1KKOA

Crystal structure of citrobacter amalonaticus methylaspartate ammonia lyase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
411
structure length
411
Chain Sequence
MKIKQALFTAGYSSFYFDDQQAIKNGAGHDGFIYTGDPVTPGFTSVRQAGECVSVQLILENGAVAVGDCAAVQYSGAGGRDPLFLAEHFIPFLNDHIKPLLEGRDVDAFLPNARFFDKLRIDGNLLHTAVRYGLSQALLDATALASGRLKTEVVCDEWQLPCVPEAIPLFGQSGDDRYIAVDKMILKGVDVLPHALINNVEEKLGFKGEKLREYVRWLSDRILSLRSSPRYHPTLHIDVYGTIGLIFDMDPVRCAEYIASLEKEAQGLPLYIEGPVDAGNKPDQIRMLTAITKELTRLGSGVKIVADEWCNTYQDIVDFTDAGSCHMVQIKTPDLGGIHNIVDAVLYCNKHGMEAYQGGTCNETEISARTCVHVALAARPMRMLIKPGMGFDEGLNIVFNEMNRTIALLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-METHYLASPARTATE AMMONIA-LYASE
publication title Insights into enzyme evolution revealed by the structure of methylaspartate ammonia lyase.
pubmed doi rcsb
source organism Citrobacter amalonaticus
molecule tags Lyase
total genus 154
structure length 411
sequence length 411
chains with identical sequence B
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2001-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
A PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1kkoA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1kkoA01
4DYEA 3UXLA 4Z1YA 3RGTA 3QTPA 4MKSA 2GDQA 2PODA 3ZLFA 1EBGA 2GGGA 2QGYA 1WUEA 4HNLA 3DEQA 2PA6A 1ECQA 2P0IA 4GISA 4GFIA 3I6EA 3N4EA 3Q45A 4HNCA 2QDEA 3DERA 1KD0A 1MUCA 3DFYA 3CXOA 3ZLHA 2HNEA 2GGJA 2AL1A 1TE6A 3CK5A 3DGBA 3D47A 3DDMA 4HCHA 4YWSA 4JN7A 3V5CA 2PCEA 3TTEA 2OLAA 3SN1A 3NO1A 4F4RA 3PWIA 4FP1A 1PDYA 4ZCWA 2AKZA 4E4FA 4JHMA 4M6UA 2ONEA 3OW1A 4GIRA 1MRAA 3Q4DA 1R6WA 3RRAA 3SQSA 4K1WA 3OZMA 2PMQA 3UJRA 3V3WA 3V5FA 3RO6A 2ZADA 3MQTA 3KUMA 1KKRA 1FHVA 6ENLA 2QDDA 3P0WA 2FYMA 3NXLA 4E6MA 4K2SA 4KEMA 3P93A 2OQHA 3TCSA 3UJFA 4E8GA 4HCDA 4A35A 3SN4A 3FXGA 3UCCA 5J04A 4DWDA 2P88A 3SSZA 4IZGA 2AL2A 3IJIA 7ENLA 2O56A 4GYPA 3CB3A 3BOXA 4H1ZA 3NZGA 3GO2A 2DW6A 4EWJA 4H83A 3ES8A 2GGIA 3MSYA 3H7VA 5BOFA 3UGVA 3CT2A 3I4KA 3QLDA 3OZYA 3V4BA 2HXTA 3TW9A 3DIPA 1JDFA 3FVDA 4FI4A 2PU1A 1SJDA 2PP0A 1SJBA 2PTZA 3QN3A 2OFJA 3QPEA 3RCYA 4GGBA 2OG9A 2P8BA 2CHRA 4MMWA 1PDZA 2P3ZA 1XPYA 1BKHA 1F9CA 3T9PA 3VFCA 4H2HA 3S5SA 1NU5A 2DW7A 2PS2A 3K1GA 1XS2A 3ES7A 1P48A 3UCDA 4DN1A 3GC2A 5FJOA 1EBHA 1JPMA 4X2PA 3SJNA 2OX4A 4IT1A 1E9IA 1MNSA 1ONEA 3TJ4A 3FCPA 2GL5A 4ENLA 4H19A 3FYYA 4G7FA 3TWAA 4JN8A 2PPGA 2XSXA 3OTRA 4ROPA 1EC9A 2GGEA 3FV9A 2FKPA 1MDLA 2QJJA 1FHUA 4HCLA 2OZTA 2PU0A 2PSNA 3PFRA 2OO6A 3IK4A 3T6CA 3MY9A 4GYPC 1KKOA 3DFHA 2PP1A 4MGGA 1NELA 3HPFA 3VA8A 3U4FA 1RVKA 3TWBA 2GGHA 3JZUA 3ZVHB 1ELSA 3SN0A 2HXUA 3TOYA 3U9IA 2MNRA 3B97A 3VC5A 1DTNA 4KWSA 1EC8A 4ZA0A 4GMEA 5FJTA 1BQGA 3R1ZA 3PK7A 3P3BA 3ZLGA 2AKMA 4IL2A 4IL0A 1YEYA 4GGHA 4E5TA 1TKKA 3D46A 3OPSA 1OEPA 2POZA 4DX3A 2RDXA 3MWCA 4Z17A 2I5QA 3EKGA 4K8GA 3JW7A 3S47A 3UJSA 5IDZA 3CYJA 4HN8A 4DHGA 2XGZA 3BSMA 2HZGA 3N6JA 2XH2A 3NFUA 2OQYA 1W6TA 3T4WA 3I6TA 1R0MA 2QJMA 3DG6A 5FJPA 4E4UA 3OP2A 2PTYA 3T8QA 2QQ6A 3R0UA 1JCTA 4HYRA 3ZVIA 1IYXA 3RITA 1KCZA 3RR1A 1L8PA 2PTWA 1WUFA 3BJSA 4G8TA 4IP5A 4J1OA 2PGEA 4DXKA 3IJQA 3UJEA 2NQLA 2PTXA 3GD6A 3N6HA 2PP3A 4KPLA 5ENLA 3DG3A 1SJCA 3TQPA 3N4FA 2XH7A 3R11A 1TZZA 3IJLA 3EEZA 5BOEA 3R10A 3DESA 1P43A 1SJAA 4A6GA 3VCCA 3CAWA 3H70A 1MDRA 2OZ3A 3H12A 4KT2A 4IHCA 3FJ4A 5EU9A 2PGWA 4HPNA 3UJ2A 3VDGA 2ZC8A 3ENLA 2AL2B 4A3RA 2XH4A 3VC6A 3GY1A 3R25A 3ZVHA 2GSHA 3QKEA 2XH0A 3UXKA 5FJRA 3THUA 2P8CA 5FJUA 3R0KA 4J3ZA 1EC7A 2QVHA 3VCNA 2OPJA 3MZNA 3H8AA 2OVLA 2QJNA 4IP4A 4M0XA 3DG7A 3PWGA 2MUCA 3TJIA 3JVAA 2OKTA 3STPA 3MKCA 1JPDX 3MUCA 3SBFA 2OZ8A
chains in the Genus database with same CATH superfamily
1YBQA 5DMMA 3P84A 4Z1CA 5GNXA 2V3DA 4J40A 1PPIA 1MXDA 1IGSA 1LZOA 3ZLFA 3W86A 2WANA 3DN5A 5CAHA 4I6KA 5LIYX 4HOZA 2V5CA 2PI6A 3P6LA 3Q45A 1VD6A 2D2HA 2QDEA 1ML1A 3ARVA 3NQEA 3DFYA 3MMTA 1KXTA 1NARA 4BA0A 1JNEA 3ABOA 6REQA 1TE6A 5IM51 1E6XM 5A6SA 1LOQA 2A79A 2WMFA 4M1BA 3GU2A 2EPNA 3SN1A 3BVJA 2FZMA 3CGBA 3VKDA 2PDCA 4AHPA 2R14A 3B3DA 4N7QA 4GY0A 3B0XA 1FEBA 1KA9F 2ZWZA 2WVTA 1KQYA 1IIHA 3C0QA 3OYZA 2UY3A 4LAZA 3HIJA 4IF2A 3OZOA 5BRBA 3WKZA 2QDDA 5EMJA 3L0GA 3HPSA 1LUCB 1GG0A 4YHGA 3GHRA 3PAOA 1B2YA 2WMIB 1GNXA 1WO2A 4DWDA 1XIIA 3WIJA 3WF0A 2GUYA 2PAJA 4IFRA 2WOQA 3PUDA 1JI1A 5C0QA 5FS9A 3T55A 4AZGA 3VIMA 3N9KA 5JCIA 3NEHA 3NZGA 1V0KA 3DHDA 4EANA 3WDPP 4EF9A 2A3CA 3QGAC 4JFSA 4M82A 3QLDA 4PMUA 2HCVA 2YR1A 3TW9A 1FWRA 4FNUA 2WPCA 1SGJA 2Y7GA 4ALDA 4JYEA 4PRRA 4W85A 5FEPA 4H4RA 2BY0A 4E3TA 4LWWA 3UG5A 2CHRA 4C6LA 3KBJA 1XPYA 1WPCA 2ZX7A 4WIWA 2VM8A 1VDVA 3VFCA 2CLKA 3D3FA 4FIQA 1XISA 3W1MA 1U30A 3ZJ6A 3S46A 1XS2A 2PWVA 4CNSA 4NAFA 1OGSA 3GR8A 5T9CE 5J8LA 4GI6A 5F2IA 5MKGA 5BWFA 2YDQA 5D2WA 2VR2A 3FCPA 4B4HA 2OB3A 3W7MA 4DM2A 1JRBA 2YIHA 1W9PA 1LP6A 5JBDA 3WH9A 4AY1A 1C91A 2QCCA 1N2VA 5E9AA 2A1YA 4XTIA 1E1CA 4Q4SA 4KH2A 1OFAA 3N2TA 1CLVA 3IJ9A 5XINA 2ON3A 3SEPA 3CIXA 4EPEC 1V6UA 5HJYA 1OX4B 1FQ0A 1RY0A 2C3CA 3MBFA 1AH0A 3VTRA 4HZMA 1CX9A 1TG7A 3NYDA 3KVLA 2CESA 3CHCA 4CQCA 4FPSA 1RVKA 2OYMA 3M1ZA 4GKTA 2P1FA 5C7VA 3HRDC 2BASA 4HSOA 4NI8A 4U28A 3UU0A 5A8QA 3AS3A 2VX4A 5FF3A 3AWOA 2HQAA 2FB3A 3W53A 1WNOA 7TIMA 3EXSA 4PMDA 1M7XA 1FKXA 2VC5A 2Z28A 3QF0A 3W70A 4DUVA 1XLFA 3MPGA 3CS2A 4ZODA 2D2GA 2CLHA 1IWPA 5AC8A 1KBJA 3ITYA 4BR1A 3EA1A 1JZ2A 5CGTA 3WDQA 1O5KA 1VYSX 3A24A 3AYTA 3GVQA 4F0MA 3TTOA 4PRTA 2WSRA 4J3SA 3DCPA 2Y85A 3IUDA 2YXOA 4A22A 4Q6JA 3NQBA 3IK2A 4WD0A 3ALGA 4HNNA 3IWPA 4XK2A 4E4UA 3E1F1 4MUPA 5H6HA 3IANA 1E4MM 4DWSA 2A7RA 4DBUA 4O10A 1IYXA 4K36A 4U3CA 3ZFHA 3ID7A 4V2XA 4WJEA 1DJZA 3GRIA 2ACQA 1L8PA 4EKJA 5CJMA 4QDPA 4TO8A 3NGFA 2OWCA 3U6WA 1IXOA 4Q4OA 1AMYA 2TAAA 3LRKA 4B3LA 4FEZA 1JZ8A 4B5TA 1K7XA 1XLHA 3VE7A 4FALA 1LL6A 2Q6ZA 2F9RA 3O7UA 4E0CA 4MOZA 4NY2A 1ZQ5A 4Z0SA 4C6BA 2ZUWA 3SADA 1GRFA 3VILA 2XVGA 2CFYA 1L6GA 1EGVA 1HKMA 2PDKA 3II4A 3AS0A 5A8OA 1FX6A 4GQBA 1A5BA 5LZLA 3WDRA 4JKMA 2TSYA 4QIUA 1M7JA 3HMCA 2BX7A 3FNDA 3PR2A 1LG2A 5MF5A 4ILSA 4BZYA 3BK0A 1B3ZA 1UP2A 4US5D 1WXZA 3RUBL 5FESA 3ANUA 1TPB1 1J5TA 2PE4A 1UD4A 3VOHA 2GUUA 1U5VA 2IQDA 3TJXA 3KRSA 1UPPA 3CWNA 1EKOA 1TTJA 1IR2A 3DXIA 3RIKA 3MUY1 3RX3A 3H53A 3JUGA 3VU2A 1G5AA 3LZ5A 3QV6A 3PBWA 3OBKA 3LA4A 3A9BA 2QMKA 5LNRA 2OCZA 4PL1A 2V6OA 1J0YA 3ECQA 3L2MA 4QGCA 2B7OA 3LPGA 3WL0A 5REQA 3WLJA 1JAEA 3WFAA 3MV01 3LG3A 2Z7KA 2VTFA 1XIGA 1F5ZA 2QT3A 1GRHA 3RM4A 1QI2A 5H1WA 1K4HA 1JOAA 4N9EA 1JQVA 4G56A 3T05A 3K8KA 4S3GA 4H7VA 3THCA 1QTWA 2WP5A 2GK1B 3BLLA 4ZB5A 1NDWA 3UXAA 2BGQA 3TJLA 2YXGA 3PZ9A 5H8MA 3OLIA 2YB1A 3G5EA 1EUNA 1YXCA 4FK9A 4J3UA 3QGKC 3CL7A 2W0HA 3HPXA 4MPQA 1U1JA 4UTFA 4LBRA 2QCHA 3U3HA 4H4UA 1PZ1A 4ZOAA 1ZZMA 5D37A 1BVZA 1O94A 3TTEA 3H4WA 2OLAA 4TMCA 1AW2A 3L7RA 1QOQA 3WLRA 1FWGC 2OXNA 4NASA 3V18A 1K7FA 1Z41A 2PLMA 3HOJA 4OUIA 4GIRA 1QT1A 3CUJA 4WKAA 3RPMA 2WZTA 3I4EA 1EYEA 2XINA 2XVPA 3I65A 2DSVA 1FFQA 3LLFA 2LLEA 1EUAA 4U4MA 1EQPA 1TUFA 3LHWA 4AZ7A 3OLEA 1VIWA 3GNOA 1TX2A 4BEQA 4OOZA 1OYBA 3FVMA 4QQ3A 5DRCA 2ZBTA 4C90A 1ONXA 5D04C 3MDWA 4GUGA 1V6TA 3SN4A 5E70A 2QCNA 2HDJA 4H8NA 3TK7A 4R53A 4GYPA 3HG5A 1UIPA 1FY6A 2X1IA 1H1YA 3S5ZA 1SZFA 2I5GA 3NQGA 1UWRA 2GGIA 1JPIA 4PCNA 1P4CA 5JQ9A 1UZDA 5CZJA 1XHCA 1XH0A 3FJLA 5AYIA 4FHAA 3V4BA 4YYFA 1W9XA 2HS6A 1JDFA 1O7AA 1P6WA 5XIAA 4XKYA 4HA1A 3CQHA 3IEBA 1XLDA 5CLTA 1XIHA 1CGYA 2P53A 1J10A 3WQ6A 4PODA 1DIOA 2W5FA 1W3JA 5EBAA 1V97A 1VENA 4BCEA 3I7RA 1OFEA 3CMGA 4DN1A 1REQA 3W38A 3LHVA 5DN1A 5A6KA 3VGDA 1H2IA 1I1XA 4QX4A 5A2AA 3UW6A 1WOBA 3ZQ9A 1LBFA 4Q32A 1MNSA 4Y9NA 4S1FA 1YDVA 4P5UA 4JTUA 3ARTA 1J96A 4H19A 1MQQA 2ZKMX 3G1DA 3VNYA 4BF5A 2C91A 3G18A 4ROPA 2GVYA 5FMHA 3S2LA 4POCA 1DWIM 3NQVA 1LT8A 1Y5WA 2GJPA 2EPKX 3BG9A 2OX1A 2EPLX 4N4PA 4D1JA 1JNDA 4CLMA 2OZTA 3OB8A 1BYCA 3C6CA 5D2TA 2GVJA 3AYSA 3WQPA 4DJEC 3DFHA 1A3HA 1N62C 3S9ZA 3GZ3A 3LM7A 3UVIA 1XG4A 2HXUA 3EB4A 1ZKQA 1E5JA 3NQAA 3CHVA 4QSFA 1US2A 3V35A 1XLAA 3HU7A 4K8DA 1GKQA 5A5WA 4AWUA 1TZ9A 2YX0A 2W62A 3VIKA 4IGNA 1VYPX 4N0RA 3L5LA 4IMAA 5C9ZA 2C1IA 2D73A 1BWKA 4MUZA 3HM7A 4ORIA 4G1NA 1Z48A 1S2CA 3AO0A 4E8DA 3EKGA 1RM6B 4UFIA 4JD4A 3CJPA 5IDZA 4CGTA 4TVYA 4QE1A 4W7VA 4G1KA 1X6NA 2ZUTA 1TPH1 4XAYA 4QE5A 3DFTA 4DJDA 1V3MA 1N5WC 1LTDA 4P7LA 2DUZA 1PKYA 2ZXAA 2EF9A 4PUUA 3LXDA 3SB0A 1XXXA 5AY7A 3V0TA 1SSDA 3WMCA 2E4TA 5HR6A 3BGJA 1W32A 3HGOA 4CN1A 3RR1A 3ZSSA 4RNFA 4F2TA 3A13A 4M3PA 2AAAA 4L65A 3W7KA 1MMFA 2YDRA 3KLLA 1VEPA 1YW1A 3VIOA 5LYRA 1ZAHA 4W86A 4FNQA 1ESWA 1LQ0A 2BVTA 4KKXA 3WUGA 3MANA 4TV5A 4YS1A 3ARSA 2QGHA 2I16A 4PMZA 4TIMA 1HQTA 4ZL1A 2E28A 3C3NA 1NIUA 2WCAA 1HKKA 1XR2A 3SRKA 4IIEA 2PTDA 1BD0A 3LBCA 2YL6A 3ZJ8A 2WSKA 5G2HA 3ZT6A 6CGTA 3CPRA 3S0CA 3CUHA 2NVCA 4MWAC 5CSYA 3B05A 2CCRA 3RYSA 1HO1A 2VGIA 1ISVA 4JICA 3VIJA 3S2CA 4WK9A 2DT1A 1KR1A 5C9UA 4HPGA 2O7SA 1GVFA 1ISZA 1MSSA 2O0TA 2A5HA 3F5JA 3FKKA 3W1NA 2RUSA 1R8LA 4O1BA 4G7EB 3G0SA 3GXMA 3UXKA 3NEVA 2QULA 3B9JB 4I7UA 3ETRB 4IX0A 4UTTC 2J6XA 2WB5A 4KWOA 4QCEA 4YU1A 3SSJA 3SQPA 3P80A 4QLLA 4IP4A 4DY1A 2FVMA 3CB8A 3JVAA 2VFGA 3REQB 1O1ZA 4WRHA 2YXXA 2EQ6A 4Q8MA 3IUIA 5BXSA 3GIPA 1RHCA 2CU0A 2E1DA 4TR9A 1CCWB 3N25A 4M51A 4JTAA 4N9CA 2QCDB 4CQ9A 3RGTA 3QTPA 2PODA 3VNKA 1HP4A 2VEPA 2R9RA 1B57A 1PBGA 3WLLA 2A8XA 4DEFA 5D4YA 1I0DA 4H8UA 3V0UA 2NX9A 2NUWA 5FCZA 1JEHA 4MHBA 1ZENA 5BCAA 1XQKA 3NS1B 5HMDA 1W37A 1Y0EA 2NZLA 4LVAA 5A8GA 5I3KA 3DGBA 3M0HA 2VUYA 4QXIA 2W92A 4DUOA 3UR2A 4RDZA 2EG6A 1EPVA 3STFA 3II1A 1RQEA 2VKZG 3W22A 1QDSA 4DBWA 4A2RA 4UTHA 4H4YA 3E96A 3L8KA 3QHOA 4PB3A 4O1FA 4EM3A 4ZGYA 3WLQA 1RQBA 1F8WA 3H4GA 3B8WA 3PUOA 1QNVA 3UJRA 1H0GA 3OQEA 4OQVA 4UCFA 4OBRA 5AB3A 3RO6A 3KFTA 2QAEA 3CNYA 1TVNA 3KUMA 2G8ZA 3URHA 4RNHA 4ZZ9A 3SUVA 3NQCA 5BXTA 3CO8A 1OCBA 4K2SA 2EQ9A 2VZSA 2E68A 2REQB 1N8FA 4I7WA 2R91A 2WNQA 3CQJA 5E0FA 3BICA 1XINA 2PGRA 5I77A 3BLOA 1OFBA 2ZXDA 3MMWA 3O05A 2BB0A 4INFA 3KOZA 2W67A 1UUQA 2OSYA 1S38A 2EPMX 1HVXA 4ML9A 5DT7A 3NL5A 3KDNA 3AJXA 4JDBA 2IKIA 4UZSA 3LXCA 1V3KA 2QJHA 2D0HA 1I1WA 3TYDA 1SJBA 2QCMA 3FA5A 4CU7A 2OFJA 3BARA 1OFQA 4DZIA 1IQ8A 3EX6A 2ZUSA 1A4MA 1F3XA 4DNMA 3IV3A 3N14A 3NVDA 4RW3A 2FZBA 4UR7A 1TUXA 3ARRA 4TVDA 2WOVA 4FXJA 5M3WA 2WSQA 2VEKA 5FJOA 1V3LA 1S2TA 5K9DA 3FX4A 4REQB 2GWGA 2PWDA 1ZGDA 3GR7A 2WCSA 4H4PA 6XIMA 1JYVA 1FP8A 3NVZB 3JR2A 1SYTA 2GQ3A 3N2BA 2WQDA 4HQVA 2P3EA 1Z32X 3AISA 1TYGA 1LL4A 3S83A 2JEPA 5DMLA 3P67A 2OR2A 3MBDA 5BXPA 4ASTA 5XIMA 3G6LA 3GVVA 2CERA 1PS9A 2ZX8A 2VOTA 3SDOA 2XZ7A 4HK7A 4MFEA 1B0IA 4W84A 3H2EA 3PHAA 2ZOXA 2ALRA 1IXPA 4PCTA 2C16A 3U2ZA 3ZSTA 1ENUA 1HJVA 1DE5A 1TWDA 2QS8A 4ZTYA 4KPRA 5GRTA 4BWLA 2D2JA 3VIGA 1RJQA 3JZUA 1TRDA 1TTIA 4L1GA 1RPKA 2C7FA 1VBJA 1S2AA 1LT7A 1BQGA 1KWKA 3APGA 3NZQA 3R8GA 4UTWC 5I5RA 5D9MA 2AKMA 3ZLGA 3GE7A 3EB3A 4MNKA 4MZYA 1B4KA 3KWXA 2ZXQA 4GGHA 3VOCA 2GVGA 1OEPA 2XIMA 1CNVA 2FIQA 3W7LA 3BW3A 3NG3A 1US0A 3EYPA 2WP6A 2VP8A 1M3UA 2CHOA 2B4GA 3F2CA 3NOYA 3E49A 3W2MA 4F0RA 1QI4A 3A3XA 3AMLA 4UXDA 3GNRA 4RL3A 1XH2A 1US3A 2NQZA 2PDYA 2B7QA 3VX0A 4GJJA 1ME7A 5I3HA 3LN3A 2FHCA 5BU9A 1FWEC 1KCKA 4E2BA 5ABFB 2VRJA 3W23A 4XISA 2BP1A 4C6QA 1W3HA 1EB3A 4LGXA 3VO0A 3OGRA 1RZMA 1I2PA 3LSBA 1NDZA 4B2DD 4A29A 4B5VA 3QBUA 1GOMA 1RJPA 3FOKA 3PSWA 2DVXA 1VJIA 3FGCA 4H4TA 4ROQA 5LNVA 4W93A 1EJXC 3GNDA 1JRPA 1XBXA 3MJMA 1E5NA 1J11A 3CLWA 2AMXA 3S6OA 4HGXA 4QG6A 3EX1A 4ADUA 4JIIX 4BI6A 2UY4A 4P8VA 1F74A 3GIYA 4C7GA 3K5XA 3QW3A 1PCWA 1IV8A 1E70M 1TX0A 2KX9A 2BGNE 1FOBA 1QCWA 2X2GA 1JZ7A 1JF6A 1OCNA 3AIWA 1E0WA 2ATMA 3LPPA 3EBVA 2OT1A 5AHIA 3UJ2A 3AXKA 3DFPA 1I9CB 4AUBA 1UOZA 1VKFA 2YPIA 1MEHA 3NJ3A 4MWAB 3GTXA 1H7RA 3ONCA 4F0KA 4C91A 1PAMA 1YTKA 3A22A 2WZMA 1UWTA 3IAPA 4NL1A 4DYKA 2QJNA 4K7ZA 2HBXA 4R88A 2EXOA 3PWGA 5A6BD 4GZEA 2X8HA 1X7FA 3P61A 1E56A 3BE7A 1DHKA 3GDBA 4LCRA 2XFRA 4KWWA 2O55A 3ZZ1A 2X8RA 3MHFA 4S3JA 1FH7A 1BPLB 1KM3A 2CYGA 4TVUA 3S3GA 5GNYA 1M6IA 2INFA 5G4EA 4GI8A 4AZCA 3AMGA 2CWXA 1BGAA 1ECQA 4NZ3A 2CPUA 3EKZA 3CUXA 4CN6A 3SCOA 5LNSA 1MUMA 1NHQA 2WHLA 3VKBA 1LRTA 1UWQA 2WOWA 1GYMA 3T0BA 2A85A 1U5HA 1IWBA 1PE1A 1X1ZA 2YOCA 4UTUA 2W3ZA 1P7TB 4KCTA 3FAXA 4YWSA 4GBUA 1KB3A 4RZ6A 3CBWA 5I09A 4QJ1A 2Y24A 4J3XA 1JGMA 4AB4A 1WZLA 3W1LA 1G7VA 4DZHA 4Y6GA 2EGZA 3H24A 1XFBA 4ZCWA 1KTBA 1CB7B 3M0LA 4WJ8A 2ONEA 1FWBC 1KWGA 5LXEA 2C15A 2AQOA 2J47A 4EQSA 3R5EA 1XM3A 1GYLA 2Q02A 2XZ9A 3DUGA 1OF8A 4NX0A 3ITCA 3STGA 5IHSA 1EEPA 1ONRA 4ECLA 1VH7A 1Y8BA 3N3TA 3SY5A 2Z1VA 3TEVA 3ZO9A 1VFHA 2V9DA 3L21A 3N17A 3WEOA 4UQDA 2D1ZA 2XPKA 3P93A 2Y62A 4HCDA 3WD1A 4PCSA 2CNCA 1KFEA 3OVGA 1DORA 1WZAA 4H4WA 3W7DA 2Z29A 4GZ7A 1CB2A 3EPMA 1GXFA 1EF3A 3E74A 2DPEA 1GETA 1UD3A 3C2RA 3O6DA 2H3BA 1W5PA 4HYWA 3WD3A 2HVMA 2HS8A 5HPCA 3AN1A 3DYMA 3ES8A 1GOOA 1GQIA 3BAYA 4L5ZA 4IFOA 1K3UA 3P82A 1JULA 1W1ZA 1QR7A 1BF2A 4O0KA 4MG4A 1V79A 3DIPA 3MYOA 2OQLA 1TZ7A 1SJDA 2YYTA 5M2FX 1VPYA 5KITA 5A8MA 4ATWA 3RCYA 4GUHA 1RJRA 2H9AA 1OSEA 2PDHA 4AU0A 3VDBA 1EF2A 3VZXA 1H50A 4DNHA 3A3WA 3CAQA 4MMWA 1O12A 1Z8AA 1SR9A 3WN6A 2ZVRA 1PCKA 5FS7A 4P8UA 3T9PA 4FF5A 1IEWA 5EMUA 2YCJA 2VDIA 2X0YA 3EWXA 4AC7C 3VD9A 1GGOA 4XAPA 3VE9A 3VKAA 2WHKA 4QTGA 3NWRA 7REQB 3M41A 1JPMA 2UBPC 2PBGA 3BZJA 1W9UA 1X39A 1B1YA 1RCOB 5I3DA 2YCIX 1QOXA 2V69A 4X63A 4E4PA 3FA4A 1DWAM 1H60A 4BI7A 1P5BA 4TOQA 4ZQCA 4YPJA 1QATA 3OTRA 4I9JA 1C8VA 3BUVA 2BY3A 5E6YA 2VVSA 3FV9A 3IJ8A 1LOLA 4XKMA 3SIMA 4AQLA 3UA3A 3SCVA 3TW7A 4AY8A 4A3HA 1JVNA 2YLLA 1VQTA 4WKFA 4PB5A 3M0JA 4MB1A 4UB9A 3MY9A 1J2WA 1Q2RA 3SZ8A 3MHUA 2YDAA 3AI0A 1Q1RA 2BXZA 1E4LA 2VEGA 5DY2A 2UY2A 3W1UA 3B8TA 4AZIA 2DZVA 2C8NA 1HTIA 4KWSA 3OEXA 4F9DA 4DJED 3LGEA 4S38A 1PZ0A 3VX1A 5SWUA 2DQXA 3KCOA 4IH3A 1KXQA 1XYBA 5F1UA 2C1GA 3G1RA 1Q6RA 2WNNA 2XVNA 3PBVA 3THQA 3FK4A 4OZOA 3MC5A 1LRQA 3K4AA 4YTUA 4QP0A 2VFHA 4GNKB 2ACUA 5A8PA 1TWWA 1YBQB 4DJFC 4LV9A 4GXWA 1PWMA 1X6LA 1XLLA 1W56A 1C7TA 4HB7A 3WUBA 3ICJA 3PUGA 4C7FA 5H2ZA 5CZTA 4LSBA 1QBBA 4W9TA 3PTKA 2FPYA 2FFCA 2X30A 4WGXA 1OG6A 4O12A 4OUEA 4DO6A 4O8AA 5A69A 1EHAA 1QI3A 3VMPA 3ITTA 5BU6A 7XIMA 1NM9A 3IV8A 1J8VA 2DSZA 6REQB 3QFEA 5CSRA 4AWEA 2OLHA 4XZHA 4UNIA 1OIMA 4GHRA 3USBA 2ESCA 4M5PA 1OINA 1UR0A 5IBXA 1S1RA 4PUWA 2OJPA 3WJSA 1B9ZA 4RLIA 1PWLA 1W17A 1JF5A 4UIOA 5LHEA 2A2IA 4GNJA 1HN1A 3QMTA 3GWQA 3M5VA 3PWAA 2CEQA 3OLDA 4UOJA 1CGUA 3UZWA 1XIMA 3V1PA 7A3HA 4M19A 4H9XA 2ICSA 3USZA 3ISIX 5C6MA 4LC6A 3ELFA 5GNZA 5EBKA 4HOXA 3B04A 3C4UA 4LUTA 3QR0A 2V3FA 1LJYA 3DBNA 2V0TA 2YBUA 2WSPA 4OVXA 4FNPA 3LCIA 1B3VA 3L0KA 3ITGA 3QFWA 5T9BG 5D30A 3RN6A 3G1XA 3RMEA 1JROA 4ERIA 4FNTA 1JCYA 3BAXA 3ITLA 3RU6A 4HU8A 2D3LA 1LRNA 1Y7VA 2INEA 2IUZA 4C6JA 1BWCA 1ZS2A 3IGUA 3CMJA 1DTUA 3R0KA 4U2YA 2E3TA 4M0XA 1NJJA 3TYZA 4J2MA 1ADSA 1B31A 3WH6A 2WAGA 3F2DA 5CJ5A 2XFYA 1F61A 1AA1B 3P74A 3WK0A 5C5YA 4ML4A 4MLRA 1RP9A 1E73M 3QYQA 4RNJA 4XZLX 3NIYA 4Y8FA 4H50A 3MKVA 4E3VA 3DFNA 1CECA 4IQDA 4UBPC 2QCEA 2BDQA 3K8MA 3PG9A 4KGLA 4NAFB 5F7UA 3MP3A 3DEQA 1CWYA 2B81A 4RDVA 2GJXA 4Z2JA 2WKLA 4LH8A 4HNCA 1R46A 4BHYA 2DUAA 4NJIA 1NOWA 3AICA 3FN9A 2BS9A 3O6AA 4I8DA 3V75A 1EO5A 3L5OA 1AK5A 1TQJA 3LHTA 1RSCA 3MKKA 3WJZA 2PLKA 1LROA 3QFAA 3UZ5A 4R9XA 1UR9A 1ADDA 1E1CB 3KXQA 1W8GA 3BH4A 1X97A 3WDJA 4JTHA 2FMOA 4E4FA 1CIUA 3L9CA 3IUHA 1A5KC 1MRAA 1H49A 4QAWA 2XIIA 2D20A 2FHBA 3TP4A 3EA3A 4FLQA 2I57A 2QUTA 3PPCA 1R7OA 2VCCA 3SCTA 3G1FA 5ER0A 3LCGA 3V3WA 1OYCA 3QSTA 1Q4NX 5EYWA 3BTNA 2ODOA 3W7QA 3ZOAA 2PLCA 4BQ5A 4LAMA 5C71A 3MQTA 1UG6A 2VUNA 1KKRA 3NSNA 3BURA 6ENLA 4B9ZA 4DXVA 4IJBA 2EKGA 4JL2A 3W7EA 4KEMA 1AUSL 4XZMX 1ZJAA 3QTGA 3B9AA 2FHFA 3W01A 2ZIDA 3W88A 3C86A 5A8NA 3SSZA 1ZCOA 3GFXA 3FYOA 1V6VA 1X1OA 2YL8A 4QQUA 1VCVA 4OV9A 3NXFA 2QCGA 3LX9A 3CB3A 3PZIA 3ZJ7A 5AFDA 2DEPA 4IX2A 3LS9A 4MJZA 1PSCA 1ITCA 2DW6A 3QZEA 3LOTA 1OK6A 4JHZA 4J56A 4YHEA 3L5AA 3QC0A 3VZZA 1JD7A 2BCPA 2WK2A 4LX4A 2HXTA 3M47A 1G67A 1JI2A 3TYCA 2PP0A 3LERA 3QPEA 1N8IA 5GJMA 2HK0A 3SCNA 3E6EA 1UHVA 1GKRA 4F48A 3LUTA 3LI0A 3GKFA 1XYFA 4DWSB 2OSXA 4AHQA 1ODUA 1VLIA 3CYVA 4RR4A 3WQCA 2QKFA 3ABRA 4FMVA 3ABQA 5CC6A 1F9CA 1F4AA 1R9ZA 1LWIA 3WQ5A 4R27A 4KETA 3BZGA 3GXPA 2GWNA 4C6KA 3WNOA 1YMYA 3WQFA 3T81A 1ZAIA 3FAWA 3W87A 3KRZA 4PCFA 3W7GA 1G0CA 2YCLA 1V59A 1A50A 3BQ5A 3EOSA 2E77A 1FCBA 1XG3A 1ZB5A 4PTWA 3ALFA 3EGJA 3A4AA 1RVGA 5DQPA 4J9JA 3A7UA 1A5OC 3NO3A 3N12A 5LHFA 2WVVB 4B3ZA 3UY8A 1XKJA 1SFSA 3QM3A 3BLEA 3WH7A 1LM1A 4JIHA 1MDLA 2BXYA 1WXJA 1WA3A 3CZGA 4A8RA 5DRIA 3KRUA 3UYCA 1AH4A 1H7PA 5ABEA 3QQWA 3NDYA 4CNUA 5U7SA 4NEVA 2ZX6A 4B91A 4GC3A 2DU2A 2E40A 3FHQA 3WLIA 2DZWA 2OELA 9RUBA 4QLKA 1IEXA 1HO4A 4JQ3A 2DJLA 1ELSA 2X41A 5D33A 3SCRA 5FKYA 2NUXA 4UFJA 3U9IA 3B97A 1G69A 1EC8A 2VDHA 5JH1A 2WM1A 4S3DA 2G4JA 1OC5A 1M7PA 1RLDA 1JFXA 5J5RA 1OZMA 4N9DA 1SR0A 1E3ZA 5REQB 2YVFA 4UFLA 1TKKA 3IIOA 1QJWA 1JAKA 1UWSA 3M5XA 2SFPA 3PBUA 3DFQA 4LNYA 3LB0A 1E43A 4MF4A 1JZ3A 1BG4A 1XIEA 1DYSA 1J2BA 4J27A 4YTRA 5FS6A 4S23A 3B8DA 5T26A 4ZSUA 3WF2A 1QPQA 4DBEA 4FDCB 3EX4A 1FEAA 3JS3A 4HSHA 2OOGA 1BEUA 1ZJIA 1R2RA 1WKEA 3R0UA 1R3QA 1W5QA 4LUYA 4HYRA 4HPXA 3QH2A 1BYAA 5D8ZA 4EOUA 2NSOA 3TTYA 2C1HA 2PTWA 4IP5A 4EMJA 1GERA 4ZOBA 4ZXLA 3W24A 2FPVA 4YTSA 4ADTA 3GD6A 1U1HA 3HN3A 1A53A 3QR3A 1I2OA 4AXNA 3HA1A 3UG8A 2Y5SA 3AHYA 2ZZ0A 1GONA 3P0XA 5BWAA 2DQWA 3HQPA 3QHNA 3G1SA 2CLPA 5CZKA 1HKIA 2VD8A 1KM2A 1W3TA 4GYFA 3KWSA 4JTIA 4R33A 4C6OA 2NV2A 4O0QA 3IJLA 5BOEA 2V81A 2V2CA 3R10A 3GBEA 1W9DM 1KM4A 1F8IA 4CUCA 1GOQA 3KOFA 3RM9A 3WQWA 4DUXA 5CEWA 1ISXA 1X8CA 2X7VA 4DZAA 4LFYA 5CC7A 4HU3A 2YSWA 1PTGA 4GQGA 1Q6CA 3CWOX 2J88A 1GQJA 3S2JA 3GY1A 3HJEA 3Q37A 3LBMA 2GR3A 1Q65A 1WYIA 1AVAA 5M03A 2P8CA 3CV1A 2ISFA 4A3UA 1VBHA 2CLOA 1EHNA 3CPGA 4PH6A 3NSXA 3W7CA 1C8YA 4HTBA 4EQRA 3VGFA 5LA1A 1NP0A 5I3FA 5EGRA 4JX4A 3AHXA 4XKYB 3SUTA 4NAEB 1O5RA 3K46A 4S39A 3MHGA 2VX6A 2WJZA 3GTIA 4DBDA 2NLIA 1TCMA 4LA1A 4WOZA 2DH2A 2YYUA 4OBTA 3W1TA 1GQKA 3KCJA 3MVIA 1BVWA 3W1PA 5LA2A 3SM0A 3S5NA 4KS0A 1RD5A 2CZFA 3WY1A 3RX2A 5L9FA 2IPGA 1MRQA 3R79A 1REQB 3EAUA 1WX0A 4Z1DA 4HNLA 4DF2A 1E55A 3GD4A 2DT2A 1C7SA 4E2DA 2GR0A 4GRTA 4P7NA 4HIBA 3G0UA 3RX4A 5CC3A 3B4YA 4WXYA 3W71A 2QUMA 3W00A 3HBLA 1JEZA 2CZ5A 3CLMA 4AVOA 1RK6A 2GGJA 3GB6A 5DO8A 3MI3A 4FX7A 1MQPA 4BQ3A 2G4FA 3NSMA 4JN7A 2VQTA 4L4OA 4FIRA 4YCOA 4JL1A 1VB9A 1NWSA 1KV8A 1VFUA 1DOSA 5CG0A 3WD2A 1VYRA 3EDJA 4N42A 5CZSA 1ICSA 2FZNA 4U3AA 2D23A 5KETA 4V33A 3WG6A 2Z2BA 3DHUA 1ZDLA 4IMCA 3SGGA 4AVFA 1FWNA 1FHDA 4QSHA 4JTCA 1QI0A 3O1NA 3DHFA 3NPVA 3SQSA 4GFSA 3K13A 4J28A 2Y5EA 2PMQA 2X16A 4HMEA 4HZ7A 2YZ5A 1NOFA 1JDDA 1TR1A 3G3MA 3GDKA 1FHVA 3T78A 3N3MA 3LHZA 1LQ2A 2E67A 2VX5A 1Q1WA 5AECA 1TPFA 1SW3A 1PVNA 3UJFA 4D6CA 1AJZA 2ZRZA 3HQ1A 4LTSA 1SMAA 3GTHA 4MNJA 5TD4A 2OYKA 5I78A 1MXSA 4W87A 2CXGA 4Q8NA 4Q3MA 1W1TA 3HMJG 1RH9A 3KBWA 4R3UA 1TREA 3G2GA 1EP3A 4EK7A 1N55A 3HFYA 1XRTA 3UYIA 1HF6A 1GSNA 4CCEA 1EXBA 1OG0A 2BWGA 2RAGA 3MSYA 3FW6A 1SU5A 1I60A 3NR0A 3E0WA 3C2VA 3A3HA 3DFSA 4FI4A 3H2CA 2NV1A 2QV5A 1UH2A 3P62A 1W0MA 4Q7BA 3UF9A 1DJIA 1J12A 4NG3A 2ZVIA 4QRNA 5KMYA 3BMWA 4GQRA 3QC3A 2WMJA 1NU5A 3G8EA 4JTGA 2V2HA 3M0XA 3WDIA 4UQEA 1H1NA 3JZEA 4LAUA 4DNAA 4K68A 2WNZA 2V38A 5E9XA 1EBHA 3HGSA 1WKDA 1QNSA 2DIKA 3NM1A 2WHJA 2BOGX 4ENLA 3B40A 3S9IA 1NWRA 4A4AA 3V5OA 5CBJA 3URBA 3GG1A 5EMKA 1DWGM 2CZDA 2XSXA 3VNJA 1VP5A 1ME9A 2BVDA 3TSMA 1BSIA 1F73A 4O54A 2CZVA 2HBVA 4H8VA 4NNCA 3BG3A 2OTDA 4I8YA 2X42A 1FWTA 3B03A 2WQPA 3CGDA 1VLWA 2W66A 2QJJA 4DI8A 5CG7A 3EMZA 1AQHA 1XI3A 4D6GA 1CW2A 5CQ1A 1N8WA 2WPGA 5A6JA 3V7PA 1K4QA 5EPDA 5HWMA 4JKLA 3URNA 3WBXA 1JZ4A 3TXZA 1S5MA 3LQGA 1W3KA 3GRSA 1N82A 4R7OA 1OFPA 1V7AA 1A0CA 4US5A 4C1KA 1D7YA 3P2VA 1BTMA 4WEVX 1YPXA 2R9ZA 3QYSA 2VC9A 3AIUA 2NXGA 2VWTA 1XLEA 1UMYA 3B8VA 3DH9A 4M8UA 4I6VA 3OGSA 1DL3A 3W6YA 4IGHA 3UPBA 1J0KA 3MWCA 1RBOB 2IS7A 5C9WA 1FBAA 4LUJA 1UMLA 3SW6A 2ASHA 4Y9AA 4Q8OA 3S47A 3JW7A 1XIBA 3BXWA 2NWRA 2XVKA 2PC4A 1GOWA 2GSEA 3HTWA 4LCQA 1C29A 1V6WA 2XN2A 4JDYA 3U5UA 4DJFD 3T8QA 1VC4A 1HT6A 2BLEA 3EDKA 1Q7ZA 1JCTA 1UOKA 5G5HB 1YDYA 3CQ0A 3H2FA 2I5IA 4WCJA 3VXGA 3ZWSA 1PZ3A 5HWNA 1CT5A 1WCGA 4J1OA 4EMWA 2PDJA 4PMXA 1PL9A 3GU1A 1IR1A 4HPHA 1XLMA 4JBRA 4D6JA 4ZFCA 3GNNA 4ZFMA 2BOFX 2F7FA 2YKKA 4J57A 1WDRA 3L4XA 3N6HA 2A7NA 1PYMA 2DSWA 4MAZA 1W1VA 5CAKA 4ACYA 4GE8A 4LYPA 2Z6IA 3H2OA 1NOUA 1L0PA 3EDFA 3W07A 4FX8A 1ALDA 1SJAA 3NPXA 4LF2A 1VBRA 2JIWA 1PKLA 1PEZA 4JOMA 5T8GA 4MYXA 2NPXA 1VRDA 3QLLA 1ZPTA 4PMYA 1LBMA 4E2VA 3DECA 4EQXA 5M5DA 3H21A 2J8FA 4Y9MA 5FSEC 1CXIA 1KFLA 4GYJA 1R38A 3CV6A 5EU9A 5I0DA 5DELA 2QF7A 1XH1A 1LUCA 2FFIA 3B8IA 1A5CA 2NWSA 2WSYA 3C8FA 4Y90A 4LAOA 2VX7A 3MCOA 3RNDA 2Y0FA 1D9EA 2V8ZA 1GKPA 3WQGA 3RLHA 5HR7A 4J3ZA 4WHBA 1F3PA 1PZ2A 2AQWA 4AIUA 3VCNA 5AHLA 3G1HA 2JK2A 1WBHA 4RXFA 2DGAA 5U4NA 1J0HA 1NAL1 2J8GA 3TJIA 3T44A 1H3GA 2OKTA 3BG5A 4IXHA 4IPLA 2QIIA 4QLJA 4GO8A 4APNA 5F2LA 2HISA 4RE2A 3T2QA 4JY8A 2JK6A 1BYDA 3UQNA 4OWGA 1XUUA 1E72M 5FEXA 1R7AA 3GDRA 1GRAA 2NXIA 2ZZCA 2GDQA 4H7ZA 1R47A 1KLYA 2V5JA 3VOGA 4AD0A 1Q6OA 2CBVA 2Q71A 1RXOB 1V7YA 2QGYA 4H6QA 3GHTA 3S9YA 4WOQA 5G1TA 4GBDA 4WDXA 4GD0A 2WCGA 3L66A 4GUJA 2WO5A 4AMCA 3UZXA 4ZSTA 4AISA 4H6KA 3DYPA 1M9HA 3ZLHA 1XDIA 1ZHAA 3TKFA 3APTA 1RR2A 5AYZA 5JMUA 1K8CA 5FAJA 2GR2A 2C79A 1N7KA 2YVJA 2E9LA 1IZKA 4LUIA 1KFBA 2YBVA 1NDVA 1R3RA 3VNDA 3E38A 1EWDA 4BF9A 6A3HA 1J6PA 1T0OA 3EX3A 5LGZA 1E9ZB 5A1AA 3AIVA 4BI5A 1MQRA 1OGGA 3L4ZA 3AHZA 2NVAA 3L65A 3EWUA 1QO5A 3M16A 5L6UA 4IPNB 3W73A 1QOPA 4G6CA 3S42A 1P1MA 1VAHA 3LPFA 5D05A 2D2OA 2ZADA 1WAWA 3UR5A 3VINA 3TXVA 4EWND 1DQWA 1OX6A 4ICMA 2WM0A 3M0KA 1H5VA 4AEFA 3N9RA 1EGZA 1H7OA 4ZENA 1DWJM 4YJ5A 4TX9A 5DEZA 4W88A 1F07A 3VKKA 1YQ2A 3DJJA 5A94A 7ENLA 5BXRA 1XF0A 1G1YA 4MDPA 1DNCA 1A49A 2EKCA 5BOOA 3CTTA 1NVMA 3TZFA 3MUZ1 1D3GA 1I4NA 3P5YA 3T1GA 3W6MA 2PDGA 4BQ2A 5K4XA 4H6RA 3O0KA 2FPTA 2D0FA 2XIJA 7PTDA 2EQDA 3H7RA 1AD1A 4LEFA 1KBLA 4Q33A 1MFVA 3VNLA 1A5NC 2E9MA 3OZYA 1XLBA 1I6NA 4DLFA 3VGEA 1WOAA 2X1TA 3BAIA 4PE8A 1KGXA 4XIMA 2TRSA 1FXPA 2VDGA 3FKRA 3F2BA 1I8JA 3LCWA 2VC7A 5C8BB 2FZ9A 3SGZA 2Z1XA 2ZUVA 4PBFA 3V1HA 1O60A 3DKLA 3GNXA 4OT7A 1P48A 1SO6A 3Q94A 1OIFA 5BZAA 8RUCA 3CTLA 2JKAA 1VJZA 4GI9A 2OKOA 4H9VA 5BW6A 2OX4A 5FJJA 1SSGA 3BWWA 1E9IA 2YZRA 4IGMA 1ONEA 2VGBA 3WQ8A 3QXBA 3SCWA 3WMBA 4MVAA 1HP5A 1RUSA 3ANYA 4A21A 9CGTA 1TFVA 1K8XA 2EQ8A 4M7TA 5JU6A 3LEPA 1KFJA 5FACA 3RF9A 4EPKA 1KV5A 1IT7A 4KQNA 2X1SA 1UIOA 3HURA 4I5UA 4JX6A 2ZCGA 5CPNA 3CQIA 1XRFA 4Q22A 3NQ8A 1K9FA 2VELA 1RA5A 2QR6A 1F2JA 3BJTA 1KKOA 3NVVB 3VABA 3LRLA 4HJWA 1KFCA 2IW0A 1EZWA 4JPGA 3ZR4A 2B7PA 1J01A 3RCNA 3U57A 1Z89A 3O2LA 1U2YA 3KE0A 3TFXA 3WBWA 3O63A 1EIXA 1ZK7A 3VC5A 1M65A 3F7JA 3F1QA 1HGWA 3W82A 3IJDA 3F5LA 3VK5A 5AN7A 4GVGA 1GPWA 3R89A 4XO6A 3KCLA 3WJWA 4Z08A 1AH3A 1GESA 1TPUA 3UR8A 3EEGA 1PJ9A 5AC6A 5C2GA 3PNZA 3D9XA 3PJTA 4ZE4A 4ADWA 1PYFA 4GABA 4ZQPA 2Y8VA 1S39A 2VEMA 4HN8A 3BSMA 1Q13A 3PJXA 3NFUA 5AYYA 4O17A 1VCGA 3S2NA 1AQFA 2PTYA 5FEZA 2GK1A 3W2JA 2Z6JA 3UA4A 2PZ0A 4KERA 1PV8A 1M1BA 2QDGA 2X1UA 4QBXA 1IXQA 4PB4A 3MUIA 3MP5A 5I6SA 1ZALA 3WD4A 3WF4A 3FA3A 5HQEA 4YMZA 2IKHA 1QPOA 3G8RA 1AG1O 1CXKA 3S5OA 3CHEA 5D02A 2IQ0A 4H9TA 2E9BA 4D72A 3A4XA 3DG3A 2BG5A 2A3AA 4EPDC 2CHNA 2QCLA 4IUOA 3N4FA 2XH7A 3GFYA 3IIVA 4V28A 8CGTA 3LGDA 1KRBC 3LSCA 3PM6A 5JCLA 3CAWA 1GYNA 1IT8A 3BAWA 1RY8A 4RV3A 1R85A 4HZ8A 1HG3A 1PTAA 3WQEA 4GUFA 1LLOA 4JQ2A 2PGWA 4HPNA 1P0BA 3MWAA 3HO8A 4F0SA 5CGMA 1JDCA 2C14A 2E6AA 4PRWA 1EP1A 1HJSA 3R25A 4J3WA 1SO3A 4Q8QA 3SURA 1J9YA 1B3YA 3NQ7A 5FJUA 1E0XA 3GH7A 4LBSA 4J2PA 1Z44A 3R0DA 1QFEA 1H11A 5AZ0A 4XQ6A 2QVHA 3OIXA 2CZEA 2XU2A 2QPXA 3MVTA 4WR3A 1AW5A 4C5ZA 4YXGA 3WEMA 4NXKA 2Z27A 3RDKA 2H9AB 2EG7A 1ZLPA 1GPFA 5JXQA 3A23A 1K1DA 2QVNA 2O9PA 3GUWA 2ZTKA 4Z1YA 4XTDA 2DV0A 1ISWA 1NHRA 4N2YA 1CGXA 3RM8A 4S3BA 5HBFA 4AF0A 5HINA 3D3AA 4LY4A 3DOPA 2DUXA 3VD7A 1KD0A 1UD5A 1MVYA 2OYLA 1F6YA 2Y8KA 4V1YA 1CLKA 2FDMA 5CGQA 1P1XA 3ABZA 3EDEA 1GOXA 4HCHA 3THAA 4WSKA 3FEMA 2NX3A 3WJYA 3TX9A 4LEQA 4LNCA 1DV7A 4OBSA 4FX9A 4IQLA 4C6IA 4MB5A 4IUGA 4O57A 3E9AA 3DX5A 1QW9A 2NVDA 4P7OA 4Y9OA 2A4AA 5ABHA 2FVLA 5TF0A 1KBKA 1GT8A 2G96A 1OFOA 5K9XA 2WXDM 2G5WA 1XRSA 5DMNA 4KWVA 4RXGA 5DX7A 1TYPA 1WP6A 5IOBA 5CC5A 2VGFA 1FIQB 5CPQA 5FD0A 3WLPA 3FXGA 3WFZA 3UCCA 4E2OA 4CVWA 4HOWA 1V03A 2F5ZA 3RO8A 1QNRA 1XD0A 2HWGA 4XZBA 2AL2A 2HMCA 3GKAA 3GXFA 2E5DA 3BOXA 1QU4A 2UWFA 4Z2LA 1BWLA 3IJ6A 4BJHA 2V3AA 3W7RA 1UZ4A 1AJ2A 2G0WA 4YLWA 3NL2A 3WX7A 1DXEA 1WXYA 3KEHA 1QASA 3ZR5A 4AYGA 3APYA 3SY8A 2RDWA 1FWAC 1BRLA 3N9SA 1CDGA 5HPOA 1SFLA 1DJNA 1SM9A 3S8HA 3TR9A 3UNTA 3KLKA 1OWQA 2FTWA 1B3OA 2X0SA 1XCFA 1W91A 3GIQA 3KBNA 3HPZA 1RAKA 3F4DA 1NHPA 4B2DA 4CD4A 1W5OA 3PNUA 5F1VA 3Q6JA 4IPPA 1GJWA 3C0SA 3L12A 4G7FA 2JIEA 4AMAA 4F3HA 4JN8A 3EWCA 5KZEA 2TPSA 4OOUA 4LF1A 2INZA 1W31A 4PR4A 3LD5A 4F40A 4TX8A 1UQZA 3LCFA 4LUTB 3VAVA 5HANA 2I1OA 3CU2A 3TE9A 2PDQA 3THDA 4CEUC 4YCPA 1TV2A 2I14A 2J7DA 3UWEA 2IPWA 4FX6M 1H5YA 1DXFA 3WK3A 2VENA 4BF7A 1CXEA 3EDDA 2Q01A 3FS2A 3DK4A 3CZJA 1V08A 1PHQA 4WY0A 1LVLA 4O1AA 3NAVA 1DIKA 5JUVA 3U0HA 4F79A 4B3KA 4OTKA 1U5JA 2DVUA 5EY5A 2PDLA 5BMWA 4JDRA 3T08A 2IPJA 2BVWA 1SB3B 5AYXA 1KGUA 1DTNA 4LPCA 1K70A 4S3AA 2HPMA 3PJWA 5LA0A 4LALA 1QBAA 3K8LA 4V15A 3G6MA 1XCWA 3KTCA 1GTEA 5FL0A 2Z1BA 3MI6A 3VD3A 1Q7MA 4LS1A 1ZU8A 3H22A 2YLAA 5A6BA 2TPRA 3TW6A 1QUMA 4PBEA 5F2MA 5CSUA 2DFAA 1GV4A 3HG4A 2YB4A 2YFNA 2R1KA 5H8UA 3QJAA 2GJXB 3MSGA 1WB0A 3SR7A 2W91A 3QGVA 2V68A 1NP2A 4L9YA 4X0VA 3KRBA 2ZRXA 2JF7A 3JRKA 4HK5A 2GQ9A 5LIWX 4O14A 4TX6A 4K1GA 1EDQA 2J77A 4TU1A 5FF4A 4KFOA 2E6DA 4IJCA 3UJEA 2ZZBA 2NQLA 1DJQA 2CLFA 2ZZ1A 3EUB3 2J9XA 5C7HA 2VCAA 3RAOA 1OQFA 5J5DA 3EOOA 3NVTA 2ADAA 1U1UA 3S1WA 4WJXA 1QNPA 1E0UA 2ZC1A 3UWYA 4AXKA 3TN6A 3GXDA 4NUWA 1S3HA 7TAAA 3P14A 3MMUA 2AQVA 4QDMA 3WJXA 2Y63A 3P5ZA 3M0ZA 3H4KA 5KZ6A 3ME3A 3W84A 3L2IA 1CXFA 1UKTA 1WDDA 1XRVA 4KRUA 4Y8EA 4O4WA 8TIMA 3I10A 1DE6A 3WMLA 3B8SA 2G3FA 1X8FA 4LCSA 3AUOA 5TQLA 3ZVHA 2XH0A 1FXQA 3G3DA 2X1RA 3FDGA 1JDEA 2A3EA 3PULA 4U31A 2TMDA 5EMMA 1V0LA 3W7NA 1BFNA 4GVFA 1E6RA 3C56A 4RW5A 2ATSA 1UWAA 1X7IA 3LENA 1AOGA 1GOIA 1Q2SA 2Z26A 3PZVA 3MKCA 1P0EA 2ZFAA 3EOUA 3U8GA 1LLWA 1VR6A 4N6FA 3MUCA 4L6HA 2OZ8A 2OWXA 1E3XA 3IC9A 2W9MA 1UZ1A 3W26A 1VRXA 3PG8A 2PWUA 3M6YA 1G9HA 4JEJA 3FJ6A 1FP9A 1LF1A 4O1CA 4ZO8A 2HQMA 1DP0A 5C2XA 2ISDA 1ZBKA 2AGKA 1DPMA 5LXXA 4TTGA 2W4XA 5HNRA 3E02A 2DDXA 3AQUA 2YCLB 3TAOA 1JYWA 4REQA 1B90A 4UOZA 4AYSA 2E3ZA 4DELA 3OQ8A 2A3BA 1ITUA 4LRTA 3R2GA 2G3MA 3FDKA 3NA8A 4DRSA 1OT1A 5T91A 1VHNA 2PWHA 1Z6KA 3IARA 1YPIA 1GW9A 4AEOA 1GQLA 4PMRA 1XC4A 4M80A 3NYZA 3BCFA 3GVGA 1R9XA 5DT5A 4WLCA 1JG9A 3BLDA 5AC7A 3MZ2A 2JGYA 1NEYA 1BAGA 4DVOA 3MW7A 4JIQA 2NT0A 4KCWA 1TA3B 4L61A 1N61C 2ISVA 3WCZA 3HZ3A 1J5SA 2BSLA 3SFWA 2RDUA 3BO9A 1N60C 3UWVA 2WJDA 1E6QM 4P61A 4CCDA 1Q4WA 2OQHA 4L4MA 4MSSA 4E8GA 1HKJA 1DXIA 1IZJA 4A35A 2DT3A 1ZAJA 1QW7A 3U5YA 4I90A 1POKA 1Q66A 2DZXA 1GW1A 4DJEA 1XX1A 3T7VA 2E5BA 3UR7A 1OC6A 2ZRWA 4TVWA 2PDMA 3UG3A 3WNKA 3PZUA 4EP8C 3LCLA 5KEZA 1CPUA 2WBAA 5DY3A 3ZWTA 1NSJA 2V63A 1W1YA 4D2JA 1V0NA 3AHTA 4FLRA 5IDIA 3A9IA 3I4KA 3UFYA 4GK8A 3A47A 4CNPA 3AHVA 4L1WA 1HKVA 3LRMA 4LAKA 5EB8A 5DXYA 1GJUA 3L0NA 2VEIA 1UH3A 3KVKA 1PDZA 4EM4A 3L4YA 2Z1WA 4MIMA 3E3HA 3MS8A 5G2WA 1NPXA 2DW7A 1XSKA 1UR2A 5D9OA 5A6LA 1L2UA 3WQVA 4GINA 3GC2A 1DXLA 1TTPA 3NQDA 4P8WA 4FLSA 1XW8A 4AX7A 3M44A 2FGBA 3PB0A 5G2IA 3VUSA 3EX2A 1C90A 2B31A 1EH9A 1O68A 1J0IA 1D7FA 2C71A 1E0TA 3L23A 1E6SM 2R1PA 3UGRA 2EBNA 2YW4A 1QHPA 2JGQA 2G37A 2FKPA 3M0MA 2WPBA 1BZLA 3CWHA 1K77A 2V82A 2RGLA 2DVTA 1XYCA 2PSNA 1ISYA 4P7RA 6PTDA 1HW6A 1XBVA 4W4QA 1W1A1 3AU2A 2EPHA 4IOTA 4JTKA 3A7RA 3HPFA 3G1YA 5HOSA 4JFUA 1QW8A 1A80A 3AXIA 3QFBA 4JQ9A 5G1YA 4B9YA 3MUAA 1Q6GA 2FQIA 4KFNA 2XSAA 4MWAA 3ZYZA 3TOPA 1LL7A 3LB8A 3VIPA 5FJTA 3R1ZA 5D09A 4GIYA 1XYMA 3N13A 1OC7A 1NFGA 4UMCA 3UBPC 4H2CA 2J7BA 1HXJA 4NVTA 3ONBA 1KBBA 4HNOA 4M7SA 2PZNA 2V5DA 1ITQA 3QY7A 5I03A 3NQ2A 1WBJA 4UTTA 3ARWA 3N11A 3HFTA 2IXUA 4OJYA 1FH9A 1G94A 2Z4GA 4LY8A 5EFDA 1E15A 4LRSA 1X96A 3RITA 1D3HA 1A0DA 3ARXA 3BLPX 1DHPA 1PTDA 4GY7A 1VHCA 5LIKX 3QV7A 5G4WA 4JYFA 1ZCCA 1GRBA 1CGTA 2EO7A 2WKGA 3B9OA 1NFBA 4TV6A 2OEJA 3DZ1A 4QROA 4ZQOA 1YE6A 1FA2A 8A3HA 3BANA 1M68A 1ZRQA 2Y2WA 3RJXA 2JQXA 1EOKA 1P7TA 4Q4QA 2BY2A 1IZCA 3CL6A 2Z7GA 3L5MA 5MHBA 2GUBA 3TA9A 3QEZA 1NFPA 4GWEA 5D2VA 2Q8LA 2ISWA 3FIGA 4KPLA 4XZ9A 3M64A 3WLOA 4RPPA 5HNNA 1R3WA 2QF8A 1Q6EA 2A7PA 1OYAA 1VFSA 2NSXA 4DB7A 2XFWA 1P0KA 5AC4A 4GZIA 1AW1A 4HA0A 1KCLA 3W74A 1O1HA 1NHSA 4IHCA 4XBJA 2PCQA 1TE1A 4J7RA 1ZJBA 2V5KA 5TBOA 2V30A 2P10A 3M9YA 4L80A 3W1XA 1D2KA 1EFZA 4QAIA 2VI0A 2GLKA 4A3RA 2G41A 5D03A 3L4UA 2PDFA 2VNCA 4AC1X 3QZAA 4KBXA 2JKEA 4Q7IA 5HULA 3W2UA 3ABSA 1S5VA 4HHLA 3QKZA 3DI0A 4JCMA 2DIJA 2J27A 1XYZA 2OPJA 5F4XA 5CBIA 3O07A 2QUVA 3MZNA 3CXBA 3PSVA 4R7WA 2WBGA 3GC5A 3DG7A 2QPSA 1OBAA 4BFAA 3IIPA 2JF6A 2Y1HA 3LPOA 3WQOA 5JCMA 4JR5A 1ZJHA 5ECVA 3IPWA 3PN8A 2PDIA 1MUWA 3S1XA 4W8AA 1J4EA 4PBGA 4DYEA 4M56A 3BMXA 1G01A 3R94A 4OKDA 4YNGA 1AJ0A 3A6OA 4H4ZA 3CMFA 1ZBWA 3PZOA 4PZVA 4MWAE 4MYAA 3TNOA 2BFGA 5K2ZA 4NILA 2C0AA 2BODX 2F61A 1HVQA 4XD6A 1Q8JA 1UBPC 4MNMA 4I5RA 4O15A 3TN4A 2F6UA 3K4WA 3N2OA 2W3SA 2O7QA 4MB3A 3DKJA 3DDMA 2ZICA 1XDMA 3GC4A 5DCBA 4IIDA 1KM6A 1W1PA 1VIZA 4F66A 3W28A 4JQAA 5K7JA 1TWZA 4JYDA 4QJ5B 1HIZA 1VFLA 3ARQA 3PWIA 4AY7A 3GXIA 4TMBA 1N63C 3A12A 7ODCA 4Q4RA 1M01A 3Q4DA 4K1WA 4W8LA 1SMDA 2R8WA 1MXGA 3BOLA 4CKQA 1FFUC 4NJGA 1IIGA 4B5WA 1VGAA 4A8LA 1R87A 4PEKA 3OIHA 2NX1A 4FOKA 1YADA 1DQUA 3PBYA 1AMKA 1XIJA 5HMSA 3F5KA 1HJQA 4PSRA 4RE0A 3SGUA 1C93A 3L4VA 2QZRA 3KW3A 1TJPA 3TYEA 2PB1A 2WNWA 2ZA1A 1AL7A 1DWHM 2Y7FA 1YKWA 3FLUA 2XIOA 2P50A 3IAQA 3LDVA 4LVBA 1U33A 3UGVA 4Q4MA 3SCQA 3LTYA 3CV2A 4K38A 3WH8A 4HSNA 3WUFA 1J79A 4H4IA 2RDTA 1TPDA 2PU1A 3BGAA 3DI1A 4RK8A 2VD9A 4UTWA 3BJFA 2WLYA 4H00A 2FB2A 2OG9A 4C5YA 2ZRUA 3A5FA 1JYXA 1DIEA 3W7PA 5A6MA 4K8EA 1CZ1A 3WBEA 4JFTA 5E0KA 5FIPA 3WZ0E 4F0HA 4GC4A 4H7CA 4IT1A 1JZ5A 3R12A 1TELA 4JXCA 4ICNA 2V3GA 4CD8A 1RBLA 1L8NA 5F4WA 1EJ7L 3KS5A 4KMQA 1B5TA 2PPGA 4C1LA 1FFVC 1OX5A 1B4EA 2ZDSA 3MT1A 1O5QA 4CD7A 1CENA 1XLJA 5DBUA 4FXFA 3I3EA 3FJNA 3XISA 1HKWA 1J6OA 3EA2A 3EOLA 4UR9A 1S5NA 1WAUA 1TIMA 5C2CA 5HUOA 3AROA 1JXJA 3N18A 1IHIA 3TSBA 1XANA 1M5WA 2V3EA 3TQVA 2ZQ0A 1M7OA 4MGGA 3VNIA 2HV5A 1NELA 2QIWA 3NGJA 4Q4KA 3UNDA 1HJWA 1AQ0A 1YIXA 3SRFA 1XDLA 4MPKA 3PPFA 2P76A 1YPFA 5C70A 3FYPA 3AS2A 3W83A 4LW7A 1EEXA 7CGTA 3L2LA 1HNYA 3ZS4A 4Z2IA 3SO7A 4ZO6A 3PF3A 5CH9A 2Z25A 3P3BA 4Y2WA 4ZMGA 4GLEA 4JQ4A 4HA3A 5A3HA 1RQHA 2WMKA 2NW0A 4L9XA 4I9AA 4AD3A 1CTNA 1TRIA 3KP0A 1YDNA 1TV7A 2ZRVA 2J75A 3DGZA 2I5QA 3OHIA 3NVWB 3T0CA 1XLCA 2PD9A 3QOKA 4MAVA 1TQXA 1P0NA 4FA3A 4QITA 4XAZA 3IVUA 4AHOA 2DJXA 1J93A 3E5PA 3AC0A 4JTQA 3QY6A 1RCXB 3IVTA 4UR8A 3C52A 5AZ1A 4EE9A 4G2DA 1OB0A 3W2LA 1YQZA 4M29A 2H8XA 3OP2A 2I17A 2QQ6A 3B4UA 3NQMA 4JTSA 2PRHA 2BC1A 4O53A 1UR4A 3HV8A 1FH8A 1N5XA 3STEA 1X98A 4BK9A 4UTMA 1L2QA 1CGVA 3LXAA 1SPQA 4MY9A 1VEOA 2AGTA 1VFMA 4GIAA 4K39A 4WY0F 5TAOA 1H2JA 5HDRA 4UQCA 5G4HC 4ZE5A 1PX4A 3AXHA 3T09A 4HP5A 4HTYA 2QAFA 1AZ1A 3ITOA 3SUUA 4Z2GA 2PP3A 2WJFA 3MUXA 2DH3A 1KCXA 1MW0A 1EYWA 1WZMA 2WLZA 3POCA 1KLZA 3W37A 4H8HA 1TIWA 4X0NA 2A21A 3BSHA 4UTIA 2IKJA 4H4QA 1I75A 3TAKA 1P43A 4QEEA 3VIFA 1T8QA 1KR0A 3CZLA 4NYYA 2GDUA 1YTEA 2UV8G 4D6IA 1V93A 2I56A 2V2DA 3WLHA 1C8XA 4A2SA 3HW2A 2NT1A 6ALDA 4I5XA 4XBSA 4N4QA 3M0YA 3WBYA 3T0DA 4YYCA 4C6MA 4U10A 5A2BA 4HU4A 1QHZA 2OODA 4LANA 1UROA 2O9TA 1F3WA 3UP8A 4AWTA 4D6EA 2ACSA 9XIMA 2B7NA 3KVMA 4C1NA 2R1NA 2MUCA 4RDWA 1GVEA 4M1RA 2EHHA 1G4PA 3RMJA 3CGCA 3PZGA 3STPA 1YXYA 3KL5A 4DWSC 4CD5A 1CXLA 2WW5A 2W54A 3TYUA 5I07A 2J3NA 2ACRA 2H8ZA 4A3QA 4MADA 1UH4A 3AXMA 5I7GA 2WOIA 3NDOA 4NQ1A 1TTQA 4O18A 4URIA 2ZX5A 4LXFA 4UQ9A 1BXCA 3L4TA 5IRPA 3GAYA 3TVAA 4ZXOA 4XG1A 1EJTC 3IS4A 4HZ6A 3EPOA 2PA6A 3WNNA 9XIAA 3I6EA 1ITXA 3W7OA 3BQ6A 4ZOEA 3AZTA 3GG0A 2O9OA 3R6IA 1MUCA 4JTEA 1B3XA 3PPHA 3LTPA 3T2PA 4AW7A 2H6RA 1TV5A 3B9EA 2DZBA 2Q09A 3CK5A 4X9YA 5HAOA 3LZ3A 3PANA 2YDSA 4PFMA 4DUWA 1WKYA 2G50A 1QWKA 1R5YA 5I24A 4IMFA 1XHGA 3GW3A 3AFBA 3H2AA 3WBAA 2YGYA 4RCXA 5CPOA 4FP1A 1X1NA 1Q5MA 2WVVA 2J74A 5FS8A 3U2CA 3AMCA 4M6UA 1ZMDA 3I3DA 4ZB2A 1TJ0A 2R6OA 4H01A 1R6WA 4XSMA 5HNUA 2PLJA 1OCJA 4IXXA 1BXBA 2QPUA 4L6OA 3AIEA 1I2NA 1SZNA 3KOYA 1ICQA 3GM8A 3IGXA 4AFYA 4GKLA 1GEQA 1F7BA 4IFKA 3PBMA 2ANUA 1ECEA 4D71A 3VFLA 3N19B 3MP4A 5DF0A 2ZUMA 3NXLA 1W2VA 1XGDA 4WSHA 3IRDA 3AIBA 3O9NA 4WDUA 2Z1SA 3TN3A 2XISA 3M5YA 4DPPA 5FSDC 3GG7A 5F4SA 2FZDA 5CCZA 2GJNA 4ZOHB 5HA7A 5CPLA 2F8QA 3S6TA 4XBKA 1KO0A 3TMQA 1XYLA 3QR1A 2XHYA 1ONWA 3H7VA 3GTFA 4LIIA 4C65A 3OGVA 2JEQA 1XDJA 3XIMA 1IWAA 2YAUA 2IMRA 4I9MA 4N9BA 1RBAA 2DORA 1S2VA 4QE4A 2PDBA 3BV4A 1H63A 3P8JA 2X40A 1BKHA 1EJVC 1YNYA 1PIFA 3GZAA 4KWUA 4U33A 3E0LA 4DJFA 4EQWA 1QPRA 2B0MA 4IIGA 2PEVA 3SCSA 2NQJA 3ES7A 3MDUA 3OBEA 2O92A 5G1MA 2RHGA 4HK6A 3VNZA 2EAWA 5BMXA 1HJUA 4GA8A 3LM3A 2GL5A 2D69A 1KM5A 1O4UA 2J6VA 4JTLA 1P6CA 3H54A 3K4DA 4JIRA 5CKSA 1FWSA 1RK5A 5AHEA 3MYPA 2IKGA 4P8XA 5EA9A 4AAJA 4H4SA 3Q67A 5D9NA 1BWVA 4G5DA 3HQNA 4CNTA 1S2UA 2PDXA 1JPHA 2PD5A 4B5UA 1TVPA 1EBDA 2J7CA 4W5ZA 3M0IA 3WYZA 5C54A 3AS1A 4RE4A 3PUEA 2V6AA 1EDGA 2ZXBA 3GAKA 3C0JA 4GYPC 4XVDA 2BTMA 5LIXX 1FHLA 2C3DA 3O15A 3VI2A 2J62A 2XJ7A 3R8RA 3TWBA 2GGHA 4TVCA 1PXGA 3TOYA 3KS6A 5I06A 1O6IA 4QG9A 2MNRA 2GDVA 1EO7A 2Z2AA 4MWAD 4AVNA 4GQ0A 3R07C 1TWIA 4GG9A 4S2BA 1P0DA 5E5CA 1NY1A 2HROA 3PK7A 1MZHA 1MW1A 3B0VC 1GORA 2FJKA 1WDQA 2EG8A 1LOSA 1TPVA 5ECUA 5FF2A 5FA5A 4PTVA 1FWJC 3OHMB 2WKJA 1T40A 3C2FA 4JEQA 4Z17A 2RABA 1YLVA 4NAEA 4GXPA 4ES4A 4AZHA 4RKAA 3UWUA 3M4HA 4RZ5A 1FWFC 1K9TA 2CLEA 5I3IA 3N15A 2E7FA 1TV8A 4ACZA 1W6TA 4ATLA 3QY8A 2VO5A 2JFEX 2WBKA 5FJPA 4AF0B 1XL9A 1R3YA 4CQAA 3URQA 1W5MA 4KEUA 4O0ZA 3ZVIA 4FB7A 3TQ0A 2XN1A 1J0JA 2F6XA 4CCCA 3C0LA 3VM7A 3A4WA 1Y5VA 4F0LA 1GVIA 3RHGA 3UERA 3M6DA 1FCQA 5MKGB 1WUFA 5HJXA 1DWFM 4JTJA 2QYGA 5KZDA 4AD1A 2XGBA 1PKNA 2J13A 1LQAA 1B30A 2I9EA 1E51A 3GYEA 1S7MA 2H90A 2PURA 2VOMA 4X3ZA 5KSWA 1NTHA 1D3CA 3LYEA 3VIHA 1C3FA 2IQTA 5EBUA 3SQLA 1ZL1A 4DO4A 3EEZA 3KHDA 1PX3A 4QNWA 1Q3NA 4DAFA 1UKSA 3MSDA 4P2VA 4OFCA 4U5KA 1L6YA 4BQ4A 1IEVA 4HD5A 2A3HA 3G22A 1QPKA 2A6LA 1I0BA 2WWCA 2JKPA 1F6PA 1WV2A 3ANVA 4L1XA 4UTJA 2P0OA 1H7XA 1YNPA 4JY9A 4B16A 2DZPA 2GH5A 3VMOA 2AL2B 2NLYA 2UZ9A 1A3WA 2VL4A 2GSHA 2XGIA 5FJRA 4EXBA 1H61A 4FLOA 3D0CA 1PO9A 2NXHA 2PWGA 3D6NA 3I3BA 4MJ4A 4AG0A 1EC7A 1BG9A 3NVYB 4QS5A 2DZTA 2JALA 2XVLA 4PMNA 4DJDC 4GH1A 1KNWA 4A8IA 4M52A 3GU9A 3P7YA 4HHHA 2C0HA 1BRLB 3W9ZA 2VZTA 1JPDX 1UYQA 3VM5A 2NV9A 4GQQA 1A5UA 4C6FA 5DCEA 5M1TA 1DQXA 3R4IA 3C2EA 4NP7A 1GEHA 4AIBA 2J8TA 1GRGA 4XUYA 1QO2A 4U5IA 4DBSA 2ZUUA 3T0TA 3AXXA 4PTDA 1ZNNA 4GISA 1FWDC 4V27A 3O0HA 3SQMA 1KQZA 4S3FA 3BOFA 4FZIA 3LQLA 2Y88A 4R9OA 2XUCA 5E93A 2POTA 3CXOA 4GJIA 3A4JA 4IIBA 2HNEA 4M81A 1WYGA 2CIPA 2Y5JA 3QQ1A 2WZIA 5CPTA 3UVAA 1IGWA 3CHDA 1YTDA 4X2RA 2QW5A 2F38A 4B15A 2GR1A 4O50A 5BRPA 1OD8A 4M6VA 4NZCA 4XSLA 4B5XA 5TIMA 3NO1A 3S5YA 2HE8A 3H4XA 2Z1KA 4EAMA 4UUIA 2GOKA 2W27A 3OVPA 3ZJKA 1G4SA 1H4PA 2PGFA 4L64A 2G3JA 1WQ5A 5KVHA 3NZ1A 4MJ2A 1R86A 3KLJA 4DM1A 3OZMA 2ALDA 4S2CA 4WY0B 1MWOA 2Q3RA 5FI8A 3QW4B 3AWNA 2Y89A 4JHOA 4PUEA 3RCMA 4OE7A 2HTMA 1E6ZA 5B7YA 2X99A 2IXVA 1SQ7A 4ERAA 1NWTA 4CEXC 1Z3NA 1EX1A 4IICA 1AQMA 4PEEA 3DGRA 4XIAA 3PFMA 2X50A 1DVJA 2PFHA 3TDFA 1T41A 1T8XA 1MOKA 1MFUA 3GDMA 1H7NA 3V36A 3PP7A 3Q65A 1HX0A 3CPUA 1F76A 1O95A 2OGYA 3S6DA 3TONA 1QRQA 3E2SA 1I2RA 4JZ5A 5IFPA 3C61A 5D32A 5BOFA 4HHPA 2D22A 5M17A 2W55A 4HNTA 1K6AA 2Y8UA 2OU4A 4HA4A 1SW0A 1V6XA 5HMFA 1QI5A 1Q85A 2FMNA 2QV4A 1LDCA 4TQTA 2GJRA 3QN3A 4D6DA 3L67A 2E09A 3PVFA 3W2KA 1Y5XA 4O8RA 4O11A 5ABGA 5DBTA 3IACA 4BY3A 1NDYA 1HL9A 2FZ8A 1BQCA 2XM2A 8XIMA 3GDTA 5I3GA 4DZ5A 2E1WA 3A7AA 1CGWA 1PKMA 3FHAA 1GZJA 2CXEA 1TO3A 4YL2A 3T8LA 2A3LA 3SJ3A 3TSDA 3TC3A 3PC0A 4HBKA 4XD4A 4H3DA 3FYYA 2X7WA 3RNMA 1YHTA 3MO4A 4DXXA 3W29A 2ABBA 1YX1A 4PTNA 6TAAA 4KCVA 4KIRA 4IMEA 3W7JA 3CV7A 4PTXA 4C6EA 2GQ8A 4RUBA 4UQBA 3B8UA 3T4CA 4XV0A 1K4GA 4QFUA 3DJGX 3UCQA 2OO6A 5DMYA 3CGEA 4DPQA 3GH5A 3KDOA 2FTPA 2KAUC 2IPFA 4DO7A 1HL2A 2G3NA 3U7VA 3U4FA 1LBLA 2GSJA 3EOEA 1JJKA 3FXYA 2OMAA 2BHZA 4H04A 3VKCA 3VKJA 3ZVHB 4FF7A 3NNTA 3SN0A 1ZXIC 1E1FA 2YJQA 2H3DA 3E2VA 3PG6A 1XCXA 5KINA 3C2YA 3CEUA 1U83A 4KEVA 4PUDA 2HEJA 2WZEA 3WEZA 2AAMA 1F4HA 4ICCX 2HK1A 1QHOA 5LIUX 3KX6A 4E5TA 5HQMA 3OPSA 1ICPA 3I7SA 1XYAA 1G6CA 4JTTA 4LS0A 4B92A 3SR6B 1EX5A 3VGHA 1QXLA 4DX3A 1FKWA 5FF0A 1VPXA 5HUPA 3FY1A 8XIAA 1WDWA 3GXTA 4K8GA 4XZWA 4BEUA 4DHGA 1X2GA 2HZGA 3N6JA 2ZZ2A 4AZBA 3BC9A 1GREA 5C9RA 3B9DA 3UWWA 2R82A 4QDWA 3T4WA 4Z42C 1R0MA 2YW3A 2QJMA 3EWDA 2OSWA 3AYRA 1TMQA 2QAPA 5KVIA 1UWIA 1A4LA 1DJGA 4NZ5A 2W63A 2BNJA 5BROA 2QCFA 4ZEPA 4KCUA 3W2NA 3QV8A 3EWWA 1U22A 2FJUB 2VURA 4HKPA 3KBSA 5JBEA 1G4TA 4GZJA 4FO4A 4GI4A 1XQLA 3WO8A 3PZTA 3QRHA 3GG8A 1Y65A 3DGHA 4EF8A 4MZ8A 3VDHA 2HE5A 3VUPA 2RJHA 2WC4A 4WZHA 3OVRA 3EKLA 3OU8A 4LBUA 3IIXA 4K3ZA 4LB4A 4O4VA 4ZQMA 2HVOA 2BY1A 1EJRC 4PGLA 4EVZA 3TLQA 1L6FA 1MO0A 2ZE3A 5FAGA 4IJRA 1E9LA 4BWLC 4XX6A 3GTNA 1JCJA 4YVVA 1JCXA 1TZZA 1RPXA 4IPJA 1L9WA 3DESA 4M24A 4NXSA 3ZT5A 2J66A 1O5XA 4A6GA 1HJXA 1Z42A 5DFAA 1V3IA 2J25A 4CU6A 3H12A 4ZB0A 1YDOA 1XBZA 4UQAA 5KTLA 2FLIA 3GSMA 3UT0A 1THFD 1UBSA 3HV9A 3OZPA 3TC7A 1GVSA 1H0IA 1MYRA 3A64A 4N02A 4WKHA 3WNLA 2W0UA 4RV8A 4FR1A 4GCXA 2J7HA 2Z00A 1BKSA 1OT2A 2OEKA 3MMDA 1SW7A 4LC8A 4OV4A 1GG1A 3P81A 3ARZA 1JGIA 4JNZA 5IXEA 1KN0A 2ZZ6A 4L4LA 4D8ZA 3BW2A 3BAKA 3UXLA 2DT0A 4JNMA 3C2OA 3KOWA 2QUUA 4LUSA 1L6WA 4DWSD 4PL2A 1P6BA 4LOCA 1MO9A 2VFDA 4AZ6A 4IG2A 4O13A 4CVUA 3DERA 1DKWA 3AMZA 1SUXA 3UPWA 3PTMA 1EA9C 3NRZB 2AL1A 4J3TA 5DCDA 4XD5A 4QHRA 4MDOA 4YWIA 3UZZA 4FNSA 2WPEA 2EEXA 3RG6A 3RPDA 2FH8A 1BLIA 1Q7QA 1TMHA 4S3EA 4F4RA 5CSSA 5HQLA 3EWBX 4LVFA 6TIMA 1QWGA 1C9WA 4UFMA 2X8GA 3KL3A 3DH7A 5H91A 1YE4A 4KESA 4RJEA 1W3IA 2ISSA 2C19A 2CBIA 4B5SA 3LV5A 4IQEA 1GVQA 1SFTA 1SVDA 2DY3A 1ZBVA 4ONVA 4W8BA 1NH6A 3VGBA 3H2NA 4JTDA 1UA7A 2ZZ5A 1FDZA 3G24A 5A2CA 3WF3A 3OC4A 5J04A 1HFBA 1UZHA 2P88A 3NZRA 3IJIA 2O56A 4LU0A 3BW4A 2Y70A 5AKQA 1Q8AA 1UASA 4HMDA 1GCYA 1WDPA 3CZKA 1OHLA 2D3NA 3WFLA 1C92A 5D38A 4ERGA 3CT2A 1V77A 2J4GA 4HU0A 1UP3A 1G4EA 1K8YA 2YQUA 3BLKA 3N2XA 2OWWA 2QJGA 2P8BA 1FWHC 4KF1A 2ZA2A 1DJHA 1UKPA 3STCA 4TUFA 3M7SA 1JL8A 3M0VA 1Q6FA 3WF1A 3TUUA 1EDTA 1VBGA 3GYCA 4DIAA 4NSBA 1W8SA 2CBUA 1TR9A 4P7QA 3KTXA 2OGJA 3MV11 1EJWC 3LLXA 5D2XA 3WLMA 4H9ZA 4JTFA 2V5LA 4X2PA 3TC6A 3LMYA 1MW2A 4MY1A 4UTLA 2EQ7A 1LWJA 3LCXA 3WK1A 1B9BA 3WDHA 2BHUA 1MEIA 3SRHA 3GD3A 3N2CA 1BHGA 3CH0A 3WLKX 1JCNA 2ZTJA 5FOOA 4FOUA 3LV6A 4PULA 3NZPA 3G0XA 4NNBA 4AX6A 3W76A 1M03A 2GGEA 3L4WA 3LK6A 4IISA 1UKQA 1DJYA 1Z9AA 1FWIC 3UETA 3UXDA 1TMLA 2YA2A 2WMHA 1FHUA 3ARYA 3N34A 3LY0A 3AZSA 4XWUA 1M04A 3DHPA 5C9XA 1NQ6A 3H7UA 3OBAA 3T6CA 3TV8A 3H23A 2E0PA 2BOEX 1KBIA 2Z24A 3EZ4A 3SAZA 5BYWA 2EPOA 3KZSA 2CLLA 4H4XA 1F6KA 3AZRA 1R3TA 4PMJA 4Z1BA 4Q8PA 1OVDA 4ZA0A 1ODZA 4GMEA 2WMIA 3EPNA 4IM4A 1T99A 3WNPA 2VJXA 3H6OA 3W0KA 1GZGA 4GJ1A 1C8QA 1OZQA 3BLIA 4IL2A 4JNYA 3BSGA 3HB9A 1W54A 3D46A 3W75A 5AC5A 5I3JA 3WK2A 4Y96A 3K2GA 2MANA 3MI2A 2ZZ7A 1R3VA 3KAOA 2J7FA 1V5XA 3OG2A 4FNRA 2VRKA 3O06A 3ATZA 2XGZA 3PAJA 2OQYA 1R2SA 4TTUA 5EMYA 4DAIA 4HT3A 1XUZA 3LU2A 1JIBA 4KEZA 3EANA 1XWYA 1CI1A 4FR6A 1TJRA 2EJAA 3FSTA 4IIFA 1V4YA 4BURA 1RCQA 1W2PA 1W3LA 3J7HA 3DU0A 1V0MA 2D24A 4NRSA 1X38A 5TNVA 4Z2KA 1OFRA 4DXKA 3R58A 2Z2UA 1K9EA 1M6JA 2OO0A 4MB4A 1DJWA 3NOEA 2RGMA 3NTYA 1QK0A 1YYAA 2J24A 2NQ9A 4AIEA 3KBMA 3POHA 3AALA 1PIGA 3CT7A 3VZYA 1KW1A 1XP3A 1I2QA 2VFIA 4D8AA 1E4NA 3NURA 2G95A 4EX4A 3W3OA 1ZY8A 3G77A 1V3HA 2WMGA 3AJ7A 3N1AA 1IXNA 4I9TA 3UWQA 5GJPA 4E8CA 3CM4A 3RLVA 1H09A 4Q7NA 1OX4A 4W7WA 4LVGA 4R7JA 2F2KA 3ERPA 3ENLA 4W5UA 3BPWA 4FS9A 2HRWA 1UC5A 3GQYA 4GOAA 2BVYA 4QS6A 3IGSA 4PSPA 4HHMA 4NKCA 3THUA 4L6DA 1XICA 1D8WA 4A8NA 4D1IA 3QQ0A 4FAMA 3MB9A 3RLGA 1M41A 3TROA 1K8ZA 5FF7A 4UOQA 2AOSA 3BCDA 1OADA 2EJ1A 1MNZA 4RNIA 1F05A 1JR1A 3P60A 3DAQA 1XGZA 4ORMA 3LTSA 5JIPA 4NU7A 3E2RA 3WQDA 2ZUNA 2DP3A 1E9YB 3OO2A 4DJDD 1WDSA 2QNEA 3EMQA 1CYGA 3PB2A 5IBXC 2YCEA 1FECA 3TN5A 1T5AA 3AIRA 2CLMA 3SRDA 4YWOA 5U1OA 3PBGA 4GFIA 3N4EA 2PUZA 2RJGA 1XSJA 2VR5A 2FTYA 4GY1A 1W3NA 1T6MA 4NX5A 1EJSC 2DIEA 4IWWA 1W1IE 3FGCB 3HPAA 2CKSA 4LS2A 3COTA 4PMVA 2PCEA 2W3RA 3CHFA 3VDCA 1PX8A 2O4MA 3Q58A 4NZFA 2V3BA 1FUYA 5IFTA 4V1XA 4E38A 1LYXA 1KTCA 1PDYA 1E40A 3RU8X 2DZUA 3CZ8A 4GXMA 3TU9A 3KZPA 2X05A 3B06A 3VIIA 4JTRA 4PN2A 3W1RA 3OW1A 4X9SA 3RRAA 1F3TA 3CAKA 2VQUA 4F9JA 4O28A 4AEEA 1TB3A 1JUBA 3N6QA 3LGGA 3SECA 3U2EA 2CWNA 1V02A 3S1VA 2XFFA 3I6RA 1LCOA 2YBTA 2Z0IA 4C6CA 4JQ1A 4J4KA 3GVRA 4DF0A 3U48A 1ZX9A 2VT0A 4JIPA 5JCKA 3SIZA 5I79A 2BXVA 3GFZA 1GVYA 4CQDA 2A0NA 2QHAA 4H9MA 5AOUA 2R24A 2XG9A 1QVBA 4NZJA 2ABAA 1KM0A 4H1ZA 1R30A 3W1QA 5RUBA 3M43A 2OLSA 4H83A 4HMNA 1NF7A 3W27A 4DO5A 5H8PA 4WSJA 3CQKA 1EXPA 1BTCA 2XIBA 1JCMP 1JFHA 1OABA 4G9PA 4US6A 3E0FA 3DBPA 4KRTA 3QMRA 4AZCB 3C8NA 4WF7A 4YIWA 2PBOA 2XWDA 5C55A 4KFPA 5JH2A 4L9ZA 3SCUA 2GZXA 1PB0A 4ZVJA 3S5SA 4U2ZA 3VOJA 3B0PA 4AIOA 4CQBA 1UR1A 4RZBA 4D8LA 3K1GA 2HSAA 5AVNA 1LWHA 3UCDA 3CUFA 5FL1A 4R34A 1NWUA 1NQKA 2WVUA 5DLCA 3SJNA 4D9PA 4ZR8A 2Q8ZA 3SY1A 4XZIA 5I2UA 4N6EA 3DFOA 5GVJA 3WLTA 4GACA 4LV4A 1Z7AA 1VFTA 1E1EA 1K02A 1W9VA 4A3YA 1OF6A 5I23A 2YVGA 3QZ6A 5AHNA 1CLXA 2CLIA 3UZJA 2AMGA 3GH4A 1UB3A 1CXHA 3M7WA 3CAVA 3PTDA 3PFRA 4HMCA 1A3XA 3IK4A 1KC7A 1PUDA 1SZGA 5CLWA 4EXAA 3VVGA 4EPBC