3R0UA

Crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : tartrate and mg complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
362
structure length
362
Chain Sequence
VSKIIDIKTSIIKIPLKRTFITAVRSTNHIDSLAVELTLDNGVKGYGVAPATTAITGDTLQGMQYIIREIFAPVILGSDLSDYKQTLELAFKKVMFNSAAKMAIDLAYHDLLAKEQDISVAKLLGAKANSIVTDVSISCGNVAETIQNIQNGVEANFTAIKVKTGADFNRDIQLLKALDNEFSKNIKFRFDANQGWNLAQTKQFIEEINKYSLNVEIIEQPVKYYDIKAMAEITKFSNIPVVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMESPAGILATASFALAEDITVADLDPLDWVAKDLYSDYITFNEPNIILKDNLKGFGFNLAENLYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Francisella philomiragia subsp. philomiragia
molecule tags Lyase
molecule keywords Enzyme of enolase superfamily
total genus 119
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3r0uA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3r0uA01
3ZVHA 1EC9A 4J3ZA 3VDGA 1NU5A 4F4RA 3I4KA 1XS2A 2GGEA 2GDQA 1WUEA 3MQTA 3MKCA 4GIRA 4GFIA 3GD6A 2P0IA 3R0KA 2OZ3A 3RGTA 3UJRA 3CAWA 4IL0A 1ECQA 4GGBA 2OQYA 3CB3A 3VFCA 1TKKA 3OTRA 3RRAA 4DXKA 3JW7A 1KCZA 2FYMA 3OZYA 1SJBA 3UGVA 2DW6A 4IZGA 3DFYA 2PU0A 4H2HA 2OO6A 3T9PA 1KKOA 2I5QA 2XGZA 4M0XA 4IP4A 3D47A 1JDFA 2QJJA 3DG6A 4EWJA 2PPGA 3FXGA 5FJPA 4IT1A 2GGHA 1ELSA 3GC2A 3UJ2A 1XPYA 2PP1A 2PSNA 4DYEA 3V5CA 2QJNA 4ENLA 1W6TA 3MUCA 1NELA 4E4FA 1FHVA 2P8CA 3T8QA 3S5SA 3IJLA 2PGWA 2OPJA 3FJ4A 3OPSA 2NQLA 3MZNA 3H8AA 3RR1A 3VC6A 1BKHA 3VCCA 2PTYA 2PODA 1PDYA 1P43A 4IHCA 1KD0A 3RITA 4HCDA 1SJDA 3I6EA 4G7FA 4DX3A 3PWGA 4A3RA 4FI4A 3ZLHA 2FKPA 2PTWA 4H83A 1F9CA 3T4WA 4MKSA 4GGHA 3V5FA 2PGEA 1BQGA 2OKTA 3V4BA 1MNSA 4JN8A 1SJAA 2PP3A 3EEZA 3SN0A 2PS2A 4HCHA 2QVHA 3NO1A 3RO6A 3SBFA 3ZLGA 3QLDA 3U9IA 4H1ZA 1R0MA 3BJSA 3UJEA 1JPDX 1PDZA 4X2PA 5FJUA 1YEYA 3UJSA 2QJMA 3H70A 2XSXA 3BSMA 3SJNA 2OX4A 4ZCWA 3OP2A 3ES7A 5FJOA 1EC8A 3QN3A 2AKZA 3N6JA 3TTEA 1TZZA 3OW1A 3MSYA 4JHMA 2P3ZA 3DDMA 3OZMA 3ZLFA 4MMWA 3H12A 3THUA 3TCSA 4HNLA 3TW9A 4KEMA 2OLAA 2PTXA 2AKMA 1DTNA 4E8GA 4YWSA 1EBHA 1ONEA 4JN7A 2QDEA 4DWDA 1SJCA 2PU1A 3RCYA 2CHRA 3UXKA 3NFUA 4MGGA 2PA6A 2MUCA 3FV9A 3S47A 2OQHA 3CXOA 3BOXA 2DW7A 5BOEA 3QTPA 3Q45A 3P3BA 2PCEA 3R25A 5EU9A 3SN4A 3SSZA 3QKEA 1IYXA 5BOFA 4K8GA 3SN1A 2HXTA 2OFJA 3DESA 1TE6A 4G8TA 3V3WA 3DG3A 2MNRA 3ENLA 4IL2A 3GY1A 4GYPC 3TJ4A 2QDDA 3P0WA 2AL1A 5IDZA 3UCDA 4M6UA 3UXLA 4E4UA 2P8BA 3N4FA 3DFHA 2GGJA 2HNEA 3D46A 3VC5A 2XH4A 3TWAA 3TOYA 1E9IA 3PK7A 2HZGA 4GYPA 4ROPA 1R6WA 3MWCA 3ZVHB 3K1GA 3FYYA 3JVAA 3R11A 2HXUA 3ZVIA 4HNCA 3QPEA 4K2SA 4A35A 1WUFA 3UCCA 4IP5A 3VCNA 3P93A 2PTZA 1MUCA 2QGYA 2AL2B 2AL2A 3TQPA 6ENLA 1KKRA 3NZGA 3DERA 4GMEA 3TJIA 3KUMA 1FHUA 3IJQA 3U4FA 2OZTA 1RVKA 3HPFA 2RDXA 2ONEA 4Z17A 1MRAA 2O56A 3VA8A 2GL5A 1JPMA 3JZUA 5ENLA 3B97A 2P88A 3N4EA 4J1OA 1MDLA 4KPLA 2GGGA 4DHGA 2ZC8A 1EC7A 4GISA 3IJIA 5J04A 3Q4DA 3DIPA 4K1WA 3DEQA 4ZA0A 3EKGA 2POZA 4HPNA 4HN8A 3H7VA 3T6CA 3DGBA 3PFRA 2OVLA 4HYRA 3DG7A 5FJRA 1MDRA 3CYJA 4KT2A 3MY9A 3GO2A 2XH0A 2XH2A 4H19A 3N6HA 3NXLA 1EBGA 1P48A 2PMQA 2GSHA 3CT2A 3STPA 3R10A 2GGIA 3R1ZA 4HCLA 1OEPA 3FVDA 3SQSA 3CK5A 5FJTA 4DN1A 2OZ8A 3UJFA 1L8PA 2XH7A 4E5TA 3TWBA 7ENLA 2QQ6A 2ZADA 3IK4A 4KWSA 2PP0A 1JCTA 3ES8A 3FCPA 4Z1YA 2OG9A 4FP1A 3I6TA 4E6MA 3R0UA 4A6GA 3PWIA
chains in the Genus database with same CATH superfamily
4GQRA 3P81A 5AN7A 1XCXA 1VB9A 2JFEX 1W17A 2WHJA 4F4RA 4BWLA 2ZE0A 3GWQA 4RPPA 1EZ2A 1J2BA 1KR0A 4JTRA 3KS5A 1C8QA 1WUEA 3LZ3A 1IQ8A 4CQCA 1ZZMA 1P0EA 4KF1A 1L6FA 2GSJA 1BVNP 3RCNA 1GERA 1RM6B 3CJPA 1NDWA 4XVEA 4O14A 4KKXA 1RZMA 2VENA 2A3AA 2I7GA 3IVUA 2A3BA 3ZWTA 4KCTA 3W9ZA 3KM8A 3RJXA 1KRCC 3HQOA 1YQ2A 2OR2A 2CBJA 3OZYA 3WUEA 2F5ZA 2PDIA 4NNAA 4DJED 1WKFA 5XINA 3RX4A 1AJ2A 3MO4A 4Q4SA 3WLTA 1KN0A 4IP4A 5M3WA 1PWLA 4EQSA 1WAWA 3FXGA 2BFGA 4DAIA 2EPKX 5K4ZA 1Q45A 1JCNA 1TVNA 5M1TA 4O0ZA 2J75A 1OX4B 4L9XA 6CGTA 5B80A 1A5NC 5AC8A 5EMKA 1J5TA 3GC2A 4U2YA 2C15A 2FLIA 5I3JA 5MKGB 2HV5A 1R2SA 2YAUA 2D24A 2X42A 1A47A 4ENLA 2DSZA 4HHPA 3BGJA 1J0HA 2ISFA 4U28A 2ALRA 3OQEA 4NZCA 2BBFA 5D9MA 2ZE3A 3MP4A 4C6PA 4O1CA 4GNKB 3UG8A 3WQCA 1Q6LA 4AD1A 3WG6A 5U25A 4FLRA 1FX6A 4XO6A 4DO5A 3QMTA 3TUUA 2GR3A 5CLTA 1AUSL 3IAQA 3CWOX 4QJ1A 2CWNA 3MPGA 1RBOB 1CPUA 4IIHA 4EANA 5I7GA 3H4GA 4KWWA 3QFWA 4LVGA 4MKSA 5FEZA 4OBRA 5DCDA 4PUUA 3T44A 1SJAA 3B9OA 2HBVA 4YHEA 4QISA 4GXWA 4I7WA 3SRFA 3WKZA 3RJYA 5A3HA 3E0IA 1NWUA 3MHFA 3G18A 3S0CA 1DJHA 1RCOB 2V38A 1TV4A 3H2AA 1UJQA 3DJJA 4QG6A 3THCA 4P5UA 4W7UA 1QHOA 3N3MA 3TW6A 1WXYA 3A4JA 3RPDA 4MJ4A 2O7SA 1UWAA 4XQ6A 1AQHA 2WBGA 1E9ZB 4DELA 4IGHA 5JH2A 2VJXA 2YL6A 2ZVRA 3OW1A 4JTHA 2P3ZA 2L5HA 1W5QA 3TXZA 1TJ1A 3F2CA 4MAVA 4KEMA 1XQLA 3P5ZA 3AUOA 1O6IA 5A6TC 2V3GA 3OYXA 1DJGA 2XG9A 5LHEA 4M6VA 3VDBA 4YN5A 3GU9A 1HF6A 1NH6A 1OY0A 3WQGA 2J7GA 3FA4A 3H4WA 4NYUA 1EJXC 4B4HA 1PZ2A 5F2IA 4AWTA 3CH9A 4M5PA 2VFIA 1UJPA 4BKNA 1HJUA 3CPUA 1N2VA 4DNHA 3WNOA 1FWAC 5BMXA 3DK8A 4AWUA 2FB2A 4LRSA 3VYLA 1C91A 4D6EA 1GORA 3UYCA 4C6NA 1GETA 4C7DA 2Y8UA 4IX0A 3IJ6A 1J4EA 3FX4A 1W5NA 1KA9F 4KCWA 4R53A 3VGHA 4GABA 4JYFA 1EFZA 4LGXA 5AC7A 1Q1RA 3EX4A 1GESA 1MW1A 3WLSA 4H41A 1JCXA 1VFOA 1H7RA 1PWMA 4UTKA 2X2YA 2NQ5A 3DFHA 2WPCA 3W24A 2B7QA 2HNEA 3KRZA 7ODCA 3T7VA 4KCUA 2DSWA 4JKMA 3NZPA 1LJYA 2F9RA 4CEXC 3FA5A 3IUDA 3QPYA 4AY8A 3QJAA 3SM0A 1WYIA 3ANYA 3W3OA 1UOZA 3OA5A 1MXSA 2VYOA 2CYGA 3BWWA 3NQFA 1JUBA 1QPQA 3MB9A 5FACA 2VC5A 3KX6A 7TAAA 1F3TA 1HKIA 1Q7MA 4G1NA 4XSLA 1M53A 1PIFA 4XD5A 4EMIA 1XR2A 3SDOA 3VU2A 1OJTA 1SZRA 1GEUA 1Z89A 2GZXA 2VUNA 4QDWA 3C8NA 2YYTA 5JBEA 4UR7A 5HDRA 4ZXLA 3TYDA 1KCKA 1UKQA 1MWOA 4J1OA 1SZFA 4ZQNA 3KEHA 1JD9A 1NOUA 2ZC8A 3AIWA 3NVZB 3QY8A 4ECLA 3IJIA 3LPFA 5J04A 3DIPA 1DOSA 4GX8A 3V1HA 1OWQA 4WKHA 4NZ1A 2PDPA 3VZYA 3KVMA 3OBEA 3DG7A 4JQ3A 2ZZCA 3M0IA 4IJBA 1E72M 3EWXA 1ECEA 2QCCA 2YVJA 1AOGA 3WQ8A 3W7QA 3B0UX 2OMAA 4J9JA 4OVXA 2WM1A 4KIEA 4ZXOA 4ADTA 1OQFA 4S3FA 3I3BA 3THAA 1OT1A 1JR1A 3W0KA 3A64A 3GDRA 4OU1A 3QV9A 5DFAA 3FVDA 1ZJIA 1NTHA 4JQ4A 4QITA 2J4GA 4B5NA 2QQ6A 3REQB 3M44A 2ZCGA 4DZHA 3EBVA 1SPQA 3FCPA 4F0RA 1UH3A 1QW9A 3QTGA 1SFTA 5GJPA 3WFAA 3A7UA 2HWGA 5GNYA 3BOFA 3P7YA 1GRGA 3N2XA 4H01A 4LEQA 4DIAA 1GUVA 1P5BA 3AC0A 4O0QA 2EGZA 4D1IA 4FO4A 3VD4A 3UF9A 1IT0A 1BD0A 4IJRA 1J0ZA 1OM0A 3AHVA 4Q8VA 1R8LA 1AD4A 1V0LA 3S1GA 3A21A 1ME8A 1R85A 1E43A 3B03A 3QH2A 3RGTA 2BDQA 2YVGA 2VO5A 3ZOAA 4O8AA 2Y0FA 2PC4A 3WBAA 2YL8A 1TTQA 3W27A 1FWTA 2VEGA 5EYWA 2R8WA 2WJFA 3CHVA 1KBIA 2XZ7A 3F2DA 1OIMA 4TMCA 1H1ZA 2D69A 5LSMA 4Q8TA 5RUBA 3VDHA 1E9YB 2G4FA 4EWJA 1OF8A 4A4AA 1FTXA 4RX0A 5HA7A 3W7IA 1XLIA 5HNNA 2YA0A 1W2PA 3ZZ1A 5M2FX 4US6A 4WVXA 1R86A 1JAKA 1SW7A 3NQVA 2PP1A 2ZZ1A 1Q6FA 4HD5A 4ZB5A 3V5CA 3L5OA 1JZ7A 2E5DA 5AFDA 4PUEA 1KWKA 4O53A 2YXOA 5M5DA 3XISA 8CGTA 1S2AA 3BAXA 4MYXA 3M43A 4CQDA 1S46A 1OFBA 1HP4A 1H49A 3ITXA 2V68A 1H3GA 4ZQPA 4XISA 3U3HA 1KM2A 3BO9A 1TTIA 2ZRWA 2BSLA 2ZRZA 3B9AA 3VE7A 4NF7A 1W1YA 1PV8A 3UXDA 3VCCA 3CLWA 3UU0A 1BKSA 2PDXA 3OYZA 4IHCA 5DCBA 2IQ0A 4ZFMA 4IXHA 1SMAA 3UY8A 3RF9A 1BGAA 5FKYA 3RITA 2A0NA 1YXCA 2WK2A 1WKEA 4KGJA 3PHAA 2WXDM 3SFKA 3AN1A 3CGEA 1BAGA 3FDGA 3DGZA 1LG1A 1AZ1A 3DC8A 4U4MA 4HMNA 3Q94A 1M04A 1B3VA 5LZLA 1V51A 3EB3A 1GRTA 4JN8A 3UW6A 1KW1A 2XN2A 1GG0A 3UWUA 2WVSA 2NLIA 3VNLA 2A7NA 2REQA 1OFPA 3SCNA 2ZZ0A 2IPWA 3O2LA 4H9YA 4HNNA 1BFNA 3MJYA 5BRQA 4K37A 1E6QM 5FJJA 2CESA 3PSWA 2VX4A 4YLWA 1LTDA 2I5IA 4N4PA 4R9OA 3ITCA 1XYLA 1RSCA 1I2OA 5AYYA 3L4ZA 4UWMA 5CKSA 4EXQA 1E56A 3T08A 1H5VA 2NQJA 4GI4A 2VL4A 3QV8A 3DH9A 1E1CA 1YX1A 4HNLA 1A5BA 1CGVA 3LD5A 4AAJA 1U5VA 5HXMA 3AOFA 4YWSA 1LORA 3NGJA 3NUKA 1ONEA 3BCDA 3GVWA 4ZQRA 2ZX8A 3N2OA 2BOFX 3LBOA 2CHRA 1GVOA 1SQ7A 1UWRA 1O5RA 1MSSA 4TUFA 2FZ9A 1J0YA 5A2AA 4KGLA 5GRTA 3WF3A 1IEXA 1TV3A 3OIXA 4GG9A 2G3IA 3DYOA 2DW7A 3AM9A 4H6QA 3E6EA 3QY6A 9RUBA 4FAMA 3W1RA 3S4TA 2C3DA 3QKEA 4Q8PA 3W73A 3L0KA 2X41A 2WYSA 4JR5A 1GOOA 4B5WA 3B9JB 2Z2BA 2GR1A 1HXJA 5I2UA 2BGSA 2VMFA 4A8NA 3U6WA 1N55A 2INEA 3SCUA 4GBUA 4WEVX 3UZ5A 2FDSA 2I9UA 2WPFA 2WSRA 3W7KA 4O50A 3EB4A 5E0FA 4AHOA 1A49A 2XFRA 3E96A 2UY2A 4JKLA 2W55A 1TWWA 4K36A 1K7EA 1B0IA 4XZMX 1O66A 5AC4A 5KTLA 2C13A 3S1VA 2PUZA 2ZDRA 1H7NA 3AIVA 4JTFA 1F8IA 4NIRA 5BXSA 2Y7EA 4NILA 4NRRA 5F7UA 5A6SA 1DIOA 4O1FA 3IGXA 4W85A 2EG6A 3S8HA 4IMDA 3SGUA 5CPLA 4FNRA 3VIMA 4I5XA 1W9DM 4ERAA 1XW8A 4EPEC 2P3EA 2GYIA 4D8LA 2QCMA 4LVFA 4RDWA 3MI6A 1MRQA 2W63A 2X1TA 3L4XA 1W3LA 1ZAJA 1XXXA 4L1WA 3MCMA 2WHLA 4H8HA 1TX2A 1UD2A 1JRBA 2I17A 2VVNA 4EK7A 1E1CB 4WXYA 2PD5A 1CNVA 1ZHAA 3E5BA 3H22A 1TIMA 1HJWA 2G50A 5EBKA 3PPCA 2EKCA 2J79A 2NZLA 3NS1B 1OZMA 4JIQA 4PYSA 2QAFA 4YU1A 4RXGA 1DXIA 2PGRA 5I03A 1OD8A 4P2VA 2H3DA 4FMVA 3RM4A 4IG2B 2G3FA 3U57A 4QM1A 2JKAA 1IE7C 1R3RA 2XH0A 1YTEA 1GOWA 5G4WA 1HG3A 2WZMA 3NXLA 1GKQA 2PMQA 1YIXA 4NI3A 3J7HA 1AK5A 5T9CE 1PAMA 3CL7A 1U22A 3AYRA 5EFDA 3W6MA 2V67A 3SRKA 3R1ZA 1WP6A 1QNOA 1TVPA 3BLEA 4ZO8A 3LCIA 2ZA2A 1BEUA 1TMLA 4H4YA 3TCEA 2CLFA 1TELA 4RE4A 2IQDA 4JTIA 2A3EA 1IR2A 2XSAA 3TWBA 7ENLA 2EPMX 3OC4A 2GH5A 2DZWA 2OLHA 3VGBA 1JZ4A 2QPSA 1H1NA 4CD6A 3W7EA 1JQVA 3F4VA 2VRKA 4LW7A 4FP1A 1QXLA 1AL8A 1WOAA 3BW3A 1FFUC 4FX9A 2NSOA 2ZC1A 2YB4A 3TDFA 1OYCA 1W9XA 1HUVA 2X2GA 1E15A 1YE4A 4CKQA 2PF8A 3I4KA 1PCKA 3LCFA 1TA3B 5JU6A 1CGYA 4AXKA 5I02A 1K7FA 4LVBA 3GD6A 4XZBA 1MXDA 4PTVA 3LLXA 4NZJA 4XZLX 1FFRA 4AYGA 2Z26A 1V97A 3T0CA 2VGIA 3W85A 4YVPA 2W3ZA 4K38A 3CZJA 1K8CA 2QUTA 3RRAA 3BMXA 5HQEA 3HPXA 2QDGA 3WJSA 4F0KA 4FR1A 3UCQA 4GYJA 3WBYA 3M6DA 3MV11 3KRUA 5C5YA 1P6CA 1XCWA 2BNJA 4H9UA 1MQQA 3FN9A 4HHLA 5D38A 2DP3A 5ABHA 1XSKA 2V3BA 4LAUA 3SRDA 1FWDC 1TWSA 1FO4A 1XANA 3WQPA 1UWUA 4LF2A 3H55A 3PBUA 6REQB 4W87A 3B8UA 3IVSA 1VZWA 2QJNA 4B90A 1TTJA 3UERA 5HPOA 1XX1A 4FEZA 3OPSA 1E0WA 1ALDA 5TNVA 2NQLA 3MP3A 4JIHA 4ADWA 3ORWA 4Y9OA 5I23A 1EJRC 1EBDA 5AHIA 1X7IA 5BCAA 2X8CA 2YL9A 3U2EA 1E51A 3L5AA 4DWSA 3W7OA 1ZKQA 1EYWA 4UFLA 4PRRA 3EDJA 5A8NA 4XTDA 2WLYA 3OLEA 3WF1A 4QDMA 1I6NA 3RM9A 3SY8A 3M47A 4DF1A 2ATMA 1XIGA 2WZTA 3HIJA 2VKZG 3OHMB 2PDJA 4MUZA 5FEWA 4S2BA 3V5FA 2JGYA 2QCHA 4WX2A 3FAWA 2WWDA 3I7SA 2C1GA 4GACA 3W6LA 4TVWA 3V7PA 2W9MA 3EPOA 3EWUA 1GOMA 1HFBA 3DU0A 3TYBA 3MO7A 2NVKX 3EWYA 1HGYA 4EM3A 2E0PA 3W7HA 1WA3A 4F3HA 4H1ZA 2QIWA 4P7LA 4LCSA 3OB8A 4LBRA 4CNNA 5HUOA 1KM4A 4B5VA 2OO0A 1UD4A 3GBEA 3IGSA 5J5RA 1TZ9A 2DV0A 4HQVA 3ZSTA 5A6AA 4MF4A 4H9XA 2FVLA 2XIJA 3NQDA 3ZLFA 3H12A 3T2OA 2KZHA 3GR7A 5C6MA 1KV8A 1TQJA 5KETA 4K3ZA 5HPCA 4JQ2A 1XLCA 2R82A 2QW5A 4E8GA 2HJPA 3LN3A 1OB0A 3E38A 5HR7A 4Q8UA 4BCEA 4ZO6A 4NJJA 1NJJA 4NHVA 4KEZA 4RZ4A 1KFEA 3I7QA 4FNTA 3OGRA 1E4MM 1V3KA 3ZT6A 1DWHM 1GNXA 3UETA 3FEMA 2WANA 3LMZA 4X0NA 3GHSA 2RJHA 3B05A 1JFHA 2YFNA 3PPFA 4LIIA 2DZAA 5DEZA 2WHMA 3QPZA 5JH1A 3IRDA 2Q01A 2H9AB 4AIBA 2GDUA 4LA1A 5CJMA 3VKDA 1EP3A 3WQDA 3P6LA 4M19A 2XSBA 3C0QA 1EJ7L 3FLUA 4GNJA 4GYPC 4KMQA 2ZUTA 1AVAA 1W32A 4PRTA 1J9YA 2XVGA 2HS8A 4UTMA 2JK2A 2FMOA 3UXLA 7PTDA 3OODA 4RXFA 4B5XA 1EJSC 2YDAA 4IQEA 4IIBA 3TW7A 4A05A 2P10A 3A3WA 5CPTA 1BVWA 5EMJA 3LV5A 1RCQA 1M3UA 3EOSA 4I9TA 5M17A 3MWCA 2JF7A 1RALA 1ZBWA 3NVVB 4Z1CA 3QR0A 2G3JA 2ZUWA 3IEBA 3QPEA 1K8YA 3VNZA 1H51A 1UB3A 3QXBA 2ZX5A 3O07A 1Q2RA 2JF6A 3MU7A 4IP5A 4YL2A 3ECQA 3A6OA 1KFWA 1DWJM 4PULA 5ECUA 3W1PA 1P0BA 1D3CA 4GMEA 4LNYA 3MI2A 2XJ7A 3L2LA 2NXIA 3SY1A 4ZQMA 2OZTA 4MNMA 4D6GA 1ODZA 1WYGA 3CGBA 4WR3A 2WOWA 1WCGA 1XRTA 5DLCA 5ENLA 1NOWA 2F61A 3N4EA 1TQXA 1GW9A 1MDLA 3L4VA 4UQ9A 3FJLA 4JICA 3QHMA 5BRBA 1UKSA 2HPIA 4GISA 4FIQA 4Q3MA 3G1HA 1VIZA 4K1GA 5FEXA 1XHGA 3CHDA 4LYRA 2JKEA 2RGMA 3LHYA 2CZEA 1YDOA 3FEQA 2PF0A 4LAMA 3CYJA 1PBGA 4JBRA 3KWSA 4XX6A 2FTWA 4K7ZA 2E67A 4OZOA 1W8SA 2D73A 2YFOA 3DN5A 3HGRA 3R12A 1R9YA 3W74A 3OLDA 4O13A 1UUMA 1CLVA 1ICQA 2VFFA 3WBXA 1L0PA 4YTQA 1W1TA 3WY1A 4CUCA 4KFNA 1QJWA 5DBUA 2Z1BA 1FA2A 1QI5A 3ZO9A 2CERA 3W83A 5H8UA 1S5VA 2IW0A 3RPMA 5E09A 4J28A 3PTDA 5I06A 4BR1A 4JTDA 1H11A 4UQAA 2A85A 2UWFA 4K68A 2I14A 1KTNA 4MB1A 1XHCA 2XHYA 2ZUSA 1GTHA 1AA1B 4MM1A 3SFWA 2Z4GA 2NV2A 3UVAA 3BVJA 3NVYB 1THFD 3KLJA 1XM3A 3KCOA 1NDZA 4DBUA 2OQYA 2PLMA 3PG8A 2R9RA 4P8XA 3WLIA 3KOWA 1ZP4A 3TN6A 3P8JA 3LU2A 3BURA 1QPRA 3WD0A 4NU7A 1H09A 3ITGA 2PU0A 3R43A 3T9PA 4KIRA 3GB6A 1IF2A 2AGKA 4KEVA 3TYAA 2WB5A 3TTQA 1W1ZA 3IJ8A 3K4DA 4E8DA 3LMYA 5JQ9A 3GVGA 4PB3A 4AWSA 4ES4A 1Q13A 2VTFA 5REQB 2A3HA 1XPYA 4I7UA 1POJA 5HULA 3S2NA 5JCIA 3H21A 3VZZA 4NKCA 3BMVA 1W6TA 3UZWA 1K4QA 1BYCA 5G1MA 1FECA 3M0XA 3QYSA 2GQ8A 2Z7GA 4Y8EA 1R5YA 3PUGA 4K8HA 4OOZA 3CH0A 2XYLA 1P0KA 5EKYA 1SW3A 5KZMA 3MUAA 4YJ5A 5HNUA 4GI9A 1FEAA 3YPIA 1JCYA 1KFCA 1V6WA 1JDEA 2PTYA 1QVBA 4FALA 3II4A 3GW3A 3EGJA 2PE4A 1OG6A 5BU9A 3K30A 3KVLA 4ZQCA 4HCDA 3RMEA 1SFSA 2FJUB 8A3HA 4M56A 5CCZA 1TB3A 2FKPA 1XQKA 3DGRA 1HP5A 2BVWA 2NSXA 3T4WA 4U31A 2UY5A 1CCWB 4EP8C 1V59A 1LF1A 2I5GA 3UG5A 1JIBA 4GPNA 4LQ1A 4FB7A 2R24A 1F5ZA 4P7QA 1OK4A 4DBSA 3ARUA 3PANA 3WF4A 1L2UA 4UOJA 3PBYA 4UBPC 3N11A 3SBFA 2NT0A 1EP1A 4YVXA 5FAGA 3LNPA 2QJMA 3BSMA 3S1UA 3SJNA 2ZUNA 1LL6A 5DMYA 3OP2A 3ES7A 5XIMA 3L12A 1JDAA 4UNKA 1RY8A 4EMJA 1GT8A 1TJRA 3IJDA 5JIPA 3HB9A 4UTTC 2VR5A 3CUZA 4FXJA 2Z0IA 3KLLA 5ABTA 1MZHA 2D23A 4CN1A 5I3KA 3G1SA 1B90A 3GG1A 1X38A 2AKMA 3SUUA 3TV8A 4UMCA 3W7PA 2FZDA 2ZDSA 2DUAA 3GW0A 4MB5A 2J78A 3TVAA 5G4HC 3PUDA 5FS7A 4HZ6A 2YVFA 1WQ5A 4NJKA 1M01A 3CIVA 4RL3A 5L9FA 3WBWA 2FB3A 1XRVA 2X7VA 4HU0A 3NQMA 4AD0A 2UV8G 1WE5A 4UCFA 5HANA 1T7LA 4KPRA 3N1AA 3G1AA 5BOFA 4ADSA 1SO3A 4M6QA 1KFKA 4FLSA 4OIFA 3GUWA 3NYDA 4YVVA 3N19B 4BEUA 3TSDA 1OT2A 4D1JA 1N63C 1T0OA 2OU4A 5C2CA 3GY1A 1JQXA 5A1AA 1L9WA 3C2EA 2NXGA 5B7YA 2WOIA 3WK3A 1X1OA 2Y8KA 1CTNA 2W92A 3B8SA 3AMLA 4FR6A 4QS5A 2XFWA 1F73A 2BS9A 3ITLA 4LT9A 3I68A 3HW2A 1TZ7A 1N8IA 3EA2A 4APNA 4O16A 1IIHA 3Q2DA 1PCWA 1IWBA 3PTMA 4PH6A 4LB4A 1XBVA 4AX6A 1Q85A 1JFXA 3K2GA 3NPWA 1O12A 2ZUUA 2CC0A 4PL2A 3XIMA 3QGVA 2ZZ4A 4H2CA 2P5NA 1Q5MA 2CWXA 2E8ZA 5I3HA 1TPH1 2AL2B 4OGZA 3BDKA 3KTSA 1A5SA 3H2NA 5L6UA 4YIWA 4A3QA 3IJQA 3T09A 3LZ5A 1U1UA 2X1IA 5K2ZA 2RDXA 4GD0A 2ZZ3A 4PRWA 2DEPA 4L64A 2E09A 1PEZA 2OT0A 3MA8A 3ALGA 4M3PA 1NFPA 1WDSA 2JEPA 4GUJA 3EF6A 1SFLA 4F9JA 2DIEA 3WLKX 3VI2A 1BYAA 5I00A 3NEVA 5KSWA 5CC3A 1XYFA 5BROA 4DF2A 4J3UA 4P7RA 1RJRA 4LVAA 5FJRA 1VYRA 1O5XA 1MDRA 2DVXA 1HTIA 2HE8A 3G3MA 3GXTA 4IPNB 1TIWA 4H8VA 7XIMA 2GK1B 3LM3A 4HA4A 4UTUA 1A5MC 3QFAA 3MT1A 4AFYA 1T96A 1P48A 1KM0A 4CU8A 4GQQA 3CT2A 4FOKA 2ZXBA 2G4JA 5TBOA 3W1TA 5KINA 1VCFA 1LG2A 3R10A 4PUKA 3DFNA 2YZ5A 4JTKA 1W9VA 4RZBA 1UBSA 1FH7A 1EZWA 1L6GA 5T8GA 3GIPA 1H4PA 3GG7A 5A6MA 5I5RA 3HPAA 3NQ6A 1TO3A 3QFEA 9XIMA 1UR9A 2W0HA 3CUHA 1D9EA 1IWPA 4WUIA 1G5AA 4XK2A 3BXWA 1I2PA 1LQAA 1CX9A 3E2QA 3KBMA 5A6BA 2ZX9A 5D02A 3CL8A 2VDGA 3ABZA 2E5BA 3RDKA 3WSUA 2IKHA 1FQ0A 2YKKA 1OC5A 2E8YA 2BGQA 5F1UA 1PKLA 1SR9A 2GVLA 4RNJA 2OSXA 4RE0A 1ZMDA 1A0DA 3O6CA 3LOTA 3W7DA 1FCBA 1OJXA 1E6PA 3URHA 4GFIA 4Y9AA 1I60A 2P0IA 1O1HA 1E6NA 3IIZA 1KXTA 1E6SM 2JK6A 4IMGA 3B8TA 3WJYA 3P67A 1B4KA 3OTRA 1WZKA 3A4XA 4MTVA 2CW6A 1P1MA 5CXPA 3W84A 3VE9A 1EPVA 2PWGA 4Z0JA 1KKOA 2J9ZA 2HQAA 4J3SA 2HBXA 3MANA 2CPUA 1QUMA 5U1OA 2YA2A 3CGTA 4FLQA 2BOEX 5JBDA 2QV4A 4IF2A 1VBJA 5FAJA 3SCOA 2CZDA 3ONBA 4XAPA 1MEHA 1EJTC 2GUYA 5IFTA 2FGBA 4H3DA 1GVFA 3TKFA 1KGWA 3N9KA 4UZSA 1E1FA 3CASA 1FHVA 4W4QA 4G9PA 1I0DA 3BCJA 5CZTA 5ABEA 1OCJA 1S5WA 3H8AA 5AHLA 3F7JA 2HCVA 4BHYA 2QUUA 3HMCA 2VFEA 2NLYA 2NUYA 3M9YA 4P7OA 4LAZA 4O28A 4ICMA 4MDOA 5REQA 3TJLA 2FMNA 4C6OA 1XBYA 4JEJA 2PDLA 3MDUA 1MW0A 3DYMA 1ZALA 3N29A 4IUGA 4B4FA 1KD0A 1A5AA 1AG1O 1QAPA 3KRSA 4DX3A 2BWGA 1L6YA 3BV4A 2CDUA 4Z1AA 3AXHA 4L6DA 4N7QA 3R8HA 1WBJA 1CXEA 2PFHA 2YXGA 4FIRA 2QAPA 4M7SA 4C60A 4DM2A 3EOEA 2JE8A 1NSJA 1OCBA 2DSUA 1XCFA 3TA9A 3SCWA 2ON3A 3EXTA 1W56A 2DSVA 1IHIA 4L5ZA 4R5EA 1I2RA 4KH2A 5CPSA 1C9WA 3C2RA 1D2KA 3H53A 3ELFA 2ACRA 4GR1A 2GVYA 1EX5A 3TTSA 5CG0A 1YDYA 5D37A 2CLLA 4DB7A 3QZ6A 4E2OA 2XSXA 1KBJA 2OX4A 4ZCWA 2E6FA 3LERA 3A4WA 3F4WA 2Z1SA 4UR9A 2BVTA 1F05A 4JTQA 4IQLA 3DBPA 2WMIB 4JYEA 3TK7A 3LB8A 1QOPA 1UP2A 3DDMA 3OZMA 3CB8A 1CXKA 3THUA 3MUZ1 4N0RA 4OBTA 3U2OA 3ZS4A 2PTXA 3S1WA 5D2WA 1TX0A 4XD3A 1YXYA 2QXWA 1EDQA 4Q7IA 3O6DA 5BMWA 3A5VA 4EWND 4ASTA 5I3GA 1JZ3A 2DVTA 4EACA 5LGZA 4LUSA 1A5CA 3CBWA 3EMZA 1SSDA 1NQ6A 3BANA 1ESWA 1FWSA 4GVGA 4MLJA 2FPYA 3SN1A 2IKGA 1DWGM 1XSIA 3LRKA 2OFJA 4C1KA 1NP2A 5A94A 3DESA 3DG3A 3HA1A 4IL2A 1PZ1A 2PDNA 4LF1A 4WXZA 5E93A 4JIIX 2ZVIA 2XVKA 3H7RA 1OABA 4JL1A 3AJXA 1FEBA 1GONA 4AY7A 3TIMA 4ERGA 3OOQA 2I16A 2OOFA 1ME9A 4ML9A 3I6RA 1EXPA 4QLJA 2F2KA 3C56A 3Q67A 3NQCA 2X0HA 4J7RA 3G5EA 1BXNA 4LUJA 4REQA 2EQ7A 3T1GA 1OF6A 4JGDA 2AOSA 4ZE4A 4ROPA 2CBUA 4JX6A 1PS9A 2BY1A 3OVGA 4ADUA 1EGVA 2BMBA 5C70A 1DKWA 1XF0A 4HNCA 5G1YA 5AYIA 3IANA 1UR3M 1Y0EA 5CZJA 4PA8A 1HL9A 4LY8A 2EQ8A 2IXVA 2A3LA 5G5IA 1H50A 1MUCA 4Z2IA 1Q6DA 1RQHA 2AL2A 4RDVA 3QKZA 3QOMA 4B3KA 5D30A 3DERA 2WOQA 3KUMA 4GKLA 1W5PA 3G77A 4TOQA 4FXSA 1A3WA 3PZOA 3C4UA 3U4FA 3TA6A 1AJZA 2Y7FA 1MRAA 2GL5A 3VD5A 3BCFA 2R6OA 2BTMA 4MPQA 1S7MA 1FWCC 2ZZBA 5H8PA 3L68A 1EYEA 3RIKA 1R2RA 4DHGA 3EKZA 3WX7A 4AUBA 5BXTA 2NQZA 5DQPA 3Q4DA 2C0AA 4H4QA 1TPC1 3H7VA 4QRNA 2RDTA 2EEXA 3H2CA 3DFPA 1YTDA 3KBJA 4H7VA 2E9MA 2OYLA 3MY9A 4L9YA 4M82A 2VDIA 3QV6A 4V1XA 4AISA 4KRTA 3UY7A 4J2MA 3BQ5A 4FA3A 1YLVA 4PZVA 1E55A 3BAJA 4XAFA 4J4KA 3GNPA 2Z24A 4HA0A 3WEOA 5KITA 2D3NA 1R87A 4GI8A 1UR2A 1QATA 2YBTA 1X2HA 3LHUA 4KERA 1GW1A 2ZADA 2BVDA 3RU6A 3B0VC 4WCJA 4BI6A 5H91A 3AMDA 3ES8A 4ZEPA 4V28A 1X6UA 1FBAA 2VOMA 4LS0A 5DRIA 2WPGA 3S2LA 3TR2A 1KM3A 3W76A 1AW5A 2Z2AA 2IPJA 1C92A 2GDQA 2Y62A 1XIBA 4WF7A 3T4CA 1VP5A 2FGLA 3TROA 2YDQA 3O05A 1GVRA 2C18A 1STZA 5DT5A 2FFCA 1JI2A 1L2QA 1FWRA 2ABBA 1JRPA 3RLGA 2PLKA 1B57A 3L2IA 1TPWA 3HFYA 1HJQA 1VJZA 1N62C 1RP8A 4QSHA 1B3YA 3S5ZA 2BHUA 2WMJA 4XV0A 1P6WA 3FVMA 3QY7A 3PR2A 1TV7A 3KBVA 4H2HA 3IIXA 3DYPA 1M41A 3A4AA 3II1A 4XKMA 4M0XA 4PN2A 4HZMA 5BZAA 2DH3A 4UOZA 3WDIA 2CLKA 2Y85A 2ISVA 3GK0A 3WEZA 5FJPA 1FH9A 2OLSA 4O15A 4DWSB 1C8XA 2G5WA 1PE1A 2FZNA 2ISWA 1KXVA 3UA3A 3D3FA 3FOKA 4HJWA 1LLZA 4INFA 2E25A 2WW5A 4W5ZA 3T8LA 1OADA 1Y65A 4BF9A 4V2XA 4W89A 5A8QA 4I90A 4D6IA 3MUCA 4C1LA 3VKAA 2J7CA 3T8QA 3B9EA 3JR2A 4QR6A 1OK6A 2EO7A 1WDWA 2QEZA 1VBUA 1W1A1 1RPXA 1RLCL 4I5RA 4DBWA 2NX9A 4PMNA 3EANA 3VCRA 1EGMA 1WO2A 4RNFA 4IPLA 1KR1A 2J66A 3NL6A 4ATLA 3AI0A 3PUOA 1XIDA 2I57A 4CN6A 1VHNA 2VFGA 3OG2A 4MY9A 1XICA 2YBVA 3E0LA 3BLDA 1BGGA 1CYGA 1BHGA 4KETA 1M6IA 1CI1A 1J6PA 2NW0A 4H9VA 2F38A 1F9CA 1US0A 4XBSA 3LPGA 1TR9A 4PBFA 3U5YA 2Y88A 4LAKA 4ZGYA 3L67A 4GH3A 3XINA 4IOTA 3SUTA 4JIRA 3LLDA 3R58A 4AEFA 4HPHA 1KTBA 4ILSA 4Z2KA 2WSQA 4YXGA 1SZNA 3TC6A 3PG9A 3QLDA 2A1YA 4S2CA 3KHJA 5FJUA 1J2WA 4Q7NA 4AHQA 3UWYA 1ZGDA 4YPJA 1SW0A 3KAOA 1KFJA 2F7FA 4O54A 1H0GA 3GTNA 4AMAA 1DQUA 5HJYA 5D8WA 1VCGA 4XD4A 1T8XA 3M5VA 4UQEA 1X96A 2XN1A 2OLAA 4JY9A 4BI7A 3S2CA 2A7RA 3T0TA 2Z25A 1F3EA 4I8DA 9XIAA 4O57A 2YW3A 1TYGA 2IS7A 1PO9A 1VIWA 3UYIA 5E70A 1W31A 3AHZA 2EAWA 2PA6A 1B3XA 4FDCB 3TSMA 3PNUA 3CXOA 3O9NA 1LP6A 1RJPA 1GOQA 5JMUA 2TAAA 4LCRA 4S3EA 4NAEB 3G22A 1IYXA 4HSHA 4GI6A 1N7KA 1EQPA 2X8HA 4J57A 3GFZA 4LC8A 4N2YA 3TAOA 2RFGA 4W5UA 4Z08A 3SADA 1J6OA 2QHAA 5D33A 1F8MA 5J5DA 3WMSA 4DAFA 1QCWA 3NDYA 1D8CA 3FYOA 1SR0A 2WVVB 5GNXA 3W1LA 2OEMA 5IDZA 2YCEA 5F1VA 2V5KA 1IEIA 4YNGA 2P8BA 3GNDA 4Y9MA 5DN1A 2H6RA 3HG3A 1XLBA 5HUPA 2XH4A 5TQLA 1NQKA 1Q4WA 1RUSA 1A53A 1E9IA 3PG6A 4LUIA 2HZGA 2ZFAA 1VKFA 3C2VA 4DO7A 3LSCA 1S5MA 3VFLA 4HPGA 6TAAA 4WKAA 3FFSA 4L7ZA 3WBEA 1OX4A 3CUJA 1UR8A 3VOGA 4H4XA 3S42A 4GY1A 1E5NA 3REQA 3CAVA 1XC6A 1KNWA 1OD0A 3P93A 2PTZA 4FHAA 4O18A 2VM8A 4GIAA 1YYAA 3JU2A 4GIEA 3N9SA 4AW7A 1ZJAA 4ZB0A 2ABAA 1XFCA 3WNNA 1GQNA 3ITVA 3GDKA 2IKJA 4CD4A 1CECA 2WMHA 4DJEA 3SR6B 1YBQA 4XZNX 1KBLA 3W29A 1I45A 1JPKA 1E40A 1UYQA 2VEFA 4BURA 1D7KA 1DE5A 4K6AA 2B7PA 3SCPA 3M46A 1GVQA 4RK8A 2D2HA 1PYFA 3EKGA 4MWAC 4PR4A 1VFUA 4W84A 1X8FA 1O5KA 4Y2WA 1LYXA 3I3EA 3DGBA 3TSBA 3TONA 3QF0A 3KTXA 1VFHA 4WRHA 4D6DA 3CV2A 1XI3A 3GTXA 3R0DA 3UNTA 4C1NA 2YDSA 4MNJA 3U0HA 4CNOA 2XH2A 1IGSA 4LSBA 1XP3A 1W9BM 3A7AA 3EXRA 3AYSA 3C52A 1VPQA 1GWJA 4J3WA 4JTEA 2GGIA 3MP5A 3TC3A 3ABQA 1FWEC 3G1RA 3SUWA 5BWAA 1WXZA 3EXSA 1G69A 4K7YA 4OQVA 4GJJA 3GZAA 3TE9A 3P82A 4QXIA 5CQ1A 1ZJHA 2OB3A 4PCPA 4NY2A 3AS2A 1T99A 1EWEA 3B40A 2FZMA 3LXCA 1EA9C 3CMFA 2GVEA 4L61A 4XD6A 3DHFA 1DL3A 1CEOA 2E68A 4LBUA 1BF2A 4DZIA 4FNPA 3R0KA 3AHXA 3V16A 3UJRA 2YYUA 1U1JA 1IT7A 1JDCA 2O9PA 5AVNA 4C7FA 2YCLA 4GGBA 1DE6A 4IGMA 4ZENA 5KVHA 4GRTA 1ONWA 2VX6A 4P8WA 1YNYA 2LLEA 3WLHA 1VFSA 2RUSA 4QFUA 4KFPA 2OYKA 2PDBA 3UZJA 2VVSA 5AC5A 3SR7A 4H4SA 3VIKA 4ACZB 4JIEA 2XGZA 1XRSA 1G94A 3POHA 4YHGA 1R9ZA 4J3XA 3SZ8A 3BK0A 3V75A 1FCVA 3GNNA 4IGNA 1B4EA 3DI0A 3BICA 3PJUA 4PSPA 1IZJA 3UWEA 2G3MA 2X1UA 4Y9PA 4JTGA 3W87A 1RY0A 1ZJBA 3NPXA 4D6FA 4YTTA 4FK9A 3WQOA 2ODOA 3TN4A 3OBKA 5A6BD 2E6AA 6PTDA 3GAYA 3QFBA 3TYZA 3S5SA 1S3TC 1WZMA 3T40A 3FSTA 4WSKA 1OYAA 4H04A 1H62A 4HU4A 1ADOA 3STEA 3W01A 5GNZA 1KB3A 3W82A 2Q6ZA 1QO5A 2H90A 4L4LA 3H6OA 1RP9A 4LEFA 4NJGA 1XBXA 2CNCA 3AS1A 1MW3A 4EX4A 2VHLA 1XLMA 1XLFA 2B7NA 4G7FA 2CLPA 3DOPA 4A3HA 1ZBCA 3ABOA 4EKJA 1S1PA 1VQZA 4PUMA 1ONFA 3KP1A 4PMQA 2OYMA 1BRLA 3ICJA 1KRAC 5C7VA 4C65A 2PGEA 3TH6A 1BQGA 2HRWA 1XH1A 2GSEA 3SUVA 2B0MA 3ARXA 1C29A 1D7FA 2X30A 4HCHA 1W3HA 1WZLA 2IQTA 4HA3A 1GSNA 2NV1A 2Z1XA 3Q6JA 3ITTA 3WH6A 1IEVA 1DV7A 4X2PA 3S6DA 2CKRA 2E7FA 3VNDA 1WPCA 2J8FA 3HZ3A 1EIBA 3GR4A 3N6JA 2BC1A 3MBFA 3ARZA 2FHFA 3BJTA 4JHMA 1W54A 4KEUA 3AS0A 3CEPA 4UC5A 3LQGA 2ZRVA 2GVGA 4IH3A 4Y96A 3TCSA 4PMVA 3TW9A 4MFDA 1TA3A 2EG7A 3C6CA 1DJXA 1DTNA 3RRXA 1UKOA 4HP5A 1A4MA 4EQWA 1HKMA 3BAYA 2WZHA 3CT7A 3C0JA 3M16A 4IMAA 4DWDA 1JZ5A 1VFMA 3A22A 2E77A 2EPOA 3VGEA 3CU2A 3NFUA 1XGEA 4ATDA 2BC0A 5KZDA 3L23A 2I1OA 4I5UA 1CDGA 4Z2JA 4GZIA 3S47A 2P76A 3ZR6A 2G37A 2TPRA 5IM51 3GNXA 1ISXA 3KDNA 1IEQA 3L4TA 1KV5A 1HIZA 1UH4A 3GD3A 2OCZA 2Q3OA 5K4XA 4MSSA 1PSCA 1F6KA 1IV8A 2YQUA 4JTAA 2HVNA 3MV01 3TMQA 5LIKX 2VWTA 1XISA 1AQMA 2FTYA 2NVAA 3P5YA 1W3KA 5T9BG 5LIYX 4HJFA 2CEQA 4IG2A 3HFTA 4CQBA 1AQFA 3UZYA 4D71A 3AYVA 2YPIA 2HTMA 3VD7A 4B5UA 3EAUA 5AHEA 4HYWA 2J24A 3W1QA 1LLOA 4Q4PA 3TWAA 3JZEA 1H5YA 4RR4A 2XIQA 1S5TA 3V18A 2W91A 2NWSA 2BY2A 3ZVHB 3LUTA 4ATWA 3FYYA 4WHBA 4PMXA 1CGUA 2QCDB 5H1WA 3LEPA 5I3FA 5AB3A 3WDHA 5JCNA 3VM5A 3D5HA 2YR1A 4GO8A 3U48A 1UR0A 2Y5EA 1VYPX 2WVUA 3LCLA 3NZGA 1GOXA 3EWZA 5DMNA 5CZ0A 3BLLA 4KS0A 2BCPA 1F76A 1SB3B 4XZHA 5AYBA 5A2BA 3NG3A 1ZBKA 1RVKA 3CQIA 4UFKA 5EB8A 4DYKA 3VA8A 3NRZB 4H4TA 1LOQA 1P0DA 1XDIA 3B97A 1ZS2A 5HWNA 2INFA 4Z2LA 5DMLA 5HMDA 1FXQA 1EC7A 4ZO9A 1UROA 3CMGA 3LADA 5CZKA 3HGSA 1BG4A 4EQXA 2FVMA 2DGAA 4AZGA 1BWLA 1EF3A 4QE1A 4F2UA 3PY2A 1OCNA 1QNQA 1XG3A 5CSUA 3QLLA 4S1FA 1NIUA 3N6HA 4I9AA 3JRKA 3VNJA 1VS1A 4ZE5A 3W2UA 4HIBA 3W71A 5C55A 8XIAA 1B30A 1BLIA 5FOOA 4DZ5A 4QLKA 4MIMA 2J6VA 1SM9A 2V3FA 2WC3A 2JIEA 3RXZA 3VIOA 4O17A 2VEKA 6XIMA 1E0XA 4POCA 4DN1A 1K3UA 3LI1A 1VDVA 3BLPX 2ACUA 3S9ZA 4H6KA 3ZJ8A 5CJNA 3WLMA 3AHTA 4M80A 2XIBA 1GREA 1ICSA 4DJFD 1EDGA 3R0UA 4B3ZA 4JD4A 1REQA 3WK1A 4ALDA 2WPBA 5B7ZA 4J5NA 3MW7A 3C61A 3P62A 3WDPP 3VDGA 3PZQA 2CXGA 1UA3A 3M0MA 1FWJC 4Q6XA 4K39A 3EA1A 3CV1A 3SSJA 1DJNA 2NX3A 1YW1A 5A8PA 2PLCA 3DI1A 1QNPA 3G24A 1GJPA 1UKTA 4ROQA 4WJEA 1DIKA 1AH3A 3GTIA 4HT3A 1O95A 1DPMA 5C9RA 4UR8A 4MPKA 3AXXA 4IL0A 1BWVA 2POTA 4TMBA 3RYSA 1P4CA 1IXOA 1X6NA 2VR2A 1V4YA 4FXRA 2QUVA 4B92A 2PDWA 4N02A 5CC6A 2UY3A 4O8RA 3QC0A 3WCZA 3UGVA 5IHRA 2HK1A 2PRMA 3OQ8A 4QE5A 1W1B1 3ARSA 1NWTA 4Y7EA 3T42A 2C3CA 3ABXA 3WLJA 1IZCA 4CCDA 3IRSA 1QK2A 2V5JA 1W5MA 4DLMA 2ZA3A 3W7GA 5EY5A 1W3NA 1FP8A 1Y8BA 2EJ1A 4IT1A 1JGMA 3BJFA 3N13A 4X0VA 3BAWA 3CLMA 3PZIA 2EPHA 2J7BA 3C8FA 3DC0A 2R1MA 2J13A 3UR2A 1OBAA 1FKXA 4ZOEA 4JNMA 1FRBA 3O06A 1JZ8A 1IT8A 1OINA 3AFBA 3GM8A 1DHKA 4UMBA 2QNEA 4C6EA 3UR5A 1BTCA 2OX1A 1F74A 2E3ZA 1UWTA 3VC6A 4C6QA 3DKLA 4DPQA 1RBLA 2YCIX 2BZNA 5G2WA 1CB7B 2DZTA 2WO5A 3UP8A 5A5WA 2AMXA 1OHLA 1K4GA 1G0CA 1AW2A 1SMDA 5E5CA 1CB2A 2OOGA 4LUYA 3EOOA 4LS1A 2VI0A 4OV4A 2IPGA 1DBTA 1YDVA 4AZ5A 4FXFA 1EUNA 5TR3A 3N34A 1ZX9A 1LBLA 4NX5A 4QLLA 2OKTA 4JFSA 4Q32A 3KZPA 1UWIA 1MNSA 4L1XA 2XWDA 4MNKA 4IMFA 5C2GA 3MKVA 2WQDA 1GHRA 3C0LA 4GUHA 2O9RA 1R3YA 3PB2A 2VZSA 5A69A 2F8QA 3WMBA 4QAWA 3ONCA 5LHFA 2G3NA 1GKPA 1XH2A 4TVCA 3NEHA 2V3AA 2E9LA 4E38A 5IHSA 1WDPA 5LNRA 3N4AA 3LX9A 1MOKA 3U7VA 1XLGA 2XN0A 3N18A 1UIPA 1V3IA 2WMIA 2HE5A 1XYBA 2QCLA 1SO5A 3Q65A 4ACYA 1LVLA 3PJWA 1TPDA 3A3XA 1UC4A 3O15A 2QDEA 4QCFA 5FJIA 4GFSA 1FP9A 3R13A 1QRQA 4Z0SA 2UBPC 4MJZA 1LOLA 1QI3A 3KOXA 2VEPA 3W7LA 2VQUA 2MUCA 4F9DA 4Q4QA 1ML1A 3WK0A 5BOEA 3UNDA 3AIUA 4G2DA 2ZTJA 3STGA 3N9RA 3COTA 1F3WA 1RCXB 1NY1A 2WNQA 1YNQA 4M24A 5EMLA 4CQAA 2QZRA 5LA0A 4ZSUA 3MMTA 1E6RA 1AD1A 2YB1A 3LY0A 3CGCA 4KQNA 5BNKA 1VEMA 3NVTA 4WOZA 3VMNA 2QGHA 3EKLA 1TPUA 3ZT5A 2TMDA 4W8BA 3C0SA 3CUGA 3W7RA 4DUOA 2X50A 3HBLA 1ZTVA 1L6SA 3W72A 2D0GA 3VIFA 3LYEA 3H4KA 3DJGX 1KM1A 3BUVA 3AIQA 3KXQA 1XYMA 3G8EA 3P8IA 1V6VA 3AU6A 4CD8A 1C8VA 7A3HA 4JHOA 4PMDA 4WOQA 3VIIA 3S2JA 2XVNA 1BG9A 2QGYA 3V1PA 3TQVA 2JBMA 2AAAA 5TD4A 1OYBA 1QT1A 3LGGA 2YIHA 2Q8LA 4LU0A 2X8RA 1LPFA 1F6YA 1FCQA 1EKOA 5HQMA 4PMUA 4DF0A 2V2CA 2WMKA 4Y8FA 4IQJA 1KO0A 3RLUA 3EWCA 3ZJKA 2PDKA 2WAGA 3IIPA 1K9TA 1JF6A 4XTIA 4R34A 2PLJA 4WQ6A 2PWHA 1T8QA 2P50A 3L2MA 3VO0A 2QR6A 1VF8A 3VOHA 3PC0A 1RQEA 4DXXA 3VAVA 2OVLA 3NPUA 3LB0A 1ZCOA 5GQBA 1HL2A 2YLLA 4B15A 3N2CA 5CPMA 4AD5A 3GO2A 2GR0A 3FKKA 4FNQA 3EDKA 3CNYA 5LA2A 1EBGA 4B91A 5IRPA 3KBSA 4M81A 3RG6A 1XIEA 4YTSA 1DJWA 5CGQA 5KVIA 1ONXA 2TPSA 4GO9A 1UWSA 1JJKA 1TCDA 2PWDA 1HT6A 1U30A 3UA4A 3ZT7A 1E1EA 2A4AA 1Q63A 2EQ9A 3PZNA 1HO4A 4DLFA 1S2TA 4BS0A 3EOLA 4KWSA 2B81A 5D32A 2GPTA 5D09A 1HZYA 3GC4A 1UC5A 3EX1A 3W7MA 1V77A 4E6MA 2VNCA 1F3XA 3F4DA 5DRCA 3GHUA 3WQFA 3AAMA 3UPBA 2ZZ5A 1U33A 4GC3A 3NXFA 4DJDC 3FYPA 2DJLA 2GGEA 4IX2A 1CBGA 1QOQA 2QKFA 3HJEA 4PCSA 1BSIA 4LVDA 1GPFA 3ZR5A 1OX6A 3AMKA 2A3CA 2WQPA 1W3JA 3T07A 3TYEA 4C90A 5FA5A 1ISWA 1NM9A 3UQNA 3CZLA 1JVNA 3WLQA 1PUDA 1A80A 5T26A 3UD6A 2F84A 4JEQA 3OZPA 1V7YA 3BW2A 1RD6A 1QTWA 4MB4A 2E5CA 4IZGA 1QPNA 3A7RA 3MYPA 2VCAA 4NAFA 2YDRA 2ZRYA 4X9SA 3B8VA 2P53A 2WLZA 3VX1A 7TIMA 4GE8A 4X63A 1IZKA 3D47A 1GVEA 4NX0A 3H2OA 4MOZA 1NFBA 2PI6A 1E0TA 3KS6A 3NZ1A 1Q6GA 3POCA 3O6AA 2VZUA 3HO8A 5DY2A 5LA1A 2FGZA 1I2QA 4DUXA 2PB1A 3OVQA 1G4SA 2VQTA 2V2DA 1BVZA 2PDYA 1JEZA 3AZSA 1EPXA 3GUGA 2ZKMX 4HTYA 4A2RA 2ZXDA 1ZP3A 2Z29A 4R3UA 4UFMA 2YBUA 5I09A 4J3TA 3WL0A 2BLEA 3T81A 3QEZA 4JTTA 1DORA 1LT7A 3A12A 4HZ7A 2GJRA 4TQTA 1R2TA 4GY7A 3OBAA 1CENA 4JTLA 3W07A 4PEEA 5FF0A 5SWUA 3M41A 1E3ZA 2XVLA 1V6YA 4GY0A 1QOXA 4TX8A 4FX7A 4P8UA 1K4HA 1Q7ZA 2ZX7A 3DK4A 2QCEA 1W0MA 3THDA 2WJZA 1ITXA 3PWGA 2JQXA 4DVOA 4D8ZA 3BL3A 1CZ1A 1XLJA 2W79A 4R7OA 1JCMP 1XKJA 1UPPA 3LCXA 4RUBA 3MS8A 1O68A 3KL0A 1OC6A 1XLHA 3M0VA 4AVOA 3CXBA 1GEHA 4RCXA 1WKDA 2A79A 1V03A 2PP3A 3N2BA 2C6QA 1H60A 2FH6A 3EEZA 4O11A 3W1XA 4Q4KA 1GV4A 3B0YA 4F0HA 1YDNA 3ZLGA 5F2GA 3SGGA 3AXIA 3FY1A 1KBBA 2C1HA 1O60A 1U83A 3TTOA 4AZCA 1C90A 4CN4A 2PD9A 2FJKA 2VC9A 3C2FA 1S2VA 5K9XA 4C6IA 2WJEA 1REQB 3GR8A 4JTSA 3KHDA 4R88A 3LK6A 1ZCCA 3EYPA 1KXHA 3AXKA 1TVLA 2KX9A 4JIPA 5CBBA 3TNBA 3T0BA 3UGRA 1D8WA 4W8AA 3SIZA 1QPOA 4ZZ9A 3GIQA 3VXGA 2F6XA 3HQPA 4QJ5B 1W2VA 3WH7A 2FPVA 3KP0A 1K6AA 3ALFA 1FH8A 3GAKA 3IARA 5E9AA 3HOJA 3APYA 3APGA 3PPHA 1XYAA 2RDWA 4CVUA 3WF0A 3G0UA 1FDZA 2VX5A 4X22A 2UY4A 1TJPA 1XBZA 4PTDA 4D6JA 4ZTXA 2F6KA 3ITOA 3WQ6A 4GVFA 1X39A 2ZRXA 3HV8A 2J77A 1KXQA 1Q6EA 2XTKA 1K9EA 3BW4A 4RE2A 4L9ZA 5CSRA 3V3WA 1UP0A 4MNLA 3RNMA 1G4TA 1EA0A 3PULA 1YXDA 3N14A 3O1NA 3DCPA 3W00A 2QMKA 3G1YA 3AMZA 1ITUA 2BODX 2QCFA 3QR1A 4GLEA 4D8AA 3D46A 3KBNA 1KFBA 2AMGA 5CLWA 1LCOA 3L4WA 4PL1A 3TQKA 4NZ4A 5I0DA 3TP4A 2VCCA 2JEQA 3ZYZA 4NQ1A 3SCRA 4AZHA 3UZZA 3IIOA 1BWKA 3BSGA 3HV9A 4YYCA 3JVAA 5I6SA 4V33A 1FVPA 2E6DA 4YTUA 3VGDA 4AF0A 4JTCA 4YCOA 1B2YA 5LYRA 2GJXB 3WENA 2XFYA 2VD9A 3M07A 1KQYA 3E2RA 6ENLA 3VTRA 3ME3A 1ZU8A 1BF6A 1H2JA 1QI0A 3HPFA 4PBGA 1UHVA 1M7PA 3PZVA 4C5ZA 4DYJA 1AH0A 2R94A 3B0PA 1NHRA 2ZICA 3QZAA 2D22A 2AQVA 1XIHA 3GDTA 3EOUA 3STFA 1VPYA 3H2FA 1E3XA 1X7FA 4FF7A 5GVJA 2Y7DA 1J8VA 1BXBA 3OVRA 3PBVA 3DEQA 1JYVA 4O4WA 3Q58A 4MAZA 1WOBA 5ABGA 3BPWA 4HYRA 4O52A 4ZFCA 3APTA 1Z8AA 1Z3NA 1ISVA 5HATA 5HAOA 5LXXA 1LT8A 1FDYA 1XIFA 2ZRUA 4KT2A 1JYNA 3CO8A 2QUMA 5AYXA 1Z6KA 3NO5A 1EOMA 4DBEA 3M5YA 3AHYA 2XVPA 4I9MA 3STPA 3LHTA 1DWAM 4Q4MA 2QS8A 4RV3A 3THQA 1RXOB 1VYSX 3CK5A 4OE7A 3AMCA 2P0OA 3LLFA 3C5QA 5F2MA 1V6TA 1R3VA 1V93A 4WK9A 3KVKA 2A7PA 2PP0A 1NDVA 3I6TA 3HM7A 1QHZA 1X97A 1QFEA 1XYCA 4J3ZA 1XUZA 3K13A 1HQTA 2J47A 3WQEA 1ITQA 5H6HA 1DQXA 1PPIA 3MQTA 2WZIA 2Z27A 2PBOA 4MWAB 3Q37A 2Y5SA 2AAQA 5HK4A 5BXPA 5D04C 1TMQA 4NNCA 2WVVA 1ECQA 2V30A 3ARRA 4O1BA 4PSRA 3WD4A 5LXEA 4MUPA 3LV6A 1SFJA 3OLIA 5HJXA 3RLHA 1KCZA 2DVUA 5LNWA 1QW7A 2V5BA 4O4VA 4MKNA 4LY4A 1D3HA 2DW6A 5AHNA 5E6YA 4HN4A 3VIGA 1TPEA 4GOAA 1UZ4A 1DYSA 2ZZ7A 3VX0A 1RVGA 4GJ1A 2ACSA 4BF7A 1MW2A 4XKYB 1R3TA 3URAA 3D3AA 3UWZA 1B3OA 4MLRA 3CUFA 1DWFM 1CXHA 1E70M 2F2HA 3GH5A 3BV7A 4DO4A 4O1AA 1G9HA 3UWQA 1VD6A 1Z48A 3G0SA 3EPMA 3O0KA 4E4FA 2Q02A 2FFIA 4K8EA 5EBUA 3CUIA 4US5A 3SQMA 4WDUA 3VOFA 3S5YA 3RR1A 3ZJ6A 3BLOA 3KWXA 4MDPA 4QQ3A 4PBEA 4FOJA 3WH5A 5EGRA 4UTTA 1SUXA 1N60C 1PHQA 3QMRA 4GYFA 2ZWZA 2HISA 2PZNA 3EA3A 4IJCA 3VNYA 1XGZA 3QW3A 2XU2A 4EOUA 5CGMA 4LFYA 2X0SA 3K8KA 3GTFA 4JN6A 3W75A 4A3RA 2PDUA 2EPLX 4FI4A 3W1NA 4AHPA 1XV8A 1AH4A 4GGHA 2R1NA 4LUTA 4N9EA 3A9BA 3PZ9A 5DT7A 3W1MA 3H2MA 3CIWA 1V6UA 1ZAHA 2VRJA 5GJNA 2V5CA 4CNUA 1OGBA 5FD0A 3RO6A 1EIXA 1QI2A 1R30A 1OVDA 1QHPA 3UESA 4EPBC 3WLOA 1PDZA 5BXRA 5EA9A 3NTYA 3BGAA 1V3LA 3BGGA 3TN3A 3AYTA 2O0TA 1JDDA 1FWNA 3BLIA 1FKWA 4NSBA 5FJOA 3R2GA 3IC9A 4Q4RA 1JROA 1T5AA 4JOMA 5HWMA 2DSKA 2DZSA 4NZ5A 3S5NA 1GHSA 3LRMA 3TN5A 4V1YA 5KZ6A 5FSEC 1ZENA 1I9CB 4Z1DA 3NSXA 1OIFA 2GQ9A 2QCNA 2REQB 1TJ0A 4H9MA 1D3GA 4GCAA 2Z1VA 4JNYA 3B9NA 4LAOA 4N4QA 1RPKA 1NF0A 4S3DA 3NOYA 3ETRB 3QVQA 4GX9A 2OSYA 4O1DA 3BG3A 4E4PA 3E9AA 1RV8A 1B1YA 2TRSA 1C9DA 4UUIA 4ZBCA 1ADDA 3W2LA 1U1HA 1W9UA 3LG3A 4TVDA 5A6LA 5HQLA 3CTTA 4GZJA 4BEQA 4GQGA 1UASA 3IWPA 1TWDA 3P3BA 3HGJA 4BWLC 3GQYA 1Q65A 2WP5A 4E2DA 4PMRA 1Q6CA 2VC7A 1J0IA 4ERIA 3D0CA 2FHBA 2GQAA 3ENLA 1KTCA 1PB0A 4XSMA 4AU0A 2X05A 4GBDA 1S3HA 3P0WA 5A6KA 5LNSA 4E4UA 2Y61A 1RJQA 4L6OA 3RPTA 2JKPA 2GGJA 1NVMA 4GZ7A 4JZ5A 2PDMA 2V0TA 1PVNA 1PZ0A 2G0WA 3MI3A 1CXLA 5CGTA 4A8IA 3WELA 2QYGA 4UOQA 3R11A 5DX7A 3HN3A 4ZMGA 1FHLA 2XIOA 1JCLA 2W0UA 4AWEA 2DPEA 3MJMA 1ZSXA 1GG1A 3WDQA 3S9IA 3NPVA 4W7WA 1J18A 2XIIA 3CO4A 3KCJA 2OQLA 1A0CA 3RX3A 3S2MA 4MZYA 2NUWA 4CCEA 2IMRA 4AC1X 3VIJA 3O7UA 3GIYA 1SO6A 2GJXA 1MO9A 4JDYA 3WJXA 3FGCA 2BY0A 2W67A 4GJIA 3SY5A 1UQZA 3GX9A 3VKBA 5JRBA 1UD6A 4MYAA 3FIGA 2OELA 4BQ2A 2VT0A 1GVSA 3N25A 1R3QA 1GYLA 2Y70A 4NZFA 4M1BA 1KBKA 4Q4OA 2QF7A 1GVYA 1EQCA 2Y5JA 5D8ZA 4UNIA 2W4XA 4G56A 3AJ7A 1VHCA 5C2XA 3IJ9A 1N8WA 4NYYA 2VZOA 4AVNA 4ORMA 3HQNA 4OV9A 2RKXA 1G6CA 4BY3A 3W22A 4U10A 5GJMA 3F03K 3AZRA 3CZEA 1ZBVA 3A47A 3EDFA 3VZXA 5DXYA 1OEPA 3P0XA 4LANA 1VBHA 3TZNA 3VNKA 4IIGA 4E5TA 2XH7A 3MCOA 1EL3A 4CCCA 2YOCA 3D9XA 2RHGA 3TJXA 4UFHA 1MEIA 3DAQA 3M5XA 5GPRA 4NEWA 2OG9A 1EJWC 3IS4A 3AO0A 5I07A 2NX1A 4ZVJA 2D2JA 3NM3A 3ZVHA 3BZGA 1EB3A 1NU5A 3WMCA 1UWQA 4TV5A 2GFTA 1XL9A 2VCBA 3L0NA 4RKAA 5CZSA 3V0SA 3IUHA 1F4HA 2Q8ZA 3M1ZA 1NWRA 5EMYA 5G5GB 4W88A 5JCKA 4WKFA 4PC8A 5JVLA 4JTJA 1N82A 2ADAA 2WCAA 4ICCX 1EOKA 1GJWA 4DXKA 3HQ1A 3JW7A 1JXKA 3MHUA 2PDGA 2DFAA 1LM1A 5JUVA 2OO6A 3BAKA 1VBGA 5DXXA 2I5QA 1TMHA 2AQWA 3PBMA 1V3JA 5D9PA 1Z9AA 4JCLA 5FI8A 4LUSB 1ZDLA 5EBAA 1N61C 3PTKA 4AYSA 3SAZA 4WDTA 2GGHA 1KLYA 5K3VA 1IR1A 1F4AA 1PTAA 2YLAA 3UJ2A 3AISA 3W23A 3BLKA 2EHHA 3N15A 1TRDA 4DM1A 3FG2P 2QULA 4Q22A 2J9XA 3MUY1 1RBAA 1F6PA 4B5SA 3T55A 1LBMA 3W38A 2F6UA 4H4PA 2E40A 3K8MA 4BZYA 3B3DA 4N9BA 2H9AA 3CTLA 3MSRA 2W61A 3G3DA 3S83A 3IAPA 1EHNA 1EXBA 2O92A 4QX4A 1EO5A 1J12A 3R7MA 2VGBA 4Q6JA 2X8GA 2PODA 4PODA 3VINA 1V8EA 5D05A 5CBIA 3P2VA 3FA3A 1RK6A 1UP3A 3T78A 4OT7A 1XD0A 2X09A 3MMDA 1R7OA 3ZR4A 1P1XA 4A21A 1GKRA 3NNTA 4H4UA 2J62A 3OU8A 1I0BA 2CXEA 1CW2A 1PHWA 1E0VA 1TPFA 1XRFA 3LCHA 1BRLB 2PS2A 4US5D 3OG3A 4XZIA 1LRNA 1VGAA 4BF5A 4GNVA 2E3TA 3RU8X 1B54A 3QQ0A 2P1FA 2VRQA 4A8LA 3U9IA 4KESA 1R0MA 3UJEA 3P61A 3BLFA 3B06A 1EEPA 4L4MA 4WD0A 3ZWSA 3GNOA 5IBXA 3S46A 3PS7A 2PURA 3IK2A 3WLPA 3LS9A 1T3QC 4AH7A 2CU0A 2C16A 3G0XA 1WX0A 2DJXA 2QT3A 3G6MA 4CNTA 1WDQA 4ZO7A 4H7ZA 3NQAA 3GVQA 5CSSA 2OXNA 4JN7A 1OGGA 3GS6A 2GVJA 3NDOA 1Y5VA 5IFPA 4DO6A 3RCYA 2EQ6A 3GG8A 2J25A 1JRCA 4IICA 4JNZA 4RJEA 4N6FA 3UBPC 3R5EA 4E8CA 3GVVA 3HG4A 2W66A 4IMCA 3NVWB 3GC5A 2BVYA 3SUSA 4P8VA 2PCEA 3SQLA 4HOWA 4IFOA 2HPMA 1MFVA 3PSVA 4AX7A 4PCTA 2H8ZA 1JYWA 2IUZA 3PM6A 4URIA 3HG5A 1J93A 3W88A 2GUUA 1UA7A 3G1DA 2QV5A 8RUCA 4UZUA 1CLKA 3F5KA 3GYCA 4GVIA 4AZ7A 1V0NA 5FIPA 3CZ8A 1PKYA 4NJIA 2Y4SA 4YYFA 1QDSA 4WSJA 1V7AA 3AWOA 3M4HA 4DBDA 2A6LA 4UXDA 1H1YA 3JS3A 2CIPA 4DUWA 4BQ5A 3HU7A 3RNDA 3PK7A 1PZ3A 3ATZA 3LHZA 4D9PA 3F4NA 2NWRA 1VC4A 1FHDA 2W5FA 4LXFA 1XIMA 5ER0A 1DHPA 1FWWA 4RPQA 3UCCA 1YPIA 3VOCA 4CEUC 3SO7A 1LZOA 3GG0A 3CC1A 1DQWA 3GSMA 4LC6A 1LLWA 5G2HA 3FDKA 3GHRA 3NL3A 5K7JA 1EEXA 4IXXA 5G1TA 5LGXA 1S38A 4HZ8A 4PTXA 1YHTA 3EDDA 2XGBA 4UTIA 4M8UA 5D4YA 4LB3A 4WJXA 2ZYFA 3PN8A 4AIOA 1MI3A 4AD3A 1VFFA 5XIAA 4F79A 1F2JA 2NVCA 3GKAA 4ZB2A 1HJXA 4KPLA 5JCMA 4I6VA 4F40A 4ZODA 1XIJA 5I3IA 3M7WA 1HN1A 2Z00A 3LCGA 1LQ2A 1QASA 2ASHA 3AALA 4NUWA 1X2GA 2OEJA 3RM8A 3F4CA 3RHGA 1FDJA 4PMJA 4G7EB 2QUNA 3FS2A 4F8XA 1ITCA 5TIMA 1E9LA 4PFMA 4GWEA 1RA5A 3B04A 4O19A 2Q71A 4NJHA 5HMSA 3N3TA 2EBNA 3RAOA 1UR4A 1VQTA 1DJYA 1QU4A 4HCLA 1H7PA 1M7XA 4R9XA 3O0HA 1E4IA 1W3IA 3GHTA 1OGSA 4F0LA 1QNRA 2V63A 4GCXA 2WNWA 4HA1A 5AECA 1XLDA 3WO8A 4KW2A 3KOZA 4B2DA 1AODA 4Z1YA 3WJZA 2CFYA 1AL7A 2HVMA 1S2UA 2Y1HA 4C91A 5I24A 1POKA 3HG2A 4JS3A 2Z6IA 4XUYA 1YADA 1OG0A 4GXMA 2NQ9A 2BXVA 3BH4A 1LDCA 4QS6A 3N12A 2PWVA 4S3KA 5D2VA 2VFHA 4PCNA 1IXPA 3CAWA 2J6XA 4QDPA 2VR4A 2C71A 4NEVA 4CCZA 3MWAA 1TV5A 4A8RA 2J7EA 1BYBA 1K8ZA 5IXEA 3E2SA 5U4NA 3EWWA 2DH2A 5DMMA 4LALA 5AKQA 4PTWA 4W7VA 4XBJA 4DJFA 5D03A 3P74A 1CXIA 1LL4A 2R9ZA 3DECA 4J56A 3B4UA 3DG6A 2WBAA 3UZXA 2BXYA 3PPGA 5HBFA 3FXYA 2DQXA 3UT0A 2VZVA 3M0KA 1J96A 4OFCA 3SURA 2W54A 5DY3A 4AVFA 4UFJA 2G8ZA 5HNTA 2X7WA 3FK4A 4JX5A 3QQ1A 2A21A 4RLIA 5BU6A 1Z42A 1CT5A 4NXSA 1RD5A 4H8UA 3U2ZA 3RO8A 1SU5A 2NPXA 5C9WA 1XJBA 2Z7KA 4DXVA 1VEOA 2FZ8A 4PB4A 4EPKA 1YPFA 4CQ8A 4XAZA 1V02E 4EE9A 4QQUA 2PDCA 1Q8JA 1HVXA 5EFFA 3VUPA 3HPZA 1PDYA 2FHCA 3A24A 3GU1A 4XIMA 3LPOA 4WY0A 3AIRA 3GXPA 3KE0A 4EAYA 4IPJA 3ID7A 5HNRA 1MO0A 2CCRA 3EX2A 2YXXA 1XDJA 1PX8A 4C6KA 5KZEA 3QQWA 3HPSA 4QSFA 4E2VA 2CFFA 4Q8QA 3W70A 1WV2A 1VBRA 3R8RA 2OJPA 2WNZA 3GH7A 4KCVA 4D6CA 1TR1A 2O55A 1ZK7A 1GCYA 3USBA 2HSAA 3MMWA 4DJFC 3DGHA 1LQ0A 3NO1A 2C8NA 1XLAA 2R91A 4U5IA 5FS8A 2V6OA 4Q8NA 4BA0A 4GQ0A 1Y5XA 4JDRA 2RAGA 4GINA 2DDXA 3PZMA 4RDYA 1GQLA 2O9OA 4H6RA 3IIVA 4GUGA 4UCGA 3WLNA 1US3A 2YCJA 4BI5A 1KM6A 3HJZA 2D1ZA 1XPGA 3IPWA 1SGJA 3K1DA 1JD7A 3W26A 4CU6A 1VFTA 1GPWA 1VRDA 3FJNA 4E3VA 4IPIA 4JCMA 1RH9A 2VWSA 1V3HA 4AEEA 1NOFA 3S6OA 3B8WA 1UZ1A 4DPPA 1YE6A 4R33A 3TMLA 1FUYA 1OFRA 3PJTA 4LV9A 3EB2A 4MGGA 2XDFA 4G1KA 3VKKA 5H8MA 3FV9A 1WDDA 4QROA 3BOXA 2PBGA 3WNMA 1BXCA 1E4NA 2W3RA 5EU9A 1M65A 1SZEA 1D7YA 4IUOA 1W9PA 1ZPTA 1DTUA 3WLRA 2HVOA 3N04A 1CLXA 4HMDA 2B31A 3N73A 1TCMA 3GNRA 1DWIM 4GXPA 3E02A 3MKKA 5E0CA 3GFXA 2MNRA 1E4LA 1I1XA 1JZ6A 5A8MA 1P6BA 5DCEA 4O1EA 4MY1A 2PWEA 3GRSA 5JXQA 4PUJA 4FX8A 3A23A 2HEJA 4ZL1A 4DQWA 2XPKA 3TFCA 4ZOHB 3L5MA 3O63A 4GYKA 4EAMA 3WLLA 2DUZA 1OFDA 4L65A 3MSDA 2WKJA 3A5FA 1R6WA 1R9XA 1ISYA 4CNSA 4S38A 2XM2A 3HGOA 3ZJ7A 1G4EA 1PYMA 3ISIX 1MYRA 4Z42C 3LDVA 2EQDA 2W27A 2I56A 5F4WA 3WJWA 1UIOA 3TQPA 5HR6A 4BK9A 2J8TA 3SEPA 3K4AA 4IWWA 1FOBA 3NJ3A 4MWAA 4HSNA 4HNVA 1HGWA 4Z17A 5LKYA 1A5KC 5U7SA 1IXQA 8XIMA 4O10A 1K1DA 2DIJA 5FF2A 4ZR8A 4RDZA 5G4EA 2ZX6A 3CUXA 4X61A 4Z2HA 3L7RA 4XB3A 3BE7A 1E6ZA 1QNVA 3RLVA 2OTDA 5LIWX 1TE1A 1GZGA 2WSYA 4V27A 1GQJA 2ZA1A 4ZA0A 2POZA 4HPNA 4HN8A 3ZFHA 3DUGA 1O94A 3QSRA 5FESA 4XAYA 4L4OA 3OIHA 1J79A 3OGVA 3V35A 1NARA 3QZEA 1GOKA 4PUWA 4TX6A 2J27A 3W2MA 4KWUA 4WIWA 2V9DA 2CKSA 2OKOA 1QK0A 5FS6A 3G6LA 4V15A 2GSHA 3N17A 3WNKA 4AB4A 3C3UA 4M29A 1XG4A 2Q09A 1V79A 4GK8A 4TXEA 4OKDA 3SQSA 1ZUAX 1S39A 3MTWA 2Y24A 5FJTA 2OODA 2VD8A 2WKLA 4NVTA 1L8PA 4DWSD 4AIUA 2HNHA 1V0KA 1K9DA 2VP8A 1C7TA 1V5XA 4R27A 1MUWA 2O4QA 2PWFA 4QG9A 1PKNA 4TU1A 1U5HA 2YZRA 3TNOA 2XFFA 1J5SA 4M6PA 4A6GA 1JNEA 2YCLB 5CC5A 5I79A 3UG4A 4FF5A 3N6QA 3GRTA 1XLKA 3RX2A 4X9YA 3H7UA 2D20A 1JCJA 2WP6A 4YS1A 3MKCA 4S3JA 1TSIA 5A2CA 3ARWA 4C6CA 7REQA 3KL5A 1M6JA 4R85A 4C6BA 4JQ9A 2VURA 3T2PA 4AZIA 4QCEA 2GRTA 1VRXA 3GRIA 1JG9A 1VLWA 3IUIA 4XAGA 4WDWA 3SCTA 4JFWA 2QPUA 4H9ZA 1AJ0A 2EKGA 2HS6A 2YCKX 2DZPA 3U7BA 3NQGA 3AROA 3DKJA 1G01A 1QR7A 1JDFA 2QJJA 1P7TA 4ONVA 1RLDA 1VPXA 3EWDA 4TX9A 1K8XA 1H63A 3BMWA 2PAJA 3CQKA 4W9TA 4A2SA 4NXKA 1O4UA 2OSWA 3QBUA 4QGCA 4QEHA 2VXNA 4HU3A 2NVDA 5AHMA 2I9EA 3LENA 2GQ3A 5ABFB 1UPMB 3PFMA 2CLMA 3QC3A 4AZCB 4UIOA 1LROA 4H4IA 4B9YA 4PTNA 1KGXA 1TWIA 2XIMA 3IJLA 2OPJA 3C86A 4AY1A 1VJIA 1HKKA 3CAKA 1UD3A 1C3FA 2D0HA 2H3BA 5DF0A 4FLOA 2WNNA 1QWKA 3UEQA 4I6KA 4JY8A 6ALDA 1YBQB 1NWSA 3I3DA 1TV8A 3K8LA 1P43A 4IFKA 3WH9A 5D2YA 1GRHA 4EXAA 4WGHA 3I6EA 1Z44A 3CPGA 2EXOA 2X40A 4GQBA 5D2TA 2WM0A 3VK5A 5ECVA 2Y8VA 4C6DA 5KMYA 1FWBC 4IGSA 1EP2A 2C19A 4GA8A 1X1ZA 1UBPC 3RMJA 1DIEA 1VENA 3T2QA 1VFLA 2G96A 2C0HA 3FKRA 3DH7A 4DWSC 1I4NA 3NAVA 4K8DA 1UOKA 2BGNE 3NQEA 1HJVA 3EZ4A 3QOKA 3TC7A 4QTGA 1Q1WA 3G1VA 4H4WA 5PTDA 2QVHA 5AVHA 1RK5A 3NZQA 4NP7A 3O8AA 3R8GA 3W37A 3PZUA 1GYNA 3G1XA 4DJDD 1B31A 1MUMA 4IFKB 3E74A 1YEYA 3ERPA 2OEKA 3LGEA 3H70A 1H6VA 1UW9A 4HKPA 1A3HA 2DZUA 3UWVA 3W6YA 2YGYA 1XINA 3PZTA 2ESCA 2X16A 4C7GA 3TTEA 3MC5A 1V6XA 4C6JA 2J3NA 2CBVA 4ZSTA 2QIIA 3MSYA 1OCQA 2Z2UA 3V0TA 3GXNA 3CL6A 2DQWA 3W1UA 1EH9A 2VC6A 5EMUA 1AMYA 3GDLA 1B5TA 4M51A 1V02A 3SCQA 4OUIA 3UVIA 1R3SA 1SJCA 4F66A 1FCUA 2DU2A 1TREA 2J7DA 3M5ZA 2E28A 3RCMA 1H61A 1K02A 4NAEA 4W8LA 3M6YA 3BOLA 3PBWA 2E5AA 2FIQA 3VKCA 3LSBA 4P61A 3H2EA 4F0MA 4XG1A 4OECA 5BRPA 1YNPA 4H4VA 3TTYA 2A2IA 4NRSA 3Q45A 1GRAA 5FEPA 2HK0A 4F48A 3R25A 4CLMA 3LGDA 3VILA 2Q3RA 2V3DA 1MQRA 2V5LA 4QAIA 4UTFA 3K4WA 4WGXA 4OBSA 1ZNNA 3OHIA 4XWUA 1E5JA 4J40A 3VOIA 4JPGA 2WMFA 4F2BA 4EF9A 4WSHA 4QHRA 4H9TA 5C8BB 1UD8A 2PCQA 4G5DA 4H8NA 1Z69A 3W53A 4L56A 3PTQA 4OHQA 4E0CA 1S1RA 4RW5A 3URNA 4AXNA 2HROA 4YCPA 3MBDA 3HURA 5CSYA 3TOYA 3ZXWA 1GRBA 1EGZA 1Y7VA 1Q6OA 4JAWA 1ME7A 3OO2A 5CAKA 3NQ2A 2W3SA 2D0FA 3W2JA 4NAFB 4LYKA 4X60A 1K03A 4IFRA 2X1RA 5FCZA 4A35A 1WUFA 3LI0A 3W28A 5LIUX 2J9YA 4AZ6A 3WF2A 3CMJA 1A4LA 2CLHA 2Z1WA 2C3ZA 3TJIA 3SCSA 1FHUA 4UB9A 4XVDA 1SYTA 3ATYA 1KC7A 4FZIA 4BQ3A 4ZOBA 4HK6A 2ONEA 3VIHA 3DFSA 1A5LC 2FQIA 2CZFA 5DANA 3E49A 2QLYA 3CQ0A 1N8FA 2IKIA 5A8GA 4HTBA 1JXJA 1MVYA 2CLIA 4PCFA 2C91A 3NGFA 4UMAA 1FXPA 3P14A 2DT0A 3CHFA 4K1WA 3WK2A 1VLIA 3U2CA 4WZHA 2DORA 3NM1A 4NG3A 1OFAA 3GDBA 3WUBA 1H7XA 3JUGA 3AQUA 3DHPA 3RILA 4H4ZA 3TXVA 4I8YA 4L4PA 4CNPA 1NEYA 1HKVA 2CLEA 2YL5A 4ML4A 3DZ1A 3AUJA 1KGUA 3VPLA 1M7JA 2W62A 1FWIC 4EVZA 1B3WA 2Y6ZA 5EPDA 5KEZA 5FSDC 4K7VA 1T6MA 4C1NB 3P60A 1S5NA 2QCGA 3EMQA 4AD2A 3BQ6A 1MMFA 1CXFA 4S3BA 4UTHA 1NP0A 3IK4A 4PE8A 2PRHA 3NZRA 1JCTA 2E4TA 1GOIA 2J7FA 2DY3A 4AMCA 1LWHA 1Q66A 2VFDA 4FX6M 1QNSA 5BWFA 5CEWA 3O16A 4UNLA 1XS2A 1OZQA 1U2YA 3ANUA 1HX0A 2GOKA 1E6XM 3GTHA 2Z1KA 1UCWA 1JI1A 2DT3A 4AC7C 3SB0A 1DEDA 1J10A 1X8CA 2C79A 3I4EA 4MFEA 3HMJG 3CB3A 3VFCA 3ANVA 2ANUA 2ZWYA 1OFEA 1MFUA 1PX3A 3NOEA 1PKMA 2GWGA 1UUOA 3WFLA 3W02A 3L65A 5CG7A 2VUYA 2CHOA 4MVAA 4KBXA 2WOVA 3NSMA 3LBCA 3F5JA 3V0UA 3UG3A 3NWRA 5J8LA 4H4RA 4GZEA 1NHSA 1WAUA 4FSAA 3UR8A 4BQ4A 4NT0A 1WB0A 4A3YA 1W1IE 2PWUA 4TVUA 3NYZA 4LWWA 4DYEA 5HINA 1NF7A 3NIYA 1LOSA 1M03A 2FPTA 4WDXA 3SIMA 4HK5A 1HL8A 1VJSA 3GXDA 2P8CA 1V3MA 3WQVA 2GJPA 1Q6RA 2QJGA 3FJ4A 4PMOA 2GR2A 4QP0A 5AOUA 4FPSA 4XIAA 2R1KA 4HOXA 1G1YA 1TUFA 4PEKA 5IBXC 1DXLA 1DJZA 6REQA 1G67A 3L9CA 5T91A 2PDQA 3CWNA 3VGFA 3FSUA 3LTYA 4LNCA 4EPDC 1K6WA 4GHRA 5CBJA 5D9NA 3W25A 2PEVA 3A9IA 2R14A 3LQLA 1SJDA 4S3CA 4AQLA 3GD4A 1JGIA 4NASA 3B4YA 4NZ3A 3ZM8A 1FWGC 3LHVA 2PTWA 3LXAA 1XD1A 1S2WA 1ZB5A 4I3GA 4DNAA 1I1WA 3W4RA 1R7AA 4MJMA 3UPWA 3L0GA 4D72A 4QEEA 2NQHA 3CAQA 3WNLA 3PF3A 2QPXA 2EPNA 2PRLA 3TLLA 1J0KA 1BSLA 2NXHA 1KFLA 4ZOAA 3DHDA 3CM4A 1PJ9A 4A22A 5CPQA 3UJSA 1BWCA 3WQ4A 3ITYA 1XKYA 2AKZA 3SCVA 2V2HA 2G97A 4JFVA 3NQ7A 4MZ8A 1TZZA 5IOBA 4UTWA 3RN6A 1BZLA 4Z2GA 1IEWA 1Y5WA 3D6NA 4JQAA 3MVIA 3OZOA 4UQDA 4I7VA 3I10A 1DXEA 3GXMA 1HKWA 3G8RA 2Z28A 4G6CA 2WZEA 5D2XA 1KWGA 2IXUA 5DBTA 3GDMA 3CHCA 2VDHA 4TVYA 1MQPA 3W81A 3QTPA 1R3WA 1AW1A 3KLKA 3TEVA 4EM4A 1UQYA 1A5UA 3GH4A 5HWJA 4L6HA 3VM7A 1QO2A 1ZXIC 3M64A 4IPPA 2ZTKA 1GZJA 1LWJA 4QNWA 2QVNA 4G8TA 1OSEA 4N6EA 1YRRA 1UZDA 3TJ4A 3VD3A 3GXIA 2FZBA 4G7EA 4RZ6A 2AL1A 3WN6A 3UPMA 4HPJA 2ZXQA