4HNCA

P. putida c92s/k166c/c264s mandelate racemase co-crystallized with benzilic acid
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
357
structure length
357
Chain Sequence
b'EVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALKSLKQLLDDMAAMIVNEPLAPVSLEAMLAKRFSLAGYTGLIRMAAAGIDMAAWDALGKVHETPLVKLLGANARPVQAYDSHSLDGVKLATERAVTAAELGFRAVKTCIGYPALDQDLAVVRSIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMFKALSIGASRLAMPDAMKIGGVTGWIRASALAQQFGIPMSSHLFQEISAHLLAATPTAHWLERLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWREKEIGKYLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase
publication title Potent inhibition of mandelate racemase by a fluorinated substrate-product analogue with a novel binding mode.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 133
structure length 357
sequence length 357
chains with identical sequence B
ec nomenclature ec 5.1.2.2: Mandelate racemase.
pdb deposition date 2012-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hncA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hncA01
1P48A 3MQTA 1WUEA 1ONEA 4ENLA 2ZADA 2DW6A 2POZA 1YEYA 2PTZA 3SQSA 2PTXA 1XS2A 3CAWA 3I6TA 4JN7A 4E4FA 2QJNA 3TQPA 3UXLA 3VCNA 3UJFA 3V4BA 2PP1A 2XSXA 3OP2A 4IZGA 2AKZA 1MDLA 1P43A 4MGGA 4F4RA 1TZZA 4M0XA 4GISA 2PU0A 3JVAA 3FV9A 1NELA 2PP3A 4H1ZA 7ENLA 3UXKA 1IYXA 2O56A 3NO1A 1DTNA 2MNRA 3EKGA 1JPMA 3BSMA 2OZ3A 1KKRA 1E9IA 1ECQA 1JPDX 1KKOA 1KD0A 3MUCA 3N6HA 2P3ZA 4J3ZA 2GGGA 1MNSA 3QLDA 2P0IA 1SJAA 4YWSA 2GSHA 3IJIA 1NU5A 1EBHA 3TJIA 3DG3A 3VC6A 5ENLA 3VA8A 2OQHA 3P3BA 5J04A 4E6MA 1EC9A 3SBFA 2QJJA 3R0KA 4ZCWA 4H83A 3DERA 2OG9A 4E8GA 3DGBA 1SJCA 3RR1A 5FJPA 3TOYA 3CK5A 3T8QA 4H2HA 3R10A 2CHRA 3TTEA 1RVKA 4HCDA 4E4UA 3DFYA 3SSZA 3ZLFA 5EU9A 3H12A 3DEQA 3MZNA 4IP5A 2ONEA 3PWIA 3FVDA 4IHCA 2OZTA 3DDMA 4KPLA 3VDGA 1MRAA 3ZVHB 3UJEA 1BQGA 2PU1A 3MWCA 3MY9A 2PMQA 4GYPA 3FYYA 1MUCA 3ZLGA 3ES8A 2OO6A 2QQ6A 2RDXA 3STPA 2PGEA 2XH2A 3PFRA 3KUMA 3S47A 4HNLA 3UGVA 2XH7A 3T4WA 3OPSA 4DHGA 3T6CA 3ES7A 4DWDA 5BOFA 2XH4A 5FJUA 2AL1A 3BOXA 3IK4A 3DG6A 4IT1A 4DXKA 2NQLA 3OW1A 3FXGA 1SJBA 4G8TA 2AL2B 3UJRA 3ENLA 3V5FA 2PP0A 2QVHA 2HXTA 2OZ8A 4A6GA 3TCSA 3SN1A 4IL2A 2I5QA 1WUFA 3N4EA 4GIRA 4FI4A 3PK7A 2PSNA 3B97A 1TE6A 3I4KA 3H7VA 3IJQA 2OFJA 2QDDA 3R1ZA 3Q45A 3QPEA 3RO6A 2P8BA 2HXUA 2OQYA 3Q4DA 3MSYA 2XH0A 3U9IA 2QJMA 3ZVIA 5IDZA 3CYJA 2PTYA 1SJDA 3V5CA 3FJ4A 3CB3A 3GO2A 2ZC8A 3TWBA 2GL5A 3GC2A 4ZA0A 2GGIA 3H70A 4HCLA 2FKPA 4Z17A 4G7FA 2FYMA 4KWSA 3I6EA 3P0WA 4A3RA 1KCZA 2HNEA 4A35A 2DW7A 5FJTA 3PWGA 3QKEA 4HCHA 4KT2A 4GGBA 1FHVA 3GD6A 6ENLA 3N4FA 1JCTA 1L8PA 3IJLA 3JW7A 3V3WA 1BKHA 4DYEA 4HNCA 4JN8A 3RCYA 1MDRA 3N6JA 1W6TA 1EBGA 3P93A 4K1WA 3QTPA 3ZVHA 3JZUA 3RITA 2PA6A 3R0UA 3BJSA 2MUCA 4GMEA 2GGEA 3DFHA 3NXLA 4GYPC 1ELSA 1PDZA 3TJ4A 2PGWA 1JDFA 3SN4A 3UJ2A 5FJOA 3VC5A 4K2SA 3VFCA 4DN1A 1EC7A 5BOEA 3SJNA 2OX4A 4GFIA 3UJSA 2OLAA 5FJRA 3OZYA 4HPNA 1TKKA 2GGHA 3SN0A 3GY1A 3MKCA 2OKTA 3VCCA 4MMWA 4EWJA 1FHUA 4IL0A 3T9PA 3UCDA 4GGHA 4E5TA 4ROPA 2AL2A 3NFUA 2GGJA 3CT2A 4FP1A 1OEPA 3R25A 4Z1YA 3DESA 2OPJA 3UCCA 3EEZA 1R0MA 3D47A 3FCPA 3K1GA 4K8GA 1R6WA 2QGYA 3H8AA 4JHMA 3HPFA 4MKSA 2PCEA 3RRAA 1EC8A 3ZLHA 2GDQA 3S5SA 3OZMA 3THUA 1F9CA 4DX3A 3U4FA 4X2PA 2OVLA 2PS2A 3DG7A 3CXOA 2QDEA 4HYRA 3TWAA 1XPYA 3DIPA 3TW9A 3OTRA 3RGTA 3R11A 3D46A 4KEMA 2P88A 2AKMA 3QN3A 2XGZA 2PTWA 4IP4A 1PDYA 3NZGA 2HZGA 4HN8A 4J1OA 2PPGA 2P8CA 4H19A 2PODA 4M6UA
chains in the Genus database with same CATH superfamily
3WQCA 2OCZA 4KERA 3CLMA 1A3WA 3QY6A 3V18A 3MA8A 3URQA 1KXVA 3CMJA 3GZ3A 2QUMA 3SGZA 5C71A 5CC6A 1V8EA 4ASTA 5BZAA 3T0DA 3EDJA 5AVNA 3EX1A 3L5MA 3W2MA 2WZHA 1U30A 2PB1A 4WXYA 4UNLA 2RGMA 1HXJA 5H2ZA 2FFIA 3A4AA 1LT8A 2CNCA 3GU2A 1FFQA 4HPJA 1U1UA 2FDSA 1BVWA 3GXTA 4UOJA 1S2WA 2PP3A 3UZWA 4DY1A 7ENLA 1JNEA 3UXKA 1HFBA 4UZSA 1C8YA 1IYXA 3HIJA 1I60A 4O15A 3B06A 1JZ4A 2ZUUA 4B3ZA 2MNRA 1PVNA 3MUY1 1J0KA 2WMIA 2YDQA 3W1UA 1QOPA 1ECQA 1KKOA 3H4XA 4UCFA 5AC8A 2P3EA 2ABAA 5CJ5A 1MNSA 3KBWA 4GWEA 5A8MA 5ECVA 1BLIA 3TJIA 1EUAA 4IGNA 1J2BA 2RJHA 4F0RA 2Y89A 4ES4A 3UG4A 4M7TA 3ZQ9A 2HROA 4QS6A 1VJIA 4F9DA 4HP5A 2NVCA 4QAWA 3R0KA 3VFLA 2WW5A 4LX4A 1SJCA 4MVAA 1DWIM 2CHOA 2W92A 2WNZA 3LUTA 1PYMA 1GCYA 1RJQA 1V4YA 3GTFA 4DXVA 4V28A 3EWZA 4DQWA 2PI6A 2YKKA 1FDYA 3P5YA 2PWEA 4EQRA 4H4UA 5LA0A 3IJ6A 3H12A 1V3KA 2YL8A 3D3FA 3P84A 3MSDA 3BQ5A 4H04A 4JPGA 1JDAA 2ZRUA 3WBYA 3TUUA 5BXPA 1PX8A 1F73A 4GABA 4DLMA 1VBGA 1OY0A 3S1WA 2EJ1A 4KGJA 4PFHA 3A3XA 4L80A 4MZ1A 4OTKA 5BU9A 1R2RA 2OELA 4UOQA 1DWHM 4H4TA 1W1YA 4S39A 2BG5A 3GIPA 4AZBA 4FIRA 5CPOA 1DIDA 3WUBA 2ACUA 1QNOA 3U7VA 4DWDA 3OVGA 2D0GA 3S5YA 4PCNA 3DG6A 3KE0A 3RRXA 4XD6A 4XVEA 4JQ4A 1GERA 2FH6A 1Z6KA 1QXLA 4ZMGA 3UGRA 3MUIA 4LEQA 5EMKA 2QLYA 4D72A 3KOFA 4XSMA 4B3KA 1SFLA 4AW7A 5CGTA 3TYBA 1WUFA 2ZXAA 4O10A 1XLCA 2ZRZA 3HM7A 2JK6A 3G0UA 4GXMA 1N61C 1J01A 2PSNA 2J27A 2OGJA 3BMXA 4XTIA 3QV9A 7PTDA 2WZMA 3AIBA 5LYRA 5CAHA 4OFCA 3M0VA 2CZFA 1M41A 2ACQA 5C9WA 3L5LA 1A5SA 1GG1A 4RR4A 4FLOA 1CENA 3P8IA 2DSKA 2AMGA 5CZKA 4B9YA 3LQLA 4W8BA 4NEVA 3KTXA 1BWVA 4PMOA 3ZSSA 1YDVA 2CZ5A 2PGFA 3R5EA 3SQPA 1OYBA 3AHZA 4M1BA 1EJ7L 4DJDC 3W7QA 2FYMA 2NUWA 3E9AA 1RZMA 3KVLA 4D8LA 2VMFA 3IIXA 5D30A 3WO8A 4L9YA 5LNSA 1DKWA 1L8NA 4P5UA 3RIKA 1V03A 4N9BA 4RXGA 1PTAA 4HCHA 1TTIA 2E68A 1HUVA 2A3AA 3SUVA 2QKFA 4XD4A 4DJEC 2WNNA 7XIMA 1YDNA 1GWJA 1P6BA 3BZJA 4XZMX 1X7FA 4A21A 2REQA 4BWLA 4O13A 1IT8A 3B8IA 3T42A 4KGLA 4IQJA 3TZNA 4WDUA 3LU2A 3CAVA 1V59A 1Q5MA 1J6OA 4H4IA 3R0UA 3WLNA 1TO3A 2VFEA 2I1OA 1RV8A 5LIWX 4W8LA 3UJ2A 1IGWA 2VHLA 1TZ9A 5F2IA 3NM1A 2VENA 1O1HA 4F48A 5MKGB 2XGIA 5FS6A 2D20A 4DJDD 3I10A 3HMJG 1O12A 2HTMA 2EQ6A 3UJSA 4XD3A 4NZ3A 4CCDA 1NDVA 2WWCA 3GR4A 4HTYA 5I6SA 2GGHA 2JF6A 2YW3A 1UA7A 3B8SA 1AH4A 3TLLA 3VCCA 4HK7A 4DJED 2Y0FA 2YOCA 3EPMA 5XIMA 4PMRA 3QKZA 4K38A 1H11A 1Q63A 2A0NA 2PDKA 2E8ZA 3MI6A 1M7PA 2V3EA 4GYJA 5I03A 4PB3A 3EEZA 3HPAA 3NAVA 3O1NA 2HSAA 4JTJA 3K1GA 4GPNA 3W00A 4IPIA 2HS6A 1RP9A 4MTVA 1TRIA 3SY8A 4FX6M 4U2ZA 3WIJA 5FF4A 4ALDA 1ISXA 4QCFA 1JUKA 3CO8A 5BU6A 4MY1A 1YMYA 4LUTA 4N9DA 2FGZA 4RZBA 3NVVB 2F5ZA 1YTKA 5FS7A 1TPH1 1OCJA 5TD4A 4IMCA 3OC4A 7REQA 2ZA1A 4F8XA 1S5VA 4LRTA 3A12A 3TE9A 4CNOA 1AD4A 3ITGA 4H19A 1QPOA 2BBFA 1WOBA 4AEEA 3K1DA 3S1GA 1SMDA 3VGHA 1SU5A 4ZL1A 2DIKA 5E9AA 1GORA 2OT0A 1OD0A 1UP3A 3QTGA 3T40A 1WUEA 4HYVA 4AWEA 4UTLA 2DW6A 5CJNA 4QLLA 3ITOA 3CAWA 3DFSA 3BMVA 2WC3A 1ICQA 2B4GA 4MSSA 2VFFA 4PCTA 5EL1A 3C8NA 1TCDA 4WSKA 2XVKA 3KOYA 3NPVA 1O66A 4IG2B 3K13A 1G5AA 3AHYA 4N4PA 3ZM8A 2C15A 4UWMA 1JEZA 3KWSA 5A2BA 3T1GA 3EDDA 3RM8A 4AVOA 3M0IA 4D6IA 1WDRA 3UT0A 1XW8A 1F8MA 1TYGA 3LN3A 3H2FA 3O9NA 3ZT5A 1TG7A 3FJNA 2JKAA 4CD5A 3DI1A 2GZXA 3TAKA 3I7SA 3MUZ1 3OO2A 3TQ0A 1PZ1A 3NGFA 1FWSA 2W61A 1T3QC 2YCJA 2P3ZA 4UQCA 3QR3A 5K4ZA 3FSTA 5E0CA 5IBXA 3W7JA 3H54A 4Z42C 2ZWYA 3KBJA 2B7PA 3LLFA 3BVJA 4IF2A 4ERGA 2YA2A 1N7KA 3BG3A 3EB2A 2R6OA 2PE4A 3W7LA 3SBFA 3VD7A 3DOPA 3QV6A 2OG9A 4UTTC 2CCRA 3QSRA 1GRGA 3FSUA 1GVQA 3T8QA 1F3PA 1DL3A 1RVKA 4EM4A 3UG5A 4W88A 3G6MA 2V38A 1LQ0A 3IUDA 5EU9A 1XIFA 5IDIA 2Y4SA 3TYAA 2OZTA 2QEZA 3U2OA 5LA1A 1BD0A 5A2CA 1TJ2A 4PCPA 1NARA 3NQFA 4RL3A 4PBFA 3T08A 4NF7A 1R3TA 5DANA 3W1NA 3ZLGA 2DT0A 4FR6A 4XBKA 3SIMA 3SQMA 1E5NA 3UD6A 3EKLA 3VM5A 4DF2A 4NXKA 4Q8QA 1V6YA 3I3BA 4PUKA 4V33A 2CWNA 4X22A 4XZNX 3C3UA 1EDQA 3B0XA 2VFHA 1GEQA 4HK6A 4QGCA 2WP5A 5TIMA 5IHRA 4GINA 3KRSA 1LL7A 2PBGA 3GNOA 5CPQA 2Q02A 1W91A 2VCBA 2JQXA 5HWMA 2EAWA 1OSEA 5E1QA 3IIZA 2V82A 4OOUA 2QMJA 2J8FA 1UASA 3S2LA 2Q6ZA 2C79A 2CU0A 3GDRA 4QCEA 4RNIA 3WQPA 2YCLA 3SUSA 3W22A 3L67A 4LTSA 1OIMA 2DZWA 4P8VA 4D6EA 4HMDA 1EXPA 2QVHA 1VFMA 2WSRA 5HK4A 3IGSA 3L2IA 1UUOA 5HJLA 1YTEA 1F74A 1XGZA 1ZJAA 1JUBA 2FZ9A 2DZPA 5GVJA 3WH5A 3I4KA 2VURA 1ISWA 1BVZA 3RLGA 3KCJA 1AVAA 1XRFA 3MSYA 2X1RA 3A47A 1JYWA 5HJXA 4Z1AA 5D09A 1OYCA 1ZU8A 2NX3A 1ISVA 2W3SA 2J7CA 1GEHA 1SZRA 3P14A 2FPTA 3BTNA 1FECA 5F4XA 5KZDA 2YDRA 4W8AA 3AM9A 3NWRA 3EMQA 2X2YA 2QYGA 4J3VA 5HMEA 5I24A 3UZXA 1OT1A 5LNRA 1M6IA 3HG5A 4ZE4A 2QDGA 3GU1A 2ZWZA 3FEMA 2NVKX 1IIHA 1D8WA 2Y1HA 4A3RA 1WX0A 2VP8A 4MFDA 2YCIX 1H1NA 3EDEA 2VD9A 5CSSA 4CVUA 1OB0A 4AIEA 3NR0A 1GOWA 3DKLA 1X2HA 4M6QA 2XN1A 2J6VA 3FA4A 4OV4A 3FG2P 3AJ7A 1AH3A 2OXNA 2X1TA 1XBVA 4Q4KA 1WA3A 1EOKA 1FFVC 1VEPA 3GE7A 2CLLA 5LXEA 5JIPA 4IICA 3RITA 3OOQA 4RKAA 1PIIA 3RM9A 3WNKA 3CGCA 3L4YA 3ARTA 1SPQA 4DZAA 4YMZA 4YVVA 5DFAA 1FX6A 5D8WA 2J6XA 1F4AA 2C0HA 2GLKA 3ITXA 1VFTA 2ZZ6A 5A5WA 2W9MA 2WMHA 3M6YA 3GDTA 1W3KA 3BW3A 4QR6A 4JQ2A 2Y5SA 2P1FA 1XBXA 1EIXA 2PDUA 2PDLA 4DO7A 4LH8A 1MZHA 4ZFMA 1H0GA 4TIMA 2YXXA 3LRLA 1UD3A 2A4AA 3UU0A 1AA1B 1PBGA 3GHTA 1IE7C 2DJLA 2UWFA 4E5TA 3LA4A 4ROPA 4QP0A 4FP1A 3R25A 1JUEA 5FEXA 4JL2A 1UKOA 3S5NA 2XFWA 2R8WA 5TBOA 1KV8A 3NG3A 3BZGA 1GK8A 4MYXA 2IW0A 1OX6A 3LXAA 1A5UA 3U4FA 3A5FA 2XINA 3FJLA 1NWRA 4C90A 1WDSA 3FA3A 4JIPA 4GRTA 3HN3A 5E6YA 3GG8A 4O1AA 3ARSA 3HBLA 4CQBA 1SSGA 4PUUA 3AZTA 1N8WA 3AWNA 5AKQA 4IP4A 2OWXA 3DCPA 4FOUA 1W54A 3FN9A 2HEJA 2REQB 1EH9A 3NO5A 5CH9A 4Z1DA 3CGEA 5GNYA 4RDYA 3AJXA 1NDZA 2DT3A 1TA3A 4KWWA 3TC3A 5G1YA 2PTZA 2ZZCA 1KC7A 3VNDA 4MY9A 3VYLA 1XS2A 4O8RA 1W5NA 2W5FA 3DFTA 2ZYFA 4US5D 5AB3A 4U10A 3P0XA 3VU2A 3V4BA 3O05A 4JYEA 5C9XA 1XKYA 1RR2A 2X7WA 2YCEA 1T0OA 4PL1A 3M6DA 4M80A 2W54A 4I9MA 4Q6XA 3T0TA 4C6OA 1KR0A 3BMWA 3TROA 1NQKA 2HPIA 3ZIZA 1K77A 2PU0A 2TPRA 2D1ZA 2WC7A 2D23A 2G3NA 3GFXA 1HL2A 4JOMA 1Q6QA 3C5QA 3VNMA 3F4VA 3TR9A 2QXWA 4Q32A 1JJKA 1R38A 2NSXA 1VH7A 3WK2A 2WHJA 4OWGA 3W1XA 3FAXA 1ZBWA 3LG3A 1R87A 4LYKA 4KCUA 5A8QA 2GQ3A 4TR9A 1WKEA 2YA1A 3TYEA 5DRCA 1LYXA 2P0IA 4LVFA 1EP1A 1JZ3A 2PDFA 4UZUA 3PJXA 4XZBA 4DYKA 5JCNA 1NU5A 1ZJBA 4MDPA 4K8EA 3WJSA 3PBWA 3UBPC 3VABA 5JVLA 4PE8A 2QR6A 2JALA 1ME9A 3LSBA 3GYCA 4F9JA 1F7BA 1VGAA 2XUCA 3TN4A 1EC9A 4H8VA 1KQZA 3W6LA 3WYZA 3UR7A 5CSUA 1LWJA 4KF1A 4S2CA 1VQZA 3MJMA 3USBA 3FIGA 1FWRA 1LTDA 4ZB5A 3VX1A 7REQB 1C3FA 5I3DA 4CQCA 1JYXA 1PV8A 4MPKA 2PDIA 1E55A 1NEYA 1LBLA 3IV3A 2VELA 4IPJA 3SSZA 4LY8A 2DDXA 5I3GA 1S39A 2ONEA 4LNCA 4R5EA 5F2GA 2RGLA 1K02A 4IHCA 1XINA 4HHMA 2EPMX 1YE6A 4S3FA 2R1MA 3ZVHB 2WMGA 5SWUA 9XIMA 3H2MA 5BOOA 4KESA 4MB4A 3GNXA 3M46A 4W85A 3GDKA 1B3ZA 1FWWA 3H53A 3QHOA 3TONA 4I6KA 1SSDA 1YHTA 1C93A 2RDXA 3B04A 3B0PA 3BLFA 3N2XA 4BZYA 3UPBA 1W8SA 3LI0A 4B4FA 1GQLA 3QYQA 1EYWA 5TNVA 4OIFA 1VJSA 3N29A 4DJFC 1EL3A 3CHEA 4ACYA 3SCWA 4TTUA 1XICA 2QCMA 3GAKA 5I00A 4LVDA 3W83A 1WKFA 3PPFA 1ITUA 1UWQA 3GTIA 3UERA 1LUCA 2XH4A 2QUTA 2YYUA 2WMFA 5FJUA 1GYLA 4H8HA 3N2BA 3GC4A 3VKKA 4E2BA 5EBUA 3NPUA 3V0UA 3UWVA 3VZYA 2JK2A 2Z7GA 4E38A 1J5SA 3HG3A 1KFJA 3NQDA 3HG4A 4GD0A 2Y8KA 1WKDA 2PP0A 1WO2A 2Z2AA 4LYQA 3NZRA 3OVPA 3UG8A 2ZRXA 4GIRA 3QPZA 3WJZA 3FJ6A 3H2AA 3PK7A 3TA6A 2B81A 2PEVA 2OSXA 5EMYA 3R1ZA 1SW0A 2O9RA 4KWVA 3EXSA 4OVXA 4OT7A 1IR2A 1R9ZA 1XIBA 4ZOHB 1NH6A 1LM1A 2QVNA 1CT5A 1M5WA 4LAMA 5XINA 3PG9A 1U33A 3ME3A 3QFEA 2WC4A 2PWVA 3FDKA 4O53A 4DJFD 3GO2A 3AYRA 1FXQA 2FMOA 4MAVA 3UY7A 3VD9A 3OG3A 3WL1A 1OGSA 6XIMA 3U8GA 2WV8A 1EWDA 4MHBA 4C6IA 2CBUA 1E71M 1Q6RA 4YTTA 1Q6CA 4HNUA 4KT2A 1QMLA 4RXFA 1JCTA 2WXDM 5E09A 1TUXA 3JW7A 3E2QA 4TX8A 3QZEA 2BV9A 4M81A 4PMZA 1US2A 2W63A 4C6MA 1AJ0A 1EWEA 2P53A 3BW2A 1G9HA 4FDCB 2A7PA 4D1IA 2VC6A 1CLVA 5K9CA 4NZ1A 3IJ7A 1UYQA 3IUHA 3TJLA 3BW4A 3KEHA 3U48A 1NP0A 5MHBA 1KM6A 4RNJA 1D2KA 3A7RA 1DNCA 1CECA 1ZJIA 3VC5A 4W7VA 2C1IA 3MUXA 3BAYA 1XLFA 1UIPA 3Q58A 4LIIA 3M47A 4O19A 1FOBA 1U22A 2TYSA 3Q6JA 4ATDA 1QW7A 1PXGA 4Y96A 3AYTA 4CNUA 3STFA 1WXYA 3UZ5A 4UTWA 2ISFA 4J2PA 3LHVA 3BURA 4HJFA 1HX0A 4HMEA 3LHUA 2VGBA 3PUOA 1WYGA 3WLQA 2GGJA 3VDAA 5A6BA 1DWFM 1GGOA 4MLJA 1R0MA 1XF0A 4K8GA 3MBDA 4MWAE 2PC4A 1NFPA 2NLIA 3OODA 5DCDA 1OT2A 4ZB2A 3CB8A 2NQJA 3WQ6A 8XIMA 5FSEC 3S5SA 3HF3A 1KGUA 1VLWA 1Y5WA 1E6SM 1WBJA 4J5NA 3MO4A 5EBKA 3RCMA 1UBSA 2VYOA 1A5AA 3OIHA 3SGGA 1GRTA 4HQVA 4C7GA 3UWEA 1CNVA 1J5TA 3ITTA 1UZDA 2W91A 1VEMA 3R58A 1BXNA 3KM8A 2WPCA 2J79A 4IFOA 1IGSA 4KEMA 4MWAA 3GH4A 2XGZA 1JULA 4NZJA 2ZTKA 4EMWA 4KPRA 4QQUA 4TMCA 1AQMA 2OWCA 4R27A 5FL1A 3UVIA 1DBTA 1Z32X 2TPSA 3MQTA 1Z48A 5KZMA 4L61A 4R85A 3SQSA 1KM3A 4TU1A 4E4FA 1VBRA 3GRSA 3MT1A 1E9YB 1CIUA 3DBPA 1UKPA 5A95A 3EXRA 3PTKA 2EQ9A 4A3YA 2Y62A 1MQRA 1DXLA 3CM4A 3I7QA 1LROA 3GWQA 4F4RA 1ZENA 4GY1A 2HV5A 4GISA 1M1BA 5EGRA 3CZLA 4XTDA 1XPGA 1XLKA 3QVQA 4YXGA 3L8KA 2J62A 2PDBA 3CWHA 4AC7C 1REQA 5EKYA 3EAUA 3PTMA 4DO6A 3WLOA 5GQBA 2ZUWA 3LB0A 3PB0A 3LCLA 4JY9A 3W1TA 3CQHA 4JQ3A 2DUXA 1OC7A 2OJPA 3NL2A 4EQSA 2CBIA 1YQZA 4XQ6A 4HA0A 4M6VA 3TTSA 1XLIA 1SJAA 3HQ1A 4F79A 1E1CB 5CBBA 2DZSA 3HGJA 2VGGA 4AVFA 1IZKA 1HVXA 3H22A 5LA2A 3WKZA 1QPQA 3VIOA 1C7SA 3WLSA 4J3SA 2A3BA 3BL3A 5LXXA 1HG3A 4JTRA 3VOHA 1B5TA 2ZDRA 3LHWA 4PMXA 4NAEB 2BCPA 4JDYA 5EB8A 4B91A 3EPOA 4L4MA 3MW7A 3SECA 3QHMA 4MAZA 2YIHA 5AHNA 1NOFA 3R10A 4AIBA 4HCDA 4P8UA 4TQTA 5JIWA 2FFCA 1KCXA 1OF8A 3QZAA 5B80A 3PWIA 1AD1A 1YIXA 2XIIA 3QGAC 2X1SA 1OABA 4ZB0A 1TZ7A 1PHWA 1Z41A 2PU1A 3MWCA 5JXQA 1QOQA 4YIWA 4GYPA 3PB2A 3ZT7A 2V3DA 4ECLA 3I3DA 1XD0A 4K37A 3OEXA 3A3WA 1QHOA 3M4HA 4I7VA 5FA5A 3USZA 2XYLA 4Y6GA 1JXKA 3HPXA 3D3AA 2WVSA 4IIEA 3EWUA 1XIHA 1F3TA 3PG8A 2G50A 3CQKA 1QO2A 1FBAA 4S3DA 1BG9A 5CZSA 3C8FA 1EJWC 2UBPC 1QNPA 3URAA 3TYUA 2F2HA 4AC1X 3WENA 5KTLA 2CC0A 2NXGA 2EG6A 3XINA 1NHPA 4IT1A 3WF3A 1ISZA 3QMRA 3HV8A 3SCQA 3UJRA 5A69A 5I2UA 3ENLA 4EAMA 1UD2A 4H4XA 2VEIA 2ZRYA 3P80A 5EA9A 3PULA 1DE5A 3TCSA 3SN1A 4Z2KA 4JCLA 3BAWA 1TWWA 1AG1O 4GLEA 1OFAA 3FGCB 2BHZA 3OLDA 3MJYA 5GPRA 4HSOA 4PUJA 3NQGA 2G3MA 4OBSA 4BURA 1NFBA 3RN6A 1GTHA 2OQYA 2RHGA 1O5KA 3FS2A 1Q2SA 4I8YA 3WD4A 5DT5A 3NXFA 4MYAA 1MEHA 5M17A 3NPWA 4GUHA 2H6RA 1XIIA 4H4PA 2X7VA 3ARPA 2Y24A 1C8VA 3KTCA 1GZ1A 3EGJA 1EP3A 3P61A 3TTYA 2GL5A 2WMJA 1UIOA 4RW3A 2CKSA 3WDPP 2VC7A 1CGUA 4OBTA 1K4GA 2CLFA 2VDGA 3VIPA 2WM1A 4LBUA 1QPNA 1B0IA 1OZMA 2PCQA 1RA0A 4EPEC 3NJ3A 1HO4A 1B90A 4J57A 1XRSA 4XVDA 2DQXA 4JTEA 4EPBC 4IXXA 1FWJC 3N4FA 2G95A 4ONVA 1RHCA 4MWAC 3KRZA 1M7OA 4JS3A 2CW6A 4ZOCA 4IMGA 4C6QA 1AL8A 4RUBA 3L4WA 3TNBA 1SO5A 3GXFA 4NI3A 3H2NA 2ZCGA 4ERIA 1W6TA 4O11A 4QEEA 1K9DA 3QV8A 1D7YA 1WCGA 3GG0A 1FRBA 1MEWA 3W76A 1VFOA 2ASHA 3JZUA 1EYEA 2DUZA 1E70M 3LGGA 1RD6A 1FIQB 4O0QA 4GUJA 4L65A 1OIFA 1GZGA 2YBUA 1EQPA 3APGA 4G2DA 1KLZA 4AD1A 2ZX8A 1LUCB 4WY0B 3INPA 4A8RA 3U2CA 2VFIA 2YGYA 3BPWA 1XLAA 2XDFA 2VCCA 1QW8A 1TV3A 4AG0A 1PE1A 3W70A 1KFLA 1I9CB 4O1BA 3W0KA 2J77A 4H7CA 1CXHA 2BHYA 1X1NA 4Q4RA 1MUWA 1D8CA 1LDCA 3G77A 4W5ZA 2DVUA 1XYLA 3LZ3A 3XISA 3W7HA 4J2MA 3BC9A 1DEDA 4REQA 2V2HA 4E2DA 4W7WA 4A05A 2BP1A 2CBJA 4JTGA 1UOKA 1O5RA 1JCYA 3H8AA 2GR0A 3M16A 1R2TA 1Q85A 5DELA 5EMLA 2J7HA 3EWBX 4ZQMA 3RR4A 4K8HA 4JTQA 4XKMA 3S2NA 3CIVA 1K8CA 2FHCA 2WZEA 3DGZA 4BEQA 3DBNA 4YTUA 2OLSA 3QN3A 1Q66A 4BF7A 3QXBA 5M5DA 4JNYA 4J1OA 2ZUNA 3W75A 3WY1A 4CN1A 3AAMA 2YL6A 2WANA 2D0FA 3TXZA 1UWUA 1HKWA 1ZQ5A 2VDHA 1DOSA 3C0QA 2J47A 4JBRA 1W1TA 4UTKA 4PBEA 4ML4A 3LXDA 1LL4A 4NKCA 1A5CA 2RDTA 4RPQA 2DQWA 4LQ1A 4Q8OA 4IMAA 5BMXA 2GVJA 3C0JA 1GOKA 3EWYA 3NQ7A 1EX5A 1NF0A 1DWGM 1PZ3A 2Z1VA 4DXXA 2FMNA 2XSXA 1TCMA 1LBFA 4UTFA 4YVXA 4E3VA 4H00A 1WAUA 4EKJA 4EK7A 4QSHA 2V3GA 4PMYA 2ZA2A 4AX6A 4H4WA 4LNYA 2J9YA 3CYVA 4DWSD 4RNFA 2DU2A 5G2WA 3B9OA 3NGJA 4H1ZA 4DEFA 3NO1A 4FXRA 1NVMA 5BRQA 4K6AA 1JYNA 1FCBA 3KVMA 3GBDA 3M44A 3KXQA 2GJNA 5DN1A 3W4RA 5JBDA 1AMKA 1DIEA 4KIEA 3MDUA 2H90A 1IZJA 3LDVA 1KTNA 2XM2A 3S3GA 2X30A 3S46A 4GE8A 2UV8G 3WLJA 1I2RA 4GG9A 3WBXA 3S2MA 4AZ5A 3F2BA 1SMAA 4X3ZA 3VDHA 3KOXA 1UG6A 1DWJM 3L65A 4W86A 3GLCA 4Q3MA 5BW6A 1W5OA 5CLTA 4DNMA 2BXZA 3K4AA 1WOAA 3MS8A 5H8UA 3W2UA 4D9PA 3EEGA 4QE4A 1OQFA 4HZ6A 1ZB5A 1OK4A 5ABGA 1R3YA 1UR2A 4D71A 1BSIA 2EO7A 1PIGA 3W6YA 3QQWA 4H3DA 1LPFA 1FWIC 1WDWA 1KR1A 3JR2A 1JF6A 2Z1BA 3QEZA 2VR2A 5DX7A 3LCIA 5G1TA 3UWQA 5C8BB 3IJ9A 2JEQA 2NLYA 3GB6A 1R86A 1UR4A 3VVGA 2BNJA 1E43A 4FA3A 2PRHA 5CGQA 4Q33A 2FZMA 2QPXA 2V63A 4Z1CA 1UH2A 3UWYA 1TIMA 3QC0A 2GWGA 1TPFA 3HZ3A 4JGDA 5FD0A 4N4QA 6TAAA 5AHMA 2Z26A 4GI9A 1UWRA 2IKIA 3T78A 1WKYA 3BAIA 2GVLA 2I17A 4S38A 5CC5A 2ZRVA 3MMDA 4HZMA 2VZTA 4HN4A 3HQPA 4UR7A 3QOKA 1EGZA 3AMZA 4G1NA 4LC8A 3AIUA 3PZIA 4APNA 1SYTA 3H7VA 3IJQA 4GKTA 3G3DA 1MYRA 2J13A 2YA0A 1N62C 4PSPA 2XH0A 1Z8AA 1KLYA 5IDZA 2Y8VA 1KFBA 1CLXA 1WZAA 1XL9A 5U25A 1HJXA 3ANVA 3L68A 2Z27A 2A85A 2Y2WA 3VZXA 4PODA 3RJXA 3WQGA 3H70A 3PWAA 3WEMA 2CERA 4LYPA 1XRTA 4H2CA 2Q3RA 5BRBA 1KCZA 3TAOA 4H9YA 5DMYA 3U0HA 1EKOA 3WLKX 3R43A 4HNTA 1H4PA 3C86A 4MIMA 2Y7GA 3HFYA 1XP3A 2VGIA 2WVVA 5FACA 4J28A 1ZLPA 2V30A 3UNDA 3Q94A 5M1TA 2QW5A 2YL9A 1O60A 2ZX5A 1UKTA 4JN8A 4JN6A 3RCYA 1W31A 2HDJA 4LPCA 4HSHA 5T26A 4UTUA 4WVXA 1XHGA 2O55A 3LBCA 1X39A 2YPIA 2PA6A 2V5JA 3PZVA 4H41A 4GMEA 2FTPA 5CBJA 4QQ3A 1XI3A 2GQ8A 2D0HA 1DTUA 3UW6A 4ZSUA 2VFDA 2QCEA 1WNOA 3AYVA 3SCSA 3VZZA 1W9UA 3SCPA 3VIHA 2DSZA 4JKMA 2HS8A 2VI0A 4HKPA 1SGJA 1ODUA 4C6LA 2NV1A 4FK9A 2XPKA 3H4GA 4G1KA 3L4TA 3E5PA 4RDZA 3M5ZA 3OZYA 3S6OA 3WX7A 4LWWA 6XIAA 1T6MA 4G9PA 4M52A 1J4EA 1KXQA 1VPXA 1TKKA 1XRVA 2A21A 3EWXA 4AZCA 3CIXA 5AC7A 3O6CA 1GOXA 3VD4A 5FF7A 1ISYA 3R2GA 3UCDA 3CL7A 4B5VA 4OECA 2AL2A 1JPHA 1TR9A 2YX0A 2R94A 3DESA 3L4UA 3UCCA 2WJZA 1H3GA 3W81A 2BY1A 2CLMA 4J7RA 2Y85A 3WJYA 5D2TA 4N6FA 1QWKA 2C0AA 3PPGA 1B3WA 2CWXA 1ADDA 1XSIA 4NYUA 1WBHA 1F9CA 3RNDA 1EA9C 4X2PA 1VHCA 5AYZA 4DB7A 4IQEA 1BAGA 1JDCA 1VPQA 3LLXA 4NEWA 3A3HA 3BLEA 2WNQA 2PLMA 3OTRA 4WR3A 4ZO9A 3DHFA 4DLFA 2BGSA 3MP5A 3W7RA 2C1HA 2OODA 3SUTA 4YTQA 1Y8BA 2WQPA 2XIBA 1ZY9A 2YXGA 4LALA 4NX0A 2Y88A 3THAA 3ARWA 1A3XA 4GJIA 3KHJA 1LWIA 1QI0A 4GIAA 1R3VA 3HURA 2Z1WA 1P48A 1J18A 3G1DA 1ADSA 5K2ZA 1AW5A 5JCLA 2HK1A 4PC8A 3WUGA 3M9YA 3UG3A 1K4QA 3M41A 2XM1A 5CBIA 4O0KA 2C8NA 2V5DA 2WKLA 3FKRA 5CPMA 3NL5A 2E5BA 4FF7A 1GVOA 2EQ8A 1M3UA 1LF1A 2OB3A 3CH9A 3N2TA 3JVAA 4MUZA 4PUDA 3WD1A 4H4VA 4Z2IA 4DBWA 3A22A 5T9BG 4EOUA 4DBEA 4DYJA 1JPKA 1PHQA 3NDYA 1DTNA 2I9UA 3NSMA 1C9DA 3WH7A 4QG6A 4ACZB 3F03K 5HR6A 4NX5A 1F5ZA 1P0EA 4GVFA 3VNIA 4K7VA 4E2OA 4I3GA 4REQB 1RBLA 5M3WA 1QNRA 6PTDA 1NTHA 1ALDA 5FL0A 3R8GA 4PGLA 5D32A 1FHLA 3EOSA 3N9KA 1TMLA 3GVVA 4LW7A 2R1PA 3HW2A 1Q8AA 5EBAA 1BPLB 3ABOA 1SW7A 4WRHA 1XYCA 5J04A 1JL8A 4B5XA 4E6MA 3NVWB 5A8NA 3SR7A 4J56A 3N19B 3DGBA 1UZHA 1VIWA 3PVFA 1MW1A 4XZHA 4KWUA 5HANA 3NS1B 2Z6JA 2E9MA 5LIYX 1TPWA 1UWAA 2ZZ4A 1GREA 5FEZA 2AQVA 3AC0A 2XZ7A 1V0LA 4NXSA 1YKWA 2ISVA 3FVDA 1F05A 5AVHA 3N11A 5HBFA 2F38A 1YDYA 5I5RA 5DCEA 1K9FA 5D9PA 3MZ2A 2PMQA 4NZFA 3FYYA 3KP1A 1CLKA 1WP6A 1EP2A 4GUIA 5F1VA 1IR1A 4AX7A 2VCAA 4JZ5A 1EUNA 1K6AA 4Q7BA 5AHFA 5GJPA 2F8QA 1X7IA 1UH3A 1GHSA 2BOFX 1XCWA 2VOTA 2BC0A 3II1A 1XLEA 1TPVA 1FVPA 1XH0A 1QI3A 4BQ3A 2R9ZA 1GOQA 2FDMA 3E5BA 3ZMRA 4GH3A 3WK0A 2HCVA 1MW2A 4IUOA 3SADA 1W9XA 2CZVA 4D6FA 2JGQA 2VEGA 1RY0A 3WMLA 1P0KA 1PJ9A 2VWTA 3CS2A 4E0CA 4F0LA 4OUIA 5I07A 1S5WA 2WHMA 4O12A 1XDMA 2FQIA 5E93A 2C14A 2WP6A 3ARYA 4Q8VA 3WLHA 2QDDA 1DJNA 3PPHA 1H7OA 2X42A 4QG9A 3IIPA 1ZNNA 3GTHA 4OUEA 3NL6A 4AWSA 5REQA 3N4AA 4W4QA 1BF6A 3CYJA 1RA5A 1EIBA 4TV5A 1TMQA 3GDLA 3EA2A 3WQVA 1QNSA 3G2GA 4PSRA 1GRHA 4JAWA 1VFUA 4Z08A 1NPXA 2I9EA 3HRDC 5FF3A 3QOMA 4ZA0A 1S2UA 4TVDA 3W1PA 5A6MA 3LCGA 3LM3A 4LU0A 3A7AA 2DT2A 1E6RA 3P74A 1VB9A 3W3OA 3BLDA 4YHGA 3P2VA 1J9YA 3WNLA 1FHVA 3GD6A 3DFOA 2BB0A 2DGAA 3C6CA 1MOKA 1VQTA 3CPGA 1CEOA 3SRKA 3K5XA 2OEMA 2NQ9A 1MQQA 5JH1A 1IXPA 2NT0A 1GRBA 4O1EA 3TA9A 2AQWA 3FK4A 2V6AA 1S3TC 1BQCA 1U5VA 5EFDA 3W1RA 3NQBA 3M5VA 3UQNA 4IGMA 4K8DA 4Q8MA 3A7UA 1PCKA 3O6AA 4AD2A 4GVIA 2PWGA 4DI8A 1YBQB 3WNMA 1M65A 3C52A 1F2JA 4C60A 1E9LA 3D5HA 2VQUA 1JDFA 2B7OA 1K7EA 3JZEA 1OCNA 5EFFA 2XZ9A 3PZOA 5JMUA 1DYSA 4D8AA 1EC7A 4EQWA 2OO0A 1UWSA 1V6XA 5BOEA 1KM4A 5HQMA 1MW0A 3NVDA 3TVAA 1RBAA 2OX4A 4GFIA 1QWGA 3NQAA 3EYPA 1BRLA 1QNQA 4NI8A 4PB4A 1E51A 2A6LA 3ARZA 2OKTA 4P7QA 5KVIA 3LLDA 4MMWA 2OEKA 1Q2RA 3CV2A 3IK2A 3AWOA 3LTPA 4QDPA 5JU6A 7CGTA 2NT1A 3LSCA 1NHSA 3UWWA 5D38A 1XC6A 3VM7A 3CLWA 1C7TA 4AXKA 2XSAA 3FCPA 4A29A 3AYSA 1N60C 1FA2A 3W7KA 2PDHA 3RRAA 1A49A 1XBZA 2EPOA 4U3CA 1IXNA 3GW3A 2GDQA 2WPFA 1LOLA 4NUWA 1FWCC 3OZMA 2WLYA 4OHQA 3E49A 3MYOA 1JVNA 3GUGA 3PBMA 1KBIA 3KHDA 4UXDA 2E1DA 3GNDA 4KEVA 3AI0A 4PRWA 5DF0A 2DZXA 1DXIA 3NEHA 1E1FA 1XLHA 3MMTA 2DZBA 4F40A 3AMDA 5G4EA 3NZGA 1UZ4A 4ORMA 4RDVA 3BCFA 2GK1A 3A4WA 1WE5A 4NG3A 3W01A 1AJ2A 3V1HA 2J74A 2B31A 4LUIA 1RY8A 1RQHA 2J24A 3NQEA 5G5GB 4UFHA 2QHAA 4HIBA 2YDAA 3DI0A 1S2AA 3KDNA 1UW9A 1J0YA 3UJFA 3PANA 1LG2A 2V3AA 1TV8A 4IZGA 1IWAA 2QCDA 1JRCA 2PLJA 2YLLA 5EYWA 3K4DA 4FLQA 4CU8A 1KWGA 1U2YA 1EGVA 4JKKA 3CGTA 4LFYA 3DK9A 1HJSA 4US6A 1X1OA 1K6WA 3EA1A 3O7UA 3F4CA 4KEZA 1ZRQA 4UR8A 3CQJA 2EPLX 3WDIA 3AROA 3KLKA 1NELA 4CD8A 2DFAA 5CG0A 3TZFA 1JFXA 5AN7A 5FEPA 3PM6A 1ONWA 2VEFA 4LF1A 1JPMA 3FFSA 1T8XA 3ZXWA 4IIHA 1V0KA 3S8HA 3B9NA 3V36A 3TSDA 4FB7A 4H9VA 3PBYA 1ONRA 1MNZA 4ML9A 4BS0A 4UFJA 4AVNA 3WDRA 5DEZA 4N42A 3WBWA 1FH9A 1TIWA 2Q01A 2J75A 4Q6JA 5CZJA 3W72A 2J25A 4BEUA 2OYLA 4WDXA 4PRTA 4GNJA 2NPXA 1BKSA 2ADAA 4MZYA 3FKKA 1E9ZB 2DZAA 3MMUA 4GBUA 1BYBA 1B4EA 5AHIA 5I0DA 4XAPA 1TTQA 2RFGA 4E8CA 2WPEA 1XLDA 2PLCA 3KL0A 2YZ5A 1PYFA 4QRNA 4JR5A 3GU9A 4L7ZA 1ME7A 1FEBA 4QEHA 5PTDA 1IXOA 3ZO9A 5BXSA 3QFBA 4UTJA 1K8XA 3V35A 1EJXC 2OEJA 3D9XA 3WH6A 4Q8TA 4Z0JA 4KPLA 4GI6A 1V79A 3L5AA 4GC4A 1UD8A 2VX4A 4AZHA 4HA3A 3PFMA 4QNWA 4HA1A 3CZ8A 1J11A 3ETRB 2J8TA 1JZ2A 4UQBA 3DH7A 1X6NA 3TSBA 3NSXA 4AHPA 4FPSA 2G37A 1KGXA 4NIRA 4L4LA 4UBPC 4NNCA 5AECA 4EXQA 1FFRA 4JTFA 1DWAM 3FEQA 5I09A 1UA3A 2W3RA 1EZ2A 1HTIA 3KBSA 3ES7A 5BOFA 2ZX7A 1HNYA 1PKNA 4P61A 4LANA 3RYSA 2AL1A 1DHPA 4KRTA 3LS9A 5I79A 4O0ZA 2QS8A 2HISA 4DBUA 4IG2A 1JI2A 2XIJA 1L6GA 2C3ZA 3B8WA 1G01A 3C2RA 1MFVA 1ZSXA 4C7DA 2GQWA 4JYDA 4A6GA 4AU0A 5GNZA 3H4KA 4LJ3A 3OZPA 1TWZA 2IUZA 2GJXB 3VIFA 2J9ZA 4XB3A 3TMQA 4JCMA 4I5XA 3QPEA 3NUKA 5CZTA 5D2XA 2HVNA 4HB7A 2HXUA 3O07A 4KH2A 3THDA 3DFQA 4XZWA 1NY1A 4PULA 4O1FA 4HHLA 1E0WA 2WCAA 4FOJA 1SJDA 3XIMA 4FNUA 4A22A 5DBUA 3CEPA 4GCAA 3W26A 3TWBA 2E6YA 2OR2A 3LK6A 3M5YA 1TTPA 2Y7EA 2KX9A 1O7AA 2FKPA 5CXPA 4ZO7A 1KFEA 3M64A 4QE5A 3I4EA 1UR3M 2TAAA 4K7YA 2YVFA 2VUYA 4A35A 1C90A 4AISA 3S2JA 3M7WA 3SCTA 4ZQRA 3VMOA 3TQVA 2V8ZA 1L8PA 1G69A 3R6IA 2VX5A 4C5ZA 3OZOA 1H7NA 2Y70A 3OU8A 3T0BA 2XTKA 3N3TA 3BWWA 1E0UA 1XDJA 3LYEA 3JS3A 1IEVA 2I14A 2XIOA 4NQ1A 3AMGA 3WMBA 4Q4PA 3NXLA 1CXFA 3ZWTA 1N63C 3TQKA 1SZNA 5HUOA 4O4VA 2EXOA 4URIA 4G6CA 2WSPA 4GA8A 4ATLA 3NCOA 1F3EA 1Y5XA 5FI8A 3CC1A 3PZNA 5CPTA 2VXNA 3H21A 3DGRA 3ZJ8A 3LD5A 3BQ6A 4V2XA 2BOEX 4MB3A 4HHHA 1OG0A 1XYMA 3EOOA 4A3QA 4H7VA 1E56A 4W9TA 4KMQA 5C70A 3QQ1A 3TW7A 1GKQA 3G1XA 2AGTA 4EWJA 3ITYA 4QLKA 4H6QA 4CCZA 2E3TA 5REQB 2PDPA 2WNWA 3W7IA 2GUUA 3ERPA 1KO0A 3E3HA 1R6WA 3EX4A 3MVIA 2OLHA 3HQOA 2VFGA 4CEUC 1V3HA 1QO5A 3W82A 3RX4A 2C6QA 5I06A 4ADTA 3C4UA 4NJGA 4MNLA 1FCQA 1YNPA 3A13A 3DG7A 1H51A 2EQDA 1V08A 3TW9A 3W9ZA 3ZWSA 2LLEA 3S9ZA 4BJHA 2PTWA 5U4NA 3KDOA 2IPJA 1X2GA 3MKVA 1MFUA 3PPCA 4PTXA 2ABBA 1S46A 3PHAA 1YADA 1ZKQA 2XIMA 2J7EA 1OYAA 2KZHA 1GV4A 3LMYA 1ONEA 3WUEA 2E6FA 2YFNA 1JFHA 1EDGA 3WN6A 3RMEA 3OBEA 1G94A 1W3IA 2R14A 4ADUA 3M5XA 1DQUA 3QM3A 3RPMA 3WEZA 1QFEA 2J7FA 5FMHA 1IT7A 2X8RA 2PP1A 3WLIA 4MJMA 4UB9A 5H6HA 2Y8UA 1UMLA 1MDLA 1ZFJA 1GEUA 1EB3A 1ZUAX 1GJWA 4UQ9A 2HMCA 3NZQA 3R89A 4M0XA 1FXPA 3I6RA 3T09A 4IP7A 2Y6ZA 3VK5A 4I9TA 4ZFCA 3EPNA 1QU4A 1BRLB 5A8GA 5C2CA 2P0OA 1A5BA 1YDOA 1W1VA 5CCZA 2XVGA 1RCQA 3VIKA 4UQAA 4FXJA 2DY3A 4P7LA 2W27A 3DHDA 2ZBTA 4C91A 1BTMA 5JCIA 2NSOA 1RCXB 3WH8A 4MKVA 3LXCA 4DWSB 3KS6A 1EJSC 1A0EA 3N6HA 2PWHA 4E2VA 2ZRWA 4FR1A 4MF4A 1G0CA 3SFWA 4JNZA 1V0NA 3T2QA 1VPYA 4KW2A 3VMNA 1G7VA 3K4WA 3WLTA 3GW0A 3W1AA 4R7WA 2D3NA 4JFVA 1EBHA 2ZXBA 3HGOA 4FNSA 3VNYA 2OOFA 1SUXA 1DJYA 1FO4A 1BYAA 1RSCA 3W27A 1BWLA 5E0FA 1KRCC 2XSBA 3WBAA 1BVNP 2GUYA 1JYVA 5A6LA 5K4XA 3GRIA 3VKCA 1GVSA 1I1WA 1BTCA 4GQBA 3QC3A 4MNMA 1A47A 1R3SA 3MUAA 2I5IA 1CGVA 2Z2BA 1E6ZA 2WJFA 4S3JA 5FJPA 3J7HA 1DJGA 2OYMA 3SFKA 1Q45A 1H2JA 3O0FA 5AHEA 1XLMA 2GK1B 1M7JA 3E0FA 4QX4A 2WOWA 4QS5A 3AZSA 2E7FA 1POJA 1US3A 4ZGYA 3GUWA 1Q13A 4XIAA 4RK8A 4QFUA 2HPMA 2W55A 4BQ2A 3N2CA 2JE8A 1K3UA 3RUBL 4AZIA 4HOZA 3VGGA 4WIWA 4W5UA 1DIOA 2CIPA 2Z28A 1A3HA 3I7RA 2V3FA 3RU6A 3ES8A 3ZR6A 2PWUA 4WK9A 4LS2A 3HPSA 3RJYA 5XIAA 2QCDB 3L0GA 3RILA 2QAEA 3CWOX 4J4KA 3PP7A 4CQ9A 2XH7A 1QI4A 5DLCA 1IQ8A 3AS1A 2G3JA 5A2AA 3CGDA 3LI1A 2FVMA 1LJYA 3NVTA 1F76A 1G6CA 1RK5A 3FHQA 1HW6A 2Z6IA 4PL2A 1W32A 3IK4A 2IKJA 3SDOA 4AHQA 3G24A 3LCHA 3PR2A 3QGVA 4NAFB 3QGKC 1GQKA 4JTSA 1W2PA 1H49A 4QE1A 2C18A 4UNIA 3SURA 1JZ7A 5KMYA 5ABEA 1FH7A 1H7PA 1VBHA 1A5MC 3YPIA 1H41A 2BXYA 3CIWA 1IEQA 1W1ZA 3UNTA 3WQ8A 1A50A 2ZZ1A 1JCNA 3OGRA 4K7ZA 4OZOA 1C8XA 2QULA 1G4PA 3DJGX 4J3TA 3ABZA 3CL6A 4C1NB 2QCNA 5IFTA 2INFA 2VGFA 3G0SA 3K8KA 6ALDA 2WJEA 3NA8A 1KRBC 2QV4A 5ABTA 4WCJA 1DJXA 3ATZA 5AC6A 3VNLA 4FALA 3BANA 3FJ4A 3CTLA 3RU8X 2Z7KA 3ALFA 3FOKA 1T99A 3RLHA 1PKLA 4PTWA 2HRWA 3IS4A 1QHZA 2FLIA 3EOEA 1B31A 5HMFA 3I6EA 3RO8A 5EMMA 3ANYA 1RP8A 3BUVA 3W1QA 4B15A 3BLLA 3KP0A 2Z00A 4PMUA 3BAXA 4NHVA 1XWYA 5AYIA 3WQDA 1OC5A 6TIMA 4L5ZA 4A4AA 3W38A 1QDSA 4YLWA 4W87A 1NWTA 1Y7VA 3JRKA 3P67A 4O16A 4OQVA 2RABA 1S5NA 3GR7A 1CYGA 3ZVHA 3BSHA 4FEZA 2CLKA 1H1YA 1KWKA 5JRBA 1W3HA 2YBVA 4Q8PA 3CV7A 5AYXA 4L1GA 3T81A 4LVGA 1NIUA 5BRPA 2FTYA 1YPIA 4R7OA 1V3MA 1CXLA 4R9OA 1IWBA 2O0TA 1FKWA 3LQGA 3A9IA 1ZY8A 1EJTC 4I9JA 5C2XA 3JUGA 1UKQA 1V3JA 4IQDA 1T96A 3T44A 3NDZA 1X6UA 1CWYA 3GSMA 3GXIA 3N2OA 5FJIA 2OSWA 4DUWA 2X05A 1OK6A 3ISIX 4DZ5A 1TYTA 1Q6EA 4UCGA 3OYXA 3GKFA 4EXAA 4B90A 2PDYA 2GVYA 2SFPA 4GC3A 3EWWA 2G4JA 3G0XA 3GY1A 1P6CA 1X96A 2HBVA 4INFA 1XIEA 4CN6A 3COTA 4IL0A 5I3FA 4H6EA 2D73A 4X61A 4JIHA 2NUYA 3N17A 1Z9AA 4NNBA 1O94A 3LGDA 3D47A 3FY1A 3RNMA 1SFJA 1TSIA 1DXEA 1XYFA 2X0YA 1L2QA 4DAFA 3P6LA 3DN5A 4QJ5B 3O63A 3K8MA 2PS2A 3URNA 3CXOA 4HJWA 3LBOA 4B16A 1YRRA 1LLOA 3W73A 4AY1A 4CGTA 3SCUA 4LVBA 1D7FA 1C92A 1E4IA 3VGEA 2E6AA 3L66A 3OHMB 3UESA 4IQLA 2P8CA 2J66A 4B5NA 2BHUA 4EPDC 2F6KA 3AMLA 2PODA 1WV2A 1VENA 4QG8A 4FNPA 4CKQA 4H4ZA 4C6FA 4OOZA 4JY8A 4DUOA 3OQEA 1NAL1 2WOVA 2CHNA 5AZ1A 4DZHA 3WSUA 3VNKA 1JDDA 1Q1RA 3VCNA 1TWDA 2VZSA 3L0NA 2P76A 3IVTA 3KLJA 3H2OA 5HMDA 3QW3A 2AKZA 3HU7A 1YE4A 2CLHA 2EG8A 4BWLC 1M01A 3WLLA 1QHPA 3N25A 1RH9A 4UTIA 4QTGA 3CV6A 3GVGA 3PNUA 1H7XA 1ICSA 4QNEA 1DPMA 3WLPA 4OU1A 1I2OA 2E77A 5ABHA 1HF6A 3F5LA 4ZXLA 4MKNA 1GOIA 1THFD 5C0QA 2I57A 1GVFA 3WMCA 1SO4A 4BHYA 3EKGA 4TVUA 1EO5A 3APYA 4NRSA 1V77A 3DYOA 1QCWA 4IPPA 3QRHA 3WG6A 3N18A 4CEXC 2X1UA 4V1XA 4YWSA 4H8UA 2R91A 2GSHA 4ZO8A 1I8JA 1XIGA 3R79A 3IJIA 4JIQA 1MO0A 1R5YA 2PZ0A 1UJPA 4LB4A 4YPJA 3T07A 2V2DA 3CL8A 2AQOA 3IVUA 1GXFA 1NFGA 3CHCA 3T05A 2IMRA 4IM4A 4M24A 4JYFA 3QYSA 1O5QA 1PZ2A 2ZVRA 3VUSA 1QUMA 1EPVA 4P8XA 1LCOA 5GJMA 1IZCA 5HDRA 1ZX9A 1GUVA 4O28A 3W7NA 1P0BA 4H2HA 1K4HA 2DSWA 4LF2A 4U31A 4H9XA 3REQB 3V1PA 2VKZG 4C5YA 4IP5A 2YZRA 5HXMA 3W1MA 3BAKA 3V5OA 5H1WA 4DPPA 3DDMA 2PWDA 3POCA 1FWGC 5D04C 2VZOA 4LYRA 2JBMA 2ZFAA 4GX8A 1E1EA 1KM2A 1R3QA 2YB1A 3UXAA 1E3ZA 4DM1A 2OO6A 1NDWA 1YW1A 4LB3A 4M19A 2VVSA 2ZC1A 3GM8A 2QJGA 3RLUA 2JF7A 1HVQA 3H55A 7ODCA 4KS0A 4UTHA 3E1F1 4M8UA 1LBMA 3LCXA 4RV8A 1LORA 2GPTA 3PFRA 3BOFA 1F3XA 4WQ6A 1DJIA 4RPPA 1ZMCA 2FPVA 2UZ9A 1S5MA 3HGSA 4ZTYA 3IGHX 1TFVA 3MSGA 2CLEA 2YVJA 1CXEA 2HVMA 1PO9A 4YWIA 3KWXA 4KBXA 1IEIA 1ODZA 2E6DA 4JQ9A 1GYMA 1JDEA 1AOGA 4PH6A 1WZLA 3VOCA 1OFRA 1O4UA 1V7YA 3OW1A 2PDWA 4H9UA 3FXGA 2A8XA 3TSMA 4C6JA 4IJBA 3WFAA 2PDJA 5DMLA 1SR9A 2BVYA 3RCNA 5HQEA 1TPB1 1V02E 4Q7NA 4IL2A 4PMVA 1EX1A 2TMDA 2XIQA 3R07C 4S3CA 1EFZA 1TE6A 3RAOA 4NJHA 1HKIA 3RO6A 1OC6A 1AK5A 3ZJ7A 2BX7A 3PZUA 3NQ6A 1OGGA 1OJXA 3NIYA 3VO0A 3EMZA 3VD3A 1CI1A 4IMEA 4TXEA 5HNUA 1K8YA 1V02A 1E1CA 3EMCA 4BF9A 1KW1A 3C2OA 3ATYA 4KRZA 1YXCA 1J12A 3UEQA 1DJHA 5IBXC 1IHIA 4QLJA 4AD5A 1AZ2A 4GI4A 1ZTVA 2P10A 4GRSA 2JKEA 3CV1A 2A3HA 1JNDA 3F4DA 4HCLA 3M0JA 1CB7B 3LNMA 5KSWA 4M82A 2CXGA 4QM1A 3W87A 2PF0A 4NAEA 3SCVA 3W07A 5D2VA 3MMWA 3DAQA 4DO4A 1TREA 3AOFA 1IEWA 2ZKMX 5F2LA 3O6YX 4DM2A 2CXEA 1N8FA 4M3PA 1EZWA 4TVYA 3IEBA 3M0ZA 4CD7A 3VCRA 2I5GA 1I2NA 2ZIDA 5G4WA 2Q3OA 2X16A 4XG1A 3V3WA 5HINA 1VFFA 5CAKA 2GSEA 3VGDA 3OHIA 1MDRA 5U1OA 1EBGA 1TTJA 1R7OA 3PUEA 2E8YA 1NF7A 5DQPA 2VX6A 1W0MA 4LC6A 3S0CA 4PUEA 4J27A 1W2VA 1GKPA 3O06A 5KEZA 1H62A 1ELSA 3POHA 3E0LA 5DMMA 3BCDA 4K2SA 3N1AA 3CASA 1J0HA 4KRUA 3K46A 4AIOA 4DRSA 4EMJA 4TX9A 2ZZ3A 3AUJA 3T55A 2TSYA 1BZLA 2G4FA 1RPKA 3UYCA 5D37A 1XGEA 4C6DA 4UTMA 1CGWA 1XCXA 4XSLA 2NXIA 2XVPA 3WD2A 5IHSA 2JIWA 5M2FX 3SAZA 1W5MA 4D6CA 3AIQA 1LT7A 2WSQA 2AGKA 3UWZA 3OA5A 4IWWA 5HNNA 4Z1YA 4FLSA 2J78A 3CHFA 1MUMA 1TMHA 1ZP4A 2OPJA 4U5KA 3TJXA 3F5KA 1EGMA 4P7OA 4JX5A 1JQXA 4O57A 4GKLA 3G18A 3EAOA 1UR0A 1VFSA 5JBFA 3FGCA 3AUOA 5H8MA 2FHBA 1W5QA 4MJZA 1EC8A 4HU8A 1CXIA 4H9ZA 3ZLHA 3KTSA 4GUGA 3H23A 2QGHA 3LZ5A 4LAOA 3KS5A 2A3CA 4LUSB 4B5SA 1P5BA 4BY3A 4GZIA 5EY5A 2H9AB 2GFTA 1QT1A 1A0DA 1W56A 4EQXA 1J2WA 2W62A 4N0RA 1MXSA 3R13A 3GVWA 1RPXA 2A3LA 4FNQA 4Y9PA 2HZGA 5DT7A 2PPGA 3W71A 2X1IA 4K1GA 4HOWA 4QDMA 1Z69A 2A3EA 1E4MM 3Q2DA 3CZKA 1ECEA 3DYMA 1Y0EA 3DENA 3BAJA 2PTXA 3SQLA 2QJNA 3TEVA 4Y9AA 2WOQA 1B30A 5BYWA 4KFPA 3VXGA 1GJUA 4G7EB 3ABXA 3VE7A 3BE7A 5DMNA 2YJQA 2BODX 2Z29A 4Z2HA 3L7RA 1ZBCA 4S3AA 1RAKA 4F0KA 1ZGDA 2FPYA 3HJZA 1ZJHA 4F0HA 3GIYA 3VOGA 2QAFA 2VQTA 4O18A 1EJUC 1KFKA 4N02A 4L64A 4NZ4A 1JXJA 2GUBA 4ROQA 2GWNA 3D6NA 5JUVA 4WY0A 2E1WA 2DORA 3TYDA 1Q1WA 1VFHA 5T91A 3CPRA 3URBA 1GT8A 1LP6A 1XG3A 3BO9A 4EANA 2GR3A 3KRBA 3VNZA 1IIGA 2H8XA 3PS7A 1PX3A 2WCGA 4V15A 4PTNA 2HK0A 3LPFA 3FVMA 5D02A 1N5XA 3TN6A 4DUXA 3KCLA 3FNDA 1X97A 3B8UA 2VZUA 5IM51 2CZDA 1FHDA 4DJDA 3SR6B 1WXJA 5KZ6A 1M04A 1HZYA 3AIRA 1MXDA 2EF9A 4B4HA 2VL4A 4I8DA 3MVTA 1BWKA 2QUVA 3GS6A 3S5OA 3A6OA 2A6NA 3RR1A 3W7PA 4DJEA 1TJ1A 3UA3A 4WKHA 3EWCA 5BROA 2PTDA 1VCVA 1R46A 4H4YA 4GACA 1BWCA 4QISA 1S1RA 2X0SA 1HJUA 3N6QA 2V5BA 2IKHA 1BSLA 1V51A 1HGYA 1EA0A 2E9LA 1MRAA 3B0VC 1GPFA 4GY0A 2FTWA 4POCA 4LXFA 3BGGA 4J3WA 1CGYA 2G5WA 4B2DD 3V16A 1MUCA 2J3NA 1VC4A 4AFYA 3GK0A 2NQ5A 2VC9A 3GIQA 2V3BA 3STPA 3LHTA 3KBVA 4CNTA 4P2VA 1GG0A 1LRQA 5AZ0A 2PFHA 4A8IA 3OGVA 1A5OC 5CC3A 4H4RA 1GRFA 1KTCA 3IJ8A 4S23A 1FDZA 2GVEA 1HQTA 1E0VA 1XCFA 3ZS4A 3DXIA 3FDGA 1MWOA 4DHGA 1TYPA 3M43A 2VNCA 3ONBA 3A23A 3AMCA 2Z1SA 2E5DA 5D9MA 1VHNA 3BOXA 3G6LA 5JCKA 1H50A 1EHAA 3TKFA 3B3DA 1W1IE 3E0WA 3QF0A 4AEFA 4NY2A 3E38A 5C5YA 4WUIA 4XZ9A 4FX9A 3V5FA 2E3ZA 4PEKA 3U2EA 1PUDA 1RALA 2HXTA 2OZ8A 1PIFA 4G56A 3BH4A 3LHZA 4A2SA 5E6ZA 1S5TA 3B97A 3B9DA 5G4HC 2V0TA 2B7QA 4UFMA 1B9ZA 3T7VA 4FSAA 2FHFA 4WGHA 2GOUA 3MBFA 2ZX9A 1K7XA 1W8GA 1YPXA 3FXYA 3GC5A 3DHUA 4PR4A 2D2GA 4WDWA 1DJZA 3WNOA 1AW2A 3HOJA 5HNTA 2ESCA 4PCSA 1BYDA 1A53A 1AL7A 4IFKB 1JAKA 2BLEA 4MNJA 2QF7A 1Q7MA 1TWSA 3MI2A 4H9MA 3SRDA 2Z1XA 4MDOA 4XKYB 4Y9MA 2HNEA 1VLIA 3DECA 4W89A 4MZ8A 3WFLA 5C7VA 1TX2A 4M1RA 2BDQA 2OTDA 5B7ZA 3ITCA 2W0HA 3MU7A 2E67A 4IMFA 4U3AA 3W86A 3N6JA 3IUIA 4DAIA 2BGQA 5A3HA 1ZBVA 3QTPA 1JQVA 3WBEA 1R7AA 1H6VA 3RHGA 1WAWA 4KWOA 2VO5A 1N82A 1H63A 2O9PA 4UFIA 1ZAIA 2YB4A 5C9UA 4DI9A 2F7FA 4UOZA 4XUGA 1B57A 3MI3A 3AIWA 1PDZA 1GTEA 3TJ4A 2PGWA 3LM7A 2OU4A 3RFAA 1XKJA 2QDHA 4HU0A 5D4YA 1JOAA 3VFCA 2E40A 3ABRA 4XV0A 3TYZA 4W7UA 4P7RA 4Z0SA 4ZQNA 3K8LA 1BXCA 4QHRA 1L9WA 3AHVA 4ATWA 4DUVA 1U83A 1H5VA 1HKVA 5ABFA 3NM3A 2BGNE 4RCXA 3TC6A 2AAQA 4M51A 3GG7A 1OADA 1T41A 1DVJA 1YTDA 1Q6FA 3CZJA 3VIIA 1IXQA 1XQLA 3T9PA 1LLZA 1H60A 3NFUA 2HJPA 4B5WA 4UTTA 1OEPA 3IARA 3GHUA 4TO8A 3V7PA 2WPBA 2BOGX 1S38A 2H3DA 3TU9A 2QGYA 4JHMA 4MKSA 4AAJA 3DHPA 3MWAA 1SQ7A 3M07A 2C71A 3MHFA 4U2YA 4MG4A 4BR1A 1LWHA 1PWLA 1UR1A 1ONXA 3DIPA 4DZIA 4BV6A 3R11A 3D46A 1ONFA 4Y90A 3WK1A 2Q09A 1M68A 4M6PA 4L6HA 2VZVA 2NQZA 3EF6A 4M6UA 3CHVA 2E25A 1MEIA 2WO5A 4FHAA 3C2YA 3SRFA 3E2SA 2WJDA 3DUGA 4QJ1A 1CGTA 5GJNA 3Q37A 3AXHA 2ZADA 2YYTA 1YEYA 5D2YA 4CNSA 1H7WA 1XC4A 4OKDA 1FWFC 4J9JA 5DBTA 2D2HA 4S3KA 3ZR5A 4LEFA 4AZ6A 4H8NA 3IIOA 5KINA 4F2TA 4WD0A 8A3HA 1QVBA 3OP2A 5BNKA 3EX3A 1XG4A 4NL1A 1P43A 2W6RA 2X09A 4MGGA 4AY8A 3VI2A 3GYEA 2EPHA 2V68A 5A6TC 4GY7A 2DJXA 4JTAA 4MADA 1RLDA 3ORWA 4YNGA 3A24A 3OA3A 2WSYA 2NVAA 5IOBA 1UZ1A 3W23A 2ZUVA 2CLOA 1NQ6A 3RPDA 3QBUA 3SUUA 3VOJA 4JICA 3ZT6A 1WDDA 1KKRA 2RJGA 3UR5A 3W7GA 4BA0A 3E2RA 1UWTA 4R7JA 3PG6A 3LV6A 3C2VA 4HSNA 1PKYA 3T0AA 3AN1A 3OIXA 5DXXA 4R88A 4EACA 3DG3A 3HPZA 2ZUTA 3VC6A 1TPUA 4A8LA 2OQHA 1GKRA 4HD5A 2DZTA 4UTWC 4Q22A 3CZEA 2ZZ7A 4OBRA 3UXDA 3WQOA 2ALRA 1SM9A 4GIYA 1U5HA 2YBTA 4BF5A 1A4LA 4UFLA 1U5JA 3IAPA 2YFOA 1OINA 3L12A 3TTEA 1R8LA 4JQAA 3RX2A 4YCOA 1JROA 4CN4A 1X98A 1OFBA 3LNPA 2YW4A 1JGIA 5D8ZA 3DEQA 2GOKA 1F8WA 3DFNA 3KW3A 2Y61A 1NWSA 4PTVA 3WD0A 1AUSL 4P7NA 1GNXA 4GXWA 2IKGA 3R0DA 1BQGA 3MY9A 3IAQA 1AH0A 2FZNA 1CXKA 3L4VA 4WJXA 3B0UX 5A6KA 1J8VA 2FH8A 1TWIA 3WQWA 2W79A 1OFPA 1ZS2A 2XFYA 3NQVA 4LCQA 2PD9A 4GO8A 1L2UA 3ALGA 1KN0A 3MP3A 1OFEA 2Z2UA 5A6BD 2Q8ZA 2PRMA 4JTDA 3DU0A 4N6EA 2QAPA 2J7BA 1ZL1A 1UBPC 3CUFA 1HIZA 1QASA 3ZJ6A 1F6YA 1Q6GA 4US5A 1SJBA 4G8TA 5HPCA 1G67A 5DY2A 1YYAA 4PZVA 3W29A 3GH5A 3CMGA 1IT0A 1TVLA 1LQAA 1VCGA 3MV01 1PAMA 4XUYA 3CO4A 4PCFA 3U6WA 3MB9A 2I5QA 3N4EA 1WQ5A 3A21A 2WVTA 5BWAA 1I2QA 4ACZA 4MWAD 5LGZA 4LBSA 2QPUA 5HQLA 3CTTA 5AC4A 5A8PA 2ZDSA 4J40A 4AF0B 1KBBA 1AQHA 1KFWA 1VRDA 2D24A 3T0CA 3GHRA 3OLGA 3QY7A 1AFSA 2ZC8A 4LBRA 4GNKB 3LCFA 3GC2A 1GETA 3G1HA 3SJ3A 3NQCA 5FS9A 3NQ2A 4G7FA 4K3ZA 4U4MA 2V69A 3PZMA 1ZP3A 4RJEA 3E2VA 4PFMA 3WF0A 4X60A 1XD1A 4NZ5A 2CLIA 2VR5A 1PWMA 2V81A 2V9DA 1LRTA 3ICJA 3W7DA 2OSYA 2L5HA 3QW4B 1EOMA 1T8QA 2O4MA 3GX9A 3F4NA 2E0PA 4MB1A 2V5KA 3N13A 5HR7A 4X9SA 1SVDA 3EB4A 4XWUA 2PDNA 3PSVA 3W7MA 2J7GA 1XR2A 4H6RA 1E0TA 3R7MA 2MUCA 4L6OA 5C7HA 3SSJA 4CUCA 1US0A 4JTKA 1BF2A 5LNUA 3A9BA 4MUPA 4GYPC 4ADWA 2FB2A 2EG7A 3KLLA 1ITQA 2HNHA 4PEEA 2CFYA 1PEZA 1TV7A 2YQUA 4HPXA 4NYYA 1RBOB 2WMIB 4FMVA 2VRKA 3MANA 3PN8A 2NV2A 3C0LA 3CU2A 5LKYA 1A80A 2V5LA 1QRQA 1TELA 1UWIA 4JFWA 4LY4A 3GFZA 1UD6A 1DHKA 3RM4A 3SM0A 4HNOA 4DNHA 4EF8A 2VEMA 4LS1A 1EBDA 2HE5A 1OFOA 3EZ4A 3TNOA 1OWQA 3B8TA 1FHUA 3IVSA 4JDRA 3PAJA 4AYGA 3VIJA 2Q8XA 3B8VA 1UP2A 1XANA 3W7OA 3MO7A 1A5LC 4R34A 5FCZA 3IIVA 4UNKA 4QITA 4MPQA 3NRZB 3W1LA 4O4WA 2Y7FA 2EHHA 5D2WA 2OVLA 1ADOA 2F9RA 4AMAA 1XPYA 3IWPA 3FYOA 1YQ2A 1GQNA 1BEUA 2QUUA 2G3FA 2P88A 2PDQA 2ZOXA 4GZ7A 3V0SA 1XLJA 4NJIA 4UC5A 4Q7IA 1EJRC 2WB5A 4B5UA 1F61A 3LGEA 3A4XA 3N3MA 3NQ8A 1VDVA 2FB3A 1Z89A 2JIEA 1QPRA 1W9PA 4DJFA 1KM5A 4F2BA 2DSUA 4ICNA 1VAHA 4JNMA 4Q4QA 3DK4A 3TX9A 3I6TA 4WZHA 1QPKA 1HJVA 5RUBA 3TQPA 1JGMA 3H26A 2J9XA 1XYZA 3ABSA 4FO4A 5F7UA 1VYSX 4O8AA 3RDKA 4EIVA 2QPSA 4JTHA 3OB8A 4F66A 1CB2A 5LGXA 4B2DA 5CJMA 4BKNA 5D9NA 2NQHA 2QCFA 2QCGA 5U7SA 1YBQA 3R8HA 5MF5A 5ABFB 4JHOA 1EJVC 2DPEA 4RDWA 1HL8A 4LRSA 3UZJA 4GIEA 1E73M 1UUMA 3S2CA 3ZFHA 3PJUA 2Z0IA 5A8OA 1LOQA 4H7ZA 4YWOA 5CSYA 3G1AA 4B5TA 4EWND 1L6YA 7A3HA 3W02A 5AY7A 1ML1A 4O1DA 1E3XA 1FCUA 2D2OA 2VTFA 1E40A 3AXXA 2G96A 4JIRA 2CESA 1LZOA 3OLIA 3NVYB 1Y65A 4QJ4B 3HQNA 1OBAA 2WHLA 2C16A 4QJ3B 4M56A 4AB4A 1N5WC 1Z3NA 1GSNA 1GJPA 2PURA 3GFYA 1KRMA 1H0IA 1VYRA 2QV5A 3H2EA 4N9CA 4IIBA 1XIDA 4ZCWA 3CMFA 4HZ7A 4L1WA 3AICA 2XGBA 3VD5A 4AZ7A 4E3TA 2PGRA 3LTYA 4AXNA 3CK5A 3LENA 2QZRA 1W37A 2CDUA 1XDLA 2I7GA 2BMBA 4HNVA 1X8FA 3AS3A 4AWTA 2VVNA 1WDPA 4PMQA 2V2CA 3WFZA 5CGMA 2GDVA 5C6MA 1P6WA 4KIRA 3GTXA 3VDGA 1VJZA 3BLKA 4IX2A 9RUBA 1YX1A 4HT3A 5H91A 3L23A 1KBLA 5F4SA 1L6SA 3WF1A 3KL3A 8CGTA 3IRDA 4HK5A 1SFSA 3EB3A 2AMXA 1VBUA 4X0VA 3NOEA 3BGAA 4YYFA 4GO9A 3QR1A 3II4A 2V5CA 1UQZA 4IPNB 5HJYA 4AEOA 3OJGA 2XN2A 3DH9A 3GNNA 1BYCA 1I4NA 5HAOA 3T4CA 1JD7A 1D9EA 1L6WA 2VX7A 6CGTA 1XBYA 2IS7A 4WY0F 4BI6A 1D3CA 3QZ6A 2YL5A 3ONCA 1OD8A 2D3LA 1X1ZA 3NL3A 2ZZ2A 3WLRA 1I6NA 2NQLA 2C3CA 2H8ZA 1FH8A 4A3UA 1HL9A 2F6XA 2R24A 3SIZA 1B9BA 3GXDA 5AC5A 3FYPA 4JTIA 3N9SA 1GONA 3VKJA 4V27A 5FKYA 4EXBA 1K9TA 3AS2A 4DF0A 4YTSA 4ZO6A 3LRMA 1U1HA 3WDJA 3AIVA 4HHPA 1X8CA 1DE6A 2P8BA 4QDWA 4YL2A 2V67A 2XHYA 1RQEA 2HQMA 2BTMA 3U9IA 4IX0A 1QNVA 4LUTB 3ZJKA 2X2GA 3WH9A 1OG6A 4EVZA 1R30A 2F2KA 3TN5A 4CQAA 1XHCA 3N73A 3G5EA 3ECQA 5AHLA 5A94A 1ITCA 3BXWA 1TJRA 4ZBCA 5GRTA 3M0KA 3PZTA 1ICPA 5IXEA 3SI9A 2PAJA 1MRQA 4EP8C 3LX9A 3DX5A 2DW7A 2P5NA 4JL1A 3QKEA 3HA1A 2Y5EA 4GJ1A 3EBVA 4J3XA 1CBGA 4WOQA 1WZKA 3MCNA 1PB0A 5F2MA 1XYAA 3IANA 2IXUA 2DZUA 1HT6A 2TODA 3IJLA 3C3NA 4A2RA 3NNTA 1B1YA 4IGSA 5HUPA 5ER0A 4S2BA 1A0CA 4BCEA 3O0KA 3AXKA 4K1WA 4PUNA 3SCNA 3W2JA 1OHLA 1FKXA 3L4ZA 1CDGA 2WK2A 3S6DA 2ZA3A 1UKSA 1L6FA 5C54A 1Q4NX 4HNNA 3ZR4A 5KITA 3CGBA 4D6DA 1ZDLA 3CAQA 1NHRA 3C2FA 3KL5A 3O2LA 3UR8A 4C1LA 3VDCA 5I3JA 4TV6A 2ZUMA 3H4WA 3HV9A 4CQ8A 1SR0A 1E72M 1OGBA 4JX6A 2BVTA 4DBDA 4J3UA 2ZXDA 5FJRA 2FGLA 2UY2A 2QCHA 4HPNA 3DYPA 3HFTA 1F07A 3L5OA 2EBNA 3MDWA 5CKSA 4F2UA 4WLCA 3M7SA 1M6JA 4WX2A 1XFBA 4XAYA 2GJRA 3MPGA 4XBSA 4YCPA 2X8GA 3CT7A 2O7QA 1TV5A 2DV0A 2TRSA 3W6MA 1OFDA 2CLPA 1XM3A 2E9BA 3OVQA 3ZOAA 2HE8A 4WJEA 3VUPA 2JFEX 1NOUA 5DRIA 4BK9A 1SB3B 2W66A 2GJXA 3TR2A 3GXNA 3WD3A 3UYIA 3AU2A 1K9EA 4GXPA 5T9CE 1KGWA 4DO5A 3AALA 3RGTA 4KKXA 2C13A 3B9EA 3B4UA 1F3WA 1UJQA 4AHOA 4XIMA 1CZ1A 1O1ZA 4FIQA 8TIMA 5LNVA 3GAYA 2CYGA 4RZ6A 2I16A 4DBSA 2XN0A 4ZOAA 3UZYA 2WVUA 3VTRA 4AMCA 2VDIA 3GNPA 5FAJA 1E15A 3KFTA 3KX6A 3TK7A 1UUQA 1BXBA 4HBKA 1TVNA 3L2LA 3LBMA 2POZA 4JXCA 1QI2A 1ZAHA 3RK8A 4ZQOA 2RUSA 1XH2A 3TIMA 3UETA 4AYSA 5C9RA 3N9RA 3CUHA 2YSWA 3GXPA 5G1MA 1W5PA 1ZK7A 1UP0A 3NYZA 1UMYA 2BY0A 3O8AA 1TVPA 1XFCA 4FLRA 5GNXA 2YCKX 3T2PA 1SZFA 5HATA 2EKCA 2YCLB 1EF3A 1KFCA 1LLWA 2QCCA 2ON3A 1RD5A 1R9XA 4AQLA 1XXXA 4QIUA 4HPGA 2I56A 4ICCX 3S42A 4A3HA 1JF5A 4LV4A 3NVZB 1N55A 1O6IA 4GJJA 5I3HA 1I0BA 1KBKA 2G97A 2FVKA 5AYYA 3HB9A 3I3EA 1J0ZA 1KD0A 1Q65A 3AZRA 1QTWA 4J3ZA 1CTNA 2ZX6A 5I02A 5I3IA 4GYKA 4I5RA 3GVQA 1KM1A 1TX0A 3STGA 2GR1A 1JZ8A 3A5VA 1TPEA 3MP4A 3CUZA 4GR1A 2ACRA 4DPQA 4F0MA 3G3MA 1ZZMA 4CQDA 3SO7A 1TV2A 3VKBA 5LHEA 5AYBA 3VA8A 3NPXA 2GJPA 2WKGA 2GJLA 2POTA 4CVWA 5D05A 2GRTA 4Z1BA 3QV7A 1FWDC 4HMNA 1GZJA 5I23A 4JFSA 3ARRA 3PUDA 4LCRA 1XUUA 2PDMA 3FHAA 4PUWA 4CCCA 1R3RA 1GPWA 3KZSA 4F0SA 4LGXA 2IQTA 4E4UA 1TE1A 2D22A 3PTQA 3ZLFA 4LAUA 2EQ7A 3S6TA 3S1VA 1VFLA 1W1PA 3ITLA 3E0VA 2IQ0A 4FXSA 3IJDA 4GI8A 1EDTA 1V3IA 2X50A 3UJEA 3BG5A 3QSTA 3EXTA 3NEVA 4PMDA 1R85A 3MHUA 2E28A 2VEKA 4ZTXA 3CPUA 3OG2A 2BASA 4YHEA 1W9BM 2QQ6A 3VOIA 3L21A 5BCAA 1FQ0A 3MSRA 3GNRA 4HU4A 4YVPA 1FDJA 3AFBA 1BHGA 3BARA 1SZGA 1UD4A 3IGXA 1J0IA 4Z2JA 1E0XA 3VGBA 5CPNA 3W7CA 4WKAA 2XU2A 2WAGA 1OZQA 2ANUA 3AO0A 3S47A 4L9XA 2FIQA 5J8LA 2DUAA 1DQWA 3T4WA 3NTYA 1V6TA 1B3XA 3BK0A 5F4WA 3FX4A 4EPKA 1XSJA 1F8IA 3QY8A 4FX8A 5CG7A 1JCLA 3U57A 3M0LA 3BLIA 3C61A 4U33A 3ELFA 2RDWA 3UPWA 1FCVA 4X0NA 2WBAA 3S1XA 5EMJA 5H8PA 4AIUA 3P82A 3RPTA 3Q65A 4C6EA 3EX6A 2G3IA 4X9YA 3STCA 3WQEA 3WF2A 1FY6A 3S83A 4PB5A 3B9JB 3BG9A 4D6JA 2A1YA 4AH7A 3LADA 2VUNA 3L2MA 4GOAA 4ZVJA 4HOXA 4L4PA 2HQAA 3VX0A 5I7GA 4D2JA 1B2YA 1P1XA 4DWSA 2QJHA 2EPKX 2WBKA 4Q4OA 4H6KA 2A79A 1H5YA 1MW3A 5HPOA 1KCLA 3I68A 4IJRA 3TTOA 3JU2A 5DXYA 4UMCA 3W37A 2G0WA 4FNTA 2B7NA 1AMYA 4JEJA 4ZXOA 4NSBA 3WDQA 1IEXA 2XVLA 4RW5A 3G1SA 2EJAA 3NQMA 5E0KA 4KETA 2GGIA 3U2ZA 2Z1KA 3IGUA 3BSGA 2X41A 4QBXA 1U1JA 1KA9F 3TYCA 7TAAA 3P0WA 4I5UA 4V1YA 3NZPA 3ID7A 1E6QM 1OJTA 1KXTA 1TA3B 1V93A 5FJTA 4AWUA 5B7YA 1XIJA 2ZVIA 2EKGA 1IV8A 2ZE0A 2ICSA 3GG1A 1H09A 1S2VA 3MCOA 4Q4SA 4DYEA 1B3VA 3B0YA 4S3EA 3W88A 3LXBA 4F3HA 4RV3A 2MANA 3AIEA 3VILA 3QFWA 1PKMA 3ZSTA 1CPUA 4XX6A 4IXHA 5TQLA 3UFYA 1JPIA 3QMSA 3TOPA 5D33A 4XAZA 1HJQA 1HKMA 3C2EA 2PDXA 3A64A 5FIPA 2R1NA 2NW0A 4H4SA 4JIEA 4IIDA 1TJ0A 4X63A 2WBGA 2GH5A 4JTTA 1WZMA 2Z24A 1XQKA 1KBJA 1RUSA 3H2CA 3WNNA 1HP4A 3P5ZA 4NAFA 1P1MA 3W74A 4G5DA 4GGHA 1W3TA 1TJPA 3VAVA 4DIAA 2ZQ0A 1D3GA 3AHXA 1EEPA 5FEWA 4UQDA 3W24A 1VEOA 1R9YA 4AY7A 3VMPA 5LZLA 4Z2LA 3KOZA 3TC7A 2NWRA 1XH1A 3CXBA 4C1NA 1M03A 1TQXA 1I45A 4GX9A 3DGHA 2O9OA 2WLZA 4NRRA 1XDIA 1ZAJA 1JZ6A 4LCSA 5C2GA 1JD9A 1WB0A 3K2GA 2VRQA 4LA1A 3OLEA 2B0MA 3VPLA 1BGGA 4PUMA 3BICA 2VM8A 4C6BA 4Q8WA 2VT0A 4OJYA 2QUNA 1R47A 3N14A 1EEXA 1BFNA 4WJ8A 2E4TA 4IGHA 4QXIA 2O92A 4FAMA 3WNPA 5A6AA 1MO9A 3QJAA 2VJXA 4PN2A 4JKLA 3KOWA 3GXMA 1KV5A 1XLLA 3O15A 3EUB3 2WOIA 1MSSA 3BCJA 2PF8A 1W9VA 1Q7QA 3WUFA 1OCQA 3TV8A 7TIMA 4UMBA 3OBAA 1EPXA 3NYDA 4ZOEA 4JIIX 1XSKA 4Q8UA 2HBXA 3TLQA 4MLRA 2IPFA 1X38A 5G5HB 3EA3A 2GQ9A 2O4QA 4EX4A 1SFTA 4XISA 4I7WA 5FF0A 3SGUA 2O56A 4JEQA 4D8ZA 3NDOA 1UR8A 4TVWA 4GCXA 3BSMA 2WZIA 4Y9NA 2OZ3A 2XJ7A 4HGXA 2WM0A 1JPDX 3CWNA 3MUCA 4ZQCA 2DSVA 3DC8A 3B05A 1HN1A 4R3UA 4JTCA 3EKZA 3SZ8A 1W1B1 3WQFA 3LB8A 2A2IA 4PBGA 4PMJA 1PPIA 1BG4A 1QOXA 3QHNA 1B54A 3KBMA 2Y63A 4Y9OA 3HG2A 1OX5A 2CETA 1S2CA 3VE9A 1H61A 1V3LA 3STEA 3DERA 3PZGA 1OVDA 1CGXA 4DWSC 2A7RA 5L9FA 4ZEPA 4O54A 4GQRA 1TUFA 4LUJA 3R4IA 4NJKA 1UROA 1KRAC 5G2HA 4RE4A 2CHRA 5LNWA 3W84A 1Q4WA 4NJJA 4A8NA 1YPFA 2DVXA 2BS9A 1MVYA 3BGJA 1GOOA 2OT1A 2QCLA 1OM0A 3LCWA 3KCOA 4IPLA 1K03A 1FWAC 4WEVX 2RAGA 3ARVA 3KRUA 4TVCA 2UY3A 5A6JA 4XZIA 1I0DA 1LOSA 3P7YA 3WELA 3U5YA 3S9YA 5BWFA 5CQ1A 1P0DA 3G22A 2W3ZA 2W4XA 4ZODA 3GDMA 2XH2A 2OWWA 5JQ9A 4KCTA 3EWDA 1G4SA 3WQ4A 1Q6OA 3CAKA 4JFTA 4PTMA 1V6WA 4XZLX 2QNEA 3IRSA 2X8HA 3RX3A 4Y8EA