1KKOA

Crystal structure of citrobacter amalonaticus methylaspartate ammonia lyase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
411
structure length
411
Chain Sequence
MKIKQALFTAGYSSFYFDDQQAIKNGAGHDGFIYTGDPVTPGFTSVRQAGECVSVQLILENGAVAVGDCAAVQYSGAGGRDPLFLAEHFIPFLNDHIKPLLEGRDVDAFLPNARFFDKLRIDGNLLHTAVRYGLSQALLDATALASGRLKTEVVCDEWQLPCVPEAIPLFGQSGDDRYIAVDKMILKGVDVLPHALINNVEEKLGFKGEKLREYVRWLSDRILSLRSSPRYHPTLHIDVYGTIGLIFDMDPVRCAEYIASLEKEAQGLPLYIEGPVDAGNKPDQIRMLTAITKELTRLGSGVKIVADEWCNTYQDIVDFTDAGSCHMVQIKTPDLGGIHNIVDAVLYCNKHGMEAYQGGTCNETEISARTCVHVALAARPMRMLIKPGMGFDEGLNIVFNEMNRTIALLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into enzyme evolution revealed by the structure of methylaspartate ammonia lyase.
pubmed doi rcsb
source organism Citrobacter amalonaticus
molecule tags Lyase
molecule keywords 3-METHYLASPARTATE AMMONIA-LYASE
total genus 154
structure length 411
sequence length 411
chains with identical sequence B
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2001-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
A PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1kkoA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1kkoA01
3IJLA 4G7FA 4H19A 3DIPA 1IYXA 3H8AA 3OTRA 3D46A 3VA8A 1P48A 1MUCA 2GL5A 3I4KA 3BSMA 3GO2A 3CB3A 3R25A 3DGBA 5FJPA 3U9IA 4H1ZA 1BKHA 1ONEA 4DXKA 2ZC8A 3QKEA 4J3ZA 3R0KA 1PDZA 4ENLA 2PU0A 3SQSA 3FCPA 1FHVA 3TWBA 3T4WA 1KCZA 3ZLHA 4MGGA 3Q4DA 2PTZA 3K1GA 3V3WA 4GMEA 3DESA 3GD6A 3SN0A 4HN8A 2OVLA 3SSZA 1RVKA 5FJOA 3KUMA 3MZNA 3OZYA 5FJTA 4DHGA 2AL2B 2OFJA 2ZADA 6ENLA 2OG9A 2OZTA 5ENLA 2QJMA 1MRAA 4KEMA 3UXKA 2GGGA 3S5SA 1SJAA 3EKGA 3P93A 2PMQA 3TOYA 3TJIA 3R11A 1EC8A 2POZA 2NQLA 4DN1A 3EEZA 3OP2A 3THUA 3UJSA 4A3RA 4HPNA 3B97A 4F4RA 3N6HA 3VCNA 4M6UA 2GGHA 4E6MA 1XS2A 4HCDA 4J1OA 2P88A 1TKKA 4MKSA 2OQHA 1OEPA 3I6EA 2AL2A 1WUEA 4DYEA 1P43A 4E5TA 3PWGA 3H7VA 3OZMA 3HPFA 3DDMA 1JPDX 1YEYA 3R1ZA 3FYYA 3FV9A 3DG6A 2GGEA 3P3BA 3MWCA 4ROPA 3CT2A 4HYRA 1KD0A 4KPLA 3T6CA 4G8TA 2O56A 3RCYA 4H2HA 5BOEA 2PPGA 4DWDA 3DG3A 3BJSA 3QTPA 2OPJA 3ZVHA 3RGTA 3T9PA 4MMWA 5EU9A 1EBHA 2GGJA 3CXOA 4GGBA 3DFHA 4K1WA 1PDYA 4GGHA 4E8GA 1EC9A 2P8BA 4K8GA 3P0WA 1F9CA 3GC2A 3N6JA 2XSXA 3SN4A 3IK4A 2XH2A 2HXUA 1JDFA 3I6TA 3RITA 4IL0A 4DX3A 4M0XA 3N4EA 3PFRA 3RRAA 4E4UA 3TW9A 3UJRA 4YWSA 3VCCA 2CHRA 4HCHA 2QDEA 4IT1A 3V5CA 1XPYA 2PU1A 3CK5A 3ES8A 3FJ4A 2XGZA 2OKTA 3DG7A 3QN3A 1NU5A 3IJQA 4GIRA 3H12A 3UXLA 3U4FA 3TTEA 1JPMA 4IL2A 4HNLA 5J04A 3SBFA 1NELA 2P0IA 3PWIA 4E4FA 1ECQA 4Z17A 2XH7A 3RO6A 3GY1A 1BQGA 2FYMA 1E9IA 3SN1A 2PGEA 4A6GA 4IP5A 2HZGA 1KKRA 3ZVIA 3MKCA 1KKOA 3ZLFA 2MUCA 3OPSA 4K2SA 3OW1A 3Q45A 3ZLGA 3MUCA 4JN7A 3VC6A 5IDZA 3NZGA 1JCTA 3MY9A 4FI4A 1MNSA 3NXLA 1ELSA 1TZZA 2OQYA 2QJNA 3FXGA 4GFIA 3DFYA 4ZCWA 2I5QA 4GYPA 4IZGA 2HXTA 2ONEA 3H70A 3ES7A 3VC5A 4HNCA 3STPA 3TJ4A 3R10A 3UCCA 3SJNA 2PTYA 3MSYA 5BOFA 1L8PA 4IHCA 1W6TA 2PA6A 2RDXA 2GGIA 4GYPC 2OO6A 7ENLA 3QPEA 1MDRA 4H83A 2XH4A 4A35A 3TCSA 2PP3A 4JHMA 3NO1A 1R0MA 2MNRA 4FP1A 2AKZA 3DEQA 4IP4A 3JVAA 4KWSA 5FJRA 3V5FA 4HCLA 4X2PA 4GISA 3JW7A 3UJ2A 3UJFA 2OZ3A 4ZA0A 2OLAA 2DW6A 3DERA 3IJIA 1SJCA 3CAWA 3R0UA 2PTXA 1FHUA 1SJBA 2QDDA 3QLDA 1EBGA 4JN8A 2QJJA 2AL1A 2QQ6A 3T8QA 3UGVA 3MQTA 2QVHA 2HNEA 2FKPA 3JZUA 1R6WA 1SJDA 2OX4A 3FVDA 3TWAA 2PGWA 3ENLA 2PP1A 2PSNA 3BOXA 3TQPA 2DW7A 2GDQA 3V4BA 2XH0A 3N4FA 2P8CA 2PTWA 3UJEA 2GSHA 3VFCA 3VDGA 2P3ZA 4EWJA 1TE6A 3ZVHB 3CYJA 1EC7A 1MDLA 3D47A 1DTNA 5FJUA 4KT2A 3NFUA 2AKMA 2PODA 3UCDA 2OZ8A 2QGYA 3PK7A 3S47A 2PP0A 1WUFA 2PCEA 3RR1A 2PS2A 4Z1YA
chains in the Genus database with same CATH superfamily
3VNMA 4PUWA 3NURA 3OBAA 2ZDSA 4AXNA 3AYRA 5CBJA 4OV4A 4ACZA 4PB4A 5BU6A 4MYAA 4LANA 3ISIX 3RR4A 3GLCA 4MPQA 2F6UA 1H63A 1G4PA 4PMQA 5A95A 2CHNA 3GDBA 1AUSL 2FHBA 3S5YA 5U4NA 2ANUA 1THFD 3OVGA 4W7UA 2CBJA 4MGGA 4Q8VA 5F2GA 4X0VA 5TIMA 3W87A 2IPGA 3E5PA 4H8NA 2W9MA 3H4GA 5FF7A 3TX9A 1XYFA 2ZX7A 3OQ8A 1LDCA 1ZL1A 2GQ3A 2WJZA 1QK0A 2H90A 1FVPA 4QITA 1S1PA 1PCKA 2ALRA 1E1CA 3KUMA 1UR1A 4S3DA 4B90A 4BJHA 4KIEA 4UMAA 3EOEA 2QJMA 4TVUA 2ISSA 4ZQNA 3EKGA 3OA3A 3A12A 3NZRA 4DJEC 5LXEA 4MVAA 1W37A 3GD3A 3BE7A 1DJHA 4FB7A 3D3FA 4JTDA 6REQB 3KOXA 3UQNA 1P5BA 1T40A 4DXXA 1O12A 1KQZA 4AMAA 1TA3A 1TZ9A 2BVYA 3QRHA 3CM4A 3DX5A 1Q1RA 2GGHA 2HPIA 4J4KA 3DYOA 1JD9A 4GX8A 1B9BA 3K2GA 3BANA 4J3UA 5E93A 3S4TA 1KR1A 4J40A 1MQQA 1GPWA 3PZGA 1TQXA 3GNOA 3QR0A 1XDMA 2NVDA 4TTUA 2B31A 3DG6A 1AQ0A 1HF6A 4A21A 4HYRA 4FLRA 1CYGA 5C2XA 3T6CA 3AMGA 4LIIA 5AYXA 4MNJA 1UIOA 3TW7A 2VGBA 3RPTA 1AH4A 4D2JA 3T0TA 3QTPA 2WMKA 4XD5A 1W9BM 1DL3A 2VTFA 3W6MA 1Y7VA 4GVIA 1FH9A 5JBDA 3B04A 1Q6GA 3W7MA 1BPLB 2P8BA 1HL9A 4WLCA 1IQ8A 5EMYA 4PTNA 3LV5A 3TSBA 1WZAA 2W55A 4D6GA 5DT5A 1MW0A 3QH2A 4KEUA 2E09A 3FG2P 1FXPA 1VFOA 5GJPA 4AHQA 1N63C 3JR2A 2V6OA 3SO7A 3TW9A 2E6YA 1JCYA 2WMHA 2R8WA 2EQ7A 4V15A 4FNRA 2L5HA 2OGJA 1TV7A 3LZ3A 4L9YA 3S3GA 2J4GA 4D6EA 1CTNA 4OTKA 3N14A 5HOSA 3VOGA 1TJRA 4FF7A 2Z7KA 2V69A 1S7MA 3G77A 4IL2A 4W7WA 5CC5A 2X1SA 4GIAA 1LRTA 2VO5A 5CCZA 4RV3A 2Z25A 1QRQA 1P6BA 4IXXA 3NIYA 2FYMA 3H4KA 1QW9A 4LSBA 3AYSA 1DXFA 3GFXA 3LB8A 4H9XA 1W31A 3ITGA 2O9RA 2YAUA 3P7YA 4DI8A 1DP0A 4NJIA 1ZAHA 4XO7A 2A0NA 3E0WA 4WR3A 3HV9A 4PMNA 5EA9A 4D8ZA 5MHBA 3O6CA 1ISYA 3V5OA 3HMCA 2ZA1A 3MV01 3OIXA 2WOIA 4JBRA 1QHOA 3CQKA 1V6UA 1E6PA 4RKAA 1GCYA 4ADSA 1A5UA 4Q7NA 3KRUA 4BCEA 5EMKA 1FIQB 5HINA 3BW2A 3W07A 3ERPA 3CV7A 4XD3A 4AY1A 3RLHA 4UTWC 1WKDA 4LUTA 2XFRA 3LDVA 4HIBA 4GR1A 1I45A 5HPOA 2TSYA 4CQ8A 4EE9A 3FGCA 1W9VA 3RNDA 1VFTA 3AIQA 5BW6A 2FQIA 1WKYA 2PDYA 3RK8A 1EBDA 1KTNA 4AEOA 4WUIA 2OEMA 3LTYA 1BEUA 2WJFA 1HKKA 3PUOA 4MNLA 4JN6A 2ZWYA 4O18A 4KWSA 5FJRA 3S1VA 3ZT5A 4M7SA 1EXPA 3BW3A 3EB3A 3M0LA 2QCFA 1AQHA 3V75A 1S39A 2CXEA 4ZA0A 5DLCA 5K3VA 4PUEA 3VNZA 4DB7A 4JIRA 4RV8A 1LCOA 1XLCA 4AX6A 1XLIA 2VFEA 2GUYA 3CZEA 4O0ZA 3SADA 1GYNA 4MNKA 4RDZA 4ZOBA 5FIPA 4XO6A 1WE5A 2QJJA 3QSRA 2QQ6A 2H8XA 5KVHA 1CECA 1J0YA 1SSGA 1ME7A 5H8UA 1OCJA 4LAZA 4JYFA 2F6XA 3BAJA 1SJDA 3WLOA 4DQWA 5CJ5A 3OVRA 1KRAC 2WPBA 1X39A 1B90A 4G5DA 3R8RA 1MW2A 3KLKA 3BLEA 4JHOA 4JKKA 1O5RA 2W54A 3L5AA 4O1DA 4TXEA 3PBUA 1TJ0A 2QAFA 3B05A 1CXIA 2DT2A 1C92A 3LTSA 1NIUA 3W7DA 2WOWA 1NWUA 4L56A 2Z7GA 2WC3A 5HBFA 3LLXA 4GACA 5LYRA 1S1RA 1VBJA 1YX1A 2ABAA 3DHDA 4V1YA 5FJUA 3TN5A 1EDGA 1VJZA 3S47A 4AYGA 3BMWA 2XN1A 4XD4A 4WXYA 3RR1A 3LXCA 3MZ2A 4AAJA 3G1RA 1RALA 3CQ0A 3C6CA 1FFRA 3I68A 3O05A 3GK0A 1TUXA 3LHZA 1RQHA 5D38A 2VX7A 4JHZA 3CUFA 3IJ6A 3WDPP 2CU0A 1C8YA 1HNYA 3BLDA 3EPOA 3WZ0E 7A3HA 3TYCA 3AJ7A 4PBEA 2CZ5A 2OR2A 2DV0A 1ODZA 3MP3A 2ZXBA 3IAPA 2WQDA 3WNMA 4DJFC 1SB3B 1BGAA 1QCWA 2IQDA 1O1HA 1J6OA 3KWSA 1TPH1 1YKWA 2YDQA 3SCNA 3N9RA 5FI8A 2VEKA 1Y0EA 3MYOA 2VQTA 4KEVA 3S2JA 1W8SA 4JTLA 3SCQA 3TV8A 4B4HA 1FH8A 5BXRA 1XCWA 1DIDA 1ZBCA 3GDLA 5F2MA 4KCTA 5C70A 1JRPA 4MPKA 4FIRA 1W5PA 3L4TA 4LB4A 1XBYA 2VUNA 4OHQA 3T2OA 2J6VA 4O19A 1MRAA 4UZSA 2BGNE 4IIHA 2G37A 1ZZMA 4MADA 2YFOA 4UFHA 3S5SA 4GZ7A 1OT2A 1JQVA 2PLMA 4BY3A 1N8FA 2A7NA 4YYCA 1GGOA 1I1XA 3VFLA 3NZQA 1LORA 3G24A 1GRAA 2ACQA 4XAYA 1S46A 5CPNA 3AWOA 3QC0A 4GCXA 1FCBA 1D9EA 3LB0A 3EWBX 1H7XA 4I5UA 1IEWA 3CTLA 3OGVA 4H9VA 4M6UA 1V6TA 1XS2A 2A8XA 2WO5A 2ISDA 2JFEX 6TIMA 4TX6A 1LBFA 3ITOA 1LWIA 3NVDA 4LB3A 3W84A 1M7PA 1EHAA 4GUGA 4FXJA 5FL0A 4HMDA 4U4MA 3VIIA 1IEQA 4FLQA 2FH6A 1KD0A 1ZJHA 1OABA 3KLJA 2EF9A 3A5FA 3WJYA 4PUUA 3IVSA 3B8SA 3GYCA 4IGNA 2RH9A 4BF7A 1X7FA 1W3HA 3AZRA 4ZB0A 3GSMA 4XIAA 4OV9A 1XRSA 3DFPA 4QSHA 5C9WA 3FEMA 5TAOA 1SZNA 1UWUA 1B3WA 1F9CA 3UWUA 4INFA 2WZTA 5AC4A 4WKFA 1SW7A 3IJDA 1YDVA 5AHEA 2NV9A 5G5IA 3RITA 3LZ5A 3N4EA 1WAWA 3TXZA 4JFWA 2CHRA 1Q6LA 4A2SA 2WHKA 4R7JA 1RXOB 3KTXA 3FFSA 4Z2IA 1E40A 1UKPA 2QF8A 1S5NA 1PX3A 3N13A 4IJBA 1GVQA 4L1GA 3FJ4A 5BCAA 3DK4A 2J7EA 2OKTA 4LTSA 1UOZA 1TPC1 2VEPA 4PEKA 1K9DA 5JCIA 3PC0A 2TPSA 3ITLA 4A3QA 4WJXA 1TWSA 2C3ZA 5D32A 3WEMA 1PJ9A 1EPVA 1P7TB 4DWSB 3BAKA 4H4XA 1OIFA 3LBMA 1SSDA 4J57A 4LF2A 3GY1A 3M41A 4L7ZA 3LUTA 3PAOA 4F0SA 3ZVIA 1VQTA 4QE1A 5CG0A 4BQ3A 1LQAA 4UFLA 5F4XA 1JEZA 4K2SA 4HYVA 4A8RA 1WB0A 2BY0A 3COTA 1JCTA 4FNTA 1CEOA 1BF6A 3D5HA 2V2CA 2YFNA 4I8YA 4Q3MA 2LLEA 3U8GA 1MNSA 1H2JA 3CUJA 3LN3A 1O1ZA 4RW3A 1JIBA 2BGQA 5GNXA 3WMBA 3KVJA 1W3JA 1IE7C 3AZSA 2R1KA 4WY0A 5AHNA 2OYLA 3SRFA 4U3CA 1R3SA 2D0HA 3HPSA 1MUWA 1SO3A 3UPMA 1KBKA 5JIPA 1M65A 3UERA 1B2YA 1L8PA 4ZQOA 1REQA 2YYUA 1W6TA 1HVXA 2OOGA 1I6NA 4R53A 1ZENA 3E6EA 3NQ6A 2ZVIA 3XINA 4ORIA 1KRBC 1FWAC 4ECLA 1WZLA 3R6IA 4Y6GA 4UR9A 4JQ1A 1GUVA 3DK8A 3L5MA 1A5MC 3WD2A 2OT0A 1D7YA 3PG6A 1KFBA 4PE8A 4PTDA 1NDAA 4EM4A 1R85A 4TVYA 3FIGA 3CV1A 5L9FA 4NT0A 4GISA 1W3IA 2Q71A 1BTMA 4YVVA 5H8MA 3U57A 1TTIA 4GJJA 1VPYA 1X96A 2HK1A 4ACZB 1OX4A 1VLIA 2YDSA 3WL1A 4TMBA 4N9BA 3OVQA 1OFQA 4UTJA 4DJDA 5AY7A 4KESA 1TUFA 2YXGA 2DZVA 2RHGA 3B9AA 4WOZA 3S1XA 1NARA 4JEQA 4GVGA 4JTAA 3RU6A 1A47A 1AZ1A 2J6XA 3PY2A 2Z1WA 3T0AA 2E6AA 2E5CA 1E6SM 4I7VA 2GR2A 1X6NA 4HZMA 5DX7A 6A3HA 1ZY8A 3HIJA 3POHA 3JZEA 3OJGA 4JD4A 2ZVRA 4N2YA 4BI6A 3G8RA 2XM1A 5FAGA 5EGRA 2IMRA 2O9TA 3BH4A 1TV4A 4LVBA 2P3ZA 2DP3A 3GXTA 3I4EA 4G1KA 3QMRA 4AZCA 3MUIA 1N60C 5KSWA 2DSVA 1NWRA 4RE0A 4LAOA 2PGRA 1QR7A 3GTNA 2DSWA 1V02A 2HRWA 3VOJA 2VWSA 2EKCA 2V5JA 4H9ZA 3EF6A 4AIBA 2YSWA 2F2HA 2FMOA 3NVTA 3UR8A 1HJVA 1DIEA 4NNAA 2TMDA 5JCLA 1T8QA 3R25A 2G8ZA 3ARRA 3H23A 1LLZA 1C8VA 2VFFA 2Y24A 4JOMA 2ZX8A 3WQ4A 2GQ9A 1PVNA 1IEXA 3WN6A 2X42A 3NDZA 1O60A 3AMDA 2O4QA 3ABRA 2V82A 1HVQA 2BWGA 3QV9A 2NWRA 4CNTA 3K1GA 2CXGA 2EG7A 1IT7A 2ZDRA 4S39A 5FF4A 3VI2A 4ERGA 1UASA 3BV4A 4F9JA 3AIBA 4B3LA 5D02A 4JQAA 2VZSA 4ZQMA 1UR2A 3P84A 1EDQA 1UIPA 3HTWA 2D20A 4KPRA 2BP1A 3T2QA 3HFTA 4N9EA 1V3IA 3A7RA 5KINA 4XTIA 4L9ZA 3T09A 4HP5A 4KWOA 2CHOA 4AZCB 4L64A 1LM1A 1KR0A 3M46A 5A2BA 1DJWA 4GXWA 1HP5A 4GY7A 4PL2A 1CZ1A 4D6FA 3NL5A 5FMHA 5DFAA 3G3DA 3B06A 3NUKA 3BDKA 4RZ4A 4UZUA 1RM6B 1TJPA 3IGSA 1E9YB 4PRTA 1IZCA 3ATZA 4H2CA 3R89A 3SQLA 5C2CA 5A6AA 1X2GA 3GNRA 4YXGA 1FFVC 3THCA 2E6FA 4AZ5A 1U2YA 2VXNA 4RZ6A 1WUEA 3ELFA 1AH3A 1PXGA 4O54A 4ADTA 2QULA 5TR3A 4H4UA 4H9UA 1NQKA 1VQZA 4UOQA 1DJZA 1S5TA 4C6NA 1A3HA 4YTUA 3BUVA 3VIFA 2PDQA 2Y61A 5HATA 4LAKA 2WWCA 3ABXA 1BFNA 1TPWA 1W1VA 3TJXA 3ZVHA 4HBKA 2PDXA 3PAJA 4CVWA 2R94A 4HYWA 3KZPA 4GH3A 3ZR5A 4LX4A 4MJ2A 2GGJA 5I3DA 2WZMA 3DFHA 1ZJBA 3BL3A 4WDXA 2CIPA 1GQIA 3G2GA 3TN3A 4DRSA 1QXLA 4UBPC 3M5VA 3IGUA 1RJQA 3WL0A 3B03A 1DJXA 3UZYA 1EYWA 2ZA3A 4ZB2A 1XXXA 1O5KA 4OT7A 2VELA 3BK0A 4C6PA 3SSJA 3RX4A 3VOIA 3F5JA 4BFAA 3CGTA 4G1NA 1NU5A 4BR1A 3H12A 4RE2A 3EX1A 5B80A 1YPFA 4ZBCA 4XB3A 3SRHA 5E70A 1E0UA 1XLKA 2CLEA 2VC7A 4QG8A 4JKMA 2RUSA 2NT0A 1BXNA 1ZMDA 2FZMA 1M7XA 3EWZA 2BS9A 1E71M 5KZDA 3L4YA 2XH7A 3RO6A 3F2CA 3C4UA 1SZEA 7TIMA 1YXDA 1FWHC 2XM2A 3ZLFA 2O7QA 3HGRA 3S5OA 4JXCA 3AROA 1IHIA 1KM3A 1IXQA 3CUZA 4GQRA 1WA3A 1H09A 3KVMA 5HMSA 3CASA 4GYKA 4L9XA 1J12A 5A8NA 2WSPA 3AXHA 1PL9A 1OQFA 4UOJA 1UKTA 1V8EA 1KFLA 5G2WA 4G9PA 1F74A 1N62C 4MWAC 4S3EA 1B3XA 3RDKA 2VNCA 1NWTA 3ZSTA 3C56A 3STPA 2PDLA 3F1QA 3POCA 5H8PA 2PLCA 3NGFA 4RW5A 1UUMA 3ZMRA 5BOFA 3EB4A 4CVUA 1UH4A 3EDEA 1PIIA 3GDMA 4DO4A 3LI0A 1TTJA 5D8WA 4AZBA 1N82A 1S2AA 3L12A 3N12A 3BG3A 1TV3A 3AS2A 1OK6A 3WDQA 3NQ8A 4QG9A 2V3DA 3OBKA 1JCJA 3UA4A 2FHCA 3ZJ7A 2KZHA 4H41A 1XANA 5C9UA 5DT7A 4X2PA 1EF3A 4ORMA 1U33A 4H9YA 2X0HA 4EPDC 2JALA 2FFIA 4PCNA 4X9SA 4RDVA 3OYZA 3W1NA 3CQJA 1TA3B 4LS0A 3GRSA 3Q67A 1RQEA 4LBRA 5B7YA 2CERA 2QXWA 3ZYZA 2P10A 1SJBA 3A13A 2WQPA 3QPYA 1C3FA 3UGVA 3WK3A 2BNJA 3N73A 1OGBA 4P7NA 3EDJA 1RCOB 3OB8A 3C52A 1BG9A 1VZWA 1Z7AA 4AHPA 1MO9A 3WQVA 1G4EA 1FFUC 3VGBA 1T8XA 1BWLA 1E0WA 3WMLA 3C3NA 3EX6A 1LUCA 1T41A 5EBKA 1K6AA 1HJWA 1QBBA 2JK2A 4JTTA 4JIHA 4Q4OA 2FZBA 1VEOA 1BD0A 3G1FA 3SJ3A 4A2RA 6CGTA 3CEPA 1XKJA 4NU7A 3PZMA 4Y2WA 5JMUA 1OFPA 1XGZA 3WUEA 4DNAA 2PURA 5EMJA 4LT9A 4EPEC 4WVXA 2PP0A 5BYWA 4DJDD 1JDCA 4UNIA 2CLLA 1FBAA 4E0CA 2HPMA 1M6JA 5K9XA 3CO4A 3W82A 4H4PA 5H91A 3O07A 3O0FA 3H8AA 2E9MA 4U2YA 1P48A 3FNDA 2ZRUA 3P6LA 1WXJA 4W87A 5GVJA 4AC7C 4DPQA 4PMYA 5ABTA 4MDOA 3RHGA 5C8BB 3NZPA 1RP9A 4UTLA 1KFEA 3MV11 4OU1A 1L6WA 2XISA 3FJ6A 2GVGA 2VP8A 5E0CA 4YLWA 3QEZA 4NZ1A 4RPPA 2INEA 3W1MA 3B9JB 2XTKA 4PUMA 3LMYA 2FZ8A 2E6DA 1YBQB 1K4QA 4M29A 3KX6A 3P60A 4WDTA 1GOIA 1UZDA 2FDSA 2VRKA 1QK2A 2JF7A 4LA1A 3G0UA 1RBOB 1LLOA 4R9XA 5FJOA 2YZRA 3IVTA 4ATLA 3NPVA 4HTYA 2NQ9A 4U5IA 3DGZA 2QKFA 1YNYA 3HFYA 2AMGA 1C8QA 1IGSA 3SY5A 2V5LA 4MLRA 1UWRA 1T5AA 4QIUA 1TQJA 2D3NA 1NTHA 2D23A 3TR9A 1H6VA 3DXIA 3CGBA 4ZENA 1ZBVA 5FS7A 2OO0A 4RLIA 1OB0A 3EDDA 3EEZA 3VIMA 1CW2A 1NSJA 2E68A 1OX4B 2C0HA 3UJSA 4E2BA 2VQUA 1F3EA 3S2MA 2Z6JA 4Y8FA 1ZP4A 1WNOA 4KRUA 2X05A 1GREA 3EXSA 1S3TC 4NZCA 4GXMA 1OIMA 2QW5A 1YDYA 4O15A 5DN1A 1PIGA 4K39A 1XD0A 1B3VA 2J78A 1CXKA 1ME8A 3DDMA 1BG4A 1H7RA 1XLJA 4XQ6A 3KBSA 1LROA 2XWEA 3HGOA 5D4YA 3T1GA 4KPLA 3C2RA 4G8TA 2O56A 3KL5A 3BICA 4LVAA 2PWVA 2CEQA 3G1DA 2V30A 3GDRA 5E6ZA 3M47A 4QJ4B 2EXOA 4K7VA 2ZBTA 4DJED 2OLSA 5CJMA 4KRTA 2GK1B 1G7UA 4TV5A 4LVGA 3M0VA 4UQAA 5AHLA 2RABA 2P3EA 1K8CA 2RJGA 3BURA 2ZZ7A 3T05A 4IICA 5DRCA 4GIYA 3F4DA 2EPHA 6PTDA 3UG8A 1KBBA 3T0DA 4L4PA 3NEHA 1C93A 1E4LA 3WX7A 1W2PA 3EWXA 2J66A 3BSGA 3HOJA 3M0JA 3Q65A 3T8LA 4LYPA 3UWVA 5GQBA 3C8NA 2YZ5A 3UWZA 3VTRA 4I8DA 2RDUA 1J0IA 4NJJA 4DIAA 1EJXC 1MO0A 4K8DA 2OWXA 3U4FA 3E2RA 2RJHA 4FLSA 1FO4A 1NELA 5EMUA 4RE4A 1GHSA 1WOBA 9XIAA 4E4FA 4I7UA 2XINA 1OGSA 1JZ8A 3ABOA 1UJPA 1Q6EA 2WPCA 1KKRA 2XVPA 3ZXWA 2J24A 2YGYA 2EJ1A 2QAPA 3VMNA 5G5GB 5DY2A 2NW0A 3QHMA 3V1HA 1KXTA 2WPEA 3ZLGA 1FWWA 4JN7A 1GVYA 2Z29A 2XN2A 4ZE5A 4IIEA 2IQTA 4Q4SA 2DVXA 1UD8A 3MA8A 4ASTA 1VR6A 1HO4A 3CV6A 5ABEA 4Q22A 1AJ0A 3VVGA 3A21A 1P0KA 3P5ZA 3ES7A 3I6RA 3ECQA 4MNMA 1FH7A 3S1WA 2UV8G 4K36A 1Q13A 3CT7A 4WKHA 1W56A 4LU0A 2E3TA 2WVVB 5LHFA 5I3JA 1XCXA 4UNLA 3DFNA 3GAYA 3MSDA 3Q58A 2CC0A 3PF3A 1LQ2A 3VGGA 2OO6A 2VENA 5AYYA 2XH4A 2GUBA 3DGRA 4NQ1A 3QVQA 4JHMA 3AIWA 5PTDA 4P8XA 3PWAA 1J6PA 3M7SA 3UF9A 5CG7A 1HN1A 1N5WC 5ER0A 1XLGA 3E9AA 4M24A 1JYNA 3RM9A 4S3FA 3GBDA 4UTMA 4UC5A 2DH2A 1AQMA 1E6ZA 1E73M 3PUGA 3CZKA 4AC1X 3TQKA 3S42A 2DH3A 3W85A 1YXCA 3RMEA 4B9YA 1RR2A 2ISVA 4YN5A 4QDWA 2DVTA 2AL1A 3FA3A 3SB0A 1WO2A 1E0TA 4TO8A 3ZZ1A 2QVHA 1Q6OA 4AU0A 2J8GA 3QFWA 2ZTJA 3CU2A 3KAOA 3EOOA 1Q63A 1KRMA 3OEXA 1XPGA 4XAZA 3U2ZA 1KA9F 2PD5A 3TQPA 3SR7A 1EKOA 3TFCA 1P0NA 1FCVA 9XIMA 1DWIM 2P8CA 5M3WA 1PX4A 4JL1A 4WRHA 4DAFA 4BF9A 3BG9A 4EWJA 4LC8A 3CYJA 1JNEA 4YTQA 1JFXA 2JK6A 3EMQA 2UBPC 4Q8TA 5KITA 1DTNA 4FR1A 3WY1A 2ISWA 2A79A 1OCBA 2QGYA 2DUAA 3DKLA 1A3XA 2PS2A 1QNOA 4Z1YA 1POJA 2ZRWA 1M9HA 4JPGA 1FWBC 3HG3A 1CB7B 4Z2KA 4C6OA 3N2OA 3D46A 1FWDC 3VZXA 3GVVA 1ZJIA 2ODOA 3LERA 1TCMA 1PYFA 5CPSA 3R94A 3P2VA 4J3ZA 3KCJA 2HJPA 1BKSA 2ZRVA 4EVZA 3CUHA 1GOOA 5I09A 1F3XA 2VR4A 1JR1A 2FH8A 5G1TA 5D2TA 4PFMA 2EQ8A 1ICPA 1WYGA 3HU7A 2VOMA 2PTZA 3ALGA 3CL7A 4OBTA 2IKHA 3TC7A 1U30A 1P7TA 5TQLA 3PULA 4TQTA 3GH5A 2VZTA 1PWLA 3SSZA 1QO2A 3G8EA 3STCA 4LS1A 4AD2A 3WQPA 4C6DA 2AL2B 1TSIA 1LWJA 4AF0A 4WZHA 3K4WA 4J3VA 4LS2A 5U1OA 1F8WA 1DXEA 5REQB 5LNRA 3P67A 4IFOA 2B7NA 2YIHA 4X61A 2OSWA 4FLOA 3SFKA 2X0YA 4EKJA 3CMJA 2F2KA 1UWIA 1XIIA 2Y89A 3VXGA 9RUBA 1EJUC 1QPOA 4EQSA 3BPWA 1OG6A 1QOQA 4CN4A 3PPCA 4EAYA 3B97A 3VOCA 3WLRA 3SCVA 3MP4A 1JDAA 3LHYA 1NHPA 1W0MA 1HQTA 3BG5A 4IIBA 1UA3A 5E1QA 3RNMA 3PUDA 1JFHA 1J2WA 3W25A 6TAAA 3A22A 2OQHA 1ZFJA 4DYJA 1NJJA 4DYEA 1EWDA 2UY5A 5BROA 3PPGA 3C2VA 5HK4A 4MFDA 4HK6A 1WKEA 3FYYA 3LYEA 1Z6KA 2GGEA 3TE9A 1LUCB 3IIZA 5C6MA 2JKAA 4NVTA 4NHVA 4U3AA 3N18A 3WJXA 4X9YA 1MFVA 3GB6A 2WCSA 3AO0A 3RGTA 3UVIA 4W4QA 4H00A 3DKJA 4KF1A 2CWXA 3PJTA 4H4IA 5CBIA 3NO5A 2WMFA 1FP9A 4JCLA 4B92A 2V5DA 4GUJA 2HCVA 3ARTA 4GRSA 4FX7A 3QY8A 4EXAA 4DI9A 5T8GA 1FHLA 1CX9A 1ZS2A 2VDHA 2XH2A 2D73A 1M03A 2RDTA 3C3UA 4MY8A 1PEZA 4O4WA 1I2RA 4H8VA 4DX3A 4M0XA 4JIEA 4W8BA 2PFHA 1H51A 4FX6M 2A6NA 2WJEA 3RRAA 3SUWA 1E4NA 3CZLA 4CQAA 3K4AA 3B9EA 2GLKA 2NX3A 4IX0A 1XLAA 2D2JA 4AWEA 1YW1A 4BQ5A 3N2TA 1FCUA 3QW4B 1TX0A 1Z89A 3ES8A 1KTBA 3GVWA 1KQYA 3AC0A 3W2KA 4U28A 1VPXA 2W3SA 1ZP3A 4OOUA 3OLIA 5AYIA 3DG7A 3CEUA 2WKJA 1GVFA 2PDPA 4NNBA 1LVLA 2WNQA 2DSKA 4OGZA 3LRKA 3WD3A 2PWGA 3QGVA 1B31A 3LBCA 3NTYA 4DXVA 1W17A 1JZ4A 2PDKA 2X0SA 4JFUA 3EYPA 4Q8PA 3WD0A 3NYZA 2Y7FA 4C7FA 1XM3A 1XLEA 3ONCA 1EUNA 4MIMA 5AVNA 1DNCA 1ZSXA 1QW8A 1RD5A 3L5LA 3V7PA 4JCMA 3WLNA 1FY6A 1NDZA 2QUMA 3VIJA 3BCFA 4MKVA 4PUDA 2PAJA 3SUSA 1CGTA 3N3TA 1HT6A 2VDIA 3L21A 1QBAA 1W1TA 2CWNA 3W81A 4DBWA 1Q65A 3LM3A 5BXTA 2DIJA 2VX6A 2QCNA 3SFWA 3F2BA 3VDBA 3OGRA 1OF8A 2H6RA 1H49A 1EDTA 3VKAA 3RYSA 1BZLA 3ARPA 4C6BA 4BA0A 1KFJA 2WW5A 3ICJA 3GC5A 3IJ8A 4P7LA 3UYCA 4FDCB 3VC5A 3IRSA 4RZBA 4CN1A 4QDPA 1VIZA 4E38A 1Z48A 1P6WA 2NVCA 4PB3A 4QQUA 2ZFAA 3MS8A 2RDXA 3SI9A 3J7HA 4E8DA 2Y8UA 2QV4A 2FZ9A 3PTQA 3TTQA 7ENLA 3EXRA 4NI8A 1XIBA 3G6MA 5A6LA 2OKOA 2WP5A 5EL1A 2JEPA 1R3RA 3GUGA 2PDIA 2YJQA 2PRMA 4N42A 3W7NA 3LU2A 1A5KC 2VCBA 3HBLA 3FVMA 4UXDA 1FWSA 3AICA 4P7OA 2YW3A 3V5FA 1FHDA 3VD4A 1AVAA 1EJTC 1DOSA 2PB1A 1QHZA 1JULA 4PH6A 2XWDA 1BGGA 3UP8A 3OLDA 3IJIA 4R88A 1DEDA 2DZPA 2HBVA 5CH9A 2XN0A 1QI3A 1F61A 3NXFA 3DOPA 4BEQA 3GDKA 4AXKA 4AQLA 5JH2A 2WAGA 3HQOA 1VYPX 4KGJA 3W71A 2RGMA 1EGVA 4IQDA 3CPUA 4W8LA 2V2HA 1EHNA 2FKPA 2EKGA 1VBHA 2YL8A 3WF2A 3W1UA 4M56A 3LCFA 5MKGA 3MKVA 3PZQA 1FKXA 3W6YA 2Y5JA 4AZ7A 2FVLA 4Y9OA 4M82A 1KFWA 2PDBA 3ABZA 3I7SA 3NPUA 2PDMA 3MSGA 4RR4A 3PPHA 2WB5A 1P4CA 3OGSA 3DJGX 3VDGA 1JRBA 3PVFA 1U83A 3RG6A 3TYBA 1EC7A 5K2ZA 4HZ6A 3B9NA 4Q6JA 5HWMA 4N9CA 1OD8A 2CZVA 2PODA 2DSUA 2Q8XA 2Y4SA 4R27A 1WUFA 3UEQA 5LIKX 1NF0A 3KHJA 3S1UA 5AC6A 2EQ9A 1IR2A 3DENA 1YHTA 4JIQA 3BC9A 1JUEA 1WX0A 1KBJA 2C91A 1L0PA 1MW1A 5FESA 2F6KA 2XVKA 2PLJA 4ZOEA 3L4XA 4Q8NA 1BKHA 1PZ0A 1E56A 1DKWA 4XBKA 1GJWA 3W1QA 2CBIA 1G6CA 4O13A 1UZHA 4XG1A 3SQSA 4GFSA 1BQCA 4QTGA 3T4WA 3HG5A 3WFLA 4F9DA 2FZNA 4M19A 3VNDA 4AVNA 7ODCA 3TR2A 3V3WA 1B57A 4HK5A 2NUXA 4LBUA 2F84A 3AYVA 2E1DA 5ABFA 3CMFA 5E6YA 4FXSA 1JZ2A 2BV9A 2WXDM 1EF2A 5G1MA 1R3TA 4GQBA 3C8FA 5HANA 1HP4A 1RP8A 2ZADA 4HNUA 2XVGA 3S5NA 1EOKA 3GBEA 2V6AA 3NVWB 1YXYA 2CFYA 2GFTA 2V0TA 3TVAA 5JH1A 1J18A 4NXKA 5C55A 3TNBA 3LPGA 3OZPA 1EJSC 1K9FA 5H1WA 1XQLA 1D2KA 2ACRA 3H4XA 3LXAA 3GKFA 2PRHA 3W1LA 3AXKA 3W38A 4IQEA 1VFSA 5KZ6A 3W7EA 3PNZA 3V35A 1KTCA 3THAA 3NRZB 3OHIA 3WLTA 4GVHA 4KEZA 3CB8A 4HU8A 4DBEA 3UW6A 1V6XA 2G4JA 4LXFA 5HAOA 2XZ7A 3VNYA 3WH7A 2ZZ6A 2CLOA 3IV8A 2I1OA 1XSIA 1J0HA 4YL2A 3HPFA 3VIKA 5E0KA 4NJGA 1JPDX 3PTDA 3WNLA 4JL2A 1XLLA 2P1FA 4IMGA 3VCRA 3FV9A 1W3TA 3O63A 1Q8AA 4B3KA 1TV8A 3W00A 1DQUA 7XIMA 3KEHA 4JTCA 3UESA 2OSXA 1N8WA 1UR8A 3RCYA 3VPLA 3WIJA 2ZXAA 4YVXA 3Q94A 1TJ1A 4D9PA 4J7RA 2IKJA 4OUEA 1HKIA 1QATA 3VGDA 3UYIA 3OZOA 1JCMP 1UD3A 3CXOA 2XFWA 2X8RA 3CHFA 4KWUA 4BWLA 5G4WA 3P0WA 3BMXA 1J8VA 3W4RA 1JZ5A 2X16A 3SUTA 4NZJA 2ZUMA 4Z2HA 2Z27A 3WBXA 3LCLA 1WOAA 2QJIA 3QTGA 1NY1A 2CZFA 2QHAA 1VB9A 3W2UA 4GUIA 4R7WA 3VUPA 3F5LA 4EF9A 3I3EA 2BMBA 4HU3A 5AKQA 2X2YA 5KZMA 1JZ3A 3FY1A 4EQWA 1UD2A 2YA2A 1BVWA 2ZZ0A 3L5OA 3PSWA 4YNGA 1F8MA 1XPYA 2PU1A 4LEFA 4GKLA 4PULA 3QMSA 4Z2GA 3T08A 1KBLA 5BZAA 3BO9A 4M80A 3UXLA 4AZ6A 2I9UA 5I00A 3GC4A 4ZTYA 3E2SA 2J7BA 3TTEA 4S3AA 3ARXA 1MYRA 2OX1A 1ZBWA 2GR1A 1Q45A 2X1UA 4OBSA 4PR4A 3CHVA 1PX8A 4DNHA 3OODA 2F5ZA 3H21A 1KLYA 2DZSA 3B0UX 3MW7A 5CPQA 1S2VA 1ALDA 2G50A 4B2DA 1AW2A 1V4YA 4IP5A 3VM7A 3VINA 3OPSA 3JUGA 4MG4A 2YBVA 2OSYA 3BLPX 1ME9A 1C7SA 2YCLB 3SM0A 5BMXA 4CD7A 3DHPA 3SRDA 3GXFA 2JF6A 3NZGA 3O7UA 1B9ZA 3RX3A 4Q7BA 1XSKA 3MY9A 2DFAA 4DUWA 4MLJA 5GJMA 4L61A 3ANYA 4FNUA 3HQ1A 2ZUVA 2ACSA 1R5YA 3WD4A 4GYPA 2DJXA 4D6JA 4W5ZA 2PI6A 1GRGA 1EUAA 1N7KA 1V7YA 4C60A 5MKGB 5A2CA 2EG6A 2YCJA 3NQGA 2HE8A 5I6SA 2WV8A 3E2VA 2NT1A 1W9PA 1TYTA 1H60A 1VYSX 1H41A 3EWUA 3RLUA 3W86A 3W7IA 1EYEA 1H11A 3LLFA 1XLBA 1XYAA 3QGAC 3G1YA 5HMFA 1TO3A 3PZUA 3DEQA 4H6EA 4JTSA 1A5OC 3AAMA 1EH9A 4TX9A 1EX5A 4FNSA 2H9AB 3PZNA 1EX1A 3UJFA 2OZ3A 3WDRA 4FNQA 4HKPA 5IHRA 2HVOA 3UG3A 4D8LA 1VYRA 4H50A 2ATSA 4IXHA 4CCEA 1HZYA 1YE4A 4DYKA 2J62A 2WSKA 2HSAA 3MC5A 4LUJA 4FOKA 1A5CA 3MCNA 1V59A 2BLEA 1EBGA 4PMVA 1YMYA 2C71A 4O1BA 3QQ0A 1X97A 3ZJ6A 1R6WA 1CDGA 2WMIA 4LGXA 4G6CA 3GUWA 1XYMA 1H7PA 1LWHA 4AG0A 4AHOA 4O1FA 4AUBA 1GVSA 2BB0A 3QFAA 1U5JA 2Z1XA 2QEZA 2UY2A 3KTSA 5ABFB 4LBSA 1YRRA 4W85A 3VFCA 4ZQCA 3URAA 5F7UA 2PDGA 1TE6A 5HNUA 4QS6A 4GCAA 4XIMA 1OJTA 3E49A 1JAKA 1ZPTA 3IIPA 1OX6A 4YWOA 1BRLA 1QVBA 4DWSA 3KZSA 1G5AA 1KM1A 4CD4A 1GOWA 3N6QA 1SFJA 3BAIA 1A49A 1XIGA 1WCGA 3TP4A 3R5EA 2JGYA 1LOSA 2HQMA 4GNKB 5GJNA 3UG5A 4AH7A 4CU7A 1WAUA 1DV7A 3TK7A 3W2NA 3B40A 1ONEA 2GVJA 3MYPA 2XZ9A 1KXQA 1JZ6A 4H01A 3UZZA 3AM9A 2BXYA 4KH2A 1TMHA 1JEHA 1TFVA 3SCOA 1L6YA 4HMNA 3FSUA 2W61A 5IRPA 2OGYA 3BSHA 4PBGA 5IHSA 4UWMA 1M53A 4K1GA 1TYGA 4BI5A 1E9ZB 1PS9A 3QHOA 1Y65A 5E09A 4HPJA 1KFKA 3GD6A 3M5XA 1E3ZA 2YBUA 4H4RA 2P0OA 5DMYA 2PDCA 3W1PA 4CQCA 2YLAA 3OZYA 2IXUA 4AVOA 4ES4A 8TIMA 3A9BA 4KFOA 3M0KA 4C91A 5ENLA 3TROA 3TYAA 1GESA 2BBFA 3H6OA 1W5OA 5HMEA 3TQVA 1PKMA 4QLLA 1UPMB 1I8JA 1GT8A 2QIIA 3R11A 5CPLA 1NWSA 2ZC1A 3SCRA 3V0UA 2CKRA 3ZJ8A 3THUA 4B5NA 4HU0A 3N19B 3VM5A 1W9UA 4NILA 1W9DM 2C16A 5JCNA 2PE4A 4HZ7A 4O28A 2QUTA 3CV2A 3VE9A 1KFCA 4ZOHB 2TODA 3KCLA 4MDPA 3AHVA 2HVMA 1VCFA 1OFOA 1OEPA 4IQJA 1UZ1A 4KCVA 5EKYA 1HFBA 2BGSA 2Y5SA 3REQB 5AHFA 3FDGA 3PWGA 4ZVJA 4XKYA 1E70M 3IRDA 4W9TA 1DIKA 4C5ZA 3VNJA 2AAQA 4CNOA 3CT2A 3B8TA 4R5EA 3C0SA 4V27A 1K7FA 3PPFA 5CSUA 3EOLA 3W22A 4A8IA 2AAMA 3TW6A 2ON3A 1A5LC 3VAVA 2Z1BA 1EGMA 1PDYA 4GGHA 1S5MA 4N4PA 2JKEA 3OLGA 1E72M 2J9XA 1UC4A 4EWND 2ZZ1A 3MMDA 4KFNA 3TZNA 4HHHA 1E15A 3LNPA 5FEXA 3BCDA 2EEXA 4HK7A 1RK6A 2QNEA 4JTHA 2FDMA 4JZ5A 3GNXA 2FB3A 3WH5A 1CI1A 3EA1A 4OVXA 4JTFA 1TWIA 3NAVA 5K7JA 3QV6A 3PR2A 4J3WA 3UXIA 2R9ZA 3TQ0A 4JDBA 3CK5A 2RGLA 3APTA 3ITVA 4AZGA 3VGEA 2QUUA 3TONA 4YHGA 3QN3A 3K8KA 4R3UA 5KEZA 2G5WA 1JPHA 1V08A 3GVGA 4OQVA 3VIGA 1PTAA 3T55A 1DWJM 4MF4A 2P5NA 3GXMA 3HPXA 3TYUA 7REQB 1Z41A 4DZIA 2R1NA 2Z4GA 5A6SA 3VGHA 3ZFHA 3VKKA 1JUBA 3U2CA 1S2UA 3FXYA 2QCLA 2YX0A 5FL1A 2C15A 4XZBA 4AYSA 1EQCA 1NFGA 1GONA 3UFYA 1G0CA 3VO0A 2MUCA 1C90A 1I2PA 4FAMA 3UCQA 1DORA 1O95A 4H7CA 5I3GA 3WJWA 1ZUAX 3GR7A 2WVTA 4PMUA 3LHVA 4L6HA 2D2HA 1XR2A 1TE1A 3IJ9A 2AMXA 4HMEA 2WNWA 2W0HA 3RPDA 3WKZA 3MBDA 1J01A 4AWUA 3U2OA 5AECA 3DCPA 3H70A 1Q7MA 3MI6A 1QJWA 3R10A 1C9DA 4IG2A 3USBA 3O06A 3IV3A 4WDWA 1AQFA 1KW1A 2BVTA 2WM0A 3MCOA 2NUYA 3SJNA 3AMZA 1GQKA 3BTNA 2CITA 1TIWA 2PDFA 1QUMA 1CGXA 1RPKA 3AN1A 1KWKA 5CAKA 1GKRA 1MDRA 2DGAA 4NP7A 3WEZA 1V0KA 5A8OA 2CFFA 2PP3A 4UQDA 1X98A 4Q4KA 1W8GA 5L6UA 3FEQA 1FFQA 2OB3A 4H8HA 1VHNA 2PGFA 4L6OA 4FP1A 5FEPA 2Y8KA 5FEWA 4P2VA 2X99A 2A3CA 4NAFB 3V1PA 2BCPA 4ICMA 5A6JA 1H7OA 4GJ1A 3GAKA 1XLHA 3PJWA 1STZA 4Q6XA 3E12A 3KBVA 4NEWA 1NPXA 4DAIA 2BY3A 4S23A 1NEYA 2ZCGA 3EBVA 4PC8A 5HR7A 4LQ1A 4ALDA 4XBJA 3UT0A 1CNVA 2Z1VA 1NDYA 2ZZ4A 3WJSA 1GOKA 4I5RA 1ENUA 2G4FA 1B5TA 1OF6A 4NZ4A 3S6TA 1Z32X 4LOCA 3QSTA 1ITXA 1FWRA 4J2PA 2XDFA 5U7SA 3W83A 4O8RA 1H7WA 5EY5A 1YIXA 3UY7A 2C7FA 3W73A 1ADSA 1V6WA 4O12A 4TVWA 3BOXA 3O15A 2XH0A 3WLPA 4YVPA 3UJEA 3BMVA 2OWWA 3W7QA 2PUZA 1PB0A 4J9JA 3W7OA 1C91A 5C9RA 2DZAA 4W84A 1TYPA 2XIOA 2E5BA 3MANA 1TG7A 3C0QA 2ZRXA 1ZX9A 1WZKA 1H7NA 1W54A 3UCDA 3L4ZA 2I7GA 2ADAA 2J79A 4QS5A 1RHCA 4G7FA 1ZQ5A 3FOKA 2CZEA 1ISZA 3WD1A 4M6PA 4JTJA 5FAJA 2PF0A 2R14A 4JNYA 4B9ZA 1GYLA 1ML1A 1F5ZA 1WBJA 3QW3A 2W6RA 5HMDA 4A3YA 3AWNA 4BK9A 3T0CA 3BZJA 1E51A 1NQ6A 4ZB5A 2PC8A 2TYSA 1KGWA 4XAGA 1HX0A 4EQRA 3OA5A 4MWAD 4BURA 3ZLHA 1UKQA 3KRSA 2ZX6A 3DI1A 4GNVA 1R2RA 1GRBA 1POKA 1TWWA 5HNTA 1LBMA 1GK8A 3B0VC 1AK5A 3XIMA 4B91A 5AHIA 1E43A 1XRTA 3SN0A 3IANA 1XL9A 1OADA 3CIWA 3WMCA 4F2TA 2IS7A 2Q3OA 2CKSA 5I78A 4RZ5A 2A3HA 2ZX5A 2OZ0A 2G3MA 4KEMA 3TXVA 3OG2A 1NFPA 4Y90A 1SJAA 3UWWA 3EB2A 3KP1A 1QPQA 7CGTA 3TOYA 3F4WA 4MY9A 1XSJA 3I10A 2BHUA 1AA1B 3NSXA 5C7VA 4TIMA 4Y9MA 4J3XA 4EANA 2E8YA 1UOKA 1GHRA 2Y5EA 2ZRYA 1CGVA 4B15A 1K77A 2FB2A 3GU2A 1VFUA 2PC4A 1KRCC 1IIGA 4WEVX 4Q33A 4JTRA 1K3UA 1G1YA 2ZUSA 1GYMA 4HCDA 4IMEA 3WH8A 3UZWA 2PDWA 3ARWA 4K8EA 3GRTA 1G4TA 3FGCB 5HUOA 1Y5WA 4PODA 3M0ZA 4R34A 3T44A 2DZBA 3EX3A 1R3WA 3OZMA 4TVDA 1QO5A 3ZOAA 1A5SA 3UWEA 2E4TA 5M1TA 3CWHA 3L2LA 1HKJA 4F79A 4P7QA 3KP0A 1FWTA 1TTQA 5LNWA 2ABBA 4YIWA 3PB0A 3ZR6A 1NAL1 1VPQA 2R1MA 1RBAA 5C54A 3ABSA 4FPSA 1AW1A 1KCKA 3JU2A 1CGYA 5BXPA 1UWAA 4GUHA 1IR1A 2B0MA 3MO7A 1E1EA 1TB3A 3RU8X 4TTGA 3MP5A 3KDNA 1A4LA 1IWBA 4CCZA 4XSLA 1ITQA 2HTMA 4AZHA 4F0MA 5A6BD 1Y5XA 3WNOA 5ABHA 1R9XA 4S2BA 4AWTA 3IK4A 2PWUA 4FS9A 1GTHA 2WC4A 3WLJA 2YXOA 1V79A 3H24A 1N55A 4XZNX 2R24A 3H2OA 1M5WA 1JG9A 3OU8A 4M6QA 1JL8A 3URHA 3EX2A 4YTSA 5E9AA 4J27A 1SW0A 2VDGA 1CLXA 1ZU8A 1GXFA 2XG9A 1QHPA 5I77A 4ZR8A 3BGJA 4J28A 3WG6A 2YW4A 3IJQA 2GH5A 4OWGA 1UJQA 1RLDA 1QAPA 5MF5A 4MB4A 2I5IA 1K4GA 3N2XA 3OYXA 2E3ZA 3KWXA 2BSLA 1O4UA 4QNEA 5J04A 3SW6A 4Q7IA 3SGZA 3GS6A 2GJRA 5DMLA 4GBUA 2B81A 3UNTA 1GRTA 2HZGA 1ZCCA 3PN8A 4DY1A 4FR6A 1LG2A 2J77A 3LHWA 2ZKMX 4IOTA 3NGJA 1OX5A 1I0BA 4WJ8A 1MFUA 3UPBA 2ISFA 4A8NA 3W29A 2WMJA 3P80A 2PLKA 4GZIA 4B5WA 1OJXA 5EMLA 4B5TA 4Z0SA 1AOGA 1IT0A 1BF2A 1PZ1A 1PCWA 4ZFMA 2GYIA 3EKZA 3BLOA 5I23A 4B5UA 5D30A 1QNPA 1V77A 4H4QA 3UETA 1XBXA 2DUXA 4Y8EA 1V3LA 1MZHA 1GQNA 4NZ5A 2QCEA 3MSYA 1RQBA 1RJRA 1KM5A 1OY0A 1OK4A 1CPUA 3AU6A 1B4EA 3ARVA 3TMQA 3TJLA 1XBVA 3TZFA 2VHLA 4GYPC 3D6NA 2QPUA 2P50A 4MWAA 1Q3NA 1V7AA 4H83A 4JX4A 1F6YA 3LGDA 3LBOA 2QUVA 3SAZA 1QI5A 3GVRA 1XGEA 1R0MA 4WIWA 2MNRA 1IZKA 3BXWA 5LKYA 2XSAA 2GDVA 1JCXA 4DO5A 1ZDLA 3DN5A 5M2FX 3LLDA 4QEEA 3AI0A 3M7WA 4IIGA 4HU4A 5XIMA 3LNMA 3W01A 2ATMA 1EEXA 5J5RA 4HSHA 3CAWA 2BOEX 5CPTA 3VDHA 1A3WA 3IEBA 4NAFA 3KFTA 3AMCA 5H6HA 2Y6ZA 1FCQA 1PTDA 1I0DA 5I06A 2VL4A 2WNZA 4Y9AA 4WOQA 4MHBA 1KM6A 4L1WA 3BAXA 2CW6A 4CNPA 2FPYA 2YVJA 2OX4A 5HWJA 3UR5A 4ZO8A 4I7WA 3S8HA 1E1FA 2PSNA 3W3OA 4GK8A 2GDQA 5GNZA 1H1NA 3O8AA 1TVLA 1JDEA 2YBTA 4XV0A 4HA3A 1O66A 5K9DA 3NNTA 5T9CE 2PD9A 4IPIA 4IP7A 4JTEA 4GZEA 3KTCA 2VR2A 2ZE0A 4Z1DA 2VOTA 3W7LA 3G18A 1V3JA 2GR0A 3URQA 3S9YA 1WDPA 3GTFA 3G1VA 2FVMA 3W7JA 1HW6A 2BOGX 1T6MA 4HHMA 4WSJA 1F7BA 5LIWX 2C3CA 3IJLA 2BX7A 1KCXA 1W9XA 2H9AA 3MCMA 4YHEA 5JXQA 1V6YA 4AIOA 5K9CA 4XUGA 1G01A 1NF7A 1VF8A 5EPDA 3HURA 3GXIA 2OODA 2HMCA 3AS0A 1ZJAA 1SZFA 3IACA 3BSMA 3GO2A 3LPPA 1NHRA 2A7RA 3WCZA 1DHKA 4PBFA 2QGHA 3TAOA 3L7RA 6ALDA 2C0AA 1UH2A 2V9DA 3A4WA 3KS5A 1JYVA 4ZMGA 4WGXA 3F03K 1H5VA 3FCPA 3C86A 3O2LA 1KCZA 2IUZA 3KXQA 1H0IA 3Q4DA 3T78A 2Y2WA 3H2MA 4QR6A 2QYGA 3PSVA 4ZO7A 3TKFA 4O1CA 1DQXA 2DSZA 3PANA 5I5RA 1NOUA 4IJRA 3G1SA 2BODX 3VABA 3CUXA 5F4SA 1UA7A 3MPGA 4UMBA 4URIA 3WF1A 4IMCA 4MJ4A 4HNOA 3TIMA 2GOUA 2Q3RA 4CU6A 4HJFA 5DCEA 2XYLA 4LUSB 5FOOA 1TREA 1OFDA 4H6KA 2AAAA 5TD4A 2CYGA 2NSXA 4IF2A 2V3AA 2V3BA 3VNLA 4JIIX 4V1XA 3SUUA 3NDYA 1K7EA 4V2XA 1YPXA 2HNHA 2D24A 4H3DA 1LTDA 4FXRA 3S1GA 2W66A 4TV6A 1R3VA 3CS2A 2CBUA 4ZE4A 1BSLA 1IEVA 2AQWA 3RCMA 3ANVA 3AS3A 4AX7A 1VAHA 3L67A 4OUIA 4E6MA 3A24A 3THQA 1WV2A 2J7DA 3H2EA 2YCKX 3CQIA 1JGIA 4WXZA 4KFPA 1K03A 5C9XA 1NDVA 3N29A 3QFBA 4BF5A 1XYCA 3MWCA 4ROPA 5EMMA 2ICSA 2XFFA 1HJXA 4F2BA 3IUIA 2XPKA 4OBRA 2ZTKA 2OEKA 3SY8A 4A22A 3T9PA 5EU9A 4I5XA 5HJYA 2ZA2A 1JOAA 1FX6A 3H26A 4K8GA 3EDFA 3W26A 1E0VA 2OELA 1RUSA 1F07A 3JRKA 3MHGA 3DFTA 4FF5A 2VWTA 3LCGA 4S3JA 4C6MA 2W79A 3UD6A 3U2EA 1MEIA 3GG7A 3V36A 3LMZA 3S2LA 5IBXC 1GW9A 5D9MA 2H3BA 3C2EA 1SQ7A 1XISA 1KV8A 1CGWA 3AHTA 3AXIA 4B16A 3VCCA 4HD5A 1XCFA 2BDQA 3NQ7A 2E28A 3K46A 1L2QA 4AVFA 3VUSA 2GR3A 2V67A 7TAAA 3CGEA 1J10A 3T4CA 3UR7A 3WK0A 2RFGA 3AHXA 2FTYA 5IDIA 3KRZA 5CSSA 5BNKA 1SVDA 4HNLA 5CJNA 2DY3A 3SBFA 2P0IA 1MNZA 3PWIA 5A6MA 3N11A 3QV7A 2J3NA 4KQNA 3O0HA 1X6LA 1R7OA 4UTIA 2XJ7A 3GU1A 2EPKX 4UTFA 3W02A 3T2PA 3DK9A 4JR5A 4LCQA 2OCZA 3AHZA 3WQGA 1LBLA 4GG9A 3SIZA 3S6OA 3VD5A 4C1LA 2V3FA 4KCUA 1KNWA 4FI4A 3FA5A 1Y8BA 3FLUA 4RUBA 1VHCA 4HTBA 1J93A 4FO4A 2HROA 1OSEA 4KETA 4DJFD 3U3HA 3ARQA 3KVKA 1CENA 1NOFA 3GW0A 4REQA 4HNVA 2J75A 3CAVA 1XWYA 1GQJA 3CL8A 3WNNA 1B3ZA 3ARSA 4ONVA 2G95A 4PFHA 3PJUA 4P8WA 1QDSA 2PF8A 3IS4A 3UY8A 2WOVA 4MB3A 1CWYA 1W3LA 5D09A 4BQ4A 4EACA 1HKVA 2A2IA 2AKZA 1RAKA 4MZ8A 1WBHA 2V38A 4FX9A 1AH0A 3U0HA 2FZDA 1FWEC 1BYDA 1L9WA 3GRIA 2IPFA 2C18A 1R87A 1TZ7A 2O0TA 4DF2A 4GZJA 4JY9A 5HA7A 1EP1A 3TYDA 3DERA 3M4HA 3VOFA 3NSMA 4LYRA 2QMKA 2F38A 3N2BA 3NCOA 1BWKA 3QOMA 3DBNA 2OQLA 2QDDA 2E0PA 2YCLA 4LY4A 2MANA 3YPIA 4H9TA 4XKYB 3WFAA 1LT7A 4GNJA 3MHUA 3A23A 1IXPA 3EGJA 3MU7A 2PGWA 4RPQA 3PTMA 2HISA 1TPDA 4MZYA 1OG0A 1UROA 1MW3A 1ZGDA 2B7OA 1O7AA 3E96A 2AGTA 1F4HA 3LCIA 1ISWA 1FUYA 2VX5A 3N4FA 3W24A 2NWSA 2VFHA 3E1F1 2CLMA 4GD0A 4LYQA 2VC5A 2GSHA 4F0HA 2WCAA 1JQXA 3ZQ9A 1PIFA 2ZZ3A 3QYSA 3PS7A 3STEA 4JTQA 3V0SA 4QCEA 3NQVA 1AFSA 1MXGA 1X7IA 5HNRA 4KT2A 3NFUA 2NVKX 1PKNA 2D0FA 5F2LA 1XGDA 4MOZA 5DXXA 1OYAA 5DXYA 4GI4A 4R85A 2FPVA 3W1AA 3B8IA 3UPWA 3STFA 1EWEA 1EZWA 5CBBA 4H1ZA 2EQ6A 1PUDA 3NA8A 5FSDC 4GQ0A 4ENLA 4M51A 2PU0A 1NHSA 1HUVA 3D9XA 1VGAA 4AD3A 2EBNA 3TWBA 3F5KA 2VYOA 4DUXA 2NXIA 3JS3A 5RUBA 3HG4A 3LXBA 4HT3A 2ZXQA 1T96A 1DJQA 4HGXA 5D04C 3AALA 4NAEA 1XLMA 1V5XA 3CO8A 5I07A 1AODA 2W3RA 5CZTA 3B9DA 4XSMA 5LGXA 2QCMA 3AUOA 4NI3A 5I7GA 1AMKA 5BWFA 3ZM8A 2OG9A 4X22A 4AD0A 1ISXA 2DT0A 5M5DA 3KS6A 2XIBA 3SZ8A 1FOBA 4JQ2A 3STGA 1UP2A 3TJIA 4LUIA 3AISA 2XIMA 2UY3A 3I3BA 4D71A 5SWUA 1D7KA 1JVNA 1UKSA 2VR5A 3E0FA 2VZOA 3UA3A 4O53A 4GINA 3QBUA 2PCQA 4R33A 3NDOA 4F4RA 2OMAA 4CN6A 1IWAA 3TC3A 1UBSA 3IWPA 4GI8A 1GW1A 3WQWA 3NOYA 2TAAA 2A21A 3UZ5A 4XISA 4LFYA 1I2QA 5TBOA 1V97A 1ZKQA 1XG3A 1LYXA 3HO8A 2EPLX 5CGQA 1US2A 4CLMA 2YA1A 1Q6RA 3QY7A 5F4WA 3LHUA 4F66A 5CZJA 5BMWA 4MFEA 1GNXA 1NH6A 4KGLA 4YTRA 2R9RA 2V81A 2WM1A 4H4YA 3KHDA 1M7OA 4IM4A 2CBVA 2RDWA 1GEQA 4YU1A 1DWGM 2J27A 2X1IA 3FK4A 2V5KA 4G7EB 4BHYA 4UR8A 3HQPA 4M6VA 5FEZA 3R13A 3N6JA 4HOXA 3FYOA 1TV2A 1SPQA 1G69A 1D7FA 1OFBA 1NP2A 2OU4A 2VZUA 3W72A 2GQWA 2WHMA 1AD4A 1AL7A 4JFTA 3D0CA 3NPXA 3WF0A 3IPWA 1XRFA 1TV5A 2JBMA 3M43A 4Y9PA 5A69A 2GWNA 5D2VA 4H4WA 5LSMA 3GIQA 5DEZA 4GJIA 3VKJA 2D69A 3MJYA 1S38A 3AUJA 1Z44A 2DEPA 1J11A 3P82A 1XYZA 1JPMA 3I3DA 3MI2A 4IIFA 3WLMA 5I79A 2QDGA 5A8PA 5FD0A 3SR6B 1J79A 1F73A 3MDUA 3PFMA 2GQAA 4L5ZA 4DM1A 2F61A 1CGUA 1P0BA 2J9ZA 2E9LA 3ZT6A 1CBGA 4C1NB 5E5CA 8RUCA 3A47A 4HQVA 2X7VA 3UG4A 4C90A 1Q8JA 1XC4A 2D3LA 6XIAA 3F7JA 3UXDA 3ZO9A 4APNA 4A29A 4FALA 1E6QM 1UUQA 4LRSA 2OYKA 3ETRB 2I17A 3W1RA 4RCXA 3O3RA 5IDZA 1LOQA 1KGUA 4DLFA 3WQ5A 1RY8A 4I6KA 5LNUA 3WNPA 1ELSA 4LUYA 2WVVA 3N04A 3QMTA 3WMSA 3DFYA 3LS9A 4ZCWA 1YQ2A 4GVFA 4PMJA 1JPIA 3DC8A 1GOMA 4KW2A 3P81A 3THDA 1UD5A 3TJ4A 3BGAA 5D03A 3GH4A 3UCCA 4UTUA 5J8LA 2VM8A 4NRRA 5HUPA 2YCIX 3CQHA 2SFPA 1I2OA 4NKCA 3UVAA 2YYTA 1D3HA 3AOFA 4O0QA 4LH8A 1IGWA 3CLMA 4YCOA 3HW2A 1TWDA 1H2IA 4A35A 1YTKA 1SGJA 4I3GA 3HJZA 1GZJA 4PA8A 2CLFA 4P7RA 1GV4A 2V5BA 2HE5A 3P8JA 3TYEA 3QY6A 1RV8A 3PM6A 3EWYA 1H1YA 3VIHA 1XW8A 1P1XA 2J7GA 2WP6A 3UJ2A 3P5YA 4HSOA 3HRDC 3GKAA 4HNTA 3UR2A 1XH1A 1Q2SA 2Z1KA 1UHVA 1SJCA 1VRDA 4LV9A 4J5NA 3VD3A 3DHUA 1CLVA 3CZJA 3SY1A 1HL2A 1MSSA 1OZQA 3BQ5A 1RVGA 3TFXA 5JRBA 1G94A 4JN8A 4CNUA 4XZLX 3MKKA 5DBTA 1R9ZA 1ONFA 4QNWA 2YVFA 4J2MA 2WC7A 4LC6A 1B30A 3ITYA 3MMUA 3SDOA 2JEQA 4EMJA 3NQEA 3FJLA 1UG6A 5G2IA 4FA3A 1RD6A 2YOCA 4ZO9A 3H53A 4HSNA 1M01A 3PZOA 2WKGA 4QQ3A 1AW5A 1IZJA 4Z08A 1FWFC 3K30A 2J7HA 1XYBA 2AOSA 4B3ZA 1PPIA 2YVGA 1QMLA 2IKIA 1S2TA 3BZGA 4GO9A 3RCNA 4CD5A 3RN6A 2BFGA 3EDKA 5CC3A 2VEIA 2OLHA 4QROA 3IIXA 3ITXA 3B8WA 1EP2A 4KIRA 1IYXA 2VUYA 4EP8C 4W88A 1FWJC 4ZQRA 2Y1HA 3LOTA 4ZFCA 3CB3A 1DXIA 3GNNA 1HG3A 3DGBA 4NZ3A 4A05A 2PDNA 4QAIA 1VENA 1OFRA 4ADWA 1OGGA 2HEJA 2NPXA 3QKEA 3VKDA 1GKPA 2V8ZA 3VMPA 3R0KA 2W3ZA 3VDCA 2GZXA 1KCLA 2Z6IA 4LVDA 4JX6A 4C6EA 1IV8A 1XH2A 2Q02A 2ACUA 4O14A 4EQXA 4X60A 2V5CA 4GMEA 2JKPA 3IGHX 4FMVA 4AB4A 1HJUA 1XG4A 3MVTA 1LPFA 4HN8A 4P5UA 3VYLA 3A4XA 1LZOA 3QM3A 3OHMB 4EIVA 3FX4A 4DVOA 3K8LA 1GOQA 5H2ZA 3MZNA 3BV7A 1X1ZA 3HF3A 3BOFA 5DF0A 4H7VA 3N9KA 4H9MA 1JDDA 1JI2A 3FN9A 5XIAA 4H6QA 2A3EA 2DZTA 1EO7A 4CD6A 2UWFA 4IUGA 1G7VA 2QT3A 4FOJA 2GGGA 5CSRA 4LV4A 2EG8A 2AGKA 4FOUA 1VCVA 1XC6A 3Q2DA 4O11A 1HL8A 4KERA 2V2DA 1DVJA 2YB1A 1H61A 5A6BA 4YYFA 2PDUA 3N6HA 1KGXA 4UFMA 4B5VA 8XIMA 2QPXA 1O68A 4LF1A 4J1OA 5D2YA 2WMIB 4WCJA 1K8ZA 3NQDA 4MKSA 2CNCA 3DECA 1V0MA 4C6QA 3C2OA 1P43A 3EAUA 4S3KA 1I4NA 3KW3A 3DFOA 4RNHA 1ONWA 3H7VA 1JF5A 3L9CA 2J74A 1H0GA 4YMZA 2FVKA 5G5HB 3ALFA 3WQOA 4PB5A 1UPPA 1DE5A 5EB8A 1XIJA 4WHBA 1ECEA 3M64A 3BJSA 3CHEA 3RRXA 1GVRA 2RAGA 2FTPA 1GQLA 4BQ2A 2C1HA 1UBPC 3GFYA 2X8GA 4MYXA 4B4FA 1BTCA 3ZT7A 3GC2A 4H4VA 4F8XA 5AC7A 3WF4A 2WBAA 1W1A1 4GBDA 1J9YA 4GUFA 1EFZA 3O0KA 1CXHA 5E9XA 4E4PA 3RJYA 1ITCA 4QJ5B 1VIWA 3MT1A 1KM2A 3NL6A 1SO5A 3SCPA 3S6DA 4HCHA 1F6KA 5A8MA 3LADA 1SU5A 4I90A 1GJPA 2FJUB 4LW7A 3A7UA 5IBXA 1QOXA 2D22A 1P1MA 4GIRA 2J47A 4LAMA 3L2IA 5JVLA 3MB9A 2VEFA 3TA9A 2XSBA 3I7QA 2EPOA 8CGTA 3NS1B 1L8NA 4GYFA 3U48A 3OIHA 1J0ZA 4TVCA 4QAWA 1BWCA 3VX1A 3BLLA 1UWSA 1JPKA 3E2QA 3EA2A 5I3KA 2H8ZA 2ZYFA 3W27A 1RPXA 1US0A 2DORA 3BLFA 3KOZA 4YS1A 1J2BA 4JNMA 4EAMA 4M52A 5I24A 4PTMA 3WH6A 4ML4A 1WDRA 1X2HA 5CKSA 4EOUA 3RXZA 2P53A 2PRLA 3MUCA 2NXGA 2EHHA 2WYSA 2WVSA 3LRLA 2Q8ZA 3I7RA 5G2HA 1RSCA 5BXSA 3H4WA 3WK1A 1UR0A 1TZZA 1Q6CA 4P8UA 3VGFA 5DY3A 3LEPA 4US5A 1YLVA 2NQZA 1NOWA 1MUMA 1WQ5A 3QQ1A 3HM7A 5A6TC 3EMCA 5T9BG 1Q66A 4X63A 3SQPA 4KS0A 2DUZA 3BWWA 5HXMA 4O1AA 4ZGYA 2DT1A 3SGGA 1TPFA 3AMKA 5A2AA 4DUVA 1HXJA 3QPEA 4UTTA 3LQGA 1W1IE 4AF0B 1TCDA 2B7PA 3BVJA 3RUBL 2W63A 5LA1A 4DF1A 3KVLA 1W5MA 4PMXA 2NX9A 3NO1A 1MWOA 5TNVA 1BRLB 5F1VA 4XKMA 5G4HC 3WELA 3QYQA 5A3HA 2FGZA 4H04A 4D6HA 5D05A 3K5XA 1GEHA 3WSUA 2Z24A 4UFIA 2F9RA 3SCUA 4IPPA 3EANA 4TR9A 4LNYA 2OLAA 1M3UA 1UMYA 3M16A 1ZY9A 3U5YA 2Y7EA 2OEJA 4FXFA 1RA0A 3USZA 1BVZA 3KBWA 1LRNA 3WQCA 5FA5A 3W0KA 4H6RA 1A0DA 1PYMA 1X1OA 1K6WA 1QU4A 4GQQA 1RY0A 4Z0JA 1EJ7L 3LSCA 4AY8A 4GKTA 3SQMA 1XHGA 4Q8QA 2D1ZA 4BV6A 3E0VA 3EUB3 3EMZA 3MMTA 4M5PA 2A6LA 3OG3A 4XZIA 4QXIA 5C0QA 3LRMA 3PBWA 2PDJA 4RNIA 5AYBA 1X6UA 3L65A 2DW7A 2ZZ2A 1QW7A 3D3AA 3M44A 2W67A 4PN2A 3B0PA 4JY8A 3TDFA 3AZTA 3MUY1 2VFGA 3EPMA 1QNSA 3N2CA 4NJHA 2PWHA 4PRRA 2C79A 2A4AA 3B0YA 1J4EA 1JXKA 3H2NA 3WLKX 3L23A 3II1A 2AKMA 3GM8A 4GY1A 4LVFA 5D2WA 5D9NA 4C1NA 4MSSA 3UNDA 2X1RA 3NQAA 2OJPA 4KRZA 3GWQA 5D9PA 2QAEA 3WFZA 4H19A 1ZXIC 1TX2A 1JYWA 3I65A 5HQLA 2J8FA 3VA8A 5C71A 2GL5A 4Z2LA 1VRXA 3VD9A 2QJGA 2IQ0A 4RK8A 4HOWA 3C5QA 1B1YA 5FJPA 3N1AA 3U9IA 4RJEA 4X2RA 2J8TA 4ZSTA 5BOOA 1NFBA 2REQA 2VT0A 1S5WA 4F48A 4MJMA 4IMDA 3WDHA 4F0KA 1SW3A 1TPB1 2XVLA 2IPWA 3N15A 4E2OA 4IG2B 2J7FA 2HDJA 1K8XA 3AIRA 2ZZBA 1BYBA 4QLJA 1PKYA 1PZ2A 2Q09A 1LQ0A 3GVQA 4N9DA 3NZ1A 2C1GA 3S46A 2DJLA 3MJMA 4WSHA 3VMOA 2WWDA 1A50A 2G3NA 1MXSA 3RJXA 4JYEA 1JNDA 1DJYA 3GYEA 4DNMA 1X1NA 5HPCA 3F4VA 3O6YX 2OFJA 5REQA 3LENA 3WQFA 4FEZA 3KBNA 5AN7A 2OZTA 3PTKA 4XD6A 4BS0A 2GDUA 3VZYA 4JICA 5AZ0A 4O16A 2WHJA 3GHUA 1BVNP 1F3WA 1VJSA 1BSIA 4AEEA 2E8ZA 1GKQA 2NQLA 2ZXDA 4DN1A 4RXGA 3XISA 3OP2A 4S1FA 2WBKA 3HZ3A 2E9BA 3NJ3A 3QR3A 1BYAA 3M5ZA 4WJEA 4EPBC 4J56A 2IKGA 4LEQA 2DQXA 2YL6A 3TH6A 5FS9A 3RFAA 1CB2A 4KWWA 1F8IA 2G41A 2D2OA 4Y7EA 2ZUNA 5CLWA 1EGZA 1OCNA 3BCJA 4IFRA 2GUUA 1E55A 1XFCA 3DYPA 3VK5A 3M0MA 2PZNA 1ONRA 1YNPA 4IFKB 1W91A 2VGFA 2X41A 4A8LA 3C2YA 1Q5MA 4UB9A 2VC6A 5AHMA 1JCNA 3KDOA 4J3TA 1YEYA 3P8IA 1J0JA 5JUVA 1E5NA 3R1ZA 1KB3A 1WDQA 5CPOA 3P3BA 2C3DA 3OOQA 3NEVA 5HULA 3VILA 5FCZA 4EX4A 3O1NA 1WPCA 4MAZA 4S3GA 5AVHA 4JDYA 2VJXA 3OC4A 1CXLA 8XIAA 4DWDA 2O55A 1B3OA 1Q6FA 1E5JA 1AD1A 2QCDB 3VIOA 1A0CA 3U7BA 2YKKA 1E6XM 3QR1A 3W1XA 1I75A 4M7TA 5HJXA 1RLCL 4TU1A 5FSEC 4PUJA 4W93A 2B7QA 3TYZA 4AY7A 4H4SA 5I3HA 1JDFA 2QUNA 3UZXA 4JNZA 2GSJA 4DPPA 4IL0A 3IAQA 3CPRA 1QPNA 1QT1A 3VIPA 1V02E 5A8QA 3QOKA 4ZODA 1RA5A 3BW4A 1K8YA 3EZ4A 3GZ3A 2XU2A 3CLWA 3EWWA 5FJJA 4YWSA 1BXCA 4IT1A 3QV8A 1H3GA 1GORA 2QMJA 4C6KA 2PTDA 3GNPA 5K4ZA 5D2XA 5JBEA 1X8CA 1YYAA 3HV8A 2XGIA 3MUZ1 3FS2A 3W23A 3BOLA 1KC7A 4I9JA 4JQ4A 2GK1A 3TLQA 5ECUA 3A5VA 3KBJA 4W5UA 1NM9A 3IUHA 3E0IA 4B5SA 4EMWA 4PUKA 3M6DA 3RAOA 1Q6QA 4M8UA 3CJPA 5KETA 3CYVA 1JI1A 3DC0A 1ECQA 4LWWA 3W7CA 3WLSA 1BQGA 2IW0A 1E3XA 2PGEA 2FLIA 3A4AA 5FS8A 2D2GA 2HBXA 3V18A 5LXXA 3LGGA 4Q4RA 3PZIA 1XLFA 3BARA 1OC5A 3DYMA 1TELA 2W91A 1GRHA 1VDVA 2HVNA 1XJBA 4F40A 3AIUA 4O10A 1V3HA 1F2JA 1Q85A 5BWAA 3F2DA 3RM4A 1GJUA 1L2UA 1R7AA 4XAFA 1BXBA 1GWJA 4Q8OA 4IZGA 1VD6A 3CIXA 3BQ6A 4C5YA 1D8WA 4DEFA 5CSYA 4GPNA 2E77A 4FIQA 4CKQA 4O52A 2TRSA 4MWAE 2PTYA 3NO3A 4CEXC 3TNOA 1WXYA 5FJIA 1PZ3A 1PWMA 1SUXA 2I16A 3WDIA 1XIFA 1TJ2A 2POTA 2VRQA 2EPMX 1EP3A 4HA0A 1E0XA 3TCSA 3N17A 4PSRA 2C6QA 3W1TA 3NPWA 3BAYA 1LLWA 1TRDA 1EL3A 1WZMA 1MQRA 4PTWA 2EQDA 4U5KA 2NLIA 3LCXA 4ROQA 1YPIA 3VE7A 4NX5A 1TVPA 3Q6JA 3U6WA 4X3ZA 2DW6A 1XIDA 3M0HA 2WCGA 1DJGA 3M6YA 4AFYA 4EPKA 2ZQ0A 1TMLA 2OWCA 2PTXA 3PZ9A 2YLLA 1MI3A 3ITTA 1FDYA 1FXQA 4Y9NA 2ZICA 1JAEA 5AYZA 3SCSA 1UP3A 3GTXA 3GXPA 4NG3A 1U1JA 4PL1A 3JZUA 2R1PA 2HS8A 1VH7A 3V16A 3IK2A 2X50A 2A5HA 4R9OA 4N6FA 4US6A 4NYYA 1M6IA 3FHAA 1F3PA 4LNCA 1W3KA 3QJAA 4FHAA 4L80A 3KL0A 4HA4A 3FAXA 1OWQA 2XIQA 3QZEA 2GJPA 3BLKA 1XP3A 3WQ8A 1GG0A 2E67A 3D47A 4G7EA 2VCAA 3WYZA 3W28A 1JJKA 3GX9A 3W37A 3NYDA 3PBGA 1AL8A 4D72A 3SEPA 3EWDA 3DAQA 4UCGA 1RCXB 1UH3A 3C0LA 3QKZA 2I56A 1J0KA 4E2VA 2AQOA 1L6GA 2Z00A 1G4SA 3GG0A 3TSMA 4PMZA 4QFUA 5GPRA 2EGZA 1LL6A 3H2FA 3I4KA 3FKRA 1ZALA 1OD0A 1VBRA 4LPCA 2GJXA 4P61A 3PZTA 4MY1A 4RE3A 4IGMA 4S3BA 1FDZA 3N25A 1LJYA 3QGKC 1VLWA 2TPRA 2D0GA 4CCCA 2QS8A 1GEUA 3QZ6A 1RZMA 3KOWA 5CZ0A 2XVNA 1YTEA 4H7ZA 1FWCC 3M1ZA 3CH9A 4K38A 2VEMA 3F4CA 2O9PA 5HQEA 4UNKA 2WZIA 1Y5VA 1HGWA 1YBQA 3CAQA 3E02A 4MAVA 5JBFA 2CCRA 2YCEA 4Q4PA 2Y0FA 3CHDA 1PBGA 4ZXLA 2W27A 2WOQA 4XX6A 1XIMA 3KCOA 1FWIC 5DANA 5E0FA 4XZMX 5I3FA 4Q8UA 2WPGA 3DU0A 5M17A 3AHYA 1W3NA 1MMFA 1RH9A 2UY4A 4UQBA 2VD9A 3GR8A 5G1YA 3GD4A 3VNIA 4N6EA 4W86A 4ZOCA 1SFLA 3FAWA 2BC0A 1JCLA 4DUOA 4C6CA 4RL3A 2YA0A 1FRBA 3MO4A 4LAUA 3PP7A 2G97A 4UTHA 3IGXA 4HPNA 4DLMA 3WQ6A 5LHEA 1I60A 3G0XA 2QDHA 1W5QA 3G1HA 3MBFA 3VCNA 1FWGC 1YADA 1YNQA 3W7GA 1W1ZA 4M3PA 5BRQA 3NVYB 3T07A 3VDAA 1ICSA 3WO8A 2AL2A 3CH0A 1AZ2A 3B3DA 3GXDA 3B8UA 3IARA 4XZWA 4DJFA 1XIEA 1P0EA 2Y63A 4HN4A 1QFEA 4PCTA 2XHYA 1ESWA 1EXBA 3EAOA 2WKLA 3BAWA 3B8DA 1FEBA 4JS3A 3TC6A 3G1AA 4GC3A 6REQA 1H5YA 4Z1AA 3LPFA 4O1EA 2WPFA 2PPGA 4IFKA 3ARUA 4D1JA 2OPJA 4EMIA 3IC9A 1WDWA 1EJWC 1DYSA 2NUWA 1SO6A 2ZRZA 3T81A 3AXMA 4K1WA 3MUAA 3QF0A 3DBPA 4IWWA 3CGDA 5K4XA 3NWRA 4QLKA 1KLZA 3QLLA 3W9ZA 1VC4A 3KRBA 1EA0A 4NIRA 1TPUA 3I6TA 4JFSA 4IISA 4KMQA 5LGZA 3DI0A 2DZUA 3W6LA 3PFRA 4E4UA 4QCFA 1LF1A 3DH7A 3L4WA 3UJRA 2G96A 1XLDA 4H4TA 4ZQPA 1S3HA 2GVLA 3GXNA 1NP0A 3AJXA 2E7FA 4OOZA 5LA2A 2WMGA 2BOFX 4PRWA 5CLTA 1E4IA 1SR0A 3WQEA 3R8HA 1A80A 3U4AA 4KWVA 3ZSSA 4C6FA 1I1WA 4Z17A 1J5SA 3N2MA 4QDMA 5LZLA 1E9IA 1Q4WA 5ECVA 4A6GA 4CD8A 3P74A 3EKLA 1ZNNA 4C7DA 2CETA 4CEUC 3UU0A 2DZWA 2X1TA 1R3QA 2QR6A 2CPUA 3HGJA 4L65A 3W70A 3Q45A 1QNQA 2FFCA 1ICQA 3HB9A 4PCPA 1TIMA 3KL3A 4S2CA 2JGQA 1VEMA 1QWKA 1A4MA 2YB4A 4REQB 3FXGA 7PTDA 4EF8A 2F7FA 4GXPA 3AFBA 2ZUWA 2IXVA 1EQPA 1WXZA 4PTXA 4KCWA 2YDRA 4BKNA 3WLHA 3H7RA 1ZHAA 2Y8VA 1X8FA 3RF9A 4UTWA 3L0KA 2OXNA 1E4MM 1B3YA 1GVIA 2I57A 1ADDA 3NL2A 4YJ5A 2PA6A 2QIWA 1JYXA 1XDIA 2WBGA 4UUIA 4N0RA 3REQA 3CHCA 2BG5A 3GG8A 1EIXA 4IPLA 3GHRA 3A3XA 1V3KA 3AYTA 4HA1A 5FKYA 1K4HA 4MKNA 4IIDA 2FIQA 2VCCA 3WNKA 3JW7A 2G3FA 2INZA 3II4A 1DIOA 5EFDA 5HR6A 3R43A 4QG6A 1SO4A 1MZRA 4D6DA 1XI3A 3NQCA 3R2GA 4GRTA 4QE5A 1VEPA 1RBLA 1UCWA 1R38A 1VFHA 4JDRA 2ZZ5A 3MQTA 4H4ZA 4C7GA 3ID7A 4JTUA 5ABGA 4JTIA 3HQNA 3FHQA 3TSDA 3GTHA 4WY0B 3TWAA 3DFQA 2E5DA 2Y7GA 1HO1A 4CU8A 3ENLA 1GG1A 1C9WA 1E1CB 4Z42C 5AC8A 4JKLA 3V4BA 4RNJA 4NJKA 1U5HA 1BWVA 3S2CA 4B2DD 1ADOA 1UP0A 3LK6A 1UD4A 1ZAJA 4PYSA 1VKFA 1MOKA 3KLLA 2PTWA 4WD0A 3UZJA 2GVEA 1SYTA 4QBXA 1DWFM 3RLVA 5BU9A 3CPGA 3ZVHB 3W74A 2V63A 1MDLA 2Z0IA 3NVVB 3W75A 4DWSC 3EPNA 1DE6A 4FK9A 3G6LA 4QP0A 4H8UA 3CMGA 1TPEA 4DM2A 1PHWA 3AS1A 3WBEA 1FQ0A 5JCKA 4BWLC 3P14A 5IFTA 1PKLA 1N61C 2BVWA 4FNPA 5A94A 4F2UA 1V03A 4BEUA 3A7AA 3S83A 3W53A 3T40A 5DO8A 3B8VA 3GG1A 3UGRA 2ZE3A 1HGYA 1DXLA 4QJ3B 5FS6A 4UTKA 4NASA 1Q2RA 1BAGA 2DQWA 3P62A 4DO7A 4DXKA 1G67A 1R46A 3WF3A 5I2UA 4JQ9A 2Z1SA 1R3YA 2VRJA 1RCQA 2V3EA 3VD7A 1IWPA 3CC1A 3R07C 3AXXA 4AD4A 2XUCA 1OCQA 1R86A 2HV5A 4RXFA 3A6OA 1JUKA 4UQCA 3QC3A 4JAWA 3FJNA 4XBSA 1V0NA 3PNUA 1YE6A 1Q7ZA 1U1HA 1QWGA 1MEWA 2BZNA 1VFLA 4GQGA 2GRTA 4DF0A 5KVIA 1TTPA 4GI9A 1RVKA 1OHLA 2BC1A 3RPMA 3LCHA 5FJTA 1WKFA 1A5AA 2R91A 2FJKA 5I02A 3HN3A 4DBUA 4AIEA 2FHFA 2R1LA 3UXKA 3RMJA 3VU2A 2ZX9A 3RX2A 4RDWA 2PMQA 1E9LA 3SCWA 3WUBA 1TR1A 3MWAA 1BHGA 4OKDA 1EEPA 3CWOX 2WSYA 4LCRA 4NNCA 2FTWA 3LTPA 4Y96A 2X2GA 4L4MA 1TRIA 4UFJA 5FACA 1T0OA 3T42A 2ZOXA 3O6DA 3VZZA 4QRNA 3VX0A 1MVYA 2PBOA 3GW3A 3WENA 1GRFA 2O9OA 1GVEA 1SR9A 3I6EA 3R8GA 4UOZA 2QVNA 4EM3A 2A1YA 1JZ7A 2ASHA 2OOFA 4YCPA 4XAPA 3EA3A 3HA1A 1EPXA 4RDYA 3L0NA 2J13A 1H4PA 1O5XA 3N9SA 2EAWA 3BLIA 1IT8A 1GERA 3URBA 4U2ZA 3H2AA 3DG3A 1EJRC 4PSPA 4GHRA 2VC9A 5LIXX 2DZXA 3C0JA 4MMWA 1EJVC 1EBHA 1PHQA 4GGBA 4K37A 1AG1O 4E8GA 4F3HA 2Y85A 1EC9A 1GSNA 3OO2A 4GX9A 3S9ZA 1F3TA 4Q4MA 1MXDA 3CTTA 4O50A 3CZ8A 5D33A 5DRIA 4HHPA 4L1XA 1QPRA 3DJJA 2DVUA 3N4AA 1XYLA 3RIKA 3QQWA 1M41A 1HJQA 4TMCA 3IIOA 1OYBA 2VVNA 4LJ3A 3VOHA 3LV6A 3BJFA 4C6LA 3EOSA 4ZTXA <