3MUCA

Muconate cycloisomerase variant i54v
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
369
structure length
360
Chain Sequence
ALIERIDAIIVDLPTIRQQQTLVVLRVRCSDGVEGIGEATTVGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MUCONATE CYCLOISOMERASE)
publication title Structural basis for the activity of two muconate cycloisomerase variants toward substituted muconates.
pubmed doi rcsb
molecule tags Isomerase
total genus 138
structure length 360
sequence length 369
chains with identical sequence B
ec nomenclature ec 5.5.1.1: Muconate cycloisomerase.
pdb deposition date 1998-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3mucA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3mucA01
2QDDA 2QQ6A 4HNCA 2OG9A 4A35A 1EC9A 2HNEA 3RO6A 7ENLA 3FYYA 3UXLA 2MUCA 2OQYA 3SBFA 4HCHA 4A6GA 3BSMA 4HCLA 3VCCA 2XH7A 3GD6A 3K1GA 1SJBA 3R10A 3PK7A 4GMEA 2AL2A 3NO1A 3ENLA 4K2SA 1SJCA 1ECQA 4H2HA 2OQHA 3OP2A 4H1ZA 4IT1A 3IJLA 1NELA 3ZLHA 4HYRA 1KCZA 1EBHA 2GSHA 1WUEA 3H7VA 4JN8A 4GISA 3MKCA 2OKTA 2GL5A 3NXLA 4JHMA 3ZVIA 3FJ4A 4DXKA 1KKRA 4E8GA 3V5CA 1W6TA 2AKMA 1JPMA 3DERA 3MSYA 3R25A 2OO6A 2PGWA 3OW1A 3V3WA 3VDGA 3FVDA 1JCTA 3CAWA 2DW7A 2ONEA 4Z1YA 3T6CA 2PP1A 5ENLA 2POZA 2GGJA 4GYPC 1ONEA 1PDZA 3QLDA 3DGBA 1TZZA 2GDQA 4M0XA 2P3ZA 3STPA 4A3RA 1MRAA 4ROPA 4HN8A 3R0UA 3UJEA 3CT2A 4H83A 3D46A 1R0MA 2PU0A 2PGEA 2QVHA 3T9PA 3I6TA 2QGYA 4GIRA 2GGGA 3N6JA 3ZLGA 1EC8A 3DFYA 5FJOA 2PODA 3H70A 1FHUA 4ZCWA 1JDFA 3RGTA 2PTWA 3QN3A 3U9IA 2HXTA 2PSNA 3N4FA 3OTRA 4ZA0A 1P48A 4DWDA 3T8QA 3U4FA 3EKGA 2QJMA 3VC6A 3H8AA 3S47A 3TQPA 4MKSA 3IJIA 3MY9A 4E6MA 4IP4A 1FHVA 2PS2A 1OEPA 2GGEA 3UJ2A 4HNLA 5IDZA 4HPNA 1MNSA 2XGZA 3VC5A 2CHRA 3TJ4A 3MZNA 4DN1A 2PPGA 5J04A 2FYMA 3N4EA 2AL1A 1WUFA 4X2PA 2O56A 1BQGA 3JW7A 2OZTA 3UJFA 1DTNA 2PCEA 2PTXA 3SSZA 2RDXA 2AKZA 3CXOA 3NFUA 1MDRA 3TOYA 3TWBA 4DX3A 2DW6A 3T4WA 3VA8A 5FJPA 2OFJA 3P3BA 4K8GA 5FJRA 3FXGA 1L8PA 4KT2A 4KEMA 3OZYA 3Q45A 3CYJA 3HPFA 3MWCA 3CB3A 3N6HA 1JPDX 2PTZA 2FKPA 4J3ZA 3QPEA 3TTEA 4YWSA 4IL0A 3UGVA 3PWGA 4GGBA 1F9CA 1KKOA 2GGHA 2OVLA 4G8TA 5BOEA 3SJNA 4JN7A 3D47A 3QKEA 3I4KA 3ZVHA 4E4FA 3Q4DA 3MUCA 1TKKA 3QTPA 4GYPA 2PP3A 4KPLA 3RRAA 3TJIA 4Z17A 3NZGA 4H19A 1TE6A 3OZMA 2HZGA 4GGHA 2QJNA 5FJUA 4DHGA 4E4UA 2OZ8A 6ENLA 3TW9A 2PU1A 2PTYA 3V5FA 4FP1A 2P8BA 4IZGA 3RCYA 3H12A 2HXUA 3DG3A 1KD0A 3SN0A 2PMQA 3IK4A 2XSXA 4MGGA 3DFHA 2ZADA 3SQSA 3THUA 2GGIA 3DDMA 3FV9A 3ES7A 2P88A 4DYEA 2P0IA 3R0KA 3TCSA 3V4BA 3R11A 4F4RA 3FCPA 3OPSA 3JZUA 3PWIA 5EU9A 3UJSA 3VCNA 3KUMA 2XH0A 3I6EA 3GY1A 4IP5A 2OZ3A 3MQTA 4E5TA 3DG7A 3JVAA 2OPJA 2OX4A 1EBGA 1BKHA 3P0WA 3EEZA 3RR1A 1XS2A 2I5QA 4IHCA 1XPYA 3ZVHB 1MUCA 1IYXA 4FI4A 3UXKA 3GO2A 1MDLA 4GFIA 3DEQA 1PDYA 3ZLFA 3DIPA 4EWJA 2QJJA 3PFRA 1R6WA 4J1OA 3TWAA 3GC2A 4KWSA 4MMWA 3UCDA 3UCCA 4IL2A 3P93A 3UJRA 3CK5A 2NQLA 3IJQA 1ELSA 5BOFA 4K1WA 1NU5A 3RITA 5FJTA 1RVKA 3SN4A 1YEYA 3ES8A 1EC7A 2XH4A 3DESA 3DG6A 2P8CA 2PP0A 3R1ZA 2ZC8A 3BJSA 1SJDA 2OLAA 3SN1A 3B97A 3VFCA 2PA6A 2QDEA 3BOXA 1E9IA 2XH2A 3S5SA 2AL2B 1P43A 4G7FA 4M6UA 4HCDA 1SJAA 2MNRA 4ENLA
chains in the Genus database with same CATH superfamily
2QDDA 1UR4A 2EPHA 1S38A 2REQB 1IZKA 2GVLA 4GBDA 1OX5A 2IQ0A 2I1OA 3BG9A 4KEUA 2Y7GA 3W6YA 3WD2A 3B9JB 4IH3A 4PUDA 2VX5A 1OFEA 4HTBA 1S2VA 3LM7A 3E5BA 1XLJA 2V68A 3VCCA 3CEUA 3SGGA 3NO1A 3W1RA 1UD8A 1Q7QA 4LOCA 1ECQA 2A79A 3B0XA 3APGA 1KBBA 2J7FA 3N15A 1E15A 3A4WA 4JFTA 2A3BA 1DHKA 4GQQA 3W1QA 3SUWA 3LNMA 3EX3A 2ZXDA 2CXEA 4IWWA 1PZ2A 4GKLA 3RYSA 5BROA 3GFZA 3LQLA 1H4PA 2F84A 2WZTA 3BMWA 4NL1A 2Z1SA 3PHAA 1QHOA 3DFOA 3OW1A 3VIJA 2WVVB 3R13A 1IZCA 2Y7EA 1N82A 5LXEA 1ITCA 3MYPA 5FMHA 3WJZA 2A0NA 1MW3A 1Z69A 4B15A 1XR2A 2RAGA 3LRKA 1GV4A 5C2GA 1J0ZA 3AUJA 3CT2A 3GNNA 4UFKA 5E0KA 3KP1A 2G3NA 3RCNA 3VKKA 4RDVA 4WHBA 3USBA 4ERGA 3P5YA 3CZKA 3PNUA 5HJXA 1QI2A 3W1PA 5IHSA 2C8NA 3M0XA 1ZP3A 2YVJA 1B3YA 1VPQA 4BURA 2OYLA 3STGA 5CH9A 3TLLA 4L9XA 3DH9A 4N4QA 1V0LA 5A8GA 1KM0A 3CHFA 1LRQA 1EBDA 2NUYA 1TFVA 4ZQRA 2VUNA 2YBVA 4ZFCA 3OVRA 3HG4A 4V28A 2R24A 1MI3A 4AHOA 2D0FA 5BXTA 2W54A 5FCZA 3T8QA 1QNSA 1TE1A 4A3UA 1JUBA 3PAJA 5HQLA 2A3HA 3MY9A 4AB4A 4GX9A 2R94A 3WJXA 1V3JA 4JNZA 3GIYA 4R27A 1O94A 4HNLA 4Q6XA 4FA3A 3FSUA 1TWWA 2E3TA 2XGZA 4DN1A 5C55A 4GZEA 2A21A 3N4EA 4AZBA 4NHVA 4AG0A 2QJIA 2EJ1A 2C91A 2RDUA 4GYFA 5HWJA 2PTXA 2OEJA 2QCCA 2YKKA 1ZSXA 3CXOA 4JIEA 4EPEC 3EX6A 3OYXA 2W3SA 3A4AA 1L9WA 4ZSUA 5FACA 1D7KA 3FG2P 2PCQA 2WNNA 5FJRA 3HGSA 1T3QC 2PFHA 3OQ8A 1D2KA 3H7UA 4EMIA 2GPTA 4JTIA 1VFUA 4MNJA 1VJZA 4FX7A 2WPGA 1UW9A 3UGVA 3PWGA 2QF7A 1H0GA 3SCOA 1SSDA 1JRPA 4EF9A 4YCPA 2NXIA 3AWOA 4OBTA 1S39A 5HATA 4UQ9A 4WIWA 1TKKA 3RILA 4DM2A 1E72M 4HBKA 2PLCA 3OZPA 1TPWA 3TJIA 1TTJA 1RZMA 3O15A 4GGHA 1LBLA 3OBEA 3NEHA 2ZX7A 4B5NA 5D02A 2OYKA 4AZHA 2C3CA 1WOAA 2A3LA 3L2MA 1JZ3A 2OKOA 3GKFA 4PB4A 1OZQA 1RY8A 3DFHA 4N2YA 3WUBA 1OCJA 3N04A 1E4IA 2ZUMA 1Q6QA 1AUSL 2W5FA 3KTSA 4ZL1A 4GZJA 4M80A 2P88A 3IARA 1GCYA 3GYEA 4AZ5A 2J79A 4MKNA 1UMLA 1LL6A 3OPSA 1EJWC 3GXTA 1ZDLA 3NJ3A 3S2JA 5EU9A 4YPJA 1EDQA 4G7EB 1A5KC 4Q4PA 1MUWA 3C0JA 3SECA 1PHQA 1HGWA 3LB0A 1XIJA 3VINA 2ZKMX 3DX5A 3C3NA 1REQA 3EPOA 3A7AA 3WQFA 4PL2A 1GGOA 3EZ4A 1IEVA 2INZA 3ZQ9A 2FFCA 4UOQA 2ZIDA 3PBMA 3NDOA 3BLKA 1KWGA 3GO2A 4GUJA 3WF2A 3N3MA 3NQ7A 3UPBA 2VUYA 4QCEA 1MUMA 1TWZA 2V69A 2ZRVA 4V33A 1RVGA 4ZE5A 3ANUA 3I10A 3P60A 3VMPA 4CD5A 4E38A 1TCMA 2ZRUA 1WDPA 3PZGA 2O7QA 4FX9A 1TV3A 3BLLA 4U2ZA 3CLWA 3RITA 3LDVA 1RVKA 4ML9A 1YEYA 3P74A 4DELA 5CEWA 4XKYB 2XH4A 4AIUA 2D22A 2ZC8A 3BJSA 3M16A 4O11A 5HNRA 4PBEA 1XXXA 1BRLA 2QPSA 1A5NC 5AB3A 4P7QA 3AU2A 1GORA 2EHHA 2DT1A 1HW6A 4DJEA 4US5D 2Y5JA 1XYAA 4QEEA 2V0TA 1QOQA 3W0KA 1UZ1A 5AY7A 3RO6A 3SUSA 2WXDM 1B3VA 1F3TA 3AMKA 1UUOA 3ID7A 1SZEA 4WK9A 2OQYA 3LCXA 3UZZA 1DXIA 2C0AA 3LNPA 3STFA 4ZQPA 1BWVA 3LEPA 3FDGA 4OZOA 2XH7A 3DYOA 1XRFA 1EF3A 2PRMA 4GMEA 2PWEA 3TZFA 3MUIA 4O12A 2E09A 2Z6JA 1OK6A 2TODA 4QEHA 3RXZA 3NZQA 4GZIA 4IT1A 1W1A1 2PGFA 2Y7DA 1G6CA 4NASA 4D72A 3CUHA 3U8GA 4O13A 2ICSA 3AAMA 1D9EA 2HQAA 3S5YA 2EPLX 1A5SA 3CV1A 4R34A 3PY2A 4AQLA 4QE4A 4ORIA 1AJ0A 3AIVA 3GBEA 3UXAA 4QITA 4PSRA 3T0CA 3ZIZA 1JZ2A 5LGXA 3CMFA 1DHPA 1XLGA 4LH8A 1F5ZA 2XIJA 1QNRA 2VDIA 2XIMA 5AVHA 2R82A 3IIOA 3CZEA 3BZJA 1OC7A 4GYPC 4GQBA 3ABQA 1VFHA 3DGBA 4Z1DA 5EPDA 3STPA 3KEHA 3LHTA 2G3IA 3QW4B 4WJEA 5EGRA 1E9YB 4D6JA 3SI9A 1M41A 2UV8G 1MRAA 4Z1AA 1W1ZA 1YDNA 4URIA 1W3TA 1BYCA 4AWSA 3S2CA 3NS1B 1C91A 5AC4A 3IJDA 2I9EA 3UESA 1EA0A 1XIGA 1W9UA 4QFUA 3QC3A 1FWSA 3THCA 1GRGA 1HP5A 2JE8A 5I24A 3AXKA 3ABRA 4O28A 4JYEA 4EXQA 1N8FA 2CBVA 1I0BA 4KGJA 4TMCA 1FWAC 3SRHA 1NWRA 1Y5VA 2PSNA 5JBFA 1PTAA 3XINA 3CIXA 4MWAE 4BQ4A 2ZVIA 3W7OA 1GSNA 2VFIA 1SZRA 2VTFA 3MCNA 2F6KA 3T2QA 2WHMA 2PZ0A 4DWDA 3VC6A 1M9HA 4YVXA 5D09A 2X41A 1IEQA 1RPXA 4XIAA 4AZIA 1KQYA 1VDVA 1VFLA 2VOTA 1EJ7L 3KCJA 4H8UA 5LNSA 1UWQA 5EY5A 3U0HA 4GRTA 3PJXA 4H9MA 3C3UA 3VKCA 1HO1A 4KIEA 4GVFA 3EWBX 3S9ZA 2RKXA 5TBOA 1FCVA 3W84A 5CAKA 2PAJA 1UZDA 2WQPA 3MDWA 4LS0A 3VGFA 4WD0A 1DWGM 5D33A 1UD2A 5HUPA 7A3HA 2C79A 1A4LA 4AHQA 3DK8A 2CZ5A 4FLRA 4QHRA 2JBMA 3TSBA 2ZBTA 4MWAB 3NDZA 2Y0FA 1TZ9A 2QMKA 3CQIA 3MWCA 3N6HA 3FJ6A 2OXNA 1CGTA 3MMTA 1TQJA 1SM9A 3NSXA 3W75A 4ZR8A 2V2CA 2Z28A 3NSNA 1KBJA 4Z0SA 4AIBA 4ES4A 2L5HA 2TYSA 3H2OA 4MLRA 4JN7A 4HHHA 2I5IA 2PWUA 3L4WA 4EAMA 3ITYA 2VC9A 5IBXA 1B9ZA 5FL0A 1FP9A 3BMVA 2D20A 4DJED 4DXXA 1TE6A 4XD5A 3CWNA 2QEZA 3PJTA 5A5WA 3VU2A 4NJHA 3UXDA 3V1PA 3F5LA 3QFWA 1IIHA 1HL9A 1OWQA 3AFBA 1O5XA 2P8BA 3ARTA 3ZJ7A 2KAUC 4IIGA 4JQ2A 3IVUA 1CT5A 4M51A 1UQYA 4IQDA 3EYPA 1SQ7A 5CPTA 1QUMA 1DWFM 2XDFA 1YBQA 1Q6DA 4H4RA 2VEMA 3PZUA 1GEUA 3AHXA 2PE4A 4GVHA 5ECUA 1XLFA 2QCDA 3WL1A 1WZMA 1G9HA 3JZUA 1NQKA 1JDAA 3O3RA 4QLJA 4BQ5A 5IXEA 3DBPA 2CLEA 4LGXA 4ZO6A 1YE4A 1IIGA 2GJRA 5GJPA 3R58A 3I6EA 4GQRA 5JBDA 4GD0A 3VVGA 2OZ3A 3VD4A 2ISSA 2Z1KA 2ZE0A 3VNLA 3EEZA 3W25A 2WSRA 2I5QA 5KZMA 4GNKB 4I5RA 1I2OA 3IACA 3U2OA 1K7FA 3BSHA 1OC5A 6PTDA 2PI6A 4JIQA 2V5CA 3GBDA 5CCZA 6A3HA 3N29A 4UTKA 4I8DA 3W7IA 4BF5A 1EO5A 1DNCA 3WNKA 1A4MA 1YQZA 4UIOA 4ADUA 3IRDA 2E5CA 1XQLA 1Q45A 1XISA 3CL6A 3PC0A 2EKCA 3WEMA 3WFZA 3MHFA 2WWDA 3MJYA 4M6QA 1AH3A 2X0SA 3QXBA 1UOKA 3URQA 6TAAA 4JIHA 1K7XA 2E9LA 2V3AA 1XW8A 4PB5A 2BHYA 2YIHA 2HQMA 3LLFA 2GFTA 3E9AA 3F5KA 1ELSA 5BRPA 4WKFA 4D6GA 4Y96A 3AXMA 5FJTA 5D2XA 3P81A 4WQ6A 3UVAA 3DFSA 3F4NA 5CC5A 1LLWA 3RPTA 4OIFA 1AQMA 1Z7AA 4MDOA 1I2NA 1D8WA 4CQAA 1F76A 4LS2A 2QIIA 4OV9A 4H4UA 3LOTA 4IMEA 1Z9AA 3KP0A 1Q66A 4LT9A 2WZMA 2EQ6A 1B1YA 4GYKA 1LLZA 2EAWA 1KRCC 5HNUA 4G7FA 5E6ZA 3G3DA 4ENLA 3FW6A 1TV8A 1G4SA 3SRDA 1J2BA 2CLOA 5KETA 3AS0A 4LUSA 3TE9A 4M5PA 1DXEA 4CU7A 4B91A 2HNEA 1S7MA 4LQ1A 1GOKA 5BOOA 2X16A 1PZ0A 1BVWA 2NLIA 2WNWA 4MLJA 5TR3A 1CNVA 3A3XA 2X2GA 3QV6A 4EQXA 1GJPA 3GC5A 3H2AA 3L4XA 1CGWA 4Z2JA 2HWGA 5A6AA 1GQJA 4GZ7A 3VDHA 3C0SA 2VCCA 5A6LA 4HYRA 4CNUA 3HOJA 1UD5A 3R43A 2FZMA 1Q4WA 4ZZ9A 3N73A 3GVVA 3POCA 4H4SA 1K77A 4WSKA 3VXGA 1O6IA 3E2VA 1X1OA 3L5AA 4EANA 1MVYA 3W7KA 1DWHM 2VR2A 1XHCA 4GO8A 3CASA 1AH0A 3WBAA 3ARUA 1L6WA 9CGTA 1RR2A 1XDIA 2VI0A 1PV8A 1YNPA 4LRSA 2C16A 1TPEA 3GNOA 1S3TC 1IXQA 1JXJA 4UNIA 1B3ZA 1ONEA 2NV2A 5I2UA 1PDZA 2NUXA 4KCUA 1VFOA 3MV11 2BXVA 3LV5A 1NFGA 4ROPA 1WDRA 2X40A 3LTYA 2WO5A 4LXFA 1RALA 2BVTA 2DY3A 3H2EA 3QR0A 1XFCA 3QPYA 3E5PA 2VENA 2X50A 1ME8A 1Q6OA 4JN6A 2P0OA 1U1HA 3NA8A 3WBYA 8A3HA 4Q8VA 4HMCA 3KBNA 1GESA 2VFFA 2Q3OA 1G69A 1JFXA 2F9RA 2GJNA 1J0JA 2ZE3A 2Q3RA 3H54A 2VZUA 3OIHA 4ZXOA 2ZRXA 5LSMA 3WX7A 1NH6A 4P8WA 1DJZA 3CQ0A 4FF5A 4JS3A 3I7QA 4GY7A 3S47A 4R9XA 2Q71A 2CESA 2EQ7A 4Z1BA 3W2JA 4DBSA 4MF4A 2V81A 4TUFA 1TWIA 4I5UA 4Q4MA 1TR9A 3MP5A 2W92A 4OKDA 3DYMA 3INPA 2W27A 4H4YA 2BY0A 3K8LA 2FPTA 1HL8A 4HK6A 2QYGA 1TPC1 3ARYA 3DC0A 3JW7A 4H4QA 2OZTA 3QLLA 2HMCA 1LT8A 3N4AA 3S1WA 1U1JA 4NYYA 1QVBA 3GR8A 3NFUA 1MDRA 1HKMA 2Y1HA 1XKYA 4GI4A 4Y8FA 3OOQA 2FHBA 3T55A 3GDBA 1VCFA 3IGSA 1CW2A 3EWDA 1LUCB 3B06A 1V4YA 3QYSA 4H8VA 3NWRA 1A0CA 4XD4A 1W3LA 1BWKA 4DZ5A 1RK6A 4H4XA 2HVMA 3NO5A 3KBWA 2CLIA 1TMHA 3N13A 3TSMA 3GTFA 3LCIA 3AHVA 5EMLA 2AMGA 4BCEA 1KFCA 1E51A 3W1TA 3P7YA 4F2UA 4YS1A 1BF6A 4E2DA 1LWHA 1XYCA 3GS6A 5U25A 4GYPA 1AD4A 3LN3A 3CGBA 3FNDA 1I75A 1UYQA 4JX5A 4Z17A 4JFSA 4LAZA 4L6HA 4C7DA 3LCGA 2PD5A 2VZSA 1EUAA 2IXVA 3VE9A 4XO6A 3IGHX 2ACUA 1QAPA 4IZGA 3RCYA 2O0TA 3H12A 4JCMA 2QMJA 4A8LA 1WDQA 3W1UA 2PDXA 3AZRA 1GWJA 4NJGA 1EDGA 1QU4A 1ZJAA 4PMQA 1U2YA 5K3VA 5EMUA 4LIIA 2VOMA 3BSGA 4UTUA 3LCFA 3FV9A 2X8CA 3RIKA 2CLMA 2YA1A 3ES7A 5ER0A 1GJWA 3E0FA 4GI8A 1HJSA 1YMYA 4D8LA 1F8IA 3TH6A 1DXLA 3C2EA 4YVPA 5FF4A 1KGUA 1SW0A 1NDAA 3AIBA 4LVFA 3ZT5A 3O7UA 3URHA 1T8XA 4RCXA 1IF2A 4RR4A 2ZXBA 4IGMA 1EOKA 1EF2A 2NVCA 1M1BA 2WC4A 5GJNA 4LAMA 1JR1A 4FEZA 4A05A 3MKKA 2R91A 3LM3A 4KFPA 4CLMA 2ZTJA 4MNKA 2QUUA 3C56A 1I2QA 3NOYA 2CXGA 1ZQ5A 1OCQA 4O1CA 1ZAIA 2V38A 1I8JA 4J3WA 1MDLA 2WSQA 3BGGA 2JK2A 3KVKA 1BYDA 1TIMA 3W70A 3P5ZA 3WLQA 2CBIA 3AIQA 3F4DA 4F0HA 3C2RA 1PZ3A 1AA1B 2Q8XA 2CKSA 3GC2A 3KDNA 2PLKA 3P93A 1X2GA 2A5HA 2R1PA 3A12A 1VENA 3CT7A 4C1KA 5JBEA 2PRLA 4TVUA 2GWGA 3BZGA 3U2CA 2ABAA 4S3FA 3H4XA 1XM3A 3PP7A 5CPMA 3WF1A 3N34A 3DI0A 1TV2A 1JCLA 4W85A 4YWOA 2QCEA 3FHQA 3T42A 4I7VA 2BB0A 1QXLA 3W24A 2X8HA 3AISA 5G2HA 3H2NA 5J5DA 1AL8A 1ZTVA 4H04A 2FTWA 1DQWA 1W1YA 2VDHA 3USZA 3HFTA 4JTGA 1XANA 3A5FA 4NX5A 1POKA 2IPWA 4Q4RA 3C5QA 5AC5A 2O9RA 3CZLA 1GVOA 3MO7A 3N9KA 1ZY9A 1HKWA 2FH6A 4NEWA 4R3UA 4PRTA 2IKGA 1H63A 3RRXA 3QZAA 1Q6FA 2QV5A 3R8HA 4FDCB 2CKRA 1LORA 4AD4A 1RA5A 4AD3A 1KFBA 1A3WA 4H2CA 4OJYA 3LK6A 5M17A 2DZPA 2OT1A 3GRIA 3NVWB 3T2PA 4E8DA 4U4MA 2A1YA 2F8QA 2J66A 2VCAA 2CERA 5F1UA 1TQXA 1AD1A 5HMFA 4Z2LA 1GERA 1HF6A 3E1F1 2Z2BA 4FXJA 1VB9A 4F0SA 5FI8A 4EVZA 2RGMA 2H6RA 4BF9A 3TN6A 3P6LA 4X9YA 3WUFA 4ACZB 4XKMA 1KM5A 2QPXA 5CXPA 3RNDA 5CZKA 3NNTA 2QT3A 3L4YA 3O0KA 3PZVA 1R2SA 3CAKA 3BJTA 2FHFA 4Q8WA 1B3OA 4GIEA 3NL6A 1EX1A 3M41A 3NAVA 4IIFA 4MPKA 1H7NA 4RDZA 5ABFA 4A3RA 1ADOA 4M3PA 1A3HA 4QLKA 1TYPA 1H3GA 3UJEA 4KBXA 1VPXA 1ZPTA 4S2CA 4UTMA 1TTQA 1W9VA 2OWCA 3KVMA 1LRTA 4S3KA 1NDVA 3IV3A 4H7VA 2YCJA 1S1PA 2NT1A 4H4IA 1G4PA 1YDOA 4KRUA 1KCLA 1R9ZA 5F4WA 4CQDA 3R79A 4W93A 4ERIA 3NVVB 2I7GA 4D71A 2Y5EA 1Q6LA 3TW6A 3H4KA 3Q94A 2IXUA 4L4MA 1O4UA 4MSSA 3GXFA 2DV0A 2VGBA 2VVNA 3VIIA 5HXMA 1SU5A 1FEBA 3EPMA 6REQA 3BAJA 3G1YA 4J28A 2FVLA 2W79A 2I17A 5HR7A 5H6HA 2HNHA 3TMLA 1GQLA 3SAZA 4FLOA 2TPRA 4AAJA 1YIXA 3KOYA 1KBKA 1S46A 1ALDA 1YPFA 4REQA 2GDUA 2V67A 1FFUC 4RJEA 2VWSA 1HJUA 3B9AA 2YFNA 2YAUA 1IV8A 2BY3A 4YTQA 2IPFA 5GJMA 2IMRA 1X6UA 4A2RA 5C6MA 5D8WA 3W01A 3A13A 5CSRA 5A69A 3W88A 3NSMA 3CO4A 2BLEA 1V02A 4S1FA 5EMKA 4RE2A 2AL1A 4AZ7A 3L8KA 1C3FA 4FHAA 4F0KA 5HBFA 2Q09A 1FXPA 1Y8BA 1CECA 2BMBA 5E0FA 4CCCA 2PDBA 2IW0A 4JQ1A 2VXNA 3MT1A 1IQ8A 2Z00A 4UTHA 4O57A 3AM9A 1W1B1 4XZBA 2WNQA 3TTOA 3T0BA 4DF1A 3M64A 2QR6A 2HJPA 3WK3A 3LCHA 1F6KA 3H23A 2W3RA 3ATZA 5HQEA 4DI8A 4RLIA 4YMZA 4C6QA 1PJ9A 5JCLA 2R1NA 1OFPA 1VP5A 4U31A 3GXPA 1R3RA 1H62A 3M6DA 3APYA 1V08A 3ZSTA 5GNYA 1XKJA 5HULA 2OVLA 1NP2A 3LMZA 4I8YA 3GYCA 1AW1A 4LAUA 4Y7EA 4WX2A 1ENUA 3Q4DA 2DIKA 2FGBA 4PODA 2E6FA 3CZJA 1WYGA 1K9FA 2WK2A 4D6IA 3P80A 4LYRA 2GVJA 1OX4A 2INFA 2VELA 4H9VA 3PM6A 3HMJG 1QK2A 1VGAA 3LHVA 3G1SA 6ENLA 3G5EA 5I09A 2BG5A 5EBKA 3BV7A 4PTNA 3V5FA 1R8LA 4PMJA 3SUUA 3QFAA 4NIRA 3JRKA 2H9AB 3OGRA 1QHPA 1FWEC 3RAOA 1QW9A 4LNYA 2J8GA 3MMUA 3QM3A 3T78A 4GVIA 1E6QM 1V6XA 4JYDA 3TYUA 4XX6A 4EQSA 2ODOA 3RM8A 2HK0A 2ZVRA 4XAYA 2ZWZA 4G1NA 3M9YA 2Z1BA 3TZNA 2FTPA 4F4RA 1F4HA 1RSCA 4DUWA 3KWSA 5K4ZA 1CZ1A 3T2OA 2WJFA 4JNYA 2Y89A 4KQNA 2VEIA 3MYOA 3W1XA 1US3A 1YDYA 3OHIA 1GVFA 1VBRA 2J9XA 3MQTA 5AYBA 4E5TA 4ZVJA 1EGVA 5BZAA 3D5HA 5HR6A 4JFWA 4P7NA 3SIMA 5AFDA 1PX8A 3NYZA 1DORA 4GC4A 4NAEB 3UZJA 1RJQA 3OO2A 3II4A 4DF2A 4IHCA 1GTHA 5A6TC 2BWGA 2D23A 1JQVA 2C1GA 1LLOA 4WRHA 1YXDA 1GVSA 4DWSD 4JX6A 3HURA 3WNMA 4PB3A 1TVNA 1RBAA 5CGQA 4O0QA 1AVAA 2PURA 3ARQA 3UR8A 1WAUA 1V02E 3R8RA 3V7PA 3IIXA 4MMWA 2E1WA 2XN1A 4TTGA 4V15A 3UJRA 3GDKA 3CPUA 2FQIA 3HGOA 4BJHA 3OVGA 1VBHA 4M1RA 1JRCA 2G4JA 4U2YA 1P6WA 1Q1RA 3QHOA 1E1CB 2YBUA 1PX3A 1A49A 2CPUA 2NVKX 1ONFA 1XLIA 3EMQA 4IPLA 1KGXA 2OLAA 4O18A 4QXIA 3B97A 3B8SA 1L0PA 2PA6A 3QSTA 3BOXA 1PIGA 5G4WA 5A8NA 1E9IA 3ABOA 3OBKA 3IIVA 5DEZA 4AFYA 1PAMA 5M03A 1FY6A 1XSJA 3GFXA 3VD3A 4AYSA 2PDGA 2Y8UA 3VX1A 2E8YA 3EMZA 1RD5A 3S6DA 1EUNA 4WGHA 1V6YA 2BASA 2OLHA 3MW7A 1TMQA 3BAYA 4RW5A 1UJPA 2PWGA 4CU8A 2GUBA 3S8HA 4RKAA 3UZYA 3BCJA 3TFXA 3EDJA 3EEGA 3BURA 3OA3A 5LIWX 1PIFA 1SUXA 3P84A 4Q7IA 3JS3A 4MAZA 4MZ1A 1FDYA 2J47A 4DNAA 3L21A 1KQZA 2JEQA 1MEHA 4J27A 5I3DA 4XWUA 3WDQA 4K38A 4NZFA 2BVWA 2BVYA 3TR9A 3BC9A 2W91A 5KMYA 2HS6A 3CTLA 1X96A 4GISA 4L9YA 5A2CA 3NVZB 3TAKA 3NVYB 5IFTA 3CIWA 4RV3A 1NDWA 3KHJA 4BFAA 3VKAA 1JRBA 4E3VA 4X2RA 5AHIA 1LBMA 3GWQA 1YW1A 4UOZA 3R94A 4AU0A 1UR9A 3SZ8A 1A5UA 1XLHA 2PGWA 3MSYA 3O6AA 4S23A 4X63A 2EPKX 3OLIA 3NGJA 1BRLB 2E5AA 2WQDA 3IJ8A 5C9ZA 1DIDA 5K9DA 3DGRA 4ZQMA 1EQPA 3IRSA 4CN4A 4WSJA 4MFDA 4CQCA 1CI1A 4W88A 2WMHA 2ZZ3A 4FXFA 3GXIA 5I5RA 4XZMX 1XD0A 1FWHC 3W83A 4LF1A 2DIJA 3R0UA 3CL7A 4K39A 4IUGA 2WCAA 3BAKA 4H83A 1R0MA 1HP4A 1LOSA 5L6UA 2B7QA 3NQAA 1TA3B 4HK7A 2R1KA 4JKMA 3S6TA 3IGXA 1JFHA 4A3QA 1DJWA 4GH3A 3IJ7A 3REQA 1NHQA 2UY5A 3WEOA 3H70A 5AC6A 2JGQA 5A2AA 1QNPA 4O54A 1G7UA 2PTWA 4P5UA 5D9OA 2GOKA 3L0KA 5HOSA 3ITXA 1EXBA 3B3DA 2GVGA 3OIXA 1EP3A 4AD2A 1S2AA 4R88A 2HE5A 3AICA 3CWHA 4XG1A 5FF3A 4DPQA 4H3DA 3DXIA 3A9BA 1EPXA 2W4XA 1JPHA 3PBYA 2HBXA 3EKGA 4UMAA 2D0GA 2YCIX 4A8RA 1KC7A 3CU2A 2VGGA 3EA2A 3GU2A 1TO3A 3MVIA 5DT5A 1XI3A 4GIAA 4E6MA 1E5NA 2GH5A 3L0NA 3EWXA 3AOFA 3UJ2A 2ZZ5A 5D2YA 3GHSA 1LQ2A 4HPNA 4I9TA 2V5JA 1B30A 4F9DA 3KW3A 4CGTA 2H3DA 4Y2WA 4KGLA 3AC0A 3L4UA 1CGXA 4NRSA 3EXRA 4B9YA 3C4UA 5JIPA 4DXVA 1UJQA 3PPGA 4RE3A 3SCQA 3G2GA 3VA8A 1XC6A 3AXIA 2VVSA 4AD5A 2NQHA 5CSYA 1SPQA 2QDHA 3TQ0A 1AJZA 4NF7A 1JCXA 1JPDX 3R0DA 5I06A 3WJSA 2VRQA 3GRSA 5JH2A 1ISZA 4O4VA 4Y9MA 4OTKA 1FWCC 1WAWA 1A53A 3W53A 4LX4A 1ZJHA 2EF9A 1M65A 3ZVHA 2GWNA 2QIWA 3OQEA 1TMLA 4IIHA 1OIMA 4ZQNA 3WDPP 2PDHA 1TJPA 1W5MA 3QTPA 4JNMA 3VOJA 4PSPA 3N3TA 2HROA 1VLIA 1JYWA 2NQZA 1I4NA 4HN4A 3V0SA 2Y2WA 3BMXA 3HQNA 5FJUA 2EQDA 1V3LA 2OZ8A 3OVQA 5EL1A 4JTKA 5REQA 4B5TA 1UBPC 1YADA 1EFZA 1L6GA 4MB4A 4XAZA 1AQHA 3WMBA 1QHZA 5CZSA 4FOKA 3LLDA 4JAWA 1FHDA 1Q8JA 1D3HA 5C5YA 3FVMA 1NARA 3G1AA 3MUY1 4H6RA 2DPEA 4LJ3A 4Q32A 4UBPC 4BWLC 5D4YA 1YLVA 4TVDA 2Z29A 2DUZA 1HQTA 1Z3NA 1A5BA 1N63C 3UJSA 1U5HA 3IAQA 1D3GA 5E93A 3SCTA 3T07A 1CDGA 4GUHA 4IPJA 4CVUA 3NXFA 4N02A 3B8DA 4ZE4A 1LWJA 3AO0A 3I3EA 4WGXA 5AHLA 3LSBA 4AH7A 3BV4A 1UQZA 2OSXA 4Q4OA 1H0IA 1MFVA 3ITGA 3GB6A 2QUVA 3F4CA 3D0CA 1M6IA 3CPRA 3T40A 5BYWA 1VD6A 1U30A 4X60A 4YTTA 3GG7A 5U1OA 3ONBA 1B2YA 2RHGA 1Q2SA 3DIPA 3ICJA 3NPWA 4KW2A 4CN1A 4UTWC 1NWSA 1PVNA 3COTA 3TDFA 1CWYA 3RLVA 5LIUX 3UCCA 4IL2A 1W31A 4P2VA 2CBUA 3O16A 4NZ4A 2NQLA 1SFTA 1UMYA 1N60C 2B7PA 2J4GA 3GDRA 2P10A 3NQDA 2NVAA 3RM9A 1NPXA 5CGMA 3BAWA 5JCMA 3W2MA 4G1KA 3PPHA 1V3MA 2WP6A 1M01A 4IGHA 2QUMA 2J62A 3ZZ1A 3SN1A 2VX4A 5HJLA 3KOFA 3ZMRA 4BS0A 2QDEA 3ALFA 4JHOA 2DSKA 3RFAA 3S5SA 2VFHA 1H7OA 2X0HA 2NV9A 4Q8MA 4IMAA 4C6OA 3HZ3A 4F0LA 4GRSA 3W7NA 1GEHA 1EC9A 3LRLA 1GXFA 1S2TA 2CHNA 6ALDA 3VNYA 4BF7A 2VMFA 3NQGA 1SO6A 1DJXA 2ZFAA 2MUCA 4D2JA 2FMOA 1GPFA 1E55A 2F38A 5FEXA 3CV6A 3IUHA 4PMRA 5KTLA 4WDTA 5A6BA 3PR2A 1SMAA 2D0HA 1DBTA 4PC8A 1H5YA 2W55A 1SJCA 2Q8ZA 1LDCA 4GY0A 3EOLA 4KEZA 1VH7A 1NAL1 5HA7A 2O7SA 3RU6A 3VYLA 1EBHA 3MZ2A 4DUOA 3G8RA 3W82A 1H2IA 4JN8A 5GQBA 4GBUA 4UUIA 1YXYA 3KE0A 4IFKB 1AW5A 4RX0A 1YNYA 5FF7A 2VURA 1E43A 1ISVA 4S38A 1JF6A 3AIEA 3CJPA 1A50A 4HJFA 1OYAA 4MFEA 5BMWA 4AX6A 3GC4A 2OO6A 5DMYA 4UB9A 5HWMA 2WNZA 3F2DA 3BDKA 5L9FA 3SGUA 1TZZA 1C7SA 2DT0A 4WZHA 1X1ZA 3WNOA 3LERA 4PMDA 1H09A 1OCNA 3HF3A 4KRZA 3E0WA 2X7WA 3TOPA 4ZOHB 2IS7A 1QNOA 4ZODA 3N18A 1WV2A 1JZ4A 3U7BA 2VKZG 3SY8A 1K6WA 3TX9A 1Q2RA 4S3AA 1TREA 3B8UA 2Z1VA 3C52A 4EWND 1CB7B 4LVDA 3QJAA 4H9ZA 1NEYA 2WOWA 3GG1A 3GU9A 3HV8A 2WBAA 4C1NA 3F4VA 1JAKA 3O0FA 1HKJA 1GRBA 2W62A 3PSVA 4NNAA 1PCKA 4TO8A 1C8YA 1PSCA 4P61A 2GSEA 2VT0A 3KBVA 2WJZA 4DM1A 5LIXX 3WQOA 4W86A 2A3AA 3NR0A 5ABGA 1B4KA 5MKGB 3L65A 3M0ZA 1IHIA 2QCLA 1P0EA 1GT8A 3RJXA 1XYFA 3LHWA 5C7VA 1BF2A 1Y65A 3WH5A 1FHVA 1B5TA 2PS2A 4IG2B 3ZO9A 1VS1A 1IEWA 1XGZA 1RLCL 1Y0EA 1XINA 2B7NA 3K8MA 2ISVA 1FWWA 2CHRA 5FF2A 3TJ4A 1ITXA 1ZMCA 2FYMA 1XLDA 1Y5XA 1F74A 4A3HA 4C6NA 3FFSA 1BQGA 1LQAA 2Q8LA 1H50A 2C1HA 4Y9AA 3P8JA 4R7OA 4EMJA 3AHTA 2C13A 4DO6A 3ARWA 5KVIA 2DW6A 4HSOA 3BO9A 3HJEA 3E02A 4PMUA 2FDMA 1ICSA 2G4FA 3J7HA 2NX9A 3VOIA 4DJDC 4HHLA 4KWOA 3CMJA 3GAYA 2VEKA 4GQGA 2WZEA 4N9EA 1AMYA 3OZYA 3Q45A 3BWWA 3QVQA 3VKDA 1EWDA 3WG6A 4B5SA 3N1AA 1ZCOA 4RE0A 2DUAA 2CW6A 4J9JA 1UPPA 4NSBA 3KOXA 2ZUNA 5AZ0A 4K36A 3VFLA 3BVJA 2ZC1A 5HWNA 3KZSA 1SZFA 2WMJA 1WO2A 1GTEA 2UZ9A 4LA1A 3EMCA 3QKEA 4PL1A 2X05A 1CXKA 4A3YA 4HD5A 1XYMA 2PP3A 3H2CA 1W37A 1ADSA 2ZTKA 1OK4A 1THFD 3GUWA 3RLGA 3NQCA 4PCPA 3ZWTA 4CU6A 3S3GA 4K7ZA 4LYQA 3DK4A 4DHGA 4Q33A 3K46A 4XAPA 3MS8A 2PTYA 3LX9A 3FDKA 4L6DA 3T7VA 4WY0B 3UQNA 4HMNA 2WKJA 3AYSA 1NOWA 3L5MA 4ERAA 3G6MA 5JRBA 3CV2A 1TPH1 3GXDA 3S5OA 5T8GA 2PWFA 1EHNA 4QM1A 1BWLA 4Q4KA 3GTHA 3VPLA 1IE7C 4DYEA 2V3EA 1ZU8A 1W17A 1KCKA 1C90A 2HK1A 1MQPA 1TPB1 1V77A 3BW2A 4F0MA 1FWDC 1DXFA 4LS1A 2X1SA 1WE5A 1VC4A 4CNOA 2CNCA 9XIAA 1L6FA 4CEXC 4GACA 2Y4SA 4DBEA 3WQCA 3SEPA 5BXSA 5I79A 2WANA 3HQOA 4YHGA 1VFMA 4Z2KA 2F2HA 3VI2A 2VFEA 2YCLA 2DEPA 1J5TA 2BOEX 1HJXA 2WCSA 1XC4A 3EDFA 3ARPA 1S5NA 4QDWA 1PDYA 3H6OA 3NZ1A 4GUGA 3GKAA 3M0LA 4RE4A 3EWCA 1FA2A 1JD7A 3LADA 1JUEA 8XIAA 3WD3A 1W5OA 4CEUC 1EYWA 1OC6A 4KWSA 4O4WA 3SGZA 2FIQA 4PZVA 3L68A 2VD8A 1H7XA 3WDHA 5D05A 4LPCA 3DFTA 3ORWA 3SSJA 4UQBA 4FS9A 2E3ZA 1KR0A 3AJXA 3SN4A 1YDVA 3LZ5A 4AF0B 3C86A 2HRWA 1FFVC 3E74A 4HPXA 1BQCA 1TSIA 3W7PA 4GK8A 4JEJA 3SB0A 1XH1A 1B3WA 3FYOA 3JUGA 5A94A 3HN3A 3CAQA 3CQJA 2ACQA 2WYSA 3FJNA 1R47A 4UTJA 4DO5A 3NQEA 2GSJA 1FO4A 3U48A 1BHGA 4PA8A 2BOFX 5FEWA 3GR7A 1XCFA 1LL4A 4NZ1A 3BQ6A 1EL3A 3BOLA 4J4KA 1R3WA 3QGVA 3GK0A 2ZYFA 1ECEA 1TV4A 2HS8A 1XRVA 3U7VA 4K7YA 5FSEC 4MJZA 1G4EA 3DGHA 4B5XA 3GX9A 1EEPA 2EG6A 3S0CA 2B31A 1OCBA 4GNVA 1KM1A 2Y8KA 4L65A 3ENLA 1N5XA 3AMDA 5AECA 1R30A 4GJJA 4PBFA 3PBGA 1W1VA 1NELA 3F1QA 4UZUA 4IICA 4C6KA 2REQA 1F3XA 3L23A 4FMVA 3IV8A 4MOZA 4EP8C 3WMSA 3UYCA 2JIWA 3LB8A 2E0PA 4J3VA 4UMBA 4JTJA 3OGSA 2W3ZA 3HPAA 2OWXA 1VCVA 2TRSA 2XVPA 5DF0A 2TSYA 3D3AA 1B90A 5DXXA 4P8VA 1YRRA 4NYUA 3GE7A 4LCSA 3L12A 3BPWA 2O9PA 4OHQA 2WMKA 3WD4A 3DGZA 3TN4A 4V1YA 3VM5A 4N6EA 3KTXA 2ONEA 3GNRA 1AH4A 2Z1XA 3QGKC 3E0VA 2GGJA 3WQ4A 2CCRA 4AVOA 2J7GA 2V9DA 3IPWA 4X61A 1W91A 3AI0A 3SY1A 1QT1A 1Z48A 3SCVA 2DT2A 2J24A 4WOZA 5CC3A 3MTWA 3C2OA 2X30A 4M29A 5G1TA 1QOPA 5LZLA 2BODX 2NUWA 4UTWA 2EBNA 4IPIA 5C9RA 2ZZCA 4UFLA 2XG9A 3S2NA 3N25A 4H4ZA 1RHCA 4U3AA 1BFNA 1PKLA 4LY8A 2PGEA 2CLLA 1DJGA 4H9TA 1YQ2A 4A4AA 4H7ZA 3VZZA 3AS2A 5HUOA 2NPXA 3N6JA 1GYNA 1XPGA 1GVIA 3NVDA 2DZTA 2YVGA 4M24A 3TAOA 4GOAA 3DKJA 4DYKA 4MVAA 3S4TA 1JNDA 1N8IA 2J6VA 4UQDA 4AWEA 5DFAA 5T9CE 2Z2UA 1XGDA 3K13A 1Z42A 1DEDA 3TQKA 3M5XA 3OU8A 4MNMA 4AEFA 3M7SA 1Q3NA 5B80A 1KRMA 1RD6A 1VBJA 3LXBA 4LUTA 5I3GA 2HTMA 1XIDA 4K37A 3V5OA 3GVGA 1Q4NX 4DB7A 1BSLA 1KV8A 4TU1A 1L2QA 4N4PA 1E6ZA 3D6NA 1E4NA 4JCLA 3MP3A 4TVYA 2DH3A 3KM8A 4DWSB 3F03K 3C6CA 4JY9A 1UWUA 2W66A 4CVWA 5CAHA 5LYRA 1CIUA 3GNDA 4E2OA 4ALDA 2CLHA 3LGDA 2G97A 1E1FA 1XQKA 4X0VA 2E77A 1LRNA 1G94A 5ABFB 4Q8NA 2F2KA 4G2DA 3ZR4A 2OB3A 2AKZA 1IWAA 4GY1A 1M7PA 3E96A 4XK2A 1YTKA 3LGGA 4ZOAA 1OADA 4ML4A 3FXGA 1JGIA 4N0RA 4KT2A 1B4EA 4KEMA 3WLRA 4TX9A 3RF9A 3BICA 1OG6A 3BL3A 2EEXA 1MRQA 4KS0A 3VNMA 1DV7A 4AY7A 1C29A 3GIPA 4ILSA 2OYMA 3EGJA 3QYQA 2GGHA 4CUCA 4CCZA 1J6OA 1IR2A 3CM4A 1ML1A 2XIOA 5XIAA 1HO4A 1FDJA 3PBWA 1T40A 3SCRA 1ISWA 5KITA 2YA0A 2ZUWA 4WOQA 3CYVA 1TRIA 4Z2IA 4BQ2A 3RRAA 3FA4A 1OFBA 3I65A 1GK8A 4KF1A 4ADTA 3SCSA 1GNXA 4C5ZA 1Q6CA 4PTDA 4E4UA 1TUFA 1W5NA 4FNRA 3WF4A 1CX9A 1V3KA 3CUJA 2HPMA 3PWAA 3W26A 2HV5A 4S3JA 1PWMA 2VZOA 1KXHA 1BXNA 3M5VA 3SN0A 4K3ZA 4US6A 3V0TA 2P5NA 4AW7A 3MU7A 4E4PA 2XGIA 1H5VA 3WN6A 3P2VA 2FZNA 3EB2A 3PNZA 3THDA 4ZB0A 1UIOA 3PUOA 1KRAC 3HPZA 3NUKA 3R0KA 1MXGA 3RJYA 1JCMP 1XWYA 1VPYA 3AN1A 4WXZA 3KUMA 4C6PA 1XL9A 3WH6A 1OYCA 1OF6A 3H26A 2V6OA 4M52A 3MP4A 3JVAA 1EBGA 4V27A 3GDMA 2CC0A 3RR1A 4CD8A 4Q8TA 4ATDA 5H8UA 4UFHA 3WLIA 3GD3A 2BFGA 1IGWA 4ATLA 5G5GB 1A3XA 3GTNA 3M5YA 1WB0A 3ITOA 3HBLA 4RW3A 5LA1A 3URBA 2V2DA 4G7EA 4WF7A 4LB4A 3SCNA 4LAOA 5FA5A 1JI2A 1OX4B 5A1AA 1TJRA 1JJKA 1PYFA 4ORMA 2OZ0A 4QJ3B 5JXQA 1GG0A 4LC6A 4X22A 1VJSA 3MSRA 3H4GA 1R46A 4LUJA 3E0LA 4F8XA 3MI3A 4YXGA 2YX0A 3CV7A 4OFCA 1KV5A 1DKWA 4DJDA 4W87A 2FDSA 4N9DA 1I0DA 3BUVA 1N62C 1MEIA 4UWMA 3KHDA 4UZSA 2HE8A 5LGZA 2GR2A 1GVRA 4CD7A 2GJXA 2W0UA 1WKDA 2J77A 3TYAA 4M8UA 4LANA 4U33A 5IFPA 2D1ZA 3SDOA 4C60A 4I5XA 1SJDA 2XVNA 3OLDA 4LTSA 1P0BA 1R38A 3VD7A 3W7QA 1F2JA 1EIXA 1JNEA 2F6XA 2J6XA 2QGHA 4NJKA 3PZNA 1KTBA 4YJ5A 2X1IA 4UOJA 4GUFA 3POHA 4O0KA 1H60A 4EPBC 1V0KA 1VHNA 4DJFC 2XISA 2Z2AA 3N11A 2YXXA 5J5RA 2DH2A 4O1FA 4CNNA 1NVMA 1DVJA 2NSXA 1LL7A 4PGLA 2HEJA 1Q5MA 4AC1X 2YZ5A 3IUIA 3R10A 3A21A 4C6LA 3TA9A 3ITVA 2CFFA 2XFRA 3C0QA 1FUYA 1P6CA 3THQA 1VKFA 4LRTA 4GCXA 4H1ZA 1V97A 1G1YA 1GW9A 4XZ9A 1R85A 2XSBA 1EB3A 5BRQA 4ZOEA 4WJXA 4LBUA 2GSHA 3PAOA 4F3HA 4PMVA 1H6VA 5FS7A 2A7NA 2XWDA 1MYRA 1S1RA 3ABSA 1WXZA 1B9BA 3LPGA 1H7WA 3WLHA 3O2LA 3B9NA 5HNNA 1IXNA 1VF8A 4BZYA 4GIYA 3LBCA 3JZEA 2BC0A 5I07A 1WYIA 4JIRA 3RN6A 4J7RA 1K6AA 3WMCA 2BGNE 3L67A 5F2LA 2E40A 3QV8A 4FIQA 1R7OA 4Y9PA 3IVSA 2VR5A 2H3BA 3LPPA 2DFAA 3M7WA 4EM3A 2POZA 4PUUA 1KFLA 3P14A 3WFLA 5KEZA 3VAVA 4C6MA 2WMIA 1J01A 3DFQA 4RXGA 3TJLA 2D69A 3R4IA 3NZPA 2XWEA 3AROA 5FF0A 2XM1A 1LT7A 1NTHA 4P8XA 3UWYA 1TV5A 2BS9A 3TVAA 3AZSA 3GVQA 5A6KA 1XH2A 5D37A 4UCGA 3H55A 3OBAA 3D46A 5HMSA 4HYWA 4AEEA 2QVHA 4CQ8A 2NT0A 3R12A 1VYSX 4TXEA 1O60A 4HOXA 1RQBA 1L6SA 5A6JA 2CITA 1FHUA 4FNQA 5BRBA 3GH5A 1ZBVA 4TX8A 1XYBA 3W00A 4EX4A 4XZIA 3GTIA 1TX0A 3OTRA 3L2LA 2VQTA 2DUXA 1QBBA 3T05A 3G6LA 3VKJA 1JCJA 1GQIA 2PBOA 4C6CA 5GPRA 3QSRA 4NXSA 4GXWA 4ONVA 2IQDA 2YOCA 3ARRA 4PR4A 5D38A 1XFBA 2J7EA 1QPRA 5FS6A 1NP0A 3GFYA 4LVGA 4FPSA 1ME7A 4LW7A 3ZWSA 8CGTA 2PDUA 1OEPA 1Q7MA 2F6UA 3EDKA 3VZXA 1RJPA 1V7YA 1JZ5A 1KR1A 5CJMA 3VC5A 2WKGA 2YPIA 3KOZA 4HT3A 4N7QA 1S5MA 4FNSA 1UD3A 1UROA 3L9CA 5AHMA 3TLQA 1W9DM 4WCJA 1I1XA 5A6SA 1DTNA 3W87A 2FVKA 4TVWA 1ICQA 1HNYA 4UNKA 2FTYA 1MQQA 1GZ1A 4QBXA 1GW1A 3VUSA 4DX3A 1LZOA 4JTQA 4BK9A 3LCWA 3W7EA 1J0YA 1RUSA 4H41A 4RV8A 3WSUA 5RUBA 2Y7FA 1CLKA 2PDFA 4Q22A 3SURA 3REQB 5E6YA 2BZNA 4HZMA 4AC7C 3EDEA 5T26A 2CZVA 5LIKX 3A7UA 1IR1A 3OGVA 3UWQA 4HIBA 3W74A 1LQ0A 3TTEA 2DVTA 2HCVA 1E0VA 4XAFA 1XBZA 1MZRA 5CG0A 4WDUA 1KKOA 5AYXA 1W32A 4DYJA 3DHUA 1NHPA 2D2GA 3AMZA 2V2HA 1PTGA 3TR2A 2D2JA 1U83A 4WKHA 5E5CA 5DT7A 4R7WA 3CXBA 1XLCA 3AXHA 4G9PA 1DIOA 4IJBA 3ITTA 2D2HA 3T0AA 2JK6A 3BARA 3NURA 4MWAA 4H19A 4KEVA 4H6KA 1J79A 3MI6A 2J78A 1V5XA 1O5RA 4ATWA 1QI3A 1GOXA 5FSDC 4IFOA 3W2NA 1EJSC 4JD4A 2VGFA 1VBUA 1TYTA 3TYBA 2V82A 1UD6A 1HT6A 1VYPX 1RA0A 1JOAA 1KNWA 4UFMA 2E5BA 3TTYA 4PTWA 4W8LA 2GR3A 1V8EA 2BP1A 3VDAA 2BGSA 3STEA 4RDYA 1FECA 4PFHA 1VRXA 1XHGA 4J40A 4C1LA 3MHUA 2NQ5A 1GOOA 3KCOA 3A24A 3GNXA 2C0HA 2RFGA 2WVUA 4MZ8A 3QR3A 3R89A 5MHBA 3P0WA 3P8IA 5I02A 3K2GA 4QE1A 5JIWA 1CXHA 3G1FA 3ZVHB 4C5YA 2G50A 3H4WA 1P0DA 3HQ1A 2QPUA 4O52A 2AGKA 3TK7A 4PUNA 3WLNA 1XBYA 3TMQA 4PEKA 4NUWA 1RBOB 1QASA 5DANA 5REQB 3CUFA 4WJ8A 2E25A 4Z2GA 2WPEA 4L4OA 3CK5A 2CLKA 2XGBA 4S39A 3OJGA 5AYZA 3WK1A 2ZCGA 4I90A 5BOFA 1NU5A 4Z2HA 1E73M 4P7LA 3M0JA 4IMGA 3HIJA 3UR2A 3BTNA 4NXKA 1MSSA 3E12A 2P8CA 4MDPA 2OGJA 1YTDA 2VL4A 3QF0A 3R1ZA 3G22A 1CGUA 1SFJA 4AZ6A 3KZPA 1F6PA 1EZWA 3DBNA 3EA1A 3WBEA 2EG8A 2JF6A 2FZ9A 3GW3A 2AL2B 4C6DA 1WKEA 3W22A 4XZWA 2ZA3A 1XCWA 4JIIX 4M6UA 3OB8A 3IJ6A 4DBDA 1IWPA 4NZCA 4GI6A 4E2VA 5C9XA 1F3WA 1YPIA 1XIEA 4GKTA 3U5YA 5HMDA 4YNGA 2YR1A 4ZMGA 1U5JA 5I0DA 4LBRA 1LG2A 1WNOA 4J2MA 3W2LA 2W67A 1SJBA 4HNUA 4H8HA 4E8CA 4MJ4A 1HUVA 3SCUA 1E9ZB 4PMYA 4YWIA 3ZXWA 1FXQA 2FB3A 3ZJKA 1HTIA 1WUEA 1LPFA 4AUBA 1FX6A 4HNOA 1OJTA 1A5OC 4B4HA 1D7YA 1M7OA 1YX1A 3ANVA 4WEVX 5AHEA 2TAAA 3WK2A 3WBWA 1ZJBA 4EPKA 1LBFA 2DZXA 4L4LA 1OD8A 3QY7A 2GK1B 4EMWA 3W02A 2YDRA 5EBAA 1IEXA 4K7VA 2BBFA 4ZXLA 3QKZA 3W28A 3A64A 4CKQA 2D24A 5BCAA 3QRHA 4EIVA 1RY0A 2CZFA 4HZ7A 1V3HA 2JFEX 4KETA 3A6OA 3TYDA 5HPOA 3UWVA 4M0XA 3O9NA 3EKLA 5K9XA 1GOWA 3FYPA 5D32A 2PRHA 2Y88A 1R87A 3THAA 3RPDA 4F0RA 2GR1A 4OQVA 1W2PA 1EJXC 1XBVA 2PF8A 4JTTA 3GIQA 4MTVA 1DWJM 2V3FA 4PMZA 6TIMA 3H21A 4UR9A 1MMFA 3VCRA 4ICMA 3EOUA 3GXMA 4NI8A 2ZRZA 3U9IA 1Y7VA 3IK2A 2WKLA 4W7VA 4GA8A 4YTRA 4HZ6A 1TJ1A 3O8AA 1HG3A 4ZB2A 3HU7A 4WVXA 2VO5A 5AZ1A 4JIPA 3BLDA 5CJ5A 2A3CA 2W9MA 1H1ZA 4OBRA 1S3HA 3TQPA 3PF3A 1OB0A 2WBGA 3GXNA 3IJIA 4DJFA 1Q6RA 3ZR6A 3WLPA 2OOFA 4NAFB 1O12A 2OOGA 2J25A 4NI3A 4D1JA 3W85A 1BTMA 5I7GA 1J2WA 3B0VC 1P5BA 5EMJA 4QJ1A 1CGVA 4MB1A 4NZ3A 2EKGA 7CGTA 5JVLA 3E2SA 3IC9A 3ARZA 1VIWA 1EJTC 4FK9A 1BSIA 3M4HA 4PN2A 2PWDA 3W7GA 1QWKA 2OFJA 5C7HA 4GWEA 4XB3A 4D6DA 2HVNA 3KFTA 2QCMA 1OFQA 1KBLA 1SSGA 4Y9OA 4DO7A 3CC1A 4UR7A 3CB8A 1KW1A 1BEUA 2DJXA 1W1IE 2ZUSA 4GGBA 4DBUA 1LOQA 4K68A 5M1TA 1HVXA 4N9BA 3UR7A 5BOEA 2WM0A 1DQUA 1UH3A 3D47A 3VNDA 5C9UA 1XLMA 2TMDA 2QCNA 3MC5A 5HINA 5AC8A 1HKVA 3PJWA 1LUCA 4O17A 1U5VA 3OHMB 2FZDA 1N2VA 1FRBA 1F73A 1R2TA 3KRSA 4OE7A 1X1NA 3OZMA 3DOPA 1CLVA 3LS9A 1RQHA 1FWFC 1JF5A 4DVOA 1IZJA 1UC5A 2X0YA 4F48A 5G2WA 3HPSA 4DF0A 4W5ZA 4U28A 5A8OA 2EO7A 1EEXA 3F2CA 5I6SA 1NOUA 4KFOA 4FB7A 2D2OA 1ZKQA 3E49A 4HPHA 1U22A 5FEZA 1WX0A 3ITLA 4M81A 1V03A 2P76A 1M6JA 3T0TA 4NJIA 3VM7A 1I1WA 1C93A 1BTCA 4HU3A 2G96A 1SW7A 5E70A 3H22A 5FD0A 3CS2A 1HN1A 4I9JA 3II1A 2V3GA 4NX0A 4YYFA 3RLHA 3S1VA 4EAYA 8RUCA 5FOOA 4C90A 3WZ0E 2CDUA 1K9TA 3DG7A 1OIFA 2OX4A 5BWAA 3O1NA 1DWIM 4UFIA 4DUXA 4IIEA 3EA3A 4IISA 4M7TA 2VEFA 4Z08A 3QZEA 2G3FA 4BI6A 5U7SA 3K4WA 4MY9A 1IYXA 1UD4A 1WBJA 2YW4A 1K8ZA 3F5JA 3U57A 1HKIA 4FXRA 1UR1A 4C7GA 3M0VA 4GJIA 3WLKX 1YKWA 3S6OA 3U6WA 1M53A 3RX3A 2WPCA 3ZOAA 1N61C 1R3SA 4MPQA 2ZICA 4DAIA 3PUGA 3EOEA 2QJGA 1TX2A 4NZ5A 4Q4QA 3URAA 4RNJA 3UCDA 4L1XA 1GKRA 3IJQA 3PBVA 4WY0F 3QH2A 5I3JA 1CEOA 1QFEA 1P0NA 4PH6A 4DJEC 2VC5A 4Q7BA 4AYGA 1GRFA 3GZAA 1BVZA 2PZNA 3MI2A 3FA3A 4IXHA 3QV7A 5HANA 1EA9C 2ALRA 4IOTA 1OYBA 2WOIA 3DHFA 1OBAA 3G1RA 1SO5A 3VGHA 2XHYA 5D2WA 2MNRA 5A8QA 1DE6A 4RXFA 2VM8A 5DXYA 4QJ4B 3U3HA 4ROQA 4ZFMA 1LM1A 2QQ6A 1UZHA 1HGYA 2AQWA 3I4EA 3KAOA 1F8MA 3BG5A 1Q8AA 3TCEA 1I9CB 8XIMA 3WQWA 2OX1A 4JX4A 2WPFA 4APNA 4DNHA 3AIUA 5AYIA 4D6FA 5A3HA 4BI7A 1DL3A 5I00A 3LLXA 3AMLA 2QJHA 4IMCA 1JYNA 1C8VA 3IUDA 4LYPA 1GRAA 1EHAA 5ABEA 5G1YA 2E7FA 3ZLHA 3SFKA 3AJ7A 2BY1A 1JI1A 3TNOA 1YHTA 3MA8A 3MUAA 4PBGA 3K30A 5C71A 4KERA 5FS8A 5BU6A 1A80A 2XPKA 2GL5A 1A0DA 2XUCA 4EQRA 2ZRWA 2FLIA 4CCEA 4DRSA 4O10A 1Z41A 3B03A 4E8GA 5DRIA 1P4CA 3G0XA 3VNKA 2JIEA 2YL8A 1OSEA 1UASA 5TIMA 4BHYA 3ZT6A 4UCFA 1ZJIA 3CQHA 3WJWA 2ZDSA 1DIKA 2DW7A 4H9UA 1T99A 1QATA 2DSVA 1QNVA 1F7BA 1ZY8A 3V36A 4TQTA 4W7UA 4QS6A 2B4GA 2A7PA 3AMGA 3I7SA 1JDCA 2P3ZA 4V1XA 2OR2A 5H8MA 4EK7A 3M0YA 5CBJA 3LQGA 3CO8A 4XD3A 3AHZA 3DHPA 2OLSA 2I14A 1T41A 2G5WA 1TJ2A 2ZZ1A 3LRMA 3GDTA 2OEMA 3TXZA 1UUMA 4J3SA 1VBGA 1J9YA 3ZLGA 1W9XA 5C2CA 4FNTA 1D7FA 2ZX5A 2ZUUA 3VNZA 3UA3A 4AWTA 2OO0A 1G7VA 3W1MA 4LU0A 4W89A 4I3GA 2HXTA 2R1LA 2AAMA 3N4FA 3OG2A 2ZX6A 2FFIA 1O5QA 3PFMA 3PZOA 3CQKA 3QHMA 4Z1CA 2E67A 4OECA 2J75A 3GVRA 4F2TA 4QSHA 3TNBA 1YE6A 5GNZA 4C7FA 1R9YA 5H1WA 5DQPA 4DAFA 2PTDA 3N2OA 4IP4A 3W73A 2VFGA 3G77A 1RK5A 5DN1A 1SFSA 5ABTA 1QMLA 3EXSA 5HAOA 3WQ8A 1NWTA 3ZFHA 5H8PA 1H51A 3FN9A 4ECLA 1XBXA 1JULA 2ZZ0A 2YLLA 2PCEA 4FXSA 1XIFA 2WOVA 2X1RA 2VX7A 2J7BA 7REQB 2C19A 2XFWA 1Q1WA 3M43A 3MKVA 5FJPA 4DNMA 1XUZA 4KWVA 2Y6ZA 2CLFA 2PLJA 4HGXA 2ZQ0A 1M7JA 4TOQA 5IBXC 1ESWA 1VCGA 1CYGA 3C2YA 3A4JA 4FZIA 3EOOA 3B8IA 3G24A 4XUGA 4OOUA 1GONA 2C6QA 2WSKA 4O19A 2I16A 1UWSA 3LHUA 1VR6A 3F4WA 3U5UA 5C0QA 1Q63A 4OGZA 2ATMA 4DLFA 2I9UA 4FOUA 1PXGA 1XLKA 4JL1A 1F8WA 5FAGA 1XICA 3QMTA 1ADDA 4K8HA 4YN5A 4LUTB 4B9ZA 3MMWA 4LAKA 5D9NA 1XYZA 2ZDRA 2PU1A 1E40A 3HM7A 4DO4A 3NO3A 2W63A 1ONWA 3OZOA 4BY3A 4H4PA 4UR8A 3TSDA 4UXDA 1KD0A 1LOLA 3VILA 3GZ3A 3QZ6A 4UQAA 2GGIA 2Z25A 4US5A 1IT0A 3EPNA 1WDSA 4IFRA 4H8NA 4LWWA 4CN6A 3N2XA 1GKQA 5LA2A 1K02A 3JR2A 1TR1A 1MQRA 3PPFA 2ATSA 5TNVA 3XISA 1Z44A 3QOMA 4AIEA 3KVLA 4S3BA 2A2IA 3WO8A 4B3LA 3PG8A 4FLQA 2DVXA 4JDBA 4K6AA 3NM1A 2H9AA 2PC4A 3TYEA 4S3CA 1E6PA 2XIQA 4BKNA 3T44A 2V5DA 4HVXA 2RDTA 5IOBA 1KGWA 5HPCA 1DJNA 5EYWA 1BGGA 1UOZA 1A0EA 7PTDA 3MCOA 4FF7A 4JQAA 2Y8VA 3MANA 4HNNA 3VDBA 3L2IA 1LVLA 1A47A 1D3CA 3VOHA 2GR0A 4FI4A 4XBKA 1GOMA 4YTSA 2QW5A 3WLLA 2ALDA 2GUUA 1X8FA 2YCEA 3WH7A 4H9YA 2RH9A 2B81A 3LHZA 4ZEPA 2QJJA 2E68A 1WZLA 4Z42C 3EWWA 2XINA 3ETRB 1Q6GA 4LVAA 4AISA 4NAEA 5DY3A 3V18A 1V6TA 1QRQA 4FAMA 4YHEA 4AVNA 4PTMA 4DZAA 1CB2A 2X1UA 3MBFA 4W5UA 2CZDA 3M5ZA 1R3QA 2XN2A 4IMDA 4L1GA 1UZ4A 4PE8A 2ISFA 4KIRA 1DE5A 2QUNA 3BLEA 5CBBA 1G5AA 3M1ZA 3QPZA 2ACRA 4JPGA 4XISA 1RBLA 4L9ZA 3BGJA 5LHEA 1FWGC 2QCFA 2GQ3A 2WSYA 1VFSA 1E1CA 5HNTA 4MY8A 3OYZA 4V2XA 2WWCA 3DN5A 3CHDA 2DZAA 2NQJA 4EM4A 3HFYA 1UP2A 2ZX9A 4AVFA 4YVVA 3UEQA 4EACA 1K1DA 2ISWA 1UKSA 1HJQA 1EQCA 1JVNA 1O68A 4H2HA 1MW2A 3W81A 2ZXAA 1BKSA 4B4FA 3KRZA 1KFJA 2FHCA 4XUYA 1GOQA 2BOGX 3SJ3A 1XRTA 2QKFA 1R9XA 2E9MA 3VO0A 1XD1A 4I6VA 2KZHA 5K2ZA 4AZCA 2GJXB 1FVPA 1PS9A 3Q37A 3WQGA 3FOKA 3FAWA 4KMQA 2EG7A 5CPQA 5A8MA 1QPOA 3B8WA 2DSUA 1UPMB 3DECA 1EH9A 4IJCA 3LHYA 4JTSA 4YLWA 3A7RA 3L7RA 1DTUA 5ENLA 4PCTA 3ANYA 3P61A 1ZBKA 2WOQA 3M0HA 4GG9A 1JG9A 3CZ8A 1ZALA 2P53A 2QCHA 3MMDA 3CNYA 5DELA 5E0CA 4H6EA 4IPPA 1B54A 3UXIA 2BV9A 2IQTA 2WHKA 1E3ZA 1WDDA 3BK0A 4WR3A 4PMNA 1XIIA 3HB9A 2YLAA 2DU2A 2D73A 3IEBA 4IIDA 5D2TA 3CBWA 1IXOA 4JTFA 2E1DA 2CFYA 2ZXQA 4HU0A 3NQBA 3WQDA 2XIBA 4GCAA 3BGAA 1J8VA 3UVIA 2VQUA 1O7AA 1EX5A 4ZCWA 1LROA 4UTLA 1OT2A 3EDDA 4U5IA 1IT8A 1KM4A 1NM9A 5EMMA 2V63A 4MY1A 3VKBA 3WJYA 3EAOA 1PTDA 2BHZA 3CIVA 1W54A 2A3EA 1QJWA 3BCFA 1TA3A 4LUIA 3RR4A 2VJXA 3S1GA 2QJMA 1ME9A 5ABHA 1A5CA 2DZWA 4C91A 3STCA 1WPCA 3O6DA 4MKSA 3UU0A 1ONXA 2YW3A 2PUZA 2PEVA 3WNLA 2P3EA 3FKKA 1K4HA 4IPNB 4KCTA 2GQ8A 3LD5A 3AZTA 3GLCA 2P50A 1PKNA 4PTVA 5HK4A 3TP4A 2WMIB 3HA1A 4IM4A 4A8NA 3BW3A 5IM51 1KB3A 3WQEA 3NQ2A 3QQ0A 1PCWA 3HW2A 4GHRA 3NQ8A 4PMXA 1XGEA 5DBUA 2YFOA 1AQFA 2VP8A 2XJ7A 1H7RA 4B16A 3SADA 3FEQA 2X09A 3W6LA 1DJHA 4JTDA 3TONA 2E9BA 2DQWA 3NM3A 2ZX8A 4LCRA 4BA0A 4DIAA 2GQWA 3LV6A 4LVBA 2VYOA 4JR5A 4QE5A 1P6BA 5I03A 1RV8A 5IRPA 3O6YX 4IX2A 2PD9A 1M3UA 2H8ZA 5F7UA 3CB3A 3WF0A 3QQ1A 2FKPA 2QZRA 3JU2A 3ONCA 1AOGA 4GQ0A 4W7WA 1UWTA 4ZQCA 4XZHA 2BNJA 4B92A 3RM4A 4YIWA 2J7CA 3E2QA 3WDRA 4EXAA 4E4FA 4QNEA 2ZUVA 3N2CA 2NV1A 1N5WC 1XJBA 1BVNP 2GLKA 4NJJA 4JTLA 4KESA 4PRWA 4LC8A 4I7WA 1KCXA 2GDVA 2Y5SA 3E3HA 2X8RA 1M04A 4NNBA 4HSHA 4TR9A 3QMSA 3S9IA 2CBJA 3GG0A 1QWGA 4D1IA 3O63A 4O1AA 3UETA 4MHBA 3G3MA 1UWAA 2IKIA 1P0KA 1SO4A 1X6LA 3IK4A 2PDJA 4MGGA 1J12A 2QUTA 1REQB 3LXDA 3CUZA 5DMLA 3KBMA 3ARXA 4TIMA 3V4BA 2OGYA 1NOFA 3OG3A 4HOZA 2XYLA 3UD6A 3PWIA 5F4XA 1EJVC 3VCNA 2YBTA 5PTDA 2XH0A 1RPKA 5EBUA 1YYAA 4IP5A 1OX6A 1IT7A 3VIPA 3CH9A 3RLUA 2F61A 1X7FA 2WCGA 3WQ6A 3T1GA 1UWIA 4ZOBA 5JMUA 1XH0A 2R9RA 2CETA 1ZNNA 3V35A 3K8KA 1JZ8A 3BJFA 2BHUA 2OWWA 1XPYA 5FIPA 2ANUA 2AOSA 1QPQA 4DPPA 1W56A 3L0GA 4O1BA 1EPVA 2VEPA 4PEEA 4TMBA 2FGLA 3DFNA 5GNXA 5G4HC 3TC7A 4MADA 1BXBA 3A4XA 2W61A 4LYKA 4QROA 1ZFJA 4HU4A 3PBUA 1E9LA 3PTDA 2H90A 3QOKA 4KH2A 3LPOA 4H6QA 4DBWA 4X0NA 2W6RA 4IIBA 4K1WA 1BLIA 1V59A 5KZEA 1W5PA 2QAEA 3NEVA 4XZLX 3FEMA 3SQLA 1MO9A 1C8XA 2OTDA 1ZENA 2PP0A 1S2WA 5M2FX 4ZTXA 3EXTA 4LALA 4LUYA 4KPRA 1TVLA 2E4TA 3M6YA 1S5TA 4G5DA 2HDJA 5AKQA 1E56A 3WNNA 3R5EA 2NX3A 4UMCA 3F7JA 4ACYA 3DU0A 1POJA 4AY8A 3N6QA 2WPBA 2OG9A 4A35A 3HQPA 4HJWA 4OWGA 5FEPA 1RXOB 1I2PA 1AK5A 1JYXA 3WY1A 2ADAA 2WMGA 4NT0A 3M47A 1JEHA 1YPXA 2EPOA 4JTEA 1FH9A 3B0YA 4Q4SA 3OLEA 2WZHA 4O8AA 3W29A 4JKKA 4S3EA 2CIPA 3CEPA 2VFDA 4XIMA 3P62A 1X8CA 1T96A 3L4VA 4LF2A 1EP1A 5T9BG 4N6FA 4TV6A 5F2IA 1X38A 4U10A 1QO2A 4FR6A 1UKQA 2YSWA 4DWSC 4Q8QA 3I3DA 4LV4A 3W3OA 1QI4A 3V5CA 1W6TA 4GABA 3VIFA 2ZA1A 1WZKA 5H2ZA 1K8XA 2O55A 3UT0A 1RAKA 3UP8A 2UY4A 2C1IA 4XD6A 3G1DA 5AOUA 4Z1YA 4INFA 1QPNA 1GG1A 3BAXA 1XDLA 3TEVA 4R33A 4IFKA 3WLJA 3WLSA 3N2TA 4LB3A 3UZWA 1R3VA 3N2BA 5D8ZA 1W0MA 1W3JA 1HX0A 5A95A 1OHLA 1OGSA 4K8DA 4BEUA 1XDJA 4O8RA 4HYVA 2QGYA 4H7CA 4XQ6A 4HB7A 3VDCA 2Z27A 3I7RA 1FKWA 4BEQA 2QV4A 2RUSA 1A5MC 4M6PA 4Q6JA 1JDFA 4IQEA 5FKYA 4HA3A 5JH1A 1GEQA 7TAAA 1RQEA 2POTA 3WFAA 1EP2A 4NILA 1BWCA 3P67A 1GOIA 1MEWA 3MDUA 1YNQA 4MIMA 3S1UA 2ZZBA 1KXQA 1OFRA 4W4QA 2FVMA 3IIZA 4MYXA 1N55A 3VGDA 1BXCA 3GH7A 2NQ9A 5C2XA 2YDAA 4LCQA 5EFDA 2OSYA 4GVGA 2PDWA 1VEPA 5F1VA 2UWFA 2GGEA 3RU8X 3TU9A 1UB3A 3VABA 5D9PA 5M3WA 5J04A 2RGLA 2NSOA 3CGCA 1WCGA 2QNEA 3BLPX 1FH8A 1WUFA 1EGZA 4WDWA 3KS6A 5MKGA 1FEAA 4ZO8A 3NL5A 2RDXA 1NWUA 1VHCA 5DMMA 1OGGA 3MB9A 3NQMA 4AX7A 4GINA 2Z7KA 4L56A 3UYIA 5E9XA 1KFKA 1KM3A 5F2MA 4MG4A 4IG2A 1E0UA 4S3GA 5TD4A 1S2CA 1L6YA 5FL1A 3NPUA 1UBSA 1AG1O 3VGGA 3LSCA 1V3IA 4J3ZA 1ZZMA 3W76A 7TIMA 5CC7A 1J18A 4NVTA 3CPGA 4O16A 2VDGA 4IL0A 2GZXA 2EPMX 4MAVA 3HG5A 1O66A 1F9CA 1OFDA 5EMYA 4KWUA 1ZMDA 4I7UA 2B0MA 3SJNA 4MB5A 1IGSA 3FHAA 1W1TA 2IPJA 1NIUA 4ZBCA 2J7HA 2BDQA 1PL9A 3W38A 1OFOA 1SB3B 5EB8A 2XVGA 1YBQB 1H2JA 1JQXA 3B40A 3PVFA 3P0XA 1JCNA 3G1HA 3NZGA 2QCDB 1HZYA 3VD5A 3GM8A 3U4AA 1NF0A 2JALA 1ZUAX 1WQ5A 4KRTA 3AHYA 2DSZA 4NRRA 4Q8OA 2AGTA 1W3KA 4QR6A 3W1AA 3W7HA 5G2IA 5G5HB 4EF8A 1NJJA 3DG3A 3G1XA 1C8QA 1W9PA 2XSXA 1RP9A 1V79A 3LYEA 3GTXA 4NQ1A 4D8ZA 2VZTA 3MSDA 3YPIA 2DZVA 1TCDA 5BU9A 4Q8UA 1X97A 1SMDA 1X2HA 1VZWA 1JZ6A 3TCSA 4WKAA 2XIIA 2VWTA 3A22A 3LA4A 3PTKA 1E4LA 1XLLA 1E1EA 1QPKA 3ZSSA 3W7CA 1UG6A 3NCOA 4QQUA 4PUMA 1GHSA 3SW6A 4WY0A 5A6MA 3CMGA 1M7XA 3EOSA 1V0MA 2A8XA 1BKHA 1EO7A 1KTCA 3V0UA 3LXAA 1XRSA 1XS2A 2A7RA 3PJUA 3NG3A 4M82A 4C6IA 3FGCA 1SZGA 1J0IA 3PB2A 1GZGA 2UY3A 5LNVA 2CWXA 1FHLA 2QAFA 2YGYA 1GKPA 3GR4A 5B7YA 3B4UA 3WNPA 1S2UA 3T4CA 1P1MA 1PZ1A 4OUIA 3O07A 2VC7A 1ITUA 1X39A 3NOEA 5DO8A 3AALA 4YL2A 3GH4A 5LNUA 2I57A 2FJUB 3AYVA 4M19A 4D6CA 3DEQA 1TYGA 1KO0A 3DFPA 3R8GA 1XF0A 3UG4A 1J5SA 3PFRA 2FB2A 3GG8A 3KLKA 1NY1A 2GQ9A 1JL8A 3PTMA 1ODUA 2NWRA 4NZJA 1EJRC 4NU7A 5G5IA 1UP3A 1WKFA 3QY8A 1RCQA 3VIMA 3T09A 4LUSB 4EXBA 1NSJA 3U2EA 1CENA 3L4ZA 1JIBA 4TTUA 1X7IA 3FSTA 2AMXA 3PN8A 3W23A 3TV8A 3TXVA 2GRTA 2CZEA 2DZSA 1MW0A 3WIJA 4XVDA 1ZB5A 3DC8A 4LSBA 5K4XA 3H7RA 4HMDA 1AL7A 3VGEA 4EPDC 5DCDA 1V6VA 1SJAA 1AZ2A 3VMOA 4PCSA 3VNIA 1FFQA 2WMFA 3EAUA 4PFMA 5XINA 1ZRQA 3O05A 4AF0A 3OODA 7ENLA 2WB5A 1FDZA 1QO5A 3DUGA 3G1VA 3GDLA 2Z7GA 4O1DA 4HA0A 3K5XA 5AHNA 1Q65A 3UZXA 3H2MA 2SFPA 3AS3A 4HCHA 5FAJA 3K1GA 4R53A 4JKLA 4QDPA 3BCDA 3FKRA 2C15A 4ZTYA 3PTQA 3W2KA 1GZJA 5AVNA 5I3IA 2YQUA 4MM1A 3EB3A 1KCZA 4BV6A 4RNIA 3H7VA 9XIMA 3L5OA 3Q58A 5BWFA 2OKTA 3TROA 4XSLA 4UNLA 3ZVIA 2PDPA 3FJ4A 3HGJA 2QDGA 4WSHA 4XSMA 1KXTA 3TJXA 4UTTC 3EX2A 1CXFA 2OCZA 4J56A 4QG9A 5A8PA 4POCA 3VDGA 2WHLA 2J74A 3R2GA 4FO4A 1FOBA 4L80A 3LCLA 5IDIA 3T6CA 4AD0A 1HJVA 2ZZ2A 1W1PA 4PUWA 3Q2DA 3TC6A 5I23A 3ZJ8A 3QLDA 4JYFA 3C61A 5I78A 1V6WA 3ME3A 4PUEA 2OT0A 2BXYA 4ZQOA 1MOKA 3H2FA 4JTHA 1WA3A 4MYAA 4AHPA 3PANA 5DCBA 2E6AA 3VIGA 2WVTA 1M5WA 5CG7A 3AWNA 1BG4A 2OSWA 3A9IA 2PU0A 5DY2A 3T9PA 4GO9A 1CLXA 1HIZA 1AW2A 2VEGA 3CZGA 4IXXA 3WLMA 2CEQA 1PPIA 2A85A 5CPNA 5FJOA 4JQ4A 1QK0A 3KTCA 3W1NA 3F2BA 1STZA 5CZTA 3TC3A 4J3UA 3VK5A 1T8QA 1I6NA 1VFTA 1N7KA 2DT3A 1E6SM 3ZT7A 3T08A 1UH2A 4ZA0A 1XP3A 1K4QA 4JQ3A 4F40A 1UC4A 2BCPA 1FBAA 4C6FA 2C14A 2ZOXA 2NW0A 3O0HA 5A6BD 3PULA 3E2RA 5MF5A 2XM2A 2YJQA 2DGAA 4H4WA 4RZ5A 4W8AA 4BQ3A 2G3JA 2O92A 1FQ0A 5XIMA 4DUVA 1DJQA 1J0KA 2Z0IA 2WC7A 3ATYA 4TX6A 4U3CA 1RCOB 1K3UA 1Z32X 5DRCA 1XIHA 3RHGA 1J96A 3GUGA 3HRDC 3AXXA 3ZYZA 4AMCA 3GW0A 1P7TA 1PWLA 1QCWA 3TTQA 2QCGA 1DYSA 1B3XA 4TV5A 3I68A 4CCDA 4LEFA 4RPPA 3NYDA 1M68A 3T4WA 3PB0A 2ON3A 2E8ZA 3S9YA 3IGUA 3CL8A 5TAOA 3PZQA 4DWSA 3WKZA 2CLPA 1UKTA 3QTGA 3FS2A 4QG8A 2PTZA 3E38A 5LA0A 1F05A 4UC5A 1NHRA 1B57A 3TA6A 3NL3A 3CH0A 4UQCA 3MJMA 4A8IA 1ZCCA 3W7DA 1EYEA 4DY1A 3LGEA 4JDRA 1SGJA 1ZBCA 3NZRA 3CGEA 3I4KA 2J88A 3BW4A 2CWNA 3ARVA 2ASHA 4L4PA 3RK8A 1C7TA 1E4MM 4HPJA 2V6AA 3WH8A 2Y62A 2A6LA 3A3WA 1EXPA 3M44A 2XVLA 3W27A 2PDQA 1ONRA 1BAGA 3TFCA 3B8TA 1H1NA 2F7FA 1E70M 5DX7A 4XO7A 4JICA 1KM6A 2R14A 2ZWYA 1DP0A 3G18A 1T5AA 3RO8A 4E2BA 4PULA 3N9RA 5H91A 3N9SA 1KLYA 1PKMA 1GVEA 4LY4A 3DJJA 1FTXA 2G0WA 3VMNA 3SRKA 3RCMA 2Y70A 4KKXA 3KVJA 3R11A 1CCWB 3SO7A 3HJZA 1GRTA 1GVYA 1S5WA 1TPUA 1T6MA 1MW1A 3MUZ1 3TKFA 2RJGA 1G01A 1Q13A 2XVKA 3HG2A 2X99A 2TPSA 3EWUA 3QV9A 1VFFA 1MWOA 2OPJA 3UW6A 1EKOA 1US2A 1FWTA 3FX4A 3IS4A 4O14A 3VNJA 3WH9A 2WLYA 2PDYA 5CLWA 1D8CA 3BQ5A 4BWLA 4B3ZA 5D04C 1LP6A 1SYTA 4OUEA 1ZL1A 3KL5A 2EQ9A 3FIGA 5JUVA 4HHPA 3WYZA 1KM2A 1JDDA 1OM0A 4PUKA 8TIMA 3VZYA 3ZS4A 2O9TA 3ITCA 3QGAC 4XTDA 1KLZA 3NL2A 4A2SA 3AU6A 1KA9F 4O50A 3NPXA 3ELFA 3LUTA 3ZM8A 1KN0A 1TG7A 3CLMA 2VZVA 3E6EA 2QVNA 1B31A 2XZ9A 3GHTA 4QG6A 1VEOA 4GI9A 2YDSA 5GVJA 2WP5A 4L6OA 1JPIA 2E5DA 3MVTA 1F07A 1KWKA 2IKJA 3BLIA 5JCIA 1RJRA 4DQWA 2DORA 2D3NA 2NLYA 4P8UA 3QQWA 2PDMA 1OD0A 2BC1A 4S3DA 3AMCA 1O5KA 2WVVA 1TB3A 3SR6B 1CXEA 4L61A 1K9DA 3ZJ6A 1X6NA 1K03A 3EANA 4JY8A 1EOMA 1UCWA 4PCFA 3KBJA 1XX1A 2EJAA 1F4AA 3CGDA 3UR5A 1I2RA 3KRUA 1JYVA 1GREA 3W72A 2VHLA 3NVTA 1TWSA 3B9EA 3W4RA 1KFWA 3KWXA 4B3KA 1J0HA 3HV9A 3BXWA 4XZNX 4ZOCA 2XZ7A 1S5VA 4I9MA 3EB4A 3WDJA 4HCLA 4A6GA 1OGBA 5JQ9A 4X3ZA 4CNTA 4Y8EA 3KLJA 2FJKA 4D9PA 3OP2A 4R7JA 1XYLA 2YB1A 2OU4A 1QR7A 3V16A 2QXWA 4IJRA 1M03A 1GHRA 4B5VA 3KL3A 2R9ZA 3W37A 4PCNA 2VR4A 4ZO7A 1ZXIC 4N9CA 3EUB3 3DKLA 4L7ZA 4KCVA 5D2VA 2PDKA 4PUJA 3C0LA 1K4GA 3MCMA 3W9ZA 5M5DA 2AKMA 2DDXA 3SUVA 4RNFA 5HMEA 1T7LA 4GR1A 2VGIA 3XIMA 1JCTA 3CAWA 5KZ6A 2QHAA 4QNWA 3SR7A 3N14A 3N12A 3KLLA 2BXZA 3GNPA 1LCOA 3S46A 2RJHA 4JTUA 3QR1A 3W7MA 1R3TA 3CHEA 1W3IA 4M56A 4FOJA 1TELA 1WXJA 5ECVA 1W3HA 1QOXA 1Y5WA 4AMAA 1JGMA 6REQB 2WM1A 4HN8A 4AWUA 4OT7A 1AJ2A 1ISXA 3TIMA 3I6TA 1GYLA 1E0XA 4REQB 5CGTA 3WUEA 2GGGA 5DBTA 4CNSA 3W7RA 2QF8A 2PODA 3P82A 1B0IA 4XAGA 3RGTA 3A5VA 1LTDA 4MJ2A 4JFVA 5KSWA 2VD9A 4W84A 1J10A 1XLAA 2VRKA 4ICCX 2PWVA 3GAKA 3VX0A 4HMEA 3AYRA 2GQAA 4HQVA 4QSFA 1K7EA 1W8SA 2NZLA 3DJGX 4AZCB 2V5KA 3W6MA 3PUDA 3U4FA 2RABA 3UG3A 4ZB5A 3KCLA 4PTXA 3VOGA 1NQ6A 1OF8A 4R5EA 1PE1A 3VGBA 4Q3MA 1FWNA 1BD0A 4JXCA 3S2MA 2F5ZA 1MNSA 4TVCA 3PPCA 4H9XA 4P7RA 5CLTA 3SM0A 2W0HA 3RNMA 4M7SA 4JHZA 2JGYA 1Q7ZA 3UG5A 1UR8A 1JAEA 2C71A 4O1EA 3B0UX 1FWRA 3RDKA 4XVEA 7XIMA 3RMEA 3MV01 4GC3A 1ZHAA 3TN3A 1OG0A 3WDIA 2YDQA 3BANA 4BI5A