3R0UA

Crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : tartrate and mg complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
362
structure length
362
Chain Sequence
b'VSKIIDIKTSIIKIPLKRTFITAVRSTNHIDSLAVELTLDNGVKGYGVAPATTAITGDTLQGMQYIIREIFAPVILGSDLSDYKQTLELAFKKVMFNSAAKMAIDLAYHDLLAKEQDISVAKLLGAKANSIVTDVSISCGNVAETIQNIQNGVEANFTAIKVKTGADFNRDIQLLKALDNEFSKNIKFRFDANQGWNLAQTKQFIEEINKYSLNVEIIEQPVKYYDIKAMAEITKFSNIPVVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMESPAGILATASFALAEDITVADLDPLDWVAKDLYSDYITFNEPNIILKDNLKGFGFNLAENLYF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enzyme of enolase superfamily
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Francisella philomiragia subsp. philomiragia
molecule tags Lyase
total genus 119
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3r0uA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3r0uA01
4E6MA 2MUCA 4H2HA 3H70A 2AKMA 2PGWA 3T8QA 1MUCA 2OVLA 2GGGA 4H19A 4DWDA 2PTYA 1WUEA 1DTNA 3BSMA 4IZGA 1OEPA 3STPA 1SJDA 3VCNA 3CK5A 1ECQA 3CT2A 3TOYA 1YEYA 2QDEA 3TJ4A 2OG9A 3TJIA 2OQHA 1P48A 3R11A 5FJTA 4E4FA 3TW9A 2PPGA 4JHMA 5EU9A 1SJCA 3ZLHA 1SJAA 2GGIA 5BOEA 1BKHA 2GGHA 3P0WA 4HNLA 2OPJA 3JW7A 1E9IA 3HPFA 2ONEA 3RR1A 3ZVHA 3NFUA 3I6TA 1BQGA 3TTEA 4J1OA 3VFCA 4F4RA 2OFJA 4K8GA 1L8PA 4GIRA 4K1WA 3V5FA 2PP1A 3SQSA 3CAWA 4H83A 3BOXA 3JVAA 2PP3A 3D47A 3OP2A 2CHRA 1W6TA 3R25A 4KPLA 3ZLGA 3N4EA 2HNEA 1XS2A 4X2PA 3OPSA 2O56A 2GSHA 4MGGA 2QJNA 4IP4A 3NXLA 4GGHA 4IHCA 3BJSA 2PTXA 1WUFA 3RO6A 3GY1A 2XH4A 2QVHA 3DG7A 1PDYA 5ENLA 2QDDA 2RDXA 1R6WA 2AKZA 3FCPA 3FVDA 3U9IA 1JPDX 4GYPC 3N6HA 5BOFA 2PP0A 3MUCA 3UJRA 4FP1A 3D46A 4HCDA 2PCEA 2GGEA 3IJIA 3DG3A 2PTZA 3PWIA 3FXGA 3UJEA 1TZZA 2AL2A 4FI4A 4IP5A 3SN0A 1KKOA 2I5QA 2P8BA 3R10A 2HXUA 3ZVHB 2DW7A 3RGTA 4MMWA 1JCTA 5FJUA 3JZUA 3OZMA 3MWCA 3RITA 3OTRA 4IL0A 1EBGA 3GC2A 4EWJA 3R0UA 1FHUA 3OZYA 4ZA0A 4ENLA 5J04A 3ES8A 3UXLA 1MDLA 1NU5A 3CYJA 3SBFA 4HCHA 3UGVA 1ONEA 2XH7A 3MSYA 4DYEA 2P88A 4HN8A 4IL2A 4M0XA 3PFRA 3DGBA 2AL1A 1ELSA 3DERA 3QN3A 1RVKA 3K1GA 1MRAA 3EEZA 1EC9A 3MQTA 3P3BA 3PK7A 2POZA 1P43A 4YWSA 3SN4A 2MNRA 3U4FA 1EBHA 1TE6A 3DIPA 2HZGA 2PSNA 3H8AA 2NQLA 2HXTA 4KEMA 3UJFA 3T9PA 2OX4A 3H12A 2P8CA 1TKKA 1SJBA 3Q45A 3DEQA 2QGYA 4JN7A 3T4WA 3H7VA 3TCSA 3IJLA 4HNCA 4DN1A 2XH0A 3N6JA 2AL2B 3UCCA 4ROPA 2P0IA 4G7FA 2FYMA 4A3RA 3IK4A 4DXKA 4HCLA 3SSZA 3RCYA 5FJRA 2ZADA 3VA8A 3CXOA 4JN8A 1EC8A 1FHVA 2OZTA 4Z17A 1JPMA 4G8TA 3CB3A 3GD6A 2OZ3A 2PU1A 2QJMA 1F9CA 3IJQA 4E4UA 2PMQA 3DFHA 3ENLA 3ZLFA 1JDFA 3FYYA 3KUMA 3I6EA 2QQ6A 2FKPA 3VC6A 3MZNA 3R0KA 3B97A 2XGZA 1MNSA 1KKRA 3EKGA 2PTWA 3QPEA 4GMEA 3NZGA 1IYXA 3N4FA 4K2SA 5IDZA 1NELA 4GISA 4KWSA 3UJ2A 3UJSA 2PU0A 1R0MA 3UXKA 2QJJA 3FV9A 4A6GA 2GGJA 2P3ZA 4ZCWA 3QKEA 2OQYA 3FJ4A 3DESA 1EC7A 3SJNA 3DG6A 1PDZA 3TWAA 4M6UA 3OW1A 3P93A 3NO1A 4J3ZA 3Q4DA 4E5TA 2XSXA 4GFIA 5FJOA 3MKCA 3SN1A 3RRAA 4GYPA 3UCDA 2ZC8A 3ZVIA 4MKSA 3PWGA 2OO6A 7ENLA 3R1ZA 4H1ZA 4E8GA 4HPNA 4HYRA 3S5SA 3THUA 1KD0A 3TQPA 4DX3A 3VCCA 3QLDA 3S47A 2GL5A 3VDGA 3ES7A 6ENLA 1KCZA 3I4KA 3V3WA 2OKTA 1MDRA 4DHGA 3GO2A 2PODA 3VC5A 4A35A 2GDQA 2DW6A 3TWBA 4KT2A 2PS2A 3DFYA 3MY9A 4IT1A 3QTPA 2XH2A 2OZ8A 1XPYA 2PA6A 4Z1YA 3V5CA 3T6CA 3DDMA 3V4BA 4GGBA 2PGEA 2OLAA 5FJPA
chains in the Genus database with same CATH superfamily
4YL2A 2WM1A 3DFNA 2PDYA 3WLQA 3MBFA 3AZRA 3VD7A 3K4AA 1MEHA 2B81A 1JEZA 5IHRA 5F2IA 2VZOA 4B92A 3DFSA 3T42A 4GWEA 3G1YA 1EQCA 3CZLA 1T7LA 2C3CA 1JDEA 4GK8A 1XHGA 3NS1B 4NEVA 3LOTA 2ISWA 3U3HA 1X6LA 5FJTA 1NY1A 1I60A 4RUBA 5AZ1A 4YVXA 2RDTA 3OYZA 3IUDA 4PZVA 4O0QA 3LCFA 3NM1A 1E1FA 1FFRA 3BGAA 2BHYA 1J6OA 5FOOA 3FLUA 3PG8A 3QVQA 1H41A 1GUVA 1HGYA 4Z2GA 1PZ2A 3FEQA 3ITLA 4NAEA 4TOQA 4EQRA 1I9CB 3HFYA 4YNGA 1QOPA 1J0KA 1S38A 2EPLX 3M0YA 4AD3A 4GINA 1C92A 3H26A 2GOKA 2GYIA 3F03K 1X8FA 4DJDA 4KEZA 3R4IA 3W86A 2CLKA 3BLFA 3M6DA 3SZ8A 3WDJA 4JKMA 5D2XA 3VOJA 5A6JA 2P5NA 4J35A 1NHPA 2HNEA 2TYSA 4PBFA 2JK2A 2W0UA 4GIEA 4B2DD 1X1NA 4MNKA 1KM3A 3BCDA 1DIDA 1R7OA 1WDRA 1P5BA 1ZUAX 5LKYA 3TE9A 3ARQA 4IGSA 3AIUA 2FPVA 5IBXA 1TO3A 1R3RA 1JNEA 3BG3A 3KCLA 3WQDA 4MJZA 3W53A 2I9UA 3G1FA 1GG0A 4G9PA 1OG0A 4Z2LA 2EAWA 1KWKA 3LNPA 1US0A 3MMTA 2WNWA 3PWIA 5M3WA 4DPPA 1UW9A 1STZA 1WPCA 3B8IA 5CPTA 5FAGA 1DWJM 3U6WA 3TMQA 1ME9A 4FI4A 4O1DA 1KTBA 3N18A 1KBIA 3V5OA 3GNNA 1N82A 4QCFA 1AFSA 4NAEB 3B0UX 4AZ7A 5FJUA 3P8IA 2PZNA 5XIAA 1JNDA 3POCA 4HOXA 4L4LA 2OU4A 4WGHA 4TV5A 4JGDA 2X8HA 1FHUA 2C14A 4JOMA 4Q8PA 3VYLA 4LYKA 5FESA 4CLMA 3W7OA 4PMZA 2QAFA 3ZMRA 4LBUA 3PNUA 3ES8A 4I9MA 4XZMX 1NU5A 2A21A 5JUVA 3SY1A 3WUFA 4ROQA 1JI2A 2ADAA 1GZJA 4HN8A 5A5WA 1VFTA 1QATA 4IMEA 1UQZA 3L66A 1EZ2A 1OFOA 1UWUA 5CG0A 5IHSA 4LS1A 4NHVA 3W22A 2ZUSA 2V3EA 1CYGA 5I24A 1FWTA 2X0HA 3DN5A 4KCWA 3TYAA 2O55A 2XVNA 3OLGA 2CWXA 1JROA 2FJKA 2NQLA 4JTDA 3WG6A 3UJFA 1K4QA 3PNZA 4DJFA 5CC6A 3NNTA 1TKKA 3NEVA 2ODOA 3TDFA 1Q85A 2ZUVA 1Z32X 2QCCA 3LPGA 3VGFA 3QLLA 1ME7A 4DN1A 1CDGA 4AMAA 1F73A 1P4CA 1E6PA 2PDGA 4P8UA 3SM0A 3C4UA 3PZMA 3WQCA 2J6XA 2WC7A 3PZUA 5LGZA 3HG4A 1H51A 4AX6A 4ZGYA 4PMOA 1CTNA 3AJXA 3F4CA 3UYCA 1B3YA 1H2IA 3QHOA 3RR4A 1V51A 3IJQA 1P0DA 1BG4A 4HA1A 1GRAA 1XSJA 4H01A 1KCLA 3BAIA 2AMXA 3R12A 3NQVA 2PWVA 3KHDA 3OLEA 1A5MC 3DKJA 4M24A 3GRSA 1JPKA 2WNZA 1GVYA 1EPVA 4UFKA 5DMLA 1P6BA 2J7EA 2XFYA 4CNSA 2WKLA 2C3ZA 3F5LA 4QJ1A 2XIIA 3WNOA 4O1BA 1JYXA 5B7YA 2OEJA 2PF8A 4AU0A 1ZCCA 1MW1A 2WLZA 1SR9A 4LJ3A 4I9TA 2J6VA 1YDOA 4A6GA 4M81A 3VKBA 4JTRA 2P3ZA 3IGXA 4Q7BA 4WCJA 2V0TA 4L7ZA 2HRWA 4H4TA 2E9LA 1L6FA 1ZK7A 2J88A 3BG9A 5LIXX 2D24A 1CGYA 2X41A 5I3GA 5BXTA 1DJNA 3TW6A 1YKWA 2QW5A 3L2IA 5AOUA 4C60A 5CAKA 3W24A 4UFIA 4GYPA 4KWOA 1RP9A 4NF7A 1U22A 2A3AA 1K8CA 1XYLA 5DQPA 3NQFA 4LX4A 3T0DA 3RN6A 4XX6A 5EBUA 4GC3A 4QEHA 3HV9A 2LLEA 1E15A 3TSDA 1KD0A 1SZNA 2D22A 4WOQA 1O7AA 1LPFA 1XLLA 4PCTA 3HGOA 1U1UA 1HIZA 2WZHA 1OZMA 3AMCA 4HQVA 3B9JB 2R1PA 1JEHA 5E0FA 2ZWZA 3R13A 4OBRA 4N9DA 1YX1A 3QV9A 2VL4A 1JRCA 4DYKA 1LWHA 3CIWA 2DT2A 1GRBA 2GDVA 3ZR6A 1ZY8A 3FOKA 1ZFJA 4IUOA 2B7QA 2XVPA 2DSVA 2V2CA 2BBFA 2HS6A 3R5EA 4ZO6A 4GPNA 1FX6A 3RAOA 1TUXA 3QY7A 3WZ0E 3T6CA 3AC0A 4YVPA 1QTWA 1YIXA 1UBPC 3WY1A 4GI6A 2D23A 3LK6A 1I2QA 1UKOA 2ATMA 1JCYA 2ZOXA 9RUBA 3VGHA 4R88A 1V3LA 1FWNA 2BCPA 4HPJA 2O7QA 3BSMA 1RQBA 4QSFA 1RXOB 3VKJA 4ZQPA 1RCOB 4NZ1A 3WDQA 1THFD 3O0FA 3W7IA 2E5BA 1YEYA 2ZX6A 1RD5A 3ZT6A 3QY8A 1YADA 1NFGA 3BGGA 2W61A 4TIMA 1VLWA 3KS5A 2X1RA 3LQGA 3UWZA 3C0LA 3B8WA 4J3XA 5JIWA 2GGIA 1BKHA 1GOKA 3GXNA 1R2RA 4IFKA 4YIWA 3NR0A 4Z1AA 3O8AA 2OPJA 1GHSA 2VEFA 4LNCA 4AZGA 1BQGA 3B05A 2ZCGA 1NQ6A 1VCGA 3OBAA 1TVPA 3K2GA 3LQLA 2YA2A 3UW6A 4E2OA 3VNZA 2X99A 2VWTA 3EZ4A 3LCGA 3ZR4A 5AECA 4MJ2A 3QYQA 2V5BA 1DQXA 4WSKA 2RABA 3UXDA 1VPXA 5M1TA 1YPIA 5AYIA 2VZVA 3APYA 1BPLB 3M0XA 4MAZA 3BPWA 1KQZA 4ATDA 1D7KA 3FA4A 1ITQA 1AJ0A 3VABA 2WOWA 2NW0A 4GGHA 4QS6A 1EHAA 2CLMA 3EPNA 5T91A 3VNDA 4GQQA 4YYFA 2YLAA 4X3ZA 5C5YA 4KCUA 1VAHA 3HMCA 2BXZA 2J9XA 1W9VA 3UY8A 1E6SM 4B9YA 2HROA 4PL1A 1GV4A 1A5SA 2PTZA 3M43A 1TWDA 4O1AA 4PYSA 1Q6QA 4IFKB 1BYDA 4WJ8A 1DJQA 1Q1WA 2BWGA 1DBTA 3ABXA 2DUAA 1W9PA 3M16A 2PWEA 3N6QA 3GNXA 4WDTA 2VWSA 5BCAA 3OZMA 1MFVA 3MWCA 4YS1A 3O1NA 4YTUA 4E38A 1S5TA 4F40A 2WMKA 4PMDA 1KRCC 3M4HA 2BNJA 1EBGA 1W5NA 1IHIA 2VEPA 4O28A 3KE0A 4E3TA 1YQZA 2FGBA 4XQ6A 2Y89A 3V0SA 1U5JA 4M19A 4IP7A 3CB8A 4MNLA 1RK6A 2JEPA 3AXMA 1O5RA 1JR1A 4M6QA 4HCHA 4Y7EA 4HK6A 1IR1A 3LCHA 4DLFA 3CEPA 1A0CA 3EKLA 1GPFA 1RUSA 2CZVA 3CMGA 2Y7DA 3DGBA 4PCPA 4R9OA 1OJTA 2E4TA 3QN3A 4Q8WA 2NV1A 1MRAA 1Q6OA 4KESA 1XRFA 1VFSA 1JYNA 5D8WA 3PAJA 4ERAA 3O7UA 1OX4A 3VM7A 1TE6A 4OUEA 3C3UA 4HT3A 4K8DA 3MVTA 2Q71A 3OVQA 4X22A 2PDLA 2HCVA 4X9YA 3T9PA 1LRQA 3AO0A 1BTCA 2OEMA 5ABTA 1IEVA 1XLDA 1M7JA 3BQ5A 3NL5A 2VC6A 3Q45A 1TYPA 4IICA 4L4MA 3DEQA 1PPIA 3CHEA 1EKOA 2VR2A 1ZDLA 3C5QA 4DAFA 4KETA 2ZZ0A 3PY2A 3OEXA 3IJ8A 3MUZ1 3LXDA 3A9IA 3W2LA 5M5DA 2Z1XA 3SADA 2ZKMX 4DRSA 3PZTA 3PTKA 3JR2A 1J5TA 2PWUA 1MXDA 1HGWA 2ZADA 1GORA 1WA3A 3VA8A 1P6CA 3EPMA 1J11A 1CT5A 3LCXA 5AC6A 4H4UA 3E0WA 4US5A 2QJMA 2C8NA 3HTWA 2I17A 4ZOBA 4EPDC 2ABBA 1RK5A 5CSYA 1G5AA 1GVQA 1FKXA 2J24A 1DWAM 5A3HA 3T81A 5JQ9A 4D6IA 1VJIA 2DIEA 1R3YA 3TFCA 1OC7A 4EMIA 1U83A 2I5IA 3KDOA 4DELA 3S42A 4C6KA 4IQEA 5FS8A 5C55A 3I6RA 2OCZA 4N42A 1UH2A 2OLSA 4AD0A 5DX7A 2E5AA 1CGUA 1JGMA 1LRNA 3HJEA 4IWWA 2E28A 5HQLA 2V81A 3IGHX 1UP0A 1OX4B 3CHVA 1ZSXA 2E6AA 2R91A 4WHBA 1KN0A 1H1YA 4LAZA 3LPFA 3DG6A 1PDZA 1B57A 2Q01A 5DY3A 4PBGA 4A3UA 7ODCA 1F8MA 1EH9A 3MWAA 2C6QA 3MYPA 4GH1A 3VMOA 4XZHA 5CBJA 5K9XA 2Q8ZA 4GBDA 4NJJA 4CUCA 1KGXA 1GWJA 2OO6A 1PWLA 3N12A 4HYRA 4M8UA 3SAZA 3VCCA 1NF0A 4YN5A 2IW0A 2EO7A 1GW9A 1BVWA 1OK4A 2WLYA 3R7MA 5HNUA 2DDXA 4U5IA 3EXSA 3G1VA 1FWAC 3SUTA 3OHMB 2QGHA 2WVTA 3OO2A 1DE6A 4MB4A 5K7JA 2R1NA 1ITCA 3NQCA 1H0IA 1GESA 3TYUA 1RBLA 4DHGA 3EWDA 1V7YA 4FXSA 2UY3A 3GO2A 1YXCA 4DZIA 3TQKA 1M7XA 4A35A 1NDVA 1XBVA 2D69A 4H50A 1GETA 1Q7MA 2I57A 4Z0SA 2E6FA 3NM3A 3DFYA 4JX5A 1OT1A 3E5BA 5HINA 1GVSA 5CPSA 2FTWA 1UPPA 3KM8A 5LNRA 2NQHA 2VEMA 1MEWA 2CETA 3V4BA 1KC7A 3GR7A 1XP3A 5FJPA 4F0MA 4G5DA 3H6OA 3BXWA 1X8CA 2ZA2A 2YSWA 4H4SA 2WO5A 1I2NA 1XYCA 3R94A 1WUEA 4LEQA 4B5VA 3A4AA 3ARXA 3TXZA 3N4AA 1SZEA 4DF0A 1G01A 2CW6A 2BODX 3LBCA 1BSLA 3QGVA 1B3VA 1MUMA 2A6NA 2BY2A 1OYBA 1CXFA 2GVYA 3GG7A 3E96A 1QPQA 1ZGDA 3TVAA 1LORA 5LIUX 3UG3A 1V02E 1ZAIA 2WCGA 1W3HA 3VMNA 3QW3A 3ITXA 4JPGA 5JH1A 4GRSA 3ZJ7A 2QLYA 3JW7A 4EF9A 2DEPA 3GUGA 3I6TA 4C1NA 1FO4A 5I3DA 3URNA 4LCRA 4D6GA 3CGBA 4HPXA 2E5CA 4JTJA 4M52A 4V33A 1EDQA 2YA1A 1RJQA 4EMWA 1TA3A 2OOGA 4GUIA 2PC8A 4HPHA 2YA0A 1BEUA 1PAMA 1UR8A 1C9DA 1XWYA 2Y7GA 2YCEA 4Y96A 1Q1RA 1W6TA 4DO6A 4KPLA 3ZLGA 1LLWA 1RALA 1KFLA 1LBFA 1W9XA 2YW3A 4C7GA 3MUY1 3PUGA 3I3DA 4H4WA 1EEPA 3EX6A 3N3MA 1NTHA 1UWTA 1DL3A 5G4EA 1KXQA 2QJNA 2X05A 4W88A 1K9FA 4IP4A 3RJYA 3BJFA 1K7EA 2DIKA 3WFLA 3QFEA 5ECUA 2W3ZA 2Y70A 1EYWA 1OZQA 3VIJA 2Y5SA 4OKDA 2VO5A 2ZE0A 1E6NA 1F74A 4KRUA 3W87A 1OG6A 2OLHA 5D4YA 4D72A 3L21A 2HNHA 4CD5A 3NURA 3JRKA 3K5XA 2EPOA 1NDWA 1TMLA 1HVXA 4KCTA 1GVEA 1W37A 2IQTA 2VNCA 5AHEA 4C1NB 3UXAA 1E51A 3H2OA 6PTDA 2NQJA 4GJIA 2FQIA 4PUDA 3WBAA 5BRBA 3B8UA 1JF5A 1XIIA 4MADA 1E4IA 2VDGA 6XIAA 3F7JA 1U33A 1KFBA 1TA3B 4RKAA 1NFPA 1EP1A 3LCIA 3OZYA 1KBKA 1ZU8A 3CH0A 4IG2A 1MDLA 4PUUA 3AZTA 4HD5A 3TZNA 2EQ9A 1LVLA 3CZEA 4ZO7A 1E70M 3SCUA 1TJ2A 4Z1CA 2QXWA 4OECA 1IT8A 1BYAA 1VFOA 3E6EA 4M7TA 5CPOA 2JFEX 4HNTA 3MMWA 1XPGA 3WJSA 4KFPA 2NT1A 3BCFA 3U4FA 1QO5A 1GG1A 1S1RA 1HFBA 2ZVRA 3W1UA 3H8AA 1WYIA 4NYUA 4WZHA 1ZAJA 1W54A 2OX4A 1UUOA 1SVDA 4IMAA 1ISZA 3AMGA 4GLEA 1SJBA 4ML4A 3NA8A 1I6NA 4IMFA 1Q3NA 2DZAA 4HTBA 1QVBA 4AWTA 4TTUA 3UCCA 4B3ZA 1KQYA 2HPIA 2BC0A 4BF9A 2VOMA 3WH6A 3UA3A 1AVAA 1M41A 1R85A 3OYXA 3LDVA 1EDGA 2UY5A 4UTFA 2ZUMA 3CZGA 4JQ2A 3FYPA 2VX5A 4UNKA 1MMFA 3UU0A 3FHQA 3TC3A 4L56A 1KGUA 1K1DA 4RPQA 3WIJA 3I6EA 4J27A 1ZS2A 4AD2A 4IG2B 3R0KA 3PWAA 1UR1A 2PDFA 4I6KA 1MNSA 3UF9A 3N2OA 1V6WA 2KX9A 3B9NA 1KKRA 1I75A 3OZPA 1US2A 3UEQA 1DXEA 4P7NA 2YCJA 3W25A 3UA4A 1NELA 3PPHA 4HYVA 1XHCA 3HW2A 2PU0A 3H24A 5A6SA 2YIHA 4P7RA 3T09A 1DWFM 5JCMA 3COTA 1F3XA 3ITVA 4DI8A 3Q2DA 1DJGA 4M29A 3K8KA 1VPYA 4D1IA 2IXUA 4XO7A 2E6YA 4B5XA 4LVFA 1SW3A 8XIAA 4L65A 3ARWA 1CECA 3VOCA 3WH7A 3AS2A 3LBOA 3NQAA 3LM3A 3E49A 1S1PA 4PR4A 3NAVA 1Y65A 1W3LA 4D6HA 1E5JA 2OSYA 1QNQA 3CHDA 3THUA 3S5SA 3H4WA 1UR2A 4HMDA 2D3NA 1BFNA 2PC4A 4H7ZA 2VZSA 4IIBA 5JBFA 1EJWC 3UPBA 3Q94A 3AIWA 1S2UA 2QUUA 2QUVA 3QFAA 4DUWA 1YDNA 1YXYA 2YPIA 1A4LA 3BUVA 1BF6A 3CQ0A 2PZ0A 3EWCA 3WLMA 1TYGA 1YTDA 2AMGA 4A3YA 3LI1A 3SUWA 2PDXA 3HQPA 5KZ6A 2VX7A 3GHRA 4GH3A 2PWFA 3IS4A 3N29A 3KHJA 2PS2A 3MY9A 3QTPA 2PDQA 1PV8A 1MOKA 1KM5A 4CNPA 1ZLPA 4CCZA 4DM1A 4MDPA 1LROA 3GW3A 1JXJA 4KBXA 1H7XA 1GVRA 3BV4A 1S2VA 4RJEA 1TRIA 1HL8A 2H90A 2XINA 1M04A 3VU2A 1OFEA 3MA8A 2GVEA 1MXSA 2OVLA 4LF1A 2FPTA 3DXIA 5H8UA 1HKWA 2BFGA 2EG6A 3BG5A 2F6KA 3VDBA 2P3EA 5AY7A 1ITUA 3OLIA 2V38A 3UNTA 5ABFA 3TA9A 3WBYA 1NEYA 2W4XA 3LSBA 2G96A 2DU2A 3VCNA 3HFTA 3E2SA 5JCIA 1XBXA 1QI0A 4E4PA 1RBOB 3UD6A 4Q4KA 2D0FA 4E4FA 4LAOA 3RFAA 1WZKA 3TW7A 4EX4A 3W7KA 3F2CA 2A2IA 4AXKA 2GGHA 2GZXA 3GTNA 3RX4A 2RAGA 3E74A 2J7GA 3AOFA 4GI4A 2AAAA 4FEZA 1KV5A 1H63A 3U0HA 1JF6A 3GR8A 3PUOA 1OY0A 1XC6A 3OG2A 2PRMA 1XCFA 6TIMA 3B40A 2DT3A 5A6BD 3GTFA 3MDUA 1WO2A 4L9ZA 1HKKA 3A3XA 4L6OA 4NZCA 4LIIA 1G7VA 3W7HA 3WQWA 3AU6A 1QNVA 3CHFA 4CCDA 1GEHA 2J13A 3VIIA 5I0DA 2NVCA 4S3CA 2PWHA 4CD4A 1QI2A 4JKKA 4H9ZA 3V16A 4FNUA 4MVAA 4ZXOA 3VD9A 1K6WA 2JIWA 2PWGA 3SECA 5HJYA 4ATLA 8CGTA 1T8QA 2PRLA 3KTXA 4ZTYA 4NIRA 4ZO8A 4EE9A 3GAYA 4H8HA 1CEOA 2I7GA 3SSJA 1TYTA 1FWCC 1Q65A 3B0VC 5ABFB 2G3FA 4AFYA 2O4MA 3BAXA 2YVGA 4YTRA 1KXVA 2AKZA 3GVQA 2FTYA 1XLAA 4JTQA 4GQ0A 3SRDA 4C6LA 4DY1A 1FA2A 3VZZA 5CH9A 5GNZA 1RCQA 4TO8A 3N2XA 1D3GA 3GDTA 1OJXA 5DO8A 2KZHA 5D32A 2E9BA 4UR9A 4FO4A 3LB0A 1XLBA 2Y88A 3L0NA 3T2QA 1B4EA 1FHLA 1LTDA 5BW6A 5LGXA 2VX4A 4JFSA 4EPBC 2YVFA 3KOZA 3VAVA 4FX9A 3EB2A 2X1IA 4HA0A 1CXLA 3CZJA 4PMNA 4RLIA 2ZA1A 3PZIA 4GCXA 4RZ6A 4MZ1A 2NSOA 4MNMA 5D37A 3WX7A 1ZX9A 4HU4A 2ICSA 3LI0A 1G1YA 5DXXA 1A5CA 5D09A 3F4VA 2VCCA 3QMSA 4Q8TA 5CAHA 1NWUA 1XLCA 3WF3A 3AN1A 1M01A 3CYJA 1RD6A 3NEHA 4H7CA 2QAEA 2OMAA 1JUKA 3GD3A 3QOKA 4FMVA 4MB3A 3LPOA 2ZZ5A 4IL2A 4M0XA 3MHUA 1DJXA 3EX2A 3U8GA 1XGZA 4RDYA 5D9PA 1HP5A 3S6DA 2CC0A 4IGNA 3G18A 5LA0A 2A6LA 3LBMA 4O16A 3S5NA 2PBOA 4O53A 1QOXA 3KVLA 3SCNA 4TMCA 5AYBA 8TIMA 2WHMA 1PEZA 3K4DA 3QBUA 3N2BA 5DLCA 1IIHA 1CGTA 1KB3A 1QO2A 4MZ8A 3LGEA 4LC8A 1F4HA 3M0IA 1L6WA 3IJ6A 3TN3A 3QY6A 4LCQA 2EGZA 2CLLA 3G6LA 3U5UA 4CQAA 3S1VA 3AHYA 1W8SA 1NOUA 3EWZA 1Q6FA 5DT7A 1EO5A 1OM0A 1JDCA 1XDMA 2PDPA 5BMWA 5CGQA 1ZENA 4J3VA 1VYRA 4J56A 2FGLA 3FW6A 2YX0A 1J2WA 2X7WA 1C9WA 5ABEA 3VGEA 3A4JA 1VP5A 3DKLA 4AH7A 1LG1A 3ITGA 3HU7A 4PSPA 1FBAA 4JL2A 4JFUA 2R14A 3ITCA 3BC9A 4Q22A 2E68A 1O95A 5H91A 1B4KA 4JDYA 3OGVA 1J79A 2WMJA 1TUFA 3FV9A 3KL0A 5D9OA 5HQEA 1DHKA 3QKEA 1YW1A 5BWAA 3NSMA 5F4SA 2R24A 3W1QA 1HJSA 3KLKA 3RX2A 4PMJA 5BZAA 2FZDA 2XSXA 4AWSA 1OCBA 3VINA 2BMBA 4XUGA 4ZFMA 2DP3A 3LZ5A 5I78A 2E8ZA 4A21A 4Q6XA 4ORMA 2QHAA 1SZFA 1XSKA 5LZLA 4FLOA 3SEPA 1JXKA 4K7VA 3NQ8A 3SRKA 3QRHA 3S47A 2ZXAA 4RV3A 5I23A 4ZO9A 4DUXA 2WMGA 1E6ZA 4QAIA 4C6QA 3ISIX 3S9ZA 4U33A 1TX2A 4O12A 4XAFA 1UMLA 2CCRA 2NX1A 4W93A 2OKTA 1MEIA 2X0SA 3IARA 2NX3A 1KXHA 4DPQA 3O0HA 1FKWA 3BJTA 4OZOA 1GJWA 3AISA 3U5YA 2CZFA 3ZYZA 4KT2A 2B31A 2XH2A 1EO7A 4H4IA 4MPQA 1Z69A 2XM2A 4UTWC 4OOZA 3UVAA 1GEQA 4LH8A 4OWGA 1Y8BA 3KBVA 4NX0A 2QV4A 1QASA 1K70A 1YXDA 4IJCA 1GW1A 3OJGA 4Q8UA 1W5MA 3P84A 4U2ZA 4UTHA 4W4QA 4Q8MA 1ZJIA 1K8XA 2Y5JA 1E1EA 2ZA3A 4QCEA 1U5HA 1FY6A 4JDRA 2WPCA 3W2JA 1SJDA 3TCEA 3SW6A 2V3GA 3B06A 3KBWA 4HU0A 2FMNA 2BGQA 1W17A 5FJJA 5A69A 1VPQA 2Z0IA 4HGXA 2XN0A 3CU2A 1B2YA 3PS7A 2FZ8A 6ALDA 3HJZA 3P0WA 3KS6A 3MTWA 5FEWA 2PB1A 1FFVC 1EP3A 4LXFA 3MKKA 4FNRA 1TPDA 2VC5A 3C2RA 3QMRA 4Z0JA 4RNIA 3BMWA 4I5XA 1MO9A 1ZXIC 4IPPA 2WQDA 2VFDA 3UZ5A 2V67A 1TJ1A 3LPPA 4XZNX 4GX9A 2F9RA 2OOFA 2DGAA 3S5ZA 4GO9A 2YDSA 1S2AA 2C0HA 3W07A 1OCNA 3RNMA 3QZEA 1TWSA 1RY0A 3S9IA 1C3FA 4ZMGA 1JL8A 4O50A 2NXHA 2PP3A 1LLZA 3FAWA 3OP2A 3R25A 1KGWA 5I3IA 4V15A 4QE5A 3H55A 3NVWB 4FOJA 5CGTA 3TXVA 1QU4A 3H4KA 4ZR8A 3S1XA 3DH7A 5CSRA 4LSBA 3WENA 3HF3A 3MI3A 1KBBA 5KTLA 5A95A 1AZ1A 4N6FA 1K3UA 4J3UA 2XH4A 1E4LA 1R6WA 4NQ1A 4C6BA 3U9IA 3T0TA 3FK4A 1LT8A 2EHHA 1JPDX 2AAQA 4FR6A 4AHOA 2DFAA 4GC4A 3UJRA 5U4NA 1PB0A 1MO0A 2WBAA 1C8XA 4AF0A 4PH6A 1Y0EA 2DUZA 2GVJA 2VC9A 3GKAA 1FP9A 1JRBA 4D6DA 4C6MA 3QQWA 5LNWA 4MJ4A 2NUWA 4JTAA 1I8JA 3WNLA 5U25A 2I5QA 4MTVA 2H8ZA 2P8BA 3INPA 2EEXA 3G77A 1UUMA 3WFAA 4KIRA 4PUKA 4Z2KA 2QCNA 1S2WA 2V5DA 3JZUA 3PTQA 5HUOA 3TAOA 3WQVA 2WOIA 1TPUA 3W38A 1G4SA 2WQPA 4D71A 3CL7A 3R0UA 5CSSA 3DBPA 3Q58A 1GYLA 4ES4A 1W3IA 3GU9A 2WC3A 8XIMA 2Z7GA 5F4WA 3H2MA 4ENLA 5A6MA 1NDZA 1W2VA 3OA5A 1TWWA 3W7LA 1GOWA 3UZYA 5FF0A 1R5YA 3T08A 5I00A 5FS6A 1FEAA 5DFAA 2VMFA 4DYEA 1AQFA 4S23A 4JCLA 3PJUA 3KWSA 4DF1A 3M0LA 4TVYA 1OFQA 4Y90A 1XGDA 4TVWA 1XYMA 5K4ZA 1TPB1 3RU6A 3I3EA 2D2OA 2OODA 4I5RA 1YRRA 2BX7A 2OZ0A 1G4TA 2Y1HA 3UR8A 1PIIA 1HL2A 2XYLA 2E0PA 1HT6A 2ZUWA 2XTKA 1V0KA 1OK6A 2RHGA 2OO0A 2YYUA 4Z1BA 4LTSA 4LB3A 2VOTA 4XVDA 4KEVA 2O4QA 1CXKA 5HNRA 1SR0A 1XSIA 3B0YA 4IQDA 1KM4A 3LXCA 5HXMA 2EPNA 2FYMA 4NJGA 3M5YA 4OVXA 4C6JA 4NL1A 1CCWB 1ZCOA 2NV2A 2QUTA 4ZODA 2YFNA 1FWDC 3G1RA 3TKFA 3MO7A 4N9EA 3MMDA 2YBVA 3T2PA 2YB1A 4HK5A 2OZTA 4Z17A 2DVTA 3W6MA 4KS0A 4E4UA 2YL6A 2GK1A 4QDWA 4CEUC 5G1TA 1Q6LA 3WF0A 3MI6A 4W5UA 1IEQA 3NO5A 7TIMA 3R79A 3H2AA 2J7CA 1J96A 1KFCA 3GSMA 2NVAA 3AS1A 4RNHA 1ONFA 3UJ2A 4ZOHB 4PB4A 3AIEA 1V59A 3TH6A 1TRDA 1JZ8A 4EACA 3UQNA 3JU2A 2Z25A 1F76A 3M0VA 3TEVA 3L4VA 2GR0A 3WLRA 3GDRA 1XXXA 4H9XA 3VE7A 3IJDA 4YTSA 1TE1A 1O6IA 3DYMA 4IMGA 3CQJA 3WDIA 3ZO9A 4JQ4A 1EB3A 5JVLA 1FWBC 1XFCA 4NRSA 2BP1A 2J7FA 3LB8A 1LYXA 3UG4A 4XTDA 1XRSA 2AGKA 3M5ZA 4H1ZA 1FEBA 4GUGA 4LEFA 1TCMA 2WSQA 1WB0A 2J79A 1XIEA 2PDBA 2BZNA 2CLPA 3VDGA 1QAPA 2ZRWA 1O94A 2ZZCA 1PX3A 4F3HA 2NLIA 1S39A 1GRGA 4PMRA 2B0MA 1JDAA 2P50A 4PB5A 1QPNA 2GK1B 3RK8A 4WJXA 2XN2A 3CQKA 1AH4A 3STCA 1BG9A 1V6UA 5REQA 1EWEA 3AUOA 3A7AA 3GVWA 3C56A 3V35A 1SFLA 1GZ1A 3TWBA 2GQWA 1UZHA 3A4XA 1BD0A 4RW3A 3VI2A 3T2OA 4AZIA 3FA5A 3EUB3 2WPGA 4PUMA 3V5CA 3EDEA 5C0QA 4B5TA 3O0KA 4UCFA 4GE8A 4B3KA 5DN1A 3QM3A 2H6RA 1V5XA 5D8ZA 2YGYA 3TTYA 1KXTA 2AKMA 3DZ1A 3G1HA 4Z2HA 2F8QA 1Q8AA 1DTNA 1CW2A 2PDJA 4LYPA 4MLRA 3A21A 3EEGA 5RUBA 2PDMA 5HDRA 4JEJA 7XIMA 3PM6A 5HMDA 4WY0F 4AD4A 1UA3A 3ZSSA 4FSAA 4OTKA 2OQHA 1W32A 4XG1A 4H9TA 3KRUA 3H2CA 4K8EA 2CNCA 4NI3A 3E12A 1L9WA 4ECLA 2PEVA 3LUTA 2HBXA 3H4GA 2ONEA 3OQ8A 1UIOA 2V5KA 1LOLA 1JCMP 4W8AA 3WF4A 3GC5A 3NQ6A 3WLKX 1L6YA 3NOEA 4O18A 1WX0A 4F4RA 5CZKA 4UTLA 2DQWA 3LD5A 3ABSA 1EFZA 4EM4A 4X2RA 2PP1A 3LCWA 1BZLA 3B0PA 3M44A 4GVGA 4GUJA 5REQB 4CNNA 4GI9A 2DJLA 3W7NA 5AZ0A 4JTHA 1TTQA 4PEKA 4ZTXA 4MWAE 1GNXA 3CUHA 5A8OA 4A8RA 2W92A 4ZE4A 4O19A 5CPNA 4HZMA 1O60A 2VZUA 2FB3A 1DORA 2DT0A 2VURA 1LQ0A 2FB2A 5FEPA 1NAL1 3RO6A 4GJ1A 4OHQA 4KRZA 1DPMA 4DYJA 4Q8VA 3S2MA 4U28A 1RQHA 4EKJA 4HOWA 4J3SA 3W72A 1Z42A 3Q37A 4GYPC 2W79A 4JFVA 1WZAA 3LLDA 3FEMA 4N6EA 2IUZA 5XINA 3S2CA 1LL7A 1V79A 4Y9NA 1K4GA 5LHEA 2HVNA 4GY7A 3M0MA 4JS3A 3VXGA 6CGTA 3PULA 2WHLA 2QJHA 3FXGA 3APTA 3BURA 4PUWA 3APGA 1XLJA 1Y7VA 2VYOA 3OIXA 3EOSA 4PMYA 5JMUA 3FVMA 1OSEA 4HHHA 4XZ9A 3GG8A 2BOEX 2G3MA 3GX9A 1QNRA 2NWRA 4I9JA 2IPJA 1JCTA 1M6IA 3ARUA 1OF6A 4I8DA 2FZMA 1H0GA 3NDZA 1KLYA 3VX1A 3BANA 1ICSA 3THDA 1X96A 3L9CA 1RQEA 1LBLA 2J9YA 2X2GA 4CD6A 4QTGA 3CEUA 3W1NA 3HM7A 2Q8LA 1JGIA 1Q8JA 4PCFA 3ZSTA 1AUSL 4I3GA 1GREA 4ALDA 4HKPA 4TVUA 1EUNA 1GCYA 4LVDA 4UTJA 1W31A 5AHFA 4WXYA 4GYKA 3L7RA 2C1GA 3V7PA 1Y5XA 1RA5A 1AD1A 5AYXA 2Y4SA 4HVXA 4AVOA 3BICA 4Q8NA 4L1GA 5LA2A 3RJXA 3DIPA 1IWPA 4IF2A 5E5CA 3G24A 3BSHA 1CPUA 3QH2A 3SR7A 4XZWA 3CPUA 3C6CA 1DJHA 1QDSA 4UZSA 3VM5A 1UKSA 4MB5A 3GFZA 2Z00A 5IFPA 5FF4A 4GY1A 4HZ7A 1IGSA 4BEQA 3UWEA 3TSMA 1XLEA 1ZMDA 1V0MA 1E71M 5JIPA 2WHKA 1B9ZA 2DSKA 3VKDA 2OR2A 2INEA 3WL0A 1OFDA 1UKTA 1VHNA 3L2LA 3GXDA 3DHPA 1VC4A 2AOSA 3P2VA 4JTGA 1G7UA 3ANYA 2VENA 2YAUA 5A1AA 4LAKA 1YTEA 5K2ZA 5CBBA 2J74A 1FHVA 2C0AA 5FEZA 3AUJA 1YBQA 1UA7A 1QI3A 2W9MA 1ONWA 2FPYA 2X42A 4R27A 4POCA 3PG6A 4WX2A 1K9EA 5GNYA 1PKMA 4CCEA 3TFXA 4KWUA 2XGZA 3HGRA 5FMHA 4IMCA 4IIDA 1T99A 3T0CA 3LGDA 3OGRA 4PTXA 3ABZA 5EB8A 1ISYA 3R8HA 4Y9AA 4H4PA 4FB7A 2R9ZA 4CD7A 3QMTA 2W63A 1UG6A 3GLCA 2YJQA 6TAAA 4GIAA 3WLIA 4QHRA 5I7GA 3Q6JA 4P8XA 4ADTA 1IQ8A 4KFOA 1TPH1 3QV8A 3ITOA 1UROA 3NZ1A 3SI9A 3NQBA 3QR3A 4V27A 1JCNA 1VFUA 3HOJA 3GXMA 4QGCA 4M6UA 1GERA 3URQA 3EPOA 1V08A 3L12A 4JIIX 2O7SA 4C6OA 1ADOA 4CN4A 3SN1A 3RRAA 3VGBA 4HBKA 3A3HA 5D05A 3QTGA 3RPMA 3L5AA 3V36A 3SJ3A 3K46A 3VIGA 1DXIA 4MKSA 1QPRA 4S3GA 3ZM8A 2QKFA 2WZTA 2A8XA 4JTKA 4BKNA 1KO0A 4EXQA 3QV7A 4UTMA 2XGBA 3NVTA 3LXAA 3ES7A 2V3FA 3NQ2A 5FF3A 1CXIA 4JY8A 8A3HA 4CQ8A 1RLDA 3VOGA 1YBQB 2HISA 5FS9A 2A7NA 3VC5A 2YBTA 3WLHA 3S1UA 1UKPA 2EPKX 1TX0A 4I7WA 3VCRA 3WK3A 3DK8A 1XPYA 4QFUA 2PFHA 2X8GA 1XLKA 5E9AA 3B9OA 1G94A 5EL1A 3LGGA 1V77A 4F9JA 3A7UA 4F48A 2A85A 5C8BB 3KL3A 2CBUA 4IPNB 1CLXA 2XIMA 1YQ2A 1JCLA 2GJXA 3OC4A 1WDSA 3IAQA 5DMMA 4Z2IA 1HG3A 1E4NA 1R30A 2G4FA 4AYSA 1A5OC 1PTAA 2FVKA 1H50A 1QR7A 3CT2A 4BQ4A 1FH7A 3VO0A 3NDYA 3W7QA 2OG9A 4O0ZA 3W88A 4C6PA 4WDUA 1MUWA 4CQCA 4WQ6A 1N5WC 3KLLA 3M6YA 4LVAA 5T8GA 4B3LA 3T78A 3CGTA 2R9RA 1SJCA 2X8CA 1E40A 1H7PA 3RPDA 1MRQA 1JZ5A 4B2DA 1KLZA 5CC5A 1F7BA 2POTA 4LOCA 2WVSA 3CHCA 3TR9A 3IAPA 3MDWA 3EF6A 1Z7AA 2OEKA 1S7MA 2CBJA 1N7KA 1GT8A 4WIWA 3ZVHA 3CV7A 4NI8A 3AMZA 4KF1A 5HQMA 3WQGA 1EEXA 3UWUA 5I07A 1V3HA 4EF8A 1Q6GA 1IXOA 3N17A 1VBJA 1YE4A 1A53A 2W67A 1OFBA 1JDDA 4NJIA 3ITTA 4X61A 4JNMA 3WLNA 5AC5A 4PRRA 4K1GA 1TMHA 2EKCA 1DWGM 4UTWA 1FUYA 3CAWA 1FHDA 3W6LA 2ZXQA 4MB1A 3BOXA 4P7OA 5BXRA 3LCLA 3F4NA 4LYRA 1FCVA 3P74A 1VFLA 5I09A 2A5HA 3LS9A 4H4VA 2D20A 4S3FA 3GU2A 5FEXA 1R7AA 1LRTA 1GQKA 1Q7QA 4CN6A 2YOCA 2GJXB 8RUCA 1WUFA 3S83A 1H5VA 3C2EA 2EBNA 3CZ8A 3V1HA 3CLWA 4JD4A 2J7DA 1RBAA 2OSXA 4EOUA 1JVNA 2F84A 2QCFA 3LX9A 4H4ZA 4BURA 2XIJA 2G8ZA 1G67A 1XLGA 3NDOA 3KTSA 1PL9A 2BOFX 3UR7A 1W1PA 2IPFA 2QCGA 5G1YA 3N9KA 4D8ZA 3SY8A 3VOIA 3GRTA 3PTDA 2AL2A 1WYGA 1DKWA 2BLEA 4O1FA 4Z08A 1Q4WA 3CASA 3WQ8A 1W91A 3UZJA 3W1AA 1M3UA 5AB3A 3PPGA 3IEBA 3R10A 3ZVHB 1PS9A 4YWOA 2VEIA 1GQNA 4R53A 5KEZA 1GKPA 3E9AA 2G41A 1TV4A 5GJPA 3OTRA 3BZGA 5E6ZA 4GKTA 1GRFA 3GC2A 3HMJG 4BV6A 2YCLA 4H4YA 5BRPA 4S3AA 4BF5A 5BXSA 1JAKA 1AODA 4E8CA 1ZTVA 3WEOA 4OBSA 4M80A 1J0IA 4W7UA 2QDGA 5HANA 5KZDA 1UP2A 4XUYA 1ONEA 1WE5A 3ZQ9A 1OD8A 4DUOA 4NY2A 1XBZA 4AVNA 2QPSA 4GNKB 3E2QA 1FP8A 4E8DA 2AL1A 3FDGA 4W85A 4JCMA 4H4XA 3GH5A 4HNOA 3VVGA 1XLMA 2YDRA 3NPUA 1GOQA 3CMFA 1GKRA 3TP4A 2V82A 3RHGA 3C8NA 2HXTA 1PWMA 3QC3A 1WXZA 2NPXA 3RDKA 4FIRA 3H12A 4HIBA 1V8EA 3IWPA 3EB4A 1F3PA 5LHFA 4LRTA 1WQ5A 1JZ2A 1AW5A 2QMJA 4ZOEA 2VFEA 3PBGA 3H7VA 3WEZA 3IJLA 1R47A 2QCHA 1ICPA 5G4WA 3UZXA 4GXPA 2AL2B 3W1TA 1Q6EA 4ROPA 3KVMA 1O5KA 1KRMA 5C9RA 1TPEA 3CIXA 1OC5A 1OGGA 4ACYA 4DXKA 4HCLA 1IXNA 5FJRA 3FKKA 3SGZA 3KEHA 3VX0A 3BLKA 1CLVA 3CXOA 2E67A 2Y6ZA 4G8TA 4FLSA 2YCLB 1YNPA 2CU0A 4I8YA 1XD0A 5U1OA 1CWYA 1KCKA 3GDLA 1ADSA 3TYCA 3WNKA 3T55A 1W1VA 5CC7A 3EWWA 3WD4A 3MZNA 3TJXA 5DT5A 1N61C 1PYFA 4JQ1A 2OT0A 3R89A 5M2FX 4JY9A 2JQXA 3NTYA 5JBEA 3UVIA 2YBUA 4GISA 3D3AA 1EBDA 3GIQA 3K4WA 1ISXA 3FS2A 1SU5A 5C9XA 2WCSA 4FLRA 3VNLA 1L6SA 5FF2A 4MFDA 3G8EA 3RM8A 5TNVA 2GGJA 2WZIA 3L0KA 3MHFA 2D2GA 4DO7A 2OQYA 5FSDC 3E0LA 3FGCA 1A50A 5D2WA 1EC7A 2QS8A 2ESCA 4QP0A 2ZUNA 4O11A 3UNDA 3TOPA 3S2LA 3AZSA 3I4EA 2XN1A 3W28A 3UCDA 2WC4A 5CEWA 2Z28A 1B5TA 1ZY9A 1FCBA 1K6AA 3DBNA 3TK7A 5LNSA 1BF2A 4X60A 3CO4A 2VGBA 4O52A 1WNOA 4QQ3A 2HDJA 1LQ2A 3ARTA 4NZ5A 1I1WA 2QIIA 4YXGA 1E9YB 2J4GA 1QHOA 2I56A 2GL5A 3M07A 3EDJA 3U2CA 3MV11 1LDCA 3MB9A 3UWQA 1V93A 3MI2A 5FKYA 2B7NA 2TRSA 1I0DA 2GWNA 3OZOA 1E0TA 2ZRXA 4MUPA 2YB4A 3DGZA 2PODA 4E2BA 3VOHA 3K8LA 4BQ3A 1S3HA 2Y85A 4PRTA 5FA5A 2A3EA 2DW6A 1FVPA 3P7YA 3TAKA 1Z9AA 5C7HA 5HWNA 2GRTA 4H41A 2BGSA 3ANVA 3EX4A 6XIMA 2DZVA 1JFXA 2FZNA 3V0UA 1E55A 3T7VA 5HA7A 5D33A 2QIWA 4APNA 5CJMA 3DGHA 2MUCA 1Z41A 5CPMA 4WEVX 4LALA 2REQA 3IUIA 3CV2A 3PZGA 2JBMA 1PKNA 2NQZA 2Z1BA 3CTLA 3TA6A 3FGCB 4E0CA 1JJKA 3LY0A 1XYBA 4GJJA 3A24A 1XQLA 3LLFA 3O6DA 2CLFA 4O1CA 4LA1A 2Z4GA 3CH9A 2VEKA 4KRTA 2Y5EA 3TJ4A 1FIQB 3T0AA 1IT0A 3N2MA 4XB3A 1ALDA 1NP2A 1QW7A 3GDMA 2ZIDA 1XINA 4GQRA 2W66A 4C7DA 3WF1A 3UY7A 4RDVA 3B8TA 1UR9A 1E9LA 3EAOA 3W02A 5JU6A 3RR1A 4I5UA 2WW5A 4XVEA 2VCBA 4WF7A 4HNNA 4S38A 3BV7A 3G8RA 2OFJA 3UG8A 3M47A 1GVIA 2XVKA 4HNVA 1OGSA 3VE9A 3TJLA 1D7FA 3H2EA 3IIXA 1QI4A 2YXXA 3MUXA 3NL2A 1QW9A 2PD9A 2XJ7A 4DB7A 2GOUA 2IQDA 1SO6A 2DH3A 4Q33A 1XIJA 4JTLA 3AQUA 1Q4NX 2HJPA 1R9XA 3WLOA 4ZFCA 3D5HA 4MGGA 1E6XM 1FWHC 3BJSA 3W83A 7PTDA 2FFIA 1VLIA 4UBPC 2E5DA 2REQB 3A64A 1B30A 1QK0A 2E8YA 2RDXA 4V2XA 3FCPA 1UZ1A 1R3QA 5J5RA 3KP1A 3U7BA 3DK4A 3FAXA 3CTTA 1UZDA 3GTXA 3EXTA 9CGTA 3N15A 3V75A 3HPSA 1GRHA 1GOXA 4LGXA 2OWXA 2GQ9A 2JE8A 4XBJA 3II1A 1WZLA 1VBHA 4HSHA 4DF2A 4PTVA 4PRWA 1HF6A 1XG3A 4K38A 2WMFA 1TSIA 1H1NA 4JR5A 2DW7A 4RK8A 2VR5A 3GXTA 4WDWA 4J3TA 3NCOA 5H8PA 4A4AA 2PLMA 1P0NA 3R8RA 2I1OA 3AXIA 1EIXA 2CIPA 4AX7A 1EJRC 3MJMA 4IL0A 4IPLA 3W2UA 1KM2A 2JF7A 3WBEA 2A7RA 3U2ZA 3HBLA 2ZXBA 4M5PA 1YPXA 4HJWA 3SUUA 4ICMA 3PJTA 3VKCA 3L0GA 1UC4A 3IVUA 1EOMA 4A3HA 1H7OA 2G95A 4XBSA 4JHOA 4AY7A 4U3AA 1XH0A 4MM1A 1VCVA 4PMUA 4DBEA 5IFTA 1E4MM 4Y8EA 2VDHA 4UTIA 4QIUA 3U2OA 3ARSA 2P0OA 3THQA 1I2OA 1TQJA 3MQTA 1OX5A 3CQIA 4HU8A 4CNTA 3R07C 1J0ZA 2MNRA 3MJYA 3LA4A 4JIRA 2BC1A 4FX7A 4JYFA 1IWBA 1OABA 1QW8A 3MV01 1W5PA 3LHYA 1G0CA 1F2JA 2Q8XA 4CEXC 4D2JA 3SCTA 1W1A1 1HJQA 3DC8A 4QLLA 1MXGA 3L4TA 3ORWA 2PF0A 3GZ3A 3IRSA 1XR2A 2E25A 1BWLA 2GQ8A 4ZENA 5FD0A 1YNYA 2WWDA 5JCLA 1SUXA 3NL6A 3CUIA 2YL9A 4GKLA 2TMDA 2PTDA 4GZJA 1XI3A 1TPVA 1M5WA 2NXIA 3C86A 4H9VA 4QEEA 2NUYA 2V5LA 3W01A 3EA1A 1K02A 1R38A 1S5MA 3EB3A 1UBSA 3TMLA 1EC8A 4UMCA 1WAUA 2VD9A 3PF3A 3QEZA 4FZIA 3GTHA 4MG4A 1W1B1 3N73A 4JAWA 2RJGA 4ZSUA 1UD5A 1JDFA 3QQ1A 2WOQA 4EXAA 1I0BA 2ZX5A 3RF9A 4PMQA 4JTFA 3AS3A 3GHSA 4EM3A 4GD0A 3WQEA 1J12A 3W70A 4ILSA 1Z3NA 1OBAA 5JXQA 4K3ZA 2PTWA 2W5FA 4UNLA 3GM8A 3A22A 5IDZA 1YLVA 1AH3A 2WWCA 1NIUA 4FX6M 4FNTA 5E6YA 1UYQA 1CZ1A 4LF2A 4X63A 3EKZA 3G3DA 4JBRA 3UWVA 3W4RA 5E0KA 3W2KA 4FALA 2RDWA 2OWWA 1UH3A 3DESA 1AJZA 1C90A 4P8WA 5FAJA 1EYEA 4BI7A 1MFUA 3NO1A 4BZYA 4FNQA 4ICCX 3UPMA 3MT1A 5FL1A 1HZYA 2CZDA 4DNHA 3BZJA 1V03A 2W0HA 3N3TA 1QWKA 2V3BA 2BSLA 5DMYA 4DXVA 4PMXA 4GIYA 3GDKA 2FDMA 4JIPA 1ISVA 1W3JA 4UFHA 1C8VA 1O68A 3QLDA 1TZ7A 4XAGA 4BI6A 2I14A 1LOSA 4F79A 5FIPA 1VQTA 3USBA 3GNDA 1NHSA 1CB7B 3MUAA 4KCVA 2P10A 3I4KA 1RHCA 2DJXA 2V2HA 3B8SA 1PKLA 2VUNA 1SZRA 1W56A 3RYSA 5PTDA 1JYVA 1RR2A 2Z2UA 1H6VA 1EJVC 4TTGA 2GDQA 5TF0A 3W75A 2CKSA 4IT1A 1UOKA 3M1ZA 3DHFA 4KMQA 4CNUA 1XYFA 1SW7A 1FTXA 1PZ1A 3W7EA 3WUEA 4U5KA 3EOLA 4QLKA 1PHQA 1OX6A 2A3LA 3GQYA 1K8YA 2WJZA 3PG9A 3O06A 3T8QA 1E3ZA 1A5NC 5CBIA 4AWUA 1X38A 1UQYA 1OEPA 2BY0A 3TYZA 4FX8A 4J9JA 2HK0A 3FYOA 1C7SA 2WAGA 3NOYA 1UWRA 2Y0FA 3WD2A 4HHPA 2V30A 3T1GA 1P48A 4LS0A 1B90A 5GRTA 3SGUA 2H3DA 3Q67A 5BOEA 4MNJA 2HVMA 2Y8KA 5DCEA 1UKQA 3MO4A 4ATWA 4HP5A 3CZKA 1XV8A 2G3JA 3REQA 1VHCA 4HMEA 4WKFA 3BSGA 4M82A 2H3BA 4AY8A 2ZRUA 3UT0A 3SUSA 5A8PA 3AXXA 3LRKA 2QPXA 3OHIA 1KTNA 2E7FA 5A6TC 3NJ3A 1XUUA 1B3WA 2CFFA 1K7FA 4ZQMA 4UWMA 4AC7C 3D47A 1FCQA 4Z2JA 2HBVA 3N4EA 4XSLA 1M1BA 1FWIC 5FF7A 2O56A 2HQAA 4CNOA 5I3KA 4QRNA 1WCGA 1AQ0A 3BLOA 1FWRA 3LNMA 3ZJ8A 4B4HA 4GBUA 3BL3A 4DVOA 3W82A 5HNNA 3UPWA 2AQOA 1CENA 3VK5A 3GB6A 3F4DA 3R8GA 3L5LA 5A8QA 3GAKA 4PUEA 3PBYA 2C71A 3QGKC 4NSBA 2DZBA 1DJWA 5BOFA 3NQMA 2PP0A 1J0YA 3P61A 4Q6JA 3TN4A 1N63C 3D46A 4HCDA 5FJIA 4JNYA 4XKYA 1J5SA 1AA1B 3KVJA 2VVSA 4G2DA 3FSTA 1XCWA 3PHAA 1UD8A 4KWWA 1O4UA 4BCEA 3DH9A 3ANUA 4W84A 1J8VA 2ISVA 2C3DA 3EA3A 1H1ZA 3B9DA 3WFZA 4RXFA 3REQB 2YYTA 1UD3A 4KH2A 2F38A 4L80A 1X6NA 3GH7A 2VXNA 2WJEA 7TAAA 1XC4A 1A0DA 4EWJA 4A8LA 2GJNA 1S5WA 1MQPA 2F6XA 3C0JA 3H23A 4DXXA 1W9BM 3CWOX 4EK7A 2SFPA 5J04A 5HAOA 4E2VA 4OBTA 3CL8A 1R3SA 2BVTA 1M7PA 3W84A 4RE0A 1JD9A 3WMLA 5BU9A 3MSYA 5BU6A 3O15A 4ZE5A 4RE4A 3WH5A 4GQGA 3V0TA 4RX0A 3LADA 1YE6A 1KM0A 2ABAA 2DZXA 1HXJA 4UQDA 4UFLA 2ALRA 1LLOA 4R3UA 1BYCA 2PSNA 1RPXA 4AEEA 1A5KC 1CGVA 1NHQA 4HMCA 3QPYA 4OJYA 1E9ZB 4NJHA 4KIEA 4B16A 1JYWA 4AYGA 3L5OA 3RU8X 5L6UA 4XKYB 1O12A 5EMYA 4E2DA 4HN4A 3A47A 5I03A 1FFUC 3ARVA 4AEFA 2DV0A 5J8LA 2QR6A 4D8LA 1EXBA 2TPSA 2ZUTA 3PJWA 3WL1A 4S3DA 3CC1A 2GVLA 4IISA 2BB0A 3CT7A 4PODA 3RCYA 1L2UA 5ECVA 5H8MA 4MAVA 1PTDA 2Q6ZA 2ZX8A 2DZPA 2EPMX 4WK9A 2J8GA 2FHCA 2QJGA 3MYOA 3PUEA 3UR5A 2FKPA 3PB0A 4MWAD 1IF2A 1UZ4A 1DNCA 3CWHA 1F6PA 3WQPA 1XISA 3DFOA 2E1WA 1V3MA 2DUXA 4GCAA 4QG6A 1XIBA 3NZGA 2Z1SA 1QXLA 3VIMA 1VJSA 4WJEA 3WELA 3CJPA 2YL5A 2G0WA 1JULA 2YW4A 4EQXA 1HUVA 2HQMA 2OXNA 4TX8A 4ZQRA 4QXIA 5ABHA 3VTRA 4XIMA 1GQIA 4FOUA 5BXPA 3C0QA 3SJNA 2QNEA 5K9DA 3UP8A 4XWUA 2QDHA 4K8HA 1OHLA 4GFIA 2FJUB 3AHTA 4F9DA 1UR4A 4WLCA 1XGEA 2P53A 1PZ3A 2VUYA 1VIZA 3E2VA 3SY5A 3O6AA 1VBUA 3TLLA 3O07A 1NOFA 4L6DA 3NVDA 4E8GA 2FZBA 2J78A 2OGJA 4QROA 1IWAA 3WLSA 4D8AA 4AAJA 4NZ3A 1Z8AA 1AD4A 1QHZA 3KVKA 2EF9A 2CEQA 2V5JA 3GXPA 1F8WA 1NJJA 4AEOA 2CWNA 5D9MA 3N2TA 3S6OA 3WD3A 5I02A 2G4JA 3MUIA 4GHRA 4RDZA 1C8YA 5HMSA 4L4PA 5CZ0A 4B5SA 4A05A 3HPZA 2FFCA 1ONRA 2OZ8A 1PX8A 1T6MA 1OADA 3ID7A 2FH6A 1KBLA 4J3WA 3WJXA 2J75A 2G37A 4D1JA 3UESA 2PGEA 1EJTC 2OLAA 3AWNA 5BOOA 1X2GA 4ERIA 2C1HA 3NRZB 4TX6A 1TELA 1A49A 5DY2A 3IGUA 1QCWA 3QFWA 3M7WA 1JUBA 5A6BA 5AVHA 4GABA 3NYZA 1ECQA 4Q4QA 1ADDA 2YKKA 3POHA 5CG7A 4B5WA 2QDEA 3W1XA 4OE7A 2Z29A 1AZ2A 3N13A 4JKLA 3AJ7A 5DANA 2WSRA 2IQ0A 4H6QA 1TV2A 1VGAA 3P8JA 4U2YA 1AW2A 3VNYA 4DWSD 4ONVA 1UD6A 3VIHA 3NPXA 4UOZA 2OB3A 3GYCA 4W7WA 4GYJA 3FX4A 1WDQA 1W1IE 2YDAA 2Z2AA 3VFCA 1SPQA 6REQA 4DZ5A 2NVDA 4JIQA 1I1XA 4XV0A 5CGMA 4GIRA 3BLIA 4K7ZA 3A5FA 1UB3A 4A8NA 2P1FA 1TR1A 1H7NA 7A3HA 3AHXA 4BR1A 7REQA 3WUBA 1ZBKA 4XZLX 4HZ6A 2RGLA 3FA3A 3VD5A 5LIYX 5HR6A 1E5NA 3QR0A 1SM9A 3CPRA 1ZJAA 3FJNA 2R1KA 3M0ZA 1VDVA 4IIFA 3LMZA 4AWEA 1QI5A 3P80A 1W3TA 2DIJA 2VGIA 1R2SA 3LHUA 3W7GA 1V6TA 3GNOA 1FOBA 3W74A 2WJDA 1I45A 4B4FA 1K7XA 1WBHA 1VRDA 1SSDA 5DXYA 3LLXA 3CO8A 4I7VA 3I7RA 3FVDA 3UXIA 4GZIA 4V28A 4R85A 4F0KA 1KTCA 3CAKA 1MI3A 2XZ9A 3RM4A 4F2UA 4YCPA 1SMDA 3KAOA 2PRHA 1XLFA 3NQDA 1VIWA 3TQVA 1XUZA 4YLWA 4CQBA 4NXSA 2VFFA 3GFYA 3AHZA 4JN6A 3R6IA 3KOFA 4H9MA 1GYMA 2HXUA 3GRIA 3M0KA 1VD6A 3RXZA 4W8LA 6REQB 1ZB5A 3OODA 2X50A 1OC6A 3UETA 2Q3OA 2W27A 1FXQA 4BWLC 4M3PA 3N1AA 3O16A 5DMNA 7REQB 4NJKA 2QUMA 2WCAA 4ZB5A 2V5CA 3LRLA 4Q4OA 5LYRA 3QHNA 3P60A 1QK2A 2V3DA 3BK0A 1US3A 1EX5A 4RZBA 4GQBA 4DJED 1QHPA 3W1PA 4UQCA 1XCXA 1BXCA 5CPQA 2DZUA 2XSAA 4NUWA 1PYMA 1DXLA 3E0VA 3QGAC 3SCPA 1H7RA 4X0VA 4LW7A 3NSXA 5EMUA 1MNZA 3T8LA 1DIOA 2DQXA 3EWXA 2VJXA 4EANA 5I5RA 3WMBA 5TAOA 1Q5MA 3ARPA 1H09A 2F2KA 1V3KA 5FACA 1J01A 4EPEC 3T07A 4CQDA 1TZ9A 3DHDA 5C54A 1RM6B 1ZALA 5C2XA 3TYBA 4GVFA 1S2CA 1R3VA 1XICA 3VUPA 1EDTA 1F3WA 4ERGA 1EGVA 3NL3A 1EZWA 2DZWA 3IK4A 3OQEA 3VIOA 4L1WA 1E0UA 2OSWA 3W7RA 3BH4A 2CYGA 1KR1A 4F0HA 2GUBA 1FH8A 3CB3A 5I3JA 4PFHA 1OT2A 2DH2A 3RCMA 3IPWA 3BLPX 2QQ6A 2EG8A 4LAMA 3GG1A 1TTPA 2BXYA 2G3IA 3FDKA 4CD8A 3E02A 1F07A 5F2GA 1LF1A 2ISDA 1B3XA 2EQDA 5A6KA 2RUSA 2Y2WA 3ABOA 2XIBA 3MSGA 2DSZA 3UYIA 3N4FA 3U4AA 1E1CA 2BY1A 4NRRA 1JCJA 2NX9A 2PBGA 4YWIA 5JH2A 4HSOA 5FS7A 1XIMA 4XTIA 1U30A 2EJAA 5J5DA 4V1XA 2J3NA 1XANA 2EG7A 3HQOA 4M6PA 1PO9A 1XL9A 2QAPA 4MY1A 2OX1A 2E6DA 1GYNA 4LS2A 1P1XA 4J3ZA 1X97A 2ON3A 3Q4DA 3AMKA 4IGMA 2R94A 2YDQA 4INFA 1EWDA 1R3TA 2GWGA 4EAYA 4M7SA 4PTMA 3W71A 3SR6B 3L23A 1V3JA 1WZMA 4XISA 2J77A 2XDFA 3H2FA 4BS0A 2CBVA 3URBA 4HPNA 2XIOA 5D2VA 1FCUA 2CITA 3TQPA 1VENA 4DX3A 4WDXA 2VD8A 3K1DA 4HK7A 3CWNA 1GXFA 3M5XA 2TODA 4NASA 2JALA 2C91A 1A3WA 1YDVA 3AIVA 3S5YA 5EYWA 2JGQA 1ZQ5A 4UCGA 6ENLA 1KCZA 1UP3A 4L4OA 5MKGA 2O9OA 2OJPA 1DIKA 1WV2A 4P61A 2J9ZA 2WSKA 4F0LA 4Z42C 1K9DA 3VGDA 1DJZA 4KPRA 3S2JA 1UR3M 3M64A 1AOGA 3FJLA 4IIGA 2GR3A 4MFEA 3DU0A 1NOWA 3AYRA 5JBDA 4ZOAA 3EXRA 1E1CB 2QT3A 4EQWA 1JG9A 1TTJA 5FCZA 5KZMA 3PB2A 1UHVA 5HWJA 1AMKA 3O3RA 1I4NA 3TIMA 3MBDA 4LV9A 1EJXC 3XISA 5C9WA 2CERA 4YMZA 1TV5A 4X9SA 1NVMA 2WV8A 1BKSA 4JIEA 2IKHA 4C5ZA 2GJPA 1X6UA 3PZQA 4MF4A 1XIDA 1SQ7A 4JHMA 4ZVJA 3FG2P 3ZLHA 1SJAA 4S2BA 3T40A 3BE7A 2WYSA 3QC0A 1VKFA 1BLIA 1UD4A 2UBPC 3B4YA 4IH3A 2DPEA 2CESA 4KERA 4MOZA 3DYPA 3W7PA 1NP0A 3A4WA 4ML9A 1W1YA 5MKGB 3GG0A 4EIVA 1O5XA 3WF2A 4IGHA 1BAGA 4I6VA 5GPRA 4K1WA 1DWIM 3V5FA 4MKVA 1GZGA 2ZZ4A 4O8RA 4PCSA 4G7EA 1UWSA 3GVGA 4CKQA 3EMQA 2Y61A 4JIHA 1Q6CA 3I68A 3L5MA 4GRTA 3W27A 2VVNA 4XZBA 2HK1A 1G4PA 3PAOA 4NNBA 2ZRZA 4D6EA 3LEPA 3UWWA 5CZTA 3VD4A 1OFRA 3GY1A 1TJ0A 5A8MA 1PDYA 2QDDA 2NLYA 4ZEPA 2UV8G 1FECA 4P7QA 3O6YX 3ZS4A 4TMBA 1GSNA 4IXXA 4TQTA 2WPBA 3C2VA 3N6HA 2ZICA 3O9NA 3IGSA 1BWCA 3MUCA 4DJDD 3O6CA 3C2OA 5I06A 4GUFA 1J2BA 4FXRA 3HPAA 5BROA 1JOAA 2FVLA 3B0XA 3QXBA 3M46A 3SO7A 1C7TA 1QJWA 3VDCA 4AC1X 4NZJA 4GR1A 2GH5A 4ZZ9A 5F1VA 1KKOA 1EQPA 3VGGA 2YXOA 1Z44A 1BHGA 1JRPA 2OTDA 5G1MA 5LIKX 2R1LA 1HNYA 3SCSA 3B3DA 2WPEA 3PBUA 2FDSA 3CUFA 2X09A 5BYWA 4C6FA 1NH6A 2VP8A 2L5HA 3T4CA 3CUJA 4IJBA 4O17A 1UC5A 2QCDA 4Y9OA 2VGGA 5AHNA 3I7QA 3ZT7A 5LNUA 3TTQA 1NWRA 3UXLA 1JCXA 4G7EB 1DWHM 1HKJA 2EPHA 3ARRA 4YCOA 3B04A 4G1NA 4XAPA 3KOYA 2AGTA 2XFRA 2YLLA 3DERA 3QF0A 3G1SA 1Q6DA 1OCQA 3N19B 3NSNA 1BGGA 2Z27A 3EEZA 4AB4A 4H00A 4LVGA 1J18A 4CQ9A 5LSMA 4HMNA 1QRQA 4UOJA 4J2MA 4IXHA 4NX5A 2HZGA 3OG3A 1UJQA 2VGFA 4M1BA 1VQZA 5KVHA 3ZR5A 1F4AA 4B15A 4F66A 2C79A 2J25A 3HZ3A 1TVLA 3MP4A 4HYWA 3S8HA 1FXPA 3GXIA 4AVFA 1SO4A 2ZTJA 2BV9A 2QUNA 3B8DA 1YDYA 4J57A 4JZ5A 4ZBCA 1RAKA 2P0IA 1WKDA 3CIVA 5AHLA 1IEIA 5BWFA 5M03A 4QM1A 4WVXA 1D7YA 3NZQA 1CGXA 1TPC1 3TONA 3TYDA 4TX9A 5AC4A 3WDHA 4JN8A 2V6AA 4X0NA 3TTOA 3KZSA 3GD6A 1REQA 2NSXA 2PU1A 2QCDB 3ZLFA 3TNOA 2GR1A 2ACUA 2P76A 3N04A 4DJFD 4N9BA 3PJXA 1HO4A 4ZXLA 5G2HA 3WBXA 4LUTA 4QE1A 2Q02A 4AIBA 3RLUA 2CLOA 2XFFA 4DZHA 1IGWA 3HO8A 4LANA 5TR3A 3WQ5A 1FWJC 2Z6JA 3OOQA 3HPXA 1AMYA 3STEA 3UBPC 4PFMA 1GVOA 4W89A 3UXKA 2RDUA 2X1SA 1IR2A 4ZB2A 2V9DA 1VJZA 5KINA 2OYMA 3TLQA 1RY8A 4JNZA 2F7FA 5I77A 1M6JA 3O05A 1DVJA 4JQ9A 5D04C 2IS7A 3WJZA 4Y9PA 3WNMA 1TV7A 4KEUA 4LCSA 3OA3A 1XYZA 2GUYA 2VR4A 4K7YA 3EMCA 1J93A 4KGJA 3G0XA 2OQLA 2C16A 3AIRA 3W00A 1E0XA 1GTEA 3RG6A 4US6A 2NT0A 3PPFA 4WKAA 3F4WA 1GQJA 3A7RA 3AFBA 3G1XA 4R7JA 3WK0A 3PZOA 1RVGA 2YCKX 3ARZA 3B4UA 1REQB 3GHUA 2VI0A 3AM9A 1MDRA 4Z1DA 3TN6A 3NQEA 1FQ0A 4MLJA 4Y2WA 1ZKQA 3GS6A 2IXVA 5A2AA 2D3LA 5C7VA 4IX2A 3HGSA 4LUTB 2XSBA 1DQWA 1EF3A 1KW1A 4DBSA 2VDIA 4NXKA 4NILA 3QFBA 4Z1YA 5D30A 1B3OA 2ZXDA 3A9BA 3R58A 2G97A 3SFKA 3WH9A 1IEWA 3DDMA 2ZZ6A 3B8VA 1GQLA 3M41A 3I7SA 5G5HB 2A4AA 1GOOA 2QEZA 1XIFA 1KFJA 1SYTA 3WK1A 9XIMA 1A47A 1ZL1A 4BK9A 2PUZA 2GGGA 4UIOA 4O57A 4NP7A 4FF7A 2I9EA 2DT1A 5D02A 1QPOA 2IPGA 2QPUA 2GSJA 1DEDA 2QYGA 2PGFA 1KV8A 1F5ZA 4MPKA 2UZ9A 4O4WA 4DNAA 1VFHA 3SIZA 5HJXA 1IE7C 1F3TA 3TW9A 1X98A 5HATA 4PMVA 3VFLA 4B9ZA 4Q7IA 1A5BA 4L1XA 5AYZA 4K36A 3IVSA 1OYAA 4S3BA 3BARA 1TG7A 1RZMA 1EHNA 3HRDC 4O14A 5HK4A 3TTEA 4IIHA 2X1UA 2F61A 2FGZA 1BWVA 3A12A 2E3ZA 1F3EA 3LMYA 4GUHA 1A80A 2R8WA 3L4UA 5F4XA 2ZTKA 4XIAA 4D6FA 3U2EA 1NQKA 2GQ3A 2PCQA 4UNIA 5GVJA 4F8XA 2ZZ2A 4LAUA 3RRXA 1HN1A 3HGJA 1HX0A 2ACSA 2ACRA 2AQVA 2HSAA 1HVQA 2ZDRA 3AMDA 2NXGA 3ONCA 3WLLA 3IJ9A 1GOMA 3WYZA 1PCWA 3QYSA 2BS9A 5LNVA 2C18A 5T9CE 5HBFA 4UC5A 3GUWA 2FHFA 1S46A 3QQ0A 1ZP4A 2GSHA 3HG3A 1YMYA 4IHCA 1OB0A 2ISFA 4PB3A 4TVCA 1B0IA 4F0SA 3GVRA 5EPDA 3VKKA 5H6HA 2FMOA 3QZAA 2OGYA 4B91A 5A6LA 4AQLA 2QVHA 3DG7A 4XD3A 3SRHA 2V6OA 2X7VA 3MMUA 1C29A 4AISA 4GFSA 3ALGA 3AI0A 4AZ5A 2ZE3A 2Y62A 2VTFA 1K77A 1N5XA 1KCXA 4PE8A 1JZ4A 1PIGA 1F61A 3PR2A 4LNYA 4OU1A 2PI6A 4IP5A 1PJ9A 4UMAA 4Q4MA 1HW6A 5K9CA 2GJLA 3WBWA 5CC3A 4UTTC 3GK0A 4PL2A 3WQ6A 1E3XA 2PDCA 1XH2A 3G5EA 4A29A 1NPXA 3FIGA 5TBOA 4XZIA 4OQVA 3BMXA 2Y7FA 1V02A 1UMYA 3SQLA 3EMZA 4QX4A 2Z2BA 2ZRYA 1RH9A 1IZKA 1E56A 4XK2A 3NZRA 5T9BG 4C6EA 5KSWA 1H11A 1Q45A 3SBFA 4ACZA 3HG2A 1IZJA 4G56A 1FDYA 3UCQA 3KOXA 4JICA 1FRBA 3BAKA 1N8WA 4DIAA 4TXEA 3CV6A 2BASA 4W7VA 1SO5A 1XLHA 3SURA 1ELSA 1NWSA 3L8KA 2DSUA 1B54A 4DZAA 2I5GA 1RVKA 2Z26A 1VB9A 3PK7A 4B5NA 1WKFA 3GD4A 3SN4A 3QPZA 2O9RA 5BNKA 1Z89A 5LXEA 5HUPA 1XQKA 5CLTA 4NZ4A 1C93A 1GPWA 4OOUA 1QFEA 1JZ6A 3OIHA 4CVWA 1ICQA 4MJMA 1U5VA 3CYVA 2VM8A 1VEPA 2ZC1A 1HJWA 3UG5A 1ZNNA 1G4EA 1LBMA 5C2CA 1AQMA 3U48A 4WXZA 4L9XA 1BTMA 1KRBC 2XH0A 3UERA 1UIPA 5C6MA 4A2RA 5KMYA 5A8NA 2NQ5A 1UR0A 4B90A 3CGCA 4BWLA 5EMMA 2VRJA 1KFWA 1MW0A 3KBMA 1FDJA 2WSPA 4FHAA 2A3BA 3PVFA 3LM7A 4URIA 2WNNA 1LCOA 4Q7NA 4IMDA 2ZFAA 2OZ3A 3S46A 1F9CA 4IUGA 2NUXA 3DFHA 3DFTA 4W9TA 3B03A 3FYYA 1BSIA 3QJAA 1EGZA 2BY3A 3EX1A 3WN6A 1AW1A 4MSSA 4ACZB 2VRKA 3DI1A 3AROA 4GG9A 4C65A 4MZYA 2CLIA 4LY4A 3E0FA 1TCDA 4LWWA 2JK6A 3ALFA 3B9EA 4LUSA 5K4XA 3M5VA 3VDHA 4D6CA 4PULA 4YTTA 3UJSA 1QNOA 4AHQA 4DBUA 2QJJA 5EKYA 1AG1O 3WDPP 3MW7A 4ZB0A 4JHZA 2UWFA 3PSWA 2HEJA 3NWRA 3AXKA 3PBVA 3TC7A 5D2TA 4C5YA 4QLJA 4OUIA 2WP6A 2JGYA 4US5D 3NGJA 3TWAA 5K3VA 4CU7A 2IKIA 3NQGA 1QNSA 3JZEA 3MVIA 3NIYA 3RMJA 4XD5A 4AY1A 3DOPA 4ORIA 3THCA 4UB9A 1HKVA 4UQEA 5JRBA 3EWYA 5CCZA 2VELA 1TTIA 3PZ9A 2X40A 4O4VA 1XRVA 3VILA 2O9TA 2C19A 4C7FA 4U10A 2RGMA 3H21A 1EJ7L 3JS3A 4HNUA 4PUJA 3BGJA 3T05A 4PSRA 3NGFA 4E3VA 1GTHA 3ABQA 5CQ1A 1LUCA 3AICA 4TV6A 3BMVA 3DENA 4UTKA 2V63A 4GXWA 1XFBA 4P8VA 2E3TA 2BHUA 2IMRA 4CGTA 1HJXA 5M17A 1T41A 3LERA 4GXMA 4K6AA 2CXEA 3ATZA 3EGJA 1FH9A 3WH8A 1Z48A 4LUSB 3W1LA 1D8WA 3NO3A 4GGBA 3SCVA 1J4EA 3VOFA 1N60C 2PLCA 1S3TC 4ZQOA 3C2FA 2JIEA 1GONA 2OELA 5A2CA 5GQBA 4L61A 3BQ6A 2VFHA 1JQXA 2FIQA 1UD2A 3C52A 3DFPA 4H6KA 4AIEA 3BTNA 1UUQA 1MYRA 4TR9A 2QULA 3GDBA 2XWEA 3N9SA 3LENA 3LN3A 3FNDA 3NYDA 3Q65A 3NVYB 3XINA 1NARA 3AS0A 3LV5A 1E6RA 2WB5A 2VQTA 3CAVA 4O13A 2NQ9A 1K03A 4FPSA 4W86A 3SQMA 2XU2A 3HPFA 4NKCA 3W73A 2AAMA 2VKZG 3HN3A 4W5ZA 4S3EA 4TUFA 4AW7A 1O5QA 3P0XA 4S2CA 1LUCB 1UWQA 1DXFA 2J66A 3FHAA 5LXXA 1TV3A 3SCOA 3SQSA 4Y6GA 2NVKX 1EP2A 4PA8A 3L4ZA 1PXGA 2B7PA 2ZUUA 1J0JA 1K4HA 2X0YA 4AD5A 3L2MA 2CHNA 1HO1A 1BYBA 3VKAA 4GOAA 2J7HA 4N0RA 4OIFA 4RE3A 1A5LC 1KBJA 4AUBA 1N8FA 3WJWA 1V4YA 3HQNA 3U7VA 1RJPA 1W1ZA 2G3NA 3ONBA 1QPKA 4RR4A 4S3KA 4FIQA 4V1YA 4PTDA 2ZRVA 1SSGA 3U57A 3H2NA 3NXLA 4LVBA 5TIMA 1W3NA 1EF2A 2VFIA 1ZAHA 4F2TA 2J27A 7CGTA 3VUSA 1G69A 4S3JA 1S2TA 1PZ0A 3GNPA 3LTPA 5ENLA 3HB9A 2GSEA 4F0RA 3DCPA 2NV9A 2OYLA 3TN5A 2A79A 1A0EA 2RJHA 5EFDA 3URHA 3MSRA 1PVNA 1BQCA 1XM3A 2R82A 4WY0A 2GGEA 4A8IA 3KRBA 4GI8A 3IJIA 3DG3A 3M9YA 2HE8A 5FSEC 3O2LA 3TROA 5F2LA 2F5ZA 4WOZA 4MWAC 5I2UA 1L6GA 3W85A 3W81A 5DBTA 3I3BA 1MWOA 3LHZA 1OF8A 1DQUA 1XX1A 4LT9A 2W62A 3KW3A 3ICJA 1I2RA 2DORA 4IPIA 1PHWA 4RDWA 4JDBA 2WHJA 1B31A 3FKRA 4KFNA 3OU8A 5F7UA 1CIUA 4CCCA 4QAWA 1XG4A 3MZ2A 4RV8A 4YTQA 4O1EA 4REQA 1GRTA 3W1RA 1XF0A 3AXHA 4H4RA 3RLHA 1S5NA 3P82A 6A3HA 2CBIA 1X2HA 3CUGA 4LBSA 1EA9C 1ZJBA 3WUGA 5LA1A 3WQ4A 2EKGA 1G9HA 2X1TA 1VS1A 5EMLA 3IRDA 3P62A 3K1GA 4IFRA 1T96A 4WSJA 1P43A 1N2VA 2D73A 2X8RA 5KVIA 2G5WA 2E77A 2W6RA 3G0SA 4NT0A 4HU3A 3CLMA 1C8QA 2ANUA 4JTSA 4HZ8A 1WBJA 2CXGA 2CDUA 5DRCA 1OFAA 3EWUA 4RXGA 2HMCA 5DRIA 2EJ1A 4DI9A 2DZTA 3A5VA 1CX9A 2A0NA 4Q4PA 3WSUA 3BVJA 4WY0B 3RNDA 1UWIA 2W54A 3SIMA 4JN7A 4RZ5A 3VPLA 1V7AA 2PAJA 4UUIA 2Z1KA 1A5UA 1ODUA 3N6JA 1P7TA 1TIMA 4G7FA 2VHLA 3KCJA 4D9PA 3EDFA 5HNTA 3AWOA 1U2YA 1M65A 3L67A 3P14A 4RNFA 2KAUC 4N4PA 3WKZA 3SUVA 4TU1A 4JX4A 2V68A 2PDWA 1F8IA 2I16A 2R1MA 4Y9MA 4H8UA 2C15A 4GZ7A 4REQB 3W29A 3WQOA 2PMQA 5E09A 3ENLA 4NG3A 4BA0A 1TWZA 3KUMA 1KM1A 3IVTA 4ZQCA 1X1ZA 1TWIA 1T0OA 3AYSA 1P0KA 2F2HA 3W7DA 3K13A 1KFKA 5A8GA 4DLMA 3EWBX 4R7OA 3TV8A 3VZXA 1H49A 2DVXA 5T26A 1L8NA 2ASHA 1TB3A 1IYXA 4K2SA 4PCNA 4KWSA 1ZP3A 2D2HA 3N9RA 2C7FA 1Y5WA 2Y8UA 1DOSA 4XKMA 3OB8A 1YYAA 2VC7A 2O92A 4QSHA 3VDAA 1KM6A 3VD3A 3EYPA 4DWSC 1UCWA 4MYAA 2GQAA 3P5ZA 3SQPA 1RP8A 5GNXA 5DCDA 4WD0A 5FJOA 4QJ5B 3HIJA 3ABRA 4LV4A 1PCKA 2VCAA 4RPPA 2ACQA 1AL7A 4KGLA 3W1MA 2WANA 4GY0A 4N9CA 3N14A 1P7TB 3R1ZA 1R46A 3BLEA 1V3IA 1GVFA 3A3WA 3DGRA 4A3QA 3ZIZA 3BDKA 1BGAA 3N2CA 2WP5A 3PANA 1NFBA 1V6YA 1PUDA 3W0KA 4UQBA 3DAQA 1GJUA 1U1HA 2JKEA 3JUGA 2A1YA 4N7QA 1HJUA 1GKQA 3V3WA 4LU0A 3A13A 3NG3A 4KQNA 3TUUA 5I3HA 4J2PA 3ERPA 1IZCA 4GNJA 2HTMA 4FOKA 1ISWA 3KZPA 3ZJ6A 1SB3B 1KRAC 1VH7A 3CBWA 3WO8A 2TSYA 5CPLA 1R86A 4RNJA 3M0HA 1VYSX 1UH4A 2PURA 1A4MA 1J10A 1SFTA 4DO4A 4PN2A 4H2HA 3H70A 4DM2A 2EQ8A 2PGWA 3LHWA 1H7WA 4C91A 2D0HA 1XYAA 3STGA 2PTYA 2YQUA 2H9AA 4ZSTA 1OVDA 3KDNA 4IZGA 4KW2A 3STPA 3IK2A 1AK5A 3S9YA 4ADWA 3CK5A 2JEQA 3TOYA 1XLIA 3H4XA 4L64A 3FN9A 3KWXA 4NZFA 2JF6A 3PTMA 2GDUA 3RPTA 1W2PA 4H9UA 1MZHA 2DSWA 3R11A 2UY2A 2HVOA 4CVUA 1EX1A 2CKRA 3ME3A 4Q3MA 4LBRA 1TVNA 3HURA 1FWSA 3CGDA 5CZJA 4EXBA 5G5IA 1O66A 1HQTA 4J4KA 1JAEA 3ECQA 1RJRA 3H54A 4F2BA 4FXJA 4LC6A 4DJEC 3PPCA 3L68A 5BMXA 2QF7A 1L8PA 1XBYA 3BAWA 2JKAA 3H53A 2HS8A 2DZSA 3O63A 4UXDA 1MVYA 5EFFA 3E2RA 1EIBA 1KWGA 3JVAA 4RZ4A 1LJYA 4IX0A 1VZWA 2CHRA 2HE5A 2ZZ7A 4J5NA 4UTUA 2ISSA 3DI0A 2VQUA 1JQVA 3KTCA 1J0HA 3L4YA 1GK8A 2QCMA 5C2GA 4I90A 5SWUA 2Y63A 3F2BA 1EXPA 4TVDA 4O0KA 3UZWA 1MSSA 1Q13A 2PTXA 5LIWX 2H9AB 2GJRA 3BAYA 3UR2A 4LYQA 4KKXA 3WNNA 1PBGA 2JKPA 4FDCB 2MANA 3W7CA 4FS9A 2ATSA 3IV3A 3MPGA 3W7MA 3TC6A 1UPMB 4C6DA 1W0MA 4R34A 1MQRA 5EMJA 3PZNA 2DVUA 1H4PA 3VZYA 3MHGA 3RGTA 4CN1A 2XHYA 4JTCA 3LTSA 1OD0A 5A94A 1XD1A 1Q2SA 3RITA 2INZA 2QZRA 3CQHA 3AU2A 1PSCA 3MU7A 4JYDA 1ZBCA 3LU2A 5D38A 1TIWA 2CPUA 4UOQA 3W37A 3EAUA 1SZGA 3KX6A 2J47A 4IM4A 1FWFC 1X1OA 2J62A 3W23A 1LL4A 4LFYA 2QCEA 4A22A 4H6EA 4WKHA 1LOQA 1T3QC 4ZOCA 1AQHA 2ZVIA 3VNJA 4LQ1A 1C91A 1RLCL 3RX3A 2PDKA 2RFGA 3BLDA 1EBHA 1Q66A 2E1DA 5FL0A 5AYYA 3RIKA 4XD4A 2G50A 3D3FA 3I65A 1M03A 3D0CA 3S0CA 4JQ3A 2FHBA 3CPGA