3R0UA

Crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : tartrate and mg complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
362
structure length
362
Chain Sequence
VSKIIDIKTSIIKIPLKRTFITAVRSTNHIDSLAVELTLDNGVKGYGVAPATTAITGDTLQGMQYIIREIFAPVILGSDLSDYKQTLELAFKKVMFNSAAKMAIDLAYHDLLAKEQDISVAKLLGAKANSIVTDVSISCGNVAETIQNIQNGVEANFTAIKVKTGADFNRDIQLLKALDNEFSKNIKFRFDANQGWNLAQTKQFIEEINKYSLNVEIIEQPVKYYDIKAMAEITKFSNIPVVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMESPAGILATASFALAEDITVADLDPLDWVAKDLYSDYITFNEPNIILKDNLKGFGFNLAENLYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Enzyme of enolase superfamily
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Francisella philomiragia subsp. philomiragia
total genus 119
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3r0uA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3r0uA01
5FJUA 3NO1A 3FVDA 4DXKA 3P0WA 2PGWA 1MNSA 3N4FA 1TZZA 4HYRA 3VA8A 3GD6A 3H70A 2OO6A 1JCTA 3TOYA 3UCDA 2GSHA 3DFHA 1JPMA 4DN1A 3PWGA 3TJ4A 5FJPA 2PA6A 3GY1A 3UJEA 1DTNA 3RO6A 2CHRA 2AL1A 4IP5A 2RDXA 1KKOA 4GISA 3UJRA 3RCYA 2DW7A 4IL2A 3UJ2A 3T8QA 1FHUA 2HXUA 2FYMA 2FKPA 3DGBA 3V3WA 4H2HA 1TE6A 5BOFA 3SN1A 4J1OA 2DW6A 4MGGA 4KPLA 3IJIA 3RGTA 3ZLHA 1WUFA 4Z17A 2GGJA 2P8CA 3S5SA 3P93A 1ECQA 2P3ZA 3DDMA 2MNRA 3B97A 4GYPC 3MWCA 3ZVHB 3NXLA 3KUMA 1MRAA 2GGGA 1JDFA 3V5CA 4HNCA 1F9CA 4MMWA 4GFIA 2HNEA 3SJNA 2GDQA 4G7FA 2OVLA 4YWSA 2PGEA 2OFJA 3VCNA 2OG9A 3N6JA 6ENLA 3OZMA 2PCEA 2PPGA 1TKKA 4K8GA 3DIPA 1ELSA 1EBHA 3UJSA 3STPA 3FCPA 4MKSA 1BQGA 2PP0A 1ONEA 1YEYA 3PFRA 2AKMA 5ENLA 1KKRA 3BOXA 2PU0A 4E8GA 3QTPA 3TWAA 4EWJA 2XH7A 3GO2A 2I5QA 2HXTA 1W6TA 3JW7A 3N6HA 4E4UA 4H83A 1SJDA 1XPYA 2XGZA 3VFCA 3CAWA 2PP1A 3R0KA 7ENLA 3H12A 4ENLA 4HCLA 1IYXA 3BJSA 3H7VA 3EEZA 3QKEA 2PTZA 3FYYA 1KCZA 4HPNA 1PDYA 4IP4A 3DG7A 2QJNA 4DX3A 1MUCA 2PODA 2P88A 2P8BA 4DYEA 3OTRA 2GL5A 3OW1A 2PTYA 2PMQA 1RVKA 1R6WA 3CK5A 3SN4A 3SBFA 3TW9A 3ZLGA 3MKCA 3VC6A 2XH4A 4IZGA 4JN7A 3FXGA 3OP2A 3NFUA 5IDZA 4HN8A 3IJLA 4A3RA 4ZA0A 3TJIA 1MDRA 1SJAA 4KWSA 4JHMA 3SSZA 3RITA 3OZYA 3PWIA 1WUEA 2QQ6A 3ENLA 3Q4DA 3P3BA 3VDGA 2OPJA 3FJ4A 3IK4A 5FJRA 4E6MA 2OZ3A 4ROPA 2NQLA 4IT1A 4M0XA 1NU5A 3EKGA 3DG6A 1E9IA 3T9PA 2PS2A 4X2PA 3CXOA 1MDLA 3MY9A 3MUCA 3PK7A 2QGYA 3UXKA 2ONEA 2AL2A 4IHCA 4GIRA 3MQTA 3DFYA 2QDEA 3R1ZA 2OZTA 2XSXA 3TCSA 2HZGA 3R11A 1SJCA 4F4RA 3THUA 1EC8A 5BOEA 3TTEA 3BSMA 4H19A 2XH2A 1P43A 3U4FA 5FJTA 2QJJA 4DWDA 1XS2A 3MZNA 2ZADA 3VC5A 2PTWA 3TWBA 1R0MA 3V5FA 3ES7A 1EBGA 2MUCA 3I6EA 3N4EA 3IJQA 2OLAA 1P48A 4A6GA 1PDZA 2P0IA 4HCHA 3DESA 4G8TA 3CYJA 3JZUA 1EC9A 3K1GA 4FP1A 1JPDX 4E5TA 3QN3A 2XH0A 2AKZA 1SJBA 2ZC8A 4E4FA 3CT2A 3QLDA 4ZCWA 4IL0A 1KD0A 3I6TA 2GGHA 4H1ZA 4J3ZA 2O56A 3UGVA 3FV9A 2OZ8A 3T6CA 4HNLA 2GGIA 3TQPA 4JN8A 3SQSA 3UXLA 2PP3A 3MSYA 4K1WA 3I4KA 5FJOA 2AL2B 3T4WA 3DG3A 1NELA 4K2SA 2OKTA 3R0UA 3SN0A 3ES8A 4KT2A 3UJFA 3DEQA 2OQYA 4HCDA 3RRAA 2QDDA 2PSNA 2PU1A 4Z1YA 3R10A 2OX4A 3GC2A 3R25A 2PTXA 3JVAA 2OQHA 3QPEA 3H8AA 3VCCA 3DERA 3HPFA 4A35A 3RR1A 4GGHA 4DHGA 1BKHA 5EU9A 3S47A 3CB3A 4GYPA 3Q45A 1OEPA 1L8PA 4M6UA 4FI4A 1EC7A 3U9IA 3ZVHA 5J04A 2POZA 2QJMA 4GGBA 3D46A 3V4BA 3UCCA 4GMEA 3D47A 2GGEA 3OPSA 2QVHA 1FHVA 3ZVIA 3ZLFA 4KEMA 3NZGA
chains in the Genus database with same CATH superfamily
1K9TA 4F3HA 5EBAA 4GJJA 1O5RA 4LUJA 2Y0FA 2DORA 5I02A 1J4EA 3RM8A 1GNXA 1YXCA 3N15A 3VA8A 3AALA 1XH1A 2GJLA 1JDCA 5T9CE 1CDGA 1JCTA 2DQWA 4CVWA 4M7TA 5HQEA 1UASA 3SAZA 1NPXA 2FPYA 4REQB 1H7PA 1O1ZA 2EPMX 2REQA 2YB4A 4D8ZA 3EYPA 2NQ5A 1K1DA 1ZENA 4UNLA 1W3IA 4HU3A 3LADA 1SM9A 2DZPA 1A80A 1TPUA 3O0KA 1VFFA 1OJTA 1JQXA 1KLZA 4IL2A 4JCMA 4S2BA 4Q7IA 3FDKA 1B4EA 3EPOA 4D2JA 2FYMA 2XDFA 3KEHA 4ZB2A 1DIEA 4DVOA 1T3QC 2NVCA 1V0NA 1ZY9A 3WQ6A 2W66A 2H3BA 4NP7A 3U0HA 1Q2RA 3A4XA 3BJFA 3QM3A 3I4EA 4FHAA 2J9YA 1SVDA 2A4AA 1I6NA 5C9UA 5CLTA 1MNZA 3EOOA 2XIQA 1X6NA 1KFBA 4JTDA 4PEEA 1QOQA 3N04A 4TMCA 2GGGA 1PYMA 1S5MA 1XUZA 4AVFA 3WDQA 1SSDA 3B8TA 4UQ9A 4O50A 2DSZA 1VP5A 1KGWA 3OZMA 4JTTA 1YXDA 2W0HA 7REQB 3DIPA 3L5LA 3UPBA 3MCOA 2V5KA 5U4NA 4H4ZA 3SADA 4AMAA 3CUHA 1E6ZA 2C18A 3KCOA 4WZHA 1RY8A 2IXUA 2GK1A 3TWAA 2DFAA 1JVNA 1WPCA 1Z89A 3CPRA 1UOKA 4GJIA 4OKDA 4H83A 2E5BA 3L4UA 3AICA 3TKFA 1D8WA 3BLFA 3BW3A 2UY4A 2PRHA 3KOYA 1S39A 2VC6A 4C6MA 1J5SA 4S1FA 1E55A 3R58A 3ZT7A 1H62A 2JF7A 3GC4A 3BANA 1I1XA 4YN5A 1ADOA 3AXHA 4Q4KA 4UXDA 3RPTA 7A3HA 2WZHA 4YCPA 5M2FX 2P88A 1JUEA 1AOGA 3CQJA 3FXYA 3OTRA 1IR1A 4NIRA 1ODZA 3CK5A 3BQ6A 4FOUA 4NI8A 4A8NA 1HFBA 3VABA 2G95A 3FXGA 2V3DA 5DEZA 4QE4A 4RCXA 5G2IA 3OP2A 1W3HA 1QVBA 1EZ2A 1QPOA 2PDFA 1W56A 3OIHA 2BSLA 3I3BA 3WIJA 1R47A 4KWSA 4RW5A 4GZ7A 2WCSA 3LZ5A 4UQCA 5REQA 3STCA 2Q3RA 5LIUX 3LD5A 1XW8A 4LXFA 3NG3A 4LYQA 4N6EA 4JYEA 4LBRA 1JYNA 4H6QA 4BEQA 2BCPA 5GPRA 1I75A 1POKA 4ZXOA 1AD4A 4HK7A 4E6MA 1W3KA 3YPIA 3WLSA 2O7SA 4FAMA 4H4UA 3A5VA 4PCFA 1DYSA 3SSJA 4NRSA 4QE5A 2NLIA 2A85A 4XG1A 2JE8A 3UZ5A 2CESA 1WXJA 3LCXA 1EQPA 2EKCA 5IRPA 1W1B1 3GWQA 3W7JA 3AZSA 4DJDA 3B8SA 2ZZ1A 2J8FA 2ONEA 4N6FA 3RK8A 4U3CA 2JGYA 4CCCA 1VIZA 1BPLB 3GTXA 1BVWA 1XDIA 4DBWA 3R11A 1ZBKA 2BB0A 4NAEA 2EG7A 4U10A 2EPNA 1C3FA 2OEJA 2V69A 2VCBA 1CT5A 5F4SA 3R43A 1P43A 3HMJG 4DBUA 4JX6A 4NILA 1F3EA 1UJPA 1E0UA 3ZJ8A 1R87A 4LF1A 3NGFA 3BARA 4JL2A 1R2RA 2OU4A 4AU0A 1W1VA 8CGTA 4PODA 2J7EA 1KRMA 1FDYA 1YLVA 3BLPX 3STFA 3W74A 3SGZA 1WDWA 4EE9A 1NH6A 1SO3A 4B2DA 2JIWA 4TTGA 3GTFA 2WLYA 4D71A 4JTJA 1FH7A 3NWRA 1XYZA 3IJ8A 1BGAA 3PAJA 1P1XA 2HTMA 3S9YA 4W9TA 5CSRA 5A6BA 3BG5A 1TZ7A 1KD0A 4R53A 4ZSUA 2CXEA 2D23A 3CUGA 2V6AA 1YNPA 3F5KA 3SUVA 3FV9A 2NVDA 1AUSL 4S3FA 4QLLA 4A3UA 3ERPA 4CNUA 4HA0A 4LUYA 5D03A 1H1ZA 1XD0A 3GBEA 2ADAA 4QS6A 5DQPA 1CXKA 3QV7A 2A3HA 3UXIA 2YX0A 4EP8C 5KMYA 1FKXA 2OKTA 4HHHA 4LY4A 1DE6A 1P7TB 1H09A 1W54A 1POJA 3IC9A 2J8TA 4UTTC 4IFOA 3LQLA 4KT2A 4IICA 1NOWA 4DF1A 1UIOA 4ZOAA 3GHSA 3DEQA 4C6EA 1PKYA 3N13A 3DHUA 4M56A 2VC5A 2TMDA 1X6UA 2WNQA 4MNKA 5I2UA 4P2VA 3PTKA 3CGBA 2PWHA 3LHTA 4KWOA 1IZKA 1WKEA 5JCMA 3AIBA 3WJWA 1O94A 2DVXA 3FK4A 4TVWA 2PF8A 1V6UA 3MP5A 4GYPA 1XISA 4O1FA 1OFBA 3PZ9A 2OYMA 4UB9A 4LY8A 4Q8QA 4PSRA 3ZVHA 3WBYA 1ADSA 3IV8A 3GKAA 1XCWA 3M7WA 2POZA 1S2VA 1U83A 3HQPA 3D47A 1SO6A 3TYDA 3SQLA 1Y5WA 2GR0A 2EGZA 1SQ7A 4GKLA 4HOZA 5LNVA 2PDCA 1UR0A 2PGRA 3L0NA 1T5AA 3P74A 1XHCA 3LZ3A 1ZCCA 1J0JA 2DZAA 2V3GA 2OSWA 2E5DA 4RNFA 4AX7A 1FWFC 2GQWA 2WSKA 4O8RA 3EWXA 2V3AA 1KR0A 1PSCA 4DLMA 3CWOX 2ABAA 2ZX6A 5I3GA 1M9HA 4WDXA 3W82A 1XC6A 1N8FA 2VFEA 3RDKA 3BLOA 3W7MA 5HWNA 3R8HA 2V5DA 4XTDA 3NL5A 4YVPA 4JKKA 2FLIA 1RA0A 1MFVA 5BOFA 2ISVA 3ZQ9A 3HFTA 1X8FA 4QLJA 2WOIA 1Q6EA 1R85A 1HN1A 2V6OA 1Q7MA 4CN1A 4DBDA 2I5IA 1K77A 1YPFA 3AO0A 4AD3A 3M0JA 4XTIA 5G1MA 3DENA 5KTLA 2E6FA 2IPJA 4P7LA 4JOMA 2B0MA 3ITGA 5F2LA 2C1IA 3F7JA 3K4DA 2WPEA 4JTFA 3AMKA 3NDOA 2YCJA 1V0LA 4YWSA 2QDGA 5CJMA 4U5IA 4XZWA 5GQBA 4FX8A 2J4GA 5HINA 3O2LA 1SFJA 4ZB0A 3RJYA 4O1EA 4R33A 3S4TA 4DBSA 1EBHA 4CQAA 1DJYA 2H9AA 4PB5A 5CLWA 3P7YA 1ONEA 1UA7A 3QFWA 1DL3A 3OQEA 1UD8A 2I57A 3LB8A 3DFOA 3GR4A 1I2QA 1Q6OA 3BGJA 5EY5A 2ZYFA 1H2IA 1YADA 1C92A 2Z7GA 4DUVA 3M9YA 4O4WA 3FVMA 2G50A 3L4YA 5PTDA 4NNCA 4E4UA 2VI0A 1V0MA 3E2QA 4W89A 1SSGA 4GNJA 4J3WA 4XAZA 1W3JA 3B8UA 3TYAA 3T81A 3GC5A 3H12A 3VZXA 4O19A 4HD5A 5FEXA 2J7HA 3OB8A 4C7GA 1K8XA 5TF0A 2EJ1A 2WZMA 4ADWA 3LCIA 2B7NA 3A3HA 1GK8A 2QUTA 3W7DA 1T41A 2DIJA 4K1GA 4GQGA 3OLGA 3NDZA 4OFCA 3SN4A 4NU7A 4HZ8A 4XUGA 2RJGA 4CNPA 1WA3A 3ZLGA 1RQBA 1XF0A 1WKFA 2XH4A 3GW0A 2YXGA 3RPMA 1VFUA 3GRTA 1OCQA 1DJWA 4H6KA 4YHEA 2V2DA 2ACSA 5K4ZA 1BXNA 2AAAA 2NSXA 3CV6A 3UR5A 4BHYA 1XLBA 3CM4A 4UMAA 3WH8A 3GTNA 1KA9F 4GXWA 4RZ4A 4WF7A 1QT1A 4GY0A 4JD4A 3FG2P 7PTDA 4ZOCA 1XIHA 1MEIA 2QIIA 2D69A 4IPPA 3VIHA 5D37A 4M6PA 1FVPA 3GXNA 4N9DA 3G18A 1CIUA 1L6FA 1ISXA 1KO0A 3HB9A 4H9XA 1KBIA 2CLEA 4X2PA 1TCMA 3DYOA 4JIHA 3PK7A 1AK5A 1ONRA 4XO7A 2QGYA 2WMGA 3P8IA 2CZEA 2QDEA 3CAQA 3EXSA 4PUDA 1WAWA 1OYAA 3S1GA 2HZGA 4N9EA 3S2CA 2WJDA 4F4RA 5IFPA 4RXGA 4JTEA 4URIA 4GRSA 3WQFA 3LRLA 2Y61A 2REQB 2XFYA 3H53A 2A6NA 1HT6A 2BXZA 3B0YA 4TUFA 1KM2A 3NXFA 2PTWA 5EKYA 2PE4A 4KESA 3SQPA 4NG3A 3I6EA 1GQIA 2G97A 2NV2A 5DY2A 1HL9A 1N61C 1FCBA 1BLIA 4L9XA 3F2DA 2ACQA 2YZ5A 1K03A 2Y7EA 5G5GB 2FFCA 2WXDM 4YTSA 3APGA 5CGMA 3GXIA 3JZEA 2P10A 3BW2A 3V0UA 1RHCA 1XFBA 1VPQA 3MSGA 4IMGA 3LXAA 4PH6A 4E4FA 1TVLA 5H91A 1WOAA 4MNLA 5C9RA 2WHMA 4B5SA 3K8MA 2ON3A 1JUBA 2R9RA 3CEPA 3S1VA 2NVAA 2WVSA 1ZTVA 4HSNA 1RBLA 1H0IA 3QOKA 3PZOA 1VHCA 5XIMA 4XAYA 6CGTA 1TWWA 4UBPC 4XVEA 3HJEA 3VIOA 2HQAA 1LDCA 2G4JA 3AYVA 4RE0A 1QR7A 3VOHA 5GRTA 1E71M 4P7QA 3S2LA 1E5JA 3V0TA 3KVLA 1UWAA 4V1XA 1BKSA 5F2MA 1ICPA 1IE7C 4WD0A 4KIRA 4S3BA 3THCA 1F74A 1CGWA 4L4LA 2A7NA 3AZTA 4G7EA 4BY3A 3I7QA 3FJ6A 1G5AA 4BA0A 4DNHA 3NQ6A 1ZU8A 4QJ4B 1IXPA 4KFPA 4OBTA 1YW1A 2OQHA 4FX7A 3MHGA 4QQ3A 1W0MA 1QI4A 4GPNA 1TREA 1QI3A 5T26A 3L21A 2VNCA 4JTLA 5A5WA 4GGHA 2R1PA 3CH0A 2GJPA 1JRCA 4UC5A 4GIAA 1UD3A 5HNUA 4TVDA 3WFLA 1DWGM 1Y5VA 1HP5A 4W5UA 4FOKA 5T91A 3DI0A 6A3HA 4PTNA 4AISA 1VFSA 4O12A 4ZQNA 1AVAA 2E40A 3TV8A 2PTDA 1XH0A 5M5DA 1EEPA 4OUIA 3CUXA 3H26A 3OPSA 2DU2A 4H4SA 3DK4A 4HA4A 4P5UA 2QAFA 3PUEA 2BV9A 2V30A 5DMMA 3RLGA 3VNKA 5H6HA 1C8XA 4S38A 1B3VA 1B57A 4N02A 4HNUA 5CSYA 4LUTA 2X41A 3T44A 4GA8A 3WX7A 1GVEA 3O8AA 1JRPA 4L9YA 4TOQA 1JPMA 3TJ4A 2DV0A 1NHQA 3BLEA 1AJ0A 2AL1A 1DHPA 2VZOA 2SFPA 4MLRA 3VNMA 5G5HB 3RCYA 4DY1A 3WF4A 3L2LA 4PL2A 3BCJA 4ZQRA 3VK5A 4ZOBA 4KF1A 4HTYA 3W1LA 3RNDA 1A3HA 3UW6A 1UR4A 4YNGA 1NWSA 1W37A 1Q6FA 1NFBA 2OYKA 4Q4QA 2PI6A 3WJSA 4PBGA 3EPNA 1UB3A 2QF8A 4M19A 2OWXA 4KCWA 3WQ4A 2VFFA 1ZNNA 4C6PA 3QZAA 4IJRA 4X2RA 4G5DA 1B90A 2E77A 1EWDA 1R9XA 3OQ8A 3TTYA 3WDHA 1BVZA 2BDQA 3M1ZA 1GJWA 4J9JA 1EZWA 1NOUA 3IIOA 4A3QA 2JF6A 4MM1A 1UD5A 3IGHX 4OOUA 3HGOA 1MW3A 2PWEA 1T96A 2RHGA 1Q1WA 3AHYA 1A3XA 3I10A 5CC5A 5CSUA 1JZ6A 4MB1A 4DIAA 3GU2A 2VR2A 4ZTYA 2CNCA 1XL9A 2NQHA 1MI3A 3DOPA 3QV9A 1JFXA 2AQVA 3W75A 1ME9A 3GO2A 3N25A 5EL1A 2BLEA 2VEGA 1ZK7A 3R8GA 4UNIA 3AS0A 4CU7A 3ARVA 2GQ8A 1QI2A 3CAWA 1BEUA 3BO9A 3MBFA 2FFIA 3GBDA 1Y8BA 4O0ZA 2C15A 1ZJIA 3ABXA 2WKLA 3RX3A 3OZPA 2CWXA 1KNWA 1TRDA 4IFKB 3ABSA 2A6LA 4M1RA 4JIRA 2Z2BA 2Z1SA 1F3WA 4DYEA 1FX6A 4NSBA 5CPTA 4LC8A 3URQA 1VBRA 4NZ5A 1VJIA 5DLCA 1IXQA 2Y70A 1AA1B 2XVKA 4GZEA 4EPDC 3MANA 3BAKA 4GIEA 3N17A 3OVRA 1US2A 5C70A 2X1TA 3IAQA 4ZA0A 4B5XA 1KFJA 2C0AA 1OC7A 1YKWA 3APYA 4GVGA 4XKYA 3WELA 4RR4A 4YWOA 4AZHA 1BFNA 3E74A 4HPGA 1W3NA 2BX7A 5DMLA 4JFTA 4Y9OA 2PWGA 3FHAA 3A12A 1GV4A 2O4MA 1GORA 4DM2A 4DZAA 5K2ZA 2IKJA 3TN5A 2OWCA 2WPBA 2W79A 2HVNA 4F2UA 1VENA 2NQLA 4RV8A 4PMRA 4ZQCA 1EP3A 2TRSA 5CZJA 3BVJA 1K02A 4J40A 3KVMA 3OBKA 3D0CA 3VOGA 2UZ9A 3AZRA 3TNBA 3ORWA 2PRMA 1FCQA 3P14A 3QGAC 2PDJA 1B3ZA 2AMXA 1TPDA 3OHMB 3W7KA 1FEAA 1A5AA 3EOEA 3ANUA 2BWGA 4PGLA 1E51A 1A5MC 1VBHA 4O10A 4D1IA 3U4FA 1UQZA 1RR2A 2QJJA 4RW3A 2IQTA 4BF9A 4EPKA 1LRTA 5FAGA 3ES7A 3KLKA 3T2QA 2I9UA 4UFHA 1LWJA 4PFMA 4UZSA 3ARXA 3P6LA 1IT7A 1ZKQA 3RCNA 4IXXA 3T4CA 5H8PA 4E8CA 3WK3A 1GTEA 3L8KA 5DELA 2Q8XA 3G22A 3W2NA 3GW3A 4NZ4A 3TU9A 2F9RA 4E3TA 1NFGA 4V2XA 5E9XA 1QHOA 1QU4A 3U5YA 1ZB5A 3VDAA 1Z42A 2OO0A 4RL3A 4L1GA 1W5NA 3L5OA 4C90A 1ZRQA 1RJRA 4AWUA 1YNYA 4BEUA 3P60A 1AQ0A 5IOBA 4LRTA 1K3UA 3A7UA 1BYBA 1SU5A 1V51A 1UROA 1F61A 3E0FA 5AHMA 5D04C 3N2XA 1HO1A 3H21A 4RJEA 5RUBA 3NO3A 2PBOA 4S3EA 2H9AB 1CNVA 4JTRA 4AFYA 3UR2A 3R0UA 1QPNA 3T42A 4AQLA 1VBGA 3DK8A 1LQAA 4F40A 4MUPA 4LOCA 3WLNA 2IPFA 3CQ0A 4J2PA 2YLAA 2WSRA 1G01A 3QR1A 2BC1A 5HR7A 1KM3A 4Z1YA 3FSTA 2VDIA 3B0VC 3G2GA 3VTRA 4AG0A 1DXIA 1BXBA 1TJ2A 4GQRA 4Y9AA 1S2UA 3KP0A 3SY8A 2P3EA 2GFTA 3EAUA 3L7RA 4CCDA 4FNQA 4KETA 1XI3A 5CEWA 3A5FA 1RCOB 4C6DA 5FEWA 1CI1A 1PZ3A 1U1HA 2YIHA 3NPWA 1EC7A 3BMWA 1EFZA 2XTKA 4ML4A 5D4YA 2VTFA 3W25A 4F2TA 4FSAA 4YTQA 3W28A 4GJ1A 2W67A 4D6DA 3CU2A 4B5UA 1M5WA 1M7JA 3TW7A 3WBEA 1PKMA 1W9XA 4O17A 3ZR6A 3CQIA 1C90A 2CBJA 5I24A 2YFNA 3NSNA 3B03A 4O53A 3UWYA 4IF2A 1SUXA 2XHYA 4NAFB 3S3GA 1S2CA 1Z6KA 5DT5A 2TAAA 2B4GA 3SRKA 1C8VA 3OG2A 3CIWA 1PTAA 1ZBVA 5CBJA 3A13A 2ZDSA 1KKOA 5FD0A 1KV5A 2XZ9A 3R89A 1DIOA 2W5FA 2FVMA 1UWRA 1YNQA 3K13A 1TVPA 1NWTA 1EKOA 4Z08A 1AZ2A 5EB8A 3WUGA 1XBZA 4B16A 3EDFA 4OU1A 3S9ZA 2DW6A 3OLDA 4AZCA 2CITA 4XV0A 2W9MA 2E09A 4L6DA 1CECA 4H7CA 3VZZA 2QULA 3S9IA 5EBKA 4NZFA 4H9ZA 1VLWA 4HIBA 4AZ5A 2HEJA 3Q6JA 2FZNA 5AC4A 2GUYA 3WF2A 1IZJA 4EF8A 4J3TA 1K9EA 3SCPA 3N3TA 2NX1A 3EOSA 2WLZA 8XIAA 2DT2A 2Y85A 3CL8A 3RF9A 3F2CA 3EGJA 2CBIA 3LRKA 4AZGA 1CGTA 3F2BA 3FCPA 1TPFA 3UWWA 2ASHA 3WNLA 4K7ZA 1QUMA 3PFRA 5K9DA 4QLKA 4JQAA 3SGUA 3VIJA 2IS7A 4Z2JA 2XH7A 3AU2A 3CHCA 5DXXA 5DCBA 4IMFA 1K8ZA 3BC9A 3PPGA 4JDRA 1FFVC 1TWZA 1QTWA 1UC5A 1H61A 3ZWTA 2O4QA 3QGVA 3VFCA 2YVGA 1HGYA 3COTA 1CW2A 4WVXA 3SECA 2FHFA 3GD4A 2B81A 1TIWA 5KZMA 1LOQA 1J5TA 3DAQA 3P62A 4HJFA 3QEZA 4QBXA 3UZXA 1KCZA 1Q6CA 4UQDA 3ZM8A 2ISWA 1K7FA 4PBEA 1NHSA 1OD0A 4JEJA 2YJQA 3THQA 3LEPA 1EPVA 2XN0A 1LWHA 4G7EB 1UD6A 1RVKA 1AMKA 1VR6A 4PBFA 1J6PA 4RPPA 4W93A 1TELA 3GXFA 5A8NA 3TVAA 4ZMGA 4P8VA 1FCVA 5B80A 4J4KA 4AWTA 2V8ZA 4IMCA 4MY8A 4M52A 1LTDA 1I8JA 4JHMA 3SSZA 3W76A 1XIIA 1H5VA 3GVWA 3AU6A 1JI1A 3FFSA 4UCGA 4JPGA 4FR6A 4TV6A 5AKQA 1GG1A 3P80A 2YCKX 1KW1A 1TYGA 3LCGA 3ZSTA 4C5YA 2OKOA 3PZVA 3MTWA 4R85A 4FMVA 1CXEA 1V4YA 2O9RA 1V6XA 3NQ2A 4IXHA 2JKPA 3F4WA 5B7ZA 2O7QA 4JIQA 4WGXA 4XZ9A 3CHEA 8XIMA 3HQNA 4H4YA 4LUTB 3RYSA 3S2MA 1XLLA 5C71A 4ZE5A 1U33A 1EL3A 2W55A 2XH2A 2OQLA 1KGXA 1GOIA 4JEQA 5AYIA 3SCVA 3AS3A 4GUJA 3LXDA 4A8LA 4X63A 3WKZA 2X2GA 4AIBA 3W7RA 3PN8A 4C7DA 1F73A 2GOUA 3LERA 3EB2A 3BXWA 1A4MA 3TC3A 5LIWX 1R8LA 2X05A 1QI5A 5AB3A 3GZAA 1X7FA 3HO8A 3VOFA 2YA0A 1TE1A 2V67A 1SGJA 3E0LA 1LRQA 5JH2A 1X1OA 3RM4A 3CPUA 2XH0A 5D2YA 2YLLA 4NZJA 3SR6B 5E5CA 3BAXA 5CG7A 2GZXA 2R91A 3NQDA 4U28A 1M1BA 2ACRA 4ZCWA 1FIQB 1O5KA 3TXVA 2Y7FA 1THFD 2G3IA 1H7WA 3W2KA 4ZQMA 4D8AA 3VE7A 5I3IA 3L5AA 3MKKA 3TQPA 2J25A 1TR9A 4A2RA 5HXMA 5CBBA 4Q4MA 2PDUA 5MHBA 2GVLA 5XIAA 1OX6A 3DECA 2YW4A 4JKLA 4OWGA 4MJMA 4O4VA 1PX8A 4LH8A 2ODOA 4PTMA 3MSDA 5A6JA 1FP9A 1JCLA 2C71A 5CH9A 2WJZA 5AZ0A 2BHYA 4LVFA 1JF6A 3QY7A 2QDDA 2PC8A 4NXKA 3AIRA 4O0KA 4YXGA 1M7XA 4MSSA 4XWUA 3E9AA 3RG6A 3NYZA 1ZDLA 3NVZB 4PSPA 5TD4A 4OZOA 1J10A 3KL3A 2FZ9A 3VKKA 3L4TA 2IQ0A 3E0IA 4ATWA 4QG9A 3RFAA 5LIYX 1JPHA 3GX9A 4JIPA 1S46A 3DFQA 2HROA 3HGSA 3VDHA 2CERA 1UH3A 2PWVA 2DH3A 4IG2A 3WF1A 1OT1A 3WK0A 2CYGA 4B3LA 4BI6A 2CLPA 4NXSA 1AH0A 4FB7A 3RLVA 2V81A 3L4WA 4K68A 4M5PA 2GGEA 4V1YA 3PSWA 2VEFA 3UR8A 4E3VA 5A95A 4QNEA 3QVQA 3NZGA 4C5ZA 2WJFA 1AD1A 3A23A 2PCQA 1J6OA 4MLJA 4Y7EA 3ITYA 1EGVA 3GU1A 4YYFA 4IPNB 2QCDB 1PIGA 4GXPA 2GVYA 2F6KA 4CVUA 3WMSA 3SB0A 4EQRA 1E0TA 3E5BA 2XJ7A 3MPGA 3H55A 4ZFCA 2VCCA 4L5ZA 1Q66A 1UWIA 2X7WA 4AUBA 2CHRA 3K1DA 4ATLA 3VKJA 3NGJA 2QCMA 2QVNA 1LVLA 1MRQA 1FY6A 4LS1A 2DEPA 3M0IA 2X42A 1RUSA 1TX0A 2DSKA 3TONA 4UTIA 4LT9A 4R7JA 1TJRA 4LGXA 4K8DA 3DUGA 2YDQA 1MQPA 1CLVA 1JG9A 3PTQA 4GY1A 3L4VA 1WUFA 1RJQA 4NL1A 3IVUA 2P53A 1XPGA 3S5SA 3ONBA 4BI5A 4DYKA 4RV3A 3WMBA 1EJTC 1UA3A 2PBGA 3B97A 3ZSSA 1FCUA 3GNPA 2VENA 3NXLA 3GG1A 3C61A 4JNZA 9RUBA 1EUAA 3N2MA 4B9ZA 1F9CA 1DQXA 2FHBA 4FO4A 3N9RA 3EWYA 1ADDA 5HANA 1I0DA 1ZXIC 2C8NA 1UKOA 3W3OA 2PPGA 1EF2A 1C8YA 5BNKA 3VX0A 1V5XA 2QS8A 1MO0A 3JS3A 5DRCA 4IGSA 1W32A 3I68A 4OVXA 3C6CA 2VQUA 3UQNA 1CEOA 1E6XM 3N14A 3G5EA 4NYUA 1OFAA 2WBGA 5A2AA 3XIMA 3CAVA 5H8UA 1KM0A 4A05A 1M04A 5I6SA 3BSGA 2YZRA 4W88A 1OINA 4JY8A 3VZYA 4AWSA 1ZFJA 1YBQB 1K9DA 2YL6A 4GXMA 2BGNE 3PANA 1IXNA 4B5VA 1WBHA 2AGKA 4HCLA 1PO9A 3LV5A 1WV2A 1LBMA 3GS6A 3WLLA 4O8AA 3S83A 4GBUA 4M29A 4D72A 3G0XA 1FTXA 1EGZA 1J2BA 2ZRYA 3IJ6A 2W3ZA 4GABA 4IP4A 2HISA 1ZSXA 3T0CA 3MB9A 3TXZA 1XRSA 1Y0EA 2HK0A 3NZPA 1OADA 2FHCA 3K5XA 1E3XA 2VL4A 1B2YA 4HSOA 4H8VA 4JN7A 3LPPA 1EXPA 1H3GA 1BZLA 3GHTA 1QO2A 1VQZA 4HN8A 3EXTA 1GESA 3B8IA 3IAPA 4PE8A 3NPXA 5DY3A 4JQ9A 3CB8A 4IX0A 2GQ9A 2OODA 5FEPA 1E6SM 5U1OA 1GQNA 3RITA 4CEUC 5A8GA 3O63A 3UF9A 3EWWA 3Q94A 2G3JA 3WLRA 4FXJA 1AW5A 5C6MA 1LQ0A 2W61A 3GIQA 3H2NA 5IXEA 5FSDC 1J0YA 2ZXAA 3RUBL 5KVIA 2Z1BA 1NFPA 4HJWA 4RZ5A 1D3GA 3PPFA 1OABA 4ZSTA 4WJEA 3DZ1A 5JQ9A 1DIKA 3ARZA 2FGZA 4FNPA 3CZ8A 2YKKA 2AL2A 3WLMA 4UTTA 3F03K 2OZTA 4MIMA 3S1WA 3RU8X 3VM5A 1CPUA 1D7FA 2Q6ZA 3UT0A 4H8UA 5G1YA 3FGCA 1VGAA 3VNZA 2X8HA 7ODCA 3FA5A 1R7OA 1EA0A 5G2WA 1NDAA 5I3DA 3WEOA 3A47A 1ESWA 3SY5A 2FTWA 2X16A 4NNBA 5A94A 3PBMA 1SZEA 4NF7A 3L66A 4D6JA 3OO2A 2DT0A 3C5QA 3W73A 4JXCA 1XV8A 1UP0A 3T2PA 3DESA 1EX5A 2VGBA 4AZCB 4WKAA 1TV4A 2Y24A 4PUMA 5DN1A 3NS1B 5FS8A 3LA4A 3AXMA 1PZ2A 2IMRA 4ZE4A 3AM9A 1EWEA 3W85A 4FLSA 1UQYA 3VIIA 4QDMA 1HJXA 5AVNA 5DX7A 4JS3A 4QSFA 5FF0A 1IT8A 2QPXA 4UWMA 1RK6A 2XM2A 4H41A 1KLYA 4P8XA 2PDMA 1OFOA 1AH3A 4LB3A 3TH6A 4CN4A 3QJAA 4LSBA 3HG5A 3KOFA 1GZGA 3ALGA 3HV9A 5FJOA 2ZZ3A 4P7RA 1NIUA 3ABZA 1YE6A 2BZNA 2I5GA 3VIKA 4WXZA 5A3HA 1GRGA 2VVNA 4J3UA 1EJXC 2ZZ7A 4GNKB 2YDRA 4W8AA 3UY7A 4QAIA 1V59A 1XLMA 3RPDA 4OQVA 4EM3A 2EQ6A 4AEOA 2POTA 3E3HA 1A5OC 3FKKA 4GBDA 1GPFA 4LB4A 3D3AA 4XB3A 2WMHA 1QW7A 3DI1A 4GI4A 4FOJA 1EP2A 3UXAA 5D2TA 3WJZA 4DEFA 1IEVA 4AVOA 3M64A 1EOMA 4W8LA 2I17A 4F9DA 2Z6IA 3CIXA 5E70A 5ER0A 3NQAA 1QPKA 2VGGA 3WBXA 3TSBA 1XGDA 1E4MM 2Y62A 4QDWA 1Q45A 3W81A 5C8BB 1S2TA 1E56A 3RO8A 4TO8A 4G9PA 1OK6A 2WVTA 4DJFC 2X0HA 1XQLA 5C7VA 4X22A 2G96A 3N4FA 2XG9A 4W8BA 5I79A 4E2BA 1UZ4A 3LCWA 1FWJC 3C2VA 4CQ8A 2J79A 2ZA2A 2FGLA 3PULA 2GSHA 3UWVA 4DN1A 4LQ1A 5A6TC 3H24A 1E4LA 3ARWA 2ZA1A 3WNNA 1ITCA 3IIZA 5XINA 4IP5A 3AMCA 4S39A 3R6IA 4GISA 1D2KA 3PBYA 3P0XA 1ME8A 2CLFA 1V93A 4AD2A 1DVJA 4QQUA 3H2MA 5CAHA 1E1CA 3O07A 1F4AA 2XWDA 3SN1A 4BI7A 3KBJA 5E0CA 1TA3A 1FHDA 4UTJA 4RPQA 4GI8A 3JUGA 4OV9A 5BU6A 2WHJA 2PLJA 4WGHA 2O9TA 1FDJA 1T6MA 2QHAA 2E3TA 2PGFA 2VKZG 5AC6A 4PMOA 4FR1A 3BL3A 4GVIA 2DZTA 1E9YB 2EAWA 4IQDA 3HBLA 1QJWA 3N73A 3R8RA 1XG3A 4GFIA 2HNEA 3I3EA 5HNNA 3C2OA 1CXFA 1RY0A 4XO6A 3G6LA 4CD8A 2YCLB 4DO5A 1OX4B 3W4RA 3II4A 4UNKA 9XIMA 2XVGA 1DNCA 1E15A 2IKHA 2OTDA 1Q1RA 2QAPA 1NEYA 2VOTA 3MKVA 4C1KA 2WPCA 5FIPA 2A0NA 4F0MA 1TPWA 1MSSA 4LA1A 4JTKA 1YDNA 5EMJA 2Y4SA 4HMEA 4GIYA 3A9BA 1UUOA 2YOCA 2CKRA 4UFMA 2DSVA 4KWVA 3OGRA 2FZDA 3WCZA 4ZENA 2Z1XA 4GKTA 1FEBA 5E6YA 3W02A 5G4HC 2ALDA 3RAOA 1F6KA 2OMAA 2DQXA 3W27A 3LMZA 3AN1A 3HPZA 2CW6A 2I56A 1WXZA 2NX3A 1W5MA 3W2JA 1LBLA 4KFNA 3BCDA 1H63A 2QJNA 4JNMA 1F07A 1NSJA 2P8BA 1SZRA 1TJPA 3OG3A 1XD1A 1DJNA 1W1IE 1VRXA 3N4AA 3N12A 5GNYA 3SRFA 2Q8ZA 1SW3A 3BAIA 4QR6A 4RNHA 3CO8A 5AYZA 3MCMA 3C0SA 2B7OA 4DI9A 3CMFA 1ISWA 1LYXA 2ZDRA 3EX4A 3ZT6A 5BMXA 3K2GA 4JQ4A 1PHWA 3C0LA 1UOZA 2F2HA 5HUOA 1A47A 4XBSA 1F6PA 3UG8A 3SFWA 2DZVA 1KC7A 2HPIA 1NDYA 3ENLA 3W86A 4UTHA 3K46A 4IG2B 2BOFX 1GYNA 3O15A 3QFBA 2DP3A 1B9BA 1X97A 5DBTA 1FWGC 3TSDA 3KBNA 3NQCA 3DJJA 2A3AA 1KFKA 2QW5A 1C93A 3RNMA 3G77A 1MOKA 2GR2A 4DI8A 1BYDA 3G24A 4I7WA 1GKQA 2Z1VA 2OZ0A 3E0VA 8RUCA 3MQTA 3CV7A 4YVXA 3DX5A 5CC7A 4K3ZA 4K8HA 1SJCA 4RLIA 4ZO6A 2J77A 1XLKA 3ID7A 3KOWA 2YA1A 2A3BA 1RQHA 3C2YA 4AX6A 4CKQA 1P6BA 2WB5A 4B5NA 4UQEA 4KMQA 2E1DA 1N63C 2CLHA 3H22A 2X0YA 3SRDA 1LJYA 4ZR8A 1W9DM 4I9JA 4ACZA 1TPC1 2FDMA 3HU7A 5A8OA 5D33A 3IJQA 1WO2A 4F0KA 3A24A 2HBXA 2YSWA 4HCHA 3FA4A 2ZOXA 3HMCA 3W7PA 4B92A 3QGKC 3UWUA 4MNMA 1OYCA 1EDTA 2V2HA 3VIMA 1W1ZA 6REQA 5JCKA 1ITQA 1HKWA 3T0BA 4Q8PA 2OOGA 4HA3A 3QHNA 1PX4A 4RE4A 2BY0A 4HSHA 4LRSA 5IM51 4S3DA 4PCSA 3SUUA 3I65A 1FO4A 4TV5A 5D9OA 3UYIA 4J2MA 3LBOA 4KWUA 3UXLA 2WMIA 4Q7NA 3VGHA 4GUIA 4H8HA 2AMGA 3CC1A 2BBFA 3ES8A 4PC8A 4ZO9A 4BV6A 4YTUA 2ZBTA 3L65A 2RKXA 3USBA 2C91A 3PPCA 3T2OA 2EG6A 4PTVA 3BICA 3SCRA 1V02E 2ZZCA 5C9ZA 3IGXA 3DH9A 2GSJA 3MSRA 4MG4A 3MI6A 4M6VA 1IXOA 1XX1A 4JKMA 3H2EA 4AHOA 3HPFA 2W3SA 4NHVA 4GE8A 1S5VA 2FIQA 4JTUA 1V3MA 3FLUA 2HCVA 3NEVA 2W27A 3PZMA 3M6DA 1DWIM 1QHZA 4W7VA 5CJ5A 3Q45A 2VEKA 4M6UA 4Y9MA 2X2YA 4JTHA 6TAAA 4GK8A 1DKWA 2IKGA 5M17A 4K6AA 1MXGA 2BGQA 3MUAA 1OF8A 3V4BA 3IACA 4A3HA 3GVVA 4Z1DA 2GR3A 1HJVA 4CD4A 2YYUA 1EJWC 5DMYA 2ISSA 3CO4A 3NO1A 1VEMA 2F61A 3BAJA 4CU8A 2PGWA 2XFRA 2HE5A 1P6CA 5JIPA 4UMBA 2ZZ5A 1V3LA 3SCQA 1J8VA 1E43A 2TPRA 5BOOA 3EZ4A 4Z2IA 4EF9A 4EX4A 2Z25A 4IQJA 3WQOA 3W1AA 2CCRA 3ZFHA 1UWQA 3DYMA 3FSUA 1ZMCA 4YS1A 4H01A 4I9MA 1RBOB 3TIMA 1D3CA 1RALA 2ZTJA 4TX9A 4H4VA 1TUFA 5ABTA 2J7DA 4AD0A 3M5XA 4QXIA 1SZFA 4UTUA 3QV8A 4DJDC 3NR0A 1QNRA 2W3RA 4QJ5B 2WPFA 1EDQA 3FGCB 5AC8A 3VD5A 1MQQA 2ZZ0A 3QZEA 4NY2A 1NQKA 2VDHA 4JGDA 4JZ5A 1DTUA 1V6VA 2FZ8A 1TFVA 1VZWA 3L2IA 4JR5A 2P5NA 1UZDA 4HHMA 4LAZA 2G3FA 1HW6A 4FX6M 1TJ0A 3VCNA 2R1KA 3WUBA 3N6JA 3MO7A 2C3DA 5KETA 2JEQA 4B2DD 2E68A 3ZR4A 4O1AA 3HZ3A 1OQFA 3IGSA 1S3TC 5LA1A 1M7PA 3WD0A 1GHSA 4GUGA 1OHLA 2CEQA 3VD3A 4F2BA 1HL8A 1NWUA 3BLDA 5G5IA 4IUGA 1T7LA 3FDGA 3ARSA 3DGRA 3M7SA 5GJPA 4EWJA 3ARUA 5A6BD 3UEQA 1X38A 3GNNA 3UWZA 1C7TA 2R24A 3A9IA 3CGCA 3BMVA 2YBUA 2XGZA 5DF0A 1BVNP 3H4GA 3CZGA 3DK9A 2PP1A 4WRHA 7ENLA 1K6AA 4ICMA 3WK2A 2FPTA 2BMBA 3BJSA 4U2ZA 3H7VA 2W4XA 2C19A 2JKEA 1BG9A 5K9XA 1L9WA 3KFTA 1PBGA 3FAWA 1TV2A 3T78A 1FWEC 3LU2A 4LX4A 3GAKA 4EACA 4WCJA 3WD4A 3UA4A 3B9DA 1GEHA 2RFGA 3MI2A 3N19B 1E72M 1EYEA 1E0WA 1QFEA 2PODA 2E0PA 4LCQA 4R5EA 2PB1A 1U2YA 3FKRA 2L5HA 2NXGA 5CCZA 2V9DA 3W7OA 2VFIA 1X39A 3Q65A 3CZKA 4PMYA 4HTBA 1TRIA 1BYAA 5CPOA 3S5NA 3W22A 2DUZA 3CLWA 1UW9A 4IUOA 4N0RA 5IDZA 1FWTA 4KS0A 1H41A 5H8MA 3O7UA 3CMJA 1OWQA 3TUUA 1AJZA 4TXEA 3FA3A 1N5XA 4G1NA 2WQDA 3MV11 4ASTA 3P8JA 1WZMA 3N2BA 1BG4A 2WKJA 2I14A 3IIXA 1XM3A 2I7GA 3C8FA 4J35A 1VKFA 2VMFA 3PG6A 1FWWA 1CGXA 4AHQA 4ROPA 3O05A 4HGXA 4B3ZA 1JUKA 1GJPA 1M6IA 5FJJA 2I1OA 2VZSA 4FLRA 5D32A 4CNNA 2VCAA 2YAUA 2C14A 3WQVA 2DIKA 1HQTA 2WOQA 4AXNA 1SB3B 1J0ZA 2YA2A 3PZTA 1DEDA 3O0FA 3TCSA 2QEZA 2WPGA 3EA3A 4LFYA 5HWJA 3NEHA 5HATA 4GYJA 1H5YA 4KRUA 1XP3A 1X98A 3AQUA 1SR9A 1FDZA 3EMZA 1Q2SA 4B91A 3EWDA 4XD4A 3TWBA 3V5FA 4TU1A 1EBGA 3R5EA 1K8CA 3CTLA 4N7QA 2XVPA 2KAUC 4Z2LA 4F8XA 3W01A 1TR1A 2FB3A 4WSJA 4XK2A 1WXYA 1TA3B 1FWBC 3PB2A 3W6YA 2NSOA 2TYSA 4GLEA 4MZYA 3DGZA 2Z0IA 4O11A 1U5HA 3WL0A 5G1TA 4ZZ9A 4EQSA 1OG0A 1GVFA 5AN7A 3BAWA 1RV8A 3KXQA 4QGCA 2WM1A 5C5YA 3FEQA 3HA1A 1A4LA 5G4WA 4OV4A 4YTTA 1NDZA 3SM0A 4E2OA 4ALDA 3TN6A 2XWEA 3WDRA 2LLEA 4Q22A 1CX9A 1XDLA 5CG0A 4LIIA 3WNMA 8TIMA 4XD5A 4JN8A 3SQSA 5LA2A 4WXYA 2AGTA 4GOAA 2PP3A 3CL7A 4K1WA 1NY1A 1M3UA 1YDOA 2QYGA 4Q4RA 2QIWA 3DFPA 1DPMA 2VVSA 3VMNA 4HMDA 2A1YA 3P84A 2AQOA 4HNVA 1E0VA 5A6MA 4QISA 2CBUA 1VDVA 4JTSA 4QX4A 4FEZA 2OYLA 5FESA 2PU1A 4O1BA 4RXFA 4Y8FA 1KM5A 4YWIA 4CUCA 3MI3A 3RCMA 3JVAA 3MO4A 1VEPA 1KRAC 1IIGA 5HNTA 2WC7A 3H8AA 3EB3A 3VXGA 4JN6A 1HJUA 3ABRA 3ITXA 3UZYA 3VDBA 1PL9A 2Y1HA 4JHOA 1LUCA 5EU9A 4CD7A 1BXCA 4GI9A 1MUMA 3GHUA 4UOZA 2J24A 3QH2A 4FXSA 1L8PA 3RLUA 5MKGB 1B4KA 3CH9A 1K7EA 3WQEA 2OR2A 1XC4A 5EFFA 3E1F1 4A4AA 1AMYA 7CGTA 3AMDA 1ECEA 3M41A 4X3ZA 4MF4A 4XD6A 5TAOA 3HV8A 3VNYA 2P50A 4YLWA 3FX4A 3VMOA 3AYRA 5FSEC 1XBYA 2ZZ6A 5LNWA 2E6DA 1U22A 2E5CA 1GETA 4AEFA 1A5BA 1ZPTA 3PBVA 1CCWB 4L64A 1KRBC 5LSMA 3HW2A 3W23A 1UP2A 5C2XA 2QCLA 2WNNA 3N2TA 2X8RA 5JIWA 2CPUA 4LWWA 2JEPA 2A7RA 3UJEA 1PHQA 3PZQA 3KVKA 2RDXA 3V16A 2YFOA 3IWPA 1SW7A 3NZQA 3GR8A 3ZOAA 3REQA 1VBJA 4C6IA 1LT8A 3MMUA 4AWEA 1W5OA 4N4PA 1VAHA 1LOLA 4PCPA 2VUYA 3MJMA 3HRDC 3SIZA 3CT7A 3LS9A 1G1YA 2D0HA 3WN6A 1F8WA 4BCEA 1MW1A 3BH4A 1GJUA 1PJ9A 3PZIA 1OFEA 1QOXA 3W1QA 1WDRA 1TYPA 4US6A 1S3HA 3CTTA 3HG4A 3B9JB 6XIMA 5HR6A 4FNTA 1FHLA 2E9LA 3KVJA 2PZNA 2PDYA 5H2ZA 3GNXA 1MRAA 1IGWA 3V5CA 4HNCA 2WM0A 3AXIA 3WNPA 3WFZA 5D2VA 2Y2WA 1XH2A 3PTMA 2QPUA 4HOXA 4GQQA 4B9YA 3EKLA 2VWTA 1YQZA 3RILA 5I5RA 3BLLA 4DO4A 3STPA 4KFOA 3M5YA 2C1HA 4MKSA 4R3UA 4GNVA 2PP0A 1XSKA 1YEYA 5M03A 1JEZA 1ZL1A 1B1YA 4O28A 2V63A 4EVZA 3U57A 1J18A 5LIXX 1XANA 4YPJA 1NJJA 3W26A 1YX1A 3VVGA 4HU8A 3W7EA 1BSLA 5AECA 3AHTA 3N6HA 1LT7A 1XSJA 4FX9A 2NV9A 2EQ9A 3KDNA 4WDUA 1GGOA 2C0HA 3VINA 1T8XA 5BXSA 4Y9NA 1DOSA 2R94A 5IHRA 1I9CB 1XFCA 3T40A 1ONXA 3B9EA 3PF3A 4A8IA 4WJXA 3OOQA 4DX3A 2RGLA 1L6YA 3BG9A 5D2XA 4DXVA 2Z2UA 3ATZA 2GL5A 3AJ7A 3GSMA 4ZXLA 3W9ZA 5FKYA 3VX1A 3MKCA 3VC6A 1AL8A 1QNOA 3NFUA 2XN2A 1XLDA 3TFCA 2F7FA 3EOUA 4A3RA 1FWAC 3STEA 5LXXA 1GVRA 4NQ1A 2QCCA 2V3FA 1SPQA 4W86A 5E93A 5CKSA 3OZYA 2QQ6A 4GINA 1F3TA 1EJRC 5KSWA 4CCEA 2G3NA 4L7ZA 1GSNA 3VIFA 4GHRA 3CJPA 3R12A 4Q33A 4UTWC 4Q4PA 1KXHA 4D1JA 4YL2A 3BZJA 2D24A 3CZLA 4MOZA 4Y90A 3D5HA 5HQMA 1QRQA 3NQEA 3W1NA 3KP1A 1E9IA 3UERA 3LPOA 1KXVA 4J3VA 2PWDA 4JIIX 1JZ3A 1KQZA 2J6VA 1JRBA 4RE2A 1OM0A 4HQVA 3I7RA 3XISA 4HPJA 3EDDA 4WY0B 4W4QA 2YQUA 3UNTA 1UJQA 2FJUB 4HYVA 5J5DA 5BOEA 1OZMA 2YBVA 3U6WA 4RDZA 3VNIA 2Z27A 4AXKA 1D8CA 1V7AA 4NRRA 3FJLA 1CWYA 2UY5A 3MS8A 1F05A 3LI0A 4WR3A 5TQLA 1N60C 1FFQA 4UUIA 1HKJA 3TDFA 1JZ7A 3WFAA 2GLKA 5LGXA 4CLMA 4ML9A 4CNSA 2P1FA 4RDVA 2GQAA 5JCIA 5K3VA 1U5VA 1M01A 4HHPA 2C16A 2FZBA 1NAL1 3K1GA 4JAWA 1JPDX 3EX1A 4W5ZA 4BQ4A 1EGMA 1FWSA 1Q7ZA 4E5TA 4C6OA 4PUUA 3QQ1A 1N8IA 1G7UA 1ENUA 4ZQPA 5CGQA 3A3WA 3DCPA 1H7OA 3M16A 5HPCA 1P6WA 3VKCA 4BJHA 4O13A 1V3IA 2W0UA 4QNWA 1JZ5A 3ZJ6A 3I4KA 3XINA 1E73M 3PUOA 1XRVA 3OBEA 3W72A 2ALRA 2X1SA 4QE1A 1V8EA 4JQ1A 4REQA 3VOJA 1N7KA 1S2AA 4WY0F 1EO7A 1TVNA 3MHUA 1GEQA 1WAUA 4LUIA 3S6OA 2XISA 1ONWA 5AZ1A 2OT0A 3H4XA 2WMFA 4WHBA 4AY7A 3OC4A 4JTIA 3MV01 2J7BA 3WDPP 2PSNA 4EPBC 2QCHA 3GC2A 5HULA 3T0TA 3C4UA 4QITA 4M3PA 1ZUAX 1IWPA 1GZ1A 4DJEA 3NVTA 3GIPA 2CZVA 3TROA 1UMYA 3UZWA 4F0LA 3WYZA 3GDTA 2O55A 1KTNA 1VFLA 3FY1A 1EHAA 1A5UA 5BZAA 4MY9A 4HA1A 3E12A 1YPIA 1XKYA 2QF7A 3MMTA 3W38A 2C1GA 1YMYA 4EMWA 4CGTA 1MWOA 1Z3NA 1KR1A 3O3RA 4OIFA 3KAOA 4KEMA 4KCUA 3AXXA 3B9AA 3H23A 3WH5A 3UR7A 7REQA 3VKAA 3MDUA 3AHZA 4NX5A 3HG3A 1W1YA 3UZZA 3N2CA 3UPMA 1S5TA 3GD6A 5HJLA 2DVUA 1XLJA 1UKSA 5D05A 4QM1A 1W2VA 1BTMA 3TZFA 4Y9PA 1Y7VA 3UESA 1CLXA 2XGIA 4O16A 1X2HA 4IIBA 1ZQ5A 3TSMA 1NTHA 1PEZA 3LYEA 4FXRA 3HOJA 1VJSA 4NEVA 3KS5A 2VP8A 3SI9A 1CLKA 2DUXA 1YPXA 4ZO8A 3V3WA 3F5JA 3E02A 3MT1A 2YPIA 3RM9A 3AUOA 2GR1A 2ZRXA 2D2HA 2GJNA 3LGEA 3GDLA 3W1MA 3RGTA 1UKQA 4QJ3B 5IHSA 4GFSA 4LF2A 4C91A 5D2WA 3A4AA 1Q63A 1VPYA 3U2OA 1US3A 1ECQA 4BF5A 2BXVA 1FH8A 1B3YA 4DWSA 2GVGA 2XGBA 3IRSA 4I3GA 4QAWA 3NQ7A 2GDQA 4H3DA 3NSMA 1WNOA 4APNA 5HQLA 3TOPA 3UWQA 1RD6A 1W8GA 3N2OA 2NUXA 3M0LA 4FPSA 1EB3A 4KQNA 1WQ5A 4UQBA 1UKTA 1HVQA 1XIGA 4KCVA 1Z44A 4JBRA 2NQJA 2EKGA 4IP7A 3DBPA 4MY1A 2AKMA 4A22A 3LHYA 5I09A 4QG6A 4OE7A 1S5NA 5DO8A 3KBMA 1RCXB 3OVPA 1E1FA 1NDVA 1X1ZA 4K8EA 3CUFA 3LSBA 3VOCA 1WDQA 1MMFA 5IBXC 3R0KA 1VCVA 1O66A 2Y89A 4NKCA 2A3LA 2CFYA 4ECLA 2C3CA 2Q09A 3V1PA 4EAMA 5I00A 3QZ6A 4LNYA 4AC7C 4E2VA 2GJXA 1DE5A 1TPVA 1R2TA 2VFHA 2R82A 2B31A 3ZR5A 1JULA 1TCDA 1XLAA 3MZ2A 2E9BA 3TC6A 1H7NA 1CB2A 1F2JA 1XIFA 4Z42C 2VGIA 1CXIA 5I7GA 3TZNA 5T9BG 3B06A 4FS9A 5J8LA 2WW5A 4JTQA 1Q4WA 4JQ3A 4OTKA 3GRSA 1YXYA 4OJYA 3T0DA 2XU2A 3VD7A 3V7PA 1QNPA 1BF6A 1A0CA 1E6RA 3URBA 3TMQA 1LUCB 3T0AA 5ABEA 3WDJA 3TMLA 1PAMA 3H4KA 3NRZB 1XLGA 5GJNA 1J11A 3BG3A 3WG6A 1XR2A 3FYPA 4DPQA 3M5ZA 4JX4A 3V75A 3VKDA 3WEMA 3M4HA 1R46A 1XGEA 3HGJA 4RZBA 1BTCA 3WZ0E 2GK1B 4D8LA 5F1VA 4Q32A 1IWAA 3BLKA 1NU5A 2BVWA 2EPHA 3V1HA 3WQGA 5SWUA 3WD3A 4CQCA 3DG6A 3SR7A 3EX3A 3KM8A 4QP0A 1MDLA 3MY9A 4GUFA 1FBAA 2Z29A 3ABOA 3NA8A 1BWKA 1WKDA 3AIUA 3KOZA 4KEUA 4LCRA 1HZYA 1TZ9A 1EA9C 5I78A 4LV9A 2CLOA 1O6IA 1HTIA 2XIOA 4EXQA 2VEPA 2QUNA 2FGBA 4DWDA 1V3JA 4V33A 3WJYA 3PP7A 4LYPA 4HMNA 3REQB 2Q01A 2WSPA 1W1PA 3VAVA 1WP6A 3N6QA 1RH9A 3W7IA 5U25A 1QO5A 4PMNA 4G8TA 4O0QA 5D8WA 3C2RA 1YRRA 3CAKA 3ZMRA 2VELA 4ADUA 4BWLC 1JAEA 3C3UA 3T7VA 5REQB 3TJXA 3Q58A 4L4OA 2VEMA 1FWIC 3CT2A 4PTDA 3C86A 2V2CA 3PM6A 3TFXA 5B7YA 2VC9A 1DJGA 4NJJA 2JGQA 1H6VA 1TQXA 3CWHA 2O92A 3BZGA 1RLDA 1SZNA 1XINA 3U3HA 5DBUA 1B3OA 3WQ8A 2Z2AA 2Z00A 5CJNA 1Z8AA 4RKAA 3MUZ1 4XAGA 1XGZA 1O7AA 4HT3A 4NAEB 3BK0A 5FF3A 4AEEA 3NQGA 1XYBA 1PKNA 2NWSA 3B9NA 3PAOA 4QS5A 1ZGDA 1EF3A 3MVIA 1CXHA 1W3TA 4HNOA 2PLMA 2VJXA 2IUZA 4F0HA 2TPSA 3GUGA 4XAPA 3W1TA 3ELFA 3WLHA 2OGJA 3ARRA 2FVKA 4U4MA 4W7WA 4L80A 2Z7KA 4N9BA 2ZX5A 3P5ZA 4AHPA 4LANA 1RAKA 3IGUA 2WBAA 1UR8A 3PBWA 4QJ1A 5HUPA 3L23A 3LV6A 3S47A 1Q4NX 1E4IA 1OEPA 3R4IA 1V6YA 1BGGA 3HPSA 4C6NA 1H7XA 2YYTA 3G8RA 3GYEA 3CUZA 1C9DA 3AFBA 2QJGA 2WYSA 3OU8A 4EIVA 3ZWSA 2ZIDA 1OFDA 4FNSA 3V18A 3M0XA 2UBPC 3K8LA 5EPDA 3DJGX 3PG9A 2ZC1A 3VO0A 2ZUMA 3A6OA 2ABBA 1XYFA 4FF7A 4DXKA 1EIXA 4DF2A 4Q4SA 2BNJA 2ZUSA 4GVHA 2P0OA 2XVLA 3LG3A 1IWBA 4HYRA 4AZ6A 3IPWA 3H70A 3AIQA 1JJKA 1W91A 1LROA 4ONVA 3EDEA 2INFA 3NAVA 3CASA 1LCOA 1M6JA 3MWAA 1E70M 4IQLA 3SQMA 3GY1A 1DTNA 1EJVC 4ORIA 1V6TA 3FAXA 1WDDA 1E0XA 4H7ZA 3SJ3A 1V08A 2WVVA 3UJRA 1CYGA 3G1RA 1TG7A 2DJXA 2AQWA 4JCLA 4UTFA 3ZJKA 5BROA 3UYCA 2PAJA 3THDA 1JGMA 5F1UA 1ZJHA 4DXXA 2IQDA 3NSXA 3IJIA 1B0IA 4UFLA 1Q8AA 1RPKA 3C3NA 3UG4A 3MP4A 3EA2A 3P93A 3DBNA 1X1NA 1DJQA 1N2VA 4MADA 5TBOA 3BW4A 2GUUA 3L0KA 4IMEA 3T55A 3LGDA 3ZVHB 4S2CA 3DH7A 3TR9A 3U5UA 4D6FA 1CB7B 3CBWA 4V27A 3Q37A 3L12A 1JR1A 3OJGA 4Y96A 3TK7A 2JBMA 3PNZA 2PDHA 3P82A 5FA5A 2W62A 2OB3A 4G7FA 4X0NA 1R9ZA 1E5NA 3IRDA 1PVNA 3WNKA 3KTSA 3TP4A 2V82A 4L4PA 1A50A 1TKKA 2BOGX 3NVWB 2J6XA 3IUIA 4QHRA 1J93A 2OJPA 1J0KA 5F2IA 5CZKA 4GC3A 3TC7A 3TYCA 4NASA 4CQ9A 2QGHA 2PU0A 1F7BA 1F4HA 3NL2A 2HMCA 3GRIA 4UZUA 3VGEA 1GG0A 2FH6A 2VDGA 4PCTA 1U30A 4EK7A 4GCXA 1EJUC 1A3WA 1GKPA 3VUSA 1R3TA 1W6TA 4GH3A 3R07C 1SJDA 3CQHA 4PMXA 1RA5A 1F6YA 3C56A 1XLEA 4UQAA 4MYXA 1SR0A 1HJSA 3OIXA 4LTSA 4C6FA 1B30A 1R3YA 1A5CA 2WANA 4QCFA 1Q3NA 4ZQOA 1XLCA 3QKEA 4C6CA 3WBAA 5T8GA 3EMQA 4LVDA 4HB7A 1XLHA 1SMDA 1G0CA 3CMGA 3TR2A 2HS6A 1K4QA 4DUOA 1S7MA 2Z1WA 5HMDA 1UIPA 3GVGA 2D0GA 4HU4A 3OW1A 1HP4A 2PTYA 1G4EA 4A3YA 2TSYA 4MWAA 2F84A 3FS2A 1XIDA 3S5ZA 3SBFA 5A2BA 3RRXA 2TODA 1X6LA 3G1XA 3TYZA 3LHWA 3W53A 4QCEA 3AIVA 2HBVA 5G2HA 3IJLA 1FWRA 2XM1A 5JBEA 1VFHA 3JU2A 1TPEA 2R8WA 5I3JA 3HJZA 3CWNA 3UD6A 3ABQA 2RDTA 1OB0A 2ZUTA 2OPJA 4A2SA 1ZBWA 3CHVA 3CGEA 2EHHA 3IK4A 3S8HA 3DFNA 2VXNA 4QEHA 3LMYA 1GEUA 4B4HA 3E5PA 3CXOA 1T40A 1UPMB 1O4UA 1UR3M 4P7NA 4TVCA 5C2GA 5BCAA 1VF8A 2OX1A 4GVFA 1JZ4A 2OEMA 3C2FA 2XIBA 3GE7A 4LS2A 1TV7A 1FP8A 5E1QA 1XDMA 3ANVA 3S6DA 1DWHM 2PFHA 1R86A 2F2KA 4PUKA 2DSWA 4CQDA 3MUY1 9CGTA 1VYPX 3MZNA 1VYRA 2C79A 2ZUNA 2E28A 1OJXA 1IEWA 4MPKA 3B3DA 4Q6JA 1AJ2A 1GHRA 3W24A 3BV7A 4J57A 2WC3A 2HJPA 3CYJA 1JNDA 2E6AA 3L4XA 4FP1A 4U31A 3W71A 4UR9A 3QN3A 1TUXA 4F0RA 4DO7A 4PRRA 3TLQA 3QMRA 4LVGA 3TE9A 3LOTA 2VQTA 4JHZA 3VM7A 2ISDA 2BHZA 1MO9A 3WH9A 4JFUA 1VRDA 4DWSB 3AIEA 3PG8A 3GXDA 4FNRA 2W91A 3MW7A 3VPLA 5JH1A 2Q3OA 2WCGA 4L61A 1PIFA 3ICJA 3H2CA 4H4PA 2BFGA 4NJKA 3CL6A 1J12A 1KWGA 5BWFA 3R2GA 1KBLA 4N4QA 5EMLA 2CLLA 4I7VA 3BQ5A 2D2JA 4LEQA 1LLOA 1R3RA 3T4WA 3GG0A 1NELA 1P1MA 2VO5A 2E5AA 1NARA 1DHKA 3EANA 1XRFA 1OGGA 4UFIA 4CN6A 2JALA 3OGSA 3GYCA 1W9BM 4CD5A 2OQYA 2JK2A 3H54A 4HCDA 3CZJA 1QW8A 3DHDA 3C8NA 1LORA 2YXOA 5E6ZA 2ZUUA 1IF2A 4YTRA 4JDBA 2D1ZA 2PTXA 3DC0A 4RZ6A 1EEXA 1XCXA 2ACUA 2NQZA 1MW0A 4B5TA 3GVRA 1K6WA 2JK6A 4R7WA 4TVYA 1GRBA 2Y7GA 4C1NA 2CBVA 2GJXB 2PDKA 2CFFA 3JRKA 3HQOA 4GQ0A 3GG8A 3U9IA 1NWRA 3O6YX 1QW9A 3QR3A 1E9LA 5EMYA 4PRTA 3D46A 3TTQA 2BY1A 4ERIA 3G3DA 1MZRA 3W1XA 4UR8A 5EYWA 3S5OA 2QVHA 1LM1A 3KTXA 3ZVIA 2FJKA 1ZAHA 5M3WA 2P76A 3O6CA 1N5WC 3FVDA 3LLDA 2ZRUA 4LEFA 5GJMA 4FK9A 4IPJA 3KCLA 4U3AA 2CHOA 5JVLA 2ZTKA 3KL0A 2R14A 2VEIA 1UCWA 3GHRA 3HF3A 2VZUA 4MJ4A 4GCAA 4POCA 4AIOA 1BYCA 4Q8NA 3OVGA 1AFSA 3GXMA 3S6TA 4FLOA 4Z2KA 2GDVA 3UJ2A 2FH8A 3QQWA 4PYSA 1W9UA 2EBNA 1VEOA 3WLJA 2W63A 2QV4A 2BGSA 4GACA 4WK9A 1J2WA 4ERGA 3UBPC 1Z9AA 3PNUA 2BHUA 1OVDA 4IFKA 3VYLA 2EO7A 1JYVA 1ZALA 4A29A 3LTYA 4NYYA 3ZIZA 3EA1A 2P8CA 3E2SA 3LY0A 4EXAA 1JGIA 3M46A 2INZA 1K4HA 1NF7A 3NQFA 4X9SA 3LXCA 1V0KA 3KWXA 1QPQA 3WLTA 1G4PA 2DVTA 2J78A 4I5UA 2OOFA 3MU7A 1ODUA 2VC7A 4UOQA 2VM8A 3P67A 1JROA 1TV3A 4B5WA 1KQYA 1OYBA 4PB4A 2PCEA 2WOWA 1EOKA 4LBUA 3P2VA 1FFRA 3AAMA 4PMUA 3RMEA 1ELSA 1ISVA 5HNRA 2D73A 1EHNA 2UY2A 1DWAM 3WDIA 4KBXA 5CPQA 6TIMA 3ZS4A 2E8YA 3EBVA 2H90A 2ZWZA 3W83A 1EP1A 2NVKX 1IEIA 1XICA 1ITUA 4EKJA 2I5QA 3A64A 4GY7A 2Z24A 1XIMA 4LAOA 4WSKA 2YVJA 1A5SA 1GVQA 4AIUA 4B90A 1AH4A 1D9EA 1R3SA 3AJXA 3OA3A 3ZO9A 4K37A 4Z1AA 2IXVA 2XIJA 2E9MA 1A5KC 3G1HA 5KVHA 1OBAA 1DWFM 1Z32X 2QJIA 2Z28A 4FALA 4H8NA 1H11A 3KHJA 4NI3A 1PDYA 1FFUC 1GQLA 3VFLA 3M0KA 3W7QA 2CDUA 4D9PA 1S2WA 2G41A 3QYSA 4I5RA 3IVTA 3ITCA 3ETRB 3CUIA 3WQ5A 2QPSA 1GVYA 4UFJA 2YW3A 4U5KA 2ZVIA 1GQKA 2X0SA 3AYSA 3LNPA 1ALDA 2R1NA 3URAA 1K7XA 1F3XA 4XUYA 3PUGA 3TJIA 2E6YA 1XYAA 2ZVRA 2PWFA 3MP3A 1AQMA 1RVGA 5FMHA 1FOBA 3PWIA 1B5TA 1FRBA 4L56A 3Q4DA 4LW7A 4AF0A 2YDSA 3EXRA 3VD4A 4DRSA 1DJHA 3NOYA 1UKPA 4OHQA 3FJ4A 4WX2A 4LPCA 3DU0A 5A8QA 1P0EA 2V5JA 2OZ3A 2NV1A 3H2FA 1TB3A 5FEZA 3EKGA 4CNTA 2Y8UA 4HVXA 3T9PA 1QBBA 2PS2A 4OT7A 5ABGA 5BXRA 1JDAA 1F3PA 3BWWA 2ATSA 1WB0A 3GNOA 1H51A 2VRQA 3BGAA 4S3JA 4GX9A 4AD1A 1Y65A 2XFFA 4LCSA 3NPVA 4MZ1A 4Q8WA 4B4FA 2H6RA 1P0KA 4HNTA 1K9FA 1A49A 3PZGA 2WO5A 1S1RA 2NXHA 5AHFA 4WEVX 1JNEA 1OFQA 3T08A 3SDOA 1XS2A 3IUDA 3KTCA 3EOLA 2ZADA 4L4MA 3MYPA 2WVVB 3E0WA 3WD2A 3E6EA 2ZX9A 4QEEA 4LUSA 3A7AA 3N4EA 2XIIA 1PTGA 3URNA 1XDJA 3PFMA 4Q8VA 4GD0A 1M03A 4EWND 4PTWA 4HU0A 3NYDA 2CC0A 3SUSA 4OECA 3OODA 1FA2A 1DJIA 1UYQA 3EPMA 1EC9A 5HWMA 3KRSA 2YL5A 4XKYB 4KCTA 4X0VA 2AKZA 4NNAA 1LP6A 4KH2A 4ZODA 1F8MA 4AMCA 3W7CA 4Z1BA 1RP9A 4NJIA 4Z0SA 4YYCA 1ZHAA 2C7FA 3BMXA 4D6EA 3NUKA 3I6TA 4JTGA 4DZIA 8A3HA 4Q8OA 3RX4A 1ZAJA 4NJGA 3ITVA 3U7BA 3MMDA 1C8QA 3SUTA 5KZDA 1P5BA 4GRTA 3GDKA 4RUBA 5EBUA 5LNSA 2BXYA 3PS7A 3RJXA 4MYAA 4NAFA 3S2JA 3H6OA 1NP2A 2R1MA 1TWIA 3POHA 3EKZA 3SCSA 2B7PA 2Z4GA 3HN3A 3UJFA 2QXWA 5E0FA 5CZSA 2NUWA 1C7SA 3F4CA 2X8GA 1R3VA 1X7IA 2NQ9A 3TTOA 2RH9A 5HA7A 3NQMA 2G8ZA 5A1AA 3QFAA 3B8VA 3N11A 2Y7DA 2W54A 1UMLA 1R30A 3DERA 1WKYA 1ICQA 1WZLA 2ZE3A 1BKHA 3UZJA 1I1WA 3A3XA 4Z0JA 2XN1A 4H9VA 2WZIA 1NOFA 4FI4A 5LHEA 1Q8JA 4O1DA 3KHDA 1MZHA 4MWAB 4EMIA 4TTUA 5CGTA 2BG5A 3N9KA 1QWKA 1L2UA 1R38A 5JRBA 1LOSA 1TWDA 1LQ2A 5EGRA 3ECQA 3NQ8A 2I9EA 3F1QA 3GK0A 1GXFA 3DHFA 2YBTA 1KFCA 2J27A 3EB4A 5LZLA 3O6DA 1TTJA 1AW1A 1E40A 1GOWA 4ZB5A 5LXEA 2OO6A 2D3LA 1BD0A 2NUYA 2WJEA 2BP1A 3H2AA 4X9YA 3STGA 3DFHA 4C1LA 2YVFA 4I9TA 3UVIA 4C6QA 5TNVA 2IW0A 4U33A 1J79A 3IJ9A 5HBFA 2NT1A 1IGSA 3KW3A 4UCFA 1N62C 4ADSA 4Q7BA 4O14A 1M65A 4DELA 1S1PA 1CGUA 2HXUA 3O0HA 3QW3A 4FDCB 2FKPA 1UZHA 2DUAA 2QMJA 1KTBA 4J3XA 2EXOA 4PMQA 2DZXA 4ZTXA 4AW7A 5L6UA 2DPEA 1J01A 5D9PA 2X30A 3ZLHA 3NM1A 2WSQA 3LN3A 4L9ZA 2ZFAA 2WV8A 1ZY8A 2J3NA 2YCEA 1TO3A 1W1TA 2BC0A 3BLIA 1RBAA 2GQ3A 1H7RA 4KKXA 2WWDA 1JDFA 1G4SA 1LRNA 2E3ZA 4HN4A 2FTYA 4IWWA 4MZ8A 3WQPA 2OVLA 2CU0A 4ACYA 5HDRA 1UBSA 3A22A 1H4PA 5I3HA 2OFJA 2ZRVA 2HPMA 3GXTA 1UUQA 4FZIA 5LA0A 1HG3A 3M47A 4K8GA 2FVLA 4HMCA 4PUWA 5HJXA 4UTWA 3BSHA 1BQGA 1OGSA 2X09A 4ORMA 3FW6A 3GTHA 2ZZ2A 3AWNA 4M81A 4JQ2A 3ZT5A 3KRBA 2VYOA 5AY7A 1X8CA 2VZVA 3S5YA 1LL7A 1PTDA 3TNOA 3GH7A 4E4PA 5C7HA 1M41A 1YYAA 2HXTA 2GWNA 1V79A 1UR2A 1GUVA 4AD4A 3WH6A 4AVNA 4GYFA 3WEZA 1EUNA 2QV5A 5BXTA 4XQ6A 4AZ7A 3EAOA 3ME3A 1MXSA 4PUJA 3SURA 3EWCA 3DXIA 2PTZA 3FYYA 2PZ0A 3UFYA 5DT7A 2QZRA 4IX2A 2ZXDA 3DG7A 4ICCX 1NQ6A 3GR7A 2YDAA 3LHVA 4JY9A 4LS0A 3QW4B 4RDYA 3U2CA 3IV3A 3IJDA 3T05A 2PMQA 3QC3A 3NQVA 3WBWA 2WK2A 3ARPA 1N82A 4NVTA 3G1AA 3WF0A 1I4NA 3DKJA 5CC6A 3L9CA 1TPH1 1R3QA 1PCKA 2G3MA 5HPOA 4C1NB 1WUEA 1O1HA 5I03A 2E4TA 2VT0A 1KFWA 1G94A 3BGGA 4S23A 5J5RA 1R9YA 4KW2A 5EFDA 3VDGA 4XZBA 4RNJA 3D9XA 3E2RA 4Q8TA 2ZRZA 3EWBX 3VGDA 1H1NA 3PC0A 1W5PA 1PE1A 3W1RA 2PC4A 2DT1A 4XZNX 4XD3A 2X50A 4S3AA 1FWDC 3M0ZA 3KS6A 3OLIA 1ZP3A 5CXPA 5I3KA 1IV8A 5F7UA 3IS4A 3AROA 4J28A 3N3MA 3N1AA 3UXKA 2NLYA 3WJXA 2H3DA 4L65A 1BWCA 1JQVA 4GIRA 3KRZA 1U1UA 1T99A 3QV6A 5FS9A 5JXQA 3T07A 4TIMA 2Q02A 2A79A 3M43A 3THUA 4IH3A 3WENA 5KZEA 1ITXA 4WOQA 3UU0A 2DIEA 1L6GA 1D3HA 1UWUA 3C2EA 4WOZA 3M6YA 2HS8A 1R0MA 2D0FA 3NCOA 5ECUA 2OLSA 3TW6A 1LLWA 1JD7A 1JF5A 3CNYA 4R9OA 3F4NA 3POCA 3B8WA 4LNCA 7TAAA 5I0DA 2C3ZA 3OEXA 4KEZA 1ZS2A 3ITTA 5D9NA 5AYYA 2EPLX 4A6GA 1PDZA 4UIOA 3JZUA 1DQWA 3P81A 1XIJA 4IMAA 2PDWA 1V3KA 2NWRA 1L2QA 1XRTA 3BOLA 5LHFA 2WC4A 1OSEA 3R0DA 1WDPA 4N42A 5C0QA 2QDHA 2R9ZA 4J5NA 5JCNA 2I16A 4LBSA 4FIQA 3OVQA 4UMCA 5LGZA 3QLLA 3NM3A 4IGNA 4AY1A 2FDSA 2O56A 1O60A 4H2CA 3T6CA 1LL6A 4RE3A 3W6LA 3QR0A 3DGHA 4UFKA 3MSYA 2QCDA 1GONA 4DUWA 7XIMA 3PJTA 3ANYA 1XKJA 3CV2A 3O9NA 3G1FA 4K2SA 2PDLA 3IEBA 3AXKA 3QY8A 1GYLA 4QROA 3TAKA 1FECA 4ZFMA 1GOXA 3BPWA 4PB3A 3KBWA 1TV5A 4FIRA 1Q6GA 1I2PA 2OEKA 2HRWA 1FWHC 4DZ5A 2JKAA 1KBKA 1B31A 1XIEA 5C55A 1W8SA 2VHLA 5ABHA 3RRAA 3DFSA 3G6MA 1OCBA 1MQRA 2ZZBA 4LAUA 3M0MA 5KINA 2QUVA 3TLLA 5CZ0A 3QPEA 3F5LA 5HJYA 1JXJA 2ZX7A 5AOUA 3LENA 3QPYA 1IHIA 1QWGA 2J62A 5AC5A 3CUJA 3SCUA 2DGAA 4W87A 3EWZA 1B3WA 3I7SA 3ITOA 6XIAA 4B3KA 3UXDA 3TCEA 2FZMA 1IZCA 3KOXA 3V0SA 1HJQA 3EX2A 2J9XA 1B3XA 4MHBA 3ZXWA 4L1WA 1O68A 3A21A 4O54A 2CHNA 2VFGA 1UH4A 4OGZA 2HV5A 4EPEC 1QHPA 1OF6A 5FCZA 4S3KA 4Z2HA 1P4CA 4Q8MA 2FQIA 4S3CA 2H8XA 1GRFA 1W17A 4AYGA 2PLKA 2PD9A 1TZZA 5ABFA 1OC6A 2Y5EA 1L6WA 3GNDA 3GDBA 4IPLA 2NXIA 4IGMA 4PUNA 3NTYA 3LBCA 2V3BA 4AF0B 1PZ0A 1TTPA 2JIEA 5FJPA 4XIAA 2Z6JA 1TYTA 4GR1A 5DCEA 3VNDA 2CXGA 2YR1A 3B0PA 5DCDA 2DT3A 4ZVJA 1RK5A 3AHVA 3WL1A 5IBXA 1JFHA 1Q6RA 2ZUVA 2WZTA 3GTIA 3UG5A 4W85A 1YBQA 3SY1A 3BAYA 2XIMA 1IR2A 4MB3A 1PYFA 1CGVA 2J9ZA 5KITA 3TTSA 1MEHA 4JICA 4LALA 5E0KA 2OT1A 2WAGA 2R1LA 3VMPA 4MGGA 4KPLA 1DXEA 1UBPC 4P7OA 2HDJA 5CBIA 4PRWA 1MVYA 3NQBA 3SGGA 3WLPA 3PHAA 3QFEA 5AHLA 1ONFA 1V02A 3M0YA 4YMZA 2J8GA 4US5D 3W84A 3WQCA 3LCHA 4JTAA 4LUSB 5D9MA 1NP0A 2OSYA 1PWLA 3EMCA 3LGGA 3EX6A 3B05A 1SYTA 3PJWA 4HK5A 4C60A 1MUWA 3VGBA 4FLQA 3GD3A 2PDIA 1IEQA 5M1TA 3MC5A 2A3CA 3UJSA 4JTCA 3AISA 5A6KA 3M44A 2VOMA 5ENLA 3QF0A 3QSTA 2OGYA 2PEVA 3UPWA 2EPOA 2H8ZA 4EQXA 1EIBA 1DJZA 3GKFA 2F8QA 1WBJA 4G6CA 3UA3A 3VIPA 3WSUA 1RM6B 2D3NA 1FUYA 2BVTA 3HIJA 3RLHA 1UD4A 3IARA 3H2OA 3H4WA 2Z1KA 1QNQA 4PFHA 1SFTA 4WLCA 2Y88A 3EEZA 1OT2A 3WY1A 4DB7A 5FI8A 2YGYA 3ISIX 4J27A 2VD8A 5GNZA 2CLIA 3LTSA 1UZ1A 1EO5A 2XYLA 2HQMA 4MWAE 5TR3A 4LAMA 1XLFA 4E0CA 3SCTA 3TW9A 1QATA 1GZJA 1DIDA 2J7FA 2EQ7A 1JOAA 4MDOA 2F6XA 1KTCA 4IPIA 3L4ZA 1Q5MA 1J0HA 3HQ1A 4BWLA 2J75A 3MVTA 3OZOA 1ZCOA 2PDBA 3WMCA 4R9XA 3QXBA 3C0QA 4DO6A 4XZIA 1KBBA 2WNZA 4BURA 2ZE0A 5A6LA 1A0DA 1CGYA 1TMLA 4MAVA 1SW0A 1BRLA 3QPZA 4BR1A 3NO5A 1CENA 2B7QA 1T0OA 3SUWA 4IT1A 3W0KA 5CAKA 3ARYA 1UHVA 4H9MA 2FPVA 3UWEA 1QASA 4MKNA 2G5WA 3WQDA 3AS2A 1C29A 1DWJM 1W5QA 2GJRA 4LC6A 4XISA 3W2UA 2EJAA 1QPRA 3CV1A 3M5VA 4MAZA 1KN0A 3ZYZA 3R7MA 4MB5A 3HPXA 4QG8A 2XSXA 4LV4A 1Z41A 5JBDA 4QDPA 4Y2WA 1HO4A 2GPTA 3APTA 2XZ7A 1ZAIA 3G3MA 1AZ1A 1KXTA 4P61A 5LIKX 1HXJA 4QTGA 1EJSC 2GOKA 2BASA 3TAOA 1O5QA 4JDYA 4MTVA 1H60A 4G2DA 2UV8G 3P61A 1GERA 3WLIA 4WSHA 1Y5XA 1AL7A 4H9YA 3WQWA 5BRBA 3U2EA 3FEMA 1SFSA 1G4TA 3GDRA 1IQ8A 2BODX 3GB6A 4H7VA 1GVOA 1E6QM 1P48A 3I6RA 2P0IA 1TQJA 1IT0A 1RQEA 2GWGA 2BY3A 3EF6A 3CQKA 2HWGA 3W1UA 1N8WA 3AI0A 3FN9A 3A7RA 4PZVA 3MUXA 3MA8A 3PPHA 4QIUA 4EM4A 1FH9A 3VDCA 1GCYA 5FJIA 4GQBA 2D2OA 3W37A 2HE8A 4YIWA 3NJ3A 4JIEA 2BS9A 2HSAA 2XVNA 1W3LA 3RXZA 2X8CA 2PWUA 3GFYA 3QHOA 3E2VA 5TIMA 4AIEA 4H4XA 3C52A 4GI6A 3SFKA 3C0JA 1ZBCA 1BWLA 2AL2B 4G56A 2GH5A 3ARQA 4J56A 4CEXC 3INPA 1X2GA 1PXGA 4X60A 3Q2DA 3KE0A 4H6EA 1YQ2A 1JIBA 1JCNA 4JL1A 4GWEA 3W7NA 1AW2A 4PTXA 2NX9A 4LU0A 3TA9A 1GOQA 1EDGA 4YJ5A 1J9YA 3LSCA 3R13A 1KRCC 3H7UA 4IMDA 4L6HA 4AB4A 1V6WA 2PDPA 3IUHA 1AODA 5BMWA 1GVSA 1E4NA 4E8DA 1AG1O 1AQHA 1H50A 1DQUA 1QNVA 3DN5A 1GVIA 1I2RA 4CD6A 1ISYA 4ZEPA 3E49A 3KCJA 3NZRA 1L0PA 3WNOA 4GX8A 1CXLA 4I6VA 2YL9A 1Q13A 4DNMA 4ERAA 1R2SA 4QRNA 5HMSA 3HTWA 4BZYA 3QSRA 2DSUA 1HVXA 4GMEA 4KRZA 1VH7A 4XZLX 3VU2A 2YCLA 3ZLFA 2DZWA 3PY2A 4XSMA 1OX4A 5FJUA 4XIMA 4DNAA 1NM9A 3QOMA 1YTKA 4KERA 2QR6A 4TX6A 1MNSA 2CZDA 4XX6A 4B15A 5AC7A 3GG7A 2WMKA 1G69A 2WHKA 3IANA 4N2YA 3EDJA 4UTMA 3TOYA 4IIFA 4O15A 4S3GA 5JUVA 1CZ1A 2WKGA 4H04A 2VGFA 3U8GA 2ZQ0A 1RXOB 3AC0A 1F76A 4MFDA 5DFAA 2Q8LA 5K9CA 3RO6A 3CIVA 3W1PA 2ISFA 4HOWA 2DW7A 4FNUA 2E8ZA 1VFOA 4A8RA 1EBDA 1PV8A 2WSYA 2CLKA 4JYFA 4ES4A 3SO7A 4HZ7A 1QK0A 3LM3A 2PDNA 3PTDA 2HK1A 3HURA 4R34A 1VFTA 1Q6QA 1WOBA 1LPFA 1S5WA 4Y6GA 2P3ZA 1F8IA 2PDGA 2MNRA 3FHQA 4GYPC 4WDWA 4TMBA 4TR9A 5JCLA 1RPXA 1HL2A 2F5ZA 3O16A 4MVAA 4GZIA 3VIGA 1JCMP 3SCNA 4BQ5A 3BV4A 3B40A 3BUVA 1OIMA 3MYOA 3WUEA 1M68A 4Y8EA 3NL3A 2VRKA 3HGRA 5GNXA 3BCFA 4IIHA 2CWNA 1NF0A 1OZQA 2PRLA 4XBJA 2VZTA 3VE9A 4DUXA 4LAKA 1EPXA 1OFPA 4NZ1A 5JMUA 1XG4A 3QQ0A 4NX0A 4E8GA 3QTPA 2WQPA 2E25A 3KZSA 3P5YA 2PDQA 1VS1A 3EDKA 5F2GA 4FA3A 4US5A 1HKVA 4IQEA 1E6NA 3W7LA 1JCYA 3CXBA 5CC3A 4Z1CA 5BRQA 3W6MA 3THAA 5AFDA 1JL8A 4BQ2A 4H50A 1FWCC 3O1NA 3Q67A 2BOEX 2BVYA 4GUHA 1E1CB 3T1GA 2QCFA 4HPNA 1QNSA 5FF4A 1PKLA 1I45A 4AD5A 1JPIA 1E3ZA 4UTLA 2AOSA 4W7UA 4JX5A 2ZRWA 4EOUA 4I8DA 4OBRA 5MF5A 4MPQA 2D22A 1U5JA 3QMTA 3UY8A 2CZ5A 4PEKA 3DFTA 1DXFA 4IZGA 3GXPA 1JEHA 1WDSA 4O1CA 1G67A 1R5YA 3AHXA 4JFSA 5FL1A 2QCEA 6PTDA 1OC5A 4RDWA 2PLCA 4DJED 1MDRA 1W9PA 1REQA 3G0SA 3TJLA 2GVJA 4RX0A 4DJEC 4ZOEA 3SEPA 4YVVA 3MJYA 2AAMA