1KKOA

Crystal structure of citrobacter amalonaticus methylaspartate ammonia lyase
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
411
structure length
411
Chain Sequence
MKIKQALFTAGYSSFYFDDQQAIKNGAGHDGFIYTGDPVTPGFTSVRQAGECVSVQLILENGAVAVGDCAAVQYSGAGGRDPLFLAEHFIPFLNDHIKPLLEGRDVDAFLPNARFFDKLRIDGNLLHTAVRYGLSQALLDATALASGRLKTEVVCDEWQLPCVPEAIPLFGQSGDDRYIAVDKMILKGVDVLPHALINNVEEKLGFKGEKLREYVRWLSDRILSLRSSPRYHPTLHIDVYGTIGLIFDMDPVRCAEYIASLEKEAQGLPLYIEGPVDAGNKPDQIRMLTAITKELTRLGSGVKIVADEWCNTYQDIVDFTDAGSCHMVQIKTPDLGGIHNIVDAVLYCNKHGMEAYQGGTCNETEISARTCVHVALAARPMRMLIKPGMGFDEGLNIVFNEMNRTIALLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-METHYLASPARTATE AMMONIA-LYASE
publication title Insights into enzyme evolution revealed by the structure of methylaspartate ammonia lyase.
pubmed doi rcsb
source organism Citrobacter amalonaticus
molecule tags Lyase
total genus 154
structure length 411
sequence length 411
chains with identical sequence B
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2001-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
A PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1kkoA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1kkoA01
4GFIA 3H70A 4DWDA 2GGEA 3CYJA 3QN3A 5IDZA 2AL2B 4HNLA 3R11A 2QJNA 1KCZA 2GL5A 1MRAA 3IK4A 3JW7A 3UJSA 3P3BA 1EBHA 1EBGA 1P43A 2DW6A 4H19A 3D46A 3D47A 1MDRA 1PDZA 4GYPC 5FJPA 3RITA 4H83A 2XH2A 3DG7A 3OTRA 3H12A 7ENLA 2PTXA 3U4FA 1WUEA 2OVLA 3MKCA 4H2HA 1TE6A 2AKMA 2PSNA 1L8PA 4J3ZA 1XS2A 3RCYA 5BOFA 5FJTA 3N6JA 4DN1A 1JPMA 4IT1A 3Q45A 3QPEA 3DFHA 4ENLA 3R0KA 2XSXA 3R25A 3DDMA 5ENLA 3ENLA 3FYYA 4E4FA 3DESA 3TW9A 2PA6A 2DW7A 4HYRA 4HCHA 3R0UA 3P93A 4HCDA 2HZGA 4F4RA 3MSYA 4KPLA 3I6EA 1JCTA 1JPDX 4HPNA 3OZYA 3TQPA 3VDGA 2OPJA 3BSMA 3EKGA 2GSHA 3UCCA 1BQGA 1SJAA 3UCDA 2HNEA 2OX4A 1FHUA 3SJNA 3QLDA 2OZ3A 4HN8A 1ELSA 3DERA 2GGJA 4X2PA 3T8QA 3STPA 3V5CA 3ZLFA 3ZVHA 3V4BA 4K8GA 3RRAA 3SN1A 1NELA 3R1ZA 4DHGA 4M6UA 3KUMA 3RO6A 1BKHA 4HNCA 1DTNA 2OO6A 4ROPA 4IHCA 4GISA 4KWSA 4EWJA 3VC5A 2GGHA 1KD0A 2NQLA 2AL2A 4KT2A 4J1OA 4DX3A 2O56A 2QJJA 4GYPA 3OPSA 3BOXA 2ZADA 3TOYA 3VCNA 3MUCA 3MWCA 2ONEA 1SJBA 2QGYA 3U9IA 2XH4A 1SJCA 3CAWA 3NZGA 4E8GA 2XH7A 3S47A 2OKTA 3ZLGA 4M0XA 4G8TA 3TJ4A 3N4FA 3GY1A 2GDQA 3FVDA 3FXGA 2PTYA 4JN7A 2QQ6A 2GGIA 2OG9A 3TCSA 3RGTA 3PWGA 3TWBA 2PTZA 1JDFA 3GC2A 3N6HA 2XGZA 4GMEA 4GGBA 3V3WA 3OP2A 3JVAA 2OFJA 3UGVA 6ENLA 3R10A 1IYXA 3JZUA 2PMQA 2P8CA 4IZGA 4E4UA 3SN0A 3GO2A 3NXLA 2PP1A 2PU1A 3S5SA 2QDDA 4GIRA 4A35A 2P0IA 1PDYA 4E5TA 2HXUA 3ZVIA 1OEPA 3CT2A 4Z17A 4JHMA 3UJEA 3PWIA 2QVHA 3OW1A 4K2SA 4ZA0A 4K1WA 3T6CA 1YEYA 2CHRA 3PK7A 1EC9A 3UXLA 3CK5A 4JN8A 4GGHA 2FYMA 3MZNA 1MNSA 2PU0A 3TJIA 4YWSA 2PGWA 2MUCA 3ES7A 2P8BA 4G7FA 3IJIA 3CXOA 3PFRA 4DXKA 4MMWA 2FKPA 1XPYA 3N4EA 4IP4A 1EC7A 2P3ZA 3FV9A 2OZ8A 3I6TA 3TTEA 1KKOA 3CB3A 3VC6A 1MUCA 1R6WA 3UJ2A 3TWAA 1TZZA 3NO1A 3T9PA 3QKEA 3Q4DA 3UJFA 4IP5A 2PP3A 3RR1A 1ONEA 3HPFA 2AKZA 3FJ4A 2XH0A 2MNRA 3T4WA 3SN4A 2P88A 3THUA 1MDLA 2RDXA 5J04A 3H8AA 1NU5A 3VFCA 3FCPA 3SBFA 3I4KA 1E9IA 3VA8A 2GGGA 3EEZA 1R0MA 4HCLA 1P48A 1KKRA 3DEQA 1WUFA 2AL1A 3SSZA 4E6MA 4A6GA 2I5QA 2HXTA 2PTWA 3DFYA 1FHVA 1SJDA 3DG6A 1W6TA 3B97A 5FJRA 3VCCA 2OQYA 1F9CA 4IL0A 4Z1YA 3SQSA 4KEMA 4A3RA 5BOEA 1RVKA 4FI4A 3UJRA 1ECQA 3IJQA 2PGEA 3ES8A 3P0WA 2OZTA 3K1GA 2OQHA 3DG3A 5EU9A 2ZC8A 3MY9A 2QDEA 3ZLHA 1EC8A 4FP1A 2PCEA 2PS2A 3BJSA 3UXKA 3QTPA 3GD6A 4IL2A 4ZCWA 2QJMA 2POZA 2PPGA 4MGGA 3ZVHB 3MQTA 3V5FA 2PP0A 2PODA 3H7VA 3IJLA 1TKKA 3DIPA 3NFUA 4MKSA 2OLAA 4H1ZA 5FJOA 3OZMA 5FJUA 4DYEA 3DGBA
chains in the Genus database with same CATH superfamily
5IFPA 1RP9A 1GREA 4AUBA 4GUGA 1MQQA 5JH2A 2HNHA 1J11A 3TV8A 4MYXA 2CBJA 1J5SA 4AZ6A 4LEQA 3LGDA 5FEPA 5DFAA 4ZB5A 1YPXA 1UIOA 5FF7A 1XIEA 4O8AA 4PE8A 5D02A 3S3GA 1PX3A 3HIJA 1JZ2A 2PTXA 3ABOA 1LRQA 2V67A 1TYTA 3FHQA 3HQOA 4YU1A 3W2KA 3W2MA 3Q45A 4WSHA 1H1NA 2BDQA 3W0KA 2RJGA 4V27A 3OA3A 3IANA 4ADSA 1XIHA 3DESA 1TJ0A 4AB4A 4MLJA 4PEEA 4Q8NA 1GTEA 4XAPA 2HZGA 2RUSA 2ZICA 5EMYA 3K30A 3L7RA 5ECUA 2QZRA 4QJ1A 3KBJA 4ZEPA 1M9HA 4M6QA 4S3GA 1UG6A 1EO5A 3G3DA 2WOQA 3NYZA 2BVWA 1LLWA 2GH5A 3EZ4A 2HQAA 2PGRA 3U2OA 4UTLA 3IACA 1GVEA 1C7SA 4J3XA 1ZCOA 4WY0A 3N2TA 2O9PA 3ERPA 1U1JA 2QUNA 1JDCA 1XYBA 2X0HA 1RM6B 2P5NA 4J2MA 3T8QA 2WM0A 1E1CB 2ZUNA 1JCLA 2CBVA 1V51A 4P8UA 2Z6IA 4TVYA 4H50A 3M6YA 2BGQA 3OG3A 2ESCA 4GOAA 1W31A 2QCLA 1JUKA 3H7UA 3MPGA 1EKOA 2D2GA 4QG6A 4AD5A 1M3UA 1FWDC 2PUZA 1GVYA 3MV01 3W7IA 4YYCA 4O13A 3DKLA 1UWQA 4YVVA 1GQJA 3RU6A 5BYWA 4K38A 1P0DA 4WDWA 1FWRA 4HU8A 4RE0A 1D7FA 1FH9A 1W1TA 4K8HA 3OC4A 3S6TA 3UF9A 1K9EA 1UP0A 3GDLA 2QS8A 1S38A 1CDGA 5BRQA 1Q6GA 3ORWA 1OFDA 3DFPA 1XANA 3Q67A 4S1FA 2QQ6A 2I9UA 1OGSA 1PWLA 5F2LA 1BQCA 3LLDA 4MKVA 1XDMA 1X6LA 2W66A 3TFXA 1TMQA 3AZSA 4GNJA 1BYBA 3LMZA 3WBAA 5A6KA 4I9MA 2VEKA 3DK8A 2NQ9A 4O10A 1R3QA 4TOQA 3OP2A 3WDQA 2YSWA 1MUMA 1W32A 1XBYA 1LLZA 2DH2A 3EXSA 3ZR5A 4WOZA 1JROA 1KFKA 3LEPA 5CH9A 3NQDA 5FSEC 4OHQA 4RDZA 1BF2A 4LVGA 4IXHA 3GFYA 3CMFA 4QEEA 2A7RA 1ZL1A 3U2EA 3C4UA 1ZQ5A 3V5OA 1P7TA 3K8KA 4JHMA 1N62C 3O1NA 2NZLA 2JIEA 3USBA 3EPOA 1K7EA 3OLGA 3N9SA 1JF5A 4DQWA 1Q5MA 1TPVA 3EYPA 1G9HA 1V7YA 3TQVA 1XCWA 1CZ1A 3RAOA 1JF6A 1KLZA 1YTKA 4QISA 4FNPA 4X0VA 2J24A 3W7DA 1FHDA 4QQUA 4LVFA 1GV4A 2G3NA 3ONBA 2DSWA 4PMZA 3TJIA 3WD2A 3MJMA 3MWAA 5K2ZA 4NYUA 5C71A 2W0UA 2X7WA 4H9UA 3P61A 4TU1A 2E3TA 2G8ZA 3VIOA 3NQFA 3DHPA 2IPJA 4HZ6A 1FWFC 1XL9A 4JIRA 1I1XA 1WDDA 4MY8A 1J6PA 3UJ2A 3TA6A 2J8GA 2PURA 5E1QA 5L9FA 2C1HA 3UPBA 1NWRA 1ZJBA 5FESA 4L1WA 2VWTA 4K8DA 2QCFA 3W00A 2WOVA 1XRVA 5I6SA 1Q4NX 4ZR8A 4B9ZA 1WPCA 3SBFA 5FEWA 4GYKA 4XZNX 3KE0A 3CPRA 4NJHA 1QBAA 2GGGA 1V3IA 1FFVC 4GXPA 2ZRXA 1TE1A 3CGDA 1D8WA 1JDAA 2H3DA 3L68A 5AYXA 2P10A 2HJPA 2BBFA 2DH3A 3C0QA 3ZJ8A 2W3RA 5C9UA 2BOFX 2YL5A 4D6DA 4GH1A 4GG9A 4J56A 4W7WA 3HTWA 5HWNA 1W2VA 1ECQA 2GDUA 3QHMA 4OFCA 5LHFA 1RBAA 1HJXA 1TYPA 4WJ8A 1RPXA 3RX3A 3NTYA 3S6OA 1NHRA 2X1SA 2INZA 2F6KA 5A6TC 3JS3A 4UNKA 3TP4A 4L1XA 3EMZA 1PB0A 5ECVA 4RUBA 3GDMA 2XN2A 3YPIA 4ERAA 5CSYA 1OJXA 3EWDA 1XRSA 1W1ZA 1H50A 2ZXBA 4XZWA 4AZ7A 2NLYA 1C8QA 1XINA 1QNQA 1Z32X 3HGJA 2J75A 3ITTA 2GWGA 3IRSA 3GXPA 3GFZA 1XIFA 3NQEA 3H4GA 3O6DA 1K03A 3BLKA 4GFIA 1O5XA 5CZTA 1W17A 2O9TA 4P8WA 1H7NA 4Y2WA 1QPRA 2J6VA 4KCTA 3A13A 1UWSA 3PWAA 3WH8A 2GL5A 4XKYA 3W1NA 4ATDA 1LOSA 1EA9C 4J7RA 1XICA 4CNNA 2OYLA 5D2WA 2J25A 2E6DA 3V0UA 3SRFA 1PDZA 4BI5A 3TQKA 2AAMA 3W1QA 1JNDA 3MA8A 1SB3B 5LZLA 1XGZA 4HZ8A 2DP3A 2OVLA 5REQB 1TE6A 2JBMA 2PDUA 2YFOA 3SCTA 3ZSSA 1PZ2A 3M5VA 5DCBA 2OELA 4JY9A 5FJTA 4J3UA 3B40A 3PBMA 3VGBA 3BMWA 1RCXB 3A9IA 1B9BA 1XJBA 4M6PA 4PBGA 4ENLA 5EPDA 1G94A 3UG5A 3GDKA 4KCUA 5F2IA 3PTKA 3VIKA 4MWAA 2F8QA 1RA5A 3N2OA 3WJZA 3GHSA 3T0TA 2XIMA 4H9ZA 2X30A 3F4VA 1YQ2A 3HPXA 2PE4A 3B03A 3PZUA 4M24A 3AMGA 2QV5A 4H7VA 4J35A 1QT1A 4N6FA 1JPDX 2OSXA 3SGGA 3VOIA 2DZUA 4AY7A 1AW5A 4HYVA 3S4TA 3S2JA 2WOWA 1JDDA 2E9MA 1XH2A 3SZ8A 2RAGA 1E43A 3LB0A 4JTQA 3GRSA 1CLKA 1FHUA 2Z24A 1FP8A 4GFSA 2PZNA 4Q8OA 5LGXA 1XHCA 2WSPA 1DQUA 3GD4A 2XWDA 4D1IA 1UA7A 4OVXA 5HAOA 2PC8A 3DU0A 1KN0A 5A69A 3EA2A 3SO7A 4ZQNA 2GQ3A 4D6HA 1GRTA 4QSHA 1EHAA 4NUWA 4HNCA 4HOXA 2WQDA 1AQ0A 1P4CA 4R33A 2OO6A 1TZ7A 3C0SA 3NVVB 4DLMA 3B9AA 1N2VA 3EOOA 2A3HA 1G4TA 3MDWA 5LNSA 4Q8TA 4Q8QA 3BLOA 2Z7GA 3PM6A 3PULA 4MPQA 4WDTA 2OKTA 3W70A 5C0QA 2OCZA 4PN2A 1MFVA 1TX0A 1GG1A 3HM7A 5EBUA 4H4QA 1EQPA 4BY3A 3UR2A 4DELA 3QMSA 1FCVA 1NAL1 3TJ4A 3KBMA 3EXTA 3WFAA 1XF0A 2WSRA 3FVDA 1X96A 3AYRA 1V3HA 4PCFA 1JXJA 3HGSA 4CEXC 4ZENA 4FR1A 3GC5A 3M5ZA 4R53A 4RL3A 1NOWA 2E8ZA 2FVMA 1HL9A 1EYWA 1JG9A 3Q58A 1Z9AA 4X9SA 1DQXA 2Y0FA 3BV4A 1GCYA 3I10A 1M5WA 1ME7A 1OK6A 1RQBA 2PWEA 3RM8A 2FPTA 3NSNA 4NXSA 3CLWA 4CGTA 1KBIA 3N2CA 4CQ9A 2OLSA 4LY4A 4Z2LA 3DFOA 4E4UA 3ZT7A 4V15A 4MZ8A 1ONRA 3P8JA 4RDYA 3KL3A 4NNAA 1RHCA 4RV3A 1BGGA 1NHPA 4S3AA 3W26A 3CPUA 1W5PA 4BEQA 4E5TA 1EP2A 2HXUA 4UQDA 4H7CA 1BYAA 1QWKA 2R1NA 4Z17A 4BQ4A 2CPUA 4UR9A 1GYMA 1YRRA 3CJPA 1EPVA 1OX4B 1DQWA 2CZ5A 4RW3A 4JN8A 4D8AA 5JUVA 2Z1VA 3VDAA 1F3XA 3CTLA 4DLFA 3ECQA 3RK8A 3GTFA 3UXIA 4MMWA 1TTJA 4B5SA 2VFEA 3GRIA 5GNXA 1WYIA 4O1BA 2QGHA 4REQB 2H6RA 1GUVA 1XSKA 3BH4A 1TPH1 3E0FA 1SFLA 3VC6A 1EPXA 4UFMA 2BG5A 2BLEA 1DWFM 1XDJA 4XIAA 1YHTA 1R3WA 3SN4A 3GG0A 5MKGB 1OIFA 4ORIA 2XJ7A 4F0LA 2PLJA 3W24A 1S5VA 4Q8VA 4GIEA 1R87A 2CLOA 1IV8A 4GIAA 2E28A 1JCXA 5T9BG 4EAMA 1WUFA 3H26A 4RX0A 1OD0A 2XFYA 2ALRA 1J18A 4M6VA 3UZ5A 2J66A 4U2ZA 2VC7A 5ABFA 2X8HA 4QJ5B 3DFYA 1FHVA 3EEGA 5MHBA 1TB3A 3N17A 1EXBA 3GLCA 3L65A 1XGDA 2ZUSA 4C6BA 4TX9A 1AZ2A 1OCJA 4A3RA 2E9LA 3A4JA 1MEIA 1OC6A 3K1DA 1L6FA 1CYGA 4FS9A 4LYKA 8XIMA 4PL1A 1UHVA 1EUAA 2Y8VA 4NNBA 2PDHA 1VPXA 2YZRA 2XVLA 3BAIA 3CM4A 4WOQA 4NIRA 1ODUA 3BV7A 3PJWA 4KESA 1VC4A 3AQUA 4NAEA 5AHIA 3HRDC 3T42A 1TJ1A 3A7AA 3KLJA 4Z2IA 3AMCA 2Z25A 3RR4A 4LS1A 1GOXA 5DO8A 7A3HA 1PCWA 4GJJA 1B31A 2OODA 4JTLA 1Q66A 3NL2A 5HR7A 2HVMA 1XP3A 3CWNA 4X9YA 2ODOA 1NDZA 1ISXA 1S7MA 1EP3A 1X8CA 1H7PA 1QPQA 2ACUA 1ZMDA 2DJXA 4MDOA 3GB6A 5XIAA 2Z4GA 1AL7A 3B05A 2FZ9A 4KEZA 3EA1A 2VR4A 4XBJA 1JGIA 1XCFA 4IX0A 4LT9A 3RLUA 2DW6A 3V16A 4AZCA 2WVVB 1WXJA 4L9XA 3EPMA 1XYFA 1MNZA 3C0LA 1UH2A 2CHOA 3KTXA 4ML4A 3VZYA 3GZAA 3URNA 2CESA 3M0MA 2EQ8A 4PMQA 1JRPA 2PSNA 1M7PA 2C1IA 3NQGA 2DPEA 1GZGA 4UTWA 1K02A 5CKSA 3VVGA 1OGBA 1ONXA 5A5WA 2KZHA 5CPQA 3H4KA 5LNWA 2VFIA 2XGIA 3VD9A 5LA2A 2VI0A 3E0VA 2X8RA 4LIIA 2PCQA 3H2OA 3VIJA 2IQDA 2BHZA 1KFCA 4KIEA 3MCNA 2XHYA 4M81A 4DUOA 5C9XA 4RK8A 4OV4A 1DWHM 4FR6A 3TTOA 5JCMA 4RZBA 2WWDA 4JFSA 1DP0A 3M43A 1OB0A 4UFHA 3EAUA 4Z2GA 3IARA 4UR7A 1B5TA 4M1RA 1W0MA 4GZ7A 1E9YB 1Q6OA 1R85A 3CQHA 5LHEA 3QC3A 4EPEC 4YMZA 4DPPA 1Z69A 4XTIA 1MEWA 3D6NA 3KCJA 4JL1A 5HR6A 2HISA 2Y6ZA 3F4CA 4DI9A 3N6QA 2WANA 4H4RA 2JE8A 1R8LA 4X2PA 4AIUA 4B3ZA 1Z44A 3H55A 1DYSA 1OYBA 2XISA 4ZOCA 2ZZ4A 3BJTA 2OEKA 2Y62A 3A4AA 5HANA 3FY1A 1DORA 3MCOA 3WFLA 2QULA 2TMDA 5KETA 3TXVA 1V5XA 3TVAA 2TAAA 1YDYA 1LCOA 4HBKA 2GDVA 2ATSA 4ROPA 2E9BA 1XR2A 3CZJA 1KXTA 1GVFA 4EWJA 3VC5A 1XLJA 3EOSA 4GXWA 2BVDA 1A5MC 3OPSA 5DCDA 3KWXA 1OHLA 5KTLA 2CWNA 4HHMA 4I7WA 3DH9A 7TIMA 1JAEA 1H7XA 1C90A 4WXZA 3W7GA 1BPLB 4AVOA 1I9CB 4AD3A 3O16A 1H63A 1HJWA 2CW6A 4PBFA 1WA3A 1KFBA 1HO4A 4QSFA 1CW2A 1JZ8A 1QPKA 2NT0A 2FFCA 2IKJA 3A3WA 1X6UA 3R4IA 3H2MA 1GKRA 3GW0A 3ICJA 1Y5XA 1JZ7A 3O0HA 1H7WA 4C6LA 1S2TA 4GMEA 6CGTA 1W91A 4JHZA 4Z1AA 4UFKA 4V33A 5CLWA 3ARUA 2BV9A 3TDFA 3VNJA 3G1YA 3LOTA 1HKIA 4UMBA 4AZIA 4BHYA 1I2QA 5HNTA 4BKNA 3RN6A 5I07A 2QMJA 3DOPA 1LYXA 1D3GA 4LANA 4JFUA 3F4WA 1TUFA 3IIPA 2WBAA 3UWQA 3VNMA 2FPYA 3NL3A 4UIOA 2GLKA 2WMIA 3GVRA 4JTHA 4QX4A 1TA3A 3UA3A 4HPGA 1IIHA 1JZ4A 1VJZA 1ZALA 1NQKA 1EC9A 5LIUX 3WF1A 3F4DA 2ZWYA 3M0LA 3O6YX 4Z2JA 2YA0A 5FF2A 4YWSA 1FKWA 1E70M 2E4TA 3AROA 4BI7A 4MB5A 3ARZA 3GG1A 1JYNA 3ZM8A 4HKPA 4WX2A 4A4AA 1BXNA 2VCBA 3VMNA 4ACZA 3AISA 3GG7A 4ZOEA 2Y70A 3QQ1A 1W5OA 3WDRA 2INEA 2XWEA 5CC5A 4Q7IA 3TMLA 2OZ8A 2X40A 2Q6ZA 5LGZA 4IQJA 3WQ5A 1NQ6A 2ISFA 4C6DA 4PTNA 8TIMA 2FJUB 2IW0A 2QPUA 4NZ1A 2EQ6A 2XYLA 1PTGA 3Q4DA 1QASA 4PUEA 3QLLA 2IPWA 3LN3A 4ZVJA 4AZ5A 2Z1KA 4L65A 1VDVA 1VHNA 2DVUA 1I75A 3CUHA 4K3ZA 3WF2A 3VFCA 2FH8A 4D8ZA 4E2OA 3I6RA 1M1BA 1BTCA 5BZAA 1UMLA 1GKPA 1W8SA 5IDIA 5CC3A 4H04A 1M01A 3EF6A 2VD9A 4DZIA 3R8HA 2D2OA 2A79A 2G3IA 2I5QA 2HXTA 3G0UA 5E70A 4L7ZA 3G3MA 4U10A 1E4MM 4N9DA 2A3EA 4IL0A 2F38A 4Q8WA 3OJGA 4MY1A 4Z1YA 4XZMX 4NEVA 2P1FA 4PMJA 1GERA 5F4XA 3UWVA 2WHMA 2V63A 2F7FA 3MMDA 3VM5A 3B8UA 3TSMA 2PDIA 2UZ9A 3P81A 1IEWA 2AGTA 4KFPA 2CBUA 2NW0A 4A8RA 2R8WA 1S39A 1JYWA 3AIUA 2WJZA 4IPLA 4ADUA 4JZ5A 3GD6A 1UPMB 1Z7AA 1FWIC 2Q8LA 2PWFA 9CGTA 3QOKA 4B5TA 2C79A 3L23A 4ECLA 3V1PA 2WSKA 4K7YA 3MU7A 1EOMA 2PP0A 4BR1A 2WHKA 2Z1WA 1DJQA 3ZOAA 2VDIA 2FGLA 2VKZG 5FJUA 3O6AA 3NAVA 1EGMA 3TSBA 1OIMA 1CECA 1M41A 3PZTA 5CCZA 3SRDA 2VL4A 4DY1A 1VBGA 3UJSA 2C91A 4LF2A 1PKYA 3URQA 3LA4A 1T8XA 2Z7KA 1SSGA 1BTMA 3A9BA 2G95A 2VX4A 3TYAA 5GJNA 4BF5A 1QXLA 2GR1A 4JIHA 5I00A 3F4NA 2Q09A 1OYAA 3WK2A 5CC6A 1K7XA 4AG0A 4G5DA 4MKNA 1X2HA 3FEQA 5E5CA 3G1AA 3PTQA 5LIYX 1O7AA 5JVLA 1F6YA 4UFJA 3RHGA 4DAIA 1GSNA 4IGHA 4NASA 4AU0A 4QBXA 4FEZA 1RV8A 2G5WA 4L80A 3B4YA 2PDXA 3MSDA 4Z1CA 2D0HA 5LIWX 4RZ5A 2PDCA 4GRTA 5M17A 3R25A 3NQ8A 3LX9A 4ZSTA 4FNQA 2Q8XA 3OVRA 1L6SA 1XLIA 5CPTA 1Z8AA 1F61A 3LD5A 3C2EA 2NLIA 3RPDA 1H6VA 3IAPA 3M5YA 4ZO7A 1HTIA 3TFCA 1PVNA 4LB3A 3MUY1 4F0SA 5U25A 4RDWA 3OZYA 3LQGA 3P67A 2QCNA 3BAJA 2CLPA 3C56A 3PBUA 4W86A 5DQPA 2NXGA 5CJNA 1GK8A 2PRHA 5EFFA 3PF3A 1EIBA 2AOSA 2PDLA 3BVJA 4JR5A 3H4XA 1ELSA 3HQ1A 4LX4A 1UH4A 4QAWA 1AMYA 3SGUA 2A2IA 2GGJA 4S3CA 1JUEA 1TV2A 4NZ3A 4J27A 3W2LA 3WF4A 1ESWA 1HJSA 4X2RA 2XU2A 3WH6A 3V5CA 4LA1A 3CZEA 3AMDA 3SN1A 2WMJA 1GVOA 1BKHA 1QCWA 4P7QA 2GJXA 3PG9A 3V18A 1W3TA 4D2JA 1UJPA 2Y7EA 2YR1A 1BXBA 3EWXA 2YW3A 2GWNA 3VKKA 4J1OA 2DSZA 4CQ8A 2F61A 1W3HA 3W85A 1E6QM 2GOUA 1R3TA 3P80A 5D38A 2QHAA 4K8EA 3JZEA 1PYFA 1E40A 5C2GA 3N1AA 1W3JA 4ZL1A 1G69A 4H7ZA 4A29A 5CG0A 5I2UA 3UZYA 1PX4A 1OFRA 3FXGA 1PX8A 1GRHA 5DXYA 1GQIA 1J2BA 1W37A 2Z2UA 4LNCA 2EPHA 2ZA3A 2X2GA 3AWNA 4JDYA 1POKA 2UY5A 3TLLA 1VB9A 4LVAA 2EQ9A 2WSYA 2XG9A 2ZZ7A 3E2QA 4KKXA 4FLQA 2ZZ5A 1GETA 2VZOA 1H62A 5CBIA 4P61A 4JTSA 2NV2A 1H1ZA 1QAPA 1IYXA 1OYCA 3LHTA 3VABA 4FAMA 4X3ZA 1RK6A 3H22A 7REQB 3SB0A 4NL1A 4HA1A 1L2QA 5LNRA 3KBNA 2E1WA 3S9IA 3MYOA 1F3EA 4PB5A 2J47A 4LYQA 3N11A 3W02A 3H2EA 3PR2A 1XLBA 4W88A 4A2SA 4IX2A 2YPIA 3UJEA 3DKJA 5C8BB 4N42A 5D03A 1YXDA 5A6SA 1ZB5A 3OW1A 4K2SA 2YDRA 1EJRC 1MMFA 5AYBA 4GR1A 2CHRA 3NOEA 1SO3A 1EOKA 3TONA 2ASHA 2Y7DA 4OQVA 4N2YA 5DBTA 5AB3A 1AH3A 5A1AA 2ZXAA 1GVQA 1MNSA 3BW2A 4TMBA 1BG9A 3PBVA 3ARXA 3QGAC 1WQ5A 5A2BA 1QW7A 5AFDA 5HJXA 4Q3MA 1T96A 3SQLA 1X1OA 4DXKA 3WH9A 1TWZA 2GQWA 1TWSA 2Y85A 1NDYA 4YN5A 8XIAA 2TPSA 1R7AA 5A8GA 4UCFA 4C91A 4HN4A 3OBEA 3W22A 3STCA 3CHVA 2QT3A 3N25A 4GQRA 4DJFD 3OA5A 4PMXA 3BGGA 3NIYA 4AIOA 3NPVA 4WZHA 3AHVA 3AMLA 5DMYA 3MZ2A 5HA7A 4CD7A 3LNPA 2EKGA 3RPMA 1VYPX 4IUGA 1EXPA 5A94A 5JH1A 3LI1A 3QY6A 1VPQA 3QTGA 2A6NA 2XDFA 5FF0A 2NXIA 1MDLA 2QKFA 3KAOA 3ME3A 3LB8A 3EKLA 2X50A 1UD2A 1XLEA 3WNMA 3QOMA 1YDNA 2ZQ0A 3GDRA 2Q3RA 4H4YA 3HOJA 4FOUA 3BICA 4C6PA 3VOFA 3UZWA 2FB2A 1PEZA 2VR2A 3W25A 1B3OA 3QFBA 4ZQCA 1WDPA 1TFVA 2YDSA 3W76A 4P2VA 1DEDA 1LJYA 3BOLA 1CENA 3B04A 1U1HA 2JF7A 3KL5A 4UB9A 3W88A 1RALA 4NJKA 3WBYA 4WY0F 1S5MA 1RVKA 3AWOA 3IIOA 4KF1A 4IPPA 5DMNA 4ZQOA 4W7VA 4NAFA 5AVNA 4CD5A 3NYDA 4LW7A 4H4VA 2OGJA 2PWUA 1LLOA 2RJHA 4XUYA 5FJJA 4PYSA 1Y7VA 3VKDA 1XXXA 2D73A 3PJUA 1EEPA 1E0TA 2J7GA 1UKQA 4WY0B 3SR6B 1QR7A 3U6WA 2VHLA 3OZOA 1LBMA 1IT0A 3B8TA 4NU7A 3AJ7A 3AXHA 4IQEA 4G1NA 1X8FA 4QFUA 4LBSA 1JD9A 3KXQA 5K3VA 3C61A 5GJMA 3MT1A 1G4EA 4PUMA 4L4MA 2RFGA 3EANA 2WJFA 3S5OA 5D32A 3APYA 1NSJA 4AH7A 1H49A 3W6YA 1R46A 4EM4A 1EZ2A 1FCUA 4PGLA 4L9YA 1H0IA 3DGZA 3OIXA 3OVPA 2AQWA 1O5RA 1C91A 3RLGA 9RUBA 4GYJA 1MRQA 1D7YA 1DXIA 1W1PA 4Y9AA 1QMLA 4NNCA 1RY0A 4YTUA 4ZE4A 3OBKA 1TVLA 1TUXA 2WP5A 5C2CA 4S3BA 1QU4A 5H8UA 1JCNA 2JK2A 3U4FA 2DIEA 1UUQA 3GKAA 3TNOA 3RCYA 4JD4A 2VFHA 4Y90A 4JBRA 3KP1A 4GJ1A 3AIEA 2D3LA 1GT8A 1RP8A 1PZ3A 2V3AA 3IVSA 5A8NA 3UNDA 3WCZA 4MB3A 4O1DA 4GCAA 2DZAA 1NFPA 2WJEA 3A3HA 3CUZA 2XTKA 1NF7A 2E8YA 1JCJA 1LOQA 3I6EA 4QJ4B 3PTDA 1UUMA 5HJLA 1GVSA 1Q8JA 3K13A 4A3YA 3P82A 3WLMA 1P7TB 4GY0A 3AIRA 3JUGA 4MZYA 3TW7A 1DJXA 1VBRA 3DENA 2VGFA 1VYRA 2HK1A 3CPGA 1QJWA 1K6WA 3EOLA 3FDGA 1B90A 3M41A 3ONCA 2NX3A 3UBPC 2R91A 3TQ0A 3M0XA 2E77A 2WB5A 3V4BA 2DFAA 1TSIA 2BMBA 2XFWA 3PUOA 4PCSA 4DHGA 1OD8A 1V97A 3L9CA 3G1VA 2WKLA 1EDTA 1V6UA 3GKFA 2A3CA 3LY0A 4B16A 4ZOBA 3T55A 3LM3A 1B4KA 4P7RA 2ZUVA 4OZOA 1K70A 4JYFA 1ZU8A 2QCGA 1TV7A 4KEVA 1SQ7A 2VUYA 3TOYA 3VCNA 2B81A 2PRLA 3MUCA 1PAMA 1SJBA 2VJXA 4WKHA 1U5VA 2CKRA 5G1YA 1D9EA 4BV6A 2BS9A 2IS7A 3K46A 3D5HA 4QE4A 4XD5A 1V6YA 1JPIA 3FX4A 4K1GA 3TEVA 3KVKA 3G1HA 4S3DA 2CU0A 3GG8A 4KWUA 3QPYA 3AHTA 5CJ5A 1K6AA 4NHVA 5G2WA 3WZ0E 5CQ1A 1LQ2A 4IPNB 4UQBA 4EMJA 5A6BD 4IIHA 3WLSA 3CYVA 2EF9A 2REQB 4O17A 3WEMA 4R7WA 1OC5A 3WELA 4O54A 1BSIA 1JDFA 3UWEA 1SR0A 3ITVA 2CHNA 1WXZA 4CQBA 1T5AA 3R13A 2YYUA 1E9ZB 3W7OA 3BAYA 3REQA 1H41A 2R1MA 3ITLA 1UR4A 4LB4A 3JZUA 1H1YA 1E1EA 4LALA 4GVIA 1N8IA 1E71M 3EDEA 1RZMA 3GO2A 1UB3A 2A3LA 4C7GA 4K7VA 5BROA 4WCJA 2C7FA 4Z08A 3VNKA 1GTHA 3B9NA 5AHEA 3WO8A 2V2CA 4S39A 5CEWA 4KFOA 3CT2A 3B8IA 4E3TA 5KINA 1US2A 4B91A 1DV7A 2J7FA 2ZZBA 1YEYA 3GD3A 1SW0A 3GAKA 3MKKA 4NY2A 1HP4A 2DU2A 1W3IA 2G4JA 2QF8A 4EQRA 4WLCA 3GTHA 3MMUA 3AHZA 3LRKA 3MJYA 3VAVA 3U8GA 4Q33A 2YL8A 3LHZA 4F2UA 1NF0A 4M56A 1E4IA 1J0IA 4XKYB 2W27A 3APGA 3DHUA 3TWAA 2PDFA 1G5AA 3DI1A 3MP5A 1TZZA 1NOFA 2ZX6A 2MANA 3UY8A 2J7HA 3LNMA 4IP5A 2YKKA 3MBFA 2W3SA 4FLOA 3F5LA 2X05A 3QBUA 3HPFA 2QUUA 3GR4A 4AWEA 4XK2A 1TELA 3GNOA 5D9NA 3HW2A 4QGCA 5MKGA 1E73M 3GW3A 3VA8A 4RDVA 3NL5A 1XLAA 4ZB2A 1K8YA 4I7VA 4D6GA 4MWAB 5HWMA 3WIJA 4A6GA 2XVKA 2YBVA 3M0YA 3SCVA 1KO0A 1B30A 2WVSA 5M5DA 3A22A 2X1RA 4UTMA 3E5PA 5BMXA 1QPNA 1D2KA 1RK5A 1M6IA 3VCCA 3O07A 4B5NA 2XZ7A 3P6LA 3FAWA 4IFOA 4P7OA 2ABAA 3T4CA 1J0JA 1L2UA 2PGEA 4IIGA 3GIYA 2Z26A 1EBDA 1TIWA 1MOKA 4FIRA 4RR4A 3VE7A 5C54A 3DX5A 1FX6A 1FWNA 1JPHA 3VIPA 3N34A 2ZX5A 4XAGA 4AEOA 2VEIA 4LS2A 4I7UA 3WMCA 3IGSA 3RUBL 3BLFA 2YQUA 3OVGA 3WNNA 2VCAA 1QNOA 5IHRA 4NJIA 3BURA 4TQTA 4LF1A 1DKWA 1J96A 4C6FA 3W1PA 1XLGA 1A49A 5CAKA 4DJED 2WK2A 3WQOA 5C7VA 1PSCA 5DT7A 3AM9A 2CZDA 5BOOA 1MVYA 1QUMA 2P3EA 3MB9A 1Z48A 4H1ZA 3MSGA 1US3A 1S2VA 2CFFA 1GRAA 2ZVIA 4GABA 3W6MA 4DJDD 2PDPA 3WNPA 1UWUA 3R12A 4C6KA 2OSYA 4QTGA 4NF7A 5JBFA 3ZO9A 4O0ZA 4BCEA 2ABBA 3IK4A 3NPWA 4P7NA 1JFXA 1W3KA 4ZFMA 4Q8MA 2GR3A 3UU0A 3D46A 1K8CA 2PFHA 4RXGA 3PUGA 1FEAA 1V7AA 2EG7A 4XVDA 5CPMA 3TTSA 3O7UA 3VIGA 3H24A 3B0VC 3H53A 5GRTA 4LU0A 4ZTYA 5H8PA 3W73A 1XG4A 3G1RA 4IIDA 2H8ZA 4EQXA 2BOGX 4YTQA 3N19B 4CN6A 1L6GA 9XIAA 2JFEX 4ALDA 4LBRA 3VGEA 4W5ZA 5ER0A 2XSXA 3GBEA 1H3GA 3KLLA 3WJXA 2NSXA 5BNKA 3SW6A 4TMCA 3K4WA 1E1FA 3QM3A 5CBBA 4TIMA 5BCAA 2F9RA 4QAIA 3XIMA 2BVTA 3DI0A 1GOKA 1UUOA 3VZXA 2DZVA 2JGYA 3WBEA 4EMWA 1JZ6A 5D4YA 3W75A 3LGGA 1QW9A 5KVIA 4NRSA 3TQPA 3TYBA 2G3MA 2P76A 2B4GA 4AY8A 3RFAA 4IPJA 1TRDA 3CWOX 2W54A 6TAAA 3AS2A 3KM8A 5HWJA 4M7TA 3E0IA 4N7QA 2ZZ3A 2E68A 1R47A 4H9VA 1FFUC 1TPUA 1K9FA 5HNRA 4LUTB 3W01A 4UTHA 5E93A 1T41A 1FWCC 1UR8A 3N29A 1U5HA 3DCPA 1F6PA 2BTMA 2GVLA 2V2HA 2DZBA 2BFGA 1LOLA 4NZJA 5LA0A 2E5BA 5M3WA 2GGHA 4IMDA 1FFQA 2XGBA 4WDXA 1SMDA 2WNQA 3LG3A 1VENA 1WDWA 1HT6A 1HJUA 3IGXA 3NQMA 3RU8X 4C6IA 1I45A 1E4LA 3AIVA 2ONEA 3LXAA 2CLMA 4XAFA 3DH7A 1J0KA 3E0LA 3EX2A 1THFD 2XH7A 2E5AA 1KM5A 4LJ3A 2W61A 3GE7A 1DWAM 1DJGA 1N8WA 5TIMA 4HNNA 1U1UA 1N55A 5I3GA 2W62A 4H8HA 2VM8A 1N63C 2EJ1A 4PRRA 1J93A 3V7PA 1AA1B 2PD9A 5HQMA 2YL6A 3EBVA 4K36A 1N8FA 3TJLA 5ABFB 1C8YA 3N6HA 4JY8A 1TTIA 4WVXA 2BOEX 3T2QA 3M44A 2O4QA 4I9JA 2ZZ1A 3SI9A 4DWSA 4AFYA 6ENLA 6REQA 3WQFA 2BODX 3QZEA 3BANA 4X60A 1KNWA 2FVLA 4S3KA 1XLCA 3AFBA 1VBHA 5CG7A 3CWHA 1GG0A 5BW6A 5C6MA 1VF8A 1F8MA 2V68A 4A35A 2BXYA 1BRLA 3FLUA 4PTMA 4S2CA 3ID7A 1OEPA 3O0FA 3PVFA 1STZA 5XIMA 4NAEB 3PWIA 5AKQA 1R2RA 1WE5A 2J9XA 4IIFA 1QOPA 3NO3A 1QPOA 2PF8A 4K1WA 5EBAA 3R43A 2LLEA 3NDZA 4H2CA 4G6CA 3TAOA 2VXNA 1TV4A 4DXXA 2ZIDA 4H4PA 3PPHA 3CC1A 4JYEA 4QROA 1K4QA 2Z28A 3DC0A 2V3EA 4JFVA 3TJXA 1XBXA 2FMNA 3HQPA 4JNYA 2G50A 4YVXA 4HU4A 2PDWA 3S0CA 1XX1A 1EC7A 1M68A 2J13A 2XFRA 2QPSA 2BGSA 3WUGA 3C8FA 3ALGA 4WSJA 1MUCA 4S2BA 2OOGA 2Z6JA 3FOKA 3MI2A 3BDKA 1EF3A 4WK9A 4M3PA 3ARQA 3FGCA 1A5CA 3HV9A 3U7VA 3I3EA 3VD7A 3RR1A 2XH0A 2MNRA 2DZWA 2FIQA 4PUUA 2ZX8A 1S46A 1FWBC 3FCPA 1UC5A 3VPLA 5CZKA 4GUFA 3CGEA 1X38A 2ZXQA 1QI5A 2GVJA 3IIXA 3DYPA 3OLIA 1MYRA 5D2YA 3GZ3A 3W27A 4QNEA 2ZWZA 2X99A 5H6HA 4Q4KA 1RJQA 3SURA 1TPB1 4QDWA 2ZRZA 4A8IA 1ICSA 2YGYA 3DG6A 3IRDA 4GZJA 1V6WA 3GXMA 2WWCA 3W2NA 3TIMA 1O1ZA 2V69A 3L4ZA 4EQSA 4GQQA 3K8MA 3KRBA 4LAKA 4UNIA 4F40A 2GOKA 1FDZA 3ITCA 4JL2A 3TZNA 2ZX9A 1I2OA 3C86A 1OVDA 2I57A 2YB1A 1E72M 4W85A 2A0NA 4XO6A 1PWMA 2VYOA 4JHOA 4FP1A 1E0UA 1YXCA 4XBSA 5KZ6A 3HFTA 3TR9A 1RAKA 4CVWA 4RXFA 2WPGA 4AMCA 3N18A 3GDBA 1MW0A 1IGSA 1W9UA 1ADDA 1CGVA 3KVMA 2PDNA 2PLMA 3FIGA 4FX8A 1GGOA 4LS0A 5CPLA 2V3DA 1FCQA 2QJMA 3N4AA 1HG3A 3E1F1 2QJHA 2WW5A 4MGGA 1E9LA 1GVRA 4ONVA 1GOWA 1ONWA 1TPFA 1KTBA 3I7SA 1N82A 4MAVA 3ABZA 1B57A 3CIXA 2Y4SA 4F2TA 2ISWA 3OZMA 2B31A 1YPFA 3BSGA 3TN3A 1UKSA 1DHKA 4I5XA 3TH6A 4ICMA 3DUGA 4DF2A 2QCCA 2KX9A 5BU6A 3W3OA 2V5BA 2QJNA 2OQLA 4WF7A 1MRAA 1YE4A 3VIFA 1WKFA 4HHHA 1EBGA 2VD8A 1S3TC 4L4LA 3GVWA 1XISA 4LUYA 1GEUA 2CKSA 3QR3A 2E3ZA 2AGKA 1V79A 5EGRA 4HMDA 1L9WA 4PZVA 5EMMA 2X1IA 4CD8A 4DO4A 5D05A 1RQHA 4Q6XA 1EJXC 4H01A 3EX1A 4CD4A 4H6RA 2WHJA 3KLKA 4QG9A 3NJ3A 2HBXA 1ZZMA 3M07A 4IT1A 2NUXA 3PZMA 2OTDA 4FXJA 1GZ1A 4F79A 1OY0A 2PTDA 5I77A 3SCWA 1E3ZA 3DDMA 2CLLA 4CNUA 2YCLA 4MADA 2BWGA 4N0RA 1OK4A 1FH8A 3WMSA 1VR6A 2H90A 1RLCL 1VFMA 3LZ5A 3R0UA 4Z1BA 2EPMX 3U7BA 5T26A 2V0TA 1KR1A 1FOBA 4L61A 5EL1A 1W9DM 1XW8A 3WK3A 4HPNA 3QV8A 3B9JB 3NZPA 2PWHA 1H4PA 2GJLA 4B15A 2I14A 3POCA 1GESA 2TRSA 1YMYA 2D2JA 1YX1A 2FDMA 3VDCA 1TA3B 3P14A 4FXRA 4JNMA 2WNWA 2V82A 2DZPA 1KW1A 3VD4A 3DERA 4KCWA 2OEMA 3MKVA 3PPGA 2CEQA 3FDKA 1XH0A 1F2JA 4TVUA 4ZGYA 4ATWA 1G4SA 5F1VA 4YTRA 3QV6A 3ZVHA 3GIQA 1TVNA 3FNDA 1ZX9A 4K8GA 5E6YA 3RRAA 2C6QA 3COTA 3M5XA 3VZZA 2DT1A 5LXEA 1G1YA 4NSBA 1TWWA 1VCVA 4NXKA 4ACZB 5JXQA 2V9DA 4PUJA 1PPIA 1UH3A 3NOYA 1PUDA 3T2OA 1FY6A 4DJFC 4C5ZA 3GXNA 4KT2A 3LS9A 1UZHA 2QJJA 1CGTA 3SCNA 3GH5A 3LPGA 3LLXA 5EFDA 4GH3A 2XH4A 5F4WA 3TN4A 2E6AA 2D22A 4LUIA 1Z41A 3C8NA 5MF5A 2ZC1A 1RD6A 1UBSA 5AHFA 2GVEA 2VWSA 3C6CA 2ANUA 1Y5VA 1GOIA 1UD5A 1AD1A 5K9DA 4KPRA 1YBQA 2VFGA 4UNLA 3ZT5A 3E49A 3AXXA 4LEFA 7XIMA 2VNCA 4LV4A 3BLPX 1DWIM 1Q6FA 4ORMA 4RZ6A 3S1UA 4YLWA 1LT7A 1MUWA 3BMVA 4DF1A 4B4FA 4IG2A 5HQEA 3S2LA 2J88A 4C90A 3HG4A 1UD4A 2HVNA 4AYGA 4ZZ9A 3O63A 1GKQA 3QVQA 4OUEA 4BQ2A 2PU1A 3BXWA 3CO8A 2VGIA 3GTNA 1PDYA 1BFNA 3RG6A 3WL0A 4KWVA 1R9ZA 4GNVA 1A3HA 3BLLA 1QO5A 5E9XA 1U30A 1SZNA 4UC5A 3M47A 3AHXA 1EX5A 1ZTVA 3T0BA 3II1A 2HROA 1TPDA 3RJXA 3G8RA 3NPXA 3DFTA 2G96A 4MF4A 4NYYA 3M46A 5G2IA 1VP5A 4A05A 3DJJA 4G7EA 1YPIA 2QDHA 2FH6A 1WKDA 4ASTA 3II4A 3PZGA 2WC7A 4TX8A 4AIBA 4C60A 2O92A 4AC7C 2FMOA 3A5FA 2CLHA 3CUIA 4FNSA 1UKPA 2WZIA 2P53A 3W1TA 5FAGA 3CZLA 4GA8A 4PTWA 1HP5A 1EWDA 3SCPA 1N60C 1WX0A 4M51A 5A8PA 4ZQMA 3KDNA 2CFYA 4JGDA 1A5SA 2GUYA 2YJQA 2WPEA 1IZKA 3G6MA 4I5UA 4RJEA 4IOTA 4Q4OA 3WQVA 4PSRA 1QDSA 1VIZA 3WY1A 1P6BA 3SSZA 3AN1A 3CH9A 3PZIA 5H2ZA 1AH0A 5D9MA 5CBJA 1V08A 5CPOA 3G2GA 4R88A 2WMKA 4Q22A 3U3HA 4YPJA 3VOHA 1BWKA 1NWSA 1C93A 1CLXA 1S5NA 3STEA 4EF8A 3UJRA 3URAA 2W92A 1LDCA 3IJQA 2JKPA 3ES8A 4JTTA 3VOGA 1MSSA 4MDPA 3RX4A 4H4XA 1Q63A 1EC8A 4PTXA 2VRQA 3LTPA 4JTIA 1KM4A 1NARA 1XC4A 5A8QA 4KERA 1HNYA 3LPOA 4GBUA 4YCOA 4IL2A 2Q02A 1R3SA 3SCOA 3HJZA 2OT1A 1ECEA 3GRTA 3NO5A 4XVEA 1KWKA 1K4GA 4Z2HA 2A7NA 3IWPA 1S2AA 2A85A 1FWWA 1P6CA 3AICA 3AYVA 4U3CA 4XG1A 2GJXB 2WNZA 2C15A 1VQZA 5E0CA 1TVPA 4ADTA 4DO6A 4PUDA 4CCZA 1XDIA 2NWSA 4INFA 3NGJA 4DZ5A 3KOWA 3P3BA 2FZNA 3DK4A 1D3HA 3CZKA 1CXFA 3TYUA 1Q85A 1M7OA 3WYZA 4PB3A 3EKZA 4FF7A 4ZQRA 4GYPC 5FJPA 1YDVA 3HJEA 5D2VA 5G5HB 5HNUA 5GNYA 2OR2A 2INFA 3UCQA 3AZRA 5TD4A 2E0PA 3L4XA 4JEQA 2VX5A 3BAXA 1EHNA 3GNDA 1CXHA 3P0XA 5HDRA 2UBPC 3TTQA 2RGLA 4E4PA 1KC7A 4DO7A 1OZQA 4JTCA 2EG8A 2BSLA 1PCKA 4DVOA 3CBWA 1GZJA 1LL6A 3B06A 5FJIA 3C3NA 4CNPA 1MZHA 3M6DA 2FHBA 4XSLA 4TR9A 5CSUA 3HQNA 3KCLA 4TUFA 2AAQA 5I09A 5CGTA 5I3DA 5C5YA 3P5ZA 3ZS4A 2EJAA 3GC4A 2CLIA 4IGNA 3WNLA 1GHRA 1T40A 5HMFA 1BAGA 1CB7B 2OEJA 1Q6RA 2IQ0A 3ABXA 1FIQB 5CSSA 2IKHA 2OZ3A 1VRDA 3VKJA 3DHFA 1CB2A 1UD8A 1G7UA 1Q7QA 4O12A 3PG6A 1PBGA 1CXIA 2YLLA 5GJPA 4A3UA 2GQ9A 4EVZA 3VIIA 4YTTA 4XAYA 2WVTA 3OU8A 3KUMA 3UR5A 4PR4A 4H4WA 3CT7A 1M03A 1U2YA 4HMEA 5DN1A 2W55A 3LCGA 1SFTA 3AJXA 1G01A 3L67A 5A8OA 4AWUA 2QVNA 4MFEA 4GISA 4B2DA 2ACRA 1A5NC 3S5YA 3LYEA 4ERIA 3H6OA 1F3WA 1A3XA 3EWZA 5IRPA 1GXFA 3WQPA 1FWSA 4CU8A 3FYPA 3QFEA 2QGYA 3OIHA 3TX9A 1UIPA 4Y9MA 4Q4MA 1EGZA 1O94A 2JALA 2FZ8A 4WKAA 1OCBA 4C6OA 4LV9A 1TJPA 4P7LA 3OHMB 3ABRA 1UR2A 4RE4A 3GY1A 4R34A 3UPMA 4FIQA 4DUWA 1QW8A 5LA1A 4GPNA 4CN4A 1XM3A 4P8XA 4Y9OA 4IGMA 3R89A 1JGMA 3NRZB 4LTSA 3PSWA 1LZOA 1QI0A 2VDGA 4I5RA 1KXHA 2REQA 4JTFA 1RBLA 1EGVA 1ZP4A 4RCXA 1WYGA 1K9TA 4ZE5A 5HJYA 1LPFA 1AZ1A 4PFHA 2DORA 3DK9A 3V3WA 2A3BA 4HK7A 1E4NA 1SZRA 1Q45A 3IUHA 3BGAA 5AC4A 3NVWB 3UW6A 3S8HA 1IT8A 3CH0A 4I9AA 1P0NA 4B4HA 1X39A 1AL8A 3EDFA 1HF6A 4XISA 4KWWA 4M52A 2ZKMX 1IXNA 3NXLA 4NAFB 2VEGA 1XBZA 4R9OA 3VUSA 1AK5A 3RMEA 4DNHA 4U3AA 3QV9A 3BE7A 2HK0A 1GJUA 3BQ5A 4GO9A 3WSUA 4HNTA 4YS1A 5HBFA 1J5TA 4US5D 2X1TA 4Y9PA 5FS8A 2CNCA 4MB1A 4DJEC 4NZ4A 4QE1A 2PAJA 4FNUA 2V5DA 3DAQA 4D8LA 1R2TA 2D23A 4CUCA 4MNKA 4I90A 2BXZA 2W4XA 4PCNA 3N04A 4X63A 4DJDC 2EO7A 3PFRA 2D3NA 3SIZA 2QUTA 2WBGA 4W8BA 1ML1A 2QMKA 4KIRA 2VGGA 4H41A 3KP0A 3W7HA 3STFA 2HPMA 1R5YA 2C14A 4TTUA 3ISIX 3EWUA 1PTDA 3KW3A 3CUFA 4ICCX 4MB4A 3LTYA 3CB3A 5KZDA 4MZ1A 4LRTA 1R6WA 3PZVA 3E0WA 3W7QA 3LADA 1OWQA 1AVAA 1MI3A 1AD4A 1SZEA 3UJFA 1QNRA 4HJWA 2BB0A 2VTFA 4F48A 3ZMRA 3T4WA 1UZDA 1I0BA 3EWCA 2WC4A 4C6CA 4PTDA 2ZDRA 4H8VA 4RNJA 2FTYA 3UZJA 3WQEA 2W3ZA 1JFHA 1HL2A 3BARA 3S2MA 4J2PA 4Z2KA 2TYSA 1PHQA 4KH2A 3FK4A 2C16A 2EGZA 3LCWA 1BD0A 1BHGA 3R07C 3XINA 4XWUA 3WBXA 1MO0A 1C3FA 1SJDA 3M0ZA 1DE6A 3UNTA 3GVQA 1VLIA 1OABA 3T8LA 1T99A 3PP7A 4E2BA 1OG0A 4FALA 2YDQA 4JTRA 2F6XA 1CXLA 2VC9A 1LQAA 2DZSA 4PUWA 1BXCA 4JTAA 1BF6A 4KEUA 3NR0A 1SR9A 3UD6A 1RR2A 3B8WA 2ZC8A 4GQGA 1AW2A 5DBUA 3WDIA 4YCPA 4IGSA 3BLEA 4HPJA 3CAVA 3P8IA 1TWIA 1E6NA 1LF1A 1HW6A 3BJSA 3CZGA 4MNLA 3IUDA 3NVZB 3F5KA 1ZJAA 2ZUUA 4ZCWA 1NFBA 1WXYA 2AMXA 3Q2DA 5C70A 1L8NA 1B0IA 4QDPA 5AN7A 4L6HA 4APNA 3DC8A 2IPGA 1HJQA 5JCKA 2Y7GA 4XZ9A 1W1B1 5DXXA 2VX6A 1KBBA 2VVNA 3HMCA 3NFUA 2ZXDA 3N73A 4RNFA 1E6XM 2VEPA 2ZFAA 2C19A 4B9YA 3DGBA 4GIYA 5BWAA 3O05A 1V6VA 1FA2A 3L12A 1OC7A 3MANA 1Y8BA 2DGAA 4DWDA 3LENA 2H3BA 4RKAA 1EWEA 1XH1A 4TX6A 3TW6A 1JDEA 3PPCA 3FKKA 3JW7A 4Y7EA 3NGFA 3Q94A 4JCMA 5I7GA 3TYZA 4QIUA 1ZBKA 1IZCA 1A4MA 3NEHA 4MFDA 3OTRA 4W4QA 3FN9A 3BJFA 3RX2A 1VIWA 1KQZA 3PBWA 2P0OA 2I17A 3DFHA 3N2XA 5EMUA 3S2CA 1XFBA 3R0KA 1KRAC 3VNZA 1UWTA 3H2FA 5HUPA 5ENLA 1TYGA 3UFYA 5DRCA 1VBJA 1KCKA 3AS3A 4IJRA 1GRGA 2NQZA 2NUYA 3REQB 4EPDC 4O0KA 2WC3A 1C9WA 2D1ZA 4JX6A 2ZE3A 4NX5A 2EXOA 4G9PA 6PTDA 3T2PA 4DNAA 2F2KA 4O57A 1G0CA 4W93A 2GSHA 5HMSA 3MHGA 4F0RA 4AIEA 2L5HA 3OOQA 2WOIA 1Z6KA 5BRPA 4HN8A 5ABEA 5I3FA 1JR1A 4PCPA 2HS8A 3ZSTA 2IKIA 1SGJA 2EQDA 2EKCA 1Z3NA 1ISVA 1TTQA 4AX7A 3L2LA 3FSTA 2R82A 3GU2A 1J01A 3GAYA 2YYTA 1EYEA 1YNYA 4U4MA 2XM1A 4LUTA 3SECA 1I1WA 3WDHA 4CNTA 4K39A 3SDOA 1JI2A 4GX8A 3U5YA 3RMJA 1A5LC 2VC6A 2G37A 4E38A 4QR6A 2R6OA 2QJGA 4JIPA 1ISZA 4E0CA 1V02A 4G1KA 3L0NA 5H91A 4EP8C 4EAYA 4GNKB 1EUNA 2HV5A 2CBIA 1PHWA 1O66A 2YOCA 2E1DA 4ZXLA 2V5JA 1C8XA 3MYPA 2FPVA 4YWIA 3F5JA 3CQKA 3SY1A 2IXVA 3S9ZA 1CTNA 2WZHA 3WD0A 4PMDA 1PKLA 5T8GA 2FQIA 2VQTA 2D0GA 1KBLA 3N2MA 3ZWTA 3LUTA 4LGXA 2OJPA 5HUOA 5FI8A 2PTZA 3GC2A 1V6TA 5AECA 4UTKA 5I3IA 3MHFA 1KRCC 4CVUA 2Y63A 1DWGM 3SGZA 4QM1A 4PMRA 2NVKX 3W84A 3MO7A 2YAUA 1FXPA 4HB7A 2H9AA 1XIMA 4TXEA 1XLDA 1W8GA 4KCVA 4F66A 4XZIA 4JFWA 4L6OA 4JIQA 3USZA 1V8EA 3L4VA 4GZEA 4X0NA 6TIMA 1L6YA 1W54A 3ARSA 3THQA 2ZBTA 1FBAA 2VENA 1B3WA 2VEFA 4PODA 1JIBA 3S5ZA 2J7CA 1XKYA 4NG3A 2HDJA 3PK7A 3G1FA 4GUJA 1JD7A 3NDYA 3AS0A 3IJ7A 1DHPA 3BMXA 3CGTA 4O1EA 4PCTA 1UCWA 1WDSA 3WH5A 1UPPA 1UBPC 5DLCA 2VT0A 3S5NA 5A2CA 4G7FA 4GKLA 2EBNA 3M0IA 1A0CA 3D3AA 1EP1A 3FG2P 3SRKA 4H6QA 3ARYA 1EA0A 4QS5A 2GQAA 1I6NA 4AXKA 1D7KA 3HURA 1L6WA 3Q37A 5EBKA 1KTNA 1XLMA 4RE3A 4JS3A 3QEZA 4UOZA 3F7JA 5AZ1A 2OZ0A 5G5IA 5KSWA 3RM4A 3LMYA 3MHUA 3FJ4A 3PAJA 1VAHA 2OXNA 3LHUA 1YKWA 4G56A 1WO2A 3LBMA 4AVFA 1KCLA 1I8JA 3KX6A 2IUZA 1SW7A 3UA4A 3EEZA 4CU6A 4N4PA 4UOQA 1NHQA 2AL1A 3RO8A 4Z0SA 3ATYA 4OBTA 3EAOA 4E6MA 4L5ZA 2QUMA 4S38A 4UQEA 1E0VA 3A64A 3OGSA 4H4TA 3IJ8A 3WLKX 4LYPA 5RUBA 1RA0A 2HWGA 1LUCA 1ONFA 3MBDA 1N5XA 3UG8A 3DG3A 4BI6A 3FSUA 2ISSA 3MY9A 1E0WA 1ZY8A 3NZRA 3PHAA 4CCEA 3DFSA 3B9DA 2GQ8A 2PDMA 4KMQA 4KGJA 2CZVA 1QHPA 3P84A 3QY8A 1R86A 3M1ZA 1KGXA 3EB3A 3PUDA 5HMDA 5FKYA 1JYVA 2PPGA 4I8DA 1KFWA 3APTA 4RV8A 3B8DA 2DZXA 4C65A 5D9PA 4GCXA 2OLAA 3BW3A 3MCMA 4CEUC 2X16A 6A3HA 1HGYA 1UOZA 1QK0A 2R9RA 3MUXA 3SAZA 1JEHA 3AXIA 3HU7A 3ITOA 4WDUA 2ISVA 1P6WA 2EHHA 4HNVA 5FA5A 4DZAA 1KCZA 1ZS2A 3DGHA 5GPRA 4C1LA 2FDSA 4XO7A 3L5MA 1ITQA 3C5QA 1YQZA 4XZBA 5A6JA 4LYRA 2J78A 4R7OA 4EPBC 1V59A 3ZR4A 2ZVRA 4M5PA 4OE7A 4EQWA 2A5HA 1ZAJA 1XIDA 4H2HA 1F4HA 4IF2A 3FEMA 5DCEA 4LWWA 3SSJA 2OX1A 3TUUA 1WCGA 1RCOB 3AI0A 1M53A 1JNEA 1XRTA 3E2SA 2DT0A 4IISA 3OVQA 1AOGA 1OX5A 3N2BA 2V6AA 3NUKA 3KHJA 2Y1HA 1LG1A 2VELA 1XPGA 3TW9A 4FLRA 3TYEA 2EG6A 4CQDA 5JCNA 4YYFA 1VJIA 3BZGA 1LVLA 1UWIA 3IK2A 4DWSB 3GVVA 6REQB 3BG3A 5BU9A 4DPQA 4IFKA 3AOFA 2YB4A 1PS9A 1R38A 1ZGDA 3HGOA 1JEZA 2I16A 2IPFA 1DXEA 2C0AA 4HMCA 3IIVA 1HN1A 4D9PA 1VFLA 3B0UX 3M7WA 5E09A 4B5XA 3I7RA 2NV9A 3UCDA 3NQCA 2ZUTA 2WHLA 1BRLB 3AU6A 4C1KA 3TLQA 1LL7A 4LAOA 4B5VA 4E2DA 4QRNA 3QW4B 1NH6A 3G18A 3E12A 2ZX7A 3W4RA 4IMGA 1DBTA 2VZVA 2WMFA 2Y88A 3BCDA 2P50A 4A8NA 4H4SA 1XYCA 2YCJA 2W79A 3LV6A 5TR3A 3WD1A 1BEUA 3FYOA 3ZLFA 2ON3A 4WEVX 3F2BA 2WJDA 3ITYA 3RLHA 5D30A 1ZNNA 4DUXA 3R1ZA 1MFUA 1DNCA 1SO6A 3ELFA 3LLFA 4KW2A 1VYSX 1MXSA 2J9YA 1Q6EA 3M7SA 3DJGX 1DTUA 1E5NA 3NDOA 1UP2A 2CITA 4WRHA 1O5QA 1KD0A 3CNYA 5FD0A 1HKJA 2AL2A 3GBDA 4IJBA 3GDTA 3L4TA 4O1AA 1GPFA 2WLYA 3POHA 4GYPA 2IMRA 3W1XA 6XIAA 4YIWA 5LIKX 3S46A 4HZMA 6ALDA 3GR8A 3GNXA 3FGCB 4AMAA 1SUXA 4K7ZA 5A6BA 1XBVA 5I06A 2YL9A 2GJNA 2YZ5A 4XD4A 4OJYA 1FDYA 2J7DA 3O6CA 2ZTJA 1DJNA 3N4FA 2OWXA 1EX1A 3HV8A 3A12A 4PRTA 3CMGA 3DYOA 7TAAA 3W7RA 4EK7A 4EF9A 1CGWA 1POJA 3UR7A 1LM1A 3PY2A 3WF0A 2PRMA 3RGTA 5HPCA 4HK6A 2G3FA 4JKMA 3WLRA 3ETRB 3NQAA 2HPIA 3V0TA 3L2MA 3SQPA 1CGYA 4W84A 4J57A 3VD3A 4URIA 2OOFA 1ITXA 5IFTA 3JVAA 2OFJA 4O16A 4PMUA 3A24A 1S2WA 2QIWA 5JU6A 2QJIA 1Q13A 1UJQA 3SN0A 1GQKA 3PB0A 2BXVA 3S2NA 4EXBA 1ZRQA 4EXAA 5EMJA 1E15A 2Z2BA 1QFEA 3PJXA 2WPFA 3S9YA 4GACA 4C1NA 3SUSA 3FA4A 3ANUA 3S5SA 1YYAA 1YLVA 3EMCA 1AW1A 5CLTA 2ZTKA 2G3JA 3PNUA 1AQFA 4BFAA 2QVHA 2WMHA 4CNSA 3UWUA 4A3HA 4HOWA 5J5RA 3T81A 2PDBA 3BC9A 1LROA 1M7XA 4FX6M 4DBDA 2YA1A 3WUEA 2PGWA 3DFQA 2DVXA 2E6YA 4JTGA 4JEJA 3GNNA 1KA9F 1EZWA 3A3XA 3MC5A 3R58A 5BXRA 3C3UA 4ZO9A 1E56A 4CU7A 3EUB3 1YXYA 1TCDA 2ZE0A 4UOJA 4EM3A 4GE8A 1ZP3A 2B7OA 2P3ZA 1Q8AA 5I24A 1MQPA 3EXRA 4Y8FA 4WR3A 1KXQA 1B3VA 3QSTA 4L4PA 4QDMA 3OQEA 4YXGA 3EA3A 3QKEA 1XRFA 1DE5A 1ZKQA 3CXBA 2CLKA 2WM1A 4QITA 3UXAA 3TN6A 4UZUA 4AEFA 1FWAC 3CEPA 1A50A 2Q8ZA 1LWIA 2RDXA 1HQTA 1XQLA 2D69A 4ZO6A 5FSDC 1CIUA 2YX0A 1U5JA 4JCLA 4Z0JA 3KBWA 3TN5A 3I4EA 3AU2A 4JFTA 3GHRA 5I78A 1W1YA 4EE9A 1W1IE 2YCLB 4JTDA 1NPXA 3W83A 2V3BA 1XHGA 3ARRA 4FMVA 3KEHA 4ZBCA 1G7VA 1AODA 4FOJA 3B97A 4DBSA 3E2RA 4C6JA 2BGNE 4C5YA 3GYEA 1J2WA 4PSPA 3CL7A 3UVIA 1CGUA 4GX9A 1EDGA 4ML9A 4AEEA 5DX7A 2HMCA 2OZTA 4DWSD 1ZBWA 2OQHA 3K1GA 3W1MA 4TTGA 4YHGA 4ADWA 1TQJA 1ZAIA 3W81A 3ZJKA 2XIQA 2ZZ6A 3FA3A 4Q7NA 5A6AA 3FJLA 5AC8A 1H51A 4GXMA 1U83A 3WLHA 2VC5A 3ZJ7A 4MM1A 1ZPTA 3DFNA 2XN0A 2PS2A 4DJEA 4XZLX 4AZBA 1FCBA 4HYWA 3GYCA 3VI2A 2FTWA 1WAWA 2FFIA 2Y5SA 1F4AA 3A23A 3LCXA 3LK6A 4NVTA 4J40A 2XPKA 4QEHA 2XIBA 4QCFA 4DJDA 3ZVHB 1Z89A 3HG3A 3T78A 2C71A 3W38A 3H21A 3DIPA 1DJIA 4JTJA 3UYIA 2VFFA 4H8UA 5TQLA 5I0DA 1X6NA 4B5UA 4DNMA 4BJHA 3FHAA 4HP5A 3QPZA 2G41A 3TROA 2Z1SA 4HNLA 2I56A 4C7DA 4HSNA 1DIOA 3ITXA 3FJNA 2PD5A 3W6LA 1X7IA 4XUGA 2BC1A 4V28A 3NCOA 4XBKA 3KDOA 2R94A 2GFTA 3HG2A 1GRBA 4BWLC 1HX0A 4V1XA 3BZJA 3HO8A 5BOFA 3PUEA 4BEUA 3N6JA 3GHTA 1JPMA 3QJAA 4GRSA 5B7ZA 4AZGA 1QI2A 2WXDM 1SW3A 1LQ0A 3OYXA 1ISYA 1DJWA 3L5LA 4YTSA 3W7JA 1YBQB 3FYYA 4ZO8A 1REQA 4UFIA 4TVWA 2RABA 5HATA 3IVUA 3U5UA 3W23A 4PRWA 4QLJA 5ABGA 2CIPA 4AZHA 1Q1RA 3V0SA 5M03A 4WUIA 3BL3A 4FZIA 4IG2B 4Z42C 3ZQ9A 1MO9A 2YDAA 3GR7A 3SUVA 1XIBA 4RW5A 1HKKA 3TE9A 1KM0A 4EACA 1ALDA 1GONA 3C0JA 1EH9A 4O4VA 3H7RA 4F0HA 1H5YA 3B9EA 4IMCA 5DRIA 4D6IA 2OX4A 3VOJA 4X61A 4D6EA 4PA8A 5EY5A 2J4GA 3N13A 1WBJA 2CWXA 4M80A 4H9XA 2GK1A 4S3EA 3WX7A 3W9ZA 1Q3NA 3A4XA 3LPPA 2X41A 3SCUA 2ADAA 4H6EA 2QIIA 2R1KA 4HPXA 4WGHA 3TU9A 2HBVA 3EDJA 2BC0A 2A3AA 2AMGA 3NQ7A 3PAOA 2F84A 2I5GA 1OFBA 4Q4RA 3GH4A 1AUSL 2V3GA 1SO4A 4D1JA 3KTSA 3FJ6A 4G7EB 2DSUA 1W5QA 5D04C 1TG7A 4QJ3B 1PE1A 1TJ2A 1V3KA 3BAKA 3DYMA 3GX9A 3SFWA 4E3VA 1KXVA 4LY8A 2X8GA 1CXKA 4DUVA 1XYMA 3W2JA 3MWCA 1KBJA 4KWOA 3F2CA 3ZR6A 1G67A 1FKXA 3IV8A 4L9ZA 2D24A 2NPXA 3ZLGA 1V77A 4M0XA 4MG4A 3MMTA 4JKKA 5JBEA 4GY7A 4TVDA 1PZ0A 3C52A 1R7OA 4FPSA 3L5OA 3E3HA 1NP0A 5C9RA 3IPWA 3VNDA 5JCLA 2OKOA 2YBUA 4Q32A 1RSCA 1ENUA 4LNYA 2UY2A 4LRSA 3WD4A 1TZ9A 3EOUA 2ZRUA 3PFMA 4MJ2A 1HJVA 2V8ZA 3N9RA 1HGWA 3UGVA 1P5BA 4TVCA 3G5EA 4LUSA 1GYLA 3HMJG 3VKBA 3LSBA 1J6OA 3BG5A 2PZ0A 2SFPA 1NP2A 1SMAA 3RXZA 3G24A 3DECA 1ZDLA 4BQ3A 2XSAA 3QH2A 5DANA 4NILA 3PZ9A 3P2VA 3LZ3A 1IHIA 1IF2A 3BO9A 4ZOHB 1O5KA 2VCCA 1ZXIC 1Q1WA 4H6KA 4GQBA 5D2TA 3QXBA 3W28A 2HTMA 3GUWA 4ZTXA 2OYMA 1XCXA 4UZSA 2BNJA 3WKZA 3MZNA 1NWUA 4GI4A 3CUGA 3THAA 2J6XA 5IM51 2P8BA 3CXOA 4NZFA 2FKPA 3GU1A 1HKWA 3ALFA 3XISA 4M29A 1A80A 4P8VA 2R1LA 2JK6A 1Y65A 1OINA 2CLFA 3N3TA 4XD6A 1A53A 3C2FA 2DIKA 1I4NA 3TTEA 2V2DA 2XVPA 1QTWA 2VOMA 4RPPA 1FWGC 2YW4A 3A47A 3VINA 4Q4PA 3P60A 1HKMA 3CZ8A 3B3DA 5AY7A 2VQUA 3ARTA 2POTA 4QS6A 1ONEA 2QAPA 2Y5JA 4EWND 1AJ2A 1OT1A 2OLHA 2YBTA 3CUXA 3CU2A 1FECA 1B3YA 5CGMA 1NU5A 1CEOA 5JCIA 3EDKA 4C6MA 1ZMCA 4MHBA 3NM1A 4M82A 3WQ8A 4MYAA 1R0MA 1LBLA 4O1CA 5G4EA 3NWRA 3UY7A 2PEVA 5AC5A 2J9ZA 1ITUA 2C3CA 2QLYA 3RM9A 2ZDSA 1XV8A 1BKSA 1WZMA 2VRKA 1JAKA 3H2NA 2WO5A 4QCEA 4V2XA 2VFDA 4HT3A 3WLIA 2W91A 3KRZA 5BOEA 2XVNA 4IIEA 3F1QA 1VLWA 4F0KA 3BPWA 2O9OA 1TTPA 4K37A 3W7NA 3CAKA 3OO2A 2CXGA 4LVDA 3UZXA 3ZLHA 3K4DA 3QFWA 1VHCA 1S1RA 1F8IA 2QCEA 4R7JA 4BS0A 3E02A 3WBWA 1XLLA 3FA5A 4JNZA 2ZA2A 1O68A 4RE2A 1SO5A 5E6ZA 2J8TA 4HJFA 2NUWA 3GXTA 1F3PA 1YNPA 4DEFA 4YNGA 3GVGA 3NSXA 3V5FA 4UUIA 2Q01A 1ODZA 5FJOA 5CZ0A 1A0DA 1CPUA 4AAJA 1RUSA 2A8XA 3A7RA 3W7CA 3H70A 1PZ1A 2GGEA 3QN3A 3AHYA 5DF0A 1A5AA 2HQMA 1PV8A 3UT0A 2WLZA 1MEHA 5BMWA 3IS4A 2Q71A 1WZLA 1P43A 3V35A 4QE5A 1ME8A 1GJPA 3D47A 2A4AA 1UZ4A 4GUIA 1UR3M 1TJRA 5G4WA 4BF9A 2Z27A 2X8CA 3VK5A 2DZTA 3AALA 1SVDA 2ZZCA 3MKCA 4GI8A 1L8PA 1VQTA 2B0MA 4S3FA 2CETA 3AXKA 4IPIA 1C9DA 3LBOA 5CZJA 3NM3A 3L0KA 3QPEA 5EYWA 1DJHA 3PC0A 1GOQA 5FMHA 3GIPA 5CPNA 4IXXA 3W53A 3WMLA 1I60A 3KZSA 4FHAA 4S3JA 4Q6JA 1XSIA 1ICPA 2TSYA 3NSMA 2F6UA 3EB2A 4POCA 4HVXA 4I3GA 1DIDA 3GQYA 1H61A 4JTUA 4AHQA 3IC9A 1V3JA 3HGRA 3QC0A 5K4ZA 4IIBA 5C55A 1LT8A 3CHDA 2E40A 2W9MA 1JCTA 1H5VA 1KM3A 1TR9A 2OPJA 4N9BA 3RRXA 1SU5A 2VOTA 4DB7A 1RY8A 2V30A 1JJKA 3KL0A 1XWYA 3SFKA 1VFOA 4WIWA 4IICA 3RNDA 4LAMA 4MNJA 3UP8A 1Q7ZA 1FWJC 5HK4A 1OFQA 3LXCA 4HZ7A 4C6QA 2VUNA 3WK0A 5CC7A 2NQJA 1KB3A 1OADA 3MVTA 3E38A 3EWBX 4N9CA 4CLMA 5T91A 2NXHA 3SIMA 1E6SM 1B3ZA 1UC4A 4ZOAA 1VFUA 1K7FA 5FEXA 5U4NA 3GH7A 3U57A 3LHWA 1F73A 1DTNA 5AYYA 4R27A 4DXVA 1SPQA 3NL6A 1NOUA 1TX2A 4IH3A 4MJ4A 1M6JA 3KWSA 1V0LA 3F03K 4BK9A 5D9OA 2NQLA 3OB8A 1UR0A 2O56A 4XX6A 2IKGA 5LYRA 4NEWA 3ATZA 4Y9NA 4UMAA 4C6EA 3U9IA 3MI6A 1XIJA 3O15A 2OWWA 4GWEA 1AH4A 4OBRA 4Q8PA 4E8GA 2V3FA 1E6RA 5GQBA 4AQLA 1E55A 2FGZA 4O8RA 2GUUA 3UGRA 1FO4A 3WUBA 4UCGA 3QGKC 1T7LA 4N02A 4MNMA 4XKMA 4UTTC 2QCHA 2X09A 4LFYA 4IM4A 2XIOA 4JN7A 3LBCA 1BVWA 3DBPA 1ZFJA 2O0TA 4HU0A 5BXPA 5JIPA 1OJTA 1OG6A 3T07A 2GR0A 1IEIA 3PBYA 3NXFA 1IGWA 3AS1A 4QP0A 2DVTA 1ZBCA 2I1OA 4EXQA 3RF9A 4HTBA 1ZJHA 2BZNA 4XTDA 1CT5A 1SFSA 2PBOA 3CB8A 3PJTA 3NNTA 3W37A 2A7PA 4O19A 1XYZA 3B0PA 5E9AA 1J0YA 4O50A 2QCDA 1EEXA 1ADOA 1FUYA 4UMCA 2C3ZA 3MDUA 5DEZA 2EPNA 5G1TA 3GK0A 2G97A 3IEBA 3B8SA 4AYSA 1OF8A 4GIRA 5FAJA 1B3XA 4W8LA 2P0IA 3SY8A 3ZVIA 4AWTA 4D71A 5HINA 3B9OA 3BWWA 4LBUA 4JX5A 1KFLA 2F2HA 4LXFA 3A4WA 3UXLA 3INPA 3V36A 5TAOA 3CV1A 3L21A 2VGBA 2PU0A 1B54A 3UG4A 4AHPA 1QBBA 1YTDA 4YL2A 4AHOA 2GZXA 1I2PA 3LGEA 1UR9A 1QHZA 1US0A 4FF5A 3O0KA 2UY3A 3UVAA 4IP4A 3FKRA 5E0KA 2NWRA 1JXKA 4B2DD 4Q7BA 3UWWA 1VBUA 3TAKA 2BHYA 1VEOA 2WBKA 2DUAA 1CI1A 5H1WA 3UEQA 2CZFA 2PP3A 2AKZA 1FVPA 3BQ6A 4N6EA 3ANYA 3CASA 1T8QA 2A6LA 4WGXA 3THUA 1FWHC 3VIHA 3W7MA 2FZBA 4ICNA 4LCQA 4OV9A 5FOOA 1YW1A 4RZ4A 4WSKA 4O18A 3CV7A 1GJWA 1P48A 4JN6A 4PFMA 4PTVA 4OWGA 4OKDA 5D09A 5F1UA 3KS5A 3P5YA 1J4EA 2QCMA 4NKCA 1W1A1 1VGAA 4L1GA 4OU1A 3OGVA 1CLVA 1TCMA 5A3HA 5M2FX 5I3KA 4AF0A 4DF0A 3SQSA 4AWSA 1EJTC 2X1UA 2G0WA 2ZYFA 2Y2WA 4HMNA 4I6KA 2JKEA 3LHVA 5AYIA 4GVGA 3IV3A 4UR8A 3L4WA 4R3UA 3CQJA 4AX6A 4DZHA 3UR8A 3OODA 5D37A 1OM0A 3TOPA 3Q65A 3PN8A 1OFOA 1VCGA 1JQXA 2PWDA 1H09A 4CN1A 2DY3A 1GHSA 4QG8A 1SFJA 1U22A 5JQ9A 2OSWA 1IEQA 3MS8A 3U2CA 1EF2A 1HL8A 1NIUA 4A2RA 3CL6A 4V1YA 4PUNA 3SUWA 4HD5A 2HCVA 4MIMA 3NPUA 2R1PA 3LCHA 1UR1A 1EL3A 3RPTA 2Z00A 1XYLA 3W86A 1TKKA 1O1HA 1PIGA 4HQVA 3L4UA 3WQ4A 3KBVA 4JAWA 3QSRA 1J0ZA 1FFRA 1RCQA 2QPXA 1NTHA 5KZMA 3DZ1A 3N15A 1RH9A 3N12A 4DO5A 1J9YA 2PDJA 5K4XA 2ACQA 1KM1A 1SYTA 2BY0A 1EBHA 1VD6A 4QHRA 3BW4A 1TV3A 4GYFA 4R5EA 1XD0A 3CGBA 1P0EA 3OQ8A 2V6OA 3PB2A 2QAFA 1GPWA 4ROQA 4GINA 3H12A 7ENLA 3TTYA 3SR7A 3BGJA 1KQYA 2HEJA 4GD0A 5M1TA 2AKMA 4XQ6A 4J3ZA 1XS2A 2GRTA 1RPKA 2D0FA 3CMJA 1GOOA 1Q2RA 1SSDA 3GTXA 4W5UA 4DN1A 1YDOA 1VS1A 4JOMA 1FEBA 2ZOXA 5EMLA 3R7MA 1PO9A 4F3HA 1DIKA 3RJYA 4I9TA 3WENA 4KFNA 4PC8A 1EDQA 4NI3A 4LVBA 3K4AA 4FK9A 3UG3A 2E5CA 2ZZ2A 5AHLA 3R79A 4TV5A 4GQ0A 1EIXA 1RLDA 4MAZA 4ATLA 3PTMA 5IBXC 4HYRA 3M64A 4HCHA 1GW9A 4MWAD 1IEVA 4AISA 2H9AB 1KTCA 3MSYA 4MTVA 3SCQA 5C2XA 2QEZA 2QV4A 1C29A 4OOUA 1VFSA 2JEPA 4D6CA 5D8ZA 3EKGA 3TA9A 1ZJIA 4PH6A 4IQDA 5DY3A 2HNEA 3GTIA 4JPGA 1B4EA 4O53A 3D0CA 1I0DA 2RH9A 1VEMA 3H23A 1KRMA 1J10A 1XDLA 3VGGA 2E7FA 4DI8A 3HG5A 1KM6A 3QLDA 1KV8A 1DOSA 2HE8A 3VNYA 8RUCA 3QV7A 1G6CA 5JIWA 4UWMA 3WG6A 1MW2A 4JQ4A 1ZSXA 4Z1DA 1IXPA 5F4SA 2YVFA 3PNZA 2I7GA 1FRBA 4L4OA 3FAXA 3O2LA 3TC7A 1KBKA 1HVQA 5SWUA 4O14A 4F2BA 1IR1A 1X7FA 4B3LA 1WP6A 4CD6A 3M4HA 1N5WC 2VO5A 4UTFA 4JDBA 1KLYA 1KGUA 1W2PA 1PIIA 5ABTA 2PLCA 5G1MA 5D33A 1TREA 2XN1A 1ZENA 1A5BA 3TKFA 1BYDA 1VCFA 4BWLA 5DMMA 5K9CA 5LKYA 1MWOA 1RXOB 2J7BA 2WCAA 4U28A 2ZRYA 3TXZA 5EA9A 1ZCCA 1F3TA 4NJGA 3VDHA 4PBEA 2B7PA 4GLEA 3HN3A 2E5DA 2C1GA 4JYDA 4U33A 2VVSA 3T0AA 3M0KA 3QMRA 4H9MA 4NZ5A 3MUZ1 1TMHA 4JXCA 4CNOA 2PTYA 3KRUA 4DBWA 4MJMA 4EMIA 2D2HA 1TIMA 3TCSA 4F9JA 3VYLA 4H4ZA 3QRHA 1O95A 1T0OA 1UROA 2WZTA 3VOCA 2JQXA 3WJYA 5A2AA 1XUUA 2GJPA 3H2CA 3WF3A 4CQCA 1O12A 3BCJA 3G77A 1FP9A 1R3RA 3MO4A 5H8MA 3N3MA 1DXLA 2R9ZA 7PTDA 1LUCB 4DWSC 1HVXA 1W1VA 2YCEA 1DIEA 1QNSA 2PB1A 2CXEA 3D3FA 2PWVA 1EJUC 3GSMA 2PP1A 2YLAA 7ODCA 3OZPA 2YA2A 4US5A 1ITCA 3B0XA 1H11A 1P1XA 5AC7A 1MQRA 3KZPA 4Y8EA 3V1HA 2HS6A 8CGTA 3MV11 3CQ0A 3U2ZA 3EDDA 3IGUA 3LU2A 1F76A 4PMVA 1NDAA 4D72A 1E0XA 1Y0EA 1UMYA 2UY4A 1W9PA 1JVNA 2UV8G 3UYCA 3CHCA 4L64A 1T6MA 1E1CA 3HB9A 3CV6A 3R8RA 3EX4A 3VKAA 1UD3A 3KS6A 4HTYA 1HUVA 3NEVA 4AD1A 2W5FA 5AZ0A 4FNRA 4R85A 1FWEC 3GXIA 4M19A 1Y5WA 3MSRA 3L66A 4BQ5A 3QQWA 4LH8A 3S6DA 3ABQA 1VZWA 3VGFA 2EEXA 1KKOA 3OLEA 1W3LA 4LQ1A 2OO0A 4IMAA 5G5GB 2GSJA 1MW3A 3K5XA 1L0PA 4H4UA 3MTWA 2YXXA 1IR2A 2J62A 3I3DA 2EQ7A 1XQKA 2XIIA 4YWOA 4KETA 3JU2A 2PDKA 3WNKA 4J3SA 3UZZA 3BCFA 3KOXA 1VPYA 1B9ZA 3W7LA 4DM2A 5J04A 1WNOA 1IQ8A 1JRCA 1XFCA 4O28A 2ZRVA 3KHDA 5F2MA 1LTDA 1O6IA 2PWGA 2VEMA 3IGHX 1F7BA 4F9DA 1NDVA 1XUZA 3V75A 3G22A 2ZA1A 1WKEA 5DMLA 3G1DA 3LI0A 4JX4A 4PMNA 3BSHA 1MXGA 4Q8UA 1S5WA 2Y61A 3RILA 3WQDA 2OQYA 4RNHA 3NS1B 1F9CA 2DIJA 2XZ9A 1C92A 4IFKB 2VZTA 2PC4A 3T40A 5I79A 1GEQA 1BLIA 2HRWA 5EU9A 3W87A 4I6VA 4KRUA 1NHSA 5HOSA 4GI9A 2QDEA 1BVNP 2J7EA 4UFLA 5FCZA 3MUIA 1J0HA 4KBXA 4DRSA 2TPRA 2GVYA 2PCEA 1RJPA 1W3NA 3QTPA 4W8AA 5GNZA 4O52A 3ZYZA 3CEUA 3OEXA 1RBOB 1TV5A 3UESA 2WVUA 1FH7A 5G4HC 2DDXA 3R5EA 4O0QA 3MQTA 1M7JA 1IWAA 4XAZA 3THDA 4OUIA 2R24A 2WCGA 5CGQA 2FGBA 4KRTA 4MKSA 1T3QC 1BYCA 3NG3A 1H7OA 4DYEA 2YXOA 4UXDA 1NJJA 3C2VA 3GHUA 3TK7A 2EPLX 1V3MA 3AO0A 4DBEA 5BWFA 1RQEA 3KVLA 3CYJA 5AVHA 1WOAA 5IDZA 3QQ0A 2AL2B 1KM2A 5I03A 3AYTA 3GNPA 3TC6A 1S5TA 3BLDA 2NVCA 2C8NA 3NQ6A 1LWHA 3VGDA 4H19A 1MDRA 4JTKA 3L2IA 2ZCGA 2Y8KA 1Q7MA 4F0MA 3VM7A 3AYSA 2X0SA 1OBAA 3W29A 4UQCA 1HXJA 1WUEA 3T09A 4JICA 5AHMA 1OT2A 3QMTA 4UQAA 4OTKA 1KWGA 4WD0A 1E3XA 2V38A 3WJSA 3URBA 4B3KA 1XLFA 1ISWA 5HMEA 3T44A 2NQHA 4HIBA 3VFLA 2Z2AA 3WDPP 4JQ9A 4W87A 4XD3A 3DXIA 3EOEA 1QO2A 3GNRA 2VP8A 4NJJA 4ZQPA 4E4FA 1JZ5A 3L0GA 1VFTA 3PBGA 1BZLA 3EB4A 2KAUC 4FXSA 5HNNA 2BX7A 1IIGA 5KZEA 3RLVA 1HFBA 1S1PA 5A8MA 4HGXA 4HCDA 1X1NA 4I8YA 3SCRA 3P7YA 1TWDA 4Y96A 3O9NA 1BWVA 4C1NB 1SJAA 2J27A 3NVYB 2BY1A 3AC0A 2V5KA 1GWJA 4JQ3A 4UTUA 2J8FA 1XC6A 4W89A 3CQIA 2OYKA 3SJNA 3S42A 3WLQA 2I9EA 5U7SA 4GVFA 4CKQA 1ZK7A 5I3HA 3RCMA 2O55A 2VMFA 3NZ1A 1EO7A 4MWAE 3P62A 1HO1A 3WLOA 3STPA 4C7FA 1PYMA 2XIJA 5J8LA 1S3HA 3F2DA 1NELA 2BCPA 1TPEA 3E6EA 4M6UA 4AD0A 1M04A 1DL3A 4MLRA 3QYQA 1QK2A 3S1WA 1AJ0A 5C9ZA 2AQOA 1R9XA 5FACA 1BWLA 5HQLA 1GNXA 3CLMA 3RNMA 4MY9A 5B7YA 3WQ6A 1WKYA 4JTEA 4NZCA 3BAWA 3BOXA 1ZHAA 3W2UA 1IZJA 4KGLA 5IHSA 1AG1O 4XIMA 1TPWA 3W1AA 1FXQA 1PKNA 2PLKA 3CAWA 4GK8A 2IQTA 3OGRA 1P1MA 4YHEA 2C3DA 1QNVA 2ZUMA 2ATMA 1XLKA 2OU4A 5REQA 1LL4A 2X7VA 2YCKX 3U4AA 2QYGA 4GBDA 4B90A 1K1DA 1TV8A 2JKAA 3M0JA 1OCNA