4KWSA

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
403
structure length
397
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVAYEPADSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords D-mannonate dehydratase
publication title Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with Mg and glycerol
rcsb
source organism Chromohalobacter salexigens
total genus 150
structure length 397
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4kwsA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4kwsA01
3UCDA 4E8GA 4H83A 2PU1A 4M0XA 1EC8A 4HNCA 3DIPA 3DG3A 1PDZA 2PSNA 2PPGA 3V5FA 3I6EA 3DG7A 2PP3A 1TE6A 1NU5A 4FP1A 1FHUA 3H12A 2ONEA 3P0WA 2OQHA 2DW7A 1EBGA 3OZYA 1EC7A 2P8CA 3D46A 1ELSA 4A6GA 4G8TA 3ES8A 1W6TA 3T6CA 3RR1A 3HPFA 2QJJA 3QLDA 3V4BA 3SBFA 3CXOA 4GGHA 4YWSA 4ZA0A 2OZTA 3QN3A 3FXGA 4GISA 3VC5A 2FKPA 3IJIA 2OVLA 3GO2A 3P3BA 3EEZA 3RGTA 3TWAA 4E4FA 3OP2A 3TWBA 3H7VA 3VCNA 2HNEA 2GGHA 5EU9A 3STPA 3TJ4A 2PGEA 3BJSA 4E5TA 1ONEA 2DW6A 3UCCA 4GYPC 4A3RA 1KCZA 5ENLA 2CHRA 2P88A 3T4WA 4J3ZA 1KKOA 2PGWA 3R11A 4E6MA 1OEPA 2QDDA 2ZADA 3D47A 3TCSA 3UJ2A 4GMEA 2PS2A 3I4KA 4MGGA 3R25A 3GD6A 3DESA 4IL2A 3U9IA 4IP4A 3H70A 3OW1A 4GYPA 3T9PA 3UXKA 1BKHA 4MKSA 3PK7A 3VCCA 1WUEA 3UJEA 2GGGA 4HN8A 4JN7A 4K1WA 3TOYA 3SN0A 3GC2A 1MRAA 4IT1A 4KPLA 4A35A 4DXKA 2PU0A 4JHMA 2OZ8A 4F4RA 4IL0A 3ZVHA 3DGBA 3TQPA 3ZVIA 1EC9A 3SN1A 3SQSA 2QJNA 1SJAA 1NELA 3MZNA 3OTRA 3PWIA 2OG9A 4GGBA 1DTNA 5FJUA 3TW9A 3FJ4A 2AKZA 3UJFA 3Q45A 2HXUA 4HCDA 4KEMA 3DFHA 4HYRA 2PTWA 2NQLA 2XH7A 2AL2A 1MNSA 3QKEA 2OKTA 3UJRA 1XS2A 2POZA 3CT2A 3RCYA 3UGVA 2P0IA 7ENLA 3FVDA 4DX3A 1PDYA 3OPSA 4K2SA 4IZGA 1SJCA 3I6TA 3DEQA 2AL1A 4HNLA 4HPNA 1EBHA 1MDLA 4KWSA 4H2HA 3R10A 3S5SA 5BOFA 3CB3A 3RO6A 2OO6A 3NFUA 3QPEA 1L8PA 3SN4A 3JZUA 3DFYA 2XSXA 3ENLA 3K1GA 4DN1A 2QGYA 2GGIA 2OPJA 4ZCWA 2QJMA 1MUCA 3N6HA 3KUMA 3IK4A 4JN8A 1TKKA 3VA8A 2GSHA 3ES7A 5FJRA 2PMQA 3EKGA 3JVAA 3CK5A 4GFIA 3CYJA 4M6UA 3RRAA 3RITA 2O56A 2OLAA 2PP1A 2QQ6A 3S47A 1JPMA 4H19A 2PCEA 3H8AA 2XH2A 4MMWA 3VC6A 4J1OA 3SSZA 3N6JA 2P8BA 4K8GA 1FHVA 2GGEA 3Q4DA 4E4UA 4DHGA 2MUCA 3ZLFA 1TZZA 1YEYA 3MKCA 2RDXA 3ZVHB 4FI4A 2FYMA 3ZLHA 3ZLGA 3JW7A 3MWCA 2PA6A 2HZGA 4IHCA 3DG6A 3VDGA 2PTXA 5J04A 2QDEA 1R0MA 4DWDA 2OQYA 5BOEA 2ZC8A 3T8QA 3N4EA 4HCLA 1WUFA 3TTEA 3V5CA 2XH4A 3CAWA 1KD0A 1RVKA 3IJQA 1SJBA 5FJTA 2QVHA 3PWGA 3SJNA 2MNRA 2AL2B 3FCPA 3DDMA 4HCHA 1JPDX 2PTZA 2GGJA 6ENLA 3U4FA 3THUA 3TJIA 2OFJA 3MUCA 3N4FA 1MDRA 3R0KA 2PTYA 1XPYA 2I5QA 2XH0A 4Z1YA 3P93A 1SJDA 5IDZA 4GIRA 3FYYA 2AKMA 5FJPA 2OX4A 4ROPA 4IP5A 1P48A 4H1ZA 4Z17A 3DERA 3BOXA 1ECQA 3GY1A 3UXLA 1E9IA 3FV9A 1F9CA 3MQTA 3IJLA 3PFRA 4EWJA 3NZGA 1P43A 1BQGA 2OZ3A 2HXTA 3R0UA 4G7FA 4DYEA 3UJSA 3NO1A 2GDQA 1JDFA 3BSMA 2PODA 2GL5A 1KKRA 2P3ZA 2XGZA 3B97A 4KT2A 1R6WA 2PP0A 3MSYA 5FJOA 3V3WA 4ENLA 3NXLA 4X2PA 3OZMA 3MY9A 3VFCA 3QTPA 3R1ZA 1IYXA 1JCTA
chains in the Genus database with same CATH superfamily
1XRTA 2GSJA 1RY8A 1CWYA 1EZWA 1H2IA 3N9RA 2I9UA 5AVHA 1IIHA 1QNVA 1V6TA 4DJDC 4YHEA 3ZXWA 2DV0A 2EPLX 2A79A 2GQ9A 4WY0B 2Z2BA 1TE6A 3H12A 3WO8A 2W79A 5CZJA 2A85A 3HFYA 3LOTA 1F4HA 2EPKX 3RLVA 2B4GA 4C6LA 3BG3A 1A53A 3M5XA 3T8LA 4M7SA 4YWOA 3TYAA 4AZIA 3RR1A 4DJFA 4F0KA 3S2CA 2BGNE 1K7EA 1GV4A 2ISVA 3NDZA 4BJHA 4LA1A 4BWLC 1N5WC 3CUIA 3L68A 3BV7A 4FIRA 2VD9A 4LUYA 3G0UA 3K4DA 2WMKA 1FWDC 2HNHA 4G9PA 5HWMA 1N62C 3AALA 1K8XA 5IBXC 3S5NA 3BAYA 3O8AA 2EPMX 3LQLA 4D6DA 4DI9A 1E1CA 2P3EA 3TYZA 4Z08A 1IGWA 1XRVA 3URNA 3LERA 4P8XA 3POCA 1N8IA 5A6AA 3BW3A 5ENLA 3BG9A 1GTHA 5FSEC 1V3JA 1WZLA 5M03A 4YVXA 3BAJA 1PTDA 3CAQA 1FWSA 4HPJA 4PFMA 5AFDA 1Q6OA 4R9XA 3EYPA 1W3LA 1S3HA 3GNDA 1K03A 3IARA 5HPOA 1VYPX 2OYLA 2F5ZA 4IL2A 4NI3A 3W23A 1WDWA 3MI2A 4V15A 3OBAA 4N6FA 3F4WA 1VP5A 5FEPA 4UQAA 3DOPA 2VDIA 2V3GA 4D1JA 4JQ1A 3GTNA 5CC5A 2V9DA 3AO0A 3ETRB 3SI9A 1PTGA 1WOBA 5BW6A 5FL0A 5DX7A 1E56A 3NEHA 3AZTA 3GD4A 1PYFA 3N9KA 1UD6A 2Y7GA 3U6WA 3CL8A 4IISA 1KBJA 4UFMA 4Q4PA 3VDHA 2I5IA 1PIFA 3CMFA 1MXDA 3WLLA 4XO7A 4H4UA 3QEZA 1FKXA 4RW3A 4LH8A 4Y96A 3WLIA 4CQDA 5DN1A 4K8DA 3M07A 3IUIA 2A0NA 2HXUA 3MMDA 4DEFA 1BYCA 5H91A 2HE8A 3TA6A 4HYRA 3LADA 5HDRA 1KBKA 3PJUA 3QKEA 4CNUA 2X16A 1OCJA 3LLXA 2P0IA 1KV8A 3H2FA 5TBOA 2RGLA 2I17A 1C29A 4CVUA 3TFXA 4DX3A 1EX5A 1KFCA 1EDQA 2A3BA 4QNWA 2J8FA 1FWCC 1W54A 1IZKA 3HPSA 3KVKA 4H01A 1W0MA 4WOQA 1SR0A 1O1HA 1D3CA 2FTPA 4EPKA 1V51A 1XLIA 4HHHA 3TN4A 3VOIA 1YXYA 3H4GA 4L1GA 4HU4A 3SDOA 3TTSA 5I07A 3T0AA 3CQ0A 4JNZA 3QM3A 3OA3A 1THFD 4DNMA 4NJJA 3EAOA 1E55A 2C15A 4MWAB 4GC3A 2PDBA 1VFTA 5IHSA 3GRTA 5F2MA 7A3HA 5AHLA 2JK6A 3EKGA 5FAGA 1JR1A 3K8KA 3ERPA 5AHNA 5T26A 3PBYA 4KS0A 3U2CA 5I6SA 3MT1A 4LXFA 4D8ZA 5LKYA 4J3XA 3W02A 3A7RA 2PP1A 4BCEA 1F5ZA 5CXPA 4X9YA 4QE5A 1UBSA 1KCXA 3IANA 3M16A 1Q6DA 3OZOA 1DNCA 3N15A 3W72A 1P4CA 3CB8A 5TQLA 1DXFA 3LI0A 2GGEA 3PSVA 3LV6A 2BVDA 2AQVA 1C3FA 2YW3A 3V75A 4C6QA 3NIYA 4DPQA 4GI9A 4S3KA 3DG6A 4OUEA 1R0MA 4N4QA 3Q65A 2FDMA 3B04A 1GRFA 4FALA 1GVRA 3QV8A 4XD3A 5I03A 1WXJA 4O0KA 3RNDA 4K68A 2PD5A 1SU5A 5D2TA 3QPYA 3CV7A 3EWZA 3IJQA 2VURA 2JALA 2GVLA 1XF0A 2E67A 2D24A 3PZMA 3T2OA 1IEXA 4MYAA 4CQBA 2VZUA 3SR7A 2VC6A 3H6OA 1XUUA 1M04A 4IPNB 2Q3RA 1R9ZA 4EPBC 1UBPC 1UWSA 1LUCA 1S5MA 4AZ7A 2DSWA 3G1AA 3LCLA 5FF4A 1RA0A 1ZUAX 2X50A 2Z1WA 1GW1A 1XKYA 4Z1YA 5I77A 5BROA 1IIGA 1VH7A 2ATSA 4TIMA 1YDNA 2OO0A 1W3TA 2XN0A 2BHZA 6XIMA 2OX4A 3WD3A 3U3HA 1JCJA 4IGMA 1OF6A 5CLTA 1VLWA 3IRDA 3OU8A 4MKVA 1FO4A 7ODCA 2BG5A 4O0ZA 3H26A 4I6VA 4PTXA 1FFRA 4C90A 2V2DA 5DMNA 5TIMA 4QCFA 1LLOA 3KOWA 4XVDA 3EWXA 4AZ6A 2R1KA 5LIYX 4UQDA 2WVTA 1KCLA 4Z1BA 2Q01A 3NXLA 4LYQA 4X2PA 1W3KA 5AZ1A 1YIXA 1UD3A 2GJLA 3S1UA 4N7QA 3GVVA 4P8WA 1UP2A 4D1IA 4PBEA 3K13A 3F5KA 5KZ6A 4UFLA 3LTSA 2WVUA 3N12A 1NDVA 1B9ZA 3FKKA 3BPWA 4Q6JA 2BDQA 1XLHA 4EXBA 3JR2A 3AIEA 1GUVA 3I6EA 3K8LA 3WQ6A 4QDWA 3HURA 3IACA 3GG7A 3UWUA 1X6UA 1MNZA 1NOFA 1JXKA 1LCOA 4QP0A 3EOUA 3SRFA 3RFAA 4JYDA 2ZFAA 3HV9A 3WK3A 2VZSA 4AIOA 2E1WA 4Q8VA 5G2HA 3GM8A 4QLJA 3HPFA 5PTDA 3NYDA 3O0FA 4FR1A 4F0LA 3VIIA 2ALDA 2Y8UA 5GRTA 4ZA0A 2INZA 1JAEA 3MP4A 1RP9A 3Q94A 3N9SA 3ABOA 4JTEA 2HMCA 4IMGA 4KRUA 2JKPA 2OLHA 1NWUA 3HPAA 1EL3A 3K2GA 3UY8A 4LUIA 3QSRA 3PN8A 3VD7A 2RABA 4PN2A 4CN4A 5F7UA 1KFLA 3BW2A 3NQ6A 4GYPC 5LSMA 5I7GA 3S6OA 2PWVA 1QI5A 1BFNA 3WLOA 4Z2IA 5BWFA 3AISA 3WLNA 2EJAA 1T8XA 3W07A 2VENA 1R46A 2H3BA 2XN2A 4DJEA 5KMYA 5EMYA 3CMGA 1ADSA 2ZRXA 2X99A 2DH3A 3A3HA 1KM2A 3JRKA 4Q8WA 4FHAA 2IXVA 2G96A 3H54A 1X8CA 3LXCA 4RE2A 2W9MA 1ZP3A 2GR0A 2VDGA 1ZFJA 2WMFA 5GJNA 1MRAA 2PFHA 4A35A 4KERA 2PU0A 3IS4A 3EB3A 4IL0A 2PDFA 1WKYA 3M46A 4JX5A 3LLDA 5ABHA 5HPCA 1GYMA 3IJ8A 3AYVA 4MNKA 4Q4KA 4PTWA 1RD6A 4DO4A 1G7VA 1I60A 1O66A 2OELA 1BYDA 1FA2A 3FHAA 1FOBA 1Q5MA 1P1MA 1SM9A 1AG1O 2F6KA 3TXVA 3TEVA 1XV8A 4JBRA 1X1NA 4QXIA 1WDQA 2Z25A 5D38A 4ZOCA 3P84A 2D2OA 4A3QA 4AEOA 4BZYA 3CV1A 3A47A 3WQ5A 3ITOA 4XVEA 5FEXA 2ZZ0A 1F3EA 3GDKA 3KBNA 3APYA 3EPNA 4IX0A 1P0DA 3AZRA 3UG3A 4GUJA 3ICJA 1RJQA 5A95A 1LBLA 1EIBA 4NILA 1VDVA 3GB6A 1BF6A 4H2HA 1DJWA 1S3TC 3LK6A 1UA3A 3OB8A 5EMJA 1HJQA 1ZALA 1LWIA 3QR1A 1CX9A 4NVTA 3QPEA 4R27A 3C3NA 1F7BA 3RMJA 3EZ4A 1HO1A 3TSBA 5K4XA 2PEVA 3TNOA 1UG6A 2EJ1A 3LYEA 2WHLA 5DXYA 4CKQA 1CEOA 4ZCWA 2JGYA 4MUPA 3W00A 1EXBA 4AFYA 2V68A 4DWSD 1QI2A 4QEEA 5CBIA 1NH6A 2FH6A 3HPXA 2C1GA 4BQ5A 2WVSA 3MYPA 5EA9A 4S23A 2JF6A 3RITA 5MKGA 2OLAA 3RLGA 1E6ZA 2IQDA 4GO9A 3S47A 3ZQ9A 3LHTA 2A4AA 2PCEA 2XH2A 4B92A 6CGTA 1TYGA 1KRBC 3LGEA 5CC7A 3M0KA 3UR2A 4M6QA 3M0MA 3DX5A 3N6JA 3A3WA 1TV7A 1DBTA 2P8BA 2XU2A 1HJSA 4E4UA 3PAOA 1V3HA 1TZZA 2RDXA 3G3MA 5C71A 1GEUA 1U5JA 1GRBA 3GXFA 2PA6A 2VGFA 3N1AA 1SR9A 2IMRA 2CC0A 1AUSL 4JGDA 1V3KA 3IEBA 1WZKA 3VIKA 1ZZMA 5KZMA 2X0YA 4J7RA 1S39A 3PF3A 3DK9A 1YE6A 3ZR4A 1X1ZA 4O1EA 5M5DA 3BAIA 4I7WA 2ZX9A 1XLMA 3WIJA 1F76A 5GVJA 2WZIA 2X2YA 1EDTA 2WMIB 1JI2A 3O0HA 3FDGA 5J5RA 3SGGA 3BV4A 2GGJA 4GY7A 3F7JA 3NZ1A 1B2YA 5EL1A 3AN1A 2F8QA 3IK2A 1S2AA 2CLEA 3V18A 2ZE0A 1DWHM 1DV7A 2OT1A 3MUCA 2ZZCA 4GPNA 4E38A 8RUCA 3QQWA 1KNWA 1PVNA 2YPIA 1E6QM 3W88A 2DY3A 1PKYA 1QU4A 3VGDA 1R2TA 3VIMA 1A5NC 3WNOA 4FO4A 3BCFA 3MUIA 1P0BA 4EQXA 4KFPA 2RFGA 1LRNA 4GHRA 2EAWA 5FJPA 5CZSA 4Z2KA 4M56A 4A3HA 1V0LA 4YVVA 4KWOA 3VKDA 4JTCA 3S2JA 4XKYB 4B91A 1RP8A 3ANYA 7REQA 2XWEA 1EJUC 1O60A 2J25A 4R85A 3IJLA 4NNCA 4IM4A 3BDKA 3M43A 3KTCA 3ALFA 1DIOA 3A12A 3VGEA 2FHBA 2YXXA 3R89A 3R0UA 1ISWA 2PTDA 1FDZA 4WJEA 5CCZA 3W7HA 4TVCA 3MDUA 5AZ0A 2BXVA 1K7FA 5JIWA 2VQUA 4B5WA 1G4SA 4FLQA 1ZAJA 4XSLA 3OHIA 3WQCA 3CHEA 4FXSA 3TN3A 2XM1A 1VLIA 1KXHA 1E3XA 3AHTA 5JCMA 2FPYA 1FXQA 3TFCA 3DFTA 1FWGC 1NEYA 4Q8PA 1LL6A 4JY8A 3A5VA 2FZNA 4H9YA 4HNCA 5AC7A 1DORA 2SFPA 4DO5A 5JCLA 4OE7A 3LUTA 4J56A 4C6BA 4ZO6A 1M6IA 3NQDA 4D8AA 1XLEA 4UCGA 4GCXA 2XUCA 5FI8A 5T9CE 2X1UA 3QJAA 2Y89A 2PDCA 3V7PA 5A2CA 3D46A 1W1A1 1GGOA 3EPOA 2GR2A 3EX4A 2Q02A 4TVYA 5FSDC 3G1RA 2R9ZA 3UR5A 1XHCA 3UZJA 1HJVA 3GE7A 2C3DA 2D2GA 2OZTA 1BG9A 1WOAA 3WUBA 1Q6QA 2FKPA 3OJGA 3L4UA 2RKXA 2J6VA 3MUZ1 4LV9A 1HL8A 4AH7A 1VFHA 1HKMA 3BQ6A 3STPA 3TJ4A 1CW2A 2OYKA 5DY2A 2Z27A 3UD6A 1M7XA 9CGTA 5MF5A 1AQFA 1OGGA 1ZSXA 3G1SA 2NPXA 3GC5A 3KOZA 1F3XA 5LXEA 4C6IA 1K6AA 3TJLA 2G3JA 4MWAA 2VKZG 1TWIA 3T4WA 1VF8A 2WHMA 4REQB 1UH3A 5GJMA 1Y0EA 4LC6A 2GZXA 5A6JA 3IVUA 1IXOA 4RPPA 5RUBA 1MXSA 3ITVA 3H4WA 1ISZA 4MWAE 4Q4QA 4PUEA 4QSFA 3O7UA 3AM9A 3BMWA 4HA3A 3LCHA 1BRLB 4W89A 4PMXA 4JN7A 2VELA 4DXVA 3TOYA 4EPEC 2WWDA 4LSBA 5BMXA 4AWTA 4O1CA 4KPLA 2AAQA 2WJDA 3FAWA 4PUMA 4TR9A 5DEZA 1IT7A 4O53A 3SRDA 3WJWA 4H4YA 3UG8A 1EJRC 3VMPA 3HPZA 1PO9A 3N2OA 5C9RA 4HOZA 5C6MA 1AMKA 4EVZA 1FWBC 2DSKA 3M4HA 1RUSA 1EX1A 1DJYA 3KHDA 5B7ZA 4AYGA 4N2YA 4L80A 3AC0A 2DT2A 4L6HA 3O63A 4IIDA 4RDWA 3MW7A 1MQQA 1POJA 5KINA 3TDFA 4WZHA 2NUXA 2JIEA 2HS6A 2YVGA 2C3CA 4XSMA 1UR9A 4ICCX 4NX5A 4ZEPA 1T7LA 4H6KA 2XFFA 3PBMA 3QZAA 2E28A 2E4TA 3T42A 3MPGA 4K2SA 1YPIA 3EOEA 3MHFA 2ZUTA 3VKJA 4HZ7A 3DEQA 4UTKA 3AUJA 3VM7A 4UR7A 1V5XA 3OHMB 5GPRA 5E09A 1QMLA 3EWCA 1OF8A 4TU1A 4AIUA 3KDNA 4W9TA 3GZAA 1SZFA 1Z7AA 4GK8A 4J28A 5DCEA 3FHQA 2EQ8A 4OJYA 3SCUA 3WH6A 3TLLA 3LPGA 2X30A 5DT7A 1QAPA 2NW0A 1SW7A 4HK7A 3G1VA 3SCOA 2JGQA 2W91A 2VFGA 2DZBA 2VFDA 2YJQA 4PB4A 2INEA 2Q71A 3T78A 2J77A 1J0YA 4HZ8A 3EX2A 1ML1A 4GQQA 2GUBA 3EDDA 3RRAA 4LBSA 1H7PA 2H6RA 1QWKA 3PPCA 1MZHA 4IPJA 1WYIA 5AC4A 3G1DA 4RV8A 2E5AA 5HK4A 3PTMA 4XZHA 5JUVA 4O52A 2Z0IA 3VKBA 3LSBA 4DHGA 1K4GA 3HA1A 1ZLPA 1YEYA 5BU6A 2F2HA 5G5IA 1VBGA 3ZLGA 2IKJA 4TVDA 2HZGA 1UD2A 5HJLA 1WO2A 2I14A 1Q6CA 2NXHA 1FWJC 3T8QA 3W7MA 1MW3A 2JE8A 4RCXA 2PDIA 4ZQRA 3FK4A 2E7FA 2OEKA 4QHRA 4JQ9A 1K9TA 4I5RA 1RVKA 1SJBA 2WZTA 2V5LA 3A4JA 2E6AA 4DUOA 2QVHA 4H41A 2YXGA 3Q37A 1BD0A 3I10A 5A8NA 3K46A 2EF9A 1TELA 3M5YA 3UVIA 4O12A 1RPXA 3BWWA 2ZDRA 2ZRZA 4BF5A 2HBXA 5A69A 3BAXA 3P8IA 1ZJHA 4M5PA 4V33A 3C2OA 2ZX5A 4V27A 4AF0B 3F5JA 3NCOA 1I9CB 1FECA 1W1YA 3GG8A 3D0CA 3D5HA 3W84A 1TVNA 1F3PA 2NVAA 1E51A 2J7GA 2E5DA 3CQKA 2A1YA 1KFKA 3GY1A 2QCGA 4RL3A 4U3CA 1ZBCA 3K4AA 5FL1A 2VRKA 1M65A 3EBVA 4EXQA 2A6LA 1IGSA 3MMWA 3CBWA 4QDPA 4KCVA 3V16A 1ZAIA 1P43A 1UR2A 3PBVA 1KR0A 3CH0A 4DAFA 3U2EA 1FWRA 1TUFA 3ZWTA 4C6MA 3UJSA 3P14A 3L5LA 4QG9A 4HA0A 2O0TA 1QNQA 2GL5A 2VWSA 4JAWA 3U5YA 2ISFA 2O92A 3NQBA 2PP0A 4PUJA 1H7RA 2YZRA 1T6MA 3HGOA 1SGJA 3CO4A 3NQEA 1I1XA 3QW3A 4W4QA 3UZ5A 1OCQA 1LWJA 4XAYA 4DBSA 2JEQA 3VIGA 1FHLA 5A6MA 3CUZA 2FVMA 3VU2A 3G2GA 2R9RA 4Q4MA 1V59A 3MS8A 4I9MA 2WNNA 2XYLA 1FHUA 3W83A 2CZ5A 2Z26A 2VEPA 3P0WA 2CLFA 2PDHA 3C3UA 2OSWA 3SADA 5FJJA 3UNTA 1FCUA 3OODA 2YXOA 2X2GA 5XIMA 2VDHA 3W1QA 3EOLA 1EC7A 3PUGA 1VYRA 2EXOA 3RJYA 2F7FA 2QPSA 3C86A 1A5KC 2CKRA 4M24A 5A2BA 1W1ZA 1JZ6A 2UV8G 3M0ZA 1K8ZA 2A21A 1S2UA 1TTPA 4GGHA 2PWFA 4XB3A 1X7IA 2DQWA 2VZTA 3QN3A 1BXNA 2OVLA 2AGKA 3OBKA 1A5LC 1HKKA 1E9LA 3IGSA 1ZBVA 1V6XA 3PG6A 2A5HA 3TWAA 4E4FA 1G94A 5IOBA 3NDYA 1M7JA 4PMUA 2J6XA 3WUEA 1OD0A 4OZOA 3LCIA 1QT1A 1EBDA 1PEZA 4XIMA 1VJZA 2DW6A 4GQGA 1EQCA 1GCYA 4ADTA 2BWGA 4O1FA 5E93A 1OFRA 2YCIX 1E6XM 1KTCA 3VX0A 2Q8XA 4KEZA 2V69A 1PKMA 1V08A 2WC4A 2QDDA 1XBVA 4PZVA 1XH2A 2R1PA 5EGRA 1OJTA 1M53A 5LZLA 3MANA 3STCA 3CWHA 3SUUA 1E6PA 1OM0A 4BV6A 1QPNA 2E77A 2BX7A 3GXMA 1UUQA 2DVUA 4R7WA 1KRCC 4HYVA 3WF3A 4IX2A 1Y7VA 2AAAA 4P8UA 4WSJA 4K1GA 1EUAA 2A6NA 5ER0A 2NXIA 3WNKA 4IT1A 3CPGA 4JIPA 3NQ2A 3GDBA 2IUZA 1K8YA 5HWJA 2O9RA 2GLKA 1C9WA 2Q09A 2Y5EA 3IIPA 3L9CA 4GE8A 3IUHA 2PRLA 3PWIA 3BGAA 2BY0A 3TW9A 4LU0A 3GS6A 4QJ3B 3A5FA 4JICA 2ZICA 3L4ZA 2WMIA 1GK8A 4WXYA 1ZJIA 2E6DA 1X6LA 2NQLA 1XIGA 4NHVA 1OBAA 1LRQA 1PX8A 4EX4A 2WJEA 1FBAA 1IHIA 3BAKA 5FF2A 1ITXA 1T99A 1H0GA 4Q3MA 5A94A 2VCBA 2Y70A 4TOQA 1QHOA 4LNCA 1SJCA 1YKWA 2REQB 3AFBA 3I6TA 3VCRA 1Y65A 3W85A 4JX4A 3VABA 3KZPA 1V3MA 1U83A 2R1NA 3S5SA 3ARRA 3WLJA 1GXFA 3KE0A 4UTTA 2OO6A 5A2AA 1NDZA 1EEXA 5A3HA 3WNPA 1OIMA 3H2NA 4XKYA 2J62A 3UPBA 1QNPA 3H55A 6ALDA 2NX1A 3G5EA 4HBKA 1PYMA 4ZB2A 2WSRA 2BVYA 1IWBA 3DJGX 5LA2A 2BC1A 1GSNA 1TKKA 3LCGA 4B4HA 1NAL1 4QROA 1JL8A 2GJRA 3LA4A 1FHDA 3WQ8A 1DXLA 4E8DA 3CQHA 4JDBA 1UPMB 4ZMGA 3DFQA 2W92A 5AYZA 1TJPA 5AYIA 2YL9A 2H3DA 1RBLA 4FLRA 3S42A 5I5RA 2VP8A 3CTTA 2NZLA 1EA9C 1J0KA 4OHQA 2WOQA 4ZVJA 1J6OA 4AVOA 1OX4B 3BZGA 4KMQA 3W70A 1OGBA 3JW7A 2XN1A 4RKAA 1WAUA 2X8RA 1D7KA 3HJEA 4NYUA 5REQB 1N63C 2WLYA 3WELA 3PTDA 5CGMA 4H4RA 5HNNA 2YL5A 4KWWA 2WPFA 2D20A 1S5NA 3N73A 3AICA 1ZRQA 3W0KA 1K9DA 3W7RA 3BK0A 1TCMA 2HRWA 4U28A 3GH5A 2W62A 4PFHA 5FJTA 2WWCA 2NWRA 4LS1A 1VFOA 2YCKX 2ZA3A 3AHYA 3MVIA 1GEHA 1CLKA 3MBDA 5CGTA 3W82A 3PVFA 3VDBA 2BZNA 3OOQA 1GEQA 3FEMA 4OWGA 3ZR6A 3FSUA 1HZYA 3QFWA 1CB2A 1MDRA 4WHBA 1J5SA 1XPYA 3W73A 5BXTA 2BB0A 4L7ZA 4IP7A 1KW1A 3UG4A 3FJLA 4UNIA 4LC8A 2HVNA 1VFSA 2XIIA 3SQPA 3TN6A 2BOEX 4O11A 4ROPA 4AC1X 4F0RA 3UGRA 3ABQA 1H63A 4H1ZA 1SPQA 3EF6A 1KFWA 1P0NA 4DRSA 3CL7A 2BNJA 3O6AA 1W5NA 3TYBA 1XIIA 4RZ5A 3RX2A 5I3IA 2FFIA 2J3NA 1FDJA 1EO5A 3N14A 4W8AA 3OG3A 4HSOA 3NGFA 3WNNA 1P1XA 4QTGA 3LXDA 1H5YA 2FZ8A 3C2EA 2QDGA 1D9EA 2V5KA 5LNRA 2BASA 1UR0A 4JQAA 3WD4A 1VQTA 3L4TA 1IYXA 4IFKB 5HR7A 1DWIM 2Y8VA 4CU7A 4Q33A 3WK2A 3L4VA 3UPMA 1MMFA 1L8NA 3SRHA 1F8WA 3S1XA 3DIPA 1R3SA 5JBDA 1YXDA 1ZMCA 2PC8A 1LLWA 3QH2A 1QW8A 3QTGA 3A24A 3EWWA 3N6QA 1EXPA 4R7JA 1UR8A 1FTXA 4DJFC 2XVKA 3E2VA 1O5QA 1J0HA 1WKFA 5HNTA 2Y63A 4WDTA 1NWSA 1DJGA 1JRCA 1TRIA 1I2PA 4B3ZA 1ME8A 3T0CA 3BMXA 2ZZ3A 1NVMA 3TZFA 2ZXBA 3UYCA 2WZHA 4PBFA 4G8TA 5KZDA 3RU8X 3EX6A 1PKLA 1WQ5A 1XIHA 4AXKA 3AS2A 5LIKX 3LDVA 2QJJA 3PANA 3WDHA 4GZEA 1US0A 2PLKA 3UA4A 1N8WA 4YWSA 4M19A 4WIWA 4U4MA 5E9AA 1MYRA 3LD5A 3CPUA 4GJ1A 4CQAA 1DQXA 1KQYA 3TX9A 3TN5A 3HMCA 4WF7A 1JGIA 2ZWYA 1XISA 4E5TA 3IJDA 3KWXA 5IDIA 2Y5JA 4DWSB 1R30A 3A21A 4A8NA 2E5BA 3QY8A 1P0KA 4Y2WA 4NAFB 2RHGA 1JXJA 3O6DA 4W5ZA 4YPJA 1J2BA 1FWWA 3R11A 3IPWA 4D6JA 3D47A 2W54A 5ABFA 4A8IA 1XCXA 4PRRA 3RRXA 3R25A 4AC7C 1J8VA 1A50A 5I3KA 3U9IA 3EAUA 5LNUA 1TX2A 3UXKA 1BKHA 4U5IA 3VCCA 1WUEA 1YNQA 4UFIA 2QUVA 3N18A 1KBIA 4RJEA 2PDMA 3NQGA 2GGGA 3ZT5A 3O16A 4GR1A 2A7PA 4AZBA 5A6SA 3KM8A 3LHWA 5CPLA 1FX6A 1GOOA 1UCWA 1UUOA 3LXAA 4HPGA 1XYMA 2CWXA 3P0XA 1AA1B 1FWTA 3EMZA 2ZXDA 3ZM8A 3W1LA 4G6CA 4EKJA 3QC0A 3L0NA 2Z2AA 1N8FA 3MWAA 1XLCA 2B7QA 2BVTA 3KEHA 3GUWA 2ZUNA 5HUPA 2XVNA 3WEZA 2ZWZA 2C19A 1MUWA 1TPVA 2J8GA 4AIBA 4H4TA 3USZA 3WFAA 2ZUSA 2V2HA 1P6CA 1N2VA 1IXNA 1VCVA 1XG3A 4F2BA 4NUWA 3E0VA 4UXDA 1RQEA 1U33A 1WDSA 6TIMA 2PDQA 1HIZA 4CCZA 4KF1A 2QHAA 4LW7A 2YVJA 3IV3A 2XVGA 3TQVA 1JRPA 3DYPA 1XLFA 1HW6A 4RXGA 3WYZA 5EBAA 3VD9A 3ME3A 1DVJA 3D3AA 2G3IA 4JTUA 1ME7A 4AF0A 2QUUA 3VDCA 1TV3A 2DIEA 1A5MC 1UD4A 1JYWA 2W3SA 1FCVA 3SCQA 2GFTA 3AWNA 1JZ3A 1OFPA 1RLCL 2PDPA 4AD5A 3AJ7A 1KV5A 2YSWA 3QOMA 2YDQA 4J35A 5AOUA 1B3ZA 4K39A 3OYXA 1FWAC 3ELFA 3RIKA 3JZUA 1VYSX 5D2XA 3K1GA 2C14A 5JBFA 2X1TA 3MJYA 4HOWA 2WXDM 3GYCA 4LY8A 5D9MA 4Q8UA 3I7QA 3FOKA 4KQNA 3KUMA 4H9ZA 1CCWB 4X0NA 3SURA 2X8CA 3W2LA 3N25A 3ZWSA 3PZUA 1KA9F 4AW7A 3CK5A 1F61A 4IGHA 1FRBA 3K5XA 3PJWA 4B9ZA 1QCWA 1EP1A 3C5QA 3V1HA 4Y7EA 2G50A 1UKOA 4L61A 1XLJA 1TQJA 4MWAD 5M2FX 3GYEA 2G3NA 2Y5SA 3GR7A 2WC7A 1H4PA 1R9XA 3KRBA 2X7WA 2WJFA 4L4LA 3Q4DA 2IKIA 4P7OA 2O9PA 2G3FA 4HHLA 4IIEA 4KGLA 2CETA 1A5UA 3NOYA 3F2DA 4RE4A 4DZIA 1OZQA 4A2SA 4C5YA 1ITCA 1RXOB 2CCRA 3ECQA 1QRQA 3LM7A 3R07C 4IQDA 4OBRA 4RK8A 3U8GA 4PMOA 2ACSA 1MEIA 1CNVA 4XAPA 3RPDA 4JIEA 1PHQA 1Q63A 3KBJA 4ZTYA 4E8CA 1H3GA 3NVTA 5LNVA 1AL8A 2GRTA 2I1OA 4L9YA 1QO5A 2DFAA 1FCBA 1K7XA 1LL4A 1WBHA 5G4WA 3DFNA 1W5PA 3P62A 1SYTA 3W76A 3NPUA 4XTIA 2BOFX 2O9TA 1F8IA 1G67A 2YAUA 1CPUA 3THDA 1O5RA 4Z1AA 4AZ5A 4LVAA 3GIYA 1DJHA 1I6NA 2VC7A 1PTAA 3BOXA 3DH9A 2HPIA 1XRSA 4QAIA 4MYXA 4PYSA 4GH1A 3B8UA 1QJWA 1TYTA 4S2BA 1XM3A 3L4XA 2Q6ZA 1BQGA 1D3HA 3M0XA 3EX3A 1K9FA 3AXKA 3NVWB 1WDPA 1YDYA 2YCLB 3LI1A 3NPVA 1XSKA 3BSMA 1ZDLA 1LL7A 2PODA 3GLCA 3ITGA 1EYEA 3LCWA 1QOPA 1TTQA 3MSYA 3W75A 4EIVA 1W2VA 3W7KA 2VX4A 2BGQA 5F4SA 3RM4A 3HF3A 1RJPA 3BZJA 1BKSA 1ZQ5A 3I3DA 3MCNA 3WQOA 3IWPA 4JHOA 1Q6FA 1SUXA 4HMDA 5CSSA 5HMDA 3H22A 1Z9AA 1BPLB 1PDZA 1DQUA 5C5YA 3W7DA 3U57A 1XLGA 1V77A 3L65A 4O14A 1RR2A 4Z2LA 4FZIA 3OVGA 5LIUX 2GUUA 3WQFA 4JL2A 5LHEA 3M44A 2FZ9A 1HGWA 2YLLA 1MW0A 4YJ5A 5HQLA 2ONEA 1ONRA 1VCFA 2OR2A 1YW1A 1KBBA 4X2RA 1OC6A 1Z8AA 5CPQA 3B8VA 2Y62A 3NQVA 1Z32X 3LBOA 1YXCA 4LVGA 9XIMA 2E68A 4WGHA 4XK2A 1IEQA 3GTFA 3BO9A 3XIMA 4L9XA 1ZCOA 4F9DA 1I2RA 3CZEA 1ECEA 1DIDA 3CXOA 2REQA 4XKMA 3LEPA 4ML4A 3WX7A 2ZTKA 1U2YA 2ZVRA 1VPYA 4Z0JA 1L6FA 2GQ8A 1SQ7A 3CZLA 2HEJA 3QHMA 3NVVB 3VM5A 2VEMA 3QGVA 4IPIA 2V3AA 1H7OA 1F6PA 4GZJA 4PODA 3TWBA 2J74A 1O68A 2C91A 3B8DA 2D0HA 2HNEA 2GGHA 3E02A 4ZE5A 1TTJA 4NL1A 3L67A 1OG6A 3HG4A 5EPDA 3CZ8A 4DJEC 4FLSA 1WZAA 3U5UA 1ZJBA 3UCCA 5I3JA 1AH4A 4JTDA 5G2WA 3WL0A 2HK1A 3KL5A 3NG3A 4Q4SA 3URQA 5HNRA 4Y9AA 4FX8A 3RU6A 5U4NA 1I1WA 3SIMA 5A5WA 1KM1A 3O3RA 3TCSA 4O0QA 2CZFA 5D8WA 4JIHA 4YWIA 1BEUA 5HJYA 5I78A 1R5YA 1PJ9A 3OW1A 5G4HC 4MY9A 2FVLA 4MKSA 2NVDA 3WH5A 1V02A 2WQDA 2F2KA 3ARQA 3SY5A 5IRPA 1Z41A 2H90A 4C6KA 2CU0A 4C6DA 3UWZA 2QCCA 4PUWA 1OX4A 3W28A 1DQWA 2OZ8A 2NX9A 4F4RA 4KIEA 4HJFA 7TIMA 2Z29A 3DZ1A 1V02E 5C54A 3WKZA 4H50A 3KRZA 4OUIA 1JF6A 1QXLA 4IMEA 3WFZA 5G1TA 1NF0A 4H4QA 3FYOA 1JCNA 3WLTA 4ALDA 1JZ7A 3E2SA 3S1GA 1LOQA 4HNUA 3VGHA 1SMAA 1TE1A 3B9NA 1Z89A 2YDRA 2P76A 4EAMA 1KBLA 1WX0A 1ESWA 3VIJA 3OZPA 2DSZA 3NA8A 3W7NA 4OOUA 4Q7IA 3E0FA 2TRSA 3GXNA 1HKVA 1J4EA 1OB0A 1V7AA 1GORA 3GR4A 5C2XA 4QITA 4GVFA 1SMDA 1BLIA 2Y1HA 3FGCB 3BSHA 2CBJA 1VEMA 3NQ8A 3KCOA 1JG9A 3UXDA 4S3JA 2HJPA 1DYSA 5HR6A 3KWSA 3RO6A 1X2GA 2E8ZA 4ICMA 3M0YA 3SUSA 3TLQA 1MI3A 1GOKA 3SEPA 3CXBA 1CXKA 3E5BA 1O7AA 3ARUA 5BRPA 4O57A 3U2ZA 2RAGA 3DHDA 4FPSA 3B0UX 1UH4A 1QHZA 1UKSA 5FS8A 3VGGA 4UUIA 1XP3A 1EGMA 4UMCA 3JS3A 4HK5A 3H4KA 4ZXOA 4JN8A 1WKEA 5JH2A 3TXZA 4V2XA 4PR4A 4XAZA 5FJRA 2HVMA 5FAJA 5D2YA 2PMQA 2I7GA 2DGAA 3M7SA 3NPWA 1X97A 3L21A 4HJWA 2GJXB 2FMOA 1JPMA 3N04A 5I09A 4A3UA 1MO9A 3NVZB 1C93A 3WJYA 4W88A 3B9JB 1AL7A 1VPQA 1EQPA 3EXSA 3W2MA 4M6PA 3QOKA 4LEQA 2A3LA 2INFA 3BCJA 3SCVA 2ZUVA 8CGTA 2HROA 4WVXA 1GZJA 5L6UA 1QDSA 4ZOEA 4ICNA 5HOSA 1DJIA 1K4HA 3BLPX 2HQAA 3TROA 2G5WA 2WMGA 1NFGA 3HBLA 1XYLA 4X60A 1S46A 5E1QA 2WZMA 2OYMA 4PTNA 5G2IA 2VR2A 4OU1A 4H8NA 2UY3A 3AS3A 4WKAA 4H8HA 2XG9A 3BLKA 2CKSA 4K8HA 3N4AA 4HZ6A 1E0WA 3HZ3A 5GNYA 2X05A 6TAAA 2B7NA 2Z1SA 4HA4A 3VNZA 1HX0A 2WANA 4GIEA 4TTGA 3HGRA 4NEVA 2FQIA 3ITLA 3RPMA 1EYWA 3TKFA 3CLMA 2QJIA 1ITUA 2Y0FA 4I9TA 3EXTA 1VQZA 4URIA 2OOGA 2RH9A 4LAUA 3U48A 3LNMA 4ERGA 4PMJA 3OLIA 4YLWA 5HA7A 3FYYA 4NZ3A 4GVIA 4JNYA 2X40A 4MLJA 3FAXA 4OOZA 4DWSA 3PC0A 1V0NA 2GK1B 1P48A 3LGGA 3EKZA 2D2HA 4O28A 3QVQA 3F4VA 1W37A 1UWQA 3BURA 5D9OA 4S3AA 1C8XA 4HKPA 1EPXA 3GDTA 1ZBWA 4KBXA 4CU8A 5HULA 3F03K 4XISA 1GG1A 3QC3A 2FLIA 3I65A 4G7FA 3O9NA 2QCHA 3CASA 5TD4A 4IMFA 1V0MA 4O16A 4G1KA 5I79A 3SCSA 2YA1A 1HVQA 2Y7FA 3IVSA 2C0HA 2QPXA 2VEIA 4ORMA 1D2KA 4YTUA 2YW4A 4JFUA 3FA5A 4OIFA 3URAA 4MB3A 4ZB0A 1Z42A 2QCLA 2PU1A 4O8AA 1T41A 3PJXA 1EC8A 3G18A 4UTHA 3E74A 3RMEA 3W7IA 1RVGA 4CQ8A 1LJYA 4QS5A 4UMBA 2FDSA 4KETA 3WEOA 1CBGA 4L4MA 3KBVA 4K7VA 2YB1A 5LHFA 4H4WA 1QI4A 3W24A 2DT1A 1HFBA 4MZ8A 1REQA 2WAGA 3OEXA 4H7VA 1TA3B 3G1FA 1PIIA 1MSSA 4J40A 3QGKC 2ZZ7A 1TSIA 1OT1A 2BC0A 1JCYA 4XQ6A 4IJBA 3LU2A 3AIBA 3KS5A 1GJPA 3MMUA 4O15A 5I3HA 2OT0A 3QLDA 1IV8A 4E3VA 4LUTB 2WSYA 1R47A 3PWAA 4ZR8A 4BHYA 1VD6A 2W55A 1GERA 1JEZA 4I3GA 3INPA 1DIEA 4ACZB 3W53A 4PTDA 5H8MA 1W56A 4MWAC 2WKGA 1UKQA 3ZJ7A 2O9OA 4HNOA 5A8PA 4LUJA 1ZNNA 1C7TA 4QJ4B 3AWOA 4FNSA 3VILA 4KESA 2C1IA 1I8JA 6REQA 5HMSA 4JD4A 5A6KA 3T0DA 3MHGA 1IEIA 4R53A 5BZAA 1OYBA 1KCZA 1QNOA 3T44A 4E2VA 1H50A 3PAJA 5D4YA 2P5NA 1XQLA 2CZEA 2Q3OA 5JMUA 3CIWA 1L6GA 4IQEA 5CPOA 3DK4A 3T08A 3UJ2A 5DANA 3CL6A 3QR0A 4S3GA 4IPLA 2XJ7A 3NOEA 1PKNA 1EZ2A 4J2MA 1VHNA 3RYSA 3T9PA 2D22A 1QPQA 1UMLA 5AECA 2ZXAA 3B0VC 3EOOA 3SCRA 4OFCA 2D1ZA 3LSCA 3AHZA 4PTMA 2JFEX 3EGJA 4JHMA 3ZT7A 1CXFA 1SVDA 3MI6A 4X0VA 3EWDA 4WDWA 4I5UA 2CLIA 3NL2A 2RGMA 4KW2A 1JFHA 2Z6JA 1P5BA 3N34A 2QJNA 2CLPA 3UZXA 2WMJA 4AVFA 1QOXA 1M7PA 4DVOA 4MJZA 3M1ZA 2YBVA 1C7SA 3T1GA 3E0LA 3GXDA 3LB8A 2QF8A 2WW5A 3W27A 3VXGA 1HGYA 3ZIZA 3NO3A 3LHYA 2GUYA 1XS2A 5GQBA 2QF7A 4B5UA 4LANA 3RG6A 4IICA 4JTLA 3RCYA 4OKDA 3B0PA 2NSOA 2XFWA 3LTPA 4AZGA 1EUNA 1XLAA 4GYJA 3XINA 4BS0A 1W3JA 3TQ0A 4DYJA 1HJXA 1R3VA 1F6KA 2ZE3A 3OLEA 3CIVA 1N61C 4RW5A 1MDLA 1G0CA 2AQWA 1JFXA 3DAQA 4W8BA 4E3TA 5CG0A 1AMYA 3C2FA 3HQNA 2FHCA 4ECLA 3WDJA 1ZB5A 5M3WA 1KGUA 4JXCA 1YPXA 3FEQA 4UZUA 1EFZA 3QFAA 1TUXA 4FOKA 1OJXA 1QPOA 5DBTA 1XYZA 3ES7A 2HDJA 3ARSA 4DF0A 3R8GA 4BK9A 3JUGA 5EMMA 3T2QA 3ZSTA 1QPKA 1ZHAA 1KB3A 3PHAA 4W5UA 3QBUA 4CQ9A 2I57A 2OXNA 1ZK7A 1HXJA 4N02A 2VHLA 5DLCA 3I3EA 2DZXA 3TW6A 2I5GA 4YCPA 4MNJA 2OSXA 1A49A 1Z44A 1W1IE 1UR3M 3LENA 1NF7A 4R5EA 2OU4A 2Z1VA 2ZZ5A 4I90A 1OT2A 4K6AA 3S5YA 4Z42C 3MBFA 3BL3A 2Q8ZA 2O4MA 3P80A 1C92A 1KM6A 1D7FA 5FS7A 1DPMA 1BVWA 1J5TA 4ZBCA 1JCLA 1V79A 3LBCA 5FCZA 4WSHA 1LQ0A 3BSGA 1XJBA 1E4IA 1T0OA 4Q8OA 2QV5A 2W3ZA 5TAOA 3TTEA 4P7LA 1EJ7L 1DWGM 1G5AA 3SUVA 3WMBA 3E9AA 2C3ZA 2L5HA 2E3ZA 2BMBA 3SSJA 2MNRA 5TF0A 2AL2B 3ARWA 1BWVA 2QIIA 1JPDX 2V2CA 2Z1BA 1VR6A 2GQWA 2ISDA 3NS1B 1U1HA 2NUWA 2J78A 3VI2A 3KW3A 1NOUA 1W32A 1K70A 2OFJA 2GWGA 3GNOA 2YBUA 4AY1A 4ZOAA 3W25A 3R8HA 1GVSA 4XTDA 3P93A 5C9ZA 1EEPA 2Z1KA 4HA1A 2Z7KA 2PD9A 1BAGA 5DQPA 2EO7A 5DFAA 1DHPA 3LRMA 4WSKA 5EFFA 4IP5A 3EPMA 3TW7A 4XG1A 2QAEA 3TR9A 3CU2A 2CXEA 5GNZA 2MANA 2PDNA 1N82A 5BCAA 5XINA 1LWHA 4ZL1A 3I3BA 1UD8A 4BI7A 5JCNA 4D6IA 3H23A 3L0KA 2QAFA 2R91A 5IM51 2GDQA 3B97A 1W9XA 3VE9A 1IR2A 4WKFA 5CC6A 2XVLA 5C9XA 5LNWA 2QZRA 4LS2A 4A05A 3OG2A 5G5GB 4P7RA 3ITTA 5H6HA 5K2ZA 7CGTA 2EQ6A 3S9YA 4UQBA 3VGBA 1TX0A 1KRMA 3KDOA 1H2JA 2YLAA 3VZXA 1XQKA 1EJSC 4FXFA 2WV8A 3UQNA 2PWUA 1XWYA 3IIVA 2IPJA 1LG2A 5LNSA 4DBEA 3VKCA 2WPCA 2BXZA 3VZYA 4GI4A 3W29A 4FMVA 4AY7A 5JBEA 3RCMA 3O0KA 4ML9A 3LN3A 4WCJA 3H7UA 3ZS4A 3LLFA 4L6OA 1MVYA 4Y6GA 1UOKA 2BHYA 4QFUA 3WF1A 4A8RA 2XWDA 3TYCA 3T6CA 2UBPC 1TIMA 4XZMX 2OEJA 3R5EA 1CGUA 4GIAA 4TO8A 3UEQA 5F1UA 2G37A 3SO7A 4B90A 4Y9NA 5KVIA 5D37A 1X8FA 2VO5A 4F0MA 4AMCA 1E9ZB 1VCGA 3HU7A 3WBXA 4DZ5A 4NI8A 1X38A 5HATA 1X7FA 3QYSA 3S6TA 1I0BA 1W9VA 1NWRA 4GG9A 5D2WA 1ONEA 4DUVA 4OVXA 3DN5A 4BF9A 1L6WA 3MMTA 4QQUA 5C0QA 1AQ0A 4PBGA 4GOAA 4O4VA 3D9XA 1E4NA 5DCBA 3O6CA 1F3TA 1SSGA 3B4UA 4HPXA 2XGBA 4IP4A 3UWYA 3DECA 4GINA 1B3WA 3TU9A 1U5VA 1J01A 1YQZA 4LCRA 1IEWA 1TV4A 3P6LA 3VIHA 3B0XA 3WLPA 3IUDA 1FUYA 4FAMA 3NYZA 3S8HA 2XIOA 4JOMA 5H8PA 4P8VA 5BNKA 1KXTA 4YU1A 1WAWA 4B5VA 1XGEA 4AAJA 8A3HA 4PMQA 2GOKA 2IPGA 2P1FA 1E0XA 1T96A 1J96A 3GNRA 4P7NA 3T7VA 4N42A 1IZCA 4EOUA 4YN5A 1GQIA 1SJAA 4D2JA 1NELA 4XAFA 3O15A 4EQRA 3CGDA 1XICA 1NARA 3GAYA 4MNMA 3GDMA 1SO5A 3Q45A 3NGJA 3ARXA 2YGYA 1F73A 4Y9OA 1NFPA 2DUXA 2NVKX 4UOZA 2F38A 3IAQA 1KWKA 4BFAA 1MNSA 1KTNA 1GVFA 3VO0A 2Q8LA 1HVXA 1BHGA 2EQDA 4UTTC 4DF1A 4AD1A 3UF9A 1PV8A 5EBKA 1PDYA 1S7MA 3OA5A 4ZTXA 1AQHA 1V0KA 1XBZA 4KCUA 3ARZA 5FACA 2FGLA 4JFWA 2HCVA 2FZMA 4E0CA 1XD0A 1MEWA 4EM4A 3SR6B 1FH8A 3N19B 4CD8A 4HOXA 1XSIA 3G24A 3GSMA 2QNEA 1WA3A 3MUY1 1Q7MA 5AB3A 3MV01 3FJNA 1A80A 3TYDA 3OBEA 3S2NA 2GK1A 2RUSA 1ZU8A 2J9XA 1K1DA 1UOZA 4FX9A 4AXNA 4TMCA 5C70A 1O4UA 2QCDB 4W7UA 3VNIA 1K3UA 1MUCA 4GUHA 3L5AA 3VA8A 2VTFA 3HIJA 1T8QA 4UC5A 5HUOA 1E9YB 4GQ0A 4US5A 3W6YA 2FB2A 3KTXA 3ITXA 2QXWA 1YBQB 4AZCB 4CNOA 4GFIA 3REQA 1ADOA 3DHPA 4M6UA 3CMJA 4PCSA 4XUYA 4G5DA 3M0VA 2O56A 3BC9A 1YQ2A 1E0TA 3PZIA 2OWWA 2WHJA 5FS6A 4NAEB 2Y7EA 4HQVA 4ZO7A 1NWTA 3PBWA 5H8UA 1FHVA 1PUDA 1NTHA 3MCOA 4RNIA 2MUCA 4LAOA 3UESA 4KEVA 3MKCA 4ILSA 2FYMA 3AS0A 3N3TA 5ABGA 2OMAA 1GRTA 3VPLA 4GKTA 3DI1A 4LCQA 3A13A 3C0SA 3W9ZA 1OADA 1C8VA 5A6LA 5D04C 2OGJA 4F8XA 3ABSA 3WF2A 3KXQA 3R8RA 3URBA 4ZGYA 1ZAHA 1TA3A 3P81A 2E09A 1KD0A 4XZBA 2Y8KA 3C0JA 3MI3A 4LVBA 2YQUA 3U7BA 2V63A 4DPPA 4LQ1A 4Z0SA 4PMNA 1UWAA 3NTYA 1BTMA 4CU6A 2PF8A 3BLEA 4QQ3A 3QY7A 3FSTA 1FCQA 1SW3A 4LUTA 2XIJA 4BQ4A 2ISWA 3PBGA 3IGXA 4V28A 4WJ8A 4I9JA 3UR7A 3IV8A 4DJDD 1BTCA 3HM7A 3BUVA 1RJRA 1EP2A 2I5QA 1R38A 3TJXA 3KFTA 3NPXA 3T40A 1WDRA 3B06A 4AHPA 1LZOA 1DJXA 4Y8FA 3SB0A 4WD0A 3R6IA 2QJGA 4HN4A 4JX6A 2WBAA 2X0HA 3M6YA 2Y6ZA 4LF2A 4Y9MA 1A4LA 3KZSA 4PMYA 1SFSA 4TVWA 4TUFA 3CUFA 1Z69A 3VUSA 3BJFA 1UWIA 3SGUA 3LTYA 4E4PA 1XW8A 3TVAA 1UYQA 4YHGA 4GD0A 4CLMA 5BMWA 3CV2A 1W8GA 4X9SA 1KKRA 4UR8A 1VS1A 3M47A 3CTLA 5FJOA 3WQEA 3OO2A 1TQXA 3GBEA 3OZMA 4R88A 3BG5A 4ONVA 2V38A 1UIOA 1NOWA 1LP6A 2TYSA 4YTTA 1R7AA 2PAJA 3WG6A 4Z2JA 5A8QA 4FS9A 2ZZ4A 1XLBA 1B30A 2PUZA 4YYCA 4WKHA 2J7FA 3W86A 4MVAA 1PHWA 1EIXA 3SFKA 4WLCA 1KFBA 4HPHA 4LB4A 3PB0A 1HO4A 1LTDA 1I4NA 1GKRA 2X1SA 1GRGA 4DIAA 3GZ3A 1XI3A 1RV8A 2ANUA 1AJ0A 2QS8A 4WR3A 3HMJG 1EBGA 3SFWA 1ISYA 3AI0A 2VFIA 3OZYA 2QR6A 5E0FA 1L2UA 3AHXA 4XIAA 3WK1A 4QG8A 1XDJA 3N29A 5CAKA 1ZXIC 4Y90A 4YL2A 1MRQA 2WKLA 3CC1A 3OGSA 1Z3NA 1LQ2A 1PE1A 2W61A 4HT3A 4H4PA 3LB0A 3STFA 1XYCA 1XIDA 1XBXA 3WZ0E 3FY1A 3DYOA 3GIPA 3IJ6A 4L9ZA 4W7VA 4QNEA 1VFMA 3MSRA 3QRHA 3RXZA 1NHQA 4UFJA 3UNDA 5F4XA 2UWFA 3NXFA 4FEZA 5E5CA 2QW5A 4DY1A 4GIYA 1AH0A 4HNVA 1RM6B 2CIPA 4UQ9A 1IXPA 1CYGA 1XC4A 1JJKA 2ZX6A 2XZ9A 4N9BA 2X1RA 3L5OA 2J47A 3W1TA 1YRRA 2A3CA 3SUTA 1QNRA 1M5WA 2PDJA 4GY1A 3TQKA 1B54A 4B4FA 3HG3A 4MUZA 4GBUA 2P10A 3WCZA 3ZJKA 3XISA 4RNFA 2BXYA 4Q8MA 3G6MA 4HNTA 4PL2A 2YB4A 2DT0A 4CN1A 3A7AA 3KBSA 5CPTA 4ZODA 3GH7A 1BQCA 1SZRA 4PSRA 3AOFA 2YZ5A 4NJGA 1R7OA 1O1ZA 2CFFA 2GSEA 1SFLA 2IKHA 3VE7A 3SCWA 1JPKA 3TQPA 4Z2GA 1UB3A 3PZNA 4DNHA 3BLIA 2VX6A 1PWLA 4WY0A 1GJUA 2OG9A 4I7UA 5E6YA 2AKZA 4UNLA 2IPFA 3W81A 2NLYA 2A3AA 3MUAA 4A8LA 3TTQA 5FEWA 1H41A 1Q4WA 2VM8A 2AL2A 3GXPA 5FMHA 2CLHA 4FNPA 4GNKB 5DRIA 1ODUA 4I5XA 3KRUA 1I0DA 1ZTVA 2VEGA 3QZ6A 4UTMA 3B8WA 3GW0A 1UR1A 2ASHA 3PB2A 2EG6A 1W91A 1ZCCA 1XR2A 3HQPA 4O18A 2E1DA 2R8WA 5K9DA 1J12A 4KWUA 1UKTA 1UC5A 4XO6A 2H9AB 4XUGA 4IIGA 3LX9A 1UR4A 4MDPA 4I8DA 5CQ1A 3OQ8A 4LRSA 4YS1A 3V36A 3CGTA 1Q45A 2FIQA 5HQEA 1LVLA 3L4YA 1VFLA 5M17A 1A47A 2X7VA 2E9MA 2GGIA 4XD4A 3CLWA 3RM9A 3DBPA 1VGAA 1VJIA 4EE9A 2PGRA 3W2NA 5K4ZA 3M5VA 3EB4A 3N6HA 4OBTA 2VXNA 3USBA 1U5HA 1GQLA 5B80A 3DGRA 4NJIA 5FEZA 2I16A 2A2IA 2J75A 2OWXA 1UWTA 1VRDA 3ZO9A 4XZ9A 3B9AA 1KFEA 3CUGA 1OWQA 2VUNA 1X39A 4O17A 4J1OA 1G69A 1XBYA 3NM1A 1PX3A 1GW9A 3KL0A 4YMZA 3F2BA 1R3YA 4FA3A 4MLRA 3UT0A 4XBSA 1O95A 2WM0A 2F6UA 3BVJA 4HHPA 4JFVA 3P61A 1ZGDA 4IHCA 3E49A 1SO6A 2E6FA 3ONBA 1VFFA 4M7TA 1Q7ZA 2PLCA 3BOLA 5CBJA 2PRMA 3QYQA 3W7CA 3LHUA 1W17A 3IGHX 3TC3A 4HMNA 2GR3A 1F3WA 4INFA 4GQBA 4CN6A 2ZUUA 4C60A 2C7FA 4LS0A 5J8LA 3CAWA 5HMFA 4FX6M 3KP1A 4RPQA 1E72M 3SJNA 4GI8A 1ICQA 3NQFA 3HN3A 4J3VA 3A9IA 4UCFA 2ACUA 4UMAA 3URHA 4D6EA 3D3FA 4ATLA 3VNYA 2DZSA 1RCXB 2PTYA 4PMVA 1AW2A 2BBFA 1B31A 3E0IA 3CZGA 3M0JA 4JTFA 3MDWA 3AQUA 1W31A 3KRSA 4QS6A 1TPFA 4NIRA 1NDWA 4ZO8A 3W2JA 3CO8A 3AZSA 4AY8A 3UERA 4J3TA 1JDCA 3WD2A 1WDDA 3AXHA 3CPRA 3J7HA 3PFRA 3HGSA 2PDUA 3MUXA 1VHCA 1JAKA 3R12A 4LBRA 1OFOA 4RDZA 3TZNA 2BV9A 2GPTA 2GQ3A 4H6RA 4ZOHB 2P50A 3QHOA 3HTWA 2PDXA 1JNDA 1MFVA 5EBUA 3FXYA 3EDFA 2P3ZA 4KT2A 4PMDA 1DXIA 3C52A 4EQSA 4F2UA 5CC3A 4RE0A 1TPB1 1XIJA 3AMZA 2UY2A 5HWNA 5HJXA 2G4JA 2ZUWA 3CNYA 4UZSA 4B15A 3ZFHA 3A4XA 1DEDA 2FGBA 4JTHA 1Q2SA 3M9YA 3ID7A 4E8GA 1GOQA 5ECUA 1FH7A 3VD3A 3L5MA 1XYAA 1QW9A 1W1TA 4LUSB 4GACA 3KVMA 5AN7A 2PP3A 3S9IA 4N9CA 2G95A 2WNQA 3KOFA 1RBAA 3SUWA 3TP4A 2VUYA 2VGBA 4B2DD 2WPGA 1ZPTA 4PA8A 3VAVA 4UTIA 1VIZA 5KVHA 5EFDA 1VJSA 5T9BG 2CERA 4ADSA 1FEBA 1FVPA 1R9YA 1YX1A 1R86A 2P8CA 3W2KA 3JU2A 1ELSA 4MY8A 4PGLA 3W1PA 3VMOA 3OQEA 4NG3A 3R13A 2PB1A 2QYGA 7PTDA 1W6TA 3R2GA 4U2ZA 1VIWA 4G1NA 3EMQA 4N4PA 1LORA 4LBUA 4F48A 5EMUA 3V4BA 2XSAA 5BWAA 3OIXA 3SBFA 1NM9A 1WZMA 3BGGA 4LF1A 3LBMA 1T5AA 3I68A 2D69A 4GISA 3VC5A 3IJIA 4BKNA 5CPSA 1D8CA 1M1BA 3O6YX 2WVVB 4GUIA 1H1ZA 3BGJA 4IH3A 2ZRYA 1CIUA 1EJXC 3HQ1A 4YXGA 4WXZA 3CM4A 1TPH1 2CHOA 3FG2P 2QCDA 3B05A 5BRBA 5LXXA 1GNXA 3VX1A 5I2UA 4QRNA 4I6KA 2NV2A 1DHKA 3EA3A 3VOCA 1IQ8A 4KFOA 2GVYA 1M03A 4U5KA 1Q66A 1KM5A 1YE4A 1YBQA 1JPIA 3GD6A 3DESA 3GVGA 4NJHA 1TVLA 4X3ZA 1EWDA 1FWIC 3W1RA 2DDXA 3F1QA 2KX9A 3NM3A 4FXRA 2OX1A 1RHCA 2XM2A 4NAEA 1LT8A 1L0PA 3UBPC 3PUEA 4F0HA 1RBOB 8TIMA 1A5CA 2VZVA 2WP6A 3TAOA 4O1AA 3NL3A 3DUGA 1S5VA 1G7UA 1G4EA 2DVTA 3FIGA 4NYYA 3ARYA 4V1YA 1TV5A 1EF3A 2OLSA 3SQSA 1UIPA 1HJWA 2PWHA 2PC4A 3APGA 1XSJA 5CSYA 4KRZA 1DTNA 5K7JA 1Q6EA 2WOIA 4YTSA 2HS8A 4EK7A 3LCFA 5EYWA 4HIBA 1GONA 4IMCA 5JQ9A 5JXQA 4Q4RA 1FWFC 3N17A 3MP5A 4I9AA 3A9BA 5F1VA 5I23A 2PTWA 1B9BA 3GQYA 1VBRA 1EGZA 1GVQA 3FN9A 3UJRA 2POZA 3PM6A 4LFYA 3NEVA 1PZ1A 2ZX7A 4KEUA 1ZX9A 4HU0A 4OBSA 5C55A 3RHGA 5JCKA 3UU0A 1KM0A 3A6OA 3QSTA 2A3EA 3PSWA 2W66A 3RNMA 3P2VA 4I8YA 3LGDA 4PMZA 2DEPA 5CSRA 1PZ0A 3SW6A 2W67A 4HPNA 2GVJA 4HNLA 2J13A 1EBHA 3CUXA 1QATA 1TFVA 1MQRA 4U31A 4JL1A 7XIMA 3CB3A 1UJPA 1F74A 5CEWA 2PZNA 1QI0A 1OIFA 3PUDA 1CENA 3QZEA 3WJZA 2GVEA 3DKJA 4XD6A 5HNUA 1GKQA 7REQB 4K7YA 3MYOA 5BRQA 4M81A 1RLDA 3CT7A 4JQ3A 4QBXA 4KH2A 3CQIA 3P5YA 4GVHA 1B1YA 4ZQOA 2DIKA 5LIXX 4JIRA 1X96A 2V81A 3DI0A 4MTVA 1KXVA 3CHFA 4HP5A 5ABTA 2OZ0A 4MPKA 4ZE4A 2ZOXA 3WH8A 4QGCA 4GRSA 2ZZ2A 4QX4A 4IJCA 2RDTA 4NY2A 4P61A 1W3HA 3LM3A 3UP8A 3WUGA 1B3OA 3WH9A 5JRBA 1JIBA 1ICPA 2WSKA 4JTQA 1M7OA 4HYWA 2NX3A 4GXWA 4JTGA 3THAA 1QWGA 3WEMA 1A0DA 4FF5A 3FW6A 3VDGA 3A22A 3OGVA 3RX3A 1E1EA 1K9EA 4W85A 3WMSA 3WNLA 3EEGA 4JEQA 3QV9A 1WUFA 3WBAA 3LV5A 1LYXA 4J3SA 4C65A 3VINA 3EDEA 2J7HA 4GVGA 3EA2A 2IQTA 4GJJA 4LEFA 1X1OA 2W63A 4ATDA 4Q8TA 2OTDA 4C6FA 2PTZA 3PNZA 1J10A 1ICSA 4JTKA 3MJMA 3SQMA 2CFYA 4DWSC 4AX7A 3AXMA 1R2SA 2FGZA 3DCPA 4ERIA 1QBAA 1XGDA 3FVMA 3NZPA 4GKLA 1WNOA 3M0LA 2CEQA 2R24A 3WDIA 3KS6A 4PC8A 3W4RA 1QPRA 1HJUA 5IDZA 2EPNA 3V1PA 1CGTA 1QBBA 4HU3A 3CS2A 1JDAA 1FWHC 3FDKA 2C1HA 3UXLA 2YYUA 3N2BA 2O55A 2V82A 2WJZA 3T0BA 1E73M 3GTIA 3MQTA 3DENA 1J93A 3WQWA 1A5OC 3PPHA 2PCQA 5A6TC 4MNLA 5FF7A 1AODA 4EWJA 1G9HA 3B9OA 2CXGA 2OZ3A 3UY7A 3W6MA 4C6JA 1CTNA 3TSMA 1Q6GA 2WHKA 5AHMA 1Z6KA 4D6HA 1JYVA 4O1BA 4R34A 5CLWA 4APNA 3V3WA 2NQ5A 4EXAA 1SW0A 2E3TA 3A7UA 2WCAA 1UP3A 1YNPA 4GJIA 3ABRA 3MY9A 3VFCA 3F4NA 1EO7A 4US5D 2WYSA 3GU9A 3PPGA 1Q6LA 1TJ1A 3AHVA 2XHYA 3ISIX 4H83A 4M0XA 4IIFA 4C1NB 2Z00A 3M64A 5AVNA 1H1YA 4UQCA 3A3XA 3V5FA 5JU6A 5C8BB 3MZ2A 4PEKA 1GQKA 3DG7A 4W86A 1U1UA 4AZHA 4H9XA 1TMQA 2QGHA 3GU1A 1GYNA 1OG0A 2ESCA 2UY5A 3SAZA 2TMDA 4FNRA 4WUIA 3AYRA 5U1OA 2BSLA 4ZQCA 2V3BA 1QTWA 1TWWA 1C91A 2VX7A 3NNTA 3JZEA 4NNAA 1IR1A 1XRFA 1MUMA 4GYFA 4A6GA 3NVYB 1BGAA 2DQXA 2FHFA 3I4EA 3NR0A 1TR9A 4RZ6A 4CEXC 3TE9A 1OD8A 2Y7DA 4QJ5B 1O5KA 5I3FA 2JIWA 1LQAA 2VI0A 3KCJA 3V35A 3FXGA 1MOKA 2H9AA 3THQA 1H1NA 1FP9A 2NT0A 4L1XA 5A6BA 2C8NA 3FKRA 3MO7A 4KWVA 2YDAA 2QUMA 1JROA 4MB4A 1V6VA 2BVWA 2XISA 1GT8A 4IIBA 2B81A 4S39A 3SM0A 1Q4NX 1JZ5A 1AQMA 4C7DA 4J9JA 3D6NA 2PRHA 4O50A 5IXEA 3TCEA 3NQ7A 2R6OA 1GVOA 2ZVIA 1ZMDA 2V5JA 2NXGA 5CPNA 1B4KA 2TAAA 4OV4A 3TR2A 2EHHA 1F05A 4MM1A 5EY5A 1OX6A 4CNPA 5GNXA 4PEEA 3GRSA 4AWSA 1H0IA 1XL9A 5CGQA 4AVNA 3UJEA 3K1DA 3MTWA 2WZEA 4DUWA 1AH3A 5C7VA 4GZIA 3SQLA 2XTKA 3CHDA 1S1PA 2FZDA 4C1LA 1MFUA 1NQ6A 2DSUA 2Y61A 3AXIA 5AC6A 2HWGA 1B90A 3VOGA 1FY6A 3GTXA 3SY1A 2R82A 5FIPA 4GO8A 3AMKA 1DJQA 2HE5A 3IIOA 2DZTA 3N2MA 3FJ4A 4TQTA 3EUB3 1TPEA 3BANA 4PTVA 1QOQA 3GWQA 4KEMA 3DFHA 5K9CA 5D02A 3WF4A 3L2MA 4LYPA 3OLGA 3GUGA 2A7RA 2DPEA 4CNTA 4XV0A 2VNCA 3CZKA 1M3UA 3WLSA 3PZTA 4LRTA 1S2TA 1HP5A 2PBGA 4FF7A 4LX4A 4UOQA 4JTSA 1W2PA 1TJ2A 3FX4A 2G3MA 3PG9A 4GRTA 2FVKA 3BW4A 5TR3A 5BOFA 1EJWC 4WGXA 3SJ3A 1L9WA 1QR7A 4PUDA 3QMSA 5D8ZA 2P0OA 4WY0F 3SCNA 2VFEA 1K77A 2JKEA 1BSIA 2BP1A 4CCCA 3ABXA 1Y5WA 3MHUA 3LPPA 4LYRA 1XH0A 2POTA 4M3PA 2E9LA 1ZS2A 1MW2A 4XBJA 4EMWA 4REQA 4EF9A 1UKPA 4IF2A 3VKKA 3ZR5A 3I6RA 4J3UA 1XANA 3BARA 5FESA 1GPFA 2EQ7A 2V6OA 4NZ5A 3AMDA 3NURA 2QQ6A 5GJPA 1TWZA 1W9UA 3Q6JA 1I2OA 1BRLA 3VC6A 3QFBA 4X22A 1VAHA 5A8OA 3SSZA 2V6AA 4F0SA 3LHZA 4JN6A 1UUMA 1GZGA 2LLEA 1W5OA 1H61A 3VNMA 1CZ1A 2BY1A 3ATZA 3PUOA 4H7CA 2QUNA 4RX0A 3HFTA 1DTUA 4PUKA 1CGXA 2G0WA 1NQKA 3C0LA 1V6UA 4LUSA 3MWCA 4RUBA 5HANA 5DBUA 4G56A 1Q1WA 1EWEA 1P0EA 4DWDA 4ZOBA 5BOEA 2VVSA 4LVFA 5C2CA 3G22A 3RLHA 1E6NA 1JQXA 3AIWA 3CUHA 5I00A 4HCLA 4R33A 1RQHA 3FA4A 1GZ1A 1HT6A 2CDUA 1UROA 5DMMA 1GVEA 3PZGA 1W9PA 3WDRA 2ADAA 2PDYA 1FP8A 4N9EA 1FDYA 1JD9A 4LVDA 2HV5A 4E2BA 3S2MA 4F2TA 1R3WA 3E3HA 3PP7A 3THUA 4UTUA 2ODOA 1RH9A 1YHTA 4XZLX 3W1XA 1JUBA 2W0UA 1E4MM 2WVVA 1HP4A 1K02A 4H7ZA 4NRSA 1QNSA 1XLKA 1PZ3A 4U33A 1ZJAA 2CLMA 1A5BA 2F6XA 1Y8BA 3GHSA 2BY3A 4IWWA 2ZZBA 4YYFA 4W93A 2TODA 4K36A 2Z28A 3G8EA 3HW2A 4B5SA 1WKDA 3MKVA 4AISA 5AHEA 1DKWA 2FMNA 3AMGA 4NZ4A 3S2LA 4QJ1A 1F9CA 3E38A 3N2CA 2BLEA 3GD3A 4XWUA 1PL9A 1QO2A 2EPOA 2HXTA 1BXBA 4DYEA 5I0DA 1YDVA 1UJQA 1TPWA 5D9PA 3DFOA 4M29A 2HPMA 3O2LA 2JBMA 5A1AA 2VCCA 2BCPA 4GX8A 1ZKQA 2C16A 1VEOA 2VFFA 4MZYA 2DZWA 1DP0A 2JF7A 3CYVA 2EGZA 1JDEA 2PBOA 4ATWA 3WBEA 4M8UA 2J7CA 2ALRA 1V6YA 2J7BA 3DG3A 3PBUA 3UZYA 3RCNA 4P5UA 1VFUA 3K30A 3TSDA 4FDCB 3KVLA 3PTKA 4AG0A 5MHBA 1W5MA 4TMBA 3ALGA 4YVPA 1E15A 3PZ9A 4IIHA 1Q85A 2WQPA 1HG3A 5D03A 4GQRA 5I06A 1MZRA 4EQWA 3ZZ1A 3CEUA 1SZEA 4GX9A 4UFKA 1GG0A 3NVDA 2RJGA 4H04A 4MSSA 3AYSA 4FXJA 4S3BA 2ON3A 4F40A 2OKOA 1XLLA 4EWND 4UBPC 3OIHA 4LV4A 3WLQA 4DLMA 4NXKA 2YA0A 4NX0A 1J2WA 3ZOAA 2FZBA 2DZAA 1TV8A 4JFSA 4DNAA 2WNZA 4A4AA 4GCAA 1GOIA 4O10A 1GWJA 4B5XA 1DE5A 1JGMA 3ZSSA 1JOAA 2X09A 3OP2A 4XD5A 5CSUA 3H7VA 3IIXA 2OQLA 2ISSA 5E70A 5EU9A 1QASA 1RK5A 3BCDA 3UZZA 4POCA 4GNVA 1ZL1A 4ZQPA 3CHVA 1XUZA 4B3KA 2Z7GA 5FA5A 1FIQB 1FQ0A 4H4SA 3FS2A 4MHBA 4ORIA 4WOZA 4MIMA 4XZIA 2D23A 2PGWA 1BWKA 3GH4A 4JTJA 4I7VA 2DUZA 3DHFA 3BE7A 2OCZA 3L4WA 1GVIA 3KP0A 4TTUA 3CAVA 1U1JA 2VVNA 1YMYA 3TC6A 1N60C 2J4GA 4LT9A 2E5CA 3QR3A 8XIMA 2X41A 3A4WA 4DBUA 3ABZA 1OK4A 4EMJA 5SWUA 1C8QA 4G7EB 4K1WA 5D30A 4YTRA 3G1HA 1ADDA 1TPDA 1YYAA 5E0KA 1E5JA 2NT1A 3AMLA 4JYFA 2WPEA 4EF8A 1YDOA 1PSCA 3OGRA 2VC5A 3NZRA 4JZ5A 2GVGA 4IQJA 1IT8A 1RQBA 4GGBA 1W9DM 2TSYA 4NZCA 4BEQA 3S83A 5IFPA 1AD4A 1OFBA 3OC4A 4GBDA 4FLOA 1GREA 4JCLA 2XVPA 4H6EA 3GFZA 1BXCA 2G8ZA 3KVJA 1TMHA 3G0XA 3MA8A 4GWEA 1QVBA 3GKFA 4HMCA 5E6ZA 2EG8A 4MY1A 1W1PA 3FVDA 5BXSA 5DF0A 3S1WA 3OPSA 1YTEA 3TONA 3B3DA 4LB3A 4ZQNA 4MB1A 2E25A 2OJPA 2WCGA 3WMCA 4J4KA 3GTHA 1IE7C 4LIIA 1IWAA 4KWSA 4JR5A 3KX6A 1AD1A 2G4FA 1OSEA 4IJRA 4L6DA 3II1A 1OK6A 1VEPA 2CYGA 1KGXA 1KCKA 3DFYA 2CW6A 2NLIA 4BEUA 4PB5A 1CB7B 1H62A 2XIBA 3G6LA 1T3QC 3STEA 4KCWA 3QW4B 4AB4A 1YTKA 3EWUA 4KCTA 3F4CA 3CAKA 3U4AA 4L64A 4MG4A 1OYCA 1W3NA 1SFTA 1WCGA 2EG7A 2XDFA 4W84A 2QT3A 3TTYA 1CT5A 4TVUA 2IPWA 3CYJA 1W1B1 1AVAA 1NJJA 1KXQA 4S3FA 3RM8A 1LBFA 4NASA 1M01A 4H19A 4C91A 1Q7QA 4QISA 5FOOA 4L65A 2AMGA 2I56A 2DJXA 2QVNA 2PF0A 1RY0A 4ZB5A 4OQVA 4MKNA 4OT7A 1V8EA 1E1FA 3KLLA 5A8GA 1WP6A 1AZ1A 2EPHA 1J11A 2WO5A 4BQ3A 3DC0A 1OVDA 4C1NA 3TOPA 4DBDA 3GNXA 3ZLHA 1A3WA 2RDWA 2J27A 1TREA 1M9HA 2HSAA 2IQ0A 2PTXA 3DHUA 3W7LA 2ZDSA 2ZC8A 4HK6A 5D2VA 1BVNP 1CXHA 4D9PA 1OQFA 3N4EA 1V6WA 3LMZA 5T8GA 1JI1A 3KLKA 1JRBA 1RCOB 1S2CA 3GNNA 3R7MA 3UWWA 1B3XA 3GIQA 2XH4A 3R79A 1LF1A 3N2XA 1JQVA 5I02A 3C4UA 1J0JA 1OC7A 4QE1A 3DDMA 3W7EA 2RDUA 4NF7A 5EB8A 5BXRA 3TIMA 4LOCA 2V3DA 3MB9A 1VBJA 3WLKX 2R1MA 2XSBA 3W6LA 4HMEA 3VIFA 1W9BM 1TJRA 4AHOA 1GRAA 1HQTA 2TPSA 4S38A 2XH0A 5C2GA 3VD4A 1CXIA 1BWCA 1OABA 2AQOA 4DJFD 2YL8A 1NDYA 3WLMA 4QE4A 4E2OA 4UTWA 1AFSA 1H11A 4LGXA 4YTQA 4MDOA 4JDYA 1PS9A 1AJZA 1KLZA 5DXXA 3H2OA 1RPKA 2GDVA 1JZ8A 3FYPA 1EP3A 3GX9A 4NQ1A 3FV9A 4BF7A 3EOSA 1GQJA 3AROA 4X61A 5ABFB 3C2VA 3WDQA 2W4XA 3F4DA 3F2CA 3W71A 4H9VA 1I45A 1JPHA 1H49A 3W74A 4ACYA 4MZ1A 3N2TA 2HTMA 1VB9A 2HBVA 1XD1A 3KTSA 4WEVX 2J8TA 2WNWA 2YYTA 4EACA 3VVGA 3L8KA 2XFRA 1OC5A 2D3NA 3VNJA 2YVFA 4XZWA 3RX4A 1IEVA 4BI6A 3T09A 2ZXQA 3Q2DA 1CLXA 4WDUA 4M51A 3ZJ8A 4DLFA 3L2IA 1FFVC 2OWCA 1J18A 3GDRA 3WD1A 4K8EA 1CECA 5FS9A 5L9FA 2BY2A 3CHCA 1RALA 2FTWA 4N6EA 3AU2A 1GTEA 1ME9A 3GAKA 5CJMA 2H8XA 4Q6XA 1GHRA 5F2GA 5REQA 1NU5A 1L2QA 1QK0A 4PMRA 1DJNA 4C7FA 3DJJA 1P7TB 5CG7A 5AY7A 1CI1A 4LY4A 4CD7A 5ECVA 3B0YA 4PB3A 1J6PA 4DJDA 4WQ6A 1XG4A 1ISVA 1XFBA 5F2IA 4AD3A 1TZ9A 3G77A 4PCNA 2ABAA 1YNYA 2DU2A 3EX1A 4QM1A 2JEPA 3MU7A 4EMIA 2OEMA 3LY0A 3ANUA 6PTDA 3TYUA 2V0TA 1GOXA 4UQEA 1NHPA 3AS1A 3WF0A 4CNNA 2EBNA 4UTFA 1NHRA 3P3BA 3LMYA 2XZ7A 4GNJA 1EB3A 2V3FA 4H4IA 3VIPA 3NQAA 3E2QA 3UYIA 2PDWA 1UZ4A 3RF9A 3BLFA 4A3RA 3OVRA 4BWLA 1UHVA 4RDYA 4DAIA 3P82A 4PRTA 1E3ZA 4DZHA 2PWDA 4ES4A 5C9UA 2GJPA 1R8LA 1KKOA 1OEPA 5IBXA 4AEEA 2ZIDA 3LPOA 2OSYA 4GLEA 3W3OA 1HF6A 3BTNA 1VC4A 5LGXA 5DT5A 3H24A 3IJ7A 3H53A 1XCFA 2BGSA 1FXPA 3UWVA 3RLUA 2OGYA 4DXXA 5FD0A 3T05A 3G1YA 3IAPA 4C6EA 1JUKA 4CD4A 4PH6A 3QY6A 3AIUA 4JIQA 4MFDA 1UQZA 4C7GA 5M1TA 3SN0A 2ZBTA 3GC2A 4KKXA 3P67A 5G1MA 2ZA2A 4D6CA 3QQ0A 1BG4A 4IFKA 3EWYA 2FPVA 3CQJA 4B3LA 1BYBA 3DGBA 3IJ9A 1AW5A 1VPXA 1W8SA 1I75A 1LT7A 3ZVIA 2ICSA 3UWQA 1EC9A 5CZ0A 6XIAA 2A3HA 4H4XA 3LNPA 3MZNA 5HMEA 1JUEA 5FJUA 3QFEA 1WV2A 3E12A 3BH4A 4NP7A 4JTRA 1OZMA 1B5TA 3UJFA 1EA0A 2CBUA 4NT0A 1M68A 3E2RA 3VFLA 4PL1A 7TAAA 3LS9A 2TPRA 1EOKA 4PRWA 5FF0A 4EANA 3SIZA 2OKTA 4ASTA 2DZUA 1ODZA 4UTJA 1ITQA 2BFGA 3S6DA 5G1YA 1GOWA 5C9WA 4NXSA 1Z48A 2NQHA 3BXWA 3CWOX 2A7NA 1TO3A 1EOMA 3AAMA 4AD4A 4M80A 3PS7A 2JK2A 2ZC1A 5U25A 4JY9A 4JQ2A 2AL1A 3IIZA 1MXGA 1TWDA 3WJSA 1UZDA 1QUMA 1ZY8A 3NSMA 1KC7A 1HUVA 4A2RA 2WP5A 3HG2A 3WQ4A 2PLJA 3NFUA 3HO8A 4Q7NA 2R14A 2E8YA 3GC4A 4E2DA 1DWAM 1IXQA 4JCMA 4QDMA 1RAKA 3QMTA 3RAOA 4NU7A 2PWGA 1BWLA 4MADA 2CHNA 3RILA 2OPJA 4DB7A 1RK6A 5A6BD 3TMQA 4DZAA 4NAFA 4XAGA 2OODA 4HSHA 3HRDC 3C8FA 3IK4A 4RR4A 3BAWA 5KETA 3AU6A 1V4YA 5HQMA 1DWFM 5DY3A 3RO8A 1BSLA 4UIOA 4DELA 3BICA 3WUFA 3BMVA 4GFSA 1TG7A 1BVZA 3GXIA 2XGIA 3W7PA 1QHPA 4KGJA 3RPTA 4A22A 4GXMA 1N5XA 1FEAA 3W7JA 4XBKA 2FPTA 1XINA 4NJKA 1IWPA 1E4LA 3LCXA 3M0IA 3KHJA 3ZLFA 4C6PA 4CD5A 4DM2A 1O94A 3KOXA 4GY0A 2PI6A 1XDLA 3LPFA 1R87A 1ZENA 2VMFA 3GBDA 1TWSA 3NQCA 1IF2A 9RUBA 1J9YA 1EGVA 3SCTA 4FOJA 2D0FA 4D6GA 3G3DA 3TAKA 4US6A 3RDKA 2GDUA 2GWNA 3DXIA 3EDKA 2Z2UA 4NZ1A 5FF3A 4LJ3A 4MB5A 3H21A 1HKJA 3PY2A 3PWGA 3WY1A 2VRQA 4BQ2A 1PX4A 5DCDA 2QULA 4HCHA 5AYYA 3S9ZA 2W5FA 2ZZ1A 3E1F1 4KFNA 1J79A 2X1IA 2FH8A 2ZRWA 5F4WA 4QAWA 3RN6A 3B40A 1V7YA 4RNHA 4QSHA 1W1VA 3TYEA 3E96A 2D0GA 1JULA 3S5OA 1UW9A 3ITYA 1O12A 3O05A 3WLRA 1L6YA 1GVYA 1KTBA 1UP0A 1X98A 4L1WA 1NP0A 4IXHA 2CLLA 1F8MA 3NL5A 3S46A 4CCDA 1PCWA 2Z1XA 2VR5A 4LCSA 4EM3A 1STZA 4ZSUA 3WQGA 2X0SA 4CUCA 1E43A 2AGTA 5KZEA 1E9IA 4F9JA 4QLLA 2WB5A 4K3ZA 4H00A 1QW7A 1N55A 1RCQA 4R3UA 2VEFA 1KN0A 4U2YA 3G0SA 3U2OA 3TV8A 4ADUA 2EKGA 2YA2A 5BOOA 2BODX 3PULA 3TMLA 3NWRA 1UWUA 2V8ZA 1YPFA 3SCPA 3W7QA 4K38A 5JVLA 4G7EA 3T2PA 1UH2A 3W7OA 3QTPA 3W2UA 4DJED 4C1KA 2ZCGA 3H7RA 2PDKA 5G4EA 2PE4A 3WN6A 2CPUA 3GFXA 3W1MA 3E0WA 4IFOA 4NRRA 3OVQA 1LOLA 1OFEA 2E6YA 3O1NA 1TJ0A 1BF2A 4CVWA 2ZYFA 1J0IA 3I7SA 3SECA 1Q8JA 1CLVA 3TNBA 1KO0A 4MJMA 1CXEA 2DW7A 4DYKA 4JS3A 1Y5XA 4TX8A 4CCEA 4JKLA 2X42A 2QCMA 4AYSA 5E9XA 5CH9A 1M6JA 4UWMA 2HK0A 4MAZA 2AOSA 1B4EA 4OTKA 3HG5A 2FJUB 4MFEA 2P53A 3MP3A 1A4MA 3MKKA 1Y5VA 5DRCA 2E9BA 1R3QA 1AJ2A 3GO2A 3EEZA 3RGTA 3DYMA 3IGUA 1GQNA 1JYNA 2CZVA 3L12A 4S3EA 5D09A 1K8CA 4AMAA 4KIRA 3VDAA 3AUOA 1RZMA 1Q6RA 2ABBA 1BGGA 3C2RA 3WJXA 6A3HA 1HN1A 5E0CA 3BLOA 1XXXA 3VKAA 2CHRA 2P88A 1FKWA 3QHNA 3W37A 4B5TA 2DZPA 2WBKA 4O4WA 1F2JA 1UQYA 4H9MA 3THCA 3SZ8A 2NV1A 1XYFA 3I4KA 4MGGA 1DE6A 5I24A 2ZX8A 4DI8A 1GHSA 4L4PA 1JNEA 4P2VA 1HKIA 1TB3A 3R4IA 3KAOA 3EXRA 2DH2A 2DT3A 3IVTA 2YCLA 4GYPA 1J0ZA 2WMHA 1TV2A 3PK7A 4HTBA 4AU0A 3DFSA 1S5TA 2G41A 3GKAA 3K4WA 4ZSTA 1ISXA 1GPWA 1KFJA 1S2VA 4IQLA 5HXMA 1W3IA 2YCEA 3U7VA 3RUBL 3R43A 5K3VA