4KWSA

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
403
structure length
397
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVAYEPADSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with Mg and glycerol
rcsb
source organism Chromohalobacter salexigens
molecule tags Hydrolase
molecule keywords D-mannonate dehydratase
total genus 150
structure length 397
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2013-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4kwsA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4kwsA01
3CT2A 3PWGA 3I4KA 2I5QA 2OQHA 2QJMA 3OZMA 3RR1A 3OW1A 2PP0A 3DIPA 4M0XA 4DN1A 3ZLHA 2PTZA 4IZGA 4Z17A 4DWDA 1L8PA 3N6HA 3TWBA 1MUCA 3EEZA 1EC7A 3SQSA 2GGJA 3U9IA 2OO6A 3B97A 1KKRA 1MRAA 1ECQA 4HNLA 2PPGA 3DG7A 3CB3A 3R11A 4DHGA 1TE6A 3OPSA 1JDFA 4MKSA 3DG6A 5FJRA 3GD6A 4H19A 4E8GA 3FYYA 3UCDA 3OTRA 1TZZA 2CHRA 2P8BA 3P0WA 3MQTA 1KD0A 2PCEA 1XPYA 3ZLFA 3FJ4A 1SJCA 1P48A 3MUCA 4IL0A 3UJFA 4KEMA 2HZGA 4DYEA 4E6MA 2PA6A 3FCPA 2PU0A 2P8CA 2XH4A 3NFUA 2OFJA 3OZYA 1EBGA 3UXKA 1MDRA 2HXTA 3V3WA 3PFRA 3VFCA 4YWSA 2QQ6A 3GO2A 4H1ZA 4IL2A 3TQPA 2FKPA 2QDEA 4IHCA 4GGBA 2AL2B 2GGHA 3S47A 2O56A 4GIRA 3MWCA 3QLDA 4DXKA 3T4WA 3D46A 3JVAA 1OEPA 3QN3A 4J3ZA 2XH0A 1EBHA 2MUCA 3UCCA 2OZTA 1XS2A 4GYPC 3SN1A 4A3RA 7ENLA 1KCZA 1DTNA 3V5CA 1KKOA 3JW7A 2GGIA 3SN4A 3MZNA 4JHMA 4HCLA 2PGWA 5EU9A 3CYJA 2GGGA 4HNCA 2DW6A 5BOEA 2AKMA 2AL1A 1EC8A 2AL2A 2PTWA 3TCSA 1JPMA 1PDYA 3ES7A 4M6UA 2NQLA 3P3BA 1BQGA 1ONEA 2OZ8A 4JN7A 1P43A 2OX4A 4GYPA 3H12A 2GDQA 1R6WA 1YEYA 2ONEA 3TTEA 2PGEA 1RVKA 5BOFA 3QKEA 3UJSA 2PODA 4IP5A 3VC6A 4IP4A 3IJIA 3GC2A 3TW9A 4K2SA 2PU1A 4ZCWA 5J04A 3PK7A 3T6CA 4G8TA 3HPFA 2FYMA 5FJPA 4MMWA 3H70A 5FJTA 4Z1YA 3EKGA 3R10A 3H8AA 2OLAA 4A35A 4IT1A 1WUFA 3MKCA 3N6JA 3TJ4A 1SJBA 3ENLA 4GISA 2DW7A 1WUEA 3CXOA 1R0MA 2P3ZA 3K1GA 3DEQA 3Q4DA 2OQYA 3DFYA 2P0IA 3D47A 3QPEA 3R1ZA 3BSMA 3ZLGA 3SBFA 3VCNA 2MNRA 2GL5A 3UXLA 3SJNA 5IDZA 4MGGA 3IJLA 2QJJA 3T8QA 2ZADA 4H2HA 3JZUA 3H7VA 2QVHA 5ENLA 4HPNA 4KPLA 2PTXA 2ZC8A 3UGVA 4K8GA 3P93A 1PDZA 2XH7A 3BOXA 4FP1A 3NZGA 3UJEA 3RGTA 2P88A 1MDLA 2PS2A 2GGEA 5FJOA 3I6EA 4ZA0A 3BJSA 1ELSA 3Q45A 3FVDA 3UJRA 3ZVHB 3UJ2A 1FHUA 1JCTA 3IJQA 3MSYA 3CAWA 2OZ3A 3FV9A 4K1WA 3I6TA 4GFIA 3IK4A 3SN0A 3V4BA 4KWSA 4X2PA 4DX3A 4HN8A 6ENLA 4JN8A 3VDGA 2POZA 3DGBA 2PP1A 3RITA 1IYXA 1SJAA 3KUMA 3SSZA 3THUA 3R0UA 3ZVHA 1W6TA 3OP2A 3ZVIA 4J1OA 4G7FA 4E4UA 2XH2A 1BKHA 3TJIA 3MY9A 3STPA 3RO6A 4A6GA 3V5FA 2PMQA 3DERA 1SJDA 3DG3A 3TOYA 2GSHA 3U4FA 3VC5A 4KT2A 4EWJA 3TWAA 3DFHA 2OVLA 2RDXA 5FJUA 4HYRA 3QTPA 4HCHA 4E5TA 1F9CA 1NELA 3CK5A 4GGHA 3GY1A 3RRAA 2AKZA 2OPJA 1MNSA 2PSNA 3DESA 2PTYA 3VCCA 3NO1A 2HXUA 2PP3A 4FI4A 4ROPA 2XSXA 3S5SA 4F4RA 2QJNA 4ENLA 2OKTA 3RCYA 1E9IA 3FXGA 1FHVA 1NU5A 2HNEA 2OG9A 4H83A 3R0KA 3R25A 2QGYA 1EC9A 1TKKA 4GMEA 3PWIA 3N4EA 3T9PA 3NXLA 4HCDA 2QDDA 3ES8A 2XGZA 3DDMA 3VA8A 3N4FA 1JPDX 4E4FA
chains in the Genus database with same CATH superfamily
4EQRA 2D2HA 5FF2A 3S5YA 1UP3A 1B3VA 1WKYA 4PMXA 4DF0A 1HL2A 3E0IA 5ABTA 1BG9A 1GORA 1E9LA 3EPMA 2GK1A 4DWDA 2FH8A 1GPWA 2A8XA 3F2CA 1H1YA 3H6OA 3SURA 1BG4A 3TWBA 1OZMA 4AWEA 2WVVB 3BPWA 1VDVA 1UH3A 3M5YA 2Z28A 1OX4A 2ZUTA 3ISIX 4W85A 2ZOXA 1Y5VA 2ACUA 1UD6A 3WQ6A 4TVWA 1TV3A 1JCLA 2WZIA 3AS3A 4MHBA 1MOKA 3KRBA 3M46A 5LNSA 2DZUA 3ZLFA 4YNGA 5KTLA 4C91A 2Y7GA 3V1HA 1GHRA 3L21A 3N2XA 3KBSA 1YXCA 2HJPA 2WWCA 1U22A 2VENA 3P82A 2ZUSA 1J11A 2R91A 1E15A 3OZYA 2CU0A 3G8EA 1B5TA 1F6PA 3Q65A 1S5NA 1SYTA 4WHBA 2JK6A 1FWFC 4UR8A 4LBUA 3AXXA 1W37A 2ZVIA 3GXIA 4EMIA 5ABFB 1EB3A 2FVLA 3L4TA 1OSEA 3P2VA 3C0SA 1X1NA 2YL5A 1ZP4A 3BXWA 4IL2A 5M1TA 3S5NA 3FYOA 1B3YA 1TJRA 2G50A 3RM9A 3TZFA 2AL2B 4PTDA 4ORIA 2OEJA 4RDVA 3WLNA 3BLFA 3V18A 4DELA 1BYCA 4DXKA 4QEHA 3MB9A 1G9HA 3HFYA 2ZZ2A 4BY3A 5KMYA 4EQWA 1QBBA 4Q8PA 4WVXA 3VKBA 4GXWA 4X0VA 1R3SA 4ZGYA 5D2XA 4GZIA 5I5RA 4ERGA 1I2OA 3W4RA 4LSBA 5DMNA 1Q65A 3IUIA 1W5OA 3LK6A 4GPNA 2VGGA 4L6HA 4PZVA 4GX8A 5I6SA 1DWGM 3EOLA 5L6UA 1X6LA 4I7WA 1PWLA 2WBGA 5TAOA 2YVJA 5A1AA 2NXIA 3RFAA 1S2UA 1B3ZA 7PTDA 5MHBA 4W7WA 3TCSA 2RHGA 4MF4A 3DX5A 1I1XA 5G5HB 3TQ0A 2QULA 1O66A 2WV8A 2ALDA 3QXBA 1UZDA 1DIDA 1SMDA 3UG8A 1XLFA 5CBJA 1ZGDA 3GBEA 3I6RA 1GG1A 1ME9A 2GDQA 4Q8WA 5LYRA 3CZEA 3GVVA 4HGXA 1LRQA 2ONEA 2PDXA 4H04A 3GAKA 3W7CA 5F4SA 4UNIA 3UWYA 2BDQA 3W53A 1UWAA 3VC6A 3DC8A 2ZX7A 4P61A 4K2SA 4A8NA 1TPVA 1A5CA 2BXVA 4DO5A 4KW2A 2J88A 4CNOA 3K4DA 3MUAA 2CLMA 2WVVA 3M0ZA 3NEVA 2DQXA 4XTDA 3SIMA 3H70A 2FIQA 2HK0A 2I5GA 1KBLA 2DU2A 1BTCA 2YVGA 4FB7A 1GQLA 4QM1A 4QEEA 4FDCB 4NAEA 2YXXA 4AWTA 1YX1A 5IRPA 3G1YA 3S2MA 3W6MA 2GQ9A 1OX6A 1TG7A 3Q4DA 1FWNA 2CLFA 1DV7A 2ZE0A 3NZRA 4PMUA 3S2JA 3EB2A 4LWWA 1OFOA 1MVYA 4EAYA 3O0FA 4FIQA 1JF5A 4HZ7A 3VD4A 4N2YA 3TYUA 3W26A 3JZUA 4D1IA 1F6KA 2BOEX 4KPLA 2EG7A 2W55A 1S39A 3GDLA 2QYGA 2R8WA 3BG5A 4KETA 4FP1A 3A5FA 3NQDA 4Q8MA 3NZGA 4GUJA 3AMGA 1S5MA 2X09A 3NDZA 1BF6A 6REQA 1AW2A 4EPBC 2GDVA 2HBVA 2YL8A 4FR1A 4AWSA 1D9EA 2RDWA 3AAMA 4WRHA 3B8DA 3AMLA 3ZVHB 1W9DM 1Z48A 2R1KA 5FEXA 2V68A 3ZZ1A 1HW6A 1XYLA 3WLLA 4H4TA 3WD3A 5BRBA 1ZAJA 2VZSA 2EO7A 1SPQA 1XG3A 4X2PA 1GYMA 1QCWA 4YMZA 3W0KA 5REQA 3GG8A 1YYAA 1EJRC 5CC5A 2BG5A 4I90A 3QOMA 3CL7A 2CBUA 3PULA 3THUA 1AMKA 4O8RA 2BGNE 4PCNA 4PSPA 5AYZA 2WSKA 4QLJA 2ZZ7A 3EPOA 5EFDA 3MY9A 3P80A 2W92A 4JQ2A 3A23A 3FOKA 5BXSA 3N29A 2W61A 1ISYA 4QX4A 1B9ZA 4X2RA 1X2HA 2DT1A 4NXSA 5AOUA 3PANA 2FVMA 3LYEA 5DMLA 1EDGA 4W4QA 4F0KA 1VCFA 1F05A 5BU6A 4QP0A 1MNSA 2WYSA 1MSSA 4PCFA 3R94A 2XWDA 1H7OA 4S3FA 2NPXA 2VMFA 3R79A 1UWUA 4H6RA 4H6KA 3BOFA 3ZSSA 2VP8A 1RD5A 3RCYA 3E9AA 4V2XA 3C2YA 4REQA 4CQDA 3BQ6A 1G0CA 4P5UA 3NVDA 3TYBA 3N25A 4LIIA 1DORA 1OIFA 3DFPA 4S3KA 3DHFA 3W6YA 2BC1A 3CV7A 2A3AA 1EZ2A 3N4EA 1N63C 3TTOA 5F2MA 3CO8A 2WOQA 4UCGA 3B06A 4I5XA 1UP0A 3REQA 4LB3A 4GZJA 1XCXA 4U10A 3SUWA 1E73M 2I5QA 5E9XA 1GOWA 1K7FA 3W7DA 4JTHA 4KWVA 1JUBA 4PUJA 4QXIA 1R7OA 3Q6JA 1RUSA 2CZEA 4O1DA 1MRQA 4GYKA 1F73A 3PTMA 1GUVA 1AVAA 1FWHC 2WKLA 4KIRA 2GJRA 7REQB 5CPOA 2V8ZA 5HJXA 2YA0A 3ZJKA 4B9ZA 1FWGC 3M6DA 5KINA 3EA3A 3UW6A 1JXJA 3DG7A 1XP3A 5K2ZA 1M7OA 2ZTKA 3O07A 3CAKA 4DHGA 5KETA 4C6IA 3GKFA 4DJFC 1DL3A 1TV4A 1NOWA 4E8GA 1ZBCA 1F6YA 4CNPA 4IIHA 3SI9A 4A3YA 1LQAA 1X39A 4B5NA 1VENA 3EXSA 4KGLA 4IWWA 1N8IA 3MQTA 2PLMA 4RUBA 2XSAA 5DFAA 3C2EA 2YL6A 1W5NA 3GR8A 1LUCA 3MANA 3MUCA 4ORMA 1TYPA 2C79A 4KKXA 1BGGA 4MB1A 3V7PA 3LX9A 2BP1A 3AO0A 1UG6A 5AHEA 2YKKA 3B8WA 4Z1AA 2PU0A 1S2VA 1F76A 4PUUA 4X9SA 3U7VA 2OOFA 3AIWA 1NDWA 3W7KA 4UFHA 3TCEA 4KMQA 4I5RA 5CQ1A 3FX4A 3RX2A 2Y89A 1IR1A 1UCWA 3NXFA 1F8IA 4GQBA 4LS0A 2PDKA 2ZKMX 3PVFA 5FMHA 1RH9A 3S1XA 3W1NA 1NFBA 1DWFM 4W7VA 3CL8A 3TV8A 2QUTA 2NUXA 4AHPA 3S2CA 5FS9A 2TMDA 1E4MM 4KS0A 2EAWA 2W54A 2E67A 3WH8A 3B04A 2QIWA 1YXDA 5HK4A 4IUGA 4EXAA 4JTLA 5EGRA 1YKWA 1KCZA 2GUBA 3G1XA 2PRMA 1X7FA 5EU9A 4DUXA 1WXJA 2XG9A 3UXDA 3N2CA 3G1SA 4H9YA 5F4XA 2GOUA 2IKGA 1E6RA 4GHRA 1G7UA 1M53A 4E2BA 3IARA 4IIBA 2DSUA 1ONEA 4RE4A 1GV4A 2ZQ0A 1XINA 4QG9A 4C6MA 1KLZA 2GJPA 3OBKA 4LNYA 1QU4A 4H9TA 5LNRA 5M3WA 2AQOA 4M52A 1DQXA 3CPRA 5C8BB 4LVGA 5D2VA 4IUOA 3GG0A 4IP5A 1D7YA 1KM2A 4AD0A 3AIBA 1VRDA 3B05A 4LYPA 1H6VA 1FWAC 2VJXA 3S6DA 1Z6KA 2UY2A 4Z1YA 4XZWA 3DYPA 4AZ7A 3BMWA 3SCUA 3CHCA 4L1GA 4YTUA 3PZVA 4ATLA 3DOPA 1I2RA 2PC8A 3CHFA 1X96A 2VD9A 4WK9A 4L80A 1FDYA 3BH4A 1IZKA 3C6CA 3NRZB 4YYCA 4J56A 1XSKA 5BMWA 5MKGB 1U1UA 2RDTA 1E4IA 1GVQA 2XFRA 1AL7A 4WXZA 1LTDA 2PEVA 4GVHA 5FSDC 4HSOA 2OQYA 5C2CA 3POCA 1VC4A 3AYRA 1KBIA 4QSFA 3TONA 1W31A 3UETA 1BPLB 3WUGA 1Q6QA 1W3JA 3VD9A 1UUMA 5H8PA 5HPCA 3QF0A 4WKAA 3LM3A 1RPKA 2JGYA 3E1F1 1W5PA 3S83A 1RR2A 3T8LA 5FOOA 1PPIA 2D3NA 2E9BA 5HOSA 1B54A 1VAHA 5REQB 4QJ4B 1V3KA 4ZO6A 1BQCA 4BQ3A 1SMAA 2EQ9A 3WX7A 3O63A 3GW3A 4QAIA 3LB8A 4PL2A 4W9TA 3ANYA 2B7QA 2B31A 1V8EA 3GC4A 3W1AA 5GVJA 1RA0A 3ALFA 4JTAA 3AXKA 1W1A1 3HPXA 4RLIA 1VJZA 1DHPA 3WEOA 4WXYA 4AXKA 1XL9A 3W88A 2A7PA 4LVFA 2E6YA 2O0TA 1LLOA 3VGHA 4HU3A 3K2GA 4UTHA 5DBTA 3P14A 1GYNA 2Z4GA 2BB0A 1QK2A 2V63A 1XIDA 2PWUA 3MI3A 2D1ZA 3LTPA 4DJED 2H3BA 1KFCA 3NO5A 4JIPA 2PGFA 4DUVA 1D3HA 5F2IA 1TCDA 1TQJA 3YPIA 7ODCA 5D8ZA 5E6ZA 2VO5A 4CVWA 3ZVIA 4LUTB 5ABHA 1O68A 1JVNA 1FEBA 1ZAHA 2OT1A 2PCQA 1WZKA 4HMCA 1W3KA 4BR1A 4YIWA 3DG3A 2DEPA 1CDGA 1F4HA 3F4VA 1EDQA 4LALA 3QMRA 3TOYA 3AIUA 2ZZ5A 3WL1A 5LIUX 3S42A 5JU6A 4Z2JA 3KRSA 2CIPA 4CUCA 1WDPA 2X2YA 3IIXA 1YQ2A 2QPSA 5JRBA 3UZJA 1R86A 3QTPA 1F8MA 1ITCA 3KLKA 1JYNA 2ZBTA 4QRNA 3GY1A 1EXBA 5J8LA 3C4UA 2J8TA 3W02A 1DJHA 4QBXA 2TPRA 5C7VA 2AMGA 1YLVA 2X42A 2XVLA 1E6QM 1LOLA 3SCTA 1QNVA 1QI5A 4AC1X 2G0WA 1TR9A 2EEXA 3ONCA 1E9IA 1FHVA 4O1AA 2VDGA 2HNEA 2REQB 4UFIA 1GVRA 2WCSA 1KTCA 3ZXWA 2DFAA 3I4EA 4XSLA 3E49A 4N9BA 3T44A 1NY1A 2POTA 4W93A 3SCQA 3W2UA 3OGSA 2BXYA 3T9PA 1QI4A 3O1NA 1XBVA 3W71A 3TDFA 3CL6A 3O0HA 4O8AA 2BZNA 5AC4A 4TV6A 3SM0A 3B0PA 1XYAA 1QPQA 4GR1A 3GTXA 2NQJA 1FTXA 4WGHA 4LNCA 3VIPA 4M19A 5C5YA 2XFWA 3ITXA 4WZHA 3W7NA 1X97A 1IXPA 4B2DD 4CU7A 3RM4A 5A3HA 3L5MA 3VKJA 3EEZA 4NZCA 3REQB 3SQSA 2HS6A 2W79A 2IPFA 1UJQA 1M41A 1NFPA 4WKHA 3PTQA 2F2KA 2V81A 2AAQA 2GYIA 4QIUA 4K8DA 4CEUC 1V93A 3QY6A 3GD6A 2Z1BA 1UQZA 2D2GA 1XUUA 3A6OA 4JQ4A 4YU1A 2G3IA 3CWNA 1TZZA 1JZ5A 1SO6A 3GHRA 5CLTA 5C9UA 4GNKB 2QCNA 3ERPA 1N82A 3M0KA 2PDNA 5SWUA 1GOIA 2FZMA 4PUMA 5KZDA 1UKSA 2DORA 5H91A 3GDKA 4S39A 1Q2SA 2P8CA 4C6NA 5JH2A 3EAUA 4DBEA 1XXXA 2OYLA 3AYVA 4W5ZA 1ZUAX 2IS7A 3GFXA 4AZCA 1CPUA 2EPLX 4U2YA 1TV8A 2QGHA 1BWKA 1SB3B 1LUCB 4NX5A 4FX6M 2O56A 3P5YA 4RK8A 4CQAA 4PCTA 2J6VA 7CGTA 3MV11 3D46A 1FWIC 6ALDA 1E3ZA 3DJJA 1JDCA 1P0KA 3VNKA 4Q4RA 4P7QA 3RDKA 3NVVB 1GKRA 2PWVA 1ONWA 5K7JA 3LV5A 1DTNA 4TUFA 4UZUA 5K9XA 1TZ7A 4FNQA 5JXQA 1SFLA 2C91A 2WOWA 5D33A 1HKJA 1AJ0A 1J10A 5DCEA 1KCKA 3E02A 3MVTA 1X1ZA 3TROA 3SCRA 1BQGA 2VC9A 1TMLA 2V0TA 1G1YA 1QHPA 3AU6A 1P4CA 4XD6A 3LNPA 4H4ZA 1W2VA 1KM6A 2QZRA 2X99A 1GJWA 4NZ3A 1E6PA 3BSGA 4B90A 2GPTA 5HNRA 1JZ6A 1WCGA 3EDEA 2D0FA 2DP3A 2EF9A 1EOMA 1Q6LA 2ZIDA 4OECA 1C92A 5E1QA 4GH3A 4WOZA 3ABOA 5I7GA 3WUBA 3PJUA 3QJAA 1SQ7A 3SCOA 3LZ5A 2FJUB 4PE8A 3M0XA 2QMKA 3MCOA 4S3JA 2VFIA 3P5ZA 1A5UA 1RXOB 4TX8A 3NVTA 2FQIA 5I3KA 4E2VA 4JIHA 3PG6A 3TMQA 1WUEA 1G4TA 4PMOA 3TN3A 3OZPA 2IPWA 1TUXA 1G4SA 1BHGA 2HSAA 3QC0A 3IK2A 4MVAA 1VBHA 4FIRA 3A9IA 2NSOA 4NASA 1XD1A 2DZPA 3WLRA 2ZXDA 3VO0A 1UPMB 2F2HA 4ZMGA 5AYYA 4WEVX 2QJJA 5J5DA 2EPKX 3WBYA 2QVHA 3W07A 4ZQCA 2J75A 1ZJBA 5LNWA 3BLDA 4PMJA 2ZRZA 3VDHA 5CPQA 1TSIA 4UQDA 1RPXA 3HRDC 3PNUA 3N2BA 4RNHA 1VHCA 4UTKA 6PTDA 4QHRA 4JTQA 1R5YA 1V6YA 4ZA0A 1ZQ5A 3FVDA 3BLKA 1JCTA 1X38A 1ITQA 3SW6A 4ACZA 2DVXA 2WPBA 1H60A 1E6XM 3I6TA 1ONXA 4KWSA 3GHTA 1N8WA 5DRIA 1V6WA 2HQAA 4IPLA 1EDTA 1ZBVA 1RA5A 3NM3A 2POZA 4O11A 5CH9A 3C2RA 3RITA 4ZSUA 2HQMA 2ZUNA 4ZE4A 4MWAA 2E09A 2RJGA 4PH6A 4Q4MA 3O2LA 1I2PA 1GRBA 1VJSA 5F2LA 5CPLA 3STPA 3PG8A 1C3FA 1OGGA 2X0YA 3BANA 1ZDLA 2WM0A 1E1CB 1M6IA 1PIGA 1RBOB 3A4XA 2IQTA 3M0MA 4Q22A 4UQAA 2NT1A 1NH6A 2RDXA 1F3PA 1UR2A 2QAEA 3EDKA 4GLEA 3ZR4A 2F7FA 1NELA 5MF5A 4MJZA 3T2OA 3QVQA 4N02A 5KVIA 3FGCA 3WO8A 1NIUA 3DC0A 1WYGA 3DESA 3XINA 2YBUA 3PZUA 1ISXA 3FKKA 5CSYA 3DBPA 2VNCA 1DWAM 2XSXA 3LSBA 3DH7A 2XIOA 1XDMA 4JKLA 5DQPA 2WMGA 5FF0A 1E72M 1LRTA 3QC3A 5GQBA 1LT7A 3CZLA 3F5JA 1K02A 3NG3A 1EGMA 2VGIA 3CTLA 4G1KA 3E12A 3LRKA 2XJ7A 3UG5A 2DT2A 1JCXA 4DLMA 1IEXA 4GMEA 3PWIA 4DBDA 3VGEA 4FX9A 3APTA 3CEUA 5DXYA 3EB4A 3VA8A 2X1RA 1V4YA 1K9DA 5BXTA 3U3HA 2QJMA 3OZMA 2VC5A 3SCWA 2VI0A 1V6XA 3F2DA 3LCXA 1QOPA 1SW0A 1KFWA 2EGZA 1GWJA 4MB3A 3CV2A 3ARZA 1GQNA 3C2FA 3QPZA 4W87A 2XINA 4ZL1A 5HWJA 2JF6A 4AD3A 3OLDA 3L4WA 3OOQA 3GG7A 1SZEA 3TZNA 3BLIA 1SGJA 3WDQA 5EMUA 1RY0A 4QDWA 3F4DA 3PUEA 4H9MA 1PB0A 1Y0EA 3P8IA 2QUNA 4LS2A 5LNUA 1S7MA 1J5SA 1CCWB 5I07A 1TFVA 3KXQA 3EX2A 4JTTA 2WHLA 2VEMA 3K4AA 3AWOA 2XPKA 2P8BA 4NEWA 4JQ3A 1KD0A 3ABXA 2UZ9A 4DJDC 1LF1A 1H0IA 1X2GA 4H6EA 3ANUA 1JDAA 4KWWA 3ANVA 1KRBC 4BEUA 2WVSA 4O1BA 3IACA 2C3ZA 3CUHA 1EZWA 3UXAA 1JDDA 2I1OA 2PA6A 5ER0A 3USZA 3F03K 5FD0A 2CYGA 3K46A 2HISA 4KGJA 5I09A 3AHVA 2GUUA 5A8MA 1B31A 4KCUA 4N6FA 2PAJA 1XR2A 3THQA 5I3DA 4XIAA 4P7NA 3MTWA 1E4NA 1MEHA 2A3LA 4F3HA 3TQPA 1WBHA 2XFFA 1TWSA 3IV3A 3DBNA 1EUAA 1D7FA 3BLEA 4UQBA 2P10A 2VQUA 1BFNA 4J5NA 4DM1A 1MW3A 1H62A 1X7IA 4QE4A 3DECA 3MP5A 4BHYA 1GQKA 1QWKA 3LCLA 4FX7A 3FXYA 1XYFA 2GVJA 3SRDA 4AQLA 4OJYA 4D2JA 1G5AA 4JHMA 3KCOA 5AZ1A 4DO7A 4B15A 1EC8A 1F3EA 1CGXA 2VTFA 4LY4A 2I57A 3VNLA 5FS7A 4QDMA 3GTNA 2YQUA 5HA7A 5HQEA 4LY8A 2NSXA 4GE8A 2GQAA 3SADA 2GH5A 2H9AA 3PBMA 3SECA 2VFFA 3DUGA 3URAA 3JU2A 3VM7A 1J5TA 3NZQA 1KXQA 1XLHA 4RPQA 4BFAA 3PPHA 3BE7A 4LCSA 3W7EA 3DK9A 1ITUA 5DANA 1MW0A 5FSEC 2NQHA 3QKEA 1H3GA 4V1YA 1DXEA 1NDYA 3IJIA 4D6IA 4YHEA 1LLZA 2PU1A 3SDOA 1NHPA 4JHZA 4LVAA 4DI9A 1H1NA 5FJPA 4L6DA 2HBXA 3O6AA 2H8XA 4WJXA 3CMJA 1OT2A 5AYIA 4A21A 2EG8A 3SY5A 1JQXA 5DEZA 1K4QA 3CBWA 2JKPA 1R2SA 2BTMA 4JR5A 4HVXA 4HKPA 4HD5A 4FF7A 3W81A 2ISDA 3ONBA 1ONRA 1OADA 3O7UA 1WYIA 1KNWA 3PUGA 1VIZA 1GW9A 4APNA 4AG0A 4JHOA 1IEIA 4C7GA 1XDLA 1UPPA 5I3IA 3GH7A 2NZLA 1EX5A 1UBSA 2GLKA 2WSYA 3INPA 1JNDA 4LXFA 3WLSA 3UEQA 4HOWA 3N15A 1WAUA 3NDYA 1S3TC 1JCMP 2YX0A 4K3ZA 4Q8OA 2TRSA 1HTIA 4GACA 1RZMA 3FDGA 4O1CA 3BCDA 3FK4A 3NAVA 3HQ1A 2Q3RA 2EXOA 4IXHA 4TO8A 1V3LA 2XTKA 3W37A 1EA0A 1M7PA 3N3MA 5AHNA 2GGEA 1EPXA 2OSYA 2Q3OA 3TA6A 1TTQA 5C2GA 3Q45A 3VNZA 5LSMA 1LWIA 5CSUA 3WSUA 3MSYA 4CCDA 2VDHA 3TUUA 4L1XA 3FSUA 5I78A 3WELA 2PDYA 2E3ZA 2TODA 1XHGA 5D4YA 3E38A 4BKNA 2HWGA 2X1TA 2FGLA 3B40A 2DJXA 3MDUA 4TMCA 2OLHA 2BLEA 1HF6A 3LGGA 4ZTXA 2O9OA 3KE0A 3GUGA 2CKRA 1JCJA 4AIBA 1MQRA 5CGTA 3L5AA 3QH2A 5FEWA 3MUY1 2PDIA 4HNTA 1KM3A 1BKHA 2XGIA 3UWEA 1Z89A 1MUMA 1W9UA 1Y7VA 3KTSA 1K8XA 4BV6A 2WW5A 5FAGA 1BXNA 2WPCA 1JROA 4QE5A 4IH3A 3GRIA 3ITYA 5FESA 5AECA 3LN3A 1OG0A 3BG9A 1VEPA 4J27A 3AMCA 4E5TA 3B8VA 1US3A 3AC0A 1XPGA 4Q8QA 3ITOA 4P8VA 5A8PA 1OK6A 3RRAA 2O55A 3QBUA 3WLOA 4XK2A 3O9NA 2WCAA 1DWHM 1V3IA 2CLEA 4GBUA 3W01A 1JD7A 2OOGA 3ZO9A 4BCEA 4XQ6A 4RPPA 2X50A 4AD5A 1OFBA 1Q5MA 1GT8A 5DMMA 5A8GA 2D22A 2A1YA 3AHXA 4AIUA 3VAVA 3J7HA 2E3TA 2OG9A 4HA0A 3N17A 1XLBA 2FPTA 1KC7A 1SR9A 1YNQA 4JYEA 3CLWA 2H3DA 3PZOA 3ZWTA 4RNIA 3IRDA 3NXLA 2WPGA 3KLLA 3DDMA 5EMLA 3KCJA 4KWUA 4TOQA 3JS3A 1W2PA 4P2VA 1JFXA 2BCPA 4XTIA 3T05A 3GKAA 5C54A 1F61A 4YCPA 4GK8A 4EPEC 4M81A 4M0XA 4MDOA 3W84A 2E4TA 1NAL1 6TIMA 3NCOA 3Q37A 1W32A 3OLEA 1OYAA 5JCLA 5A6KA 4EPKA 4ZB0A 4GJ1A 3CTTA 3HG2A 2WJEA 1MUCA 4DPPA 3VNJA 4WDXA 3H54A 3OEXA 1CZ1A 3VIMA 1T41A 2C19A 3EOEA 1FCUA 4P7RA 3R2GA 3PZNA 4PULA 3H2CA 1TE6A 4AHQA 3C8FA 5K9DA 1V59A 1OK4A 4BQ5A 5A6BD 2X05A 3G1VA 4MJMA 3FYYA 1A5AA 3LY0A 2VR5A 4OV4A 1HKWA 3UPWA 3GD3A 1ZFJA 3SQLA 4A29A 3HO8A 3FIGA 1Q7MA 1XIHA 1QW8A 4J7RA 2DZBA 4DUWA 3BZJA 2V5LA 3JR2A 1K1DA 1B4EA 1GVYA 5HNNA 3ALGA 3RLGA 3WLTA 4IPNB 2Q8XA 3GNDA 4UQ9A 4NNAA 1IE7C 2EQ6A 2PE4A 3CV1A 3D5HA 3VINA 4H8NA 5ECUA 5HNUA 2BVYA 2R1LA 4DF2A 3WQ8A 1ML1A 4J3VA 3AIVA 2WNWA 3EMZA 3FDKA 3S4TA 2X1IA 4ADWA 4RE3A 1GONA 4WIWA 2EJ1A 5GNZA 1M7JA 4C1NA 3F1QA 5CLWA 4JN6A 2YCEA 4F48A 1IXQA 3AROA 2GGHA 2LLEA 4I9AA 2B7NA 2G4JA 5T26A 5G4EA 3UR7A 2CZFA 3QPYA 5HMEA 5K4XA 2VRKA 1Z41A 5DN1A 2QDHA 3VIGA 4UXDA 3L4VA 5CPTA 2QUVA 3UPMA 3UCCA 5C9XA 1PYFA 4CQBA 1BGAA 1YTEA 1DJXA 5I00A 1HJVA 1DBTA 1UR8A 1K8CA 2QPXA 5AN7A 3EWXA 4LA1A 3N9RA 5FCZA 1YMYA 4MZYA 3TK7A 1CLVA 2REQA 2WSRA 1N2VA 4AEOA 3MUIA 2BS9A 1FH7A 4EWND 1IZJA 4Z1CA 3KEHA 1JXKA 5HMFA 2INZA 4P8XA 2DSZA 4NHVA 1TJ0A 1OCJA 2FFCA 1MI3A 4XO7A 3H12A 4H01A 3UP8A 2QF8A 3W38A 3TTEA 4J2PA 3BGGA 4R3UA 5ECVA 3BLLA 2NQZA 2C14A 4TU1A 1PO9A 1MFVA 3WNLA 1XG4A 5AFDA 4WY0B 3VK5A 2ON3A 4CU6A 4S3GA 1DPMA 2OB3A 1B30A 1J4EA 4PMRA 1PTAA 4NYUA 1LCOA 4MSSA 3KFTA 3VGGA 1XC6A 4GXMA 1WO2A 3G24A 1GRHA 1PE1A 3GDMA 1NARA 2P5NA 4A35A 3CZKA 1W8SA 3E2VA 3MKCA 2PBGA 1TV2A 2VX5A 4XG1A 1WDRA 1MW2A 2BGQA 1XFCA 3TJ4A 3AICA 4WD0A 2PDUA 2VL4A 4O19A 3G1HA 4HQVA 2ZC1A 3L68A 2Z6JA 2P3ZA 3GTFA 4ERIA 4FXJA 3L8KA 2DZWA 1M68A 4GO9A 1VFTA 3EWWA 3CUIA 4ZOBA 1ECEA 1R7AA 3SFKA 4E3VA 3VCNA 4FSAA 3QGKC 4PMDA 1MXSA 1TTJA 1SZFA 3TIMA 4QISA 3BICA 3DHDA 4IX2A 3WL0A 3LU2A 3W1MA 1GTHA 1YPIA 4JXCA 2CPUA 1FY6A 5HANA 5XIAA 1ADDA 2ZC8A 3DXIA 1QATA 4LQ1A 1DXIA 3GK0A 2J66A 1XGZA 3RGTA 3CIVA 4UTWA 1T40A 3NQ7A 3VD7A 1VFFA 4G7EB 2QW5A 4I6VA 3UWZA 3LXAA 2R1MA 3BQ5A 3UJ2A 1EJXC 4IMGA 3WD2A 3AYTA 2QHAA 3QFWA 1QI2A 1QO2A 4MNLA 3CPGA 3OC4A 3SR6B 2HEJA 4X22A 1L0PA 4YJ5A 4UR7A 4ZB5A 1ZJHA 5CZ0A 2CCRA 4HU4A 4KCVA 2WPEA 1MWOA 4IGNA 3LS9A 1SFSA 1IXOA 1E56A 3KUMA 3GVRA 4YTSA 4RCXA 3Q2DA 3L2LA 2BHUA 2XYLA 1VKFA 1HVQA 4DZHA 2CETA 3RX4A 3APYA 3IGSA 4JEQA 5CSSA 4UBPC 2Y63A 4GCXA 1ZALA 2CXGA 1SJDA 4O15A 4H4RA 1OD0A 2GWGA 4PTNA 3NURA 1GW1A 1ZU8A 1OWQA 5HUPA 2E40A 3EX1A 1KRAC 1JFHA 5FS8A 3DCPA 2PUZA 3VKCA 1JGIA 4BI5A 5EY5A 5HNTA 4ASTA 4PBEA 4R33A 1QW9A 2XDFA 1RAKA 1VPQA 1W5MA 3R12A 4GVGA 4ZO8A 2BV9A 4ZOEA 1J9YA 3W2LA 4JIQA 4ZQOA 3HG3A 3NO1A 4AY8A 3OIXA 3GFZA 1POJA 1AH4A 4FI4A 1LL7A 4P8WA 3W1XA 5FS6A 4ENLA 1AOGA 2VZVA 4Z1BA 2DIKA 4Q6JA 2Z2AA 3S1WA 2V3DA 4F8XA 2WNNA 2ZZ3A 3TAOA 1KXVA 1IV8A 3K5XA 2VDIA 1B4KA 1WOBA 4IMAA 4GI8A 3LRMA 1R3YA 3VDBA 3HPSA 2ZFAA 1PZ0A 3G0UA 4NZJA 1BD0A 3V75A 4CCZA 2OQHA 5H2ZA 4G9PA 1GERA 3HGOA 1L6GA 2E5CA 1XQKA 4CN4A 2F61A 5CSRA 4MOZA 2VEPA 2WLYA 4JYFA 3NWRA 3LMZA 4GYFA 1L6YA 2YGYA 4XAFA 4NIRA 4LUSB 4IIDA 3VKAA 3UZZA 4H9ZA 3DFTA 2KAUC 3LDVA 4WDUA 3VKDA 3BAXA 3A4JA 1NP0A 2ZE3A 2IW0A 2FMNA 4Y8FA 4MKSA 5FJRA 4Q8NA 4YTTA 1Q6DA 3OTRA 4JPGA 1T96A 2IQDA 1UBPC 1SVDA 1A5OC 3MW7A 2JGQA 1ZMCA 3FJ4A 3GIPA 1XKJA 3IVUA 4UFKA 2E9LA 3HIJA 1REQB 4XSMA 1UHVA 1RLDA 2DVUA 2QCEA 1R38A 1DJIA 2PRLA 3SAZA 4L65A 4YTRA 3Q67A 1PX8A 3AS0A 5CZTA 4B5SA 2QS8A 2FTPA 3QMTA 5FJJA 4Q4OA 1Q6CA 3GXMA 3QFBA 3NSNA 3PFRA 2C1GA 1PJ9A 3JUGA 2YLAA 3TJLA 3DI0A 4LV9A 3PSVA 4AF0B 3DGHA 2YDSA 1O6IA 5D02A 5E0KA 1I2QA 3BC9A 1XCFA 4A05A 1OCNA 1GCYA 3DGRA 4KBXA 4KEZA 3JVAA 2PURA 3CWOX 3NQGA 4H8UA 1OEPA 2P0OA 1W1IE 3STCA 2G3MA 1AFSA 4J3XA 2WVTA 4J3ZA 1W17A 4GUHA 4M6VA 4W84A 5L9FA 3N2OA 5JMUA 4HB7A 3FG2P 4CCCA 2YDRA 3SN1A 2GJNA 1GESA 4O14A 5GNXA 3OA3A 1KKOA 4FPSA 4HIBA 3MZNA 2ABAA 3S6OA 3WH5A 2EQDA 4K38A 5BOEA 2XSBA 3ARQA 3UWUA 3WD4A 4M6UA 4MAZA 6TAAA 3W1TA 1ZK7A 3IJ7A 1QHZA 2I9EA 4M8UA 1ZL1A 2Y5JA 3BGJA 3WG6A 5G2IA 4GYJA 4RZ5A 1JEHA 1EF2A 4RJEA 3A64A 1TIMA 1U33A 4M24A 4UR9A 1ME8A 1J01A 4I5UA 4Z42C 4A2SA 2EG6A 3OZOA 4XB3A 3W74A 3PTDA 4JICA 1MEIA 1MW1A 3BJTA 5CKSA 1LT8A 3IVTA 5LZLA 3GDTA 3LCWA 5TR3A 3STGA 1TR1A 1BKSA 4CD7A 1DIEA 3MDWA 1PS9A 3OHMB 4GXPA 1W1PA 3B9OA 3M0VA 4AISA 2A3CA 3A3XA 2WQDA 1SM9A 1N55A 2PD5A 1JPKA 1FWWA 4IXXA 5KITA 4OZOA 3WF1A 4XBJA 1RP8A 2ISFA 4LBRA 3OQEA 2VXNA 4W5UA 5KZ6A 1R0MA 3BZGA 2J77A 3VCRA 3A7AA 4D6DA 2NUYA 4XVDA 1R87A 3KZSA 3D47A 3SZ8A 5TNVA 4DWSA 3CZJA 3SBFA 3URHA 4AXNA 1LOSA 3V36A 4HJFA 3NA8A 5C9RA 4FZIA 3SJNA 2GUYA 4OT7A 4D6FA 2HPMA 4BWLA 3AXMA 3S9ZA 4MADA 2X1SA 2XN1A 3TLLA 3M41A 4OIFA 2PTXA 1K7EA 2J7GA 3FAWA 1PDZA 2YR1A 3P60A 1Q85A 2V5DA 2NLYA 2YCKX 1W3IA 1WXYA 3DFNA 2P88A 4AD2A 1P7TA 1Q3NA 4HMDA 4TIMA 4UTTC 4MNMA 1EJ7L 4B4FA 3EWCA 3W2MA 4O0ZA 1VP5A 1Q63A 2GQWA 1YDVA 3E2SA 4UQEA 1KFKA 1R9YA 3UR5A 3VOCA 1FX6A 1MEWA 3LPGA 4XKYA 3BW3A 3H4WA 3UG3A 5H1WA 2OZ0A 5HMDA 3GB6A 3TYAA 1WKEA 3IGUA 1EJTC 2D69A 3VDGA 3BTNA 5D8WA 3OG2A 1SSDA 2Y85A 5DELA 3NYDA 5EMKA 2CC0A 5DBUA 2A79A 4ZVJA 1N8FA 4O53A 2YL9A 4RW3A 4B4HA 3LB0A 1GRFA 2Y1HA 2QCFA 1A0EA 4LAZA 3WDIA 4M6QA 3ATYA 1YNPA 1O5QA 2CLLA 2R1NA 2VFHA 3RUBL 4CD5A 1Q6OA 5IFPA 4GX9A 1WQ5A 3ZT7A 1JZ3A 5CBBA 4QSHA 2OVLA 3UFYA 2JIEA 2FMOA 3ARUA 3MSRA 1FOBA 4JS3A 3EXTA 3CK5A 4JEJA 1ZP3A 1TMHA 1Y5WA 3LNMA 2WP5A 1RCQA 2BOGX 4N7QA 5E09A 2X0HA 1DKWA 2FGZA 2YFNA 2YJQA 1EJUC 1SO5A 4H50A 2DIJA 1NQKA 2VCAA 1E71M 3PBUA 3B0UX 1WZAA 5J5RA 2GWNA 4NI8A 3W83A 1P5BA 4PC8A 4XBSA 5IHRA 3PZTA 1E9ZB 2DIEA 1QXLA 2C0HA 2Y8KA 3GVGA 4LUSA 3W2KA 2OX1A 1EJSC 3LHVA 1RJRA 4AW7A 2Z1VA 1O5KA 4MUZA 1FXPA 1C8QA 1H4PA 4MWAB 1RCOB 3VI2A 3LPOA 1LLWA 3RR1A 3A9BA 4FOJA 3RRXA 4LX4A 3OYZA 3OW1A 5D2WA 1EHNA 1E55A 4PUWA 2FZNA 4EACA 2C3DA 3OVRA 1QFEA 1J12A 1NHSA 2R1PA 5CEWA 4DYJA 4HK5A 1YTDA 1L8PA 2YCJA 3VDCA 4C6BA 2GVEA 1X98A 3CUJA 1GKPA 3EX4A 2NV2A 3FS2A 4LCQA 2VC7A 3WQOA 3ABZA 4UOQA 2VX7A 3O6CA 3TA9A 4BURA 3PF3A 2CKSA 2PDQA 1ZHAA 3DU0A 2DT0A 2F38A 1RK6A 4H19A 2F6XA 2R82A 3ARTA 4R9OA 2FDMA 4HPJA 1YBQB 3W7GA 1F3XA 4XZBA 4MYXA 1GHSA 2XVKA 1P48A 2V2CA 1XRVA 3ZYZA 4AIOA 1CI1A 4Y9MA 3M5XA 4U4MA 1BYBA 3S0CA 4U3AA 1E43A 1ONFA 4O12A 3B9AA 5HAOA 2WHKA 1EBGA 4PBFA 3CHDA 3EWZA 1MDRA 5GJPA 2PF0A 2ZX8A 1BVWA 3QHNA 4E8CA 1V0KA 2WMJA 3U2CA 5HXMA 2L5HA 3WLJA 1GJPA 4HA1A 1EFZA 1VBRA 4KFPA 1OD8A 3FSTA 1E0XA 1U2YA 3TR2A 1JZ4A 4NQ1A 1BZLA 4H3DA 1HGWA 3R8HA 1CT5A 4IFOA 5D03A 2JKAA 1TX2A 3W7JA 4RZ4A 3VOFA 4ZOCA 4HCLA 1C29A 3TC3A 4ROQA 1NWTA 3PWAA 3PZMA 3F5LA 4D6CA 4DF1A 5CAHA 4UIOA 3VOJA 1OF6A 1VFOA 3MKVA 5CJNA 1DWIM 3U48A 1IIGA 1H2JA 5HJYA 1XBZA 1TE1A 1C8YA 4IP7A 2FLIA 4K8HA 2V5JA 3UWVA 5LA1A 3ZR5A 1MZHA 2P50A 3VFLA 1GOKA 3TW9A 3T40A 4LUIA 2WWDA 3T07A 3PK7A 1XLKA 4K36A 3AALA 2VR4A 4I9MA 4DYKA 3HURA 1Z44A 2H8ZA 2QF7A 1MFUA 5FJTA 3NDOA 5HATA 4CD4A 4ZSTA 3B4YA 3W1LA 4CN1A 3BVJA 2VR2A 4LUTA 2Y61A 1QOXA 2WP6A 5A6TC 1W1B1 3WLKX 1BVNP 5LIKX 3NGFA 1GG0A 3QY8A 1B3XA 2Z25A 2E28A 3L0GA 3W70A 3G77A 4HMEA 2Z1SA 4MUPA 4TTGA 3GS6A 1C8VA 4L9ZA 4IQDA 2C71A 3ARPA 4U31A 3DEQA 3CGTA 3U5YA 5DCBA 2O4MA 1ICQA 4EQXA 5AVNA 3HQOA 3VILA 3VNDA 1T8XA 3A12A 4JTKA 1NDZA 1VZWA 3TFXA 1NM9A 3KP0A 1ZMDA 4U5KA 3TTQA 4PGLA 3VE9A 4HN4A 4MNJA 4B3KA 4RW5A 4XKYB 3KM8A 2HROA 4BWLC 1ZSXA 2J27A 3WNNA 3ARSA 2I56A 4DNMA 5M5DA 2VVSA 1CBGA 3WNOA 3PAJA 1LBLA 3URQA 1B2YA 5D9MA 1P1MA 4GIYA 2BXZA 3ZQ9A 2PS2A 3AOFA 4JIIX 3I6EA 4GQRA 4UB9A 2X1UA 1VBJA 3BW4A 4NJGA 3T42A 2QMJA 4OFCA 4PODA 3VIOA 4G2DA 1KRCC 4TTUA 4YPJA 4YVXA 1Q1RA 2UV8G 2Q02A 4LAOA 2E25A 4Q8TA 3FV9A 4QLLA 4J40A 4KF1A 2J6XA 5ABGA 1GQJA 2NW0A 1EBDA 4XZHA 2W4XA 5E0FA 4IF2A 1EIXA 4UMCA 6ENLA 3ARYA 5CC7A 4JN8A 2DH3A 4M7TA 2QNEA 1VBGA 2RKXA 2YDQA 3SSZA 3R0UA 2CFYA 4AD4A 4FK9A 3H55A 3V0SA 4BI6A 1VQZA 3PSWA 3SGUA 4JNMA 4LUJA 3DERA 2OU4A 3GNRA 4OVXA 2OODA 3UCQA 4NVTA 2ATMA 1J0ZA 4NAFA 1PAMA 1RJQA 3RU6A 2OT0A 4WSHA 1ISZA 4QJ5B 1CECA 3TYEA 4EWJA 1TV7A 1ZCOA 2JK2A 2X8HA 2DV0A 4IFKB 5HULA 2XGBA 4Q8VA 3VU2A 1N7KA 3WKZA 3WCZA 3EBVA 3PZQA 1HFBA 1OC5A 1J0YA 3BO9A 1DOSA 1DJNA 2PP3A 1KBJA 3G1RA 4Z1DA 4ZXLA 1KFBA 3A47A 1C90A 1HN1A 3AXHA 3S2NA 5AYXA 2OXNA 1BYAA 1Q13A 1XSIA 3K1DA 4CD8A 4H83A 4GABA 4W89A 4DZ5A 3MPGA 3R25A 2YCLA 1QTWA 3DKLA 2OMAA 1JD9A 4DJEA 4OBTA 4JOMA 5A5WA 3TJXA 4HA3A 2WC3A 1T5AA 3WJYA 1VS1A 4ZFCA 4RL3A 2BSLA 1GVFA 2DZXA 1NDVA 4GZ7A 4OBRA 1A53A 4IICA 2CHOA 1KQYA 3E5BA 3W6LA 3L9CA 5KZMA 1KM5A 4NUWA 4I8DA 1LORA 1TA3B 1WDQA 3MMTA 4UTTA 2PTZA 2WNQA 2X2GA 3O6DA 1KRMA 1KQZA 4NY2A 3VPLA 1K6AA 8XIAA 4JNYA 4IISA 3TE9A 3CV6A 4R53A 1K70A 2IKJA 3N6HA 1XC4A 2V5CA 1R9XA 3OB8A 4O1EA 2XFYA 2QAFA 1US2A 4WR3A 3FAXA 1Q45A 4C6QA 1JPHA 3IWPA 3U9IA 3XISA 1WDWA 3GRSA 3LXBA 3PR2A 1XJBA 5D38A 3R11A 3SSJA 4QDPA 3B8UA 1V79A 2A3BA 3OPSA 5CJ5A 4LTSA 3ZM8A 4HK7A 3G1DA 4DO6A 2YYUA 1K9TA 2BY3A 4FNUA 3W7PA 1QR7A 3AZRA 3D3AA 2E6DA 3URNA 2NWSA 1FWBC 1FWDC 3GM8A 2Z24A 4J28A 4AB4A 5LIYX 1DYSA 2PBOA 1SJCA 4IL0A 2OEKA 2EPHA 4JTRA 3D9XA 1UC5A 2WJFA 3UZYA 5JUVA 1HP4A 1KW1A 2C18A 2OFJA 3H2MA 3DI1A 1V0NA 1CENA 5DT5A 2RAGA 4DAFA 2HRWA 1UR1A 4HPXA 3QV6A 3MVIA 1D7KA 1GNXA 4PRRA 2PDWA 4GO8A 4H1ZA 2A5HA 2FKPA 1JF6A 3VIJA 1S5VA 1PHQA 3SRKA 3GU9A 3I3DA 1H09A 2A7RA 3QN3A 1TPUA 4RXFA 2VQTA 4UFLA 3KS5A 3BV7A 1EBHA 3N04A 4CD6A 1DJYA 3TTSA 2GJXB 1S3HA 1JJKA 3UT0A 1STZA 2DVTA 2D20A 2WZEA 1VPYA 4PB3A 1W9XA 1QNQA 4FEZA 4GKLA 5TQLA 2FHFA 3DK8A 2NVCA 1K9EA 2AKMA 2AL1A 2AL2A 1A4MA 4H4WA 1OABA 4MPKA 2OKOA 4TQTA 3LUTA 2ZUWA 4OUIA 2IPGA 3PB2A 4GRSA 1WDSA 1UIPA 1OF8A 4L61A 2HTMA 4ZZ9A 1ALDA 1FWCC 1E4LA 3ITCA 1A80A 3AN1A 1R30A 1DTUA 3HGRA 3LA4A 3M9YA 2CZ5A 1V0MA 3I3BA 3UJSA 2IKHA 9RUBA 1VJIA 1V08A 4JKMA 3MKKA 2Y7EA 1LPFA 1SW7A 2W3RA 3N13A 5A95A 5GNYA 3UR8A 4X63A 3HPFA 5G2HA 4K68A 5FKYA 4LJ3A 3VIKA 3EKGA 4N9CA 3LBCA 4GFSA 2PLJA 4NP7A 5IHSA 3OA5A 1OGSA 3AIRA 3WH7A 1PHWA 2IQ0A 3FA4A 3AWNA 1KO0A 3BLPX 5FACA 4CKQA 3CQ0A 3B9JB 3ITGA 1KM4A 4M6PA 2PLKA 4LC8A 2DW7A 4WKFA 3K1GA 4EPDC 3WQPA 3CAQA 3QFAA 4R9XA 1LL6A 4HHMA 4DBSA 2P0IA 4GBDA 4HP5A 4MAVA 1S38A 5HMSA 2C1HA 3LV6A 2MNRA 5D9OA 1FKXA 5FL1A 4K1GA 3KDNA 2DUZA 4DM2A 3E2QA 4ADSA 2F8QA 2E5DA 4MNKA 4NNCA 5IOBA 5KSWA 3SJ3A 1A5BA 5K9CA 1Z3NA 1JDEA 2PC4A 3LBMA 4MWAC 4ZO9A 1L2QA 3R8RA 1N5WC 1XIIA 1XLEA 5IXEA 4ICNA 1AW5A 4WOQA 4LVBA 4M1BA 2EHHA 2O4QA 4PMQA 1ZZMA 4AAJA 3U7BA 2E8ZA 1J2BA 1S1PA 4LAMA 4K39A 4JTUA 4M7SA 3G1FA 1PTGA 1P1XA 5BRPA 2DH2A 1BXBA 3IIOA 4GG9A 2BHYA 3ATZA 1OYCA 1UWRA 1X1OA 4RE0A 4NJHA 1KV5A 4NZ1A 2ZA3A 5T9CE 3WJXA 4K7VA 3AJ7A 2B0MA 5DXXA 5AKQA 4MY8A 1EL3A 1TCMA 3ZVHA 1W6TA 3LLDA 2GQ3A 1LZOA 3MHUA 3WLIA 3AISA 4MFEA 3W28A 3CJPA 3M0HA 5ABFA 3PBWA 3VZYA 3M0YA 1EQPA 2GJLA 1FFRA 1GZJA 1XKYA 3M4HA 3NTYA 2FHBA 2D3LA 5FJUA 2YOCA 3GTHA 5GJMA 1IF2A 1O1HA 3GQYA 3FJNA 1Q6GA 3W2NA 1IEQA 3R43A 3NQMA 3L7RA 2HXUA 2FZ9A 5U25A 4ROPA 1NSJA 3ABSA 3H24A 1HKVA 3EMCA 1EKOA 1JL8A 4JGDA 1RV8A 1L6FA 3MMWA 1JPIA 1NOFA 4Q3MA 3H22A 1WZLA 2QLYA 1R85A 4MDPA 1QDSA 3KZPA 4QG6A 4H41A 1Z9AA 2CHNA 4A8RA 3OU8A 4AZBA 1WP6A 1BTMA 2YXGA 1TKKA 2DDXA 2ISVA 4H2CA 2VEKA 4Y7EA 4JFTA 1FFQA 1YE6A 2ASHA 4UZSA 3THAA 2GVYA 2V5BA 2E8YA 1D8WA 3EZ4A 5C0QA 1V03A 3CMFA 4WSKA 2ZDSA 2NXGA 2G41A 2W27A 3XIMA 1E5NA 1QHOA 2G8ZA 4EKJA 4O0KA 3GXTA 3PZ9A 1Q8JA 4D72A 2YAUA 3AHYA 2PP0A 1GK8A 2Z1KA 1QWGA 4YWIA 2QCHA 3GNPA 1PCKA 4E8DA 3RHGA 3LTSA 1NF0A 1C93A 1PX4A 4XKMA 1W1TA 3DKJA 1WZMA 4D6EA 3VIFA 1TPEA 1DIKA 4RX0A 3QZEA 3UY8A 9XIAA 1B3WA 5AC8A 3AHTA 4WLCA 5EBUA 2A3HA 5M17A 3EAOA 1M3UA 3KOWA 1UR0A 3VIHA 5LKYA 5LXEA 4DO4A 1O95A 2H6RA 2XIJA 3GNNA 5AHIA 2IXVA 2J7CA 1TVPA 4O0QA 4L6OA 3P0WA 5BCAA 2WZTA 1U1HA 4J4KA 5AVHA 2OSWA 4BK9A 4GY1A 1ADSA 4Y96A 2WCGA 1IGSA 2PDJA 5G2WA 1ZCCA 3V0TA 4F0RA 3QM3A 4HPGA 3SRFA 3WQWA 1Q4NX 1XRFA 3H23A 4FNTA 4ALDA 3TKFA 3QKZA 3L4UA 3NFUA 5FEZA 4S2BA 4KERA 4UCFA 3EDJA 1A5MC 4DEFA 2Y7DA 5LNVA 3MV01 4UQCA 3QR0A 2QQ6A 3THDA 1YDYA 4JX5A 4QE1A 2QDEA 1WDDA 3GDBA 5D05A 1LDCA 3B0VC 1FA2A 1TJPA 1FDJA 2NWRA 3MWCA 1X8CA 3QLDA 1C8XA 3O05A 4UWMA 2HVNA 5HJLA 2PF8A 2HK1A 4BJHA 2VUYA 1I8JA 3LPPA 4IOTA 2J7FA 1VEMA 3ZR6A 2OJPA 4WDTA 2OZTA 1QPRA 1GEHA 4DJDA 4XWUA 4D1JA 2Z1WA 7ENLA 4H4XA 1QJWA 1QNOA 3SN4A 3TQKA 4IFRA 3DFSA 3C2VA 3WDHA 4QITA 2R24A 4POCA 1B9BA 3D6NA 3PPFA 3TXZA 1JCNA 1UYQA 3M07A 2ZZCA 4CEXC 1JG9A 2JKEA 1OFPA 3BAIA 5AHMA 3A5VA 2O9PA 1XANA 4MFDA 2OZ8A 4JN7A 4NU7A 5I77A 1BWCA 3SR7A 2C1IA 5E9AA 1G4EA 4GUIA 3UU0A 1TJ2A 1LROA 2PFHA 3MCNA 4UNKA 3STFA 3VYLA 4A8IA 3W7QA 2WSQA 4OV9A 1ICSA 1C9WA 1O12A 1H50A 3L4ZA 4ZCWA 5RUBA 2YFOA 1VRXA 3BAJA 1LJYA 4Q4SA 1V02E 3H4GA 4BA0A 2A0NA 3UG4A 3W2JA 1OX4B 5FEPA 4W7UA 4N42A 3UF9A 4PN2A 3O15A 3H4KA 3PNZA 3U6WA 1V7AA 5C9ZA 1JRPA 1XH2A 3LHUA 1THFD 1EEPA 5FF4A 1JNEA 1YNYA 4BQ2A 3APGA 3WJWA 4AF0A 4RE2A 4AY7A 2JEPA 1GRGA 3WBAA 1E0VA 3M0JA 1XISA 2BFGA 3MYOA 3C8NA 1UWIA 3R07C 4LW7A 3G0XA 3T0CA 4DZAA 2WM1A 3ZMRA 4JQ1A 6XIAA 1XRTA 3RXZA 4WJEA 3S3GA 4JKKA 4FX8A 1O1ZA 3NS1B 1EX1A 2GL5A 3W1RA 1XLCA 4JTDA 2WMIB 1R47A 4FMVA 4S23A 4H2HA 4M82A 4O4VA 1M9HA 3LEPA 4HPNA 1RQBA 3EWUA 2NV9A 3HW2A 4YWOA 4GH1A 2PWEA 3CU2A 4JAWA 3C61A 3PY2A 1OFRA 4ZFMA 3SEPA 3HU7A 1MDLA 4OWGA 1WAWA 4ES4A 2ZZ6A 1US0A 3SQMA 3LBOA 4F2UA 1V6TA 3T2PA 1DJQA 1VLWA 5A6BA 3MHFA 3UXIA 3TYCA 3E0LA 3SQPA 1XH1A 2OZ3A 1OCQA 3CT7A 4C6JA 3ZFHA 1HJXA 3NIYA 4K1WA 3SN0A 5LIXX 3HFTA 4W8LA 1KV8A 1N61C 1ZAIA 4ONVA 4JD4A 1HXJA 4C90A 2VD8A 1IYXA 4Q6XA 1UZ4A 2ZICA 4OTKA 3HMJG 3LM7A 1EWDA 1PYMA 4G7FA 2ZXQA 1K77A 1LWJA 1R46A 1V3HA 1QVBA 2IPJA 3QLLA 5IFTA 1Z32X 2BVTA 2YZ5A 3RO6A 3TR9A 3AXIA 3MSDA 3OLGA 4GRTA 4AZIA 4UNLA 4PBGA 1C7SA 1BF2A 3DENA 3G3MA 1J2WA 4IMEA 3VC5A 1H7RA 3O8AA 1QW7A 1IZCA 1MYRA 2BVWA 3MT1A 1HG3A 2CLOA 2Y0FA 1AODA 1UWQA 2A4AA 4J9JA 1YBQA 3KRUA 3DHPA 3I7QA 4FXRA 1FWJC 4GGHA 3RLUA 1DEDA 2GSEA 1YE4A 3ZIZA 2GZXA 3LQLA 4U5IA 2BC0A 1EYWA 3WF3A 4BF7A 3I3EA 1A0CA 2VCBA 4H7CA 1U5VA 3G3DA 2W6RA 3WK0A 1S2TA 2ACRA 3OIHA 2G37A 3EWYA 1Q7QA 1CLXA 1MUWA 1OC6A 2J62A 4I7UA 4Q33A 2WMHA 5T91A 2D2JA 3SUTA 2HNHA 1EP3A 1W9BM 1P0EA 2W5FA 5DT7A 1CTNA 2QDDA 3AUOA 2D0HA 2XZ7A 2Y62A 3ZJ7A 2RH9A 3M0LA 4DXXA 1VD6A 3S5OA 4JX6A 1EYEA 2F5ZA 2GVLA 5JCNA 5HDRA 1UIOA 3TP4A 3RNDA 3PWGA 1EO7A 3NQ8A 2XZ9A 1F2JA 3WF2A 1XV8A 2VC6A 2CZVA 2CDUA 1SSGA 4RZ6A 3VUSA 4ZENA 3FNDA 3LCGA 2VVNA 4AX6A 2WBKA 4B91A 2EPNA 1H0GA 4LC6A 3EWDA 3KVKA 4IPJA 3FA5A 1EC7A 3S9YA 1UA7A 1ECQA 2BGSA 3CB3A 3G22A 1OG6A 1LOQA 3LSCA 3FA3A 5G4WA 3PBGA 3VD5A 4YXGA 3DFQA 3TSMA 5EKYA 4GVFA 3P67A 3MO7A 3A21A 3DK4A 1H7NA 4LRSA 4OQVA 1D2KA 5EBAA 1NOUA 3GDRA 4MPQA 5GJNA 4X61A 3FN9A 2OELA 2ALRA 3G2GA 3O6YX 4I3GA 3H7UA 3HZ3A 4DYEA 4S38A 2RDUA 4FHAA 3W9ZA 3MJYA 3FCPA 3S1VA 3W85A 2JF7A 3CH0A 3OG3A 1VPXA 1QRQA 3M64A 1R3WA 3NQBA 3MP4A 2PWHA 1RY8A 2Y6ZA 2FB3A 1DHKA 2EBNA 1AD1A 3GLCA 4PSRA 5DY2A 2WMFA 4XVEA 1VFLA 1ESWA 4AZ5A 2W0HA 2VGBA 4AFYA 4HTBA 4Z2KA 2OYKA 5D2YA 5DF0A 2MUCA 3AJXA 4PMVA 1E6ZA 1F07A 1TB3A 4XZ9A 2X41A 2JIWA 4H8HA 4JFSA 4CQ8A 2X16A 1BVZA 2H90A 4XD4A 2DW6A 4LGXA 2ZX6A 2VRJA 8XIMA 3TC6A 5JH1A 4J3WA 3KP1A 1NJJA 1TPB1 4B5VA 1IHIA 4HHHA 5B7YA 4ILSA 1EUNA 3P3BA 1KCLA 2QPUA 3PC0A 3WJSA 1A49A 3CQKA 4G7EA 4O18A 2CNCA 5F4WA 2YLLA 3CPUA 1XBYA 1P43A 4ACYA 4F9JA 4GYPA 3RF9A 1ZLPA 4JX4A 4L9YA 3P62A 1R6WA 1WV2A 2QT3A 1HIZA 3MUZ1 1RVKA 1UH4A 1LVLA 1A3HA 4DXVA 3ITVA 4FOKA 2J9ZA 1E6NA 3CGCA 3LXDA 1EOKA 1TO3A 4BF9A 2QUMA 1MZRA 3R0DA 3LADA 1ZNNA 3QMSA 1ZY8A 2D23A 1GRTA 2E9MA 2FYMA 2YIHA 1Y8BA 1OFAA 5LXXA 3SB0A 4IJBA 4GUGA 3T0BA 3TW6A 5DCDA 3NSMA 2WMIA 4Q4KA 3QV7A 4Q32A 4IJCA 1LBFA 4NEVA 3UGRA 3IANA 4GUFA 4KRTA 4L4MA 4FXSA 2E1WA 1M6JA 2HS8A 2V2HA 1MO0A 2V38A 2ZXBA 3GU2A 3CXOA 4C6EA 4E2DA 1HKIA 3HG5A 3LI0A 1EJWC 2BY0A 4AVFA 1VFSA 2QCDB 1H63A 1LQ2A 1KFJA 4US6A 4YVVA 3PPCA 2VZTA 1TYTA 3W75A 5H6HA 4V27A 3T81A 2AGKA 4ML4A 1VYSX 3H7VA 4A2RA 3LCHA 1EPVA 2VX6A 1FWEC 4DB7A 2INEA 3P93A 3H2AA 1O5RA 3BOXA 1KGWA 1ME7A 3SY1A 4O50A 3VMNA 1U83A 1IT7A 1IWPA 2YCIX 2PI6A 2J7HA 1CGUA 4ADTA 3ZJ8A 2PLCA 1TVLA 3II1A 1RBLA 3E2RA 3JZEA 3P0XA 3VTRA 1FKWA 3UWWA 2O9RA 2WO5A 3NOEA 2BOFX 1PTDA 4JDRA 2V5KA 3ARXA 1PX3A 1V7YA 1CXKA 5JQ9A 3HF3A 1EEXA 1FECA 4CLMA 1LQ0A 2CLHA 3IAQA 3NQ6A 4HZMA 3KLJA 4JCLA 6A3HA 5D2TA 2VEGA 4J1OA 3RLHA 3GHSA 2XN0A 2DQWA 2HV5A 4DJFA 4HTYA 3VE7A 1P0DA 1RLCL 4HPHA 4LAUA 4Y90A 1SFTA 1OJXA 3S1UA 1NVMA 5A69A 4H7VA 3W29A 4FLSA 2UBPC 3K30A 3KOZA 2FFIA 4PCSA 2CLPA 4REQB 2W3ZA 3PM6A 3E0FA 3M43A 1UZHA 3GIQA 3C0JA 3B8IA 2BASA 2PRHA 3QQWA 3U0HA 5XIMA 1HJWA 4HZ6A 5CPNA 4GINA 1MXGA 4B5TA 5LHFA 1M1BA 1LL4A 4NL1A 2E0PA 4GQ0A 1JR1A 2NV1A 1DJGA 4LANA 2EPOA 1OYBA 2QJNA 3D0CA 4D8ZA 2KX9A 1YXYA 1FP9A 5B80A 5MKGA 4N4QA 2J9XA 1PIFA 3H2EA 1U5JA 4QQ3A 2XGZA 3CUGA 5BYWA 4IPPA 1QT1A 2OR2A 1W56A 3CQIA 3WYZA 4AX7A 3RYSA 4FNPA 4DUOA 2WOIA 1SO3A 3GU1A 3IUHA 3TX9A 1AJZA 4WY0A 5CG7A 1M65A 2FHCA 3IVSA 1P6BA 2NXHA 3Q58A 4F2TA 3GE7A 5HR6A 3MS8A 4K6AA 4RR4A 1UROA 2TAAA 1Q2RA 2J24A 2GGJA 3HBLA 3GVQA 1HKMA 2PPGA 4RXGA 2VHLA 3UBPC 3NQFA 1VYRA 4JTFA 4NYYA 2P1FA 3MA8A 4OHQA 4H9VA 1KTNA 3G6LA 1H51A 1GOMA 1XDJA 1R3RA 3WEZA 2ZYFA 5LGZA 2CHRA 2ISWA 3FKRA 5CZJA 1B0IA 3WQCA 1PZ1A 3WK1A 2QJHA 2WC4A 1SW3A 5AY7A 3TSBA 1E0WA 1W9PA 2D0GA 4E6MA 1KXHA 2DZTA 1DWJM 5BROA 1OJTA 5FL0A 2XH4A 1D3CA 4IIGA 1HGYA 1XLMA 3UXKA 3W82A 3BSHA 4DY1A 4J2MA 3S2LA 3V3WA 2Q09A 4PUDA 3WMCA 4HSNA 2O9TA 1ISVA 3HGSA 1ZKQA 2HCVA 4UTMA 4PMYA 2FZDA 5E70A 1IIHA 2TYSA 3DJGX 1AJ2A 3H4XA 4DWSB 2Y8VA 3SCSA 2A3EA 4QJ3B 4EP8C 1H5YA 3VGBA 2G96A 4J3SA 4XO6A 4ECLA 2OO0A 3KS6A 2BNJA 3N1AA 2VRQA 3JW7A 3SGZA 4UTLA 2OTDA 4MKNA 2CERA 3CYJA 4HZ8A 1H11A 4HNCA 2OCZA 5KEZA 5F1UA 4XAYA 3HPZA 1JPMA 3BGAA 4I9TA 4OOUA 3DAQA 2J8FA 4PEKA 5BOOA 2WXDM 4DZIA 3E3HA 1P0NA 1PKNA 3FHQA 3ZOAA 2UY4A 2J47A 3NZPA 4ZOHB 4GVIA 5FF3A 1E1CA 2YW4A 3SCNA 1ITXA 4ZQPA 1AUSL 3ORWA 2JQXA 4QCFA 4YHGA 3GD4A 4PUNA 4U2ZA 1BEUA 5C7HA 1P7TB 5E93A 3A24A 3F4NA 1XFBA 3GC2A 4H4VA 2YW3A 2PWFA 3K8KA 1FO4A 1AQHA 1A5KC 1Z42A 3ZT6A 2BODX 4NRSA 3BWWA 1MMFA 1VH7A 1HJQA 3CNYA 3B4UA 1E0TA 1TWZA 4FLRA 5AB3A 2I7GA 1GVIA 2WZHA 2V3GA 2E7FA 4AU0A 2AAAA 1Q66A 4O28A 3LERA 4TVCA 4JFWA 4L7ZA 1CNVA 3RX3A 3N6JA 1F74A 1ZJIA 3M7WA 1IWAA 2VFGA 4S3DA 3AMKA 4V1XA 2CLKA 4OU1A 3VUPA 5HQMA 1YTKA 1XHCA 3EWBX 4Z08A 4B92A 1UA3A 3COTA 3RMEA 3HQNA 2RABA 4S3CA 4D6JA 4QTGA 1EXPA 4GA8A 1G7VA 3QYQA 3UA3A 1AQMA 1LM1A 2VWTA 1TPWA 4UFMA 3NJ3A 3ZLGA 4P7OA 1EGVA 1EWEA 4WUIA 4QNEA 3P6LA 4MGGA 3W27A 3SCPA 1TTIA 1TELA 2ZADA 1O60A 4MG4A 3A22A 3L2MA 3WH6A 3NSXA 3LHZA 2ZX9A 1I60A 5EMMA 2XH7A 3W24A 4AZCB 1U5HA 4B3LA 3BK0A 2XIQA 3L67A 1Q8AA 2YYTA 4JBRA 1S46A 5CPSA 1TWDA 3SFWA 5FJOA 3WDRA 4E38A 1Z8AA 2VKZG 4DJDD 4NZFA 3UJRA 3E5PA 2YBTA 3QFEA 2ZUVA 2YVFA 3VGDA 3CQJA 3ICJA 2V6AA 5DY3A 1KLYA 3HQPA 4AEFA 3ARRA 4KRUA 4EF9A 1ZBWA 1BLIA 3ZWSA 2B7OA 1GEUA 3CS2A 3LD5A 5C9WA 4FF5A 3CYVA 4CCEA 3BCFA 4JL2A 3RM8A 3RO8A 3QHMA 4CGTA 1V02A 1NQ6A 1HL9A 4P7LA 3A7RA 3AMZA 3L4YA 8RUCA 1L9WA 2VEIA 4L9XA 1A50A 1B3OA 1K7XA 1JUEA 1CB7B 3PP7A 5IBXA 5HPOA 4DAIA 4KRZA 5A8NA 4A6GA 3E6EA 4EM3A 1GSNA 4ZO7A 3H7RA 1DIOA 3W1PA 4AYGA 5HWNA 4FO4A 3L5OA 4R85A 3SIZA 3DFHA 4IG2B 2QEZA 2GR2A 4PTVA 4D8AA 2D73A 3N34A 2XIIA 4Y6GA 4Z2HA 2TSYA 3V1PA 1XICA 3WLPA 2A21A 2VX4A 1PWMA 4WX2A 2Y7FA 2VFDA 3U2ZA 5A6LA 3E0WA 3KBVA 5D9NA 3N4AA 5CGMA 1QOQA 1UMLA 2C16A 1Q6EA 2PDFA 5JCKA 3TAKA 4NAEB 5CJMA 1I4NA 3LMYA 1XRSA 4ATDA 5D30A 1L8NA 3QRHA 5H8MA 5I02A 4BI7A 4KCTA 2NUWA 2G97A 3URBA 1XD0A 4XX6A 3CGBA 4HCDA 3QR3A 1F4AA 1JYVA 3CGDA 4JTSA 1A3WA 4EVZA 4C1KA 3R13A 4DWSD 2WSPA 2Z2BA 2ZUMA 1T0OA 3I4KA 4H4SA 1U30A 3HM7A 2GSJA 2WVUA 1J6OA 3QYSA 3W7RA 4CNTA 1FP8A 1QO5A 3KOYA 3DIPA 4RKAA 1CXLA 3UWQA 1S5WA 4EE9A 2RJHA 4GCAA 4F40A 4IX0A 4HYWA 3H26A 5A6JA 1BWLA 4XAGA 4E2OA 3H21A 3B97A 4HNLA 3OVPA 4X60A 1RHCA 4DBWA 2BY1A 3R7MA 3EUB3 3LZ3A 1TVNA 5BNKA 1JDFA 1TWWA 3MI6A 4Y9NA 5I0DA 2ABBA 1UUOA 1R3VA 5BWFA 3W22A 1GEQA 3N2TA 4C6PA 4UTJA 4NT0A 3NQ2A 4Y8EA 4Q7BA 3CAVA 2FTYA 4OE7A 2OWCA 1E40A 2Y2WA 2FPVA 4JYDA 3RMJA 1GZ1A 5G1TA 1B90A 4JDYA 1OT1A 3P74A 3AFBA 3P81A 7A3HA 3VABA 1H7PA 1N62C 3NL6A 1KCXA 3S9IA 5BRQA 4PB4A 1HUVA 3GHUA 2E5AA 1J18A 1YADA 1V77A 3B8TA 2ZWYA 2PDGA 3SUVA 4DNAA 3UNDA 5EB8A 4BEQA 2OQLA 1VQTA 3IIVA 2NVAA 4M29A 4NNBA 5I03A 1HVXA 2W66A 5AZ0A 5D32A 1V51A 4GJJA 1NDAA 4PYSA 3OLIA 1S2CA 3SUSA 1K8ZA 4LB4A 4NJKA 3KL0A 2QV4A 3C0QA 1E5JA 1W8GA 1XIJA 1OZQA 4AMAA 2ZDRA 2J78A 1HJSA 4H9XA 5CZKA 4C6DA 2ZUUA 1LBMA 2CXEA 2V30A 8CGTA 2V67A 4FNSA 1NP2A 3AIEA 4C6OA 1YDNA 4EOUA 1LRNA 1TPDA 4GYPC 4KESA 4A3RA 2AQWA 4L56A 2VWSA 3NEHA 3OBEA 4LOCA 1UR4A 1OFEA 2PGWA 4J3UA 5EMYA 2GGGA 3BMXA 2YPIA 3P8JA 3B0XA 3K13A 4ZQNA 2HPIA 5A94A 5EA9A 3I65A 2JFEX 3T0DA 2NQLA 4D8LA 1KGXA 4KFNA 1GRAA 4QGCA 2CEQA 4JFVA 3BW2A 3MBFA 2D24A 1CXFA 1EO5A 2X8RA 2PGEA 3AS1A 1GVOA 1WPCA 4MYAA 1UW9A 5KVHA 5A2BA 1HQTA 5D9PA 2ATSA 4IIFA 1J79A 2C8NA 4LUYA 3FEQA 3NOYA 4GI6A 1GQIA 1BSIA 3VKKA 1JYXA 5C2XA 4EMJA 2W63A 3LTYA 3GH4A 2PB1A 4AWUA 2YXOA 1HP5A 4MMWA 1AZ2A 5BZAA 3H8AA 4YLWA 2EKCA 4GWEA 2WANA 1AA1B 3JRKA 3N14A 3IJ8A 3S5ZA 3EDDA 4TVDA 5BXRA 1PKLA 2DUXA 3LRLA 5D09A 3ENLA 1UD3A 2Y24A 3GBDA 4GISA 5I3GA 4D9PA 4DRSA 1Q4WA 1KBKA 3SCVA 2Q8LA 1UOZA 5I3HA 1A5SA 1YPXA 3QPEA 2OGYA 1XIEA 2CITA 5C55A 2I9UA 2G3JA 4LV4A 2ISSA 3GC5A 4ZB2A 2PDLA 2QKFA 3F4WA 4HMNA 3U5UA 1DQUA 4R5EA 4KIEA 2FB2A 4ZE5A 1SUXA 1RVGA 4C7FA 1E70M 4Q4QA 4PB5A 1SZRA 3PJWA 1NHQA 2VCCA 2Z1XA 4YL2A 1TIWA 3QGAC 1EJVC 1ZRQA 5CC6A 5DX7A 4O52A 1TV5A 5CG0A 3WQEA 3UVAA 3GIYA 3UVIA 4HA4A 3U2OA 1QPKA 1XYBA 3BJSA 2QDGA 2VOMA 1POKA 2QXWA 2FTWA 3OQ8A 1FHUA 4PTMA 5CBIA 1JAEA 1CGWA 3CAWA 1FRBA 4X0NA 4QG8A 4UTWC 4LT9A 1R3QA 3WK3A 3CXBA 1V0LA 3K8MA 1T6MA 4U28A 2A2IA 4AZGA 3CUZA 1I75A 4AY1A 5GRTA 3V5OA 3V4BA 1UR9A 4JZ5A 3TH6A 1BRLB 2OWXA 4HN8A 1TPH1 3DGBA 3WDJA 3F2BA 4H4YA 1DJZA 5I3FA 2PP1A 1KXTA 3DYOA 2YB4A 2NQ5A 4JNZA 4G1NA 1GGOA 4YS1A 1KR0A 4R34A 2DZAA 3CWHA 2XH2A 4PRTA 1FWRA 1Z7AA 2FPYA 3BAKA 5HUOA 1EA9C 1H7WA 2G3NA 4C1NB 4Z2GA 1UKPA 4L4LA 4B5XA 1JOAA 1UKQA 4CNNA 2B81A 3CMGA 4HCHA 4BF5A 1S1RA 3E74A 2X8CA 3NPVA 1CXEA 3RG6A 1LG1A 1IGWA 1YDOA 4FLOA 1FWTA 1K03A 1A3XA 4H00A 3BAWA 1W5QA 4F4RA 1K3UA 1U1JA 2E5BA 5CZSA 1AW1A 3VXGA 3DH9A 3HA1A 2DGAA 3WMSA 3R0KA 4LYQA 4IQEA 2QGYA 1K6WA 1XUZA 3IJ9A 2CW6A 5IM51 1AQFA 4JQ9A 1JUKA 1VLIA 3NR0A 3AHZA 2F9RA 1VBUA 2QAPA 2VUNA 4E4FA 2XUCA 4PFMA 3IS4A 1OGBA 3RJYA 2WMKA 3FJLA 1EH9A 3OVQA 3MBDA 2VEFA 4RV8A 3ZLHA 4ML9A 4KH2A 1TUFA 3C3NA 4AMCA 2WLZA 4R7JA 2ZA2A 3BL3A 5EL1A 3A7UA 3LG3A 2OSXA 1CWYA 1IEVA 3E96A 3TSDA 4I7VA 1CXHA 4L5ZA 1REQA 5EYWA 3WENA 3WNPA 3PHAA 3L66A 1WNOA 4UTFA 1OX5A 2DT3A 3ECQA 4GQGA 5AC7A 2WKJA 2J25A 1CGVA 4TX6A 4HNOA 1OCBA 3N73A 3VOIA 3VX1A 5LHEA 2A6LA 5M03A 2EPMX 3SRHA 1XLJA 2QUUA 4US5D 2F6KA 3NVYB 1QPOA 2XVNA 4EXBA 1HO4A 2J9YA 3B0YA 1J6PA 4AEEA 2ADAA 1V6VA 2BVDA 3EKZA 3WQGA 3GG1A 2IXUA 3VMPA 3A3HA 4W86A 5FI8A 2PGRA 5IBXC 4W8BA 3T0TA 4ZOAA 4R88A 3T0AA 2R6OA 3MP3A 3II4A 3OGVA 1AMYA 4NZ5A 3NGJA 3CGEA 2Y5EA 4Q8UA 1DE6A 4HHPA 1PVNA 1JI1A 1SZGA 4YWSA 2JEQA 1DP0A 4KQNA 3VM5A 5BMXA 2J7EA 4GC4A 3PUOA 3KHJA 1EP2A 2AOSA 1H5VA 3VZXA 1GOOA 3ITTA 1C7TA 2Z2UA 2WJDA 2ZZ1A 1OVDA 1Q6RA 2AGTA 3IUDA 4ATWA 5JVLA 4JTCA 2XH0A 2XM1A 2DSVA 3A3WA 2FVKA 4DBUA 1ZPTA 1ICPA 2P53A 3V5CA 1VCVA 2QCCA 3WUEA 3S6TA 3K4WA 4HU8A 3KWXA 4KPRA 3UR2A 1UD5A 1RP9A 2CLIA 2XVPA 2E1DA 4A3HA 3OVGA 3AU2A 2ICSA 1O94A 1N60C 3GFYA 5JCMA 2HE8A 3ZT5A 2EQ8A 3WBEA 3U57A 3C3UA 2ZZ4A 1YEYA 1F7BA 4OGZA 7TIMA 1NFGA 1E9YB 1K9FA 4EM4A 1PKMA 4PTXA 8TIMA 4IJRA 1WKDA 4QLKA 4IP4A 5CAKA 3UYCA 1W3NA 3M5VA 2QJGA 3W25A 1W3HA 3T6CA 4G8TA 3FHAA 4A3QA 3EANA 4DNHA 3V0UA 4E4PA 4EMWA 3QHOA 4XIMA 1YQZA 1VEOA 3TN4A 3BAYA 1H2IA 3R10A 3MUXA 5C6MA 2ZA1A 3H2FA 2J13A 2GFTA 4QROA 2Q8ZA 2X30A 3H2OA 2Y70A 3FYPA 1WUFA 2W91A 2VZUA 2WKGA 5C71A 1M03A 1B57A 3WEMA 1MQQA 1V3JA 2J3NA 1I1WA 1AK5A 3PJXA 4B5WA 1WKFA 3T08A 3GWQA 3CZGA 1KN0A 4J57A 1UMYA 3R1ZA 1TTPA 1S2AA 3B8SA 4NJIA 2VOTA 4Y9AA 1XIMA 4M51A 2ZRYA 4MM1A 3KBMA 3T8QA 8A3HA 2IKIA 4DPQA 1XYCA 3M6YA 2PDHA 5ENLA 3UPBA 5A2AA 3LXCA 4K8GA 3IRSA 3N9SA 2A85A 4GY7A 4XD3A 1H1ZA 5E0CA 1FCBA 3C86A 2BX7A 3AZSA 5H8UA 1L6WA 4WCJA 4DVOA 3BV4A 3ID7A 1W91A 4IGSA 2O92A 4GOAA 4QS6A 4EXQA 4JQAA 1J0IA 5CC3A 3PBVA 3EMQA 1XCWA 4EK7A 1CXIA 4R7OA 4CU8A 3RAOA 1J96A 4GNVA 2BHZA 2Z27A 3CLMA 1M7XA 2W3SA 3EPNA 3ME3A 3RR4A 1FFUC 3VZZA 3KW3A 1Q1WA 5I2UA 4OBSA 4QR6A 5LGXA 1PBGA 1UR3M 2Z0IA 4HSHA 1SJAA 5C70A 3N2MA 3T55A 4XZNX 1LWHA 2PDPA 5K3VA 1FWSA 3KDOA 3WD1A 2FH6A 1NHRA 1G69A 4IMFA 1PUDA 1YRRA 3KHDA 5AC6A 1UP2A 3NNTA 4IIEA 5TD4A 4AZ6A 1CEOA 2I17A 3U4FA 1HNYA 4C6KA 1MNZA 3GNOA 2ZRXA 2DUAA 3TWAA 3KOFA 1ZBKA 2JALA 2GR0A 3KBJA 3K8LA 3R5EA 1FCQA 1UH2A 3QQ0A 3C52A 2TPSA 1FIQB 1DQWA 2J79A 1VIWA 3N11A 2AKZA 2OPJA 3QQ1A 3NM1A 3ARWA 1VR6A 3RCNA 2XU2A 1UKTA 3M0IA 4XBKA 1SU5A 1BSLA 2EQ7A 1X6NA 1HO1A 1QPNA 4NRRA 3EYPA 3L4XA 4YTQA 2W62A 3OODA 2WHMA 3S5SA 1ISWA 1KWGA 1A47A 7TAAA 4MJ4A 1RSCA 3LPFA 1WE5A 3MO4A 3WQVA 3HJEA 3PFMA 4LPCA 4JIRA 4XZLX 1M04A 4NXKA 1F3WA 1XX1A 3U2EA 4B16A 1VYPX 3KAOA 4ZBCA 2PTDA 1JGMA 1PEZA 4K8EA 3DZ1A 4PUEA 4BZYA 4N6EA 3FW6A 5HINA 1ODZA 5G5GB 3NQEA 1VGAA 1K4HA 4JTJA 3RNMA 1G94A 4FALA 4Z2IA 3QTGA 1DXLA 2Q01A 3F5KA 3UY7A 4PEEA 5E5CA 1XH0A 1E51A 1UOKA 4QJ1A 4F9DA 2XISA 2W67A 4G6CA 1TWIA 2V3BA 3AIQA 1XSJA 3MWAA 1GJUA 4K7YA 1ZB5A 3TQVA 4W88A 4LYRA 3VMOA 3CIWA 4P8UA 1WA3A 4MB5A 1PCWA 3B9DA 4MWAD 3W7OA 3ZJ6A 3WFLA 3DG6A 3PUDA 3G5EA 4ACZB 1H49A 3UCDA 2SFPA 1NWSA 1CGTA 3QZAA 4ADUA 5A6MA 4UOZA 1HKKA 2F6UA 4GI9A 1TRDA 3GR7A 1R8LA 1XPYA 3RPTA 1Q6FA 1KA9F 4EAMA 3TVAA 3IJDA 1OBAA 4XAPA 1ZENA 1GPFA 3UJFA 4PR4A 2INFA 3S8HA 4KEMA 2ZRWA 1XIFA 2HZGA 1NWUA 3PAOA 4ZEPA 2Y5SA 3QZ6A 3PPGA 4LRTA 3G8RA 1BAGA 3LLXA 1OIMA 3GXNA 2V9DA 5DMYA 5A2CA 4WSJA 1BWVA 4L64A 4ERAA 4QCEA 2G95A 4Z0JA 4UTIA 3CHEA 3HG4A 1E6SM 1JULA 3VFCA 5JBFA 1KM1A 1P0BA 4MY9A 3PS7A 3GO2A 1MQPA 2WHJA 3WBXA 2A6NA 3BLOA 1OC7A 4HJWA 5LA2A 4AUBA 2CBJA 1NEYA 4IHCA 1PZ3A 4UFJA 2QV5A 4H7ZA 2RFGA 3HJZA 1V5XA 1VFUA 3EOUA 1KR1A 1IQ8A 3KOXA 4QNWA 5IDIA 4LAKA 1B1YA 1G4PA 3HGJA 1GZGA 1JQVA 2GDUA 4F66A 3VVGA 3M47A 5G1YA 2XIBA 2BWGA 2GK1B 4F0HA 4LEQA 3O3RA 2NLIA 4AIEA 3WD0A 4JTEA 3CM4A 3KWSA 1PDYA 3ES7A 5BW6A 2V3EA 3B9NA 1TRIA 5A8QA 3VNIA 1UASA 3GUWA 2GOKA 2NT0A 3TC7A 2WAGA 4EIVA 4MIMA 1FUYA 3EX3A 3LQGA 2XIMA 5M2FX 1SO4A 3CB8A 4EF8A 2DPEA 4LF2A 4HNNA 5BOFA 4M3PA 5DO8A 4PFHA 3ABRA 1XGDA 2VGFA 1OINA 3BDKA 1RQHA 3U4AA 5EBKA 3TU9A 3KX6A 4PMNA 4FAMA 3GTIA 3QOKA 4CNUA 1IXNA 1ZXIC 3T1GA 1RM6B 4IMCA 4YYFA 3IGXA 1XM3A 5BU9A 2JE8A 3ZSTA 4PCPA 3SY8A 4MKVA 4H8VA 3BMVA 3LI1A 4NF7A 3EXRA 3M5ZA 3BCJA 4IT1A 4HHLA 5HR7A 3N12A 3WUFA 1QAPA