3CGDA

Pyridine nucleotide complexes with bacillus anthracis coenzyme a-disulfide reductase: a structural analysis of dual nad(p)h specificity
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
444
structure length
444
Chain Sequence
b'MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRDKYGIDAKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGAIGLEMAETFVELGKKVRMIERNDHIGTIYDGDMAEYIYKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLVSVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyridine nucleotide-disulfide oxidoreductase, class I
publication title Pyridine Nucleotide Complexes with Bacillus anthracis Coenzyme A-Disulfide Reductase: A Structural Analysis of Dual NAD(P)H Specificity.
pubmed doi rcsb
source organism Bacillus anthracis str.
molecule tags Oxidoreductase
total genus 154
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3cgdA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgdA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgdA02
2BYBA 5KVHA 2RGHA 4YSZA 1Q1RA 2YM2A 3AD8B 4M52A 3DJEA 5KXJA 5EB4A 3Q9TA 3DJGX 4D03A 1D7LA 1YQ3A 3BI5A 4BK1A 1RP0A 2CVJA 1GRBA 3ZYXA 5JCIA 4BJZA 2EQ9A 3CGCA 5JCMA 4NZHA 5TR3A 1GTEA 3ICSA 3UP5A 4CNKA 2V5ZA 2EQ8A 4E0VA 3AYIA 3VRDB 2HQMA 3F8DA 2GMJA 5M10A 4ZCDA 2BXSA 1F8WA 4OPTA 3GDNA 3GWDA 1PHHA 1E1LA 5EOWA 1FOHA 3KPFA 1OJAA 1NG4A 3FPZA 5KRQA 4B66A 1VQWA 1MOKA 3UOYA 1GESA 3AE6A 2BK3A 3BNMA 4TM4A 4J34A 1S3EA 2WDRA 2RGJA 3B6DA 1PDHA 2WETA 2ACZA 3P4RA 1E1KA 1GETA 4OPUA 4TM3A 2YG4A 1XDIA 3LXDA 5JCLA 1GV4A 1UKVG 3AE9A 2OLOA 1GRGA 2XFQA 4AT0A 3PO7A 1TYPA 2WOVA 1JOAA 4O5UA 1TDKA 2BC1A 3C4NA 1GRHA 4IVMB 5IPYA 2WOIA 4GDEA 5JCKA 3REDA 1NAAA 2WQYA 1L9EA 1N1PA 3BI4A 4Z2RA 3H8LA 4C5OA 4YKGA 1BZLA 1B5QA 4Z43A 4EQRA 3RNMA 4Z2TA 4NTEA 4ZCCA 4CCRA 4U8JA 2C7GA 3AE2A 4C3YA 3AB1A 3VRBA 1REOA 2YAUA 3OC4A 1BGJA 2BCGG 3AE8A 3NK0X 4H4PA 4USQA 4AP1A 2WP9A 2WS3A 3NKSA 3S61A 3AD9B 4J31A 4BK3A 1OJCA 2XFNA 2X8GA 4DSGA 2XYOA 4J33A 1FEBA 1H82A 2IIDA 3SGLA 4NTDA 2GVCA 4TLZA 2XDOA 3CN8A 5CQFA 3B3RA 1GPEA 5BUKA 2B76A 1E7PA 3CNSA 1OJTA 4Y4LA 3Q6JA 1FECA 4C74A 2V60A 1EBDA 2Q0LA 2YLWA 3QVPA 4TLXA 5J7XA 4B65A 4EMWA 2FJDA 4JNAA 4CRTA 2X50A 4IA5A 4TM1A 1Y56A 2WU2A 3GMBA 5U1OA 2GRTA 1CC2A 5IQ1A 2WEUA 1ONFA 2YLSA 4XXGA 1GNDA 2C67A 2WOWA 4H4UA 3CPHG 3UP4A 4H50A 3AE7A 4MJWA 1RSGA 2VRLA 5HHFA 1BGNA 3T37A 1CBOA 2XFPA 2VZ2A 1KDGA 1GXFA 2GQWA 2GR1A 3IC9A 1NG3A 3CGDA 2B9XA 2V3BA 3AECA 3V3OA 2JBVA 1NHQA 4H4RA 3AE4A 3DK4A 1NPXA 3ATRA 2YVGA 1GERA 4OCGA 1GEUA 1XHCA 2RABA 4Z44A 2XLSA 3P4SA 4X9MA 3UTGA 4ADWA 2BS4A 3NYCA 3GRSA 1K0JA 3IHGA 4H2RA 2BACA 1PXCA 2YVFA 4GCMA 1P2HA 3UTFA 2ZZCA 1PBBA 5M0ZA 2XVJA 5HXIA 3L1RA 4U8NA 3KU9A 3UCLA 1BKWA 3LZWA 2J3NA 4FDCB 5HY5A 3NGCX 1CHUA 4USRA 4B63A 2JB1A 2GMHA 4CY6A 1JEHA 4EQSA 3CTYA 3G5QA 1QJDA 1ZK7A 3AE5A 3CPJG 3I6DA 1L0VA 2OALA 3AEDA 1YY5A 4J57A 3NT6A 4LIIA 1K4QA 2R0PA 3ITJA 4GRTA 4B68A 2IVEA 2UZZA 5KWFA 1E39A 3UKFA 1PBDA 4YSXA 4PAAA 4A7AA 2YLXA 3RP6A 4RG4A 2XLTA 2Y6RA 4U8OA 5KVIA 3P4QA 1KNRA 1O94A 2YLTA 3NNEA 2C75A 1PXBA 3ADAB 5ER0A 3COXA 3BHKA 3O0HA 4NEWA 4J2WA 5EBKA 1DJNA 4K2XA 4HB9A 4ICYA 3SFEA 4D04A 2R4JA 2EQ6A 3NK1X 4JN9A 3GDPA 1ZY8A 2WHDA 1GRAA 2H89A 4GR1A 5KOXA 4U2SA 2BC0A 4FK1C 2WPFA 1QLBA 1D7YA 2C3DA 1CL0A 4AT2A 1LQUA 4DSHA 4FX9A 3K30A 1PS9A 4AOSA 3C96A 4YSYA 2XVHA 1D4CA 1Z6LA 3CPIG 1VDCA 2JB2A 4WCTA 4K22A 5FMHA 4Y4MA 2XVEA 3UKPA 4YSHA 1D4EA 4H2QA 4OPCA 1ELIA 1PBFA 2QA1A 2XLRA 2YG6A 3K7MX 3K7QX 5J60A 2OA1A 2BCPA 3CGEA 1N4UA 1E1NA 1ZX9A 1YQ4A 2WP5A 3ABVA 5CKUA 4A65A 4U8PA 2ZBWA 3ISHA 4X4JA 1PJ6A 3D8XA 3M13A 4A6NB 3GRTA 3K7TA 3RP8A 1EL5A 2JK6A 1KF6A 3NN0X 4B64A 3DK8A 3V76A 3DGHA 2C65A 1XANA 2B7RA 4J56A 1KFYA 2YR6A 1RYIA 2VQBA 3NIXA 1K0LA 2E1MA 4U8MA 1TDOA 2FJBA 4UP3A 3P4PA 1B8SA 4KPRA 1B37A 2V61A 2WPEA 2BA9A 2XVIA 4CCQA 4P9SA 2CDUA 4N9XA 2PYXA 4H2NA 1IUWA 2OLNA 1NEKA 1E1MA 2XLPA 4A79A 3HZLA 4B69A 2YG5A 5L46A 2V3AA 4U2LA 1V59A 1PBEA 5FS8A 4IA6A 2A8XA 1JRZA 4PABA 1L9DA 3FMWA 4Z25A 2BK4A 4JY2A 1FEAA 4K5SA 3KVEA 3QSMA 3UOXA 1FCDA 2YG3A 4U8KA 1M64A 4EIQA 2C64A 1ZKQA 4NTCA 2XFOA 1EL8A 4JNQA 1CJ3A 1KSSA 2AR8A 2AQJA 2GQFA 2I0ZA 1NHPA 4DGKA 2YLRA 3LB8A 1NDAA 4EM3A 4I58A 2C3CA 3S5WA 4H2PA 1OJ9A 2JAEA 2XVFA 4I59A 1CC6A 1QO8A 3V3NA 1IUUA 4FK1A 4BURA 4OPDA 2NVKX 4AP3A 4H4XA 3VR9A 5FS7A 3UKLA 4RG3A 3DJJA 3GD4A 3ATQA 3AYJA 1LQTA 3DH9A 1S2YA 4JY3A 1GOSA 4YTPA 3I3LA 2GF3A 3CIRA 1PBCA 3GWFA 3ALMA 3NYEA 4GF7A 4H4WA 4Y4NA 1LJ1A 2C72A 4B67A 2GAHB 3PVCA 3QJ4A 3SQPA 4WX1A 3GYIA 4A5LA 1DODA 4JQ9A 3AE1A 1NHRA 3LZXA 2W0HA 1P2EA 1H7WA 1KNPA 3R9UA 2O9ZA 3UOVA 1NHSA 5GRTA 2C73A 4A9WA 2BK5A 3CNTA 2FJAA 4REKA 4Z24A 3VRAA 2GR0A 4EMJA 3VR8A 2XFUA 4APNA 1YKJA 2VRMA 3C4AA 3AEBA 1GT8A 1IUTA 3NH3X 5KOWA 2DKHA 1GTHA 2WDVA 2YR4A 1HYUA 2Z5YA 3G5RA 3IHMA 4A6NA 1TYTA 1N4VA 4IVOB 1S3BA 3L8KA 3QVRA 4NEVA 3G5SA 4Z26A 3EPTA 1ZP0A 3ALJA 3LJPA 4U8LA 1TDFA 3UTHA 1PXAA 3ICTA 2CULA 4HA6A 5JCNA 2R45A 3FG2P 1TDNA 5IQ4A 2BABA 1H81A 3DA1A 3FIMB 5BULA 4YT0A 4H4TA 1OJDA 3AEEA 2APGA 2ZZ0A 3WE0A 2QAEA 1D5TA 2GR2A 3M12A 2QCUA 4XWZA 3EF6A 1Q9IA 1JNRA 1H6VA 2WP6A 3DMEA 3JSKA 3SM8A 2F5ZA 1IUVA 1F8RA 2H88A 3ZDNA 4K8DA 1PN0A 3SFDA 3GMCA 2EQ7A 2OAMA 4TM0A 3VQRA 3BI2A 4K7ZA 1DJQA 1ZMCA 5BVAA 3NTDA 4A99A 1LV0A 2VVMA 1DOBA 1JU2A 1EL7A 2FBWA 3ICRA 3D1CA 2CFYA 2YQUA 3LADA 1VRQB 4BJYA 1H7XA 2YG7A 3IWAA 3QSSA 2XCGA 1PJ7A 2X8CA 3AXBA 2TPRA 2WDQA 3CNJA 3AE3A 3UTEA 2X99A 2C70A 2YM1A 1ZOYA 4YWOA 2GH5A 3DK9A 2DKIA 2R9ZA 1KSUA 2YLZA 3QSEA 3KKJA 2B9YA 2IVDA 1GREA 3QFAA 1H86A 2TMDA 3CNDA 3UKAA 4H4SA 4OPLA 3UOZA 1MO9A 1F3PA 3NTAA 3OZ2A 3EANA 3ALLA 4OPGA 4ZN0A 1TDEA 1XPQA 3FBSA 4ECHA 3URHA 4H4QA 2V6OA 4YKFA 2A87A 3UKHA 1BF3A 3P1WA 4H4ZA 2Q0KA 3DJDA 4UDRA 2VOUA 1F8SA 5U63A 4DNAA 1E6EA 5HYMA 3P9UA 3DGZA 1Y0PA 2BXRA 3H8IA 4C77A 4YTNA 2PHHA 2YVJA 1LTXR 2R46A 4EMIA 1AOGA 2Q6UA 5C2TA 1Q1WA 1H83A 3E1TA 4LU6A 2ZZBA 3AWIA 1FL2A 1CJ4A 3NYFA 4H4VA 4H4YA 1ZDLA 1GSNA 4O5QA 2WPCA 1VG0A 4YTMA 2JB3A 2VVLA 1JNZA 2X3NA 3II4A 4KX6A 5EB5A 3KLJA 1LPFA 2XLUA 4GDPA 5BRTA 1PJ5A 3RP7A 1GRFA 2C76A 2WU5A 5DBJA 1CJ2A 2BS2A 1W4XA 2GV8A 3PS9A 4Z2UA 3EAOA 1VG9A 2Q7VA 2R0GA 3KA7A 3CNPA 3GSIA 4RSLA 1B4VA 1O95A 1L9CA 2RGOA 4U2TA 3RHAA 3NK2X 2QA2A 3BHFA 3IF9A 2X8HA 1K0IA 1IJHA 1EL9A 3NN6X 1ZMDA 2NPXA 1O5WA 2E5VA 1LVLA 2Z5XA 4EM4A 4CNJA 4B1BA 4OPIA 5GSNA 1COYA 3F8RA 4K5RA 2R0CA 3AYLA 3NG7X 1ZOVA 2B7SA 1BWCA 3UKKA 3F8PA 3AEFA 3BNUA 4GUVA 2WBAA 2GAGB 4BV6A 1CF3A 2GR3A 3M0OA 3AEAA 3GD3A 1CJCA 1X31B 4UDPA 3AD7B 2A89A 1D4DA 2AAQA 1MXTA 4CBQA 4YXDA 2YWLA 3CGBA 1H84A 4BK2A 1S2QA 4U8IA 2VQ7A 2C66A 4H7UA 4EIPA 4C3XA 5C3JA 2R4EA 1YQZA 4J36A 3NLCA 3UKQA 1F6MA 4LA1A 2B9WA 2VVLG 2Y6QA 1IUSA 3AEGA 4OVIA 1JRXA 4IV9A 1DXLA 1GALA 1N4WA 2YR5A 1IUXA 5U25A 1GRTA 4CY8A 5LV9A 1DOCA 3NRNA 1JRYA 1DNCA 5FS6A 4EQXA 2BS3A 3GYJA 3QFBA 1M6IA 2WESA 4JDRA 4XWRA 1Y56B 1NENA 4AOXA 5FS9A 2GEWA 4EQWA 3H4KA 1TRBA 2E4GA 2FJEA 4UDQA 2JKCA 1DOEA 3LOVA 1SEZA 2GB0A 3KD9A 2ARDA 3NHOX 1CC4A 4X9NA
chains in the Genus database with same CATH superfamily
5KVHA 1Q1RA 3HYXA 1SJCA 3Q9TA 3U9IA 1GTEA 3CXBA 3AYIA 4ENLA 3OPSA 2BXSA 1F8WA 3GWDA 4TVYA 4KEMA 1FFUC 4B66A 3BNMA 4J34A 1S3EA 1PDHA 1GETA 2YG4A 3AE9A 2OLOA 1FIQB 2WOVA 5IPYA 2WOIA 3H8AA 4GYPA 1L9EA 3H8LA 2PTXA 1XPYA 2HXTA 3RNMA 2ZC8A 4C3YA 4USQA 2BCGG 4DYEA 1MDRA 3AD9B 1OJCA 4DSGA 2XYOA 1FEBA 4TLZA 2OO6A 3N4EA 2XDOA 3B3RA 3B9JB 1E7PA 1BKHA 1OJTA 1FECA 2V60A 3HPFA 5J7XA 3QVPA 4CRTA 2X50A 3TQPA 1ONFA 4XXGA 4MJWA 2VRLA 1BGNA 5JRBA 4MGGA 3OTRA 2XFPA 1NG3A 4KPLA 3DK4A 1NPXA 3ATRA 3P4SA 4X9MA 2BS4A 2FYMA 4G6GA 2BACA 4GCMA 1P2HA 4JN7A 5M0ZA 2XVJA 4U8NA 3KU9A 3LZWA 2J3NA 4FDCB 1CHUA 5KMPA 2JB1A 1L0VA 3CPJG 1ZK7A 3I6DA 4J57A 3SYIA 1K4QA 2R0PA 2IVEA 4RG4A 2XLTA 5KVIA 1O94A 3ADAB 4K1WA 4K2XA 3SFEA 4HB9A 4ICYA 3NK1X 3GDPA 2WHDA 4GFIA 2OZTA 2P3ZA 1D7YA 6ENLA 1VQZA 1LQUA 4DWDA 4Y4MA 3CPIG 4K22A 5FMHA 2XLRA 2OA1A 1E1NA 2WP5A 2PU1A 4X2PA 4X4JA 3GRTA 3RP8A 3L5OA 2JK6A 3V76A 2C65A 2B7RA 1KFYA 2GGEA 1B37A 2V61A 5G5GB 5FJOA 3V3WA 3S5SA 2OZ8A 1IUWA 4KWSA 4A79A 3HZLA 4B69A 1DTNA 5L46A 4II3A 4U2LA 1V59A 1N5WC 1FEAA 3R0UA 2XFOA 4JNQA 2I0ZA 3ZVHA 2AQJA 2GQFA 1NHPA 3S5WA 1OJ9A 4YWSA 4HCHA 4I59A 1CC6A 3TTEA 5FJRA 3T31A 5FS7A 2QVHA 2PMQA 1GOSA 4YTPA 3CIRA 3PK7A 4Y4NA 2C72A 4B67A 3QJ4A 3SQPA 3OW1A 4DN1A 3R9UA 1EBGA 1NHSA 3R0KA 2FJAA 4REKA 3T14A 3VRAA 4EMJA 3VR8A 1YKJA 3C4AA 4ZOHB 3AEBA 2DKHA 2WDVA 3G5RA 2Z5YA 3SZ0A 3IHMA 3L8KA 3QVRA 3MQTA 1X2HA 4Z26A 3BJSA 1ZP0A 1SJDA 4U8LA 4ZA0A 4HA6A 1KKOA 3NXLA 1OJDA 2APGA 3WE0A 1D5TA 2QCUA 3JSKA 3ZDNA 2PTZA 5KRQA 4TM0A 3VQRA 4ROPA 1DJQA 2MUCA 3UGVA 3ICRA 3IJIA 2GGIA 3IWAA 4IT1A 3QSSA 2X8CA 3NO1A 1ZOYA 2FKPA 3HW2A 3QSEA 2B9YA 1H86A 3CNDA 4H4SA 3NTAA 4ZN0A 4ECHA 4YKFA 1BF3A 2Q0KA 5HYMA 3DGZA 1STZA 2YVJA 2R46A 5C2TA 3H7VA 3E1TA 4H4VA 3FVDA 1VG0A 4YTMA 2X3NA 5EB5A 3A7AA 3SN1A 5BRTA 3RP7A 2WU5A 2XH2A 2BS2A 2W55A 3UJRA 3EAOA 4IHCA 3CNPA 1B4VA 2PSNA 1L9CA 4DX3A 3BHFA 3IF9A 1ZMDA 5EU9A 2CHRA 2Z5XA 1SB3B 3P3BA 3F8RA 3CAWA 3AYLA 4K8GA 1BWCA 4E4UA 3AEFA 4G9KA 1P48A 5FJTA 3THUA 4GUVA 2GAGB 2GR3A 3M0OA 1MDLA 3SSZA 4YXDA 3CK5A 2DW7A 3RRAA 4J36A 3NLCA 4GYPC 2VVLG 1H2IA 3H70A 4HNCA 4OVIA 3MSYA 3CYJA 4IV9A 1DXLA 4CY8A 1DOCA 1DNCA 4Z17A 3VDGA 1FFVC 3R25A 4XWRA 1NENA 2PPGA 5FS9A 3K1GA 2ARDA 4IP5A 3NHOX 1CC4A 2OQYA 4YSZA 4M52A 5KXJA 4D03A 3R1ZA 1RP0A 2CVJA 1GRBA 1JRPA 5JCIA 3CGCA 5JCMA 3UP5A 2V5ZA 2EQ8A 4E0VA 3Q45A 1FO4A 3VRDB 2GMJA 5M10A 3Q4DA 1NG4A 3FPZA 4G73A 3CMMA 1GESA 3AE6A 2QJJA 2RDXA 3RR1A 2RGJA 5KNLA 4TM3A 3ES7A 1XDIA 2P8CA 1GV4A 1UKVG 3PO7A 1TYPA 2PODA 4O5UA 3UXLA 1FHUA 1NAAA 3RO6A 3OZMA 4IZGA 4NTEA 3QLDA 4CCRA 4U8JA 2C7GA 1JPMA 1PDZA 4AP1A 2WP9A 3NKSA 4J31A 4BK3A 4J33A 3HYVA 4NTDA 2GVCA 3CN8A 2GGGA 5G5HB 1GPEA 5BUKA 4C74A 2Q0LA 1WUEA 4EMWA 4IA5A 4TM1A 1Y56A 3ZLFA 1CC2A 3SQSA 1GNDA 1V97A 4H4UA 3CPHG 4H50A 4IL0A 3AE7A 5HHFA 2AL2B 3T37A 3JZUA 2GQWA 2GR1A 3T0KA 1NELA 4OCGA 4Z44A 1XHCA 3MY9A 3IHGA 1PXCA 3UTFA 2ZZCA 1N60C 3NGCX 4USRA 4B63A 2GMHA 3G5QA 4EQSA 2OALA 4G7FA 1YY5A 2W3RA 4LIIA 3ITJA 2POZA 4H83A 3TJIA 1E39A 4YSXA 2Y6RA 1N62C 1PXBA 3COXA 3PWGA 4J2WA 4NEWA 1NU5A 3DFYA 1DJNA 2R4JA 2EQ6A 3ZLGA 1ZY8A 3GC2A 3NFUA 2BC0A 1QLBA 3IK4A 1ZXIC 2OQHA 4AOSA 2XVHA 1D4CA 1S7MA 1VDCA 2JB2A 3UKPA 4H1ZA 1ELIA 3K7QX 2YG6A 3K7MX 1N4UA 3GD6A 5CKUA 4U8PA 3ISHA 1FHVA 3K7TA 3NN0X 2P88A 1XANA 1TDOA 2FJBA 4KPRA 2WPEA 2BA9A 1TKKA 4P9SA 4H2NA 3BSMA 1E1MA 4GAPA 2V3AA 3UCCA 4K5SA 3KVEA 3UOXA 1FCDA 4U8KA 4EIQA 3U4FA 2AR8A 4G6HA 2YLRA 2C3CA 4H2PA 2XVFA 3TJ4A 3V3NA 4MMWA 2NVKX 4H4XA 3VR9A 3UKLA 1EC9A 3GD4A 3VFCA 2OFJA 3I3LA 2GF3A 3GWFA 3ALMA 3IJQA 4H4WA 1LJ1A 3GYIA 4A5LA 3QPEA 1H7WA 1SJBA 1KNPA 3UOVA 2O9ZA 2C73A 3JW7A 2BK5A 4DXKA 4Z24A 4NNJA 4APNA 1KKRA 3RITA 1GT8A 2YR4A 1BQGA 3ALJA 3LJPA 1N63C 1JROA 5JCNA 3TW9A 5BULA 4YT0A 2ZZ0A 2QGYA 2GR2A 2XGZA 1JNRA 2AL1A 4A6GA 1F8RA 2H88A 3SFDA 1EBHA 2EQ7A 2OAMA 3JVAA 1TZZA 3EUB3 4A99A 1DOBA 1KN0A 3IJLA 2FBWA 2PU0A 3I4KA 1PJ7A 3SN0A 3CNJA 2X99A 3UXKA 4NWZA 3UJSA 3UJEA 3DK9A 1KSUA 3KKJA 4OPLA 3UOZA 1F3PA 3OZ2A 3EANA 3URHA 2V6OA 2A87A 2XH0A 4UDRA 1F8SA 2BXRA 3H8IA 2PHHA 3D46A 1AOGA 1Q1WA 3DEQA 3PFRA 4EWJA 4H4YA 4M0XA 3II4A 4GDPA 1PJ5A 4TVWA 2C76A 3PS9A 1CJ2A 2R0GA 3T6CA 3KA7A 3GSIA 2RGOA 4U2TA 3RHAA 2QA2A 1K0IA 1IJHA 1EL9A 4MKSA 1W6TA 1LVLA 2PP0A 4EM4A 3SXIA 4CNJA 1RM6B 4E5TA 3NG7X 1ZOVA 3UKKA 3MUCA 4BV6A 3DESA 3EKGA 1D4DA 3CGBA 3FV9A 2C66A 2R4EA 3UKQA 3AEGA 2P0IA 3UJ2A 1JRXA 3KUMA 1GALA 2YR5A 1N4WA 5U25A 1GRTA 3NRNA 2BS3A 3OP2A 2QDDA 4JDRA 3ZVHB 2E3TA 1VDVA 4UDQA 2JKCA 4M6UA 1DOEA 3KD9A 2GDQA 2HNEA 3GO2A 1MUCA 3AD8B 3DJEA 5EB4A 4II2A 1YQ3A 4BK1A 3ZYXA 2EQ9A 4NZHA 5TR3A 3ICSA 1MNSA 1KD0A 4J1OA 4Z1YA 3P0WA 3F8DA 4ZCDA 4OPTA 3GDNA 1PHHA 1FOHA 2GSHA 3UOYA 3AMZA 3ENLA 2ACZA 2ZADA 3LXDA 5JCLA 3R11A 1GRGA 1TDKA 2BC1A 3C4NA 4IVMB 4GDEA 1EC7A 3BI4A 4C5OA 4YKGA 4Z2TA 4EQRA 3NZGA 3AB1A 2YAUA 3NK0X 4H4PA 2WS3A 3S61A 3AM9A 3DG3A 3SGLA 4E4FA 2B76A 3CNSA 4Y4LA 1TE6A 4F4RA 3S47A 1JDFA 4TLXA 4B65A 4JNAA 2WU2A 4G8TA 2PP1A 3GMBA 2YLSA 2WOWA 3ES8A 1R6WA 1CBOA 1KDGA 1GXFA 3IC9A 2B9XA 3CGDA 3V3OA 2JBVA 1NHQA 3AE4A 5KWFA 2YVGA 1GERA 1GEUA 2RABA 4G74A 3UTGA 3ZLHA 4H2RA 3FCPA 3L1RA 3UCLA 1BKWA 5HY5A 3GY1A 3AE5A 3MKCA 3AEDA 4GGBA 5IDZA 4GRTA 4B68A 2OLAA 4A7AA 1KNRA 3VC6A 3DG7A 3DFHA 1GRAA 2OG9A 4GR1A 5KOXA 4U2SA 4AT2A 4DSHA 3K30A 4YSYA 1Z6LA 4YSHA 4OPCA 1PBFA 1WUFA 3CGEA 4IP4A 1YQ4A 2ZBWA 3T4WA 1L8PA 3M13A 4A6NB 4H2HA 4JN8A 1EL5A 4B64A 3HRDC 3DK8A 3NRZB 3ETRB 1RYIA 3AN1A 2E1MA 4U8MA 4UP3A 3DERA 4N9XA 2PYXA 5FS8A 4PABA 1L9DA 3FMWA 4JY2A 3QSMA 1M64A 1ZKQA 4NTCA 2GGHA 1KSSA 3DIPA 4DGKA 3FYYA 4I58A 1NDAA 3SZWA 2JAEA 1N61C 1QO8A 2XH7A 4FK1A 4BURA 4OPDA 3MWCA 3DJJA 3ATQA 3AYJA 1S2YA 3T2YA 1PBCA 3HYWA 4HCDA 3SZFA 3NYEA 4GF7A 2GAHB 3PVCA 4WX1A 4ZCWA 4JQ9A 1P2EA 2OVLA 3A7RA 4E6MA 5GRTA 3N6HA 3CNTA 1EC8A 2XSXA 3VA8A 5KOWA 1IUTA 3V4BA 1GTHA 1HYUA 1F9CA 1TYTA 2QJMA 4IVOB 4HYRA 4NEVA 3G5SA 3EPTA 2BRYA 1TDFA 3DDMA 3UTHA 3FG2P 3DA1A 2HXUA 1H81A 2W3SA 2BRAA 4H4TA 3BOXA 2QAEA 3M12A 1Q9IA 1H6VA 3DMEA 2F5ZA 2NQLA 3GMCA 5BVAA 5KMRA 1LV0A 1JU2A 1EL7A 3R10A 2CFYA 1VRQB 3LADA 2YG7A 2TPRA 2W54A 3UTEA 3UCDA 2YM1A 4YWOA 2GH5A 2DKIA 2R9ZA 3SJNA 2E5AA 3UKAA 5KMQA 3ALLA 4OPGA 1TDEA 4HNLA 1XPQA 3FBSA 1N5XA 4H4QA 5U63A 2AKZA 4DNAA 1E6EA 1Y0PA 4YTNA 4EMIA 1H83A 3AWIA 3T2KA 1CJ4A 3NYFA 2OKTA 4GIRA 1ZDLA 1GSNA 2WPCA 1JNZA 2PP3A 3KLJA 2XLUA 5DBJA 1W4XA 4Z2UA 2Q7VA 3NK2X 3NN6X 2NPXA 2E5VA 4B1BA 4OPIA 5GSNA 1COYA 3SZCA 3AEAA 3GD3A 1CJCA 3AD7B 1MXTA 4CBQA 2YWLA 4GMEA 4GISA 4BK2A 2VQ7A 1PDYA 3TOYA 4EIPA 4C3XA 3VCNA 1XS2A 2P8BA 1F6MA 2PA6A 2B9WA 5FJUA 3RCYA 5FS6A 3GYJA 2PGEA 3ZVIA 4HCLA 4AOXA 2GEWA 2E4GA 4DHGA 3H4KA 3TWBA 4EQWA 1TRBA 2FJEA 3NVWB 3RP6A 5J04A 5IQ1A 4X9NA 2BYBA 2RGHA 4E8GA 2YM2A 3DJGX 1IYXA 3N6JA 1D7LA 3BI5A 1ECQA 4BJZA 4GGHA 4CNKA 1KCZA 3KPKA 3RGTA 4IL2A 2HQMA 4FP1A 1E1LA 5EOWA 3KPFA 1OJAA 1VQWA 1MOKA 2BK3A 4TM4A 2WDRA 3B6DA 3P93A 2WETA 3P4RA 1E1KA 4OPUA 2XFQA 4AT0A 1JOAA 1GRHA 5JCKA 3VC5A 3REDA 2WQYA 1N1PA 2QDEA 4Z2RA 1BZLA 1B5QA 4Z43A 4ZCCA 3PWIA 3AE2A 3VRBA 1REOA 3AE8A 3OC4A 1BGJA 3FJ4A 2XFNA 2X8GA 3DGBA 5FJPA 3UJFA 1H82A 2IIDA 5CQFA 5BOEA 3Q6JA 2QJNA 1EBDA 2YLWA 2FJDA 5U1OA 3I6EA 2GRTA 2WEUA 2C67A 3UP4A 1X2GA 2AKMA 5BOFA 4K2SA 1RSGA 3SX6A 4H19A 3EEZA 3TCSA 2VZ2A 3T9PA 2V3BA 3AECA 4H4RA 2XLSA 4ADWA 3NYCA 3GRSA 1K0JA 2YVFA 5HXIA 1PBBA 2HZGA 3N4FA 1T3QC 4CY6A 1JEHA 3CTYA 1QJDA 2ONEA 3NT6A 2UZZA 3UKFA 1PBDA 4PAAA 2YLXA 2I5QA 4U8OA 3P4QA 2YLTA 3NNEA 2C75A 5ER0A 3BHKA 3O0HA 5EBKA 4D04A 2O56A 3T8QA 4JN9A 5KMSA 3FXGA 2H89A 4FK1C 2WPFA 2OX4A 1MRAA 2C3DA 1CL0A 2QQ6A 4FX9A 3I6TA 3DG6A 1PS9A 3C96A 3V5CA 3OZYA 4WCTA 2PGWA 2XVEA 1D4EA 4H2QA 2QA1A 3T2ZA 3V5FA 5J60A 2BCPA 2PTWA 1ZX9A 3ABVA 4A65A 3TWAA 1PJ6A 3D8XA 1KF6A 2GGJA 3DGHA 4J56A 2YR6A 3CB3A 2VQBA 3NIXA 1K0LA 3P4PA 1B8SA 2XVIA 4CCQA 2CDUA 2OLNA 1NEKA 2XLPA 2YG5A 3VCCA 3STPA 1JCTA 4KT2A 1PBEA 4IA6A 2A8XA 1JRZA 3D9XA 4Z25A 2BK4A 4GAVA 2YG3A 2C64A 1EL8A 3SN4A 4A35A 1CJ3A 3LB8A 3QKEA 4EM3A 4HPNA 1OEPA 1IUUA 4AP3A 1JPDX 4FI4A 4RG3A 1LQTA 3DH9A 2XH4A 4JY3A 1DODA 3AE1A 1ELSA 1NHRA 3LZXA 2W0HA 2OZ3A 3A7UA 4A9WA 2GR0A 2XFUA 2VRMA 3D47A 3NH3X 4A6NA 1N4VA 1S3BA 4A3RA 1PXAA 3ICTA 2CULA 2DW6A 2R45A 4JHMA 1TDNA 5IQ4A 2BABA 3FIMB 3AEEA 4XWZA 7ENLA 3EF6A 3SR6B 3CT2A 2WP6A 3SM8A 1IUVA 4K8DA 1PN0A 3BI2A 4K7ZA 1ZMCA 3NTDA 2VVMA 3MZNA 3NVYB 3D1CA 2YQUA 4BJYA 1YEYA 3SY4A 1H7XA 2XCGA 3AXBA 2WDQA 3AE3A 2PTYA 2C70A 1R0MA 2YLZA 2IVDA 1GREA 3QFAA 2AL2A 2TMDA 1SJAA 1MO9A 3NVZB 3NS1B 3PG6A 3UKHA 3P1WA 4H4ZA 3DJDA 2VOUA 3P9UA 1P43A 4C77A 1LTXR 2Q6UA 1WYGA 3QN3A 4LU6A 2ZZBA 1FL2A 1E9IA 4O5QA 2JB3A 2VVLA 4KX6A 2PS2A 1LPFA 1GRFA 2MNRA 2GV8A 1VG9A 3QTPA 1ONEA 4RSLA 1O95A 2X8HA 1O5WA 3R07C 2GL5A 4K5RA 2R0CA 2B7SA 3F8PA 3BNUA 2PCEA 3H12A 2WBAA 4J3ZA 1CF3A 1X31B 4UDPA 4HN8A 1RVKA 2A89A 2AAQA 1H84A 1S2QA 4U8IA 4H7UA 5C3JA 3SBFA 1YQZA 3NVVB 3CXOA 4LA1A 2Y6QA 1IUSA 2OPJA 2C4CA 1IUXA 5LV9A 1JRYA 4EQXA 3QFBA 1M6IA 2WESA 3GYXA 1Y56B 3B97A 5ENLA 3LOVA 1SEZA 2GB0A
chains in the Genus database with same CATH topology
2BYBA 5KVHA 2RGHA 4YSZA 1Q1RA 2YM2A 3HYXA 3AD8B 4M52A 3DJEA 5KXJA 5EB4A 3Q9TA 3DJGX 4II2A 4D03A 1D7LA 1YQ3A 3BI5A 4BK1A 1RP0A 2CVJA 1GRBA 3ZYXA 5JCIA 4BJZA 2EQ9A 3CGCA 5JCMA 4NZHA 5TR3A 1GTEA 3ICSA 3UP5A 4CNKA 2V5ZA 3KPKA 2EQ8A 4E0VA 3AYIA 3VRDB 2HQMA 3F8DA 2GMJA 5M10A 4ZCDA 2BXSA 1F8WA 4OPTA 3GDNA 3GWDA 1PHHA 1E1LA 5EOWA 1FOHA 3KPFA 1OJAA 1NG4A 3FPZA 4G73A 5KRQA 4B66A 3CMMA 1VQWA 1MOKA 3UOYA 1GESA 3AE6A 2BK3A 3BNMA 4TM4A 4J34A 1S3EA 2WDRA 2RGJA 3B6DA 1PDHA 2WETA 2ACZA 3P4RA 1E1KA 1GETA 5KNLA 4OPUA 4TM3A 2YG4A 1XDIA 3LXDA 5JCLA 1GV4A 1UKVG 3AE9A 2OLOA 1GRGA 2XFQA 4AT0A 3PO7A 1TYPA 2WOVA 1JOAA 4O5UA 1TDKA 2BC1A 3C4NA 1GRHA 4IVMB 5IPYA 2WOIA 4GDEA 5JCKA 3REDA 1NAAA 2WQYA 1L9EA 1N1PA 3BI4A 4Z2RA 3H8LA 4C5OA 4YKGA 1BZLA 1B5QA 4Z43A 4EQRA 3RNMA 4Z2TA 4NTEA 4ZCCA 4CCRA 4U8JA 2C7GA 3AE2A 4C3YA 3AB1A 3VRBA 1REOA 2YAUA 3OC4A 1BGJA 2BCGG 3AE8A 3NK0X 4H4PA 4USQA 4AP1A 2WP9A 2WS3A 3NKSA 3S61A 3AD9B 4J31A 4BK3A 1OJCA 2XFNA 2X8GA 4DSGA 2XYOA 4J33A 3HYVA 1FEBA 1H82A 2IIDA 3SGLA 4NTDA 2GVCA 4TLZA 2XDOA 3CN8A 5CQFA 3B3RA 1GPEA 5BUKA 2B76A 1E7PA 3CNSA 1OJTA 4Y4LA 3Q6JA 1FECA 4C74A 2V60A 1EBDA 2Q0LA 2YLWA 3QVPA 4TLXA 5J7XA 4B65A 4EMWA 2FJDA 4JNAA 4CRTA 2X50A 4IA5A 4TM1A 1Y56A 2WU2A 3GMBA 5U1OA 2GRTA 1CC2A 5IQ1A 2WEUA 1ONFA 2YLSA 4XXGA 1GNDA 2C67A 2WOWA 4H4UA 3CPHG 3UP4A 4H50A 3AE7A 4MJWA 1RSGA 3SX6A 2VRLA 5HHFA 1BGNA 5JRBA 3T37A 1CBOA 2XFPA 2VZ2A 1KDGA 1GXFA 2GQWA 2GR1A 3IC9A 1NG3A 2V3BA 3CGDA 2B9XA 3AECA 3T0KA 3V3OA 2JBVA 1NHQA 4H4RA 3AE4A 3DK4A 1NPXA 3ATRA 2YVGA 1GERA 4OCGA 1GEUA 1XHCA 2RABA 4Z44A 2XLSA 3P4SA 4G74A 4X9MA 3UTGA 4ADWA 2BS4A 3NYCA 3GRSA 4G6GA 1K0JA 3IHGA 4H2RA 2BACA 1PXCA 2YVFA 4GCMA 1P2HA 3UTFA 2ZZCA 1PBBA 5M0ZA 2XVJA 5HXIA 3L1RA 4U8NA 3KU9A 3UCLA 1BKWA 3LZWA 2J3NA 4FDCB 5HY5A 3NGCX 1CHUA 4USRA 4B63A 5KMPA 2JB1A 2GMHA 4CY6A 1JEHA 4EQSA 3CTYA 3G5QA 1QJDA 1ZK7A 3AE5A 3CPJG 3I6DA 1L0VA 2OALA 3AEDA 1YY5A 4J57A 3NT6A 3SYIA 4LIIA 1K4QA 2R0PA 3ITJA 4GRTA 4B68A 2IVEA 2UZZA 5KWFA 1E39A 3UKFA 1PBDA 4YSXA 4PAAA 4A7AA 2YLXA 3RP6A 4RG4A 2XLTA 2Y6RA 4U8OA 5KVIA 3P4QA 1KNRA 1O94A 2YLTA 3NNEA 2C75A 1PXBA 3ADAB 5ER0A 3COXA 3BHKA 3O0HA 4NEWA 4J2WA 5EBKA 1DJNA 4K2XA 4HB9A 4ICYA 3SFEA 4D04A 2R4JA 2EQ6A 3NK1X 4JN9A 5KMSA 3GDPA 1ZY8A 2WHDA 1GRAA 2H89A 4GR1A 5KOXA 4U2SA 2BC0A 4FK1C 2WPFA 1QLBA 1D7YA 2C3DA 1CL0A 4AT2A 1LQUA 4DSHA 4FX9A 3K30A 1PS9A 4AOSA 3C96A 4YSYA 2XVHA 1D4CA 1Z6LA 3CPIG 1S7MA 1VDCA 2JB2A 4K22A 5FMHA 4WCTA 2XVEA 4Y4MA 3UKPA 4YSHA 1D4EA 4H2QA 4OPCA 1ELIA 1PBFA 2QA1A 2XLRA 2YG6A 3K7MX 3K7QX 3T2ZA 2OA1A 2BCPA 3CGEA 5J60A 1N4UA 1E1NA 1ZX9A 1YQ4A 2WP5A 3ABVA 5CKUA 4A65A 4U8PA 2ZBWA 3ISHA 4X4JA 1PJ6A 3D8XA 3M13A 4A6NB 3GRTA 3K7TA 3RP8A 1EL5A 3L5OA 2JK6A 1KF6A 3NN0X 4B64A 3DK8A 3V76A 3DGHA 2C65A 1XANA 2B7RA 4J56A 1KFYA 2YR6A 1RYIA 2VQBA 3NIXA 1K0LA 2E1MA 4U8MA 1TDOA 2FJBA 4UP3A 3P4PA 1B8SA 4KPRA 1B37A 2V61A 2WPEA 2BA9A 2XVIA 4CCQA 4P9SA 2CDUA 4N9XA 2PYXA 4H2NA 1IUWA 2OLNA 1NEKA 1E1MA 2XLPA 4A79A 3HZLA 4B69A 2YG5A 4GAPA 5L46A 4II3A 2V3AA 4U2LA 1V59A 1PBEA 5FS8A 4IA6A 2A8XA 1JRZA 4PABA 3D9XA 1L9DA 3FMWA 4Z25A 2BK4A 4GAVA 1FEAA 4JY2A 4K5SA 3KVEA 3QSMA 3UOXA 1FCDA 2YG3A 4U8KA 1M64A 4EIQA 2C64A 1ZKQA 4NTCA 2XFOA 1EL8A 4JNQA 1CJ3A 1KSSA 2AR8A 2AQJA 2GQFA 2I0ZA 1NHPA 4DGKA 4G6HA 2YLRA 3LB8A 1NDAA 4EM3A 4I58A 2C3CA 3S5WA 4H2PA 1OJ9A 3SZWA 2JAEA 2XVFA 4I59A 1CC6A 1QO8A 3V3NA 1IUUA 4FK1A 3T31A 4BURA 4OPDA 2NVKX 4AP3A 4H4XA 3VR9A 5FS7A 3UKLA 4RG3A 3DJJA 3GD4A 3ATQA 3AYJA 1LQTA 3DH9A 1S2YA 4JY3A 1GOSA 4YTPA 3I3LA 2GF3A 3T2YA 3CIRA 1PBCA 3GWFA 3HYWA 3ALMA 3SZFA 3NYEA 4GF7A 4H4WA 4Y4NA 1LJ1A 2C72A 4B67A 2GAHB 3PVCA 3QJ4A 3SQPA 4WX1A 3GYIA 4A5LA 1DODA 4JQ9A 3AE1A 1NHRA 3LZXA 2W0HA 1P2EA 1H7WA 1KNPA 3R9UA 2O9ZA 3UOVA 1NHSA 5GRTA 2C73A 4A9WA 2BK5A 3CNTA 2FJAA 4REKA 4Z24A 4NNJA 3T14A 3VRAA 2GR0A 4EMJA 3VR8A 2XFUA 4APNA 1YKJA 2VRMA 3C4AA 3AEBA 1GT8A 1IUTA 3NH3X 5KOWA 2DKHA 1GTHA 2WDVA 2YR4A 1HYUA 2Z5YA 3G5RA 3IHMA 3SZ0A 4A6NA 1TYTA 1N4VA 4IVOB 1S3BA 3L8KA 3QVRA 4NEVA 3G5SA 4Z26A 3EPTA 2BRYA 1ZP0A 3ALJA 3LJPA 4U8LA 1TDFA 3UTHA 1PXAA 3ICTA 2CULA 4HA6A 5JCNA 2R45A 3FG2P 1TDNA 5IQ4A 2BABA 1H81A 3DA1A 2BRAA 3FIMB 5BULA 4YT0A 4H4TA 1OJDA 3AEEA 2APGA 2ZZ0A 3WE0A 2QAEA 1D5TA 2GR2A 3M12A 2QCUA 4XWZA 3EF6A 1Q9IA 1JNRA 1H6VA 2WP6A 3DMEA 3JSKA 3SM8A 2F5ZA 1IUVA 1F8RA 2H88A 3ZDNA 4K8DA 1PN0A 3SFDA 3GMCA 2EQ7A 2OAMA 4TM0A 3VQRA 3BI2A 4K7ZA 1DJQA 1ZMCA 5BVAA 3NTDA 4A99A 5KMRA 1LV0A 2VVMA 1DOBA 1JU2A 1KN0A 1EL7A 2FBWA 3ICRA 3D1CA 2CFYA 2YQUA 3LADA 1VRQB 4BJYA 3SY4A 1H7XA 2YG7A 3IWAA 3QSSA 2XCGA 1PJ7A 2X8CA 3AXBA 2TPRA 2WDQA 3CNJA 3AE3A 3UTEA 2X99A 2C70A 4NWZA 2YM1A 1ZOYA 4YWOA 2GH5A 3DK9A 2DKIA 2R9ZA 1KSUA 2YLZA 3QSEA 3KKJA 2B9YA 2IVDA 1GREA 3QFAA 1H86A 2TMDA 3CNDA 3UKAA 4H4SA 4OPLA 3UOZA 1MO9A 5KMQA 1F3PA 3NTAA 3OZ2A 3EANA 3ALLA 4OPGA 4ZN0A 1TDEA 1XPQA 3FBSA 4ECHA 3URHA 4H4QA 2V6OA 3PG6A 2A87A 4YKFA 3UKHA 1BF3A 3P1WA 4H4ZA 2Q0KA 3DJDA 4UDRA 2VOUA 1F8SA 5U63A 4DNAA 1E6EA 5HYMA 3P9UA 3DGZA 1Y0PA 2BXRA 3H8IA 4C77A 4YTNA 2PHHA 2YVJA 1LTXR 2R46A 4EMIA 1AOGA 2Q6UA 5C2TA 1Q1WA 1H83A 3E1TA 4LU6A 2ZZBA 3AWIA 1FL2A 3T2KA 1CJ4A 3NYFA 4H4VA 4H4YA 1ZDLA 1GSNA 4O5QA 2WPCA 1VG0A 4YTMA 2JB3A 2VVLA 1JNZA 2X3NA 3II4A 4KX6A 5EB5A 3KLJA 1LPFA 2XLUA 4GDPA 5BRTA 1PJ5A 3RP7A 1GRFA 2C76A 2WU5A 5DBJA 1CJ2A 2BS2A 1W4XA 2GV8A 3PS9A 4Z2UA 3EAOA 1VG9A 2Q7VA 2R0GA 3KA7A 3CNPA 3GSIA 4RSLA 1B4VA 1O95A 1L9CA 2RGOA 4U2TA 3RHAA 3NK2X 2QA2A 3BHFA 3IF9A 2X8HA 1K0IA 1IJHA 1EL9A 3NN6X 1ZMDA 2NPXA 1O5WA 2E5VA 1LVLA 2Z5XA 4EM4A 3SXIA 4CNJA 4B1BA 4OPIA 5GSNA 1COYA 3SZCA 3F8RA 4K5RA 2R0CA 3AYLA 3NG7X 1ZOVA 2B7SA 1BWCA 3UKKA 3F8PA 3AEFA 3BNUA 4G9KA 4GUVA 2WBAA 2GAGB 4BV6A 1CF3A 2GR3A 3M0OA 3AEAA 3GD3A 1CJCA 1X31B 4UDPA 3AD7B 2A89A 1D4DA 2AAQA 1MXTA 4CBQA 4YXDA 2YWLA 3CGBA 1H84A 4BK2A 1S2QA 4U8IA 2VQ7A 2C66A 4H7UA 4EIPA 4C3XA 5C3JA 2R4EA 1YQZA 4J36A 3NLCA 3UKQA 1F6MA 4LA1A 2B9WA 2VVLG 2Y6QA 1IUSA 1H2IA 3AEGA 4OVIA 1JRXA 4IV9A 2C4CA 1DXLA 1GALA 1N4WA 2YR5A 1IUXA 5U25A 1GRTA 4CY8A 5LV9A 1DOCA 3NRNA 1JRYA 1DNCA 5FS6A 4EQXA 2BS3A 3GYJA 3QFBA 1M6IA 2WESA 4JDRA 3GYXA 4XWRA 1Y56B 1NENA 4AOXA 5FS9A 2GEWA 4EQWA 3H4KA 1TRBA 2E4GA 2FJEA 4UDQA 2JKCA 1DOEA 3LOVA 1SEZA 2GB0A 3KD9A 2ARDA 3NHOX 1CC4A 4X9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYB A;  5KVH A;  2RGH A;  4YSZ A;  1Q1R A;  2YM2 A;  3AD8 B;  4M52 A;  3DJE A;  5KXJ A;  5EB4 A;  3Q9T A;  3DJG X;  4D03 A;  1D7L A;  1YQ3 A;  3BI5 A;  4BK1 A;  1RP0 A;  2CVJ A;  1GRB A;  3ZYX A;  5JCI A;  4BJZ A;  2EQ9 A;  3CGC A;  5JCM A;  4NZH A;  5TR3 A;  1GTE A;  3ICS A;  3UP5 A;  4CNK A;  2V5Z A;  2EQ8 A;  4E0V A;  3AYI A;  3VRD B;  2HQM A;  3F8D A;  2GMJ A;  5M10 A;  4ZCD A;  2BXS A;  1F8W A;  4OPT A;  3GDN A;  3GWD A;  1PHH A;  1E1L A;  5EOW A;  1FOH A;  3KPF A;  1OJA A;  1NG4 A;  3FPZ A;  5KRQ A;  4B66 A;  1VQW A;  1MOK A;  3UOY A;  1GES A;  3AE6 A;  2BK3 A;  3BNM A;  4TM4 A;  4J34 A;  1S3E A;  2WDR A;  2RGJ A;  3B6D A;  1PDH A;  2WET A;  2ACZ A;  3P4R A;  1E1K A;  1GET A;  4OPU A;  4TM3 A;  2YG4 A;  1XDI A;  3LXD A;  5JCL A;  1GV4 A;  1UKV G;  3AE9 A;  2OLO A;  1GRG A;  2XFQ A;  4AT0 A;  3PO7 A;  1TYP A;  2WOV A;  1JOA A;  4O5U A;  1TDK A;  2BC1 A;  3C4N A;  1GRH A;  4IVM B;  5IPY A;  2WOI A;  4GDE A;  5JCK A;  3RED A;  1NAA A;  2WQY A;  1L9E A;  1N1P A;  3BI4 A;  4Z2R A;  3H8L A;  4C5O A;  4YKG A;  1BZL A;  1B5Q A;  4Z43 A;  4EQR A;  3RNM A;  4Z2T A;  4NTE A;  4ZCC A;  4CCR A;  4U8J A;  2C7G A;  3AE2 A;  4C3Y A;  3AB1 A;  3VRB A;  1REO A;  2YAU A;  3OC4 A;  1BGJ A;  2BCG G;  3AE8 A;  3NK0 X;  4H4P A;  4USQ A;  4AP1 A;  2WP9 A;  2WS3 A;  3NKS A;  3S61 A;  3AD9 B;  4J31 A;  4BK3 A;  1OJC A;  2XFN A;  2X8G A;  4DSG A;  2XYO A;  4J33 A;  1FEB A;  1H82 A;  2IID A;  3SGL A;  4NTD A;  2GVC A;  4TLZ A;  2XDO A;  3CN8 A;  5CQF A;  3B3R A;  1GPE A;  5BUK A;  2B76 A;  1E7P A;  3CNS A;  1OJT A;  4Y4L A;  3Q6J A;  1FEC A;  4C74 A;  2V60 A;  1EBD A;  2Q0L A;  2YLW A;  3QVP A;  4TLX A;  5J7X A;  4B65 A;  4EMW A;  2FJD A;  4JNA A;  4CRT A;  2X50 A;  4IA5 A;  4TM1 A;  1Y56 A;  2WU2 A;  3GMB A;  5U1O A;  2GRT A;  1CC2 A;  5IQ1 A;  2WEU A;  1ONF A;  2YLS A;  4XXG A;  1GND A;  2C67 A;  2WOW A;  4H4U A;  3CPH G;  3UP4 A;  4H50 A;  3AE7 A;  4MJW A;  1RSG A;  2VRL A;  5HHF A;  1BGN A;  3T37 A;  1CBO A;  2XFP A;  2VZ2 A;  1KDG A;  1GXF A;  2GQW A;  2GR1 A;  3IC9 A;  1NG3 A;  3CGD A;  2B9X A;  2V3B A;  3AEC A;  3V3O A;  2JBV A;  1NHQ A;  4H4R A;  3AE4 A;  3DK4 A;  1NPX A;  3ATR A;  2YVG A;  1GER A;  4OCG A;  1GEU A;  1XHC A;  2RAB A;  4Z44 A;  2XLS A;  3P4S A;  4X9M A;  3UTG A;  4ADW A;  2BS4 A;  3NYC A;  3GRS A;  1K0J A;  3IHG A;  4H2R A;  2BAC A;  1PXC A;  2YVF A;  4GCM A;  1P2H A;  3UTF A;  2ZZC A;  1PBB A;  5M0Z A;  2XVJ A;  5HXI A;  3L1R A;  4U8N A;  3KU9 A;  3UCL A;  1BKW A;  3LZW A;  2J3N A;  4FDC B;  5HY5 A;  3NGC X;  1CHU A;  4USR A;  4B63 A;  2JB1 A;  2GMH A;  4CY6 A;  1JEH A;  4EQS A;  3CTY A;  3G5Q A;  1QJD A;  1ZK7 A;  3AE5 A;  3CPJ G;  3I6D A;  1L0V A;  2OAL A;  3AED A;  1YY5 A;  4J57 A;  3NT6 A;  4LII A;  1K4Q A;  2R0P A;  3ITJ A;  4GRT A;  4B68 A;  2IVE A;  2UZZ A;  5KWF A;  1E39 A;  3UKF A;  1PBD A;  4YSX A;  4PAA A;  4A7A A;  2YLX A;  3RP6 A;  4RG4 A;  2XLT A;  2Y6R A;  4U8O A;  5KVI A;  3P4Q A;  1KNR A;  1O94 A;  2YLT A;  3NNE A;  2C75 A;  1PXB A;  3ADA B;  5ER0 A;  3COX A;  3BHK A;  3O0H A;  4NEW A;  4J2W A;  5EBK A;  1DJN A;  4K2X A;  4HB9 A;  4ICY A;  3SFE A;  4D04 A;  2R4J A;  2EQ6 A;  3NK1 X;  4JN9 A;  3GDP A;  1ZY8 A;  2WHD A;  1GRA A;  2H89 A;  4GR1 A;  5KOX A;  4U2S A;  2BC0 A;  4FK1 C;  2WPF A;  1QLB A;  1D7Y A;  2C3D A;  1CL0 A;  4AT2 A;  1LQU A;  4DSH A;  4FX9 A;  3K30 A;  1PS9 A;  4AOS A;  3C96 A;  4YSY A;  2XVH A;  1D4C A;  1Z6L A;  3CPI G;  1VDC A;  2JB2 A;  4WCT A;  4K22 A;  5FMH A;  4Y4M A;  2XVE A;  3UKP A;  4YSH A;  1D4E A;  4H2Q A;  4OPC A;  1ELI A;  1PBF A;  2QA1 A;  2XLR A;  2YG6 A;  3K7M X;  3K7Q X;  5J60 A;  2OA1 A;  2BCP A;  3CGE A;  1N4U A;  1E1N A;  1ZX9 A;  1YQ4 A;  2WP5 A;  3ABV A;  5CKU A;  4A65 A;  4U8P A;  2ZBW A;  3ISH A;  4X4J A;  1PJ6 A;  3D8X A;  3M13 A;  4A6N B;  3GRT A;  3K7T A;  3RP8 A;  1EL5 A;  2JK6 A;  1KF6 A;  3NN0 X;  4B64 A;  3DK8 A;  3V76 A;  3DGH A;  2C65 A;  1XAN A;  2B7R A;  4J56 A;  1KFY A;  2YR6 A;  1RYI A;  2VQB A;  3NIX A;  1K0L A;  2E1M A;  4U8M A;  1TDO A;  2FJB A;  4UP3 A;  3P4P A;  1B8S A;  4KPR A;  1B37 A;  2V61 A;  2WPE A;  2BA9 A;  2XVI A;  4CCQ A;  4P9S A;  2CDU A;  4N9X A;  2PYX A;  4H2N A;  1IUW A;  2OLN A;  1NEK A;  1E1M A;  2XLP A;  4A79 A;  3HZL A;  4B69 A;  2YG5 A;  5L46 A;  2V3A A;  4U2L A;  1V59 A;  1PBE A;  5FS8 A;  4IA6 A;  2A8X A;  1JRZ A;  4PAB A;  1L9D A;  3FMW A;  4Z25 A;  2BK4 A;  4JY2 A;  1FEA A;  4K5S A;  3KVE A;  3QSM A;  3UOX A;  1FCD A;  2YG3 A;  4U8K A;  1M64 A;  4EIQ A;  2C64 A;  1ZKQ A;  4NTC A;  2XFO A;  1EL8 A;  4JNQ A;  1CJ3 A;  1KSS A;  2AR8 A;  2AQJ A;  2GQF A;  2I0Z A;  1NHP A;  4DGK A;  2YLR A;  3LB8 A;  1NDA A;  4EM3 A;  4I58 A;  2C3C A;  3S5W A;  4H2P A;  1OJ9 A;  2JAE A;  2XVF A;  4I59 A;  1CC6 A;  1QO8 A;  3V3N A;  1IUU A;  4FK1 A;  4BUR A;  4OPD A;  2NVK X;  4AP3 A;  4H4X A;  3VR9 A;  5FS7 A;  3UKL A;  4RG3 A;  3DJJ A;  3GD4 A;  3ATQ A;  3AYJ A;  1LQT A;  3DH9 A;  1S2Y A;  4JY3 A;  1GOS A;  4YTP A;  3I3L A;  2GF3 A;  3CIR A;  1PBC A;  3GWF A;  3ALM A;  3NYE A;  4GF7 A;  4H4W A;  4Y4N A;  1LJ1 A;  2C72 A;  4B67 A;  2GAH B;  3PVC A;  3QJ4 A;  3SQP A;  4WX1 A;  3GYI A;  4A5L A;  1DOD A;  4JQ9 A;  3AE1 A;  1NHR A;  3LZX A;  2W0H A;  1P2E A;  1H7W A;  1KNP A;  3R9U A;  2O9Z A;  3UOV A;  1NHS A;  5GRT A;  2C73 A;  4A9W A;  2BK5 A;  3CNT A;  2FJA A;  4REK A;  4Z24 A;  3VRA A;  2GR0 A;  4EMJ A;  3VR8 A;  2XFU A;  4APN A;  1YKJ A;  2VRM A;  3C4A A;  3AEB A;  1GT8 A;  1IUT A;  3NH3 X;  5KOW A;  2DKH A;  1GTH A;  2WDV A;  2YR4 A;  1HYU A;  2Z5Y A;  3G5R A;  3IHM A;  4A6N A;  1TYT A;  1N4V A;  4IVO B;  1S3B A;  3L8K A;  3QVR A;  4NEV A;  3G5S A;  4Z26 A;  3EPT A;  1ZP0 A;  3ALJ A;  3LJP A;  4U8L A;  1TDF A;  3UTH A;  1PXA A;  3ICT A;  2CUL A;  4HA6 A;  5JCN A;  2R45 A;  3FG2 P;  1TDN A;  5IQ4 A;  2BAB A;  1H81 A;  3DA1 A;  3FIM B;  5BUL A;  4YT0 A;  4H4T A;  1OJD A;  3AEE A;  2APG A;  2ZZ0 A;  3WE0 A;  2QAE A;  1D5T A;  2GR2 A;  3M12 A;  2QCU A;  4XWZ A;  3EF6 A;  1Q9I A;  1JNR A;  1H6V A;  2WP6 A;  3DME A;  3JSK A;  3SM8 A;  2F5Z A;  1IUV A;  1F8R A;  2H88 A;  3ZDN A;  4K8D A;  1PN0 A;  3SFD A;  3GMC A;  2EQ7 A;  2OAM A;  4TM0 A;  3VQR A;  3BI2 A;  4K7Z A;  1DJQ A;  1ZMC A;  5BVA A;  3NTD A;  4A99 A;  1LV0 A;  2VVM A;  1DOB A;  1JU2 A;  1EL7 A;  2FBW A;  3ICR A;  3D1C A;  2CFY A;  2YQU A;  3LAD A;  1VRQ B;  4BJY A;  1H7X A;  2YG7 A;  3IWA A;  3QSS A;  2XCG A;  1PJ7 A;  2X8C A;  3AXB A;  2TPR A;  2WDQ A;  3CNJ A;  3AE3 A;  3UTE A;  2X99 A;  2C70 A;  2YM1 A;  1ZOY A;  4YWO A;  2GH5 A;  3DK9 A;  2DKI A;  2R9Z A;  1KSU A;  2YLZ A;  3QSE A;  3KKJ A;  2B9Y A;  2IVD A;  1GRE A;  3QFA A;  1H86 A;  2TMD A;  3CND A;  3UKA A;  4H4S A;  4OPL A;  3UOZ A;  1MO9 A;  1F3P A;  3NTA A;  3OZ2 A;  3EAN A;  3ALL A;  4OPG A;  4ZN0 A;  1TDE A;  1XPQ A;  3FBS A;  4ECH A;  3URH A;  4H4Q A;  2V6O A;  4YKF A;  2A87 A;  3UKH A;  1BF3 A;  3P1W A;  4H4Z A;  2Q0K A;  3DJD A;  4UDR A;  2VOU A;  1F8S A;  5U63 A;  4DNA A;  1E6E A;  5HYM A;  3P9U A;  3DGZ A;  1Y0P A;  2BXR A;  3H8I A;  4C77 A;  4YTN A;  2PHH A;  2YVJ A;  1LTX R;  2R46 A;  4EMI A;  1AOG A;  2Q6U A;  5C2T A;  1Q1W A;  1H83 A;  3E1T A;  4LU6 A;  2ZZB A;  3AWI A;  1FL2 A;  1CJ4 A;  3NYF A;  4H4V A;  4H4Y A;  1ZDL A;  1GSN A;  4O5Q A;  2WPC A;  1VG0 A;  4YTM A;  2JB3 A;  2VVL A;  1JNZ A;  2X3N A;  3II4 A;  4KX6 A;  5EB5 A;  3KLJ A;  1LPF A;  2XLU A;  4GDP A;  5BRT A;  1PJ5 A;  3RP7 A;  1GRF A;  2C76 A;  2WU5 A;  5DBJ A;  1CJ2 A;  2BS2 A;  1W4X A;  2GV8 A;  3PS9 A;  4Z2U A;  3EAO A;  1VG9 A;  2Q7V A;  2R0G A;  3KA7 A;  3CNP A;  3GSI A;  4RSL A;  1B4V A;  1O95 A;  1L9C A;  2RGO A;  4U2T A;  3RHA A;  3NK2 X;  2QA2 A;  3BHF A;  3IF9 A;  2X8H A;  1K0I A;  1IJH A;  1EL9 A;  3NN6 X;  1ZMD A;  2NPX A;  1O5W A;  2E5V A;  1LVL A;  2Z5X A;  4EM4 A;  4CNJ A;  4B1B A;  4OPI A;  5GSN A;  1COY A;  3F8R A;  4K5R A;  2R0C A;  3AYL A;  3NG7 X;  1ZOV A;  2B7S A;  1BWC A;  3UKK A;  3F8P A;  3AEF A;  3BNU A;  4GUV A;  2WBA A;  2GAG B;  4BV6 A;  1CF3 A;  2GR3 A;  3M0O A;  3AEA A;  3GD3 A;  1CJC A;  1X31 B;  4UDP A;  3AD7 B;  2A89 A;  1D4D A;  2AAQ A;  1MXT A;  4CBQ A;  4YXD A;  2YWL A;  3CGB A;  1H84 A;  4BK2 A;  1S2Q A;  4U8I A;  2VQ7 A;  2C66 A;  4H7U A;  4EIP A;  4C3X A;  5C3J A;  2R4E A;  1YQZ A;  4J36 A;  3NLC A;  3UKQ A;  1F6M A;  4LA1 A;  2B9W A;  2VVL G;  2Y6Q A;  1IUS A;  3AEG A;  4OVI A;  1JRX A;  4IV9 A;  1DXL A;  1GAL A;  1N4W A;  2YR5 A;  1IUX A;  5U25 A;  1GRT A;  4CY8 A;  5LV9 A;  1DOC A;  3NRN A;  1JRY A;  1DNC A;  5FS6 A;  4EQX A;  2BS3 A;  3GYJ A;  3QFB A;  1M6I A;  2WES A;  4JDR A;  4XWR A;  1Y56 B;  1NEN A;  4AOX A;  5FS9 A;  2GEW A;  4EQW A;  3H4K A;  1TRB A;  2E4G A;  2FJE A;  4UDQ A;  2JKC A;  1DOE A;  3LOV A;  1SEZ A;  2GB0 A;  3KD9 A;  2ARD A;  3NHO X;  1CC4 A;  4X9N A; 
#chains in the Genus database with same CATH topology
 5KVH A;  1Q1R A;  3HYX A;  1SJC A;  3Q9T A;  3U9I A;  1GTE A;  3CXB A;  3AYI A;  4ENL A;  3OPS A;  2BXS A;  1F8W A;  3GWD A;  4TVY A;  4KEM A;  1FFU C;  4B66 A;  3BNM A;  4J34 A;  1S3E A;  1PDH A;  1GET A;  2YG4 A;  3AE9 A;  2OLO A;  1FIQ B;  2WOV A;  5IPY A;  2WOI A;  3H8A A;  4GYP A;  1L9E A;  3H8L A;  2PTX A;  1XPY A;  2HXT A;  3RNM A;  2ZC8 A;  4C3Y A;  4USQ A;  2BCG G;  4DYE A;  1MDR A;  3AD9 B;  1OJC A;  4DSG A;  2XYO A;  1FEB A;  4TLZ A;  2OO6 A;  3N4E A;  2XDO A;  3B3R A;  3B9J B;  1E7P A;  1BKH A;  1OJT A;  1FEC A;  2V60 A;  3HPF A;  5J7X A;  3QVP A;  4CRT A;  2X50 A;  3TQP A;  1ONF A;  4XXG A;  4MJW A;  2VRL A;  1BGN A;  5JRB A;  4MGG A;  3OTR A;  2XFP A;  1NG3 A;  4KPL A;  3DK4 A;  1NPX A;  3ATR A;  3P4S A;  4X9M A;  2BS4 A;  2FYM A;  4G6G A;  2BAC A;  4GCM A;  1P2H A;  4JN7 A;  5M0Z A;  2XVJ A;  4U8N A;  3KU9 A;  3LZW A;  2J3N A;  4FDC B;  1CHU A;  5KMP A;  2JB1 A;  1L0V A;  3CPJ G;  1ZK7 A;  3I6D A;  4J57 A;  3SYI A;  1K4Q A;  2R0P A;  2IVE A;  4RG4 A;  2XLT A;  5KVI A;  1O94 A;  3ADA B;  4K1W A;  4K2X A;  3SFE A;  4HB9 A;  4ICY A;  3NK1 X;  3GDP A;  2WHD A;  4GFI A;  2OZT A;  2P3Z A;  1D7Y A;  6ENL A;  1VQZ A;  1LQU A;  4DWD A;  4Y4M A;  3CPI G;  4K22 A;  5FMH A;  2XLR A;  2OA1 A;  1E1N A;  2WP5 A;  2PU1 A;  4X2P A;  4X4J A;  3GRT A;  3RP8 A;  3L5O A;  2JK6 A;  3V76 A;  2C65 A;  2B7R A;  1KFY A;  2GGE A;  1B37 A;  2V61 A;  5G5G B;  5FJO A;  3V3W A;  3S5S A;  2OZ8 A;  1IUW A;  4KWS A;  4A79 A;  3HZL A;  4B69 A;  1DTN A;  5L46 A;  4II3 A;  4U2L A;  1V59 A;  1N5W C;  1FEA A;  3R0U A;  2XFO A;  4JNQ A;  2I0Z A;  3ZVH A;  2AQJ A;  2GQF A;  1NHP A;  3S5W A;  1OJ9 A;  4YWS A;  4HCH A;  4I59 A;  1CC6 A;  3TTE A;  5FJR A;  3T31 A;  5FS7 A;  2QVH A;  2PMQ A;  1GOS A;  4YTP A;  3CIR A;  3PK7 A;  4Y4N A;  2C72 A;  4B67 A;  3QJ4 A;  3SQP A;  3OW1 A;  4DN1 A;  3R9U A;  1EBG A;  1NHS A;  3R0K A;  2FJA A;  4REK A;  3T14 A;  3VRA A;  4EMJ A;  3VR8 A;  1YKJ A;  3C4A A;  4ZOH B;  3AEB A;  2DKH A;  2WDV A;  3G5R A;  2Z5Y A;  3SZ0 A;  3IHM A;  3L8K A;  3QVR A;  3MQT A;  1X2H A;  4Z26 A;  3BJS A;  1ZP0 A;  1SJD A;  4U8L A;  4ZA0 A;  4HA6 A;  1KKO A;  3NXL A;  1OJD A;  2APG A;  3WE0 A;  1D5T A;  2QCU A;  3JSK A;  3ZDN A;  2PTZ A;  5KRQ A;  4TM0 A;  3VQR A;  4ROP A;  1DJQ A;  2MUC A;  3UGV A;  3ICR A;  3IJI A;  2GGI A;  3IWA A;  4IT1 A;  3QSS A;  2X8C A;  3NO1 A;  1ZOY A;  2FKP A;  3HW2 A;  3QSE A;  2B9Y A;  1H86 A;  3CND A;  4H4S A;  3NTA A;  4ZN0 A;  4ECH A;  4YKF A;  1BF3 A;  2Q0K A;  5HYM A;  3DGZ A;  1STZ A;  2YVJ A;  2R46 A;  5C2T A;  3H7V A;  3E1T A;  4H4V A;  3FVD A;  1VG0 A;  4YTM A;  2X3N A;  5EB5 A;  3A7A A;  3SN1 A;  5BRT A;  3RP7 A;  2WU5 A;  2XH2 A;  2BS2 A;  2W55 A;  3UJR A;  3EAO A;  4IHC A;  3CNP A;  1B4V A;  2PSN A;  1L9C A;  4DX3 A;  3BHF A;  3IF9 A;  1ZMD A;  5EU9 A;  2CHR A;  2Z5X A;  1SB3 B;  3P3B A;  3F8R A;  3CAW A;  3AYL A;  4K8G A;  1BWC A;  4E4U A;  3AEF A;  4G9K A;  1P48 A;  5FJT A;  3THU A;  4GUV A;  2GAG B;  2GR3 A;  3M0O A;  1MDL A;  3SSZ A;  4YXD A;  3CK5 A;  2DW7 A;  3RRA A;  4J36 A;  3NLC A;  4GYP C;  2VVL G;  1H2I A;  3H70 A;  4HNC A;  4OVI A;  3MSY A;  3CYJ A;  4IV9 A;  1DXL A;  4CY8 A;  1DOC A;  1DNC A;  4Z17 A;  3VDG A;  1FFV C;  3R25 A;  4XWR A;  1NEN A;  2PPG A;  5FS9 A;  3K1G A;  2ARD A;  4IP5 A;  3NHO X;  1CC4 A;  2OQY A;  4YSZ A;  4M52 A;  5KXJ A;  4D03 A;  3R1Z A;  1RP0 A;  2CVJ A;  1GRB A;  1JRP A;  5JCI A;  3CGC A;  5JCM A;  3UP5 A;  2V5Z A;  2EQ8 A;  4E0V A;  3Q45 A;  1FO4 A;  3VRD B;  2GMJ A;  5M10 A;  3Q4D A;  1NG4 A;  3FPZ A;  4G73 A;  3CMM A;  1GES A;  3AE6 A;  2QJJ A;  2RDX A;  3RR1 A;  2RGJ A;  5KNL A;  4TM3 A;  3ES7 A;  1XDI A;  2P8C A;  1GV4 A;  1UKV G;  3PO7 A;  1TYP A;  2POD A;  4O5U A;  3UXL A;  1FHU A;  1NAA A;  3RO6 A;  3OZM A;  4IZG A;  4NTE A;  3QLD A;  4CCR A;  4U8J A;  2C7G A;  1JPM A;  1PDZ A;  4AP1 A;  2WP9 A;  3NKS A;  4J31 A;  4BK3 A;  4J33 A;  3HYV A;  4NTD A;  2GVC A;  3CN8 A;  2GGG A;  5G5H B;  1GPE A;  5BUK A;  4C74 A;  2Q0L A;  1WUE A;  4EMW A;  4IA5 A;  4TM1 A;  1Y56 A;  3ZLF A;  1CC2 A;  3SQS A;  1GND A;  1V97 A;  4H4U A;  3CPH G;  4H50 A;  4IL0 A;  3AE7 A;  5HHF A;  2AL2 B;  3T37 A;  3JZU A;  2GQW A;  2GR1 A;  3T0K A;  1NEL A;  4OCG A;  4Z44 A;  1XHC A;  3MY9 A;  3IHG A;  1PXC A;  3UTF A;  2ZZC A;  1N60 C;  3NGC X;  4USR A;  4B63 A;  2GMH A;  3G5Q A;  4EQS A;  2OAL A;  4G7F A;  1YY5 A;  2W3R A;  4LII A;  3ITJ A;  2POZ A;  4H83 A;  3TJI A;  1E39 A;  4YSX A;  2Y6R A;  1N62 C;  1PXB A;  3COX A;  3PWG A;  4J2W A;  4NEW A;  1NU5 A;  3DFY A;  1DJN A;  2R4J A;  2EQ6 A;  3ZLG A;  1ZY8 A;  3GC2 A;  3NFU A;  2BC0 A;  1QLB A;  3IK4 A;  1ZXI C;  2OQH A;  4AOS A;  2XVH A;  1D4C A;  1S7M A;  1VDC A;  2JB2 A;  3UKP A;  4H1Z A;  1ELI A;  3K7Q X;  2YG6 A;  3K7M X;  1N4U A;  3GD6 A;  5CKU A;  4U8P A;  3ISH A;  1FHV A;  3K7T A;  3NN0 X;  2P88 A;  1XAN A;  1TDO A;  2FJB A;  4KPR A;  2WPE A;  2BA9 A;  1TKK A;  4P9S A;  4H2N A;  3BSM A;  1E1M A;  4GAP A;  2V3A A;  3UCC A;  4K5S A;  3KVE A;  3UOX A;  1FCD A;  4U8K A;  4EIQ A;  3U4F A;  2AR8 A;  4G6H A;  2YLR A;  2C3C A;  4H2P A;  2XVF A;  3TJ4 A;  3V3N A;  4MMW A;  2NVK X;  4H4X A;  3VR9 A;  3UKL A;  1EC9 A;  3GD4 A;  3VFC A;  2OFJ A;  3I3L A;  2GF3 A;  3GWF A;  3ALM A;  3IJQ A;  4H4W A;  1LJ1 A;  3GYI A;  4A5L A;  3QPE A;  1H7W A;  1SJB A;  1KNP A;  3UOV A;  2O9Z A;  2C73 A;  3JW7 A;  2BK5 A;  4DXK A;  4Z24 A;  4NNJ A;  4APN A;  1KKR A;  3RIT A;  1GT8 A;  2YR4 A;  1BQG A;  3ALJ A;  3LJP A;  1N63 C;  1JRO A;  5JCN A;  3TW9 A;  5BUL A;  4YT0 A;  2ZZ0 A;  2QGY A;  2GR2 A;  2XGZ A;  1JNR A;  2AL1 A;  4A6G A;  1F8R A;  2H88 A;  3SFD A;  1EBH A;  2EQ7 A;  2OAM A;  3JVA A;  1TZZ A;  3EUB 3;  4A99 A;  1DOB A;  1KN0 A;  3IJL A;  2FBW A;  2PU0 A;  3I4K A;  1PJ7 A;  3SN0 A;  3CNJ A;  2X99 A;  3UXK A;  4NWZ A;  3UJS A;  3UJE A;  3DK9 A;  1KSU A;  3KKJ A;  4OPL A;  3UOZ A;  1F3P A;  3OZ2 A;  3EAN A;  3URH A;  2V6O A;  2A87 A;  2XH0 A;  4UDR A;  1F8S A;  2BXR A;  3H8I A;  2PHH A;  3D46 A;  1AOG A;  1Q1W A;  3DEQ A;  3PFR A;  4EWJ A;  4H4Y A;  4M0X A;  3II4 A;  4GDP A;  1PJ5 A;  4TVW A;  2C76 A;  3PS9 A;  1CJ2 A;  2R0G A;  3T6C A;  3KA7 A;  3GSI A;  2RGO A;  4U2T A;  3RHA A;  2QA2 A;  1K0I A;  1IJH A;  1EL9 A;  4MKS A;  1W6T A;  1LVL A;  2PP0 A;  4EM4 A;  3SXI A;  4CNJ A;  1RM6 B;  4E5T A;  3NG7 X;  1ZOV A;  3UKK A;  3MUC A;  4BV6 A;  3DES A;  3EKG A;  1D4D A;  3CGB A;  3FV9 A;  2C66 A;  2R4E A;  3UKQ A;  3AEG A;  2P0I A;  3UJ2 A;  1JRX A;  3KUM A;  1GAL A;  2YR5 A;  1N4W A;  5U25 A;  1GRT A;  3NRN A;  2BS3 A;  3OP2 A;  2QDD A;  4JDR A;  3ZVH B;  2E3T A;  1VDV A;  4UDQ A;  2JKC A;  4M6U A;  1DOE A;  3KD9 A;  2GDQ A;  2HNE A;  3GO2 A;  1MUC A;  3AD8 B;  3DJE A;  5EB4 A;  4II2 A;  1YQ3 A;  4BK1 A;  3ZYX A;  2EQ9 A;  4NZH A;  5TR3 A;  3ICS A;  1MNS A;  1KD0 A;  4J1O A;  4Z1Y A;  3P0W A;  3F8D A;  4ZCD A;  4OPT A;  3GDN A;  1PHH A;  1FOH A;  2GSH A;  3UOY A;  3AMZ A;  3ENL A;  2ACZ A;  2ZAD A;  3LXD A;  5JCL A;  3R11 A;  1GRG A;  1TDK A;  2BC1 A;  3C4N A;  4IVM B;  4GDE A;  1EC7 A;  3BI4 A;  4C5O A;  4YKG A;  4Z2T A;  4EQR A;  3NZG A;  3AB1 A;  2YAU A;  3NK0 X;  4H4P A;  2WS3 A;  3S61 A;  3AM9 A;  3DG3 A;  3SGL A;  4E4F A;  2B76 A;  3CNS A;  4Y4L A;  1TE6 A;  4F4R A;  3S47 A;  1JDF A;  4TLX A;  4B65 A;  4JNA A;  2WU2 A;  4G8T A;  2PP1 A;  3GMB A;  2YLS A;  2WOW A;  3ES8 A;  1R6W A;  1CBO A;  1KDG A;  1GXF A;  3IC9 A;  2B9X A;  3CGD A;  3V3O A;  2JBV A;  1NHQ A;  3AE4 A;  5KWF A;  2YVG A;  1GER A;  1GEU A;  2RAB A;  4G74 A;  3UTG A;  3ZLH A;  4H2R A;  3FCP A;  3L1R A;  3UCL A;  1BKW A;  5HY5 A;  3GY1 A;  3AE5 A;  3MKC A;  3AED A;  4GGB A;  5IDZ A;  4GRT A;  4B68 A;  2OLA A;  4A7A A;  1KNR A;  3VC6 A;  3DG7 A;  3DFH A;  1GRA A;  2OG9 A;  4GR1 A;  5KOX A;  4U2S A;  4AT2 A;  4DSH A;  3K30 A;  4YSY A;  1Z6L A;  4YSH A;  4OPC A;  1PBF A;  1WUF A;  3CGE A;  4IP4 A;  1YQ4 A;  2ZBW A;  3T4W A;  1L8P A;  3M13 A;  4A6N B;  4H2H A;  4JN8 A;  1EL5 A;  4B64 A;  3HRD C;  3DK8 A;  3NRZ B;  3ETR B;  1RYI A;  3AN1 A;  2E1M A;  4U8M A;  4UP3 A;  3DER A;  4N9X A;  2PYX A;  5FS8 A;  4PAB A;  1L9D A;  3FMW A;  4JY2 A;  3QSM A;  1M64 A;  1ZKQ A;  4NTC A;  2GGH A;  1KSS A;  3DIP A;  4DGK A;  3FYY A;  4I58 A;  1NDA A;  3SZW A;  2JAE A;  1N61 C;  1QO8 A;  2XH7 A;  4FK1 A;  4BUR A;  4OPD A;  3MWC A;  3DJJ A;  3ATQ A;  3AYJ A;  1S2Y A;  3T2Y A;  1PBC A;  3HYW A;  4HCD A;  3SZF A;  3NYE A;  4GF7 A;  2GAH B;  3PVC A;  4WX1 A;  4ZCW A;  4JQ9 A;  1P2E A;  2OVL A;  3A7R A;  4E6M A;  5GRT A;  3N6H A;  3CNT A;  1EC8 A;  2XSX A;  3VA8 A;  5KOW A;  1IUT A;  3V4B A;  1GTH A;  1HYU A;  1F9C A;  1TYT A;  2QJM A;  4IVO B;  4HYR A;  4NEV A;  3G5S A;  3EPT A;  2BRY A;  1TDF A;  3DDM A;  3UTH A;  3FG2 P;  3DA1 A;  2HXU A;  1H81 A;  2W3S A;  2BRA A;  4H4T A;  3BOX A;  2QAE A;  3M12 A;  1Q9I A;  1H6V A;  3DME A;  2F5Z A;  2NQL A;  3GMC A;  5BVA A;  5KMR A;  1LV0 A;  1JU2 A;  1EL7 A;  3R10 A;  2CFY A;  1VRQ B;  3LAD A;  2YG7 A;  2TPR A;  2W54 A;  3UTE A;  3UCD A;  2YM1 A;  4YWO A;  2GH5 A;  2DKI A;  2R9Z A;  3SJN A;  2E5A A;  3UKA A;  5KMQ A;  3ALL A;  4OPG A;  1TDE A;  4HNL A;  1XPQ A;  3FBS A;  1N5X A;  4H4Q A;  5U63 A;  2AKZ A;  4DNA A;  1E6E A;  1Y0P A;  4YTN A;  4EMI A;  1H83 A;  3AWI A;  3T2K A;  1CJ4 A;  3NYF A;  2OKT A;  4GIR A;  1ZDL A;  1GSN A;  2WPC A;  1JNZ A;  2PP3 A;  3KLJ A;  2XLU A;  5DBJ A;  1W4X A;  4Z2U A;  2Q7V A;  3NK2 X;  3NN6 X;  2NPX A;  2E5V A;  4B1B A;  4OPI A;  5GSN A;  1COY A;  3SZC A;  3AEA A;  3GD3 A;  1CJC A;  3AD7 B;  1MXT A;  4CBQ A;  2YWL A;  4GME A;  4GIS A;  4BK2 A;  2VQ7 A;  1PDY A;  3TOY A;  4EIP A;  4C3X A;  3VCN A;  1XS2 A;  2P8B A;  1F6M A;  2PA6 A;  2B9W A;  5FJU A;  3RCY A;  5FS6 A;  3GYJ A;  2PGE A;  3ZVI A;  4HCL A;  4AOX A;  2GEW A;  2E4G A;  4DHG A;  3H4K A;  3TWB A;  4EQW A;  1TRB A;  2FJE A;  3NVW B;  3RP6 A;  5J04 A;  5IQ1 A;  4X9N A;  2BYB A;  2RGH A;  4E8G A;  2YM2 A;  3DJG X;  1IYX A;  3N6J A;  1D7L A;  3BI5 A;  1ECQ A;  4BJZ A;  4GGH A;  4CNK A;  1KCZ A;  3KPK A;  3RGT A;  4IL2 A;  2HQM A;  4FP1 A;  1E1L A;  5EOW A;  3KPF A;  1OJA A;  1VQW A;  1MOK A;  2BK3 A;  4TM4 A;  2WDR A;  3B6D A;  3P93 A;  2WET A;  3P4R A;  1E1K A;  4OPU A;  2XFQ A;  4AT0 A;  1JOA A;  1GRH A;  5JCK A;  3VC5 A;  3RED A;  2WQY A;  1N1P A;  2QDE A;  4Z2R A;  1BZL A;  1B5Q A;  4Z43 A;  4ZCC A;  3PWI A;  3AE2 A;  3VRB A;  1REO A;  3AE8 A;  3OC4 A;  1BGJ A;  3FJ4 A;  2XFN A;  2X8G A;  3DGB A;  5FJP A;  3UJF A;  1H82 A;  2IID A;  5CQF A;  5BOE A;  3Q6J A;  2QJN A;  1EBD A;  2YLW A;  2FJD A;  5U1O A;  3I6E A;  2GRT A;  2WEU A;  2C67 A;  3UP4 A;  1X2G A;  2AKM A;  5BOF A;  4K2S A;  1RSG A;  3SX6 A;  4H19 A;  3EEZ A;  3TCS A;  2VZ2 A;  3T9P A;  2V3B A;  3AEC A;  4H4R A;  2XLS A;  4ADW A;  3NYC A;  3GRS A;  1K0J A;  2YVF A;  5HXI A;  1PBB A;  2HZG A;  3N4F A;  1T3Q C;  4CY6 A;  1JEH A;  3CTY A;  1QJD A;  2ONE A;  3NT6 A;  2UZZ A;  3UKF A;  1PBD A;  4PAA A;  2YLX A;  2I5Q A;  4U8O A;  3P4Q A;  2YLT A;  3NNE A;  2C75 A;  5ER0 A;  3BHK A;  3O0H A;  5EBK A;  4D04 A;  2O56 A;  3T8Q A;  4JN9 A;  5KMS A;  3FXG A;  2H89 A;  4FK1 C;  2WPF A;  2OX4 A;  1MRA A;  2C3D A;  1CL0 A;  2QQ6 A;  4FX9 A;  3I6T A;  3DG6 A;  1PS9 A;  3C96 A;  3V5C A;  3OZY A;  4WCT A;  2PGW A;  2XVE A;  1D4E A;  4H2Q A;  2QA1 A;  3T2Z A;  3V5F A;  5J60 A;  2BCP A;  2PTW A;  1ZX9 A;  3ABV A;  4A65 A;  3TWA A;  1PJ6 A;  3D8X A;  1KF6 A;  2GGJ A;  3DGH A;  4J56 A;  2YR6 A;  3CB3 A;  2VQB A;  3NIX A;  1K0L A;  3P4P A;  1B8S A;  2XVI A;  4CCQ A;  2CDU A;  2OLN A;  1NEK A;  2XLP A;  2YG5 A;  3VCC A;  3STP A;  1JCT A;  4KT2 A;  1PBE A;  4IA6 A;  2A8X A;  1JRZ A;  3D9X A;  4Z25 A;  2BK4 A;  4GAV A;  2YG3 A;  2C64 A;  1EL8 A;  3SN4 A;  4A35 A;  1CJ3 A;  3LB8 A;  3QKE A;  4EM3 A;  4HPN A;  1OEP A;  1IUU A;  4AP3 A;  1JPD X;  4FI4 A;  4RG3 A;  1LQT A;  3DH9 A;  2XH4 A;  4JY3 A;  1DOD A;  3AE1 A;  1ELS A;  1NHR A;  3LZX A;  2W0H A;  2OZ3 A;  3A7U A;  4A9W A;  2GR0 A;  2XFU A;  2VRM A;  3D47 A;  3NH3 X;  4A6N A;  1N4V A;  1S3B A;  4A3R A;  1PXA A;  3ICT A;  2CUL A;  2DW6 A;  2R45 A;  4JHM A;  1TDN A;  5IQ4 A;  2BAB A;  3FIM B;  3AEE A;  4XWZ A;  7ENL A;  3EF6 A;  3SR6 B;  3CT2 A;  2WP6 A;  3SM8 A;  1IUV A;  4K8D A;  1PN0 A;  3BI2 A;  4K7Z A;  1ZMC A;  3NTD A;  2VVM A;  3MZN A;  3NVY B;  3D1C A;  2YQU A;  4BJY A;  1YEY A;  3SY4 A;  1H7X A;  2XCG A;  3AXB A;  2WDQ A;  3AE3 A;  2PTY A;  2C70 A;  1R0M A;  2YLZ A;  2IVD A;  1GRE A;  3QFA A;  2AL2 A;  2TMD A;  1SJA A;  1MO9 A;  3NVZ B;  3NS1 B;  3PG6 A;  3UKH A;  3P1W A;  4H4Z A;  3DJD A;  2VOU A;  3P9U A;  1P43 A;  4C77 A;  1LTX R;  2Q6U A;  1WYG A;  3QN3 A;  4LU6 A;  2ZZB A;  1FL2 A;  1E9I A;  4O5Q A;  2JB3 A;  2VVL A;  4KX6 A;  2PS2 A;  1LPF A;  1GRF A;  2MNR A;  2GV8 A;  1VG9 A;  3QTP A;  1ONE A;  4RSL A;  1O95 A;  2X8H A;  1O5W A;  3R07 C;  2GL5 A;  4K5R A;  2R0C A;  2B7S A;  3F8P A;  3BNU A;  2PCE A;  3H12 A;  2WBA A;  4J3Z A;  1CF3 A;  1X31 B;  4UDP A;  4HN8 A;  1RVK A;  2A89 A;  2AAQ A;  1H84 A;  1S2Q A;  4U8I A;  4H7U A;  5C3J A;  3SBF A;  1YQZ A;  3NVV B;  3CXO A;  4LA1 A;  2Y6Q A;  1IUS A;  2OPJ A;  2C4C A;  1IUX A;  5LV9 A;  1JRY A;  4EQX A;  3QFB A;  1M6I A;  2WES A;  3GYX A;  1Y56 B;  3B97 A;  5ENL A;  3LOV A;  1SEZ A;  2GB0 A; 
#chains in the Genus database with same CATH homology
 2BYB A;  5KVH A;  2RGH A;  4YSZ A;  1Q1R A;  2YM2 A;  3HYX A;  3AD8 B;  4M52 A;  3DJE A;  5KXJ A;  5EB4 A;  3Q9T A;  3DJG X;  4II2 A;  4D03 A;  1D7L A;  1YQ3 A;  3BI5 A;  4BK1 A;  1RP0 A;  2CVJ A;  1GRB A;  3ZYX A;  5JCI A;  4BJZ A;  2EQ9 A;  3CGC A;  5JCM A;  4NZH A;  5TR3 A;  1GTE A;  3ICS A;  3UP5 A;  4CNK A;  2V5Z A;  3KPK A;  2EQ8 A;  4E0V A;  3AYI A;  3VRD B;  2HQM A;  3F8D A;  2GMJ A;  5M10 A;  4ZCD A;  2BXS A;  1F8W A;  4OPT A;  3GDN A;  3GWD A;  1PHH A;  1E1L A;  5EOW A;  1FOH A;  3KPF A;  1OJA A;  1NG4 A;  3FPZ A;  4G73 A;  5KRQ A;  4B66 A;  3CMM A;  1VQW A;  1MOK A;  3UOY A;  1GES A;  3AE6 A;  2BK3 A;  3BNM A;  4TM4 A;  4J34 A;  1S3E A;  2WDR A;  2RGJ A;  3B6D A;  1PDH A;  2WET A;  2ACZ A;  3P4R A;  1E1K A;  1GET A;  5KNL A;  4OPU A;  4TM3 A;  2YG4 A;  1XDI A;  3LXD A;  5JCL A;  1GV4 A;  1UKV G;  3AE9 A;  2OLO A;  1GRG A;  2XFQ A;  4AT0 A;  3PO7 A;  1TYP A;  2WOV A;  1JOA A;  4O5U A;  1TDK A;  2BC1 A;  3C4N A;  1GRH A;  4IVM B;  5IPY A;  2WOI A;  4GDE A;  5JCK A;  3RED A;  1NAA A;  2WQY A;  1L9E A;  1N1P A;  3BI4 A;  4Z2R A;  3H8L A;  4C5O A;  4YKG A;  1BZL A;  1B5Q A;  4Z43 A;  4EQR A;  3RNM A;  4Z2T A;  4NTE A;  4ZCC A;  4CCR A;  4U8J A;  2C7G A;  3AE2 A;  4C3Y A;  3AB1 A;  3VRB A;  1REO A;  2YAU A;  3OC4 A;  1BGJ A;  2BCG G;  3AE8 A;  3NK0 X;  4H4P A;  4USQ A;  4AP1 A;  2WP9 A;  2WS3 A;  3NKS A;  3S61 A;  3AD9 B;  4J31 A;  4BK3 A;  1OJC A;  2XFN A;  2X8G A;  4DSG A;  2XYO A;  4J33 A;  3HYV A;  1FEB A;  1H82 A;  2IID A;  3SGL A;  4NTD A;  2GVC A;  4TLZ A;  2XDO A;  3CN8 A;  5CQF A;  3B3R A;  1GPE A;  5BUK A;  2B76 A;  1E7P A;  3CNS A;  1OJT A;  4Y4L A;  3Q6J A;  1FEC A;  4C74 A;  2V60 A;  1EBD A;  2Q0L A;  2YLW A;  3QVP A;  4TLX A;  5J7X A;  4B65 A;  4EMW A;  2FJD A;  4JNA A;  4CRT A;  2X50 A;  4IA5 A;  4TM1 A;  1Y56 A;  2WU2 A;  3GMB A;  5U1O A;  2GRT A;  1CC2 A;  5IQ1 A;  2WEU A;  1ONF A;  2YLS A;  4XXG A;  1GND A;  2C67 A;  2WOW A;  4H4U A;  3CPH G;  3UP4 A;  4H50 A;  3AE7 A;  4MJW A;  1RSG A;  3SX6 A;  2VRL A;  5HHF A;  1BGN A;  5JRB A;  3T37 A;  1CBO A;  2XFP A;  2VZ2 A;  1KDG A;  1GXF A;  2GQW A;  2GR1 A;  3IC9 A;  1NG3 A;  2V3B A;  3CGD A;  2B9X A;  3AEC A;  3T0K A;  3V3O A;  2JBV A;  1NHQ A;  4H4R A;  3AE4 A;  3DK4 A;  1NPX A;  3ATR A;  2YVG A;  1GER A;  4OCG A;  1GEU A;  1XHC A;  2RAB A;  4Z44 A;  2XLS A;  3P4S A;  4G74 A;  4X9M A;  3UTG A;  4ADW A;  2BS4 A;  3NYC A;  3GRS A;  4G6G A;  1K0J A;  3IHG A;  4H2R A;  2BAC A;  1PXC A;  2YVF A;  4GCM A;  1P2H A;  3UTF A;  2ZZC A;  1PBB A;  5M0Z A;  2XVJ A;  5HXI A;  3L1R A;  4U8N A;  3KU9 A;  3UCL A;  1BKW A;  3LZW A;  2J3N A;  4FDC B;  5HY5 A;  3NGC X;  1CHU A;  4USR A;  4B63 A;  5KMP A;  2JB1 A;  2GMH A;  4CY6 A;  1JEH A;  4EQS A;  3CTY A;  3G5Q A;  1QJD A;  1ZK7 A;  3AE5 A;  3CPJ G;  3I6D A;  1L0V A;  2OAL A;  3AED A;  1YY5 A;  4J57 A;  3NT6 A;  3SYI A;  4LII A;  1K4Q A;  2R0P A;  3ITJ A;  4GRT A;  4B68 A;  2IVE A;  2UZZ A;  5KWF A;  1E39 A;  3UKF A;  1PBD A;  4YSX A;  4PAA A;  4A7A A;  2YLX A;  3RP6 A;  4RG4 A;  2XLT A;  2Y6R A;  4U8O A;  5KVI A;  3P4Q A;  1KNR A;  1O94 A;  2YLT A;  3NNE A;  2C75 A;  1PXB A;  3ADA B;  5ER0 A;  3COX A;  3BHK A;  3O0H A;  4NEW A;  4J2W A;  5EBK A;  1DJN A;  4K2X A;  4HB9 A;  4ICY A;  3SFE A;  4D04 A;  2R4J A;  2EQ6 A;  3NK1 X;  4JN9 A;  5KMS A;  3GDP A;  1ZY8 A;  2WHD A;  1GRA A;  2H89 A;  4GR1 A;  5KOX A;  4U2S A;  2BC0 A;  4FK1 C;  2WPF A;  1QLB A;  1D7Y A;  2C3D A;  1CL0 A;  4AT2 A;  1LQU A;  4DSH A;  4FX9 A;  3K30 A;  1PS9 A;  4AOS A;  3C96 A;  4YSY A;  2XVH A;  1D4C A;  1Z6L A;  3CPI G;  1S7M A;  1VDC A;  2JB2 A;  4K22 A;  5FMH A;  4WCT A;  2XVE A;  4Y4M A;  3UKP A;  4YSH A;  1D4E A;  4H2Q A;  4OPC A;  1ELI A;  1PBF A;  2QA1 A;  2XLR A;  2YG6 A;  3K7M X;  3K7Q X;  3T2Z A;  2OA1 A;  2BCP A;  3CGE A;  5J60 A;  1N4U A;  1E1N A;  1ZX9 A;  1YQ4 A;  2WP5 A;  3ABV A;  5CKU A;  4A65 A;  4U8P A;  2ZBW A;  3ISH A;  4X4J A;  1PJ6 A;  3D8X A;  3M13 A;  4A6N B;  3GRT A;  3K7T A;  3RP8 A;  1EL5 A;  3L5O A;  2JK6 A;  1KF6 A;  3NN0 X;  4B64 A;  3DK8 A;  3V76 A;  3DGH A;  2C65 A;  1XAN A;  2B7R A;  4J56 A;  1KFY A;  2YR6 A;  1RYI A;  2VQB A;  3NIX A;  1K0L A;  2E1M A;  4U8M A;  1TDO A;  2FJB A;  4UP3 A;  3P4P A;  1B8S A;  4KPR A;  1B37 A;  2V61 A;  2WPE A;  2BA9 A;  2XVI A;  4CCQ A;  4P9S A;  2CDU A;  4N9X A;  2PYX A;  4H2N A;  1IUW A;  2OLN A;  1NEK A;  1E1M A;  2XLP A;  4A79 A;  3HZL A;  4B69 A;  2YG5 A;  4GAP A;  5L46 A;  4II3 A;  2V3A A;  4U2L A;  1V59 A;  1PBE A;  5FS8 A;  4IA6 A;  2A8X A;  1JRZ A;  4PAB A;  3D9X A;  1L9D A;  3FMW A;  4Z25 A;  2BK4 A;  4GAV A;  1FEA A;  4JY2 A;  4K5S A;  3KVE A;  3QSM A;  3UOX A;  1FCD A;  2YG3 A;  4U8K A;  1M64 A;  4EIQ A;  2C64 A;  1ZKQ A;  4NTC A;  2XFO A;  1EL8 A;  4JNQ A;  1CJ3 A;  1KSS A;  2AR8 A;  2AQJ A;  2GQF A;  2I0Z A;  1NHP A;  4DGK A;  4G6H A;  2YLR A;  3LB8 A;  1NDA A;  4EM3 A;  4I58 A;  2C3C A;  3S5W A;  4H2P A;  1OJ9 A;  3SZW A;  2JAE A;  2XVF A;  4I59 A;  1CC6 A;  1QO8 A;  3V3N A;  1IUU A;  4FK1 A;  3T31 A;  4BUR A;  4OPD A;  2NVK X;  4AP3 A;  4H4X A;  3VR9 A;  5FS7 A;  3UKL A;  4RG3 A;  3DJJ A;  3GD4 A;  3ATQ A;  3AYJ A;  1LQT A;  3DH9 A;  1S2Y A;  4JY3 A;  1GOS A;  4YTP A;  3I3L A;  2GF3 A;  3T2Y A;  3CIR A;  1PBC A;  3GWF A;  3HYW A;  3ALM A;  3SZF A;  3NYE A;  4GF7 A;  4H4W A;  4Y4N A;  1LJ1 A;  2C72 A;  4B67 A;  2GAH B;  3PVC A;  3QJ4 A;  3SQP A;  4WX1 A;  3GYI A;  4A5L A;  1DOD A;  4JQ9 A;  3AE1 A;  1NHR A;  3LZX A;  2W0H A;  1P2E A;  1H7W A;  1KNP A;  3R9U A;  2O9Z A;  3UOV A;  1NHS A;  5GRT A;  2C73 A;  4A9W A;  2BK5 A;  3CNT A;  2FJA A;  4REK A;  4Z24 A;  4NNJ A;  3T14 A;  3VRA A;  2GR0 A;  4EMJ A;  3VR8 A;  2XFU A;  4APN A;  1YKJ A;  2VRM A;  3C4A A;  3AEB A;  1GT8 A;  1IUT A;  3NH3 X;  5KOW A;  2DKH A;  1GTH A;  2WDV A;  2YR4 A;  1HYU A;  2Z5Y A;  3G5R A;  3IHM A;  3SZ0 A;  4A6N A;  1TYT A;  1N4V A;  4IVO B;  1S3B A;  3L8K A;  3QVR A;  4NEV A;  3G5S A;  4Z26 A;  3EPT A;  2BRY A;  1ZP0 A;  3ALJ A;  3LJP A;  4U8L A;  1TDF A;  3UTH A;  1PXA A;  3ICT A;  2CUL A;  4HA6 A;  5JCN A;  2R45 A;  3FG2 P;  1TDN A;  5IQ4 A;  2BAB A;  1H81 A;  3DA1 A;  2BRA A;  3FIM B;  5BUL A;  4YT0 A;  4H4T A;  1OJD A;  3AEE A;  2APG A;  2ZZ0 A;  3WE0 A;  2QAE A;  1D5T A;  2GR2 A;  3M12 A;  2QCU A;  4XWZ A;  3EF6 A;  1Q9I A;  1JNR A;  1H6V A;  2WP6 A;  3DME A;  3JSK A;  3SM8 A;  2F5Z A;  1IUV A;  1F8R A;  2H88 A;  3ZDN A;  4K8D A;  1PN0 A;  3SFD A;  3GMC A;  2EQ7 A;  2OAM A;  4TM0 A;  3VQR A;  3BI2 A;  4K7Z A;  1DJQ A;  1ZMC A;  5BVA A;  3NTD A;  4A99 A;  5KMR A;  1LV0 A;  2VVM A;  1DOB A;  1JU2 A;  1KN0 A;  1EL7 A;  2FBW A;  3ICR A;  3D1C A;  2CFY A;  2YQU A;  3LAD A;  1VRQ B;  4BJY A;  3SY4 A;  1H7X A;  2YG7 A;  3IWA A;  3QSS A;  2XCG A;  1PJ7 A;  2X8C A;  3AXB A;  2TPR A;  2WDQ A;  3CNJ A;  3AE3 A;  3UTE A;  2X99 A;  2C70 A;  4NWZ A;  2YM1 A;  1ZOY A;  4YWO A;  2GH5 A;  3DK9 A;  2DKI A;  2R9Z A;  1KSU A;  2YLZ A;  3QSE A;  3KKJ A;  2B9Y A;  2IVD A;  1GRE A;  3QFA A;  1H86 A;  2TMD A;  3CND A;  3UKA A;  4H4S A;  4OPL A;  3UOZ A;  1MO9 A;  5KMQ A;  1F3P A;  3NTA A;  3OZ2 A;  3EAN A;  3ALL A;  4OPG A;  4ZN0 A;  1TDE A;  1XPQ A;  3FBS A;  4ECH A;  3URH A;  4H4Q A;  2V6O A;  3PG6 A;  2A87 A;  4YKF A;  3UKH A;  1BF3 A;  3P1W A;  4H4Z A;  2Q0K A;  3DJD A;  4UDR A;  2VOU A;  1F8S A;  5U63 A;  4DNA A;  1E6E A;  5HYM A;  3P9U A;  3DGZ A;  1Y0P A;  2BXR A;  3H8I A;  4C77 A;  4YTN A;  2PHH A;  2YVJ A;  1LTX R;  2R46 A;  4EMI A;  1AOG A;  2Q6U A;  5C2T A;  1Q1W A;  1H83 A;  3E1T A;  4LU6 A;  2ZZB A;  3AWI A;  1FL2 A;  3T2K A;  1CJ4 A;  3NYF A;  4H4V A;  4H4Y A;  1ZDL A;  1GSN A;  4O5Q A;  2WPC A;  1VG0 A;  4YTM A;  2JB3 A;  2VVL A;  1JNZ A;  2X3N A;  3II4 A;  4KX6 A;  5EB5 A;  3KLJ A;  1LPF A;  2XLU A;  4GDP A;  5BRT A;  1PJ5 A;  3RP7 A;  1GRF A;  2C76 A;  2WU5 A;  5DBJ A;  1CJ2 A;  2BS2 A;  1W4X A;  2GV8 A;  3PS9 A;  4Z2U A;  3EAO A;  1VG9 A;  2Q7V A;  2R0G A;  3KA7 A;  3CNP A;  3GSI A;  4RSL A;  1B4V A;  1O95 A;  1L9C A;  2RGO A;  4U2T A;  3RHA A;  3NK2 X;  2QA2 A;  3BHF A;  3IF9 A;  2X8H A;  1K0I A;  1IJH A;  1EL9 A;  3NN6 X;  1ZMD A;  2NPX A;  1O5W A;  2E5V A;  1LVL A;  2Z5X A;  4EM4 A;  3SXI A;  4CNJ A;  4B1B A;  4OPI A;  5GSN A;  1COY A;  3SZC A;  3F8R A;  4K5R A;  2R0C A;  3AYL A;  3NG7 X;  1ZOV A;  2B7S A;  1BWC A;  3UKK A;  3F8P A;  3AEF A;  3BNU A;  4G9K A;  4GUV A;  2WBA A;  2GAG B;  4BV6 A;  1CF3 A;  2GR3 A;  3M0O A;  3AEA A;  3GD3 A;  1CJC A;  1X31 B;  4UDP A;  3AD7 B;  2A89 A;  1D4D A;  2AAQ A;  1MXT A;  4CBQ A;  4YXD A;  2YWL A;  3CGB A;  1H84 A;  4BK2 A;  1S2Q A;  4U8I A;  2VQ7 A;  2C66 A;  4H7U A;  4EIP A;  4C3X A;  5C3J A;  2R4E A;  1YQZ A;  4J36 A;  3NLC A;  3UKQ A;  1F6M A;  4LA1 A;  2B9W A;  2VVL G;  2Y6Q A;  1IUS A;  1H2I A;  3AEG A;  4OVI A;  1JRX A;  4IV9 A;  2C4C A;  1DXL A;  1GAL A;  1N4W A;  2YR5 A;  1IUX A;  5U25 A;  1GRT A;  4CY8 A;  5LV9 A;  1DOC A;  3NRN A;  1JRY A;  1DNC A;  5FS6 A;  4EQX A;  2BS3 A;  3GYJ A;  3QFB A;  1M6I A;  2WES A;  4JDR A;  3GYX A;  4XWR A;  1Y56 B;  1NEN A;  4AOX A;  5FS9 A;  2GEW A;  4EQW A;  3H4K A;  1TRB A;  2E4G A;  2FJE A;  4UDQ A;  2JKC A;  1DOE A;  3LOV A;  1SEZ A;  2GB0 A;  3KD9 A;  2ARD A;  3NHO X;  1CC4 A;  4X9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...