3CGDA

Pyridine nucleotide complexes with bacillus anthracis coenzyme a-disulfide reductase: a structural analysis of dual nad(p)h specificity
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
444
structure length
444
Chain Sequence
MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRDKYGIDAKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGAIGLEMAETFVELGKKVRMIERNDHIGTIYDGDMAEYIYKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLVSVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Pyridine nucleotide-disulfide oxidoreductase, class I
publication title Pyridine Nucleotide Complexes with Bacillus anthracis Coenzyme A-Disulfide Reductase: A Structural Analysis of Dual NAD(P)H Specificity.
pubmed doi rcsb
source organism Bacillus anthracis str.
total genus 154
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3cgdA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgdA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgdA02
4JDRA 4KPRA 2V61A 4B69A 4A6NA 2XLUA 2GR1A 2R0CA 2YVJA 3UKPA 2FJEA 2GRTA 3BI4A 3QFAA 4CY6A 3RP6A 1PJ5A 4D04A 4CNJA 4FK1C 4EIPA 5L46A 1RYIA 4Z24A 1YKJA 1BGNA 2IVEA 1CC2A 2C70A 1GEUA 1K4QA 2FJDA 3K7MX 5FS8A 1TDOA 4GCMA 2WPFA 3AE3A 3CNTA 1E1MA 2E5VA 3IF9A 1E39A 3QVRA 1CJCA 2V60A 5FS6A 3PS9A 4J57A 2CULA 1KSUA 1CJ3A 4HB9A 3UP4A 1OJCA 4H2RA 3UOVA 3VR9A 4H2PA 1BWCA 1E1NA 1BGJA 3CPJG 2YM2A 1D4CA 3ICTA 1NHSA 3CGBA 3F8DA 1F8WA 4IA5A 3ADAB 3NGCX 2V3BA 4B68A 5KVIA 2YLZA 2A87A 3QSEA 1DJQA 4X9NA 1PXAA 2FBWA 3DK9A 4NZHA 3DJJA 3C4NA 2EQ8A 3NH3X 3REDA 3UTHA 3PVCA 2WU5A 2R4EA 1JNRA 4AP3A 5CKUA 2VQBA 2Y6RA 5JCMA 1JRZA 2H88A 3UKKA 1NHQA 3CPIG 1S3EA 5J60A 2WDQA 4BURA 2GH5A 4H4TA 3NN0X 3UOZA 2XFOA 4NTCA 2BCPA 3LZWA 1ZY8A 3AYLA 4OPCA 1KSSA 3CNSA 5J7XA 3V3OA 2NVKX 4TM4A 3ALMA 4YKFA 4EQXA 2X3NA 4AT0A 2OLNA 2XLPA 2YVGA 3NK2X 5JCKA 1BKWA 1H86A 1VDCA 1RSGA 4JNQA 1P2EA 1GT8A 2AAQA 3Q9TA 3SGLA 2V5ZA 1LPFA 3KKJA 2FJAA 3NT6A 1NHPA 2F5ZA 4LA1A 4DNAA 4J34A 3UKLA 1VG0A 1ZX9A 3F8RA 2VRLA 2WOWA 2X8CA 1YY5A 4TLXA 2GQFA 1FL2A 1LQUA 5EOWA 4C74A 3COXA 4D03A 3AEGA 3Q6JA 2A89A 2B76A 2EQ7A 3FBSA 4ZCDA 3S5WA 2YG5A 3S61A 4KX6A 1E1LA 2JKCA 3P4RA 3GRSA 1QLBA 2CDUA 4P9SA 3V76A 4XWZA 1PN0A 2WESA 3M12A 3P1WA 3DJEA 3AWIA 3AECA 3ALLA 2GEWA 2XYOA 2WOVA 3LOVA 4K22A 1XDIA 4YXDA 3DH9A 4YWOA 3LXDA 1ZMDA 4RSLA 1NAAA 1MXTA 4EM4A 3KA7A 1GETA 4C3YA 1CF3A 3GYIA 2XFPA 2BS3A 2C73A 1TRBA 1CHUA 3CGDA 1TDKA 4IVMB 5GSNA 2Q7VA 4OPGA 2Q0KA 3UOXA 1GNDA 5KRQA 3AE2A 5M10A 4I59A 3SFDA 2YG7A 2B9XA 2UZZA 1N4UA 3BHFA 2QA1A 2CVJA 3DJDA 4H7UA 3BI5A 3RP8A 4GUVA 2XFQA 3E1TA 2YR4A 5KVHA 3ATRA 1JRYA 4C77A 4ECHA 3KLJA 2WP6A 2WBAA 3ISHA 4JY2A 4WCTA 3CN8A 2WPEA 2GMJA 1GALA 1OJDA 2WHDA 3AE9A 3PO7A 3QJ4A 2ACZA 3O0HA 3AEFA 1O5WA 3CPHG 3KU9A 4OCGA 4CBQA 2YWLA 2V3AA 4U8LA 2OA1A 3FMWA 3K7QX 2W0HA 4YTNA 1GRFA 4TM1A 2R46A 4U8PA 4GDPA 4U8NA 4A9WA 1S3BA 4K2XA 4J2WA 2YLWA 1MOKA 1Y56B 4YTPA 4K5SA 1PHHA 2E1MA 2XFNA 4BJZA 3AEAA 3JSKA 1DJNA 1VQWA 2YLSA 1XPQA 3ABVA 2GR3A 1IUSA 2R4JA 4REKA 1TDNA 3NKSA 1ZOVA 3AB1A 3ZDNA 4CY8A 5C3JA 3DK8A 2B9WA 4ADWA 4GDEA 3UTEA 5CQFA 2I0ZA 3GMCA 3P4PA 1LTXR 2WP5A 4BV6A 3DJGX 5U1OA 2C7GA 4YT0A 2ZZBA 4H50A 1BF3A 3D8XA 3IWAA 1E1KA 1L9EA 5TR3A 3K30A 4I58A 2EQ9A 4RG4A 4Z2RA 5KOXA 1Z6LA 3SM8A 1H82A 2FJBA 1SEZA 4J33A 4H4WA 1DODA 1H7XA 1DNCA 2X99A 3UKFA 2X50A 4CCQA 1FEBA 2XVHA 4JY3A 2YVFA 4H4VA 3VRDB 2Y6QA 1K0IA 5IPYA 3L8KA 1ZK7A 4M52A 3B3RA 1XHCA 2BC0A 3NN6X 1DOCA 1PXCA 2VQ7A 3AD7B 3ITJA 3VRBA 2AR8A 2AQJA 4DSHA 3V3NA 5U63A 1PBFA 4U8KA 1PXBA 2Z5YA 3VQRA 2DKIA 1JRXA 1GRTA 2B9YA 1CL0A 1REOA 4Z2UA 4OVIA 3UCLA 1UKVG 2J3NA 4TM3A 4EIQA 1ZKQA 5FS7A 4FX9A 4APNA 1KFYA 4A5LA 3RHAA 1PDHA 3AE1A 5DBJA 4H4QA 3HZLA 3AYJA 2BXRA 4UP3A 1EL7A 2ZZ0A 4EQRA 4JN9A 1IJHA 3KVEA 3FG2P 3RP7A 3AEDA 2QCUA 4JQ9A 2GVCA 5BUKA 1GPEA 1LQTA 1LV0A 3NHOX 1DOEA 3VRAA 1IUVA 4IV9A 5KOWA 2H89A 1K0JA 1CJ4A 1F8RA 4X9MA 1KNRA 1QO8A 4H4SA 4IA6A 4Z26A 2V6OA 2VVLA 3GYJA 3R9UA 2YR5A 4HA6A 2BYBA 3G5SA 5EBKA 2Z5XA 4YSHA 1VRQB 4EQWA 5U25A 2XDOA 2EQ6A 3P9UA 4TLZA 3CNJA 5KWFA 2BA9A 3M0OA 3QFBA 1D7LA 3SQPA 2BS2A 1QJDA 3ICSA 1KF6A 1MO9A 3EAOA 3VR8A 4B63A 4OPUA 2VVLG 2QA2A 3URHA 2GF3A 3C4AA 2R9ZA 4A65A 5JCLA 1N4VA 2JBVA 2NPXA 4USQA 2RGJA 4K8DA 4XXGA 4E0VA 2C72A 1O94A 1B8SA 3OC4A 2XVJA 3BNMA 1V59A 5JCIA 5M0ZA 1IUUA 1YQ3A 1ZMCA 3IHMA 2DKHA 3AD9B 3RNMA 3AEEA 2YQUA 2WP9A 1F8SA 2YG6A 3AE8A 1GERA 1CBOA 3LADA 4C3XA 2C3CA 2TMDA 4EQSA 2C66A 2C65A 1ZOYA 3NYCA 4U8OA 3AE5A 1D5TA 5HXIA 4X4JA 2GQWA 1K0LA 1DXLA 2WDRA 3LZXA 2IVDA 2JB1A 5HY5A 4Z25A 3QVPA 4K5RA 3EPTA 2BCGG 1H6VA 4NEWA 2GMHA 4XWRA 1GRGA 1FOHA 1Q1WA 4EM3A 4H2NA 1GESA 4U8JA 1OJTA 2GR2A 3CIRA 3CNDA 1HYUA 4H4XA 1TDEA 4H4PA 4B66A 2RGOA 4B1BA 2ZBWA 4AT2A 3II4A 4WX1A 4A79A 4RG3A 4B65A 1B5QA 4UDRA 5ER0A 1EBDA 1ELIA 1EL8A 4OPTA 4YKGA 4NEVA 4A99A 2XVEA 4DSGA 2BACA 2WS3A 2JB2A 1TYTA 2VZ2A 1L9CA 1B37A 4EMWA 1H7WA 3IC9A 1KDGA 2XLRA 4Y4NA 2BK5A 2X8HA 3H8IA 4BK3A 3DGZA 3ZYXA 3NRNA 1GOSA 3F8PA 1NHRA 2ZZCA 3LJPA 4H4UA 4AP1A 1BZLA 4FK1A 4OPDA 3CGEA 2C64A 5EB4A 3DGHA 1JEHA 1YQ4A 1FECA 3G5QA 4O5QA 1D7YA 1M6IA 1COYA 1TYPA 3NTAA 2JK6A 4J31A 5IQ4A 4OPIA 5BULA 4Z2TA 3ALJA 3GWFA 4U2LA 3H4KA 3LB8A 5BRTA 3EF6A 1OJAA 4H4RA 3UOYA 3BNUA 3T37A 2R0GA 4K7ZA 1AOGA 2R45A 5EB5A 4ZN0A 3QSSA 1IUXA 1GRHA 1Y0PA 4Z44A 1GV4A 1NPXA 1E6EA 1JOAA 2GR0A 3GDPA 2YLXA 3OZ2A 2RABA 2YAUA 2Q6UA 2A8XA 2WEUA 4UDQA 4EMJA 1LJ1A 4AOSA 2GV8A 2O9ZA 4U8MA 1FCDA 4YSXA 1RP0A 5IQ1A 3NK1X 4LIIA 1PBCA 2XLTA 4U2TA 1Y56A 4GRTA 1XANA 2Q0LA 3NNEA 2YG4A 1CC4A 1M64A 5HHFA 2C67A 5GRTA 2GB0A 1Q1RA 1N4WA 2X8GA 3P4SA 1X31B 3BI2A 4BK1A 3AD8B 5FMHA 3DK4A 1IUWA 2OLOA 3GMBA 4USRA 3UKQA 3AE7A 4GF7A 1GTEA 3FIMB 4YSYA 1ZDLA 1O95A 1NDAA 1CJ2A 2E4GA 4NTEA 1VG9A 4Y4LA 3NG7X 3P4QA 2C76A 1D4EA 3IHGA 1L0VA 2YLRA 4PAAA 3CNPA 1TDFA 5JCNA 4IVOB 2GAGB 4ZCCA 3GD3A 1S2YA 3K7TA 1JNZA 1IUTA 2VVMA 4U2SA 4NTDA 3NIXA 1CC6A 1W4XA 1P2HA 2WPCA 2IIDA 1PBBA 3AEBA 3KPFA 1N1PA 2C75A 3H8LA 4O5UA 1PJ6A 2ARDA 3DMEA 3GD4A 2JB3A 4CNKA 1NG3A 1S2QA 1GRAA 3GRTA 4N9XA 1PJ7A 4FDCB 2VRMA 2BK3A 3AE6A 4EMIA 3G5RA 3GSIA 4ICYA 4PABA 2BS4A 1NEKA 2TPRA 3NYFA 1GSNA 5C2TA 5BVAA 1GXFA 2B7SA 2GAHB 3UTFA 2WQYA 2WOIA 1B4VA 4C5OA 1FEAA 4B67A 3AE4A 3QSMA 1H84A 2YM1A 2BABA 2VOUA 1LVLA 1ZP0A 2XCGA 5FS9A 1DOBA 4YTMA 4A6NB 3ICRA 1PBDA 4CRTA 3UKHA 4UDPA 2QAEA 1H81A 2XVIA 3I6DA 1NG4A 2BK4A 2YLTA 2CFYA 2YR6A 3BHKA 2B7RA 1ONFA 3DA1A 3L1RA 2WETA 4DGKA 3SFEA 2XLSA 2XVFA 1GREA 3FPZA 3NK0X 4H4YA 4LU6A 4BJYA 1H83A 1NENA 4J36A 4TM0A 4B64A 1EL5A 3CGCA 1GRBA 1JU2A 2OALA 2APGA 2XFUA 3I3LA 4JNAA 5LV9A 4Z43A 2PHHA 3UKAA 4GR1A 2OAMA 2HQMA 1OJ9A 2WDVA 4MJWA 4YSZA 3KD9A 4A7AA 4H4ZA 2R0PA 3GWDA 3C96A 1PS9A 3B6DA 3ATQA 4CCRA 3GDNA 3NTDA 4OPLA 3EANA 4U8IA 5HYMA 1D4DA 3UP5A 3D1CA 2RGHA 3WE0A 2WU2A 4BK2A 1EL9A 3AXBA 1YQZA 2YG3A 3NLCA 1L9DA 2BXSA 4J56A 1E7PA 4Y4MA 2PYXA 3NYEA 3CTYA 3M13A 1F6MA 1KNPA 2BC1A 1PBEA 2JAEA 1F3PA 3AYIA 1Q9IA 4AOXA 2C3DA 4H2QA 3UTGA 1GTHA 5KXJA
chains in the Genus database with same CATH superfamily
2FJEA 2GRTA 3RP6A 4IP5A 1PJ5A 4FK1C 4Z24A 2OZ8A 2C70A 2FJDA 5FS8A 3AE3A 1E1MA 2E5VA 3SN1A 5FS6A 3PS9A 4J57A 1CJ3A 2OZ3A 3ICTA 3ADAB 5KVIA 3HRDC 1DJQA 2FBWA 3T8QA 3DJJA 3PVCA 3SN4A 1JNRA 3ES8A 5CKUA 2Y6RA 4K8GA 4H4TA 4NTCA 3CNSA 5J7XA 4IP4A 3T9PA 3ALMA 5JCKA 1H86A 1VDCA 4JNQA 2AL2B 3SGLA 3HYWA 3NT6A 4GAPA 4J34A 3UKLA 1VG0A 1ONEA 1YY5A 5EOWA 3COXA 2A89A 2B76A 4ZCDA 4KX6A 3DG7A 4P9SA 1PN0A 3P1WA 3M12A 3SJNA 1XDIA 1ZMDA 4EWJA 1NAAA 1GETA 4HNCA 1CF3A 1TRBA 2PPGA 5GSNA 3UOXA 5KRQA 1P43A 3AE2A 3SFDA 2ONEA 2QVHA 3ZLHA 3HW2A 3BHFA 4H7UA 2YR4A 5KVHA 2WP6A 2QJNA 4WCTA 3CN8A 4A6GA 1GALA 2WHDA 3AE9A 3CPHG 3PG6A 3SXIA 3ZVIA 3FMWA 1GRFA 3I4KA 2YLWA 1MOKA 3UJ2A 1DJNA 1VQWA 4REKA 3DK8A 2PS2A 2I0ZA 3GMCA 1JRPA 4H83A 2WP5A 3MSYA 5U1OA 2ZZBA 3D8XA 3IWAA 1L9EA 5TR3A 3QPEA 4RG4A 1Z6LA 3SM8A 2FJBA 4J1OA 4H4WA 1H7XA 1DNCA 2AKZA 1FEBA 4JY3A 2YVFA 3PK7A 4NWZA 3IJQA 4M52A 3B3RA 3IJLA 2BC0A 4GGBA 2VQ7A 3HPFA 4DSHA 4U8KA 3N6JA 1CL0A 2XH4A 1ZKQA 5FS7A 4FX9A 3UCDA 4A5LA 3AYJA 3RP7A 3KVEA 2GVCA 1LQTA 1DOEA 1K0JA 1EC7A 4IA6A 2V6OA 2BYBA 5EBKA 2Z5XA 5U25A 2XDOA 3Q4DA 3SQPA 1MRAA 2BS2A 1PDYA 2XH7A 3ICSA 1MO9A 2VVLG 4E5TA 3A7RA 3URHA 3S5SA 1KKOA 2NQLA 2RGJA 3UXLA 5M0ZA 2DKHA 3AD9B 3RNMA 4DXKA 3AEEA 2YG6A 2PMQA 1CBOA 3UJFA 2C65A 4TVWA 1ZOYA 5HXIA 3T6CA 4X4JA 2WDRA 1DXLA 3LZXA 2HXTA 2PU0A 3N4FA 3DG6A 1Q1WA 3ZLGA 1OJTA 2GR2A 1HYUA 4H4XA 1TKKA 1R6WA 4B1BA 4B65A 4UDRA 2XVEA 2JB2A 2VZ2A 3IC9A 2FYMA 3SN0A 4BK3A 1NHRA 4H4UA 4G73A 2OFJA 4OPDA 2C64A 5EB4A 5FJTA 1JEHA 3PFRA 1TYPA 4MGGA 4U2LA 4IHCA 2ZC8A 4H4RA 1AOGA 2QGYA 3JW7A 1GV4A 5KNLA 1JOAA 3GDPA 2RABA 2YAUA 2WEUA 1XANA 2OG9A 3NNEA 1CC4A 2C67A 2GB0A 3SZFA 1Q1RA 3P4SA 1X31B 3BI2A 4BK1A 4USRA 3ZVHA 3AE7A 4YSYA 1ZDLA 4H1ZA 1O95A 1CJ2A 2E4GA 4Y4LA 2RDXA 3NG7X 3P4QA 2C76A 1D4EA 4HCHA 3PWIA 4IVOB 1JNZA 2IIDA 3T4WA 4HYRA 1PBBA 3AEBA 1N1PA 2C75A 3GD4A 1JPMA 4PABA 4ENLA 3H70A 4IL0A 3QKEA 2BS4A 1GSNA 1GXFA 2GAHB 3MQTA 3AE4A 1H84A 2BABA 3NFUA 2XH2A 1PBDA 3UKHA 2CFYA 3DA1A 3L1RA 3UXKA 2XLSA 4HN8A 3SFEA 3FPZA 1NENA 1EC8A 1S7MA 4GYPA 2OALA 3I3LA 5LV9A 2HQMA 4A7AA 4Z1YA 3EANA 3WE0A 3NLCA 3AXBA 1YQZA 1L9DA 2BXSA 1E7PA 3DGBA 1WYGA 1Q9IA 2C3DA 3UTGA 1KN0A 4JDRA 1N63C 2GR1A 2R0CA 4D04A 4CNJA 5L46A 2IVEA 1CC2A 1K4QA 3K7MX 2WPFA 4YWSA 3IF9A 1CJCA 2V60A 2CULA 1KSUA 4HB9A 4H2RA 3BJSA 3RR1A 1E1NA 1BGJA 2YM2A 1D4CA 4DX3A 3NXLA 1NHSA 3CGBA 3NGCX 2YLZA 2A87A 3UJEA 5FJRA 5FJOA 3REDA 5JCMA 2PCEA 4E4FA 2H88A 2HNEA 4IZGA 3V4BA 1S3EA 5J60A 3NN0X 4M0XA 3UOZA 1ZY8A 3AYLA 1KSSA 3V3OA 1H2IA 4EQXA 2GGGA 3HYXA 1BKWA 3NZGA 3UGVA 2OQHA 1GT8A 4IT1A 1LPFA 3KKJA 3RRAA 2FJAA 1ZX9A 2VRLA 2WOWA 2C4CA 1FL2A 2PGWA 4D03A 2P8BA 1W6TA 3S5WA 1E1LA 1QLBA 3FYYA 3HYVA 2WESA 3AWIA 5J04A 4YXDA 4C3YA 3RCYA 1TDKA 2Q7VA 3NVYB 2B9XA 2UZZA 2W3SA 3DJDA 4HPNA 3BI5A 3RP8A 4C77A 4ECHA 1JRYA 3ETRB 3KLJA 3H12A 2WPEA 2XGZA 1R0MA 3NRZB 1JPDX 2V3AA 4MMWA 2OA1A 3EEZA 4TM1A 2R46A 4A9WA 4HCLA 4M6UA 4YTPA 1PHHA 2XFNA 3ABVA 2R4JA 1ZOVA 3AB1A 4H19A 4ADWA 4GDEA 5CQFA 1LTXR 4BV6A 3DJGX 2XH0A 4H50A 5KMQA 1E1KA 2EQ9A 3PWGA 1KCZA 2X99A 4H4VA 3VRDB 2Y6QA 2PP0A 4X2PA 2PTYA 3GO2A 2GL5A 3NN6X 1DOCA 3AD7B 3VRBA 3V3NA 1PBFA 7ENLA 3VQRA 2DKIA 3A7UA 1JRXA 1GRTA 1WUFA 1REOA 3UCLA 4TM3A 4EIQA 1KFYA 4APNA 4G74A 1EL7A 3FG2P 4JQ9A 5KMPA 3NHOX 3VRAA 1X2GA 4IV9A 1XS2A 1QO8A 4Z26A 2VVLA 3GYJA 3OPSA 3G5SA 1VRQB 3V3WA 4TLZA 3CNJA 3IJIA 3M0OA 3ENLA 1D7LA 1RVKA 2QJMA 2W3RA 3EAOA 1N5WC 2R9ZA 2JBVA 3OZYA 3IK4A 4XXGA 4E0VA 2C72A 1JCTA 1P48A 1SJDA 3OC4A 5JCIA 1IUUA 1YQ3A 3GYXA 1KKRA 3CAWA 1GERA 2TMDA 4EQSA 3THUA 4G7FA 1D5TA 1GRGA 2AL1A 4DYEA 4EM3A 1BKHA 4ZA0A 3CNDA 1TDEA 3TCSA 3CB3A 2ZBWA 3OZMA 4A79A 1EBDA 4YKGA 3SZCA 2OQYA 4DSGA 1B37A 3R0KA 3ZVHB 2BK5A 3DGZA 3ZYXA 2ZZCA 1BZLA 4FK1A 3CGEA 1IYXA 4J3ZA 1D7YA 1XPYA 4II2A 3NTAA 5IQ4A 4DN1A 4Z2TA 3GWFA 5BRTA 3UOYA 2R0GA 4K7ZA 5EB5A 3CYJA 3VC6A 2AKMA 3OZ2A 4HCDA 4UDQA 1LJ1A 4AOSA 2GV8A 3FVDA 3RITA 4LIIA 4U2TA 2Q0LA 1M64A 3T2YA 3KPKA 3OTRA 2OLOA 3GMBA 3FIMB 3A7AA 3OW1A 1VG9A 3CXBA 3QTPA 5JCNA 2GAGB 1S2YA 1IUTA 2VVMA 4NTDA 2WPCA 3KPFA 4O5UA 2ARDA 2JB3A 1NG3A 4GGHA 4ICYA 2BK3A 3G5RA 4EMIA 3NYFA 5C2TA 5BVAA 3B9JB 2WQYA 1B4VA 1FEAA 1LVLA 1ZP0A 2XCGA 3ICRA 4CRTA 3VC5A 4UDPA 2QAEA 3FV9A 3TWBA 1NG4A 2GSHA 4E6MA 4DGKA 4H4YA 3TQPA 4J36A 1JU2A 4Z43A 3D47A 2OAMA 1OJ9A 2WDVA 4YSZA 4ROPA 1PS9A 3B6DA 3GDNA 2P0IA 3UP5A 2GGJA 4BK2A 4MKSA 3NYEA 1KNPA 2BC1A 2JAEA 1F3PA 4AOXA 1JDFA 4ZCWA 5KXJA 4KPRA 2V61A 4B69A 4A6NA 2XLUA 2OKTA 2YVJA 3UKPA 3BI4A 4CY6A 2OVLA 3N4EA 4JHMA 3FXGA 1YKJA 1NELA 3CNTA 2W54A 1E39A 3NS1B 3UOVA 4H2PA 3KUMA 3CPJG 1F8WA 4B68A 1WUEA 1FFUC 6ENLA 4X9NA 3DK9A 3T31A 4NZHA 3C4NA 2EQ8A 3NH3X 3UTHA 3STPA 2WU5A 4AP3A 2VQBA 1NHQA 3CPIG 2WDQA 4BURA 2XFOA 3RO6A 4OPCA 4YKFA 2OLNA 2XLPA 3NK2X 4E4UA 1RSGA 3OP2A 3Q9TA 3I6EA 1BQGA 3F8RA 1N61C 4C74A 3D46A 3DEQA 3Q6JA 3TJIA 3FBSA 3S61A 2JKCA 3DESA 3GRSA 3P4RA 2CDUA 3V76A 4XWZA 1NU5A 3AECA 3ALLA 2GEWA 3U9IA 2XYOA 3LOVA 5G5HB 4YWOA 4RSLA 1MXTA 4EM4A 3MUCA 2XFPA 2OO6A 2XSXA 3ES7A 3CGDA 4IVMB 5M10A 2YG7A 1FFVC 2QA1A 2CVJA 2OPJA 4KT2A 3E1TA 3RGTA 2WBAA 1OJDA 3PO7A 3QJ4A 2ACZA 3O0HA 4OCGA 4GISA 2W0HA 4YTNA 3MZNA 4U8NA 1S3BA 1Y56B 2GR3A 1IUSA 4CY8A 5C3JA 1TDNA 3NKSA 2B9WA 2PP1A 3UTEA 3P4PA 3R25A 3T0KA 2P3ZA 2C7GA 2PGEA 1BF3A 4I58A 5KOXA 4Z2RA 3GD6A 1H82A 4JN7A 1DODA 3UKFA 2GDQA 2E5AA 2XVHA 1FHUA 3R10A 1K0IA 5IPYA 3L8KA 2OX4A 4G6HA 5G5GB 2AR8A 4GIRA 2Z5YA 2GGHA 4Z2UA 3VDGA 2J3NA 3RHAA 3AE1A 5DBJA 3HZLA 2BXRA 2QQ6A 2ZZ0A 4JN9A 1IJHA 1GPEA 5KOWA 2H89A 4X9MA 1KNRA 3R9UA 2YR5A 5KWFA 2BA9A 3QFBA 5FJUA 1MDLA 1QJDA 4B63A 4OPUA 2DW6A 2QA2A 2GF3A 3C4AA 4ZOHB 2PU1A 1N4VA 2PODA 1O94A 2XVJA 1V59A 2WP9A 3AE8A 2C66A 4U8OA 3AE5A 1ZXIC 2BRAA 1K0LA 2IVDA 5HY5A 3GC2A 4Z25A 3QVPA 3EPTA 1H6VA 4NEWA 2GMHA 1ECQA 3R1ZA 2PSNA 2RGOA 5EU9A 3DFHA 3VFCA 1SJCA 4A99A 3SY4A 2BACA 1TYTA 2PTZA 1L9CA 1H7WA 2XLRA 4Y4NA 3H8IA 3NVWB 1GOSA 3AM9A 4AP1A 5JRBA 1YQ4A 1FECA 3EUB3 4J31A 4OPIA 5BULA 2HZGA 3ALJA 3LB8A 3BNUA 3T37A 1N5XA 3QSSA 1GRHA 4Z44A 2W55A 2Q6UA 4EMJA 2O9ZA 4U8MA 4DHGA 4YSXA 1RP0A 5IQ1A 3NK1X 4TVYA 1Y56A 4GRTA 5GRTA 1MUCA 2E3TA 3AD8B 3DK4A 1IUWA 3UKQA 4GF7A 2ZADA 4NNJA 4NTEA 1L0VA 2QDEA 2FKPA 4PAAA 3CNPA 3K7TA 1CC6A 1P2HA 3H8LA 1PJ6A 3DMEA 1S2QA 1GRAA 3SSZA 3GRTA 4N9XA 1PJ7A 4FDCB 2PTWA 5BOFA 2B7SA 3UTFA 2WOIA 4G9KA 4C5OA 3QSMA 2YM1A 2PP3A 2VOUA 5FS9A 4A6NB 2CHRA 3I6DA 1H81A 2XVIA 2YR6A 1FIQB 2WETA 4BJYA 3NK0X 1GREA 1H83A 3L5OA 4B64A 3QN3A 3CGCA 2O56A 4GFIA 2XFUA 2PHHA 3UKAA 1V97A 2MUCA 3KD9A 3GWDA 4E8GA 3C96A 4CCRA 3ATQA 4OPLA 5HYMA 1D4DA 3R0UA 3I6TA 2PYXA 3CTYA 1F6MA 1PBEA 3DFYA 3AYIA 3QLDA 4H2QA 1GTHA 1RM6B 3QFAA 4EIPA 1RYIA 1T3QC 1STZA 4IL2A 1BGNA 1GEUA 3ZLFA 1TDOA 4GCMA 3QVRA 4HNLA 3VR9A 3UP4A 2MNRA 1OJCA 3DG3A 1BWCA 1SB3B 2QJJA 3F8DA 4IA5A 2V3BA 2P8CA 3QSEA 1MNSA 1PXAA 3NO1A 3B97A 3SQSA 4DWDA 2R4EA 3DDMA 1JRZA 3UKKA 2GH5A 2BCPA 3LZWA 2NVKX 4TM4A 4AT0A 2X3NA 2YVGA 3NVZB 3DERA 1P2EA 2AAQA 2V5ZA 1N60C 1NHPA 2F5ZA 4LA1A 4DNAA 2P88A 2X8CA 4TLXA 1SJBA 2GQFA 1LQUA 5KMRA 3UCCA 3CXOA 3AEGA 1DTNA 3NVVB 2EQ7A 2YG5A 3DJEA 3R07C 2WOVA 3H7VA 1F9CA 4K22A 3DH9A 3LXDA 3AMZA 3KA7A 3GYIA 2BS3A 2C73A 4GMEA 1CHUA 4GYPC 4OPGA 2Q0KA 1GNDA 3CMMA 3VA8A 1FO4A 4I59A 3TTEA 3SR6B 1N4UA 4GUVA 2XFQA 3ATRA 2AL2A 2BRYA 3ISHA 4JY2A 2GMJA 3KU9A 3AEFA 1O5WA 4CBQA 2YWLA 4U8LA 3K7QX 4U8PA 4GDPA 4K2XA 4J2WA 4K1WA 5ENLA 4G8TA 4K5SA 2E1MA 4BJZA 3P3BA 3AEAA 3JSKA 2YLSA 1XPQA 3ZDNA 4A3RA 3BSMA 4KPLA 3V5CA 4YT0A 3GY1A 4JN8A 3K30A 1KD0A 4FP1A 1SEZA 4J33A 2X50A 3UJSA 2I5QA 4G6GA 4CCQA 3TW9A 1ZK7A 3MY9A 1XHCA 1PXCA 3ITJA 2AQJA 4A35A 4GAVA 5U63A 1PXBA 2B9YA 3T2ZA 3UJRA 3P93A 4OVIA 1EBGA 1UKVG 3JVAA 3CK5A 2OLAA 1PDHA 4H4QA 4UP3A 4EQRA 3AEDA 2QCUA 5BUKA 1LV0A 3N6HA 1IUVA 1F8RA 4KEMA 4H4SA 3EKGA 4HA6A 3K1GA 3Q45A 2PTXA 4YSHA 4EQWA 3H8AA 2EQ6A 4F4RA 3S47A 3P9UA 1L8PA 1KF6A 1SJAA 3VR8A 2POZA 3JZUA 1FHVA 4A65A 5JCLA 2NPXA 4USQA 4K8DA 1B8SA 3BNMA 1VDVA 1ZMCA 3IHMA 2OZTA 2YQUA 1F8SA 3LADA 4C3XA 2C3CA 3NYCA 3TWAA 2GQWA 2JB1A 5FJPA 4K5RA 1PDZA 2QDDA 2BCGG 4XWRA 1FOHA 4H2NA 1GESA 4U8JA 1EC9A 3AN1A 3CIRA 4H4PA 4B66A 4FI4A 1VQZA 4AT2A 3II4A 4WX1A 4RG3A 1B5QA 3SX6A 3SZ0A 5ER0A 1ELIA 1EL8A 4OPTA 4NEVA 2WS3A 2DW7A 5KMSA 4EMWA 1KDGA 3VCCA 2X8HA 3NRNA 3F8PA 3LJPA 1MDRA 3DGHA 3MKCA 3G5QA 4O5QA 1COYA 1M6IA 1YEYA 4KWSA 2JK6A 3CT2A 4II3A 3H4KA 3EF6A 1OJAA 1JROA 2R45A 4ZN0A 1IUXA 1X2HA 1Y0PA 1NPXA 1E6EA 2GR0A 2YLXA 2A8XA 1FCDA 3VCNA 2XLTA 1PBCA 2YG4A 5HHFA 1N4WA 2X8GA 4H2HA 5FMHA 1GTEA 1TZZA 1NDAA 3SBFA 3IHGA 5BOEA 3SYIA 2YLRA 3T14A 1TDFA 4ZCCA 3GD3A 4U2SA 3NIXA 1W4XA 3R11A 4CNKA 2VRMA 3AE6A 3GSIA 1EBHA 1NEKA 2TPRA 3TJ4A 3SZWA 1TE6A 2HXUA 4B67A 3T2KA 3MWCA 1DOBA 4YTMA 3DIPA 2YLTA 2BK4A 3BHKA 2B7RA 1ONFA 1OEPA 2XVFA 4LU6A 4TM0A 1EL5A 1GRBA 3BOXA 2PA6A 4K2SA 2APGA 4JNAA 3U4FA 4GR1A 3V5FA 4MJWA 3FJ4A 4Z17A 1ELSA 4H4ZA 2R0PA 3P0WA 3D9XA 3TOYA 3NTDA 4U8IA 2GGIA 5IDZA 2GGEA 3D1CA 2RGHA 2WU2A 1EL9A 2YG3A 1E9IA 3FCPA 4J56A 4Y4MA 3M13A 1N62C 1CJ4A
chains in the Genus database with same CATH topology
4JDRA 4KPRA 2V61A 4B69A 4A6NA 2XLUA 2GR1A 2R0CA 2YVJA 3UKPA 2FJEA 2GRTA 3BI4A 3QFAA 4CY6A 3RP6A 1PJ5A 4D04A 4CNJA 4FK1C 4EIPA 5L46A 1RYIA 4Z24A 1YKJA 1BGNA 2IVEA 1CC2A 2C70A 1GEUA 1K4QA 2FJDA 3K7MX 5FS8A 1TDOA 4GCMA 2WPFA 3AE3A 3CNTA 1E1MA 2E5VA 3IF9A 1E39A 3QVRA 1CJCA 2V60A 5FS6A 3PS9A 4J57A 2CULA 1KSUA 1CJ3A 4HB9A 3UP4A 1OJCA 4H2RA 3UOVA 3VR9A 4H2PA 1BWCA 1E1NA 1BGJA 3CPJG 2YM2A 1D4CA 3ICTA 1NHSA 3CGBA 3F8DA 1F8WA 4IA5A 3ADAB 3NGCX 2V3BA 4B68A 5KVIA 2YLZA 2A87A 3QSEA 1DJQA 4X9NA 1PXAA 2FBWA 3DK9A 3T31A 4NZHA 3DJJA 3C4NA 2EQ8A 3NH3X 3REDA 3UTHA 3PVCA 2WU5A 2R4EA 1JNRA 4AP3A 5CKUA 2VQBA 2Y6RA 5JCMA 1JRZA 2H88A 3UKKA 1NHQA 3CPIG 1S3EA 5J60A 2WDQA 4BURA 2GH5A 4H4TA 3NN0X 3UOZA 2XFOA 4NTCA 2BCPA 3LZWA 1ZY8A 3AYLA 4OPCA 1KSSA 3CNSA 5J7XA 3V3OA 2NVKX 4TM4A 3ALMA 1H2IA 4EQXA 2X3NA 4YKFA 2OLNA 4AT0A 2XLPA 2YVGA 3NK2X 5JCKA 3HYXA 1BKWA 1H86A 1VDCA 1RSGA 4JNQA 1P2EA 1GT8A 2AAQA 3Q9TA 3SGLA 2V5ZA 1LPFA 3KKJA 3HYWA 2FJAA 3NT6A 1NHPA 2F5ZA 4LA1A 4DNAA 4GAPA 4J34A 3UKLA 1VG0A 1ZX9A 3F8RA 2VRLA 2WOWA 2X8CA 1YY5A 4TLXA 2GQFA 2C4CA 1FL2A 1LQUA 5EOWA 4C74A 5KMRA 3COXA 4D03A 3AEGA 3Q6JA 2A89A 2B76A 2EQ7A 3FBSA 4ZCDA 3S5WA 2YG5A 3S61A 4KX6A 1E1LA 2JKCA 3P4RA 3GRSA 1QLBA 2CDUA 4P9SA 3HYVA 3V76A 4XWZA 1PN0A 2WESA 3M12A 3P1WA 3DJEA 3AWIA 3AECA 3ALLA 2GEWA 2XYOA 2WOVA 3LOVA 4K22A 1XDIA 4YXDA 3DH9A 4YWOA 3LXDA 1ZMDA 4RSLA 1NAAA 1MXTA 4EM4A 3KA7A 1GETA 4C3YA 1CF3A 3GYIA 2XFPA 2BS3A 2C73A 1TRBA 1CHUA 3CGDA 1TDKA 4IVMB 5GSNA 2Q7VA 4OPGA 2Q0KA 3UOXA 1GNDA 3CMMA 5KRQA 3AE2A 5M10A 4I59A 3SFDA 2YG7A 2B9XA 2UZZA 1N4UA 3BHFA 2QA1A 2CVJA 3DJDA 4H7UA 3BI5A 3RP8A 4GUVA 2XFQA 3E1TA 2YR4A 5KVHA 3ATRA 1JRYA 2BRYA 4C77A 4ECHA 3KLJA 2WP6A 2WBAA 3ISHA 4JY2A 4WCTA 3CN8A 2WPEA 2GMJA 1GALA 1OJDA 2WHDA 3AE9A 3PO7A 3QJ4A 2ACZA 3O0HA 3AEFA 1O5WA 3CPHG 3PG6A 3KU9A 4OCGA 4CBQA 3SXIA 2YWLA 2V3AA 4U8LA 2OA1A 3FMWA 3K7QX 2W0HA 4YTNA 1GRFA 4TM1A 2R46A 4U8PA 4GDPA 4U8NA 4A9WA 1S3BA 4K2XA 4J2WA 2YLWA 1MOKA 1Y56B 4YTPA 4K5SA 1PHHA 2E1MA 2XFNA 4BJZA 3AEAA 3JSKA 1DJNA 1VQWA 2YLSA 1XPQA 3ABVA 2GR3A 1IUSA 2R4JA 4REKA 1TDNA 3NKSA 1ZOVA 3AB1A 3ZDNA 4CY8A 5C3JA 3DK8A 2B9WA 4ADWA 4GDEA 3UTEA 5CQFA 2I0ZA 3GMCA 3P4PA 3T0KA 1LTXR 2WP5A 4BV6A 3DJGX 5U1OA 2C7GA 4YT0A 2ZZBA 4H50A 1BF3A 3D8XA 3IWAA 1E1KA 1L9EA 5TR3A 3K30A 4I58A 2EQ9A 4RG4A 4Z2RA 5KOXA 1Z6LA 3SM8A 1H82A 2FJBA 1SEZA 4J33A 4H4WA 1DODA 1H7XA 1DNCA 2X99A 3UKFA 2X50A 4G6GA 4CCQA 1FEBA 2XVHA 4JY3A 2YVFA 4H4VA 3VRDB 2Y6QA 1K0IA 5IPYA 4NWZA 3L8KA 1ZK7A 4M52A 3B3RA 1XHCA 2BC0A 3NN6X 1DOCA 4G6HA 1PXCA 2VQ7A 3AD7B 3ITJA 3VRBA 2AR8A 2AQJA 4GAVA 4DSHA 3V3NA 5U63A 1PBFA 4U8KA 1PXBA 2Z5YA 3VQRA 2DKIA 1JRXA 1GRTA 2B9YA 1CL0A 3T2ZA 1REOA 4Z2UA 4OVIA 3UCLA 1UKVG 2J3NA 4TM3A 4EIQA 1ZKQA 5FS7A 4FX9A 4APNA 1KFYA 4A5LA 3RHAA 1PDHA 3AE1A 5DBJA 4H4QA 3HZLA 3AYJA 2BXRA 4UP3A 4G74A 1EL7A 2ZZ0A 4EQRA 4JN9A 1IJHA 3KVEA 3FG2P 3RP7A 3AEDA 2QCUA 4JQ9A 2GVCA 5BUKA 5KMPA 1GPEA 1LQTA 1LV0A 3NHOX 1DOEA 3VRAA 1IUVA 4IV9A 5KOWA 2H89A 1K0JA 1CJ4A 1F8RA 4X9MA 1KNRA 1QO8A 4H4SA 4IA6A 4Z26A 2V6OA 2VVLA 3GYJA 3R9UA 2YR5A 4HA6A 2BYBA 3G5SA 5EBKA 2Z5XA 4YSHA 1VRQB 4EQWA 5U25A 2XDOA 2EQ6A 3P9UA 4TLZA 3CNJA 5KWFA 2BA9A 3M0OA 3QFBA 1D7LA 3SQPA 2BS2A 1QJDA 3ICSA 1KF6A 1MO9A 3EAOA 3VR8A 4B63A 4OPUA 2VVLG 2QA2A 3URHA 2GF3A 3C4AA 2R9ZA 4A65A 5JCLA 1N4VA 2JBVA 2NPXA 4USQA 2RGJA 4K8DA 4XXGA 4E0VA 2C72A 1O94A 1B8SA 3OC4A 2XVJA 3BNMA 1V59A 5JCIA 5M0ZA 1IUUA 1YQ3A 3GYXA 1ZMCA 3IHMA 2DKHA 3AD9B 3RNMA 3AEEA 2YQUA 2WP9A 1F8SA 2YG6A 3AE8A 1GERA 1CBOA 3LADA 4C3XA 2C3CA 2TMDA 4EQSA 2C66A 2C65A 1ZOYA 3NYCA 4U8OA 3AE5A 2BRAA 1D5TA 5HXIA 4X4JA 2GQWA 1K0LA 1DXLA 2WDRA 3LZXA 2IVDA 2JB1A 5HY5A 4Z25A 3QVPA 4K5RA 3EPTA 2BCGG 1H6VA 4NEWA 2GMHA 4XWRA 1GRGA 1FOHA 1Q1WA 4EM3A 4H2NA 1GESA 4U8JA 1OJTA 2GR2A 3CIRA 3CNDA 1HYUA 4H4XA 1TDEA 4H4PA 4B66A 2RGOA 4B1BA 2ZBWA 4AT2A 3II4A 4WX1A 4A79A 4RG3A 4B65A 1B5QA 4UDRA 3SX6A 3SZ0A 5ER0A 1EBDA 1ELIA 1EL8A 4OPTA 4YKGA 3SZCA 4NEVA 4A99A 2XVEA 3SY4A 4DSGA 2BACA 2WS3A 2JB2A 1TYTA 2VZ2A 1L9CA 1B37A 5KMSA 4EMWA 1H7WA 3IC9A 1KDGA 2XLRA 4Y4NA 2BK5A 2X8HA 3H8IA 4BK3A 3DGZA 3ZYXA 3NRNA 1GOSA 3F8PA 1NHRA 2ZZCA 3LJPA 4H4UA 5JRBA 1BZLA 4G73A 4FK1A 4AP1A 4OPDA 3CGEA 2C64A 5EB4A 3DGHA 1JEHA 1YQ4A 1FECA 3G5QA 4O5QA 1D7YA 1M6IA 1COYA 1TYPA 4II2A 3NTAA 2JK6A 4J31A 5IQ4A 4OPIA 5BULA 4Z2TA 3ALJA 3GWFA 4II3A 4U2LA 3H4KA 3LB8A 5BRTA 3EF6A 1OJAA 4H4RA 3UOYA 3BNUA 3T37A 2R0GA 4K7ZA 1AOGA 2R45A 5EB5A 4ZN0A 3QSSA 1IUXA 1GRHA 1Y0PA 4Z44A 1GV4A 5KNLA 1NPXA 1E6EA 1JOAA 2GR0A 3GDPA 2YLXA 3OZ2A 2RABA 2YAUA 2Q6UA 2A8XA 2WEUA 4UDQA 4EMJA 1LJ1A 5KMQA 2GV8A 2O9ZA 4AOSA 4U8MA 1FCDA 4YSXA 1RP0A 5IQ1A 3NK1X 4LIIA 1PBCA 2XLTA 4U2TA 1Y56A 4GRTA 1XANA 2Q0LA 3NNEA 2YG4A 1CC4A 1M64A 5HHFA 2C67A 3KPKA 3T2YA 5GRTA 2GB0A 3SZFA 1Q1RA 1N4WA 2X8GA 3P4SA 1X31B 3BI2A 4BK1A 3AD8B 5FMHA 3DK4A 1IUWA 2OLOA 3GMBA 4USRA 3UKQA 3AE7A 4GF7A 1GTEA 3FIMB 4YSYA 1ZDLA 1O95A 1NDAA 4NNJA 1CJ2A 2E4GA 4NTEA 1VG9A 4Y4LA 3NG7X 3P4QA 2C76A 1D4EA 3IHGA 1L0VA 3SYIA 2YLRA 4PAAA 3T14A 3CNPA 1TDFA 5JCNA 4IVOB 2GAGB 4ZCCA 3GD3A 1S2YA 3K7TA 1JNZA 1IUTA 2VVMA 4U2SA 4NTDA 3NIXA 1CC6A 1W4XA 1P2HA 2WPCA 2IIDA 1PBBA 3AEBA 3KPFA 1N1PA 2C75A 3H8LA 4O5UA 1PJ6A 2ARDA 3DMEA 3GD4A 2JB3A 4CNKA 1NG3A 1S2QA 1GRAA 3GRTA 4N9XA 1PJ7A 4FDCB 2VRMA 2BK3A 3AE6A 4EMIA 3G5RA 3GSIA 4ICYA 4PABA 2BS4A 1NEKA 2TPRA 3NYFA 1GSNA 5C2TA 5BVAA 1GXFA 2B7SA 2GAHB 3UTFA 2WQYA 2WOIA 3SZWA 1B4VA 4G9KA 4C5OA 1FEAA 4B67A 3AE4A 3QSMA 3T2KA 1H84A 2YM1A 2BABA 2VOUA 1LVLA 1ZP0A 2XCGA 5FS9A 1DOBA 4YTMA 4A6NB 3ICRA 1PBDA 4CRTA 3UKHA 4UDPA 2QAEA 1H81A 2XVIA 3I6DA 1NG4A 2BK4A 2YLTA 2CFYA 2YR6A 3BHKA 2B7RA 1ONFA 3DA1A 3L1RA 2WETA 4DGKA 3SFEA 2XLSA 2XVFA 1GREA 3FPZA 3NK0X 4H4YA 4LU6A 4BJYA 1H83A 1NENA 3L5OA 4J36A 4TM0A 4B64A 1S7MA 1EL5A 3CGCA 1GRBA 1JU2A 2OALA 2APGA 2XFUA 3I3LA 4JNAA 5LV9A 4Z43A 2PHHA 3UKAA 4GR1A 2OAMA 2HQMA 1OJ9A 2WDVA 4MJWA 4YSZA 3KD9A 4A7AA 4H4ZA 2R0PA 3GWDA 3C96A 1PS9A 3B6DA 3D9XA 3ATQA 3GDNA 3NTDA 4OPLA 4CCRA 3EANA 4U8IA 5HYMA 1D4DA 3UP5A 3D1CA 2RGHA 3WE0A 2WU2A 4BK2A 1EL9A 3AXBA 1YQZA 2YG3A 3NLCA 1L9DA 2BXSA 4J56A 1E7PA 4Y4MA 2PYXA 3NYEA 3CTYA 3M13A 1F6MA 1KNPA 2BC1A 1PBEA 2JAEA 1F3PA 3AYIA 1Q9IA 4AOXA 2C3DA 4H2QA 3UTGA 1KN0A 1GTHA 5KXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JDR A;  4KPR A;  2V61 A;  4B69 A;  4A6N A;  2XLU A;  2GR1 A;  2R0C A;  2YVJ A;  3UKP A;  2FJE A;  2GRT A;  3BI4 A;  3QFA A;  4CY6 A;  3RP6 A;  1PJ5 A;  4D04 A;  4CNJ A;  4FK1 C;  4EIP A;  5L46 A;  1RYI A;  4Z24 A;  1YKJ A;  1BGN A;  2IVE A;  1CC2 A;  2C70 A;  1GEU A;  1K4Q A;  2FJD A;  3K7M X;  5FS8 A;  1TDO A;  4GCM A;  2WPF A;  3AE3 A;  3CNT A;  1E1M A;  2E5V A;  3IF9 A;  1E39 A;  3QVR A;  1CJC A;  2V60 A;  5FS6 A;  3PS9 A;  4J57 A;  2CUL A;  1KSU A;  1CJ3 A;  4HB9 A;  3UP4 A;  1OJC A;  4H2R A;  3UOV A;  3VR9 A;  4H2P A;  1BWC A;  1E1N A;  1BGJ A;  3CPJ G;  2YM2 A;  1D4C A;  3ICT A;  1NHS A;  3CGB A;  3F8D A;  1F8W A;  4IA5 A;  3ADA B;  3NGC X;  2V3B A;  4B68 A;  5KVI A;  2YLZ A;  2A87 A;  3QSE A;  1DJQ A;  4X9N A;  1PXA A;  2FBW A;  3DK9 A;  4NZH A;  3DJJ A;  3C4N A;  2EQ8 A;  3NH3 X;  3RED A;  3UTH A;  3PVC A;  2WU5 A;  2R4E A;  1JNR A;  4AP3 A;  5CKU A;  2VQB A;  2Y6R A;  5JCM A;  1JRZ A;  2H88 A;  3UKK A;  1NHQ A;  3CPI G;  1S3E A;  5J60 A;  2WDQ A;  4BUR A;  2GH5 A;  4H4T A;  3NN0 X;  3UOZ A;  2XFO A;  4NTC A;  2BCP A;  3LZW A;  1ZY8 A;  3AYL A;  4OPC A;  1KSS A;  3CNS A;  5J7X A;  3V3O A;  2NVK X;  4TM4 A;  3ALM A;  4YKF A;  4EQX A;  2X3N A;  4AT0 A;  2OLN A;  2XLP A;  2YVG A;  3NK2 X;  5JCK A;  1BKW A;  1H86 A;  1VDC A;  1RSG A;  4JNQ A;  1P2E A;  1GT8 A;  2AAQ A;  3Q9T A;  3SGL A;  2V5Z A;  1LPF A;  3KKJ A;  2FJA A;  3NT6 A;  1NHP A;  2F5Z A;  4LA1 A;  4DNA A;  4J34 A;  3UKL A;  1VG0 A;  1ZX9 A;  3F8R A;  2VRL A;  2WOW A;  2X8C A;  1YY5 A;  4TLX A;  2GQF A;  1FL2 A;  1LQU A;  5EOW A;  4C74 A;  3COX A;  4D03 A;  3AEG A;  3Q6J A;  2A89 A;  2B76 A;  2EQ7 A;  3FBS A;  4ZCD A;  3S5W A;  2YG5 A;  3S61 A;  4KX6 A;  1E1L A;  2JKC A;  3P4R A;  3GRS A;  1QLB A;  2CDU A;  4P9S A;  3V76 A;  4XWZ A;  1PN0 A;  2WES A;  3M12 A;  3P1W A;  3DJE A;  3AWI A;  3AEC A;  3ALL A;  2GEW A;  2XYO A;  2WOV A;  3LOV A;  4K22 A;  1XDI A;  4YXD A;  3DH9 A;  4YWO A;  3LXD A;  1ZMD A;  4RSL A;  1NAA A;  1MXT A;  4EM4 A;  3KA7 A;  1GET A;  4C3Y A;  1CF3 A;  3GYI A;  2XFP A;  2BS3 A;  2C73 A;  1TRB A;  1CHU A;  3CGD A;  1TDK A;  4IVM B;  5GSN A;  2Q7V A;  4OPG A;  2Q0K A;  3UOX A;  1GND A;  5KRQ A;  3AE2 A;  5M10 A;  4I59 A;  3SFD A;  2YG7 A;  2B9X A;  2UZZ A;  1N4U A;  3BHF A;  2QA1 A;  2CVJ A;  3DJD A;  4H7U A;  3BI5 A;  3RP8 A;  4GUV A;  2XFQ A;  3E1T A;  2YR4 A;  5KVH A;  3ATR A;  1JRY A;  4C77 A;  4ECH A;  3KLJ A;  2WP6 A;  2WBA A;  3ISH A;  4JY2 A;  4WCT A;  3CN8 A;  2WPE A;  2GMJ A;  1GAL A;  1OJD A;  2WHD A;  3AE9 A;  3PO7 A;  3QJ4 A;  2ACZ A;  3O0H A;  3AEF A;  1O5W A;  3CPH G;  3KU9 A;  4OCG A;  4CBQ A;  2YWL A;  2V3A A;  4U8L A;  2OA1 A;  3FMW A;  3K7Q X;  2W0H A;  4YTN A;  1GRF A;  4TM1 A;  2R46 A;  4U8P A;  4GDP A;  4U8N A;  4A9W A;  1S3B A;  4K2X A;  4J2W A;  2YLW A;  1MOK A;  1Y56 B;  4YTP A;  4K5S A;  1PHH A;  2E1M A;  2XFN A;  4BJZ A;  3AEA A;  3JSK A;  1DJN A;  1VQW A;  2YLS A;  1XPQ A;  3ABV A;  2GR3 A;  1IUS A;  2R4J A;  4REK A;  1TDN A;  3NKS A;  1ZOV A;  3AB1 A;  3ZDN A;  4CY8 A;  5C3J A;  3DK8 A;  2B9W A;  4ADW A;  4GDE A;  3UTE A;  5CQF A;  2I0Z A;  3GMC A;  3P4P A;  1LTX R;  2WP5 A;  4BV6 A;  3DJG X;  5U1O A;  2C7G A;  4YT0 A;  2ZZB A;  4H50 A;  1BF3 A;  3D8X A;  3IWA A;  1E1K A;  1L9E A;  5TR3 A;  3K30 A;  4I58 A;  2EQ9 A;  4RG4 A;  4Z2R A;  5KOX A;  1Z6L A;  3SM8 A;  1H82 A;  2FJB A;  1SEZ A;  4J33 A;  4H4W A;  1DOD A;  1H7X A;  1DNC A;  2X99 A;  3UKF A;  2X50 A;  4CCQ A;  1FEB A;  2XVH A;  4JY3 A;  2YVF A;  4H4V A;  3VRD B;  2Y6Q A;  1K0I A;  5IPY A;  3L8K A;  1ZK7 A;  4M52 A;  3B3R A;  1XHC A;  2BC0 A;  3NN6 X;  1DOC A;  1PXC A;  2VQ7 A;  3AD7 B;  3ITJ A;  3VRB A;  2AR8 A;  2AQJ A;  4DSH A;  3V3N A;  5U63 A;  1PBF A;  4U8K A;  1PXB A;  2Z5Y A;  3VQR A;  2DKI A;  1JRX A;  1GRT A;  2B9Y A;  1CL0 A;  1REO A;  4Z2U A;  4OVI A;  3UCL A;  1UKV G;  2J3N A;  4TM3 A;  4EIQ A;  1ZKQ A;  5FS7 A;  4FX9 A;  4APN A;  1KFY A;  4A5L A;  3RHA A;  1PDH A;  3AE1 A;  5DBJ A;  4H4Q A;  3HZL A;  3AYJ A;  2BXR A;  4UP3 A;  1EL7 A;  2ZZ0 A;  4EQR A;  4JN9 A;  1IJH A;  3KVE A;  3FG2 P;  3RP7 A;  3AED A;  2QCU A;  4JQ9 A;  2GVC A;  5BUK A;  1GPE A;  1LQT A;  1LV0 A;  3NHO X;  1DOE A;  3VRA A;  1IUV A;  4IV9 A;  5KOW A;  2H89 A;  1K0J A;  1CJ4 A;  1F8R A;  4X9M A;  1KNR A;  1QO8 A;  4H4S A;  4IA6 A;  4Z26 A;  2V6O A;  2VVL A;  3GYJ A;  3R9U A;  2YR5 A;  4HA6 A;  2BYB A;  3G5S A;  5EBK A;  2Z5X A;  4YSH A;  1VRQ B;  4EQW A;  5U25 A;  2XDO A;  2EQ6 A;  3P9U A;  4TLZ A;  3CNJ A;  5KWF A;  2BA9 A;  3M0O A;  3QFB A;  1D7L A;  3SQP A;  2BS2 A;  1QJD A;  3ICS A;  1KF6 A;  1MO9 A;  3EAO A;  3VR8 A;  4B63 A;  4OPU A;  2VVL G;  2QA2 A;  3URH A;  2GF3 A;  3C4A A;  2R9Z A;  4A65 A;  5JCL A;  1N4V A;  2JBV A;  2NPX A;  4USQ A;  2RGJ A;  4K8D A;  4XXG A;  4E0V A;  2C72 A;  1O94 A;  1B8S A;  3OC4 A;  2XVJ A;  3BNM A;  1V59 A;  5JCI A;  5M0Z A;  1IUU A;  1YQ3 A;  1ZMC A;  3IHM A;  2DKH A;  3AD9 B;  3RNM A;  3AEE A;  2YQU A;  2WP9 A;  1F8S A;  2YG6 A;  3AE8 A;  1GER A;  1CBO A;  3LAD A;  4C3X A;  2C3C A;  2TMD A;  4EQS A;  2C66 A;  2C65 A;  1ZOY A;  3NYC A;  4U8O A;  3AE5 A;  1D5T A;  5HXI A;  4X4J A;  2GQW A;  1K0L A;  1DXL A;  2WDR A;  3LZX A;  2IVD A;  2JB1 A;  5HY5 A;  4Z25 A;  3QVP A;  4K5R A;  3EPT A;  2BCG G;  1H6V A;  4NEW A;  2GMH A;  4XWR A;  1GRG A;  1FOH A;  1Q1W A;  4EM3 A;  4H2N A;  1GES A;  4U8J A;  1OJT A;  2GR2 A;  3CIR A;  3CND A;  1HYU A;  4H4X A;  1TDE A;  4H4P A;  4B66 A;  2RGO A;  4B1B A;  2ZBW A;  4AT2 A;  3II4 A;  4WX1 A;  4A79 A;  4RG3 A;  4B65 A;  1B5Q A;  4UDR A;  5ER0 A;  1EBD A;  1ELI A;  1EL8 A;  4OPT A;  4YKG A;  4NEV A;  4A99 A;  2XVE A;  4DSG A;  2BAC A;  2WS3 A;  2JB2 A;  1TYT A;  2VZ2 A;  1L9C A;  1B37 A;  4EMW A;  1H7W A;  3IC9 A;  1KDG A;  2XLR A;  4Y4N A;  2BK5 A;  2X8H A;  3H8I A;  4BK3 A;  3DGZ A;  3ZYX A;  3NRN A;  1GOS A;  3F8P A;  1NHR A;  2ZZC A;  3LJP A;  4H4U A;  4AP1 A;  1BZL A;  4FK1 A;  4OPD A;  3CGE A;  2C64 A;  5EB4 A;  3DGH A;  1JEH A;  1YQ4 A;  1FEC A;  3G5Q A;  4O5Q A;  1D7Y A;  1M6I A;  1COY A;  1TYP A;  3NTA A;  2JK6 A;  4J31 A;  5IQ4 A;  4OPI A;  5BUL A;  4Z2T A;  3ALJ A;  3GWF A;  4U2L A;  3H4K A;  3LB8 A;  5BRT A;  3EF6 A;  1OJA A;  4H4R A;  3UOY A;  3BNU A;  3T37 A;  2R0G A;  4K7Z A;  1AOG A;  2R45 A;  5EB5 A;  4ZN0 A;  3QSS A;  1IUX A;  1GRH A;  1Y0P A;  4Z44 A;  1GV4 A;  1NPX A;  1E6E A;  1JOA A;  2GR0 A;  3GDP A;  2YLX A;  3OZ2 A;  2RAB A;  2YAU A;  2Q6U A;  2A8X A;  2WEU A;  4UDQ A;  4EMJ A;  1LJ1 A;  4AOS A;  2GV8 A;  2O9Z A;  4U8M A;  1FCD A;  4YSX A;  1RP0 A;  5IQ1 A;  3NK1 X;  4LII A;  1PBC A;  2XLT A;  4U2T A;  1Y56 A;  4GRT A;  1XAN A;  2Q0L A;  3NNE A;  2YG4 A;  1CC4 A;  1M64 A;  5HHF A;  2C67 A;  5GRT A;  2GB0 A;  1Q1R A;  1N4W A;  2X8G A;  3P4S A;  1X31 B;  3BI2 A;  4BK1 A;  3AD8 B;  5FMH A;  3DK4 A;  1IUW A;  2OLO A;  3GMB A;  4USR A;  3UKQ A;  3AE7 A;  4GF7 A;  1GTE A;  3FIM B;  4YSY A;  1ZDL A;  1O95 A;  1NDA A;  1CJ2 A;  2E4G A;  4NTE A;  1VG9 A;  4Y4L A;  3NG7 X;  3P4Q A;  2C76 A;  1D4E A;  3IHG A;  1L0V A;  2YLR A;  4PAA A;  3CNP A;  1TDF A;  5JCN A;  4IVO B;  2GAG B;  4ZCC A;  3GD3 A;  1S2Y A;  3K7T A;  1JNZ A;  1IUT A;  2VVM A;  4U2S A;  4NTD A;  3NIX A;  1CC6 A;  1W4X A;  1P2H A;  2WPC A;  2IID A;  1PBB A;  3AEB A;  3KPF A;  1N1P A;  2C75 A;  3H8L A;  4O5U A;  1PJ6 A;  2ARD A;  3DME A;  3GD4 A;  2JB3 A;  4CNK A;  1NG3 A;  1S2Q A;  1GRA A;  3GRT A;  4N9X A;  1PJ7 A;  4FDC B;  2VRM A;  2BK3 A;  3AE6 A;  4EMI A;  3G5R A;  3GSI A;  4ICY A;  4PAB A;  2BS4 A;  1NEK A;  2TPR A;  3NYF A;  1GSN A;  5C2T A;  5BVA A;  1GXF A;  2B7S A;  2GAH B;  3UTF A;  2WQY A;  2WOI A;  1B4V A;  4C5O A;  1FEA A;  4B67 A;  3AE4 A;  3QSM A;  1H84 A;  2YM1 A;  2BAB A;  2VOU A;  1LVL A;  1ZP0 A;  2XCG A;  5FS9 A;  1DOB A;  4YTM A;  4A6N B;  3ICR A;  1PBD A;  4CRT A;  3UKH A;  4UDP A;  2QAE A;  1H81 A;  2XVI A;  3I6D A;  1NG4 A;  2BK4 A;  2YLT A;  2CFY A;  2YR6 A;  3BHK A;  2B7R A;  1ONF A;  3DA1 A;  3L1R A;  2WET A;  4DGK A;  3SFE A;  2XLS A;  2XVF A;  1GRE A;  3FPZ A;  3NK0 X;  4H4Y A;  4LU6 A;  4BJY A;  1H83 A;  1NEN A;  4J36 A;  4TM0 A;  4B64 A;  1EL5 A;  3CGC A;  1GRB A;  1JU2 A;  2OAL A;  2APG A;  2XFU A;  3I3L A;  4JNA A;  5LV9 A;  4Z43 A;  2PHH A;  3UKA A;  4GR1 A;  2OAM A;  2HQM A;  1OJ9 A;  2WDV A;  4MJW A;  4YSZ A;  3KD9 A;  4A7A A;  4H4Z A;  2R0P A;  3GWD A;  3C96 A;  1PS9 A;  3B6D A;  3ATQ A;  4CCR A;  3GDN A;  3NTD A;  4OPL A;  3EAN A;  4U8I A;  5HYM A;  1D4D A;  3UP5 A;  3D1C A;  2RGH A;  3WE0 A;  2WU2 A;  4BK2 A;  1EL9 A;  3AXB A;  1YQZ A;  2YG3 A;  3NLC A;  1L9D A;  2BXS A;  4J56 A;  1E7P A;  4Y4M A;  2PYX A;  3NYE A;  3CTY A;  3M13 A;  1F6M A;  1KNP A;  2BC1 A;  1PBE A;  2JAE A;  1F3P A;  3AYI A;  1Q9I A;  4AOX A;  2C3D A;  4H2Q A;  3UTG A;  1GTH A;  5KXJ A; 
#chains in the Genus database with same CATH topology
 2FJE A;  2GRT A;  3RP6 A;  4IP5 A;  1PJ5 A;  4FK1 C;  4Z24 A;  2OZ8 A;  2C70 A;  2FJD A;  5FS8 A;  3AE3 A;  1E1M A;  2E5V A;  3SN1 A;  5FS6 A;  3PS9 A;  4J57 A;  1CJ3 A;  2OZ3 A;  3ICT A;  3ADA B;  5KVI A;  3HRD C;  1DJQ A;  2FBW A;  3T8Q A;  3DJJ A;  3PVC A;  3SN4 A;  1JNR A;  3ES8 A;  5CKU A;  2Y6R A;  4K8G A;  4H4T A;  4NTC A;  3CNS A;  5J7X A;  4IP4 A;  3T9P A;  3ALM A;  5JCK A;  1H86 A;  1VDC A;  4JNQ A;  2AL2 B;  3SGL A;  3HYW A;  3NT6 A;  4GAP A;  4J34 A;  3UKL A;  1VG0 A;  1ONE A;  1YY5 A;  5EOW A;  3COX A;  2A89 A;  2B76 A;  4ZCD A;  4KX6 A;  3DG7 A;  4P9S A;  1PN0 A;  3P1W A;  3M12 A;  3SJN A;  1XDI A;  1ZMD A;  4EWJ A;  1NAA A;  1GET A;  4HNC A;  1CF3 A;  1TRB A;  2PPG A;  5GSN A;  3UOX A;  5KRQ A;  1P43 A;  3AE2 A;  3SFD A;  2ONE A;  2QVH A;  3ZLH A;  3HW2 A;  3BHF A;  4H7U A;  2YR4 A;  5KVH A;  2WP6 A;  2QJN A;  4WCT A;  3CN8 A;  4A6G A;  1GAL A;  2WHD A;  3AE9 A;  3CPH G;  3PG6 A;  3SXI A;  3ZVI A;  3FMW A;  1GRF A;  3I4K A;  2YLW A;  1MOK A;  3UJ2 A;  1DJN A;  1VQW A;  4REK A;  3DK8 A;  2PS2 A;  2I0Z A;  3GMC A;  1JRP A;  4H83 A;  2WP5 A;  3MSY A;  5U1O A;  2ZZB A;  3D8X A;  3IWA A;  1L9E A;  5TR3 A;  3QPE A;  4RG4 A;  1Z6L A;  3SM8 A;  2FJB A;  4J1O A;  4H4W A;  1H7X A;  1DNC A;  2AKZ A;  1FEB A;  4JY3 A;  2YVF A;  3PK7 A;  4NWZ A;  3IJQ A;  4M52 A;  3B3R A;  3IJL A;  2BC0 A;  4GGB A;  2VQ7 A;  3HPF A;  4DSH A;  4U8K A;  3N6J A;  1CL0 A;  2XH4 A;  1ZKQ A;  5FS7 A;  4FX9 A;  3UCD A;  4A5L A;  3AYJ A;  3RP7 A;  3KVE A;  2GVC A;  1LQT A;  1DOE A;  1K0J A;  1EC7 A;  4IA6 A;  2V6O A;  2BYB A;  5EBK A;  2Z5X A;  5U25 A;  2XDO A;  3Q4D A;  3SQP A;  1MRA A;  2BS2 A;  1PDY A;  2XH7 A;  3ICS A;  1MO9 A;  2VVL G;  4E5T A;  3A7R A;  3URH A;  3S5S A;  1KKO A;  2NQL A;  2RGJ A;  3UXL A;  5M0Z A;  2DKH A;  3AD9 B;  3RNM A;  4DXK A;  3AEE A;  2YG6 A;  2PMQ A;  1CBO A;  3UJF A;  2C65 A;  4TVW A;  1ZOY A;  5HXI A;  3T6C A;  4X4J A;  2WDR A;  1DXL A;  3LZX A;  2HXT A;  2PU0 A;  3N4F A;  3DG6 A;  1Q1W A;  3ZLG A;  1OJT A;  2GR2 A;  1HYU A;  4H4X A;  1TKK A;  1R6W A;  4B1B A;  4B65 A;  4UDR A;  2XVE A;  2JB2 A;  2VZ2 A;  3IC9 A;  2FYM A;  3SN0 A;  4BK3 A;  1NHR A;  4H4U A;  4G73 A;  2OFJ A;  4OPD A;  2C64 A;  5EB4 A;  5FJT A;  1JEH A;  3PFR A;  1TYP A;  4MGG A;  4U2L A;  4IHC A;  2ZC8 A;  4H4R A;  1AOG A;  2QGY A;  3JW7 A;  1GV4 A;  5KNL A;  1JOA A;  3GDP A;  2RAB A;  2YAU A;  2WEU A;  1XAN A;  2OG9 A;  3NNE A;  1CC4 A;  2C67 A;  2GB0 A;  3SZF A;  1Q1R A;  3P4S A;  1X31 B;  3BI2 A;  4BK1 A;  4USR A;  3ZVH A;  3AE7 A;  4YSY A;  1ZDL A;  4H1Z A;  1O95 A;  1CJ2 A;  2E4G A;  4Y4L A;  2RDX A;  3NG7 X;  3P4Q A;  2C76 A;  1D4E A;  4HCH A;  3PWI A;  4IVO B;  1JNZ A;  2IID A;  3T4W A;  4HYR A;  1PBB A;  3AEB A;  1N1P A;  2C75 A;  3GD4 A;  1JPM A;  4PAB A;  4ENL A;  3H70 A;  4IL0 A;  3QKE A;  2BS4 A;  1GSN A;  1GXF A;  2GAH B;  3MQT A;  3AE4 A;  1H84 A;  2BAB A;  3NFU A;  2XH2 A;  1PBD A;  3UKH A;  2CFY A;  3DA1 A;  3L1R A;  3UXK A;  2XLS A;  4HN8 A;  3SFE A;  3FPZ A;  1NEN A;  1EC8 A;  1S7M A;  4GYP A;  2OAL A;  3I3L A;  5LV9 A;  2HQM A;  4A7A A;  4Z1Y A;  3EAN A;  3WE0 A;  3NLC A;  3AXB A;  1YQZ A;  1L9D A;  2BXS A;  1E7P A;  3DGB A;  1WYG A;  1Q9I A;  2C3D A;  3UTG A;  1KN0 A;  4JDR A;  1N63 C;  2GR1 A;  2R0C A;  4D04 A;  4CNJ A;  5L46 A;  2IVE A;  1CC2 A;  1K4Q A;  3K7M X;  2WPF A;  4YWS A;  3IF9 A;  1CJC A;  2V60 A;  2CUL A;  1KSU A;  4HB9 A;  4H2R A;  3BJS A;  3RR1 A;  1E1N A;  1BGJ A;  2YM2 A;  1D4C A;  4DX3 A;  3NXL A;  1NHS A;  3CGB A;  3NGC X;  2YLZ A;  2A87 A;  3UJE A;  5FJR A;  5FJO A;  3RED A;  5JCM A;  2PCE A;  4E4F A;  2H88 A;  2HNE A;  4IZG A;  3V4B A;  1S3E A;  5J60 A;  3NN0 X;  4M0X A;  3UOZ A;  1ZY8 A;  3AYL A;  1KSS A;  3V3O A;  1H2I A;  4EQX A;  2GGG A;  3HYX A;  1BKW A;  3NZG A;  3UGV A;  2OQH A;  1GT8 A;  4IT1 A;  1LPF A;  3KKJ A;  3RRA A;  2FJA A;  1ZX9 A;  2VRL A;  2WOW A;  2C4C A;  1FL2 A;  2PGW A;  4D03 A;  2P8B A;  1W6T A;  3S5W A;  1E1L A;  1QLB A;  3FYY A;  3HYV A;  2WES A;  3AWI A;  5J04 A;  4YXD A;  4C3Y A;  3RCY A;  1TDK A;  2Q7V A;  3NVY B;  2B9X A;  2UZZ A;  2W3S A;  3DJD A;  4HPN A;  3BI5 A;  3RP8 A;  4C77 A;  4ECH A;  1JRY A;  3ETR B;  3KLJ A;  3H12 A;  2WPE A;  2XGZ A;  1R0M A;  3NRZ B;  1JPD X;  2V3A A;  4MMW A;  2OA1 A;  3EEZ A;  4TM1 A;  2R46 A;  4A9W A;  4HCL A;  4M6U A;  4YTP A;  1PHH A;  2XFN A;  3ABV A;  2R4J A;  1ZOV A;  3AB1 A;  4H19 A;  4ADW A;  4GDE A;  5CQF A;  1LTX R;  4BV6 A;  3DJG X;  2XH0 A;  4H50 A;  5KMQ A;  1E1K A;  2EQ9 A;  3PWG A;  1KCZ A;  2X99 A;  4H4V A;  3VRD B;  2Y6Q A;  2PP0 A;  4X2P A;  2PTY A;  3GO2 A;  2GL5 A;  3NN6 X;  1DOC A;  3AD7 B;  3VRB A;  3V3N A;  1PBF A;  7ENL A;  3VQR A;  2DKI A;  3A7U A;  1JRX A;  1GRT A;  1WUF A;  1REO A;  3UCL A;  4TM3 A;  4EIQ A;  1KFY A;  4APN A;  4G74 A;  1EL7 A;  3FG2 P;  4JQ9 A;  5KMP A;  3NHO X;  3VRA A;  1X2G A;  4IV9 A;  1XS2 A;  1QO8 A;  4Z26 A;  2VVL A;  3GYJ A;  3OPS A;  3G5S A;  1VRQ B;  3V3W A;  4TLZ A;  3CNJ A;  3IJI A;  3M0O A;  3ENL A;  1D7L A;  1RVK A;  2QJM A;  2W3R A;  3EAO A;  1N5W C;  2R9Z A;  2JBV A;  3OZY A;  3IK4 A;  4XXG A;  4E0V A;  2C72 A;  1JCT A;  1P48 A;  1SJD A;  3OC4 A;  5JCI A;  1IUU A;  1YQ3 A;  3GYX A;  1KKR A;  3CAW A;  1GER A;  2TMD A;  4EQS A;  3THU A;  4G7F A;  1D5T A;  1GRG A;  2AL1 A;  4DYE A;  4EM3 A;  1BKH A;  4ZA0 A;  3CND A;  1TDE A;  3TCS A;  3CB3 A;  2ZBW A;  3OZM A;  4A79 A;  1EBD A;  4YKG A;  3SZC A;  2OQY A;  4DSG A;  1B37 A;  3R0K A;  3ZVH B;  2BK5 A;  3DGZ A;  3ZYX A;  2ZZC A;  1BZL A;  4FK1 A;  3CGE A;  1IYX A;  4J3Z A;  1D7Y A;  1XPY A;  4II2 A;  3NTA A;  5IQ4 A;  4DN1 A;  4Z2T A;  3GWF A;  5BRT A;  3UOY A;  2R0G A;  4K7Z A;  5EB5 A;  3CYJ A;  3VC6 A;  2AKM A;  3OZ2 A;  4HCD A;  4UDQ A;  1LJ1 A;  4AOS A;  2GV8 A;  3FVD A;  3RIT A;  4LII A;  4U2T A;  2Q0L A;  1M64 A;  3T2Y A;  3KPK A;  3OTR A;  2OLO A;  3GMB A;  3FIM B;  3A7A A;  3OW1 A;  1VG9 A;  3CXB A;  3QTP A;  5JCN A;  2GAG B;  1S2Y A;  1IUT A;  2VVM A;  4NTD A;  2WPC A;  3KPF A;  4O5U A;  2ARD A;  2JB3 A;  1NG3 A;  4GGH A;  4ICY A;  2BK3 A;  3G5R A;  4EMI A;  3NYF A;  5C2T A;  5BVA A;  3B9J B;  2WQY A;  1B4V A;  1FEA A;  1LVL A;  1ZP0 A;  2XCG A;  3ICR A;  4CRT A;  3VC5 A;  4UDP A;  2QAE A;  3FV9 A;  3TWB A;  1NG4 A;  2GSH A;  4E6M A;  4DGK A;  4H4Y A;  3TQP A;  4J36 A;  1JU2 A;  4Z43 A;  3D47 A;  2OAM A;  1OJ9 A;  2WDV A;  4YSZ A;  4ROP A;  1PS9 A;  3B6D A;  3GDN A;  2P0I A;  3UP5 A;  2GGJ A;  4BK2 A;  4MKS A;  3NYE A;  1KNP A;  2BC1 A;  2JAE A;  1F3P A;  4AOX A;  1JDF A;  4ZCW A;  5KXJ A;  4KPR A;  2V61 A;  4B69 A;  4A6N A;  2XLU A;  2OKT A;  2YVJ A;  3UKP A;  3BI4 A;  4CY6 A;  2OVL A;  3N4E A;  4JHM A;  3FXG A;  1YKJ A;  1NEL A;  3CNT A;  2W54 A;  1E39 A;  3NS1 B;  3UOV A;  4H2P A;  3KUM A;  3CPJ G;  1F8W A;  4B68 A;  1WUE A;  1FFU C;  6ENL A;  4X9N A;  3DK9 A;  3T31 A;  4NZH A;  3C4N A;  2EQ8 A;  3NH3 X;  3UTH A;  3STP A;  2WU5 A;  4AP3 A;  2VQB A;  1NHQ A;  3CPI G;  2WDQ A;  4BUR A;  2XFO A;  3RO6 A;  4OPC A;  4YKF A;  2OLN A;  2XLP A;  3NK2 X;  4E4U A;  1RSG A;  3OP2 A;  3Q9T A;  3I6E A;  1BQG A;  3F8R A;  1N61 C;  4C74 A;  3D46 A;  3DEQ A;  3Q6J A;  3TJI A;  3FBS A;  3S61 A;  2JKC A;  3DES A;  3GRS A;  3P4R A;  2CDU A;  3V76 A;  4XWZ A;  1NU5 A;  3AEC A;  3ALL A;  2GEW A;  3U9I A;  2XYO A;  3LOV A;  5G5H B;  4YWO A;  4RSL A;  1MXT A;  4EM4 A;  3MUC A;  2XFP A;  2OO6 A;  2XSX A;  3ES7 A;  3CGD A;  4IVM B;  5M10 A;  2YG7 A;  1FFV C;  2QA1 A;  2CVJ A;  2OPJ A;  4KT2 A;  3E1T A;  3RGT A;  2WBA A;  1OJD A;  3PO7 A;  3QJ4 A;  2ACZ A;  3O0H A;  4OCG A;  4GIS A;  2W0H A;  4YTN A;  3MZN A;  4U8N A;  1S3B A;  1Y56 B;  2GR3 A;  1IUS A;  4CY8 A;  5C3J A;  1TDN A;  3NKS A;  2B9W A;  2PP1 A;  3UTE A;  3P4P A;  3R25 A;  3T0K A;  2P3Z A;  2C7G A;  2PGE A;  1BF3 A;  4I58 A;  5KOX A;  4Z2R A;  3GD6 A;  1H82 A;  4JN7 A;  1DOD A;  3UKF A;  2GDQ A;  2E5A A;  2XVH A;  1FHU A;  3R10 A;  1K0I A;  5IPY A;  3L8K A;  2OX4 A;  4G6H A;  5G5G B;  2AR8 A;  4GIR A;  2Z5Y A;  2GGH A;  4Z2U A;  3VDG A;  2J3N A;  3RHA A;  3AE1 A;  5DBJ A;  3HZL A;  2BXR A;  2QQ6 A;  2ZZ0 A;  4JN9 A;  1IJH A;  1GPE A;  5KOW A;  2H89 A;  4X9M A;  1KNR A;  3R9U A;  2YR5 A;  5KWF A;  2BA9 A;  3QFB A;  5FJU A;  1MDL A;  1QJD A;  4B63 A;  4OPU A;  2DW6 A;  2QA2 A;  2GF3 A;  3C4A A;  4ZOH B;  2PU1 A;  1N4V A;  2POD A;  1O94 A;  2XVJ A;  1V59 A;  2WP9 A;  3AE8 A;  2C66 A;  4U8O A;  3AE5 A;  1ZXI C;  2BRA A;  1K0L A;  2IVD A;  5HY5 A;  3GC2 A;  4Z25 A;  3QVP A;  3EPT A;  1H6V A;  4NEW A;  2GMH A;  1ECQ A;  3R1Z A;  2PSN A;  2RGO A;  5EU9 A;  3DFH A;  3VFC A;  1SJC A;  4A99 A;  3SY4 A;  2BAC A;  1TYT A;  2PTZ A;  1L9C A;  1H7W A;  2XLR A;  4Y4N A;  3H8I A;  3NVW B;  1GOS A;  3AM9 A;  4AP1 A;  5JRB A;  1YQ4 A;  1FEC A;  3EUB 3;  4J31 A;  4OPI A;  5BUL A;  2HZG A;  3ALJ A;  3LB8 A;  3BNU A;  3T37 A;  1N5X A;  3QSS A;  1GRH A;  4Z44 A;  2W55 A;  2Q6U A;  4EMJ A;  2O9Z A;  4U8M A;  4DHG A;  4YSX A;  1RP0 A;  5IQ1 A;  3NK1 X;  4TVY A;  1Y56 A;  4GRT A;  5GRT A;  1MUC A;  2E3T A;  3AD8 B;  3DK4 A;  1IUW A;  3UKQ A;  4GF7 A;  2ZAD A;  4NNJ A;  4NTE A;  1L0V A;  2QDE A;  2FKP A;  4PAA A;  3CNP A;  3K7T A;  1CC6 A;  1P2H A;  3H8L A;  1PJ6 A;  3DME A;  1S2Q A;  1GRA A;  3SSZ A;  3GRT A;  4N9X A;  1PJ7 A;  4FDC B;  2PTW A;  5BOF A;  2B7S A;  3UTF A;  2WOI A;  4G9K A;  4C5O A;  3QSM A;  2YM1 A;  2PP3 A;  2VOU A;  5FS9 A;  4A6N B;  2CHR A;  3I6D A;  1H81 A;  2XVI A;  2YR6 A;  1FIQ B;  2WET A;  4BJY A;  3NK0 X;  1GRE A;  1H83 A;  3L5O A;  4B64 A;  3QN3 A;  3CGC A;  2O56 A;  4GFI A;  2XFU A;  2PHH A;  3UKA A;  1V97 A;  2MUC A;  3KD9 A;  3GWD A;  4E8G A;  3C96 A;  4CCR A;  3ATQ A;  4OPL A;  5HYM A;  1D4D A;  3R0U A;  3I6T A;  2PYX A;  3CTY A;  1F6M A;  1PBE A;  3DFY A;  3AYI A;  3QLD A;  4H2Q A;  1GTH A;  1RM6 B;  3QFA A;  4EIP A;  1RYI A;  1T3Q C;  1STZ A;  4IL2 A;  1BGN A;  1GEU A;  3ZLF A;  1TDO A;  4GCM A;  3QVR A;  4HNL A;  3VR9 A;  3UP4 A;  2MNR A;  1OJC A;  3DG3 A;  1BWC A;  1SB3 B;  2QJJ A;  3F8D A;  4IA5 A;  2V3B A;  2P8C A;  3QSE A;  1MNS A;  1PXA A;  3NO1 A;  3B97 A;  3SQS A;  4DWD A;  2R4E A;  3DDM A;  1JRZ A;  3UKK A;  2GH5 A;  2BCP A;  3LZW A;  2NVK X;  4TM4 A;  4AT0 A;  2X3N A;  2YVG A;  3NVZ B;  3DER A;  1P2E A;  2AAQ A;  2V5Z A;  1N60 C;  1NHP A;  2F5Z A;  4LA1 A;  4DNA A;  2P88 A;  2X8C A;  4TLX A;  1SJB A;  2GQF A;  1LQU A;  5KMR A;  3UCC A;  3CXO A;  3AEG A;  1DTN A;  3NVV B;  2EQ7 A;  2YG5 A;  3DJE A;  3R07 C;  2WOV A;  3H7V A;  1F9C A;  4K22 A;  3DH9 A;  3LXD A;  3AMZ A;  3KA7 A;  3GYI A;  2BS3 A;  2C73 A;  4GME A;  1CHU A;  4GYP C;  4OPG A;  2Q0K A;  1GND A;  3CMM A;  3VA8 A;  1FO4 A;  4I59 A;  3TTE A;  3SR6 B;  1N4U A;  4GUV A;  2XFQ A;  3ATR A;  2AL2 A;  2BRY A;  3ISH A;  4JY2 A;  2GMJ A;  3KU9 A;  3AEF A;  1O5W A;  4CBQ A;  2YWL A;  4U8L A;  3K7Q X;  4U8P A;  4GDP A;  4K2X A;  4J2W A;  4K1W A;  5ENL A;  4G8T A;  4K5S A;  2E1M A;  4BJZ A;  3P3B A;  3AEA A;  3JSK A;  2YLS A;  1XPQ A;  3ZDN A;  4A3R A;  3BSM A;  4KPL A;  3V5C A;  4YT0 A;  3GY1 A;  4JN8 A;  3K30 A;  1KD0 A;  4FP1 A;  1SEZ A;  4J33 A;  2X50 A;  3UJS A;  2I5Q A;  4G6G A;  4CCQ A;  3TW9 A;  1ZK7 A;  3MY9 A;  1XHC A;  1PXC A;  3ITJ A;  2AQJ A;  4A35 A;  4GAV A;  5U63 A;  1PXB A;  2B9Y A;  3T2Z A;  3UJR A;  3P93 A;  4OVI A;  1EBG A;  1UKV G;  3JVA A;  3CK5 A;  2OLA A;  1PDH A;  4H4Q A;  4UP3 A;  4EQR A;  3AED A;  2QCU A;  5BUK A;  1LV0 A;  3N6H A;  1IUV A;  1F8R A;  4KEM A;  4H4S A;  3EKG A;  4HA6 A;  3K1G A;  3Q45 A;  2PTX A;  4YSH A;  4EQW A;  3H8A A;  2EQ6 A;  4F4R A;  3S47 A;  3P9U A;  1L8P A;  1KF6 A;  1SJA A;  3VR8 A;  2POZ A;  3JZU A;  1FHV A;  4A65 A;  5JCL A;  2NPX A;  4USQ A;  4K8D A;  1B8S A;  3BNM A;  1VDV A;  1ZMC A;  3IHM A;  2OZT A;  2YQU A;  1F8S A;  3LAD A;  4C3X A;  2C3C A;  3NYC A;  3TWA A;  2GQW A;  2JB1 A;  5FJP A;  4K5R A;  1PDZ A;  2QDD A;  2BCG G;  4XWR A;  1FOH A;  4H2N A;  1GES A;  4U8J A;  1EC9 A;  3AN1 A;  3CIR A;  4H4P A;  4B66 A;  4FI4 A;  1VQZ A;  4AT2 A;  3II4 A;  4WX1 A;  4RG3 A;  1B5Q A;  3SX6 A;  3SZ0 A;  5ER0 A;  1ELI A;  1EL8 A;  4OPT A;  4NEV A;  2WS3 A;  2DW7 A;  5KMS A;  4EMW A;  1KDG A;  3VCC A;  2X8H A;  3NRN A;  3F8P A;  3LJP A;  1MDR A;  3DGH A;  3MKC A;  3G5Q A;  4O5Q A;  1COY A;  1M6I A;  1YEY A;  4KWS A;  2JK6 A;  3CT2 A;  4II3 A;  3H4K A;  3EF6 A;  1OJA A;  1JRO A;  2R45 A;  4ZN0 A;  1IUX A;  1X2H A;  1Y0P A;  1NPX A;  1E6E A;  2GR0 A;  2YLX A;  2A8X A;  1FCD A;  3VCN A;  2XLT A;  1PBC A;  2YG4 A;  5HHF A;  1N4W A;  2X8G A;  4H2H A;  5FMH A;  1GTE A;  1TZZ A;  1NDA A;  3SBF A;  3IHG A;  5BOE A;  3SYI A;  2YLR A;  3T14 A;  1TDF A;  4ZCC A;  3GD3 A;  4U2S A;  3NIX A;  1W4X A;  3R11 A;  4CNK A;  2VRM A;  3AE6 A;  3GSI A;  1EBH A;  1NEK A;  2TPR A;  3TJ4 A;  3SZW A;  1TE6 A;  2HXU A;  4B67 A;  3T2K A;  3MWC A;  1DOB A;  4YTM A;  3DIP A;  2YLT A;  2BK4 A;  3BHK A;  2B7R A;  1ONF A;  1OEP A;  2XVF A;  4LU6 A;  4TM0 A;  1EL5 A;  1GRB A;  3BOX A;  2PA6 A;  4K2S A;  2APG A;  4JNA A;  3U4F A;  4GR1 A;  3V5F A;  4MJW A;  3FJ4 A;  4Z17 A;  1ELS A;  4H4Z A;  2R0P A;  3P0W A;  3D9X A;  3TOY A;  3NTD A;  4U8I A;  2GGI A;  5IDZ A;  2GGE A;  3D1C A;  2RGH A;  2WU2 A;  1EL9 A;  2YG3 A;  1E9I A;  3FCP A;  4J56 A;  4Y4M A;  3M13 A;  1N62 C;  1CJ4 A; 
#chains in the Genus database with same CATH homology
 4JDR A;  4KPR A;  2V61 A;  4B69 A;  4A6N A;  2XLU A;  2GR1 A;  2R0C A;  2YVJ A;  3UKP A;  2FJE A;  2GRT A;  3BI4 A;  3QFA A;  4CY6 A;  3RP6 A;  1PJ5 A;  4D04 A;  4CNJ A;  4FK1 C;  4EIP A;  5L46 A;  1RYI A;  4Z24 A;  1YKJ A;  1BGN A;  2IVE A;  1CC2 A;  2C70 A;  1GEU A;  1K4Q A;  2FJD A;  3K7M X;  5FS8 A;  1TDO A;  4GCM A;  2WPF A;  3AE3 A;  3CNT A;  1E1M A;  2E5V A;  3IF9 A;  1E39 A;  3QVR A;  1CJC A;  2V60 A;  5FS6 A;  3PS9 A;  4J57 A;  2CUL A;  1KSU A;  1CJ3 A;  4HB9 A;  3UP4 A;  1OJC A;  4H2R A;  3UOV A;  3VR9 A;  4H2P A;  1BWC A;  1E1N A;  1BGJ A;  3CPJ G;  2YM2 A;  1D4C A;  3ICT A;  1NHS A;  3CGB A;  3F8D A;  1F8W A;  4IA5 A;  3ADA B;  3NGC X;  2V3B A;  4B68 A;  5KVI A;  2YLZ A;  2A87 A;  3QSE A;  1DJQ A;  4X9N A;  1PXA A;  2FBW A;  3DK9 A;  3T31 A;  4NZH A;  3DJJ A;  3C4N A;  2EQ8 A;  3NH3 X;  3RED A;  3UTH A;  3PVC A;  2WU5 A;  2R4E A;  1JNR A;  4AP3 A;  5CKU A;  2VQB A;  2Y6R A;  5JCM A;  1JRZ A;  2H88 A;  3UKK A;  1NHQ A;  3CPI G;  1S3E A;  5J60 A;  2WDQ A;  4BUR A;  2GH5 A;  4H4T A;  3NN0 X;  3UOZ A;  2XFO A;  4NTC A;  2BCP A;  3LZW A;  1ZY8 A;  3AYL A;  4OPC A;  1KSS A;  3CNS A;  5J7X A;  3V3O A;  2NVK X;  4TM4 A;  3ALM A;  1H2I A;  4EQX A;  2X3N A;  4YKF A;  2OLN A;  4AT0 A;  2XLP A;  2YVG A;  3NK2 X;  5JCK A;  3HYX A;  1BKW A;  1H86 A;  1VDC A;  1RSG A;  4JNQ A;  1P2E A;  1GT8 A;  2AAQ A;  3Q9T A;  3SGL A;  2V5Z A;  1LPF A;  3KKJ A;  3HYW A;  2FJA A;  3NT6 A;  1NHP A;  2F5Z A;  4LA1 A;  4DNA A;  4GAP A;  4J34 A;  3UKL A;  1VG0 A;  1ZX9 A;  3F8R A;  2VRL A;  2WOW A;  2X8C A;  1YY5 A;  4TLX A;  2GQF A;  2C4C A;  1FL2 A;  1LQU A;  5EOW A;  4C74 A;  5KMR A;  3COX A;  4D03 A;  3AEG A;  3Q6J A;  2A89 A;  2B76 A;  2EQ7 A;  3FBS A;  4ZCD A;  3S5W A;  2YG5 A;  3S61 A;  4KX6 A;  1E1L A;  2JKC A;  3P4R A;  3GRS A;  1QLB A;  2CDU A;  4P9S A;  3HYV A;  3V76 A;  4XWZ A;  1PN0 A;  2WES A;  3M12 A;  3P1W A;  3DJE A;  3AWI A;  3AEC A;  3ALL A;  2GEW A;  2XYO A;  2WOV A;  3LOV A;  4K22 A;  1XDI A;  4YXD A;  3DH9 A;  4YWO A;  3LXD A;  1ZMD A;  4RSL A;  1NAA A;  1MXT A;  4EM4 A;  3KA7 A;  1GET A;  4C3Y A;  1CF3 A;  3GYI A;  2XFP A;  2BS3 A;  2C73 A;  1TRB A;  1CHU A;  3CGD A;  1TDK A;  4IVM B;  5GSN A;  2Q7V A;  4OPG A;  2Q0K A;  3UOX A;  1GND A;  3CMM A;  5KRQ A;  3AE2 A;  5M10 A;  4I59 A;  3SFD A;  2YG7 A;  2B9X A;  2UZZ A;  1N4U A;  3BHF A;  2QA1 A;  2CVJ A;  3DJD A;  4H7U A;  3BI5 A;  3RP8 A;  4GUV A;  2XFQ A;  3E1T A;  2YR4 A;  5KVH A;  3ATR A;  1JRY A;  2BRY A;  4C77 A;  4ECH A;  3KLJ A;  2WP6 A;  2WBA A;  3ISH A;  4JY2 A;  4WCT A;  3CN8 A;  2WPE A;  2GMJ A;  1GAL A;  1OJD A;  2WHD A;  3AE9 A;  3PO7 A;  3QJ4 A;  2ACZ A;  3O0H A;  3AEF A;  1O5W A;  3CPH G;  3PG6 A;  3KU9 A;  4OCG A;  4CBQ A;  3SXI A;  2YWL A;  2V3A A;  4U8L A;  2OA1 A;  3FMW A;  3K7Q X;  2W0H A;  4YTN A;  1GRF A;  4TM1 A;  2R46 A;  4U8P A;  4GDP A;  4U8N A;  4A9W A;  1S3B A;  4K2X A;  4J2W A;  2YLW A;  1MOK A;  1Y56 B;  4YTP A;  4K5S A;  1PHH A;  2E1M A;  2XFN A;  4BJZ A;  3AEA A;  3JSK A;  1DJN A;  1VQW A;  2YLS A;  1XPQ A;  3ABV A;  2GR3 A;  1IUS A;  2R4J A;  4REK A;  1TDN A;  3NKS A;  1ZOV A;  3AB1 A;  3ZDN A;  4CY8 A;  5C3J A;  3DK8 A;  2B9W A;  4ADW A;  4GDE A;  3UTE A;  5CQF A;  2I0Z A;  3GMC A;  3P4P A;  3T0K A;  1LTX R;  2WP5 A;  4BV6 A;  3DJG X;  5U1O A;  2C7G A;  4YT0 A;  2ZZB A;  4H50 A;  1BF3 A;  3D8X A;  3IWA A;  1E1K A;  1L9E A;  5TR3 A;  3K30 A;  4I58 A;  2EQ9 A;  4RG4 A;  4Z2R A;  5KOX A;  1Z6L A;  3SM8 A;  1H82 A;  2FJB A;  1SEZ A;  4J33 A;  4H4W A;  1DOD A;  1H7X A;  1DNC A;  2X99 A;  3UKF A;  2X50 A;  4G6G A;  4CCQ A;  1FEB A;  2XVH A;  4JY3 A;  2YVF A;  4H4V A;  3VRD B;  2Y6Q A;  1K0I A;  5IPY A;  4NWZ A;  3L8K A;  1ZK7 A;  4M52 A;  3B3R A;  1XHC A;  2BC0 A;  3NN6 X;  1DOC A;  4G6H A;  1PXC A;  2VQ7 A;  3AD7 B;  3ITJ A;  3VRB A;  2AR8 A;  2AQJ A;  4GAV A;  4DSH A;  3V3N A;  5U63 A;  1PBF A;  4U8K A;  1PXB A;  2Z5Y A;  3VQR A;  2DKI A;  1JRX A;  1GRT A;  2B9Y A;  1CL0 A;  3T2Z A;  1REO A;  4Z2U A;  4OVI A;  3UCL A;  1UKV G;  2J3N A;  4TM3 A;  4EIQ A;  1ZKQ A;  5FS7 A;  4FX9 A;  4APN A;  1KFY A;  4A5L A;  3RHA A;  1PDH A;  3AE1 A;  5DBJ A;  4H4Q A;  3HZL A;  3AYJ A;  2BXR A;  4UP3 A;  4G74 A;  1EL7 A;  2ZZ0 A;  4EQR A;  4JN9 A;  1IJH A;  3KVE A;  3FG2 P;  3RP7 A;  3AED A;  2QCU A;  4JQ9 A;  2GVC A;  5BUK A;  5KMP A;  1GPE A;  1LQT A;  1LV0 A;  3NHO X;  1DOE A;  3VRA A;  1IUV A;  4IV9 A;  5KOW A;  2H89 A;  1K0J A;  1CJ4 A;  1F8R A;  4X9M A;  1KNR A;  1QO8 A;  4H4S A;  4IA6 A;  4Z26 A;  2V6O A;  2VVL A;  3GYJ A;  3R9U A;  2YR5 A;  4HA6 A;  2BYB A;  3G5S A;  5EBK A;  2Z5X A;  4YSH A;  1VRQ B;  4EQW A;  5U25 A;  2XDO A;  2EQ6 A;  3P9U A;  4TLZ A;  3CNJ A;  5KWF A;  2BA9 A;  3M0O A;  3QFB A;  1D7L A;  3SQP A;  2BS2 A;  1QJD A;  3ICS A;  1KF6 A;  1MO9 A;  3EAO A;  3VR8 A;  4B63 A;  4OPU A;  2VVL G;  2QA2 A;  3URH A;  2GF3 A;  3C4A A;  2R9Z A;  4A65 A;  5JCL A;  1N4V A;  2JBV A;  2NPX A;  4USQ A;  2RGJ A;  4K8D A;  4XXG A;  4E0V A;  2C72 A;  1O94 A;  1B8S A;  3OC4 A;  2XVJ A;  3BNM A;  1V59 A;  5JCI A;  5M0Z A;  1IUU A;  1YQ3 A;  3GYX A;  1ZMC A;  3IHM A;  2DKH A;  3AD9 B;  3RNM A;  3AEE A;  2YQU A;  2WP9 A;  1F8S A;  2YG6 A;  3AE8 A;  1GER A;  1CBO A;  3LAD A;  4C3X A;  2C3C A;  2TMD A;  4EQS A;  2C66 A;  2C65 A;  1ZOY A;  3NYC A;  4U8O A;  3AE5 A;  2BRA A;  1D5T A;  5HXI A;  4X4J A;  2GQW A;  1K0L A;  1DXL A;  2WDR A;  3LZX A;  2IVD A;  2JB1 A;  5HY5 A;  4Z25 A;  3QVP A;  4K5R A;  3EPT A;  2BCG G;  1H6V A;  4NEW A;  2GMH A;  4XWR A;  1GRG A;  1FOH A;  1Q1W A;  4EM3 A;  4H2N A;  1GES A;  4U8J A;  1OJT A;  2GR2 A;  3CIR A;  3CND A;  1HYU A;  4H4X A;  1TDE A;  4H4P A;  4B66 A;  2RGO A;  4B1B A;  2ZBW A;  4AT2 A;  3II4 A;  4WX1 A;  4A79 A;  4RG3 A;  4B65 A;  1B5Q A;  4UDR A;  3SX6 A;  3SZ0 A;  5ER0 A;  1EBD A;  1ELI A;  1EL8 A;  4OPT A;  4YKG A;  3SZC A;  4NEV A;  4A99 A;  2XVE A;  3SY4 A;  4DSG A;  2BAC A;  2WS3 A;  2JB2 A;  1TYT A;  2VZ2 A;  1L9C A;  1B37 A;  5KMS A;  4EMW A;  1H7W A;  3IC9 A;  1KDG A;  2XLR A;  4Y4N A;  2BK5 A;  2X8H A;  3H8I A;  4BK3 A;  3DGZ A;  3ZYX A;  3NRN A;  1GOS A;  3F8P A;  1NHR A;  2ZZC A;  3LJP A;  4H4U A;  5JRB A;  1BZL A;  4G73 A;  4FK1 A;  4AP1 A;  4OPD A;  3CGE A;  2C64 A;  5EB4 A;  3DGH A;  1JEH A;  1YQ4 A;  1FEC A;  3G5Q A;  4O5Q A;  1D7Y A;  1M6I A;  1COY A;  1TYP A;  4II2 A;  3NTA A;  2JK6 A;  4J31 A;  5IQ4 A;  4OPI A;  5BUL A;  4Z2T A;  3ALJ A;  3GWF A;  4II3 A;  4U2L A;  3H4K A;  3LB8 A;  5BRT A;  3EF6 A;  1OJA A;  4H4R A;  3UOY A;  3BNU A;  3T37 A;  2R0G A;  4K7Z A;  1AOG A;  2R45 A;  5EB5 A;  4ZN0 A;  3QSS A;  1IUX A;  1GRH A;  1Y0P A;  4Z44 A;  1GV4 A;  5KNL A;  1NPX A;  1E6E A;  1JOA A;  2GR0 A;  3GDP A;  2YLX A;  3OZ2 A;  2RAB A;  2YAU A;  2Q6U A;  2A8X A;  2WEU A;  4UDQ A;  4EMJ A;  1LJ1 A;  5KMQ A;  2GV8 A;  2O9Z A;  4AOS A;  4U8M A;  1FCD A;  4YSX A;  1RP0 A;  5IQ1 A;  3NK1 X;  4LII A;  1PBC A;  2XLT A;  4U2T A;  1Y56 A;  4GRT A;  1XAN A;  2Q0L A;  3NNE A;  2YG4 A;  1CC4 A;  1M64 A;  5HHF A;  2C67 A;  3KPK A;  3T2Y A;  5GRT A;  2GB0 A;  3SZF A;  1Q1R A;  1N4W A;  2X8G A;  3P4S A;  1X31 B;  3BI2 A;  4BK1 A;  3AD8 B;  5FMH A;  3DK4 A;  1IUW A;  2OLO A;  3GMB A;  4USR A;  3UKQ A;  3AE7 A;  4GF7 A;  1GTE A;  3FIM B;  4YSY A;  1ZDL A;  1O95 A;  1NDA A;  4NNJ A;  1CJ2 A;  2E4G A;  4NTE A;  1VG9 A;  4Y4L A;  3NG7 X;  3P4Q A;  2C76 A;  1D4E A;  3IHG A;  1L0V A;  3SYI A;  2YLR A;  4PAA A;  3T14 A;  3CNP A;  1TDF A;  5JCN A;  4IVO B;  2GAG B;  4ZCC A;  3GD3 A;  1S2Y A;  3K7T A;  1JNZ A;  1IUT A;  2VVM A;  4U2S A;  4NTD A;  3NIX A;  1CC6 A;  1W4X A;  1P2H A;  2WPC A;  2IID A;  1PBB A;  3AEB A;  3KPF A;  1N1P A;  2C75 A;  3H8L A;  4O5U A;  1PJ6 A;  2ARD A;  3DME A;  3GD4 A;  2JB3 A;  4CNK A;  1NG3 A;  1S2Q A;  1GRA A;  3GRT A;  4N9X A;  1PJ7 A;  4FDC B;  2VRM A;  2BK3 A;  3AE6 A;  4EMI A;  3G5R A;  3GSI A;  4ICY A;  4PAB A;  2BS4 A;  1NEK A;  2TPR A;  3NYF A;  1GSN A;  5C2T A;  5BVA A;  1GXF A;  2B7S A;  2GAH B;  3UTF A;  2WQY A;  2WOI A;  3SZW A;  1B4V A;  4G9K A;  4C5O A;  1FEA A;  4B67 A;  3AE4 A;  3QSM A;  3T2K A;  1H84 A;  2YM1 A;  2BAB A;  2VOU A;  1LVL A;  1ZP0 A;  2XCG A;  5FS9 A;  1DOB A;  4YTM A;  4A6N B;  3ICR A;  1PBD A;  4CRT A;  3UKH A;  4UDP A;  2QAE A;  1H81 A;  2XVI A;  3I6D A;  1NG4 A;  2BK4 A;  2YLT A;  2CFY A;  2YR6 A;  3BHK A;  2B7R A;  1ONF A;  3DA1 A;  3L1R A;  2WET A;  4DGK A;  3SFE A;  2XLS A;  2XVF A;  1GRE A;  3FPZ A;  3NK0 X;  4H4Y A;  4LU6 A;  4BJY A;  1H83 A;  1NEN A;  3L5O A;  4J36 A;  4TM0 A;  4B64 A;  1S7M A;  1EL5 A;  3CGC A;  1GRB A;  1JU2 A;  2OAL A;  2APG A;  2XFU A;  3I3L A;  4JNA A;  5LV9 A;  4Z43 A;  2PHH A;  3UKA A;  4GR1 A;  2OAM A;  2HQM A;  1OJ9 A;  2WDV A;  4MJW A;  4YSZ A;  3KD9 A;  4A7A A;  4H4Z A;  2R0P A;  3GWD A;  3C96 A;  1PS9 A;  3B6D A;  3D9X A;  3ATQ A;  3GDN A;  3NTD A;  4OPL A;  4CCR A;  3EAN A;  4U8I A;  5HYM A;  1D4D A;  3UP5 A;  3D1C A;  2RGH A;  3WE0 A;  2WU2 A;  4BK2 A;  1EL9 A;  3AXB A;  1YQZ A;  2YG3 A;  3NLC A;  1L9D A;  2BXS A;  4J56 A;  1E7P A;  4Y4M A;  2PYX A;  3NYE A;  3CTY A;  3M13 A;  1F6M A;  1KNP A;  2BC1 A;  1PBE A;  2JAE A;  1F3P A;  3AYI A;  1Q9I A;  4AOX A;  2C3D A;  4H2Q A;  3UTG A;  1KN0 A;  1GTH A;  5KXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...