4KWSA

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
403
structure length
397
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVAYEPADSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-mannonate dehydratase
publication title Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with Mg and glycerol
rcsb
source organism Chromohalobacter salexigens
molecule tags Hydrolase
total genus 150
structure length 397
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4kwsA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4kwsA01
1JPMA 3NZGA 3MQTA 4GFIA 2XGZA 2HZGA 3BJSA 2QGYA 3DESA 1XS2A 3P3BA 3ZLHA 3TOYA 3H8AA 3IJIA 1TKKA 4KWSA 1TZZA 2PP3A 4ZA0A 4GYPA 4MMWA 4J1OA 2AKZA 2PU1A 3CYJA 3T8QA 3S5SA 4KPLA 4IL2A 5J04A 3NXLA 4H2HA 3CB3A 3MZNA 1YEYA 3EKGA 2QJJA 2GGGA 3BSMA 3SN4A 3B97A 2AL1A 1SJDA 4HNLA 3U9IA 5FJTA 3CT2A 3DFYA 1MNSA 2PP0A 2HXUA 2PTYA 3QPEA 3GO2A 6ENLA 3I6TA 2PSNA 1KKRA 2FYMA 2CHRA 1FHVA 4X2PA 1L8PA 4IT1A 3SQSA 4MGGA 2MUCA 4DWDA 4KT2A 4IP4A 2PODA 3ENLA 1RVKA 1KD0A 3R1ZA 3DG7A 3DGBA 3FYYA 3UJFA 1MDLA 4E4FA 3OPSA 4Z17A 1EC9A 3ZLGA 4HCDA 3R25A 2XH7A 4MKSA 2HXTA 3UCDA 3TW9A 3DFHA 4GIRA 3R11A 3FCPA 3NO1A 4IHCA 3JZUA 4K2SA 3R0UA 4JN7A 3ZVHB 5EU9A 3GY1A 5ENLA 3RGTA 4FI4A 2DW6A 3D46A 4IP5A 2AKMA 2OZ3A 3VA8A 2PCEA 3D47A 3QKEA 1MUCA 3SBFA 5IDZA 3ES7A 2OFJA 3NFUA 1SJCA 2DW7A 4IZGA 3ES8A 4GGBA 3I4KA 2OVLA 3H70A 4E6MA 3VC5A 1EC7A 4ZCWA 3TTEA 1NELA 2GGEA 4YWSA 1P48A 1ELSA 1WUFA 3SJNA 1ECQA 2PU0A 2P0IA 4A3RA 4DN1A 4GMEA 1P43A 3THUA 2QQ6A 3RITA 3UCCA 4HPNA 4JHMA 3JVAA 4GYPC 3OW1A 3VC6A 3TCSA 1IYXA 3Q4DA 3FVDA 3PK7A 4H19A 1MRAA 2ZADA 3MWCA 5BOFA 1JDFA 3N4EA 1SJAA 2POZA 3R10A 3UJRA 3TWBA 1KCZA 2GGJA 4F4RA 3EEZA 3GD6A 4DYEA 3DEQA 1DTNA 3DG6A 2P88A 4M0XA 3QTPA 3UJEA 1JPDX 3UJSA 2PTXA 4H1ZA 3OZYA 1JCTA 3V5FA 3STPA 2NQLA 2QJMA 4Z1YA 2AL2B 1TE6A 3OP2A 2PA6A 2QVHA 3SSZA 4HN8A 7ENLA 2AL2A 1R6WA 5BOEA 3DDMA 4JN8A 3SN1A 2ONEA 1EBGA 2FKPA 1F9CA 3R0KA 3DERA 2GSHA 3MSYA 1BKHA 3IJLA 3FXGA 3RR1A 4HYRA 3TJIA 2QJNA 3MKCA 2I5QA 1BQGA 3VDGA 3PWGA 2PP1A 4E4UA 3T6CA 3ZVHA 2OQYA 5FJRA 3IJQA 3RO6A 2OLAA 1W6TA 3MY9A 3UXKA 4HCHA 4A35A 2OZ8A 1EBHA 2QDEA 1E9IA 3V4BA 1PDYA 4IL0A 2OZTA 3V3WA 2GGHA 4M6UA 3H7VA 5FJPA 4G8TA 4K1WA 1NU5A 4A6GA 3U4FA 4KEMA 3PWIA 2GDQA 3TWAA 4DXKA 4GGHA 3DIPA 3KUMA 2P8BA 2PGEA 5FJUA 1WUEA 3MUCA 4G7FA 3TQPA 3CK5A 2OG9A 2ZC8A 2OPJA 3OTRA 3VFCA 3ZVIA 2OO6A 3N6JA 3QN3A 2OX4A 3VCNA 4DHGA 3P0WA 3SN0A 3ZLFA 2XSXA 1PDZA 2PTZA 4J3ZA 3DG3A 2GL5A 4ROPA 3RCYA 2P3ZA 2XH0A 1MDRA 2PS2A 2OQHA 4EWJA 2MNRA 1XPYA 4E8GA 3FJ4A 3P93A 3UGVA 2PGWA 4HNCA 3RRAA 3S47A 3V5CA 3JW7A 4FP1A 1KKOA 3I6EA 3CXOA 3T9PA 1EC8A 4ENLA 3BOXA 4HCLA 2QDDA 2P8CA 4H83A 5FJOA 2XH4A 3UJ2A 3N6HA 2OKTA 2PMQA 3H12A 1ONEA 3N4FA 3Q45A 2RDXA 2GGIA 2PTWA 3PFRA 4E5TA 3CAWA 4K8GA 1FHUA 3OZMA 3QLDA 3FV9A 3K1GA 3IK4A 3TJ4A 3HPFA 3T4WA 1SJBA 3VCCA 2XH2A 1OEPA 1R0MA 4GISA 2HNEA 3UXLA 4DX3A 2PPGA 2O56A 3GC2A
chains in the Genus database with same CATH superfamily
1JPMA 2CXEA 1VIWA 1KTBA 4QAWA 2W61A 3QMTA 2QGHA 3WLTA 1KXTA 2JK2A 1P0EA 2HS8A 2QGYA 3DKLA 4I9AA 3P3BA 4QDWA 4AAJA 1OYCA 5KTLA 3WUEA 1SO3A 3WLHA 2B7OA 1EOKA 2HTMA 4DF0A 1W54A 3IV8A 3STFA 2PFHA 3LG3A 1AJ0A 2NXIA 1Q7MA 3GKFA 4AY8A 4HMCA 3NXLA 4MAVA 1YEYA 4JTUA 1VPXA 3OBEA 4Z1AA 1NHPA 4RJEA 2XIBA 3H24A 2GOKA 4BK9A 4NG3A 2XWEA 2F6UA 1JULA 4IMGA 4K7VA 2GDVA 1NWRA 1TPUA 2X8GA 3HV8A 2CFYA 1QBBA 2W79A 4LUTA 2VZVA 4GRSA 4DNAA 1BGAA 5HUOA 4BF5A 5HNNA 3W74A 3T8LA 2DH2A 2C1GA 2IMRA 4I5RA 2WHKA 3QC3A 5HNTA 1AH0A 2KX9A 3SQSA 3GZ3A 2BHZA 3EEGA 4LUYA 2WB5A 4M1BA 3KRZA 3VKDA 4X9SA 2BXVA 1MZRA 3LRMA 3WBAA 4BQ5A 2PWFA 3I10A 2IKIA 4AD0A 1Y5VA 4UIOA 1ADDA 4ILSA 3SCTA 2ZRYA 3NVYB 3SB0A 4EP8C 1ZUAX 4O16A 1A53A 1YNPA 4YTQA 3UY8A 1B30A 4F2UA 5K9DA 4TMCA 4LANA 2YYTA 5BMXA 2V3FA 1XLAA 4MDPA 3DFHA 3L8KA 1J6OA 4GUFA 2P0OA 3IIVA 3XISA 4IHCA 3L2IA 2OMAA 1LM1A 3VDBA 4FB7A 1NARA 1LVLA 2YZRA 3ABSA 1E51A 2DW6A 4A3UA 4GI6A 5TBOA 3V16A 4B5VA 2VD8A 4L1XA 3SBFA 1XL9A 2Y88A 1DWJM 1LF1A 2IKJA 1LG1A 3NVTA 3NQAA 4RV8A 4POCA 4IPJA 3A21A 1EGZA 3PHAA 4JTKA 2P1FA 3MPGA 1B3ZA 1RQEA 2OVLA 4AWEA 1R3SA 2CKRA 2W67A 2QVNA 4XISA 3LRKA 1NHQA 2WPCA 1A4MA 4W8BA 1P48A 2C7FA 4HTBA 2Y0FA 3TSBA 5A2BA 1I4NA 1UROA 1Q6CA 4UCGA 5FF0A 3A7RA 1XYLA 4GMEA 2GWNA 2W62A 1T96A 4JHMA 2IQDA 3U3HA 4PUUA 1RR2A 4BQ2A 4HZMA 3KVKA 5G1YA 4QQ3A 1LDCA 4O1EA 1E3ZA 3N9RA 4E8CA 3IJ8A 1SJAA 3LZ5A 1L9WA 4DRSA 2J8GA 4PSPA 2ZA3A 1EX1A 2C3CA 1MZHA 4O0QA 1JXJA 1X39A 1SW3A 3H22A 3EEZA 4NASA 3W2KA 1A0DA 2QJIA 1NPXA 1JPDX 4HMNA 4M7TA 3OZYA 4WJ8A 3EGJA 4PA8A 1AL8A 4IGHA 4MKNA 4MNLA 1GRGA 4Z1YA 2AL2B 1TV3A 1J6PA 2X42A 4JTAA 3KXQA 1B9ZA 4B15A 2VUNA 5BOEA 2CHOA 3VKCA 4JTCA 3UVAA 4EIVA 3KL0A 3LPOA 1OF8A 4UTIA 1LORA 1FUYA 1JGMA 1N7KA 4G56A 3HGRA 1MUMA 4Y90A 4P7NA 2EQ7A 5HANA 1YXDA 2BZNA 1U22A 3EX1A 3LLFA 4PRWA 1W6TA 2P50A 4PMDA 3L65A 4ML4A 1O5KA 1KQZA 3V4BA 1P7TA 1G94A 1DOSA 1W31A 5D04C 1L6FA 3A4JA 2ZUMA 3PAJA 4PB4A 5FF3A 4A6GA 2PDMA 4LTSA 1S2WA 3VIGA 1NDWA 3RX2A 4LYPA 2P8BA 3DJJA 4PL2A 2EPMX 3E0VA 2G4FA 1TPWA 3OG2A 2PI6A 2WKLA 3ZYZA 2QCEA 3MW7A 4YHEA 2OX4A 4QLLA 3EOSA 3SN0A 1W17A 1V0LA 1YDNA 3T05A 3ZWSA 4Q3MA 1SR9A 3SQMA 5D2WA 1S5TA 3SCPA 1J12A 1GVIA 4PODA 5B7ZA 3UGVA 2BP1A 4HNCA 3WQGA 1SUXA 3ALFA 3GIYA 2E09A 3L4TA 2EG6A 3M6YA 1Z41A 3NVZB 2JE8A 1M41A 5LKYA 1IEXA 5FMHA 1XLIA 1W8SA 4D6IA 1NWSA 4HA4A 2G37A 4MOZA 1XH2A 5FIPA 3P80A 5CJNA 3CZ8A 1R85A 3FX4A 1KXQA 3UR5A 4AWSA 1I2NA 1Q1RA 3N4FA 4JEQA 2BNJA 1JUBA 2VDIA 3WF4A 1DWHM 1TWWA 1M65A 3TZNA 5BU6A 1ZMDA 2QAPA 2YXGA 2WMIB 5HPOA 1F6PA 3EX3A 1FHUA 4B5TA 3UETA 2Y7FA 2FZ8A 4RZBA 4NILA 3N2TA 5AB3A 4WSJA 3VOFA 1QW7A 2BGQA 3TK7A 3M0MA 3LRLA 1EJ7L 5AHIA 3CQ0A 1XRFA 4QSFA 4Y8EA 1OQFA 5LIUX 2OXNA 1R0MA 5JUVA 2FZ9A 3AYRA 4HOXA 3A24A 2Q02A 3L9CA 2PPGA 2O56A 2ZZ7A 4YHGA 4CD8A 4E3VA 1TPEA 1EP1A 1UH2A 3NZGA 4J4KA 1VYPX 3L23A 4BFAA 3QFAA 3PUEA 4GFIA 3UXIA 2DT0A 1KFJA 1TELA 5PTDA 3W7IA 4F0HA 2R1KA 2J6XA 3BOLA 3U48A 2VQTA 1GT8A 3URBA 3VKKA 1XV8A 3T8QA 2W3RA 3VDCA 3MSRA 4QGCA 4AC1X 4DBEA 3KHJA 4MADA 2VC5A 1VLIA 3K30A 3GC4A 2YDQA 3ABZA 3PBVA 1UMLA 2QJJA 2YXXA 3CJPA 3TLLA 1BF6A 4MWAE 3VILA 1KLZA 3W7EA 3QGKC 3U57A 1XBVA 4LC6A 1G4EA 3GIQA 1YX1A 2PP0A 3WDJA 4XZBA 4A29A 3RPDA 4G1NA 2PSNA 3LPFA 2AAQA 3VNMA 1YQZA 1ITQA 2X0YA 4AUBA 1G7UA 3UG5A 3FA4A 3KHDA 3W38A 4LUSA 2Y6ZA 3EWXA 3BE7A 3KTSA 1LRQA 4MB1A 1UZDA 5AN7A 2IKHA 4NSBA 5AFDA 3VUSA 3A13A 4J5NA 1NDAA 1C8YA 2O7QA 3NQGA 4WRHA 1QR7A 3GTHA 1QVBA 4H4SA 5KMYA 1VBGA 5F4XA 4HGXA 5FESA 1TREA 2XIIA 4QLJA 3GLCA 2DZWA 1MW2A 1R38A 1K7EA 1DQXA 4W5ZA 1K8CA 4JNZA 3B8SA 3JZUA 1LLWA 1IGSA 4Z0JA 1V6WA 3EX4A 4CN1A 2YOCA 3RGTA 4LJ3A 3K8MA 1XBXA 1L6WA 1XIHA 2YFOA 4RE0A 3AYSA 1FWJC 1PX3A 2PWGA 4KQNA 4DJFA 2PDKA 3WD1A 2O9TA 1VGAA 2UV8G 3WENA 2J6VA 1ZL1A 3NSNA 3WH6A 1JCMP 3WYZA 1BRLB 3MDUA 3W1UA 3RAOA 3AZSA 3U4AA 1QOXA 1RPXA 3T08A 2ZZ6A 3SECA 3PJTA 4A3RA 3IC9A 1LT8A 1K7XA 1PXGA 1OFDA 1S1PA 5GNYA 4IMAA 2Y62A 4JGDA 3LX9A 4AVFA 3EAOA 3Q4DA 1I0DA 3CHVA 1JL8A 5E5CA 1M04A 2XM2A 2FDMA 3BSHA 1GUVA 7XIMA 2OKOA 1M7PA 1W3HA 4NY2A 3VU2A 4Q4OA 3B9EA 1JZ6A 3K4AA 4HA3A 4MZYA 5CPSA 3DC8A 3U6WA 3DG6A 4F0LA 3CPUA 4O57A 4DI8A 3KL3A 3JRKA 4EKJA 2DU2A 1CGYA 2PWDA 2QJMA 4OBTA 5BRQA 1D3CA 3L0NA 2QVHA 4YNGA 1N62C 3NZ1A 1B4EA 4GHRA 4BWLC 1US3A 1I6NA 2NVAA 4S3KA 4RDVA 3A4WA 3WBXA 5F4SA 3FFSA 4DJDA 3WIJA 4XUYA 3M0JA 2GLKA 3RRXA 1TG7A 3MSYA 4US5D 3TYBA 2Z0IA 4Y2WA 1IV8A 3G1HA 3B8IA 3W0KA 5G2HA 3FXGA 3WMSA 3TJIA 1F6KA 2QJNA 5FD0A 2VX5A 3GHTA 5DO8A 3G8RA 3ATYA 1SZEA 1UWTA 2ASHA 1MMFA 1J79A 3OJGA 2DZUA 5BYWA 4HSHA 4XAZA 4JTTA 3AMCA 1XP3A 1XHGA 2NT0A 1EJRC 2NWRA 1AA1B 4ES4A 3WLOA 3DFQA 2HEJA 2A3AA 3WQDA 2ZX6A 3T0DA 4ZQNA 1NQ6A 4YYFA 1KCXA 3MHGA 1UR9A 2FH6A 2H8XA 2VOMA 3IIXA 4WCJA 1F3XA 1TB3A 1D8WA 3MB9A 3RNMA 2D24A 3M0KA 1H63A 2ZC8A 2A3BA 1W1IE 3W4RA 3ZVIA 4DJED 3EXRA 4PCTA 2J8FA 1YPFA 3N6QA 3VCNA 4ERGA 4XD4A 1PDZA 3W00A 1JZ3A 1HL9A 1WZKA 2JKPA 1MQRA 4FDCB 1TPVA 3KBJA 2CLEA 2C79A 1E70M 3HG3A 5GJMA 5LA2A 4JIIX 2INZA 5DFAA 1ZK7A 4M6QA 3EA1A 4S38A 4DZ5A 4DWSA 3R79A 5HMFA 1YADA 5AYYA 4NX0A 3GVQA 2RKXA 2XINA 1XRVA 3CUIA 4EOUA 2VM8A 4S3AA 2ZICA 4C7GA 2ZA2A 4ENLA 1FY6A 1LBLA 3NYZA 3M1ZA 4CCZA 2FPYA 3REQA 1KM5A 1DXLA 4UNIA 1K4QA 4YJ5A 2IPFA 1XLGA 3TOPA 4ZE4A 4GRTA 2XN2A 2QPUA 1SM9A 1UWSA 1HXJA 4N2YA 3G8EA 1PJ9A 1UD6A 4KIRA 1EJVC 4ZSTA 1PL9A 1V77A 3EKLA 1J0YA 3O15A 3S0CA 1PV8A 3L12A 2VGGA 2A3CA 3EDKA 1GZ1A 3MHUA 2C15A 2YFNA 4AZ6A 1C7TA 3QFWA 3GC2A 2XISA 4C91A 4WKAA 8TIMA 2XGZA 3BJSA 4A8LA 3PULA 3FY1A 4L4MA 1XANA 4F0MA 2CFFA 1W9DM 3NPWA 4TTGA 3AJXA 5A5WA 4DLMA 4WJXA 2X09A 1ZP3A 4R88A 1W3JA 4J1OA 3U5UA 5FI8A 3VNKA 1S2TA 2VL4A 3S2CA 3WMLA 1H0IA 1R9XA 2WXDM 2J3NA 1S2AA 4GBUA 1H1YA 4CNUA 2WSKA 3G3DA 2WC7A 2VFFA 4PULA 3EOEA 4LNCA 1SYTA 4IQEA 1XSJA 2R8WA 2E9LA 2E5DA 4R7OA 4M1RA 4HNLA 3U9IA 3CH0A 3NQVA 4ALDA 1QXLA 4OOUA 1FA2A 3WLQA 4HNOA 3SY5A 1IF2A 1QI3A 1L2UA 3B8UA 3UD6A 3UT0A 2CU0A 4QBXA 1G67A 3W6MA 2WP5A 2OO0A 3BMVA 4IT1A 3CZJA 4XVEA 4CNOA 1D2KA 1XCWA 3EXTA 1GK8A 4ZOBA 1L2QA 3ECQA 1XW8A 1P4CA 3SCQA 4AZGA 4LAOA 4FF5A 3SCNA 4Y9NA 5U25A 2QCCA 1B3YA 5JMUA 1E6SM 4UTWC 4U3AA 3L4YA 5AYIA 3KZPA 2BGNE 4NVTA 2CKSA 1G9HA 3RPTA 4ORIA 2A5HA 4ZB5A 2VT0A 3QJAA 4P7LA 4IIFA 3LB0A 4CEUC 2J9YA 1GQJA 3WK3A 2V30A 3E2RA 4MFEA 1XIJA 3UG8A 1XUUA 4PTNA 1Q6RA 1MYRA 1W3LA 3QKEA 4Y9OA 1U30A 4UWMA 3CUGA 1GV4A 1SSGA 1V7AA 2EQ8A 5AVHA 2SFPA 1VCGA 2FIQA 1UBSA 3VC5A 4RX0A 2V3BA 1O1ZA 3SCVA 1O95A 3VK5A 4G5DA 2BFGA 4B2DD 3WL1A 2X16A 4E2OA 3PSWA 1I45A 4DB7A 4RK8A 3EWWA 3RITA 4HPNA 5AYXA 3HPAA 3SUWA 2YVGA 1ALDA 3J7HA 4XZLX 3GTIA 4ZL1A 3RNDA 3IK2A 3TTYA 3PPHA 2POZA 2WVTA 2BY1A 4GI9A 3R10A 3XINA 4JKLA 1EOMA 1I75A 3A5VA 5CKSA 5FF7A 2E77A 5LHFA 4DBDA 3EPNA 3PFMA 4L61A 3RFAA 2EGZA 2XVNA 2E68A 3WQ5A 5FCZA 5IBXA 2PTXA 4L6DA 1FWIC 2CLPA 1M53A 1R2TA 1OK4A 3GYCA 4K7YA 4GQQA 3R4IA 3RMEA 1VPQA 3G22A 1Q2SA 4HD5A 4UR9A 1E43A 1GONA 2X50A 1ZTVA 1F2JA 1GVQA 1V3LA 2G41A 1VRDA 2DY3A 2QCGA 3RX4A 1I2OA 2INFA 4BR1A 2GSJA 2X8CA 1VBJA 3W53A 1YLVA 1GEHA 4FHAA 4YVXA 1QOQA 3L2MA 3NCOA 3M44A 1PIIA 2XJ7A 3IV3A 4FALA 1KGUA 2AMGA 3LCGA 4PB5A 1KWGA 1E0UA 3CV7A 1RLDA 5K9XA 4XO6A 2PP1A 3T6CA 3THDA 3ZVHA 4KBXA 2RH9A 1FWNA 2J75A 4RNHA 3BC9A 3LXCA 2AQWA 1UR2A 4IJCA 3NIYA 5FKYA 2X8HA 1YPIA 4UQAA 4ICCX 4NAEB 3AM9A 1WO2A 3KCJA 3OO2A 4KRUA 4C6QA 4H8UA 2X40A 4BS0A 4DXKA 4JD4A 4GVGA 4GC4A 5AOUA 3GR7A 1H7WA 2ZUTA 2A7NA 1Z7AA 1OIMA 3F1QA 3NR0A 1XLDA 3GE7A 4C6CA 4OJYA 3LYEA 3NSMA 3PPFA 4GOAA 1EGMA 2Z1SA 1TV5A 1IQ8A 2QF7A 4MKVA 4F40A 2PS2A 3WQWA 3LY0A 4UZUA 4P5UA 4EQWA 4JOMA 2MNRA 4EWJA 1QI5A 2ZDRA 1Q3NA 1OWQA 4MG4A 3UWWA 4WLCA 3Q2DA 5G4WA 1WOBA 1E6QM 3PZ9A 4HMEA 5AC5A 4K39A 3TYDA 2YX0A 3BV7A 1UWQA 1IEWA 4OIFA 2J77A 2OODA 3GYEA 4PB3A 5FS8A 3OYZA 5EMLA 1TPFA 1FWAC 3VE7A 2Z1XA 3V18A 1H5YA 4D71A 1VEPA 4R9XA 2DJXA 2EQ6A 7REQA 4NF7A 1N55A 4LVBA 4DNHA 4C1NA 2FZDA 3GFXA 1GRHA 1BEUA 1Q65A 4ZSUA 3UZZA 1E1FA 4E5TA 3B40A 2G3FA 2Q01A 1MW1A 4IFKA 3GUGA 2ZKMX 3GR4A 4AEFA 3OVRA 3TJ4A 1GOXA 2ZUUA 2VP8A 3KL5A 1GVYA 3LBCA 2ZE3A 4PYSA 3HTWA 4O19A 3G1VA 4JY9A 5FS9A 1A5KC 5DRIA 3MI2A 2AQOA 1GVEA 1LTDA 3WK1A 3WD4A 1JDEA 3MQTA 3O8AA 4MNMA 1S5VA 1XS2A 5AZ1A 1P6BA 2QJGA 3W1PA 2W0HA 4YXGA 4Z1BA 1F5ZA 3MI6A 1SQ7A 3QVQA 2PDWA 4OFCA 4K37A 5A6BA 5CSSA 2QNEA 1O60A 1UYQA 3B8WA 3TLQA 1BPLB 1QTWA 1H50A 1UWIA 4M3PA 5J04A 2PAJA 3TSDA 2V3AA 3N18A 3MZNA 3EKGA 1JIBA 4MY1A 1W2PA 3NDZA 3GSMA 2QHAA 2OOGA 3ZZ1A 3S1VA 1VYSX 2YBVA 5CZSA 4KFOA 2W6RA 1MEHA 2OOFA 4E4PA 4HOZA 2B7NA 5D03A 3BAWA 1VDVA 4CNPA 2FB3A 3ZOAA 3NZPA 3PJXA 1FHVA 1XX1A 2Z2AA 4MWAB 3FW6A 2DIEA 5DT7A 3R12A 4IXXA 1W91A 2EO7A 2CLHA 2YYUA 3WQ4A 1K8XA 3ENLA 1FTXA 3UF9A 1EKOA 1KD0A 4W86A 3DG7A 1MDLA 1KRBC 4WGXA 4RXFA 1KGXA 3AIBA 2WLZA 3ZLGA 6TAAA 3NL5A 1OGBA 1NOWA 3B03A 1TIMA 4JDYA 2WC3A 4R53A 3S6OA 4P7RA 1DXIA 3UU0A 1TQJA 2D22A 3LB8A 4MWAC 1JDCA 3P2VA 1N63C 5I3GA 1BKSA 2F2HA 4KFNA 3R11A 3FCPA 1Q7ZA 3B0XA 1LBFA 3R0UA 1P0KA 5EU9A 3NM1A 3WD2A 3T09A 1ZY9A 4E8DA 4KEUA 2YAUA 2BVWA 4O10A 3L5AA 3F4DA 2WVVB 2FMNA 3O6CA 3L4WA 4E3TA 5MHBA 3URHA 2Z1VA 1BXBA 1SGJA 2WPBA 4UCFA 4DPPA 4W9TA 3GXIA 1BLIA 4FOKA 3ES8A 4TVDA 4FNSA 3B9JB 3E1F1 4PEEA 1WDDA 1N60C 4N6EA 3GVWA 2DSZA 5K3VA 4XD6A 2BOFX 2V6OA 4OTKA 2HVOA 2RHGA 2HMCA 4C60A 1B31A 3WLKX 1KFWA 4QNEA 4JIQA 4ZFMA 3LN3A 1H1NA 3LDVA 3P82A 1ZMCA 2E28A 4Z42C 2EJAA 2CBVA 2XM1A 3FJ6A 1AQHA 3WEMA 3LTYA 5DMLA 1WDRA 3TONA 3NS1B 1ZXIC 3VTRA 1I9CB 3GD6A 4HIBA 4IWWA 3PSVA 3DEQA 4RDYA 5XIAA 4IF2A 2G95A 1NFGA 3BPWA 2FPTA 2XTKA 1U1JA 3N2XA 1S2VA 1FHLA 1Z6KA 1VFHA 2P3EA 3AROA 4C6FA 2VZTA 1KV5A 4UNLA 1A5BA 5TQLA 3RMJA 3T2PA 4AX6A 1RJPA 2HS6A 4AMAA 3L0GA 5A6TC 1BYDA 4B5SA 1GQNA 4D6GA 1DL3A 2A2IA 2VFGA 1CENA 3EXSA 1TVNA 4LYKA 3ARYA 2E5CA 3DERA 4A3HA 4K8EA 1LP6A 4Q32A 2NVKX 2NV2A 3STGA 3GDKA 4AHPA 1PHWA 1VR6A 4S2CA 3C2FA 1CEOA 1LOSA 2A3EA 5HATA 3PUDA 1UZ4A 4IGSA 1TMHA 3RO6A 3DFTA 3QHMA 3MMWA 2NVDA 3S5NA 5A94A 4WQ6A 3BJTA 1K9DA 3EUB3 2OZTA 4G9PA 4Q4MA 1JF6A 1TFVA 2GWGA 1CLVA 3F2DA 2JIWA 5CGMA 2OU4A 1OT2A 1R3RA 5C2GA 1VJZA 3UVIA 1UWUA 5CLWA 3W9ZA 3KZSA 3NYDA 1VP5A 4GGHA 1SVDA 1ZAHA 3B06A 3DHFA 4K6AA 3NNTA 3ANYA 3R13A 1OCNA 4Q8WA 5FACA 2BB0A 2WNWA 4A8NA 1BVNP 3TJXA 2WVSA 4YMZA 5J8LA 1VFLA 2BBFA 4GJIA 2PTZA 1E9ZB 4LS1A 5EL1A 1WYIA 1MSSA 3W1RA 2J47A 1R2SA 4QNWA 1FDJA 1BYBA 3FGCB 5XINA 4S2BA 5HQLA 1IEQA 2WM0A 1XLJA 2ZXAA 3S2LA 2W63A 2XGIA 1T99A 4U3CA 4FEZA 5I3DA 3VZYA 3ALGA 2BXYA 2WP6A 3EMCA 3DBPA 3L66A 3T9PA 4QLKA 3W37A 1IWPA 2X7WA 3VGFA 5AYZA 2W3SA 2WOWA 3IANA 1FP8A 4GH3A 4DQWA 4PGLA 4I5UA 1GOWA 1ZENA 2I7GA 2H9AA 5TD4A 1DE5A 2ISDA 1AJZA 2D1ZA 4NQ1A 5BXRA 1CT5A 4NRRA 4AYGA 2CESA 4B5UA 1VRXA 3N13A 3PB0A 2IPJA 1WKFA 2G50A 2H6RA 1MO9A 4IM4A 1XDLA 2FJKA 5AECA 1GORA 3VCCA 2WMHA 4DO6A 5TNVA 2W54A 2KAUC 3YPIA 3VIOA 4MPQA 3WELA 3QV8A 1VBRA 2HNEA 3HPXA 3LPPA 3MSDA 3VKAA 5KVHA 4GCAA 2AAMA 2DIKA 4JCMA 3R94A 4Y9AA 3O3RA 3NO3A 3MMTA 3VIFA 3QV7A 1N82A 2PGRA 4ZTYA 3KBWA 1GG0A 1K4HA 4F79A 4WOQA 3PR2A 3TW6A 3I7QA 2DORA 4QISA 3TNOA 2HSAA 5D32A 4EMJA 3HB9A 3AIQA 3WMCA 4DJFD 5MF5A 4AD2A 2OWCA 1KM1A 4YCOA 4MNKA 4NRSA 4S3EA 3GAKA 2GGGA 4HZ6A 4KETA 3B97A 3QM3A 2EPKX 3ANVA 4QQUA 4JQAA 4FLQA 2WSPA 1V02A 2ZZBA 1T6MA 4APNA 5BROA 1TJ2A 1SMDA 1SO6A 3QPEA 1GXFA 5IM51 3CC1A 4LU0A 2JF7A 3L7RA 1A5MC 1VFUA 1ZB5A 3MT1A 3UWEA 3FYPA 3PY2A 1HP4A 3VIMA 3MYOA 1WPCA 3W24A 5KVIA 3P0XA 3Q94A 2CC0A 1E9LA 1ONXA 1JPHA 5D9MA 1Q8JA 2EPLX 4IQJA 4LNYA 2A4AA 2WAGA 3GAYA 2J7DA 1J2BA 4CU7A 4XZHA 3NURA 1Q45A 4RR4A 4WVXA 2RDUA 3KWXA 1EUNA 4MNJA 1WB0A 3UA3A 4EACA 1OM0A 5CPLA 1EQCA 2FVKA 1ISYA 3ZJ8A 3CZKA 1OB0A 4XZIA 5CZKA 1S5WA 4KRZA 1L8NA 1N8FA 3AO0A 1EZWA 3D3FA 1RK5A 5HR6A 1WNOA 5BWFA 3ARVA 2VOTA 2E3ZA 2BTMA 3ME3A 4DJDD 3W2NA 3HM7A 4ZO9A 5CCZA 4FI4A 4LCQA 1YW1A 1RVGA 3WLNA 4FA3A 4J7RA 3W23A 2AKMA 2OZ3A 5I79A 1PWLA 5C2XA 1MUWA 1EPVA 5E93A 3KVLA 3NQDA 1EHNA 3W7PA 5IRPA 1RCXB 1AFSA 1C29A 4LY4A 3TUUA 3S9ZA 3W70A 3QTGA 1FH8A 1QT1A 1N8WA 2J62A 1HG3A 2CLLA 3GD4A 3S5YA 1QOPA 4JZ5A 3NQ8A 4DJEC 2EHHA 1S5MA 5KZMA 4GQGA 1PEZA 4A8RA 4M52A 4GG9A 3ZT5A 2NVCA 1XI3A 3W7GA 3WLLA 1CIUA 4CLMA 5M5DA 3WQ8A 3WLSA 3GVVA 1MWOA 2VX7A 1K7FA 3IIPA 1GQIA 3CQJA 2VZUA 3GTNA 4S3DA 2GGJA 4GYJA 4F4RA 2C19A 4H9VA 1TYPA 4MUPA 3MKVA 2PCQA 3OIXA 2AGTA 2RDWA 2Z6IA 2OSWA 3VD9A 3STPA 4N4QA 4HHLA 3OP2A 3G5EA 1K70A 3ITLA 3EB4A 4DWSD 5I00A 4DF2A 1ADOA 1OABA 2AL2A 5A1AA 4JN8A 3VOJA 2WPEA 3RJXA 3S6TA 3GG8A 5D2TA 4RV3A 2HV5A 1Z8AA 4DBWA 1FWRA 3BICA 1L6YA 3K4DA 4NZ1A 3DI1A 3C2OA 2FZNA 4GNJA 4PRTA 4GIAA 5FJRA 3GVGA 3RR4A 4LX4A 3GNDA 3GXMA 2AQVA 1IGWA 2C3DA 2GJLA 1VBUA 4AD3A 2X0SA 3BZJA 2PC8A 2X7VA 1PDYA 3MMUA 1TJ0A 4KWWA 3E3HA 3H2OA 3R2GA 5C9XA 4GUGA 2ACQA 2OJPA 2WKJA 3TC6A 3SCRA 1EDGA 4KEMA 1B9BA 1HF6A 4H04A 3W84A 1OIFA 3VCRA 4CQ9A 3DIPA 4YVPA 2E67A 3NEVA 3WDPP 4N42A 4UTJA 1B2YA 3TQPA 3NPVA 1HP5A 2ON3A 4O4VA 3TXZA 1NOFA 3PS7A 1X6UA 4K1GA 4S3JA 3I65A 3LGEA 1N8IA 3C8NA 5LGXA 3EDJA 1V6UA 2WNQA 2DT3A 2H3BA 1BYAA 5A6KA 1XUZA 5I02A 4UTMA 5JCLA 1IXQA 3WNNA 1KXVA 4E8GA 1EA9C 3B4YA 3DC0A 5T9CE 4GFSA 4TIMA 3DU0A 3SGZA 1W0MA 2WZEA 5FOOA 1KC7A 4PCSA 1M6IA 4DEFA 2WYSA 4JFWA 3I6EA 4UZSA 5EBAA 7TIMA 2CZ5A 1V6XA 3TROA 4KFPA 5IDIA 2ZC1A 4JYDA 4TOQA 1XPGA 3PZUA 1EO7A 4HPGA 2R24A 3C2YA 1OGSA 1O94A 2ZXQA 4Y96A 3ZM8A 1TA3A 1Q6OA 1UKTA 4ZFCA 3FYOA 4PUNA 2C8NA 2VZSA 4W84A 3EYPA 3IJ7A 1KM2A 4ZB2A 1VD6A 1XG4A 4H4UA 1MXGA 3A7UA 1XXXA 3OZMA 3VE9A 4D8LA 1FIQB 4IUGA 3ITCA 3RHGA 3ZJ7A 4NNBA 3LCWA 3H2NA 2TAAA 2OT1A 3SURA 2NPXA 5G2WA 2BV9A 4J2MA 4J3SA 3N12A 3ZQ9A 2Z28A 3NDYA 4M7SA 3NOYA 5HMSA 1HJUA 4M5PA 4PUKA 3VNDA 4DZIA 5GNZA 1CXHA 1BZLA 4Q7BA 4TTUA 3APTA 2IQ0A 1OFEA 4TUFA 1X1ZA 4LYQA 3GB6A 3W2LA 4RNJA 1TV8A 3F4WA 3I7RA 2G97A 2J74A 3CH9A 1PHQA 2PDQA 2VJXA 4HK6A 5K9CA 4LGXA 1BVWA 4NKCA 1OC7A 1ONFA 1T40A 4XZMX 4WX2A 1E0VA 3QGVA 1TTQA 4O11A 3IUDA 3RDKA 4C6PA 3DGZA 4FLRA 1OY0A 2AL1A 4DBUA 3VAVA 4Q4PA 2WW5A 4QG8A 4NNAA 7TAAA 4MJ2A 4QRNA 3DFYA 2E1DA 3A47A 3S1GA 1QO2A 3U2CA 4PCFA 5CG7A 1TWIA 3H4WA 2FYMA 1PCWA 3N9SA 1R2RA 4GUJA 4LRSA 2RDTA 1H7XA 2VGIA 2PDHA 1UWAA 1LT7A 1JYNA 4DWDA 4YWIA 1TRIA 2WSQA 4CD6A 3C56A 4H50A 4RE2A 1RVKA 1S3TC 1KFLA 1V3KA 4IPLA 4Z2HA 1FOBA 1E6PA 3OPSA 2CYGA 3IWPA 3LPGA 5I3HA 1TCDA 2J4GA 3DX5A 3CXBA 1IXNA 1E15A 5REQA 1NP2A 3E96A 3ZJ6A 3WQCA 4JX5A 1A3HA 2JKEA 1HKIA 3TN5A 3DENA 1C8QA 1XRTA 2EPHA 4EQSA 1BYCA 2GUYA 1EHAA 4Q22A 3ZVHB 4H00A 3PBUA 1PO9A 2E25A 3ERPA 4EWND 4MFDA 5LNUA 3ITXA 1J2WA 5HDRA 3WUBA 1CI1A 3ARRA 1THFD 4LOCA 2DQXA 3CU2A 2VX6A 2Z27A 2QUUA 1A0EA 3D47A 3KRBA 1VCVA 4GINA 4EK7A 4L1WA 4EANA 1XD0A 3N11A 4GKLA 2VC6A 3B8DA 1XYZA 4HNTA 1U2YA 5G1TA 1AD4A 3P74A 4CD7A 3L4UA 4C6JA 1WDWA 4RZ4A 3GXTA 3W25A 5KZ6A 3CV1A 3FJNA 3TTEA 2ANUA 4E2VA 2GGEA 2BHUA 1Q4NX 3LXAA 1ME8A 4B91A 4DUOA 4WXYA 4DN1A 2PWUA 3SUTA 3GNXA 3NDOA 4DELA 5HK4A 4Q4KA 1JI2A 3WKZA 3JVAA 1JEZA 3AXKA 3T0CA 4XTIA 5MKGA 1G4SA 2UBPC 1DJGA 2YL5A 3MWCA 4FSAA 4ZB0A 3CNYA 4AX7A 2V68A 3SRFA 1TUFA 3SGGA 5JH1A 4ERAA 1F3EA 2QUVA 2V5DA 2H8ZA 4J28A 4Q8UA 4J9JA 4S3BA 1V7YA 4WDTA 2VFHA 3CGBA 1WKDA 3RYSA 5HWJA 1NFPA 3MUY1 1PKNA 3LLDA 5LA1A 5DCEA 3CB8A 3T2QA 4WSHA 5AHEA 1C92A 2XUCA 1LUCB 4V1XA 3SRKA 4CCCA 3AIUA 5E0FA 4N0RA 5JIWA 2VR4A 4DZAA 1QO5A 4IFKB 3CQKA 2Z29A 2OEKA 4ZTXA 1YTEA 3EAUA 3FAWA 4UQDA 1UPMB 4UBPC 2V3GA 4MDOA 2W0UA 3R8HA 2HK1A 5A2AA 1U5JA 3QW3A 3NQ2A 2VDHA 2ZZ0A 1TYTA 3M7WA 3IJQA 4I7WA 2IQTA 5M3WA 1UR1A 1ZY8A 3P8JA 3NVWB 4HCHA 5U4NA 1E9IA 1XKJA 1S46A 4H7ZA 3OBKA 5FJPA 3TIMA 2FTYA 3MP3A 3E6EA 5M17A 2B7QA 3JUGA 4J40A 1GRBA 5G5IA 3GK0A 2BCPA 2BSLA 4LVFA 3MUCA 1I2RA 3SADA 3CWNA 4O13A 4MJMA 2A79A 3W6YA 4J56A 1G7VA 4AHOA 2DT2A 3TQKA 4DHGA 1G01A 5A6JA 4NX5A 1LPFA 4RUBA 2I5IA 4CN6A 1Z69A 5A6BD 1XSKA 4JTGA 5C54A 2XH0A 2W9MA 3DYMA 1LOQA 4NJIA 5D30A 1V8EA 4JX4A 1KA9F 4D8AA 3CZLA 1GKPA 2ZUVA 3F03K 4D6JA 3P93A 1X97A 4MPKA 2L5HA 1H60A 2WZHA 2YCEA 2ALDA 4JTIA 2RJHA 3T07A 2E0PA 3CLWA 1YDYA 1DJYA 3TR2A 1KCLA 3NL6A 2QCMA 4KESA 3ABRA 3E02A 3M16A 3CUZA 3N6HA 4BURA 1REQB 4UTUA 3LHZA 3S42A 3FKKA 3H12A 1ONEA 8XIMA 4ZOHB 2D73A 2Y7DA 1R8LA 1ZZMA 2GJRA 4ZENA 2GGIA 2X1RA 1EWDA 1J0IA 3WN6A 5AY7A 5LXEA 1KXHA 5JCMA 4UFIA 3ZS4A 4AISA 5CPNA 3T42A 3IVUA 3PZQA 3AJ7A 1Y5WA 1XYCA 2Y8VA 1YQ2A 1GZGA 4BEQA 2DSWA 1RP8A 2PDGA 1TVLA 1MRQA 2CEQA 4JCLA 5LNVA 4IXHA 3UXLA 2WV8A 1W1YA 3HQPA 4NI8A 4X63A 3ITVA 3IGUA 1E4NA 1JDAA 5HNUA 2YLAA 1P0NA 3DFNA 4OQVA 4UFKA 3B04A 1E71M 1S38A 2NQZA 1UOKA 4DXXA 3HRDC 3BG3A 5JCNA 4KPLA 1A5CA 4H2HA 2C6QA 4R7JA 4ECLA 3CB3A 3W29A 4EF9A 3H26A 2EG7A 1X1OA 4IJRA 1ISXA 4Q4RA 5J5DA 1CXKA 4ZQMA 1B1YA 2OT0A 6REQA 1RM6B 4UTTA 2ZOXA 2X1UA 1JFHA 1RV8A 2ZCGA 2XDFA 4UQBA 4WR3A 5EFDA 2FDSA 1KTCA 4H4ZA 1QBAA 4PMVA 4B4FA 5CSRA 3UZYA 4KRTA 2VKZG 4XAYA 3CGTA 2DV0A 3ID7A 4PMZA 1JQVA 2BX7A 4IMCA 1FKXA 1XM3A 4NXSA 1FFQA 4IPIA 3V36A 3B9OA 4CQBA 1BGGA 1L8PA 3UZWA 4ZEPA 4Q7IA 1J01A 2QUNA 2XZ9A 4Y9MA 3PZOA 4EMWA 1PE1A 2Q8ZA 2QMKA 1CB2A 1ENUA 3UR8A 3DECA 4ZO7A 3VIPA 3GR8A 3ONBA 2FVMA 5A95A 3EWYA 4J3UA 1RJQA 3AWNA 3N9KA 2WPGA 3HMCA 4H4PA 1EX5A 4LW7A 1AQFA 2J79A 4MKSA 4YLWA 3NPXA 4GVHA 4GPNA 2F61A 2B4GA 2OR2A 3UPWA 2O55A 3ABQA 4ZQCA 5C7HA 2ZWZA 5FAGA 3NO1A 4RDZA 2HISA 3C8FA 3SY8A 1VJIA 2XFRA 1B0IA 3CHDA 1UR0A 3BH4A 4OE7A 3MYPA 1US2A 4B3LA 3GU1A 3AAMA 4C5YA 4F0RA 1MXSA 1TWDA 2DZSA 5LIWX 4B92A 4ZXLA 2XVKA 1XSIA 1TWZA 1EJXC 1HT6A 2NQ5A 4WD0A 1P5BA 1YTDA 2GZXA 3I4KA 4ML9A 4IIHA 4MYXA 3A7AA 4N6FA 4L80A 1NVMA 1UG6A 1UW9A 2IS7A 1RY8A 4JHOA 1EC7A 3JS3A 1H3GA 1E72M 3LA4A 1DE6A 3TC7A 3B9DA 4KS0A 4W7VA 2DH3A 1ELSA 2HJPA 5IHRA 4H6KA 4FR1A 1OVDA 3ARZA 3NQMA 3BLDA 5AHFA 4ZOEA 4NP7A 2GQ3A 2GR0A 3E5BA 1JR1A 2OYMA 4JIPA 1YDVA 1V6TA 1P0BA 2F9RA 4KGLA 1C8VA 4Q8PA 5CG0A 1FWSA 1F07A 2BY0A 4NZ5A 5TAOA 5BXPA 3SFKA 4H4WA 2JKAA 1O12A 3PZTA 2CIPA 1ZBCA 2WNZA 1IZKA 4ZO8A 1W37A 4DM1A 3UJEA 4CNNA 5I24A 2RGMA 1KFEA 5F2LA 2Y5EA 1NDVA 4IIDA 3W7DA 3NSXA 1U5VA 2ZUWA 1OD0A 3SUUA 2EKGA 3VVGA 3VNIA 5A6MA 1LLOA 4Q7NA 4TU1A 4HN8A 1A3WA 2W5FA 4PN2A 4O15A 2WWDA 3W7QA 1A4LA 4QE5A 5H8PA 5HPCA 3CEUA 1XRSA 4O17A 1WYGA 3SUVA 4O0ZA 3O0FA 4DIAA 2VGFA 2QCNA 2HBVA 3LHTA 5D8ZA 4PMYA 3MANA 3SJ3A 3RLUA 2Y7GA 3O6AA 4YTRA 4DUXA 1X38A 1H11A 1MW3A 2O92A 4E2DA 3KRSA 1DWFM 1E6ZA 4WGHA 2WJFA 2BGSA 4HT3A 4MJ4A 2OLAA 4K36A 1CLXA 1FWHC 4MB4A 2OZ8A 1V6YA 1EBHA 3A3WA 4IL0A 1OADA 3EA3A 5FEXA 4H9XA 4M6UA 2GR3A 3DGRA 2DSKA 1OX4B 4PFHA 5I78A 5IOBA 3TMQA 4FNRA 4GI8A 4NAEA 4D6DA 4GD0A 4D6CA 3TN6A 3ITTA 2J27A 4ADWA 3M47A 4QJ4B 2NV1A 4I9MA 5FF4A 1X2HA 3VMNA 3WF3A 1EEXA 4YTSA 4RE4A 2X41A 4W8LA 1M7OA 3BLKA 1XCFA 3G6MA 3M41A 3T44A 1QPOA 2VWSA 4Z2JA 1R3VA 2ZIDA 1RXOB 4GJJA 1EIXA 2W66A 1F4HA 3N25A 3W7KA 5A69A 2MANA 1WQ5A 2OQLA 4HHMA 3BTNA 3S9IA 4U31A 4M8UA 5U1OA 3TYEA 1QASA 4F2TA 4J3XA 5FSDC 2PUZA 1EF2A 2YJQA 1V93A 2WBGA 2ZE0A 3EOLA 3L67A 3AYTA 5B7YA 3OLDA 1SPQA 1CECA 1GJPA 3LXBA 3NVDA 2XVPA 4I8DA 4NL1A 2C3ZA 4DUWA 1F4AA 3TYAA 1UD3A 3M5VA 3SY1A 3ZT6A 2QPSA 3TE9A 3APGA 2F38A 3HGOA 4LC8A 2ZA1A 4TVUA 1E56A 3GH7A 3Q45A 3ZIZA 5H8MA 1FKWA 3RM4A 3WJYA 2INEA 1OFPA 3B05A 2G96A 4GZIA 3CPGA 1AH4A 1WOAA 4G7EB 3UFYA 3K1GA 5D09A 1SJBA 1IT7A 5LZLA 4OT7A 1NIUA 2OEJA 1XR2A 1O66A 1DJNA 2R91A 1XD1A 2WZMA 4QTGA 2G3IA 4YL2A 4YPJA 2W55A 2ATMA 4DX3A 5D8WA 1S2CA 1ZKQA 2CXGA 4KCUA 1HKVA 4JICA 2OWWA 4RL3A 4HU0A 5U7SA 2NLYA 3IJIA 4EQXA 1VQTA 2Q3RA 2PP3A 4Q6JA 3QOKA 3PP7A 2PF0A 1XF0A 5DX7A 2VDGA 4OECA 2CLFA 2QV5A 1HX0A 4TX6A 2F7FA 2REQA 3GNRA 1E0XA 1UBPC 1RSCA 4Q8MA 2ZXDA 5AC4A 3AUJA 4XVDA 1AVAA 1BWCA 5LIKX 1TR1A 3WF0A 2JGQA 4KIEA 2QCLA 1EJTC 1CW2A 5HNRA 1RALA 3RF9A 3W7MA 4S23A 2DT1A 4C7FA 1A5AA 1EWEA 3KVMA 5FJTA 3WLIA 4MLRA 3GM8A 1YBQB 4HU4A 4LUIA 2XG9A 2VVNA 4R5EA 3FS2A 3VXGA 3G6LA 1MQPA 4L6OA 4ACZB 4FF7A 3R89A 3G1AA 2IPWA 4OZOA 2MUCA 2E6AA 3AMLA 4MWAA 4I7UA 2F8QA 3BXWA 1WE5A 3PANA 4DWSC 4C1KA 2ABAA 3LBOA 3CLMA 4MJZA 1F7BA 1E5NA 2DJLA 4JY8A 3H55A 1UQYA 2BOEX 1H1ZA 3C86A 1VAHA 3E0IA 2NQHA 1J11A 3GH4A 1VFSA 1UASA 3UGRA 3GXPA 1KGWA 1YHTA 4AEEA 1M5WA 1X1NA 3GVRA 1EJSC 1E1EA 3TW9A 3MV11 1RLCL 2QS8A 1OG0A 2Y7EA 1XLCA 1GW9A 1GTHA 4XX6A 4FMVA 3TYZA 5ENLA 3G1DA 2A6NA 5A6SA 1SO4A 4H2CA 2CCRA 5LA0A 1FEAA 3CO4A 5HOSA 3K8LA 2ICSA 3QFBA 4F9JA 1D8CA 2WVVA 3CL7A 2I16A 2D20A 4H4TA 1XKYA 3K5XA 3UCQA 1GETA 3NFUA 4NNCA 4Z1CA 4CU6A 1ZGDA 4GO9A 4HBKA 4DXVA 3IEBA 1VFMA 1ADSA 2HE5A 3LADA 3SFWA 1SW0A 3UXAA 4AF0B 3AXXA 3PTDA 4B4HA 3WQFA 5L9FA 4JFUA 1KBKA 1Q66A 1XYBA 3WFLA 1FWCC 3WNMA 3NA8A 4LVAA 3QH2A 3CHFA 1FFUC 2V69A 1UA7A 3KLKA 2HBXA 2P0IA 4FOUA 4J2PA 3QY7A 3UCCA 3OZPA 3VNYA 1ZSXA 4W93A 3AICA 3W1TA 2P10A 4EM4A 1U1HA 3FVDA 1CGWA 1J10A 3C61A 5BOFA 3MUXA 3GZAA 3PPGA 4QJ3B 2UWFA 4BF9A 2A21A 4RPPA 3G2GA 3D6NA 4EQRA 2W3ZA 4HHHA 1LWIA 4PFMA 1DHPA 2E7FA 2V0TA 2V63A 4O4WA 1YNYA 4D8ZA 4UTLA 5JXQA 5DF0A 2JF6A 4CVWA 3LCXA 1DTUA 2A7PA 3G1YA 1TE6A 4HB7A 3PN8A 1F3TA 2QPXA 2WJEA 1J0HA 4CQAA 2XWDA 1TA3B 1C90A 2FMOA 1R6WA 3W7OA 1PKYA 4B16A 5BRBA 2EQ9A 2ONEA 5E9AA 1TRDA 1EBGA 5BU9A 3MDWA 3S5OA 3R0KA 5SWUA 4NZCA 1U33A 5DRCA 3GNNA 3A6OA 2R1LA 4GQBA 1Q85A 3BLFA 3H4GA 1ZP4A 1XFCA 3VIKA 3RLVA 2XU2A 4O1FA 1QRQA 3GDMA 3H4XA 3MKCA 1FWFC 4GX9A 3MKKA 1ITUA 3QGAC 1DJZA 1OX5A 3CAVA 2OQYA 4JQ4A 1MQQA 2X30A 3UXKA 4WY0B 2WOVA 2H3DA 2PRHA 3PZNA 1S2UA 3QRHA 3OLIA 3N4AA 3H7VA 4G8TA 4K1WA 1NU5A 5E9XA 2X99A 9RUBA 3LM3A 4O53A 1PKLA 2E6FA 5DXXA 3EB3A 3PWIA 2ACUA 1QI0A 4QP0A 4XD3A 3MO7A 5GQBA 1W3TA 3ZSTA 2X1TA 4IGMA 3CK5A 2GVYA 1VENA 5I07A 4GY7A 4O28A 2OPJA 4HPHA 4QS6A 3VFCA 2BC1A 1P1XA 4MAZA 3R8RA 1KBIA 3ZFHA 4R33A 4EAMA 1UPPA 4R85A 5D4YA 4D6HA 2IXUA 1JUKA 1H2JA 2ZDSA 2ISFA 1LRNA 2PC4A 3P61A 2CZDA 3HU7A 3AMZA 2X0HA 1HKWA 3WX7A 2OQHA 1A5UA 3EANA 3JR2A 1LL6A 4R7WA 3VNZA 1GVRA 2VRJA 3FEQA 2XIJA 1Y7VA 1OCBA 2P53A 4XO7A 2NX9A 2WCGA 1NHSA 3FGCA 3S47A 3E0FA 1BXCA 3QPZA 2WQPA 1W9XA 1Z32X 3UWVA 3O7UA 4BZYA 1NAL1 3OC4A 2BDQA 3WQPA 1GPWA 3QHOA 1RQHA 2WSRA 4L4PA 1AW5A 3BSGA 3GQYA 1D9EA 1JCXA 1MVYA 3L4XA 2XH4A 3IARA 2OKTA 4S3CA 4LAUA 5DANA 3HG2A 4GUHA 3MJYA 4I9JA 4PTXA 1H2IA 1JAEA 5IBXC 5LHEA 2Q8XA 4BF7A 3G77A 1EQPA 1Y0EA 3IS4A 5REQB 1C7SA 4QSHA 5JBEA 5KZEA 3WNLA 2XFWA 4NUWA 1YIXA 4L64A 2O9PA 3C2VA 1KWKA 4HZ8A 3BG9A 2BXZA 3S4TA 1F74A 4GC3A 5D2VA 3EB2A 5A2CA 4ZOAA 9XIMA 4MHBA 5D02A 1UR8A 4XSMA 1NWTA 3QYSA 5I5RA 3DK4A 4AB4A 4TX8A 1TX0A 3E2VA 1LWHA 3BURA 4WDUA 1EF3A 3SSJA 2HZGA 1TV4A 4FX9A 3W7JA 3ARXA 3ZLHA 3H8AA 4US6A 1QWGA 3NWRA 3IAQA 3W1XA 4QROA 1EYWA 1GRTA 2CBJA 3R58A 3ZSSA 4GYPA 3CT7A 1YE4A 4IIGA 3G1FA 1E4MM 1VEMA 4Z2LA 5CLTA 5EBKA 3NG3A 3MP4A 4IL2A 4PUWA 2EEXA 3VD4A 3THQA 1KM4A 5C7VA 3USBA 3TV8A 1Q13A 2WWCA 3CPRA 5MKGB 1WP6A 3AHZA 5ECVA 2QMJA 1DPMA 2TRSA 1AL7A 3GG7A 2VVSA 3UR7A 2VMFA 3GNOA 2BS9A 3JZEA 4O1AA 3GO2A 4DUVA 1W3IA 2TPSA 1FO4A 4DZHA 3GXFA 4HVXA 4YYCA 4HYWA 1G69A 3UERA 4X2RA 4UXDA 3DJGX 1VEOA 1EZ2A 1Z89A 1PB0A 4N9BA 1JZ8A 1IXPA 3RO8A 3R1ZA 1YKWA 4ZO6A 1KR0A 3VOHA 3DFSA 4JS3A 3IRDA 3R25A 4EPKA 3HV9A 3HQOA 3KBVA 4HKPA 3EKZA 1IEIA 4P8UA 1TV7A 4WOZA 3W1LA 2XVGA 3M5YA 4A3QA 5CC7A 3GNPA 1LOLA 3S1XA 2OELA 3FNDA 1T3QC 1X6LA 4OOZA 4FNTA 2OSYA 1FFVC 2WOQA 4F3HA 1FH7A 2E5BA 4AD5A 2Z2UA 1PUDA 2V3DA 4IMEA 3EOOA 1H49A 4TV6A 4W89A 3TA6A 4JTEA 3SCUA 1TQXA 1RAKA 1XLBA 1JVNA 1MNZA 3PAOA 1OFOA 3KOYA 1Q7QA 3ES7A 5HMEA 3OVPA 3N73A 1W5PA 4P7OA 1XYAA 1GYNA 3FVMA 3DH9A 3ITYA 1D7KA 4LH8A 3DK9A 1WA3A 2PRLA 1TR9A 4XBSA 1VH7A 3CZEA 4LYRA 4V15A 2E8YA 3OOQA 4MTVA 4RXGA 3IVTA 1GKRA 5EBUA 5AHNA 1PIFA 4REQB 1DNCA 2PU0A 4YTTA 1J96A 1ITXA 1E1CB 3H2MA 5CC5A 3C0QA 4CNTA 3GWQA 4FO4A 3DFPA 5I3KA 3ABOA 3W1QA 2V67A 3UZXA 3GRTA 1A3XA 1ZLPA 5CBBA 2FTWA 2Z26A 1KCKA 1OGGA 4W7UA 1QMLA 4LVDA 4C6BA 4MZ8A 1OYBA 3SR6B 1NHRA 3VKJA 4HSNA 1Y5XA 1QK0A 4RLIA 3OQEA 4I6VA 1DTNA 2Z1WA 2XIQA 3UZ5A 2OGYA 4N02A 1ZHAA 3C5QA 4I3GA 1X96A 4H1ZA 1EFZA 4X9YA 3D9XA 3V5FA 4LUJA 3EMQA 4A21A 1MO0A 2NQLA 5HQEA 4X0NA 3M0LA 4TVWA 3WH7A 2Y1HA 3LTPA 4OBSA 1T41A 1KFBA 2QYGA 3O63A 4HN4A 4C6EA 4H9UA 4JQ2A 1CNVA 2Z24A 4QDMA 3UW6A 4TVCA 3LOTA 2G3JA 4L56A 3S1WA 4RPQA 3AQUA 4LBUA 1BG4A 5JRBA 1CCWB 3MCMA 2OGJA 4C6IA 4YCPA 2VWTA 3G0SA 5CAHA 3FXYA 1RA0A 1PTAA 4IMDA 2OYLA 2ISWA 3GBEA 3CQHA 3EPOA 1IR1A 2CDUA 2D23A 2GQ8A 3EDEA 4C6DA 1KW1A 1GPFA 4JIHA 2FFCA 1E73M 3LGDA 2FFIA 1AUSL 2WSYA 3A12A 3W2UA 4X0VA 3U4FA 1DJQA 4C5ZA 1WBJA 4XWUA 2FHCA 3QR3A 1MW0A 1RH9A 1T8QA 1WUEA 1HVQA 4GYFA 3H21A 3EX2A 2YSWA 1CX9A 1YMYA 3PZGA 3C6CA 1RD6A 3NQCA 1QATA 3R0DA 4CQDA 1G0CA 3QN3A 1HKKA 2A0NA 2QCFA 1R9ZA 1V97A 6REQB 4J3ZA 3U8GA 2EXOA 3W87A 5D9OA 4WJEA 2GL5A 1TJ1A 5FA5A 3RLHA 3TP4A 1Z44A 1YPXA 3GU9A 1GKQA 3A9BA 1MDRA 2DGAA 4X61A 5G4HC 2XVLA 4HU3A 1IHIA 5I09A 1P0DA 2NX1A 2PGWA 3TU9A 3WDHA 3W02A 4IQDA 3PBGA 4RCXA 1QPNA 4FP1A 5A8MA 1V51A 1VHCA 2DIJA 4Q4QA 3BZGA 2R1MA 2C14A 3VM7A 4XAFA 3WNKA 3BL3A 2J25A 3UJ2A 3W75A 1M7JA 4YN5A 1EGVA 1OT1A 4NXKA 4AZCB 3UZJA 4HPXA 3WQ6A 4C90A 4WKHA 5H91A 3KP1A 5EMYA 4U5KA 3M5ZA 5G1MA 2QW5A 1XLMA 3DYPA 2J9ZA 4HA1A 5HWNA 4K7ZA 3UESA 3CAQA 4GZJA 4JX6A 3WH9A 1V3IA 3H2EA 3BLIA 2FJUB 4EXBA 2GDUA 1OZMA 1XDJA 1JAKA 3B9AA 4AQLA 1GW1A 4LVGA 3W71A 1R9YA 2CLMA 4IPPA 4KCWA 6XIAA 1RHCA 3OHMB 1NY1A 2F2KA 3II4A 1T0OA 4BEUA 3AUOA 3BAXA 3DN5A 5FEWA 3PBWA 4I8YA 2DZPA 2QIWA 3GHRA 1FCQA 3BMWA 1QAPA 4B90A 5A8QA 2VEGA 3LBMA 2G3NA 3NQ7A 1XINA 2AKZA 1PTDA 4JN6A 3N2MA 1E5JA 5DY2A 3AIWA 4X22A 1ZQ5A 1RPKA 2X2YA 2YCLB 4H8HA 2QV4A 3WLRA 1FWWA 4JTFA 1R7AA 4ZE5A 2V3EA 3VKBA 4JFVA 2BY3A 2B81A 2ZTJA 3BSMA 2YL9A 5ABFA 3Q65A 5BNKA 3IRSA 4JIRA 3RM9A 3LCFA 3TTQA 3QR1A 3W3OA 5CPTA 1HGWA 5AC6A 2HE8A 1O5XA 2WVUA 4M6VA 3TJLA 4JFSA 3UXDA 3HW2A 3N04A 1AW1A 3CQIA 4MGGA 4JR5A 3PB2A 1V0KA 2XFYA 5DMMA 1WX0A 4KEZA 3UWYA 4HPJA 4ZMGA 3N34A 1VB9A 2O9RA 4D1IA 3UJFA 3I7SA 1ZJHA 3KW3A 5CPOA 4QIUA 1EJUC 1XYMA 1EC9A 3RPMA 5I7GA 1GHSA 1XJBA 1UZ1A 3VO0A 5T9BG 1E6NA 3SRDA 3G24A 4WZHA 5BRPA 3F4VA 3FK4A 1NWUA 1QI4A 3BMXA 1NF7A 1CGVA 1QCWA 5LXXA 3WK2A 3PJUA 2D3LA 4GYKA 3W7CA 4LV9A 1XICA 2FLIA 4O8AA 4H6RA 3M9YA 3GY1A 3QC0A 3K8KA 1E40A 2ZFAA 4O1DA 2AMXA 4Y9PA 2R6OA 4ZODA 1M01A 2PCEA 1NJJA 1MUCA 4DBSA 3SZ8A 1OG6A 2DW7A 2FZBA 1UC5A 1XBYA 3HGJA 1J0JA 3MO4A 3U7VA 4IP7A 4AY1A 1WKEA 1TPDA 5ECUA 5LIXX 4YWOA 2ZRVA 1NSJA 2Y70A 4YU1A 4E6MA 4PMJA 1LBMA 5CZTA 4BI7A 4QEHA 3NXFA 4ICNA 4O52A 2BASA 3W2MA 3O0HA 1I2PA 3GU2A 4HU8A 2ZX7A 4CNSA 1J9YA 5E09A 1M3UA 5HJLA 3SJNA 2V2HA 2OWXA 1RBLA 4QJ1A 2VC9A 3HURA 5EMUA 5I23A 2DVXA 4AIOA 4IG2A 1IYXA 5HJXA 4TR9A 1MRAA 1UKQA 2RJGA 2YB1A 3E9AA 3R07C 2ZZ1A 4JQ3A 5EMMA 3P62A 2GVJA 3GW0A 2E9BA 4FS9A 1OC5A 2VRKA 4A05A 4JTRA 1PYMA 2PDPA 3T55A 4RNIA 2E3TA 1S5NA 3UY7A 1VF8A 5I0DA 3AC0A 3VIHA 4G6CA 3GC5A 3QTPA 4NYUA 4A8IA 1YE6A 3NZQA 1UKOA 2I9EA 5A6AA 2I1OA 3AXMA 2WMKA 4RW3A 4PUMA 3SSZA 3VYLA 1TVPA 1TYGA 4WXZA 5FJIA 1DVJA 3G0UA 3GDRA 1XIIA 1LUCA 4PTMA 1TMQA 3QEZA 1EUAA 4C6KA 3AS0A 3W27A 4HTYA 5C9ZA 1W1PA 4QHRA 3VMOA 3PPCA 3MA8A 3NQEA 3TH6A 2PE4A 5HULA 4A22A 1K1DA 3KDNA 4F2BA 3S83A 4IOTA 1DIDA 2VFDA 4BJHA 2RABA 4ASTA 4NJGA 4LXFA 3F5JA 2ZRUA 1KO0A 1NP0A 2NX3A 2NQJA 2JQXA 1BSIA 1J0KA 2WZIA 5BMWA 2FZMA 1NOUA 1POKA 5C8BB 2V38A 3BUVA 3B3DA 1YXYA 3V0TA 5JQ9A 3K13A 2VTFA 1UD2A 1FECA 1JNEA 3GBDA 4GZ7A 5FJUA 1RY0A 1TX2A 3VD7A 1QNOA 2REQB 1G4TA 3M0HA 1W9UA 4ZQPA 1RP9A 1SO5A 5CJ5A 5I3FA 1RBAA 1FQ0A 1B3VA 3WBEA 1LZOA 1FH9A 3P0WA 1SFSA 4HP5A 2Z7KA 1ODUA 2B31A 3KOFA 4N9DA 2G8ZA 2Z4GA 3HPZA 1ODZA 2P3ZA 4LT9A 1SB3B 3LQLA 3QV9A 4IICA 2FGBA 5C9WA 2ZRZA 1C8XA 3DKJA 4B9YA 2ACRA 2FB2A 1K6WA 1H7OA 1YNQA 2GK1A 3DAQA 1K9EA 2I9UA 4JXCA 4TO8A 4BI5A 4AVNA 1WBHA 3LV5A 1XYFA 1C3FA 4MB3A 3M0VA 3P5ZA 3I4EA 2CBUA 2HVMA 4JHZA 2JBMA 4HCLA 1ZJAA 2P8CA 4AZBA 1C91A 1DP0A 4LB3A 2GUUA 3WF1A 3Q58A 3G18A 4GXPA 3BDKA 4CUCA 1HGYA 1UKSA 1XG3A 3ARWA 3KBNA 4M24A 1REQA 3S46A 3OG3A 3TEVA 1KR1A 1SU5A 5D2YA 2E8ZA 4P8WA 3POHA 3S2NA 4MWAD 1V0NA 2E6YA 3P67A 2TPRA 3HQNA 4DNMA 4RNFA 4IIBA 2VO5A 3RU8X 4GXMA 4FX7A 1XDIA 4D1JA 3KLJA 1RCQA 3E49A 4KGJA 4H6EA 2CWNA 3HPFA 7ODCA 1ZCOA 5A3HA 1GRAA 1NQKA 3NAVA 2BY2A 3RX3A 3VGBA 4GIYA 1B3OA 1F3WA 1FWGC 2IUZA 4JPGA 3RN6A 3II1A 1QFEA 2FVLA 5HMDA 1FCVA 2CZVA 3WFZA 2GVLA 4EPBC 9CGTA 5I6SA 2PDUA 5JBDA 3DESA 3NTYA 1YYAA 3WY1A 1UMYA 4OGZA 3QPYA 6A3HA 3GH5A 1LQ2A 4EXQA 2OSXA 1M6JA 3WEOA 5IXEA 3PBMA 5CZJA 4WDXA 5FJJA 1VCFA 1EIBA 2V5JA 4ZA0A 5KETA 1O5QA 4GNKB 1CXIA 4LY8A 2CITA 5LSMA 1T7LA 3E0WA 1XLHA 4Y8FA 1VKFA 3H7UA 3P60A 3NL2A 2UY2A 2WHLA 1DV7A 4KCTA 3SDOA 4J3WA 4LS0A 4CVUA 1PZ0A 3RIKA 1XGDA 2CNCA 3LUTA 1PBGA 4UFJA 4QE4A 5GJNA 1AODA 3UWZA 4AZ7A 3MVIA 3W85A 3W86A 1FFRA 1QU4A 4UUIA 2WJDA 2XGBA 1MNSA 3N3MA 1UD5A 3QV6A 2QDGA 3LLXA 4UOZA 2QIIA 5JH2A 1KKRA 3LI1A 5DXYA 1XIFA 3V0SA 4EMIA 2E4TA 4GR1A 2PDYA 4H9ZA 1XFBA 3HG5A 3T78A 1GGOA 4F9DA 4TVYA 5LNRA 1DJWA 3SAZA 5HA7A 4C65A 4FK9A 5JCKA 3NQFA 3GDBA 4Z17A 2A1YA 4AY7A 1JYWA 2ZQ0A 3SIMA 1ICQA 3NGFA 1FP9A 1I1XA 3O6YX 1R7OA 1SR0A 3R6IA 1XH0A 4HNNA 3Q37A 4MB5A 3SCSA 1U83A 3RJYA 3KEHA 2R1PA 4JQ1A 5EGRA 1RK6A 5JIPA 4EPDC 4IX2A 3TYCA 1D3HA 4JN7A 3CWHA 1PWMA 3T0TA 1Q8AA 3W22A 3ITGA 5A8NA 1K77A 1DJHA 1LL7A 3WD3A 4RZ6A 3ZT7A 3A22A 2BVDA 3EX6A 4R34A 3BQ5A 5A6LA 3LNMA 2C13A 3P7YA 3TN4A 4S1FA 1EXPA 2Y89A 1SJCA 2A3HA 3QQ1A 1ZU8A 3L4ZA 1IEVA 3T7VA 3RK8A 1XLLA 1JNDA 1V3HA 7PTDA 5ABGA 3MUIA 1PTGA 2R1NA 2ACSA 3P8IA 2O4QA 4LWWA 2QUMA 1CB7B 5KINA 3CMGA 3GG0A 3QZEA 1QNPA 4YWSA 3WZ0E 1K8ZA 4Q6XA 1QI2A 4LAKA 3W7RA 1WUFA 3DUGA 4UB9A 1OFBA 1ZBKA 3V1HA 2ZYFA 1UJQA 3NZRA 5AZ0A 2ATSA 3STEA 5D37A 4AIUA 2QULA 2X1SA 3W72A 3TCSA 3G1XA 1R86A 5H2ZA 4Y6GA 1QW8A 2PD9A 4O18A 2EAWA 3R43A 5AHMA 4BQ3A 1F76A 4D9PA 3TWBA 1MI3A 2ZZ3A 2D0HA 5JBFA 5EYWA 1PZ2A 2ESCA 3WDRA 3B0VC 2HK0A 2VR2A 1PZ3A 3KS5A 1CZ1A 2D2HA 6PTDA 4Q8QA 3IGHX 1BAGA 1W2VA 5FS6A 2H90A 3M43A 3BW2A 2XFFA 3CHCA 4ICMA 4PR4A 4D6FA 1FEBA 1TV2A 1IT8A 2DSUA 3VABA 3CUJA 5GVJA 2G3MA 1BXNA 3ARPA 5C55A 3DK8A 3K2GA 3QW4B 3SN1A 1DYSA 2P5NA 5GJPA 2GSHA 1GVSA 2YDAA 4FIRA 5T8GA 4FXSA 3BAIA 1LL4A 4LV4A 4HMDA 5E0CA 1XQLA 4E0CA 3WD0A 1G5AA 2I5QA 4CCEA 3EOUA 2EKCA 2PDCA 1TIWA 1I0BA 3PTMA 4XKMA 3N29A 1FCBA 5BZAA 4AH7A 1PVNA 1U5HA 1O1HA 1FXPA 1V3MA 3DH7A 2DQWA 4H4QA 1LROA 1K8YA 4XSLA 5K7JA 3SO7A 3QHNA 4A35A 2EJ1A 4LIIA 5HXMA 2CLIA 2WCSA 2GQAA 3POCA 2D0FA 3NJ3A 3N2CA 2Y2WA 3CAKA 4IIEA 3L5MA 1OX6A 2WBKA 4XIAA 3UNTA 1ECEA 4P8VA 1OX4A 4D2JA 1Z48A 3K46A 4KH2A 3BLOA 4XD5A 3MV01 2E40A 1QJWA 3COTA 3NL3A 1UQZA 1WDPA 4XKYB 3HQ1A 4KPRA 1OHLA 3AN1A 3ABXA 2BOGX 1VFTA 3ZLFA 3HJZA 4FR6A 3TSMA 5BW6A 3QQ0A 4M51A 4R27A 3BLLA 4H7VA 3DG3A 3NEHA 3KRUA 4JTDA 4GX8A 1CWYA 1H61A 3GTXA 1W1ZA 2O0TA 1GEUA 2XSAA 3IUIA 3RG6A 5T26A 3BANA 1XPYA 3QF0A 1HQTA 3RCMA 3ITOA 3W73A 3TC3A 3HGSA 3M0XA 3UWQA 5CAKA 1OC6A 2WANA 4J3TA 4IISA 4JYEA 3CXOA 3TCEA 1KBLA 4I7VA 4NJHA 1B57A 4URIA 3SM0A 5HBFA 3IGSA 1HFBA 1NF0A 3KS6A 5G5HB 3SQLA 3T4CA 4GWEA 5A8GA 4GBDA 1BSLA 2PTWA 2E1WA 3F2BA 2HQMA 1AD1A 2X8RA 4MZ1A 3KVJA 3EWDA 1WZLA 1F73A 4N9CA 1FVPA 3BAJA 3QLDA 1DJIA 2WC4A 3LV6A 3H23A 1KFCA 3TN3A 3HBLA 4EF8A 4G7EA 3JU2A 3CGDA 3DI0A 4ZR8A 1OEPA 4INFA 5DEZA 1NTHA 3ZR5A 4ZQRA 1CGUA 4CCDA 1WZAA 2G4JA 5FEPA 2I57A 1MFUA 5D9NA 1JRPA 3C2RA 3RU6A 4UFLA 4PUEA 1V4YA 1XIGA 3DFOA 1VS1A 3UYIA 4NEWA 1RJRA 1OZQA 3HJEA 4K38A 4XAPA 5BXTA 1JD7A 4KWSA 1B3WA 5GNXA 2PLCA 4HNUA 3RLGA 4C6NA 5C70A 1PYFA 1HKJA 4AC7C 4MMWA 3BGGA 3UR2A 2X2GA 4IH3A 1U1UA 2Y5JA 3WNPA 3S5SA 2PBGA 2BWGA 5EPDA 4XG1A 2OZ0A 1FX6A 2GJXB 3LMYA 3URAA 4UR7A 3D5HA 3WO8A 1A0CA 3N2BA 4UOJA 3P6LA 3MCNA 3CGEA 3SN4A 3TTSA 3FKRA 4L9XA 1RZMA 2ZUSA 1R3TA 2QDHA 2J9XA 3GHUA 2NXHA 4OWGA 1E55A 3XIMA 5EY5A 4OUIA 1KM6A 3LD5A 4L4LA 1CXEA 1YBQA 5C9RA 2XZ7A 2OLSA 3VDHA 2O7SA 1PX8A 5H1WA 2DUAA 3BCDA 4ACZA 2C0HA 2PDNA 1X7IA 3O9NA 1O6IA 2WMJA 4GE8A 4UNKA 1IXOA 2DEPA 3AMGA 3CO8A 4XZNX 1LG2A 3AU2A 3TA9A 1BF2A 3D0CA 3MTWA 3BW3A 5E1QA 2HVNA 4ZGYA 4XK2A 1H7NA 1Q63A 2DVUA 1WAUA 1DKWA 2YVJA 4JTLA 2VRQA 1TPB1 3O6DA 4K3ZA 1HNYA 4LSBA 1ZCCA 1Q6GA 4NJJA 4JDRA 1UC4A 3EWCA 1Q1WA 3PTKA 3ORWA 1C93A 3ZXWA 2IKGA 2PLJA 3UQNA 4JL2A 4HJWA 3D46A 4KMQA 3SW6A 4QX4A 1J4EA 2YBTA 3C0SA 3ZWTA 1JXKA 3HFTA 3VA8A 3AS2A 2OEMA 3A4XA 4KWVA 1H51A 3AU6A 1MEWA 4XZ9A 1SZGA 2YCKX 3DBNA 3DHUA 3WBWA 2F6KA 3HFYA 1AG1O 1AK5A 3IJ9A 3LMZA 2V5BA 4PBEA 5LIYX 3ATZA 2ZVIA 3VGHA 8CGTA 1JYXA 4AF0A 2FHBA 4K68A 3KBMA 4WSKA 3S1UA 2QZRA 4WF7A 3GUWA 3QZAA 4WY0F 2NWSA 4ZZ9A 3THUA 2QQ6A 5CC6A 2A3LA 4N7QA 2DVTA 1Q6DA 4MYAA 2ALRA 5HR7A 2J13A 3VM5A 2DFAA 3ARUA 4ONVA 3AISA 2GFTA 4LQ1A 3LU2A 1B3XA 5I3IA 4LCSA 2ZX9A 3CS2A 3CM4A 4UTTC 4ZOCA 3G3MA 3T1GA 3U2EA 4Z1DA 3V1PA 3RUBL 2VI0A 4L65A 3W26A 3DZ1A 1XH1A 1J5TA 3AHYA 4ACYA 3PZIA 4GVIA 2YKKA 3BCFA 4S3GA 4KERA 1HL8A 3OB8A 1EJWC 2FKPA 4F48A 1VQZA 5EFFA 3THCA 1KRAC 1SFLA 4AXNA 1ZX9A 2VFIA 3LCHA 2KZHA 3ETRB 4FNPA 3WQEA 4AIBA 4QM1A 1OINA 1CTNA 2YB4A 2Y5SA 4AHQA 2J8TA 3BGAA 3PWGA 1I8JA 4IPNB 1IZCA 3LI0A 4JNYA 4MY9A 5FSEC 4WKFA 4WY0A 3IAPA 1G4PA 2GGHA 2ZZ5A 4OBRA 4GZEA 4KWUA 1Q5MA 1AMYA 2YR1A 3TWAA 1KV8A 1J93A 2CBIA 3N19B 3GS6A 2WBAA 1XC6A 1N61C 1UUMA 1VHNA 2OG9A 1UB3A 1X8CA 3H2CA 3C3UA 3N6JA 3BLPX 3PUOA 2XSXA 1JUEA 4F0SA 2PTDA 3UPBA 3VNJA 1JPKA 4H3DA 4Z0SA 4ADUA 4JTQA 3BOFA 5ABFB 2EQDA 1BHGA 8A3HA 3E74A 2X05A 2XPKA 1LYXA 1GEQA 3MJMA 1UA3A 4TXEA 4W4QA 3ARQA 1H41A 3FJ4A 2Z6JA 1HVXA 4G2DA 1CGXA 4C1LA 4J57A 2VC7A 3WFAA 2V9DA 1WV2A 4AZHA 4FPSA 3AMDA 3WL0A 4N4PA 3V5CA 5CGTA 4J35A 5D05A 3KE0A 1TTIA 1HJVA 3CUHA 3BW4A 5FF2A 3IVSA 2DZXA 1F8IA 3CYVA 3A5FA 2OTDA 1QPQA 3P14A 1OBAA 1IZJA 1UZHA 1WZMA 3MHFA 3WLJA 3FDGA 4Q8TA 3PM6A 5FJOA 4OHQA 1W1B1 4U33A 3QSTA 1KRCC 5E0KA 1F6YA 1S1RA 1UHVA 2RDXA 4UFMA 2BVTA 1GREA 2WK2A 4C6MA 3E2SA 3FAXA 3INPA 1WXYA 4UC5A 2YGYA 1CDGA 4MVAA 2Z7GA 2GPTA 3BJFA 4QE1A 1J5SA 4V28A 2EPOA 4S3FA 4JKMA 3TTOA 5LNSA 3OLEA 4Q8VA 4RKAA 5GRTA 2Z00A 5FAJA 4GISA 2QF8A 2CLKA 3HN3A 3ZR4A 8RUCA 1WXZA 2WHMA 4EX4A 4CU8A 4B3ZA 4JTSA 5HAOA 1EA0A 2CZEA 1GESA 4LA1A 1QPKA 3TOYA 1OF6A 1TKKA 2XYLA 4M19A 2J7BA 3I68A 1GSNA 4ATDA 4HK5A 4XUGA 3H53A 1VPYA 3ZO9A 1NFBA 5KEZA 3PG8A 1E6RA 2FH8A 3V75A 2EG8A 2ABBA 1R87A 4AG0A 2PDIA 4TMBA 3LS9A 5ABHA 2WCAA 1K4GA 3M0ZA 3EF6A 3LENA 4IG2B 1L6GA 1JOAA 1JCJA 4HK7A 5E6ZA 3S5ZA 2PURA 3EMZA 1FWDC 4LUTB 1D7FA 4NJKA 1AJ2A 4O1BA 4O8RA 1H0GA 1K9TA 3APYA 2VFEA 2ZXBA 4BHYA 3B8VA 3W7NA 3F4NA 5D33A 1XIEA 4BWLA 4UTKA 2GQ9A 2GUBA 2HRWA 4XTDA 1HTIA 3TW7A 2VEFA 1WDSA 4KT2A 3Q67A 2PODA 2BC0A 2CZFA 3KOZA 2IPGA 4W85A 5C71A 3N1AA 1A5OC 4M81A 3L4VA 3WEZA 3EZ4A 3F7JA 3VI2A 4HCDA 2XH7A 4L1GA 4AW7A 3WDIA 2V81A 4ADTA 2GSEA 4LEFA 1XIMA 3QXBA 4MY8A 1SFJA 3MVTA 1X6NA 2HXTA 3TFCA 1DHKA 1CXFA 4JKKA 2POTA 8XIAA 4AU0A 2A7RA 3FOKA 2VEPA 4AFYA 1EEPA 1UR4A 4NYYA 3R8GA 2WJZA 2J78A 3PNZA 5DT5A 3S2JA 3TDFA 1DJXA 1TTPA 4NT0A 1XQKA 1V6VA 2HPIA 5C5YA 3QY8A 2EPNA 4ZXOA 2YL6A 3AMKA 2D0GA 1Z3NA 4DAIA 1F61A 2A6LA 1UUOA 4FAMA 2VEMA 4EAYA 4GGBA 1KN0A 1GOKA 3FA5A 1F8MA 1L0PA 5EMJA 1P1MA 3KBSA 9XIAA 2NZLA 3NRZB 2OCZA 1H4PA 1GQKA 1BWVA 4IFRA 3SRHA 3AFBA 3W07A 1X7FA 4GNVA 5C2CA 2Y4SA 4GXWA 5HINA 4REQA 3ARSA 4JIEA 3PUGA 2FQIA 2V6AA 1E1CA 1W8GA 2JFEX 3PK7A 4H4IA 2GR1A 3UP8A 4JYFA 1K03A 3M64A 1TZ9A 3ZMRA 1S39A 4ADSA 3KDOA 3TX9A 2GK1B 2WM1A 4C6LA 2QEZA 2YXOA 4M6PA 4CKQA 3QOMA 4BKNA 1XC4A 1JZ4A 2BLEA 3AI0A 3PNUA 4GJ1A 3N17A 5CPMA 5ABEA 4HNVA 3N14A 1B54A 3G0XA 1UWRA 3WUFA 1F05A 3PJWA 5CZ0A 1GOQA 2PDBA 3KX6A 1R46A 4BA0A 2QCDA 1UIPA 2E6DA 3OA3A 1ONRA 2G0WA 1PIGA 2XIMA 3TNBA 3CV6A 7ENLA 2ZX8A 1JCYA 2PBOA 4JAWA 4BCEA 3LK6A 4PEKA 2W91A 1TMLA 1ISZA 4FOJA 1E0WA 1A5NC 1R3QA 3L5OA 5CQ1A 3VD5A 4IX0A 3BVJA 1AMKA 4U28A 3W82A 1IWBA 1PKMA 2JALA 4H8VA 3PC0A 4GIEA 1DWAM 3W7LA 2HCVA 3GD3A 2Q6ZA 5FL1A 4G1KA 1XDMA 1P7TB 2VEIA 5LNWA 4UOQA 3ANUA 3W81A 4S39A 4WIWA 1Q6QA 3TZFA 2GOUA 1C9DA 3EA2A 1RCOB 3HOJA 2V2DA 3HA1A 2J24A 1HN1A 1RA5A 2B7PA 2YL8A 3BWWA 4HYVA 3MI3A 2JK6A 2NW0A 3DXIA 2D2GA 3KCOA 2J7HA 1TPC1 1EL3A 2C91A 4B5WA 2CW6A 1XGZA 2Y8KA 2PGEA 3LCIA 3E12A 3W1MA 3VZZA 1DEDA 2GYIA 1BD0A 4GQRA 3W6LA 2YCJA 4BY3A 5I3JA 1X8FA 1ZJBA 3OEXA 3VX1A 3MBDA 3NVVB 3CASA 2J7FA 1QNRA 4UR8A 3WQVA 1HW6A 4NIRA 1IE7C 1UOZA 2DUXA 2OX1A 4PL1A 1MOKA 1KNWA 4RDWA 4UMAA 3CMJA 3MUAA 4U2YA 1GYLA 3LSBA 4JNMA 4Q4SA 3TFXA 3C0LA 2WKGA 1Z42A 2TYSA 1JYVA 2VELA 5LYRA 4DPQA 1YTKA 2I17A 5DY3A 2FGZA 3OBAA 4F66A 3LHWA 4A3YA 1KB3A 2DZAA 4UTWA 1XCXA 1Y65A 1DIKA 2VYOA 2V82A 4NZFA 1SZNA 1H7RA 3TAKA 5CJMA 1Q2RA 1RD5A 4LBSA 3URNA 4AZCA 1VC4A 4Q8NA 4Z2IA 3HZ3A 3VMPA 1J8VA 4QEEA 1K6AA 3P5YA 1K3UA 3KOXA 2BG5A 3MCOA 4LAMA 4EVZA 1IIHA 1GZJA 1SZFA 3HIJA 1P6CA 3OU8A 1A80A 5T91A 2QXWA 3TYUA 2R94A 4LRTA 2NSOA 2W92A 4QITA 2FGLA 4DYKA 1ZALA 3BO9A 4EPEC 2OLHA 1JFXA 4KF1A 1A49A 2TMDA 2Y85A 3UPMA 1I2QA 1L6SA 4L4OA 3N3TA 1SFTA 2BMBA 2LLEA 1ONWA 1DBTA 4H8NA 1ZS2A 3VFLA 3LNPA 4JBRA 3ISIX 5DMYA 1JPIA 3BGJA 1TO3A 1F8WA 1K9FA 3LTSA 1BVZA 4LALA 2V8ZA 4L9YA 1VBHA 2ZVRA 2UY4A 2X1IA 2WQDA 4QS5A 1HO4A 2YCLA 5L6UA 4NAFA 4QCEA 1EPXA 2A85A 2YA1A 1VYRA 3CMFA 3M4HA 3AWOA 3W1NA 1AH3A 5I06A 3A9IA 3O05A 3AOFA 3AZTA 4UTHA 3URQA 2WPFA 3OZOA 4O1CA 1A5SA 3VPLA 1W32A 3CV2A 2Y63A 2C16A 4LEQA 4W87A 2RUSA 1T8XA 4LUSB 1FDYA 4CD5A 4X2PA 3TXVA 5EMKA 3O1NA 4TQTA 4XAGA 2PZNA 2VR5A 3ZR6A 3T0BA 1XBZA 4FXFA 5K2ZA 1N5XA 1ZFJA 3O06A 1GJWA 4UTFA 1HZYA 1OK6A 1IIGA 3NM3A 4FX6M 3SIZA 1AOGA 3F5LA 1RQBA 3EWUA 4NZJA 4Z08A 4KW2A 4C7DA 4B3KA 1POJA 1JDDA 3C3NA 3PF3A 4OU1A 4NI3A 2DUZA 4AD4A 2VNCA 1W5QA 3R7MA 6TIMA 2E9MA 3WNOA 4GIRA 2HQAA 1GOMA 3B8TA 5TR3A 4HZ7A 3O2LA 6CGTA 4P2VA 1BQCA 2DSVA 4OVXA 1CBGA 1UP2A 1ZBWA 2I14A 3W7HA 1KTNA 1UP0A 4H4XA 4PSRA 2JEQA 4BQ4A 2VXNA 3GHSA 3FSUA 1OCQA 5IDZA 1ESWA 1I1WA 4GCXA 5TF0A 2ISSA 2D3NA 3WJWA 1B4KA 3SQPA 4FNQA 2NUWA 2DPEA 4GO8A 2PGFA 3H70A 1HO1A 3BQ6A 2YBUA 3T40A 2J88A 4XV0A 3W88A 1V03A 3M0IA 1Y8BA 4A2RA 1AW2A 3IJDA 2YLLA 2DDXA 2AAAA 4WK9A 2ADAA 2VZOA 3W83A 1NH6A 4DJFC 2QR6A 1PS9A 4AVOA 1GCYA 5H8UA 4CD4A 5D9PA 4P8XA 4P7QA 3KLLA 3PG6A 3VGDA 4DM2A 4GYPC 4D72A 4DO5A 4H41A 1N2VA 2NQ9A 5CPQA 3BAYA 4GLEA 1JDFA 1VLWA 4X3ZA 1H62A 3NQBA 1ISVA 3UA4A 3QZ6A 5AHLA 1OYAA 1QK2A 1BTCA 3QQWA 1TWSA 3AZRA 4C6OA 1QHZA 2C0AA 3M5XA 4RZ5A 1XHCA 3BCJA 3H6OA 3L2LA 3CBWA