3R0UA

Crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : tartrate and mg complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
362
structure length
362
Chain Sequence
VSKIIDIKTSIIKIPLKRTFITAVRSTNHIDSLAVELTLDNGVKGYGVAPATTAITGDTLQGMQYIIREIFAPVILGSDLSDYKQTLELAFKKVMFNSAAKMAIDLAYHDLLAKEQDISVAKLLGAKANSIVTDVSISCGNVAETIQNIQNGVEANFTAIKVKTGADFNRDIQLLKALDNEFSKNIKFRFDANQGWNLAQTKQFIEEINKYSLNVEIIEQPVKYYDIKAMAEITKFSNIPVVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMESPAGILATASFALAEDITVADLDPLDWVAKDLYSDYITFNEPNIILKDNLKGFGFNLAENLYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Francisella philomiragia subsp. philomiragia
molecule tags Lyase
molecule keywords Enzyme of enolase superfamily
total genus 119
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3r0uA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3r0uA01
2HNEA 4IT1A 3UJSA 3TCSA 1F9CA 2NQLA 4HCLA 1EBGA 4J1OA 3RR1A 3TOYA 3NFUA 3UGVA 4IL0A 3ES8A 2P88A 1W6TA 4GIRA 1KCZA 1XS2A 4HCHA 2DW7A 1TZZA 5BOFA 3R1ZA 3QTPA 1RVKA 4GYPC 3MQTA 3MWCA 3DIPA 3T4WA 2RDXA 5ENLA 1WUEA 3ZLFA 3VCCA 3QKEA 2PPGA 3KUMA 1NELA 2HXUA 1SJAA 5FJUA 3QPEA 3SN4A 3H12A 1KKRA 2ZADA 3QLDA 5IDZA 4GISA 4ENLA 4MGGA 3P3BA 4GFIA 3VFCA 2XH4A 5FJRA 3JZUA 1EBHA 4H2HA 2PTWA 1MRAA 3GD6A 2QJJA 2QJNA 1P48A 4K1WA 4JN7A 2P0IA 3CXOA 3UXLA 4GGBA 4FI4A 4HYRA 4KWSA 4Z1YA 3H8AA 3I6TA 3OPSA 4JN8A 1WUFA 3FXGA 4A3RA 3UCCA 4JHMA 3RO6A 3SBFA 3RCYA 1SJCA 3TTEA 4K8GA 1DTNA 2FYMA 2GGEA 2QDDA 3DERA 3ENLA 1EC7A 2OQHA 3TQPA 2QJMA 4M6UA 4K2SA 2AL1A 3OP2A 3VA8A 3BOXA 4YWSA 1KKOA 3CB3A 1ONEA 1FHUA 3VCNA 1MDRA 3U9IA 4E8GA 2PMQA 4GYPA 2QVHA 2GL5A 3D46A 2OLAA 3STPA 3FJ4A 4HNLA 7ENLA 4KPLA 2AKMA 2GSHA 3SN0A 4MMWA 4DYEA 4HPNA 3RRAA 4DHGA 2PTZA 3PWGA 3V5FA 3CK5A 1TKKA 3S47A 3N4FA 4ZCWA 4IHCA 3ZVHA 2FKPA 3DDMA 3NZGA 4E4FA 1OEPA 4GGHA 2I5QA 2PP0A 4KEMA 2XH7A 4HN8A 2QGYA 3OZYA 3VDGA 3ZLGA 2O56A 2OX4A 3RITA 4FP1A 2MNRA 1SJBA 2GGHA 3TJ4A 4IP4A 3DFYA 1E9IA 4H83A 3CT2A 2GGJA 1BKHA 1YEYA 3B97A 1L8PA 3NXLA 1XPYA 3K1GA 3R11A 5BOEA 3S5SA 3UJRA 3GY1A 3TWAA 3R25A 4G7FA 4H1ZA 3I6EA 4GMEA 1JPMA 1NU5A 3FCPA 3H70A 3MSYA 4E4UA 3PK7A 4IZGA 2GDQA 1KD0A 4EWJA 2PTXA 4X2PA 2XH2A 3N4EA 3UJ2A 1PDZA 3VC5A 3U4FA 3UXKA 3DESA 3MUCA 3R10A 3RGTA 4HNCA 2AL2A 2OO6A 4G8TA 3MKCA 4ZA0A 2QDEA 2AKZA 2MUCA 3P0WA 3N6HA 2PU0A 1JPDX 2OQYA 3R0UA 1P43A 2OFJA 1ELSA 1PDYA 2P8BA 3OZMA 3ZLHA 3CYJA 2OZTA 2HXTA 3IJQA 2PTYA 5FJPA 2ZC8A 3FYYA 3HPFA 4HCDA 2POZA 4F4RA 2OKTA 2OVLA 4E5TA 4KT2A 2XSXA 3V3WA 3MZNA 2PP1A 3SN1A 3ES7A 5FJOA 1MUCA 2PSNA 3V5CA 4DXKA 4DWDA 2PODA 5J04A 2PCEA 3PWIA 1SJDA 2OZ3A 3GO2A 1ECQA 3H7VA 4A6GA 3V4BA 1MDLA 1EC9A 4MKSA 2DW6A 3P93A 3MY9A 3TJIA 3TWBA 6ENLA 3JVAA 4IP5A 2XGZA 3EEZA 3N6JA 3R0KA 3IJLA 1TE6A 3PFRA 3OW1A 2PGWA 3GC2A 5EU9A 2ONEA 3DG3A 3OTRA 3T6CA 3JW7A 4J3ZA 3DG7A 3UJFA 3FV9A 2OPJA 3T8QA 4ROPA 1IYXA 2P8CA 2PU1A 3I4KA 3VC6A 4A35A 3SQSA 3IK4A 3ZVHB 2PS2A 2AL2B 3NO1A 1FHVA 2P3ZA 3IJIA 1EC8A 3DGBA 3UCDA 1JCTA 3FVDA 4IL2A 1JDFA 5FJTA 2XH0A 3Q4DA 1BQGA 3CAWA 3T9PA 3TW9A 2OG9A 2QQ6A 3D47A 2PP3A 4E6MA 3SSZA 3Q45A 4DN1A 4Z17A 1R6WA 1MNSA 3DG6A 2GGIA 3DFHA 4H19A 3QN3A 3THUA 2CHRA 1R0MA 4DX3A 3BSMA 3ZVIA 2PA6A 2HZGA 3SJNA 2PGEA 3EKGA 3UJEA 3DEQA 3BJSA 2OZ8A 4M0XA 2GGGA
chains in the Genus database with same CATH superfamily
3ZT7A 2GK1A 3A13A 2PGFA 3N9SA 4GK8A 1SB3B 2GJXB 2DVTA 4X2RA 2DSKA 4NJKA 4A8RA 1EBGA 1F2JA 3V0TA 2DZAA 4LUTA 1TX0A 3W74A 2BXZA 4WUIA 2NLYA 3WLQA 2VNCA 3N3MA 3ANUA 1ESWA 1QW7A 2X1UA 4DJEA 1XYLA 1BKSA 3HMCA 3C56A 5HR7A 3G0XA 3MQTA 1P6CA 1R47A 4O52A 1NF0A 4H3DA 1X1ZA 1S2VA 3RHGA 2PPGA 5F2GA 3G1DA 3N18A 4DVOA 5H6HA 1P4CA 4JQ1A 2DIEA 4ADTA 1GKPA 1EX1A 1F76A 3PZUA 1J0HA 3MUIA 3P3BA 3F5JA 2PDJA 3ZJ6A 3QXBA 1LUCA 1POKA 2XWEA 1QPNA 2O9RA 5EY5A 1ICQA 2KZHA 2PTWA 2QJJA 3BAXA 3PBVA 5D9NA 1I9CB 4HYRA 3H8AA 2I9EA 2W92A 3GYEA 2Y1HA 1OJTA 1M6JA 2BFGA 4JQ3A 1JUBA 2CWXA 2FDSA 5KZDA 3PJXA 4KFPA 1HO1A 1E6RA 2Y8VA 1WKEA 2YZ5A 3RX4A 5GPRA 2E9LA 1H2JA 2QDDA 4MJ2A 2JIWA 3ENLA 1WOBA 4BJHA 3INPA 4ZXOA 1XYMA 3AIUA 4AXNA 4M6QA 3W4RA 3E0VA 1FDYA 1QNQA 3VGDA 3CB3A 4BF7A 1S3HA 3RAOA 3GG7A 4QG6A 1EIBA 1N82A 4ACZB 3E02A 2OEJA 3R79A 2DV0A 1P7TB 1TQJA 3UVAA 1JCMP 3SGZA 3UNDA 4MMWA 4J2PA 2NUYA 2PWGA 2W0HA 3R13A 4PULA 1H7WA 3TVAA 4DHGA 3DN5A 4ZGYA 4AX6A 4WDWA 1NY1A 2VZOA 1KRAC 3A3WA 3W26A 4CNUA 2TPSA 1XX1A 3UWUA 1EJUC 4UFHA 4WJ8A 4K8HA 1U83A 3VZZA 3BK0A 3FSUA 3SQPA 4REQA 3GTFA 3KOXA 3VFLA 1RQBA 4ZB2A 1O5KA 3KVLA 1Z41A 5ABFB 4XZNX 2HBVA 1GYMA 1A5SA 1SJBA 5E6YA 5CC5A 1LTDA 4EM4A 5T91A 2HRWA 4EWND 1K6AA 5IDIA 4IP4A 1Z3NA 4H83A 5DT7A 1KTNA 4XSLA 4TMBA 3LGDA 2W54A 2GR3A 3C2EA 4PB4A 1HVQA 3AZSA 1QK0A 4JYEA 4LRSA 4HKPA 3VKDA 1L9WA 1WZKA 4FHAA 3TWAA 3WQGA 3DFQA 1Q66A 1Y5VA 3DGRA 4EF8A 1US2A 3GD3A 4DO7A 4LXFA 4I3GA 1DJIA 1KGXA 2D24A 3UXKA 4Y6GA 1XH0A 4F2UA 3UA4A 2EQ6A 2AL2A 3T05A 1XBYA 3NA8A 1UD6A 4Z2KA 4B5NA 4EPEC 3VGEA 2OWXA 4WDXA 4QROA 5TQLA 3EXTA 4K68A 4JKMA 2BOGX 4LYPA 2VR4A 1JPHA 3CWOX 2OKOA 2ZUWA 2P8BA 1OM0A 5A6TC 1UKQA 2W91A 5I3IA 3QTGA 2XVKA 1W8GA 2ZWZA 1KBJA 3BC9A 1OC5A 2OXNA 1X7FA 3L2LA 3O06A 4C6EA 3LBCA 2GZXA 4DBEA 1BGGA 2EPNA 4JHZA 3O6CA 3SN1A 3ES7A 2PSNA 3QZAA 4LYKA 3C2YA 3LTSA 5J04A 2EQ7A 1GVEA 1SZNA 5BW6A 4B5UA 3ZJKA 1TELA 3ZT5A 5HMEA 2F61A 2DW6A 1WXJA 3LQLA 1MYRA 3H53A 2GJXA 3LLDA 1Q6EA 1QOXA 3NO3A 2GWNA 1QXLA 3CU2A 4H9MA 3I7RA 2J7BA 4WCJA 5I00A 1HJXA 1PSCA 3PUEA 5B7YA 1SSDA 1OINA 5IXEA 4G1NA 4PUUA 4PTWA 3DG3A 4YTRA 3GBEA 2YL5A 3LHUA 5DO8A 1G01A 3TUUA 1OC7A 2I57A 1HL8A 3T8QA 4PRWA 1OGBA 2P1FA 1W9DM 4F0SA 4G6CA 1UCWA 3STEA 1Z9AA 3R43A 2P8CA 1XLAA 3A4WA 4AIUA 2PD5A 4PMZA 3WQVA 2NZLA 1UWRA 3WNPA 1LQAA 3T1GA 1UD4A 2PC8A 1IQ8A 1JUKA 2X8CA 4N2YA 5JBDA 1VF8A 4YCPA 5FMHA 2XH0A 4HJFA 3VMNA 2J7EA 3I4EA 4IPIA 3CHVA 3BW2A 3AMDA 4LYRA 3UY8A 3WQ6A 1XYZA 5TR3A 2HCVA 4Z17A 3WQFA 2X05A 4PMOA 3T0BA 4ICNA 1HT6A 3S9YA 4WGXA 4GIAA 3QR0A 4C1NB 1YNQA 3HV9A 2VDHA 4MNJA 1HKKA 3HV8A 4PMJA 1GZJA 3SJNA 3OC4A 3GFXA 3DEQA 4Q8WA 2XSBA 3GFYA 1GORA 1LYXA 3GRSA 1Q6FA 4XTIA 3PZ9A 1X2GA 2WP6A 1BWVA 1XCFA 4IMDA 4IIEA 4AY8A 2VI0A 3ZWTA 3UR7A 3RM4A 3A7RA 3EUB3 4HCLA 3VOGA 1PHQA 3COTA 1HTIA 3BW4A 1H50A 5EMKA 4LFYA 1ZENA 1XS2A 5CEWA 3VOFA 4TV5A 5FSEC 1QBAA 3LADA 2VRQA 3AHXA 1WE5A 3RCNA 3CLMA 3R89A 4TVWA 3NAVA 1JG9A 4QS6A 3DIPA 2QAFA 3UR8A 1JYVA 3OU8A 2WVUA 4IMAA 4K36A 4MAZA 3VCCA 4GI9A 1GRGA 1AJ2A 1DWIM 3EOLA 3B8IA 4FIQA 4O4VA 2ZADA 1IT8A 4UMAA 4QAWA 4WSKA 3EOEA 2QCDA 4XIAA 2H9AB 1TR9A 4PMXA 3E2QA 3FK4A 5PTDA 6CGTA 3AQUA 3CUIA 2DIJA 3ZIZA 4O1AA 5FKYA 1JGMA 3N14A 1GJWA 3HG4A 3MVTA 4KWSA 1L6WA 4O53A 4RNHA 5C8BB 5M03A 1WUFA 3C4UA 3NDYA 1TQXA 2ZXQA 1VEMA 4IX0A 1B54A 4DJFA 4JNMA 4QTGA 1R3YA 2W62A 3W29A 2WCAA 4WIWA 3VD3A 1P0KA 2XM1A 4D1IA 1VFUA 2OQHA 1J0IA 4I5XA 2FB3A 5U25A 2XDFA 2OOFA 2XZ7A 2QAPA 3K46A 3S5YA 4KPRA 1QNPA 4KWWA 3GR7A 2AMGA 3OLEA 3TN6A 1ZL1A 4AIOA 3ECQA 5K9CA 4Z1AA 3POHA 4LAUA 3A12A 2J75A 2BDQA 3AMLA 2QVHA 2TODA 3U7VA 3AUOA 5LHFA 2WC4A 1FH9A 4FXRA 4KPLA 3EWZA 2OTDA 2XINA 4AY1A 3WF0A 1NHRA 1D7YA 1UC5A 4DF1A 4YTUA 2DVUA 4PBFA 1ZCCA 3GIYA 4OWGA 4AD0A 2BCPA 1ZB5A 3NVYB 4H4UA 2RAGA 4EP8C 2EXOA 4RE2A 3C3UA 3LYEA 2PDHA 2FQIA 5E9AA 3B9EA 4ZMGA 2PDXA 3K30A 4AD1A 2FZDA 5D2VA 4KEMA 4AH7A 4JX6A 1PIFA 2ZICA 5AHMA 3LNPA 1FWAC 4KWVA 4QCFA 1EXBA 3B04A 2D0FA 4A3HA 4JTGA 2EQ8A 3ARZA 1IXPA 1Z48A 1QWKA 4S2CA 4PR4A 3TYBA 2OGYA 1EP3A 1PCWA 4HP5A 1IWPA 3S42A 5C9RA 3R11A 3S5SA 3BAIA 3F2DA 2D2GA 3O63A 1KM3A 3BQ5A 4GMEA 1W3IA 2QCNA 4CQCA 3WMBA 1PZ0A 1SSGA 5K9XA 1D7FA 1MUMA 5CZTA 6REQA 4E3TA 3ARYA 4U28A 3ZXWA 4OV4A 1J10A 4DWSA 3TTSA 3KLJA 1P0BA 4HNCA 2Z7KA 1GHSA 2OO6A 1HW6A 4ALDA 3WD1A 4JFWA 3TR2A 1R87A 3W0KA 4YVXA 2V6AA 1JZ3A 3ITLA 1TV8A 1KFWA 1TVLA 4P7QA 4PMUA 2I56A 4DIAA 3W37A 1R30A 4RPQA 2PWDA 2PF0A 1IEIA 5XIAA 3POCA 4BEUA 1M01A 4X9YA 5GNYA 5I03A 4OFCA 3PULA 1DBTA 4YYFA 1XFBA 4KFOA 4Q4KA 3EDKA 1FHLA 3KM8A 4ZSTA 1IXOA 3UZ5A 3S1VA 1QI4A 3HQOA 3RFAA 3TQ0A 1JL8A 7A3HA 2GQ9A 3GW0A 2QPXA 5FF4A 4MAVA 3VTRA 3SUTA 1BHGA 3LRLA 4UTLA 1JYXA 2DZVA 2YA0A 1GW9A 4GY0A 2FZNA 3V5CA 1TG7A 1FECA 4L4OA 2WB5A 2BY0A 1EH9A 4JCLA 2W5FA 3GO2A 1QNSA 2YB1A 3GE7A 1I4NA 1LRTA 2QUTA 2A3CA 3LTYA 1VENA 1VYPX 2XGZA 1O66A 2ZDRA 4MY8A 3N6JA 3H26A 4ZXLA 3W38A 2EJ1A 7CGTA 4H8VA 3R4IA 4JKKA 1E9LA 1J2WA 3BAKA 1TPWA 3E0IA 4H01A 4QHRA 3B0VC 3AZRA 3FSTA 3BAJA 5DXYA 2AQWA 2D0HA 3H21A 2J6VA 4Q7NA 2C3DA 3WD3A 2E8ZA 2HEJA 3B9JB 3RLUA 1Q6DA 3WLLA 3IV8A 3WQ5A 5CJ5A 2PRHA 2ZX7A 3W1PA 1W3TA 2J7FA 4GE8A 2X50A 3UWYA 3EXSA 3U5UA 1FHVA 1QW9A 2CZVA 1DV7A 3IJIA 4OGZA 5E0FA 4ZO9A 2ACRA 4GQRA 1Y8BA 2YCEA 2VRJA 5HJLA 1XJBA 1SO4A 2V2DA 5HXMA 4C5YA 2ZZ4A 2C13A 5CJMA 3S83A 4BCEA 1OIFA 2A4AA 5CC3A 2OT0A 1TYGA 1I2RA 1OD0A 2QF8A 3I65A 2IW0A 2Z26A 3II4A 4ZSUA 2PDPA 4I5RA 4H9YA 1MQPA 1W8SA 1G4TA 3TN4A 3W07A 2P53A 1LP6A 1I0DA 2PRLA 3K4DA 4O0KA 4MWAD 5D2TA 2HZGA 1Z69A 4MIMA 3OB8A 2PWVA 1PS9A 3MHFA 1W5NA 3P0XA 1RSCA 3BSHA 4Q8UA 4IMFA 5B7ZA 1ZMDA 3PG9A 2F6UA 3C52A 1EBDA 1XF0A 3U2CA 3LCIA 3WFAA 4F0RA 3PBYA 3OJGA 3NFUA 2X2YA 1GYLA 4LF1A 4CU6A 1T3QC 3VNKA 4CNTA 1JVNA 3GHTA 3QY8A 4GC4A 3AICA 4GD0A 1H41A 1VZWA 3W6LA 4JDYA 3SCRA 3S2LA 3II1A 1GERA 3DKJA 3VE7A 2ZUNA 4MNKA 3URBA 4ZZ9A 1BF6A 4UC5A 4HMDA 2HXUA 3B9AA 4KFNA 3SCUA 5FJUA 3RPDA 3LHTA 1BWCA 3AJ7A 4QG8A 3TAOA 3AOFA 4TV6A 2WOQA 3I7QA 1FVPA 4FLQA 2PDGA 5C9XA 3NPWA 2JFEX 3W2LA 1WB0A 2IKIA 1MRAA 3WZ0E 3QKZA 3MI2A 1K1DA 5D9OA 3QW3A 4D6JA 2ZUUA 1VBHA 3W25A 2AOSA 4LVDA 3KRZA 2OYLA 1A3HA 4HOWA 3BLDA 4Z1CA 1MW2A 2QUNA 2DU2A 1UA3A 1ZKQA 2YBVA 3AIQA 2DSUA 4UOJA 1B2YA 2B31A 2V67A 1SJCA 2GVEA 1X8FA 4B3ZA 1R2TA 1V0KA 3M0MA 4Q6JA 5BMWA 4B91A 1OADA 4MKNA 4NX0A 4GYKA 4PCPA 3SFWA 1C8XA 2C16A 2QJMA 4UB9A 1QATA 4QM1A 5BRPA 3W7EA 3N04A 1FDJA 1MVYA 1PB0A 2NX9A 4F9JA 3K1DA 5HNRA 1IHIA 2A7PA 2PZ0A 3GWQA 2WMFA 2E1DA 2VP8A 1FWGC 2WOIA 1LL4A 1KFJA 3UNTA 2QCLA 1VDVA 3GNOA 3GM8A 4M56A 4LUTB 2QMJA 1HF6A 3NCOA 1TV2A 3WBAA 3VINA 1QOPA 5AC8A 4Q8TA 4E0CA 4RDVA 3VDCA 3V0SA 1KFKA 2J78A 1HGWA 2FKPA 2BVTA 3FHQA 3VE9A 3BLIA 1FQ0A 4XZMX 1OEPA 2G50A 2YXOA 3E38A 1P0NA 3T0DA 3LUTA 1V08A 1XCWA 3W7KA 2O7QA 1X96A 4J57A 3VKJA 3BLFA 4I90A 4TR9A 3BOFA 2VYOA 1AZ2A 3MMUA 2C71A 1SW7A 3DYMA 3THAA 3R94A 4XAPA 2GGHA 4C6IA 1SO6A 3DC0A 1OFRA 3ZT6A 2QXWA 3LPOA 3S2JA 3ALGA 3ALFA 1W37A 1RJPA 2O4QA 1UG6A 1DE5A 4BK9A 4NX5A 3B9NA 4UUIA 5A6SA 3EPMA 2WKLA 4UCGA 3LHYA 1EUAA 4KF1A 1MNZA 4Y90A 1A0CA 4DO6A 1E73M 1P5BA 2A3AA 2YDAA 3LRMA 3IWPA 3BICA 5FF3A 1HIZA 4D2JA 2C3ZA 3IC9A 3FAXA 4L6OA 4BI5A 4HHPA 3CUXA 1K03A 3UPBA 4FNQA 1DQWA 4JYFA 3CUJA 3GTIA 1VCVA 3S1XA 3MKCA 4GCAA 4CQDA 1I2QA 5A6MA 2ZRZA 2DZWA 1TPH1 4W8AA 3M07A 1H1ZA 3F2CA 4PH6A 2XU2A 1WNOA 1G0CA 3M0XA 5I2UA 3L21A 1AQMA 1IEQA 4KIRA 5EKYA 2IPGA 1NDWA 1ZAIA 1AA1B 3LNMA 3VZXA 4DWSC 4RE4A 1AD1A 1S2TA 3CL8A 4PCTA 5LSMA 5FJPA 1CXFA 3O3RA 5HNNA 3W9ZA 1E5JA 2P10A 4O10A 1UWIA 4R7OA 2WSRA 3UZZA 3EWXA 1JYNA 3GHUA 4W4QA 4ORIA 3ARVA 1JXJA 5CXPA 1GQKA 3NQ2A 3S2CA 2ZRVA 1UIPA 4EPKA 4H6KA 1XIGA 4YCOA 3QOKA 3V18A 3BG5A 1A5AA 2H3DA 3BURA 2Z1XA 1CGWA 2VJXA 4BZYA 1P1XA 3G3MA 4PGLA 3IRDA 1S5WA 1WAWA 4FXFA 3QV9A 3MKVA 3AMGA 3PJUA 4A3UA 1CBGA 5D2WA 3ONBA 2C19A 3ARQA 1SW3A 2ATMA 6XIAA 3YPIA 2ONEA 3Q67A 3F4NA 4QQUA 2ESCA 3NQEA 5BU6A 3FV9A 1CDGA 3KBNA 3WLKX 1E1FA 3PJTA 2OR2A 5DN1A 3SGUA 4TTGA 4GC3A 1VBUA 2VGFA 2QMKA 4QJ1A 4H9XA 5FEZA 3RNDA 3PBWA 3ZVHB 2AL2B 3SO7A 1QHZA 3DOPA 3TSMA 1SPQA 1A5OC 4TTUA 3PZIA 2NX3A 3L5OA 4V2XA 1D2KA 1FH7A 1T99A 3B40A 4M6PA 4F9DA 1C8VA 1XLIA 2VUNA 2ZZ2A 3TW9A 2QQ6A 4XAGA 2X42A 4HJWA 2ZRYA 1I2NA 4Z1BA 3MSGA 3HQPA 4M1RA 1B57A 2OEMA 1OZMA 4NNBA 4H9TA 2VFDA 2FIQA 1F8WA 3HG3A 3PS7A 2CYGA 3VD5A 2OB3A 3LHZA 3NYZA 3IJ7A 3L9CA 4LRTA 4KWUA 3SCTA 5CSUA 3PNUA 4MJMA 4FS9A 4B2DD 5JCLA 2BHYA 3CJPA 3PZMA 4EXAA 3THCA 3VPLA 4U2ZA 4QSHA 3CZEA 1WDQA 1QMLA 5DELA 2WHMA 3CT7A 3SY5A 1JAEA 2YAUA 1W3NA 2DUZA 3RJXA 3ETRB 5A8QA 2OZ0A 3UYCA 5BOFA 1Z42A 3KXQA 2GVJA 2HE8A 2QJHA 2H6RA 1IZKA 3DH7A 1YYAA 1ICPA 4DUXA 2E77A 5EGRA 1IT7A 2J66A 4O1DA 3WQEA 3SM0A 1V77A 2CLEA 2GUBA 9XIAA 3TQVA 1OFOA 3VGGA 5CPNA 1P0DA 2WWDA 3QMTA 3N13A 4FNRA 2JK2A 1LLZA 4U2YA 3GTXA 3EGJA 2P0IA 4HHLA 5HPCA 1GOQA 2YBUA 4GGBA 3FA5A 4AY7A 1VYSX 1ZQ5A 1NWTA 4JN8A 3OODA 4CLMA 1ZBKA 3P7YA 1K4GA 4Y8FA 2QYGA 2Z1BA 2HNHA 3ZR6A 3QM3A 4CNSA 3PPGA 4NEWA 4L61A 3EMQA 3LSBA 1EC7A 5TAOA 3FEQA 1SFJA 4PCSA 2JE8A 4IFKB 1AMYA 2Z1KA 4R7JA 4C60A 2WLZA 5EMUA 1TWZA 1DJZA 3BOXA 4GWEA 3P5YA 4HA0A 1LWHA 1SO3A 2CLKA 2X1IA 4MOZA 5JCNA 4KCTA 3TSBA 3OBAA 3VU2A 2E1WA 4GVFA 1QNRA 4NQ1A 3IGXA 7ENLA 3PG6A 3E2RA 3RLGA 1F73A 1VFMA 2HVOA 2BC1A 3WDHA 3CC1A 4ZVJA 2YL8A 3PUGA 1DPMA 2WSPA 2R1PA 1WV2A 3AHTA 3ZS4A 5K4ZA 1PKNA 3B8WA 4O4WA 1UKTA 1FWFC 1SFSA 1NTHA 1CB7B 3DJJA 1N2VA 4KWOA 2NSXA 2GJLA 4F0MA 1X1NA 3G5EA 4HMCA 1IZCA 5BMXA 2X2GA 3WFLA 2QCDB 4GIEA 3PZNA 5CPLA 3TC7A 1RD6A 3N9RA 1UD3A 1EP2A 2OLHA 4HNVA 2XVLA 4Q7BA 3W7IA 4UBPC 2ALRA 1XLEA 2BOFX 1WOAA 1YBQA 4AC1X 1BKHA 4MDPA 3NQ6A 3G1XA 1X6LA 1ENUA 3UPWA 3GC4A 1JYWA 3A21A 5KITA 2FJUB 5DMMA 1ODUA 3R25A 3K8KA 3WQPA 3KZPA 4K3ZA 5EBUA 1M41A 3EB3A 4IH3A 1Q8JA 3TR9A 3GK0A 1KM6A 3NZPA 1H5VA 1OWQA 3WEOA 3UJ2A 2V3GA 4GNVA 3LB8A 3NJ3A 4AHQA 1AJ0A 1WA3A 1A50A 1VS1A 2Y5JA 2GOKA 1VRDA 3PNZA 1B3VA 1UZ1A 3OYXA 3SEPA 2XN0A 4LGXA 2IKHA 4ZFMA 2XFRA 3FJLA 3APGA 4KRTA 3U2ZA 3CGCA 2WMGA 5E09A 3BLEA 2WBAA 5HQLA 4M82A 1QCWA 3H2EA 3WLPA 3ZLHA 4AVNA 4IGSA 3CYJA 1MW0A 5JMUA 3IJQA 1VFOA 4H4VA 1VR6A 4ASTA 3HPFA 2DORA 5EPDA 3WUBA 4O16A 3UWWA 3FLUA 3DHPA 2NXIA 1DWJM 3FKKA 3BDKA 3T08A 5TF0A 2ZOXA 4QE5A 2YL6A 4IF2A 4JTEA 4CNOA 1B3ZA 1WKDA 3E5BA 2D23A 4BI7A 2D2HA 4ZB0A 1JXKA 4UTUA 3H7VA 3M0ZA 4QXIA 1A4MA 1CLVA 1J9YA 1UKOA 2CZ5A 1YDYA 3TJIA 4DM1A 3ZJ7A 1DHKA 1W9UA 4GO9A 3TJXA 1MXGA 3MYPA 3IJLA 3U48A 1UBPC 2WZEA 1YX1A 5XIMA 1W0MA 1XKYA 3P74A 4W8BA 4F3HA 3HBLA 1HG3A 1J0YA 4BY3A 3KZSA 4S3KA 3OVPA 3DBNA 3OVRA 4GUJA 5SWUA 1W9PA 1TTIA 2WSKA 3IPWA 2WVSA 2CESA 3EOOA 1ZTVA 1PV8A 2XIQA 4B5WA 4PTVA 2PS2A 5FL0A 3PJWA 3EX3A 3BO9A 3EEGA 2Z1WA 1NJJA 3O0HA 1FCVA 3K2GA 3GIPA 4ES4A 5CAKA 3EZ4A 4C6CA 3FYPA 3PWAA 3QSRA 3R8GA 1GQLA 5LYRA 3MMDA 1FHDA 1XDMA 2ZUTA 4XZ9A 1S5VA 1VJIA 1IF2A 3IGHX 4AYGA 4Z2JA 4GX8A 3GAKA 1Q45A 5CPQA 1IIHA 3P60A 3E3HA 1PHWA 1RY0A 3NL5A 5BWAA 3Q6JA 2PWHA 4PTDA 1PYMA 4ZOAA 6A3HA 3BSMA 3KBWA 1TPC1 3WD4A 4JQ2A 4PUDA 3SW6A 2PGEA 1NFGA 1W9BM 3G1FA 1K4HA 1J01A 5C5YA 2DVXA 3TC6A 4WSJA 2IMRA 3TX9A 5MF5A 2VEIA 3NPVA 3VI2A 3QFWA 3L0GA 4O28A 5C2CA 3AYRA 3RR1A 1WYIA 4BA0A 3MU7A 3AS0A 2WW5A 5HR6A 3AALA 2GR2A 3GHRA 1B4KA 3B05A 1OABA 3FN9A 5D38A 3QPZA 2VC7A 3CHDA 2WVVA 3KUMA 2JKAA 4PMVA 1MQQA 3M64A 1UKSA 3CL6A 2YL9A 1XR2A 4LCSA 1WDWA 3H2OA 4GX9A 1QUMA 1SFTA 1YADA 2IXUA 4ZOBA 2ZA1A 2Z27A 3QHNA 4GBDA 1V93A 4W93A 2VR5A 3TTOA 5FAGA 3SSJA 2DZTA 4O1EA 1B3YA 1XH1A 3VOIA 2E6YA 3W84A 4Z1YA 4FNPA 4HU8A 4G1KA 3S5OA 1D3HA 4LAZA 4C90A 1JR1A 4C7FA 4MF4A 4JTDA 3MB9A 5LIYX 1Q65A 1E40A 1YDVA 2VEFA 3AM9A 2XHYA 1LBLA 4WQ6A 3RO8A 5DCDA 2NQ9A 4X0VA 4GQQA 3TYUA 4EF9A 2EG6A 1H5YA 5G1MA 2EF9A 1H2IA 1UB3A 2QDGA 3CV2A 1FHUA 3MUXA 3MSDA 1Q4NX 3H2NA 3TH6A 4ZE5A 4RZ6A 1SMDA 5G1YA 1HJQA 2BGQA 4E3VA 4HPGA 3REQB 1WBHA 1BG9A 1LWJA 4HNLA 3VGHA 1NP2A 4C6QA 4GXWA 4D6IA 5HWNA 1PCKA 1GJPA 5I79A 3W24A 4RV3A 2YX0A 3CEUA 2DJXA 4PEKA 2YDQA 1Z32X 2J77A 1A5NC 2FGBA 2E09A 4YTQA 3IARA 4P8XA 1THFD 4AYSA 1MW3A 1Y5XA 2GR1A 1UD5A 2I5QA 1A0EA 3C3NA 3SUVA 4JHOA 4AB4A 1GOWA 2VCCA 5IHRA 3IGSA 3NURA 1R3RA 1HUVA 1UBSA 2XFFA 3LXAA 3LA4A 4FO4A 1Q85A 3F1QA 3CO8A 2E6AA 2PEVA 3KL3A 2DZBA 3W81A 1UOZA 5CQ1A 2DDXA 4PMQA 1WZAA 5I3FA 4DPQA 4O18A 1Y0EA 3WH7A 4FLOA 5AOUA 4WKHA 1V0MA 4LS0A 4BURA 3IJ8A 1A5MC 1EIXA 2GQ3A 3KLKA 3I6EA 4I7VA 3RG6A 1BGAA 2ON3A 2JALA 4RW3A 5A2AA 2WZHA 5IOBA 1GOXA 4DNAA 4MJ4A 4EWJA 3ZOAA 4N9EA 1ZALA 4IQEA 2DH3A 3MUCA 4W86A 1Z89A 1QI0A 3UW6A 1RPKA 4L9ZA 3N2XA 4Q4MA 4MKVA 4IIGA 3LRKA 2VENA 1TSIA 4ATWA 4WX2A 1LL6A 1PKMA 5JCIA 1LOSA 4YXGA 3WD0A 1ELSA 3VKKA 2ZVIA 5DRCA 2QCFA 4GR1A 2Y85A 1EEXA 2R1LA 4K8DA 4KIEA 3V5OA 2XYLA 1JZ4A 4C1LA 2OJPA 3LXCA 1YMYA 3GC5A 1I60A 1YPXA 2XSXA 3MZNA 4A8NA 4BV6A 1K8XA 2J79A 1Q2RA 2J4GA 1UHVA 1JAKA 4OUIA 3N12A 4O1BA 1NOWA 3PWIA 1X97A 3QPYA 2OZ3A 4X61A 2PDWA 4FR6A 4EANA 6XIMA 2BHUA 2WHLA 3M9YA 1UUOA 9RUBA 4DJDA 2VDGA 4HK6A 4IP5A 2XWDA 1BTCA 3BGJA 1XG4A 3LD5A 3DU0A 2W66A 2QJGA 2BBFA 4DXVA 2AAAA 3AN1A 1RCXB 2PGWA 2ALDA 4JTCA 1VAHA 5EU9A 3CZKA 1Q3NA 5C70A 1Z7AA 4NHVA 5I78A 1F7BA 3HW2A 1QAPA 2NWSA 5I5RA 3MT1A 4NILA 4IP7A 1X6NA 3IV3A 1POJA 4MHBA 2E3ZA 4GG9A 2TYSA 2Y2WA 3NO1A 5H1WA 3TNOA 2PDNA 3E2VA 3USBA 1SZRA 1EJ7L 2Q01A 2GLKA 1Q6RA 3XIMA 4F66A 4KESA 1E71M 1BQGA 3CAWA 5T8GA 4R5EA 2IKGA 4EPDC 4WDUA 3BXWA 4I9MA 3IIXA 4H50A 1NP0A 4GQ0A 3S3GA 3UETA 1DP0A 2BY1A 4O1FA 2WPFA 2OMAA 1HN1A 3M0LA 1GEQA 3W1QA 3VD7A 2WMIB 4WXYA 2WCSA 4UOZA 1DJHA 1F8IA 2ZX5A 3RPTA 1H0GA 1E9YB 3CV7A 1CPUA 3QFAA 2FJKA 3K8MA 3KOYA 4UZUA 1Q1WA 1ISXA 3W23A 3M0YA 5I7GA 3B0XA 1BFNA 2FZMA 3HN3A 2YR1A 1YTEA 2DT0A 3LEPA 3APYA 4IL0A 1A5BA 1OIMA 1W6TA 4ZQPA 4HCHA 1T8QA 2BC0A 1JPIA 3QQWA 3R6IA 1PX3A 3QTPA 1JRCA 2BGSA 2CHNA 2VC6A 2DQWA 2PCQA 4QLJA 3USZA 2WNNA 4L9YA 2VRKA 1V0LA 3BGAA 3RDKA 4K7VA 2GUUA 3O6YX 4JEJA 3T44A 4CCZA 1VIZA 4UNLA 3BV4A 3L7RA 1VFLA 3CZJA 1FWRA 4HQVA 2GUYA 2D3LA 4XBKA 3O2LA 5GNXA 2YKKA 4L6DA 4JTQA 2QGHA 1MWOA 1GTEA 1UZDA 2A3LA 1ZUAX 1W5QA 3HG5A 4D8AA 4QIUA 1KR0A 3V75A 1VJSA 2WC7A 2Q6ZA 1RPXA 3SI9A 1W9XA 3W72A 3W6YA 1EGMA 1ME8A 3RCMA 1O60A 3CV1A 2FTYA 1TPUA 1TRDA 2CFFA 3LLXA 1FX6A 4QS5A 4A2RA 3VXGA 3T78A 3QEZA 4AEEA 2I7GA 4FMVA 2CU0A 3RILA 5TD4A 3PFMA 4GUFA 1W32A 3VNIA 2UY5A 1WDSA 1JCJA 3T4CA 4AEFA 2VURA 4FX9A 5DQPA 4FAMA 3RX3A 4PUEA 3NG3A 4GJJA 1QHOA 3CLWA 1XLKA 3LDVA 5D4YA 3GKFA 3NPXA 4NP7A 2NV2A 4FOUA 4LAMA 1UOKA 2RDTA 1SZEA 2ABAA 3M0IA 3W1TA 5G4HC 1U1HA 3WBYA 3VYLA 1XPGA 3B9OA 5AB3A 1UP0A 1KCKA 2WKGA 3DDMA 4JN6A 3HIJA 4UTJA 3VM5A 4DM2A 3SRFA 3NPUA 4AD4A 4MFEA 5LGZA 3BCJA 2UV8G 3GDLA 2QHAA 3U6WA 1CT5A 2QGYA 3P82A 5FACA 5FEPA 2CLPA 3WK3A 1YDNA 2IQ0A 2Z25A 4W9TA 1W5PA 2G3JA 3G8EA 2WYSA 4JL2A 4TUFA 1KB3A 3EWWA 1X1OA 4IMCA 5HATA 4B4HA 3WLHA 2NXHA 1VHNA 4MNLA 3QVQA 3LOTA 2OWWA 1DXEA 2JEPA 5HDRA 3PBMA 1J18A 4NIRA 1EOMA 3GVQA 3UA3A 1XLJA 3ZM8A 1EWDA 2VZUA 4AX7A 5IFTA 3MSYA 3P61A 1C91A 4Z2HA 1ICSA 1IXNA 4EMJA 2AMXA 2VOTA 2BMBA 1HJSA 3TLQA 3BLPX 4OKDA 3U4FA 2CHOA 5HMFA 4DB7A 2AAMA 2B7NA 4NZCA 1PE1A 4I9TA 4LQ1A 1VPXA 1L6FA 1Q1RA 3W2MA 2E5BA 4L56A 5E93A 1PWMA 1ZS2A 2Q3OA 1TWIA 1GRTA 2GSJA 5J5DA 3CQJA 3FG2P 3OO2A 2EO7A 3ABSA 1TV4A 4ZO6A 4NJHA 2WZTA 5CG7A 4EQSA 3VIHA 2Y7GA 2H8ZA 2IPWA 3A5FA 1YE4A 1MO9A 4WRHA 2DUXA 4JY8A 1K02A 3C0LA 4EXBA 2BV9A 4XKYA 4HA1A 2OVLA 2X1RA 1ZCOA 1TPEA 1GRAA 4JS3A 3S5NA 5FIPA 1F5ZA 3P5ZA 1U5HA 2WNZA 3QYQA 4CU7A 2YFOA 3U8GA 1SJDA 1TV3A 2WAGA 2DGAA 4JR5A 4NSBA 3V4BA 5K2ZA 5FOOA 3P93A 3U0HA 2J6XA 4JDRA 1F4AA 4ZOHB 2X16A 3CM4A 3KBVA 2XIMA 4OTKA 3TSDA 4H8NA 4HNNA 3VNZA 4JD4A 3A23A 4KH2A 3GC2A 4UR8A 3DGZA 1UW9A 2DZUA 3BPWA 1PJ9A 1EHNA 1PVNA 3UJFA 1AL7A 3U57A 4FF5A 2HQAA 2PC4A 1TV5A 3LPFA 5KINA 1XBVA 4IIBA 1VQTA 2Y89A 5D02A 4JFSA 1O95A 3TROA 3LPGA 2E6DA 3NL6A 1JNEA 4AD5A 2OSWA 1AZ1A 3RXZA 3WCZA 4GH3A 4DAFA 1UMLA 4NEVA 4L7ZA 3E0WA 4YHEA 2O92A 2VZTA 4MB5A 2VX7A 3PZTA 1HKWA 1WBJA 1HKIA 2XPKA 3CZGA 2SFPA 3W22A 4M3PA 3GX9A 5EMMA 4DN1A 4Q22A 3OGRA 1NSJA 1XHGA 3DKLA 4DI8A 3W7JA 3E12A 3M5XA 4M6VA 2PI6A 5CSYA 3GXNA 3CZ8A 4IWWA 1VC4A 4IISA 1AUSL 4ROQA 3DUGA 1V3MA 4M19A 1UR8A 4XQ6A 1GYNA 2HBXA 3EANA 1W9VA 2E4TA 1TTQA 1GWJA 1P1MA 3M6YA 3UJSA 2A5HA 4RZ5A 2XVGA 1BWLA 1K8ZA 2INZA 4H4TA 4O14A 3UGVA 4NKCA 5A95A 2VFEA 3IRSA 3G1RA 3RLHA 4QP0A 2QLYA 3IANA 2FPTA 4R7WA 1UYQA 4INFA 2XSAA 5I0DA 2D2OA 2DW7A 2ACQA 1CGTA 1QW8A 1TZZA 4OECA 3R1ZA 1TPDA 1OFDA 1XGDA 3ARUA 3LPPA 1RVKA 3EDJA 3BQ6A 2XN1A 1MW1A 1WUEA 2FTWA 3TZNA 3VIJA 1JCLA 3WK1A 2VHLA 2V5LA 3NXFA 5A8NA 1UR3M 4I7WA 4Q3MA 2WSQA 4BHYA 2H3BA 3IACA 2BVDA 4IX2A 3PANA 2G95A 3G1YA 3VNDA 5K3VA 1LROA 1YDOA 5DY3A 5H2ZA 1BZLA 3IIZA 4F2TA 1EJSC 3RU6A 1G6CA 5A6LA 1EBHA 1LCOA 4QFUA 5K7JA 1BAGA 1ZJIA 3LZ3A 4TMCA 3M5YA 4W85A 4AIBA 3VK5A 4K1GA 5CZ0A 4D6CA 3KP1A 2QIIA 2VQUA 4JTAA 2G8ZA 4ADWA 3HOJA 4GUIA 3VD4A 3MJYA 3IIPA 1GSNA 5FSDC 1XM3A 1PWLA 2FGZA 1GNXA 2XZ9A 2F5ZA 5K4XA 2J9XA 4KCVA 4OE7A 2OU4A 4PZVA 2C0HA 1TCMA 4GZ7A 4H4SA 3EDFA 1KBIA 4QSFA 4JBRA 1YTDA 4ERIA 1M03A 4K2SA 4XV0A 2WMIA 3QJAA 1VFSA 4LALA 1IR2A 2Y61A 4YWSA 3EAOA 1VB9A 5HK4A 5F7UA 2NT0A 3CNYA 4QGCA 3KX6A 4M81A 2FVLA 5MKGB 4E2DA 1ALDA 2DFAA 3FDGA 2PMQA 4OJYA 4B2DA 1JRBA 1MQRA 2OEKA 3AUJA 5HA7A 2Z1SA 3SB0A 1YLVA 3GR8A 3NYDA 4A22A 2IPFA 4DZHA 2Y8KA 4OOUA 4D1JA 3TXZA 2VVNA 3W86A 2PTZA 1ZU8A 1GVSA 1CNVA 2PDQA 1BRLA 1E3XA 2REQA 3QR3A 3CK5A 2C15A 4HHHA 1XGEA 3EAUA 3C86A 2HDJA 3N3TA 4MUPA 4DBSA 4C1KA 4KQNA 4NAFB 1EZ2A 1IIGA 2WO5A 4PL1A 1SFLA 3HGOA 1FRBA 3TE9A 3F4VA 2ADAA 3D5HA 2XGIA 4YTTA 4ZBCA 2W79A 4PTNA 2YXXA 2XIOA 3C0JA 1DIEA 3CS2A 2VDIA 1R86A 2ZRUA 1B1YA 2WOVA 4Q8PA 2CITA 2ATSA 3C2FA 3HJZA 3VIIA 2Z0IA 2OLSA 3H4KA 4PMYA 3ARRA 1KNWA 3EX1A 1X7IA 1HKMA 5JH2A 3WDPP 1NFPA 4WVXA 1S2AA 9CGTA 1W91A 3L4UA 1H3GA 4M24A 5T26A 4XK2A 1ZBWA 3AMZA 3GH5A 3FEMA 3WJXA 1Q6OA 1UP3A 1B3OA 3EX6A 4HMEA 2FMNA 1KCXA 2O9OA 1XYFA 5DMYA 2NQHA 4IZGA 3PVFA 1ECEA 1UH3A 1KWGA 4H4XA 3VC5A 3TTQA 5HMDA 5G2HA 3TXVA 4GLEA 1E3ZA 4RCXA 4ZA0A 2QDEA 3I3BA 3MMTA 2AKZA 3JS3A 4PRRA 4Y9AA 1U1UA 4FLSA 3HB9A 4UTMA 3EXRA 5FF2A 1EA0A 5FEWA 2C6QA 3R0UA 1BXNA 2BTMA 1LRNA 1A5CA 4UNKA 2BNJA 3UZJA 2PDUA 3DI1A 3KHJA 5AN7A 4Y7EA 4BKNA 2Y7DA 4JX5A 3AWNA 2QVNA 3FW6A 2VTFA 4KS0A 1BSLA 2ZXBA 2AQVA 3TMQA 1XIDA 4F4RA 3SURA 4S39A 3HGJA 1FP9A 4S3DA 4JNYA 4JTHA 2PP1A 1VPQA 3GFZA 5C9WA 4WD0A 5EA9A 4IICA 3C2RA 1QR7A 1IEWA 2OCZA 4TQTA 3MHGA 4UFJA 1KFEA 3AIVA 3BAYA 4GI6A 1ISVA 3ZSTA 2VFFA 1OCNA 8A3HA 2NSOA 1F8MA 2GFTA 4E2OA 1EB3A 2ZZ6A 3RK8A 3P80A 1LG1A 4CN4A 3BZGA 3L4VA 3WF1A 3PZVA 1HKJA 3OIXA 1C9WA 4Q7IA 1N63C 1TIMA 3SY8A 4XWUA 1V3KA 2HE5A 4ERAA 4LAOA 1O68A 1DWGM 3LTPA 3LM3A 3F03K 4PB3A 3CIVA 2WNWA 1J6PA 3FNDA 5HBFA 1H7PA 3R58A 3UERA 3L65A 1I45A 1EC8A 4LS1A 1TUFA 3R2GA 1LQ2A 1XLDA 1B3WA 4I5UA 1EGVA 1ZBCA 4BR1A 2C1IA 4UFLA 3GU9A 3GKAA 2WANA 1OX6A 1V51A 3W7MA 1C8QA 4R34A 2NXGA 1KC7A 1C90A 3VM7A 1LORA 2HPMA 5F4XA 1G1YA 1KQYA 1PPIA 2PDFA 4MG4A 4H19A 2CHRA 3S2MA 3RU8X 1V5XA 1B9BA 3QGVA 4GYJA 1CIUA 4JFUA 5D32A 1JGIA 4UFKA 4JTSA 3KDNA 3VNLA 3LB0A 2OZ8A 1TUXA 3AMKA 3BUVA 1UMYA 2CBJA 2CBIA 2G97A 3IJ9A 3CHCA 4TVYA 2ISDA 3F4DA 2Z4GA 2NPXA 1NH6A 4XIMA 4NU7A 2NQLA 1QPQA 1FUYA 4WF7A 4GVIA 1H1YA 2VT0A 5CPOA 3OVGA 3CGDA 3GW3A 5I06A 4D6HA 4ZTXA 3ANVA 3CPGA 3TOPA 2NQ5A 3BE7A 3WY1A 1DJQA 1N5XA 1Q2SA 1GPFA 2HJPA 2YCLB 1JDAA 1ZJBA 4IPPA 3SRKA 1R2RA 2X40A 5AYIA 1RP9A 4H8UA 1SR0A 3TYAA 5CBIA 2F84A 2A79A 5FJJA 3G77A 2TPRA 1TMQA 1HJWA 4DJDC 2DZSA 1VPYA 4C6BA 1KFCA 2R1NA 3GBDA 5AZ0A 3MHUA 4N6FA 1BD0A 5LXXA 5DF0A 1F3PA 4U5IA 3CUGA 4XUYA 5XINA 1GHRA 1U33A 3VDHA 3CXOA 3VMOA 2CXGA 4MB1A 4XD5A 2FVMA 1BYDA 4LB4A 4D71A 4RNJA 1JDDA 4P8WA 2B7QA 2BWGA 4GCXA 3FXGA 4TO8A 1AQ0A 1CGUA 1OB0A 2WMJA 3ITTA 3STGA 1JCXA 1RD5A 4N9DA 1AL8A 4JTKA 1X38A 1TR1A 2ZBTA 1UZ4A 3RMEA 2RGMA 2PWEA 3C5QA 1K6WA 1GQIA 5FESA 2D2JA 5EYWA 1RBAA 1RHCA 4WJXA 3B0UX 3GVVA 3MV01 2GVYA 2AL1A 3OP2A 4CQAA 1ZBVA 1SU5A 3WLRA 4EX4A 2NVAA 2O55A 1KKOA 4IIDA 2CZFA 3ZFHA 5CC6A 2WPGA 1PX4A 3BV7A 2E7FA 1AQFA 2VFIA 2CEQA 4Y9MA 3A5VA 5LNWA 1A80A 4PCNA 3G6LA 5AYBA 3TKFA 4LC8A 4QX4A 2O9TA 3SN0A 3LLFA 3OHIA 1LPFA 4PTMA 4YIWA 2YOCA 3LM7A 1KQZA 5LIXX 1RQEA 1TKKA 2PRMA 4XISA 4A3YA 3BOLA 4IHCA 4XVEA 3UPMA 1GOIA 3NZGA 3MZ2A 2Q8LA 4A05A 4K7YA 3N73A 2E3TA 1AD4A 3KOZA 1EX5A 1EDQA 2B4GA 3S46A 3PN8A 3OZPA 4HN8A 3U4AA 2ZXDA 3PB2A 3M7WA 3CUHA 3GIQA 2BY3A 5LA2A 1T41A 3SADA 2NVKX 1T5AA 1E6XM 3WJZA 1B0IA 2G3NA 1MO0A 3I7SA 3CHFA 4R9OA 1CENA 5CPTA 3M0HA 3JZEA 4DWSB 3NVVB 1EJRC 3B97A 4XD4A 1GW1A 3UD6A 4EOUA 3GDKA 1W3HA 3LS9A 1T0OA 1RK5A 4ATDA 2RKXA 1ZSXA 3UJRA 4WDTA 3GY1A 1UJQA 2X1SA 3PTKA 1S39A 3G24A 3U5YA 5A5WA 4N9CA 2ZWYA 1JPMA 3RRXA 1WDRA 4B3KA 2J25A 4E4UA 3T07A 3AXKA 4Z0SA 3BJFA 3SAZA 4O50A 4DYJA 5F2MA 1ISYA 4JNZA 5I24A 4ZQOA 1YNPA 4S3AA 3WEMA 1V79A 2YCKX 4PUMA 1F3WA 1U30A 1DJGA 2EG7A 2C1HA 2XJ7A 4H4ZA 4DLFA 3OLDA 1TVNA 1ZAJA 2R9RA 2P76A 4DJFD 4PC8A 3PG8A 3BMVA 5HUOA 1LLWA 1PDYA 3NL2A 2WPBA 4XKMA 1NOFA 2O4MA 1OK6A 2WCGA 3SY1A 1UPMB 1FP8A 2L5HA 1XSJA 4RDYA 2G41A 5A2CA 1V8EA 1JI1A 4E5TA 1ZPTA 3VIGA 3K5XA 1E4LA 1EO7A 3U3HA 3G18A 1HJUA 2NV1A 3W01A 2HWGA 3OZOA 2IPJA 4DWDA 3AO0A 2PUZA 3NQ7A 1UIOA 1E6QM 1FCBA 3P62A 2CKRA 3H2MA 4YYCA 3HO8A 5BZAA 3GRTA 2VZSA 1ECQA 1G9HA 2VEGA 2QEZA 3TDFA 2Q71A 3UZXA 5I09A 2VX4A 1H6VA 4GH1A 2ACUA 3GZAA 4GVHA 4OU1A 3F5KA 3SECA 3KRUA 5CLWA 1DOSA 3S4TA 3L4YA 3AI0A 4KEZA 4NZ3A 5EBKA 2E40A 4PFMA 3T6CA 4J3ZA 1DEDA 3FJNA 2YW3A 4PL2A 1C9DA 2I16A 4DEFA 3MWAA 4GO8A 2HS8A 5HQMA 3KEHA 3WH8A 2DSWA 4V15A 4F0KA 3VNYA 1GV4A 3ZWSA 1J93A 1XIIA 3VC6A 4QRNA 4US5D 1TA3A 1DYSA 5CCZA 3KTCA 3DYOA 3Q94A 3B06A 2EKGA 4DPPA 1TJ1A 4NYUA 4APNA 1TWSA 4JY9A 3AXXA 3G1SA 4EAMA 4LBRA 4US6A 3HF3A 1UR2A 1E6PA 3EWYA 4AISA 4W88A 2Y8UA 3WH6A 4MLJA 2X1TA 4AWTA 1W1ZA 4IQJA 3ICJA 1EDGA 2JKPA 3MANA 4W7UA 4P8UA 3NNTA 2GGIA 1CW2A 3EDEA 5KVIA 4O12A 5A8GA 1FEAA 3AYVA 1N8WA 4HSNA 4DBWA 3PR2A 4EVZA 1A5KC 4H7ZA 4ZO7A 1QBBA 3UR2A 3MKKA 3ID7A 4ML4A 4E2VA 5CZJA 5AKQA 3N15A 2PA6A 2XM2A 4A21A 4IPJA 4A29A 4JIQA 2YZRA 3NGJA 2BHZA 1FWHC 4WSHA 4MZ1A 3PB0A 2V2HA 4V28A 3O6DA 1NDVA 3H23A 3O7UA 2CKSA 5M17A 3NL3A 1PXGA 2GR0A 1AJZA 4PBEA 4AF0A 1TMLA 1RA0A 2PWFA 2CETA 4BQ4A 3S1WA 2Z00A 1V6XA 4WZHA 2ACSA 4WJEA 1E4NA 3R8RA 1JQXA 1KCZA 1XINA 2F8QA 4AUBA 4AZCA 1A49A 2QV4A 3RJYA 2NV9A 2JEQA 1KTBA 1WO2A 4CD5A 1XANA 2RDXA 2WHJA 3ZLFA 1U2YA 3QFBA 1KRMA 5LNUA 1IWAA 1GQNA 3TEVA 3D6NA 4NAFA 4BQ3A 3F4WA 1SJAA 4GPNA 3DK9A 2OGJA 1HO4A 3H12A 4GUGA 5DLCA 3FFSA 4A2SA 5D2YA 1S38A 1PUDA 3QLDA 4GISA 4ENLA 4WK9A 4GFIA 4S2BA 2QKFA 4US5A 1NARA 1PYFA 4H2HA 4YHGA 3EPOA 1UKPA 4V1YA 2Z2UA 3P84A 1EGZA 3NGFA 1KM1A 3GG0A 4O0QA 1AFSA 1CXIA 3B8UA 4WHBA 2RDUA 4C6JA 2VD8A 4IUOA 4JHMA 3RO6A 4U31A 4LNYA 3NVZB 1MSSA 4LSBA 4NY2A 3SBFA 4V1XA 1Q6LA 2EAWA 1DTNA 2GGEA 1DJXA 3TLLA 3PC0A 3H2AA 5AVNA 4XZWA 1KA9F 4AFYA 4FX7A 2YDSA 3LN3A 1UR4A 4M6UA 4QAIA 2W63A 1EEPA 3GTHA 3T55A 5LA0A 1XKJA 1FCUA 4L1XA 4W89A 4XVDA 4AVOA 1N55A 5A8PA 2CERA 5D37A 5HULA 5I23A 3P2VA 4H04A 3NUKA 4ZO8A 5BU9A 1W56A 1E9ZB 1Q7MA 3OQEA 4PRTA 3B03A 2QIWA 5LIWX 4MWAB 1XDLA 4FDCB 4BI6A 3TZFA 1XLLA 4JZ5A 1FFUC 4NNAA 1WDPA 4ZB5A 1XLCA 2YA2A 1GEUA 4UR9A 1MZHA 1HP4A 2JKEA 2NQZA 1QVBA 3M4HA 2GQWA 3CAVA 4H9VA 3BAWA 1RVGA 1UWQA 3TP4A 3Q2DA 2XFWA 4JFTA 4E4FA 1SUXA 4NASA 1VFHA 3GXFA 2WNQA 4EMWA 4HTYA 1M7PA 2XH7A 2ICSA 4GHRA 2R14A 3ZLGA 1ADSA 1XHCA 4G7EB 1WZLA 4EAYA 1WPCA 4FP1A 2PDCA 2E25A 4KRUA 1SO5A 3DENA 3WLMA 2PLKA 1GJUA 2Z7GA 1X6UA 1DJYA 3EWBX 4JIRA 5I77A 3KTXA 4LF2A 2FPYA 3UU0A 1DVJA 1L8NA 3U2OA 3WQWA 2V81A 3A4AA 1J0KA 3G8RA 4I7UA 1XPYA 2G0WA 4U4MA 1FIQB 2Y63A 1UC4A 1NQKA 4LUYA 4H9UA 2PWUA 1FY6A 2I5IA 2ZIDA 3TN3A 1FWBC 4NZJA 4CN6A 1BTMA 3T42A 5DEZA 3H70A 3B3DA 4XSMA 4C6LA 1DJNA 2F6XA 4HPJA 3GS6A 2JK6A 1H7XA 1EWEA 3LCXA 3LBOA 1W3KA 1NDZA 4F2BA 7REQA 4NXKA 3BMWA 3WFZA 5EMJA 3S8HA 3NM3A 4NZ1A 4C6PA 3SQMA 4HU3A 4GNKB 5CGTA 4G8TA 2YVFA 5A8OA 1OCQA 1B4EA 1L6SA 3WUGA 2NT1A 3P0WA 1AOGA 2XVNA 1Z8AA 1EF3A 2WWCA 1FWWA 1KM0A 4UTWC 2OFJA 2E5AA 1LUCB 4DBUA 4WEVX 4QEEA 2R6OA 2VCBA 3ITGA 5G2IA 4R88A 2Q09A 3BLLA 4MZYA 3TA6A 2REQB 3UY7A 2QCHA 1H09A 1VQZA 1OF8A 3WJYA 2W3ZA 2J9YA 9XIMA 1U1JA 2RDWA 5A6JA 5JBEA 1R7OA 1QNOA 2VGIA 5I6SA 3GXTA 1HVXA 5REQA 1TPFA 2PODA 2VOMA 2WV8A 4H6RA 4OOZA 3ABXA 4JYDA 2YDRA 3S0CA 1KBLA 3KL0A 3T2PA 2LLEA 4O57A 1J5TA 1M6IA 4TX8A 3MVIA 2BASA 1EC9A 4KCUA 3Q65A 3MY9A 3QFEA 2PTDA 3PAJA 4M1BA 1Q8AA 3ANYA 6ENLA 1F61A 3SDOA 1VBGA 1TV7A 2YCIX 4QE1A 2ANUA 1K3UA 1ZXIC 3OLIA 3W7LA 1CGYA 3WK2A 3C0SA 1ONRA 2F2KA 3OTRA 3FKRA 1NF7A 3E6EA 3HFYA 1GCYA 3WX7A 2ZZCA 3NS1B 1ONWA 3AWOA 3DCPA 3N4AA 4O8RA 3NVDA 4IXXA 1AMKA 4ACZA 1JULA 3MP3A 4HHMA 5IHSA 5K9DA 4MY9A 1UWTA 2PU1A 5D9PA 1F07A 3SQSA 1KRCC 4W87A 2QPUA 3AXIA 3GNRA 1DXIA 1D3GA 4MSSA 8TIMA 1QPRA 3HPZA 4J7RA 3GYCA 1LBFA 2BS9A 3AU6A 1JEZA 2CLLA 3BG3A 4RXFA 2EKCA 2XTKA 2PGRA 3H7UA 1OY0A 3L5MA 1LQ0A 1ITUA 5A2BA 2ZUSA 2OG9A 1DWAM 3LHWA 2WP5A 1CXEA 2YVJA 3WBWA 2PP3A 4GXPA 4E6MA 2QAEA 2VGGA 1OQFA 4AEOA 1A47A 4EKJA 3DG6A 3B8TA 3OQ8A 3W73A 3QOMA 5DCBA 4ZODA 3EWCA 5AHLA 1DIDA 4LB3A 3KTSA 1F4HA 1NOUA 3E5PA 3AHVA 3B4YA 1Y7VA 1ZJAA 1JDCA 2A3BA 5C9UA 4O15A 1LJYA 2V3AA 3GLCA 4Y2WA 3BWWA 1ZAHA 3BJSA 2G5WA 3QR1A 4Q4SA 2PDBA 3RLVA 4GXMA 1E0XA 4M7TA 4YLWA 3LV6A 3MP4A 2OX1A 1XGZA 4QISA 3ATYA 2YCJA 4HK7A 6REQB 1F9CA 3L0KA 1ZK7A 2E5CA 4O19A 1Q7ZA 5DRIA 1ADDA 3TOYA 1W2PA 2BP1A 3O05A 1FTXA 3TV8A 3L0NA 3BCFA 4H9ZA 2QCEA 4KEUA 1A53A 3MO7A 3H4GA 3V7PA 1LZOA 3AXHA 2NQJA 1H51A 1XD1A 1YTKA 2C1GA 3WL1A 4BFAA 4JEQA 3T4WA 5E1QA 4ERGA 1E0VA 1O5XA 2AGTA 4GKLA 1H63A 1FWCC 2ZZ5A 1Q6CA 2Y70A 1GVQA 1E6ZA 2ZXAA 4WKAA 1VP5A 3P6LA 2CWNA 4RE0A 2FFIA 3C8NA 3MI6A 1FFVC 3K4AA 4UTHA 4IFOA 1QASA 3KBMA 2J8FA 1Q5MA 3GAYA 1N7KA 1XQLA 1XG3A 3IAPA 3L5LA 4Q6XA 3WSUA 4NUWA 3CV6A 2FH8A 5HUPA 1QWGA 4C6NA 1W1B1 3A3HA 3MSRA 3QV8A 2WSYA 3G3DA 1AVAA 2ZUVA 2GJRA 3MPGA 2XUCA 4HZ6A 4QNEA 1LLOA 4DJDD 1XRSA 3TCEA 3BW3A 4LY4A 4DWSD 5FS9A 4HN4A 2D20A 4P5UA 4AZGA 3AIWA 2EBNA 4M29A 4JQAA 2C8NA 4LBUA 4N7QA 5G1TA 2E0PA 3VILA 3FS2A 3BH4A 1UH4A 1XBXA 4B5XA 3NSXA 4D6DA 1WAUA 1EPXA 2CLHA 1N60C 5IRPA 4OQVA 3W7QA 5EB8A 2CZDA 4JAWA 3N29A 3STPA 3T81A 4Q4RA 1RK6A 2UZ9A 3MA8A 2YYTA 3OHMB 3EB2A 2R9ZA 5F4WA 4F8XA 4Z1DA 1TFVA 2W3RA 1W3JA 2BXVA 2XGBA 2GDVA 5AHEA 3PWGA 2G4JA 3WD2A 3S6DA 4JTLA 1M7OA 4I6VA 2A1YA 4LCQA 5A69A 4W84A 2OYKA 2WVTA 1VLIA 4TIMA 1W5OA 3O15A 5I3JA 1E1EA 2HTMA 1UR9A 2PP0A 2V3DA 1BSIA 4B4FA 2V3FA 1DKWA 2GOUA 4GNJA 1ISWA 4KMQA 2E5DA 3WH5A 3QF0A 2CXEA 2OX4A 1CCWB 2XVPA 3TJLA 3WUFA 2XIJA 4X9SA 5ABGA 3DHFA 1F3TA 1V3IA 3VDBA 4QNWA 1E9IA 1XISA 3DZ1A 4ZOEA 2QUVA 3ARWA 4QJ4B 1C93A 2I5GA 4ICCX 3PP7A 5D09A 5CSRA 7TIMA 4U5KA 3K1GA 3WBEA 3EPNA 3QLLA 2FHFA 3SUWA 2A7NA 4XZIA 4FEZA 1GQJA 3S6TA 5CH9A 4XAZA 2J7DA 1NU5A 4RDWA 1RUSA 2WHKA 2PURA 1RALA 3SIZA 5ABEA 3UT0A 4YMZA 1SGJA 1JIBA 4MWAC 4ILSA 1NFBA 1W3LA 1PDZA 2VD9A 3DESA 5AHNA 4LNCA 4PFHA 1PTGA 4TX6A 3L23A 3R0DA 1FWJC 5I3GA 1RH9A 1M1BA 1UJPA 3D3FA 3W2UA 1G4SA 4CCEA 1ONXA 3P67A 1GT8A 4EXQA 2OQYA 1FFRA 1P43A 3I10A 1GESA 2NUWA 5F2IA 1VJZA 1PTDA 1FOBA 5GJNA 2A3HA 3WF3A 2DSVA 2OZTA 2A21A 4N0RA 2ZA3A 3QQ1A 4NZ4A 2CBVA 3DXIA 2ZE3A 4FNTA 1Y65A 3B8VA 3T0CA 1H62A 2IS7A 4P8VA 2CCRA 3UESA 5AC6A 2OKTA 4GOAA 5IBXA 1RA5A 3ME3A 4BEQA 1JI2A 4WOQA 5JQ9A 4FOJA 2DY3A 2F9RA 3NQGA 2HK1A 4RXGA 4H6EA 4LS2A 3LI1A 3ARXA 1ZHAA 1PAMA 1F05A 3FOKA 3SCNA 4H7CA 4IQDA 2BX7A 3NTYA 3E74A 1TREA 1DIOA 4AG0A 1G7VA 5KSWA 3RF9A 1OFAA 4E8DA 5FAJA 1SM9A 3HJEA 2QR6A 2Y7FA 3REQA 5M5DA 2C79A 2VEKA 1GK8A 3HG2A 2OPJA 3GZ3A 5AYZA 4G9PA 2J74A 1ZFJA 2VMFA 3WH9A 3WJWA 3QMRA 1BF2A 2FTPA 4PBGA 1AW5A 1V6TA 1JCNA 2R8WA 2VZVA 3QZ6A 3EOSA 4URIA 4JICA 3NIYA 3W53A 4P61A 4HVXA 3F7JA 5CSSA 3W82A 1YHTA 2P3ZA 4Z42C 1KM5A 3BANA 1RZMA 3GU1A 1JDFA 3VX0A 3G0UA 3PSVA 3AJXA 3W7OA 3Q4DA 3XINA 2R24A 6ALDA 5KZ6A 1CI1A 2E8YA 3W6MA 2A8XA 4DJFC 4IOTA 4CD8A 1F6PA 2V8ZA 1W54A 4YNGA 4OBRA 4C91A 2X8GA 5T9CE 4JX4A 1B90A 5TNVA 4AW7A 4NJGA 4LBSA 1R0MA 2NVDA 2HVNA 5G5GB 4JDBA 1XLFA 1DIKA 2OT1A 1XYAA 5U7SA 3E2SA 2ZCGA 3UJEA 4MPQA 2QUMA 3BZJA 1B3XA 1GVIA 5DANA 4M8UA 3P8JA 1PKYA 3D0CA 4UIOA 4NRSA 2E28A 1OT2A 4IT1A 4QG9A 3HZ3A 1J12A 3MYOA 4MWAA 1T40A 3QH2A 3L5AA 4YWIA 3FDKA 2D3NA 2UY4A 5FS8A 5KTLA 3GH4A 1K9DA 1SZGA 3CBWA 5KETA 2IXVA 3HPAA 1WCGA 1TWWA 3EB4A 3MWCA 4X60A 2YJQA 4GKTA 3GDTA 1OFBA 2VEMA 3VGBA 2B0MA 3WMLA 3FY1A 2POTA 3QKEA 3AIEA 5FF0A 4DZAA 2Z1VA 1NELA 1TVPA 2FMOA 2X8RA 4MGGA 2XH4A 2VVSA 4J9JA 1MOKA 4XKYB 1LRQA 4ZQNA 1GUVA 4KRZA 4F0HA 4H4RA 1IGWA 4KW2A 1XWYA 1GZ1A 5I3HA 1UROA 4JGDA 3HGSA 3TNBA 3AISA 2ZZBA 3I6TA 3PM6A 4GQGA 1YXCA 2CW6A 4BWLA 3VUPA 2MANA 3J7HA 3C0QA 3MP5A 4A3RA 3CAKA 1QFEA 2V5CA 4UR7A 4HIBA 2WPCA 4M7SA 1OX4A 3WLSA 1DWFM 1XLHA 4MUZA 4MFDA 2PDYA 1O7AA 3DERA 4GFSA 3DJGX 5H8UA 3N2BA 1QJWA 3TQPA 3WQ4A 2HK0A 4O13A 4RK8A 1EYEA 1BRLB 5HNTA 5BCAA 1E72M 4L4LA 4X63A 3WNKA 3ARTA 4LVFA 5C71A 2ZX8A 1FO4A 2JBMA 3ABQA 3B0YA 3T40A 4Y9OA 4XUGA 4E8GA 1VFFA 4AF0B 2GH5A 4FX8A 1E5NA 3DGHA 3FVMA 3WNLA 3OGSA 4S3BA 3GHSA 4ZENA 4L4MA 3LGGA 3DC8A 3R5EA 3CO4A 1H49A 3TFCA 4IM4A 2JF6A 5D2XA 1E0WA 1E4MM 3FIGA 4HU0A 2VQTA 3SCPA 2R1KA 1TCDA 3WF4A 3LCWA 4HNTA 1MEWA 2BLEA 2OO0A 4JIHA 3URQA 4RZBA 4PE8A 1WKYA 3WN6A 3GSMA 4QJ5B 3RYSA 4F48A 5BXTA 5KVHA 3A4XA 3WLNA 2W6RA 2OODA 2UWFA 5IFPA 4NYYA 1W1A1 5KMYA 2A85A 6TAAA 3WDIA 3OG3A 5AC5A 2EPHA 1FXQA 4ZEPA 3LI0A 2DSZA 2MNRA 4CN1A 3A24A 1AW2A 4PUJA 2J62A 2ISVA 3G1AA 3GQYA 3CYVA 3SJ3A 1NAL1 4NZ5A 2G4FA 2J9ZA 3NSNA 3VZYA 3CUFA 5C6MA 1FCQA 3NXLA 3W7RA 4DBDA 1J11A 3MTWA 2NW0A 2J47A 2YGYA 1FWIC 1DE6A 2VWTA 2J7CA 1ZY8A 2B7PA 1R3TA 1TE1A 1V3JA 1FWTA 3H7RA 1GEHA 4YS1A 2YPIA 7XIMA 3DHUA 4NI8A 4FA3A 3TK7A 4XB3A 3WUEA 1MUWA 4IMGA 1AH0A 1OFPA 2QULA 4H4PA 3IJ6A 2A6NA 3R10A 3ZMRA 1A4LA 3TA9A 1X98A 2X09A 3W27A 3ARSA 3LMYA 3CTTA 4C6KA 1DQUA 1RLCL 3CMGA 1BYBA 5HNUA 3URNA 1D3CA 3OYZA 3RX2A 2D0GA 5LXEA 4FX6M 1FEBA 1X39A 1EUNA 1KW1A 1CGVA 2VR2A 3ZR5A 1GVFA 3IK2A 3CIXA 2ABBA 3PZQA 1OX5A 1ITQA 4IG2B 4QDWA 3W1RA 5FJOA 1MFUA 1Q6QA 2YQUA 4UQAA 4EQWA 1MMFA 1MFVA 3GB6A 3GRIA 5C9ZA 3AIBA 3H54A 3DH9A 4K39A 4C7DA 4WGHA 3CPRA 4S3CA 1MEHA 4QDPA 1LVLA 3LCHA 1C7TA 4E38A 1Z44A 2AQOA 3FXYA 1E6SM 4OV9A 3IAQA 5BXSA 5A8MA 2BVWA 1QT1A 1NDAA 1EO5A 1TE6A 3WLTA 1JZ5A 1JFXA 5MKGA 2GPTA 2DT2A 2HS6A 2GQ8A 4S23A 1KFLA 4GUHA 3JW7A 3W7HA 3KS5A 2DP3A 1HNYA 4LJ3A 1BVWA 1HXJA 1NHQA 1KGWA 5M3WA 3HPSA 3QY7A 4Q4OA 4YVPA 1SVDA 1F3XA 1FKWA 3NDOA 1R3VA 1HL2A 2DZXA 3TW7A 3TFXA 3V1HA 1DQXA 5D04C 4DYKA 7REQB 1LL7A 3LCLA 3CGEA 1JF5A 4E8CA 4HPHA 3CEPA 3L4XA 1S2CA 1JNDA 1F74A 3PSWA 3WELA 3O8AA 3IGUA 4K7ZA 1V6VA 3EA1A 3NZ1A 3MC5A 4TVCA 3BCDA 4J3VA 2RABA 4MB4A 2GVLA 4MADA 1QHPA 1TYTA 4RV8A 1QI3A 3UXIA 2NWRA 3A4JA 1A3XA 5ABTA 4HZ7A 1R3QA 3THUA 3L8KA 3KRBA 2RHGA 3NZRA 3EYPA 1N5WC 2V9DA 1P6WA 2Z6JA 1C29A 1US0A 2F38A 3IUHA 1N61C 1L2UA 3SRDA 1HQTA 1S5MA 1O5QA 5HANA 2YCLA 3E1F1 1QTWA 2X0YA 3P8IA 4ZQMA 3M46A 3KS6A 2FHCA 4IPNB 2VFHA 1K9EA 2GGGA 3E9AA 4K6AA 1KTCA 3RM9A 1EKOA 3CQ0A 4X22A 5E0KA 3DFNA 4WOZA 5IBXC 4CKQA 5IM51 2YB4A 4PB5A 4PUNA 1S46A 5CC7A 2P88A 4TXEA 1GXFA 4EQRA 4UQCA 4RX0A 2DH2A 4RJEA 1TJ0A 1BG4A 4WY0B 5BOOA 3R07C 3M7SA 4F79A 3S1UA 4CGTA 3AHZA 2V5KA 2ZYFA 3CQKA 4QJ3B 2IQTA 1NWSA 3UP8A 3BTNA 2ZX6A 1C8YA 3A9IA 3OLGA 1V0NA 4WY0F 5C2GA 3BVJA 2VX5A 3CL7A 3GG8A 3PBGA 2J3NA 3N2OA 5A6BD 5I02A 4HD5A 3NOYA 1BXBA 2V68A 3D9XA 3L66A 2YBTA 1KBKA 1P48A 3M6DA 3EWUA 1REQA 3DAQA 1HKVA 3GG1A 5D03A 4FI4A 4N4PA 4JTTA 4UNIA 3H55A 3VVGA 1KCLA 3LX9A 1AK5A 3FAWA 4PEEA 4IPLA 4N4QA 1H11A 3L12A 4C6OA 3WQDA 2BB0A 3CB8A 4QQ3A 2TSYA 3VGFA 2FZ9A 3T7VA 3AMCA 4CCCA 1IEXA 1VEPA 1YPFA 2CLFA 1EOKA 3AYSA 3KRSA 1B9ZA 1GKQA 2X0SA 2VFGA 4OBSA 1XRVA 3BSGA 3CASA 1UP2A 1KM2A 2FFCA 2Q8ZA 4NZFA 3VCNA 1PIIA 1K4QA 4HNOA 1I1WA 3IEBA 2BY2A 2ZZ1A 3TMLA 3WKZA 3KCOA 4MWAE 3GU2A 4GYPA 3W00A 4DF2A 5A1AA 1Z6KA 3APTA 2DQXA 2WZIA 1WXZA 3FJ4A 2ZQ0A 1V7YA 3W02A 1WKFA 2NVCA 2OOGA 4I8YA 5BYWA 2GSHA 3MUY1 4L5ZA 3PF3A 1W1PA 1GOOA 1KRBC 1R9YA 4HYVA 3V5FA 4B5TA 3MCOA 5G2WA 4GQBA 1W17A 3LG3A 4EQXA 3N2MA 1XIEA 3ARPA 1CGXA 3M44A 4LAKA 1PZ2A 1QK2A 4JQ4A 3W28A 4AD2A 4RNIA 3OA5A 1V6YA 1WXYA 4GGHA 1UH2A 4Y96A 3CGBA 4ZQRA 1ZLPA 3HQ1A 3KOWA 1OGGA 2A3EA 5DBUA 1DXFA 3M1ZA 2INFA 3VKCA 4FNSA 4J27A 1HFBA 1JQVA 3UWQA 2EQDA 3AROA 1V03A 2RUSA 2GGJA 4KETA 3NQ8A 1AODA 1C92A 5C7VA 3TW6A 3MO4A 1L8PA 4A4AA 1NQ6A 1RXOB 1D8CA 1QPOA 4H6QA 4R9XA 1V4YA 3SCSA 1H7NA 1D7KA 3GTNA 1K8CA 2D69A 4W5ZA 1XRFA 3PK7A 5H8PA 4XO6A 3KVKA 4IG2A 5I3DA 3E0FA 4X2PA 3SR7A 4XZLX 4EPBC 3RGTA 3W7DA 2RH9A 1EYWA 4HTBA 4JCMA 1V02E 3SFKA 2YSWA 4P7OA 1XD0A 1CZ1A 3QGKC 1K7XA 3EA2A 2QCMA 2PU0A 1OHLA 3FGCA 3CWHA 1W31A 3M0VA 2JIEA 5REQB 5KZMA 3VNJA 1XV8A 1OYBA 2GSEA 4YJ5A 1QI5A 2V63A 3FYYA 8CGTA 2POZA 3LCGA 1T8XA 1N62C 3JUGA 4TX9A 3R7MA 3LV5A 4S1FA 4B16A 4C6FA 5LNSA 3WL0A 2ODOA 3LCFA 5CAHA 2V5DA 4GY1A 5LGXA 1DXLA 3I3DA 4FOKA 4DY1A 4M51A 4P7NA 2W67A 5B80A 4GABA 4KKXA 3UWZA 1QDSA 2GVGA 4B90A 5F1VA 3UG5A 1VLWA 1MDLA 2ZC1A 4ICMA 5CPMA 3OIHA 4AZHA 1BYAA 3C61A 1SQ7A 2P5NA 1U22A 2DEPA 4IFRA 2AAQA 1NVMA 3AFBA 4AWEA 1W2VA 3LY0A 4AZIA 3VIOA 2V5BA 2EHHA 4LUIA 1T7LA 3U7BA 2FH6A 1CYGA 4QDMA 1RV8A 1XIBA 3AS1A 3M5VA 3VOJA 1WQ5A 4AHPA 5AC7A 4S3FA 4EIVA 1M5WA 3JR2A 3SQLA 1KV5A 1LBMA 2C3CA 4P7RA 4DZIA 4S3GA 1JFHA 1JRPA 4H41A 1F6YA 1WX0A 1VBJA 3HQNA 1D9EA 4R33A 5ECVA 1ZZMA 4D8ZA 1JDEA 4JOMA 4Q32A 3GNDA 1DHPA 4AHOA 1OVDA 1H0IA 2J27A 2CLIA 3LU2A 3IJDA 1RBLA 4WLCA 3CTLA 4OVXA 5TBOA 3DGBA 4M80A 2RJHA 1NM9A 1KO0A 3F2BA 2C18A 2X41A 3T9PA 2PFHA 5RUBA 1H60A 1V3HA 1Q7QA 5BRQA 3TTYA 1FKXA 3Q45A 4Z2GA 4PUWA 3UXDA 1WP6A 3NVWB 1UQYA 1XC6A 1DNCA 4DJEC 4WY0A 4PUKA 2W61A 4UFIA 3G22A 4QEHA 3KP0A 1MZRA 3QN3A 4QITA 1LT7A 3BLOA 1IV8A 2VEPA 3CHEA 1QO5A 4Z2LA 3ZVIA 5DY2A 3TQKA 3KBSA 2EG8A 4YTSA 4O54A 2Y4SA 1EL3A 1TZ7A 1S2WA 1CLKA 5HJXA 2ZZ7A 3VIMA 3S1GA 1RY8A 4O11A 3RMJA 3N2TA 2QV5A 1OC6A 1VBRA 1WZMA 2EGZA 2V38A 2W55A 3DYPA 3K13A 3ONCA 1XW8A 5U1OA 3IIOA 4MDOA 3G1HA 3ES8A 5E6ZA 1RLDA 3CAQA 5ABHA 2UBPC 5AYXA 3B9DA 3UYIA 1CXKA 1MXDA 6TIMA 3UWVA 4GYPC 2Z28A 3DX5A 4ZFCA 2EPMX 3NO5A 2GRTA 5DMNA 1VKFA 2I17A 2JGYA 3KW3A 3EBVA 1PIGA 2J7GA 4GIYA 1DL3A 4DUVA 4IGNA 3QPEA 3CZLA 3VMPA 4XX6A 3MDUA 4YU1A 4UTKA 4Z2IA 4BWLC 4HMNA 4OUEA 3CUZA 4JTFA 2WBKA 3GDRA 5CLTA 1ZDLA 4L6HA 2WK2A 4LU0A 1WDDA 5CZKA 4IXHA 5FJRA 1K9TA 2WMHA 4K1WA 4W5UA 4ADUA 2HVMA 3UXLA 3JRKA 2ZUMA 1GGOA 1TTJA 3OPSA 3XISA 3WLJA 3L4ZA 1XQKA 4Q4PA 1M68A 4FXSA 3NM1A 4XO7A 5C55A 2W0UA 1KGUA 4J3XA 2DZPA 5J5RA 3NQBA 5H8MA 8XIAA 4LUSB 5CPSA 1CWYA 1GVOA 4NL1A 1E1CA 3OVQA 1GZGA 1O12A 2HMCA 3PTMA 5C54A 1VCFA 2TAAA 4RE3A 3VA8A 1XXXA 1AH3A 3M16A 4DXXA 1S1PA 2YYUA 5GVJA 3B8SA 2J13A 2O0TA 1OZQA 1IE7C 4DUOA 3U9IA 2BOEX 4LANA 3Q58A 2J7HA 2CDUA 1S5TA 1NIUA 1S1RA 2GL5A 1UQZA 1G94A 2Q3RA 3UZWA 1AG1O 1JPKA 1ZP3A 1FXPA 1JEHA 4DYEA 4JQ9A 4HPNA 1D8WA 1O1ZA 3RRAA 3CIWA 3K4WA 1H7RA 4CU8A 1GETA 2QCCA 3C6CA 2QS8A 3N4FA 4B92A 1BVZA 5U4NA 4ZCWA 2D73A 2OELA 4AAJA 1PKLA 4ACYA 3CQIA 4H4QA 4H4YA 3N34A 1JF6A 2Z24A 4LX4A 1TYPA 4NRRA 3HFTA 3EWDA 1C3FA 4BF5A 4FR1A 2Z29A 4S38A 3VDGA 3S9ZA 2G3FA 4GACA 2QW5A 4GBUA 5G4EA 1S2UA 1DORA 1CTNA 1CX9A 2ZKMX 3KVMA 1KM4A 5JXQA 1E0UA 4W7VA 1Y5WA 5HINA 1OG6A 3DK8A 1T6MA 1UWSA 1RP8A 5GNZA 3ELFA 4DF0A 3AU2A 4QE4A 1XP3A 1Q13A 3W1NA 5DMLA 2R82A 3GNPA 3GUGA 4W7WA 3OGVA 3LXBA 5A94A 1XCXA 1OX4B 4F40A 1DJWA 3PUOA 2E67A 3QY6A 1CXLA 1M9HA 2G37A 1YQ2A 1ADOA 1KV8A 1IXQA 4PMDA 1R3WA 3WF2A 2XH2A 4REQB 1JD9A 4AZCB 1XSIA 3N17A 4HA4A 2IQDA 4J4KA 4UXDA 3GDBA 3ZQ9A 4HSOA 3IUIA 5KEZA 2MUCA 3N6HA 7PTDA 1R5YA 5FS7A 3FA4A 1KXTA 1G69A 2CNCA 1A5UA 4FZIA 4C5ZA 3OZMA 2R1MA 5ECUA 1BPLB 2V6OA 1XYCA 1K7EA 3HA1A 4LEQA 2HXTA 2PTYA 2ZC8A 2ZE0A 3WQ8A 3RM8A 4PYSA 7TAAA 3U2EA 3AS2A 3W71A 2CLOA 3UGRA 3M0KA 2FPVA 4EK7A 2DPEA 3VKBA 2G96A 4LT9A 1K77A 1PEZA 4RKAA 5E5CA 2W3SA 1LG2A 1XBZA 2V3EA 3CPUA 5LNVA 3A7AA 4FLRA 4UQDA 3HGRA 4L1WA 1O1HA 5DX7A 2FLIA 1MI3A 1G4EA 4GYFA 5JIPA 4MNMA 3ABZA 3T2OA 2WM0A 4TVUA 5DT5A 3QZEA 3UR5A 3N19B 4GY7A 5AFDA 3ISIX 1XDIA 3PFRA 3FYOA 4MY1A 3ZZ1A 4R27A 1L2QA 4UMBA 3ZYZA 3BGGA 2CC0A 3ERPA 1FWDC 3EA3A 1LM1A 2WJEA 4UZSA 4A3QA 2WPEA 3KCJA 3AYTA 1J0ZA 1XIJA 3TYCA 4LY8A 4QBXA 3UG4A 5HMSA 1HP5A 3OA3A 3WNNA 4FIRA 4S3EA 3KDOA 3I3EA 3O6AA 4O8AA 2YXGA 4GZIA 4YL2A 3A3XA 5D05A 1J8VA 1E51A 1SW0A 4ZL1A 3EF6A 1R8LA 4L4PA 2RFGA 2PDIA 3UZYA 1I1XA 3PZOA 4HNUA 3FJ6A 1M3UA 3EKLA 4AWSA 2V69A 3BLKA 3BG9A 3D3AA 5C0QA 1RCOB 2BGNE 4LCRA 3T2QA 1VRXA 1TX2A 1Q63A 4H4IA 2E9BA 1JROA 3CH9A 3DFHA 4TU1A 5EFFA 3UG3A 3UQNA 2CLMA 1BLIA 4D8LA 1XIHA 1E1CB 2PDKA 2CIPA 3O1NA 3GVWA 4RNFA 1IGSA 4UQEA 1GOMA 1OFQA 4NAEB 3A47A 4AZBA 4DQWA 3HPXA 3P14A 3WQCA 1QRQA 3A22A 3M5ZA 4O0ZA 3HM7A 4FK9A 4DNHA 1YE6A 3MW7A 4MJZA 3NEVA 4JIEA 4AQLA 4GJ1A 4A8IA 2BZNA 4CEUC 3ATZA 3GVRA 4LUJA 3NR0A 4KGLA 2H90A 3UVIA 2A7RA 3MBFA 4XG1A 4XAFA 1I2PA 3EMCA 5LNRA 4U3AA 5FL1A 3W7CA 4H2CA 4IGMA 4KERA 4PSPA 4CCDA 1HGYA 1A3WA 1J0JA 1KKRA 3W1MA 4F0LA 5D33A 3N9KA 1EF2A 3JZUA 3L68A 1NDYA 2DT3A 5F2LA 3T0AA 2QJNA 4Q8VA 3F5LA 4JN7A 3KFTA 2OSXA 1EPVA 3WK0A 4E4PA 1QOQA 1J5SA 2WJZA 2XISA 1OYCA 4B9ZA 2A2IA 4DUWA 5A6AA 3ITXA 3OEXA 4C6DA 3O16A 3UFYA 2FYMA 2FZ8A 4IJBA 4H8HA 3W87A 2WZMA 2ZRXA 1ZGDA 3GXPA 1FDZA 4WKFA 2BXYA 1OF6A 4PMNA 2Q02A 2CFYA 1LOQA 4H7VA 1VGAA 2Y5EA 2BODX 3MMWA 2EPLX 2WKJA 1EDTA 2ZTKA 2GQAA 1KXQA 1KXHA 3NQFA 1ITXA 2G3IA 4B15A 1MDRA 3HTWA 4MZ8A 1M7XA 3TAKA 5AY7A 1W5MA 3D46A 3A6OA 4Z08A 1TJRA 4ZQCA 3IVSA 4CQ8A 3QSTA 4LPCA 1BXCA 1OFEA 4J40A 3E49A 4GINA 4XTDA 4PA8A 3H4XA 1BVNP 2O7SA 5BROA 1VYRA 1PTAA 2CPUA 2KX9A 3ZVHA 1AW1A 2VUYA 2QT3A 4AC7C 1RR2A 5JCKA 1EA9C 4FXJA 4NI3A 1PO9A 2Y88A 1U5VA 2GYIA 4MTVA 1CLXA 3SRHA 3LMZA 1HJVA 4HOXA 1JCYA 4CD7A 4Q8MA 2HSAA 3ITVA 1N8FA 4EM3A 3AS3A 4LC6A 3KCLA 2Y6ZA 3LBMA 4LH8A 1M04A 3W75A 1F3EA 4DO4A 4S3JA 1YRRA 1ZP4A 1KBBA 4GJIA 3O0FA 2E9MA 4XAYA 3L2IA 1REQB 1Q6GA 2WQDA 3W70A 1V6WA 2RJGA 6PTDA 3CMFA 4H1ZA 1YW1A 3L4WA 3G6MA 1X2HA 3ITCA 4DELA 1N8IA 2WMKA 3DHDA 2XN2A 3DBPA 1KD0A 1PL9A