3P3BA

Crystal structure of galacturonate dehydratase from geobacillus sp. complexed with d-tartrate
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
385
structure length
377
Chain Sequence
LNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSSLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title CRYSTAL STRUCTURE OF Galacturonate DEHYDRATASE FROM GEOBACILLUS SP. COMPLEXED WITH D-TARTRATE.
rcsb
source organism Geobacillus sp. y412mc10
total genus 133
structure length 377
sequence length 385
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3p3bA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3p3bA01
1JPDX 2MNRA 2P0IA 2PTXA 4F4RA 2OFJA 3S47A 5BOFA 4A6GA 4DN1A 2OO6A 3PFRA 4IT1A 2OLAA 3R25A 2GL5A 4E8GA 2PGWA 4KWSA 2QJNA 3FCPA 4GYPC 2QGYA 3QN3A 3SJNA 4KT2A 2POZA 4J3ZA 1OEPA 3DESA 2PMQA 4E5TA 2QDEA 4DX3A 1TE6A 3VCCA 2GGGA 3MZNA 2HXUA 1SJDA 2PS2A 3BJSA 3NO1A 4FP1A 3ZLGA 2OZ8A 3CT2A 3MSYA 1E9IA 3N6JA 1L8PA 2OG9A 3IJQA 4J1OA 4GYPA 4DWDA 4MMWA 3UJFA 3DG7A 3RO6A 3I6TA 2DW6A 2FKPA 3H70A 3MUCA 3D46A 1NU5A 1EC9A 2XSXA 1EBGA 3ZLHA 3GO2A 2GSHA 4G8TA 4IL0A 3QPEA 2ONEA 3S5SA 3DIPA 3SQSA 3N4FA 3V5CA 3OZMA 3DERA 5IDZA 3CXOA 4ROPA 3VDGA 3TOYA 3MY9A 7ENLA 2OX4A 3T4WA 2QVHA 1XS2A 4FI4A 3V5FA 3GC2A 2GGEA 3TTEA 2XH4A 4K8GA 4GGHA 3P0WA 3BOXA 3UXKA 1ONEA 1KCZA 3DDMA 3H7VA 3ES8A 3I4KA 2AKZA 3ZLFA 3SBFA 1SJBA 4MKSA 3FJ4A 3VC6A 2HNEA 3OZYA 3EKGA 3MWCA 5FJRA 3GY1A 5J04A 1SJCA 1KKOA 3OPSA 1TKKA 3EEZA 3IK4A 3SN1A 2PU0A 3VA8A 3SSZA 2PP3A 2PP1A 4IP5A 2HZGA 3KUMA 3TWBA 1MNSA 3IJIA 2QJJA 2AL2A 3DGBA 3MQTA 1IYXA 4YWSA 1FHVA 2XGZA 4DYEA 2PCEA 3NFUA 2XH7A 3DFHA 4H19A 2PPGA 3T8QA 3ZVHA 3UJEA 3UXLA 2O56A 3R0UA 3CB3A 3NXLA 3RCYA 2PTYA 2OKTA 2OPJA 3TQPA 1JCTA 3PWIA 1KD0A 2QQ6A 1EC8A 4A3RA 3Q4DA 2PTZA 3R10A 2FYMA 4GISA 3VFCA 3STPA 3UJ2A 2PTWA 5BOEA 3V3WA 3TW9A 4E4UA 2ZC8A 4X2PA 4HNCA 3GD6A 1BQGA 3P3BA 1PDZA 1KKRA 1XPYA 3UCCA 3UJRA 2PA6A 1JDFA 3OTRA 1ECQA 2OQYA 4JHMA 4DHGA 2QJMA 1MRAA 3R0KA 2DW7A 2GGIA 3FYYA 3N4EA 1EBHA 2OZ3A 3U4FA 1ELSA 1SJAA 3I6EA 1R6WA 1W6TA 2HXTA 6ENLA 1DTNA 4K2SA 2P3ZA 3N6HA 3IJLA 2PP0A 4E6MA 5FJOA 2P8BA 3FV9A 3UJSA 1RVKA 2CHRA 4HCHA 1FHUA 3K1GA 3TCSA 3TJ4A 4ENLA 2MUCA 2XH2A 4EWJA 3BSMA 3VCNA 4IZGA 2AKMA 4Z17A 4Z1YA 3ZVIA 2GDQA 3R1ZA 4G7FA 4GMEA 5FJTA 3QKEA 3CYJA 3RGTA 1EC7A 3TJIA 2OZTA 3UGVA 4KPLA 3T6CA 2RDXA 3FXGA 4HN8A 2OQHA 3HPFA 3PWGA 3DG3A 4M6UA 3B97A 4A35A 2GGJA 3V4BA 5FJPA 3DG6A 4HPNA 3UCDA 1NELA 3OP2A 3P93A 1PDYA 3THUA 1TZZA 3SN0A 1WUFA 4GIRA 3DEQA 4HCLA 4H2HA 4H1ZA 3JW7A 4IP4A 2PODA 1R0MA 3VC5A 3SN4A 3Q45A 3D47A 2PSNA 1YEYA 4H83A 2OVLA 3FVDA 3CK5A 4ZCWA 3JZUA 2PGEA 4GGBA 4IL2A 3QTPA 3ENLA 1P43A 3OW1A 4E4FA 3TWAA 2AL1A 2NQLA 2AL2B 2ZADA 3RR1A 3RITA 2PU1A 3R11A 5EU9A 1JPMA 1MDLA 4DXKA 4MGGA 1BKHA 3RRAA 4HNLA 4ZA0A 4K1WA 3DFYA 5FJUA 2GGHA 4GFIA 1F9CA 3JVAA 3ZVHB 3MKCA 3CAWA 3PK7A 2I5QA 4HYRA 1MDRA 2P88A 1P48A 3NZGA 5ENLA 3T9PA 3U9IA 4IHCA 3H12A 1MUCA 3H8AA 4M0XA 4HCDA 1WUEA 2P8CA 3QLDA 3ES7A 4JN7A 4KEMA 2XH0A 2QDDA 4JN8A
chains in the Genus database with same CATH superfamily
1GT8A 7ODCA 4F4RA 3PAJA 4UTTC 4DN1A 3VOFA 2OO6A 3CQ0A 4KGLA 4ZO8A 3VVGA 4E8GA 4GACA 2HVNA 1V0KA 3I3BA 4C6MA 1JQXA 2QGYA 4K1GA 1GRTA 1ZENA 4K68A 3EOLA 4AD0A 3M6DA 3IS4A 1BVWA 3B0XA 1BWCA 4ZENA 3LI1A 3PF3A 4MAZA 5AC6A 3TTYA 4LUJA 3JS3A 3LBCA 3WH9A 5I3IA 1IT7A 1TELA 1S2CA 3VCCA 4FPSA 4PULA 1XD1A 4PUUA 1SZEA 4MZYA 1XLEA 2X0SA 3FS2A 5DMNA 1J96A 1WKDA 1FCVA 3GIYA 2GJLA 3GU2A 1KFJA 2BY0A 1GW1A 4Y2WA 4LF2A 4Q8MA 5GNZA 2VC5A 3MTWA 5F4WA 2YOCA 1GKQA 3RO6A 3AXKA 1BSIA 1W3HA 1CIUA 2NQJA 3CLWA 3O3RA 4LBRA 3RF9A 1E6QM 1QFEA 2B0MA 1NQ6A 2BMBA 2YFNA 1QNQA 1W37A 4G9PA 1NHQA 1XLGA 4JR5A 3GO2A 2PAJA 4H6RA 1DJQA 2VO5A 4K3ZA 3MDUA 4JEJA 5FEPA 4CEXC 4AWSA 3S6DA 1V3HA 3DIPA 4DPQA 3A5VA 4B3ZA 1PEZA 3G1DA 3TC7A 3WK3A 2YAUA 4KEVA 3TOYA 3PNUA 4PTWA 5J8LA 1J93A 4AY8A 1B57A 3HQ1A 3P0WA 4Y6GA 3UXKA 1VLIA 4LC6A 1KCZA 3G3MA 4H6QA 3UERA 1AH4A 4R88A 1QW8A 5E0CA 1PTGA 1LQ0A 5CPOA 2W62A 5DXYA 1OFOA 4CQ8A 1HZYA 1XBYA 3OZYA 3MO4A 4UQBA 4NVTA 4AZCB 1KKOA 2ISSA 3ZQ9A 4DNHA 3RM8A 1OVDA 1EDGA 1SZFA 4ERAA 4WDXA 3NJ3A 5HK4A 1A49A 3WBEA 1DP0A 1A47A 3ATYA 5K4XA 3P5YA 5HXMA 1BYBA 2BODX 4RZBA 4M8UA 2Z4GA 1IEIA 4A8NA 2YSWA 2EPNA 3OVGA 2Y7GA 4ICNA 5F4XA 3MMWA 1EDTA 3OG3A 4AZHA 3ELFA 4IQLA 4LY4A 3NG3A 4OOUA 4X9YA 2QF7A 3MS8A 1UCWA 3PNZA 1XI3A 1XP3A 4TMCA 1IXOA 9RUBA 1IGWA 2GYIA 5C8BB 3AHZA 1US2A 1BYAA 1XSJA 1FWEC 1OG6A 1TE1A 4MNMA 1KM0A 2CLOA 1ZKQA 1VJIA 2J75A 4H6EA 2ISWA 4P8UA 3TYZA 3GKFA 5EPDA 1O95A 1Q6CA 1LRTA 2HS6A 5G5IA 2KZHA 2ABAA 1N2VA 1UZ1A 4QCFA 3N19B 3NGFA 2H8XA 3B3DA 1FRBA 1J10A 4R3UA 2QCMA 4IP7A 5A8OA 1OADA 1T5AA 1FKXA 2VP8A 4XUYA 1SGJA 1YHTA 4TR9A 3S9ZA 3BAXA 2FFCA 1YPIA 3O2LA 1HJQA 3G0XA 1OF8A 2C13A 2OO0A 4HB7A 3D3FA 1NOUA 4IJRA 3U5YA 2GK1A 4LEQA 3INPA 4KEUA 1KGXA 3WDQA 2VWTA 4ZSUA 1GVEA 2XH2A 5HA7A 5F2IA 4PL2A 3GQYA 2FPVA 4HU4A 5D09A 3FA3A 3ZSTA 3PPCA 5D2VA 3C56A 1RH9A 3N18A 1EUAA 4IZGA 3M43A 3IV3A 3R4IA 1FXPA 4N9EA 3DU0A 4ILSA 2F7FA 3SCRA 1KGUA 2ZUTA 4JKMA 4NJKA 4RKAA 2EG7A 2ZOXA 3GHTA 2HVOA 1YMYA 3H2CA 4R9OA 3QFAA 1T3QC 2C6QA 2RDWA 3BLOA 2Z1SA 5CPQA 3IGHX 2RDXA 2BG5A 1WNOA 3F4VA 3CGCA 1TWDA 3SRKA 4MTVA 3WK0A 4WRHA 2QCHA 1OYAA 3AXXA 1GVOA 4B5NA 3EA1A 4UTKA 1G5AA 3PB0A 3APTA 1TA3B 2J6VA 2NQ9A 1XPGA 3W1MA 3M0IA 4QHRA 5LNRA 2NXIA 4UTMA 3AO0A 4XVEA 2DJLA 3ANUA 4NF7A 4QAIA 4HHPA 3WJSA 4HZ6A 2VL4A 5CH9A 1F3XA 3UZZA 1RD6A 5JH2A 4UFMA 3KL0A 1T40A 3DBPA 4U5KA 4C90A 2ZCGA 4QS5A 1XDJA 4LQ1A 1QXLA 2GR0A 3VOCA 3FHAA 4HHHA 2GJXA 1VFOA 3SR7A 2J4GA 1NHSA 3SJ3A 1ONRA 4CD8A 1F6PA 4Z2KA 2GJPA 5C55A 1H3GA 2O4MA 1XFBA 2WPEA 2G5WA 5CBJA 3IK2A 1AW1A 1JPMA 3CXBA 1TWWA 2VT0A 2ZWZA 3GU9A 2C18A 2V2DA 5FOOA 4OECA 1ZXIC 2A79A 3K2GA 2PI6A 3U2EA 4HYRA 4O52A 1CCWB 1HXJA 1MQRA 1JPKA 2IXVA 1I1XA 1SZRA 4JIRA 4IGSA 3L0KA 1YX1A 1GPFA 1EUNA 4F3HA 5CC7A 1U1JA 2JKPA 3AMZA 3MI3A 4YYCA 4UNKA 4H4ZA 1MEHA 2WVSA 1EX5A 4H4VA 4GFSA 3V75A 2G37A 1ZBVA 1F3WA 1E0VA 4PFHA 4XIAA 3W82A 2J13A 3W1QA 5FSDC 2GQAA 5FF4A 2AMXA 2J8GA 2V2HA 3NPXA 4ZQNA 1BZLA 4LAUA 4S3CA 3BMVA 1KM1A 3HIJA 3VDBA 4I5RA 1TYGA 4GR1A 5HMSA 2POZA 2NWRA 3PJWA 4AZ5A 2DZUA 5AVHA 3WMBA 1KBJA 4CQ9A 3LRKA 2DZBA 5D04C 3G1VA 4E5TA 2QDEA 3P61A 4I5UA 1TE6A 3NQFA 4GXWA 3S1XA 5DCBA 3GUGA 5DT7A 3DFOA 4Z2IA 1SJDA 3LRMA 2W3ZA 3HG2A 4D72A 4EPDC 3W72A 2J7CA 4DEFA 1TZ9A 4MADA 1U2YA 4JKKA 3EUB3 1AJZA 4O15A 3UXIA 1H60A 1M6IA 3ZZ1A 4MFEA 1JZ5A 4J4KA 1RCOB 1EJSC 1UJQA 3PZQA 1W32A 4H4WA 4XAPA 4JTFA 1TPH1 3ARTA 3L0NA 2OKOA 3BZJA 2OLSA 4POCA 3T7VA 1EJRC 3H70A 1UUQA 1KB3A 1THFD 3MVTA 3G5EA 1ZJBA 4K7VA 1QASA 3VO0A 1JF5A 4DI8A 5CPNA 5LIYX 2XYLA 3MT1A 1RJRA 3TN5A 1STZA 3VIJA 4DRSA 3DERA 4JKLA 4DBUA 2QDGA 2OX4A 5D05A 3CZLA 5I7GA 2WOQA 1IEQA 4O54A 4NX0A 3AYSA 4K8GA 2OEKA 4HQVA 5D9PA 3LCLA 5C70A 4WQ6A 4EP8C 3TYAA 3AIUA 1A5BA 4MF4A 3WLKX 1XQLA 1KFLA 1UYQA 4LIIA 2O4QA 1DVJA 1K8XA 3ARVA 4NAEA 4BF5A 3VABA 3TLQA 1E4IA 4DO5A 3PZTA 1OZMA 3NAVA 4QJ4B 2PU0A 4JFUA 4W5ZA 2X8GA 2PP3A 4WY0A 3UETA 2ZUVA 5AB3A 3KBNA 1HVQA 3NIYA 5AZ1A 3L7RA 2W3RA 5ABFA 3HW2A 1W2PA 3DGBA 1DIKA 3DZ1A 5T8GA 2EQ8A 2WHLA 1EJUC 3TX9A 3UYCA 7TAAA 1FHVA 2WSRA 1SU5A 3M07A 4V1XA 3EXRA 4W8AA 3T8QA 4Z08A 4CD6A 4XZNX 3TTOA 5D4YA 1BGAA 4E8DA 1TYTA 1KLZA 3S2LA 1LUCB 3W2LA 4IMAA 4WSKA 5DCDA 2R8WA 1HJXA 4B5XA 1PUDA 3EWWA 3EYPA 3BARA 5C2GA 2FGLA 4Q4PA 3W2MA 2X1TA 2G95A 1RQEA 1R2RA 4PCPA 3Q6JA 5T9BG 4FO4A 3C4UA 2PDHA 4W7WA 1K3UA 3CIVA 1JD7A 3N15A 3U2OA 4CN6A 5AC4A 5CZKA 4DJDC 3G24A 3W7RA 1E5JA 3VINA 5M5DA 2D2OA 3SCNA 3U3HA 3NL5A 3B8UA 3VFLA 4I3GA 2DW7A 5FSEC 1M04A 2E28A 3M7WA 4HD5A 1V0MA 4AEOA 3W22A 1R3TA 3N34A 1IHIA 3KHJA 3FXYA 3GRSA 4H9XA 1I8JA 1CLVA 2GVYA 5DEZA 3IJLA 5D33A 4F79A 1HKMA 1MUMA 2GVGA 4P7OA 1R9XA 3L5AA 1GW9A 1KBIA 1EJXC 1LG1A 1YDNA 3OVPA 4EQRA 3BLIA 4MAVA 3NZQA 3WUFA 5LGXA 3OO2A 1GREA 1FFVC 4M7TA 1GRHA 1GJUA 4H04A 1OFRA 1BTCA 4UFHA 5AHFA 1EXBA 5D38A 1GQJA 1QW9A 3RFAA 4CN1A 4FNPA 3MDWA 1P6WA 3QV7A 1A50A 1J5SA 4AX7A 2WVTA 4QQUA 2BNJA 3IACA 5K2ZA 1XLJA 3WDHA 1RBOB 4JNYA 5EKYA 1BVZA 3CEPA 2DDXA 2VRKA 3M44A 2EPLX 3QR3A 3PS7A 3UCDA 2GQWA 1W9PA 4DLMA 4JN6A 1H51A 2EQ9A 1VF8A 4XO6A 4RNFA 2VFHA 4PCNA 3PPFA 3DEQA 4XAZA 1G7UA 2NX3A 4E2DA 1AD4A 3FGCA 2OYKA 2JGYA 3QOKA 5FACA 1WYGA 2FHCA 4UR8A 3B0UX 3WX7A 4MB5A 3ITVA 1OIFA 2VRQA 4MB4A 3SW6A 4ERIA 1BQCA 3N6QA 3M5XA 1M6JA 3QJAA 4W89A 4FLOA 3URHA 2FZMA 1GG1A 1UQYA 5E6YA 4EM3A 2GVJA 5D32A 2FH8A 4PMDA 3WJXA 1BRLB 4IUGA 1H7OA 4I8YA 2CEQA 2HSAA 1E72M 4WXYA 2NQ5A 4NRSA 5K4ZA 2Q8XA 3B4UA 3MP5A 3CUXA 4FB7A 4PTDA 2I5IA 3CQIA 4EF8A 2EQDA 4GJ1A 3KOXA 1S2AA 5FJJA 5AYIA 4OWGA 1AZ1A 3OA5A 5CLTA 3TNOA 3EDEA 3XISA 1BWLA 3WDRA 2ZQ0A 4NEWA 2PDCA 1KM6A 1OM0A 3BL3A 2DFAA 4UOQA 3ZWSA 3L4YA 4AZIA 1PCWA 4P61A 1LTDA 1QHOA 3GIQA 4NQ1A 1RA5A 1RUSA 1XLAA 2BY3A 3ARUA 4NJGA 1Q6OA 4NI3A 3KL5A 3R8GA 1GJWA 2OLAA 3U48A 4ADWA 5F1UA 1R87A 1S38A 2QYGA 5DANA 4NASA 2R6OA 1XBVA 2HVMA 4MHBA 1GVFA 3BAWA 4PFMA 1F5ZA 2WZEA 1ZCCA 1P0BA 3M7SA 1Q2SA 1FWNA 1TV8A 4L6DA 1FEBA 3W37A 2WP6A 4DZIA 4TQTA 4XK2A 5HOSA 4PMUA 2ICSA 3A4WA 4GKLA 4UTTA 2J7BA 4A2SA 1E9IA 3G0UA 5EMLA 5JQ9A 3RX3A 3IUHA 4ATDA 3NEVA 1I75A 1T0OA 2V5CA 2RDTA 1KTNA 3BLEA 4UCFA 3NVDA 4Q8UA 1EO7A 3QPZA 5EL1A 2BASA 1DJHA 3VIIA 1B9ZA 1KFWA 4WLCA 1VR6A 1WAWA 2CITA 3MUCA 5CAKA 1Z41A 4M52A 4YL2A 2F6KA 3D46A 4HIBA 2XINA 3UG5A 4PR4A 4G8TA 4AZBA 1NQKA 1F8WA 1B3VA 2P3EA 2XGBA 3GXFA 4LSBA 4QLLA 3RR4A 4DF1A 1D8CA 4GX8A 1YPXA 1RVGA 1G4SA 2WSQA 2VTFA 2VEMA 5E0KA 4GBUA 3H4XA 1FCUA 4GK8A 1RHCA 3U2ZA 2C3DA 2Y5SA 2PDKA 2A0NA 2PDYA 1J9YA 3SGGA 3QEZA 1V6UA 4H00A 1MW3A 4Q6XA 4C6FA 3RM4A 3UWEA 3O63A 2JKEA 3KX6A 2ZZ4A 3L2IA 4Q33A 1W1B1 2JK6A 3RN6A 3KM8A 5E9XA 5EBAA 3SBFA 1GZ1A 1PX8A 4PYSA 2Y8UA 4HOXA 1UKOA 1EJWC 2J8TA 1XG3A 1TSIA 1UPPA 4ZVJA 4KQNA 4XG1A 4JEQA 4U4MA 1TKKA 4DELA 4GIEA 4ZFMA 4BS0A 3SSZA 2V3DA 3LPGA 2H9AB 2YPIA 3QC3A 4Q22A 3TWBA 2QJHA 3NYZA 1J6PA 3SCSA 1JL8A 4JNZA 3RCNA 3C6CA 1DXEA 2OU4A 4E3VA 3UPMA 1ZPTA 4N02A 1ZALA 2XGZA 3C61A 1MW0A 1M7JA 1ITCA 2BV9A 1M5WA 3UR2A 1JCLA 2R1NA 2HBXA 4B5WA 4R9XA 1SFSA 1WP6A 3OVQA 3RCYA 4HT3A 4GI4A 1YE6A 1K7EA 4OT7A 3IGXA 4IPLA 3DN5A 3PWIA 4GYJA 1VYSX 3SDOA 3CB8A 1J18A 3P2VA 4Q4QA 4NZ1A 3TNBA 4NL1A 1WO2A 1KV8A 5FESA 2VX7A 3I65A 3V3WA 1G7VA 3BGGA 3WO8A 3GTXA 3IGSA 3RLUA 1VFUA 2JKAA 3N2BA 1B3OA 2A3EA 1M3UA 3MU7A 1XYMA 1AD1A 3N73A 4KESA 1JDFA 2ISVA 2VFEA 3TP4A 1KXHA 5BMWA 4F2BA 3PZOA 4XD5A 5CG7A 1J01A 4IPNB 3MA8A 2P10A 3FN9A 2VQTA 4LUYA 3U7BA 1V3KA 1W5NA 3H24A 4C6CA 2HXTA 1ZZMA 3PTMA 3MCOA 3OVRA 1NDWA 1L6GA 1ICQA 1QI0A 1A3HA 1CENA 2HROA 4JOMA 3UY8A 1EFZA 1UB3A 3QQWA 2D3NA 4C6DA 4JTHA 4DNAA 5AN7A 3B0PA 3ZWTA 3GZ3A 1JULA 3CO4A 3KTCA 5IHRA 2XN2A 2CESA 3N3MA 3QKEA 1OB0A 2HNHA 4D1JA 4CNOA 1UW9A 3SGUA 3ZXWA 3DH7A 4CLMA 1BD0A 2Z2UA 3DKJA 2NW0A 3RG6A 2ZVRA 4XKMA 2DIJA 3B97A 4H01A 4GVFA 4G2DA 1OX6A 1KFEA 3IRSA 1PYFA 3GH4A 3NCOA 2DY3A 3IJ9A 2X0YA 2X8HA 3TXVA 5D9OA 3ARXA 4MPQA 3LNPA 3U5UA 2A3CA 5H8UA 5CBIA 1W3JA 3N9RA 3M47A 4CKQA 1XIDA 1J4EA 1E0TA 2PSNA 4Y90A 4BEQA 1YEYA 2ZZ3A 3EWXA 3WLOA 1NVMA 4J56A 4ZCWA 2YVFA 2BXYA 4Q8PA 1FWSA 3VKAA 3W7IA 2W67A 4NAFA 2O55A 4QE5A 2WM1A 4ZR8A 3LHZA 3TOPA 2VR4A 1C9DA 3KVLA 2QPUA 1BYDA 1RZMA 1SM9A 3HPSA 3GXNA 3G22A 1PZ2A 3MI2A 2E8YA 3NQCA 4GHRA 4KCVA 1HP4A 3E96A 1QATA 2YCEA 2I56A 3FJ6A 3CAWA 4V1YA 2PLCA 3B9EA 5BZAA 2P88A 2I14A 5FS7A 1E6SM 3DYPA 4HYVA 3NQEA 1PHWA 2IW0A 2VM8A 3EMQA 2Z7KA 4S23A 4KH2A 3O05A 2F61A 3VGDA 4O50A 4O18A 1TMQA 5EY5A 2PC4A 3DK8A 4MNLA 3KLLA 2PRHA 4ZQOA 1F74A 2XH0A 1MEIA 3C3UA 1LPFA 3A3XA 4NHVA 4GCAA 2BOFX 3UWYA 4DBSA 5CJMA 4IIFA 1HO1A 4ATWA 5BCAA 3IEBA 3AALA 4GUFA 4YPJA 3SUUA 3RLVA 1FFUC 3G6MA 3OOQA 5M2FX 1O66A 1E5NA 1AUSL 3E0FA 4GYPC 3EAOA 3RPDA 3PB2A 2CLFA 2YDSA 5I02A 4AMCA 5A6BA 2GVEA 1GVQA 3VNDA 2INEA 4F0KA 4X60A 1XLHA 3QZEA 2J62A 2GK1B 2FZNA 1US0A 4C1KA 1KA9F 4RNIA 1PE1A 1QK2A 5GVJA 1YKWA 3WBWA 2UZ9A 4TVUA 2A3AA 1VEMA 4FP1A 2EJ1A 1HL2A 3WDJA 4HA4A 2V82A 3CUFA 1WBHA 4RZ5A 1TJRA 3FK4A 3SY8A 1ZFJA 2BDQA 2DSWA 3EXTA 5DCEA 2FKPA 5EBKA 3QHOA 3KLJA 1VH7A 4FS9A 4U3CA 3E0VA 3WD4A 1V3MA 1S5VA 2WZHA 3UYIA 1V02E 1CYGA 1ZTVA 3I7RA 1B3ZA 3QPEA 2DSUA 1HF6A 1TMHA 2E40A 3W7NA 5LXEA 4Q32A 2D23A 4N9BA 3VDGA 4LF1A 3RYSA 2QZRA 6XIAA 4HOZA 4UTIA 1W1TA 2WPFA 2PRLA 2B7NA 2QJIA 2V3AA 1H2JA 1TG7A 3EDJA 3WK2A 4BEUA 1S2WA 2Q3RA 3ZS4A 3BMXA 1TTPA 3NZPA 1T99A 4YTUA 3CPRA 4KPRA 1PO9A 3W27A 2FHFA 1K7XA 2WWDA 1VQTA 3AC0A 2GJXB 3SADA 2J77A 1EEXA 1XH1A 2BZNA 4JL2A 2QAFA 4LA1A 3NM1A 1XYAA 1LP6A 3BLLA 3S0CA 1UKQA 3H53A 3UG3A 3C8FA 4FR6A 3SUVA 1W5PA 2J7DA 5FL0A 1SW0A 2YCLA 4S3GA 3ABXA 1JYNA 1D8WA 3WH6A 1XSKA 1ZB5A 4NI8A 4PODA 2OMAA 5C9ZA 1LJYA 2E0PA 5SWUA 4LVAA 4XTDA 2UWFA 4LALA 1IEXA 3MUAA 1OGGA 2P0OA 3WD3A 3BW2A 1OT1A 3WH8A 2R24A 4S2CA 1GZJA 3NFUA 3LPFA 1EQPA 3KTSA 2X8CA 2D0HA 3MSRA 2E3ZA 2E6FA 5CGQA 1YXYA 3ZR4A 3ZVHA 3BANA 1FEAA 4ZBCA 2OPJA 2UY4A 4PTXA 5DBTA 1EC8A 3R79A 3THDA 3GC5A 3SCWA 2EG8A 1F3EA 2DH3A 1XLKA 1J11A 5I24A 4HU3A 4A22A 1EWDA 2J24A 1HL9A 3GFYA 3CGBA 5IXEA 3W7PA 2ZC8A 1DIEA 2YCIX 4US5D 2V3GA 3B9DA 2E25A 3CV1A 4PUDA 2OT0A 3VAVA 2YVJA 4LY8A 3UCCA 3FEMA 2Y88A 1JUEA 3UJRA 4AD3A 4JIPA 3AIRA 1H7NA 4JHOA 1RSCA 3SCPA 2GGIA 5CJNA 3NSNA 1M7OA 1H11A 1EHNA 1TQXA 4X63A 1XIIA 1EZ2A 1SJAA 1R6WA 5EFDA 4UFIA 3LMZA 3SCTA 3WCZA 1ZK7A 1IV8A 3GUWA 4JZ5A 3VGEA 2F2HA 2C71A 2V3EA 1GV4A 4F2TA 3SEPA 5C7HA 3WNPA 1ADOA 4DJDA 3AM9A 4NJIA 4L61A 3EOEA 3SIMA 4WR3A 2A1YA 1JYVA 6CGTA 1XD0A 1DWAM 4D6CA 2Z1XA 3VD3A 3UVAA 5LIWX 2W0UA 1GRBA 1DYSA 2VUNA 2Y5EA 4L9YA 3BOFA 3HV8A 3QR0A 4M82A 4GMEA 4R34A 4E4PA 3FHQA 3A3WA 4CU6A 1GSNA 3LU2A 4LUIA 2XHYA 5JCMA 5E5CA 3STEA 4V33A 2V2CA 3GBDA 4LYPA 3CAVA 6REQA 3QKZA 2OQHA 3WQFA 1C7SA 3FSTA 3QQ1A 4UFLA 1RJPA 2VD8A 3B8TA 3KP1A 4HPXA 4H4IA 4MJ2A 3EX2A 3B8SA 4LNCA 2Z24A 4IXHA 5BXTA 2V68A 2IS7A 3H2EA 4MDOA 3KRSA 1UD4A 4NAEB 4BK9A 2PZ0A 4HCLA 2R1LA 2RKXA 3GHSA 4EANA 3H21A 5KZMA 5A8NA 2VQUA 5ABHA 2JALA 4Z2HA 2J6XA 5LNVA 4G56A 1AZ2A 3KRBA 2HPIA 3DK9A 4TU1A 2OGYA 1QU4A 1G0CA 4WY0B 2DZPA 4HPHA 3ITLA 3EA2A 3N04A 1J79A 2BVTA 4RLIA 5ABFB 3LLDA 1JI1A 2OEJA 3IJDA 1JDEA 1A5MC 3RRAA 1PX3A 4O16A 4AISA 1E9ZB 3DFYA 2FZ9A 3W7OA 3AXHA 1LLOA 1XLCA 4MNJA 2GQ9A 5LIUX 2CLHA 2VCCA 3KBJA 2FVKA 1H5VA 3D9XA 1WXJA 2FVLA 4MY9A 1S39A 4ZODA 4JTKA 1LL7A 4DWSD 1QO2A 1GGOA 3V1PA 4DF2A 3D5HA 3CV6A 1EP2A 2D2JA 3BWWA 5FAJA 4AD5A 3B0YA 3SIZA 5IOBA 2XISA 3GTFA 2FGBA 2GJNA 1Z9AA 4CQAA 1GWJA 3SGZA 5LA1A 2QDHA 4KT2A 3WF2A 3GXTA 4LPCA 3UA4A 4JXCA 3QTGA 4N9DA 1IXPA 5C9XA 4GQ0A 1DJZA 1MMFA 4PMQA 1I45A 1Y65A 1I60A 1GOIA 2WC3A 5KVIA 2J7GA 1HJSA 4DM1A 1XBXA 1I0DA 3O9NA 4HNUA 4XSMA 4GY1A 1JRBA 3URQA 3WNLA 6TAAA 1OFAA 2XFFA 5I2UA 3LBMA 4FNSA 1XGEA 4OJYA 1DXLA 4WHBA 3H6OA 3PPHA 1GOWA 3BXWA 2CHNA 2DSZA 4LH8A 2GUBA 2CNCA 1OCJA 4P8WA 1UWTA 4JQ9A 2YJQA 3RPTA 2Z2AA 3DBNA 3USBA 1UASA 4JTEA 4AX6A 2XZ9A 3NWRA 4GI8A 4QG8A 3O06A 3RU8X 4IIHA 2Q02A 1TJ2A 1XUUA 1KRBC 4Z1CA 3M4HA 1JAKA 3V1HA 3DC8A 2XIQA 3UU0A 5K7JA 4YVPA 1OFEA 2CYGA 3EWBX 4O19A 2J47A 4XWUA 3C0SA 2E09A 2DP3A 1JIBA 3AHTA 3CUGA 1SMDA 3IAQA 3B8DA 3FGCB 3WZ0E 5FEWA 3ORWA 2WSYA 1XLDA 3ZMRA 3ZLFA 3GTIA 3FFSA 1W3LA 1LQ2A 3DHDA 4IPJA 3P5ZA 1IIHA 3M64A 2CPUA 1HG3A 3WEOA 1JFXA 4FF7A 1AOGA 2OTDA 3OPSA 2A3LA 3W1LA 2GDUA 5DY3A 3DHPA 2QXWA 4XO7A 1JCJA 1UUOA 4NRRA 2YKKA 3L12A 3M0XA 4WXZA 1XLMA 3R58A 4LXFA 4MIMA 1MNSA 4GZEA 4DQWA 5EMJA 1VFMA 1CEOA 1I2PA 4C6EA 1KFBA 2C0AA 3NS1B 1XXXA 3OYZA 5AHEA 2W3SA 1UD5A 3FA4A 1CGWA 3UR5A 1YXCA 5A2CA 3H26A 3TQPA 3GR7A 1NY1A 4PRTA 5BNKA 4H4QA 3Q4DA 4Z2LA 3IIZA 3AIWA 4L80A 4KBXA 2HWGA 1FWFC 2EXOA 1LF1A 3TYEA 3NSXA 3GB6A 3W28A 4L4MA 1T7LA 1P7TA 2XIMA 3DFSA 4LB3A 5AFDA 3PJTA 4MUZA 5HNNA 3HGSA 1ADDA 3HB9A 4B91A 1XINA 1VDVA 1KKRA 4JTQA 2GUYA 5JBFA 1UWQA 4K7ZA 4L1GA 1PAMA 1RK6A 3S46A 2WCAA 1OBAA 5FEXA 4DZ5A 5MHBA 1K7FA 4CVUA 1YXDA 3GR8A 2QV5A 2JBMA 4O8RA 1DNCA 3QY7A 1GONA 3ITYA 6ENLA 1DTNA 5AC7A 4LAZA 4FA3A 1KM5A 2CHRA 4LEFA 4MFDA 4MG4A 1PCKA 2ZE3A 1VCVA 2GSJA 3F2BA 3QV9A 3WKZA 4TX8A 2YXOA 1Z32X 2IPFA 3TJLA 4M5PA 4NX5A 4FIQA 4R53A 4ICMA 1UKPA 1QCWA 3LENA 4GY7A 1S2TA 4XZBA 3AWNA 3NNTA 1AQFA 4PA8A 1DJWA 1TPC1 1WZKA 3GG0A 3CYJA 3TR2A 1QPNA 1GYNA 3W6LA 5DO8A 4S3EA 1NTHA 1K8YA 3PZUA 3QM3A 3PWGA 4CVWA 7CGTA 1A3XA 5F1VA 4HSOA 2F5ZA 3ZM8A 4IGNA 6XIMA 5XIMA 3R8RA 3RMEA 4S3KA 4F66A 4M19A 1NPXA 2NV9A 4HK6A 1C90A 4QR6A 2X30A 5EMUA 1BSLA 3MYOA 3JU2A 3N2XA 2J3NA 4J28A 3WD1A 4H2HA 1B90A 3A7AA 1UWUA 4REQA 2OR2A 1ONWA 4R85A 3ARPA 5FAGA 2CLLA 2ATSA 1UR1A 3QOMA 1UA3A 1POJA 4LS1A 1IEVA 5AYYA 2OB3A 4HP5A 5H8MA 2F84A 4BI5A 1C8YA 3CZJA 1ZX9A 2YXXA 5E1QA 3E1F1 3E9AA 1MWOA 4M29A 3O0KA 2NQLA 2WMFA 3O15A 1TV4A 1TWZA 2ZADA 4UWMA 2I16A 3UWZA 4XAGA 2R91A 5DF0A 4D6FA 1JEZA 1XCXA 1W3TA 1UC4A 2VD9A 4DUXA 3EOSA 1L2UA 2VEFA 4GFIA 3ICJA 1XYCA 3PUEA 2YA2A 1JDDA 3E74A 3MKCA 1JQVA 2I5QA 3GWQA 1UR8A 2VJXA 1K9TA 3LYEA 3L65A 4S3FA 4PC8A 1BLIA 1GK8A 1LORA 3U9IA 5C9RA 2CZFA 1D7FA 3KZPA 4JDBA 4L9XA 3GRIA 3BQ6A 3CL8A 4M0XA 4HCDA 1M65A 3IVSA 2Y63A 3QYQA 4JCLA 2DSVA 2P8CA 4M1BA 1VCGA 3ES7A 2OFJA 3ABOA 1VIWA 1XG4A 2QT3A 1GHSA 3S5YA 2ZZBA 3RHGA 4IMCA 1XDMA 4NZ3A 5D03A 1RCQA 3FX4A 1DJXA 2UV8G 3EGJA 3GTNA 1V08A 4GBDA 1UH3A 4RXFA 3KRZA 2E4TA 3DESA 3WF0A 3GTHA 3N13A 2E8ZA 2CWXA 3PZMA 4AZ6A 3WQOA 2BC1A 3GDKA 3MZNA 1KRCC 3RRXA 4C65A 3PSVA 1MZRA 1AL8A 4LB4A 1V8EA 1GTEA 1D3CA 3NO1A 2DGAA 1PPIA 2D0FA 4MWAD 4IUOA 1BWKA 4J1OA 4GYPA 4MMWA 3VNIA 3W75A 5CPLA 4EPKA 3TVAA 3P80A 3PUDA 3PN8A 3BAIA 5DRIA 3NDYA 2R1PA 3L21A 1Q1WA 4FXJA 4NZCA 1NU5A 3LCWA 4KRTA 4DBWA 3VGBA 1DOSA 1Z3NA 2I9UA 3SY1A 3E02A 2ZZ1A 4GWEA 2W66A 1FIQB 4Z0SA 2UY5A 1XH0A 3RM9A 2JEPA 3UZXA 2X7VA 1OABA 2E9LA 3VOIA 4ZTYA 1VQZA 1IEWA 3WMSA 2HK1A 5D2XA 3PZNA 4Q8TA 5FJIA 3NVWB 1IT0A 1MRQA 3A7RA 4QG9A 5DELA 3WQDA 2QJGA 4QEHA 4DAFA 5M3WA 2V5DA 4HPGA 2W61A 2VRJA 3W07A 5KITA 3LPOA 3RU6A 3AS1A 4LV4A 2C3ZA 1I6NA 3SQPA 1BGGA 3I4KA 1J0IA 4FR1A 1N62C 1KBBA 4D1IA 1GYLA 2AKZA 4CD4A 3LMYA 3T0AA 5E6ZA 1DQWA 4F2UA 1BG4A 3EKGA 4GNVA 1UMYA 3DK4A 2PDFA 3GY1A 4Q7IA 2GQ3A 4NAFB 4NU7A 2NUWA 3LNMA 5BRBA 2ZFAA 1ZHAA 2DV0A 4DLFA 3NL3A 2XFYA 3MV11 2EKCA 1VHNA 4QXIA 4H7CA 3G6LA 4JPGA 4DY1A 1R2SA 2C15A 1FP8A 2Y1HA 2C7FA 4UTLA 2Z1BA 1VC4A 3HU7A 3W71A 2V6AA 2Z27A 4D9PA 1XSIA 4OQVA 4ZQMA 4LC8A 1AQMA 2JQXA 1Q65A 1WYIA 3P84A 2QGHA 4RV3A 2QUNA 4WZHA 2VCAA 3DI0A 2YA1A 2ASHA 2PTYA 3OQ8A 4EIVA 3AIBA 2WM0A 4E2VA 4MZ8A 4GIAA 2YX0A 3H2FA 3DFQA 3ABSA 3HV9A 2IKIA 3OGSA 3CHCA 1H7XA 3STPA 4EVZA 1FHDA 1QPKA 2J9YA 2RUSA 3PBGA 1XLLA 2DQXA 3PWAA 1ZU8A 5U1OA 1S1RA 5HNRA 3WF4A 4F9DA 3LSCA 3RPMA 1GKPA 4PE8A 5C9WA 4NZJA 3CMGA 3DHFA 5A6MA 4JDYA 1ZQ5A 3OTRA 4J5NA 3QGAC 2PWEA 1MRAA 3R7MA 4B9ZA 1K4HA 3CUJA 1GNXA 3BW4A 3EB3A 2PDXA 2Y61A 4JCMA 4I8DA 4RR4A 1FVPA 2YCKX 3STGA 4X0VA 4EM4A 2G96A 2GZXA 5U4NA 3CMJA 1ZUAX 3EDFA 4FAMA 2POTA 4V2XA 4PB4A 4XZMX 3TROA 1FWRA 1OF6A 4ENLA 3GNRA 3FG2P 2FZBA 1CGVA 3QMTA 4QM1A 1OK6A 4H8VA 3VIPA 3LTPA 3SCOA 4CEUC 1UIPA 1R46A 3LPPA 4YCOA 1X39A 4W88A 1XH2A 1VFFA 1W31A 1C29A 3A22A 5JIPA 2VGBA 2SFPA 3NSMA 3W7GA 3RUBL 3E2VA 3WQEA 1U30A 4IM4A 4S38A 1MVYA 1DORA 1WDRA 3PZIA 4LRTA 3EF6A 3W6YA 3BGJA 1RPXA 3VKBA 2G3JA 2W27A 1VBJA 2Y7EA 4NSBA 4HVXA 1UR2A 4Z2GA 4H9TA 4B15A 3HN3A 2DUAA 2W54A 3H55A 4IG2A 4HPNA 1W9BM 2D69A 2OOGA 3LHTA 4GA8A 3QLLA 4X0NA 4K8DA 1A4MA 1EA0A 3SCQA 4TX6A 3UG4A 2ZUMA 2W9MA 1N5WC 3NOYA 2VKZG 1NARA 2L5HA 4XBSA 4UB9A 3TJXA 4JIHA 4FMVA 2ZRUA 5LIKX 2X2GA 2AQVA 2DEPA 1GVIA 5T91A 4PUKA 2ODOA 1KM4A 5TQLA 5XIAA 4L9ZA 4PUMA 2XFRA 4JYEA 4AB4A 2YCLB 3C0JA 4D6GA 2J9ZA 4LCSA 3W7HA 3LDVA 1Q6QA 3T0BA 2FB3A 3HJEA 2DU2A 1KWGA 4C6JA 1F3PA 1TCMA 4E4FA 3K30A 2XVPA 5GNXA 1GVRA 3MMDA 1ALDA 2V5KA 3UFYA 3JR2A 4IPPA 4I5XA 3QHMA 5B7ZA 2V63A 3RITA 3STFA 2PU1A 3VNJA 3ZIZA 3R11A 4WF7A 4DXKA 2WJFA 4DIAA 1KGWA 2OX1A 4HNLA 5LNWA 1Q6EA 1XR2A 4MYAA 2TMDA 1W8GA 4O1CA 3LBOA 5FJUA 4ZL1A 2Z2BA 4K8HA 3GVQA 3ZVHB 1CX9A 2I17A 5LNUA 3H23A 3PTKA 1LOQA 4P7LA 4GUGA 5ENLA 3AS0A 4B3LA 3UR7A 5I77A 3DJGX 4E3TA 2GOUA 3AHYA 1M41A 1VFLA 3UW6A 1CDGA 7PTDA 2XSBA 4JN7A 2ZUNA 1X8FA 3NQ6A 4KIRA 4LS2A 3I7QA 4DYJA 4CD5A 1RQHA 2MNRA 1W9DM 2PTXA 3FYPA 3P7YA 1SQ7A 1P0DA 2HISA 1YE4A 5FD0A 2PDGA 1UPMB 4R27A 2WLYA 4PEEA 2C8NA 4BI7A 3VYLA 3FCPA 1MXDA 3H4KA 4IGMA 1PL9A 5DN1A 4GNJA 4JY9A 1YYAA 4B2DD 4KETA 2AMGA 3U6WA 1BG9A 3ZJ8A 4L5ZA 3CUHA 3PJXA 3BJFA 3I68A 4PEKA 1TVLA 4TX9A 4FEZA 5AKQA 4KKXA 1VRXA 4JYDA 3AMKA 1SFTA 3LG3A 4MPKA 1UKSA 2PURA 3C2VA 4P7RA 5B80A 2Y4SA 3NA8A 1OCNA 4PN2A 4YTQA 3LHWA 2XPKA 3O6DA 5A8GA 3U0HA 3KWXA 5HJLA 2PRMA 1F4AA 3MHUA 4WOZA 1W2VA 2R82A 4LV9A 4LVBA 3BCFA 2NX1A 1J0YA 6REQB 4P7NA 4I6KA 2PD9A 2CXEA 2ONEA 2VZOA 4TVYA 3BG5A 2FZ8A 4FSAA 3NL6A 1SO4A 1Z8AA 4HNOA 5FIPA 4O1FA 3SCUA 1Q7QA 4HTYA 3REQA 3W1XA 3WFAA 1K70A 1Z44A 3MY9A 1WDWA 4W8LA 4XV0A 4GXPA 3T4WA 1XS2A 4MB1A 2WVUA 4FI4A 3OG2A 1ZBWA 3DC0A 3E2QA 4NYYA 3AROA 3PTQA 3ZT5A 4IQDA 2NLYA 1H7PA 4JDRA 5LIXX 3S42A 3PPGA 2I1OA 4RNHA 4EK7A 2OGJA 1E6XM 3TN6A 4KWVA 1DPMA 3E38A 1AFSA 4MKSA 4CQDA 4AUBA 4CNTA 5HWMA 1OYCA 3CM4A 3S8HA 2WC7A 2GLKA 2D20A 5HWJA 4JTLA 1U5JA 1FWBC 4GIYA 3EEZA 4HGXA 2DH2A 3ABZA 5K9XA 1NDYA 1PWMA 4FNTA 4XBJA 1CB7B 2C16A 2QULA 4IP5A 4X22A 3P6LA 1JXKA 1R8LA 2OWXA 3BC9A 4ORIA 3WLQA 2EBNA 3WQPA 4EOUA 1HKWA 1J12A 4HU0A 4EMIA 1RALA 4O13A 1NIUA 3MV01 1WDQA 5FCZA 2Y89A 4AXKA 4GG9A 4H19A 3B40A 5IDIA 4EKJA 2W92A 2ZX5A 4F8XA 1YRRA 2O56A 2BSLA 3R0UA 3CB3A 5CC5A 4DJED 2WHKA 2QQ6A 3TTQA 3W38A 3WUBA 3O6YX 1NDZA 1OT2A 2NPXA 3O6CA 2PWDA 4K39A 4KCWA 3QFEA 5GJMA 1AW2A 3LGEA 4JTRA 1TV5A 3MI6A 2NSXA 4QCEA 1POKA 1A0DA 2F38A 3OHIA 1V3JA 1CGYA 1UP0A 4C5YA 1OHLA 1S3HA 3BMWA 4WEVX 1OFPA 1JUKA 4OVXA 3H4WA 2WANA 3DYMA 2ZXQA 1J0JA 2JEQA 1OJXA 3I6EA 3W7MA 3TW7A 1JEHA 1EF3A 3E0WA 5G5HB 2J7FA 3WMCA 2RHGA 4G7EA 3WJYA 3FV9A 7A3HA 1TFVA 2G3NA 2DSKA 2YDQA 2DVUA 2P50A 1VFTA 3H4GA 1X38A 1V02A 3PZGA 2WXDM 1TTQA 1UD8A 4HNTA 3NZRA 3BSMA 3LQLA 1OC7A 3K46A 3PBUA 1E6RA 1X7FA 2ON3A 4RW3A 5A2AA 3PZVA 2HEJA 2R14A 4LX4A 4Z17A 2CZEA 3DCPA 1LWJA 3C86A 3M0KA 2XGIA 4AIBA 1XGZA 2Q01A 3VZZA 1QR7A 1ITQA 1EC7A 1J2BA 3T6CA 5CXPA 1NHPA 3CQKA 4JTUA 4C6IA 4HN8A 4KCUA 2IPWA 1IQ8A 1SO5A 1V4YA 3ANVA 3P82A 8A3HA 4BURA 1VLWA 3TC3A 1EOMA 1TREA 1HJWA 3QH2A 3V0UA 1NWRA 3ZFHA 1C92A 2ZYFA 3SO7A 1S5NA 1YBQA 1JYXA 3LZ5A 3DYOA 1FA2A 1OX4B 1PDYA 5EBUA 1JRCA 1PXGA 3ID7A 3W87A 2Q71A 3UP8A 4Z1DA 2QIWA 3GXDA 2CXGA 3I10A 2IUZA 4UQCA 3GDBA 4GI9A 1WZMA 4GYKA 3SN4A 2WJDA 4RUBA 2BVYA 1QNVA 3STCA 1JJKA 3K5XA 5LGZA 4Y9OA 3EX1A 3F5JA 1HTIA 4GH1A 4G5DA 3SAZA 2EF9A 4JIIX 3FDGA 1J5TA 2HCVA 3T4CA 3ME3A 1UBSA 1A5LC 1SSDA 3TC6A 3NRZB 2C0HA 3LCHA 1JCNA 4DYKA 1V79A 2UY3A 3TDFA 2VC7A 2JFEX 2VMFA 4C6KA 4H4PA 3W1UA 1XC6A 1H0IA 3QPYA 2RGMA 3A6OA 3CV2A 4GQQA 2X1RA 4IHCA 4FOUA 1K9FA 2GQ8A 1AVAA 2FTPA 5HULA 5CQ1A 4YWIA 1VD6A 3T40A 1NOFA 4WOQA 1P7TB 2WKLA 1ZAIA 2ZXBA 4UFKA 4P8XA 3T8LA 2QCFA 1N8IA 2HBVA 2BFGA 4AQLA 5D30A 1JPDX 3C2EA 2QHAA 2VI0A 4NILA 2CWNA 4IFRA 5AYBA 1CECA 2W91A 3TN3A 4PTVA 2Z6JA 3LXDA 3RNDA 1HKJA 4ASTA 1ZDLA 3II4A 4V27A 2WP5A 4HTBA 4JIEA 3AJXA 4M24A 3WQ5A 1GETA 5ABTA 2XM2A 3PG6A 3PTDA 3GX9A 3NQBA 3QZAA 2J74A 1W1ZA 5A8MA 4BWLC 3I3DA 4B16A 3N6JA 1E40A 4FLSA 1UA7A 3AISA 3HOJA 1BF6A 3FSUA 3PG9A 3AMLA 2XVLA 2A5HA 4UTUA 1YPFA 1H61A 4LYKA 1TPWA 3FAWA 4AC1X 2X50A 4U2YA 1HO4A 1E1FA 2VX6A 4N2YA 3URBA 1K4QA 1BXBA 1IR1A 4YHGA 1V6TA 4C7DA 4CCEA 4A29A 2XU2A 1R3SA 4PUEA 3F2DA 3G1AA 4IL0A 2IQDA 1QOXA 1G94A 1L6YA 1YTDA 3DHUA 5KZ6A 1QAPA 2WBKA 2VELA 3TQVA 1FFQA 3RX4A 2WKGA 3QHNA 2CKRA 4AIEA 4C6NA 4UOZA 2YQUA 3GNXA 3W25A 3L4VA 1R9YA 1ZAJA 1BEUA 1KRAC 4CNUA 3ITCA 1F2JA 4US6A 1UD6A 4M81A 3GYEA 1B3YA 5JCNA 3BOXA 1YW1A 4REQB 1VJZA 3L2MA 1IXQA 2QCDA 2XWEA 3CQJA 2XUCA 2R9ZA 5EMMA 4YNGA 3SFKA 4LTSA 1JRPA 4EAMA 3KP0A 4A8RA 2VFDA 3LTYA 4FOKA 4F0MA 1ZY8A 1BXNA 3QY6A 4EQXA 3L4TA 4TV5A 3VUPA 1LZOA 3DFNA 3LM3A 4TIMA 4A05A 1QI2A 1R3VA 3W23A 4BQ3A 3CAKA 4QX4A 3LLXA 2XM1A 4X2RA 4C5ZA 4IMFA 2QCCA 3MB9A 1E1EA 4HOWA 4JX4A 2HZGA 3CWOX 3KLKA 1E6ZA 2QJJA 3LADA 3IJ8A 2QKFA 2NSOA 4AY7A 4YWSA 4L4LA 3PP7A 1S7MA 5FA5A 3DKLA 4RW5A 3QV6A 1R7AA 2XH7A 3DFTA 4L1WA 2YB4A 4GZIA 5GPRA 3UXLA 4EWND 1FHLA 2WSPA 1SW7A 4WGXA 4NG3A 1A0EA 3UBPC 4ZXOA 1UMLA 4A3UA 3NL2A 3TCEA 1BYCA 2TYSA 2Y5JA 3E5PA 3UJ2A 3TLLA 5JBEA 1VBGA 3P67A 2GJRA 3V5OA 1NWUA 1Y8BA 3AWOA 3RX2A 4FX9A 4MDPA 1E9YB 4R5EA 3PHAA 2HQMA 3R94A 1QI5A 2AQOA 4DHGA 1GRAA 5CPMA 5CEWA 3TQKA 1X1ZA 2OT1A 2JIEA 1O6IA 1D3GA 2PF0A 4QLJA 1ZLPA 3KS5A 3N6HA 4E6MA 1HW6A 5MKGA 3GBEA 4N6EA 4KFPA 1GOXA 1ZRQA 3GXMA 1VAHA 1QNSA 4KFNA 3T05A 1IXNA 2QVNA 3W29A 1LDCA 3CNYA 5C71A 3BAYA 3BE7A 2INFA 3HJZA 2DUZA 1DQXA 4TV6A 3NGJA 2PDJA 3VDCA 4A3QA 4B9YA 1UKTA 1J2WA 1HJVA 1ISWA 4UFJA 3NZ1A 5AVNA 4HNVA 3TK7A 2H8ZA 9CGTA 5HR6A 2DT2A 3HF3A 1CXKA 4KPLA 3L66A 1Q5MA 2PUZA 4C6OA 3BK0A 4IICA 3WQGA 3SECA 4YMZA 3N2MA 4CN4A 2A6LA 3MC5A 1FWGC 1OINA 5E70A 5D2WA 4A35A 5H2ZA 2YA0A 3WNOA 1EXPA 1LWHA 3UWWA 4OOZA 4DNMA 3WDPP 3UA3A 3AHVA 1AW5A 4W9TA 5REQA 3QF0A 1OZQA 3BCDA 3ITGA 1X98A 3MKKA 5HPCA 3A21A 3BICA 1B5TA 1TZZA 3AN1A 2YLAA 3M0VA 4S3JA 1C91A 5BXSA 2OWWA 1H63A 4MY1A 1CGUA 4NP7A 4HMNA 1TV7A 3COTA 1QOQA 1DTUA 3IRDA 4GGBA 4QE4A 3POHA 3TAKA 2WVVA 4DAIA 1WDSA 3BCJA 3TWAA 4BA0A 3TFCA 1M01A 3W74A 4XKYA 2W6RA 4UBPC 4LT9A 2CZ5A 1FCBA 1YDOA 3NVZB 5EU9A 1G67A 2O9OA 4MGGA 2GR1A 2NVDA 2VENA 1L6WA 3R6IA 3DX5A 1B3WA 1UR3M 4PBFA 2OXNA 2J25A 1RQBA 4JQ4A 4EXAA 1HQTA 2V6OA 1DIDA 5ECUA 1EOKA 2W55A 1EEPA 4EAYA 4AWTA 1Q2RA 2A21A 3H8AA 4BR1A 1H7WA 1YADA 4JFVA 1LLZA 2W4XA 3T07A 4ZQCA 1Q6RA 3QLDA 3EX6A 1CLKA 1YNPA 2WW5A 4KEMA 2QDDA 4W84A 4O17A 3FIGA 3K4DA 3GZAA 2BHZA 3W3OA 3LHUA 4LWWA 4O1AA 3S47A 4DJFD 4TVCA 1NP2A 1KQZA 1JZ4A 2WZIA 3C0LA 2FH6A 4D6JA 5AC5A 5FMHA 5U25A 3H7UA 1R47A 3C0QA 1GVYA 3N9KA 2QR6A 2EQ6A 4YHEA 1SPQA 1DWFM 2YZRA 3WSUA 1BWVA 3TSMA 2FPYA 3WJWA 5LXXA 5HMEA 2BGQA 3HPZA 3KCJA 4GE8A 1OD8A 1VB9A 3TAOA 1OWQA 2J9XA 3KWSA 3CT2A 1Y5WA 3U8GA 3ARRA 2CCRA 1C8VA 2ALRA 1G1YA 4U33A 4ZQPA 4AY1A 2DQWA 4GH3A 2QAPA 4GZ7A 2FJKA 2RJHA 4QDWA 3CPGA 3P74A 3V36A 1DQUA 1I2NA 4RPQA 4LYQA 2WQDA 4PMZA 4O53A 4DUVA 1HKIA 3SUWA 3L5LA 2A3HA 5CKSA 2WJZA 3DAQA 3QYSA 3G1HA 4J35A 4WCJA 4EACA 3M6YA 2IPJA 1LBLA 3VD4A 3F5KA 1W1YA 3S5SA 2IQ0A 3WENA 1NJJA 4J3VA 3RCMA 3L4UA 2YL9A 1XWYA 4GNKB 1OIMA 2A7PA 3ITOA 1V6VA 3PY2A 4IG2B 4ZE4A 1HIZA 7TIMA 2YYTA 1J0KA 1VRDA 3WNNA 5FF3A 1BF2A 1PKMA 1I2OA 3KXQA 1XLBA 3H7RA 3ARQA 1PIFA 3LOTA 1DE5A 3FKKA 2PE4A 4W5UA 4XTIA 1MZHA 4YLWA 4MJMA 3W86A 3T44A 4CNNA 2A6NA 3GHUA 4HPJA 1AL7A 1EIXA 4X3ZA 3CASA 1FH7A 1XV8A 3B03A 3IK4A 3SN1A 4LUTA 2DIEA 3RDKA 1JD9A 4ZFCA 1NF7A 1R2TA 3SRDA 2WMJA 3O6AA 1E3ZA 4U31A 4PUJA 1D7YA 1ZP4A 3II1A 1UZHA 4PB5A 4AD4A 5JBDA 3EOOA 3VX0A 2NT0A 2B4GA 3WD0A 3OJGA 3U7VA 1ICPA 3DFHA 4AVFA 2PPGA 4TO8A 3P62A 3SZ8A 3IC9A 1SVDA 1F3TA 4IX0A 3BOLA 4RXGA 2C3CA 3WL1A 3HO8A 4A3RA 4O4VA 3QQ0A 1DJNA 2PTZA 3WG6A 2QPXA 3R10A 3MMUA 4GISA 4Q7NA 2D22A 4KCTA 1CXEA 3TSDA 2PTWA 2OLHA 2NUXA 2VGIA 1M1BA 1RBLA 3GD6A 3W7DA 4AVOA 1XPYA 4AZGA 1TX2A 3E12A 2FFIA 2WBAA 2PA6A 3EXSA 3MANA 2QJMA 4ADTA 5CSYA 4ZXLA 3BG9A 1TPEA 3W0KA 2HDJA 4UNLA 4WVXA 4DZHA 3N2TA 3T55A 1W6TA 4K2SA 5I3KA 5K9DA 3WLNA 3CZKA 4R7JA 4S1FA 5CC3A 4NEVA 4NNAA 3DGHA 3GK0A 4B5TA 1OSEA 4HZ7A 1EPVA 3BAJA 1B31A 5CSSA 1L6SA 1A5UA 1W1VA 4ERGA 3WFZA 4EXQA 3VM7A 1HNYA 2VVSA 3VCNA 1CXLA 2YIHA 3LK6A 3AJ7A 4AHOA 2AKMA 3A3HA 1RY8A 4YIWA 1JNDA 1EPXA 2Z7GA 2GDQA 1C8XA 3OZPA 4GINA 4ZO9A 1UP3A 1NDAA 3BLKA 2WO5A 2AQWA 3TJIA 1Z7AA 3VD7A 2P1FA 1H62A 1V5XA 2D1ZA 1M68A 1V3IA 2EHHA 4WIWA 5AOUA 3REQB 5HDRA 3VKKA 3M9YA 3QR1A 4PMXA 3RMJA 1TPVA 4LVDA 3GDLA 4JNMA 1FY6A 4M56A 4C1NA 4MM1A 3V7PA 5J5DA 4XZHA 2XTKA 1IT8A 3CGEA 4OE7A 3WLJA 3DI1A 1O5RA 1J0ZA 5I00A 4XD3A 3KHDA 3HMCA 4IF2A 5CAHA 3NR0A 4PL1A 4NYUA 1WUFA 4Z2JA 1FXQA 1AMYA 4EXBA 1O5KA 3W6MA 4W7VA 5FS6A 3VIMA 1XKYA 2D2HA 2V8ZA 4WDWA 2H3BA 4E0CA 2OVLA 1GERA 1D9EA 1TJ0A 1XKJA 1LT7A 4I7UA 3W81A 3PUOA 2V38A 3TA6A 5FF2A 2H6RA 4PMNA 3ZSSA 1F8IA 1JNEA 3FW6A 1HP5A 2TSYA 1L0PA 3PAOA 3MSGA 2Z1WA 2PDNA 4JFTA 2O92A 4JAWA 3W84A 4K1WA 5C0QA 4MWAE 4MZ1A 3UPBA 3S2MA 3QZ6A 4QEEA 1TQJA 1CWYA 4IH3A 4O0KA 2V3FA 2G3IA 4J2PA 5H6HA 3HGJA 3NOEA 3H12A 1T96A 1CT5A 3NQGA 4Q4KA 3BPWA 3IIVA 1K8ZA 4RZ6A 1DXFA 2VYOA 1WZAA 3GAYA 2VFIA 5AHIA 5M03A 3IIXA 2P0IA 3NDOA 3KZSA 3BZGA 3PSWA 4TOQA 4R7WA 3OYXA 3C3NA 3CHDA 5BXRA 4I9AA 3R25A 1GOQA 2ZRZA 4GO9A 4Z0JA 1PIGA 2J8FA 1PB0A 1K9DA 1MSSA 5D8ZA 4PMOA 2WC4A 1GQIA 5HNUA 3GG8A 1GQKA 3G0SA 1AG1O 2REQA 2ZXAA 4UR9A 2BVWA 2QUUA 3CHFA 4G7EB 3F7JA 2XVNA 4GVHA 5CLWA 4OFCA 2WK2A 5EB8A 2WNQA 2CFFA 4JTGA 1YNQA 3FAXA 1TPUA 4J3TA 3ANYA 1H2IA 4DXXA 1XIEA 3EA3A 4QIUA 3F1QA 3VTRA 1A5CA 5MF5A 2OG9A 3P81A 2FJUB 4DWSC 5I06A 3IJQA 3MYPA 3EKZA 1Q3NA 4G1KA 1PHQA 4RDWA 1P1XA 4J9JA 1P0KA 2YL8A 1YDYA 4GOAA 5CGTA 2BLEA 4BF7A 5I03A 3S6TA 1W5MA 2RAGA 4ROQA 2BGNE 4PCTA 1DJIA 2XSXA 5I23A 1EBGA 3CMFA 1UH4A 3EAUA 2PEVA 2C14A 1YLVA 2WCGA 1RAKA 4BWLA 4RCXA 3WD2A 2CETA 1QUMA 2WNZA 1TJPA 2ZUWA 3LXAA 4DF0A 1IE7C 1KBLA 2HJPA 3NDZA 2HK0A 1GOMA 2E67A 5GJPA 3H54A 1JCYA 4HZ8A 4HBKA 3K4AA 3W2UA 3V5FA 3GC2A 1YBQB 1HFBA 4H8UA 3LHYA 4UZUA 1CPUA 1HJUA 2ACQA 2PWHA 2XH4A 4N7QA 5A95A 2X1IA 4B4HA 1SZGA 3FLUA 3L0GA 3H7VA 1GCYA 5F4SA 1T41A 5A6SA 2GR2A 1W1A1 1LBMA 3FJ4A 4XB3A 4B5VA 1PIIA 4FF5A 1UWAA 3PFMA 5FJRA 5LZLA 3QFBA 1UR9A 3IGUA 1KCLA 4UC5A 4HN4A 3S5NA 4C60A 1KTCA 1G6CA 1FWDC 1XX1A 3AMDA 2PP1A 5XINA 1GRFA 3AZSA 2CZVA 3G8RA 1XLFA 1TCDA 1OG0A 4DO6A 3W2JA 3WH5A 1RA0A 4GZJA 4GQRA 4HA3A 3UESA 1NFGA 2VZSA 4IISA 3W1RA 4F0LA 5IRPA 8XIAA 2PCEA 4NT0A 1W3NA 4OU1A 4LCQA 5BXPA 1C3FA 3K13A 3WK1A 1YQZA 4K38A 1M7PA 2JE8A 3WEMA 3LQGA 3LHVA 2FYMA 5CG0A 4URIA 1H1YA 4PMJA 1JPHA 1NFBA 1UZ4A 4V15A 2XWDA 3ZO9A 1P4CA 3HA1A 3BO9A 4X2PA 5G1MA 2VVNA 3MSDA 2G0WA 2PGFA 3MVIA 1JROA 2OQYA 4UXDA 4JHMA 4XBKA 4H6KA 1EYEA 3K8KA 3G1YA 2YXGA 1KO0A 4KWUA 1EJTC 3BV7A 4UOJA 4M6VA 3G3DA 1FOBA 1MFVA 3R5EA 3V0TA 2NQHA 4PSRA 4C6PA 1EKOA 4A3YA 4DUWA 2PP0A 2VOTA 2X1UA 2V5LA 3AMCA 1JI2A 1XM3A 5DX7A 5C2XA 1UG6A 3SQMA 3BQ5A 4AF0A 5A8PA 1EA9C 3CUIA 1ISYA 4O0ZA 2E77A 5DRCA 5LNSA 2DJXA 3MP4A 3VX1A 3L68A 3ARSA 3EWCA 1X6NA 3WLPA 2A3BA 4DXVA 3GYCA 2Y24A 4QGCA 3B0VC 1KXVA 2VR2A 2Y7DA 1QOPA 3A9BA 2C91A 3TYUA 1V3LA 2QIIA 1DV7A 1MXGA 2WV8A 4JYFA 4QDPA 1QHPA 3I6RA 4P5UA 3KVJA 2E5DA 3TXZA 4YCPA 3C5QA 4UIOA 2YBVA 1EHAA 4GKTA 2B7OA 1H50A 1VPXA 3A47A 1E3XA 4QAWA 3V4BA 1EJ7L 5CPSA 2V67A 3FOKA 4O14A 5TBOA 4AAJA 1KQYA 2QCDB 3TFXA 3OP2A 1SUXA 2BC0A 3VNZA 2WHJA 1HUVA 1I0BA 4PMYA 4TUFA 3MUZ1 5IBXC 1XRSA 3N2CA 1VYRA 4IP4A 2PODA 3A9IA 3ALFA 4UMAA 1MQQA 4N9CA 3WF1A 5H8PA 3GFZA 5A6KA 2G41A 3CGTA 3L9CA 4H83A 1UQZA 3I7SA 3CK5A 2WOVA 3FA5A 3JZUA 2PGEA 3WQVA 3NQ2A 2EPKX 4MLRA 5FKYA 4ZO6A 1ISXA 2DZTA 1JZ2A 4FALA 3UZYA 2PDBA 3W7KA 3TYDA 4ICCX 1HX0A 3AUJA 2NVKX 2WHMA 3OBEA 4IFOA 4PBGA 1BKHA 2PB1A 4QITA 4WJXA 1U1UA 2YYUA 4GVGA 1MDRA 2WOIA 4S3BA 3E2SA 1WZLA 3MCNA 4YJ5A 2EPHA 2PDLA 3B8WA 4ZE5A 4A4AA 3WLLA 1W5QA 1WUEA 2DPEA 1EO5A 3AS2A 3PBYA 1EGMA 3GRTA 2RH9A 5D9MA 1QT1A 3VM5A 5LHEA 5HQEA 4NZ4A 2BXVA 5DY2A 2X41A 4W4QA 1V6YA 2BS9A 3KCLA 1E55A 4WKFA 4L7ZA 4NY2A 3A13A 3HFYA 3SJNA 3QMSA 1XBZA 1XFCA 2DVTA 5TNVA 3F5LA 4UTHA 1ENUA 3W7EA 3QGVA 5MKGB 3H2OA 3PJUA 1F4HA 2WJEA 5AYZA 4H4YA 1RJQA 1T8QA 5HWNA 5CBBA 2CIPA 4PSPA 1H41A 2PS2A 2GUUA 3OIHA 2V5JA 3FJNA 4GPNA 2OELA 4JTJA 5I79A 3VCRA 4H9ZA 1CB2A 2Y2WA 2Z25A 1RK5A 2CFYA 1QRQA 5RUBA 4GD0A 5C5YA 1J6OA 4XX6A 2WWCA 2QLYA 4B4FA 2E5CA 3BUVA 4IQJA 2XIBA 3BTNA 4K8EA 1LCOA 2QV4A 1CGXA 4Q6JA 1JDCA 1ZMCA 1K4GA 1OFDA 4OKDA 2GSHA 2X09A 3WFLA 1D7KA 4FDCB 2VHLA 4O28A 4JY8A 3CTTA 3SQSA 4L6OA 4GJJA 1F7BA 1GZGA 1W3KA 3TE9A 1UZDA 1V7YA 2BY2A 3BG3A 4ZO7A 7ENLA 5REQB 9XIMA 1FDYA 1UC5A 1VYPX 1Q63A 1ZJIA 2YLLA 1DWJM 2OYMA 2VEIA 3MPGA 4BQ5A 3T2PA 1RCXB 4MWAC 1XYBA 1GKRA 1UJPA 2OWCA 3QFWA 1QBBA 3U4AA 3KOYA 1ONEA 4FX8A 4O1DA 3V0SA 1AQHA 5IM51 3PBWA 4CCCA 3N4AA 1TVPA 1FWCC 4I9TA 1PV8A 1ISZA 4WKHA 1XYLA 4IJCA 3LCFA 1Q6LA 1XHGA 4QSHA 3R07C 4QG6A 5JRBA 2QS8A 3UF9A 4D8AA 3RLGA 2Z1VA 1A3WA 1JYWA 2PLMA 2WVVB 4RNJA 1SJCA 4XAFA 4EPEC 1SO3A 1QWKA 3GR4A 4D2JA 2XZ7A 5LA2A 4XKYB 1MW2A 3VMPA 1EGZA 4E8CA 2E6AA 3CHVA 1SR9A 2DZAA 1PTAA 1D3HA 1B54A 2UY2A 4KS0A 3THQA 4IFKA 2WYSA 2GR3A 5K9CA 1A5AA 1NHRA 1EWEA 3BLFA 3NQAA 2QEZA 3W1NA 1GOOA 2BX7A 1F76A 1PWLA 2NQZA 1WOBA 3MQTA 4MNKA 2Q8LA 4MJZA 4ADSA 5KVHA 4JTCA 3N11A 3DXIA 3SQLA 1W9XA 1R85A 4ZOCA 1X6UA 4LAMA 1OC5A 3CGDA 1VBHA 3G1FA 3R12A 2OKTA 4U5IA 3EDDA 3OC4A 2WBGA 2C1GA 4KRZA 2VDHA 3IUIA 3GDMA 3VFCA 1VCFA 3RIKA 4HK7A 3DFPA 4TVDA 4S2BA 1R7OA 2PDWA 5DQPA 1YIXA 4BV6A 1J8VA 1SFJA 2IPGA 3S5OA 1CBGA 3Q58A 1BXCA 1A5NC 4PRRA 5D9NA 2ZTJA 4KMQA 2DT0A 2VX4A 1FWJC 4BI6A 2ZUSA 4AXNA 4EPBC 1P0NA 3F4CA 3N4EA 2PDIA 1V6WA 1AMKA 2BVDA 3AFBA 1OQFA 1PX4A 2YW4A 1H4PA 1XANA 3IVUA 5KEZA 5CSRA 1EJVC 5K3VA 5BYWA 3W1TA 4ZEPA 4GXMA 4D6IA 1A4LA 2E1WA 2PBGA 4EWJA 1PJ9A 5HMDA 4JTDA 2A7RA 3S2NA 3M0MA 1FO4A 3PR2A 4DBEA 1M03A 2R1KA 3ONBA 2EAWA 4O10A 4YVXA 2PF8A 4DBDA 3HQOA 4M3PA 1VPQA 4NJHA 1H49A 3TZFA 2Z0IA 1SSGA 3R89A 5E9AA 1R86A 3GVRA 1N61C 4AYSA 3LZ3A 4M7SA 1LQAA 3FYOA 3WEZA 1GORA 3UGVA 2Y0FA 3BSGA 3T42A 4RE2A 1NM9A 2PWFA 3PANA 3TV8A 3OLGA 3ZJKA 1VFHA 2ZXDA 3P0XA 4R33A 2X05A 4V28A 3HG4A 3AS3A 1WCGA 4AFYA 2Q3OA 2OEMA 3LCXA 4CQCA 4KFOA 4US5A 4G6CA 1HKVA 5CGMA 3AIEA 4JFWA 1LG2A 5A1AA 3CYVA 2NWSA 3IANA 2R94A 1WXZA 4GUHA 1NF0A 1KFCA 4WKAA 1VBUA 4XQ6A 4H9VA 1ONFA 3V16A 3W24A 3W00A 4OUEA 2JF6A 5G5GB 1K9EA 4GCXA 1MXSA 1PS9A 2VURA 2DT3A 4AH7A 4JIQA 4MB3A 4LUTB 4FOJA 4Y8FA 2I57A 4RV8A 5EYWA 4AC7C 3ENLA 3C2FA 1F6YA 3HGRA 3O0FA 4AD2A 1TJ1A 3W7CA 4IOTA 5JH1A 4PBEA 4XSLA 2GOKA 2ZWYA 3SB0A 4WGHA 3URNA 1FFRA 1B4KA 1E43A 2O0TA 1O60A 3CJPA 2H90A 4ZA0A 1W17A 1C8QA 1WDDA 4Q8OA 1TTJA 4KRUA 4RX0A 3H2MA 2DZSA 2R1MA 2BGSA 2XVGA 1TO3A 1NDVA 3A24A 4GRSA 5EMKA 4H9UA 3S3GA 3WY1A 2CZDA 4I7WA 4NXKA 3WDIA 3QGKC 4GLEA 5JU6A 3VNLA 3DENA 2YBTA 3T78A 3QSTA 3IV8A 2Z28A 1IWPA 4OV9A 1QNRA 4UMCA 3EDKA 4ZSTA 4PH6A 1S3TC 1SB3B 3IWPA 3GW0A 5TF0A 1LWIA 3T0DA 2GDVA 2WOWA 3B8VA 2ZRYA 3YPIA 1UWSA 2E1DA 4Q4MA 2PGWA 3CL7A 4KWSA 5T9CE 1WV2A 3D6NA 1K1DA 2EGZA 3UY7A 2EKGA 2WMKA 1V59A 3ALGA 3AIVA 1NOWA 4YN5A 1XIGA 4HA1A 2PDPA 3AXIA 4PGLA 4M6PA 5EMYA 4YS1A 1W3IA 2CLKA 4LAKA 4DX3A 4GY0A 3P8IA 2DZWA 3RILA 5LKYA 5G4EA 1I2RA 1E1CA 4LUSA 5KSWA 4H4UA 1NSJA 3O0HA 3AYRA 5DXXA 3M5ZA 5IHSA 1Q45A 4LNYA 1IF2A 2ZIDA 1L8PA 4IMEA 2YR1A 5DMMA 1V03A 3IJ6A 4JHZA 2Y8VA 3SR6B 1KR1A 1KM3A 1TVNA 3LCIA 2HS8A 3OLIA 2FMOA 4C6LA 5F2GA 1XL9A 3TKFA 4LYRA 4QE1A 3N3TA 1CLXA 2X0HA 2WZTA 1FWWA 3O1NA 4LBUA 1XIBA 1WA3A 3W7JA 3HG3A 3AZRA 3EPOA 1LRNA 2Z6IA 5C6MA 2BHUA 2PD5A 5KETA 3ARYA 3QV8A 4C1NB 4DWSA 5HUOA 4MJ4A 1IZJA 1FDZA 2CBVA 2J79A 2CLEA 2DVXA 4FNUA 4MSSA 4U28A 1WKYA 4ACZA 2XFWA 3S2JA 3M16A 1ML1A 5HR7A 1DXIA 2EEXA 5AHMA 4OHQA 3A4JA 3DH9A 2PWVA 3ES8A 3W26A 5A94A 3GSMA 1TPDA 1E15A 5EFFA 2H3DA 3HPAA 3WNKA 1FQ0A 1UD2A 3PZ9A 3S1WA 3HRDC 1SJBA 2ATMA 4Q3MA 2HNEA 2WMHA 1HGYA 3WMLA 3R13A 1CW2A 3HMJG 5J04A 2WCSA 3AZTA 4MKNA 2ZKMX 2PLKA 5I3FA 1XYFA 3K8MA 1R3QA 3VILA 2ZZ0A 4FLQA 4RK8A 1PZ1A 4CU8A 3CWNA 3HBLA 2AL2A 2LLEA 4W7UA 2X99A 1YNYA 5FS9A 2QCLA 1G69A 1IYXA 2Q8ZA 3TA9A 3ITTA 4K7YA 2E7FA 3LB0A 2G3MA 2VFFA 4L6HA 3UXDA 1GESA 4G1NA 1EYWA 1OC6A 5F7UA 1PZ3A 1H7RA 5KZDA 1U1HA 5FS8A 3WLSA 3RJXA 1KBKA 3TW6A 3SY5A 2VZUA 1LL4A 4F0RA 1KD0A 5A69A 5LSMA 1PTDA 4BQ2A 1JZ6A 3XINA 1XYZA 2OYLA 4K37A 3HZ3A 3H2NA 1VP5A 1WE5A 2J7HA 3CUZA 4PTNA 3GNDA 4LANA 1XHCA 2KX9A 3D0CA 4BHYA 3CH9A 5LYRA 4HHMA 1KWKA 3A64A 1BHGA 5DMLA 4IQEA 4H2CA 2OSWA 2VGFA 5H1WA 2AAMA 3WLRA 4BZYA 5BMXA 2FMNA 1QK0A 5L9FA 2REQB 2E6DA 3WUGA 3P60A 3IAPA 2ADAA 5HANA 3R0DA 3ARZA 3IIOA 5AHNA 4UQEA 2CBUA 4GRTA 1EBHA 2OZ3A 1ZAHA 2NX9A 5U7SA 1TX0A 1VJSA 1IWAA 4H9YA 4Q8NA 3GG1A 4CD7A 2P3ZA 1WB0A 2VR5A 4JTAA 4DJEC 1ESWA 2TPRA 3H22A 5KTLA 1FHUA 4CGTA 4IX2A 4JQAA 4AHQA 2CLPA 2NV1A 3CIWA 2MUCA 3CC1A 4EE9A 5ECVA 3OEXA 1V0NA 1L6FA 4Y9AA 1ONXA 4O4WA 2B81A 2HE5A 1VBRA 2CW6A 1LRQA 1G9HA 2Z26A 3M0ZA 3T2QA 4TTUA 1PKYA 2PLJA 3EPNA 1KFKA 2ZRWA 4AMAA 3RGTA 3PG8A 1Q6GA 1KLYA 2DZVA 3VD5A 4FXSA 4D6EA 5C7VA 3UCQA 1OY0A 4J3WA 3HGOA 3RK8A 4D8LA 1UUMA 4MLJA 1X2GA 3VKJA 4F0HA 1JCMP 3NPWA 1F07A 5FF7A 3AYTA 3TU9A 4QTGA 1X8CA 4QS6A 2A4AA 1DJGA 4MKVA 3GS6A 2A2IA 2CKSA 2BXZA 3S2CA 1H6VA 3L67A 5G1TA 4AEEA 2VNCA 3CZGA 3MMTA 2QCNA 5I3GA 4Y7EA 1KRMA 3W85A 4AEFA 2Y8KA 2PCQA 3OU8A 4C6QA 1KV5A 2CERA 4RPPA 3EWUA 2GH5A 3URAA 1TV3A 5IFPA 4H1ZA 4XZ9A 2E3TA 3W4RA 5I09A 1S5MA 3S6OA 5A6BD 1LVLA 1H0GA 1XISA 1XRVA 2GRTA 5A5WA 3CEUA 1ADSA 1XDIA 1U5VA 2HTMA 1FUYA 1RY0A 3G77A 1GXFA 1GUVA 3QTPA 3EWYA 3LXBA 1O5QA 3VGHA 3LLFA 4IWWA 4XVDA 2ZX8A 1XCWA 5IBXA 4Q8VA 2O9TA 2Y7FA 3HG5A 3N17A 1JF6A 5M1TA 5HJYA 4Z1BA 3RAOA 3WELA 5G2WA 1CI1A 2GGHA 2PDMA 2XIJA 3PK7A 4N0RA 2Z29A 1P48A 2ANUA 1A5SA 2ZTKA 3IPWA 1C93A 3T9PA 1O12A 3Q94A 2QCGA 3GH7A 3NXFA 3QXBA 3EKLA 4AYGA 4CCZA 2PWGA 2YDAA 3SUTA 3DECA 2DT1A 4IMGA 3KVKA 3RNMA 4P2VA 3SURA 1N63C 2TRSA 3IVTA 4HJFA 5AC8A 4X61A 4I7VA 2ZX7A 4Q8QA 4LVFA 4IT1A 3UZ5A 3FDKA 3G1SA 4EMWA 3A7UA 1ZP3A 5BRQA 5IFTA 4TXEA 1N7KA 5DMYA 1ZBCA 3GG7A 3C2OA 4FZIA 1AQ0A 3A5FA 4EQWA 4ORMA 3ECQA 2GWNA 1LT8A 5BW6A 3VK5A 2JK2A 4D8ZA 3QW4B 2GGGA 1GJPA 1QPRA 1ZGDA 2HXUA 3NVVB 3CQHA 1R30A 3S5ZA 1KN0A 1ZCOA 2BB0A 4AF0B 4M6QA 2R9RA 5TIMA 4H7ZA 3NM3A 3VE9A 3MHFA 4ZOBA 3N2OA 1WQ5A 3UJFA 2G97A 2O7SA 2ZZ7A 1PZ0A 1AH3A 1WX0A 1EP3A 2ZZ6A 1NAL1 2DW6A 5C54A 2CLMA 3L5MA 4JX5A 1DEDA 1QI4A 1RD5A 2NZLA 2QUTA 5JCLA 4O1BA 4WK9A 3WH7A 1SYTA 1UHVA 5HQLA 3EMZA 2E5BA 3N4FA 3OZMA 3ITXA 3CTLA 3CXOA 1HT6A 1UR0A 3GNOA 4D71A 5JUVA 3VOGA 3ZR6A 1QNPA 1Y5XA 3NVYB 3NPVA 1U83A 3ZYZA 2E68A 2XVKA 2XN1A 2G4FA 3DDMA 1VHCA 3E6EA 4NNBA 2GWGA 3AICA 1BKSA 3EX3A 4B5UA 3DJJA 4WSJA 1P6CA 1TUFA 5PTDA 5TD4A 1FTXA 2PGRA 2VFGA 4NZ5A 2WMIA 4UTWC 1X6LA 1W9UA 3NTYA 3W83A 1KXTA 1Q1RA 1N8WA 4N6FA 1O94A 4MWAA 3TH6A 5FI8A 1NWSA 1U22A 3ISIX 3KAOA 3GVVA 1WDPA 3KUMA 4DJDD 3NQVA 3LUTA 1UR4A 2GSEA 4LJ3A 1OCBA 2J78A 3SCVA 5B7YA 4CNPA 1RPKA 3GDTA 1G4EA 3BW3A 4QJ1A 4H3DA 3MBFA 3OIXA 1B30A 2YW3A 2QMKA 4H8NA 2Y6ZA 3BGAA 3QW3A 1T8XA 4W85A 1K6WA 3S4TA 1LM1A 4YTSA 3LXCA 3V35A 4QNEA 3LX9A 3TYCA 4BY3A 3SUSA 1S2VA 2PDUA 1EH9A 2V3BA 3U2CA 1CZ1A 3TW9A 1O5XA 4PCFA 3ZT6A 5BOOA 3KE0A 2QPSA 3HTWA 4IIEA 1REQA 2G4JA 2X40A 4QFUA 4UQ9A 4H8HA 3IUDA 2NXHA 1E4LA 2X8RA 2INZA 1TPB1 1MYRA 2C79A 3TEVA 3SI9A 3W88A 5GJNA 3S83A 2BBFA 2BCPA 4FHAA 2HPMA 1Q13A 3MUXA 3SRFA 1DHKA 1V77A 3JZEA 6A3HA 3C2RA 5D02A 1Q8AA 1N55A 1ZS2A 3AQUA 3NQDA 5HBFA 3NQMA 4NJJA 4JD4A 3RXZA 5FEZA 3B4YA 2TODA 4KWOA 3W76A 2P76A 1FH8A 3VXGA 1XUZA 3UQNA 3KEHA 1NFPA 5A8QA 5G2HA 1S5TA 3TYBA 1E70M 3NEHA 4A3HA 4JTIA 1O4UA 2ZA3A 2WNNA 4GVIA 3KBWA 2I5GA 1ECEA 3LI0A 3VI2A 3IJ7A 3TUUA 4MOZA 2PDQA 4DO4A 3MWAA 5AHLA 3ONCA 1N5XA 2QUMA 1IZKA 2X42A 1B3XA 3LGDA 3VNKA 4JTSA 4Z1AA 5A6JA 4JBRA 1OJTA 4OBSA 3T09A 4JX6A 4B92A 2JIWA 1LOSA 1FWIC 2J27A 3B9NA 2YL6A 1V51A 3SN0A 1JOAA 2J66A 3V18A 2JF7A 3OODA 1A5OC 4GQGA 2OSYA 1GTHA 2EJAA 4NIRA 2P5NA 3Q45A 1QO5A 1CXIA 3S9IA 4IFKB 2OZ0A 3WL0A 1TRIA 3CU2A 2QAEA 5D8WA 3AUOA 2FTWA 3GNNA 4CU7A 1QW7A 1BTMA 3L4XA 1KTBA 4I9MA 3PVFA 3BVJA 1FDJA 4Q4SA 4TTGA 4GQBA 1F61A 2CDUA 3GLCA 3B05A 1YQ2A 3A4AA 2WPGA 3EWDA 1DWHM 3JVAA 3VIHA 3TQ0A 1WXYA 1L8NA 4AZ7A 1E6PA 4X9SA 3GAKA 4J3XA 4PCSA 4PTMA 3S9YA 3P14A 3AMGA 2XDFA 2QMJA 5ER0A 1EB3A 1ME8A 4J3SA 3MHGA 5TAOA 3LN3A 3KDOA 2WNWA 3L2LA 5LHFA 3KVMA 1QWGA 4HNNA 2B7QA 1W1IE 5HUPA 1ZBKA 1EZWA 1GEQA 4BQ4A 4ES4A 1E4NA 2QJNA 3Q65A 4RDYA 2ZX9A 2PC8A 4O8AA 4J3ZA 4IXXA 3NQ8A 2J7EA 3CZEA 1FWAC 1Z48A 2PMQA 3BSHA 3AXMA 3VNMA 4F48A 2WKJA 4EX4A 1YTKA 1GOKA 3AU2A 5BWFA 1WAUA 5TR3A 3MJMA 4O57A 4LBSA 4B3KA 1ITUA 4XZLX 2VDIA 5A3HA 2ACSA 2OZ8A 3KS6A 2ZDSA 1Y7VA 3N14A 1D2KA 4QJ5B 3CLMA 3ZOAA 4W8BA 4DWDA 4AWUA 3DG7A 1LYXA 1QTWA 4KIEA 4BF9A 4FIRA 1A0CA 4DJFC 3M1ZA 4GC4A 1EL3A 3W2NA 4UZSA 4MUPA 3PC0A 3S1VA 4L64A 3GXPA 4HA0A 3APYA 4FX7A 2IMRA 2BOGX 4I6VA 1Q8JA 1RV8A 3U57A 2WSKA 2VZTA 3WUEA 4GUJA 3FVMA 3EPMA 3E3HA 2YVGA 3IIPA 2VX5A 2B31A 1A5KC 1PYMA 4F40A 4WX2A 2YBUA 2OCZA 3PBVA 1ZY9A 4ZOEA 3VIGA 1B0IA 3HURA 3W2KA 2IKHA 1OX5A 1W91A 3GDRA 2AOSA 2YB1A 4E2BA 1HVXA 1CXHA 1XIFA 1RBAA 4B2DA 3F4WA 1PVNA 3HFTA 3N12A 4ML9A 4EQSA 3XIMA 1KW1A 1I1WA 4H41A 4DI9A 3W1PA 3TSBA 3VKDA 3OGRA 4RE3A 1JR1A 3VGGA 3MCMA 2ZDRA 3CZ8A 4Y9MA 4NXSA 3UWVA 3W01A 2WPBA 3UWUA 3LD5A 1U5HA 1QI3A 1XDLA 2FTYA 3O07A 4YXGA 2FDSA 7REQA 1YTEA 5GNYA 1H1NA 1BVNP 3IJIA 4FNRA 3WBAA 1GQNA 1P5BA 4QSFA 2DUXA 8CGTA 4RDVA 3LA4A 1TR9A 1KNWA 1RP8A 3QSRA 4HMEA 5DBUA 1M53A 3I4EA 1OYBA 1YDVA 3MKVA 3UJEA 1ICSA 3VDAA 4JQ2A 3UGRA 1S1PA 3CO8A 3K8LA 1FECA 1GHRA 5F2LA 2GVLA 2TAAA 3GKAA 2XN0A 3FJLA 2ZVIA 3LEPA 2RABA 3UVIA 1N8FA 5CZJA 3E5BA 2V30A 3UPWA 3FEQA 2ZBTA 1ZL1A 1ECQA 1VKFA 2O9RA 4JTTA 3VGFA 4QQ3A 1H1ZA 3R0KA 4QRNA 3ZJ6A 1E1CB 3VOHA 3O16A 4LUSB 1V0LA 1TR1A 1ELSA 4I90A 4ZB2A 2YCJA 3B8IA 4M80A 3KBSA 1ODZA 5CZ0A 2ALDA 5GQBA 5FJOA 3NUKA 2P8BA 2QNEA 1OFQA 3M41A 4AU0A 3M5YA 3TCSA 3TJ4A 5DFAA 4WDUA 1KCXA 1OX4A 3BV4A 1Z42A 3GVGA 1ODUA 2KAUC 3DGRA 5KZEA 1SO6A 4LRSA 5FL1A