2MUCA

Muconate cycloisomerase variant f329i
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
369
structure length
360
Chain Sequence
ALIERIDAIIVDLPTIRQQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELIGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MUCONATE CYCLOISOMERASE)
publication title Structural basis for the activity of two muconate cycloisomerase variants toward substituted muconates.
pubmed doi rcsb
molecule tags Isomerase
total genus 139
structure length 360
sequence length 369
chains with identical sequence B
ec nomenclature ec 5.5.1.1: Muconate cycloisomerase.
pdb deposition date 1998-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2mucA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2mucA01
4M6UA 4GYPA 4MKSA 2OX4A 3IJIA 3TJIA 3H7VA 4KWSA 2OQHA 4ROPA 3NZGA 4MMWA 2CHRA 3FV9A 5ENLA 4DN1A 4HN8A 4K8GA 3I6TA 3CB3A 2QDDA 3B97A 2PA6A 2ONEA 4DHGA 1JCTA 3UJSA 1SJDA 3I4KA 2PGEA 2XH0A 3CT2A 3QPEA 3K1GA 4G8TA 3PK7A 2HXTA 2AKMA 2QVHA 2PU0A 1FHVA 2RDXA 2P3ZA 3GO2A 3Q45A 3ZVHA 2OKTA 3CAWA 3GY1A 4J1OA 2P8BA 4JN8A 5FJUA 3TOYA 1JPDX 3DG7A 3UCDA 3U4FA 4A6GA 2POZA 4J3ZA 2QQ6A 3QKEA 3TCSA 1MRAA 3IK4A 2OG9A 3S47A 1TZZA 4HNCA 3DDMA 3VCCA 5BOEA 1F9CA 2AKZA 1OEPA 4YWSA 3DEQA 1XPYA 1R0MA 3PFRA 3BJSA 3OPSA 3SJNA 3ZLFA 3R1ZA 3V3WA 4DXKA 4KT2A 3R11A 3P93A 2PTYA 3BSMA 1L8PA 2PTXA 3OZYA 3H8AA 1WUEA 3RRAA 3VDGA 3RITA 4IL2A 3MSYA 1PDYA 4A3RA 1NELA 4FI4A 4FP1A 4H19A 4JHMA 2I5QA 4IL0A 2OLAA 1MDLA 2MUCA 3FXGA 3S5SA 4K1WA 2PGWA 3KUMA 3TW9A 3N4EA 2GSHA 1TE6A 4ENLA 1KCZA 3STPA 3GC2A 2ZC8A 1P43A 1SJAA 2P88A 3DIPA 4HCDA 3MY9A 1RVKA 3VA8A 4GGHA 2QJNA 5EU9A 2OVLA 1IYXA 3EEZA 3SN4A 4JN7A 1XS2A 2OZ3A 2QGYA 1FHUA 3OZMA 3P0WA 1MDRA 4HCLA 1P48A 3DFYA 2GGGA 4E6MA 4GFIA 4DWDA 3V5FA 4HPNA 4GMEA 3V4BA 2P8CA 7ENLA 3SN0A 1ELSA 3HPFA 1BKHA 3RGTA 1EC7A 2OFJA 2AL2A 3DESA 2XH4A 2AL2B 2PS2A 5FJOA 3ZLGA 1KKOA 3UCCA 2OZTA 3OTRA 2PODA 4KEMA 3UXKA 3T6CA 3UXLA 4GYPC 3DERA 1NU5A 3MQTA 3RO6A 3OP2A 1EC9A 4HCHA 2AL1A 1KKRA 3ENLA 1EC8A 3FVDA 4IHCA 3FCPA 3T9PA 1YEYA 4IP5A 4HNLA 2NQLA 4IT1A 3FJ4A 1PDZA 4K2SA 3NXLA 2PP0A 3UJRA 4H1ZA 1W6TA 3SN1A 3D47A 3ES8A 4GIRA 3QTPA 2XGZA 4IP4A 3TTEA 2GGHA 1EBHA 3H12A 4H2HA 2GGJA 2PPGA 3PWGA 3T4WA 1BQGA 3OW1A 3UJFA 4M0XA 3T8QA 3CXOA 3JVAA 2P0IA 3QLDA 3V5CA 3I6EA 4Z1YA 4IZGA 2HNEA 3JW7A 2DW7A 4E5TA 3GD6A 2MNRA 2GL5A 3IJLA 2PU1A 4X2PA 1TKKA 2FYMA 3SQSA 4DYEA 3BOXA 2ZADA 3R0UA 3IJQA 4H83A 3VFCA 4GGBA 2HZGA 3P3BA 4EWJA 3NFUA 3TWBA 3H70A 1MNSA 4ZA0A 3UJEA 3ES7A 3Q4DA 4ZCWA 2PP3A 2HXUA 3R25A 5J04A 5BOFA 3QN3A 3THUA 2PTZA 2OO6A 4DX3A 2QJJA 2PCEA 3DFHA 3N6JA 2QJMA 3ZVHB 2XSXA 1EBGA 3N6HA 2XH2A 4A35A 4F4RA 3MUCA 3FYYA 1SJBA 5IDZA 3DGBA 3U9IA 4MGGA 1R6WA 3UJ2A 1WUFA 1KD0A 3NO1A 2FKPA 3SSZA 3MKCA 3ZVIA 1ONEA 4G7FA 3DG6A 2GDQA 4Z17A 1DTNA 4E8GA 3EKGA 4E4UA 4HYRA 1JPMA 3R0KA 3SBFA 2PSNA 3VC5A 3MZNA 5FJTA 2GGEA 2OPJA 3CYJA 3D46A 3RCYA 3ZLHA 5FJPA 3RR1A 1E9IA 2PTWA 2GGIA 6ENLA 3PWIA 3R10A 3UGVA 1ECQA 3CK5A 3VC6A 4E4FA 2OZ8A 3JZUA 2DW6A 3DG3A 2OQYA 5FJRA 2PMQA 2XH7A 3TQPA 2PP1A 2QDEA 1SJCA 2O56A 3N4FA 4KPLA 3TJ4A 1MUCA 4GISA 3TWAA 3VCNA 1JDFA 3MWCA
chains in the Genus database with same CATH superfamily
1H0IA 2VCBA 1AZ2A 4H01A 4C6IA 2ZZ0A 3GAYA 3VOJA 1DJZA 2YW4A 2FZ8A 5E09A 2WOIA 2NUWA 1NDWA 1P7TA 2ZUMA 3FV9A 1KWKA 5HWNA 2QCHA 1J0HA 1TPUA 5EMMA 3AZSA 3CHVA 1X8FA 1J96A 4IOTA 5I3DA 1Q7MA 1WDRA 4JTSA 2INZA 5D9MA 3POHA 4CLMA 1EGZA 3WDRA 1TIWA 3K1GA 4G8TA 4UOJA 3AS1A 1QPNA 2WPFA 4CQAA 4PCTA 3WH7A 2D23A 1GQKA 3TN6A 1JZ7A 2I5IA 4NL1A 2DT0A 1AJ0A 4X60A 3FJLA 4AZIA 3NEVA 1RSCA 1YNQA 1XDJA 1NSJA 1IHIA 5AC4A 1OFEA 4A6GA 1HKKA 3KZPA 3NO3A 4Y8EA 4ADTA 4M1BA 4DJEC 2WZTA 1GYMA 3HM7A 1NHRA 1VPXA 4NX5A 5LGXA 1RLDA 2WLZA 1CWYA 1K6AA 2EXOA 5TD4A 3IJ6A 1VFTA 2ZIDA 4U2ZA 1X2GA 4GO8A 3BV7A 4K8HA 4AC7C 1G5AA 2ZZCA 4PB5A 3UW6A 3KL0A 2WOQA 2WPEA 1XG4A 3TYUA 4OUIA 3BC9A 3R1ZA 3OYXA 5CSYA 2HK0A 3R11A 4O57A 3EWWA 1MFUA 4GVIA 1L8PA 4YVXA 3UPMA 1WUEA 2DFAA 3LMZA 1NFGA 4AVFA 3OQEA 2CW6A 4NSBA 2YYTA 3KL3A 4TU1A 5C0QA 4C1KA 1O68A 2R1NA 3NQ6A 1V6XA 3S5SA 4H4RA 3IGHX 3N13A 1M3UA 4NAEA 1J0YA 3HMCA 2FTPA 3QYSA 5JMUA 1L6SA 2I16A 3W53A 2YDAA 4HCDA 2O9OA 2WKJA 2FMNA 1W3NA 2R14A 5BRBA 2P53A 4RKAA 1VD6A 2QJNA 1EJUC 4NNBA 4C91A 4ZE4A 1G9HA 1GKPA 2CU0A 2R8WA 3TK7A 1X6LA 4GO9A 2WXDM 3M46A 3MKKA 5CGQA 1MDRA 4HCLA 4JIEA 1JI1A 2Q09A 3LXBA 3KOWA 4HZ6A 2EPLX 1KGUA 1RJRA 3EXRA 1H1YA 3SI9A 3BZGA 3SN0A 3IJ9A 5DFAA 4MWAA 4B4FA 2QF8A 3C8NA 3DECA 1EC7A 1T99A 1E4MM 4URIA 2WBAA 1FBAA 5CPLA 1GT8A 1IR1A 1UH3A 2O0TA 1XBVA 3NVZB 2VQTA 1SZRA 5E0FA 1HL8A 2GVLA 4GXWA 4X0NA 1VYSX 2OZTA 4QSHA 3TR2A 5AFDA 2VKZG 4X22A 1OC5A 1UMLA 3RRXA 1KFEA 5EMUA 2EF9A 3AIVA 1OWQA 4IGMA 3IK2A 4XQ6A 2FLIA 5ECUA 1MWOA 4Q8PA 5KEZA 2J8TA 4JIHA 2GJLA 1PIFA 2WJZA 1XUUA 3MV01 1CT5A 1RY0A 2ZXBA 3NXLA 3UJRA 1FUYA 2AQVA 1VR6A 2FGZA 1V6VA 1JDDA 3P2VA 2OWXA 2HQMA 2OOGA 1FFQA 5HNNA 4MDPA 2WLYA 3LHYA 4XO7A 1HO4A 4P8UA 4WXZA 3QQWA 1UJQA 1QATA 4NXSA 2NUXA 1OT1A 3THCA 1EHNA 1BWVA 3KOFA 3A7RA 2DIEA 4IFKA 4U10A 2C6QA 2PTDA 4ZO9A 3JW7A 1GJUA 1NQ6A 1EJXC 2VP8A 2DW7A 3AYRA 3GZ3A 1M04A 2FJUB 3ARVA 4MUZA 3P8JA 4IFOA 1UUOA 3SM0A 2AQOA 5CPMA 3TH6A 5A8MA 1XUZA 1W9VA 3TQVA 3B40A 1E6SM 2ZTJA 3C86A 3BOLA 2F2HA 2OQLA 1OB0A 3NZ1A 4LAUA 1PWMA 4ASTA 4WZHA 1ZAHA 1WE5A 2GWNA 1WXZA 1CB7B 5A2BA 3EKLA 3KLJA 3NL2A 3UD6A 1Q7QA 3ANUA 1GOIA 4ZOEA 4DX3A 5HJXA 4UOZA 4N02A 4WY0F 3O6DA 3T1GA 1UKTA 1HKVA 4K68A 1W3LA 3RCNA 3TAKA 4F4RA 2GVYA 1G67A 5CXPA 1HUVA 3KX6A 1UWSA 3GHTA 1GYLA 2I57A 4GNJA 1E0XA 1DQWA 3GR8A 4J3SA 3UXDA 3M0YA 1H5VA 2BG5A 3W84A 4MUPA 3AIUA 1RPKA 5DMMA 3W2LA 3HZ3A 1P6WA 2JK6A 2TODA 3EWDA 3UR2A 1RP8A 1LRTA 4WKFA 3AU2A 1I8JA 2A7PA 2CLFA 3SUVA 4H4PA 5BU6A 4QDPA 2GUBA 5A6AA 1XLAA 5BWFA 1BEUA 1A4LA 1I60A 1V7YA 3W88A 4CU6A 1NEYA 1WDDA 3NYDA 4CQ8A 2BY0A 5C71A 2GVGA 1U1JA 3UGVA 1V6TA 3HV8A 4GVFA 3A21A 3CV6A 4H2CA 3LI1A 3JZUA 3NGFA 3WKZA 1E72M 3DG3A 3A3XA 2BP1A 3B0XA 1X39A 2VD8A 4KPLA 1F6PA 1K77A 3VOFA 1C8QA 4BQ3A 3R2GA 2C15A 5AC7A 4DWSA 2C18A 1NOFA 2Y4SA 5IBXC 5LA0A 1GVEA 3TJIA 3C2OA 4GLEA 5I06A 4QLJA 3W73A 3ANYA 3LNMA 3DI1A 1C8YA 3RM8A 1R46A 4MNKA 3NRZB 2GVEA 3ORWA 4KESA 4JCMA 1PKYA 1I1WA 3W28A 1IGWA 4MKVA 3B97A 4UQAA 5CBJA 4EWND 4YTUA 4V33A 1R2RA 3ZJ6A 3TN4A 4ZQNA 2WMKA 4DLFA 1XJBA 7REQA 1BSIA 1JRCA 3SY1A 1LG1A 4AEEA 1ZB5A 3RUBL 4FIRA 5K9XA 4EQSA 4RZ6A 3HFYA 5CC5A 4J35A 4JKKA 1JQXA 1NFPA 1R87A 3KOYA 3VGDA 1T41A 3H55A 3CGEA 4MB1A 1VFSA 2WVSA 4N9BA 4RW5A 1OJXA 3OVQA 5BXPA 3GVVA 1FTXA 3W38A 3PUEA 4CEUC 4ERGA 1R7OA 3U48A 3U4FA 2POZA 4J7RA 2CKSA 2NV9A 1XLMA 3ITOA 2ZZ2A 4WOZA 2PDGA 1Z3NA 1CZ1A 4UQBA 1V59A 4ZO6A 3QRHA 4XWUA 1BF2A 4IICA 3CQ0A 1RCOB 3EWZA 1B9ZA 2IW0A 1JAEA 3MI2A 2QAPA 2DJXA 4NZ4A 4F0RA 5J8LA 1AQ0A 4W7VA 3OHMB 2QUNA 3HJEA 4MY8A 1XSKA 4LT9A 4LRTA 4IP7A 5U25A 5GRTA 3EOLA 4GWEA 3P67A 3PFRA 4FR1A 4FALA 1WO2A 2R94A 3V3WA 4B4HA 3EX1A 3LLFA 1W2PA 1QPOA 1ZTVA 4ZXOA 2JBMA 4JTLA 4N4QA 1RQHA 3R0DA 5DXYA 4XBKA 1QR7A 2A3BA 4JYEA 1IXOA 1LQ0A 3S2MA 1A5KC 3UY7A 1J93A 4NZ1A 3GDLA 2WZMA 1XQKA 3A23A 2UY2A 2WSYA 2DZBA 3BWWA 5AHFA 4IPLA 3WQ8A 4L9YA 4UTTC 3IAQA 3I7SA 5CSRA 4GJJA 2HCVA 1PS9A 2PDMA 3WDQA 2G4JA 2XVLA 3E1F1 3U5YA 1UA7A 2PFHA 2E6DA 2Y7EA 4EMJA 1A80A 1UIOA 2P3EA 4BI7A 3KW3A 2C71A 4AW7A 1XIEA 3GDMA 2I7GA 3KM8A 2OSYA 3VGFA 1TJPA 3AXKA 1LOSA 2J6XA 3ZQ9A 2DH3A 4AVOA 4IX0A 3MJMA 4F0LA 4ZFMA 1EH9A 4JN7A 3PB0A 2V3BA 5BWAA 1V3IA 4HSOA 1BXBA 3O15A 1V0MA 3QSTA 5HXMA 4HA4A 3VU2A 2VJXA 4GQBA 3LGDA 4DLMA 4XAYA 1BG4A 1ONRA 3IIZA 3LBMA 2IQ0A 3PBMA 1XFCA 1XRFA 3VKCA 3TYAA 2VGBA 3BK0A 3C56A 2PDIA 4LALA 4JYDA 2VOMA 2VENA 2XSAA 2PLJA 3E5BA 3VOIA 2QCLA 1Q8JA 3ATYA 4OGZA 1S5WA 4UZSA 4XZMX 5FL1A 5FS6A 5D02A 2W0UA 4PL2A 4NYUA 3LB0A 2ISFA 4EXBA 4OFCA 4JIPA 2Z00A 3UXKA 3G0UA 1SZEA 1SO6A 4KFOA 4FSAA 4L7ZA 1HKWA 4K36A 2ZA3A 4N0RA 3WLNA 1E5NA 2YPIA 2H8XA 4PMZA 1EJSC 1KKRA 1UWAA 1G0CA 1IEIA 3MVIA 1QI0A 4BF5A 2AAAA 3CGBA 5GNXA 2PD5A 4AIUA 3G3MA 1W1YA 3BPWA 4JL1A 1YX1A 3A7AA 3SN1A 3KLLA 1KV5A 2X0YA 5DRIA 1VCFA 1VBRA 2XG9A 1IWAA 2CESA 2Z2BA 1VGAA 4ALDA 3MHGA 3CEPA 1ODZA 4H41A 4S3FA 5CQ1A 3S1UA 2WNNA 2TPRA 3UY8A 2A3CA 5A3HA 4ZTXA 1V6YA 1Z9AA 4AZHA 2V3DA 3ELFA 1JCNA 1W31A 3PZGA 3B8SA 4U5IA 1ME9A 3FY1A 5D37A 4DPPA 5F2LA 3BAWA 3LOTA 3WSUA 4XD5A 5DQPA 2E40A 3SUUA 4Q22A 2WVVA 3A9IA 2BGSA 3N9RA 1GUVA 1TJRA 2FYMA 1U1HA 2ZX5A 3BOXA 1OCBA 2J9YA 5HJLA 3R0UA 5IDIA 1EQPA 3KRBA 1UC5A 4ZSUA 5AZ1A 2EQDA 1QPQA 4WX2A 5HMSA 4ATWA 1GOQA 5BCAA 1FRBA 1CYGA 1JROA 3DC0A 3TWBA 3H70A 2YCJA 3ZT7A 1P6CA 3P5ZA 1V3MA 3E2SA 4LFYA 4WDUA 4ZCWA 4RNFA 5BOFA 1B1YA 1GEHA 3P81A 1P6BA 5A6KA 4OOUA 2QJMA 4PSPA 1Y8BA 1LPFA 1K9DA 4Z2LA 4OIFA 4XKYB 3VABA 4UTWA 1ALDA 2XM1A 3M5VA 3CASA 1YRRA 4HHPA 3WNNA 1I6NA 1JDEA 3SSZA 4UTIA 2BV9A 2J6VA 3W9ZA 5IHRA 3CPUA 4ZSTA 4E4UA 2I5GA 2Q3RA 2EAWA 3GXIA 3NOYA 1LWIA 5E9XA 3PUGA 2QHAA 4UQCA 3ZLHA 1QFEA 4H4XA 2ZRVA 1ZP4A 1RP9A 4BI5A 3LRKA 4CKQA 1EUNA 6ENLA 2XIMA 4A21A 2YDSA 2WWCA 3GRTA 1ECQA 3A22A 1A53A 1ZBWA 2XFFA 3E38A 2R1KA 1B3OA 3F4NA 3EWCA 3B9JB 1W5PA 1W9PA 3LZ3A 3INPA 3LHWA 3R58A 2R1LA 5IRPA 2VDIA 3DENA 4ZGYA 4U31A 2W3SA 4UC5A 2RH9A 3T2OA 3DHUA 4C65A 4YPJA 2P76A 4F0SA 2OXNA 4EPEC 2NSXA 1R7AA 4IM4A 3QFEA 2R9RA 1GTEA 1KR0A 1Z89A 5EL1A 1W1PA 5AHNA 4FIQA 3CWNA 3RJXA 2BCPA 4B5TA 2F9RA 3B9OA 1F3XA 2QIWA 1RM6B 4NZJA 1MW2A 1X6NA 3NDOA 4OKDA 2JK2A 3N2BA 1MZHA 1J5SA 2XINA 5K2ZA 4L4OA 4GX9A 2ZFAA 4GCXA 1QI2A 1B0IA 2V68A 2YCEA 1LTDA 5HQMA 2J88A 4JEJA 1QO2A 4Z1DA 1AW5A 1SMDA 2C14A 4NJGA 1RJQA 4RL3A 1UWTA 3VIIA 4J1OA 3AROA 3CHFA 1UC4A 1GORA 2WZHA 5FJUA 2W3ZA 1PKLA 1K8CA 4KWUA 4XZNX 1SUXA 1FP8A 3C3NA 2I9UA 2OWWA 5XIAA 3QW4B 5DT5A 8RUCA 3R43A 2J25A 3FA3A 2YR1A 3MUAA 1DORA 3S47A 4W4QA 1H7OA 2P50A 2GLKA 3UXIA 2CYGA 1H49A 2OYKA 4IWWA 1F9CA 4JTHA 3UZXA 5MHBA 5FEPA 1AOGA 2WWDA 4OOZA 1AL8A 4RE0A 3GLCA 3BJSA 4YN5A 2KAUC 3IRDA 5REQB 3SR7A 4LUJA 5CG0A 4O0ZA 4XG1A 5JU6A 1GERA 5LHFA 1XYAA 2W91A 1EJTC 3EPOA 2XVPA 3P0XA 1SM9A 1MFVA 3PNUA 2V63A 2YQUA 2CLPA 4P8VA 3NDZA 2PGWA 3K4AA 2G4FA 3RU6A 3C61A 3OLDA 4JTFA 1BGAA 1LRQA 3TLLA 4A05A 5LXEA 1RHCA 3L66A 4BURA 3RHGA 5CC3A 2RABA 1V4YA 3L9CA 1H62A 3EWXA 3H4KA 4LNYA 1OYAA 1CGTA 3C5QA 3STFA 4MAVA 5HUPA 4A8RA 4JPGA 5K4ZA 4LS1A 1HIZA 2NXIA 1PVNA 2J47A 5CEWA 4JAWA 5AOUA 3IIOA 3GFYA 1RK6A 2SFPA 5EY5A 3W81A 1OCQA 3S9YA 2XIQA 3I3DA 4P7LA 1KFBA 1X38A 4KIEA 3TVAA 3P62A 3VD9A 3KDNA 3W6LA 1LWJA 2B7QA 3H2AA 3WF1A 1I2NA 2VL4A 1FFUC 1W8SA 2VTFA 1FWCC 2XH4A 4IPPA 3MDWA 3WQOA 1J0ZA 4KPRA 5I6SA 4CNUA 4R7OA 3BLKA 2QIIA 1TX0A 1SO4A 2C91A 3GXTA 4DAFA 3DBPA 1N5XA 4H9VA 4YTQA 4PMJA 4EVZA 2A7NA 3T0BA 1OFBA 1DWHM 1ZJBA 3W74A 3F4WA 2EO7A 4Y7EA 1DJIA 1CEOA 3VNZA 1MZRA 1PHQA 2BASA 2NX9A 5HDRA 3FJ4A 3Q58A 4L1XA 2CWXA 3LM7A 3U3HA 3FGCA 4I9AA 1U1UA 4DWSD 1R9ZA 1VAHA 4XUGA 3C6CA 1YBQB 2FDMA 1ICPA 1SYTA 1TTIA 4Z0JA 5G1YA 1H7WA 2G95A 4NT0A 1KNWA 1S38A 4BR1A 3NQAA 1TRDA 3W7OA 4C90A 1D8WA 4I7VA 1KA9F 1TJ2A 3HQOA 3R94A 4JCLA 2CWNA 3EPMA 4H2HA 1RPXA 3B9DA 2G50A 3OG3A 4M0XA 4ATLA 3OU8A 3SQLA 1X7FA 4NZ5A 4Y8FA 1B90A 1W3KA 1Z7AA 2GL5A 3IJLA 2PU1A 3HFTA 1DOSA 5L6UA 1SZFA 1V0LA 1LP6A 3VE9A 1UASA 2J4GA 2BODX 4H4SA 5F4XA 3LMYA 1V3LA 3ARXA 1LBMA 4D8LA 4UTHA 4JNMA 5AHMA 3FFSA 3ABOA 1GQIA 4GD0A 5CPNA 2WJFA 4QG9A 4AY7A 3R8HA 1T96A 2FB2A 3RPMA 3N6JA 2XSXA 1AD1A 4IG2A 3L4VA 1X97A 3DK9A 3W70A 3G2GA 4PGLA 4QX4A 3O8AA 3A24A 4Q4MA 2EPNA 3MMTA 4IGSA 2G8ZA 4UFJA 3F5JA 1HJVA 1J79A 5A8OA 2FKPA 4QNEA 1VIZA 1FFVC 5J5DA 2PDJA 3IIXA 4C6OA 4UMAA 8CGTA 4K38A 5I23A 3ZFHA 5MKGA 4C5ZA 4KRZA 5G4EA 3QBUA 3PNZA 4I9MA 3NQVA 3L0KA 3RCYA 4NQ1A 3OHIA 5CSSA 1JFXA 3I3BA 2X7WA 4S3AA 4HMNA 4OU1A 4HB7A 2J66A 3AUOA 3VKAA 3SRDA 3N9SA 4HMCA 4WVXA 3CK5A 5C55A 2QCDA 3VD4A 4I3GA 3BICA 2DW6A 4CNPA 2YVFA 3TFXA 2J75A 2XH7A 1WZMA 3MJYA 1JCMP 3T78A 1CXHA 1R3QA 4Q3MA 4UCGA 1JCLA 4OE7A 2GYIA 1GVIA 5CG7A 1A47A 3L8KA 3WNLA 3PBWA 3NQEA 4MKSA 4BV6A 1NP2A 4ECLA 1FP9A 3L4ZA 4MWAC 2NVDA 2VC6A 1AH3A 3GRIA 2A3AA 1XYBA 1E4IA 1VJSA 1RCXB 1EP2A 1WB0A 2DQXA 2OLHA 1KM4A 4DN1A 2J9XA 1RUSA 1JAKA 5D9PA 1FX6A 2QDDA 3WD2A 4J3WA 2GZXA 1J6OA 1ISWA 1P4CA 5C54A 4JQ3A 2BBFA 3AQUA 2C0AA 1GRAA 4N42A 4UB9A 1SB3B 3PTDA 1XI3A 1Q6CA 5FMHA 2RDXA 3VMNA 4JBRA 2C0HA 3WIJA 4H4QA 1L0PA 3OGRA 4GY0A 3L2MA 3WQGA 5CBIA 1QOXA 3UCDA 4UMCA 4HU3A 2OX1A 3PJWA 4IIEA 1NWTA 6TIMA 1JOAA 4MAZA 2A6LA 4B5WA 4PUJA 3LB8A 3DHFA 1TCMA 1KRCC 4FO4A 3IK4A 4B90A 4LVDA 1UROA 3GK0A 2ESCA 1Z42A 4QJ5B 2VC5A 2WZEA 3M0KA 3PZUA 2WAGA 2HV5A 2YL9A 4DPQA 2OT1A 3GR4A 1V6UA 3BL3A 3QR3A 1FOBA 4GZJA 4LY4A 3MU7A 4M1RA 3L65A 2VR4A 4YIWA 3BMWA 3A5VA 2DZXA 3QY8A 4KGJA 4BCEA 1OD8A 2VHLA 1GOKA 3WD1A 1LL4A 2EG6A 4O50A 2FTWA 5LNUA 1QHPA 6ALDA 3RNDA 4CQDA 4A3RA 1S2UA 2EGZA 3OIXA 1IEVA 2V3EA 3KOZA 4JTIA 4H9MA 4KEUA 3SJ3A 1EJ7L 1K4HA 3RU8X 5CSUA 5MF5A 1RA0A 4DJDA 1LDCA 2QPSA 4JTTA 4UR7A 2J7BA 1PZ2A 3MW7A 4REQB 3STPA 3A4WA 1IEWA 4NZ3A 2C19A 4IUGA 3LERA 3K13A 3W7LA 2X1UA 4US6A 5FS8A 4K37A 1TREA 3LHUA 3G1VA 3I4EA 4ZOBA 4XVEA 1GRTA 2XVGA 3TCEA 3N2CA 1NHPA 2H90A 2UBPC 2PLMA 3KFTA 1TWZA 1FWAC 1FWFC 3PVFA 5IOBA 1FH7A 1H63A 4GZEA 4UFLA 3SIZA 1FDJA 4TUFA 1FECA 3EX3A 4PCPA 2R82A 3BW3A 1VEOA 4MVAA 3VNDA 4D6JA 1OK4A 9RUBA 3NWRA 3MANA 1OF8A 4GFIA 4FXSA 2E1DA 2EQ8A 4K6AA 3J7HA 2W55A 3L5AA 2G3IA 2WQPA 3QV6A 3RK8A 1E56A 4O10A 1VFFA 1LF1A 2YCLB 1F3PA 4H4WA 4FDCB 5FJOA 3HPSA 1LLOA 4LUYA 5C70A 4XK2A 4UQ9A 3ZLGA 3GXFA 1M9HA 3KCOA 4ZL1A 3WDJA 1HT6A 3FHAA 2ZX6A 3ZR5A 3WO8A 4GXPA 1ZRQA 3NXFA 4YCOA 3GDKA 2QCFA 1GQNA 4DWSC 3RO6A 3R79A 4IQDA 2VVSA 4KEZA 3OVRA 3CZGA 1TV2A 1HGWA 2CHNA 3CC1A 4M82A 4AWEA 3PTMA 3T9PA 1ZZMA 2VUNA 2WHJA 1GG0A 3BLLA 4HNLA 3HGRA 2DVUA 3WELA 2YJQA 3T2PA 1PDZA 5I3HA 4RK8A 2VFDA 3N73A 3L5OA 3S2LA 3RJYA 1J11A 4KRUA 4GIRA 3ISIX 4JTRA 2WMFA 4GXMA 3PAOA 3QV9A 1HKMA 2NZLA 4FPSA 4DXVA 4H3DA 2GGJA 4BK9A 1HJSA 3LDVA 3NNTA 4RNJA 4XZ9A 1G4SA 3EOUA 1BYDA 3AS0A 3WMCA 2FFIA 4XV0A 1YDYA 1OABA 4Z1YA 1E4NA 1RZMA 3PUOA 2EJAA 3WQ4A 1DNCA 4LNCA 3H6OA 1XKJA 3UCQA 3KE0A 1A3HA 1J01A 4PMDA 1RBLA 4GE8A 4TX9A 2ADAA 4DUOA 1RQBA 4PMQA 3HV9A 2WPCA 1KM0A 4I5XA 2CC0A 2AQWA 3HRDC 2Z25A 2QV5A 3LK6A 3QY6A 1R3TA 3GNOA 4MZ8A 2P0OA 4LYKA 2BXZA 1XYFA 3S0CA 3IUIA 1IXPA 1UP2A 5EBAA 2XYLA 3WL1A 2KX9A 5J04A 3P5YA 4BHYA 1VZWA 4AH7A 2D20A 4Q8UA 5FF4A 4HNUA 3ANVA 1LM1A 5CJMA 3EEGA 5E9AA 3RFAA 1K70A 1PZ1A 2F6UA 4ZR8A 3VGHA 1TYPA 4I5RA 2H8ZA 4CCDA 4AWSA 4LV4A 1TELA 2TPSA 2NX3A 4XAZA 2YXOA 1NP0A 1LBFA 2QS8A 3NM3A 1CB2A 4HYRA 3O2LA 3SBFA 4EQXA 2D22A 1CI1A 1QAPA 3KHDA 3B0YA 3DH9A 1Z48A 3KWXA 4RZ4A 3EMCA 4M5PA 3G1HA 4NF7A 1GPWA 5C9RA 3IACA 3P74A 3ITVA 1O66A 4FLOA 4TQTA 4GKLA 4NEWA 2YDRA 3R12A 3NQBA 2PGRA 4AISA 1JQVA 2QDEA 3KVKA 1SZGA 4GHRA 4JOMA 1CLVA 4XISA 1JDFA 3M6YA 2QJGA 2D2HA 4G1KA 4NIRA 3NJ3A 1S46A 1XINA 3SQMA 1JDAA 1E55A 1Q6QA 1AQFA 4LVFA 4XD3A 1QWGA 2WOWA 3URQA 4ZO8A 2VFGA 4XO6A 4MB3A 2BY2A 4FS9A 1V02A 3ZT6A 2VGFA 4IIGA 3K4DA 2ONEA 4EX4A 2VEFA 4EM3A 3S5NA 4CD7A 8TIMA 1DIKA 3CT2A 5F4SA 4FX9A 1H11A 1AMKA 2C13A 3KVLA 3IUHA 1LJYA 2Z7KA 5AN7A 2CLMA 4QIUA 1US2A 2C8NA 2OKTA 4OV9A 3GYCA 1AW1A 3SAZA 1T8QA 1Z32X 4JEQA 5CZJA 3FYOA 2XN1A 1ZDLA 3RMJA 2PDKA 1VRDA 2WCGA 1HJQA 3QHOA 1A5CA 1EF3A 2WNZA 4LSBA 1SR0A 2GFTA 1MRQA 3TAOA 4E4PA 2Y62A 3EOOA 4OTKA 3T81A 2J7CA 5I79A 1NWUA 3S5OA 5C2CA 4NRSA 2VCAA 1XPYA 3GRSA 2EQ7A 1PUDA 5F7UA 1F73A 2DQWA 4GBDA 4D72A 4DXKA 4OQVA 2OB3A 1I2QA 4GX8A 2FH6A 1KXVA 1W9XA 4F0HA 4H9XA 1JPHA 3GHSA 2UY5A 4HZ8A 3DJJA 3W7RA 3ARQA 3IJ8A 1DXFA 4QJ4B 1LLZA 5I78A 4DM2A 3W07A 2DJLA 3KBWA 1QDSA 4ZZ9A 3FXGA 3B03A 3IVTA 3LXDA 4OWGA 2NVCA 4CGTA 3SR6B 1UJPA 3M4HA 1PV8A 5AHIA 1Q1RA 3GG8A 3KUMA 4AY1A 1FKWA 3SADA 1A5LC 3GD3A 5D2XA 2X1TA 4ACZB 1QU4A 3IVUA 5CJNA 2CHOA 4YHEA 1TR9A 2CLKA 1XHGA 1ZAIA 3VA8A 1GHSA 4UTWC 1EX5A 1Q63A 2W79A 1ZMDA 1KXHA 1TQJA 4US5A 4DUVA 2H9AA 3TC7A 4IQEA 1A50A 3W2MA 2OLSA 2DIJA 3CZKA 4MJMA 4GABA 2Z29A 1K7XA 2BZNA 3KEHA 3S1XA 3QM3A 4UTKA 1QT1A 2ZZ4A 1IE7C 1ZALA 1B4KA 3N25A 4M7SA 1GWJA 1L6GA 4JDRA 3BARA 3EX2A 4GY7A 7ENLA 3HPFA 4RE3A 2QPUA 4KFPA 3THAA 1PHWA 2VC7A 3LQGA 3BLIA 3RLHA 1XIIA 2AL2B 4AZGA 4A3HA 3N29A 1YDVA 4PULA 1ITUA 2XTKA 1X1NA 4UFKA 4PH6A 2J3NA 3MDUA 3UG3A 2G41A 3AU6A 3R5EA 2FGLA 2PB1A 4JS3A 4LEFA 3PG9A 1SO3A 4J3VA 1F4AA 1W17A 3W7HA 2AL1A 5TF0A 4EF8A 4B3ZA 2DT1A 2H3DA 7XIMA 3EMQA 1GZGA 4J3UA 2Z1SA 3S1GA 1LLWA 1E70M 1ITXA 4FLSA 1Q4NX 1ZENA 2DUAA 1XANA 4WDXA 4RDYA 5HMDA 1D7YA 3NURA 1XCFA 2QPXA 3ID7A 3UWVA 4M29A 4D8AA 2EPMX 3H4WA 3W75A 3IVSA 3QTPA 5F1UA 3LCHA 3WK2A 4XB3A 4C1NB 3QHMA 3QVQA 2FB3A 3TUUA 3USBA 3GNDA 4NZFA 5TAOA 3WF4A 1GREA 4FLRA 3B8WA 1HFBA 2V2DA 1EYEA 3UJFA 3W7MA 5HATA 2VFHA 3M16A 4TX6A 3VKKA 3AC0A 2X1IA 2ZUNA 3PZQA 1ZBVA 3ZOAA 4F9DA 4LPCA 3VZZA 4A3YA 3MP3A 4UTLA 1B3YA 3SRFA 3N1AA 4JXCA 1Q6EA 4O15A 1OYBA 1B9BA 1TKKA 5K7JA 3VIJA 3W7GA 1IZKA 3VIFA 4J56A 4LUSA 2JIEA 3LNPA 2V6AA 3WJSA 1ISYA 4CVUA 2ZC1A 1TPEA 4PRWA 5A69A 4CNOA 5CPQA 1SFTA 3UFYA 1E6NA 1HF6A 3AISA 1QPRA 3T7VA 4CEXC 2Y7FA 2EEXA 4LGXA 2FPTA 1V8EA 5DCDA 2QAEA 4BY3A 1O5QA 1Z6KA 3IV8A 1SMAA 3G1SA 2WJEA 4HA3A 3B8VA 2YGYA 3SCPA 2OO0A 4Q4QA 1US0A 3WD0A 2E8ZA 2IPJA 1Q2RA 6REQA 3DGBA 1E73M 5A5WA 2OGYA 2XIIA 1VKFA 4HNNA 1QNPA 1U30A 3TYBA 2PSNA 1RD5A 2AMGA 4UR9A 3V5OA 5EBKA 3SY5A 3PTKA 4HVXA 4WSJA 4AY8A 1WV2A 4QM1A 3DZ1A 4C6BA 2PDQA 4IMGA 5GPRA 7PTDA 1W91A 3KBJA 3GU2A 3QKZA 4WF7A 1EWEA 3LPGA 3ECQA 4O1BA 2XISA 4D6IA 5M3WA 1B2YA 2W5FA 5A8QA 5AC8A 2XDFA 4EIVA 3CS2A 4W86A 5F2IA 4I6VA 3EF6A 4PUWA 1UKPA 1MUCA 3M5ZA 4LUIA 1I0BA 3V1HA 5KVHA 1ML1A 4AQLA 1QJWA 2GJNA 1TG7A 1JYXA 2W66A 4AZCB 4DQWA 1VPYA 2VC9A 1KM1A 3KTXA 3A4AA 5LHEA 3TTOA 4KWWA 3QQ0A 4MMWA 1NARA 4RNIA 4ZENA 4E2OA 4UFHA 2J7FA 1RR2A 3G1YA 4F9JA 1ZSXA 3RXZA 1XH2A 2REQB 2Q8ZA 2FPYA 4F79A 4Z1CA 3I4KA 3PBYA 5AZ0A 1YPFA 2QKFA 3WJXA 2QVHA 3ZO9A 2JKPA 3SCOA 1JEHA 3GNRA 4UUIA 3W7CA 2WVUA 3TJLA 2D2OA 1S2TA 3HMJG 3QY7A 4LS2A 1RA5A 3CUIA 4WY0B 1FWDC 3RPTA 1F2JA 1F7BA 4B15A 1ONFA 1QNOA 3LLDA 1XG3A 4JTUA 3UETA 4PSRA 3V1PA 1DXLA 1NHSA 4TVYA 3OEXA 5D4YA 1CENA 3LXCA 5CAHA 5HPCA 3A13A 1ZUAX 3M7WA 2F8QA 5LIXX 1O94A 3BVJA 4ACYA 3DEQA 2DEPA 2Y6ZA 2VRKA 3BE7A 3UZ5A 4W7WA 3APTA 3VOHA 5LA1A 1FKXA 4GI9A 1FEBA 2ACRA 2WMIB 3VD7A 4LYRA 2PTYA 3RNMA 1PX8A 3VUSA 2C1HA 4B5XA 3MSYA 1PDYA 5I3KA 1NELA 3OQ8A 2YVGA 4K7YA 4TV5A 2Y0FA 3L5LA 3MHFA 1BXNA 2I9EA 4H00A 1B3WA 3SGUA 3HQPA 3AIBA 1WBJA 3WUEA 4GZIA 4X2RA 1W32A 3RLUA 2NVKX 3VCRA 3P8IA 1DIEA 1CXKA 1P43A 3TTYA 2NV1A 2BVDA 2QV4A 5I24A 3MY9A 1NTHA 3GAKA 4YVPA 4AAJA 2YSWA 3DCPA 4Q32A 5JCIA 5EU9A 3GHUA 4GOAA 2E5BA 6XIMA 4Q7IA 4DZAA 3W24A 3MMWA 2ACQA 3DFNA 3U2CA 3SN4A 2X1SA 2YAUA 2FMOA 5BXTA 2ACSA 4H4IA 4CN4A 2BY3A 2PCQA 2IPGA 3EWYA 2R24A 4PTDA 1LUCA 3F2CA 4Y96A 3GG0A 3CMGA 5BMXA 3AWNA 4LCQA 3PB2A 1RVGA 4QFUA 2ODOA 3BGGA 3OJGA 4HMDA 1B54A 3D0CA 4DJFC 4FX8A 1W1IE 4DI9A 3IEBA 3CGDA 2V5JA 1UQZA 1EUAA 1TPFA 3TE9A 3T0AA 4FHAA 1US3A 1TUXA 4U28A 4GI4A 1FWNA 4MPQA 4YCPA 3GSMA 1EZWA 4C6DA 1I2OA 3CZ8A 1BLIA 3TTSA 1TWSA 3HB9A 1GKRA 1IIGA 2WP6A 2W61A 3MBDA 1CXEA 3AMGA 4LOCA 2XIJA 4O54A 1WDSA 1BYCA 4UTUA 3UR5A 1SGJA 3AOFA 4QBXA 4GJ1A 1KC7A 4MDOA 4GI6A 4LAKA 1TPWA 3TTEA 4O4WA 2DORA 2DZAA 5A6BA 4AX7A 3LPOA 1M41A 1OFPA 4B9ZA 3LENA 4FNUA 1NIUA 4R34A 3CXOA 3V5CA 3II4A 2VURA 1UMYA 2RFGA 4H8NA 1O5KA 3SB0A 3LHVA 3NQDA 2XGIA 3GBEA 5EMKA 1TV5A 3CXBA 4DIAA 1UD8A 1V3JA 2Y85A 3AHZA 4S3KA 3FSTA 5CZ0A 3PZMA 1K9TA 1HKJA 4ZB5A 4QP0A 4BEQA 3VFCA 3GUGA 3S6DA 3FJ6A 3AM9A 1JZ2A 1FWSA 1KCKA 3P3BA 3BLOA 3DH7A 1ADOA 3W1NA 2F5ZA 3S4TA 3THQA 2PWEA 4J4KA 4PMUA 3SCTA 1GZ1A 2OO6A 3KZSA 3GTXA 5ABFA 5C2GA 1F05A 2G3FA 4C6KA 1MUWA 4Z2JA 3PZVA 1G94A 2A0NA 4N9CA 1WDPA 5U1OA 4POCA 1AJZA 3H26A 3TTQA 3QPYA 4R7JA 1W5MA 5CPTA 4DF1A 3UF9A 1U5HA 2XVNA 1UR3M 4BA0A 4O16A 2DSWA 2B4GA 2Y2WA 4OUEA 4DJDC 5ABHA 1BYBA 3PZOA 4Z17A 2ZICA 4E8GA 1ME8A 1EDQA 2P1FA 2YLAA 1R9XA 3UU0A 3AXHA 3MZNA 4XTDA 3N3MA 3UG4A 3D46A 4GH3A 3FX4A 5EGRA 3AO0A 3OOQA 5CAKA 1JDCA 2ZA2A 3CGTA 3IGSA 3QMSA 1U33A 4AIBA 1ODUA 3B05A 3HJZA 1EL3A 2OZ8A 4LF1A 4WKHA 5JBEA 3DYOA 2R6OA 4XSLA 1E40A 1PYFA 4W7UA 4WCJA 3CV7A 4US5D 3U8GA 3N19B 5AVNA 4YNGA 4PTNA 2Y8VA 2PC8A 2VFFA 1V0KA 3GG7A 4WQ6A 3CHCA 1XLEA 2OX4A 4WSHA 3E3HA 2X2GA 3VGBA 3OBAA 5G1MA 5I0DA 1AFSA 4UCFA 5DY2A 4DO7A 4F2UA 1QVBA 1P7TB 1XIGA 2WANA 1UR9A 1TIMA 4V1YA 1PCKA 2Z1WA 1IIHA 1MEIA 2PA6A 4AVNA 3NQFA 4Q8QA 4JDBA 3DK4A 1J0IA 4GIYA 3DAQA 4P8XA 2PDLA 3Q65A 1W3HA 3M6DA 5HJYA 1TO3A 4PUNA 3I68A 4F48A 3H22A 4Q7BA 5C9UA 3GO2A 4U3CA 4ZVJA 3I7RA 1GHRA 5KTLA 2PUZA 2E67A 4BF7A 3VDAA 4QLLA 3ARUA 1ZX9A 1X6UA 1XLLA 1X7IA 2ZUVA 2PGFA 4CN6A 1ME7A 4O1EA 1U22A 2NVAA 3EDFA 4JFUA 4RNHA 1VIWA 3A4XA 5HINA 1NY1A 5I5RA 3AJXA 4PR4A 2I56A 3WH9A 1A5AA 2XZ9A 3VIOA 4RPPA 1P0KA 1H60A 3GIPA 4BWLA 3QFBA 2LLEA 4LIIA 4CD8A 2WZIA 3AHXA 4XD4A 2VZOA 2CLLA 3F4CA 4V28A 1ZCOA 1OK6A 1KGWA 1CNVA 1M7XA 5ABGA 5C7HA 3STGA 3A3HA 1ZGDA 3D3FA 3DKLA 3OPSA 5IFTA 3ZLFA 3DJGX 3LEPA 1R3VA 1F3WA 4TOQA 1GJWA 1PX3A 1ZCCA 4YMZA 4ADSA 2E5AA 5CC7A 4A22A 3OZYA 2OELA 1XIHA 4FOKA 3ZMRA 4UWMA 1O1HA 3WNOA 4FI4A 3AIQA 1UOKA 3H53A 2C3ZA 3RG6A 3W72A 3S1WA 4YTTA 1UKOA 3TW9A 2CLOA 4XZLX 2JF6A 3E0WA 1ONXA 4PMXA 4NAEB 1KCZA 4PRTA 4UFMA 3RCMA 4W5ZA 3W7NA 4HOWA 4GR1A 1JNDA 1RBAA 4MYXA 4D6DA 3C2VA 3RX3A 1JYVA 3H7UA 1X98A 1FH8A 4JTJA 3MI3A 3VXGA 1IT8A 1W5NA 3MS8A 5D9NA 1EPXA 3UESA 4AC1X 1F8IA 4G56A 4HNTA 3T08A 3GXDA 1UR1A 3I65A 3L68A 2GPTA 3RM9A 2QUTA 1MQPA 1EP3A 4O52A 3VYLA 5H6HA 4YXGA 2Z27A 3O63A 4UQEA 4IGHA 4QEHA 4ZXLA 1KR1A 2X8CA 2OYMA 4NUWA 4AD3A 2ZXQA 4JR5A 3NQ7A 5E70A 3TC6A 1Q6RA 3S9IA 4ICMA 1NDYA 1F76A 3V0TA 4MWAB 1MEWA 3TFCA 4DO5A 3U2EA 4D71A 1D7KA 3DESA 3AALA 1AODA 2OODA 4HQVA 4G6CA 2R91A 2DSKA 4R9OA 2ABAA 1QBAA 3P61A 1V7AA 2WC7A 4AIEA 3KCLA 3NM1A 2NUYA 5XIMA 3RR4A 3UYIA 6CGTA 4N6FA 1D7FA 4B5NA 1JG9A 3O06A 2Z4GA 3CQIA 4MY9A 3W83A 4RPQA 1UP3A 1OGBA 2NLIA 1K7FA 3RIKA 4BQ5A 1DEDA 3GYEA 1BZLA 4LVAA 4Z1BA 4GFSA 3D47A 4DXXA 4Z2HA 3BZJA 1UD5A 1ECEA 2GJPA 1SSDA 1JRBA 1GRFA 3M0JA 4HTBA 1OIMA 3AZRA 3V18A 4CN1A 1YTKA 3WL0A 2PBOA 5T91A 4NNAA 5CPOA 1A5UA 3MUIA 4HJWA 3SURA 4D6EA 2L5HA 1EGMA 5LNSA 1BF6A 2F6XA 4KFNA 3GVRA 1QK0A 3ZSTA 2ZE0A 2VR2A 2KZHA 4IFKB 4QITA 4CCZA 3SUTA 3WLPA 1PWLA 1NOWA 5FACA 2Y8UA 2BGNE 3BGJA 4WK9A 5EFFA 2DUXA 2QGHA 2J13A 1E0WA 2ZUTA 2WNQA 3NZPA 2VZSA 4PZVA 3QYQA 3M7SA 5F2MA 1MYRA 1E3ZA 4AU0A 1A0CA 2YDQA 2VEPA 4WOQA 2NPXA 1YXDA 4S3JA 3IJ7A 1BHGA 3ABXA 1C9DA 2NWRA 5LKYA 4L80A 4O28A 2WQDA 3FK4A 2E6FA 1GYNA 4ILSA 1TMQA 3JRKA 3XINA 4A2SA 5J5RA 1P1MA 1LVLA 2A4AA 3L2IA 4S3GA 5DY3A 4I9TA 2D69A 4RDVA 3NVDA 4FAMA 3NSNA 4O1DA 1VF8A 3KWSA 1BRLA 3PPGA 3WLQA 4W9TA 2FZMA 5A1AA 3USZA 3F1QA 2XH2A 3MUCA 2JGYA 1I0DA 1C91A 2DZPA 5M1TA 1K03A 1CGVA 4XAGA 1XLDA 1U5JA 2VR5A 1JNEA 4HPGA 2NQZA 3M0XA 1ZBKA 2GR2A 3LM3A 4IXHA 2CDUA 4O14A 2OPJA 1KBJA 5FJPA 3HTWA 5FEXA 3K30A 3DYMA 1XH0A 4HNVA 1HO1A 3QEZA 3EX6A 3UR7A 4B2DD 1XIJA 4AZBA 1L8NA 3IPWA 3PJTA 2POTA 1EO7A 4H7VA 3CL6A 1AD4A 4F0KA 5C8BB 2YXXA 3SQPA 4F3HA 4JNYA 4E4FA 4ML4A 1BTMA 1IT0A 1TVLA 3WQDA 1SR9A 2NQ5A 2JKEA 4PFMA 1FCUA 1GGOA 3R7MA 3W7PA 1K3UA 3VO0A 4UNLA 1F3EA 1WNOA 5D09A 4UBPC 1J2WA 4JL2A 4YS1A 2TRSA 2PD9A 1FWRA 3ITYA 2J74A 3NPXA 2G3MA 2QXWA 4DWSB 4ZMGA 1BKSA 2QNEA 4OV4A 4AMAA 1L6YA 1B3ZA 3HIJA 3LPPA 4A8NA 5BU9A 1W5QA 3H2MA 1XGEA 3SCQA 1KRBC 5ENLA 3WLJA 4IMCA 3E2VA 2HRWA 1VBHA 5C9WA 4IPNB 3TN3A 2WYSA 2HVMA 1W1A1 4CU8A 4MOZA 3LYEA 5LZLA 3WBEA 1PX4A 5FJJA 3G8RA 3UJSA 1SJDA 2BXVA 2HROA 2HVNA 4WGHA 4P7OA 7REQB 2VEKA 2ZUSA 1R47A 1SFSA 2AKMA 2EPHA 3TJXA 1XHCA 4CUCA 3FW6A 4E2VA 1KGXA 3GKFA 3DN5A 2BC1A 1KBKA 1LORA 2XWEA 1AQMA 1G69A 2P8BA 1GVFA 3BG3A 3E9AA 4QQUA 2X8GA 1DJQA 3NQGA 3NVVB 3HQ1A 4A3QA 1UCWA 3VDCA 3R07C 2VCCA 1MRAA 1XH1A 1TZZA 1IF2A 4JQAA 5DX7A 1LROA 1B4EA 3DU0A 3MT1A 2A7RA 4V1XA 3VCCA 1C92A 5DMNA 1XRTA 1TV3A 2DH2A 4YWSA 3F4DA 5FCZA 1EO5A 3EYPA 5A6BD 4I5UA 5C7VA 3G1FA 4C6LA 4DZIA 1NOUA 2XGBA 3VUPA 2OEJA 4C6NA 4IL2A 1FCBA 5EFDA 1DQUA 4H19A 1HP4A 2PF8A 3A12A 4Q8TA 1GW9A 3EA1A 4ZQPA 3SSJA 3CH0A 3W7KA 3FG2P 1VBJA 3NZQA 4O8RA 3WLSA 3SRKA 1IQ8A 3F2BA 4YWIA 2D2JA 1VFUA 2YVJA 4IXXA 4X9YA 4KBXA 1VFHA 1OQFA 2ISDA 4LVBA 4AYSA 3TZNA 4ZODA 3W85A 3WMLA 2DDXA 3S3GA 3V0UA 4F8XA 5HPOA 1NM9A 4KCUA 1N82A 3BXWA 1UD4A 3GVGA 4TMBA 3W23A 3ARYA 1DE6A 2GR3A 3MHUA 1N61C 3LRLA 3FS2A 3PHAA 4LCRA 1GOOA 4S2BA 3MTWA 3EEZA 1XS2A 3C2FA 4NY2A 4IPJA 2BOFX 3W1TA 4AD2A 5M03A 3M0MA 1L2QA 3RPDA 3WK1A 2ZTKA 1ICSA 4HA1A 5HMEA 5AC5A 3ICJA 3CGCA 4I8YA 1J5TA 3AS3A 2YL8A 1GPFA 1FY6A 4RCXA 4W84A 3V4BA 1ZPTA 2VVNA 4C6QA 5H91A 3BAJA 3SRHA 4FX6M 4M7TA 5I00A 1MQQA 1WKYA 3RGTA 2WSKA 3W1UA 3ZIZA 1X8CA 4H4TA 2OTDA 3O0HA 1I45A 3OG2A 3WLLA 3LX9A 4NILA 1XLBA 1LCOA 4B5UA 2XN2A 4IMEA 5DMLA 4NU7A 1NF7A 3OTRA 1CX9A 3LV6A 1G6CA 2X40A 4NI3A 2NXGA 4P7QA 3UXLA 3REQA 1XC6A 2Y5EA 3VIMA 4MZYA 3STEA 4PUKA 5HNTA 3N14A 1SFJA 2HBXA 3H2OA 4ONVA 4KKXA 1OINA 2HISA 1QI5A 2Z28A 2IQTA 5I02A 1EA0A 2V82A 1TA3A 2YBUA 1MO0A 3M9YA 1V51A 1SZNA 3H2CA 2ZDSA 4MPKA 2Y24A 2PP0A 3ZSSA 3ES8A 5HQLA 3T0DA 3BGAA 4N2YA 3FA4A 3OGVA 3LCIA 2YL6A 4LB3A 4XZIA 4Z08A 5IHSA 2EKCA 3WNPA 4IIDA 2QW5A 1PYMA 3R89A 3N4AA 4S3CA 3WLHA 1IGSA 4QEEA 4Q4OA 3B0PA 4FNQA 4JTDA 4KH2A 1FCQA 3W26A 1EDGA 4MF4A 4RUBA 5DF0A 2Z1VA 4KQNA 3JZEA 3QLDA 2D0FA 3CHEA 2JEPA 3QGKC 1UZDA 2F84A 1VRXA 4KERA 1XYMA 2HNEA 3U2OA 3UNTA 2GR1A 2X7VA 2QUVA 4ICNA 3SUSA 2O9RA 4GYJA 3QPZA 4AFYA 4KF1A 2WVVB 1UR2A 2ATMA 2FGBA 3N04A 3ITCA 3S2NA 2J7EA 4DO4A 1GEUA 5D32A 5FIPA 1H3GA 1P5BA 2GJRA 4GYFA 4AWUA 1BPLB 1H61A 1AUSL 3DYPA 1BWKA 2W9MA 4XBJA 2NLYA 2ZRWA 2WOVA 2IS7A 1P0DA 2GSEA 3B3DA 3HN3A 2CBVA 1E6QM 4PUEA 4IF2A 3ZJKA 3WLIA 3HG2A 4GY1A 3BURA 1HXJA 1T5AA 1V5XA 3N6HA 3MSDA 5DLCA 4GCAA 5IDZA 4FEZA 3U9IA 1D2KA 2DIKA 3O7UA 3B9NA 2G3NA 2JQXA 1NQKA 2VEMA 4S38A 1HJUA 3EBVA 2GDQA 1PPIA 3LCXA 1WKEA 4HYVA 3QOKA 3ARSA 3QMRA 4RDZA 3UBPC 4PB4A 3UGRA 1OGGA 2ALRA 1R3YA 3N34A 4QCEA 3VD3A 3WQ5A 3CQJA 4RXGA 5LNVA 2GRTA 4UMBA 4DZ5A 1R8LA 1UUMA 1LOQA 1GRHA 3VNLA 5JRBA 3AFBA 1VYPX 1K8ZA 2P5NA 5EMLA 4HT3A 2UZ9A 3WEZA 1R5YA 4PTXA 1WAUA 1E9LA 1J4EA 5G4WA 4OVXA 1SJCA 4U33A 4DZHA 4PEEA 1CLXA 4HU4A 4ERAA 4W5UA 4LUTB 4KGLA 4JX5A 3GTNA 2WP5A 1W1TA 4M6UA 3MC5A 2NWSA 1ZJAA 2YZ5A 2W6RA 3WJZA 3WUFA 1KM3A 1TPDA 3H7VA 2Z1BA 5G4HC 3LGEA 3PM6A 1NWSA 3GW3A 3NZGA 3C3UA 3A64A 1F6YA 1GW1A 5JCKA 4J3TA 3W22A 1Y0EA 2E8YA 1GOXA 5EA9A 5I7GA 1OG0A 4G1NA 1W9DM 3H54A 4FB7A 3OA3A 2FHCA 3T44A 4HTYA 4G2DA 1DHKA 2CZ5A 3P80A 3B4UA 4OECA 4NAFA 4C6JA 4ADWA 4MB5A 4C1LA 2BLEA 4S2CA 1HW6A 1LBLA 1TTJA 2ISVA 1HNYA 4JIRA 1DWFM 1E1CA 4Q8WA 3AUJA 3CQKA 5LA2A 4MLJA 3HW2A 4BS0A 3KBVA 4N7QA 4KEVA 1TQXA 3GVWA 2FZNA 5KZEA 4DBSA 3T2QA 1MNZA 3SFWA 1O12A 1UZ1A 3GHRA 2HWGA 2VZVA 2E1WA 3IGUA 4E2DA 5FF2A 1TV8A 1QXLA 1TPVA 2VI0A 3L21A 4QHRA 3SJNA 4KT2A 1QOQA 3HQNA 1TWWA 3P93A 1SU5A 2PDNA 4WIWA 2PTXA 3BMVA 3KS6A 1U2YA 4JX4A 1DE5A 4QE5A 1LL6A 2DPEA 2UY4A 2X8RA 2OMAA 1KCXA 1F61A 2WSRA 7TIMA 4FP1A 3DKJA 3FN9A 4GI8A 3SCRA 4PBGA 1C90A 2GDVA 3DFQA 3U0HA 3PS7A 1TE6A 1XGDA 3K8KA 2XFYA 3FDGA 1P0EA 1UZHA 3NPWA 4LC8A 2H3BA 3SDOA 3V75A 1C7TA 5GJMA 4O1FA 3VVGA 4E3TA 2E7FA 1CXLA 3P6LA 4S3BA 7ODCA 3TU9A 1DKWA 1XWYA 3NPUA 1GV4A 2ZX7A 2PDYA 4EPBC 1WZKA 2Z7GA 4QTGA 1OZMA 3W0KA 2XM2A 2QULA 5HWMA 4L9ZA 4B3KA 4J2MA 1FFRA 5AY7A 1QUMA 1EBDA 1P48A 3WFZA 4E6MA 5CKSA 4HPNA 3MI6A 4XIMA 5JCLA 4LAZA 3UVAA 1TWDA 4CVWA 2GK1A 2PDWA 3UZJA 1TYGA 3CIXA 1DVJA 3FNDA 2BVYA 4MNJA 1SW0A 3QQ1A 1CCWB 1BFNA 2CKRA 3EB2A 1W3TA 5GJNA 4LAMA 1IEQA 4M52A 5DANA 2VZUA 1IZCA 1CXFA 4UTFA 1QK2A 2W27A 3ITGA 1W8GA 2PF0A 4JTCA 3KVJA 1MEHA 1YXCA 3V16A 2WMIA 1CECA 4YYCA 1VH7A 3NQMA 4PCNA 1UIPA 3M0IA 4Z1AA 2I1OA 1H5YA 4R7WA 4IT1A 5FSEC 1OX6A 4NI8A 3EOEA 5LXXA 3NGJA 5KINA 1QNRA 3FGCB 1JCYA 3L67A 1JVNA 3VNMA 4WJEA 2PRMA 4E38A 3CO4A 4DBWA 5AKQA 2FTYA 2YA1A 2AOSA 3G6LA 3WMBA 1EB3A 3MUZ1 4R3UA 3CIWA 2HDJA 2B0MA 3CJPA 3LY0A 3FEQA 3GNPA 1THFD 4J3XA 3AI0A 4NJIA 1C93A 2VGIA 3JVAA 4QDMA 4ZB0A 4M3PA 4GBUA 5B80A 4GUGA 4R33A 3CAVA 1BYAA 1UH2A 1WXJA 1AH0A 4TMCA 1YQ2A 1UWIA 1C3FA 1VCGA 1W3IA 3KXQA 5ABEA 2QVNA 4P7NA 4BWLC 3HU7A 1KTBA 2ZADA 4FX7A 3F03K 1MSSA 4MNMA 1ZL1A 4L64A 4HPXA 3SY8A 4A2RA 3GZAA 3TXVA 1EOKA 5H8UA 2PDXA 2G3JA 3F5LA 4IJCA 3T09A 4EWJA 4YTRA 5I3FA 1XV8A 3KL5A 1GVYA 5AECA 5CC6A 4HNOA 4MWAE 3CUFA 2ZBTA 1HX0A 3DFHA 4BFAA 5C5YA 1R2SA 4DNHA 3ZZ1A 3ZVHB 4Q8NA 3M1ZA 2DZUA 3IUDA 3AN1A 4HHLA 3VKDA 2Q02A 2G5WA 3E5PA 1J6PA 1W1B1 2JE8A 1TYTA 5FF0A 4JY9A 3CUXA 2OGJA 4O1AA 5HAOA 1XIDA 5MKGB 1RK5A 1Q6DA 3TYZA 3G77A 2WKLA 1GVRA 2ATSA 1DYSA 1L6WA 5A94A 4HA0A 3A3WA 4IQJA 3RR1A 1DJXA 4AHQA 4MJZA 1M6JA 5DELA 3WK3A 1M68A 4HYWA 2QCDB 1STZA 3W1LA 5BRQA 3LV5A 4IPIA 2XIBA 2V2HA 3VD5A 2O56A 3Q67A 3EXTA 1G4EA 1KM6A 3IANA 3CNYA 3W7QA 1DJGA 1A0DA 3URNA 3TWAA 1M5WA 1NWRA 3CQHA 2ZDRA 1VFMA 2E68A 1JRPA 2WHMA 1N55A 4MADA 3W00A 3GU1A 4NXKA 3O6AA 5F2GA 1ZU8A 4IIHA 3P82A 3PSVA 1EJRC 3GXPA 4AD5A 1GQJA 3ABZA 5K9CA 4K8GA 3DK8A 3CAKA 4FXJA 4D1IA 1C29A 1V08A 4DHGA 4MFEA 3AXMA 4C5YA 1HVXA 5D9OA 2VM8A 1QASA 1A3XA 2BGQA 4GK8A 4O12A 3OLGA 4I6KA 1PIIA 1XLHA 4I7UA 2XJ7A 3P60A 4H8VA 3VDBA 1E0TA 3A4JA 3A47A 4ZB2A 3VX1A 1FIQB 1I2RA 4JQ2A 3WEOA 5TQLA 3TQ0A 3LUTA 4L6DA 1GOMA 6TAAA 4H50A 1W2VA 4LBRA 4BQ2A 3DG7A 4BZYA 4WHBA 1XLJA 5K9DA 1PIGA 4TXEA 2VELA 3IS4A 2BWGA 1ZJIA 3QKEA 3TCSA 5G2HA 3ABRA 3B0VC 4K8EA 4GUIA 2W67A 3M07A 1LZOA 1OX4A 3U5UA 4ZQRA 4Z42C 6PTDA 3TIMA 4DUWA 1BVNP 5AHLA 3M44A 3M0HA 3BMXA 1KXQA 3NVYB 3PJUA 4M6PA 4PEKA 1VBUA 3R13A 4U4MA 4U3AA 4CCCA 4HBKA 3AMLA 4J27A 3TOPA 4DF0A 4AB4A 2Y7DA 3RRAA 5BOOA 2B7NA 2A21A 4AZ6A 3G0XA 4Q4RA 4FF7A 3GH5A 2HBVA 1M53A 5D2WA 1AG1O 2ZE3A 5RUBA 3G6MA 4M81A 1QCWA 1UWQA 4PMVA 4AMCA 1LT8A 1Q4WA 2EG7A 3EOSA 4MLRA 2ZC8A 3B06A 2A3HA 4WUIA 1QO5A 3IGXA 3VMOA 3CLMA 2IUZA 4UNKA 3DFTA 2WPBA 1FDYA 3BQ5A 3EB3A 3R8RA 5C9ZA 3WLMA 1TVPA 2VXNA 4KRTA 2DY3A 3GTFA 2HVOA 1F8WA 3OLIA 1REQA 5HUOA 4MFDA 2TSYA 3TC3A 2QT3A 5IFPA 1IR2A 3GH4A 1E9ZB 5DO8A 1I2PA 1HL2A 2V67A 2CLHA 3WF0A 4LBUA 3LGGA 2GJXA 2AMXA 5AB3A 5KZDA 9CGTA 1Y65A 1HKIA 3ARWA 3LBCA 4IX2A 2CLEA 5CZTA 5JH1A 2J27A 1YE4A 4EAYA 2BDQA 3NOEA 4DRSA 2RHGA 2ZWZA 3TP4A 4GIEA 5A6LA 1XLGA 3ARPA 4Q8MA 2BX7A 3WK0A 3LG3A 2V5DA 2F38A 1R38A 2D3LA 4QE1A 3E74A 1O7AA 3RMEA 2PAJA 3D6NA 3PPHA 3H23A 3ABSA 5FS9A 4G7EA 3RO8A 1H2JA 2PODA 3TLQA 4Y2WA 3DERA 5JBFA 5A2CA 4FNRA 4JKLA 3SCUA 3URHA 2VX4A 3WFLA 1VQTA 4Q8OA 4PTWA 3LHTA 5CGMA 5FL0A 2QCGA 2Q71A 3S9ZA 1YDOA 3L23A 4NNCA 1W6TA 1XISA 2X16A 4JTAA 3FSUA 5AYZA 4NYYA 1WP6A 3VM5A 4HHHA 3ALFA 2O92A 3MP4A 1SQ7A 4AEOA 1O95A 2GQ3A 3CO8A 3AIEA 5FA5A 5HWJA 4L6OA 3TXZA 2E6YA 1T40A 1KFJA 1X2HA 2ZA1A 3HG5A 3T4WA 1JUKA 2DV0A 3QR1A 5DBUA 3EDKA 1TCDA 1UD6A 3SEPA 1KV8A 1K8YA 1QNQA 3DFOA 3EA2A 1G4TA 3WLTA 5U7SA 2CNCA 1XGZA 5A6SA 1L9WA 4R85A 5JBDA 1I1XA 2WSPA 3BJFA 4D2JA 3E0LA 2DT2A 3WF3A 1UWRA 3ITTA 3NEHA 3T8LA 1KLYA 3LN3A 3NAVA 3W2UA 3QGAC 4H4VA 3HF3A 4A29A 3GQYA 1LRNA 1JXJA 1YLVA 4HGXA 1HG3A 2W0HA 1R3WA 1Y7VA 3OB8A 4IMDA 3L2LA 3WJWA 4D6HA 1MNSA 3Q4DA 4RR4A 4IGNA 2ZX8A 4EPDC 1EWDA 2PP3A 3R25A 2VT0A 3FIGA 3IC9A 3HA1A 3I3EA 3B4YA 2G96A 1W54A 1IWBA 3WX7A 4F66A 1TMHA 3XISA 5BMWA 3WQCA 5G5IA 4EK7A 1SJBA 1V3KA 4FR6A 1XRVA 5GNZA 2RJHA 4EXQA 3NVTA 1S5TA 1AVAA 1TPH1 2WB5A 1JIBA 3MKCA 2X42A 1SW7A 2FHFA 1O6IA 3GNXA 2CCRA 5HANA 3FOKA 1JPMA 3TSMA 2NT1A 1EJWC 4IJBA 3H24A 5JCNA 3CYVA 4KWVA 5FJTA 2GGEA 3HPAA 2RAGA 1ISVA 4Z2KA 3WFAA 4AF0A 1K6WA 4DUXA 1PBGA 3WBAA 2GGIA 3K8LA 2J79A 4O13A 4O0QA 1QW9A 2JALA 1GJPA 4W93A 3M47A 3ATZA 5FJRA 1QHOA 3MWAA 1XIBA 2J7DA 4GJIA 3TQPA 2BB0A 8XIMA 3N6QA 3AYTA 3W7JA 4GISA 4UQDA 1Z69A 4DBDA 3VCNA 3MWCA 4EE9A 3G3DA 4PE8A 4GYPA 1EYWA 1E51A 1OJTA 1U83A 3W2JA 3KTCA 2YOCA 3CPGA 3OVGA 3QFWA 4KWSA 2VEIA 2O7QA 2VX5A 1N62C 2BHZA 3AMZA 2BFGA 3UWUA 4HJFA 2E25A 2OEKA 1AL7A 3I6TA 2YL5A 3CB3A 2BHUA 3L4UA 4PN2A 2EPOA 4V2XA 3EPNA 3QJAA 4D9PA 1UOZA 1D9EA 1X1OA 3CT7A 3POCA 3O1NA 2O9PA 2XH0A 4AD4A 4DNMA 1PKNA 1LG2A 4J2PA 4CQ9A 1DWIM 1XC4A 2J78A 2PU0A 4Y6GA 4XUYA 2WM0A 3GBDA 5FAGA 1G1YA 3NL6A 3M0LA 3EAUA 1DQXA 1S1RA 2VQUA 1OC7A 3GY1A 3W27A 3FYPA 3WNMA 4PTVA 2PWGA 1XIFA 3OYZA 2MANA 2OSXA 4N9DA 1TVNA 3WMSA 3RAOA 3BCFA 4YVVA 3Q37A 3O07A 3AHTA 2EHHA 3VGGA 4ERIA 4Q4SA 5U4NA 5M2FX 1YADA 3TNOA 2WHKA 1FCVA 2PI6A 3LCLA 1A0EA 5CLTA 2Z24A 4JKMA 4JHOA 1D8CA 1Z44A 5HNRA 3IARA 1FDZA 1R0MA 2ACUA 1VHCA 2WMGA 5HQEA 3TMQA 1XDIA 3C2EA 2NQHA 4I7WA 2Z1KA 1DL3A 3HPZA 3MMUA 3PR2A 4GQQA 3VDGA 4R53A 1HVQA 5I03A 1K8XA 4EQWA 3S46A 1A5BA 1EXPA 1KWGA 2PLKA 1FH9A 1QOPA 3O05A 3H2FA 1AK5A 4H7CA 4JNZA 3TYDA 2IKHA 3HGSA 4LWWA 5LSMA 4HK7A 3GS6A 3WNKA 1UB3A 4INFA 3AXXA 3B04A 1SJAA 1GEQA 2P88A 3DIPA 3DGZA 3O16A 4XAFA 3UG8A 3W02A 4Y9PA 2IKJA 1EEXA 2VMFA 2FH8A 2H9AB 1M7JA 1IYXA 4FXFA 3QZEA 5A6MA 1ZJHA 1ZKQA 2QUMA 2Y61A 5HR7A 1F74A 1CPUA 4QAIA 4PBEA 3W1RA 4Y9MA 1FWJC 3G1RA 3JR2A 3TV8A 2YXGA 3DFYA 3VZXA 1VLIA 1F8MA 2X50A 4DBUA 3AYSA 1YPXA 3V0SA 3UWQA 1JZ3A 5E0KA 3V35A 3NSMA 5B7ZA 4QRNA 2Q3OA 3GIYA 3PG8A 1GVQA 2GDUA 2VYOA 1F6KA 3AMKA 1POKA 3AHVA 3LD5A 1KFWA 1VLWA 2PS2A 2FPVA 1FWWA 4HSHA 4IH3A 3T42A 4PB3A 3M5XA 4QG8A 3CBWA 3FLUA 3LTPA 3VNJA 1X1ZA 3TSDA 3UCCA 2Z6JA 4DYKA 3LS9A 1XIMA 4N9EA 3QOMA 4KEMA 1ZXIC 4NEVA 2X0SA 3UERA 1S3TC 3MQTA 1V93A 5D30A 2J77A 3QFAA 4H8HA 3SCSA 3ENLA 1TE1A 2AGTA 3M0VA 1K4QA 4IHCA 4MZ1A 1YEYA 4TTUA 5HK4A 1H50A 4LYPA 5BZAA 4ZQCA 3KTSA 4H1ZA 4PL1A 3VM7A 2YB1A 3S1VA 2ZUUA 4LCSA 3RDKA 4IUOA 1KFKA 4JGDA 3KRZA 4DB7A 1QNSA 1XPGA 4H6KA 1DP0A 5D03A 3T40A 1GKQA 4GG9A 3WF2A 4QJ3B 2FFCA 3C2RA 3OW1A 5D2VA 1VPQA 5KVIA 1WPCA 1GCYA 2X05A 3PPFA 4CNTA 3Q2DA 5I3JA 1HL9A 4Y9NA 4D8ZA 3EWBX 3SW6A 4E5TA 1Q7ZA 3GD6A 2OR2A 4AG0A 4UR8A 3WD3A 2DSZA 2YB4A 2NT0A 1OGSA 4MKNA 1GZJA 3MCMA 3XIMA 3WLRA 5DT7A 1UR8A 2HE8A 4Q4KA 4O4VA 3PJXA 4HK6A 3L4XA 2RUSA 4PUUA 3AAMA 3CWHA 4WXYA 4LUSB 2RDWA 2WSQA 1CTNA 2JGQA 2PRLA 1YW1A 3PBUA 1FEAA 1FWIC 1T7LA 1PB0A 1UA3A 3Q94A 3WDIA 2A5HA 2HTMA 2HS8A 4AWTA 3LADA 1CIUA 4QAWA 2Y7GA 1Q8AA 4QCFA 5JUVA 4MGGA 3KCJA 3PZNA 4ZTYA 5GVJA 3WEMA 6REQB 5AC6A 3I6RA 2R9ZA 3NO1A 3DFPA 3CIVA 3AYVA 4L65A 4MHBA 1EJVC 1QW8A 4K3ZA 2IPFA 4XX6A 2OEMA 1DTNA 3ME3A 4ZOCA 1GK8A 1FWGC 1UYQA 3R0KA 3W86A 1WA3A 4UZUA 1R3RA 2DT3A 4S3DA 1TTPA 4H9YA 3LBOA 4HPJA 1MI3A 3MSRA 3CYJA 2F7FA 1MQRA 3UNDA 3PFMA 4QROA 3SCWA 3UQNA 2A3EA 5D04C 4MSSA 3KHJA 4GACA 1FQ0A 1IXQA 3TN5A 3IV3A 3SGGA 5BYWA 3R10A 3B8DA 4XIAA 3CZEA 5TNVA 3N15A 1EF2A 3MMDA 1R86A 4ROQA 1CGYA 2EBNA 3VPLA 2J8GA 3A6OA 4N4PA 4F2BA 1FWEC 5T8GA 2Z0IA 3MA8A 2YFOA 3ONCA 1EPVA 2PZNA 2FIQA 4MM1A 3RX2A 1WOBA 3PUDA 1BGGA 3MP5A 1OCJA 1DV7A 1M65A 4C6PA 1L2UA 4WGXA 4B91A 3DOPA 1T3QC 2ZOXA 4RW3A 4LH8A 3SCNA 3RX4A 5H8MA 4X0VA 4KETA 3GIQA 1GRBA 2CXEA 1LYXA 1JGMA 4AZ5A 3ZWSA 1JCTA 3BH4A 2QCNA 3GR7A 3K8MA 1RLCL 4JTQA 1JZ8A 3L4YA 1FWBC 2IXUA 4QS5A 5E0CA 1K4GA 3PK7A 1YIXA 1E6RA 2HXTA 4HZMA 3DGHA 1PO9A 4YTSA 3S2CA 3STCA 1CBGA 4MB4A 3PWAA 4D6CA 4P5UA 3Q45A 3KRSA 3AICA 3CAWA 3CZLA 2D24A 2ZZ7A 2E6AA 5G5GB 1TRIA 5C2XA 1DJNA 3TQKA 3C2YA 4XKMA 3VZYA 1JPDX 1O1ZA 3KLKA 4ADUA 4RDWA 2QCEA 3EGJA 1EX1A 3EAOA 4CQBA 2Y1HA 4L1WA 4H6EA 4S39A 3N2MA 2E4TA 3DBNA 2VWTA 2V5LA 3GKAA 3VILA 3EB4A 2BHYA 2JF7A 4FXRA 5JXQA 4Q33A 4S23A 2G37A 3G18A 3L12A 1T0OA 5CLWA 2XUCA 4XZHA 2ZRZA 3UWWA 3W6YA 3BSMA 1E0VA 2IKGA 2YW3A 5A8PA 4NKCA 1KO0A 3NIYA 3AS2A 5D38A 4D1JA 4YL2A 2EJ1A 2YBVA 3O0FA 3KP1A 4LUTA 2ZZBA 4IL0A 4GC3A 3LA4A 2MUCA 2YZRA 3GDBA 4QQ3A 1XYCA 1OADA 3V36A 3KVMA 1AA1B 1JZ5A 2QAFA 4NJJA 2W4XA 2XN0A 3NZRA 1LT7A 1HQTA 1UWUA 3U2ZA 4DAIA 1EEPA 3PANA 1BXCA 4B92A 3B8UA 3MB9A 3MYOA 5FESA 4MWAD 3DHPA 4GZ7A 1PCWA 5LIUX 1JZ6A 3CMJA 3AXIA 3S8HA 4H6QA 4GNVA 1J2BA 1VCVA 4C6EA 1NVMA 1TV4A 4GRSA 2A2IA 2HMCA 2Y88A 5FF3A 3OZMA 4CD5A 1HJWA 5C9XA 2CETA 3WLOA 4WLCA 4GVHA 1KW1A 4KCWA 1XICA 3C52A 2GGGA 3CV2A 1EGVA 2GQWA 2A3LA 4GMEA 2PDCA 3SFKA 1AMYA 7CGTA 1GTHA 4I90A 4GVGA 4AHPA 1LUCB 3BANA 4JFSA 1EIXA 4ORIA 3B0UX 1AZ1A 3P7YA 5BNKA 4L61A 1W1VA 3W82A 5H2ZA 4L4MA 2QR6A 3PC0A 2A79A 3ZJ7A 1J8VA 2DSVA 1PZ3A 1KKOA 1TWIA 2QJIA 2WBGA 3EA3A 3T6CA 3ITLA 4WJ8A 2QMKA 3F4VA 1YDNA 1NU5A 1ADSA 4RV8A 5A8NA 3L7RA 4GC4A 1K1DA 1UH4A 4HCHA 1XSIA 5CH9A 3TA6A 4HU8A 1NJJA 2E5DA 3B8TA 5IM51 3BG9A 5DN1A 3GH7A 3S6OA 2NQLA 3A5FA 3CUJA 3MYPA 1PKMA 5G1TA 1F07A 1SSGA 4W89A 1PEZA 3N12A 1H0GA 1H4PA 5K4XA 3K4WA 4JIQA 5A2AA 3VIHA 4O8AA 2WMHA 3ERPA 3TZFA 4CD6A 1TZ9A 5KETA 1GESA 3EZ4A 3U6WA 3PF3A 3NQCA 1V03A 1UKQA 3M0ZA 3ZT5A 2Y70A 3WBYA 4TX8A 1BG9A 2EQ9A 1IZJA 2E9BA 3EDJA 1OFAA 3T4CA 1XKYA 1E6XM 4LW7A 2BMBA 3IJDA 1ISZA 2OZ0A 2MNRA 3CH9A 4JY8A 5I09A 2Z26A 2CZFA 3UVIA 3LTSA 5FSDC 3FVMA 3CLWA 3GU9A 3PAJA 5DCBA 2XSBA 4H83A 4GGBA 2E9LA 4QDWA 2RGMA 1ITCA 5KSWA 4TV6A 4PFHA 2HZGA 2QDHA 5ABTA 5FI8A 1EA9C 2PDPA 3CL7A 1PTDA 4CQCA 4RZ5A 1Q85A 3O6YX 3THUA 2QLYA 4JQ9A 4HD5A 2QJJA 4MY1A 4EXAA 2PCEA 2UWFA 5FAJA 5ABFB 1BWCA 2H6RA 4K7VA 4XKYA 4H9UA 4A35A 1YKWA 3L0NA 2BOGX 1LL7A 4A4AA 1KFCA 1RD6A 4EMWA 4HK5A 4HOZA 1DHPA 1O4UA 4LF2A 5ECVA 2IMRA 4ATDA 3ZR4A 5IXEA 3DG6A 1EIBA 3S6TA 4PTMA 4MYAA 1G01A 1K9EA 2F61A 1DTUA 4H4UA 3EKGA 1VP5A 2ZYFA 3T05A 1NHQA 2ZX9A 1XDMA 1DJHA 5HNUA 3RF9A 2BY1A 3G1AA 1NPXA 1AW2A 1VC4A 1ZFJA 1YMYA 2X2YA 1YYAA 3EDEA 2ZZ1A 3K1DA 4FNTA 2X0HA 2PBGA 3KP0A 1H09A 1UUQA 5F4WA 3OBEA 3UR8A 1E9IA 2OKOA 2WNWA 3HBLA 5I07A 3PWIA 4LB4A 5FEWA 2QMJA 4LANA 5BRPA 1PZ0A 1LOLA 4DBEA 4O11A 3Q6JA 5G2WA 4GIAA 4HU0A 3N17A 1E4LA 1S5NA 4UNIA 3TJ4A 3WYZA 4L4LA 3CPRA 2ZZ5A 5JVLA 4YLWA 4L6HA 1C8VA 4ZFCA 3HG4A 2ZXDA 4B2DA 2AAQA 2VGGA 4W8AA 1EHAA 1D3CA 3BO9A 1MUMA 3LCWA 1G7UA 4JICA 4FNSA 3WBXA 2WV8A 2ZWYA 3GVQA 3GM8A 3VX0A 5D2TA 4L9XA 1GQLA 1NFBA 1BSLA 4E3VA 4M19A 4C7GA 1H7NA 4DO6A 2XHYA 1QMLA 4XSMA 1UP0A 4GKTA 4TTGA 3QPEA 2X09A 1K02A 2RJGA 2W3RA 4BEUA 1GRGA 3T0TA 1FVPA 1MW0A 2E77A 4Q6XA 5CCZA 4I9JA 5E1QA 3O9NA 4M56A 3ZVHA 3AZTA 3MO4A 4A8LA 2VWSA 3U4AA 3PZ9A 4JN8A 4XVDA 1XR2A 2UV8G 3PY2A 1G7VA 4IFRA 2X99A 4J3ZA 3IIPA 2ZQ0A 1FHDA 2QJHA 1XBYA 3W1XA 3GW0A 3N2OA 3KDOA 3AWOA 1ISXA 1IXNA 2NV2A 2NXHA 3NQ8A 2HEJA 3DDMA 5HR6A 4B3LA 4AYGA 2INFA 4C7DA 2AKZA 3OZOA 2QCCA 4PUMA 1PL9A 4V27A 4XTIA 1H1ZA 3ZR6A 1XD0A 3OC4A 1P0BA 5REQA 1QNVA 5LIWX 1UPMB 2CZVA 4ZQMA 3W01A 2PDHA 1HTIA 1QWKA 1ZLPA 3GE7A 2OCZA 4OBTA 1F5ZA 3N9KA 4KMQA 1RXOB 2CBIA 2V6OA 3M43A 4DJFA 2E9MA 2ZRYA 4UTJA 3F2DA 3RM4A 1GVOA 3PP7A 2OLAA 6A3HA 8A3HA 2AAMA 2OJPA 2V38A 3NG3A 2DZSA 3K5XA 3P14A 4G5DA 2GR0A 4JHZA 3FKRA 1XX1A 4P7RA 3SO7A 1PTGA 1E1FA 1GXFA 2J7HA 2Q6ZA 3QC0A 1V79A 1UQYA 3PSWA 1ONWA 2WK2A 1JCXA 4LV9A 3II1A 2DZVA 2DU2A 5LYRA 5FKYA 4L4PA 1MW1A 1V02E 2DSUA 3LU2A 1A5MC 1H7XA 4FMVA 2OVLA 3H2EA 4LX4A 4H9TA 2UY3A 1Z41A 4BQ4A 1JR1A 2J62A 2OZ3A 4U2YA 4QNWA 3COTA 5G2IA 3UZZA 5L9FA 2CBJA 4KWOA 3WBWA 1V77A 4IQLA 4H04A 4DWDA 5LNRA 1KBLA 2W92A 3W3OA 2P8CA 1DBTA 1TX2A 1KN0A 1W0MA 1A4MA 1IT7A 4Q4PA 4H7ZA 1BD0A 2P10A 4MG4A 2CFFA 3WQVA 3QR0A 4DYJA 3SCVA 5F1VA 4NVTA 1A5NC 3CV1A 1OBAA 1JUEA 1MOKA 2GOUA 4GQGA 2X30A 1TV7A 3HURA 3H2NA 2A8XA 1W56A 1KM5A 1N8FA 2DVTA 1QRQA 4JDYA 4GYPC 6XIAA 3FJNA 2ZXAA 2FZBA 3OP2A 1JD7A 3LHZA 4CNSA 2NQJA 4IISA 3BAXA 4DVOA 4UTMA 3PZTA 1E43A 2PURA 3QH2A 2VDGA 3W87A 2WC4A 3FCPA 3PBGA 2F6KA 5E6YA 5EMJA 4B16A 5FJIA 1H1NA 4Y9OA 1CGUA 1D3HA 1A49A 2GUUA 4GH1A 4K2SA 1Q2SA 1YBQA 2B7OA 2VRQA 3FXYA 3S83A 3WG6A 2CFYA 3M41A 3QMTA 4XZWA 1UD2A 1DJYA 5FD0A 2DZTA 3H12A 2XFWA 3URAA 2GOKA 4O19A 1C9WA 3NDYA 3PWGA 1VENA 2CBUA 2WBKA 3KS5A 3T8QA 4R88A 3CU2A 4Z2IA 2P0IA 2VX6A 3I6EA 2D0GA 3GWQA 1OT2A 1DJWA 4JFTA 4TIMA 3UZYA 2C1IA 4EANA 4RE4A 3WLKX 2ZUWA 4ZE5A 4OBSA 5JIWA 3ARTA 3W25A 4AD0A 5A95A 2RDTA 2FQIA 1BVZA 2WJDA 3T55A 1S7MA 2TAAA 1AJ2A 3IJQA 3HO8A 1OCNA 3JS3A 2QYGA 4D6FA 5M5DA 5CZKA 5D8ZA 3EANA 3UJEA 2B81A 3ES7A 3EMZA 3W1AA 1UBSA 1SW3A 3QN3A 3C0SA 4RLIA 1JUBA 4CU7A 4APNA 3GD4A 1NDVA 2WPGA 1Z8AA 3URBA 1XXXA 1BRLB 1UG6A 3ABQA 1BAGA 4C6FA 2W63A 4MTVA 4J57A 3APYA 1GOWA 3S5ZA 4LJ3A 3NYZA 1HP5A 3CEUA 1ZMCA 1PE1A 3RLVA 2C3DA 3WDPP 4AIOA 4TR9A 4RE2A 5FOOA 3GUWA 2WC3A 4MJ2A 4JX6A 2INEA 3D9XA 1JJKA 3VC5A 5C6MA 3UWYA 3E0IA 2C7FA 4NZCA 3JU2A 3U57A 2IKIA 2GWGA 3H4GA 4ES4A 3VNKA 2YFNA 2GVJA 2X41A 2FVKA 5HOSA 2ALDA 3QZ6A 3W37A 3B9AA 3MUY1 4B5VA 3WZ0E 9XIAA 4X3ZA 1A5SA 2BXYA 2V5KA 2E5CA 3GFXA 4O53A 1J18A 2PMQA 2VUYA 1W9UA 3N4FA 1ZHAA 3ZM8A 3AIWA 2G0WA 3VNIA 1XBXA 1UKSA 1QBBA 2WMJA 2RGLA 5JCMA 1TR1A 3OVPA 3UWZA 5CBBA 3AHYA 3IJIA 4JTKA 4R27A 1FWTA 4PMRA 3V7PA 1LQ2A 4NP7A 2OT0A 2Y89A 1TFVA 3FAXA 3G0SA 3L4TA 2VOTA 4ML9A 4I8DA 1J12A 4WEVX 3IAPA 1WDWA 2BNJA 1DIOA 1ZBCA 1PJ9A 2FHBA 5M17A 2J8FA 3LSCA 1FXPA 2Z2AA 4EQRA 3NVWB 2D3NA 1OD0A 1FO4A 1WX0A 1XLIA 3WUBA 3W7IA 2IXVA 3LRMA 4WDTA 2WM1A 1XLCA 1FHVA 2CEQA 3UYCA 1N60C 3OA5A 4L5ZA 3LLXA 2VFEA 5T26A 2JFEX 4ZOHB 4DNAA 1JGIA 3M64A 1OHLA 4FK9A 4OZOA 1ZQ5A 1YXYA 1YQZA 1ADDA 4J9JA 2D2GA 3MCNA 1PSCA 2OG9A 1S2VA 4GUJA 4HZ7A 1IV8A 2GQ9A 4RXFA 1KRAC 1W3JA 4X63A 4PMNA 4JFVA 4YWOA 4QJ1A 2R1PA 4O17A 7TAAA 1ESWA 1GVSA 2ZVRA 3WH6A 5HMFA 1VB9A 3MCOA 3H8AA 4B5SA 1A5OC 3RITA 3VIPA 1VBGA 2PEVA 1BWLA 4JHMA 1YHTA 2I5QA 3G22A 2Y5JA 5EMYA 1JL8A 4DM1A 1JYNA 3CAQA 3FEMA 5AYIA 3GXNA 3N4EA 2GSHA 2DVXA 4REQA 4AEFA 2QZRA 3I7QA 4J5NA 4Y9AA 4R9XA 1E5JA 1YE6A 2V8ZA 3JUGA 2YIHA 2ZCGA 1UBPC 3E12A 2O4MA 3PPCA 3FA5A 4EPKA 3FAWA 3IRSA 5TIMA 3ZWTA 5GJPA 2WO5A 4GGHA 1YTDA