2MUCA

Muconate cycloisomerase variant f329i
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
369
structure length
360
Chain Sequence
ALIERIDAIIVDLPTIRQQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELIGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PROTEIN (MUCONATE CYCLOISOMERASE)
publication title Structural basis for the activity of two muconate cycloisomerase variants toward substituted muconates.
pubmed doi rcsb
total genus 139
structure length 360
sequence length 369
chains with identical sequence B
ec nomenclature ec 5.5.1.1: Muconate cycloisomerase.
pdb deposition date 1998-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2mucA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2mucA01
3T9PA 5BOEA 2OZTA 1MUCA 4GISA 3MSYA 3H12A 1EC8A 3P0WA 3PFRA 4DN1A 3UJSA 2AL2B 4HCLA 2PGWA 2PU1A 3N6JA 4IL2A 3S5SA 4IT1A 2OZ3A 1EC7A 2AL2A 3H8AA 4K2SA 1SJAA 4IP4A 2XH7A 3V5FA 3RGTA 3R0KA 4H2HA 4IL0A 3RITA 2HXUA 2OKTA 4Z17A 3SN4A 2HNEA 2XSXA 1DTNA 2MNRA 2OX4A 3QPEA 5IDZA 3FCPA 2FKPA 5FJTA 3OW1A 3GC2A 1TKKA 3TCSA 3OZMA 3MY9A 3RRAA 3U4FA 3P93A 1KCZA 2P3ZA 5FJOA 3UJ2A 3GO2A 4ROPA 3IJQA 2OQHA 3CYJA 1BKHA 3PWGA 3T6CA 1XS2A 4G8TA 3R0UA 4GYPA 2PPGA 4A35A 3R10A 1MRAA 4H1ZA 2PS2A 7ENLA 4MMWA 3THUA 5BOFA 3SN1A 4E8GA 2OVLA 2PTXA 3PK7A 2PTWA 2OFJA 2XH4A 4DYEA 3N4FA 2PGEA 2GGIA 3SN0A 3S47A 4Z1YA 3DDMA 2QQ6A 1TE6A 1MDRA 3DG7A 1R6WA 1ONEA 2CHRA 2P8CA 3OPSA 2DW7A 3VCNA 4H83A 2NQLA 3NXLA 4M6UA 3D46A 3IJIA 3TTEA 3R25A 3DIPA 2PCEA 4KT2A 3STPA 2P8BA 4A6GA 3K1GA 3UCCA 4FP1A 3OTRA 1NU5A 2ZC8A 2OLAA 5FJUA 2P0IA 5FJPA 3TW9A 3MZNA 2DW6A 2AKMA 3UXKA 4J3ZA 1R0MA 2MUCA 2OPJA 3BSMA 3RO6A 3DGBA 3DEQA 3FJ4A 4E4FA 3T4WA 1ECQA 4MGGA 3DFHA 4DHGA 3I6TA 1WUEA 4G7FA 3OP2A 3H7VA 3TJ4A 4A3RA 4EWJA 1EBGA 3JZUA 3QN3A 4HNLA 1SJBA 3TJIA 2AL1A 4X2PA 2HXTA 4JN8A 1OEPA 3R1ZA 3SQSA 4DX3A 3DG3A 3BJSA 3ENLA 3CAWA 3V5CA 4GIRA 3GD6A 3ES7A 4M0XA 4KPLA 1JPMA 3P3BA 3B97A 3PWIA 4K1WA 1WUFA 1JDFA 2GDQA 1RVKA 2FYMA 2GSHA 3JW7A 2PTZA 2AKZA 3SSZA 3QLDA 4K8GA 1EBHA 2GGEA 3OZYA 3IK4A 5EU9A 3ZLFA 4J1OA 1FHVA 3CK5A 3Q4DA 1MNSA 3UCDA 4GGBA 2PSNA 1KD0A 3CXOA 2GL5A 3MUCA 3MKCA 3NO1A 3SJNA 2PA6A 3V3WA 3GY1A 2PU0A 1SJDA 1PDYA 4E4UA 3JVAA 3EEZA 4HYRA 2P88A 4GMEA 3UJRA 3HPFA 4ZA0A 2HZGA 4HN8A 2GGGA 3DERA 3RCYA 3UJEA 3ES8A 2OO6A 3R11A 2I5QA 5ENLA 4IHCA 4HPNA 4F4RA 2QJMA 2QDDA 1P48A 3DFYA 1NELA 3TQPA 4JHMA 2PP0A 3ZLHA 4GYPC 5FJRA 4DWDA 4E5TA 3BOXA 2PTYA 2PP1A 1KKRA 3CB3A 1MDLA 3ZVHB 2RDXA 3NZGA 3FYYA 1TZZA 3I4KA 2QDEA 4KEMA 3ZVHA 4IZGA 4HCDA 1W6TA 3N6HA 3NFUA 1E9IA 3H70A 3ZLGA 2QJNA 4E6MA 1YEYA 3VC5A 4MKSA 3I6EA 3VA8A 2PODA 3DG6A 2GGJA 2PMQA 2PP3A 4H19A 3V4BA 3SBFA 3IJLA 3N4EA 3EKGA 2QJJA 1KKOA 4JN7A 4HCHA 1PDZA 1ELSA 3QTPA 3UJFA 3D47A 3FXGA 3FV9A 3TOYA 3T8QA 4GGHA 1P43A 1XPYA 3U9IA 1FHUA 4HNCA 4ZCWA 2POZA 2ZADA 1IYXA 4DXKA 3VC6A 4IP5A 5J04A 2XH0A 3KUMA 3FVDA 4ENLA 3UGVA 3CT2A 2QGYA 3VDGA 3QKEA 3UXLA 2ONEA 2XH2A 3ZVIA 4GFIA 3Q45A 2GGHA 1L8PA 3TWBA 1F9CA 2XGZA 3VFCA 6ENLA 3VCCA 3RR1A 4KWSA 1BQGA 2O56A 1EC9A 4YWSA 2OZ8A 1SJCA 3MWCA 2QVHA 2OQYA 1JCTA 4FI4A 1JPDX 3MQTA 3TWAA 3DESA 2OG9A
chains in the Genus database with same CATH superfamily
2A2IA 1EHNA 3FLUA 2WWDA 5D32A 3WH5A 3HJEA 3OLDA 4GISA 3GNOA 5JVLA 1S2WA 1W2PA 3BLFA 4IFRA 4FLOA 4Y2WA 2DY3A 3QR1A 1E6SM 4D6DA 1NEYA 3RMEA 1RPXA 4IGNA 2INZA 2WMIA 3G8RA 4UZUA 5DQPA 4AH7A 2WHLA 2VVSA 2NWSA 3Q6JA 3WENA 4YVPA 2Z1WA 1F8WA 9RUBA 4EPKA 3URNA 1EJTC 3VIMA 1NFBA 3VGFA 1GPWA 3BJTA 4W7UA 2ZE0A 1DHKA 4IPLA 3WF2A 5JBFA 3XISA 1Q6QA 4DI9A 2C1IA 5IDZA 3LBOA 1ZAIA 2WAGA 1B3YA 1G6CA 1R5YA 2A21A 1J01A 3TCSA 1KB3A 3U4FA 4NZJA 3W86A 1GG1A 3LCIA 1LL7A 4C90A 2HDJA 1P7TA 4QNWA 4C6KA 4XAYA 4IMCA 3B8VA 4NYUA 4GYPA 1NH6A 1B31A 1MFVA 2E6AA 4AZ6A 3ARWA 3A3HA 1X2GA 1M01A 3ABSA 4FA3A 3THUA 1HJVA 3LXAA 4E8GA 3DENA 5U4NA 2Z7GA 1XC4A 2HS6A 2OFJA 3CH9A 3ARUA 4G9PA 1FWBC 3VE9A 2DZXA 3TSBA 3DFTA 3TXZA 1YXCA 3R5EA 4WY0F 3UR7A 3NM1A 4J28A 1E55A 1ADOA 5CSRA 2DZSA 1R6WA 5G2IA 4EF9A 5K4XA 2DVXA 1JF5A 2I9UA 5EMYA 1X7IA 1XM3A 4H6RA 4Q7NA 4ADTA 4UXDA 4NKCA 3T7VA 4B3ZA 4HU4A 5HBFA 1NARA 4KT2A 3LNPA 4TVUA 2B7QA 2WQPA 2QIWA 2Q71A 3OODA 1XRTA 3H7RA 4X63A 3BW4A 1E5JA 3VD7A 2WOVA 1I4NA 3NVTA 5G2HA 3HURA 2PCQA 5HPCA 2OO0A 4WJEA 4CNTA 1OD8A 2WANA 4FS9A 3NOYA 2VEPA 3GFYA 3CV6A 4F0LA 3K4DA 2E3TA 4R33A 4ZO7A 1L6GA 8CGTA 1N62C 1IXQA 2FGBA 1VIZA 2REQA 1AD4A 3OP2A 4EWJA 4QDPA 4AF0B 3B9JB 1VBUA 4JD4A 2PWDA 4X2PA 3G1XA 4JN8A 4CQBA 3GNXA 3GXPA 4PMZA 4IF2A 3DJGX 2QAFA 3T78A 5AHEA 1DNCA 4AWSA 3HG3A 5FAGA 3DHPA 3OQEA 3GNDA 3HGOA 3UW6A 1NWSA 3UF9A 1EF3A 1GK8A 3IPWA 3NZPA 1K03A 2PDUA 5I3JA 5C70A 5TIMA 4GIYA 4GBUA 4JTTA 2GUUA 4Z1AA 4AX6A 2E77A 2QT3A 1TX0A 3R94A 4K6AA 3WD4A 1ZY9A 3BMXA 4GO8A 2PBOA 3SURA 4JPGA 1EWEA 1D7YA 3FK4A 1I1WA 4H9VA 4LUSB 4QDMA 2NLIA 3DECA 4X0NA 5BMWA 2ZCGA 3M43A 1OHLA 5JIPA 4AMAA 3NEVA 2PRMA 4PTVA 3L2MA 4K8DA 2R9ZA 4MOZA 4EE9A 6ALDA 5HANA 3PR2A 4GZEA 2OOFA 1OM0A 3GG0A 3ES8A 1W8SA 3KOFA 2ZUUA 3QXBA 3GD3A 5FF3A 1KV8A 3LK6A 4M51A 1KBLA 3OB8A 4ZO6A 3KOYA 3B0VC 1DWGM 2CZDA 1CW2A 4N9BA 2PP1A 1KKRA 4MKVA 3WLPA 3FG2P 3PTMA 2QJIA 1ME7A 1G9HA 1KM0A 3R2GA 4GYFA 3N6HA 2ZUWA 5ECVA 4H50A 4EQXA 1B3WA 2G37A 3W7QA 3L5LA 3GXMA 3VC5A 5HAOA 3MHUA 1BF6A 2YQUA 3RLHA 3B8WA 3ANYA 1ZBCA 3AHYA 3CHCA 2PP3A 4MG4A 1CB7B 2CNCA 3M6DA 3M0KA 5TNVA 4Q4RA 3K1DA 4P2VA 4JN7A 1YDOA 1MUWA 2B31A 2ICSA 3MDWA 1W9DM 1BSLA 2PDXA 1XPYA 4XO7A 4AWTA 1E9YB 3OG2A 3WL1A 1NOWA 1HKKA 1H11A 4GUHA 3AU2A 2XTKA 2GR2A 3NL6A 5EBKA 1NIUA 1FDJA 2A8XA 3ARRA 3QKEA 3ZR6A 2DIKA 4WDTA 2HEJA 5E6YA 4ZGYA 3GUWA 3WD3A 1Q66A 4HGXA 4JIIX 5G4HC 1V79A 2IPWA 4YTSA 6ENLA 2AAAA 1ECEA 4Q8QA 2CLPA 5AYZA 2Y88A 1VLWA 1FO4A 1I75A 3UNDA 4W7VA 3SCPA 1WKYA 3M47A 2WJDA 3VDCA 2C79A 1XCFA 2P76A 4F0SA 3AIQA 4L4MA 1GG0A 4S3AA 4JCMA 3MMUA 5KZ6A 2BOEX 5BOEA 1ONXA 3LPPA 3OHIA 1QI4A 2DZBA 3T1GA 1UKTA 4D9PA 5SWUA 1TWSA 1X6LA 3RU6A 2CHOA 3TLLA 3I7QA 3BCJA 3EKLA 3PFRA 4PUKA 2PDBA 3APYA 2VKZG 3EAUA 4JTAA 4I7UA 4PH6A 3A47A 4IPPA 4UQ9A 3AICA 1PKLA 4IL0A 2XFYA 4CD7A 3EB3A 1PZ0A 4EK7A 2X1SA 1KFLA 2EG7A 3AIRA 1YPXA 1RY8A 1EF2A 1QAPA 4GG9A 3B4YA 1S2VA 1Q63A 2QMJA 3SCNA 3SSJA 3TIMA 1DJGA 4GH3A 4Z2IA 3W83A 4MB4A 3U2OA 2NV2A 1UJQA 4HB7A 2BV9A 2WMHA 3T08A 3PBGA 4ZFCA 3A13A 2Y8VA 4MWAC 3WH6A 2DUAA 3S46A 1K9EA 1BKHA 2A7RA 4W5UA 2HVMA 3H4KA 1UB3A 4ZSUA 4WD0A 1YW1A 2DZAA 3BOLA 4CCDA 3EDDA 3POHA 3CYVA 3GHRA 1MRAA 2Y4SA 3NGFA 1SZFA 1WOBA 4H4IA 2YDSA 2IKIA 5BYWA 3PK7A 3ANVA 3IIXA 3BE7A 1LPFA 4I5RA 4ZXLA 5AB3A 4H8HA 5EMMA 1ONRA 3LRLA 4QJ3B 3SCVA 3EWDA 1N8WA 1VBRA 3DYMA 4GZ7A 5D9NA 1O5RA 1Q6RA 3T2QA 1I2RA 3CZLA 3VCNA 2J24A 3K13A 1AQFA 3FHQA 4TR9A 2RDTA 4TX6A 3IJIA 1XLDA 1VC4A 3R25A 2YDRA 4RJEA 1QCWA 2WLZA 1RK5A 3QRHA 3STPA 3W2MA 1R3RA 2PDFA 1MO0A 1K6WA 1EX5A 1ADSA 2HBVA 3RG6A 5F4XA 4PMOA 4JY8A 3WF4A 1EBDA 4JDRA 1D7FA 2GRTA 2J6XA 5I03A 4UFHA 4HK7A 1KBJA 4M19A 1LQ0A 3VGBA 3SCSA 5ABHA 3OYZA 5I79A 1FWIC 4Z0JA 4DUOA 1WBJA 1GQIA 5C9WA 4NZ5A 2O9RA 3VZYA 2E5DA 2QYGA 1W31A 4QS6A 3WH8A 3EDJA 1PE1A 3NSXA 3AISA 2Z4GA 4QJ4B 4N0RA 1LG1A 4OWGA 2GSJA 3DBNA 3VD5A 3IJ9A 1V59A 3VNYA 1L6WA 1X7FA 2FFCA 5E0FA 3WK1A 4AXNA 4IG2B 1LJYA 2W4XA 4Z1BA 2E67A 3ZT5A 1R3YA 1JPMA 2J7HA 3P3BA 1RQBA 3L0NA 3TV8A 3V1HA 1IEIA 1O1ZA 4XD4A 2QCGA 3HMCA 4FOUA 4KEZA 2R1PA 4MLRA 2GGEA 3R79A 4O13A 5T9CE 1FWDC 3THQA 1IT7A 3MUY1 3IUIA 4DNMA 2C3CA 2ZVRA 4PRTA 4AC7C 4A2SA 3TP4A 1ME9A 4DBWA 4ATWA 3VKKA 2FZDA 4AHPA 3OGRA 2ASHA 3EPNA 5FAJA 3SJNA 4DELA 3KS5A 2WPCA 2D23A 2NX3A 3VM7A 3VX1A 4R9XA 1RCQA 3A5FA 3VAVA 4HYRA 1XUZA 4LY8A 4CNNA 2V3AA 3G0XA 3L5MA 3HPFA 5BXTA 1P4CA 2EQ8A 1N82A 3U3HA 5HOSA 2HZGA 3IACA 3B8DA 1ZUAX 3W29A 4MWAB 2JQXA 1FKXA 2IXUA 1OZMA 3GZ3A 2NQZA 4XK2A 1HL2A 1OINA 3CZKA 3N14A 1P48A 4KEVA 2WVVA 3B04A 3MP3A 5FS9A 3E12A 1OIMA 4Y9PA 1Q7MA 4UFIA 4JNZA 3TLQA 4R88A 4FLSA 2PC8A 3MUIA 2ZRXA 1GGOA 1DEDA 2EXOA 4NT0A 3NFUA 4QHRA 1W1A1 1EPXA 3LTYA 1V3IA 2PDGA 3OA5A 4UTWA 3TYDA 3VA8A 4JAWA 3V0SA 4ATDA 1HJSA 3UESA 1LM1A 5HDRA 2VD8A 3H55A 4DQWA 3F4VA 5BXRA 1TX2A 1VLIA 3G0SA 3WQ5A 1C8XA 5GJNA 3NPXA 4A2RA 2BODX 1BWLA 3KRZA 4GNKB 4WOZA 1C3FA 3V5OA 3N17A 1PX4A 2QDGA 3KRBA 3AHTA 3HW2A 3U9IA 3CQJA 1TREA 1O5KA 4JQ4A 1ZMDA 1YIXA 4NNAA 4K7VA 3NQCA 1IYXA 1XF0A 3WO8A 1W1B1 3E74A 4HK5A 4L9YA 3T2OA 1QVBA 2CWXA 2ZUMA 3U2ZA 4V15A 2AOSA 4AX7A 3KUMA 1Z8AA 2X99A 1K77A 1A3WA 1EH9A 3R12A 4L6DA 2FJKA 3IGUA 1CECA 1PCWA 4FDCB 2I7GA 4PMRA 5A2CA 1BWKA 1GRBA 3GHTA 2Y5SA 1N63C 3UXAA 1H0IA 1ZHAA 3W7CA 3R8GA 1OFEA 1N61C 1YTEA 2CHNA 4I8YA 3WJYA 1W5QA 1R3WA 5A6SA 1KLZA 1XBZA 2X7VA 1DIOA 1JUKA 3W1LA 5I09A 9XIMA 3WN6A 5F4WA 1Q85A 4QG6A 2OGYA 3LGGA 1G94A 2VFDA 3V18A 4J4KA 1OZQA 4MJMA 1ZJIA 1NHPA 2Y70A 4JS3A 1JYNA 2JIWA 2GJPA 3ABQA 4ZB5A 3S5SA 4JFVA 1H5VA 2OZ3A 3ITXA 1SMAA 2FFIA 1I1XA 4UFKA 4HSOA 3RX4A 1SJAA 1DVJA 1XWYA 4C6CA 3AIWA 3THAA 3NR0A 1JG9A 3S6TA 4W85A 4F40A 2C91A 1LLWA 1XI3A 4YPJA 2HK1A 4DYKA 3CTTA 5CSUA 1OY0A 2V6OA 4YWIA 4PGLA 2E5CA 3QPEA 4PMJA 1IR1A 3SADA 4CD5A 5JCNA 3W38A 3ZYZA 1J10A 1H7NA 1ZJBA 1P0DA 5A2BA 5FIPA 4FX8A 1JCXA 1GOXA 3E0IA 3WQDA 1TG7A 5KZMA 1Y5XA 1RR2A 4JHZA 3MANA 5TR3A 1JUBA 2GQ3A 4M1BA 1XUUA 3W84A 2D69A 3OBKA 1UPPA 1DJNA 4F48A 3TMLA 4A35A 1TTJA 3ITTA 1FTXA 1Z3NA 4MMWA 5CJ5A 1RJPA 2VR5A 4O1FA 1CGYA 1NOFA 1S5WA 4UMCA 3NQ7A 2A85A 3MW7A 2XH4A 4DYEA 2C71A 1TV5A 4QCEA 5FL1A 3M0LA 1SO6A 2ZZBA 2I17A 3N19B 3CO4A 5JCMA 1GOMA 3UZJA 4H9YA 1TA3B 1WQ5A 2RDUA 4DJEC 3GG8A 2GJRA 1A5NC 2NQLA 1BEUA 2E6FA 1QJWA 2Z1KA 2QCDB 3AU6A 3Q2DA 1J0KA 3F5LA 3HQPA 2VFEA 1X39A 2NVKX 1FECA 2GOUA 1ZL1A 5AFDA 4AUBA 1T5AA 4Q8MA 3AS2A 1E71M 2DJLA 2VM8A 1ZU8A 2DGAA 3IEBA 3MJYA 4XBSA 1JOAA 3VKJA 4QISA 1RP9A 3FAXA 2DH2A 3R6IA 2V82A 1OT1A 2BWGA 2X40A 1TYPA 4CD4A 1JEZA 4J3TA 1O7AA 3RX3A 3MSDA 3VU2A 2VUYA 2J7EA 3B8UA 3EDEA 2BGQA 3G8EA 4HSNA 4KWOA 4UTKA 1JYXA 4G6CA 4OIFA 2HCVA 1KV5A 1WUEA 4TV5A 1OCQA 1KR0A 2OSYA 3D9XA 3SCUA 2E28A 3QN3A 4HPGA 3PAJA 4ZQRA 2F6KA 2Q8ZA 3CMJA 2PE4A 4KS0A 5AHFA 4DX3A 4NRRA 3MB9A 3WQVA 4UOQA 2UY4A 3EA1A 5EBAA 1FOBA 3V5CA 4GIRA 1R2SA 2DH3A 3VUPA 1GYMA 1JVNA 5D8ZA 3TU9A 1SW0A 3GWQA 1HKIA 2F5ZA 4JTRA 4X2RA 3O0KA 5A6BD 2BXYA 5I3FA 2JGQA 2PGFA 4S3JA 1VCGA 1W9XA 4IXXA 4IIFA 4BQ2A 3SSZA 3NQVA 5T26A 2DT0A 1NWTA 1XLAA 4J35A 3MJMA 1UR1A 2NLYA 1QPOA 5AHMA 5H8UA 2VL4A 4LS0A 1GW9A 1I2QA 2RHGA 4R27A 3VD3A 3HPAA 3NDZA 4Q4SA 4EIVA 4YCOA 4G7EB 1R2RA 2HVNA 2Y8KA 4HHMA 3LPGA 1UR0A 3PJTA 1B9BA 4UTMA 3DK8A 3LGDA 3N4AA 4RZ6A 5F4SA 4QXIA 3LI1A 2QF8A 2BDQA 2OLSA 1Q4WA 5BRQA 3DERA 3O7UA 3K8LA 1K9DA 1E1CA 3SI9A 3V35A 4RZBA 3R11A 3WFZA 1NQ6A 1TO3A 4H4VA 1TSIA 2X42A 2PTDA 5KETA 3AXKA 2E1DA 3SCOA 4EKJA 2PP0A 4W93A 1HJWA 2XUCA 2YPIA 1FHDA 2J13A 2FJUB 3AQUA 1XLGA 3BW2A 3EWBX 1DIDA 3W1TA 1GCYA 2XGIA 4I5XA 5G2WA 1L0PA 3L0KA 1VPYA 3GFXA 3Q58A 1SVDA 1TPWA 5D9MA 1NF7A 5ECUA 1YEYA 3HM7A 3UZZA 2CIPA 2OWXA 1D8CA 3PZIA 2E0PA 3LLDA 1O5QA 1HW6A 3UD6A 3EA2A 4GQGA 3ZM8A 2F2KA 1OYBA 1GVQA 5D4YA 2R1LA 4Q32A 1GHSA 1LF1A 3VOGA 4J57A 4LOCA 4UB9A 1PDZA 4HNUA 2LLEA 2EQ9A 3CL8A 2ZUSA 3TYEA 4B9ZA 4DO4A 1BWVA 4IISA 3SEPA 3OVQA 2BS9A 4XZWA 3BSHA 4YJ5A 4M7SA 4ZCWA 3H2EA 4A8LA 1O94A 8RUCA 1I0BA 3HB9A 1PWMA 4S3BA 4GXMA 4W87A 4ML9A 3IGXA 2YW3A 4QEHA 3GXDA 3UXLA 3LCWA 1DTUA 4REQA 2YKKA 4V1YA 2Y5JA 4XSLA 4E3VA 3AMLA 5FOOA 1LVLA 4IWWA 1YTDA 2ESCA 4NEVA 1MOKA 2WM0A 2A79A 3QMRA 3PVFA 3VFCA 3MMTA 4DF2A 3LHZA 3WBYA 1TVLA 3ARZA 1W3KA 5I06A 1EC9A 1MO9A 1REQA 4ZXOA 5CLTA 2E6DA 4R85A 4RKAA 5DO8A 2OODA 4MM1A 3O6YX 4KFNA 3SRHA 3TC7A 2X8GA 1J2WA 3RFAA 1LOLA 2RJHA 1MUCA 3DI1A 2JBMA 1A80A 3S1XA 4QQUA 1Q8AA 1X96A 5EMLA 3EAOA 2PGRA 3BLKA 1XR2A 3MC5A 1B4EA 5AC6A 3M41A 1UD2A 3NDOA 3OOQA 3RPMA 1H1YA 4QTGA 1ZP3A 5MKGA 1EP2A 1YX1A 1XQLA 3UG4A 1UR8A 4MJZA 4OV4A 1W3HA 4LU0A 1XXXA 1XD1A 2E5BA 1DTNA 3N2MA 4RDVA 3TR2A 1D9EA 1LWIA 3WLIA 1E6PA 2QPUA 4DBDA 4ERAA 1WAUA 3PBYA 5LGZA 5HMDA 5GNYA 1VF8A 1X6UA 3WJWA 4ZQPA 5HINA 4C6JA 3BQ5A 4ZZ9A 1S3TC 2PLJA 1N60C 4DO7A 5CPQA 4PCNA 1ZCCA 5A6MA 3WDIA 3IV8A 1W8GA 2VR2A 3E2QA 2Z1SA 1XDJA 1XS2A 3F03K 2ZZ5A 4W86A 3NL5A 4QRNA 2O9TA 3PBMA 3NQFA 1CENA 3TYUA 1OFQA 3TQVA 3C2OA 4L6OA 1HNYA 4IM4A 1BKSA 3SN1A 2Y2WA 1HKVA 4UWMA 1EJUC 5GJMA 3LM3A 1TQXA 2FTPA 2CKRA 4PR4A 4NAFA 4WSKA 2PWFA 4O57A 4IGHA 3MO4A 3D6NA 2QIIA 3G24A 1RV8A 2ZWZA 1NFPA 4HMDA 5I3DA 2J9YA 5CZ0A 4ZQCA 3GAYA 4D6EA 3WK0A 2YCLB 2ZXQA 4M3PA 2UZ9A 3BARA 4HOXA 1JZ8A 3VILA 4RE2A 2QKFA 2D2GA 1FKWA 3M7WA 3ETRB 2OELA 4AZIA 4U5KA 5KEZA 2YXXA 1SFJA 4O1BA 4BI6A 3MBDA 2IPGA 5I24A 2P53A 5LA0A 3T55A 3RUBL 1UZHA 2QNEA 4MF4A 8A3HA 1Q1WA 2VP8A 5HNUA 1TVNA 1QNPA 4ZEPA 1GOQA 1J0YA 1AJ2A 2WSRA 4EQWA 2GDVA 1JXKA 4PUNA 1EJRC 4XZIA 3FJ4A 4LBRA 3IIZA 2OLHA 3A9IA 5E1QA 2ANUA 3OC4A 3OZPA 3ZIZA 3W6MA 2J8GA 2VEGA 1XGEA 1C8VA 2VFHA 3WBEA 1EIBA 1VKFA 4RDWA 3BPWA 4NILA 4O8RA 5EFFA 3T42A 3UNTA 4UTTA 4GXPA 1GESA 2ZZ1A 4N9CA 4LAUA 3R1ZA 3FKRA 1AH4A 4OBRA 2J79A 3BJSA 3SIMA 1QNSA 2ZX6A 1YHTA 4M0XA 4UOZA 1FWTA 5AVHA 3S42A 4IIEA 4PMVA 1BPLB 2CETA 4M29A 2V68A 3M4HA 1HN1A 3CV1A 4AXKA 3S9IA 1UZ1A 4LPCA 3B8IA 3TX9A 2G97A 1UPMB 4DJFA 1YNYA 3ZZ1A 3M46A 4LRTA 2BVWA 4FX6M 1MNSA 2J77A 1F3WA 2OZ0A 1IZKA 1H2IA 4GWEA 3SQMA 2NUWA 3SZ8A 3FA3A 4JIEA 1JEHA 1XGDA 5FEPA 5D03A 4FNRA 4CNSA 3ERPA 1XLKA 4H4ZA 3G22A 2H8ZA 2A3AA 4HMEA 1XLMA 2VELA 3LUTA 4NZ4A 1E43A 3LU2A 3NZQA 5HNRA 1C29A 4X22A 4ZA0A 3TCEA 2FDSA 4HN8A 2CBVA 2G3MA 4A4AA 3GU9A 4C7FA 5JCLA 1H49A 1R86A 1UWAA 1MW3A 1O95A 2NPXA 4PMNA 4YHGA 4I6VA 3REQB 1R7OA 5L6UA 1XIGA 5ENLA 3VIGA 4JKKA 1V3LA 4ZB2A 4IFKA 4TOQA 3L4VA 1XLCA 2BSLA 3BH4A 1XC6A 3NQ2A 1Y5VA 1W1VA 4GYPC 2XG9A 4MKNA 1PZ2A 1GWJA 3FSUA 1W5OA 1HGWA 1H0GA 2WJEA 3ZVHB 3PP7A 2VRQA 2J3NA 3AALA 3FYYA 3N1AA 1W1TA 1R38A 2NZLA 1XYFA 4IZGA 4NAEB 1JAEA 1F3TA 3GNNA 3QHOA 3BDKA 3N3MA 2DSUA 4XO6A 2V2CA 3WQ4A 4DBEA 3AXMA 2OSWA 4C6LA 3M6YA 3ABRA 5KZEA 1JQVA 1HKWA 3L68A 3UCQA 4O0KA 4HZ7A 2PODA 1GKQA 2OSXA 2ZZ7A 5A69A 3STEA 1XW8A 1VJZA 3B8SA 4ZODA 3L5OA 4ORMA 2X1UA 4O50A 4D6JA 2Y61A 3XINA 9CGTA 1UD4A 1LUCA 3FKKA 2CKSA 3KDNA 3PTDA 1F6PA 2XWEA 1W54A 1KM6A 1WDWA 1GUVA 4IP7A 2X7WA 4NY2A 1ZSXA 3GB6A 1D3GA 1FFQA 1DQXA 3N11A 2G50A 2I5IA 1WKDA 5FF2A 2EPKX 3FVDA 3WUGA 1OSEA 2Y24A 2I16A 3W2JA 4ML4A 4RE4A 2Y7DA 3Q45A 3WQ6A 1V93A 3TWBA 2XGZA 4EMJA 1SSDA 1NDZA 4L1GA 2W66A 3IVSA 3LQLA 3RNMA 4KWSA 2J9XA 3TYCA 4JNMA 4HPHA 1F61A 1X98A 1A5MC 1YLVA 2Y89A 4H8VA 1SR9A 3KVJA 1MVYA 4PL1A 1VPQA 4PUMA 2DSVA 5CZJA 3MYPA 4B5NA 2DZWA 4A22A 4C6NA 1IEWA 2NT0A 4NXKA 3WDRA 3IC9A 3HG4A 2FZ9A 2PWGA 3BO9A 4L1WA 3UJSA 1S46A 5BRBA 2IUZA 3ICJA 4C7DA 3RR4A 4YS1A 3ZQ9A 3IIPA 2AAQA 1MWOA 4NJJA 4GLEA 5LKYA 3H22A 1A5UA 1WV2A 4IP4A 2V5JA 4EX4A 5C2XA 4B4HA 2KAUC 1OT2A 2WK2A 1MUMA 3A5VA 2OKTA 4UUIA 1YBQA 6XIAA 2XSXA 3DFPA 1DHPA 4S3KA 3WEOA 3RCNA 3WLTA 1JZ7A 3OJGA 4A21A 5CPNA 3O07A 2BNJA 3PWAA 1C91A 4UQCA 3N13A 3HRDC 3GRTA 3E0VA 1OJTA 1XYBA 4X61A 4LT9A 4PRWA 2DIJA 3TR9A 3M7SA 4S3FA 3CWHA 4LUIA 4YL2A 2OQHA 3F2DA 3SQPA 5CGTA 4KCUA 4IG2A 3GR4A 4S39A 3W1NA 5EFDA 1IZCA 4AHQA 1KRCC 4ALDA 1UD8A 4LUTB 3P61A 1PX3A 1OCBA 2Q3RA 1B1YA 5FS7A 1NY1A 1GVSA 1BLIA 2PLMA 3PPHA 4ZL1A 2VC9A 3GU2A 2DSKA 3TOPA 1UD6A 3Q94A 1UJPA 4PCSA 3LXCA 3L4XA 2C7FA 3A4XA 3PNZA 1R87A 1PTGA 1RBAA 2CZ5A 1RCOB 3G3DA 3EX3A 4HT3A 2A3LA 3ZJ6A 3VNZA 4OOUA 4KF1A 2BX7A 3NXLA 2WW5A 1BF2A 4HOWA 1M03A 3UG3A 3WF0A 5AYYA 1F4AA 2PF8A 1KRBC 3HQNA 3AYSA 1H7OA 3II4A 7PTDA 3IJDA 4KRTA 3C0QA 1XYMA 5DF0A 1PCKA 4MWAA 1KM5A 3H2NA 1WKEA 4LC8A 3M9YA 2WB5A 2J9ZA 2A7NA 4BWLA 3GTIA 3F4WA 1G7UA 4K8EA 4NU7A 1O4UA 2GJXB 4RV3A 3H23A 1E0XA 2GVEA 1VFFA 1FXPA 2OPJA 4FO4A 4LEQA 3C4UA 1JDDA 2D3LA 2G41A 3VGDA 1S5TA 1TWDA 2QULA 4RX0A 2O9OA 3DK9A 2E8YA 3EB2A 5CQ1A 3AIEA 4ZE5A 2VFGA 1FWNA 3Q67A 2CFFA 1IGWA 2XJ7A 2X50A 2G96A 1PXGA 5XIMA 3V75A 3LMZA 3ZR5A 3MDUA 5E6ZA 2J66A 2X0HA 4P8UA 4B15A 3WH7A 4DZ5A 3GKFA 4DJDA 2E6YA 3TC3A 2H3DA 3H21A 1NSJA 3LHTA 3HG5A 4MJ4A 2QJHA 3SRDA 5D2YA 2QEZA 2ZRZA 4WDUA 1N2VA 1CGXA 2D20A 4K1WA 4LQ1A 1D7KA 1WUFA 1JDFA 2GDQA 4O53A 2J74A 1JCLA 1Z69A 1IR2A 4Q6XA 1Q2RA 4PCPA 4K8GA 3U48A 1I2NA 3SFWA 1IT8A 1PAMA 4EMWA 3Q4DA 3GR8A 2YCEA 1O5XA 1OFAA 3IUDA 3KZPA 3M5YA 9XIAA 5CZKA 2PSNA 5EL1A 1E5NA 4QG9A 4GQ0A 4KH2A 2WNNA 4GKLA 4BS0A 1Z48A 3UXDA 5A6KA 3TNOA 1SJDA 3E5BA 1SO5A 4I8DA 2D1ZA 3AYTA 4IXHA 3LHUA 4GNJA 4LAOA 1N7KA 1MXGA 1Q6CA 1WDDA 4QJ5B 1T0OA 1R3TA 3C3UA 3EWUA 2QXWA 3IVTA 1M6JA 3H2AA 1EJ7L 3LEPA 4XG1A 1VFUA 3W7IA 4DRSA 1E72M 1W1PA 1SW3A 3WNMA 4KQNA 3WJSA 1NWUA 2XIJA 2GK1A 2Z1XA 3LCXA 4DPQA 2FVKA 2Q01A 2OT0A 1MNZA 3CWNA 1KRAC 3E0FA 5FJRA 3T07A 1S39A 1I2OA 3A21A 3WLLA 4H4UA 1UP2A 4QR6A 1JD9A 3EOUA 4AIBA 1W0MA 2C14A 1KFJA 4Y8FA 4U3CA 2VRJA 3GTNA 1KXQA 3NYZA 4AIUA 2DT1A 3B9EA 4F9DA 2X0SA 1VJSA 4K7YA 2EEXA 2YB1A 1IIHA 4EPBC 2EHHA 2GGJA 4E3TA 2PMQA 4AC1X 4QROA 1JRCA 2VT0A 5JIWA 2QUMA 3SBFA 3RK8A 4O17A 4INFA 2CC0A 4HMCA 1YYAA 3DAQA 3ALGA 4WY0B 3QGAC 2WVSA 2FTYA 1X97A 5BU6A 1EHAA 3FXGA 4JTGA 5CBJA 2ZDSA 3OYXA 1W5PA 1GKRA 4N02A 3T09A 3NVVB 1CX9A 5DY3A 2WOQA 1VFSA 1JI2A 5I3KA 1OX4B 3VPLA 1WPCA 1X8CA 5FCZA 2QV5A 4CQDA 4FXSA 4Y9NA 3AS3A 3RN6A 3DX5A 5RUBA 2CLKA 3WBXA 3SCWA 1OD0A 3KCOA 3SUTA 1GRHA 3SY8A 2V2DA 4U28A 4LAMA 4QP0A 1TJ2A 1IT0A 3WUFA 4TTUA 1XANA 1U83A 4CCCA 4B5SA 4MNKA 1XBVA 2QCNA 4U5IA 3S1WA 3CIWA 1TA3A 1QI3A 2O4QA 4UBPC 4ZFMA 1ITQA 3CPUA 1QO5A 3L5AA 3W2LA 2OWWA 3C5QA 2PD9A 3P81A 3W02A 5LIWX 1Z32X 3QGVA 2ZE3A 2ZRUA 2PDLA 1SFSA 4FIRA 3ALFA 1EGZA 5BZAA 2IS7A 1XHCA 4NZ1A 4UNLA 2WP6A 2ZWYA 1HL9A 2YJQA 2WHKA 1IWPA 1CLVA 4AYSA 1MXSA 3V1PA 4LH8A 2BTMA 2GQAA 4JTSA 3KCJA 4WVXA 1BXCA 1VRXA 4PSRA 4UQDA 4ZB0A 2F61A 3GHUA 3G5EA 2Z27A 3MVTA 3W27A 4H9UA 4XVDA 4WX2A 3NZRA 1HKMA 5FJTA 3VIKA 3B3DA 1A53A 4TVYA 1H61A 4MY8A 4RW5A 3L2IA 4H4QA 1BWCA 1DL3A 2VZUA 5ABEA 3ITVA 3R07C 1W5NA 3CLMA 2ACSA 3B0PA 5BNKA 3W7RA 3NNTA 3VK5A 3GO2A 3IJQA 3G1YA 4LYKA 4WGHA 4A3UA 5BRPA 3WYZA 3L7RA 3KVKA 2X8CA 3JRKA 1ODZA 4A8IA 3G0UA 2YA2A 1BXNA 3AI0A 2HK0A 1EEXA 3FIGA 4PRRA 1OGSA 1THFD 3DZ1A 4DBUA 3LRMA 4F0RA 1VRDA 3NGJA 4UTWC 4PEEA 2A3BA 1HJUA 4LNYA 5AKQA 3VMOA 1QPKA 3IS4A 3L4TA 4H83A 4Y9AA 2XIMA 1QTWA 4HVXA 2Q8XA 3SY5A 1FDZA 3PNUA 1EDGA 4HOZA 1SO3A 1HXJA 2PCEA 5DANA 1C93A 1P0KA 4ERGA 4WF7A 3LG3A 3R89A 4CQCA 3HFTA 4IX0A 4RNHA 3W70A 4C6BA 4WIWA 2P8BA 5CBIA 5DN1A 4IMEA 4BR1A 1TWZA 1V8EA 2CPUA 1OYCA 3SIZA 3CHVA 4PL2A 2C16A 5F1UA 4B3KA 2Z00A 3SGZA 4JQ2A 4N4QA 1UOZA 1P5BA 1GORA 1MW1A 3TW9A 4MUZA 4A3YA 1ZK7A 2HWGA 5LA1A 4PSPA 3TSDA 1LBLA 1HIZA 3C56A 5DMNA 3S2MA 2DFAA 3URAA 4PTNA 1JJKA 3NVWB 1FWHC 4JTUA 4K1GA 1Q1RA 1LWJA 4LV4A 1P6BA 2NQ5A 4MDOA 3TJ4A 4FK9A 3CAVA 5D9PA 4HZMA 4HNLA 2XSAA 1F8MA 4JFTA 2ISDA 2HXTA 1TRDA 4A8NA 3K4AA 4DJEA 4UTFA 3O0HA 4M6PA 3FYOA 3P80A 3PSVA 4OUIA 2HV5A 2RJGA 4K38A 3O2LA 3ENLA 4Z2GA 3I3BA 2EO7A 2X1TA 2FZMA 3CUZA 1J79A 3UVAA 2EQ6A 1S7MA 4AZBA 1Q4NX 5FEWA 3H54A 4L4LA 4AD5A 3OZYA 5D05A 1FHVA 2J27A 4MFDA 4YWOA 3WZ0E 3P14A 3AM9A 1XLFA 3KL3A 3MV11 1E56A 3NO1A 3WQOA 4JCLA 1TWIA 3MHFA 1E0TA 3B9AA 3WJZA 4AYGA 3N3TA 3UVIA 4L6HA 1QU4A 1LQAA 4PUUA 3I4EA 2CZFA 4LANA 3ZFHA 2BCPA 3PBUA 2YXGA 2OYMA 4TX9A 3EWYA 3U5UA 1LTDA 3LN3A 4XAZA 3CZJA 4KRZA 4XD3A 3B4UA 1QW9A 4LB4A 1HL8A 3T0BA 1UUMA 1PTDA 2D0HA 4BEUA 1ZJAA 1XPGA 1TFVA 3TQPA 1GNXA 3W6LA 1K1DA 1RHCA 2Z1BA 2VMFA 2QCFA 3LERA 2YW4A 5BXPA 3UGRA 4JFWA 3ONCA 1Y5WA 1E9IA 1S5VA 3EDKA 2DU2A 4DWSD 2XVLA 2G5WA 4DUWA 2PDWA 3MU7A 3VNMA 5CC6A 3VDAA 3VZXA 1ZXIC 2BXZA 1WX0A 7A3HA 1FY6A 1IEXA 2DORA 2O9PA 3EPOA 3LXDA 2V3GA 2JE8A 1EJSC 4YCPA 3GR7A 3CH0A 3EOEA 1WDSA 1KXVA 3WFLA 4D1IA 1TVPA 3P7YA 4CCZA 5U25A 3GXTA 1UW9A 3AYRA 5JRBA 4B2DA 4JYDA 1CPUA 1GETA 2X1RA 4H4PA 5ABFB 1ZBVA 2NSOA 3GK0A 1JQXA 2PDYA 1GEUA 2H3BA 5A6TC 3HTWA 2E3ZA 3NJ3A 4LYPA 4IP5A 4XX6A 5J04A 3L4WA 4FF5A 3A3XA 2FVLA 3CEPA 1TIMA 3UGVA 3LTSA 2TODA 4MWAE 1OVDA 1GQJA 3MVIA 5CG0A 1S2TA 3VOHA 1UYQA 3ZVIA 5AHNA 1VBJA 5CG7A 4AY8A 3IJ8A 3O6CA 1QI0A 1KCKA 1ZTVA 4DEFA 3TXVA 4O1CA 2V81A 3BLEA 3N12A 4YWSA 1Z42A 2QPXA 1XIEA 1Q13A 2VHLA 5IDIA 3A7RA 3N6QA 4AG0A 5DBTA 3GVVA 5JH1A 1JPIA 4QS5A 4C6FA 5CC5A 1KBIA 4MAZA 2GQWA 4IX2A 5BWAA 2QUNA 5GNZA 1DQUA 4US5A 2D3NA 4AD3A 3U4AA 1VEPA 1V0NA 2O4MA 2VOMA 4MNLA 1KGUA 2W91A 4GABA 2E7FA 1UQZA 1CT5A 1HVQA 1LOQA 3CZEA 3GE7A 3TYBA 4DAFA 4K68A 4GH1A 4XV0A 3ATYA 2IKHA 4PB5A 1MZHA 4JTQA 1PZ1A 4S23A 1F05A 4C6IA 4IMAA 3GW0A 2MNRA 3WJXA 4J7RA 2ZZ6A 3IWPA 4J9JA 1GJWA 3KP1A 3LCGA 3CGTA 4MSSA 2W27A 4AIEA 3WLQA 1XG3A 1EXBA 4KERA 2OEMA 4IPJA 3PTQA 1CXFA 3W75A 4UR7A 4PTDA 3T2PA 1J0ZA 2WC3A 2AAMA 3S1VA 1I8JA 1IWBA 1JFXA 5DT7A 4Q33A 1UD5A 3UY7A 3UZ5A 1V5XA 3I6RA 2ISFA 1GOKA 3C2EA 5ABGA 1U5HA 4AIOA 4IJCA 2X8RA 1Z44A 4BQ3A 1C7SA 1XJBA 5AC8A 3ZT7A 1BYCA 1VS1A 4Y96A 2XVPA 3W28A 2OB3A 2PGEA 1R2TA 5I3HA 4Z2LA 3FNDA 2X16A 3G1AA 1AW1A 3S47A 1K4HA 3NSNA 3CUJA 1UA3A 1PWLA 1JZ6A 1POJA 4GI8A 1ITUA 2D2OA 3L65A 4V1XA 5AN7A 4D8ZA 1UR4A 4LUJA 4MLJA 2G3IA 2ALRA 4GNVA 4GY0A 1XDMA 3AS1A 4JTEA 3TE9A 1ML1A 4JTLA 4O12A 1RCXB 2G4JA 3E9AA 3T0DA 4PULA 3K1GA 1O12A 1V02E 2B81A 3GYEA 2DZPA 4NQ1A 3REQA 2ISSA 3CT7A 3QPYA 4GC3A 5IXEA 2GVGA 2QCCA 4APNA 2ZZ3A 1E0UA 1VP5A 3PS7A 3GXNA 1EYEA 4JQ3A 5LIYX 4UR8A 5CJNA 1OFRA 5G5IA 3SO7A 2WVUA 3OU8A 5E5CA 4WGXA 3ZJKA 4NNCA 3BSMA 3BL3A 4G5DA 1OADA 3FHAA 2W3RA 2X30A 1ECQA 2JIEA 4I90A 4MGGA 1U33A 2TSYA 4QE5A 1XLHA 3WH9A 1PX8A 3F2BA 5C71A 3QH2A 4NAEA 3I3DA 2VFFA 4B5XA 1TPH1 4O54A 1ICPA 3VX0A 2YL6A 2J7CA 3GC5A 5LIKX 4J40A 2VQTA 4EVZA 2TPSA 2BHZA 4U10A 4HU8A 3M5ZA 4YYFA 1UR3M 3PAOA 3VNLA 1AA1B 3S2JA 4AEEA 4PE8A 1DJXA 1GZ1A 3PZUA 1JNDA 1U2YA 5G4EA 4H7CA 4MUPA 5H2ZA 3VKAA 5GVJA 3EXRA 5K3VA 3WQCA 4ECLA 2I1OA 4C1NA 2GSHA 2AKZA 3RIKA 3IK4A 5EU9A 3LCLA 4JICA 3M0IA 3LCFA 5IM51 3RF9A 1CGTA 5GQBA 3QHMA 5HXMA 3UZWA 2ZQ0A 4GGBA 4GQQA 2F84A 5AYIA 1EGMA 3C2FA 2VX6A 2XN2A 2ZRVA 3GY1A 2BASA 2WKJA 4FR6A 4QE1A 1PDYA 3VXGA 4EWND 3JVAA 1V6VA 1IXOA 4HTYA 4JKMA 1V3JA 1B9ZA 3NWRA 1MQRA 2FPVA 2V5CA 4PCTA 4C91A 5HQEA 4H2CA 2VX5A 3VE7A 2Z7KA 4AFYA 3L2LA 3U2CA 1GVOA 3OQ8A 3GRSA 1AG1O 4Q7IA 2R6OA 4X9YA 4JX4A 4QITA 4PFMA 3BGJA 1YDVA 2ACUA 1P1XA 1K7FA 4HNTA 3AXHA 4NHVA 3IUHA 4D71A 3BG5A 5AZ0A 1LBFA 3CASA 4KEMA 5A8GA 1RD5A 2VJXA 2XM2A 1XIDA 4E6MA 4FIQA 2R24A 4MPQA 1EYWA 1PS9A 2YIHA 4XTIA 5K9CA 2HPIA 4CCEA 5CKSA 1E3XA 5AYXA 1G4TA 1PHQA 2QJJA 3PZVA 5FEZA 2XYLA 4IJBA 2A7PA 1US3A 1BXBA 3VDBA 3CAKA 3UQNA 2A3CA 2L5HA 4D6CA 1WYIA 3UA3A 4FF7A 4GGHA 5TF0A 1TWWA 4CVWA 5C9ZA 2GUBA 3NCOA 3PZQA 2D2HA 2POZA 1RALA 3GM8A 2WOWA 1Z89A 5IFPA 4H4TA 4REQB 3S9YA 1W32A 1SZRA 2VR4A 4AISA 4BZYA 5KVIA 1H62A 4LUTA 5FEXA 3FA5A 3DKJA 1UUOA 2VZVA 1UBSA 2XN1A 2CLFA 3IV3A 1L8PA 4PA8A 3UERA 5HJYA 4LX4A 1JGMA 1G1YA 1REQB 3EDFA 3P60A 2QGHA 3VCCA 1YADA 3CHDA 4GX8A 3QR3A 2HS8A 5JXQA 4UTTC 3MWCA 3E2VA 3CO8A 1JPDX 3OA3A 4DBSA 4IIGA 2OZTA 3MTWA 2WMFA 7TAAA 4GIEA 3C0SA 2CDUA 1CLKA 5C9UA 4BI5A 4R5EA 1EC8A 2OKOA 4LF1A 1JZ3A 1W56A 4V28A 4HCLA 1ZZMA 5HATA 4DJFC 4LVBA 5KVHA 4V27A 1I0DA 4GY7A 3PSWA 2R1MA 4Q8TA 4QEEA 3H8AA 4N7QA 4XVEA 5MKGB 4HU3A 2HE8A 3KWXA 1EWDA 3W37A 2PWUA 2HXUA 1MRQA 5A1AA 1ZRQA 3PZTA 2HNEA 2GJXA 4ZBCA 5A8MA 1H1NA 5JCIA 1KTCA 5L9FA 3BCDA 3BV7A 1XCXA 4EXQA 4JTKA 2FKPA 3E1F1 3KOXA 3O1NA 4WSHA 3HOJA 2IQDA 5B7ZA 1XFBA 1M3UA 1P0BA 1CGVA 5FJOA 3HO8A 1H41A 1RXOB 3LBMA 4LGXA 2WQDA 3CGDA 3DFOA 3PWGA 1KFKA 4LB3A 1W1ZA 1CIUA 4G8TA 4LBSA 1WA3A 6TIMA 1CI1A 4EACA 4H9MA 2NX9A 4JHOA 3R10A 2PDHA 1XX1A 3W1UA 3G6MA 2HQMA 3C2RA 3NQGA 4PB3A 3KBJA 1BVWA 4HHPA 4IOTA 3KBWA 5G1YA 1LL6A 2PTXA 3OZOA 3L23A 4NAFB 4LSBA 3KBMA 2X05A 3WNPA 3GX9A 3INPA 1TPC1 4C6EA 1V03A 2R1NA 2Z28A 5FMHA 4XBKA 4HSHA 1DJIA 2VGFA 3NQ8A 1BVZA 1TE6A 2Z25A 1MDRA 4WOQA 3VNKA 2JF6A 4Q4KA 1X1ZA 1ONEA 1TPUA 2VX7A 1NOUA 4HNNA 4RLIA 1ENUA 5C9XA 1VDVA 3GDTA 4KWWA 5DX7A 4ZMGA 3UA4A 1R7AA 3TQ0A 3B0UX 4O52A 2VQUA 3WEMA 4P7LA 4CUCA 3EMQA 3W7GA 4J56A 3C86A 2DP3A 2RKXA 2PDIA 2VXNA 2WKLA 4IMDA 3M16A 2H6RA 4XZHA 2B7PA 3UY8A 2VCAA 3H26A 4F2BA 4CN1A 3PUOA 4Y8EA 4RNFA 3M0ZA 5FJUA 2P0IA 3CMGA 3RM8A 2FVMA 4WKFA 1PPIA 1XIMA 4DIAA 4HZ6A 2MUCA 4MY9A 5K2ZA 1GKPA 5CEWA 3BLDA 3TONA 3A64A 2X41A 1R3VA 4GUGA 1TJ1A 1K7XA 3CGBA 1LOSA 1TMLA 4OKDA 4V33A 1OYAA 1T40A 1PTAA 4S3DA 3HV9A 8TIMA 4S38A 5FI8A 1EP3A 4K37A 4LCSA 1Q6OA 3F7JA 2W9MA 3GBEA 2HMCA 1MEIA 5A3HA 1OQFA 2TYSA 2Z24A 3A7UA 3A4WA 5HPOA 4Y7EA 2RABA 4KIRA 2E8ZA 3W7KA 3ES7A 1ZB5A 3QQ1A 1G69A 4J2PA 2EKCA 1K9TA 4UOJA 2RUSA 4U3AA 2GQ8A 3HPXA 4WY0A 2FH8A 2GOKA 1AQHA 2PTZA 2WJZA 2NVAA 5HUPA 4DF1A 2C3ZA 4E2DA 2G3NA 1WBHA 4KIEA 3LADA 4MWAD 5JCKA 3NUKA 4M81A 4GK8A 1O66A 3OLIA 1MFUA 2YBTA 3VOJA 5DY2A 3BZGA 1HVXA 4JFUA 3ZSTA 3HPZA 1GQLA 2ZX8A 1TUFA 1IXNA 2WZIA 1OX4A 3WNNA 1U22A 1GQKA 3WK2A 2XIOA 1M6IA 3KTXA 2PWVA 4L4PA 3GIPA 3M64A 1EDTA 1LT8A 4N2YA 3W1PA 3CWOX 2OYKA 2JALA 3MP5A 4D72A 1XG4A 4IFKB 1LORA 4RZ5A 1WZKA 3S4TA 2R91A 4JTDA 4MYAA 2VWSA 1E9ZB 2PDNA 1KWGA 5A94A 1M7JA 1V7AA 4JHMA 4KEUA 1A5KC 3VOCA 5H8MA 3I10A 1KGXA 2J62A 2EGZA 2QHAA 4M56A 1BYBA 1EPVA 1I9CB 2RDXA 1CXIA 3CNYA 3NZGA 1US0A 4BF9A 4YTUA 1R8LA 3C6CA 1NWRA 3O06A 1VYPX 5FKYA 2VC5A 1DXFA 1JD7A 3JUGA 2R8WA 3PB2A 3DYPA 3ZLGA 2QJNA 2UY5A 5GPRA 2W67A 3MCOA 3U0HA 4XAFA 1ZQ5A 4IUOA 2INFA 3O3RA 3EOSA 3AJXA 2WKGA 1K4QA 5LNRA 3WQ8A 4BQ4A 1F2JA 3P74A 1QPQA 3ZSSA 5GJPA 1BG9A 3HGRA 1RA0A 2E9BA 3UPMA 2F38A 1C9WA 1LRNA 2OOGA 2ZZ2A 1UIOA 1Q65A 4F9JA 2E5AA 1LUCB 5K9DA 2A4AA 2HE5A 5JH2A 4RNJA 4MIMA 1DWHM 1A47A 2H8XA 1H6VA 3BC9A 4NJGA 3LSBA 4PUJA 1W5MA 1FEAA 1KO0A 2GQ9A 4GY1A 1S1PA 4LCRA 4FNUA 2OCZA 3UWVA 4BWLC 1FFRA 1KR1A 4D6FA 2ZVIA 4P8WA 2XVKA 1XSJA 2WOIA 2GR0A 3TK7A 1UH2A 1CLXA 5CPSA 3FAWA 3W85A 2FPTA 3HGSA 3N73A 2JFEX 2DQWA 1G5AA 1PB0A 4JIQA 2H9AB 5C9RA 3WDJA 3W7PA 4R9OA 1R9ZA 3RYSA 1JZ4A 1H7WA 2ZZCA 2GJLA 1L9WA 4H9XA 4PZVA 4UTJA 5EB8A 3CAQA 1M1BA 3C0LA 1G0CA 4H41A 4QBXA 3G6LA 1RY0A 4H6KA 5HA7A 2PUZA 3R8HA 1TJPA 5D33A 3UR8A 4DJDC 3H6OA 3DHUA 3KWSA 3PUGA 2V38A 3NQEA 4JYFA 4KESA 4MFEA 4LS1A 4BEQA 3P0WA 4P61A 4XTDA 4ICCX 3RRXA 1WP6A 4L9ZA 4Y9OA 4I9JA 4IT1A 4CEXC 2QF7A 2AL2A 3DU0A 3VGHA 1KBKA 1QK0A 3SR7A 3QV9A 1P0NA 2XH7A 4YU1A 1YBQB 3R0KA 3IK2A 1DWFM 2YVJA 2NSXA 1UZDA 3GHSA 4LNCA 1VQZA 3SN4A 4PMDA 5LNSA 3UG8A 4KKXA 2J7DA 4CU6A 1TIWA 4RW3A 2CFYA 3ARQA 5AY7A 2DZTA 4L5ZA 3M0JA 3URQA 4HZ8A 4I7WA 4UNIA 4DNHA 1QNVA 3GC2A 1T7LA 3G2GA 1TPEA 5FACA 4WJXA 3JU2A 1NFGA 1OX6A 3ID7A 4NZ3A 3HBLA 4GI9A 1ALDA 4J3UA 1FWFC 4M52A 3EPMA 2QAPA 1CNVA 3CJPA 3CQHA 5CZSA 4JR5A 1H60A 2DQXA 4Q8UA 4CKQA 2OQLA 1POKA 4OE7A 3NL3A 3TN4A 2QCHA 3VIHA 1A4MA 4ADSA 3UYIA 2C15A 3T0CA 5HNTA 1XYLA 4BY3A 1T99A 3NVZB 4ZSTA 3CM4A 2VWTA 2W79A 1NDVA 3DKLA 4QFUA 2FZNA 1F3XA 1F4HA 3PJWA 5I3GA 3P82A 5AHIA 2E25A 1RQHA 2EKGA 1EUNA 2FLIA 3H2MA 5BOOA 4UTHA 4WR3A 4PTWA 1SMDA 3PJXA 3KLLA 3W1MA 2W55A 3LSCA 1KGWA 2XIBA 4M1RA 4WQ6A 1C90A 1GV4A 1H3GA 4UTLA 2FB3A 4GCXA 3VYLA 2A3HA 1AJZA 3PZOA 3W01A 1AODA 3AHXA 3P0XA 3TN6A 3OTRA 1NU5A 2W61A 4CQAA 1NPXA 2OLAA 3T81A 4W89A 4QE4A 2Q09A 3UEQA 2G3JA 2DW6A 2J8FA 4WCJA 4FNQA 4KFOA 4AW7A 2XFWA 2P10A 3QSTA 4TV6A 1CDGA 3W7NA 4GVIA 4BV6A 3GNRA 4FOJA 4OVXA 4C65A 2GVYA 1TMQA 2ZBTA 3BLPX 3EWWA 5TAOA 4NX5A 4AD1A 2X1IA 3UETA 3JZUA 2PAJA 2WZTA 3PN8A 4B5VA 1M7XA 4CD6A 1OEPA 4XISA 5BXSA 1XRFA 4ATLA 3SCQA 5D9OA 3F1QA 3CEUA 5T8GA 1SUXA 1E4NA 3GD6A 4WKAA 5MF5A 4UZSA 1KFEA 2W54A 5EA9A 3GC4A 3C3NA 3CGCA 3T8LA 3L4YA 2JGYA 5HMEA 4M82A 3RU8X 3GVRA 3LY0A 1PYFA 4TMBA 1FFVC 5ABFA 5TQLA 5CPMA 4IIBA 4EAYA 5HUOA 1EX1A 1KM1A 1X38A 2WSKA 3ECQA 3UWYA 1R9YA 4TO8A 2GL5A 2BY1A 3MUCA 4ZOAA 3DH7A 1QI2A 5C6MA 3ITYA 3EF6A 2WZEA 5T91A 3WDQA 1FH8A 1K8YA 1J93A 1SZEA 3WQPA 3FVMA 4DAIA 1F5ZA 1AQ0A 4KWVA 2QCMA 4BK9A 1TV7A 1W91A 3E38A 1UIPA 1LG2A 3L67A 5A6BA 3WY1A 1A5CA 5F2LA 2GLKA 5CSYA 1QNRA 5M03A 1UWSA 3CBWA 2GK1B 4FXRA 4YVXA 4QSHA 1RZMA 4WLCA 4GZIA 1XYCA 4DJED 4KMQA 1H50A 1W1IE 1L6FA 3NQ6A 3LDVA 3QC0A 3DFQA 3QFEA 3WMLA 5EPDA 4RV8A 4NUWA 3BVJA 1F3EA 2NXGA 1V0LA 2ZYFA 1TMHA 3MI2A 4GC4A 2OEJA 3R7MA 2FHBA 4QJ1A 3STGA 4WRHA 1DQWA 5LNUA 1T3QC 4LJ3A 2IQTA 3S83A 3V0UA 2ZX9A 4GHRA 4UQAA 1OFPA 1UROA 1H4PA 1GVFA 3GAKA 3GTFA 3PTKA 1J96A 4ZQNA 2QAEA 4OBSA 1Q6FA 2QLYA 4EPEC 4PTMA 3RAOA 4LALA 5CSSA 1VD6A 3EUB3 3QBUA 1E6QM 3TYAA 4GKTA 5DMMA 3V4BA 3LENA 4CD8A 3GW3A 2JKPA 1EGVA 1T8XA 1KKOA 4J27A 5CGMA 3PB0A 4HPJA 3QTPA 5DCBA 2YSWA 1PUDA 2C8NA 1CXEA 3AN1A 4MB1A 3CL7A 2PDKA 1GYNA 5DCDA 3C2YA 1T8QA 1F74A 2WCAA 1LLOA 3ONBA 1DE6A 3B8TA 4GA8A 3SM0A 1W9PA 1UMLA 1HF6A 4EM3A 2C1GA 1Q8JA 4ADUA 3IJ6A 3QV7A 5GNXA 2CBIA 1P0EA 3LX9A 3C0JA 3B03A 2HBXA 2GJNA 1SFTA 3W9ZA 1XQKA 1SFLA 1VFHA 4H00A 3BAKA 5DMLA 3TSMA 1W1YA 4IQDA 3AYVA 4ZO8A 2ACQA 4J3SA 5LXEA 1GVEA 4FXFA 4Q8OA 2VC7A 2AMGA 3WQGA 3KRUA 3W00A 2OQYA 1NHQA 1CCWB 2BHUA 4YHEA 4F0KA 1NAL1 1AW2A 3WUEA 1RK6A 4GVFA 5CPOA 4P5UA 3VFLA 3MSYA 3VOIA 4ZTYA 5AC5A 2EPNA 3ME3A 2CBJA 5GRTA 3C52A 1GOWA 3TUUA 3EWCA 3GDLA 2V9DA 3GIYA 4WK9A 4ZR8A 5DLCA 3EXSA 5FD0A 4B2DD 2E68A 2EAWA 3M5XA 5E93A 2OX1A 3V5FA 4RPPA 4S3GA 1J11A 3AXXA 3MKKA 3RITA 1Q45A 3ARSA 4G56A 3SY1A 3QTGA 1S2AA 1JUEA 4F2TA 1VBGA 3C61A 3DH9A 4UCFA 1VCFA 3F5KA 3W7OA 3ITOA 4RCXA 3HA1A 5FS6A 3WX7A 5D2VA 4ICNA 1GRTA 4GI4A 3I7RA 5H91A 1TKKA 3W4RA 1TJRA 4TU1A 2CZVA 1OGBA 2NT1A 2HSAA 4MB5A 3ITCA 1V4YA 2P3ZA 3G1SA 4B90A 2WPBA 4QLKA 1V6YA 3TDFA 4NYYA 1Q2SA 1RVGA 3EXTA 1LBMA 3MCMA 3A23A 4I9TA 1UWTA 6PTDA 4OTKA 1VEOA 3EOLA 2PDJA 2XN0A 1K3UA 2NV9A 5EMUA 4GUFA 4H1ZA 2PS2A 5CJMA 1NP2A 4JIRA 1FWGC 3CPRA 3I7SA 2QS8A 3QF0A 4AQLA 3KOZA 1VAHA 3N4FA 4H3DA 4NF7A 3QLLA 3TW6A 5DEZA 3FYPA 2YX0A 4GD0A 3DG7A 2CWNA 5M1TA 2P8CA 5HQMA 3VM5A 3VGEA 3PPFA 2W0UA 2DW7A 1I45A 1EKOA 4EOUA 3OHMB 3GG1A 1OC7A 4FOKA 2OWCA 2V3EA 5D2WA 4I9MA 2ZXBA 1AOGA 1VENA 2GR1A 3LI0A 1I6NA 3F5JA 3UWUA 2PRLA 4PN2A 4UR9A 3EOOA 1FEBA 3THDA 3UCCA 3VDHA 3IIOA 3B05A 1TELA 1E1EA 1FWCC 3FS2A 1QNOA 4IGMA 4YTRA 2BZNA 4O1EA 2CLHA 4ACZA 2AQWA 2G3FA 1QW8A 1TV8A 5BROA 4CGTA 1JPKA 2J78A 2WZHA 3O63A 1GXFA 1UOKA 2VENA 1VPXA 4JL2A 1EBGA 1EL3A 4PMXA 1KM3A 1YDNA 4ZENA 5H1WA 4Y9MA 4ERIA 1LROA 5A8PA 3KBVA 1TE1A 1VHNA 3NPUA 2V0TA 1XLIA 3OEXA 4GVHA 1GOIA 1XD0A 1DWJM 4KGLA 4XQ6A 5I00A 3SQLA 1ZP4A 3B97A 3WLNA 2B4GA 2NVDA 1JAKA 1F7BA 3O6DA 4BJHA 2ZRYA 1TQJA 4IH3A 4Z2HA 3VZZA 4RL3A 1EBHA 1W2VA 3VO0A 3ZS4A 1JZ5A 5BU9A 3UCDA 4AZHA 1LZOA 1TYTA 1YTKA 3MKCA 3PJUA 1TR1A 4PEKA 3EWZA 2V67A 3W2NA 4EPDC 4CNUA 1H5YA 4ZOEA 3TA9A 3JR2A 1SQ7A 1T96A 1DIKA 3L12A 4GMEA 4L9XA 3AMCA 3LNMA 5DXXA 3G1DA 4J3VA 2RGLA 5FSDC 2GGGA 4F8XA 1S1RA 1RBOB 4O8AA 4QCFA 3K8MA 1ZLPA 1S5MA 3S6DA 4Q3MA 3TAOA 2IKJA 4MY1A 1WAWA 4CN6A 4O4VA 2O7QA 4IHCA 2NQJA 1MQQA 3BLLA 3S2LA 1ZPTA 1AMYA 4P8XA 4B5UA 4I9AA 1YE6A 3KVLA 2XFFA 1KWKA 3C8FA 4GACA 4NJKA 2CITA 1IXPA 3UP8A 3GSMA 5A95A 1R3SA 3G3MA 2FHCA 1WKFA 3SGUA 4O16A 1V6WA 3VNIA 2BXVA 4RDYA 3RM4A 5CPLA 5I07A 3LV5A 2ZUVA 4JGDA 3KBSA 1DPMA 4LY4A 4OT7A 4O11A 2GVLA 1XLLA 3NQBA 3N2OA 4ZVJA 1IE7C 2CW6A 4EP8C 1AK5A 4C5YA 1ZAHA 4FEZA 3IVUA 4H19A 2WHMA 4PUEA 2DVUA 4J5NA 3KTSA 1XINA 4I3GA 2AQVA 4E8DA 4EM4A 4Z42C 4KBXA 3GUGA 2JF7A 1DP0A 2WC4A 4TVDA 1XHGA 3AWNA 1J5SA 1UC5A 4HJWA 2EBNA 3MCNA 4E8CA 1VFLA 1UKSA 2FH6A 4LFYA 3TOYA 5CLWA 1QHPA 4D8LA 1CXLA 4QLLA 3N9RA 1P43A 2BLEA 4OFCA 3ARYA 3GQYA 1YRRA 4E4PA 1OWQA 3OLGA 4DXKA 3TKFA 1QBAA 4AZ5A 3AHZA 3UWEA 3GG7A 1H09A 1DJWA 3E0WA 4D6HA 1QATA 4B91A 2YYTA 1EB3A 3VDGA 4AHOA 4L1XA 4PODA 5F1VA 2FB2A 2VD9A 4H8NA 4X0VA 5K4ZA 1J5TA 4TQTA 1PL9A 1OCJA 3EBVA 2EPHA 1GEQA 1IWAA 1JPHA 2WZMA 1WXJA 2ABAA 3DXIA 2XINA 4ZQMA 2OZ8A 4HNVA 2QVHA 4FI4A 4UC5A 1BGAA 3CUHA 3LMYA 5A8OA 3FEQA 3S5NA 1NM9A 4O0QA 4L80A 3BAYA 2YZ5A 2J7FA 2D0FA 1UKQA 1CGWA 1QUMA 2DSZA 1Z41A 4A29A 4XZMX 1CTNA 1FWSA 4D2JA 1EXPA 4C1KA 4EANA 1CB2A 2Q3OA 4QG8A 3ELFA 3IANA 1X1OA 5J8LA 3QMTA 1JRPA 1DJHA 1Q5MA 4C60A 4IQLA 5IOBA 4DXXA 2PBGA 2VYOA 2YZRA 3PF3A 3H24A 4MNJA 3SCRA 2DPEA 3WLKX 4YTTA 4GO9A 3R58A 2E9LA 4M6QA 3CU2A 3JZEA 4GZJA 3W71A 3H4GA 2BP1A 1FUYA 2DZUA 3PY2A 1KCZA 4M7TA 2YVFA 5M5DA 3CQKA 1AZ2A 4AZ7A 3QOMA 1F6KA 3FSTA 1L2QA 3U5YA 1GREA 1JDCA 1C8QA 1G4PA 3AC0A 3FJNA 1GJPA 3CHFA 4W88A 4FALA 7ENLA 3OGVA 5M17A 1WE5A 2C3DA 3E2SA 4AU0A 4LRSA 4NX0A 1MZRA 1Y65A 2OVLA 3NA8A 1F76A 4DXVA 3ZR4A 3PBVA 2C0AA 1HJXA 2GGIA 2ZA1A 3SN0A 4IIHA 1RP8A 4H9TA 1E15A 4DUVA 1S5NA 5A6LA 3WSUA 2QMKA 3PPGA 5ABTA 2YCJA 2PZ0A 3BUVA 5DRCA 5TBOA 4MNMA 3WDHA 1W3JA 2XIQA 1G7VA 4LC6A 1PVNA 3R13A 1DWAM 2WHJA 5U7SA 4N6FA 1A0EA 3B0XA 4LEFA 4XKYA 1AD1A 3CQ0A 3H7UA 3TROA 2ZC8A 3QV6A 4WEVX 1SZNA 5CXPA 4PUWA 5DELA 1KFBA 3MZNA 1SB3B 2GWNA 4XSMA 3UXIA 1HQTA 4GINA 4FMVA 3DGRA 1OABA 1XH0A 3W6YA 3CLWA 3QEZA 4H4WA 3P8JA 1K8XA 4AZCB 1CGUA 1N55A 4F2UA 3U57A 1XDIA 4A3RA 1QBBA 1WXZA 4XZLX 1BZLA 4C6QA 2FDMA 3QMSA 1KFCA 4HU0A 2WYSA 3GDRA 3CGEA 4MAVA 3PPCA 4GFSA 3M5VA 2WSQA 2Y62A 4KWUA 4NI3A 5I02A 1W9VA 2ZX7A 3EA3A 4G2DA 1ZNNA 3VKCA 4JL1A 4OQVA 5M2FX 1QWKA 4C1NB 2FHFA 4LVGA 2EJAA 3XIMA 3CIXA 1VQTA 3GVQA 4GUIA 4O0ZA 2PURA 1BHGA 4GQBA 1CBGA 3ZLFA 3L4ZA 1R9XA 1SW7A 4X3ZA 3PM6A 4EQRA 4E2VA 2X09A 1H51A 1KD0A 3OBAA 4K8HA 3RPTA 4DB7A 3GLCA 3MSGA 2Y7GA 1FWEC 4DO6A 1FCBA 3V3WA 1KBBA 4EMIA 1BRLA 5T9BG 1QMLA 3SRKA 1OFBA 4F0HA 5C5YA 2P88A 4JXCA 5DT5A 2V3FA 2H9AA 4OJYA 4GYKA 4TX8A 1OX5A 4OU1A 1BGGA 4FNTA 3EX2A 4CQ9A 3CXBA 2V8ZA 4H7VA 2ISWA 1OC6A 4M8UA 4HPNA 2YA0A 1MEWA 1ZALA 1SYTA 3TTOA 4C5ZA 1FWAC 4JYEA 1YQ2A 2PTYA 3P5ZA 3CUFA 4QDWA 2UY3A 1XSIA 5KITA 3AIVA 6CGTA 1WNOA 3GRIA 3BW3A 3MV01 3FX4A 3RX2A 2J25A 3S5OA 6REQB 3LHWA 5EYWA 4B5TA 2Z6JA 3QPZA 1FRBA 4N9DA 1OJXA 5A8NA 2YB4A 3NXFA 1JF6A 3CHEA 3KE0A 1N5WC 3ZJ8A 3P84A 1BYAA 2JEQA 2W3SA 3MWAA 5CAHA 1K70A 1VFMA 1H63A 3NPWA 4X60A 5CC7A 2VCCA 4GJJA 4KCVA 1VFOA 4C6PA 3ITGA 2H90A 3GFZA 3B40A 3VD4A 1SR0A 3ZJ7A 1V0MA 1EA9C 3QQ0A 2ZC1A 4IPNB 3E2RA 3U6WA 1G01A 4QQ3A 2IMRA 3G18A 3E0LA 1ISWA 2VDGA 3HF3A 1FHUA 3I3EA 5B7YA 4WZHA 4ROQA 2WXDM 2PWHA 1XGZA 1QASA 3CL6A 3KBNA 3N29A 1FX6A 2RGMA 3DN5A 2Y0FA 3BAJA 4NJIA 1UH3A 2OT1A 1H1ZA 3PHAA 2VRKA 2A5HA 1MW2A 3WMBA 1UUQA 1US2A 1VBHA 3VVGA 2ZX5A 4B16A 2YVGA 4CU8A 3E49A 4KCTA 1BQGA 3PULA 2O56A 1OGGA 5D2XA 2CYGA 4XD6A 1O1HA 4NVTA 2VO5A 7ODCA 1XFCA 1TTPA 3D3AA 3TWAA 4BI7A 3HMJG 1TTQA 2P50A 3T9PA 5REQA 1JI1A 4MYXA 4JDBA 4CVUA 3NG3A 1PEZA 1J4EA 1WOAA 2YL8A 3LM7A 3L9CA 3EX4A 4RE3A 1B57A 2V3BA 1E6XM 3NQMA 1YKWA 4LUYA 1Q7QA 4YXGA 1JR1A 3NPVA 1EOMA 2UY2A 4OV9A 3N6JA 1AQMA 4IL2A 3DOPA 1T6MA 1HO1A 4KCWA 3GDKA 2QUVA 3WLJA 3W82A 1IGSA 4L4OA 2WVTA 5HULA 4GXWA 4R53A 4K3ZA 3TAKA 3RLUA 4JTJA 1E6NA 4BCEA 3TTYA 4U31A 4GRSA 3CIVA 1OF8A 1KM2A 2CLMA 2VZSA 3UWWA 3FCPA 1UWIA 3BTNA 4ONVA 2YL5A 3WD0A 3PUEA 5E0CA 3GKAA 3S2CA 2QPSA 4YN5A 3RRAA 2X8HA 4RE0A 2F7FA 1OCNA 3CV7A 3FJLA 3EANA 4XZNX 1WYGA 1RSCA 1ZBKA 3CQIA 4YYCA 1OB0A 4JIPA 2RAGA 4UFJA 1K4GA 1A49A 1E4LA 4O10A 1JNEA 1SGJA 3WLOA 1RM6B 5IBXA 1M9HA 1L6YA 5HNNA 3AZSA 1A5OC 3PG6A 4RZ4A 1H2JA 1E0WA 3DDMA 2R14A 2BY2A 3BV4A 1UR9A 5HMFA 2CHRA 3F4CA 1JFHA 4LAKA 1FDYA 1PZ3A 2F6UA 3CS2A 1A5LC 4P7OA 1PHWA 2IPFA 2V5DA 1GT8A 5E0KA 3UFYA 4RXFA 2YL9A 2BB0A 1J0HA 4JZ5A 2ZDRA 4CEUC 3UZYA 3AWOA 4Q8VA 4E2BA 2HRWA 4H4RA 3C8NA 5DRIA 1L2UA 1LRTA 3QZAA 4OZOA 3LHYA 4JQ1A 2V5BA 3RO8A 3EWXA 2AKMA 3UXKA 5AOUA 1M68A 1UHVA 1FIQB 1GERA 4EAMA 4AVFA 4H6QA 5C2CA 1JCJA 4W84A 4N42A 5JU6A 2HNHA 4AVOA 3DGBA 2AQOA 2PRHA 4G1KA 3D0CA 1AH0A 2OEKA 3IGHX 1GOOA 1KCLA 1XP3A 3E02A 3AMKA 3QM3A 3VKDA 4CU7A 1SJBA 1JULA 2AL1A 2NVCA 3KDOA 3MUAA 2WPGA 4IPIA 3P8IA 3DFNA 5LA2A 3DC8A 3DG3A 4IIDA 3T44A 2GPTA 3N34A 1F07A 2O92A 2FGZA 4S2BA 3KOWA 3NL2A 4AWEA 3BG9A 2XZ9A 1X6NA 4G1NA 3UBPC 1XLJA 1AW5A 1CEOA 1TCMA 4R7JA 5JMUA 5LXXA 3BMVA 1EO5A 1QW7A 2V2HA 2WWCA 2FYMA 3GZAA 4Q8NA 3W0KA 3OVPA 1EFZA 1MQPA 3QY7A 2ZTJA 1LP6A 4US6A 1CXKA 3Q37A 1PKNA 2EQDA 1HJQA 2JK2A 4WDXA 3ZO9A 1IQ8A 1HKJA 1XBYA 2ZZ0A 2WMKA 4GPNA 5CZTA 1FA2A 3KXQA 3T0TA 3OLEA 4E4UA 2XDFA 3EEZA 1J6OA 3QQWA 3O8AA 4B5WA 5BWFA 1V6TA 3TC6A 1UP0A 5EKYA 2VZOA 1UR2A 1E3ZA 3FGCA 3AXIA 1AUSL 3TMQA 4JY9A 2UWFA 2Z2BA 1VCVA 3BMWA 1YNQA 1TTIA 3RHGA 1VJIA 1QOQA 1CZ1A 3N15A 4DO5A 3O05A 1Z9AA 4PCFA 3M0MA 1RLDA 3BOXA 3S5ZA 1U30A 4OGZA 4AB4A 3BGGA 3W72A 3MP4A 3BJFA 2C19A 4OUEA 2GFTA 2V6AA 4HCDA 1RJRA 1PBGA 3AAMA 2A1YA 3AIUA 1FH7A 3QSRA 2AMXA 3D5HA 1PIFA 4PYSA 1VYSX 3V16A 3VIJA 2BY3A 2A0NA 3MT1A 2BC0A 3W81A 4XUYA 3KHDA 3DG6A 2VOTA 3GYCA 8XIMA 3CV2A 4Z08A 1BQCA 1QOPA 5LNWA 1R30A 5AC7A 3IJLA 2OXNA 1A0DA 2QZRA 2YBVA 5AYBA 3W53A 2PWEA 5G5HB 4HCHA 1SSGA 2HROA 4PMYA 3A22A 1ELSA 5A8QA 4O28A 4URIA 3D47A 4OBTA 1B30A 3W1AA 2O0TA 4D6GA 5AC4A 3QVQA 3UR5A 2WPFA 2Y63A 3AZTA 1ME8A 1E1FA 1X8FA 1RQEA 3WLHA 3MS8A 1GONA 4DWSA 1NDWA 7TIMA 1GHRA 3LB0A 3IRSA 3M07A 3ABOA 1XISA 3SUUA 3A7AA 4PBFA 4H6EA 1OFDA 3M0VA 3U7BA 5U1OA 2NUXA 3FXYA 3SR6B 2BOGX 3W7DA 1Z7AA 4YIWA 5LNVA 4LBUA 1B3ZA 3N2XA 1B5TA 3ZOAA 1R85A 2V63A 4JEQA 3G1VA 3LHVA 3QKZA 3TTSA 3AUOA 4UNKA 1V6XA 3K8KA 2POTA 5FL0A 1JYWA 1A5SA 1AL7A 1XLBA 4QSFA 2D73A 3LBCA 3L66A 4HBKA 2WLYA 1E70M 3OBEA 1J6PA 4U2ZA 3NVDA 3CUIA 1MMFA 2OTDA 1E40A 3SUWA 3DHDA 4DN1A 2AL2B 4IJRA 1UKOA 4O15A 1PKYA 4N6EA 2I14A 4HJFA 4RXGA 1YPFA 2W0HA 2ZUTA 3S2NA 3S6OA 1V3HA 5G4WA 5C7VA 2ZFAA 3W73A 4P8VA 3IJ7A 3A4AA 2PB1A 5G5GB 2PD5A 2NX1A 4H9ZA 4N4PA 4FX9A 3IAQA 1JCYA 2VEKA 4DZAA 2DEPA 1UZ4A 4IQJA 1GTEA 2OX4A 3PUDA 4C6MA 4BURA 4B92A 5H6HA 3E6EA 2OGJA 1RD6A 2IPJA 3OW1A 2G8ZA 1NVMA 1GVRA 3HQ1A 2BGSA 1FCUA 4H4YA 3ABXA 3MY9A 7CGTA 5M3WA 1TB3A 4LVDA 3SRFA 4YLWA 4RK8A 1VEMA 2I9EA 4LIIA 1G67A 3E5PA 4XAPA 5D37A 1FCVA 2A6NA 4ROPA 4GYJA 1DJYA 2W3ZA 3R0UA 3GBDA 4POCA 3EEGA 4GRTA 2PPGA 2WV8A 3NDYA 2EF9A 3W7HA 1TV4A 4QAWA 1ZFJA 2DSWA 3MMDA 1KXHA 2PTWA 2QCLA 2OJPA 3WFAA 4M5PA 4AWUA 5KINA 5HR6A 3S1UA 3CZGA 4DM2A 1FCQA 4C6DA 1FWJC 3OPSA 2VI0A 4QAIA 1XKJA 3AMDA 1QPNA 4ASTA 2JEPA 4GOAA 3NURA 1E73M 2V5LA 1JGIA 1TUXA 3P62A 3DCPA 1DBTA 3GDMA 4HTBA 2Y1HA 3WNOA 1M53A 2YXOA 5JUVA 3BQ6A 5A6JA 4A6GA 3IGSA 1BYDA 1NJJA 1ZGDA 1EJWC 5C54A 1UA7A 1DJZA 5XIAA 4EQSA 2YDAA 2YFNA 4L61A 3LLXA 1XICA 2J75A 5I78A 3CMFA 4NZCA 3WDPP 3UWZA 4WXZA 1YMYA 1ISYA 5AHLA 4YMZA 3T4CA 2VDHA 4DZIA 4PFHA 2FMNA 3L4UA 3DFHA 3I6TA 4TMCA 1JL8A 4MDPA 3SGGA 3LGEA 4G7FA 1A3XA 4DUXA 1UASA 2VNCA 3W7EA 2GVJA 4XBJA 1U5JA 1XIHA 2XWDA 1XLEA 3BOFA 1ITXA 3TJIA 3NVYB 1UCWA 5A2AA 4AF0A 4M80A 3SW6A 3P6LA 4E2OA 4WUIA 2EG8A 3PZNA 1EQCA 1WXYA 2ODOA 1ZBWA 3GH7A 3TFXA 2HPMA 5HQLA 1GRFA 2DUZA 4FNPA 3WQWA 4HA3A 1K02A 4HD5A 2QR6A 3V36A 2W63A 5AVNA 3QFAA 2D24A 3DUGA 3DBPA 1R46A 1VB9A 3A9BA 3WLSA 1JXJA 1A50A 3GTXA 3LB8A 3AS0A 3HU7A 3BAXA 3IAPA 4DY1A 1QNQA 4HN4A 1TRIA 2ZA2A 2OR2A 1B3OA 4GUJA 3S0CA 1RUSA 1QHZA 2PA6A 4UFLA 1V51A 4W7WA 2QUUA 2YR1A 4K39A 3GVWA 4LUSA 4AAJA 1HP4A 2WO5A 4U4MA 3R4IA 3UJRA 3H2FA 4PMQA 3K5XA 3QW4B 4NL1A 4W8BA 4OHQA 2GH5A 3DYOA 1ZS2A 5AECA 1UC4A 4ZOHB 4TXEA 1XIIA 3HZ3A 3N9KA 1QXLA 3LTPA 4KW2A 1GVIA 1HG3A 1VYRA 1GW1A 1EJVC 1NF0A 3QV8A 4MZ1A 1J2BA 2BVDA 1WDPA 3ZLHA 1QRQA 2QDHA 4JKLA 3NO3A 4K36A 3FN9A 3K46A 4QGCA 2BOFX 2EQ7A 4CLMA 1U1HA 3LZ5A 3M1ZA 1GZGA 3I4KA 4JDYA 4XZBA 2FMOA 5C0QA 2A3EA 4MZ8A 3FJ6A 3DJJA 4S1FA 4CN4A 4WDWA 2IW0A 1ZKQA 4LF2A 1VIWA 3VIIA 4DLFA 1OC5A 4NRSA 1YXDA 5I0DA 1TZ9A 1EZWA 8XIAA 1XV8A 3T40A 3H2CA 2UBPC 2V3DA 5FS8A 1Q3NA 3PFMA 1S2UA 1NP0A 2G4FA 3RLGA 2X2GA 3FDGA 3HQOA 3GU1A 1UQYA 3H53A 5LGXA 2DT2A 1V7YA 3UJFA 1PSCA 1UBPC 3W24A 3AOFA 1EP1A 3FV9A 3T8QA 4NIRA 2EPOA 4OOZA 2NQHA 3UWQA 2WMGA 5I6SA 3NO5A 3LRKA 4LV9A 4AZGA 3J7HA 3DGHA 5A5WA 3VC6A 1V3MA 1XDLA 1RJQA 4GI6A 3W74A 4D1JA 2ZIDA 1K9FA 3N2CA 2Y85A 4NI8A 2E9MA 3PC0A 5CBBA 2QGYA 1UKPA 5KSWA 4CNOA 1D2KA 3BAWA 2ZXDA 1PIGA 2XH2A 1W3NA 4GFIA 2D2JA 4GBDA 2I56A 3PZMA 5A6AA 1M41A 3RMJA 3H2OA 3EGJA 4S3CA 3CTLA 3DI0A 3MMWA 2J7BA 3PG8A 5I2UA 1ICSA 2PDCA 1SJCA 2GSEA 4Q4PA 3BSGA 1JCTA 2EPMX 5I3IA 1FP9A 5EMKA 3APTA 5HR7A 1JDAA 3DESA 1EIXA 1QO2A 5F2GA 2YOCA 3MZ2A 3STFA 3ARTA 3KS6A 4W8LA 1YXYA 4AD4A 4LVFA 1B0IA 4Q4MA 2C1HA 1VHCA 2WSYA 3TJXA 5IHRA 1FP8A 2PGWA 4R34A 2R1KA 1NHRA 3BWWA 2JKEA 1EC7A 3CPGA 1SPQA 4J3WA 7REQB 3RILA 3SUVA 5I23A 3FA4A 3B9OA 3OIXA 1TCDA 4H8UA 3TVAA 4Z17A 3VMPA 3UT0A 3OVGA 2TPRA 4GJ1A 5FA5A 3RJXA 5D30A 3ZT6A 1I60A 4Q8PA 5C7HA 1B2YA 3AHVA 4BFAA 2R94A 1BTCA 4F3HA 3OVRA 1KRMA 1LQ2A 2YA1A 2Y7FA 4R3UA 4LA1A 4AZCA 5I77A 3HFYA 3OZMA 1OG0A 2Z2UA 1X1NA 2QW5A 4LVAA 1DWIM 1K6AA 3P93A 3EMCA 1KC7A 4ZE4A 1OG6A 2DZVA 4FLQA 3W25A 1GTHA 3KRSA 3W2UA 4KFPA 1EJXC 2DV0A 4WJ8A 2X2YA 3RJYA 3AUJA 5FJJA 3PANA 3P2VA 2CZEA 5BOFA 1J9YA 2WM1A 1JRBA 1AZ1A 4Q4OA 1PJ9A 2Q6ZA 5FJIA 5HWNA 2VCBA 5CCZA 2Z29A 3OIHA 3BZJA 4H7ZA 4U2YA 2WBAA 1T41A 1QR7A 1XL9A 2C6QA 4A3QA 5EGRA 3LXBA 4TIMA 4ORIA 3R43A 3EKZA 4FB7A 1STZA 4Q22A 4IUGA 3TN5A 1CXHA 3HIJA 4M6UA 1EUAA 6TAAA 1KCXA 3ORWA 3MSRA 3WD2A 3AMGA 3U8GA 2VURA 1G4EA 4GJIA 2VUNA 2WMIB 4L64A 3BANA 5DMYA 4AMCA 4I6KA 4YNGA 4FP1A 3EMZA 3L0GA 4ACZB 1AJ0A 4O1DA 5D02A 2FQIA 5HWMA 1FBAA 3USBA 1AMKA 3I68A 2BVTA 4JBRA 4AD2A 1FWRA 3VABA 4KPRA 1JDEA 2WC7A 5DFAA 3MO7A 4C1LA 1XRSA 3WBAA 1VFTA 1YPIA 1D8WA 2GUYA 2PC4A 3DEQA 1V3KA 3KHJA 1DV7A 1DORA 3KLJA 3GH4A 1QFEA 1GYLA 1LL4A 1WZAA 2PZNA 3VMNA 5C8BB 4DJFD 2D0GA 3K30A 3ARVA 4MZYA 3NIYA 6REQA 4JQ9A 4RR4A 4DYJA 1B4KA 2Z26A 3N18A 3U2EA 4PC8A 1C92A 1D3CA 3WL0A 1HZYA 3LOTA 4EXAA 4LTSA 1P7TB 3MPGA 5H8PA 2O55A 3BLIA 3W7JA 2GR3A 3LQGA 2QVNA 4DZHA 2CLEA 3COTA 3O0FA 1OFOA 1KXTA 4XUGA 3W76A 4F0MA 4W5ZA 3U7VA 3G77A 2B7OA 3S8HA 1XCWA 1MXDA