3CGDA

Pyridine nucleotide complexes with bacillus anthracis coenzyme a-disulfide reductase: a structural analysis of dual nad(p)h specificity
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
444
structure length
444
Chain Sequence
MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRDKYGIDAKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGAIGLEMAETFVELGKKVRMIERNDHIGTIYDGDMAEYIYKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLVSVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyridine nucleotide-disulfide oxidoreductase, class I
publication title Pyridine Nucleotide Complexes with Bacillus anthracis Coenzyme A-Disulfide Reductase: A Structural Analysis of Dual NAD(P)H Specificity.
pubmed doi rcsb
source organism Bacillus anthracis str.
molecule tags Oxidoreductase
total genus 154
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3cgdA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgdA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgdA02
4APNA 3GYJA 1ZP0A 3NYFA 3PS9A 1D4CA 4GCMA 1GT8A 2C72A 5JCLA 2BCGG 5JCKA 2QA1A 1S3BA 2VVLG 3FBSA 3NK1X 3SM8A 2VVMA 1BGNA 1ZOVA 2BS3A 3KPFA 1IUUA 2C66A 3DK9A 2GB0A 2YLWA 3AYJA 4Z24A 2GEWA 4OPGA 3G5SA 3AEAA 4TM4A 1TDEA 3NYEA 4BK2A 1TYTA 1ONFA 4XXGA 1V59A 2APGA 4BK3A 2IIDA 4RG3A 2YLRA 1XDIA 1GTEA 4REKA 3GRSA 3LJPA 1LVLA 1N1PA 1JRZA 2JKCA 3AXBA 3DJDA 4CCQA 1E39A 2Q6UA 3UP5A 3GDPA 5KRQA 4E0VA 1Y56A 3CGBA 4Z25A 3K7QX 4AT0A 1XPQA 2HQMA 4BK1A 3D8XA 2BS4A 2FBWA 2V3AA 1JRYA 2R46A 1SEZA 4FK1A 4OCGA 3WE0A 2RABA 1ZKQA 2F5ZA 3NTAA 3D1CA 1GRGA 2GAHB 2WS3A 1O5WA 3DK4A 4CY6A 4B63A 4H2RA 3VR8A 2FJDA 5GSNA 2WEUA 3BNMA 2YR4A 4J2WA 4U2SA 4B67A 3AWIA 4EMIA 1S2YA 3DK8A 1OJDA 3ICTA 3QFAA 1NEKA 3K7TA 1KDGA 2DKHA 1ZK7A 2BACA 2JB3A 2A8XA 2E5VA 1D4DA 4H4UA 3DJEA 1DOEA 3NIXA 1JOAA 2XCGA 1MOKA 2R4JA 3KKJA 3AD9B 3LOVA 1GERA 1BGJA 1EL8A 4ECHA 1FEBA 1DODA 3AE2A 2B9YA 2Z5YA 3FMWA 2GV8A 2YLSA 3PVCA 2B7RA 1O94A 4A79A 3EAOA 3RHAA 1CF3A 2CVJA 2WDRA 1Q9IA 4J33A 2VRLA 4D03A 4TLZA 1UKVG 3LXDA 3NN0X 1EL7A 1QJDA 1BF3A 2GR2A 1H83A 1YQ4A 3ADAB 3G5RA 3IHMA 1DNCA 2R4EA 3K7MX 1VG9A 4A99A 2PYXA 4YSXA 4ICYA 3UKLA 3GWFA 2R0CA 1EBDA 3ISHA 4O5QA 1IJHA 5BUKA 5C3JA 5KVHA 3NG7X 4K22A 2ACZA 2BXSA 2QCUA 2BK5A 2XVJA 3ICRA 4OPDA 5BRTA 2E4GA 3S5WA 1H82A 4X4JA 4Y4MA 2BCPA 4U8OA 5DBJA 5BVAA 4A5LA 1AOGA 3K30A 2YVGA 5HHFA 2EQ7A 3CGDA 4C77A 5EB4A 3M12A 1PHHA 1NENA 3ZYXA 1GRHA 2DKIA 4K5SA 1QO8A 4PABA 3P9UA 1NHQA 3LZWA 1TDFA 2YLZA 3CPJG 1NHPA 1LQTA 2XVFA 2ARDA 2BC1A 5IQ1A 5FS6A 2WP9A 4EQRA 3ZDNA 4YSZA 1DOCA 5U63A 3AYIA 3AD8B 2Q7VA 4A6NA 4B64A 4C5OA 3CPHG 2R45A 5CQFA 4ZN0A 2VZ2A 1K0JA 1GSNA 1NHSA 3AE9A 1Y56B 2ZZ0A 1GXFA 2RGHA 3OC4A 3G5QA 2WU5A 3UKKA 4AOSA 5U25A 3UKQA 2GRTA 1H7XA 4U2LA 5HY5A 2VQBA 4BJYA 3NH3X 1NHRA 3IC9A 1GRTA 2J3NA 4GUVA 2ZZCA 2GQFA 4LU6A 3P1WA 4H4WA 2X8GA 1NG4A 2XFNA 2YG6A 3OZ2A 3GRTA 2GH5A 2YWLA 3CNJA 5M10A 4H4XA 1BKWA 3LB8A 2YM2A 2EQ6A 4EMJA 4H4ZA 3V3OA 1EL5A 1L0VA 2A87A 3AE8A 3ABVA 4H4SA 1E1KA 4IA5A 1PJ7A 2C75A 3UTFA 1S3EA 1GALA 3REDA 4ZCCA 3NKSA 4H4TA 5J60A 4CCRA 1F8SA 1LJ1A 4YTMA 3DJJA 3JSKA 4TM3A 4GDEA 4OPIA 3ALMA 4Z43A 3BI5A 1BWCA 1E1LA 3AE7A 4AT2A 4Z26A 1JEHA 1F3PA 1VDCA 2R0GA 3CIRA 2VVLA 4YT0A 1FOHA 4H50A 4YKGA 2BC0A 2GR3A 2YR6A 4JY2A 2Q0LA 2BK4A 4NTEA 1EL9A 1N4WA 4U8MA 2CULA 2BS2A 4XWZA 2GMHA 1E1MA 1OJ9A 1PXBA 4Y4NA 1FCDA 1RP0A 3NHOX 1NG3A 4WX1A 4A65A 1DOBA 4NTCA 4D04A 2X50A 5KXJA 1B8SA 4C74A 1GPEA 2C3DA 3CPIG 4NZHA 4RG4A 4CNKA 2YAUA 4B68A 4I59A 2AR8A 2YG3A 3F8RA 2BXRA 2JB2A 4A9WA 1DJQA 2YVJA 2V61A 3NK0X 4H2PA 3CTYA 2IVDA 4N9XA 4C3YA 1GV4A 5KVIA 2V60A 2B76A 4JNQA 3RP7A 4WCTA 3DMEA 2EQ9A 3CGEA 4OPUA 2WOIA 1PS9A 2BYBA 2C65A 2JBVA 4J31A 3VQRA 1D7YA 3CNPA 2B9XA 3AD7B 4TM0A 3C4AA 1H86A 1ZOYA 3AE1A 1B37A 1B5QA 5FS7A 4U8LA 3UOZA 2Q0KA 2X8CA 1HYUA 5KOWA 5J7XA 2GMJA 2AAQA 4Y4LA 1KNPA 2BA9A 2FJAA 4AP1A 4H2QA 4J57A 1CJ4A 1FL2A 5CKUA 4AOXA 3V76A 4NEWA 2C76A 2YG4A 1YY5A 2VOUA 2WOVA 4H4PA 4O5UA 4EMWA 3FG2P 1GRAA 1NPXA 4A6NB 1ZMDA 3GD4A 2XDOA 4IA6A 3NN6X 3NNEA 3NK2X 2OLNA 3PO7A 2FJBA 3Q9TA 4K8DA 4YKFA 3RP8A 4UP3A 4EM4A 1KSUA 2YVFA 4K7ZA 3AEBA 5JCMA 1L9CA 1VG0A 1K0IA 3S61A 4DSGA 3L8KA 1PBBA 5ER0A 2XLTA 3GWDA 3COXA 4GF7A 1ZX9A 3QSMA 2NVKX 3QVRA 2I0ZA 3DH9A 5GRTA 3KD9A 1MO9A 2C3CA 1CL0A 1M64A 4TLXA 4U8PA 1TYPA 3NTDA 3NGCX 1JRXA 3ITJA 1H81A 3AEFA 4OPCA 4LIIA 4B1BA 2YLTA 2YLXA 3LADA 3CN8A 3KU9A 1PBCA 3M13A 3NLCA 2WDVA 3SFEA 1N4UA 2JB1A 1CC6A 1GNDA 3GMBA 5FS8A 3BHFA 1OJTA 1RSGA 4YTPA 4UDRA 1E7PA 3H8LA 4U8NA 3AEDA 4DNAA 2CFYA 2Z5XA 1Q1RA 1GOSA 3GMCA 3SGLA 4K2XA 2XFQA 4B69A 4H4YA 3F8PA 4USRA 1GRFA 3Q6JA 4USQA 2GQWA 4BURA 4EQWA 3EPTA 4H2NA 1LPFA 2YM1A 3II4A 4JQ9A 5LV9A 3R9UA 4JNAA 2RGOA 2WOWA 3H4KA 4KX6A 2XVHA 3GSIA 4JN9A 3ATQA 4CBQA 4CNJA 1CJ2A 4UDPA 5JCIA 1PJ5A 2QA2A 3ICSA 1P2EA 4J34A 3AE3A 3L1RA 2WP6A 1IUWA 4Z2UA 4EIPA 1NDAA 1DJNA 2X3NA 2GVCA 3NRNA 1XHCA 3AE5A 4YXDA 4EQSA 3B3RA 4NEVA 1GEUA 1TRBA 1ELIA 5C2TA 3EANA 4YSYA 4DGKA 3I6DA 4H7UA 1QLBA 1NAAA 1Y0PA 2NPXA 1H84A 1Z6LA 1JNRA 2OLOA 4I58A 2XVEA 3ATRA 2WP5A 4JY3A 3V3NA 4J36A 1B4VA 2R0PA 3VR9A 4U8IA 4OPLA 1E6EA 1VQWA 2C7GA 2XLUA 1IUSA 3KVEA 3IHGA 5EOWA 1F6MA 3O0HA 4MJWA 4AP3A 2W0HA 2XFOA 4HB9A 5HXIA 1BZLA 3BI4A 4J56A 2OALA 3CNTA 4P9SA 1M6IA 2IVEA 3SFDA 3B6DA 2WPFA 4JDRA 3I3LA 1PBFA 1KF6A 3VRAA 4K5RA 1CJ3A 1ZY8A 4DSHA 3BHKA 3RNMA 3VRBA 3BNUA 2WDQA 1K0LA 3FPZA 2XVIA 2H88A 3EF6A 4B65A 2C70A 4HA6A 3UKHA 4ADWA 3UP4A 2WPEA 3UCLA 2Y6RA 2JAEA 4FDCB 1L9EA 3AB1A 3T37A 3AEEA 5U1OA 2R9ZA 3DGHA 4LA1A 1KNRA 3FIMB 4OVIA 4GRTA 2WESA 4XWRA 4U8JA 1YQZA 2VQ7A 3UTEA 3URHA 1N4VA 2OA1A 2PHHA 2TMDA 1TDOA 4NTDA 1JNZA 3SQPA 4C3XA 4CRTA 2VRMA 2V5ZA 1RYIA 1KSSA 1PXAA 1PN0A 4FX9A 2E1MA 2Y6QA 3M0OA 4YTNA 4Z2RA 5HYMA 4Z44A 5M0ZA 2XLSA 4IVMB 2V6OA 1D4EA 2AQJA 1O95A 4OPTA 1X31B 4FK1C 3ALLA 2A89A 3QSEA 1D5TA 1JU2A 1PBDA 2C67A 2YG7A 2XFUA 1VRQB 5L46A 4U2TA 4U8KA 2H89A 1LTXR 1PXCA 4CY8A 2GR0A 4EM3A 4EQXA 1GTHA 1GETA 3UOXA 3IF9A 4PAAA 4EIQA 5BULA 2YG5A 4YSHA 3AEGA 3CNDA 4UDQA 4BV6A 3H8IA 2ZZBA 1IUTA 2XLRA 1F8RA 1P2HA 1COYA 3QVPA 1GRBA 2GF3A 5FMHA 1YQ3A 1FEAA 3AE4A 5EB5A 1DXLA 3UKAA 3LZXA 1CJCA 2OAMA 2JK6A 3DGZA 3DA1A 5IPYA 3KLJA 2WHDA 1CC4A 3P4SA 3QJ4A 1LQUA 2QAEA 4GDPA 1PDHA 4TM1A 3F8DA 5JCNA 2C73A 1H6VA 4M52A 1W4XA 2GAGB 2CDUA 2UZZA 3UTGA 2WPCA 3BI2A 3C4NA 1H7WA 2BK3A 2WETA 2XLPA 3RP6A 5KWFA 3E1TA 2XYOA 1ZDLA 4Z2TA 4B66A 3CNSA 4IVOB 1F8WA 2WBAA 3P4PA 1KFYA 4H4QA 2RGJA 3GDNA 5TR3A 4X9NA 3AE6A 1GREA 3UOVA 3P4QA 4YWOA 3UTHA 3DJGX 1ZMCA 3AECA 2EQ8A 4H4VA 1PJ6A 1E1NA 5EBKA 4X9MA 4KPRA 1CC2A 4RSLA 2ZBWA 2XFPA 3QFBA 5KOXA 1S2QA 4A7AA 3IWAA 1IUVA 3GD3A 2TPRA 1CHUA 1OJCA 4BJZA 3C96A 1TDNA 3UKPA 5FS9A 4H4RA 1IUXA 1LV0A 2FJEA 2O9ZA 1Q1WA 4IV9A 5IQ4A 1XANA 3NYCA 2X99A 1MXTA 2GR1A 3GYIA 3AYLA 1OJAA 2C64A 4ZCDA 2X8HA 3UKFA 3CGCA 3UOYA 1D7LA 2BABA 1CBOA 3KA7A 2YQUA 1TDKA 3HZLA 1GESA 4GR1A 1REOA 1YKJA 3ALJA 1K4QA 3VRDB 2YR5A 2B9WA 1PBEA 3NT6A 3QSSA 1FECA 2V3BA 1L9DA 2B7SA 2WQYA 2WU2A 3P4RA
chains in the Genus database with same CATH superfamily
3GYJA 1ZP0A 3STPA 1D4CA 3NK1X 3P4PA 3SM8A 5HYMA 2PGWA 1BGNA 2BS3A 3KPFA 2GB0A 2OZTA 1JCTA 3RCYA 2GEWA 5KMQA 2PP1A 1TYTA 4XXGA 2APGA 2OLAA 1PDYA 4REKA 3DJDA 3FXGA 5FJTA 1KCZA 3H7VA 3UP5A 3GDPA 5KRQA 3OZYA 3CGBA 1XPQA 4G8TA 2FBWA 1JRYA 3IJLA 1SEZA 3WE0A 3NTAA 1GRGA 1O5WA 4CY6A 1X2GA 4B63A 3VR8A 5GSNA 3DIPA 4U2SA 3DFHA 3DK8A 1OJDA 1NEKA 1TKKA 1KDGA 2E5VA 1JOAA 2XCGA 2R4JA 3KKJA 5KMPA 3T0KA 1EL8A 1FEBA 3HYXA 1FFVC 2GV8A 3EAOA 4FI4A 2WDRA 1UKVG 3NN0X 1BF3A 3IHMA 3T9PA 2PYXA 4ICYA 1JRPA 3UKLA 2R0CA 4O5QA 3NG7X 1EBHA 3ICRA 3S5WA 1WUFA 5BVAA 3V4BA 3M12A 2PODA 1GRHA 4M0XA 1QO8A 3OTRA 1KN0A 3P9UA 1NHQA 3OPSA 1TDFA 2ARDA 5IQ1A 1DOCA 1GSNA 1NHSA 1GXFA 5KMRA 2WU5A 1H7XA 2VQBA 4BJYA 3UGVA 1NHRA 2ZZCA 3FVDA 4ZCWA 4E8GA 3GRTA 2GH5A 3CNJA 3SZWA 4H4XA 2OVLA 5G5GB 1E1KA 4IA5A 2P8BA 3REDA 3NKSA 3ALMA 2E3TA 1JEHA 4Z26A 3HYWA 2YR6A 2ONEA 2Q0LA 3AMZA 1N61C 4XWZA 2GMHA 1E1MA 2QGYA 1PXBA 3A7RA 4DXKA 4WX1A 4A65A 4NTCA 3SZ0A 4D04A 2C3DA 3EKGA 5J04A 2MUCA 4B68A 3R11A 2YG3A 4A9WA 2YVJA 3NK0X 4C3YA 4JNQA 3DMEA 2WOIA 1EC9A 3VQRA 1D7YA 3CNPA 2B9XA 3AD7B 1ZOYA 3QKEA 3AE1A 1B37A 1B5QA 1E9IA 3RITA 2Q0KA 3CXBA 4GFIA 5J7XA 4H2QA 3P3BA 2WOVA 4EMWA 2W55A 2GL5A 2XDOA 4IA6A 4YWSA 5BOEA 3DGBA 3TQPA 2FJBA 4YKFA 3H12A 1KSUA 3AEBA 1K0IA 3L8KA 4GF7A 1ZX9A 3OZMA 3QSMA 3QVRA 3DH9A 1M64A 1TYPA 3NTDA 1JRXA 2YLTA 3KU9A 3VDGA 1N4UA 2JB1A 2AL1A 1CC6A 3ZVHB 5FS8A 1RSGA 4YTPA 4UDRA 1JPMA 3AEDA 2CFYA 5G5HB 4H4YA 4USRA 3Q6JA 4USQA 2C4CA 4H2NA 5LV9A 3R9UA 2RGOA 3UCDA 3GSIA 2XH0A 3ATQA 4CNJA 1CJ2A 4UDPA 5JCIA 3UJSA 1DJNA 3SR6B 3NRNA 3K1GA 3AE5A 4YXDA 2O56A 4EQSA 4KEMA 1ELIA 5FJPA 4DGKA 4H7UA 4I58A 1NAAA 1Y0PA 2WP5A 2XLUA 5EOWA 2PS2A 3O0HA 4MJWA 4AP3A 2W0HA 2W3RA 4HB9A 3CNTA 4P9SA 1M6IA 3SFDA 4JDRA 1XS2A 3I3LA 1CJ3A 3BHKA 2WDQA 3EF6A 4ENLA 3UCLA 2JAEA 3SBFA 4EWJA 3T2ZA 3DGHA 4OVIA 3VA8A 1KNRA 4XWRA 2GGHA 1TDOA 1STZA 3S5SA 4JHMA 1R0MA 2VRMA 2V5ZA 4FX9A 3Q4DA 2Y6QA 3SYIA 4YTNA 1JROA 5M0ZA 2AQJA 4HCLA 3ALLA 1ELSA 1VRQB 5L46A 2H89A 4CY8A 2GR0A 5BULA 2YG5A 1YEYA 4UDQA 3D9XA 2ZZBA 1IUTA 2GF3A 3TOYA 1DXLA 1TZZA 3LZXA 5IPYA 3QJ4A 4G73A 3N6HA 2C73A 3NO1A 2CDUA 2WPCA 4H1ZA 5KWFA 2WETA 4Z2TA 2WBAA 2AL2A 1P43A 3FV9A 1ZMCA 3R1ZA 1CC2A 2DW6A 2PU0A 3IWAA 1CHUA 3RO6A 4H4RA 3KUMA 2FJEA 2O9ZA 1XANA 3NYCA 4GISA 3AYLA 2X8HA 2OKTA 1D7LA 3KA7A 2YQUA 1GESA 3FCPA 4X2PA 3R0UA 3NYFA 2C72A 2BCGG 2QA1A 2VVMA 1NU5A 2C66A 3DK9A 1SJBA 4OPGA 3AEAA 1TDEA 1V59A 4E6MA 4MKSA 1N1PA 3I4KA 4CCQA 2I5QA 3AXBA 2PP0A 1Y56A 4AT0A 4GYPA 4FK1A 1X2HA 3JW7A 2GAHB 1SJDA 2FJDA 2WEUA 4B67A 2YR4A 3QFAA 2OG9A 3K7TA 2DKHA 4H4UA 1DOEA 3NIXA 1MOKA 3RGTA 3LOVA 1MUCA 4IT1A 1DODA 3AE2A 2QJJA 3FMWA 1O94A 4IZGA 3RHAA 3I6TA 2CVJA 4D03A 3LXDA 1YQ4A 1DNCA 2R4EA 3GWFA 3ISHA 2DW7A 2XVJA 2E4GA 4X4JA 4Y4MA 2BCPA 3K30A 2YVGA 3A7UA 2EQ7A 5EB4A 4E4FA 3U4FA 3CPJG 2XVFA 2QJNA 2WP9A 5U63A 4K1WA 3AYIA 3UJRA 4A6NA 4B64A 1OEPA 3MZNA 3AE9A 2RGHA 3NRZB 5U25A 2ZADA 2GRTA 4U2LA 3IC9A 1GRTA 3DG7A 4H4WA 2XFNA 2YWLA 2YM2A 3LB8A 4EMJA 4H4ZA 1EL5A 2A87A 3AE8A 3ABVA 3MWCA 3D46A 3DFYA 1LJ1A 4YTMA 4GDEA 3BI5A 3HYVA 4AT2A 3H8AA 3BSMA 4H83A 2VVLA 2BC0A 3NFUA 5FJRA 4KT2A 1FCDA 1NG3A 1DOBA 2X50A 4C74A 3CPIG 3R10A 4RG4A 4NZHA 2YAUA 2AR8A 2BXRA 1DJQA 2HNEA 5KVIA 2V60A 2B76A 4A6GA 4WCTA 3DG6A 2BYBA 2C65A 2FYMA 3B9JB 3UOZA 2X8CA 3VC6A 2GMJA 4Y4LA 1KNPA 2BA9A 2PTYA 4AP1A 4J57A 3DG3A 4NEWA 1YY5A 2HXUA 4H4PA 1ZMDA 2GDQA 3NK2X 1FIQB 4K8DA 4IHCA 4A3RA 5JCMA 1L9CA 2PSNA 5ER0A 3NVVB 1MO9A 2C3CA 1CL0A 4TLXA 3AEFA 4OPCA 4FP1A 3LADA 3A7AA 1PBCA 3NLCA 2WDVA 3H70A 1GNDA 4A35A 1SB3B 3THUA 1IYXA 3MSYA 3RR1A 3H8LA 4U8NA 1GOSA 3GMCA 4K2XA 2XFQA 4B69A 1MDLA 2W3SA 1GRFA 4GAVA 4BURA 3EPTA 1LPFA 3AM9A 3CXOA 3H4KA 2QJMA 1VQZA 2W54A 2QA2A 2OFJA 4HPNA 4EIPA 3R25A 2X3NA 2GVCA 1TRBA 4KPLA 3PK7A 3EANA 4YSYA 3JZUA 3CMMA 1QLBA 3GC2A 3P93A 4JY3A 4J36A 2R0PA 4OPLA 1E6EA 1VQWA 2C7GA 1ECQA 3KVEA 1MDRA 3IK4A 4IL2A 3IJIA 2WPFA 4H19A 1KF6A 3VRAA 4DSHA 3RNMA 1K0LA 2XVIA 2Y6RA 1L9EA 5U1OA 3UJ2A 2R9ZA 3CYJA 4LA1A 4GRTA 2WESA 3VCNA 4U8JA 3UTEA 1N4VA 2OA1A 1RYIA 2E1MA 4Z44A 3CB3A 2XLSA 4GYPC 2V6OA 1X31B 4FK1C 1JU2A 3D47A 2PU1A 1KKRA 1PXCA 4KWSA 4EQXA 3IF9A 4PAAA 4ZA0A 2AKMA 4BV6A 3QVPA 1F8RA 1P2HA 1GRBA 5FMHA 4GMEA 1CJCA 2JK6A 3DA1A 1FHVA 2QAEA 3N4FA 5JCNA 4M52A 1W4XA 2GAGB 3S47A 3UTGA 2XLPA 1S7MA 2EQ8A 1E1NA 2XFPA 3QFBA 5KOXA 1OJCA 3UKPA 5IQ4A 1MXTA 1OJAA 3SXIA 2GGGA 1CBOA 1YKJA 3ALJA 3VRDB 3PWIA 1FECA 2V3BA 2B7SA 2WU2A 1N63C 4APNA 3GY1A 3TW9A 5JCLA 5JCKA 1S3BA 3FBSA 1JDFA 3MQTA 3AYJA 4Z24A 3G5SA 3CAWA 3NYEA 1FHUA 4BK3A 3R07C 2IIDA 4RG3A 3SN1A 2YLRA 2NQLA 3SZCA 4IL0A 4F4RA 2JKCA 2OPJA 3GYXA 4E0VA 2GGEA 2HQMA 3D8XA 2V3AA 2GSHA 2F5ZA 3RRAA 2XH4A 4DN1A 2WS3A 3I6EA 3DEQA 3DK4A 4H2RA 4HCHA 3ENLA 3BNMA 3AWIA 2PGEA 4EMIA 1N60C 3ICTA 3FYYA 2JB3A 2A8XA 1D4DA 3DJEA 3AD9B 1BGJA 2HXTA 2YLSA 2B7RA 1ZXIC 1CF3A 1Q9IA 2E5AA 2VRLA 4TLZA 1EL7A 2GR2A 4CNKA 3K7MX 3V5FA 1IJHA 5BUKA 4K22A 2ACZA 2BXSA 2QCUA 2BK5A 3SQSA 4OPDA 1TE6A 5BRTA 1H82A 3UJFA 4U8OA 5DBJA 4A5LA 1AOGA 4C77A 2OX4A 1PHHA 2OQYA 1NENA 2DKIA 4K5SA 1RM6B 1KD0A 1LQTA 3OP2A 3ETRB 2OZ8A 2Q7VA 1RVKA 4C5OA 4ZN0A 3QTPA 2ZZ0A 3OC4A 3UKKA 3UKQA 5HY5A 2GGJA 2OO6A 2GQFA 4LU6A 3KPKA 3P1WA 2X8GA 2YG6A 3OZ2A 7ENLA 3NZGA 2EQ6A 4H4SA 1PJ7A 3UTFA 1S3EA 1GALA 4ZCCA 4H4TA 4CCRA 1F8SA 3JSKA 4TM3A 4OPIA 1BWCA 3SSZA 3AE7A 1VDCA 2R0GA 1MRAA 4YT0A 4YKGA 2GR3A 5KNLA 4U8MA 2BS2A 1OJ9A 4Y4NA 3NHOX 1FFUC 1KKOA 3F8RA 2XH7A 3V5CA 4H2PA 2XGZA 3L5OA 2IVDA 4N9XA 3ZVIA 2HZGA 3RP7A 2EQ9A 4OPUA 1PS9A 4TM0A 3MY9A 1H86A 5FS7A 1SJCA 4U8LA 5KOWA 1EC7A 2AAQA 2RDXA 2FJAA 1FL2A 4AOXA 3V76A 2YG4A 1WYGA 2C76A 2VOUA 4GGBA 1NPXA 2AKZA 3NN6X 3NNEA 3R0KA 3UJEA 3NVYB 3Q9TA 3RP8A 2YVFA 4K2SA 4DSGA 1PBBA 3COXA 2NVKX 2QDDA 2I0ZA 1NELA 3KD9A 4U8PA 2BRYA 2MNRA 3ITJA 4B1BA 2YLXA 2OZ3A 3M13A 3GMBA 4J3ZA 3BHFA 1E7PA 1P48A 4DNAA 4DYEA 1Q1RA 3SGLA 2PTZA 3F8PA 3ES7A 2GQWA 4EQWA 3II4A 4JQ9A 4JNAA 4HCDA 4KX6A 2XVHA 4CBQA 1PJ5A 3QLDA 4J34A 3AE3A 3L1RA 1R6WA 3IJQA 3VC5A 4IP5A 1NDAA 2POZA 3N6JA 3T31A 3B3RA 4HN8A 5C2TA 3I6DA 1Z6LA 1H84A 1JNRA 2OLOA 5FJUA 3ATRA 3V3NA 2XSXA 4U8IA 1IUSA 1V97A 5HXIA 1BZLA 4J56A 3BJSA 3TCSA 3B6DA 1PBFA 4GGHA 4JN7A 2P0IA 3FPZA 2H88A 4B65A 3UCCA 3UKHA 4ADWA 3UP4A 2P3ZA 3AEEA 4Z1YA 3FIMB 2VQ7A 3URHA 3SQPA 4C3XA 4CRTA 3M0OA 1PXAA 1PN0A 3VFCA 3QN3A 4IVMB 3QSEA 2C67A 2YG7A 2XFUA 4U2TA 4U8KA 1LTXR 2QDEA 1GTHA 1GETA 3UOXA 4YSHA 4G7FA 4HNLA 3SN0A 4DHGA 3CNDA 1EBGA 1YQ3A 1FEAA 3AE4A 5EB5A 3UKAA 2OAMA 3KLJA 2WHDA 3P4SA 1LQUA 3JVAA 1PDHA 3F8DA 3QPEA 1H6VA 1BKHA 3NS1B 2UZZA 3OW1A 4IP4A 2BK3A 1JPDX 2XYOA 3CNSA 4IVOB 1F8WA 3T6CA 1KFYA 2RGJA 5TR3A 4II3A 4X9NA 3AE6A 1GREA 3DJGX 2QQ6A 1PJ6A 2BRAA 3GD6A 4A7AA 3GD3A 5BOFA 3C96A 1VDVA 3GYIA 1L8PA 3UKFA 2BABA 4GR1A 3SY4A 2GGIA 3T4WA 2B9WA 1PBEA 1L9DA 2WQYA 3P4RA 3PS9A 3UOYA 5CKUA 4GCMA 1GT8A 2VVLG 1ZOVA 1ONEA 1IUUA 2YLWA 4TM4A 4BK2A 3ZLGA 1ONFA 1DTNA 1W6TA 1PDZA 4NNJA 1XDIA 1GTEA 3ZLFA 2QVHA 3GRSA 3LJPA 1LVLA 1JRZA 1E39A 3VCCA 2Q6UA 4Z25A 1EC8A 4G6HA 3K7QX 3UXLA 4BK1A 2BS4A 4OCGA 2R46A 2RABA 1ZKQA 2AL2B 3D1CA 1SJAA 4J2WA 3MUCA 1BQGA 1S2YA 1ZK7A 2BACA 4H2HA 4GIRA 1GERA 4ECHA 2B9YA 2Z5YA 4A79A 3PVCA 4J33A 1QJDA 1H83A 3ADAB 3G5RA 4YSXA 1VG9A 4A99A 1EBDA 5C3JA 3ZLHA 5KVHA 3TTEA 5HHFA 3CGDA 3UXKA 3ZYXA 4PABA 3LZWA 2PCEA 2YLZA 1NHPA 2BC1A 5FS6A 4EQRA 3ZDNA 4YSZA 3AD8B 1H2IA 3CPHG 2R45A 5CQFA 3Q45A 2VZ2A 1K0JA 1Y56B 3T14A 3G5QA 4AOSA 3SN4A 3NH3X 2J3NA 4GUVA 2PMQA 3DERA 1NG4A 4DX3A 5M10A 1BKWA 3V3OA 1L0VA 2C75A 5ENLA 5J60A 3DJJA 4Z43A 1E1LA 1F3PA 3CIRA 3HW2A 1FOHA 4H50A 4JY2A 2BK4A 4NTEA 1EL9A 1N4WA 2CULA 3PG6A 1RP0A 5KXJA 1B8SA 1GPEA 4DWDA 1N5XA 1T3QC 4I59A 2JB2A 2V61A 3NXLA 3CTYA 1GV4A 3TWBA 4HYRA 3CGEA 2JBVA 4J31A 3C4AA 4II2A 1HYUA 3GO2A 1CJ4A 1WUEA 4O5UA 3FG2P 1GRAA 4A6NB 4ZOHB 2PP3A 3GD4A 6ENLA 2OLNA 3PO7A 3EUB3 4Z17A 4UP3A 1MNSA 4EM4A 4K7ZA 3TJIA 3S61A 1VG0A 3FJ4A 4J1OA 2XLTA 3GWDA 3ES8A 5GRTA 5KMSA 3NGCX 4NWZA 4HNCA 1H81A 3CT2A 4LIIA 3CN8A 3DESA 3SFEA 3AN1A 1OJTA 2PTWA 2PPGA 2Z5XA 1F9CA 2YM1A 4E4UA 3N4EA 5FJOA 2WOWA 4JN9A 3B97A 4GAPA 3ICSA 1P2EA 2WP6A 1IUWA 4Z2UA 1XHCA 4TVYA 2P8CA 4NEVA 1GEUA 3T2YA 1N62C 2P88A 3ZVHA 2NPXA 2XVEA 1FO4A 1B4VA 3VR9A 3T8QA 3IHGA 1F6MA 5IDZA 2XFOA 3BOXA 3BI4A 2OALA 2IVEA 4K5RA 1ZY8A 3VRBA 3BNUA 2C70A 4HA6A 2PA6A 2WPEA 4FDCB 3AB1A 3T37A 2FKPA 3CK5A 3NVZB 4G9KA 1YQZA 2PHHA 2TMDA 4NTDA 1JNZA 3PFRA 1KSSA 1XPYA 4Z2RA 3U9IA 4G6GA 1D4EA 4MMWA 1O95A 4OPTA 2A89A 3SX6A 1D5TA 1PBDA 3SZFA 4G74A 3PWGA 4EM3A 4EIQA 3AEGA 3MKCA 5EU9A 3T2KA 4MGGA 3H8IA 2XLRA 2XH2A 1COYA 3DDMA 3NVWB 3V3WA 3DGZA 3TWAA 5JRBA 1CC4A 3HPFA 4GDPA 3HRDC 3EEZA 3BI2A 3SJNA 3C4NA 1H7WA 3RP6A 3E1TA 1ZDLA 4B66A 4H4QA 3GDNA 4JN8A 3UOVA 3P4QA 4YWOA 3UTHA 3AECA 4H4VA 2ZC8A 5EBKA 4X9MA 4KPRA 4RSLA 2ZBWA 1N5WC 1S2QA 1IUVA 3TJ4A 2TPRA 4E5TA 4BJZA 1TDNA 5FS9A 1IUXA 1LV0A 4IV9A 1Q1WA 4TVWA 4ROPA 2X99A 2GR1A 4M6UA 2C64A 4ZCDA 3CGCA 4K8GA 1TDKA 3HZLA 1REOA 3P0WA 1K4QA 2YR5A 3NT6A 2CHRA 2OQHA 3QSSA 2PTXA 4TM1A
chains in the Genus database with same CATH topology
4APNA 3GYJA 1ZP0A 3NYFA 3PS9A 1D4CA 4GCMA 1GT8A 2C72A 5JCLA 2BCGG 5JCKA 2QA1A 1S3BA 2VVLG 3FBSA 3NK1X 3SM8A 2VVMA 1BGNA 1ZOVA 2BS3A 3KPFA 1IUUA 2C66A 3DK9A 2GB0A 2YLWA 3AYJA 4Z24A 2GEWA 4OPGA 3G5SA 3AEAA 5KMQA 4TM4A 1TDEA 3NYEA 4BK2A 1TYTA 1ONFA 4XXGA 1V59A 2APGA 4BK3A 2IIDA 4NNJA 4RG3A 2YLRA 1XDIA 1GTEA 4REKA 3GRSA 3LJPA 1LVLA 1N1PA 3SZCA 1JRZA 2JKCA 3AXBA 3DJDA 4CCQA 1E39A 2Q6UA 3GYXA 3UP5A 3GDPA 5KRQA 4E0VA 1Y56A 3CGBA 4Z25A 4G6HA 3K7QX 4AT0A 1XPQA 2HQMA 4BK1A 3D8XA 2BS4A 2V3AA 2FBWA 1JRYA 2R46A 1SEZA 4FK1A 4OCGA 3WE0A 2RABA 1ZKQA 2F5ZA 3NTAA 3D1CA 1GRGA 2GAHB 2WS3A 1O5WA 3DK4A 4CY6A 4B63A 4H2RA 3VR8A 2FJDA 5GSNA 2WEUA 3BNMA 2YR4A 4J2WA 4U2SA 4B67A 3AWIA 4EMIA 1S2YA 3DK8A 1OJDA 3ICTA 3QFAA 1NEKA 3K7TA 1KDGA 2DKHA 1ZK7A 2BACA 2JB3A 2A8XA 2E5VA 1D4DA 4H4UA 3DJEA 1DOEA 3NIXA 1JOAA 2XCGA 1MOKA 2R4JA 3KKJA 3AD9B 5KMPA 3LOVA 1GERA 1BGJA 3T0KA 1EL8A 4ECHA 1FEBA 1DODA 3AE2A 2B9YA 3HYXA 2Z5YA 3FMWA 2GV8A 2YLSA 3PVCA 2B7RA 1O94A 4A79A 3EAOA 3RHAA 1CF3A 2CVJA 2WDRA 1Q9IA 4J33A 2VRLA 4D03A 4TLZA 1UKVG 3LXDA 3NN0X 1EL7A 1QJDA 1BF3A 2GR2A 1H83A 1YQ4A 3ADAB 3G5RA 3IHMA 1DNCA 2R4EA 3K7MX 1VG9A 4A99A 2PYXA 4YSXA 4ICYA 3UKLA 3GWFA 2R0CA 1EBDA 3ISHA 4O5QA 1IJHA 5BUKA 5C3JA 5KVHA 3NG7X 4K22A 2ACZA 2BXSA 2QCUA 2BK5A 2XVJA 3ICRA 4OPDA 5BRTA 2E4GA 3S5WA 1H82A 4X4JA 4Y4MA 2BCPA 4U8OA 5DBJA 5BVAA 4A5LA 1AOGA 3K30A 2YVGA 5HHFA 2EQ7A 3CGDA 4C77A 5EB4A 3M12A 1PHHA 1NENA 3ZYXA 1GRHA 2DKIA 4K5SA 1QO8A 4PABA 1KN0A 3P9UA 1NHQA 3LZWA 1TDFA 2YLZA 3CPJG 1NHPA 1LQTA 2XVFA 2ARDA 2BC1A 5IQ1A 5FS6A 2WP9A 4EQRA 3ZDNA 4YSZA 1DOCA 5U63A 3AYIA 3AD8B 2Q7VA 4A6NA 1H2IA 4B64A 4C5OA 3CPHG 2R45A 5CQFA 4ZN0A 2VZ2A 1K0JA 1GSNA 1NHSA 3AE9A 1Y56B 2ZZ0A 1GXFA 2RGHA 3OC4A 3G5QA 2WU5A 3T14A 3UKKA 5U25A 3UKQA 4AOSA 5KMRA 2GRTA 1H7XA 4U2LA 5HY5A 2VQBA 4BJYA 3NH3X 1NHRA 3IC9A 1GRTA 2J3NA 4GUVA 2ZZCA 2GQFA 4LU6A 3KPKA 3P1WA 4H4WA 2X8GA 1NG4A 2XFNA 2YG6A 3OZ2A 3GRTA 2GH5A 2YWLA 3CNJA 3SZWA 5M10A 4H4XA 1BKWA 3LB8A 2YM2A 2EQ6A 4EMJA 4H4ZA 3V3OA 1EL5A 1L0VA 2A87A 3AE8A 3ABVA 4H4SA 1E1KA 4IA5A 1PJ7A 2C75A 3UTFA 1S3EA 1GALA 3REDA 4ZCCA 3NKSA 4H4TA 5J60A 4CCRA 1F8SA 1LJ1A 4YTMA 3DJJA 3JSKA 4TM3A 4GDEA 4OPIA 3ALMA 4Z43A 3BI5A 1BWCA 3HYVA 1E1LA 3AE7A 4AT2A 4Z26A 1JEHA 1F3PA 1VDCA 2R0GA 3CIRA 2VVLA 4YT0A 1FOHA 4H50A 4YKGA 2BC0A 2GR3A 2YR6A 3HYWA 4JY2A 2Q0LA 5KNLA 2BK4A 4NTEA 1EL9A 1N4WA 4U8MA 2CULA 2BS2A 4XWZA 2GMHA 1E1MA 3PG6A 1OJ9A 1PXBA 4Y4NA 1FCDA 1RP0A 3NHOX 1NG3A 4WX1A 4A65A 1DOBA 4NTCA 3SZ0A 2X50A 4D04A 5KXJA 1B8SA 4C74A 1GPEA 2C3DA 3CPIG 4NZHA 4RG4A 4CNKA 2YAUA 4B68A 4I59A 2AR8A 2YG3A 3F8RA 2BXRA 2JB2A 4A9WA 1DJQA 2YVJA 2V61A 3NK0X 4H2PA 3L5OA 3CTYA 2IVDA 4N9XA 4C3YA 1GV4A 5KVIA 2V60A 2B76A 4JNQA 3RP7A 4WCTA 3DMEA 2EQ9A 3CGEA 4OPUA 2WOIA 1PS9A 2BYBA 2C65A 2JBVA 4J31A 3VQRA 1D7YA 3CNPA 2B9XA 3AD7B 4TM0A 3C4AA 1H86A 1ZOYA 4II2A 3AE1A 1B37A 1B5QA 5FS7A 4U8LA 3UOZA 2Q0KA 2X8CA 1HYUA 5KOWA 5J7XA 2GMJA 2AAQA 4Y4LA 1KNPA 2BA9A 2FJAA 4AP1A 4H2QA 4J57A 1CJ4A 1FL2A 5CKUA 4AOXA 3V76A 4NEWA 2C76A 2YG4A 1YY5A 2VOUA 2WOVA 4H4PA 4O5UA 4EMWA 3FG2P 1GRAA 1NPXA 4A6NB 1ZMDA 3GD4A 2XDOA 4IA6A 3NN6X 3NNEA 3NK2X 2OLNA 3PO7A 2FJBA 3Q9TA 4K8DA 4YKFA 3RP8A 4UP3A 4EM4A 1KSUA 2YVFA 4K7ZA 3AEBA 5JCMA 1L9CA 1VG0A 1K0IA 3S61A 4DSGA 3L8KA 1PBBA 5ER0A 2XLTA 3GWDA 3COXA 4GF7A 1ZX9A 3QSMA 2NVKX 3QVRA 2I0ZA 3DH9A 5GRTA 3KD9A 1MO9A 2C3CA 1CL0A 1M64A 2BRYA 4TLXA 4U8PA 5KMSA 1TYPA 3NTDA 3NGCX 1JRXA 4NWZA 3ITJA 1H81A 3AEFA 4OPCA 4LIIA 4B1BA 2YLTA 2YLXA 3LADA 3CN8A 3KU9A 1PBCA 3M13A 3NLCA 2WDVA 3SFEA 1N4UA 2JB1A 1CC6A 1GNDA 3GMBA 5FS8A 3BHFA 1OJTA 1RSGA 4YTPA 4UDRA 1E7PA 3H8LA 4U8NA 3AEDA 4DNAA 2CFYA 2Z5XA 1Q1RA 1GOSA 3GMCA 3SGLA 4K2XA 2XFQA 4B69A 4H4YA 3F8PA 4USRA 1GRFA 3Q6JA 4GAVA 4USQA 2GQWA 4BURA 2C4CA 4EQWA 3EPTA 4H2NA 1LPFA 2YM1A 3II4A 4JQ9A 5LV9A 3R9UA 4JNAA 2RGOA 2WOWA 3H4KA 4KX6A 2XVHA 3GSIA 4JN9A 3ATQA 4CBQA 4CNJA 1CJ2A 4UDPA 5JCIA 1PJ5A 4GAPA 2QA2A 3ICSA 1P2EA 4J34A 3AE3A 3L1RA 2WP6A 1IUWA 4Z2UA 4EIPA 1NDAA 1DJNA 2X3NA 2GVCA 3NRNA 1XHCA 3AE5A 4YXDA 3T31A 4EQSA 3B3RA 4NEVA 1GEUA 1TRBA 1ELIA 3T2YA 5C2TA 3EANA 4YSYA 4DGKA 3I6DA 4H7UA 1QLBA 1NAAA 1Y0PA 2NPXA 1H84A 1Z6LA 1JNRA 2OLOA 3CMMA 4I58A 2XVEA 3ATRA 2WP5A 4JY3A 3V3NA 4J36A 1B4VA 2R0PA 3VR9A 4U8IA 4OPLA 1E6EA 1VQWA 2C7GA 2XLUA 1IUSA 3KVEA 3IHGA 5EOWA 1F6MA 3O0HA 4MJWA 4AP3A 2W0HA 2XFOA 4HB9A 5HXIA 1BZLA 3BI4A 4J56A 2OALA 3CNTA 4P9SA 1M6IA 2IVEA 3SFDA 3B6DA 2WPFA 4JDRA 3I3LA 1PBFA 1KF6A 3VRAA 4K5RA 1CJ3A 1ZY8A 4DSHA 3BHKA 3RNMA 3VRBA 3BNUA 2WDQA 1K0LA 3FPZA 2XVIA 2H88A 3EF6A 4B65A 2C70A 4HA6A 3UKHA 4ADWA 3UP4A 2WPEA 3UCLA 2Y6RA 2JAEA 4FDCB 1L9EA 3AB1A 3T2ZA 3AEEA 5U1OA 3T37A 2R9ZA 3DGHA 4LA1A 1KNRA 3FIMB 4G9KA 4GRTA 2WESA 4OVIA 4XWRA 4U8JA 1YQZA 2VQ7A 3UTEA 3URHA 1N4VA 2OA1A 2PHHA 2TMDA 1TDOA 4NTDA 1JNZA 3SQPA 4C3XA 4CRTA 2VRMA 2V5ZA 1RYIA 1KSSA 1PXAA 1PN0A 4FX9A 2E1MA 2Y6QA 3M0OA 3SYIA 4YTNA 4Z2RA 5HYMA 4Z44A 5M0ZA 4G6GA 2XLSA 4IVMB 2V6OA 1D4EA 2AQJA 1O95A 4OPTA 1X31B 4FK1C 3ALLA 2A89A 3QSEA 3SX6A 1D5TA 1JU2A 1PBDA 2C67A 2YG7A 2XFUA 3SZFA 1VRQB 5L46A 4U2TA 4G74A 4U8KA 2H89A 1LTXR 1PXCA 4CY8A 2GR0A 4EM3A 4EQXA 1GTHA 1GETA 3UOXA 3IF9A 4PAAA 4EIQA 5BULA 2YG5A 4YSHA 3AEGA 3T2KA 3CNDA 4UDQA 3D9XA 4BV6A 3H8IA 2ZZBA 1IUTA 2XLRA 1F8RA 1P2HA 1COYA 3QVPA 1GRBA 2GF3A 5FMHA 1YQ3A 1FEAA 3AE4A 5EB5A 1DXLA 3UKAA 3LZXA 1CJCA 2OAMA 2JK6A 3DGZA 3DA1A 5IPYA 3KLJA 5JRBA 2WHDA 1CC4A 3P4SA 3QJ4A 1LQUA 2QAEA 4GDPA 1PDHA 4G73A 4TM1A 3F8DA 5JCNA 2C73A 1H6VA 4M52A 1W4XA 2GAGB 2CDUA 2UZZA 3UTGA 2WPCA 3BI2A 3C4NA 1H7WA 2BK3A 2WETA 2XLPA 3RP6A 5KWFA 3E1TA 2XYOA 1ZDLA 4Z2TA 4B66A 3CNSA 4IVOB 1F8WA 2WBAA 3P4PA 1KFYA 4H4QA 2RGJA 3GDNA 1S7MA 5TR3A 4II3A 4X9NA 3AE6A 1GREA 3UOVA 3P4QA 4YWOA 3UTHA 3DJGX 1ZMCA 3AECA 2EQ8A 4H4VA 1PJ6A 2BRAA 1E1NA 5EBKA 4X9MA 4KPRA 1CC2A 4RSLA 2ZBWA 2XFPA 3QFBA 5KOXA 1S2QA 4A7AA 3IWAA 1IUVA 3GD3A 2TPRA 1CHUA 1OJCA 4BJZA 3C96A 1TDNA 3UKPA 5FS9A 4H4RA 1IUXA 1LV0A 2FJEA 2O9ZA 1Q1WA 4IV9A 5IQ4A 1XANA 3NYCA 2X99A 1MXTA 2GR1A 3GYIA 3AYLA 1OJAA 3SXIA 2C64A 4ZCDA 2X8HA 3UKFA 3CGCA 3UOYA 1D7LA 2BABA 1CBOA 3KA7A 2YQUA 1TDKA 3HZLA 1GESA 4GR1A 1REOA 3SY4A 1YKJA 3ALJA 1K4QA 3VRDB 2YR5A 2B9WA 1PBEA 3NT6A 3QSSA 1FECA 2V3BA 1L9DA 2B7SA 2WQYA 2WU2A 3P4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4APN A;  3GYJ A;  1ZP0 A;  3NYF A;  3PS9 A;  1D4C A;  4GCM A;  1GT8 A;  2C72 A;  5JCL A;  2BCG G;  5JCK A;  2QA1 A;  1S3B A;  2VVL G;  3FBS A;  3NK1 X;  3SM8 A;  2VVM A;  1BGN A;  1ZOV A;  2BS3 A;  3KPF A;  1IUU A;  2C66 A;  3DK9 A;  2GB0 A;  2YLW A;  3AYJ A;  4Z24 A;  2GEW A;  4OPG A;  3G5S A;  3AEA A;  4TM4 A;  1TDE A;  3NYE A;  4BK2 A;  1TYT A;  1ONF A;  4XXG A;  1V59 A;  2APG A;  4BK3 A;  2IID A;  4RG3 A;  2YLR A;  1XDI A;  1GTE A;  4REK A;  3GRS A;  3LJP A;  1LVL A;  1N1P A;  1JRZ A;  2JKC A;  3AXB A;  3DJD A;  4CCQ A;  1E39 A;  2Q6U A;  3UP5 A;  3GDP A;  5KRQ A;  4E0V A;  1Y56 A;  3CGB A;  4Z25 A;  3K7Q X;  4AT0 A;  1XPQ A;  2HQM A;  4BK1 A;  3D8X A;  2BS4 A;  2FBW A;  2V3A A;  1JRY A;  2R46 A;  1SEZ A;  4FK1 A;  4OCG A;  3WE0 A;  2RAB A;  1ZKQ A;  2F5Z A;  3NTA A;  3D1C A;  1GRG A;  2GAH B;  2WS3 A;  1O5W A;  3DK4 A;  4CY6 A;  4B63 A;  4H2R A;  3VR8 A;  2FJD A;  5GSN A;  2WEU A;  3BNM A;  2YR4 A;  4J2W A;  4U2S A;  4B67 A;  3AWI A;  4EMI A;  1S2Y A;  3DK8 A;  1OJD A;  3ICT A;  3QFA A;  1NEK A;  3K7T A;  1KDG A;  2DKH A;  1ZK7 A;  2BAC A;  2JB3 A;  2A8X A;  2E5V A;  1D4D A;  4H4U A;  3DJE A;  1DOE A;  3NIX A;  1JOA A;  2XCG A;  1MOK A;  2R4J A;  3KKJ A;  3AD9 B;  3LOV A;  1GER A;  1BGJ A;  1EL8 A;  4ECH A;  1FEB A;  1DOD A;  3AE2 A;  2B9Y A;  2Z5Y A;  3FMW A;  2GV8 A;  2YLS A;  3PVC A;  2B7R A;  1O94 A;  4A79 A;  3EAO A;  3RHA A;  1CF3 A;  2CVJ A;  2WDR A;  1Q9I A;  4J33 A;  2VRL A;  4D03 A;  4TLZ A;  1UKV G;  3LXD A;  3NN0 X;  1EL7 A;  1QJD A;  1BF3 A;  2GR2 A;  1H83 A;  1YQ4 A;  3ADA B;  3G5R A;  3IHM A;  1DNC A;  2R4E A;  3K7M X;  1VG9 A;  4A99 A;  2PYX A;  4YSX A;  4ICY A;  3UKL A;  3GWF A;  2R0C A;  1EBD A;  3ISH A;  4O5Q A;  1IJH A;  5BUK A;  5C3J A;  5KVH A;  3NG7 X;  4K22 A;  2ACZ A;  2BXS A;  2QCU A;  2BK5 A;  2XVJ A;  3ICR A;  4OPD A;  5BRT A;  2E4G A;  3S5W A;  1H82 A;  4X4J A;  4Y4M A;  2BCP A;  4U8O A;  5DBJ A;  5BVA A;  4A5L A;  1AOG A;  3K30 A;  2YVG A;  5HHF A;  2EQ7 A;  3CGD A;  4C77 A;  5EB4 A;  3M12 A;  1PHH A;  1NEN A;  3ZYX A;  1GRH A;  2DKI A;  4K5S A;  1QO8 A;  4PAB A;  3P9U A;  1NHQ A;  3LZW A;  1TDF A;  2YLZ A;  3CPJ G;  1NHP A;  1LQT A;  2XVF A;  2ARD A;  2BC1 A;  5IQ1 A;  5FS6 A;  2WP9 A;  4EQR A;  3ZDN A;  4YSZ A;  1DOC A;  5U63 A;  3AYI A;  3AD8 B;  2Q7V A;  4A6N A;  4B64 A;  4C5O A;  3CPH G;  2R45 A;  5CQF A;  4ZN0 A;  2VZ2 A;  1K0J A;  1GSN A;  1NHS A;  3AE9 A;  1Y56 B;  2ZZ0 A;  1GXF A;  2RGH A;  3OC4 A;  3G5Q A;  2WU5 A;  3UKK A;  4AOS A;  5U25 A;  3UKQ A;  2GRT A;  1H7X A;  4U2L A;  5HY5 A;  2VQB A;  4BJY A;  3NH3 X;  1NHR A;  3IC9 A;  1GRT A;  2J3N A;  4GUV A;  2ZZC A;  2GQF A;  4LU6 A;  3P1W A;  4H4W A;  2X8G A;  1NG4 A;  2XFN A;  2YG6 A;  3OZ2 A;  3GRT A;  2GH5 A;  2YWL A;  3CNJ A;  5M10 A;  4H4X A;  1BKW A;  3LB8 A;  2YM2 A;  2EQ6 A;  4EMJ A;  4H4Z A;  3V3O A;  1EL5 A;  1L0V A;  2A87 A;  3AE8 A;  3ABV A;  4H4S A;  1E1K A;  4IA5 A;  1PJ7 A;  2C75 A;  3UTF A;  1S3E A;  1GAL A;  3RED A;  4ZCC A;  3NKS A;  4H4T A;  5J60 A;  4CCR A;  1F8S A;  1LJ1 A;  4YTM A;  3DJJ A;  3JSK A;  4TM3 A;  4GDE A;  4OPI A;  3ALM A;  4Z43 A;  3BI5 A;  1BWC A;  1E1L A;  3AE7 A;  4AT2 A;  4Z26 A;  1JEH A;  1F3P A;  1VDC A;  2R0G A;  3CIR A;  2VVL A;  4YT0 A;  1FOH A;  4H50 A;  4YKG A;  2BC0 A;  2GR3 A;  2YR6 A;  4JY2 A;  2Q0L A;  2BK4 A;  4NTE A;  1EL9 A;  1N4W A;  4U8M A;  2CUL A;  2BS2 A;  4XWZ A;  2GMH A;  1E1M A;  1OJ9 A;  1PXB A;  4Y4N A;  1FCD A;  1RP0 A;  3NHO X;  1NG3 A;  4WX1 A;  4A65 A;  1DOB A;  4NTC A;  4D04 A;  2X50 A;  5KXJ A;  1B8S A;  4C74 A;  1GPE A;  2C3D A;  3CPI G;  4NZH A;  4RG4 A;  4CNK A;  2YAU A;  4B68 A;  4I59 A;  2AR8 A;  2YG3 A;  3F8R A;  2BXR A;  2JB2 A;  4A9W A;  1DJQ A;  2YVJ A;  2V61 A;  3NK0 X;  4H2P A;  3CTY A;  2IVD A;  4N9X A;  4C3Y A;  1GV4 A;  5KVI A;  2V60 A;  2B76 A;  4JNQ A;  3RP7 A;  4WCT A;  3DME A;  2EQ9 A;  3CGE A;  4OPU A;  2WOI A;  1PS9 A;  2BYB A;  2C65 A;  2JBV A;  4J31 A;  3VQR A;  1D7Y A;  3CNP A;  2B9X A;  3AD7 B;  4TM0 A;  3C4A A;  1H86 A;  1ZOY A;  3AE1 A;  1B37 A;  1B5Q A;  5FS7 A;  4U8L A;  3UOZ A;  2Q0K A;  2X8C A;  1HYU A;  5KOW A;  5J7X A;  2GMJ A;  2AAQ A;  4Y4L A;  1KNP A;  2BA9 A;  2FJA A;  4AP1 A;  4H2Q A;  4J57 A;  1CJ4 A;  1FL2 A;  5CKU A;  4AOX A;  3V76 A;  4NEW A;  2C76 A;  2YG4 A;  1YY5 A;  2VOU A;  2WOV A;  4H4P A;  4O5U A;  4EMW A;  3FG2 P;  1GRA A;  1NPX A;  4A6N B;  1ZMD A;  3GD4 A;  2XDO A;  4IA6 A;  3NN6 X;  3NNE A;  3NK2 X;  2OLN A;  3PO7 A;  2FJB A;  3Q9T A;  4K8D A;  4YKF A;  3RP8 A;  4UP3 A;  4EM4 A;  1KSU A;  2YVF A;  4K7Z A;  3AEB A;  5JCM A;  1L9C A;  1VG0 A;  1K0I A;  3S61 A;  4DSG A;  3L8K A;  1PBB A;  5ER0 A;  2XLT A;  3GWD A;  3COX A;  4GF7 A;  1ZX9 A;  3QSM A;  2NVK X;  3QVR A;  2I0Z A;  3DH9 A;  5GRT A;  3KD9 A;  1MO9 A;  2C3C A;  1CL0 A;  1M64 A;  4TLX A;  4U8P A;  1TYP A;  3NTD A;  3NGC X;  1JRX A;  3ITJ A;  1H81 A;  3AEF A;  4OPC A;  4LII A;  4B1B A;  2YLT A;  2YLX A;  3LAD A;  3CN8 A;  3KU9 A;  1PBC A;  3M13 A;  3NLC A;  2WDV A;  3SFE A;  1N4U A;  2JB1 A;  1CC6 A;  1GND A;  3GMB A;  5FS8 A;  3BHF A;  1OJT A;  1RSG A;  4YTP A;  4UDR A;  1E7P A;  3H8L A;  4U8N A;  3AED A;  4DNA A;  2CFY A;  2Z5X A;  1Q1R A;  1GOS A;  3GMC A;  3SGL A;  4K2X A;  2XFQ A;  4B69 A;  4H4Y A;  3F8P A;  4USR A;  1GRF A;  3Q6J A;  4USQ A;  2GQW A;  4BUR A;  4EQW A;  3EPT A;  4H2N A;  1LPF A;  2YM1 A;  3II4 A;  4JQ9 A;  5LV9 A;  3R9U A;  4JNA A;  2RGO A;  2WOW A;  3H4K A;  4KX6 A;  2XVH A;  3GSI A;  4JN9 A;  3ATQ A;  4CBQ A;  4CNJ A;  1CJ2 A;  4UDP A;  5JCI A;  1PJ5 A;  2QA2 A;  3ICS A;  1P2E A;  4J34 A;  3AE3 A;  3L1R A;  2WP6 A;  1IUW A;  4Z2U A;  4EIP A;  1NDA A;  1DJN A;  2X3N A;  2GVC A;  3NRN A;  1XHC A;  3AE5 A;  4YXD A;  4EQS A;  3B3R A;  4NEV A;  1GEU A;  1TRB A;  1ELI A;  5C2T A;  3EAN A;  4YSY A;  4DGK A;  3I6D A;  4H7U A;  1QLB A;  1NAA A;  1Y0P A;  2NPX A;  1H84 A;  1Z6L A;  1JNR A;  2OLO A;  4I58 A;  2XVE A;  3ATR A;  2WP5 A;  4JY3 A;  3V3N A;  4J36 A;  1B4V A;  2R0P A;  3VR9 A;  4U8I A;  4OPL A;  1E6E A;  1VQW A;  2C7G A;  2XLU A;  1IUS A;  3KVE A;  3IHG A;  5EOW A;  1F6M A;  3O0H A;  4MJW A;  4AP3 A;  2W0H A;  2XFO A;  4HB9 A;  5HXI A;  1BZL A;  3BI4 A;  4J56 A;  2OAL A;  3CNT A;  4P9S A;  1M6I A;  2IVE A;  3SFD A;  3B6D A;  2WPF A;  4JDR A;  3I3L A;  1PBF A;  1KF6 A;  3VRA A;  4K5R A;  1CJ3 A;  1ZY8 A;  4DSH A;  3BHK A;  3RNM A;  3VRB A;  3BNU A;  2WDQ A;  1K0L A;  3FPZ A;  2XVI A;  2H88 A;  3EF6 A;  4B65 A;  2C70 A;  4HA6 A;  3UKH A;  4ADW A;  3UP4 A;  2WPE A;  3UCL A;  2Y6R A;  2JAE A;  4FDC B;  1L9E A;  3AB1 A;  3T37 A;  3AEE A;  5U1O A;  2R9Z A;  3DGH A;  4LA1 A;  1KNR A;  3FIM B;  4OVI A;  4GRT A;  2WES A;  4XWR A;  4U8J A;  1YQZ A;  2VQ7 A;  3UTE A;  3URH A;  1N4V A;  2OA1 A;  2PHH A;  2TMD A;  1TDO A;  4NTD A;  1JNZ A;  3SQP A;  4C3X A;  4CRT A;  2VRM A;  2V5Z A;  1RYI A;  1KSS A;  1PXA A;  1PN0 A;  4FX9 A;  2E1M A;  2Y6Q A;  3M0O A;  4YTN A;  4Z2R A;  5HYM A;  4Z44 A;  5M0Z A;  2XLS A;  4IVM B;  2V6O A;  1D4E A;  2AQJ A;  1O95 A;  4OPT A;  1X31 B;  4FK1 C;  3ALL A;  2A89 A;  3QSE A;  1D5T A;  1JU2 A;  1PBD A;  2C67 A;  2YG7 A;  2XFU A;  1VRQ B;  5L46 A;  4U2T A;  4U8K A;  2H89 A;  1LTX R;  1PXC A;  4CY8 A;  2GR0 A;  4EM3 A;  4EQX A;  1GTH A;  1GET A;  3UOX A;  3IF9 A;  4PAA A;  4EIQ A;  5BUL A;  2YG5 A;  4YSH A;  3AEG A;  3CND A;  4UDQ A;  4BV6 A;  3H8I A;  2ZZB A;  1IUT A;  2XLR A;  1F8R A;  1P2H A;  1COY A;  3QVP A;  1GRB A;  2GF3 A;  5FMH A;  1YQ3 A;  1FEA A;  3AE4 A;  5EB5 A;  1DXL A;  3UKA A;  3LZX A;  1CJC A;  2OAM A;  2JK6 A;  3DGZ A;  3DA1 A;  5IPY A;  3KLJ A;  2WHD A;  1CC4 A;  3P4S A;  3QJ4 A;  1LQU A;  2QAE A;  4GDP A;  1PDH A;  4TM1 A;  3F8D A;  5JCN A;  2C73 A;  1H6V A;  4M52 A;  1W4X A;  2GAG B;  2CDU A;  2UZZ A;  3UTG A;  2WPC A;  3BI2 A;  3C4N A;  1H7W A;  2BK3 A;  2WET A;  2XLP A;  3RP6 A;  5KWF A;  3E1T A;  2XYO A;  1ZDL A;  4Z2T A;  4B66 A;  3CNS A;  4IVO B;  1F8W A;  2WBA A;  3P4P A;  1KFY A;  4H4Q A;  2RGJ A;  3GDN A;  5TR3 A;  4X9N A;  3AE6 A;  1GRE A;  3UOV A;  3P4Q A;  4YWO A;  3UTH A;  3DJG X;  1ZMC A;  3AEC A;  2EQ8 A;  4H4V A;  1PJ6 A;  1E1N A;  5EBK A;  4X9M A;  4KPR A;  1CC2 A;  4RSL A;  2ZBW A;  2XFP A;  3QFB A;  5KOX A;  1S2Q A;  4A7A A;  3IWA A;  1IUV A;  3GD3 A;  2TPR A;  1CHU A;  1OJC A;  4BJZ A;  3C96 A;  1TDN A;  3UKP A;  5FS9 A;  4H4R A;  1IUX A;  1LV0 A;  2FJE A;  2O9Z A;  1Q1W A;  4IV9 A;  5IQ4 A;  1XAN A;  3NYC A;  2X99 A;  1MXT A;  2GR1 A;  3GYI A;  3AYL A;  1OJA A;  2C64 A;  4ZCD A;  2X8H A;  3UKF A;  3CGC A;  3UOY A;  1D7L A;  2BAB A;  1CBO A;  3KA7 A;  2YQU A;  1TDK A;  3HZL A;  1GES A;  4GR1 A;  1REO A;  1YKJ A;  3ALJ A;  1K4Q A;  3VRD B;  2YR5 A;  2B9W A;  1PBE A;  3NT6 A;  3QSS A;  1FEC A;  2V3B A;  1L9D A;  2B7S A;  2WQY A;  2WU2 A;  3P4R A; 
#chains in the Genus database with same CATH topology
 3GYJ A;  1ZP0 A;  3STP A;  1D4C A;  3NK1 X;  3P4P A;  3SM8 A;  5HYM A;  2PGW A;  1BGN A;  2BS3 A;  3KPF A;  2GB0 A;  2OZT A;  1JCT A;  3RCY A;  2GEW A;  5KMQ A;  2PP1 A;  1TYT A;  4XXG A;  2APG A;  2OLA A;  1PDY A;  4REK A;  3DJD A;  3FXG A;  5FJT A;  1KCZ A;  3H7V A;  3UP5 A;  3GDP A;  5KRQ A;  3OZY A;  3CGB A;  1XPQ A;  4G8T A;  2FBW A;  1JRY A;  3IJL A;  1SEZ A;  3WE0 A;  3NTA A;  1GRG A;  1O5W A;  4CY6 A;  1X2G A;  4B63 A;  3VR8 A;  5GSN A;  3DIP A;  4U2S A;  3DFH A;  3DK8 A;  1OJD A;  1NEK A;  1TKK A;  1KDG A;  2E5V A;  1JOA A;  2XCG A;  2R4J A;  3KKJ A;  5KMP A;  3T0K A;  1EL8 A;  1FEB A;  3HYX A;  1FFV C;  2GV8 A;  3EAO A;  4FI4 A;  2WDR A;  1UKV G;  3NN0 X;  1BF3 A;  3IHM A;  3T9P A;  2PYX A;  4ICY A;  1JRP A;  3UKL A;  2R0C A;  4O5Q A;  3NG7 X;  1EBH A;  3ICR A;  3S5W A;  1WUF A;  5BVA A;  3V4B A;  3M12 A;  2POD A;  1GRH A;  4M0X A;  1QO8 A;  3OTR A;  1KN0 A;  3P9U A;  1NHQ A;  3OPS A;  1TDF A;  2ARD A;  5IQ1 A;  1DOC A;  1GSN A;  1NHS A;  1GXF A;  5KMR A;  2WU5 A;  1H7X A;  2VQB A;  4BJY A;  3UGV A;  1NHR A;  2ZZC A;  3FVD A;  4ZCW A;  4E8G A;  3GRT A;  2GH5 A;  3CNJ A;  3SZW A;  4H4X A;  2OVL A;  5G5G B;  1E1K A;  4IA5 A;  2P8B A;  3RED A;  3NKS A;  3ALM A;  2E3T A;  1JEH A;  4Z26 A;  3HYW A;  2YR6 A;  2ONE A;  2Q0L A;  3AMZ A;  1N61 C;  4XWZ A;  2GMH A;  1E1M A;  2QGY A;  1PXB A;  3A7R A;  4DXK A;  4WX1 A;  4A65 A;  4NTC A;  3SZ0 A;  4D04 A;  2C3D A;  3EKG A;  5J04 A;  2MUC A;  4B68 A;  3R11 A;  2YG3 A;  4A9W A;  2YVJ A;  3NK0 X;  4C3Y A;  4JNQ A;  3DME A;  2WOI A;  1EC9 A;  3VQR A;  1D7Y A;  3CNP A;  2B9X A;  3AD7 B;  1ZOY A;  3QKE A;  3AE1 A;  1B37 A;  1B5Q A;  1E9I A;  3RIT A;  2Q0K A;  3CXB A;  4GFI A;  5J7X A;  4H2Q A;  3P3B A;  2WOV A;  4EMW A;  2W55 A;  2GL5 A;  2XDO A;  4IA6 A;  4YWS A;  5BOE A;  3DGB A;  3TQP A;  2FJB A;  4YKF A;  3H12 A;  1KSU A;  3AEB A;  1K0I A;  3L8K A;  4GF7 A;  1ZX9 A;  3OZM A;  3QSM A;  3QVR A;  3DH9 A;  1M64 A;  1TYP A;  3NTD A;  1JRX A;  2YLT A;  3KU9 A;  3VDG A;  1N4U A;  2JB1 A;  2AL1 A;  1CC6 A;  3ZVH B;  5FS8 A;  1RSG A;  4YTP A;  4UDR A;  1JPM A;  3AED A;  2CFY A;  5G5H B;  4H4Y A;  4USR A;  3Q6J A;  4USQ A;  2C4C A;  4H2N A;  5LV9 A;  3R9U A;  2RGO A;  3UCD A;  3GSI A;  2XH0 A;  3ATQ A;  4CNJ A;  1CJ2 A;  4UDP A;  5JCI A;  3UJS A;  1DJN A;  3SR6 B;  3NRN A;  3K1G A;  3AE5 A;  4YXD A;  2O56 A;  4EQS A;  4KEM A;  1ELI A;  5FJP A;  4DGK A;  4H7U A;  4I58 A;  1NAA A;  1Y0P A;  2WP5 A;  2XLU A;  5EOW A;  2PS2 A;  3O0H A;  4MJW A;  4AP3 A;  2W0H A;  2W3R A;  4HB9 A;  3CNT A;  4P9S A;  1M6I A;  3SFD A;  4JDR A;  1XS2 A;  3I3L A;  1CJ3 A;  3BHK A;  2WDQ A;  3EF6 A;  4ENL A;  3UCL A;  2JAE A;  3SBF A;  4EWJ A;  3T2Z A;  3DGH A;  4OVI A;  3VA8 A;  1KNR A;  4XWR A;  2GGH A;  1TDO A;  1STZ A;  3S5S A;  4JHM A;  1R0M A;  2VRM A;  2V5Z A;  4FX9 A;  3Q4D A;  2Y6Q A;  3SYI A;  4YTN A;  1JRO A;  5M0Z A;  2AQJ A;  4HCL A;  3ALL A;  1ELS A;  1VRQ B;  5L46 A;  2H89 A;  4CY8 A;  2GR0 A;  5BUL A;  2YG5 A;  1YEY A;  4UDQ A;  3D9X A;  2ZZB A;  1IUT A;  2GF3 A;  3TOY A;  1DXL A;  1TZZ A;  3LZX A;  5IPY A;  3QJ4 A;  4G73 A;  3N6H A;  2C73 A;  3NO1 A;  2CDU A;  2WPC A;  4H1Z A;  5KWF A;  2WET A;  4Z2T A;  2WBA A;  2AL2 A;  1P43 A;  3FV9 A;  1ZMC A;  3R1Z A;  1CC2 A;  2DW6 A;  2PU0 A;  3IWA A;  1CHU A;  3RO6 A;  4H4R A;  3KUM A;  2FJE A;  2O9Z A;  1XAN A;  3NYC A;  4GIS A;  3AYL A;  2X8H A;  2OKT A;  1D7L A;  3KA7 A;  2YQU A;  1GES A;  3FCP A;  4X2P A;  3R0U A;  3NYF A;  2C72 A;  2BCG G;  2QA1 A;  2VVM A;  1NU5 A;  2C66 A;  3DK9 A;  1SJB A;  4OPG A;  3AEA A;  1TDE A;  1V59 A;  4E6M A;  4MKS A;  1N1P A;  3I4K A;  4CCQ A;  2I5Q A;  3AXB A;  2PP0 A;  1Y56 A;  4AT0 A;  4GYP A;  4FK1 A;  1X2H A;  3JW7 A;  2GAH B;  1SJD A;  2FJD A;  2WEU A;  4B67 A;  2YR4 A;  3QFA A;  2OG9 A;  3K7T A;  2DKH A;  4H4U A;  1DOE A;  3NIX A;  1MOK A;  3RGT A;  3LOV A;  1MUC A;  4IT1 A;  1DOD A;  3AE2 A;  2QJJ A;  3FMW A;  1O94 A;  4IZG A;  3RHA A;  3I6T A;  2CVJ A;  4D03 A;  3LXD A;  1YQ4 A;  1DNC A;  2R4E A;  3GWF A;  3ISH A;  2DW7 A;  2XVJ A;  2E4G A;  4X4J A;  4Y4M A;  2BCP A;  3K30 A;  2YVG A;  3A7U A;  2EQ7 A;  5EB4 A;  4E4F A;  3U4F A;  3CPJ G;  2XVF A;  2QJN A;  2WP9 A;  5U63 A;  4K1W A;  3AYI A;  3UJR A;  4A6N A;  4B64 A;  1OEP A;  3MZN A;  3AE9 A;  2RGH A;  3NRZ B;  5U25 A;  2ZAD A;  2GRT A;  4U2L A;  3IC9 A;  1GRT A;  3DG7 A;  4H4W A;  2XFN A;  2YWL A;  2YM2 A;  3LB8 A;  4EMJ A;  4H4Z A;  1EL5 A;  2A87 A;  3AE8 A;  3ABV A;  3MWC A;  3D46 A;  3DFY A;  1LJ1 A;  4YTM A;  4GDE A;  3BI5 A;  3HYV A;  4AT2 A;  3H8A A;  3BSM A;  4H83 A;  2VVL A;  2BC0 A;  3NFU A;  5FJR A;  4KT2 A;  1FCD A;  1NG3 A;  1DOB A;  2X50 A;  4C74 A;  3CPI G;  3R10 A;  4RG4 A;  4NZH A;  2YAU A;  2AR8 A;  2BXR A;  1DJQ A;  2HNE A;  5KVI A;  2V60 A;  2B76 A;  4A6G A;  4WCT A;  3DG6 A;  2BYB A;  2C65 A;  2FYM A;  3B9J B;  3UOZ A;  2X8C A;  3VC6 A;  2GMJ A;  4Y4L A;  1KNP A;  2BA9 A;  2PTY A;  4AP1 A;  4J57 A;  3DG3 A;  4NEW A;  1YY5 A;  2HXU A;  4H4P A;  1ZMD A;  2GDQ A;  3NK2 X;  1FIQ B;  4K8D A;  4IHC A;  4A3R A;  5JCM A;  1L9C A;  2PSN A;  5ER0 A;  3NVV B;  1MO9 A;  2C3C A;  1CL0 A;  4TLX A;  3AEF A;  4OPC A;  4FP1 A;  3LAD A;  3A7A A;  1PBC A;  3NLC A;  2WDV A;  3H70 A;  1GND A;  4A35 A;  1SB3 B;  3THU A;  1IYX A;  3MSY A;  3RR1 A;  3H8L A;  4U8N A;  1GOS A;  3GMC A;  4K2X A;  2XFQ A;  4B69 A;  1MDL A;  2W3S A;  1GRF A;  4GAV A;  4BUR A;  3EPT A;  1LPF A;  3AM9 A;  3CXO A;  3H4K A;  2QJM A;  1VQZ A;  2W54 A;  2QA2 A;  2OFJ A;  4HPN A;  4EIP A;  3R25 A;  2X3N A;  2GVC A;  1TRB A;  4KPL A;  3PK7 A;  3EAN A;  4YSY A;  3JZU A;  3CMM A;  1QLB A;  3GC2 A;  3P93 A;  4JY3 A;  4J36 A;  2R0P A;  4OPL A;  1E6E A;  1VQW A;  2C7G A;  1ECQ A;  3KVE A;  1MDR A;  3IK4 A;  4IL2 A;  3IJI A;  2WPF A;  4H19 A;  1KF6 A;  3VRA A;  4DSH A;  3RNM A;  1K0L A;  2XVI A;  2Y6R A;  1L9E A;  5U1O A;  3UJ2 A;  2R9Z A;  3CYJ A;  4LA1 A;  4GRT A;  2WES A;  3VCN A;  4U8J A;  3UTE A;  1N4V A;  2OA1 A;  1RYI A;  2E1M A;  4Z44 A;  3CB3 A;  2XLS A;  4GYP C;  2V6O A;  1X31 B;  4FK1 C;  1JU2 A;  3D47 A;  2PU1 A;  1KKR A;  1PXC A;  4KWS A;  4EQX A;  3IF9 A;  4PAA A;  4ZA0 A;  2AKM A;  4BV6 A;  3QVP A;  1F8R A;  1P2H A;  1GRB A;  5FMH A;  4GME A;  1CJC A;  2JK6 A;  3DA1 A;  1FHV A;  2QAE A;  3N4F A;  5JCN A;  4M52 A;  1W4X A;  2GAG B;  3S47 A;  3UTG A;  2XLP A;  1S7M A;  2EQ8 A;  1E1N A;  2XFP A;  3QFB A;  5KOX A;  1OJC A;  3UKP A;  5IQ4 A;  1MXT A;  1OJA A;  3SXI A;  2GGG A;  1CBO A;  1YKJ A;  3ALJ A;  3VRD B;  3PWI A;  1FEC A;  2V3B A;  2B7S A;  2WU2 A;  1N63 C;  4APN A;  3GY1 A;  3TW9 A;  5JCL A;  5JCK A;  1S3B A;  3FBS A;  1JDF A;  3MQT A;  3AYJ A;  4Z24 A;  3G5S A;  3CAW A;  3NYE A;  1FHU A;  4BK3 A;  3R07 C;  2IID A;  4RG3 A;  3SN1 A;  2YLR A;  2NQL A;  3SZC A;  4IL0 A;  4F4R A;  2JKC A;  2OPJ A;  3GYX A;  4E0V A;  2GGE A;  2HQM A;  3D8X A;  2V3A A;  2GSH A;  2F5Z A;  3RRA A;  2XH4 A;  4DN1 A;  2WS3 A;  3I6E A;  3DEQ A;  3DK4 A;  4H2R A;  4HCH A;  3ENL A;  3BNM A;  3AWI A;  2PGE A;  4EMI A;  1N60 C;  3ICT A;  3FYY A;  2JB3 A;  2A8X A;  1D4D A;  3DJE A;  3AD9 B;  1BGJ A;  2HXT A;  2YLS A;  2B7R A;  1ZXI C;  1CF3 A;  1Q9I A;  2E5A A;  2VRL A;  4TLZ A;  1EL7 A;  2GR2 A;  4CNK A;  3K7M X;  3V5F A;  1IJH A;  5BUK A;  4K22 A;  2ACZ A;  2BXS A;  2QCU A;  2BK5 A;  3SQS A;  4OPD A;  1TE6 A;  5BRT A;  1H82 A;  3UJF A;  4U8O A;  5DBJ A;  4A5L A;  1AOG A;  4C77 A;  2OX4 A;  1PHH A;  2OQY A;  1NEN A;  2DKI A;  4K5S A;  1RM6 B;  1KD0 A;  1LQT A;  3OP2 A;  3ETR B;  2OZ8 A;  2Q7V A;  1RVK A;  4C5O A;  4ZN0 A;  3QTP A;  2ZZ0 A;  3OC4 A;  3UKK A;  3UKQ A;  5HY5 A;  2GGJ A;  2OO6 A;  2GQF A;  4LU6 A;  3KPK A;  3P1W A;  2X8G A;  2YG6 A;  3OZ2 A;  7ENL A;  3NZG A;  2EQ6 A;  4H4S A;  1PJ7 A;  3UTF A;  1S3E A;  1GAL A;  4ZCC A;  4H4T A;  4CCR A;  1F8S A;  3JSK A;  4TM3 A;  4OPI A;  1BWC A;  3SSZ A;  3AE7 A;  1VDC A;  2R0G A;  1MRA A;  4YT0 A;  4YKG A;  2GR3 A;  5KNL A;  4U8M A;  2BS2 A;  1OJ9 A;  4Y4N A;  3NHO X;  1FFU C;  1KKO A;  3F8R A;  2XH7 A;  3V5C A;  4H2P A;  2XGZ A;  3L5O A;  2IVD A;  4N9X A;  3ZVI A;  2HZG A;  3RP7 A;  2EQ9 A;  4OPU A;  1PS9 A;  4TM0 A;  3MY9 A;  1H86 A;  5FS7 A;  1SJC A;  4U8L A;  5KOW A;  1EC7 A;  2AAQ A;  2RDX A;  2FJA A;  1FL2 A;  4AOX A;  3V76 A;  2YG4 A;  1WYG A;  2C76 A;  2VOU A;  4GGB A;  1NPX A;  2AKZ A;  3NN6 X;  3NNE A;  3R0K A;  3UJE A;  3NVY B;  3Q9T A;  3RP8 A;  2YVF A;  4K2S A;  4DSG A;  1PBB A;  3COX A;  2NVK X;  2QDD A;  2I0Z A;  1NEL A;  3KD9 A;  4U8P A;  2BRY A;  2MNR A;  3ITJ A;  4B1B A;  2YLX A;  2OZ3 A;  3M13 A;  3GMB A;  4J3Z A;  3BHF A;  1E7P A;  1P48 A;  4DNA A;  4DYE A;  1Q1R A;  3SGL A;  2PTZ A;  3F8P A;  3ES7 A;  2GQW A;  4EQW A;  3II4 A;  4JQ9 A;  4JNA A;  4HCD A;  4KX6 A;  2XVH A;  4CBQ A;  1PJ5 A;  3QLD A;  4J34 A;  3AE3 A;  3L1R A;  1R6W A;  3IJQ A;  3VC5 A;  4IP5 A;  1NDA A;  2POZ A;  3N6J A;  3T31 A;  3B3R A;  4HN8 A;  5C2T A;  3I6D A;  1Z6L A;  1H84 A;  1JNR A;  2OLO A;  5FJU A;  3ATR A;  3V3N A;  2XSX A;  4U8I A;  1IUS A;  1V97 A;  5HXI A;  1BZL A;  4J56 A;  3BJS A;  3TCS A;  3B6D A;  1PBF A;  4GGH A;  4JN7 A;  2P0I A;  3FPZ A;  2H88 A;  4B65 A;  3UCC A;  3UKH A;  4ADW A;  3UP4 A;  2P3Z A;  3AEE A;  4Z1Y A;  3FIM B;  2VQ7 A;  3URH A;  3SQP A;  4C3X A;  4CRT A;  3M0O A;  1PXA A;  1PN0 A;  3VFC A;  3QN3 A;  4IVM B;  3QSE A;  2C67 A;  2YG7 A;  2XFU A;  4U2T A;  4U8K A;  1LTX R;  2QDE A;  1GTH A;  1GET A;  3UOX A;  4YSH A;  4G7F A;  4HNL A;  3SN0 A;  4DHG A;  3CND A;  1EBG A;  1YQ3 A;  1FEA A;  3AE4 A;  5EB5 A;  3UKA A;  2OAM A;  3KLJ A;  2WHD A;  3P4S A;  1LQU A;  3JVA A;  1PDH A;  3F8D A;  3QPE A;  1H6V A;  1BKH A;  3NS1 B;  2UZZ A;  3OW1 A;  4IP4 A;  2BK3 A;  1JPD X;  2XYO A;  3CNS A;  4IVO B;  1F8W A;  3T6C A;  1KFY A;  2RGJ A;  5TR3 A;  4II3 A;  4X9N A;  3AE6 A;  1GRE A;  3DJG X;  2QQ6 A;  1PJ6 A;  2BRA A;  3GD6 A;  4A7A A;  3GD3 A;  5BOF A;  3C96 A;  1VDV A;  3GYI A;  1L8P A;  3UKF A;  2BAB A;  4GR1 A;  3SY4 A;  2GGI A;  3T4W A;  2B9W A;  1PBE A;  1L9D A;  2WQY A;  3P4R A;  3PS9 A;  3UOY A;  5CKU A;  4GCM A;  1GT8 A;  2VVL G;  1ZOV A;  1ONE A;  1IUU A;  2YLW A;  4TM4 A;  4BK2 A;  3ZLG A;  1ONF A;  1DTN A;  1W6T A;  1PDZ A;  4NNJ A;  1XDI A;  1GTE A;  3ZLF A;  2QVH A;  3GRS A;  3LJP A;  1LVL A;  1JRZ A;  1E39 A;  3VCC A;  2Q6U A;  4Z25 A;  1EC8 A;  4G6H A;  3K7Q X;  3UXL A;  4BK1 A;  2BS4 A;  4OCG A;  2R46 A;  2RAB A;  1ZKQ A;  2AL2 B;  3D1C A;  1SJA A;  4J2W A;  3MUC A;  1BQG A;  1S2Y A;  1ZK7 A;  2BAC A;  4H2H A;  4GIR A;  1GER A;  4ECH A;  2B9Y A;  2Z5Y A;  4A79 A;  3PVC A;  4J33 A;  1QJD A;  1H83 A;  3ADA B;  3G5R A;  4YSX A;  1VG9 A;  4A99 A;  1EBD A;  5C3J A;  3ZLH A;  5KVH A;  3TTE A;  5HHF A;  3CGD A;  3UXK A;  3ZYX A;  4PAB A;  3LZW A;  2PCE A;  2YLZ A;  1NHP A;  2BC1 A;  5FS6 A;  4EQR A;  3ZDN A;  4YSZ A;  3AD8 B;  1H2I A;  3CPH G;  2R45 A;  5CQF A;  3Q45 A;  2VZ2 A;  1K0J A;  1Y56 B;  3T14 A;  3G5Q A;  4AOS A;  3SN4 A;  3NH3 X;  2J3N A;  4GUV A;  2PMQ A;  3DER A;  1NG4 A;  4DX3 A;  5M10 A;  1BKW A;  3V3O A;  1L0V A;  2C75 A;  5ENL A;  5J60 A;  3DJJ A;  4Z43 A;  1E1L A;  1F3P A;  3CIR A;  3HW2 A;  1FOH A;  4H50 A;  4JY2 A;  2BK4 A;  4NTE A;  1EL9 A;  1N4W A;  2CUL A;  3PG6 A;  1RP0 A;  5KXJ A;  1B8S A;  1GPE A;  4DWD A;  1N5X A;  1T3Q C;  4I59 A;  2JB2 A;  2V61 A;  3NXL A;  3CTY A;  1GV4 A;  3TWB A;  4HYR A;  3CGE A;  2JBV A;  4J31 A;  3C4A A;  4II2 A;  1HYU A;  3GO2 A;  1CJ4 A;  1WUE A;  4O5U A;  3FG2 P;  1GRA A;  4A6N B;  4ZOH B;  2PP3 A;  3GD4 A;  6ENL A;  2OLN A;  3PO7 A;  3EUB 3;  4Z17 A;  4UP3 A;  1MNS A;  4EM4 A;  4K7Z A;  3TJI A;  3S61 A;  1VG0 A;  3FJ4 A;  4J1O A;  2XLT A;  3GWD A;  3ES8 A;  5GRT A;  5KMS A;  3NGC X;  4NWZ A;  4HNC A;  1H81 A;  3CT2 A;  4LII A;  3CN8 A;  3DES A;  3SFE A;  3AN1 A;  1OJT A;  2PTW A;  2PPG A;  2Z5X A;  1F9C A;  2YM1 A;  4E4U A;  3N4E A;  5FJO A;  2WOW A;  4JN9 A;  3B97 A;  4GAP A;  3ICS A;  1P2E A;  2WP6 A;  1IUW A;  4Z2U A;  1XHC A;  4TVY A;  2P8C A;  4NEV A;  1GEU A;  3T2Y A;  1N62 C;  2P88 A;  3ZVH A;  2NPX A;  2XVE A;  1FO4 A;  1B4V A;  3VR9 A;  3T8Q A;  3IHG A;  1F6M A;  5IDZ A;  2XFO A;  3BOX A;  3BI4 A;  2OAL A;  2IVE A;  4K5R A;  1ZY8 A;  3VRB A;  3BNU A;  2C70 A;  4HA6 A;  2PA6 A;  2WPE A;  4FDC B;  3AB1 A;  3T37 A;  2FKP A;  3CK5 A;  3NVZ B;  4G9K A;  1YQZ A;  2PHH A;  2TMD A;  4NTD A;  1JNZ A;  3PFR A;  1KSS A;  1XPY A;  4Z2R A;  3U9I A;  4G6G A;  1D4E A;  4MMW A;  1O95 A;  4OPT A;  2A89 A;  3SX6 A;  1D5T A;  1PBD A;  3SZF A;  4G74 A;  3PWG A;  4EM3 A;  4EIQ A;  3AEG A;  3MKC A;  5EU9 A;  3T2K A;  4MGG A;  3H8I A;  2XLR A;  2XH2 A;  1COY A;  3DDM A;  3NVW B;  3V3W A;  3DGZ A;  3TWA A;  5JRB A;  1CC4 A;  3HPF A;  4GDP A;  3HRD C;  3EEZ A;  3BI2 A;  3SJN A;  3C4N A;  1H7W A;  3RP6 A;  3E1T A;  1ZDL A;  4B66 A;  4H4Q A;  3GDN A;  4JN8 A;  3UOV A;  3P4Q A;  4YWO A;  3UTH A;  3AEC A;  4H4V A;  2ZC8 A;  5EBK A;  4X9M A;  4KPR A;  4RSL A;  2ZBW A;  1N5W C;  1S2Q A;  1IUV A;  3TJ4 A;  2TPR A;  4E5T A;  4BJZ A;  1TDN A;  5FS9 A;  1IUX A;  1LV0 A;  4IV9 A;  1Q1W A;  4TVW A;  4ROP A;  2X99 A;  2GR1 A;  4M6U A;  2C64 A;  4ZCD A;  3CGC A;  4K8G A;  1TDK A;  3HZL A;  1REO A;  3P0W A;  1K4Q A;  2YR5 A;  3NT6 A;  2CHR A;  2OQH A;  3QSS A;  2PTX A;  4TM1 A; 
#chains in the Genus database with same CATH homology
 4APN A;  3GYJ A;  1ZP0 A;  3NYF A;  3PS9 A;  1D4C A;  4GCM A;  1GT8 A;  2C72 A;  5JCL A;  2BCG G;  5JCK A;  2QA1 A;  1S3B A;  2VVL G;  3FBS A;  3NK1 X;  3SM8 A;  2VVM A;  1BGN A;  1ZOV A;  2BS3 A;  3KPF A;  1IUU A;  2C66 A;  3DK9 A;  2GB0 A;  2YLW A;  3AYJ A;  4Z24 A;  2GEW A;  4OPG A;  3G5S A;  3AEA A;  5KMQ A;  4TM4 A;  1TDE A;  3NYE A;  4BK2 A;  1TYT A;  1ONF A;  4XXG A;  1V59 A;  2APG A;  4BK3 A;  2IID A;  4NNJ A;  4RG3 A;  2YLR A;  1XDI A;  1GTE A;  4REK A;  3GRS A;  3LJP A;  1LVL A;  1N1P A;  3SZC A;  1JRZ A;  2JKC A;  3AXB A;  3DJD A;  4CCQ A;  1E39 A;  2Q6U A;  3GYX A;  3UP5 A;  3GDP A;  5KRQ A;  4E0V A;  1Y56 A;  3CGB A;  4Z25 A;  4G6H A;  3K7Q X;  4AT0 A;  1XPQ A;  2HQM A;  4BK1 A;  3D8X A;  2BS4 A;  2V3A A;  2FBW A;  1JRY A;  2R46 A;  1SEZ A;  4FK1 A;  4OCG A;  3WE0 A;  2RAB A;  1ZKQ A;  2F5Z A;  3NTA A;  3D1C A;  1GRG A;  2GAH B;  2WS3 A;  1O5W A;  3DK4 A;  4CY6 A;  4B63 A;  4H2R A;  3VR8 A;  2FJD A;  5GSN A;  2WEU A;  3BNM A;  2YR4 A;  4J2W A;  4U2S A;  4B67 A;  3AWI A;  4EMI A;  1S2Y A;  3DK8 A;  1OJD A;  3ICT A;  3QFA A;  1NEK A;  3K7T A;  1KDG A;  2DKH A;  1ZK7 A;  2BAC A;  2JB3 A;  2A8X A;  2E5V A;  1D4D A;  4H4U A;  3DJE A;  1DOE A;  3NIX A;  1JOA A;  2XCG A;  1MOK A;  2R4J A;  3KKJ A;  3AD9 B;  5KMP A;  3LOV A;  1GER A;  1BGJ A;  3T0K A;  1EL8 A;  4ECH A;  1FEB A;  1DOD A;  3AE2 A;  2B9Y A;  3HYX A;  2Z5Y A;  3FMW A;  2GV8 A;  2YLS A;  3PVC A;  2B7R A;  1O94 A;  4A79 A;  3EAO A;  3RHA A;  1CF3 A;  2CVJ A;  2WDR A;  1Q9I A;  4J33 A;  2VRL A;  4D03 A;  4TLZ A;  1UKV G;  3LXD A;  3NN0 X;  1EL7 A;  1QJD A;  1BF3 A;  2GR2 A;  1H83 A;  1YQ4 A;  3ADA B;  3G5R A;  3IHM A;  1DNC A;  2R4E A;  3K7M X;  1VG9 A;  4A99 A;  2PYX A;  4YSX A;  4ICY A;  3UKL A;  3GWF A;  2R0C A;  1EBD A;  3ISH A;  4O5Q A;  1IJH A;  5BUK A;  5C3J A;  5KVH A;  3NG7 X;  4K22 A;  2ACZ A;  2BXS A;  2QCU A;  2BK5 A;  2XVJ A;  3ICR A;  4OPD A;  5BRT A;  2E4G A;  3S5W A;  1H82 A;  4X4J A;  4Y4M A;  2BCP A;  4U8O A;  5DBJ A;  5BVA A;  4A5L A;  1AOG A;  3K30 A;  2YVG A;  5HHF A;  2EQ7 A;  3CGD A;  4C77 A;  5EB4 A;  3M12 A;  1PHH A;  1NEN A;  3ZYX A;  1GRH A;  2DKI A;  4K5S A;  1QO8 A;  4PAB A;  1KN0 A;  3P9U A;  1NHQ A;  3LZW A;  1TDF A;  2YLZ A;  3CPJ G;  1NHP A;  1LQT A;  2XVF A;  2ARD A;  2BC1 A;  5IQ1 A;  5FS6 A;  2WP9 A;  4EQR A;  3ZDN A;  4YSZ A;  1DOC A;  5U63 A;  3AYI A;  3AD8 B;  2Q7V A;  4A6N A;  1H2I A;  4B64 A;  4C5O A;  3CPH G;  2R45 A;  5CQF A;  4ZN0 A;  2VZ2 A;  1K0J A;  1GSN A;  1NHS A;  3AE9 A;  1Y56 B;  2ZZ0 A;  1GXF A;  2RGH A;  3OC4 A;  3G5Q A;  2WU5 A;  3T14 A;  3UKK A;  5U25 A;  3UKQ A;  4AOS A;  5KMR A;  2GRT A;  1H7X A;  4U2L A;  5HY5 A;  2VQB A;  4BJY A;  3NH3 X;  1NHR A;  3IC9 A;  1GRT A;  2J3N A;  4GUV A;  2ZZC A;  2GQF A;  4LU6 A;  3KPK A;  3P1W A;  4H4W A;  2X8G A;  1NG4 A;  2XFN A;  2YG6 A;  3OZ2 A;  3GRT A;  2GH5 A;  2YWL A;  3CNJ A;  3SZW A;  5M10 A;  4H4X A;  1BKW A;  3LB8 A;  2YM2 A;  2EQ6 A;  4EMJ A;  4H4Z A;  3V3O A;  1EL5 A;  1L0V A;  2A87 A;  3AE8 A;  3ABV A;  4H4S A;  1E1K A;  4IA5 A;  1PJ7 A;  2C75 A;  3UTF A;  1S3E A;  1GAL A;  3RED A;  4ZCC A;  3NKS A;  4H4T A;  5J60 A;  4CCR A;  1F8S A;  1LJ1 A;  4YTM A;  3DJJ A;  3JSK A;  4TM3 A;  4GDE A;  4OPI A;  3ALM A;  4Z43 A;  3BI5 A;  1BWC A;  3HYV A;  1E1L A;  3AE7 A;  4AT2 A;  4Z26 A;  1JEH A;  1F3P A;  1VDC A;  2R0G A;  3CIR A;  2VVL A;  4YT0 A;  1FOH A;  4H50 A;  4YKG A;  2BC0 A;  2GR3 A;  2YR6 A;  3HYW A;  4JY2 A;  2Q0L A;  5KNL A;  2BK4 A;  4NTE A;  1EL9 A;  1N4W A;  4U8M A;  2CUL A;  2BS2 A;  4XWZ A;  2GMH A;  1E1M A;  3PG6 A;  1OJ9 A;  1PXB A;  4Y4N A;  1FCD A;  1RP0 A;  3NHO X;  1NG3 A;  4WX1 A;  4A65 A;  1DOB A;  4NTC A;  3SZ0 A;  2X50 A;  4D04 A;  5KXJ A;  1B8S A;  4C74 A;  1GPE A;  2C3D A;  3CPI G;  4NZH A;  4RG4 A;  4CNK A;  2YAU A;  4B68 A;  4I59 A;  2AR8 A;  2YG3 A;  3F8R A;  2BXR A;  2JB2 A;  4A9W A;  1DJQ A;  2YVJ A;  2V61 A;  3NK0 X;  4H2P A;  3L5O A;  3CTY A;  2IVD A;  4N9X A;  4C3Y A;  1GV4 A;  5KVI A;  2V60 A;  2B76 A;  4JNQ A;  3RP7 A;  4WCT A;  3DME A;  2EQ9 A;  3CGE A;  4OPU A;  2WOI A;  1PS9 A;  2BYB A;  2C65 A;  2JBV A;  4J31 A;  3VQR A;  1D7Y A;  3CNP A;  2B9X A;  3AD7 B;  4TM0 A;  3C4A A;  1H86 A;  1ZOY A;  4II2 A;  3AE1 A;  1B37 A;  1B5Q A;  5FS7 A;  4U8L A;  3UOZ A;  2Q0K A;  2X8C A;  1HYU A;  5KOW A;  5J7X A;  2GMJ A;  2AAQ A;  4Y4L A;  1KNP A;  2BA9 A;  2FJA A;  4AP1 A;  4H2Q A;  4J57 A;  1CJ4 A;  1FL2 A;  5CKU A;  4AOX A;  3V76 A;  4NEW A;  2C76 A;  2YG4 A;  1YY5 A;  2VOU A;  2WOV A;  4H4P A;  4O5U A;  4EMW A;  3FG2 P;  1GRA A;  1NPX A;  4A6N B;  1ZMD A;  3GD4 A;  2XDO A;  4IA6 A;  3NN6 X;  3NNE A;  3NK2 X;  2OLN A;  3PO7 A;  2FJB A;  3Q9T A;  4K8D A;  4YKF A;  3RP8 A;  4UP3 A;  4EM4 A;  1KSU A;  2YVF A;  4K7Z A;  3AEB A;  5JCM A;  1L9C A;  1VG0 A;  1K0I A;  3S61 A;  4DSG A;  3L8K A;  1PBB A;  5ER0 A;  2XLT A;  3GWD A;  3COX A;  4GF7 A;  1ZX9 A;  3QSM A;  2NVK X;  3QVR A;  2I0Z A;  3DH9 A;  5GRT A;  3KD9 A;  1MO9 A;  2C3C A;  1CL0 A;  1M64 A;  2BRY A;  4TLX A;  4U8P A;  5KMS A;  1TYP A;  3NTD A;  3NGC X;  1JRX A;  4NWZ A;  3ITJ A;  1H81 A;  3AEF A;  4OPC A;  4LII A;  4B1B A;  2YLT A;  2YLX A;  3LAD A;  3CN8 A;  3KU9 A;  1PBC A;  3M13 A;  3NLC A;  2WDV A;  3SFE A;  1N4U A;  2JB1 A;  1CC6 A;  1GND A;  3GMB A;  5FS8 A;  3BHF A;  1OJT A;  1RSG A;  4YTP A;  4UDR A;  1E7P A;  3H8L A;  4U8N A;  3AED A;  4DNA A;  2CFY A;  2Z5X A;  1Q1R A;  1GOS A;  3GMC A;  3SGL A;  4K2X A;  2XFQ A;  4B69 A;  4H4Y A;  3F8P A;  4USR A;  1GRF A;  3Q6J A;  4GAV A;  4USQ A;  2GQW A;  4BUR A;  2C4C A;  4EQW A;  3EPT A;  4H2N A;  1LPF A;  2YM1 A;  3II4 A;  4JQ9 A;  5LV9 A;  3R9U A;  4JNA A;  2RGO A;  2WOW A;  3H4K A;  4KX6 A;  2XVH A;  3GSI A;  4JN9 A;  3ATQ A;  4CBQ A;  4CNJ A;  1CJ2 A;  4UDP A;  5JCI A;  1PJ5 A;  4GAP A;  2QA2 A;  3ICS A;  1P2E A;  4J34 A;  3AE3 A;  3L1R A;  2WP6 A;  1IUW A;  4Z2U A;  4EIP A;  1NDA A;  1DJN A;  2X3N A;  2GVC A;  3NRN A;  1XHC A;  3AE5 A;  4YXD A;  3T31 A;  4EQS A;  3B3R A;  4NEV A;  1GEU A;  1TRB A;  1ELI A;  3T2Y A;  5C2T A;  3EAN A;  4YSY A;  4DGK A;  3I6D A;  4H7U A;  1QLB A;  1NAA A;  1Y0P A;  2NPX A;  1H84 A;  1Z6L A;  1JNR A;  2OLO A;  3CMM A;  4I58 A;  2XVE A;  3ATR A;  2WP5 A;  4JY3 A;  3V3N A;  4J36 A;  1B4V A;  2R0P A;  3VR9 A;  4U8I A;  4OPL A;  1E6E A;  1VQW A;  2C7G A;  2XLU A;  1IUS A;  3KVE A;  3IHG A;  5EOW A;  1F6M A;  3O0H A;  4MJW A;  4AP3 A;  2W0H A;  2XFO A;  4HB9 A;  5HXI A;  1BZL A;  3BI4 A;  4J56 A;  2OAL A;  3CNT A;  4P9S A;  1M6I A;  2IVE A;  3SFD A;  3B6D A;  2WPF A;  4JDR A;  3I3L A;  1PBF A;  1KF6 A;  3VRA A;  4K5R A;  1CJ3 A;  1ZY8 A;  4DSH A;  3BHK A;  3RNM A;  3VRB A;  3BNU A;  2WDQ A;  1K0L A;  3FPZ A;  2XVI A;  2H88 A;  3EF6 A;  4B65 A;  2C70 A;  4HA6 A;  3UKH A;  4ADW A;  3UP4 A;  2WPE A;  3UCL A;  2Y6R A;  2JAE A;  4FDC B;  1L9E A;  3AB1 A;  3T2Z A;  3AEE A;  5U1O A;  3T37 A;  2R9Z A;  3DGH A;  4LA1 A;  1KNR A;  3FIM B;  4G9K A;  4GRT A;  2WES A;  4OVI A;  4XWR A;  4U8J A;  1YQZ A;  2VQ7 A;  3UTE A;  3URH A;  1N4V A;  2OA1 A;  2PHH A;  2TMD A;  1TDO A;  4NTD A;  1JNZ A;  3SQP A;  4C3X A;  4CRT A;  2VRM A;  2V5Z A;  1RYI A;  1KSS A;  1PXA A;  1PN0 A;  4FX9 A;  2E1M A;  2Y6Q A;  3M0O A;  3SYI A;  4YTN A;  4Z2R A;  5HYM A;  4Z44 A;  5M0Z A;  4G6G A;  2XLS A;  4IVM B;  2V6O A;  1D4E A;  2AQJ A;  1O95 A;  4OPT A;  1X31 B;  4FK1 C;  3ALL A;  2A89 A;  3QSE A;  3SX6 A;  1D5T A;  1JU2 A;  1PBD A;  2C67 A;  2YG7 A;  2XFU A;  3SZF A;  1VRQ B;  5L46 A;  4U2T A;  4G74 A;  4U8K A;  2H89 A;  1LTX R;  1PXC A;  4CY8 A;  2GR0 A;  4EM3 A;  4EQX A;  1GTH A;  1GET A;  3UOX A;  3IF9 A;  4PAA A;  4EIQ A;  5BUL A;  2YG5 A;  4YSH A;  3AEG A;  3T2K A;  3CND A;  4UDQ A;  3D9X A;  4BV6 A;  3H8I A;  2ZZB A;  1IUT A;  2XLR A;  1F8R A;  1P2H A;  1COY A;  3QVP A;  1GRB A;  2GF3 A;  5FMH A;  1YQ3 A;  1FEA A;  3AE4 A;  5EB5 A;  1DXL A;  3UKA A;  3LZX A;  1CJC A;  2OAM A;  2JK6 A;  3DGZ A;  3DA1 A;  5IPY A;  3KLJ A;  5JRB A;  2WHD A;  1CC4 A;  3P4S A;  3QJ4 A;  1LQU A;  2QAE A;  4GDP A;  1PDH A;  4G73 A;  4TM1 A;  3F8D A;  5JCN A;  2C73 A;  1H6V A;  4M52 A;  1W4X A;  2GAG B;  2CDU A;  2UZZ A;  3UTG A;  2WPC A;  3BI2 A;  3C4N A;  1H7W A;  2BK3 A;  2WET A;  2XLP A;  3RP6 A;  5KWF A;  3E1T A;  2XYO A;  1ZDL A;  4Z2T A;  4B66 A;  3CNS A;  4IVO B;  1F8W A;  2WBA A;  3P4P A;  1KFY A;  4H4Q A;  2RGJ A;  3GDN A;  1S7M A;  5TR3 A;  4II3 A;  4X9N A;  3AE6 A;  1GRE A;  3UOV A;  3P4Q A;  4YWO A;  3UTH A;  3DJG X;  1ZMC A;  3AEC A;  2EQ8 A;  4H4V A;  1PJ6 A;  2BRA A;  1E1N A;  5EBK A;  4X9M A;  4KPR A;  1CC2 A;  4RSL A;  2ZBW A;  2XFP A;  3QFB A;  5KOX A;  1S2Q A;  4A7A A;  3IWA A;  1IUV A;  3GD3 A;  2TPR A;  1CHU A;  1OJC A;  4BJZ A;  3C96 A;  1TDN A;  3UKP A;  5FS9 A;  4H4R A;  1IUX A;  1LV0 A;  2FJE A;  2O9Z A;  1Q1W A;  4IV9 A;  5IQ4 A;  1XAN A;  3NYC A;  2X99 A;  1MXT A;  2GR1 A;  3GYI A;  3AYL A;  1OJA A;  3SXI A;  2C64 A;  4ZCD A;  2X8H A;  3UKF A;  3CGC A;  3UOY A;  1D7L A;  2BAB A;  1CBO A;  3KA7 A;  2YQU A;  1TDK A;  3HZL A;  1GES A;  4GR1 A;  1REO A;  3SY4 A;  1YKJ A;  3ALJ A;  1K4Q A;  3VRD B;  2YR5 A;  2B9W A;  1PBE A;  3NT6 A;  3QSS A;  1FEC A;  2V3B A;  1L9D A;  2B7S A;  2WQY A;  2WU2 A;  3P4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...