1KKOA

Crystal structure of citrobacter amalonaticus methylaspartate ammonia lyase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
411
structure length
411
Chain Sequence
MKIKQALFTAGYSSFYFDDQQAIKNGAGHDGFIYTGDPVTPGFTSVRQAGECVSVQLILENGAVAVGDCAAVQYSGAGGRDPLFLAEHFIPFLNDHIKPLLEGRDVDAFLPNARFFDKLRIDGNLLHTAVRYGLSQALLDATALASGRLKTEVVCDEWQLPCVPEAIPLFGQSGDDRYIAVDKMILKGVDVLPHALINNVEEKLGFKGEKLREYVRWLSDRILSLRSSPRYHPTLHIDVYGTIGLIFDMDPVRCAEYIASLEKEAQGLPLYIEGPVDAGNKPDQIRMLTAITKELTRLGSGVKIVADEWCNTYQDIVDFTDAGSCHMVQIKTPDLGGIHNIVDAVLYCNKHGMEAYQGGTCNETEISARTCVHVALAARPMRMLIKPGMGFDEGLNIVFNEMNRTIALLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords 3-METHYLASPARTATE AMMONIA-LYASE
publication title Insights into enzyme evolution revealed by the structure of methylaspartate ammonia lyase.
pubmed doi rcsb
source organism Citrobacter amalonaticus
total genus 154
structure length 411
sequence length 411
chains with identical sequence B
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2001-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
A PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1kkoA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1kkoA01
3DIPA 3DESA 4HPNA 3N4EA 4IZGA 4MMWA 4Z1YA 3DGBA 3RITA 3UXLA 3MUCA 5ENLA 1BQGA 2GL5A 4E4UA 3H7VA 2QQ6A 4HCLA 2AL2A 2GGEA 3ZLHA 3VFCA 1FHUA 2I5QA 3OZYA 5J04A 2QGYA 1XPYA 2POZA 3THUA 7ENLA 3SQSA 4A3RA 3T4WA 2XSXA 3GY1A 2FKPA 3N6JA 4A35A 2PCEA 4GFIA 4GISA 1JDFA 3R1ZA 4K2SA 3UJ2A 4IP5A 2OZ3A 3MZNA 1JPDX 4E5TA 1KD0A 1WUEA 3TCSA 3QLDA 3RGTA 3PK7A 1EC9A 1EC7A 2FYMA 3I6EA 3SBFA 3ZVHB 4HCDA 4KT2A 4KPLA 1MDRA 4DXKA 4E4FA 1SJAA 3FV9A 2OX4A 2HNEA 1MNSA 2MUCA 5EU9A 3RR1A 3TQPA 3N6HA 1EBHA 4HNLA 3ZVIA 3QN3A 2OZTA 4IP4A 1NELA 2QDEA 2PPGA 1MDLA 3R10A 2PSNA 2OQHA 2PODA 2GSHA 5FJUA 1RVKA 2OFJA 2QDDA 2GGGA 3JZUA 3OZMA 1JCTA 4G7FA 2XGZA 2PP0A 3P3BA 3UGVA 1KKOA 3P93A 3TWAA 3T9PA 4YWSA 1WUFA 2OZ8A 3MKCA 4G8TA 4MKSA 3KUMA 3TJIA 2OPJA 2MNRA 2QJJA 1IYXA 2AKZA 2PS2A 4H83A 3HPFA 1F9CA 4GYPA 3UJSA 1W6TA 2P3ZA 1KKRA 4E8GA 2PGEA 5BOFA 3IJLA 3DERA 4A6GA 2XH4A 3EEZA 2P0IA 1XS2A 1P43A 3MY9A 2XH7A 1BKHA 3UJEA 3V5FA 4ENLA 3PFRA 2GGIA 1ONEA 4KWSA 4GGHA 4H19A 4JN7A 2PP3A 3FXGA 4Z17A 3TJ4A 3IJIA 1PDYA 2OLAA 1EC8A 2AL2B 2PU0A 4K1WA 1OEPA 3CXOA 3TWBA 1SJDA 1FHVA 3PWGA 1DTNA 5IDZA 4M6UA 3R11A 4IT1A 4FI4A 3ZLFA 3T6CA 4DN1A 2PU1A 2P88A 4HYRA 1TE6A 3UJFA 4ZCWA 3K1GA 2PTYA 2XH0A 4ROPA 3TTEA 2GDQA 3OTRA 3GO2A 3VCNA 3H70A 2NQLA 1MRAA 1YEYA 2DW6A 3STPA 3VC6A 4K8GA 3QKEA 4DWDA 4JHMA 5FJTA 3CB3A 2P8BA 2AL1A 1TZZA 5BOEA 2P8CA 5FJRA 3SSZA 4EWJA 3FVDA 3ENLA 2OKTA 4KEMA 3OP2A 3JVAA 3UCCA 3GD6A 2OVLA 3ES8A 1JPMA 2CHRA 2O56A 2RDXA 2PTWA 3QPEA 3SN0A 4DHGA 4DX3A 3MSYA 2QJMA 3UCDA 3CAWA 3DFYA 4MGGA 5FJOA 3D46A 3T8QA 3MWCA 3DG3A 3BSMA 4DYEA 2PTXA 1NU5A 3QTPA 2OO6A 4HN8A 3DG7A 4FP1A 4GIRA 3RCYA 3U4FA 3VC5A 3UJRA 4IHCA 4ZA0A 2XH2A 3PWIA 3TW9A 3CT2A 3IK4A 2PMQA 2ZADA 1TKKA 3DFHA 3H12A 4H1ZA 3NXLA 4HNCA 4F4RA 1L8PA 2ONEA 3BOXA 3R0UA 3OPSA 3R0KA 3JW7A 2DW7A 3R25A 2GGHA 3RRAA 4IL2A 4IL0A 3ES7A 3RO6A 3SN4A 2HXUA 3P0WA 3ZVHA 3MQTA 3VCCA 3Q45A 2AKMA 3DDMA 4J3ZA 3NFUA 3FCPA 3U9IA 3V4BA 2OQYA 3TOYA 2QVHA 2PA6A 1SJBA 1R0MA 1MUCA 3VA8A 1P48A 2PP1A 3CYJA 2ZC8A 3BJSA 2HXTA 1PDZA 4H2HA 1KCZA 4X2PA 3H8AA 2PTZA 2PGWA 3D47A 3VDGA 4HCHA 3FYYA 3IJQA 1ECQA 1ELSA 3CK5A 3ZLGA 3V3WA 1EBGA 5FJPA 4GYPC 3S5SA 3GC2A 1SJCA 4GMEA 3V5CA 3DEQA 3B97A 2GGJA 3NO1A 3I6TA 2QJNA 4J1OA 3FJ4A 2OG9A 3SN1A 4GGBA 1R6WA 3DG6A 3UXKA 3Q4DA 3N4FA 3EKGA 3SJNA 2HZGA 1E9IA 3S47A 3I4KA 4JN8A 3NZGA 4M0XA 4E6MA 6ENLA 3OW1A
chains in the Genus database with same CATH superfamily
2JE8A 1NDYA 3GNRA 5TQLA 1GEUA 1B90A 3HZ3A 2Q09A 3V0UA 1CIUA 3VIJA 3ABZA 4MMWA 2CLEA 1DXEA 4A3YA 2GVJA 1E71M 2WWDA 3UPMA 3E5PA 3EWWA 1Z7AA 1FP9A 1N8IA 2NQHA 1KFCA 1RVGA 2INEA 2WMFA 3W02A 1LBLA 3VDCA 3PPHA 2P3EA 4TIMA 3DYPA 1O5RA 2I5QA 1BYCA 4Y8EA 1Q6QA 1C3FA 2DZXA 2AMGA 2OGYA 4FMVA 2ACSA 2YCIX 5D9PA 3UXAA 1PAMA 5G1MA 3SQSA 4UR7A 1ISVA 5TIMA 4NX0A 4UNLA 3VVGA 4O1DA 1E1CB 3HG3A 3UJ2A 4GIEA 4RXGA 1WPCA 3BMWA 3UQNA 3CUFA 1JXKA 1H4PA 4B2DA 5EFDA 4L4MA 5T26A 1Z3NA 4JNMA 3GXPA 3LSCA 5D2YA 2D3NA 3W1UA 2V30A 3IC9A 4WDUA 2J9XA 3AIQA 4BZYA 2MUCA 4IMDA 1H0GA 1VBJA 3A3HA 1E9LA 3OQ8A 4FK9A 2JKEA 1S3HA 3MMTA 5KZEA 2OLSA 2WCGA 1YE4A 5EMKA 4UTHA 2CLIA 2FMOA 3CV7A 3DI0A 4H8VA 1DYSA 4RE3A 1EXPA 1YTKA 4ERIA 4IQJA 3VM7A 2DZTA 4N4PA 1K70A 3ANUA 1DIEA 4K3ZA 3NWRA 3CQJA 3WUEA 4F0MA 1EFZA 1PTGA 5LGXA 1NDVA 3SCUA 5DANA 3EPNA 4RX0A 1QFEA 2FFIA 3O16A 3RAOA 5HMSA 1R9ZA 1BKSA 1KKOA 1MQRA 4GQGA 3K30A 1ZP4A 3PBWA 2WMIB 2E09A 2ZUWA 1U1UA 2NV2A 3UWZA 3WK3A 3PZVA 2QJJA 2AKZA 4KFPA 1V79A 3A7RA 2XN0A 2A5HA 1ONXA 1FWBC 3WH5A 1PYMA 3MCOA 2WOWA 1X97A 2GJRA 3WQ4A 3E2RA 4I9AA 4A6GA 3LERA 4Q8MA 2E5AA 1V6WA 4L1XA 1PTDA 2YA2A 2ZKMX 5FEWA 1Q6FA 4Q8TA 1V03A 4RL3A 4FPSA 1U1JA 3NZRA 3GXTA 3GTFA 2EQ9A 3G22A 1TPUA 3GXMA 4Z17A 3S5YA 2A3HA 4HSOA 1Z9AA 4L9ZA 1QI5A 3S1XA 3C8FA 3W2JA 4GLEA 3WH8A 2VNCA 2XH0A 4ADWA 1J12A 3WUGA 3TTEA 1WXJA 1DORA 2V3GA 4C6KA 1MUMA 1SB3B 3W24A 2GH5A 5D30A 4ICCX 1TZ9A 4FEZA 1QPOA 2JKPA 3SQLA 4G5DA 1TV5A 4HD5A 1O66A 3QOMA 1CWYA 2QIWA 1TTJA 3FK4A 4PTNA 3WK2A 4J2PA 1VYSX 4LVDA 4CD5A 5KINA 4LVGA 5FKYA 3SCVA 1L6YA 3N1AA 3S6TA 5FACA 5A8QA 2ATMA 4L4PA 1QPNA 3RM9A 2VT0A 4GX8A 2F84A 1VLWA 4Q8OA 1VEPA 1KRMA 4S2CA 4JQ2A 2EQDA 1DJGA 1HL2A 3IANA 2DV0A 3R12A 2VEFA 1IV8A 3F03K 3TNBA 5D8WA 1KWKA 1TZ7A 2XH2A 4MWAC 5U1OA 5PTDA 1D8WA 2J62A 2J7BA 3GVRA 3MCNA 3QPZA 1WKDA 4JFUA 4JL1A 1JIBA 1J6OA 4PFMA 3G3MA 4JCLA 4UIOA 2WHLA 2UZ9A 4GG9A 2QMJA 2VDGA 1YRRA 4J2MA 5ABFB 2ZX9A 1XLLA 3KS5A 3NXLA 3WQDA 3WK1A 2XZ9A 3BOXA 4WX2A 5CSYA 3T0TA 4YL2A 3M0MA 4GQQA 1E73M 3I6RA 5HPOA 1W56A 3R25A 4KH2A 4UCFA 2J79A 3OLIA 3MMDA 3NQ2A 3UG4A 1OHLA 3ANYA 1XG3A 3UESA 4NJHA 4W88A 3MQTA 3EOLA 3LUTA 2DZPA 3NG3A 2ZIDA 1R8LA 5AYXA 2DU2A 4JQ3A 2DT0A 4MG4A 5FAGA 4LUSA 1M3UA 4WY0A 2FH8A 1FECA 2ZUNA 3WF3A 1TCDA 2RGLA 2WMHA 3IIXA 2H90A 4QJ1A 4EM4A 1UKPA 1UZ4A 3HB9A 3K13A 4NXKA 4DJFA 3AXHA 1S3TC 2VZVA 1P6WA 1DWAM 2GR2A 2QUTA 1OX4B 5G1TA 3TH6A 3S5SA 4W8BA 1VRDA 3SW6A 1QI4A 4HPGA 4GMEA 3BAIA 3WNOA 1KB3A 1WKYA 5TD4A 3T0AA 5BXPA 3I6TA 2W0HA 4J35A 2XVNA 1QMLA 1NQKA 3L67A 4V28A 4US5A 1LCOA 2JK2A 4QR6A 2Z27A 1XX1A 2WZIA 5D02A 5A6AA 4O14A 5E0KA 5JH2A 4R9OA 3V16A 1R3SA 1UA3A 3TJLA 3W73A 1JQXA 3KVJA 3G1FA 4K37A 4GH1A 5F2MA 3QZEA 3R7MA 5CPMA 2VGIA 2Z2BA 1XD0A 5I3IA 4ZOHB 2G37A 1AMKA 2EG8A 4XD3A 3V1HA 1W2VA 3LSBA 5JRBA 1IXOA 3L0NA 4W87A 4UOZA 2JKAA 1DBTA 1BYAA 2YR1A 1TYGA 3CV1A 4UQEA 3KAOA 4YMZA 3MJMA 3E0FA 4YTUA 4M8UA 3SFKA 1F3XA 3NVZB 4FR6A 3LX9A 2CXGA 5HJLA 1F3WA 3LPPA 5AC7A 4KGJA 4N4QA 1I9CB 3EWBX 5ABHA 5BNKA 5A8GA 4NYYA 4GFIA 4V33A 4JZ5A 4IP5A 4CVWA 1XUUA 4F0LA 3AHTA 4PTDA 5LIYX 1JOAA 2FHFA 4GYKA 4BI5A 1S1RA 4F0RA 2NUXA 4RW3A 2VZUA 3B8DA 1JZ3A 3CXBA 4JTIA 1WDPA 1EC7A 3I6EA 4KFNA 1O1ZA 2DQWA 1OFDA 2VUNA 3UZ5A 3RX4A 3QSTA 3GRIA 2VKZG 1XDLA 3ZR5A 4WY0F 2Y62A 4MPKA 1RD6A 3NSMA 3QXBA 1JCYA 4DXXA 4XZBA 1R3RA 1HIZA 4ZBCA 2V5DA 3H55A 1O95A 5KITA 2BY0A 4R7WA 3SURA 3BZJA 1AJZA 1SZEA 9RUBA 3H7RA 5BU6A 2I1OA 2V82A 4OUIA 1UKQA 2QUMA 4PMOA 3K46A 4DJEA 1PKYA 2PODA 2PRHA 1PZ0A 5BRBA 1U5HA 4XSMA 3ARUA 3E12A 3K8MA 3ARWA 2YYUA 3MA8A 1WBHA 2YCKX 3PJTA 4H4TA 1A4LA 1C9DA 4PZVA 3VU2A 4ADUA 1KW1A 4UCGA 4FB7A 2VURA 1FFVC 2H3DA 4J7RA 2REQB 2D2GA 4QQ3A 3WJSA 1B2YA 2FB2A 4F9JA 3NEHA 5C9ZA 3IVUA 1K8ZA 4E8GA 4JTEA 4GVFA 3IJLA 5HQLA 3L5LA 4J40A 1VKFA 3CGEA 4X9SA 2QCLA 1BKHA 3UJEA 1VFTA 1XC4A 3LM3A 4HNUA 5LHFA 1ODZA 4OZOA 4RR4A 1EA0A 1XLHA 3NM1A 4H4PA 3F4NA 3WDRA 3EOOA 3YPIA 3TN6A 4I3GA 5G1YA 1E5NA 1HJXA 3PWGA 1F6YA 1J0YA 3R11A 1J0JA 2O55A 4FI4A 2QCEA 4WKAA 3E0VA 3Q37A 1SW0A 2X2YA 4Y90A 5GRTA 1NF0A 2F7FA 2GOUA 1XF0A 2NQLA 1LL4A 4RDYA 4RV8A 3WFZA 1W3HA 2GYIA 3CMGA 2VC6A 2WBAA 4JTFA 4V15A 4HA1A 2J47A 3VGFA 4EWJA 3LGGA 3KBWA 3DKLA 4CU8A 2ICSA 4KEMA 3ZSSA 2YBTA 4AAJA 3B0VC 1ICSA 2OKOA 2HV5A 1E4NA 4N02A 2OVLA 3A47A 4PB5A 4PUNA 7TAAA 4TVDA 1GOKA 2YXOA 4HQVA 3N14A 4I7WA 3BVJA 4YVPA 1UR3M 3CWOX 1KXHA 3B4YA 1DXFA 2Y63A 4WJXA 4HK5A 1VBUA 3ARZA 4GJ1A 1PHQA 1KTBA 2EEXA 1X1NA 2OO6A 6A3HA 5J8LA 2NLYA 4IPNB 3VC5A 3W2KA 1EIBA 3LB0A 3EX1A 2PDLA 3USBA 3W1NA 3N11A 2E3ZA 1KQYA 3WMSA 2CKRA 3NDZA 4XX6A 4LS1A 3MP4A 1BSIA 3C2YA 4HHPA 1ZAJA 1RPXA 4F40A 1MUWA 4Q6XA 2CBVA 4WGXA 5E1QA 3RFAA 3VDBA 1R38A 3CL6A 4C6JA 3W3OA 5D9MA 2CFFA 4FHAA 3EA2A 2GJNA 2X09A 2PDNA 1EGVA 2WM1A 3N34A 5H91A 1JDEA 4LYKA 1KM3A 2DY3A 3MUIA 2QZRA 1A5LC 5HJYA 4TO8A 2R14A 4H7ZA 3TYCA 1E0TA 4HHMA 3ZO9A 1Z89A 4TVUA 1LORA 4QITA 3NZQA 3ZS4A 1V02E 5AHNA 1CYGA 2DZAA 5KZDA 1U33A 3BOFA 2XVKA 1M41A 3BLOA 4RDVA 1R0MA 3OVPA 4O54A 2HSAA 3NVDA 4AD2A 3CYJA 3HPAA 4XD5A 3H8AA 2R1NA 3W7HA 4IGSA 1TMQA 4W86A 4R33A 3TVAA 3RPDA 5AY7A 4E3VA 1EBGA 5FJPA 5LXEA 1SR0A 3LHTA 3SUSA 3GC2A 3O2LA 3VKBA 1ZRQA 4ZQPA 1V3KA 1TUXA 5LIXX 3UCQA 1ZTVA 3GYEA 5C54A 4FIQA 5AYBA 2FIQA 5I03A 4EANA 1YW1A 2PLKA 1M03A 3QFAA 1LRQA 1JF6A 4TR9A 3OEXA 1WKFA 3M0JA 1WYGA 5CJNA 2ZZ4A 1KO0A 2PWHA 4E6MA 3GH7A 2D0FA 4JTKA 4BKNA 5CSRA 2YOCA 4DM2A 3BQ5A 3P80A 4RV3A 4ZQOA 4BF7A 2UY5A 3SM0A 3MUZ1 1BVZA 2CFYA 3S83A 4AVFA 1JRPA 3IEBA 3UZJA 2C16A 1FX6A 4DQWA 2Y5EA 5DCDA 4ZTXA 4CQBA 4TV5A 5CPQA 5JIWA 1JR1A 1HJVA 3UW6A 1SZRA 2PGFA 1ZB5A 2WNNA 1GQNA 2ACUA 2PDPA 5H8UA 2EQ6A 2D24A 1I8JA 2Z7KA 3C2FA 2JIWA 3GK0A 3HQPA 2ZZ2A 2WOQA 1XFCA 4IXXA 5F2IA 5A8OA 1PKNA 1KBJA 3W7MA 4A3HA 1X38A 5BW6A 3WSUA 3GX9A 1XPYA 2JEPA 4NZ5A 5FL1A 3G1DA 2PWUA 4AWUA 3ZJKA 4K36A 4LPCA 2DUZA 3ABQA 5CGQA 1QPKA 3BJTA 4A35A 1DJYA 2PCEA 1GQIA 2YDQA 3BANA 1RJQA 2OZ3A 3MZNA 1KLYA 5GNYA 3TN4A 4C6FA 3QKZA 1WUEA 4JIIX 5CPLA 1S2WA 1XLAA 3WF2A 4HZ6A 6TIMA 4JTHA 3HO8A 5FIPA 4K7ZA 4U33A 3B8SA 1QO5A 4S23A 1MDRA 4XB3A 5CZJA 5A6LA 1HT6A 4N9DA 4KW2A 1W1PA 3SCRA 2OX4A 4Y6GA 1KLZA 1HUVA 1MI3A 3B9DA 2VMFA 1LRTA 3S2MA 1UB3A 4EPEC 2ZYFA 4H4WA 3W4RA 3F1QA 4IJCA 3WIJA 1N7KA 3EGJA 2A85A 4RZ4A 4RZ6A 3CAQA 1JNEA 3OU8A 5M2FX 5EBKA 4C6LA 1C7TA 1TSIA 2B81A 2PZ0A 3IJ7A 2V3FA 3T8LA 4GKTA 2C6QA 2V2DA 4R34A 1SR9A 3DK4A 1JCTA 6ALDA 1EJRC 3P5ZA 3F5LA 2DEPA 3L68A 3W7EA 3NVTA 4A8IA 2R91A 1M53A 2Q3OA 4JFVA 3K5XA 3E74A 2EXOA 3GVGA 3PULA 3WJYA 3U5UA 1ZHAA 2Z25A 4NRRA 3LM7A 4MIMA 5FI8A 1CLKA 3CQHA 4AZ7A 1ME7A 2Z6IA 1UR0A 1M01A 1DE5A 2BWGA 1E0WA 4CQ9A 4L4OA 3EBVA 4W5UA 5H2ZA 2XGBA 4IQDA 4XBKA 3TA9A 4Q7NA 1QW9A 1XS2A 3ARYA 3M44A 2XH7A 3WQPA 2DP3A 1W9PA 4ZSUA 1SW3A 2V5LA 3CGBA 3N19B 3R6IA 2Z6JA 2MANA 3PTMA 3GAKA 3CAVA 2X1TA 1J6PA 2WYSA 5FS6A 3BSHA 4MM1A 3TE9A 3SCTA 4ZB5A 4GRTA 2NW0A 3WJZA 1L9WA 1JRBA 4CEXC 1B57A 1OVDA 3NXFA 4O1AA 3VD7A 2VFDA 2CERA 4PSRA 2QPSA 5FS7A 2A7RA 3INPA 4Y9MA 4MYAA 1TE6A 1ZDLA 4TX8A 1ZJIA 2EKCA 1B0IA 3M9YA 4PTVA 2PBGA 3AQUA 5MKGB 4XKMA 3HQOA 1XCWA 3STPA 2DSVA 3U5YA 2ISVA 2WSQA 3ITXA 3OVQA 2QUUA 4JICA 1QOPA 3KOXA 3V0SA 1VJZA 5HQMA 4UTWA 1HO1A 1C92A 1AUSL 3W7QA 5DBTA 2OTDA 3PF3A 3SSZA 3CPGA 1VCGA 2Y85A 1QOQA 4RDZA 1J93A 2NVDA 1G7VA 3CT7A 2P50A 3KXQA 1GG0A 1M6IA 3L2LA 2CHRA 4GA8A 3CUXA 2QJMA 1XDIA 2BXZA 1ICQA 3M47A 2D22A 2GVLA 2WP6A 3URBA 1V6YA 2WAGA 3T8QA 2WO5A 1NU5A 3HV9A 4HN4A 1QK2A 1J5TA 4HZ8A 3AN1A 2J13A 4LT9A 2ALDA 3NL5A 4LXFA 4EQSA 3U4FA 4URIA 1SGJA 4ROQA 4FX8A 4Y9NA 2W63A 5B7ZA 2VR2A 4PMYA 2Y1HA 3PWIA 2ZX7A 3NDYA 1EKOA 2CHOA 4XBJA 3T55A 1XIBA 1TKKA 4MB5A 4W89A 3ZR6A 3P62A 3FJ6A 5TAOA 3VGEA 4PULA 4F4RA 4J27A 4LVAA 2NT1A 3K2GA 4EQRA 4FNTA 3WD0A 4LF2A 4ZMGA 1SUXA 1LBFA 2E1WA 2Q02A 4FXFA 2ESCA 1ISYA 1MYRA 3AWOA 3H23A 2BHUA 4Y2WA 1KFBA 3I3DA 1RSCA 1LDCA 3MYOA 3GB6A 3T0CA 3I10A 4NAEB 2GGHA 2PDUA 3LCXA 1DP0A 1XICA 2X1SA 3PAJA 4HMDA 1E6RA 1EHNA 2ZRUA 1XINA 5AC6A 1UBSA 2GSJA 4CD8A 3GNNA 4E38A 2AKMA 4OT7A 5LNUA 4J4KA 3NJ3A 1YTDA 2QVHA 3LMYA 3LBCA 3TLQA 4S3BA 4JYFA 5KVIA 2ZC8A 1OD8A 2O9OA 4OU1A 4H2HA 4O1BA 1DWIM 4D6CA 3LPFA 4LEQA 3HURA 4OJYA 2ZUTA 5E70A 5JBDA 4LQ1A 5FJIA 3C3NA 3FN9A 1WDDA 5XIAA 4XK2A 2ZDSA 3B97A 3MHUA 3P14A 4WGHA 1GJPA 2W0UA 2V68A 3U48A 3BTNA 2FTPA 1EJUC 1Q6DA 1VQTA 1H5YA 4B92A 1E70M 1B4EA 2NLIA 2Y2WA 3WZ0E 3D9XA 2C3ZA 5BU9A 4ZR8A 1RQEA 2HDJA 4R7JA 6ENLA 1GJUA 4PH6A 2PC8A 3WMCA 3GLCA 3G18A 3W22A 4ZFMA 3MPGA 1QO2A 5EMJA 2ZZ0A 3LU2A 1QPRA 1JQVA 1KFKA 5AYIA 3SY1A 4DWSD 1EP1A 1BXCA 2ZXDA 1N62C 1S38A 1STZA 5C9XA 1YX1A 4MAZA 2RH9A 3POHA 3ZXWA 1D3CA 2YIHA 1DWFM 4OBRA 4AD0A 4OFCA 2XSXA 4AQLA 1QBAA 3E02A 3PN8A 2HROA 2ZRWA 1UBPC 4H00A 2QF7A 1F8IA 4GI8A 1ZAHA 3PVFA 3EF6A 2YZ5A 4FLSA 2XN2A 5E0CA 4KWOA 1A5MC 5CEWA 3A4XA 5T9BG 1Q63A 3V0TA 3K8KA 2QDHA 1J18A 2A3AA 1V3MA 3PB0A 2BX7A 4XZWA 1BPLB 3R43A 4C6CA 1SFJA 4E2DA 3PJUA 1AQFA 4FALA 3G1HA 1E43A 1B1YA 3ARPA 3QTGA 5E5CA 2BXVA 1EBHA 5I3KA 4KPRA 2G8ZA 3GW0A 4B4FA 2HCVA 1JPHA 5EKYA 2BHZA 2YCLA 3WH7A 1XSJA 3W70A 1Q5MA 1T7LA 4L6OA 3L12A 1NOWA 1JYVA 5AC4A 3H2MA 1E0VA 2PBOA 4S2BA 1G6CA 4NAFA 4Q8VA 1E6PA 1RVKA 3KHDA 3LPOA 2OFJA 4R9XA 3GXNA 2RUSA 3AXXA 4F9DA 3C2RA 1C93A 3EWCA 2YA0A 3MO7A 1GETA 3TWAA 4QFUA 2Y89A 1J2WA 3VOGA 1EWDA 4CD7A 2YFOA 1XYFA 2R1PA 3TJIA 4KERA 5CZTA 1CT5A 5AYZA 1VIWA 1XLMA 4AWSA 1OJTA 1RUSA 4XIAA 1W2PA 1MW2A 2AGKA 3OBAA 3SCOA 2PUZA 4JN6A 1VS1A 1J0IA 4NSBA 1KKRA 4FX7A 3CIWA 1GRHA 1GV4A 1H09A 3QHMA 1U30A 1W54A 3TX9A 3MY9A 3WQ6A 3HMCA 4ES4A 3C3UA 3P81A 4IF2A 2FTYA 2VX7A 4QJ3B 5B80A 1FWAC 2GR3A 3WF4A 3MCMA 4EAMA 4EPKA 2BOEX 2NPXA 4PCNA 5BRQA 4HGXA 1FWGC 1BG4A 4H8HA 1UW9A 4LNCA 2G0WA 1Q6CA 4AX6A 5H8MA 1US3A 4IMFA 1BYBA 1H0IA 2PU1A 1E51A 4GI6A 4NNAA 3TAOA 3B05A 3G1AA 3OJGA 4Z1BA 3H70A 3KLKA 2PDXA 3M07A 2X1RA 4QHRA 4RLIA 2BBFA 2D0GA 5AHMA 4DWDA 1DXLA 5D2XA 2V81A 1RQBA 5LIKX 4GFSA 1F4HA 5BOEA 3HW2A 3FVDA 5HQEA 1W1IE 2F38A 1O5QA 1NM9A 3XISA 4H3DA 3OP2A 3PBVA 1UD2A 3GHRA 2XWDA 5FS8A 3O06A 1EEXA 3QSRA 3HQ1A 3QFWA 3DHFA 4ICMA 4DNAA 4O28A 3SN0A 1G9HA 4H9VA 4AEOA 8XIMA 2NWRA 1NDWA 1W32A 3AI0A 3PJWA 4HK6A 3DFYA 1KBBA 3D3AA 1GVRA 3QTPA 3U8GA 3A23A 4AHOA 2FGBA 1QJWA 4JQ1A 4M82A 2V6OA 1XH0A 2P1FA 4LU0A 4RDWA 2VC9A 3SIZA 5CAHA 3P60A 4NHVA 4EF8A 3AMKA 4LUTA 2CZVA 3NPWA 4AY7A 5LYRA 5M1TA 1EIXA 3N2XA 1CXEA 4US6A 3GTIA 4H1ZA 3F2DA 3DH7A 3W88A 1L8PA 4GVIA 4JS3A 4GO9A 4NL1A 4XO7A 4IGHA 1HZYA 4AEEA 3DBPA 3VKDA 2A1YA 1TV4A 2OGJA 1MXSA 1E3ZA 3UGRA 1K6WA 4QM1A 3RRAA 6XIAA 2I9UA 5AOUA 3AZRA 3RO6A 1GYMA 3QY6A 1REQA 5KEZA 2NX1A 3U0HA 2J75A 2PRMA 3TSBA 3CV6A 1BQCA 3UD6A 3KTCA 4HVXA 3RLGA 1DQXA 4BQ3A 4P7RA 4DUWA 3DFPA 2PDWA 3NIYA 3IGUA 2ZZBA 4EK7A 2PDBA 5CJ5A 4KIEA 3MWAA 5KSWA 1S46A 4OOZA 3CEPA 3TUUA 3GIYA 4LC8A 3M64A 2FH6A 3D47A 1UJQA 4JNZA 1E9YB 7REQA 5I3FA 2GQ8A 3THAA 4MYXA 4Z0JA 3E49A 4GYPC 1LOQA 1UH4A 2G4JA 1VH7A 2D2HA 1JDDA 3M46A 2PWDA 1N82A 2WVVA 3I7QA 2FPYA 3AWNA 4DPPA 3UR7A 1TX0A 5DMYA 3KBVA 4B5WA 3M6DA 4IX2A 4LY4A 3LZ5A 2BC0A 1UPPA 4FF5A 3BICA 1KRCC 3WQVA 3BCFA 4QISA 1WZKA 1KWGA 1WAWA 3GHTA 4REQB 3DIPA 2WXDM 3ZSTA 1GHRA 4INFA 5ECUA 2H8ZA 1LL6A 3EMQA 4Z1YA 2Y7GA 3G0UA 2YX0A 1X7FA 5F4XA 3SFWA 2Y7EA 3UETA 2OWCA 2V3EA 1IEXA 1XG4A 3BG9A 1ZLPA 1XRVA 3TIMA 1XLIA 2OT1A 3H2EA 3IPWA 4MB1A 4CD6A 4QE4A 3GIPA 3WG6A 4D9PA 3CH9A 3W81A 3AXKA 3M0VA 5I77A 2G3FA 4ZGYA 4OBSA 3BV4A 3UNDA 4F2UA 2QCCA 2FPVA 3E1F1 1OG0A 1ADOA 5RUBA 4A22A 1UD4A 4WOQA 1FXQA 4UTIA 5I3GA 4ZB2A 1IEIA 4GINA 3PZTA 4IM4A 2OOGA 4UB9A 1Q7MA 1QWGA 3E6EA 3A22A 3W83A 3QC0A 1R7OA 3W87A 5CPSA 4E5TA 1EEPA 1QNSA 1UWUA 5DRIA 3H4KA 3E5BA 4AMCA 1F3PA 1TJ1A 5ABGA 3F5JA 4H9UA 4E2OA 2Y88A 1EC9A 1GOWA 1ITCA 3C5QA 1TTPA 2WZHA 5F1UA 4C6IA 3RK8A 4DPQA 2R9RA 1BD0A 4J3SA 3MP5A 1Q65A 1TPVA 2ZZ7A 1K1DA 2HVMA 3EWUA 1MNSA 3DOPA 1M04A 3TQPA 3KTXA 2BGSA 1XQLA 3W2LA 3TAKA 4V27A 4PUKA 1TQXA 1FWWA 3WN6A 7CGTA 4F0KA 4L4LA 1Q6EA 1SO5A 4HOXA 3VIPA 2G3IA 2PLCA 4PMUA 1UP2A 2PPGA 4G7EA 1TE1A 1ISWA 1P0BA 4RKAA 2DORA 4TXEA 2ISWA 3VD3A 3GS6A 1ZJBA 2YYTA 1W5MA 1XIFA 3BZGA 1PUDA 3NYZA 2QDDA 2WMKA 1HKIA 2Y61A 3TR2A 3TP4A 2VX4A 5IBXA 2RDWA 2VZTA 1XIEA 3GTNA 2NX9A 3H2OA 1XYMA 5LXXA 1A5CA 5CPOA 4LY8A 5K4XA 3BLPX 2OPJA 3VNZA 1DEDA 2EPKX 3Q67A 4P61A 4H83A 1ZMDA 5BMXA 3ZYZA 4XAGA 2VP8A 1Q2RA 1W1A1 5FEXA 3HPFA 2VX5A 1PX4A 5M03A 1JUKA 4WDWA 3WQFA 2HMCA 2XH4A 1PKLA 4FOKA 3VINA 5C7HA 1Q3NA 1P43A 2GVGA 1HP4A 4B2DD 3UVAA 3CPUA 2WHJA 4PUMA 2ZUMA 3PFRA 3TLLA 4FZIA 2OU4A 1GT8A 1ZGDA 4LYQA 4DXVA 3WQ5A 2WZMA 5SWUA 4AZCB 3V7PA 4JIEA 3WL1A 1XYBA 4I7VA 1H7PA 3W7CA 5JMUA 2V38A 2PP3A 5BZAA 5FCZA 1ZX9A 1GZGA 3TJ4A 3LENA 2IQ0A 3WBXA 4C6PA 3CXOA 4PMNA 3DZ1A 3HJEA 3W7OA 4P8XA 1O4UA 3W7KA 5CJMA 2Y70A 3S6OA 2P88A 4ZCWA 4ROPA 3MUY1 1V5XA 1QOXA 2LLEA 3FA4A 1IXQA 2ZXBA 4EP8C 1UH2A 1YEYA 1GOXA 4NQ1A 2ZWYA 5IFPA 2EQ7A 3L4XA 4WR3A 3UZYA 3GG8A 4H7CA 5C6MA 3WMLA 3CM4A 2QV4A 3W2NA 4Y96A 1CCWB 2IPGA 3ECQA 3L66A 4A2RA 4AYGA 4GUGA 1A5OC 1QR7A 5JCLA 1TV2A 5I07A 3KP1A 4X9YA 3N18A 1NTHA 1TYTA 1NJJA 2PDFA 1ISZA 4LCRA 4MY9A 4F48A 1VBRA 5ECVA 4KKXA 1IR2A 4CNSA 4ORMA 3ABXA 4Z2JA 9XIAA 3LLFA 3E9AA 1H7OA 4HN8A 1PBGA 3B06A 3TV8A 3PB2A 5A2CA 1RHCA 2NUYA 2GOKA 2FB3A 3Q94A 2DVTA 4QDMA 4H50A 1NP0A 4ZE4A 1ONRA 5G5IA 3BJFA 4LCSA 5G5HB 4JTQA 5LSMA 5KZ6A 2DIJA 4DAFA 5KETA 4Q4MA 2V2HA 3H6OA 3ABRA 1FWSA 1L6GA 3T2QA 1WZMA 4K8EA 2I57A 2YGYA 3MI6A 1VFSA 4NY2A 3T0DA 4IFKB 2JGYA 5A8PA 1WYIA 5GPRA 5F2GA 4OECA 4EMJA 2Z4GA 2HRWA 3ZWTA 3DGHA 4HYVA 1A3XA 2E6AA 3P8JA 4GRSA 2ZRZA 3GDBA 4XAYA 5IDIA 5CPTA 1PCKA 4ML9A 4PODA 1MEIA 2X8GA 2VZSA 1UMLA 1ZCOA 4GK8A 2A7NA 2EJ1A 1UWSA 3V1PA 3EWXA 5KTLA 3R2GA 1W91A 4NZCA 3VPLA 1XYZA 4J3ZA 3AIUA 3FCPA 2OQYA 1X39A 1POJA 7TIMA 5DQPA 1T96A 2CEQA 1OD0A 5JXQA 2HS8A 2O0TA 1MZRA 4AWTA 2F6KA 2OSXA 1KCZA 1BWKA 2BGQA 3ITVA 4HCHA 3B9JB 4AHPA 2QCHA 3FYYA 3QZ6A 1ECQA 2IXVA 1XPGA 4WKHA 4QTGA 3A3XA 4HA3A 2DPEA 3A4AA 3NQ8A 4X60A 4BR1A 5H6HA 2CPUA 3FNDA 3DJGX 2XG9A 1QATA 4EXQA 3M0XA 1Y7VA 2Y5SA 2FZDA 5GJPA 3SGZA 5I5RA 1R6WA 1KXTA 5FEZA 3ZZ1A 5DO8A 1H1ZA 1UWRA 3GTHA 1E9IA 5FF3A 3RF9A 1GOQA 4K2SA 2W67A 3VIHA 2IKJA 1Q45A 4TMBA 1WQ5A 3T42A 1TR1A 3DESA 3M43A 3BURA 2DZBA 4WUIA 3VO0A 5J5RA 2YVFA 4ZODA 1NVMA 3T81A 3W6LA 4NKCA 5BROA 4XKYB 3B8VA 3WFLA 5BXSA 2C0AA 1S5TA 3W23A 1A5AA 1RA5A 2J66A 1AW2A 1VP5A 3PFMA 3T05A 2AL2A 3FSTA 2C91A 1XLCA 1D3HA 1H2JA 3W9ZA 1XIJA 1BXBA 1WB0A 3THUA 3QV9A 4A05A 3GDTA 1D2KA 3WLPA 4S3FA 3R94A 2FJKA 3QYSA 4QJ4B 4MFEA 3B9AA 2PWGA 2B0MA 3I7SA 1GOIA 2RKXA 1QW7A 2YPIA 3IVTA 1HTIA 1V0NA 1WNOA 3GXIA 1KA9F 3KDNA 3UG5A 1JI2A 5K2ZA 5DBUA 4HT3A 3S1GA 1DWHM 3EX4A 4DBSA 5A6MA 1X2GA 1IHIA 3SCWA 4HOWA 4DWSB 4JQAA 2UWFA 4RE2A 1NDZA 3A64A 3MSRA 3EDJA 4S1FA 2HNEA 3DGZA 3H2AA 4V1YA 4GYJA 1XC6A 3M1ZA 4FNRA 1IWPA 1GVYA 3U2CA 1PHWA 3GSMA 3GFYA 3AU6A 4N2YA 4FSAA 2XIBA 5CSSA 1K77A 2OLHA 1UUQA 1OFOA 1B5TA 4JTUA 4PB3A 2V9DA 1KXQA 1K9DA 2D3LA 1UC4A 1GEHA 3SADA 2NT0A 3CQ0A 1UHVA 1Q8JA 4WEVX 3OZMA 4G7FA 2XGZA 1ML1A 3HGJA 4MFDA 4KFOA 3D5HA 2Z28A 3EA1A 3A9IA 3WLSA 1B9ZA 4QLKA 3STCA 4EX4A 1OZQA 1YDOA 5GNXA 1XDMA 2YQUA 5D03A 2IKIA 1GERA 3PTKA 2X1UA 3PZIA 4G8TA 3S9ZA 1XV8A 5FJJA 3BL3A 3OHMB 4ML4A 5XIMA 3OVGA 3N9RA 1MQQA 2J78A 5EFFA 2INZA 4U3AA 3LTSA 1EDQA 2Q8LA 4GIAA 3W7RA 2J8FA 2OEKA 1Z8AA 3UXDA 2J74A 4H9YA 5K9XA 2J8TA 2ZVIA 1NSJA 1CW2A 4DO6A 3GD4A 2A3CA 4F8XA 2VEIA 3REQA 1JXJA 3W38A 4BJHA 3F4WA 4GJJA 3NGJA 1PXGA 4IFOA 4JHOA 3Q58A 4NVTA 2VDIA 1E15A 1TPH1 3TWBA 4X2RA 4DF0A 4A8LA 3WENA 4B5XA 1FWTA 4AH7A 4GUHA 4DN1A 5DT7A 3AIBA 1G1YA 3WQCA 5D9OA 3GO2A 1CX9A 3MMUA 1TX2A 4B3ZA 2TAAA 4ZO6A 4M1RA 1IE7C 1UP3A 1TQJA 3C61A 5LA0A 3SUTA 4JFWA 1DHPA 5GNZA 2BY2A 1U2YA 4EVZA 3KS6A 4DJED 3H21A 5TR3A 3BMXA 1OF8A 4JEQA 5FJRA 3NSNA 3FXYA 3ENLA 3KWSA 5HINA 2GZXA 3UCCA 2BFGA 1W9DM 1AK5A 4EPBC 2BVWA 1AZ1A 2DGAA 4M24A 4K7VA 3KCLA 1J4EA 5DMMA 1RY0A 2VL4A 1XKYA 4PA8A 4IICA 3WY1A 2ZXAA 4IIHA 4G6CA 4AMAA 2FPTA 3CB8A 4D6DA 3KOFA 3I3EA 1CXFA 4EMWA 4Q8WA 1ME9A 1IGWA 1R87A 3URQA 2RHGA 3UPBA 2QUVA 4DBWA 1Z69A 1PX8A 2X2GA 4HNVA 5M3WA 1HQTA 3HM7A 1FH9A 2J27A 1D7YA 2EGZA 1ZU8A 2VC7A 3EOUA 4PCFA 4BEUA 4Z1AA 4P7OA 4ZE5A 4GVHA 4IGMA 2BB0A 1FHDA 1IEWA 2FZNA 2WMGA 4H4IA 4DRSA 4D2JA 1A50A 4EIVA 4C1LA 2RJHA 1U83A 2VC5A 3FVMA 3NDOA 4CCEA 3EDDA 2G3JA 4S3CA 4S3KA 5LIWX 1PX3A 4LEFA 1E6SM 2O7QA 3LXDA 1OC5A 3WLKX 1EL3A 4KWUA 1NHRA 3PZMA 2IXUA 3UR8A 3GZAA 3VOHA 1EUAA 4OGZA 1W9XA 1H41A 3LMZA 4PL2A 2G96A 1YMYA 3B0XA 1FP8A 4ZXLA 4IIFA 4GZEA 3VM5A 3LRLA 4EACA 4JKMA 3PZ9A 2V5BA 1CGTA 2H3BA 3LN3A 4MTVA 1YPFA 2EPNA 4X2PA 3WH9A 2HWGA 1YXYA 4W8AA 4NZJA 3VDGA 4QE5A 4NZ1A 8A3HA 3AS3A 2BV9A 4HNTA 3LCLA 3KP0A 2IPFA 1ZFJA 5HWMA 1DJWA 1GQLA 1K8YA 4PMVA 3UY7A 3NCOA 1A3WA 5BRPA 3MBDA 1OB0A 5LNVA 4QROA 4JPGA 3TYDA 1DJIA 3GXFA 4P7QA 1JCNA 4HMCA 4R27A 1FEBA 3WNPA 2VEGA 3W74A 1X1OA 3NAVA 3IGSA 3CH0A 1BAGA 7XIMA 1TPB1 4G1KA 3ID7A 3NQ6A 5A94A 1TV3A 3FA3A 4C7DA 4TOQA 3HA1A 3TC7A 1FY6A 3GAYA 1PVNA 4HPNA 2Z1XA 3N4EA 4YNGA 2QIIA 4XZHA 3XIMA 1ZL1A 2R24A 4YHEA 3DGBA 1WCGA 3MUCA 1XGDA 3G0XA 4UTTA 4AC1X 4E4UA 3UNTA 1GVSA 4LF1A 5FD0A 5C55A 5A6JA 3TQ0A 1HF6A 1YBQB 3K1DA 1A47A 5I02A 3PSWA 3RYSA 4DBUA 1UIPA 3QGAC 1Z32X 1X2HA 3W1RA 2E40A 4GNVA 1I60A 1OGSA 6REQB 4Z1CA 3GG0A 4I6KA 4JDYA 1JROA 3P82A 3W85A 3D6NA 5DLCA 3WEOA 2W61A 4BF9A 2JEQA 3IRSA 4GISA 3CEUA 2ALRA 3CQKA 3WBYA 2EAWA 5JCKA 4P8WA 4H8NA 1GPFA 1KD0A 2FDSA 3WCZA 5A2AA 1OCJA 5IBXC 2YVGA 3VMOA 4AB4A 2ZOXA 3SBFA 5K9DA 4FNUA 1XHGA 1YHTA 3L65A 2J9ZA 1UKSA 4LAKA 3RLUA 2JFEX 4OBTA 1SJAA 1RH9A 1Q6RA 3BE7A 3N2OA 1UD5A 2WCSA 1FCQA 3UG3A 4C1NA 5EU9A 2OT0A 3IACA 4H4YA 1JCLA 3UF9A 1FOBA 4NXSA 1MEHA 4LA1A 3QR1A 3PUGA 3N25A 5FAJA 3QN3A 2OZTA 2NXHA 4IP4A 2NZLA 2ZZ5A 3OIXA 1LPFA 2R94A 4UMBA 1LWIA 4LAOA 3VIFA 2PE4A 2YJQA 3M5VA 4ZQMA 2FZMA 4DAIA 1MDLA 1GTHA 3F4VA 1OINA 3B8IA 3U3HA 3R10A 4PL1A 4UTUA 4MZYA 5E6ZA 4A8NA 4D6GA 2J7GA 1OFBA 1QWKA 3NQFA 3WQGA 5CZSA 2PP0A 2E5BA 3CLWA 5CAKA 1G7UA 1KV8A 3GG1A 4QQUA 4L9XA 1W5PA 3GH4A 4M81A 4MKSA 5BWFA 2GQ3A 4GHRA 3LXAA 2E9LA 4GUFA 1RD5A 4DLFA 3GDMA 3H22A 3AMLA 1N55A 3TMQA 4Q33A 4GABA 2IKHA 2BVDA 2JF6A 2QV5A 1M68A 3IRDA 4JFTA 4HNNA 1VYRA 3VD5A 1AW1A 2GDUA 1AVAA 5EGRA 4CNTA 3CUZA 4C90A 2GGIA 4PBGA 7ODCA 1VBHA 2YDSA 3VOJA 2XFWA 3EXSA 1QASA 3RN6A 1OEPA 2PI6A 1YQ2A 5A6BD 1JZ7A 4AZIA 1WKEA 1DTNA 3ZLFA 3TA6A 1TREA 4MKNA 4E8CA 1US2A 4O19A 4KQNA 4LWWA 2Q8ZA 5TBOA 4HA4A 1WOBA 1LRNA 1GW9A 3KRZA 3O15A 4ADTA 3KFTA 2XSAA 1DHKA 4E2VA 1C90A 2BP1A 4QE1A 3CMFA 1XLBA 1H7RA 4JTAA 4YTSA 3N13A 1FA2A 1W5QA 5DY2A 1X98A 3N9SA 1QNPA 3AJ7A 4RE4A 4BQ2A 3WLOA 2XINA 3NL3A 3MT1A 4DX3A 1P7TB 3KTSA 3UWVA 1EGMA 1KGUA 4LAUA 3LRMA 2VWSA 3DG3A 4DYEA 1MWOA 2BZNA 1U1HA 2ABBA 4GIRA 3IUHA 1IGSA 4ADSA 3S2JA 2GQAA 1ZALA 2VR5A 3HPZA 1XH1A 4UFKA 1RCOB 2GJXA 1CNVA 1EUNA 2G3MA 3KLLA 3HGRA 2DVXA 3AZTA 1V77A 1JD9A 2OMAA 1V93A 4B90A 1SO6A 3CUGA 2X41A 4I9JA 4XIMA 3AMGA 5REQA 2VRKA 1J11A 1ZENA 2DVUA 2ADAA 3R0KA 2XHYA 5A6KA 2FMNA 2WOIA 4LH8A 1WZAA 3VZYA 2VCCA 1QI3A 1Q6OA 1TYPA 4G1NA 1TA3A 1XYCA 1B3WA 1XDJA 2ZZ1A 4GXMA 5E9XA 1T8QA 1W9UA 3P84A 3I7RA 3C2EA 1XGZA 5L9FA 3MTWA 3DDMA 3AXIA 2H9AA 3OG2A 1HJSA 2D23A 1KM6A 3V4BA 3U6WA 1R3YA 1V0MA 2J6VA 3QV7A 2CLFA 2CZFA 3LEPA 4MNMA 1MUCA 5C8BB 3MBFA 4NUWA 2HXTA 4CU7A 3QFBA 3COTA 5LNWA 2QPUA 3BARA 3E38A 1PV8A 3VGGA 4GCAA 1YNYA 1N5XA 2PTZA 2OQLA 2DUXA 2Z1WA 1DIKA 3QHNA 4IUGA 3FS2A 1PJ9A 1P7TA 4HTBA 1FCUA 4MHBA 3V3WA 4M7TA 1TRIA 3I68A 2IUZA 4X3ZA 2XN1A 1QBBA 3PTQA 1B3VA 3QC3A 1B3YA 5G2IA 1MSSA 1EBDA 4HHHA 1OWQA 2R1MA 3FSUA 3DG6A 4FLRA 3IIVA 1A0CA 1E55A 2Y0FA 4DZHA 3CJPA 4V1XA 4CKQA 1XIDA 3KW3A 3KWXA 4WVXA 1Y5XA 2E3TA 2OB3A 5HR6A 1ALDA 1XLFA 1PZ2A 1A53A 3LTYA 1TV8A 2PD9A 1FWNA 3WD1A 2WBKA 4HMEA 3STFA 3AM9A 1ZZMA 4RPQA 1FFQA 3BCDA 3EAOA 1UOKA 1RJRA 3BK0A 1SFLA 2A3EA 3BMVA 4O12A 5EBUA 3QQ0A 1RXOB 3W7LA 2X0YA 1P1XA 1BWVA 4RNIA 2GL5A 3QEZA 3TFXA 3VNIA 2JQXA 4AIEA 4AU0A 1JZ4A 3WYZA 2QQ6A 4GI9A 1YIXA 1MFVA 1W3NA 3G1RA 3VFCA 1QVBA 2PWEA 3AHVA 4IMEA 4N9EA 3E96A 4R5EA 2C3CA 3OA5A 3RLHA 3DBNA 5DF0A 1MO0A 4QG9A 1YPIA 3OOQA 3OZOA 1EQCA 3LCIA 4EQXA 3HQNA 1NWUA 3OZPA 4O8RA 1Z41A 3W00A 4UMCA 4MKVA 3MU7A 1G01A 1W9VA 3O6AA 2YBVA 3LLDA 4RE0A 2WPBA 3AO0A 1TWIA 3TCSA 4B5VA 2HE8A 3W2MA 3TU9A 4LYPA 3IARA 1TPEA 2ZUVA 1YLVA 3NM3A 5HA7A 4F0HA 2ZC1A 3TTOA 6PTDA 5U7SA 5D2VA 3PG6A 3NQEA 2NSXA 3B04A 3M41A 3CL7A 4AZ6A 4ZEPA 1YADA 3W0KA 3ARVA 1EJTC 4XISA 1RJPA 4K8DA 1GZ1A 3KE0A 3LS9A 2X16A 3LQLA 1ZY9A 4LUSB 1MXDA 1HGWA 4WY0B 1UKTA 5DEZA 3NQBA 3VCRA 3JZEA 2J7EA 1BHGA 3QM3A 1T99A 3WH6A 4U5IA 5DCEA 3GHSA 1JPKA 1YNPA 3C0JA 3PNUA 4YHGA 1WOAA 2UY3A 2OQHA 3KOZA 3PPCA 1X8FA 1QDSA 1FRBA 1CPUA 4H6RA 1M7JA 4XBSA 4DWSC 3L9CA 5C2XA 1Y65A 3OQEA 2DZVA 1BRLA 1MRQA 2WKGA 4ZOCA 1XYLA 1TWZA 3IAQA 3TFCA 3POCA 3VZZA 2O92A 3KCJA 4A2SA 4OIFA 4AY8A 4DNHA 2VUYA 3QLLA 1W5NA 2XZ7A 4WDXA 2WM0A 2XPKA 2OYLA 5LA1A 1QI0A 4MADA 3EPMA 2ZUUA 3STGA 5K4ZA 4GPNA 1DJNA 3ONCA 1SO3A 3T40A 1D3GA 2V3AA 3CWHA 3W76A 4EKJA 1I2QA 3N9KA 2GVYA 3GBEA 1WX0A 2YDRA 2VJXA 3KOYA 1QK0A 1UWTA 1GXFA 2CBUA 2PDMA 4B9YA 1Q85A 4D1JA 3R4IA 3A4JA 4UC5A 4OVXA 4EAYA 3IJIA 4I5UA 2DDXA 4H9XA 4AZGA 1RLCL 3UERA 4AISA 1BLIA 4NNBA 1XD1A 5A8MA 4PEEA 3FHAA 4ACZA 2F5ZA 2G95A 4AD1A 1GOMA 1KN0A 1AQMA 3A5FA 3L4YA 2PTYA 3WNLA 3ZJ8A 8CGTA 5CC7A 3NGFA 5HAOA 4XD6A 2QYGA 4UWMA 3PJXA 2VGGA 3WEZA 1OF6A 1GG1A 1TV7A 1AJ2A 4JIQA 4I6VA 5A6SA 4X0VA 5CKSA 4A21A 2EO7A 2HPIA 3SSJA 3VX1A 2X99A 4PTMA 1UC5A 1FO4A 4F66A 1H61A 3LGDA 3I3BA 4YWIA 4GC3A 4QXIA 1V4YA 5AC8A 1WBJA 4G2DA 2WC3A 4IIDA 4DHGA 3ARQA 3CAKA 3FIGA 4I8YA 2D1ZA 2QCDA 5HNRA 3QMRA 1X7IA 1TPWA 3BSMA 5ABEA 3VIMA 4FNPA 4OWGA 4DUVA 3EMCA 2F2KA 1KM5A 4GOAA 3EXRA 1VHCA 4WOZA 2DT2A 1XRSA 3JR2A 4L1GA 4U5KA 4IHCA 1GJWA 3N4AA 3P7YA 4ZA0A 3KL3A 2RABA 1W3LA 3CT2A 3KCOA 2CESA 4L80A 5D2TA 5ABTA 2XIIA 2PMQA 2ZADA 4QJ5B 3KLJA 1FWFC 3BAXA 2W54A 4HNCA 4PFHA 5CPNA 1XH2A 3VUSA 2WB5A 4TTGA 4YVVA 1ESWA 3R0UA 3GWQA 5DMNA 4P8UA 3U2ZA 1LUCA 2O4MA 4CN6A 3SRFA 2DW7A 2UY2A 2PDQA 1XIHA 1VEMA 4Z42C 2TSYA 3KX6A 4XZ9A 3NURA 4IL0A 2Y7DA 2EF9A 1XP3A 4W84A 2CLOA 2WVSA 3O63A 3AUJA 3FAXA 2B7NA 3FA5A 5C5YA 1C8XA 1ZBCA 2BDQA 1IIHA 3IGHX 1SJBA 2QLYA 3VA8A 4BI7A 4LUIA 4JY8A 2FQIA 4KESA 3RM8A 1X6UA 4W4QA 2VO5A 1EPVA 3GIQA 2V63A 3W37A 2PURA 3QR3A 4B16A 1E1EA 3U2OA 4L64A 1PB0A 3CC1A 3CK5A 3ZLGA 7PTDA 3L0GA 1HKWA 3HG5A 1A49A 5AHIA 1ZBWA 1V97A 3RG6A 4Y9OA 1MW0A 2I9EA 1RK6A 5A95A 3GTXA 2E9MA 3CV2A 3FJ4A 4H8UA 1Y8BA 3IJDA 3M7WA 1L6SA 2E67A 4HP5A 5I3DA 4AVOA 4YWOA 5HANA 4NI8A 3V18A 5FEPA 5HOSA 1UCWA 2R1KA 4XD4A 4BI6A 1K6AA 3TJXA 4M0XA 5L6UA 4IISA 1EP3A 1L6FA 4HU8A 3EZ4A 4IX0A 4LW7A 4ZVJA 4B3KA 4TUFA 3W27A 3S5ZA 5H8PA 3TQVA 4IWWA 1X8CA 3WLNA 3NEVA 5A69A 1AQ0A 2EQ8A 1FIQB 1GYLA 4MJMA 3P5YA 3UXLA 2OEJA 1AL7A 4NJGA 1M5WA 1OIFA 1HKJA 3TROA 1KGXA 1ITUA 3BXWA 3DK8A 2WHKA 1UYQA 3BAJA 2Q3RA 4JNYA 3LZ3A 1SSGA 3W28A 2CCRA 1ZSXA 4W7WA 5E09A 3LHUA 4HBKA 1R85A 3EX6A 3EXTA 3GY1A 3N6JA 1BSLA 1RPKA 1GZJA 1E0UA 4FR1A 4Q4QA 4KCUA 4ATLA 1I2RA 2IQDA 3RU8X 1N2VA 1G4TA 1JDFA 1MMFA 1R3TA 3EANA 1M9HA 3WL0A 4JIPA 1OX5A 3ITCA 4MWAA 3BG5A 2GWNA 1AJ0A 1D9EA 3CHVA 3ABOA 1UZ1A 4GCXA 3RGTA 1EA9C 4FXSA 2CETA 2R82A 3R07C 3MVTA 1QCWA 2VWTA 3O6YX 3OYXA 1OT2A 3N2TA 1ZJHA 3WLTA 4QEEA 1LVLA 1E4IA 1XCFA 3S5OA 3EDEA 4ZOBA 1UKOA 1BGAA 1XBXA 5LZLA 2C71A 2J88A 3GNDA 4ATWA 5G2HA 4W93A 4HNLA 2XJ7A 4UFMA 3OB8A 2BOGX 5EYWA 2HBXA 2QS8A 3H2CA 3FGCA 2Q8XA 2QJHA 2FZBA 2Z0IA 1VIZA 1RCXB 1R3QA 1KFWA 2W55A 3GDKA 2PDYA 3QMTA 4JBRA 4LCQA 5JVLA 5FJUA 2VR4A 4O0KA 2E77A 3NQGA 1H1NA 6CGTA 1HJQA 1V59A 5CCZA 1XR2A 3R89A 2BHYA 1N5WC 3WDIA 1G4EA 3L5OA 5TNVA 1RLDA 3U4AA 1SMAA 1WUFA 2CBJA 3CGTA 3C6CA 3Q6JA 4LBSA 3KUMA 2J24A 1XGEA 3L23A 1VFOA 3D3FA 4EE9A 5C9WA 1UWQA 3AMZA 2OO0A 2VVNA 3B0YA 3WLLA 2L5HA 1K9TA 2ZCGA 5BOFA 3WUBA 3ANVA 4XO6A 3M0LA 4JIRA 1AH4A 2GUUA 4LX4A 3PUDA 3VIKA 5FSDC 4C6QA 2BY3A 1IQ8A 1K9EA 4QSHA 5D04C 3CASA 1QRQA 2QT3A 2VFEA 2CKSA 1J0HA 1R46A 2XUCA 4JN7A 3VNLA 2EHHA 2CLKA 2V2CA 4L5ZA 2BVTA 2BTMA 2Z1KA 4R3UA 3GFZA 4BWLC 3RO8A 4HNOA 3I4EA 4U2ZA 4HYRA 4R88A 3K1GA 2J7CA 2G50A 2HBVA 4Z2HA 1TRDA 3VDHA 1I2OA 3CTTA 4S3EA 4GVGA 3WQEA 3PS7A 1CDGA 2DW6A 2IPWA 1D7KA 2GVEA 1GWJA 1LOSA 5FJTA 5HNUA 3LBOA 4M51A 3AS1A 2A79A 4EXAA 3OLDA 5EL1A 1HXJA 1OFPA 2P8CA 1H50A 1EXBA 2YCJA 1EP2A 4IG2A 2OKTA 1B30A 1BTMA 4UQBA 2ZWZA 4Q8PA 3TTSA 2HVNA 2HQAA 3ES8A 4E0CA 3WF1A 4ERGA 4O10A 1E6XM 4UNKA 2QAEA 1RM6B 3NVVB 5LNRA 4W7UA 3QW4B 2BMBA 3P67A 3OIHA 4MLJA 1LQ0A 4MJ4A 1KR1A 3DG7A 4Z08A 1TO3A 3HRDC 3NQ7A 1A5SA 3VKCA 2E6DA 4MPQA 3UJRA 1XI3A 1R2RA 4LUYA 2YB4A 4MJZA 3KVLA 6TAAA 5HPCA 2CW6A 1GORA 3WBWA 4ILSA 2YB1A 1W3KA 2CYGA 4F2TA 2V0TA 1A3HA 1FDZA 3VKKA 4PMZA 5I06A 3THCA 2TMDA 2D73A 4ZOAA 2C3DA 2F2HA 1HKMA 3WLRA 4L1WA 3TXVA 1SZNA 3A9BA 4RZBA 4POCA 2CIPA 3O1NA 1CENA 1LZOA 2X7WA 3AIWA 2C19A 1GKQA 3NO5A 4DUOA 1FWHC 2VGFA 3TMLA 5EMYA 2WVUA 3TKFA 1U22A 4XUGA 2GK1A 2VOTA 4PUUA 1V0LA 1CXLA 3O0HA 1ITXA 4I90A 3LI1A 2P53A 1A5NC 1RK5A 3C8NA 3ZVHA 3ATYA 1GREA 3LYEA 5G4WA 1O7AA 4LIIA 2E1DA 4J56A 1M7PA 1H49A 1M7OA 2X42A 3VNKA 2PA6A 3DC8A 2Z24A 2NQZA 4HJWA 3CHFA 2X1IA 4PGLA 1YNQA 3GZ3A 2WCAA 3VYLA 1EJWC 4MWAE 3CO4A 3CQIA 1B9BA 3CUJA 4UTJA 1JGIA 3MZ2A 3BLFA 1KQZA 4FA3A 2G97A 2XVPA 1W1VA 3BOLA 4MUZA 5LKYA 3F2BA 3RRXA 5A6BA 2FDMA 2WPCA 3RMEA 2WLZA 1HL9A 1T8XA 1ZMCA 1J5SA 4IQLA 1HGYA 1SJCA 4XZLX 1BEUA 2GGJA 2OYKA 4P8VA 4GQ0A 3WBAA 3SB0A 5D09A 4BHYA 1PKMA 4DF1A 1DXIA 1PE1A 4LBRA 1NQ6A 2OG9A 3LADA 1I6NA 3LG3A 1NP2A 2Z2UA 4UBPC 3Q4DA 4LAMA 2W27A 4ICNA 1V6TA 3N3MA 1SMDA 1W5OA 3PPGA 3LCFA 4RZ5A 4IFRA 1Q1RA 3PBUA 3AHYA 4DY1A 2ZTJA 1YYAA 4K38A 4KEVA 4NRSA 1RZMA 4Y7EA 3VOCA 5JCMA 4CUCA 3FG2P 3GDLA 1KNWA 3GW3A 3GE7A 4MNKA 4DO7A 3T07A 2IW0A 2PLJA 5HNNA 2WKLA 3CHEA 3NYDA 1VD6A 3LNPA 4NX5A 3VGBA 1BQGA 3UY8A 4NNCA 1E6ZA 3DFOA 2PRLA 4IIBA 4KRZA 1FWRA 3EWZA 4YCPA 4JXCA 1A0DA 3FW6A 1MVYA 3IIOA 2Z26A 3H4WA 4U2YA 4S3GA 3UXIA 4H4QA 4MLRA 4K8HA 1JGMA 1A4MA 1FFRA 4FAMA 1AFSA 5JU6A 1RBAA 2QVNA 1TUFA 2FKPA 1XW8A 1I0BA 3NZPA 3WKZA 3ME3A 1MW3A 2XIOA 5AB3A 5CZ0A 1JG9A 2PGRA 2WV8A 2DH3A 4B3LA 1JYNA 4UQDA 1UR9A 4OTKA 2DZUA 2ZX6A 2DIKA 1HJUA 1W1B1 1B4KA 1B3ZA 4X63A 3QV6A 4QCEA 1TWDA 3T09A 3P2VA 4DI8A 3SJ3A 4N9BA 2PWVA 2X0HA 1GRBA 1Y5VA 2O9RA 3N29A 1YXDA 1VB9A 3UR2A 4E8DA 3B03A 2V6AA 3ELFA 2ZRYA 3VNJA 4KWWA 5CZKA 2WOVA 1XRTA 3VIOA 1UR2A 2J77A 3H2NA 4H4UA 1F05A 5FF7A 4ONVA 4NG3A 2A8XA 1NFBA 2ISFA 3VNMA 1U5VA 4BQ5A 3N3TA 2QULA 3GR8A 5EMLA 4C6DA 4O8AA 4H9TA 1Z6KA 4PUEA 1LG2A 1LT7A 3T9PA 1CECA 3WLJA 5DRCA 3LLXA 5D9NA 1OG6A 4TV6A 4JY9A 1DKWA 4AC7C 4QIUA 1PZ1A 2E28A 2KAUC 4UFLA 1F9CA 1UIOA 4H01A 1WA3A 2B7QA 1UOZA 3NOYA 3BLLA 4QRNA 4S3JA 3IK2A 1KTCA 1QNQA 3XINA 2Y5JA 4QLLA 3GYCA 3W1PA 4AW7A 3EEZA 4DJFC 3CBWA 3B9OA 3W1TA 2QJGA 4TX9A 1DQWA 2FFCA 3OGVA 4Q6JA 4IH3A 4OUEA 4F2BA 1Z44A 1E4MM 4JR5A 2DJLA 3T7VA 3ICJA 2IPJA 3ARRA 3RNMA 1XANA 2W3RA 3VX0A 1UQYA 3S2LA 3T6CA 3HF3A 4D6JA 4DZIA 5DCBA 3IJ6A 3ORWA 3OA3A 3S42A 4N9CA 2FTWA 3CMJA 3VCNA 2QDGA 3APTA 5KZMA 2PC4A 3LQGA 2ANUA 4XQ6A 1W8GA 1IT7A 3W82A 3QYQA 1CI1A 3DKJA 1TJ0A 3WDHA 3CB3A 4FDCB 4MSSA 4DB7A 4KCVA 3NOEA 1LROA 1ZQ5A 3IVSA 4UUIA 2YVJA 3QFEA 1QAPA 3JVAA 3S46A 2YXGA 2FZ8A 1FH8A 1ZPTA 3S2NA 3JS3A 2ZQ0A 4L6HA 3LRKA 1S5VA 1TIWA 3T0BA 1NWSA 3MKVA 1YDNA 4JGDA 4GR1A 2WJEA 1LL7A 1NEYA 2ZE0A 1IF2A 3KVMA 5FL0A 2BGNE 3R5EA 4H7VA 4MY1A 2ZRVA 3OODA 2YCLB 4ZQCA 1UG6A 1VR6A 4RXFA 4NAFB 4PB4A 2X0SA 2D20A 1J0KA 4DM1A 1LTDA 2PEVA 4XG1A 2WSKA 1CGUA 3H54A 2B4GA 3W71A 2D69A 5IXEA 4AG0A 4IPJA 3FHQA 4LVFA 4U28A 2YL8A 1E1CA 1Q6LA 4GWEA 4S38A 4O11A 2ZBTA 2OZ0A 1I75A 4DO4A 1S2UA 1XLJA 2WPEA 4IIEA 4NI3A 3QOKA 1FWCC 4Q22A 1W3IA 3KBSA 1NY1A 1HVXA 2VRJA 4Z0SA 3GG7A 2HXUA 4K6AA 1XISA 5BCAA 1YQZA 4NP7A 4LB3A 3G1SA 2YDAA 3PR2A 1VAHA 2HS6A 3VIGA 3WELA 1TELA 1F2JA 4IMCA 3DYMA 4WJEA 4DJEC 1D7FA 1OABA 3C0QA 4WSJA 1H11A 4LGXA 3T2OA 1VC4A 3ITOA 2ZFAA 4PYSA 3ZMRA 1EOMA 3TR9A 1P0NA 4Y8FA 4QCFA 3S9IA 1PDZA 3W7JA 3UWUA 4UFHA 3SQPA 2WWCA 4CNNA 3HGOA 1F07A 1XBVA 3MS8A 4N42A 2YCEA 3VD9A 1JZ2A 2CC0A 1XKJA 4R7OA 4GO8A 1WP6A 3AYRA 3C56A 1P0KA 2I14A 3BW3A 3AYTA 3PNZA 1N8FA 4OOUA 4PR4A 3CYVA 1G69A 2W3ZA 5DELA 4C7FA 4GGBA 2WMIA 4QAIA 5I79A 1ZP3A 2J25A 4HJFA 1R3WA 1TJ2A 1W17A 4DIAA 3SUWA 4ACYA 1VJSA 4IQEA 4B9ZA 3SJNA 4HSHA 1PYFA 4YLWA 3FAWA 1BF2A 3BSGA 1ENUA 4FNSA 4H4VA 3OW1A 5AYYA 1EWEA 4CCCA 3O8AA 3RX3A 4O18A 3VK5A 2VDHA 4LVBA 2Y8VA 1J79A 4IZGA 1H2IA 1HVQA 1BGGA 2E25A 1VQZA 3URHA 1DWGM 3W7NA 1VFFA 4Q3MA 1H60A 4QG8A 2WPGA 5A6TC 3ALGA 4HPXA 5EY5A 4HCLA 4RNJA 2QR6A 2WNWA 5DX7A 1FHUA 4PRTA 4Q4RA 3URAA 2R6OA 3EKZA 1LWHA 3PUEA 3B0UX 2NVKX 3DJJA 4LUTB 1VDVA 4CN1A 2QGHA 2CU0A 3QZAA 3LHYA 4KF1A 5FOOA 2YLLA 4L9YA 1PCWA 3M7SA 4KMQA 3TSDA 4J3VA 4D8AA 2YAUA 4XUYA 4CQCA 3WUFA 3SCNA 1KFJA 1UA7A 4EWND 1GKRA 4NJKA 1Q6GA 4LAZA 4LALA 4AF0B 1OC6A 1M7XA 1IZCA 4JFSA 4BS0A 3O05A 4UXDA 4C91A 3S3GA 1IEQA 1REQB 1SQ7A 3LA4A 3HPSA 1ZS2A 1S5WA 3WNNA 4KPLA 1FKXA 5LHEA 1EJ7L 1JEZA 4GNKB 1NHPA 3UEQA 1WO2A 1WDWA 4NILA 5K3VA 4WHBA 4PMQA 1ODUA 1W9BM 5F4WA 4NZFA 1OK4A 4WSHA 2Q01A 1QU4A 4LFYA 3VOFA 1RR2A 3NA8A 1BFNA 1NELA 4JKLA 4JTLA 2VFGA 2V5JA 2F6UA 2PDKA 3TC6A 4I8DA 1NF7A 1EF2A 7REQB 4JX5A 4XAZA 5LGZA 3D0CA 1O6IA 4M52A 1F7BA 2JGQA 2BASA 1FH7A 1R7AA 3WLQA 2AQOA 1R86A 5CBJA 3MSGA 1F3EA 4GD0A 2W62A 3IUDA 2AMXA 2V5KA 1X6NA 1OCNA 4PUDA 3AIEA 3GDRA 5ABFA 4CN4A 1N63C 2WVVB 2Y24A 3W7GA 5F1VA 1W31A 4IPPA 2NVCA 2OZ8A 3UZXA 2OCZA 3IGXA 4F0SA 1UQZA 2MNRA 3CIXA 4IGNA 2PS2A 1NFPA 4GY0A 2C8NA 3G1YA 1KBLA 3G8EA 3KBJA 5KVHA 3THQA 3W2UA 1G4PA 3N17A 2PB1A 1V7AA 4QDWA 2CWXA 1VLIA 1S2TA 2QW5A 1YKWA 4DJDD 1V02A 4O15A 1M65A 5EB8A 3KEHA 4AD5A 3V36A 3L21A 1IT8A 2DSZA 3UR5A 5HUOA 1G67A 1VENA 5DN1A 4AF0A 3DI1A 3EOEA 3JRKA 2XFYA 2PU0A 3C0SA 4ZB0A 2CLPA 5HBFA 1LYXA 4GZJA 4EPDC 3UWQA 1FHVA 4FX6M 5IDZA 4IMGA 4XV0A 3UJFA 5K9CA 4KS0A 4LTSA 1OX4A 3PZNA 1L2QA 5C2GA 2A4AA 5CC5A 3IWPA 1HP5A 3AS2A 4CCDA 1VCVA 4O57A 3WEMA 1HKKA 4AHQA 4M19A 1R2TA 3MB9A 1VPXA 1ZAIA 3PZUA 9XIMA 4GBUA 5MF5A 1BG9A 2X50A 3AZSA 2XVLA 3WNMA 4P7NA 2INFA 1V6XA 4M3PA 1J01A 4IIGA 3ZT6A 5T8GA 3ITGA 4DYJA 2H6RA 1DE6A 4YJ5A 1C91A 2HEJA 2Y8UA 1JFHA 3DFNA 3PUOA 1DJZA 3RMJA 4XTIA 5BXRA 5FJOA 4GACA 5DT5A 3D46A 1QT1A 3BPWA 3L4ZA 3OLGA 1CZ1A 2BODX 1HKVA 3M0YA 4NU7A 1TVNA 3W01A 3MKKA 3PP7A 4C60A 4FP1A 5AZ1A 4DLMA 1V8EA 1LQAA 1W3JA 2ZXQA 4G7EB 4C5YA 2WBGA 3DYOA 3OLEA 1UUMA 3CLMA 3A24A 2NQ9A 1EZWA 2WC4A 4RW5A 3IK4A 4H4ZA 1NWRA 3DH9A 4MB3A 3CS2A 2PZNA 3H12A 4ZTYA 2YBUA 1RP9A 2ONEA 4GE8A 2I7GA 3NO3A 1TTIA 2VEMA 4L56A 2CZ5A 4C6EA 3AS0A 4MF4A 3JW7A 4PTXA 3B9NA 1D8CA 3LV6A 4UZSA 1H1YA 1LF1A 3USZA 4JD4A 4D6EA 1LOLA 4WXYA 1EYWA 4CQ8A 4TVYA 4XZNX 3CZGA 3DAQA 1MEWA 1WZLA 2WQPA 3E0WA 5D05A 3IIZA 2OWWA 3VNDA 3JUGA 4H9ZA 3TW7A 1SPQA 4YIWA 3PBMA 4ZXOA 3G0SA 3TYAA 3CGDA 1P48A 4XZIA 1MW1A 5C9UA 1G0CA 5EPDA 1ZK7A 2EKGA 1KM4A 1IWBA 1WXZA 4TVWA 3VMNA 3CZEA 5JBFA 4Q7BA 5IHRA 4YN5A 3UYIA 3W1LA 1BZLA 2AQVA 3DN5A 2ATSA 5BWAA 1F61A 1VJIA 4PBFA 1JDCA 1HO4A 1T6MA 2XSBA 3W1XA 1DJXA 4DEFA 4LV9A 1IXPA 1XLKA 2NXIA 1FWDC 1KM1A 3ABSA 3SO7A 4CVUA 3SDOA 3TCEA 5I23A 2PDGA 3AISA 4S3AA 2REQA 2WVTA 2HZGA 1RCQA 4UQCA 3VXGA 2I56A 4QEHA 1CGXA 2W9MA 4NYUA 3L4VA 2Z29A 1C8VA 5JUVA 2A6LA 3MJYA 4D6FA 1K7XA 3SCQA 3IV8A 3SCSA 3TSMA 4K68A 1TFVA 2VFHA 4AEFA 2VTFA 2FVLA 3W72A 5LIUX 2SFPA 4BK9A 4I7UA 3HFYA 1EJSC 1VBGA 1L8NA 2WC7A 5LA2A 4PMJA 1F8WA 4UTWC 1X1ZA 3UYCA 2FVKA 3OZYA 1Y0EA 5AN7A 2POZA 1DTUA 7ENLA 4DNMA 3LI0A 1H63A 1JZ6A 3LY0A 1VHNA 2OELA 3B4UA 1SW7A 3W6MA 4UR8A 5E0FA 3RIKA 1XBYA 3CHCA 4A4AA 3DCPA 3W25A 1IIGA 2CHNA 2WSPA 1Q8AA 1DOSA 4QLJA 1GTEA 2RAGA 1G5AA 2B7OA 3L2IA 5C2CA 4OHQA 1KBKA 3PK7A 4M29A 2PF0A 3HV8A 1TG7A 1C7SA 3L5MA 4CEUC 3QVQA 4ASTA 1PZ3A 4HCDA 1FQ0A 1IT0A 2C0HA 1KV5A 1BXNA 1FKWA 1XWYA 4JTTA 1E72M 4ATDA 3O0KA 1VCFA 3TYBA 3AXMA 3UPWA 1AA1B 4H04A 1OYBA 3ZVIA 4KBXA 4O17A 1Q4NX 4O1CA 3VKAA 4NIRA 3N6QA 4J28A 5EBAA 1XJBA 3NNTA 1UPMB 3EAUA 3GH5A 1F3TA 2NV1A 3AIVA 5G2WA 2HJPA 1XLDA 3TEVA 2GSHA 3PWAA 1YXCA 4UFIA 3F4CA 3MDWA 3VFLA 1E6QM 1V3HA 5D8ZA 2YL6A 4D6HA 3G6LA 3BLKA 3WLMA 1UZDA 4Z1DA 3PG9A 4L6DA 2X40A 1KFLA 2CLLA 4YVXA 3VI2A 3R0DA 4B91A 4KCTA 4YWSA 1JD7A 4JTGA 4DZAA 3O7UA 3S1VA 1IYXA 3PPFA 1QNOA 1M6JA 1QNRA 4H4XA 3TN5A 4MY8A 4YTTA 1H62A 4U31A 4GYPA 4HYWA 1K4GA 1OYCA 3GUWA 2CNCA 2NVAA 1TR9A 1CGWA 4WRHA 3KHJA 1O5XA 3QR0A 3TDFA 3IS4A 3DERA 1OT1A 5A1AA 1WDRA 3W29A 3TYZA 3LK6A 2ZRXA 3N2CA 1J0ZA 1K7FA 3LGEA 1JUEA 4Q4OA 3HG4A 4GGHA 4DI9A 2PDIA 4GZ7A 1C8QA 3EB2A 4QDPA 3RCNA 2AL2B 2TRSA 2RDTA 3AU2A 2B7PA 1PIGA 5EA9A 1AOGA 1TIMA 4MJ2A 3A13A 1DL3A 3IJ9A 2NV9A 3G77A 3ZM8A 2A0NA 1DWJM 2GR0A 3GD3A 1Q13A 2BY1A 3OTRA 3GU2A 3G3DA 3VDAA 3LBMA 2DJXA 4K8GA 2YKKA 1AW5A 1NARA 1O5KA 2P0OA 1O60A 3L0KA 3P74A 2WNQA 1DQUA 4ECLA 1VFLA 4UOJA 3M0ZA 3O3RA 3UZWA 2QHAA 3AICA 3TYEA 2E8YA 1OGBA 3OHIA 1B3XA 2GUYA 3GD6A 2ZA3A 5HMDA 4M80A 4M1BA 2HVOA 1XBZA 3L8KA 1FFUC 3RCMA 3A4WA 3BGJA 2PTWA 3QPEA 3GXDA 1NFGA 2FZ9A 1K8XA 1RY8A 1TCMA 2IS7A 2CLHA 1KM0A 3E0LA 3LTPA 4EM3A 5C9RA 3WO8A 1LP6A 1MXGA 1MNZA 4DELA 3HFTA 1TWSA 5A2BA 3EWYA 1SZGA 3NZ1A 3LHVA 1JJKA 4QG6A 1MFUA 3AJXA 1F74A 1DIDA 1I45A 5IFTA 4LB4A 3CZKA 4GBDA 2J3NA 1RAKA 2NSOA 2GPTA 1GCYA 4PEKA 1AG1O 2ZA2A 3SY8A 4ZL1A 1K03A 4FOUA 1GRAA 2WQDA 3FEMA 4APNA 2YZRA 1DJQA 1EJVC 4N6FA 5AZ0A 1K02A 3DENA 4HU4A 1QW8A 1OFEA 2CBIA 1QPQA 3L7RA 3QH2A 2E68A 3NTYA 4X0NA 2RJGA 3W84A 2CZEA 2VYOA 2WANA 2ACQA 3QQ1A 1O1HA 2XYLA 1SO4A 1GHSA 4RCXA 2UBPC 2OSWA 1GOOA 1P1MA 2J7FA 2JK6A 3BAKA 3P0WA 5D37A 3L2MA 1JF5A 1TVLA 3ATZA 3FEQA 1XL9A 3T4CA 3NFUA 3MV01 5CBBA 4CD4A 2NX3A 3I65A 1OIMA 2HPMA 1CXIA 3TTYA 3SRHA 3REQB 1P4CA 1WAUA 4YXGA 1EX5A 3TZFA 5G5GB 2TPSA 1XCXA 3N2BA 3WLHA 2KX9A 2HNHA 1W8SA 2Z7GA 3OBKA 2AAMA 2RDUA 2R8WA 5A5WA 4KRTA 3SY5A 3W7DA 2PGWA 4J9JA 1TMHA 3CU2A 3BAWA 4WIWA 2EPMX 1XHCA 3IJQA 3VAVA 1ZBVA 4H2CA 4DZ5A 3AUOA 3NVYB 2QPXA 3NO1A 1U5JA 2WLYA 5I0DA 4CQDA 3AHXA 1FBAA 1I1XA 4HU3A 2CZDA 1EDGA 2QJNA 4JIHA 4IJRA 1ZNNA 5M5DA 4O0QA 3ZOAA 1E6NA 1QHPA 3NPXA 2E5CA 3ZFHA 3UXKA 3T1GA 1SVDA 4HB7A 4PSPA 4PMXA 5CBIA 1GUVA 4FLOA 5F2LA 1QUMA 1X96A 2OWXA 3A21A 3NR0A 3RILA 4M6QA 2O7SA 1RA0A 2C1GA 4H4RA 4WJ8A 2VVSA 5EMMA 4A29A 4AFYA 5CLWA 2PDCA 1UH3A 3MMWA 3FJNA 4MNJA 3C86A 3H7VA 2YSWA 3NRZB 2CLMA 1UR1A 3UU0A 3KRSA 1FXPA 2BCPA 3PM6A 2G41A 4Q4KA 1J96A 3BG3A 1XIIA 3L4TA 2XISA 3T4WA 4RK8A 2AGTA 5HMFA 5MKGA 1JPIA 1FCVA 3KBNA 4PE8A 4AYSA 2V8ZA 4IUOA 4BF5A 4QAWA 1V51A 4TMCA 1JPDX 2DIEA 2C79A 4LJ3A 2GJPA 3WLIA 4WQ6A 4QX4A 1K8CA 2GRTA 4G56A 1C8YA 1JEHA 5CH9A 4C6MA 1OM0A 4IXHA 3FV9A 4L61A 1HJWA 3QHOA 4QNWA 4AUBA 5I24A 3AAMA 2AQWA 5T9CE 1NOUA 3PC0A 4NZ3A 5G4HC 4W7VA 3N6HA 1OC7A 2DSKA 2XWEA 2P5NA 2VEKA 2G3NA 5HR7A 1A80A 1XLGA 1R47A 1W1YA 4ERAA 2A21A 2BLEA 3BLIA 3BUVA 4C65A 3SCPA 3ITYA 2XDFA 3NQDA 1NAL1 3MW7A 2Z2AA 3ZR4A 1VFMA 5AVHA 3LXBA 3A6OA 4O50A 3RM4A 4UTFA 1UWIA 3E2QA 4NF7A 4C5ZA 4YYCA 3WNKA 2Z00A 4P7LA 4RNHA 5DXYA 3ZJ7A 1PEZA 2W66A 1A5KC 3P3BA 1B31A 3P93A 4QBXA 4I9TA 1OCQA 4X61A 4JCMA 4PMDA 3SRDA 1R30A 1VGAA 5GJNA 3GNOA 4B5UA 4Y9PA 3SZ8A 1T41A 4NAEA 5BXTA 1YTEA 3UJSA 2QMKA 1KC7A 1O12A 3O6DA 3G1VA 4O0ZA 4UTKA 4OV4A 3AALA 1W0MA 2ZTKA 1W6TA 4A8RA 3U7VA 1IWAA 3GR4A 1VPQA 3C4UA 3WDJA 3T44A 3EDKA 1PIFA 2HTMA 5IHSA 1JFXA 4MWAD 3LHWA 3DFQA 1XXXA 3URNA 2DZSA 2OEMA 1I2PA 3PTDA 3W7PA 2YFNA 1BWLA 4K39A 1XUZA 4GXWA 2X30A 4UFJA 1EC8A 3R58A 2C1HA 1JVNA 1KCXA 5HMEA 1GONA 5IOBA 4IT1A 4QP0A 4W8LA 1UWAA 2AAAA 2WSYA 2WMJA 4GX9A 3IUIA 3HGSA 4DBDA 3QKEA 2AOSA 4ORIA 2DQXA 1P5BA 2Q71A 3NQAA 2A6NA 1L2UA 2HK1A 3C2VA 3GC4A 4JX6A 3AMCA 3MV11 4P5UA 4GY7A 4Q32A 4ZQRA 4DF2A 3N73A 1H51A 4NEVA 4ZO8A 3KRUA 4FO4A 2FHBA 2ZVRA 3C52A 1FWJC 2O56A 3QJAA 5DY3A 1ZKQA 3IAPA 1WE5A 3S1UA 5D33A 4C1NB 3HPXA 1EDTA 1FEAA 2VRQA 3H4XA 3M5ZA 1HL8A 5J5DA 1PWLA 3AIRA 1ZBKA 2WZTA 4Z2IA 2ISSA 2RGMA 1GVIA 2V3BA 3RCYA 4KGLA 1EB3A 2EG6A 3GM8A 4OV9A 5GQBA 1PWMA 3M0KA 4BV6A 1S2VA 1FDYA 1NWTA 3BLDA 3MDUA 3DK9A 1L0PA 4BA0A 3V35A 3TW9A 3KDOA 4GIYA 3GNPA 4ZSTA 1P0EA 2QNEA 1CLVA 1EYEA 2TYSA 1EJXC 1Z42A 3RR4A 2J6XA 3VE9A 1XYAA 2CITA 1CB2A 2QCGA 3CHDA 4LS2A 2GQWA 3KVKA 1ZJAA 3DUGA 3UG8A 3Q65A 5CXPA 5GVJA 3P8IA 3N04A 2XVGA 1OBAA 4IL2A 2VELA 3RHGA 4JDRA 3MO4A 3DU0A 3RPMA 3SN4A 1S1PA 5AHFA 2A2IA 4MNLA 4FXRA 1GRGA 2W3SA 5DMLA 4O4VA 2DH2A 2E9BA 2Y4SA 4O53A 3UA3A 4DJDA 2Q6ZA 4CU6A 3MVIA 3OC4A 3ITTA 4JEJA 1YPXA 3LCWA 3C2OA 3FJLA 2GSEA 4G9PA 4ZOEA 3VZXA 4AVNA 1UZHA 3H7UA 3E0IA 5U25A 4P2VA 1FDJA 4GUIA 4BY3A 4HZMA 3M5XA 1ELSA 3B8TA 3V5OA 2IKGA 4CNUA 3EYPA 3CIVA 3KBMA 5I3HA 2W6RA 3CPRA 4X22A 3U57A 4WCJA 2X8CA 1US0A 4OQVA 5CLTA 1HX0A 3OGSA 1DV7A 2BOFX 4J1OA 3SN1A 3PAOA 3P6LA 2D0HA 1S5NA 1XSIA 4KEUA 3EKGA 1FWEC 3SR7A 4Q8UA 2ZE3A 4HSNA 3H2FA 4WZHA 4WF7A 3VOIA 3M0IA 4LOCA 1V08A 2Y6ZA 1GKPA 3L4UA 4O1FA 3WD2A 3EA3A 3G8RA 4KCWA 3HMJG 2ABAA 4EOUA 3U7BA 1UD3A 4GNJA 1YDYA 4F3HA 4BURA 2VENA 5I00A 1GRTA 2JALA 4J3TA 4S3DA 5MHBA 2BS9A 3FOKA 2XM2A 1BVWA 3UP8A 3BQ6A 4GY1A 2BSLA 1ZY8A 2GJXB 1OSEA 5D38A 2XFRA 5G4EA 3II4A 8XIAA 1IXNA 4M6PA 3LNMA 3H53A 3VABA 4WKFA 3NL2A 1SSDA 3EUB3 4C6NA 2EG7A 5REQB 2GUBA 4EQWA 4UQ9A 4GKLA 3HJZA 3KRBA 2H8XA 4XTDA 2W5FA 2GQ9A 2P76A 2DT3A 4PC8A 1K4QA 3LV5A 3QLDA 4Q4SA 1TA3B 2VQUA 5FESA 1IEVA 2HQMA 2GWGA 4YPJA 3CNYA 3NPVA 3W1AA 3ARXA 2RFGA 4E4FA 1S5MA 2G4FA 2H9AB 1Z48A 3O6CA 5AHLA 4YYFA 3VIIA 3CZJA 4ZO7A 4HPHA 3RR1A 1I1WA 5C71A 1PO9A 4Q8NA 1Q2SA 3A3WA 3BAYA 4JQ9A 3QGVA 4IOTA 5FA5A 2WHMA 4H4SA 2DSWA 1GVOA 2WSRA 4TQTA 1OY0A 4QGCA 2VX6A 4QS6A 3QY7A 2VZOA 1SFTA 1X6LA 1Q7ZA 3JZUA 4HKPA 5LNSA 3F5KA 4A3QA 4BQ4A 4IMAA 1UMYA 4RUBA 2J4GA 3CL8A 4AD3A 3TXZA 1GVFA 3GVWA 1EX1A 2WW5A 2YLAA 1FTXA 1JAKA 3SR6B 2PWFA 3SRKA 1ISXA 2I5IA 3F7JA 3EB3A 3EMZA 2VOMA 1JI1A 2P3ZA 1OFRA 3BV7A 4UZUA 3UWYA 2XM1A 1T0OA 4IJBA 4JAWA 3ZJ6A 2E5DA 1IZKA 3HN3A 3E3HA 1KR0A 2P0IA 3ARSA 4D8ZA 4FXJA 3E2SA 3CO8A 3GRTA 3QV8A 4ENLA 1ONEA 3LCGA 4KWSA 5HULA 3OGRA 3THDA 3GBDA 3ISIX 2IQTA 3FXGA 4ZENA 2GLKA 2QAPA 1PDYA 3FY1A 4K1WA 5CG0A 3ITLA 4J3WA 1C9WA 1ICPA 2W4XA 1N60C 1H3GA 1SU5A 2C15A 1DPMA