3MUCA

Muconate cycloisomerase variant i54v
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
369
structure length
360
Chain Sequence
ALIERIDAIIVDLPTIRQQQTLVVLRVRCSDGVEGIGEATTVGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MUCONATE CYCLOISOMERASE)
publication title Structural basis for the activity of two muconate cycloisomerase variants toward substituted muconates.
pubmed doi rcsb
molecule tags Isomerase
total genus 138
structure length 360
sequence length 369
chains with identical sequence B
ec nomenclature ec 5.5.1.1: Muconate cycloisomerase.
pdb deposition date 1998-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3mucA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3mucA01
3R1ZA 3IJIA 1XPYA 4DX3A 2PPGA 3THUA 1ELSA 4K1WA 3DG7A 4GGHA 3H7VA 4FI4A 3NO1A 4HNCA 2PSNA 3MKCA 3GD6A 4A35A 4KPLA 4HNLA 3TWAA 3JVAA 3MUCA 1R0MA 3RRAA 1FHUA 3D46A 2AL1A 2OX4A 3MSYA 3CB3A 3VC6A 2PODA 2FYMA 3N6JA 2PA6A 2OVLA 2OKTA 1R6WA 3FV9A 3N4EA 3V5FA 2XH7A 3GY1A 3MZNA 2P88A 4H83A 1MDRA 3H8AA 3PK7A 1OEPA 4JN7A 4IL2A 4GISA 3IJLA 3U9IA 4IZGA 3V4BA 4ENLA 3DG3A 4HCLA 1PDZA 1SJBA 5FJUA 3TJIA 2RDXA 3CK5A 4GYPC 4JN8A 3UCDA 3DGBA 2QVHA 4YWSA 4K8GA 3VDGA 2OQHA 2DW7A 2P8CA 2QDDA 3DDMA 3BOXA 3N4FA 1MUCA 3R0UA 1KKRA 2O56A 2AL2A 3MY9A 2HXUA 1ONEA 2AL2B 2GL5A 3K1GA 3DIPA 1TZZA 2CHRA 4KWSA 3UXLA 3R25A 2XSXA 2OQYA 1W6TA 3V5CA 2XH4A 3ES7A 2NQLA 1XS2A 4KT2A 2HNEA 4E4UA 4FP1A 4IT1A 3UJSA 3ZVHA 3JZUA 3ZVHB 1F9CA 1JDFA 3D47A 3ENLA 3N6HA 3UCCA 4MKSA 5EU9A 3JW7A 3EKGA 1IYXA 2OO6A 3OPSA 2GSHA 2GGJA 1E9IA 1PDYA 2HXTA 2QJJA 2P8BA 2POZA 5BOFA 3SJNA 1BQGA 3SN4A 3FVDA 3KUMA 4E6MA 3Q45A 1ECQA 2PS2A 2OZTA 4J3ZA 3U4FA 3DEQA 1TE6A 5IDZA 3RGTA 3CT2A 4MGGA 2QDEA 2OFJA 1NU5A 2P3ZA 3RITA 3RR1A 5J04A 2OLAA 4IL0A 4HCDA 3RO6A 3UGVA 2FKPA 3UXKA 3P0WA 1NELA 3NFUA 3B97A 3SN1A 3VA8A 3UJ2A 3SSZA 3SBFA 1KCZA 3VFCA 2PP0A 2QGYA 3NZGA 3EEZA 2AKMA 2AKZA 3T9PA 4GIRA 4F4RA 3PFRA 3STPA 3DG6A 4H1ZA 4ROPA 1JPMA 1EC8A 3MWCA 4MMWA 3TTEA 3S47A 1RVKA 3TQPA 2PTZA 3H70A 7ENLA 3ZLFA 1EBHA 4HCHA 3QLDA 2PGWA 3NXLA 3QKEA 2XH0A 3FJ4A 1DTNA 3MQTA 1EC7A 3TJ4A 3V3WA 1MRAA 5FJOA 4M6UA 2PMQA 4DXKA 3ZVIA 4A6GA 4DYEA 1JPDX 3VCCA 3FXGA 1P48A 3I6EA 3BJSA 3UJFA 3BSMA 3T6CA 5FJTA 3CYJA 3P93A 3IJQA 1SJAA 3OZYA 4J1OA 6ENLA 4E5TA 4GFIA 2PU1A 3S5SA 3DERA 3CXOA 5FJPA 3OTRA 2QJNA 3QPEA 1SJCA 3ES8A 3I4KA 4K2SA 2OG9A 3R0KA 4DN1A 3Q4DA 1TKKA 2ZC8A 2XH2A 3QTPA 2MUCA 5FJRA 3OZMA 1MDLA 4M0XA 2HZGA 4DWDA 3FYYA 3DESA 2PGEA 1WUFA 4Z1YA 3GO2A 2PTXA 2PCEA 3ZLHA 1MNSA 3DFYA 2GGEA 2GGIA 3TWBA 1P43A 3IK4A 4GYPA 4G8TA 4H2HA 2PTYA 2ONEA 5BOEA 1BKHA 5ENLA 4DHGA 3QN3A 3SQSA 3T4WA 2QQ6A 3H12A 2GGHA 3FCPA 4ZA0A 3TOYA 2PU0A 4KEMA 3OW1A 3I6TA 1SJDA 2OZ8A 3VC5A 3RCYA 3VCNA 1WUEA 3TCSA 3GC2A 4IP5A 3OP2A 2MNRA 2DW6A 3DFHA 3P3BA 4Z17A 4HPNA 4HYRA 3UJRA 2GGGA 4JHMA 2ZADA 4E4FA 4H19A 3R11A 2XGZA 1YEYA 2I5QA 4HN8A 2OZ3A 2PP3A 4E8GA 4A3RA 4EWJA 2QJMA 3CAWA 2P0IA 3ZLGA 2OPJA 2PTWA 1EBGA 4GMEA 3PWIA 3SN0A 3HPFA 3PWGA 4X2PA 2GDQA 3R10A 2PP1A 1FHVA 1KKOA 4ZCWA 4GGBA 3UJEA 1KD0A 3T8QA 4IP4A 3TW9A 4IHCA 1EC9A 4G7FA 1JCTA 1L8PA
chains in the Genus database with same CATH superfamily
1XPYA 2DSUA 1MXDA 1ZKQA 1LL7A 5GRTA 2H8ZA 1AQMA 1T0OA 4UFLA 2H6RA 5XIMA 2R8WA 4KPLA 1P6CA 3PPGA 1X6NA 2CITA 4PSPA 5LIXX 3QHOA 1TMLA 3OLGA 3W1AA 5TQLA 4UTMA 3LZ5A 3M9YA 5E5CA 3THQA 3W23A 4DWSB 1DJQA 3TX9A 4DF2A 4AX7A 1XYLA 1A5UA 5LHEA 4AMAA 3TR2A 4A2SA 2E8ZA 3VX1A 3QOMA 1H1YA 2XG9A 3UYCA 1QATA 4JIIX 3TMLA 4NIRA 1S3TC 4JICA 4JN7A 1E5JA 4LUYA 5K9CA 3W7HA 4LB3A 2XJ7A 2ZRWA 9RUBA 1P6BA 4CNPA 1PDZA 4MSSA 2CLIA 3LM7A 4A3HA 3B8VA 3CB8A 1IIGA 1J0JA 4JN8A 1JDEA 4G56A 4NEVA 2RUSA 4HSNA 1N8FA 4YWSA 1BYBA 5JH1A 2REQA 3UXDA 2P8CA 3NZQA 2ZYFA 4I9MA 4NQ1A 1F7BA 4EXAA 1F6KA 1KKRA 1GT8A 5I06A 3MYPA 1T40A 2PBOA 1US0A 2D2OA 3CHCA 2HWGA 2QEZA 1SGJA 1J5SA 4ML4A 1F3XA 4JTRA 3TR9A 3CGBA 4DZ5A 3ES7A 3WY1A 1EDGA 3RNDA 4XQ6A 5G5HB 4AY7A 1VJIA 3WD0A 3VD7A 5GQBA 2CLHA 2FZDA 1WYGA 4D8LA 4LAOA 4UOZA 4MDPA 5FS6A 1F05A 3AOFA 1FWBC 4JTDA 2WWDA 5H2ZA 3S9ZA 2CLPA 4AUBA 3MUXA 4GOAA 2AMXA 3EKGA 3A7UA 4AD5A 4F9DA 3UPWA 2C0HA 3N14A 3CASA 3TXZA 5AYBA 2SFPA 4JEQA 3SO7A 1ZCOA 3QW3A 2WZIA 1G0CA 4GNJA 3DHFA 2BOFX 1NIUA 3TQ0A 1IXQA 1RA0A 1V3LA 2OT0A 1WPCA 4ZGYA 4WK9A 4D6EA 4DY1A 3FVDA 3MKKA 1J0KA 4L64A 1W9XA 3EWUA 4LEFA 1VC4A 1B90A 3ICJA 2XVPA 3QVQA 3FJNA 2FPTA 4ZVJA 2CDUA 1T8XA 2XM2A 2P3ZA 3WQDA 5EMMA 1MNZA 4O1FA 5E93A 3GNRA 4US6A 3M0HA 3NVDA 1IHIA 1OF6A 3LV5A 4BHYA 2C14A 2UY3A 3MCMA 1F3WA 4LB4A 4JTIA 4GYKA 3T9PA 3LCXA 4EOUA 4US5A 4H9TA 3QM3A 3D5HA 4GJ1A 3P81A 3SCNA 3M5XA 4BA0A 3CWOX 4Z0JA 3WLJA 2EG8A 2E3ZA 3GKAA 4FX8A 4XUGA 1V3HA 4UTIA 3ZO9A 5GNZA 2BHYA 3AAMA 1BF2A 4KERA 4Q4KA 5MKGA 1PV8A 2O9OA 1DTNA 1CGTA 4Q7IA 2UWFA 1LOQA 1KR1A 1VS1A 4ZTXA 4LCSA 3QY8A 1MRAA 1L6FA 3W9ZA 2OEJA 4BQ2A 1O4UA 1MOKA 4PUJA 1PZ1A 1W9DM 2A79A 2J77A 3D9XA 1W9PA 3ERPA 1HX0A 4GXPA 4YXGA 1AH4A 4R9XA 2YZ5A 1K8ZA 1X98A 4XZBA 4M56A 1XANA 3P5ZA 4LYQA 3DK4A 2E4TA 3CNYA 3N4AA 1R2RA 4BURA 4G2DA 1IE7C 1R30A 1VBRA 1POJA 3EDJA 3M64A 2R1PA 4OECA 4BWLC 2GSJA 1ZAHA 1RY8A 1JYWA 4NZ4A 3IV8A 2QJGA 1JZ8A 1PKNA 1EXPA 3T42A 2HS6A 1ZRQA 5HJXA 3WF4A 1F8MA 3W86A 4GH3A 1EUAA 3WQPA 5D02A 4EE9A 2G96A 5BCAA 3FXYA 3VKAA 3O0HA 3E0WA 1CXFA 2EPMX 2I9UA 2VFHA 2YL5A 3IJ6A 3WDHA 3CXBA 4YU1A 1K6WA 1C8YA 4ACZB 3GX9A 3DFYA 4LS2A 1D2KA 2F9RA 1N2VA 6CGTA 1W17A 1H4PA 5D09A 2DJLA 3UG4A 5T9CE 5BWAA 3CH0A 1TYGA 2CERA 1XLKA 1NF7A 4ORMA 3BCDA 1N5WC 3W53A 3QN3A 4RW3A 4OHQA 4M1RA 4BV6A 4LQ1A 1FWSA 2CLEA 2FDSA 3SR7A 5LYRA 2OSYA 4KEMA 4PMRA 3W1QA 1AW5A 2BZNA 1XLAA 3LHYA 4LS1A 1KM6A 4QE4A 4HYWA 3GD4A 1TA3B 3CWNA 4FX6M 3CQHA 1BKSA 3H2OA 4F0SA 2BS9A 2OO0A 5JXQA 4LC8A 5LA0A 4ZFCA 1L6YA 4Z17A 4BI6A 4MWAB 4GG9A 1TVNA 5AOUA 1K9FA 1U5HA 3G1FA 4MYXA 1K1DA 4JHMA 2YCLB 1HKIA 1NP2A 4HB7A 4OVXA 3GVRA 4TX9A 2YYTA 2HDJA 4FNSA 3GHSA 3VCRA 4C6BA 3WLPA 4TOQA 3W1TA 3LD5A 4A3RA 5K3VA 2QAFA 4R7OA 1ZX9A 3URBA 4GMEA 3NEVA 4RE4A 1RLCL 5AYYA 3TMQA 5KZDA 4DJDD 3NL6A 5HINA 4R34A 2GDQA 3UD6A 2DIKA 4JKKA 5DCBA 1FHVA 3OHMB 2X8RA 1KRAC 5AVHA 3L9CA 3NXFA 1FH9A 2RKXA 1WZLA 4DJFD 3RM4A 1Q6GA 3OU8A 2YDSA 4PUKA 3HU7A 1OQFA 5HNRA 3BGJA 3DG7A 1PWMA 2CLLA 4OJYA 2QT3A 4UQDA 3LHVA 1CENA 4I8YA 4Q8VA 3B9EA 2Z6JA 1KM2A 2QYGA 3CV6A 3DBNA 3JVAA 1R0MA 4K6AA 4MJMA 3RLVA 3D46A 3DUGA 1RQBA 1UWQA 4FNTA 3VC6A 4LNYA 5G1TA 1ZLPA 2HK0A 4HHHA 1IZCA 1NQKA 2H90A 1BXNA 4CKQA 3N2CA 4UMCA 1OGGA 4DXVA 1BSLA 1KTNA 1GKRA 3GG7A 4AYSA 1EP1A 2X2GA 4WXYA 5C2GA 1W2VA 3BO9A 1UZ4A 1C7TA 3VNDA 1W54A 1N62C 4RE2A 5BRBA 3BCFA 3BV4A 4EMJA 1JAKA 2G3FA 1OWQA 2CBVA 4KIRA 4B5UA 6XIAA 1R2SA 1PXGA 6XIMA 1FWRA 4Z42C 4EPKA 2EKCA 3WL0A 4ZOBA 4EM3A 4N42A 2WVSA 1GOIA 1UH2A 1JAEA 1LRQA 3NTYA 3IIVA 4IX2A 3WH6A 3GKFA 3H54A 1W1IE 1H1ZA 3V1HA 3ZXWA 2JFEX 3LEPA 3NO3A 1XLJA 1UKTA 2BVYA 2XH4A 2ZE0A 2HNEA 3P82A 1W3JA 1BLIA 1EBDA 2NSXA 4XKYB 2VR2A 1KCLA 4Y90A 3M5ZA 4MWAC 1PS9A 4HPXA 3GVWA 4IMFA 1W1YA 1GKQA 4WX2A 1XIJA 3EA3A 5REQA 3E0IA 3M0IA 3B8SA 5CJ5A 2HSAA 3LN3A 5DXXA 3T09A 3E3HA 4D9PA 1J2WA 1QI4A 4DUVA 3KVKA 3OGVA 4ZSTA 1BWCA 5FESA 4M7TA 2XZ7A 2YW3A 2XSAA 1SO3A 1LPFA 4W85A 2VX7A 3ARXA 2P8BA 4GNKB 3E5PA 1QBBA 4HU0A 1B2YA 2D2GA 1LQ0A 2FZNA 3P14A 3HM7A 1ICPA 1Q1WA 3CLWA 1W32A 2HE5A 2O9PA 2WKJA 2J47A 2YW4A 1BRLA 1PAMA 3SUUA 1C8XA 4RNIA 1T41A 3LY0A 2E40A 4IFKB 1X6UA 1HT6A 2W67A 4HN4A 4C6NA 4OE7A 2OFJA 3EAUA 4WOZA 5E0KA 3FEMA 1UWTA 2NZLA 4YVXA 1CDGA 4HCDA 2NUYA 4XZ9A 4AEEA 1YDYA 1BG4A 1JEZA 6REQA 4NG3A 1HKKA 4MNKA 1XINA 5I23A 2PP0A 2X16A 5F2LA 1A5MC 4E2OA 1LZOA 1AQHA 2XISA 1Q8AA 4QJ4B 3PB0A 4NAFA 1UR1A 2VRJA 2TMDA 2VOTA 1ISXA 4H4VA 1TUXA 3EOSA 2DT3A 4JS3A 4L7ZA 1B3YA 4MMWA 1J0ZA 4IPNB 3O0KA 4HNNA 4PODA 4B4HA 6ALDA 3MT1A 4K3ZA 1KXQA 4DNAA 4C6QA 2WKGA 4YTTA 3V3WA 2ALDA 3B9JB 3O3RA 2RJHA 2DZUA 5CEWA 1E0VA 1OG0A 3TYZA 4PRTA 1OX4A 4L65A 1TV8A 2YSWA 5FOOA 5JRBA 3I6EA 3AMCA 4PCTA 2GK1B 2ISWA 4C1LA 2YZRA 1K9DA 1O5QA 3MMDA 3D3FA 3W01A 1OB0A 1N55A 1SJAA 4LFYA 4IMEA 3WLOA 2E8YA 3CXOA 4LALA 5HUOA 3G1DA 1JGMA 1ZXIC 1VYRA 1CW2A 2Y5JA 3ISIX 2B7NA 1DBTA 2HCVA 2V69A 9XIMA 1XH1A 4B5NA 5CPTA 2Y1HA 4O28A 5BW6A 4JXCA 3KL3A 3S5YA 3KW3A 4OKDA 3TQVA 5A6AA 1IWPA 4DWDA 1EF3A 4LVDA 4CVWA 4H7VA 3LK6A 3RM8A 3OYZA 2PGEA 2BXYA 3MA8A 3P0XA 1JUEA 3O16A 3TSDA 1K03A 1NDVA 4MLRA 1X1NA 4Z2HA 1JD7A 1I2QA 2ONEA 5BOEA 1KRMA 4YPJA 3GDLA 3S2NA 3AXHA 5G4WA 2F61A 4TR9A 3BXWA 4AHQA 4DUXA 4LBUA 3IJDA 1HNYA 1KFKA 3HG4A 3PC0A 3A5FA 2OLSA 1UR9A 3NDZA 4MB3A 4CQCA 3A3WA 3NL3A 5BRPA 1EB3A 1E9YB 2IW0A 3FFSA 3AWOA 1Q5MA 3WQVA 4ZQMA 3A6OA 5EBAA 4QG9A 5CCZA 3PBMA 1GVRA 1G7UA 2WJZA 2VGBA 1GOOA 4L61A 3S1XA 4GVGA 3EWCA 4FR6A 4F40A 3VIJA 2FZ8A 3OLEA 1TPB1 4EQWA 5U4NA 3H2EA 4ERAA 2YA0A 3AXXA 4OQVA 1W1PA 2PRLA 1MW3A 2OZ3A 3GK0A 4E8GA 2HTMA 1JR1A 4O0ZA 4R7WA 3EUB3 3CUJA 4ZSUA 1L6SA 1Q3NA 3ARWA 1W9UA 1H7RA 3VIKA 3IIXA 4UOQA 4WRHA 1Q6OA 1RSCA 3NVZB 1MUMA 3JRKA 3BG3A 4R53A 1I1WA 4TU1A 1IGSA 1EJTC 1KD0A 1VQTA 2EHHA 2BG5A 4PCNA 3SIMA 2E5DA 1ME8A 4O15A 2NQ9A 1IT0A 4XZIA 1Y7VA 1DHPA 1XRSA 4KQNA 4PCFA 2Z1WA 4G1NA 1BYCA 2BWGA 3ITCA 3ITYA 1RR2A 2OYLA 1VD6A 4HMDA 4RV3A 4P61A 2DVXA 1XRFA 3VZYA 3MSYA 3VNJA 1R46A 2HVOA 4FF7A 1DOSA 4QCFA 2VCBA 1P1MA 1TX0A 3T8LA 1ISZA 1GORA 3RYSA 1MDRA 2Y7FA 4B3KA 1SZGA 4FPSA 1JUBA 3PK7A 4B2DD 5B80A 1P7TB 3U2ZA 2VDHA 1HGYA 1B4KA 4BI5A 3FS2A 3PUOA 3VILA 1SJBA 4J2PA 2CFYA 3EPOA 1Y0EA 2VWSA 3VMNA 7PTDA 4XVDA 3HRDC 3GFYA 3DGBA 3ABRA 5DF0A 4O18A 2VDGA 2FJKA 1A0EA 1QASA 4R7JA 3LRLA 2YBVA 4IGHA 3PUDA 2V6OA 1SFSA 2QDHA 4BWLA 1V6XA 1R8LA 4A22A 4KWSA 3K1DA 3KBVA 1JYNA 1DE5A 4QM1A 2ESCA 3V5CA 2AGTA 2E1DA 4QLJA 4S3CA 3H2CA 3MCOA 4IT1A 4ZEPA 3HQPA 3DFOA 2NV1A 4GY1A 4DZIA 3OC4A 2PDXA 1XHCA 3VGFA 2Y7EA 2XWDA 2PZNA 2WWCA 4PMNA 4FEZA 1KFWA 3KBNA 4LX4A 2WP6A 3UXAA 3WH7A 2E6DA 1EJXC 4NJJA 3GUGA 2R24A 5DBUA 5DBTA 4WHBA 2RDTA 3ZR4A 3SJNA 2BHUA 4TUFA 3M43A 3OO2A 4FMVA 3AICA 4RNJA 5E9XA 1UB3A 1ZMDA 1CGVA 4W8BA 1HJWA 2OZTA 1FCUA 3U4FA 1TE6A 4Z2JA 2YFNA 3GWQA 3MPGA 3NYZA 1RQHA 1VPYA 2PGFA 1WV2A 3BQ5A 4W8AA 3K4WA 3RITA 1QUMA 1US2A 1V7YA 3C52A 3DK8A 1WQ5A 3ITLA 1FWTA 2IQ0A 2WNZA 4O50A 1R9XA 3LPPA 3NFUA 2BVTA 1B3XA 5BNKA 2DIJA 2IKHA 2AQOA 2Y5EA 3VGBA 5F7UA 1UQYA 2ZUVA 6TIMA 1PKYA 3TAKA 4NJGA 3M6DA 1ISVA 4H8NA 2F6KA 3CC1A 2AQWA 4J5NA 1F07A 1VLIA 5FEPA 3TTEA 1XIDA 4MY9A 4OBTA 3TQPA 3H70A 4QAWA 3HV9A 5LXXA 1IT8A 4WY0B 1JCNA 3IJ7A 2WZHA 2V5BA 1H5VA 2GDVA 1EC7A 1UIOA 3B9NA 5FIPA 4GJIA 1QW8A 2TYSA 2KZHA 1OFBA 3WLIA 2QHAA 3SI9A 1MFUA 3S2CA 1TWSA 4LRTA 3VCCA 1TWIA 4OUIA 3JS3A 2VXNA 4XWUA 5D2YA 5FJTA 3W6YA 1XDMA 4BQ5A 4GYFA 4MPKA 4H7CA 3A7RA 1JUKA 1YX1A 3RO8A 4F0KA 3G1HA 3SECA 4A29A 4LAMA 8XIAA 4PMUA 3BLDA 3SCTA 3GR8A 4PTDA 4WZHA 3SY1A 3G24A 1FDZA 1OZQA 3Q6JA 1Y5XA 3N2TA 4L4PA 4LGXA 5G5IA 4XKMA 2VVSA 3QC0A 4KH2A 1E6RA 2NQZA 1CX9A 5E1QA 3NZPA 1YMYA 3L65A 3WMBA 3QZAA 4H4WA 1MYRA 3I3BA 2ANUA 1YTDA 1CGXA 2DSZA 1PX3A 3MVTA 1MNSA 3NGFA 4AEFA 1QO5A 2R9RA 2GJXB 1R87A 3FK4A 5CZTA 1HJUA 4G8TA 1IXNA 1UJQA 2VX5A 4QITA 5JCNA 3O6AA 3VK5A 3BLEA 4GQQA 3BCJA 3WH5A 3FOKA 1V59A 2QQ6A 4OBRA 2G97A 1FWDC 1JQXA 1XIMA 3WNOA 1TA3A 1BWKA 3STEA 4NZCA 2BX7A 2YXOA 3VI2A 5L9FA 5AECA 2CLOA 4MHBA 2QULA 5TD4A 1E71M 2PI6A 1FWHC 4GZEA 3EXSA 4MWAA 2QJHA 3WL1A 3DH9A 1GYMA 2EG7A 2W55A 3LYEA 5JBEA 1VYSX 2NVAA 4M24A 2AAAA 3TOPA 3GU2A 3C5QA 4EWJA 5JBDA 1XC4A 3M07A 3RU8X 1ITCA 3E12A 3WLSA 1BFNA 3WQWA 4FOKA 5EBKA 3B3DA 2DSVA 3W1MA 4TIMA 1CB2A 1PO9A 1V03A 1H41A 4CNSA 3HB9A 2R91A 3UWEA 4ZQPA 3PPFA 2C19A 1L8PA 3QFWA 2PPGA 3WQ4A 5CSYA 4UNIA 3NQEA 5IDIA 2IXUA 5EPDA 2BMBA 3F2BA 3L4VA 2OYKA 3BLLA 4DO5A 4PB4A 3PWAA 3UZXA 5D9OA 2Y8UA 4DM2A 4UBPC 3AS0A 3CTTA 2ACQA 3G1AA 3AROA 3MO4A 3PY2A 3P2VA 3NDYA 4R3UA 4JOMA 2CFFA 5CC5A 4BI7A 2C15A 1Q4NX 1XLEA 3DJGX 2NT1A 3CZEA 1IV8A 4LC6A 1LCOA 2WSQA 3TE9A 4UTTC 1VHNA 5HNTA 4M80A 1M5WA 2QJIA 4YHEA 1GGOA 3T81A 1XHGA 4IIFA 3R4IA 4BS0A 2EF9A 3BMXA 2XN2A 4IGSA 1TPUA 3VD5A 1UUMA 1YPFA 3IWPA 1Q6RA 1V3MA 1DQWA 2ZFAA 3GS6A 3LXAA 3Q67A 3S1VA 3AXMA 3WNNA 1W2PA 3SUSA 2O56A 2WXDM 3HG3A 4XZWA 3P8JA 2V68A 4YMZA 4O13A 3TC6A 3F4NA 3KHDA 1RD5A 1S2CA 1TZ7A 2G50A 3N19B 1O60A 4J40A 3FY1A 1LWJA 1ZGDA 4UFJA 4X2RA 1OVDA 2XSXA 4ZODA 2VZOA 4DBSA 4WDUA 4W5ZA 5JIWA 3R12A 3CQ0A 3REQA 4J35A 1Q45A 2XFWA 5BYWA 1QPQA 4NYYA 3VGHA 4WKHA 5HANA 4Z2IA 1LROA 4N6EA 1OC5A 3MU7A 4F3HA 1YXDA 3BL3A 1F8WA 1OABA 3DFNA 2FQIA 2E5CA 3UW6A 4H9VA 3STGA 5AHFA 3IUHA 4IXHA 3ARSA 4H9UA 1EQPA 2FGBA 3QGAC 6A3HA 3SGZA 3ENLA 3N6HA 3HF3A 2FZBA 1KQYA 3WNMA 1OFOA 1GESA 1CLXA 4DPQA 3B9AA 1W1A1 2GSHA 4Q6JA 3T0BA 2HXTA 1QHOA 3W6MA 2XGIA 2QV4A 4HK7A 1XSIA 2QCCA 4FIQA 1BSIA 1OJXA 4Q8OA 3KUMA 3E0FA 3Q45A 4RR4A 1ECQA 3B0YA 2CESA 3R2GA 3W7GA 4S3AA 1UMYA 4H9ZA 1I1XA 1TV3A 4RNHA 4MAVA 1XQLA 3VINA 3E6EA 2GQ3A 5DN1A 3NYDA 3VDHA 2QPSA 1LP6A 3UGVA 2FKPA 1PTDA 1QNRA 1I75A 1UZDA 1YNPA 4FDCB 3SN1A 1NJJA 4QS5A 1V0NA 1UH3A 1JCJA 1EDQA 4H6KA 3PPCA 1KCZA 1H09A 3AHYA 1JDAA 1J79A 2AKMA 1ODUA 3H2FA 4AZ7A 3MSRA 3NOYA 3WQ8A 2PWDA 8A3HA 3AYRA 4UB9A 5AYXA 4BF5A 3LUTA 1RVKA 3II1A 4YNGA 4OTKA 1A53A 1HJQA 1R3SA 3CQKA 3QLDA 4A3YA 1IZKA 5H6HA 1TSIA 4X22A 4MUPA 2D73A 3N9RA 1YQZA 5A8MA 4WDWA 1I2OA 1DYSA 4F0RA 4NX5A 3H2MA 5T8GA 4DYEA 3OA5A 3NQCA 4GNVA 4CD6A 4FXSA 4DJED 3I3EA 4UMAA 3E96A 1Q8JA 3S9YA 4TVWA 3AC0A 4IWWA 2CZEA 4JQ2A 4PTXA 4E8CA 2OODA 4Y9PA 4AH7A 3F4VA 3AIUA 1U83A 3I4KA 4Q32A 2HK1A 3PN8A 3F2DA 4HMCA 5FAJA 3LGEA 3QZEA 3TIMA 4Y96A 4CCDA 2XH2A 1GXFA 4I9JA 1SFTA 2B7PA 2WQDA 4ZQRA 1H7NA 5KZMA 2HZGA 1P5BA 3OVPA 4D72A 1KGWA 3G1VA 1QHPA 3ORWA 2C8NA 3IVTA 3ZFHA 2PCEA 2XIJA 3P61A 4E3TA 3NSNA 1NPXA 2CW6A 1OYCA 2ZUNA 3S1GA 5C9XA 4H4YA 3AWNA 2FMOA 1O6IA 3DYMA 3NOEA 2B0MA 4K8HA 4V33A 3WQOA 1W5NA 3TTQA 2DH3A 5CJNA 1A3WA 3L5MA 5I3KA 1OT2A 1XYMA 4AZCB 2I5IA 1J93A 4AIEA 1SJDA 1DJXA 1GQNA 1U1JA 4EWND 3H2NA 3SRFA 2FMNA 1SZEA 3PBUA 1FA2A 2XPKA 5FEXA 1M7JA 1XCFA 3QMRA 1WKYA 1VF8A 3L4WA 3C2EA 2OT1A 3VOIA 2QMKA 4M6QA 3WX7A 3NVVB 4XAGA 3P3BA 3SURA 4H4RA 5KTLA 4TX8A 1DXIA 1QI3A 3SEPA 1NDZA 1UD3A 3EWWA 3NQBA 3N34A 1VFMA 4RDWA 2ZDSA 4L4OA 4QE1A 1C7SA 1XDJA 1OD8A 1OZMA 5U1OA 1Q2RA 3IAQA 2WHJA 2Y6ZA 3FW6A 5CAHA 2VC6A 1LOLA 1DWHM 3B05A 3UG3A 2PBGA 1IEVA 2A3HA 4PYSA 1HF6A 4DBWA 4JTTA 3FHQA 1W3LA 1JPIA 1VYPX 2YR1A 1KCKA 5EFDA 1UWUA 4C6PA 5AHEA 1Z32X 1Q6CA 2XIOA 2GVGA 4AIOA 1ZDLA 1TMHA 2XINA 2YCIX 5A8GA 3APGA 3UJEA 3F7JA 3T8QA 1FWJC 3GNDA 1QRQA 2PAJA 3WUEA 3FJLA 4GC4A 2A4AA 1AW2A 4RDZA 1JZ2A 3IJIA 2XGBA 3AZRA 4JTGA 1V3JA 3S42A 2ODOA 5I3FA 3MKCA 3LXDA 4IPLA 4CN6A 5A2AA 3CL8A 3ME3A 5C0QA 1WZKA 5HWNA 3QTGA 1GREA 1ZJHA 2G95A 3RK8A 3GNPA 1CEOA 4C6JA 1KWGA 3N6JA 1FH7A 4DBEA 5I3IA 2QV5A 4UTJA 2XIQA 1HKWA 1R7AA 2XH7A 1ZUAX 1GOQA 2IPWA 3VOCA 4TMBA 3VOJA 4F48A 1G01A 1P7TA 1HXJA 3KVJA 4XBSA 1IR2A 4IL2A 1DKWA 4K36A 1WDQA 4QXIA 4W9TA 1JDCA 2D69A 4NNCA 3V0TA 1XYBA 1KTBA 1H2IA 3ELFA 4POCA 1POKA 1EHNA 3LOTA 2DUAA 5EGRA 1EL3A 2PWFA 4GIEA 1TX2A 3Q2DA 3VDGA 1RP8A 3MVIA 4Q8PA 1EJVC 4HJFA 2FH6A 2ZVRA 4DEFA 3ID7A 3URAA 1LJYA 2YIHA 3W75A 1NHQA 4GUFA 1SR9A 4QLKA 1KXHA 3NRZB 4B92A 1QPNA 3CBWA 3W27A 4L9XA 3TC7A 2VL4A 1TPFA 1TJ0A 3UERA 3EX3A 3KLKA 5FF4A 1UH4A 3H22A 5T26A 4Q22A 2PD5A 2Z1XA 3HPZA 3IIOA 4PSRA 2A3BA 5AYZA 3EAOA 3VD3A 1VLWA 3O6YX 2W62A 1QMLA 3WBXA 4X0NA 3RX4A 1RPXA 3HJEA 3CMJA 5EU9A 3G1SA 3IK2A 3O7UA 2QW5A 3II4A 1IYXA 3OPSA 5DO8A 3W83A 2ZX8A 3CPRA 3WF2A 1BVNP 3NWRA 4WD0A 1SO6A 3VZXA 4C65A 4PR4A 1UROA 2POZA 3VNZA 1EWDA 3VE9A 3W7JA 4LWWA 3O06A 3C2FA 4NP7A 3MHUA 1TO3A 3RGTA 1ITXA 4GRTA 3HA1A 4HGXA 5FCZA 3SW6A 1L6WA 2W6RA 3LNMA 4B5SA 4QDWA 3EPMA 2ZTJA 1P0BA 2V2DA 1CI1A 2FLIA 4C6CA 3QBUA 1RBAA 2FJUB 3S9IA 2B81A 1ONXA 5FF0A 3OQ8A 1ADSA 3NZGA 5LIYX 1FHLA 4YJ5A 2X1TA 2CEQA 5B7ZA 1VAHA 3QQ0A 4NX0A 2E28A 4RZ4A 3F4CA 5K4XA 2ZXQA 1UG6A 4CEUC 3O9NA 1FO4A 3Q94A 2X40A 5IBXC 4WY0A 1K7EA 2P0OA 5FJIA 1D3GA 2Y89A 2WMHA 3A3XA 3QV6A 4CN4A 3KLLA 2ZICA 2PMQA 4CQ9A 1TJ2A 1CT5A 2A2IA 2J8FA 3NSXA 3V0SA 3NQMA 1IEIA 3FHAA 3DU0A 4AZBA 4H4QA 1E9ZB 3ABOA 1ITQA 3PBYA 1JG9A 3PZQA 2OELA 5DMMA 1HL8A 4AMCA 4MJ4A 1J8VA 3PZNA 3FDGA 4C6OA 1JZ7A 4AVFA 3BG5A 3QMSA 1VCVA 3OOQA 1S7MA 2C13A 1ICQA 4K2SA 3PJWA 4UFHA 2QVNA 1JZ5A 2A7PA 2A3EA 1Q13A 4O16A 4Q7NA 2ZC8A 2FFIA 1JDDA 2H3BA 2A1YA 2F84A 1A80A 3FYYA 2ICSA 1O12A 3PZ9A 4UTTA 4FK9A 3URQA 1RV8A 4NXSA 5A8OA 3QPYA 2XU2A 3PJXA 2CLFA 2PTXA 1V0MA 2Y0FA 5TF0A 1E6QM 4CQ8A 4WXZA 4XAYA 3VIFA 1VEOA 2DZPA 4ZOCA 4I3GA 4PB5A 1Z7AA 1AH0A 1ZFJA 1E1EA 4Y6GA 2CHNA 3IK4A 1O95A 3SY5A 3GXMA 1QW7A 1GOXA 4ATDA 1JNEA 2GVEA 4DHGA 3MZ2A 5IM51 3I65A 4MTVA 2UBPC 3N9SA 1PSCA 4J9JA 2OWXA 3H7RA 1GG0A 1D7FA 3LM3A 2ZX9A 2INEA 4GUIA 4QE5A 3HG2A 1G6CA 5HULA 3LHWA 2EQ8A 3VVGA 1XRTA 2OLHA 4NU7A 3OIXA 4UNLA 2BB0A 2VCAA 2WSKA 2X2YA 2YXXA 4A8LA 1B3VA 4LJ3A 3UJRA 4Y9MA 2GGGA 1EO5A 3R43A 4ALDA 1JZ6A 4JFWA 3R11A 3GFXA 2INZA 4H4XA 1HGWA 2JGYA 1J0YA 1UHVA 1OM0A 3HMCA 3APYA 1EYWA 3LHUA 4D6JA 1A4MA 2DP3A 1YXCA 3PWIA 2IKIA 1WOAA 2J75A 1LDCA 4DUWA 3WH9A 5A1AA 1NQ6A 1PUDA 2ZXBA 1GSNA 3TW9A 5C9UA 4IHCA 3NURA 3HV8A 5A6MA 1B9ZA 5HDRA 4K1WA 1GONA 1QXLA 3BSGA 1WXJA 2D20A 4JEJA 1DL3A 4JQ9A 3TWAA 2A21A 3KP0A 4PH6A 3MKVA 4UC5A 1OSEA 1S5VA 2VX4A 2X30A 5BOOA 4GZ7A 4WIWA 4D6HA 1EPVA 3NZ1A 4MG4A 3AI0A 3KZPA 2VP8A 2OKTA 1MEWA 2Z7GA 4NXKA 5M5DA 3N4EA 1P0EA 3MBFA 1H1NA 2J7DA 3R8RA 2HPIA 4O19A 4O0KA 4GRSA 2QUVA 3MI6A 1PCKA 3SQPA 3WK0A 1WAUA 2AGKA 4RXFA 4H4PA 3K46A 3ALFA 1NHSA 3MTWA 1AD1A 1XQKA 3RPMA 2Y7DA 2VRKA 2BNJA 3TW7A 3B9DA 3PSWA 4NSBA 1DNCA 1F3PA 1U30A 2XN0A 2D2JA 1KBIA 4AQLA 1Q6LA 2A85A 1XI3A 3SCQA 3NPVA 1XLFA 1EP2A 3CAKA 7REQB 4ZO6A 2DW7A 3WBAA 1SFLA 1T6MA 1XUZA 5KINA 1Q4WA 4UOJA 4QCEA 1DVJA 2GL5A 5JBFA 2EPKX 1NWUA 3DIPA 4D1JA 3W3OA 3CGEA 4NKCA 1OJTA 2VVNA 4CD7A 2HRWA 1W6TA 2PGRA 1B0IA 1RA5A 1PCWA 2VEMA 2D0HA 4IQJA 1GQLA 1KO0A 1HP4A 3T0AA 4JIPA 5BXTA 1PX8A 1FX6A 3NQ6A 4XVEA 4RZ6A 4MWAE 4S3BA 3WEMA 2R1MA 1QK2A 1WKEA 4PA8A 1XXXA 1DQUA 1B30A 3ECQA 4EXBA 2XVLA 2WW5A 2JIWA 4UR9A 1QNQA 3C2RA 2BY0A 3SFWA 3GVQA 5HJLA 1K7XA 2WNWA 3FA4A 4WDXA 4WJ8A 2ISDA 1FEBA 3ANVA 4L1WA 3BOLA 2Y7GA 2YCEA 2CBUA 3EF6A 2B31A 4XBJA 1UKQA 4E6MA 4S1FA 3DCPA 4LYPA 5AHLA 3EX6A 3H21A 4IIDA 2Z26A 3CPGA 4Q8MA 1N5XA 3H7UA 2EPHA 1W9BM 4OZOA 1ZJBA 4K37A 3CAQA 2OLAA 4LUIA 3G0SA 3LBMA 3RO6A 2CLMA 2Y70A 3NDOA 4MPQA 5A5WA 3UWQA 1ADDA 3H23A 2CC0A 1DXEA 2BY2A 4FXFA 1CNVA 4LH8A 1ZBKA 2WKLA 3GC5A 1XGZA 1EJWC 4H4SA 3PZGA 2PDYA 4M5PA 3LB0A 1ME9A 4I90A 4X63A 3CL7A 4TXEA 4QFUA 4LSBA 3AMKA 2VDIA 3BMWA 2ISVA 4IIGA 1KR0A 2D0FA 4I8DA 5LNSA 1W5QA 1EBHA 2E68A 3G3DA 2WMGA 4CU8A 4KPRA 1MZHA 4XK2A 3S46A 2PDNA 3MB9A 3SGUA 2NLIA 1K77A 3NQVA 3HGOA 2EEXA 3GZAA 3RG6A 3DFPA 5HMDA 3G22A 4UWMA 4HZ6A 5KZ6A 3MO7A 4DLMA 5A69A 2Z28A 3FXGA 2DU2A 3VKBA 4P7NA 1FIQB 3WLRA 4K1GA 5U25A 2CBIA 4N9BA 1PIIA 3P93A 1RH9A 3MMTA 3LXCA 1WE5A 3N04A 5HWMA 3OZYA 1A3XA 4HNTA 4GFIA 4DIAA 4JNMA 3RJYA 2ZXDA 4EP8C 2ZRXA 3MSGA 3G6LA 3EKZA 2DZWA 5FJPA 5C55A 2I7GA 5JMUA 4A05A 1XICA 2VT0A 4XSLA 2BHZA 2W0HA 2ZXAA 1TRIA 2OMAA 1UASA 3AUOA 4DN1A 2V30A 3PBGA 1GNXA 1AK5A 1M68A 2E6FA 3PM6A 4M0XA 3DHDA 5KVIA 2CWNA 2Y8VA 3UXIA 1KXTA 2PWGA 1E73M 1RP9A 3LU2A 1V6YA 1ZALA 4FOJA 5XIAA 3ZLHA 3WH8A 3BV7A 2PLMA 5I09A 3VKJA 3MYOA 2YA2A 2W61A 4K38A 4PBEA 1H7OA 2CNCA 3GW3A 2CPUA 3URHA 5ENLA 3RLUA 4DO4A 3A5VA 1O5RA 3IJ8A 1GERA 3BAXA 2J66A 2CIPA 3QV7A 3WJXA 4QS6A 1KLYA 5HJYA 2A8XA 4GY7A 3TYEA 4CNTA 1OK4A 4NZJA 2GZXA 4GACA 3CZLA 4AXKA 1REQB 4GX8A 1A0CA 1V97A 4QNEA 2DJXA 1FWCC 1RJQA 4N9DA 1Q6FA 1VFLA 3DN5A 5E70A 4HOZA 4LOCA 3TZFA 1UCWA 1M1BA 5DFAA 2Z29A 2PE4A 1LL6A 1QVBA 2QNEA 2ZC1A 1QNVA 3KOXA 5EKYA 1UP2A 2VC5A 3KOFA 1E43A 2ZKMX 4XZLX 2HQAA 4R27A 3AZTA 3MP3A 3BLPX 4YWIA 2QJMA 3B8UA 3GVGA 3EWYA 3QGKC 2AAMA 3P84A 4Q8NA 2HV5A 4UXDA 4EIVA 1UKPA 2ZVIA 1N7KA 5A6TC 1H3GA 3B04A 3CZKA 1ZY8A 3SGGA 1CB7B 3SM0A 1DJIA 4PFMA 4HSHA 1MO9A 2FB2A 1LG1A 3U7VA 1GQKA 2J7EA 4J28A 4IJRA 5HOSA 2EQ6A 3PZVA 2X09A 3DAQA 1ZCCA 3JU2A 3CEPA 3DK9A 4A35A 2UZ9A 3BLOA 4C5YA 1M41A 1NSJA 3MUCA 3NL5A 1FHUA 4EM4A 3ZYZA 4ONVA 2PODA 1UWIA 4L1GA 4B91A 3KRZA 5EMKA 1R9ZA 3O2LA 3TDFA 4K8DA 1R6WA 1H7PA 2A3AA 2D3LA 3GSMA 3WBEA 3FV9A 2X99A 4HYVA 4HMEA 2CWXA 1Q63A 1QJWA 1TPH1 2A5HA 3ZS4A 1XJBA 4OV9A 2WPCA 2W5FA 4H83A 3B9OA 3NQGA 5GNXA 4WSKA 2VWTA 5IBXA 4QAIA 2I16A 3SRKA 2Q02A 4AVOA 3FGCA 1MQPA 4DZAA 3K8KA 1AQ0A 5EB8A 1FEAA 2OSWA 1I8JA 2CZ5A 3CGDA 3LB8A 2JK2A 2POTA 3DG3A 1JROA 4G7EB 4HP5A 1TTIA 5FL0A 3ARPA 2WV8A 2P5NA 1FH8A 3N29A 4AWSA 4BEUA 3O63A 1EYEA 4JX6A 5D33A 3VM5A 1HFBA 5C2CA 4U28A 2O7SA 3NQFA 4B5XA 5I3JA 2DEPA 2Z1BA 4U2YA 1XIGA 3C2VA 3QGVA 3COTA 2WCSA 4FALA 3L67A 4I5UA 4Q4OA 2V3FA 1CCWB 4C6FA 2EPNA 4FLQA 3AMGA 4RE3A 4OOUA 2QKFA 4HD5A 4GVIA 1B31A 2J8TA 4FLRA 4AC7C 2C3CA 3E2VA 5CPMA 4XTIA 2V38A 1DXFA 4WUIA 1EZ2A 1W31A 3W38A 3T05A 3FJ6A 2O92A 3JZUA 3IVSA 1XYAA 2YDRA 2QPUA 1AMYA 1QNOA 1VDVA 1JDFA 3N73A 3RPTA 4WY0F 5F4XA 3XIMA 1XCXA 4JGDA 3BZJA 2HMCA 2NQ5A 2XYLA 1LWHA 1Z3NA 2CHOA 1B3ZA 1KLZA 1SW7A 2QCNA 2R6OA 2W4XA 2G3IA 1OFQA 2UY2A 2ZUWA 1DQXA 2EGZA 3UR8A 1GW9A 2OZ0A 2DVTA 1VFTA 4W89A 4UR7A 3G1RA 3C3NA 4AU0A 2XDFA 4GK8A 4H6QA 3C0QA 2NX1A 3FNDA 4J3ZA 4RPPA 3QEZA 3WO8A 4CLMA 4W8LA 1E6ZA 3MHFA 1QK0A 1DWJM 4GD0A 1GJPA 3DGZA 1FDJA 3WLNA 2V67A 3GXDA 1W91A 3DHPA 2JEQA 3OG3A 1JVNA 1CXKA 3VA8A 4ZQOA 2CYGA 3NS1B 1HL9A 1NFPA 2Z1SA 1GCYA 1LG2A 1GVOA 3EEZA 4QRNA 3VNKA 1F4AA 3BW4A 1Y5VA 2L5HA 3LRKA 3WQFA 1YRRA 3LTPA 3HOJA 4CGTA 4C1KA 3SDOA 4RDYA 1G69A 2V81A 1R3QA 3C56A 2WMIB 1XLGA 1MFVA 3TFCA 2QR6A 2VEKA 3URNA 3XINA 5ABTA 3UFYA 3GVVA 2WOIA 1ZHAA 1DORA 1GEHA 1OK6A 4LY4A 7ODCA 1J0HA 5BMWA 1TJRA 3SCUA 2O9TA 2FVMA 4Q8QA 1XIIA 3VDBA 4O1EA 1SYTA 1E4NA 4WSHA 1Q6DA 3W7IA 3WNLA 4JYFA 1VPXA 3FLUA 4JY9A 3VTRA 1NOFA 3BE7A 3UVIA 1RUSA 1V08A 4I5XA 1IEXA 1YNQA 4L4LA 3L7RA 4UQCA 2QCEA 5CGTA 1AQFA 3P74A 3KM8A 4ICMA 5H8UA 4E3VA 4ZMGA 4GPNA 3VYLA 4JY8A 2E7FA 1KA9F 1JFXA 4J3SA 4LA1A 1TVLA 1NWSA 4XUYA 3VNYA 2OG9A 3R0KA 5DT7A 3EPNA 1UUQA 4MUZA 3K8MA 4HTBA 4JDRA 5JVLA 4P8UA 1V6WA 3L2LA 3C86A 3R79A 1N61C 1ML1A 1RCOB 4A8NA 2GLKA 2WANA 5LNUA 4MLJA 4H4IA 1QT1A 3FYPA 4HHMA 3ZT7A 1QOPA 4AIUA 2CZFA 3DGRA 2V5CA 2C79A 3QV9A 4HSOA 3KE0A 5DLCA 1D7YA 5JCLA 3OVGA 2GGEA 2MANA 4M51A 5CZ0A 1OY0A 3SUWA 3ARTA 4JTEA 2YBUA 4Q7BA 5TR3A 1E6SM 2J7CA 2WC3A 3AHTA 5C9RA 3YPIA 4DBUA 5C71A 2E9LA 4D6CA 4AY8A 4DXXA 2VENA 4F8XA 4IIEA 2WMJA 3TTOA 3A47A 3SAZA 1R85A 4KFNA 1FP8A 2PB1A 2YAUA 3VCNA 1WUEA 3HO8A 4XIMA 1M9HA 3UWVA 2VGIA 3U8GA 1FUYA 1ZB5A 5KMYA 2C1IA 3VOGA 1L8NA 2FGLA 1EJRC 2WOWA 1M03A 4DQWA 4KESA 1NM9A 1HKJA 4OGZA 2ZADA 1X96A 3AIEA 4PFHA 1E4MM 3UA3A 4JYDA 4LT9A 2BXZA 3NUKA 2XGZA 3GHRA 3CUZA 4QIUA 4GIAA 3W88A 3H53A 1Q2SA 5DRCA 1EA0A 3W7DA 1SSDA 5HNNA 2ZA1A 4C1NB 3L5OA 3SCSA 3WLKX 1BYDA 3VNLA 2YX0A 1K8YA 1HQTA 3SB0A 3PWGA 4I7UA 3PJUA 5D37A 3A13A 3QSRA 3KLJA 2F2HA 2W92A 4ZCWA 4F66A 4Q33A 5I3HA 2DFAA 1QAPA 4G7FA 4AB4A 1M53A 3R1ZA 2ZZ6A 3Q65A 4UQEA 3KOWA 3GDMA 4RW5A 1S2TA 2Q71A 4FI4A 3VIHA 1MW2A 1AVAA 3POHA 1A5BA 4A8RA 4ZFMA 3EOOA 3QSTA 1UJPA 1TRDA 4EQSA 3WDIA 1FFVC 4MY8A 4O1BA 4JNZA 2JF6A 3T0DA 2O0TA 4MJ2A 3RX2A 1GVQA 4WF7A 5C9WA 1X1OA 3DFTA 4CQBA 4IOTA 3BZGA 4FXRA 2GJPA 3NL2A 1WYIA 1J11A 2VTFA 1W3IA 4P7LA 4JHZA 3XISA 1WNOA 4H4UA 2DY3A 4TTUA 4IPIA 4IFRA 3FDKA 1P0DA 2E77A 4UQAA 4G9PA 1R5YA 1QO2A 3V4BA 4YCOA 4D6FA 1Q85A 1XLBA 5IHRA 3F5KA 1D3HA 3GBEA 4C6IA 4DWSC 3CK5A 2HISA 2FIQA 3MMWA 3CHDA 3GTFA 1BD0A 2BV9A 1IT7A 1GRTA 3PBVA 4JR5A 2WQPA 4O1AA 2QDDA 4MWAD 1YE4A 3GFZA 2E09A 4AZGA 4PRWA 3TC3A 3W7LA 4RE0A 3BSHA 4M3PA 5GJPA 1KFJA 3F4WA 5DX7A 3W82A 3P5YA 3SCVA 2FTYA 3ARRA 4QJ3B 1XS2A 2NQLA 4DBDA 4HA0A 3VM7A 4AG0A 2ACUA 4IGMA 2VO5A 1V93A 3ZVHB 2V2CA 2C7FA 1VR6A 3DX5A 3GAYA 4S23A 2DDXA 3WUFA 2V2HA 4JAWA 2VZVA 3N1AA 2OOGA 4OUEA 1RLDA 4Y9AA 5M1TA 5I03A 4HPJA 1ME7A 1H0IA 5LSMA 4HZ8A 1DTUA 1ZU8A 3VIOA 2J27A 4D6GA 4CCCA 1Z42A 4LU0A 4UTFA 4H8UA 4AF0A 1OFPA 2ZX6A 4RL3A 1NWTA 1G7VA 4JIHA 2EJ1A 3VIPA 3L2MA 3WF1A 4MZ8A 1TV7A 2HVMA 3BAWA 4E2VA 3TAOA 1JYVA 4HVXA 4JTAA 1T3QC 5ER0A 4N7QA 2DQXA 1MW0A 3AIQA 2WNQA 3MHGA 3E1F1 3W1NA 5AKQA 1X39A 1XRVA 1JQVA 3A3HA 2OXNA 1KRCC 3ZWTA 4K68A 1G5AA 2GVYA 1N8WA 1U5JA 1QI5A 1CWYA 3VFCA 4GIRA 2WSRA 1ZP4A 3EWXA 1GVSA 3J7HA 3WFZA 1J9YA 4EF8A 1RZMA 3PG9A 3U48A 3H2AA 4UCFA 1KXVA 2REQB 1NOWA 4FZIA 3BTNA 2VFFA 3ZLFA 1CLVA 4BF7A 2E67A 2PGWA 2QCHA 1QWKA 3DKLA 3VPLA 1LUCB 2XH0A 2BASA 3ARYA 4O11A 4MNLA 3BGGA 1Z8AA 3AXKA 4M6UA 2WVTA 1AA1B 2DZBA 4A6GA 4H4TA 4RLIA 1CXEA 4PEKA 1NHPA 1P48A 2EPOA 2GUUA 2BY3A 2VZTA 3CO8A 3SCRA 1JCLA 5TAOA 2ZZ0A 1KN0A 3RNMA 5CC3A 3DXIA 4M6VA 3VIGA 4RXGA 2DT1A 2VMFA 4F2UA 1R9YA 1E6NA 2J6VA 3MJMA 3W02A 1UOKA 3LBOA 2BC1A 1YTEA 3BANA 4HBKA 1XLHA 3AQUA 1XBYA 2P10A 2WJFA 1IEWA 3FEQA 1XC6A 4QJ1A 3R07C 1EP3A 2F6UA 4AHPA 1PEZA 1YPIA 2WPEA 5D2XA 5HWJA 3I7RA 2H9AA 1EGVA 3MW7A 1EZWA 1GVIA 2E25A 3C0SA 3GNNA 1C92A 2GVJA 2HS8A 2OEMA 3QRHA 1F8IA 3S6DA 1XLMA 3KP1A 1WDDA 4QR6A 1W8GA 4ZE4A 2QGHA 3UBPC 5J5DA 3MUAA 1K70A 3N12A 1FKXA 2PTYA 2QPXA 4H00A 1VIWA 4RV8A 5EY5A 4KWVA 2OSXA 1FFRA 4X60A 2W27A 1KNWA 3N2XA 4B3LA 4ILSA 9CGTA 1V3IA 4D6IA 3RDKA 1JD9A 3V0UA 1DIDA 1S5MA 2VUNA 4KCVA 1JNDA 4IPPA 3B8WA 2X1IA 3QW4B 4DYKA 1REQA 1PL9A 3IV3A 1JI1A 5CZKA 3NGJA 3LTSA 3DC0A 3AXIA 2PDFA 4U2ZA 3TLQA 4XO6A 4MB4A 4PUMA 1EIBA 4A3QA 3G0UA 3L0NA 4IMDA 1I45A 2O55A 4HYRA 4NF7A 1ZBVA 2GSEA 2X41A 1QNSA 3CWHA 3KVLA 1NVMA 2DSWA 4X0VA 3E5BA 5CC6A 3GXFA 4R9OA 1S1PA 1R3TA 5I3DA 1X1ZA 4MF4A 4NYUA 1CTNA 2XFRA 3HBLA 3FAWA 1DWAM 2OPJA 3F5LA 1VCGA 1Q7QA 5BWFA 2X7VA 3SN0A 5HPCA 2IS7A 2PP1A 5KVHA 4PZVA 3PAOA 4P5UA 2WM0A 5AYIA 1MO0A 2VGGA 3CIVA 4TVUA 1HL2A 2Z1KA 1HJVA 4MOZA 1NDAA 2QUUA 3HPSA 2PWEA 1JCTA 5C6MA 1GETA 4L9YA 1T5AA 4JHOA 2BVWA 4PCSA 5JIPA 2GFTA 2DV0A 1BXCA 1VEMA 2OGYA 2ZZ4A 4TMCA 4HNLA 1GHSA 1S2AA 3L21A 3W00A 4XV0A 1GW1A 5KITA 5BZAA 1CXHA 3VZZA 1G94A 1TWDA 2Y88A 3BW2A 4WGHA 4Z2GA 1E51A 2AL1A 5A2BA 3AJXA 1R3WA 2IKJA 2PA6A 3QR3A 2OVLA 4ZTYA 1W1B1 4A2RA 3UWZA 1TE1A 5HNUA 2P76A 2CETA 2WZMA 2P88A 3EX2A 1F6PA 3AHXA 1Z6KA 1HZYA 5FF7A 3H8AA 1FTXA 3W4RA 2EBNA 3AIBA 2DZVA 5LNWA 2V3EA 3KWSA 3BVJA 1KCXA 1S39A 1VZWA 3V36A 4W7WA 3IIPA 3WQEA 4IZGA 2X05A 3QY6A 3I7SA 4FS9A 4YTRA 1F5ZA 1BGGA 4RPQA 4PUUA 2RDXA 4KFPA 1Z48A 4IXXA 1ITUA 5AC4A 1K4HA 3ABXA 3TA9A 3BLIA 3EA2A 1C29A 3L23A 1R3RA 2QVHA 3ATZA 1TPWA 3CZJA 3PUGA 1R2TA 5EMUA 5HR7A 3R0UA 2GOUA 1THFD 3M0MA 1S2VA 1ONEA 4KCWA 1VENA 3B0XA 3WIJA 5H8MA 1XV8A 4LUTA 1NARA 3KTCA 1F76A 3H4XA 3UPBA 1TPDA 3WD4A 1GRGA 1GYNA 1SW3A 2YL8A 1B9BA 2J78A 5JUVA 3EB2A 1KBJA 4NI8A 3Q58A 1UYQA 5EMYA 5I02A 4Q8TA 2ZUUA 1PYFA 5CBIA 3OVQA 1H63A 4NASA 4H41A 1I0BA 1YW1A 1V8EA 1W1ZA 1HKVA 1FHDA 4BY3A 2YDQA 3RRXA 3UCCA 4GO8A 3KRSA 4DUOA 4MY1A 5I78A 2XFYA 4EX4A 2DH2A 3RXZA 3L4XA 2QDGA 3OEXA 2V5LA 1WDWA 2CXEA 5HMEA 4JZ5A 4U10A 3QHMA 3W25A 1MI3A 3UETA 1VPQA 2D23A 1AL8A 2PS2A 4GZJA 1KWKA 1BQCA 5LIKX 2BOEX 2PWVA 3WK1A 3KL5A 7XIMA 1NU5A 1G1YA 3IJ9A 1VFHA 1YDOA 1PYMA 2FDMA 3DZ1A 2J4GA 4B5WA 1G4TA 1E9LA 5DEZA 4X9SA 3R8HA 1H62A 4JDBA 2HNHA 1XSJA 5CLTA 2C3DA 3CUGA 3T78A 1CGUA 2DGAA 1XR2A 5E6ZA 4HPGA 3SBFA 4AD1A 3EDDA 3T07A 3E38A 1I9CB 3KOZA 3LI0A 1TELA 4NILA 3KBSA 5DMNA 4PBGA 3U7BA 2G0WA 4IISA 3EMCA 1YDVA 4GFSA 3B4YA 5D2TA 5I6SA 3GTIA 1SO4A 4ROPA 4A4AA 4DYJA 1OD0A 1O1ZA 1EC8A 3C0JA 3HPXA 3OBEA 3S47A 1WP6A 1FDYA 4E0CA 4N9EA 1LVLA 4Z1DA 4YLWA 2WMIA 4GBDA 2GQAA 4WJEA 3ZSSA 4W7VA 4EQXA 3NM3A 1JRCA 3FJ4A 3VKKA 3T4CA 2WP5A 3NZRA 2X8HA 3A24A 3TJ4A 1PBGA 1A3HA 4QG8A 1VP5A 3RCNA 3ZVIA 4P7OA 3BLFA 3NA8A 2BVDA 1V51A 1JPDX 4GJJA 2OEKA 1W3KA 3CT7A 2TAAA 2NWSA 3GU9A 1UBSA 5CGMA 3TEVA 3NVTA 1QU4A 3E2SA 4HOWA 1YADA 5HA7A 1K9TA 3LPGA 2J88A 1KTCA 5REQB 3KZSA 6ENLA 3ITOA 2RFGA 2WJEA 5FMHA 1KFCA 4TQTA 1Y65A 5CPNA 2W63A 2A0NA 4XD6A 5DCDA 4IJCA 4LRSA 3IGHX 4YL2A 1KM0A 1KM4A 4BR1A 2TRSA 2PDJA 1A47A 2ATMA 1ZS2A 5FEWA 3Q4DA 3LHZA 2EQ7A 4D2JA 1SW0A 3F03K 3QTPA 2MUCA 3DYOA 3ANUA 1BRLB 5DMYA 4XAPA 3N18A 3N25A 2WHKA 2WO5A 3WF0A 3WD1A 4FF5A 3UWYA 1WZAA 2WMKA 4KS0A 5LIWX 3TU9A 1QI0A 4HNUA 2ZIDA 4ZOEA 3KHJA 4DWSA 1LQ2A 5D8WA 5DCEA 4P8VA 1VGAA 4FLOA 4JTKA 4JTCA 2V5JA 4V1YA 1OCBA 1OINA 3T4WA 1HO1A 2GGHA 5LKYA 3NCOA 2PU0A 4Z2LA 3W7MA 1WBJA 3WBYA 2OCZA 3T2QA 1BWVA 2WK2A 2OZ8A 3GC4A 4CCZA 2ZOXA 3H24A 4O8AA 3RIKA 4DRSA 4I9AA 5GNYA 1DJNA 3AU6A 3PSVA 3G1XA 4WJXA 2J7HA 1O7AA 1TV5A 1WOBA 2MNRA 1WX0A 1ESWA 3ZT6A 1K9EA 2D22A 2TPSA 1A5AA 3AIVA 4JTLA 3B40A 3MC5A 3KCJA 1QTWA 3M0KA 3WMCA 1UIPA 5LNVA 2NLYA 4GY0A 4NRSA 1EJ7L 1NFBA 1F2JA 2ZRZA 1OX6A 3AUJA 4D71A 3NPWA 5D30A 3BUVA 4H19A 2YVGA 3BJFA 1YEYA 1W5MA 4BCEA 1Z69A 3EOUA 3CV2A 5LXEA 3CJPA 4HN8A 5G4EA 4B90A 3W7EA 4JCLA 1WCGA 1H51A 2FZ9A 2WZEA 4IGNA 3V1PA 2HVNA 4C1NA 4R33A 4GI6A 4L5ZA 3GXTA 1EF2A 4GZIA 5PTDA 4HU4A 2ISFA 4JFUA 2G8ZA 1QW9A 3W7QA 3BAJA 3RFAA 3OB8A 1A0DA 4BQ3A 3V7PA 4GGBA 1HJXA 1R38A 5I0DA 1BG9A 2ISSA 3ZMRA 3GDTA 4LW7A 1TJPA 3GQYA 3M5YA 2HPMA 3KDNA 3FKKA 2WPFA 3D3AA 4UFKA 2YLAA 5A6KA 4C6MA 3QYSA 4RK8A 5CG0A 3LX9A 1ODZA 1TR9A 1R47A 4PMDA 2J9XA 3VGGA 1OX5A 2DORA 1OBAA 2QIIA 4ZB0A 1XIFA 2X0SA 3CGCA 5CGQA 3V18A 1JI2A 1TQJA 4GYJA 4NZFA 3ZR5A 2E9BA 3CS2A 2YFOA 3W26A 4GISA 1BVZA 3T2PA 1G67A 4Q6XA 4OU1A 4ENLA 4HCLA 5FJUA 3TJIA 5CSSA 4GE8A 4RDVA 3WQ5A 2YB1A 3W7KA 3EX1A 4UTUA 2WAGA 3W1XA 3CZGA 1E0WA 5D32A 3G0XA 1SMDA 4KF1A 3KS5A 4HQVA 3L8KA 8CGTA 4APNA 3VE7A 3BOXA 3N4FA 1RALA 1TZ9A 3B8TA 1TTJA 3WD2A 4O14A 3AU2A 1RJPA 4L6HA 4XG1A 2QF8A 1JEHA 1EGZA 3Q37A 1JF5A 1TUFA 4JPGA 5A6BA 1PE1A 5I00A 3UXLA 4Q4RA 3TW6A 1FWGC 2IKGA 3KOYA 2Z27A 4GKLA 4TVYA 4ADTA 3TCEA 3EDFA 3A7AA 4DELA 2B7OA 4C7DA 4FP1A 1TTPA 3TN5A 3A4AA 3ZVHA 4Q4PA 1EH9A 5D03A 1J0IA 2X0HA 3WYZA 1VBJA 5FA5A 2ZZ2A 1F9CA 1VJZA 3O6DA 1VKFA 1GYLA 3W7PA 4RZBA 3C61A 1NWRA 1FXPA 2PRHA 3WCZA 3W28A 4UIOA 4GO9A 2DPEA 2Q6ZA 1E9IA 4ADSA 1PDYA 1V6TA 2ASHA 2QJJA 4Z1BA 3BWWA 1DXLA 3LZ3A 3WENA 4L9ZA 3MANA 2Z1VA 1JCYA 1F6YA 2G37A 2HBVA 4NNBA 5E6YA 1LYXA 4H01A 5AC7A 4B5TA 2RAGA 1UD6A 2Q3OA 5E0CA 3WN6A 3CT2A 4N9CA 3UZJA 3KBMA 4ZE5A 2Y63A 4AZHA 3DBPA 2YKKA 3M1ZA 3L66A 1DWFM 3UVAA 4ACZA 2JBMA 3KBWA 3CUFA 1NELA 3EOEA 4MAZA 2VQUA 4RUBA 4V2XA 3SSZA 2WZTA 5ECVA 3UGRA 4EPBC 4NAEB 1TWZA 4DAFA 2C91A 2E5AA 2QUTA 2ZZ1A 3G77A 1U1HA 4MNJA 5AVNA 1TV2A 3U5YA 2RGLA 2FPYA 3M0VA 3N6QA 4W84A 4S3DA 3KCLA 2PTZA 7ENLA 3A23A 3NXLA 2XWEA 1LUCA 3R13A 5TBOA 3N2OA 2ZZ3A 3FKRA 5KSWA 1RAKA 2YCLA 1PHWA 3PB2A 3T55A 2F2KA 1BXBA 3CM4A 1LORA 3AALA 4YCPA 3BSMA 3T6CA 3P60A 1XL9A 3GH7A 1XGEA 4H9XA 1LT8A 1J18A 3TN3A 1E0UA 2VFGA 2PDBA 4PGLA 4QLLA 4LANA 3JZEA 3S5SA 1YE6A 5EMLA 2C71A 5F2MA 2R14A 1F61A 4AWEA 3M44A 4JL1A 1VFSA 4NZ5A 5LGZA 2NT0A 4ML9A 4XAFA 3OZPA 2GPTA 1EFZA 3EANA 3E74A 2BODX 3DYPA 1ZK7A 3O0FA 5AHIA 2OGJA 3AS2A 3WUGA 3N11A 1V6VA 3I6RA 1S5NA 4QDMA 3NVWB 3VOFA 1YYAA 1AD4A 1UD5A 4CD8A 4JX4A 4P2VA 2EG6A 1LBFA 2VC9A 1E5NA 2NVCA 3IACA 5GJNA 1OFRA 2QXWA 3SRDA 1PX4A 3GO2A 4CU6A 3GUWA 4U4MA 4CN1A 4DB7A 1D9EA 1H11A 1GJUA 1C9WA 4P7RA 2PFHA 2EQ9A 2BTMA 4UZSA 1M65A 1OADA 4EMIA 4MIMA 4QISA 4S3KA 1DIOA 3SZ8A 3WJSA 4MDOA 2BC0A 4URIA 3N2MA 4YHGA 3VC5A 2H8XA 2BCPA 4MB1A 4Q3MA 5A8PA 2ZUMA 2X1RA 4FXJA 1VFOA 1XFBA 3TCSA 1XDIA 3TFXA 4LVAA 2GR0A 1H7XA 2V3GA 4AZIA 3LERA 1D8CA 2J13A 2QF7A 3OP2A 2DW6A 4HHPA 1B57A 1YHTA 5EFFA 1VQZA 4HPNA 4X9YA 3LENA 3IUIA 3U2CA 1J10A 2ZZBA 2NXGA 1MZRA 2WPGA 4K39A 2E3TA 1ISYA 1C3FA 1PZ2A 2OB3A 3PR2A 1V0KA 1AW1A 4DLFA 4H50A 4LUJA 3D6NA 3G1YA 1EWEA 3OZOA 3W6LA 4XKYA 2VJXA 3KCOA 3EWBX 4BKNA 1O5KA 4PTNA 3GNXA 4X2PA 3R10A 5BROA 2BOGX 1RK5A 1XBZA 3QLLA 5ABFB 3EA1A 4QSFA 3BAKA 1FWIC 3RAOA 2IMRA 3PZMA 3PAJA 1ZBWA 1WDRA 4ZR8A 1CLKA 4LS0A 1OCQA 4JTUA 1ELSA 3H7VA 2VKZG 1GWJA 3U57A 3NO1A 4TX6A 1VCFA 1IQ8A 3DI0A 3NG3A 1X6LA 3R5EA 1XYFA 2RH9A 5CXPA 1TV4A 3GYEA 5DXYA 4IG2B 3UZWA 2CU0A 3DJJA 3W81A 3AHVA 2OJPA 3THAA 1XIHA 1V3KA 1TIWA 1G4EA 3H4GA 3K30A 3UNDA 4IFKA 2UY4A 4DZHA 3B4UA 4LVGA 1OC7A 1UPMB 3SRHA 2J3NA 3VU2A 4O4VA 3C6CA 4JTSA 5F2GA 3GY1A 3JR2A 5F4WA 4F2BA 4S2CA 4YYFA 3E0VA 3BICA 4JQ4A 2W91A 3SSJA 2QUNA 2VURA 3RUBL 1SMAA 4LY8A 1FKWA 3VMOA 1XYCA 4H04A 4JDYA 3GTNA 1JJKA 3LCHA 4GABA 4JD4A 2B4GA 2R1LA 3MSDA 4GYPC 1EEXA 3PS7A 2ZUTA 2GOKA 3NVYB 4HZ7A 2CZDA 2YLLA 1TYPA 2ZZ7A 1P0KA 1FY6A 1WZMA 3GB6A 3PTKA 1BPLB 1CXLA 3BDKA 5CH9A 2CHRA 1UKOA 3N2BA 1E0TA 5E9AA 2O7QA 1Y5WA 3POCA 4PE8A 1NTHA 3T1GA 1WKFA 3WF3A 3EOLA 3K5XA 1C8QA 3W2UA 1RD6A 2VR4A 4KT2A 5G4HC 1UKSA 4E4UA 1EQCA 2GK1A 4N4QA 3SJ3A 3QZ6A 4KEUA 4ASTA 5F1VA 3UWUA 4JBRA 4JIRA 2ZUSA 4AAJA 1MVYA 3WLHA 4MKSA 2V8ZA 3QXBA 2J9YA 4M52A 3GD3A 2Q8XA 3WDQA 3LQGA 4FOUA 1U1UA 4W7UA 1ECEA 4XD5A 2NVDA 4DO6A 2IQDA 2WB5A 2X7WA 5JCIA 1GQIA 2Q8ZA 3TONA 1IXPA 4Z1AA 4XO7A 2ZQ0A 4LPCA 1A5OC 1BQGA 1WA3A 5LGXA 3AMDA 1W5PA 1E1CB 1JZ3A 1H2JA 4PCPA 3SFKA 2VZUA 1V7AA 5BXPA 1RBOB 2XVGA 4NRRA 5M17A 1FFUC 1ZAJA 4NHVA 2Y4SA 1DJZA 5ABEA 1CGWA 4B9YA 4JX5A 3SY8A 2BP1A 1PB0A 3AHZA 2ZX5A 2DZAA 4UNKA 1OCNA 3MDWA 4YVPA 1OIFA 2RHGA 1OHLA 3S0CA 4H6EA 3UY8A 3B97A 1TTQA 4UTHA 2GJLA 3PP7A 4MFEA 3W1RA 3LDVA 3FSUA 3NEHA 4NZ3A 4HA1A 2DZTA 4H8VA 2QCMA 1J4EA 1AMKA 4GINA 5FSDC 3PVFA 3UCQA 2E1WA 4BEQA 3STPA 3PTMA 3DG6A 3S83A 1DPMA 4IICA 3PBWA 1JOAA 5AN7A 1K7FA 1YLVA 5CQ1A 1VIZA 5IRPA 1HJSA 3KWXA 4LYRA 3FIGA 1W56A 3ARUA 2Z00A 3DFQA 1CXIA 3FVMA 1A5CA 2F38A 1HP5A 1ZMCA 1UR0A 3LCLA 3REQB 2QCFA 2Y5SA 5BXSA 5HQEA 4UFIA 2CKRA 3SUVA 5DRIA 1DEDA 2V3BA 5G5GB 2NQHA 2EKGA 1E1FA 1PZ0A 4IQDA 3A9IA 1H6VA 2G4FA 1AODA 1G4PA 4TVCA 4L1XA 3DH7A 1O68A 2VFIA 4C7GA 3TUUA 5FF2A 5G2IA 3ANYA 4Y8EA 5DT5A 2XIIA 2ABBA 3OLIA 3DERA 4GCXA 4LTSA 2D2HA 4KFOA 4CNNA 2I14A 5LHFA 1N8IA 1ONWA 2IUZA 2PZ0A 3GBDA 3GRIA 3ONBA 3B03A 4B16A 3V35A 5AHMA 2GRTA 4FNPA 1GTEA 4BZYA 3B8DA 1TKKA 4BK9A 4DO7A 2YVFA 1BGAA 4GWEA 1SSGA 1GVEA 2VRQA 5IOBA 2P50A 2NUWA 3UY7A 1VH7A 3M6YA 3S1WA 1TPC1 1HW6A 3AIRA 3LCGA 4Z08A 4FSAA 4IMAA 4MKNA 3T2OA 3FA5A 5J8LA 3N17A 1VEPA 2GGIA 4MZYA 3GTXA 2JKPA 1NHRA 2YXGA 2Y62A 3KRBA 4H2HA 1TIMA 1AUSL 3OHIA 1SPQA 3GXNA 5A6SA 2YCJA 3PHAA 4LV4A 3M4HA 5DY2A 3VNIA 1V4YA 4N0RA 3QMTA 4C60A 3W22A 5C9ZA 1UC5A 4XX6A 4Q4QA 3V75A 1TB3A 3CAVA 1RXOB 1GHRA 3BOFA 3R94A 4ZENA 4DI9A 4AXNA 3MV11 4PMOA 4L6DA 2BLEA 3EYPA 3WQGA 5CZJA 1S46A 3DFHA 3HG5A 5H91A 3GRSA 1AFSA 3GXIA 3WFLA 4H7ZA 1J01A 3NSMA 4P7QA 1J6PA 3S3GA 1P4CA 4H4ZA 4REQB 2FTPA 1RVGA 4CD5A 3BAYA 1F3TA 3LCFA 5DELA 3VO0A 3GU1A 3M7WA 1HKMA 2HJPA 5CPOA 2XIBA 3W1UA 3TTSA 3L4TA 3CAWA 2P0IA 3CL6A 1H60A 2BGQA 3NM1A 1LOSA 3OODA 3FAXA 1KKOA 1L0PA 1UA3A 4XSMA 1WBHA 2V6AA 2NSOA 4GC3A 3H6OA 2ACRA 3EBVA 4ZOAA 2P1FA 4EK7A 4XISA 3KAOA 3RLGA 1DIEA 2V0TA 1LWIA 4HNCA 3GD6A 2NV2A 3GG1A 4C6LA 2DVUA 2YPIA 4NZ1A 3RILA 1UBPC 1NH6A 4DJDC 4QG6A 1SZFA 4ORIA 2XVKA 1RPKA 3QFEA 4OV4A 4HOXA 1KBKA 4O54A 1XD1A 2FYMA 4XBKA 1EUNA 3V16A 4DJFC 1HVQA 2DSKA 4JNYA 1UZ1A 3HQNA 4UQ9A 4UTWC 3WG6A 3WQ6A 1BYAA 1PIFA 2J62A 1UD2A 1VB9A 2VQTA 3TKFA 4CQAA 1V5XA 1B4EA 3QH2A 5EBUA 2WBKA 2XIMA 1E55A 5FF3A 3WZ0E 1SQ7A 1BF6A 4JFVA 4QX4A 5K2ZA 2FHBA 3NIYA 1DE6A 2W79A 2OQLA 3FX4A 3PUEA 4NY2A 2FHFA 5LIUX 3TN4A 2EAWA 3EX4A 2DIEA 2PDKA 3DDMA 4BFAA 1Z44A 3CV7A 1UD8A 4JN6A 5F1UA 5TNVA 2ZRYA 1JPHA 2HXUA 1O5XA 4GI9A 4IFOA 4O8RA 4M82A 4C90A 1UUOA 3MP5A 3ZR6A 2BFGA 3DOPA 2CKSA 2OQYA 3ZJ8A 1SVDA 1AJ0A 2FPVA 3LQLA 1LRTA 2VCCA 1XIEA 6TAAA 2I5GA 1GG1A 2FH8A 2WHLA 2X1UA 1SB3B 4L4MA 1GRHA 1C90A 3CQJA 2YCKX 3UJSA 3DFSA 3CO4A 4KETA 4JTHA 5AC5A 3EB3A 5KETA 4GI4A 2WLZA 1TPEA 3TSMA 3ZJ7A 3JW7A 3R7MA 3RX3A 3T44A 1E6PA 1FRBA 1FQ0A 4GVHA 4ZB5A 3QQ1A 1VJSA 3W2JA 4KKXA 5T9BG 1OYAA 3HN3A 1F3EA 5M03A 4DNHA 2LLEA 4AWTA 1KFLA 3T08A 1R7OA 4RZ5A 4QROA 5KZEA 3M47A 3CQIA 2R1KA 3HQ1A 1MEIA 1UR2A 2QMJA 1NP0A 3F2CA 4AZ5A 4KGLA 1TPVA 5K9DA 3L5LA 1GVFA 3GIQA 4FNUA 3TTYA 3C8FA 1P1XA 4EANA 3OG2A 1EJSC 2GJXA 5ABGA 3MI3A 1PTGA 1ZENA 3DHUA 3ATYA 4ERGA 4O52A 1O66A 3GTHA 4NAEA 5ECUA 4PMZA 4QDPA 1QPKA 4O53A 1LL4A 3EDKA 3USZA 2AKZA 5LZLA 5U7SA 3UZYA 4US5D 3CH9A 4F4RA 1L6GA 1M7XA 4XB3A 3PFRA 3M0JA 5A3HA 1L2UA 3BH4A 2PWHA 1JPMA 1KQZA 2Z0IA 1YTKA 2UV8G 1E6XM 2Y61A 1YBQB 3QKEA 3AM9A 4WOQA 3NO5A 5CKSA 5FAGA 4HT3A 4J2MA 4O4WA 1KM3A 3MQTA 4PB3A 1XP3A 5D38A 4PUNA 5FJOA 3OVRA 1EX5A 3F5JA 1UR3M 4U3AA 4ACYA 3CHFA 4DF1A 1TMQA 3GXPA 3S5NA 4H2CA 3O1NA 1GZGA 4LAUA 1M01A 3LPFA 1I60A 2AOSA 4C6DA 3L2IA 3RPDA 3UESA 2X8GA 3LGGA 4QSHA 2GYIA 1A5SA 4J1OA 1GEQA 2WMFA 5HXMA 4E8DA 2P3EA 5LNRA 1TFVA 2ZA3A 3GR4A 4CQDA 3TVAA 2J25A 3C0LA 1LTDA 7A3HA 3ES8A 4V27A 1EIXA 1KB3A 3AZSA 3L68A 3UPMA 3RF9A 2Z7KA 1IF2A 3NQ8A 4FNRA 3ETRB 7TAAA 3APTA 1Z9AA 5FS8A 4HHLA 4UQBA 2GJNA 3AFBA 4O12A 4MM1A 4J57A 3M0XA 1Q1RA 2ZE3A 4KWWA 4EMWA 2QLYA 4NJKA 4LUSB 4QEEA 2PWUA 2V63A 3BURA 2YDAA 4ES4A 2XVNA 2YQUA 5FL1A 3KX6A 4AISA 3KDOA 4ZO9A 4GYPA 4AEOA 3N3MA 3DENA 4AD3A 4U33A 3W7OA 4C6KA 3CUIA 5CSUA 3WEOA 2CCRA 1LBLA 1C91A 4JFSA 1IGWA 1EHAA 3CZ8A 1S5TA 1I0DA 5I07A 2I57A 4M7SA 3PG8A 4ZA0A 4C6EA 3HQOA 1MW1A 3HGRA 3VKDA 3N3TA 3I6TA 3RU6A 2C0AA 2VGFA 2Z2AA 1UWAA 2V9DA 4N4PA 5I3GA 1QR7A 1FVPA 1U5VA 2NVKX 1T99A 3TYUA 3U2OA 2PTDA 2PDLA 3U3HA 3CU2A 3E2RA 3VDAA 5XINA 2NQJA 1MXGA 3UWWA 2JIEA 2H3DA 5H1WA 4ZQCA 4S38A 3LNPA 2VEPA 3OBKA 1J6OA 2Z2BA 2GWNA 4GA8A 3AISA 3CV1A 3HFTA 2ATSA 1PKMA 4Q8UA 3TP4A 3W7RA 4B4FA 3ZJKA 3LPOA 4W88A 1CBGA 1UMLA 3CIWA 4MVAA 1BEUA 1Q7MA 3JUGA 3GYCA 2F5ZA 4PEEA 3R0DA 3H26A 4JKMA 3NPUA 3CUXA 5AY7A 4S2BA 1B1YA 3ZSTA 1JXKA 3W1PA 4CD4A 2GUYA 3WQCA 1XKJA 3IRDA 1ZP3A 3QHNA 4ATLA 5ABFA 4IJBA 2NUXA 2B7QA 5F4SA 3MDUA 4IP4A 3EWDA 1FOBA 1YDNA 3VMPA 3LGDA 2J9ZA 2WBGA 1E56A 4DX3A 5H8PA 1AH3A 1IWBA 1LF1A 2DUZA 3M46A 4JFTA 3IEBA 5JCMA 2A6LA 2ZZ5A 4LAKA 1FFQA 4IG2A 1JFHA 4MJZA 1UOZA 2OX4A 1C9DA 4QNWA 3OIHA 4JYEA 1E15A 4K7YA 1XWYA 4A3UA 4J3UA 3OYXA 2A3LA 1EA9C 4UCGA 2G5WA 2VOMA 4J3XA 3KRUA 5G1YA 1S5WA 5DANA 3LXBA 3KTSA 5FI8A 1AOGA 4JQ3A 1OEPA 4OT7A 4W86A 3R58A 8TIMA 1X2GA 1XSKA 4GXWA 5CPSA 2Z25A 1ENUA 1FWFC 2VR5A 3OGSA 2BGNE 2FGZA 1T8QA 5D2WA 1JCMP 3UF9A 4WGXA 1UPPA 5EMJA 4LIIA 3W84A 4K8GA 3WLLA 1UP0A 3LADA 1TJ1A 4KWOA 1N82A 2C3ZA 3QYQA 1PKLA 2O9RA 4V28A 4HPHA 4PRRA 2IPJA 5LA1A 2VFDA 1UWSA 1QWGA 1EO7A 4Y9OA 1H61A 3W7CA 2ON3A 4B5VA 5EL1A 3I68A 2C6QA 3NQDA 1GOKA 4U31A 3L0KA 3BMVA 5B7YA 2ZWYA 1HG3A 2CZVA 3SQLA 1JPKA 3W7NA 2O4MA 3GLCA 2FB3A 2TSYA 5EYWA 4Z0SA 4KW2A 3WFAA 5T91A 1FCQA 1S1RA 4ADUA 3TNOA 1KM5A 4YVVA 3QR0A 1V79A 4O1CA 2F7FA 2GH5A 1W3NA 1TCDA 4IUGA 1XGDA 4M1BA 4DI8A 1F4HA 3TLLA 3AYTA 4EAYA 3W07A 4ZQNA 2YL6A 5ABHA 2A3CA 3VGEA 1IIHA 4GQRA 2HBXA 3PZOA 4U3CA 5BOFA 4HA4A 2EXOA 1V02A 1E1CA 4M6PA 4F0MA 2P53A 1W1VA 3ITVA 2FVKA 4R5EA 1Z41A 4L56A 4OBSA 4MGGA 1NFGA 1US3A 1KV5A 4GQGA 2QDEA 5FEZA 1OGBA 3UG5A 1R86A 1RJRA 1IWAA 1Q66A 3SCPA 5F2IA 1XD0A 2BBFA 3AMLA 3ITXA 4IL0A 5D9PA 1UWRA 4TV5A 3UXKA 1Z89A 1EX1A 1OT1A 2R1NA 2WNNA 3HJZA 4KEVA 4LNCA 3O15A 3M0ZA 1OC6A 4EQRA 2YJQA 2QGYA 3LSBA 3W29A 4NEWA 1XLLA 4AZCA 4AHOA 1LT7A 2ZX7A 4TVDA 1CZ1A 3R89A 3E2QA 4W93A 4ZO7A 3HZ3A 2HROA 4HIBA 3PANA 2YBTA 1T7LA 4KGJA 4H3DA 1WDSA 1PJ9A 2DUXA 4IIBA 3RR4A 2V3DA 5MHBA 2YYUA 3VX0A 4HCHA 3WELA 3GHTA 1EJUC 2QAEA 1GVYA 2ZA2A 1FWNA 2XN1A 4E2BA 3PZIA 4GUJA 4ERIA 4WKFA 1TR1A 5AC6A 3TXVA 3NNTA 4N2YA 2F6XA 3UQNA 3FG2P 1XUUA 1NEYA 4WSJA 1XBXA 1CIUA 4DAIA 4F79A 5A95A 4ADWA 3A9BA 1O94A 1LQAA 3BJSA 1ONFA 1MEHA 2KX9A 2F8QA 3GDKA 5A94A 1KC7A 1W3HA 5RUBA 5EA9A 2DT2A 4JIEA 3BGAA 2ZBTA 1S2WA 1LLOA 2INFA 3OBAA 4IM4A 4DJDA 1ZNNA 3LCWA 3OTRA 3WKZA 1W5OA 3A22A 4G1KA 4IF2A 3U2EA 1V0LA 1ZL1A 3RJXA 4DJFA 3LTYA 4YN5A 4PMQA 3LLDA 3EDEA 4LEQA 4PL2A 4UTWA 5CPLA 4TTGA 2E0PA 3TYDA 2NX9A 4GH1A 5C5YA 1A5KC 4JQ1A 1E0XA 5K9XA 1UD4A 3L12A 1GRBA 9XIAA 4V1XA 3KL0A 3HURA 3P6LA 3QKZA 4R88A 3O6CA 3RN6A 4HK6A 4PUDA 1DWIM 1ZAIA 4M8UA 2CXGA 3WD3A 4AC1X 5IFPA 3S5ZA 3W74A 1GK8A 1HO4A 2VD8A 3TWBA 3IC9A 3A4XA 3MUY1 4RNFA 2QCDB 5IHSA 1VFUA 1YPXA 3BPWA 2G41A 4YIWA 3TOYA 4ZZ9A 2WSYA 3DECA 1H7WA 3MV01 2JK6A 2QZRA 3RCYA 4S3EA 1N60C 2FHCA 1S3HA 3GRTA 2Z2UA 5I5RA 5SWUA 1IR1A 1RBLA 3QY7A 2PDMA 1SO5A 5AB3A 4U5KA 1V77A 3L4YA 4HK5A 1OFEA 4UFMA 4REQA 3SADA 4J7RA 2GR2A 2RDUA 2OX1A 4L6OA 5K4ZA 3SCOA 4EKJA 4JL2A 1ZY9A 4TV6A 1J96A 1FWAC 2PUZA 3IARA 2DQWA 1UP3A 2PP3A 2ALRA 1JXJA 1DJYA 1XFCA 4QQ3A 5CLWA 3N9KA 1A4LA 4XIAA 1EEPA 4EPEC 1GZ1A 5AZ0A 5AFDA 3UEQA 4J3VA 1FP9A 1JULA 4DM1A 1X2HA 1F74A 2NX3A 4B15A 3VUSA 4P8XA 3PF3A 1KV8A 3TYAA 3G5EA 3ZWSA 2ZTKA 2PDCA 3CEUA 3HIJA 4GGHA 1FBAA 4JTJA 4K8EA 3H55A 2R94A 2OTDA 2XZ9A 3RMEA 2WVVB 1B3WA 3OJGA 1KBLA 4KIEA 4I9TA 8XIMA 3A4JA 3CYVA 5DY3A 4DWSD 1DV7A 4NVTA 3NQ7A 3NQAA 5A8QA 1E3XA 3L4UA 3TSBA 3IIZA 4LCQA 2Y24A 5BMXA 2PC8A 4PTVA 3UG8A 1BZLA 3C2OA 5JU6A 2V82A 1E3ZA 3IRSA 1UA7A 5FS9A 4XTDA 1VHCA 4V15A 4CU7A 3CMGA 2OWWA 4DF0A 1WDPA 2CLKA 4ECLA 1U33A 4K7ZA 1GTHA 2NXHA 1B3OA 7CGTA 4LF2A 1DWGM 2JF7A 3TYBA 3OA3A 3TH6A 4BQ4A 2AL2B 3K1GA 2DT0A 4FX9A 3ARZA 1YQ2A 1MXSA 2RGMA 1XLCA 3F1QA 1JRPA 1STZA 1YXYA 2PDQA 1I2NA 3NAVA 3TA6A 1B54A 1LLZA 4D8AA 2E6AA 4AD4A 1U22A 1M7PA 3M16A 5KEZA 4PTMA 3VD9A 3CHVA 4GX9A 1X7IA 4DNMA 4LXFA 3ZOAA 4C7FA 1G9HA 4NUWA 3EWZA 3TJXA 1ZSXA 2NWRA 2WOQA 3D47A 3WDJA 3E9AA 1NAL1 4KWUA 3ARVA 4HTYA 4TO8A 3P62A 4PUWA 3PJTA 1GJWA 3WJYA 2OO6A 1XH0A 3K4AA 4FX7A 2Y8KA 3WK3A 2ADAA 5G1MA 4AFYA 4R85A 1EPXA 4UMBA 3WNPA 1GPWA 3R8GA 1M6IA 1DHKA 3G2GA 3SN4A 5M2FX 3P8IA 4S3FA 3W73A 3M0LA 3T7VA 1D8WA 3GZ3A