4ASTA 1G5AA 3WBEA 4DO7A 1KCLA 2NQ9A 1GCYA 4RV3A 2BY3A 1MEHA 4NZJA 3JS3A 4F0LA 3WQPA 4N4QA 2Z2UA 4U33A 4YCPA 1UR4A 3BO9A 4ZB5A 4HVXA 1VC4A 1E6XM 5D2XA 4ENLA 2E67A 1YQ2A 1HKIA 1US3A 3GXIA 3S5YA 2BV9A 2QCDB 3UZWA 2Y89A 2DSZA 3IJLA 1KM6A 1FEAA 1WBHA 3MP4A 3GH5A 1ICPA 1O60A 4MYAA 1GEHA 1QI4A 1EB3A 1HL9A 2YDAA 1FWJC 1KO0A 4YHEA 5IM51 1HG3A 4IOTA 4H9MA 2PA6A 2Y8VA 4HA4A 1CPUA 4O50A 3CAKA 2QMJA 3GTFA 1T0OA 4NILA 3FSUA 2Y88A 5LXXA 5JMUA 3STCA 7PTDA 3W28A 2X1IA 3LTSA 3B8VA 4AU0A 1PJ9A 3KVKA 2WZHA 3GVQA 1XHGA 4XD4A 2FTPA 5FJPA 2X42A 4X63A 4CN1A 1J01A 1BXNA 2XGZA 3EAOA 1JZ3A 1NHPA 5GRTA 5BOEA 1RQBA 3U2EA 1FXPA 1W91A 1LRNA 3IRSA 2AGKA 4WRHA 3SUTA 3N6HA 3PG8A 3DCPA 1SFJA 1WP6A 3RRAA 3QY7A 5TF0A 3WEZA 3ZJ7A 2R9RA 3WQ6A 4HNTA 2V5JA 4WX2A 5U4NA 4D6CA 3U6WA 4QJ1A 3UR5A 3O63A 1EP3A 1DJIA 4DF1A 4QJ5B 1PX3A 1HJUA 3CXOA 2WHKA 3K13A 4JN8A 2FH8A 4H9TA 2DIJA 3K4AA 3NVTA 4U3CA 4KIRA 1BVNP 1Y65A 4GJIA 1YTEA 4DXKA 1OFRA 1EO5A 1UKPA 3R58A 4ACZB 3GD3A 3DK9A 3O7UA 2C3DA 3O05A 1N61C 3VINA 3NEVA 2ZX5A 2J9ZA 3EKLA 3RXZA 4IGSA 3V3WA 3H54A 3IWPA 3TQPA 3MO4A 4IP5A 1ZBCA 4JFWA 5C9XA 2JALA 2C1HA 2YCIX 3KE0A 3LZ3A 3ABRA 3GNRA 4TV5A 4QG9A 2R1KA 2ZZ4A 3NVYB 1TV5A 5EMLA 2IKGA 3AIEA 1QNPA 3SCPA 5I00A 2PLJA 3NQEA 3NSNA 3TFCA 3DOPA 4IWWA 4H19A 2PPGA 1REQB 5FS7A 4RNFA 4FB7A 2ZYFA 4RW3A 3Q65A 1ZMDA 3C2FA 3OP2A 4XIMA 3SIZA 2XISA 4AY8A 2MNRA 4GXPA 3TW6A 3W7LA 4FX9A 4YWIA 1TPFA 3T4CA 4LXFA 2WMHA 3PG6A 4HB7A 1UR0A 4ATWA 1GSNA 2GDUA 4ICNA 1PKMA 1ZQ5A 4IUGA 5EFDA 3WMSA 4WDXA 2BVYA 2GJXA 4A3HA 3VOCA 2V38A 3NQDA 5GJPA 3EWDA 3EPMA 1D9EA 1UR3M 2AKMA 3W6LA 2Q09A 1P0BA 2DUZA 4AWTA 3S1GA 3S1WA 4PZVA 1SGJA 3MYOA 1W5PA 4HN4A 1GW1A 1NFPA 1GORA 4HKPA 2DW6A 3KDNA 1K3UA 5LNRA 2YKKA 1LG2A 3EOSA 3B8WA 2Y63A 1DP0A 2A4AA 1GOQA 2GJRA 5BOFA 3TJXA 4G5DA 2YW4A 1RV8A 1YXYA 3FJ4A 4FI4A 2XIQA 3VABA 1VLWA 4S2CA 5CLWA 2A3LA 4WJEA 4BURA 4F9JA 2G4FA 9XIAA 3F4WA 1CX9A 3NOYA 4RLIA 3B4YA 5CPSA 4JTHA 2Z1KA 4LTSA 1CNVA 3RK8A 4U2ZA 1XLEA 1FWDC 3TN6A 1VBHA 4FXFA 5EMMA 4GYFA 3OIXA 4MKNA 3VOIA 4U3AA 4WKAA 4ZCWA 5M1TA 4NJJA 5CPQA 4S1FA 1AJ0A 1UKSA 2OKOA 4DUOA 3V35A 3CYVA 3GXTA 3V5OA 4HNVA 1RH9A 3KVJA 2F2KA 3PZVA 4IMDA 1AJZA 4TMCA 3P60A 5FACA 3QV9A 1Q6OA 1UWIA 3W2UA 2XSAA 1FWIC 1KFEA 4RXGA 1MWOA 4ZOBA 1VJIA 3MJMA 3KBWA 3NG3A 3RN6A 4KFNA 1H6VA 2PDCA 4AZGA 3A6OA 3AMDA 3QH2A 4ERGA 4JTDA 2C79A 5CZSA 1EQCA 4YCOA 1KW1A 3FVMA 3AMCA 2YSWA 4O1DA 3B8DA 1WZLA 1YDVA 4J40A 3BV7A 4OE7A 1G4PA 3L8KA 1NIUA 3NNTA 3M0HA 2D0GA 1ZHAA 1HW6A 4PMVA 1BYDA 1GREA 2VQTA 5ABGA 2YX0A 3AS3A 1LOSA 4Q8PA 5HJLA 1HKKA 3M46A 4HT3A 2POZA 4C6CA 1WDSA 2QGHA 3OZYA 5AVHA 3CQHA 1UROA 3M47A 1TA3B 5D09A 2E5CA 1BAGA 3FGCA 1E15A 2YOCA 1H1ZA 1LWIA 5IBXC 2H3BA 3F7JA 3C2OA 4CU6A 1DORA 1TQJA 1S46A 4P8VA 3CGBA 2WPEA 3OG2A 1UUMA 1N55A 4H3DA 4Y8FA 4O14A 4DN1A 5I0DA 3BJSA 4EVZA 3VKAA 3GC2A 2I17A 3CASA 1FHDA 4HNUA 1LL6A 1S2TA 2FHFA 3U9IA 1WBJA 3VIGA 2WYSA 3ZR6A 2XFYA 1GNXA 3HW2A 4FAMA 2PU1A 5FF0A 1JEZA 1KXHA 2DZAA 1RLCL 3ATZA 4O1CA 3NXFA 4EF9A 3EMQA 2X1SA 4K68A 6PTDA 4K1GA 4YXGA 4BF9A 3N6JA 3R0UA 3D9XA 1MUMA 1GERA 4UQDA 3GIYA 4GQGA 1UZ1A 4FNQA 5JXQA 1OC7A 1Z41A 1TYGA 4NZ3A 4ERIA 2EHHA 4AVOA 1A5UA 2VEPA 3R10A 3G1XA 3MS8A 3TQKA 1SZEA 4PL2A 4PMOA 4LCRA 5FEWA 4PMQA 1K9FA 2OWCA 4WJXA 4RE0A 5GQBA 2JQXA 3CU2A 3KL5A 3W73A 1UWUA 2CLEA 4WOZA 2Z1VA 3CB3A 4C1KA 1UYQA 4AIEA 3C5QA 1FOBA 3P14A 3DC8A 3SY5A 2QIWA 3WUGA 1X7FA 1Q3NA 3K2GA 5EB8A 2HK0A 3PZQA 5D03A 1O66A 1FWHC 4FP1A 2PB1A 1B4KA 1S5NA 3HA1A 7TIMA 1IWPA 2XWDA 5RUBA 1H5YA 1C8XA 1GTEA 3KX6A 4HQVA 5AN7A 1W9XA 1XHCA 4Y7EA 1TCDA 4RE2A 1QO2A 3PAOA 1JOAA 1YLVA 3PJUA 2GDQA 1TREA 3UCCA 5AHFA 2WQDA 3G1VA 4E2VA 1N62C 5GVJA 5F2LA 2ASHA 3DERA 1HVXA 4UTIA 3WH6A 2YXGA 3FLUA 2EPKX 2BY0A 3VIHA 3LK6A 4HA1A 3W6MA 3WDJA 2OLAA 4FA3A 2C0HA 1GYLA 2J88A 1ONRA 4DI9A 3T0AA 1R2TA 2EXOA 2OT0A 1GG1A 3E96A 4JR5A 1XI3A 3VKJA 3NIYA 3ES8A 4J3VA 1FO4A 2D23A 1KBLA 3PZOA 3VO0A 2PODA 2CBIA 1IZKA 4K38A 1XG3A 2ZUWA 3LENA 1OADA 1TX0A 4UQAA 3C2RA 1AMYA 3VGFA 1XIBA 3AYRA 3QC0A 2DV0A 1IEXA 1PL9A 1FTXA 2YA1A 3WD1A 1ZAIA 3E2SA 2WANA 4Y9OA 2ALRA 2J7FA 4A05A 3W00A 2FZMA 1VFUA 3LGGA 5C2CA 1PX4A 5LSMA 2IUZA 2C16A 4XKYA 4JNZA 2GL5A 3MV01 3T2PA 1UD6A 1XIIA 1V7AA 4KESA 4E38A 4H9UA 2VZTA 5HANA 1MDLA 4PMRA 3S0CA 2FZ9A 2H8XA 3R11A 2V67A 1R87A 1C7TA 4PMDA 2CETA 2A5HA 1GHSA 3CQJA 2E9MA 5FF2A 1H2JA 4BFAA 2FMOA 5A2CA 1BEUA 4U5KA 1KBIA 4NNCA 1P0NA 3BZJA 3U5YA 1WYIA 4LUSA 3UA3A 2C13A 3QZAA 1P6BA 5LIYX 5C6MA 1PZ3A 1U33A 2QCHA 3LLDA 2YVFA 5DBTA 2PP1A 1XBXA 2BXVA 2D3NA 3GUWA 2P76A 1U1JA 4AYSA 3PANA 3LLFA 5HOSA 1PHQA 1XLIA 3SEPA 5JBDA 4AQLA 3GR4A 1MRQA 3T6CA 1QUMA 1KGXA 3A5FA 4RDWA 1LRTA 3RNDA 1Y8BA 4Y6GA 3EZ4A 2CBVA 3B0XA 3PSVA 2NXHA 3I6EA 1L6YA 1FCBA 2JK6A 3KHJA 5D2YA 1E9YB 3SCWA 1X39A 5G4EA 4M6UA 4PMZA 3VCCA 3S6TA 4JIPA 3AO0A 4IQLA 1V8EA 2VP8A 4E8CA 3QFWA 1VLIA 1SO6A 1UZ4A 2E6YA 3C2VA 4L6HA 1D2KA 4HCLA 2XYLA 1US0A 5EPDA 1ISZA 1OM0A 3WH9A 5C5YA 3WL1A 3W23A 1YDOA 3H70A 1TSIA 4V1XA 4JTFA 1J5TA 1E4IA 5DBUA 3H24A 2BG5A 2ATMA 1K77A 2P3EA 3NQ7A 3M9YA 3GD6A 1G4TA 3QM3A 2EG7A 3BLIA 4AXKA 3FA5A 3G5EA 4HPGA 1Q8JA 1FKXA 1PYFA 3S8HA 2YL5A 1HZYA 1P48A 3IACA 3N18A 4E6MA 1UUOA 1LBLA 3NTYA 1JVNA 2NLIA 3UXAA 4HJFA 2X0SA 2RJGA 1IXOA 3UZZA 1LLZA 2JBMA 3WK3A 3SJNA 4ZR8A 3MSRA 3GUGA 1Q1RA 4IH3A 4XTDA 2ZRWA 1GOXA 1RPXA 1TRDA 4CD8A 1NSJA 4PRTA 3H2FA 1WUEA 1HP5A 1U5JA 2PRHA 1U1UA 1IEVA 4LWWA 4V2XA 2F38A 4H6KA 3UJ2A 1I2RA 1P7TA 3BGJA 3S1UA 4HPHA 3WY1A 9RUBA 4IJCA 1QVBA 4DWSD 2YCLB 3CH9A 3WL0A 1S1PA 1UQYA 1E0VA 2AL2A 1KXQA 5L9FA 2I5GA 5DCBA 3AIQA 3GXNA 4S3DA 3L4YA 3AHZA 4J3ZA 1PAMA 3EX6A 2D2JA 3ZSSA 2C91A 1KB3A 3DK4A 1XRSA 4OBTA 4YTQA 4M7TA 2Z27A 1U5HA 5FA5A 4D8ZA 3NL5A 1A5LC 3B0YA 4LVFA 5JCIA 1ISXA 2J8GA 4IPNB 1Q65A 3TA6A 3IPWA 4ZXLA 1CLVA 2J6VA 4JTJA 4AC1X 1E4MM 1OCJA 1BYAA 4DPPA 3LBCA 1LYXA 4MZ1A 3WQ8A 4RZBA 3ITVA 4NQ1A 4W87A 2EG6A 1ICSA 2NW0A 2DH2A 1JQVA 2Z6IA 2O56A 4LNCA 3ONCA 2GK1B 3WENA 3UWQA 5HK4A 3N2TA 2HK1A 3CUFA 3F03K 2HQMA 2GWNA 3O8AA 4LYKA 4XV0A 4O28A 2VI0A 1PDZA 1XKJA 3SR7A 4FF5A 4JTEA 4YWSA 2INFA 3NZGA 1G4SA 4D6FA 3W6YA 2FPVA 3OQ8A 1SYTA 2NSOA 2I9UA 1EIBA 3LCWA 2PDMA 3WBXA 1XM3A 4B5TA 2DH3A 2IXVA 2XUCA 1FDYA 5DY3A 1DJGA 3VIMA 4MLJA 1UP0A 3P8IA 4ICCX 3EPOA 3NZQA 3D47A 2GJPA 1BF6A 3VIFA 5K9XA 1ISYA 4GY7A 3YPIA 5D02A 3T05A 2CLKA 2ZVIA 2WSQA 5EMKA 4AMAA 4JEQA 3MANA 4GINA 4N6FA 1PS9A 2H6RA 4FLSA 2VD9A 4J3WA 3EB2A 3M44A 3RAOA 3PBWA 1W9UA 5C7HA 1BXBA 4CCEA 2VJXA 3PPCA 4ATLA 1K7FA 4BS0A 4YU1A 3AU6A 3BOXA 3VIKA 5EL1A 1UKQA 1DXLA 5CG7A 1VIWA 2V3DA 1HL8A 2QCFA 3T1GA 3VYLA 3HG2A 3NPVA 1BPLB 2Q3RA 4M24A 4MDOA 4O1BA 3LQLA 5JQ9A 5IDZA 5M5DA 4NAEB 3I68A 1IXQA 4HMNA 4QNWA 1SW7A 1XGEA 1HKVA 3W7KA 1ESWA 1JRCA 2PWDA 4H4QA 2DW7A 3CHCA 3JUGA 3WJYA 3VGDA 3GWQA 4F9DA 5CH9A 4Z2JA 2OMAA 1CI1A 4L56A 3CLWA 1XIDA 1FWTA 1CLXA 3A23A 4DAFA 4B9ZA 3CUZA 1K8YA 3VKCA 2OPJA 3ZM8A 4F0HA 3W7RA 3L66A 5CZ0A 1REQA 2QMKA 3W01A 5HNNA 1N63C 1C91A 4F48A 2VHLA 4I3GA 1JDDA 4NX0A 3B9NA 1OD0A 1ONFA 1JUKA 1Q6EA 4K3ZA 4A3RA 4EOUA 4D2JA 1X6LA 1GVSA 3WCZA 1RXOB 2RFGA 4GFSA 4QNEA 1B54A 3EWBX 4BI6A 1YRRA 4GYPC 5GNXA 3GY1A 1TWDA 1L0PA 1PWLA 1S1RA 1LZOA 2QCLA 2AKZA 1TRIA 1JCJA 4KKXA 4CN6A 1XSKA 4N9DA 4JKKA 4Q6JA 3A9BA 1XLJA 7ODCA 3HU7A 2ZE0A 5FKYA 1XIGA 5CSRA 3E0WA 4GKLA 1A3HA 4DLMA 7TAAA 4H50A 1VD6A 2PGWA 4Q8VA 3NPWA 4DB7A 2R1PA 3UZYA 2X1TA 4PFMA 4D8LA 3N73A 5H2ZA 2J77A 3WLKX 3DFHA 1EEXA 3RG6A 3WQCA 5FD0A 4PTWA 3BCFA 1S38A 1EKOA 2GVYA 1F76A 3GR7A 4OUEA 4BWLC 3W1TA 1PBGA 4GRTA 4J3XA 2FVKA 4D8AA 5F1UA 4F66A 2E8ZA 2TAAA 4ZMGA 1J2BA 5LNVA 1S5MA 2ZRUA 1OFBA 3UWWA 4LAUA 6TIMA 2NVCA 4JCLA 4CQ9A 4PUEA 4MJ4A 1XSIA 3N25A 5BCAA 4MB5A 3DH7A 5IFPA 4W9TA 1IXPA 2FKPA 1KR0A 1FFVC 3LI0A 2OSWA 2BBFA 5CC5A 4K7YA 3VKBA 3BMXA 3AIRA 3EX3A 3IJ8A 3MHFA 1AFSA 4MWAA 4BHYA 4JD4A 3D46A 2Z4GA 2GDVA 1TV3A 3C4UA 4LPCA 4KT2A 2V3FA 4Y96A 2PAJA 5E0FA 3EX1A 1CGYA 4AEFA 4W89A 1PV8A 3R13A 4INFA 3W25A 1SSDA 2EF9A 4UZSA 1TQXA 4Q8MA 3NDOA 4RNHA 3ABXA 2RDUA 3CGTA 2ZIDA 3DGBA 3GD4A 3AMLA 4IMCA 1ICQA 5A8OA 4B15A 1R7AA 3ZJ6A 4PEEA 1B3XA 4MFDA 2CWNA 2C14A 2FZNA 3TN3A 3S2LA 3T8LA 4RDZA 2DZBA 3SB0A 4DLFA 4IXXA 1QFEA 2XIJA 3DU0A 4QXIA 4D1IA 4GZIA 3W76A 4WXYA 3C2YA 4LGXA 1NDWA 2QUVA 1HKWA 1KC7A 2ICSA 4OQVA 4FMVA 2FJUB 2I5QA 2X0YA 1E5NA 1XIEA 4LX4A 4D9PA 2TRSA 2ZDSA 3G2GA 1YADA 1SZRA 1BGAA 3SCUA 2W91A 4FLOA 2GQ3A 4LOCA 4JTAA 1OCQA 1EC9A 3TSBA 4YYFA 2PWVA 4HCDA 1YYAA 2ZOXA 4NAFB 3V36A 4WDUA 4J3TA 3VZYA 2W3RA 2FFIA 4J1OA 1IHIA 2BC1A 3CQIA 3ZWTA 3QFBA 1XLLA 1Z3NA 4O1FA 1QWKA 3LHTA 1ELSA 1VPXA 1JJKA 3IVSA 4XISA 4PBGA 1D7YA 4M6VA 1H5VA 2DFAA 1TZZA 1FFQA 2PP3A 2VURA 1FWFC 4YPJA 1K03A 4N02A 3MY9A 3TZFA 4O52A 1CCWB 4B5VA 4D71A 2DJLA 1KN0A 1ZBKA 2X2GA 4PRWA 4TVCA 4UNIA 3WLQA 4NJIA 3WNPA 4PUMA 3RGTA 3PUOA 5AFDA 5CZJA 2BC0A 5A6KA 2WCAA 1DE6A 4V1YA 3TYAA 1VBUA 2PFHA 4AAJA 3KTCA 3SR6B 5AZ1A 3AHYA 2QJNA 4LRSA 4LW7A 5AHIA 3PNZA 1YPXA 5D8ZA 4DBWA 3I6RA 4EXBA 4PCFA 4GO8A 5K9CA 3IIPA 1XH1A 3SDOA 3UY8A 5IDIA 1NTHA 3UWUA 3DYOA 1WNOA 4C6PA 4X9YA 1NFGA 3N19B 4L1XA 4MWAD 3WLIA 1TA3A 2R24A 3NVWB 4H4XA 3GE7A 4AZ7A 1WKYA 1EQPA 5HUPA 2FHCA 1K9DA 8XIMA 3GU2A 4UCFA 1OYAA 4PTVA 3HV8A 1Q13A 2WMFA 3IJ6A 1LM1A 4HNCA 1H7RA 2E8YA 3WLHA 2C3CA 1WDDA 1XW8A 2C0AA 3OYXA 4HSNA 5LZLA 3MZNA 3E5PA 3GXFA 4IPIA 3VC5A 3GK0A 2A3EA 1NP0A 1P5BA 3UWYA 3VU2A 3LB8A 1FUYA 4FPSA 5A1AA 2VX5A 3CPRA 1KFWA 2SFPA 1OGBA 1P6WA 1R86A 4JQ2A 5EYWA 1ONEA 1ZS2A 4U31A 3IS4A 1G01A 2D2HA 2B4GA 3JR2A 1R2RA 1OX4A 1QHOA 3LPGA 5C0QA 1E6NA 3A3HA 1UZHA 2BOFX 3QY6A 2ZUVA 4GNKB 2Q8XA 3RPTA 1W1YA 1TVLA 3G1AA 1V93A 3E1F1 4GHRA 3GFYA 1E40A 3M43A 4B3KA 2XDFA 4XVDA 5XIMA 1IGSA 3QTGA 5B80A 1E73M 4ZO9A 2VO5A 3WDIA 2G37A 1BWLA 3W38A 3QEZA 2D20A 5FEXA 4EF8A 3Q94A 3BPWA 4AZHA 4QLLA 3CL7A 4L6DA 1UC5A 3HGOA 3OODA 3OOQA 4KQNA 1V6YA 4L9YA 1FA2A 4FXRA 3TXZA 5DRIA 3CIXA 1RJQA 5U25A 4UTLA 4UUIA 2YDSA 5EMYA 3B9AA 2ADAA 3EWCA 1O5RA 1K8CA 1JCTA 2HVOA 4AXNA 1YDNA 3II4A 4GG9A 3S9YA 4XKMA 4BQ3A 3HIJA 3UVIA 2VRJA 4R7OA 3I7QA 3KWXA 4JIIX 2RGMA 5K3VA 3UEQA 4MZ8A 2Q71A 1PHWA 1H61A 3C86A 1HKJA 2GUBA 1SFSA 4IFOA 1QHZA 2OWXA 2XIBA 5F2IA 3T81A 3PZUA 4JX4A 5AZ0A 5KZMA 3P93A 1DJYA 3QR0A 3CO8A 3SGUA 3FW6A 4LJ3A 3AIVA 5JCKA 2Z6JA 3OJGA 3Q2DA 2GGGA 4Z1BA 2XH2A 5FS9A 3Q37A 4E2BA 4GI8A 2WM1A 2WHMA 1DIOA 1XINA 3HZ3A 2V81A 3LHUA 3QOMA 1J2WA 3S1XA 2J9YA 6A3HA 3BUVA 2PC4A 3MCMA 3TKFA 1JI1A 4AVFA 3N15A 4CNSA 3IIXA 1RY0A 2YLLA 2CLLA 4GUIA 2F2HA 3BJFA 1SU5A 2HS8A 3CS2A 1E51A 2Z0IA 1UBPC 3DHDA 2Z7KA 3AXXA 4LUIA 3QSTA 2GJXB 1JCLA 2W61A 1E1EA 1RUSA 1UZDA 4JCMA 3QVQA 2CKRA 1H41A 1EOMA 1W5QA 3K8LA 2JF7A 4QE1A 3TLLA 1JCYA 2CLFA 1O68A 4JTIA 1H0GA 3IVTA 3NVDA 4WZHA 4QROA 2ACSA 3U2OA 3O6CA 1JPMA 4MKVA 3AMKA 3T0DA 4YIWA 4PN2A 3OTRA 3AALA 3LMYA 3WQOA 4EQWA 4GD0A 2WSRA 3T09A 2VEKA 2YB4A 1Q66A 4IZGA 3UJRA 1FECA 1JROA 5ABFB 3IAQA 4GI4A 1J93A 3V0SA 2E6DA 1EZWA 2VR5A 4O0QA 4FNPA 4P7LA 3A4WA 2WOQA 3E6EA 4J35A 4BQ2A 4DY1A 5C55A 4H1ZA 1KCXA 3W2KA 2R9ZA 5C9UA 1XLGA 4UR8A 3S2CA 4W5ZA 4HGXA 1SR0A 3SZ8A 4K2SA 1R3RA 1VBJA 3SGGA 4MNKA 1W8SA 2V30A 2GGHA 2NPXA 1V6XA 5HINA 4FF7A 1M7XA 3W75A 1XYAA 4C6QA 4GLEA 4NG3A 4WQ6A 4AHPA 3SSJA 3LCIA 3PWIA 2IQDA 2NVAA 2HEJA 3QV8A 2HSAA 1TPC1 2XVPA 4Q8UA 1CGWA 1MW0A 4CNOA 1OFQA 3MMTA 5MKGB 1KTCA 1KQZA 4NZCA 1FXQA 3FKRA 2A85A 1RVKA 4PCTA 3LM3A 2VX6A 5JH1A 5BWAA 2P50A 5D38A 3KWSA 4YWOA 3G6MA 5E0KA 3KDOA 4I6VA 2H9AA 5SWUA 4X60A 3VDAA 1NP2A 1Y5WA 3VDGA 2YL8A 1GOKA 3VCRA 3U2ZA 3DBNA 3WIJA 4NYUA 1FCVA 2J75A 3BQ5A 1MQPA 4CUCA 1LT8A 5CZKA 4C60A 1I2NA 3UT0A 4HHPA 4M56A 3TWAA 1A50A 1OVDA 2P88A 2W6RA 3UERA 2ZZBA 3LBOA 1H50A 4LAMA 3L5AA 1AOGA 1XD0A 5D2VA 3CWOX 2ZZ1A 4W7WA 3TQVA 2ZX7A 1UCWA 2WPCA 4L65A 5EBAA 1WX0A 2HVNA 4B5NA 5FJUA 4E4UA 4Q4SA 5KMYA 4TVUA 3KRSA 3GH7A 1RBAA 1H7NA 1IIHA 4JHOA 3PAJA 1W1B1 3P6LA 3BW4A 2PDXA 5A3HA 3G8EA 1KKOA 3IGUA 4LT9A 1OEPA 1UR2A 2D3LA 5LNUA 3NO5A 2QPXA 1E0XA 1KNWA 1V6VA 4GA8A 3LXBA 3GO2A 1QNVA 5BMXA 3W7OA 4LVDA 3QGVA 1WO2A 4C65A 1O5XA 1V3JA 4Z2HA 4P8XA 3LUTA 2CNCA 3HMCA 1RSCA 2BZNA 1ZP3A 5D9MA 4LUYA 1KBJA 2FJKA 3APYA 2ISSA 4CCDA 2EGZA 4B5WA 1GOMA 3NL3A 2CZDA 3HPZA 4NU7A 2VVSA 4QTGA 4I8YA 4ACZA 5H1WA 3CL6A 1E9LA 2WVTA 4PSRA 4EPEC 1OFDA 4UTFA 2QV5A 4B91A 1AJ2A 1H09A 1FH7A 3LCGA 5BYWA 2C6QA 2E7FA 1YE4A 1HJWA 1HVQA 5I79A 1UOZA 4DZAA 3PZGA 2HDJA 3BSMA 3CTLA 4UQEA 3N2XA 3VDCA 1WPCA 1LP6A 3T42A 5AYXA 1RAKA 4C6BA 1N5XA 3S2MA 1JG9A 2VFHA 1KKRA 3C0LA 2OQLA 5I03A 3ZYZA 3FXGA 4FSAA 1J0IA 3DECA 4JS3A 4LCQA 1UD5A 4QFUA 4L61A 4QSHA 1HQTA 5IHRA 1GOWA 1NPXA 2QQ6A 4ZL1A 4JYDA 4GE8A 2RJHA 3U7BA 3O9NA 5I3JA 3LPFA 4M7SA 2OOGA 1ZNNA 1TPB1 1IR2A 2XGIA 5LNSA 4MAVA 3VCNA 2V2HA 4HOWA 2WP6A 1SZNA 3E02A 3WBAA 1H1YA 3L5MA 1E0TA 4IIBA 2VEIA 3W27A 4R34A 4EMWA 3W1NA 1SSGA 3DG7A 4WY0F 4LUSB 3FYPA 4ILSA 1OYCA 3LERA 4PODA 1SR9A 2PDHA 1SUXA 3MUAA 2EO7A 5A6TC 2B7PA 4KF1A 3E12A 4YTTA 4EKJA 3MKVA 3B0UX 3GNNA 5JCMA 2GK1A 4LB4A 2DY3A 1H1NA 3TA9A 4HIBA 3W1MA 3CQ0A 4YTRA 4A2SA 3KP0A 2OELA 1JF6A 4GX9A 3ERPA 1RD5A 3GC4A 1CEOA 1VS1A 1NU5A 2CZ5A 3W1LA 4XAYA 4X3ZA 2Y7EA 3TW9A 2O55A 3B3DA 3RMJA 3HJZA 4O16A 1T7LA 2J13A 1FCQA 3W4RA 2EQ9A 1EJ7L 1GVEA 1NFBA 1GRTA 2WNWA 2YQUA 1UHVA 4P5UA 4I6KA 1D7FA 3DZ1A 3CUGA 3OVRA 4Q7BA 1ONWA 1Z6KA 4G1NA 1QBBA 3W22A 3B4UA 5I78A 3NCOA 2CLMA 4XZMX 1GKRA 1TTIA 3A4JA 2DQWA 1ZBVA 4XIAA 5EGRA 4BJHA 4IICA 3PVFA 8CGTA 1CZ1A 5G4WA 2VL4A 3GBDA 5PTDA 1JZ2A 1WXYA 2CYGA 4GZ7A 1CYGA 2CPUA 1BGGA 1N8FA 2G3IA 4ZOEA 3URAA 3WH5A 3VMPA 2Y7FA 3L9CA 4HK5A 3SCRA 1CXKA 1V79A 4GABA 3W7MA 4DM2A 2OG9A 3I3DA 4K7ZA 3H4GA 1OJXA 3O07A 3W37A 7CGTA 1Y7VA 3IV8A 1U83A 5EMJA 4GNJA 3P62A 3PZIA 1B0IA 1NDVA 1NELA 4LFYA 5HWMA 2X7WA 4G6CA 2NSXA 5LHEA 1Q7MA 1XG4A 5ENLA 4HYVA 3MP3A 3RU8X 2YDQA 1VRDA 4MJMA 1AMKA 1QWGA 1WDPA 3WBYA 1XLDA 3GTNA 3T7VA 2ON3A 3L0GA 4MPQA 3NSMA 2YR1A 2XVKA 3ZQ9A 4MY9A 2ACRA 1E56A 3COTA 4KRUA 4ZBCA 1H4PA 3ANVA 3S9ZA 1XISA 2EQ7A 3QOKA 3L7RA 3CGCA 3NXLA 4M1BA 4N9CA 3UXKA 3AWNA 3RM8A 1LBFA 4I5UA 2QCCA 1W9DM 4AX6A 2Z1BA 4GGBA 2WK2A 3N9SA 2Y5EA 4KWSA 4YVXA 4BZYA 1OT2A 2AL2B 4NEVA 3MKCA 2PTDA 2HBVA 3CIWA 2XVNA 1PDYA 4XAZA 3REQA 1ZK7A 1TUXA 2OZ8A 4AC7C 1A0DA 2FPYA 3EEZA 4X2PA 1T6MA 3AOFA 4RZ5A 1XX1A 1HIZA 2V9DA 4O12A 1Q45A 4PUKA 3TJ4A 2GQAA 2J8FA 4PUDA 1AD1A 1UA3A 3R7MA 1MW1A 1BZLA 1HTIA 5CAHA 2Y5JA 1L2UA 1IE7C 2ZRYA 3F2DA 4DNAA 4AWSA 4UTWC 2BSLA 2PBGA 5K7JA 2AGTA 1N7KA 1G9HA 1M03A 1ZJBA 5HULA 1LOLA 1P0EA 2EAWA 3O3RA 1IT0A 4GYKA 4XD5A 4NZ1A 2QT3A 3EXRA 3B97A 5CJNA 3SCVA 3T2QA 4M8UA 2V5KA 3SRHA 3TN5A 4O13A 3RPMA 3UA4A 2Z7GA 4PCPA 1GETA 2HPMA 4DO4A 3FNDA 4U28A 2XFRA 2ZICA 4EE9A 3STPA 5A6LA 3SY8A 4F2UA 3UY7A 4ZOAA 1KXVA 1S3TC 5CXPA 3WLLA 1UBSA 3QZEA 1TVPA 3GHRA 1KXTA 3AYTA 5DELA 4G2DA 1GQIA 4PEKA 3JVAA 2NVKX 1F8IA 4LF2A 2CIPA 4WXZA 1BWVA 2JKPA 3BV4A 3O6YX 1V5XA 4FO4A 1XLHA 1OK4A 4W88A 1OT1A 1Q5MA 4US5A 1GHRA 4ZODA 4OJYA 1MO9A 2JGQA 2VZUA 1W1IE 1J6PA 2ISDA 1P43A 3SO7A 3UD6A 3SUSA 1MDRA 3TAKA 2E9BA 2WCSA 4WSJA 4ICMA 4UQBA 1Q7ZA 4JFVA 2HTMA 3G3DA 4C7FA 4FDCB 4XAGA 1TWIA 4UQ9A 4HHMA 1LORA 4PCSA 3CNYA 1V3LA 1Q6LA 1CGVA 4PTMA 1F8WA 1OIMA 2QKFA 2WLYA 4RE3A 3G3MA 1ZMCA 3FJLA 2FZ8A 3BL3A 3M0KA 2ABBA 2WWDA 3GHTA 5GJNA 4R27A 1NY1A 1OG0A 4O15A 4FX8A 5AKQA 3ORWA 2XSBA 2G3FA 1CGTA 1FP9A 3GVWA 4A4AA 3QR1A 4I9AA 3M6DA 4HMCA 4O0ZA 2DZPA 5TNVA 1L6SA 5B7YA 4LS2A 1N8WA 4R33A 4HHLA 1FCUA 3MUXA 3KCLA 4BEUA 2FMNA 2OX1A 3GRTA 4XAPA 2KZHA 4K1WA 4DYJA 2G8ZA 4HOZA 1KD0A 1TMQA 3WK0A 4CVUA 4DVOA 4ZTYA 2GVGA 3A7UA 1S5TA 2PMQA 3R1ZA 3A5VA 5EFFA 5A69A 2J78A 1FWAC 1ALDA 4Q8NA 4J9JA 4XZHA 1MQRA 3N34A 2FH6A 2QIIA 4ML9A 1JRBA 2W3ZA 4MIMA 1QXLA 3NGFA 1ISWA 4H4ZA 4W85A 1DXIA 5DX7A 4HU8A 4Q7NA 3OVPA 5HDRA 3BAWA 3K4DA 2CBUA 2CFYA 2Z2AA 1JCMP 2QGYA 3URHA 3GNOA 2VT0A 4KPLA 3OB8A 4IIDA 1XYCA 3LI1A 3U57A 4XUYA 1O94A 3KEHA 5HMDA 3EYPA 4R7JA 3EEGA 3CZKA 4AIBA 1XDMA 1BYBA 2BODX 1X8CA 3AFBA 2BVWA 1G94A 1F3WA 2GR0A 1XICA 4TV6A 1S5WA 5C54A 3E0VA 5KEZA 3C56A 2V82A 3ARRA 4KBXA 4RZ6A 5DMYA 1F61A 4RXFA 2WZTA 5A95A 2JEQA 1DNCA 3NYZA 3A12A 1ITUA 3WJZA 1ENUA 3QW3A 2YYTA 4U2YA 3MBDA 1A80A 4RX0A 3PBYA 4QSFA 1BKHA 1BWKA 1TJ1A 1NAL1 2WC4A 3ARXA 1RCOB 1XV8A 3TYZA 3WLTA 1FWGC 3W1QA 1TVNA 4UOZA 3Q4DA 2PDPA 4WOQA 2OLSA 4F4RA 1IZCA 3TONA 2ZQ0A 2P0OA 5HJYA 3IC9A 5B7ZA 3G0XA 1QT1A 4FOKA 3MUZ1 2XVLA 3MJYA 4B5SA 4HPJA 1EX5A 1DEDA 3F1QA 2RH9A 3W7PA 2YL9A 3W2JA 4JIQA 2ATSA 4NI3A 3HFYA 3H2MA 5AC7A 2W67A 4IUOA 3EMZA 1J11A 2P8BA 2A7PA 2NWSA 4PTNA 4C1NB 2J7DA 2X30A 2BVTA 1R2SA 2Y6ZA 5BZAA 3AHXA 4X61A 4NSBA 4IFKA 1N2VA 3BAJA 3V5FA 3THQA 4LCSA 4YTUA 3DFQA 4GWEA 1XIMA 3TC3A 3RPDA 1UMYA 3KVMA 3EDEA 4K39A 3L65A 2QDEA 4MLRA 2BB0A 4AG0A 3CLMA 4H4VA 2C1GA 3TC7A 3VIOA 1JZ8A 4GQQA 4G9PA 3GG8A 4YN5A 1FWSA 1VYSX 1XBZA 2X1UA 2PDWA 4IISA 3K4WA 3RU6A 3XINA 1NQKA 4ROPA 4NJKA 2Q01A 5BRBA 5LYRA 3BAYA 1F4AA 3VM7A 4LU0A 3S5SA 3DEQA 5IFTA 1C92A 1F2JA 2VZOA 3LPOA 2ZX8A 1R30A 4BF7A 2CBJA 4GMEA 4Q8WA 4ZE5A 4NRRA 5C8BB 4LIIA 5AYIA 3KRBA 5JU6A 3W53A 5FEZA 4Q32A 2WSYA 4EQSA 2JE8A 1QNOA 5TIMA 1SJBA 2QAPA 3UF9A 3UXDA 3IGHX 5D4YA 2VNCA 1CXHA 1QATA 1BRLA 1SW0A 3HFTA 3QF0A 2WXDM 1V0MA 3RCNA 1YX1A 3W81A 4EXAA 3NFUA 4LVBA 3DENA 4DX3A 2Y24A 9CGTA 3VMNA 2OQYA 3UG8A 1EHAA 3DKLA 3TROA 1TB3A 2HMCA 4QG8A 1IEWA 3MUIA 1XLCA 1RK5A 4M19A 5JBEA 4S3JA 5A8QA 2TPSA 3T4WA 3N2MA 2Z24A 1I8JA 2F5ZA 2YBUA 4KEMA 4AZIA 4KEZA 4Q22A 1A5OC 4TXEA 1F3XA 1HP4A 2BOEX 1JEHA 3AXHA 1V97A 5A2AA 1QNSA 4BV6A 1TX2A 2WB5A 4UFHA 1GVOA 4CCZA 5TR3A 1T3QC 3THAA 1DL3A 4M82A 3HN3A 5D04C 4TVYA 2FIQA 4CKQA 2PDUA 1T5AA 1BFNA 2GGEA 1JYXA 3LHYA 1E6PA 3W0KA 1S2CA 1B3WA 1PO9A 3LYEA 1JZ7A 1FQ0A 3RX3A 1W6TA 3N11A 3N4EA 1HT6A 4MB3A 4AMCA 3W1XA 4I7VA 6REQA 3P61A 1V03A 1EWDA 1W8GA 1A49A 3DESA 2ALDA 4F8XA 5I3DA 2QYGA 3P0XA 5G1YA 2DZWA 3W7IA 1VH7A 5AYZA 1A5SA 2Q8LA 3SIMA 3UNDA 1ZFJA 5EKYA 4C7DA 5LXEA 3UR2A 4Q3MA 2FTWA 3H2CA 2E68A 4IHCA 4NKCA 4IQDA 2NUYA 2A8XA 1PE1A 5KZ6A 1Z89A 3TR2A 2QXWA 3E2QA 3H8AA 3UJSA 4CQBA 5G5HB 2QF8A 4DJDA 1UIOA 3MHGA 2FVMA 2WNNA 1C7SA 3UZ5A 4CNNA 3PPFA 5M2FX 3LV5A 4GPNA 1MI3A 1JGMA 4KCTA 4O11A 3W71A 5HNRA 2PURA 3OVQA 5M03A 1J79A 1J8VA 1K7XA 4GC4A 2EPNA 4K36A 2CC0A 4ZFCA 5CBBA 1HJSA 4A22A 3HF3A 2ISVA 4ZVJA 3UZXA 1BF2A 1W3KA 4OT7A 4DWDA 3ARUA 2WBAA 6TAAA 4MNJA 3M5VA 1QU4A 3VD4A 1KBBA 3B06A 1O7AA 1XCWA 3OBKA 4ZENA 1CT5A 5KZEA 1JD7A 4JL1A 3QHMA 3QXBA 4D6JA 2WSPA 2W27A 3KL0A 2XN1A 3FEMA 3KLLA 1F9CA 1WAWA 4QDMA 2AQOA 2QS8A 1LL4A 3DJJA 3NZ1A 4FALA 1RCXB 2BS9A 4L6OA 1YPIA 2FGLA 1GG0A 1OINA 2NXIA 3G77A 1OF6A 2XU2A 3M5YA 1R5YA 5GJMA 3O16A 3ARWA 3FKKA 2VM8A 4IIHA 3E0FA 3LZ5A 3FVDA 3QHOA 2J8TA 2XFFA 4FNSA 4C6OA 3EX4A 2HXTA 3EA2A 1X8FA 4L1GA 2I16A 1UH2A 1W3HA 1IQ8A 3ZJKA 1MNSA 1Q1WA 2BP1A 1BQGA 3O0HA 4PL1A 1EXBA 4B9YA 4S3CA 4EPBC 1V0LA 2V8ZA 3NOEA 4ERAA 2HNHA 2FDSA 3L23A 3OG3A 2VRKA 1PKLA 1X1OA 1R3SA 5L6UA 5CJ5A 3DAQA 3R0DA 4NI8A 4ROQA 2Y8KA 4NASA 1XDJA 4Y9PA 3W84A 2Z26A 4M1RA 4UNKA 2R82A 1QW9A 1J0HA 3ITLA 4K8GA 3HOJA 5DT7A 2WPBA 2EBNA 1H7PA 4BI7A 1VFLA 2J7CA 1EL3A 3VIPA 3OLGA 4I90A 4HNNA 3LQGA 3S6DA 4GACA 4CD7A 3L4XA 3DG3A 1OF8A 3HM7A 1GOIA 3EF6A 1G7UA 2NUWA 1ML1A 2YAUA 4LS0A 4IPLA 4W8BA 3BQ6A 1J12A 3FK4A 3F4CA 3DYMA 1YDYA 3FA3A 2XM2A 4GGHA 5CBJA 3K8KA 3DK8A 4FNTA 4KW2A 4BY3A 3ITXA 1OGSA 4UCGA 3PWAA 4G1KA 5F2GA 1RCQA 5ABEA 1A53A 3B9DA 3TYCA 2O7SA 3WK2A 1E0UA 1EUNA 5CEWA 3GZ3A 1L8PA 2OKTA 3N9KA 5HUOA 2OQHA 3BLKA 3N14A 4JGDA 3Q67A 2F6XA 3DXIA 4GX8A 2YVGA 2YYUA 4KEVA 3ZSTA 4XD3A 4ORMA 2XH4A 4S3AA 3FDKA 5AC5A 3ZVHB 1TV7A 2YGYA 3ITCA 4G56A 2PTZA 3GW3A 5DMNA 1MYRA 1QMLA 2ZXAA 1OX6A 3I7RA 4UNLA 3SUUA 4F2TA 4GNVA 1NHRA 4P7RA 4LYPA 2GVEA 3ENLA 4OU1A 3PM6A 1ONXA 3W26A 3FCPA 5G1MA 1XYBA 1AQMA 1KM0A 3DKJA 4TX6A 3U8GA 2WLZA 1R9YA 2Z1WA 1E6RA 2NQJA 5JH2A 3URBA 1A4MA 5LA1A 4S3GA 1YKWA 1Y5XA 3NQGA 4O53A 4IIEA 4UTHA 4XZLX 1X97A 1NVMA 1GKPA 3L2MA 2FVLA 1ADDA 3DHFA 4QS6A 3DGRA 1I45A 3MDWA 1DWHM 4PULA 5GNYA 3KBMA 1FWCC 4JHMA 3V0UA 4MMWA 1F6KA 1SO5A 1V0NA 3OHMB 4QAIA 3N2OA 4RE4A 4Y90A 3AJXA 4M81A 5A6BA 3CPGA 4AZ6A 2TPRA 3DG6A 1VEOA 5DO8A 1W1VA 2EG8A 3KM8A 2V63A 2JF6A 4YJ5A 3LN3A 2G41A 4S3EA 1C9DA 1GJUA 1Z32X 1RALA 5FAJA 3FOKA 2GWGA 5I06A 4XQ6A 2QCEA 1FHLA 5DF0A 3RO6A 4W8LA 3GBEA 4KWUA 2FHBA 3WLMA 4DJEA 4QEEA 1Q2RA 1ZKQA 4UXDA 3EOEA 5IBXA 1OZMA 2XG9A 5BU9A 4AEEA 1SM9A 5D8WA 1R3QA 4IF2A 4KH2A 2R91A 4HSOA 1DJZA 3BLPX 5J04A 3MWCA 2Y0FA 4FXSA 1DHKA 3PTQA 5E0CA 3TSDA 4PMXA 2DIKA 2H3DA 1W3LA 1VQZA 4Q4MA 4O8RA 2INEA 2WMJA 1XIFA 1EJTC 2A79A 1YEYA 1WDWA 4JQ4A 4DUWA 1R3VA 2XH0A 1W3NA 1B4EA 5CJMA 3QR3A 1F6PA 2VR4A 3PZ9A 3G1HA 1T8XA 1EBDA 2JKEA 3E5BA 4NVTA 3M0MA 3SCSA 4GIEA 4LF1A 3MB9A 1E9ZB 1RJPA 5F4WA 3MSDA 1MZRA 1TYTA 1A0CA 1UKOA 3GH4A 2X8CA 1Z69A 3EDJA 4OZOA 4ZQOA 3P84A 1GQLA 2E6FA 5I2UA 4ZSTA 2PRLA 2QZRA 3VUPA 1TKKA 4GOAA 3R43A 4GZJA 3B40A 2BMBA 2A6NA 1JZ5A 3BMVA 4EPDC 3VOGA 3VXGA 1FVPA 1NF0A 2QLYA 3HGSA 3DDMA 1Q6FA 3R94A 2VGBA 4BWLA 2FZDA 3B0VC 3CGDA 5LA2A 1BHGA 3GNDA 3W7CA 2A3AA 4ORIA 4ZB2A 1V3HA 2ZA2A 4C1LA 1JIBA 3PZMA 2RKXA 3L2IA 3ARSA 4GKTA 4LYQA 4H8VA 5G2HA 4H9YA 2YW3A 1KLYA 4P8UA 2P3ZA 2OYMA 3P8JA 3N13A 2CLIA 3MP5A 5AVNA 3WDQA 4RL3A 4FX7A 3LRKA 3LXAA 5C9RA 2VELA 1DWJM 3VGHA 4LVGA 2MUCA 4L9XA 3P80A 4H6RA 1BVZA 1OCBA 5BMWA 1ZJHA 3BARA 4AYGA 4HHHA 4NZ5A 4AIOA 1UP3A 4FZIA 3RF9A 3ZLFA 3ZO9A 2NX1A 4NHVA 3CM4A 5XINA 3O15A 3W1AA 3NEHA 3CIVA 4XSMA 5CBIA 2RUSA 2G3MA 3NAVA 3GTHA 1DJNA 3LOTA 1LUCA 4ZB0A 2ZDRA 4GXWA 4H41A 2ZWZA 3BW2A 1VDVA 1KRAC 2ZZ7A 2QAFA 1UJQA 5U7SA 3UFYA 2CZVA 3TOYA 2WM0A 4GUJA 2C3ZA 3M0LA 3U0HA 1V59A 3WDHA 2CLPA 1ZAHA 4EP8C 2YFOA 4RV8A 5C70A 5BXTA 1TJ0A 2PS2A 2EPLX 2WZEA 4C1NA 1KM3A 1M04A 6XIMA 1RD6A 3U5UA 2QCMA 5E1QA 3G8RA 1VJZA 2VOMA 3SUVA 2A3BA 1JYNA 3VAVA 2CLOA 4KIEA 2PWUA 1FHVA 4OKDA 3ARYA 3CTTA 1EUAA 3FAWA 4DBEA 4EACA 3KLJA 3TE9A 1SVDA 1CDGA 1FDJA 2O4QA 1V02A 1MFUA 1NWRA 4MY1A 2NQ5A 4AY7A 4JTKA 2V5DA 2Y7GA 1E4LA 1TPDA 2W4XA 1RP9A 3H2OA 4OFCA 3UR8A 2XHYA 3H53A 4BA0A 4GUGA 5EBKA 3ANUA 1E4NA 1BD0A 3LHWA 3MI3A 4LBSA 4IG2B 2Y4SA 1XDLA 1U2YA 1QOQA 3AZSA 4PH6A 1NH6A 3MMUA 3VKKA 4P8WA 4XZBA 3AISA 3VE7A 5ABHA 3OVGA 1LL7A 1B9BA 2QW5A 3W24A 3SRFA 4R3UA 5REQB 1QPKA 2DEPA 4JL2A 5CSYA 3NR0A 3GSMA 2GUUA 2QCDA 2G4JA 3CWNA 3AHTA 4N4PA 3SCQA 2XINA 3P5YA 4JKMA 1TIMA 2DSVA 2ZUNA 3MSGA 4XVEA 3KBJA 1MSSA 3EPNA 3MC5A 4W93A 1H63A 4Q6XA 3PPHA 4E3VA 3SQPA 1QR7A 1PWMA 1W1ZA 4AF0A 4GI9A 5A8GA 3VM5A 3VDHA 1OK6A 1P4CA 1B2YA 1GPWA 2VVNA 1TPUA 3MVTA 3HPFA 4JZ5A 3TK7A 2NVDA 4IP7A 1ZX9A 5A6MA 1K4HA 4F0MA 2FLIA 3BSGA 1DJHA 1OX4B 2ZZCA 4NL1A 1KGUA 1F73A 4UTUA 1WV2A 4DM1A 4WKHA 3N3TA 4EAYA 5GNZA 3WJXA 4U4MA 3H55A 1SO4A 1BSLA 4H6EA 2YL6A 4MB1A 4MWAE 1A5NC 1EJVC 4QJ3B 1ZJAA 4AVNA 2XPKA 3S9IA 4WY0B 2QPUA 1M6IA 2JGYA 1IF2A 3SUWA 2W92A 4Z2IA 3E2VA 3CZEA 1R3TA 3EA1A 3W7QA 5DCDA 2VDIA 4GXMA 4LAOA 3PTKA 3K5XA 4H4PA 3BCDA 5K9DA 4LAZA 3WH8A 3XISA 2V3AA 1YBQA 1E6SM 2MANA 3RLUA 2A21A 1UIPA 7REQB 4J27A 5CPOA 3SQLA 4Y9NA 3VGGA 2VC9A 3CL8A 1BKSA 3GG1A 2PDNA 4W7VA 2FB2A 3L67A 5KVHA 2EKGA 4IPPA 1V0KA 1X38A 5REQA 1Q2SA 5FSEC 4DWSB 1F07A 2B0MA 4UZUA 4RUBA 3H23A 3BG5A 3H21A 1SFLA 2X8RA 4DRSA 5JVLA 2B7QA 3BICA 4Z2LA 3BLDA 5I07A 2WNQA 4H8HA 1OX5A 4E2OA 4WGHA 2XZ9A 1I4NA 1VENA 3HQNA 3GKAA 1CW2A 1RA0A 2WKJA 1KM4A 1KRCC 1NQ6A 1MXDA 5BROA 1GZ1A 3OA5A 5HMFA 1D3CA 2X41A 4BCEA 4A3YA 4GY0A 3WFLA 2Q6ZA 3RLVA 1JXKA 4MFEA 1XLFA 2CXGA 4H7CA 3NM1A 1HO4A 2HWGA 3WQGA 4FEZA 4GVGA 1Z44A 1B30A 4UMBA 3DGHA 4A3UA 5FJJA 3RLGA 2JIEA 4WKFA 2E5AA 3S1VA 1UWQA 5K4ZA 3QMTA 2GJNA 4D6HA 3WF3A 1K4GA 2RDXA 3HTWA 4MWAC 5E6YA 1VB9A 4R5EA 2EQDA 4MDPA 1R38A 1U5VA 5EU9A 2HS6A 2GVLA 4ALDA 1RQHA 1P6CA 1GESA 1IIGA 3KHDA 1FBAA 1XKYA 3HQOA 4R85A 3WH7A 4KEUA 3MCOA 4PFHA 3THDA 2GRTA 2VXNA 3WF1A 3ZLGA 1LLWA 4Q4PA 1XANA 3ZOAA 3EWYA 3RM4A 3C0JA 4DXVA 1KR1A 1TPWA 2R94A 1QPOA 3QYSA 4NJHA 3WFZA 2D73A 4PB3A 1UG6A 2WOVA 1EP2A 2Z25A 1JCNA 2ZZ0A 3NL6A 3C6CA 5DEZA 1POKA 2FFCA 4NY2A 1EFZA 1KFBA 5LKYA 4PUNA 2I57A 4GRSA 1PTGA 4ZQMA 2CHOA 5T8GA 4N2YA 1WUFA 2QEZA 5D9PA 4PBEA 3RDKA 1PEZA 3QQ1A 3PN8A 3KVLA 4HMEA 3R07C 1U1HA 1VFOA 1DVJA 1VCVA 5DLCA 3A13A 3BC9A 3G1RA 1OFOA 3N12A 1Q6CA 2NX9A 1W1A1 5AHEA 4D6IA 1W5OA 4WY0A 2ZRVA 1GUVA 2EKCA 4MWAB 3QMSA 4JICA 1NWTA 1CLKA 3R5EA 3SBFA 2R8WA 4PB5A 4QBXA 4PA8A 4R9OA 5H6HA 4QDWA 1DWGM 3R8RA 1S39A 3QRHA 3G1YA 2POTA 2WVSA 3UESA 1XYZA 5T26A 2VFGA 2F9RA 5J5RA 2VUNA 3NJ3A 4A2RA 1XD1A 3AMGA 3ARPA 4IJRA 4RPPA 3WF0A 1R85A 4O18A 4TTGA 4KWVA 3FYYA 5I24A 1OSEA 2O4MA 1H62A 1NARA 4C6MA 7XIMA 3KBVA 4D72A 4WCJA 3B8IA 4OHQA 2ABAA 2YA0A 2A0NA 3WQFA 1UH4A 1MUWA 1WE5A 1PIFA 4LV4A 5JRBA 1MQQA 3N4AA 4BQ4A 4FOUA 2WKLA 3KP1A 1JPIA 1MOKA 2XIIA 1UQZA 4CQAA 3CMGA 1HFBA 4H8NA 2PD5A 1SW3A 3QKZA 3TJLA 2REQA 3DIPA 3UWVA 4CCCA 1RR2A 3FJNA 2QJHA 1V6WA 1X6UA 2IS7A 1C29A 1V3MA 1BRLB 3WLJA 1DE5A 3ELFA 3QMRA 4EK7A 1EP1A 3HJEA 3VTRA 1F6YA 4H2HA 2X99A 1CB2A 1KFKA 1WCGA 3M41A 4K8HA 1K6WA 2ZWYA 1XLAA 2UY5A 1HXJA 2GYIA 4AZCA 3OU8A 4JPGA 3PNUA 3T78A 4US6A 1JFHA 1PB0A 1T41A 3VGEA 3VVGA 1MO0A 5MF5A 3W7GA 5CSUA 2J24A 1B3YA 3FEQA 1VPQA 2IQ0A 5KTLA 1VFHA 5U1OA 3IIZA 4KCWA 5HJXA 4AH7A 3F4DA 3UG3A 4QCEA 4MY8A 3OZMA 1EA9C 3W82A 3NQ8A 3NQFA 1OB0A 3UPMA 3GHSA 4C6JA 3POHA 3J7HA 4PR4A 2E3ZA 1XQLA 1SO3A 4QS5A 5K2ZA 1XJBA 3P3BA 5HBFA 2YIHA 2OEMA 4MF4A 1TUFA 4X22A 1F3PA 5HWJA 4KRZA 3TTYA 5F1VA 1AODA 2AAAA 3MUCA 3M64A 3NRZB 4WJ8A 3BWWA 3KOWA 1ITXA 4AD1A 1NF7A 4NNBA 3A3XA 3MWAA 1M5WA 3NQMA 4H9ZA 3FY1A 5FEPA 4BR1A 3TMQA 4ES4A 1HNYA 1DIDA 2BXYA 3ZLHA 2X0HA 1YIXA 3T0BA 5LGXA 1V7YA 2DSKA 4UB9A 3APTA 1H7WA 4P7NA 4DYKA 2PDJA 4ZQCA 2E4TA 5KETA 1OHLA 1K8ZA 3LHVA 3ETRB 1ZP4A 1OQFA 1E72M 3GW0A 4R7WA 1N82A 2QUTA 4AHOA 4CQDA 3NS1B 1OC5A 2V5BA 1MMFA 1HGWA 1NJJA 1HGYA 2ZFAA 3DI0A 3VNIA 2I14A 1FH8A 1NWSA 4QLKA 4C6KA 4JTLA 4WVXA 3CAQA 2JKAA 2QR6A 3T9PA 1GW9A 5CSSA 4EQRA 2B81A 4Z0SA 2CZEA 3S4TA 2NUXA 2H90A 2VX4A 4UTWA 1KBKA 2CESA 4JHZA 4O17A 2DZTA 1JPHA 4JBRA 5HNTA 1LQAA 1VFMA 2PE4A 3PBVA 6CGTA 1DOSA 1LOQA 2O9OA 3II1A 5A94A 1ZGDA 3C52A 1VBGA 3GXPA 4PBFA 1EJWC 3C3NA 4XK2A 3B0PA 1OIFA 2VDGA 4Z2GA 1EA0A 3DFYA 2QDGA 4U5IA 2R6OA 1H51A 1XFCA 4AD3A 2BFGA 4GQ0A 5CGQA 4CGTA 4LUTA 3BW3A 3W1UA 4AISA 1J10A 4F79A 1R0MA 3SCNA 3VNZA 3C3UA 3I65A 4AB4A 5D2TA 5G1TA 4KCUA 3UGVA 1G6CA 3V4BA 3WFAA 3LXDA 5MHBA 3H12A 1ODUA 4JX5A 4PE8A 1TPVA 3N29A 5AECA 1YE6A 2XZ7A 1E1CA 4L4PA 2WZIA 4P7OA 4YTSA 3IUDA 1KLZA 3F2CA 4LS1A 4PSPA 4FIQA 2YVJA 2HISA 3DBPA 1XQKA 3GKFA 3PJWA 1LPFA 2WW5A 2I7GA 3RX2A 3B8SA 2PZ0A 2GR1A 1UWTA 2J25A 1XYLA 2ANUA 6ALDA 1VKFA 1EZ2A 4XG1A 4M80A 2DIEA 5LIXX 4EAMA 3PPGA 2C19A 3STEA 5D32A 1TMLA 3ZFHA 3WDPP 1EDGA 2EPOA 1JYVA 3KTSA 1IT7A 3L5LA 4B5XA 2AQVA 1ME8A 1A5MC 3H6OA 4KGLA 4M6QA 2EJ1A 4ZQRA 4EWJA 2F84A 3QTPA 3FV9A 4UFJA 5BWFA 4LALA 3RCYA 3AJ7A 1JPKA 4K37A 1MW3A 2DP3A 4HNOA 3RCMA 3RITA 4HOXA 2CKSA 4QIUA 5F2MA 3WQDA 3BH4A 5A6SA 2DSWA 3B9EA 1D3GA 3ONBA 5IXEA 1UH3A 5FMHA 4A8LA 3RUBL 3VOJA 3PTMA 2TODA 1I1WA 3EOUA 3VKDA 2Q8ZA 2GQ9A 3PFMA 1L9WA 3S5ZA 4GZEA 1EX1A 3OBAA 3HGJA 1AQHA 2VCBA 1V51A 1R6WA 3V18A 3SN0A 1LBMA 1XLBA 1MVYA 3FIGA 2BHUA 1FDZA 2HZGA 3CMFA 4IIGA 4TR9A 3MSYA 1EO7A 2BNJA 2UWFA 3GG0A 4QDPA 3TFXA 5I3IA 3WZ0E 3ARVA 4YYCA 2W66A 3SFWA 2EJAA 3PJTA 3TTOA 5CGTA 1JDEA 3VNYA 4CD4A 1E9IA 3OEXA 2BVDA 3QKEA 2F7FA 2PI6A 1SMDA 3NQBA 4GVHA 3AYSA 7A3HA 1K9EA 3NURA 2CZFA 4DELA 2UY4A 4AEOA 4J3SA 3JRKA 5AC6A 4IM4A 3MI2A 1W5NA 2J3NA 5BOOA 1XLMA 1ZRQA 3G22A 1KCKA 3IV3A 2D0FA 3WD3A 1N60C 1LDCA 2J6XA 3AU2A 1KRBC 1GYNA 4LC6A 3NZPA 1VRXA 2YCJA 3L5OA 3HRDC 2NQZA 1GZGA 2GH5A 3B8UA 1PKNA 4FK9A 2OB3A 4P2VA 2E5DA 4K8DA 3S3GA 4TX8A 1TV2A 3G18A 3DJGX 2V68A 1TFVA 3GHUA 3WBWA 1WB0A 4LSBA 3H2AA 1GWJA 4NAEA 4Q33A 1QK0A 1G0CA 1PTAA 4HU4A 3DHUA 4JNMA 3SRKA 3ZT5A 1HN1A 5FOOA 2Z1SA 2OOFA 3HQ1A 3LBMA 2G3JA 1DWIM 4I7UA 1TMHA 4WR3A 2XN2A 2XIOA 3C8NA 4QR6A 4LBRA 2WHJA 3G6LA 1LRQA 4OECA 4MUPA 3ECQA 3CH0A 3FGCB 2WNZA 1ZCCA 2WP5A 4M29A 4YVPA 1GJWA 3TYUA 2PDYA 4GUHA 2BXZA 1A0EA 3GYEA 4NZFA 2NLYA 3ZMRA 1AL8A 3POCA 1DPMA 3WLRA 1CTNA 4TIMA 5A6AA 5LA0A 2VTFA 1XS2A 5DXYA 1ZSXA 1EYEA 1GEQA 5M3WA 3TAOA 2J7EA 2VEFA 8TIMA 1NWUA 4UTKA 3W7DA 1F5ZA 5BXPA 1VPYA 4H4UA 1WZKA 4HZMA 3PZTA 1LJYA 1VAHA 2GLKA 2NT0A 1WOBA 4YVVA 5HNUA 4K6AA 2PF8A 1XFBA 1K9TA 3AIWA 1QAPA 3QBUA 1RPKA 3VPLA 4IJBA 4FOJA 4JN7A 3AIUA 2RABA 3AN1A 1IEQA 3ZZ1A 4UWMA 1O1ZA 1AH0A 1E0WA 4V15A 3A7AA 4JYFA 2ODOA 1YXCA 1GQJA 4UR9A 4HP5A 2QHAA 4NRSA 1KFJA 4CU7A 3LDVA 3H4XA 2DQXA 4D6GA 5D2WA 2WKGA 1W3IA 1DHPA 3KS5A 3MMDA 2OWWA 5FF7A 4H04A 3WD4A 3P0WA 2PDLA 3S5NA 3THCA 3UPWA 3W83A 1Q6DA 4I9TA 3F2BA 1KTNA 1U30A 5I3GA 3M0VA 3NM3A 1FX6A 1I2QA 2Z00A 3SCTA 1VEPA 2WOWA 3IJQA 1CGUA 1LWJA 4KRTA 1YXDA 4S3BA 3M5XA 4JQ1A 2ZXBA 4H8UA 2JIWA 3LPPA 4A8RA 3KAOA 2GQ8A 4E4PA 1VFSA 3M6YA 3LGEA 3NA8A 3NWRA 5LIUX 2CDUA 1SZGA 2I9EA 1P0KA 5H8PA 1JNEA 4IGMA 1I1XA 3E0IA 1V3KA 4W7UA 5FJTA 1AW2A 1GRGA 4KPRA 2QDDA 1PSCA 1VJSA 2BX7A 4AWUA 2DT2A 1EC8A 1XDIA 1SJDA 4O1AA 1GT8A 2CEQA 1KV5A 1C8VA 1EPVA 1W17A 5TBOA 3VOHA 4ZZ9A 3H7UA 3NL2A 4OOZA 4UBPC 3WMBA 4DZ5A 3LXCA 1V6UA 1TWSA 4TO8A 3DFPA 1FRBA 3EXSA 1Z8AA 3ZT6A 1YHTA 1W9PA 3FXYA 4Q4RA 3R0KA 1STZA 3KW3A 3FJ6A 2E9LA 4JQ3A 2NV2A 4OV4A 5AHLA 1ZXIC 1WYGA 1ECEA 3FX4A 2VEGA 3CZLA 8XIAA 1UUQA 3VK5A 1JD9A 3LCHA 2FGZA 4TTUA 4TMBA 1QPRA 3W29A 4AWEA 3B9JB 5A8PA 2DSUA 2PF0A 5M17A 1X7IA 2YBTA 2OCZA 4QLJA 3U48A 5DANA 2ZZ2A 3RNMA 2L5HA 5FS6A 4HTBA 4ZO8A 3GXDA 4H4WA 1W54A 3MTWA 4M6PA 3UWEA 3P82A 2X1RA 3QV7A 1GRAA 1JUEA 3RRXA 1EJUC 4F0RA 2PRMA 2P10A 4KGJA 2OLHA 3UXLA 4J3UA 4O4VA 1A5AA 4UMAA 3FN9A 3ARQA 5EA9A 3PY2A 5DT5A 4CNPA 2J7HA 2ZZ5A 2A3HA 4I9JA 1VP5A 1QNRA 1NM9A 2Y62A 3E2RA 3ICJA 5CAKA 1Z48A 4R9XA 1DJXA 4K7VA 4LBUA 3SRDA 1O5QA 1NOFA 3GDLA 1O4UA 4QG6A 5CLTA 5EY5A 1ITCA 1FWRA 3HG3A 1XL9A 1AG1O 5LIKX 1XPYA 3G24A 1MFVA 3LSBA 1NHQA 1G69A 1EJSC 1SJAA 3SECA 3PR2A 3L4TA 5I23A 4MM1A 2UZ9A 3SN1A 2FPTA 3EWUA 4DF0A 2OVLA 3V7PA 4TU1A 1E5JA 4MJ2A 1EXPA 2X09A 1VCGA 1OZQA 5CKSA 3MPGA 2A3CA 3ZVHA 2W0HA 1KRMA 2ZA1A 1OGGA 3B8TA 3BVJA 5HMEA 4Y9MA 2V3EA 4S2BA 3EWZA 2ISWA 2OFJA 3ES7A 1F3EA 2D24A 3OLDA 5DQPA 3UZJA 2AOSA 2X2YA 3VNLA 1SPQA 4H4YA 5TQLA 3A9IA 2QJJA 1YNYA 4XBJA 3M0YA 3E0LA 3EWWA 2ZC1A 3WYZA 1M7JA 3TEVA 5G5GB 2PDQA 1I2PA 1GRFA 3W86A 3R8HA 1E70M 1TTPA 4URIA 3OW1A 3ITOA 4OWGA 3RMEA 1EOKA 2IKJA 2JFEX 4QQUA 5D37A 3TYEA 4B4HA 4M0XA 3VX0A 3LEPA 1Z9AA 3L4WA 1H11A 3N6QA 2J74A 4E3TA 3K1DA 2REQB 1ADOA 1JGIA 1H3GA 2YFNA 4H4RA 3WD2A 1R46A 2R14A 3MA8A 3ZIZA 3CHFA 3W2MA 4HA0A 2PWEA 3NZRA 3CUJA 3DFNA 4TVDA 3WNMA 2ZUMA 2IPWA 3OZPA 1HUVA 1JULA 2A7RA 1B9ZA 3N17A 3UXIA 1W32A 1Q8AA 3C0SA 1KM1A 4MNMA 4DAIA 3LCXA 3R89A 3RJYA 1F4HA 4AX7A 1QJWA 3CBWA 3HBLA 4N0RA 2PEVA 4RK8A 3R6IA 4E8DA 4FNUA 1AZ1A 2GSHA 4C6LA 4IQJA 4UTMA 4DBUA 2ZRZA 2X16A 4R88A 1ZTVA 1THFD 4NEWA 1ZLPA 2FQIA 4HN8A 4AD5A 2CFFA 2BGQA 4Q4KA 3KTXA 3A4XA 3B03A 4QM1A 2QV4A 4E2DA 4AF0B 3ME3A 4H83A 1GONA 3M0IA 2F61A 4AY1A 3VFLA 3S46A 4WDWA 3WLNA 3S5OA 2ACUA 1FWEC 4GVFA 4DJEC 2NV9A 3WQ5A 1GGOA 4XZWA 4H6QA 1JAKA 1E6QM 4PUJA 1K7EA 2GJLA 1D3HA 3I10A 2AMXA 4BEQA 4GIRA 1IXNA 3TNOA 4GISA 1LT7A 1FIQB 1YBQB 1P0DA 3R4IA 4FNRA 3GDMA 3TYDA 4ZO7A 1X2HA 3SN4A 1I9CB 4GIAA 1TR1A 4J2MA 2IPFA 2OX4A 4IP4A 2B7OA 4I9MA 1OFAA 4UFKA 3LD5A 1U22A 2VCAA 4N9BA 1KGWA 4YMZA 1ZBWA 1IWBA 3KOZA 2CHNA 4XTIA 4IPJA 3HV9A 2HVMA 4BKNA 4TVWA 1QNQA 3NGJA 4AW7A 1YNPA 2P5NA 1IGWA 4WGXA 1UR8A 3A4AA 3KLKA 4H7ZA 1DTUA 1GZJA 2GZXA 1W3JA 4JEJA 1TR9A 1G4EA 3GVVA 1J18A 3E38A 1WDQA 4GCAA 4PTXA 1XIJA 2J7BA 5HQEA 4REQB 1VBRA 2ZZ3A 1TTQA 2OXNA 4V27A 4QE5A 4DJDD 3W02A 1BTCA 4G7EB 1M7OA 4Y9AA 1I0DA 1EPXA 3DFTA 1J96A 1M1BA 4GCXA 3V5CA 5G2IA 1DYSA 4HJWA 4YLWA 1UP2A 1WXJA 2WO5A 5XIAA 4MZYA 4JTGA 4B2DD 1XUUA 3OHIA 3CT7A 4QX4A 3S2JA 4DBDA 4LY4A 3QPZA 1KFLA 1QTWA 3HPAA 2J79A 2OZ3A 3JW7A 2Y5SA 3W07A 4B3ZA 2O9PA 1VR6A 3TUUA 1SZFA 4FS9A 3NYDA 4L1WA 1EDQA 3UWZA 2J62A 1QHPA 4MSSA 2HRWA 2CITA 3LLXA 3STGA 4GUFA 5GPRA 3RX4A 1PCWA 4HK6A 3VC6A 4OVXA 3W7NA 1ZY9A 1J4EA 2W55A 4KCVA 2W3SA 2DU2A 4ZQNA 1W56A 1LF1A 1XUZA 5CQ1A 3EBVA 2PSNA 5CPMA 4C6IA 2ZC8A 1CXFA 3O6DA 4JTRA 2XTKA 3KBNA 1RHCA 4F3HA 2ZZ6A 3UGRA 2OO6A 4HU0A 3EDKA 3D0CA 4H9XA 3LADA 3WSUA 3A47A 2GQWA 5I77A 3UCQA 1TO3A 1F3TA 4ZGYA 3EKZA 2WJZA 1LG1A 4Q4QA 3W2LA 2RGLA 3HPSA 4LEFA 3EOOA 1B90A 2X50A 1ZUAX 2Q3OA 4KS0A 3ZR4A 3UJFA 1RBOB 3OPSA 4MUZA 4XO6A 4O8AA 1TPH1 3AYVA 2YXOA 2NQLA 3GVRA 2ZTKA 5ER0A 1RY8A 3NPUA 2YCLA 1QPQA 1W1TA 1TJPA 3A7RA 2C8NA 4ZQPA 2QUNA 4ADSA 4C5YA 2VX7A 2OYKA 3LSCA 1US2A 2E3TA 2R1MA 5T91A 3BMWA 4BI5A 1E6ZA 3A24A 3OIHA 2ONEA 3WQWA 3WJWA 1EGMA 3AZRA 5HR7A 3IK4A 1JCXA 1BTMA 4J4KA 5KINA 3QLDA 3TP4A 3NVZB 3EDFA 3BLLA 1GJPA 4LV9A 4OV9A 1F74A 3NO3A 1JDFA 2HE5A 1F7BA 2F8QA 8A3HA 4NIRA 1ZZMA 4AHQA 3AICA 3VD7A 3UW6A 1WZAA 3E49A 3HG5A 1WZMA 1TZ7A 1VHNA 4XD6A 1ME9A 1XPGA 3GXMA 3JZUA 3T0TA 3SQMA 2HCVA 3ALFA 4DXXA 1UJPA 4DJFC 4AZ5A 3G1DA 3QFEA 3IANA 2VUYA 2W0UA 4S38A 4D6DA 1C8QA 3URQA 5J5DA 2WOIA 2OT1A 2ZBTA 3AS2A 2ZCGA 1QPNA 4KFOA 3T0CA 3QGKC 3BSHA 5LGZA 3F4NA 1CIUA 4UFMA 3VD5A 3TQ0A 2FYMA 1A3WA 1ZAJA 5JCLA 1UWRA 2ZKMX 1TWZA 5CGMA 4OOUA 3PTDA 2GPTA 1B3OA 3MHUA 3W1RA 2WVVA 1UKTA 1M9HA 2VC6A 3EMCA 4H00A 3UYIA 4G8TA 2DZVA 2W62A 1OBAA 4IL0A 4YHGA 2WQPA 1TIWA 3WNKA 1JDAA 2VGGA 5DMLA 4W86A 2YB1A 4GH1A 3GDRA 3STFA 3ARZA 4NZ4A 3BAKA 3LX9A 3BAXA 4MNLA 1BVWA 1LTDA 2PDFA 5CPLA 2GR2A 1QOXA 2GR3A 2VOTA 3E9AA 4DHGA 3NDZA 1HX0A 3IEBA 1Z42A 1AQ0A 3TTQA 1TE6A 1TWWA 2PTYA 3U3HA 3LGDA 2C71A 1GRHA 1R47A 3AIBA 4WDTA 1PIGA 1J9YA 1IYXA 1GRBA 5HPCA 1L6GA 1KWGA 2IPGA 1BXCA 5BRQA 3SJ3A 1PKYA 4RZ4A 3GX9A 4IQEA 4NJGA 3V0TA 4IGNA 2QCNA 3H4WA 3L4VA 3BURA 6XIAA 4JTCA 1A5BA 5HATA 3LRMA 3N1AA 4UTTA 1ZL1A 4LNYA 3QQ0A 4S3KA 1QDSA 4KWOA 1CXEA 1DV7A 5DRCA 3PB2A 3ITGA 3PBGA 1K1DA 2GVJA 2BHZA 2VDHA 3TTSA 3WF4A 2E0PA 3OLIA 2IKHA 1M7PA 2H9AB 1G7VA 1DKWA 2D2GA 3SCOA 3CHDA 5D9NA 9XIMA 1W2VA 4MG4A 3WD0A 3PUGA 1V3IA 4JTTA 3OBEA 4GC3A 3TNBA 4MOZA 4PYSA 3PUEA 3CWHA 2CWXA 4REQA 5KITA 3SQSA 3M0JA 3M16A 2I1OA 2NT1A 5A6JA 1CXIA 2E1DA 5I5RA 4W84A 1GVQA 1SFTA 3KBSA 4ECLA 4OGZA 2EPMX 3LCLA 1JFXA 3S42A 4PUWA 3FHAA 1C9WA 2GFTA 2YA2A 3V75A 4XO7A 4ZE4A 3CB8A 4GVIA 4LRTA 3CEPA 1EDTA 1AL7A 2QULA 1M65A 2OZ0A 2VZSA 4L5ZA 4ZA0A 2W9MA 1O6IA 1QOPA 4GJ1A 4JYEA 1UC4A 3WKZA 4OTKA 2PZNA 1A47A 4LANA 2I56A 2DT0A 1QRQA 3XIMA 1T99A 4Q8TA 4CNUA 3AROA 4H7VA 3ITTA 4NXSA 3GRIA 2FB3A 2QUUA 1OYBA 3UP8A 1HJXA 1DIEA 1EBHA 1EGVA 2D1ZA 4OUIA 2HQAA 2AAMA 3DUGA 1M68A 4PRRA 4O4WA 2ZX6A 4US5D 3IJ7A 3W87A 4U10A 1Y0EA 5KSWA 4WK9A 3MDUA 1RVGA 2ZVRA 3ID7A 4C6DA 3L12A 4GY1A 4E0CA 1LWHA 3AQUA 3S47A 1F05A 1GVIA 3S6OA 1UPPA 2C18A 4ZSUA 4B92A 1X1NA 3GTIA 4M3PA 1W1PA 1AK5A 3WJSA 2WMKA 5TD4A 4IFKB 4C7GA 4ADUA 2NQHA 3BAIA 4J2PA 1LVLA 4PC8A 1XRVA 4UIOA 3IGXA 3W7EA 5D33A 4WSKA 1V08A 2WAGA 3PF3A 4TOQA 1K4QA 3FDGA 3CV1A 4WIWA 3CZGA 2EPHA 5C7VA 3MQTA 4BK9A 5HA7A 1YNQA 4L9ZA 4Z1YA 4F0SA 2CLHA 3FYOA 1AVAA 4A8IA 1GPFA 3O0FA 3A64A 1HF6A 3OLEA 1PVNA 1V6TA 1AH4A 1MW2A 4O10A 4EM3A 4LA1A 5CCZA 4XWUA 5CC7A 3IARA 4YL2A 4HPNA 3DHPA 3LV6A 1BQCA 1OG6A 3VMOA 1Q6RA 4BQ5A 1UD2A 4C6FA 1IR1A 1BYCA 2OZTA 1J5SA 3D5HA 3L4UA 4B4FA 1AW1A 3QQWA 1XBYA 3BDKA 2V5LA 3B05A 4HNLA 4ML4A 1ZJIA 1CGXA 3ABOA 3TV8A 1OJTA 4CEXC 3BOFA 2V2CA 1JZ4A 1JYWA 4IXHA 2X05A 1DXFA 4MPKA 1HJVA 2PDIA 4N9EA 3UYCA 2NX3A 2PWFA 1WDRA 3PJXA 3S2NA 3VX1A 3MT1A 1H49A 5AYBA 2VD8A 5ECUA 3AXIA 2Q02A 4XBKA 3SW6A 4M52A 2ISFA 4QAWA 4BF5A 3EDDA 4JAWA 3F4VA 4FR1A 4C91A 2PTXA 5I6SA 3EX2A 2VRQA 2VQUA 3PBUA 4LVAA 4DYEA 3DFOA 2DUAA 1EEPA 2QAEA 4W8AA 4CD6A 1TV4A 1VFTA 2CU0A 2WC3A 4MB4A 4LUTB 2Z1XA 1Q85A 2KAUC 5DMMA 1VEMA 1QCWA 2E09A 3TZNA 2PP0A 2XM1A 2BWGA 4KFPA 4IMEA 1GV4A 1B1YA 3TYBA 2OYLA 4QHRA 5BXSA 5E9AA 4QJ4B 1I75A 3VILA 1DQXA 4DZHA 2TSYA 1QI3A 3N3MA 3IJIA 1IT8A 3HQPA 2XH7A 4JN6A 1KA9F 5I09A 4IGHA 3GAYA 3T40A 4H01A 4GI6A 1K6AA 3P74A 1GQKA 4N7QA 4ZOCA 1SJCA 1DJWA 1OCNA 3ABSA 1P7TB 2OJPA 4UOJA 2DZSA 3NQAA 4AD0A 3LTYA 4CNTA 3AC0A 2V0TA 4EX4A 3T08A 3VZZA 2ACQA 1R3YA 1TTJA 4S3FA 4J28A 1FFUC 2OODA 2W79A 3B9OA 1M6JA 3GS6A 2WCGA 2VFDA 4UR7A 3GC5A 3OA3A 2FTYA 3NQCA 2HV5A 4WHBA 1P1XA 2OGYA 2CHRA 3PFRA 3GZAA 4P61A 1CB7B 2GOKA 2W54A 2DVUA 5HAOA 2BGNE 3GIPA 4MKSA 4NT0A 4JY8A 2J47A 3TJIA 1H7XA 4HBKA 2XVGA 3T8QA 2V3GA 4JTSA 1JNDA 4KMQA 1XC6A 1K02A 2OEKA 2W63A 4H4IA 3L21A 4JQAA 4IX2A 2ZX9A 4EMJA 1HKMA 4QE4A 1MZHA 2VR2A 5FF3A 3BK0A 3T44A 2HNEA 2J4GA 4H4SA 2G97A 3THUA 2PGEA 3EUB3 4HYRA 1JF5A 2AMGA 4ZFMA 4MADA 1N8IA 3IUHA 1DTNA 5E09A 5DFAA 2WMIA 3TCEA 4Q7IA 4GH3A 3AS1A 4HYWA 4GJJA 2ZE3A 2HROA 2PBOA 1L8NA 3ZJ8A 4IX0A 4OIFA 4Z2KA 3AM9A 3U2CA 3INPA 5BRPA 3KS6A 4JNYA 5CC6A 1PCKA 5DY2A 1WA3A 1E1FA 3W3OA 3TOPA 1SB3B 2D0HA 5ECVA 1PPIA 3ZWSA 2UV8G 1XH0A 4E5TA 3A22A 1UASA 3GU9A