3CGDA

Pyridine nucleotide complexes with bacillus anthracis coenzyme a-disulfide reductase: a structural analysis of dual nad(p)h specificity
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
444
structure length
444
Chain Sequence
MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRDKYGIDAKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGAIGLEMAETFVELGKKVRMIERNDHIGTIYDGDMAEYIYKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLVSVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyridine nucleotide-disulfide oxidoreductase, class I
publication title Pyridine Nucleotide Complexes with Bacillus anthracis Coenzyme A-Disulfide Reductase: A Structural Analysis of Dual NAD(P)H Specificity.
pubmed doi rcsb
source organism Bacillus anthracis str.
molecule tags Oxidoreductase
total genus 154
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3cgdA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgdA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgdA02
3RP7A 3IF9A 4B63A 4Z26A 2YVGA 2UZZA 4J56A 4ZN0A 4H4PA 4B67A 3D1CA 1FCDA 3JSKA 4BK2A 4WX1A 5C3JA 2XVJA 2APGA 2BS4A 2YQUA 4A7AA 1XANA 4Z43A 3R9UA 3CGBA 3VRAA 2IIDA 4CBQA 1SEZA 2R4JA 4J2WA 3RP8A 3AYLA 1PJ6A 1ZX9A 3V76A 4CNKA 1ZY8A 3AXBA 1KNPA 3ATQA 4U8LA 4X9MA 2GRTA 1S3BA 4B66A 1JRXA 2X99A 1P2HA 2DKIA 3AEDA 5IQ4A 1PBCA 3BI2A 1Z6LA 4EQWA 1IUUA 4H2PA 4YSZA 1PBFA 1E1LA 5BRTA 2YLTA 2B9YA 1H83A 3L1RA 3GD3A 1EL5A 1ZMCA 1E6EA 1PHHA 3AB1A 3FBSA 4C74A 3QFBA 1NG3A 1D4EA 4YSYA 3AD9B 3CPIG 1DODA 4GUVA 3ALLA 1GV4A 1XHCA 5JCKA 2GV8A 1LQUA 3C4NA 3UP5A 3V3OA 1VQWA 2B9XA 4K8DA 1E1MA 3P4RA 4YT0A 3AD8B 3AEBA 2GQFA 1LVLA 3SFEA 3AE3A 2OAMA 5FMHA 4CNJA 1GESA 3CIRA 4U8OA 1ZK7A 3H8IA 1PDHA 2AR8A 1N4WA 4J33A 3P4PA 3IHMA 5HHFA 2YLZA 2BA9A 3NN0X 1GRGA 2OLOA 3T37A 3AE4A 4BJYA 2CFYA 4GR1A 2XVHA 1KNRA 4OPDA 1ZKQA 4DSGA 2YR6A 3V3NA 1GOSA 3CPHG 2TPRA 2VRMA 1JNRA 4U8JA 4D04A 1ZOYA 2YLWA 4UP3A 1OJAA 1F8WA 5CKUA 1GEUA 5ER0A 2EQ6A 1MO9A 4KX6A 1JOAA 3AYIA 1OJ9A 4ZCDA 2R0CA 3SM8A 4GCMA 3NK0X 3SFDA 4BK1A 4GDPA 4O5QA 3DGZA 3NKSA 2YLXA 5EBKA 4U2LA 3DJGX 3ZDNA 1GRAA 2V6OA 2VRLA 1PXAA 3CGEA 1H81A 4TM1A 4CCQA 3D8XA 3GSIA 3UP4A 3KPFA 3FPZA 2A89A 3QSMA 1YQ3A 2BXSA 3DK4A 5U25A 1TYPA 2YG6A 1NHRA 1FEAA 4BV6A 2C72A 3QFAA 4TM4A 2JB3A 3O0HA 4EIPA 3VRDB 5HXIA 4Z44A 2X50A 3LJPA 3AE1A 4H50A 3AE2A 2JKCA 2Z5XA 1BF3A 5FS6A 4X4JA 4YSXA 2BC0A 1PS9A 2F5ZA 1TRBA 3NRNA 1GXFA 2OLNA 5CQFA 4Z24A 3UOZA 1NPXA 3ICTA 1L9CA 1L9DA 1O95A 1PJ7A 3K30A 1EL8A 2A87A 3M13A 5TR3A 2C75A 4H4ZA 2WEUA 2C66A 3F8DA 3BNMA 1K0LA 1VRQB 3NT6A 3NLCA 1IJHA 3BHFA 1Y56B 2QA2A 5M10A 1B8SA 1FOHA 2R0PA 3ABVA 2HQMA 2WP9A 1DXLA 2V3AA 3OZ2A 3AD7B 5BUKA 5U1OA 3EF6A 1GRHA 4TM0A 2WOIA 1M6IA 4K2XA 2YWLA 3KU9A 2XFNA 3UTGA 2ARDA 4OPTA 4AT0A 1GERA 2BYBA 1RP0A 4JY2A 3RHAA 1NDAA 3NN6X 4NTEA 4OPGA 4B64A 1GSNA 3CNPA 5GSNA 3UKPA 3RNMA 5JCNA 4H2QA 3AYJA 3DA1A 3NGCX 2YM2A 1LTXR 4EMJA 1AOGA 4Z2TA 1HYUA 1YY5A 2XLPA 1KSUA 1YKJA 2BCPA 4A99A 2V5ZA 3ALJA 2EQ8A 4CRTA 5DBJA 4AOXA 2C73A 2JAEA 3PVCA 4A5LA 3RP6A 2GQWA 2X8HA 1CF3A 4EQXA 1XDIA 4M52A 3NIXA 2C7GA 1D4DA 1K4QA 4BJZA 3CNSA 1Q9IA 1Y56A 1N1PA 1H7WA 2B76A 1EL7A 4UDPA 2RGOA 3ICSA 1L9EA 1K0JA 5KVHA 1EL9A 2JK6A 2X3NA 3ITJA 1CC2A 3QSSA 2WP6A 4OCGA 3DH9A 3CGCA 1GTHA 2BABA 3Q9TA 3M12A 2YVJA 4KPRA 3ICRA 4OPLA 2C3DA 2YG5A 4USQA 2A8XA 4FX9A 2FBWA 2PYXA 5JCMA 2VQ7A 2H89A 2YM1A 3QSEA 2XDOA 1B37A 2Q7VA 3L8KA 3H8LA 3QJ4A 2BCGG 5KWFA 4OPIA 1PN0A 1TDFA 1IUSA 3BHKA 4YSHA 1LPFA 2RGJA 2GR3A 4CY8A 1F8RA 3ALMA 3ADAB 1TDKA 2BACA 3GDNA 4DNAA 4J31A 3CTYA 4BK3A 3EANA 1OJDA 3LXDA 2JBVA 4A65A 4NEVA 1D7LA 3B6DA 2XFPA 4JNQA 2XVEA 1Q1WA 2XVFA 4H4WA 2GB0A 2AAQA 5U63A 4H4XA 4YTNA 3AECA 3QVPA 3P4SA 5KOWA 1F6MA 1DOEA 4UDRA 5FS8A 2I0ZA 2R0GA 4FK1C 2X8GA 2RABA 3DK9A 2GMHA 1NEKA 2VVLG 1DNCA 3IWAA 1L0VA 1GETA 3I6DA 4Y4MA 2YR5A 1E1NA 1H6VA 4K5RA 1N4VA 4C77A 2V3BA 4FDCB 5KOXA 2ACZA 3LZXA 1Y0PA 4Y4LA 2CULA 3AE9A 2Q0KA 4J36A 3I3LA 1YQ4A 2XCGA 1QLBA 3CPJG 5J7XA 4A6NB 2J3NA 4Y4NA 3AEFA 2ZBWA 4RG4A 4H2RA 3AE5A 3SGLA 3SQPA 2XLSA 1NAAA 1B4VA 3LZWA 4H2NA 3NYEA 1ONFA 2H88A 1PXBA 3BI4A 2C70A 2R4EA 4AP1A 1IUTA 1RYIA 2GR2A 2B7RA 3GWFA 3AEAA 4RG3A 2GVCA 4U2SA 5HY5A 1ZDLA 3NG7X 1K0IA 4DSHA 2QAEA 3BI5A 1KSSA 4IA6A 2GMJA 2BXRA 4JN9A 1NENA 1TDEA 4YKFA 4YTMA 2X8CA 4U8PA 2FJBA 4JNAA 3S61A 2BS3A 4U8KA 3CNJA 1E1KA 3K7MX 1KDGA 3G5QA 3DGHA 2WOWA 1H84A 1S2QA 4BURA 1BWCA 2V60A 1FEBA 3C4AA 4J34A 4LU6A 1CJCA 1H86A 2QCUA 3G5SA 4U2TA 4NEWA 1CJ3A 1COYA 4B1BA 4O5UA 2CVJA 2C76A 5FS7A 2WDRA 4XXGA 3OC4A 2BC1A 2CDUA 3GDPA 5JCIA 3DMEA 1NG4A 4ICYA 2Q0LA 3UKLA 1REOA 4EIQA 1NHPA 3P4QA 5L46A 4U8MA 1ZMDA 3ATRA 1M64A 1CJ4A 1PBEA 1VG9A 4H4UA 4EM3A 1DOCA 3UKKA 3NYFA 1X31B 2YG3A 1CL0A 1RSGA 3NTAA 5M0ZA 3DK8A 1B5QA 3GYIA 1CHUA 5IPYA 4CCRA 5KRQA 2C65A 3KLJA 1OJTA 3PS9A 1JU2A 2FJDA 4Z25A 3DJJA 2WPCA 3NK2X 1EBDA 1QJDA 1YQZA 2PHHA 2BK3A 3Q6JA 4I59A 1P2EA 1PBBA 4JQ9A 2GR0A 1OJCA 1ELIA 4GDEA 4HB9A 3AEEA 4H4YA 4A79A 3KKJA 4IVOB 5BVAA 3G5RA 4LIIA 1JRZA 1TDOA 1O94A 2VZ2A 3AWIA 2XFQA 1CBOA 2XVIA 4H7UA 3VR8A 2WBAA 3FG2P 1GNDA 2XLTA 3UKFA 4WCTA 3GMCA 1FECA 5GRTA 4ECHA 4I58A 5EB4A 4UDQA 4X9NA 1GTEA 3NNEA 3P1WA 5J60A 2GAHB 4NTCA 4RSLA 3KVEA 1E39A 1Q1RA 4USRA 2XLUA 2ZZBA 4AT2A 1GPEA 4OVIA 1W4XA 2XFUA 3M0OA 4C5OA 3GRSA 4ADWA 1MOKA 1NHQA 1GRFA 1ZOVA 2XLRA 3UTHA 5EB5A 4XWRA 2EQ7A 3LADA 1IUXA 2AQJA 3PO7A 1H82A 2VVLA 1BGJA 3COXA 2QA1A 1JNZA 3EPTA 4EQRA 4PAAA 4AOSA 3H4KA 2YLRA 3K7QX 4FK1A 3UKQA 4AP3A 4APNA 2C3CA 5FS9A 1TDNA 3BNUA 4YXDA 2O9ZA 3B3RA 4D03A 4YKGA 2WDQA 1XPQA 1FL2A 4REKA 1IUWA 1CC6A 2IVEA 2OALA 2R45A 1F8SA 2YLSA 1BKWA 1JRYA 2DKHA 5KXJA 1UKVG 2ZZCA 2XFOA 1KF6A 2W0HA 3VQRA 2E1MA 2R46A 1DOBA 4N9XA 1GREA 2JB1A 3K7TA 4B68A 2E5VA 3UOYA 4TLXA 3UOXA 4JY3A 3P9UA 1DJQA 3HZLA 1JEHA 1VDCA 3GYJA 3GMBA 4J57A 3KA7A 1CJ2A 4LA1A 4H4VA 1VG0A 3DJEA 1GRBA 2WESA 3AE7A 3KD9A 4YTPA 1ZP0A 4IA5A 4H4QA 3NTDA 3UTFA 2GR1A 5EOWA 4DGKA 1V59A 2NVKX 1PJ5A 4TLZA 4U8NA 2YR4A 2GAGB 2WQYA 1LJ1A 2WDVA 1PXCA 4OPCA 4Z2UA 2XYOA 3AE6A 4GF7A 2WOVA 2EQ9A 1LV0A 2FJAA 4ZCCA 3UTEA 2NPXA 2WPEA 1N4UA 3FIMB 1BGNA 4K5SA 1O5WA 2YG4A 1PBDA 3AE8A 1S3EA 4K22A 1QO8A 3CNTA 3REDA 4EMWA 3II4A 3C96A 4C3YA 4Z2RA 3URHA 2Y6RA 3VR9A 4H4TA 3IC9A 2WU5A 1TYTA 2OA1A 1E7PA 2VQBA 4HA6A 4U8IA 3FMWA 3CN8A 4XWZA 2Y6QA 5BULA 4K7ZA 2YG7A 3CNDA 4EQSA 2E4GA 2WHDA 4MJWA 2B9WA 2GF3A 2GEWA 3E1TA 1F3PA 5KVIA 2TMDA 4B69A 4E0VA 4A6NA 3ZYXA 3LB8A 5IQ1A 1D7YA 1S2YA 1BZLA 4H4SA 4H4RA 4IV9A 2Z5YA 3CGDA 2YAUA 3ISHA 3DJDA 3GRTA 2FJEA 4TM3A 1KFYA 1CC4A 2YVFA 4CY6A 3GD4A 3NYCA 2BS2A 2GH5A 3WE0A 2ZZ0A 2RGHA 2BK5A 1D5TA 2V61A 4A9WA 3QVRA 3F8PA 4NTDA 4OPUA 2BK4A 4IVMB 4B65A 2Q6UA 1MXTA 2JB2A 1IUVA 3UKHA 5JCLA 3UOVA 1GALA 4YWOA 3UCLA 3GWDA 1GT8A 2WU2A 2VOUA 4EMIA 4PABA 2WP5A 4C3XA 2IVDA 3UKAA 1LQTA 3IHGA 2VVMA 2WETA 3NHOX 3AEGA 2R9ZA 1D4CA 2C64A 3LOVA 1H7XA 4GRTA 2WS3A 3NH3X 4P9SA 3S5WA 5LV9A 1DJNA 4EM4A 4JDRA 2B7SA 3NK1X 5HYMA 1NHSA 2WPFA 4NZHA 3F8RA 3EAOA 1GRTA 5C2TA 2C67A 3VRBA
chains in the Genus database with same CATH superfamily
3NVYB 3QN3A 4ZN0A 4ZA0A 4BK2A 2PTZA 5C3JA 4Z43A 4CBQA 1SEZA 1WYGA 3RP8A 3AYLA 4U8LA 1ZXIC 2GRTA 1S3BA 4B66A 4X2PA 1Z6LA 4MGGA 1IUUA 1EC8A 3GD3A 2NQLA 1KD0A 1D4EA 4GUVA 2GGGA 1GV4A 1XHCA 1ONEA 3UP5A 4KT2A 3P4RA 2OZ8A 3H8IA 1PDHA 1MDRA 3UJRA 1FIQB 2BA9A 1GRGA 4BJYA 2XVHA 1KNRA 1ZKQA 1BKHA 1KKRA 1GOSA 1JNRA 2P0IA 4H83A 5ER0A 2EQ6A 2R0CA 3SM8A 3SFDA 1EC7A 3DGZA 4G6GA 3N6HA 3DJGX 2V6OA 1PXAA 3B97A 1YQ3A 2BXSA 3IJQA 1FEAA 3IJLA 2C72A 4EIPA 4GAVA 4JN7A 1VQZA 1JPDX 2X50A 2JKCA 2Z5XA 1TRBA 1PS9A 4Z24A 5CQFA 2OLNA 1L9DA 1O95A 2A87A 2DW6A 3U4FA 3NLCA 5M10A 3EF6A 3SR6B 4TM0A 1M6IA 2YWLA 3UJFA 1GERA 2BYBA 3OPSA 1RP0A 3RHAA 4OPGA 3NN6X 4B64A 3RGTA 1GSNA 3MZNA 3RNMA 3T2KA 2YM2A 3UGVA 4Z2TA 1AOGA 1YY5A 2XLPA 1KSUA 1JROA 4A99A 1KN0A 2EQ8A 4AOXA 3RP6A 2PGEA 3ZVHB 1CF3A 1XDIA 3HRDC 4M52A 1Q9IA 1Y56A 1H7WA 4UDPA 1L9EA 3IJIA 2JK6A 1GTHA 3CGCA 4D04A 4KPRA 2YG5A 2PYXA 2YM1A 3QSEA 2XDOA 1B37A 3TQPA 3H8LA 3QJ4A 2BCGG 4NNJA 3DFHA 1TDFA 1IUSA 3BHKA 4K2SA 2GR3A 1F8RA 3ALMA 3NXLA 2BACA 2P88A 3LXDA 3ETRB 1D7LA 2XVFA 3IK4A 3GYXA 2AAQA 4H4XA 2R0GA 3N6JA 3SX6A 4G8TA 2YR5A 2OKTA 1E1NA 4ZCWA 3A7RA 2ACZA 3LZXA 1ECQA 2CULA 4J36A 3I3LA 2XCGA 3SYIA 3AE5A 2PP3A 3NYEA 1PXBA 1RYIA 2GR2A 2PGWA 2XGZA 4GAPA 1K0IA 2QAEA 2GMJA 4YTMA 4JNAA 3CNJA 3K7MX 3ZLHA 2V60A 1CJCA 2PTYA 3FYYA 2PODA 1CJ3A 4B1BA 4O5UA 2C76A 2WDRA 3T0KA 3RRAA 3DMEA 4ICYA 3UKLA 1REOA 1SJAA 2PP0A 1VG9A 4H4UA 4EM3A 1X31B 1CL0A 2OG9A 5KRQA 1BQGA 2C65A 4Z25A 4I59A 1P2EA 4FP1A 2GR0A 1OJCA 4IL0A 4GDEA 5BVAA 3KKJA 4IVOB 1TDOA 1O94A 2VZ2A 3AWIA 2XVIA 3VR8A 3FG2P 3GMCA 4ECHA 5EB4A 4UDQA 4RSLA 4USRA 2GDQA 2ZZBA 7ENLA 2XFUA 3HW2A 4C5OA 4ADWA 4M0XA 2XLRA 2W3SA 3MUCA 4XWRA 4AOSA 2YLRA 4FK1A 2C3CA 1NELA 3B3RA 3ZVHA 1FL2A 2IVEA 3AN1A 2OALA 2R45A 1F8SA 3RO6A 2YLSA 1BKWA 3SZCA 1OEPA 1GREA 2E5AA 2JB1A 1TZZA 2QDDA 1DJQA 1JEHA 1X2GA 3KA7A 4LA1A 3DJEA 3KD9A 4TLZA 2NVKX 1PJ5A 1PXCA 2XYOA 2WOVA 2EQ9A 2NPXA 2QVHA 3FIMB 1BGNA 2YG4A 3AE8A 1QO8A 3C96A 3II4A 2Y6RA 1TYTA 2OA1A 4U8IA 4HA6A 4EWJA 3FMWA 4XWZA 4K7ZA 4EQSA 4MJWA 5KVIA 4GIRA 4E4UA 1R0MA 3ZYXA 3LB8A 1BZLA 2OZ3A 4IV9A 5KMPA 2YAUA 2YVFA 4CY6A 3WE0A 3VC6A 1D5TA 4OPUA 2BK4A 4B65A 1E9IA 1FHVA 3I6EA 4HNCA 1LQTA 2VVMA 3LOVA 1H7XA 3NH3X 3DEQA 3TJIA 3F8RA 5C2TA 3KPKA 4B63A 1SJCA 4M6UA 2APGA 2YQUA 3R9UA 3VRAA 1SB3B 4GMEA 2R4JA 3V76A 3AXBA 3ATQA 1JRXA 2X99A 1P2HA 3AEDA 1N5WC 4H2PA 1PBFA 1JPMA 1PHHA 4C74A 3CPIG 3NS1B 1DODA 3ALLA 5JCKA 3OW1A 3STPA 3UXLA 1VQWA 3HYXA 3AD8B 2OFJA 5FMHA 3MQTA 1N4WA 2MNRA 3DFYA 5HHFA 2YLZA 3T37A 4DSGA 2FYMA 2TPRA 2XH0A 5KNLA 2YLWA 3DG6A 5CKUA 1XS2A 1MO9A 4KX6A 4E4FA 3NK0X 4BK1A 3NKSA 4CCQA 1GRAA 2VRLA 4TM1A 3GSIA 3UP4A 2A89A 4GYPA 2PU0A 4BV6A 2JB3A 3D47A 3I4KA 3VRDB 3Q45A 3LJPA 2AL1A 1BF3A 2BC0A 1GXFA 3UOZA 1L9CA 1PJ7A 2C75A 2WEUA 2C66A 1K0LA 3NT6A 1Y56B 1B8SA 2R0PA 2WP9A 3OZ2A 5BUKA 3L5OA 5U1OA 1GRHA 4Z1YA 2PTXA 4H1ZA 2XFNA 3UTGA 1NDAA 4NTEA 5FJUA 5GSNA 3DA1A 1LTXR 3FCPA 4CRTA 4A5LA 3NRZB 3PWGA 2X8HA 3P3BA 3CXOA 1K4QA 1XPYA 3CNSA 2W54A 1N1PA 3V3WA 1EL7A 3ES7A 3BSMA 3DG7A 1K0JA 1EL9A 3ITJA 1CC2A 3QSSA 3Q9TA 3R25A 2YVJA 4USQA 2MUCA 2C3DA 2H89A 2Q7VA 4OPIA 2GGEA 4E5TA 1LPFA 2RGJA 3ADAB 3VCNA 3VCCA 4BK3A 1OJDA 3DGBA 4KWSA 5U63A 4YTNA 5KOWA 3SN0A 1F6MA 1DOEA 4FI4A 2RABA 3N4EA 1GETA 3ZLFA 3I6DA 4K5RA 4FDCB 4IP4A 1Y0PA 3CPJG 4Y4NA 3SZ0A 4ROPA 4H2NA 1N61C 3V4BA 5BOFA 2C70A 3DG3A 3T9PA 1IUTA 4AP1A 2GVCA 4U2SA 5HY5A 4DSHA 4IA6A 1KSSA 4JHMA 4DN1A 2BXRA 1NENA 1P43A 3S61A 1KDGA 3DGHA 2WOWA 1S2QA 1BWCA 1FEBA 3C4AA 2QCUA 4U2TA 1COYA 1T3QC 2CVJA 3GDPA 5JCIA 1NG4A 2Q0LA 3DESA 1NHPA 2XH2A 1ZMDA 3ATRA 3UKKA 1SJDA 3NYFA 2YG3A 2P3ZA 1CHUA 4CCRA 1JU2A 2FJDA 3NK2X 1EBDA 1QJDA 2PHHA 2BK3A 3Q6JA 3A7UA 4JQ9A 1ELSA 4HB9A 3AEEA 4LIIA 5FJTA 2C4CA 1CBOA 1GNDA 3UKFA 4I58A 2GGIA 1GTEA 2BRAA 3KVEA 1Q1RA 4A35A 3CYJA 1W4XA 3R0KA 3GRSA 1MOKA 3UTHA 2EQ7A 2AQJA 5ENLA 2VVLA 1BGJA 1JNZA 3EPTA 3H4KA 3ES8A 4HYRA 1TDNA 5FS9A 3CT2A 3HYVA 3KUMA 2OO6A 2OX4A 3FJ4A 1JRYA 5KXJA 1UKVG 2ZZCA 2W0HA 3VQRA 2R46A 3SJNA 4B68A 3SXIA 3P9UA 1N5XA 4H4VA 1IYXA 2WESA 3AE7A 4IT1A 3UTFA 4H4QA 3DERA 2YR4A 3H70A 1EC9A 2GAGB 2WDVA 4OPCA 2P8CA 3AE6A 1LV0A 2FJAA 3GD6A 1O5WA 1S3EA 4C3YA 4EMWA 3QLDA 4Z2RA 3URHA 3VR9A 4H4TA 3IC9A 3GY1A 2Y6QA 5BULA 3CNDA 1KCZA 2WHDA 2GEWA 2TMDA 4E0VA 1KKOA 4HNLA 2Z5YA 4TVWA 1TE6A 1CC4A 3TJ4A 2OQHA 2HXTA 4A9WA 2CHRA 2Q6UA 3UKHA 3TW9A 3T31A 1P48A 2WU2A 4PABA 2WETA 3FV9A 4II2A 3AEGA 4G9KA 2R9ZA 4DWDA 1D4CA 2WS3A 4P9SA 3B9JB 4EM4A 3NK1X 1VDVA 3MSYA 3EAOA 2QDEA 3RP7A 3H7VA 2YVGA 2UZZA 4J56A 2QGYA 4H4PA 4WX1A 2BS4A 2QQ6A 4A7AA 2PA6A 2IIDA 2PMQA 1ZX9A 4CNKA 1ZY8A 1KNPA 4X9MA 2DKIA 5IQ4A 1PBCA 5KMQA 1E1LA 5BRTA 3L1RA 3FBSA 1EL5A 1E6EA 3NVWB 4YSYA 2QJJA 3AD9B 3T14A 3C4NA 2ZC8A 1LQUA 2XH7A 1E1MA 4YT0A 4HCLA 4G6HA 3SFEA 3AE3A 2OAMA 4CNJA 3CIRA 1ZK7A 2AR8A 3I6TA 3JVAA 4J33A 3P4PA 3DDMA 3R0UA 3SY4A 4OPDA 2YR6A 3QPEA 3MKCA 4HN8A 1OJAA 1F8WA 3T8QA 5KMSA 1GEUA 5JRBA 5FJPA 3AYIA 1OJ9A 4G74A 4ZCDA 4G73A 2OZTA 4GDPA 4O5QA 2YLXA 3GC2A 5EBKA 4U2LA 3ZDNA 4IP5A 3KPFA 3FPZA 3QSMA 5U25A 1F9CA 1NHRA 4GISA 3OTRA 4HCHA 3QFAA 4H19A 1PDZA 5HXIA 3PWIA 3AE1A 4H50A 4ENLA 4X4JA 4YSXA 5FS6A 3NRNA 1RVKA 3RCYA 1NPXA 3K30A 3M13A 1EL8A 3OP2A 3F8DA 4JN8A 1VRQB 1IJHA 3BHFA 2QA2A 3OZYA 1FOHA 2HQMA 1DXLA 2V3AA 3AD7B 1NU5A 2WOIA 4K2XA 2GSHA 2ARDA 4K8GA 4GGHA 3ZLGA 3CNPA 3UKPA 3AYJA 4EMJA 3TOYA 2PP1A 2V5ZA 5DBJA 2C73A 2JAEA 2GQWA 5FJOA 2C7GA 1D4DA 4BJZA 2B76A 3U9IA 2RGOA 3ICSA 2XH4A 2WP6A 2AKMA 4OCGA 3DH9A 3ICRA 2FBWA 5JCMA 5KWFA 4DNAA 4J31A 3CTYA 1X2HA 2OLAA 2JBVA 4A65A 3NZGA 4NEVA 3B6DA 2XFPA 1Q1WA 3AECA 3QVPA 3P4SA 5FS8A 2POZA 2X8GA 3DK9A 2GMHA 1H6VA 1RM6B 4C77A 2V3BA 4Y4LA 1FHUA 2Q0KA 3AEFA 4H2RA 3SQPA 1NAAA 1B4VA 3LZWA 1ONFA 2R4EA 3H12A 2B7RA 1ZDLA 2PSNA 3S47A 4U8PA 4U8KA 3R11A 2RDXA 4J34A 1WUEA 3G5SA 4NEWA 3TTEA 3EEZA 2CDUA 4H2HA 4G7FA 3CAWA 5L46A 4U8MA 5G5HB 1CJ4A 1PBEA 1FFUC 4ZOHB 5IPYA 2PCEA 3T4WA 3PS9A 3TWAA 3DJJA 2WPCA 3P93A 1YQZA 2OPJA 1ELIA 3HPFA 4H4YA 1FFVC 1JRZA 2QJMA 1W6TA 2XFQA 4H7UA 2WBAA 2XLTA 3NFUA 4WCTA 5GRTA 5KMRA 3NNEA 5J60A 2GAHB 1E39A 4OVIA 3M0OA 1GRFA 3VA8A 1H82A 2QA1A 3EKGA 4EQRA 3AMZA 4J3ZA 3UKQA 4APNA 3BNUA 4D03A 3BJSA 4YKGA 4REKA 1IUWA 2AL2B 3N4FA 3PG6A 2XFOA 1KF6A 2E1MA 1DOBA 3R1ZA 3K7TA 3RITA 3UOYA 4TLXA 4HCDA 2XSXA 3CK5A 3A7AA 4JY3A 3HZLA 3DIPA 3SSZA 1CJ2A 1MRAA 3ENLA 1GRBA 4E8GA 2E3TA 4DGKA 4U8NA 2BRYA 1LJ1A 4Z2UA 4MMWA 3JW7A 3UTEA 4ZCCA 1N4UA 4K22A 3REDA 2WU5A 2P8BA 3D46A 3THUA 2GGJA 3FVDA 3CN8A 3SN4A 2B9WA 3E1TA 1F3PA 1S7MA 3VFCA 3NVZB 3SBFA 4DX3A 3R10A 3SZFA 1S2YA 2OVLA 3ISHA 4TM3A 3GRTA 2FJEA 3GD4A 3ZVIA 3NYCA 2GH5A 2ZZ0A 2RGHA 2BK5A 2V61A 3QVRA 3F8PA 4NTDA 4KPLA 1MXTA 3VC5A 5JCLA 1GALA 3UCLA 4EMIA 2WP5A 4C3XA 2IVDA 3S5SA 3Q4DA 2PTWA 4GRTA 5LV9A 1DJNA 5J04A 2B7SA 1GRTA 2C67A 3VRBA 3IF9A 3EUB3 4Z26A 3H8AA 4B67A 3D1CA 1FCDA 3JSKA 2XVJA 1XANA 3CGBA 3UJ2A 2ZADA 4J2WA 2W55A 4Z17A 1PJ6A 4J1OA 3TWBA 4E6MA 3BI2A 4EQWA 3SQSA 4YSZA 2YLTA 2B9YA 1H83A 3K1GA 3T2ZA 1ZMCA 3AB1A 3QFBA 1NG3A 1EBGA 3V3OA 2GV8A 2B9XA 4K8DA 3AEBA 2GQFA 1LVLA 1GESA 4U8OA 3IHMA 3T2YA 3NN0X 2HNEA 2OLOA 5BOEA 5FJRA 3AE4A 2CFYA 3UXKA 4GR1A 4K1WA 3V3NA 4GFIA 3CPHG 2VRMA 4U8JA 4TVYA 1ZOYA 4UP3A 2I5QA 1SJBA 1V97A 1JOAA 2AL2A 2ONEA 4GCMA 4NWZA 4YWSA 3CGEA 1H81A 3D8XA 3T6CA 3DK4A 2HZGA 1TYPA 3UJEA 2YG6A 3HYWA 4TM4A 1R6WA 3O0HA 4Z44A 3AE2A 3RR1A 2F5ZA 3ICTA 5TR3A 4H4ZA 3BNMA 3P0WA 3FXGA 3ABVA 3TCSA 3KU9A 4AT0A 4OPTA 4JY2A 3NO1A 3UCCA 5JCNA 4H2QA 3NGCX 2GL5A 1HYUA 1YKJA 2BCPA 3ALJA 2OQYA 1L8PA 3PFRA 3PVCA 1DTNA 4EQXA 3NIXA 3JZUA 3MY9A 5KVHA 2X3NA 2BABA 1N62C 4OPLA 3M12A 2A8XA 4FX9A 2VQ7A 3UCDA 3L8KA 1PN0A 1MDLA 4YSHA 4CY8A 1TDKA 3NVVB 3GDNA 3EANA 4JNQA 2XVEA 1WUFA 4H4WA 2GB0A 5EU9A 4UDRA 1JRPA 3UJSA 2I0ZA 3CXBA 4FK1C 2VVLG 1NEKA 1DNCA 3IWAA 1L0VA 4Y4MA 1N4VA 5KOXA 3AE9A 1YQ4A 1QLBA 4A6NB 2J3NA 2ZBWA 4RG4A 3SGLA 2XLSA 3R07C 2H88A 3BI4A 4A6GA 3QTPA 3GWFA 3AEAA 4RG3A 1MUCA 3NG7X 3BI5A 4JN9A 2PU1A 1TDEA 4YKFA 2X8CA 2FJBA 2BS3A 1E1KA 4A3RA 2W3RA 3G5QA 1H84A 4BURA 1JDFA 1N60C 4LU6A 1H2IA 1H86A 1PDYA 5FS7A 4XXGA 3OC4A 2BC1A 3V5FA 4KEMA 4EIQA 3P4QA 3D9XA 5G5GB 1TKKA 2GGHA 1M64A 3QKEA 4DHGA 2QJNA 1DOCA 4II3A 1RSGA 3NTAA 5M0ZA 3DK8A 1B5QA 3GYIA 3KLJA 1OJTA 1N63C 1PBBA 2PPGA 4A79A 3G5RA 3CB3A 4MKSA 1FECA 4X9NA 3P1WA 4NTCA 4DXKA 3PK7A 2XLUA 4AT2A 1GPEA 1NHQA 1ZOVA 5EB5A 3LADA 1IUXA 3PO7A 2PS2A 3COXA 4IZGA 4PAAA 3K7QX 4AP3A 4YXDA 2O9ZA 2WDQA 1XPQA 1MNSA 2DW7A 1CC6A 4HPNA 6ENLA 2DKHA 4N9XA 2E5VA 1JCTA 1STZA 3V5CA 2FKPA 3UOXA 2AKZA 2O56A 1VDCA 3GYJA 3GMBA 4J57A 1VG0A 3CMMA 4YTPA 1ZP0A 4IA5A 3NTDA 2GR1A 5EOWA 1V59A 3SZWA 2WQYA 4GF7A 2HXUA 2WPEA 4K5SA 1PBDA 3CNTA 3OZMA 4DYEA 3VDGA 2VQBA 1E7PA 4F4RA 3MWCA 2YG7A 2E4GA 4IL2A 2GF3A 3AM9A 4B69A 4A6NA 1YEYA 3GO2A 5IQ1A 4IHCA 5IDZA 1D7YA 1EBHA 1FO4A 4GYPC 4H4SA 4H4RA 3CGDA 3DJDA 1KFYA 2BS2A 4IVMB 2JB2A 1IUVA 3SN1A 3UOVA 3BOXA 4YWOA 3GWDA 1GT8A 2VOUA 3UKAA 3IHGA 3NHOX 2C64A 3S5WA 4GGBA 4JDRA 5HYMA 1NHSA 2WPFA 4NZHA 5J7XA
chains in the Genus database with same CATH topology
3KPKA 3RP7A 3IF9A 4B63A 4Z26A 2YVGA 2UZZA 4J56A 4ZN0A 4H4PA 4B67A 3D1CA 1FCDA 3JSKA 4BK2A 4WX1A 5C3JA 2XVJA 2APGA 2BS4A 2YQUA 4A7AA 1XANA 4Z43A 3R9UA 3CGBA 3VRAA 2IIDA 4CBQA 1SEZA 2R4JA 4J2WA 3RP8A 3AYLA 1PJ6A 1ZX9A 3V76A 4CNKA 1ZY8A 3AXBA 1KNPA 3ATQA 4U8LA 4X9MA 2GRTA 1S3BA 4B66A 1JRXA 2X99A 1P2HA 2DKIA 3AEDA 5IQ4A 1PBCA 3BI2A 5KMQA 1Z6LA 4EQWA 1IUUA 4H2PA 4YSZA 1PBFA 1E1LA 5BRTA 2YLTA 2B9YA 1H83A 3L1RA 3GD3A 1EL5A 1ZMCA 1E6EA 1PHHA 3AB1A 3FBSA 3T2ZA 4C74A 3QFBA 1NG3A 1D4EA 4YSYA 3AD9B 3CPIG 3T14A 1DODA 4GUVA 3ALLA 1GV4A 1XHCA 5JCKA 2GV8A 1LQUA 3C4NA 3UP5A 3V3OA 1VQWA 2B9XA 3HYXA 4K8DA 1E1MA 3P4RA 4YT0A 3AD8B 3AEBA 2GQFA 4G6HA 1LVLA 3SFEA 3AE3A 2OAMA 5FMHA 4CNJA 1GESA 3CIRA 4U8OA 1ZK7A 3H8IA 1PDHA 2AR8A 1N4WA 4J33A 3P4PA 3IHMA 3T2YA 5HHFA 2YLZA 2BA9A 3NN0X 1GRGA 2OLOA 3T37A 3AE4A 4BJYA 2CFYA 4GR1A 2XVHA 1KNRA 3SY4A 4OPDA 1ZKQA 4DSGA 2YR6A 3V3NA 1GOSA 3CPHG 2TPRA 2VRMA 1JNRA 4U8JA 4D04A 5KNLA 1ZOYA 2YLWA 4UP3A 1OJAA 1F8WA 5CKUA 5KMSA 1GEUA 5ER0A 5JRBA 2EQ6A 1MO9A 4KX6A 1JOAA 3AYIA 1OJ9A 4G74A 4ZCDA 2R0CA 3SM8A 4G73A 4GCMA 3NK0X 3SFDA 4BK1A 4GDPA 4NWZA 4O5QA 3DGZA 3NKSA 2YLXA 4G6GA 5EBKA 4U2LA 3DJGX 3ZDNA 1GRAA 2V6OA 2VRLA 1PXAA 3CGEA 1H81A 4TM1A 4CCQA 3D8XA 3GSIA 3UP4A 3KPFA 3FPZA 2A89A 3QSMA 1YQ3A 2BXSA 3DK4A 5U25A 1TYPA 2YG6A 1NHRA 1FEAA 4BV6A 3HYWA 2C72A 3QFAA 4TM4A 2JB3A 3O0HA 4GAVA 4EIPA 3VRDB 5HXIA 4Z44A 2X50A 3LJPA 3AE1A 4H50A 3AE2A 2JKCA 2Z5XA 1BF3A 5FS6A 4X4JA 4YSXA 2BC0A 1PS9A 2F5ZA 1TRBA 3NRNA 1GXFA 2OLNA 5CQFA 4Z24A 3UOZA 1NPXA 3ICTA 1L9CA 1L9DA 1O95A 1PJ7A 3K30A 1EL8A 2A87A 3M13A 5TR3A 2C75A 4H4ZA 2WEUA 2C66A 3F8DA 3BNMA 1K0LA 1VRQB 3NT6A 3NLCA 1IJHA 3BHFA 1Y56B 2QA2A 5M10A 1B8SA 1FOHA 2R0PA 3ABVA 2HQMA 2WP9A 1DXLA 2V3AA 3OZ2A 3AD7B 5BUKA 3L5OA 5U1OA 3EF6A 1GRHA 4TM0A 2WOIA 1M6IA 4K2XA 2YWLA 3KU9A 2XFNA 3UTGA 2ARDA 4OPTA 4AT0A 1GERA 2BYBA 1RP0A 4JY2A 3RHAA 1NDAA 3NN6X 4NTEA 4OPGA 4B64A 1GSNA 3CNPA 5GSNA 3UKPA 3RNMA 5JCNA 4H2QA 3AYJA 3DA1A 3NGCX 3T2KA 2YM2A 1LTXR 4EMJA 1AOGA 4Z2TA 1HYUA 1YY5A 2XLPA 1KSUA 1YKJA 2BCPA 4A99A 2V5ZA 1KN0A 3ALJA 2EQ8A 4CRTA 5DBJA 4AOXA 2C73A 2JAEA 3PVCA 4A5LA 3RP6A 2GQWA 2X8HA 1CF3A 4EQXA 1XDIA 4M52A 3NIXA 2C7GA 1D4DA 1K4QA 4BJZA 3CNSA 1Q9IA 1Y56A 1N1PA 1H7WA 2B76A 1EL7A 4UDPA 2RGOA 3ICSA 1L9EA 1K0JA 5KVHA 1EL9A 2JK6A 2X3NA 3ITJA 1CC2A 3QSSA 2WP6A 4OCGA 3DH9A 3CGCA 1GTHA 2BABA 3Q9TA 3M12A 2YVJA 4KPRA 3ICRA 4OPLA 2C3DA 2YG5A 4USQA 2A8XA 4FX9A 2FBWA 2PYXA 5JCMA 2VQ7A 2H89A 2YM1A 3QSEA 2XDOA 1B37A 2Q7VA 3L8KA 3H8LA 3QJ4A 2BCGG 5KWFA 4OPIA 4NNJA 1PN0A 1TDFA 1IUSA 3BHKA 4YSHA 1LPFA 2RGJA 2GR3A 4CY8A 1F8RA 3ALMA 3ADAB 1TDKA 2BACA 3GDNA 4DNAA 4J31A 3CTYA 4BK3A 3EANA 1OJDA 3LXDA 2JBVA 4A65A 4NEVA 1D7LA 3B6DA 2XFPA 4JNQA 2XVEA 1Q1WA 2XVFA 4H4WA 3GYXA 2GB0A 2AAQA 5U63A 4H4XA 4YTNA 3AECA 3QVPA 3P4SA 5KOWA 1F6MA 1DOEA 4UDRA 5FS8A 2I0ZA 2R0GA 4FK1C 2X8GA 2RABA 3DK9A 2GMHA 1NEKA 2VVLG 1DNCA 3IWAA 1L0VA 3SX6A 1GETA 3I6DA 4Y4MA 2YR5A 1E1NA 1H6VA 4K5RA 1N4VA 4C77A 2V3BA 4FDCB 5KOXA 2ACZA 3LZXA 1Y0PA 4Y4LA 2CULA 3AE9A 2Q0KA 4J36A 3I3LA 1YQ4A 2XCGA 1QLBA 3CPJG 5J7XA 4A6NB 2J3NA 4Y4NA 3AEFA 3SZ0A 2ZBWA 3SYIA 4RG4A 4H2RA 3AE5A 3SGLA 3SQPA 2XLSA 1NAAA 1B4VA 3LZWA 4H2NA 3NYEA 1ONFA 2H88A 1PXBA 3BI4A 2C70A 2R4EA 4AP1A 1IUTA 1RYIA 2GR2A 2B7RA 3GWFA 3AEAA 4RG3A 2GVCA 4GAPA 4U2SA 5HY5A 1ZDLA 3NG7X 1K0IA 4DSHA 2QAEA 3BI5A 1KSSA 4IA6A 2GMJA 2BXRA 4JN9A 1NENA 1TDEA 4YKFA 4YTMA 2X8CA 4U8PA 2FJBA 4JNAA 3S61A 2BS3A 4U8KA 3CNJA 1E1KA 3K7MX 1KDGA 3G5QA 3DGHA 2WOWA 1H84A 1S2QA 4BURA 1BWCA 2V60A 1FEBA 3C4AA 4J34A 4LU6A 1CJCA 1H2IA 1H86A 2QCUA 3G5SA 4U2TA 4NEWA 1CJ3A 1COYA 4B1BA 4O5UA 2CVJA 2C76A 5FS7A 2WDRA 4XXGA 3OC4A 2BC1A 2CDUA 3GDPA 3T0KA 5JCIA 3DMEA 1NG4A 4ICYA 2Q0LA 3UKLA 1REOA 4EIQA 1NHPA 3P4QA 3D9XA 5L46A 4U8MA 1ZMDA 3ATRA 1M64A 1CJ4A 1PBEA 1VG9A 4H4UA 4EM3A 1DOCA 3UKKA 3NYFA 1X31B 2YG3A 1CL0A 4II3A 1RSGA 3NTAA 5M0ZA 3DK8A 1B5QA 3GYIA 1CHUA 5IPYA 4CCRA 5KRQA 2C65A 3KLJA 1OJTA 3PS9A 1JU2A 2FJDA 4Z25A 3DJJA 2WPCA 3NK2X 1EBDA 1QJDA 1YQZA 2PHHA 2BK3A 3Q6JA 4I59A 1P2EA 1PBBA 4JQ9A 2GR0A 1OJCA 1ELIA 4GDEA 4HB9A 3AEEA 4H4YA 4A79A 3KKJA 4IVOB 5BVAA 3G5RA 4LIIA 1JRZA 1TDOA 1O94A 2VZ2A 3AWIA 2XFQA 2C4CA 1CBOA 2XVIA 4H7UA 3VR8A 2WBAA 3FG2P 1GNDA 2XLTA 3UKFA 4WCTA 3GMCA 1FECA 5GRTA 4ECHA 4I58A 5EB4A 4UDQA 4X9NA 5KMRA 1GTEA 3NNEA 3P1WA 5J60A 2GAHB 4NTCA 4RSLA 2BRAA 3KVEA 1E39A 1Q1RA 4USRA 2XLUA 2ZZBA 4AT2A 1GPEA 4OVIA 1W4XA 2XFUA 3M0OA 4C5OA 3GRSA 4ADWA 1MOKA 1NHQA 1GRFA 1ZOVA 2XLRA 3UTHA 5EB5A 4XWRA 2EQ7A 3LADA 1IUXA 2AQJA 3PO7A 1H82A 2VVLA 1BGJA 3COXA 2QA1A 1JNZA 3EPTA 4EQRA 4PAAA 4AOSA 3H4KA 2YLRA 3K7QX 4FK1A 3UKQA 4AP3A 4APNA 2C3CA 5FS9A 1TDNA 3BNUA 4YXDA 2O9ZA 3B3RA 3HYVA 4D03A 4YKGA 2WDQA 1XPQA 1FL2A 4REKA 1IUWA 1CC6A 2IVEA 2OALA 2R45A 1F8SA 2YLSA 1BKWA 1JRYA 2DKHA 5KXJA 1UKVG 3SZCA 2ZZCA 3PG6A 2XFOA 1KF6A 2W0HA 3VQRA 2E1MA 2R46A 1DOBA 4N9XA 1GREA 2JB1A 3K7TA 4B68A 2E5VA 3UOYA 3SXIA 4TLXA 3UOXA 4JY3A 3P9UA 1DJQA 3HZLA 1JEHA 1VDCA 3GYJA 3GMBA 4J57A 3KA7A 1CJ2A 4LA1A 4H4VA 1VG0A 3CMMA 3DJEA 1GRBA 2WESA 3AE7A 3KD9A 4YTPA 1ZP0A 4IA5A 4H4QA 3NTDA 3UTFA 2GR1A 5EOWA 4DGKA 1V59A 2NVKX 1PJ5A 4TLZA 3SZWA 4U8NA 2YR4A 2BRYA 2GAGB 2WQYA 1LJ1A 2WDVA 1PXCA 4OPCA 4Z2UA 2XYOA 3AE6A 4GF7A 2WOVA 2EQ9A 1LV0A 2FJAA 4ZCCA 3UTEA 2NPXA 2WPEA 1N4UA 3FIMB 1BGNA 4K5SA 1O5WA 2YG4A 1PBDA 3AE8A 1S3EA 4K22A 1QO8A 3CNTA 3REDA 4EMWA 3II4A 3C96A 4C3YA 4Z2RA 3URHA 2Y6RA 3VR9A 4H4TA 3IC9A 2WU5A 1TYTA 2OA1A 1E7PA 2VQBA 4HA6A 4U8IA 3FMWA 3CN8A 4XWZA 2Y6QA 5BULA 4K7ZA 2YG7A 3CNDA 4EQSA 2E4GA 2WHDA 4MJWA 2B9WA 2GF3A 2GEWA 3E1TA 1F3PA 1S7MA 5KVIA 2TMDA 4B69A 4E0VA 4A6NA 3ZYXA 3LB8A 5IQ1A 1D7YA 3SZFA 1S2YA 1BZLA 4H4SA 4H4RA 4IV9A 5KMPA 2Z5YA 3CGDA 2YAUA 3ISHA 3DJDA 3GRTA 2FJEA 4TM3A 1KFYA 1CC4A 2YVFA 4CY6A 3GD4A 3NYCA 2BS2A 2GH5A 3WE0A 2ZZ0A 2RGHA 2BK5A 1D5TA 2V61A 4A9WA 3QVRA 3F8PA 4NTDA 4OPUA 2BK4A 4IVMB 4B65A 2Q6UA 1MXTA 2JB2A 1IUVA 3UKHA 5JCLA 3UOVA 1GALA 3T31A 4YWOA 3UCLA 3GWDA 1GT8A 2WU2A 2VOUA 4EMIA 4PABA 2WP5A 4C3XA 2IVDA 3UKAA 1LQTA 3IHGA 2VVMA 2WETA 3NHOX 4II2A 3AEGA 4G9KA 2R9ZA 1D4CA 2C64A 3LOVA 1H7XA 4GRTA 2WS3A 3NH3X 4P9SA 3S5WA 5LV9A 1DJNA 4EM4A 4JDRA 2B7SA 3NK1X 5HYMA 1NHSA 2WPFA 4NZHA 3F8RA 3EAOA 1GRTA 5C2TA 2C67A 3VRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RP7 A;  3IF9 A;  4B63 A;  4Z26 A;  2YVG A;  2UZZ A;  4J56 A;  4ZN0 A;  4H4P A;  4B67 A;  3D1C A;  1FCD A;  3JSK A;  4BK2 A;  4WX1 A;  5C3J A;  2XVJ A;  2APG A;  2BS4 A;  2YQU A;  4A7A A;  1XAN A;  4Z43 A;  3R9U A;  3CGB A;  3VRA A;  2IID A;  4CBQ A;  1SEZ A;  2R4J A;  4J2W A;  3RP8 A;  3AYL A;  1PJ6 A;  1ZX9 A;  3V76 A;  4CNK A;  1ZY8 A;  3AXB A;  1KNP A;  3ATQ A;  4U8L A;  4X9M A;  2GRT A;  1S3B A;  4B66 A;  1JRX A;  2X99 A;  1P2H A;  2DKI A;  3AED A;  5IQ4 A;  1PBC A;  3BI2 A;  1Z6L A;  4EQW A;  1IUU A;  4H2P A;  4YSZ A;  1PBF A;  1E1L A;  5BRT A;  2YLT A;  2B9Y A;  1H83 A;  3L1R A;  3GD3 A;  1EL5 A;  1ZMC A;  1E6E A;  1PHH A;  3AB1 A;  3FBS A;  4C74 A;  3QFB A;  1NG3 A;  1D4E A;  4YSY A;  3AD9 B;  3CPI G;  1DOD A;  4GUV A;  3ALL A;  1GV4 A;  1XHC A;  5JCK A;  2GV8 A;  1LQU A;  3C4N A;  3UP5 A;  3V3O A;  1VQW A;  2B9X A;  4K8D A;  1E1M A;  3P4R A;  4YT0 A;  3AD8 B;  3AEB A;  2GQF A;  1LVL A;  3SFE A;  3AE3 A;  2OAM A;  5FMH A;  4CNJ A;  1GES A;  3CIR A;  4U8O A;  1ZK7 A;  3H8I A;  1PDH A;  2AR8 A;  1N4W A;  4J33 A;  3P4P A;  3IHM A;  5HHF A;  2YLZ A;  2BA9 A;  3NN0 X;  1GRG A;  2OLO A;  3T37 A;  3AE4 A;  4BJY A;  2CFY A;  4GR1 A;  2XVH A;  1KNR A;  4OPD A;  1ZKQ A;  4DSG A;  2YR6 A;  3V3N A;  1GOS A;  3CPH G;  2TPR A;  2VRM A;  1JNR A;  4U8J A;  4D04 A;  1ZOY A;  2YLW A;  4UP3 A;  1OJA A;  1F8W A;  5CKU A;  1GEU A;  5ER0 A;  2EQ6 A;  1MO9 A;  4KX6 A;  1JOA A;  3AYI A;  1OJ9 A;  4ZCD A;  2R0C A;  3SM8 A;  4GCM A;  3NK0 X;  3SFD A;  4BK1 A;  4GDP A;  4O5Q A;  3DGZ A;  3NKS A;  2YLX A;  5EBK A;  4U2L A;  3DJG X;  3ZDN A;  1GRA A;  2V6O A;  2VRL A;  1PXA A;  3CGE A;  1H81 A;  4TM1 A;  4CCQ A;  3D8X A;  3GSI A;  3UP4 A;  3KPF A;  3FPZ A;  2A89 A;  3QSM A;  1YQ3 A;  2BXS A;  3DK4 A;  5U25 A;  1TYP A;  2YG6 A;  1NHR A;  1FEA A;  4BV6 A;  2C72 A;  3QFA A;  4TM4 A;  2JB3 A;  3O0H A;  4EIP A;  3VRD B;  5HXI A;  4Z44 A;  2X50 A;  3LJP A;  3AE1 A;  4H50 A;  3AE2 A;  2JKC A;  2Z5X A;  1BF3 A;  5FS6 A;  4X4J A;  4YSX A;  2BC0 A;  1PS9 A;  2F5Z A;  1TRB A;  3NRN A;  1GXF A;  2OLN A;  5CQF A;  4Z24 A;  3UOZ A;  1NPX A;  3ICT A;  1L9C A;  1L9D A;  1O95 A;  1PJ7 A;  3K30 A;  1EL8 A;  2A87 A;  3M13 A;  5TR3 A;  2C75 A;  4H4Z A;  2WEU A;  2C66 A;  3F8D A;  3BNM A;  1K0L A;  1VRQ B;  3NT6 A;  3NLC A;  1IJH A;  3BHF A;  1Y56 B;  2QA2 A;  5M10 A;  1B8S A;  1FOH A;  2R0P A;  3ABV A;  2HQM A;  2WP9 A;  1DXL A;  2V3A A;  3OZ2 A;  3AD7 B;  5BUK A;  5U1O A;  3EF6 A;  1GRH A;  4TM0 A;  2WOI A;  1M6I A;  4K2X A;  2YWL A;  3KU9 A;  2XFN A;  3UTG A;  2ARD A;  4OPT A;  4AT0 A;  1GER A;  2BYB A;  1RP0 A;  4JY2 A;  3RHA A;  1NDA A;  3NN6 X;  4NTE A;  4OPG A;  4B64 A;  1GSN A;  3CNP A;  5GSN A;  3UKP A;  3RNM A;  5JCN A;  4H2Q A;  3AYJ A;  3DA1 A;  3NGC X;  2YM2 A;  1LTX R;  4EMJ A;  1AOG A;  4Z2T A;  1HYU A;  1YY5 A;  2XLP A;  1KSU A;  1YKJ A;  2BCP A;  4A99 A;  2V5Z A;  3ALJ A;  2EQ8 A;  4CRT A;  5DBJ A;  4AOX A;  2C73 A;  2JAE A;  3PVC A;  4A5L A;  3RP6 A;  2GQW A;  2X8H A;  1CF3 A;  4EQX A;  1XDI A;  4M52 A;  3NIX A;  2C7G A;  1D4D A;  1K4Q A;  4BJZ A;  3CNS A;  1Q9I A;  1Y56 A;  1N1P A;  1H7W A;  2B76 A;  1EL7 A;  4UDP A;  2RGO A;  3ICS A;  1L9E A;  1K0J A;  5KVH A;  1EL9 A;  2JK6 A;  2X3N A;  3ITJ A;  1CC2 A;  3QSS A;  2WP6 A;  4OCG A;  3DH9 A;  3CGC A;  1GTH A;  2BAB A;  3Q9T A;  3M12 A;  2YVJ A;  4KPR A;  3ICR A;  4OPL A;  2C3D A;  2YG5 A;  4USQ A;  2A8X A;  4FX9 A;  2FBW A;  2PYX A;  5JCM A;  2VQ7 A;  2H89 A;  2YM1 A;  3QSE A;  2XDO A;  1B37 A;  2Q7V A;  3L8K A;  3H8L A;  3QJ4 A;  2BCG G;  5KWF A;  4OPI A;  1PN0 A;  1TDF A;  1IUS A;  3BHK A;  4YSH A;  1LPF A;  2RGJ A;  2GR3 A;  4CY8 A;  1F8R A;  3ALM A;  3ADA B;  1TDK A;  2BAC A;  3GDN A;  4DNA A;  4J31 A;  3CTY A;  4BK3 A;  3EAN A;  1OJD A;  3LXD A;  2JBV A;  4A65 A;  4NEV A;  1D7L A;  3B6D A;  2XFP A;  4JNQ A;  2XVE A;  1Q1W A;  2XVF A;  4H4W A;  2GB0 A;  2AAQ A;  5U63 A;  4H4X A;  4YTN A;  3AEC A;  3QVP A;  3P4S A;  5KOW A;  1F6M A;  1DOE A;  4UDR A;  5FS8 A;  2I0Z A;  2R0G A;  4FK1 C;  2X8G A;  2RAB A;  3DK9 A;  2GMH A;  1NEK A;  2VVL G;  1DNC A;  3IWA A;  1L0V A;  1GET A;  3I6D A;  4Y4M A;  2YR5 A;  1E1N A;  1H6V A;  4K5R A;  1N4V A;  4C77 A;  2V3B A;  4FDC B;  5KOX A;  2ACZ A;  3LZX A;  1Y0P A;  4Y4L A;  2CUL A;  3AE9 A;  2Q0K A;  4J36 A;  3I3L A;  1YQ4 A;  2XCG A;  1QLB A;  3CPJ G;  5J7X A;  4A6N B;  2J3N A;  4Y4N A;  3AEF A;  2ZBW A;  4RG4 A;  4H2R A;  3AE5 A;  3SGL A;  3SQP A;  2XLS A;  1NAA A;  1B4V A;  3LZW A;  4H2N A;  3NYE A;  1ONF A;  2H88 A;  1PXB A;  3BI4 A;  2C70 A;  2R4E A;  4AP1 A;  1IUT A;  1RYI A;  2GR2 A;  2B7R A;  3GWF A;  3AEA A;  4RG3 A;  2GVC A;  4U2S A;  5HY5 A;  1ZDL A;  3NG7 X;  1K0I A;  4DSH A;  2QAE A;  3BI5 A;  1KSS A;  4IA6 A;  2GMJ A;  2BXR A;  4JN9 A;  1NEN A;  1TDE A;  4YKF A;  4YTM A;  2X8C A;  4U8P A;  2FJB A;  4JNA A;  3S61 A;  2BS3 A;  4U8K A;  3CNJ A;  1E1K A;  3K7M X;  1KDG A;  3G5Q A;  3DGH A;  2WOW A;  1H84 A;  1S2Q A;  4BUR A;  1BWC A;  2V60 A;  1FEB A;  3C4A A;  4J34 A;  4LU6 A;  1CJC A;  1H86 A;  2QCU A;  3G5S A;  4U2T A;  4NEW A;  1CJ3 A;  1COY A;  4B1B A;  4O5U A;  2CVJ A;  2C76 A;  5FS7 A;  2WDR A;  4XXG A;  3OC4 A;  2BC1 A;  2CDU A;  3GDP A;  5JCI A;  3DME A;  1NG4 A;  4ICY A;  2Q0L A;  3UKL A;  1REO A;  4EIQ A;  1NHP A;  3P4Q A;  5L46 A;  4U8M A;  1ZMD A;  3ATR A;  1M64 A;  1CJ4 A;  1PBE A;  1VG9 A;  4H4U A;  4EM3 A;  1DOC A;  3UKK A;  3NYF A;  1X31 B;  2YG3 A;  1CL0 A;  1RSG A;  3NTA A;  5M0Z A;  3DK8 A;  1B5Q A;  3GYI A;  1CHU A;  5IPY A;  4CCR A;  5KRQ A;  2C65 A;  3KLJ A;  1OJT A;  3PS9 A;  1JU2 A;  2FJD A;  4Z25 A;  3DJJ A;  2WPC A;  3NK2 X;  1EBD A;  1QJD A;  1YQZ A;  2PHH A;  2BK3 A;  3Q6J A;  4I59 A;  1P2E A;  1PBB A;  4JQ9 A;  2GR0 A;  1OJC A;  1ELI A;  4GDE A;  4HB9 A;  3AEE A;  4H4Y A;  4A79 A;  3KKJ A;  4IVO B;  5BVA A;  3G5R A;  4LII A;  1JRZ A;  1TDO A;  1O94 A;  2VZ2 A;  3AWI A;  2XFQ A;  1CBO A;  2XVI A;  4H7U A;  3VR8 A;  2WBA A;  3FG2 P;  1GND A;  2XLT A;  3UKF A;  4WCT A;  3GMC A;  1FEC A;  5GRT A;  4ECH A;  4I58 A;  5EB4 A;  4UDQ A;  4X9N A;  1GTE A;  3NNE A;  3P1W A;  5J60 A;  2GAH B;  4NTC A;  4RSL A;  3KVE A;  1E39 A;  1Q1R A;  4USR A;  2XLU A;  2ZZB A;  4AT2 A;  1GPE A;  4OVI A;  1W4X A;  2XFU A;  3M0O A;  4C5O A;  3GRS A;  4ADW A;  1MOK A;  1NHQ A;  1GRF A;  1ZOV A;  2XLR A;  3UTH A;  5EB5 A;  4XWR A;  2EQ7 A;  3LAD A;  1IUX A;  2AQJ A;  3PO7 A;  1H82 A;  2VVL A;  1BGJ A;  3COX A;  2QA1 A;  1JNZ A;  3EPT A;  4EQR A;  4PAA A;  4AOS A;  3H4K A;  2YLR A;  3K7Q X;  4FK1 A;  3UKQ A;  4AP3 A;  4APN A;  2C3C A;  5FS9 A;  1TDN A;  3BNU A;  4YXD A;  2O9Z A;  3B3R A;  4D03 A;  4YKG A;  2WDQ A;  1XPQ A;  1FL2 A;  4REK A;  1IUW A;  1CC6 A;  2IVE A;  2OAL A;  2R45 A;  1F8S A;  2YLS A;  1BKW A;  1JRY A;  2DKH A;  5KXJ A;  1UKV G;  2ZZC A;  2XFO A;  1KF6 A;  2W0H A;  3VQR A;  2E1M A;  2R46 A;  1DOB A;  4N9X A;  1GRE A;  2JB1 A;  3K7T A;  4B68 A;  2E5V A;  3UOY A;  4TLX A;  3UOX A;  4JY3 A;  3P9U A;  1DJQ A;  3HZL A;  1JEH A;  1VDC A;  3GYJ A;  3GMB A;  4J57 A;  3KA7 A;  1CJ2 A;  4LA1 A;  4H4V A;  1VG0 A;  3DJE A;  1GRB A;  2WES A;  3AE7 A;  3KD9 A;  4YTP A;  1ZP0 A;  4IA5 A;  4H4Q A;  3NTD A;  3UTF A;  2GR1 A;  5EOW A;  4DGK A;  1V59 A;  2NVK X;  1PJ5 A;  4TLZ A;  4U8N A;  2YR4 A;  2GAG B;  2WQY A;  1LJ1 A;  2WDV A;  1PXC A;  4OPC A;  4Z2U A;  2XYO A;  3AE6 A;  4GF7 A;  2WOV A;  2EQ9 A;  1LV0 A;  2FJA A;  4ZCC A;  3UTE A;  2NPX A;  2WPE A;  1N4U A;  3FIM B;  1BGN A;  4K5S A;  1O5W A;  2YG4 A;  1PBD A;  3AE8 A;  1S3E A;  4K22 A;  1QO8 A;  3CNT A;  3RED A;  4EMW A;  3II4 A;  3C96 A;  4C3Y A;  4Z2R A;  3URH A;  2Y6R A;  3VR9 A;  4H4T A;  3IC9 A;  2WU5 A;  1TYT A;  2OA1 A;  1E7P A;  2VQB A;  4HA6 A;  4U8I A;  3FMW A;  3CN8 A;  4XWZ A;  2Y6Q A;  5BUL A;  4K7Z A;  2YG7 A;  3CND A;  4EQS A;  2E4G A;  2WHD A;  4MJW A;  2B9W A;  2GF3 A;  2GEW A;  3E1T A;  1F3P A;  5KVI A;  2TMD A;  4B69 A;  4E0V A;  4A6N A;  3ZYX A;  3LB8 A;  5IQ1 A;  1D7Y A;  1S2Y A;  1BZL A;  4H4S A;  4H4R A;  4IV9 A;  2Z5Y A;  3CGD A;  2YAU A;  3ISH A;  3DJD A;  3GRT A;  2FJE A;  4TM3 A;  1KFY A;  1CC4 A;  2YVF A;  4CY6 A;  3GD4 A;  3NYC A;  2BS2 A;  2GH5 A;  3WE0 A;  2ZZ0 A;  2RGH A;  2BK5 A;  1D5T A;  2V61 A;  4A9W A;  3QVR A;  3F8P A;  4NTD A;  4OPU A;  2BK4 A;  4IVM B;  4B65 A;  2Q6U A;  1MXT A;  2JB2 A;  1IUV A;  3UKH A;  5JCL A;  3UOV A;  1GAL A;  4YWO A;  3UCL A;  3GWD A;  1GT8 A;  2WU2 A;  2VOU A;  4EMI A;  4PAB A;  2WP5 A;  4C3X A;  2IVD A;  3UKA A;  1LQT A;  3IHG A;  2VVM A;  2WET A;  3NHO X;  3AEG A;  2R9Z A;  1D4C A;  2C64 A;  3LOV A;  1H7X A;  4GRT A;  2WS3 A;  3NH3 X;  4P9S A;  3S5W A;  5LV9 A;  1DJN A;  4EM4 A;  4JDR A;  2B7S A;  3NK1 X;  5HYM A;  1NHS A;  2WPF A;  4NZH A;  3F8R A;  3EAO A;  1GRT A;  5C2T A;  2C67 A;  3VRB A; 
#chains in the Genus database with same CATH topology
 3NVY B;  3QN3 A;  4ZN0 A;  4ZA0 A;  4BK2 A;  2PTZ A;  5C3J A;  4Z43 A;  4CBQ A;  1SEZ A;  1WYG A;  3RP8 A;  3AYL A;  4U8L A;  1ZXI C;  2GRT A;  1S3B A;  4B66 A;  4X2P A;  1Z6L A;  4MGG A;  1IUU A;  1EC8 A;  3GD3 A;  2NQL A;  1KD0 A;  1D4E A;  4GUV A;  2GGG A;  1GV4 A;  1XHC A;  1ONE A;  3UP5 A;  4KT2 A;  3P4R A;  2OZ8 A;  3H8I A;  1PDH A;  1MDR A;  3UJR A;  1FIQ B;  2BA9 A;  1GRG A;  4BJY A;  2XVH A;  1KNR A;  1ZKQ A;  1BKH A;  1KKR A;  1GOS A;  1JNR A;  2P0I A;  4H83 A;  5ER0 A;  2EQ6 A;  2R0C A;  3SM8 A;  3SFD A;  1EC7 A;  3DGZ A;  4G6G A;  3N6H A;  3DJG X;  2V6O A;  1PXA A;  3B97 A;  1YQ3 A;  2BXS A;  3IJQ A;  1FEA A;  3IJL A;  2C72 A;  4EIP A;  4GAV A;  4JN7 A;  1VQZ A;  1JPD X;  2X50 A;  2JKC A;  2Z5X A;  1TRB A;  1PS9 A;  4Z24 A;  5CQF A;  2OLN A;  1L9D A;  1O95 A;  2A87 A;  2DW6 A;  3U4F A;  3NLC A;  5M10 A;  3EF6 A;  3SR6 B;  4TM0 A;  1M6I A;  2YWL A;  3UJF A;  1GER A;  2BYB A;  3OPS A;  1RP0 A;  3RHA A;  4OPG A;  3NN6 X;  4B64 A;  3RGT A;  1GSN A;  3MZN A;  3RNM A;  3T2K A;  2YM2 A;  3UGV A;  4Z2T A;  1AOG A;  1YY5 A;  2XLP A;  1KSU A;  1JRO A;  4A99 A;  1KN0 A;  2EQ8 A;  4AOX A;  3RP6 A;  2PGE A;  3ZVH B;  1CF3 A;  1XDI A;  3HRD C;  4M52 A;  1Q9I A;  1Y56 A;  1H7W A;  4UDP A;  1L9E A;  3IJI A;  2JK6 A;  1GTH A;  3CGC A;  4D04 A;  4KPR A;  2YG5 A;  2PYX A;  2YM1 A;  3QSE A;  2XDO A;  1B37 A;  3TQP A;  3H8L A;  3QJ4 A;  2BCG G;  4NNJ A;  3DFH A;  1TDF A;  1IUS A;  3BHK A;  4K2S A;  2GR3 A;  1F8R A;  3ALM A;  3NXL A;  2BAC A;  2P88 A;  3LXD A;  3ETR B;  1D7L A;  2XVF A;  3IK4 A;  3GYX A;  2AAQ A;  4H4X A;  2R0G A;  3N6J A;  3SX6 A;  4G8T A;  2YR5 A;  2OKT A;  1E1N A;  4ZCW A;  3A7R A;  2ACZ A;  3LZX A;  1ECQ A;  2CUL A;  4J36 A;  3I3L A;  2XCG A;  3SYI A;  3AE5 A;  2PP3 A;  3NYE A;  1PXB A;  1RYI A;  2GR2 A;  2PGW A;  2XGZ A;  4GAP A;  1K0I A;  2QAE A;  2GMJ A;  4YTM A;  4JNA A;  3CNJ A;  3K7M X;  3ZLH A;  2V60 A;  1CJC A;  2PTY A;  3FYY A;  2POD A;  1CJ3 A;  4B1B A;  4O5U A;  2C76 A;  2WDR A;  3T0K A;  3RRA A;  3DME A;  4ICY A;  3UKL A;  1REO A;  1SJA A;  2PP0 A;  1VG9 A;  4H4U A;  4EM3 A;  1X31 B;  1CL0 A;  2OG9 A;  5KRQ A;  1BQG A;  2C65 A;  4Z25 A;  4I59 A;  1P2E A;  4FP1 A;  2GR0 A;  1OJC A;  4IL0 A;  4GDE A;  5BVA A;  3KKJ A;  4IVO B;  1TDO A;  1O94 A;  2VZ2 A;  3AWI A;  2XVI A;  3VR8 A;  3FG2 P;  3GMC A;  4ECH A;  5EB4 A;  4UDQ A;  4RSL A;  4USR A;  2GDQ A;  2ZZB A;  7ENL A;  2XFU A;  3HW2 A;  4C5O A;  4ADW A;  4M0X A;  2XLR A;  2W3S A;  3MUC A;  4XWR A;  4AOS A;  2YLR A;  4FK1 A;  2C3C A;  1NEL A;  3B3R A;  3ZVH A;  1FL2 A;  2IVE A;  3AN1 A;  2OAL A;  2R45 A;  1F8S A;  3RO6 A;  2YLS A;  1BKW A;  3SZC A;  1OEP A;  1GRE A;  2E5A A;  2JB1 A;  1TZZ A;  2QDD A;  1DJQ A;  1JEH A;  1X2G A;  3KA7 A;  4LA1 A;  3DJE A;  3KD9 A;  4TLZ A;  2NVK X;  1PJ5 A;  1PXC A;  2XYO A;  2WOV A;  2EQ9 A;  2NPX A;  2QVH A;  3FIM B;  1BGN A;  2YG4 A;  3AE8 A;  1QO8 A;  3C96 A;  3II4 A;  2Y6R A;  1TYT A;  2OA1 A;  4U8I A;  4HA6 A;  4EWJ A;  3FMW A;  4XWZ A;  4K7Z A;  4EQS A;  4MJW A;  5KVI A;  4GIR A;  4E4U A;  1R0M A;  3ZYX A;  3LB8 A;  1BZL A;  2OZ3 A;  4IV9 A;  5KMP A;  2YAU A;  2YVF A;  4CY6 A;  3WE0 A;  3VC6 A;  1D5T A;  4OPU A;  2BK4 A;  4B65 A;  1E9I A;  1FHV A;  3I6E A;  4HNC A;  1LQT A;  2VVM A;  3LOV A;  1H7X A;  3NH3 X;  3DEQ A;  3TJI A;  3F8R A;  5C2T A;  3KPK A;  4B63 A;  1SJC A;  4M6U A;  2APG A;  2YQU A;  3R9U A;  3VRA A;  1SB3 B;  4GME A;  2R4J A;  3V76 A;  3AXB A;  3ATQ A;  1JRX A;  2X99 A;  1P2H A;  3AED A;  1N5W C;  4H2P A;  1PBF A;  1JPM A;  1PHH A;  4C74 A;  3CPI G;  3NS1 B;  1DOD A;  3ALL A;  5JCK A;  3OW1 A;  3STP A;  3UXL A;  1VQW A;  3HYX A;  3AD8 B;  2OFJ A;  5FMH A;  3MQT A;  1N4W A;  2MNR A;  3DFY A;  5HHF A;  2YLZ A;  3T37 A;  4DSG A;  2FYM A;  2TPR A;  2XH0 A;  5KNL A;  2YLW A;  3DG6 A;  5CKU A;  1XS2 A;  1MO9 A;  4KX6 A;  4E4F A;  3NK0 X;  4BK1 A;  3NKS A;  4CCQ A;  1GRA A;  2VRL A;  4TM1 A;  3GSI A;  3UP4 A;  2A89 A;  4GYP A;  2PU0 A;  4BV6 A;  2JB3 A;  3D47 A;  3I4K A;  3VRD B;  3Q45 A;  3LJP A;  2AL1 A;  1BF3 A;  2BC0 A;  1GXF A;  3UOZ A;  1L9C A;  1PJ7 A;  2C75 A;  2WEU A;  2C66 A;  1K0L A;  3NT6 A;  1Y56 B;  1B8S A;  2R0P A;  2WP9 A;  3OZ2 A;  5BUK A;  3L5O A;  5U1O A;  1GRH A;  4Z1Y A;  2PTX A;  4H1Z A;  2XFN A;  3UTG A;  1NDA A;  4NTE A;  5FJU A;  5GSN A;  3DA1 A;  1LTX R;  3FCP A;  4CRT A;  4A5L A;  3NRZ B;  3PWG A;  2X8H A;  3P3B A;  3CXO A;  1K4Q A;  1XPY A;  3CNS A;  2W54 A;  1N1P A;  3V3W A;  1EL7 A;  3ES7 A;  3BSM A;  3DG7 A;  1K0J A;  1EL9 A;  3ITJ A;  1CC2 A;  3QSS A;  3Q9T A;  3R25 A;  2YVJ A;  4USQ A;  2MUC A;  2C3D A;  2H89 A;  2Q7V A;  4OPI A;  2GGE A;  4E5T A;  1LPF A;  2RGJ A;  3ADA B;  3VCN A;  3VCC A;  4BK3 A;  1OJD A;  3DGB A;  4KWS A;  5U63 A;  4YTN A;  5KOW A;  3SN0 A;  1F6M A;  1DOE A;  4FI4 A;  2RAB A;  3N4E A;  1GET A;  3ZLF A;  3I6D A;  4K5R A;  4FDC B;  4IP4 A;  1Y0P A;  3CPJ G;  4Y4N A;  3SZ0 A;  4ROP A;  4H2N A;  1N61 C;  3V4B A;  5BOF A;  2C70 A;  3DG3 A;  3T9P A;  1IUT A;  4AP1 A;  2GVC A;  4U2S A;  5HY5 A;  4DSH A;  4IA6 A;  1KSS A;  4JHM A;  4DN1 A;  2BXR A;  1NEN A;  1P43 A;  3S61 A;  1KDG A;  3DGH A;  2WOW A;  1S2Q A;  1BWC A;  1FEB A;  3C4A A;  2QCU A;  4U2T A;  1COY A;  1T3Q C;  2CVJ A;  3GDP A;  5JCI A;  1NG4 A;  2Q0L A;  3DES A;  1NHP A;  2XH2 A;  1ZMD A;  3ATR A;  3UKK A;  1SJD A;  3NYF A;  2YG3 A;  2P3Z A;  1CHU A;  4CCR A;  1JU2 A;  2FJD A;  3NK2 X;  1EBD A;  1QJD A;  2PHH A;  2BK3 A;  3Q6J A;  3A7U A;  4JQ9 A;  1ELS A;  4HB9 A;  3AEE A;  4LII A;  5FJT A;  2C4C A;  1CBO A;  1GND A;  3UKF A;  4I58 A;  2GGI A;  1GTE A;  2BRA A;  3KVE A;  1Q1R A;  4A35 A;  3CYJ A;  1W4X A;  3R0K A;  3GRS A;  1MOK A;  3UTH A;  2EQ7 A;  2AQJ A;  5ENL A;  2VVL A;  1BGJ A;  1JNZ A;  3EPT A;  3H4K A;  3ES8 A;  4HYR A;  1TDN A;  5FS9 A;  3CT2 A;  3HYV A;  3KUM A;  2OO6 A;  2OX4 A;  3FJ4 A;  1JRY A;  5KXJ A;  1UKV G;  2ZZC A;  2W0H A;  3VQR A;  2R46 A;  3SJN A;  4B68 A;  3SXI A;  3P9U A;  1N5X A;  4H4V A;  1IYX A;  2WES A;  3AE7 A;  4IT1 A;  3UTF A;  4H4Q A;  3DER A;  2YR4 A;  3H70 A;  1EC9 A;  2GAG B;  2WDV A;  4OPC A;  2P8C A;  3AE6 A;  1LV0 A;  2FJA A;  3GD6 A;  1O5W A;  1S3E A;  4C3Y A;  4EMW A;  3QLD A;  4Z2R A;  3URH A;  3VR9 A;  4H4T A;  3IC9 A;  3GY1 A;  2Y6Q A;  5BUL A;  3CND A;  1KCZ A;  2WHD A;  2GEW A;  2TMD A;  4E0V A;  1KKO A;  4HNL A;  2Z5Y A;  4TVW A;  1TE6 A;  1CC4 A;  3TJ4 A;  2OQH A;  2HXT A;  4A9W A;  2CHR A;  2Q6U A;  3UKH A;  3TW9 A;  3T31 A;  1P48 A;  2WU2 A;  4PAB A;  2WET A;  3FV9 A;  4II2 A;  3AEG A;  4G9K A;  2R9Z A;  4DWD A;  1D4C A;  2WS3 A;  4P9S A;  3B9J B;  4EM4 A;  3NK1 X;  1VDV A;  3MSY A;  3EAO A;  2QDE A;  3RP7 A;  3H7V A;  2YVG A;  2UZZ A;  4J56 A;  2QGY A;  4H4P A;  4WX1 A;  2BS4 A;  2QQ6 A;  4A7A A;  2PA6 A;  2IID A;  2PMQ A;  1ZX9 A;  4CNK A;  1ZY8 A;  1KNP A;  4X9M A;  2DKI A;  5IQ4 A;  1PBC A;  5KMQ A;  1E1L A;  5BRT A;  3L1R A;  3FBS A;  1EL5 A;  1E6E A;  3NVW B;  4YSY A;  2QJJ A;  3AD9 B;  3T14 A;  3C4N A;  2ZC8 A;  1LQU A;  2XH7 A;  1E1M A;  4YT0 A;  4HCL A;  4G6H A;  3SFE A;  3AE3 A;  2OAM A;  4CNJ A;  3CIR A;  1ZK7 A;  2AR8 A;  3I6T A;  3JVA A;  4J33 A;  3P4P A;  3DDM A;  3R0U A;  3SY4 A;  4OPD A;  2YR6 A;  3QPE A;  3MKC A;  4HN8 A;  1OJA A;  1F8W A;  3T8Q A;  5KMS A;  1GEU A;  5JRB A;  5FJP A;  3AYI A;  1OJ9 A;  4G74 A;  4ZCD A;  4G73 A;  2OZT A;  4GDP A;  4O5Q A;  2YLX A;  3GC2 A;  5EBK A;  4U2L A;  3ZDN A;  4IP5 A;  3KPF A;  3FPZ A;  3QSM A;  5U25 A;  1F9C A;  1NHR A;  4GIS A;  3OTR A;  4HCH A;  3QFA A;  4H19 A;  1PDZ A;  5HXI A;  3PWI A;  3AE1 A;  4H50 A;  4ENL A;  4X4J A;  4YSX A;  5FS6 A;  3NRN A;  1RVK A;  3RCY A;  1NPX A;  3K30 A;  3M13 A;  1EL8 A;  3OP2 A;  3F8D A;  4JN8 A;  1VRQ B;  1IJH A;  3BHF A;  2QA2 A;  3OZY A;  1FOH A;  2HQM A;  1DXL A;  2V3A A;  3AD7 B;  1NU5 A;  2WOI A;  4K2X A;  2GSH A;  2ARD A;  4K8G A;  4GGH A;  3ZLG A;  3CNP A;  3UKP A;  3AYJ A;  4EMJ A;  3TOY A;  2PP1 A;  2V5Z A;  5DBJ A;  2C73 A;  2JAE A;  2GQW A;  5FJO A;  2C7G A;  1D4D A;  4BJZ A;  2B76 A;  3U9I A;  2RGO A;  3ICS A;  2XH4 A;  2WP6 A;  2AKM A;  4OCG A;  3DH9 A;  3ICR A;  2FBW A;  5JCM A;  5KWF A;  4DNA A;  4J31 A;  3CTY A;  1X2H A;  2OLA A;  2JBV A;  4A65 A;  3NZG A;  4NEV A;  3B6D A;  2XFP A;  1Q1W A;  3AEC A;  3QVP A;  3P4S A;  5FS8 A;  2POZ A;  2X8G A;  3DK9 A;  2GMH A;  1H6V A;  1RM6 B;  4C77 A;  2V3B A;  4Y4L A;  1FHU A;  2Q0K A;  3AEF A;  4H2R A;  3SQP A;  1NAA A;  1B4V A;  3LZW A;  1ONF A;  2R4E A;  3H12 A;  2B7R A;  1ZDL A;  2PSN A;  3S47 A;  4U8P A;  4U8K A;  3R11 A;  2RDX A;  4J34 A;  1WUE A;  3G5S A;  4NEW A;  3TTE A;  3EEZ A;  2CDU A;  4H2H A;  4G7F A;  3CAW A;  5L46 A;  4U8M A;  5G5H B;  1CJ4 A;  1PBE A;  1FFU C;  4ZOH B;  5IPY A;  2PCE A;  3T4W A;  3PS9 A;  3TWA A;  3DJJ A;  2WPC A;  3P93 A;  1YQZ A;  2OPJ A;  1ELI A;  3HPF A;  4H4Y A;  1FFV C;  1JRZ A;  2QJM A;  1W6T A;  2XFQ A;  4H7U A;  2WBA A;  2XLT A;  3NFU A;  4WCT A;  5GRT A;  5KMR A;  3NNE A;  5J60 A;  2GAH B;  1E39 A;  4OVI A;  3M0O A;  1GRF A;  3VA8 A;  1H82 A;  2QA1 A;  3EKG A;  4EQR A;  3AMZ A;  4J3Z A;  3UKQ A;  4APN A;  3BNU A;  4D03 A;  3BJS A;  4YKG A;  4REK A;  1IUW A;  2AL2 B;  3N4F A;  3PG6 A;  2XFO A;  1KF6 A;  2E1M A;  1DOB A;  3R1Z A;  3K7T A;  3RIT A;  3UOY A;  4TLX A;  4HCD A;  2XSX A;  3CK5 A;  3A7A A;  4JY3 A;  3HZL A;  3DIP A;  3SSZ A;  1CJ2 A;  1MRA A;  3ENL A;  1GRB A;  4E8G A;  2E3T A;  4DGK A;  4U8N A;  2BRY A;  1LJ1 A;  4Z2U A;  4MMW A;  3JW7 A;  3UTE A;  4ZCC A;  1N4U A;  4K22 A;  3RED A;  2WU5 A;  2P8B A;  3D46 A;  3THU A;  2GGJ A;  3FVD A;  3CN8 A;  3SN4 A;  2B9W A;  3E1T A;  1F3P A;  1S7M A;  3VFC A;  3NVZ B;  3SBF A;  4DX3 A;  3R10 A;  3SZF A;  1S2Y A;  2OVL A;  3ISH A;  4TM3 A;  3GRT A;  2FJE A;  3GD4 A;  3ZVI A;  3NYC A;  2GH5 A;  2ZZ0 A;  2RGH A;  2BK5 A;  2V61 A;  3QVR A;  3F8P A;  4NTD A;  4KPL A;  1MXT A;  3VC5 A;  5JCL A;  1GAL A;  3UCL A;  4EMI A;  2WP5 A;  4C3X A;  2IVD A;  3S5S A;  3Q4D A;  2PTW A;  4GRT A;  5LV9 A;  1DJN A;  5J04 A;  2B7S A;  1GRT A;  2C67 A;  3VRB A;  3IF9 A;  3EUB 3;  4Z26 A;  3H8A A;  4B67 A;  3D1C A;  1FCD A;  3JSK A;  2XVJ A;  1XAN A;  3CGB A;  3UJ2 A;  2ZAD A;  4J2W A;  2W55 A;  4Z17 A;  1PJ6 A;  4J1O A;  3TWB A;  4E6M A;  3BI2 A;  4EQW A;  3SQS A;  4YSZ A;  2YLT A;  2B9Y A;  1H83 A;  3K1G A;  3T2Z A;  1ZMC A;  3AB1 A;  3QFB A;  1NG3 A;  1EBG A;  3V3O A;  2GV8 A;  2B9X A;  4K8D A;  3AEB A;  2GQF A;  1LVL A;  1GES A;  4U8O A;  3IHM A;  3T2Y A;  3NN0 X;  2HNE A;  2OLO A;  5BOE A;  5FJR A;  3AE4 A;  2CFY A;  3UXK A;  4GR1 A;  4K1W A;  3V3N A;  4GFI A;  3CPH G;  2VRM A;  4U8J A;  4TVY A;  1ZOY A;  4UP3 A;  2I5Q A;  1SJB A;  1V97 A;  1JOA A;  2AL2 A;  2ONE A;  4GCM A;  4NWZ A;  4YWS A;  3CGE A;  1H81 A;  3D8X A;  3T6C A;  3DK4 A;  2HZG A;  1TYP A;  3UJE A;  2YG6 A;  3HYW A;  4TM4 A;  1R6W A;  3O0H A;  4Z44 A;  3AE2 A;  3RR1 A;  2F5Z A;  3ICT A;  5TR3 A;  4H4Z A;  3BNM A;  3P0W A;  3FXG A;  3ABV A;  3TCS A;  3KU9 A;  4AT0 A;  4OPT A;  4JY2 A;  3NO1 A;  3UCC A;  5JCN A;  4H2Q A;  3NGC X;  2GL5 A;  1HYU A;  1YKJ A;  2BCP A;  3ALJ A;  2OQY A;  1L8P A;  3PFR A;  3PVC A;  1DTN A;  4EQX A;  3NIX A;  3JZU A;  3MY9 A;  5KVH A;  2X3N A;  2BAB A;  1N62 C;  4OPL A;  3M12 A;  2A8X A;  4FX9 A;  2VQ7 A;  3UCD A;  3L8K A;  1PN0 A;  1MDL A;  4YSH A;  4CY8 A;  1TDK A;  3NVV B;  3GDN A;  3EAN A;  4JNQ A;  2XVE A;  1WUF A;  4H4W A;  2GB0 A;  5EU9 A;  4UDR A;  1JRP A;  3UJS A;  2I0Z A;  3CXB A;  4FK1 C;  2VVL G;  1NEK A;  1DNC A;  3IWA A;  1L0V A;  4Y4M A;  1N4V A;  5KOX A;  3AE9 A;  1YQ4 A;  1QLB A;  4A6N B;  2J3N A;  2ZBW A;  4RG4 A;  3SGL A;  2XLS A;  3R07 C;  2H88 A;  3BI4 A;  4A6G A;  3QTP A;  3GWF A;  3AEA A;  4RG3 A;  1MUC A;  3NG7 X;  3BI5 A;  4JN9 A;  2PU1 A;  1TDE A;  4YKF A;  2X8C A;  2FJB A;  2BS3 A;  1E1K A;  4A3R A;  2W3R A;  3G5Q A;  1H84 A;  4BUR A;  1JDF A;  1N60 C;  4LU6 A;  1H2I A;  1H86 A;  1PDY A;  5FS7 A;  4XXG A;  3OC4 A;  2BC1 A;  3V5F A;  4KEM A;  4EIQ A;  3P4Q A;  3D9X A;  5G5G B;  1TKK A;  2GGH A;  1M64 A;  3QKE A;  4DHG A;  2QJN A;  1DOC A;  4II3 A;  1RSG A;  3NTA A;  5M0Z A;  3DK8 A;  1B5Q A;  3GYI A;  3KLJ A;  1OJT A;  1N63 C;  1PBB A;  2PPG A;  4A79 A;  3G5R A;  3CB3 A;  4MKS A;  1FEC A;  4X9N A;  3P1W A;  4NTC A;  4DXK A;  3PK7 A;  2XLU A;  4AT2 A;  1GPE A;  1NHQ A;  1ZOV A;  5EB5 A;  3LAD A;  1IUX A;  3PO7 A;  2PS2 A;  3COX A;  4IZG A;  4PAA A;  3K7Q X;  4AP3 A;  4YXD A;  2O9Z A;  2WDQ A;  1XPQ A;  1MNS A;  2DW7 A;  1CC6 A;  4HPN A;  6ENL A;  2DKH A;  4N9X A;  2E5V A;  1JCT A;  1STZ A;  3V5C A;  2FKP A;  3UOX A;  2AKZ A;  2O56 A;  1VDC A;  3GYJ A;  3GMB A;  4J57 A;  1VG0 A;  3CMM A;  4YTP A;  1ZP0 A;  4IA5 A;  3NTD A;  2GR1 A;  5EOW A;  1V59 A;  3SZW A;  2WQY A;  4GF7 A;  2HXU A;  2WPE A;  4K5S A;  1PBD A;  3CNT A;  3OZM A;  4DYE A;  3VDG A;  2VQB A;  1E7P A;  4F4R A;  3MWC A;  2YG7 A;  2E4G A;  4IL2 A;  2GF3 A;  3AM9 A;  4B69 A;  4A6N A;  1YEY A;  3GO2 A;  5IQ1 A;  4IHC A;  5IDZ A;  1D7Y A;  1EBH A;  1FO4 A;  4GYP C;  4H4S A;  4H4R A;  3CGD A;  3DJD A;  1KFY A;  2BS2 A;  4IVM B;  2JB2 A;  1IUV A;  3SN1 A;  3UOV A;  3BOX A;  4YWO A;  3GWD A;  1GT8 A;  2VOU A;  3UKA A;  3IHG A;  3NHO X;  2C64 A;  3S5W A;  4GGB A;  4JDR A;  5HYM A;  1NHS A;  2WPF A;  4NZH A;  5J7X A; 
#chains in the Genus database with same CATH homology
 3KPK A;  3RP7 A;  3IF9 A;  4B63 A;  4Z26 A;  2YVG A;  2UZZ A;  4J56 A;  4ZN0 A;  4H4P A;  4B67 A;  3D1C A;  1FCD A;  3JSK A;  4BK2 A;  4WX1 A;  5C3J A;  2XVJ A;  2APG A;  2BS4 A;  2YQU A;  4A7A A;  1XAN A;  4Z43 A;  3R9U A;  3CGB A;  3VRA A;  2IID A;  4CBQ A;  1SEZ A;  2R4J A;  4J2W A;  3RP8 A;  3AYL A;  1PJ6 A;  1ZX9 A;  3V76 A;  4CNK A;  1ZY8 A;  3AXB A;  1KNP A;  3ATQ A;  4U8L A;  4X9M A;  2GRT A;  1S3B A;  4B66 A;  1JRX A;  2X99 A;  1P2H A;  2DKI A;  3AED A;  5IQ4 A;  1PBC A;  3BI2 A;  5KMQ A;  1Z6L A;  4EQW A;  1IUU A;  4H2P A;  4YSZ A;  1PBF A;  1E1L A;  5BRT A;  2YLT A;  2B9Y A;  1H83 A;  3L1R A;  3GD3 A;  1EL5 A;  1ZMC A;  1E6E A;  1PHH A;  3AB1 A;  3FBS A;  3T2Z A;  4C74 A;  3QFB A;  1NG3 A;  1D4E A;  4YSY A;  3AD9 B;  3CPI G;  3T14 A;  1DOD A;  4GUV A;  3ALL A;  1GV4 A;  1XHC A;  5JCK A;  2GV8 A;  1LQU A;  3C4N A;  3UP5 A;  3V3O A;  1VQW A;  2B9X A;  3HYX A;  4K8D A;  1E1M A;  3P4R A;  4YT0 A;  3AD8 B;  3AEB A;  2GQF A;  4G6H A;  1LVL A;  3SFE A;  3AE3 A;  2OAM A;  5FMH A;  4CNJ A;  1GES A;  3CIR A;  4U8O A;  1ZK7 A;  3H8I A;  1PDH A;  2AR8 A;  1N4W A;  4J33 A;  3P4P A;  3IHM A;  3T2Y A;  5HHF A;  2YLZ A;  2BA9 A;  3NN0 X;  1GRG A;  2OLO A;  3T37 A;  3AE4 A;  4BJY A;  2CFY A;  4GR1 A;  2XVH A;  1KNR A;  3SY4 A;  4OPD A;  1ZKQ A;  4DSG A;  2YR6 A;  3V3N A;  1GOS A;  3CPH G;  2TPR A;  2VRM A;  1JNR A;  4U8J A;  4D04 A;  5KNL A;  1ZOY A;  2YLW A;  4UP3 A;  1OJA A;  1F8W A;  5CKU A;  5KMS A;  1GEU A;  5ER0 A;  5JRB A;  2EQ6 A;  1MO9 A;  4KX6 A;  1JOA A;  3AYI A;  1OJ9 A;  4G74 A;  4ZCD A;  2R0C A;  3SM8 A;  4G73 A;  4GCM A;  3NK0 X;  3SFD A;  4BK1 A;  4GDP A;  4NWZ A;  4O5Q A;  3DGZ A;  3NKS A;  2YLX A;  4G6G A;  5EBK A;  4U2L A;  3DJG X;  3ZDN A;  1GRA A;  2V6O A;  2VRL A;  1PXA A;  3CGE A;  1H81 A;  4TM1 A;  4CCQ A;  3D8X A;  3GSI A;  3UP4 A;  3KPF A;  3FPZ A;  2A89 A;  3QSM A;  1YQ3 A;  2BXS A;  3DK4 A;  5U25 A;  1TYP A;  2YG6 A;  1NHR A;  1FEA A;  4BV6 A;  3HYW A;  2C72 A;  3QFA A;  4TM4 A;  2JB3 A;  3O0H A;  4GAV A;  4EIP A;  3VRD B;  5HXI A;  4Z44 A;  2X50 A;  3LJP A;  3AE1 A;  4H50 A;  3AE2 A;  2JKC A;  2Z5X A;  1BF3 A;  5FS6 A;  4X4J A;  4YSX A;  2BC0 A;  1PS9 A;  2F5Z A;  1TRB A;  3NRN A;  1GXF A;  2OLN A;  5CQF A;  4Z24 A;  3UOZ A;  1NPX A;  3ICT A;  1L9C A;  1L9D A;  1O95 A;  1PJ7 A;  3K30 A;  1EL8 A;  2A87 A;  3M13 A;  5TR3 A;  2C75 A;  4H4Z A;  2WEU A;  2C66 A;  3F8D A;  3BNM A;  1K0L A;  1VRQ B;  3NT6 A;  3NLC A;  1IJH A;  3BHF A;  1Y56 B;  2QA2 A;  5M10 A;  1B8S A;  1FOH A;  2R0P A;  3ABV A;  2HQM A;  2WP9 A;  1DXL A;  2V3A A;  3OZ2 A;  3AD7 B;  5BUK A;  3L5O A;  5U1O A;  3EF6 A;  1GRH A;  4TM0 A;  2WOI A;  1M6I A;  4K2X A;  2YWL A;  3KU9 A;  2XFN A;  3UTG A;  2ARD A;  4OPT A;  4AT0 A;  1GER A;  2BYB A;  1RP0 A;  4JY2 A;  3RHA A;  1NDA A;  3NN6 X;  4NTE A;  4OPG A;  4B64 A;  1GSN A;  3CNP A;  5GSN A;  3UKP A;  3RNM A;  5JCN A;  4H2Q A;  3AYJ A;  3DA1 A;  3NGC X;  3T2K A;  2YM2 A;  1LTX R;  4EMJ A;  1AOG A;  4Z2T A;  1HYU A;  1YY5 A;  2XLP A;  1KSU A;  1YKJ A;  2BCP A;  4A99 A;  2V5Z A;  1KN0 A;  3ALJ A;  2EQ8 A;  4CRT A;  5DBJ A;  4AOX A;  2C73 A;  2JAE A;  3PVC A;  4A5L A;  3RP6 A;  2GQW A;  2X8H A;  1CF3 A;  4EQX A;  1XDI A;  4M52 A;  3NIX A;  2C7G A;  1D4D A;  1K4Q A;  4BJZ A;  3CNS A;  1Q9I A;  1Y56 A;  1N1P A;  1H7W A;  2B76 A;  1EL7 A;  4UDP A;  2RGO A;  3ICS A;  1L9E A;  1K0J A;  5KVH A;  1EL9 A;  2JK6 A;  2X3N A;  3ITJ A;  1CC2 A;  3QSS A;  2WP6 A;  4OCG A;  3DH9 A;  3CGC A;  1GTH A;  2BAB A;  3Q9T A;  3M12 A;  2YVJ A;  4KPR A;  3ICR A;  4OPL A;  2C3D A;  2YG5 A;  4USQ A;  2A8X A;  4FX9 A;  2FBW A;  2PYX A;  5JCM A;  2VQ7 A;  2H89 A;  2YM1 A;  3QSE A;  2XDO A;  1B37 A;  2Q7V A;  3L8K A;  3H8L A;  3QJ4 A;  2BCG G;  5KWF A;  4OPI A;  4NNJ A;  1PN0 A;  1TDF A;  1IUS A;  3BHK A;  4YSH A;  1LPF A;  2RGJ A;  2GR3 A;  4CY8 A;  1F8R A;  3ALM A;  3ADA B;  1TDK A;  2BAC A;  3GDN A;  4DNA A;  4J31 A;  3CTY A;  4BK3 A;  3EAN A;  1OJD A;  3LXD A;  2JBV A;  4A65 A;  4NEV A;  1D7L A;  3B6D A;  2XFP A;  4JNQ A;  2XVE A;  1Q1W A;  2XVF A;  4H4W A;  3GYX A;  2GB0 A;  2AAQ A;  5U63 A;  4H4X A;  4YTN A;  3AEC A;  3QVP A;  3P4S A;  5KOW A;  1F6M A;  1DOE A;  4UDR A;  5FS8 A;  2I0Z A;  2R0G A;  4FK1 C;  2X8G A;  2RAB A;  3DK9 A;  2GMH A;  1NEK A;  2VVL G;  1DNC A;  3IWA A;  1L0V A;  3SX6 A;  1GET A;  3I6D A;  4Y4M A;  2YR5 A;  1E1N A;  1H6V A;  4K5R A;  1N4V A;  4C77 A;  2V3B A;  4FDC B;  5KOX A;  2ACZ A;  3LZX A;  1Y0P A;  4Y4L A;  2CUL A;  3AE9 A;  2Q0K A;  4J36 A;  3I3L A;  1YQ4 A;  2XCG A;  1QLB A;  3CPJ G;  5J7X A;  4A6N B;  2J3N A;  4Y4N A;  3AEF A;  3SZ0 A;  2ZBW A;  3SYI A;  4RG4 A;  4H2R A;  3AE5 A;  3SGL A;  3SQP A;  2XLS A;  1NAA A;  1B4V A;  3LZW A;  4H2N A;  3NYE A;  1ONF A;  2H88 A;  1PXB A;  3BI4 A;  2C70 A;  2R4E A;  4AP1 A;  1IUT A;  1RYI A;  2GR2 A;  2B7R A;  3GWF A;  3AEA A;  4RG3 A;  2GVC A;  4GAP A;  4U2S A;  5HY5 A;  1ZDL A;  3NG7 X;  1K0I A;  4DSH A;  2QAE A;  3BI5 A;  1KSS A;  4IA6 A;  2GMJ A;  2BXR A;  4JN9 A;  1NEN A;  1TDE A;  4YKF A;  4YTM A;  2X8C A;  4U8P A;  2FJB A;  4JNA A;  3S61 A;  2BS3 A;  4U8K A;  3CNJ A;  1E1K A;  3K7M X;  1KDG A;  3G5Q A;  3DGH A;  2WOW A;  1H84 A;  1S2Q A;  4BUR A;  1BWC A;  2V60 A;  1FEB A;  3C4A A;  4J34 A;  4LU6 A;  1CJC A;  1H2I A;  1H86 A;  2QCU A;  3G5S A;  4U2T A;  4NEW A;  1CJ3 A;  1COY A;  4B1B A;  4O5U A;  2CVJ A;  2C76 A;  5FS7 A;  2WDR A;  4XXG A;  3OC4 A;  2BC1 A;  2CDU A;  3GDP A;  3T0K A;  5JCI A;  3DME A;  1NG4 A;  4ICY A;  2Q0L A;  3UKL A;  1REO A;  4EIQ A;  1NHP A;  3P4Q A;  3D9X A;  5L46 A;  4U8M A;  1ZMD A;  3ATR A;  1M64 A;  1CJ4 A;  1PBE A;  1VG9 A;  4H4U A;  4EM3 A;  1DOC A;  3UKK A;  3NYF A;  1X31 B;  2YG3 A;  1CL0 A;  4II3 A;  1RSG A;  3NTA A;  5M0Z A;  3DK8 A;  1B5Q A;  3GYI A;  1CHU A;  5IPY A;  4CCR A;  5KRQ A;  2C65 A;  3KLJ A;  1OJT A;  3PS9 A;  1JU2 A;  2FJD A;  4Z25 A;  3DJJ A;  2WPC A;  3NK2 X;  1EBD A;  1QJD A;  1YQZ A;  2PHH A;  2BK3 A;  3Q6J A;  4I59 A;  1P2E A;  1PBB A;  4JQ9 A;  2GR0 A;  1OJC A;  1ELI A;  4GDE A;  4HB9 A;  3AEE A;  4H4Y A;  4A79 A;  3KKJ A;  4IVO B;  5BVA A;  3G5R A;  4LII A;  1JRZ A;  1TDO A;  1O94 A;  2VZ2 A;  3AWI A;  2XFQ A;  2C4C A;  1CBO A;  2XVI A;  4H7U A;  3VR8 A;  2WBA A;  3FG2 P;  1GND A;  2XLT A;  3UKF A;  4WCT A;  3GMC A;  1FEC A;  5GRT A;  4ECH A;  4I58 A;  5EB4 A;  4UDQ A;  4X9N A;  5KMR A;  1GTE A;  3NNE A;  3P1W A;  5J60 A;  2GAH B;  4NTC A;  4RSL A;  2BRA A;  3KVE A;  1E39 A;  1Q1R A;  4USR A;  2XLU A;  2ZZB A;  4AT2 A;  1GPE A;  4OVI A;  1W4X A;  2XFU A;  3M0O A;  4C5O A;  3GRS A;  4ADW A;  1MOK A;  1NHQ A;  1GRF A;  1ZOV A;  2XLR A;  3UTH A;  5EB5 A;  4XWR A;  2EQ7 A;  3LAD A;  1IUX A;  2AQJ A;  3PO7 A;  1H82 A;  2VVL A;  1BGJ A;  3COX A;  2QA1 A;  1JNZ A;  3EPT A;  4EQR A;  4PAA A;  4AOS A;  3H4K A;  2YLR A;  3K7Q X;  4FK1 A;  3UKQ A;  4AP3 A;  4APN A;  2C3C A;  5FS9 A;  1TDN A;  3BNU A;  4YXD A;  2O9Z A;  3B3R A;  3HYV A;  4D03 A;  4YKG A;  2WDQ A;  1XPQ A;  1FL2 A;  4REK A;  1IUW A;  1CC6 A;  2IVE A;  2OAL A;  2R45 A;  1F8S A;  2YLS A;  1BKW A;  1JRY A;  2DKH A;  5KXJ A;  1UKV G;  3SZC A;  2ZZC A;  3PG6 A;  2XFO A;  1KF6 A;  2W0H A;  3VQR A;  2E1M A;  2R46 A;  1DOB A;  4N9X A;  1GRE A;  2JB1 A;  3K7T A;  4B68 A;  2E5V A;  3UOY A;  3SXI A;  4TLX A;  3UOX A;  4JY3 A;  3P9U A;  1DJQ A;  3HZL A;  1JEH A;  1VDC A;  3GYJ A;  3GMB A;  4J57 A;  3KA7 A;  1CJ2 A;  4LA1 A;  4H4V A;  1VG0 A;  3CMM A;  3DJE A;  1GRB A;  2WES A;  3AE7 A;  3KD9 A;  4YTP A;  1ZP0 A;  4IA5 A;  4H4Q A;  3NTD A;  3UTF A;  2GR1 A;  5EOW A;  4DGK A;  1V59 A;  2NVK X;  1PJ5 A;  4TLZ A;  3SZW A;  4U8N A;  2YR4 A;  2BRY A;  2GAG B;  2WQY A;  1LJ1 A;  2WDV A;  1PXC A;  4OPC A;  4Z2U A;  2XYO A;  3AE6 A;  4GF7 A;  2WOV A;  2EQ9 A;  1LV0 A;  2FJA A;  4ZCC A;  3UTE A;  2NPX A;  2WPE A;  1N4U A;  3FIM B;  1BGN A;  4K5S A;  1O5W A;  2YG4 A;  1PBD A;  3AE8 A;  1S3E A;  4K22 A;  1QO8 A;  3CNT A;  3RED A;  4EMW A;  3II4 A;  3C96 A;  4C3Y A;  4Z2R A;  3URH A;  2Y6R A;  3VR9 A;  4H4T A;  3IC9 A;  2WU5 A;  1TYT A;  2OA1 A;  1E7P A;  2VQB A;  4HA6 A;  4U8I A;  3FMW A;  3CN8 A;  4XWZ A;  2Y6Q A;  5BUL A;  4K7Z A;  2YG7 A;  3CND A;  4EQS A;  2E4G A;  2WHD A;  4MJW A;  2B9W A;  2GF3 A;  2GEW A;  3E1T A;  1F3P A;  1S7M A;  5KVI A;  2TMD A;  4B69 A;  4E0V A;  4A6N A;  3ZYX A;  3LB8 A;  5IQ1 A;  1D7Y A;  3SZF A;  1S2Y A;  1BZL A;  4H4S A;  4H4R A;  4IV9 A;  5KMP A;  2Z5Y A;  3CGD A;  2YAU A;  3ISH A;  3DJD A;  3GRT A;  2FJE A;  4TM3 A;  1KFY A;  1CC4 A;  2YVF A;  4CY6 A;  3GD4 A;  3NYC A;  2BS2 A;  2GH5 A;  3WE0 A;  2ZZ0 A;  2RGH A;  2BK5 A;  1D5T A;  2V61 A;  4A9W A;  3QVR A;  3F8P A;  4NTD A;  4OPU A;  2BK4 A;  4IVM B;  4B65 A;  2Q6U A;  1MXT A;  2JB2 A;  1IUV A;  3UKH A;  5JCL A;  3UOV A;  1GAL A;  3T31 A;  4YWO A;  3UCL A;  3GWD A;  1GT8 A;  2WU2 A;  2VOU A;  4EMI A;  4PAB A;  2WP5 A;  4C3X A;  2IVD A;  3UKA A;  1LQT A;  3IHG A;  2VVM A;  2WET A;  3NHO X;  4II2 A;  3AEG A;  4G9K A;  2R9Z A;  1D4C A;  2C64 A;  3LOV A;  1H7X A;  4GRT A;  2WS3 A;  3NH3 X;  4P9S A;  3S5W A;  5LV9 A;  1DJN A;  4EM4 A;  4JDR A;  2B7S A;  3NK1 X;  5HYM A;  1NHS A;  2WPF A;  4NZH A;  3F8R A;  3EAO A;  1GRT A;  5C2T A;  2C67 A;  3VRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...