3R0UA

Crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : tartrate and mg complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
362
structure length
362
Chain Sequence
VSKIIDIKTSIIKIPLKRTFITAVRSTNHIDSLAVELTLDNGVKGYGVAPATTAITGDTLQGMQYIIREIFAPVILGSDLSDYKQTLELAFKKVMFNSAAKMAIDLAYHDLLAKEQDISVAKLLGAKANSIVTDVSISCGNVAETIQNIQNGVEANFTAIKVKTGADFNRDIQLLKALDNEFSKNIKFRFDANQGWNLAQTKQFIEEINKYSLNVEIIEQPVKYYDIKAMAEITKFSNIPVVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMESPAGILATASFALAEDITVADLDPLDWVAKDLYSDYITFNEPNIILKDNLKGFGFNLAENLYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enzyme of enolase superfamily
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Francisella philomiragia subsp. philomiragia
molecule tags Lyase
total genus 119
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3r0uA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3r0uA01
2MUCA 4G8TA 3IJQA 3VC6A 5ENLA 3NZGA 3R11A 1OEPA 3VC5A 3SN4A 1EC8A 2CHRA 3I6EA 3QTPA 3ZLGA 3OW1A 2QJJA 3RCYA 4H83A 2ZC8A 3JZUA 2PMQA 3MSYA 3TJIA 3FXGA 1KKOA 3H12A 3CAWA 3MZNA 4GIRA 3TCSA 4IP5A 2I5QA 3CT2A 3DGBA 3ZVIA 3CB3A 4FP1A 4DX3A 3S5SA 4MGGA 2OG9A 1WUEA 4X2PA 4E4FA 3TJ4A 3MUCA 2OVLA 3ZLHA 4HNLA 3JW7A 2POZA 4FI4A 3V3WA 3N4EA 2P8CA 3UXLA 3NXLA 2AL2A 2GGJA 1EC9A 2XH0A 3SN1A 2MNRA 2OQHA 3IK4A 1MDLA 2PP1A 3DDMA 4MMWA 4DWDA 1WUFA 2FYMA 2P88A 4J3ZA 3I4KA 4IL2A 1P43A 1KKRA 1IYXA 4A6GA 3VCNA 2HXUA 1PDZA 3U4FA 3N6HA 3OPSA 3I6TA 4ENLA 3N4FA 2GGEA 3TW9A 1RVKA 3ENLA 2HNEA 3TQPA 3TTEA 2PP0A 5J04A 4E4UA 2PCEA 3R0UA 1NELA 3P0WA 2QGYA 3UJRA 4DXKA 4EWJA 2FKPA 3PFRA 4HNCA 3ZLFA 3UCDA 3R0KA 3EKGA 4IT1A 1ELSA 2PPGA 4JN7A 4HYRA 2PTWA 2PODA 1R6WA 2XGZA 1MUCA 3OZMA 3GY1A 4HCHA 1JDFA 1PDYA 3JVAA 3ES7A 3P93A 4J1OA 3PWGA 3THUA 3MQTA 1TKKA 2GGGA 3DFHA 4GGBA 2GDQA 3UJ2A 3R1ZA 2P3ZA 1KCZA 4KT2A 4HCDA 1YEYA 2HXTA 3N6JA 5FJPA 1EBHA 3UCCA 5BOFA 3UGVA 3Q45A 3OZYA 2PSNA 2O56A 2PU1A 2RDXA 5EU9A 2ZADA 2AKZA 3ZVHA 3UJFA 3VCCA 3RITA 2QJNA 4ROPA 4DYEA 1L8PA 3D46A 4DHGA 3FV9A 3R25A 3PK7A 1SJAA 4KEMA 1TE6A 4H19A 2QJMA 4IL0A 2GGIA 3DG6A 2GL5A 6ENLA 3DERA 3Q4DA 3CXOA 3IJIA 3EEZA 1DTNA 3TOYA 3SSZA 5IDZA 5FJRA 3VFCA 2OFJA 2QDEA 3IJLA 3DFYA 1FHVA 3ZVHB 5BOEA 3VDGA 2PA6A 2PTYA 1FHUA 1E9IA 1JCTA 2DW6A 2AL2B 3H8AA 4M6UA 1SJBA 4A3RA 2OQYA 2XH4A 1MRAA 2OZ3A 2PTZA 1SJCA 3T4WA 3K1GA 1BKHA 2PTXA 3QLDA 3R10A 3ES8A 3RO6A 2XH2A 3D47A 2OPJA 3V5CA 2PS2A 4K8GA 2OZTA 3NO1A 2GSHA 5FJUA 2QQ6A 3OTRA 4H1ZA 2OO6A 2HZGA 3DIPA 1EBGA 4MKSA 3FJ4A 2DW7A 3PWIA 3QKEA 4HCLA 3U9IA 2XSXA 2PU0A 3STPA 2AL1A 4Z1YA 3FCPA 4IP4A 2OLAA 2P8BA 2OX4A 3MKCA 2NQLA 4F4RA 3QN3A 1MNSA 3CK5A 4Z17A 4KPLA 4GGHA 1P48A 3H70A 1ONEA 3GO2A 3RR1A 3MWCA 1MDRA 3VA8A 2PP3A 3DG3A 3H7VA 2OZ8A 1W6TA 3OP2A 2XH7A 3KUMA 3BSMA 3RGTA 2OKTA 3TWBA 3MY9A 1NU5A 3T8QA 4ZA0A 7ENLA 1BQGA 4E6MA 1JPMA 3DEQA 3SQSA 3V4BA 4E8GA 3GC2A 1XPYA 3SJNA 3DESA 4JHMA 4GISA 4GYPA 3HPFA 2AKMA 3TWAA 4A35A 1EC7A 4IZGA 3V5FA 3QPEA 3UJEA 1F9CA 4IHCA 4YWSA 2QVHA 4K1WA 3NFUA 3B97A 3FYYA 3BOXA 3GD6A 4GYPC 1TZZA 4HPNA 3P3BA 1R0MA 1SJDA 2QDDA 1ECQA 2P0IA 1KD0A 3UJSA 3RRAA 4G7FA 4M0XA 3UXKA 3T6CA 2GGHA 3T9PA 4GFIA 4HN8A 5FJTA 2PGEA 2PGWA 4H2HA 3BJSA 3S47A 3SN0A 1XS2A 4DN1A 3FVDA 1JPDX 4KWSA 4ZCWA 3SBFA 5FJOA 3DG7A 4GMEA 4E5TA 4JN8A 3CYJA 4K2SA 2ONEA
chains in the Genus database with same CATH superfamily
2V3AA 3D3FA 3FJNA 2TSYA 4NXSA 4JYEA 1P1XA 1W56A 1LUCA 2DSVA 3EWZA 4W9TA 4RPQA 1JNEA 3EKZA 5LXEA 1DNCA 3KRSA 2CLMA 1XICA 4KGLA 1W1VA 3P5ZA 5F7UA 1W8GA 4JQ9A 2PMQA 2J47A 1JDDA 5HINA 4I5UA 3N29A 1E40A 1XH1A 5KTLA 2CXEA 2EPMX 5ABGA 2F61A 3GTFA 4WOZA 3O1NA 1XYAA 4ZQMA 1NAL1 5AFDA 4DUVA 5E5CA 3STCA 3LCFA 4DO5A 4AXKA 3KWXA 3VNZA 4WDTA 1EZ2A 4RNFA 4O15A 1FFVC 3LCGA 3LV5A 1JZ7A 4HNLA 4IGSA 4HOZA 1BKSA 4AWEA 4F2BA 1X97A 3C2VA 3DGHA 3HTWA 1RPKA 3UY7A 1F6KA 4UTJA 3SGGA 4RL3A 2ALRA 2NX9A 4DWDA 3SGZA 1UP2A 1XINA 4FX7A 4OIFA 2CBJA 2XJ7A 3I4KA 4LCRA 4S3KA 2W3RA 2VUYA 4PR4A 1FX6A 3O63A 2V5CA 4MJZA 5DMMA 1Y5WA 2ZUWA 2CITA 1E1CA 1ZCCA 4XAGA 5C5YA 2CCRA 4PUJA 4IFOA 3ENLA 4O1DA 2VEIA 2X1RA 4O8RA 1M3UA 3AISA 3REQA 1KQZA 2P10A 5MF5A 3EKLA 3P0WA 1VEMA 3MVTA 3KLJA 3G5EA 4XAFA 4LCQA 4DWSD 3HMCA 1J6PA 3W1XA 3EDFA 2WNNA 3WH6A 3EKGA 1TX0A 4E2BA 2WB5A 3CQHA 3IGHX 4O0ZA 2PTWA 1UWTA 3A4WA 4WXYA 3BVJA 3GYCA 3VNMA 3SCOA 3OZMA 4NZCA 1W5MA 1OF6A 1NJJA 3PWAA 4EMIA 5MHBA 1DHPA 3I7SA 2RDUA 3HQ1A 3NRZB 1H1ZA 4JN6A 4HNTA 1DJYA 1UQZA 1OG6A 2PDKA 3WLJA 1DJQA 3U3HA 3RLUA 3U7BA 2VZOA 3L2IA 1WBJA 2ZZ1A 3VNDA 4H4WA 3GTHA 1XDLA 2ACUA 2X1SA 3E5BA 2AAMA 5BWAA 2V5KA 3R6IA 4UQDA 5I7GA 2PF0A 2FVKA 4GYFA 3PJTA 2O56A 4F2UA 2ZADA 3PPHA 2AKZA 4M51A 2XSBA 3W2LA 3ARWA 1PCWA 3G1RA 3RCNA 4MJMA 1FWDC 1GQKA 3E0VA 1SJAA 1HO4A 3NVZB 2VEFA 5CJMA 4GXMA 5EMJA 2QJMA 3JS3A 3UR7A 1BYBA 3OVQA 1STZA 5DX7A 2F38A 1Q8JA 3S2CA 3WLLA 4Z2LA 4M8UA 1OFPA 2QDEA 1DPMA 3VK5A 2Y62A 4YTSA 4QEEA 3BURA 4RDWA 3B9AA 3Q65A 4UB9A 3O2LA 3EOUA 1PX3A 2E25A 1CZ1A 3FK4A 5M2FX 1S5NA 2Z27A 2A0NA 3CMJA 4U4MA 4M1BA 5I5RA 3PY2A 3OG3A 5IDIA 3VKJA 2YA1A 5LNSA 4E8CA 3TMLA 3TXVA 2BTMA 1KBIA 3C2OA 1TCDA 1VRXA 1UH3A 2H3BA 2HV5A 2OZTA 5IFTA 1D3GA 2XN0A 3NO1A 4ZGYA 3EMQA 3QYQA 1J0HA 2KX9A 4P8UA 2VD9A 2CLPA 1W37A 2XISA 2PURA 3CGDA 1VFMA 1IR2A 4GO9A 1JGMA 4EIVA 2REQB 3IVSA 1EXBA 3FAXA 4BWLC 2YFNA 3DBNA 3BARA 4H9MA 1S7MA 3IIPA 4Z17A 4X2RA 4YN5A 4KBXA 1YXDA 4AF0A 3S9IA 3AC0A 4WSHA 5BU6A 2X05A 4IUOA 3RLVA 2YDRA 3RU6A 3GIYA 1TA3B 3LY0A 3SCRA 1HKWA 4F9DA 2ZX8A 4V1YA 1LJYA 1UZDA 3VCRA 4QLKA 4XUGA 4S2CA 1F3EA 5HJYA 1FY6A 1SR0A 1QNOA 4V28A 1O60A 5HQEA 1K8ZA 1BQGA 2PWUA 1NWRA 1K7EA 4NF7A 3WL1A 5C9UA 3SJNA 2R82A 4E2OA 1C90A 1Z9AA 1GHRA 4TOQA 3I3BA 3II1A 4KPRA 5HATA 4MNJA 4PTWA 3WJZA 1XYZA 2X1TA 2GH5A 1KWGA 3HJZA 4XG1A 5D8WA 3PZQA 3HG2A 5D32A 3NFUA 4U5IA 1T8QA 1OFRA 1TRDA 3I68A 1EO7A 1SJDA 2QAFA 3TKFA 1YDYA 2I57A 1XUZA 3H2OA 3NZRA 2INZA 1JUEA 1O5RA 1PVNA 3G22A 1AH4A 3N25A 4P7RA 3E96A 1PX8A 2I9EA 4Q8WA 1W2VA 3EX2A 3WQEA 4I3GA 5HMDA 2X42A 2UBPC 4NRSA 4XKYA 3ZT6A 2F2HA 1MUMA 4C6EA 1E73M 5D2WA 3UF9A 3AYVA 1TTPA 3CUZA 1K02A 1N82A 2C16A 4DNHA 3TAKA 3SBFA 1GREA 3E5PA 2O9OA 3DJJA 3BAKA 3NEVA 1VIWA 2EPLX 3W7NA 2VFDA 2QZRA 4XD3A 3FDKA 4C6CA 8RUCA 2Y5JA 2W9MA 1WZKA 1JAKA 3BLPX 4AZCA 2JK6A 2JF6A 4J40A 2YL5A 4NZ5A 1PHWA 1EDTA 2CZFA 2XIOA 3OQEA 1TJ2A 4PMUA 2QNEA 3GR8A 4UFHA 1DWHM 2Y7DA 2POTA 4AHOA 1OG0A 3QF0A 3GUWA 3STGA 2G8ZA 3GDLA 4CN4A 3PB2A 4JY8A 3MZNA 3OBAA 4FZIA 3V0TA 3WH5A 5BXPA 2I5QA 1JI2A 5JBFA 4RKAA 2O7SA 4AD4A 1MO0A 4FP1A 4NAEB 5HMEA 2XDFA 4W85A 1R2TA 2OYLA 1ZS2A 5LA1A 2VVSA 1S2TA 2Y5EA 1OIMA 4PA8A 5AY7A 4EAMA 3VE7A 3SCNA 4JTQA 1LWJA 1Q3NA 2YFOA 2QJIA 3QZAA 4H7VA 4CCDA 5EPDA 5JRBA 3ZT5A 5ER0A 2J7CA 4LAUA 4EF9A 1HL9A 1H3GA 4EKJA 3W02A 2XH0A 4PB4A 1AMKA 4GQBA 1D9EA 4MMWA 4ATDA 3SCSA 4HA1A 1M7XA 2YDSA 2BV9A 3QQ0A 3H2MA 1R3QA 2PDCA 9XIAA 3MYOA 4K7ZA 3MB9A 3NPXA 1P43A 2G41A 2WHLA 2BXZA 3AN1A 1E6SM 3MMTA 2VQTA 4CLMA 3ITGA 5CJ5A 2V82A 3W82A 1N7KA 2BY0A 2DFAA 1YADA 5FF0A 4YYCA 1S5TA 3TTEA 3QOKA 1EYWA 3R8RA 3S6OA 3MI6A 1JF5A 3SRKA 1IIGA 4CQBA 4NU7A 3HQNA 4FIRA 3SO7A 3C52A 3F4VA 1LT8A 2ZDRA 2PDMA 2X0HA 1NHPA 3IANA 2H6RA 1GKRA 5CGQA 2DT1A 3KZPA 3A13A 4REQB 3T78A 3EAUA 3WJYA 3MJYA 3PUGA 3QYSA 4ADUA 3DOPA 1H1YA 1DIKA 4E4PA 5FMHA 4S3DA 3VGDA 4A2RA 1XSJA 2YCIX 4ZFMA 2V6AA 1SYTA 1X6UA 1JGIA 3DFHA 4H2CA 3QMRA 1RQEA 1UR2A 3PG9A 1VCVA 1HT6A 5EFDA 1KM3A 4Z2JA 5CQ1A 2ZXQA 2NVKX 3A4JA 4I9JA 3MANA 5HDRA 1FWBC 1YEYA 3N6JA 4JFWA 4W93A 4MWAE 1NFGA 1Z69A 3OZYA 4DJDD 3M9YA 3W38A 1R3TA 5D2VA 2CLOA 3R13A 3O6AA 4FDCB 2DZBA 3ITVA 2WQDA 2ZVIA 3NL6A 1VENA 3NUKA 3HPXA 2YW3A 3P6LA 3M0MA 3L23A 4F3HA 2ZZ0A 6ENLA 4ACZB 1ONRA 3IJIA 3RXZA 4K3ZA 2ZX5A 4GE8A 5BMXA 1VBRA 1ZBKA 5C7VA 3QGAC 4EP8C 1D8WA 1C7TA 3RX3A 5FACA 4RE3A 4OJYA 1HJUA 4GD0A 3WLNA 1XR2A 3S5NA 3L4UA 3QLDA 3F5JA 1CNVA 3RO6A 3OA3A 3G18A 5AYBA 1JI1A 3D47A 3GS6A 3VKBA 1PBGA 1K8CA 1KGUA 2RDWA 2QQ6A 4HOWA 3AYTA 1GQLA 4TO8A 4AIOA 4JTJA 3B06A 3R8GA 1VKFA 3WN6A 1JPIA 4Y9PA 1BAGA 2VRKA 3OG2A 3TC7A 1K8XA 3PBWA 4H4PA 1BYDA 3ARSA 1B3OA 5K9XA 4IMGA 2G3NA 3EX6A 2GJNA 2NQLA 1UZ1A 4JNYA 1GVIA 1MFUA 1XQLA 1A80A 4PMRA 2ZUUA 5IFPA 5CGMA 3IVTA 1SM9A 3DYPA 2NQHA 3K30A 4PMOA 4P5UA 1X8CA 1HKIA 3RRXA 4BI5A 2X8CA 4ZVJA 4JFSA 2OKTA 1K4HA 3T1GA 4O53A 2QCEA 4HK6A 4LALA 5FKYA 3WQGA 1GWJA 3WH9A 1JUBA 1H09A 4N42A 4B2DD 4AEFA 4D9PA 2HVNA 1RA0A 1NEYA 3LGEA 3RN6A 2A3CA 4JHMA 3MCMA 1Q45A 2FH6A 4XSMA 4KWWA 3Q37A 2PD9A 4BY3A 5LKYA 1N8FA 1TPB1 2B7OA 2P76A 4H3DA 4K8EA 5G2WA 4MUPA 4KH2A 3RPMA 2G5WA 4QE5A 4J56A 3MUAA 1GTEA 2GR1A 2E7FA 4YWSA 2G3MA 1SMAA 3W76A 4V15A 3O0KA 1W1YA 1SB3B 3AFBA 1B1YA 3BDKA 4HHHA 5BU9A 6TIMA 1KCKA 1RP9A 2ZBTA 4A8RA 1YDVA 3O7UA 5C70A 1KD0A 1GOMA 3KTSA 3RHGA 4PCFA 1TB3A 3SUUA 5AECA 3NQDA 4JR5A 2QUVA 5U25A 2WLZA 1LQ0A 2BODX 3WNLA 4FXSA 2XU2A 1EYEA 5AHLA 4PMVA 4Q4RA 3R89A 1GEHA 4IG2A 3LCWA 2W55A 3GH5A 3DHUA 4F9JA 5JMUA 3LCIA 3Q6JA 4Y90A 3FA3A 4FK9A 4WUIA 1DJHA 4GMEA 2DH3A 4I90A 4HMCA 2W3ZA 4Z08A 1EA9C 4FMVA 3WEMA 3TYUA 5ABTA 1EJRC 1R3YA 2Z2UA 5K9CA 1H0GA 1P6CA 3HBLA 1QNQA 2V3EA 3QV6A 2FLIA 3U8GA 1REQB 3SDOA 3AHYA 3V0SA 4JYFA 4I9MA 3ZLGA 1VRDA 2JKPA 4EK7A 1E3XA 3CL8A 3UESA 4QSFA 1B9BA 2EKCA 1OWQA 1CCWB 1R38A 1JRCA 3SUSA 3AIQA 4IP5A 1QU4A 1JCMP 1PKYA 1N5WC 3L5AA 4B9ZA 2VZVA 3S2MA 3IRSA 4DJFD 1O4UA 1KRCC 2AQWA 2VFHA 4GVHA 3KP1A 3UG3A 1IF2A 3NZ1A 1NH6A 3DECA 3AS3A 4QCEA 3JW7A 3PUDA 1QASA 3DI0A 1A0DA 4L1XA 5C2CA 2VC6A 4PRRA 2WBAA 2VYOA 3WMLA 4QE1A 3VOGA 2DY3A 3PG8A 4FA3A 3CO4A 1ITQA 3VX0A 5A3HA 1KTBA 2DORA 1I60A 2FYMA 3NWRA 4FNPA 1RD6A 2JIWA 2ZX6A 2G95A 4M56A 2ZTKA 3VDAA 4IL2A 4FNQA 3S5OA 5DRIA 2HXUA 1PDZA 4YWIA 2QCNA 2FHCA 3W2KA 1PHQA 3BW4A 1UZ4A 2XM2A 4OE7A 2BC0A 1VEPA 3H53A 5D2XA 1RBAA 1F5ZA 5G1MA 3B0YA 3UJRA 2WJZA 4NNBA 1QVBA 4IF2A 3WL0A 3PTMA 3T2OA 3ARPA 2DZWA 4MDOA 4A4AA 5DEZA 1LCOA 5K2ZA 3IAPA 4DBDA 2BVYA 1W1ZA 1V0MA 1ODUA 3A24A 1MUCA 3QHOA 1TYPA 7CGTA 1BG9A 1LOLA 1EJ7L 3VPLA 1XF0A 2X40A 4QEHA 8XIAA 2WSQA 3KVKA 3ABRA 2BP1A 5B80A 2WAGA 1U2YA 1BF6A 1FXPA 1F2JA 4NZFA 3H2CA 4IIHA 4GIEA 3MC5A 5FEZA 3KFTA 3WMBA 1ZRQA 2OX1A 5TR3A 3QOMA 4M82A 1A0CA 1GGOA 3HPZA 4ADSA 3GZ3A 3BC9A 1WBHA 1AODA 4K7VA 3UGVA 2A79A 2A3AA 5A6MA 5HA7A 4DF0A 1IV8A 2A6LA 2EXOA 3AZSA 3WF0A 3DI1A 2VVNA 3CUJA 4KEZA 4FO4A 4H9ZA 1L8PA 5BRQA 3TONA 2ZXAA 1NP2A 3GBDA 3DHPA 1OZQA 5CGTA 3KBVA 5FJIA 1CX9A 4CQ9A 3CJPA 1M01A 3L2MA 3Q4DA 1W3LA 1FWNA 4H04A 2FDSA 3TZFA 5F2GA 3U57A 1R7AA 3PJWA 5H8MA 1DEDA 3N2BA 3N34A 1MFVA 5ABEA 2CFFA 8XIMA 4RZBA 1WAUA 4B5WA 2WC7A 1KN0A 4PSPA 1OFQA 1UWUA 2Q09A 1J01A 1EJVC 1TPWA 2EO7A 3T4WA 2XPKA 4C91A 5LXXA 4GJIA 3W27A 5AHIA 4RV8A 3ZJKA 3DGZA 2IUZA 1E0VA 2BXYA 4DAFA 1O1HA 3AMDA 4JTUA 3L4WA 1RAKA 4Z2KA 3WKZA 2BVDA 3PR2A 1TVNA 3VAVA 3ZFHA 1EIXA 3GSMA 4DYJA 4Z1AA 4NEWA 3GKFA 4M6QA 3P61A 3FJ4A 1TTJA 3WFAA 3EF6A 5T9BG 3EDEA 1XYBA 3FCPA 4CEUC 3M41A 3GXMA 2P8BA 2HWGA 4J3TA 4D1JA 1C9DA 2Z7GA 1H4PA 3V35A 3EDKA 1XKJA 3QN3A 2B7PA 2QS8A 1UR8A 2JQXA 3F4DA 3EBVA 5ECUA 3A7RA 3GO2A 4UCGA 1W3NA 1UKOA 2YL6A 1JZ3A 5F1UA 4PEKA 3HB9A 1EEPA 1HG3A 1KM6A 3ANUA 1QBBA 5HJLA 1VJSA 2RDTA 2FGZA 1FCQA 3ALGA 3EXTA 3GC4A 1AOGA 4HN4A 2CZEA 2IXVA 4HPGA 4AX6A 2P0OA 1FWFC 3L5OA 3V4BA 1A5LC 3O6CA 5D09A 2PDXA 3D3AA 2NUYA 4N9EA 4GISA 4FX6M 3HPFA 3PZNA 1GOQA 3FY1A 1Y65A 5XIAA 1KWKA 2QULA 4PMJA 3KE0A 4LOCA 3EWWA 4L64A 3CASA 4QTGA 3BSHA 1J93A 1SSGA 1KRMA 1AQFA 2FPTA 2HE5A 3W7GA 4H4RA 3ANVA 4RNIA 2CLHA 2QV4A 1PPIA 2BZNA 2GRTA 2W54A 5FF2A 4DEFA 4F66A 2CKRA 3W23A 1IGWA 4FLSA 2Z25A 1KXTA 1YW1A 1GSNA 3MHGA 1GVSA 2VO5A 1ENUA 3LMZA 3CXBA 1GPWA 4AIEA 2B81A 2HVOA 1DJGA 3O6YX 4DBSA 3NQ8A 1WXJA 3TROA 4KFPA 4DPPA 4TTGA 3CYJA 4LGXA 4GNVA 4HYWA 3UFYA 1UD8A 2VFIA 1R46A 2V5DA 1QOXA 3H4GA 3DC8A 1ICSA 3VVGA 3NZGA 1QOQA 4FLRA 1M68A 4AY7A 6XIMA 2YLLA 3PZTA 3QC0A 1X98A 1HL8A 2JBMA 2YXXA 2ZUTA 1ICPA 3OW1A 4DJEC 3RCYA 3O15A 3T09A 5I2UA 3ID7A 3UW6A 3ITXA 1LQ2A 1BXNA 1KFJA 2OQLA 3EA3A 2V30A 1P0NA 3TZNA 4A22A 2V38A 1R2SA 3CMFA 1KO0A 4MB5A 4Q4OA 4AF0B 2OU4A 4YJ5A 1KM1A 3S5SA 4AVFA 2WOQA 5D9NA 4EAYA 3PBVA 1HIZA 1NM9A 5HWNA 1J2WA 3UZXA 3A64A 4W86A 1RD5A 3WBXA 3WLHA 1HJXA 3MKKA 2VWSA 1UWIA 5BROA 2WXDM 1JCXA 3NXLA 4OV4A 2NXIA 2PDJA 4XSLA 2WSKA 2WWDA 3ARQA 4LAOA 2V68A 3C0QA 1N5XA 4PTNA 1WXYA 3MUIA 3WELA 1LG1A 4US6A 2WSPA 4Y2WA 3BXWA 3NVTA 4XZHA 1B57A 4A6GA 2CHOA 4XB3A 4IQEA 1SO6A 2C1HA 2Z0IA 3N6HA 2OR2A 3HOJA 2B0MA 4GK8A 3BLDA 1PYMA 4PMXA 1K6AA 5C9RA 4JFVA 2PCEA 4IISA 3C2EA 1NELA 4TX8A 1FA2A 2DVXA 3N9RA 3H4WA 3PBGA 3IARA 1B90A 2PD5A 3AHXA 3S46A 2XVGA 4HGXA 3WF4A 3UCDA 1ZCOA 3R0KA 3H21A 4L6HA 1X1NA 1FKXA 2EGZA 4XBSA 3U2EA 2E1WA 1XG4A 3LHUA 1ISVA 4XKYB 3BCJA 1DTUA 4H00A 3CEPA 4L6DA 1HKJA 3AMZA 1FXQA 4QCFA 1H1NA 2CHNA 2FZ9A 1W8SA 2D22A 4LANA 1DVJA 4CD7A 2VZTA 5CSRA 1UMYA 2VOMA 1TYTA 1XRVA 3T0AA 1B2YA 1V02E 3W74A 4HHLA 3KZSA 2BHZA 1TMHA 4J7RA 3ABSA 1XISA 3WQVA 3GNRA 1WA3A 3V1PA 2DUXA 1XCXA 2BS9A 1SMDA 4Y8FA 3OOQA 1QPKA 3FJ6A 1LROA 2XGIA 4O52A 3RUBL 5CKSA 4Q7BA 1JZ5A 4U10A 2GJXA 3DGRA 3T0TA 2OO0A 3O06A 4HHPA 4O19A 4GR1A 1RXOB 3LZ5A 4MPQA 1MXDA 4ZE4A 3BLOA 2OLHA 3JRKA 4DZ5A 3E74A 2QJNA 4KCWA 2C13A 3PNUA 3UCQA 4UTFA 3AS2A 3FOKA 2EKGA 2W79A 4O10A 3N13A 1YBQA 1PYFA 1EUAA 2E67A 3KEHA 3TTSA 4UMAA 4Q8UA 4LV9A 1KQYA 4WKFA 5GJMA 3HM7A 3DFYA 3WDRA 1M65A 3M0JA 5I02A 2PA6A 4XV0A 3ZT7A 1AH3A 5CPQA 3NO5A 3GVWA 1TV8A 1Q6EA 5EYWA 5DBUA 1NDZA 2E68A 1NDYA 3PZ9A 4YCOA 4HA3A 3CV2A 3W1TA 4S3BA 5HMFA 1EA0A 1NHQA 1FOBA 2G3FA 1W54A 2QIWA 3PC0A 2WJFA 3K8LA 1FEBA 6ALDA 5J5RA 4QRNA 1TWWA 5CPLA 4H9VA 1OM0A 4N6EA 4LVAA 1VBUA 2WYSA 3PUOA 3SB0A 4UTTC 3BE7A 3MDUA 4FEZA 4Z0JA 4EPKA 5LNUA 1TPFA 2EPOA 2ESCA 2JALA 4JIHA 4Y9AA 1WDPA 3O16A 4KFNA 4TUFA 4LFYA 1F4HA 2YCLB 3UBPC 1MNSA 2D2GA 3EMCA 2QUNA 3T40A 2VXNA 1P48A 1EGZA 3CWNA 4WJ8A 1CB2A 3URAA 1NWSA 1QO2A 1O6IA 2ZX7A 1NVMA 3OIHA 4OOZA 1T6MA 1BD0A 1G5AA 1WZMA 4MB4A 1XIJA 5AC4A 2EQ6A 3WLRA 1HP4A 3LXAA 4DUWA 3WD2A 4MPKA 2VX6A 3DH7A 2AAQA 1EOMA 1HTIA 2OCZA 3FAWA 5HR6A 2J9XA 3SFWA 2P5NA 4PMDA 2BDQA 4YPJA 2VDGA 1VR6A 4NJKA 4E8DA 1RP8A 3DENA 3CV1A 4BKNA 4W88A 1JYNA 3MUZ1 5BMWA 1UC4A 1A4LA 1W5QA 1GZJA 2ISDA 4AZIA 4JNZA 2BGSA 9XIMA 4WJXA 2ZZ4A 2ABBA 4K68A 3K8KA 3LHTA 1BZLA 3BOXA 2DT3A 3EX1A 2GYIA 3UR2A 4OBRA 5I3JA 3UXIA 1Z48A 4X60A 4MOZA 1VB9A 2W66A 5G1TA 3UZZA 3KOWA 3UJSA 1LRNA 4M0XA 1E0XA 1M1BA 1L6WA 5I00A 3S3GA 1UD6A 1PZ3A 1NHSA 4AYGA 1A5NC 4UXDA 3B8WA 2FFIA 3AM9A 3SN0A 2WMKA 2NV2A 5M17A 3SIMA 1HX0A 1KBBA 1JPDX 2Y4SA 3CIXA 5BWFA 3MO7A 5FS8A 1GJWA 4QIUA 2V63A 2H8ZA 1CLVA 1R9ZA 3UR5A 4A3UA 3WD1A 4FXJA 2BY3A 5C54A 1ZZMA 2ZRYA 4AD5A 3V16A 2NSXA 1UASA 4BQ2A 1TMQA 3QTPA 4MIMA 4NI3A 1ITUA 2R9RA 2YX0A 2XGBA 1IEVA 3A3HA 2QEZA 5LA0A 4UTLA 5AHMA 4DO7A 3IEBA 3UYCA 1XANA 1M6IA 3QGKC 1XHCA 4H6KA 2HQMA 2IPWA 4NL1A 4X9YA 3MI2A 3NQ7A 3UYIA 1F61A 3BMVA 5GJNA 1GCYA 3T0DA 4RXGA 1NDVA 4LUSB 1MW2A 1SZNA 3VI2A 4ZOAA 4F2TA 2JEQA 4QSHA 1KNWA 1FBAA 2XFYA 4W8BA 1ZP4A 5A8QA 1W3HA 3TJ4A 3VXGA 1NFPA 3VABA 2VGIA 4GG9A 1JZ2A 1Q6RA 1XM3A 3AXXA 4WCJA 1LP6A 4P7NA 2P8CA 2TPRA 2IKHA 3CS2A 1LM1A 3TW7A 3P80A 5G4WA 3GDRA 2PP1A 1GZGA 1EB3A 4KRTA 3VMNA 3B4YA 3M6DA 4OT7A 4Q8OA 4OFCA 1IXPA 3QPYA 5FL0A 3TK7A 2UY4A 1PO9A 1KKRA 4AZ7A 1DP0A 1Q6DA 2DDXA 1EPXA 4KS0A 4CNNA 4UMBA 3GWQA 1BTMA 1MW1A 2GJLA 3BK0A 5I3KA 1C93A 2ZZ2A 5AOUA 5DY2A 5DMYA 4PMYA 2PP0A 3QEZA 4IUGA 3VM7A 3A47A 3KL0A 5G2HA 2OSWA 4LNCA 2O9TA 4JEJA 1GEUA 2QGHA 2DIKA 1V0NA 3VGFA 2FKPA 1EWEA 2E9BA 2DEPA 3SI9A 2XIMA 1EZWA 3CZJA 1W3IA 1LZOA 3CZKA 2XGZA 1H11A 4ZOCA 3PZGA 3BMXA 3ARYA 1US3A 3W1MA 4ATLA 5I0DA 4IPNB 1HQTA 4OWGA 3LRMA 4O0QA 4MTVA 3LI0A 4DLFA 4XISA 5C7HA 3AMKA 3TMQA 4I7VA 2E09A 2E6FA 1TTIA 2FPVA 1RJRA 3P81A 3KRUA 4M24A 4RUBA 3AHVA 2E6DA 2YKKA 2HISA 3W81A 4HNOA 3PG6A 4NNAA 2PDFA 1PB0A 1KXQA 5CG0A 5MKGA 4ZO7A 1U83A 1ONFA 4JQAA 2VWTA 3Q67A 1UB3A 1XL9A 3GD4A 3V0UA 3IIZA 2HE8A 2W62A 3I65A 1YTDA 3S6TA 1G4EA 5CAHA 3SW6A 4GA8A 3HV9A 2DJLA 4XUYA 1TRIA 3WNKA 2OODA 4PFMA 2OT0A 4WIWA 3D46A 4APNA 4LBUA 4DHGA 2VX5A 2FVLA 3AICA 4BQ4A 4PZVA 1XD1A 1RH9A 2PGFA 1W1IE 2ZIDA 4NP7A 4BURA 3EEZA 5HQMA 3M0ZA 2OWWA 4L4LA 3RX2A 3VKKA 5HQLA 2Q6ZA 5C71A 3IJDA 1EHNA 5KITA 3XISA 1Q65A 2PAJA 3G1VA 3LLXA 1WX0A 4YNGA 1VYPX 5EKYA 3H54A 4FLOA 5IRPA 4GIAA 5D33A 3LCHA 2XH4A 3FEQA 3L8KA 2PTZA 3HGJA 2PTXA 4PTMA 3FGCA 1J5SA 2C19A 1F05A 1F3TA 1M6JA 3NOYA 4PUNA 4HJFA 4G7EB 3B04A 3AJ7A 1H7XA 2GSHA 3DZ1A 3N2CA 3O3RA 1UD3A 1JXKA 1QPNA 4H8NA 3LS9A 3MTWA 1JZ8A 1OX6A 4CU6A 2CLLA 1JDAA 3QC3A 2GDUA 1OYBA 2DUZA 1WYGA 1AJ0A 4LB3A 5BW6A 4PGLA 2XSXA 3QTGA 1NF7A 3W7IA 1XYFA 5JU6A 5I23A 1POJA 3KBSA 3MKCA 3CHDA 1GRTA 1F7BA 1CGVA 1ONEA 1BSLA 2J7DA 3BOLA 3DU0A 3RPDA 3GYEA 1TZ9A 2FZNA 2NX3A 3B8DA 1F73A 2B31A 1HXJA 4HTYA 1FFUC 2E5AA 4FNTA 3POCA 3A5VA 3GNPA 2RGMA 3R58A 2QUMA 4B5UA 1W1TA 4IGHA 4ZA0A 3E2VA 1RA5A 3DEQA 1RQBA 2ATMA 1OINA 3NL5A 3P8IA 4GWEA 2WC3A 5IBXC 2IKIA 5CC7A 1X6NA 3FKRA 4ZQOA 2SFPA 2VRQA 2F2KA 2Z1BA 4JTTA 4CNOA 4BEQA 3ZJ6A 3PJXA 4LH8A 4GYJA 3KXQA 3ZR6A 3F2DA 5CPTA 1DWFM 4LAMA 4YCPA 1F9CA 1FUYA 7ODCA 2JIEA 3P7YA 5JH2A 1XLHA 4GUFA 1M04A 5IHRA 1LPFA 1J6OA 2GOKA 1VCFA 4POCA 3P3BA 2DIJA 1UKSA 5AVHA 1UG6A 5C0QA 1XLLA 2A3EA 1GXFA 4H01A 1WB0A 3IJ9A 4LBRA 3K5XA 3GW0A 1C9WA 3RRAA 7REQB 2GVYA 4JPGA 3T6CA 2PCQA 4HN8A 2FVMA 1XW8A 1Q2RA 2PGWA 4HZMA 2E5DA 2WPCA 4MWAC 5C2XA 3WJSA 3EWDA 2W61A 4MWAB 3E0LA 3QZEA 4BJHA 4C60A 1D2KA 3VNYA 1Y7VA 4PRWA 2E9LA 5TBOA 3EOOA 4S3FA 5B7ZA 3KDOA 1T96A 2INFA 3A12A 4WDWA 1BVWA 1PJ9A 1W9VA 3AMGA 3NVWB 4O1AA 4ZOBA 4U3CA 3TSDA 5H1WA 4Q4SA 3CZLA 3EOEA 4DZHA 1O5QA 3WENA 3OBEA 1Z7AA 3MSYA 3PF3A 3TJIA 3CNYA 3N2TA 4PCSA 3V36A 5DQPA 3NSXA 2ZYFA 2BFGA 3DGBA 1UYQA 5CBJA 3LLFA 4GVIA 3MP4A 5JUVA 2D1ZA 4RE2A 2J4GA 1WOBA 4WOQA 4BQ3A 3GK0A 1OGSA 2QV5A 2I9UA 1WYIA 3CWOX 4R33A 5HUOA 2Y7FA 3ZLHA 4JICA 3RU8X 3BZJA 2I17A 3TN6A 4CCZA 4ZODA 3TA9A 3WFZA 3MJMA 3A23A 4MKVA 3IK4A 1YDNA 3NL3A 3KS5A 3P0XA 4WY0B 2FZBA 4AZ6A 1F07A 4PCPA 1U5HA 1CXFA 1BXBA 5A8GA 2VFGA 1MXGA 2WLYA 1K03A 4Q4PA 3BG3A 3LSCA 5KSWA 4W7UA 1DWIM 4EACA 3M0HA 1B4KA 2PRHA 3EDJA 4IMDA 3I6TA 4GCXA 3N73A 1GRFA 3WQWA 2NVAA 3LCLA 1M7OA 5HNRA 1MEIA 5C9XA 1JZ6A 5J04A 1EIBA 1ZJBA 3S1VA 2DT0A 1ZDLA 1HZYA 4OV9A 3AXMA 4O28A 3CYVA 2QDHA 1BSIA 4B5SA 3OBKA 3FSTA 3C3UA 5CXPA 1ELSA 3R0DA 4Q8PA 2CC0A 3GTIA 3EX3A 5U7SA 5D37A 5C8BB 1H7WA 1IE7C 3NO3A 2BASA 3C8FA 4HCHA 3QRHA 1B30A 1HJSA 1YNYA 3USBA 4AWTA 4F8XA 2WMIA 2D3NA 2QLYA 4KESA 4JY9A 4UTWC 2ISWA 5SWUA 4HBKA 4GY7A 2VT0A 3MQTA 1WQ5A 3C86A 2J6XA 3R1ZA 2WNWA 2FTPA 4JTRA 3EA2A 1JRBA 2Y24A 2VGGA 2CESA 3EAOA 1A5CA 4C7GA 4XZWA 4CKQA 1OZMA 4UR8A 1ME7A 4GIYA 2QAPA 3ZSSA 1TO3A 2R91A 1OC7A 1M41A 4D2JA 4GBUA 3DC0A 4G56A 1QNPA 1MMFA 2CZDA 1H2IA 2AMGA 2J78A 5HR7A 1V59A 1KA9F 4R53A 4WEVX 4PBEA 3U5YA 3BAIA 1EPVA 2NV1A 2VQUA 2ZX9A 4DBEA 1WV2A 3LRKA 1K70A 3CTTA 1KM4A 5ABHA 4C5YA 1T5AA 3OVGA 1D8CA 1PIGA 3A5FA 5J8LA 3S5ZA 4K39A 1Q1WA 3OODA 3CXOA 2D2OA 4CQAA 1JR1A 3K1DA 4HA0A 4ECLA 4QAIA 1J0JA 3T0CA 1OC5A 1FHVA 1D7YA 3BJTA 3LZ3A 5M5DA 1EP1A 5FESA 1CLKA 7XIMA 4K37A 3FYPA 3P67A 1ZMDA 1R3WA 4DXXA 1W91A 3H2NA 3GXDA 2EQ8A 5LGZA 4B2DA 3WBWA 2Y88A 1HJVA 2DV0A 2PDYA 1Y8BA 4BEUA 2OO6A 2L5HA 3CQJA 1FIQB 1FFQA 2HPMA 3BAJA 5EMUA 4Z2GA 2D69A 3L4ZA 4HZ8A 4AYSA 3N15A 1JXJA 4E3TA 4DF2A 1GOKA 4AVNA 1PV8A 4NJIA 1PIIA 3WQ8A 3EXSA 1W9PA 3VNJA 3HA1A 2TAAA 1D7KA 1SZEA 4O57A 1VJIA 3UPBA 3BGAA 3BMWA 1EF2A 4F0MA 4QG6A 4N0RA 1VCGA 4MNMA 1V97A 3TWBA 3MY9A 2ZKMX 3IUHA 3EMZA 2X1IA 4TX9A 2CYGA 3BGJA 3GG8A 1S1RA 1VHNA 5ABFA 2P3EA 2BOGX 1E6RA 1WNOA 3V5OA 4B90A 1Z3NA 4P61A 3LM7A 3PZMA 1CI1A 4GYPA 1PKLA 4RX0A 1EC7A 1M5WA 3NG3A 4IZGA 3I3EA 2A1YA 1FH7A 3EWUA 6REQB 2GJXB 5D8ZA 3RR4A 4XBKA 2ZA3A 1I45A 3B8SA 1J9YA 3B97A 1ME9A 2JEPA 3N3TA 4HPNA 6A3HA 3M0KA 4AIBA 4TU1A 3BGGA 3GHTA 4CUCA 2H90A 4QDWA 2WMJA 1OFEA 3THCA 2HBXA 3SQMA 3IUIA 2X30A 1F74A 5FJTA 2ZRUA 3CHCA 5D04C 3EWXA 3G1FA 5G4HC 4LA1A 2XIBA 1ESWA 1K4GA 4CD8A 1OK6A 1VQZA 3R8HA 1ZU8A 4DN1A 1O1ZA 3LDVA 3MU7A 4URIA 5AC8A 3QHMA 5LIXX 3CIWA 2QW5A 4H9UA 1XV8A 4QE4A 4ZOHB 5IOBA 2DSKA 4MZ1A 4Q22A 4IIDA 4ACYA 3H6OA 1FH8A 3IUDA 4H9TA 3VNKA 4GC4A 3ZM8A 1TPDA 3QQ1A 5JBEA 1OBAA 2QCCA 5FA5A 4Q8QA 4WY0F 2NQJA 3GC5A 1NWTA 5FJJA 4TV5A 1XLFA 1CXEA 2QJJA 5CLTA 3ZJ8A 1QWKA 3VIKA 1S39A 3PULA 3W24A 3H12A 3CAWA 2VCAA 4L6OA 4C6OA 1F6YA 5EGRA 1U5JA 1R5YA 4XZBA 4JEQA 3OLGA 4DO4A 4N02A 4W7WA 4QDMA 5B7YA 1J0YA 1ZP3A 1YTKA 4HP5A 5D2TA 3MUCA 1EX5A 2WOIA 1TVPA 1KC7A 1XSIA 2F8QA 4Q3MA 1V6VA 5KINA 3KCOA 1X1OA 1QBAA 3HN3A 4HU4A 2GQ8A 3EB3A 3WH8A 1F6PA 3NDOA 4AXNA 2GQ3A 3FHQA 2V5LA 4H4QA 3WNMA 1H49A 3ATZA 1W9DM 3F7JA 1ZGDA 4C6LA 1K6WA 2W0UA 4WGHA 1YQ2A 4IICA 1N2VA 1P7TB 2YBTA 3A21A 2NVDA 2W0HA 4RJEA 1LQAA 1OF8A 2QDGA 2GGEA 1LWHA 2BLEA 1UH4A 1W3KA 3LEPA 4DBUA 1S3HA 2G4FA 1DIOA 4RNJA 3PBMA 2O9RA 5H8UA 5BZAA 4YTRA 3XINA 5H91A 3ZOAA 1S2UA 3SRHA 4C6FA 1TWSA 4ROQA 4NSBA 4AMCA 1MZHA 2Z4GA 3N17A 5FAJA 4ERIA 4IT1A 1V7AA 4X9SA 5JVLA 3PZOA 3ANYA 2PFHA 2PODA 1Z8AA 5K7JA 1XGZA 3GTXA 3FLUA 2WK2A 1V3KA 4OGZA 3LPPA 2FZ8A 4MB3A 3JVAA 1KRAC 4IMFA 5CSUA 5M03A 1QR7A 4FXRA 2A6NA 4CVWA 2IS7A 4HTBA 2DZPA 4O1CA 1QI2A 3WUBA 1EJXC 3NCOA 5I3HA 3T42A 3MKVA 4IIEA 4LT9A 2P1FA 1UR3M 2Y70A 3HJEA 3WEZA 3F5KA 3RJXA 3EOSA 2CXGA 3QFWA 2G3JA 4AB4A 1KCZA 1RV8A 3NQEA 5BXTA 4G6CA 1RCXB 3ZWTA 3AU6A 3SSJA 2DZVA 3Q45A 2J24A 2PSNA 3LV6A 2PDNA 1WDSA 1YPFA 3TSMA 2QVNA 2D73A 5LIKX 4NHVA 3GU1A 1CGWA 4OUEA 4DWSC 3AWOA 4DWSB 4JFTA 4B5VA 1GJPA 5AC7A 3D9XA 4B3ZA 3SAZA 3DG6A 2WBGA 5JCLA 4O4VA 4JX5A 3DBPA 1GRGA 3PPFA 2QCFA 4PUKA 1H62A 4C1NB 4JXCA 2Y8VA 3VFCA 3N11A 3TC3A 1XSKA 1VC4A 1JCTA 2DW6A 4FNSA 3PZVA 5HUPA 3AS0A 4H7CA 3F4CA 4OECA 1WDDA 2WCAA 4MAVA 4OZOA 2C3CA 3UWWA 1JCLA 3PANA 1EX1A 3C5QA 4LUYA 3NQGA 2ZQ0A 2V2HA 3TN3A 3EDDA 4JTSA 2PDWA 4WQ6A 4DM1A 2ZXDA 4H1ZA 1S46A 1GRBA 3WF3A 2C1GA 3V75A 4H50A 4WXZA 3C2YA 4INFA 1EBGA 4MKSA 2EBNA 2QT3A 2BNJA 1TPC1 3VD5A 4US5D 1AQHA 2YSWA 4NJGA 4XO6A 3DKLA 1KTNA 4JZ5A 4I7UA 4WX2A 3T08A 2C6QA 1UC5A 2VEMA 1L6GA 2E5BA 2Z1XA 3QPZA 4GH3A 1GERA 2I5GA 2PI6A 3RK8A 4UFKA 3W28A 4JTIA 1QPOA 3TLQA 1OCJA 3WBAA 4D6GA 4N2YA 2WMGA 4B92A 1GKPA 1B0IA 1GVRA 3WUEA 1TCMA 4LYQA 1H63A 2Z1SA 1V03A 4NZJA 3RX4A 3OHIA 3OP2A 1JRPA 4ZENA 4K36A 3KUMA 3EZ4A 4A21A 3O0FA 1E4LA 2HCVA 3EX4A 4JQ4A 5C9ZA 5DY3A 3FVMA 4A8NA 7ENLA 2VP8A 4QJ4B 3WNNA 5C55A 4M81A 1KFEA 1Z32X 1ZUAX 1GNXA 4TX6A 1YXCA 1LL7A 1JJKA 4IFRA 3CUFA 4Y6GA 4Q4KA 4UBPC 4XD6A 4A35A 3M5VA 1ISZA 4L65A 1Q13A 1XRTA 1I2OA 2WKGA 3BLLA 3LENA 2Y7EA 1HF6A 4GFSA 1JFHA 3GD6A 1RZMA 2GDVA 3OJGA 1UR1A 4W89A 2DGAA 3VGBA 1BYAA 2H9AB 3W7EA 3OHMB 3TUUA 5CH9A 5U4NA 2YQUA 1F3PA 1AZ1A 2D24A 2QIIA 3LADA 4GFIA 1XYCA 2NXHA 4EXQA 2WP5A 5A6LA 4IOTA 5E0CA 1THFD 3O0HA 1XQKA 2BHYA 2R1PA 2VFEA 4IX0A 2V9DA 1C8XA 1XLBA 1XC6A 1KFWA 3U6WA 4HNNA 3DHDA 3IV3A 3M1ZA 3B03A 5CSSA 5K9DA 3FGCB 3N3MA 3BH4A 3N14A 1JEHA 2J6VA 2BOEX 1EXPA 4I9AA 1Q85A 3QW3A 3IWPA 4ZXLA 3L2LA 3RYSA 1IR1A 1I2QA 3VIOA 3DAQA 1TR1A 1S5MA 3MSRA 5BYWA 4BV6A 3W83A 2NQZA 3WMCA 2D2HA 3GHSA 1FHDA 2YB1A 4Q6JA 2VENA 1UP3A 2G50A 2QF8A 5A95A 1WCGA 4C7DA 2VUNA 3GVGA 1UIPA 3L7RA 3GW3A 2OSYA 3LU2A 2F5ZA 3ARXA 1K7XA 2I1OA 3QVQA 1QK2A 3SY8A 3OIXA 2WPBA 2DVTA 3VILA 3U7VA 1SW0A 5JIPA 3TVAA 1R7OA 1XIDA 1GVFA 1SW7A 3UEQA 3CAKA 4AWUA 5G2IA 3LOTA 2CETA 2GQ9A 2GVJA 3UWYA 4J9JA 5TNVA 3M47A 1K9EA 3SFKA 5GJPA 5EMYA 3W75A 1MDLA 3N04A 7TIMA 4A3YA 3F1QA 1VFTA 4PRTA 5KVHA 3D6NA 3G1HA 1GOWA 4UOJA 2BBFA 1MVYA 3GFYA 1JQXA 3W70A 1X7IA 1V93A 4HZ6A 2A5HA 1FWJC 3OPSA 2XVPA 2GFTA 1DORA 4I8DA 1CXLA 2NVCA 5A6BD 3TNOA 4H6RA 4O16A 3ERPA 3QLLA 1GONA 5E70A 4JL1A 1MWOA 1E5NA 1BFNA 4ZZ9A 3GVVA 2YCKX 3MP5A 3ZLFA 2R1KA 4UQCA 1DJZA 2YYTA 3UWUA 2VEKA 1LVLA 2C3ZA 3BW3A 3DCPA 2IQ0A 4DZIA 4O54A 3H55A 2VX4A 2V67A 4C6KA 1VZWA 3ICJA 3NOEA 3GVRA 3M0VA 3VGEA 4UNLA 3PP7A 1YE6A 5FF3A 4Y9OA 2XM1A 1S2VA 1X1ZA 4QG8A 2PC8A 1S5VA 4PCTA 5FCZA 3II4A 3EPOA 5G5IA 3PWGA 1AG1O 3WCZA 1SR9A 3M0LA 1ZKQA 3MYPA 4JYDA 1ZLPA 3MHUA 4AX7A 1TYGA 5D03A 2WMHA 4EPBC 3RM4A 4KCTA 1GETA 4OHQA 4GPNA 1CGYA 2DU2A 3QGVA 1R86A 3EXRA 2V5BA 1UROA 3KHJA 3LYEA 1EOKA 5DN1A 4YLWA 4JKMA 1AUSL 1UZHA 3SADA 1HVQA 4UNIA 2WZTA 2GUBA 3LERA 1LDCA 1C8VA 3TYBA 3VIJA 3PBUA 4M7SA 4AZ5A 4UTMA 1CGXA 1LOQA 4GXPA 3KVJA 4XZNX 3GDMA 2WKLA 4QP0A 1QW8A 3LX9A 2NUXA 3W87A 3B4UA 2NSOA 1SO3A 1ZJAA 2EPNA 1NPXA 4GJ1A 1O66A 1Q6LA 1HL2A 4JKLA 4MZ8A 1R3VA 4IFKA 1JVNA 1EJUC 5EBUA 3VDHA 1FWAC 4IPIA 4Z1CA 3JUGA 4PYSA 2XUCA 5E9XA 5CPMA 4GRSA 3LHZA 2OZ3A 3TIMA 2REQA 1UR0A 3ITCA 2YBUA 4LY4A 3C0SA 1RCOB 1HJWA 4BWLA 2JKAA 3C2FA 1AZ2A 3ITLA 4TVWA 1OCNA 1UW9A 2R94A 1QNVA 3OTRA 2VEGA 1HO1A 1SFLA 3LSBA 4LU0A 3DUGA 2ALDA 4R9OA 3WLQA 1H51A 3NSMA 4DJDC 3PWIA 2B7NA 1SGJA 2OEKA 4UIOA 1YE4A 3B8TA 5AHEA 2W6RA 3C3NA 4ICCX 4CNTA 2PBOA 3DK4A 3WQFA 3G3MA 1H6VA 4D8ZA 2O0TA 2J9YA 1ITCA 1ZK7A 5AN7A 1CDGA 3G1SA 5A1AA 1QT1A 4YVXA 4Z42C 1AQ0A 5A94A 2ATSA 3CBWA 3VMOA 1V3MA 3TEVA 3ABOA 4QQUA 4F79A 1TTQA 4PSRA 1ZNNA 2X8RA 1NU5A 2O4MA 3T8QA 3VDCA 5DLCA 2X8GA 2Y8UA 2R8WA 5HNTA 3UZYA 1SO4A 3B0VC 3FA4A 5ECVA 5KZMA 3GC2A 3ME3A 1H7OA 1V3JA 1RJQA 4B15A 3UR8A 1B3VA 4FIQA 1HUVA 2KZHA 4GX8A 4A3QA 2D0GA 4FSAA 4KCUA 2FH8A 1YNPA 1UOKA 4AU0A 3KWSA 3BO9A 1GZ1A 3NIYA 5HOSA 1H5VA 1RCQA 4QLLA 3AHZA 1X2GA 1LWIA 3E3HA 1BEUA 3WF2A 2YB4A 4ZB2A 1B3WA 1TUXA 1MW0A 1TPH1 3G1DA 3LGDA 4O50A 3W7HA 1BQCA 3BCFA 1UCWA 1G9HA 1E56A 3RCMA 4C6NA 1O12A 3T05A 3M64A 2OTDA 2PF8A 4A2SA 5C2GA 2BGNE 1ECEA 4NASA 1E6XM 3A22A 3W88A 4H9XA 3TLLA 1IZJA 2FHFA 3ATYA 4QS5A 1ODZA 3UXDA 4LAKA 4NIRA 1RR2A 5EMKA 4A8LA 1GVEA 4W8AA 3IVUA 3LQLA 4TTUA 1TPUA 3L66A 4DI8A 3WF1A 4XTIA 1QHOA 4D6CA 1TQXA 3KM8A 2TODA 1V8EA 1TIWA 3ALFA 3E12A 2J8GA 3R11A 1PAMA 4NAEA 3W01A 4IH3A 2XZ9A 1NSJA 1LG2A 4JTCA 1WZLA 1N61C 3KBWA 4GX9A 3GDBA 3LM3A 4GI8A 5FS7A 3N9SA 2VRJA 1NQ6A 1IWBA 2EG8A 1JAEA 3TCSA 3AIUA 2NUWA 4Z1BA 1RBLA 3L5MA 3CHEA 3RM8A 3ABZA 1JPHA 3UERA 3IGSA 4FR6A 1XYLA 4LX4A 2X50A 1YDOA 2VKZG 3U0HA 1XC4A 2A85A 3CL7A 1E0TA 3U5UA 1KBLA 4YVVA 4PL2A 1P0DA 2OVLA 2OLSA 1KRBC 1U1HA 3WX7A 3CPRA 3NR0A 3GIQA 4R7JA 3BG9A 2AL2A 3GNOA 5ABFB 1DBTA 3G6LA 3ZWSA 3ZQ9A 2P88A 2ICSA 4I5RA 4ML4A 3NZPA 3BL3A 4UC5A 3VCNA 3PNZA 4DXVA 1YYAA 5DXXA 2Q02A 1EJTC 5LZLA 4ENLA 3N4FA 3QXBA 2E6YA 3KBJA 3ZR4A 2Y89A 3IJ8A 3O9NA 3VOCA 4MNKA 3BQ6A 2EG7A 2W92A 2VR5A 3VTRA 2QGYA 4DUXA 4N6FA 4LPCA 4DXKA 1CXKA 4N9BA 1QI4A 2FTWA 4HNCA 3KOZA 2ZRWA 2Z00A 5E1QA 1VQTA 2G3IA 1RY8A 3HQPA 3WLSA 5JBDA 1KM2A 3GTNA 1B31A 3GY1A 1JOAA 2X7WA 1XBYA 2DH2A 4HIBA 4H4VA 1B3ZA 1X7FA 3AMLA 1P0BA 1G7UA 4I7WA 2HNHA 3AQUA 1B54A 3P93A 5GPRA 2Y7GA 1GK8A 3B9JB 2Q01A 1UKTA 4C6JA 3T81A 4TR9A 1JD9A 3S9YA 2PE4A 4UFLA 3UG4A 3AJXA 1HGWA 4CVUA 1IZKA 5E6ZA 1QPRA 4LVBA 2VEPA 4GKLA 3KLLA 2G37A 5DELA 1O5XA 4R5EA 1RJPA 3GM8A 4EPDC 5F1VA 3WLPA 4ACZA 4XVEA 3MV11 2V2DA 4J3SA 1ZXIC 2V6OA 3VGHA 3VZXA 5F2MA 3C2RA 2EF9A 1I4NA 1L2QA 1L2UA 2YR1A 4B3LA 1J0IA 2A3LA 1V3HA 4DYEA 4JIRA 3MW7A 2HQAA 3FV9A 1NOFA 3TYCA 1TE6A 4IXHA 1FECA 3DERA 1L6YA 1TREA 3LBOA 2HS6A 4RK8A 1S2CA 2EPKX 3BSGA 2C91A 3NVVB 5FJRA 4GI4A 1EH9A 2XVKA 3BLFA 3IJLA 1UUQA 4PTDA 3ZVHB 1UA3A 4E38A 3SQLA 1FWRA 1GORA 1H7RA 4Y8EA 1SJBA 2ZA2A 3GXFA 4PUDA 2PLCA 5XIMA 1AVAA 4YYFA 3KDNA 1VS1A 3S5YA 3BV7A 3UT0A 4EXBA 3C6CA 4AISA 4UNKA 3ISIX 1LLOA 4IPPA 3TJLA 1GHSA 2A21A 4RW5A 1FWTA 3VINA 1A5AA 1US2A 3MBDA 3AZRA 2YVGA 5E6YA 1P0KA 4LVGA 1I2RA 2KAUC 1J10A 4HPXA 3G0UA 1QJWA 4I9TA 3I6RA 3GBEA 1MO9A 3STPA 2QCDA 4Z1YA 1XIFA 4IP4A 2AGKA 4G1NA 4B4HA 4CNPA 4JQ2A 1NWUA 1XFBA 4AZBA 3OYXA 2GSEA 1BWCA 1N63C 1H7NA 1Q6GA 2PP3A 3GXTA 3NYDA 1F8WA 4YL2A 4QITA 3S2LA 1OD8A 1VFOA 3NL2A 4BZYA 1P5BA 1G6CA 2BC1A 3B8IA 1VDVA 4LXFA 1AFSA 3AYRA 2UZ9A 2FMNA 1OX4A 4RDYA 3G2GA 4B91A 2IXUA 1TJRA 1XI3A 5F2LA 5CJNA 3DESA 3PJUA 4RE4A 1QI5A 1V79A 3NQ2A 4TQTA 4YU1A 3R2GA 2FTYA 3BW2A 1SSDA 2WOWA 3WBEA 2Y63A 1W5PA 3QPEA 5M3WA 3KTCA 4DYKA 5KEZA 3S42A 1WKDA 2QCGA 3AWNA 3CU2A 1XCWA 4GUHA 3SRFA 3NZQA 3TQVA 3SCPA 4F0HA 4JHOA 1SZFA 2QDDA 1RALA 3FW6A 4B9YA 3CHVA 3KL3A 2Z6IA 2DIEA 2CBIA 3B0XA 3M16A 9CGTA 2PGRA 4JS3A 4J57A 3EWYA 1G69A 3QR1A 1TPVA 2W91A 5TIMA 5I09A 1G7VA 2GK1B 1UPMB 4Q8VA 1XIBA 5HJXA 4L1GA 1F76A 3RAOA 1TVLA 5GNXA 4K8DA 4MJ2A 3VD7A 1T99A 3A3XA 4IMAA 2GQWA 2X41A 2PWGA 3LD5A 3SUTA 4B3KA 5BOOA 4KWOA 1VAHA 2VI0A 1ADDA 4H7ZA 1KFLA 5EA9A 3CMGA 3WYZA 1CEOA 4BS0A 4PN2A 4LTSA 1OADA 1QHZA 3KOXA 2GSJA 3S2JA 3V18A 2MUCA 4S3JA 2V5JA 1ISWA 4FXFA 1ZENA 4OKDA 7PTDA 3MUY1 3CZEA 4EOUA 1D3CA 2WSRA 1PCKA 1JPKA 3NPVA 4LUTA 4KF1A 1LBLA 3NPUA 2VR4A 3URQA 4F48A 4V1XA 2BVTA 1FDZA 4NAFB 2DT2A 1K9DA 3HIJA 1NOWA 1NDAA 3AIBA 3VX1A 1TR9A 3ONBA 3G8RA 2WSYA 1UWSA 1SU5A 1CXIA 3G1XA 1GQJA 3FEMA 4WGXA 2UY2A 3J7HA 1LUCB 3W86A 1VPXA 3N2MA 3W53A 1A0EA 4YTUA 1VFLA 2Z28A 3A4AA 3NS1B 1OCQA 4H4SA 3FKKA 1GYNA 4MUZA 5CC6A 1YKWA 4CCEA 1J12A 4NX0A 3SECA 4D8LA 2D0HA 3WFLA 5A69A 2ACSA 3FYOA 2J7FA 4G2DA 3UXLA 4KIEA 3TAOA 5EY5A 3PB0A 2ZVRA 3APTA 4TXEA 4AMAA 1E9LA 4AD2A 2ZC1A 4GZEA 4IQLA 4RDVA 4PTXA 3H2AA 1XIEA 3ZS4A 1JDEA 4S38A 3GX9A 1KXVA 2WVUA 4CNUA 4AZHA 4FPSA 1U1JA 4UTIA 3RFAA 1WO2A 1MUWA 4GLEA 3T55A 1WP6A 1RVKA 3APYA 2VMFA 1AQMA 2J74A 3TQPA 2PWFA 4O0KA 2R6OA 4Z2IA 4CQDA 4XD5A 3OVPA 1VPQA 4Q8NA 4BF5A 3WJWA 2JF7A 2DZAA 3WLTA 1OSEA 2FPYA 5JH1A 2UV8G 2QCMA 1E1CB 2PBGA 2CWXA 4QFUA 1I9CB 2FB3A 1ADOA 2YJQA 1D3HA 1BWLA 1S2AA 3NXFA 3RNDA 1TMLA 3L9CA 2E3ZA 4NG3A 3VIFA 4NQ1A 1FWGC 3IPWA 3REQB 5DRCA 1B9ZA 2X2YA 1H41A 2HVMA 3TR9A 4M52A 1UD2A 3PHAA 4RV3A 3SCTA 3S4TA 1Y5VA 3QSRA 3K8MA 5LIYX 4DM2A 3W6YA 8TIMA 4GXWA 1DE5A 3E0WA 1UHVA 3TX9A 4PCNA 4DRSA 1KW1A 4IP7A 2GGGA 4W4QA 5D9OA 3W1LA 4LBSA 1R9YA 4R7WA 3KLKA 4F0SA 3UY8A 4HSHA 3PS7A 3S0CA 3QSTA 5E0FA 5LSMA 2GWNA 4M7TA 4OBTA 4JCMA 5FJPA 1EBHA 4JKKA 3P82A 4C1KA 3H4KA 3NVYB 2C8NA 2HRWA 1KV5A 1HW6A 2YL9A 1PKMA 2QMKA 2J13A 1CT5A 3MMDA 1W17A 2IW0A 1JL8A 2E8ZA 4I6VA 2HK0A 2YIHA 1OIFA 4HSNA 5LNVA 2GGIA 1UWRA 4GJJA 3W1RA 1E6NA 1E51A 4WVXA 3TOYA 1O68A 1FEAA 1LBMA 1W0MA 2GVEA 4LVDA 1JUKA 3WMSA 4BQ5A 3NQ6A 4KQNA 4J28A 1FHUA 3HFTA 1BPLB 1R87A 4L7ZA 1SW3A 2ZRVA 1E6QM 3W2NA 1I2PA 1V6WA 4YHGA 4QNEA 2VGFA 1ZAJA 4Q33A 1S38A 4MAZA 3ES8A 3O05A 1OJTA 2WVVA 4XVDA 2WP6A 4H4UA 1WDRA 2ZZBA 1LYXA 1QXLA 1C3FA 1SVDA 3NDYA 3WQ5A 1XLDA 3TYAA 2V3DA 1IT7A 4LAZA 4FF5A 3QKEA 4BCEA 4D6IA 1A5OC 5AYZA 2PU0A 1DJXA 3TTQA 1AL7A 5LHEA 1O7AA 3UWEA 3ARVA 3QW4B 4MADA 4AG0A 2PDGA 4HNUA 2DZSA 3CK5A 1BWVA 2EEXA 3AYSA 4GGHA 3QMTA 4MM1A 2IPGA 3UD6A 3WEOA 4NJJA 4WD0A 2PDBA 2ZZ3A 2XH7A 1VBJA 4AAJA 1DXEA 3M46A 1ICQA 1W1PA 2OEJA 3DYMA 3TN4A 4UQ9A 1EWDA 3UXAA 4LC6A 2Q71A 4QLJA 1UR4A 4Q4MA 4ZB5A 4ASTA 1MQRA 2XN2A 3BTNA 3R43A 3HFYA 2X2GA 3VIMA 2RUSA 3MZ2A 4LUIA 1ZJHA 1DHKA 4L56A 3E1F1 4O4WA 4GQQA 4KEVA 1QHPA 5T9CE 4JIQA 3R79A 6PTDA 3CUXA 3PTKA 5CPNA 1CGUA 3LK6A 3GDTA 1HGYA 2CLKA 4DELA 5JCKA 4R3UA 1NP0A 3ONCA 5LNRA 1KBJA 4JX6A 3ECQA 1NQKA 2QR6A 3WK0A 4HKPA 3N19B 4ICNA 2I56A 4XAZA 5IXEA 2XZ7A 3C56A 3VZYA 3NQCA 4Z2HA 2DSZA 4N9DA 3WNOA 4KWUA 2J8TA 2OKOA 5C6MA 2Z6JA 1MZRA 2A2IA 1IWAA 1D7FA 4W84A 2WVSA 1OFOA 4DNAA 1W9UA 2GGHA 3WDPP 2Q3OA 2YYUA 2PGEA 4IFKB 4ZSUA 4EANA 1GTHA 3C0JA 3TTOA 3S6DA 2H8XA 1V3IA 3LG3A 3PPCA 3WLMA 1Q4NX 4NX5A 3KBMA 2OWCA 4ERGA 4EMJA 3MT1A 1SUXA 2VZSA 4ZTXA 3QH2A 3SZ8A 3WH7A 4DJEA 2GPTA 3W7LA 2WQPA 3I7QA 3P74A 4QS6A 1FTXA 1DQUA 4C6QA 2PLKA 1N55A 3Q58A 1QO5A 1WE5A 3LHVA 3P84A 3VC5A 3SUVA 3E02A 4BR1A 2CHRA 1ONXA 1OFAA 4YTTA 1K9FA 3SEPA 3UP8A 2XG9A 1RLDA 1GT8A 3JZUA 3W6LA 5C9WA 4H4YA 3DYOA 4NY2A 1ZTVA 4L9ZA 7A3HA 4UOQA 2PWDA 1QTWA 3F5LA 1B4EA 4AZCB 1DL3A 2F84A 4LCSA 1BVZA 2CPUA 1ZBVA 1XCFA 3SM0A 4QGCA 1AK5A 5A2CA 1WUEA 1Q8AA 3E6EA 4DI9A 5I79A 3OA5A 2J88A 4XIAA 4NKCA 2HROA 5LYRA 5TQLA 2PLJA 3OEXA 3M43A 2QMJA 5DF0A 2POZA 1UBSA 2C14A 3V3WA 3N4EA 4HJWA 4GZ7A 3PFMA 5D9MA 5DT5A 3BUVA 3LA4A 2TPSA 1XIHA 3URHA 3DDMA 1PTDA 1YPIA 3MCNA 4U2ZA 3WDIA 5FEWA 3HV8A 2VC5A 3GRTA 1LL6A 5A8PA 4RCXA 1QCWA 3OGVA 2YLAA 2YDAA 1CLXA 4X22A 1QOPA 3CTLA 3NEHA 4OUIA 1H2JA 2CWNA 4D6JA 3OB8A 1JYWA 3CT7A 2FGBA 4JTFA 1E9YB 1TJ1A 4L4OA 3KS6A 4HOXA 3G1AA 3AMCA 1FH9A 3S1WA 4P2VA 4EWJA 2HBVA 3PFRA 4EQRA 1NF0A 3VDBA 1FVPA 2UY3A 2Z1WA 1FWWA 4AH7A 1PXGA 2LLEA 4E2VA 1GYLA 1SFTA 4JN7A 4CN6A 4GH1A 4HYRA 1AL8A 3MWAA 2OGJA 1M7JA 4L4PA 3WD0A 1OHLA 2WW5A 4KFOA 1KR0A 1ZPTA 2QUTA 5F4SA 1HKVA 5FD0A 2GR0A 1OVDA 2PDUA 5AYYA 4JGDA 1EGVA 2AQVA 2I7GA 4N7QA 2DZUA 1VHCA 1V51A 2OOFA 4HU3A 3THUA 3V7PA 4D6HA 3BZGA 1Q6QA 3OU8A 1VF8A 4GGBA 1H7PA 2ISFA 3COTA 1OFBA 4QJ3B 3BWWA 1LL4A 4MJ4A 4EE9A 1L9WA 3E38A 2BMBA 3RPTA 5FIPA 3POHA 1FHLA 3RIKA 1QK0A 5GRTA 1FP9A 4I5XA 2RJGA 1EF3A 4G5DA 3NQVA 5H6HA 3GG1A 4EWND 2PDHA 1RVGA 1XLIA 3FIGA 3TYDA 4US5A 2WPFA 4AD1A 2FQIA 2Y61A 4ROPA 2HMCA 3RJYA 1SZRA 2CW6A 2J9ZA 1EFZA 1EJSC 4HK7A 3B0UX 4V2XA 1XBZA 4AD3A 3KVMA 2PLMA 1MI3A 3RNMA 2PC4A 1EJWC 1NTHA 3EOLA 4H19A 4R34A 4LEQA 2A4AA 3A9IA 3CPGA 4DPQA 2CDUA 4FF7A 3R4IA 4U31A 3THAA 1UWAA 5K3VA 5A2BA 1UD4A 2Y0FA 2PTDA 3LB0A 1A3HA 4KGJA 1LRTA 3W2JA 4H6EA 3ARZA 1E9IA 2AL2B 3KL5A 2J66A 1UJPA 4A3RA 1G67A 1KV8A 1RUSA 4FS9A 1RK5A 3Q2DA 1W1A1 4UTTA 4K6AA 2X09A 1FKWA 1ALDA 4UMCA 3W1UA 3FX4A 4ZQCA 3M4HA 2VDHA 2NLIA 2OPJA 2YCLA 3T44A 1SFSA 3KBNA 1UUOA 5FJUA 3WLKX 4H8HA 3VOFA 1PUDA 3ZYZA 2DW7A 3H24A 3EEGA 3GVQA 1QW7A 2NWSA 5LNWA 3LI1A 2RJHA 4XZLX 2WM1A 3GR7A 5H2ZA 5FSEC 1R85A 2JE8A 4ZL1A 1ZHAA 4KPLA 1KB3A 3RMEA 3MWCA 5GVJA 4TMCA 1MDRA 1K8YA 1FCUA 3VKCA 4ALDA 5M1TA 3QFBA 3MS8A 3SJ3A 1W6TA 1RM6B 3EA1A 1WAWA 1Q6FA 3CO8A 3LB8A 1BGAA 4QJ5B 1PEZA 4JL2A 4G9PA 1VEOA 1QPQA 3D5HA 4E6MA 3GIPA 4GBDA 4HB7A 1HJQA 4FR1A 4XQ6A 3F2BA 4HSOA 2EHHA 1AW1A 4ZOEA 1Z42A 2INEA 3TWAA 4LY8A 3WZ0E 5CBIA 1EEXA 1HP5A 2ZDSA 3HF3A 2OGYA 4AEEA 4XZIA 3NGJA 3VIGA 1JIBA 1KR1A 1X39A 3CIVA 3GRIA 4X0NA 3CV7A 3DK8A 1A49A 1E55A 2BGQA 4PE8A 2JGQA 3ITTA 4X3ZA 1GG0A 1W3JA 4R88A 2FZMA 5E93A 1T41A 3KOYA 3A4XA 5AHNA 3L21A 2P0IA 4M3PA 2XFWA 3LPGA 3K13A 4FOJA 4BHYA 1L6SA 4LWWA 3G8EA 3TA6A 3T9PA 3ETRB 1TJ0A 1QUMA 1X2HA 4Q4QA 5DBTA 4K1GA 3QM3A 2EG6A 1S3TC 5J5DA 3ORWA 5DCBA 3UZJA 1RK6A 1XBXA 1V0LA 3VZZA 2XN1A 4MF4A 4H4XA 4KWSA 3SURA 1TQJA 1E72M 2IKGA 4AHQA 3M7WA 2GVGA 4HQVA 5FI8A 4JN8A 1OJXA 3AIWA 4EM4A 2OOGA 2XWEA 1Z41A 1BF2A 4ZQNA 2A8XA 4JCLA 1FDYA 3UVIA 1JNDA 2Z26A 2V3GA 1GUVA 2O92A 4LB4A 4IG2B 4LUSA 3NSNA 4MFEA 2XYLA 4XX6A 1EC8A 4Y9NA 2R14A 3IJ7A 4R7OA 3CZ8A 1EP2A 4JIPA 3PSWA 1TSIA 4D6EA 4C6IA 4GVFA 4L61A 2ZC8A 4UR7A 2ZRXA 3P14A 2EQ9A 2QCDB 3MBFA 4IGNA 1ZAHA 5HPOA 5A6BA 4LUJA 4D1IA 3HGRA 1A4MA 3CT2A 3EB4A 5E9AA 1HN1A 3CB3A 1YTEA 2ISSA 3AAMA 4KW2A 5GQBA 4DX3A 4MGGA 2RKXA 3CHFA 4L9XA 3UWVA 3SRDA 2MANA 1PL9A 2ZE3A 3W0KA 1RLCL 2OZ0A 4J4KA 4AQLA 1A5MC 1F8MA 1E0UA 4G1KA 3AXHA 1DXIA 2CBVA 4CNSA 1H50A 2XIIA 1EDQA 1OX4B 1AA1B 1SPQA 1P6BA 4A8IA 4S23A 3TW6A 4TV6A 2PRMA 1IZCA 5CZ0A 1QMLA 5CAKA 1WUFA 1TX2A 1NOUA 5CPOA 4IJCA 1XBVA 5I06A 3K4AA 1PSCA 4FOKA 1KTCA 5GNZA 4E0CA 3W1AA 1JZ4A 1PZ0A 2D3LA 2HNEA 1E0WA 1BYCA 3A9BA 5DMNA 3UNDA 4YWOA 1KLZA 4H9YA 4HPHA 1GVYA 1KFBA 1V6YA 4J27A 3UA3A 4M1RA 5A6TC 4FX8A 1QI0A 3AXKA 3KW3A 3L68A 3W72A 3DFOA 4CD6A 4RW3A 2QAEA 2Z2BA 1MEHA 2WBKA 5A6SA 3MSDA 5KETA 1X38A 2YBVA 2YGYA 5I78A 5DANA 5L9FA 2E8YA 5JCMA 4J1OA 1LORA 5KZDA 1CENA 1DJNA 3N12A 1BVNP 3TYEA 1BHGA 1TKKA 4HVXA 3W85A 4HYVA 3ITYA 7TAAA 3L65A 4Q8MA 2QPUA 4PTVA 3E0FA 3F4NA 1K7FA 4GACA 4LYPA 1C91A 4NRRA 4QDPA 3GU2A 1R3SA 1P0EA 1E43A 4LUTB 4NT0A 4CU7A 5PTDA 2WHKA 1W9BM 5BOFA 4NUWA 5A2AA 5LGXA 3UGRA 2RDXA 4QR6A 1I2NA 2XWDA 4IPLA 3HG5A 5HWMA 2DQWA 3SIZA 3AUOA 1IWPA 1ZALA 4PMNA 3SCWA 3EGJA 4UTUA 2VM8A 4PBGA 1NFBA 2RH9A 4KRZA 2J8FA 3EUB3 3PPGA 4LS1A 5K4ZA 3CH9A 2PRLA 1PKNA 1QNSA 4G7EA 3O6DA 2OFJA 2YDQA 3MHFA 2NT1A 2OEMA 5BOEA 2YVFA 1XPGA 1RQHA 4P8XA 1DE6A 1WZAA 3WQ4A 4GQ0A 2PWEA 1JYVA 3MMWA 3VD4A 1GPFA 3D0CA 1K9TA 2HEJA 2NT0A 2CLFA 4FHAA 2R9ZA 1BKHA 3KVLA 3NYZA 3ZZ1A 1W3TA 3CZGA 3R10A 3W37A 5FOOA 1OK4A 3B9EA 2XH2A 1OCBA 3KAOA 1F4AA 5AHFA 1OD0A 2VTFA 4B5NA 3S8HA 1LF1A 2WVTA 4EVZA 1PS9A 1XDJA 3W7DA 3ABQA 3UPWA 2E1DA 1JCJA 3DIPA 3CPUA 4QX4A 2ZFAA 6CGTA 4HCLA 4LRSA 4DY1A 3S1UA 3QR3A 2PUZA 4NI8A 1ISYA 2OX4A 4CQCA 2PWHA 3TQKA 4BA0A 3IS4A 2C79A 4ML9A 5KZ6A 1RPXA 2BHUA 1A5SA 2VOTA 2VDIA 3DN5A 5CLWA 1M7PA 5BXRA 5IBXA 4K7YA 3E0IA 4HZ7A 4AVOA 1I0BA 3DG3A 2FGLA 2OZ8A 4LW7A 4TIMA 3TDFA 4GUIA 2O7QA 4ORMA 1I6NA 3WK3A 2ADAA 2PDQA 4FALA 4M5PA 3LN3A 1CXHA 3C0LA 3W1NA 1JQVA 1PIFA 2J75A 5AC6A 2ASHA 6XIAA 1JPMA 3LUTA 5FEPA 4UZSA 3GD3A 3MV01 1XPYA 4OVXA 4J3XA 3VIPA 1KGXA 4WK9A 4EQXA 4S2BA 1IEQA 4QISA 3CH0A 3UWZA 2FJKA 5A8OA 3OVRA 4D6DA 2EQ7A 1PE1A 4Y96A 4MLJA 2BB0A 3TV8A 3CUIA 1V6TA 4S3AA 1G1YA 3AO0A 4GY1A 4IHCA 4S3GA 7REQA 4UUIA 3R5EA 5DXYA 4DZAA 1GJUA 5A6JA 4JHZA 2ZICA 3FNDA 5KMYA 4IJRA 2CBUA 1LBFA 1K4QA 4J2MA 1VYRA 1R0MA 1C8QA 4OOUA 2PZNA 4MWAA 1DWGM 1FQ0A 4C5ZA 4JQ3A 2TMDA 3CUHA 3UXKA 1G4SA 3W7RA 1B5TA 3VIHA 4TVDA 1UD5A 3BV4A 2NXGA 1A3WA 3ZIZA 4F0RA 3T7VA 2I16A 2DZTA 3AS1A 3H4XA 4H2HA 3ELFA 4XO7A 3PZUA 4QXIA 4D72A 1FO4A 1JCYA 3M44A 3E2QA 1GEQA 3FVDA 3NQBA 1LRQA 3HO8A 4QJ1A 5CZSA 1QRQA 4ZR8A 4U3AA 5A6KA 5FJOA 3UG8A 4ZTYA 2WPEA 3IGXA 3L67A 2R1LA 3TXZA 1BWKA 2ZZ6A 3T07A 2DVUA 1TJPA 2WVVB 2QF7A 4KERA 1Z89A 2WCGA 4B5XA 3WG6A 4OTKA 4PMQA 4JIEA 1P4CA 2FMOA 2CLIA 1H0IA 1F3XA 4MYAA 3SN4A 2DZXA 4ZO8A 1JCNA 3ARRA 3NPWA 4KMQA 2W3SA 4RDZA 5CZTA 3DXIA 2Z24A 1CBGA 5BRPA 4IIGA 4GIRA 3K4DA 4J3VA 4N4PA 3CGEA 1XGEA 4O1EA 1OX5A 2ZA1A 4ADWA 3CGBA 3EPNA 1I0DA 3EB2A 4MHBA 5EBAA 4P8WA 4AIUA 1LTDA 2VCCA 1FP8A 5D9PA 4WY0A 5I3GA 2C0AA 3S83A 3JU2A 4X2PA 2RABA 4HMNA 4HU0A 3HURA 2WJEA 3IV8A 4NZ1A 1E6ZA 4K8HA 3CM4A 1DQXA 3GAKA 3BAXA 1YMYA 1AW5A 1OC6A 2E9MA 1ITXA 4AY8A 1R30A 2WKJA 3L0NA 3N1AA 4QNWA 3M0XA 3STFA 1UWQA 1EC9A 1XRFA 3SN1A 1UPPA 5I24A 5JCNA 3B9DA 5CG7A 4Y9MA 2ANUA 2BX7A 4GOAA 3O8AA 3PTQA 3URNA 1IHIA 3BAYA 2PDPA 2X0SA 2WZHA 4AUBA 4XIMA 1BXCA 3TFCA 2Z29A 4JBRA 3ZSTA 1IYXA 1OYCA 1K3UA 1GRAA 3IJ6A 3WD4A 1DOSA 3GH4A 4X61A 4IX2A 4AFYA 3TNBA 2BXVA 4AY1A 2YXOA 3TW9A 3UU0A 1LOSA 2GZXA 4GNKB 3PTDA 4ZXOA 1G94A 3OQ8A 2HK1A 1V6XA 4HNVA 3GKAA 4FB7A 3SCVA 4GNJA 4U5KA 1AW2A 2V2CA 4UTWA 4ZEPA 1Q66A 3MO4A 2ZUVA 4DQWA 4ZO6A 2OMAA 4S3EA 4I6KA 3CGCA 3VKDA 3ZR5A 1T7LA 3BAWA 1YHTA 1JDFA 3T2QA 3RG6A 1HVXA 1DIDA 3ES7A 4ZMGA 1YLVA 5EMLA 4UOZA 1QFEA 4I8YA 4NXKA 3FN9A 2XTKA 4PODA 2XVLA 1E6PA 3W26A 4O11A 2YVJA 3F2CA 4RPPA 1DXLA 4GQRA 5FAGA 5HNUA 1W1B1 4RZ5A 4YS1A 2VURA 2IQTA 3SUWA 2X7VA 4UCFA 1VIZA 1EO5A 4KT2A 1UBPC 2EPHA 3QKZA 3ITOA 1E5JA 2QHAA 5BXSA 2WPGA 1E4NA 4M29A 3W7CA 2WWCA 4LNYA 5A8NA 2QPSA 2DPEA 5CSYA 1IGSA 3HU7A 1UUMA 3P62A 1V5XA 3KOFA 3UJFA 5CC3A 5BRBA 2YPIA 2F6XA 3I10A 4EF8A 1C92A 3LPFA 3TE9A 3KP0A 4IWWA 4UR9A 3VMPA 3LTPA 4AC7C 1IT0A 3H7RA 1KFCA 3B40A 3A7UA 1J8VA 3GB6A 4F0LA 3SSZA 4KIRA 3SQPA 2V69A 3CL6A 3WD3A 4O8AA 1GVQA 2WC4A 4PB5A 4GO8A 5CCZA 4GINA 4L5ZA 4Z0SA 1TUFA 4EQSA 1KXHA 3MP3A 2FZDA 4R85A 1OY0A 4CN1A 3VD9A 4NZ4A 3GXIA 2W4XA 4UQAA 4KKXA 1TV7A 1RY0A 2Y6ZA 4XK2A 3GG0A 1YBQB 1VFFA 5HAOA 1E71M 1VFHA 1MXSA 3V5CA 1OFDA 2ZCGA 2GVLA 4W5ZA 6TAAA 2XFRA 1GV4A 1FWCC 3DKJA 3VYLA 1XIGA 5I03A 4YHEA 4C1LA 3L4VA 4MY1A 3WUGA 3W73A 2J7HA 1DWAM 3LHWA 3VO0A 2FB2A 3U9IA 5T26A 4QHRA 3VOJA 4JDYA 2ISVA 1IQ8A 1MNZA 1ONWA 2AL1A 3BCDA 1CECA 4BFAA 3B0PA 2W67A 4DO6A 4MDPA 2VFFA 3AROA 3TTYA 3QHNA 3JZEA 2WANA 5DMLA 3MPGA 1DQWA 2Q8ZA 2CFYA 1J5TA 1GQNA 1N8IA 2CZ5A 5G5GB 1L0PA 3CAQA 1GG1A 3T0BA 1YPXA 3FSUA 4LF2A 1S1PA 4RNHA 1QI3A 1XUUA 1M9HA 1WKFA 4C6PA 3AZTA 4FX9A 3N2OA 4PUEA 3WSUA 3FS2A 2QPXA 3CQIA 2D20A 6REQA 5AYXA 2PZ0A 1C7SA 3WLIA 4H41A 1AD4A 3WBYA 3THQA 1PWLA 2O4QA 1ZJIA 3W07A 1A50A 2E28A 4NYYA 5HWJA 2W27A 5KZEA 3OLDA 3G6MA 3GH7A 4NYUA 2YAUA 4ORIA 4ZE5A 4LYRA 4KEUA 2AKMA 3NGFA 5BNKA 2D23A 3CEUA 2ZOXA 3AXIA 3V5FA 3I4EA 1EHAA 2RHGA 3WDQA 4DJED 2CKSA 3LMYA 2A3HA 3GNNA 1E4MM 5K4XA 4K1WA 2BVWA 2BOFX 1V7YA 5I6SA 1GVOA 3OLIA 1ECQA 1W5OA 3UPMA 3L4TA 4W87A 1V3LA 3CLWA 5G4EA 2X0YA 5TD4A 1B3XA 5DCDA 2ZE0A 4UTKA 4BI7A 2VNCA 3FG2P 1KBKA 3SR6B 5AYIA 3RDKA 2EQDA 3G24A 4M80A 4WDUA 1MEWA 5CZJA 2E40A 2VC7A 1KM0A 2HSAA 4WKHA 1QATA 4P7LA 3DH9A 3MSGA 4MSSA 1Q6CA 4UFMA 4AW7A 5AZ1A 2IQDA 1DKWA 1UR9A 2YCEA 3DG7A 3IIVA 1JD7A 3VNLA 1E15A 1X8FA 4ZSTA 3A6OA 2ZZCA 2D0FA 3W7PA 1WOAA 2WHMA 2NQ5A 3OLEA 4O1BA 3PAOA 3VC6A 4LV4A 1AJ2A 1WPCA 3IRDA 1K1DA 2X16A 4Q7IA 2OJPA 4H8VA 1J0KA 3W4RA 1XLAA 1ML1A 2OWXA 2GOUA 1JF6A 3L0KA 2ZUSA 1TELA 4H83A 2C3DA 4JFUA 1OYAA 4WZHA 3FXGA 3LCXA 5I77A 1GYMA 2CNCA 1Z44A 3EWCA 3A7AA 3MI3A 3ZVIA 3NTYA 3URBA 3FHAA 2XVNA 2EJAA 1NHRA 1KCXA 3E2RA 1N62C 3WQOA 1BLIA 2ZWYA 2QUUA 1ZBCA 2VR2A 4EMWA 4TVYA 1P7TA 3SCUA 4FI4A 4WDXA 3R07C 3OYZA 4YIWA 3THDA 2MNRA 4GUGA 3K46A 5HMSA 2RFGA 3EPMA 2FIQA 2H3DA 4N9CA 5H8PA 3PM6A 1L6FA 3G0XA 5AZ0A 1T3QC 1NY1A 3SGUA 2IPJA 4NJHA 3GXNA 4HA4A 1ISXA 2NX1A 1W5NA 3TOPA 2DJXA 1MQQA 3FDGA 4EPEC 1OABA 3U2CA 3C61A 5JXQA 3AI0A 3ZO9A 1CWYA 1N60C 3CV6A 4NILA 3TQ0A 4RXFA 3GFZA 4MY9A 3KX6A 4O13A 2X8HA 2J79A 3QR0A 1FDJA 3WO8A 4NZ3A 1K77A 1MQPA 2EJ1A 4HMDA 1F8IA 5REQA 3RF9A 1W2PA 3WQPA 2ZUNA 1XH0A 2WHJA 2X1UA 4PULA 2WM0A 1IEXA 2FHBA 1BRLA 4GABA 1P1MA 3IAQA 1H61A 1MRQA 2J77A 2ZZ5A 1A5UA 3W7JA 3WQCA 2WCSA 3ABXA 3UJ2A 4LC8A 2P3ZA 1XD0A 1DJIA 4UQBA 3UA4A 2J62A 3GXPA 4D71A 1ME8A 3LRLA 3M07A 4CU8A 4O17A 1TZ7A 1G0CA 9RUBA 4DWSA 4CCCA 1YRRA 1ZAIA 3C8NA 4JTEA 3CB8A 4IQDA 1IIHA 4GZIA 3DFPA 3TH6A 4GVGA 3LXCA 2ZXBA 3TP4A 1I75A 3CWHA 2E0PA 1TIMA 3LQGA 4BK9A 2O9PA 4C1NA 1PTGA 4J2PA 1TFVA 3A3WA