4KWSA

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
403
structure length
397
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVAYEPADSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-mannonate dehydratase
publication title Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with Mg and glycerol
rcsb
source organism Chromohalobacter salexigens
molecule tags Hydrolase
total genus 150
structure length 397
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4kwsA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4kwsA01
2QJMA 3DGBA 4MMWA 3D46A 3DEQA 1YEYA 4ROPA 2AKZA 4GISA 3R0KA 1EBHA 5BOEA 3OP2A 3NXLA 1R0MA 2QJNA 3B97A 3FYYA 3P3BA 2GSHA 3ZLHA 7ENLA 2XGZA 2QGYA 3GY1A 4J3ZA 4JN7A 4IL0A 3RGTA 3V5FA 1IYXA 4HYRA 3R1ZA 2PCEA 3SN4A 1JCTA 1MNSA 4JHMA 2AKMA 3QPEA 3OPSA 3TQPA 5FJRA 3UJSA 3CYJA 1JPDX 4GGHA 3DG6A 3JW7A 3T6CA 3RRAA 2OZ8A 2O56A 2PGEA 4DYEA 2PPGA 1SJAA 1TZZA 3VA8A 3TJIA 2PP1A 3MUCA 4GFIA 2CHRA 2XH7A 3D47A 4G8TA 3H8AA 4G7FA 3DFYA 2MUCA 2ZADA 1TKKA 3DFHA 5IDZA 3ENLA 2PA6A 2PU1A 1P48A 3UJRA 3ZLFA 1SJBA 3R10A 4H19A 4IP5A 1L8PA 4ZCWA 3UJEA 1JDFA 3P0WA 2GDQA 2P3ZA 5J04A 2PTXA 4FP1A 2DW6A 2OLAA 2ONEA 3N4FA 2PMQA 1XPYA 2NQLA 3RO6A 2XH2A 3U4FA 2P88A 3EKGA 3QN3A 2OZ3A 3IJQA 2PP3A 1MRAA 3SN0A 3JVAA 4HCDA 2OZTA 4X2PA 3Q4DA 4FI4A 2OQYA 3SQSA 1TE6A 4K1WA 1FHUA 4E6MA 2QJJA 3ZVHB 4KWSA 4HCHA 3CAWA 4K8GA 2AL2B 3PFRA 3H7VA 3FVDA 5FJOA 3RR1A 2POZA 3MQTA 5FJUA 1XS2A 1ECQA 4HCLA 3IJLA 2GL5A 1JPMA 2OO6A 3SN1A 2OG9A 3T4WA 4DWDA 3Q45A 3UCCA 1KKRA 3N6HA 1ONEA 4HPNA 4IL2A 5EU9A 4DN1A 3FJ4A 1WUEA 4IT1A 2GGGA 2GGHA 4KEMA 1OEPA 3DERA 4A6GA 1MUCA 3UCDA 2PP0A 3ZVIA 3TW9A 3UGVA 2MNRA 4YWSA 5BOFA 4F4RA 1ELSA 3TJ4A 2XSXA 4MKSA 1NELA 3CXOA 3R0UA 4A35A 1DTNA 5ENLA 2PS2A 4DXKA 3T9PA 3OW1A 2PSNA 3TCSA 3VC6A 1SJDA 3GD6A 3S5SA 3DESA 3NFUA 3IK4A 4GGBA 3TTEA 2QDEA 1RVKA 3IJIA 3OTRA 1EC9A 4H2HA 4HN8A 3N6JA 1EC7A 3UJ2A 3VCNA 4M6UA 2PTYA 3H70A 4E8GA 6ENLA 3BSMA 3UJFA 4Z17A 3GC2A 3R25A 2GGJA 3T8QA 4GYPC 1MDLA 3QLDA 3KUMA 3PWGA 4GYPA 4IHCA 3DG3A 1MDRA 3OZYA 3MKCA 4KT2A 2QQ6A 3R11A 1KD0A 1P43A 4E4UA 3H12A 4E5TA 3UXLA 5FJPA 3FXGA 3TOYA 1FHVA 2DW7A 1NU5A 1R6WA 1SJCA 4ENLA 2PODA 2PU0A 3PK7A 3FV9A 3VCCA 3V5CA 3NO1A 3DIPA 4MGGA 2QVHA 3CB3A 1EBGA 4A3RA 1F9CA 3SSZA 4E4FA 3ES8A 4HNLA 3VFCA 4H83A 3ZVHA 4EWJA 1WUFA 2OPJA 3N4EA 3DDMA 4DX3A 3FCPA 2OQHA 2AL2A 2HZGA 3RCYA 1BKHA 2OKTA 3UXKA 4DHGA 2RDXA 3HPFA 3QKEA 2PTZA 2ZC8A 2PGWA 3GO2A 4GIRA 2P8BA 4H1ZA 2HXUA 3NZGA 3TWBA 3MSYA 3VC5A 1PDZA 1PDYA 4K2SA 2XH4A 2FKPA 4JN8A 3THUA 3MWCA 3I4KA 3VDGA 2I5QA 2QDDA 3CT2A 3ZLGA 3OZMA 3JZUA 3P93A 3MZNA 4IZGA 2OFJA 3QTPA 3PWIA 3SBFA 1KCZA 2XH0A 3STPA 3V4BA 4ZA0A 4Z1YA 2HNEA 2OX4A 3DG7A 3BJSA 3SJNA 4IP4A 3RITA 2FYMA 2OVLA 3EEZA 2P0IA 2P8CA 5FJTA 4J1OA 1EC8A 2HXTA 4M0XA 3U9IA 3S47A 4KPLA 2GGEA 3V3WA 1KKOA 3TWAA 1W6TA 1E9IA 3ES7A 2AL1A 1BQGA 3MY9A 3BOXA 4HNCA 3K1GA 3I6TA 2PTWA 4GMEA 3I6EA 2GGIA 3CK5A
chains in the Genus database with same CATH superfamily
2GVGA 4MADA 3LHUA 1ZSXA 4OT7A 3M0IA 2CLLA 4PCSA 3ITCA 4CNOA 3L4YA 3NXLA 1A5SA 4LY4A 3K13A 5LGXA 1J79A 1E6PA 3BCJA 3CQHA 1K8YA 4KCWA 1I2NA 4QP0A 1NPXA 2C1HA 3SRHA 3RGTA 2REQB 3IEBA 4EK7A 1QR7A 3N3MA 5I02A 3ARYA 2V63A 3WL0A 2V2CA 1KNWA 3CMGA 3W2KA 1QK0A 2TYSA 4HNOA 3DG6A 3JW7A 1BSIA 1NOFA 3R7MA 4GJIA 3L66A 2PGEA 4H41A 3TFCA 3E0LA 4H4SA 2CLOA 4Q4MA 2ZUSA 2QPXA 1VLWA 4GCXA 1L6SA 3EWBX 1YE4A 1CXEA 4IIBA 1J0YA 1YE6A 3H8AA 1XRTA 1EL3A 3THCA 4AY7A 4CU8A 4OGZA 3S4TA 4A8IA 2PU1A 3L4XA 1P48A 4GNVA 3GXDA 1UD4A 3ZLFA 4YXGA 3GHUA 4FIQA 1GZJA 1HVQA 1UKPA 3IIOA 3LSBA 1CGTA 1GQLA 2ZX7A 4LF2A 4JIQA 3ZM8A 2VFIA 3TONA 4A3HA 1DYSA 1OCJA 3QR1A 1PZ2A 5KINA 2NX1A 3IJ7A 2GDQA 1ZLPA 2QCGA 4PH6A 4Y8EA 2WB5A 4N6FA 3UPBA 1X8FA 3B40A 3TOPA 4KH2A 7PTDA 2R6OA 4B5XA 1QO5A 1E55A 5M2FX 4N7QA 1CPUA 3UR5A 4DF1A 3FDKA 2ZZ2A 1F61A 1WDWA 1V0LA 1Q1WA 2X42A 3NZQA 1V5XA 4NI3A 2QV4A 1TVNA 2BTMA 3PWAA 4TIMA 3F7JA 4AMCA 2PLKA 3ECQA 3TJLA 1J10A 5F4XA 1V02A 3GXPA 2W62A 1B9BA 4Y6GA 1X6UA 4FK9A 4XO6A 1ZENA 2WHJA 6ALDA 3CAWA 3DECA 3ZJ6A 5TR3A 2JIEA 4JPGA 1YDOA 1JF6A 1NAL1 3AHXA 9CGTA 1JQXA 4ZODA 2YVGA 1DOSA 1ZKQA 4HYWA 1KXQA 1X6LA 4CVUA 1XIMA 2GK1A 3STCA 5CJ5A 2GJXB 3VO0A 2J7DA 4H4IA 2BY3A 5JVLA 4LRSA 3DH9A 2I17A 3CAKA 1XGDA 3GH4A 1M6IA 4JR5A 2IQ0A 2Q8ZA 3MMWA 2YFOA 4F0KA 5AY7A 1R3TA 5ABHA 5CSSA 3S1WA 4CD7A 5I3IA 1Q85A 5U7SA 4Q7IA 1D3HA 4CQ9A 4ACZA 3ARTA 5EMJA 2VEGA 5CH9A 4NJKA 2XU2A 1JAKA 4IF2A 2Z1KA 3R94A 4LUTB 1HXJA 2W0UA 4GD0A 4JDRA 3LHVA 1V0NA 1Z42A 3ATYA 2VT0A 3A9BA 1M6JA 1XCFA 1RBAA 2WM1A 4GR1A 5AC4A 3OBEA 1EDGA 2KAUC 1I60A 3PPFA 3UJFA 1AH3A 3W07A 3VIJA 4OQVA 4D6DA 1F74A 3EMCA 4GWEA 3BAIA 1XBXA 3ANVA 2O7SA 2I1OA 1IF2A 4GK8A 2ZX6A 2JGYA 2YDSA 4EMWA 5KETA 4BK9A 4J27A 2D20A 4JQ4A 1OFQA 1O4UA 4LBRA 2VMFA 4TU1A 4WKFA 4J3XA 1A4LA 4YWOA 3KCLA 4Z0SA 2DW7A 3Q37A 1LG1A 2YW4A 1LJYA 3ITTA 3KCOA 1VPXA 2GDUA 4UZSA 2V67A 3WLNA 4IFKA 3F4NA 2XUCA 4GVGA 1NY1A 2QR6A 3QW4B 1KCXA 5I78A 1FKWA 1O5KA 4DBSA 1VD6A 4H83A 3UZWA 1R2TA 3PB0A 1IEIA 2NXHA 4ZZ9A 3CHDA 4FSAA 4UTLA 3W88A 3EANA 5LNWA 1S2TA 3BZJA 3GXFA 3HPFA 2VGIA 2NQ5A 4UMCA 3TH6A 4YTUA 2C16A 1HGWA 3RM4A 3LHYA 2QAEA 2DJXA 3NZGA 3RU6A 3T1GA 1GONA 4JYDA 4RNIA 3STGA 3MPGA 4AWTA 3WN6A 3G6MA 1KBBA 2Y89A 2WZHA 4DZAA 4L4PA 3REQA 4KPRA 2Z1WA 2J9YA 2XN2A 1UG6A 4MAVA 3OZMA 1LG2A 2NQZA 1K9EA 3WKZA 3SQLA 1UA3A 2VP8A 1UP3A 1R5YA 1E0UA 3NQMA 1N62C 1EBDA 3R6IA 1FO4A 1E9YB 3QJAA 2GYIA 1FH9A 4L6OA 5TD4A 2HS8A 4PZVA 3L2MA 4LAMA 3SR6B 2FYMA 5K2ZA 3BCFA 3NA8A 1F07A 1C9WA 4V28A 5D04C 3WJZA 4Y9AA 4XQ6A 3WLSA 4ECLA 4PSPA 3RHGA 3CIVA 2PF8A 3W7JA 4IPLA 1H51A 1M1BA 4DRSA 5H91A 3ORWA 5FF3A 4B2DA 1UWIA 3D46A 2OYMA 4ERGA 4WKAA 4WSJA 3DJGX 2PDIA 4IISA 1NDWA 3HGRA 3ZT5A 3BMWA 3SFKA 5HWJA 1L9WA 4JY9A 1G67A 1R2RA 1O68A 2VEFA 2VUNA 3TQVA 4NIRA 3TP4A 1JDCA 4EIVA 3CZ8A 3GY1A 4F66A 2FGZA 3FFSA 1XIFA 3V5FA 1MXGA 4C7DA 5CGMA 4D6GA 1MI3A 2RHGA 2H3BA 3VOGA 1V3LA 1OINA 1KFWA 2WVSA 3TXVA 4OKDA 5FJRA 2PAJA 4GGHA 3B05A 2FPVA 3I3DA 3NQAA 5FOOA 4FXRA 1W5NA 2J7GA 3PPCA 1GRGA 3O8AA 1X7IA 2EKGA 2X1UA 4FLQA 3MUCA 5HPCA 3V1HA 4FR1A 5DO8A 1R7AA 2VDIA 4JKMA 2VC9A 1JPHA 3OHIA 1RCXB 4UNKA 1F3XA 3VUSA 3VYLA 4O14A 4G9PA 1UHVA 1T5AA 1H11A 2PA6A 5G5GB 4IWWA 2B7QA 2ATSA 3KL5A 1XX1A 1E15A 3ME3A 7ODCA 1GJWA 5CC6A 1BVWA 1CXIA 5EYWA 2QMJA 4ZOAA 1RBOB 4NKCA 4W87A 1PS9A 1JZ4A 3PUOA 3MUIA 1A49A 1MW2A 2QJIA 3FK4A 3BARA 1GYNA 2FZMA 3S5ZA 1SM9A 4LPCA 4ADSA 4OHQA 1FUYA 4DIAA 1T40A 4GFSA 3DXIA 3WUGA 3CYVA 3MV11 2VNCA 3KLKA 2XGIA 5EMYA 3VIHA 2PDQA 2CZEA 1W8GA 1LOSA 3L5OA 3PPHA 4TQTA 2AGTA 1E0VA 4FI4A 3SQSA 1AFSA 2X1SA 4M24A 2QXWA 1E4IA 3L0KA 1R3QA 1XFBA 2O9RA 1XLKA 5E1QA 1G4SA 1D3GA 1PIIA 3QY6A 4W93A 3UA4A 2CESA 1ZHAA 1UWRA 3V36A 3W2LA 1OCQA 4EM4A 4AQLA 1YDYA 4B90A 2XHYA 1S1RA 5HJLA 3SR7A 2VWSA 5I3KA 5FJUA 1VEMA 3PS7A 1VYRA 3IJLA 2NQJA 4NZCA 3A7UA 4EQXA 3OZOA 3SN1A 4DYKA 2OG9A 1PO9A 3BLPX 5CXPA 2GLKA 3M41A 3NQVA 2Y7FA 2OWXA 1V59A 2PTDA 2J4GA 1XLLA 2RDTA 3NVTA 4MWAD 1GOWA 3NZ1A 3WK2A 3SUVA 1LQAA 2VC7A 4C6KA 3NRZB 2UY3A 1SYTA 3CGCA 3VPLA 1UWSA 3P2VA 4AVFA 5AYZA 2UWFA 3GNPA 4IPPA 3RK8A 3BWWA 3H4GA 3HPSA 1OFOA 3TMQA 3PN8A 3ABQA 3IJ6A 1LBFA 3Q94A 3W75A 1Z3NA 1J2WA 2WP5A 1XH2A 3W23A 5A6TC 4MZ1A 2W54A 3Q65A 3TCEA 1IXOA 5I3GA 3MBDA 1G9HA 2Y2WA 3TAOA 2QDEA 4GY7A 4LANA 1WDQA 5AOUA 1HFBA 3SGZA 1HT6A 1SUXA 4HN8A 4XISA 3WLPA 3WY1A 3KWSA 4DB7A 1FP8A 5F4WA 3TNOA 1J11A 5E6YA 3STFA 4IIFA 1VP5A 5TQLA 3BUVA 1JZ2A 1W56A 3WD0A 4HU3A 4R7WA 4DWSD 3GC2A 2R1LA 3L4ZA 4PFHA 4Z1BA 3LHTA 3DBNA 2QW5A 3AISA 3WQGA 4HQVA 1V6YA 2Z2UA 5D8ZA 3FNDA 1E9ZB 3NAVA 3OBKA 3MP5A 2PDPA 3MKCA 4LS2A 3W24A 3N29A 3RLGA 3N14A 1KD0A 1OX6A 4E5TA 3UXLA 4S3AA 3WEOA 1RZMA 2O7QA 1KTNA 3MUY1 3PJWA 1FA2A 1PZ3A 2BGNE 3T05A 1MRQA 2ZUMA 1J6OA 4XKMA 1ESWA 3W82A 4ENLA 3W74A 2BWGA 3A6OA 1GRHA 1DHPA 5C9RA 5F2GA 1CZ1A 3TC6A 3PUEA 3DIPA 4ZVJA 1ADSA 4K6AA 2V3EA 3W71A 2ZFAA 1E40A 3ZVHA 3BV7A 4H8UA 3LM7A 4S3EA 4PA8A 4O18A 3R43A 1EGZA 3RCYA 3BG5A 3U4AA 2PLMA 4DEFA 4KWOA 3BO9A 3QKEA 4GH1A 2XINA 4JTCA 3KHJA 4V1YA 4H4WA 4JFTA 4H1ZA 5M3WA 1QOXA 3GXNA 3TN6A 1QHOA 1L2UA 3EBVA 4LEQA 3THQA 2B7NA 2FHBA 5U25A 4PUEA 1PE1A 2CBIA 4OOZA 1E5NA 4J2PA 3Q67A 3UERA 4LYPA 3VDGA 1OCNA 2I5QA 2QDDA 4LUSA 4P2VA 2C7FA 4KGJA 1C9DA 2WSQA 2WVVB 2RABA 2OFJA 3QTPA 1ZPTA 1OSEA 2EGZA 2I5GA 1Q6RA 4EOUA 1H60A 2VO5A 3K4AA 4A21A 3ABRA 3LRMA 3GC4A 2DT1A 2AAMA 2HS6A 2C1GA 1UPPA 1W1B1 4CEUC 4IP4A 3TK7A 4UFKA 2IPWA 3WH9A 1XGEA 3CPUA 3WD4A 1MQPA 3B8DA 3CC1A 3BG3A 3PG9A 8A3HA 2DSUA 1CLVA 3UPMA 3TWAA 1W6TA 2V68A 4A22A 1E9IA 2QDGA 2WLYA 4HNCA 2RFGA 2ZICA 4QE4A 3I6TA 4CNTA 3FXYA 1XYZA 4JTJA 4BF5A 2G3FA 1TJ2A 1WDRA 1GPFA 1GQNA 4D8LA 4H7CA 3RO8A 5BOEA 3WK1A 3P5YA 3BGJA 2HCVA 3WZ0E 3BANA 4KESA 1MNZA 2ZTKA 2DSZA 4QISA 3EX1A 1A5MC 1EZ2A 1OCBA 1RA0A 3IARA 1K03A 4K7YA 4PMOA 5H8UA 2XTKA 2D3NA 4MY8A 2ZBTA 4C6DA 4I9AA 2OODA 2W6RA 2OLSA 1JPDX 4GINA 4AD5A 2O0TA 2OYKA 2CLMA 4JFUA 2O56A 4BQ4A 3AWNA 4ROQA 4S3JA 1E4LA 3A21A 3HQNA 4JDYA 2GRTA 5D37A 4DXVA 4GFIA 2CHRA 3H4WA 5G2HA 3GRTA 3R12A 2WMFA 3TYUA 1BLIA 1QNPA 3IVSA 3C8NA 4ERIA 1S38A 1WYIA 3O15A 4I7UA 4IMEA 1M7PA 3P62A 2I7GA 1MUMA 4YLWA 2DT2A 1ZBKA 4LEFA 3KXQA 2HV5A 5GQBA 3WH6A 2WBKA 1XFCA 1F7BA 1F6PA 1ODZA 1F8IA 4DJFA 1XG3A 3N15A 5K3VA 2Q8XA 3AIBA 1W1IE 3CV6A 2ALDA 1B30A 1YBQA 1TE1A 1XSJA 4NAFA 1V03A 4IJRA 5ECVA 2OLAA 5BXRA 2RDUA 4PBGA 3SCWA 3B8VA 2PC4A 3A13A 9XIAA 2BGSA 1EJRC 3UFYA 1Y5VA 3QN3A 3CGTA 1IIHA 1GOIA 2D69A 5CG0A 1TG7A 1WP6A 2XFWA 3L4UA 2D2HA 3JVAA 4I7VA 2X16A 1GEUA 4QTGA 3OYXA 1TV2A 5D2TA 3PF3A 1YMYA 2BASA 4AIOA 1NFBA 3PFRA 1GORA 4NQ1A 3VX0A 3ZJKA 3I3BA 2A0NA 1V79A 4FLRA 5XINA 4QNEA 1XRFA 1W37A 3QV8A 1ISVA 3C52A 4AEOA 3NL6A 3O9NA 3KS5A 4GBDA 5D09A 1O1ZA 4WZHA 3VE9A 4WIWA 1GKQA 4YVVA 2PWHA 3T4WA 1RK6A 5CBJA 1CGXA 4H00A 4UOZA 4WOZA 3NPUA 2VOMA 1WOBA 4U5IA 2W3SA 2CDUA 5BROA 4O13A 4QM1A 2HK1A 4TXEA 4S3GA 5EPDA 2Y6ZA 3CMJA 1XANA 4XZMX 3HGJA 1XLHA 4C6JA 3IUHA 1K8XA 1JIBA 4AWEA 5EMKA 1G4TA 5F7UA 3RX3A 3CXBA 3FGCA 4MY9A 1K7EA 5C55A 4QBXA 2GJXA 3PC0A 3EDEA 1NELA 5ABGA 4O1CA 2EPKX 3XIMA 4GX9A 3FN9A 5ENLA 5I3DA 4HMNA 3BV4A 2DZAA 3KM8A 4AEFA 4H01A 2PSNA 2X09A 1ZAIA 2BZNA 2DT3A 3KRBA 4GACA 1N7KA 1OGSA 1P0EA 3L4WA 2QNEA 4AZ7A 1D8WA 1HKVA 4YIWA 1Q65A 4Q4OA 3N34A 5JMUA 3NNTA 5XIMA 5IHRA 4H4YA 5MKGB 2PDFA 3RG6A 3VM5A 3WQPA 3NYZA 3WMSA 4Z17A 4H4XA 1GTHA 4LJ3A 2V3AA 4Q8QA 1DWJM 1OABA 4LGXA 1X97A 4MHBA 1ZQ5A 5CLWA 3PSWA 2E6FA 2W67A 1JPKA 3W7GA 3S9ZA 3NQ8A 5KZMA 1CYGA 4GIEA 3FYPA 3RM9A 2YCIX 4RK8A 1Z48A 3AU2A 1H63A 1ZCOA 3OOQA 3PY2A 1N55A 1H49A 1FHVA 1JRPA 3AIRA 1ZY8A 3W1RA 2F2KA 1FWAC 4NAEB 4FAMA 3FV9A 3DI0A 1RPKA 4JICA 4PUNA 4HN4A 1FVPA 4PTVA 1PCWA 3C86A 4MGGA 2ISSA 3MP4A 1P1MA 3LN3A 2C0HA 1GZGA 3W1AA 4M5PA 2V0TA 2BY0A 2Y7EA 2HK0A 3I65A 4NT0A 1DJXA 1QNSA 5D9MA 4HYVA 1RJQA 2VUYA 1SO5A 5C2XA 4KCVA 1KO0A 5A8GA 3HZ3A 4JIIX 4MNKA 3G8RA 3BAXA 3B8IA 4TVWA 3CB8A 5AHLA 4DBDA 2ISVA 4Z1CA 2AAQA 2WMGA 1KGXA 4QDWA 2ZZBA 4C5ZA 4B5VA 4UOJA 3VC5A 1BXCA 3AXKA 3QPZA 3BAWA 2EG6A 3MDWA 2ZOXA 2BVDA 3LB8A 2W55A 3O3RA 4XX6A 3DFTA 3WQEA 2G4JA 1OT2A 3JZUA 1F2JA 5AHIA 4NI8A 1W1PA 3P93A 1AZ1A 4MFDA 1KWGA 5I00A 4IQJA 2VYOA 3SBFA 3W7DA 3HG2A 1J93A 1P0NA 9RUBA 3AYSA 5DLCA 1CXHA 1GV4A 2P0IA 4HP5A 2P8CA 2VZTA 2YBVA 4M0XA 2NWRA 1A53A 1R86A 4W7WA 3OYZA 3W25A 3KFTA 2FHFA 3ZXWA 5K9DA 2VCBA 1BQGA 1XIDA 1LBMA 5T26A 4N2YA 2WJDA 2DVTA 1H0IA 4JTEA 3NJ3A 4H8NA 1HO4A 3MWAA 1OFBA 2I16A 5D05A 3IJ8A 3RPTA 4ZFMA 1EBHA 5C54A 2ZZ4A 4ADWA 5HXMA 4PL2A 3TN3A 3HB9A 3QSRA 1AMKA 1DIDA 3LTPA 7ENLA 3BH4A 4G7EB 4X9YA 1GRBA 2EHHA 4HYRA 1M01A 1NF0A 3HOJA 2FHCA 3WLRA 3MO4A 3LG3A 1RALA 3CQJA 1XP3A 4AC1X 1TWWA 4M82A 1ZJAA 1TPB1 2E8YA 2J27A 4AHPA 4HK5A 3ALGA 1QTWA 3FJLA 3VZYA 3CH0A 4Q4RA 1EGVA 2PPGA 1W3NA 1SJAA 4IFOA 3A24A 3CV1A 4UR9A 2D0GA 1SFLA 4JL2A 3N2MA 3VNDA 1EQCA 4ZOHB 4W84A 3AS3A 2NZLA 2Y8UA 5CSRA 3LI1A 5GNZA 5A5WA 4A8RA 1HJQA 4G1KA 4PMDA 4UFMA 1JD9A 3AS2A 3BAJA 1M04A 4NG3A 3WBYA 1CLXA 2QULA 2H3DA 3QV9A 1OJTA 3VGDA 4AVOA 5BXPA 2VDHA 1JI2A 3S83A 3WQOA 4JY8A 5AB3A 2ZCGA 3RNDA 4FALA 3PNZA 3DAQA 3OO2A 6XIAA 3DC0A 3TIMA 3PULA 4MAZA 1U83A 2J7BA 3AIEA 1FDYA 1VS1A 2J13A 3SI9A 2OT1A 2VM8A 2NX9A 2BOFX 3N2OA 4BKNA 3FAWA 3T2PA 3UZZA 1Q6LA 1XCWA 1KM6A 4K1WA 7A3HA 2DV0A 4AY1A 2GR3A 3I7RA 3QV6A 2H8XA 4P7RA 2WSRA 2DH3A 5C9ZA 3VIPA 1WXYA 1TPC1 1DIOA 4PULA 1UUMA 4UTFA 4K8GA 5A69A 2JKEA 2DEPA 3PBVA 2QYGA 5G5HB 1RY8A 4NZ4A 3RR1A 2QAFA 4M1BA 5AHFA 2NV1A 4JFVA 3GYCA 4NXKA 3CU2A 3QC3A 4U33A 5DCEA 1HIZA 1N5WC 3LCXA 3A12A 3O06A 1RUSA 3EWUA 1KRBC 2L5HA 1UJPA 3VOHA 2YBUA 4PTWA 1HL8A 3II1A 1EUAA 3MVTA 3PBMA 4IT1A 3GD3A 2O4MA 4XKYB 1CCWB 4A6GA 1KRCC 1TPVA 3ZVIA 3I6RA 4EACA 5ABTA 4KEVA 2W4XA 5C2CA 4ZXOA 1ELSA 2JKPA 4TTUA 1QMLA 3W37A 2HPIA 4DXKA 2QUMA 3T9PA 4AYGA 4QGCA 4RZBA 3SEPA 2P53A 4ZB0A 5LNSA 3TLQA 4UTJA 1IEXA 3KW3A 1JUBA 3TEVA 1KGUA 3NZPA 1PV8A 2A1YA 3WLOA 3P8IA 4GOAA 3IJIA 4UTTA 3OTRA 1RK5A 4TX9A 1EJ7L 4H9YA 1DJIA 4CCCA 4C1LA 3NQ6A 4M6UA 1JD7A 3VZXA 4H4ZA 1RQBA 3U2CA 3LCLA 4D2JA 4E8GA 1XICA 1RSCA 1KR1A 5A1AA 2Z1VA 4FNRA 3WUFA 3MCMA 2AOSA 3A5FA 3GVRA 3QVQA 4E8DA 1QWKA 3HPZA 2OU4A 4PUWA 2QF8A 1NQKA 3ITVA 4XIMA 3FAXA 3IPWA 2DH2A 2YYUA 3ANUA 4LYKA 4AZGA 3EX6A 2D22A 4H9VA 1CGWA 3PUDA 1O6IA 1FTXA 1I0BA 2XFYA 3DHUA 4H6QA 3SGUA 2PRLA 4C7FA 1WDPA 1TPEA 3W6MA 4PCNA 2FPTA 3PG8A 4H4TA 1NU5A 3DYOA 4J35A 3UWYA 2Z2BA 2BXZA 1X1OA 4HSNA 3UNDA 3NO1A 5DMLA 1YPIA 4L4OA 4ML4A 4DZIA 2PRMA 3CH9A 3KL3A 2A79A 4W4QA 1F9CA 4E4FA 4IMFA 2ESCA 3LTSA 2Z29A 4O54A 4LS0A 4V33A 3AALA 2EPMX 2FMOA 1GOMA 3AHTA 1E9LA 2WCSA 1E3ZA 3DX5A 1M53A 1TPUA 1UR9A 3TN5A 3W7CA 1EOMA 2OKTA 3N4AA 4AG0A 2EPLX 3WCZA 4BHYA 1MXDA 4TOQA 2F6UA 2Y61A 2ZC8A 3HW2A 1VFLA 3H54A 3CWHA 3CQIA 1ZXIC 3TA9A 1JPIA 3BLIA 3VI2A 4GVFA 2J7EA 3BOFA 3N2BA 2O55A 3TR2A 3NSNA 1DIEA 2DQXA 2WNWA 1IHIA 2FKPA 3IUDA 3QRHA 4X60A 1LRQA 1YDNA 4FOJA 5FSEC 3RUBL 8CGTA 1F76A 4NJJA 3GUWA 2PLJA 4N42A 1TPDA 1VHNA 2YB4A 3QHOA 3KOZA 3C0LA 3GVQA 3AWOA 1ADDA 3T40A 2F61A 5E6ZA 1W3JA 2P76A 1LCOA 3WD2A 3DFOA 3BSGA 3M0YA 1KM4A 2JGQA 1AQHA 1G7UA 3EKZA 4Z1YA 1B54A 2HNEA 1FWHC 1EP1A 1XYAA 3IACA 1XRSA 3N04A 3VGBA 2VXNA 4K36A 4R34A 4JTDA 3CPRA 4LBUA 1LRTA 2ACSA 4XG1A 1GJUA 2DU2A 4UTWA 3KOWA 4AAJA 2WCGA 1GT8A 1OYAA 3S1VA 3EWZA 3V5OA 3VNLA 2J77A 5HMFA 2YLLA 1YXCA 1GQJA 2WYSA 4RV3A 5FAJA 5D9OA 4WEVX 3XISA 1KWKA 5JUVA 2PBGA 3R0KA 4UCFA 4C6PA 1V4YA 3GU9A 4QXIA 2PWEA 3EB2A 1UD5A 1FWBC 3CMFA 3C6CA 4GUFA 1DEDA 3WBAA 2GSHA 1H41A 4LCSA 4WSKA 4H04A 1M7XA 4U3CA 3II4A 3WQ4A 2VX7A 2GUYA 4IQLA 4C1NA 5LNVA 4JDBA 5CZJA 3KDOA 4XZWA 4AXNA 1QPNA 2VL4A 3LMYA 4US6A 3IS4A 1NFPA 4MFEA 2VR4A 3SN4A 4GE8A 1WBHA 3RLHA 3MT1A 4XZBA 3TQPA 2ZA3A 3FHQA 2WC3A 4CNNA 2PDBA 4EWND 5HJXA 1J0KA 3NVWB 2YXXA 1ECEA 1WAUA 1AA1B 7TAAA 1OF8A 3NSXA 3E74A 3NL3A 1U22A 2W66A 3LCHA 1GVEA 4MSSA 3QPYA 3CTTA 4WJ8A 2XN0A 4P5UA 2NLYA 5LHEA 2FB3A 3GKAA 3LLXA 3GHRA 2ZUNA 4PTNA 1UROA 1JXKA 2Z00A 1Q6FA 5E93A 2C13A 1PCKA 1ONWA 3QKZA 1K02A 4X9SA 1SGJA 3HPXA 3DYMA 3OLDA 1O5RA 5I0DA 1UD3A 3ZIZA 4E3TA 2QDHA 3JS3A 3PZOA 2DZSA 5LZLA 3T0TA 3VGHA 1PJ9A 5J04A 4CQ8A 4QEHA 1VBRA 4E0CA 3VD7A 3ALFA 3JU2A 2VGFA 3E0FA 5FL1A 1ZP4A 3R8RA 3WDIA 5EKYA 4I6KA 4LUYA 1G6CA 1FFQA 1KXVA 1RP8A 3E5PA 2ZE0A 2ZWYA 3CNYA 1BXNA 3ELFA 1ZBCA 3EOSA 1FHUA 3GS6A 1UH2A 3W6LA 1T8QA 4ADTA 1L6FA 2P0OA 1XRVA 4Q8UA 1WZMA 3KTSA 1H2JA 1V6WA 4LB4A 3WQ8A 2AL2B 1IZJA 2VCAA 4M6QA 1O66A 2YZRA 1FWEC 2H8ZA 3ITXA 5LNRA 1XLJA 1KM0A 3A9IA 1GW9A 3QQWA 3P8JA 2BCPA 2JFEX 1YQ2A 2PF0A 4GBUA 2OCZA 1QI3A 4I9JA 1S5TA 2CERA 1D3CA 3WDRA 3VD4A 4O19A 4RNJA 3UVIA 4HT3A 4DNHA 5C8BB 3K8LA 1UQYA 5FSDC 3FJ4A 2VI0A 1OIMA 1IE7C 3VABA 2VZUA 3VDAA 2FVMA 4F3HA 4GI4A 2GGHA 5JCNA 3W7NA 1B1YA 3W7RA 4ATLA 4LSBA 2XN1A 3RIKA 4WRHA 2BODX 3MKVA 3TW9A 4GG9A 3AZSA 3OVRA 4PMUA 2OSWA 1EEXA 2XDFA 3NL5A 4YTTA 4A8NA 4MKSA 3O0HA 2W3ZA 4GJJA 4ZMGA 2TPRA 4F2UA 2QT3A 3GYEA 1TQXA 3BVJA 4MF4A 4BQ2A 4JEQA 4Z2GA 2NVCA 1I75A 4U5KA 3S9YA 3B04A 2WKGA 3M44A 4GGBA 1VKFA 3P6LA 2A3BA 3OJGA 5B7YA 3VIIA 4FIRA 1EC7A 3MBFA 1MO9A 1KV5A 5EY5A 1FP9A 4XSMA 2GDVA 3A3HA 5I3FA 3AUOA 3ABXA 3NXFA 3BMVA 5AVHA 3ICJA 1LL6A 3PTDA 1S5VA 4C5YA 6XIMA 3G22A 1PYMA 3AHVA 3AI0A 3EAOA 3LOTA 3HA1A 3R0DA 4CNPA 4U31A 1V08A 3RU8X 4OWGA 4H6EA 1XD1A 1AJZA 3FLUA 4GX8A 2INEA 1TR9A 4IMGA 4JHZA 1JI1A 2WV8A 1HJSA 4TMCA 1F8WA 3LRKA 3GW3A 3NZRA 2Y8VA 1R6WA 1B9ZA 2O9PA 3V18A 2WMJA 2CBVA 2PU0A 3VCCA 4C90A 3M43A 2Y7DA 2DUAA 2C91A 1ZMCA 3O6DA 1WXJA 1S3HA 1FFUC 1G01A 1TA3A 1OG0A 3LNMA 3ES8A 4O28A 2HMCA 2PDJA 4P8UA 3T0AA 1PHQA 3C4UA 3W1NA 1AW2A 3E2RA 3PTKA 4DX3A 4AZCB 2YW3A 5DMMA 2CBUA 4MTVA 3HGOA 4GZIA 3SCUA 4NAEA 4O8RA 4Y96A 3SRKA 1A47A 2PTZA 1V8EA 1CXFA 4MLJA 2PGWA 4GIRA 5DMNA 3MU7A 4C6IA 2VEPA 3LENA 3GHTA 1V6TA 2WCAA 3KBWA 4KFOA 3Q2DA 3EA2A 3MSYA 1EO5A 4KFPA 1E43A 5U4NA 1IXNA 3P60A 3G77A 4W5ZA 3I4KA 3M07A 2V2DA 4HB7A 2QIIA 4MVAA 3CT2A 4IPIA 1EPXA 3B4YA 1SSDA 3A3WA 4OIFA 1IIGA 1AH4A 4ICNA 4JTQA 3VKCA 5I09A 3QV7A 4NZFA 4AVNA 3TW7A 4U4MA 5I07A 1MYRA 4J2MA 4TVCA 2OX4A 2PWVA 4IIHA 5CJMA 3SJNA 2QUTA 4P7OA 1J0JA 3ZWSA 3GB6A 1FWTA 4UTWC 2NWSA 3ISIX 1A3HA 4O15A 1C3FA 1XC4A 3WG6A 1J12A 2FMNA 4DI9A 2A5HA 3VNYA 2ZZCA 1F6KA 4Q4PA 3LA4A 2ZIDA 3K1GA 3TFXA 2Z4GA 3AMLA 5DN1A 3S5OA 1TX0A 1J0IA 2I5IA 3EA3A 3J7HA 5AC6A 3UWWA 2GK1B 2ALRA 2DZXA 3U0HA 2FZDA 2QJNA 2HISA 3FYYA 1SFSA 1F05A 4HBKA 3G24A 1MSSA 1IZKA 3W29A 3LZ5A 2EAWA 1K6WA 3F4CA 4RR4A 2ZZ7A 4XD4A 1VQZA 5BU6A 3WQFA 3U57A 1BYDA 1NDYA 4BWLA 1DWAM 2AKMA 3L0NA 4GZEA 3SFWA 1KBLA 1TELA 2FDSA 2WMIA 3UD6A 4O16A 4BQ5A 1Q66A 3T6CA 4M7TA 1JZ8A 1K7FA 1TUXA 2WQPA 2VRJA 3UGRA 2WVUA 4IIEA 1W91A 4GPNA 2QMKA 1G69A 3UF9A 1IQ8A 3W53A 2NT1A 3AHYA 4JNZA 5DQPA 4L6HA 3SSJA 4HMDA 1CENA 4DQWA 1JFHA 1W3KA 5JH1A 3T8LA 1RLCL 1SZRA 1WZAA 2E77A 5HBFA 3WF2A 1QNQA 4B2DD 1XI3A 4F8XA 1JNEA 4G6CA 1FWIC 1TKKA 5IDZA 3L5MA 5DF0A 4QAIA 3IK2A 1FWSA 1I2OA 1VCVA 3N2TA 3G6LA 2PE4A 1YHTA 3WJXA 1FFRA 3N9KA 4IUGA 3GVVA 3W73A 1H7OA 3G8EA 3DFPA 4ORIA 3U5UA 3FKRA 4YCPA 2ATMA 3P14A 3LHZA 5J5DA 3W1PA 2F2HA 4E3VA 4IX2A 3U2OA 4IJBA 1H7XA 1Z44A 4WXZA 1SMAA 2YYTA 4O12A 2UY4A 3EXTA 1BEUA 1Q8JA 1EF2A 2C71A 4Y90A 2R8WA 1RJRA 2XH2A 4CU6A 4FPSA 2Q71A 3L2LA 1UR0A 4GXMA 3W70A 1HX0A 1NOUA 4XZIA 1LRNA 3T2QA 2XIIA 3ABZA 1U5VA 1TPH1 2AQWA 2WAGA 1F4HA 1TTQA 5RUBA 4E6MA 3ZQ9A 1M3UA 3ZR5A 5E9XA 4UQBA 4QSFA 3UZXA 3E02A 2ZXQA 3WYZA 1KC7A 4LA1A 3W4RA 3WLMA 1YW1A 2A4AA 3TYAA 2YXOA 1E5JA 4M7SA 2UBPC 5DBUA 2D3LA 3UQNA 2P3EA 5DFAA 4G56A 3DENA 5HUPA 4S39A 3U7VA 2VCCA 2HVNA 3GIPA 3IRSA 4XTIA 2BV9A 3STEA 1QASA 5EMLA 1V77A 1JPMA 4RW3A 3NEHA 2VRQA 3FDGA 3GTHA 2WJEA 4JTHA 4O1AA 4NJHA 2YA0A 1H61A 2YL6A 1P7TA 3CL8A 4KMQA 1FRBA 1Q7QA 2HNHA 4AIBA 3GDRA 3FOKA 1JULA 3T0BA 2X8GA 3OBAA 3EYPA 7REQA 2OR2A 3CWNA 4EM3A 3W85A 2DZVA 2OKOA 4NNAA 3D3FA 4GY0A 1WQ5A 4RDZA 1MUCA 3W01A 3OG2A 1BG9A 1ZY9A 4O17A 5FEPA 4RW5A 1KFLA 4A2RA 4F4RA 3M4HA 3KTXA 4DPPA 3GIQA 1JGMA 4POCA 3KRSA 4UOQA 4A35A 3W02A 3UR2A 2ACQA 3H55A 2O9TA 3IGSA 4FNUA 5LIUX 2DJLA 4GQQA 2PDMA 4FXSA 1V97A 4I5UA 1UKSA 4GO9A 1HVXA 2C14A 3SCVA 3U2ZA 4V15A 4H2HA 4PMYA 1UD6A 4WXYA 2ISDA 4DYJA 9XIMA 4UMAA 3GZ3A 1E0TA 1L0PA 1SW3A 1UW9A 3MYOA 5E0KA 3MS8A 3U7BA 1NDVA 4MY1A 3KVLA 3O16A 5ABFA 1DKWA 1V6UA 4ATDA 5DRIA 4D9PA 2PUZA 4AUBA 5FEXA 1FEAA 3NEVA 3RCMA 3SCTA 4HZ7A 3TC7A 2BHUA 3KLJA 3OLIA 3AMDA 1H3GA 2Y4SA 1EA9C 4PEEA 1Z8AA 4QRNA 1JRBA 3LX9A 3RYSA 3CEUA 4MPQA 3NQDA 2QGHA 1I45A 4MNLA 1FH8A 3OU8A 3PK7A 3TAKA 4UZUA 2YB1A 2R1PA 5FAGA 4M80A 3AMKA 5AECA 1A0EA 1P0BA 3LCWA 1TJRA 2E1WA 3NG3A 1J0ZA 2HVMA 2Q3OA 4Q22A 1T8XA 1VFHA 1XDMA 1LWIA 4UTHA 4YPJA 2FTYA 1FKXA 1EJVC 2QZRA 3OODA 3RPDA 2DFAA 1OFRA 4DAIA 2YVFA 3UA3A 2GVYA 3S5YA 2ZX8A 2YPIA 2V38A 1KA9F 3PHAA 3QFWA 1JCXA 3H24A 4ZB5A 1XC6A 2X7VA 3OLEA 4PTMA 4Q4SA 3MANA 4GUGA 2TPSA 4ZQMA 3S2JA 3T42A 1MW1A 2GSEA 3T0DA 3TC3A 4KIEA 1P6CA 3AOFA 4L65A 4ZO9A 3EWDA 2KZHA 1ONRA 4RPQA 4OUEA 2QCHA 1V3MA 4NY2A 5JU6A 1HO1A 1TYTA 3RXZA 2Q3RA 3AU6A 4MDPA 3W2MA 2VZOA 4PYSA 1F8MA 2CBJA 4AXKA 1TIWA 3LHWA 4P7QA 1E1CA 5LIXX 3R13A 3QZ6A 1BAGA 4JXCA 2WJFA 1CGUA 2D0FA 2UY2A 1W9BM 1O1HA 2V5DA 2O92A 1RD6A 1ZDLA 3N18A 1UBPC 5FS7A 1S2VA 3S6DA 2Z24A 1CWYA 2EJAA 3QMSA 6TAAA 1W3TA 3NS1B 2BNJA 3IV3A 1X2HA 1ZBWA 3GU2A 1XR2A 2QJMA 3LXAA 5EBKA 1C7SA 2OX1A 3QGVA 5CGTA 2DVXA 1FXPA 4O1FA 4LBSA 4HHLA 4MDOA 3LGDA 3GXTA 2CHOA 5HR6A 4ZXLA 5AYBA 3UG5A 4C6FA 4Q8WA 4LH8A 1GKRA 5L9FA 1S2AA 3LXBA 4CQDA 1H2IA 3AZRA 4R3UA 4J3ZA 4XBSA 4QAWA 4BWLC 2CZ5A 1PYFA 1IYXA 4E2BA 1CGYA 1YTKA 4NNCA 4D6EA 1MNSA 1AD1A 3W72A 1FQ0A 3M0MA 2YQUA 1SZGA 2OYLA 5JBFA 1RXOB 3RRAA 1TZ7A 1O95A 3UWQA 1BG4A 3CPGA 2C0AA 3KTCA 2G3IA 5I2UA 2TODA 4K8HA 4WSHA 1GPWA 4DYEA 2WOWA 1STZA 4N02A 1UZ4A 4PTXA 1D7FA 4FA3A 2R9RA 1YNPA 3GWQA 5KEZA 3GAYA 5BZAA 5GJPA 3CQ0A 3K8KA 1E1EA 1US3A 3NDYA 3M1ZA 1DNCA 1ITUA 3DCPA 5G1TA 3KOXA 3IVTA 1UH3A 2F8QA 1BSLA 1K3UA 5KVIA 1KBKA 1S2UA 3IIVA 3EXSA 3W7MA 5BRBA 5C9XA 5FS8A 5CPQA 3W87A 4L80A 3LPFA 5JRBA 1EUNA 3O0FA 2C19A 1AZ2A 2W92A 1JZ5A 1Z6KA 1ONFA 3TTSA 1EDQA 1NWTA 1W8SA 3KBMA 5REQA 1S39A 2NV2A 1OFPA 3QR3A 4ZOBA 1TYGA 2PP3A 3TTQA 3TYZA 3P81A 1Q6OA 3SUUA 2OZTA 2IMRA 3MSDA 3KRZA 4V27A 2QJHA 3EWWA 3SW6A 4GQBA 1SB3B 1L6YA 1JDDA 3FSUA 3VVGA 1TPFA 3ZVHB 3BJFA 4AU0A 5D9PA 2WZIA 3B8TA 1UWAA 5K4ZA 3TU9A 3U6WA 3FVDA 4ASTA 1BTCA 5D03A 4M6VA 3PZUA 4DJFD 2Y8KA 4ZQOA 3LBCA 1H7NA 2UV8G 4Q7NA 4EPKA 2GOKA 3RILA 3SCSA 2OO6A 3D0CA 3C2EA 5E5CA 4XAGA 1W9VA 2GH5A 1ONEA 3HG4A 5CCZA 4HSHA 5EU9A 1OBAA 3AIVA 4XAZA 3TDFA 4QFUA 5M1TA 4DUWA 1I9CB 1EDTA 4LUSB 2QKFA 4X63A 1WDSA 1SQ7A 3PZIA 4JQ2A 2XZ7A 4OV4A 1NWSA 1XYMA 3VILA 4DI8A 1XQKA 1FH7A 3FJNA 1GRTA 2OT0A 3BLDA 2RDWA 1E72M 1U5JA 4QR6A 3LSCA 1EPVA 3A4WA 3EKLA 3H2FA 1S2WA 3O2LA 5EMUA 2VR2A 1QAPA 1EWEA 2XSXA 4MIMA 2TRSA 2XIOA 1A5KC 4D6HA 2PDWA 4HTYA 2ICSA 3VC6A 3WLQA 5CBBA 3SY1A 4ZQCA 7CGTA 3ZSSA 3MUXA 3TTEA 1W2PA 3APGA 5CPLA 1BQCA 5K7JA 2XVGA 5FJJA 4W89A 3CUJA 4GC3A 3ZOAA 3G1RA 2B7OA 3T81A 4MWAA 1XH0A 3G3DA 4NHVA 2E7FA 2Y5SA 2CLPA 3CUGA 4KBXA 3PPGA 3G1XA 5J5RA 4ZQRA 4V2XA 1FX6A 1LUCA 1ODUA 2OZ0A 4RE2A 1GCYA 1K9FA 4N0RA 1WBJA 4LAUA 3MMUA 5FJPA 3R07C 2VFHA 3RCNA 2VEIA 2V81A 4PL1A 1XIHA 4LF1A 2WOVA 4H9TA 4J56A 3VX1A 2NT0A 2YDQA 4R9XA 1H0GA 4Z2LA 3FIGA 3UNTA 4AH7A 3V7PA 1IEVA 3WQCA 1RJPA 1EX5A 3SSZA 1WZLA 1GVRA 4HNLA 3VIFA 1YXDA 1WUFA 2OLHA 1RCQA 1SU5A 4PFMA 1ISWA 1ZL1A 5IFPA 5A6BA 5D32A 4N9CA 3HQ1A 4APNA 2QS8A 2R24A 4M6PA 3UXKA 2UZ9A 4ADUA 3EAUA 1WPCA 2C15A 3GVGA 1KRAC 4NX5A 3AO0A 3BQ6A 4QIUA 3BXWA 3BJTA 2F6XA 1HP4A 3PAOA 5AZ1A 5D38A 1BWCA 1CNVA 4RNFA 2X30A 1YBQB 2A21A 3VOJA 5GPRA 5CAKA 3PTMA 4NAFB 4AZCA 4S2BA 1AQ0A 4P8XA 4EKJA 3ZLGA 5FIPA 2ZUVA 3VOFA 2WNZA 1KLZA 4O8AA 3URQA 3LMZA 3VKJA 3GNRA 3BE7A 1FEBA 3WJWA 4N9BA 3STPA 1FDJA 1WXZA 2HQAA 4CU7A 3DFQA 2XVLA 3KZSA 1TJ0A 4XBJA 3W7EA 3S47A 3N17A 2GGEA 2V69A 1E71M 1UR1A 3URBA 3W7IA 1Q13A 3ES7A 4FNSA 3CEPA 4WY0A 3E0WA 3ZYZA 3MY9A 1QUMA 2J6XA 3MJMA 1B3OA 3VMNA 3L2IA 3NURA 2R1MA 3GG7A 1OD0A 3YPIA 3I6EA 4UFLA 3VIGA 4AFYA 4L5ZA 5JXQA 4WF7A 1YEYA 1H7PA 3M0ZA 2FTPA 2CNCA 1D2KA 2CLEA 2DIJA 3N12A 4P7NA 2BOGX 2QLYA 4US5A 4LTSA 5GRTA 2BBFA 1NM9A 4UTMA 5T9BG 1BD0A 2XGZA 2QGYA 1Q2RA 2BLEA 3LK6A 4OTKA 3EB3A 1IXPA 2WC7A 2V3GA 3JRKA 1O12A 2J7FA 2EPNA 1F73A 4Y9NA 3FGCB 1AG1O 3VE7A 4GYFA 1L2QA 1AD4A 2YBTA 4HNUA 3GAKA 4S3CA 4N4QA 1KQZA 4L1GA 3WLIA 2QUVA 3BLEA 3FW6A 4H9MA 4XAYA 3C8FA 4UTUA 4LFYA 3FJ6A 5CC3A 4AZ5A 4AWSA 2WXDM 3LI0A 1F3WA 1PX4A 3C2RA 4KF1A 2DSWA 3GXMA 4JBRA 3IWPA 2XGBA 3LY0A 3S5NA 3ZR6A 5HNRA 2PGRA 2XVNA 4XB3A 5ABEA 3ENLA 2QCCA 3GFYA 3WK0A 5T91A 4AZHA 1Q3NA 1XWYA 4B15A 3VNJA 1A3WA 1TWIA 2DT0A 3QHMA 4Q4QA 4ZCWA 1JROA 2D24A 1R85A 4BY3A 1SO3A 4EX4A 5LGZA 4J3SA 1BYAA 4JNMA 5D33A 5HMSA 2P3ZA 4KQNA 3AAMA 2YCKX 4O1DA 1RM6B 1ADOA 1ZS2A 1K8ZA 1NDAA 1OGGA 3ONBA 5I3JA 5G4HC 3U2EA 4G5DA 2J75A 1O7AA 3B06A 2Z1SA 2J25A 3GH7A 1MRAA 1NP0A 1VRDA 3GHSA 3EOOA 4CGTA 4HCDA 4EMJA 3AIWA 3V0UA 5H1WA 2OQYA 3H2NA 1TE6A 2E9BA 1F3PA 3ETRB 2D2OA 1SFJA 5I79A 1LYXA 2OJPA 3DGRA 5TF0A 4JIPA 3TYCA 3KOFA 4B16A 3CZGA 2G96A 2FZ8A 4H4QA 1TRDA 5KVHA 1S2CA 1ME7A 3NUKA 5IFTA 3WH8A 2WVTA 4UNLA 1FWGC 4WGXA 4JAWA 1JDEA 3W1XA 1OF6A 3MQTA 1DE5A 1CIUA 4BF9A 1ONXA 5CZSA 2QV5A 3HV9A 4QQUA 3T2OA 1AH0A 2BP1A 2IKJA 2BG5A 2ZXDA 4HU0A 2WHMA 3K4WA 1VDVA 3UCCA 3QMRA 1KKRA 1SZNA 4C6LA 4UUIA 4K68A 2Q6ZA 1XUUA 1OHLA 3F5KA 3NL2A 4XZHA 2ZWZA 3LQGA 3WFZA 4PODA 4ORMA 1QFEA 4KEMA 3EX2A 2YIHA 4N9DA 2AMGA 2BVTA 4LQ1A 2I14A 3EWYA 5BOFA 3R8HA 1Q6GA 1K4HA 4EXBA 3UBPC 4JGDA 4PCPA 1OZQA 2GOUA 3E12A 1YTEA 3MSGA 3AJXA 1B3WA 1N8WA 1MEHA 2PS2A 3WK3A 5A6SA 3AUJA 2VWTA 4KRUA 1SJDA 3VKKA 3DESA 3ONCA 3UESA 5I03A 4OE7A 4B4FA 3AJ7A 3WDQA 3A64A 3EOUA 1X7FA 6CGTA 4GLEA 4MWAC 3E2QA 2VZVA 3DGHA 3OGRA 3ZZ1A 1ZCCA 3VCNA 1XYFA 3F03K 1U1UA 1R8LA 4BI5A 3W1TA 3M5ZA 2A2IA 2NUWA 4OU1A 4JTIA 2V3BA 4MJ2A 3KUMA 4ZQNA 2PWDA 3DG3A 3O6CA 4HA0A 1BYCA 1H1YA 4PRRA 4EQSA 1N5XA 3OQEA 1BRLB 2WQDA 4IPNB 3V75A 1P4CA 3GG8A 4WQ6A 3N11A 1S5NA 2PURA 3NQCA 2GFTA 1EOKA 2BHYA 3H2OA 3LGEA 4FNPA 4DNMA 3LUTA 1MFVA 2O9OA 5HPOA 1AJ2A 1ZP3A 1ZMDA 5A6AA 1VIZA 1DQXA 1DJQA 1FOBA 4J7RA 4YL2A 4DWSC 1M9HA 1KB3A 4U2ZA 2PDKA 3N4EA 1VPQA 3S42A 4DZ5A 3CL7A 5CJNA 1W3LA 1WA3A 4UR7A 3UVAA 3F2DA 1J4EA 3C5QA 2PLCA 2CKRA 4MOZA 1NDZA 3M5YA 3M5XA 3H2AA 5A8OA 1CB2A 1S3TC 1IXQA 2RAGA 4BCEA 4U3AA 2LLEA 1AW5A 1ZTVA 1KBIA 4O52A 3VGGA 4D6IA 1G7VA 1MUWA 1W17A 2CYGA 2OTDA 3UP8A 1XLDA 3WQ5A 3VDCA 2J8TA 4GIYA 2XH4A 2J7HA 4O1BA 3G0UA 3AMZA 1AL8A 1T0OA 4P8VA 1F6YA 3P5ZA 2RJHA 3LCIA 4JTTA 1VYPX 4B5SA 4JS3A 2WLZA 4PTDA 2H9AB 1ICSA 2ZRXA 2XH0A 4JCLA 1HZYA 3K30A 3HURA 3VD3A 2E5BA 1TR1A 4GKTA 3TZNA 4LT9A 3V16A 1DORA 5AC8A 1PWLA 2OVLA 3GBEA 3RF9A 1EC8A 2A7RA 3BLOA 3DOPA 4A3UA 4UWMA 1XIJA 4ONVA 3W1UA 1D9EA 4DJDA 3S1UA 2IPFA 4JD4A 4GJ1A 2JALA 2J3NA 1SW0A 4LU0A 1QWGA 2O4QA 4L9ZA 4EPBC 2VC5A 2PWUA 3DGBA 3RX4A 1V02E 3S2MA 2E68A 3F2CA 3H6OA 1W3HA 2QHAA 4PMZA 1R0MA 2INFA 4J3VA 4AW7A 1S7MA 3RLUA 4K39A 2DVUA 2IQDA 5U1OA 3P61A 4I8DA 4M3PA 4ZE5A 1TB3A 4RDYA 3EWCA 4JN7A 1Q7MA 3M0KA 2MANA 2EQDA 3PG6A 1C8YA 2J8FA 2BMBA 3F4WA 4K38A 3FHAA 3GH5A 3IVUA 4R9OA 4CCZA 4LRTA 1TCDA 4LNCA 1DXFA 1I0DA 4U28A 4HOZA 3I68A 4JTFA 1M7OA 5CQ1A 4GVIA 1KFCA 2YR1A 4I7WA 4PR4A 3ITOA 1VB9A 4TO8A 3MSRA 3UZ5A 2OMAA 2CC0A 2DQWA 1W5PA 4G7FA 5C5YA 4WD0A 4WLCA 4JX6A 2WZEA 4B5UA 4RCXA 1TVLA 2YSWA 3CWOX 1KGWA 1QXLA 3NCOA 3OGSA 1WB0A 3GFZA 1VRXA 3MHUA 2GVJA 4CLMA 1POKA 3WBWA 4BS0A 4JYFA 3THAA 4XZ9A 3DKJA 3I7QA 4J28A 2H6RA 3SADA 5LHFA 3NSMA 4NU7A 1RH9A 5DMYA 4O10A 1ZFJA 2C8NA 2J24A 2BSLA 3NVVB 2IPJA 3VMOA 1TV8A 1VBGA 2PDCA 3I7SA 3HBLA 2F84A 4IXXA 2WC4A 2VZSA 4ZSUA 3MYPA 4GABA 5CAHA 3QR0A 4WVXA 4MM1A 1HKJA 4V1XA 3IJQA 3MI2A 4WX2A 1NARA 2OOFA 2XSBA 2YCEA 3WLHA 1KM3A 4YHEA 3W00A 3WLTA 1DTUA 3USBA 3SCNA 5JQ9A 3BL3A 3VOIA 4KKXA 2JBMA 1VFTA 5CZKA 3V1PA 5HA7A 2ZUUA 4KWSA 2Z2AA 2F5ZA 3C3UA 1B3XA 3BZGA 1SVDA 4D1JA 2OWCA 1FHDA 4W8AA 2G3MA 4Y9MA 4CQBA 2XM2A 3KX6A 3TKFA 4F0SA 1SO6A 5A94A 5G1YA 1WYGA 4B5NA 1R38A 2FZNA 1E6QM 3EDDA 3CZEA 4DLMA 2IXVA 4WDTA 3MTWA 2Y0FA 4W85A 4OJYA 2I57A 1FBAA 4WOQA 2FH6A 1XCXA 3B0XA 1GG1A 5LKYA 4PMXA 1X2GA 4GH3A 2WK2A 4C1KA 4CD6A 5BMXA 3S1GA 2C79A 1TWSA 1YXYA 4NZ3A 4I5XA 1PIFA 4URIA 3W9ZA 4R27A 2FGBA 4WR3A 4YWSA 1PBGA 1GERA 1SPQA 4TVYA 3HFYA 3PBWA 3CBWA 3CIWA 1TX2A 2QCFA 3R0UA 4W5UA 2OELA 4HK7A 1XLBA 5FI8A 3KVMA 4EANA 1RP9A 4BA0A 3OW1A 3LB0A 1FECA 1HKMA 3UEQA 4Q8OA 4IQDA 2XZ9A 5T9CE 3K2GA 4GI9A 2TSYA 1TZ9A 3G5EA 4W7UA 1RVKA 4AZBA 3DN5A 3GR7A 1DJGA 3EF6A 1JDAA 3PUGA 3UJ2A 2BVWA 2E67A 4KW2A 5EFDA 3V35A 4C6NA 3APYA 3K5XA 4S3BA 1JEHA 3PZ9A 1XIEA 4JYEA 3C2YA 3MCNA 1RA5A 4RE4A 4TX8A 1JYVA 1V3JA 1LZOA 4C91A 4Q6XA 3QLDA 4H9XA 4IP7A 3OC4A 2X1TA 4PE8A 3PWGA 1J9YA 3T08A 3WELA 4E8CA 3G18A 1JYXA 2W27A 3T55A 4C1NB 3TQ0A 3TX9A 1IGSA 1EQPA 2EO7A 4WJXA 3SY8A 3AIQA 1QW9A 2GPTA 1FWNA 2FTWA 1BPLB 3QYQA 2OSYA 2J62A 1HJXA 3EDJA 3V5CA 4YTRA 3CUHA 1LBLA 1V51A 1OC7A 1BTMA 3WQDA 2DZTA 4IUOA 1R9YA 3SY5A 1H7RA 1KFBA 2WMKA 1NF7A 3DDMA 3FCPA 1KM5A 2OQLA 2CZDA 2HZGA 2IXUA 4PB3A 5CKSA 4DM1A 3HGSA 1Q45A 4J57A 1AQFA 1WOAA 1QBAA 1QCWA 2FVKA 3QSTA 4WJEA 2V2HA 1KBJA 5A2CA 1P0DA 2EEXA 2R14A 3WJYA 3GDBA 3USZA 2E6DA 1JQVA 2VC6A 4XAPA 1UP2A 2Y88A 5DBTA 2Y7GA 1ISXA 2FLIA 1UOZA 5HR7A 5D2WA 2OGYA 2CFFA 1XSIA 4WDWA 1Z69A 2TMDA 2QCDA 4HOWA 4L61A 3HTWA 3EEZA 3VK5A 2HDJA 5HANA 1OYBA 3G1VA 2IKGA 3CASA 3WO8A 2JQXA 1LORA 3WLKX 4DJDC 2IQTA 3QY8A 5C7VA 4Y7EA 1VR6A 1HKIA 1NHRA 4IQEA 3GNXA 2A85A 4GI6A 3W2JA 4GMEA 2PTWA 3HO8A 4MUZA 2E3TA 5EMMA 4HPGA 4MMWA 3TMLA 2ZVRA 3QF0A 2WMHA 3FA3A 4FNQA 4UTKA 2Z27A 4JNYA 1GSNA 4CNUA 1DWFM 3VUPA 4O50A 4B3ZA 4E2VA 3DK8A 5A8PA 2WOIA 3CUIA 1OFEA 4C6QA 1EFZA 3WF1A 4R88A 3ANYA 1EYEA 2J74A 4H9ZA 1W31A 1IEWA 1RHCA 4DJED 2BC0A 2ZRVA 4L9XA 2BY2A 3NPVA 4GYJA 3O7UA 3QZAA 1W5OA 3LNPA 5AYYA 1QPKA 2F38A 1KFKA 2JF6A 3ITYA 4NNBA 1XLGA 1DL3A 4K1GA 3BPWA 1FXQA 2GVLA 4PMRA 3TJIA 1WKFA 4G2DA 2C18A 2WWDA 2XH7A 1GVOA 3D47A 3W6YA 2GJNA 3URAA 4D1IA 3SDOA 1E70M 2D1ZA 5FF2A 8TIMA 3S2LA 5CGQA 4NRRA 1JGIA 1X96A 4CCDA 2BGQA 3HQPA 4IGNA 1TV5A 4PMQA 3HJEA 1TV7A 3E49A 3XINA 1Q4WA 2VFGA 4FP1A 4AX7A 1B31A 4QX4A 2NQ9A 2FGLA 5BWFA 3BSHA 1IWAA 1EIXA 2CLFA 3CUXA 4AD0A 3WF0A 1PB0A 4OECA 4S38A 1XLMA 2PGFA 2Z6IA 4IIGA 3KL0A 3SN0A 4XIAA 1OX5A 3AXXA 2AQOA 1GNXA 2X05A 1TA3B 3DBPA 4CN1A 3D6NA 1KFEA 3O6AA 5D8WA 2QJJA 3KWXA 3NR0A 4Q8TA 1XD0A 4MG4A 1B90A 4BF7A 1XBYA 4BEUA 3VMPA 2EJ1A 3PVFA 3SZ8A 2W5FA 1EO7A 1LDCA 4PMVA 1DP0A 2J9XA 3B9JB 2R9ZA 3MV01 3GTFA 1VIWA 3EWXA 1ECQA 1F3TA 4B91A 2PB1A 2HROA 5CG7A 2BVYA 3O1NA 5PTDA 6REQB 1AL7A 2Q09A 4J3WA 2IKHA 1OFAA 3CS2A 2EG7A 1S1PA 1FFVC 4FXJA 2W3RA 1ALDA 2EPOA 2ZC1A 2YDRA 5DELA 4ICMA 4MJMA 3DUGA 4ZOEA 4HVXA 3AZTA 3M0HA 2E0PA 3UCDA 2PP0A 1VBJA 3NYDA 1S5WA 3IIXA 4ZOCA 2CXEA 7XIMA 5G4EA 3JUGA 5E9AA 1H1ZA 4KETA 3SGGA 4QE5A 1KM1A 3CXOA 2WNQA 3ZJ7A 1PKMA 5AHEA 4LV4A 4ATWA 3PJXA 1XISA 1EA0A 3CHFA 3EA1A 1UMLA 2Y5JA 1WAWA 1UR2A 3C2VA 2E28A 2NXGA 1HQTA 1GZ1A 2QCEA 3MMTA 4GQRA 5IM51 4R5EA 4DLFA 3IK4A 1GEQA 2ZDSA 3IJDA 1NTHA 2BS9A 5BOOA 4J3UA 1W0MA 4O11A 1EP2A 4Z1DA 4WY0F 6PTDA 3M64A 1VAHA 4NX0A 5C0QA 1FWJC 3QOKA 3LPOA 3NVYB 2CITA 5K9CA 1NOWA 2VX4A 3CHCA 4FOKA 4N4PA 4WHBA 5CSYA 2W9MA 1MDRA 1A5CA 2DGAA 1GVYA 2CIPA 2IW0A 3ZMRA 2D0HA 2E09A 4K3ZA 5HNUA 5A8MA 1KTCA 1Q2SA 2PZNA 1V7AA 5BMWA 1ICPA 5I6SA 2V3FA 4ZO8A 4RX0A 3LGGA 2WMIB 4YTSA 5ER0A 3P74A 3PZNA 4HA4A 4IG2B 2E5AA 2VEMA 1GOKA 1PEZA 3QQ0A 3M6YA 3PZVA 3QQ1A 4Z2JA 1Y7VA 3E2VA 1FIQB 1BRLA 2WZTA 3S3GA 1OX4A 3LV6A 1KRMA 2XG9A 3URNA 5I24A 1ZAHA 4GCAA 3WD1A 3SUTA 1SR0A 1A5UA 1YDVA 4NASA 2P1FA 3KBSA 4KGLA 2X0YA 3CGEA 4QJ1A 4IXHA 1M41A 3LXDA 4TR9A 2W79A 2P8BA 2CLIA 2A8XA 2ODOA 3WH7A 3U8GA 4CVWA 1UKTA 3I4EA 3L5AA 1KCKA 2QF7A 1EF3A 2J47A 3RAOA 2PWGA 3WEZA 3WIJA 1JNDA 2V5CA 2ZRUA 3B8SA 1XDLA 2EBNA 2HJPA 2WSKA 3EGJA 1IR1A 2E6YA 2XM1A 3C0QA 3NGFA 1VEOA 3MWCA 2P5NA 1W54A 4S1FA 1U2YA 4QS6A 2J66A 2FIQA 5CPTA 1YIXA 2X8HA 2ZKMX 2Y5EA 3LCFA 5I23A 4L56A 1JF5A 1XBZA 2OB3A 3CLMA 5HMEA 2FJKA 1J2BA 1GYLA 2BOEX 4FDCB 2X8CA 3KVJA 3P84A 4GRTA 1JFXA 3SCOA 1GQKA 1DWHM 3CAQA 3SIZA 4C65A 4RDVA 3DH7A 1V3HA 2HXTA 4PCFA 4MPKA 4PRWA 1UR3M 2Y63A 1PWMA 1AODA 1W9UA 2CWXA 4OFCA 3V3WA 3UZJA 2WW5A 5HMDA 1S5MA 3LZ3A 2G0WA 3TV8A 3TZFA 2EQ8A 2WBGA 3GDMA 2AL1A 2RUSA 4K8EA 1YQZA 4H9UA 2I9EA 1F3EA 4M29A 3PNUA 3WX7A 2H9AA 1KFJA 5CPOA 4RJEA 3CK5A 3M0VA 1K9TA 3DEQA 4LYQA 3WQ6A 2AKZA 3BURA 4J4KA 3WBXA 4DF2A 4FO4A 2D23A 5FF4A 1G5AA 4GHRA 4GIAA 4CEXC 3RRXA 1JYWA 2D73A 1P7TB 1ZALA 4L4LA 2VFEA 3B97A 1CX9A 3QGAC 1MZHA 8XIMA 7REQB 4ZB2A 1XLFA 3S2NA 3CAVA 1IT0A 3LU2A 4IL0A 3HFTA 3OG3A 3LRLA 2ZZ3A 4DXXA 3FVMA 3P82A 1M65A 5G4WA 1KM2A 1TMLA 1W2VA 1OG6A 2OEMA 1VBHA 3QPEA 4QNWA 3RLVA 3CYJA 4QLLA 1ML1A 5HNTA 1E6SM 4IGMA 1JCYA 2J9ZA 4YCOA 1NWRA 4EXAA 1TWDA 3M47A 2DORA 3AM9A 4LNYA 4Q8NA 2D2JA 1WKDA 2V3DA 3AMGA 2Z1BA 4AWUA 2G3NA 5HUOA 3VTRA 3UCQA 3NTYA 4DVOA 3WNMA 1OQFA 1X8CA 1PAMA 1QATA 4BFAA 5ABFB 4H4RA 5TBOA 2B7PA 1DXEA 3L9CA 1MMFA 2IPGA 1ME9A 5I3HA 4KIRA 4M8UA 2F6KA 4K37A 1PTAA 2YAUA 3W1QA 1D8CA 2PTXA 1CTNA 4IGSA 3V0TA 5IBXC 2WPCA 5E0FA 3M6DA 1Y5WA 3M9YA 3W26A 5HINA 1DJNA 3TSDA 1XLIA 4CD4A 1VGAA 4GZ7A 1LTDA 2OGJA 2CLKA 5F1UA 2B0MA 3ID7A 1T96A 1UJQA 1XG4A 1RD5A 1QHZA 1DJZA 4XVDA 3QY7A 1ZZMA 1VLIA 4FX7A 3HPAA 3B0PA 1QOPA 2I56A 3KZPA 3BW2A 4H4UA 3CZJA 4UCGA 1J96A 2A3LA 3TW6A 3VNIA 3OEXA 2QUNA 3RN6A 4RKAA 4IICA 1BVZA 3HU7A 2QJGA 3TE9A 4M1RA 1LQ2A 2CEQA 4M51A 3F4VA 4ZGYA 3VNMA 4X2RA 1PKYA 4HOXA 3M0JA 1LPFA 1BHGA 1R2SA 2EF9A 5CPMA 4HNNA 4BJHA 2HPMA 4DZHA 1UP0A 5DX7A 4DN1A 1K7XA 1BF2A 4Y9PA 5FD0A 1Z7AA 5KMYA 5LSMA 1ZX9A 2Z25A 3BAKA 3KRUA 1JXJA 3DERA 1XW8A 1A5LC 4IIDA 4RE0A 1QI2A 2WNNA 2DUZA 5KZEA 3EMZA 4MNMA 4TX6A 2VKZG 5CBIA 2VQTA 3SCPA 4FF5A 3CQKA 4UIOA 5HJYA 1E1CB 1TRIA 4C7GA 1KR0A 3S2CA 3T7VA 2G41A 4FF7A 1F4AA 4RZ4A 4X0VA 1N82A 1LWHA 1XDIA 3LDVA 5KZ6A 2R94A 5F2IA 2ZZ5A 1W1VA 3GD6A 3NFUA 1UUQA 3SO7A 1AMYA 4U10A 1K6AA 2X0SA 3W7KA 3KE0A 4A29A 2VENA 2A3CA 3H21A 3W1MA 3W81A 3SQPA 4XD5A 1VF8A 3Q58A 2Q02A 4LVGA 4JTRA 4AHOA 5EGRA 3H4KA 1AK5A 2OXNA 1QPQA 2QCLA 2VJXA 3QC0A 1P43A 3CJPA 4M19A 2QPUA 1LL7A 3M5VA 3UG4A 3TOYA 3GG1A 4D6FA 1OWQA 4GNKB 2NQHA 1Y8BA 1SJCA 3CTLA 1US2A 4RDWA 2DSKA 3MCOA 1E4NA 4HK6A 2Z0IA 4Q33A 1BZLA 3M7SA 1WE5A 1W1ZA 3AYTA 4Y9OA 2ACRA 2YCJA 3UYCA 5BXTA 2DZUA 4A3RA 2QIWA 3MO7A 4PUKA 3UXIA 4LVFA 4XD3A 5IDIA 2IKIA 2YDAA 3A7AA 1R9XA 4FLOA 1UIOA 4XWUA 2W0HA 4PUJA 5BRQA 1LWJA 3IV8A 5AYIA 1H50A 2RDXA 5TIMA 4ACYA 4CKQA 1ZAJA 1B4KA 4R53A 2FQIA 4LB3A 4L7ZA 1TSIA 2ZZ1A 2INZA 3LXCA 2AGKA 3BDKA 1YKWA 1I6NA 4HMCA 4EPDC 3BAYA 3PB2A 1U5HA 4DO5A 2J79A 4FOUA 1DXLA 2PRHA 1PDZA 1CECA 2V8ZA 4DO6A 1REQA 4JIEA 4JN8A 3KOYA 3L65A 3BG9A 4JX4A 2WPGA 1BVNP 4FEZA 3OVPA 4QG6A 1HW6A 3VDBA 1Q5MA 2NXIA 3UR7A 3AS1A 5REQB 1GOXA 4Z2KA 3GIYA 4E4PA 1J18A 3ZR4A 2G3JA 2PDGA 4OBTA 1ITXA 2QEZA 3V4BA 2YFNA 3E5BA 5GVJA 2VX5A 3BJSA 3CIXA 3WNNA 4EAYA 4FS9A 5A6BD 4QJ3B 4LYRA 4GVHA 4EE9A 4CNSA 4UTIA 3KBJA 1KKOA 2HVOA 4AY8A 4RUBA 3EEGA 1W1A1 1LROA 2A3EA 3FA5A 3RR4A 2X99A 4L6DA 4O4VA 3BOXA 1MXSA 3B0UX 1O5XA 5A6MA 1ISZA 1HJWA 5IXEA 4Z2IA 4ROPA 4XK2A 3DFNA 4DELA 1TIMA 3GE7A 4HNTA 1UZ1A 1UD8A 3E9AA 1TV4A 3H2EA 1O94A 2VX6A 5C71A 3IGUA 2E25A 3SQMA 5G5IA 3H7RA 2ZQ0A 3NO3A 3BTNA 1K4GA 5K4XA 3K1DA 1KCLA 2GUUA 4PBFA 1G0CA 1UH4A 1IGWA 2I9UA 3AS0A 4OBRA 3R1ZA 4I9TA 3GFXA 3QFBA 2FDMA 1JCTA 2HBXA 4E2DA 2PDXA 3OPSA 3IUIA 2NUXA 1H62A 3LLDA 2V6AA 3MJYA 4NEWA 5HWMA 1JUEA 1KLYA 5FCZA 3SECA 3ARVA 3MP3A 4ZEPA 5M5DA 4PUDA 1I8JA 3GXIA 3RMJA 2BHZA 2FFIA 2F7FA 2X8RA 5LNUA 1NH6A 1TMQA 1TJPA 4UNIA 5DCBA 3NOYA 5FL0A 4D8ZA 1E73M 1PTDA 2HBVA 5HNNA 3PJTA 2FVLA 2VR5A 4RZ6A 2C6QA 4CUCA 2PEVA 3ZWTA 4MWAB 4NP7A 3DFHA 3LV5A 3DKLA 4US5D 2YCLA 4Q3MA 4EXQA 1XDJA 3LM3A 4LAKA 2DDXA 3BMXA 3NWRA 3RJXA 3TUUA 1LUCB 2CZVA 3ARRA 1JDFA 4MZYA 2CW6A 1E3XA 4Q8PA 3P0WA 4QLJA 5IRPA 5AKQA 1YYAA 5A3HA 1RV8A 3GNOA 4Q7BA 1U1JA 5J8LA 2A6NA 2ONEA 3AFBA 2YXGA 1UMYA 1XPYA 3SCQA 2NQLA 3IIPA 2P88A 3UW6A 3F1QA 3GLCA 4HGXA 2YL8A 4AC7C 4DF0A 2OZ3A 5BNKA 4PGLA 1WX0A 4EQWA 4GKLA 4QG9A 5FS9A 3ZT7A 5TNVA 4ICCX 4MB4A 4H50A 3TR9A 1V7YA 4IFRA 1C8QA 4KS0A 4MJ4A 3ZJ8A 1ZGDA 3HMJG 1OADA 1I2PA 2ON3A 4RV8A 4AMAA 4J3TA 4HCHA 4XZNX 4DWSB 4GA8A 4QE1A 1XIGA 5D2VA 4WDXA 1I2QA 4ML9A 2WANA 1AW1A 3IC9A 3EOEA 3GRIA 4I5RA 2GL5A 4AZIA 4IMCA 2GR1A 3WFAA 4CQCA 2R82A 2FPYA 3Q45A 2QUUA 4QDMA 3VKBA 1TPWA 2OO0A 4IL2A 5E09A 4F0RA 5EL1A 2WO5A 5A95A 3M0LA 3MZ2A 3CGDA 4L9YA 1N8FA 2VHLA 1XKJA 1UASA 4LCRA 3GZAA 4REQB 5A2BA 2REQA 1FDZA 4FMVA 3HF3A 2Z28A 3UGVA 4R33A 3QTGA 4AD2A 2NW0A 1QNRA 2GUBA 1A0DA 5M03A 3W3OA 1T6MA 2JIWA 1TTPA 3FG2P 2JEQA 6REQA 3QH2A 1FCBA 1JCNA 1QO2A 1SMDA 3T78A 4NZJA 3L4VA 4O0QA 1J01A 2VURA 4A4AA 1R3RA 3LBMA 1NWUA 2QCNA 3NIYA 3D5HA 4IMDA 1VFSA 1OK6A 3S5SA 4FX6M 1VFOA 2NSXA 4JX5A 1N61C 3WF3A 1EWDA 4WY0B 1L6GA 1YLVA 4WCJA 1XBVA 4DBEA 1Q7ZA 4GI8A 3IGXA 3NM1A 3HJZA 3C0JA 3CZLA 3E96A 1JCJA 4NF7A 1TTIA 2YX0A 4A05A 4LVBA 3LCGA 2HEJA 3IAPA 4A8LA 5D2YA 3SB0A 5FEWA 1X6NA 2WOQA 2GGJA 4AIUA 3T8QA 3PTQA 3HG5A 1QI5A 1I2RA 3OQ8A 2ACUA 2CXGA 4QJ5B 4GYPA 3BW3A 3QEZA 3OZYA 2FZBA 1UZDA 3R11A 1HG3A 4JHOA 4NYUA 2G50A 1RBLA 3TSBA 3O07A 1Z89A 1QPRA 1XLEA 4F0LA 3FEQA 4ZO7A 1PZ0A 3AC0A 1IR2A 2CCRA 2OEKA 4PSRA 5LA1A 3VGFA 3NM3A 3P7YA 3LPGA 2PODA 1K70A 4B5TA 1ICQA 4YN5A 4HZMA 1L8NA 2OWWA 4JEJA 3CB3A 3RJYA 4BEQA 2ZTJA 1XQLA 4YTQA 1VENA 4H8VA 4AD3A 1XLCA 1BWKA 4FR6A 4NZ5A 2OPJA 1QT1A 2PZ0A 3CUFA 2HWGA 4LCQA 1XJBA 1SSGA 3C56A 4D6JA 1RCOB 3RM8A 2BC1A 2XWEA 4LV9A 3DK9A 4W9TA 4F0HA 4IG2A 3AROA 5I7GA 2YGYA 3H26A 1XH1A 1OK4A 4BI7A 4HIBA 8XIAA 5D30A 3PSVA 3OVGA 3DK4A 4K2SA 1Z41A 2ZA2A 4PBEA 3A5VA 4YMZA 3E2SA 1JUKA 2HQMA 4Z2HA 2GR0A 3LTYA 3FSTA 3R89A 1R87A 2VQUA 5LIKX 3L8KA 3EX4A 6A3HA 5F4SA 3W7OA 3CT7A 1WO2A 3G1AA 4BQ3A 4OOUA 1EH9A 2PI6A 4IZGA 2GWGA 2FJUB 5HULA 2P10A 3E38A 4KRTA 1CDGA 4F0MA 5JBDA 2ISFA 4DBUA 3DG7A 1H7WA 1K4QA 3W2NA 2CETA 3PR2A 2Q01A 4LUTA 3G0SA 2RGLA 4MB1A 1EEPA 2V9DA 4KPLA 5SWUA 1GOQA 4UQ9A 3C2OA 4QHRA 2VTFA 3AQUA 2WP6A 4PRTA 3TTYA 1C92A 3PJUA 2CPUA 3O05A 2XIMA 3ARPA 1A5BA 5AHMA 2GGIA 4JN6A 2G4FA 5G2IA 1GRAA 1C90A 4GISA 3ZSTA 3UG8A 4F48A 3CV2A 4F40A 1I1WA 3IRDA 4JKLA 3GD4A 1B0IA 1QHPA 1R3YA 3P3BA 4Q4KA 1MFUA 3N19B 1GOOA 5EBUA 4FX8A 1YRRA 4PC8A 1V6VA 5ECUA 2ZRWA 2PDYA 4LY8A 5FEZA 1VQTA 4YHGA 4DAFA 3KDNA 4K7VA 1BFNA 1NVMA 3QM3A 2PCEA 1W9DM 1LOQA 1DWIM 4EP8C 3LQLA 4BR1A 2BX7A 3ARZA 2V5LA 4ZL1A 4J40A 4Q6JA 4DO4A 3AN1A 1HN1A 1WV2A 4M56A 4DJDD 5DT5A 1KV8A 3VA8A 1UYQA 1UZHA 4BURA 5JCIA 5AZ0A 3BCDA 2EPHA 1XV8A 4UQAA 2VGBA 1WNOA 2NVAA 4ZFCA 5CC5A 1V93A 3ARQA 1QNVA 2ZVIA 2YLAA 2ZADA 4AB4A 2ZZ0A 3S46A 3IJ9A 4DNAA 5IOBA 3UJRA 3WLLA 2J88A 1CGVA 3LD5A 5CEWA 5HQEA 1MZRA 3PZQA 4OV9A 3BLFA 1EJXC 2CFYA 3MHFA 1L8PA 1P6BA 5HDRA 4B9ZA 1ZU8A 2B31A 1NQ6A 4PCTA 1CEOA 1VFMA 4I3GA 3QGKC 2YA1A 4OUIA 1JEZA 2DW6A 4LIIA 4XVEA 2XFFA 4M52A 4NVTA 4OVXA 3WMCA 2OEJA 1DWGM 3E0VA 1HGYA 2ASHA 4NYYA 2CLHA 3L23A 1EIBA 4D8AA 4W8BA 4KRZA 4UFIA 5E0CA 3BICA 1LVLA 1X1ZA 1RQEA 2CWNA 2E6AA 3K8MA 3MA8A 5DXYA 2A6LA 1GREA 4QEEA 2BXVA 5F1VA 3EB4A 3EZ4A 2GJPA 2GQ8A 3LLFA 3UU0A 5HATA 3AIUA 4NJIA 2BY1A 3H2MA 2E5DA 3R79A 2JK6A 3TVAA 1ENUA 3QZEA 1XXXA 3U48A 3P0XA 1EKOA 1NEYA 5GNYA 3DHFA 3BQ5A 1YX1A 3BGAA 4HCLA 4YU1A 1XIIA 1EXPA 3UWEA 6TIMA 2DY3A 1PX8A 4DWDA 2ABAA 2VRKA 1VFUA 5AN7A 4B92A 3HM7A 4B3LA 2C3CA 3H4XA 3DHDA 1E1FA 3CO8A 1Q6QA 1OEPA 5B7ZA 5DCDA 1VZWA 4UXDA 4HNVA 1OVDA 3AHZA 5DXXA 2MNRA 2NUYA 5G1MA 1Y0EA 2NVDA 4JQ9A 3P80A 1TCMA 2ZX5A 2ZA1A 3CHEA 5H6HA 4DJFC 1DTNA 3B03A 4PMJA 3QOMA 4Q8VA 3EUB3 1CI1A 1FHLA 5JH2A 1EJSC 1TREA 2V6OA 1LOLA 3S6OA 1RQHA 4MKVA 3GKFA 2DUXA 4D6CA 3BLKA 3OA3A 1Z32X 1HF6A 2E40A 4HU4A 5JCKA 1US0A 1RAKA 4GYPC 3O0KA 1MDLA 3DJJA 5M17A 4LWWA 3GDTA 3AYRA 3L68A 2YKKA 1PUDA 2KX9A 4IHCA 1MQRA 3GX9A 2ZZ6A 2XVKA 3LYEA 2PD9A 2QQ6A 5FF0A 3SCRA 1AUSL 3HV8A 1N63C 4TMBA 1TMHA 3VDHA 2J7CA 1UWUA 3W84A 4AYSA 4UC5A 3N2XA 3ATZA 3EPNA 2YOCA 3TXZA 3PBYA 2DZBA 2DZPA 1QDSA 3VIOA 3H7UA 4NRSA 2Y62A 5BWAA 4PN2A 3WDHA 1L6WA 4HPHA 1GGOA 3UY7A 2A3HA 2X40A 2X7WA 4S3KA 3AMCA 2DP3A 2VELA 4HSOA 2Q8LA 3VFCA 3NVZB 5T8GA 3BOLA 3MKKA 3BLLA 4L1XA 3MHGA 2JEPA 4ES4A 2EQ9A 2WKLA 3UYIA 4N6EA 4PB5A 1BKHA 3TA6A 1OY0A 5BYWA 4HHHA 4GQ0A 1DV7A 2YL9A 3EDKA 2ZXBA 5C9WA 1C93A 1ZK7A 4I6VA 4RNHA 3W28A 3NQBA 4NL1A 5HK4A 4WGHA 3GR8A 2XIBA 5B80A 5LIWX 3MC5A 1N8IA 1JYNA 1UWTA 4GXWA 4YJ5A 5HWNA 1E0XA 2JKAA 3THUA 3TJXA 1CB7B 3F5LA 1EB3A 5C7HA 3A47A 1PIGA 3KEHA 4LXFA 1FCQA 2RGMA 1QVBA 4GUJA 2WHLA 3GK0A 3PWIA 2GQAA 1R7OA 1G4PA 2Y1HA 1T99A 2A7PA 2G5WA 2XYLA 3PZGA 3WD3A 3G1FA 1MOKA 3PZMA 1V3IA 4E2OA 3TTOA 3MMDA 3A4JA 5FJTA 1V6XA 1W9PA 3U9IA 3W86A 5F2MA 5KSWA 1AJ0A 1THFD 1UCWA 4A3QA 1NHSA 2ZUTA 1AVAA 1E6RA 4O4WA 3W83A 2J8GA 4F9DA 1GYMA 3KVKA 1KQYA 1A80A 3B0VC 1LT8A 2HE5A 3MUAA 1JVNA 1CBGA 3IAQA 1BWVA 1DJHA 1WKYA 1OB0A 2VD8A 3QBUA 3WBEA 5EB8A 4MLRA 3MW7A 4PB4A 3IGHX 4UBPC 1LLWA 3TQKA 3ZS4A 1MW0A 1Q6EA 3VD5A 1E6ZA 1JG9A 3DYPA 2GQ9A 3B0YA 1GVQA 1KXHA 2W61A 3N2CA 3ZLHA 1WKEA 4GO8A 3W2UA 3CL6A 4LW7A 2Z7GA 1VFFA 3O63A 1GHSA 5C70A 1NHPA 3ARXA 4AD1A 3GG0A 3MDUA 3PANA 1E6XM 3KP0A 4JHMA 2ADAA 4KCTA 3U5YA 1D7KA 1OD8A 5GJMA 3VAVA 3UT0A 3UJSA 3VFLA 1LL4A 1PZ1A 4UFJA 4ZE4A 3E1F1 3C3NA 1U33A 2WWCA 5LXXA 4RXFA 3APTA 4A3YA 3M16A 3T4CA 2WZMA 1ZJIA 2G37A 3SUWA 1UWQA 1VJSA 2ZX9A 4G8TA 3GDKA 4GYKA 4ALDA 5A8QA 1BXBA 3FS2A 1A4MA 4PMNA 2V82A 4MYXA 3PAJA 1LM1A 2VVNA 2CU0A 3GR4A 3URHA 3VIKA 3QFEA 1IWPA 4ZENA 5A6JA 3ERPA 1K9DA 4BZYA 1UKQA 3ARWA 3WNKA 4QQ3A 4IP5A 5FS6A 4GY1A 4O0KA 2Z1XA 5GNXA 1UKOA 3UJEA 2DZWA 5BU9A 1B57A 2DIKA 1BWLA 3HIJA 1SZEA 1DJWA 2B4GA 3C0SA 3G2GA 3L0GA 3CV7A 1ZNNA 2BB0A 1OFDA 1LLZA 3UWUA 2AAAA 2Z7KA 2PMQA 3NVDA 4JFWA 3FEMA 3G1YA 1H5VA 5L6UA 1JRCA 2WVVA 2YVJA 4W86A 4C60A 7TIMA 4UR8A 1P1XA 4QS5A 3GNNA 3Q4DA 2XSAA 1X38A 3TSMA 2AMXA 1VJIA 3ITGA 4GC4A 3B9OA 1C8XA 1MWOA 1EZWA 1J0HA 1IZCA 1V0KA 3SIMA 3FYOA 5HAOA 1W5MA 3CHVA 1B3VA 2ABBA 4L64A