4HNCA

P. putida c92s/k166c/c264s mandelate racemase co-crystallized with benzilic acid
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
357
structure length
357
Chain Sequence
EVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALKSLKQLLDDMAAMIVNEPLAPVSLEAMLAKRFSLAGYTGLIRMAAAGIDMAAWDALGKVHETPLVKLLGANARPVQAYDSHSLDGVKLATERAVTAAELGFRAVKTCIGYPALDQDLAVVRSIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMFKALSIGASRLAMPDAMKIGGVTGWIRASALAQQFGIPMSSHLFQEISAHLLAATPTAHWLERLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWREKEIGKYLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Mandelate racemase
publication title Potent inhibition of mandelate racemase by a fluorinated substrate-product analogue with a novel binding mode.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 133
structure length 357
sequence length 357
chains with identical sequence B
ec nomenclature ec 5.1.2.2: Mandelate racemase.
pdb deposition date 2012-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4hncA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4hncA01
1TZZA 3DG3A 3DG7A 3BJSA 3RO6A 3H8AA 5BOEA 3R0KA 2OZ3A 2GGJA 2P88A 4IL2A 6ENLA 3VDGA 3SSZA 4GFIA 3U9IA 3MKCA 3ES8A 3I6TA 3ZLGA 4HN8A 2PA6A 1JDFA 3UGVA 3R1ZA 1BKHA 1FHUA 1L8PA 3FV9A 3FXGA 2XH2A 4G7FA 3CT2A 1NELA 4GIRA 1MUCA 3K1GA 3UXLA 4Z17A 4IHCA 3N6HA 3SQSA 3DDMA 2QQ6A 3GY1A 1ELSA 3HPFA 3MWCA 4KEMA 4J3ZA 3U4FA 4F4RA 1E9IA 3TWAA 3I4KA 4HCDA 4HNLA 1KD0A 3TJ4A 3DGBA 4MMWA 3MY9A 3BOXA 3SJNA 4KT2A 4M6UA 1EBGA 2OG9A 4GGHA 2MNRA 4M0XA 1W6TA 3JW7A 4GYPC 3IJIA 2QDDA 1EBHA 2AL1A 4IP5A 4IZGA 5FJTA 1NU5A 4ENLA 4H2HA 3SN4A 3TQPA 3DEQA 1KCZA 4MKSA 2QJJA 2PTZA 1F9CA 1MDRA 3CYJA 2OZ8A 3PWGA 1WUEA 2XSXA 1BQGA 1EC7A 3TCSA 1SJDA 2PS2A 2OVLA 5FJRA 3P0WA 4FI4A 2QGYA 3TJIA 3V5FA 2XGZA 3V3WA 4IP4A 4JN8A 3UJEA 3EKGA 2PU1A 2OQHA 3OW1A 4ROPA 4HCLA 4A35A 3QLDA 2PODA 3OZYA 1KKOA 2FYMA 5EU9A 2HXTA 5ENLA 2PCEA 2OLAA 3BSMA 4EWJA 2GL5A 2OO6A 3GD6A 1EC9A 2QDEA 2QJNA 4E6MA 3CK5A 3ZVHA 3UJSA 2PU0A 3NZGA 4DWDA 3ZLFA 4H19A 4H83A 1SJBA 4HPNA 3T9PA 3UCDA 3IJLA 3CAWA 4HYRA 2P3ZA 1PDYA 2P0IA 2GGIA 3QKEA 4YWSA 2HNEA 3FCPA 2OPJA 3VC6A 3FYYA 3ZVHB 3R25A 1ONEA 3DG6A 3T8QA 1EC8A 2PTXA 3TW9A 2OZTA 3JZUA 1MRAA 5FJOA 3VC5A 4GYPA 3ES7A 3SN0A 3TOYA 3CXOA 3N6JA 2RDXA 3UJRA 4H1ZA 3B97A 1MNSA 3H12A 1KKRA 3QTPA 2QJMA 3MZNA 3VA8A 3DFYA 4G8TA 1JPMA 2PP1A 4E4FA 4E5TA 2ONEA 1YEYA 2PGWA 1JCTA 4KWSA 3SBFA 1R0MA 4DHGA 2PMQA 1SJCA 2OFJA 3OPSA 4E4UA 2ZC8A 3VFCA 7ENLA 5BOFA 3QPEA 3V5CA 4A3RA 4DN1A 1TKKA 3JVAA 3DFHA 2PGEA 3V4BA 3H7VA 2PP0A 1P43A 2QVHA 1IYXA 2OQYA 3MUCA 3PFRA 4GISA 3CB3A 4J1OA 2XH0A 2P8CA 1WUFA 3THUA 4DXKA 3RRAA 4K1WA 3PWIA 2OX4A 3P93A 3QN3A 2PPGA 3SN1A 2NQLA 2CHRA 3STPA 2GGHA 4GMEA 3PK7A 2DW7A 2AL2A 4FP1A 3ZVIA 2PP3A 2GSHA 4ZCWA 3RGTA 2OKTA 3P3BA 4JHMA 3OZMA 2ZADA 1TE6A 2AKMA 3GC2A 2P8BA 3DIPA 3Q4DA 3N4EA 1XS2A 3I6EA 2DW6A 1P48A 3Q45A 2POZA 4GGBA 2MUCA 1OEPA 3IK4A 1SJAA 2AL2B 2PTWA 1JPDX 3R10A 1RVKA 4IL0A 3T6CA 3TTEA 4HNCA 3ZLHA 3UJ2A 3ENLA 4KPLA 3FVDA 3EEZA 4Z1YA 3FJ4A 3GO2A 4X2PA 3N4FA 2XH4A 3DERA 3NO1A 4A6GA 4IT1A 3R0UA 5J04A 4E8GA 3NXLA 3RR1A 1MDLA 5IDZA 3UXKA 3MSYA 1ECQA 5FJPA 3RCYA 3UCCA 1PDZA 2GGEA 3MQTA 3DESA 3S47A 3R11A 2GGGA 2I5QA 2PTYA 2AKZA 3D46A 2PSNA 5FJUA 2FKPA 3VCNA 4JN7A 3T4WA 3D47A 3S5SA 4HCHA 2HZGA 3IJQA 3OTRA 3OP2A 1R6WA 1FHVA 3KUMA 2GDQA 3TWBA 2O56A 1DTNA 2HXUA 3H70A 3VCCA 3UJFA 4DYEA 3NFUA 4MGGA 3RITA 4K8GA 1XPYA 2XH7A 4DX3A 4K2SA 4ZA0A
chains in the Genus database with same CATH superfamily
3DG3A 1W1PA 4PBFA 1W54A 4DJFD 2R91A 1TV7A 4LRTA 1X1ZA 1DE6A 5E1QA 4Z2LA 4NJKA 4S3JA 1F6KA 3ITLA 1AW1A 4D8ZA 1KM2A 3W1PA 2P88A 2RGMA 3W1TA 1XIDA 3VKJA 1U1UA 1X8CA 4QG8A 1DWIM 2E6DA 3HZ3A 2XIJA 1I2PA 4IIHA 1HVQA 1LT7A 4JYEA 4JX4A 1SVDA 1QWGA 2V3AA 2QUUA 3DI1A 1K4HA 4NZJA 5LZLA 3QZAA 3H55A 2BV9A 3WLTA 3BCFA 3IGHX 2E4TA 2ZXAA 2W27A 1JFHA 1QASA 4L4MA 4EVZA 4WVXA 5E93A 4UCFA 3N34A 5CBIA 1DHKA 4KERA 1KM3A 1MQQA 1FWAC 2PGFA 1MQRA 1EX5A 1W31A 1QDSA 5H8UA 3D9XA 1CEOA 3DHPA 1J0KA 1ELSA 3BWWA 2OXNA 5MKGB 1JD7A 3NL3A 9CGTA 1Z6KA 3CHDA 3PZGA 2NQZA 3I4KA 1LROA 1P6CA 1WP6A 3LCGA 1N5XA 4WKHA 1X1OA 2V3EA 3PBVA 5GPRA 4FXSA 4I90A 4D6DA 2A85A 3JW7A 4GJJA 4M3PA 5T91A 3W1LA 1C9DA 1GW9A 4WSHA 1OJTA 1GTEA 3SR7A 2IUZA 2J88A 2VGGA 4CCZA 3WLLA 2WKLA 2ZZBA 2V5LA 2AQOA 4PUWA 4ENLA 2WHLA 3L4UA 3VMNA 3KRUA 1XC6A 3L67A 3QMTA 2ZDSA 3IIPA 4DNHA 2V5CA 2E6YA 4IPLA 4PGLA 4C6PA 3HG5A 3MUAA 1LBLA 2B81A 2W9MA 3LLFA 8XIMA 3S2JA 4MNKA 1US3A 5AZ1A 4Y9OA 2HE5A 1GNXA 3NEVA 4W7UA 1WUEA 3MV11 3EOUA 2QNEA 3UZ5A 3N29A 1IEVA 4REQA 3ABXA 3W7LA 2OVLA 2QS8A 3KRSA 1S5MA 3OIXA 1THFD 3HMCA 3W76A 3U6WA 2Q01A 1OFAA 4GA8A 4LYKA 1QFEA 4CN4A 1NOWA 5FD0A 4DJDC 3OVQA 4Z1BA 1HTIA 2J66A 2JQXA 4XIAA 1GVEA 3N15A 1E70M 2JE8A 4BY3A 4DBSA 3QBUA 3LRMA 4G7EA 2VELA 1OG6A 1HKKA 1EP1A 4PTVA 3R89A 3W74A 2EPOA 3ABQA 4NAFA 2E3ZA 4DWDA 4Z1DA 4I8DA 3RILA 3WD2A 4AXKA 3U0HA 4EQSA 3MUIA 1R3WA 3M0LA 5HWJA 5I3KA 2BC1A 5JCLA 2VP8A 3G0SA 1GQKA 2QCFA 1XKYA 3TJLA 3EKZA 2JFEX 2R82A 2O9TA 1NHQA 4NZFA 5LYRA 3LLXA 5C2XA 4WUIA 1M3UA 3EDEA 4Y8FA 1S2AA 2DU2A 3DYOA 4R27A 4U5IA 3RFAA 3FG2P 1US2A 4GVFA 4OE7A 2Y0FA 2Y5SA 1CXLA 3POHA 1NPXA 5HR7A 4EIVA 4P8VA 2RDXA 4A2SA 2WOWA 2PDYA 3F2BA 4Y6GA 3W83A 3BGJA 5C7VA 4PCTA 4E5TA 2JEQA 3NQBA 4RDZA 4LT9A 1TMLA 2PGWA 2OYMA 1HL8A 4WY0B 5LKYA 3SUTA 3BAJA 3GG1A 1GORA 1BXBA 3V5CA 3E2SA 1NM9A 2WBGA 1NSJA 3RMEA 1VCFA 5FMHA 1PS9A 1RXOB 1S38A 5D38A 5CLWA 2DT0A 1HNYA 2A3HA 4NT0A 4WX2A 4B5VA 2AMXA 2Y7DA 4DLFA 5ECUA 4WKAA 3SEPA 3N73A 5A69A 3UD6A 4A2RA 3U7VA 3PG9A 4AZ7A 2ZUMA 4GCAA 4JHMA 3OZMA 1S7MA 4R88A 3N9SA 5LA0A 3GC2A 1UR3M 1PKLA 1B3VA 3BPWA 3WMCA 1A5LC 1RD6A 1B3WA 1D8CA 2CYGA 3Q45A 1WDQA 3UF9A 1DQXA 1KM6A 3B8TA 1F4AA 2W55A 2EQ8A 3UCQA 3SADA 1UR1A 4MG4A 5AHLA 1UC5A 3L2LA 3B4YA 4XZWA 5AYYA 4IWWA 1J6OA 3R10A 3TSDA 2GQ3A 2PD5A 1HKIA 5FA5A 5K4XA 3PAJA 2VC9A 2WKJA 2V3DA 4G1NA 4YU1A 2P0OA 3TMLA 4TMCA 2QCHA 3EEZA 1VPXA 4PSRA 4X2PA 4H7ZA 1NWSA 3T44A 1MFUA 2QCDB 3CQKA 4MIMA 2PLKA 3PZVA 1QNPA 1V8EA 2WZHA 3AIUA 1AW2A 4D71A 3TFXA 5H6HA 4QR6A 4K7VA 2EQ9A 3QRHA 2ZRZA 4M5PA 5CPMA 5HPOA 1GQJA 3M41A 3WDRA 3POCA 4KWOA 2FTWA 3KZPA 4ZR8A 4LV4A 1GRAA 4BJHA 1E73M 1LORA 1NY1A 1C7SA 2FKPA 4LU0A 4HYVA 5AKQA 3G1RA 4EACA 5HR6A 4CCCA 1I2RA 4MY9A 5FF3A 3S5YA 2WMJA 4AC1X 3OP2A 2QAFA 5KMYA 2VHLA 4A29A 3NGJA 3OQ8A 3QY8A 2FZ9A 4FNQA 4F0HA 1W1IE 2E9MA 3QKZA 4UCGA 1E1CB 1M7JA 1HXJA 4LWWA 3LTPA 3B9NA 5DBUA 3GE7A 1AZ2A 5D4YA 1R3RA 1QNSA 1ICQA 3L65A 3NOYA 5FS9A 3LEPA 3GDMA 3GDBA 4TVWA 5BRQA 2WZIA 1WNOA 4X22A 1ZJBA 2ZICA 4B5UA 4J3XA 3NDOA 4QDMA 3MJYA 2V63A 3B8VA 3VNDA 4FF5A 4BEUA 5E6YA 3GH5A 3IAPA 3E6EA 3U5UA 1QOPA 4AZBA 4J4KA 4Z2HA 1FCBA 4ZB0A 3SY1A 3IV3A 1RUSA 3W0KA 2OOGA 5KTLA 2ZBTA 4HNUA 1CLXA 1W3IA 3A21A 4OKDA 3TOPA 4G6CA 1DJXA 2WMKA 5JIWA 3DJJA 2XDFA 2PWHA 3BMXA 5REQB 1TTJA 1NOFA 3EBVA 2H8ZA 1XYFA 1PSCA 3AALA 4ZB2A 4O0KA 1ZKQA 2ALDA 4OHQA 3AWNA 3NPWA 1IV8A 3HPFA 4J3ZA 3UP8A 5G1YA 3SFWA 4GY0A 4LYPA 4RDYA 3KBNA 2UWFA 3IJ8A 3FFSA 3CLWA 5XIMA 4IQLA 4XD6A 2MNRA 4ZQCA 2ZZ6A 2PDKA 4KCTA 3OC4A 1XLFA 4PMNA 4XUYA 4L9XA 2YXXA 2XVPA 3WEMA 2AL1A 4H4QA 1U30A 1QI2A 3NOEA 2OX1A 4J2PA 5KINA 1KFJA 4CVUA 2C79A 1JCJA 2FMOA 3S1GA 3TQPA 2Z27A 4LALA 3P0XA 1FP8A 1F9CA 3PJWA 1GZJA 3NL6A 2ZVIA 4FOKA 2EQDA 5IDIA 1UG6A 3SRKA 5DN1A 1LTDA 2PDUA 3F7JA 4K8HA 1ME9A 1IR1A 9XIMA 4JNYA 3ZO9A 4GYKA 1VFUA 3MBDA 1GYLA 4H4IA 6PTDA 1T0OA 4WSJA 3A9BA 4L7ZA 1OQFA 1HF6A 2XGZA 1EJUC 3YPIA 1O4UA 4PUEA 1GVOA 3GLCA 3EAUA 1ZAJA 1K8YA 5CJNA 2OQHA 1H6VA 2VUNA 5CPOA 3N2MA 3KVJA 4CNNA 1X6UA 3G2GA 3AXKA 3MCNA 4FA3A 5T8GA 1R47A 3T78A 3KHJA 4LF2A 2XGIA 3CUJA 7REQB 4GABA 2OO6A 2ZDRA 2ZQ0A 5DXXA 3KBWA 3CK5A 3UJSA 1VC4A 1B30A 3O63A 3V0SA 1UHVA 1TWZA 4H19A 2B0MA 4FNUA 2DGAA 3GQYA 3UPMA 1QNOA 3M43A 3RX3A 2XIOA 3UCDA 4TTUA 1QBAA 2WYSA 4QAWA 2XWDA 1IEXA 3H54A 4W88A 3CZKA 3V1PA 1BWLA 1DWHM 4JQ3A 5JBFA 5LGZA 3N3TA 3NCOA 2CIPA 3VC6A 3VD9A 4HMDA 5EMMA 3E74A 1J2WA 4UQ9A 4YPJA 2C3CA 5C7HA 4UFHA 1LCOA 2FVLA 4O1EA 3WIJA 3QFEA 4V27A 3TOYA 3WENA 3W7QA 4H1ZA 1WZAA 1K3UA 3FDKA 3MZNA 2WC3A 5JIPA 2Q02A 2TRSA 2PP1A 4L56A 2PDQA 1XLKA 4GI4A 1IHIA 5KETA 3NPVA 3SY5A 3SBFA 4F0LA 2NT0A 4Q32A 4BS0A 4FIQA 4PMXA 4RUBA 2WPCA 1XLHA 3NNTA 1VBRA 4HA1A 1U5JA 3UGRA 3S9YA 1SO3A 1O66A 1FWFC 3EF6A 2F2HA 2UY4A 1JCXA 3HGSA 3AIWA 3WD3A 4AF0A 4AEEA 4B4HA 2CXEA 2GDUA 5CG7A 2J8FA 3CWNA 4AIBA 1EQPA 3ABRA 3W1UA 3BAIA 5FS6A 1GVSA 4H9YA 3ZQ9A 1T99A 4LUYA 3K4AA 1KB3A 1FCVA 1WBJA 2AKMA 4LS2A 5AOUA 1EF2A 4LC6A 4WSKA 2VWTA 4US5D 3P81A 3WY1A 1E9YB 1AW5A 4DEFA 3BLIA 5EL1A 3UY8A 3RCNA 3VZZA 1B1YA 1TIMA 2AL2B 4B4FA 1JPDX 4I5UA 4GYJA 2YB1A 1OFQA 2GQWA 1HFBA 1JDDA 4GUJA 5MF5A 1VFLA 4WLCA 4WXZA 3OVGA 2E6FA 5A6SA 3G1DA 1RP8A 5M2FX 2NSOA 2CLHA 3VIOA 2J27A 3VKCA 1UCWA 3DC8A 4OJYA 4GUGA 4C6DA 3FOKA 2Y62A 2A7PA 2Z4GA 3QF0A 5H91A 1KWKA 4XZ9A 3K30A 3GXPA 2GUBA 4JEJA 4Q22A 2X8HA 3HJZA 1VFTA 3M5VA 3RCMA 3Q2DA 2Y61A 4QJ4B 3ARQA 1R8LA 1HW6A 1PDZA 3CL6A 3R11A 1E72M 4J3WA 2I5QA 3M6DA 4NHVA 4DXXA 5HJXA 3PB0A 5FF2A 3MI6A 3HPZA 1H41A 3M6YA 3B40A 1XCFA 4XD4A 1PAMA 3UYCA 3VABA 1P0KA 4RNIA 2A3AA 3A22A 4R9OA 4MY8A 1DJNA 3F5KA 3HPSA 4S3AA 3KL3A 2BXYA 2FMNA 3BMWA 3WH8A 2DT2A 4QG9A 3S5ZA 5BMXA 1TTPA 3WNNA 1VYSX 4IMAA 1CDGA 3AIBA 3HQPA 1XPYA 3M5XA 5GQBA 1ZZMA 1U1HA 4C1KA 1W9PA 4IIGA 4DO5A 2VR2A 2AQWA 3EOSA 1JGMA 1FWSA 1PZ3A 1PX4A 1TPH1 4DUWA 1OF8A 1KNWA 3OU8A 1TX0A 1H63A 2BOFX 3W25A 1R46A 3A23A 4GKLA 3F4DA 1YNPA 4G5DA 2GGJA 1JI2A 2CESA 3H6OA 2BOGX 3KCOA 3SSZA 4CNPA 3NDZA 1LWHA 3NPUA 3AS1A 1PHQA 4HZ7A 4ZODA 3PJUA 3L0NA 4Y8EA 2J7CA 4HPGA 4A8IA 2E09A 1WQ5A 3ATYA 1ONFA 4IISA 4GUHA 1NARA 4YWOA 2ZUWA 4H3DA 3BQ5A 4N9DA 4RPQA 1TA3B 2OELA 3UWZA 3QEZA 4OOUA 3UBPC 4PUUA 2EPHA 4GNKB 1FKWA 4WGHA 3VIPA 4MLJA 3W00A 4LAMA 1I6NA 2ZRXA 5I3IA 2FFIA 4PMUA 2WV8A 4F4RA 1KTBA 2W62A 4LEQA 5BRPA 5JH2A 3E02A 1IXOA 1DJIA 1ZTVA 3PNZA 1D9EA 4V2XA 2XVGA 2OGYA 2PDCA 1ISXA 1CZ1A 4M6PA 3SJNA 2I9EA 4O52A 2GLKA 1YYAA 4HQVA 2ZUUA 1LL7A 1XRFA 4Q4KA 5CH9A 2RABA 3ONBA 4GZ7A 2VFDA 4H2HA 2ZKMX 2DSVA 1CGWA 3SUWA 2ZXBA 5LHFA 4IIFA 3WLKX 1GVRA 2I5GA 3O6CA 4K7ZA 3GHRA 1GEHA 4OBTA 5G2WA 4O1CA 5A6TC 4AMCA 3QC3A 2VI0A 3MHGA 4XAZA 3KVLA 2VMFA 2GVLA 2AGTA 3QPYA 3N17A 4NX0A 1US0A 4M51A 1XBZA 3N04A 4MHBA 1SJDA 2WMIA 3LZ3A 4LY4A 1TFVA 4EQWA 3VM5A 1QHPA 2QGYA 3QQ0A 4K6AA 3OVRA 1YTEA 3CEUA 3GTNA 2VEKA 1TQXA 3DBPA 1TPDA 1F3XA 2NLIA 3MJMA 1M01A 4UTTA 3LCLA 3MHUA 3TKFA 2A4AA 3EAOA 3AJ7A 5ENLA 1YE4A 4RPPA 5C8BB 3ARXA 3S5OA 1M1BA 3BV4A 1U5HA 3W88A 4JGDA 3S2NA 4PUKA 3EX4A 1K9FA 1UOZA 3EXSA 2GRTA 3S83A 4O11A 3AXHA 1XYMA 2FGZA 1IXNA 1W91A 3AHYA 4JPGA 3IARA 3K13A 1WZMA 3EA3A 4JTIA 3RR4A 2D1ZA 3CHVA 3CASA 3HN3A 1MW3A 4IM4A 1XD1A 3MHFA 2PZNA 3MANA 4IUOA 3WFZA 1XG3A 1TTIA 2HNEA 3AYVA 3QW4B 4UTIA 1UKOA 4PBEA 5JMUA 3LTSA 1EZWA 3E2QA 4JX6A 1FIQB 2A7NA 3T05A 3G1AA 3N6QA 4QNEA 3W72A 4F0KA 3SCSA 4HMEA 3APGA 1JR1A 2CLIA 3THQA 4O13A 1QK2A 2FGBA 5FSEC 3SCQA 2Z29A 3WLHA 2XGBA 5DELA 5HMDA 4FEZA 1PKMA 3UJRA 3C61A 3KFTA 3PY2A 3LM3A 1MO9A 1A4LA 2WP5A 4GHRA 5K7JA 2WSPA 5BXSA 4C5YA 1POKA 4H4UA 2YIHA 5JCMA 5AYXA 4H8HA 1K8ZA 3GFZA 5KZ6A 1N61C 2B7QA 3BC9A 2GPTA 2V68A 3NQGA 3GK0A 4DJDD 3WLIA 1N5WC 2WCSA 2E5AA 3K8LA 1ISYA 2VOMA 3JRKA 4PUMA 1BVWA 1LWIA 2ZX8A 2VR4A 3S6TA 3PULA 3L4YA 2XUCA 1IT8A 2HK1A 1L2QA 4LEFA 2QULA 2A0NA 3P8IA 2WOVA 3CIXA 3W7PA 3STPA 5JUVA 1XJBA 1X38A 4B9YA 4PRWA 3PK7A 1WYGA 3BAXA 4O8AA 1B31A 1N2VA 1XF0A 3S1WA 4IXXA 4JY8A 2D20A 3N11A 3LHVA 4L64A 2ZVRA 1LQ0A 2O7SA 1YPFA 2BHZA 4JFUA 3DIPA 4OBRA 1CENA 1GKPA 4MKNA 1XG4A 1Q66A 4QLLA 1P48A 4CU6A 4MNMA 2IPFA 4IUGA 1J0HA 4GO8A 4PMYA 4UWMA 3INPA 1WDPA 3GX9A 2QJGA 2EQ6A 3N2CA 1YTDA 4EQXA 3T6CA 3A7UA 2Z7GA 5AC4A 6XIMA 1GSNA 2OWCA 1XSIA 2HVNA 4AWSA 1NHRA 4C7FA 1ZUAX 4CD8A 4U33A 1IZJA 2V69A 1OCQA 2YCEA 4Z1YA 1J0IA 1FXPA 3HQ1A 2PC8A 3TC3A 4KH2A 2VEIA 2DH3A 3M0ZA 3AHXA 4AH7A 3G1YA 1E6NA 1WA3A 3MO7A 1MQPA 3IIZA 2W54A 4R53A 4QEHA 3NXLA 2YFOA 3OGVA 1QVBA 3UG3A 4ICMA 1H1NA 2F61A 3NSNA 4XISA 4M56A 4N6FA 3WNLA 2CDUA 1GG0A 5I3FA 3S47A 2RKXA 3ZS4A 4HU0A 3VGGA 2X8CA 1YXCA 4MB3A 5BROA 2QR6A 3VCNA 1A5KC 2DQXA 3T4WA 3U2EA 1ITQA 3DECA 2J6VA 3KP1A 1DEDA 2HZGA 4WDTA 4ZENA 4GG9A 2GDQA 4NRSA 5AC7A 4Q33A 1LYXA 4ERGA 4PULA 1VH7A 5HANA 2OWXA 3T2QA 2CEQA 4GACA 2HE8A 4V1XA 3MI2A 2WO5A 3COTA 2E5CA 2GFTA 4MVAA 4B5SA 2VC7A 2NW0A 3ALGA 3OZPA 3WJSA 2C18A 3DCPA 3DG7A 7REQA 3QOKA 2VRKA 3U3HA 1PX3A 4AIOA 4K8EA 1V51A 1SO5A 3G22A 4KRTA 3HPXA 4YLWA 5DBTA 1MXDA 3W81A 3DYPA 3H24A 5EY5A 3W2NA 3CGBA 3FXYA 1DIDA 2G3JA 1B3XA 1G9HA 4P8UA 3VOGA 1BKSA 1J11A 2PGRA 4HHHA 2J7DA 2V9DA 2Y5EA 3R1ZA 3PG8A 1SU5A 1YHTA 4AWEA 4DZHA 4HPXA 1AODA 1F5ZA 1W3NA 1BGGA 1XIMA 2C6QA 4IGNA 3B3DA 2A79A 5EKYA 1ICPA 3DHDA 5KZDA 4HNOA 4Z17A 4J27A 5DRCA 4FNTA 3RLUA 2QQ6A 3CV7A 1MEWA 3GY1A 4ZFMA 5C2GA 1F2JA 4D6HA 4DRSA 1UUOA 2WJFA 3U4FA 4O1FA 4W84A 3V35A 1QT1A 1KD0A 4JN6A 4D6FA 1D3GA 4JHOA 3MY9A 4H6QA 3BOXA 4TX8A 1F3EA 4JCMA 3HFYA 2ZX7A 4RW3A 4Y96A 4GGHA 5HATA 3WEZA 3OEXA 2E28A 3D6NA 1OX4B 4YHGA 4IZGA 3NSXA 1FDJA 3VD5A 1BF2A 2WANA 4DJEA 3N25A 4HZ8A 2WK2A 4NILA 4TVUA 3S2LA 2XVKA 5KSWA 1NIUA 3UWEA 3PJXA 1DTUA 3K8KA 3MT1A 2NV1A 4XVDA 2J7FA 3M4HA 1DXEA 1YXYA 2WNZA 5DCEA 4F2BA 3S4TA 3S5NA 5A1AA 2X2YA 4XSMA 2JF7A 4LYQA 3I7RA 2I14A 1PBGA 1V77A 2W6RA 1CGVA 1EJXC 3NZQA 3EDJA 1W8SA 2PODA 4O14A 4QGCA 1FCUA 1H09A 3A24A 1XP3A 3KAOA 1DJQA 3BSMA 1TYPA 2EXOA 1DQUA 2PDBA 1EUNA 5FL1A 5IXEA 4JQAA 4YJ5A 1JZ5A 3L4TA 1TPFA 4BF5A 1Z7AA 2PU0A 1VB9A 4Q8NA 2Z6JA 1FWJC 4WF7A 3RX4A 1BWVA 4NU7A 1ECEA 1GHSA 4GIYA 3PZIA 5F1VA 5E6ZA 5IHRA 1OB0A 1JRBA 4HYRA 2DEPA 1QW8A 1E5JA 1VKFA 2GGIA 3P82A 1VCGA 4I9MA 4YWSA 2J9YA 1UH4A 4BA0A 2NQJA 2WVUA 4Q8WA 3STFA 7TIMA 1ZBKA 2V2CA 3P80A 3W2LA 4F2TA 1TJPA 4APNA 4HK5A 1FWIC 2PDGA 3RU6A 2DZXA 2DQWA 5IHSA 5CJ5A 3OJGA 1TPB1 3SY8A 4A3YA 1S2WA 1PZ0A 2IXVA 3U7BA 5FL0A 3GM8A 3LA4A 5TD4A 3VO0A 2XJ7A 3VKAA 2NX1A 4KPRA 3DK9A 1DOSA 3RIKA 5CJMA 2DZWA 5D05A 3QTPA 3H4KA 1CGXA 4QE4A 1D3CA 2XG9A 3CUGA 4E38A 3G77A 4Z2GA 4B2DD 3GYCA 2YDSA 2BVDA 3E9AA 2VRJA 3VFCA 2FHBA 3TTQA 1RCXB 1BRLA 1ZY9A 3JVAA 4NI3A 4BF7A 4AY7A 5M03A 1WAUA 4S3CA 3AUJA 3HRDC 1JCLA 3FIGA 3RRAA 4DWSB 2DPEA 2OX4A 4PRTA 4GNJA 3LMYA 2BOEX 4YIWA 1GREA 4X9SA 3SIMA 3TW7A 3EWZA 3RDKA 3WDQA 2ZADA 1JULA 4LANA 3TFCA 1PWMA 1Q65A 3W01A 3UWWA 4ATLA 3WDHA 1TA3A 3DJGX 4KWVA 3BLKA 5J5RA 4GGBA 4N42A 1HKVA 4H50A 1EYWA 8TIMA 2HVOA 3W28A 3THDA 1GVFA 1WYIA 3GXFA 2OKOA 1H61A 4J57A 1CW2A 3WLSA 4LCQA 1UA3A 5FEPA 4D6JA 4MYXA 5HA7A 4MZYA 2RDWA 4ZTYA 1LF1A 3GS6A 4JR5A 3DFSA 3PAOA 2G3NA 4H4YA 2TPRA 4QSFA 1VPYA 1YXDA 1JF5A 4G56A 3VDBA 2IPWA 4H7CA 3N3MA 5I2UA 4Z1CA 3C8FA 1C8VA 3DERA 4WDWA 2VWSA 2J47A 1NOUA 2OT1A 5J8LA 4AB4A 1FKXA 4EMIA 2R9RA 1E9ZB 2NVCA 3SCWA 2GOUA 3UXKA 2H9AB 5C71A 4J35A 1K6AA 1UC4A 2Y5JA 5FEXA 1Q6OA 1FX6A 4C6FA 3I3BA 2CFFA 4PODA 4W85A 1SUXA 1KM5A 3D46A 4W87A 4C90A 2YVGA 3BSHA 3PTDA 1S2UA 4H8NA 4MSSA 3WJWA 3QW3A 4DF2A 1OADA 5KVIA 4ACYA 1HJSA 2YCJA 4CCDA 2WVTA 3CHCA 3G3DA 3QGKC 4Y9AA 2WPFA 2XIIA 4BFAA 2DZBA 1B3YA 3AAMA 4KCWA 3EDFA 2BNJA 2WBKA 3NPXA 4OVXA 3NDYA 3LUTA 4D72A 5GJPA 3R79A 2YAUA 5BOEA 1F3PA 2CLOA 4DYKA 3F4VA 1EIXA 2H8XA 4EQRA 2VGFA 3L21A 1LL6A 2W5FA 3DFOA 1M65A 3GVRA 3WNKA 3BTNA 4H9XA 4N9EA 2FH6A 4KRZA 3T0DA 1LWJA 1XLJA 5AVNA 4XD5A 1XRTA 1DE5A 2IQDA 4XX6A 5HQMA 1TREA 3L0GA 4CD5A 4BQ3A 4D1IA 4WOQA 4ZSTA 3ZIZA 1VENA 4GLEA 2YGYA 1C92A 4BEQA 4IJBA 4IMFA 5D04C 3O6DA 3VX0A 1QR7A 2D2HA 3DHUA 1OJXA 2PLCA 4A3QA 4Q4RA 4AFYA 3PTQA 4JQ1A 2NQ9A 4UR8A 3MYPA 2XWEA 1XW8A 2JF6A 5XIAA 3PBGA 5FAJA 4HNLA 1GVYA 2R1LA 3GVQA 2DSKA 3F4CA 2CITA 4TMBA 4TUFA 4ROQA 3VKBA 3DUGA 3SRFA 2VQTA 4CN6A 4FF7A 1IIHA 3BLFA 2R8WA 3WUFA 1NU5A 5HBFA 1W3TA 3VNJA 2QUMA 1I60A 5HUOA 2WVSA 4RV3A 2GVJA 3W7KA 5HMEA 4GX9A 4DWSC 3ARYA 4S2CA 4MJ2A 2NX3A 1EIBA 2IQ0A 4PMDA 4CGTA 2J75A 1KLYA 4NZ3A 4LCSA 3ZR4A 4C1NB 1UWIA 3FAWA 5DMLA 4KETA 1C93A 4QRNA 2C13A 2CPUA 2D24A 1XDJA 2D3NA 4S1FA 1ZJHA 3MUZ1 4GH1A 2WHKA 2NT1A 3PZNA 1BVNP 2DZAA 1OCNA 3QLDA 2CZFA 1VCVA 4X0NA 1GOXA 3VMOA 1ZRQA 3H2MA 2X16A 3IJDA 4YNGA 1JNDA 2GK1B 4O1AA 1JPKA 3NGFA 4S3BA 4HKPA 1EDTA 2PF0A 1E3ZA 1KRCC 2ACSA 3R0DA 1GOMA 3AYTA 1VRDA 4M1BA 1MMFA 3TC7A 4RZ6A 4BWLA 4A4AA 1ITUA 1C91A 5D03A 3O0KA 4F9DA 4H01A 2PDFA 5A6LA 4INFA 3TNBA 3TDFA 4NKCA 3VNMA 4M7TA 1A80A 2O92A 1TELA 1JZ4A 2Q8XA 3SGGA 4D6IA 3ZVHB 4N7QA 3JUGA 1JF6A 1EC8A 1KQZA 3GR4A 2PTXA 4RNJA 2WKGA 4AYSA 3I6RA 4YTTA 4YTRA 3C56A 4NX5A 2EPKX 4AZ5A 2G5WA 2VEGA 1G0CA 3RNDA 1LG1A 3VIIA 1R9XA 1RY0A 2V3GA 2OOFA 1KKRA 1V7AA 4QM1A 3MP3A 1ZL1A 1Z44A 3FSTA 3M9YA 4B9ZA 1XDIA 1DPMA 2C1HA 3E2RA 3ITYA 3U2ZA 4RXFA 3HB9A 3EWXA 2EGZA 1NWTA 1TCDA 1H0IA 5F4SA 3VKDA 3GU1A 3GHUA 4LAOA 3PF3A 1JCNA 2B4GA 5CQ1A 3RX2A 4DZIA 1E6QM 3VIFA 4QS5A 5CPNA 3HV9A 1H7NA 2QVHA 3DH9A 1IYXA 3FYPA 2PZ0A 3C4UA 5FIPA 4ZQNA 4DXKA 3MVTA 3OLEA 4ZO8A 3O0HA 5HK4A 2HSAA 4O8RA 2VO5A 4EAMA 1EOKA 3NEHA 2PF8A 2QAPA 5C54A 1NDWA 2DW7A 4XZHA 5EMYA 2GSHA 4IG2A 1W3HA 4PUDA 2YDAA 1O12A 4XBSA 5LNRA 4Z2JA 4FHAA 3TYBA 3R58A 2BGQA 2OO0A 4WOZA 4WKFA 4ASTA 3LI1A 1N62C 4GBDA 3DU0A 3G5EA 1DORA 2X41A 4Q8OA 1SSDA 1K70A 4WK9A 2P1FA 3EDDA 1Q7MA 4HP5A 1EQCA 4F0MA 1L6GA 3UXDA 2YBUA 4MWAB 1PUDA 3FA4A 1JPIA 1W8GA 1G4EA 4ICNA 1KWGA 1HVXA 5G5GB 4GBUA 2PEVA 2FJKA 2X1TA 5C5YA 3TQ0A 2XFFA 4JKLA 4ZL1A 1J01A 4KGJA 4E8DA 1LLWA 3CQJA 2YZRA 1HL9A 2J9ZA 4FNRA 1UP3A 3FN9A 2OEKA 1WPCA 1TV8A 3GVWA 3UCCA 4EXAA 4QJ1A 5B80A 3WDIA 2ABAA 1WOBA 3ZT6A 4MDPA 3W85A 1ZMCA 5LIKX 3RM4A 3II4A 4S3EA 2EG7A 1BSLA 3GB6A 3AU6A 3GVVA 4AU0A 2X7WA 3QYQA 1MXSA 3GTXA 3ANYA 3S5SA 1DP0A 3IJ7A 2BSLA 2UY3A 3OLGA 1VFHA 2DZPA 1R7AA 2TAAA 2PDNA 1ZP4A 3M0HA 3VDCA 4ZB5A 1ZBWA 2GZXA 3VCCA 1OIFA 1UROA 5DO8A 3H23A 1JZ8A 3BJFA 4D8AA 2Y4SA 4LGXA 2DT3A 4R34A 3E0FA 3A6OA 1UR9A 3OYXA 3KOXA 3DI0A 1QI3A 4GQRA 3FKKA 1KQYA 1PJ9A 1S2VA 1LOQA 3WLOA 1B90A 3VDGA 3PWAA 5L6UA 1FWRA 5TNVA 1ZBVA 4AD5A 2XM2A 3TW6A 4IGSA 2VUYA 1QPRA 5F7UA 5A6AA 3EKLA 3HO8A 2C15A 1A5AA 2EG8A 3BW2A 1BKHA 1OC6A 3C0JA 2EPMX 2Z24A 2NZLA 4ZXOA 4QDPA 4RDVA 1WXZA 4RK8A 4MJ4A 1KRAC 3EOLA 4OTKA 3GD3A 3ITXA 1C9WA 2A2IA 2YLLA 3NQFA 3P84A 3SQSA 2FZMA 3VNYA 3M64A 1RVGA 1GONA 1A5UA 1A50A 5PTDA 3VXGA 1KCKA 1MFVA 1R3QA 1E9IA 1NEYA 4R85A 2BVYA 1DHPA 3NQMA 4H9ZA 1GQIA 4M6UA 4FAMA 2OG9A 3E0LA 3GUWA 2G4JA 3I4EA 4MNLA 4RZBA 5EFFA 3L5OA 4JIIX 3BG5A 3SUSA 3VFLA 2GH5A 4IP5A 4NASA 4LPCA 1JDAA 1QPQA 1RR2A 3UWUA 4E8CA 3AWOA 3QXBA 4NXSA 1YQZA 4GH3A 2XN0A 3TXZA 4DBDA 3VUPA 1EPXA 2J8GA 3GVGA 2W63A 3I7QA 3MMDA 3IGUA 3LNPA 4U28A 4GI9A 1WV2A 2Z26A 5E9AA 1PO9A 3SI9A 3ZFHA 1W3LA 3W22A 1IWAA 4MY1A 1W17A 4UZSA 1WKEA 3TYAA 4JTJA 4HZMA 3CUFA 3ORWA 4JTDA 3WBWA 2ZRVA 1YDYA 3NYDA 3PUGA 3DK8A 1XD0A 2DUZA 2OEJA 3M5ZA 1LT8A 5EGRA 1BYBA 4HSOA 3TJIA 3FW6A 2VD8A 3V75A 2WOQA 1BTMA 3NA8A 2X7VA 3UJEA 2PRLA 5I7GA 3H7RA 1V08A 4HCLA 1EJSC 3P6LA 1OT2A 2ZZ5A 2V5DA 3HPAA 4Y90A 3UR2A 4PB4A 1P6BA 2HXTA 4PTXA 5CSSA 5EFDA 4NSBA 1BHGA 4MB1A 3ITOA 2YFNA 4REQB 3BLDA 3N14A 3W71A 2XYLA 3MKVA 1HGWA 5HNRA 4MWAC 1UUQA 3D3FA 3MWAA 3T2PA 4L1WA 1BLIA 1PL9A 1PZ1A 4IH3A 2W0UA 2Q3RA 4H4RA 1EDQA 3ZWTA 3H21A 3PBUA 2F5ZA 3CAWA 3WQFA 1K7FA 2R1KA 1A49A 4G7EB 1PDYA 3SJ3A 3QV9A 4PTWA 2XTKA 1CGYA 2OPJA 4NAFB 3VNIA 1EJTC 1FDZA 4CD6A 2EKGA 2LLEA 4GVIA 4UFLA 2OZTA 3JZUA 4WY0F 1EDGA 2P50A 4K36A 4XZIA 1QOQA 1KN0A 5A6KA 3USBA 3KRZA 2BWGA 3C2OA 3VD4A 5JU6A 3H53A 2QVNA 1OC5A 4HB7A 1A3HA 1TYTA 2CBJA 5B7ZA 4TV5A 1UASA 2DFAA 1QHZA 3TX9A 3LRLA 1FWCC 4P7LA 3LM7A 4BI7A 2QPSA 2ZC8A 1E1EA 3LGGA 3CV1A 4WQ6A 3AI0A 1IZCA 4DN1A 2ZRWA 3BOFA 3EX2A 1R87A 2I57A 3H2CA 4UB9A 1H62A 2UY5A 3GXMA 1DWJM 1MW1A 3TLLA 3WK0A 3EWWA 3AO0A 3CV6A 3QN3A 3W6MA 3MDWA 4ZE5A 4M6QA 1FH9A 1XX1A 4P8XA 4JOMA 1QPOA 2EHHA 2FPVA 4YHEA 3EX1A 2OYKA 1OGSA 2PBOA 5A95A 1WKDA 2J3NA 2GJXB 4CD7A 2ISFA 1V93A 3B06A 1ZU8A 1AL8A 1P1XA 3KTXA 5DY3A 1T8QA 2DZUA 1MWOA 5T26A 3PBYA 2WXDM 4BURA 4C6LA 1FQ0A 4PFMA 3ICJA 1D2KA 2VZSA 5GNYA 3TK7A 4TV6A 4MPQA 4PCNA 4QFUA 4AW7A 5LXEA 3KLJA 3T0AA 1T6MA 5F4WA 1SZGA 1UP2A 8A3HA 1E56A 5DMMA 1T8XA 1W1TA 2IKHA 3CL7A 1Z48A 2V5JA 3FJ4A 3EWUA 4C5ZA 1JFXA 3WH7A 1VEPA 4OECA 4GZEA 2VOTA 3GSMA 4AIUA 3FJLA 3UG8A 2QT3A 1NHSA 2FZ8A 1TV5A 4JIRA 3GNRA 4N02A 5FJPA 1TUXA 2FB3A 1RP9A 1E1FA 1F7BA 3EOOA 6TIMA 3HU7A 4PMQA 3E96A 4I5RA 4POCA 1QCWA 3SUUA 4F8XA 3SCRA 2A3EA 3IS4A 2E68A 1EBDA 5U4NA 3CV2A 2A8XA 4M6VA 3VIKA 3AIEA 4Y7EA 3UFYA 4OT7A 3QGAC 5D2WA 3NO5A 3IJQA 3K1DA 2J7EA 1B4KA 3KUMA 3WK2A 4XZNX 4S3DA 4DZAA 1K02A 4LVGA 3DC0A 4DM1A 4GX8A 3UWQA 4GQ0A 4AY8A 1ZAHA 1VAHA 4V1YA 1F4HA 3ARTA 4P7NA 2XH7A 3WQVA 1HJQA 3F5JA 2A7RA 3L5MA 4I6KA 1P4CA 4LUSB 2FVMA 4G9PA 4R7WA 4PZVA 1SFLA 1JYVA 3UPWA 1CX9A 3CYVA 2YBTA 4XZLX 5AYIA 2PD9A 2ZUVA 4LVFA 1XPGA 4YS1A 2DZTA 3C3UA 1NJJA 3Q37A 4PB3A 2YJQA 3GNNA 4UOQA 4RZ4A 4GFIA 3BURA 3W75A 4U10A 3EXTA 5ABTA 4KMQA 4PMOA 4CNTA 3B8SA 2VDHA 3CO4A 4ZZ9A 2PA6A 3DENA 1JDFA 3NVVB 1B9ZA 3CUXA 1FHUA 3WBEA 4JFSA 3SIZA 3FV9A 1GW1A 3FXGA 1Q4WA 1IT7A 3CT2A 3VE7A 4EMJA 2F6UA 1M9HA 3RF9A 5HWMA 3GXNA 1IEQA 1E6ZA 2WC4A 1KBLA 1GEUA 2YZ5A 1N60C 5E70A 2W91A 1OINA 4E2DA 2E67A 3MWCA 3SAZA 3LY0A 2Q71A 4H00A 3M7WA 1QI0A 2Y7FA 3M16A 1J0YA 4O1BA 3TWAA 3E49A 1GJWA 3ECQA 2G4FA 1FFRA 1OFDA 1O60A 1VQTA 2BVTA 2QJHA 1DQWA 4KT2A 2CU0A 4L9YA 1E43A 4M0XA 1EJ7L 1OX6A 2PWVA 2WMFA 4O1DA 4XBJA 1A5NC 1XDMA 2FZNA 4EKJA 2J4GA 3PN8A 1GUVA 3L68A 3L7RA 3DXIA 1Q6FA 4O12A 1EKOA 1ZS2A 4NXKA 4IMGA 1LUCA 4XVEA 1AMKA 3RPTA 2PC4A 1SW0A 1OWQA 3NG3A 1WE5A 4O0QA 4X9YA 4AZHA 2YBVA 3F1QA 2YPIA 2VM8A 1RJQA 1T7LA 1V79A 1AG1O 1H60A 4C6BA 2QXWA 1KGWA 2HEJA 5TIMA 3V36A 2BY0A 4O17A 1HKMA 3L2IA 4ATWA 1OGGA 3MMUA 2QIWA 4DNAA 2V30A 1Q45A 3WK3A 3EEGA 2BMBA 2WCGA 1UZDA 4DAFA 2GWGA 1Z32X 1W37A 3WF3A 1XIIA 1V6WA 3UT0A 4GPNA 4IFRA 1RV8A 4ATDA 2JKPA 4WJEA 3W2UA 3KS5A 3W4RA 3G1FA 2O0TA 1XICA 3GTHA 1SGJA 2DDXA 1E0TA 2V2DA 4IIEA 4JL2A 2I16A 4D9PA 1S39A 3AS0A 1MZRA 1R38A 1WX0A 3M44A 4B3KA 2CLPA 3RK8A 4D2JA 2RJHA 1TRIA 1NDVA 1JXJA 4LCRA 4AAJA 1KGUA 3IC9A 4JICA 1XLGA 1FA2A 1XCWA 1Y7VA 3DH7A 4RL3A 4Y2WA 1AJ2A 1RJPA 2BDQA 4LJ3A 4QE1A 1UW9A 3KWXA 5AC8A 4GFSA 1WKYA 2IKIA 3URAA 1CIUA 3KOFA 3ZMRA 4S38A 3W38A 1OCBA 4DWSD 4QEEA 5BNKA 3KM8A 2JK2A 3CAVA 4B3LA 4O0ZA 3WL0A 3H22A 2XZ7A 5G5HB 4QISA 3UZJA 1KRBC 1MNSA 1O6IA 1GEQA 2OWWA 2ISSA 4HA3A 4XBKA 4UOZA 3CZ8A 1UMLA 1B9BA 3BO9A 4C1LA 5CPSA 1CLKA 2E7FA 4XZBA 2RHGA 4KWSA 1KM4A 1L6WA 2OFJA 2ZA1A 4IMDA 2J79A 1J4EA 3G0UA 3QFWA 3C0LA 1EZ2A 2HNHA 1NDAA 3B8UA 1I45A 4H9VA 3VYLA 1VFSA 4GZJA 1GOIA 1J18A 1XLMA 5D2TA 2OMAA 2ZX9A 4XO6A 1L9WA 2VZOA 3AU2A 3A4WA 3EWBX 4I6VA 3ME3A 3IPWA 1JCMP 1EL3A 1BZLA 2IPJA 1WB0A 2DSUA 4HK6A 1RJRA 3GZ3A 5EPDA 3NM1A 4W8LA 3L0KA 3Q67A 4KESA 3GH7A 3QZEA 2OKTA 4HHPA 1GGOA 3E1F1 3BCJA 1DJHA 3QR0A 3Q4DA 3A64A 1FWNA 2G3FA 1TRDA 4AF0B 3C0SA 4LUIA 1M7XA 4FR6A 2MUCA 2VD9A 3ABSA 1Q4NX 4PC8A 4IGHA 4KGLA 4AVFA 1HKJA 5HQLA 5HXMA 1CBGA 5FSDC 4FR1A 2YQUA 3FS2A 2R1NA 2WPBA 3AOFA 2CKSA 3GRTA 4OU1A 3GAKA 5CPTA 1QXLA 3KWSA 1F8IA 3UR5A 3FGCA 4EP8C 2W79A 5FS8A 7A3HA 3K8MA 4AXNA 1HP5A 4HVXA 5FEZA 3AS2A 1JAEA 4S3GA 2ESCA 3QPZA 4IP7A 2NUWA 2PBGA 3WLPA 3HIJA 1XCXA 2ZZ4A 1GK8A 4TO8A 2FTPA 3G1HA 4JD4A 3T55A 2FPTA 1JZ6A 1UR4A 1FECA 3KTCA 1P6WA 2BX7A 1YPXA 3VAVA 3CU2A 5IRPA 4UTLA 2W61A 1V0KA 4MNJA 3N2TA 1TQJA 4YN5A 1O1HA 2VGIA 3C2RA 4GVGA 1GZ1A 3PZUA 2HXUA 2KAUC 3L23A 4GY7A 4PEEA 5D9OA 2VFEA 3KOZA 5T9BG 1XLAA 4R9XA 4IFOA 4MUZA 1XIGA 1GPFA 3CZLA 2R14A 5DLCA 5AC6A 2XIMA 1ZXIC 2X8RA 1GPWA 4F0RA 3W7JA 1EYEA 3B0YA 1QO2A 1Y8BA 2VKZG 6A3HA 2CZDA 3R0KA 3W82A 3CUIA 4J7RA 8RUCA 3T2OA 1ZALA 4AWTA 2O4QA 1MNZA 2VCBA 4KEVA 3BARA 5CSYA 4YXGA 1OSEA 1SFSA 1UKTA 1HG3A 1GHRA 1UOKA 4W8BA 4BI6A 3N9RA 3ITTA 3W1AA 2IPGA 2CBVA 4DBUA 2OCZA 4TVYA 1L8PA 4UQEA 1E4LA 1RPXA 1JYNA 3NVZB 5JXQA 3R7MA 2ZZ7A 3ZWSA 4UXDA 5E9XA 3O0FA 3N6HA 4X60A 2CC0A 3LN3A 3EB4A 4JFTA 4Z1AA 3WBAA 2I56A 4GYFA 2WHMA 5CZTA 2JIWA 4GZIA 4Y9NA 3K46A 2QUVA 2IW0A 4XZMX 1B57A 1FEAA 3PBWA 2RGLA 3KE0A 9XIAA 3REQA 3SR6B 4MAZA 3OB8A 1UWSA 3FAXA 3CMGA 2GYIA 1IXQA 1Q13A 4AC7C 1EBHA 4OQVA 1JDEA 3PJTA 5C55A 1AK5A 4YCPA 4TX9A 5FJTA 2C19A 4LUJA 1NVMA 1AD4A 3WF4A 1QTWA 3GTIA 4AEFA 2PUZA 4OFCA 3A9IA 5DT7A 3IIXA 3MVIA 4GI6A 4B5NA 4H4WA 4UBPC 1H0GA 1MVYA 1OYBA 1G7UA 4TVCA 4WDUA 2VJXA 3CTTA 2NXHA 1KM0A 1VF8A 2QUTA 2GJXA 2OSXA 3SZ8A 3NIYA 3RLVA 1L8NA 1XFBA 1RA5A 3U5YA 3B0XA 2D22A 1H51A 3EKGA 4UQAA 4QCEA 4AD3A 3P2VA 4BHYA 3LXCA 3VI2A 1G69A 1ZENA 4PL1A 1K8CA 4YVPA 3IJ6A 3P60A 3THCA 3WQ5A 3AUOA 3U57A 5AZ0A 1JCYA 2QPXA 1CECA 3NSMA 4O28A 2WMIB 4ZOCA 2HVMA 3O1NA 2OJPA 3SUVA 1P7TA 2VGBA 1XLEA 2DZVA 1AH0A 4UTKA 2WMHA 4JQ4A 3T9PA 3CWHA 3EANA 2ADAA 4FX6M 4XKMA 2Y2WA 2Y85A 4BQ5A 3O6YX 1E6SM 4IXHA 1G94A 1DJGA 4ZQRA 2QF7A 1GT8A 2VX5A 4NRRA 1XFCA 2IKGA 2QJIA 1DIKA 4ERAA 2ZE0A 2UBPC 2OGJA 1FXQA 4J56A 1H50A 3CQIA 2CKRA 5AC5A 3LBMA 4K8DA 1HJWA 4PMZA 1TPEA 3O07A 3L4WA 1X6LA 3L4XA 2PWGA 3GDLA 3KBJA 1TUFA 1OABA 2A5HA 4YL2A 1MRQA 3QSTA 1XLBA 1SW3A 1F76A 3ERPA 4LUTA 3S1UA 1LLZA 1BYDA 4M80A 1LOSA 1JD9A 3E5BA 2PLJA 3E12A 1ZJIA 3AIVA 1OFOA 3DKJA 3AHVA 5I3DA 1KTNA 1AOGA 1LBFA 1ITXA 4LUSA 3KOYA 4EX4A 4FOJA 3GIYA 1W3KA 2ZX6A 6REQA 3ARVA 3T4CA 2ATMA 3EA1A 1TV2A 3WBYA 5A6BD 2F7FA 4GISA 3F03K 2ANUA 4D6GA 2QF8A 4JTHA 5DT5A 4MWAD 1J0JA 4HOWA 3EPMA 2C7FA 3BJTA 4XD3A 1TPUA 4DB7A 3RYSA 5EBAA 2GQ8A 3WF2A 4GWEA 1DJYA 3MUXA 1QU4A 3CT7A 3PZ9A 5KZEA 1A5BA 4LB4A 3LCWA 3OBEA 3RGTA 3T08A 4RJEA 4ZE4A 3EMCA 1TR9A 4J28A 2IS7A 4HMCA 3KDOA 4JTUA 3WLMA 1V6UA 2BP1A 3LS9A 3RPDA 4Q7NA 4KCVA 3A7RA 3CC1A 3FVMA 1OEPA 2DIJA 1Q6LA 2XN2A 3NAVA 3VCRA 4DO4A 1V3KA 4HSHA 4UTHA 1BYCA 3ZR5A 3KBSA 4UUIA 3W3OA 3VDAA 3WK1A 4C60A 5FACA 3MCMA 3AXMA 1ZLPA 4FNPA 5C9XA 5HNNA 1FH8A 3ARZA 1VYRA 3EMQA 1FUYA 2XIBA 4J40A 4DAIA 1V3HA 3LHYA 4PN2A 1HN1A 4CQDA 1YMYA 1CLVA 3WUGA 3LV6A 1V0LA 3A7AA 1POJA 3LHZA 1ZAIA 3K2GA 3GTFA 2YA0A 1P1MA 2YL8A 3NTYA 4ZTXA 3BANA 4AZCA 2INZA 1OFEA 3UWVA 1FFUC 4AZIA 2JEPA 3QZ6A 3FEQA 3HJEA 1WKFA 4GUFA 3UVIA 1SZRA 3BGGA 4HSNA 1XRVA 5M1TA 2VT0A 3K4WA 4E2VA 4PMVA 1Y5WA 1XYCA 1S46A 4QS6A 3GR7A 3CH9A 1G4SA 1LM1A 3CBWA 3OHMB 2QIIA 3WD0A 4KFOA 4EPDC 1JUBA 1FHVA 1HJXA 2RH9A 2HQAA 1EGMA 3CMJA 3M0MA 4IPNB 4U3AA 1A5SA 4H4SA 2G95A 3RITA 2A21A 1K4GA 3RO8A 3G8RA 4A21A 1PTDA 4UFMA 1O68A 1WOAA 1K9DA 2Z2AA 2WQDA 4W4QA 1X39A 5F2MA 2WOIA 1VFMA 1JYWA 1NFPA 3Q58A 3E5PA 1UB3A 4IPPA 2OZ3A 2YDRA 5I07A 3W24A 2FHCA 1NP2A 2ZWZA 3VINA 3A4XA 4QP0A 4KFPA 3WUBA 5HNTA 3G0XA 1ZFJA 2Y8KA 4UTTC 5BU6A 3ARWA 3TN6A 2GOKA 3ZLGA 5LHEA 1EFZA 4M81A 1KV5A 4PTNA 2Z7KA 1RALA 4J3TA 3QY7A 1EEPA 1YDOA 2Z2BA 4ALDA 3U8GA 2WJZA 3SQMA 3PUDA 4KWUA 4OIFA 4I3GA 2RDUA 1W9BM 4O15A 3CGTA 2AOSA 4K7YA 1VLWA 1SZNA 4LBSA 1IIGA 5D2YA 4K37A 3UZYA 5LIYX 3B4UA 4Q8UA 1HIZA 3EA2A 2C14A 2J78A 3R4IA 2VYOA 3UA3A 1TYGA 2CFYA 3R5EA 2IXUA 2XSAA 1OK4A 2CWNA 3WCZA 4EMWA 1S5TA 1ADDA 2X1IA 4UFJA 1JQXA 4KWWA 2PCQA 3FEMA 2DSWA 1SZEA 3H7UA 2YB4A 4UIOA 3S6OA 3IJIA 4JIQA 4Q3MA 1BFNA 1W3JA 2Q3OA 2OSYA 3SN4A 1KCZA 4MKSA 2X42A 5K3VA 1QW7A 2DP3A 3L4VA 2V6OA 5DQPA 3OLIA 4QG6A 3BDKA 1PV8A 5HJYA 1QO5A 3S9ZA 1XIEA 5ABEA 1E4MM 3CEPA 3WSUA 2XSXA 5FF7A 1BQGA 1EC7A 4U2YA 4A3UA 2ACQA 3VPLA 4NP7A 2TPSA 4QTGA 1CI1A 1R7OA 3RJXA 4MF4A 4DUVA 2B7PA 4DBEA 1N63C 2OR2A 3J7HA 1L0PA 3ID7A 1PIGA 2CW6A 3BG9A 2C0AA 3GW3A 1XYBA 2QMKA 3WBXA 3OZYA 2YW4A 4IIBA 4B16A 3S2MA 3AXIA 1LJYA 5D2XA 4WXYA 4B5TA 4E6MA 5H8PA 2ZTJA 4AY1A 4XAFA 4F79A 4GXWA 3NZGA 5A8GA 1TB3A 3M46A 4O53A 1V6TA 2BFGA 1F74A 1GRBA 1MW2A 3O2LA 5C9UA 2ZRUA 2BY1A 2ZTKA 3IJLA 3E38A 4S2BA 4AX7A 5HMFA 2BASA 4ZBCA 3M0IA 3N2OA 3RG6A 3VZXA 3ETRB 2WQPA 2OTDA 1K77A 3TZFA 2CBUA 2UZ9A 5TF0A 5CCZA 1GRFA 3IVTA 1AJZA 5ABHA 1VIZA 2O9PA 3FYYA 3R25A 5JVLA 3BL3A 2PWUA 4X0VA 3VOIA 4JTGA 6CGTA 2ZA2A 1GOQA 3N12A 3IRDA 4IIDA 2RJGA 1IZKA 3VD3A 3CM4A 5C70A 3B97A 3V16A 2YX0A 3WDPP 2ZUSA 3VA8A 1NP0A 1DYSA 4AISA 4IQJA 2PI6A 2CHOA 1WXJA 4N9CA 1IE7C 4QJ5B 4US6A 2Z1KA 3WELA 2DIEA 1XIBA 3L9CA 5D9NA 3PPCA 2QW5A 2B7OA 1LL4A 1LRQA 4U3CA 4Q7IA 1BG9A 2PWDA 3T0BA 3EWDA 3O3RA 4K1WA 3NO3A 1G4PA 5CKSA 4IFKA 2NQLA 4LBUA 2CHRA 2YCKX 4FP1A 1W32A 1UZ4A 3H4GA 1BRLB 3F5LA 2RDTA 1Q6QA 1RHCA 3PSVA 3NZRA 5GJMA 3SDOA 3NR0A 2HBVA 1F3TA 1V3MA 3CQHA 5L9FA 3HQOA 2X09A 3N4EA 3ANUA 1I4NA 1ENUA 2JALA 1Q3NA 1XXXA 2R24A 3G8EA 1A4MA 3C52A 3PZOA 4A8LA 3P5ZA 5HQEA 1GXFA 3A13A 4O19A 4E2BA 3F4WA 3Q94A 1UKQA 1GRHA 3UXAA 4BQ4A 3HFTA 1ZGDA 1N55A 3QQ1A 2HS6A 1NH6A 3WLJA 1FO4A 3LXDA 1CGTA 2GQ9A 3TTEA 1XH2A 3S2CA 1VEOA 3GNPA 3CTLA 4JCLA 1TMHA 3VGHA 1HO1A 4YYFA 4FLQA 2Y8VA 1UWUA 5C9RA 1V02E 4A6GA 3R0UA 4AVOA 2ODOA 4FXFA 4NVTA 1ZBCA 3ZOAA 3CUZA 3RR1A 3TSMA 2E6AA 2W0HA 4QDWA 1KFCA 5DEZA 2PDMA 1XWYA 4W5ZA 5B7YA 5I3GA 4M19A 2YSWA 4XG1A 1ISWA 4YCOA 5CGQA 3GG7A 2PAJA 2YDQA 2AKZA 4NYYA 1M53A 2WSYA 5F4XA 1BAGA 4R7JA 4JTEA 4I9AA 2R1PA 4MJMA 5A3HA 1HUVA 2J62A 4P7RA 1YIXA 4EWND 1QI4A 3ZT5A 3OG3A 2REQA 1J12A 2NVAA 1A3XA 2WAGA 4XKYA 1FDYA 2D0GA 1DTNA 4DJEC 2ACUA 3AXXA 2E5BA 4PB5A 3SQLA 4HA0A 1K03A 5CZSA 1H5YA 4MGGA 5BXRA 4UTJA 1KFKA 4FLOA 1TJ1A 1D7FA 1Q8AA 5IBXA 5ABGA 2V81A 3I68A 4Q4OA 3XISA 4UQCA 5SWUA 2C8NA 4WRHA 1H1ZA 4C91A 1XC4A 2Y63A 3TROA 1B54A 3WF0A 1KFEA 3QJAA 2A3CA 3LCFA 4WJ8A 2TODA 2TSYA 5CLTA 2F6KA 4HPHA 2ACRA 3C86A 5U7SA 1E40A 2E9BA 1JPHA 3ES8A 3PC0A 1TE1A 3N9KA 1FTXA 2X1SA 1UPMB 4FX9A 1DXFA 4X63A 5I5RA 4HN8A 4AD1A 3UGVA 2BODX 2Q6ZA 3QFAA 1AZ1A 5I23A 1CYGA 4R33A 1YBQB 2Y1HA 4NZ5A 3UR7A 1P0BA 5CSRA 3GG8A 1GVIA 2NWSA 4C6QA 4ZO9A 3PUEA 3K1GA 3UXLA 3G1XA 3OBKA 2FHFA 4HOXA 4LC8A 1SMDA 2DJXA 1WDRA 5HWNA 4CEXC 5F2IA 1R85A 1RQEA 4B92A 1ZMDA 2X1RA 4YTSA 1U33A 4AUBA 1RCOB 2BXZA 3HG3A 1N82A 3RNMA 3S8HA 2XHYA 4ML4A 3H2EA 3URBA 1OZQA 4XQ6A 3TA9A 1W6TA 2VZTA 4IQEA 3WQOA 3S1VA 1PIIA 3PM6A 5JCKA 2YXOA 4A8RA 1ZP3A 4UZUA 4A3HA 1VHNA 5ER0A 1TVLA 3W53A 3DEQA 1E0WA 1ODZA 2CERA 3FSUA 3QH2A 1MXGA 4D6CA 4JTSA 1MUMA 2QGHA 2QJJA 5TQLA 2Z25A 1MDRA 1X2GA 3XIMA 1TV3A 2EPLX 2FJUB 1K1DA 1ME8A 4PYSA 2Y24A 4JIHA 1S5VA 4H41A 1L6SA 3DFPA 2O9RA 3HGOA 1W56A 4NNAA 1I8JA 1I9CB 1TPWA 4W5UA 3LPFA 4FK9A 3CGDA 4Q7BA 1UKSA 2QCEA 3VMPA 3CPGA 2W4XA 3TLQA 1KBKA 5HOSA 3QV6A 4ADWA 4EANA 3CIVA 3W27A 2O4MA 2WLYA 3JZEA 1EUAA 3W1RA 1GYMA 4AIEA 2GQAA 3EWYA 5I79A 1DNCA 4IPIA 1UBPC 4L6DA 4ZXLA 3IVSA 4I7UA 8XIAA 2MANA 3QY6A 3NL2A 3ZLFA 4QJ3B 4GIAA 1DJWA 2ZZ0A 4Q8QA 1GRTA 4QLJA 6TAAA 1EHNA 1Q6CA 5I03A 1J2BA 5A8MA 4Q8MA 1RBAA 1H1YA 3NL5A 1MUWA 3ITGA 3GIQA 1O1ZA 4S39A 2DUXA 4KBXA 4CKQA 5U25A 3SCVA 1PYFA 4IMEA 1RBOB 1OG0A 4ADSA 2OZ0A 3W1MA 1KCLA 5FI8A 3PZTA 3URNA 3W7CA 3R8RA 1KXVA 3UVAA 3O9NA 5CSUA 3QMSA 4GYPA 1XLLA 4PMRA 3IIVA 4PCFA 4JIEA 2G8ZA 5KZMA 3OO2A 1PWLA 3URHA 3RLGA 3AIQA 5E09A 4DELA 1OK6A 2BY3A 1GJUA 5I06A 3SO7A 4UTWA 1RK6A 2FPYA 1HJUA 4E4FA 1JQVA 1XIHA 1XQLA 2IKJA 5GNZA 3QGVA 1I0DA 3EB2A 3VD7A 4P8WA 3FA3A 3M0YA 5DANA 3QR3A 3T07A 1SJCA 4IX0A 2FZBA 3M47A 2F9RA 4A3RA 1FBAA 3N1AA 3DFHA 1TVNA 3NQCA 5AYBA 4D6EA 2OQYA 1Q6RA 1BQCA 4C7DA 3PWIA 5BWAA 2EEXA 3SN1A 4RXGA 3DOPA 5K4ZA 3CGEA 3CJPA 3VGDA 4AZ6A 2FZDA 1GJPA 2PP3A 1DKWA 5DY2A 4GIEA 2O9OA 3DZ1A 3P74A 3T1GA 3TV8A 4AWUA 5EBKA 4KFNA 2V3FA 4UFIA 1VQZA 4C7GA 2DW6A 3FX4A 3LGEA 5D02A 2HWGA 3L5AA 5D37A 1ESWA 3FLUA 4RCXA 2PTWA 4JTKA 4CNUA 4A8NA 4P2VA 2ON3A 4IG2B 3T7VA 3VU2A 2YR1A 4LOCA 4UOJA 4QCFA 3BVJA 1RQBA 1GQNA 4US5A 3MS8A 4MOZA 3CWOX 4M1RA 4PL2A 4JDYA 4TIMA 2Y88A 4HJWA 2ZIDA 3GO2A 5CZ0A 2EAWA 5CPQA 1OY0A 1ONXA 4S3FA 5I78A 1B3OA 1AH4A 4C65A 4E8GA 1TSIA 2YXGA 1MDLA 1OGBA 4ZO6A 4LYRA 1ZX9A 3RCYA 1FWBC 3DESA 4B15A 4C6EA 1CCWB 3UU0A 1SSGA 1HGYA 3ALFA 3G6LA 2HJPA 2DVUA 4HZ6A 4ORIA 4LRSA 4K38A 4RE2A 2BTMA 4HU4A 2G96A 2CLKA 4N4QA 4NUWA 2YOCA 1K8XA 1QATA 2WNNA 2XN1A 3W7OA 2HROA 2DVXA 2CLMA 1OFPA 5I24A 2YW3A 1G6CA 1CXHA 1BTCA 4H9TA 3TYDA 1G4TA 1W9XA 1I2OA 1ADSA 3LHTA 3QHOA 3FK4A 3UJFA 1Z89A 3AFBA 3FJ6A 1UH3A 1PPIA 2E5DA 2QKFA 4KKXA 3GU2A 1H49A 2ZC1A 3C2VA 5T9CE 3NRZB 4GXMA 3O15A 4UTMA 3W1NA 5KITA 4IX2A 3UZWA 4KS0A 1V59A 4CCEA 2GUUA 4XAYA 4H2CA 4J5NA 5D8WA 2VX4A 1FEBA 2VFHA 2C71A 2DSZA 3LQGA 1UR8A 1B5TA 1FCQA 4MYAA 1JZ3A 5LSMA 3T42A 1L6FA 3WG6A 3HURA 4F66A 4O18A 4V33A 1LZOA 1HX0A 7PTDA 2GWNA 2J25A 3QSRA 4L65A 4ZOAA 1EOMA 1R9YA 5ABFA 3I7SA 3DX5A 2Y6ZA 3W84A 4BWLC 5AHMA 4Z08A 5HJLA 2WM1A 3RJYA 3DDMA 1KBIA 1O5KA 2I5IA 2XSBA 3TN4A 1NAL1 1VJZA 1QMLA 4MM1A 4ZQOA 4DLMA 4WJXA 3FHQA 3R94A 5H8MA 1HO4A 4QXIA 3TJ4A 2JGQA 2DVTA 1FFQA 1AVAA 3B0UX 1HT6A 3STEA 1ZK7A 3UYIA 3LPOA 1YPIA 3BICA 4QAIA 2WHJA 4W93A 1M03A 1UD6A 2EKCA 3BUVA 4K68A 3WMSA 1AQFA 4HHLA 3B0PA 5LA2A 4HNNA 1XM3A 2JKAA 3Q6JA 3UETA 3H4XA 5F2GA 3TNOA 3UA4A 4NJHA 2OU4A 4HYWA 4ZOBA 1S5NA 4OV4A 7ODCA 3RUBL 2WMGA 1JL8A 1EO5A 1Q6DA 1NWRA 4H4PA 3LCIA 4L5ZA 3V5FA 4IP4A 3PPFA 2V38A 3D0CA 4PTMA 2HBXA 2BBFA 3A5VA 1D3HA 4BF9A 3UNDA 4BR1A 1Z8AA 3SURA 1UR0A 3PANA 3WJYA 3AJXA 3B9OA 5BU9A 1FH7A 4C6JA 5CZKA 4NAEA 2V6AA 3WD4A 3CLMA 4I7WA 3FA5A 3GG0A 4L9ZA 1ML1A 3CO8A 3M1ZA 1E51A 3SSJA 1T41A 1YRRA 4BCEA 2G50A 4WHBA 3AMDA 3LCHA 4J3VA 1T96A 2J77A 3MZ2A 4H7VA 5AFDA 2I9UA 3SB0A 1VZWA 6ALDA 1TMQA 1REQA 5I3JA 3S1XA 3GDRA 3E3HA 5F2LA 4ADUA 3GIPA 1OD0A 1U5VA 1KW1A 3QKEA 3GRSA 1RSCA 1V03A 3KS6A 3QV8A 2FDMA 4WR3A 2ZOXA 1Q1RA 3HMJG 1IEWA 4LXFA 1UH2A 1SFTA 4YMZA 4GINA 2WPEA 2XINA 2NXIA 1UD8A 3T81A 3UG5A 1W5NA 4OUIA 3GFYA 3H12A 1IGSA 4FX7A 4V28A 4G8TA 3KZSA 3P67A 1QI5A 4ACZA 4JTCA 1WDDA 3WH6A 1XQKA 2Z2UA 3GFXA 4PH6A 2P53A 1J79A 2OODA 2ZXDA 3OPSA 3LOTA 5JH1A 1RLCL 2D2JA 2V0TA 5K9XA 1YDNA 2QLYA 4H4XA 3H7VA 1KFBA 2CLLA 1KTCA 1IQ8A 3ABOA 4FNSA 3PFRA 1OVDA 3LENA 1K9TA 3BXWA 2SFPA 1EB3A 2C1GA 5LGXA 3EX6A 1MSSA 1R9ZA 4DJDA 1CXEA 3CUHA 1E9LA 1T40A 3SCTA 5JBDA 3QV7A 1N8WA 1ZNNA 4ZCWA 1QNVA 3EXRA 5HUPA 4F0SA 1JZ2A 1TE6A 1E55A 1YBQA 1UWRA 3BLPX 1UJPA 2ZRYA 3B9AA 2YVFA 3MB9A 1SQ7A 2GUYA 2WNQA 2H3BA 1I1WA 1BEUA 3GHTA 4NI8A 3DFNA 1XHGA 3M0JA 2BCPA 1V97A 1KBBA 1K7EA 2PWEA 1VBUA 1UBSA 4M7SA 4IL0A 3OGRA 3WO8A 4LB3A 3RXZA 5EBUA 1GOKA 4E4PA 1ICSA 3BQ6A 2ALRA 1GKQA 1W0MA 2WLZA 4KPLA 1KR1A 1WBHA 3D3AA 4FMVA 3NQAA 3WFAA 1TWIA 3R8GA 1HQTA 5AVHA 5J04A 4MUPA 4UFKA 5EMJA 1CTNA 5CZJA 2OQLA 5K9DA 1EJWC 1BGAA 1O7AA 1XIFA 4CLMA 1DVJA 2OLSA 4Q4PA 1Y65A 3W87A 2WSRA 3W1QA 4G2DA 1LDCA 3AHTA 1UD3A 1YTKA 2TYSA 1GTHA 3G1SA 4ZEPA 6XIAA 1EJVC 3SRDA 5HULA 1R86A 5CAKA 3BZJA 5EB8A 4CQBA 1VIWA 3VX1A 3TWBA 4M52A 3RRXA 2XFWA 1KV8A 1XGEA 3ZXWA 2PB1A 4HT3A 3UWYA 2VZUA 2DJLA 2GJPA 2JIEA 2NV9A 4OUEA 2BC0A 3BSGA 4CQ9A 1PCKA 2UY2A 1XISA 2IMRA 3QC0A 2A6NA 3KTSA 3H2OA 3H8AA 4GC4A 4HNVA 2ZXQA 3WNMA 5HDRA 4KF1A 1CT5A 3AZSA 2W3RA 4IL2A 5FS7A 5DMYA 4UTFA 4ZVJA 1UA7A 1NFGA 4JNZA 1A0EA 2NXGA 1Q2SA 1Y5VA 5MKGA 3STCA 2QDGA 3BCDA 4DVOA 1QW9A 2EQ7A 1T5AA 2CLFA 3FNDA 2D73A 1XSJA 5AY7A 3B0VC 1R2TA 4LAKA 1UZHA 3UESA 3W7HA 2AAAA 1LOLA 1U2YA 3WQGA 1YKWA 4ZGYA 1AQMA 1GQLA 4QSHA 4K1GA 1OIMA 2GVGA 3WEOA 1W5PA 1DXIA 3T0CA 2XZ9A 4LW7A 2XFYA 5CEWA 4HCDA 4MMWA 1F73A 3C6CA 4DJED 2HS8A 1GVQA 2R1MA 4TX6A 2NVDA 4TQTA 1K6WA 4KEZA 2EJAA 5A2AA 3TVAA 4LNCA 4LFYA 3I10A 2JK6A 3W6YA 5FOOA 2WCAA 1TZ9A 1JI1A 1V0NA 4CD4A 1V3IA 1KXTA 5JQ9A 4RKAA 3WNOA 1G01A 1OD8A 4DO6A 4NQ1A 2Y7GA 1UIPA 4HIBA 4OGZA 3W7RA 1MW0A 3DN5A 5BW6A 3DFTA 3ZJ6A 2YYTA 4B91A 2JBMA 1R3TA 2OZ8A 4IQDA 1Q7QA 3IJ9A 4PSPA 1J9YA 3TCSA 4LY8A 3PBMA 3AS3A 5JCIA 3PNUA 1LUCB 2PDHA 3LSCA 3TYUA 1XL9A 1TWDA 1GOOA 4EXQA 2HPIA 5A2CA 2F84A 4O4VA 4Q6XA 1JZ7A 1KKOA 4I9TA 5EU9A 1KR0A 1V5XA 4DUXA 4LAUA 3W1XA 1UD5A 4F9JA 1WZLA 3UZZA 2GL5A 2NLYA 1W9DM 5TAOA 2DH2A 2E25A 2W3SA 1E0UA 4Q4SA 4DF1A 3EPNA 4H4TA 1XANA 4O4WA 4HPNA 1GKRA 5DCDA 1JJKA 4Q4MA 2BG5A 1V02A 3IGXA 2V82A 4DQWA 2F6XA 2AQVA 2E3TA 5C6MA 3KDNA 4HTYA 4H8VA 2HCVA 1W5OA 3KLKA 3U48A 4AD2A 4H9UA 4CNOA 4LV9A 5C0QA 4DO7A 3VUSA 5HNUA 1KGXA 1MRAA 4MFEA 3R43A 5FJOA 4WY0A 2F8QA 2D2OA 1FHLA 3M7SA 1F6YA 2A3LA 3IUIA 3N6JA 3WD1A 5CC3A 1WDWA 3VTRA 3LQLA 3KP0A 3VILA 5GRTA 4CU8A 2XFRA 3BAYA 3V0UA 3UW6A 3ONCA 1PTAA 5E0KA 2INEA 3B04A 3DFYA 4PTDA 4ES4A 4WD0A 3MBFA 1STZA 4EK7A 3OYZA 3LPPA 4GI8A 3WLRA 5D32A 3TMQA 4S3KA 3OZOA 5BOFA 3PG6A 1H7WA 4AEOA 3ANVA 1H4PA 3FYOA 5CG0A 4CVWA 2PGEA 2VFIA 1A5MC 4PCSA 4C6OA 1SR0A 4B2DA 2VCCA 1JRCA 1LBMA 4RNFA 2VDGA 2I1OA 3DGHA 3NVWB 1WCGA 4GMEA 1ISVA 3T8LA 3VVGA 1R2SA 1A0DA 4ZFCA 2VNCA 4HHMA 2ICSA 3HW2A 2R9ZA 5FF4A 4CUCA 2HISA 2WVVB 3HA1A 3B8IA 2E9LA 1Q5MA 3QM3A 3H2NA 1M6IA 3GU9A 4PFHA 1KM1A 3VM7A 1OCJA 2WWCA 3MDUA 1UYQA 4NZ4A 1G67A 4DIAA 2PDXA 2QCDA 3T09A 3RM9A 1SR9A 1ZPTA 3BMVA 1PXGA 1RLDA 1RPKA 3KCLA 1S1PA 4MLRA 4QLKA 1OC7A 3LXBA 3UG4A 3KL5A 1UJQA 3BLEA 4QROA 3CHEA 3GAYA 1TIWA 4IT1A 2DT1A 3CMFA 3BH4A 1W1A1 3BZGA 2E77A 3MSYA 3VDHA 2VENA 3UEQA 5LNVA 3IWPA 5KEZA 3PR2A 3XINA 1QOXA 2ZWYA 3URQA 1IGWA 3LU2A 3FGCB 2QAEA 1E1CA 4UR9A 3ZR6A 1BXNA 2ZZ1A 4C6CA 2PSNA 3ZJKA 1RM6B 1S3TC 3BLOA 3DGRA 1E6XM 4N9BA 1I75A 3B9JB 4BV6A 1ZJAA 4H4VA 2V2HA 5HPCA 1BWCA 5FKYA 1SM9A 3DFQA 3WJZA 2XPKA 3W86A 2QZRA 3H70A 5FESA 5C2CA 3GW0A 3WUEA 3HG4A 5LIWX 2YA1A 1CXIA 4A22A 1VR6A 2VX6A 1F8WA 5EMUA 4NY2A 4RV8A 1WZKA 5LIUX 2RFGA 1EJRC 2CETA 3KX6A 3WN6A 3ATZA 3BE7A 4W89A 3IIOA 2GR3A 2CZVA 4GQBA 4L4OA 1VLIA 4IICA 3OQEA 4U31A 3H26A 4N6EA 1EO7A 5REQA 3DKLA 5D8ZA 1FP9A 1AH3A 4NG3A 4FIRA 2XU2A 1RD5A 2Y7EA 4N4PA 2X0HA 3W23A 1F61A 1A47A 3MI3A 4Q6JA 3CGCA 3SW6A 3G3MA 1X7FA 1S2TA 1NF0A 3H2FA 3LMZA 3B05A 1W1YA 4LVBA 4UNIA 3N2XA 3MA8A 3P62A 1A0CA 5D9MA 3TTOA 3H2AA 4GJIA 2I17A 3PPGA 3UZXA 1RQHA 2BGSA 1N8IA 1NELA 1J5SA 3AICA 1YNQA 1EEXA 4GIRA 2OEMA 4PR4A 3D5HA 1TCMA 4F3HA 5EMLA 1JIBA 3UQNA 1ZQ5A 3FJNA 5D33A 2Z1BA 1W5MA 4XIMA 1TWSA 1XHCA 4LIIA 1NF7A 4TR9A 5BOOA 3DGBA 2OYLA 3B9DA 1O5RA 3WL1A 9RUBA 5F1UA 1ONWA 2QDHA 1GG1A 4RW5A 3AZRA 1JDCA 4Z0JA 1E4IA 5BXPA 4JL1A 4DUOA 2WP6A 4OOZA 1NWUA 3WQCA 1PTGA 2G41A 4HGXA 3LHWA 4K39A 3USZA 4RX0A 1EXPA 2VVSA 3AYRA 3B03A 2Y70A 3UPBA 5IM51 3F4NA 3VNLA 1SZFA 2C16A 3LZ5A 3REQB 3WQPA 4ILSA 1VJSA 2A1YA 1SYTA 3KVKA 1W2VA 5EMKA 2C91A 3LYEA 2JGYA 2PDIA 4MJZA 3OVPA 3ARRA 4Z0SA 4HA4A 3OIHA 1JAKA 1GCYA 3GUGA 1W1VA 3U4AA 1BF6A 2G3IA 3A5FA 1XDLA 2PDJA 4NJJA 4FLRA 5I6SA 2O55A 2NUYA 3NXFA 3OW1A 1K7XA 1AL7A 4HPJA 1TJ2A 3U2OA 5CBBA 3QOMA 2J13A 4AD0A 1X97A 3WQDA 1P5BA 1C8XA 4D1JA 3W2JA 4JYDA 3RPMA 1WO2A 4S23A 2QDEA 3NVTA 3G1VA 2P76A 1C8YA 1H2IA 2WM0A 2NX9A 2ASHA 3WYZA 3E2VA 3UXIA 2WNWA 3JR2A 3NURA 3R2GA 1DWAM 1U22A 2AAQA 3O06A 1MEHA 1J5TA 4H83A 3SRHA 1SJBA 4DM2A 4JYFA 4FXRA 4H4ZA 1FWHC 2P5NA 3CL8A 4LNYA 2P0IA 3ARSA 5A6JA 4EF8A 4AG0A 3WKZA 3CZGA 5BRBA 5A8NA 5D09A 3G18A 3M0XA 1P7TB 4E2OA 3T8QA 1O5QA 4L80A 3PTMA 5LIXX 3K4DA 1C3FA 3TW9A 4WIWA 3VC5A 4Y9PA 2E0PA 1JYXA 1EXBA 3ZZ1A 3G24A 3TEVA 4YTQA 4H8UA 3DHFA 4GOAA 3ZYZA 3OG2A 3VIGA 1D7YA 1LVLA 1TPVA 1R2RA 2C1IA 3AIRA 1JPMA 1FWGC 1FWDC 3W7NA 1I1XA 3LB8A 4R5EA 3WDJA 3HOJA 5JCNA 3GKFA 4PRRA 2ZA3A 4X3ZA 2E40A 7ENLA 1SO6A 3QPEA 4ONVA 2E1DA 1DIOA 3CS2A 3RU8X 3LPGA 3V4BA 1C7TA 2XIQA 3QMRA 1Z9AA 3A47A 1KFLA 1T3QC 3GDTA 1P43A 4LUTB 1R30A 1E6RA 1DBTA 2XH0A 5AECA 2ISDA 3SCNA 4NIRA 2J7BA 3CAKA 3MUY1 3O16A 2FGLA 1BG4A 3LGDA 3KHDA 4EM3A 1VD6A 3B9EA 2AL2A 3ZM8A 2HDJA 3VOJA 6REQB 3WQ6A 4W7WA 3T0TA 1BPLB 3C0QA 1WDSA 4KQNA 3EPOA 5CBJA 3LRKA 3CZJA 3LI0A 3B8DA 5DFAA 1NDYA 2WZTA 3GHSA 2PLMA 3PVFA 4FX8A 5FAGA 3WQ8A 1SJAA 1XYAA 5G2HA 3S42A 1O95A 1RVKA 5CC6A 3QFBA 4GK8A 1JEZA 4B90A 3V0TA 1VBJA 4HNCA 3IVUA 1TX2A 1VBHA 3LSBA 1E5NA 5A5WA 3UJ2A 1NHPA 3GNOA 3ENLA 1N8FA 3FVDA 3TN5A 4D8LA 4O54A 5LA1A 1ZDLA 3KXQA 1VJIA 2W66A 4GQGA 2XH4A 4JXCA 1J0ZA 1CB2A 4IF2A 3NO1A 1PCWA 3CXBA 4N0RA 3I65A 3MC5A 5AB3A 4J3UA 4CEUC 1EWEA 3PFMA 1M5WA 1RK5A 3LADA 4O16A 1JUKA 1KA9F 4JFVA 3AHZA 2FB2A 3APYA 3MQTA 1OT1A 3TSBA 3SECA 1RA0A 4Z42C 2L5HA 4OWGA 1E6PA 4GNVA 1AD1A 3BV7A 3E0IA 2WC7A 4P61A 1K4QA 1EPVA 3QTGA 1PKYA 4M82A 3WLQA 4IJCA 3VOHA 3O05A 4TVDA 1X2HA 2DIKA 3HBLA 4AZCB 2QCLA 4MTVA 2O56A 3R07C 4EM4A 3HTWA 3CIWA 2JKEA 2R94A 2FLIA 4DYEA 2WBAA 2OLHA 2OT0A 3HF3A 3PUOA 3M07A 3SGZA 1B2YA 1JNEA 3KOWA 1W5QA 3NZPA 2ZFAA 3I3EA 3OBAA 2VDIA 4IJRA 2KZHA 3W07A 4GXPA 1QNQA 4ZA0A 3IEBA 4JZ5A 3O7UA 3TR9A 1KXQA 3K5XA 3VOCA 3V18A 1KRMA 4IOTA 6ENLA 3LX9A 1NQ6A 1FHDA 3U9IA 1YX1A 2BGNE 3MKCA 4XUGA 3CQ0A 4HOZA 4XAPA 1ZB5A 3L12A 2FTYA 4I5XA 3C8NA 1EP3A 3GYEA 3TC6A 4MWAE 4AX6A 1JOAA 3AROA 1FWWA 5M5DA 4G7FA 2RUSA 3LK6A 2J6XA 2QCNA 4DZ5A 1DIEA 5G2IA 1MUCA 1G1YA 3AMLA 3W7MA 4HJFA 4L61A 4GC3A 1U83A 1YE6A 3VKKA 5K2ZA 4IHCA 2E1WA 2ZYFA 3NQ6A 3A3XA 2ISVA 4WGXA 4HMNA 2PTDA 2X0YA 1QPNA 1OFRA 1SO4A 4PMJA 4MZ8A 4C6NA 4QIUA 4XTDA 5H2ZA 2GJRA 3TIMA 5JBEA 3W7EA 1M68A 5CGTA 4QE5A 1VHCA 1DL3A 1BWKA 4RZ5A 3CH0A 2QDDA 3LG3A 2VFFA 4MPKA 4H6KA 3CZEA 2EPNA 3EOEA 4ZOHB 4AHPA 4Z2KA 4PBGA 3W2KA 4ZQPA 4PUJA 3MTWA 3W9ZA 3HGJA 2IQTA 1EA0A 2QV5A 3E0VA 2A3BA 5D30A 3IK2A 1JGIA 4RNHA 1UUMA 4IGMA 4K3ZA 3QLLA 5IOBA 3QHNA 3W73A 3UY7A 3W70A 2J24A 1L6YA 3PZMA 2PE4A 2WVVA 3N4AA 3FHAA 3PWGA 3EX3A 4GVHA 2D23A 5CGMA 2ZE3A 2F2KA 2OB3A 4LSBA 2PS2A 3TCEA 4FSAA 3V3WA 4JN8A 4EAYA 2V67A 2X8GA 3NQ8A 1XGZA 3AM9A 1IXPA 3IUHA 1H7PA 5E0CA 2UV8G 3A3HA 3KW3A 1AJ0A 4AHQA 4RR4A 4AQLA 2FYMA 1XYZA 3ZT7A 2PCEA 2OLAA 1EX1A 1M7OA 1LG2A 1FVPA 3KBMA 4BQ2A 1EC9A 1TPC1 1W1B1 4V15A 4UR7A 2BVWA 1OHLA 4UMAA 1YW1A 4HK7A 3DGZA 3GKAA 1CPUA 3L8KA 2CNCA 4YYCA 5LNWA 3KVMA 3R13A 4AZGA 3VNZA 2P3ZA 5AYZA 2BHUA 1S5WA 1V0MA 3L2MA 4FDCB 4OZOA 1C8QA 3FY1A 5DMNA 4AD4A 2YVJA 1E3XA 1M7PA 1FRBA 1V6YA 1TVPA 1ONEA 4Q4QA 3G6MA 4XWUA 2FQIA 3THAA 1GZGA 5BZAA 2E8YA 1PVNA 3MSDA 4W9TA 1GESA 1H7RA 1GRGA 3SN0A 3OA3A 5LNSA 3UERA 4LA1A 2XM1A 3GWQA 1F6PA 3N2BA 4J9JA 2QJMA 4NZCA 4AHOA 4GRTA 3IACA 4BI5A 1J93A 1R0MA 4DHGA 5AHNA 1FWEC 2ZUNA 2NV2A 1IWPA