3CGDA

Pyridine nucleotide complexes with bacillus anthracis coenzyme a-disulfide reductase: a structural analysis of dual nad(p)h specificity
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
444
structure length
444
Chain Sequence
MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRDKYGIDAKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGAIGLEMAETFVELGKKVRMIERNDHIGTIYDGDMAEYIYKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLVSVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pyridine Nucleotide Complexes with Bacillus anthracis Coenzyme A-Disulfide Reductase: A Structural Analysis of Dual NAD(P)H Specificity.
pubmed doi rcsb
source organism Bacillus anthracis str.
molecule tags Oxidoreductase
molecule keywords Pyridine nucleotide-disulfide oxidoreductase, class I
total genus 154
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3cgdA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgdA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgdA02
4C5OA 3AE3A 3BI5A 4BV6A 4GRTA 4PAAA 1D7LA 1MOKA 3ICRA 2H88A 1GT8A 2YLZA 4OPGA 5BVAA 1IJHA 1JEHA 2W0HA 2BACA 2VVLA 1P2EA 3CTYA 4DSHA 3UKHA 4ZCDA 3VR9A 4B67A 3GRTA 2OAMA 2VRMA 1ELIA 2XYOA 4JNAA 4EMIA 3BHFA 3LJPA 3DK4A 1BGNA 4EQWA 1E1MA 1GSNA 5GSNA 2CDUA 4Z43A 4U8MA 4ZN0A 4BJZA 4C77A 2BK5A 2C75A 4NTCA 1K4QA 1GTEA 1K0LA 2C72A 1KNRA 2WQYA 3KD9A 5C2TA 1GRGA 2GQFA 2RGOA 3K30A 5U1OA 3NK2X 4IVOB 3LZXA 1FEBA 1CJ2A 4I58A 5M0ZA 3V3OA 3AEDA 3CGBA 1F3PA 3DMEA 3P9UA 2YVFA 2YWLA 3NTDA 1CL0A 1L9DA 4ECHA 3DJJA 1OJAA 2FJBA 3L1RA 2WOWA 2YQUA 2C70A 3AYLA 4LU6A 2GMHA 2GR3A 4EQRA 4E0VA 4Z24A 4U8PA 5KWFA 5C3JA 1QO8A 2YLWA 3QSEA 3V76A 4JY3A 2VQBA 3UTEA 3VRAA 1KF6A 1N1PA 5KXJA 3DK8A 1TDFA 2RGHA 3ALJA 3CNDA 4J34A 3AE5A 3Q6JA 3ITJA 1H7XA 2BS3A 2CVJA 2WU5A 3GWDA 3NYCA 5EOWA 3CGDA 3ZYXA 2GR2A 1JU2A 4A6NB 3CPJG 2WHDA 5JCNA 2GVCA 5HY5A 1O94A 5KVIA 3ALLA 2GMJA 4USQA 4ZCCA 3UOZA 2X3NA 3GD4A 4U8LA 3NHOX 2BXSA 1ZOYA 1DOEA 3FPZA 3UKLA 3NKSA 3ZDNA 3ICTA 1H84A 1GRTA 2XVEA 3I6DA 3ISHA 3VRDB 4GDPA 2YLTA 3ALMA 3SGLA 1OJ9A 1JRXA 1PBBA 2JB2A 1LVLA 2BK4A 2E5VA 1DXLA 4OCGA 1DOBA 3P4QA 2WP9A 2DKIA 1B5QA 4C74A 3FMWA 4J31A 3D1CA 2GR0A 1PBFA 1DOCA 2C65A 4WCTA 4TLXA 4J57A 1KDGA 2YLXA 1Q1RA 1GTHA 2JB3A 2WESA 2YG5A 3OC4A 2YR6A 4A6NA 2ZZBA 4USRA 2XVFA 5FS9A 3M12A 1N4UA 2YVGA 3JSKA 3OZ2A 4H2RA 2EQ6A 4WX1A 3M0OA 5KOXA 3ABVA 4RG4A 3K7MX 4NTEA 4BJYA 2GF3A 2C3CA 3LADA 2QCUA 2A89A 3CPHG 1F8RA 1KSUA 3NIXA 3NYEA 4B69A 4A7AA 2AQJA 1BKWA 1FL2A 5U63A 3UP4A 4TLZA 2YR4A 4U8IA 4X9MA 3DJEA 3QVPA 3R9UA 4UDRA 4XWRA 1B8SA 2Q7VA 2A8XA 4LIIA 4KX6A 4CNJA 4JQ9A 1H81A 3KA7A 3NK1X 3UP5A 1LTXR 5JCLA 1E1LA 1GNDA 4O5QA 2Q0KA 2ZZCA 3PVCA 1IUXA 4TM0A 2YLSA 3VQRA 2V61A 3AD9B 4BK1A 2B9WA 2WPFA 4XWZA 1F6MA 3RP6A 2PHHA 3AE1A 4FDCB 4AOXA 4B65A 2GEWA 2GV8A 3UOVA 3DH9A 2BC0A 3GDPA 3GD3A 4NEVA 2BABA 2R45A 2Z5XA 4RSLA 1CC4A 3AE6A 2JAEA 4J2WA 2R9ZA 1CF3A 1JRYA 4J56A 1M64A 2XVIA 4H4TA 5J60A 3F8PA 1GOSA 3GYJA 4IVMB 3CIRA 2WDVA 1XHCA 4CY6A 3CNSA 2C73A 3AEAA 3GMCA 3K7QX 4J36A 4KPRA 3O0HA 3K7TA 1NHPA 2OLNA 2WEUA 4H4VA 5FS6A 5DBJA 2C76A 2JBVA 3NLCA 4NTDA 3AYIA 3L8KA 1GPEA 4FX9A 3P4RA 1GXFA 3BI4A 4H50A 1NENA 1PJ6A 3DGHA 3AE2A 3H4KA 4DGKA 3IF9A 4CNKA 1DJQA 1F8SA 1NDAA 4B66A 3GDNA 4K8DA 1CJ3A 2BK3A 3NG7X 2R46A 3FBSA 1EL8A 1PBDA 3RP7A 2VQ7A 1L9EA 2VZ2A 3NNEA 4DNAA 3H8LA 4H7UA 2NPXA 1FCDA 1PJ5A 3P4SA 1PBCA 4H4QA 2B76A 3NTAA 4AOSA 3DJGX 4IV9A 3DGZA 2WETA 1GRBA 1TYPA 2B9XA 3AECA 3BNUA 5EB5A 1HYUA 5CKUA 3UTHA 1JNRA 2GQWA 2RGJA 4NEWA 2XDOA 1IUVA 4FK1A 4GF7A 2FJEA 2GAGB 3EANA 1EL5A 1Y56B 1Q1WA 1P2HA 5LV9A 2APGA 1YQ3A 4IA6A 4YSZA 1BZLA 4YKFA 2YG3A 4U8JA 2ZZ0A 2YM1A 3GYIA 1PJ7A 4Z2UA 1E1NA 4YT0A 4P9SA 4Z26A 1LV0A 1Y0PA 3UOYA 2CFYA 2WU2A 2XLUA 5JCIA 3ATRA 3T37A 1D5TA 1DJNA 5EB4A 3SM8A 4OPDA 1NAAA 1D4CA 4TM4A 5IQ1A 4H2PA 1L0VA 5JCKA 1E1KA 1TDKA 1NHSA 3C96A 2WP6A 5FS7A 1EBDA 3UKPA 1N4WA 3QFAA 2TPRA 1GALA 3HZLA 1VRQB 1QLBA 5U25A 4HB9A 3URHA 3KPFA 3BNMA 2YM2A 4Z2TA 1BWCA 1UKVG 2GB0A 4O5UA 2WP5A 4YSXA 4C3XA 4H4WA 3NGCX 2GH5A 4MJWA 1QJDA 1EL7A 4Z2RA 1D4EA 3AEEA 4U2SA 1ZDLA 2VOUA 4JY2A 1OJTA 1NPXA 2BCGG 4EMJA 1NEKA 1VQWA 3ATQA 1H82A 2WS3A 2XFOA 3CNJA 1DNCA 1REOA 5ER0A 1MO9A 2O9ZA 4NZHA 2V5ZA 4H4ZA 3RNMA 1S3EA 3VR8A 2BS4A 1SEZA 4H4XA 1JNZA 2WDQA 2WOIA 3C4AA 2XFQA 2YAUA 1DODA 1IUUA 3IC9A 5BRTA 3AE7A 5HXIA 3CGEA 4YXDA 5IPYA 1H7WA 3ADAB 4B68A 5KVHA 3LB8A 1LPFA 1B4VA 4ICYA 4K5RA 4OPCA 4U8NA 2J3NA 1W4XA 1IUTA 3SFDA 4YTPA 4AP1A 5HHFA 2F5ZA 1AOGA 4H4YA 4H4SA 2BCPA 2CULA 2XVJA 3C4NA 2R0CA 1X31B 3LOVA 4J33A 2X99A 3AD7B 2XFUA 1N4VA 4JN9A 4Y4NA 2HQMA 2V6OA 1YY5A 1GRHA 1F8WA 2BS2A 1D7YA 1CBOA 1TYTA 2RABA 3SFEA 1GRAA 4Z25A 4A9WA 2YG6A 5L46A 2C64A 3FIMB 1TRBA 2WBAA 4H2QA 4U2TA 5KRQA 1JOAA 1FEAA 2YG7A 3B6DA 1YKJA 3NYFA 1LJ1A 1MXTA 3F8RA 3S5WA 1EL9A 1TDNA 4EQXA 1CJCA 1KFYA 4OPIA 4B64A 2V3AA 3QSSA 1GREA 2NVKX 2X8CA 4H4UA 1LQUA 1Z6LA 4APNA 3AE9A 4Y4LA 2WPEA 1O95A 2WDRA 2XLSA 2BXRA 2XVHA 1VG9A 2FBWA 2JB1A 4FK1C 4BK3A 1K0JA 1S2YA 3KVEA 5BULA 4X4JA 1V59A 4BURA 2E4GA 2B7SA 3E1TA 3P4PA 4GCMA 1OJDA 4TM1A 2BYBA 2R0GA 3UKFA 4EM4A 4A99A 3EAOA 2FJDA 4U2LA 2EQ7A 2C7GA 2VVMA 3GMBA 5FMHA 3FG2P 1CC2A 3AWIA 4PABA 1GERA 4EIPA 1BF3A 4B63A 1GEUA 4RG3A 4N9XA 1ZOVA 1RP0A 4CBQA 1H86A 4XXGA 3BI2A 2OLOA 4A5LA 2DKHA 2BC1A 4HA6A 2XFNA 1JRZA 5M10A 1VDCA 3UTGA 4A79A 5IQ4A 2YLRA 2PYXA 4REKA 2ARDA 2TMDA 1GRFA 4EQSA 4U8OA 1XANA 3CPIG 4K2XA 2H89A 3UKKA 3G5SA 2XCGA 4AP3A 1H83A 2C66A 4CCRA 3LZWA 3B3RA 4K7ZA 2WPCA 1L9CA 4UP3A 4UDPA 1E7PA 4YKGA 2IVEA 3QFBA 4BK2A 2V3BA 5GRTA 3BHKA 4H2NA 2ZBWA 1CJ4A 4EIQA 1COYA 2ACZA 3AE4A 3DA1A 4I59A 3QSMA 2Y6QA 3V3NA 3AEFA 4JDRA 1RSGA 3D8XA 2EQ9A 5KOWA 1FECA 3QVRA 3NN6X 4K22A 2JK6A 1E6EA 2XLRA 2QAEA 2AAQA 4K5SA 1KNPA 2VVLG 3IHGA 3G5QA 5JCMA 1CHUA 3WE0A 4EM3A 2Q0LA 1YQZA 1XDIA 4M52A 3AYJA 1ZMCA 4U8KA 1XPQA 2QA2A 4YSHA 1PHHA 4AT2A 3SQPA 2JKCA 1GESA 2BA9A 4OPTA 4OVIA 4LA1A 1PXCA 2IVDA 3RP8A 1PDHA 3II4A 2Q6UA 5EBKA 2B7RA 4DSGA 1Y56A 1CC6A 3REDA 3GRSA 1NHQA 1S2QA 1OJCA 1BGJA 3NRNA 4C3YA 3GSIA 1O5WA 2XLTA 3KKJA 1ONFA 3PS9A 3DJDA 5BUKA 2A87A 1GETA 4A65A 1PS9A 1S3BA 3AEGA 4OPLA 2Z5YA 1FOHA 3NN0X 3QJ4A 1IUSA 3EPTA 1RYIA 4JNQA 2YVJA 3F8DA 1TDOA 4Z44A 5FS8A 2C67A 3CNTA 3IWAA 1LQTA 4X9NA 4CCQA 2QA1A 3PO7A 4YWOA 1H6VA 2YR5A 5CQFA 1Q9IA 4IA5A 3CNPA 4D03A 4ADWA 1E39A 2VRLA 3UKQA 3AEBA 1ZMDA 2AR8A 1NG3A 3DK9A 4YTMA 4EMWA 2C3DA 2GRTA 2E1MA 4YTNA 4D04A 1GV4A 4CRTA 3IHMA 4YSYA 2FJAA 3NK0X 5J7XA 2IIDA 4H4RA 2UZZA 2R0PA 1D4DA 3M13A 3VRBA 3G5RA 4CY8A 2XLPA 3S61A 4GUVA 1PXBA 3NT6A 3GWFA 1PBEA 3AE8A 4GR1A 4B1BA 2OA1A 4AT0A 3LXDA 3UCLA 3RHAA 3ICSA 1ZX9A 2X8GA 1PN0A 1VG0A 1ZP0A 2V60A 1K0IA 1ZKQA 4OPUA 2GAHB 3P1WA 4GDEA 5HYMA 1ZY8A 3CN8A 3I3LA 2YG4A 3UOXA 3Q9TA 2XFPA 4UDQA 3EF6A 1KSSA 3KLJA 1NHRA 3AD8B 1M6IA 2X50A 3KU9A 2EQ8A 1IUWA 1B37A 2X8HA 3UKAA 2OALA 2WOVA 1ZK7A 1TDEA 3H8IA 5TR3A 4Y4MA 2R4JA 3AB1A 4H4PA 1YQ4A 3NH3X 3AXBA 4TM3A 3UTFA 3COXA 2GR1A 2R4EA 2B9YA 1PXAA 3CGCA 2I0ZA 2Y6RA 1NG4A
chains in the Genus database with same CATH superfamily
4BV6A 3BJSA 4JN7A 1P48A 2YLZA 1FFVC 1JEHA 2W0HA 1IJHA 2BACA 3L5OA 2VVLA 1P2EA 1TKKA 2FYMA 4DSHA 3UKHA 3VR9A 2XYOA 4JNAA 2W54A 2CHRA 3SJNA 4EQWA 5GSNA 2PA6A 1GTEA 1K0LA 3KD9A 1GRGA 2RGOA 3K30A 2PPGA 3TJ4A 5FJUA 3NK2X 1FEBA 3V3OA 3CGBA 4ECHA 3DJJA 3T2KA 2GGEA 2WOWA 2YQUA 3AYLA 3OP2A 4EQRA 3QSEA 3UTEA 3VRAA 3DK8A 2RGHA 3ALJA 4GFIA 2WU5A 4HCHA 1ZXIC 3CGDA 3CPJG 4II3A 3PG6A 4ZOHB 1DOEA 1KCZA 3ZDNA 1H84A 3I6DA 2XVEA 2PTYA 2BK4A 4M0XA 2E5VA 4GMEA 3NVVB 1DOBA 3P4QA 2DKIA 1B5QA 3D1CA 1KDGA 1Q1RA 2OKTA 1MRAA 5FS9A 2EQ6A 3K7MX 2GF3A 2AL2A 3NYEA 4B69A 2AQJA 1FL2A 3UP4A 3H12A 4H1ZA 2YR4A 3JVAA 3DJEA 4UDRA 4F4RA 4XWRA 3HW2A 4KX6A 4CNJA 2XH2A 2OQYA 2WPFA 4XWZA 4NEVA 4RSLA 2PODA 5J60A 3GYJA 4IVMB 3CIRA 1FFUC 3ZLFA 4TVYA 5FJOA 3L8KA 1GXFA 2PTWA 3GDNA 4K8DA 1CJ3A 3FBSA 1EL8A 2RDXA 3RP7A 2VZ2A 3NNEA 1E9IA 4K1WA 1FCDA 2B76A 1W6TA 3B97A 4GAPA 3JZUA 1TYPA 3BNUA 5FJTA 2XDOA 5BOFA 3EANA 1Q1WA 2OPJA 4YKFA 3BOXA 1PJ7A 4Z2UA 1E1NA 2OG9A 3SR6B 4E4FA 1L0VA 5JCKA 3C96A 2WP6A 1N4WA 2ZADA 3HZLA 1FO4A 3URHA 3BNMA 4Z2TA 4YSXA 2WP5A 4H4WA 4MJWA 1QJDA 1ZDLA 2WS3A 3CNJA 1DNCA 1REOA 3AN1A 5ER0A 1SB3B 2O56A 4H4ZA 1S3EA 4HNLA 1SEZA 3QPEA 3C4AA 3AE7A 5HXIA 5IPYA 1H7WA 3ADAB 3CT2A 3S47A 3TJIA 4K5RA 3ZVHB 1RM6B 1IUTA 4YTPA 1AOGA 2CULA 3MSYA 1X31B 2X99A 2HQMA 2V6OA 1GRHA 2BS2A 1D7YA 3HRDC 3UJFA 4Z25A 5L46A 2C64A 3FIMB 3CXBA 4H2QA 4U2TA 1YKJA 1LJ1A 1VQZA 3UCDA 1CJCA 3R07C 3R0KA 2X8CA 3AE9A 4H4UA 2WPEA 1K0JA 1S2YA 4X4JA 3RGTA 2E4GA 4FI4A 1OJDA 4EM4A 4A99A 4U2LA 2VVMA 3GMBA 4EIPA 4RG3A 4EWJA 5FJPA 1JRZA 4A79A 2ARDA 4K2XA 2XCGA 4E5TA 3T2YA 1F9CA 3VCNA 4UDPA 2P8CA 1FHUA 5GRTA 4EIQA 1COYA 3AE4A 3DA1A 4I59A 3V3NA 4MMWA 2JK6A 3R0UA 2XLRA 1MUCA 2QAEA 1KNPA 3G5QA 2AKMA 5BOEA 1CHUA 3VFCA 5G5HB 4U8KA 1ZMCA 4AT2A 2JKCA 4OPTA 2IVDA 2OFJA 3UXLA 3FXGA 3SZWA 1S2QA 1OJCA 3GSIA 1O5WA 2XLTA 3KKJA 1ONFA 1R6WA 1FOHA 3F8DA 4YWSA 3PO7A 1Q9IA 4IA5A 4D03A 2PMQA 2VRLA 3AEBA 1NG3A 3NVWB 3GY1A 1N63C 1D4DA 3IJQA 3AE8A 4GR1A 1X2HA 4B1BA 3DFHA 1ZX9A 2X8GA 1PN0A 1ZKQA 4GGHA 4GDEA 1SJDA 3N6HA 1JRPA 5HYMA 3UOXA 3D47A 3DESA 4UDQA 3AD8B 2C4CA 1IUWA 2OALA 2WOVA 1TDEA 4Y4MA 3H8IA 5TR3A 2R4JA 4H4PA 3NH3X 4J1OA 4K5SA 3DEQA 3AE3A 1MOKA 1GT8A 2QJNA 3OW1A 4ZCDA 4B67A 3GRTA 3LJPA 1MDRA 3DK4A 4BJZA 1V97A 4NTCA 1KNRA 3LZXA 4I58A 3T9PA 1N5XA 2GSHA 1CL0A 1L9DA 1N60C 1OJAA 3RITA 4E0VA 4U8PA 5KWFA 2PP3A 2OVLA 1KF6A 5KXJA 4J34A 1H7XA 3BSMA 2WHDA 4ZCCA 2GMJA 3UOZA 3NHOX 3FPZA 1GRTA 2YLTA 3ALMA 3SGLA 1OJ9A 4OCGA 4J31A 2C65A 4WCTA 2YLXA 1GTHA 2JB3A 2YG5A 2ZZBA 2YVGA 3JSKA 1H2IA 5J04A 4WX1A 3ABVA 4GAVA 2C3CA 4M6UA 2A89A 1F8RA 3NIXA 4A7AA 5G5GB 4TLZA 3R9UA 2HXTA 1H81A 2Q0KA 4TM0A 3NXLA 2YLSA 3VQRA 4DHGA 3RP6A 4AOXA 4FDCB 1OEPA 3GDPA 3N4FA 2BABA 3AE6A 2JAEA 4J2WA 1CF3A 1JRYA 4JHMA 1M64A 2XVIA 1IYXA 3UCCA 3F8PA 4MKSA 1XHCA 2WDVA 3UJRA 3CNSA 3SN4A 2C73A 3AEAA 4G74A 2OZ8A 4KPRA 4J36A 4GISA 3HYWA 3K7TA 2MNRA 2OLNA 2WEUA 4H4VA 5DBJA 3NLCA 3D9XA 4FX9A 3P4RA 3PFRA 4H50A 1NENA 3DGHA 3H4KA 3MQTA 4DGKA 3IF9A 4JN8A 1F8SA 1NDAA 1N61C 4B66A 3JW7A 2BK3A 3NG7X 1ELSA 4K8GA 2R46A 2VQ7A 1L9EA 4DNAA 3EEZA 4H7UA 3SX6A 3DIPA 1PJ5A 3AM9A 4H4QA 4IV9A 3CYJA 3DGZA 2WETA 3T8QA 2GGIA 4A3RA 5CKUA 1JNRA 1IUVA 2FJEA 1EL5A 1Y56B 1BKHA 3OZYA 3Q45A 3FJ4A 3ES8A 3EKGA 2YM1A 3GYIA 4Z26A 1LV0A 3SYIA 2WU2A 2XLUA 3ATRA 3QN3A 4TM4A 1NHSA 3H70A 1EBDA 1JPMA 2QQ6A 1BWCA 1UKVG 1SJBA 4C3XA 4G6HA 1RVKA 2VOUA 3ATQA 1NEKA 3GC2A 2XFOA 2O9ZA 2V5ZA 4H83A 1XPYA 2BS4A 2WOIA 3H7VA 2PS2A 3V4BA 3LB8A 1LPFA 2PU1A 1B4VA 4ICYA 4OPCA 1W4XA 2W3SA 4AP1A 5HHFA 4H4SA 4J33A 2XFUA 4Y4NA 2AKZA 1YY5A 1F8WA 2RABA 3V5FA 4TVWA 3RRAA 3GYXA 5KRQA 6ENLA 1FEAA 3OTRA 2OO6A 3F8RA 1EBHA 3S5WA 1TDNA 4B64A 2V3AA 1LQUA 3K1GA 4Y4LA 3T0KA 4APNA 2BXRA 1VG9A 2FBWA 3PK7A 4BURA 3P4PA 2PU0A 2BYBA 2R0GA 3EAOA 2FJDA 2MUCA 2EQ7A 3AWIA 4PABA 1RP0A 4A5LA 2BC1A 1VDCA 4G8TA 3FYYA 2PYXA 1WUFA 2TMDA 1GRFA 4EQSA 4U8OA 1XANA 3V3WA 2OQHA 1TZZA 1L9CA 2QDEA 3R10A 3ZLGA 3AEFA 2EQ9A 1FECA 3NO1A 1E6EA 2QJMA 3CK5A 2Q0LA 1YQZA 3KUMA 3AYJA 2QA2A 4YSHA 3N4EA 2BA9A 1PDHA 2Q6UA 2B7RA 3IJIA 1Y56A 1CC6A 3NVZB 4C3YA 2QGYA 4GYPC 3T4WA 4A65A 4A35A 1PS9A 1MNSA 2NQLA 2POZA 3NN0X 3OPSA 1VDVA 2W3RA 1IUSA 3EPTA 3STPA 1JCTA 2ZC8A 4Z44A 3PWGA 3CNTA 4IT1A 4CCQA 3I6TA 4YWOA 1H6VA 5CQFA 1ZMDA 2AR8A 3DK9A 2E1MA 4YTNA 1GV4A 2XH4A 3NK0X 2IIDA 3CB3A 3G5RA 4CY8A 1PXBA 4H19A 3LXDA 5KMPA 5KMRA 1KKOA 1ZP0A 2V60A 1K0IA 2P0IA 1X2GA 3RCYA 1ZY8A 3I3LA 2YG4A 3EF6A 1B37A 1EC7A 4HCLA 2X8HA 3NS1B 4IL0A 2YAUA 1NG4A 4C5OA 3FV9A 1FIQB 3BI5A 4PAAA 1D7LA 3ICRA 4E4UA 4OPGA 2OAMA 2VRMA 1KD0A 4Z43A 2CDUA 4C77A 2BK5A 2C75A 2PGEA 4GYPA 2WQYA 5U1OA 4IVOB 5M0ZA 3DMEA 2XGZA 2FJBA 2C70A 2XSXA 2GR3A 4Z24A 5IDZA 5C3JA 4H2HA 3ZLHA 1QO8A 2YLWA 3V76A 4JY3A 4ROPA 2VQBA 1TDFA 3ITJA 2BS3A 2CVJA 2W55A 3NYCA 3ZYXA 2GGHA 4A6NB 5JCNA 5KVIA 1JPDX 4USQA 2BXSA 4DYEA 1ZOYA 3UKLA 3ICTA 2XH7A 3VRDB 1JRXA 1PBBA 2JB2A 1LVLA 1DXLA 3TOYA 4C74A 2GR0A 3QTPA 4TLXA 4J57A 3R25A 3OC4A 4USRA 2XVFA 3M12A 1N4UA 3VCCA 3M0OA 3TWAA 4RG4A 4NTEA 1KN0A 2DW7A 3DG6A 3HPFA 3LADA 3TCSA 3CPHG 3SN0A 4U8IA 4X9MA 2Q7VA 4G6GA 2A8XA 4E6MA 4JQ9A 2OZ3A 3VC6A 4E8GA 3UP5A 1E1LA 1GNDA 2ZZCA 3V5CA 3NZGA 2V61A 4BK1A 4X2PA 2B9WA 2GGGA 2PHHA 3AE1A 2BC0A 3P3BA 2R9ZA 3NRZB 4CY6A 3GD6A 3GMCA 3O0HA 2HXUA 4DWDA 5FS6A 2JBVA 2OZTA 3ZVHA 3BI4A 2PP1A 2DW6A 2P8BA 3DDMA 1PBCA 3R1ZA 3DJGX 2BRAA 3MY9A 1GRBA 4ZCWA 2B9XA 5EB5A 4G73A 3UTHA 4FK1A 4NEWA 4GF7A 2GAGB 1TE6A 3B9JB 1P2HA 1YQ3A 4YSZA 1BZLA 1N62C 4U8JA 3DERA 4YT0A 4P9SA 1Y0PA 3A7UA 2GDQA 3T37A 1D5TA 1DJNA 5EB4A 3A7AA 5FS7A 2TPRA 1GALA 1VRQB 1QLBA 4IP5A 3KPFA 2YM2A 4O5UA 3CMMA 3NGCX 3UJEA 1D4EA 4U2SA 4JY2A 1MO9A 1EBGA 4NWZA 3RNMA 3S5SA 1JNZA 3IC9A 5BRTA 3CGEA 4YXDA 5KVHA 4U8NA 3SFDA 2BCPA 3SZFA 3C4NA 2R0CA 3AD7B 1N4VA 4JN9A 1CBOA 3R11A 1TYTA 3DG7A 3SFEA 3UXKA 2WBAA 3NYFA 3THUA 1EL9A 4EQXA 1KFYA 4DXKA 3QSSA 1GREA 2NVKX 3I6EA 4GIRA 1O95A 2XLSA 4FK1C 4BK3A 3KVEA 3T14A 4GCMA 1FHVA 2C7GA 1GERA 4B63A 1ZOVA 4CBQA 2GL5A 4XXGA 3BI2A 3EUB3 3T31A 2DKHA 4HA6A 5M10A 2I5QA 3UTGA 3TW9A 5IQ4A 4REKA 3OZMA 3G5SA 4GGBA 1H83A 2C66A 1JROA 4CCRA 3B3RA 4K7ZA 2WPCA 3NVYB 4YKGA 2IVEA 4IL2A 1CJ4A 3QSMA 7ENLA 2Y6QA 1RSGA 1EC8A 4MGGA 3IHGA 3IK4A 1JDFA 5JCMA 4K2SA 3WE0A 4EM3A 1XDIA 4M52A 1XPQA 4ZA0A 1PHHA 4LA1A 1S7MA 5EBKA 4DSGA 3PS9A 1GETA 1S3BA 3AEGA 3QJ4A 1N5WC 3ENLA 1RYIA 4JNQA 1TDOA 2AL1A 5FS8A 2C67A 1LQTA 4X9NA 2QA1A 2PSNA 2YR5A 1STZA 3CNPA 4ADWA 1E39A 4G9KA 1ONEA 3FCPA 2GGJA 4YTMA 2C3DA 2GRTA 4II2A 3IHMA 2FJAA 5J7XA 4DN1A 4H4RA 5JRBA 3DG3A 2R0PA 3M13A 2XLPA 3NT6A 1T3QC 3UCLA 3RHAA 3ICSA 1VG0A 2GAHB 3CN8A 2XFPA 1NHRA 2PTZA 3QKEA 3AMZA 1ZK7A 3AB1A 1YQ4A 3UTFA 4TM3A 3AXBA 3COXA 2GR1A 1KKRA 3FVDA 2R4EA 4Z17A 2I0ZA 4GRTA 4HNCA 2H88A 2QVHA 5BVAA 3HYVA 2P3ZA 3CTYA 3VA8A 1ELIA 4EMIA 3BHFA 1BGNA 1E1MA 1GSNA 4ZN0A 3DGBA 4U8MA 1SJAA 4KPLA 1K4QA 2C72A 5C2TA 2GQFA 2E3TA 1CJ2A 3AEDA 1F3PA 4KEMA 3P9UA 2YVFA 2YWLA 3NTDA 3L1RA 4LU6A 2GMHA 2AL2B 1N1PA 3SQSA 3CNDA 3AE5A 3Q6JA 3GWDA 5EOWA 2GR2A 1JU2A 2GVCA 5HY5A 1O94A 3MWCA 3ALLA 3VDGA 3GD4A 2X3NA 4U8LA 3NKSA 3T6CA 3T2ZA 3ISHA 4GDPA 3A7RA 1PDYA 4IHCA 2WP9A 2E5AA 3FMWA 2QDDA 1PBFA 1DOCA 2FKPA 5FJRA 3N6JA 2WESA 2YR6A 4DX3A 4A6NA 3OZ2A 4H2RA 5KOXA 3H8AA 5KMSA 4BJYA 2PCEA 3MUCA 2QCUA 2PP0A 1KSUA 1BKWA 5U63A 3SXIA 3QVPA 1B8SA 4LIIA 2QJJA 3KA7A 3NK1X 1LTXR 5JCLA 4O5QA 3PVCA 1IUXA 3AD9B 4HCDA 1F6MA 4B65A 2GEWA 2GV8A 3UOVA 1XS2A 3DH9A 3GD3A 2R45A 2Z5XA 1CC4A 4J3ZA 4J56A 4H4TA 1GOSA 3K7QX 1NHPA 3Q4DA 3TTEA 2C76A 4NTDA 1WYGA 3AYIA 3D46A 1GPEA 1PJ6A 4IZGA 3AE2A 3SSZA 4CNKA 3SY4A 3SN1A 1DJQA 3P0WA 1PBDA 1BQGA 1L8PA 3H8LA 2NPXA 1YEYA 3P4SA 3NTAA 4AOSA 3AECA 1HYUA 2GQWA 2RGJA 3P93A 5LV9A 2APGA 4Z1YA 4IA6A 2YG3A 2ZZ0A 3UOYA 2CFYA 5JCIA 3SM8A 4HN8A 4OPDA 1NAAA 4KT2A 1D4CA 4ENLA 5IQ1A 3TWBA 4H2PA 5EU9A 1E1KA 3ES7A 1TDKA 3UKPA 3QFAA 1NELA 4A6GA 5U25A 4HB9A 2OLAA 3U9IA 3SZ0A 3ETRB 2GB0A 2GH5A 1EL7A 4Z2RA 3AEEA 3UJ2A 1OJTA 1NPXA 2BCGG 4EMJA 1VQWA 1H82A 1MDLA 4NZHA 3QLDA 4G7FA 3VR8A 4H4XA 3MZNA 2WDQA 5KNLA 3TQPA 2XFQA 1DODA 1IUUA 4B68A 2J3NA 2F5ZA 4H4YA 2XVJA 3RR1A 3LOVA 3GO2A 3I4KA 2HZGA 1GRAA 4A9WA 2YG6A 1TRBA 3PWIA 1JOAA 2YG7A 3B6DA 1MXTA 4OPIA 3DFYA 1Z6LA 3U4FA 2WDRA 2HNEA 2XVHA 2JB1A 5BULA 1V59A 3E1TA 2B7SA 4TM1A 3UKFA 4NNJA 5FMHA 3FG2P 1CC2A 1BF3A 1GEUA 4N9XA 1H86A 3RO6A 1R0MA 2OLOA 2XFNA 2OX4A 2YLRA 3CPIG 2H89A 3UKKA 4AP3A 5ENLA 3LZWA 4UP3A 1NU5A 1E7PA 4FP1A 4BK2A 3QFBA 3CAWA 3HYXA 2V3BA 3BHKA 4H2NA 2ZBWA 2ACZA 4JDRA 3D8XA 5KOWA 3ZVIA 3QVRA 3KPKA 3NN6X 4K22A 3SZCA 2AAQA 2VVLG 2BRYA 3NFUA 1EC9A 3SQPA 3SBFA 1GESA 1DTNA 4OVIA 1PXCA 3RP8A 3II4A 3UJSA 3REDA 3GRSA 1NHQA 3NRNA 1BGJA 1PDZA 2ONEA 3CXOA 3DJDA 5BUKA 2A87A 3MKCA 4OPLA 2Z5YA 4HPNA 2YVJA 3UGVA 3IWAA 3UKQA 4KWSA 4EMWA 4D04A 4CRTA 4YSYA 1ECQA 1P43A 2UZZA 4HYRA 3VRBA 2PGWA 2P88A 3S61A 4GUVA 1SJCA 3GWFA 1PBEA 2XH0A 2OA1A 4AT0A 2PTXA 4OPUA 3P1WA 3Q9TA 5KMQA 1KSSA 3KLJA 1M6IA 1WUEA 2X50A 3IJLA 3KU9A 2EQ8A 3VC5A 3UKAA 4IP4A 2B9YA 1PXAA 3CGCA 2Y6RA
chains in the Genus database with same CATH topology
4C5OA 3AE3A 3BI5A 4BV6A 4GRTA 4PAAA 1D7LA 1MOKA 3ICRA 2H88A 1GT8A 2YLZA 4OPGA 5BVAA 1IJHA 1JEHA 2W0HA 2BACA 3HYVA 3L5OA 2VVLA 1P2EA 3CTYA 4DSHA 3UKHA 4ZCDA 3VR9A 4B67A 3GRTA 2OAMA 2VRMA 1ELIA 2XYOA 4JNAA 4EMIA 3BHFA 3LJPA 3DK4A 1BGNA 4EQWA 1E1MA 1GSNA 5GSNA 2CDUA 4Z43A 4U8MA 4ZN0A 4BJZA 4C77A 2BK5A 2C75A 4NTCA 1K4QA 1GTEA 1K0LA 2C72A 1KNRA 2WQYA 3KD9A 5C2TA 1GRGA 2GQFA 2RGOA 3K30A 5U1OA 3NK2X 4IVOB 3LZXA 1FEBA 1CJ2A 4I58A 5M0ZA 3V3OA 3AEDA 3CGBA 1F3PA 3DMEA 3P9UA 2YVFA 2YWLA 3NTDA 1CL0A 1L9DA 4ECHA 3DJJA 3T2KA 1OJAA 2FJBA 3L1RA 2WOWA 2YQUA 2C70A 3AYLA 4LU6A 2GMHA 2GR3A 4EQRA 4E0VA 4Z24A 4U8PA 5KWFA 5C3JA 1QO8A 2YLWA 3QSEA 3V76A 4JY3A 2VQBA 3UTEA 3VRAA 1KF6A 1N1PA 5KXJA 3DK8A 1TDFA 2RGHA 3ALJA 3CNDA 4J34A 3AE5A 3Q6JA 3ITJA 1H7XA 2BS3A 2CVJA 2WU5A 3GWDA 3NYCA 5EOWA 3CGDA 3ZYXA 2GR2A 1JU2A 4A6NB 3CPJG 2WHDA 5JCNA 2GVCA 5HY5A 1O94A 4II3A 5KVIA 3ALLA 2GMJA 4USQA 4ZCCA 3PG6A 2X3NA 3GD4A 4U8LA 3UOZA 3NHOX 2BXSA 1ZOYA 1DOEA 3FPZA 3UKLA 3NKSA 3T2ZA 3ICTA 3ZDNA 1H84A 1GRTA 2XVEA 3I6DA 3ISHA 3VRDB 4GDPA 2YLTA 3ALMA 3SGLA 1OJ9A 1JRXA 1PBBA 2JB2A 1LVLA 2BK4A 2E5VA 1DXLA 4OCGA 1DOBA 3P4QA 2WP9A 2DKIA 1B5QA 4C74A 3FMWA 4J31A 3D1CA 2GR0A 1PBFA 1DOCA 2C65A 4WCTA 4TLXA 4J57A 1KDGA 2YLXA 1Q1RA 1GTHA 2JB3A 2WESA 2YG5A 3OC4A 2YR6A 4A6NA 2ZZBA 4USRA 2XVFA 5FS9A 3M12A 1N4UA 2YVGA 3JSKA 3OZ2A 1H2IA 4H2RA 2EQ6A 4WX1A 3M0OA 5KOXA 5KMSA 3ABVA 4RG4A 3K7MX 4NTEA 4BJYA 1KN0A 2GF3A 4GAVA 2C3CA 3LADA 2QCUA 2A89A 3CPHG 1F8RA 1KSUA 3NIXA 3NYEA 4B69A 4A7AA 2AQJA 1BKWA 1FL2A 5U63A 3UP4A 4TLZA 2YR4A 3SXIA 4U8IA 4X9MA 3DJEA 3QVPA 3R9UA 4UDRA 4XWRA 1B8SA 2Q7VA 4G6GA 2A8XA 4LIIA 4KX6A 4CNJA 4JQ9A 1H81A 3KA7A 3NK1X 3UP5A 1LTXR 5JCLA 1E1LA 1GNDA 4O5QA 2Q0KA 2ZZCA 3PVCA 1IUXA 4TM0A 2YLSA 3VQRA 2V61A 3AD9B 4BK1A 2B9WA 2WPFA 4XWZA 1F6MA 3RP6A 2PHHA 3AE1A 4FDCB 4AOXA 4B65A 2GEWA 2GV8A 3UOVA 3DH9A 2BC0A 3GDPA 3GD3A 4NEVA 2BABA 2R45A 2Z5XA 4RSLA 1CC4A 3AE6A 2JAEA 4J2WA 2R9ZA 1CF3A 1JRYA 4J56A 1M64A 2XVIA 4H4TA 5J60A 3F8PA 1GOSA 3GYJA 4IVMB 3CIRA 2WDVA 1XHCA 4CY6A 3CNSA 2C73A 3AEAA 4G74A 3GMCA 3K7QX 4J36A 4KPRA 3HYWA 3O0HA 3K7TA 1NHPA 2OLNA 2WEUA 4H4VA 5FS6A 5DBJA 2C76A 2JBVA 3NLCA 4NTDA 3D9XA 3AYIA 3L8KA 1GPEA 4FX9A 3P4RA 1GXFA 3BI4A 4H50A 1NENA 1PJ6A 3DGHA 3AE2A 3H4KA 4DGKA 3IF9A 4CNKA 3SY4A 1DJQA 1F8SA 1NDAA 4B66A 3GDNA 4K8DA 1CJ3A 2BK3A 3NG7X 2R46A 3FBSA 1EL8A 1PBDA 3RP7A 2VQ7A 1L9EA 2VZ2A 3NNEA 4DNAA 3H8LA 4H7UA 3SX6A 2NPXA 1FCDA 1PJ5A 3P4SA 1PBCA 4H4QA 2B76A 3NTAA 4AOSA 3DJGX 2BRAA 4IV9A 3DGZA 2WETA 4GAPA 1GRBA 1TYPA 2B9XA 3AECA 3BNUA 5EB5A 4G73A 1HYUA 5CKUA 3UTHA 1JNRA 2GQWA 2RGJA 4NEWA 2XDOA 1IUVA 4FK1A 4GF7A 2FJEA 2GAGB 3EANA 1EL5A 1Y56B 1Q1WA 1P2HA 5LV9A 2APGA 1YQ3A 4IA6A 4YSZA 1BZLA 4YKFA 2YG3A 4U8JA 2ZZ0A 2YM1A 3GYIA 1PJ7A 4Z2UA 1E1NA 4YT0A 4P9SA 4Z26A 1LV0A 3SYIA 1Y0PA 3UOYA 2CFYA 2WU2A 2XLUA 5JCIA 3ATRA 3T37A 1D5TA 1DJNA 5EB4A 3SM8A 4OPDA 1NAAA 1D4CA 4TM4A 5IQ1A 4H2PA 1L0VA 5JCKA 1E1KA 1TDKA 1NHSA 3C96A 2WP6A 5FS7A 1EBDA 3UKPA 1N4WA 3QFAA 2TPRA 1GALA 3HZLA 1VRQB 1QLBA 5U25A 4HB9A 3URHA 3KPFA 3BNMA 2YM2A 3SZ0A 4Z2TA 1BWCA 1UKVG 2GB0A 4O5UA 2WP5A 3CMMA 4C3XA 4H4WA 4YSXA 3NGCX 2GH5A 4MJWA 1QJDA 1EL7A 4Z2RA 1D4EA 3AEEA 4G6HA 4U2SA 1ZDLA 2VOUA 4JY2A 1OJTA 1NPXA 2BCGG 4EMJA 1NEKA 1VQWA 3ATQA 1H82A 2WS3A 2XFOA 3CNJA 1DNCA 1REOA 5ER0A 1MO9A 4NWZA 2O9ZA 4NZHA 2V5ZA 4H4ZA 3RNMA 1S3EA 3VR8A 2BS4A 1SEZA 4H4XA 1JNZA 2WDQA 5KNLA 2WOIA 3C4AA 2XFQA 2YAUA 1DODA 1IUUA 3IC9A 5BRTA 3AE7A 5HXIA 3CGEA 4YXDA 5IPYA 1H7WA 3ADAB 4B68A 5KVHA 3LB8A 1LPFA 1B4VA 4ICYA 4K5RA 4OPCA 4U8NA 2J3NA 1W4XA 1IUTA 3SFDA 4YTPA 4AP1A 5HHFA 2F5ZA 1AOGA 4H4YA 4H4SA 2BCPA 2CULA 2XVJA 3C4NA 2R0CA 1X31B 3LOVA 4J33A 3SZFA 2X99A 3AD7B 2XFUA 1N4VA 4JN9A 4Y4NA 2HQMA 2V6OA 1YY5A 1GRHA 1F8WA 2BS2A 1D7YA 1CBOA 1TYTA 2RABA 3SFEA 1GRAA 4Z25A 4A9WA 2YG6A 5L46A 2C64A 3FIMB 1TRBA 2WBAA 4H2QA 3GYXA 4U2TA 5KRQA 1JOAA 1FEAA 2YG7A 3B6DA 1YKJA 3NYFA 1LJ1A 1MXTA 3F8RA 3S5WA 1EL9A 1TDNA 4EQXA 1CJCA 1KFYA 4OPIA 4B64A 2V3AA 3QSSA 1GREA 2NVKX 2X8CA 4H4UA 1LQUA 1Z6LA 4APNA 3AE9A 4Y4LA 2WPEA 1O95A 2WDRA 3T0KA 2XLSA 2BXRA 2XVHA 1VG9A 2FBWA 2JB1A 4FK1C 4BK3A 1K0JA 1S2YA 3KVEA 5BULA 4X4JA 3T14A 1V59A 4BURA 2E4GA 2B7SA 3E1TA 3P4PA 4GCMA 1OJDA 4TM1A 2BYBA 2R0GA 3UKFA 4EM4A 4A99A 3EAOA 2FJDA 4NNJA 4U2LA 2EQ7A 2C7GA 2VVMA 3GMBA 5FMHA 3FG2P 1CC2A 3AWIA 4PABA 1GERA 4EIPA 1BF3A 4B63A 1GEUA 4RG3A 4N9XA 1ZOVA 1RP0A 4CBQA 1H86A 4XXGA 3BI2A 2OLOA 3T31A 4A5LA 2DKHA 2BC1A 4HA6A 2XFNA 1JRZA 5M10A 1VDCA 3UTGA 4A79A 5IQ4A 2YLRA 2PYXA 4REKA 2ARDA 2TMDA 1GRFA 4EQSA 4U8OA 1XANA 3CPIG 4K2XA 2H89A 3UKKA 3G5SA 2XCGA 4AP3A 1H83A 2C66A 4CCRA 3LZWA 3B3RA 4K7ZA 3T2YA 2WPCA 1L9CA 4UP3A 4UDPA 1E7PA 4YKGA 2IVEA 3QFBA 3HYXA 4BK2A 2V3BA 5GRTA 3BHKA 4H2NA 2ZBWA 1CJ4A 4EIQA 1COYA 2ACZA 3AE4A 3DA1A 4I59A 3QSMA 2Y6QA 3V3NA 3AEFA 4JDRA 1RSGA 3D8XA 2EQ9A 5KOWA 1FECA 3QVRA 3KPKA 3NN6X 4K22A 2JK6A 1E6EA 2XLRA 3SZCA 2QAEA 2AAQA 4K5SA 1KNPA 2VVLG 3IHGA 3G5QA 5JCMA 1CHUA 2BRYA 3WE0A 4EM3A 2Q0LA 1YQZA 1XDIA 4M52A 3AYJA 1ZMCA 4U8KA 1XPQA 2QA2A 4YSHA 1PHHA 4AT2A 3SQPA 2JKCA 1GESA 2BA9A 4OPTA 4OVIA 4LA1A 1PXCA 2IVDA 1S7MA 3RP8A 1PDHA 3II4A 2Q6UA 5EBKA 2B7RA 4DSGA 1Y56A 1CC6A 3REDA 3SZWA 3GRSA 1NHQA 1S2QA 1OJCA 1BGJA 3NRNA 4C3YA 3GSIA 1O5WA 2XLTA 3KKJA 1ONFA 3PS9A 3DJDA 5BUKA 2A87A 1GETA 4A65A 1PS9A 1S3BA 3AEGA 4OPLA 2Z5YA 1FOHA 3NN0X 3QJ4A 1IUSA 3EPTA 1RYIA 4JNQA 2YVJA 3F8DA 1TDOA 4Z44A 5FS8A 2C67A 3CNTA 3IWAA 1LQTA 4X9NA 4CCQA 2QA1A 3PO7A 4YWOA 1H6VA 2YR5A 5CQFA 1Q9IA 4IA5A 3CNPA 4D03A 4ADWA 1E39A 4G9KA 2VRLA 3UKQA 3AEBA 1ZMDA 2AR8A 1NG3A 3DK9A 4YTMA 4EMWA 2C3DA 2GRTA 2E1MA 4YTNA 4II2A 4D04A 1GV4A 4CRTA 3IHMA 4YSYA 2FJAA 3NK0X 5J7XA 2IIDA 4H4RA 2UZZA 5JRBA 2R0PA 1D4DA 3M13A 3VRBA 3G5RA 4CY8A 2XLPA 3S61A 4GUVA 1PXBA 3NT6A 3GWFA 1PBEA 3AE8A 4GR1A 4B1BA 2OA1A 4AT0A 3LXDA 3UCLA 3RHAA 3ICSA 1ZX9A 5KMPA 5KMRA 2X8GA 1PN0A 1VG0A 1ZP0A 2V60A 1K0IA 1ZKQA 4OPUA 2GAHB 3P1WA 4GDEA 5HYMA 1ZY8A 3CN8A 3I3LA 2YG4A 3UOXA 3Q9TA 5KMQA 2XFPA 4UDQA 3EF6A 1KSSA 3KLJA 1NHRA 2C4CA 3AD8B 1M6IA 2X50A 3KU9A 2EQ8A 1IUWA 1B37A 2X8HA 3UKAA 2OALA 2WOVA 1ZK7A 1TDEA 3H8IA 5TR3A 4Y4MA 2R4JA 3AB1A 4H4PA 1YQ4A 3NH3X 3AXBA 4TM3A 3UTFA 3COXA 2GR1A 2R4EA 2B9YA 1PXAA 3CGCA 2I0ZA 2Y6RA 1NG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C5O A;  3AE3 A;  3BI5 A;  4BV6 A;  4GRT A;  4PAA A;  1D7L A;  1MOK A;  3ICR A;  2H88 A;  1GT8 A;  2YLZ A;  4OPG A;  5BVA A;  1IJH A;  1JEH A;  2W0H A;  2BAC A;  2VVL A;  1P2E A;  3CTY A;  4DSH A;  3UKH A;  4ZCD A;  3VR9 A;  4B67 A;  3GRT A;  2OAM A;  2VRM A;  1ELI A;  2XYO A;  4JNA A;  4EMI A;  3BHF A;  3LJP A;  3DK4 A;  1BGN A;  4EQW A;  1E1M A;  1GSN A;  5GSN A;  2CDU A;  4Z43 A;  4U8M A;  4ZN0 A;  4BJZ A;  4C77 A;  2BK5 A;  2C75 A;  4NTC A;  1K4Q A;  1GTE A;  1K0L A;  2C72 A;  1KNR A;  2WQY A;  3KD9 A;  5C2T A;  1GRG A;  2GQF A;  2RGO A;  3K30 A;  5U1O A;  3NK2 X;  4IVO B;  3LZX A;  1FEB A;  1CJ2 A;  4I58 A;  5M0Z A;  3V3O A;  3AED A;  3CGB A;  1F3P A;  3DME A;  3P9U A;  2YVF A;  2YWL A;  3NTD A;  1CL0 A;  1L9D A;  4ECH A;  3DJJ A;  1OJA A;  2FJB A;  3L1R A;  2WOW A;  2YQU A;  2C70 A;  3AYL A;  4LU6 A;  2GMH A;  2GR3 A;  4EQR A;  4E0V A;  4Z24 A;  4U8P A;  5KWF A;  5C3J A;  1QO8 A;  2YLW A;  3QSE A;  3V76 A;  4JY3 A;  2VQB A;  3UTE A;  3VRA A;  1KF6 A;  1N1P A;  5KXJ A;  3DK8 A;  1TDF A;  2RGH A;  3ALJ A;  3CND A;  4J34 A;  3AE5 A;  3Q6J A;  3ITJ A;  1H7X A;  2BS3 A;  2CVJ A;  2WU5 A;  3GWD A;  3NYC A;  5EOW A;  3CGD A;  3ZYX A;  2GR2 A;  1JU2 A;  4A6N B;  3CPJ G;  2WHD A;  5JCN A;  2GVC A;  5HY5 A;  1O94 A;  5KVI A;  3ALL A;  2GMJ A;  4USQ A;  4ZCC A;  3UOZ A;  2X3N A;  3GD4 A;  4U8L A;  3NHO X;  2BXS A;  1ZOY A;  1DOE A;  3FPZ A;  3UKL A;  3NKS A;  3ZDN A;  3ICT A;  1H84 A;  1GRT A;  2XVE A;  3I6D A;  3ISH A;  3VRD B;  4GDP A;  2YLT A;  3ALM A;  3SGL A;  1OJ9 A;  1JRX A;  1PBB A;  2JB2 A;  1LVL A;  2BK4 A;  2E5V A;  1DXL A;  4OCG A;  1DOB A;  3P4Q A;  2WP9 A;  2DKI A;  1B5Q A;  4C74 A;  3FMW A;  4J31 A;  3D1C A;  2GR0 A;  1PBF A;  1DOC A;  2C65 A;  4WCT A;  4TLX A;  4J57 A;  1KDG A;  2YLX A;  1Q1R A;  1GTH A;  2JB3 A;  2WES A;  2YG5 A;  3OC4 A;  2YR6 A;  4A6N A;  2ZZB A;  4USR A;  2XVF A;  5FS9 A;  3M12 A;  1N4U A;  2YVG A;  3JSK A;  3OZ2 A;  4H2R A;  2EQ6 A;  4WX1 A;  3M0O A;  5KOX A;  3ABV A;  4RG4 A;  3K7M X;  4NTE A;  4BJY A;  2GF3 A;  2C3C A;  3LAD A;  2QCU A;  2A89 A;  3CPH G;  1F8R A;  1KSU A;  3NIX A;  3NYE A;  4B69 A;  4A7A A;  2AQJ A;  1BKW A;  1FL2 A;  5U63 A;  3UP4 A;  4TLZ A;  2YR4 A;  4U8I A;  4X9M A;  3DJE A;  3QVP A;  3R9U A;  4UDR A;  4XWR A;  1B8S A;  2Q7V A;  2A8X A;  4LII A;  4KX6 A;  4CNJ A;  4JQ9 A;  1H81 A;  3KA7 A;  3NK1 X;  3UP5 A;  1LTX R;  5JCL A;  1E1L A;  1GND A;  4O5Q A;  2Q0K A;  2ZZC A;  3PVC A;  1IUX A;  4TM0 A;  2YLS A;  3VQR A;  2V61 A;  3AD9 B;  4BK1 A;  2B9W A;  2WPF A;  4XWZ A;  1F6M A;  3RP6 A;  2PHH A;  3AE1 A;  4FDC B;  4AOX A;  4B65 A;  2GEW A;  2GV8 A;  3UOV A;  3DH9 A;  2BC0 A;  3GDP A;  3GD3 A;  4NEV A;  2BAB A;  2R45 A;  2Z5X A;  4RSL A;  1CC4 A;  3AE6 A;  2JAE A;  4J2W A;  2R9Z A;  1CF3 A;  1JRY A;  4J56 A;  1M64 A;  2XVI A;  4H4T A;  5J60 A;  3F8P A;  1GOS A;  3GYJ A;  4IVM B;  3CIR A;  2WDV A;  1XHC A;  4CY6 A;  3CNS A;  2C73 A;  3AEA A;  3GMC A;  3K7Q X;  4J36 A;  4KPR A;  3O0H A;  3K7T A;  1NHP A;  2OLN A;  2WEU A;  4H4V A;  5FS6 A;  5DBJ A;  2C76 A;  2JBV A;  3NLC A;  4NTD A;  3AYI A;  3L8K A;  1GPE A;  4FX9 A;  3P4R A;  1GXF A;  3BI4 A;  4H50 A;  1NEN A;  1PJ6 A;  3DGH A;  3AE2 A;  3H4K A;  4DGK A;  3IF9 A;  4CNK A;  1DJQ A;  1F8S A;  1NDA A;  4B66 A;  3GDN A;  4K8D A;  1CJ3 A;  2BK3 A;  3NG7 X;  2R46 A;  3FBS A;  1EL8 A;  1PBD A;  3RP7 A;  2VQ7 A;  1L9E A;  2VZ2 A;  3NNE A;  4DNA A;  3H8L A;  4H7U A;  2NPX A;  1FCD A;  1PJ5 A;  3P4S A;  1PBC A;  4H4Q A;  2B76 A;  3NTA A;  4AOS A;  3DJG X;  4IV9 A;  3DGZ A;  2WET A;  1GRB A;  1TYP A;  2B9X A;  3AEC A;  3BNU A;  5EB5 A;  1HYU A;  5CKU A;  3UTH A;  1JNR A;  2GQW A;  2RGJ A;  4NEW A;  2XDO A;  1IUV A;  4FK1 A;  4GF7 A;  2FJE A;  2GAG B;  3EAN A;  1EL5 A;  1Y56 B;  1Q1W A;  1P2H A;  5LV9 A;  2APG A;  1YQ3 A;  4IA6 A;  4YSZ A;  1BZL A;  4YKF A;  2YG3 A;  4U8J A;  2ZZ0 A;  2YM1 A;  3GYI A;  1PJ7 A;  4Z2U A;  1E1N A;  4YT0 A;  4P9S A;  4Z26 A;  1LV0 A;  1Y0P A;  3UOY A;  2CFY A;  2WU2 A;  2XLU A;  5JCI A;  3ATR A;  3T37 A;  1D5T A;  1DJN A;  5EB4 A;  3SM8 A;  4OPD A;  1NAA A;  1D4C A;  4TM4 A;  5IQ1 A;  4H2P A;  1L0V A;  5JCK A;  1E1K A;  1TDK A;  1NHS A;  3C96 A;  2WP6 A;  5FS7 A;  1EBD A;  3UKP A;  1N4W A;  3QFA A;  2TPR A;  1GAL A;  3HZL A;  1VRQ B;  1QLB A;  5U25 A;  4HB9 A;  3URH A;  3KPF A;  3BNM A;  2YM2 A;  4Z2T A;  1BWC A;  1UKV G;  2GB0 A;  4O5U A;  2WP5 A;  4YSX A;  4C3X A;  4H4W A;  3NGC X;  2GH5 A;  4MJW A;  1QJD A;  1EL7 A;  4Z2R A;  1D4E A;  3AEE A;  4U2S A;  1ZDL A;  2VOU A;  4JY2 A;  1OJT A;  1NPX A;  2BCG G;  4EMJ A;  1NEK A;  1VQW A;  3ATQ A;  1H82 A;  2WS3 A;  2XFO A;  3CNJ A;  1DNC A;  1REO A;  5ER0 A;  1MO9 A;  2O9Z A;  4NZH A;  2V5Z A;  4H4Z A;  3RNM A;  1S3E A;  3VR8 A;  2BS4 A;  1SEZ A;  4H4X A;  1JNZ A;  2WDQ A;  2WOI A;  3C4A A;  2XFQ A;  2YAU A;  1DOD A;  1IUU A;  3IC9 A;  5BRT A;  3AE7 A;  5HXI A;  3CGE A;  4YXD A;  5IPY A;  1H7W A;  3ADA B;  4B68 A;  5KVH A;  3LB8 A;  1LPF A;  1B4V A;  4ICY A;  4K5R A;  4OPC A;  4U8N A;  2J3N A;  1W4X A;  1IUT A;  3SFD A;  4YTP A;  4AP1 A;  5HHF A;  2F5Z A;  1AOG A;  4H4Y A;  4H4S A;  2BCP A;  2CUL A;  2XVJ A;  3C4N A;  2R0C A;  1X31 B;  3LOV A;  4J33 A;  2X99 A;  3AD7 B;  2XFU A;  1N4V A;  4JN9 A;  4Y4N A;  2HQM A;  2V6O A;  1YY5 A;  1GRH A;  1F8W A;  2BS2 A;  1D7Y A;  1CBO A;  1TYT A;  2RAB A;  3SFE A;  1GRA A;  4Z25 A;  4A9W A;  2YG6 A;  5L46 A;  2C64 A;  3FIM B;  1TRB A;  2WBA A;  4H2Q A;  4U2T A;  5KRQ A;  1JOA A;  1FEA A;  2YG7 A;  3B6D A;  1YKJ A;  3NYF A;  1LJ1 A;  1MXT A;  3F8R A;  3S5W A;  1EL9 A;  1TDN A;  4EQX A;  1CJC A;  1KFY A;  4OPI A;  4B64 A;  2V3A A;  3QSS A;  1GRE A;  2NVK X;  2X8C A;  4H4U A;  1LQU A;  1Z6L A;  4APN A;  3AE9 A;  4Y4L A;  2WPE A;  1O95 A;  2WDR A;  2XLS A;  2BXR A;  2XVH A;  1VG9 A;  2FBW A;  2JB1 A;  4FK1 C;  4BK3 A;  1K0J A;  1S2Y A;  3KVE A;  5BUL A;  4X4J A;  1V59 A;  4BUR A;  2E4G A;  2B7S A;  3E1T A;  3P4P A;  4GCM A;  1OJD A;  4TM1 A;  2BYB A;  2R0G A;  3UKF A;  4EM4 A;  4A99 A;  3EAO A;  2FJD A;  4U2L A;  2EQ7 A;  2C7G A;  2VVM A;  3GMB A;  5FMH A;  3FG2 P;  1CC2 A;  3AWI A;  4PAB A;  1GER A;  4EIP A;  1BF3 A;  4B63 A;  1GEU A;  4RG3 A;  4N9X A;  1ZOV A;  1RP0 A;  4CBQ A;  1H86 A;  4XXG A;  3BI2 A;  2OLO A;  4A5L A;  2DKH A;  2BC1 A;  4HA6 A;  2XFN A;  1JRZ A;  5M10 A;  1VDC A;  3UTG A;  4A79 A;  5IQ4 A;  2YLR A;  2PYX A;  4REK A;  2ARD A;  2TMD A;  1GRF A;  4EQS A;  4U8O A;  1XAN A;  3CPI G;  4K2X A;  2H89 A;  3UKK A;  3G5S A;  2XCG A;  4AP3 A;  1H83 A;  2C66 A;  4CCR A;  3LZW A;  3B3R A;  4K7Z A;  2WPC A;  1L9C A;  4UP3 A;  4UDP A;  1E7P A;  4YKG A;  2IVE A;  3QFB A;  4BK2 A;  2V3B A;  5GRT A;  3BHK A;  4H2N A;  2ZBW A;  1CJ4 A;  4EIQ A;  1COY A;  2ACZ A;  3AE4 A;  3DA1 A;  4I59 A;  3QSM A;  2Y6Q A;  3V3N A;  3AEF A;  4JDR A;  1RSG A;  3D8X A;  2EQ9 A;  5KOW A;  1FEC A;  3QVR A;  3NN6 X;  4K22 A;  2JK6 A;  1E6E A;  2XLR A;  2QAE A;  2AAQ A;  4K5S A;  1KNP A;  2VVL G;  3IHG A;  3G5Q A;  5JCM A;  1CHU A;  3WE0 A;  4EM3 A;  2Q0L A;  1YQZ A;  1XDI A;  4M52 A;  3AYJ A;  1ZMC A;  4U8K A;  1XPQ A;  2QA2 A;  4YSH A;  1PHH A;  4AT2 A;  3SQP A;  2JKC A;  1GES A;  2BA9 A;  4OPT A;  4OVI A;  4LA1 A;  1PXC A;  2IVD A;  3RP8 A;  1PDH A;  3II4 A;  2Q6U A;  5EBK A;  2B7R A;  4DSG A;  1Y56 A;  1CC6 A;  3RED A;  3GRS A;  1NHQ A;  1S2Q A;  1OJC A;  1BGJ A;  3NRN A;  4C3Y A;  3GSI A;  1O5W A;  2XLT A;  3KKJ A;  1ONF A;  3PS9 A;  3DJD A;  5BUK A;  2A87 A;  1GET A;  4A65 A;  1PS9 A;  1S3B A;  3AEG A;  4OPL A;  2Z5Y A;  1FOH A;  3NN0 X;  3QJ4 A;  1IUS A;  3EPT A;  1RYI A;  4JNQ A;  2YVJ A;  3F8D A;  1TDO A;  4Z44 A;  5FS8 A;  2C67 A;  3CNT A;  3IWA A;  1LQT A;  4X9N A;  4CCQ A;  2QA1 A;  3PO7 A;  4YWO A;  1H6V A;  2YR5 A;  5CQF A;  1Q9I A;  4IA5 A;  3CNP A;  4D03 A;  4ADW A;  1E39 A;  2VRL A;  3UKQ A;  3AEB A;  1ZMD A;  2AR8 A;  1NG3 A;  3DK9 A;  4YTM A;  4EMW A;  2C3D A;  2GRT A;  2E1M A;  4YTN A;  4D04 A;  1GV4 A;  4CRT A;  3IHM A;  4YSY A;  2FJA A;  3NK0 X;  5J7X A;  2IID A;  4H4R A;  2UZZ A;  2R0P A;  1D4D A;  3M13 A;  3VRB A;  3G5R A;  4CY8 A;  2XLP A;  3S61 A;  4GUV A;  1PXB A;  3NT6 A;  3GWF A;  1PBE A;  3AE8 A;  4GR1 A;  4B1B A;  2OA1 A;  4AT0 A;  3LXD A;  3UCL A;  3RHA A;  3ICS A;  1ZX9 A;  2X8G A;  1PN0 A;  1VG0 A;  1ZP0 A;  2V60 A;  1K0I A;  1ZKQ A;  4OPU A;  2GAH B;  3P1W A;  4GDE A;  5HYM A;  1ZY8 A;  3CN8 A;  3I3L A;  2YG4 A;  3UOX A;  3Q9T A;  2XFP A;  4UDQ A;  3EF6 A;  1KSS A;  3KLJ A;  1NHR A;  3AD8 B;  1M6I A;  2X50 A;  3KU9 A;  2EQ8 A;  1IUW A;  1B37 A;  2X8H A;  3UKA A;  2OAL A;  2WOV A;  1ZK7 A;  1TDE A;  3H8I A;  5TR3 A;  4Y4M A;  2R4J A;  3AB1 A;  4H4P A;  1YQ4 A;  3NH3 X;  3AXB A;  4TM3 A;  3UTF A;  3COX A;  2GR1 A;  2R4E A;  2B9Y A;  1PXA A;  3CGC A;  2I0Z A;  2Y6R A;  1NG4 A; 
#chains in the Genus database with same CATH topology
 4BV6 A;  3BJS A;  4JN7 A;  1P48 A;  2YLZ A;  1FFV C;  1JEH A;  2W0H A;  1IJH A;  2BAC A;  3L5O A;  2VVL A;  1P2E A;  1TKK A;  2FYM A;  4DSH A;  3UKH A;  3VR9 A;  2XYO A;  4JNA A;  2W54 A;  2CHR A;  3SJN A;  4EQW A;  5GSN A;  2PA6 A;  1GTE A;  1K0L A;  3KD9 A;  1GRG A;  2RGO A;  3K30 A;  2PPG A;  3TJ4 A;  5FJU A;  3NK2 X;  1FEB A;  3V3O A;  3CGB A;  4ECH A;  3DJJ A;  3T2K A;  2GGE A;  2WOW A;  2YQU A;  3AYL A;  3OP2 A;  4EQR A;  3QSE A;  3UTE A;  3VRA A;  3DK8 A;  2RGH A;  3ALJ A;  4GFI A;  2WU5 A;  4HCH A;  1ZXI C;  3CGD A;  3CPJ G;  4II3 A;  3PG6 A;  4ZOH B;  1DOE A;  1KCZ A;  3ZDN A;  1H84 A;  3I6D A;  2XVE A;  2PTY A;  2BK4 A;  4M0X A;  2E5V A;  4GME A;  3NVV B;  1DOB A;  3P4Q A;  2DKI A;  1B5Q A;  3D1C A;  1KDG A;  1Q1R A;  2OKT A;  1MRA A;  5FS9 A;  2EQ6 A;  3K7M X;  2GF3 A;  2AL2 A;  3NYE A;  4B69 A;  2AQJ A;  1FL2 A;  3UP4 A;  3H12 A;  4H1Z A;  2YR4 A;  3JVA A;  3DJE A;  4UDR A;  4F4R A;  4XWR A;  3HW2 A;  4KX6 A;  4CNJ A;  2XH2 A;  2OQY A;  2WPF A;  4XWZ A;  4NEV A;  4RSL A;  2POD A;  5J60 A;  3GYJ A;  4IVM B;  3CIR A;  1FFU C;  3ZLF A;  4TVY A;  5FJO A;  3L8K A;  1GXF A;  2PTW A;  3GDN A;  4K8D A;  1CJ3 A;  3FBS A;  1EL8 A;  2RDX A;  3RP7 A;  2VZ2 A;  3NNE A;  1E9I A;  4K1W A;  1FCD A;  2B76 A;  1W6T A;  3B97 A;  4GAP A;  3JZU A;  1TYP A;  3BNU A;  5FJT A;  2XDO A;  5BOF A;  3EAN A;  1Q1W A;  2OPJ A;  4YKF A;  3BOX A;  1PJ7 A;  4Z2U A;  1E1N A;  2OG9 A;  3SR6 B;  4E4F A;  1L0V A;  5JCK A;  3C96 A;  2WP6 A;  1N4W A;  2ZAD A;  3HZL A;  1FO4 A;  3URH A;  3BNM A;  4Z2T A;  4YSX A;  2WP5 A;  4H4W A;  4MJW A;  1QJD A;  1ZDL A;  2WS3 A;  3CNJ A;  1DNC A;  1REO A;  3AN1 A;  5ER0 A;  1SB3 B;  2O56 A;  4H4Z A;  1S3E A;  4HNL A;  1SEZ A;  3QPE A;  3C4A A;  3AE7 A;  5HXI A;  5IPY A;  1H7W A;  3ADA B;  3CT2 A;  3S47 A;  3TJI A;  4K5R A;  3ZVH B;  1RM6 B;  1IUT A;  4YTP A;  1AOG A;  2CUL A;  3MSY A;  1X31 B;  2X99 A;  2HQM A;  2V6O A;  1GRH A;  2BS2 A;  1D7Y A;  3HRD C;  3UJF A;  4Z25 A;  5L46 A;  2C64 A;  3FIM B;  3CXB A;  4H2Q A;  4U2T A;  1YKJ A;  1LJ1 A;  1VQZ A;  3UCD A;  1CJC A;  3R07 C;  3R0K A;  2X8C A;  3AE9 A;  4H4U A;  2WPE A;  1K0J A;  1S2Y A;  4X4J A;  3RGT A;  2E4G A;  4FI4 A;  1OJD A;  4EM4 A;  4A99 A;  4U2L A;  2VVM A;  3GMB A;  4EIP A;  4RG3 A;  4EWJ A;  5FJP A;  1JRZ A;  4A79 A;  2ARD A;  4K2X A;  2XCG A;  4E5T A;  3T2Y A;  1F9C A;  3VCN A;  4UDP A;  2P8C A;  1FHU A;  5GRT A;  4EIQ A;  1COY A;  3AE4 A;  3DA1 A;  4I59 A;  3V3N A;  4MMW A;  2JK6 A;  3R0U A;  2XLR A;  1MUC A;  2QAE A;  1KNP A;  3G5Q A;  2AKM A;  5BOE A;  1CHU A;  3VFC A;  5G5H B;  4U8K A;  1ZMC A;  4AT2 A;  2JKC A;  4OPT A;  2IVD A;  2OFJ A;  3UXL A;  3FXG A;  3SZW A;  1S2Q A;  1OJC A;  3GSI A;  1O5W A;  2XLT A;  3KKJ A;  1ONF A;  1R6W A;  1FOH A;  3F8D A;  4YWS A;  3PO7 A;  1Q9I A;  4IA5 A;  4D03 A;  2PMQ A;  2VRL A;  3AEB A;  1NG3 A;  3NVW B;  3GY1 A;  1N63 C;  1D4D A;  3IJQ A;  3AE8 A;  4GR1 A;  1X2H A;  4B1B A;  3DFH A;  1ZX9 A;  2X8G A;  1PN0 A;  1ZKQ A;  4GGH A;  4GDE A;  1SJD A;  3N6H A;  1JRP A;  5HYM A;  3UOX A;  3D47 A;  3DES A;  4UDQ A;  3AD8 B;  2C4C A;  1IUW A;  2OAL A;  2WOV A;  1TDE A;  4Y4M A;  3H8I A;  5TR3 A;  2R4J A;  4H4P A;  3NH3 X;  4J1O A;  4K5S A;  3DEQ A;  3AE3 A;  1MOK A;  1GT8 A;  2QJN A;  3OW1 A;  4ZCD A;  4B67 A;  3GRT A;  3LJP A;  1MDR A;  3DK4 A;  4BJZ A;  1V97 A;  4NTC A;  1KNR A;  3LZX A;  4I58 A;  3T9P A;  1N5X A;  2GSH A;  1CL0 A;  1L9D A;  1N60 C;  1OJA A;  3RIT A;  4E0V A;  4U8P A;  5KWF A;  2PP3 A;  2OVL A;  1KF6 A;  5KXJ A;  4J34 A;  1H7X A;  3BSM A;  2WHD A;  4ZCC A;  2GMJ A;  3UOZ A;  3NHO X;  3FPZ A;  1GRT A;  2YLT A;  3ALM A;  3SGL A;  1OJ9 A;  4OCG A;  4J31 A;  2C65 A;  4WCT A;  2YLX A;  1GTH A;  2JB3 A;  2YG5 A;  2ZZB A;  2YVG A;  3JSK A;  1H2I A;  5J04 A;  4WX1 A;  3ABV A;  4GAV A;  2C3C A;  4M6U A;  2A89 A;  1F8R A;  3NIX A;  4A7A A;  5G5G B;  4TLZ A;  3R9U A;  2HXT A;  1H81 A;  2Q0K A;  4TM0 A;  3NXL A;  2YLS A;  3VQR A;  4DHG A;  3RP6 A;  4AOX A;  4FDC B;  1OEP A;  3GDP A;  3N4F A;  2BAB A;  3AE6 A;  2JAE A;  4J2W A;  1CF3 A;  1JRY A;  4JHM A;  1M64 A;  2XVI A;  1IYX A;  3UCC A;  3F8P A;  4MKS A;  1XHC A;  2WDV A;  3UJR A;  3CNS A;  3SN4 A;  2C73 A;  3AEA A;  4G74 A;  2OZ8 A;  4KPR A;  4J36 A;  4GIS A;  3HYW A;  3K7T A;  2MNR A;  2OLN A;  2WEU A;  4H4V A;  5DBJ A;  3NLC A;  3D9X A;  4FX9 A;  3P4R A;  3PFR A;  4H50 A;  1NEN A;  3DGH A;  3H4K A;  3MQT A;  4DGK A;  3IF9 A;  4JN8 A;  1F8S A;  1NDA A;  1N61 C;  4B66 A;  3JW7 A;  2BK3 A;  3NG7 X;  1ELS A;  4K8G A;  2R46 A;  2VQ7 A;  1L9E A;  4DNA A;  3EEZ A;  4H7U A;  3SX6 A;  3DIP A;  1PJ5 A;  3AM9 A;  4H4Q A;  4IV9 A;  3CYJ A;  3DGZ A;  2WET A;  3T8Q A;  2GGI A;  4A3R A;  5CKU A;  1JNR A;  1IUV A;  2FJE A;  1EL5 A;  1Y56 B;  1BKH A;  3OZY A;  3Q45 A;  3FJ4 A;  3ES8 A;  3EKG A;  2YM1 A;  3GYI A;  4Z26 A;  1LV0 A;  3SYI A;  2WU2 A;  2XLU A;  3ATR A;  3QN3 A;  4TM4 A;  1NHS A;  3H70 A;  1EBD A;  1JPM A;  2QQ6 A;  1BWC A;  1UKV G;  1SJB A;  4C3X A;  4G6H A;  1RVK A;  2VOU A;  3ATQ A;  1NEK A;  3GC2 A;  2XFO A;  2O9Z A;  2V5Z A;  4H83 A;  1XPY A;  2BS4 A;  2WOI A;  3H7V A;  2PS2 A;  3V4B A;  3LB8 A;  1LPF A;  2PU1 A;  1B4V A;  4ICY A;  4OPC A;  1W4X A;  2W3S A;  4AP1 A;  5HHF A;  4H4S A;  4J33 A;  2XFU A;  4Y4N A;  2AKZ A;  1YY5 A;  1F8W A;  2RAB A;  3V5F A;  4TVW A;  3RRA A;  3GYX A;  5KRQ A;  6ENL A;  1FEA A;  3OTR A;  2OO6 A;  3F8R A;  1EBH A;  3S5W A;  1TDN A;  4B64 A;  2V3A A;  1LQU A;  3K1G A;  4Y4L A;  3T0K A;  4APN A;  2BXR A;  1VG9 A;  2FBW A;  3PK7 A;  4BUR A;  3P4P A;  2PU0 A;  2BYB A;  2R0G A;  3EAO A;  2FJD A;  2MUC A;  2EQ7 A;  3AWI A;  4PAB A;  1RP0 A;  4A5L A;  2BC1 A;  1VDC A;  4G8T A;  3FYY A;  2PYX A;  1WUF A;  2TMD A;  1GRF A;  4EQS A;  4U8O A;  1XAN A;  3V3W A;  2OQH A;  1TZZ A;  1L9C A;  2QDE A;  3R10 A;  3ZLG A;  3AEF A;  2EQ9 A;  1FEC A;  3NO1 A;  1E6E A;  2QJM A;  3CK5 A;  2Q0L A;  1YQZ A;  3KUM A;  3AYJ A;  2QA2 A;  4YSH A;  3N4E A;  2BA9 A;  1PDH A;  2Q6U A;  2B7R A;  3IJI A;  1Y56 A;  1CC6 A;  3NVZ B;  4C3Y A;  2QGY A;  4GYP C;  3T4W A;  4A65 A;  4A35 A;  1PS9 A;  1MNS A;  2NQL A;  2POZ A;  3NN0 X;  3OPS A;  1VDV A;  2W3R A;  1IUS A;  3EPT A;  3STP A;  1JCT A;  2ZC8 A;  4Z44 A;  3PWG A;  3CNT A;  4IT1 A;  4CCQ A;  3I6T A;  4YWO A;  1H6V A;  5CQF A;  1ZMD A;  2AR8 A;  3DK9 A;  2E1M A;  4YTN A;  1GV4 A;  2XH4 A;  3NK0 X;  2IID A;  3CB3 A;  3G5R A;  4CY8 A;  1PXB A;  4H19 A;  3LXD A;  5KMP A;  5KMR A;  1KKO A;  1ZP0 A;  2V60 A;  1K0I A;  2P0I A;  1X2G A;  3RCY A;  1ZY8 A;  3I3L A;  2YG4 A;  3EF6 A;  1B37 A;  1EC7 A;  4HCL A;  2X8H A;  3NS1 B;  4IL0 A;  2YAU A;  1NG4 A;  4C5O A;  3FV9 A;  1FIQ B;  3BI5 A;  4PAA A;  1D7L A;  3ICR A;  4E4U A;  4OPG A;  2OAM A;  2VRM A;  1KD0 A;  4Z43 A;  2CDU A;  4C77 A;  2BK5 A;  2C75 A;  2PGE A;  4GYP A;  2WQY A;  5U1O A;  4IVO B;  5M0Z A;  3DME A;  2XGZ A;  2FJB A;  2C70 A;  2XSX A;  2GR3 A;  4Z24 A;  5IDZ A;  5C3J A;  4H2H A;  3ZLH A;  1QO8 A;  2YLW A;  3V76 A;  4JY3 A;  4ROP A;  2VQB A;  1TDF A;  3ITJ A;  2BS3 A;  2CVJ A;  2W55 A;  3NYC A;  3ZYX A;  2GGH A;  4A6N B;  5JCN A;  5KVI A;  1JPD X;  4USQ A;  2BXS A;  4DYE A;  1ZOY A;  3UKL A;  3ICT A;  2XH7 A;  3VRD B;  1JRX A;  1PBB A;  2JB2 A;  1LVL A;  1DXL A;  3TOY A;  4C74 A;  2GR0 A;  3QTP A;  4TLX A;  4J57 A;  3R25 A;  3OC4 A;  4USR A;  2XVF A;  3M12 A;  1N4U A;  3VCC A;  3M0O A;  3TWA A;  4RG4 A;  4NTE A;  1KN0 A;  2DW7 A;  3DG6 A;  3HPF A;  3LAD A;  3TCS A;  3CPH G;  3SN0 A;  4U8I A;  4X9M A;  2Q7V A;  4G6G A;  2A8X A;  4E6M A;  4JQ9 A;  2OZ3 A;  3VC6 A;  4E8G A;  3UP5 A;  1E1L A;  1GND A;  2ZZC A;  3V5C A;  3NZG A;  2V61 A;  4BK1 A;  4X2P A;  2B9W A;  2GGG A;  2PHH A;  3AE1 A;  2BC0 A;  3P3B A;  2R9Z A;  3NRZ B;  4CY6 A;  3GD6 A;  3GMC A;  3O0H A;  2HXU A;  4DWD A;  5FS6 A;  2JBV A;  2OZT A;  3ZVH A;  3BI4 A;  2PP1 A;  2DW6 A;  2P8B A;  3DDM A;  1PBC A;  3R1Z A;  3DJG X;  2BRA A;  3MY9 A;  1GRB A;  4ZCW A;  2B9X A;  5EB5 A;  4G73 A;  3UTH A;  4FK1 A;  4NEW A;  4GF7 A;  2GAG B;  1TE6 A;  3B9J B;  1P2H A;  1YQ3 A;  4YSZ A;  1BZL A;  1N62 C;  4U8J A;  3DER A;  4YT0 A;  4P9S A;  1Y0P A;  3A7U A;  2GDQ A;  3T37 A;  1D5T A;  1DJN A;  5EB4 A;  3A7A A;  5FS7 A;  2TPR A;  1GAL A;  1VRQ B;  1QLB A;  4IP5 A;  3KPF A;  2YM2 A;  4O5U A;  3CMM A;  3NGC X;  3UJE A;  1D4E A;  4U2S A;  4JY2 A;  1MO9 A;  1EBG A;  4NWZ A;  3RNM A;  3S5S A;  1JNZ A;  3IC9 A;  5BRT A;  3CGE A;  4YXD A;  5KVH A;  4U8N A;  3SFD A;  2BCP A;  3SZF A;  3C4N A;  2R0C A;  3AD7 B;  1N4V A;  4JN9 A;  1CBO A;  3R11 A;  1TYT A;  3DG7 A;  3SFE A;  3UXK A;  2WBA A;  3NYF A;  3THU A;  1EL9 A;  4EQX A;  1KFY A;  4DXK A;  3QSS A;  1GRE A;  2NVK X;  3I6E A;  4GIR A;  1O95 A;  2XLS A;  4FK1 C;  4BK3 A;  3KVE A;  3T14 A;  4GCM A;  1FHV A;  2C7G A;  1GER A;  4B63 A;  1ZOV A;  4CBQ A;  2GL5 A;  4XXG A;  3BI2 A;  3EUB 3;  3T31 A;  2DKH A;  4HA6 A;  5M10 A;  2I5Q A;  3UTG A;  3TW9 A;  5IQ4 A;  4REK A;  3OZM A;  3G5S A;  4GGB A;  1H83 A;  2C66 A;  1JRO A;  4CCR A;  3B3R A;  4K7Z A;  2WPC A;  3NVY B;  4YKG A;  2IVE A;  4IL2 A;  1CJ4 A;  3QSM A;  7ENL A;  2Y6Q A;  1RSG A;  1EC8 A;  4MGG A;  3IHG A;  3IK4 A;  1JDF A;  5JCM A;  4K2S A;  3WE0 A;  4EM3 A;  1XDI A;  4M52 A;  1XPQ A;  4ZA0 A;  1PHH A;  4LA1 A;  1S7M A;  5EBK A;  4DSG A;  3PS9 A;  1GET A;  1S3B A;  3AEG A;  3QJ4 A;  1N5W C;  3ENL A;  1RYI A;  4JNQ A;  1TDO A;  2AL1 A;  5FS8 A;  2C67 A;  1LQT A;  4X9N A;  2QA1 A;  2PSN A;  2YR5 A;  1STZ A;  3CNP A;  4ADW A;  1E39 A;  4G9K A;  1ONE A;  3FCP A;  2GGJ A;  4YTM A;  2C3D A;  2GRT A;  4II2 A;  3IHM A;  2FJA A;  5J7X A;  4DN1 A;  4H4R A;  5JRB A;  3DG3 A;  2R0P A;  3M13 A;  2XLP A;  3NT6 A;  1T3Q C;  3UCL A;  3RHA A;  3ICS A;  1VG0 A;  2GAH B;  3CN8 A;  2XFP A;  1NHR A;  2PTZ A;  3QKE A;  3AMZ A;  1ZK7 A;  3AB1 A;  1YQ4 A;  3UTF A;  4TM3 A;  3AXB A;  3COX A;  2GR1 A;  1KKR A;  3FVD A;  2R4E A;  4Z17 A;  2I0Z A;  4GRT A;  4HNC A;  2H88 A;  2QVH A;  5BVA A;  3HYV A;  2P3Z A;  3CTY A;  3VA8 A;  1ELI A;  4EMI A;  3BHF A;  1BGN A;  1E1M A;  1GSN A;  4ZN0 A;  3DGB A;  4U8M A;  1SJA A;  4KPL A;  1K4Q A;  2C72 A;  5C2T A;  2GQF A;  2E3T A;  1CJ2 A;  3AED A;  1F3P A;  4KEM A;  3P9U A;  2YVF A;  2YWL A;  3NTD A;  3L1R A;  4LU6 A;  2GMH A;  2AL2 B;  1N1P A;  3SQS A;  3CND A;  3AE5 A;  3Q6J A;  3GWD A;  5EOW A;  2GR2 A;  1JU2 A;  2GVC A;  5HY5 A;  1O94 A;  3MWC A;  3ALL A;  3VDG A;  3GD4 A;  2X3N A;  4U8L A;  3NKS A;  3T6C A;  3T2Z A;  3ISH A;  4GDP A;  3A7R A;  1PDY A;  4IHC A;  2WP9 A;  2E5A A;  3FMW A;  2QDD A;  1PBF A;  1DOC A;  2FKP A;  5FJR A;  3N6J A;  2WES A;  2YR6 A;  4DX3 A;  4A6N A;  3OZ2 A;  4H2R A;  5KOX A;  3H8A A;  5KMS A;  4BJY A;  2PCE A;  3MUC A;  2QCU A;  2PP0 A;  1KSU A;  1BKW A;  5U63 A;  3SXI A;  3QVP A;  1B8S A;  4LII A;  2QJJ A;  3KA7 A;  3NK1 X;  1LTX R;  5JCL A;  4O5Q A;  3PVC A;  1IUX A;  3AD9 B;  4HCD A;  1F6M A;  4B65 A;  2GEW A;  2GV8 A;  3UOV A;  1XS2 A;  3DH9 A;  3GD3 A;  2R45 A;  2Z5X A;  1CC4 A;  4J3Z A;  4J56 A;  4H4T A;  1GOS A;  3K7Q X;  1NHP A;  3Q4D A;  3TTE A;  2C76 A;  4NTD A;  1WYG A;  3AYI A;  3D46 A;  1GPE A;  1PJ6 A;  4IZG A;  3AE2 A;  3SSZ A;  4CNK A;  3SY4 A;  3SN1 A;  1DJQ A;  3P0W A;  1PBD A;  1BQG A;  1L8P A;  3H8L A;  2NPX A;  1YEY A;  3P4S A;  3NTA A;  4AOS A;  3AEC A;  1HYU A;  2GQW A;  2RGJ A;  3P93 A;  5LV9 A;  2APG A;  4Z1Y A;  4IA6 A;  2YG3 A;  2ZZ0 A;  3UOY A;  2CFY A;  5JCI A;  3SM8 A;  4HN8 A;  4OPD A;  1NAA A;  4KT2 A;  1D4C A;  4ENL A;  5IQ1 A;  3TWB A;  4H2P A;  5EU9 A;  1E1K A;  3ES7 A;  1TDK A;  3UKP A;  3QFA A;  1NEL A;  4A6G A;  5U25 A;  4HB9 A;  2OLA A;  3U9I A;  3SZ0 A;  3ETR B;  2GB0 A;  2GH5 A;  1EL7 A;  4Z2R A;  3AEE A;  3UJ2 A;  1OJT A;  1NPX A;  2BCG G;  4EMJ A;  1VQW A;  1H82 A;  1MDL A;  4NZH A;  3QLD A;  4G7F A;  3VR8 A;  4H4X A;  3MZN A;  2WDQ A;  5KNL A;  3TQP A;  2XFQ A;  1DOD A;  1IUU A;  4B68 A;  2J3N A;  2F5Z A;  4H4Y A;  2XVJ A;  3RR1 A;  3LOV A;  3GO2 A;  3I4K A;  2HZG A;  1GRA A;  4A9W A;  2YG6 A;  1TRB A;  3PWI A;  1JOA A;  2YG7 A;  3B6D A;  1MXT A;  4OPI A;  3DFY A;  1Z6L A;  3U4F A;  2WDR A;  2HNE A;  2XVH A;  2JB1 A;  5BUL A;  1V59 A;  3E1T A;  2B7S A;  4TM1 A;  3UKF A;  4NNJ A;  5FMH A;  3FG2 P;  1CC2 A;  1BF3 A;  1GEU A;  4N9X A;  1H86 A;  3RO6 A;  1R0M A;  2OLO A;  2XFN A;  2OX4 A;  2YLR A;  3CPI G;  2H89 A;  3UKK A;  4AP3 A;  5ENL A;  3LZW A;  4UP3 A;  1NU5 A;  1E7P A;  4FP1 A;  4BK2 A;  3QFB A;  3CAW A;  3HYX A;  2V3B A;  3BHK A;  4H2N A;  2ZBW A;  2ACZ A;  4JDR A;  3D8X A;  5KOW A;  3ZVI A;  3QVR A;  3KPK A;  3NN6 X;  4K22 A;  3SZC A;  2AAQ A;  2VVL G;  2BRY A;  3NFU A;  1EC9 A;  3SQP A;  3SBF A;  1GES A;  1DTN A;  4OVI A;  1PXC A;  3RP8 A;  3II4 A;  3UJS A;  3RED A;  3GRS A;  1NHQ A;  3NRN A;  1BGJ A;  1PDZ A;  2ONE A;  3CXO A;  3DJD A;  5BUK A;  2A87 A;  3MKC A;  4OPL A;  2Z5Y A;  4HPN A;  2YVJ A;  3UGV A;  3IWA A;  3UKQ A;  4KWS A;  4EMW A;  4D04 A;  4CRT A;  4YSY A;  1ECQ A;  1P43 A;  2UZZ A;  4HYR A;  3VRB A;  2PGW A;  2P88 A;  3S61 A;  4GUV A;  1SJC A;  3GWF A;  1PBE A;  2XH0 A;  2OA1 A;  4AT0 A;  2PTX A;  4OPU A;  3P1W A;  3Q9T A;  5KMQ A;  1KSS A;  3KLJ A;  1M6I A;  1WUE A;  2X50 A;  3IJL A;  3KU9 A;  2EQ8 A;  3VC5 A;  3UKA A;  4IP4 A;  2B9Y A;  1PXA A;  3CGC A;  2Y6R A; 
#chains in the Genus database with same CATH homology
 4C5O A;  3AE3 A;  3BI5 A;  4BV6 A;  4GRT A;  4PAA A;  1D7L A;  1MOK A;  3ICR A;  2H88 A;  1GT8 A;  2YLZ A;  4OPG A;  5BVA A;  1IJH A;  1JEH A;  2W0H A;  2BAC A;  3HYV A;  3L5O A;  2VVL A;  1P2E A;  3CTY A;  4DSH A;  3UKH A;  4ZCD A;  3VR9 A;  4B67 A;  3GRT A;  2OAM A;  2VRM A;  1ELI A;  2XYO A;  4JNA A;  4EMI A;  3BHF A;  3LJP A;  3DK4 A;  1BGN A;  4EQW A;  1E1M A;  1GSN A;  5GSN A;  2CDU A;  4Z43 A;  4U8M A;  4ZN0 A;  4BJZ A;  4C77 A;  2BK5 A;  2C75 A;  4NTC A;  1K4Q A;  1GTE A;  1K0L A;  2C72 A;  1KNR A;  2WQY A;  3KD9 A;  5C2T A;  1GRG A;  2GQF A;  2RGO A;  3K30 A;  5U1O A;  3NK2 X;  4IVO B;  3LZX A;  1FEB A;  1CJ2 A;  4I58 A;  5M0Z A;  3V3O A;  3AED A;  3CGB A;  1F3P A;  3DME A;  3P9U A;  2YVF A;  2YWL A;  3NTD A;  1CL0 A;  1L9D A;  4ECH A;  3DJJ A;  3T2K A;  1OJA A;  2FJB A;  3L1R A;  2WOW A;  2YQU A;  2C70 A;  3AYL A;  4LU6 A;  2GMH A;  2GR3 A;  4EQR A;  4E0V A;  4Z24 A;  4U8P A;  5KWF A;  5C3J A;  1QO8 A;  2YLW A;  3QSE A;  3V76 A;  4JY3 A;  2VQB A;  3UTE A;  3VRA A;  1KF6 A;  1N1P A;  5KXJ A;  3DK8 A;  1TDF A;  2RGH A;  3ALJ A;  3CND A;  4J34 A;  3AE5 A;  3Q6J A;  3ITJ A;  1H7X A;  2BS3 A;  2CVJ A;  2WU5 A;  3GWD A;  3NYC A;  5EOW A;  3CGD A;  3ZYX A;  2GR2 A;  1JU2 A;  4A6N B;  3CPJ G;  2WHD A;  5JCN A;  2GVC A;  5HY5 A;  1O94 A;  4II3 A;  5KVI A;  3ALL A;  2GMJ A;  4USQ A;  4ZCC A;  3PG6 A;  2X3N A;  3GD4 A;  4U8L A;  3UOZ A;  3NHO X;  2BXS A;  1ZOY A;  1DOE A;  3FPZ A;  3UKL A;  3NKS A;  3T2Z A;  3ICT A;  3ZDN A;  1H84 A;  1GRT A;  2XVE A;  3I6D A;  3ISH A;  3VRD B;  4GDP A;  2YLT A;  3ALM A;  3SGL A;  1OJ9 A;  1JRX A;  1PBB A;  2JB2 A;  1LVL A;  2BK4 A;  2E5V A;  1DXL A;  4OCG A;  1DOB A;  3P4Q A;  2WP9 A;  2DKI A;  1B5Q A;  4C74 A;  3FMW A;  4J31 A;  3D1C A;  2GR0 A;  1PBF A;  1DOC A;  2C65 A;  4WCT A;  4TLX A;  4J57 A;  1KDG A;  2YLX A;  1Q1R A;  1GTH A;  2JB3 A;  2WES A;  2YG5 A;  3OC4 A;  2YR6 A;  4A6N A;  2ZZB A;  4USR A;  2XVF A;  5FS9 A;  3M12 A;  1N4U A;  2YVG A;  3JSK A;  3OZ2 A;  1H2I A;  4H2R A;  2EQ6 A;  4WX1 A;  3M0O A;  5KOX A;  5KMS A;  3ABV A;  4RG4 A;  3K7M X;  4NTE A;  4BJY A;  1KN0 A;  2GF3 A;  4GAV A;  2C3C A;  3LAD A;  2QCU A;  2A89 A;  3CPH G;  1F8R A;  1KSU A;  3NIX A;  3NYE A;  4B69 A;  4A7A A;  2AQJ A;  1BKW A;  1FL2 A;  5U63 A;  3UP4 A;  4TLZ A;  2YR4 A;  3SXI A;  4U8I A;  4X9M A;  3DJE A;  3QVP A;  3R9U A;  4UDR A;  4XWR A;  1B8S A;  2Q7V A;  4G6G A;  2A8X A;  4LII A;  4KX6 A;  4CNJ A;  4JQ9 A;  1H81 A;  3KA7 A;  3NK1 X;  3UP5 A;  1LTX R;  5JCL A;  1E1L A;  1GND A;  4O5Q A;  2Q0K A;  2ZZC A;  3PVC A;  1IUX A;  4TM0 A;  2YLS A;  3VQR A;  2V61 A;  3AD9 B;  4BK1 A;  2B9W A;  2WPF A;  4XWZ A;  1F6M A;  3RP6 A;  2PHH A;  3AE1 A;  4FDC B;  4AOX A;  4B65 A;  2GEW A;  2GV8 A;  3UOV A;  3DH9 A;  2BC0 A;  3GDP A;  3GD3 A;  4NEV A;  2BAB A;  2R45 A;  2Z5X A;  4RSL A;  1CC4 A;  3AE6 A;  2JAE A;  4J2W A;  2R9Z A;  1CF3 A;  1JRY A;  4J56 A;  1M64 A;  2XVI A;  4H4T A;  5J60 A;  3F8P A;  1GOS A;  3GYJ A;  4IVM B;  3CIR A;  2WDV A;  1XHC A;  4CY6 A;  3CNS A;  2C73 A;  3AEA A;  4G74 A;  3GMC A;  3K7Q X;  4J36 A;  4KPR A;  3HYW A;  3O0H A;  3K7T A;  1NHP A;  2OLN A;  2WEU A;  4H4V A;  5FS6 A;  5DBJ A;  2C76 A;  2JBV A;  3NLC A;  4NTD A;  3D9X A;  3AYI A;  3L8K A;  1GPE A;  4FX9 A;  3P4R A;  1GXF A;  3BI4 A;  4H50 A;  1NEN A;  1PJ6 A;  3DGH A;  3AE2 A;  3H4K A;  4DGK A;  3IF9 A;  4CNK A;  3SY4 A;  1DJQ A;  1F8S A;  1NDA A;  4B66 A;  3GDN A;  4K8D A;  1CJ3 A;  2BK3 A;  3NG7 X;  2R46 A;  3FBS A;  1EL8 A;  1PBD A;  3RP7 A;  2VQ7 A;  1L9E A;  2VZ2 A;  3NNE A;  4DNA A;  3H8L A;  4H7U A;  3SX6 A;  2NPX A;  1FCD A;  1PJ5 A;  3P4S A;  1PBC A;  4H4Q A;  2B76 A;  3NTA A;  4AOS A;  3DJG X;  2BRA A;  4IV9 A;  3DGZ A;  2WET A;  4GAP A;  1GRB A;  1TYP A;  2B9X A;  3AEC A;  3BNU A;  5EB5 A;  4G73 A;  1HYU A;  5CKU A;  3UTH A;  1JNR A;  2GQW A;  2RGJ A;  4NEW A;  2XDO A;  1IUV A;  4FK1 A;  4GF7 A;  2FJE A;  2GAG B;  3EAN A;  1EL5 A;  1Y56 B;  1Q1W A;  1P2H A;  5LV9 A;  2APG A;  1YQ3 A;  4IA6 A;  4YSZ A;  1BZL A;  4YKF A;  2YG3 A;  4U8J A;  2ZZ0 A;  2YM1 A;  3GYI A;  1PJ7 A;  4Z2U A;  1E1N A;  4YT0 A;  4P9S A;  4Z26 A;  1LV0 A;  3SYI A;  1Y0P A;  3UOY A;  2CFY A;  2WU2 A;  2XLU A;  5JCI A;  3ATR A;  3T37 A;  1D5T A;  1DJN A;  5EB4 A;  3SM8 A;  4OPD A;  1NAA A;  1D4C A;  4TM4 A;  5IQ1 A;  4H2P A;  1L0V A;  5JCK A;  1E1K A;  1TDK A;  1NHS A;  3C96 A;  2WP6 A;  5FS7 A;  1EBD A;  3UKP A;  1N4W A;  3QFA A;  2TPR A;  1GAL A;  3HZL A;  1VRQ B;  1QLB A;  5U25 A;  4HB9 A;  3URH A;  3KPF A;  3BNM A;  2YM2 A;  3SZ0 A;  4Z2T A;  1BWC A;  1UKV G;  2GB0 A;  4O5U A;  2WP5 A;  3CMM A;  4C3X A;  4H4W A;  4YSX A;  3NGC X;  2GH5 A;  4MJW A;  1QJD A;  1EL7 A;  4Z2R A;  1D4E A;  3AEE A;  4G6H A;  4U2S A;  1ZDL A;  2VOU A;  4JY2 A;  1OJT A;  1NPX A;  2BCG G;  4EMJ A;  1NEK A;  1VQW A;  3ATQ A;  1H82 A;  2WS3 A;  2XFO A;  3CNJ A;  1DNC A;  1REO A;  5ER0 A;  1MO9 A;  4NWZ A;  2O9Z A;  4NZH A;  2V5Z A;  4H4Z A;  3RNM A;  1S3E A;  3VR8 A;  2BS4 A;  1SEZ A;  4H4X A;  1JNZ A;  2WDQ A;  5KNL A;  2WOI A;  3C4A A;  2XFQ A;  2YAU A;  1DOD A;  1IUU A;  3IC9 A;  5BRT A;  3AE7 A;  5HXI A;  3CGE A;  4YXD A;  5IPY A;  1H7W A;  3ADA B;  4B68 A;  5KVH A;  3LB8 A;  1LPF A;  1B4V A;  4ICY A;  4K5R A;  4OPC A;  4U8N A;  2J3N A;  1W4X A;  1IUT A;  3SFD A;  4YTP A;  4AP1 A;  5HHF A;  2F5Z A;  1AOG A;  4H4Y A;  4H4S A;  2BCP A;  2CUL A;  2XVJ A;  3C4N A;  2R0C A;  1X31 B;  3LOV A;  4J33 A;  3SZF A;  2X99 A;  3AD7 B;  2XFU A;  1N4V A;  4JN9 A;  4Y4N A;  2HQM A;  2V6O A;  1YY5 A;  1GRH A;  1F8W A;  2BS2 A;  1D7Y A;  1CBO A;  1TYT A;  2RAB A;  3SFE A;  1GRA A;  4Z25 A;  4A9W A;  2YG6 A;  5L46 A;  2C64 A;  3FIM B;  1TRB A;  2WBA A;  4H2Q A;  3GYX A;  4U2T A;  5KRQ A;  1JOA A;  1FEA A;  2YG7 A;  3B6D A;  1YKJ A;  3NYF A;  1LJ1 A;  1MXT A;  3F8R A;  3S5W A;  1EL9 A;  1TDN A;  4EQX A;  1CJC A;  1KFY A;  4OPI A;  4B64 A;  2V3A A;  3QSS A;  1GRE A;  2NVK X;  2X8C A;  4H4U A;  1LQU A;  1Z6L A;  4APN A;  3AE9 A;  4Y4L A;  2WPE A;  1O95 A;  2WDR A;  3T0K A;  2XLS A;  2BXR A;  2XVH A;  1VG9 A;  2FBW A;  2JB1 A;  4FK1 C;  4BK3 A;  1K0J A;  1S2Y A;  3KVE A;  5BUL A;  4X4J A;  3T14 A;  1V59 A;  4BUR A;  2E4G A;  2B7S A;  3E1T A;  3P4P A;  4GCM A;  1OJD A;  4TM1 A;  2BYB A;  2R0G A;  3UKF A;  4EM4 A;  4A99 A;  3EAO A;  2FJD A;  4NNJ A;  4U2L A;  2EQ7 A;  2C7G A;  2VVM A;  3GMB A;  5FMH A;  3FG2 P;  1CC2 A;  3AWI A;  4PAB A;  1GER A;  4EIP A;  1BF3 A;  4B63 A;  1GEU A;  4RG3 A;  4N9X A;  1ZOV A;  1RP0 A;  4CBQ A;  1H86 A;  4XXG A;  3BI2 A;  2OLO A;  3T31 A;  4A5L A;  2DKH A;  2BC1 A;  4HA6 A;  2XFN A;  1JRZ A;  5M10 A;  1VDC A;  3UTG A;  4A79 A;  5IQ4 A;  2YLR A;  2PYX A;  4REK A;  2ARD A;  2TMD A;  1GRF A;  4EQS A;  4U8O A;  1XAN A;  3CPI G;  4K2X A;  2H89 A;  3UKK A;  3G5S A;  2XCG A;  4AP3 A;  1H83 A;  2C66 A;  4CCR A;  3LZW A;  3B3R A;  4K7Z A;  3T2Y A;  2WPC A;  1L9C A;  4UP3 A;  4UDP A;  1E7P A;  4YKG A;  2IVE A;  3QFB A;  3HYX A;  4BK2 A;  2V3B A;  5GRT A;  3BHK A;  4H2N A;  2ZBW A;  1CJ4 A;  4EIQ A;  1COY A;  2ACZ A;  3AE4 A;  3DA1 A;  4I59 A;  3QSM A;  2Y6Q A;  3V3N A;  3AEF A;  4JDR A;  1RSG A;  3D8X A;  2EQ9 A;  5KOW A;  1FEC A;  3QVR A;  3KPK A;  3NN6 X;  4K22 A;  2JK6 A;  1E6E A;  2XLR A;  3SZC A;  2QAE A;  2AAQ A;  4K5S A;  1KNP A;  2VVL G;  3IHG A;  3G5Q A;  5JCM A;  1CHU A;  2BRY A;  3WE0 A;  4EM3 A;  2Q0L A;  1YQZ A;  1XDI A;  4M52 A;  3AYJ A;  1ZMC A;  4U8K A;  1XPQ A;  2QA2 A;  4YSH A;  1PHH A;  4AT2 A;  3SQP A;  2JKC A;  1GES A;  2BA9 A;  4OPT A;  4OVI A;  4LA1 A;  1PXC A;  2IVD A;  1S7M A;  3RP8 A;  1PDH A;  3II4 A;  2Q6U A;  5EBK A;  2B7R A;  4DSG A;  1Y56 A;  1CC6 A;  3RED A;  3SZW A;  3GRS A;  1NHQ A;  1S2Q A;  1OJC A;  1BGJ A;  3NRN A;  4C3Y A;  3GSI A;  1O5W A;  2XLT A;  3KKJ A;  1ONF A;  3PS9 A;  3DJD A;  5BUK A;  2A87 A;  1GET A;  4A65 A;  1PS9 A;  1S3B A;  3AEG A;  4OPL A;  2Z5Y A;  1FOH A;  3NN0 X;  3QJ4 A;  1IUS A;  3EPT A;  1RYI A;  4JNQ A;  2YVJ A;  3F8D A;  1TDO A;  4Z44 A;  5FS8 A;  2C67 A;  3CNT A;  3IWA A;  1LQT A;  4X9N A;  4CCQ A;  2QA1 A;  3PO7 A;  4YWO A;  1H6V A;  2YR5 A;  5CQF A;  1Q9I A;  4IA5 A;  3CNP A;  4D03 A;  4ADW A;  1E39 A;  4G9K A;  2VRL A;  3UKQ A;  3AEB A;  1ZMD A;  2AR8 A;  1NG3 A;  3DK9 A;  4YTM A;  4EMW A;  2C3D A;  2GRT A;  2E1M A;  4YTN A;  4II2 A;  4D04 A;  1GV4 A;  4CRT A;  3IHM A;  4YSY A;  2FJA A;  3NK0 X;  5J7X A;  2IID A;  4H4R A;  2UZZ A;  5JRB A;  2R0P A;  1D4D A;  3M13 A;  3VRB A;  3G5R A;  4CY8 A;  2XLP A;  3S61 A;  4GUV A;  1PXB A;  3NT6 A;  3GWF A;  1PBE A;  3AE8 A;  4GR1 A;  4B1B A;  2OA1 A;  4AT0 A;  3LXD A;  3UCL A;  3RHA A;  3ICS A;  1ZX9 A;  5KMP A;  5KMR A;  2X8G A;  1PN0 A;  1VG0 A;  1ZP0 A;  2V60 A;  1K0I A;  1ZKQ A;  4OPU A;  2GAH B;  3P1W A;  4GDE A;  5HYM A;  1ZY8 A;  3CN8 A;  3I3L A;  2YG4 A;  3UOX A;  3Q9T A;  5KMQ A;  2XFP A;  4UDQ A;  3EF6 A;  1KSS A;  3KLJ A;  1NHR A;  2C4C A;  3AD8 B;  1M6I A;  2X50 A;  3KU9 A;  2EQ8 A;  1IUW A;  1B37 A;  2X8H A;  3UKA A;  2OAL A;  2WOV A;  1ZK7 A;  1TDE A;  3H8I A;  5TR3 A;  4Y4M A;  2R4J A;  3AB1 A;  4H4P A;  1YQ4 A;  3NH3 X;  3AXB A;  4TM3 A;  3UTF A;  3COX A;  2GR1 A;  2R4E A;  2B9Y A;  1PXA A;  3CGC A;  2I0Z A;  2Y6R A;  1NG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...