4IL2A

Crystal structure of d-mannonate dehydratase (rspa) from e. coli cft073 (efi target efi-501585)
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
403
structure length
380
Chain Sequence
KIVKAEVFVTCPGRNFVTLKITTEDGITGLGDATLNGRELSVASYLQDHLCPQLIGRDAHRIEDIWQFFYKGAYWRRGPVTMSAISAVDMALWDIKAKAANMPLYQLLGGASREGVMVYCHTTGHSIDEALDDYARHQELGFKAIRVQCGIPGPEEQLWSTEKYLDFMPKLFDAVRNKFGFDEHLLHDMHHRLTPIEAARFGKSIEDYRMFWMEDPTPAENQECFRLIRQHTVTPIAVGEVFNSIWDCKQLIEEQLIDYIRTTLTHAGGITGMRRIADFASLYQVRTGSHGPSDLSPVCMAAALHFDLWVPNFGVQEYMGYSEQMLEVFPHNWTFDNGYMHPGEKPGLGIEFDEKLAAKYPYEPAYLPVARLEDGTLWNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Starvation sensing protein rspA
publication title Mannonate degradation pathway in E. coli CFT073
rcsb
source organism Escherichia coli
total genus 130
structure length 380
sequence length 403
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2012-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4il2A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4il2A01
1KD0A 2PP1A 2PTWA 3I6EA 4JHMA 3IJQA 2OPJA 2AL1A 3ZLFA 4HNCA 3UCDA 4DN1A 3UXLA 3OW1A 4FP1A 2HXTA 2PGWA 2OKTA 3DG3A 4J1OA 4KPLA 1BQGA 4DXKA 3V4BA 3IJLA 1EBHA 1SJDA 1NELA 3V5FA 3UJEA 2P8BA 1MDLA 1EC7A 3D47A 3BJSA 4EWJA 3TQPA 2XH2A 1WUFA 5IDZA 3QPEA 3UXKA 1SJCA 1SJBA 4GGBA 2QJMA 3V5CA 3R11A 1DTNA 3THUA 3SQSA 1JPDX 2QQ6A 4H1ZA 3KUMA 1KKOA 2OVLA 4DWDA 2AKMA 3GY1A 2GGIA 2PS2A 3DDMA 3V3WA 5FJPA 3ES7A 3TCSA 4HN8A 3TWAA 3DFHA 5J04A 2PP0A 3DG6A 3RCYA 4E4UA 3FYYA 4E8GA 2OFJA 4DX3A 3RR1A 2PTYA 2OG9A 1R6WA 3NO1A 4F4RA 1PDYA 2GGEA 3QLDA 4FI4A 3UGVA 1JDFA 3JVAA 3DEQA 3EKGA 1P48A 3N4FA 1TE6A 3SSZA 5FJOA 4DYEA 3Q4DA 3QN3A 3MZNA 5EU9A 4IZGA 3UCCA 3R0KA 2QDDA 3IJIA 4G7FA 3MKCA 4X2PA 4H2HA 2QJNA 4HNLA 2DW7A 3DFYA 3DIPA 2PMQA 3ZLGA 4IL2A 3H12A 1TZZA 4ROPA 1MNSA 3P0WA 1EBGA 3MUCA 1XPYA 2XH0A 3OZYA 3H7VA 2XGZA 2OQYA 2MNRA 2OZ3A 4A3RA 5FJRA 2CHRA 3T9PA 3SBFA 3PWIA 4MMWA 3FCPA 4HCLA 4GGHA 3NZGA 4GMEA 2AKZA 2NQLA 3NFUA 1JPMA 3GC2A 3U4FA 1KCZA 3JW7A 1W6TA 3DG7A 3UJFA 4GIRA 5FJUA 1NU5A 3H70A 3EEZA 1EC8A 5BOEA 2GL5A 3VCCA 1EC9A 1XS2A 3TW9A 1KKRA 3OP2A 4GYPC 4E6MA 1ECQA 3ZVHA 3CXOA 4K8GA 3FV9A 4IP5A 3VA8A 3Q45A 3VDGA 4MKSA 3NXLA 3JZUA 3CT2A 2PPGA 3D46A 4KT2A 4IT1A 2OO6A 5ENLA 7ENLA 1MDRA 2GGJA 2GGHA 3VFCA 2QDEA 3HPFA 3DGBA 3DERA 2PA6A 1YEYA 3I6TA 3H8AA 3OPSA 3ZVIA 5FJTA 4M6UA 2OLAA 2PCEA 3R25A 4YWSA 4GFIA 2PTXA 3PK7A 3T6CA 1F9CA 4Z17A 4HPNA 3N4EA 3MWCA 3N6JA 3ENLA 6ENLA 2OZTA 3CB3A 2PTZA 4K1WA 4GYPA 3TWBA 2GDQA 3BOXA 2PGEA 3FXGA 2P8CA 3SN1A 3TJIA 2XSXA 2PODA 3MSYA 2P0IA 3SN4A 2I5QA 4J3ZA 1P43A 3SJNA 3GD6A 1PDZA 4HYRA 2RDXA 3B97A 4ZCWA 1TKKA 4HCDA 1ELSA 4IP4A 3P93A 1MUCA 4IL0A 3VC6A 2AL2A 1JCTA 4DHGA 3OZMA 3R1ZA 3ZLHA 2PU0A 2QJJA 2HNEA 1IYXA 2OZ8A 4IHCA 3RO6A 3ES8A 3P3BA 3R10A 2PP3A 3CAWA 4KEMA 3RGTA 2ZADA 3MQTA 3QTPA 1WUEA 1OEPA 2AL2B 3K1GA 3RRAA 3SN0A 3S47A 2DW6A 2XH4A 3QKEA 3UJSA 2PU1A 2ZC8A 1RVKA 2POZA 1R0MA 2FYMA 2P3ZA 3S5SA 3CYJA 3RITA 3STPA 4E5TA 3UJ2A 3U9IA 5BOFA 3R0UA 4KWSA 3VC5A 3MY9A 2QGYA 2HXUA 2XH7A 3IK4A 3PFRA 3FJ4A 4ZA0A 3T8QA 2O56A 1E9IA 2OQHA 1FHVA 3T4WA 1MRAA 2GGGA 2QVHA 3CK5A 4ENLA 1L8PA 2GSHA 3ZVHB 3TTEA 3GO2A 2FKPA 4G8TA 2OX4A 4JN8A 1ONEA 3I4KA 3TJ4A 3BSMA 3UJRA 4GISA 4HCHA 4A6GA 4K2SA 4H19A 3N6HA 2ONEA 2P88A 3TOYA 3PWGA 2PSNA 4JN7A 4E4FA 4MGGA 3FVDA 3OTRA 4M0XA 2MUCA 3VCNA 4A35A 1SJAA 4Z1YA 1FHUA 2HZGA 1BKHA 4H83A 3DESA
chains in the Genus database with same CATH superfamily
4UR8A 4UTKA 1IEQA 1KRAC 2OLHA 3KVJA 2WSRA 3SIMA 5U4NA 4PUUA 2E8YA 5E5CA 3W7OA 2G0WA 3DECA 2A7NA 2OPJA 3QH2A 3VIJA 2R1PA 5FACA 3UWZA 1GESA 2HXTA 2QZRA 4I7VA 3M16A 4EQWA 1ONRA 1TPUA 4BURA 3NSXA 2ZZ4A 4WF7A 2NV1A 1UKTA 1O5RA 3VU2A 3WO8A 1Q6CA 1W1A1 4NP7A 2DIEA 3HQPA 4YS1A 5B80A 5IDZA 4AD3A 4PZVA 3RPTA 1FWDC 1CECA 3ARQA 3KVLA 1ZKQA 5G4WA 2JQXA 3M5VA 2DSWA 4EAMA 3QR3A 2QQ6A 3PB0A 3A4WA 1IGWA 3B0XA 4AD0A 2E5AA 4ERGA 1DYSA 3TNBA 3IJDA 1HX0A 1JAEA 3EWZA 3SFWA 4KGLA 3I3DA 1XPGA 1RLCL 4C6OA 4DBEA 5G4HC 4IQEA 4DIAA 2OFJA 1TTQA 3N2BA 3OVPA 5F2MA 1RY8A 5GVJA 5IOBA 1G67A 1CXLA 3TA6A 3GHSA 2WHJA 1CXEA 3ATZA 5DMNA 3MVIA 3N1AA 2ACRA 5XINA 3WUBA 3UG3A 1D7YA 1OIFA 5IHSA 3KLKA 3UWUA 3WNKA 1REQA 3OHIA 4DQWA 2C1IA 1DQUA 1GREA 1UMLA 2BG5A 2Q02A 3EGJA 1YXCA 4H2HA 3B4UA 1XDIA 2WMIB 4DO5A 3GXIA 1F3WA 1L6WA 1Q6RA 4KS0A 4MUZA 1MXGA 4IL2A 3G6LA 4U3AA 1SM9A 3ARRA 4IGSA 4QG6A 2VGGA 2RUSA 3CIVA 2WCSA 4EPBC 3W7DA 4AXNA 3G1DA 4RE0A 3GVVA 2BFGA 3MP5A 4QAWA 5EB8A 2YCJA 2J7CA 2VZOA 3W3OA 1TREA 3DAQA 3W2JA 2YCLA 4DJDC 2QW5A 4FXRA 4WVXA 2VFDA 2E77A 1A5LC 4GMEA 3SRHA 5DBUA 3N13A 4DNMA 3L4TA 3GR7A 1KCZA 1W6TA 2ZWYA 3WLSA 3E38A 2DVUA 3WLKX 3FJLA 3WDQA 4DBDA 4FX8A 3CMJA 4YTTA 3PJUA 4XZIA 4ORMA 3QRHA 4LNYA 1VPXA 3W87A 2X7WA 2BTMA 4LB3A 3SSJA 4PTNA 2C91A 5FI8A 2DZUA 2JKAA 1P0NA 1JZ7A 4KCWA 3FV9A 3N25A 4PN2A 3VA8A 1J10A 1Q85A 1RR2A 3BLPX 3JZUA 3CGBA 5J5RA 2YXGA 1NFGA 5EBUA 3UA3A 1DKWA 3JU2A 2NT1A 3LXCA 4I9MA 4C6MA 3JRKA 2VGIA 3KCJA 5CXPA 5H8UA 2GGJA 2PI6A 4O4WA 3COTA 4QLJA 5EMUA 4AHOA 2WVUA 1ADOA 1D8WA 3HPFA 1O1HA 3ALGA 3LQGA 1UD6A 1F7BA 1J0IA 1POKA 3A4AA 1KXTA 4KF1A 4HPHA 3CZ8A 1RV8A 4HSNA 1TJRA 1Z69A 2OEKA 2A3HA 2G3MA 2VD9A 4GFIA 1LRQA 2ZUWA 5IXEA 4UC5A 2XJ7A 2V30A 3KW3A 4HPNA 3MWCA 1I6NA 3UWWA 4EPDC 2XVKA 3CUJA 1TA3A 2VENA 3S6DA 4J3SA 2A6NA 3UYCA 1HVXA 3WKZA 4LYRA 3B4YA 3GD4A 3SN1A 2GR3A 1W5QA 3NS1B 1WQ5A 4JEJA 3MSYA 2VL4A 1FKWA 2NVAA 1WZAA 4UTIA 1PX3A 2B7OA 5A94A 3KRSA 1HJUA 2WMJA 4W5UA 4IFRA 3HMCA 1P6WA 3QFEA 4EF9A 4AZ5A 3PZUA 4B5SA 1S46A 3H2AA 2ZXQA 1VHNA 2WKLA 4HNNA 1KCKA 2V5CA 1UUQA 1KFKA 3BJTA 5D30A 3WJSA 4JY8A 1TWSA 3GNRA 3DFTA 1W31A 4JFUA 3JS3A 4MPKA 1LLOA 3N14A 1NP0A 2X1SA 4GCXA 2VR2A 1DTUA 4C6DA 1KCXA 3P0XA 5H91A 2F61A 4UTFA 2WB5A 1XIDA 2X1UA 2CKSA 4CQ8A 1N8IA 2X1TA 5JMUA 4B92A 3BGJA 3BLIA 2E6AA 1X2GA 3QGVA 2ZRZA 5LGXA 1OBAA 1TELA 1FWFC 3K4WA 3ANYA 3RXZA 3S5SA 1UZ1A 4EXQA 3PPHA 4A2SA 2WLZA 3WLTA 1R3TA 3WQCA 1TV5A 2E6DA 2BCPA 2H8ZA 4IPNB 2UWFA 1RK5A 3FKRA 5LA0A 1QCWA 5HR6A 1LL7A 1ZAJA 4Y8FA 1E6SM 3D9XA 3POCA 3DGHA 3SM0A 1OF8A 1ITQA 1I2QA 4H4QA 3M0ZA 4ZOAA 3ZOAA 4F2TA 1FWNA 3GNOA 2B4GA 3LPFA 4RNHA 4FDCB 3BAXA 2XGIA 3N2XA 1NTHA 1F8WA 2BVWA 5CSRA 1RM6B 1PIFA 4UNIA 1R2TA 4UTMA 2W54A 2FZBA 3WNMA 3A9BA 2FHBA 1R3RA 3NR0A 3O05A 3T08A 4O12A 4BV6A 2ZICA 4J2PA 2WSYA 3PWGA 3GG1A 1GETA 1YLVA 3BLLA 1JCXA 3WUEA 4EOUA 1R7OA 3ZS4A 2H9AB 5FIPA 3G18A 3A4JA 3TX9A 1H6VA 5AYBA 3QV9A 3NCOA 3TW7A 3WLOA 1F4AA 1ZALA 3AIQA 4RV3A 2PTWA 1EJWC 5HULA 1UD2A 2CBVA 3NEVA 2Y7FA 4QXIA 4UQEA 3VCRA 1S2CA 3B8IA 1QRQA 3G1RA 3H2EA 3ZZ1A 4DJDD 2BHYA 1J0ZA 1XG3A 1J01A 2GVLA 1TRIA 3TEVA 1TQJA 4O4VA 4ZOEA 4S3FA 3F2DA 2XWDA 1CLKA 3W7GA 3KZPA 4CQBA 2O9OA 4LAKA 4RPQA 3AISA 3O0FA 3UNDA 3UZJA 2RDTA 2H8XA 3WMCA 3SRKA 5FF0A 1XKYA 1YTKA 2ACSA 3THDA 1GRGA 3GZ3A 4MG4A 4KEVA 3BO9A 3ZR4A 4IMCA 3TJLA 1CTNA 2XIJA 1QHOA 5HPCA 3ES7A 1AVAA 4HA0A 4R7WA 3O6YX 3E12A 2WWDA 3DFHA 1TUXA 2A0NA 2HSAA 2EPHA 2FQIA 2C3CA 1WV2A 3GH5A 4TXEA 3W71A 3BOLA 1MUWA 5C8BB 2OG9A 4Q8OA 3E2RA 2W63A 1EPVA 1ZPTA 2ZZ2A 3SW6A 2RHGA 4V1XA 3CXBA 1DIEA 4DYEA 2OCZA 3AUJA 4G6CA 1HFBA 3MZNA 1A5SA 3S5OA 3ZWTA 1DV7A 3BLEA 4RJEA 5DLCA 3TQKA 3CC1A 3I65A 3MKCA 1V02E 4NJGA 1QFEA 5HK4A 1Q6EA 2VGFA 4ICNA 1I1WA 3FGCA 2IS7A 5GNYA 3XIMA 3AWNA 3L5OA 4PTXA 2PMQA 1ODUA 1XD0A 4R85A 3MDUA 1MNSA 2WNNA 3P0WA 2GQ3A 4PULA 4J28A 3W2KA 1WKYA 3EWXA 2WOWA 3LTPA 2QCDB 3UW6A 1D7FA 3H7VA 2WPBA 2NLIA 3LADA 3M46A 1YBQB 3MJMA 1DWFM 3AZSA 5F2IA 1E55A 1XFBA 3OBEA 3GNPA 3FCPA 4IIEA 3BAKA 1ZCOA 3RILA 5D2XA 1FXPA 5DANA 3CASA 4A2RA 3VM5A 3UYIA 1V6VA 4ZQOA 3NJ3A 3VOFA 1DHPA 1TMQA 4NZFA 3VI2A 1EOKA 4HOWA 1DXLA 3KLJA 3WH7A 4WKAA 1JEHA 4XO7A 3DH7A 4A05A 3EEZA 2L5HA 5BOEA 1JROA 3ZO9A 3QM3A 3EWDA 3GU9A 1ECQA 3AIBA 4L9YA 2GUBA 4YN5A 1J18A 4M6QA 1JQXA 4B5VA 3LHYA 4MKSA 3PFMA 7A3HA 4W9TA 4GNKB 3OYZA 2DT3A 4W7VA 2FGBA 4FOUA 1ESWA 3WQ8A 4PTWA 3HGOA 1S2TA 3RCNA 4FMVA 1EJXC 5D9MA 2QDEA 3G1FA 3WEZA 1AK5A 3VXGA 1S39A 1SO6A 2J27A 1YEYA 3BLDA 2QIWA 5BXPA 4A8IA 3QMTA 1PUDA 1KM4A 1EDQA 3R25A 4QX4A 2VEGA 3L4YA 2X30A 3A3XA 2ADAA 4PUMA 2WM1A 4CU7A 3GNDA 3NZQA 1CEOA 3KVKA 4PEEA 3KBMA 3WUGA 1HKWA 1SW7A 1OG6A 3APYA 3LTYA 3LS9A 1P43A 5HQEA 3KTCA 1RBLA 1LG1A 3B97A 1FH8A 1TKKA 3BANA 4L9XA 1IGSA 4C7GA 2YBUA 4B9YA 2ZUNA 1XX1A 2XTKA 2V38A 4MLRA 3VDCA 5AKQA 1VFTA 2HV5A 4X2RA 4S3EA 1AZ1A 3NUKA 2XIOA 3O1NA 4IHCA 1L6YA 1XSJA 4CD7A 3P3BA 4MFEA 1O6IA 5A8OA 1C8XA 4OV9A 2VEFA 3WDRA 2WSPA 4HNOA 2Z1XA 4FEZA 3GR8A 1X96A 1EDGA 4AMAA 5AFDA 3S5YA 3MQTA 1OC7A 1DWHM 4ZTYA 2F2KA 4CNOA 3K1GA 3CH9A 3S6TA 3OC4A 4AVNA 4HKPA 1OHLA 1H5VA 4CD5A 5AYXA 1RPXA 3K8KA 3OGRA 3H4GA 1OADA 1UQYA 3R07C 3PZOA 4IWWA 3HQNA 2NV9A 3CUXA 2FFCA 4MLJA 1US2A 1T6MA 1LQ2A 2O55A 3AXKA 1HW6A 3TR2A 4PRWA 4ZB2A 3L5LA 4OT7A 4MJMA 4MUPA 2ZX5A 4Y90A 1US3A 2WZHA 3F5KA 4YTQA 1FDJA 1SZGA 3GBDA 2Y7EA 2YL5A 4D6HA 4QLKA 4LOCA 3LU2A 1L8PA 1XLMA 2C8NA 4Z2KA 3EMZA 4TR9A 1H4PA 1A4LA 3WNNA 1TWIA 3EB2A 5REQA 3H23A 5JCIA 3OU8A 4D1JA 1NFBA 2HRWA 2Z25A 3W7CA 2W3RA 4TVCA 5ABFB 2FVKA 4D6DA 1HTIA 3PAOA 1QAPA 2YCEA 2F6UA 1EJSC 3A64A 2DDXA 1PXGA 1X97A 4Z2IA 3PZNA 3VGFA 4M8UA 3P5ZA 3HJEA 2ZWZA 4DY1A 4A29A 4Q32A 1Q6GA 1Q7QA 4JTIA 3LV6A 3RO8A 1W3NA 4DAIA 5A8MA 1US0A 4CD8A 2WNWA 1V03A 1XBYA 3ZT7A 4PMUA 5A8GA 4KFPA 4C6CA 1VJIA 4MNJA 2PDXA 1PL9A 1B3OA 3GYEA 4W93A 1JRPA 3C6CA 3B0PA 3W02A 4ACZB 3A4XA 3BC9A 1E1CA 3GRIA 3CNYA 4GVFA 2Y4SA 4YTUA 1XFCA 1W9BM 1E4LA 1Z32X 1XH2A 2VFIA 2DQWA 4KPLA 4TVDA 2YDRA 1BQGA 2DIKA 4FK9A 4RDYA 4K8DA 3W2LA 2DSZA 5E09A 2CW6A 3AHVA 3EB3A 1OQFA 5A69A 3T40A 2VURA 4ILSA 4M6VA 3T2OA 3THAA 4AF0B 3A3HA 2F8QA 1UBSA 1NARA 4QLLA 4JX4A 1SJCA 2PF0A 1XIJA 2G4JA 1M9HA 4LCRA 1K9TA 4XKYA 4L4PA 3QHNA 2HVNA 3W82A 3FS2A 5T91A 2KX9A 3G8EA 3A9IA 4FR1A 3ZR6A 3QBUA 2KAUC 1S2UA 5FJPA 2OYMA 1GW1A 3CUGA 3BK0A 1C3FA 3L4XA 3P82A 3K1DA 4Q4OA 5DXXA 1GVFA 1Q6FA 1K02A 2GQWA 1T96A 1JZ8A 1XHGA 3R94A 5HNNA 4AIUA 1AA1B 3HGJA 4JPGA 1SW3A 4GXPA 2QV5A 3ITGA 1KGUA 3CUIA 1FDYA 5ER0A 1L2QA 4U5IA 1R86A 4XB3A 1V77A 3NOEA 3V75A 1QWKA 3R0KA 4HMCA 2XVPA 4PSRA 5AYIA 2NVCA 2J75A 3W29A 1W37A 1GOIA 3ZSTA 1UWUA 3TAKA 4ROPA 4GYKA 4J4KA 1G5AA 3KEHA 4DJFA 5BRQA 3TROA 1XIGA 1WYIA 1CLVA 2ZUMA 2DZTA 3FA3A 1NQ6A 1IWAA 1JZ4A 1RJQA 4CGTA 4C6PA 2Y5JA 2XH0A 1SZNA 3GVWA 3W7QA 4L65A 1S1PA 4N4QA 4WJXA 2WXDM 2W27A 3CAKA 1AD4A 3H4WA 1UUOA 1YPIA 3NL5A 2BGSA 1ICQA 4G1KA 1H0IA 3GTHA 3WEOA 2ZVIA 4JN6A 3OJGA 4PBGA 3KRBA 2VRJA 1YE6A 1EF2A 5ABTA 5A6JA 4EXAA 3NFUA 1HZYA 2ANUA 2CPUA 3GC2A 1QUMA 1WX0A 3GNNA 3N2MA 3GXFA 2QT3A 1DE5A 1BD0A 1TR1A 3MO7A 5D32A 3QZAA 3GG8A 5FJUA 4REQA 4W89A 3AS1A 3IRDA 3D3AA 2V5BA 3TONA 1UP3A 3UESA 1C7TA 2ISVA 4PB3A 1W3IA 5G5HB 4LEQA 4NXKA 1U1HA 1WE5A 4O13A 1XC4A 4JDRA 2C14A 5A6TC 1MFVA 2QPUA 1W8GA 1YHTA 3PPFA 4NJIA 1EP3A 5K2ZA 3GFYA 2AQWA 5HMEA 5I00A 1GYMA 1UZHA 3G2GA 4EAYA 3M5ZA 4DUXA 4C6KA 2V6OA 1V51A 3LCWA 3C86A 1NSJA 1PWMA 2QCLA 1MDRA 4IMFA 1AODA 3WELA 4HHLA 4XBKA 3WQEA 1SB3B 5FSEC 2BGNE 4JTFA 1B3XA 4GC4A 3WLMA 2WCAA 3O63A 5BWAA 3DX5A 3T4CA 4QE4A 3BW2A 3PC0A 2PA6A 1VENA 4E2OA 3L5MA 3SECA 1DJQA 2OSWA 4P7LA 3PNUA 5FJTA 3M5YA 1DHKA 4HPXA 1I0DA 5EY5A 4PTDA 4QJ1A 4UTTA 3IANA 4YWSA 4OBRA 4EM3A 1V93A 1NFPA 3PK7A 4Z17A 4UZSA 3NSMA 3UG5A 1MQQA 3TKFA 3S1GA 3B40A 3LCFA 2WVVA 4LCQA 3OQ8A 5T9BG 2XSXA 1AW1A 1Q65A 4C5YA 1HJWA 1CXIA 2HE8A 4D9PA 5FEXA 3DYOA 4JQ9A 4S2CA 4NJJA 2V67A 2O7SA 2CZVA 1ZRQA 3UVAA 4TV6A 3TZNA 3EKZA 3WFAA 4JGDA 3SURA 4H8HA 5LA2A 3F2CA 3P7YA 4DXVA 3VIGA 3TSBA 2Z0IA 1TSIA 3O8AA 4QTGA 3GDKA 2XVLA 1OD8A 1OC5A 2Z1WA 2FDMA 1KTBA 4W87A 3SGZA 1W3HA 4KEMA 1TPH1 1JFXA 3QMRA 4LIIA 1QXLA 3BH4A 4KWWA 2BNJA 1DNCA 1Q6QA 1R3QA 3NVDA 1DQWA 5BU9A 3C2FA 3PR2A 1R0MA 2QF7A 2P3ZA 2GR0A 3QFAA 4AWEA 3CYJA 4IIHA 2YLLA 3M43A 2C1HA 3M0XA 4WSHA 1U1JA 3PJTA 1ZJIA 2REQB 4WHBA 3MTWA 2YIHA 2ATMA 3T8QA 5C9XA 3E0LA 2HROA 3PZIA 4GQRA 3PZGA 1BEUA 3W1AA 2X16A 4IG2A 2NXHA 3TYBA 2DUAA 5CPTA 2GSHA 3ZVHB 4LFYA 3AFBA 2JE8A 2FKPA 4MY9A 1VC4A 2INFA 2JALA 2GYIA 3EZ4A 5LYRA 4DRSA 4F9JA 3NO3A 3IIPA 3SDOA 3WMLA 4H4ZA 4BHYA 4AC1X 4GQBA 4H19A 3N6HA 4H4YA 8XIAA 1PAMA 2RABA 3B3DA 1M7XA 4UCGA 1Q8AA 2FPVA 1VJSA 3F5JA 3VZYA 4GY1A 1VFLA 1JGIA 4B2DD 4B4HA 1BGGA 3GXPA 1GEUA 3BOFA 3OTRA 3WLIA 4G56A 4M0XA 4DXXA 5FKYA 5CG7A 4CN6A 5KEZA 4FS9A 3DC8A 3M0MA 3ABQA 3AIUA 4A4AA 1JDCA 1XQKA 1WNOA 3IUIA 3WLNA 3AROA 1UR0A 5C6MA 1HKKA 1N7KA 3NM3A 3R8HA 1WXZA 4H4IA 4IP7A 4DN1A 6XIAA 3RCMA 4DPQA 2XG9A 2QNEA 4BA0A 4RXFA 1F73A 1YNQA 1MQRA 1AL8A 1IWBA 3LSBA 3G0UA 2P8BA 4WIWA 4ERIA 3SJ3A 4O8AA 4WQ6A 4X61A 1IXOA 1LBMA 2CYGA 4WDWA 1BRLA 1QOQA 2NQ9A 5I78A 4W85A 4EANA 3OLEA 4NZCA 1GOMA 1TTIA 2BBFA 3SQSA 1XYAA 5LNRA 1EH9A 3II4A 4ATDA 3A47A 2WQPA 2NQZA 4IPPA 1KFBA 4TV5A 1H50A 1Q4NX 1Y5VA 4U2ZA 3DDMA 3UR2A 3MYOA 1YXDA 3ARWA 3S2JA 4MJZA 2GR2A 3EA2A 5BRPA 4FOKA 4QFUA 5BZAA 1S38A 4FNUA 4NJKA 4DX3A 5CBIA 3UU0A 3B8UA 2BZNA 2PZNA 1VRDA 2YVFA 4F4RA 4NZ1A 1ITXA 3WH8A 3AXMA 3EOOA 3TLQA 4R7JA 1F2JA 1ZY8A 3D5HA 4JYDA 1P1XA 2XWEA 1S3HA 3QN3A 1IE7C 1U5HA 4HZ7A 4IZGA 4ZXLA 5IBXC 3AJ7A 4E8CA 2QDDA 5BXTA 2R8WA 1XBZA 2HVOA 4H41A 4A22A 2EQ8A 6TAAA 4A3QA 4O0QA 5I09A 1RCXB 1V3JA 3GUGA 3EOEA 1NF7A 4K39A 4J56A 2J66A 1KFJA 2F6XA 2VVNA 3GU2A 4A3YA 3EXRA 3N2OA 3H7UA 3GHTA 1E3XA 3TSMA 1JDEA 1IQ8A 4C6QA 1MQPA 3L0NA 5AHIA 5HUPA 5HBFA 1M6JA 5FF4A 2BWGA 4CVWA 5K7JA 3NQVA 3BAWA 1I45A 1XH0A 3PWIA 3C8FA 3M0YA 1GYLA 1X8CA 3NGFA 4GKTA 4D6CA 3E49A 5I3FA 4NYUA 3PTDA 4LQ1A 2QF8A 3W07A 1GYNA 1LWJA 2CHOA 2DT2A 2YOCA 1LUCA 1QATA 3CYVA 1QK2A 2QR6A 2D2HA 4GUIA 2W61A 1IV8A 5LKYA 1E6QM 1UKSA 5CGTA 1I75A 2BXVA 1J0JA 1EC8A 3ELFA 1HQTA 3VNDA 1XS2A 1KKRA 4TX8A 4UFLA 3RX4A 4ZE5A 1T7LA 2X8GA 3EPOA 3M6YA 3TV8A 1GK8A 2AMGA 4J7RA 3SRFA 3M9YA 2D23A 4F66A 3U5YA 1EX5A 2GJPA 4CNNA 5CPNA 1RA5A 4H50A 2A7RA 1O66A 7ENLA 4MKNA 1SQ7A 1KM0A 3TN3A 1C8VA 4TQTA 5DN1A 1C8QA 4H9MA 3DFPA 2H3DA 3OB8A 1UYQA 3STEA 4IQJA 4PH6A 3AXHA 3V16A 4B4FA 3CGDA 1DVJA 3FX4A 3WLQA 3ABXA 2Y5EA 1SW0A 3GHUA 1YADA 1DOSA 3WQGA 2EPOA 4IXHA 1EL3A 4CCZA 4N9EA 2PTXA 4Z0SA 1WZMA 3EXSA 4W8BA 3VD3A 1VAHA 4AQLA 4D6JA 2IMRA 1DJZA 4GJIA 1O1ZA 3FXGA 4HYWA 3UNTA 3CQJA 4WDTA 4KBXA 2JBMA 2I5QA 1XV8A 1SZEA 1AMKA 4MVAA 1BTCA 3EANA 1PDZA 2UBPC 3E0FA 4HYRA 3OG3A 4LV9A 1OFBA 4JTCA 3WF4A 1MUCA 2O9PA 2AL2A 4DHGA 2I56A 3TDFA 3C52A 4GKLA 3A23A 4HJWA 3P74A 4KCTA 3KOWA 4JCLA 4PMJA 2WZIA 1BVWA 3B9JB 1BKSA 3ZM8A 1ME9A 2OB3A 3HM7A 1V6TA 3MI3A 4NAEB 5LIKX 1PTGA 1XM3A 1Y65A 1KXVA 3I7SA 1PIGA 3WG6A 2F2HA 1RY0A 1GRBA 3EWWA 5DXYA 3S1UA 2QCGA 2Y8VA 4B9ZA 1YXYA 4H9YA 3NVYB 4H04A 3SY5A 4IJRA 4PRTA 4CNPA 3IGUA 3FXYA 1D9EA 1WAUA 1QI2A 1UA3A 2X0SA 3KP1A 3EF6A 3R0UA 1QR7A 2GJNA 3TOPA 2YR1A 3H6OA 4H3DA 2HXUA 5DT7A 3NVVB 5JBFA 3PBWA 5G4EA 2WJDA 3FJ4A 2VRKA 3SY1A 1EB3A 1EF3A 3W01A 3W6MA 2G3FA 2OGJA 1GJPA 3B8SA 3KL3A 3LMZA 3PSVA 4CN4A 2W92A 3PWAA 4D6FA 4LUYA 4Q8TA 1ZCCA 1TRDA 5CGMA 4U31A 3BLOA 2GR1A 2ZTKA 4QG9A 4WXYA 3WH5A 1LT8A 3W1RA 3GTXA 1SR0A 3AM9A 3BSHA 2QAPA 1OF6A 4GO9A 4HHPA 4EKJA 3E74A 4NF7A 3WD1A 5JBDA 3T0DA 3B9DA 5E1QA 3AYRA 4Q8QA 1VYRA 1H61A 3W7MA 5CLTA 1MO0A 4GQGA 4US5A 3R13A 6XIMA 1JPKA 4P2VA 1VEMA 1UWRA 4QAIA 1UWSA 2RAGA 3Q67A 2YA2A 2MUCA 1E56A 2Y7DA 3VOCA 4JDBA 4E3VA 1B0IA 2PF8A 2VFEA 5FAJA 4AZ7A 2ZVRA 3U4AA 1CXHA 2WNQA 1KBJA 4XVEA 3W4RA 2QPSA 5M3WA 3R79A 5DO8A 3FY1A 4H7VA 4LAMA 1BHGA 4YCPA 3I6EA 3P8JA 1E6RA 1TIWA 3HPSA 3ZLFA 3HURA 3HU7A 1BXNA 3DZ1A 4FPSA 2XSAA 3LD5A 4AG0A 2QS8A 2BC0A 1HP5A 3BXWA 3VIHA 4PL1A 1PX4A 2GRTA 1F6YA 1NQKA 1LWHA 2DJLA 1PTAA 1SPQA 2DSVA 1A80A 2EHHA 5BXSA 4GWEA 2PFHA 1OYBA 2OQLA 4YHEA 5HWJA 4AWSA 3LTSA 4J3WA 2C7FA 4WRHA 3W6YA 2WP6A 4Q4RA 1JZ2A 2HE5A 3S46A 3NVTA 3SR7A 1VLWA 4DNHA 5BMXA 2VUYA 1JI2A 1BWVA 2INZA 4F0KA 1V02A 2ZZ6A 1I8JA 2D0FA 3NDZA 3O16A 1M53A 1JPDX 1XRTA 1ZXIC 2C15A 1R5YA 4E38A 3KOYA 1A4MA 4I7WA 3ITYA 3W86A 4MFDA 1P0KA 2NX1A 2FH6A 1JYXA 3RCYA 5DEZA 2QPXA 4M56A 4DZHA 3LHZA 1GONA 1K4QA 4WGXA 3O0KA 1WDPA 5LXXA 5GRTA 3GR4A 3ZSSA 1IEIA 3APGA 4PB4A 2X99A 2XIMA 3EOSA 3SCRA 3SSZA 4WSKA 1NOFA 1P0DA 1AL7A 4PTVA 3W23A 4UQ9A 4DO7A 1XISA 4QITA 2C3DA 4ML4A 3AHZA 5H2ZA 4JEQA 3QPZA 4GIYA 3R43A 4Z0JA 3NGJA 1QU4A 3TC7A 1JEZA 4H4SA 1TZZA 4BQ2A 5K3VA 1A0CA 3F5LA 3EPNA 3DK8A 1XI3A 3RIKA 1QPNA 3PAJA 7REQB 2E6YA 3MUCA 4FX7A 3ARTA 5L6UA 2V81A 4OUEA 3URQA 4JQ3A 4HU8A 3M47A 5FJRA 4LBRA 1E9LA 4YLWA 4Y9NA 3TN5A 3AWOA 2ZZ5A 4AD2A 2I9EA 4DWSB 3B0YA 2I1OA 2GVYA 1XCXA 1U1UA 9RUBA 2FIQA 3IIXA 2XU2A 3AALA 4L61A 3NVWB 4E2VA 1RJRA 3FJ6A 1J11A 1BLIA 2Z2AA 5DT5A 3RM4A 1OWQA 3UJFA 4QG8A 4W5ZA 2ZC1A 4LSBA 3RLUA 3PG6A 4H9XA 3UR5A 1DWAM 3N11A 3DK9A 1H3GA 1XRVA 3VCCA 3MWAA 2A3BA 2CLMA 3DI1A 1WXYA 3VOGA 2J62A 4RK8A 5ABGA 2J79A 1QOPA 4UTLA 1MEWA 5M17A 1XLBA 1CT5A 4NEWA 4K8GA 4HK6A 1H1ZA 3W00A 2J25A 1GOKA 2DUXA 1UKPA 3H2OA 4AYGA 3I6RA 3QKZA 3K8MA 1HNYA 3OVRA 2V3AA 2D2JA 3FAWA 2J24A 4PC8A 1L6SA 1H60A 2B7PA 3GAKA 3B8TA 2PDPA 5CZTA 3CAVA 2E68A 1BYCA 1A3XA 2GGHA 2BXYA 5G2IA 2WJFA 4HQVA 1YDOA 1DWJM 1W3JA 3GH4A 3I3EA 3WD0A 4IOTA 1YW1A 4WSJA 3APTA 4GIAA 3LM7A 2DPEA 1M5WA 4R53A 4CCDA 4OECA 2NWRA 3UG8A 3S0CA 2WKGA 2OXNA 2WC4A 4CUCA 1A0EA 3LXAA 2PDLA 2YW4A 4GR1A 2NQHA 2J7BA 3RDKA 3IUHA 3MS8A 3V7PA 3CB3A 2O9TA 4XUYA 3S9ZA 5JQ9A 2VC7A 3NQMA 7CGTA 3WFZA 2BX7A 4AZCB 3QQ0A 5JIWA 3AQUA 4B3KA 1H49A 1Y5XA 1KFWA 4LBSA 5D38A 3E2SA 3QTGA 1N60C 4RZ6A 1QOXA 2YW3A 2V5JA 3PBYA 4O54A 5KSWA 3DHPA 2FMNA 1JVNA 4PUDA 3PUEA 1SZRA 4DZIA 2WZEA 5D02A 4L7ZA 1KLYA 1J4EA 1BFNA 3WK2A 1FWTA 1FWCC 1TPVA 3W7HA 1N8WA 1OT1A 3MHFA 3ES8A 1YQ2A 4HSHA 4PCPA 1DE6A 4O1FA 3S2LA 3WCZA 4EACA 5A8PA 3RGTA 5EL1A 2Q71A 2GVGA 4P5UA 2YFNA 2QMJA 5C5YA 4KRUA 4O57A 3HGSA 4P61A 2RDWA 4Y8EA 1ZB5A 4GI6A 3EA3A 3NNTA 2R1NA 4W8AA 1UR9A 5EYWA 3U2CA 1XDLA 4V28A 1DXIA 1Q45A 1MI3A 1WYGA 1F61A 4UQAA 1B3WA 3M1ZA 2WC7A 4S3AA 1FCUA 1P4CA 1VIWA 3MVTA 2FZMA 2J88A 2O0TA 2Z2BA 2O56A 5I2UA 2OWXA 3POHA 1I2OA 3RHGA 3LI1A 5T8GA 3T4WA 2GVJA 3G8RA 1Q66A 2CBIA 1XICA 2QJHA 5A1AA 2BP1A 5G2WA 1K6WA 3QY8A 8XIMA 2E5BA 1PZ2A 2EPNA 2WHKA 4GLEA 3NQAA 2H9AA 2GVEA 1MZRA 4GHRA 3A12A 3TJ4A 2DV0A 2IPWA 3CM4A 4LVGA 4JAWA 5TQLA 1ZDLA 3KOXA 2RGLA 4D8ZA 2Q8ZA 5T9CE 1OGSA 1E5NA 3K30A 4MGGA 2R9RA 1VEOA 2ZX6A 4IMAA 5AVNA 1YDVA 4DO6A 1ZJHA 1SJAA 3EPMA 2BC1A 4Z1YA 1M7PA 2HCVA 2HZGA 2H90A 1C91A 1W1PA 1AW5A 1CBGA 4CNSA 7PTDA 2E5DA 1DEDA 1M41A 2PP1A 2XZ7A 4RL3A 4QDPA 4U28A 3QEZA 4N42A 4LAUA 4DM1A 4O1DA 2O4MA 4WK9A 3DG3A 3F4VA 4EXBA 1V3IA 1B9BA 3EA1A 3ITTA 3LZ3A 5AOUA 2WLYA 3PF3A 3I3BA 3UJEA 4AHPA 4JTTA 1LRNA 3MU7A 3LX9A 1W91A 4LVAA 3S1VA 4K6AA 2XHYA 1QW7A 1ZSXA 1GQLA 3OIHA 2FMOA 3VNLA 1LTDA 1UKOA 3GS6A 4HMDA 2Z29A 4HIBA 4IUOA 3QVQA 3HB9A 1XP3A 3AIVA 3GG7A 3ANUA 1X1NA 3BSGA 3HN3A 3DHDA 1P6CA 5I3KA 3TWAA 1GRAA 1R8LA 4E4UA 2OELA 5ABEA 1K8ZA 4CLMA 3LLDA 1K8CA 1QNOA 3H24A 1YPXA 3KX6A 4OOUA 1DIDA 4IQLA 4MOZA 2WBAA 3N9RA 4H6KA 3T8LA 3USZA 1V0LA 3MANA 1HF6A 3N12A 1OJTA 4WX2A 3CS2A 3SAZA 4IFKA 5I06A 5CZJA 1ZBKA 3TC3A 3LI0A 3MHUA 1IXQA 3NQGA 4LY4A 2EPLX 1J2BA 4CD6A 1TVLA 4D8LA 4XBJA 3LLFA 2PLJA 7XIMA 3C61A 1PO9A 1H5YA 4G7FA 5DY3A 2R1KA 3TJXA 2GQ9A 2A21A 2Z00A 3ZJ8A 3AYVA 3R0DA 3DFYA 1VFFA 3PJWA 3KZSA 5AZ0A 3F4CA 3GIYA 3O9NA 4C1NB 4MYAA 1FECA 4UB9A 2WSQA 3HBLA 5A6KA 2PWGA 1W54A 2Y88A 5BYWA 2FZNA 3DCPA 4KIEA 2OQYA 2EQ7A 2JGYA 2GUUA 3UZZA 3CHFA 5KMYA 2P3EA 4GX9A 3SADA 1CX9A 1PYFA 4HCLA 3BW3A 1DORA 4CQDA 4C7FA 3Q58A 1F8MA 5FS8A 1HGYA 4U4MA 4DYKA 1AJ0A 3DGZA 4RLIA 3PB2A 3WL0A 2WZTA 4AX7A 1CGYA 2W55A 1UR4A 3CWOX 3H70A 3LEPA 1W1VA 1UIPA 4DELA 1WKDA 3XISA 2GL5A 3OA3A 3TTQA 2WPFA 2WW5A 3OP2A 3WBWA 1GVYA 1OZMA 2J9XA 1P5BA 3LXBA 1QNSA 1ZAIA 4AISA 3Q45A 1ZJAA 3VDGA 1JPIA 3L68A 1B4EA 2B7NA 3UVIA 1MW2A 3NPUA 1VRXA 2CZEA 3W1XA 1W9VA 1E71M 3BPWA 5KVHA 1U22A 4FR6A 1Z6KA 1RJPA 4Z1CA 2Q8LA 1JXKA 4H4WA 3DKJA 2YB4A 1HKJA 5CC3A 1RCQA 1MRQA 4XG1A 3I68A 4H9TA 3VX1A 3T05A 4ORIA 1M6IA 1KM5A 2ACQA 4U2YA 2X09A 3E02A 4O1EA 1TZ7A 1IIHA 4O14A 4AY7A 4C6FA 1ME7A 3TAOA 3W53A 1EP2A 2OZTA 5A6MA 4L1XA 1XR2A 4B5UA 3W6LA 4LC6A 3ONBA 1TPWA 1HP4A 1OX5A 4MAZA 4GZ7A 4D6EA 2Q01A 1NDVA 3S9IA 4GACA 4MDPA 2XFRA 3RJXA 5A6AA 3AMZA 2QIIA 1EGZA 2BY0A 2V3BA 4GVGA 3G0SA 1CW2A 2BB0A 4C65A 5KZ6A 3TYAA 2QJJA 4JXCA 1EBDA 2CLHA 1X98A 1ISXA 1BF2A 3GTNA 1QNVA 3W1TA 2PE4A 1N55A 1FFVC 3CAWA 4D6GA 3W24A 1FTXA 2FZ9A 4EF8A 1ZBCA 3ZWSA 1YTEA 4O10A 1QHZA 4BI6A 4ML9A 1EOMA 4WKHA 3EAUA 4F40A 3SQMA 4OBSA 3CWHA 2DH3A 3E0VA 4GH3A 4HNVA 4IMGA 4MWAB 1QWGA 4W8LA 3NDOA 1B31A 3OEXA 3VM7A 2PDQA 1IZCA 2V3DA 2DJXA 1BTMA 3VUSA 4B5TA 4I9TA 4NU7A 1XXXA 1E9IA 1H63A 2EQDA 2YBTA 2VZTA 1ZL1A 4RPPA 1KXHA 1IZKA 4UIOA 1PX8A 3ETRB 3TZFA 3A3WA 1XUUA 2WV8A 1ONEA 4PMYA 1ZFJA 3VTRA 2OT0A 2WPCA 3LMYA 2UV8G 3KBVA 3ABRA 3O15A 1DXEA 5E0KA 4IIFA 3T0BA 4AIEA 3A7UA 2CXEA 3HFYA 4K36A 3BZJA 3CPRA 2VI0A 5JCKA 4PE8A 1YYAA 1Z9AA 4J5NA 1RUSA 3PZ9A 3VCNA 3THQA 3AC0A 1K7FA 4H83A 4TUFA 5FS9A 1MW1A 1BSIA 3DESA 2VR5A 3DBNA 4FO4A 3WBYA 1X1OA 5J8LA 3DFNA 1KB3A 2TYSA 2NW0A 3SRDA 4HNCA 3UXLA 2DZBA 4ONVA 2ZIDA 2A5HA 3LHVA 5D33A 4ERAA 1ZMDA 4LPCA 3M0KA 3B04A 3NQCA 3ZIZA 2WM0A 1CDGA 4H6RA 1JR1A 3TFCA 3S4TA 3AIWA 4NXSA 1SJDA 5EPDA 4H4XA 1EC7A 2F6KA 1GVQA 1K70A 4UFIA 3AHYA 2DVTA 1WUFA 1F8IA 4JKLA 1FEBA 3TQ0A 1EHNA 3TCEA 4M7TA 2BVTA 5IDIA 1YRRA 3UQNA 2XDFA 3R11A 3PULA 2X7VA 1HO4A 4ZOHB 1KQZA 5CJ5A 1N82A 2E9BA 5I7GA 1KKOA 3C2OA 3ABZA 3CMGA 1T8XA 3MCMA 2R94A 4HP5A 1K7EA 4EMJA 3AHTA 1J8VA 4V27A 3CLWA 5DX7A 2WOQA 4H6QA 2YFOA 3FYYA 4E8GA 4LALA 1ADSA 3VO0A 2VX7A 4G7EB 4GY0A 1VGAA 3U2OA 1R6WA 2GLKA 4E4PA 2X50A 4MSSA 3UGVA 4K7YA 5E9AA 4ZBCA 4P7OA 4Q7BA 5HANA 1TE6A 2XIBA 3ANVA 4UMCA 1L0PA 3AS0A 2BODX 4QS6A 2HJPA 2EEXA 2I7GA 3LBOA 3C3NA 3CPGA 1QMLA 3GK0A 1V0MA 1W9UA 1FIQB 1EUNA 4O1AA 1FWHC 4GUHA 1R30A 2VP8A 2BLEA 2NT0A 1EBGA 9XIMA 2VQTA 1L9WA 4DUWA 4YL2A 3MCNA 4JX6A 1LM1A 4PSPA 5XIAA 3H54A 1V59A 1UD5A 4L80A 2CLEA 1EFZA 4DUVA 1TTJA 2E09A 2XGZA 3PPGA 2O9RA 1AW2A 3BMVA 2ABAA 3A5VA 4LX4A 4E8DA 3BCFA 4C6NA 1NM9A 1H7PA 4MB1A 3S8HA 4PODA 1ZENA 2PWFA 4HOXA 2R24A 1YDNA 4Y9MA 1QJWA 5D2TA 5M2FX 5IBXA 3KDOA 3NQ6A 4S1FA 4H8VA 4JS3A 3QW4B 1E0TA 1ICSA 1OCNA 1LWIA 4ADUA 3W7KA 2GWNA 3BLKA 2I14A 3LGEA 1E6ZA 4AVFA 3NYDA 5CBBA 2TODA 1ZUAX 2EF9A 2DZPA 3JUGA 4U10A 2F9RA 1X2HA 1GVOA 4RW5A 3ZYZA 3TVAA 2XN2A 3BGAA 2BVDA 4WUIA 4WLCA 4S3BA 1GJUA 1ZU8A 9XIAA 1VPQA 2FPTA 4RZ4A 2WVTA 1VCFA 1ZK7A 1TYGA 2F5ZA 1JAKA 4MB4A 3VMOA 2ZCGA 3OZPA 2Y62A 1V6UA 3LCLA 3ZT5A 2PWUA 3SGUA 3CGTA 1AH0A 2E4TA 3KM8A 3L12A 1N2VA 3OYXA 5CAKA 1E3ZA 2HQAA 3KL0A 4PEKA 5D2VA 5L9FA 1TWZA 1QVBA 4V2XA 3OVQA 2CHNA 4XZNX 6CGTA 1P1MA 2GDQA 3IK2A 1H7OA 3WF3A 1B1YA 1QPRA 4M6PA 1S1RA 1KR1A 3MMDA 3A6OA 4GNJA 1MXDA 4CCEA 3MUZ1 3AO0A 2ZXAA 2ESCA 1G4PA 2J7FA 3LQLA 1QT1A 4OOZA 4IL0A 3VC6A 2EXOA 4DYJA 3IJ9A 4WJ8A 4GY7A 3AUOA 2XN1A 4Q6JA 4LYKA 1LQ0A 3WYZA 4ZO7A 1IR2A 2WOIA 4G9PA 1WZKA 4EX4A 2JF6A 3HQOA 1TCDA 1P6BA 1UP0A 4F8XA 4WD0A 4QS5A 3BWWA 4FIQA 3H2FA 1PKMA 3VGHA 2NXIA 4OZOA 3HPZA 1IXPA 4JYEA 1I1XA 1LG2A 4JQ4A 4LYPA 1BWCA 1GSNA 2FGLA 3GRTA 3FYPA 1QI4A 3IPWA 1A3HA 3NRZB 3PFRA 3MJYA 1TPEA 1GGOA 3JR2A 4ZA0A 2ON3A 4DAFA 2WJZA 4Q7NA 3W2MA 2EKGA 3FJNA 5F4XA 3DHFA 3BAIA 4HZ8A 4M1RA 4MWAE 4ZSUA 5F1VA 1NOWA 1Z41A 3W83A 3I4KA 4PMRA 3BSMA 3AS3A 3U5UA 1GQJA 3ITOA 4JFTA 3EDJA 3H2CA 2GOUA 1ZMCA 1FCBA 1JG9A 1S5MA 1H2IA 3GKAA 4TX9A 1XHCA 3HTWA 3LRKA 3NG3A 4HA4A 1PYMA 4DPPA 4CN1A 4R27A 3FA4A 3VKCA 4OTKA 3PUDA 2Z2UA 4I5RA 3GUWA 4W86A 3TP4A 3L23A 5C71A 3KWXA 3V35A 3W7RA 3VKAA 4FOJA 3OHMB 2HS6A 3TTOA 2OR2A 3IUDA 3URBA 5CG0A 4Y2WA 2VX5A 1UHVA 4YIWA 3V4BA 5I6SA 4UTJA 1BQCA 1JPHA 3GHRA 2NQJA 3TQPA 1WDSA 4DF2A 4KGJA 4GJ1A 3BE7A 4XAPA 1EIXA 1BYAA 3AJXA 1JZ5A 4LH8A 3PUOA 3V1PA 1ITCA 5HA7A 1GOWA 5HNUA 1O7AA 4PMXA 2V6AA 1HL8A 4UMBA 3KUMA 1N5XA 3HV9A 3USBA 4DWDA 2P50A 1MUMA 3VKKA 1W3LA 4LUSB 5CGQA 2ZRXA 1J9YA 2B7QA 3D3FA 2TPRA 5U25A 1J6PA 1RVGA 3UR8A 2C0AA 5HAOA 5J04A 1KRBC 4TTUA 4G5DA 3NTYA 4UBPC 3U48A 3BG5A 2A6LA 1TYTA 3CHDA 1X6UA 1K77A 1UWAA 4PCFA 3GQYA 3FEQA 4I9JA 1I0BA 3UPMA 4H2CA 4UFMA 1TCMA 3JVAA 1GV4A 3EKGA 1S7MA 1JJKA 3ARYA 3SUUA 5FJOA 1UIOA 1SO4A 2XN0A 1PSCA 1XWYA 3NPWA 3TFXA 2TSYA 1QASA 1E9ZB 3VKDA 4MKVA 4EP8C 3NPVA 4MHBA 3ITXA 1FCQA 4RE4A 2F84A 3WBEA 4M52A 3L2IA 3GC5A 1SR9A 4UFJA 4M19A 1GKQA 2G41A 3DHUA 3FW6A 3NL6A 3DOPA 3CV7A 1XYCA 3VMPA 5D09A 3N2TA 2G3JA 2AAAA 2X1IA 3N34A 1AQ0A 2HBXA 4QM1A 1HG3A 1R2RA 4JIQA 1BGAA 5CPSA 2YB1A 2HPMA 2R6OA 3AXIA 4ZQMA 3F03K 1MVYA 1X6LA 1E4NA 3H7RA 4DVOA 3VNIA 4ATLA 2XFFA 2IXVA 2GK1B 1TTPA 3DG7A 2E3ZA 1XYMA 5F7UA 4DJEC 1HJSA 2D0HA 4DZAA 4NAFA 2J6XA 1KFCA 3LGGA 4A8RA 4BF7A 1OFRA 3M0LA 3VMNA 3LG3A 2J8GA 5C9UA 1Q8JA 1E40A 3WZ0E 5H8MA 1KBLA 4NVTA 2XUCA 2GFTA 1E70M 4QEHA 2VZVA 4PMNA 1TZ9A 3B9OA 3TYZA 5AC6A 4GZIA 1V5XA 3BUVA 3OIXA 3GXDA 2J6VA 5LGZA 4XKYB 1MXSA 3H21A 3EYPA 6ALDA 3MMWA 3LXDA 4K7ZA 2PWVA 1GQNA 3UETA 5LSMA 1EA0A 1G9HA 2AMXA 2OMAA 4EQRA 3A22A 3TN4A 5CPLA 1AOGA 3MI2A 1GKRA 3IEBA 1KWGA 3B0VC 5HNRA 1PHWA 1EA9C 3KTXA 3O07A 3TWBA 3WDJA 2PTDA 1CB2A 1IF2A 1PE1A 2ZUSA 1AZ2A 2QYGA 4H4RA 2E9MA 6TIMA 1NEYA 1SSGA 5K9XA 3SN4A 4NAEA 4JL2A 3T0AA 1VQZA 5D4YA 3WMBA 5E0FA 4YXGA 2OYLA 4IP4A 4WY0A 3MUAA 5JU6A 1ONWA 5I3DA 1ITUA 4PFMA 1Z7AA 2BOGX 3VNKA 2JF7A 4K1GA 3CTLA 4BFAA 1PB0A 3ITLA 4S38A 3CL6A 1PVNA 4FNTA 3VPLA 3AMLA 3L9CA 1GXFA 3ERPA 1WOBA 3OOQA 2PDYA 4ROQA 4JTEA 4MZYA 1R38A 5BCAA 3GTIA 3TU9A 4J57A 4D1IA 1KBIA 3GRSA 5D2WA 4GC3A 3LA4A 4N6FA 3S47A 3M0VA 5DF0A 3V0TA 3EDEA 2IKHA 3CO8A 2ZUUA 4HD5A 3L0GA 1KNWA 5HJYA 3C2EA 4J2MA 5AHFA 1BAGA 2Q09A 2A3AA 5RUBA 4INFA 2FTPA 4AZHA 1B30A 1GZGA 1NVMA 3W1PA 2Y8UA 4REQB 4RDVA 4WOQA 1RBAA 5DFAA 5K4ZA 4JQAA 1C8YA 5CSYA 3A7RA 3IS4A 1MRAA 2PDNA 1J93A 1UPMB 4M51A 1TV2A 3W28A 3DYPA 4W4QA 3GO2A 4IIDA 1V3HA 1E5JA 1HKMA 3MPGA 5KINA 4HVXA 4GCAA 2WWCA 5B7YA 3MSRA 4H9ZA 4H6EA 3QY6A 3KCLA 3DFQA 2J13A 4L4MA 1LLWA 1VIZA 3DN5A 1DJHA 1BWLA 5AC4A 4GX8A 2WK2A 4H8NA 1T41A 1OT2A 1PTDA 4GH1A 4V15A 1D3GA 3TR9A 1DJIA 3GB6A 4MNLA 3E9AA 1FKXA 2QULA 4GI9A 3VD5A 3NPXA 4CEUC 4AD1A 1NDWA 3T42A 3DK4A 1KXQA 3SCVA 5D9PA 3UERA 4AX6A 3IJQA 1RD5A 3GDBA 1UKQA 1UWQA 2CFFA 2Q3RA 1O5XA 3ONCA 4Q8VA 4GABA 5KZDA 1WBJA 4WGHA 1A5AA 4GA8A 4H00A 4Z08A 4JFVA 1P0BA 1NELA 1UWIA 3EOLA 2YA0A 4Z1DA 3VIMA 4BQ4A 5EMMA 1Q63A 3AU6A 2WPEA 2GSJA 1X6NA 1T0OA 2DIJA 1X39A 3KWSA 1JCMP 3NZ1A 1E1FA 4FNQA 3C0QA 4UUIA 5DQPA 3THCA 3W76A 5CPOA 2ATSA 3NZPA 3PTKA 2W6RA 4L1GA 4NZ5A 1A5CA 4UQDA 3SCOA 4H1ZA 1PBGA 1AG1O 3R5EA 4EQXA 4TIMA 2I5IA 1M68A 3P5YA 1GVSA 4LANA 4US5D 3VK5A 3MKKA 1DJYA 1NAL1 4XUGA 1LLZA 1HUVA 4PCSA 1ZHAA 4GK8A 2V68A 1J6OA 2IUZA 3H55A 1E51A 2V3EA 1LT7A 1XLGA 1I2NA 1MEIA 1DJNA 2ZOXA 4YJ5A 4NJHA 1FFUC 4HA1A 4WKFA 3W1QA 3FK4A 4FI4A 4XQ6A 4M24A 3UWEA 2WCGA 1YQZA 3U7VA 3VOIA 3TNOA 4C6JA 1UQZA 1EZ2A 4FXFA 4HGXA 4ZXOA 2A7PA 1FWJC 2W67A 2G50A 3CQHA 2WOVA 4U33A 4ICMA 4LVFA 4K7VA 4QR6A 3RF9A 3W27A 1G0CA 1P7TB 3GIPA 4NASA 2NX3A 3M4HA 1OABA 2A79A 3DIPA 4EPKA 5BWFA 3ZLGA 4DWSA 2PC4A 3G1SA 1UCWA 4M1BA 3URNA 1GTEA 3VYLA 1S5NA 1XIFA 3WLJA 1KGXA 2D22A 1I2PA 3WFLA 3T0CA 1UOKA 1PWLA 1F3EA 4JIHA 1U5JA 2CLFA 3PZQA 2HEJA 3ME3A 7TAAA 1C29A 1FWBC 4X3ZA 4LUTB 1EIBA 3PG9A 3T9PA 2IXUA 3QSRA 4MNKA 3UZ5A 3G3DA 2BGQA 2QCMA 1IR1A 1G94A 3PG8A 3RPMA 3SQPA 2YDQA 1B4KA 3VIPA 1OVDA 4QQUA 4A8LA 1RLDA 1XRSA 2NQLA 3UXDA 1N8FA 1WDRA 5C9ZA 3T2QA 1MZHA 1UH2A 1Q1WA 5F2GA 1XGDA 1RBOB 2W0UA 2QLYA 2KZHA 5E6ZA 5A8NA 1NHQA 2PGRA 3EX2A 5DCBA 4MZ1A 4Q8WA 3GDLA 1RXOB 1OFEA 3ZFHA 1TPDA 1GEQA 3RJYA 4GRTA 1RQEA 2PDHA 3VE9A 3F1QA 1DPMA 2VWSA 1KBBA 2HBVA 1BF6A 3QC0A 2CIPA 3WF2A 1IXNA 3RNDA 1JQVA 1W5OA 4N9BA 2ALDA 1H7RA 1X1ZA 1OG0A 2PEVA 3TYEA 3VD9A 4PUWA 3PJXA 1F76A 1C7SA 1GPFA 2Z24A 2Z26A 2QDHA 2X41A 1OM0A 3CIWA 4QHRA 1MSSA 1VS1A 3RX2A 2J78A 3UR7A 3GH7A 4S39A 1EQCA 3ZVIA 3CTTA 2WPGA 1OK4A 4WOZA 3DC0A 3URHA 1HVQA 4LCSA 2Y7GA 3OGVA 1F9CA 1CLXA 3FIGA 2H6RA 3N6JA 2OTDA 5GJPA 4BF5A 3W1MA 4C5ZA 2QUUA 2ZYFA 5IFPA 1GERA 1WXJA 1VLIA 5CLWA 2PDUA 5EA9A 2QUTA 4X0VA 2V2DA 1M04A 3PZVA 4PR4A 3LERA 4GZEA 1TO3A 4HCDA 2X40A 3WNLA 5DRCA 4QNWA 3RR4A 1XJBA 4I6KA 1OK6A 1OYAA 2BOFX 1Z44A 3R1ZA 3W85A 1H09A 2FTWA 5AVHA 3NOYA 1IYXA 2OEJA 3E2VA 4BI5A 2WNZA 3NDYA 5I77A 1F74A 3RO6A 1E6NA 3B0UX 2RJGA 3VDHA 1FQ0A 2ZRUA 3EDFA 3ARPA 5A2CA 1ISZA 1TMHA 1AQHA 4H9VA 3CT7A 2Q3OA 3MUXA 5AHLA 2PGFA 4ES4A 2P10A 4ACYA 3MSDA 4MYXA 4I7UA 5C0QA 1LRTA 4IPLA 1UR8A 2BHZA 2E28A 1LUCB 4Q7IA 2C13A 4AXKA 4I3GA 2C16A 1EYWA 1FWWA 1ZTVA 2IKGA 4IICA 2QCNA 2XH7A 3MP4A 5G1MA 5K4XA 2TRSA 4OJYA 4JHZA 1K1DA 2Z6IA 1TX0A 4CNUA 4KRTA 1XD1A 1FHVA 3CWNA 1RALA 3LRMA 4ENLA 1QNQA 4IF2A 3WF0A 3C2VA 1TWWA 4XZ9A 5FEZA 1TVPA 1J5SA 3CJPA 1YTDA 1W9PA 4P8UA 1ADDA 1XBXA 4QISA 4F0MA 3WJWA 4NI8A 1JF6A 4DNAA 2YQUA 2J8TA 2DUZA 3G1VA 4NY2A 2PDGA 5E6YA 5A95A 1OX4A 2DZAA 1LQAA 2QEZA 3DU0A 2F38A 1B54A 4AD5A 2FLIA 1R3WA 5GQBA 2BOEX 1FHUA 3M07A 4CVUA 1G4TA 1QK0A 4I9AA 4QQ3A 3GFZA 3QV7A 2DORA 3M0IA 3M7WA 3IARA 2FGZA 4JHMA 4KEUA 3WLLA 1BPLB 1D7KA 2QGHA 4B90A 3QR0A 2PGWA 3NQDA 2CWNA 1U83A 1FFRA 1HJQA 2F7FA 2FFIA 2ZZ1A 1G7VA 4XAGA 2X8CA 6PTDA 2BMBA 1MDLA 2Y2WA 4ZODA 1ZZMA 2J74A 3OBAA 1JXJA 4RZ5A 4WJEA 3REQA 2DSKA 4L4OA 1D3CA 2CZDA 4GXWA 1SYTA 5A6BA 4BWLA 1A53A 3NO5A 2YVGA 2YZ5A 2PBOA 4PCNA 6REQA 4UWMA 2CEQA 4R33A 2J3NA 1VDVA 2QAEA 1TE1A 3QHMA 2AKMA 2VMFA 3OGSA 4L6DA 5LNSA 1YDYA 2VT0A 3V3WA 4GIEA 4HZ6A 3E5BA 4B3LA 4QCFA 4AEFA 1XG4A 3BZGA 1WKEA 2PP0A 4AIOA 4JTAA 4Z1BA 1E1EA 4LT9A 3F4DA 4GBUA 3VIFA 1XYFA 4G2DA 1NHRA 1OCQA 3SZ8A 1PDYA 2W91A 3U3HA 5D8ZA 5AC7A 1JDFA 4ZE4A 5C2GA 2MANA 4S3DA 1GCYA 1N61C 4FXJA 3N15A 3G0XA 2WO5A 4IGNA 3R4IA 3KAOA 1EP1A 4JTSA 1YPFA 3SUWA 1RA0A 4KERA 2Z1BA 1I60A 1L2UA 4LAZA 4XD3A 1EQPA 4O1BA 2VC6A 4K37A 3YPIA 1GRFA 4UNLA 4GQ0A 1PKNA 3R8GA 1SFTA 1TVNA 1W5MA 4GYJA 5F4SA 2V5KA 2WMGA 4AUBA 5HPOA 3SCQA 2AGTA 4Z2GA 2W4XA 3LBMA 3S1WA 5TNVA 3MDWA 3NAVA 4UTWC 1B9ZA 1SZFA 4ZL1A 5I5RA 3LCGA 1T99A 3UXIA 4O19A 3AIEA 4NZJA 3BMXA 1Q7MA 1DJWA 1SO3A 3UF9A 1ISYA 5D9NA 3P6LA 2VZSA 3BMWA 1QO5A 4AIBA 1WPCA 1W1ZA 1C9DA 1ENUA 1OFOA 3KFTA 3PS7A 5JVLA 3O0HA 5FD0A 4R3UA 2V63A 3D0CA 3RU8X 2CBJA 1NDYA 2ZX9A 3NA8A 5MHBA 5FF3A 1DXFA 2Q8XA 3LV5A 3R7MA 5FESA 1V8EA 2YA1A 3IC9A 1JCYA 3B8VA 2QAFA 2RFGA 5CBJA 5FJIA 1IZJA 3CXOA 3BV4A 5EGRA 3NEHA 2X05A 1PKLA 1RP8A 3V0SA 4POCA 3NL2A 4HNUA 2BASA 4XD5A 2XM2A 2D1ZA 3KTSA 4QROA 3QMSA 4DBWA 1GQIA 5ENLA 3W26A 1KLZA 4PMQA 1I9CB 4LTSA 3T1GA 3OG2A 4JTGA 3P61A 1BVNP 1UR2A 2B0MA 2EO7A 4GI8A 1X8FA 2E5CA 4P7RA 4CQAA 4JTJA 1Q2RA 4GO8A 4PMOA 4JD4A 3LNPA 1W56A 5C2XA 1M7JA 1QBBA 3T81A 2R1LA 1CWYA 1EEPA 2YXOA 4HT3A 4YVXA 4IUGA 4FB7A 1NHSA 3RU6A 5G2HA 3H2MA 2W9MA 2QDGA 4D72A 1S5WA 4MB3A 5TIMA 2GUYA 2WSKA 3F4WA 1LVLA 3G1XA 3WN6A 3PN8A 1QO2A 3DH9A 1TV8A 3CZKA 1CCWB 1OD0A 5C55A 1V7AA 1V3MA 4Q22A 1S2VA 2HK0A 4KCUA 4HMEA 3HV8A 4H7ZA 4JFSA 2QMKA 2W5FA 4QNEA 5I3GA 2XPKA 2Z6JA 3KLLA 3NYZA 3PBMA 4MWAA 3V18A 1M1BA 4E2BA 2WBGA 1CZ1A 3C3UA 3EOUA 3B06A 3N9KA 5HATA 1WDDA 1WUEA 1OEPA 1LCOA 1GNXA 1AFSA 1J0YA 1T40A 2J47A 4WXZA 2ZC8A 3Q94A 4BEUA 8TIMA 2PWHA 3W72A 3KE0A 1LROA 2FHCA 2JGQA 2CLPA 5EBKA 1VH7A 4L56A 4KCVA 4H8UA 3U8GA 2UY5A 1YE4A 5K9CA 2CETA 3M0JA 4RNFA 1ZP4A 3SB0A 1V08A 3SCWA 7ODCA 1ZQ5A 4Z42C 4UTUA 4QCEA 4R7OA 2OSYA 3E2QA 5AYYA 4OQVA 5FAGA 3LGDA 4YMZA 5IFTA 3TYUA 2HTMA 2C71A 1EJVC 3HPXA 3TTEA 3DI0A 3LZ5A 2G97A 5HNTA 2PRLA 4FA3A 2VO5A 1D8CA 1G01A 5GNXA 5AYZA 3SY8A 4GISA 3FVMA 4AFYA 2V9DA 2WMHA 1JYVA 4OWGA 4XD4A 1A50A 4K2SA 1UB3A 4BF9A 2YSWA 2O4QA 4UXDA 3HG3A 1MEHA 4B91A 2NSXA 2X8RA 5MKGA 4KRZA 1MW0A 1KCLA 4LVBA 3RLHA 1TV4A 1RPKA 2CFYA 3EMQA 5M5DA 4YTRA 1ODZA 4PFHA 4XAYA 1Q1RA 4JNMA 2Z1VA 3LN3A 3OBKA 1W32A 1VFMA 1H1NA 1ZNNA 2POTA 5CPQA 1UP2A 4AWUA 3SCNA 4RR4A 4J27A 1OCJA 2GDVA 1WDQA 3S1XA 2ZRYA 4O28A 3C0LA 4QSHA 2DFAA 2A3CA 2R9ZA 1VBJA 4ZEPA 3QC3A 1TB3A 5CC6A 3S5ZA 1EBHA 3BV7A 3I7QA 3QPYA 4JY9A 4Y6GA 4E0CA 2YX0A 1E4IA 5JRBA 3W81A 4M5PA 4NNCA 3D47A 3V0UA 5HR7A 2NX9A 4JHOA 2WANA 1F6PA 4ZVJA 5AB3A 1E15A 3IJ8A 2OYKA 1SJBA 4GGBA 5G5GB 1W5NA 4G7EA 3SCPA 3V5CA 4C7DA 2VDIA 4FX6M 1E43A 3IV3A 3RM9A 1FCVA 2OVLA 1STZA 2GGIA 2PS2A 3W1NA 4FLQA 3L0KA 3TCSA 4LGXA 5H8PA 1P0EA 3AYTA 5M1TA 3W88A 2YKKA 3CUZA 1J0KA 4I8DA 1EUAA 1GVRA 1Q7ZA 2I57A 3U2EA 2V2HA 3HF3A 4Q8PA 3IV8A 1P48A 3IIOA 2CZ5A 3AZTA 4TU1A 5A8QA 3B03A 5BROA 1GRHA 3GVQA 1B2YA 1GPWA 2ISDA 5EU9A 3TN6A 2ZA3A 4Q3MA 4IXXA 1G7UA 1JUBA 3CB8A 4I5XA 3EUB3 1XIIA 2OKOA 3LNMA 1FA2A 4PRRA 4N7QA 3C0JA 2DU2A 2R82A 3B9AA 1RP9A 3IVUA 4B5WA 2UZ9A 3NWRA 1ZBWA 3BQ6A 1WA3A 4GINA 2NUWA 1W9DM 2HWGA 4KPRA 1MW3A 3OZYA 4W7WA 4BQ5A 4NQ1A 2VD8A 3LB8A 3VINA 3V36A 2ZDSA 3UWVA 4JTHA 3U6WA 5FEWA 4J40A 4LS0A 1R9YA 1VCGA 3TYCA 3BARA 4ADWA 4HN4A 5LIUX 1F3TA 2AKZA 5CEWA 5AY7A 5LNWA 4Y7EA 3WH6A 3HG4A 3QOKA 1OJXA 4FXSA 1GUVA 2DY3A 1XKJA 3W25A 1RK6A 1IWPA 2FH8A 1VHCA 3MV01 4IFOA 4MTVA 4ZO6A 2J4GA 3MUY1 2CLKA 2UY4A 3IVSA 2QCHA 2PZ0A 3WNOA 1G4SA 4MJ4A 3ARZA 3LPGA 3W7EA 5LXEA 3TQVA 5KZMA 1H7XA 3NZRA 1B5TA 1S2WA 4MNMA 1NF0A 5FL0A 4LA1A 1T5AA 4UTHA 2QVNA 1N5WC 3T7VA 1NH6A 3VDBA 5AC5A 3WLRA 3AZRA 3DGRA 3GM8A 3O06A 3CQIA 1XLHA 3N2CA 3PUGA 1U5VA 5LIYX 3TK7A 1C9WA 5D03A 1UOZA 3PHAA 2JIWA 1C93A 3VKJA 1OINA 1XCFA 1VFSA 5FL1A 4M6UA 4DJEA 2QUMA 2G5WA 2EQ6A 3CL8A 3LRLA 4YYFA 4YPJA 4A3HA 4LNCA 3BVJA 3WK0A 4HA3A 3WQPA 2ZRWA 1DBTA 1TPB1 2V3GA 2Y24A 1K9FA 1FRBA 3L2LA 1V0KA 3AYSA 3UPWA 2V82A 1O94A 2DGAA 4IGHA 4IFKB 5HOSA 4NRRA 2HVMA 1JDAA 4TVYA 5TAOA 1OFPA 1ZS2A 2DT0A 2WYSA 3SJNA 2FPYA 4LV4A 5GNZA 2DZSA 4JIIX 4TMCA 3G1YA 3QFBA 4W88A 5EMKA 2OOGA 2ZZ0A 3Q37A 3BURA 4K38A 3OZMA 1VZWA 4J3VA 4Y9AA 3K5XA 4FNPA 1M01A 9CGTA 2OZ8A 2PC8A 4O8RA 3I10A 4JTRA 2XSBA 4GUFA 4MAVA 1W5PA 3QV8A 4JNZA 1R87A 4UNKA 3R10A 1N63C 3BAYA 3SIZA 4CQCA 1XDMA 2WHMA 4OE7A 2ZA2A 4B3ZA 1UD8A 2QUNA 3WLPA 3UZYA 1UJPA 3HRDC 4DEFA 2PU1A 3FLUA 2VTFA 2POZA 5D2YA 2Q6ZA 3KRZA 1H1YA 4FLOA 3BW4A 1K6AA 4QIUA 4IGMA 1MMFA 4D2JA 1GTHA 3VC5A 5GPRA 2QGYA 1TIMA 4YVVA 4I8YA 1ZX9A 3ABOA 1NP2A 1KA9F 4HSOA 2QCCA 1FHDA 1K4GA 4UQCA 1E6XM 5JIPA 2XM1A 2CLLA 3IIZA 4JQ1A 2QJGA 2XISA 2JK2A 1TJ0A 4F0HA 5KETA 2EPKX 3GDRA 4ZB0A 3QY7A 5CZ0A 2WMIA 4JN8A 5FA5A 3MMTA 1GG0A 3H53A 1MFUA 3F7JA 3C56A 4W7UA 5I23A 4K68A 2VHLA 2JEPA 1K4HA 1R7AA 4JNYA 1B3YA 4DUOA 4M82A 4Q4QA 2PSNA 4E4FA 1KM6A 1MWOA 2D0GA 4HPGA 4EPEC 3PP7A 1EX1A 2AOSA 1XRFA 4V1YA 1GKPA 4GQQA 4AH7A 4A35A 1VBGA 2TAAA 2C6QA 3ID7A 2A3LA 2WMFA 3LK6A 3ATYA 1ISVA 1J2WA 3WUFA 1VR6A 2YL9A 4WDXA 1EGVA 4MIMA 1HO1A 2AL1A 2PWEA 3UCDA 4S3KA 1W1TA 1QPQA 4FP1A 3GYCA 1UH3A 4Q8NA 4WCJA 1QI0A 1JIBA 3RN6A 5EMYA 4LBUA 3VNYA 3EX6A 3WNPA 4KWOA 1UMYA 4LUSA 4AEEA 3STCA 3BJSA 5I24A 3G1AA 2HK1A 1Z89A 1HL9A 1U2YA 5DCEA 1H11A 1XLKA 2OWWA 3VX0A 3W75A 3NQ8A 1KR0A 5HJXA 7TIMA 2QJMA 1CENA 3MUIA 3R58A 1DWGM 1O5KA 3CMFA 4RE2A 1DTNA 4H4VA 1VCVA 3VGDA 5ECUA 1HGWA 1KTCA 4YWIA 2DZVA 2WVSA 1J12A 1XLFA 3ALFA 3URAA 1PEZA 2WC3A 4C1KA 4X22A 2GJXB 1UPPA 1BVZA 1QHPA 4F0RA 2NLYA 2WP5A 1VF8A 5HWMA 3FYOA 3WQ4A 3AU2A 4ZQRA 4XV0A 4IMDA 3E6EA 1DWIM 4TVUA 3RR1A 1XCWA 1X38A 4P8WA 4Q4KA 4O0KA 3WQWA 1LPFA 4US6A 1WP6A 2GGEA 5JBEA 5JCNA 3GXTA 2FTYA 3NQFA 5JH2A 2EGZA 2R14A 2VOTA 2QXWA 4B5NA 1TJ2A 3PBVA 5DMYA 2YBVA 3NURA 4L4LA 2JEQA 1EWDA 2PDJA 4XIAA 3TMQA 3LCXA 3GFXA 1V97A 4AZGA 2PB1A 2CWXA 1YKWA 1H62A 4MZ8A 2C1GA 3VD7A 5FMHA 3VNJA 1EXBA 2J9ZA 1BYBA 4J9JA 2DW7A 2ZE3A 4JIRA 3LCIA 2WZMA 3RNMA 4LXFA 1J5TA 1FDZA 3WF1A 3I7RA 1Y8BA 3RFAA 4ZQNA 2X2GA 2GK1A 4F0SA 1XPYA 1MNZA 1THFD 1XLIA 4K8EA 3AN1A 3M6DA 1UBPC 5KITA 2GSEA 3BL3A 3V5OA 3EKLA 1AJ2A 4CKQA 4HBKA 3G1HA 1K8YA 3XINA 3KRUA 2YDAA 2PBGA 4RNIA 3KHDA 2VFGA 3KBWA 3UG4A 3QOMA 4JX5A 1FWRA 1KM3A 1JPMA 4LF1A 4PCTA 2D20A 1JFHA 3KDNA 3QYQA 2Y61A 5A6LA 4XZMX 1F07A 4B16A 5CZSA 2P5NA 1FWGC 2C0HA 2Y6ZA 1R2SA 1XQLA 3A13A 2V8ZA 3LENA 4BS0A 5I79A 2ZZCA 5AHEA 1NPXA 2CC0A 5FS6A 2Z4GA 4NX0A 3MZ2A 4ZQCA 3HMJG 5E0CA 1V3KA 2JFEX 2VDGA 4IT1A 2Z7GA 1T8QA 2FVMA 1EXPA 8CGTA 5DCDA 2VDHA 2D2OA 5FEPA 3MW7A 3DXIA 1AQMA 2ZKMX 3TXVA 2PDKA 1TV3A 1R47A 3MP3A 1UH4A 2J7GA 3DERA 4L6OA 5JUVA 4ZO9A 3I6TA 3ISIX 2ODOA 1CGWA 2EPMX 1AQFA 4E2DA 3FEMA 4D6IA 1FWIC 4AC7C 4NNBA 5TBOA 2D69A 1W2VA 5CPMA 1FFQA 3B05A 5CJNA 3UD6A 1A5BA 2I9UA 2C3ZA 2P53A 2YGYA 2W3ZA 1W3KA 3ENLA 5BXRA 1S3TC 1S2AA 1GQKA 2DH2A 4BI7A 2PODA 4O0ZA 4L1WA 1QW8A 1ICPA 1SMAA 3QGAC 1E72M 3P93A 4F9DA 1SFLA 3W74A 3AAMA 3WY1A 2J8FA 1OFAA 4ATWA 2PU0A 1A5OC 1PZ0A 4RCXA 1SFSA 1S5VA 3MI6A 1OYCA 4LW7A 2JIEA 3S2CA 4IIGA 2ZZBA 4GUGA 3G5EA 2OGYA 3VZZA 2DSUA 3GZAA 2PLMA 2EG6A 3GX9A 2YXXA 1L6FA 1Q5MA 2J7HA 1AJZA 3KOZA 5C7HA 2QUVA 3QTPA 3CBWA 2JKEA 4HJFA 4GJJA 4AU0A 1Q6OA 3RRAA 4N9DA 4QRNA 5EMLA 1RVKA 4NZ3A 2VCBA 3WEMA 1KW1A 3MKVA 3VABA 4NT0A 3NIYA 1GZ1A 2PLCA 2VR4A 4GE8A 1V4YA 5DMLA 1V6XA 3IGXA 4KWSA 3L65A 3WIJA 4YWOA 4IPIA 3D6NA 5CH9A 1O68A 2Y63A 1CI1A 2YL8A 3C2YA 2RH9A 4DWSC 1W3TA 2OJPA 3SI9A 4ZOBA 1UG6A 5G5IA 3ZMRA 2OQHA 4DO4A 1I2RA 4F2UA 1PIIA 5DELA 2NVDA 1V3LA 3DJJA 3P8IA 2GGGA 1JZ6A 4S23A 1VBUA 1H0GA 3T2PA 1EEXA 3LOTA 4X9YA 2QCEA 3QR1A 1UR1A 3RAOA 3SCTA 3TH6A 1JL8A 4CEXC 3L67A 1XDJA 2P88A 4BKNA 3K13A 1Q6DA 4DM2A 2QCDA 2VFHA 2B81A 3WDPP 1VB9A 4QEEA 4YTSA 1KV8A 1YBQA 3CIXA 4LF2A 1ZY9A 1DP0A 4CNTA 4Y9OA 3ITVA 1CGVA 4OHQA 3M64A 4BR1A 3UA4A 1KD0A 3HG2A 4MDOA 1D2KA 2JKPA 1FX6A 3B8WA 1F05A 4QGCA 2VYOA 3P60A 1YNPA 2YCIX 4WEVX 3GXNA 4J1OA 5HJLA 2VGBA 3O2LA 1KV5A 1XLEA 5C54A 1T3QC 1Q3NA 2GJLA 4DXKA 4C6IA 3IJLA 2R1MA 1UR3M 4FLRA 2OEMA 2INEA 4GRSA 3N9SA 2TMDA 4HHMA 4J3TA 5HDRA 5HMFA 3QPEA 2XIIA 4O17A 2E8ZA 4XK2A 2VRQA 3UBPC 2D73A 1NWSA 3THUA 4DLFA 4AD4A 2XYLA 3CH0A 5GJMA 3W37A 1B90A 5U7SA 4QBXA 1EO5A 1O60A 3S5NA 2VVSA 3FG2P 5TD4A 5CQ1A 4O11A 3M7SA 3DKLA 4FIRA 1EHAA 3NQBA 3Q65A 2FZ8A 3INPA 2Z28A 3W7IA 4ZZ9A 3RLGA 1AD1A 3A7AA 1PPIA 1P7TA 3OO2A 2YLAA 2ISFA 3QFWA 4DB7A 4NL1A 4PBEA 4F0LA 2H3BA 3QLDA 1LL6A 3OLGA 3RRXA 2ZDRA 4TVWA 2AQOA 4FNRA 1NWRA 3IIVA 3CQKA 1IT8A 1EJ7L 4KIRA 3SFKA 2RKXA 2NV2A 4LUTA 3ZR5A 1M03A 3LYEA 4R5EA 4QDMA 4JTDA 3ZT6A 3EBVA 5A3HA 4PBFA 3K8LA 4RNJA 3H12A 4Y9PA 3CPUA 2VX4A 4BEQA 1REQB 1E0UA 3ITCA 3SUSA 3MSGA 2OSXA 5AN7A 3G6MA 2TPSA 2XINA 3N3TA 5GJNA 3P14A 3CEPA 2JK6A 3EDKA 1QBAA 1Y5WA 2WMKA 3VD4A 4LVDA 5BU6A 1R3VA 3SBFA 3QLLA 2DEPA 3HA1A 3LPOA 1ONXA 2ZXDA 3F4NA 3HGRA 5TR3A 3VILA 1LJYA 1HJVA 4QSFA 1K8XA 2BSLA 4XZWA 1XF0A 1E6PA 1NU5A 2A3EA 4URIA 3CZEA 2RJHA 2CLOA 5MF5A 1X7FA 1XLAA 5D8WA 3L7RA 4GYFA 4AY8A 3SR6B 2YCLB 1CIUA 3O6DA 1CB7B 4GYPC 1FXQA 5BOOA 3AMCA 2VM8A 2X42A 5FSDC 4Q4MA 4F3HA 4FF5A 1K9EA 1RSCA 3TXZA 3CAQA 4UTWA 3GTFA 5ABFA 2OO6A 3H4KA 2EG7A 2NPXA 3HZ3A 1VBHA 2PUZA 2XVNA 4F2BA 2QCFA 4DWSD 4PA8A 5IHRA 3IJ6A 1PZ3A 5I3JA 2WAGA 2GDUA 3KBJA 3DGBA 3WBAA 4NIRA 2EKCA 3DYMA 3H8AA 5LIXX 4H01A 1XL9A 4R34A 1ME8A 1B3VA 1L8NA 2NQ5A 1R85A 4R88A 1EO7A 3GE7A 3C4UA 3GW3A 3BAJA 3CO4A 2PTZA 4ACZA 4S3JA 2NWSA 2PGEA 5I02A 3QW3A 4GVIA 1XGZA 3DUGA 3EX1A 1TR9A 4BWLC 4PGLA 2EBNA 4HZMA 1E0VA 4A3UA 4OU1A 1ZAHA 2IPGA 2FDSA 3RMJA 4PMZA 4XSMA 4H4TA 1C92A 2EAWA 3GC4A 3BDKA 1JCTA 3ZJKA 1TA3B 3ZLHA 4AF0A 5F1UA 3P80A 3PPCA 1ZBVA 2VFFA 4LWWA 3OA5A 1W8SA 3UY7A 5HQMA 3LDVA 4MB5A 1W1B1 2VOMA 5F2LA 3KBNA 1Z3NA 4HTYA 2PDWA 3WDHA 1Z48A 3A5FA 2VXNA 2ZX7A 1EDTA 3CUFA 3UWYA 5IM51 5FJJA 2BHUA 1XBVA 2DW6A 2XH4A 3QKEA 1TPC1 3PNZA 3PY2A 1KC7A 2YYUA 3VAVA 3WQ6A 3W22A 5FF2A 1JI1A 3CQ0A 4AAJA 1XSIA 2VZUA 3HPAA 3DBPA 4AY1A 3UJ2A 4DBSA 5C7VA 3G22A 3OQEA 1SGJA 3N17A 2OO0A 4A21A 3IK4A 4DJDA 1M65A 4NAFB 2IKJA 5HQLA 3UZWA 1J79A 2D24A 2R91A 3STGA 2A2IA 4FSAA 3CK5A 5LZLA 3LPPA 2WQDA 4KMQA 2GZXA 3OODA 3WJZA 3GXMA 2OT1A 4G8TA 2HPIA 4JTKA 4ZTXA 1XYLA 4XIMA 3UJRA 2WBKA 3WL1A 3CV1A 2DQXA 4ECLA 1ZP3A 4YCOA 3L8KA 4Z2HA 5C9WA 4NYYA 4V33A 1XSKA 1QTWA 3FVDA 2X1RA 2J7EA 4OVXA 1GT8A 4WDUA 1JRBA 3UGRA 3NQ7A 4L6HA 3TYDA 4ZENA 3VIKA 5H1WA 4HMNA 1BKHA 4NNAA 2XZ9A 1Q6LA 2RGMA 4MJ2A 4XISA 4L5ZA 4B5XA 3EAOA 1SMDA 2X2YA 2BS9A 3FN9A 4M29A 1LBFA 5I03A 2P76A 1PCWA 5EFFA 3GDMA 1FH7A 4DI9A 4M80A 3TC6A 4GUJA 1CNVA 3FDKA 3N3MA 2QHAA 4W84A 2V0TA 5HWNA 4O53A 3V5FA 4NRSA 4WY0B 1WAWA 2ZBTA 3WK1A 3W9ZA 3R12A 2PD9A 1XYZA 5JCMA 3UWQA 1GOQA 1XH1A 2XH2A 1OGGA 2EG8A 3KL5A 3H4XA 2W79A 2ACUA 1X7IA 1E9YB 3MBDA 3UXKA 4WZHA 4JQ2A 1UD4A 3W1LA 1NIUA 3QXBA 3VOJA 1GRTA 3MA8A 4TMBA 1XYBA 1NY1A 3GY1A 4UZUA 5K9DA 4UOJA 2PAJA 2PDCA 4JR5A 1J96A 4HN8A 2BXZA 3TTSA 1OIMA 3WK3A 1M7OA 4BJHA 3PBUA 3AMDA 1GEHA 4DLMA 1OGBA 1G4EA 2O92A 3B9EA 3PTQA 3FFSA 4KFOA 3VNZA 4CU8A 1QDSA 3NO1A 4RXGA 5FS7A 2VNCA 1SSDA 2UY3A 1LOSA 1V79A 4GNVA 3DEQA 4FHAA 2W3SA 5KTLA 2UY2A 1XANA 5JXQA 2EJAA 4O18A 1JD7A 3UCCA 4MWAC 3RPDA 2VEIA 3EXTA 1Z42A 4OFCA 2G8ZA 3EEGA 1JNDA 4HNLA 3L5AA 4HB7A 4PTMA 4LC8A 1PS9A 2YL6A 5AC8A 1JF5A 1LDCA 4N9CA 1J0HA 1OFQA 4KKXA 1KRMA 3W38A 2YVJA 4BQ3A 4QJ5B 2GJRA 4D8AA 5C2CA 3N19B 2HDJA 3B8DA 5A6BD 3VUPA 5C9RA 3L4UA 3EWUA 1UD3A 2ASHA 3LY0A 2OZ3A 4A3RA 4YYCA 3GSMA 3C5QA 4O1CA 3FGCB 5D05A 4P7NA 4IQDA 4Z2LA 5F4WA 1O5QA 1XC6A 5EBAA 1KM2A 1F6KA 4AMCA 4F79A 3VIIA 4ZB5A 4JTUA 1OSEA 1E4MM 4GIRA 1ZJBA 2REQA 2CDUA 2ZTJA 3KOFA 1TV7A 4I90A 5LHEA 3L4ZA 4FF7A 3GDTA 2G37A 3WLHA 3WD4A 1EC9A 1UA7A 2PDMA 3MBFA 2V5DA 3E1F1 3ZVHA 3M41A 1UC4A 3AICA 1SU5A 1Y7VA 5M03A 4AYSA 5DBTA 4JBRA 3A24A 2VEMA 3KP0A 3C8NA 2P0OA 3VOHA 4NG3A 3O6CA 2PPGA 3FHAA 2E1DA 4BK9A 3P67A 3OLDA 4IH3A 3HQ1A 3P84A 1QNPA 4PUEA 1VBRA 3GNXA 1FUYA 1W1IE 3CV2A 1UJQA 2FB3A 2ISWA 1KGWA 1RD6A 4QJ4B 1QI3A 4KEZA 3MCOA 2A85A 3RG6A 3KCOA 4JZ5A 4M3PA 2B31A 4R9XA 1F3PA 4S2BA 4UMAA 2PDBA 4GI4A 1HKIA 4X0NA 4XAZA 1GOXA 2YAUA 3H26A 2DVXA 2DT1A 4JICA 1HT6A 2HMCA 4IX2A 5D37A 1BYDA 5I3HA 5DRIA 5IRPA 1FP8A 4NKCA 4K8HA 3WQ5A