4KWSA

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
403
structure length
397
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVAYEPADSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with Mg and glycerol
rcsb
source organism Chromohalobacter salexigens
molecule tags Hydrolase
molecule keywords D-mannonate dehydratase
total genus 150
structure length 397
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4kwsA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4kwsA01
3ES8A 2GGHA 2PP3A 3V5CA 1EBGA 3EKGA 3T9PA 4IT1A 4H1ZA 4E5TA 1XPYA 3R0KA 3VCCA 4JN8A 2GSHA 3OP2A 1OEPA 4FI4A 2OQHA 4DX3A 3CT2A 2QVHA 3OTRA 4KEMA 3SN0A 2PPGA 1EC8A 1TZZA 3ENLA 3JZUA 1ELSA 2RDXA 2P88A 3TTEA 1NELA 3UCDA 1SJAA 3ZLFA 3HPFA 3STPA 4Z1YA 3UCCA 4DXKA 1R0MA 4ROPA 2AL2B 2DW7A 2OKTA 4MKSA 3T8QA 2PU0A 3BOXA 2XSXA 2O56A 1F9CA 4DYEA 3I6EA 3FJ4A 4A35A 2PA6A 3ZVIA 3UJ2A 3RO6A 4X2PA 2P0IA 3MZNA 3VFCA 3BSMA 1E9IA 3T6CA 3IJIA 2HXUA 3SBFA 1L8PA 3NZGA 4HPNA 1PDZA 1W6TA 3QLDA 4HCLA 4GYPA 2ONEA 4MGGA 3H8AA 2OG9A 3D46A 2FYMA 3CB3A 1KKOA 4E8GA 3CAWA 3UXKA 3RCYA 1WUFA 3ZLGA 5J04A 1NU5A 4GFIA 4HCDA 4KWSA 1EBHA 2GGEA 3S5SA 1ECQA 3DFYA 3DG6A 3QN3A 3UXLA 1EC7A 2AL1A 2OLAA 2DW6A 3DESA 3TCSA 3UJFA 3UGVA 1YEYA 4IZGA 2PTYA 2NQLA 2PGWA 3VA8A 2PP1A 2OQYA 5IDZA 3FVDA 3SN4A 2PU1A 3ZVHA 3RGTA 2QJMA 3PWIA 1KD0A 2PODA 5FJPA 1IYXA 3V5FA 4Z17A 3DG3A 3TJ4A 3DIPA 3FCPA 4ZCWA 2QJJA 3IJQA 1MDRA 3DERA 3GC2A 3QTPA 2PS2A 3R25A 1MDLA 1EC9A 2QGYA 3PWGA 4J3ZA 3ZVHB 3DFHA 3OW1A 4DWDA 1SJDA 3ES7A 3N4EA 3IK4A 3I6TA 2OO6A 1MNSA 4EWJA 3GD6A 3THUA 3GY1A 4IP4A 3NFUA 3T4WA 2CHRA 4H19A 2GGIA 3OZYA 2HNEA 4JN7A 4HNCA 3MKCA 2HXTA 5FJOA 2GDQA 2ZC8A 1BKHA 2XH4A 3N4FA 3DEQA 2PCEA 2QJNA 3K1GA 3B97A 3MSYA 4A3RA 3R11A 1PDYA 2OZ8A 3H7VA 4K8GA 2OVLA 2AL2A 3MY9A 3KUMA 4DN1A 1KKRA 2HZGA 1FHVA 1BQGA 4KPLA 3TOYA 1P48A 3P0WA 3FV9A 4H83A 3DG7A 3OZMA 1MUCA 4GIRA 3BJSA 4IL2A 3I4KA 3P3BA 1DTNA 2MNRA 2I5QA 3CYJA 4DHGA 1MRAA 4YWSA 2PP0A 3MQTA 5FJRA 4E4FA 2XH0A 4E6MA 4ZA0A 3H70A 4GGBA 1JPMA 3V3WA 1ONEA 2OPJA 5ENLA 3Q45A 1TKKA 1TE6A 1R6WA 3PK7A 1RVKA 3D47A 2P3ZA 3GO2A 1JPDX 3RITA 3VC5A 3CK5A 2XGZA 4E4UA 2P8CA 2PMQA 2QDEA 4IHCA 3SSZA 2OZ3A 2AKZA 4G8TA 5FJTA 3SN1A 1FHUA 3FXGA 3RRAA 5EU9A 3VC6A 3N6JA 1SJBA 1WUEA 2OX4A 3V4BA 3VDGA 3P93A 2PSNA 4GYPC 3PFRA 3EEZA 4HNLA 1XS2A 4K1WA 3CXOA 3N6HA 4KT2A 3MUCA 7ENLA 3MWCA 2AKMA 3QKEA 3NO1A 4HN8A 4JHMA 3IJLA 4GMEA 3JVAA 4ENLA 2GGGA 2MUCA 5FJUA 3FYYA 2XH7A 4F4RA 2P8BA 3TJIA 2PTWA 5BOFA 2ZADA 4J1OA 3UJEA 3S47A 1JCTA 4K2SA 2GL5A 2QDDA 2XH2A 3UJRA 1JDFA 5BOEA 4IP5A 3VCNA 3H12A 3TW9A 3TWAA 3TQPA 2PGEA 4FP1A 2POZA 2OZTA 2OFJA 2QQ6A 3JW7A 3R10A 3TWBA 3Q4DA 4HCHA 4H2HA 3OPSA 3U9IA 3UJSA 4M6UA 4HYRA 4MMWA 3SQSA 3ZLHA 2GGJA 3DGBA 3R0UA 3R1ZA 1KCZA 4GISA 3NXLA 4GGHA 3QPEA 4IL0A 2FKPA 4M0XA 1SJCA 3SJNA 2PTZA 2PTXA 4G7FA 3RR1A 3U4FA 4A6GA 6ENLA 1P43A 3DDMA
chains in the Genus database with same CATH superfamily
1XIBA 1JDDA 4REQA 3MHUA 3PJWA 3HPZA 1TX0A 4I90A 3TW7A 4Q7BA 3GVWA 1EDGA 1VRXA 4QX4A 4V1XA 2FB2A 3VKAA 3R0KA 1BYDA 4TUFA 1EGVA 2DQWA 5D2YA 1RZMA 2ZZ7A 4EQWA 1XGDA 2DV0A 4DJDD 5HUOA 4LCRA 1X39A 4GJ1A 4DI9A 3W7EA 3Q6JA 5LXEA 1EC8A 1GTEA 1XFCA 4H9XA 1PJ9A 3A5VA 2Z1KA 3W6LA 2VRQA 3NIYA 1KCLA 1FFUC 4I7WA 2IQ0A 4AX7A 3IGUA 2ZZCA 4OBRA 4AQLA 3VKBA 2GWGA 4G2DA 3QQ0A 3AIUA 3IPWA 1R86A 1SMAA 1PZ1A 2WLYA 4O15A 3PAJA 4Z0JA 3LLFA 4KWUA 4ZVJA 4ZE4A 4H6QA 3H2NA 4MIMA 2V3AA 5AYYA 3NGFA 3F5JA 3A4WA 1H7RA 4IXXA 1AQHA 1YDYA 2PA6A 3IV8A 4V33A 1P0EA 3GXNA 3IGXA 3SCRA 4DUXA 3NPWA 4H2CA 1T7LA 4W7VA 5CEWA 1E9IA 4YXGA 2OSWA 1FXPA 3N2BA 3EWXA 3H2AA 1ITCA 3PAOA 4PCSA 4ZQCA 4K38A 3HU7A 4GACA 2G8ZA 4AG0A 1GYMA 1EJWC 1TV4A 4YN5A 2ANUA 3MB9A 2ZXAA 4L4MA 3B8WA 1JRCA 2X7VA 2Y1HA 4XZHA 3CB3A 3INPA 4BHYA 3LM7A 3IC9A 5I3KA 3UA4A 3CAWA 4B5WA 5LKYA 3GM8A 4MB3A 3UQNA 4Y8EA 3GXTA 2OLHA 3CMFA 4GFIA 5HJLA 1CECA 4AIEA 4QJ5B 3OGSA 2PZ0A 1XFBA 3AYTA 2QMJA 2QT3A 1LROA 4O18A 4O1EA 2OLAA 2H3DA 3CLWA 1OHLA 2YDQA 2Z1VA 4J3XA 3BAWA 4PUWA 3LGGA 1IIGA 1UR8A 1YEYA 2TSYA 2PTYA 1R2SA 4J4KA 4OJYA 3RNMA 2ACSA 1H2JA 1E5JA 3B8VA 4HPHA 4YS1A 3WH7A 4DZAA 3RGTA 2Z6IA 3NR0A 1EA0A 1OYAA 3PVFA 2PDIA 3BLPX 4QG8A 4ZCWA 3GHTA 3AZTA 1YXCA 3UNDA 3EMZA 1B3VA 2D0GA 3IAQA 2EKGA 4PODA 3B0XA 2ZWYA 4GCXA 2YYUA 2Q01A 4HJWA 5LNVA 3TC6A 4NG3A 1BGGA 4HMEA 3DFTA 2G3MA 1BWVA 1K7XA 2GGIA 3GQYA 2D2HA 3VD5A 1FOBA 1LJYA 3IJ6A 3QGAC 1P0KA 1FFQA 2XH4A 4ACYA 5DMLA 3N2CA 4XSMA 5DBUA 1BTCA 3K1GA 2EG6A 2HMCA 2J6XA 4A3RA 3VGDA 2YA0A 2NQZA 3KM8A 2ADAA 3KVKA 2X16A 2NUWA 3VGHA 2EGZA 5C2GA 3LI0A 1IIHA 2VP8A 4CN1A 4ZMGA 2DSZA 3G3DA 3BVJA 2J3NA 2E9BA 1DPMA 1XCXA 2HBVA 1QU4A 3QQ1A 3RIKA 1D3CA 4ECLA 2X8RA 2ZRZA 1JI2A 4B2DD 4FNUA 4LGXA 1KFBA 2C79A 1PXGA 4AD1A 2QCCA 3O0KA 4MG4A 1K03A 3CYVA 9CGTA 5KINA 3L68A 4H4YA 2PP0A 4AZCA 1TTPA 4HZ6A 2HVOA 4M19A 2X1TA 1UCWA 1D2KA 2H3BA 1QI4A 2PWVA 1BF2A 1RQHA 4O17A 1L8NA 1Q2RA 2ZOXA 3HMJG 4Q4SA 2GSEA 3KBVA 7XIMA 1VJIA 2OWXA 1N5WC 2P8CA 4C6JA 4K1GA 1OABA 4L1GA 1NFBA 2D2GA 5I3JA 1EJXC 4Q8VA 1ONWA 1R87A 3OG2A 3AIQA 1P1XA 4KPRA 2G96A 3IVUA 4IMEA 2O9OA 2XUCA 4AXNA 1SFTA 4Q32A 3AYSA 4AVNA 1Q4NX 2EPLX 4UTWA 3QR3A 1FUYA 2PBGA 2Y8VA 7TAAA 5ABTA 1A3HA 8A3HA 3M0ZA 2W92A 3S9YA 3N18A 3E1F1 1AL8A 3QGVA 4O13A 1UB3A 3URNA 1VFUA 3RDKA 2Q8LA 2WP5A 1QI3A 1BF6A 1M7XA 4F4RA 3GKAA 2YOCA 3ARUA 5I03A 2XG9A 4LOCA 2ZADA 3TR2A 3ZSSA 3FGCA 1K1DA 3UJEA 3KXQA 3U7BA 2WCAA 1DJZA 2AGTA 4MDPA 1HXJA 1J2BA 1VBGA 3UG3A 4PEKA 3CXBA 4Y9MA 3UESA 3A6OA 2CC0A 4DUOA 3AHZA 5LNUA 4TX9A 2UBPC 3MA8A 1RJRA 2YLAA 2I57A 5E5CA 3M44A 1ENUA 3MUY1 1TRDA 2C14A 3W23A 4KGJA 2VHLA 4IG2B 2NXHA 1LOSA 3GU1A 3UZJA 3GUGA 4DF2A 4GABA 1OFDA 4MMWA 2WZHA 4WY0B 1OADA 3R0UA 4GIAA 3B40A 3VDAA 2VD8A 4XZLX 3C3NA 5K2ZA 4F0MA 3UWYA 1A0EA 4LWWA 4S3FA 3V36A 3DZ1A 3QW3A 5G4WA 4EPKA 3FXYA 4G7FA 3B4YA 2VCAA 1I2NA 4ATDA 4B2DA 1K9FA 2IKIA 1UKPA 3VD7A 2XZ9A 2UY3A 1NHSA 1RCOB 4QAWA 1YBQA 3CH0A 4CQBA 5RUBA 3P6LA 4C7GA 1W1PA 2GQ3A 3AN1A 1VHNA 1GQIA 2V63A 4ZB5A 2PRMA 2V3FA 4ICCX 4OBTA 1T41A 4PL1A 2GVEA 1PCKA 2WZIA 4IM4A 4JIHA 1T3QC 3LYEA 3ABXA 2QCGA 4R88A 3LCIA 2XU2A 3KTXA 4NRSA 5BRPA 4UTKA 1W3JA 3GRTA 1T96A 1DWGM 4LX4A 1JAEA 1XH2A 2XZ7A 1EB3A 3E0IA 3K4WA 4E3TA 1Z44A 1J11A 2HWGA 1HJVA 2Q8XA 3ANUA 2UWFA 2VCBA 2CBJA 3LRLA 4IPPA 1RBLA 1YE6A 1IV8A 1SW7A 2PWGA 2ZRUA 1WDDA 1F9CA 5D8ZA 4DYEA 1QTWA 2GVLA 1WZAA 5CPQA 4GKTA 2EQ8A 5BWAA 1H4PA 3B8UA 3RO6A 3REQA 1A3WA 4C6PA 2ZA3A 3IJIA 1UKQA 3EDFA 1CXLA 2HXUA 2BY1A 3LZ3A 4C6CA 4JTSA 4JR5A 3VD9A 3ARVA 1PWMA 1TRIA 3NNTA 3T0CA 1VFTA 4AWEA 1AD4A 3FEMA 3O6AA 3F5LA 1E51A 4ZOAA 1FECA 2VTFA 4OBSA 3IJDA 2X05A 1OBAA 2QW5A 1C8XA 1OFQA 4DO5A 1UC5A 4RW3A 1OIMA 1XG3A 4EIVA 4KWSA 4AX6A 4J56A 2ZUUA 3LS9A 2IUZA 4IGMA 3W02A 1PKNA 4HHLA 4S3DA 1Z7AA 4PR4A 1ZUAX 1IXNA 5AC8A 4LVFA 3VNYA 2IXVA 1YHTA 2Y24A 1R3VA 4XZMX 4WX2A 4PCTA 3MZ2A 3LLXA 4HBKA 2Y8UA 1XLKA 3DHPA 2PP1A 1AH0A 4HB7A 1FBAA 2G50A 1Q6RA 1RM6B 3WJYA 2HJPA 3CM4A 3WDRA 3GKFA 3HW2A 4H4RA 5C2CA 4XUGA 2BXZA 1UIOA 1ZPTA 2HE8A 1HT6A 4GO9A 2HS8A 3PTMA 2A3EA 3AMLA 1XR2A 2VWTA 2YZRA 1J93A 3FYOA 4G9PA 2OODA 3E38A 1YX1A 4D6FA 1O95A 4E2BA 3BH4A 1SJDA 3ES7A 3HJZA 3I6TA 1NP2A 1HKVA 1Q8AA 1TQJA 3LU2A 2YCLB 3AS1A 3SRFA 2VEIA 3DYMA 2V5DA 4HNCA 2HXTA 3FNDA 4AFYA 3CQJA 2W55A 3PPHA 3CC1A 3ARXA 3IJ8A 2E6YA 4U3CA 3BJTA 3EXRA 4GNKB 5I7GA 2EG7A 1M7JA 3DAQA 3EX3A 2GYIA 4DN1A 1SVDA 2WNZA 2CLLA 1CDGA 4MLRA 5HULA 3H4XA 5LXXA 3K4DA 4ZTYA 4PMOA 1UKSA 1IEVA 1KLYA 1GZ1A 3KOZA 5AHIA 1C93A 5JIWA 1NOFA 3W85A 4HK6A 4NQ1A 3OGRA 3BAJA 4E8DA 2WBAA 1OX4B 3R58A 3H24A 4JDBA 3P62A 4PCFA 1E6XM 3QMSA 5B7YA 1QCWA 1V0MA 1PVNA 3C0JA 4G7EB 5IFTA 1CLVA 3GDKA 4JIRA 3B0PA 4K39A 1XYCA 3C61A 5KVHA 3LCXA 1TPEA 3GNRA 2RJHA 4GI4A 2UY4A 3L5OA 5BXPA 2XINA 5HMEA 2NVDA 3DCPA 3RITA 4YCOA 4E4UA 2XGZA 3KVMA 3QY7A 3VIJA 4M3PA 3ARPA 5U7SA 2BOFX 2CIPA 4X61A 1Z42A 5F4WA 4C91A 4IISA 3WKZA 1KLZA 1FHUA 2FJKA 4UQEA 2YDSA 3GDMA 3SUSA 5IBXA 3N6JA 1KBBA 5I5RA 3V4BA 1VFMA 3RYSA 5LIWX 3GXDA 1DIEA 4JTTA 3PFRA 3N34A 3E2VA 5T91A 4RE3A 5EBUA 4BKNA 1MSSA 3N6HA 3TLLA 4ZO8A 4RZ6A 1U1JA 2WHJA 5A6BD 2J8GA 3NZRA 3VOGA 4Y90A 1AQMA 4GRSA 1EEPA 3VZXA 2XGIA 1FDZA 3SADA 4MNLA 1WPCA 5I3FA 5HK4A 3WBAA 4JIIX 5JRBA 2Y63A 2G3FA 4R3UA 1U30A 1WDQA 2QDDA 2X42A 2TMDA 3LHTA 1M9HA 4D1IA 5BRBA 1C9DA 4KW2A 2WOVA 1F6PA 1QNSA 3G8RA 3PZVA 4AVOA 2CW6A 3WQ4A 1OC6A 2FZBA 4FEZA 3VM5A 5D9NA 2PD5A 1UH3A 3SQLA 4WQ6A 1HQTA 2GJXB 1KTBA 3USBA 3NQGA 3MUZ1 5M03A 1DV7A 4XG1A 2PAJA 1XI3A 3R89A 3UZ5A 1HN1A 1XCWA 3LHUA 2O55A 4L6DA 5CLTA 4DO7A 2GOKA 2DQXA 2BV9A 3KAOA 3CT7A 1CGTA 2VCCA 3N25A 4NYYA 4ROQA 3GTFA 1ISWA 5DCEA 2WZMA 5CSUA 4US5D 4CNOA 1ISZA 4J40A 4PMXA 4ZQPA 2I16A 4N4QA 2OEKA 3M41A 1K70A 2OWCA 1RALA 3W7GA 5JIPA 1R3WA 4JTKA 1P43A 4DXVA 4OUEA 3W72A 4DJEA 4FZIA 1VCFA 3SSJA 2ZTKA 1XHCA 4P61A 4NZ5A 4YJ5A 4NZ3A 3WK2A 2ZWZA 2EQ7A 5FSEC 4J2PA 3BQ5A 3PANA 5DELA 3C6CA 4GH3A 3BICA 1D3HA 4JQ2A 5I09A 3SIZA 3GR8A 2XFRA 5AHLA 4ERAA 4DM2A 1OY0A 2J7HA 4K68A 3MU7A 1CI1A 1VCVA 5I07A 1IWPA 1HX0A 4RXFA 3LCHA 3B05A 2YX0A 1ELSA 1GOXA 1WKDA 1R9XA 2Z29A 3C2FA 4H01A 4H3DA 5T9CE 3VIOA 4A3UA 3OQ8A 1TR9A 5G2IA 4AW7A 1H7XA 2VX5A 1YTDA 1J79A 2DW7A 3O2LA 4EPDC 3THCA 2GJNA 2EQ6A 1ZQ5A 4BF7A 4U33A 3TN4A 2XSXA 5KZDA 2WVSA 3BLOA 1E56A 4D8ZA 5A2AA 4FOUA 1O5KA 2E7FA 3W7OA 3AXHA 1F07A 5BU9A 4RK8A 2WSYA 1CWYA 3G1RA 1M68A 3WNOA 3CGTA 3MZNA 4XZIA 3IRDA 5G1YA 4WCJA 4MNMA 3KE0A 1CCWB 1ZB5A 4HHMA 3FSUA 4QDMA 4EK7A 1KQYA 3AXIA 3CHCA 4MZ8A 4D6IA 1K6AA 2R9RA 2YB4A 1LOQA 2WPCA 4AY7A 4HNTA 2GUYA 4BF5A 5GNZA 2WP6A 4K7YA 3LBCA 3RPTA 3DX5A 3N14A 2HROA 1S5NA 3ANYA 4ONVA 1NWUA 4UOZA 1X8CA 3L0NA 4AC7C 1LG2A 4HD5A 4N9DA 3VNIA 2Z27A 4H04A 4UOJA 1TJRA 3OO2A 3RU6A 2ZRVA 1O60A 1M1BA 3O05A 1Q4WA 2QULA 1KM3A 5E9AA 1JRBA 3TMQA 3TYDA 4UTUA 3L12A 1JXKA 2EPNA 3ELFA 1KWKA 1XD0A 4DM1A 1JCMP 2FZ8A 4MJMA 3VIGA 1Q8JA 4GR1A 3B4UA 4JEQA 4FF5A 5BMWA 1R3QA 4ZENA 2EPKX 1H0IA 1KC7A 3C0QA 1F61A 1CW2A 1B2YA 1GQNA 3ZSTA 2GH5A 1DIOA 1GVFA 1G94A 5LNSA 4PRWA 2W91A 2QMKA 5LYRA 1MXGA 4WUIA 3L23A 1IGSA 1OJTA 1SSGA 5EMKA 4ZE5A 2OO6A 1MNSA 1VAHA 3THUA 3LNMA 4C6QA 3M6YA 3RJYA 3R07C 1G7VA 4LF1A 4LVDA 3QYSA 1UW9A 2GDQA 1O68A 3K2GA 2OB3A 3R11A 3WLRA 4Z2GA 5FEPA 4KEUA 4Y8FA 3TN5A 4DLMA 3K4AA 3AFBA 2G41A 1DL3A 2Z6JA 4AU0A 3B8DA 3CZ8A 3HJEA 4J7RA 5C7VA 3CHVA 3FVMA 2YCEA 3APYA 1DVJA 2E40A 1JROA 2ZVRA 4P7NA 4IMAA 2OZ0A 3W2KA 1GPWA 2ZYFA 1E40A 3W00A 4US5A 3XIMA 4OV4A 3RX4A 4L9XA 3M5XA 1FEBA 3SGZA 3E2SA 5FJRA 3TX9A 5EKYA 3BLLA 2BWGA 1VFSA 6XIAA 3ORWA 5BXTA 5ENLA 4F0HA 4GQQA 1TVLA 4BK9A 2A7PA 1UD6A 1X7IA 2GSJA 4FX9A 2B31A 3VOIA 1MFVA 3GO2A 3H21A 2YXXA 1QHPA 4WIWA 1C7TA 2OOGA 2RAGA 3CWOX 5AHFA 2A3HA 3AXMA 3VMNA 2V2CA 3LOTA 2BVTA 2VEMA 3VC6A 4WVXA 5I00A 3FG2P 4IP7A 4KFNA 1UHVA 1B5TA 1ZFJA 3MO7A 4K1WA 3CXOA 1LQ0A 3KVJA 1UR0A 5KZEA 4WRHA 1VQTA 2Z7GA 3O16A 4RL3A 2WC7A 4HU0A 4HGXA 4CD4A 2OSXA 3NUKA 3IJLA 2DPEA 1R8LA 5FAGA 4W85A 5ABGA 4ZQRA 5BZAA 4IMFA 1MZHA 2PDXA 2PTWA 5I06A 1GOIA 3W75A 3AU2A 4R9OA 3QHOA 5I6SA 1XIMA 3QYQA 1IE7C 3UJRA 4Z2IA 4IP5A 4U5IA 2E5DA 3UXDA 4CNTA 1JGIA 3ANVA 4DUWA 5A8QA 1QO2A 3TJLA 2ODOA 1WB0A 2ISVA 2PGEA 3CL6A 1B3YA 4J9JA 2DFAA 3AS0A 3DKJA 4QBXA 4P5UA 4DZHA 3GDTA 2CBIA 1G69A 1HZYA 3LQLA 1HVQA 4MKNA 3K13A 3LN3A 3BQ6A 3IUDA 3GVVA 1XBYA 2DVXA 1ZBKA 1YNYA 3GVQA 4EXBA 3DGBA 3VOCA 3AU6A 4BQ5A 4JICA 3ABQA 1QT1A 2BS9A 2JKAA 3J7HA 5IOBA 2DZSA 3O63A 1BGAA 1PB0A 3CUGA 5AZ1A 1EX1A 4C6MA 5AN7A 1ADOA 4IGNA 3I7QA 3URBA 2FGLA 2Y85A 1GVOA 1FFRA 3OBKA 3EKGA 1H7NA 1ZJBA 3I68A 1TB3A 2V6AA 3KOWA 5C0QA 1W3HA 3NVDA 3WF2A 1VIZA 4DB7A 3BLKA 5AC4A 1XLLA 4DX3A 4WKAA 1I2RA 4DWSB 3NYDA 4PUMA 1GXFA 5CPMA 3F2CA 1GJWA 5JBDA 1Z89A 1GNXA 1ONRA 2QPUA 3V35A 1E4NA 4PFHA 2E1DA 5FESA 3UY8A 3FHQA 3G1DA 1OFBA 2XIMA 2XDFA 4RZ5A 2ZUTA 3QV6A 4CCEA 3UWEA 1SFSA 1HJWA 2J25A 1VENA 1C3FA 2V3DA 4PB5A 4ICMA 3HGJA 3OODA 1XPGA 1RQEA 3UW6A 3LHVA 3SBFA 2XTKA 4KS0A 4GINA 3GVGA 2RGLA 3MUAA 1XC4A 3IK2A 3I7SA 4J3SA 4D6GA 3BURA 2RUSA 1XRFA 3TC7A 4QDWA 2D0HA 3OG3A 2NT1A 3C86A 2RHGA 3IIVA 1ZBWA 4B92A 1JZ3A 1WYIA 2QCFA 3OLEA 4DF1A 1FDJA 1WBJA 3A4JA 3UXKA 1WUFA 4IGHA 5C5YA 1M53A 3NTYA 3W01A 3QZEA 2V69A 4DF0A 4YMZA 2A2IA 2J66A 1AK5A 3M0XA 4DVOA 5B80A 1TCMA 3GYEA 4LAMA 3QMTA 4D1JA 1W1IE 2A4AA 3UXLA 1ZTVA 4V1YA 3A3HA 4J3WA 4AEOA 1WDSA 4DNHA 3UPWA 1TWWA 3WY1A 4P7OA 1KXTA 1UOZA 1KR1A 2G37A 1CB7B 5JU6A 1AQFA 1V4YA 5IM51 3STFA 4BI5A 4HPJA 2JEQA 4KMQA 1EH9A 4ZB2A 4RNJA 3W29A 4LBRA 3EA2A 4MKVA 5DRIA 1TWIA 4TO8A 3VYLA 2A3AA 4W4QA 4JTQA 4HHHA 4Q8NA 3TK7A 1W9UA 4JTHA 4S23A 3STEA 1UP2A 1WXZA 4HNOA 2J8FA 2VUYA 3TROA 3W70A 2V6OA 1W8SA 3IVTA 2CBVA 3IK4A 2X1IA 4WDXA 3NQCA 4H41A 1MO0A 4ZXLA 1A0CA 4H9ZA 2BY0A 4CEUC 3MKCA 3NA8A 3W7JA 3NEHA 2W62A 4M1RA 4AEEA 4QG9A 3SUVA 4GC3A 3AMDA 1D8WA 1S5TA 4DJDA 3LNPA 2HDJA 4WJEA 1ICQA 4PA8A 1VD6A 2ABBA 2G4FA 3TJXA 2BSLA 2QNEA 2VJXA 1QOPA 1E4IA 1WXJA 3TKFA 2IPFA 4YWSA 3TSBA 5AC5A 3CGEA 3P5YA 2QAEA 1WAUA 4HK5A 1LCOA 3QFWA 1I6NA 2BHYA 3DFNA 1F4HA 2ZXBA 3CMJA 1H50A 1PHWA 4D6DA 3MSGA 2FHBA 1TE6A 4NJKA 1PKYA 1R6WA 2Y7FA 2DZPA 3W82A 2GJPA 2WANA 4AMCA 1HL9A 4IIBA 1JPDX 2C71A 3S42A 3LMZA 5CPSA 2YL6A 4IHCA 3THDA 2WNQA 2XWDA 3LERA 1EF3A 1P6BA 4UFLA 3LPPA 4M82A 4HJFA 4QISA 3OVQA 3PWAA 2WJFA 1S5WA 1AW5A 3AZSA 4QGCA 3ZM8A 4KBXA 3BV4A 5FS7A 1LRQA 3A9IA 3C4UA 1LRNA 5HOSA 3HA1A 2D3LA 2X50A 2WMIA 2CXGA 4GYPC 1R3RA 2VFHA 4N42A 4GJIA 4C1LA 3LXAA 4XAPA 5I02A 5JBFA 2WKGA 4U28A 3QLLA 4D9PA 1ZHAA 2CFFA 4B9YA 1F6YA 3BOFA 1QHZA 1YNPA 1DJXA 1F8WA 1B9BA 5LHEA 1P0NA 3F7JA 2Y5SA 3BC9A 1HJSA 4ZGYA 2R1MA 2DDXA 1K3UA 1V3KA 3FHAA 4E3VA 3VZZA 3EMCA 3I65A 4P8VA 3S3GA 2IW0A 2ZXQA 4LUIA 1FH7A 2CLOA 3DKLA 3MP4A 2NX3A 2FVMA 1SGJA 3ITLA 1E4LA 1H62A 4CU8A 1KBJA 2X0HA 3H26A 1B3WA 3AROA 4YPJA 4KERA 5LIYX 1GERA 5KITA 2XIQA 3ZFHA 1HL2A 4Q8QA 4MWAC 4TQTA 5DANA 4AYGA 1OZMA 2R1PA 2XPKA 1JZ7A 1JEHA 3G6LA 2VR4A 5M1TA 4H4VA 5DX7A 1FP8A 1O5XA 1GREA 3QVQA 3S9ZA 4QCFA 1K9TA 1EPXA 1KCZA 1K02A 4UUIA 3EGJA 4LRTA 4C6KA 4DJEC 2ZZ0A 3H23A 5CH9A 3O9NA 2XFWA 3ZMRA 1X6NA 3DHUA 1VJZA 5BXSA 3GNDA 5HMSA 1IT8A 6TAAA 1AW2A 4JBRA 3P2VA 4O1DA 2EF9A 1QBBA 1NDYA 1KM0A 2J62A 4GIYA 4OOZA 3E3HA 3LADA 1F3EA 4QNEA 1OCBA 2E5CA 2QIWA 3WLSA 2V9DA 2D23A 2FH8A 2XIJA 5HWNA 2VC9A 1DXIA 5HJYA 4V2XA 3JS3A 4IFKA 2ZTJA 4FXRA 4FMVA 4Y7EA 1FWBC 1UD5A 2DSVA 4Z2HA 1H60A 4UFKA 2GQAA 5EBAA 4HIBA 4FB7A 4JNYA 1VYRA 4PFMA 2J7DA 3PY2A 2FGBA 1QDSA 1IT7A 4IWWA 3STPA 2ZZ6A 3A9BA 1E1EA 1E0WA 3O1NA 3T8QA 1MWOA 4X9YA 3EUB3 3L5MA 4CD7A 4K7ZA 3O8AA 4LFYA 1WKYA 2JBMA 3GG1A 3WEOA 3ZJ7A 3NQBA 3CHEA 2X09A 5M2FX 4HNUA 4QLLA 3TQ0A 3NZGA 1VS1A 4NNAA 2Z4GA 2J7CA 2OELA 1QJWA 3UF9A 4ML4A 5AFDA 2QDHA 1YQZA 4B3KA 4UR8A 4W8LA 3QGKC 1Y65A 3FJ6A 5C8BB 1RAKA 1VIWA 5LZLA 5HQLA 4JEJA 4WF7A 4WJ8A 3M0VA 3W26A 2QJIA 3VX1A 1F3PA 3N9KA 1N61C 3U8GA 1F5ZA 2VR2A 3S2CA 1V3MA 4RCXA 3TXZA 1XUUA 1CGWA 4QE1A 3QC3A 2NXGA 3S8HA 4NKCA 4CGTA 2VC6A 3KBNA 3EWCA 4GYFA 4MLJA 4ZFMA 5LGZA 2D69A 1D9EA 1J0JA 1S39A 1QWKA 3M46A 5AVHA 3EAOA 5D30A 4XD4A 3WDPP 4ZQNA 1NVMA 1AQ0A 1ZL1A 3NOYA 1Y5VA 3KBMA 4BA0A 1VC4A 5BOOA 5DCBA 3PFMA 4DQWA 1FDYA 3GC2A 4HZ7A 4JL2A 1EKOA 2PS2A 1FWSA 4JTFA 1WKFA 2AQWA 4ZSUA 4NY2A 4C6OA 4O8RA 1ZKQA 1JPIA 1F3XA 5CQ1A 3CGDA 1W5PA 2Z1BA 3QZAA 3B04A 2GK1A 3LENA 1F3TA 5DN1A 3AIWA 4DXXA 5HWMA 1V59A 1O1HA 3P84A 3R6IA 4UQCA 2HK0A 4GUFA 2OGYA 3HG3A 1FA2A 3BXWA 3CV6A 3H7VA 2DEPA 5JH2A 5K3VA 2BVDA 3W53A 4OQVA 2PI6A 3MY9A 1V02A 3FOKA 4GQBA 4OV9A 1N62C 1VFLA 1MUCA 3CL8A 3HM7A 4UXDA 4I5XA 2PDMA 5HPCA 2J7GA 1Q85A 5I3GA 2GK1B 1EIBA 4Z08A 1GCYA 2P5NA 4PSPA 3MQTA 4KWVA 1Y5WA 4ZQOA 1RQBA 4F8XA 1VB9A 3MKVA 4IH3A 4WXYA 3BMVA 4G5DA 1FWDC 3TV8A 4JHZA 4IX0A 1FP9A 3S5NA 1PEZA 2BHZA 3EXSA 3WEMA 4ZTXA 1UP3A 1DE6A 2BVYA 2ZBTA 1RBAA 4AZGA 2GOUA 4FR6A 3SSZA 4HHPA 5FJTA 3GS6A 3CWHA 1UR2A 4HPXA 3TH6A 2WWCA 1RK5A 4O1AA 1A5CA 1VBRA 4JQAA 1IHIA 1J4EA 1E0VA 3VXGA 1THFD 1Q5MA 4GBDA 1MEIA 2QZRA 3WDQA 2XN0A 3WD2A 1EX5A 3KZSA 4KCUA 1LL7A 2W54A 4QFUA 4LV9A 2REQA 4HN8A 4GOAA 4GMEA 2QHAA 3N2OA 3USZA 5FJUA 1ISXA 3S9IA 2PF8A 1UD8A 3O06A 2WOWA 3TTQA 4FLSA 2CBUA 3VTRA 3HIJA 2RDUA 3SUWA 4L6HA 4Z0SA 3M5ZA 1KFKA 3T8LA 2GL5A 2PDKA 2IMRA 3GBDA 2TYSA 3SZ8A 4IPJA 3CU2A 3LXBA 1TYGA 1J0YA 2VFGA 3H12A 2Z00A 5JVLA 3WELA 3II4A 3JR2A 4KRZA 4L1XA 2POZA 3UZYA 3WLHA 1Z41A 4I5UA 5EA9A 4WGHA 3FDKA 4Y9OA 2DH3A 1EWEA 4D6JA 2UY5A 5FS8A 3P8IA 3EX2A 3VIPA 4C6FA 2PLKA 1XKJA 4FALA 3UJSA 1YXYA 2VZUA 1ZRQA 2I17A 2QAFA 2CZ5A 2PWDA 4H7CA 3HFYA 5LA2A 4J2MA 4NASA 1W3LA 1CB2A 3M0JA 3KL3A 1T8XA 2CKSA 5AHEA 4AH7A 3P74A 2J77A 4LCSA 2DIJA 2ZUWA 1F7BA 1X1ZA 1TPUA 1LWHA 5JQ9A 1OYBA 3E74A 1J0ZA 4GWEA 4NXSA 5TD4A 2Y5JA 3LPFA 3COTA 2GDVA 3RXZA 4TXEA 2I7GA 5KVIA 3BLEA 2OYMA 1UR4A 3ITGA 2VO5A 3GE7A 4XUYA 1E3XA 4O57A 3PZIA 2ZUNA 4H1ZA 4NX5A 2Z28A 4UIOA 4KRUA 3LGEA 2HNHA 1OFEA 5HPOA 4F2UA 3LB0A 4UTJA 2ATSA 1Z9AA 4JFSA 4A4AA 3S1UA 3SW6A 1MXDA 1QVBA 1IWAA 4Q3MA 1CYGA 1GV4A 1BPLB 3ALGA 3EDKA 1IXQA 1OINA 3CHDA 1MQPA 4GCAA 2INFA 1POKA 3DBNA 3AXKA 1P0BA 3E0VA 4HK7A 3A7AA 4AVFA 3BMXA 3W88A 3UZZA 1KM6A 3VOFA 3WUFA 1XLHA 1O66A 4Q8TA 2YQUA 3IV3A 1XDLA 3QC0A 4MWAA 1UPMB 3ZS4A 3TUUA 4QJ1A 1C29A 1RJQA 3EB2A 4JCLA 3OBEA 3UD6A 5C55A 4LC8A 3NSMA 3ITTA 2DUXA 8RUCA 2ZRYA 5C71A 1SZEA 1FTXA 1AMKA 1DJHA 4LYPA 4M1BA 3EPMA 4PCPA 3MCOA 1EXBA 3FJ4A 2W0HA 1XLIA 2Z24A 2ZCGA 3VCRA 1S3TC 3KOFA 3OIXA 2VNCA 4LUSB 1VBUA 4ADUA 1I4NA 4DAFA 3E9AA 1CBGA 3DFQA 2VZVA 4MNKA 3C3UA 3ZWSA 2I56A 4DJED 1ME7A 1ZP4A 1OG6A 4S3EA 3VKKA 3P67A 2WMJA 3ZLGA 4LA1A 4LVGA 1H09A 3DN5A 2QLYA 2ISWA 5BW6A 1EBHA 1I2PA 3OVGA 3GH7A 2W9MA 2DUZA 3GXPA 4BQ2A 3T78A 4MYXA 4K8EA 3TCSA 1JIBA 4UFIA 2D73A 3GTIA 4IZGA 3UWVA 2ZX7A 1EJVC 4UTLA 2WW5A 2X2GA 3N73A 2CNCA 5BU6A 1OB0A 2IPJA 1XDIA 2B7PA 2V82A 3OIHA 4D8AA 6ALDA 5E6YA 3MBFA 1ZENA 1ZMCA 5FCZA 4J35A 3BO9A 4XAFA 2QJJA 4W8BA 2OYLA 3N3MA 3QFAA 2VL4A 2XVNA 4OZOA 2HVNA 3QEZA 3FK4A 1QOXA 4HSOA 3WFZA 3GD6A 4WSJA 8CGTA 3WF0A 5CZSA 2WVVB 2E5AA 4FA3A 1UQYA 2EKCA 1FKXA 1LM1A 4TX6A 1OC5A 5M3WA 4LQ1A 4YYFA 3NO3A 3SCSA 5I2UA 1EDTA 4GVIA 4EE9A 2YAUA 3BWWA 2WMKA 1CGUA 3MSYA 1PDYA 2F6UA 1FHVA 1K6WA 1XL9A 2WMGA 4F9DA 3HO8A 3MJMA 1XX1A 3WQDA 4BI7A 2R6OA 4IL2A 1XLGA 1N55A 1ZJIA 3VKDA 3VGGA 1IR2A 3PR2A 4MFDA 3PNUA 1J0IA 3WQCA 2FTYA 3GXMA 3U6WA 1POJA 3QY6A 3CO8A 2JIWA 2XIOA 4H6EA 1I1XA 5TR3A 2VFIA 4LY4A 3AIEA 1OC7A 4J28A 2OQLA 5SWUA 1W9BM 2Z2BA 3C2YA 4TVDA 1XRSA 4DPPA 5E1QA 4CU6A 4GGBA 4EPBC 1MFUA 4MY8A 4NIRA 2Y89A 3OU8A 4WZHA 1W8GA 4Q4KA 5CZ0A 1QBAA 1YDVA 1R3YA 1VHCA 4IMGA 3NQDA 4RV3A 1RVGA 1NWSA 3GAYA 3PULA 2R94A 1KNWA 3WLQA 3EF6A 4R7WA 2WVVA 3AYVA 3OZOA 1D7FA 4EANA 3BGJA 1E3ZA 1QW7A 3CASA 5EU9A 3W7RA 4INFA 4I9TA 1WUEA 3B3DA 1JD7A 2WHKA 3L66A 1FXQA 4Q7NA 1ZBCA 3R8GA 4BJHA 3TIMA 3W7PA 2J9XA 1AVAA 1WOBA 2O9TA 1LRTA 1Q13A 4REQB 3EX1A 3UWUA 5EY5A 4CVWA 1BFNA 2J9YA 3TFCA 2ACQA 4YVXA 5D9PA 1OD0A 1JFXA 1TREA 1DXFA 4I8DA 1UZ1A 1K8XA 3ZYZA 3FYYA 3GK0A 2XH7A 3WZ0E 3TJIA 3Q2DA 5BMXA 4XKYB 4O54A 2VDHA 3T0DA 2XHYA 2FGZA 1JUBA 3W86A 3RR4A 3N19B 1QNVA 5EFDA 4DYKA 4PGLA 4HA1A 4LW7A 4PTMA 1LORA 1SB3B 5F2GA 2G95A 3L4VA 4LYRA 1SZNA 1G6CA 2OT0A 4JXCA 4KIRA 4Q7IA 1R7AA 4XSLA 2QEZA 3LRKA 1E1FA 1P5BA 3W6YA 4AISA 5ABFA 4AZIA 5DMYA 3U9IA 1NWTA 4Y96A 1MQRA 1A0DA 1DIKA 4E4PA 2FMOA 5HMFA 1QWGA 5CG0A 3IACA 4QJ4B 3W87A 4MFEA 5HAOA 4IIEA 2BY3A 4HP5A 4GGHA 1QW9A 3UVAA 5D9OA 3GG7A 4IL0A 3UERA 1RHCA 3LY0A 4HOZA 3IGHX 4M0XA 1PIFA 1SZGA 3C8FA 3D3AA 3TOPA 2PBOA 3SCOA 2OOFA 3AMZA 6ENLA 3W28A 5KTLA 1HKMA 1MUMA 1GVSA 5FAJA 3E0LA 2AQVA 5C9RA 3TZNA 3M7WA 3SB0A 5DFAA 4ATWA 4PH6A 3GW0A 3WENA 4F79A 3NXFA 1FX6A 2YKKA 1Z3NA 5EBKA 1UA7A 3K8MA 1R38A 1W9PA 4IQLA 1EUNA 4ADSA 2Z1WA 1KV8A 3CEUA 3AXXA 2OQHA 4FI4A 3UR5A 3TTSA 2E09A 3OQEA 2CZDA 1KO0A 3OTRA 1QW8A 5FIPA 1L0PA 4MJZA 5DXYA 3P8JA 1QXLA 1EQPA 2Z2AA 3HG2A 4PMJA 2H90A 2AAAA 4X2RA 2NWRA 2G97A 3TTEA 4ZFCA 2GUBA 2EPMX 4H4TA 1UMLA 4UTMA 1JI1A 4B5SA 2BXYA 5A2BA 3MMUA 3EB3A 1NEYA 4XZ9A 4LUTB 3KLJA 4MKSA 2PU0A 3F2DA 1BRLA 2BTMA 3D5HA 5M17A 2C6QA 3GD3A 1WX0A 1BXBA 4A35A 1QAPA 3FJLA 3WFAA 1DXEA 4NEWA 3CZKA 2XFFA 1JDEA 1Y5XA 3GIPA 3VDHA 3W7NA 1PIGA 1ISVA 3PJXA 4L5ZA 4WOQA 3RFAA 3M6DA 2TPSA 5AC6A 2CLHA 3N11A 1K9EA 4WKHA 3I3EA 1BVZA 2FMNA 1TTJA 3DI0A 2V30A 2F7FA 4HU4A 1WXYA 2YXOA 4QAIA 1OK6A 3WYZA 2O9PA 1Q6EA 2FZ9A 2OX1A 1AH3A 3ZT5A 1A5OC 4NL1A 3SCQA 4PBGA 1XSIA 3TDFA 4GNJA 2C7FA 5LIXX 3WH8A 4PUDA 1QR7A 4Z2KA 3K8KA 2NVAA 4GC4A 2V2HA 3MCNA 1S38A 4NF7A 3KBWA 3WLIA 2R82A 1EP1A 3DH7A 4QR6A 2D1ZA 4JYFA 2EHHA 2YBUA 3O7UA 1N5XA 5EYWA 4ACZB 1KD0A 3MDUA 3CNYA 1I8JA 2QF7A 3GTNA 2YIHA 4KESA 3C2VA 5LIUX 1L6GA 3WUEA 5BNKA 4WJXA 2ICSA 5H8MA 4FR1A 4N9CA 1YPXA 1JXJA 2R8WA 1GVEA 4AZBA 1JZ8A 3MT1A 5C6MA 3W1QA 1UYQA 1EC9A 2YCIX 4UTTA 1X8FA 4Y6GA 5LNRA 4LNYA 4MZYA 2BDQA 3MV01 5MHBA 2BZNA 1UROA 5MKGA 3VIMA 3GG0A 1DYSA 5BYWA 5DT7A 2HE5A 3MC5A 4O10A 2PURA 3XISA 1H5YA 3GNOA 3TQVA 3NVTA 4XX6A 4UR7A 1W5QA 4Q4PA 3DEQA 4UMBA 1LQAA 3NL5A 2JGYA 5BXRA 2DT0A 2R24A 3T2OA 1YKWA 1SUXA 3A4AA 5BCAA 5G4HC 4LY8A 1CEOA 3NSXA 2QCNA 4RLIA 3ABOA 4EXAA 3FV9A 3ZJKA 3BJSA 3FDGA 1NP0A 3GXIA 4A3HA 4R27A 2WB5A 3EDJA 3T0AA 1Q1RA 3XINA 4FXFA 3G77A 5F7UA 3RM9A 4I5RA 3UNTA 1QK2A 4F0KA 3WSUA 4M5PA 4BURA 4HYWA 2W0UA 1VFFA 1X2HA 1XBVA 3RM4A 4MY1A 3E96A 4IUGA 2BB0A 2CFYA 4D72A 4JTDA 3GZAA 1GJPA 2ZZ5A 1TKKA 3RF9A 3BGGA 5C70A 3H4KA 2Z2UA 2DJLA 1DIDA 3NDYA 3RPMA 4A8RA 1E55A 2VWSA 3WNMA 1PTAA 1QK0A 4JY8A 5IBXC 3SFKA 2E3ZA 1TJ2A 5I77A 2AKZA 4CD6A 1XBXA 2Q3RA 1OWQA 3VIFA 4JL1A 3W74A 1E6QM 3RHGA 5H8PA 3MBDA 1KM5A 2Z25A 3NQ8A 2E77A 4LEQA 1XLCA 4QJ3B 1JCYA 2PSNA 3NL2A 1HO1A 3KHDA 3LXCA 1DJYA 4GE8A 4PB3A 3UXIA 5D2WA 1FO4A 4C1NA 1AW1A 4JYDA 1TELA 4DZ5A 3MUCA 4NT0A 3TYEA 2AKMA 3QKEA 5HDRA 3QRHA 2E6DA 1JF5A 5FS9A 2O7SA 3GNXA 3VD4A 1M5WA 5A8OA 3H7UA 3CPUA 4LPCA 4UCGA 4BZYA 4ES4A 3B06A 1XIJA 2RKXA 2Y2WA 3UR2A 1LQ2A 3N13A 1GEUA 2E8ZA 2GPTA 4HNNA 1JCTA 4C6NA 5D2VA 1RXOB 3P60A 4BV6A 4UMCA 1RR2A 4LS2A 1NQ6A 4WKFA 3SRHA 5JCLA 4DWSD 3LZ5A 1G5AA 3HMCA 1E70M 1G4EA 2BVWA 2PWEA 2WYSA 4ORIA 3AWOA 4HTYA 3A47A 3EX4A 3KOYA 4W84A 3BCFA 3T81A 5DLCA 5CSYA 3WQGA 9XIMA 5U1OA 1E6SM 3S2LA 3LM3A 3WUBA 1YYAA 1K8CA 1LBMA 3FSTA 1XGEA 4GZ7A 1R2RA 1E9YB 1Q6LA 1IXOA 5LGXA 3VNJA 5L9FA 4F40A 4EMIA 3DFOA 3E0WA 1NWRA 1DWAM 3BL3A 1JNDA 1RUSA 3HPAA 2PTXA 1FWNA 4AHOA 2WCGA 1A5AA 3U4FA 1NHRA 3O0FA 1GKRA 3MW7A 2H8XA 2XJ7A 1M7PA 1GOWA 3W7KA 5REQA 1GGOA 1KCXA 2QV5A 3PB0A 3BGAA 4ZB0A 3NL6A 2PEVA 3L5AA 2PGRA 2G3JA 3R4IA 4LBSA 4AWSA 4DJFA 1O1ZA 2Y7DA 4K36A 4PRTA 1F3WA 3HTWA 4AMAA 3OP2A 2ZDSA 3KOXA 5IDIA 4JX4A 1Z32X 3BLFA 1RJPA 1KBLA 2CKRA 2QVHA 1Q6FA 3AJ7A 2E0PA 3MI3A 2PDLA 4C60A 2PPGA 3KDOA 2VQUA 2J74A 1A5NC 1GVYA 3BPWA 2WO5A 4H7ZA 4PMZA 1Y8BA 3S2JA 4DJFC 3RRXA 1FWHC 4HPGA 3W37A 2WSQA 4PTXA 3REQB 2DIEA 4E2VA 4I7UA 3B03A 2BX7A 4FNSA 4B4HA 3A24A 3FN9A 3UG8A 4ZZ9A 3WNNA 2Q3OA 4AZCB 4EAMA 1J8VA 2IPWA 1ZAJA 3AHVA 3LHYA 1VYSX 5TIMA 1GRBA 5H2ZA 3PZNA 2G0WA 5A6SA 4FXSA 1FWGC 3K30A 2X8CA 5D02A 4L61A 1PDZA 2CDUA 5K9XA 5C9ZA 5CC5A 5LHFA 5D8WA 4UFJA 4ZSTA 1DHPA 2XIIA 2OG9A 4H50A 1HJQA 4CCCA 2FHCA 2FDMA 3RCYA 1V3LA 3G0UA 1TX2A 5CJNA 1OQFA 1BSIA 3S4TA 1C8YA 4JKLA 4DY1A 3H22A 4JHOA 2BY2A 4B4FA 1B4KA 3UWQA 1KRCC 3W83A 3ARTA 4PTWA 3M0YA 3UJFA 4R5EA 1RPKA 1GHRA 1JJKA 1ZAIA 1GW1A 2PGWA 5AC7A 3MSRA 4HA3A 1DWIM 2YB1A 3E2RA 2TODA 2OQYA 3CQIA 1OF6A 1KB3A 4DIAA 3R12A 4O53A 3P82A 2PU1A 1NHPA 4K3ZA 4H4QA 4Y9NA 1BXNA 2FQIA 1BVWA 1R2TA 3EWDA 1N60C 2FTWA 1TJ0A 4WDWA 3DK4A 1SU5A 1R7OA 3LEPA 4C1KA 2ATMA 1MDRA 2PFHA 1GVRA 4Q4MA 1ZU8A 5KEZA 3R25A 4C1NB 3ECQA 3ZVHB 4N0RA 2QCLA 3S1WA 4N4PA 1TQXA 3CIVA 1B9ZA 4ZXOA 3W7MA 4S3AA 4FO4A 1OZQA 3WK3A 2VDGA 3NZQA 4XO6A 3EOSA 1US2A 3H53A 4OGZA 4LAUA 1PKMA 3TW6A 1M6IA 3ZR4A 3PZOA 4X9SA 3FLUA 3CH9A 4FNTA 4J57A 4RR4A 4EQSA 5FOOA 4BF9A 1XIFA 1A5UA 4A21A 1IT0A 3KTCA 1HW6A 4EAYA 1LWJA 3EYPA 4KCVA 1N8WA 3WF1A 4H8VA 2P50A 2OVLA 3AISA 5CSRA 1UMYA 5KSWA 1XBZA 1GETA 4DBWA 2HZGA 1OYCA 1WZKA 3WCZA 3NZPA 4Q8PA 4H9VA 2CYGA 3PG6A 4KPLA 4OE7A 1P48A 2IKGA 4IXHA 4IX2A 1R9YA 2DVTA 3AUJA 4KRTA 3ONBA 4KF1A 3S83A 3H2FA 4G6CA 3I4KA 3NCOA 1OSEA 3P3BA 1MUWA 3PZTA 2I5QA 1WQ5A 3UWZA 2QUUA 3SY8A 2C3DA 3T40A 1H0GA 2D22A 2ZX9A 3T05A 1JYVA 2OJPA 2Y61A 5CPLA 1PUDA 3WEZA 1XM3A 3RNDA 4E6MA 3BE7A 3MUXA 1JPHA 4XK2A 3TE9A 2WZTA 4GY1A 3ARRA 1QFEA 2VELA 1VFOA 1BLIA 4Q8OA 3UG5A 1PKLA 1ONFA 4HZMA 3U2OA 4RPQA 2CLMA 3EAUA 1DJIA 4NX0A 4HMCA 1Q6OA 3T2PA 2A1YA 1T0OA 3BAKA 2V68A 3E49A 2D20A 1AL7A 1DQUA 3KFTA 5IXEA 1B54A 4JQ4A 2DZAA 3B8TA 1I2OA 5A6AA 1X1NA 5AYXA 5CC3A 1BYCA 1RPXA 3C56A 2ZZ4A 5A3HA 3WF3A 4EXQA 2JK6A 2BG5A 1X7FA 4S2BA 2YYTA 3KL0A 1XS2A 1ECEA 5GJPA 1L9WA 1DWHM 1EPVA 3LCGA 2ZFAA 3UYIA 4CNNA 4M6QA 1FWJC 3W22A 1MZRA 4PB4A 3ZJ8A 1LYXA 2GUUA 1T6MA 3B9NA 3T42A 5H6HA 2H9AA 3MKKA 2CETA 2VGGA 3NQVA 1HP4A 3KS5A 1PS9A 1W3TA 5BOFA 3WBYA 4EMWA 2Y8KA 3S47A 5D2XA 3VX0A 3GFXA 1F76A 3M4HA 1TA3B 3K1DA 1UD2A 4ALDA 4RNFA 3IVSA 3IAPA 1B90A 2YL8A 3TW9A 1M01A 2AOSA 1QI5A 1EGZA 3U57A 2DZUA 2WQPA 2FZMA 3FJNA 3DGHA 1F8IA 3GW3A 1SR9A 4FNRA 1J12A 1NY1A 4O4VA 5D4YA 3R10A 2E68A 4C7FA 1V6UA 1QASA 1ICSA 2ZC1A 4H8HA 4F0RA 3SEPA 5FL1A 3EX6A 3VNKA 4JQ3A 1M65A 1RY0A 1V7YA 3R1ZA 3AWNA 4F3HA 2E5BA 1QMLA 3VNMA 4AIOA 4C65A 3NXLA 1FCUA 1SM9A 3VMOA 3PBUA 3URHA 1CNVA 1PAMA 4B5TA 5HNNA 2Q09A 3ABSA 3ARZA 4LIIA 1SO4A 2PDGA 2IXUA 3L21A 1PPIA 1XCFA 4W89A 3II1A 4Y9PA 4PYSA 3DH9A 3EOLA 2HV5A 3BCDA 4FOJA 4U10A 1MW2A 3DGZA 3DYOA 1XF0A 2G4JA 1S1PA 3UP8A 3W7IA 1EBGA 1W1A1 3SUUA 4DO4A 3C2OA 2CZFA 4LAOA 3ABZA 5E9XA 3IIXA 2XVKA 3BZGA 1R46A 1YBQB 4JN8A 3DJGX 2OU4A 3IIZA 1V97A 3SQMA 1E1CA 4UTIA 1XINA 3TFXA 3VIHA 1N2VA 4JGDA 3AOFA 3I6RA 4JQ9A 1LLOA 1T40A 3LCFA 3NPUA 2WKJA 1S2UA 3JZUA 3KCOA 1V0LA 2A7RA 4OVXA 5G2HA 6A3HA 1EJSC 4AB4A 4J3VA 3CAVA 1S5MA 1TV7A 4IPNB 4M7TA 1EUAA 1KW1A 2GQ9A 4KGLA 1ZGDA 1RCQA 3WLLA 1ODZA 1ADDA 3PF3A 3KLLA 3HV8A 1VEMA 2OKTA 4FX7A 1B30A 1C7SA 1ZCCA 1A50A 2BBFA 2BMBA 1ME8A 2UZ9A 3UR7A 4AY8A 3KX6A 4OFCA 2V3EA 4O19A 1U22A 3ITYA 3PJTA 3W27A 2C0AA 3C0LA 3WH6A 2PDQA 3TA6A 2CWNA 5HMDA 1J6OA 5CC7A 3CUXA 2NQJA 1KGWA 2FPVA 3ABRA 3KP1A 3QR1A 2OYKA 2JALA 1F4AA 1UWIA 2GJLA 3H4WA 1FWCC 1S5VA 2PB1A 3WH5A 3QLDA 2HRWA 2E1WA 1X97A 1G0CA 4TMCA 2ONEA 4F9JA 3QSRA 4AD3A 3WG6A 4HA0A 4UNLA 2A3BA 1MMFA 2PWFA 4NP7A 1XH0A 3EKLA 4FNQA 4FIQA 1LZOA 1X2GA 1S2TA 5DMNA 4M6VA 4QSFA 3FAWA 3MI6A 4M7SA 3SIMA 4AZ5A 1E43A 2W79A 1JAKA 3PN8A 2QUTA 3TSDA 1PWLA 1T8QA 2NW0A 3W25A 1W31A 1EDQA 4HTBA 4NI3A 1Q2SA 3NDZA 2GGEA 2YPIA 2DZXA 1Q6QA 3BSGA 3QKZA 1W5NA 2Z7KA 4HU8A 4UTFA 1H2IA 5D2TA 2YDAA 1SPQA 1JL8A 2V5CA 3GNPA 2WMHA 3I4EA 5K4XA 3AHTA 1H3GA 1T99A 2B0MA 1J18A 3FYPA 3PBGA 2Y5EA 4S1FA 1YW1A 3SN4A 3D9XA 4LRSA 2J7BA 4Q8WA 4L9ZA 5EL1A 3V5FA 4MJ4A 4H4PA 1ZSXA 1HTIA 3VABA 2OWWA 2R1NA 1PYFA 1VP5A 3OVPA 5AB3A 3IJQA 1YNQA 1PZ0A 3N12A 3UZXA 4GUGA 1X96A 1T5AA 4WLCA 3QHMA 3OLDA 2ZRWA 3VKJA 3GIQA 1BZLA 3PWGA 2QGYA 1XC6A 5E09A 2ZZ1A 1AOGA 4UQBA 3EA3A 5E70A 3GY1A 2HQAA 1UBPC 2TAAA 5G1TA 4H19A 3KZPA 3EBVA 4NZJA 3WMSA 3WX7A 3HPSA 4FLRA 3UT0A 2OR2A 3P80A 4XISA 4QROA 2YBTA 4XB3A 4JKKA 1JFHA 2V2DA 1BG9A 1LDCA 4JCMA 1EO5A 4UNIA 2OZ8A 1JCJA 2A0NA 3VIKA 4APNA 3KUMA 1HF6A 4DUVA 4FX8A 3QM3A 1J0HA 3AO0A 5EMLA 3WQ5A 3OZMA 3MPGA 4B5UA 2PGFA 5IHRA 4JNMA 4W93A 1R3SA 1GVQA 5HNTA 1E71M 1DKWA 5I24A 1K4QA 3BLDA 4R7OA 1SFLA 3KP0A 3LGDA 3WNKA 1VLWA 2QUNA 1GQKA 3DFPA 4OOUA 5TQLA 4U5KA 1NJJA 3W24A 3U0HA 3TN3A 2WV8A 3O0HA 3Q45A 1FVPA 3KCJA 3GYCA 1VR6A 3B9EA 3CAKA 5D33A 1ZMDA 3VPLA 4W5ZA 5F1VA 5BRQA 3D47A 3OLIA 4Q4QA 4JTAA 1XANA 2WCSA 5FACA 2OZ3A 1AH4A 1Q6DA 2IKHA 5AYZA 2Z26A 1VYPX 3ZQ9A 2VGIA 1YPIA 3FXGA 2J7FA 3I7RA 3VAVA 2Z1SA 4UMAA 3FKRA 3TYUA 3VDGA 5K7JA 3CS2A 4J27A 1HKJA 4C6EA 2YJQA 5I79A 1CIUA 5CZKA 3PJUA 4FIRA 3BARA 3KS6A 1GOMA 2ZRXA 7ENLA 3MWCA 2OEMA 3KRUA 1BHGA 4B5NA 4AAJA 4PUNA 4A8IA 2E3TA 5FD0A 4GVHA 4J3UA 4NZFA 1GOKA 4G1KA 2MUCA 1ZZMA 3Q94A 3ZJ6A 3M47A 4LS1A 4J1OA 3OGVA 1OF8A 3U3HA 3W1PA 3SQPA 1Q66A 5CPOA 3LLDA 4PN2A 4NJJA 3F4CA 1GONA 5BOEA 1MVYA 4XVDA 5JUVA 3MJYA 2VD9A 3THQA 3V1PA 4Q8UA 4AZHA 4DWSA 3TWAA 2X30A 4FP1A 3BDKA 4U3AA 5G2WA 2VC7A 1GKQA 4GXPA 2OFJA 4NNCA 3OLGA 1LOLA 2ZIDA 4GQGA 3DUGA 3MANA 3P7YA 4UTWC 3L7RA 3SCPA 4L64A 1QI0A 1XDMA 1UKOA 1QNOA 4AY1A 4A05A 3L2IA 4KWWA 4O0KA 5T26A 1XYBA 3VFLA 4FDCB 2E4TA 2A3LA 4AYSA 1KV5A 4GLEA 3R8RA 5GVJA 3SQSA 4DWSC 3A5FA 3TU9A 2RJGA 2R14A 4GO8A 1VZWA 1U1HA 3HGOA 4EM3A 3E0FA 5HXMA 5G4EA 1H1YA 1XGZA 4RE2A 4LUSA 1PX3A 3W9ZA 1KTCA 1YLVA 3S0CA 4LVBA 2PP3A 3ZIZA 4UQ9A 3ALFA 4PSRA 3VOJA 2BC1A 1TUFA 3W07A 1TFVA 5K9DA 1W2PA 4RXGA 2V67A 3CV2A 3DXIA 4U2ZA 3U48A 3QPYA 1X98A 3GC4A 2J7EA 3PB2A 1RH9A 2XM1A 2KAUC 1JZ2A 1KRAC 3PZQA 1TZ9A 2D2JA 3NPXA 4LXFA 2I1OA 5G5IA 3BG9A 3GFZA 7PTDA 2PRHA 3DOPA 1Q6CA 1B0IA 1CZ1A 1LLWA 1VPXA 3UYCA 4H6KA 2RDXA 2JKEA 4WR3A 1WOAA 1A47A 2F61A 4ORMA 3FA3A 3TN6A 2ZE0A 5AHNA 2J6VA 5XIMA 1CGVA 3DJJA 4DXKA 4CLMA 1SSDA 3W84A 1JCLA 3CZJA 1ITQA 1A4LA 2FFCA 4HQVA 4J5NA 1IZJA 4WY0F 1V6XA 4AXKA 5KETA 3CGCA 4WHBA 4XWUA 3R94A 4JFUA 3SRDA 1LWIA 1VLIA 2J27A 4Z1AA 3GFYA 4JN6A 4A2SA 2P0IA 1XWYA 4PRRA 2PDBA 1UZ4A 1QATA 4AD4A 2P1FA 1PV8A 4QITA 1Z69A 2EQDA 1UWAA 2GDUA 4KH2A 2GZXA 3GTHA 2GJRA 1RY8A 1EOMA 2CITA 4W87A 1VPYA 2FYMA 4QDPA 3W6MA 2J24A 1SMDA 1VRDA 3NG3A 4E2DA 3PTQA 1FWFC 1NU5A 1UBSA 4RKAA 3NGJA 1O4UA 3W1TA 5CCZA 2RDWA 3S6TA 3G0XA 1JDAA 4NAEB 2WNWA 3QN3A 3VK5A 1V77A 3HGRA 1RK6A 2ZX8A 1OX6A 4L65A 2IPGA 1RLDA 2W66A 4JS3A 3UGVA 5FF2A 2OCZA 4IICA 4RX0A 1BVNP 3GH4A 1ONXA 5GRTA 3FVDA 2WOQA 2V5JA 1BG4A 3E5BA 2XVLA 1GESA 2F6KA 2E8YA 3QF0A 1J96A 4H00A 5ECUA 4Z17A 4XD3A 2JKPA 3VKCA 5KZMA 3MSDA 1JZ6A 2VEKA 2VYOA 4XO7A 3TA9A 5D38A 5I23A 1GRTA 3DERA 4DRSA 5A95A 3LTSA 1PTGA 4XKMA 1GOOA 4NEVA 2H9AB 1XLMA 1K8YA 2OGJA 5D32A 3N4EA 1VFHA 3C0SA 2ISSA 2VRJA 2JQXA 2I5IA 3GNNA 4Q33A 1UR3M 3SCVA 5CBBA 2NXIA 2Y7EA 3OZYA 4GZEA 1R5YA 3B9JB 1AG1O 5I78A 2C0HA 4WD0A 3NQ2A 4M24A 1S2VA 1VKFA 3GU9A 5F4XA 2PCEA 5E0FA 1IQ8A 1JF6A 3NDOA 4AUBA 2CEQA 4JTEA 1V93A 3M5VA 1FQ0A 2LLEA 1XIEA 3T0BA 1TIMA 5F2MA 4E2OA 3RX2A 4N02A 2WBKA 4QS6A 1W54A 1CXHA 5AKQA 1V7AA 2X7WA 1E6PA 3IARA 4TV5A 3G1VA 4GA8A 3TNBA 2Q6ZA 3HGSA 3ITVA 3PZ9A 4KEVA 4PE8A 3QZ6A 3A7RA 3BMWA 1L6FA 4URIA 1WE5A 1JG9A 4IIGA 1WAWA 2CHNA 3DC0A 2HPMA 4RDZA 1TPB1 4PMRA 2YBVA 4QLKA 1C8QA 4OU1A 1ONEA 3GDRA 3T4CA 1LTDA 3NYZA 1EYWA 2O4QA 3OA3A 4R34A 4U4MA 1V02E 2HTMA 4KCWA 3ZWTA 3VC5A 1XW8A 3M7SA 2VZTA 3EWYA 1IEQA 5G1MA 3WQEA 2AAMA 3ERPA 1M03A 3MHGA 2WM1A 6CGTA 4DAIA 2BGQA 4FLOA 5JCMA 1TPDA 2OX4A 4GBUA 4IIDA 1NDVA 5CPTA 1AJ2A 2AMXA 4JTRA 3EZ4A 1SO5A 4YTRA 3D6NA 4I6KA 5HINA 1NFGA 1XYAA 2X40A 4DYJA 1HKKA 4JHMA 4U2YA 1BWKA 3GR7A 2QJGA 1H1NA 2FPTA 4IF2A 3EEGA 4LTSA 3CPGA 8TIMA 4A3QA 1US0A 2NQ5A 4AEFA 3SURA 4CD5A 4CCZA 4V28A 4X60A 4Z2LA 5CXPA 1IZCA 1O7AA 4M81A 5AZ0A 2O0TA 2QCDB 1GKPA 4JFWA 3OHMB 3THAA 2J75A 6REQA 2VEPA 3PSWA 3WLOA 1BTMA 2POTA 4IIFA 2ALDA 2NVCA 4QEHA 4B90A 1A53A 1R3TA 2X0SA 2JGQA 1OK4A 5CSSA 2DZTA 4NJHA 1KM1A 4YLWA 2VMFA 1TTQA 4UZUA 3V0TA 5FEZA 3LD5A 1KM4A 3W73A 1XLEA 2FZNA 4TTGA 4AC1X 1TCDA 4HYRA 1EOKA 1IF2A 2XVPA 1EQCA 3EWUA 4KIEA 3QW4B 2F38A 4QG6A 4CKQA 4GISA 5A8PA 1UA3A 1H41A 4P7LA 2V8ZA 1GQJA 4PULA 1VQZA 3QTGA 2VX6A 3E02A 1NF7A 3LCWA 4OHQA 1MQQA 1X1OA 4X0VA 5H91A 1XIDA 3U4AA 1U83A 4HKPA 3WO8A 3RG6A 2XN2A 2BC0A 3CIWA 2FPYA 3STCA 2SFPA 4H4IA 1ME9A 5HA7A 1KBIA 3HG5A 1KXHA 1IEIA 1O5RA 5DEZA 1MYRA 3ARSA 4LAZA 5DBTA 1IWBA 2DORA 4QTGA 1JD9A 3M5YA 1E73M 3A12A 3GRSA 3W2UA 9RUBA 1FH8A 2V0TA 3PZMA 2EQ9A 5AYBA 4IMDA 3BOXA 5CG7A 1NDAA 3VUPA 2QGHA 3V16A 3CZGA 3FA4A 2ZUMA 3RLGA 2QS8A 1RP9A 3L0KA 5E0CA 4Z1BA 2VUNA 3RCNA 3ZVIA 4E38A 3DFSA 4XAZA 1TYPA 2PTDA 5FEWA 3VFCA 2PLCA 4PTDA 3QHNA 4RDWA 1L6SA 2VENA 2RH9A 3LRMA 3RLVA 2X0YA 3UU0A 1XG4A 2NVKX 1Q7ZA 4QRNA 1DP0A 1W5OA 4D71A 5CZTA 4PBFA 3MMWA 4WDUA 2GQ8A 3WLJA 4O16A 3CO4A 3A64A 1XIIA 1GEHA 3D46A 2NZLA 3R0DA 3SUTA 1PYMA 1LL4A 3GR4A 1OFAA 1HKWA 5DXXA 4EKJA 3P0XA 1H61A 4K6AA 3G1XA 1MW3A 1YQ2A 4HYVA 1H6VA 3MI2A 2WNNA 4ERIA 4J3TA 4RJEA 1HUVA 1ECQA 3DFYA 3DG6A 3E2QA 3PHAA 3UXAA 4D8LA 4O52A 3LHWA 3AMGA 4K8DA 4ZO7A 1GTHA 1W2VA 4B5XA 3CTLA 3TYZA 3UWWA 1XSKA 1TPVA 3NPVA 2WPEA 2F9RA 3PC0A 3JRKA 3OB8A 5BWFA 3B8SA 2XSBA 2QJMA 3A23A 1N63C 1NPXA 1K4GA 3AICA 4QSHA 1CPUA 3TAOA 5K9CA 1U5JA 3AIBA 3W1UA 3F1QA 4C5YA 1Y7VA 4MDOA 5JBEA 1FHLA 1GYNA 4QIUA 4H9MA 2CESA 3T08A 3EXTA 2DUAA 1TTIA 3RLHA 2XM2A 4J3ZA 4F0SA 3RN6A 3OW1A 4DWDA 3V0UA 5HR6A 5JCKA 3VVGA 4V15A 3URQA 2J8TA 4HNVA 2GQWA 1B3OA 3T4WA 3CQKA 4RUBA 3T2QA 2C3CA 3ATZA 3HZ3A 4PMQA 2J78A 2V3BA 2JEPA 2BNJA 3HFTA 3N4FA 4O0ZA 2Y70A 2VT0A 3SECA 3B97A 5E93A 1H51A 3CPRA 1F05A 3WLNA 3W1LA 4RNHA 1GZGA 2NT0A 3GIYA 2PDUA 4ILSA 1W37A 3IUHA 3P0WA 4PMNA 4K7VA 1A5KC 1FWIC 3POCA 2WPFA 1JOAA 1EWDA 3S6OA 3T44A 2IKJA 1STZA 3H2EA 2JF6A 3UR8A 3WQ8A 1W1B1 2W67A 1J5TA 4GQ0A 1QPOA 4TX8A 1NOWA 2VKZG 4EP8C 4OKDA 2INEA 1PO9A 1H11A 1O12A 1LF1A 1W56A 4DO6A 2VEGA 3L4XA 4MAZA 3WQVA 4HMDA 2AGKA 5A8MA 4A2RA 3W7QA 1HIZA 1D7KA 4OECA 1LBFA 2DVUA 1W1YA 4Z42C 1JZ5A 5J5RA 4GZJA 4IQJA 3UG4A 2HBXA 4EMJA 3EDEA 2W4XA 4ZEPA 2REQB 2CZVA 1SR0A 5ECVA 1E9LA 2VVNA 4K8HA 4BCEA 3NO5A 2WHMA 3RRAA 4GQRA 5IRPA 2F2KA 5GJMA 2VFEA 5FKYA 4DJFD 1A5LC 3KWSA 4DI8A 3BK0A 3ATYA 2PZNA 1NDZA 3PS7A 2BLEA 2BP1A 3EEZA 1NQKA 3NVZB 3CAQA 1FWAC 3ZR5A 1W3IA 5A69A 2QUMA 3G22A 3QFBA 3HURA 2H6RA 3QV7A 1OFOA 3ZT7A 1LG1A 2Z1XA 3GG8A 2B7OA 2WJDA 4X63A 2NUXA 3IRSA 4XKYA 2EPHA 2WSRA 2QVNA 2E6FA 5PTDA 1GJUA 3M9YA 4BEUA 2C19A 4LUTA 3M0KA 5CJ5A 1V3IA 1FRBA 1UASA 3MMDA 1JDFA 2OMAA 3VCNA 4JQ1A 3N9SA 1JDCA 4JNZA 2YSWA 1NAL1 1TVPA 4MUPA 3U2EA 1TO3A 2X2YA 3IJ7A 1AA1B 4TV6A 1E6NA 4EOUA 4ZR8A 2F2HA 3H2OA 4PMUA 3Q4DA 5LA0A 4H2HA 4QE5A 3QH2A 2UY2A 2FVLA 5D09A 3QOKA 3E5PA 4CD8A 1FFVC 2DT2A 4DNMA 2D3NA 3WMBA 4DEFA 1DWJM 2FVKA 3NEVA 4A29A 4HOXA 3LUTA 4LVAA 3EB4A 3W3OA 1SJCA 1N8IA 3WLKX 3LDVA 2NQ9A 1WV2A 3CTTA 3DDMA 1RD6A 4WY0A 3U5UA 3ES8A 2BGSA 1J01A 4W86A 3UZWA 4LB4A 1FH9A 4L4LA 3T9PA 4LH8A 4E5TA 4LALA 7TIMA 3PUEA 4JDRA 2ON3A 2A6NA 2F5ZA 2PLMA 2ZX6A 1K9DA 1TYTA 1REQB 1UPPA 2YL5A 4LYKA 3GVRA 2CLEA 4B3LA 3CB8A 2HCVA 2D0FA 2RABA 4KEMA 4XZWA 3S2NA 1B3ZA 2NV2A 2XWEA 1NH6A 2E6AA 4CVUA 3IIOA 1V5XA 3TNOA 1C9WA 2QKFA 3T1GA 1VDVA 2CLFA 1MOKA 3ZLFA 2YW3A 3VIIA 4DBSA 1HGWA 1BWLA 3T7VA 3WQWA 1NIUA 1Q45A 1RLCL 5AHMA 2ZDRA 4AD5A 1Z48A 3FIGA 5D05A 4OIFA 4BEQA 1JQXA 4NVTA 2BGNE 4L1WA 1UWSA 1JPKA 5DCDA 2OXNA 4O28A 3UJ2A 4QS5A 4YHGA 7A3HA 2ZA2A 1XYFA 3PG9A 3LSBA 2B81A 4YIWA 3A21A 4D2JA 3VI2A 3PUDA 3APGA 4GIEA 3CUZA 4KQNA 4HPNA 3UPBA 4YHEA 1W6TA 3LPGA 3DECA 4XIAA 4ACZA 2B7NA 5DQPA 4FNPA 4A8LA 2PDHA 1W9XA 3ZO9A 3H8AA 2TPRA 1LVLA 4GPNA 1BEUA 2VGBA 2PDWA 4AF0A 4AHPA 2YFOA 9XIAA 1FEAA 4N6FA 1W3KA 4F48A 1XIHA 4DBUA 4UCFA 1GVIA 1BKSA 3WJWA 2FZDA 1YIXA 4AZ7A 2W27A 3MCMA 1JUKA 1GEQA 2QR6A 3ICJA 1F8MA 1GW9A 3GC5A 4F0LA 2P76A 1J2WA 3A13A 1OX5A 3SGGA 3A3XA 2NV9A 3FX4A 3VMPA 1ADSA 1GYLA 2EAWA 3N3TA 5DMMA 3VE7A 1JULA 1B3XA 1U1UA 3P5ZA 3G2GA 4HZ8A 5AECA 2X8HA 5A94A 2JE8A 3VA8A 2VURA 4PTNA 2O4MA 4DBDA 3JUGA 4Z1CA 4NSBA 4M8UA 4S3JA 5T8GA 3WLMA 4JTGA 4FX6M 1ZY8A 3BG5A 2VC5A 1XYZA 3L4UA 1M7OA 3DG3A 4WK9A 3TJ4A 1R30A 4CQ9A 4YWIA 1NFPA 1GSNA 4GH1A 4AD0A 1W1ZA 4AHQA 2YVFA 5J8LA 1H7PA 1VGAA 4RZBA 1O94A 3NOEA 3UGRA 3BCJA 3VO0A 1I0DA 3WDHA 2V5BA 3NJ3A 1ZY9A 4IP4A 3VD3A 4KCTA 1TG7A 1P4CA 3LV5A 2DZBA 5A2CA 4JN7A 3VOHA 5E0KA 1YDNA 3BAIA 1W0MA 3S6DA 4IQDA 4DPQA 4MJ2A 1WDWA 4XAYA 2UV8G 1EFZA 3NVWB 1MW0A 2QJNA 1DE5A 3S1VA 2W63A 3CEPA 3FGCB 1MO9A 1G4PA 4YTUA 3W7DA 3WNPA 2ZICA 4FK9A 1F6KA 1KKRA 3AS3A 1BQGA 2VXNA 3ONCA 2CPUA 4UQDA 1DWFM 1FWRA 3CLMA 4DELA 3QBUA 3DG7A 4N9EA 3KRZA 4HU3A 5HQEA 3U7VA 1CXIA 3O07A 5FJJA 1NOUA 4KETA 1B31A 2Q8ZA 1PZ3A 1GRFA 3LB8A 1JVNA 4MY9A 3LCLA 4H7VA 4E4FA 2VOTA 1TWSA 3GTXA 3B0UX 3CBWA 1J0KA 1JPMA 1WZLA 3CMGA 3W71A 4NHVA 5DRCA 1V0NA 3SFWA 1Z6KA 3HOJA 4YL2A 2A6LA 1WO2A 4MPKA 2QYGA 4JTUA 1DHKA 2PUZA 1VPQA 4GVFA 3ITOA 2I5GA 1JRPA 4G8TA 4ZODA 2WOIA 3FW6A 1TUXA 2CERA 3SN1A 3L4TA 4N9BA 5CJMA 3EWWA 2A3CA 2CWXA 3R13A 2DZVA 4XD6A 4AZ6A 1SJBA 4TVYA 3NQ6A 1O5QA 4UR9A 2PDCA 3RO8A 3GAKA 3STGA 2HPIA 1SZRA 2WKLA 4X22A 2FIQA 1A4MA 1REQA 1ZS2A 4RDYA 3C2EA 1AMYA 2BODX 1UG6A 1TMQA 1PX8A 3IEBA 1GK8A 4CQCA 4XAGA 4NNBA 1BXCA 1L6WA 4ENLA 3K5XA 4GI6A 1L2UA 2VFDA 3MHFA 2P10A 3GDBA 1EJUC 2XH2A 5HWJA 1U5VA 4R9XA 3UA3A 3PBMA 2Q02A 2YCJA 5M5DA 1EL3A 3SY5A 2QDGA 3TQPA 5REQB 2Z0IA 3AAMA 1XICA 3TMLA 5CBIA 4C6IA 3NSNA 3PBVA 1CT5A 1I9CB 4O0QA 1XLFA 4BQ4A 1LP6A 3NQMA 1W9VA 4NAFA 3Q37A 4IJBA 3W7CA 4PEEA 1GRAA 4BI6A 5F4SA 2J9ZA 1Q1WA 4FF7A 4C6BA 4I9AA 2GR0A 4XVEA 4GX9A 2GGJA 4RV8A 1ALDA 5HQMA 2NLIA 1WZMA 1TMHA 1JQVA 4XBJA 1BYBA 4GD0A 1W1VA 4BS0A 4MF4A 4E0CA 1KN0A 4YTSA 4B15A 3VDCA 4S3BA 1UJPA 3KEHA 4LB3A 2XYLA 3M0LA 3VGFA 1KCKA 1QPKA 4NAEA 4AWTA 4W7WA 4FOKA 1GUVA 3PBWA 4R33A 4LS0A 3V5CA 4FLQA 4BFAA 5DO8A 4L4PA 1XPYA 3JU2A 1CXFA 4UQAA 4JIQA 2J88A 3DC8A 2QUVA 2X99A 4GI8A 1EO7A 3GU2A 3NZ1A 1JR1A 4L4OA 3L9CA 2P88A 2I14A 1E15A 3VM7A 5B7ZA 3HN3A 1V0KA 2VOMA 3L0GA 4W88A 2QCHA 3GLCA 4H4SA 3AZRA 3VGEA 1HGYA 3UCCA 1TJPA 2AL2B 1LBLA 2E9LA 3EWBX 4D6HA 5K4ZA 2PDNA 2YCLA 3ME3A 4TU1A 4IJRA 5EMJA 1Q6GA 1OGBA 2X1RA 3VINA 1SZFA 3NQ7A 2DSUA 1XRTA 4YVPA 2WMFA 5EPDA 2W3ZA 1UH2A 1TV5A 3HB9A 3LV6A 4CN6A 3T6CA 1RD5A 3A4XA 3LTYA 3TTOA 4LCQA 1DBTA 2WSPA 1TPH1 1S2AA 3BSHA 1L2QA 4HCLA 4L6OA 3AC0A 4OT7A 1JUEA 1UD4A 3O6DA 4MGGA 1QOQA 1CTNA 2ZZ2A 3P14A 3NS1B 4AIUA 2V81A 4U31A 7CGTA 2VX7A 4Y2WA 1V51A 5F2LA 1U33A 2Y4SA 1XYLA 3Q58A 3FEQA 3C5QA 3VNZA 1WNOA 3WBWA 4JTLA 1UIPA 3DI1A 5KZ6A 1MI3A 3CZLA 4B91A 4OTKA 1J5SA 1FCQA 3KVLA 3H55A 2D24A 2HSAA 1TV3A 1X38A 5FF4A 1P7TA 7REQA 4S3CA 2WXDM 1EC7A 2WK2A 1JCNA 4QNWA 3BUVA 4JOMA 3VILA 1FWEC 3WL0A 3KDNA 2A79A 2QV4A 3MMTA 3BAXA 4GRTA 3WD0A 3N9RA 3LG3A 4O14A 3P81A 5EMYA 1H63A 1YRRA 4F2TA 4ZO6A 3MP5A 4NUWA 2PODA 3NURA 1FHDA 3UPMA 4Q6XA 3T07A 3RLUA 1P7TB 1UZDA 1CLKA 1US3A 1TE1A 4F66A 3AJXA 3B0VC 1UP0A 3PUGA 1TIWA 3QTPA 3TP4A 3DBPA 3GD4A 2A5HA 3PP7A 5C9WA 2ZA1A 1A5SA 4LANA 2IQTA 3O15A 4ADTA 2W3RA 2WLZA 3K8LA 1NHQA 5I3DA 4CQ8A 1XSJA 3B8IA 4ADWA 3NFUA 1KXQA 3N2MA 3L4ZA 4MADA 1OVDA 3H2CA 2YGYA 1U2YA 1C91A 3G1YA 2JK2A 3CZEA 4TIMA 1KA9F 1KRBC 4N6EA 2P53A 5CZJA 4XBKA 5A6LA 3O6CA 1XLBA 2E28A 3NVYB 4C90A 2NUYA 3ETRB 1LLZA 1V3HA 4DNAA 3IGSA 1YTKA 4ZOEA 3G24A 5CC6A 3NWRA 4UWMA 4G1NA 4JDYA 4K37A 2PDFA 4I3GA 5J5DA 1CGXA 4LNCA 4GIRA 2PRLA 1I2QA 4IIHA 1I1WA 3SCNA 2VGFA 3MWAA 5CAHA 1CENA 3W1MA 1N7KA 5C9XA 1SW0A 3RJXA 3BW4A 4XV0A 4O8AA 4Q8MA 4KEZA 5FF7A 1TSIA 1DTUA 3BJFA 6XIMA 3AMKA 3N6QA 2O92A 2F6XA 1LPFA 3OA5A 3CV1A 1PE1A 3H70A 4YYCA 5ER0A 4C6LA 3TYAA 2OO0A 3GB6A 1ODUA 1MRQA 4EWND 1B4EA 1ZX9A 1Q7MA 3GSMA 3CJPA 3A7UA 3CV7A 3BW3A 5U25A 2R1LA 3CK5A 4F2BA 1HVXA 2PMQA 2QDEA 3ARYA 4AWUA 2YR1A 1P6WA 3RX3A 1GG1A 3DHFA 4D6CA 4I9JA 2PDJA 1EHNA 2DT3A 4N2YA 3OC4A 2CLKA 3FKKA 3PG8A 2WHLA 3RUBL 3CIXA 4LJ3A 2YVGA 1HL8A 4PL2A 1UWRA 3HF3A 1EP2A 4EX4A 1K4HA 4CUCA 1B1YA 3OEXA 3V1HA 3M64A 1DJWA 2HK1A 2YZ5A 5DT5A 3HRDC 3W1NA 4QQUA 1TWDA 2WZEA 3MS8A 4H4ZA 3RU8X 1OT1A 5AYIA 3GHUA 1IEWA 2P8BA 4TMBA 4JZ5A 5HATA 2OTDA 3L5LA 4IOTA 1RBOB 4Q4RA 1QPQA 4PC8A 3S5ZA 1RV8A 3SM0A 2XVGA 1DORA 3WIJA 1XV8A 1FKWA 5HR7A 1G4SA 3CHFA 1VEPA 1AJZA 2PC4A 2WM0A 4B3ZA 4NZ1A 5A5WA 1YXDA 3BANA 3OJGA 2OZTA 3EMQA 4BY3A 3LPOA 2OEJA 2X41A 4NRRA 2C91A 5FA5A 2F84A 2V5KA 4ATLA 3W2MA 4G56A 2EG8A 1Q7QA 1WDPA 5HANA 1LUCB 3SRKA 4TVWA 2JFEX 2ZKMX 1OCQA 4B5VA 3B9OA 3WH9A 3HQOA 1QNPA 5AVNA 3WL1A 3L2LA 1MEWA 4H9YA 1ZJHA 2I9EA 3QPEA 3KCLA 1RA5A 3IWPA 1PZ2A 2C13A 2DSWA 2GWNA 4UBPC 3SO7A 2PTZA 3TYCA 2XSAA 3NL3A 3LK6A 1PX4A 3NM1A 3POHA 1KTNA 5BROA 3GUWA 4M56A 4S38A 2NX9A 4GY0A 3ARQA 4MUZA 3HG4A 4LAKA 4B16A 2GLKA 3GHRA 4IT1A 4WGXA 3L4WA 3VCCA 1IR1A 3GRIA 3ITCA 1OCJA 3W76A 2PF0A 4WOZA 1P1MA 1ML1A 4HSNA 3W2LA 1BAGA 3LHZA 1A3XA 5T9BG 1CXKA 3V75A 3AIVA 2EXOA 5F2IA 3YPIA 2NPXA 1MNZA 1UH4A 1TZZA 3H54A 4FS9A 2WVUA 3SCUA 2ZQ0A 3QJAA 3UCDA 1V8EA 2VFFA 4MWAE 4Z1YA 2GVJA 3WBEA 1OD8A 1EA9C 4KFPA 4YCPA 1NDWA 3R8HA 1D8CA 3W7HA 1AZ2A 3T0TA 2WJZA 1BD0A 3H4GA 4JIPA 3W2JA 1DXLA 1YPFA 2H8ZA 1PCWA 1A49A 1NSJA 3EPNA 3I6EA 5C7HA 6REQB 1BWCA 3R5EA 3VDBA 3SCTA 2A7NA 4MNJA 5CGQA 3SY1A 2YCKX 1GG0A 1UUMA 5GJNA 4CCDA 3WJXA 2ZUSA 2CCRA 2E67A 1E9ZB 5IHSA 4XBSA 2HEJA 1UZHA 3MYPA 2HS6A 3QV8A 4P7RA 1GRHA 3KBSA 4LSBA 1I0BA 1WBHA 1LL6A 3G1FA 3MTWA 1KKOA 2C1HA 2E25A 1FWTA 3ID7A 3E12A 4O1BA 4IG2A 3EANA 2C15A 4HCDA 1TJ1A 4W8AA 1TWZA 3GH5A 4JY9A 3OHIA 3S2MA 4JAWA 1LUCA 5IFPA 1B57A 3A3WA 4O1CA 3G1SA 4O4WA 4R7JA 3TAKA 2DY3A 2AL1A 2DW6A 3M0IA 4X3ZA 4JFTA 3DESA 3KLKA 4C6DA 1XJBA 1V3JA 4HT3A 2OKOA 3UETA 3TR9A 5IDZA 4XIMA 1OM0A 1K7FA 1V6WA 3QQWA 3SR7A 3PWIA 4MHBA 2DSKA 1SO6A 1R85A 3SAZA 3LBOA 4GG9A 3DU0A 4CNPA 2GVYA 4Y9AA 2C1IA 2Q71A 4A3YA 1GWJA 2WSKA 3W1XA 5HNRA 2Y7GA 5H1WA 3W81A 2R1KA 3HPXA 5JMUA 5A8GA 2GVGA 2ESCA 1QO5A 3PTKA 2FFIA 4PMDA 4GFSA 3BW2A 4M80A 4S2CA 1K8ZA 3MO4A 3QOMA 1C90A 1QI2A 1V6YA 2CHRA 3H7RA 7ODCA