3P3BA

Crystal structure of galacturonate dehydratase from geobacillus sp. complexed with d-tartrate
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
385
structure length
377
Chain Sequence
LNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSSLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title CRYSTAL STRUCTURE OF Galacturonate DEHYDRATASE FROM GEOBACILLUS SP. COMPLEXED WITH D-TARTRATE.
rcsb
source organism Geobacillus sp. y412mc10
molecule tags Lyase
total genus 133
structure length 377
sequence length 385
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3p3bA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3p3bA01
3NZGA 4GMEA 3TJIA 3RCYA 4E8GA 2AL2A 1P43A 4GIRA 3IK4A 2PGWA 1R6WA 3R0UA 1XPYA 3SN0A 2PPGA 3ZVIA 2MUCA 1JDFA 4E4UA 2PU0A 3CT2A 1DTNA 4H1ZA 1SJDA 2GGGA 3JZUA 3V5CA 3I4KA 3GC2A 3DFHA 3GY1A 2QJMA 5FJPA 1ECQA 1BKHA 3T4WA 3CAWA 3TJ4A 3V3WA 3GD6A 1KKRA 2O56A 5BOEA 4GISA 4J3ZA 2P8BA 4K8GA 1FHVA 4K2SA 3K1GA 4GYPA 3RITA 1WUEA 1MUCA 4IT1A 3STPA 3ZVHB 3OP2A 3TCSA 2DW6A 3VCNA 4ENLA 3ES7A 2MNRA 2XGZA 3TOYA 3UJ2A 3R0KA 4M0XA 4DN1A 3U9IA 1NELA 3CB3A 4IHCA 1F9CA 3D47A 4HCLA 2RDXA 2QQ6A 2AL2B 4HPNA 3SQSA 3TTEA 4M6UA 1ONEA 2GDQA 3Q45A 4HCDA 3DERA 1XS2A 2XH4A 3T9PA 2XH7A 3DGBA 3D46A 2OZ8A 2OO6A 7ENLA 3S47A 3I6TA 3ENLA 1E9IA 2OKTA 3FVDA 1W6TA 1KCZA 4K1WA 4G7FA 3FV9A 2XH0A 2PODA 3SBFA 3PK7A 3UXKA 2PTWA 4Z17A 4HCHA 3JW7A 2AL1A 4JN7A 1WUFA 2PMQA 4Z1YA 3VCCA 3OPSA 2OFJA 3IJIA 2PP0A 4MGGA 3PWGA 2GSHA 3QN3A 4KT2A 3SSZA 3S5SA 3VDGA 4HN8A 1MNSA 3RR1A 3P3BA 3TWAA 2CHRA 5FJOA 3GO2A 2GGHA 3OW1A 4H2HA 1JCTA 1JPDX 3QTPA 1PDYA 4ZCWA 3U4FA 4YWSA 3P0WA 2GGEA 1EC9A 4KPLA 4DHGA 2QDDA 4KEMA 3UCCA 3KUMA 3UCDA 1YEYA 3CYJA 3OTRA 4FI4A 4JHMA 3RRAA 3QPEA 3MZNA 3TQPA 4H83A 3VA8A 2PP1A 3DG6A 3R10A 3EKGA 4E4FA 3PFRA 3RGTA 4ZA0A 2OX4A 2OG9A 3R11A 3TW9A 3VC6A 2QDEA 2PGEA 2P3ZA 4MKSA 4IZGA 1KKOA 3V4BA 3P93A 3ES8A 1IYXA 2PCEA 4IP5A 3DESA 3B97A 2OVLA 2XSXA 1TE6A 3NO1A 4J1OA 3CXOA 3UGVA 3PWIA 4JN8A 2QJJA 2FYMA 3R25A 5J04A 3BOXA 2OQYA 3N6JA 1SJAA 1RVKA 2P8CA 3SN4A 3H12A 4FP1A 2P88A 1MRAA 3DFYA 4GGBA 2PS2A 3BJSA 1BQGA 3OZMA 4MMWA 1EC7A 2PP3A 1SJBA 1MDLA 3UXLA 3SN1A 3H70A 3SJNA 3H7VA 1EBGA 3ZLHA 4A35A 3DDMA 2HZGA 1EBHA 4DWDA 3V5FA 2XH2A 2OLAA 4E6MA 2AKZA 3QLDA 4IL0A 2ZC8A 3JVAA 2PA6A 3R1ZA 4IP4A 4KWSA 5FJRA 1PDZA 3ZLGA 3IJLA 2OZTA 3N4FA 1MDRA 1R0MA 3UJRA 4F4RA 3FYYA 2PU1A 4E5TA 4EWJA 2ONEA 3MQTA 5FJTA 4DX3A 1KD0A 4HNLA 4G8TA 3CK5A 2HXTA 2GL5A 3NFUA 4X2PA 1NU5A 4HNCA 2QVHA 3UJFA 1SJCA 2GGIA 3TWBA 3BSMA 3MY9A 4GFIA 3OZYA 4A3RA 2I5QA 2FKPA 2PTZA 3RO6A 2P0IA 5BOFA 3FCPA 3I6EA 3THUA 2POZA 4GYPC 3VFCA 2HXUA 3UJSA 2AKMA 6ENLA 3VC5A 3FXGA 2OPJA 3MWCA 3ZLFA 3MSYA 3H8AA 2PSNA 2QGYA 2ZADA 4DYEA 3T6CA 3N4EA 4IL2A 2PTXA 5IDZA 5FJUA 3T8QA 3QKEA 3UJEA 4A6GA 3EEZA 1FHUA 2OZ3A 1JPMA 3N6HA 2QJNA 3DG3A 2NQLA 5ENLA 1OEPA 3DIPA 3MUCA 3NXLA 1TZZA 3IJQA 2DW7A 2GGJA 3MKCA 4DXKA 1EC8A 4H19A 1L8PA 2PTYA 1ELSA 3ZVHA 4ROPA 3DG7A 5EU9A 2HNEA 3HPFA 4HYRA 4GGHA 3DEQA 2OQHA 3FJ4A 1TKKA 1P48A 3Q4DA
chains in the Genus database with same CATH superfamily
4O17A 3Q37A 2WWDA 3TTOA 1WV2A 3MHFA 1D7FA 4GQ0A 3K30A 2ZZ3A 3RU6A 3GD3A 5K2ZA 4S3AA 4H7ZA 3NVTA 3IJ6A 4Q8OA 2V9DA 2WM1A 1UWIA 3QZEA 3VIPA 1ZBCA 4E3TA 1DXIA 3THAA 1N62C 1KCLA 1GW9A 3CLMA 4IFKA 4RE4A 2ATMA 3T4WA 2DQXA 2PCQA 4OU1A 2W6RA 1VBUA 1H60A 2PWHA 2ZE3A 4GXMA 2R91A 3ORWA 3S5NA 1VPYA 3TCSA 4XWUA 5AKQA 2ZUMA 5A5WA 3K5XA 1E55A 4C6CA 1GK8A 3UW6A 4GZJA 2WOWA 4IHCA 1PE1A 3G24A 3MVTA 3H55A 4GH1A 3E0WA 2V3FA 3O0HA 1MW3A 1BLIA 1EA0A 4LYPA 3O0KA 3TX9A 4X2RA 1O5KA 2GOKA 4S38A 3QHMA 1FWJC 1W5PA 4EPBC 3LERA 1XS2A 4ADWA 3KBSA 2XH7A 3D46A 4O12A 3E38A 4XIMA 3V5OA 4QNWA 2OWWA 4DUVA 1I2PA 4EIVA 4AZCA 4FB7A 1XDIA 1BF2A 1CT5A 2EPLX 3FGCA 4TX9A 5K4XA 3EKZA 1HGWA 2I56A 4IG2A 4WJXA 2PODA 3BLKA 1C9WA 3GVGA 4X9SA 5EBAA 4HCHA 1M7JA 4F40A 4KWOA 3EDFA 1XQKA 4W85A 3C8NA 4UFKA 2J7DA 3PSVA 5CLWA 5PTDA 4NYUA 4HYWA 3QN3A 4KT2A 3S1UA 2E3ZA 4H7CA 3BCJA 1WA3A 3TMLA 1JDCA 1MNSA 4MWAE 2DZXA 4PUUA 1E9ZB 4ZEPA 1YDOA 4RNFA 2GSJA 1E9YB 4FIRA 1FCQA 4ZOBA 5CBJA 1G9HA 1QOXA 4M51A 3CMGA 1Z48A 1OZMA 4ZVJA 1EC9A 1B9BA 4OHQA 4WQ6A 4FXJA 4OWGA 2QDDA 5AHFA 2Y5JA 1W9UA 1ZK7A 2C15A 1FKWA 5DMMA 1VEMA 3MKKA 4WR3A 4CD6A 1UC4A 2A79A 3PHAA 4LX4A 1W91A 4UTHA 4GXPA 1ZAJA 3HGOA 3W7HA 2AQVA 3TAOA 3KLKA 1GJPA 4CCCA 4XAGA 4NNAA 1AL8A 2ZZ0A 4PMDA 2ZTKA 4ZA0A 4AD1A 4JFSA 3R11A 5C2CA 1WKYA 3LADA 2P3ZA 4LCRA 5C70A 4PMJA 3SO7A 4JKMA 3WH9A 7ODCA 1A5LC 3ES8A 2QIIA 3IUIA 1NWRA 5DBTA 1S1PA 3B8IA 4AAJA 4GRSA 3EB3A 2FYMA 3PFMA 4ZGYA 5CPTA 5A94A 3CTLA 5BWAA 1KR1A 1PB0A 1XBXA 4L4MA 4DBUA 4NHVA 1M65A 2H8ZA 1PTAA 2IW0A 4GGBA 3DFYA 2C1HA 3PWAA 3REQB 4H4WA 2UZ9A 1KQYA 3P5YA 3DFNA 1SR0A 1U5HA 3PM6A 3N73A 5EMYA 4M29A 1BVZA 3NG3A 2YR1A 3A6OA 3G6MA 3KZSA 4H01A 3B8DA 3CZEA 1C9DA 1EBGA 2OEMA 3DDMA 4JFUA 3PR2A 3V5FA 2WHLA 4OIFA 1TZ9A 3W0KA 3VFLA 5BXSA 4OOZA 3CAKA 2ZRXA 3OVRA 3T08A 3WD4A 3O8AA 1YQZA 1ZJBA 4NP7A 5CSRA 2ZC8A 4AEFA 1AD4A 2YDQA 4DBWA 2XZ7A 3UWQA 1PV8A 1XYBA 1NFBA 2TODA 3AIVA 3DX5A 2VOTA 1CXIA 1MDRA 1HG3A 2O92A 1L2QA 4UQBA 3WK0A 4N0RA 4J3VA 3V16A 5M3WA 3UESA 3W1TA 2QUUA 3N14A 4DNAA 1XIIA 4F9DA 4ZO6A 3EUB3 1OYCA 1VJZA 2CLEA 3CV2A 1GONA 3VOHA 3QV8A 5HULA 2XSAA 1AJZA 3OZYA 4N9EA 4NJHA 1UWRA 1GOXA 2HNHA 5DFAA 3I6EA 2ZZ6A 5D8ZA 3VU2A 3G3MA 3EZ4A 4X3ZA 1W0MA 2CPUA 3WJWA 6ENLA 2OPJA 3TFCA 1JF5A 4WDWA 3VNJA 4QJ3B 1ME7A 1IZCA 3QJAA 2ZDRA 1LTDA 3KLJA 3T6CA 1EYEA 3ARSA 3RX2A 1OT2A 3N4EA 2WMFA 1L6WA 1P0DA 4PBFA 3VNDA 1HXJA 4AZBA 4L4LA 4TVWA 4GINA 1ZKQA 3BW4A 5AZ1A 4ZO9A 1OEPA 3O3RA 2X2YA 1GRFA 4RLIA 1YE6A 3UR2A 5ABFA 1XFBA 2EBNA 3VKBA 3VE7A 4S2CA 1ML1A 3OJGA 2PDWA 3GC4A 1IGWA 3E5PA 5LNSA 2R9ZA 1OC7A 4M5PA 2WVVA 4GBDA 2HNEA 2R1LA 3HGSA 4Q8PA 2VUNA 4KIEA 3IV8A 3NIYA 1EA9C 4P7OA 3GQYA 3NZGA 4I8DA 3W73A 3DUGA 2QUNA 4P8UA 2AQOA 3ONBA 1R6WA 1N63C 4JZ5A 1JFHA 4UTLA 3TZFA 5KTLA 2DSUA 1RZMA 3D6NA 1VS1A 2QV4A 3NSXA 2H90A 3W2UA 1GVIA 2YCEA 4AF0A 2WLYA 3II4A 3CO4A 1E5NA 3WLSA 3BCFA 3HFTA 1ECQA 4QTGA 4D6JA 1VBGA 2ATSA 3HURA 1I1XA 1W3NA 1W1B1 1CLXA 3K4AA 4JTRA 4K8GA 4UUIA 4XVEA 2QCMA 3W3OA 1MQRA 4LPCA 5IOBA 1OJXA 3UETA 1SYTA 1W2PA 1XLLA 2IMRA 4BS0A 1I2QA 2YDRA 3VGDA 4NEWA 2MNRA 1FBAA 2DSKA 5LIKX 1IXOA 3GBDA 3F7JA 2DJLA 2YKKA 2JIWA 4Q4KA 4FNPA 1K8YA 3HOJA 2I16A 1VH7A 2C3CA 1ONEA 3M41A 3TVAA 5LNVA 1WBHA 3CQHA 3FA3A 3NVWB 3ZYZA 5HNNA 4CVWA 1YXDA 3ARPA 1FFQA 1GYMA 1H1ZA 2X8RA 1TPVA 2QGHA 2CFFA 5BWFA 4PH6A 4R7OA 2YB1A 3O6DA 4O28A 4N7QA 4CD8A 3FV9A 4GCXA 5CKSA 4IIBA 3NPXA 3PK7A 1EDTA 3WQDA 1TVPA 1MFVA 2YFNA 2IKIA 1XKYA 3WN6A 4C6OA 1S46A 2VWSA 5HXMA 2BXVA 4CQDA 1XBYA 1WB0A 1KXQA 5DCBA 3LG3A 2JKPA 2PB1A 1ZZMA 1SZFA 3LLDA 5FJIA 2GVJA 2OTDA 3N2XA 4HA1A 3KZPA 2VHLA 3TJLA 1FDYA 4HMEA 3LPFA 2PWGA 1W37A 1SPQA 3ABOA 4CN4A 1PZ2A 2GGHA 1N61C 1R9ZA 3LCWA 3Q6JA 3GR8A 1V3MA 4DJDD 4FMVA 5A8QA 1TWIA 5DBUA 3QFBA 2GGEA 1CZ1A 4MJMA 3T42A 2V2DA 4FHAA 1HJWA 1SMDA 2DORA 4BI6A 4DM1A 1H11A 3LLFA 1YEYA 3DHDA 3EX6A 1EP1A 3FLUA 1BXNA 2ZRYA 1S2AA 1T41A 1TV2A 4UTUA 3TZNA 2V3GA 5AOUA 1IQ8A 1C92A 5HBFA 4XIAA 1TE1A 2WC7A 4JDYA 3HIJA 3ZT6A 4AG0A 5I3IA 4GQBA 1PEZA 4WY0B 1POJA 3M6YA 4H41A 3TN5A 4BK9A 1DJQA 1C7SA 4LUJA 4L9ZA 1VRDA 3LI1A 3NWRA 3BQ5A 3OLIA 3WLNA 2PDXA 2XPKA 4C6JA 4ZB2A 5TF0A 3CHEA 2WMHA 4N6FA 4L1WA 4JYDA 2W3ZA 2VD9A 4C6MA 4NAFB 3CUZA 4X61A 3D3AA 5E6ZA 1KM6A 4APNA 1IEQA 1W3HA 3M0ZA 1O5XA 4MPQA 3DHPA 4YTRA 1J79A 1KTCA 3MVIA 3UXLA 3KOFA 5I02A 1X6LA 1MYRA 2WYSA 1V02A 1FX6A 2EF9A 1GQIA 4DNMA 3ZLHA 3EA3A 4JQ9A 3UNTA 3UG5A 1Q13A 3MMDA 1PX3A 2QUVA 3W23A 1RCQA 5DX7A 3TN3A 1ISXA 4R9XA 2AKZA 5HQLA 1UBSA 4KETA 4WKAA 3QBUA 1J11A 1XH1A 3JVAA 4QJ4B 3B4UA 5FJRA 1S5WA 1PDZA 2W62A 4M82A 5KVIA 1FWIC 4LS2A 3S9ZA 3N9KA 4OJYA 2V82A 4R7JA 1NFPA 3DKJA 4FXFA 2VC5A 1DIOA 3WJXA 4UTWC 4IPLA 3VMNA 3RAOA 3H21A 4G8TA 1R3TA 3O7UA 3RM9A 4GWEA 1XH0A 3LD5A 2GGIA 4I7UA 5JH2A 3QC0A 5AZ0A 1SZGA 4ORMA 2J4GA 2NVDA 5I23A 3IV3A 1BHGA 3A7AA 1T3QC 4R53A 4XSLA 4US5D 3L4YA 2J3NA 8TIMA 1LYXA 3CASA 4JTIA 3UYCA 1W5QA 1Z6KA 1DJIA 1ZFJA 1JD7A 2VEGA 1SW7A 1WBJA 3ZLFA 2Y6ZA 3CT7A 4L4OA 3KL0A 4OUEA 3LGDA 4HMDA 3UWUA 1PIGA 4G56A 4GYJA 3A12A 8XIMA 5G2HA 1ZCOA 3PZVA 4PUJA 4J28A 3N1AA 1MO9A 3S6TA 2Y88A 3IJDA 5C7HA 2WW5A 3V1HA 3CQKA 4GLEA 1TZZA 3IJQA 3NQ6A 3CUJA 5LSMA 2OGYA 3LCHA 2GJRA 5CG0A 1CECA 4JY9A 4HU8A 2F7FA 1JUKA 2QAFA 3G1DA 4H7VA 2FZ9A 3GFZA 1UKOA 3EOOA 2I5GA 4YTTA 1TYGA 4V15A 4QG6A 3W74A 1WO2A 3VD5A 3CGTA 3EOEA 1UP0A 1TKKA 4LXFA 1L6FA 4B5VA 2V5CA 4O50A 3BAWA 1T6MA 2G50A 3VTRA 3GXPA 3HM7A 1CWYA 3UXAA 3GDTA 4QITA 1CXEA 1P43A 1WZMA 2NUXA 3GTFA 3MCMA 3SRFA 1XPYA 4H6KA 4J9JA 3ZVIA 3NVVB 2RAGA 3HN3A 2VZTA 5RUBA 2X8CA 4C60A 3LCIA 1LPFA 3P67A 3ITOA 5DLCA 3V0SA 1GVQA 4JIRA 3GY1A 4PUMA 3LGGA 5FJPA 1PUDA 1ZUAX 1XISA 3PZOA 1NHPA 3TJ4A 2PGFA 4KCVA 1QI0A 3CMFA 1MXDA 1ZALA 5C9WA 2J66A 4MWAD 3THQA 2O7SA 4YIWA 1FHVA 2DDXA 3NO5A 3AZRA 1SZRA 5T26A 3J7HA 1B30A 1I60A 4QE4A 3RITA 4MKVA 3UYIA 1Q6RA 3ZVHB 3NQ8A 3OP2A 3G0SA 3WDRA 4M80A 4C6BA 3WDPP 3M7SA 3ZR6A 4HK5A 4H6EA 2PDBA 4Q32A 3P14A 2X1RA 3W26A 2Y5EA 3UR5A 1NELA 5LIUX 4DWSA 3D47A 1ICQA 4H4XA 4HCLA 1YMYA 3WUGA 1B31A 3ARUA 4JTQA 2A7NA 2ASHA 3E2SA 4P8WA 4PCSA 2C0AA 3MO7A 1P1MA 5J8LA 4NZ1A 3W24A 4U28A 2WZEA 5FSEC 1UA3A 1ZP3A 3W81A 3WQ4A 4FR1A 3NSMA 3G5EA 1FWFC 2F6KA 3I6TA 2WHKA 5AYYA 2OMAA 3ZR5A 1WZKA 1XQLA 4EOUA 1W6TA 3UG8A 3Q2DA 3P82A 4HHMA 3NQVA 4K1WA 4IFOA 3V18A 1B4KA 1MQPA 1DWAM 1S2VA 2HPIA 4PMNA 3H2NA 3RX3A 1DXFA 3VDBA 4HHLA 2HTMA 1FEAA 3IPWA 1T0OA 5DY2A 2RGLA 1Q85A 3LCGA 1PKLA 1V4YA 1JRCA 1HQTA 4GZEA 3O9NA 2D3LA 4LRSA 2ACSA 1N8FA 1ISVA 1Q6EA 1JJKA 4DEFA 3K13A 2AL1A 4FA3A 1LQAA 2OYMA 2XG9A 2GWGA 1ZLPA 3ATYA 2BB0A 1QK2A 1NOFA 1ZJAA 2Y7FA 2VDIA 1I8JA 1V6XA 1VENA 4Q8UA 2QCFA 1TZ7A 5ER0A 4RNHA 1UJQA 2J77A 4LBRA 2WC3A 4AU0A 3CYVA 3M5ZA 4PMZA 4I6KA 4JQ3A 4PRTA 4Q3MA 4IIGA 1N2VA 4WSKA 1C8XA 4AXNA 3KL5A 4XQ6A 3SQLA 4BHYA 2GQAA 4PZVA 4DAIA 3H2AA 4YL2A 2QEZA 2OEKA 3VNKA 3UD6A 3SW6A 1STZA 5JH1A 3QMSA 5A8OA 2ZCGA 3GB6A 4RW3A 4FLSA 2DPEA 2BY1A 4HP5A 1HL2A 4AQLA 4DXVA 1A3HA 2WAGA 5D4YA 2REQA 5D32A 3VC6A 1RD5A 1H1YA 4NXKA 1P6BA 3RYSA 3ETRB 4PFMA 3V4BA 5REQA 3WNKA 5A8MA 4DZ5A 4QG8A 5LNWA 4N9DA 1CI1A 1WKEA 1JEZA 3M44A 4HSOA 4MUPA 3I7SA 3MCNA 5CZTA 2C0HA 3BH4A 3M5XA 3OGSA 1BG4A 3RCMA 1B2YA 1UW9A 1AQFA 4Q4OA 5BU6A 3UGRA 3NL2A 3DHUA 1ISYA 3GU2A 3OYXA 4HMCA 4DJFA 4HYVA 1RVKA 2P8CA 4RPQA 4CNUA 1YRRA 3E74A 4NX5A 3TP4A 1P5BA 2J24A 1UA7A 1M53A 3KBJA 1XM3A 1HJUA 4QLJA 3QGAC 1H7PA 1YBQA 3AIWA 1ALDA 1QO5A 2DU2A 4IIHA 2ISSA 5C54A 1PCKA 5EL1A 5BNKA 3QFWA 1DE5A 1Q3NA 1FWCC 4CQBA 4NNCA 3WNNA 4F48A 5IRPA 2CLLA 3URNA 1UIPA 3KOWA 4O1CA 2V2HA 1E4MM 4AZ6A 2E28A 1FH7A 3P61A 5BU9A 1UR0A 3EXTA 1JDAA 1E0VA 4CD7A 4M1BA 4MNJA 1W3JA 4JGDA 3GK0A 2D24A 4DJEC 3BMXA 1JRBA 3FDGA 5FS6A 4CCEA 3M46A 4NASA 4H6RA 1E1CA 3D0CA 1A53A 4S3EA 4OV9A 4XZNX 2CWXA 3LV6A 5CZJA 6TAAA 1B4EA 2WXDM 3NFUA 1OFPA 5AVNA 4HNCA 2QULA 5I06A 1MMFA 1OF6A 3N3TA 5C5YA 3XIMA 4AMAA 1RUSA 2PLJA 5U1OA 5HJYA 3A24A 4TIMA 2I9UA 2P0IA 4XUYA 2V30A 1A5NC 1TV8A 2RGMA 2NPXA 2POZA 4C90A 1EHNA 3W84A 3NM3A 2B4GA 3CPUA 3CB8A 3N11A 2Y8KA 3BDKA 3E2QA 3VC5A 1XKJA 3CV1A 4JPGA 2E7FA 2QGYA 1EF2A 1X39A 3RO8A 2VCCA 3LS9A 3OGVA 1CCWB 3O6AA 2BXZA 4LYRA 4MSSA 1ZQ5A 4BURA 3I3EA 1Q6LA 2Y8VA 4RZ5A 1DXEA 4JQ1A 3VDAA 4BF9A 2NQLA 3GTHA 1IF2A 4W89A 1TJPA 4ROQA 3EGJA 1MUMA 1WPCA 4OZOA 3GTXA 1YPIA 3WNLA 5C2XA 1RCOB 2UY3A 2D2JA 1M7OA 1RV8A 3R43A 2VNCA 1ECEA 3POHA 2BC0A 1AA1B 5JCLA 4QBXA 4PMQA 3A21A 1TTQA 3UZWA 2HVNA 1EPVA 2Z1BA 3ZQ9A 4C6PA 4DXXA 4BR1A 4UXDA 3AIRA 4EQRA 2V0TA 1AQ0A 1E72M 5CBIA 3TCEA 3N3MA 1XICA 3B3DA 3UXDA 4DUWA 3G1AA 1W3KA 1ZHAA 2JEQA 4E4UA 5LIXX 5G4EA 4D6IA 3JZUA 1N8WA 3BJTA 3W2LA 3WLPA 4QE5A 2CYGA 2YVGA 5D05A 4WGXA 1VFUA 1SFTA 1EJ7L 1O12A 1BXCA 3LN3A 3MCOA 3UZJA 4KCTA 3PB2A 4K2SA 4X9YA 2FDMA 1UHVA 1AFSA 3H22A 2A8XA 4ALDA 4G7EB 5FACA 1MEWA 5BCAA 1G4SA 3GHSA 3H7RA 5HJLA 1EJSC 1W1ZA 1WAWA 3GS6A 1W3IA 1WYIA 1KBLA 1YNYA 4HCDA 1V3KA 1V3HA 4K8HA 3GXFA 4NJJA 3V75A 3AS3A 2ZOXA 2OZ8A 1HO1A 3DYMA 4Q8QA 2Q01A 3MP4A 3NDOA 3G1XA 3L4UA 1JCJA 1E9IA 4PTWA 1PX8A 1DJYA 5AYXA 4JKKA 1U83A 4L9XA 3EPOA 1MXSA 2INZA 4LY4A 1XYZA 3H2FA 3RILA 1EBDA 2Z1VA 2JK6A 2BV9A 4Z17A 1GETA 3NO3A 4HJWA 4HPJA 1JZ5A 4WJEA 4LF1A 2A6LA 4JHZA 2W61A 1BVWA 4MVAA 1J8VA 2NQ5A 3R8GA 5K7JA 3WJZA 4J2PA 3ZSTA 1QRQA 3DFTA 3TN6A 4AH7A 4D1IA 1Q45A 4TVDA 3VGGA 1JCTA 4R7WA 5LXEA 1KFBA 3I68A 3OA3A 1GEHA 1H5VA 1R2SA 1F3PA 5FI8A 2WQPA 4ZB0A 1W5NA 2D0HA 3EDEA 8A3HA 1GERA 4UFHA 4E8CA 1KFJA 3FHQA 2XIQA 3GHTA 4JHMA 5A95A 4ADUA 5FJJA 5U4NA 1BTCA 3M0VA 3VZZA 3K8LA 1JCLA 1CGWA 1OD0A 1LL7A 3VA8A 3B0XA 3AIQA 4YTSA 2P76A 3MYPA 3DG6A 3AUJA 1DYSA 3IGUA 4IPPA 4Z0JA 4Z1BA 5LNRA 3CEUA 4UTTA 1XLIA 2ZZ4A 3THDA 3U5YA 4XZIA 4IGMA 4MKSA 3AHTA 2QW5A 3GIYA 5CPQA 3P93A 2CIPA 4U2ZA 1O1ZA 1GOQA 2A3LA 4GH3A 1Q4WA 5CC7A 1BWVA 2A4AA 4DJDA 5HMDA 2WJFA 2A3AA 2BVDA 3CQIA 3GH4A 4LIIA 3RG6A 4DAFA 3MI3A 1EHAA 1V7AA 5HATA 5EPDA 1UZHA 2E1WA 1E3ZA 1G5AA 1EUAA 2OCZA 2ZX9A 1BYDA 4HNVA 4GO9A 3ZFHA 4BF7A 4LCSA 4O19A 2P1FA 2VURA 1LCOA 4PMOA 1BYBA 1HF6A 2CLFA 4QSHA 4KBXA 1LL4A 1TVLA 5A3HA 3WZ0E 2WZMA 7TIMA 4B3ZA 5MHBA 4RPPA 4Q6JA 4WK9A 1RBLA 1A3WA 2GJNA 3LV5A 3VYLA 4MJ2A 2J7GA 1PZ0A 3GRSA 4D6FA 1GVRA 3MANA 1LWIA 5EMMA 3WNOA 4XUGA 1H7RA 4RV8A 3NURA 1KFKA 4NX0A 3VKJA 1TMQA 1X1OA 1KM0A 4XZMX 2CZEA 2Z25A 3K2GA 3FEMA 4AX6A 1L6YA 3MV11 3WKZA 1VLIA 3AXHA 1TQJA 1QBAA 3CWOX 2E09A 1TB3A 3FYYA 2A5HA 1G7VA 1OYAA 3REQA 2DGAA 4DX3A 3NL3A 4INFA 1T8XA 2F2HA 4NUWA 1H7OA 2HXTA 1T8QA 1JI1A 3Q58A 3WMLA 2O7QA 4B92A 4IPJA 4A8RA 4WJ8A 4PBEA 2XDFA 4LY8A 5CGQA 5CZ0A 1ITUA 2JF6A 4JNYA 4CVUA 1EZ2A 3QR3A 2XTKA 3WBXA 2RDTA 5FS7A 1QUMA 2Y1HA 4PTXA 1J18A 3W1RA 2CLMA 1ZNNA 1BD0A 1G67A 4EACA 3L68A 2NXGA 3GXDA 1QNOA 2YA0A 4RE3A 2QJIA 3LXDA 4UOZA 3T8QA 3RM4A 5ABEA 3CWNA 2R1KA 1C29A 2WZTA 1QNVA 4ZBCA 2AMXA 4MPKA 1I2NA 3O07A 3H54A 4CU7A 1G69A 1F7BA 1JEHA 3B8VA 1D3CA 3C2VA 4H19A 3A47A 3L4ZA 3A22A 3RLHA 3IAPA 3M16A 4OGZA 4US5A 1FWSA 3HFYA 1B90A 4GGHA 3WUFA 2WV8A 2J88A 4IJRA 4Q8TA 2WC4A 4MAZA 4GJIA 1H7NA 4EX4A 3E0IA 5GPRA 4YVVA 2WNZA 4C1NA 3WBEA 1U2YA 4M52A 5HPCA 1GW1A 2PGWA 1ZBWA 2WWCA 3ID7A 3WL1A 4E4PA 4JBRA 3FA4A 2WKLA 2E5DA 1LBLA 4Y9MA 3GDBA 5G4WA 4XTIA 4F0HA 2XVNA 3VOFA 3FYOA 1E71M 4Y7EA 3NPWA 3QQ0A 3IACA 1QI4A 4DLMA 2ABBA 2E9MA 4IPIA 3VOCA 4B15A 2XFWA 2KX9A 5IFPA 1GOKA 3AXXA 4XBJA 5D2WA 2Z27A 1JL8A 1XXXA 1I6NA 3N2BA 3QOKA 3WQCA 1ISZA 1F5ZA 1A5SA 4H9VA 1W9DM 2DT0A 1J96A 4GKTA 4GI6A 4D72A 4C6FA 1VJSA 4F2TA 3GG0A 5D38A 3QZ6A 2DH3A 3QFEA 2H9AA 2AL2B 4TV5A 4AIOA 3I3DA 3MMWA 3WDQA 2E6FA 3KCOA 3UU0A 4L7ZA 1VYRA 3S2NA 2Y7GA 2JKAA 4CKQA 3AU2A 2BVWA 2DZTA 3T07A 8XIAA 3CTTA 3VX1A 4J3TA 4MWAA 4CGTA 4ZFCA 1FH8A 1PHWA 3WELA 3CU2A 3NQ2A 1AUSL 3WF4A 3BGJA 2UY4A 1K9TA 1DJHA 1G7UA 1TMLA 3GDRA 4WSJA 1KTNA 4ATDA 4BKNA 4Y9PA 5CJNA 1GT8A 2VL4A 4XVDA 1F2JA 4XB3A 4N9CA 2TSYA 3M0IA 1VEOA 3IAQA 1IV8A 1HO4A 2ZZ7A 4AEOA 3S8HA 1NF7A 2VQUA 1WXJA 3BWWA 4XTDA 3MJMA 4X22A 3GR7A 5JXQA 1JZ3A 1R9YA 4ACZB 3UWVA 1UOZA 3BC9A 4I90A 1LP6A 1NF0A 2QCLA 2FGZA 5E6YA 3W01A 2VWTA 3SUTA 1OFDA 3BG9A 1PKNA 2Z6JA 4AWUA 5CXPA 2WZHA 3HPSA 1I2RA 1VQZA 3G6LA 2R8WA 4J4KA 4X0VA 3NS1B 1EP2A 3W7GA 3WD1A 1F6PA 4J7RA 2ZUSA 2GVYA 2GQWA 1HJQA 3S6OA 4MNLA 3NCOA 2QAPA 1GKQA 1SQ7A 1GKRA 1DL3A 2XN1A 3W70A 1WQ5A 4DNHA 1SW0A 3VMPA 3GYEA 3PZGA 3MC5A 1RY0A 1XR2A 3WD3A 3ZM8A 1FXQA 3HG5A 3R7MA 3EPNA 4FI4A 3IRDA 3GFYA 5HMSA 1UKSA 1XLMA 4NAEB 4ICNA 3LXCA 3SCSA 4M7TA 3F2BA 3C2OA 1LG1A 3ISIX 2WOVA 1WAUA 1DWJM 2NQZA 3N2CA 2PDPA 3TW9A 4Q8NA 1TMHA 4A3QA 1R38A 1XLCA 1OFRA 1KB3A 4ADTA 1R3YA 1V6TA 1OHLA 3LTSA 3MUAA 4MYAA 1NAL1 3AC0A 2CHNA 1W3LA 3L0NA 2GQ3A 1SFJA 2ZFAA 1B3WA 3W28A 2WSQA 3LNMA 2VX5A 3L5LA 1JZ8A 3QQ1A 4FIQA 4JN8A 1GSNA 4IM4A 1XANA 4HZMA 1E43A 1GQNA 3RUBL 3DFQA 4GHRA 4W87A 2I57A 3N6JA 4K7VA 1TPFA 1QHPA 1XLJA 3GNDA 1E40A 2VKZG 1WOAA 1PZ3A 5AC7A 4MMWA 1IWBA 3WDJA 2XFRA 3L5OA 1ZX9A 3QYSA 5D04C 2E0PA 1A5KC 4L1XA 3VKKA 1FWRA 3MUXA 1TPDA 2PLKA 2TYSA 1HZYA 4ZTYA 5G5GB 4QLLA 4LUIA 2ACRA 1RBAA 4KEUA 1AH3A 2QZRA 1V3JA 5G1MA 4UTFA 2VZOA 4A05A 1UR4A 1UG6A 3O06A 2GVGA 4QIUA 4O52A 2PA6A 4PL1A 3P6LA 4GUJA 2IPFA 4AYSA 1B57A 4F66A 3KVKA 2YXXA 4LH8A 1JR1A 3TXZA 3R79A 3BMWA 5E0FA 2PD5A 3AZTA 2WSYA 4CLMA 3GG7A 2EO7A 3I65A 4HNLA 4WOZA 4JTGA 5F7UA 4H4SA 5ABGA 3AS2A 2BY0A 5IM51 1NY1A 1UR9A 1X2HA 1OG6A 3WYZA 1X6NA 1YYAA 1LUCB 1EJUC 4OE7A 3WLRA 4RDZA 4LUYA 2CLHA 4H9YA 1Y5WA 2OJPA 4UR8A 3WQOA 4PMRA 1KFEA 5C9RA 1BWCA 1IEIA 1JOAA 3IGSA 5DF0A 2FIQA 5EMKA 1JCMP 3GR4A 6XIAA 3VILA 4KESA 1IT0A 2Q71A 4JTAA 4Q33A 1TPB1 3C6CA 1HFBA 1DORA 1OD8A 3TC6A 1WX0A 3RMEA 3M5YA 3VIIA 3IS4A 3RJYA 3ARQA 4DQWA 4WVXA 4DF0A 2X41A 3EEZA 4ZZ9A 3PZMA 1L8NA 3BUVA 5I00A 1QJWA 3V35A 3N04A 4O0QA 5ENLA 1Q4NX 4E2BA 4LWWA 5KZ6A 3V1PA 4DXKA 1U33A 2IQ0A 4WLCA 1FFUC 2RDUA 4QQ3A 4LVDA 4BWLC 3C3NA 2AAQA 1E51A 3C2FA 4HPHA 3AUOA 1RD6A 3JUGA 3LTPA 6PTDA 2YA2A 2FQIA 3WLOA 4ROPA 4ZE4A 3HQPA 2G96A 5CBBA 1GPFA 2VEMA 1V0MA 4P7RA 2ZQ0A 1P48A 1RBOB 4DB7A 4LRTA 5JCIA 3C4UA 3H4WA 3PAOA 2EQDA 4NJKA 1CXLA 3PZUA 3BMVA 3LZ3A 3SRDA 4HA0A 4HK6A 2YCIX 3G2GA 2VDHA 4JFVA 1WDPA 1HP4A 1JGMA 4QG9A 4GI8A 4QAIA 1LDCA 3TW6A 3DGRA 3V7PA 3FSUA 1E5JA 5MKGB 1SO6A 2X8HA 3SEPA 3AYRA 4K68A 5AYZA 3F2DA 5TBOA 1WYGA 5FD0A 1KM3A 1S3HA 3QZAA 2VEPA 2GK1A 2Z28A 3BXWA 1O1HA 1X8FA 1UZ4A 1BVNP 1N5XA 2Z7KA 4R88A 4I7WA 4AFYA 1VC4A 2NSOA 2CW6A 3CL7A 4O15A 3T0BA 4HSNA 4RR4A 3CUFA 4B91A 2Q8ZA 1NDZA 1US0A 4MLJA 4B9ZA 3M47A 2O9OA 2GDQA 3ITXA 3QV9A 1A49A 1XIFA 2NV1A 2YXOA 5CSUA 2FH6A 4YU1A 4L64A 3HGRA 1VZWA 1HNYA 4YHGA 4RDYA 2WQDA 4MB4A 4DZIA 3TQVA 1U5VA 3CUHA 1R7OA 4XX6A 4D9PA 1J2WA 1NHRA 4OFCA 1XRSA 1KM5A 1TTIA 2QUMA 3DK8A 1C93A 3TFXA 1NM9A 5EBKA 4HBKA 4NJIA 2XFYA 4Q8MA 3AFBA 5FF3A 3SCVA 5HMFA 1BRLA 1RP9A 2VX7A 3ARXA 5KITA 2PC8A 1M68A 3T2QA 2PLCA 4GIAA 1DV7A 3GTNA 4XV0A 4JIQA 4I5UA 1JCNA 4L56A 3NL5A 1R3QA 4GOAA 4HT3A 1UC5A 1Z8AA 5DT5A 2PMQA 2ISFA 4NZ5A 1M9HA 3OPSA 3UR7A 1GTEA 1N60C 4GX8A 2XHYA 3PWGA 1U1UA 1PIIA 2GR0A 2EQ7A 3S1GA 3CL8A 2ISWA 1HN1A 3GBEA 4RKAA 3RR1A 3P3BA 4MFDA 4YYCA 3TYDA 3OW1A 1YW1A 2ZUVA 1ME8A 2JEPA 1TPH1 4A8LA 4AVNA 4HU3A 4Z08A 3T4CA 2F8QA 1MQQA 2QCDA 2PURA 1PWMA 2WPBA 4IX0A 4EMWA 1O68A 5C9XA 4GR1A 4H6QA 3UCDA 2GUBA 3CHDA 5JCKA 1BTMA 3VD4A 3WMBA 3PTDA 1W1YA 3B8UA 4PMVA 1W9VA 3QXBA 3FSTA 4I9JA 4NY2A 4DBSA 2NV2A 5A8NA 4BA0A 1X7FA 3R2GA 4Y6GA 3B03A 3MA8A 3ABSA 1FOBA 2Y61A 4M1RA 2QDEA 1A0CA 1KA9F 4LAUA 4JTCA 4W93A 1UWQA 4LUTB 4HOWA 2E3TA 3PBGA 3EDDA 4Q8WA 3SQMA 3GDLA 2CLIA 3MP3A 3KDOA 1P7TA 1PXGA 3HPXA 4I6VA 1EJXC 1XLBA 3DAQA 4ZQNA 1GOIA 3B0VC 4Y8EA 1M01A 1U5JA 3P5ZA 4IPNB 3BAYA 1P0BA 1XC6A 3BJSA 3YPIA 3HZ3A 3E96A 4FX6M 3RHGA 1VHNA 3AJXA 2G41A 1NIUA 4XD3A 4REQB 1KM4A 1EC7A 5G1TA 4HZ6A 5FEXA 1DWHM 2X42A 3VI2A 3GVVA 4M7SA 1HKJA 4B5UA 2QPXA 4S3CA 4HZ8A 3CNYA 4KS0A 1DJWA 4NZJA 1GNXA 1L2UA 4GA8A 1TWWA 3HPZA 4MY8A 1WDRA 3CZJA 3W2JA 2WPCA 4LUSA 2TAAA 2KAUC 2DSZA 2YYUA 4O1AA 3ZWTA 5FESA 2VJXA 1QNRA 4FOUA 3IJLA 4KFPA 1ME9A 4P7NA 3N4FA 1R0MA 3MMUA 2PU1A 4YMZA 5HNUA 4E3VA 3I7RA 1D2KA 3M0MA 4H4YA 2ZIDA 4GVGA 2EKCA 4H8HA 3IVTA 3SY8A 2CKRA 3SI9A 2XU2A 1XYLA 3B8WA 1NU5A 4AD5A 3EWBX 4U4MA 3TWBA 3SCUA 3MY9A 1ZU8A 4RX0A 4BF5A 3PUEA 1NDAA 1W5MA 1RK5A 2R1MA 5JMUA 1TPWA 4P5UA 4Z1AA 4ML4A 2BNJA 4GRTA 3KRBA 4FEZA 3TK7A 5D33A 1FVPA 4JL2A 5AHNA 4MKNA 3NQDA 4M19A 5FOOA 4IGSA 4CNOA 1EGMA 1IE7C 3NSNA 3ZSSA 2W67A 1OB0A 4Q4RA 1XPGA 4ES4A 1Q8JA 5HAOA 4DYEA 1S5NA 1X2GA 4EPDC 2QMJA 1W9BM 1YNQA 2VZSA 2VC6A 1OIFA 2GVEA 2CXGA 2BP1A 2F9RA 2Y5SA 3FA5A 4GBUA 4Q4QA 1XC4A 5D9NA 3OHIA 5FAGA 1WXZA 3OODA 5I3DA 3M7WA 4AYGA 4TVCA 1R47A 5D9OA 1DJXA 1YDVA 1S2WA 2J7FA 2B7QA 1Y5XA 1CXFA 4JTFA 3HPFA 2ZUUA 3UY8A 4J35A 2L5HA 4LAKA 1EJVC 1Q8AA 1WDWA 4O1FA 1NARA 1G1YA 3CQ0A 2EAWA 3AHYA 4E8GA 1XHGA 3VIGA 3OZOA 3LM3A 3P62A 1K03A 4UTWA 3VZXA 1D3HA 4LVGA 5F4WA 1KXTA 3EX2A 3PP7A 3AICA 3BV4A 1EGVA 1FA2A 4J27A 1SJDA 3WD0A 4F8XA 4EP8C 4ZO8A 4L80A 1GKPA 1TR1A 3V3WA 3WY1A 5BOEA 3EWWA 3W7LA 9RUBA 4XO7A 3WH5A 4P8VA 1QNQA 1SR9A 1TFVA 3OG3A 5DEZA 3K1GA 5I78A 1RHCA 1OZQA 3LHTA 4E8DA 3VGEA 1GG1A 1OK4A 1RQEA 5AN7A 4IQEA 5CPLA 5AHIA 1A47A 4LYQA 3WEMA 1TPC1 4JTKA 3TROA 2J78A 2W79A 1HGYA 2WP5A 3EOSA 5DANA 1E6PA 5HMEA 3UJ2A 5G5HB 4CD5A 4DN1A 2ZZCA 3E2RA 4JX4A 1EWDA 1JI2A 3AWOA 5DO8A 3ME3A 3QOMA 1V5XA 1GVYA 1YADA 3R58A 5HR7A 1Z42A 2ZC1A 3CS2A 2XH4A 3T0DA 4RXGA 1UKPA 1LBMA 1AMKA 1IEVA 3SM0A 1IWAA 7ENLA 1XDLA 1H4PA 4IFKB 5D03A 5D9MA 3BLEA 3MSDA 1TV7A 2Z1XA 2PDQA 2J6XA 1UMLA 1WDQA 4MYXA 4DYKA 1H5YA 2XGBA 3ITTA 4BQ2A 3OB8A 4G1NA 3E12A 2PTWA 2CWNA 3UA3A 1GRGA 4H9UA 4JL1A 5CPSA 1G6CA 4XAFA 4XAPA 5D09A 2J6VA 7PTDA 4GY1A 4O4VA 2UBPC 1UUOA 1ZTVA 2PP0A 2YBTA 4F0LA 3N25A 4NNBA 7CGTA 1KRMA 2QCEA 2WKJA 2X1TA 4HN8A 4EM4A 3IVUA 1ITXA 3W4RA 5FJOA 3GHUA 3BLFA 2QPSA 4POCA 3BW3A 5IHSA 3L4XA 3F5JA 3W1MA 5BOOA 2XM1A 5C9ZA 2WPEA 2ANUA 1ZB5A 2C13A 1OF8A 4O4WA 4AZCB 4HKPA 3UCCA 1QBBA 4KGJA 3GUWA 5I3KA 3HG4A 5HINA 3FGCB 3CYJA 3R8RA 2X30A 1CBGA 2A3HA 3HJZA 4IG2B 3TQPA 1UYQA 1GVSA 1EDGA 1MI3A 2VFEA 1EP3A 3R10A 3AYSA 1EL3A 5LA1A 4RL3A 3GSMA 1TA3A 3PVFA 2OG9A 2WNQA 3F4DA 2FGBA 4FS9A 3OG2A 3BLPX 2G97A 1RJRA 3DI1A 1ZSXA 2BHZA 4NRRA 1IIGA 4GI4A 1GJUA 2X16A 3W75A 4AIEA 3CIXA 2R6OA 4PSPA 3STEA 1AW2A 2E6YA 3EDKA 4ERIA 3O05A 1GREA 4DUXA 1PPIA 4CN1A 4KWWA 3G1VA 2O4QA 3AHVA 2ZA3A 4EQSA 5ABTA 1SJAA 3TEVA 3FHAA 3BLDA 4MZYA 2CCRA 1MZRA 1OCJA 2YDSA 2UV8G 2YZ5A 2VZUA 2PRHA 1OIMA 2ZXAA 3OO2A 1GQKA 2JKEA 5IDIA 1YX1A 1TUXA 3WK2A 1KV8A 2HVOA 3K4WA 3IIZA 3KCJA 3WNMA 3S1WA 5K9CA 1GORA 5XIAA 3ONCA 4IICA 1A5CA 1JNDA 1M04A 2OLAA 2ZVIA 4EXQA 1V0LA 2OELA 4UQ9A 4H4IA 1GHRA 5LNUA 1MEIA 2H3DA 3B0UX 3SAZA 1B9ZA 4DWSD 4O18A 2DQWA 1TPUA 5E09A 3SUUA 2QUTA 5K3VA 1RVGA 1KLZA 4F4RA 4E5TA 3NR0A 4F79A 2DH2A 5IBXA 1XG3A 1C3FA 2WCGA 2BC1A 3MQTA 3PANA 1UASA 4IIDA 4O53A 2VC9A 3W6LA 3GHRA 4D8LA 1DPMA 1UWUA 3LU2A 3MUIA 4AY8A 2WBGA 2Y7EA 5KMYA 4CCDA 1OWQA 3CLWA 3FY1A 3EF6A 3MPGA 3K1DA 2D2OA 2I17A 1TIWA 4BCEA 3BOLA 1Z41A 5F4SA 3QY6A 1RPXA 5BOFA 1XH2A 1QTWA 2NQHA 1YTKA 3G0XA 2PDUA 3M0XA 4GUFA 2WANA 4EQWA 1J0JA 5FIPA 3VPLA 5KSWA 5HANA 2Z29A 2YXGA 3S3GA 4G5DA 3WMCA 1JPHA 3K8KA 4IUGA 4GVIA 1RCXB 3AS1A 4ICMA 1V79A 3M0KA 1W17A 2C79A 4C6DA 4DO6A 1Z44A 1CGYA 4KERA 4ZSTA 4DBDA 1Q1WA 1Y5VA 4WGHA 3KDNA 4JQ2A 4W7WA 3LX9A 3UG3A 3MKCA 3TTQA 2XVGA 2YAUA 2ALRA 3GFXA 1KNWA 1H62A 3N9RA 4GUHA 1AZ2A 4LNYA 4YNGA 3S5ZA 3CHFA 5I07A 4Y9OA 4RJEA 5EU9A 4PTVA 3GZAA 5D2TA 2GZXA 4HYRA 5LKYA 2FZ8A 9XIAA 4QGCA 1A5BA 2PEVA 2J75A 3A5VA 3IIOA 1RPKA 3B4YA 5GQBA 3F5LA 4DJEA 1QI5A 3A3HA 4MAVA 4O0ZA 1NOWA 2YCLA 2Z00A 2DZSA 3DK9A 4QX4A 2FZBA 5LYRA 2VGIA 2G4JA 3H4GA 2E1DA 3M6DA 4H4QA 4IGNA 3NYZA 1DTNA 2GQ8A 5JIWA 2J7EA 4Z2HA 1BWKA 2NLIA 1D7YA 1W1PA 1PO9A 4PRRA 4JTHA 4LSBA 3LEPA 3WFZA 1S2TA 3N18A 1LWHA 1ZCCA 1EZWA 5ABFB 3C0QA 4JCMA 1H0GA 1QFEA 1WCGA 2YB4A 3GDKA 2A1YA 2WVVB 3WNPA 3DFPA 1JRPA 1V59A 2TPSA 2WKGA 3QGVA 1TTJA 4DJFD 4PA8A 2FTPA 3F4VA 3WBWA 4FF7A 4ZSUA 5GNZA 4QM1A 4OBRA 3W7CA 3A4XA 3LHUA 3VVGA 3KBWA 4KWVA 4KEVA 3R4IA 1W8GA 2QQ6A 1LT8A 2YBUA 2X2GA 4M6UA 3KXQA 4YWOA 3H7UA 4JQAA 4O10A 1US3A 2VC7A 3KWXA 1LZOA 2ADAA 4W8BA 4YPJA 4KRTA 3DERA 3NA8A 3CZKA 3URAA 3KS6A 1E73M 1VAHA 4IMGA 4AF0B 4A3UA 3VNMA 4YHEA 3OLDA 3M0LA 3ENLA 3SY5A 1F3EA 1V6VA 3CUIA 4KQNA 4DF2A 3P84A 2Y7DA 1KCZA 3VZYA 3GNNA 2HWGA 5F2MA 4OBSA 2C7FA 4FX7A 5FF2A 3SIZA 4AHPA 2WMGA 1CNVA 3B8TA 4ZODA 4H8NA 4JYEA 1H51A 3W7RA 3BAJA 2NLYA 2ON3A 4RNIA 1NOUA 2PDKA 2CLPA 4Z1YA 8RUCA 3PJUA 1FP8A 3MZ2A 4ZOEA 1RM6B 4S23A 3E3HA 2P53A 1FWTA 2PDGA 2FGLA 2QF7A 3RM8A 2BGNE 2WPFA 1H61A 3JU2A 1JYNA 1PVNA 4M8UA 3WLHA 3B05A 1BGGA 4ZL1A 5KZDA 3O2LA 4QE1A 3UT0A 2D0FA 4JTJA 1XSJA 3UWYA 3WENA 1OFOA 1PL9A 1ADOA 2CKSA 3LK6A 2DVTA 1XLFA 1MOKA 2FZNA 4A4AA 3N2MA 1P0NA 4YXGA 4ERGA 1A5AA 4OT7A 4R33A 3QPEA 4H8UA 1DWGM 4H9ZA 2R24A 3FFSA 1QXLA 1SFSA 3NQFA 5T9BG 4QXIA 2J25A 2PP1A 3EKGA 3PFRA 3CH0A 3OYZA 1HIZA 1ZL1A 2VCBA 3MDUA 2XJ7A 3EWXA 2BHYA 1XCWA 4BV6A 5I6SA 3IEBA 2YL9A 3T2PA 3WH8A 5FSDC 1X1NA 3XISA 3URQA 4JFWA 3PG6A 1N7KA 1QPKA 4MNKA 4L4PA 4KPRA 3QPZA 5E0KA 4A2RA 3R8HA 1YKWA 1K3UA 2QJJA 3EPMA 1F61A 4YVXA 2J8TA 4IXHA 1UPMB 3N2OA 2W92A 4DUOA 3ZO9A 4BQ3A 2VRQA 1E6NA 3AHZA 4KCWA 4PUDA 2V3EA 4LFYA 4LS0A 7REQA 3KOXA 2YW4A 4PRWA 2DZUA 3ITLA 4UFMA 3FJLA 1AW5A 3N34A 4Z2GA 3NM1A 2EKGA 4R27A 1WKDA 1MDLA 1PCWA 2WK2A 3UPWA 4R85A 3CGCA 4Z2LA 1W8SA 5C0QA 1V93A 2BS9A 1O5QA 1EH9A 4K7YA 2XIMA 1Q6DA 4PMUA 2GPTA 4K39A 3EEGA 1OINA 5EA9A 3UG4A 1JCXA 4XAYA 4Z2KA 4YCOA 1AQMA 1UB3A 5GRTA 2ZRZA 1CGVA 4QR6A 2Y70A 3S9YA 3IGXA 2Z4GA 4KWSA 1C8QA 1XIGA 3II1A 3HV8A 1BFNA 2Q09A 3CMJA 4W7UA 3MTWA 2Z1WA 1EXPA 2ONEA 3ERPA 3C3UA 4IF2A 5LGZA 1IZKA 3EA1A 4QDWA 3MHGA 2WJEA 3ARWA 2ZYFA 4IISA 3PNUA 1J0IA 1JG9A 4AIBA 3VAVA 2Z6IA 2NXIA 2PC4A 2AGKA 4GFIA 3T09A 3CBWA 2WOIA 3EOLA 3MP5A 1Z89A 2OT0A 3RCNA 4NZFA 3VGBA 2PTZA 4E38A 3W7PA 2ZA1A 4MDOA 4K8EA 1B3XA 1QAPA 2WMIA 2F38A 3OQEA 2BCPA 3LPOA 2PDJA 3IK2A 2XWDA 3EXSA 1CGUA 3W7IA 1TR9A 3PZ9A 4GX9A 2QKFA 1NSJA 2PDHA 2ZADA 3HQ1A 5BW6A 5A6BA 2X1IA 4GABA 3WLIA 3N17A 2CC0A 2VDGA 4UQEA 1OX4A 1TCDA 5LA0A 4J40A 4OQVA 1K70A 3FG2P 3LMZA 4WKHA 4AX7A 4IFRA 3PBVA 3N9SA 2VFDA 2RJGA 4JICA 3NXLA 4WDTA 1NHQA 2DW7A 1DWFM 3M0JA 2XWEA 2RFGA 3F5KA 1L8PA 1V6WA 1WNOA 2PTYA 1EX5A 5HUPA 3KLLA 1IXQA 1RAKA 4D6EA 5HUOA 4IIFA 1TWDA 1A3XA 2Q8LA 1PS9A 4LYKA 5CQ1A 4IJBA 4US6A 2J7BA 4HTBA 2D22A 2CBIA 2J74A 4DLFA 2QCHA 3DBPA 2ZTJA 2XIIA 3GZ3A 5I3GA 4ICCX 1E1FA 1F4AA 4EM3A 1VIWA 3A5FA 3UP8A 1KBIA 3UZXA 5CZSA 4PCNA 4IX2A 1EOKA 2HROA 2PUZA 3C2EA 2NX9A 3LXBA 4Z2IA 3T0AA 2WM0A 1W1A1 3A13A 1RXOB 2R82A 4H9TA 3DFHA 3PZIA 2ZZ2A 4YWIA 1X7IA 3C2YA 3TH6A 4U33A 1I0BA 4XKMA 3BVJA 4JTSA 3APYA 3VM5A 2O55A 4AIUA 2XN2A 2VGGA 3L23A 4V1YA 1SSGA 1GOOA 5EB8A 1V3LA 1D7KA 1WUEA 1R2TA 3DH9A 2V2CA 1TJ1A 1JYXA 3G77A 1ZAIA 2JE8A 1E15A 2E4TA 1JIBA 1Y0EA 2XGZA 1WDDA 2FVLA 5CLTA 3OEXA 1J5TA 1F6KA 2PDYA 1HKVA 3L0GA 4HPNA 1F6YA 5JBEA 2I1OA 1ONWA 3GC5A 2GR2A 3NQBA 3E49A 1OG0A 3EA2A 3QYQA 1VEPA 3BLOA 1LLOA 1ITQA 2JBMA 2QYGA 2GLKA 2Z1KA 2E6AA 3AXMA 2F5ZA 1ITCA 4QEEA 3DJJA 3G1RA 1G4TA 1OJTA 3NPVA 1DQXA 1QI3A 2YQUA 4A22A 1B3YA 1F73A 1D8WA 3L12A 3QHNA 4D2JA 5GNXA 1XFCA 3TA9A 1YTDA 1UR2A 2X7VA 3AQUA 1GZJA 4FF5A 1JZ7A 1LJYA 2E9LA 3BSGA 4KF1A 2BOGX 2OXNA 5XIMA 5C2GA 5A8GA 2Q8XA 3EYPA 1F3XA 3H23A 2CZDA 2YYTA 3BJFA 5HK4A 3DC8A 2TPRA 2YLAA 4MF4A 1KCXA 2VR5A 4DWSB 1XSIA 3NGFA 4MGGA 2GSHA 2NQJA 3C2RA 3W82A 1KBBA 1VCVA 3OLEA 1F76A 4LNCA 3CH9A 1LQ2A 1XIBA 1HKWA 2OWCA 2P10A 2Z1SA 1UR3M 5HWNA 1XLDA 2DZVA 3BG3A 1WXYA 1A50A 3EBVA 4DHGA 4WRHA 1LOLA 5I79A 4J5NA 5H6HA 1H09A 3KUMA 3OQ8A 1VFTA 3APTA 3LDVA 3WMSA 5TR3A 1XW8A 3EMZA 3VO0A 1M7XA 3UA4A 4XG1A 3EMCA 3UZ5A 3TN4A 3VGHA 1EQCA 3GXIA 4Y90A 4GZ7A 3GD4A 2D23A 3FN9A 3CGBA 2WVUA 2ZX5A 3S5OA 4JN6A 3RGTA 2FHBA 1N8IA 3V0TA 2H6RA 3PB0A 1CXHA 4XZWA 4QCEA 1OVDA 4C91A 4LAZA 3VX0A 3EB2A 2BWGA 1DNCA 5AVHA 2YL6A 3W7MA 1V0KA 1EYWA 1RA5A 3VCRA 3W7NA 2JALA 4GQRA 4WXYA 3N15A 2W27A 2ZXBA 1E4NA 3OOQA 3QF0A 3BOFA 4K3ZA 5KETA 2WCSA 5JBDA 3DH7A 4LBUA 4EWND 2NXHA 2X7WA 1I1WA 4S3JA 4QS5A 1ICSA 1V3IA 4EAMA 2PS2A 1XHCA 1BXBA 3NQGA 2FJUB 2CLOA 4C6NA 1FWEC 3ECQA 2JGQA 3W7KA 2JFEX 4PODA 1T5AA 3OIXA 5HPOA 1ZY8A 2HK1A 3WQFA 2BTMA 2REQB 1XRFA 4GJ1A 2RDWA 4I5XA 3PULA 4UQDA 2P50A 1SO3A 5BRQA 4Q6XA 1VF8A 4JDBA 2AMGA 2OOGA 1TRDA 5CZKA 3D5HA 5REQB 1Z3NA 4IL0A 2Q6ZA 1FY6A 3F03K 2A6NA 2H3BA 4NIRA 1EKOA 2CZFA 1QMLA 3MYOA 2V5LA 1X1ZA 1QW8A 5TQLA 3W2KA 4J3XA 3C52A 4LU0A 2F2KA 2XZ9A 1F74A 3ARYA 3M43A 4TVUA 3T7VA 3QW4B 3W1LA 3L7RA 1H49A 3ITYA 2OGJA 2CEQA 3NDYA 3W71A 2GL5A 3MSGA 4K37A 2UY5A 4X2PA 2CU0A 1ONRA 1SJCA 2Z2AA 4F9JA 3SCWA 1YBQB 2W5FA 3WJSA 3ELFA 1V08A 2X99A 2PD9A 4UQAA 2FZDA 2BY3A 2DUXA 1K6AA 4V33A 1O7AA 1Q7QA 3FNDA 3RO6A 3CXBA 5EBUA 4WZHA 1XI3A 2B7PA 3D9XA 4YVPA 5FAJA 1FCBA 3T05A 1AOGA 4MB3A 1S38A 1ZGDA 5G2WA 4O1BA 3VD3A 2ESCA 1V7YA 2R1PA 1IR1A 3KS5A 3WQWA 3O63A 3SDOA 4GK8A 1H7WA 3F4NA 3TA6A 2OZ3A 5I3HA 3B40A 3W76A 1MXGA 2A7RA 2YX0A 4FLRA 1R9XA 1VFOA 4KEZA 4QAWA 1E1CB 1SFLA 6CGTA 4AZIA 3APGA 3LLXA 1ONFA 3H24A 5I7GA 3PY2A 1E0XA 4EMIA 3KEHA 1Q7MA 3TYAA 4ADSA 1IGSA 5C7VA 3RPTA 3R0DA 3QEZA 3FJ4A 4UR7A 4D8ZA 3TIMA 4Y9NA 3WJYA 4RNJA 1CLVA 2PFHA 1J9YA 3NPUA 1TCMA 1R8LA 2Z2UA 3OBKA 1DQWA 4R34A 1XD1A 3W2NA 3VIHA 5FEZA 3R0UA 2EXOA 1XX1A 1K9FA 2FB3A 2OT1A 4HHHA 7A3HA 3DKLA 3AN1A 3CZLA 1FWDC 3LM7A 2HS6A 3GNOA 2TMDA 3AI0A 5G1YA 4DM2A 2ZUTA 3I4KA 3AXKA 3RLUA 1RA0A 1S1RA 2C19A 1M03A 4XKYA 2PWDA 3ARZA 4ATWA 4Z0SA 4AD4A 1QU4A 4HOXA 3CAWA 2BX7A 2G4FA 1XUUA 1KKRA 2VEFA 2ZZ5A 3U2OA 5JBFA 1K8ZA 1H2IA 4DF1A 1DWIM 3LQGA 1YE4A 1Q63A 3IWPA 2E5BA 1KLYA 1OGGA 4HVXA 3UY7A 1JZ4A 3SSJA 4AC1X 5DRIA 4IT1A 4B3LA 1XRTA 4UZSA 3UF9A 3UBPC 1F8IA 3QRHA 2GR3A 4HNTA 1XGDA 5KINA 2OEJA 4YLWA 3GDMA 4JTEA 3U5UA 2JGYA 3RPDA 6REQA 4BFAA 5DCDA 2V5BA 3W38A 2GUUA 2PDNA 4JTLA 2C6QA 3T9PA 3TV8A 4FAMA 2YCJA 1UKQA 3BZJA 4HNUA 2E68A 1VPQA 4BEQA 2OKTA 3SADA 4HN4A 3FVDA 2E25A 1VBHA 1WKFA 3QR0A 4LB3A 2GJXA 4MWAC 1YDNA 2V5JA 4O1DA 2D2HA 3AS0A 2F6UA 1DE6A 3GIQA 4WKFA 2C18A 2VQTA 1ZAHA 2O4MA 4NZ4A 4O57A 4LVFA 2ALDA 1TWSA 2GDVA 4H50A 3SCPA 3TKFA 3ZJ6A 2IQDA 1AVAA 1FDJA 2MANA 3PUGA 4FLOA 3AOFA 3ITGA 3GKFA 3CV6A 1ZDLA 4AXKA 4N42A 5D30A 2RUSA 4NILA 1UWTA 3TTYA 4WUIA 4TTGA 3GXTA 1A5OC 1Q65A 4XZHA 3TNBA 2IKJA 4Y8FA 3QMRA 4I5RA 3LA4A 5G2IA 3RN6A 4P7LA 2HRWA 1K8CA 4ZMGA 1LL6A 4I9TA 1OYBA 4YWSA 3MW7A 4EK7A 4M81A 1M6IA 4V1XA 1UR8A 3NZQA 1H3GA 4A21A 2BVYA 4KPLA 3AAMA 3N29A 2INFA 2WMKA 3TSDA 2PWUA 2QS8A 2V5DA 4UFLA 3SGUA 1UOKA 1LORA 2BOFX 4JTTA 1W1VA 5EFDA 4A8NA 3FAWA 4DBEA 1RLCL 4H83A 1VCFA 3D3FA 3EANA 1VB9A 4OTKA 4GZIA 2QDGA 1N5WC 3SFWA 3NYDA 3EX3A 3ITVA 3CGDA 3A4WA 4AISA 3C0SA 2HVMA 2OOFA 5FF7A 1I9CB 3LXAA 2G37A 4FNQA 3G1YA 2OVLA 1ZBKA 1UJPA 1R3WA 3ZT5A 1XINA 4UWMA 4B4HA 3PJWA 3P8IA 4UMCA 5J04A 2DZAA 4DI9A 4FO4A 3RIKA 3ZS4A 5T8GA 2A7PA 3G8RA 4TQTA 3WFAA 1PBGA 1FECA 2PZ0A 3T0CA 3ARRA 2P88A 5DMLA 3WD2A 3R94A 3VKCA 1G4PA 1H0IA 5JVLA 1REQA 4J57A 2IKGA 3MDWA 3SR6B 2P0OA 4WF7A 5HNTA 3PBUA 1SJBA 3CWHA 3SN1A 5LIWX 4MADA 1ZP4A 2VFHA 1BQCA 3H70A 4FK9A 1BSLA 5C55A 2BGQA 3U3HA 2HZGA 3LB8A 3PJTA 4PTNA 5EMLA 3WIJA 2DSWA 1JD9A 4KMQA 1Y65A 3WH6A 3P0XA 2WHJA 1G4EA 2Y2WA 3TYUA 1HJVA 4E0CA 4HU0A 1ZJIA 1LWJA 1O95A 2I7GA 1V6YA 3PG8A 4L1GA 3SGGA 3CIVA 3MI2A 5F2GA 4KRUA 2ZX8A 2PE4A 3T81A 2EPMX 4FPSA 2Y0FA 5DN1A 1JVNA 5EMJA 1KV5A 3CK5A 4AHQA 3INPA 3LCXA 2XGIA 5JCMA 3BSMA 1PWLA 5CPMA 3M4HA 4GVFA 2DUAA 4OKDA 1EFZA 5I3FA 2BY2A 2JF7A 1WE5A 3CAVA 4CQCA 1L6SA 4GPNA 4Z1DA 2XYLA 3FK4A 2WBAA 3THUA 5BXTA 2HK0A 2QMKA 1OC5A 4QFUA 4GI9A 3UJSA 1GGOA 3E0LA 1I45A 3NGJA 2XFFA 2EEXA 4MLRA 2QF8A 4EANA 5BZAA 5DMYA 4F0SA 1KM1A 1UIOA 2PTXA 5F1VA 4I8YA 4K6AA 5KZEA 1FWWA 4DO5A 2F6XA 4NRSA 5DCEA 4MHBA 1AH4A 3DIPA 3VDHA 1SB3B 3RNMA 1V03A 1ZS2A 3WCZA 4ZQPA 2J62A 3CM4A 3RX4A 1NEYA 3U0HA 2C71A 4JEQA 2VI0A 1QR7A 4WY0F 4IQDA 3R12A 2X1SA 1QW7A 3DEQA 4W5UA 4Q7IA 4JY8A 5E93A 1PX4A 4D8AA 1JNEA 3A3WA 4FXRA 1BG9A 3GW3A 4PTMA 2VGFA 1Z32X 1V77A 3G22A 1OK6A 2MUCA 2QLYA 5GJMA 4GC4A 2WO5A 3HQOA 3T44A 2OSYA 2PU0A 3DI0A 2W91A 2FHFA 1UBPC 5D02A 4FNTA 1QOQA 3NQAA 4WSHA 3OA5A 1LBFA 4IWWA 1OCQA 4N4QA 1TVNA 5M5DA 4J3ZA 2G8ZA 1FRBA 4U5KA 3G18A 1CW2A 4Q22A 3LSBA 1UP3A 3CJPA 1AL7A 2XN0A 2V69A 5BYWA 1I0DA 3TU9A 1IR2A 2R1NA 4GFSA 4ENLA 3ES7A 3MS8A 3OHMB 1C8YA 3UPMA 2WJZA 5C8BB 4LTSA 4M6QA 2YVFA 2YPIA 4AWSA 4L61A 3BURA 3KAOA 4ZOCA 4MB5A 1W1TA 4C1NB 3AXIA 1QCWA 2AGTA 2RDXA 3TTEA 1B54A 2V81A 3Q45A 1XSKA 1TJ2A 2E67A 1CIUA 2GJPA 4MZ1A 1XIJA 3F4WA 4MY9A 3PTMA 1JAEA 1GVEA 1KWKA 1NDVA 3I4EA 1JPIA 1KXHA 1ADDA 2EQ8A 4LBSA 1NH6A 1UWAA 4K36A 5IFTA 5A6JA 3L0KA 2BXYA 3PF3A 2HE5A 2D73A 1HL9A 4W8LA 1XBVA 1F8MA 4GVHA 3RK8A 3DYPA 4NT0A 3GG8A 3TONA 1FP9A 5M2FX 4QSFA 3TYZA 1YXYA 3RJXA 2G95A 4OUIA 1CDGA 1P0KA 2O9TA 2VGBA 2W66A 1TWZA 3KVMA 5I5RA 4JIPA 5A6TC 1TX0A 4G2DA 4GIYA 5AHLA 5TAOA 2VELA 1ISWA 2YW3A 3IUHA 4GQGA 3RFAA 1CX9A 3IJ9A 1R85A 4B5WA 2H9AB 3TQKA 1BKSA 4MJZA 4RUBA 5JU6A 5U7SA 3QVQA 1FH9A 3HW2A 4HK7A 2ZZ1A 3PZTA 3VDCA 3COTA 4H2HA 2CXEA 3QTPA 1E9LA 4HMNA 4PMYA 4MWAB 1Q2RA 2V3AA 4PMXA 3S46A 3LMYA 3SZ8A 2A2IA 1TV5A 3KOYA 3FIGA 4CD4A 2DUZA 2VEKA 3H6OA 1UD8A 2Q3RA 3NVZB 3GVWA 3ABZA 2X05A 2QCGA 4Y9AA 3RRAA 3AIBA 3QQWA 1HUVA 2PAJA 2PDCA 3HV9A 2ZX7A 5A6AA 2DT2A 1MRQA 1NFGA 1RSCA 2GJLA 2OX4A 4BJHA 4J56A 1TV3A 1OFEA 2CZVA 1IEXA 4IZGA 4ECLA 4QEHA 1YHTA 3MI6A 3W6YA 1OM0A 1OSEA 4NU7A 4EPKA 3QM3A 3DESA 2WNWA 1OCNA 1RLDA 2QV5A 1DVJA 2C1GA 1Q1RA 2XSXA 4Q7BA 3OVGA 4GG9A 2I9EA 2PDLA 3S83A 3WQEA 4JX5A 1XGZA 2DIKA 2ISDA 5ABHA 2OQYA 2VEIA 3UFYA 3USZA 1K4HA 3R13A 1VQTA 2FHCA 2PWFA 3CHCA 1QPOA 2VP8A 3S2CA 1NTHA 3UZZA 3R89A 1OABA 2YSWA 3LHYA 1CGXA 1HJSA 4HGXA 4S2BA 1SM9A 1BQGA 3MSRA 5AC8A 3IIPA 3G1FA 3LGEA 2P3EA 1H6VA 4AY1A 1Q7ZA 2PP3A 2HPMA 1PAMA 4IOTA 5M03A 2YLLA 4YS1A 5H1WA 1PZ1A 2DT1A 3S9IA 2NV9A 1CYGA 4A35A 3GVQA 3TTSA 1EBHA 2E8YA 1ZRQA 3MMTA 2BODX 4ZTXA 1R46A 3W1XA 4J3WA 2CLKA 2HBVA 2NVAA 4PE8A 4KFNA 3R1ZA 4WCJA 3M5VA 2WLZA 4H4ZA 4FSAA 3CPGA 4N4PA 3M64A 1VPXA 4Q4SA 3HF3A 4PC8A 3VOGA 2P5NA 1SGJA 5EFFA 3WLKX 1JUBA 1Q6FA 9CGTA 4LAOA 1XBZA 3LBOA 2C14A 3LPPA 1VKFA 3BQ6A 3VGFA 3E5BA 5FJTA 1E56A 4GD0A 4GQQA 1Q66A 1KGXA 3ITCA 1L6GA 3G8EA 1LM1A 4NZCA 2VCAA 2WOQA 4GKLA 4AWTA 4RDWA 2WBKA 2QVHA 4WIWA 3JR2A 2Y8UA 4FNRA 1KCKA 4A3RA 4UTIA 1FXPA 1HKIA 1RJQA 1AK5A 1MZHA 1EB3A 2INEA 2QR6A 3STFA 4XZBA 2ZRVA 1VHCA 3H26A 2RH9A 4GYPC 3L2LA 2HXUA 5A6SA 1EX1A 4MOZA 3LCFA 4H4VA 4O16A 4IQLA 1UROA 1EUNA 4IUOA 1VFLA 2ZUWA 1JXKA 3WLMA 4B16A 3W1UA 4PUKA 4AZ5A 1LROA 1UUMA 1XCXA 1J0KA 2CITA 2IXVA 4J3SA 5FCZA 1YLVA 1KFWA 4JQ4A 1JYWA 4H4PA 3GXNA 4UNLA 2GGJA 2VYOA 5DQPA 4A2SA 3IJ7A 1TYPA 3MBDA 3AMKA 5FEPA 4RZ4A 4H9XA 1XWYA 3W37A 4GCAA 2B0MA 1ODZA 3W07A 3E02A 5H8MA 1UZ1A 1JZ6A 2BBFA 4CQ8A 3C0LA 5FS9A 1JQVA 3HMJG 1NDYA 4NI3A 2HV5A 4ERAA 4XD4A 1W3TA 3GU1A 3CUGA 3O16A 5TD4A 3S1VA 3AMGA 3W1QA 1QPQA 3VNYA 3LPGA 3TUUA 2XVLA 3W25A 3W2MA 1EO5A 1GQJA 4JXCA 3CZGA 2PPGA 3BG5A 2PDFA 1JDFA 3HA1A 3NDZA 5HR6A 4ILSA 2J9XA 4EF9A 2G3FA 1X6UA 1ADSA 1LQ0A 1ZXIC 2Z0IA 3GC2A 4ZXOA 4HOZA 2NQ9A 3ANVA 3BE7A 4G9PA 4GY7A 4JCLA 1FHLA 2YIHA 3GD6A 1A80A 4GISA 2P8BA 3AMZA 3ZJKA 4KRZA 1W32A 2YZRA 4YYFA 1FHDA 4JAWA 4WDXA 1GWJA 2NT0A 3KVLA 4O8AA 3VKDA 4V27A 1RH9A 2DW6A 4HZ7A 1NWSA 3IIVA 5JUVA 2V67A 3PPHA 3VKAA 3TOYA 1FUYA 4I7VA 3BK0A 3TR2A 1S7MA 3BANA 3WF3A 2BLEA 2PWEA 2ZVRA 3MUZ1 4X0NA 2YCKX 1UD5A 2CBVA 1HVXA 1TX2A 1GPWA 2GOUA 3USBA 4W88A 3TJXA 3M1ZA 2VRJA 3WF2A 4O54A 3M9YA 2ZXQA 1GZGA 3DGBA 5HQMA 3PBMA 1LLZA 3DENA 4DO4A 1UH4A 3VABA 3OBAA 1IWPA 2J8FA 4D1JA 1E4LA 3WQ6A 4W4QA 2GK1B 1O94A 3JRKA 2NZLA 3MT1A 3SJ3A 2W0UA 1W1IE 4H2CA 3SBFA 5LIYX 4NYYA 3CC1A 4R3UA 4BI7A 1HVQA 2Q3OA 3TNOA 4P61A 5EGRA 2G3NA 4XD5A 4W9TA 3S6DA 2NT1A 3E0VA 4JNMA 1H50A 1XCFA 3BPWA 5AYIA 3URHA 3SY1A 1XLAA 3GVRA 2VX6A 1S39A 4HPXA 2E5AA 3SSZA 4WY0A 4IJCA 3S5SA 4L6DA 3GAYA 4F0MA 3IUDA 4MFEA 3L5MA 4HB7A 3HTWA 2HBXA 1D8CA 5E9AA 4LQ1A 4PL2A 4ZCWA 3U4FA 2IPJA 4Y2WA 5EKYA 3A9BA 3ZIZA 1AODA 4CCZA 4KIRA 3LRLA 3KE0A 3IRSA 4LV9A 4PSRA 1NWTA 1M7PA 1VYSX 4GXWA 4NAFA 3HU7A 1FTXA 4NG3A 1BRLB 3G1SA 2ZZBA 4O14A 1X8CA 5E9XA 3DN5A 1E0WA 4TUFA 2R14A 7TAAA 1DJNA 1DHKA 3MZNA 1Q6GA 1LF1A 4F3HA 5LGXA 1P6WA 1TSIA 4TMBA 1TIMA 2X50A 5LHEA 4IH3A 2ZXDA 3O1NA 5A69A 4UC5A 1GVFA 4D6CA 3R5EA 5HWMA 4PCPA 1CLKA 4GYFA 5J5RA 1IYXA 4IMDA 3DCPA 4HA3A 4ML9A 3OVQA 5HNRA 2DJXA 3G0UA 4PCTA 1TE6A 2VMFA 1KN0A 2E9BA 3LBMA 4DJED 4HSHA 2FVKA 4IMFA 4MY1A 3VD9A 4W86A 2YOCA 2IPGA 3R25A 1KBJA 2Q02A 4XZ9A 1DIEA 1X96A 2ZA2A 3U48A 5D9PA 3W7QA 4E2OA 1PHQA 1VBRA 4C6IA 4ZOHB 4B5SA 4TX6A 3TYCA 2QCDB 4RW5A 3AIEA 4TOQA 2G3JA 4PBGA 3LOTA 3ZJ7A 2PLMA 1CEOA 1HTIA 1VYPX 3AALA 3WK3A 1DJGA 1R86A 1W5OA 1V51A 2WB5A 4O8RA 2YGYA 4HJFA 1EGZA 4UZUA 1QO2A 3PG9A 3BARA 2QNEA 3NZPA 1XDJA 1XG4A 1XYMA 4IIEA 2YL8A 1UR1A 3UVAA 1HKMA 3BZGA 5BMXA 3KX6A 4WXZA 4UFJA 3UR8A 1BYCA 4A29A 4IP4A 4MNMA 2AOSA 3B9AA 3BCDA 1XJBA 3EB4A 3CV7A 1K77A 1FCUA 3HBLA 1LRNA 2HSAA 1NWUA 4EXBA 4FOJA 3U2EA 4DRSA 1P7TB 1PTGA 4XBKA 4GIEA 4C5ZA 3OVPA 4HA4A 4O11A 3MJYA 3VIMA 5J5DA 3WQVA 2GR1A 4CEUC 5AY7A 4NQ1A 2YVJA 3C5QA 3UJFA 4BQ5A 3W7OA 4IXXA 5IBXC 1OY0A 2FZMA 3DOPA 3CQJA 3H2EA 1FWBC 1J6PA 2VM8A 5DXXA 3W29A 3L4TA 4CU6A 2CDUA 1BAGA 4XZLX 1B3ZA 3VUPA 2WMJA 3DU0A 3U7VA 3FCPA 3EAOA 1E6QM 3N12A 1P6CA 4C1KA 1XLHA 3VFCA 4CN6A 3DBNA 5T91A 3VIFA 2BVTA 3MWCA 4LUSB 3MSYA 4B5NA 1WP6A 4C65A 1XP3A 3THCA 1CPUA 2Y63A 4BI5A 3KL3A 1JPMA 4I9AA 3PJXA 2QJNA 3BGGA 3XINA 4RK8A 2VUYA 2DY3A 5BRBA 2J47A 1QI2A 3ABRA 4BEUA 1ZY9A 1OX5A 3C61A 1EC8A 4B2DD 2J7CA 3WL0A 5CAKA 1OFAA 3TSMA 1SZEA 3L2MA 3QLLA 4ZO7A 1YQ2A 4OBTA 3ZVHA 1QPNA 4JIHA 1MVYA 3DGHA 2OLHA 2ZUNA 4C7GA 2OSWA 2VFIA 3E0FA 4JEJA 2RKXA 3I7QA 4CNNA 3DC0A 4RZBA 1PJ9A 1QWKA 2QHAA 3RCYA 3LB0A 3W27A 1XLKA 1AH0A 1NQ6A 1LLWA 2OYLA 2ZDSA 3UPBA 4PFHA 4NZ3A 5BXRA 1R7AA 3AISA 5GJNA 1M6JA 3P80A 4QLKA 4EAYA 1EWEA 1P0EA 3AHXA 2GGGA 3LZ5A 3BTNA 2G0WA 3KTSA 5AYBA 4TMCA 1UP2A 3AYTA 4L6HA 5DRCA 3S2LA 2C1IA 2FMOA 3L9CA 3W83A 4B4FA 2D1ZA 4TXEA 3ZR4A 4B3KA 2NUWA 1TO3A 1POKA 3B8SA 4WD0A 4PCFA 2WSRA 3OGRA 2D2GA 1EJRC 3ARVA 3U8GA 2VVNA 4EKJA 5A6KA 3U9IA 4GC3A 4FNSA 2EJAA 4PUWA 4K8DA 3N19B 4HNNA 3Q65A 3TLQA 3HRDC 5CJ5A 3DFOA 4KH2A 1M41A 3QC3A 4S1FA 2WVTA 1TG7A 2O0TA 4O1EA 3ALGA 1PIFA 2E5CA 5LZLA 1SU5A 1NP0A 3LBCA 5I2UA 3R6IA 1GTHA 2WCAA 1AJ2A 4V2XA 3ABXA 4G7FA 3CIWA 4JIIX 3RF9A 4AY7A 3HPAA 5ECVA 3QHOA 4FX9A 1ZBVA 6TIMA 1TUFA 5LA2A 1LOQA 2R9RA 2FMNA 1VFHA 3WQPA 4MM1A 1OADA 3W53A 1FFRA 2I14A 4A3YA 3JW7A 2FJKA 4Q4MA 2RJHA 1WUFA 1OCBA 1AD1A 3NOEA 3LHVA 3NQEA 3S2MA 3BLLA 4S3FA 2C3DA 3QH2A 1AJ0A 4NXSA 3CAQA 4RV3A 1PKYA 1IZJA 4ZB5A 1QK0A 1M1BA 3P81A 4KKXA 5B7YA 4W7VA 3ABQA 3KHDA 4TO8A 4K38A 5CGTA 3GO2A 3EX1A 3W7JA 3UZYA 1QT1A 1JPDX 1PDYA 2DSVA 1TELA 2EHHA 4U2YA 4EPEC 2ZE0A 4HIBA 4F2BA 1XYFA 5M1TA 3F2CA 4AW7A 2YDAA 5A6BD 2FB2A 1G0CA 3WUBA 4ZR8A 9XIMA 3JZEA 4QISA 2ZBTA 3SECA 3NNTA 3F4CA 4EF8A 1XIHA 1XLGA 3OU8A 1H1NA 4BZYA 4GACA 3VNZA 1F3WA 4ONVA 1SO4A 4CNTA 3AJ7A 4B90A 1J2BA 3IGHX 1RJPA 3MV01 4F0RA 2X0HA 4QDMA 4QRNA 3L8KA 3TQ0A 3KWSA 4C6EA 3AMCA 2PGEA 5H8PA 3LNPA 4AVOA 5AB3A 1VD6A 1ZJHA 2CNCA 3BAKA 2V8ZA 3SUSA 1T7LA 4V28A 1R30A 2YFOA 1ICPA 1A0DA 3VINA 1E1EA 2CERA 4ZQMA 3PAJA 1CB7B 3BGAA 4C6LA 3NO1A 1YXCA 2J9YA 1F05A 4ZOAA 4LOCA 5A8PA 1SUXA 1EIXA 2CETA 3UQNA 3S42A 2DEPA 3MU7A 3H12A 2UY2A 3DECA 1MUWA 5CAHA 1IXPA 1OT1A 5C6MA 2PGRA 4H8VA 3MKVA 4FZIA 3C56A 3QSRA 5M17A 2VFGA 1XL9A 4L9YA 3RU8X 3PUOA 1GESA 2CBUA 2BHUA 3UERA 4PGLA 2ZWZA 3N4AA 2A3EA 3QTGA 3SJNA 4QJ1A 1LOSA 3GE7A 3FKRA 2PBGA 5CH9A 4B9YA 4GUIA 1TA3B 2IKHA 2W54A 1BSIA 5CPOA 3NQ7A 1K6WA 3KBVA 4WDUA 3GRTA 3FKKA 1LG2A 4ATLA 4M6PA 2G3MA 2Y62A 2CFYA 2V6OA 3EWZA 1QHOA 3PPFA 2VRKA 3B0YA 4KCUA 1NJJA 2Y4SA 4PN2A 3KP0A 4I9MA 1EIBA 5LXXA 1DIDA 2WNNA 3W86A 3H4XA 3MBFA 4YTUA 5A2AA 4Y96A 4EWJA 1J0ZA 4QCFA 3EWUA 1DP0A 3GU9A 2QCCA 3QPYA 4GO8A 3NUKA 5CGMA 1OC6A 3SRKA 1U1JA 3CHVA 1JPKA 4FXSA 3A4JA 4HPGA 4U10A 2DT3A 3W02A 4LA1A 4ZFMA 4YN5A 2BSLA 3T1GA 2GWNA 1RR2A 1SZNA 5FL1A 3T78A 4JDRA 1UCWA 4E2DA 3H4KA 3JS3A 1S5TA 4UNIA 1ZMCA 4LT9A 3V0UA 2TRSA 4IGHA 2FFIA 4AD3A 2J13A 3EWYA 1QWGA 4C7DA 5A6LA 1GXFA 1R5YA 4FR6A 1FQ0A 2AKMA 2O9RA 5D8WA 3H8AA 5IXEA 1H63A 1U22A 4H9MA 5JQ9A 3NJ3A 3WLTA 3VM7A 1ZENA 4URIA 1EQPA 1CB2A 3U7BA 3BO9A 1I75A 3T2OA 5CEWA 1DEDA 4DELA 5CC3A 7XIMA 1B5TA 1FHUA 2HS8A 3T40A 3MUCA 4DZAA 4TX8A 1GOMA 4RXFA 2A3CA 1VFMA 1K9DA 3RMJA 1HKKA 4P2VA 3A3XA 2C16A 3KHJA 3OBEA 2OB3A 2EPOA 2PZNA 1YTEA 1OFBA 1ELSA 2PRLA 4XBSA 2X09A 3L4VA 4G7EA 2W3RA 4UOQA 3CL6A 3GIPA 1BF6A 4N02A 4A8IA 1UD4A 1DTUA 1P4CA 3K4DA 4GMEA 4IMEA 1W56A 2BGSA 2J8GA 2V5KA 1TRIA 3TJIA 1BEUA 1VDVA 8CGTA 2AAMA 4QS6A 3CZ8A 1E6SM 2GUYA 3IK4A 4LCQA 5DMNA 1KRCC 1GCYA 2Y89A 1X98A 5D2XA 2EPKX 3GX9A 4QQUA 4TVYA 3P7YA 3O6CA 4JIEA 1H2JA 3TLLA 3SCOA 3GNRA 2FPYA 3T55A 3ANUA 3GKAA 3SB0A 3SFKA 2HISA 1FWNA 3C8FA 4EMJA 3ANYA 1KTBA 2HJPA 2XVPA 4PR4A 3ATZA 4F2UA 3CUXA 3MO4A 3PBYA 4XD6A 3IARA 4XISA 5EYWA 4DZHA 1QPRA 1EOMA 2VFFA 1RQHA 3L5AA 1YPFA 4FX8A 3OC4A 1GHSA 1JF6A 4R9OA 3ALFA 1FIQB 1V6UA 3MB9A 3LYEA 4RE2A 2CBJA 1OQFA 4UQCA 1BWLA 1WZLA 4HU4A 4S3DA 1IT8A 4GY0A 3MUY1 3R0KA 4M0XA 4Q4PA 1KQZA 4H4UA 4OV4A 4M6VA 1F9CA 1ODUA 5C71A 4U3CA 4CQ9A 3SQSA 2FLIA 2YCLB 4U5IA 5L9FA 2KZHA 1R2RA 3V36A 1Q6CA 3S4TA 3RLGA 1JCYA 4ZE5A 1I2OA 3TDFA 3OIHA 2YL5A 1K7XA 1C90A 2R94A 3KTCA 1FWAC 1T40A 3A64A 1UH3A 3O15A 5JIPA 3C86A 3GW0A 2WVSA 4P8XA 1ESWA 4UTKA 5FS8A 1WDSA 1X38A 5HQEA 4MUZA 5C9UA 3L65A 4ZQRA 3TW7A 2XH0A 1AW1A 3SCQA 3UXKA 1GYNA 4TTUA 2ZKMX 2XINA 2VO5A 5D2YA 1XLEA 3KRSA 5KVHA 1VP5A 4JX6A 1J12A 3DFSA 2IXUA 3GAKA 1W9PA 3FAXA 5A2BA 2OODA 2SFPA 3BV7A 4MDPA 4YCPA 4K7ZA 3BLIA 2IS7A 2HEJA 1NVMA 3HO8A 4OOUA 3NVYB 4YTQA 5HDRA 3VE9A 3UXIA 3VDGA 2W55A 2OLSA 3KBMA 4CUCA 4S3KA 4GE8A 4YJ5A 3W1PA 4DPPA 4C1LA 1E6ZA 3SCNA 1JYVA 2NX1A 2IUZA 2IPWA 3W88A 3P0WA 2D69A 1ZMDA 1GRHA 3W22A 4DIAA 5DXYA 1QW9A 3HB9A 3LQLA 1S2UA 4MJ4A 1Z9AA 2Z26A 2ISVA 2ZRUA 2DFAA 3LSCA 3IJ8A 3L67A 4H3DA 4JFTA