1KKOA

Crystal structure of citrobacter amalonaticus methylaspartate ammonia lyase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
411
structure length
411
Chain Sequence
b'MKIKQALFTAGYSSFYFDDQQAIKNGAGHDGFIYTGDPVTPGFTSVRQAGECVSVQLILENGAVAVGDCAAVQYSGAGGRDPLFLAEHFIPFLNDHIKPLLEGRDVDAFLPNARFFDKLRIDGNLLHTAVRYGLSQALLDATALASGRLKTEVVCDEWQLPCVPEAIPLFGQSGDDRYIAVDKMILKGVDVLPHALINNVEEKLGFKGEKLREYVRWLSDRILSLRSSPRYHPTLHIDVYGTIGLIFDMDPVRCAEYIASLEKEAQGLPLYIEGPVDAGNKPDQIRMLTAITKELTRLGSGVKIVADEWCNTYQDIVDFTDAGSCHMVQIKTPDLGGIHNIVDAVLYCNKHGMEAYQGGTCNETEISARTCVHVALAARPMRMLIKPGMGFDEGLNIVFNEMNRTIALLQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-METHYLASPARTATE AMMONIA-LYASE
molecule tags Lyase
source organism Citrobacter amalonaticus
publication title Insights into enzyme evolution revealed by the structure of methylaspartate ammonia lyase.
pubmed doi rcsb
total genus 154
structure length 411
sequence length 411
chains with identical sequence B
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2001-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
A PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1kkoA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1kkoA01
2OZTA 1KKRA 2P8BA 3UJ2A 4HCHA 3ZLHA 3PFRA 3DG7A 4HCDA 2PTZA 2PSNA 2PP1A 5FJOA 4FP1A 3DG3A 2QJNA 1P43A 1L8PA 1XS2A 3U4FA 3FJ4A 3NFUA 3MUCA 4DX3A 3PWIA 2AL1A 3GY1A 2PA6A 1JPMA 1OEPA 3BSMA 3SN4A 3I6TA 3MKCA 2AL2B 1SJCA 3RGTA 3ES7A 1R6WA 2QDEA 3EKGA 3D47A 4E6MA 4A6GA 1P48A 2PP3A 4EWJA 2PTWA 2QGYA 1XPYA 3DGBA 4JN8A 4HNLA 2GL5A 2OFJA 1ELSA 1EC9A 3FXGA 3STPA 3P0WA 3NZGA 2QJMA 4G7FA 4IP4A 3OW1A 4HPNA 4IL2A 5IDZA 2GGIA 4IT1A 4GYPC 3OZMA 3BJSA 3V4BA 2PPGA 3VA8A 2OX4A 3V3WA 3RO6A 1TE6A 2PTYA 4FI4A 3MQTA 3GO2A 2PS2A 4X2PA 2HZGA 3TJ4A 4E5TA 4MMWA 2P88A 3B97A 4J3ZA 7ENLA 3UJRA 3TJIA 1FHVA 2FKPA 2OVLA 2GDQA 1WUFA 2DW6A 3DIPA 3TOYA 2OZ8A 2PU0A 1E9IA 3IJQA 1JCTA 4Z17A 2ZC8A 2QDDA 2HXTA 2MUCA 1PDYA 3CT2A 1FHUA 1BKHA 4H2HA 1WUEA 3UGVA 3Q4DA 3TTEA 3QPEA 3FVDA 3T4WA 4Z1YA 3MY9A 3P3BA 3DFYA 5FJRA 4HCLA 4GGHA 2PCEA 3SQSA 1EC7A 2XGZA 2OPJA 3V5CA 1NU5A 3T6CA 4G8TA 1KD0A 2NQLA 4HN8A 3S5SA 1W6TA 2OO6A 5BOFA 1NELA 3OPSA 1JDFA 4GMEA 3UCCA 3H7VA 2OQHA 1EBGA 3DFHA 3T9PA 3U9IA 3TCSA 4A3RA 3H70A 4E8GA 3GC2A 3RITA 3OP2A 3NO1A 1MDRA 2AKZA 4GYPA 3BOXA 3MZNA 4M0XA 4HYRA 1DTNA 1MRAA 5FJUA 3SBFA 4KT2A 2MNRA 1SJDA 1MUCA 2O56A 4IHCA 3THUA 2PGEA 3D46A 3SSZA 1ECQA 3MSYA 1R0MA 3R1ZA 4GIRA 3CYJA 2XH2A 4K2SA 2OG9A 1IYXA 3RRAA 3ZVHB 3TW9A 3DERA 4E4FA 3T8QA 5FJPA 3TWBA 3OTRA 3ENLA 3VC6A 3FV9A 2OLAA 3DESA 4KWSA 5BOEA 1PDZA 2RDXA 3CK5A 1BQGA 3GD6A 3CAWA 3JVAA 3S47A 4JN7A 1KKOA 3ZVIA 3DEQA 3TWAA 4GFIA 4DN1A 4ROPA 3NXLA 2QJJA 2OKTA 2XSXA 3EEZA 4HNCA 3PK7A 3MWCA 4IZGA 5EU9A 2XH7A 3CB3A 4ZA0A 3CXOA 2FYMA 3QTPA 4K8GA 3OZYA 3K1GA 1KCZA 4JHMA 3IJIA 3H8AA 3VDGA 2OZ3A 4DXKA 3JW7A 1RVKA 2GGHA 1F9CA 2CHRA 2GGGA 3I6EA 1SJBA 1EC8A 1ONEA 3Q45A 4IL0A 4A35A 5ENLA 4E4UA 4ENLA 3UXLA 4KEMA 3N6JA 4H1ZA 4J1OA 4GISA 2QQ6A 3VCNA 1TKKA 3R10A 4DHGA 4K1WA 3UJSA 3I4KA 2AKMA 2AL2A 3UCDA 3VC5A 3TQPA 3ES8A 5J04A 1TZZA 4YWSA 1JPDX 2P3ZA 3H12A 3JZUA 1MDLA 2PU1A 3UJFA 4H83A 2DW7A 3FCPA 3SN1A 2QVHA 2OQYA 2PMQA 2PP0A 3V5FA 2GSHA 3FYYA 3R11A 3QN3A 3N4FA 4H19A 3VFCA 3IK4A 1SJAA 2P8CA 4DYEA 3ZLFA 3UXKA 2PTXA 3DDMA 4MGGA 3R25A 3R0KA 2P0IA 3KUMA 3P93A 4GGBA 4M6UA 5FJTA 3R0UA 3RCYA 3VCCA 2HXUA 3ZVHA 3DG6A 1YEYA 2PODA 2I5QA 4DWDA 2POZA 2PGWA 4ZCWA 2GGEA 4IP5A 4KPLA 3ZLGA 3PWGA 2HNEA 3RR1A 4MKSA 3UJEA 2XH0A 2ZADA 2ONEA 3SN0A 1EBHA 6ENLA 3N4EA 3QKEA 3N6HA 3QLDA 2GGJA 3HPFA 1MNSA 2XH4A 3IJLA 4F4RA 3SJNA
chains in the Genus database with same CATH superfamily
3K4AA 1MQRA 3LLXA 5I03A 2A3AA 2VD9A 1DIOA 1P0EA 1PXGA 1IHIA 1TWSA 2IKJA 2INZA 1K3UA 3TU9A 3NFUA 4AD2A 2PDIA 2WJZA 3NAVA 1WB0A 2E8ZA 3ORWA 2BZNA 4LAUA 4I5RA 3KEHA 2YAUA 3CZEA 3ZSSA 2IS7A 3E0FA 2HMCA 1XRSA 5FCZA 2HQMA 4WDTA 3L65A 1ZAJA 2OODA 5LNRA 2NXHA 3W28A 3WDRA 1TQJA 3VKBA 3GHSA 2C3CA 2EG8A 3F4WA 4EWND 3TE9A 1SR9A 4IP4A 2ALDA 3BG5A 1F73A 2PDXA 4NYUA 2FVLA 3BGAA 1GPWA 3V4BA 2PD5A 1IV8A 3B0XA 1XF0A 4REQA 4GVGA 4MB5A 3SIMA 1KM1A 3TW6A 1UIOA 4TVCA 3TA9A 4E5TA 1TV4A 3A64A 1JZ6A 3UJRA 4Y7EA 5A6BD 3NYZA 3TYEA 2HVMA 5I3KA 4XZWA 4QRNA 3HGOA 4IIDA 1XGZA 4O16A 2Y7EA 2GK1A 1LCOA 4XQ6A 2O9PA 1XV8A 1F5ZA 4UTWC 3GFYA 1XYMA 4DBDA 3DFSA 4QEHA 1IGSA 4JDBA 4XWUA 3KLKA 3WK3A 2CU0A 3VNDA 4CKQA 4HPXA 5K2ZA 1TA3A 2X8RA 3HA1A 3LHTA 1ZUAX 3UR2A 3MI6A 3MHUA 1A0DA 4J4KA 2EF9A 1JL8A 1SZRA 4WX2A 4NAEA 1OK4A 2OLSA 4IQLA 1KD0A 2WP6A 5CG0A 1CBGA 3TC6A 2ISWA 2W92A 5J8LA 4E2BA 3FG2P 3DUGA 1QK2A 3M7SA 3QFWA 4O13A 2PZ0A 2W62A 1XHCA 1FWFC 3ITVA 4L65A 3GC2A 2ABBA 5JH1A 1E6RA 1OVDA 3GTFA 1F8MA 3PZGA 5BW6A 1OFPA 2OLHA 3GC4A 1BPLB 4HYRA 1S5VA 4ORIA 5C9ZA 4IQDA 4HNOA 2QPXA 5AHNA 4TIMA 4UOJA 3PB2A 3PS7A 4AZCB 4CD6A 4FMVA 4PUNA 4DWSC 4HKPA 1UWIA 4NZJA 4QG9A 5G2HA 4ASTA 3OBEA 3N9RA 1JQVA 3LOTA 3RAOA 2V68A 4FF5A 2BB0A 2ZVIA 3W1PA 1UASA 4JR5A 3TFXA 3ANUA 5FJPA 2KAUC 3E02A 1U1HA 1WAWA 2VC9A 6XIAA 3I6RA 4DJFD 3ERPA 3DESA 1LJYA 3CK5A 1QBBA 1TRDA 2AMXA 2XSAA 4EP8C 1US3A 5F1UA 3U2CA 1ONRA 2R6OA 1QCWA 1QI5A 4ILSA 2X16A 3OGSA 1DV7A 4YN5A 3FAXA 1LORA 2D2GA 3WMBA 4GFIA 3BAYA 4HD5A 2IQDA 2PF0A 1ZAHA 3L4TA 4KRTA 4O19A 3H26A 2ZZ1A 4NUWA 3VKCA 3LCHA 3OHIA 2ZZBA 4DO4A 1MMFA 4AIEA 2OJPA 1Z9AA 3VGDA 1H41A 4EM3A 4W8AA 4LAZA 5I3HA 3NQEA 4QDMA 3ATYA 4YWOA 1GK8A 1TTIA 3S5OA 4H4SA 1JFXA 2VUYA 3U6WA 1VDVA 4F0LA 3VIPA 2WPFA 2PC4A 3FK4A 2DGAA 2CHRA 5TF0A 1HVXA 4RXFA 3LRLA 5BXSA 5BZAA 3RCMA 2TODA 4W9TA 2YW3A 1W3TA 2GSEA 4M81A 4ZQPA 3IANA 2FGLA 1M7OA 2WC7A 2QQ6A 4WUIA 1V3IA 5I3IA 4OV9A 3JS3A 4JYEA 4XIMA 4K1WA 3UJSA 4D8LA 5JCMA 1OBAA 4H7CA 1ZMCA 3MI3A 1DWJM 1JR1A 1XL9A 1TPDA 3OLGA 3SCTA 3SQMA 2VVSA 5D2TA 3EB4A 4X60A 3SCSA 4W7VA 1BXCA 4IIFA 1MDLA 2QCNA 1N8WA 4GFSA 3FCPA 5G4HC 3BAJA 1LOLA 2PI6A 2DT3A 4NI3A 3AXIA 5F2IA 3II4A 3PNUA 5HQMA 4HMDA 1SJAA 3RLGA 1BG4A 3OG3A 1TPFA 2WHJA 1R8LA 1V5XA 4CNNA 3WLLA 4MGGA 1CXIA 2IXVA 1QXLA 4EMIA 3R0UA 3V0TA 2WQPA 3A9IA 1XISA 4Y9OA 5JU6A 3VIOA 3QXBA 4TV6A 4LFYA 1W8SA 3KRSA 4KPLA 3PWGA 1XYZA 1UR8A 2ZADA 4PMDA 1S2UA 1W1IE 2W63A 2WSPA 3DJGX 1M7XA 4M6VA 1RUSA 2XH4A 4JX6A 1E4MM 4BFAA 1RJPA 1TYGA 1JRBA 2BC0A 3CEPA 4AG0A 2A4AA 2QUUA 1OD0A 3DG3A 2QCMA 1UROA 1H2IA 4Z2IA 1XX1A 4UQCA 4DJEA 2QCGA 1QNSA 3GNNA 2W61A 4GY0A 4ZMGA 3NA8A 1TX0A 4YJ5A 3SR7A 1TV5A 1OEPA 2ZXQA 5EMUA 3W87A 2V0TA 1TMHA 3M6DA 3RDKA 2A1YA 1R6WA 1B3OA 4HK7A 1N8IA 7CGTA 1ZBWA 4Z1AA 4H7VA 4D6EA 4FOJA 5DRCA 2VZTA 2LLEA 2YXGA 5LZLA 4KKXA 3PUGA 1JUBA 3CPRA 3WLQA 1UC4A 4IT1A 1K77A 2X2YA 5LNUA 2D3LA 4YWIA 3TSDA 4I3GA 1V7YA 3ANYA 2E1DA 1ZALA 1J2WA 1TE6A 3GG7A 4HTBA 1DWAM 3AU2A 2XIMA 4ROQA 3WQ8A 5LXEA 3P82A 2CERA 5EPDA 4YTQA 2PS2A 5TAOA 3W7QA 3C2EA 1QHOA 4ZSTA 7ENLA 2PF8A 1FHVA 4GQRA 3EDFA 4HA4A 1Z41A 4G2DA 4ZOAA 3L12A 1KC7A 2H8XA 4DEFA 1E6PA 1QAPA 3AS2A 2HXTA 1EDGA 4JOMA 1PDYA 3QW3A 4CCEA 2FJKA 4UTIA 3IJDA 3ZO9A 1C7TA 4U4MA 4JX5A 2A85A 5HUOA 2J9ZA 5REQB 3XISA 3S1UA 2BS9A 1ZS2A 1GHSA 1K6AA 2ZTJA 3UWUA 5T26A 3IUIA 4Y6GA 5G5GB 3KXQA 1WYGA 3PB0A 5GPRA 1AMKA 4DO7A 1UW9A 3QTGA 4HOZA 1LOSA 3SGGA 4KWOA 2D24A 4A8NA 4Z08A 4FPSA 2VD8A 3TQKA 1F8WA 4RW3A 2YVGA 2PWEA 1JDDA 1W3KA 3C0LA 4AVNA 4AWTA 3W7IA 4B3LA 1AA1B 1GORA 1W56A 4I9AA 1PCKA 3APYA 3BOXA 3WN6A 2JK6A 1CZ1A 3RPDA 2QIIA 3E9AA 4CN4A 1J0ZA 3H4GA 1M3UA 2XUCA 4KWVA 4B5NA 4KT2A 1TFVA 3I68A 1VFUA 2MNRA 2WOQA 3KBWA 3WBXA 1SJDA 3EOUA 4EOUA 3FEQA 3H53A 3SIZA 4PMNA 2NVKX 1ECQA 3U0HA 3G6LA 3T81A 3EDEA 3SCPA 4K2SA 1SFJA 1NTHA 5GNXA 3HJEA 5DT7A 4J3XA 3EUB3 3LA4A 1Q4NX 3VK5A 2OOGA 3KVKA 4JTKA 2HE5A 3N18A 5G2IA 1ZFJA 4FXSA 2OQLA 3CZ8A 3PG9A 3JVAA 4S23A 3UPBA 3ZVIA 3GH4A 4WQ6A 1O4UA 5HNRA 3GH7A 4N9CA 1H63A 5G1MA 2Z1VA 3WFZA 1FY6A 4AIBA 4D6GA 1V02E 1V0KA 1V3MA 4PEEA 4MLRA 4IZGA 3TTSA 2XH7A 4GI6A 2ZUUA 1B4KA 2A3HA 3UERA 3NPXA 4DB7A 4R3UA 1EJSC 3KBVA 3GBEA 2D0GA 4HHLA 1RJQA 2EBNA 4NAFB 3VDGA 3O6CA 3RMJA 1TPC1 4MDPA 1XDLA 1EC8A 2OT1A 1FXQA 4M19A 3RIKA 4I5XA 4YTTA 3PTDA 4H50A 4HN4A 5C9WA 5E9AA 3UT0A 4CCCA 3T2QA 5BROA 3E38A 3UXLA 1TIWA 4EM4A 1SVDA 3BCFA 4UFMA 4EPDC 1A5AA 3GXNA 3WLJA 1ZXIC 5A8GA 2WC4A 3DBPA 1V97A 5AZ0A 1F3TA 2D2HA 4QM1A 2W79A 5HATA 4S39A 2C1IA 3H12A 3QFEA 4I8DA 1LG2A 3G8RA 1US2A 4IPPA 1AH3A 1L2QA 1DEDA 3NQ6A 3C0SA 2ZX5A 2VX7A 1XD1A 2PURA 4UQEA 5FAJA 2PCQA 1H7OA 1THFD 3UZYA 3TNOA 4AX6A 3N4FA 3MCOA 1XIFA 3ZT7A 3AIVA 4HPHA 3CIVA 4U2ZA 1E73M 1ZGDA 1AD1A 2JBMA 5DLCA 3TW7A 1ZKQA 4IPIA 4M24A 4G9PA 2ATSA 3TN3A 2BLEA 2DIKA 1GTHA 1XKJA 2E9MA 3W7NA 3KX6A 4IP5A 3COTA 1KR0A 1KTCA 5C9XA 2WJEA 4H4PA 2XH0A 4JQ3A 3UEQA 1O60A 3N6HA 4Y2WA 4DLFA 3IJLA 1WXYA 4E38A 1ZJBA 3B04A 3MSGA 2Y1HA 2ZRZA 3S2JA 1UD6A 4GNJA 4QITA 5HANA 3S6TA 3TYCA 1U22A 1ZCOA 3B05A 4CQ8A 5D03A 4NJKA 3QMTA 1XCXA 3SEPA 2FTYA 1KM2A 3AU6A 4B5UA 1CCWB 1WDPA 2XM1A 3I7RA 1RBAA 5MF5A 1POJA 1GOKA 1ICPA 2X1SA 5C2CA 3EKGA 2F6UA 1IXPA 3FDGA 4F66A 1NIUA 1JRCA 3CZLA 5JCIA 2L5HA 3BXWA 1AJZA 1SW7A 5KTLA 2XN0A 3EWYA 2BOGX 4KCTA 3GU9A 2YFOA 1NHSA 2QJMA 5IBXA 1EWDA 2RJHA 5G4EA 3O6YX 4LOCA 3AYVA 3VOJA 2I16A 5TNVA 3V35A 2V2CA 2JEQA 3VD4A 4X22A 2BHUA 3AIQA 4GYPC 1RLCL 4LW7A 5JCLA 4ZBCA 4IWWA 1AL8A 4BF5A 5M2FX 1B3YA 4JN6A 4S1FA 2WP5A 3K8MA 1BVWA 2AQOA 3CO8A 4DJDA 3F5LA 2YR1A 2P88A 4LNCA 3EAUA 4MVAA 1R9ZA 3LCFA 4IJRA 3S1VA 2YCIX 3IJQA 1H1YA 4RNIA 2NWRA 2GFTA 1GPFA 1QPRA 3WMLA 1BVNP 1IT8A 4FLRA 3UZZA 4FO4A 1H1NA 4BF9A 8XIMA 4OOZA 3LI0A 3BGGA 1A5KC 3GTNA 4YVPA 2RAGA 2PEVA 3M5ZA 1OFQA 4BY3A 3ZIZA 3N14A 3C0JA 5EGRA 2P53A 3UG3A 4H4UA 1MZHA 4C6QA 3G24A 4XG1A 3T4WA 3L5MA 4ZR8A 1ODZA 4TQTA 2VWTA 1RK5A 1JCNA 5ABEA 1W2PA 3F4NA 3E12A 5JCKA 5E6ZA 4LT9A 4DF0A 1AOGA 4FNTA 3CQKA 4LALA 3G0UA 1XH1A 1PIGA 4HZ8A 5HMEA 2X99A 3T6CA 4ZTXA 1LBLA 3GNOA 3VPLA 4GKTA 1NELA 3M6YA 1FXPA 3QQWA 3MMWA 1VYRA 3TJLA 1JI1A 3NG3A 1KBKA 3OODA 1G4EA 4I90A 4LRSA 1HKWA 4GXMA 2Y5JA 2F5ZA 4CVWA 3BQ6A 3MZNA 1XLHA 3HJZA 4UMAA 2AGKA 4Z2HA 4H9UA 4QJ1A 1E1FA 3KHDA 3P61A 4IISA 3BW3A 4HNUA 2J9XA 3NL6A 1MEWA 4MFDA 3I4EA 4XAGA 5SWUA 4DZIA 1DHPA 2G3IA 3D46A 2E40A 4E8DA 4H4ZA 1O66A 3SSZA 3PWAA 4D6DA 2X8CA 2J8FA 2JIWA 3PC0A 4FLSA 2GQ8A 3R1ZA 4L9ZA 3H4KA 4UOQA 4AY7A 5LA2A 3TNBA 1XGDA 5I3JA 4FLQA 1ML1A 1AK5A 4W5UA 5EMJA 4P8UA 1NWTA 4GXWA 1VBRA 4OBRA 5EBUA 3CJPA 1HN1A 4WKFA 1EJVC 1OFEA 4KS0A 1L9WA 3GXFA 3LBMA 4W8BA 1SFLA 4V2XA 5D30A 1EYEA 3VNIA 1CXLA 1IIHA 3H6OA 3GG8A 3S5ZA 3HQPA 4O18A 2OO0A 1PX3A 9XIMA 3WNOA 3PBUA 1KFKA 3W86A 3R89A 2AAQA 3AMDA 5CC6A 2QJJA 5KETA 4QTGA 4LV9A 3GXPA 4BA0A 1J79A 3ATZA 3SCQA 4IX2A 3W7HA 3WO8A 1D3GA 2VVNA 4LUIA 3CB3A 3CXOA 1QVBA 4LF1A 4B5TA 3PJUA 5GJNA 5HPCA 3QTPA 1F8IA 3S9IA 4L9YA 2AGTA 1CYGA 2WK2A 1PVNA 4FNRA 4JHMA 3XIMA 2CBUA 2I1OA 4TO8A 3OLIA 2YL5A 4ZB5A 4E0CA 3W73A 3A3WA 4JIRA 4Y96A 1EIXA 3FYPA 4PFMA 1HP4A 1L6WA 3PZUA 5BRPA 4XX6A 3OLEA 3E0IA 1E70M 1R3RA 3EXRA 2CNCA 1VQZA 5DQPA 3GXMA 2CLKA 3WDQA 1WCGA 1DE5A 3M0YA 5GNZA 4F9DA 1EYWA 1OGGA 1XLJA 3GKAA 4H1ZA 1K4HA 1YTEA 4RNFA 2CPUA 4J1OA 1PTGA 4HK5A 5CKSA 1XLDA 3NQ8A 2G3MA 2X1RA 1NQ6A 5AC5A 1GSNA 3CV6A 2F6XA 2DUZA 3N3TA 2WNWA 3R10A 3BCDA 3R43A 3LCIA 3W7LA 4MWAE 4O8RA 4EXAA 2WVTA 4M6QA 2OWCA 4WIWA 3TQPA 1P6CA 4D71A 3L5OA 1LLOA 5I00A 4JFTA 1TZZA 3LTPA 7A3HA 1EX5A 4Q8QA 3T05A 1S39A 4RE2A 4H83A 3REQA 1OZQA 3ABXA 4YHEA 4C6PA 2E5AA 1GERA 1H60A 1HQTA 3AMZA 4AU0A 4Y8FA 3C8NA 4KWUA 3V5FA 1T5AA 5D9MA 2GJPA 3P5ZA 4O14A 1ESWA 3IK4A 1XUUA 5CJNA 1N55A 5IOBA 3ZLFA 2VGBA 3VIHA 2DZAA 4C6KA 4H00A 3BJTA 3QV8A 5CH9A 3TZNA 1J5TA 2W0UA 2A3CA 2Y7DA 4K7VA 4R33A 2Y7FA 1TTQA 4GH3A 3W3OA 3VIMA 2D0FA 2PWDA 3C2RA 1VBGA 1FWCC 4AZ5A 3POCA 3SGUA 1FTXA 3AROA 3U57A 1PKYA 4OKDA 4DF2A 1XRVA 3RM4A 2QF7A 1EB3A 3HV8A 3UWQA 1OWQA 1EL3A 4FOKA 5FA5A 1S38A 1TR1A 1E3XA 4FLOA 4A3YA 3G3DA 3OGVA 1U30A 1UR1A 1UP2A 4FHAA 5CPSA 2WHLA 4UIOA 1YDVA 3W6MA 4CD8A 5AYIA 3RU8X 1KW1A 3N19B 1XIHA 1Y5WA 3O6DA 4DUVA 2WYSA 2X7WA 4M1RA 1W37A 4FF7A 4QCFA 1W8GA 4F40A 2GR0A 2AL1A 4NF7A 1ZLPA 3KLJA 2XVNA 1E9LA 2XFWA 3L68A 4MOZA 1VIWA 4Q3MA 2ZRXA 1UH4A 1UKTA 4KIRA 1J0HA 3WQOA 2AQWA 3AO0A 3EOLA 5J5RA 1P48A 4ZB2A 6CGTA 3MI2A 1IEVA 1GW9A 2QGYA 1ZTVA 1UWAA 4HNLA 4RDVA 1YLVA 2Y0FA 4S3AA 4JTGA 4RK8A 2FPVA 3P8IA 3F03K 4QLJA 2VFDA 5AOUA 4OBTA 1JZ7A 2WHMA 2DZSA 1HUVA 3G1DA 2WVVA 1GYNA 3E2QA 3CO4A 1P7TB 2PDHA 2F8QA 2OX4A 3OHMB 4HYVA 2E25A 3QV9A 1P6BA 1QNOA 2CBJA 2QGHA 2PTYA 4FI4A 1HJSA 3GO2A 3TJ4A 3PZTA 2V6AA 4NT0A 3SUSA 4HNNA 5AHLA 2CXEA 1E4LA 4GA8A 3B8SA 1TMLA 2OZ8A 4AY8A 4YXGA 4FDCB 5LNVA 4FXFA 3I65A 4HHHA 4PBFA 3STFA 4LEFA 1KFCA 2GUBA 3RNMA 1G7VA 3E2RA 3HRDC 1EOKA 4MLJA 3CS2A 1C8QA 3FIGA 4N2YA 2FQIA 1GG1A 4N7QA 3N2MA 4LQ1A 4W5ZA 3IGHX 1TTPA 2E5CA 5T91A 1CXHA 3MY9A 1SFTA 1BTMA 3DFYA 3N4AA 1FDJA 3MV01 1BWVA 4IM4A 2CYGA 3V75A 2NQZA 3V1PA 3PHAA 1BHGA 2YFNA 4PYSA 1HJQA 4H9XA 4ECLA 1SW0A 2ZQ0A 1AQFA 1OX4B 4V28A 3F4VA 4GG9A 3ID7A 1C9WA 4MJMA 1LDCA 1PE1A 5D2XA 3SECA 5C70A 3WYZA 3CM4A 3C3NA 4LY4A 4LC6A 2CBVA 3E3HA 3HGSA 5HA7A 4C5YA 1F6YA 1CGWA 3O6AA 2WLZA 4OTKA 5M5DA 3H2AA 2XIJA 4Q4KA 1NWSA 1TUFA 1HZYA 2C79A 2WXDM 4IIBA 2DZWA 1WOAA 3WBYA 3AHZA 1OZMA 4O0QA 3LMYA 4IHCA 1PV8A 1Q2RA 1B90A 1RH9A 2IUZA 2BOEX 5A6KA 3LMZA 1SUXA 4GIRA 3CIWA 4R34A 3UY8A 3LU2A 3W7DA 1R7AA 4JIPA 2RGLA 2WWCA 2NX1A 3BOFA 3CZJA 3M7WA 3C2FA 1YDNA 3PJXA 4QR6A 3OTRA 5D33A 1L6GA 3ARTA 2NW0A 3H54A 4CEUC 3RMEA 3A4JA 6REQB 2BXVA 1G4TA 3GD6A 3WBEA 4UQDA 1A5LC 2ZXBA 2GJRA 1Q6OA 2WBAA 3BG3A 1Q5MA 1Q6FA 3RRXA 3EX2A 3LPGA 1UZHA 1CXEA 4OGZA 4L80A 5HPOA 2WB5A 1W1B1 2IPJA 1C9DA 3SUUA 1TTJA 4DJFC 3QHOA 4QCEA 1F7BA 4X0NA 1OYAA 3R8HA 1Q3NA 4DXVA 1NDAA 5CGTA 5D2YA 1S5MA 4JQ1A 1VFSA 3LM3A 4LCSA 4K8GA 4O1DA 4I6KA 3RPTA 5E0CA 1KCZA 3CHFA 4JIHA 2PDMA 1XKYA 1DL3A 4Q8OA 4DJEC 2H9AB 3GAYA 3W7OA 2DT2A 3WD3A 4LS1A 4EIVA 4CU6A 4GI4A 1SJBA 3LV5A 4ACYA 2TYSA 1GRBA 3N29A 3W7RA 3P5YA 1V08A 1FH9A 1OIFA 3GNPA 2NUYA 3VIIA 5BWFA 3KRBA 3N1AA 1GOXA 4Q22A 3QH2A 4EF8A 1E6XM 4Q8PA 1UOZA 3BLFA 1QNRA 3IV3A 1F3EA 3DK8A 1T7LA 2BXZA 3LBOA 3MSRA 2XIOA 5A2BA 3GYEA 5K4ZA 2CZFA 3ES8A 4UQ9A 5AYYA 3BWWA 2V5KA 7TIMA 2BFGA 3OG2A 1B57A 3S8HA 4WOQA 4IMDA 5I3GA 5A6AA 4W84A 3QPYA 3GUGA 1W54A 4PA8A 1O1ZA 2PMQA 2PP0A 5CPNA 5CZTA 3BAWA 3RLHA 4HJWA 1JDEA 5FL1A 1EZWA 5JIPA 2H8ZA 5EFDA 1XLAA 4W85A 3C8FA 2G8ZA 4AMCA 1JCXA 3FN9A 2GVYA 4NQ1A 3W1LA 4GX9A 1EEXA 1G01A 3QOKA 2X1TA 2I7GA 2IPWA 1JPHA 1E0XA 5F4SA 5JQ9A 3B9OA 2YL9A 4A8LA 1PAMA 4DJED 1UA7A 2PGWA 1Q65A 1KR1A 1YXCA 5H1WA 1Q6RA 3U4AA 3UD6A 3GR7A 5K9CA 1DXLA 3QKEA 5E9XA 3K46A 2DIJA 3BMXA 1JF5A 1ME7A 4NP7A 2V3FA 4CNTA 3UJ2A 1J9YA 4RZBA 5DFAA 7TAAA 3F4DA 1A0CA 5GNYA 4ICNA 1OX4A 2HROA 4AEFA 5DMNA 4HT3A 3BPWA 1XS2A 3U4FA 1X6LA 2J88A 4AW7A 3GY1A 4H7ZA 1TV7A 4P7OA 1GVIA 1HO1A 1UD8A 3A4AA 2G4JA 1H09A 3IJ8A 1OCBA 3B3DA 3EX4A 3PVFA 3PZNA 3UW6A 4JNYA 1XDIA 1Q8AA 2J4GA 2TAAA 7ODCA 5C9UA 4FXJA 3WQDA 2IMRA 3NURA 1XLMA 2XVKA 1KA9F 3GKFA 4WY0A 1CTNA 3GW3A 4H41A 1BRLB 3A13A 1F4HA 1TPUA 1WKYA 4MNKA 1SW3A 1Z44A 1K8CA 3EWCA 1G94A 1M9HA 5TQLA 1F6KA 3RO6A 4TUFA 3BLLA 3TJXA 2DT0A 4DNHA 2GVJA 4QE1A 2VGGA 3DKJA 1POKA 3EOSA 4Z2JA 3DFOA 4X2PA 4NXKA 3OIHA 4XD5A 1X97A 1JI2A 3M47A 3ABRA 3WLNA 1QPNA 2OVLA 4YNGA 4MAVA 2NUXA 1N61C 4RDYA 4LANA 1OT2A 3DIPA 2PDBA 1OCJA 1E9IA 4KF1A 2BCPA 3VKKA 2P0OA 1OD8A 1XFCA 2ZC8A 3CZKA 2QW5A 1FWHC 1DORA 3GTIA 1YPXA 4FIQA 1QW8A 4GVIA 3VGBA 1MXGA 3BV4A 2W9MA 4UNIA 2Y63A 1N2VA 3QPEA 2CEQA 3MWAA 2REQB 1VFTA 5H2ZA 3W29A 5DMMA 2ZOXA 1J11A 3DU0A 3LGDA 1OQFA 4Q4OA 3IJ9A 3HF3A 1TWDA 1XLBA 3S3GA 1IZJA 2PWHA 4BK9A 2VKZG 2WSYA 2XGZA 4O12A 3V5CA 1GVYA 4J35A 5KZ6A 4R9OA 2BVYA 2YPIA 3EMZA 4RJEA 4OE7A 3HV9A 3DBNA 1VBHA 3M44A 4M3PA 1A5BA 2YZRA 3RFAA 2CLEA 5EBAA 1CPUA 2PRMA 3H70A 2POTA 2YL8A 4IIGA 2ZVRA 3OP2A 4PB4A 1MDRA 1YE6A 2AKZA 4GYPA 4M0XA 3N17A 1MW3A 5FJUA 3SBFA 3S1GA 2PLKA 4MPKA 3AWOA 2Q8LA 1JDAA 5HAOA 4DZ5A 3Q58A 4ZQRA 1Q1RA 1GVFA 4JHZA 1ITXA 3VX1A 1V6XA 3G5EA 3H23A 3TQ0A 3CBWA 3S1WA 3WCZA 3NGJA 3G2GA 3ITLA 3CAKA 3TC3A 2VOMA 3NZ1A 2V63A 2ALRA 3ITXA 4W86A 2NSOA 2UV8G 3DERA 1XBYA 3T8QA 4GBDA 1PPIA 4QJ3B 4XSLA 3LTYA 3DFTA 2QCEA 3GD4A 2R82A 2Z00A 1XANA 1WE5A 2ACQA 1UR0A 3FSUA 3L66A 3L67A 5CZKA 3WL1A 3CAWA 3CWOX 1KKOA 2YA2A 2O55A 2E6FA 3AICA 2GZXA 1TX2A 1FWAC 2WHKA 4W7WA 1ITQA 4F0HA 2QUTA 5AFDA 5C2GA 3B9EA 4JKLA 4PUJA 3QV6A 3DENA 1UR9A 4ATWA 4PUMA 2J24A 4HNCA 1EFZA 2CWNA 1KFBA 2CXGA 1HP5A 2A2IA 2EKGA 2ZZCA 2G95A 4CEXC 5HWMA 1XIGA 3WNNA 6ALDA 4DYJA 2EQDA 2NZLA 3CUJA 2CBIA 3KOFA 2YCJA 2GJXA 3BMVA 3WY1A 4B90A 1XSKA 5LXXA 1XQLA 3QZ6A 4IMGA 5I24A 3GYCA 2J13A 3IJ7A 1V3JA 5I6SA 3NDOA 4D6JA 1DXEA 4O0KA 4O57A 3V16A 3NQ7A 5HXMA 4IL0A 4HNVA 3QW4B 2ZIDA 1L6YA 1KXHA 1HJVA 3CMJA 1HVQA 4CD7A 3LTSA 4PEKA 4EANA 1QOXA 3L0KA 1S2WA 1M5WA 3IC9A 4CQAA 1KRAC 4YYCA 1FWRA 1B3XA 1HGYA 3UZWA 5HQLA 4D2JA 3OO2A 1JUKA 2QMJA 2YBVA 3K5XA 4TVUA 1XYLA 3ICJA 5DXXA 3WQFA 3RXZA 4GRSA 3USBA 2NVCA 1QNQA 2NPXA 4YLWA 1FOBA 4E3TA 1AQHA 2PU1A 4A22A 3W38A 1CI1A 2PBOA 4TVDA 2ZZ5A 3A4XA 2JIEA 4QG8A 3DHUA 3GZAA 2HRWA 4GR1A 4X63A 2OQYA 2GOUA 2QMKA 3V0SA 4DVOA 2FIQA 2ZRUA 4HMEA 1YPFA 3GXTA 2JKEA 4YHGA 4D6IA 3ALGA 3O07A 5HMSA 4DYEA 3UXKA 1V0NA 2DZTA 2PTXA 4H9ZA 2CLMA 3FJ6A 1FP8A 2HPIA 1XLGA 1XM3A 3V18A 4BQ2A 4C6MA 3I3EA 2DV0A 4Q6JA 3KTSA 1QI3A 3P62A 1K7XA 1K9TA 1YYAA 3M0LA 2Z7KA 2J7EA 3ABQA 1DQXA 4FNQA 2YSWA 3W7GA 1ZBCA 1MXSA 1XBZA 9RUBA 1I0DA 1VPQA 2A6LA 5DBUA 4QLLA 5ABTA 2CLOA 2VL4A 3L21A 1WKFA 4GACA 4TMCA 3CWHA 1V51A 3LLDA 3UCQA 2RDTA 1G0CA 4LUSA 5FEPA 4HCDA 4FX6M 3QR0A 4WD0A 2J74A 3GVVA 3WQVA 1JJKA 5LGXA 2HTMA 1P43A 3KCOA 1H4PA 1BWCA 4H4TA 1WZAA 3MUCA 2FDSA 4Z0SA 5A8QA 4DI8A 1Y65A 1F4AA 2GK1B 1A5NC 1VEPA 2OX1A 3N9SA 4LUJA 4L5ZA 1XLFA 1GQNA 3RM9A 5A6JA 4IG2B 4N42A 1J8VA 4MFEA 1RVGA 2ESCA 2PP3A 2PTWA 1EEPA 2GDUA 2J7BA 2BP1A 1Q6CA 4GUHA 1FWIC 2VFFA 4ADTA 4JTTA 1J12A 3G18A 1OGSA 4XZIA 1FHLA 3BO9A 1GEUA 5FOOA 3OW1A 3WF4A 3GUWA 1MOKA 1DP0A 4U28A 1R47A 1FX6A 1YE4A 1L8NA 1S2VA 1QUMA 1OJXA 2NSXA 3PAJA 2C13A 3W83A 1W31A 3EX6A 1OFAA 5K9XA 4C1KA 2GSJA 1EOMA 2XZ7A 4PMRA 4BQ5A 4J56A 5EB8A 2H3DA 5E09A 5FS6A 4LYRA 1NAL1 3VX0A 4PCNA 4NX5A 1OJTA 3PNZA 3OA3A 1LVLA 1KGXA 1RK6A 2GVGA 2X41A 2VDHA 4L6OA 4S3DA 1IZKA 3SUVA 2RH9A 1GQKA 5A8NA 4AF0A 3B4UA 4XISA 2OMAA 2MUCA 2EG7A 4ZODA 1TREA 4F79A 3ZWTA 2QIWA 3DC0A 4UTUA 3UGVA 1REQA 2F6KA 4L9XA 1KBLA 3ZSTA 3FY1A 1QJWA 4UXDA 4IFOA 2CESA 3EWDA 4KQNA 5AC6A 2FPYA 1UWQA 1O5XA 3C0QA 1SQ7A 2PCEA 4WLCA 4CU8A 2CIPA 3UPMA 4MNMA 1NFGA 2DVXA 3UXDA 2A3LA 2J6VA 3ZMRA 1NDWA 1NH6A 1MO9A 1YTKA 4GJ1A 2DSWA 2EPMX 4CVUA 1EBDA 4IPJA 2F38A 4NNCA 1KQZA 1O94A 3BSGA 1K6WA 2E1WA 5JBEA 1Q8JA 1E15A 4AWEA 2PWFA 1ISZA 3QZEA 4GI8A 1I2QA 1M6JA 2CHNA 4AZBA 3B40A 3HGJA 5C9RA 1NDYA 5BU9A 3ETRB 4XAZA 4GNKB 3WFLA 1UG6A 4JQ2A 3UG4A 2WOWA 3W2NA 3DGRA 4H2CA 5EFFA 4HU8A 1KO0A 5BMWA 1CENA 2J79A 4C6CA 8RUCA 3HIJA 3W7MA 2XH2A 4Q4MA 1Z48A 2VCCA 1KFEA 3QVQA 4TR9A 1PYFA 3L0GA 4LY8A 3NOYA 4ZQMA 3EWZA 1EF3A 1KBJA 3MUXA 2VEIA 3NSNA 1UR2A 3GDKA 2TSYA 4GBUA 1E5JA 1T40A 4JDYA 5ECUA 4BURA 2ZTKA 2R1MA 4KWSA 1VF8A 1BAGA 1ALDA 3EDJA 3MKVA 2DZVA 1R2SA 3AXHA 4DYKA 2FFIA 2BX7A 3PFMA 3ABSA 3USZA 3BZJA 1XYAA 1DQUA 3R5EA 2IQ0A 3LNPA 3M1ZA 5ABGA 2IKIA 4PCFA 1KM5A 2Q01A 4IF2A 2ZYFA 2ACRA 2YBUA 5LHEA 2VC7A 3UF9A 1YKWA 3DFQA 2INEA 4BI7A 2FYMA 2WSKA 3KLLA 3MBDA 4RPPA 4D9PA 1OY0A 3OZYA 3ZZ1A 5A69A 3TN6A 2HBXA 4S3KA 1RA0A 4PTWA 4ADWA 3MT1A 2G96A 4BKNA 3CQIA 1N82A 2AAMA 5BU6A 1LL7A 2D0HA 3GE7A 3C2YA 2OYKA 3UWEA 1TWZA 4UFJA 1FKWA 1OX5A 3Q45A 4H8HA 5D02A 4XD3A 3LYEA 1ADDA 4EK7A 3M0KA 3W81A 3KZSA 2DSZA 2QUNA 1AJ0A 2PDLA 3T0CA 5D32A 1XCWA 1B30A 4HHPA 3R0DA 1TKKA 3SUTA 1GG0A 1X7IA 1E51A 3HTWA 2WLYA 2OEMA 2AL2A 2ACSA 1Y8BA 5LKYA 2OU4A 1K4QA 3Q37A 5HMFA 5G5HB 1JYWA 3FEMA 1A5CA 1DHKA 1VFFA 1Q6QA 1JPDX 4S3FA 1P4CA 4P8XA 3MYOA 3TN5A 2V2HA 1UUQA 1OFRA 1LT8A 3R13A 4BQ3A 3PF3A 1PKMA 3DYMA 2DW7A 3AM9A 4ZO8A 4MF4A 4LUTB 2ZXAA 4A8IA 3WLHA 1W1ZA 1V4YA 2P8CA 2NQ5A 1XYFA 3G1HA 3IWPA 4PZVA 4B2DA 1UHVA 1DWIM 3DI1A 4OUEA 1S2TA 2DUAA 3P93A 2CETA 3NVTA 3E5BA 4AZCA 1SZNA 1EXBA 2TPSA 5AN7A 4OBSA 1TZ9A 1R3QA 3VGFA 3W70A 3NSMA 2GGEA 4MG4A 2H3BA 1X8CA 3A47A 3SN0A 2WPGA 4PCPA 6ENLA 2DY3A 1JFHA 4WGHA 4GNVA 2Z29A 8CGTA 4F4RA 3SJNA 3CIXA 4AD1A 3KL5A 1FDZA 4HCHA 1YIXA 1Q6GA 2G97A 4BHYA 1XUZA 3ZJ7A 4UZSA 5FJOA 1NP0A 1ECEA 2X0SA 4CQCA 3TYUA 1L8PA 3K2GA 3DC8A 3E2SA 2Y8VA 2DJLA 1NFBA 1FHDA 1MZRA 2VDGA 2UY4A 3EX1A 2PA6A 3H22A 4ZGYA 1P7TA 3SN4A 3GDMA 1PL9A 1XIDA 4JFWA 3RGTA 1F07A 1TJRA 1FFQA 3SM0A 3V7PA 1ISWA 3HPSA 2XFFA 4HZ6A 5JBDA 3IK2A 4IICA 3YPIA 1W1YA 3DGBA 1Q66A 3L4ZA 1IXOA 3P8JA 5T8GA 2E6DA 1ISVA 1QOQA 1LWJA 1Z32X 3P0WA 5C6MA 1MXDA 4NKCA 1V6VA 2WMFA 2ZUSA 3VD9A 4IPNB 1R87A 3FHQA 2WNQA 3WUFA 5IDZA 1YNPA 3PPCA 1GKQA 1XRTA 2BGSA 3EEGA 1BLIA 2P3EA 2PPGA 1WBJA 1VYSX 3C56A 3APTA 4JY8A 3OEXA 1L6FA 3CU2A 4O4VA 5LIYX 3CUHA 3WKZA 1KFWA 1FUYA 4LSBA 4PBEA 2GDQA 1NM9A 4GY7A 3NQ2A 2Z24A 1W5PA 3MJMA 4FALA 1LLZA 4RKAA 2VR2A 3ELFA 3B9JB 1EZ2A 1TJ1A 1MFUA 4JY9A 1ME8A 4NZ3A 1K7FA 1WDWA 3NQAA 3PANA 4AD5A 3AIEA 3WLTA 1DIEA 1RBOB 3AC0A 3ARRA 1W32A 3NQVA 3MJYA 3M0XA 3UY7A 3AMLA 3UNTA 1TV8A 2PAJA 1MEIA 3WJWA 2XN1A 1F6PA 1U1JA 1TVNA 2FTWA 2P5NA 5FJRA 2Z6JA 1H5YA 4N4QA 4GGHA 3SQSA 1WNOA 1B1YA 3T07A 1C93A 3VOGA 2E6YA 4QP0A 3ARWA 4GX8A 3HURA 1WX0A 3K4DA 3RF9A 1EX1A 4RE0A 3BW4A 4RE4A 5BOFA 2P50A 4TX9A 3TROA 1B4EA 2R14A 1I60A 1GVSA 3CV7A 3TTOA 3IARA 3FJNA 1VEOA 4DBSA 4MJZA 1RAKA 1YNYA 2OQHA 1IEWA 3R6IA 1R3WA 1AODA 1IEXA 2Q3RA 3KOYA 2XHYA 3M43A 1N62C 4I6VA 4S2BA 3C2OA 1E0UA 3ZYZA 4Z1DA 1FCVA 2Z2UA 3TR9A 2O9TA 2GUUA 3QYQA 1MRAA 3W02A 2QZRA 1BD0A 1CB2A 1PKNA 3UWVA 1FIQB 3TEVA 3HQ1A 1V0MA 1GESA 4NNBA 1F3WA 3L4XA 2FGBA 2DP3A 3N2CA 4DXXA 5CPTA 3QMRA 1E9ZB 3UVIA 1W9XA 4ZSUA 1X2GA 3M0MA 2JK2A 5E0KA 3RUBL 3KFTA 1GONA 2W66A 2C1GA 4RDWA 1C8XA 2CKSA 1EF2A 3W00A 1BWLA 5C0QA 1GJWA 1HL9A 5BYWA 3VNJA 3WH7A 1GZGA 1RR2A 3AXMA 3BTNA 3NL3A 4B16A 3PM6A 3MDUA 3FV9A 1GOIA 4AISA 2XIIA 5DY3A 4D8ZA 4H9VA 3H24A 3WDIA 1BQGA 3NDYA 5KZEA 4DZAA 3EXTA 5BRQA 1FP9A 4IIHA 3U48A 3UFYA 3VILA 3RJXA 3W9ZA 1EP2A 2ISFA 3NXLA 3ZR4A 3LQLA 3IJ6A 4NJHA 2WBGA 4XBJA 5G5IA 3DXIA 1QNVA 3WNKA 1OF6A 4XAPA 3WX7A 3UPWA 3SZ8A 3EWXA 3GHUA 4DJFA 3NL2A 2BMBA 3B03A 3UG5A 2O4QA 1U5JA 5A3HA 1PIFA 2VGFA 3ISIX 4Y9PA 3WQ5A 2V82A 3AWNA 4LVGA 1W9DM 2YB1A 3EWBX 4UC5A 1FCQA 3CGBA 2YVFA 4HA3A 2WKJA 1F9CA 1ONEA 3F2BA 1OC7A 3VOCA 3GG0A 1J0IA 2H90A 3W6YA 3PTMA 3PG6A 1JIBA 4GIYA 1H2JA 8A3HA 2ZKMX 1DKWA 3KE0A 1IR1A 3CV2A 3WDHA 1UKOA 3CTTA 3GWQA 1Z8AA 3SCVA 3I4KA 1XCFA 3NL5A 2PWGA 4XIAA 5KZMA 1HG3A 1Z3NA 4IXHA 3T2OA 3VAVA 3PZOA 4CNPA 5D2WA 3BAXA 3CL6A 3N2BA 2BSLA 3CNYA 1TVPA 3BW2A 4DUWA 3I3BA 3WQWA 3B8IA 2EPOA 4PH6A 4W7UA 2WMKA 4ZO6A 3UR8A 3DH7A 4HBKA 4JTAA 3I3DA 3H4WA 1NSJA 1KRBC 1ZP4A 3UJFA 4R27A 1FEAA 1AL7A 4Y9AA 3NQCA 3KTCA 3L2IA 2OYLA 3W7KA 1RXOB 4GY1A 4L6HA 5U4NA 3PPHA 4EX4A 3CL8A 1JPKA 1PJ9A 4M29A 5DCDA 5C7VA 4PTDA 1JEHA 3M5YA 3ECQA 3PSWA 5CC3A 2BY1A 3KUMA 4XB3A 2BC1A 1O68A 4XKYB 4B91A 2ZX9A 1O7AA 3VCCA 4UNKA 1LQAA 1WDSA 2EJAA 1G6CA 4HVXA 1E0WA 2QKFA 3K8KA 1G69A 3WUBA 2Y89A 1CWYA 1HX0A 3QR3A 3R8GA 4L6DA 3N4EA 2WCSA 2JQXA 3B0UX 4UTKA 3HPFA 1TV3A 1IIGA 1PSCA 2H6RA 3NWRA 3UR7A 4KFOA 1PHWA 4PUDA 3SY5A 2XU2A 4C7GA 3AIRA 1UR3M 3VKDA 3VIJA 5HNUA 3AXXA 3SCWA 2E9LA 1EWEA 1OADA 4MB1A 5AC4A 5XINA 1M68A 2QAFA 4LEQA 2OZ0A 3VINA 4C1NA 1X6UA 1RQHA 4MKVA 4DUOA 3GM8A 5K4XA 3HB9A 7REQA 3ZOAA 3O0HA 3MKCA 4O15A 4JKKA 1FECA 4IXXA 2BVTA 1F76A 3G1SA 4AY1A 1V79A 1W17A 4A6GA 1M04A 3EA2A 1J6OA 4XUGA 4GIEA 2GL5A 2V3EA 1ELSA 3TXVA 3SADA 3TSMA 4IJCA 5TD4A 2HS6A 4ICMA 4EXBA 4M56A 3ZT6A 3BZGA 4NG3A 4HPNA 4QHRA 5FEXA 3S6DA 2W3RA 2DZXA 3CB8A 4S3JA 2Y2WA 1GQJA 1OG0A 4M7TA 4P2VA 3BJSA 4DWSD 1O95A 4AXKA 4C91A 3EA3A 3MUZ1 4XD4A 2I9EA 3KW3A 2FZDA 3S0CA 1YX1A 2V3AA 3A3HA 4GYKA 4WEVX 1R9YA 2SFPA 3G1VA 3M16A 1PB0A 3N04A 4FAMA 3NQGA 1PS9A 2QXWA 4XD6A 2FKPA 5FF3A 3L4UA 1WBHA 5FESA 2C15A 3R79A 2BY2A 4ZFCA 2F9RA 1R5YA 1F74A 2YLLA 1MQQA 4Z0JA 4P5UA 4KCWA 4XV0A 3AI0A 1UUOA 2E4TA 1PX8A 3VE9A 2FHBA 5A8MA 3DJJA 2FB3A 3WQGA 3WL0A 1K02A 1DBTA 2R9ZA 4R88A 3PN8A 3OBKA 2GJLA 3THDA 1E6NA 2PDGA 4US5D 3TUUA 2W3ZA 3TX9A 1TSIA 2CLHA 3LGEA 4NJJA 1V3KA 1VPXA 3O7UA 4JTUA 1SZGA 3SI9A 3QV7A 4XSMA 4NHVA 1FFRA 1M41A 3M46A 4LNYA 5A6BA 2NVAA 2KZHA 3FA4A 1K9EA 1SMDA 1WKEA 4G1KA 1W5OA 3ZM8A 4JIIX 1NJJA 3O0KA 3N3MA 3D3FA 3H55A 1YXDA 2DH3A 3HMCA 1CDGA 4AC7C 5CBJA 5BXRA 1UOKA 5B7ZA 1RA5A 1T99A 2F7FA 4DRSA 3B9AA 1JXJA 2B7OA 3T09A 1FFVC 3FDKA 3G8EA 2J66A 2V5BA 2DT1A 1HIZA 4JXCA 5FKYA 2Z26A 3Q2DA 1TPB1 4D6FA 3G0XA 5E1QA 1QT1A 1EP3A 4XK2A 2HVNA 1VCGA 4GVHA 4QEEA 1UWUA 1MVYA 5A94A 1JD9A 5DMYA 4PMJA 5D2VA 3EWWA 1B3WA 2OG9A 1VFHA 2BHYA 1ICQA 2C0AA 1BYAA 3RNDA 4E4FA 4X0VA 4NVTA 3N6QA 2EQ9A 1U5VA 3VC6A 4PUKA 4O0ZA 2OLAA 5I3FA 1D9EA 3A3XA 2YA0A 4LCRA 3BK0A 4Z1CA 4Y8EA 4N9BA 4GC4A 1MUMA 3WEMA 1SO6A 3QY8A 2ISVA 3GAKA 3R12A 3A6OA 3MC5A 5LIXX 1I6NA 2X1UA 4RLIA 3BUVA 3P6LA 1KGWA 4FS9A 5ECVA 1B0IA 6TAAA 4AQLA 3ARVA 3OGRA 5CSUA 1QHZA 1HFBA 1CIUA 2C0HA 4ADSA 5I77A 4DO5A 1RPXA 4O54A 5FS8A 5LA1A 2R1NA 4PRWA 4Z42C 5I7GA 1W91A 3MB9A 4WGXA 4HQVA 3B0PA 4IMEA 4UTFA 3WFAA 1P1MA 4C60A 2OZ3A 1TRIA 3IIXA 3LG3A 4GZJA 2G5WA 1GQLA 2WVVB 5KVHA 1SR0A 1ADOA 1QWGA 2JGQA 3T0BA 3W71A 5A6TC 4QJ5B 5ENLA 3P7YA 4E4UA 1EA0A 3SURA 4TXEA 1U2YA 3RX2A 4PMXA 3LB0A 3F2DA 5G1TA 4G5DA 1GYMA 1A3HA 4WDUA 4K1GA 4J2PA 1J10A 3PJTA 4LBUA 4QROA 2YDQA 1VGAA 2TPRA 1GRGA 3SQLA 4H6QA 2QCFA 5FMHA 3VC5A 2VDIA 3C4UA 4B3ZA 1QFEA 4KCUA 1UP3A 4GXPA 4AVFA 2EQ6A 2BY0A 3P14A 5DRIA 2VEPA 1Q13A 1O12A 2NV2A 3ONCA 2QPSA 3MMTA 3GXDA 1OC6A 3MYPA 3FYYA 1O5RA 3R11A 3QN3A 1V59A 1VENA 3GRIA 3A9BA 4JD4A 1NWUA 1H49A 3FA5A 2PBGA 2J9YA 1Q6EA 1VBUA 2XYLA 3VNLA 3VM7A 1TE1A 2FH8A 4DAFA 3MUAA 4KW2A 4ZO7A 1PTAA 3DG6A 4C6FA 3VO0A 3TP4A 1H7PA 2NXIA 1KFJA 2ADAA 5DT5A 5M1TA 4KH2A 3ONBA 1AH0A 5DXYA 2YX0A 2FVKA 2ZUTA 3WEZA 4HU3A 2NQHA 3DOPA 4MKSA 3TONA 4AF0B 1DJGA 1CLXA 1OGBA 2ONEA 3T55A 3ZR6A 2EPLX 2VRKA 2PC8A 3W22A 3LGGA 4AD0A 3WQPA 2E6AA 2OZTA 4FX9A 3PZVA 3GRSA 5EYWA 4MY1A 2VMFA 1PZ0A 1UYQA 2WWDA 4IMCA 3Q94A 2A79A 2WJFA 1GT8A 1F05A 2XVGA 4N6FA 1ZX9A 4A29A 1FWGC 4I7WA 3ZFHA 4EPBC 1A49A 1AZ1A 2XJ7A 1KXVA 3M4HA 2WNNA 3INPA 1C8YA 4ATDA 3EKZA 4EPKA 3O63A 3W2JA 5C2XA 1J5SA 3MO7A 3T7VA 1E40A 3ITTA 4R9XA 1DWFM 1OFDA 1NEYA 2J3NA 3E0VA 1HKVA 4Q8MA 2D69A 1JNEA 3KWSA 2OFJA 4FX8A 4IMAA 1H0GA 2X8GA 1VHNA 3STPA 2V67A 2VTFA 2C7FA 1OINA 1HL8A 2RHGA 4QGCA 1LP6A 2VX4A 1JF6A 4QBXA 1XGEA 2YVJA 4JCMA 1NDVA 2HSAA 2YLAA 2VFGA 2OEKA 3OU8A 4QAIA 4A3UA 2Y62A 3VCRA 4BJHA 5IFTA 2WMIB 4U3AA 5DEZA 4R7OA 4TVWA 1LQ2A 3AN1A 4NRSA 4C6EA 2D2JA 2DW6A 2XTKA 3R8RA 4C6DA 3LEPA 5CLWA 5C54A 3G6MA 4QQ3A 3PTKA 1REQB 1W5NA 1D7YA 3MP5A 4Q4RA 3VYLA 1AMYA 2I56A 1TUXA 1FHUA 3VABA 3W76A 4RV8A 3C5QA 4LVFA 5G1YA 3GS6A 4C7FA 1M7JA 2I5IA 4AHOA 2DIEA 3QKZA 1LUCA 4C6OA 2NV1A 4Z1YA 1VZWA 2VEFA 4EQXA 3DK4A 1PUDA 4AIUA 4OJYA 1P6WA 2ZUWA 3NQMA 2E68A 1PCWA 2J78A 3IIOA 3MPGA 3IIVA 3PR2A 1G4SA 3KVMA 3GVQA 2CDUA 3VIKA 1Q85A 4E4PA 1V6WA 3EPNA 1X38A 4OECA 3U2EA 3CGDA 3LHUA 5E70A 2VFIA 3RK8A 1QU4A 1ITCA 3W85A 3LSBA 5A8OA 2ODOA 4Q8UA 1UD4A 5BXTA 1YBQA 1YNQA 2WQDA 1EXPA 5I02A 2OWXA 3IUDA 3G1YA 4EACA 3LHWA 3VOFA 3TMLA 4DAIA 1D8WA 2A0NA 2XWEA 2V69A 3VMNA 1BSLA 5FIPA 5CXPA 3DKLA 3ME3A 5DANA 3WENA 6TIMA 3EAOA 3HPZA 2Z1BA 1N7KA 1PWLA 3B9DA 3H2FA 4JZ5A 4H8VA 4IUGA 1BYCA 3KRUA 4AVOA 4KRUA 2QS8A 4Q4PA 1TYTA 3T4CA 3QM3A 1QI2A 4WCJA 2C14A 1K4GA 3T1GA 1NHRA 2QPUA 3VNKA 3T40A 4LXFA 1E71M 3JZEA 4W93A 3GHRA 2O9RA 2YB4A 1H3GA 3SCNA 3BG9A 3HFTA 3QRHA 1CLKA 4L4OA 4BV6A 1JCJA 2YCLA 1O5KA 4DN1A 2GVLA 1OC5A 1GETA 3H7RA 3WLSA 2E7FA 3CPUA 3MV11 3PK7A 3MWCA 3QJAA 3RN6A 1OM0A 2Y70A 4L64A 1PX4A 1E1EA 1HKMA 1OB0A 2VRQA 4U5IA 4PB5A 1TWIA 3WJSA 1QPOA 1SU5A 3ITYA 1YTDA 1WKDA 2ICSA 2IPGA 2G3JA 3MZ2A 4K8EA 1SGJA 3AJ7A 5BOOA 3E74A 2GGHA 1EJ7L 1TELA 4BEUA 3MS8A 4AD3A 2WCAA 2QCDB 3U2OA 3W75A 4OHQA 2YCEA 1KWKA 2BODX 2EG6A 4WOZA 3QC0A 2G0WA 1TPVA 4AEEA 4XZLX 4KWWA 3O8AA 1K03A 3O2LA 2Z27A 4JX4A 1XHGA 3N15A 3G77A 3A24A 6REQA 2OELA 2VWSA 2OWWA 5TBOA 4G1NA 2HVOA 3WK2A 3EPOA 2R1PA 2PLMA 4PMQA 4ZOBA 4GQQA 2WW5A 4RNJA 4XVDA 4NAFA 5HOSA 1ZHAA 3TTQA 3VGHA 3K4WA 4MY9A 4B5XA 1ZBKA 4XBKA 1UIPA 1JZ2A 3QSTA 4CNSA 2RKXA 1STZA 5H8UA 3CL7A 2Z1KA 4UBPC 5JUVA 1DJIA 4GH1A 4WSJA 1XSJA 3GDTA 3KAOA 5HNNA 1K9FA 3QF0A 2UZ9A 1ISXA 2PDNA 5CAHA 3GRTA 1RBLA 2QHAA 4TX8A 2VENA 1HL2A 1EJWC 5B80A 1HKKA 4H4VA 4JTJA 1LF1A 5HINA 4E8CA 3TOPA 2V3BA 3TSBA 2C91A 3QOMA 2HXUA 2V38A 2YDAA 4F0KA 3E0LA 4HB7A 1C92A 2CLPA 5HR6A 3PJWA 4S2CA 2WZEA 5C55A 3F4CA 3ZLGA 2RJGA 5I5RA 3PZ9A 1FEBA 3URQA 3NR0A 4QS5A 3GU2A 2E0PA 1NOFA 4HZ7A 4EAYA 2VX5A 4YU1A 1QATA 4HIBA 1H1ZA 5CZJA 4LRTA 3SB0A 3FVMA 3BICA 3DG7A 1AW5A 4PMYA 1UH3A 2DFAA 2PTZA 3P80A 3TN4A 3WG6A 4FP1A 1QBAA 2XZ9A 4FZIA 4QS6A 2EEXA 4JTEA 5CGQA 3L8KA 3L0NA 4UQBA 3U7BA 4HSOA 3OZOA 4CNUA 4IMFA 5ABFA 4LVDA 3FFSA 3TC7A 1JAEA 1OFOA 3GDLA 2RFGA 2CZVA 4ZXLA 5G4WA 1UKSA 2AL2B 1JXKA 3ES7A 4O1FA 2ABAA 4DZHA 2EQ8A 1CNVA 4C1LA 1BQCA 3TXZA 4ZZ9A 2E67A 2I9UA 3LNMA 2DDXA 1K9DA 1U5HA 5E5CA 4DM2A 4JN8A 4AHQA 3TLLA 2FGZA 1FH7A 4QG6A 3AUJA 1E6SM 3SY8A 5D4YA 3MSDA 1A5UA 3BLOA 4XKMA 3MMUA 2AMGA 4U10A 4F0SA 2O92A 1JRPA 2V6OA 2HK0A 3VIFA 2WZHA 4UTTC 1TWWA 2EPHA 3S1XA 4HOWA 2Y5SA 2X42A 3IS4A 1DVJA 5CZ0A 4DLMA 3V3WA 1IXNA 2W0HA 4I9MA 1MQPA 2Y85A 3W88A 3WQCA 3KOZA 2HZGA 4ZOCA 3LV6A 1W2VA 4GKLA 4F8XA 4M6PA 1TV2A 5DO8A 3TOYA 3M0IA 1XYCA 3S9YA 1NF0A 4PGLA 1Q7MA 4KEVA 4Z17A 1R3TA 2ZFAA 3NDZA 1M03A 1H5VA 3BANA 3D3AA 3EB3A 2PB1A 1VJZA 2HJPA 1M6IA 4U31A 1EKOA 2W55A 3AYTA 4ZB0A 5U25A 3AYSA 1OF8A 3UXAA 4GQ0A 1EDTA 2WZTA 3SR6B 2A3EA 4AYSA 2WO5A 1NDZA 1WV2A 1VHCA 2CZ5A 1A3WA 2DZBA 5I0DA 2HISA 1XLIA 4AWUA 4QFUA 2C71A 1KNWA 1NU5A 3GBDA 3O0FA 1B31A 3NIYA 3LADA 1KBBA 4DELA 3S5SA 1W6TA 4Y9NA 1A5SA 2XM2A 4UQAA 3RG6A 1P0DA 2QAEA 4JTLA 3VGEA 4O8AA 3IEBA 1XLEA 4AAJA 3GK0A 4GLEA 4H4YA 2WKLA 3LN3A 4E8GA 3FKKA 3MP3A 1UKQA 1ZMDA 1FA2A 4S38A 3QBUA 3KBJA 1YQZA 4HSHA 1I8JA 3W53A 4OQVA 4AIOA 4B5VA 4D8AA 2BBFA 2OYMA 3BL3A 3SRDA 2EQ7A 2QUMA 1K7EA 1NVMA 2GJNA 2CCRA 4JTSA 3DH9A 4DM1A 4PULA 4DIAA 3TTYA 1IYXA 3LB8A 3VMOA 4PMOA 3RRAA 4M80A 2ACUA 3UYCA 3A22A 1R46A 3S2LA 1WZKA 3ZS4A 2XISA 1HJUA 5FD0A 3SFWA 3KDOA 1SO3A 1Z7AA 4D1JA 2WZIA 4HJFA 3BAIA 5BOEA 4PTNA 2B0MA 4JN7A 2ZE3A 1V02A 4LYPA 4ATLA 5F7UA 1KRMA 2GQWA 5GQBA 2QDGA 3WLOA 1ZNNA 4RXGA 1ISYA 2J7FA 2F2HA 1DJZA 5M03A 4C6IA 4CCZA 1J96A 1HF6A 1G5AA 3NYDA 3EWUA 4TTUA 1T41A 3OOQA 2ZC1A 5REQA 4Y9MA 3VFLA 4WK9A 4Q8VA 2QUVA 4US5A 3H2MA 3NEVA 4HSNA 3KBSA 4H4WA 3VZXA 1P5BA 4HZMA 1K1DA 1HO4A 2IQTA 4PRRA 2WZMA 3GH5A 5AVHA 1O6IA 4H4QA 4LWWA 1IEQA 3WLIA 4RV3A 3WELA 2B7PA 3W7CA 1BXNA 1GJUA 1SZEA 4HU4A 2E5BA 4ES4A 1E5NA 1GZ1A 2WPBA 1JZ4A 1EP1A 4IFKA 3A7UA 3U5YA 4ENLA 4TVYA 1RHCA 3DHDA 4UFHA 4D72A 1KTNA 3RX4A 1VJSA 3GC5A 4YYFA 1HKIA 1GOWA 3VCNA 3VUSA 3KS6A 4Z2KA 1NF7A 4P7LA 3IPWA 4ZOEA 3TV8A 3BOLA 4KRZA 4LIIA 5ABFB 1A5MC 2GR1A 2PDYA 5LA0A 1A53A 2NT0A 1XP3A 3WH9A 1EJUC 3TQVA 4LGXA 1DTUA 2Y24A 4M82A 3UESA 1SFSA 3AQUA 5LSMA 1CEOA 5T9BG 4ZFMA 1SSGA 3UWZA 5E6YA 4OU1A 2EXOA 5LNWA 2ANUA 3IIZA 3UU0A 3WLKX 1BG9A 3D0CA 3PZMA 1KWGA 3N13A 1PZ3A 4F2BA 3EBVA 4J3TA 2RABA 3B8WA 4U33A 3CWNA 1X2HA 3RCYA 2DSKA 3W4RA 4OVXA 1DJNA 3N2XA 1LROA 3EDDA 1I1XA 3EMQA 3BE7A 4I9JA 2I5QA 3QEZA 2POZA 4HMCA 3T42A 4ZCWA 2GWNA 2E8YA 2G50A 3LM7A 3M5XA 4QXIA 3A23A 5LIWX 4YIWA 4LBRA 5FF0A 2UY3A 1OYCA 3HPAA 4ZQCA 1C8VA 2GDVA 4BQ4A 1V03A 1KXQA 5FS9A 3OYZA 3GQYA 2W6RA 2Y4SA 3W1UA 2CZEA 4FOUA 5D38A 1QR7A 3UQNA 3W6LA 5AYBA 3NO3A 2BXYA 4GO8A 1KBIA 3RJYA 2VI0A 3DK9A 4V1XA 4WZHA 1VJIA 2JE8A 3DHFA 3MCMA 4QSFA 3WMCA 3R4IA 4C5ZA 3I6TA 4GWEA 4INFA 5CJ5A 5AHEA 2B81A 3GIYA 5FEZA 1VAHA 1LL4A 1GCYA 2CC0A 2GOKA 3NNTA 1BTCA 2DZUA 4P8VA 4UTJA 2Z7GA 4QLKA 1GRHA 1GOOA 1HW6A 4GQBA 4JGDA 1X1ZA 5ABHA 3T2PA 1TB3A 2D1ZA 1XH2A 3FXGA 3F5JA 3ZR5A 2Z4GA 4XBSA 4NEWA 3NO5A 4C65A 2VXNA 4KETA 3GHTA 3SW6A 3KS5A 4PFHA 1ONFA 4IL2A 1XW8A 5LGZA 2E09A 2JKPA 3OVPA 1BWKA 2ON3A 3LSCA 5HUPA 4OZOA 6A3HA 4HMNA 3CHDA 1VS1A 2Y8UA 2VZOA 4FR6A 3PPGA 3KWXA 4PL1A 2QLYA 4YVVA 4PB3A 4O1EA 1ZZMA 4EE9A 1GW1A 3W27A 2F2KA 1FDYA 4GYJA 4PR4A 1XIEA 4ADUA 3HW2A 3M0VA 4WHBA 1WUFA 1UQZA 4KEUA 3NEHA 3URAA 4ERAA 2A7RA 1VKFA 1C29A 2NV9A 1ZENA 2J62A 2V3DA 3HQNA 2ZA1A 2YL6A 3DGZA 4EXQA 1AVAA 1LRQA 3FYOA 1KV8A 1JCYA 2VT0A 1YHTA 3RYSA 4JL1A 1XPGA 1WUEA 4IQJA 1ZP3A 1IGWA 1DIDA 4R5EA 3W2UA 3FVDA 4H4XA 3P3BA 1X96A 2PWVA 1P0KA 4WRHA 2A8XA 1FKXA 3WLRA 4QNWA 4XZMX 1UZDA 1V6YA 4CNOA 2OPJA 2YIHA 4J3VA 3OBAA 4QNEA 3HG3A 4NJGA 3F5KA 3G1AA 3VNZA 2OEJA 1C3FA 4R7WA 5J5DA 3NVYB 2E5DA 1LUCB 3NZQA 5ER0A 1WZMA 3QY6A 1AD4A 3TCSA 4A3RA 3NVWB 1XSIA 3NTYA 4QQUA 1O1HA 3GZ3A 4JBRA 1A80A 1OSEA 1PBGA 3UA4A 3F2CA 3G1FA 4OOUA 3PY2A 4MHBA 1JVNA 4F9JA 3ABOA 3TH6A 4B4HA 4AX7A 2J7CA 1GV4A 4N0RA 2OKOA 3M0HA 3URHA 1UMYA 2Q09A 4PSPA 3VU2A 4B5SA 1IZCA 2O56A 1J01A 5IRPA 1IWBA 1RY0A 1I2RA 2WOVA 4P8WA 3LXBA 1OG6A 4H4IA 4O50A 4QX4A 2CLLA 1DIKA 2ISSA 1VPYA 1X7FA 3CV1A 2EHHA 2VQUA 4MYXA 4XZ9A 1TA3B 3ZJKA 3P81A 3ENLA 3UVAA 2O7SA 5KEZA 4UCGA 1SMAA 1PDZA 2INFA 2NX3A 3WSUA 1EPVA 1ME9A 3QR1A 1MFVA 3PTQA 1FWTA 2WMJA 4LUYA 3AS1A 5IBXC 3MW7A 1GVEA 4HK6A 2NXGA 5DN1A 4O53A 1BZLA 3O15A 4GZ7A 3FGCA 3OVGA 4MZYA 4Q33A 1N5XA 3FKRA 2XSXA 2JALA 1QASA 3W1XA 3GTHA 2I5GA 1DJYA 2C18A 4PTVA 2VC6A 3TK7A 1GVRA 4V33A 1YBQB 3STEA 2DVUA 3HG4A 2G4FA 5DF0A 3K1GA 3G3MA 3IVSA 2RUSA 4UWMA 4RW5A 3B8VA 4KFPA 1T8XA 3JW7A 1UC5A 1TPWA 5FI8A 1GEHA 3L5LA 1JROA 2VZUA 1F3PA 3O1NA 3GB6A 1XC6A 5MKGB 1A50A 3JU2A 4GRTA 3AZSA 4WSHA 1MI3A 2J6XA 4WR3A 4JIQA 4MWAA 2F61A 1ZQ5A 1IEIA 3TYAA 2R94A 2EGZA 1NARA 5FF4A 3C52A 2PDKA 3H2CA 4J27A 3LQGA 4PMUA 3EF6A 4IQEA 4A2RA 3M64A 4WF7A 1K8XA 5LNSA 1VR6A 3WLMA 1VIZA 5A5WA 3N25A 1H62A 3K8LA 3BLPX 2IW0A 3AMKA 1K70A 4Q8WA 3ITGA 1E72M 3UWWA 4BF7A 1YQ2A 1QI0A 1EJXC 3CMGA 3DX5A 3TA6A 4E2DA 3SN1A 3AXKA 3DN5A 5CPLA 3WBWA 2DUXA 1RD6A 1QW9A 4KGLA 3E96A 2Z1SA 5I09A 4US6A 8XIAA 2VR5A 3TYZA 4H19A 3CZGA 4E2OA 2NLYA 2VHLA 3HBLA 1WP6A 3WD4A 1D2KA 3RPMA 3FHAA 3VDAA 3EB2A 3ARQA 3DDMA 3R25A 1RP9A 4GGBA 3EOOA 3AAMA 2ZUMA 3ARPA 4JQ4A 4EVZA 1KQYA 3W2MA 4W4QA 4TTGA 1R9XA 1ZDLA 5C5YA 1U33A 1AG1O 2PFHA 1IWPA 3RR1A 4H4RA 1W1A1 1E55A 4KGJA 2X2GA 4GZIA 4PN2A 2GGJA 5KMYA 4AZ6A 2V8ZA 4U2YA 2D20A 1B5TA 3ARXA 3CUFA 2P8BA 4JTDA 1BF2A 4UB9A 3VZYA 1UD5A 3EGJA 1GTEA 3ZLHA 1UZ1A 2V5JA 1PKLA 1R3VA 2PSNA 4AUBA 2J8TA 3LHVA 1E1CA 1EIBA 1Q6DA 1H7XA 4DX3A 3RHGA 2XVPA 1JPMA 2ZWZA 5KSWA 1QTWA 2GR3A 1Y0EA 1JEZA 4GIAA 4ZOHB 2ZX7A 3QSRA 3XINA 1FBAA 4U5KA 5I2UA 3D47A 4EPEC 5D05A 3CUGA 5EMMA 1NHQA 2BVDA 3WK1A 4V27A 3IGSA 3CASA 2Y8KA 3Q65A 1R2TA 5AYZA 2OR2A 4QE5A 4HP5A 1EC9A 1PZ1A 3A21A 5MKGA 2ZCGA 3AFBA 4F3HA 1K8ZA 1IF2A 3LUTA 1DXFA 4IFRA 5U1OA 4H3DA 2GGIA 3THAA 4CQBA 2QJGA 3TAKA 2IKHA 4D1IA 1OT1A 1TPEA 3KVJA 3VA8A 1VD6A 5CBIA 3HZ3A 3VNMA 3M0JA 3OVRA 3DI0A 1WQ5A 1H11A 5JRBA 3M9YA 3MQTA 1Y5VA 4OT7A 2RGMA 1OFBA 1JYNA 4HHMA 3EZ4A 4J3ZA 5EMYA 1A5OC 1YDYA 3KBNA 1IWAA 5D9OA 1W1TA 4RNHA 4HPJA 3LY0A 1JCTA 5H8MA 2QV5A 3Q6JA 4R85A 2QDDA 3V0UA 3KZPA 9CGTA 2PDUA 2Z0IA 4QDPA 1SPQA 4N9DA 1XDMA 4BI6A 1BGGA 3MTWA 4O28A 3LZ5A 3GNXA 3Q4DA 1TCDA 4JS3A 4RZ5A 4YCPA 4F0MA 4XTIA 1ZL1A 4GQGA 3CUZA 4JTQA 4XUYA 1LYXA 5TIMA 3OIXA 2CLFA 4O11A 1H50A 3VXGA 2XG9A 4JNMA 1VRDA 5EA9A 1GGOA 2CITA 4GJJA 3S2CA 4POCA 3WEOA 1KTBA 4ACZB 1Y7VA 1UH2A 2GPTA 4S3GA 2NQLA 3TAOA 4MUZA 4CN1A 3NZRA 1V6UA 1FWWA 1JDFA 2CFFA 1CECA 1VCFA 1CT5A 2ISDA 3KOWA 4J5NA 4MJ4A 1J6PA 1J93A 2I57A 3HPXA 1NFPA 3DFHA 3GR4A 1LWHA 3VTRA 2AAAA 3PUDA 2FPTA 4JTRA 3LPOA 5T9CE 2A6NA 4FA3A 1GRTA 4Q6XA 3SSJA 4CGTA 2ZRVA 5HBFA 4HTYA 1OX6A 3IRSA 2C19A 2WANA 1EUNA 3AZRA 4JTFA 2ZRWA 3TKFA 4LUTA 2CW6A 1E6QM 1MUWA 2WVSA 2PRHA 2OB3A 3NM1A 1OCQA 4PUWA 1R38A 1CW2A 2BNJA 3FOKA 5I78A 4Q8TA 2DZPA 4IH3A 4S3EA 2EAWA 4MNJA 2ZZ0A 1W1PA 3POHA 4JPGA 1W5QA 4GUIA 3TW9A 4Q7BA 3WF0A 5KZDA 3AHTA 3S5NA 1GKRA 1BSIA 3QHNA 4X3ZA 3WD1A 4AH7A 1BFNA 2BY3A 1XH0A 5H6HA 1FRBA 3ITCA 3R94A 2RDXA 2FZ9A 1GZJA 5BCAA 3P74A 5LIKX 3WF1A 2HS8A 4IPLA 2OT0A 2MANA 1TQXA 2WM0A 2PZNA 3ZJ6A 3CYVA 5FJIA 4XZHA 1OK6A 4W87A 1WO2A 1JOAA 1BRLA 4TX6A 3EEZA 3VKAA 1IT7A 1T0OA 5JH2A 3QQ1A 1FWEC 2PGFA 5C8BB 3MA8A 1E43A 4ZE5A 2Z2BA 3CT7A 3QYSA 1LRTA 4HA1A 2WSQA 1EGZA 1WPCA 1J2BA 1E3ZA 1NOWA 4EQRA 1XI3A 1QMLA 4JTHA 3WUGA 1KCXA 1R86A 3G1RA 4DBUA 3ITOA 1UWSA 4MZ1A 1RVKA 4GD0A 4O10A 3APGA 2ZBTA 4FK9A 2R8WA 1CGXA 4A35A 2A7PA 4GCXA 3BLEA 1EO7A 5RUBA 4ZVJA 5F4XA 1W3NA 3N6JA 3RLVA 5JVLA 1R7OA 3OLDA 2UWFA 4AXNA 3LXDA 4MNLA 4RE3A 4JIEA 1NOUA 3TIMA 1AJ2A 3RILA 2ZWYA 2REQA 2AKMA 3EOEA 2WVUA 2ZZ7A 3LPPA 3MHFA 3ZQ9A 4B3KA 1G7UA 1N5WC 2BHZA 1VBJA 2C6QA 5JMUA 1SSDA 4O1AA 3WBAA 4LJ3A 2WSRA 1KM6A 4HOXA 5J04A 3BAKA 3GVWA 1S5TA 3BCJA 1M53A 3GXIA 3SJ3A 3NPVA 3AHYA 1QPQA 5F2GA 4PODA 3I7SA 4AHPA 1MO0A 4M7SA 1JYXA 1VRXA 3FX4A 4IOTA 4LC8A 1SO4A 2WPEA 4J3SA 1XIIA 3D6NA 3CC1A 4XTDA 4AWSA 3H4XA 1UJQA 2AOSA 2DSUA 2I14A 5CC5A 1A4LA 3AHVA 3W01A 3AJXA 3QMSA 3AZTA 1EH9A 2QDHA 1AUSL 1V3HA 3PBGA 3G22A 5KITA 3BSHA 2XN2A 2D23A 3CQJA 1XLCA 3BARA 4K7ZA 1F2JA 1QO2A 1YW1A 1A47A 4X2RA 2Y6ZA 4DNMA 1M7PA 3WDPP 3KL0A 5BMXA 1MWOA 4QE4A 1Q45A 4MWAC 4H6RA 1WDQA 4Q4QA 2XIQA 3RCNA 5HNTA 3JR2A 4NZCA 1UA3A 1KKRA 4ZE4A 4GYFA 4MWAD 3N34A 2V5LA 1BVZA 3N11A 3HMJG 3E0WA 2J7GA 2PP1A 4UMBA 4HYWA 1AQ0A 3VUPA 3NCOA 2J75A 3SCUA 4W88A 2WC3A 3MUY1 1VLIA 4LVBA 4DF1A 3BQ5A 4LA1A 3PBYA 3TR2A 3LPFA 5XIMA 1D8CA 2QDEA 3VD7A 4LAOA 1H7WA 4Z2LA 1J0JA 3W84A 4C6BA 4RPQA 4DQWA 5XIAA 5CG7A 2ZA3A 5FF7A 3RR4A 1SYTA 2W67A 2E3TA 2JEPA 3E2VA 1H0IA 4GUJA 3OVQA 5GJPA 4P7NA 1T96A 1S5WA 2Z25A 2D3NA 3H2NA 4GE8A 4PMZA 4BCEA 4MB4A 3EPMA 2QCLA 1TZ7A 1EJRC 4ORMA 3DYOA 4OV4A 1X6NA 1CB7B 3HN3A 2GQ3A 4DBWA 1L6SA 3TZFA 5FSDC 5JBFA 4NJIA 1PYMA 2G41A 3KDNA 4JFUA 2EJ1A 1DWHM 2OCZA 2CWXA 4KFNA 5AVNA 3S2MA 3VMPA 3VDHA 1UPPA 3CQ0A 2WNZA 4C7DA 4G6CA 2I17A 3ARZA 3T78A 4NILA 3I10A 3PUOA 4W8LA 3QGKC 1VH7A 2FB2A 3CT2A 1EGVA 1DQWA 2PDCA 3H7UA 1VP5A 4H2HA 3WJZA 5AC7A 3TTEA 3GIPA 1S46A 4UNLA 3PPFA 3B8UA 3LERA 1BYBA 1CGVA 1NY1A 2WMHA 2R91A 4X61A 1E0VA 4GUFA 1LL6A 3UZ5A 3O16A 4HCLA 3AISA 3CUXA 4NRRA 3RLUA 3GDBA 4A21A 4FNUA 1YRRA 2E9BA 2DVTA 4B5WA 2HV5A 2ZZ2A 4MUPA 3NZPA 1JD7A 2O7QA 4G8TA 1U1UA 4ERGA 2OO6A 1HJXA 3GDRA 2WBKA 3OB8A 3UCCA 4NXSA 5CPQA 1I9CB 3HU7A 1ITUA 1W9UA 1JUEA 2YBTA 4N4PA 3U9IA 4QJ4B 3MVIA 1W3LA 3U7VA 1J0KA 4WJXA 3QGAC 1AQMA 1EQCA 3PBMA 4PTMA 1ZK7A 5D9NA 1M1BA 4PC8A 4IGNA 1DXIA 3CLWA 1RCXB 1ZSXA 4TOQA 4UTWA 2W3SA 2IPFA 3SQPA 1T3QC 4Q8NA 3PZQA 1QOPA 3NPUA 2J77A 2ASHA 2X0YA 1LBFA 4WDXA 4M52A 3BURA 2QVNA 2WPCA 4LS0A 3IRDA 2VGIA 4OIFA 1KCKA 2JFEX 3AS0A 4JCLA 1ENUA 1JNDA 4JAWA 3S42A 7PTDA 4ZO9A 4A3QA 3BVJA 1DWGM 2VRJA 3KM8A 3B0YA 4NI8A 2Q6ZA 1PIIA 4DJDC 5DX7A 1R2RA 2YOCA 4MSSA 1K8YA 3ZWSA 1UKPA 2DEPA 3VD5A 3MKKA 1RCQA 1Z89A 2WJDA 4IGMA 4GUGA 3W24A 1VC4A 1EJTC 2R1KA 1V77A 4MY8A 2ZA2A 4IJBA 3ALFA 4NL1A 3W26A 4JYDA 3B0VC 4LCQA 3MCNA 2HE8A 3TWAA 4N6EA 4EF9A 3QY7A 1TIMA 4UMCA 2VCBA 1QWKA 4J3UA 4MJ2A 1M01A 3S6OA 4DJDD 4WVXA 1I75A 4CD5A 2PWUA 3VI2A 1L2UA 3HQOA 4L1WA 2FMOA 4WJEA 3W1RA 3AOFA 1S2CA 4ZA0A 4MPQA 4MWAB 3VDCA 3II1A 2PGRA 3UETA 1G1YA 1EHNA 5KVIA 2W4XA 3WLPA 3V5OA 3W7PA 2O0TA 4B9ZA 3GFXA 2BVWA 4V1YA 1FCUA 3WD2A 4LBSA 4LU0A 1XICA 3IJIA 1XRFA 3V36A 4CU7A 4KESA 2EO7A 2HNHA 4DXKA 1I45A 1NPXA 2HEJA 2V3GA 4BI5A 1XIMA 4JDRA 1M65A 2HCVA 1TJ2A 3CAVA 1MW0A 5I79A 2ZZ6A 1XR2A 4D6CA 2HBVA 2A7NA 1LOQA 4KEMA 2FFCA 1Q7QA 2VEGA 5K9DA 4LH8A 4JTIA 5CPMA 1XJBA 1Q6LA 3T0DA 3L4YA 3HGRA 4UTHA 3A5FA 1A0EA 4QISA 5A2CA 2QAPA 3STGA 1MYRA 4PE8A 3N2TA 1JCMP 3W1MA 4UTTA 3EMCA 5GJMA 4EQWA 4JNZA 4L4PA 3GFZA 2VO5A 2P3ZA 4UR9A 2QJHA 3GU1A 4LTSA 4UCFA 2W54A 3WQ4A 5I06A 4PUEA 3QZAA 2TMDA 3PAOA 1IR2A 5BNKA 1LZOA 4AZGA 3FGCB 2PLJA 2QVHA 2TRSA 3A5VA 3QQ0A 3KP0A 4AD4A 3O3RA 1SB3B 3K13A 2VUNA 4H9YA 5BWAA 4KIEA 2E77A 3GIQA 4WKHA 3L7RA 5FL0A 3U5UA 1X8FA 2ZZ4A 4XZNX 2UY5A 4DNAA 3KL3A 4LAKA 1RM6B 5HMDA 2Y5EA 3MUIA 5DELA 2B4GA 4K68A 4NX0A 1GWJA 1HJWA 2GJXB 5E93A 4JKMA 3VIGA 1DOSA 1WDRA 2PDJA 5EMLA 3ZVHA 4ML4A 2PODA 2YYUA 4PRTA 3ZJ8A 1EPXA 3WDJA 3DGHA 1QRQA 1JAKA 1E4NA 4UFLA 5L6UA 3UP8A 1QHPA 2PLCA 4ZL1A 3DAQA 1JZ3A 5CCZA 3KHJA 3E5PA 4QAWA 3D9XA 4BR1A 1MNSA 4GHRA 3HG2A 1FWJC 3THQA 3NM3A 2YZ5A 2X40A 4RUBA 3AIWA 1HNYA 3G0SA 4DWSA 4HNTA 2QJNA 5HWNA 1GEQA 3KVLA 3R58A 3W7EA 5LHFA 2VELA 3FJ4A 4LVAA 1EHAA 1UWTA 4PSRA 3M07A 2P10A 1RQBA 1XINA 2CZDA 3BSMA 3VNYA 4PCTA 1B9ZA 1XG3A 1XYBA 2DSVA 5L9FA 1NHPA 3WH5A 2VZSA 4EMJA 4E6MA 1GKPA 1YADA 3U3HA 5A95A 4J7RA 1JQXA 5CSRA 2OSXA 4JTCA 4A3HA 5KINA 1RSCA 3UG8A 4K6AA 3EX3A 3O06A 3TDFA 2ZDSA 5MHBA 3NZGA 4Q7NA 4DPQA 4PUUA 3ZT5A 2G37A 1MNZA 2C16A 3DHPA 2W27A 4G7EA 3UBPC 1L0PA 1C90A 1D3CA 2A5HA 3IVTA 3VD3A 1XBVA 2BASA 5LYRA 3N12A 4G56A 5EKYA 3N9KA 1GXFA 2C3ZA 4OUIA 2HK1A 2YQUA 1MSSA 1R3YA 3URBA 3VOHA 3ANVA 4MMWA 2XDFA 1QW7A 2OGJA 4JQ9A 4X9SA 5CSYA 3L2MA 1JCLA 3IUHA 3RX3A 2PU0A 1AH4A 1Y5XA 4S3CA 5EMKA 2AQVA 4FXRA 3S4TA 3CLMA 5F1VA 3LCLA 3EA1A 2NT1A 5AECA 2DU2A 2BV9A 4GC3A 3SAZA 3UWYA 4FR1A 4CN6A 2WV8A 1PWMA 2C8NA 2GQAA 2J7HA 4CQ9A 1I2OA 2DJXA 1ZJAA 1WYIA 2PDQA 2YJQA 2PDPA 4V15A 3HM7A 4B4FA 2VNCA 4IX0A 1Z42A 4GMEA 3IGUA 2UBPC 1XXXA 1N60C 2X7VA 3H7VA 4XO7A 3V1HA 3W1AA 1KXTA 2JF6A 1J4EA 1V6TA 3R2GA 3IAPA 1S2AA 5EBKA 3L4WA 1WDDA 3ARYA 3IACA 3URNA 4PBGA 3RITA 1PTDA 3DFNA 1EQPA 5AZ1A 4XAYA 1PEZA 1KM4A 5AHFA 1DTNA 4MM1A 4AYGA 1JYVA 3CAQA 3AIBA 1UUMA 3P0XA 3L4VA 2P76A 3OC4A 1RPKA 3BJFA 1DJXA 3T08A 2FZNA 2OOFA 3GX9A 5A2AA 3BLIA 4RZ6A 1NQKA 3REQB 1S5NA 3MSYA 5AHMA 1DJQA 1R0MA 1W0MA 4CCDA 5HWJA 3CYJA 3JRKA 4Z1BA 2CFYA 2DQXA 5JCNA 4IGSA 4H9MA 3HO8A 4RL3A 1HXJA 4DPPA 5HULA 4WJ8A 2GLKA 3ZVHB 2V5DA 4UOZA 3C61A 1XLLA 4X9YA 1CGTA 1QDSA 2OTDA 4JFVA