3P3BA

Crystal structure of galacturonate dehydratase from geobacillus sp. complexed with d-tartrate
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
385
structure length
377
Chain Sequence
LNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSSLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title CRYSTAL STRUCTURE OF Galacturonate DEHYDRATASE FROM GEOBACILLUS SP. COMPLEXED WITH D-TARTRATE.
rcsb
source organism Geobacillus sp. y412mc10
molecule tags Lyase
total genus 133
structure length 377
sequence length 385
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3p3bA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3p3bA01
3ZVIA 3R1ZA 4GYPC 2OQYA 4DN1A 4DX3A 2FKPA 3ENLA 1ECQA 4DHGA 3R0KA 2OKTA 4JHMA 3VDGA 6ENLA 4K2SA 3ZVHB 3D46A 3STPA 2MUCA 1EBHA 4E4FA 4K1WA 1W6TA 2HXTA 2QJMA 2PGEA 3KUMA 2PP3A 2PPGA 4YWSA 3VC6A 2PS2A 2QDDA 1TKKA 3PWIA 3R0UA 2P3ZA 3T6CA 3UJEA 3MUCA 1MDLA 1WUEA 1XS2A 2AL1A 3T9PA 2PGWA 3PFRA 4GYPA 2PMQA 1KCZA 1ONEA 3TJ4A 1KD0A 3UJ2A 4IP5A 2PODA 5BOEA 4M6UA 3U4FA 1WUFA 3T4WA 2OLAA 3DFYA 1MRAA 3OZYA 3TJIA 4HN8A 1E9IA 5FJUA 1MUCA 2OG9A 4KPLA 3RR1A 3DFHA 3IJIA 3NO1A 4E6MA 2PP0A 1R0MA 3IJQA 3ZVHA 2XH0A 1FHUA 2GSHA 4E4UA 1IYXA 4K8GA 3FJ4A 3OW1A 2QJJA 3N4FA 1FHVA 3QPEA 2QQ6A 3P93A 3TOYA 1BKHA 4JN8A 2HZGA 4GMEA 1EC9A 4J1OA 4ENLA 3H7VA 4GGBA 4DXKA 4IL2A 3VFCA 4ROPA 5FJPA 4JN7A 3UJFA 2GGHA 1PDYA 3H70A 3TWAA 5FJRA 3V5CA 3UXLA 3H12A 3DG3A 1SJBA 3CB3A 3N6HA 2OQHA 4J3ZA 3CAWA 3FVDA 3P3BA 3N6JA 3CXOA 3DGBA 3HPFA 3ES8A 4IP4A 3Q45A 3DESA 3GO2A 4Z17A 2GGJA 3RGTA 1ELSA 3R10A 3FCPA 4X2PA 4DYEA 3BJSA 3BSMA 1NU5A 1MDRA 2RDXA 3S47A 1TZZA 4F4RA 1JDFA 3TCSA 3UJSA 3B97A 1TE6A 3V3WA 3EEZA 4A35A 2GDQA 3Q4DA 3MQTA 2PU1A 2O56A 1NELA 2XSXA 4GGHA 3N4EA 2OO6A 3UJRA 3I4KA 1JPMA 2OVLA 3MSYA 3R25A 1XPYA 3DG6A 3UGVA 2PTWA 2P8BA 2HNEA 3OZMA 2QDEA 3QLDA 2MNRA 3MZNA 3JVAA 4ZA0A 2CHRA 3K1GA 5IDZA 3ZLFA 5ENLA 2OZ8A 3SN4A 7ENLA 4GISA 2PCEA 2XH7A 1EBGA 4A3RA 1PDZA 3DERA 4DWDA 2OZTA 2DW7A 1EC8A 3DIPA 4KT2A 2I5QA 4MMWA 4E8GA 3ZLGA 3MWCA 2PSNA 4GFIA 4HCDA 3RO6A 3GY1A 3VC5A 3IJLA 2AKMA 4E5TA 3SBFA 4G7FA 2AKZA 2OX4A 3JW7A 3SQSA 1MNSA 3RITA 2AL2B 2P88A 1L8PA 4Z1YA 2PTZA 3H8AA 3DEQA 2GL5A 2FYMA 3BOXA 3UXKA 3GC2A 3DG7A 2GGEA 3NFUA 4HCLA 4HNCA 1P48A 4HNLA 1JPDX 3UCDA 1BQGA 4HPNA 2GGGA 1EC7A 1YEYA 3VCCA 4FP1A 3GD6A 5FJTA 4EWJA 4HCHA 2XGZA 4H83A 3FV9A 3ZLHA 3OPSA 4H1ZA 1R6WA 2HXUA 3TTEA 3V5FA 3CYJA 2XH2A 3OP2A 4ZCWA 4G8TA 3SSZA 3THUA 4IT1A 4KWSA 2ONEA 4H2HA 2P8CA 2PP1A 1RVKA 4H19A 5J04A 4M0XA 5FJOA 2PA6A 1OEPA 4IZGA 2GGIA 3QTPA 1SJCA 2OZ3A 2OPJA 3QN3A 2AL2A 4GIRA 4A6GA 3TW9A 3ES7A 1F9CA 2ZADA 3V4BA 3FYYA 2DW6A 4MKSA 3SN0A 3P0WA 3VCNA 3R11A 3DDMA 3PWGA 2PTYA 3EKGA 2QGYA 3D47A 3CK5A 3NXLA 5EU9A 1KKOA 4KEMA 3MKCA 3UCCA 4IL0A 3SN1A 2QVHA 1KKRA 4IHCA 3TWBA 2ZC8A 2PU0A 1P43A 3IK4A 3CT2A 3PK7A 4HYRA 1SJAA 3TQPA 3FXGA 3T8QA 2QJNA 1SJDA 4FI4A 3U9IA 3VA8A 3OTRA 3NZGA 2PTXA 3S5SA 5BOFA 1DTNA 2NQLA 2POZA 3I6EA 2XH4A 3RCYA 3JZUA 2OFJA 3SJNA 2P0IA 3I6TA 3QKEA 1JCTA 3RRAA 3MY9A 4MGGA
chains in the Genus database with same CATH superfamily
3ZVIA 3W7MA 3RU8X 2VDIA 3GU9A 4LYPA 1FDJA 1ZAJA 2TODA 4XIMA 3QVQA 4W7WA 1WYIA 3INPA 4HMEA 3BZJA 4ZFCA 1M41A 4H6QA 2NSOA 4WY0A 4HNTA 4MDOA 1L6WA 4GHRA 4CU6A 2GUBA 4IISA 4JPGA 1E4LA 4WKAA 5A6MA 1RBLA 3HIJA 2YXGA 4BQ5A 4S23A 3A7UA 3HM7A 4E4FA 3UQNA 3CU2A 5I78A 1W1ZA 2ISWA 3PZMA 1HW6A 2GFTA 1VS1A 2GJNA 2PS2A 2FH8A 1WQ5A 3ERPA 4WJ8A 1BHGA 4C5ZA 3T6CA 1XS2A 3I4EA 3T1GA 3T78A 2AQOA 2QIIA 3AXIA 4UCFA 1FXQA 4CD4A 3TAKA 3TJ4A 5CPNA 2WHKA 1XWYA 3OO2A 4M6UA 3GQYA 4PUNA 1JD7A 3W1MA 5AB3A 3CPUA 1XCXA 5FJIA 4ATDA 4MWAC 3CV2A 3UNDA 3MBFA 4FK9A 3W7PA 3W37A 4ASTA 1VFLA 4IMCA 1SO4A 3ZJ7A 1ZJBA 4M52A 5D02A 5CGTA 3FDKA 4JNZA 1WXJA 3T08A 4NXSA 4NEWA 3L2LA 2W6RA 4JY9A 1KO0A 3PAJA 3TW6A 1UD2A 4AWSA 2BGSA 3FLUA 3AROA 5ABFB 5LA2A 1OQFA 4OE7A 1BVWA 4O0QA 3OLIA 3NQ2A 4G5DA 4FNRA 1NWUA 3HG5A 3WD0A 4JD4A 2ZXQA 1M6JA 1FHVA 3CL8A 3LZ5A 4H7VA 2IPFA 2QQ6A 2KX9A 4E8DA 1H11A 1QNRA 2ZZ3A 3KS5A 3FKKA 1DJIA 1KRCC 3TTOA 1I6NA 2UZ9A 3SCPA 1PZ1A 4PULA 1QI3A 2QULA 4CGTA 1EJTC 1T41A 1I2OA 4ZFMA 4Q4RA 2DZPA 4DPPA 2E7FA 2ZTKA 3NZRA 4GFSA 4NAEA 5BXPA 3O15A 4JKMA 2YGYA 4KBXA 4QNEA 1THFD 5I2UA 3W75A 4I5UA 3GVQA 1JPIA 4C1LA 4J3UA 4M1RA 1GYMA 1VFSA 1Z3NA 4CNPA 1W91A 2YCKX 3GKAA 1A3WA 1S5WA 7TAAA 4OIFA 3KTSA 1Y7VA 3I68A 4NX5A 1G1YA 4NUWA 2FB2A 2VC6A 1P0DA 3NOYA 1FH7A 2PDCA 1X1ZA 4A35A 2XHYA 5K7JA 5M3WA 3QV6A 2PAJA 3LM7A 3GW3A 5REQB 2HDJA 1WAUA 3WFAA 3RCMA 3UCQA 2Y5JA 1DXLA 5D38A 2FDSA 3S4TA 1B54A 3CZKA 2FMNA 1TJ1A 1BYAA 3I4KA 2CLEA 2Y7GA 3SCSA 1BKSA 3GZ3A 2VFEA 3OQ8A 1WDWA 4KCVA 3FJ6A 2PTWA 1S2AA 5C55A 4JZ5A 2VC7A 3S83A 3VGGA 2Z1WA 3QMRA 2CHRA 2NUXA 4JTUA 2B0MA 5BZAA 2WMIA 3VIJA 4IIDA 1US3A 5HR7A 3A4AA 1PS9A 1RPKA 3VIFA 3GVRA 2WVVA 1LORA 3ICJA 1SU5A 3DI1A 3HMCA 4MY1A 2INZA 4JCMA 2O4QA 2HK0A 4PGLA 3PB0A 4BQ4A 3VYLA 5CPTA 1QNVA 2D0FA 4HT3A 3CHVA 3ARSA 3LV5A 1XHCA 4IWWA 4AB4A 4DZ5A 4CQ8A 3QFEA 3ITTA 1A4LA 4FLSA 3BLOA 1VP5A 1W32A 1AG1O 2X50A 4EM4A 5DCDA 2XVPA 1P1XA 3GY1A 5EKYA 3B04A 3PY2A 3SGGA 3XISA 1LWJA 2BSLA 4HQVA 3MP3A 1IWPA 1HG3A 2VGFA 4FIQA 1DVJA 3URNA 3WJWA 1TFVA 4OFCA 3PSWA 2E4TA 2AL2B 3HGOA 3W2KA 1TQJA 3NL5A 5G1YA 3D3FA 1BAGA 3G24A 4QE5A 3W7KA 1OFEA 1JCXA 2YL6A 4Q8TA 1L9WA 2DZBA 3KBNA 4HTYA 2PDHA 1SZNA 2I56A 2G3NA 2YKKA 2WMKA 1EZ2A 4I7VA 3V1PA 3QQWA 2FTWA 4XO7A 1CPUA 4B4HA 4OHQA 4BR1A 2YQUA 3ATZA 3DHDA 3LXDA 4UZUA 2VNCA 5AN7A 5IFTA 4LNCA 4HCHA 4EACA 3A3WA 4AIUA 3CIVA 4LT9A 2I9EA 1XKYA 4ZODA 4CU8A 3LERA 3CUZA 2CIPA 4L65A 1Z41A 4IICA 3KCJA 3TTYA 4ZB0A 1FHDA 1E5NA 1YBQB 4JS3A 1TE1A 2IW0A 3B05A 1XIDA 2VXNA 3AZTA 3HURA 3QTPA 3NEHA 3TYBA 4EXBA 2DP3A 1BXCA 1F9CA 1M6IA 1XLJA 1TPWA 2HPIA 2J7GA 1FWFC 3WNOA 2DT3A 2YX0A 3W84A 1QCWA 5C70A 1G5AA 3N12A 4UNKA 3VX1A 4RNIA 1JUKA 4AXNA 3B4UA 4LB3A 5A6SA 2J7HA 3S2JA 1X96A 1GVQA 3H55A 3DJGX 5ECUA 3OG2A 1LWIA 2PWVA 2JGQA 2ACRA 2OO0A 1H63A 2PI6A 3SCQA 1MFVA 3WIJA 3KCOA 3IK4A 3IIZA 2HVNA 3LXCA 5D32A 4UTWC 1ZSXA 2V2DA 2PWFA 4GO9A 3SECA 3W22A 5A69A 4S38A 3ANYA 2QAEA 3BLEA 5DX7A 3RR4A 1TX2A 2O92A 4O1EA 3VNMA 4EX4A 4O19A 5E93A 4UNIA 3DGZA 1E0XA 3EAOA 2AGTA 4H4SA 3EXSA 3I6EA 1FECA 3G1AA 2G4FA 3VDCA 4D8ZA 1LLWA 4R27A 2V3GA 1UUMA 4W5UA 2VGIA 3N34A 1SFTA 5A3HA 4H4UA 3R1ZA 2OR2A 5A95A 4W5ZA 2YVGA 1GWJA 3PAOA 5F2LA 3VGHA 3RRXA 4AF0A 3AU2A 3UA4A 8XIAA 3VUPA 3E1F1 2XN1A 3QSRA 2G41A 3OZPA 3EF6A 3FY1A 3MSRA 3GM8A 1O1HA 1U5HA 2V6AA 4OBTA 3MTWA 4XQ6A 3R2GA 3STPA 5C2GA 4DF2A 5LIXX 2VL4A 2W0HA 4YTSA 2QJMA 1EOKA 5ABEA 2PPGA 1DXFA 4LYQA 2HE5A 3NAVA 3VNJA 2NX9A 2YDSA 5AHIA 2PLKA 3CXBA 2BDQA 3K4DA 3TCEA 1WDRA 5JCKA 3DYMA 3WYZA 2ZZ1A 4GUIA 1VJSA 1K9FA 3U0HA 2V3FA 1YXDA 4NJHA 3ZZ1A 1QW8A 1TELA 3KOYA 1A0CA 2TPSA 5FJUA 1SO6A 4XG1A 2O9PA 3IS4A 3PZNA 3VE9A 2CZ5A 1F6YA 2GOUA 2OT0A 1E73M 2ZRVA 5HQLA 2GSHA 1NTHA 4QS5A 4FLQA 4NJIA 4AZ5A 5JU6A 4INFA 1F5ZA 5IM51 1W8SA 4GRTA 1VRDA 1C8QA 5CC7A 4NX0A 3PJTA 1UWAA 3KBVA 2RDUA 4LALA 4GGBA 2E09A 1BRLB 1PCKA 1ZNNA 1IQ8A 4MFEA 3T0CA 3O2LA 4DUWA 1HJQA 4LANA 3BSGA 2WZTA 3AI0A 2DZVA 4S3KA 4IQEA 4YYFA 4D6FA 3KOZA 4DJEC 3MP4A 3TAOA 3CGCA 3L12A 5FAGA 1X6UA 3N6HA 4M6PA 2VENA 2GVGA 3BC9A 2VI0A 3WJYA 4CNNA 1R30A 4YYCA 3DGBA 2ZUWA 3LBCA 4LAKA 6A3HA 3GHRA 4CN1A 4H9YA 4AD5A 3OGVA 1J9YA 5U1OA 1W3JA 3OEXA 1KFEA 1O6IA 4YJ5A 1TR1A 4ACZA 1UWTA 4O13A 3P60A 4ACYA 4UTIA 3CHCA 1KB3A 3NVTA 3TCSA 4F2BA 5K9CA 4IGNA 2YOCA 4NRRA 1M7JA 1CTNA 5SWUA 3NPUA 2X1TA 4MLJA 4I90A 1KTBA 4O53A 4JIPA 2C14A 1WDPA 2WPCA 4Q8PA 3UJRA 4I9AA 3VNDA 3H53A 5J5DA 1UWUA 3WDPP 3VOCA 1S5MA 5KZ6A 1ODZA 3N2XA 3MB9A 1GQLA 5A6AA 4MFDA 2ZZ6A 1VEPA 4AHPA 2FHCA 1CENA 5I07A 2OCZA 1BFNA 2EPLX 3NIYA 7ENLA 1R7OA 2BOGX 3E0LA 2AQWA 4LW7A 1KRBC 1C3FA 1DJWA 2BB0A 1E0TA 5H8PA 4JICA 1EO7A 4BQ2A 1C92A 3BAYA 5M5DA 3TUUA 4A3YA 1DWIM 3GD4A 2YBTA 3LCWA 4Q4QA 4S3EA 5XIAA 5JBFA 2NX3A 1DWJM 1YIXA 1IHIA 5IOBA 3OLEA 1VR6A 5H6HA 4H4TA 4ZQRA 1MNSA 1SZRA 2EKCA 1PKLA 2NT1A 2WK2A 1XYMA 4HHHA 2FZ9A 3H8AA 1RXOB 1WDDA 4JFWA 3GE7A 2F9RA 4PCPA 3UXKA 2YDAA 3SURA 2WJZA 1C91A 2G8ZA 2GVEA 3PBVA 1MUMA 1NOFA 1MVYA 4YMZA 4OGZA 3L4XA 1Q6GA 4Q32A 5DRIA 2FZMA 4H1ZA 2WMFA 3CGEA 3TTEA 3TC6A 2VZSA 1HN1A 2G3FA 3IACA 1H7WA 4S3JA 2CCRA 5E5CA 4DBWA 7REQB 2Z24A 4KWSA 4J56A 3LHZA 1NDZA 1V6VA 1RVKA 1XFCA 4GQRA 1M7PA 1D3CA 5FJOA 5HJLA 4REQA 2CWNA 4EF9A 2PA6A 1OIFA 2WVUA 1I2PA 3A4XA 2OZ3A 3TW9A 1LUCB 3KWXA 1IEIA 4EPDC 4WOQA 3FYYA 4C6PA 1YHTA 3PBMA 1RZMA 1Y8BA 1JVNA 5I3FA 5A94A 4Z1AA 3R11A 2C1IA 3S1UA 2V63A 2TMDA 3E9AA 3VOHA 2GDUA 2WJEA 4JAWA 1O5XA 3C52A 2BC0A 3WD1A 1PZ3A 2FZDA 4GUJA 1GHRA 5I06A 1FKWA 2VX7A 5EMMA 2O0TA 1JL8A 3O0FA 2P50A 3GHUA 3VDBA 5DMLA 1CLVA 1UZDA 2DPEA 2PLCA 4XISA 2NW0A 2YZ5A 3MUIA 4UQDA 2YPIA 3H2EA 4HU0A 3TKFA 2GOKA 1H0IA 1MQRA 5GJNA 3POCA 5L9FA 4IGSA 4PL2A 3NZGA 3TROA 1EX1A 4I7UA 3MO7A 4N9BA 1GERA 1HT6A 4LUJA 4GBUA 4X2RA 1YRRA 2OFJA 1US0A 1SO5A 2BY0A 2WSRA 1VD6A 3RCNA 4MGGA 2R1PA 1TX0A 3VD3A 4PMUA 5DMMA 2P10A 3NZQA 3E0IA 2F2HA 3W76A 1EDQA 1F76A 3QY8A 4MYAA 3ONBA 1UBSA 5A1AA 3R7MA 6ENLA 4MPKA 1WBJA 3WD3A 4LPCA 3BW4A 1E4NA 2IUZA 2JIEA 3MHUA 5FKYA 1UW9A 2FZBA 1UASA 5D2YA 2BNJA 2X0HA 4JYEA 4C6JA 2HWGA 1FWCC 2BXZA 2PP3A 4A8NA 1FX6A 4QEHA 4GX9A 1IV8A 4HHPA 3XINA 3QPZA 2VHLA 4Y9AA 3UY7A 5CLWA 5KMYA 4QG6A 4GZ7A 2PUZA 4NHVA 2BZNA 4GIAA 2PMQA 2WJFA 5BRBA 1D8WA 4HA3A 2VUYA 1Q6LA 2V30A 1NEYA 2XZ7A 3LCLA 3WNLA 3OVPA 4F8XA 1GRAA 2OYKA 4NJGA 3HMJG 1UUQA 3TN5A 4FNUA 1PVNA 3C2YA 3GNDA 5A8GA 4JQ9A 4AF0B 1YPFA 2CLKA 2A4AA 2J9XA 4LVAA 4JQ1A 3PSVA 5H8UA 2E77A 3VD5A 4FR6A 1EJ7L 1IEWA 2RAGA 3D0CA 4K36A 1FHUA 3UERA 4E4UA 4GIEA 1H41A 3IIOA 1PCWA 2DUAA 3LHVA 1W3IA 3O7UA 2Y63A 3A7AA 3H2OA 3L4YA 4F48A 2ZA3A 2OMAA 2XGBA 5LGZA 1V7AA 6ALDA 3BGAA 2W0UA 3RM9A 3V0SA 3O0HA 1DJHA 5CBJA 1ONFA 4HA0A 1DORA 4FLRA 1CXLA 4C6MA 5CGMA 1M04A 5HBFA 1W56A 4LBSA 2HISA 1GTHA 1MNZA 1BWLA 1A53A 4K8HA 3G1DA 1XDJA 3A3HA 3W53A 1QJWA 4JHOA 3G3DA 1KGXA 5FJRA 3DHFA 2FVMA 5E0KA 4HPHA 5CZJA 2J9ZA 2ZXBA 4IM4A 2QW5A 3H12A 4JYDA 3DG3A 1A3XA 4IPJA 2GDVA 1G4EA 2EHHA 4M7SA 2YXOA 2QNEA 3AAMA 5CC3A 4PL1A 4JTCA 5HR6A 3UR8A 8TIMA 2YYTA 4PC8A 3LN3A 2R14A 3TSDA 1TA3B 2I5IA 3WEOA 2A85A 1ZZMA 2ADAA 1NDAA 1QW9A 3BOLA 3BW2A 4JQ2A 3ITOA 4V33A 5HINA 4UNLA 1NU5A 1LBMA 1EBDA 5DMYA 3QGVA 4AIBA 4BI6A 3IJ6A 4OECA 2DFAA 3UF9A 1BXBA 3IEBA 4JTEA 4GGHA 1BTMA 1B0IA 3SGUA 2PEVA 1XD1A 5ABGA 3TLLA 3I7QA 4Y8EA 3LHUA 3FGCB 3G6MA 1R5YA 4DELA 5EBAA 3GG8A 4X60A 2QUNA 1EP2A 2XSBA 1X97A 1UC4A 4GX8A 1NH6A 1X8FA 1O94A 4TVCA 3CUIA 4R33A 1BG9A 4O50A 2Z29A 3WQ5A 3JU2A 5K9DA 2A7RA 3G0XA 1EC8A 3DIPA 4BV6A 1GOWA 5M17A 4Y96A 3WENA 1XSKA 2EG6A 1R2SA 5F7UA 3H4GA 4ICNA 4JTIA 1YX1A 3VIOA 4MWAD 1DWAM 2QPXA 4H6RA 2QF7A 2WMHA 3LK6A 3K4AA 1TPVA 2RDTA 4DVOA 2FGBA 1C9DA 1TO3A 3NQ7A 4NAFA 1RD5A 4M1BA 1MZRA 1XLGA 3LXBA 3NDZA 1J0YA 4XUYA 3AUJA 2QDGA 3N11A 5CPMA 2WNWA 1LDCA 2Q71A 1GETA 3PFMA 2JEPA 2WKJA 1P48A 4H41A 4B5NA 3WSUA 4H01A 3WH7A 3UCDA 3C8NA 1WV2A 4ERAA 2BODX 1EC7A 3PTMA 2QCDB 3GD6A 2PTDA 5FJTA 1LOLA 3R43A 3ZJ6A 4D8LA 1HGWA 2X05A 4ZMGA 2ZUMA 3W7NA 2W4XA 3VU2A 3V18A 3G1HA 4J3SA 4DWSC 1UQZA 1AK5A 3RK8A 4UQEA 1JFXA 2E5CA 1XIJA 1ME7A 2OSYA 1V6YA 1UBPC 4ADSA 1SUXA 3GNRA 3N25A 3THAA 4AVOA 2BP1A 2X8RA 1CXEA 1UD3A 1SPQA 1GONA 1EHNA 1UMLA 3W87A 3KOXA 3I3EA 2VJXA 3EMQA 3TIMA 4EXQA 1VEOA 4ZVJA 1LCOA 3HPXA 4IFKB 4RE0A 2GQ3A 1KKOA 1ZAIA 4LY4A 1CGTA 1J96A 1QAPA 1FY6A 4Z0JA 2QVHA 3UVIA 3LCIA 3ZR6A 4Q4SA 1R3RA 1E0VA 4HB7A 2ZCGA 4XVEA 2X8HA 2YCLB 4KCWA 2VURA 1E1FA 1LRNA 4LIIA 3FXGA 1N82A 4IJRA 3CMGA 3ITVA 4HHMA 4DJFC 2C18A 2VRQA 3S5SA 1H2JA 2ACQA 1CGVA 1OX6A 5DFAA 3GHTA 2Z0IA 1P6WA 5FACA 1OHLA 3BH4A 4L4OA 4LUTA 4GYPC 3B8UA 2POTA 4R7OA 2QCCA 4PMRA 3U2EA 1KFKA 1UKSA 3ZT7A 1AZ1A 1RK6A 4LS0A 3SRDA 4JHMA 4BI7A 1F8IA 3L5MA 4ZENA 5D37A 4WUIA 3C56A 2J78A 4W89A 1S2WA 2BHYA 3V16A 2VP8A 4V15A 4JY8A 3II4A 2ZXAA 2H9AB 2HXTA 3QV8A 3U2CA 5HQEA 1WZLA 3KLJA 1J5SA 2XJ7A 2IKJA 4K7ZA 1JAEA 3CWHA 1ZAHA 2VGGA 2W55A 4K3ZA 4PH6A 4FNQA 1P7TA 1WUEA 3WDIA 2VOMA 3N9SA 1NJJA 4GPNA 2YL9A 1CYGA 1V0LA 1SR0A 4K8DA 2BVYA 5BOEA 1PB0A 1KBIA 2D2GA 5LSMA 3WQ6A 4WQ6A 1JULA 2OLAA 1Z44A 2PDFA 4NKCA 4U28A 1D8CA 1PYFA 2Q09A 4TTGA 3O6CA 3VCRA 3MI2A 2EPHA 1QI0A 1QPQA 2PLMA 1OFPA 3ZVHA 3NNTA 2EPOA 4FS9A 2YL8A 1F07A 4WIWA 3IJDA 2WPBA 4K8GA 1H7OA 5EFDA 3W7HA 3F4WA 4O17A 2V5KA 3WQCA 3AIVA 3LU2A 3P14A 4M81A 1J79A 4XZBA 3W7GA 1B9BA 4L9ZA 4LGXA 1GJUA 4QG9A 2OEKA 3P61A 4ZR8A 3CTLA 4JTRA 4NVTA 3WDRA 1FFQA 1L0PA 4HK5A 3W3OA 4P8WA 2DQWA 3W4RA 2OXNA 1PXGA 4JDRA 5AHLA 3DI0A 4C6QA 1Q6RA 4GYKA 3AHTA 3VOFA 4E0CA 4Q33A 2J7DA 1OK6A 2WVSA 3MV11 3TJLA 3TYZA 2YA0A 3EUB3 2YW4A 3EWCA 2FVLA 3CWOX 1FWEC 2X1UA 4GG9A 4NI3A 2V3EA 1UIPA 4GNKB 1MFUA 2WM1A 4DZIA 1QI4A 2Z1XA 2YJQA 2VCAA 1F4AA 3I65A 4ALDA 5JBEA 1D7YA 4WDTA 5D33A 3N9RA 3AMGA 3OU8A 4GXPA 3L67A 4D1JA 2WOVA 2Z1VA 3L68A 5EMJA 1AD4A 1TE6A 3LNMA 3WNNA 3JR2A 3P5ZA 2VFDA 1AJZA 1BXNA 2PU1A 2V67A 5KITA 4N9EA 5T91A 1AQHA 2O56A 3A21A 4HKPA 1NELA 1OCNA 1ZJAA 2OODA 3N2TA 3F1QA 5CSYA 1L8NA 5TD4A 3T07A 3FG2P 4U33A 3VO0A 4S3AA 1EKOA 1S5NA 1KBKA 5K4ZA 4LA1A 2PWUA 4LRTA 2NXGA 3WN6A 3OZMA 4LVGA 3W7JA 3M0XA 5FOOA 1PX3A 2C71A 1J2WA 1G0CA 2BLEA 5C7VA 1HJXA 2VQTA 2RGLA 1XIHA 1FH9A 1JI2A 2P3EA 4IX2A 5ENLA 3RLUA 2Y5EA 4HSOA 2OGYA 3PPCA 3LPGA 4AX6A 2F61A 1JRBA 3STCA 4ZB5A 4WF7A 5CLTA 3URHA 1GPFA 1JPHA 1GJPA 2REQA 2V3AA 4MWAA 4HA1A 1KQYA 2GSEA 2BCPA 3C5QA 4HHLA 2BASA 4AMAA 3UEQA 4DB7A 4I5XA 3W9ZA 3SGZA 1VF8A 2KAUC 4UQAA 4YVXA 1NWTA 4HVXA 4M19A 1YKWA 2DZXA 1PTDA 1E6RA 5FEXA 3DFNA 3IUHA 1EL3A 5LHEA 1UKQA 2NV9A 2JE8A 1AJ2A 1AW2A 1BVZA 2GGEA 2NWSA 4IH3A 4PUUA 4ATWA 3UG4A 4QISA 1E9LA 1HL9A 2DVXA 4UR8A 2YW3A 3H2NA 3FW6A 4HPNA 1FWTA 4ORIA 4EPEC 1JR1A 2V9DA 4Y9MA 3RAOA 4F2UA 1CXHA 1V6XA 3Q67A 3M5YA 3MMTA 1GXFA 3CWNA 3LCGA 5LKYA 4PR4A 1KFCA 2CKRA 2F7FA 3RPMA 1KM0A 1H09A 4AY8A 4KWVA 5FF7A 4B5TA 1HP4A 4H4ZA 3AMDA 3SSZA 4IT1A 5G5GB 3VIHA 1G9HA 1PWMA 4TMCA 1QUMA 4NY2A 1R9XA 1MUWA 3VZXA 2J6VA 1AD1A 3QFWA 1E6XM 4IIFA 1ITUA 3BAJA 3NRZB 3WK0A 2J3NA 2CETA 1FFRA 3WY1A 4Q4MA 4AH7A 4F2TA 1UYQA 4DJED 3APTA 4PB5A 4L5ZA 3WKZA 1TZ7A 1T6MA 1SSDA 4IZGA 2AMGA 1W2VA 3GIPA 4N9CA 1SJCA 3AZRA 3L0KA 3LRMA 3BCFA 3ES7A 2ATSA 3SUUA 3T8LA 4L6DA 2NVKX 3LLDA 2E25A 1VGAA 2WB5A 4POCA 1MSSA 3AZSA 4IFOA 4GY7A 1LRQA 4MB1A 1DP0A 1QT1A 3AYRA 1I1XA 2G96A 4JX6A 3SUVA 1XUZA 3LS9A 5I3JA 3MKCA 2V68A 4LVDA 4Q8NA 3C0JA 7A3HA 3S2LA 1UZ4A 4JX4A 4IMAA 4Y9NA 4LUIA 4LQ1A 3VNIA 4QSHA 5ABTA 4KFOA 3AHVA 3DJJA 4FX8A 1DIDA 1R7AA 3E6EA 3M0YA 1DNCA 4Y9OA 4HZ6A 2P0OA 3SCVA 4Y7EA 3N2BA 3QBUA 1JZ6A 4HU8A 9CGTA 4AMCA 3NVZB 2FKPA 4EMWA 2AAAA 1ZU8A 4DUOA 1DXEA 1OT1A 1ENUA 3H24A 3ZSTA 1JDCA 4PTMA 1VJIA 5H1WA 2YFNA 5BOOA 1OYAA 4NZ5A 1Z48A 4HMNA 4C60A 4HA4A 3KL0A 2E6DA 1PTGA 3TH6A 2CEQA 1GTEA 3R13A 3KWSA 1AQFA 2G97A 4R53A 4WSKA 1NDVA 2UV8G 1CEOA 4KMQA 4MJ4A 1FWRA 4M29A 4PBGA 3IUDA 2X1SA 1TV5A 2J7FA 4JKKA 2PGWA 2VFFA 3VDHA 3W83A 4AWTA 5C2XA 1LQAA 1TYTA 4HOZA 3U4FA 2GJXB 5TQLA 2ZIDA 3E0WA 1HGYA 4U5KA 3DFYA 4WJXA 5D2VA 1PTAA 4FOUA 2E8ZA 1N61C 1ZLPA 2ABAA 1LYXA 3ZR5A 5E0FA 1R0MA 4XIAA 1F6PA 2V5JA 2WHJA 3R12A 3OODA 1IXOA 1KLYA 4FB7A 1KNWA 5TNVA 1HJWA 5T8GA 1TWZA 1DJYA 3EA2A 4RXFA 3BLLA 3TYCA 3KBJA 1GOMA 4LC8A 3W1AA 1I8JA 4JN8A 1JEHA 4PRRA 1DWGM 4LVBA 1TJRA 1X39A 2RDWA 1ZRQA 4QS6A 3PBGA 3VFCA 5EMUA 3E3HA 4RLIA 4UTTA 5FJPA 4XWUA 4KH2A 1PDYA 2CC0A 1XL9A 2WMGA 5CH9A 1BF6A 3HBLA 3VK5A 2GR1A 4IUGA 1V59A 5HPOA 4BHYA 3PPHA 3MKKA 3MP5A 3RMEA 1REQB 1TPEA 4Y6GA 5DRCA 6PTDA 2ZRWA 3CV7A 3P3BA 1M03A 5BYWA 4F66A 4EF8A 3CGTA 1H6VA 4PEEA 1O68A 4ZO8A 4OV4A 3EPNA 3EKLA 1WPCA 1LPFA 1A3HA 4LEFA 4OQVA 2PDKA 4UMAA 4DYEA 3H22A 3RO8A 4N42A 1S2CA 1OCQA 3E5PA 3W72A 3TE9A 4P7RA 3GXFA 3THQA 3WLSA 4JQ3A 3IC9A 2ISFA 4O1BA 4J28A 1NFGA 4LU0A 3AALA 3MQTA 3OVRA 4RZ4A 4D1IA 2W5FA 4U10A 3ABSA 4RUBA 1OINA 1RQEA 1SFJA 1NOWA 2F5ZA 5JH2A 1JRCA 2E3ZA 5EB8A 4MY8A 2V5BA 3KLLA 1UR8A 1S39A 1OT2A 3LGDA 1KR1A 1FCQA 3JVAA 5A8OA 3STFA 4PEKA 4J5NA 1JUEA 3G0SA 5M03A 3KFTA 4H4VA 2GQAA 4G7EB 2OZ8A 3G3MA 4AWUA 1Q1RA 2V2HA 2OB3A 3PNZA 1EBGA 1KBLA 4J35A 1FXPA 3HQ1A 2ZRZA 1ZENA 3NUKA 1Q7ZA 2PDUA 2PWGA 2VT0A 4HN4A 5FSEC 3TV8A 2ZKMX 4JCLA 3TZFA 2FFCA 3MVTA 3N18A 3GDKA 3B0XA 3EWDA 1KC7A 3MZ2A 4C91A 2ZE3A 1GGOA 1UG6A 3ARZA 1KBJA 3TEVA 2AGKA 4XZ9A 4BF5A 2VC5A 3SFKA 5TF0A 1XRTA 3AJXA 4HGXA 3E49A 4AZGA 2PDPA 1XYFA 2CLHA 4EOUA 3PF3A 3COTA 1V6WA 5K3VA 4ZOBA 3MT1A 4LS1A 1MEHA 2GRTA 3FV9A 1EF3A 1WDSA 2X2GA 5C9RA 3V5FA 2XH2A 1E1CA 4UC5A 4QXIA 5FS9A 5CJ5A 1IT7A 3ARPA 3ZMRA 3MV01 4GINA 5F4XA 4UFKA 1KGWA 1DE5A 1QNOA 4QDMA 4V27A 4QLLA 4XZWA 1W1B1 2G4JA 3TNBA 1OGGA 3QF0A 4CEXC 1SW0A 1RCXB 2QKFA 3M0MA 3CLMA 2FDMA 3G1XA 3QV9A 5MHBA 3VCNA 1W3HA 2J8GA 4N0RA 2ZA1A 7PTDA 1DL3A 3ZIZA 3W7QA 3BG5A 4JTKA 4E4PA 2XM2A 3LLXA 5EU9A 4R9XA 5BXRA 2NQHA 4QQUA 1JCYA 2DZUA 4IL0A 1YXCA 4DUXA 5I3KA 4ICCX 4JTQA 5LNRA 2ZBTA 4QR6A 1TYGA 4YVPA 3ZO9A 3MHFA 1UH3A 3B8SA 2VZVA 2BGNE 2A7PA 4IPNB 4RX0A 4FHAA 2JGYA 1E56A 4OKDA 3NXFA 3LHYA 1U1HA 3A4WA 5K4XA 2P5NA 1ZX9A 4ZQNA 4O1CA 1OZMA 3BJFA 1H7NA 5GRTA 4AD2A 1FQ0A 5DY2A 1CIUA 3M6YA 1J4EA 5HUPA 3MUY1 3VI2A 4QLKA 3C8FA 4DM2A 3PZGA 5EY5A 3GXNA 1XC6A 4D6CA 2XVNA 3UYCA 3UWZA 3PBUA 1RCOB 2F6XA 1TPC1 1B3ZA 4CEUC 4GJ1A 3ID7A 5JIWA 1W6TA 4DEFA 4D6DA 1Q4NX 2BG5A 3G1FA 5HANA 1V0NA 2FPTA 3STGA 1XW8A 4CQAA 3JS3A 4CQBA 1JZ7A 2QDDA 3H7UA 3SIZA 3UZWA 3R0UA 2DUZA 2C8NA 3U57A 1UR9A 1MDLA 1JXKA 4J2MA 4N02A 3U4AA 1JJKA 3ARXA 4AVFA 2V3DA 3EYPA 2VOTA 1KD0A 1RVGA 3CL6A 4NEVA 1XJBA 3IIPA 3PNUA 2GPTA 2A1YA 2VFGA 5A6JA 3P67A 3F4NA 1GQJA 4J3XA 1KFBA 5G2IA 3UNTA 1QNQA 1LQ2A 3KX6A 4PMJA 3TW7A 4HN8A 4P7OA 5BCAA 5BMXA 3W1PA 2WYSA 3UWVA 2DUXA 3IJIA 1C7TA 3W7EA 2NVDA 1TREA 1AUSL 4A4AA 1GQIA 1RHCA 1KCKA 2C6QA 3T05A 5DELA 2CERA 4QJ5B 3OW1A 3W01A 5HUOA 1ISVA 1ML1A 1CCWB 2WO5A 5AOUA 3GD3A 3PTQA 3LCHA 1H50A 1I60A 5D2XA 2DT2A 1S5VA 4JEJA 4Z2IA 4S39A 5GJPA 4NNAA 3RNMA 1V93A 1VCVA 4GY1A 1IEXA 4IL2A 1FIQB 3NL6A 4QE1A 1B57A 1JZ4A 5D30A 3OBEA 1ZJHA 4XBSA 1VBGA 1U30A 1EZWA 4YWOA 4X0VA 5K9XA 2HPMA 2C13A 2YL5A 1OX4A 1VZWA 1EUAA 4LJ3A 3M64A 1VBRA 4TXEA 4CCDA 1X7IA 1IZJA 3CUHA 1VH7A 4FXFA 1IGSA 3VNYA 8A3HA 4AEFA 4F40A 3RNDA 1KM2A 1JGMA 4LCSA 3ES8A 1P0BA 3S1GA 1W3NA 4HP5A 3PTDA 5A2AA 3NSMA 4TO8A 2A6NA 3HG2A 4PCTA 5GNXA 2Y4SA 2Q01A 3C2RA 3FCPA 3GNOA 3FSUA 3EXTA 3HQPA 3WLMA 1KM1A 3GVVA 4DJDD 2DVTA 1VAHA 1T5AA 4EM3A 1Z42A 2PF8A 3EEZA 5G5IA 4H50A 3GKFA 1M9HA 2D2HA 4AAJA 3H7RA 4YNGA 2CLPA 4UWMA 4XV0A 4X61A 3AS3A 1K3UA 1XBVA 1MRQA 1IIHA 3EOOA 5AVNA 3SY5A 1OGBA 3N73A 3R25A 3MU7A 1WKYA 3ARVA 3UGVA 4KWOA 1RA5A 2VRKA 3O6DA 4XAGA 1ADDA 3RHGA 2NX1A 4GOAA 1E40A 3BZGA 4MSSA 3RDKA 4H8NA 2YFOA 4TIMA 3VKBA 1PL9A 2EPKX 3WMSA 2HJPA 1MI3A 4IFRA 1V6TA 4UOJA 4FX9A 1VBUA 2PCEA 2WW5A 1VC4A 1PIIA 1HJSA 2FQIA 1U22A 3PBWA 4WCJA 3UR2A 3UT0A 4J40A 4HJFA 3A47A 4MMWA 1M65A 1ZCCA 5FF3A 3DCPA 3S9ZA 4DO5A 1KW1A 3UESA 4LS2A 2HQMA 4GCAA 4PUEA 1UOKA 5C6MA 5CZ0A 2GWGA 4QAWA 1OFRA 2OTDA 3EDEA 2C16A 2PWEA 1HJUA 3GXTA 1L8PA 2BV9A 3S2MA 2DSUA 1XCFA 3NWRA 3I3BA 3OHMB 3L21A 3R89A 3WUGA 2CDUA 1FTXA 4CNUA 2FYMA 4P7LA 1LQ0A 1SMAA 4WKHA 5FCZA 2IMRA 4ZE4A 1LT8A 1RALA 3RLVA 3NQMA 3BG9A 1GRTA 3SRHA 1ALDA 4YXGA 4JFTA 5FL1A 1P0EA 5JUVA 1A0DA 1YEYA 1KRMA 4KEZA 5LNSA 1Q4WA 1QNPA 3V7PA 2CU0A 4QRNA 3U2OA 3SFWA 2HQAA 2YCIX 1PE1A 4Q8WA 1YQ2A 2EJAA 3WLIA 1WO2A 2H90A 1R9YA 3PUOA 4JTSA 1S3HA 2W3ZA 4QFUA 1K03A 1MWOA 3T09A 4JYFA 4B3ZA 4DUVA 1E70M 3L0NA 4MJMA 3RG6A 1DBTA 4UQCA 4GACA 3RYSA 4NT0A 1OSEA 1TCDA 5HNUA 1I4NA 2GVJA 4ZOAA 4XSMA 3TC3A 2B4GA 4EK7A 1HKWA 1HTIA 1NHRA 4Z2KA 3W86A 3WQ4A 1OG0A 4R34A 2ZX9A 4K1GA 5K2ZA 3W1RA 4QQ3A 3WLPA 1BGAA 3EKGA 3ETRB 1KXQA 2BY3A 3NXLA 1UD4A 1FCVA 5HNRA 4HSNA 1O5QA 3QR0A 4HOWA 1QDSA 3TWBA 1N60C 4B3LA 3USBA 3OYZA 2JF7A 1LL7A 3TQPA 4DBDA 1XYLA 3OA3A 2FJUB 4RNJA 3T8QA 5FS8A 1RBOB 3GXIA 1RY8A 1EJXC 3UYIA 1F05A 2VR5A 3EEGA 1PX8A 3VNZA 1TIWA 3RX3A 4LC6A 3FVMA 1ICPA 2XFRA 1Q2RA 3L8KA 4O4VA 2ZYFA 3ANUA 2XU2A 4GK8A 1EYWA 1KXTA 3HGJA 1DQXA 1YXYA 3CJPA 3UVAA 3OBAA 5IXEA 3G0UA 1W54A 3L7RA 2AQVA 4BWLC 3SQPA 2QPUA 2BY1A 4Z1DA 3LGEA 5D8WA 4H4PA 4L80A 1XGDA 2HK1A 2VEPA 4KIEA 3QR1A 4CQ9A 3SJ3A 3GYCA 1V51A 5HJYA 4FMVA 3UW6A 4B5WA 4LVFA 1W0MA 1NFBA 2Z00A 4KIRA 2PRLA 1MEWA 3VUSA 3L0GA 2A79A 5F4SA 3IRDA 1Q85A 3R07C 4QTGA 3W81A 1GV4A 3WBXA 3UG8A 1TKKA 4Q8QA 3WL0A 1FWDC 4YCOA 3BLDA 5HJXA 3MUCA 3LENA 1QI2A 3P2VA 2QDHA 1S1RA 4IG2A 1MO0A 1N5WC 3H2FA 4M5PA 3BWWA 5EBUA 5BRQA 1M1BA 3IARA 1XGZA 1FRBA 4XZNX 3FA5A 1N7KA 2G0WA 1BZLA 1DHKA 3CUFA 2QEZA 1GHSA 3MBDA 4W84A 2YA2A 4MOZA 2B81A 1MUCA 1NHQA 3VM5A 4G2DA 4NILA 3ITYA 3T44A 1Q3NA 1BSLA 3RIKA 2VUNA 3GTNA 3MYPA 5DN1A 2A3BA 4DXVA 3OA5A 4YLWA 3W1LA 1J12A 1AVAA 3WQFA 5D2TA 3WQWA 4CD5A 1C9WA 4JR5A 4PFHA 3VKDA 3REQB 2FB3A 2HZGA 1R38A 3CUJA 1EC9A 1V3HA 2QHAA 4WSHA 3EA1A 4HMDA 4EWND 1JG9A 4N4PA 3EOLA 3ITLA 3KEHA 4DPQA 4IMGA 1NIUA 3H26A 3NVYB 3S46A 4GYFA 3VIGA 1WA3A 3FS2A 1RBAA 3H70A 4FXRA 5LNWA 3LTPA 1F61A 3NDYA 2OOGA 3NPXA 3CB3A 1QNSA 2EAWA 5LA0A 3EPOA 2J4GA 2IQTA 2ZFAA 2R9ZA 3M4HA 2WHLA 4GVFA 2WBAA 5E6ZA 2QYGA 1ZCOA 2XUCA 4HSHA 3RGTA 1UJPA 4UIOA 3SDOA 1GEQA 3TX9A 4XUGA 1CB2A 4DJDA 3LADA 5AC5A 1JFHA 2WZIA 3WQDA 4APNA 1ICSA 3UA3A 3GVGA 3S47A 1HO1A 4F4RA 1TPB1 3UJSA 1JZ8A 3BE7A 3T2QA 2CZEA 2OELA 5RUBA 3IJ8A 4J2PA 2Z6IA 2W61A 3ELFA 4ZGYA 1F6KA 4W7VA 3GAKA 1XLIA 4GWEA 5B7YA 3A6OA 2D23A 3SB0A 4FPSA 5A2BA 3DFTA 1VIZA 3EB4A 2E1DA 2P8BA 3S6OA 4H00A 1S2UA 4LTSA 1ZDLA 3MZNA 1X38A 2I57A 2PC8A 1C90A 5IRPA 1PZ0A 2QCFA 3ZLFA 3LSBA 2BOEX 4CQCA 2W67A 4Z1CA 3ZS4A 1CXFA 4RZ6A 4QROA 1YE6A 1JUBA 2NUWA 4QCEA 4ZSUA 4GNJA 4WXYA 3MUXA 1TG7A 3MYOA 4PRWA 4B9ZA 3N9KA 3AISA 4XZHA 1TWIA 3O0KA 4C6KA 1ZMDA 2Z2AA 4UFHA 1EDGA 1A5MC 4AZCB 3M47A 1R46A 4FNSA 4UMBA 2NT0A 3NQBA 1S7MA 3EX3A 2R6OA 1S2TA 3TYEA 2Q3RA 2VZUA 1Q6DA 4PE8A 1OFBA 1FFUC 2BXVA 5HATA 1NHSA 1HL8A 4M8UA 1EGVA 1Q5MA 1J11A 3R4IA 2NVAA 3JZEA 1N62C 3BAIA 3HQOA 1VLIA 4GZJA 1B4EA 1D7KA 4KCUA 5HWNA 5I03A 4NZFA 4UOZA 4AHQA 1ONWA 1EEXA 1W9DM 2XSAA 5DLCA 2WZMA 3FFSA 1HKVA 4NG3A 2AMXA 1K7XA 2PB1A 2J6XA 4MY9A 1Q45A 5CPQA 4EWJA 3B40A 2GUYA 2ESCA 5DO8A 1DIOA 4W8BA 5CJMA 1XYAA 1H2IA 1E5JA 3URAA 5IBXC 4NZ1A 3SW6A 2I5GA 2QCLA 1H5VA 4IMDA 5DF0A 3BJTA 4MJ2A 2FGLA 5AZ0A 4R7WA 2A2IA 4U2ZA 4H9ZA 1ZBWA 4DQWA 4GJJA 5CPOA 3ZM8A 1JYWA 2A3AA 2OPJA 3QN3A 4AHOA 4MZYA 4TX8A 2J13A 3QC0A 4NI8A 3WF2A 4GBDA 3PWGA 3D9XA 3BOFA 3M0ZA 5FEZA 1EUNA 2PWDA 4GD0A 2VR4A 2R94A 2MANA 4YN5A 1PSCA 3WH9A 4CD6A 1Q6QA 1U33A 3AYVA 3RLHA 5IFPA 1KFJA 4U5IA 3TR9A 2WSYA 2XWDA 4OUEA 2QJNA 4O28A 5HMSA 1R2RA 2NPXA 3VA8A 2B7QA 3OTRA 4F0MA 3FA3A 5AYYA 3B8DA 4JEQA 3EKZA 1XLCA 2E0PA 3QKEA 4PMXA 3RRAA 4H9MA 1JCLA 3VX0A 2GH5A 4IP7A 3KBSA 3I7RA 4DN1A 4BF9A 2FGZA 3RMJA 4NNBA 3O07A 3ATYA 3N3MA 1ZBKA 1XH1A 2YDRA 3FKRA 3SQLA 3S5ZA 2ZA2A 2BXYA 2X0YA 1GRHA 4H4XA 3F5JA 2R1MA 1L2UA 3K8KA 3SZ8A 3CPGA 2BC1A 3KCLA 3STEA 4KRZA 4V1XA 3D46A 3NVDA 4L64A 5BW6A 2UY5A 2WP5A 5PTDA 3BLIA 1UD5A 4ATLA 4YS1A 1Q8JA 4YPJA 3T0BA 3TONA 2IQDA 4HJWA 2CFFA 3IUIA 2JALA 4PMNA 3SY8A 1Z7AA 3WJSA 1T99A 4GLEA 3A5FA 4AVNA 5DBUA 4XB3A 4J7RA 4GO8A 3ABXA 3W1QA 4IP5A 2GJPA 1KV5A 5H91A 4E2BA 2XTKA 5BRPA 2W9MA 3TSBA 1UQYA 2WV8A 5LA1A 5TR3A 3LQLA 2PGRA 1YPIA 3DN5A 3SEPA 3OJGA 4G9PA 2QF8A 4PFMA 5KETA 3HPSA 1UP3A 3L23A 2IPJA 4KGLA 1Q63A 4LY8A 1QI5A 3CMJA 2VVNA 1DWFM 4CQDA 5LHFA 4XD6A 2J25A 4V2XA 2W66A 3W6YA 4MKVA 3FOKA 5KZDA 3HN3A 3W2NA 1QPNA 3AIQA 4JFUA 2E9MA 3HPZA 4PB4A 1VHCA 4LUSB 3RUBL 3QPEA 2Z6JA 4KRUA 1MW3A 1E6ZA 3P93A 1BKHA 4Q6XA 4TQTA 2WJDA 1LL6A 3BCDA 1J5TA 1QVBA 2FIQA 4ROPA 1RK5A 3TA6A 3KVKA 3QM3A 1W5NA 1O12A 4K37A 3FYPA 2QS8A 1W37A 5GJMA 4H8VA 2ZX6A 1KTCA 3AXXA 3VINA 1SO3A 4MUPA 3LI0A 2W3SA 2RJHA 1KCXA 5MF5A 2OQHA 3C0QA 2XWEA 4UR7A 3M41A 1DHPA 3MUZ1 5CSSA 1W2PA 3ARYA 5I3IA 4PCSA 3ISIX 1EOMA 3AMZA 4LXFA 3FYOA 3BW3A 5CPSA 1MDRA 2RDXA 3LOTA 1JDFA 2VKZG 4L6HA 4DAIA 1NHPA 2OT1A 4I8DA 3CPRA 2OEMA 4AFYA 1UWIA 2GDQA 2EG7A 5AC6A 4IQJA 1H61A 5D9NA 8RUCA 1LLOA 3W2MA 5JMUA 2E5AA 1J93A 4QSFA 1RUSA 3QHNA 5T26A 1TPH1 4F3HA 1IWBA 3URQA 4C65A 4ONVA 2C0AA 3UPBA 1K9EA 1B3WA 4N6EA 3DBNA 3N04A 1CZ1A 4EKJA 4URIA 3UFYA 4RE2A 1EEPA 1OC6A 1JDAA 3EWUA 2MNRA 3P7YA 3OYXA 3DH9A 1G7VA 3CQJA 1XIIA 1TV7A 3W7DA 1YQZA 3V0TA 3DFPA 2GVLA 3V0UA 3KRUA 3W24A 3S6DA 3S8HA 1LJYA 4QG8A 3ITGA 3DYPA 1Q13A 3ITXA 5G5HB 3U5YA 4QE4A 2A3LA 3BSHA 3SQMA 4O8RA 1CDGA 3AIEA 4HYWA 2YA1A 1YDOA 5C71A 2ISDA 1EO5A 4XK2A 3T42A 4GE8A 2RJGA 1QPRA 3RO6A 3M6DA 3GHSA 2PWHA 1V7YA 2QMJA 5C8BB 3IJLA 1X1OA 1LG1A 5EA9A 4G7FA 4ES4A 1ECEA 3RPTA 3CEUA 3LHWA 1AQMA 3AIUA 3QY7A 4O0KA 3GG0A 1IE7C 3C2EA 1WOBA 4DNHA 2WOIA 3KP0A 3PZQA 1QASA 2Y0FA 1TCMA 3NFUA 3WD2A 1Y5XA 3A5VA 1XCWA 2XFWA 4H6KA 3QOKA 1DTUA 3AJ7A 2V81A 8CGTA 3VCCA 3WLRA 5FAJA 1B90A 3F2CA 1ZTVA 4BURA 4BK9A 3SRFA 3UWWA 9XIMA 1PKMA 5FI8A 1TIMA 3GXMA 3OP2A 3CQKA 1DJXA 4JTHA 1NOUA 3H6OA 1FKXA 2CBUA 3C3UA 4I9JA 4WK9A 1BWVA 2CLOA 2VGBA 3L4UA 3K4WA 2WNZA 4RZBA 3VIPA 4JQ4A 2RFGA 4ZXLA 3VKAA 4XTDA 6REQB 5AZ1A 1GRGA 3MI6A 4FSAA 4Z08A 1GNXA 1NDYA 3S1VA 4MKSA 1DEDA 5IDIA 1W5OA 2Z2BA 4M6QA 3VAVA 2D0HA 3D47A 4E3TA 4EPKA 4WY0B 3LX9A 3WLNA 5A5WA 4TMBA 4MZ8A 4OJYA 4A05A 3CYVA 3UCCA 3N29A 2V38A 3SN1A 2VX5A 5G1TA 4IHCA 1TVPA 4QM1A 2YZRA 4EAYA 2W63A 1ME9A 4G1KA 3CT2A 4DZHA 1XG4A 4MNKA 4RDWA 1XANA 3AIWA 2ALRA 1CGXA 2G3JA 4OZOA 1YNYA 4EMIA 1SR9A 2BFGA 5E70A 1G4TA 1JNDA 1I75A 4DY1A 4B91A 4JTTA 1FEBA 3Q58A 2XH4A 4E2VA 3NGJA 3C2VA 2DIKA 5U25A 4EAMA 1I9CB 4NL1A 1C7SA 3TYAA 5CG7A 3MO4A 3IV8A 4AISA 4GRSA 5FD0A 4DHGA 3CGDA 4Q4KA 1UWRA 2WMJA 4XD3A 4KESA 3KOFA 4GKLA 2EGZA 1SM9A 5JCLA 1TYPA 1RLCL 1OF8A 4HZ8A 3KLKA 5DBTA 3SI9A 5HDRA 1QPKA 1TTIA 3CLWA 2ZQ0A 3VC6A 4OT7A 1W9VA 1K8ZA 1BF2A 3W2JA 4E2DA 2C3ZA 1RQBA 1R8LA 3BPWA 4GA8A 4LWWA 3A24A 2AL1A 3GNPA 2V82A 2PDLA 3GFYA 2X0SA 2RUSA 3U3HA 1KWKA 3TC7A 4DBEA 1WUFA 2Y61A 4IGMA 1J0ZA 4HNNA 5FEWA 1MRAA 1BTCA 1XICA 3D5HA 4NAEB 4LBRA 3UWYA 2NQJA 1Z6KA 4C6OA 1GVRA 2W91A 2WSQA 4W7UA 2PP0A 3H21A 3TXVA 3N2CA 3LY0A 3E74A 3QPYA 3M1ZA 1GEHA 3PC0A 5E1QA 5CSRA 1XYZA 1Y5WA 1SQ7A 4GUGA 2PCQA 3O1NA 1SZGA 4JIRA 3ZT5A 5HNTA 1IXNA 1GVIA 2QJJA 4B16A 1OC5A 1ZY9A 4PMYA 1X2HA 1XISA 2FMOA 3IK2A 1UWQA 4MIMA 3DH7A 3QMSA 4RXGA 4KF1A 1JCJA 2RHGA 5D09A 4A2SA 3F2DA 4UZSA 1J2BA 4UFLA 1FWBC 1HZYA 3EWYA 3IRSA 3W00A 5B80A 3N6QA 1TMQA 1JPKA 3II1A 1LL4A 1RA0A 2VEGA 1SZFA 3BAWA 4TTUA 4ADUA 4C6FA 3UPMA 4J3ZA 3GR4A 3PB2A 1ICQA 2NQ5A 3GDLA 1FHLA 5LNVA 2C3CA 1PUDA 1RSCA 2ALDA 2PD5A 2WMIB 5AFDA 3DESA 3AMLA 3TR2A 1XQLA 3KDNA 4S1FA 5ABFA 1RCQA 4MKNA 3GH4A 3VKJA 3GG1A 4O1AA 4GZEA 5DY3A 3OC4A 3QFBA 2WVVB 1U5JA 3DYOA 3KVLA 1KRAC 5HMDA 2VEIA 3W85A 2E6FA 3B9OA 1QTWA 2ZUUA 3AYSA 4O8AA 1JXJA 3VM7A 1MQQA 2FVKA 4YTUA 3NYZA 4UCGA 2A3CA 1WDQA 1MXGA 4FNPA 4RNFA 3CH0A 4D6IA 2ZZ2A 1K4GA 5U7SA 5E9XA 2J79A 3NEVA 3RX2A 2XIIA 5G1MA 3QFAA 1T40A 1XYCA 3SCWA 1M68A 3CIWA 1WKDA 4H9XA 3TJXA 4ZA0A 4IXXA 3RM4A 2ZUTA 2CHOA 2F8QA 3WCZA 4B90A 1XSIA 3T55A 8XIMA 2OJPA 2GQWA 3DX5A 1W3LA 4QJ4B 2FH6A 4MNLA 3AS0A 3QJAA 4GISA 3IGXA 3TK7A 1CLXA 4P7QA 5A6BD 1UR3M 4AXKA 4GC4A 2NLYA 1ZUAX 4ZO9A 4AD4A 3O6YX 2J66A 3F5KA 3MCOA 1K77A 1TWDA 3WK2A 3M5VA 4E8GA 3KL3A 3T0AA 1KFWA 4JXCA 5REQA 4AZIA 4HYVA 2BMBA 1NSJA 3GW0A 1QO5A 5I6SA 2I16A 1ZB5A 2TPRA 1EYEA 2NWRA 5EBKA 3QZ6A 2RKXA 3BMWA 4NYUA 1Q65A 5AC7A 4LAZA 3M46A 1WKEA 1A5OC 5KEZA 1XIFA 1UPMB 4LCQA 4GQGA 2Q3OA 3W29A 3HO8A 1X6LA 3D3AA 1XBZA 3T40A 4J3WA 5G2HA 1Q6EA 3FHQA 4H9VA 3AICA 4AD3A 4IIEA 5I24A 4JTFA 2H3DA 1EA9C 4HZ7A 1EIXA 1JPDX 3EB3A 3LUTA 3BANA 4LFYA 5KINA 3L4ZA 2BY2A 1O5RA 1KQZA 3F4VA 3THCA 3UGRA 3TN3A 1R6WA 4PTWA 2Y6ZA 3GU2A 3N17A 3CT7A 4YCPA 2G3MA 1V02E 3KS6A 2R1LA 4AQLA 2BVWA 3KHDA 1JZ3A 1RD6A 1EJSC 3A9IA 1V79A 2ZDRA 1PEZA 3EDJA 3TXZA 2D24A 1OEPA 4D71A 4QHRA 2AL2A 2XINA 3BMVA 2ZADA 4E38A 3UBPC 3EMCA 2HBVA 3GRIA 3P0WA 3T81A 2FZ8A 4MUZA 3H23A 4RW3A 1UPPA 1XKJA 4WSJA 5CCZA 3EGJA 2Z28A 3QSTA 5TIMA 2BHZA 1MXSA 4UB9A 4QX4A 1EH9A 2YVJA 2FTYA 3QLLA 2DU2A 2X8CA 2EO7A 2OYMA 2ON3A 3LQGA 4HYRA 1SJAA 7XIMA 2DJLA 3QRHA 3UXAA 2ZZCA 4PMVA 2Z26A 4C6LA 1YBQA 5AYXA 5EL1A 1Q1WA 1EPXA 4O14A 3S2CA 1DQUA 3CZJA 1DYSA 5I7GA 3QW4B 3SR7A 3M0IA 3OGRA 2OGJA 3MUAA 1WNOA 3GDRA 6XIMA 3TZNA 4O1FA 2Q8ZA 3GXPA 4DX3A 4WDXA 4QGCA 5H8MA 2WSPA 2GK1A 3H2CA 3QYSA 1UHVA 3EMZA 3TOPA 4MNMA 4C7GA 1OG6A 3HTWA 1V08A 4K1WA 5J5RA 1MYRA 3KL5A 3KRSA 3FDGA 1IT8A 4NU7A 2ICSA 5FSDC 3GDTA 3GNNA 1SYTA 1WZMA 2P3ZA 5HK4A 4AEEA 1XRVA 3F2BA 3MMWA 2CLLA 3LTYA 3E0VA 3EDKA 1ONEA 1XI3A 3UJ2A 2PODA 2PGFA 1EDTA 3R94A 1F73A 3LPPA 1W5PA 1ZPTA 1Q6OA 3W0KA 2WWDA 2VR2A 1B2YA 3A7RA 3PANA 3HU7A 1GZ1A 3GU1A 3VGBA 1NM9A 1L6FA 2QJIA 4AEOA 3O16A 4P7NA 1TTPA 5I3DA 4MB4A 4ACZB 1VIWA 1FO4A 2VX6A 3GYEA 2E6YA 1SMDA 2FPYA 2O9RA 3KZSA 4D6EA 3K13A 3GR8A 5GQBA 3DFOA 4NSBA 3W82A 4KEUA 1VB9A 3GAYA 2CWXA 1DIEA 4EXAA 2D22A 3P0XA 1WX0A 3WQEA 4LF2A 1UMYA 2VDHA 1KWGA 3LTSA 1T0OA 3CHDA 1K6WA 3ABZA 4J57A 3U48A 3VD9A 2EQ8A 1D3HA 4YWIA 4ZSTA 1B4KA 3DGRA 1K70A 1AJ0A 5CPLA 5HWJA 2GJLA 1QHZA 3CAWA 1F3XA 3RFAA 2V5LA 2CBIA 3CXOA 1FA2A 3ARRA 5E09A 3BGGA 4S3GA 1H4PA 4FIRA 1TV4A 4R3UA 5A6KA 1KXVA 4Z17A 3SAZA 2Q8XA 1B30A 3R10A 4LRSA 3BLKA 3T0DA 5DXXA 4YL2A 4H7ZA 1RPXA 2D73A 2D2JA 3FAWA 1TPFA 2JIWA 1L6SA 3CMFA 1VYRA 3PG9A 2ZVRA 3TFXA 2GUUA 3MJYA 4RW5A 3WFZA 2E6AA 1J10A 2XG9A 4XBJA 5KZEA 1X7FA 3MWAA 3B9NA 5D03A 5CXPA 2QJHA 4B15A 3WF0A 4BWLA 4O52A 1BRLA 1GOQA 3W26A 1XYBA 3K1DA 1U1JA 1QBAA 3T4CA 1LZOA 4EMJA 1TVLA 3TQKA 2R1NA 3PULA 2ZICA 5CKSA 4GQ0A 1AMYA 2QGHA 1D2KA 1JPMA 3HJEA 3KAOA 3PZVA 2OYLA 1XPYA 1JF5A 1Q8AA 5DT7A 2O7SA 4OUIA 1FP9A 4B5VA 2QDEA 1HNYA 1MW0A 4XSLA 4QEEA 1GVOA 3FAXA 5FESA 1HKKA 2D69A 4QJ1A 1B3VA 4M80A 1LOQA 4N7QA 2VEMA 1V8EA 3ALGA 2VMFA 4PTDA 1BSIA 2B7PA 5HQMA 4LNYA 5A6BA 1WB0A 5DQPA 5A8QA 4A3RA 3DERA 5BU9A 1GKRA 5FIPA 1W9PA 4DO7A 1R85A 4LOCA 1D3GA 2C15A 3T2PA 3DC8A 3NO3A 2Z7GA 3LMYA 1RAKA 5I79A 3H2MA 3ARQA 3ZLGA 1GT8A 2GYIA 1DV7A 4QDPA 4MTVA 2QAFA 7CGTA 2VO5A 2R82A 4UXDA 4B3KA 1N55A 4KKXA 1S46A 2HROA 4REQB 1NARA 2DSWA 2OX4A 3SQSA 4UTLA 5AHMA 4DAFA 3T2OA 3ZFHA 4IXHA 1XGEA 5GNZA 4L1WA 2W54A 3V1HA 3A64A 4D6JA 3B06A 1YTKA 4ROQA 3C0SA 5FEPA 4GQBA 2WBGA 4JTLA 4BEUA 2R1KA 1GJWA 2CBVA 2D1ZA 2E40A 3L2MA 2J8TA 3WNPA 2DZSA 3CZGA 5FF2A 3SUSA 5G2WA 4F0HA 3W27A 4JDYA 4ZOCA 5F1VA 4EIVA 2VEKA 3EB2A 3WD4A 4ZQOA 4TVUA 1KTNA 4MHBA 4XAZA 4DM1A 3LPOA 2GR2A 2V0TA 2E68A 2PDGA 1K4QA 3P6LA 1P1MA 1SGJA 4XKYA 4EQSA 1EXBA 5J04A 5BNKA 5AYBA 4XZIA 4OOUA 3B8IA 3LBMA 2GGIA 1IXQA 1EP3A 2XVGA 5I23A 4LCRA 4NXKA 4MG4A 4PN2A 3HQNA 3M0HA 3DKJA 3APGA 3B9JB 5LYRA 3VD7A 3RM8A 5H2ZA 4FALA 2P1FA 2EEXA 1RQHA 1UR2A 4XAFA 1VYPX 3U7BA 3DXIA 3CK5A 2WC3A 3M43A 5CSUA 1K1DA 3C4UA 5C7HA 1HP5A 5CQ1A 5JIPA 3MHGA 4DZAA 3E0FA 1KKRA 1XDMA 4DO6A 4LAMA 1DQWA 3CM4A 4GNVA 4RZ5A 2ZC8A 1LP6A 3W25A 3MDUA 4OU1A 7REQA 1OM0A 3TA9A 1U1UA 5B7ZA 3ZR4A 4G1NA 2E1WA 3U9IA 3A13A 2PLJA 1T96A 1E0UA 2NLIA 4H3DA 3SCTA 3LRKA 1XDLA 4Q7NA 4D6HA 3E38A 5ABHA 4DYKA 4L61A 2WOQA 4B92A 4K7VA 4S3BA 3UD6A 4GUHA 3KOWA 2C1GA 4GCXA 1LUCA 4JTDA 3CASA 1DPMA 3GFXA 2OQYA 2CLIA 3DU0A 1ECQA 3PN8A 3HG4A 1VENA 4F9JA 4RV8A 2OKTA 1JAKA 2WLZA 3WLTA 2QUVA 3N1AA 3WBYA 1YNQA 2C7FA 5G4WA 3CEPA 4FA3A 5DEZA 5DCBA 3I6RA 3CV6A 4S3DA 5AYZA 4WY0F 2ZZ7A 4LB4A 3VIKA 1GK8A 4ILSA 2NXIA 4BEQA 4H4YA 1WE5A 4R88A 2V5CA 3GX9A 5IHSA 3W7CA 4YWSA 2H3BA 5D4YA 2AAQA 4L1XA 3O6AA 4BJHA 1M5WA 1UIOA 2ZUNA 4AZ6A 4DXXA 3V5OA 2HS6A 3NYDA 3FJLA 4C1NA 3BQ6A 5AC8A 2NV1A 4OBSA 5XINA 1HF6A 4O16A 4D8AA 1EFZA 1R86A 3F03K 1PKYA 5HULA 4ZL1A 3E12A 5TBOA 1IZCA 4Z2JA 4AD0A 4UTTC 5D9OA 5HWMA 2GK1B 1EIBA 4P2VA 2WBKA 1TTQA 4L4MA 1Z9AA 1GOOA 3P80A 4NASA 3VGEA 5EYWA 4CN6A 1E6PA 4GI9A 4E6MA 1XRFA 2VELA 4DYJA 1IR2A 1FWGC 5IBXA 3TP4A 3WEMA 2QPSA 3VDAA 1Z69A 4EE9A 1O4UA 4C5YA 4PUWA 2VD9A 3W70A 1I1WA 3NQGA 3K30A 1POJA 3KTXA 3TYDA 1EA0A 1ZY8A 2OEJA 4TVYA 4KS0A 3NPVA 2V8ZA 1RJQA 1ZJIA 2ZE0A 4BFAA 1V77A 2YBVA 2UWFA 4DXKA 4BZYA 1P5BA 4NRSA 3WQOA 3RLGA 2BOFX 2VQUA 1E71M 1XBXA 3SIMA 4AYSA 3EXRA 3LDVA 1VHNA 3TFCA 4I5RA 3GUWA 1UD6A 2WVTA 3V5CA 3QXBA 4QNWA 1HUVA 2FJKA 3OIXA 1SJBA 2WSKA 4P61A 2XM1A 2IKHA 3N6JA 4L7ZA 1AL7A 2CBJA 4Q8MA 4K8EA 1EJUC 2VDGA 1Y65A 3GO2A 6XIAA 2CZFA 4HBKA 4YIWA 3GC4A 4DLFA 5KVIA 1BD0A 1OYBA 4RR4A 3BSMA 2YAUA 1A80A 3KHJA 1V0KA 2ISSA 3B97A 3PZTA 4LAUA 4L4PA 2A3EA 3Q4DA 1QRQA 4EVZA 5AHNA 4MNJA 2EBNA 3QZEA 3TQVA 2NVCA 1FOBA 3NCOA 1PIFA 3CZLA 3AUOA 1A5LC 5HXMA 3QMTA 4QITA 1XLEA 2OO6A 3NZPA 1V5XA 4L1GA 3DKLA 1JQVA 2GJRA 1V0MA 4NAFB 3CZEA 4JX5A 2XVLA 2HNEA 4GXMA 3PTKA 3NTYA 3DHPA 3AIRA 4Q8UA 3QYQA 1ZHAA 3O9NA 3I7SA 3AM9A 3L5AA 1TA3A 1XQKA 5LIWX 3AMCA 3VVGA 2X09A 2CITA 2G3IA 2RH9A 3KE0A 3H54A 4U3AA 3KVJA 1JF6A 3S5NA 2V3BA 1E9ZB 2X1RA 1H3GA 5AYIA 4X3ZA 4O10A 1TRIA 2I5QA 1A49A 1F7BA 5C5YA 1EJRC 4EQWA 3SSJA 3MCNA 5D04C 3S6TA 3BK0A 2XN2A 4X22A 1IT0A 3PZIA 5EPDA 1H51A 1G94A 4GI8A 3VC5A 4S3FA 5I02A 3VMPA 1EPVA 3PUGA 4E5TA 3SBFA 3N2MA 4AY7A 1QHOA 2AKZA 3O63A 3CTTA 2HMCA 3W74A 3FGCA 3DHUA 3GFZA 3QHOA 2ZRYA 2A7NA 4MYXA 1BWKA 1LG2A 2W27A 1KM6A 4W9TA 4LSBA 5DANA 1NF7A 2Z1SA 1RM6B 3WF4A 2GQ9A 5ER0A 4XD4A 4F0LA 4A21A 4D2JA 2HV5A 2PF0A 4HNLA 5FF0A 3BGJA 5A6TC 5A8PA 3VD4A 2GGGA 2DIEA 3ARWA 2VZTA 2EG8A 2EF9A 3KM8A 1AZ2A 2XGZA 4H83A 1JCMP 1J01A 1FWWA 2G50A 2C0HA 4DRSA 4E2OA 1YLVA 2ZRXA 2JFEX 2I9UA 1ADOA 4A8IA 4UQBA 1HKJA 2F6UA 1QATA 3VOGA 3WUFA 4NF7A 3B0VC 2YR1A 4C6NA 1S3TC 2D3NA 4Y9PA 4HU4A 3SO7A 1EGMA 4H19A 4CD7A 2CYGA 3EBVA 4UFJA 3SUWA 1ISZA 2J7CA 3HZ3A 4NZJA 5JH1A 1FH8A 2VWTA 3IIVA 3W6MA 1FFVC 4N9DA 1IEVA 4Q7BA 1O60A 4LUTB 1O5KA 1OGSA 3B3DA 1XUUA 2CFYA 3VZZA 2J8FA 1ZBVA 1TTJA 2PDMA 4U31A 4AX7A 4Y2WA 3KRZA 2X99A 4ZQCA 3ZYZA 2INEA 1AL8A 2PDBA 2QCDA 4GUFA 4YTQA 6TIMA 4DF0A 1NF0A 1V3KA 4JNMA 3EX4A 2RABA 1H60A 4ECLA 1POKA 3DFSA 4XKYB 2KZHA 1SJDA 3VKCA 1H1NA 3B9DA 3OQEA 3P5YA 2GQ8A 1P7TB 1TRDA 2PTXA 3AHXA 3RU6A 2E9BA 3I10A 5EFFA 4DF1A 1IR1A 3NL2A 2IKGA 1GEUA 1C93A 4IPLA 2DT1A 3WQPA 3HRDC 1NFPA 2VM8A 2Y8VA 3WO8A 4F9DA 2C3DA 3M5XA 1Q6FA 3WUBA 1V03A 2EQ6A 1YDYA 2XFYA 1H1YA 3NS1B 1EP1A 3A4JA 3BAKA 4JTAA 3SCUA 3NSXA 4P5UA 1MW1A 4IFKA 3ZVHB 3NJ3A 5JQ9A 3WBAA 2IKIA 3UETA 1GESA 4UTWA 1D9EA 2ZRUA 4ZOHB 1OJTA 1B31A 5C54A 2GR3A 5BROA 1CB7B 1ZP4A 1QOXA 1IF2A 2XIBA 2YCLA 1WZAA 2PGEA 3KUMA 1J18A 1K02A 4UTHA 2DT0A 1GYLA 1LROA 2CW6A 3TYUA 3W73A 3P8JA 5JBDA 1US2A 3W1NA 1EX5A 3RILA 2ZOXA 4QBXA 1H0GA 1FEAA 3PFRA 3EA3A 1L2QA 1WXZA 4TVWA 1FP8A 4CCEA 4ZQPA 2BVDA 1XIMA 9RUBA 1TZ9A 4D9PA 1GZJA 3WDHA 2OLHA 2WANA 2VCCA 4WVXA 1MMFA 1V3IA 4HNVA 4JFSA 3BV7A 1MW2A 4IGHA 2OWCA 3IJQA 3GDMA 3DOPA 3BCJA 4K7YA 4E3VA 2B31A 1IYXA 2H9AA 1OC7A 1GPWA 1PIGA 3ZWSA 1L6GA 2EJ1A 1HL2A 3M07A 2DORA 5D2WA 3F5LA 4TR9A 1AH0A 3LD5A 4ZQMA 3R58A 2YBUA 3B8TA 1CXKA 4C1NB 4PUJA 1DIKA 2D20A 2QIWA 1X98A 4WRHA 3NM1A 1C8VA 4AZHA 4Q4OA 1BEUA 3UJFA 1WXYA 3GK0A 2WXDM 4A8LA 1QXLA 3TMLA 3PM6A 1OWQA 3E5BA 1J0KA 1MOKA 3TWAA 2WC4A 4DNAA 3NQEA 3EAUA 4RV3A 3BQ5A 3GNXA 1H7PA 4V1YA 5GPRA 1NAL1 4JTJA 3TVAA 1WZKA 1EJVC 4HK6A 3U8GA 3PZ9A 1N2VA 2PBGA 5DCEA 4MB3A 1AA1B 3HPFA 4MDPA 1XIGA 2JF6A 1UKOA 5XIMA 4HPGA 3WLLA 3PWAA 2VRJA 3VZYA 4JOMA 2EPNA 3EOEA 2Y5SA 3W1UA 1IZKA 3ZSSA 4EP8C 1R3TA 3BAXA 1NQ6A 3IGSA 2VEFA 4A29A 1GOIA 4H8UA 4I7WA 1ZL1A 2REQB 4MWAB 1XXXA 1PJ9A 2J24A 4LBUA 3QY6A 1DWHM 1VCGA 3ZQ9A 4FR1A 4DJEA 3FEMA 5G4EA 1JYXA 1PHQA 2A0NA 1JD9A 3NQ6A 2A3HA 1VLWA 5EMLA 4BS0A 2Z4GA 2V6OA 3DG6A 1CGUA 4C6DA 1A5BA 1GOKA 3CL7A 4JL2A 2WKLA 3W6LA 3HA1A 2XZ9A 5A8NA 3R0DA 4N2YA 1OCJA 5JXQA 4WJEA 1BYCA 3O05A 3UWQA 1YW1A 4AIEA 3IVUA 1JGIA 3WJXA 1XLBA 4ZO7A 3S5OA 3LRLA 1F2JA 1XLKA 3MJMA 2DZWA 3M7SA 1W31A 1ZK7A 1W5QA 1CXIA 4KT2A 1QK2A 3NQ8A 2JK6A 4LEQA 4YHEA 4AIOA 4M56A 2XIJA 4GFIA 1W1VA 3W88A 1DJQA 3FXYA 2OQLA 2Z7KA 4PCFA 4Z2LA 5C9UA 2ZXDA 7TIMA 2AKMA 3EWWA 3FHAA 1HJVA 3OOQA 4LAOA 5I3GA 2X8GA 3L9CA 4UUIA 1A5SA 3RITA 4AC7C 4R7JA 4MADA 2P88A 3UR5A 1H49A 3ZXWA 2QUMA 4I8YA 4ADWA 2GL5A 3MPGA 1K7FA 3U6WA 3BOXA 3IJ9A 3MMUA 3DG7A 4AU0A 1XLAA 3T0TA 2A8XA 4OWGA 3N19B 5EMYA 1KM3A 2ZWZA 2CXGA 2GSJA 4FO4A 4JL1A 4PMZA 4FP1A 2DY3A 4Y8FA 3WLJA 5LNUA 3R8GA 1MO9A 1JZ5A 1K7EA 3B8WA 1KFLA 1N8IA 4LV9A 4UFMA 1XLMA 3OPSA 4YHGA 3P81A 1YPXA 4GIYA 3MS8A 3R6IA 2PDWA 1UD8A 4NZCA 2O9TA 1E6NA 3LSCA 3CQ0A 3WFLA 1BPLB 4IJCA 1JQXA 4NJJA 1E3ZA 3CBWA 2VC9A 2LLEA 1VJZA 4K39A 3W07A 2L5HA 3G1VA 3ITCA 3TSMA 3S2NA 1UP2A 3M16A 1GREA 3WBWA 3K8MA 2ANUA 3SUTA 1OY0A 4YU1A 1MEIA 3W7RA 5L6UA 4A2RA 3HGSA 1Z32X 2J7EA 1TR9A 4KCTA 3U7VA 1XBYA 4Q8VA 3DDMA 3BLPX 3LGGA 3FSTA 4KETA 1SW7A 4US6A 1K8CA 2W92A 2Y8UA 1V4YA 1AW5A 2TAAA 4WLCA 1BGGA 4GKTA 5C0QA 3GWQA 1T8QA 4W4QA 1S38A 2A21A 2CZDA 2E5BA 1VFOA 4DWSD 2FTPA 3MMDA 1P43A 1AH4A 3L4VA 3Q37A 4KPRA 1DOSA 3QGAC 2F84A 2VX4A 4J4KA 5CZTA 3K46A 3OZOA 4WDWA 4C7FA 4IQLA 3HGRA 2Y24A 5M1TA 4ERGA 1A5KC 3BMXA 3LI1A 4DO4A 1JCTA 2CPUA 2ACSA 3G77A 3T7VA 1IIGA 1OADA 2HE8A 1N8FA 4WZHA 3AU6A 3ENLA 3W23A 2Z25A 1FWNA 3BURA 4JFVA 4MPQA 4XKMA 1P4CA 4WDUA 4O15A 1TV2A 3L2IA 1GOXA 2MUCA 3LZ3A 1L6YA 3EZ4A 1UP0A 4EQRA 1CLKA 4FAMA 4A3UA 3QOMA 3E2SA 4DJFD 1SVDA 1H62A 3BXWA 1KA9F 2BGQA 4EPBC 4MF4A 2YSWA 1JYVA 2A6LA 4AC1X 5LXEA 4C90A 3LB8A 3MA8A 2QAPA 1PKNA 2EPMX 2HRWA 2V2CA 3QW3A 6CGTA 4UOQA 2XIOA 2ZTJA 1CI1A 1LF1A 3APYA 2ZWYA 1EQPA 2VCBA 3KBMA 3WJZA 1ISXA 1LBFA 2D3LA 4DI8A 3THDA 4PTNA 1VPXA 2QCEA 2WWCA 5CBBA 2YB1A 4XD5A 1X6NA 5E9AA 4TOQA 3NDOA 4MB5A 4KPLA 4M82A 1SSGA 3P82A 3DFHA 4M3PA 3VNKA 3OLGA 1TPUA 1XINA 1W5MA 3RXZA 3MSGA 3Q94A 3PG8A 3WDJA 3FIGA 1QWKA 1ZGDA 5CZSA 4BY3A 4UTFA 3LA4A 1OB0A 2E28A 4JIIX 1JZ2A 1NWSA 1AODA 3CO8A 4RPQA 1A4MA 1WKFA 2FLIA 3B0YA 1UJQA 4GI4A 4DJDC 1EF2A 3NM3A 5FS6A 2VVSA 3GTXA 1EXPA 4S3CA 4KW2A 2GJXA 1ISYA 4FLOA 4PODA 2QMKA 3Q2DA 3UZZA 2YLAA 4H4RA 1E55A 4Q22A 4DNMA 4F79A 3Q45A 2XYLA 3BLFA 4GABA 2QT3A 3GRSA 4C7DA 3LPFA 3BJSA 2XISA 1W9XA 1OFAA 4CKQA 1ITXA 1MZHA 3SCRA 3E02A 3YPIA 1QW7A 2DGAA 4HNOA 1O66A 4UMCA 2HSAA 1E3XA 2AAMA 4AZBA 4LYKA 3W02A 4LH8A 1W17A 2W62A 2PFHA 3AN1A 4NIRA 3GVWA 2O4MA 3N4EA 1ADSA 3M7WA 1NY1A 4UFIA 5IHRA 1IGWA 2JKEA 2H8XA 3UZYA 1NP0A 4W86A 3DUGA 1JCNA 1V3LA 4HPJA 3QLDA 3G2GA 1REQA 1VPYA 3UPWA 3I3DA 3AIBA 1CECA 4ML9A 3UG3A 5GVJA 3UU0A 1C29A 1S2VA 2WQDA 4C6EA 3ABRA 4O11A 2XH7A 3HW2A 4NP7A 4HU3A 4H04A 4O0ZA 1TMLA 3O3RA 3WH5A 3ECQA 4Q8OA 2ZX7A 3CO4A 3S5YA 4CNOA 4QLJA 4ML4A 4BQ3A 3NA8A 1E1CB 2A5HA 3C6CA 4JTGA 1V3MA 2CNCA 3A23A 1VFMA 3MWCA 1SZEA 3F7JA 1OZQA 3WNMA 4I9MA 2Z2UA 3R79A 3L4TA 1WYGA 1OFDA 3DK8A 4C6CA 3ME3A 4JNYA 3FNDA 3KTCA 4B4FA 2O55A 4CVUA 5HAOA 4L4LA 1R3QA 3JW7A 3KW3A 3EX2A 3W28A 4RE4A 3AQUA 4GI6A 3PBYA 1GKPA 3DBPA 3GXDA 1GORA 1A0EA 1JDEA 4IMEA 1HVXA 3AWNA 1LTDA 4W87A 1LRTA 4H4QA 1HX0A 4OVXA 3GC2A 2E3TA 3O8AA 3ABQA 4G7EA 4AWEA 4UTJA 1J8VA 1PWLA 2TRSA 4H6EA 4Z2HA 1CGWA 1BQGA 3CC1A 2W3RA 2E5DA 3WLOA 4P8XA 4FZIA 4NJKA 4W8LA 4J3TA 2YYUA 3A3XA 4TX9A 1KR0A 4WOZA 1UROA 1GSNA 1TJPA 3E2VA 1VKFA 3DENA 2J47A 5CAHA 1E72M 4G8TA 4IPPA 3NPWA 4MJZA 4WKFA 1AH3A 4PUMA 2QZRA 3WUEA 4FEZA 3VGFA 4O4WA 1RV8A 1Q66A 5KVHA 2VD8A 5TAOA 3H2AA 3WEZA 1FVPA 1OBAA 4M0XA 2CLFA 3MVIA 2ZX8A 4W88A 4E8CA 2DSKA 2WOWA 4F0RA 2DEPA 1KM5A 4A6GA 5EGRA 3RX4A 1DJNA 2QCHA 2VTFA 3L5OA 4H4WA 1O95A 4FOKA 3EX6A 2V69A 3NURA 1EB3A 5HPCA 1TWWA 2FFIA 4XZLX 4N4QA 5I00A 3BL3A 1XX1A 1I45A 4X63A 1NDWA 1OFQA 2WQPA 3U5UA 5F4WA 3PP7A 2PD9A 4DWSA 3CAKA 4F0SA 1EJWC 5I5RA 4CCCA 1P6BA 4WGXA 4Q3MA 4TV5A 3RJXA 3PK7A 3OVQA 4FNTA 3TTQA 3IV3A 4A3HA 4XO6A 1V02A 5F1UA 3GBDA 1K6AA 5F2GA 4OV9A 2CESA 3KVMA 1U5VA 3QR3A 1JI1A 5LIUX 5BOFA 2NQLA 3OIHA 5DMNA 5LGXA 2P0IA 3C3NA 1M53A 1GQNA 2EQ9A 4Z42C 3LEPA 3MY9A 3IJ7A 4KEVA 3WF1A 1G01A 2VYOA 3WLQA 2UY3A 3LBOA 2WKGA 4HMCA 4O12A 2YVFA 3O06A 2DDXA 1TUFA 2E67A 4PYSA 1VRXA 4EQXA 2NSXA 2X7WA 1OD0A 3Q6JA 1PAMA 3CGBA 3CQIA 3R5EA 4US5D 3WZ0E 1OABA 3AXKA 3M0LA 1HXJA 3ZWTA 2YIHA 3EPMA 4DJFA 3PUEA 5CEWA 5FF4A 3CZ8A 2X40A 1TQXA 1FBAA 3DECA 4I9TA 2WAGA 3PWIA 1GQKA 4CCZA 4B5XA 5CAKA 1EGZA 1W3TA 3WH6A 1OFOA 2C1HA 1SFSA 3BICA 3UJEA 3GH5A 3EOUA 4GYPA 2IS7A 4GQQA 3N2OA 4AUBA 5C9ZA 2EQDA 3CAVA 1YYAA 3GTFA 4PCNA 2IXVA 4Z1BA 5CG0A 3T4WA 2C19A 3SRKA 4PA8A 3FX4A 1JEZA 3KRBA 3P74A 1FCUA 3GTIA 3NVWB 4JBRA 1KV8A 4LYRA 1OX4B 2DZTA 4JGDA 3TJIA 3FEQA 4OBRA 3IGHX 1E9IA 3WNKA 2EKGA 3CB8A 3CIXA 3KXQA 4Z2GA 1GW9A 3ABOA 2XH0A 4GC3A 2WCSA 4KERA 3G1YA 3GDBA 1CX9A 1OYCA 3FJ4A 2J9YA 2VFHA 3TMQA 1UUOA 4GVIA 3N4FA 2V5DA 2JKAA 1Q7QA 4D72A 1JIBA 3MC5A 3SCOA 3PJXA 3VNLA 1WAWA 4DBUA 2ZC1A 3HG3A 4O54A 3UG5A 2QVNA 2QXWA 1HKIA 5AHFA 4UR9A 2DVUA 3WG6A 4ADTA 3TTSA 4MM1A 4J1OA 3PPGA 4PUDA 1UKTA 1STZA 1AQ0A 1UZHA 1E6QM 3TLQA 3VABA 3RF9A 3UXLA 5GNYA 3UY8A 4I3GA 2QR6A 4L56A 4JHZA 3FJNA 3NZ1A 4PBFA 1BQCA 1KLZA 4NZ3A 4RKAA 1OVDA 5A6LA 3LHTA 5LIKX 5AC4A 4IP4A 2NXHA 3QH2A 3C2OA 3IGUA 3L4WA 5A8MA 3CHFA 1BYBA 4JIQA 3LM3A 4FX7A 4K68A 3BG3A 5LXXA 1AW1A 4O1DA 3GIYA 2BVTA 4O57A 3U2ZA 1EWDA 3SY1A 3ZJ8A 3AMKA 5BXTA 3PUDA 1ZQ5A 1ITCA 3VFLA 1AMKA 1XG3A 2DQXA 3HFTA 4AW7A 1GUVA 4OOZA 3F4CA 3C86A 3MDWA 2E9LA 3S1XA 2WNQA 5LZLA 2XSXA 4M24A 5C2CA 1I2RA 3G1RA 4I6KA 2IXUA 4ZTXA 1R3SA 3KZPA 1NP2A 1TB3A 1QOPA 3XIMA 4CLMA 5CC5A 4C1KA 5J8LA 1TWSA 3KP1A 3KBWA 3DAQA 3USZA 3EWXA