3MUCA

Muconate cycloisomerase variant i54v
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
369
structure length
360
Chain Sequence
ALIERIDAIIVDLPTIRQQQTLVVLRVRCSDGVEGIGEATTVGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PROTEIN (MUCONATE CYCLOISOMERASE)
publication title Structural basis for the activity of two muconate cycloisomerase variants toward substituted muconates.
pubmed doi rcsb
total genus 138
structure length 360
sequence length 369
chains with identical sequence B
ec nomenclature ec 5.5.1.1: Muconate cycloisomerase.
pdb deposition date 1998-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3mucA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3mucA01
1MRAA 3QTPA 1XPYA 3RGTA 4HCDA 2XH7A 2PP3A 1KKRA 4M6UA 2OQYA 3UXLA 1SJAA 3OZMA 3VCCA 1KD0A 7ENLA 3UGVA 4DXKA 3S47A 4M0XA 3VFCA 3ZLGA 3RR1A 3DIPA 1L8PA 3VC6A 2PTZA 3RCYA 4E6MA 6ENLA 4A3RA 3DG6A 3DFHA 5IDZA 2PS2A 1FHUA 4H1ZA 3V5CA 1EBHA 3T9PA 2PTXA 3R25A 2HXTA 3UJFA 2PGEA 4JN7A 1KCZA 3N4FA 4IP5A 3GY1A 3DG7A 2XH0A 3ZLHA 2PTWA 2I5QA 3CYJA 3OZYA 4E4FA 4GMEA 1P48A 1TKKA 4G7FA 2OFJA 5ENLA 3DDMA 1NU5A 4KT2A 1WUFA 4E8GA 3V4BA 2PMQA 2QJMA 2PTYA 3FJ4A 5FJPA 2OKTA 2DW7A 1MDRA 3BOXA 3MQTA 4ZCWA 3FV9A 2OLAA 3MY9A 2MUCA 2RDXA 3I6TA 3TOYA 3T4WA 3EEZA 2XH4A 3CK5A 1ELSA 3MKCA 3N6HA 1BQGA 1JPDX 4X2PA 2FKPA 3TWAA 4GFIA 2AL2A 2GGIA 3CB3A 4E5TA 3JW7A 3VCNA 2XSXA 3RO6A 3OTRA 2P8BA 3MSYA 2OZ8A 2PA6A 3U9IA 1F9CA 1TE6A 4HN8A 3V3WA 4HYRA 4G8TA 4GGHA 3MZNA 4F4RA 3UXKA 3VC5A 3D46A 1R0MA 4KWSA 5BOFA 3OP2A 5FJUA 4JHMA 2P3ZA 3Q4DA 4DYEA 4Z17A 4KEMA 3SN0A 4E4UA 4GISA 3D47A 3UJRA 3BSMA 3R0KA 4Z1YA 3ZVHB 1BKHA 2PU1A 3T6CA 3P3BA 3RITA 3SJNA 2PU0A 3B97A 2NQLA 3R1ZA 2QJNA 4MKSA 3UJ2A 3JZUA 4GIRA 3SN4A 1IYXA 1JDFA 1P43A 5J04A 4IT1A 2PP0A 1W6TA 2CHRA 1ECQA 2P8CA 3SN1A 3SSZA 2O56A 2OG9A 2ZC8A 5FJOA 2ZADA 3U4FA 4A6GA 4HCLA 3S5SA 1OEPA 3H7VA 2GSHA 3TTEA 2XH2A 4ENLA 4A35A 2GGGA 2QGYA 1MUCA 1E9IA 4ZA0A 2GGHA 2XGZA 3VDGA 2FYMA 4HNCA 4DN1A 2PP1A 3ES7A 3TJ4A 3GD6A 3TWBA 4GYPC 4EWJA 3JVAA 3H12A 1EC9A 2PCEA 2OPJA 3V5FA 3FXGA 3TJIA 3GC2A 3RRAA 2HZGA 4K2SA 2ONEA 3QKEA 3EKGA 3CXOA 3DGBA 4JN8A 3P93A 3R11A 3FYYA 2PPGA 3UCCA 3UJEA 3IJIA 2GGEA 4DHGA 1EBGA 3VA8A 4DWDA 5BOEA 2OQHA 4ROPA 2P0IA 2GDQA 3I4KA 3UJSA 3H70A 2POZA 4HPNA 3NO1A 1PDZA 3IK4A 3I6EA 4K1WA 3DEQA 3OW1A 3ZVHA 5EU9A 3R10A 3GO2A 4IL2A 3H8AA 3IJLA 2QDEA 1YEYA 4DX3A 1JCTA 3KUMA 3DESA 2MNRA 3PWIA 3T8QA 4HCHA 3UCDA 2HNEA 3ZLFA 3ZVIA 4KPLA 4YWSA 3PFRA 1PDYA 2AKMA 3FCPA 1MDLA 1FHVA 2PSNA 2PGWA 2QVHA 1ONEA 3HPFA 3Q45A 2QDDA 4GYPA 3TQPA 2P88A 3QPEA 4FP1A 3SBFA 3PWGA 3SQSA 4GGBA 4MGGA 1R6WA 3CAWA 2QQ6A 3FVDA 3DFYA 3THUA 4HNLA 2HXUA 3ENLA 4H83A 3STPA 1EC8A 1DTNA 3ES8A 3BJSA 4MMWA 2OZ3A 2QJJA 1NELA 2OO6A 3IJQA 3PK7A 2GL5A 3CT2A 3OPSA 3MUCA 3QN3A 2AL1A 3DG3A 3R0UA 4J3ZA 4H2HA 4J1OA 2OX4A 2GGJA 3K1GA 3NFUA 2AKZA 4FI4A 1MNSA 2DW6A 4H19A 1SJDA 3NZGA 1SJCA 1XS2A 2OVLA 3QLDA 1RVKA 3P0WA 5FJTA 4IP4A 4K8GA 5FJRA 1EC7A 3N6JA 1TZZA 3N4EA 4IZGA 3TW9A 4IL0A 1SJBA 1JPMA 3MWCA 2OZTA 1WUEA 2AL2B 3DERA 4IHCA 1KKOA 2PODA 3NXLA 3TCSA
chains in the Genus database with same CATH superfamily
2E8YA 4GR1A 3BQ6A 4MPQA 3EOSA 3AS2A 3GTFA 1SJAA 1VENA 2ISWA 4M0XA 3WLNA 3WNMA 2VFFA 3SDOA 3PJWA 4UTUA 3WEZA 4C6LA 2W54A 2PTZA 4BR1A 3HU7A 2XVLA 1EF3A 5CSUA 4RNJA 1EEXA 4I5XA 2C7FA 1VLIA 4YTQA 1EHNA 1Q6LA 2UY5A 3LRMA 1C8QA 3W7NA 1JYXA 1TV3A 4MM1A 1RP8A 3RF9A 1VRDA 3NZPA 5CAHA 2PGEA 1XQLA 4TVUA 1ZKQA 4BS0A 2D2HA 3WK1A 2IXUA 4JD4A 3G1VA 3NR0A 1CCWB 1J0IA 8XIAA 3GFZA 3P6LA 3PFMA 1DV7A 5H1WA 1AW5A 1IF2A 4P7OA 4K39A 4U2YA 1QBBA 3SRDA 2BS9A 3FJ4A 2J6XA 2NLYA 1RQHA 2DVTA 3FVMA 3MMWA 3VIOA 5HQLA 3WFLA 3K8LA 1QAPA 2EXOA 3RJXA 1UUOA 1REQA 2QULA 4XD4A 1B54A 4EWND 5AYXA 2YDRA 4TIMA 4X2PA 4LXFA 2E6DA 2VWTA 3JUGA 3CC1A 3WLJA 3QZAA 1O66A 2DZSA 3HFYA 4ZB2A 4PL1A 4C6PA 4HYRA 1TTJA 4G1NA 3MZNA 4Z2LA 1G4PA 1PV8A 5HPCA 1UKTA 4MWAD 3TK7A 5D2WA 1MXGA 2HVNA 1FCBA 4DB7A 4QR6A 1HX0A 2QAPA 1YXDA 2B4GA 3L0KA 5HBFA 3FGCA 1NFGA 4KEMA 3SN0A 1TZ7A 3NOEA 4CVUA 1FFUC 1RJPA 5LIUX 1K8ZA 1ADDA 1YPIA 3WQFA 3LEPA 4IG2B 2PEVA 3WH7A 4HPJA 4RUBA 3GG1A 4IFRA 3I65A 3O1NA 3LV6A 4C6CA 2NQLA 4B2DA 1FWCC 4E38A 1GVEA 3LTSA 3VOIA 1XIIA 3IS4A 4CNTA 4YMZA 1F3XA 2GWGA 3R13A 3WLOA 1TX0A 1DWIM 3FN9A 1XC6A 1KGXA 3QJAA 3RPTA 3V5OA 4G7EB 3BOLA 4KQNA 3RNDA 3SN1A 1NEYA 2VL4A 5I03A 1G6CA 2FMNA 2YBUA 3P8IA 4CCEA 3CMJA 3LCIA 1Z44A 4A3YA 3QZ6A 3NQDA 2A7RA 1H1YA 2D73A 1Z8AA 2HE8A 3LX9A 4H6QA 1JOAA 1E0XA 4YN5A 4H9ZA 4NI8A 3GC5A 4EWJA 2GR1A 3HQOA 2Y24A 2C3DA 4GH1A 3MS8A 1JRBA 1M9HA 4GYFA 1DIKA 4ES4A 4W7WA 5SWUA 4ADTA 1OF8A 1JL8A 1XIBA 1HVQA 3LHYA 4D8ZA 4OBRA 3VIIA 3NCOA 1WOBA 4M3PA 2J77A 3TA9A 3I4KA 2XPKA 3HV9A 4RE2A 5JCKA 1F7BA 4E3VA 4S3CA 2CHNA 3W1AA 4M52A 1H7OA 4IL2A 4MOZA 1VEPA 2VGBA 1P4CA 3RRXA 3ZSSA 1GKPA 2BNJA 2DEPA 3CWNA 3KUMA 3ABQA 1XDIA 4FX6M 2BG5A 3N9RA 1K6WA 4KBXA 5AFDA 2YA0A 1FWRA 3R5EA 3HW2A 1XHGA 4R7OA 3B06A 1U2YA 3CHVA 3MP3A 1W31A 3SUSA 3ZVIA 3LB0A 2VTFA 1UOZA 1PDYA 1E4LA 1DJZA 2W27A 3UFYA 1X1NA 1XLKA 2VXNA 2E9MA 3S5YA 3TNOA 1M04A 3PNUA 2PSNA 1IV8A 3LOTA 4Q4PA 4UCFA 3W28A 4CQAA 5DRIA 3QPZA 1K9FA 4QS6A 1E3XA 3CGCA 4LT9A 4B4FA 4JICA 3L5MA 1UKPA 3GX9A 1XH2A 3FA4A 4HHLA 2QCNA 4GNJA 4CVWA 3AU6A 1LM1A 3DFYA 1A5OC 4Q7NA 3L4WA 3THUA 4W7VA 3B8WA 2NWRA 4KETA 3W84A 4H83A 2OLSA 4QLJA 3BANA 2EPLX 2ZXQA 4XSLA 5F4WA 3U2OA 4GX8A 3VGGA 3FS2A 3N73A 3N12A 3PK7A 3OVGA 2QR6A 1EUAA 4QRNA 2ACRA 2RJGA 3IV3A 4GABA 2QCMA 3GNRA 1VZWA 2BBFA 4HK6A 2OSYA 1Q6QA 1VBJA 2W6RA 4K8HA 3SY8A 1ONFA 1OC6A 2GGJA 4NJIA 1ZL1A 3VGFA 3FA5A 4O11A 1MI3A 1R7AA 4D6IA 1LPFA 5M1TA 4K7ZA 4U5IA 3CUJA 4PMJA 3G1RA 1PHWA 2ZUWA 3B05A 1S2CA 3WJXA 2YA2A 3BLDA 4JTQA 3KBVA 1E55A 3JZEA 3HJZA 2Y7EA 1F3TA 3RM8A 1HP4A 5REQA 2PRMA 2V3EA 1BYCA 1IEVA 1UH3A 3KL3A 1NFPA 4AZCA 4BF7A 3TR9A 2VFGA 2ZBTA 3PSVA 4KMQA 5TBOA 3VIMA 3EMCA 4PULA 3G24A 2D69A 3HTWA 4EKJA 3PBYA 4AZ6A 1V3KA 3TROA 1KV8A 3F1QA 3TJXA 3TXZA 1WP6A 4AVOA 2WZMA 2B81A 4B5UA 3ITOA 3W87A 4NAEB 4Y96A 3QC3A 2WVTA 4J57A 1Z32X 4XD6A 2Y2WA 5I3IA 2BVWA 1OIMA 3DFHA 3KFTA 3UXAA 3KCLA 2ACSA 3PULA 3BAIA 4F3HA 2A3HA 5GQBA 4IFOA 4X3ZA 4GBUA 1B31A 1TUFA 4AY1A 1KCZA 3N4FA 4NNCA 2X8HA 3UWEA 1Q85A 4WZHA 3GR8A 3H21A 1UWUA 5HNNA 4E4FA 1IR1A 1LBFA 1TKKA 1B3YA 3GNNA 1I2QA 4WJXA 2YVJA 1DJIA 3BW2A 1E6QM 4N9CA 3VZXA 3W0KA 1O1ZA 2NUXA 3VKCA 4K68A 2GQ8A 1ITUA 3FAXA 4I7VA 3MQTA 4Q4MA 1V6UA 5FF7A 4DJDA 4D71A 3KVMA 3HG4A 4H6RA 1B3WA 2W67A 1UWRA 5GVJA 2IXVA 4PYSA 1WYGA 1RHCA 1KGUA 3B0YA 2B7OA 1K8YA 4ZO7A 3D0CA 2I16A 1IR2A 4EOUA 1MZHA 1GQIA 2Q02A 2X2YA 3CV1A 3VFLA 4O1CA 4DUVA 3KP0A 3OO2A 5L9FA 4C6NA 1GRBA 3RUBL 4FOKA 2VJXA 1I6NA 1JZ3A 3DU0A 1EDQA 1NHRA 2PF0A 1XH1A 3H2EA 4WSJA 2OOGA 3FX4A 3EAOA 1O95A 2A3BA 3E5BA 1XISA 4LAKA 1U1UA 1FH8A 1NDWA 3B4YA 2YBTA 4Q4OA 2Q71A 3SJNA 1VP5A 5HMEA 2J62A 4LY4A 3PPCA 3PUOA 5AC7A 4JNYA 3TE9A 3NQVA 3PY2A 3SN4A 1QDSA 2ZWYA 3H2CA 4MKNA 1MW1A 3INPA 1OYCA 1W6TA 3NM1A 2V3AA 1ECQA 3F5LA 4IGMA 3C56A 1XIMA 2GDVA 1JG9A 4C1LA 4OTKA 5DCEA 5BU6A 3EA2A 3LCXA 4KWUA 3PB0A 3FHQA 4IPJA 4AB4A 4NXSA 2PWUA 1E9IA 3CO4A 3P84A 4MF4A 4XTDA 3MV01 2R1LA 3M0HA 3BLLA 1G9HA 2FZBA 3W7KA 1KLZA 3H7UA 1GSNA 1AA1B 3W7GA 2RDUA 3ZM8A 4GIAA 3C6CA 1N7KA 2YR1A 2DV0A 1JD9A 2HZGA 1PZ1A 2VEIA 3KAOA 2BASA 3LCWA 3DGBA 1ZB5A 3GBDA 2Z7KA 3I68A 3UCCA 3UJEA 1K8CA 3RPMA 3OYZA 1VR6A 2P0IA 3H70A 5I77A 3NO3A 4LB3A 4EMIA 5KVIA 4H9TA 1YDYA 5A2CA 3C2OA 1G5AA 4IG2A 3GO2A 4AY7A 5AHEA 5FL0A 3T08A 1M7JA 2VI0A 1XHCA 4HNNA 3RIKA 3BG5A 1TR1A 3MVTA 3MA8A 3E6EA 5LGXA 3WO8A 1EOKA 3CGDA 3KTXA 5CZJA 4F66A 1OX4B 6A3HA 3E49A 4MSSA 3W9ZA 4HPGA 1EPVA 1YW1A 4FEZA 2R1KA 1RBOB 1KCLA 3SGZA 1UC5A 2Z6JA 4LRSA 3W7HA 4XBSA 4NF7A 3FCPA 3QMSA 3TU9A 2PF8A 3EX2A 2TAAA 4J7RA 3MSDA 4MZ1A 5HJLA 3UZYA 1ISXA 5DELA 2NZLA 4JTEA 4NRRA 3L68A 3BOFA 2IMRA 3Q45A 1R2SA 4GYPA 3OLGA 1GOQA 3WUGA 2A6LA 1N2VA 3MW7A 3GU9A 2A7PA 3SZ8A 5AY7A 4GQBA 1QK2A 4AWUA 3BICA 3GVQA 5AC6A 3RNMA 3UF9A 1UWQA 1PZ3A 2X1RA 4QS5A 4XUYA 4B16A 3SCTA 3OOQA 3ZJKA 3FVDA 5FCZA 1XG4A 4L4LA 1WE5A 5CPMA 1U1JA 3NEVA 3IANA 4AUBA 3ENLA 1GOOA 3EXSA 1TWZA 4A4AA 1G7VA 1JUKA 3FLUA 2EG8A 5FAGA 3BARA 3QV9A 1P7TA 2DH3A 1V6TA 2WMKA 1DXIA 1AL8A 1NELA 4V2XA 2X05A 3CM4A 3S3GA 2CLOA 3QN3A 3IWPA 1Y8BA 4CEXC 3NTYA 1BKSA 4PB3A 1BSLA 3LGEA 3EANA 3KW3A 5AYZA 4AZIA 2WQDA 4QAWA 4H2HA 4XVEA 1FWBC 3S83A 5MKGA 3ARPA 3ELFA 5I23A 5DY3A 3HA1A 5D05A 1SM9A 1KM0A 1VFSA 3LPGA 1ZJBA 4HP5A 3EPNA 4NYYA 5FJJA 2J74A 2E0PA 5FJTA 3FKKA 3NDZA 2HBXA 4JIEA 3UWWA 1UR3M 1J0ZA 3ITVA 5AOUA 4L4OA 2Y70A 4XD5A 3S0CA 1XLHA 3OVRA 1CLKA 1MW3A 2ATSA 2R8WA 1HXJA 1WV2A 1S2WA 4LF2A 1TVNA 1VJIA 4C1NB 3DFQA 3TYZA 5DXYA 2PGFA 4NHVA 4O1BA 5HXMA 2EHHA 2EQ6A 2XH7A 3MMDA 1KKRA 4MDPA 2YLAA 1VCGA 4IFKB 1XLAA 5EL1A 1Y5WA 3S47A 4NY2A 2EPOA 3AQUA 3ZO9A 1EDGA 3L2IA 4A8NA 1PIGA 1Y7VA 3VC6A 4LIIA 1F3PA 3PZIA 1GZJA 1YADA 2REQB 2HJPA 3NVWB 4L1GA 4POCA 1R30A 2X0YA 3CZ8A 4WF7A 2BY0A 4L56A 4ZE4A 1EBHA 3K4DA 3QC0A 1AL7A 3T9PA 1FTXA 3CTTA 1E9LA 3EWZA 2VMFA 1XIGA 1A50A 5CSRA 3LPPA 2GJNA 2XH0A 3IK2A 1QWKA 4MB5A 3A4JA 4TV5A 3W6LA 4N9BA 3OZYA 2YFOA 2J27A 3K2GA 1XIDA 4ZO9A 4D2JA 3CL7A 4PC8A 3V4BA 4AXKA 4WDXA 3LI0A 2ABAA 2PTYA 4JIPA 2BXZA 2J25A 1RJRA 5C9WA 1UW9A 1WAWA 2YA1A 4C90A 2JKAA 4P8XA 2YL8A 1IZCA 4HSOA 3DK9A 2DQXA 4GA8A 4PBEA 1D3HA 3B0XA 3PC0A 5JBEA 5LGZA 4R3UA 3LSBA 2E4TA 4IJBA 5EBKA 1SQ7A 3VD9A 1S2AA 2ZUVA 1O68A 2PWHA 4BWLC 3LG3A 2X1IA 4O50A 2I56A 5F2GA 1VH7A 2IQTA 3P62A 3U9IA 3T2PA 2CYGA 5B7YA 2P5NA 9RUBA 5EFFA 4MY9A 3UXKA 4NKCA 4JDYA 4NAEA 4YNGA 2ZOXA 1OZMA 2J7BA 1AD4A 5BOFA 5EFDA 1P6CA 1GQKA 1A4LA 1WDPA 4AG0A 4WJ8A 4JQAA 2VDHA 1H0IA 4RNFA 1KXTA 2ZTKA 1VIWA 4UTWC 4QXIA 4RPPA 3A7RA 1QOPA 4LS2A 4GC3A 2D2OA 3CNYA 3M6YA 3HPXA 4DRSA 1QJWA 3T6CA 1YLVA 3P3BA 1P1XA 2O0TA 5DMMA 4D6EA 4H4TA 1I0DA 1O6IA 3CL8A 3B97A 4DI8A 4CNSA 1XLBA 4X63A 3EOEA 1XQKA 2GK1B 4O12A 5CSSA 3SUUA 4WGXA 1F61A 4FXSA 3SM0A 1QOXA 2F8QA 4N4QA 4A21A 2DSZA 1IYXA 4XKYB 2PGRA 3C5QA 3Q58A 1CNVA 4RDVA 4JQ3A 1NOFA 3Q94A 1N82A 3FHAA 3S6DA 4Q4QA 2DZXA 3FKRA 4CNUA 4HCLA 3GXMA 1OEPA 2OT1A 3GK0A 3W88A 3IJ8A 1R8LA 1DJHA 3TYCA 4N6EA 3W37A 3TSBA 2X41A 2GGHA 1QNQA 2C6QA 3WMLA 3UEQA 3ES7A 1I45A 1THFD 1HVXA 2YFNA 4GHRA 4ERIA 2CBVA 3B0PA 4JKKA 3AAMA 4DJEA 5ABFB 3G1YA 2D2GA 3TJIA 3VI2A 3LBOA 4EXBA 3L4XA 1VFFA 4K7VA 1PYMA 4OE7A 2G50A 1V0MA 2PPGA 1KCKA 2GGEA 1PXGA 3ZMRA 1EBGA 4UCGA 2YX0A 5CBBA 1TV2A 3KX6A 1GG1A 3NAVA 1FRBA 1W9VA 1ZJAA 2FZMA 1XGZA 3A47A 4RK8A 4RL3A 5AC4A 4Y9NA 5C6MA 2NVAA 2QCDB 5HMFA 2CZ5A 3DESA 3OU8A 4BF9A 1CGVA 4LA1A 4PUEA 1JIBA 4UWMA 2FZ8A 5G1TA 3H2OA 5JXQA 2W61A 1AJ2A 1Q63A 4FNRA 3ZT5A 6TAAA 5E0KA 4DBDA 4UTHA 1KM5A 4Z2GA 3PFRA 3SQPA 2UWFA 4XK2A 6XIAA 1GRFA 3NDOA 3BV4A 4JFVA 3KBMA 1KXQA 3O0KA 1FWIC 2BHYA 1OGBA 1ZAJA 2PGWA 4A8IA 2OMAA 3GZ3A 4A29A 2DSKA 4GIYA 2BC1A 4GOAA 4W8AA 1EQCA 1JDEA 1NJJA 1JCJA 1UD3A 4MNLA 1JQVA 4E3TA 3WSUA 3VDHA 5MF5A 3WEOA 2VENA 3G8RA 4PL2A 2ZA2A 2J75A 3R89A 2Y8VA 3MBFA 2PRHA 2ZCGA 4ADSA 2DIJA 2OEJA 4LYPA 4CCCA 3WBEA 1PCKA 3CHFA 1UA3A 3CIWA 3GU2A 2G8ZA 4KRUA 3AUOA 2J8GA 4PMNA 2GUBA 5G4HC 2VNCA 3KZPA 1BHGA 3BJFA 3E2QA 3KVKA 2FZDA 2GL5A 3OPSA 5JH2A 1DOSA 4DWSC 5HQEA 4TVCA 4KCTA 2WHJA 1PKYA 3ERPA 4RZ6A 2PLKA 2DPEA 4ZENA 1S5WA 1Q6DA 4A3HA 5LNSA 4ORIA 2BTMA 4QIUA 1B2YA 1TMHA 3BMXA 3OEXA 3QRHA 2WK2A 1UBSA 4ML4A 1X2GA 1UYQA 3MP5A 4GZEA 4YCPA 3LPFA 1BD0A 5C9UA 5CSYA 4WRHA 4Z2KA 1DHKA 3DYPA 3TW9A 1VBGA 1XI3A 1HGYA 5A2BA 1L9WA 4TMCA 1PAMA 2PLJA 1OGGA 4BK9A 2QCLA 5I3DA 1QI3A 4PTMA 1S3HA 1X2HA 3NXLA 1GK8A 4DZ5A 1H6VA 3IJDA 3W00A 2SFPA 3LTYA 4O0QA 2VCBA 1KRMA 3GVWA 4HHMA 1PVNA 4UQCA 2EGZA 3BCFA 3CT7A 3RR1A 4JDBA 3DIPA 2IQDA 1WKDA 2DH2A 2ATMA 3NURA 3LADA 4BV6A 1TV7A 2C13A 1IZKA 4JNMA 3LPOA 2EQDA 3UZJA 1TMLA 1J9YA 3F03K 3WF1A 4AF0A 3LLFA 1YNQA 3RN6A 5G5HB 2D23A 1DWJM 3KBJA 4JIRA 4AC7C 4XIAA 4H8VA 5ABHA 3WDRA 4XZ9A 1V8EA 5A5WA 4WHBA 3H7RA 3QQ0A 1DJNA 2D3NA 1XBZA 4HT3A 1NOWA 5AN7A 4CNPA 4O18A 1T8QA 3ICJA 4IPLA 2QLYA 3WQCA 4I9MA 2FFCA 4Q8QA 2OLAA 1GZGA 3QOKA 4FNPA 1J01A 4LU0A 1Y5VA 2A8XA 5CC6A 1AJ0A 5T9BG 1ELSA 3EB2A 1XDLA 1JCYA 2DP3A 5I00A 3TWAA 3M9YA 1OT1A 2NXGA 2GGIA 1RAKA 1WNOA 4C1NA 4GACA 4PN2A 3CWHA 5IBXC 3RO6A 4LV9A 1XANA 4K8DA 5D2YA 2XIIA 4LOCA 1P0DA 2PBOA 5CBIA 3V3WA 3N29A 4K8EA 2VX7A 3PB2A 3Q37A 2E25A 4IFKA 3EWCA 4K7YA 1AMYA 1OT2A 4AZBA 4PE8A 1A53A 3PBWA 3NGFA 1MW2A 3UW6A 4L7ZA 4AWSA 4JHMA 2REQA 4DYEA 4GJ1A 9XIMA 1J18A 1T5AA 3MSGA 3GH4A 1EJ7L 3LV5A 3M43A 1GQJA 2BVYA 2Y5JA 4DAIA 3W1NA 3IAPA 3NQEA 3W53A 4GYKA 3CUGA 4H50A 4GUJA 4W93A 1GONA 3LQLA 1I1XA 3WELA 3UJ2A 4QG6A 1YRRA 3EAUA 3MDWA 2J8TA 4DLMA 5JCMA 1GERA 4TO8A 1CX9A 4MY8A 3BAXA 4H4PA 4BCEA 1JEZA 4BF5A 1VBHA 1TVLA 5FJIA 2YW3A 3A4AA 1RPXA 4NYUA 4E2VA 3QYSA 2F84A 3W27A 3AMCA 1DWHM 3GFYA 4Q4SA 4PA8A 1GYNA 1NFBA 2JF7A 3VIGA 3VD7A 1A3XA 4MLRA 3F2DA 2X16A 2WZTA 3S6OA 4PRRA 2V68A 3NQ2A 2TODA 2XVPA 5FL1A 3BAKA 1UZDA 3NM3A 2NSOA 3TYUA 3ZR5A 1GUVA 3ITTA 3QPYA 2C14A 3GRSA 3EWUA 2WNWA 2WM1A 5FF4A 4ROPA 1QMLA 1XCWA 2IPGA 2ZQ0A 5FF3A 3REQA 3EX4A 4GXPA 1ZXIC 2JBMA 1JXJA 3NDYA 2A21A 3LCLA 3MI3A 2Z00A 3P14A 1XLCA 4ZFCA 4WXYA 2QMKA 3KOFA 4DELA 2ANUA 1JUBA 3LXCA 4FF7A 3O9NA 3N4AA 1IGWA 2GK1A 5I07A 2YIHA 2X8CA 1VF8A 3AHXA 3DGZA 1KM2A 1KBJA 1ZPTA 1XLGA 1EH9A 1K9EA 1C9WA 1J2BA 1BG4A 4GINA 1KFLA 1VCVA 4BQ4A 4GUHA 5CPNA 3QHMA 1FWHC 1EJUC 5AYIA 2XJ7A 1CZ1A 3I6RA 2YL6A 1V03A 3VMPA 4LRTA 5G2HA 5JQ9A 1GREA 1CGYA 4KWWA 4BQ5A 4A22A 4B91A 2C1HA 2P88A 4FP1A 4NZCA 1Q5MA 4ADWA 1PSCA 3CIVA 4MGGA 1WAUA 4KESA 4B3KA 5ABFA 3W1RA 1EYWA 3M0JA 4YVXA 2J7DA 3QVQA 4N02A 4O57A 2YAUA 1RCQA 4TX6A 3P61A 1POJA 3P81A 4F0RA 1C7TA 3U2EA 4EQSA 3WDIA 1ITQA 1R5YA 3STCA 4RDZA 3NQAA 3OGVA 2BVDA 2GQWA 3O07A 3UERA 2HV5A 3E0VA 1QI5A 2QPUA 3NL2A 4MTVA 4NEWA 4NX5A 2R9RA 1DEDA 5EB8A 1TWSA 5C9XA 1AOGA 3NQ6A 4DJED 4Y6GA 1G67A 2JF6A 3U7VA 3UG5A 3TONA 1UH4A 3SUVA 3W2LA 3RU8X 4UFMA 3ZIZA 4QJ5B 3MC5A 3AXKA 4UQAA 2ZRWA 1OFQA 3G2GA 5ECUA 1UWTA 4Q3MA 3QLDA 5M2FX 3QV7A 3C0QA 1D7YA 1VQZA 4GPNA 5HAOA 3KRSA 4RNIA 1EC7A 2CZEA 1JFHA 1VLWA 3W6YA 3GE7A 2TRSA 4WDWA 3S1VA 3WL1A 1LT8A 1JPMA 3OIXA 5A8NA 3PNZA 2GJLA 1W9XA 5D03A 4Z42C 3DBNA 4JL1A 2E1DA 2X8GA 2V5CA 1OFBA 2EAWA 2NV2A 2D24A 3WLPA 4BI6A 1FDZA 2Q09A 4S3BA 1LRTA 1TPDA 4PMZA 7ENLA 1FWNA 3VFCA 4C6IA 4IJCA 4Y8EA 5D2VA 4KF1A 4F79A 1XIFA 2QPSA 2KX9A 3H22A 1AVAA 1WDQA 4CD8A 4DUWA 2BMBA 3NVDA 3R0DA 4LVGA 1RY0A 3N2OA 1FHUA 4JCLA 3MZ2A 1KRBC 1ISYA 1HO4A 3ATYA 3R58A 4I3GA 2O9TA 4E8CA 3WLKX 2ADAA 1N8WA 1ZBKA 1Z69A 2NX9A 1BTMA 2FGBA 5K4ZA 2VM8A 5D2TA 3UZ5A 2WKGA 3OC4A 1ZU8A 1ISZA 3DGHA 3CYJA 1A49A 1V0KA 5LKYA 1R47A 3ABOA 3CH9A 4PMRA 5JBFA 3MJMA 4RZBA 2QJMA 4IIEA 1GPFA 5AYYA 3STGA 5FJPA 5D4YA 3A24A 2Y8UA 4ACYA 4ZOCA 1EB3A 3NYDA 4C6KA 3TX9A 3G0SA 3PG9A 1RA5A 4X0NA 4GH3A 1EEPA 1V3IA 4DBSA 4GUIA 3SI9A 3CJPA 3A6OA 1AW1A 2YYTA 1E6ZA 4E5TA 3C2RA 1B0IA 2XSXA 2ZX8A 3DXIA 2P3EA 1W5MA 1CB2A 1QNVA 3SW6A 1E1CB 3WLIA 1JZ5A 1J12A 3AHZA 4H7VA 4JQ2A 1YDOA 3B8VA 3W1XA 1NWTA 4GE8A 2J4GA 1R0MA 1TB3A 3NJ3A 5KZ6A 3PG6A 3GDBA 5LHEA 2CFFA 3B8TA 2ZZ7A 1C8XA 3HFTA 4ZR8A 4HNOA 1W1YA 3SCQA 4PMXA 3CQJA 1VFOA 4JX4A 1J5SA 2XFFA 1N8FA 3GNXA 3NRZB 4W7UA 4FALA 2UV8G 1JDCA 3CZLA 1QASA 3NWRA 3OZPA 4UTJA 5LZLA 3VNYA 3W7MA 2YCKX 4MWAB 4EM4A 4JBRA 4PTNA 4EACA 2YDSA 1MNZA 3UA4A 2JEQA 4MKSA 2EPNA 4UZUA 2QDGA 3M16A 3H54A 4M8UA 4G5DA 3I7QA 1W32A 3SQLA 1EXPA 1US3A 1TTPA 1SFSA 2DZPA 1VEOA 1AK5A 1X7FA 3MU7A 3UVIA 1XFCA 5LIKX 2OYLA 3F7JA 4DJFA 3MUAA 5DT5A 5BXPA 5JVLA 1IWPA 1M41A 3LRLA 3GDMA 4JTJA 3CS2A 1OSEA 3S2NA 3PZ9A 5G5IA 3DC8A 2PDBA 2NX3A 4I7UA 3KBSA 4LW7A 2GOKA 4FXJA 2VUNA 4C5ZA 1FOBA 1G7UA 4Y9MA 2CW6A 2PDYA 3VOGA 1JDAA 4WXZA 2BGSA 4OU1A 2ZIDA 1EC9A 4Q7IA 2VD9A 5G4EA 5FSDC 3SJ3A 4KGLA 1EX5A 5G2IA 4Q32A 3GKFA 1V6YA 4DBEA 3GD3A 2W5FA 1YNPA 3DKLA 4RXGA 2HVMA 4Y9PA 1B3ZA 1FWWA 1SO5A 2OQHA 1ONRA 4C6EA 1EP3A 1VYSX 5BU9A 2ACQA 3H8AA 3VE7A 4DY1A 1LUCA 3VD3A 4KEVA 1SUXA 3OLIA 4DX3A 2V2DA 3LSCA 1A5LC 1YYAA 2WQPA 2X7WA 3PR2A 3VIHA 3W7PA 4CUCA 4UNIA 3GTNA 4LCRA 2IPFA 3UCDA 2L5HA 4A05A 2Z27A 1QOQA 2C71A 2G0WA 3CQKA 3ARZA 3USZA 4O14A 3UR2A 3KOYA 4XZIA 1X6LA 3QLLA 2ZZ2A 1SZGA 2YYUA 4PEEA 3QV6A 5I02A 2CLIA 4LUSB 1OCBA 3E38A 4WCJA 4UTMA 2ESCA 4QG8A 3TQPA 4PMQA 3SCWA 4UOQA 3VPLA 3N2BA 3H23A 1KM1A 3GH5A 3W7DA 1W91A 5CZKA 3W72A 1BPLB 2OYKA 1K03A 3A21A 5I78A 2GR2A 1RPKA 3R8GA 5A8PA 3EX3A 3PBUA 3PZQA 4KERA 4LUIA 4PR4A 4Q6JA 3ZWTA 1Q6EA 2JK6A 4QE5A 4D6GA 1X8CA 4C91A 4F9DA 2VC9A 1AG1O 1MSSA 4UQDA 3NSXA 4JFTA 1E70M 2O4QA 5T91A 3MUIA 3W7QA 1E5JA 2JK2A 4BEQA 4BHYA 2OZ3A 4J4KA 4US5D 1LCOA 1CXLA 2PDUA 3L5LA 1Q8JA 4CLMA 2PAJA 4LX4A 3BAJA 3R0UA 1LBMA 5D8ZA 2JGYA 3BUVA 4JQ9A 3N14A 4L9ZA 2AQOA 2NQ5A 4FI4A 5D30A 4H4XA 1SJCA 4NSBA 1K6AA 3RLVA 2OELA 2BCPA 1EP1A 5I3GA 3QGAC 4F0LA 5FESA 3S9IA 3GB6A 4K6AA 2OX1A 4UZSA 1TYPA 1LL6A 2IKIA 2XGBA 2WBAA 1IXPA 1H4PA 4MKVA 3QFAA 4RE0A 4DVOA 3WKZA 1ME7A 4IL0A 3RK8A 1LYXA 2NT0A 4ALDA 3VNZA 4WKAA 3BSHA 3TCSA 1MRAA 3FK4A 4PCSA 3TZNA 3RGTA 4DNHA 4HCDA 2HWGA 2YZ5A 3WJSA 2OGYA 4GY0A 1LLZA 3OZMA 2G41A 1GGOA 3NVYB 1IEQA 2FDMA 1ODUA 4RV8A 1NWSA 5HQMA 3NS1B 5E9XA 3DH7A 3GU1A 1EBDA 3HG3A 4KS0A 3RCYA 4AZ5A 5H8MA 3UY8A 4I6KA 3P60A 1ZMCA 2PD9A 4F2BA 4H1ZA 3CAQA 3E0LA 5HR7A 3E5PA 3SRFA 1UR2A 1ADOA 3S9YA 1JYWA 3GY1A 4N9DA 4EMWA 3PM6A 2ZRXA 4YLWA 4Z1BA 2D3LA 4O15A 1WA3A 5HWJA 2WC4A 4PMOA 1MUWA 1B3VA 3AIBA 3GDRA 4IQEA 4J9JA 1GOIA 3ZQ9A 5E1QA 7REQB 3M0VA 4E8GA 4LAOA 4JY9A 1EKOA 2Z24A 4YTRA 5AB3A 5IM51 2Y5EA 3E0WA 1M7XA 4GZ7A 1DXFA 4QGCA 1VPQA 3VCRA 2DSVA 3CQ0A 2ALDA 4ZODA 4IXXA 3CUXA 2VURA 3U7BA 3EEZA 1H3GA 3TVAA 5LNVA 2NPXA 1E9ZB 3R8HA 3JW7A 7ODCA 3K13A 2V82A 3VCNA 3VKJA 2G3JA 1R85A 1V3HA 4ZQNA 2CIPA 4XTIA 4LCSA 1M6JA 5AVNA 3TKFA 3L4VA 4AVNA 3D46A 4DJDC 3T78A 2IUZA 4V15A 4B90A 4E8DA 1FP9A 4PB5A 3ZYZA 1E4MM 5LA0A 3PP7A 1D8CA 3E1F1 1BGAA 4WVXA 4U2ZA 4ROQA 2X30A 3BGAA 1A0CA 3PUGA 2VC5A 2QCCA 5B7ZA 3T4CA 2HK0A 6XIMA 3U48A 3L5AA 3BSMA 4XAYA 1OM0A 1UROA 4XG1A 5U25A 2PC4A 2E6FA 1ZDLA 4NL1A 3LBMA 4M7SA 4C6JA 2WMFA 4QM1A 1E72M 1NOUA 1C8VA 1E51A 4DM1A 2I5GA 1NY1A 2NW0A 1E1EA 1ONWA 2HPIA 3OJGA 1U5VA 3WF2A 2YCEA 2NQZA 4H6KA 4YVVA 1BEUA 3D9XA 5C7VA 1UZ4A 5FSEC 1JGMA 1P43A 2ISVA 3E2VA 5A8OA 3NL3A 2I9EA 1G0CA 1AQHA 1H5VA 5IFTA 3V7PA 1V51A 1ZK7A 2JQXA 1UQZA 3SSZA 4AHQA 3RFAA 3U2ZA 2QW5A 3M6DA 3SUTA 1DQUA 2VR4A 3UPBA 3DX5A 3U4FA 5A6MA 4ATLA 3TTEA 3TW6A 1HUVA 1PYFA 3BE7A 2DU2A 3EF6A 2CZVA 1BVZA 2XVKA 4HJFA 2ZWZA 3BCJA 5K4XA 1LOLA 1ECEA 3GNPA 4LCQA 2FYMA 4I8DA 3SUWA 3AMZA 5D09A 4RJEA 3IVTA 5C2CA 2XTKA 5EMYA 2QUTA 1QHZA 3DFPA 4TVYA 5AHFA 4H4UA 4EE9A 3DN5A 4MG4A 4JTHA 3CUHA 3RRAA 4K2SA 2ONEA 1IEWA 1V3JA 1AQMA 1U83A 3WNKA 2XISA 4LF1A 1PX8A 4AHPA 1SZFA 2PFHA 2VQTA 1TPFA 3O15A 1Z41A 3R2GA 3W73A 3RXZA 2HISA 3DCPA 2ABBA 3W70A 2XIOA 1MYRA 2Z2UA 3PHAA 4I6VA 1ZBWA 4OWGA 3IK4A 2BSLA 1CYGA 2Z4GA 4DF1A 5BRPA 1K70A 4CD6A 2VOTA 3MP4A 1UUQA 3L8KA 4XD3A 1VGAA 1O94A 4JY8A 2GVEA 3VDAA 1EWEA 2PZNA 1SB3B 1REQB 1H2JA 3H6OA 1UBPC 1UIPA 4J3TA 4QDPA 1RBAA 2BX7A 3OLEA 1UB3A 4KPLA 5F1UA 2VFDA 4GZIA 1PBGA 4KH2A 1HF6A 2EPKX 2BY2A 4AIEA 1NQ6A 3OBAA 2HVOA 4IMAA 2CLPA 5F1VA 4IMFA 3GRIA 2YB1A 2OTDA 1TPUA 3KBWA 2ZZ0A 2E9LA 4S3KA 3TQKA 1WDSA 3FGCB 2WWDA 4L64A 4OKDA 3HB9A 1HTIA 3QXBA 3P80A 3UNTA 3M64A 3MBDA 5CC5A 1KBLA 4AD0A 4H9MA 4GK8A 1ALDA 1IEXA 2VZVA 2PWGA 1R6WA 4DJFD 1A0EA 4YHEA 1SW7A 1D8WA 4BI7A 4UTFA 1R87A 5ABEA 2HXUA 1I2OA 4DBUA 5AC5A 3STPA 3G77A 3IGUA 5H8PA 3IC9A 3W1PA 1PEZA 3G1XA 1FFQA 4TU1A 1YIXA 3LXDA 3VKAA 3WQWA 3MT1A 2OSWA 2V3GA 4HN4A 4EAYA 2WHMA 4J3ZA 4PCNA 4HOZA 3VIKA 4M5PA 1KWGA 1E0VA 3KS5A 4J1OA 1OADA 1UD4A 3JRKA 5JBDA 1HW6A 2EQ7A 3IIPA 4W87A 5F7UA 3ZOAA 2DW6A 2PDLA 3WH9A 1SJDA 3KBNA 1FBAA 2Z1XA 4GNKB 3EA3A 1L6WA 4HSNA 4R88A 2XM2A 5CZ0A 1V7AA 4IP4A 1V6WA 1F07A 1ZLPA 4DZHA 3OYXA 2EQ8A 3VD5A 3G0UA 4UC5A 1VQTA 3DHDA 3C0SA 1H60A 4DPPA 1YQ2A 3QTPA 6PTDA 3IGHX 1C91A 4ZB0A 2GUUA 1H7XA 4S38A 5H2ZA 3QY7A 2PURA 2VT0A 2FQIA 3UGVA 7PTDA 5DY2A 1HKMA 2Z7GA 3GTIA 5K9XA 3IACA 3AIQA 4C6OA 1FP8A 3AIWA 3H4XA 4LYRA 4ERGA 3PTQA 1TVPA 1BLIA 1UR9A 3BMWA 2W3ZA 4Z1DA 2BODX 1LF1A 3GSMA 4DLFA 1WQ5A 2Q8ZA 4JTGA 4RPQA 3SFKA 1XLMA 1Y5XA 3ABRA 4JFUA 3ITCA 5DMLA 2WLYA 3E3HA 3PZUA 2DDXA 4I7WA 1VFUA 2ICSA 3PTDA 1I60A 1VHCA 4YYCA 1JRPA 2PWEA 1TJRA 3G1HA 2OFJA 3CTLA 2HQAA 3DDMA 2GOUA 3W85A 3O6AA 1ZX9A 3BLIA 3S9ZA 5EBUA 1BVNP 4ATDA 3GXDA 2DT0A 4MJ4A 1O12A 2QCGA 3BOXA 4KIEA 4I9AA 4FPSA 3IRDA 4JX6A 2DUXA 2WOQA 2HSAA 3WQVA 4TV6A 1GJWA 5C0QA 1XG3A 3MKCA 3AM9A 5G2WA 2VGIA 3N6HA 4APNA 5AYBA 2V0TA 5FS8A 1HL2A 3KE0A 4ACZB 3AHYA 1T7LA 3VO0A 1O1HA 3SSJA 5XIMA 5FS7A 4B9YA 5G4WA 2BVTA 3IAQA 4M51A 4WY0B 1OFRA 2Q3RA 1TJ1A 3W7IA 2ISDA 4HA3A 1W1B1 2J3NA 4J3UA 5C8BB 2E68A 5C70A 1YKWA 2P1FA 3POHA 4BFAA 4WUIA 1OBAA 4WY0F 4IF2A 2WVVB 1DJYA 2I9UA 4EMJA 2G96A 2P3ZA 4Z17A 1JZ8A 3LDVA 2FVKA 2DORA 1JZ4A 4P5UA 5IXEA 2YCJA 3FXYA 2PWFA 1BWLA 3VD4A 3L12A 2XIMA 1M03A 1TO3A 3WMCA 1H50A 4H4IA 5RUBA 2DQWA 5CAKA 4XVDA 1O7AA 4MYAA 5REQB 4ZZ9A 2J13A 3MPGA 2EO7A 1QI0A 1YE4A 1TYTA 3BV7A 4MLJA 1V97A 4OECA 4GFSA 1JFXA 2A79A 2GR0A 4HPXA 1VJZA 4LGXA 5C7HA 7REQA 2FDSA 4D6FA 3S42A 1UD6A 1XWYA 4QG9A 3SQMA 4FO4A 4LJ3A 3AYTA 4LYQA 3GRTA 2PLCA 1HO1A 1L8NA 4NXKA 3N25A 1K7EA 1FCQA 1VFLA 1VFHA 4G9PA 3TSDA 4L9XA 2I1OA 2QGYA 4MUZA 1EOMA 4O13A 4HTBA 3W74A 1LQAA 2VFHA 4AZHA 4LALA 4S3JA 4EAMA 1PIFA 4NZ1A 3H12A 5HK4A 4F0KA 1QPOA 2PCEA 6TIMA 1HQTA 4J2PA 2VZSA 5AVHA 2OXNA 1FWFC 5CBJA 3EKGA 2Z2BA 5LNRA 4XBJA 4D6JA 3CXOA 4JN8A 5KVHA 1TELA 3BLOA 5FMHA 4LANA 2Z1WA 1E5NA 3N2MA 4Z08A 5EKYA 4MIMA 4OUEA 2VKZG 2J8FA 3FW6A 1VKFA 3WK2A 1G4EA 3VNLA 1TA3A 3BVJA 2C16A 3GIYA 1TQJA 4CKQA 3T0DA 1Q7MA 3E12A 3I6EA 1FWAC 1F6YA 3R10A 5CJMA 2V3FA 2A3CA 1N5WC 1HFBA 3RLGA 1KFCA 4DI9A 4NG3A 3CIXA 3ZJ6A 3WENA 1EF2A 4C7GA 4HNUA 1Q4WA 2Y1HA 3T8QA 1XP3A 1YPXA 4FR1A 3OQ8A 1LROA 3ABZA 4FSAA 3PUDA 3AZSA 3AXIA 4GQRA 1NDVA 4LC8A 4V28A 1V6XA 1QNPA 1RR2A 3UG4A 4FK9A 3EYPA 3UPMA 4XISA 3BG9A 5A95A 1CBGA 5E5CA 3NIYA 1Y0EA 1I2PA 4H6EA 1B3XA 3T0AA 3KRBA 4UTLA 4OOUA 1O5XA 1OK4A 3GZAA 1PS9A 4Q8VA 2BFGA 3KVJA 2Z1KA 5JH1A 2YXOA 5FAJA 3HQPA 1W37A 3K4AA 2WLZA 1OG0A 1PIIA 4LYKA 3KXQA 3W6MA 1CXKA 4M6VA 1LBLA 5A6TC 1R3TA 1DE6A 4PCTA 5DF0A 4S3AA 4M6PA 4EANA 1A5NC 1MRQA 1GHRA 3FNDA 2EKCA 1MQPA 2G37A 4QCFA 3WQ6A 1H5YA 1PL9A 1SVDA 3UVAA 1AH3A 1HIZA 3WYZA 5KINA 2BWGA 3BPWA 5A8QA 3WLLA 3AZRA 1B9BA 4HIBA 2QCEA 1JYNA 4IGHA 4JIIX 1KTBA 4ZTYA 3AALA 1ML1A 4UTIA 1K8XA 1KM4A 1V3LA 3TC6A 4GUFA 3H4KA 2JKPA 1US2A 2PDHA 4FNUA 4LUYA 3SAZA 4TX8A 3EOLA 1Q2RA 4BA0A 2Z28A 3N9SA 4PMDA 2JIEA 1NQKA 1TPC1 3QEZA 3VVGA 1SJBA 3B9EA 4XUGA 2Q01A 3ZJ7A 3AXXA 2RGMA 4PUWA 4KFPA 2H3BA 1QFEA 3J7HA 2C8NA 1H0GA 3ISIX 1T41A 2PP3A 1GT8A 4WLCA 1T96A 3C2YA 4M6UA 4AFYA 1Z3NA 2QV4A 1PKMA 1UG6A 1M7OA 1HKJA 3WLRA 2WKJA 1DVJA 2PS2A 1XYMA 3PVFA 1BYAA 1W3TA 1VYPX 4JR5A 1W9UA 5IFPA 2PTXA 3PTMA 4OZOA 5HINA 2PLMA 1ICSA 1AD1A 1K3UA 1J96A 3QSRA 3B9AA 4GC4A 4K37A 1ZALA 4C60A 3CZJA 2PTWA 4CNOA 3IJ6A 1EQPA 1V77A 3W2UA 1X1OA 3WCZA 2G95A 2XIJA 2V38A 4G7FA 5BCAA 1RLDA 1OC7A 1Q1RA 2EQ9A 1TWDA 2UY4A 1FWDC 1GTEA 3R43A 5D32A 1LL7A 1TMQA 1MFUA 1RSCA 5HPOA 2X2GA 2WC3A 1XDMA 3UPWA 2C0AA 2Z1VA 4X61A 3S5NA 5L6UA 3I3EA 1EJVC 3E74A 2OWCA 4QLKA 1WYIA 3IJ9A 3KOXA 1BXCA 4PUJA 2B0MA 4ZE5A 1QATA 4DNAA 2C18A 3FSTA 5PTDA 1XV8A 3GIPA 4CN4A 3L4YA 4GD0A 3W75A 4FS9A 2D2JA 2Z1SA 2P8BA 3H4GA 1P7TB 4I9TA 3OBEA 1IWBA 2V5KA 4E0CA 1J10A 1W1IE 3CHEA 4D8LA 3ZR6A 3VC5A 1KFJA 4IIBA 3W24A 3ABSA 3I4EA 3WF4A 3L23A 4KWSA 4D1IA 1XC4A 2QUMA 5MKGB 2XSAA 3R12A 5HULA 1UPPA 4QSFA 3FJLA 4UTTA 4M82A 5XINA 1Q8AA 1AODA 4QITA 4UNKA 3T40A 2PDQA 1LZOA 4KCUA 5HA7A 1AMKA 2J9XA 2HBVA 3TOPA 4FIQA 1PTAA 1FWSA 3TN6A 1F6KA 1YTDA 1M65A 1RV8A 2W66A 5D9PA 5IRPA 1BWVA 3WBYA 4EQXA 2DVXA 2Y7DA 3WQ4A 3UG3A 2VVSA 2VO5A 3NYZA 3RG6A 1KN0A 1ZP3A 4GY7A 4JHZA 1WKEA 3WJWA 3URHA 4OV4A 1ZBVA 1X6NA 4HHHA 4LSBA 2Y8KA 1AJZA 1QW9A 2NXHA 4FX8A 1DJGA 2J24A 3HF3A 4ZSTA 1UJQA 3ZT6A 1OC5A 3KZSA 4B3ZA 3BLFA 4BWLA 3ETRB 3OA5A 1VBUA 2J79A 3O63A 1NHPA 1SU5A 1LQ2A 3AYRA 4ACZA 1GVQA 2XGZA 4H9UA 4HNCA 1P0BA 3GXFA 1IT7A 5HUOA 1IGSA 2PDCA 2Y62A 4WY0A 2Y85A 2Y89A 4K36A 8RUCA 2OPJA 1GOWA 1M7PA 3GC2A 4PTVA 1C7SA 4UTWA 3KHJA 4UFKA 1KQYA 4DM2A 4Q8TA 4OBTA 4IMDA 3QY6A 4PUNA 1UR0A 5BROA 3SURA 3N15A 5LA2A 4IOTA 2WVVA 4Y9OA 1EXBA 3AJ7A 3F4CA 5BMXA 3VOCA 4DHGA 1D3CA 1F8MA 2DIKA 3V0UA 1HGWA 4NX0A 3QHOA 3UJSA 2O55A 4OFCA 1OJTA 3LERA 4BURA 4JYDA 2FH8A 3EXRA 1U33A 2WWCA 1PJ9A 4U3AA 1CT5A 2EG7A 2MNRA 1DWAM 2FIQA 3T7VA 1GYMA 4FF5A 1JGIA 4JYFA 3ABXA 2W9MA 3LI1A 5CEWA 2VYOA 5CJ5A 3G5EA 3DC0A 5DBUA 3LQGA 3U3HA 1MEHA 2V2CA 2WPGA 1OG6A 1S39A 4MDOA 3TYDA 3GTHA 4HU3A 3UP8A 1G1YA 4YJ5A 4M1RA 1QR7A 4U3CA 3WK0A 4H00A 3DK4A 3DYOA 3GW0A 3GXPA 5KZEA 1ONEA 1RCOB 3H53A 4QNEA 1QI4A 1A3WA 4MADA 1OFPA 3EDKA 3WNNA 4AX6A 3FDKA 1ZY8A 4YTSA 4GY1A 1Q65A 5DMNA 1HT6A 3AIVA 2ON3A 4IGNA 3SY1A 4RZ4A 3B04A 4XAZA 2F61A 4WOZA 3NO5A 1OY0A 3QQ1A 4JKMA 2HDJA 1J8VA 2R1NA 4XO6A 3U6WA 3MV11 2HMCA 2ZUUA 3SADA 4LEQA 3M4HA 2YXGA 4S3FA 1JZ7A 1W9BM 1E6SM 4TVWA 3E2SA 1T3QC 3LU2A 4H9YA 1KR1A 2VEGA 2CLKA 1AZ1A 3GHUA 3PN8A 3LM7A 8CGTA 5BRQA 4F0MA 5KTLA 3N04A 4OIFA 3LZ3A 3AMDA 1X6UA 3GXTA 3R4IA 4D8AA 2OX4A 1IIGA 3NZQA 4ZL1A 2ZXAA 2OSXA 3LNMA 3JS3A 1R3RA 2J78A 1RVKA 3WLSA 3JU2A 4TQTA 5E09A 3HGOA 5JCLA 2QYGA 5DQPA 3L21A 3S5OA 1H63A 2E7FA 1TV8A 3TYAA 1L6FA 2TMDA 4UFJA 2D0GA 2Z2AA 1ITXA 4Z2JA 1V7YA 5FI8A 2Z26A 2DGAA 3LA4A 3MUZ1 3ANVA 4WR3A 5CJNA 4H7CA 3F4NA 1IHIA 4ORMA 1MMFA 1BF2A 2OQYA 2ZKMX 1K4HA 4QBXA 4DXKA 4O0KA 3UBPC 3ZLGA 2W3RA 4AAJA 1E15A 4A8RA 4NI3A 1J2WA 2PDIA 3CMFA 5CC7A 1SFLA 4XV0A 5CXPA 1VD6A 2H8XA 2E3TA 6ENLA 3W3OA 3C52A 4HTYA 2V2HA 4IX2A 1UD2A 1JPIA 6CGTA 3G22A 1DHPA 5E93A 2EEXA 4H9VA 3EDEA 4ICNA 4OQVA 2OODA 3TH6A 4AEFA 3ZT7A 2XYLA 5DANA 1X97A 4MVAA 1HJUA 2CKSA 3TLLA 1ZTVA 4WOQA 1SW0A 4YWOA 3C4UA 4K1GA 1XDJA 3K30A 1WDWA 5M3WA 2R6OA 3L2MA 2WSKA 3KVLA 1E6RA 3ARWA 4CQ9A 1YDVA 3GLCA 4D9PA 2DZUA 3W7EA 4DBWA 1K77A 2ZUTA 3HPAA 1NSJA 3V0SA 3CZGA 3U8GA 3GQYA 5D37A 2GVGA 1PTDA 4DXXA 4DYJA 2A5HA 5I7GA 3UYCA 2PDGA 3D3AA 2D0FA 3MY9A 2MUCA 1QPNA 5EY5A 3W2KA 5HOSA 2RDXA 3BJTA 3PZGA 1H09A 2A1YA 2NV1A 3G1FA 5F2LA 5AKQA 4L1WA 4MY1A 4PODA 3V1HA 1UR8A 2RJHA 3RLHA 4LBSA 4Q22A 2QNEA 4W89A 3PPGA 1SGJA 4WX2A 4GX9A 3CBWA 1L2UA 2PDJA 4Q4RA 5FEWA 4JS3A 1I9CB 4UMCA 4PUUA 4GLEA 2Y7FA 4GVFA 3PZVA 2GFTA 1XIHA 1JF5A 2PDPA 4GQQA 3OLDA 3THDA 4I90A 3LCFA 1K9TA 2O7QA 3TV8A 1VDVA 4GISA 5HWMA 1ODZA 1WKFA 1O5KA 3WN6A 5A6BA 3FSUA 2ZE3A 4ZOEA 2VX4A 4PEKA 5CPLA 3HN3A 3QFBA 1E71M 3G0XA 3PWAA 3AIRA 5DBTA 4QP0A 1MFVA 5E0FA 4C6MA 4LVDA 2A4AA 4GIRA 3LLXA 5DLCA 5EYWA 5EA9A 4RW5A 3ARTA 1JDFA 4XZHA 2NQHA 3RX4A 4QSHA 1UP0A 3W7RA 2ZE0A 4UFIA 4L1XA 2FZNA 1I75A 1V5XA 3CQIA 4M80A 5I3HA 1FKWA 5JCIA 1XD1A 4Y8FA 5LA1A 2OG9A 1OYAA 1S5TA 4KWOA 2ZADA 4XZNX 4REQA 1RALA 3MCNA 3DFTA 3PAOA 1DBTA 1LVLA 3LZ5A 5IBXA 4ENLA 4A35A 2YCIX 3SECA 1JCLA 1S2TA 2GGGA 1AH4A 3GS6A 3OHMB 3BGGA 4ML9A 3TJ4A 2EBNA 3NQ7A 1TYGA 2OLHA 5I0DA 2WPEA 5E6YA 1Q7ZA 3S1GA 4RR4A 4DAFA 3UCQA 2IS7A 4AF0B 3RM9A 1XXXA 3UXDA 2V6OA 5DO8A 3F2BA 4GIEA 1XYBA 3WD2A 1RM6B 4DUXA 4G2DA 2G3FA 2XGIA 4CN1A 2POZA 2HPMA 1WZMA 4HVXA 4PZVA 1GQLA 3IUDA 3W01A 4U33A 1C29A 1OFOA 2VC6A 3YPIA 4GYJA 1YHTA 2QDEA 3A64A 3W86A 2BZNA 1LL4A 3PBGA 4OUIA 4AZ7A 3B0UX 3P8JA 1GJPA 4ILSA 5A3HA 2DT3A 2QS8A 3LRKA 2HQMA 1TSIA 4XKMA 1LWIA 4LEFA 3HURA 4QX4A 1XRFA 2FTYA 1VFTA 3WX7A 1V59A 2ZVRA 3PTKA 1GXFA 3FFSA 3GG8A 3MCMA 2RHGA 5DCDA 1TE1A 1V6VA 1DIEA 5FACA 2VEPA 5JUVA 2CITA 1E9YB 5CPTA 3THQA 1KFBA 3IIXA 2DJLA 4JZ5A 2AQWA 5CGQA 3U0HA 1S7MA 2V69A 3QPEA 2VEKA 3O0FA 3BMVA 3HQ1A 3PWGA 4DO4A 1H7PA 1M53A 1NAL1 2D0HA 1U22A 1VEMA 4R7JA 5BOOA 3V36A 4Q6XA 1CGUA 4NUWA 3AFBA 1VS1A 4P7NA 4JTKA 3SRHA 3V1PA 2KAUC 4MZYA 1W3LA 1STZA 3QKZA 2GJPA 5AHIA 4D6DA 1BXNA 2RUSA 5F4XA 1GG0A 3TN5A 2A3AA 5FF2A 4W88A 4RKAA 1B4EA 3LMYA 2XG9A 4J35A 3ID7A 3L4ZA 3EDFA 2OO6A 3CT2A 2JKEA 3LGDA 1O60A 3RCMA 4S39A 1CLXA 2CLMA 7TAAA 3AMLA 3B8UA 3TC7A 1MO9A 4IM4A 2IKHA 5CLWA 3C8FA 1EJTC 3WDHA 3G18A 3O0HA 4FNQA 3WIJA 1MEIA 3UQNA 1RZMA 1W3NA 1GEUA 3L67A 4RW3A 3NZGA 1JPHA 5A6JA 3WJYA 3KCOA 1TV4A 4MB3A 3CUIA 4NT0A 3LB8A 1NVMA 4K8GA 3QR3A 1WDDA 3CASA 4H7ZA 1B5TA 3QR1A 2P53A 5FEXA 2OZTA 2E40A 3P5YA 3HZ3A 3VIJA 4XAGA 1ZZMA 1W1VA 1XLIA 4W84A 1DQXA 1RD6A 4FA3A 1XPYA 1BFNA 4P7RA 4DIAA 3C0LA 4TXEA 1HJXA 4O0ZA 1TFVA 4G1KA 2ZZ5A 4ZMGA 3GWQA 3REQB 3PG8A 3VCCA 1KD0A 1O4UA 2OWWA 2GLKA 1W1TA 1PZ2A 2CC0A 4GKLA 5C54A 2WHLA 1JCMP 1CTNA 2G5WA 3TNBA 1UP2A 4HMEA 3LCGA 3W81A 4B5VA 5IDZA 4LC6A 4H4QA 3HGJA 4BQ2A 1FHLA 1MUMA 2FGLA 3HOJA 2H8ZA 2ZRYA 1N62C 2VFEA 2WMHA 4AC1X 1RLCL 3UJFA 2FJKA 3ZLHA 1ZSXA 4PMYA 3W83A 3JR2A 2QVNA 4B3LA 1XL9A 5CZTA 1A5BA 4XIMA 1I0BA 5EBAA 3AI0A 1SR0A 3BAWA 4YTUA 1D7FA 2TYSA 1FWEC 2J7GA 8XIMA 1HL8A 1MDRA 5JU6A 1R3WA 1S46A 1TJ2A 1PE1A 2IPJA 3A7AA 2AGKA 4PTXA 5ECVA 2YCLA 1NH6A 5HANA 1EJWC 1TG7A 1CXIA 5EMKA 3MCOA 2FKPA 3LS9A 1MVYA 4JPGA 5BXTA 2H6RA 1P0NA 2GQ3A 3T2QA 1F9CA 3WL0A 1EFZA 6ALDA 3C3UA 1TIMA 4PB4A 3CGTA 3W4RA 1BGGA 3N2CA 5D9OA 1TQXA 2WVUA 1ZGDA 3FDGA 5CKSA 3FG2P 2VDGA 4LFYA 1KM3A 3ITLA 2WMIB 4QDWA 3KWSA 4S2BA 1ZNNA 1KGWA 3T81A 2A7NA 2XFYA 1NF7A 3VGDA 1N8IA 4HD5A 3MHFA 4QISA 3WMBA 3I10A 5CPQA 1O5QA 1KBIA 2BGQA 2O92A 1HKWA 5A69A 3AMKA 4HU0A 1FFRA 3NQBA 1OF6A 2VC7A 5FKYA 3MUY1 2C79A 4H4RA 3AHVA 3M0MA 4KEUA 2H9AA 3GNOA 2Y6ZA 1V02E 3NQ8A 3NQCA 3O3RA 2HRWA 1K02A 4B4HA 3S2JA 3WD3A 3R07C 4DWSD 1JF6A 1SO6A 1UWAA 3EOUA 3AZTA 4HZ7A 1C90A 2PC8A 3IVSA 3WLHA 3O16A 3S5SA 1PCWA 4XQ6A 3OA3A 3SB0A 4JNZA 2OCZA 3TMLA 1MO0A 4AWEA 1PKNA 4M19A 5MHBA 1X8FA 2FB3A 2Z0IA 3ARYA 1MUCA 5KMYA 1GCYA 3NQFA 3RYSA 1IXQA 4R33A 4DO6A 3BZJA 4DN1A 3P74A 4IJRA 2CLLA 3WNLA 3WD4A 3M07A 4OBSA 4WQ6A 2V81A 3EGJA 1V08A 3E96A 2E3ZA 3APGA 3A3HA 5HMDA 3JVAA 3UESA 4CU6A 3ECQA 1YTKA 2OEKA 2WYSA 2P10A 3ZZ1A 4QNWA 2NSXA 3TDFA 1CDGA 1WZAA 2G3MA 4Q4KA 2FVLA 2QHAA 1B90A 4LQ1A 5TNVA 3CAVA 3STFA 2F7FA 2J88A 3EWWA 3QFWA 4DWDA 4LBRA 1GZ1A 1LT7A 2YVFA 3NO1A 1UQYA 3CLMA 1Z9AA 1F3WA 5J8LA 4V27A 2NV9A 2YKKA 4W8LA 1RJQA 1BRLB 2QAFA 3B40A 1M6IA 3PWIA 3QYQA 2O7SA 4ONVA 2E28A 2Q3OA 2DT2A 2I17A 2BGNE 1Z7AA 3LHTA 4FHAA 2CDUA 1NWRA 3UR8A 1OVDA 4Z0SA 4PMUA 5A6BD 4IPPA 4NU7A 3UXIA 2X42A 2DY3A 1GRHA 1MDLA 4HA4A 1FHVA 3DI0A 1CXEA 3OG2A 4JTFA 3FAWA 2E8ZA 4AU0A 4MWAC 4N42A 2WZIA 1UWIA 4Q8OA 1A5UA 4V33A 3DKJA 2CFYA 1R9XA 1Q66A 4C6QA 4L80A 3C2VA 4KPRA 3SBFA 4HYVA 2X0SA 1R3YA 1YX1A 1W2VA 3SQSA 5BWFA 3ANUA 4GGBA 5U1OA 1BQCA 2HCVA 4ECLA 2A3EA 2WC7A 4Q8UA 3O7UA 1YXCA 1JQXA 1US0A 4CQDA 2WCAA 1IT0A 1RQEA 3ZSTA 3W1QA 3VAVA 4FX9A 1XIEA 1T40A 1AZ2A 4OJYA 3EPMA 4PRTA 2ZRVA 2QV5A 3A3WA 3WFAA 4BEUA 1RVGA 1J5TA 3OQEA 3VX1A 2YVGA 1W1ZA 1SYTA 2F2HA 3MUCA 4RXFA 2V5JA 3COTA 3UNDA 2YB4A 4PSPA 5F4SA 4UR8A 2HE5A 4EX4A 1Z89A 3GD4A 3VNJA 1H1NA 1ZS2A 3LM3A 1R7OA 1MZRA 1FECA 4J56A 2GJXB 4HMNA 1CGXA 3PF3A 2CESA 4R27A 3URNA 1XS2A 3ZS4A 3B03A 3PZMA 1Q6FA 2XVNA 4LNCA 2JEPA 3V75A 2C3CA 1Q45A 2F9RA 1XD0A 3P2VA 3WUEA 1CXHA 2WAGA 2QJGA 2BOFX 2YL5A 5I3KA 4UFLA 2QT3A 1L6SA 1EGZA 2W4XA 4GVGA 4C7DA 3NPWA 3VNMA 4F2UA 1QK0A 3VZZA 1NTHA 4L6OA 2H3DA 2WPBA 4HOWA 4HBKA 3SO7A 3LXAA 2QF8A 5CLTA 3QOMA 1XSIA 1RA0A 4YPJA 3M0IA 3QMRA 2QUVA 4AD5A 4WSKA 3AHTA 2HS6A 3CV2A 5FS9A 1UPMB 1IIHA 1UWSA 3GVRA 4TUFA 3WQGA 1LUCB 2ZXDA 3C3NA 2XINA 2E77A 2O9RA 1FWGC 3BGJA 3HMCA 4XWUA 2C19A 3QW3A 1Q1WA 3VIFA 3UWVA 2CZDA 4IPIA 3RHGA 2P50A 4R34A 3WBWA 4UQ9A 2W62A 3LY0A 2BXYA 1BXBA 4MAVA 4JTAA 1FUYA 4C1KA 3AWOA 1GVSA 4ZO6A 1WZLA 3G1SA 2RABA 3L2LA 2E09A 5I24A 2ZZ3A 4MB1A 3WH5A 4J28A 1PX3A 1NU5A 4KT2A 3C0JA 5C9ZA 4O1EA 4PH6A 3A4XA 4GI4A 3XISA 4DPQA 4DQWA 4US5A 1T0OA 1K9DA 2DW7A 3MMTA 1U1HA 3MB9A 1JNEA 1P0EA 5GJMA 1FWTA 1FDYA 2W3SA 2EG6A 3CPRA 6REQB 1LQ0A 3M46A 3SCVA 1OHLA 1H11A 2AAAA 4N2YA 4PUDA 3DBPA 3T44A 3APYA 4GCAA 3MDUA 2ZZ1A 5D2XA 1QRQA 3KLKA 3L4UA 4GI6A 1DTUA 4N4PA 3MI6A 1W1A1 3OTRA 2TSYA 4L61A 3CYVA 1LP6A 4CD7A 4OT7A 3EB4A 3TUUA 1M1BA 2BY3A 1E1FA 4KCWA 5I2UA 2ZYFA 2VRKA 1XPGA 1R9YA 2C15A 2CEQA 2I14A 2RAGA 1UMYA 3KLLA 2VRJA 2EJAA 4W5ZA 4M1BA 2WV8A 4CD4A 3K46A 1CB7B 3IEBA 4GJIA 3R0KA 2WJDA 3EOOA 1LWHA 1F6PA 4E2OA 4X60A 2IQ0A 5EMJA 2FTWA 4L6DA 2RKXA 2I5IA 1Q3NA 1ZAIA 5LIYX 3BW3A 3CV6A 1NF0A 1VPXA 3R1ZA 2AQVA 2ZUSA 3WD0A 3GC4A 4IP7A 3S6TA 1QHPA 1GJUA 3MTWA 3NOYA 3W71A 5A6KA 2DSUA 1KC7A 5G1YA 1RK5A 1EDTA 3UZZA 2TPSA 4IT1A 3VYLA 1GVFA 5KSWA 3QR0A 1W3KA 3G3MA 1XINA 2P8CA 4LB4A 2ZC8A 5FJOA 4EXQA 2GSEA 1JXKA 3BAYA 3OVPA 1OD8A 1OGSA 1QVBA 2X1UA 1KTNA 3E0FA 4AYSA 1OCQA 2QMJA 3AO0A 5D8WA 1PPIA 3EZ4A 4H9XA 1EX1A 4ZA0A 1SMAA 4Z1AA 3VDGA 4L65A 1B30A 3KRZA 5E0CA 3R6IA 2QEZA 4B15A 3URQA 1C8YA 4QLLA 1GTHA 3P82A 1G4SA 3VMOA 3GR7A 1ZQ5A 1VC4A 2PB1A 4L4PA 5TR3A 4QE1A 1XRSA 3CO8A 2ZX6A 3VILA 3PAJA 3TZFA 3CZKA 3VIPA 1PWLA 1Q6RA 4IMGA 3WY1A 1C3FA 1ESWA 1Q4NX 1YDNA 5E9AA 1UD8A 2WMIA 4JN6A 3AMGA 2OB3A 2E6YA 2GDQA 3THCA 2VCAA 3TXVA 2CWXA 2R1PA 2CLEA 8TIMA 4K1WA 1BG9A 4GVHA 1TREA 3ARRA 4JEJA 4YXGA 3SR7A 4I9JA 1H51A 3SGGA 1R9ZA 1HZYA 1UC4A 2VP8A 1YEYA 1AQ0A 4GVIA 4A2SA 1V02A 2C3ZA 3TTOA 4EPBC 4HA1A 2ZVIA 2J7CA 4HGXA 3W07A 1XCXA 3V16A 4KIRA 4GKTA 1KV5A 1TR9A 4JL2A 4J3XA 2DZAA 4R5EA 4LS0A 1N61C 3BW4A 2PE4A 3NZRA 3TJLA 3QY8A 1HJVA 4N7QA 1XYLA 4BQ3A 4W9TA 3O05A 2VR5A 3NSMA 3DFOA 3A7UA 1OWQA 1SZNA 4FLSA 4P7QA 2O9OA 2AMXA 1BYDA 3MO7A 3HPFA 4TVDA 3CEUA 1OJXA 3FYOA 4HZ8A 2P76A 2WP6A 5FF0A 2WPFA 1HNYA 1R46A 4R7WA 4H01A 1LG1A 3EWYA 5DRCA 2WNQA 2F6KA 4HPHA 5AECA 2XN0A 1FO4A 3CHDA 2DFAA 2ZXBA 4Y9AA 3VNKA 2DUAA 2J7FA 2G4JA 3VXGA 3VMNA 1H7RA 1J11A 4AWTA 2E5AA 3CAKA 4J27A 3OHIA 1QW8A 1JCNA 4DNMA 1DTNA 3BJSA 2QJHA 3FJ6A 1Q2SA 3VKKA 3Q65A 2QJJA 2OEMA 5KETA 4R53A 3UY7A 3ARUA 1AW2A 1YE6A 4JQ4A 4YVPA 1OINA 4DO5A 4CD5A 3W82A 1F05A 5E70A 3AS1A 3CZEA 1TRIA 4QJ4B 3S2CA 5ER0A 5AZ0A 2AAQA 3AWNA 1BRLA 3G1DA 3MYOA 4C5YA 3NEHA 1NDZA 1L6GA 3SY5A 5HMSA 1GVYA 2OVLA 3FEQA 3GVVA 5EMUA 1ME9A 2E5CA 1W9DM 1NDYA 1Q6CA 3CPGA 3WH8A 2J9ZA 3W7JA 1JROA 3AXHA 2TPRA 3N6JA 3P7YA 3I7RA 3SCSA 2ZZ6A 1LTDA 4M56A 4IZGA 4UQBA 1D2KA 4XBKA 3UD6A 5KZDA 1VAHA 3CEPA 5EMLA 3EKZA 3IIOA 2AL2B 1RUSA 2OO0A 2Y63A 3T1GA 1XYZA 5DMYA 3Q67A 4FNTA 1UKOA 1E40A 4HQVA 1IQ8A 2INZA 4G7EA 4XZBA 3RJYA 4AXNA 4EM3A 1O5RA 5DEZA 3QZEA 4ZQCA 4BKNA 3GH7A 2XM1A 3LD5A 4ZTXA 1TWIA 1UA7A 2XFWA 3M5VA 1HKKA 1GRGA 3F4DA 4B2DD 4A3RA 3VUPA 2YZRA 4DO7A 4RX0A 2BOEX 3DG6A 4MB4A 2GQ9A 3I3DA 2VRQA 5AHLA 1FEAA 3H2FA 4ZEPA 1FH9A 3R25A 1J0KA 4BJHA 2QCFA 4JOMA 4IP5A 2VZUA 4URIA 2VDIA 1PWMA 1F8WA 1IEIA 2I5QA 4PTWA 3U4AA 1FFVC 3AU2A 5K9DA 1E0UA 2FTPA 1X96A 3BLKA 3WUFA 3OBKA 4E2DA 3LYEA 4W86A 2F5ZA 1OX6A 4HU4A 4I8YA 1RY8A 2CLHA 1E73M 1OIFA 1XF0A 2GJXA 1KWKA 3WDJA 1X39A 3Q6JA 1H49A 3V18A 2GZXA 2CPUA 4GZJA 4N6FA 3G3DA 3BZGA 2FVMA 2NVDA 1GVIA 5TAOA 1W54A 4JCMA 4MFDA 3PUEA 4NZJA 5H8UA 4RV3A 2FHFA 1JPDX 1KQZA 5A6LA 4WDTA 1CGWA 1J6OA 1C9DA 3SCRA 3STEA 1KBBA 1EO7A 1TZ9A 3CV7A 2FPYA 3TAKA 3GKAA 4HU8A 3L5OA 3NVVB 4P7LA 4JTCA 3GG0A 4MYXA 3W2NA 3BQ5A 5KITA 4RDYA 4PCPA 3V0TA 3P5ZA 1QBAA 1GEHA 1TE6A 4C6FA 3W29A 4R9OA 2INFA 1Y65A 1ZBCA 1QT1A 4WKHA 1YQZA 3M5YA 4UQEA 1GRTA 4JTSA 5FJUA 2VR2A 2X7VA 3Q4DA 1WKYA 5CPOA 1VJSA 3B4UA 3QHNA 2XIBA 3W1LA 3TYEA 2CXGA 2CHOA 1DQWA 4Z1YA 1DNCA 2PU1A 1AQFA 1A47A 1CWYA 1TV5A 1VRXA 2HK1A 3SCNA 1S5VA 2FFIA 3L66A 3RLUA 3NXFA 2CKRA 5HJYA 3VABA 5HR6A 3EXTA 3P67A 1EYEA 3T0TA 1DJXA 2R82A 3HGSA 4H4WA 1Q13A 4QQUA 2WSPA 4UTTC 1SO4A 3NVTA 3ZJ8A 1V4YA 2CHRA 4GI9A 4HMCA 4IX0A 1LORA 3UYIA 3KOZA 2B7QA 1FXQA 3II1A 3R79A 2PRLA 1JEHA 6REQA 1IE7C 1H41A 1DP0A 3GXNA 1NHSA 1RD5A 2YPIA 2R1MA 3N17A 3NUKA 4U31A 3WFZA 1WBHA 2GDUA 4AVFA 3GD6A 4AIOA 3TWBA 4J3SA 3M7WA 1W5QA 3QF0A 3W7OA 1QXLA 2VX5A 2W79A 3N2TA 4O1FA 4GI8A 3MI2A 1KR0A 1EA0A 4KFNA 4KRTA 3MSRA 3PJXA 5I3FA 2PDXA 3M0ZA 1T8XA 2DZVA 3KM8A 4D1JA 3NZ1A 4J40A 4AIUA 3NPXA 2EJ1A 3SRKA 1NHQA 1B57A 1DIDA 1OK6A 4ICCX 3ALGA 2FJUB 2R9ZA 5LHFA 3BO9A 2J6VA 4KKXA 5G1MA 3GAYA 3MVIA 5HUPA 4LVFA 3GDLA 3VX0A 1TPEA 2WZEA 1TTIA 1NWUA 1JCTA 5TD4A 5A94A 4JDRA 2CNCA 3RAOA 1KNWA 4DZAA 4WDUA 5CZSA 1SMDA 3N19B 2EPHA 3QW4B 1I2RA 2D22A 3ANYA 1PTGA 3HJEA 3EBVA 2WB5A 2H90A 1MEWA 2XVGA 4UR7A 1XBYA 2W55A 4FLQA 4ZSUA 3DFNA 1MWOA 2Y5SA 1E0WA 1S38A 1TCDA 2QVHA 4S1FA 3T05A 1ZCCA 2NT1A 4RCXA 1XBVA 4IUGA 4HZMA 3V35A 3KWXA 4Q8MA 3OG3A 4JTDA 4RE4A 1F4HA 1SSGA 4OHQA 3W38A 4FLOA 4KFOA 2QIIA 1D3GA 3VKDA 1XRVA 4IIHA 1KXHA 3EMZA 1RP9A 5CPSA 4BY3A 4HNLA 5TIMA 1GESA 2ZUMA 1SPQA 4H8NA 4JTTA 4UMAA 4NQ1A 2NWSA 2WKLA 3PJUA 3M0YA 1F76A 2ZC1A 4GXWA 3URAA 2QIWA 3E02A 7TIMA 3HQNA 2DUZA 1TJ0A 2HS8A 1FX6A 1ITCA 4R85A 1RBLA 2VD8A 3N18A 2WCSA 1EHAA 3MHGA 4DJDD 1W5OA 2YDQA 2A0NA 1SO3A 3GDKA 2OKOA 3WQDA 3B8SA 5C55A 3LXBA 5J5RA 5LIXX 3K1GA 3NFUA 4IQJA 1TX2A 2NUWA 1EGMA 2YLLA 2LLEA 4HK7A 2GVLA 1JNDA 4A3UA 1N5XA 2WVSA 5U7SA 3URBA 2BXVA 3NL6A 3VNIA 4KW2A 3DZ1A 1X98A 3DJJA 5FJRA 1J0HA 1P0KA 4LAUA 3UT0A 3N4EA 1BF6A 4MNJA 1W2PA 1OYBA 3BCDA 2G3IA 3MWCA 2XFRA 2CZFA 2XN2A 5GNZA 1GOMA 5BZAA 3CGEA 9XIAA 1HG3A 1ZMDA 4ZXLA 3UWQA 1OFEA 2V9DA 4LWWA 2D20A 4PTDA 2FMOA 3LUTA 4G56A 3U5YA 5JIPA 3W7CA 1F74A 4X0VA 4P8VA 1XKJA 3I7SA 1TA3B 1V3MA 3EX6A 3LHVA 5M17A 2FLIA 3W7LA 4ASTA 1OFDA 2R24A 2WNNA 3UXLA 2OT0A 1XBXA 3TTYA 1JZ6A 4ZQPA 2HNHA 1A5SA 2F6UA 4P61A 2UBPC 3FA3A 4L6HA 5ABTA 3IPWA 1EJSC 3IVUA 1ICPA 4GRTA 2OR2A 9CGTA 1PZ0A 1N60C 3B9JB 1OB0A 2IKGA 5IHSA 3AUJA 4EK7A 1UKSA 3DG7A 1GKRA 4HK5A 4JAWA 3VZYA 1QUMA 1HN1A 3D3FA 3LHUA 1KM6A 3PPHA 3M7SA 2E5DA 3AJXA 5H6HA 1NIUA 4J2MA 1UH2A 2P0OA 4GXMA 4F48A 3AIUA 4FZIA 1DWGM 2CU0A 3KCJA 4NNBA 4KWVA 4ZCWA 3FV9A 3H4WA 2AAMA 3TOYA 1VFMA 3T4WA 3H2AA 2R94A 2VCCA 1OCJA 3WH6A 3AS3A 3UU0A 4RNHA 2V5DA 1XLFA 1XLLA 1BQGA 3OGRA 3GTXA 5FEZA 3WBAA 1R38A 4NAFB 1ZJIA 1OX4A 1R3QA 4GFIA 4QDMA 2DZWA 1BZLA 2OU4A 2AL2A 3TR2A 1CIUA 1IWAA 1FHDA 4IQDA 1TPB1 3CB3A 1S2VA 1F5ZA 4F40A 1UZHA 3EUB3 3S1UA 2CWNA 4B5WA 3WUBA 4HN8A 3N3TA 1HJSA 1JAKA 3ITYA 3L4TA 4JEQA 1G4TA 2PTDA 3O8AA 1CGTA 4KCVA 2CBUA 4JQ1A 4Q7BA 1PX4A 3N13A 2XIQA 4HA0A 5GJPA 3OVQA 2PDFA 2GR3A 5LIWX 1W5PA 4JTRA 4RLIA 3KEHA 4XSMA 2WMGA 1QO2A 4E4UA 4TR9A 5AC8A 4W4QA 1NP0A 2V6AA 1MXDA 2WHKA 4AD2A 3RCNA 3MHUA 5U4NA 3FEMA 1A4MA 1BKHA 1XCFA 2A2IA 2ZX7A 4J3WA 5F2IA 2ZUNA 2VELA 1TWWA 5FA5A 3WJZA 1IXNA 1F4AA 4UOZA 4JGDA 3O6CA 2PU0A 1UOKA 3RMEA 2FB2A 3IARA 4LVBA 2QJNA 1DORA 3UWUA 4NEVA 3BDKA 3DHUA 4TMBA 1EL3A 4ZOAA 3WNPA 3GAKA 3VGEA 1JYVA 1E56A 1KFWA 3QGVA 3U5UA 2PP0A 3MUXA 3E9AA 5DN1A 2XUCA 3T2OA 2X0HA 1GVOA 4UBPC 4Q33A 3L65A 1JI1A 5I6SA 2WANA 3K8KA 2J7EA 2XH2A 2CBJA 5D38A 3Q2DA 4HMDA 2BOGX 2F2KA 2BY1A 5CG7A 4UOJA 4YYFA 3TFXA 4NRSA 3F5KA 5GRTA 2IW0A 3GYEA 4GYPC 2WW5A 1VIZA 3TEVA 3NG3A 1OCNA 4QAIA 1Z6KA 4ZOBA 3W76A 1U5HA 2JE8A 4U28A 4AD1A 3ZWSA 1W3JA 1OABA 4CU8A 3DFSA 1UZ1A 3BLPX 3PZNA 1JDDA 4RDWA 3A22A 1IT8A 4NP7A 3FJNA 2PZ0A 4V1XA 1L2QA 3DEQA 2GYIA 1DPMA 2BP1A 4O8RA 1KFKA 3K8MA 5ABGA 1CENA 4I5RA 2ASHA 5CGTA 1JVNA 2ZDRA 5BW6A 1KRAC 2EPMX 2YGYA 4CNNA 3CU2A 1HJQA 3WBXA 2Z29A 2V8ZA 4W5UA 2VZOA 1KB3A 4LPCA 1BWCA 1WXYA 1XGEA 2AKMA 4PFHA 2PWDA 3LHZA 3USBA 1PKLA 1QPKA 4TTUA 4OV9A 3SCOA 4NJHA 3HMJG 4NVTA 1WOAA 4Y7EA 2VUYA 2E1WA 1WX0A 3S4TA 3UETA 1V0NA 5I5RA 3CL6A 5DFAA 3W2JA 2OQLA 3LCHA 1LRNA 1GEQA 1SR9A 4MNKA 3QTGA 1GRAA 3ARQA 3WF0A 2WP5A 5A8GA 4FXFA 1XYCA 3C61A 3R94A 1M3UA 3TMQA 3TQVA 2ZTJA 1OZQA 4AX7A 2NQJA 4HSHA 4V1YA 3M41A 3CAWA 1UD5A 4US6A 1X1ZA 1U5JA 4PBGA 4JIHA 3PJTA 5F2MA 1GHSA 4QHRA 4NNAA 4JFWA 5TF0A 3VUSA 2WPCA 3WG6A 1JJKA 4J3VA 2Y7GA 1R2RA 2WSQA 4JTLA 1J0JA 2V30A 1ZHAA 1H7NA 1BVWA 3LHWA 3SIZA 4FLRA 2AL1A 3O6YX 3VU2A 5A6SA 1J4EA 3C2EA 4IISA 4AMAA 4NZ5A 1LG2A 4AZGA 1LDCA 3AYSA 4EXAA 1E6NA 4WKFA 2QCHA 4ZQOA 3LN3A 4H19A 1XUZA 2RH9A 2GRTA 2GQAA 2YOCA 3OODA 3P0WA 1W1PA 4GRSA 5C2XA 4JXCA 3DUGA 3WQPA 2Y4SA 4EVZA 2C91A 4YHGA 5T26A 4NZFA 4X9SA 5LNWA 1A0DA 1WUEA 2AGTA 4AHOA 1UIOA 1S2UA 4XKYA 1GW9A 1KKOA 2WBGA 2PODA 3VM5A 3PANA 2ALRA 2Z25A 4NZ4A 4DEFA 4X9YA 3N9KA 1UASA 1P1MA 1W0MA 3QM3A 1J6PA 1Z48A 4FB7A 2J66A 1SSDA 1TPVA 3CHCA 3CLWA 1DIOA 4GCXA 2GH5A 2GSJA 1PO9A 3O06A 2VOMA 4UMBA 4P8UA 1A5CA 1M5WA 2D1ZA 1L8PA 4N0RA 1NPXA 3W1MA 1MOKA 2ZFAA 3RM4A 2R14A 3ONBA 2WSRA 4B5SA 3ARVA 3OIHA 5XIAA 1VPYA 4ERAA 3APTA 1ZP4A 3UGRA 2ACUA 3IGSA 3XINA 3BXWA 3LNPA 1WB0A 4DXVA 1I8JA 3B8DA 1UR1A 4L5ZA 3KL0A 2UY3A 4AEOA 1R3SA 5C9RA 3SCPA 4Q8NA 3A9IA 5T8GA 1FCUA 5IOBA 1EIBA 5M5DA 1E6XM 1P48A 4IH3A 5I06A 1SFTA 5ENLA 2YW4A 3EWBX 1WUFA 4KEZA 1DXLA 2PMQA 2DZTA 1QWGA 1KXVA 2XN1A 3GUGA 3GUWA 3TYBA 4HNTA 1FH7A 2QCDA 3KDNA 1FIQB 2A3LA 4S3EA 1QTWA 5BWAA 3CK5A 4O16A 4JHOA 4PSRA 1FWJC 2YQUA 1XLEA 1QCWA 4M29A 1KW1A 3A13A 2YXXA 2XZ7A 1TUXA 3EEGA 2J7HA 1I2NA 3GHRA 3W02A 1R2TA 4ADUA 3A3XA 1W5NA 4MHBA 1H62A 2VFIA 3NL5A 1JRCA 1XYFA 2WM0A 2X1TA 1ZAHA 4F4RA 4XB3A 3GBEA 4CQCA 3KTCA 3ZR4A 3RR4A 1GOKA 4DJEC 2QUUA 5HATA 1EO5A 2XSBA 2ZICA 3WLTA 1ICQA 3RX3A 3UJRA 3GHTA 1JI2A 4EIVA 2X8RA 3B9DA 2A85A 1W56A 2OYMA 4HNVA 1W8GA 5E6ZA 4H3DA 4UIOA 1NP2A 1RH9A 2VHLA 3DK8A 2EF9A 2V63A 4H04A 1ENUA 1UHVA 2VGGA 1YNYA 2PDKA 5BXSA 4JFSA 1RQBA 1N63C 3WDPP 4A2RA 2ZRZA 4P8WA 5K9CA 1YBQB 3KP1A 3M0LA 2CXEA 1QU4A 4O52A 1X7IA 2VEMA 2WXDM 1WCGA 1