3MUCA

Muconate cycloisomerase variant i54v
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
369
structure length
360
Chain Sequence
b'ALIERIDAIIVDLPTIRQQQTLVVLRVRCSDGVEGIGEATTVGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MUCONATE CYCLOISOMERASE)
publication title Structural basis for the activity of two muconate cycloisomerase variants toward substituted muconates.
pubmed doi rcsb
molecule tags Isomerase
total genus 138
structure length 360
sequence length 369
chains with identical sequence B
ec nomenclature ec 5.5.1.1: Muconate cycloisomerase.
pdb deposition date 1998-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3mucA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3mucA01
3U9IA 3RCYA 1FHVA 2DW7A 4K2SA 4JN8A 1E9IA 4F4RA 4GYPA 4IT1A 1XPYA 2XH2A 4HCHA 3U4FA 4G8TA 2P3ZA 1XS2A 2P8CA 2OQHA 4MGGA 2GGIA 3R1ZA 3QLDA 1JPMA 4E4UA 2FYMA 2GGGA 2PS2A 3CAWA 4IHCA 4A6GA 5FJTA 3RITA 1YEYA 4M6UA 3VFCA 5IDZA 4GFIA 2PPGA 5ENLA 1EBHA 1EC7A 3TJ4A 2MNRA 4K1WA 3UGVA 3P0WA 2OZ3A 4J3ZA 2OLAA 3T6CA 3V5FA 3MWCA 3P93A 4H83A 3JW7A 2PP3A 4KEMA 3I6TA 3K1GA 4HN8A 4IZGA 2PTWA 1SJAA 2RDXA 2NQLA 3H12A 5BOEA 1EBGA 3HPFA 1R0MA 3SN1A 3UXLA 3MY9A 3DERA 3GO2A 2HZGA 1BKHA 3R25A 3FXGA 1P43A 4E6MA 4E5TA 1SJDA 3I6EA 3TWBA 3NXLA 1MUCA 2PTZA 2PU0A 3DG3A 2XH4A 4H2HA 3V4BA 7ENLA 1L8PA 2DW6A 6ENLA 5FJPA 3I4KA 4DYEA 2PP0A 3PWGA 2AL2B 3IJLA 4A3RA 4MKSA 1MNSA 2O56A 1F9CA 3RGTA 3ZLGA 3CT2A 4H1ZA 3MQTA 1JPDX 4HPNA 3GD6A 5EU9A 4A35A 3ZVIA 3DG6A 3R0UA 3PK7A 1ELSA 2HXTA 4E4FA 2OVLA 3CXOA 3MSYA 3GY1A 3H7VA 2OQYA 3DG7A 4K8GA 3OW1A 2FKPA 4IP5A 5FJRA 3BJSA 1JCTA 1KKOA 3ES8A 3NO1A 1OEPA 3ZLFA 4Z1YA 2AL1A 3UCDA 3ZVHA 3R10A 2QDEA 2OPJA 4IP4A 2ONEA 2OX4A 3DGBA 3NZGA 3GC2A 4HCDA 2QQ6A 3P3BA 3UJEA 2HXUA 3Q4DA 3STPA 2XGZA 3SBFA 3FJ4A 3IJQA 2AKZA 3N6JA 1P48A 2PGEA 3VCNA 1NELA 3BSMA 3V5CA 3IK4A 4J1OA 3R0KA 3THUA 2PU1A 4GISA 3SJNA 3N4FA 4E8GA 3QTPA 3DEQA 3D46A 1KCZA 2PSNA 3OPSA 3V3WA 3Q45A 4DN1A 3UXKA 4HYRA 1MRAA 1MDRA 1MDLA 3ZLHA 3N4EA 2GGJA 2XH0A 3RRAA 3VDGA 2OO6A 3S47A 3CB3A 2POZA 3IJIA 3TJIA 2GGHA 4JHMA 3UJRA 4ZA0A 3DFYA 1SJBA 2CHRA 2I5QA 3FV9A 3VC5A 3TWAA 3OTRA 3QKEA 3OZYA 3OZMA 3QPEA 4IL2A 3JVAA 4DX3A 3DFHA 4ZCWA 3RR1A 1RVKA 4M0XA 3SN0A 3MKCA 3T8QA 2AKMA 3EKGA 3FCPA 3FVDA 3KUMA 3ZVHB 3DIPA 1TZZA 4JN7A 3UCCA 4G7FA 3FYYA 3JZUA 3VA8A 2HNEA 3T9PA 1EC8A 2PGWA 4DWDA 3TW9A 3D47A 1TKKA 3RO6A 3TCSA 2P8BA 2PCEA 2PP1A 3BOXA 4KWSA 3UJ2A 2PA6A 1PDYA 3PWIA 4GYPC 4GIRA 2QDDA 3EEZA 1JDFA 4YWSA 4H19A 2ZC8A 4FP1A 3DESA 2GDQA 4GMEA 4ENLA 3TQPA 1WUEA 3CK5A 4MMWA 1TE6A 2QVHA 3VC6A 2QJMA 1ECQA 5BOFA 3CYJA 1R6WA 3UJFA 3SQSA 4HCLA 3PFRA 2XH7A 2P88A 2OZ8A 3S5SA 4IL0A 4DHGA 1DTNA 3SSZA 2P0IA 2MUCA 3DDMA 2GL5A 2OG9A 3VCCA 2ZADA 4GGBA 2XSXA 1EC9A 4HNCA 3B97A 4X2PA 5J04A 3UJSA 2PTXA 1BQGA 3R11A 1NU5A 5FJUA 3OP2A 3QN3A 1SJCA 1KKRA 1IYXA 4HNLA 2OZTA 2QJJA 2PTYA 1PDZA 2QGYA 4KPLA 2OKTA 4FI4A 1WUFA 5FJOA 3ES7A 2PMQA 3MZNA 1FHUA 3N6HA 3SN4A 2AL2A 3T4WA 3ENLA 2GGEA 4Z17A 1W6TA 3TTEA 4KT2A 3H8AA 4ROPA 2PODA 2GSHA 2QJNA 3TOYA 4GGHA 3NFUA 1ONEA 4DXKA 1KD0A 3H70A 3MUCA 4EWJA 2OFJA
chains in the Genus database with same CATH superfamily
4QEEA 3U9IA 1YDVA 1S5WA 3W7HA 4JTGA 3A22A 1VEPA 5I24A 4Y8FA 4Z2IA 3IACA 4WQ6A 3TSMA 1GJUA 2BC0A 2TODA 1UZDA 4YHGA 3NTYA 3SY8A 4NJGA 3PUGA 1L9WA 3GIPA 4LH8A 4HK5A 4G56A 2EQDA 1TUFA 3QLDA 4AIBA 1NOWA 2XVLA 3E5PA 3WQVA 3LBOA 1XFBA 1LROA 4DNMA 1QTWA 3SGUA 2EQ6A 5CPQA 5HDRA 2GR0A 2GSJA 5FJIA 1W8GA 4LPCA 3KVJA 2JF7A 1UBPC 2TMDA 4MOZA 1KA9F 3OHIA 1IT7A 3GKFA 2PDYA 3RK8A 1CXHA 2WVSA 4QJ3B 4HD5A 3T09A 3FIGA 4UFMA 4IOTA 4JQAA 1YX1A 1TTJA 1TE1A 1V5XA 5LNVA 1HKKA 2GUBA 3WK0A 3PZQA 4KEMA 1XSKA 4ZQOA 4IZGA 1O68A 3OHMB 1HXJA 4LW7A 1UZ4A 3CUIA 1E6NA 3LK6A 4IH3A 2JK6A 1QNPA 4NP7A 1BXCA 4Q8NA 3T2OA 3TN3A 4QR6A 4Q8PA 4XAFA 1SJDA 1TPB1 4CD7A 2PU0A 1E73M 3TMLA 1GW1A 4N4QA 1VLIA 1BWLA 3V4BA 2CIPA 2PE4A 1UPPA 1JZ5A 3OEXA 1CWYA 1NFPA 1J18A 2ACUA 1HG3A 2YDSA 2VEPA 4IFOA 3W7RA 3IGSA 2HV5A 3WL0A 3RGTA 3KVKA 5FA5A 1RQBA 1JRPA 4L7ZA 2PD9A 6CGTA 3A3WA 3NVDA 3A5FA 3FS2A 3MSYA 3H7VA 1ADDA 4LALA 2OQYA 4O19A 3H4WA 1E9LA 4NQ1A 5LNSA 1FWCC 2W62A 4C6LA 4F9JA 2ACRA 1JXKA 1H63A 4AFYA 3PJWA 3H7UA 5DMNA 3N9SA 1OX5A 3GXDA 4OQVA 2HEJA 4GI9A 3FKRA 3NQDA 1JF6A 1J10A 4ZO8A 4C5ZA 1ZJBA 2PWVA 5CXPA 3UPBA 4KESA 3UR5A 4GXWA 2PWHA 4DQWA 1V3HA 1GG0A 4I3GA 4Q8WA 4E3VA 4XIAA 2CNCA 3M0LA 5FD0A 3CB8A 2J6XA 1E4NA 3LCIA 4OZOA 1S1PA 3O1NA 5T9CE 3BSMA 4NNBA 4CD8A 4H4XA 2HVMA 1OD0A 3TLLA 3CL6A 3WD3A 1T8QA 3BG5A 4HZMA 3FNDA 3HBLA 3D46A 4PTMA 3V3WA 4DN1A 4BURA 1M5WA 1ML1A 1H5YA 5CAHA 1TCMA 2NUWA 5U25A 4C6CA 3TE9A 1LOQA 1ZS2A 4IX0A 1QBAA 3HPZA 1PWMA 3TNOA 4UFKA 5FL0A 2CITA 3K8MA 3L4WA 3GG8A 3E0FA 3GVQA 3O7UA 1TYGA 1GTHA 3IGUA 3CT7A 3OVPA 2XIOA 4YNGA 4ZODA 1FHDA 1SR9A 4IMEA 3MDUA 2DSKA 2HCVA 3P60A 4PBGA 3IJ6A 1FXQA 3TDFA 6PTDA 2VENA 4M1RA 4B16A 1JFXA 3BCFA 2EJAA 4UR7A 3HPSA 3M46A 3RR1A 3SN0A 3SY5A 4PTXA 3RU8X 3WDJA 3GXPA 1DXIA 3NNTA 4L1GA 4P7RA 1NDAA 3JZUA 1KTNA 1PTAA 4IUOA 2C15A 5HINA 1E3XA 2EPKX 1EC8A 4AEEA 1K9DA 2WSPA 4AWUA 1JGIA 1EJSC 3B4YA 3AO0A 4S3KA 1VLWA 4GNVA 4S1FA 2VGGA 2ZX7A 2Z4GA 3UG8A 4DLMA 4EANA 4Z2KA 3UPMA 1NQ6A 4IWWA 4CVUA 1DJWA 1M53A 2JQXA 3EEZA 1OCNA 1R3VA 1UOZA 5LIKX 3RX4A 3QY7A 3P62A 3PPGA 4MG4A 1L6SA 2MANA 2QV5A 4CNPA 3QOKA 5A8OA 5CEWA 1XPGA 4X61A 5LA0A 4LNYA 3WH5A 4XSMA 2EEXA 4N6EA 1M68A 4LY8A 4NX0A 1NDZA 3GS6A 3XINA 3B8TA 4DHGA 3PULA 3TYCA 2BCPA 1WBJA 1W3KA 3DDMA 3UWUA 2OEJA 2XIIA 3A3XA 3TX9A 4LBRA 4GGBA 2BHYA 3G3DA 4HNCA 2QMKA 3FJLA 4QGCA 2XFWA 4Y9PA 3B9NA 4ZB5A 2XWEA 5CBBA 3H2NA 1J01A 3B8VA 1TMQA 2OZTA 4UQAA 3KWXA 4FK9A 3N2XA 3LGGA 3TCEA 3PTDA 2P50A 3NZRA 5D37A 4NILA 1R7OA 4I9JA 1H6VA 1EX1A 4LEQA 3LU2A 1FHUA 2WPCA 2E3TA 1OIFA 3M0KA 1XP3A 4D71A 2AL2A 2FB3A 1OVDA 4YCOA 3NIYA 3UF9A 2I16A 3WLMA 4XZ9A 3EEGA 4NRRA 4RNIA 4DM1A 4JTRA 3DHPA 5M3WA 2ZA1A 4QROA 1ONRA 3TN4A 1FCBA 2HVOA 3AMDA 1QJWA 2C0AA 1UROA 1R86A 4D2JA 1FHVA 4DBEA 3DJGX 5CPSA 1E1CA 3N34A 3PM6A 3V36A 1XS2A 3BDKA 1L0PA 3PZNA 1N5WC 2UV8G 2OOGA 4GH1A 1JPMA 3CYVA 3CJPA 3UNDA 1S5VA 4NEVA 3L7RA 4MY9A 2F7FA 1P1MA 4GRTA 1FCUA 2PZNA 3CAWA 1JZ4A 4A6GA 3GFYA 2R6OA 2AAQA 4DZHA 3FG2P 1P6BA 4D6DA 1PE1A 1FEAA 1H0IA 5EBKA 4M82A 1ZQ5A 5FEWA 4AHOA 4H8VA 4B5NA 4C1KA 4APNA 2OZ3A 3ZM8A 1B3XA 3P93A 3JW7A 1YTDA 5HMEA 5F4WA 3DI0A 4QDMA 4MHBA 3NQAA 3VGHA 1T7LA 3ZJ8A 1OFPA 2EQ8A 2FIQA 4FPSA 3Q6JA 5A69A 3H54A 3ISIX 4BCEA 2VR5A 1OFDA 2G4FA 1FRBA 1DBTA 2VD8A 2HZGA 3LXAA 2OWCA 3H23A 1EPVA 3HURA 1P43A 1XQLA 1W2PA 2ZA3A 4V2XA 4GNJA 2DJLA 1K4HA 4DO5A 3EWZA 2X40A 3W6YA 1M03A 3GR8A 3TVAA 2DW6A 4MM1A 4MLJA 4PUKA 4DYEA 4LXFA 2AQVA 1SB3B 4MAVA 1XRSA 4N6FA 3VK5A 3ID7A 1QCWA 1K9TA 4PTVA 4JTDA 1F74A 3AXIA 3ORWA 4HPNA 3LXBA 2QAPA 7CGTA 4A35A 1ELSA 1VFOA 5A95A 4IIFA 3LHYA 2P10A 1UR0A 1QI3A 4LSBA 4RXFA 4O8AA 4ML4A 4CQCA 3L4TA 1G69A 1VRXA 1FXPA 1VS1A 2BGNE 3BJSA 5CLWA 1ME7A 2HK0A 3CWHA 4XKMA 4KCWA 3RLGA 3UG4A 5CPTA 5K9CA 4WJ8A 4ZQPA 4EQXA 2VEIA 3QGKC 4IMCA 1NWRA 1BGGA 2ZOXA 2VGBA 3NPVA 1W1TA 5DXXA 1J8VA 2ONEA 1B3OA 1TPDA 2VMFA 1I2QA 1V93A 3N6QA 4J3SA 1ZAJA 2BMBA 1E43A 3C8FA 4PTNA 3W0KA 3W84A 4PL2A 5I06A 3ABOA 1RXOB 3N12A 1JAKA 3S2MA 2NV9A 1KM6A 1GOIA 2HPIA 5TNVA 4DELA 4TX8A 4FB7A 3Q58A 1NELA 2OODA 4QFUA 4GXMA 1EEXA 1N7KA 1E72M 3I7SA 3Q2DA 1QOXA 1W3JA 3CZJA 1SZGA 1M04A 4OE7A 1JEZA 3SJNA 4QCFA 1HIZA 4PE8A 1O6IA 1WDSA 3CHDA 2WPBA 1JDAA 1XC6A 5I78A 3IRSA 3CZ8A 5F2GA 1EDTA 5FS7A 4AZGA 2EG8A 3LRKA 3OIHA 4K8EA 3NVWB 1WDPA 4JY8A 3TTOA 2VT0A 1DJXA 2XVPA 5I09A 3IJDA 3DK4A 4UTHA 3D3FA 1LM1A 3UZXA 7REQA 5BWAA 2CLIA 1V3IA 3POHA 5M17A 2VX7A 3G1SA 4TU1A 1B5TA 1VH7A 2Y61A 1XIMA 4MVAA 1GK8A 1RY8A 4JOMA 4CU7A 3VC5A 2CBJA 4CVWA 2HSAA 3HB9A 4NZ1A 5J8LA 1H1YA 1XIBA 5M2FX 3B0PA 3W29A 1UW9A 3WJZA 2WB5A 4JNZA 4M7SA 1VPQA 5CZKA 1XBVA 2AKMA 1J79A 1ME9A 3HGSA 3ARWA 4Q22A 3DIPA 3QQWA 3WLOA 1XUZA 2JKEA 1YRRA 3SCNA 3OBKA 4WKAA 3LENA 3G1FA 4M6PA 3MCOA 4NNAA 5HMDA 1IXOA 4U5KA 2QCDA 2RH9A 2XM2A 4LCQA 5BRQA 1LF1A 4WKFA 3FKKA 1ZAIA 5DMMA 3OA5A 4MZYA 3W2NA 1W2VA 4WOZA 4C6OA 2ZZBA 3IV8A 4H9MA 3S6DA 1FHLA 3VKCA 2ZZ2A 4A3HA 1RD6A 3AHXA 3M5ZA 2YAUA 3MVIA 3K8KA 3M0XA 3P74A 4QLKA 1JYXA 7TAAA 5M5DA 2HRWA 2D2JA 2EPNA 4KRZA 4KBXA 4UTMA 3AIEA 3G6LA 1QK0A 2XH7A 1WX0A 2YL6A 1CECA 3VD3A 2ZUUA 4L61A 1EJXC 1KM0A 3H6OA 3WLTA 4AD5A 4LA1A 4C7FA 3FA3A 4PC8A 3LB8A 5BCAA 4R7JA 3BUVA 4IFRA 4LYKA 1N8WA 3H4KA 2ZX9A 2C13A 1E9ZB 1XBYA 3BQ6A 4HNLA 4EAYA 1SSDA 4KFNA 3TYUA 4JIHA 1X7FA 2X1SA 3IS4A 5AECA 3DU0A 1S38A 1D9EA 4XAGA 3VUPA 4E3TA 4LF2A 4MJ4A 2EAWA 3LA4A 3QGAC 3TLQA 1US0A 3T4WA 3UYCA 5D2TA 3PBUA 1W6TA 2HVNA 1SO6A 2IXVA 2X30A 2QJNA 1KD0A 3VPLA 2QCHA 4XD3A 4AAJA 2C3ZA 4MKVA 3VKDA 5G5GB 3RCYA 3DYOA 4WUIA 3T78A 2E5CA 3GG0A 4I7UA 1VPYA 2E1WA 3FXYA 3P14A 3W71A 5L9FA 4KWVA 5KZDA 4EACA 5DRIA 4PBEA 3NL2A 3WNKA 3W25A 2H9AB 4FNTA 4RDYA 6TIMA 1V7AA 2RAGA 4LGXA 4IIEA 2OQHA 4PUMA 4GJ1A 2FJKA 1XF0A 2WCAA 4L56A 1CGWA 2OMAA 1MUWA 1FKWA 4ECLA 5LXXA 1A5UA 3GBEA 3DK9A 3ZT5A 1JYWA 3MANA 3WEMA 2OJPA 3PZVA 1W5QA 4Q8UA 4XZNX 5FJTA 2WZIA 2NQ5A 4HT3A 2XJ7A 3OGSA 1DORA 1XGEA 2VDIA 1E6XM 3RF9A 4AISA 3AISA 4LIIA 3RNDA 2IPWA 1G9HA 1OFRA 1OFEA 4HSHA 2FPVA 4QAIA 1LORA 1S2WA 4UFIA 3GNXA 5T91A 2YL8A 2NPXA 1V6XA 2W3ZA 4HK6A 2VQTA 3USBA 3B9JB 3GC4A 4TMBA 3NOYA 2PP3A 3W22A 1DE6A 1NQKA 3P82A 1C91A 4H3DA 3VE9A 1EP1A 2RDXA 5FF4A 1V3JA 4JTQA 1EO5A 3LHTA 5U4NA 1R85A 4AU0A 3SN1A 4JPGA 2INZA 3UXLA 4BI5A 4RDVA 2WSQA 1XCWA 3WLKX 1XLIA 3I6EA 3SQLA 3NPWA 1JRBA 3WENA 1U5VA 5D38A 1GYLA 4AYSA 1DEDA 3P7YA 1E51A 4P7NA 3V35A 2FTWA 1O1ZA 4H04A 1QMLA 2G3NA 3TEVA 1MNSA 2BY3A 4Z2JA 1JUBA 2V6OA 2J8FA 1FWEC 3KLKA 1V6WA 3WDQA 3UPWA 5A2BA 1MW2A 2QR6A 4XKYB 4A2SA 1UWRA 1Q6DA 2V38A 1A5BA 5D8ZA 4K39A 2NLIA 1ZJAA 4O50A 3QOMA 1F6KA 3TP4A 1EUAA 2CKRA 1U1JA 1OEPA 3CNYA 4GX9A 2WLYA 4XB3A 2NUYA 3UCDA 1FCQA 2HQMA 1V4YA 1HKIA 4DIAA 4KCVA 3TXVA 2YFNA 3CV7A 2J8TA 3L23A 4UCFA 3A9BA 3TQKA 4DXXA 1H7WA 2GSEA 1UMYA 1OF6A 2AOSA 1CENA 2YJQA 5I02A 1Q4WA 3EWBX 1ZSXA 1H50A 4F0HA 3S9ZA 1C7SA 2GR2A 2ZWZA 2YX0A 3UCQA 2YSWA 3AMCA 3VOFA 4IIDA 4EQWA 4YMZA 3BOLA 1WAWA 5FESA 3DC8A 3F2BA 3S2LA 4W88A 4OIFA 4D6EA 3K8LA 5JBFA 1GV4A 2WMIB 1RZMA 2PU1A 3IC9A 2EPMX 3B05A 1O7AA 2WMIA 2FFIA 4XD6A 3F4WA 3RRXA 4JL1A 3NQVA 3DH7A 3ONCA 3DXIA 4LRTA 4HNVA 2W9MA 3M5YA 4RUBA 3WUFA 5ABGA 1HO4A 1B1YA 5RUBA 4NJJA 2ZZCA 3LBCA 3LEPA 4AB4A 5HAOA 4C6QA 4XZBA 2ZVRA 2C14A 1GQLA 2WJEA 1CZ1A 4GWEA 3KRZA 3MCMA 3W28A 3ALGA 1XSIA 1ZBCA 1KBKA 1J0IA 5I03A 4TMCA 2E40A 3W2UA 3KVMA 3BARA 4O52A 4C5YA 1F3WA 4TO8A 4B4HA 2J27A 1YW1A 1GVQA 1KTCA 2V2CA 2FVMA 1BVZA 2Y5EA 4W86A 4ZA0A 2X0SA 1EDGA 3WQ4A 1V3LA 3EUB3 3EMZA 5TBOA 3QM3A 5IFTA 3L4VA 5AN7A 2C79A 1B54A 1U22A 3KTCA 3KOWA 2Z00A 2ON3A 2FDSA 3B8IA 1K8ZA 3MHFA 2QT3A 3WUGA 1UC4A 1RVKA 1KXHA 3T0BA 4O8RA 3ZVHB 1QFEA 5K4XA 3BJFA 2HNEA 2WKJA 3UESA 1H0GA 1HP5A 5FMHA 4W7WA 1R3QA 2FLIA 4GYKA 2J77A 3BICA 8A3HA 3L5OA 1F61A 1TSIA 3E74A 2ZFAA 1UHVA 4M1BA 4UXDA 2FHCA 2DORA 5LIYX 3N04A 4PB3A 4F8XA 2IKJA 4CNSA 3M0MA 3LUTA 4GJJA 4ENLA 5F1UA 3TXZA 2B7QA 1HP4A 3P5ZA 2P53A 5DX7A 3WMCA 2QIIA 1KM4A 2DSVA 1QNVA 2QPXA 3N18A 3AMZA 4X3ZA 3CHCA 3AIQA 1Y7VA 1I60A 4IL0A 1IF2A 2PBOA 1GGOA 5AHNA 4X0VA 4WZHA 3GAKA 3ITLA 4AZBA 5IHSA 4JAWA 1XYLA 5D05A 2REQB 4ZQMA 1HKVA 1AQMA 3OA3A 3EB3A 3HPAA 4D8AA 3B97A 3GHUA 1F4AA 2REQA 4PMUA 2YFOA 3OP2A 3QN3A 3XIMA 2PWEA 4RE0A 2JFEX 4XWUA 1GOKA 4QS6A 2C8NA 1OSEA 3AAMA 3NGJA 1E1EA 1QI4A 3EWCA 4HYVA 3VD7A 1J12A 3N2OA 3D9XA 1CXIA 1KGUA 3CLWA 3HG5A 4Q7BA 4P8WA 4IISA 1JIBA 1E5JA 1EKOA 4J40A 1XWYA 3NR0A 3WO8A 5I3JA 4ACYA 4EMIA 2QUMA 3G24A 3U3HA 3TTEA 3IIPA 3MUIA 3ARSA 1OK4A 4Y9NA 4DXKA 1MW1A 2PDCA 3SIZA 3FAWA 4H4RA 1J93A 3L4XA 4IXXA 2Y2WA 3JS3A 2BVTA 2YDRA 4JTAA 3G77A 3SECA 1OY0A 1YDYA 5BU6A 3VZZA 2EGZA 1E6RA 2P3ZA 3SCRA 1IE7C 3R79A 3R1ZA 4ZB2A 1DWGM 4FLSA 3R07C 2WZEA 4X60A 3W1NA 2DT3A 1ZPTA 4TVWA 1MMFA 2J66A 2XVKA 4Z1AA 3E2SA 1BQCA 4YU1A 2VCAA 2FHBA 1QNRA 2Y8KA 4QE5A 3ABSA 1TJPA 3CS2A 4IQEA 4NZ4A 2IPGA 3VFCA 1VYSX 3LHZA 6TAAA 1H49A 3MO7A 4GIYA 1B3ZA 1M01A 3KZSA 5CPOA 1OADA 2D2HA 1E0XA 1CI1A 3QFAA 3FHQA 4HMNA 1X2GA 3V1HA 3W72A 1AUSL 1A53A 2CZDA 2QLYA 2IQ0A 2Z24A 3N29A 2DSUA 3GHRA 1L2UA 2J25A 1ISYA 4FIQA 5LYRA 3A4WA 3HMCA 4OBRA 1EBGA 5ECVA 3TAKA 5I6SA 4H4PA 5C9WA 2ZUTA 3AFBA 3EGJA 4E6MA 2ZXDA 4H50A 5DANA 3NXLA 3SCUA 3CEUA 4HPGA 1OC7A 2XH4A 1S5TA 2O7QA 1PWLA 4UQ9A 2PZ0A 2ATMA 2VEFA 3GU2A 3E49A 4ML9A 4A29A 4GLEA 4KH2A 1VIWA 1GJWA 1Y65A 1R2RA 2A7NA 1UWSA 2A1YA 1A5NC 4AZ7A 1WE5A 2YW3A 3GD6A 3FSTA 3ATYA 2BB0A 3HMJG 1BEUA 3VINA 4D6CA 3I3BA 2W0UA 3DG7A 4LC8A 5CSRA 3MWAA 3GE7A 3QQ0A 3ZT7A 2WM1A 4F0RA 5EFFA 5CCZA 1TR1A 4Z0SA 3BMXA 3AXKA 3UU0A 1ONXA 1UWUA 3DFNA 4FAMA 1BYDA 3R10A 4LY4A 4PMJA 1FWFC 3O05A 2VD9A 3IK2A 4O4VA 1V7YA 3URBA 1CX9A 1XD1A 4GQGA 1KWKA 5I0DA 3U7BA 5D2VA 2BS9A 3UJEA 2HXUA 3BAWA 1VBRA 2WMFA 2NQ9A 3PJXA 4TX9A 3KOFA 3W1LA 4MDPA 2AKZA 4TR9A 1CXKA 1GORA 3PY2A 2DT0A 3ZR5A 2DY3A 5G1YA 4NL1A 3CUJA 4B5VA 3RYSA 2J8GA 1LQAA 4AY8A 5EMMA 1EXPA 1HL9A 3DYPA 4JTUA 4KIEA 4L1WA 3UW6A 4DJED 3HGOA 3BLDA 1RBOB 1GOXA 3HFTA 5G5HB 4IFKB 1YQZA 3CV2A 5GQBA 2G8ZA 2V63A 4IFKA 3AI0A 2J88A 1RHCA 1VYRA 4PUWA 4J3UA 4RE2A 5EMKA 3QQ1A 4GUJA 2Z29A 4GVIA 4QCEA 3UY8A 2NQZA 4MJMA 4DZIA 5CBJA 3CXBA 3B8UA 4IGHA 5C6MA 3CQIA 4H6KA 4AHPA 4I7VA 1GRFA 1GZ1A 4BKNA 4WGHA 4INFA 1W9PA 2CHRA 3QPYA 3WF4A 4Y8EA 5LNUA 1BRLB 5ABTA 3QXBA 2ZKMX 3UR8A 5M03A 2YVGA 2CBIA 1ZALA 3A13A 3FCPA 1J5SA 1HL8A 4I9AA 3DHDA 5HJXA 4BFAA 1Z7AA 3GYCA 3VCRA 2GK1B 3SCWA 2PGWA 3BGAA 1UUMA 4AD2A 2HBXA 3G1VA 2GK1A 4C90A 5D30A 1O5KA 3L4ZA 1ZY8A 1ZK7A 3WFLA 1JUKA 1R2SA 1KXTA 2DIKA 2PA6A 1GNXA 2C91A 1Q6OA 1WOBA 2XFRA 3GXFA 1GKQA 1XLJA 4L4LA 2BHZA 3CV6A 4ILSA 3TTQA 1N62C 4RV8A 4P61A 1R3WA 2JIEA 1XLHA 2UZ9A 3COTA 3TYDA 1XH2A 3UR2A 5FS6A 4GBDA 4NZCA 1KFLA 1TWZA 2Q02A 4K37A 3FX4A 4WVXA 5FAJA 4IIHA 3A5VA 3NQEA 5CZJA 1R6WA 1QUMA 4L9ZA 4XVEA 3PBWA 3W2JA 3SUWA 2B4GA 2J79A 2QCNA 1ONWA 5A6TC 1CNVA 1YTKA 3GDRA 3SSZA 1BWKA 4Q8OA 2VEKA 1SW3A 2J62A 4YPJA 3S1UA 4IJRA 1VFMA 1RSCA 4KWUA 1F8MA 5HBFA 2OYMA 3QZEA 1SM9A 3WNLA 2BSLA 3DK8A 1UWTA 3WBEA 4Q32A 1JPKA 1K6WA 3HIJA 4O54A 2JBMA 1RD5A 1WXZA 4ZQCA 2D24A 3SGGA 3LI1A 3MKVA 1RCQA 4B92A 4U28A 5HQMA 4PA8A 3VDBA 3EOOA 1OIMA 1OWQA 2EBNA 3FEQA 5KSWA 1ZBWA 2GWNA 4FI4A 3RM4A 1NM9A 1VCGA 2WP6A 2CKSA 3ABXA 1UJQA 3ARVA 1Q1WA 1WKEA 3LD5A 4KFPA 3FEMA 3TK7A 2VZVA 4B90A 3EXSA 3ZJKA 5FJJA 4BY3A 4M52A 1FDJA 4KT2A 2GSHA 1W5MA 4WJEA 5JBEA 3STCA 5A5WA 4EWJA 2CLFA 2BLEA 1XISA 4JIRA 4ZENA 4I7WA 2V3FA 1RR2A 1IXNA 3W4RA 3QR1A 2XWDA 1TJ2A 1FWDC 3NL5A 2ZX6A 1NWUA 1PX3A 4UMBA 4FNUA 2R24A 3WQEA 2FMNA 3NQFA 1JULA 3QFEA 4QM1A 3VIIA 2PTDA 4V28A 4UTWA 2I57A 5D2WA 1RBLA 2GGGA 4EMWA 3AMGA 1EPXA 2Q6ZA 4OKDA 1P7TB 3AALA 1XHCA 1P7TA 9CGTA 1LUCB 5FEXA 1LLWA 2J9XA 1LWJA 2DIJA 1EC7A 2Y4SA 2J75A 1TPC1 1JF5A 3G0SA 4Z2LA 1M7PA 1X1OA 2X8GA 1J96A 3B8WA 5LSMA 2GR1A 2CLEA 3LPFA 3WLLA 1EUNA 4LAMA 4N9EA 2VFHA 3W1RA 1P0DA 1HVQA 1RM6B 4GQBA 1NF7A 4AG0A 1OCBA 3EWYA 5BOEA 2C0HA 3OLEA 4N9CA 1Z44A 5I7GA 1FVPA 5C0QA 4HHHA 2WC7A 3CO8A 3BXWA 1XDIA 2YXOA 3IUIA 2QV4A 5A6LA 4F0SA 1DWJM 2Z27A 5AOUA 1UQYA 2WHMA 4P2VA 2Z1XA 3TZNA 2BFGA 2ZUMA 6ENLA 4Z1CA 4ZEPA 2PP0A 3EDJA 2I1OA 4JQ1A 3QEZA 1A5LC 3O3RA 2VX5A 4JQ4A 3EYPA 3OODA 1VFTA 1XD0A 1OJTA 3DG6A 4HZ6A 4EM4A 4H01A 2OVLA 3SCSA 3DGRA 3PZUA 4HU3A 1R9XA 3UNTA 5I3DA 4IP5A 3B0YA 3S1XA 3GHTA 2Y5JA 4EPBC 3THCA 1DNCA 1KXQA 2QGHA 3IVUA 2DZWA 2X0HA 1XH1A 5FF3A 1ISZA 3W2KA 3UVAA 4QITA 1ZX9A 1YPIA 5FAGA 3MDWA 5JBDA 4Q3MA 3CQJA 3W7LA 1KGWA 5JQ9A 1Z6KA 3VKAA 1FFVC 3TMQA 5D9MA 2IS7A 1JI1A 3MVTA 3BMWA 4HCDA 1FH9A 3FN9A 3Q4DA 5LIUX 3NVTA 4DYKA 4QJ5B 2Z6IA 4JFVA 4WY0F 3FJ4A 3CQHA 3LB0A 4JBRA 4A8IA 4C6MA 4HP5A 4W89A 3W7OA 3GH7A 4IGSA 4LF1A 3L0NA 1E0WA 5E0KA 5IM51 4DJDD 1O60A 1OG0A 4XIMA 5CSYA 2V3EA 1AZ1A 1RV8A 4ERIA 3CAKA 2BBFA 3V5CA 1JDEA 1IWPA 4GISA 3QV6A 1ZP4A 2FPTA 2ZRVA 3RAOA 2R1KA 3QTPA 2AGKA 4EMJA 1E9YB 1W1IE 3EOUA 3RLVA 3CGDA 1MQRA 4R34A 1ADOA 1XW8A 2NXGA 4GG9A 5I3IA 4YIWA 3WJYA 1NPXA 4DJFD 2AAAA 3S0CA 4MTVA 4DRSA 2GJPA 4JFWA 2OSXA 4E8CA 4XAZA 3KOZA 4UUIA 4RLIA 5LXEA 1H60A 3KHDA 4U33A 2VDHA 1I9CB 2CEQA 3DFYA 4KGJA 2I5QA 3CUZA 1FWBC 2WWCA 4QLLA 4W85A 2OKOA 2ICSA 3T8LA 3QKEA 3NA8A 1O5QA 3UETA 3BLLA 2Z7KA 2WPGA 4NASA 3TA6A 2FZBA 4H9XA 1PZ0A 4AH7A 1LT7A 2GJRA 3MKCA 4P5UA 2ZRUA 3FDKA 3V0TA 1Q66A 2WNNA 3NXFA 3EKGA 3R94A 3W1MA 1SO4A 5I3GA 1XG4A 1PKNA 5F1VA 4FXRA 1RP9A 1A49A 1LRQA 4W87A 4LAZA 3GM8A 2VHLA 4GI6A 3N19B 3N2MA 2ZTJA 2O9RA 4FA3A 1Q6GA 3SRHA 4CN4A 1NAL1 5D03A 3WUEA 3M7WA 1K7FA 1LYXA 2ZVIA 1UKOA 5F2MA 4PGLA 4BWLA 3T0DA 2VURA 4QNWA 4QP0A 4O17A 3WQOA 1HJVA 3O0KA 4GMEA 4GVFA 1VJIA 3MP3A 2XISA 3LNMA 3L21A 3B3DA 1VFLA 1VB9A 3HF3A 4C91A 3M44A 1R3RA 3L0KA 1UR1A 4DWSD 4H00A 4XZWA 3TU9A 4JTIA 4CNNA 2VOTA 3SEPA 3AQUA 4IGNA 4H4VA 4YHEA 3LN3A 1MZRA 4QIUA 2PB1A 1VD6A 1BZLA 4AVFA 1UD3A 1KFBA 4JTLA 1F73A 2G3MA 1KCLA 2FGZA 1JI2A 1KCKA 2VI0A 1TJ1A 3OVQA 3H26A 3AWNA 4DM2A 1ZCOA 1KO0A 3MMTA 4DXVA 2PLJA 2C1IA 1BQGA 4AXKA 5BMXA 3EOSA 1EFZA 1ZTVA 4YTQA 2Q8ZA 3V0UA 2AGTA 5C5YA 4FLQA 2WW5A 4LJ3A 1PYFA 2CERA 1VKFA 2ODOA 1KR1A 4M19A 1CCWB 4RE4A 3I65A 1YBQA 2NLYA 2R14A 3ZMRA 5H91A 4IQDA 3VMPA 1XIFA 3IIVA 3SN4A 1DV7A 2WOIA 4PCPA 2GYIA 1G1YA 2DSZA 3QV8A 1W54A 4ZSUA 1GVRA 2VUYA 4PB4A 2DIEA 3MUCA 3CWOX 1JDDA 1OHLA 1DJQA 3SCTA 1GVEA 1C9WA 4JEQA 5G1TA 5G2IA 4C7DA 4JN8A 2VXNA 1C7TA 1VP5A 1XPYA 1EIXA 4XAPA 3N1AA 5I2UA 1IZJA 2CLMA 1WO2A 2HQAA 1G0CA 1FDZA 1K8XA 1R46A 1KFEA 4IJBA 1XLMA 3CUFA 2VCCA 2YPIA 3W7KA 2ALRA 3M0IA 1LG2A 3OC4A 3QF0A 1FOBA 3GDKA 4FNRA 2VELA 3OZOA 2VR2A 1Z3NA 3B9EA 3AS3A 5E6ZA 4MSSA 4BWLC 2GFTA 5JCKA 1UIPA 1KM1A 2F61A 1EX5A 4HZ8A 1IXQA 3KCOA 3VILA 2BTMA 3ANYA 3LX9A 4H8UA 3P84A 3DKLA 2D1ZA 1BXNA 5EL1A 4WGXA 3U57A 2X7VA 4QBXA 1TVNA 4CCZA 2YBUA 1PIFA 2Z26A 4Y90A 1IR2A 1JPHA 4PTDA 1I0DA 3TA9A 4WR3A 3R25A 3NYZA 1CEOA 3WH9A 3ARUA 2ZZ4A 4RV3A 3DG3A 4HJWA 5EBAA 4J9JA 1HFBA 3G2GA 4PULA 1SGJA 5SWUA 3I4KA 4ZVJA 4V27A 1KGXA 3OBEA 2OZ0A 5BMWA 4R9XA 4FNPA 4JX5A 1TUXA 1SW7A 1JPDX 1R3SA 2DZUA 2BOEX 3L4UA 3N2CA 1TWDA 3HQPA 4QJ4B 2V3BA 4PN2A 3A9IA 1VBGA 4W5UA 1ODUA 1X2HA 1GERA 2AMGA 3AMLA 1F6YA 3GDMA 2PDIA 1AMYA 1TWSA 4PUUA 3NWRA 4ERGA 1FH8A 4GY0A 1AQHA 2WMGA 4YL2A 4KRUA 1S7MA 3GAYA 1GUVA 1OYAA 4NG3A 4F0MA 1R7AA 1M1BA 4GI8A 4FX7A 3W88A 1CGXA 4AMCA 4B4FA 2W67A 3W83A 1BF6A 4HU0A 3E3HA 3FW6A 3C52A 4K1GA 3W7EA 3A12A 2ZUVA 4NRSA 4EQSA 3UP8A 1V02E 4R85A 3LADA 3L66A 5DY3A 5LKYA 1H7XA 1AH4A 1ESWA 1BG4A 1LRTA 2NQHA 2D2GA 3W7DA 3MSRA 3G1YA 1WXJA 1V02A 1Q13A 1NJJA 5EGRA 4AYGA 3UWEA 4A8LA 5GNYA 1L6FA 2VEMA 3WFAA 4H8HA 2F6KA 3LRMA 4K7VA 3KBJA 4GE8A 3LRLA 4TIMA 1VRDA 1KBIA 4DBDA 2YLAA 3LY0A 4HSNA 5DXYA 1REQB 3W86A 5CKSA 3H4GA 4MY8A 4QQ3A 2ZZ6A 3VDAA 3OQ8A 3IJ7A 2FB2A 3SUSA 1C93A 3A7AA 3GWQA 3GTFA 3I7RA 4UFLA 3C2EA 3GFZA 4QQUA 2OO6A 4L80A 1X6UA 5H8MA 3LLXA 2BGSA 1HUVA 3SFWA 3QKZA 1J11A 4GQ0A 4MAZA 1UKPA 1Q6RA 2ZWYA 1SJBA 3BV7A 1RCXB 4HHPA 1E0TA 1KR0A 3OZYA 1KWGA 1X8FA 4IL2A 3WQPA 3N13A 2P3EA 3ECQA 4M24A 1US2A 1S5NA 3BGGA 4UIOA 3ZQ9A 2H3DA 3ZOAA 1CXLA 1JVNA 3T42A 2ZDSA 3VIPA 4PL1A 4UMAA 3BVJA 1GETA 2A2IA 3AICA 3FLUA 4RNHA 3B9OA 4S3FA 4XBSA 2PDUA 1E71M 2ISFA 2VUNA 3IJ8A 4CLMA 3PSVA 2XINA 3RM9A 3KOYA 4TUFA 2VWSA 3UZZA 1Q6EA 3DESA 1WZAA 1VFFA 3AN1A 4RW3A 3GB6A 5KETA 1Q6QA 3DZ1A 3U0HA 3LTPA 4LYQA 3VGEA 3L8KA 2P0OA 3OO2A 4NZ3A 1LWHA 3GR7A 4PCNA 1QHZA 4W7UA 2BVWA 5C54A 4KWWA 2XUCA 1KQYA 3G1RA 3WL1A 3LSBA 2ADAA 2DZPA 3TYZA 4AHQA 3KBNA 2GL5A 2QKFA 3VCCA 4ADSA 4E2OA 1OB0A 7ODCA 2WHJA 2BXVA 2OYLA 1TCDA 1F76A 1VAHA 3CZKA 3WLRA 3VUSA 1H09A 3DENA 1GG1A 3TSBA 2WP5A 5A94A 3RDKA 1MSSA 3UWVA 4O0ZA 1IYXA 3CZGA 1JZ2A 1O1HA 2PF8A 2WKLA 4L4MA 2PTYA 3QMTA 1W9XA 1A47A 4WSHA 1Z9AA 4FHAA 3QV9A 3CZEA 3HJZA 2PMQA 1XYMA 1K70A 3A64A 1XM3A 1LT8A 3R58A 2OB3A 2VO5A 3M6DA 1D7YA 4DBWA 3AWOA 4S3BA 5TF0A 2X8CA 1BVWA 2X1IA 3KCLA 4CD5A 2ZZ7A 1KBBA 3KLLA 3RCMA 4FX9A 3GRTA 3E38A 4IPIA 4WX2A 2FVKA 3A4XA 3PF3A 1ITCA 1W3HA 2X0YA 4JTCA 4MWAD 3AIVA 3WQCA 1UR3M 2RGMA 4EXBA 5GJNA 3A23A 4RZ4A 4MGGA 1XLCA 5CPMA 4DI8A 1Z89A 1KC7A 2E9BA 4C6PA 2EG7A 2B31A 5LA1A 1W1B1 2TPRA 4IJCA 4ATLA 2ZXQA 3L2LA 4Q4PA 4NIRA 1DJZA 2X2YA 4DJEA 3LCHA 3EX2A 2X99A 3EAOA 2V81A 3MJYA 4HNNA 5I3HA 5DF0A 3PJUA 1EBDA 1H1NA 4O1AA 2A3CA 4GQRA 2J6VA 4PFHA 4HJFA 1NHRA 5A3HA 1YDOA 1WB0A 4GVHA 4J3ZA 2INFA 3TW7A 3DFSA 3L68A 1P6CA 1UG6A 5AKQA 1UQZA 2J7EA 3WNNA 5D9PA 3CZLA 3N2BA 4GCXA 3W6MA 4WF7A 2EXOA 1EJTC 3NEHA 5AC4A 1GSNA 2ZZ5A 2FGLA 4GUFA 1QASA 1C8XA 2BODX 5EMUA 4FIRA 1F4HA 4FEZA 4PUNA 4LYRA 2XZ7A 4H9YA 2GZXA 4PTWA 4E5TA 1QR7A 4MIMA 1QW8A 3VDHA 2OCZA 4AUBA 4H2HA 4XG1A 2XU2A 4CN6A 3H21A 4IQLA 2PF0A 3RLHA 3O63A 3EX4A 5AZ1A 3R6IA 1F9CA 3T07A 5GPRA 4MZ8A 3WQ6A 1XR2A 4JICA 3PAJA 1JCYA 4ZO6A 1VBJA 1VZWA 1TPFA 1G67A 1VBUA 1SYTA 1TPH1 3JUGA 3WQGA 1UWIA 3PG9A 1TWIA 4US5D 1XJBA 2HK1A 4RPPA 1UJPA 4AD3A 1EYEA 2ZE3A 4K68A 3QPZA 2GQWA 3LCFA 4IF2A 5BOOA 4UTJA 3GZAA 2XYLA 4LBSA 1Q3NA 3BSGA 2Q71A 4UTIA 3A21A 5ECUA 3G5EA 2I14A 3T4CA 1JEHA 1RALA 4FOJA 2PDFA 5KEZA 2KZHA 1YNPA 1PVNA 4LTSA 4HPXA 1JL8A 3CH0A 3EPOA 2Z1KA 2E7FA 1GREA 5A8MA 3CL7A 4XISA 3R4IA 2Y70A 5B80A 4LAKA 2KAUC 3M4HA 1TREA 1JNEA 1UB3A 1DP0A 1R5YA 3R0KA 2Y62A 1G4PA 3U5UA 2YR1A 4DJEC 5HUPA 4G5DA 3SDOA 3C2YA 2A21A 4XD5A 1QDSA 2VFIA 2G3JA 3AROA 1AQFA 3RFAA 3Q45A 3SY1A 1E5NA 3PB2A 3LOTA 4KWOA 3TAOA 1XXXA 4KW2A 4GINA 1H41A 2GGJA 1W1A1 2AQWA 4EWND 3FA4A 2XH0A 4AZCB 1JZ6A 4WK9A 3APYA 4WKHA 1EH9A 2XN1A 1LPFA 3CB3A 5CLTA 4W8AA 3RLUA 8XIMA 1UKTA 1RA0A 3MBDA 3NDZA 4KFOA 5LZLA 4C6JA 5AFDA 3PP7A 4S3AA 1J0JA 3RG6A 1B4EA 1DIOA 1IZKA 4LUYA 1PIIA 1YIXA 4RR4A 2VL4A 2CZVA 3JZEA 1UYQA 2DUAA 1VHCA 1MW3A 1GPFA 2V5KA 1ICQA 1XC4A 3RCNA 3DGZA 1UP2A 2V2DA 4GCAA 5MKGB 3LCGA 5AB3A 2BY0A 3T9PA 5IOBA 3C56A 1UOKA 3TW9A 3WEOA 5JVLA 2VKZG 1TKKA 1OFQA 2X8RA 7TIMA 3QSRA 3VIKA 2O9PA 1N2VA 1Q6CA 3AXMA 2E8ZA 4FOUA 4ZSTA 1FH7A 4B5TA 4F3HA 3T08A 4FSAA 5AYXA 4N9DA 1T3QC 3WZ0E 2GJLA 1C90A 1S1RA 5G4EA 1IXPA 3QRHA 1XLKA 3VC6A 3VKJA 1U5HA 3I68A 3LM7A 1R3TA 1DJHA 2FMOA 3UJFA 1OT2A 4ZE4A 4ZOBA 5LGXA 3WLPA 4ROQA 1U30A 1EJVC 1ISXA 3BK0A 3S5SA 1UR9A 4U5IA 4B2DA 4ASTA 1DTNA 3N9RA 1ONFA 4F9DA 3MKKA 3VI2A 1JD7A 1IGWA 4ZB0A 2OG9A 4E0CA 4HN4A 4UZUA 3CPGA 1X6LA 3YPIA 4LVGA 4RDWA 4PMRA 4MNJA 2BDQA 5T26A 1LRNA 1OT1A 3R11A 3UGRA 1PPIA 3GVWA 1W9DM 3WUBA 3F2CA 3GUGA 3RMEA 1QO2A 2VC6A 1EO7A 2F38A 3BW2A 4RE3A 1L6WA 3F4DA 4C6EA 4O16A 4K38A 2UY4A 2WC4A 3DBNA 2CLLA 4JR5A 3CMJA 2ESCA 4M80A 1ADSA 2R91A 2NVCA 2PODA 2E9LA 2DVXA 3NFUA 1ONEA 1TVLA 3E6EA 1G01A 5LIXX 4B5UA 2BY2A 4XZHA 2Z2AA 3EB2A 2ANUA 1XLFA 3BQ5A 3LSCA 3KEHA 4A8NA 1STZA 3CUHA 3VOJA 1F6PA 2ZUWA 3M0ZA 4QHRA 3UR7A 1GRTA 2E5BA 1JRCA 2ISWA 3WMLA 4PR4A 2PAJA 3LS9A 4MUZA 3B0XA 1FTXA 4ADUA 3QGVA 4V1YA 5I3KA 1TJ0A 3RIKA 2Y8VA 4U4MA 1C8VA 4ZXOA 3RITA 3B0UX 4OBSA 2JALA 1C8YA 3SSJA 1R38A 1FCVA 5ENLA 2CZFA 3KVLA 4BQ2A 2R9ZA 3G22A 4F0LA 4V15A 2JGQA 3GUWA 4EF8A 2Q01A 1V51A 4P8VA 5GJPA 1GOQA 1ICPA 3HFYA 4V33A 3K1GA 3W82A 4HN8A 3VIGA 1M7OA 2PTWA 1DPMA 3G1AA 4BI6A 3RM8A 1LVLA 4GZ7A 3EX3A 1Q7ZA 4AZ6A 2HDJA 1TX0A 2WNWA 4GUIA 2VRQA 3H2FA 4L9YA 1AVAA 3U2OA 1FDYA 1PO9A 1TR9A 2GOUA 4HIBA 1WZMA 2GDUA 1A80A 3EAUA 3IV3A 2YYTA 4R33A 4PB5A 4O0KA 4O1EA 3QW4B 1XH0A 4Q8TA 4HVXA 1YMYA 3VD4A 2WK2A 1OGGA 4IIBA 5FCZA 1OGSA 3NUKA 8RUCA 3WMBA 3VNLA 3BC9A 3MYPA 4IPJA 1X39A 3U7VA 2ZYFA 3ZLGA 3MQTA 3APTA 4O11A 4MFDA 5D32A 4J3XA 3WYZA 4Z1DA 3L2MA 1R2TA 4ZO7A 1TELA 2PC8A 3PK7A 3CQ0A 2X05A 4W93A 1DQUA 1LL6A 3RX2A 3M64A 3SRFA 5A1AA 4ERAA 4E4FA 3PG8A 4MNMA 1M6IA 4F2BA 1A5CA 3C6CA 2G97A 1LTDA 1HQTA 3UEQA 5C71A 4HOXA 4ZOCA 2RDWA 2QVNA 5HR7A 3QTGA 5KITA 1ZENA 3T44A 1I75A 4PFMA 3OOQA 3PTMA 3QJAA 2WMJA 4YN5A 1N82A 4DO6A 4X9YA 4DWSB 4GIAA 1XQKA 4GRSA 2QHAA 3W7PA 4XO6A 1Z8AA 4WXZA 1V03A 3M5XA 4DWSA 1EJUC 2NX9A 4A05A 3CH9A 2FZMA 3O07A 3NZGA 1HGWA 1H7NA 2OELA 1N8IA 4CQDA 3STPA 4YXGA 1RK6A 4LVAA 4KEZA 5KMYA 2CWXA 1W5PA 3WQWA 5JCNA 3IK4A 4ICMA 4UQEA 3WD0A 1TRDA 4IX2A 2W54A 5A8GA 2PEVA 2G0WA 3S4TA 4QISA 4REQB 4RDZA 4F66A 2G96A 5AC5A 4Q6XA 2W66A 4REQA 3TQVA 2E4TA 2HMCA 3UXKA 4W84A 5AHFA 2ACQA 2B0MA 4YTSA 1H61A 4ORMA 3HQNA 1Q4NX 1FQ0A 3AIRA 5BNKA 1I1WA 5M1TA 3P81A 3S5OA 1D7FA 4DJFC 4HYWA 3VDGA 2DP3A 2V5JA 3ITGA 3SW6A 3W26A 1O12A 3SM0A 4KKXA 4ZQRA 1AW2A 5A6SA 1EZ2A 4PUJA 3FFSA 4G6CA 1KV5A 4O10A 1VBHA 3TR2A 5DLCA 2H3BA 3LERA 3FV9A 1N61C 3MI2A 4EP8C 3VNDA 3AZSA 3C4UA 4DX3A 1XSJA 4DEFA 2V5DA 2Y1HA 4U10A 2A6NA 2E3ZA 3HU7A 4JTTA 2FQIA 1A0DA 4XO7A 2WAGA 2CHOA 4HA4A 3GC5A 4WSKA 4D6JA 4ZFMA 1D2KA 1GVFA 3ZT6A 4IMAA 2OEMA 1OC6A 2W79A 1E70M 3FJ6A 1V08A 3BOXA 4ATWA 2CXEA 4A3QA 2L5HA 4H4UA 3PWIA 3BLOA 3WLJA 2QDDA 3JRKA 3NZPA 4LQ1A 5TD4A 1T99A 2ZC8A 5DMYA 4AEOA 1PS9A 1JR1A 1XIHA 3L5AA 4U3CA 3C2RA 2QJHA 3M0HA 3TQPA 4X2RA 4U2YA 5DCDA 4O1FA 3A7UA 4MMWA 3C86A 2QVHA 4DWSC 4GPNA 1N55A 4GY1A 4UFJA 2SFPA 2C1HA 3PBGA 2HS8A 4R9OA 3SQSA 3R0DA 1NF0A 1UKSA 1PKYA 4U2ZA 4F0KA 2VZOA 3EB4A 3NYDA 1TFVA 1K8CA 1F07A 3RX3A 5EKYA 2QDHA 1QBBA 1XIDA 1V6TA 3O9NA 4HHLA 2R9RA 3VU2A 3NVVB 4LV9A 4JNYA 2I7GA 3LBMA 2YVJA 4NI8A 2W55A 4BQ5A 3GXMA 4NVTA 1DQWA 1TV5A 2XN0A 4NJHA 4KPRA 2KX9A 2QCCA 1FEBA 2TPSA 4QE1A 1KNWA 1NU5A 5FSDC 5FJUA 1RBAA 3NL3A 1N63C 1DHKA 4B91A 4I5RA 3WF2A 1QPQA 1MQQA 4HU4A 1JNDA 4AY1A 2A7RA 2QYGA 6ALDA 5AZ0A 1LLZA 3W3OA 1ZJIA 4HPHA 4LC6A 1GESA 4OTKA 4NAEB 4QTGA 1UH2A 2WCSA 3THAA 3BGJA 1AH3A 3NQ8A 4NAEA 4MPQA 2W91A 1IWBA 4JTKA 1SFSA 2PDWA 2YLLA 3IUHA 3DAQA 1GQIA 4M8UA 3DN5A 3EANA 1WOAA 1W3NA 1EZWA 1BHGA 1E9IA 1EJWC 3E0LA 3DUGA 1TVPA 4I90A 3M7SA 2ZDRA 2QCLA 4M3PA 1GRAA 1MFUA 2XIMA 3AU6A 2CLHA 3WJWA 3EA1A 2EPOA 2QW5A 2XIQA 4XTDA 1LZOA 2ZUSA 1VQTA 1TZ9A 4JS3A 5CGMA 2WOWA 4P7LA 3WLQA 4CNUA 4WRHA 1XUUA 1YLVA 5CBIA 2NUXA 1M7XA 1POJA 5D4YA 3TFXA 2TRSA 3KRUA 1KFWA 1OFAA 4HB7A 4P7OA 2Y85A 2ABBA 5G1MA 3VABA 1H51A 1LL7A 3UZJA 2JEQA 4ICCX 4UTTA 1CTNA 4OFCA 4G7EB 1MFVA 2D0GA 4OUEA 1W0MA 1F8WA 3USZA 3S3GA 4H6EA 1KXVA 4G7EA 3STGA 3HPFA 3BLPX 3L0GA 1CGYA 3MY9A 2DSWA 3DYMA 2D20A 2VZTA 2YDQA 1W9UA 3AHVA 4JNMA 1TB3A 1MUCA 2PTZA 1UP3A 1IWAA 1RJPA 5AC8A 5HQEA 5E70A 5CJMA 1MEWA 1UD2A 1PUDA 1A3WA 2QS8A 5A8PA 1JCXA 1UUQA 3KRSA 4PRTA 3FVMA 4L1XA 3GX9A 3AJ7A 3PFMA 2QUUA 4R3UA 5DT5A 1K3UA 4F2TA 5EY5A 3VGBA 1XIGA 1ZMCA 3FDGA 3GY1A 1MXDA 3GFXA 1SMAA 2HE5A 2WSRA 3FA5A 1PB0A 1JDCA 3ES8A 3O0FA 1G5AA 2PD5A 2ZRWA 2V5BA 1PZ1A 1DYSA 1QNSA 3HG4A 2X2GA 1RLCL 2TAAA 1FWJC 1KLYA 1F7BA 4EVZA 1E1FA 5JMUA 1NARA 2WNZA 4X0NA 3UT0A 3GDLA 3H4XA 2OQLA 3AYRA 2WYSA 1ZHAA 2OX4A 3K2GA 4JTJA 5IRPA 5HXMA 3OVRA 1ZMDA 1VFUA 2Y88A 1GOMA 2XGZA 3W7QA 2JGYA 4CEXC 1CDGA 2BVDA 4D6FA 4ZE5A 4I9TA 4N02A 1FWWA 1BG9A 3N6JA 3F5JA 1F5ZA 4WIWA 3TSDA 1ZBKA 5BZAA 5K2ZA 3RR4A 3VTRA 3EF6A 3HA1A 4S38A 1BVNP 1TIWA 4JTFA 4KERA 4K3ZA 3THUA 4LCRA 5A6MA 4L5ZA 2P76A 4CCCA 3NQBA 3ME3A 2I5IA 2V5LA 1XYZA 3KL3A 4MB3A 3Q37A 4MZ1A 1BTCA 4G1KA 3VKBA 5D2YA 1D3CA 4S3CA 5U1OA 2FPYA 1UD5A 1UASA 2WVUA 2GJXB 1SO3A 3THQA 2DQWA 2C3DA 2V3GA 3VOIA 4UTTC 4AZHA 3NS1B 2GJXA 1A5OC 1EA9C 1S2CA 1HKWA 2ZA2A 3I4EA 2OSYA 3WD4A 1HJSA 3S47A 3IJIA 3CM4A 3SQMA 2GH5A 4MWAE 4MNKA 1KBJA 1MO0A 3RJXA 2FTPA 4MWAB 4AX7A 2AAMA 3ZR4A 4H9UA 5D2XA 4MWAA 4LUSB 1UH3A 2IKHA 4OU1A 1KQZA 1NTHA 4LUSA 3N4AA 4DPQA 2DH2A 1EHAA 4HA0A 3WBAA 1IEVA 2BXZA 2FHFA 1K7EA 1WNOA 4M56A 4JN7A 2VFGA 3P67A 1OG6A 3UVIA 5IHRA 2WBGA 3BSHA 4N4PA 2CW6A 3V5OA 4XV0A 5HNNA 3APGA 1LJYA 4WD0A 4X9SA 2E25A 2YXGA 2PRHA 4LWWA 3UXDA 4P7QA 2QJIA 4WHBA 1YXCA 1QI5A 4GYPC 5CZ0A 2H9AA 2NX3A 1IGSA 3C61A 3S2CA 5K4ZA 3AHYA 1HX0A 2GR3A 2PDKA 4J2PA 3NG3A 3WDRA 5JUVA 3WF3A 4CEUC 4C6KA 1EYWA 2BC1A 3O16A 5JIWA 3BLKA 3CMGA 3URHA 3VNMA 4HSOA 1ECQA 2YB1A 2P1FA 1OYBA 2VC9A 2BOGX 3MJMA 1EJRC 4O1DA 5C7HA 4DUVA 1DJNA 2WNQA 1VIZA 2PURA 2ISDA 4B3ZA 3WNMA 3GQYA 4ZTXA 4QDPA 1EOKA 3CHEA 3ARTA 2NT0A 4ZOAA 2P0IA 3PC0A 4NF7A 3KFTA 2MUCA 5LNWA 3T0CA 1FWRA 3SJ3A 2CC0A 4BA0A 2NQJA 3W2MA 3W7NA 2XSXA 1NOFA 5U7SA 4JL2A 1UZ1A 2HROA 3UJSA 4K8HA 4MPKA 4CQAA 5C9UA 3OU8A 3TKFA 1XCFA 3NQMA 3EPMA 1E6ZA 4JIIX 4HOZA 1QHPA 3ONBA 1U1UA 5DN1A 1ME8A 2FVLA 4Q4RA 2NSXA 3NM1A 3ETRB 3SZ8A 3WSUA 1XYCA 4POCA 2NXIA 2X7WA 2W3RA 3O2LA 1IIGA 2OGJA 3C3NA 3BW4A 4NU7A 5FF2A 3CHVA 4C6DA 3ARYA 3WLIA 4LOCA 3PANA 3P5YA 4OGZA 4JDBA 3CTTA 3OYXA 3NQCA 3FAXA 3IPWA 4H41A 4IQJA 1VC4A 1L2QA 4DZAA 1AK5A 4I6VA 4XKYA 2I9UA 3BZGA 3B04A 4MWAC 4M5PA 1UD4A 5FS9A 2PDHA 4ZL1A 1DL3A 3W7JA 4BZYA 1LQ0A 3QLLA 3BLEA 4HCHA 4G8TA 5B7ZA 3LXDA 1B9ZA 3AIUA 1A5MC 1NHQA 2Z6JA 3G3MA 1Y0EA 4KF1A 4XQ6A 2RGLA 2D69A 3MA8A 1WDDA 2FDMA 4DF2A 2X1TA 3ANVA 1ITQA 3DBPA 3UYIA 2VWTA 1MYRA 3QMSA 2V9DA 1KLZA 3V18A 3TJ4A 2MNRA 5ABHA 1IEIA 3KAOA 3C2FA 2WBAA 3R8RA 2OT0A 3MZ2A 4H7VA 1UUOA 4PMZA 1FWTA 4H4IA 1PX8A 1H2JA 3NZ1A 2ZUNA 1AFSA 3TC3A 8XIAA 3V0SA 3II1A 1VEMA 1XIIA 1LOSA 3PHAA 4ORIA 1X1ZA 1H4PA 3UG3A 1IV8A 2PDGA 1UMLA 3THDA 1O5XA 4LEFA 1HT6A 3BL3A 3L65A 1J0YA 1OABA 3WIJA 2CU0A 2E1DA 2XIBA 4XTIA 4PBFA 4JIPA 4NYUA 1KW1A 1TA3B 1X38A 1YXYA 5XINA 2O56A 3C5QA 1Y5XA 3DC0A 4A8RA 4NI3A 2YCLB 3CT2A 4KS0A 1A4LA 2F9RA 4HMDA 2YCLA 2YGYA 3R0UA 1PCWA 2EO7A 3TROA 4S3GA 4TV5A 3DH9A 3KOXA 1ZL1A 3NQ6A 1U33A 3LV6A 4A4AA 4TTGA 3LV5A 3GH5A 1IZCA 1LCOA 2WZTA 3LCXA 2X50A 3T81A 2NVKX 3IGXA 3W81A 4NZ5A 4AVOA 2PLCA 1WV2A 3WCZA 2J47A 1XBXA 2YCEA 3GW0A 4FXSA 1W17A 1M6JA 3ZVHA 2D0HA 3CUXA 2ABAA 5DBUA 1TPUA 1GRBA 4IP4A 3DOPA 1SU5A 1NVMA 1QPKA 3WJSA 1MXGA 1W5NA 1X7IA 4UOZA 3NO5A 3PG6A 1AL7A 1AW1A 1MRQA 3P3BA 4YWIA 3RILA 1RH9A 5HANA 3UBPC 2Y89A 3KCJA 3GNRA 3ARRA 5E9XA 3IIOA 2UY5A 4JTEA 4B5WA 3GIQA 1RJRA 3T05A 4HKPA 3VZXA 3WLSA 1BGAA 2QXWA 4E4PA 3WLNA 1B4KA 4PCTA 2FZDA 3ITXA 1BYCA 1V77A 1JG9A 3VDCA 2NSOA 4AWEA 5MHBA 1Y5WA 3CU2A 5A2CA 2V30A 3VO0A 1SFJA 4WSJA 2E67A 3LM3A 1S2TA 1QOQA 4L4OA 1X98A 1HKJA 1MDRA 2GPTA 5H1WA 3AUJA 1XGDA 4HNTA 1XKJA 2E6DA 1ITXA 4HPJA 3WQ5A 4JEJA 3RRAA 1US3A 5D9NA 3D3AA 4UTKA 4C6FA 4C6NA 1YHTA 4GUGA 2C1GA 2V0TA 5FL1A 1OBAA 1JQXA 5CPNA 3SCQA 3T0AA 2GGHA 1X96A 3P8IA 5AHMA 1NFBA 3M0VA 2WSKA 4HBKA 3GU9A 4O12A 3NZQA 3OZMA 4H4QA 4FR1A 2NVAA 3DCPA 4OVXA 3DHFA 3NCOA 4M0XA 4CCDA 3QV7A 3M0YA 1NDVA 3S5NA 5HK4A 4JCLA 1SR0A 7A3HA 5DT7A 4LVDA 1EGZA 1QO5A 4Z0JA 4I8YA 3T55A 4R88A 2X1RA 4GX8A 1V79A 5IDIA 5I3FA 3PUEA 3M41A 3TCSA 4IUGA 1CLXA 3GTNA 4KWSA 2A3HA 4UOJA 4JTHA 4TVUA 3UJ2A 4M6QA 1A0CA 3RPDA 2WZMA 1KFKA 3B4UA 1TTIA 4OBTA 2UY2A 1YQ2A 3VKKA 1JQVA 2XFYA 4GUHA 3EDDA 2Y5SA 1IR1A 3R5EA 1TWWA 2A3AA 1HJQA 2J7FA 4JZ5A 1DWHM 3QY8A 4D6HA 1RUSA 5JCMA 3CYJA 1TMHA 3WQDA 4HNUA 2XPKA 3H53A 4HCLA 1I1XA 3CQKA 4FF7A 1XGZA 2ZZ1A 3RN6A 1SVDA 3KBWA 3PUOA 1YTEA 3W23A 1E6SM 3R13A 4GOAA 3TH6A 1WBHA 3EPNA 4Z1BA 1WZLA 1HGYA 4GD0A 1QPOA 3EOLA 4IG2B 5J04A 5DQPA 5BU9A 3S1WA 1OZMA 5T9BG 4IG2A 3VX1A 4GR1A 4GZIA 3N11A 4HMEA 1EIBA 3GZ3A 2O92A 1RY0A 2V3DA 5IFPA 1XIJA 5HR6A 3S83A 3ZO9A 1BFNA 5DBTA 3ABZA 4GXPA 3NPXA 2V8ZA 1GW9A 2PRLA 4YJ5A 1H2IA 2G41A 1K7XA 3BAJA 3AS2A 3WX7A 4CU6A 3NAVA 3QVQA 1K9EA 5H8UA 2Y0FA 5A8NA 1G4SA 3WY1A 3CL8A 1E56A 2OWXA 1T8XA 2I9EA 3S2JA 1DIDA 1XLAA 2ZXBA 2VOMA 4J4KA 4MDOA 2ZE0A 3WG6A 2DW7A 4XX6A 3KE0A 1YADA 3KP0A 4S2BA 1V6YA 1NWSA 3WN6A 3CIXA 2W61A 1JROA 3CIWA 2VTFA 3U4FA 2X8HA 1I8JA 1J0ZA 3CGCA 1R9ZA 4RKAA 3EWWA 3MSDA 1QWGA 4HA1A 2FYMA 2ZC1A 2J7CA 4YWOA 3RNMA 1BSLA 2G3IA 1YEYA 5EMLA 2NVDA 3TC7A 2A3LA 3HZ3A 3CPRA 3PS7A 4Y6GA 4O53A 3PZ9A 2HBVA 3MPGA 1T41A 4MYAA 1HZYA 5FACA 3F4VA 5TQLA 2DZXA 2ZXAA 1UZHA 1FA2A 2I56A 4CUCA 3P0WA 1MQPA 4CGTA 1GZJA 1HO1A 3MUZ1 2NWSA 1MZHA 2OO0A 1VJZA 4ZFCA 3SAZA 3I6TA 1TV3A 5HWJA 4ZOHB 5I5RA 2NQLA 3EMCA 3N73A 1I2PA 2WHLA 2POTA 4FXFA 1HJXA 3F4CA 1XLLA 3AZRA 1BYAA 5GNXA 4UC5A 5PTDA 3I7QA 3MI6A 3HPXA 5E1QA 2HS6A 5ABFB 1XIEA 1ZU8A 1QRQA 5HA7A 5ABFA 2DV0A 4IPPA 2CDUA 1PBGA 2CXGA 2AL2B 4JYEA 3QC0A 1D8WA 1OFBA 2HE8A 1AD4A 4DZ5A 1VJSA 3P61A 4TXEA 1EEPA 1PAMA 4IXHA 4JKKA 4CKQA 2VM8A 5EU9A 4W8LA 5C2GA 2NZLA 1VENA 1A3XA 1GEQA 3KS5A 1FFQA 3CXOA 2JKPA 4JKLA 4Z08A 1BRLA 2FKPA 6XIAA 1E1CB 4W9TA 4HQVA 1OJXA 4UNKA 2CZEA 3P8JA 3BJTA 4FDCB 1PZ3A 1LBLA 2GQAA 5EFDA 1TJRA 2AL1A 2D22A 2XM1A 3P0XA 1GEHA 5FKYA 4Q8QA 2XGBA 3LNPA 2ZTKA 1TQJA 2OPJA 5BROA 3ZYZA 4JCMA 5G2WA 2Z25A 3HTWA 5JCLA 3BMVA 3NSMA 2B81A 1H1ZA 3LLDA 3TUUA 4DNAA 3QY6A 4EK7A 1IT0A 3LDVA 3VOHA 2YA2A 3AIBA 2W63A 4KCUA 4NXSA 5HNUA 1C92A 1EXBA 1P48A 2PGEA 1XYAA 4S3DA 1UKQA 2OEKA 2W4XA 4DO7A 1OGBA 4NZFA 1OYCA 4BK9A 3NVZB 1TZ7A 3E96A 2E9MA 2YCJA 4NZJA 3FHAA 1KFJA 3VGGA 3HV9A 4ZMGA 1T5AA 2J13A 4PMYA 1VHNA 6REQB 3IGHX 1PEZA 4OECA 4C1LA 3DFTA 1GVOA 1Q6FA 6REQA 5JXQA 1C9DA 3ARXA 3ZLHA 3IAPA 3S8HA 4PSPA 1WPCA 3GDBA 1CXEA 3SUTA 4B15A 2CFYA 1WYGA 3MUXA 3F4NA 4B3KA 3MV11 3ITOA 3V16A 4YTRA 4JHZA 4BF7A 4UQBA 3AYTA 1G7UA 4GNKB 4RJEA 4ZO9A 2BV9A 2RHGA 2BWGA 4DI9A 3QHMA 4ICNA 3BZJA 3KDOA 1RLDA 3TWAA 3F5LA 3OTRA 3VGFA 3U5YA 3TYEA 3LZ3A 2HTMA 3SRKA 4AX6A 1ZBVA 4JFUA 4ZCWA 3W38A 3VNIA 2H8XA 1B30A 4OT7A 4IMGA 2V2HA 1TZZA 5D9OA 1YXDA 1WDWA 2HWGA 1MNZA 3BLIA 4Q4MA 3NO3A 3TC6A 2C19A 2D0FA 3D47A 2YB4A 4O1BA 1KM2A 4Y7EA 1NHSA 2QULA 1ENUA 3BAIA 3WD2A 1V0LA 2W92A 3AXHA 4B9ZA 4YYCA 1PHQA 1FFUC 3C8NA 4WOQA 1WCGA 4LS1A 1PDYA 3WELA 4G1NA 2DVTA 3C0QA 1RK5A 9XIMA 4OHQA 1QK2A 2XTKA 4H19A 4FOKA 4CQBA 2F2KA 5DMLA 4KEVA 4JYDA 3UWWA 1VYPX 1POKA 3CK5A 5LGZA 3CGBA 1C3FA 3WDIA 1V97A 3TIMA 3HRDC 4US6A 2A6LA 1LUCA 3QC3A 4CU8A 3NDYA 3R2GA 1PKMA 3N3MA 4CD4A 4D1JA 2DUZA 1F8IA 1TPWA 1P6WA 4CQ9A 1ZZMA 3QFBA 4YLWA 5BXTA 3PWAA 2A0NA 3S5ZA 2C16A 1V8EA 1UA7A 2BGQA 4EQRA 4JQ2A 4PCFA 4Q7NA 3BH4A 1TQXA 4WCJA 3DKJA 1K4GA 3M5VA 3L5LA 5HULA 1XYFA 4GK8A 3TYBA 7REQB 3E2RA 4Q8MA 2CYGA 2I5GA 3OVGA 1EQCA 2UWFA 3MI3A 4ADWA 2F5ZA 3POCA 1CBGA 1Q7QA 4LUJA 2PGRA 3A4JA 1XG3A 1OINA 1H62A 1W1YA 1B90A 3DECA 4GO9A 4KPLA 3ZFHA 6XIMA 3W07A 3HQ1A 1KCXA 4V1XA 2CZ5A 4Q4KA 2A3BA 1T0OA 4HMCA 1Z41A 3W7GA 4EPDC 3NVYB 1GVIA 1E4LA 1QATA 1JPIA 2CFFA 4J57A 1QI0A 3H55A 4ROPA 4NY2A 5AHEA 4LUTB 4MADA 1YPXA 4WY0B 3URAA 2ZBTA 4LUTA 4H4ZA 2OFJA 3VOCA 2Z0IA 4BS0A 4WY0A 1BSIA 1OCJA 5AVHA 2TSYA 1JCJA 1QXLA 2QCDB 3UWQA 4N0RA 4N2YA 3MHUA 3EKZA 1M9HA 4XAYA 5D02A 3SADA 5C7VA 1F3TA 4HA3A 5FSEC 1R8LA 4DYJA 2WVTA 1YDNA 4EAMA 2V68A 3W7CA 2GGIA 1CGTA 4OV9A 3GKAA 3NDOA 3DHUA 4S39A 2OSWA 4XBJA 3GXTA 1HL2A 3S1VA 2ZRZA 3D0CA 4H2CA 4IHCA 4GYJA 4KCTA 4LU0A 4HZ7A 3K46A 4KETA 4L65A 1ZGDA 4M6UA 1J0HA 3NL6A 4EOUA 1J4EA 3UG5A 1CGVA 4GFIA 4J3TA 5EPDA 3SCOA 1CB2A 5CAKA 3P2VA 4K1WA 1I2OA 4ZXLA 4GC3A 3UA3A 4H6QA 3BG9A 2XSAA 3D5HA 4XZIA 3G6MA 4MNLA 1K1DA 2GRTA 4DY1A 3KS6A 4C6IA 3PVFA 4F40A 4TTUA 3BANA 3VVGA 1OD8A 4L4PA 3LHWA 5H2ZA 2OYKA 3KW3A 2RABA 3TWBA 4QSFA 2J24A 1EQPA 5HATA 2CETA 2RFGA 1WDQA 2ALDA 4EPEC 3AOFA 1O66A 3OGRA 2H6RA 2XFFA 3LHUA 2PLMA 1EHNA 1NOUA 3B40A 2JF6A 3IJLA 4A3RA 1VCFA 4X22A 2UBPC 2WO5A 2VP8A 2YZRA 5GRTA 4O4WA 1OF8A 4LVFA 1JGMA 1BD0A 3ZVIA 2DZSA 1V59A 1UR2A 1S46A 3PZGA 4KMQA 4LVBA 1DTUA 2OWWA 5K7JA 1PYMA 3UZYA 4I6KA 3CEPA 4IPLA 3W7MA 4FX8A 3NO1A 4TV6A 1WP6A 1XINA 2GUYA 1JCMP 1WDRA 3QFWA 2D23A 2Y7EA 4G2DA 2VFFA 9XIAA 2IKIA 1ZLPA 1Q5MA 3GNNA 1BWCA 1P0NA 2WPFA 3PTKA 3G0UA 3T2PA 3DGBA 1SFLA 3LHVA 1UCWA 4GO8A 5CC6A 1NIUA 2RJGA 4MFEA 3TTYA 3SBFA 3IVTA 3TFCA 4AWSA 3IJQA 4PSRA 1W1VA 1LG1A 3VOGA 1P5BA 4PRWA 3Q65A 2BNJA 2JIWA 3MTWA 3VGDA 2R8WA 5KVHA 1XL9A 5HNRA 4L6OA 1CXFA 4MF4A 5H6HA 2X09A 1TV7A 4EX4A 2VC5A 3DEQA 3IRDA 5CG7A 3QZAA 1DHPA 4IMDA 5I23A 2EQ9A 3HV8A 3LMZA 1HJUA 3SR7A 1Q6LA 5KZ6A 2E0PA 1W1PA 1AOGA 3DGHA 4L9XA 1Q45A 1ODZA 1BLIA 2G37A 3S2NA 1MWOA 4PMDA 2PDMA 2J78A 1XLEA 3ARZA 2D73A 1YKWA 2POZA 5CSUA 4EKJA 3H2CA 2XIJA 4GBUA 3TJIA 3U8GA 1O94A 3L5MA 3GIYA 5BXPA 3W1PA 5HQLA 2PWDA 2ATSA 5GVJA 4O14A 2A5HA 2EPHA 1UBSA 3L9CA 3TR9A 3GU1A 1ECEA 1NDWA 2VYOA 4CQ8A 2JKAA 5HMSA 1E6QM 1JJKA 3W87A 3SB0A 5CPLA 3VE7A 2WVVB 3W02A 4ZR8A 1VF8A 4GIEA 1GHRA 2X16A 2CHNA 2WVVA 1MXSA 1BKSA 1FUYA 1W1ZA 4XUYA 5DRCA 3VA8A 4G9PA 1G7VA 3PZIA 1D3GA 4R7OA 1N60C 1NSJA 1F3EA 1Q2RA 3WDHA 3RO6A 3OG3A 2E6YA 1P4CA 1O95A 3ERPA 5CG0A 3AYSA 1GKPA 1GQNA 2Q09A 2YKKA 2Z2UA 1V0MA 4PMNA 4R27A 4WDUA 4AEFA 4HOWA 1S2VA 1ZUAX 4YWSA 1ZXIC 1B31A 1SZFA 3ZS4A 2J9ZA 1DE5A 4AIUA 1WAUA 3UWZA 3NQ7A 3LGEA 4XZMX 1FY6A 2A3EA 1Q65A 2QJMA 1KRCC 1X1NA 4Y9OA 4GZJA 3U2EA 3C0JA 1ZB5A 5F4SA 4W8BA 4EXQA 5BOFA 2PUZA 5MF5A 2H90A 3SCPA 4JX4A 3GXIA 2A85A 4M6VA 3T0TA 2YVFA 1AA1B 4AC7C 2OZ8A 4CNOA 4W7VA 1BAGA 1J5TA 4O15A 5LIWX 4JIQA 3KWSA 3F7JA 5C9ZA 3T7VA 1W5OA 4I9MA 3J7HA 2A7PA 2WCGA 2QCMA 4IP7A 1WZKA 4GABA 3VD5A 3ARQA 4I8DA 1QOPA 1Q63A 3WBYA 4PRRA 1UR8A 2IQDA 3NM3A 3GNDA 3BOFA 2OXNA 4FZIA 1OCQA 5FJOA 4AY7A 2XDFA 3CASA 1VFSA 1F2JA 4RZ5A 3RPTA 2Y6ZA 1VDVA 2VR4A 2OOFA 1UWAA 3ENLA 3O06A 2C7FA 2GGEA 4JDRA 3B0VC 1BWVA 3TOYA 1MUMA 2DEPA 1GPWA 5F2LA 1S2AA 4AD1A 2W6RA 3SUUA 2J9YA 2DGAA 2Z1VA 4YS1A 3H2MA 3SI9A 1XLBA 2GVJA 1V6VA 5TIMA 2QPUA 4EXAA 4P8XA 3LCLA 4XK2A 5D8WA 3ZIZA 3KRBA 1AZ2A 3LPOA 5HNTA 1JZ8A 3BWWA 3NURA 4P8UA 4LS2A 1ZRQA 1TIMA 5BYWA 3AS1A 3A3HA 1GT8A 3KM8A 2PS2A 3NQ2A 4AF0B 4NX5A 2GUUA 4QG8A 3W9ZA 5AYIA 5AC7A 3VIHA 4LUIA 4JX6A 4AF0A 2W27A 3CUGA 3M6YA 4OUIA 1DXEA 3LTYA 1A5SA 1EBHA 1R3YA 2OTDA 1PL9A 5CGTA 5AYBA 3ZR6A 4QNEA 2DQXA 2WM0A 8CGTA 1RVGA 4KEUA 1LBMA 5A6BD 4DAIA 2BXYA 1XRFA 3T6CA 3MWCA 4H83A 5HPCA 3E1F1 5KTLA 1Z42A 3KL5A 3VNJA 2RDTA 2NXHA 3S6OA 4QG9A 2CBUA 2VZUA 4EPKA 1A0EA 5ABEA 1AQ0A 1CB7B 4DUOA 4UTLA 4M29A 4UQDA 1YPFA 2CLOA 4UB9A 1REQA 2GQ9A 4J35A 2DU2A 1I2RA 2F84A 4MB4A 4GACA 4E2BA 5AYZA 1QWKA 1V0NA 5DEZA 5AY7A 4M51A 4QJ1A 3H7RA 4GQQA 5FJPA 4TQTA 4B5XA 2IMRA 3ZWSA 1W9VA 1FWAC 1PHWA 4RZ6A 4D6IA 1IEQA 2ZRXA 4WEVX 1EF2A 3W7IA 1LP6A 3PPFA 1A5KC 2O9OA 2G95A 1UD8A 2JK2A 4NEWA 3PBMA 1K8YA 1WXYA 1NEYA 3BAKA 4O57A 4ZBCA 3IJ9A 5AC6A 3AM9A 3NQGA 2WV8A 3A6OA 4YYFA 4ES4A 3B03A 3ITCA 4Z1YA 1BPLB 5IXEA 2ASHA 3OG2A 1AG1O 4O13A 2YXXA 2Y63A 2DDXA 4UBPC 4QG6A 2YBTA 1U1HA 3C0LA 3A7RA 4A22A 1TYPA 4HHMA 1GOWA 3ITVA 3VX0A 2QQ6A 2BASA 3R8GA 1XX1A 3CBWA 1ISWA 1O5RA 4OOZA 1X8CA 1FWIC 3BCJA 3CGTA 5J5RA 2V67A 4DF1A 4LAOA 1AMKA 3R43A 3MB9A 4IICA 4NKCA 4RCXA 1TV2A 4DF0A 2ZZ3A 4Q8VA 3EWUA 2D3LA 1DJIA 1XFCA 2FTYA 1CLKA 3P80A 4E8GA 3QW3A 4LCSA 3RJYA 1GQJA 1CPUA 1ALDA 3ZSTA 4L64A 5DELA 1PV8A 3CHFA 1WYIA 3RMJA 3TOPA 2XZ9A 1MDLA 1W3IA 4AMAA 4J28A 4AQLA 1N8FA 2VVSA 3LQGA 3VIMA 3AHTA 2YA0A 3VZYA 4F79A 1ZDLA 3PBVA 1NY1A 5CJNA 1DJYA 4IPNB 5JCIA 1Y8BA 3VAVA 1B3YA 5EMJA 4CD6A 4U31A 1F05A 2QF7A 1TYTA 5DCBA 5EYWA 2RJHA 4H7ZA 3MYOA 5BXRA 2F6XA 2J7DA 4QXIA 3VD9A 1FWGC 2E77A 3GNOA 1QHOA 2QIWA 2YA1A 4CNTA 1D8CA 3U4AA 2PDBA 4RW5A 2PDNA 4NT0A 2OGYA 1ZAHA 4DUWA 1OFOA 3G1DA 2PI6A 5L6UA 2YQUA 4Q7IA 4FLOA 3FYYA 3UZWA 3ATZA 3GR4A 2Z2BA 5E0CA 4UTUA 1DKWA 2PCEA 3CGEA 2PP1A 3ALFA 4QX4A 3M9YA 1ITUA 2HISA 4Z2HA 4GIRA 1X97A 2QUVA 2PRMA 3B8DA 2VCBA 2GVGA 1JDFA 4K6AA 3SURA 2HNHA 1J6OA 4BJHA 2GDQA 3UA4A 3N9KA 3GBDA 3MO4A 2W5FA 3AS0A 1GCYA 4BR1A 3U48A 5E93A 2OLHA 5G4WA 3H24A 3ABQA 3QR3A 4RNJA 3PBYA 3S5YA 2PC4A 2FJUB 3LPGA 2E6AA 1ZKQA 3RPMA 3HM7A 2XG9A 2JE8A 2FFCA 2RUSA 3JU2A 2WWDA 1C29A 1EJ7L 4LS0A 1GEUA 1L8NA 2PDLA 2BOFX 1HN1A 3KX6A 4PEEA 5IBXA 3QYSA 2ZADA 3MT1A 3KLJA 1XRTA 4LB4A 4XZLX 3HO8A 3V7PA 2WOVA 2PCQA 7XIMA 2IUZA 1RQEA 1FP9A 4ONVA 1YE4A 1QU4A 3PN8A 2QJGA 3MV01 4XBKA 1TTPA 3L67A 2BG5A 2Z1SA 2WXDM 3OIXA 2V82A 3VM5A 3KHJA 4HGXA 1FBAA 1WKDA 4EE9A 2PDPA 3HW2A 5A6KA 1UD6A 3GD3A 2DZVA 3I3DA 3K13A 1Y5VA 5HUOA 3V75A 1BF2A 1ZFJA 2X41A 1KRMA 1NP0A 4FXJA 3VYLA 2O7SA 1XI3A 3WDPP 1EGVA 4GZEA 1T40A 1LQ2A 3H8AA 4X63A 1E6PA 5E09A 4GGHA 3W73A 1HKMA 1KB3A 4LRSA 2QAFA 3H70A 4NJIA 4WJXA 1FWNA 1FIQB 3SO7A 2CBVA 3BV4A 4K2SA 4Y9AA 3CAVA 1K03A 1H7OA 5I79A 3EDEA 1WA3A 3WK3A 1BYBA 1O4UA 5FS8A 4UWMA 2WQPA 1E0UA 4ZTYA 3GNPA 3KP1A 2DPEA 2GVYA 2O0TA 3B06A 2IXUA 2VX4A 3N15A 1U2YA 3BAXA 3BAYA 4KQNA 3ANUA 1HW6A 3VIOA 5CH9A 3G8RA 5CC5A 2ZCGA 1J0KA 4W5ZA 2E8YA 3WF1A 1IEWA 2DFAA 4BHYA 4PEKA 2QPSA 3II4A 3VMOA 4PCSA 3CPUA 2DJXA 2OLAA 1QVBA 2GQ8A 2QCGA 5KZMA 1S3TC 4XD4A 2H8ZA 4DNHA 1QPRA 4I5XA 1LDCA 3VXGA 4H4YA 1GONA 1SJAA 1UPMB 3GYEA 3VNYA 4Q4OA 3IIZA 5E5CA 3P6LA 2V69A 4QE4A 1LBFA 1AW5A 5CQ1A 3DERA 1QT1A 1F3PA 1EOMA 1BKHA 4PODA 5C2XA 3F1QA 1JOAA 2VGIA 2CPUA 3AC0A 2R94A 3S42A 1BTMA 3GLCA 1T96A 2NT1A 7ENLA 3S6TA 2C18A 1L8PA 4BQ4A 5IBXC 1P0EA 4AZCA 1K9FA 4UOQA 1SPQA 4D8ZA 2WC3A 4PYSA 2Y7GA 1KTBA 4H1ZA 3HQOA 4TVCA 7PTDA 2E28A 3C2OA 4GFSA 3PAOA 1UIOA 3DFOA 1WQ5A 3WKZA 3GH4A 4YCPA 1R47A 2CLPA 3CLMA 2F8QA 4O18A 2OT1A 1PX4A 3GVRA 1JCTA 4AZIA 2OX1A 2Z1BA 3MC5A 2FZNA 3ZXWA 3I6RA 1XDMA 4BEQA 4XVDA 1A50A 1GRHA 3K4WA 5CZTA 3E0WA 4GYFA 5D09A 5MKGA 4O28A 4XUGA 4DUXA 2WHKA 1NFGA 4JXCA 1CGUA 1VFHA 3A4AA 1PJ9A 1F3XA 4FMVA 3C2VA 5BW6A 1EL3A 2V6AA 1XHGA 2DZAA 2Q3OA 1Z32X 2R1PA 2XHYA 1RPKA 2QDGA 2NWRA 1H5VA 4RPQA 3VCNA 4LFYA 3R12A 3G0XA 4J7RA 4J3VA 4UNIA 4PUEA 2ISSA 2WLZA 1CLVA 1DXLA 2PBGA 2D3NA 2VRJA 4NAFB 3N25A 3F2DA 2YDAA 4UFHA 3SFKA 3G18A 3N4FA 3E2VA 1DWIM 4DB7A 3G1HA 4NAFA 4LT9A 3KBMA 2EJ1A 3EZ4A 4RK8A 5HMFA 1EWDA 3PNUA 3S9IA 3GG7A 1MO9A 1TG7A 4S3JA 3WNOA 5C2CA 2VFEA 1E4IA 1XCXA 3OLDA 2HPMA 1UP0A 3AMKA 4C60A 4B2DD 4ZOEA 1V3KA 3HGJA 1B9BA 4OOUA 3BW3A 1TMLA 3I10A 4UR8A 4Q33A 5K3VA 2EQ7A 4GKTA 4E2DA 3SR6B 1WKFA 2INEA 1W3LA 1JYVA 5LNRA 3EWXA 3SIMA 4AW7A 2QUNA 2ZX8A 4A21