5U1OA

2.3 angstrom resolution crystal structure of glutathione reductase from vibrio parahaemolyticus in complex with fad.
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
450
structure length
450
Chain Sequence
ATHFDYICIGGGSGGIASANRAAMYGAKVALIEAQDLGGTCVNVGCVPKKVMWHGAQIAEAMNLYAEDYGFDVDVKGFDWSKLVESRQAYIGRIHQSYDRVLGNNKVNVIKGFAKFVDEKTVEVNGEHYTADHILIAVGGRPTIPNIPGAEYGIDSNGFFDLAEQPKRVAVVGAGYIAVEIAGVLHALGTETHLFVRKESPLRSFDPMIIDTLVEVMEAEGPTLHTHSVPKEVVKEADGSLTLHLENGESQNVDQLIWAIGRHPATDAINLASTGVATNEKGYIKVDEYQETNVKGIYCVGDIMEGGIELTPVAVKAGRQLSERLFNNKPNAKMDYDLVPTVVFSHPPIGTIGLTTQEAEEKYGKDNIKVYTSGFTAMYTAVTKHRQPCKMKLVCAGEEETVVGLHGIGFTVDEMIQGFGVAMKMGATKADFDSVVAIHPTGSEEFVTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione reductase
publication title 2.3 Angstrom Resolution Crystal Structure of Glutathione Reductase from Vibrio parahaemolyticus in Complex with FAD.
rcsb
source organism Vibrio parahaemolyticus serotype o3:k6 (strain rimd 2210633)
molecule tags Lipid binding protein
total genus 146
structure length 450
sequence length 450
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5u1oA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5u1oA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5u1oA02
1VQWA 4Z26A 1S2QA 1TDOA 4EIQA 1LPFA 4GCMA 3DJJA 4H4RA 5BULA 1CJ3A 3DMEA 2QA1A 2YM1A 3CNSA 4XXGA 2VOUA 2VVMA 1TDEA 3ALMA 4YKFA 4U2LA 4EM4A 4H50A 4EQRA 2C66A 2EQ9A 3T37A 1GTHA 3AE9A 3AEEA 5J7XA 4YSHA 2GEWA 3B3RA 4WX1A 3D8XA 4YSXA 2YLRA 3DGHA 1H84A 5BRTA 2X8GA 1CJCA 4H4PA 1KNRA 2AAQA 2JB3A 5EBKA 3NYCA 4EM3A 4X9NA 1ZMCA 4H4UA 4APNA 3UOXA 4YT0A 2A89A 4CRTA 4EMJA 3G5QA 3FG2P 3CPIG 2X50A 2WBAA 2C7GA 2EQ8A 3BNMA 4H4VA 4OPCA 1F8SA 3AE5A 4U8LA 3DA1A 1GRTA 2C67A 4Z43A 1PXCA 3V3NA 1JRZA 3CGDA 4TM0A 4O5UA 3AEAA 3KLJA 5HY5A 1SEZA 4EMWA 3NK0X 5IQ1A 3NK2X 4H4QA 1JNZA 3GWFA 1TRBA 4A65A 2W0HA 2YG6A 4Z24A 2GMHA 3C96A 4B68A 1D7LA 3VRAA 4GUVA 4TLZA 1RP0A 4U2TA 4XWZA 1D4DA 5LV9A 4EQWA 2B9XA 1DJQA 4Z2RA 1CJ2A 3Q9TA 1TYPA 5FS6A 2WDQA 4H4XA 2R45A 1GPEA 2C73A 1V59A 3CGCA 4XWRA 3H8LA 1OJAA 4U8KA 2VRMA 2OLNA 3NN6X 2O9ZA 3UTFA 3RNMA 4JNQA 2GQFA 1VG9A 5KWFA 3AE6A 2WPCA 1JOAA 3S61A 1KSUA 1H86A 2OLOA 4C74A 4AT2A 3FBSA 3P4QA 4H2PA 3SGLA 2XLTA 3Q6JA 4OPGA 3V76A 4FX9A 1NHPA 1JNRA 4DSGA 2E5VA 3NK1X 2OAMA 2WU2A 4BK2A 2C65A 2UZZA 4U8IA 2X8HA 2E1MA 1NENA 2YM2A 2QCUA 2YR4A 4K2XA 1KF6A 1QJDA 3AYLA 1CC2A 1LTXR 2WP9A 1MO9A 2YLTA 3P9UA 3KA7A 4YXDA 4CY8A 1ZP0A 3PO7A 2GR1A 3GRSA 3NH3X 4RG3A 3V3OA 1BKWA 4CBQA 2APGA 3ISHA 4JDRA 1ZOVA 2X8CA 1IUTA 2B76A 1KFYA 1PS9A 3F8RA 2GF3A 4CCRA 3LJPA 2IIDA 4UDPA 1LVLA 3DGZA 4NEWA 3E1TA 2XLRA 5JCIA 3CIRA 2GR0A 3UKFA 1IUVA 1VRQB 2XCGA 2YR5A 2V60A 3D1CA 4A99A 1NDAA 3AEDA 4U8NA 4IV9A 2ZZ0A 2OALA 4Y4MA 5HHFA 4LIIA 2BC1A 1IUUA 5M10A 3G5SA 2RGOA 3P4SA 4RG4A 2BA9A 1DXLA 3AE4A 3UKKA 2JAEA 1PJ6A 4E0VA 2EQ6A 5HYMA 3M0OA 2BCGG 3B6DA 4Z25A 1XHCA 5JCKA 4H4SA 3QSMA 4DSHA 3BI4A 5IPYA 2YG3A 4A5LA 5FS7A 3IWAA 4N9XA 3UOZA 3ZDNA 1NHSA 2BC0A 2A87A 3AD9B 2AR8A 3ATRA 3G5RA 3NYEA 2GMJA 1XPQA 3ITJA 3F8PA 1GRFA 4LU6A 1M64A 2EQ7A 5FS8A 5J60A 1BGNA 5KOWA 3IHGA 3QFBA 3M12A 3HZLA 3GYIA 3FPZA 3NN0X 2YVFA 1DOEA 1E7PA 1FL2A 2AQJA 3NKSA 2HQMA 1ZKQA 4FDCB 1VG0A 2FJEA 4BJZA 5CQFA 4OPUA 2VVLA 4FK1C 3K7QX 3K30A 1QLBA 2C70A 2V6OA 5BUKA 4OPDA 1D4EA 2B7SA 2XDOA 4Z2UA 3BI5A 4AP3A 2C3DA 2XYOA 1E1MA 4MJWA 5KRQA 3ADAB 1MXTA 2XLUA 1CJ4A 1GALA 3C4NA 3KKJA 3RP8A 1GT8A 1OJTA 1GXFA 1ONFA 2BYBA 4IVMB 2Q6UA 2ZZBA 1PDHA 3LZWA 3P4PA 1B4VA 2WOVA 1GREA 3NTDA 1GESA 2BS4A 1O94A 1PN0A 2WPEA 2R0GA 4U8PA 1S2YA 3UKLA 3ATQA 4ZCDA 4H4YA 2WOWA 2C72A 2E4GA 5GRTA 1PBEA 2IVDA 2XVIA 3ALJA 1L9EA 2FJAA 2XVJA 3LOVA 4U8JA 1P2HA 5EOWA 2Z5XA 3PVCA 2YG4A 3UKPA 1PBBA 5JCNA 4YSZA 2BK3A 2CULA 4J33A 1ZDLA 2C3CA 4YTMA 1N4WA 1PXAA 2WP5A 2YWLA 4H2RA 1ZMDA 4A9WA 3AE1A 2WS3A 5M0ZA 1D7YA 2Q7VA 3LB8A 4OPTA 4B63A 4K8DA 1YQ3A 3IHMA 4C77A 1LV0A 2V5ZA 3NTAA 1H81A 4GRTA 1RYIA 2VQ7A 1YQ4A 4GDPA 3AYIA 3ICTA 3VR8A 5KXJA 3AECA 3UP5A 1ZY8A 1L9DA 3SQPA 3ABVA 1CC4A 4U8MA 2YLSA 2V3BA 3II4A 2V3AA 3KVEA 1XDIA 1L0VA 3UKQA 1NAAA 2B7RA 1LQUA 1EL5A 1MOKA 2GR3A 1E1LA 3CN8A 2XVFA 2F5ZA 4GF7A 1K0LA 2QA2A 2RABA 1B5QA 1NEKA 3NGCX 2ARDA 3GYJA 4O5QA 3OC4A 2ACZA 4OPLA 4CNJA 1Q1WA 4WCTA 4DGKA 1PBDA 1GRBA 3EPTA 3ALLA 4U2SA 1F8WA 5GSNA 2DKIA 1JEHA 4C3XA 3L8KA 4K5SA 2Z5YA 1O5WA 3IF9A 3S5WA 2Q0LA 4H7UA 3AXBA 2H89A 4Z44A 1S3EA 5ER0A 3QJ4A 4GDEA 2YG5A 2R46A 5JCLA 1X31B 3DH9A 1S3BA 2BXSA 3AB1A 4TM4A 2BXRA 2YQUA 1LQTA 2X3NA 2B9WA 4EQXA 3SFDA 2XLPA 3UKHA 2RGJA 3NHOX 2BS2A 2BK5A 4HB9A 4J2WA 2YLXA 1XANA 1YKJA 2WU5A 4B66A 1O95A 4H2QA 1IUWA 1F6MA 3DK8A 2YAUA 3REDA 1D5TA 1E1KA 1M6IA 3ICSA 1GRGA 2XFOA 3UTEA 1K0IA 3CNPA 3AEFA 2FJDA 4AP1A 5C2TA 2WESA 2YR6A 3AWIA 4PABA 2WDRA 3O0HA 1LJ1A 1NG4A 3AD7B 4NTDA 4CCQA 3GWDA 4AOSA 3ICRA 1NHQA 1Y56B 3NT6A 3I6DA 4JQ9A 4DNAA 4HA6A 1GERA 2GAGB 4B1BA 5BVAA 3CGEA 2WQYA 3UOYA 3VRDB 1GOSA 3KPFA 4KX6A 3P4RA 2XFPA 3CNJA 3DJDA 4BURA 1GV4A 2CFYA 3F8DA 1JRXA 3CPHG 4IA6A 4UDQA 4EMIA 3UOVA 5U25A 5FMHA 3DJEA 4USQA 1K0JA 2Q0KA 3LZXA 1JU2A 1KNPA 3GMCA 1H6VA 1REOA 1TDKA 4ADWA 3KU9A 1VDCA 1OJDA 2GH5A 4K5RA 3CGBA 4J31A 4X4JA 4YTPA 3AEGA 3RHAA 3BI2A 4BK1A 1DNCA 3GD3A 2WOIA 2PYXA 3AYJA 1FCDA 3VR9A 2FJBA 3GD4A 3AD8B 1N4VA 1P2EA 2Y6QA 3M13A 5L46A 1H7WA 2RGHA 1PXBA 2GAHB 4I59A 1OJ9A 3WE0A 1GEUA 2PHHA 4JNAA 3C4AA 4JY3A 1TYTA 4NEVA 3URHA 1CF3A 1PBCA 2NVKX 3COXA 3FIMB 3GMBA 3UP4A 2YVGA 2JB1A 3LXDA 4IA5A 4A6NB 1F8RA 3GDNA 1BZLA 3EAOA 5IQ4A 4KPRA 2H88A 1B8SA 1IUXA 3LADA 1KSSA 3CNDA 3H8IA 1RSGA 4IVOB 2R4EA 1EL7A 3CNTA 2C76A 1Q9IA 4EQSA 1PBFA 1ZX9A 1TDNA 3NRNA 4YTNA 4YKGA 4REKA 1AOGA 3UTGA 3R9UA 4J56A 2J3NA 2FBWA 1ZK7A 3L1RA 4NTEA 1ELIA 4BV6A 1N1PA 1DOBA 1DODA 2I0ZA 1JRYA 2ZBWA 1NG3A 1H83A 4CY6A 2R0CA 4ECHA 3NNEA 3FMWA 3JSKA 3QVRA 3UTHA 1DOCA 4AT0A 2TPRA 1GNDA 2GV8A 3CTYA 3QSSA 3IC9A 2GR2A 1QO8A 2GRTA 1PHHA 2JB2A 4TLXA 2JBVA 3AEBA 1PJ5A 2YG7A 4UDRA 1BGJA 4JY2A 1F3PA 5TR3A 3H4KA 4H4WA 2JK6A 2VVLG 3KD9A 2CVJA 4K7ZA 3BHFA 3AE8A 3PS9A 5KVIA 4J34A 3VRBA 3OZ2A 2YLZA 4C5OA 1K4QA 1GRHA 1NHRA 1B37A 2X99A 1BF3A 3QFAA 2B9YA 4ICYA 4JN9A 4P9SA 2WHDA 2ZZCA 3K7MX 2XFNA 3EF6A 1EL9A 1EBDA 4FK1A 5HXIA 3SM8A 5EB5A 3P1WA 2WEUA 4C3YA 1FECA 3RP7A 4YWOA 2A8XA 4BJYA 1HYUA 1PJ7A 4B64A 1L9CA 3QSEA 2BACA 1GRAA 5CKUA 1FEAA 5FS9A 1Y56A 1GSNA 3GRTA 2GVCA 2XVEA 4K22A 4CNKA 2BCPA 1YQZA 4ZCCA 4Y4LA 3RP6A 2CDUA 2YLWA 4J36A 1CBOA 5JCMA 1CHUA 1E1NA 4BK3A 4H4TA 5KVHA 3GDPA 2VQBA 2WPFA 1FEBA 1UKVG 3UCLA 4GR1A 3AE7A 4U8OA 2BS3A 4RSLA 1CC6A 1EL8A 2QAEA 3I3LA 1GTEA 5U1OA 4M52A 4OVIA 3BHKA 2WETA 2XFUA 2YVJA 2VZ2A 1KDGA 3DK4A 3UKAA 2NPXA 5U63A 4Z2TA 4USRA 3NLCA 2XLSA 4TM3A 4I58A 4AOXA 1N4UA 2DKHA 1OJCA 4B65A 3EANA 3QVPA 4OCGA 3AE2A 5C3JA 1BWCA 3SFEA 4PAAA 2WP6A 1GETA 2WDVA 1Y0PA 2GB0A 4NZHA 1H7XA 3VQRA 1IJHA 1E6EA 1W4XA 1DJNA 3DK9A 2BK4A 2R0PA 3DJGX 2IVEA 2C75A 2R9ZA 1Q1RA 4B67A 2R4JA 1H82A 2XVHA 2C64A 1IUSA 4OPIA 2GQWA 1Z6LA 4B69A 4A6NA 4H2NA 5KOXA 3CPJG 2VRLA 4H4ZA 2OA1A 2JKCA 3BNUA 1TDFA 4ZN0A 2BABA 4EIPA 4A79A 1E39A 1FOHA 3NIXA 4LA1A 1ZOYA 2TMDA 2XFQA 2Y6RA 3AE3A 4UP3A 3ZYXA 1YY5A 2V61A 4J57A 4D03A 3GSIA 4X9MA 3K7TA 1NPXA 3NG7X 5DBJA 3NYFA 4D04A 5EB4A 1COYA 4NTCA 4TM1A 1D4CA 4Y4NA 4YSYA 4A7AA 1CL0A
chains in the Genus database with same CATH superfamily
3CB3A 4Z26A 4E4FA 4HN8A 5BULA 3K1GA 3SN1A 2QA1A 2YM1A 4XXGA 3DERA 2VOUA 3ALMA 4HNLA 4H50A 3AE9A 4A35A 3P3BA 4YSHA 2GGHA 3R11A 4YSXA 2YLRA 3DGHA 1PDYA 4TVYA 2X8GA 4H4PA 3HYVA 3NZGA 1N5WC 4APNA 3H12A 3R0KA 3G5QA 3FG2P 3B9JB 3PG6A 5KMRA 4TM0A 3AEAA 1JNZA 1TRBA 2YG6A 2GMHA 3C96A 4B68A 1D7LA 4GUVA 4TLZA 4EQWA 2PGWA 3OZYA 3Q9TA 1TYPA 3NXLA 5FS6A 2WDQA 1W6TA 1GPEA 2C73A 1V59A 4U8KA 3N6JA 2O9ZA 4JNQA 1KKOA 3AE6A 3GY1A 4AT2A 5FJPA 3Q6JA 3V76A 1NHPA 4DSGA 2E5VA 2PTZA 2OAMA 2C65A 2X8HA 2E1MA 1KF6A 4YXDA 2QQ6A 1ZP0A 3PO7A 4RG3A 1BKWA 4CBQA 2APGA 1PS9A 2IIDA 4UDPA 3E1TA 3PK7A 3UKFA 1VRQB 2E3TA 3AEDA 4U8NA 2ZZ0A 1IUUA 3G5SA 3DEQA 2JAEA 3R25A 1VQZA 3M0OA 2BCGG 3NVYB 5JCKA 4H4SA 1P48A 3BI4A 4A5LA 3S5SA 4N9XA 3UOZA 2AR8A 2GMJA 3ITJA 1NU5A 5J60A 3IHGA 3NN0X 2YVFA 1E7PA 1ZKQA 1VG0A 2FJEA 3K7QX 3K30A 4OPDA 2PODA 2QJMA 5KRQA 1MXTA 2XLUA 4KT2A 2MUCA 1OJTA 1ONFA 3P4PA 2WOVA 1GREA 2OLAA 4Z17A 4H4YA 2WOWA 3NS1B 2IVDA 2XVIA 4U8JA 2Z5XA 1PBBA 5JCNA 3DIPA 1YQ3A 3NVZB 4IT1A 4GDPA 5FJTA 1CC4A 3DG7A 3IJQA 3II4A 1JRPA 1E1LA 2XVFA 3MKCA 1K0LA 3NGCX 2RABA 2XH7A 1B5QA 2ACZA 4DGKA 3A7RA 4U2SA 1F8WA 5GSNA 2DKIA 2Z5YA 1O5WA 3IF9A 3UJEA 2Q0LA 4H7UA 3CAWA 3AXBA 4X2PA 4Z44A 1DTNA 2PTYA 3QJ4A 4GDEA 2YG5A 3SSZA 3VFCA 3V5CA 2BXSA 4TM4A 2BXRA 2X3NA 1LQTA 4DYEA 4GYPC 2RGJA 2XGZA 2YLXA 3VA8A 3SBFA 1IUWA 1D5TA 1E1KA 2CHRA 1K0IA 2QDDA 3AWIA 3AMZA 4PABA 1JPDX 2OPJA 3O0HA 4CCQA 3RR1A 4NNJA 3GWDA 1Y56B 3NT6A 4JQ9A 4DNAA 4MGGA 3R10A 4KX6A 4BURA 2CFYA 4IA6A 4UDQA 3U9IA 4EMIA 3DJEA 3LZXA 2XH0A 1REOA 3KU9A 4J31A 3TTEA 4YTPA 1DNCA 1EBHA 3AD8B 1SJAA 3UJSA 1X2GA 1PXBA 2E5AA 4I59A 3H70A 3WE0A 4JY3A 2NVKX 2OZ3A 1EC7A 1WUEA 1BZLA 4M6UA 1MDRA 2RDXA 2C76A 1Q9IA 1PBFA 3NRNA 1TDNA 3R9UA 4J56A 1MDLA 3L1RA 1R0MA 4K1WA 4BV6A 2FKPA 2ZBWA 3NNEA 3FMWA 2TPRA 3CTYA 2GRTA 1PJ5A 2YG7A 1F3PA 2MNRA 3H4KA 2CVJA 5KVIA 1NHRA 1B37A 2B9YA 3QFAA 4G7FA 1EBDA 4FK1A 3SM8A 3RO6A 4GGHA 2A8XA 2ZC8A 3P0WA 3QSEA 1GRAA 1FEAA 1Y56A 2XVEA 2BCPA 4GGBA 2CDUA 4J36A 5FJUA 4G8TA 4E6MA 2I5QA 1CC6A 2XFUA 3SZFA 1KDGA 5U63A 1KD0A 3NLCA 4I58A 4B65A 3CXOA 3AE2A 3SZCA 3A7AA 1GETA 3VQRA 1H7XA 3D46A 1E6EA 3UXKA 1ELSA 2C75A 2R4JA 3EKGA 3CPJG 3BNUA 1TDFA 1E39A 4LA1A 3K7TA 1NPXA 4A7AA 1CL0A 1S2QA 1TDOA 3DDMA 3DMEA 3UGVA 1TDEA 2ONEA 4YKFA 1E9IA 3T37A 1GTHA 3CXBA 3D8XA 1R6WA 2PS2A 5EBKA 4EMJA 3HPFA 2X50A 2WBAA 3L5OA 2C7GA 4OPCA 3CK5A 4ROPA 3AE5A 3DA1A 1GRTA 2C67A 4Z43A 3CT2A 3GWFA 4A65A 4Z24A 4F4RA 4IP4A 1DJQA 4Z2RA 4JHMA 2R45A 3CGCA 4XWRA 1RM6B 1XPYA 2VRMA 2OLNA 1VG9A 5KWFA 3S61A 1KSUA 2OLOA 3FBSA 2DW7A 3P4QA 4DN1A 4K8GA 1JPMA 3NK1X 2UZZA 2QJJA 2YM2A 2WP9A 4CY8A 2GR1A 3UJRA 3ISHA 4JDRA 3THUA 2X8CA 3VDGA 3F8RA 4CCRA 2PP3A 3DGZA 5JCIA 3DGBA 1IUVA 2YR5A 2V60A 4A99A 2QJNA 3D9XA 2OALA 2OX4A 4ZOHB 4LIIA 4HYRA 4RG4A 3UKKA 3HYWA 5HYMA 3HYXA 4Z25A 3OTRA 2YG3A 3IWAA 1JCTA 2BC0A 4KEMA 3AD9B 3ATRA 1XPQA 2BRYA 4LU6A 3ES7A 1M64A 2EQ7A 1BGNA 1L8PA 1FL2A 2AQJA 3R07C 4FK1C 4DWDA 1D4EA 4AP3A 2XYOA 4HCLA 1CJ4A 3C4NA 3KKJA 4GYPA 1GT8A 2BYBA 1PDHA 1GESA 1O94A 1PN0A 2R0GA 4ZCDA 4GIRA 5EOWA 2FJAA 3GYXA 1PXAA 2YWLA 4H2RA 2PP1A 1D7YA 2W55A 3H7VA 4B63A 1LV0A 2V5ZA 3NTAA 1H81A 3ICTA 3VR8A 3UP5A 1L9DA 2OO6A 3ABVA 4U8MA 2PA6A 2V3AA 3UKQA 2B7RA 1EL5A 3CN8A 1TE6A 1ECQA 2QA2A 4O5QA 1IYXA 4CNJA 1Q1WA 3EPTA 3ALLA 1TZZA 3MSYA 4K5SA 3FJ4A 1S3BA 3AB1A 2XH4A 2YQUA 3UKHA 1WYGA 2BS2A 4J2WA 1XANA 3FYYA 2WU5A 1O95A 3DK8A 1M6IA 2XFOA 1EC9A 3AEFA 2FJDA 1FO4A 2WESA 2WDRA 1LJ1A 1NG4A 3GC2A 3AD7B 2GAGB 5BVAA 3CGEA 3VRDB 4HPNA 3KPFA 3P4RA 3DJDA 1OEPA 5U25A 1K0JA 2Q0KA 1TDKA 4ADWA 1VDCA 3CGBA 4X4JA 2XH2A 3AEGA 3BI2A 4G6HA 2WOIA 3AYJA 2FJBA 1N4VA 2PCEA 2Y6QA 1H7WA 1GEUA 4JNAA 1PDZA 1CF3A 1PBCA 2PU0A 1N61C 3EAOA 5FJOA 2AKMA 2H88A 1IUXA 1RSGA 3NVVB 4EQSA 5EU9A 3UTGA 3R1ZA 4NTEA 3T4WA 1DODA 1JRYA 4E5TA 1NG3A 3GD6A 4ECHA 2GGEA 3UTHA 1DOCA 1GNDA 2GV8A 4JN8A 1SJBA 2JBVA 4UDRA 3SQSA 1SJDA 4E8GA 4FI4A 2POZA 3I4KA 3AE8A 3BHFA 2W54A 3TW9A 4C5OA 4II3A 2ZZCA 2PMQA 4J3ZA 1FECA 3RP7A 2P0IA 2PTXA 4YWOA 4BJYA 3IK4A 1GSNA 1STZA 4Y4LA 2YLWA 1CBOA 2GL5A 5KVHA 3GDPA 2WPFA 1UKVG 3UCLA 4GR1A 4RSLA 5U1OA 3BHKA 2WETA 1F9CA 3UKAA 2AKZA 4USRA 4TM3A 4AOXA 1N4UA 1OJCA 3QPEA 4OCGA 5C3JA 1BWCA 5G5GB 3R0UA 2WP6A 3FVDA 1Y0PA 4NZHA 1W4XA 1DJNA 4HNCA 2GQWA 1Z6LA 4H2NA 3JVAA 2JKCA 4ZN0A 2BABA 4EIPA 3Q45A 1FOHA 3AE3A 3RGTA 2Y6RA 4UP3A 3GSIA 5DBJA 3TOYA 4D04A 1SB3B 2OG9A 4NTCA 1D4CA 4YSYA 1KN0A 4EIQA 3DJJA 1CJ3A 3CNSA 3QTPA 4U2LA 2EQ9A 3B3RA 3H8AA 1H84A 1CJCA 3N4FA 2JB3A 4X9NA 3B97A 4YT0A 3UOXA 4CRTA 3BNMA 4U8LA 3VCNA 1PXCA 1JRZA 3CGDA 3AM9A 3KLJA 4EMWA 5IQ1A 3NK2X 2W0HA 3OPSA 3MZNA 2C4CA 4U2TA 4XWZA 1D4DA 2B9XA 1FIQB 1CJ2A 3MQTA 4GMEA 3SY4A 2HXTA 3UTFA 3RNMA 2GQFA 4A3RA 1JOAA 4C74A 1H86A 1KCZA 2PPGA 4H2PA 3SGLA 4OPGA 4FX9A 2WU2A 4H83A 1NENA 4K2XA 2QCUA 3AYLA 1CC2A 1MO9A 2YLTA 1FFUC 4H2HA 1ZOVA 4IL2A 2NQLA 2GF3A 3LJPA 1LVLA 4NEWA 2XLRA 2GR0A 3D1CA 1NDAA 4IV9A 3SN0A 2BC1A 3P4SA 4E0VA 1PJ6A 2EQ6A 1ONEA 3B6DA 2P3ZA 5IPYA 4DSHA 4TVWA 1JDFA 1GRFA 5FS8A 4KPLA 3M12A 3QN3A 3GYIA 1DOEA 3NKSA 4FDCB 1MRAA 4OPUA 3BOXA 2VVLA 3TJIA 1QLBA 2C70A 5BUKA 2B7SA 3ZVIA 3D47A 3N4EA 4MJWA 1YEYA 1GALA 5KMSA 2Q6UA 2P8BA 3OZMA 2BS4A 4U8PA 1S2YA 3UKLA 3TWBA 3UJ2A 3N6HA 3SR6B 2E4GA 5GRTA 4DX3A 1PBEA 4G74A 2XVJA 1P2HA 3UKPA 3PVCA 2YG4A 4YSZA 2CULA 4J33A 1ZDLA 2C3CA 4YTMA 1N4WA 2WP5A 4A9WA 1ZMDA 2WS3A 2Q7VA 3LB8A 2PU1A 2OQHA 3T14A 3OP2A 5JRBA 4GRTA 1RYIA 1YQ4A 5KXJA 4G6GA 4IL0A 1ZY8A 2DW6A 3IJLA 3KVEA 1XDIA 1NAAA 4GF7A 1XS2A 2F5ZA 1NEKA 2AL1A 2ARDA 4OPLA 1MUCA 3OC4A 1PBDA 2HXUA 4C3XA 3EUB3 3I6EA 1S3EA 4DHGA 3CYJA 2R46A 5JCLA 1X31B 4GAVA 2B9WA 4EQXA 3SFDA 3NHOX 2BRAA 3ZLFA 1YKJA 4B66A 3VC5A 1F6MA 2YAUA 1GRGA 5C2TA 4AP1A 3UCCA 4NTDA 4AOSA 3ICRA 1NHQA 1T3QC 3I6DA 2FYMA 4B1BA 3UOYA 3TWAA 1GOSA 2XFPA 4FP1A 3CNJA 1GV4A 3F8DA 3CPHG 3NO1A 5FMHA 1JU2A 1KNPA 3GMCA 4ZA0A 4II2A 3DESA 2GH5A 1OJDA 4K5RA 1KKRA 4BK1A 2PYXA 3PFRA 1MNSA 1P2EA 3I6TA 3M13A 5L46A 1FHUA 2RGHA 3NFUA 1OJ9A 3C4AA 4IP5A 3COXA 1BKHA 1NELA 4KPRA 4NWZA 3H8IA 4IVOB 2R4EA 2QGYA 1EL7A 3CMMA 3CNTA 1ZX9A 4YTNA 4YKGA 4REKA 2FBWA 1ZK7A 3T0KA 2QDEA 1ELIA 1N1PA 2I0ZA 1H83A 4CY6A 3JSKA 3QVRA 3RITA 3IC9A 1QO8A 1PHHA 2JB2A 4TLXA 4Z1YA 3UCDA 4JY2A 1EC8A 5TR3A 3DFYA 3T2KA 2JK6A 3KD9A 4K7ZA 3PS9A 3PWIA 4HCHA 1GRHA 4JN9A 2X99A 4ICYA 2WHDA 4G73A 1EL9A 5HXIA 5EB5A 4C3YA 3V4BA 3TQPA 3PWGA 2GVCA 3GRTA 1YQZA 4ZCCA 3RCYA 3SX6A 1CHUA 1E1NA 4H4TA 1X2HA 4U8OA 2BS3A 3I3LA 2QAEA 2GDQA 3ZLGA 2VZ2A 3DK4A 2NPXA 3T9PA 4MMWA 5J04A 2GB0A 3BSMA 1IJHA 4K2SA 3DK9A 2BK4A 2R0PA 3DJGX 3HW2A 2R9ZA 4DXKA 2GGJA 1IUSA 4B69A 2OVLA 3A7UA 1ZXIC 4A79A 3NIXA 1ZOYA 2TMDA 4H1ZA 1YY5A 4D03A 4X9MA 3OW1A 3NYFA 2OQYA 4TM1A 1VQWA 1WUFA 1LPFA 4GCMA 2AL2B 4H4RA 1N5XA 1VDVA 2VVMA 4EM4A 4EQRA 2C66A 5G5HB 2OFJA 3AEEA 5J7XA 2GEWA 4WX1A 5BRTA 3JW7A 1KNRA 2AAQA 4ENLA 3NYCA 4EM3A 1ZMCA 4H4UA 3UJFA 2A89A 3P93A 1V97A 3CPIG 2EQ8A 4H4VA 1F8SA 7ENLA 3V3NA 4O5UA 5HY5A 1SEZA 3T2ZA 3NK0X 4H4QA 3T31A 3VRAA 1RP0A 3VCCA 5LV9A 4H4XA 3H8LA 1OJAA 2PTWA 2QVHA 2OKTA 3NN6X 3FXGA 3BJSA 2WPCA 3JZUA 2PP0A 3DG6A 5KMPA 2XLTA 1JNRA 4BK2A 4H19A 4U8IA 2YR4A 1QJDA 1BQGA 1LTXR 3P9UA 3KA7A 3GRSA 3NH3X 3V3OA 1IUTA 2B76A 1KFYA 3CIRA 2XCGA 3T2YA 3GO2A 5HHFA 4Y4MA 5M10A 2RGOA 3RRAA 2BA9A 1DXLA 3AE4A 2P8CA 1XHCA 3QSMA 2HZGA 5FS7A 3ZDNA 1NHSA 2A87A 2AL2A 3G5RA 3NYEA 3F8PA 5KOWA 3V3WA 3QFBA 3HZLA 3FPZA 2HQMA 4BJZA 5CQFA 2V6OA 4E4UA 2XDOA 4Z2UA 3BI5A 2C3DA 1E1MA 3ADAB 4EWJA 3RP8A 4G9KA 1GXFA 4IVMB 2ZZBA 3LZWA 1B4VA 3NTDA 6ENLA 2WPEA 2ZADA 3ATQA 3NRZB 3SJNA 2C72A 3ALJA 1L9EA 3LOVA 3EEZA 2BK3A 5FJRA 3MY9A 3SYIA 5BOEA 3AE1A 5M0ZA 4OPTA 4K8DA 1SJCA 5KNLA 3IHMA 4C77A 2VQ7A 3S47A 3AYIA 3TCSA 3AECA 4A6GA 3SQPA 2YLSA 2V3BA 4GFIA 1L0VA 4JN7A 1LQUA 1MOKA 2GR3A 3GYJA 4WCTA 1GRBA 2PGEA 5KMQA 3Q4DA 4ZCWA 4M0XA 1JEHA 3L8KA 3S5WA 2H89A 5ER0A 2GGIA 3DH9A 1RVKA 5ENLA 3FCPA 2XLPA 2BK5A 4HB9A 3T6CA 3U4FA 3QLDA 1N62C 4H2QA 3AN1A 3REDA 3ICSA 3UTEA 3CNPA 3HRDC 2YR6A 1FFVC 1JROA 3KUMA 3V5FA 4HA6A 1GERA 3ES8A 2O56A 2WQYA 4J1OA 1JRXA 4IZGA 2GGGA 3UOVA 3KPKA 4USQA 2W3RA 1H6VA 3ZLHA 2OZTA 2PSNA 3RHAA 3FV9A 3ETRB 3GD3A 3DG3A 1FCDA 3VR9A 3GD4A 3ZVHB 2GAHB 2PHHA 1TYTA 4NEVA 3URHA 3FIMB 2W3SA 3GMBA 1P43A 2YVGA 3UP4A 2JB1A 3LXDA 4IA5A 4A6NB 1F8RA 3GDNA 5IQ4A 2XSXA 2P88A 1B8SA 3LADA 1KSSA 3CNDA 1AOGA 2J3NA 1H2IA 1DOBA 4GAPA 2HNEA 3MUCA 2R0CA 4AT0A 3QSSA 2GR2A 3TJ4A 3QKEA 3AEBA 1BGJA 3VC6A 5BOFA 4H4WA 2VVLG 4YWSA 4J34A 3VRBA 3OZ2A 2YLZA 1K4QA 3SXIA 1BF3A 4P9SA 3K7MX 2XFNA 3SN4A 3EF6A 3NVWB 3P1WA 2WEUA 1EBGA 1HYUA 1PJ7A 4B64A 1L9CA 2BACA 4IHCA 5CKUA 5FS9A 4CNKA 4K22A 3RP6A 5JCMA 4MKSA 1N60C 4BK3A 2VQBA 1FEBA 3AE7A 1EL8A 1GTEA 4M52A 4OVIA 2YVJA 3SZWA 2OZ8A 4Z2TA 2XLSA 3SZ0A 2DKHA 3EANA 3QVPA 3UXLA 1TKKA 3T8QA 3SFEA 4PAAA 2WDVA 3ZVHA 1N63C 4HCDA 3MWCA 2IVEA 1Q1RA 4B67A 3ENLA 1S7MA 1H82A 2XVHA 1FHVA 3IJIA 2C64A 4OPIA 4KWSA 4A6NA 5KOXA 2VRLA 4H4ZA 2OA1A 3DFHA 4GISA 2GSHA 2XFQA 3ZYXA 2V61A 4J57A 5IDZA 3NG7X 5EB4A 1COYA 4Y4NA 3STPA
chains in the Genus database with same CATH topology
1VQWA 4Z26A 1S2QA 1TDOA 4EIQA 1LPFA 4GCMA 3DJJA 4H4RA 5BULA 1CJ3A 3DMEA 2QA1A 2YM1A 3CNSA 4XXGA 2VOUA 2VVMA 1TDEA 3ALMA 4YKFA 4U2LA 4EM4A 4H50A 4EQRA 2C66A 2EQ9A 3T37A 1GTHA 3AE9A 3AEEA 5J7XA 4YSHA 2GEWA 3B3RA 4WX1A 3D8XA 4YSXA 2YLRA 3DGHA 1H84A 5BRTA 2X8GA 1CJCA 4H4PA 1KNRA 2AAQA 2JB3A 5EBKA 3HYVA 3NYCA 4EM3A 4X9NA 1ZMCA 4H4UA 4APNA 3UOXA 4YT0A 2A89A 4CRTA 4EMJA 3G5QA 3FG2P 3CPIG 2X50A 2WBAA 3L5OA 2EQ8A 2C7GA 3BNMA 4H4VA 4OPCA 1F8SA 3AE5A 4U8LA 3PG6A 3DA1A 1GRTA 2C67A 4Z43A 1PXCA 3V3NA 5KMRA 1JRZA 3CGDA 4TM0A 4O5UA 3AEAA 3KLJA 5HY5A 1SEZA 3T2ZA 4EMWA 3NK0X 5IQ1A 3NK2X 4H4QA 1JNZA 3GWFA 1TRBA 4A65A 2W0HA 3T31A 2YG6A 4Z24A 2C4CA 2GMHA 3C96A 4B68A 1D7LA 3VRAA 4GUVA 4TLZA 1RP0A 4U2TA 4XWZA 1D4DA 5LV9A 4EQWA 2B9XA 1DJQA 4Z2RA 1CJ2A 3Q9TA 1TYPA 5FS6A 2WDQA 4H4XA 2R45A 1GPEA 2C73A 1V59A 3CGCA 4XWRA 3H8LA 1OJAA 4U8KA 3SY4A 2VRMA 2OLNA 3NN6X 2O9ZA 3UTFA 3RNMA 4JNQA 2GQFA 1VG9A 5KWFA 3AE6A 2WPCA 1JOAA 3S61A 1KSUA 1H86A 2OLOA 4C74A 4AT2A 3FBSA 3P4QA 4H2PA 3SGLA 2XLTA 3Q6JA 4OPGA 3V76A 4FX9A 5KMPA 1NHPA 1JNRA 4DSGA 2E5VA 3NK1X 2OAMA 2WU2A 4BK2A 2C65A 2UZZA 4U8IA 2X8HA 2E1MA 1NENA 2YM2A 2QCUA 2YR4A 4K2XA 1KF6A 1QJDA 3AYLA 1CC2A 1LTXR 2WP9A 1MO9A 2YLTA 3P9UA 3KA7A 4YXDA 4CY8A 1ZP0A 3PO7A 2GR1A 3GRSA 3NH3X 4RG3A 3V3OA 1BKWA 4CBQA 2APGA 3ISHA 4JDRA 1ZOVA 2X8CA 1IUTA 2B76A 1KFYA 1PS9A 3F8RA 2GF3A 4CCRA 3LJPA 2IIDA 4UDPA 1LVLA 3DGZA 4NEWA 3E1TA 2XLRA 5JCIA 3CIRA 2GR0A 3UKFA 1IUVA 1VRQB 2XCGA 3T2YA 2YR5A 2V60A 3D1CA 4A99A 1NDAA 3AEDA 3D9XA 4IV9A 2ZZ0A 2OALA 4U8NA 4Y4MA 5HHFA 4LIIA 2BC1A 1IUUA 5M10A 3G5SA 2RGOA 3P4SA 4RG4A 2BA9A 1DXLA 3AE4A 3HYWA 2JAEA 1PJ6A 3UKKA 4E0VA 2EQ6A 5HYMA 3M0OA 2BCGG 3B6DA 3HYXA 4Z25A 1XHCA 5JCKA 4H4SA 3QSMA 4DSHA 3BI4A 5IPYA 2YG3A 4A5LA 5FS7A 3IWAA 4N9XA 3UOZA 3ZDNA 1NHSA 2BC0A 2A87A 3AD9B 2AR8A 3ATRA 3G5RA 3NYEA 2GMJA 1XPQA 3ITJA 2BRYA 3F8PA 1GRFA 4LU6A 1M64A 2EQ7A 5FS8A 5J60A 1BGNA 5KOWA 3IHGA 3QFBA 3M12A 3HZLA 3GYIA 3FPZA 3NN0X 2YVFA 1DOEA 1E7PA 1FL2A 2AQJA 3NKSA 2HQMA 1ZKQA 4FDCB 1VG0A 2FJEA 4BJZA 5CQFA 4OPUA 2VVLA 4FK1C 3K7QX 3K30A 1QLBA 2C70A 2V6OA 5BUKA 4OPDA 1D4EA 2B7SA 2XDOA 4Z2UA 3BI5A 4AP3A 2C3DA 2XYOA 1E1MA 4MJWA 5KRQA 3ADAB 1MXTA 2XLUA 1CJ4A 1GALA 3C4NA 3KKJA 3RP8A 5KMSA 4G9KA 1GT8A 1OJTA 1GXFA 1ONFA 2BYBA 4IVMB 2Q6UA 2ZZBA 1PDHA 3LZWA 3P4PA 1B4VA 2WOVA 1GREA 3NTDA 1GESA 2BS4A 1O94A 1PN0A 2WPEA 2R0GA 4U8PA 1S2YA 3UKLA 3ATQA 4ZCDA 4H4YA 2WOWA 2C72A 2E4GA 5GRTA 1PBEA 2IVDA 2XVIA 3ALJA 1L9EA 2FJAA 2XVJA 3LOVA 4G74A 1P2HA 4U8JA 2Z5XA 3GYXA 2YG4A 3PVCA 3UKPA 1PBBA 5JCNA 4YSZA 2BK3A 2CULA 4J33A 1ZDLA 2C3CA 4YTMA 1N4WA 1PXAA 2WP5A 2YWLA 4H2RA 1ZMDA 3SYIA 3AE1A 2WS3A 4A9WA 5M0ZA 1D7YA 2Q7VA 3LB8A 4OPTA 4B63A 4K8DA 1YQ3A 5KNLA 3IHMA 4C77A 1LV0A 2V5ZA 3NTAA 3T14A 5JRBA 1H81A 4GRTA 1RYIA 2VQ7A 1YQ4A 4GDPA 3AYIA 3ICTA 3VR8A 5KXJA 4G6GA 3AECA 3UP5A 1ZY8A 1L9DA 3SQPA 3ABVA 1CC4A 4U8MA 2YLSA 2V3BA 3II4A 2V3AA 3KVEA 1XDIA 1L0VA 3UKQA 1NAAA 2B7RA 1LQUA 1EL5A 1MOKA 2GR3A 1E1LA 3CN8A 2XVFA 2F5ZA 4GF7A 1K0LA 2QA2A 2RABA 1B5QA 1NEKA 3NGCX 2ARDA 3GYJA 4O5QA 3OC4A 2ACZA 4OPLA 4CNJA 1Q1WA 4WCTA 4DGKA 1PBDA 1GRBA 3EPTA 3ALLA 4U2SA 5KMQA 1F8WA 5GSNA 2DKIA 1JEHA 4C3XA 3L8KA 4K5SA 2Z5YA 1O5WA 3IF9A 3S5WA 2Q0LA 4H7UA 3AXBA 2H89A 4Z44A 1S3EA 5ER0A 3QJ4A 4GDEA 2YG5A 2R46A 5JCLA 1X31B 3DH9A 1S3BA 2BXSA 3AB1A 4GAVA 4TM4A 2BXRA 2YQUA 1LQTA 2X3NA 2B9WA 4EQXA 3SFDA 2XLPA 3UKHA 2RGJA 3NHOX 2BRAA 2BS2A 2BK5A 4HB9A 4J2WA 2YLXA 1XANA 1YKJA 2WU5A 4B66A 1O95A 4H2QA 1IUWA 1F6MA 3DK8A 2YAUA 3REDA 1D5TA 1E1KA 1M6IA 3ICSA 1GRGA 2XFOA 3UTEA 1K0IA 3CNPA 3AEFA 2FJDA 4AP1A 5C2TA 2WESA 2YR6A 3AWIA 4PABA 2WDRA 3O0HA 1LJ1A 1NG4A 3AD7B 4NTDA 4NNJA 4CCQA 3GWDA 4AOSA 3ICRA 1NHQA 1Y56B 3NT6A 3I6DA 4JQ9A 4DNAA 4HA6A 1GERA 2GAGB 4B1BA 5BVAA 3CGEA 2WQYA 3UOYA 3VRDB 1GOSA 3KPFA 4KX6A 3P4RA 2XFPA 3CNJA 3DJDA 4BURA 1GV4A 2CFYA 3F8DA 1JRXA 3CPHG 4IA6A 4UDQA 5EOWA 4EMIA 3UOVA 5U25A 3KPKA 5FMHA 3DJEA 4USQA 1K0JA 2Q0KA 3LZXA 1JU2A 1KNPA 3GMCA 1H6VA 1REOA 1TDKA 4ADWA 3KU9A 1VDCA 4II2A 1OJDA 2GH5A 4K5RA 3CGBA 4J31A 4X4JA 4YTPA 3AEGA 3RHAA 3BI2A 4G6HA 4BK1A 1DNCA 3GD3A 2WOIA 2PYXA 3AYJA 1FCDA 3VR9A 2FJBA 3GD4A 3AD8B 1N4VA 1P2EA 2Y6QA 3M13A 5L46A 1H7WA 2RGHA 1PXBA 2GAHB 4I59A 1OJ9A 3WE0A 1GEUA 2PHHA 4JNAA 3C4AA 4JY3A 1TYTA 4NEVA 3URHA 1CF3A 1PBCA 2NVKX 3COXA 3FIMB 3GMBA 3UP4A 2YVGA 2JB1A 3LXDA 4IA5A 4A6NB 1F8RA 3GDNA 1BZLA 3EAOA 5IQ4A 4KPRA 2H88A 4NWZA 1B8SA 1IUXA 3LADA 1KSSA 3CNDA 3H8IA 1RSGA 4IVOB 2R4EA 3CMMA 1EL7A 3CNTA 2C76A 1Q9IA 4EQSA 1PBFA 1ZX9A 1TDNA 3NRNA 4YTNA 4YKGA 4REKA 1AOGA 3UTGA 3R9UA 4J56A 2J3NA 2FBWA 1ZK7A 3L1RA 1H2IA 4NTEA 3T0KA 1ELIA 4BV6A 1N1PA 1DOBA 1DODA 4GAPA 2I0ZA 1JRYA 2ZBWA 1NG3A 1H83A 4CY6A 2R0CA 4ECHA 3NNEA 3FMWA 3JSKA 3QVRA 3UTHA 1DOCA 4AT0A 2TPRA 1GNDA 2GV8A 3CTYA 3QSSA 3IC9A 2GR2A 1QO8A 2GRTA 3SXIA 1PHHA 2JB2A 4TLXA 2JBVA 3AEBA 1PJ5A 2YG7A 4UDRA 1BGJA 4JY2A 1F3PA 5TR3A 3T2KA 3H4KA 4H4WA 2JK6A 2VVLG 3KD9A 2CVJA 4K7ZA 3BHFA 3AE8A 3PS9A 5KVIA 4J34A 3VRBA 3OZ2A 2YLZA 4C5OA 1K4QA 1GRHA 1NHRA 1B37A 2X99A 1BF3A 3QFAA 2B9YA 4ICYA 4JN9A 4II3A 2WHDA 4P9SA 2ZZCA 3K7MX 2XFNA 4G73A 3EF6A 1EL9A 1EBDA 4FK1A 5HXIA 3SM8A 5EB5A 3P1WA 2WEUA 4C3YA 1FECA 3RP7A 4YWOA 2A8XA 4BJYA 1HYUA 1PJ7A 4B64A 1L9CA 3QSEA 2BACA 1GRAA 5CKUA 1FEAA 5FS9A 1Y56A 1GSNA 3GRTA 2GVCA 2XVEA 4K22A 4CNKA 2BCPA 1YQZA 4ZCCA 4Y4LA 3SX6A 3RP6A 2CDUA 2YLWA 4J36A 1CBOA 5JCMA 1CHUA 1E1NA 4BK3A 4H4TA 5KVHA 3GDPA 2VQBA 2WPFA 1FEBA 1UKVG 3UCLA 4GR1A 3AE7A 4U8OA 2BS3A 4RSLA 1CC6A 1EL8A 2QAEA 3I3LA 1GTEA 5U1OA 4M52A 4OVIA 3BHKA 2WETA 2XFUA 2YVJA 2VZ2A 3SZFA 1KDGA 3DK4A 3SZWA 3UKAA 2NPXA 5U63A 4Z2TA 4USRA 3NLCA 2XLSA 4TM3A 3SZ0A 4I58A 4AOXA 1N4UA 2DKHA 1OJCA 4B65A 3EANA 3QVPA 4OCGA 3AE2A 5C3JA 1BWCA 3SFEA 3SZCA 4PAAA 2WP6A 1GETA 2WDVA 1Y0PA 2GB0A 4NZHA 1H7XA 3VQRA 1IJHA 1E6EA 1W4XA 1DJNA 3DK9A 2BK4A 2R0PA 3DJGX 2IVEA 2C75A 2R9ZA 1Q1RA 4B67A 2R4JA 1S7MA 1H82A 2XVHA 2C64A 1IUSA 4OPIA 2GQWA 1Z6LA 4B69A 4A6NA 4H2NA 5KOXA 3CPJG 2VRLA 4H4ZA 2OA1A 2JKCA 3BNUA 1TDFA 4ZN0A 2BABA 4EIPA 4A79A 1E39A 1FOHA 3NIXA 4LA1A 1ZOYA 2TMDA 2XFQA 2Y6RA 3AE3A 4UP3A 3ZYXA 1YY5A 2V61A 4J57A 4D03A 3GSIA 4X9MA 3K7TA 1NPXA 3NG7X 5DBJA 3NYFA 4D04A 5EB4A 1COYA 4NTCA 4TM1A 1D4CA 4Y4NA 4YSYA 4A7AA 1CL0A 1KN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQW A;  4Z26 A;  1S2Q A;  1TDO A;  4EIQ A;  1LPF A;  4GCM A;  3DJJ A;  4H4R A;  5BUL A;  1CJ3 A;  3DME A;  2QA1 A;  2YM1 A;  3CNS A;  4XXG A;  2VOU A;  2VVM A;  1TDE A;  3ALM A;  4YKF A;  4U2L A;  4EM4 A;  4H50 A;  4EQR A;  2C66 A;  2EQ9 A;  3T37 A;  1GTH A;  3AE9 A;  3AEE A;  5J7X A;  4YSH A;  2GEW A;  3B3R A;  4WX1 A;  3D8X A;  4YSX A;  2YLR A;  3DGH A;  1H84 A;  5BRT A;  2X8G A;  1CJC A;  4H4P A;  1KNR A;  2AAQ A;  2JB3 A;  5EBK A;  3NYC A;  4EM3 A;  4X9N A;  1ZMC A;  4H4U A;  4APN A;  3UOX A;  4YT0 A;  2A89 A;  4CRT A;  4EMJ A;  3G5Q A;  3FG2 P;  3CPI G;  2X50 A;  2WBA A;  2C7G A;  2EQ8 A;  3BNM A;  4H4V A;  4OPC A;  1F8S A;  3AE5 A;  4U8L A;  3DA1 A;  1GRT A;  2C67 A;  4Z43 A;  1PXC A;  3V3N A;  1JRZ A;  3CGD A;  4TM0 A;  4O5U A;  3AEA A;  3KLJ A;  5HY5 A;  1SEZ A;  4EMW A;  3NK0 X;  5IQ1 A;  3NK2 X;  4H4Q A;  1JNZ A;  3GWF A;  1TRB A;  4A65 A;  2W0H A;  2YG6 A;  4Z24 A;  2GMH A;  3C96 A;  4B68 A;  1D7L A;  3VRA A;  4GUV A;  4TLZ A;  1RP0 A;  4U2T A;  4XWZ A;  1D4D A;  5LV9 A;  4EQW A;  2B9X A;  1DJQ A;  4Z2R A;  1CJ2 A;  3Q9T A;  1TYP A;  5FS6 A;  2WDQ A;  4H4X A;  2R45 A;  1GPE A;  2C73 A;  1V59 A;  3CGC A;  4XWR A;  3H8L A;  1OJA A;  4U8K A;  2VRM A;  2OLN A;  3NN6 X;  2O9Z A;  3UTF A;  3RNM A;  4JNQ A;  2GQF A;  1VG9 A;  5KWF A;  3AE6 A;  2WPC A;  1JOA A;  3S61 A;  1KSU A;  1H86 A;  2OLO A;  4C74 A;  4AT2 A;  3FBS A;  3P4Q A;  4H2P A;  3SGL A;  2XLT A;  3Q6J A;  4OPG A;  3V76 A;  4FX9 A;  1NHP A;  1JNR A;  4DSG A;  2E5V A;  3NK1 X;  2OAM A;  2WU2 A;  4BK2 A;  2C65 A;  2UZZ A;  4U8I A;  2X8H A;  2E1M A;  1NEN A;  2YM2 A;  2QCU A;  2YR4 A;  4K2X A;  1KF6 A;  1QJD A;  3AYL A;  1CC2 A;  1LTX R;  2WP9 A;  1MO9 A;  2YLT A;  3P9U A;  3KA7 A;  4YXD A;  4CY8 A;  1ZP0 A;  3PO7 A;  2GR1 A;  3GRS A;  3NH3 X;  4RG3 A;  3V3O A;  1BKW A;  4CBQ A;  2APG A;  3ISH A;  4JDR A;  1ZOV A;  2X8C A;  1IUT A;  2B76 A;  1KFY A;  1PS9 A;  3F8R A;  2GF3 A;  4CCR A;  3LJP A;  2IID A;  4UDP A;  1LVL A;  3DGZ A;  4NEW A;  3E1T A;  2XLR A;  5JCI A;  3CIR A;  2GR0 A;  3UKF A;  1IUV A;  1VRQ B;  2XCG A;  2YR5 A;  2V60 A;  3D1C A;  4A99 A;  1NDA A;  3AED A;  4U8N A;  4IV9 A;  2ZZ0 A;  2OAL A;  4Y4M A;  5HHF A;  4LII A;  2BC1 A;  1IUU A;  5M10 A;  3G5S A;  2RGO A;  3P4S A;  4RG4 A;  2BA9 A;  1DXL A;  3AE4 A;  3UKK A;  2JAE A;  1PJ6 A;  4E0V A;  2EQ6 A;  5HYM A;  3M0O A;  2BCG G;  3B6D A;  4Z25 A;  1XHC A;  5JCK A;  4H4S A;  3QSM A;  4DSH A;  3BI4 A;  5IPY A;  2YG3 A;  4A5L A;  5FS7 A;  3IWA A;  4N9X A;  3UOZ A;  3ZDN A;  1NHS A;  2BC0 A;  2A87 A;  3AD9 B;  2AR8 A;  3ATR A;  3G5R A;  3NYE A;  2GMJ A;  1XPQ A;  3ITJ A;  3F8P A;  1GRF A;  4LU6 A;  1M64 A;  2EQ7 A;  5FS8 A;  5J60 A;  1BGN A;  5KOW A;  3IHG A;  3QFB A;  3M12 A;  3HZL A;  3GYI A;  3FPZ A;  3NN0 X;  2YVF A;  1DOE A;  1E7P A;  1FL2 A;  2AQJ A;  3NKS A;  2HQM A;  1ZKQ A;  4FDC B;  1VG0 A;  2FJE A;  4BJZ A;  5CQF A;  4OPU A;  2VVL A;  4FK1 C;  3K7Q X;  3K30 A;  1QLB A;  2C70 A;  2V6O A;  5BUK A;  4OPD A;  1D4E A;  2B7S A;  2XDO A;  4Z2U A;  3BI5 A;  4AP3 A;  2C3D A;  2XYO A;  1E1M A;  4MJW A;  5KRQ A;  3ADA B;  1MXT A;  2XLU A;  1CJ4 A;  1GAL A;  3C4N A;  3KKJ A;  3RP8 A;  1GT8 A;  1OJT A;  1GXF A;  1ONF A;  2BYB A;  4IVM B;  2Q6U A;  2ZZB A;  1PDH A;  3LZW A;  3P4P A;  1B4V A;  2WOV A;  1GRE A;  3NTD A;  1GES A;  2BS4 A;  1O94 A;  1PN0 A;  2WPE A;  2R0G A;  4U8P A;  1S2Y A;  3UKL A;  3ATQ A;  4ZCD A;  4H4Y A;  2WOW A;  2C72 A;  2E4G A;  5GRT A;  1PBE A;  2IVD A;  2XVI A;  3ALJ A;  1L9E A;  2FJA A;  2XVJ A;  3LOV A;  4U8J A;  1P2H A;  5EOW A;  2Z5X A;  3PVC A;  2YG4 A;  3UKP A;  1PBB A;  5JCN A;  4YSZ A;  2BK3 A;  2CUL A;  4J33 A;  1ZDL A;  2C3C A;  4YTM A;  1N4W A;  1PXA A;  2WP5 A;  2YWL A;  4H2R A;  1ZMD A;  4A9W A;  3AE1 A;  2WS3 A;  5M0Z A;  1D7Y A;  2Q7V A;  3LB8 A;  4OPT A;  4B63 A;  4K8D A;  1YQ3 A;  3IHM A;  4C77 A;  1LV0 A;  2V5Z A;  3NTA A;  1H81 A;  4GRT A;  1RYI A;  2VQ7 A;  1YQ4 A;  4GDP A;  3AYI A;  3ICT A;  3VR8 A;  5KXJ A;  3AEC A;  3UP5 A;  1ZY8 A;  1L9D A;  3SQP A;  3ABV A;  1CC4 A;  4U8M A;  2YLS A;  2V3B A;  3II4 A;  2V3A A;  3KVE A;  1XDI A;  1L0V A;  3UKQ A;  1NAA A;  2B7R A;  1LQU A;  1EL5 A;  1MOK A;  2GR3 A;  1E1L A;  3CN8 A;  2XVF A;  2F5Z A;  4GF7 A;  1K0L A;  2QA2 A;  2RAB A;  1B5Q A;  1NEK A;  3NGC X;  2ARD A;  3GYJ A;  4O5Q A;  3OC4 A;  2ACZ A;  4OPL A;  4CNJ A;  1Q1W A;  4WCT A;  4DGK A;  1PBD A;  1GRB A;  3EPT A;  3ALL A;  4U2S A;  1F8W A;  5GSN A;  2DKI A;  1JEH A;  4C3X A;  3L8K A;  4K5S A;  2Z5Y A;  1O5W A;  3IF9 A;  3S5W A;  2Q0L A;  4H7U A;  3AXB A;  2H89 A;  4Z44 A;  1S3E A;  5ER0 A;  3QJ4 A;  4GDE A;  2YG5 A;  2R46 A;  5JCL A;  1X31 B;  3DH9 A;  1S3B A;  2BXS A;  3AB1 A;  4TM4 A;  2BXR A;  2YQU A;  1LQT A;  2X3N A;  2B9W A;  4EQX A;  3SFD A;  2XLP A;  3UKH A;  2RGJ A;  3NHO X;  2BS2 A;  2BK5 A;  4HB9 A;  4J2W A;  2YLX A;  1XAN A;  1YKJ A;  2WU5 A;  4B66 A;  1O95 A;  4H2Q A;  1IUW A;  1F6M A;  3DK8 A;  2YAU A;  3RED A;  1D5T A;  1E1K A;  1M6I A;  3ICS A;  1GRG A;  2XFO A;  3UTE A;  1K0I A;  3CNP A;  3AEF A;  2FJD A;  4AP1 A;  5C2T A;  2WES A;  2YR6 A;  3AWI A;  4PAB A;  2WDR A;  3O0H A;  1LJ1 A;  1NG4 A;  3AD7 B;  4NTD A;  4CCQ A;  3GWD A;  4AOS A;  3ICR A;  1NHQ A;  1Y56 B;  3NT6 A;  3I6D A;  4JQ9 A;  4DNA A;  4HA6 A;  1GER A;  2GAG B;  4B1B A;  5BVA A;  3CGE A;  2WQY A;  3UOY A;  3VRD B;  1GOS A;  3KPF A;  4KX6 A;  3P4R A;  2XFP A;  3CNJ A;  3DJD A;  4BUR A;  1GV4 A;  2CFY A;  3F8D A;  1JRX A;  3CPH G;  4IA6 A;  4UDQ A;  4EMI A;  3UOV A;  5U25 A;  5FMH A;  3DJE A;  4USQ A;  1K0J A;  2Q0K A;  3LZX A;  1JU2 A;  1KNP A;  3GMC A;  1H6V A;  1REO A;  1TDK A;  4ADW A;  3KU9 A;  1VDC A;  1OJD A;  2GH5 A;  4K5R A;  3CGB A;  4J31 A;  4X4J A;  4YTP A;  3AEG A;  3RHA A;  3BI2 A;  4BK1 A;  1DNC A;  3GD3 A;  2WOI A;  2PYX A;  3AYJ A;  1FCD A;  3VR9 A;  2FJB A;  3GD4 A;  3AD8 B;  1N4V A;  1P2E A;  2Y6Q A;  3M13 A;  5L46 A;  1H7W A;  2RGH A;  1PXB A;  2GAH B;  4I59 A;  1OJ9 A;  3WE0 A;  1GEU A;  2PHH A;  4JNA A;  3C4A A;  4JY3 A;  1TYT A;  4NEV A;  3URH A;  1CF3 A;  1PBC A;  2NVK X;  3COX A;  3FIM B;  3GMB A;  3UP4 A;  2YVG A;  2JB1 A;  3LXD A;  4IA5 A;  4A6N B;  1F8R A;  3GDN A;  1BZL A;  3EAO A;  5IQ4 A;  4KPR A;  2H88 A;  1B8S A;  1IUX A;  3LAD A;  1KSS A;  3CND A;  3H8I A;  1RSG A;  4IVO B;  2R4E A;  1EL7 A;  3CNT A;  2C76 A;  1Q9I A;  4EQS A;  1PBF A;  1ZX9 A;  1TDN A;  3NRN A;  4YTN A;  4YKG A;  4REK A;  1AOG A;  3UTG A;  3R9U A;  4J56 A;  2J3N A;  2FBW A;  1ZK7 A;  3L1R A;  4NTE A;  1ELI A;  4BV6 A;  1N1P A;  1DOB A;  1DOD A;  2I0Z A;  1JRY A;  2ZBW A;  1NG3 A;  1H83 A;  4CY6 A;  2R0C A;  4ECH A;  3NNE A;  3FMW A;  3JSK A;  3QVR A;  3UTH A;  1DOC A;  4AT0 A;  2TPR A;  1GND A;  2GV8 A;  3CTY A;  3QSS A;  3IC9 A;  2GR2 A;  1QO8 A;  2GRT A;  1PHH A;  2JB2 A;  4TLX A;  2JBV A;  3AEB A;  1PJ5 A;  2YG7 A;  4UDR A;  1BGJ A;  4JY2 A;  1F3P A;  5TR3 A;  3H4K A;  4H4W A;  2JK6 A;  2VVL G;  3KD9 A;  2CVJ A;  4K7Z A;  3BHF A;  3AE8 A;  3PS9 A;  5KVI A;  4J34 A;  3VRB A;  3OZ2 A;  2YLZ A;  4C5O A;  1K4Q A;  1GRH A;  1NHR A;  1B37 A;  2X99 A;  1BF3 A;  3QFA A;  2B9Y A;  4ICY A;  4JN9 A;  4P9S A;  2WHD A;  2ZZC A;  3K7M X;  2XFN A;  3EF6 A;  1EL9 A;  1EBD A;  4FK1 A;  5HXI A;  3SM8 A;  5EB5 A;  3P1W A;  2WEU A;  4C3Y A;  1FEC A;  3RP7 A;  4YWO A;  2A8X A;  4BJY A;  1HYU A;  1PJ7 A;  4B64 A;  1L9C A;  3QSE A;  2BAC A;  1GRA A;  5CKU A;  1FEA A;  5FS9 A;  1Y56 A;  1GSN A;  3GRT A;  2GVC A;  2XVE A;  4K22 A;  4CNK A;  2BCP A;  1YQZ A;  4ZCC A;  4Y4L A;  3RP6 A;  2CDU A;  2YLW A;  4J36 A;  1CBO A;  5JCM A;  1CHU A;  1E1N A;  4BK3 A;  4H4T A;  5KVH A;  3GDP A;  2VQB A;  2WPF A;  1FEB A;  1UKV G;  3UCL A;  4GR1 A;  3AE7 A;  4U8O A;  2BS3 A;  4RSL A;  1CC6 A;  1EL8 A;  2QAE A;  3I3L A;  1GTE A;  5U1O A;  4M52 A;  4OVI A;  3BHK A;  2WET A;  2XFU A;  2YVJ A;  2VZ2 A;  1KDG A;  3DK4 A;  3UKA A;  2NPX A;  5U63 A;  4Z2T A;  4USR A;  3NLC A;  2XLS A;  4TM3 A;  4I58 A;  4AOX A;  1N4U A;  2DKH A;  1OJC A;  4B65 A;  3EAN A;  3QVP A;  4OCG A;  3AE2 A;  5C3J A;  1BWC A;  3SFE A;  4PAA A;  2WP6 A;  1GET A;  2WDV A;  1Y0P A;  2GB0 A;  4NZH A;  1H7X A;  3VQR A;  1IJH A;  1E6E A;  1W4X A;  1DJN A;  3DK9 A;  2BK4 A;  2R0P A;  3DJG X;  2IVE A;  2C75 A;  2R9Z A;  1Q1R A;  4B67 A;  2R4J A;  1H82 A;  2XVH A;  2C64 A;  1IUS A;  4OPI A;  2GQW A;  1Z6L A;  4B69 A;  4A6N A;  4H2N A;  5KOX A;  3CPJ G;  2VRL A;  4H4Z A;  2OA1 A;  2JKC A;  3BNU A;  1TDF A;  4ZN0 A;  2BAB A;  4EIP A;  4A79 A;  1E39 A;  1FOH A;  3NIX A;  4LA1 A;  1ZOY A;  2TMD A;  2XFQ A;  2Y6R A;  3AE3 A;  4UP3 A;  3ZYX A;  1YY5 A;  2V61 A;  4J57 A;  4D03 A;  3GSI A;  4X9M A;  3K7T A;  1NPX A;  3NG7 X;  5DBJ A;  3NYF A;  4D04 A;  5EB4 A;  1COY A;  4NTC A;  4TM1 A;  1D4C A;  4Y4N A;  4YSY A;  4A7A A;  1CL0 A; 
#chains in the Genus database with same CATH topology
 3CB3 A;  4Z26 A;  4E4F A;  4HN8 A;  5BUL A;  3K1G A;  3SN1 A;  2QA1 A;  2YM1 A;  4XXG A;  3DER A;  2VOU A;  3ALM A;  4HNL A;  4H50 A;  3AE9 A;  4A35 A;  3P3B A;  4YSH A;  2GGH A;  3R11 A;  4YSX A;  2YLR A;  3DGH A;  1PDY A;  4TVY A;  2X8G A;  4H4P A;  3HYV A;  3NZG A;  1N5W C;  4APN A;  3H12 A;  3R0K A;  3G5Q A;  3FG2 P;  3B9J B;  3PG6 A;  5KMR A;  4TM0 A;  3AEA A;  1JNZ A;  1TRB A;  2YG6 A;  2GMH A;  3C96 A;  4B68 A;  1D7L A;  4GUV A;  4TLZ A;  4EQW A;  2PGW A;  3OZY A;  3Q9T A;  1TYP A;  3NXL A;  5FS6 A;  2WDQ A;  1W6T A;  1GPE A;  2C73 A;  1V59 A;  4U8K A;  3N6J A;  2O9Z A;  4JNQ A;  1KKO A;  3AE6 A;  3GY1 A;  4AT2 A;  5FJP A;  3Q6J A;  3V76 A;  1NHP A;  4DSG A;  2E5V A;  2PTZ A;  2OAM A;  2C65 A;  2X8H A;  2E1M A;  1KF6 A;  4YXD A;  2QQ6 A;  1ZP0 A;  3PO7 A;  4RG3 A;  1BKW A;  4CBQ A;  2APG A;  1PS9 A;  2IID A;  4UDP A;  3E1T A;  3PK7 A;  3UKF A;  1VRQ B;  2E3T A;  3AED A;  4U8N A;  2ZZ0 A;  1IUU A;  3G5S A;  3DEQ A;  2JAE A;  3R25 A;  1VQZ A;  3M0O A;  2BCG G;  3NVY B;  5JCK A;  4H4S A;  1P48 A;  3BI4 A;  4A5L A;  3S5S A;  4N9X A;  3UOZ A;  2AR8 A;  2GMJ A;  3ITJ A;  1NU5 A;  5J60 A;  3IHG A;  3NN0 X;  2YVF A;  1E7P A;  1ZKQ A;  1VG0 A;  2FJE A;  3K7Q X;  3K30 A;  4OPD A;  2POD A;  2QJM A;  5KRQ A;  1MXT A;  2XLU A;  4KT2 A;  2MUC A;  1OJT A;  1ONF A;  3P4P A;  2WOV A;  1GRE A;  2OLA A;  4Z17 A;  4H4Y A;  2WOW A;  3NS1 B;  2IVD A;  2XVI A;  4U8J A;  2Z5X A;  1PBB A;  5JCN A;  3DIP A;  1YQ3 A;  3NVZ B;  4IT1 A;  4GDP A;  5FJT A;  1CC4 A;  3DG7 A;  3IJQ A;  3II4 A;  1JRP A;  1E1L A;  2XVF A;  3MKC A;  1K0L A;  3NGC X;  2RAB A;  2XH7 A;  1B5Q A;  2ACZ A;  4DGK A;  3A7R A;  4U2S A;  1F8W A;  5GSN A;  2DKI A;  2Z5Y A;  1O5W A;  3IF9 A;  3UJE A;  2Q0L A;  4H7U A;  3CAW A;  3AXB A;  4X2P A;  4Z44 A;  1DTN A;  2PTY A;  3QJ4 A;  4GDE A;  2YG5 A;  3SSZ A;  3VFC A;  3V5C A;  2BXS A;  4TM4 A;  2BXR A;  2X3N A;  1LQT A;  4DYE A;  4GYP C;  2RGJ A;  2XGZ A;  2YLX A;  3VA8 A;  3SBF A;  1IUW A;  1D5T A;  1E1K A;  2CHR A;  1K0I A;  2QDD A;  3AWI A;  3AMZ A;  4PAB A;  1JPD X;  2OPJ A;  3O0H A;  4CCQ A;  3RR1 A;  4NNJ A;  3GWD A;  1Y56 B;  3NT6 A;  4JQ9 A;  4DNA A;  4MGG A;  3R10 A;  4KX6 A;  4BUR A;  2CFY A;  4IA6 A;  4UDQ A;  3U9I A;  4EMI A;  3DJE A;  3LZX A;  2XH0 A;  1REO A;  3KU9 A;  4J31 A;  3TTE A;  4YTP A;  1DNC A;  1EBH A;  3AD8 B;  1SJA A;  3UJS A;  1X2G A;  1PXB A;  2E5A A;  4I59 A;  3H70 A;  3WE0 A;  4JY3 A;  2NVK X;  2OZ3 A;  1EC7 A;  1WUE A;  1BZL A;  4M6U A;  1MDR A;  2RDX A;  2C76 A;  1Q9I A;  1PBF A;  3NRN A;  1TDN A;  3R9U A;  4J56 A;  1MDL A;  3L1R A;  1R0M A;  4K1W A;  4BV6 A;  2FKP A;  2ZBW A;  3NNE A;  3FMW A;  2TPR A;  3CTY A;  2GRT A;  1PJ5 A;  2YG7 A;  1F3P A;  2MNR A;  3H4K A;  2CVJ A;  5KVI A;  1NHR A;  1B37 A;  2B9Y A;  3QFA A;  4G7F A;  1EBD A;  4FK1 A;  3SM8 A;  3RO6 A;  4GGH A;  2A8X A;  2ZC8 A;  3P0W A;  3QSE A;  1GRA A;  1FEA A;  1Y56 A;  2XVE A;  2BCP A;  4GGB A;  2CDU A;  4J36 A;  5FJU A;  4G8T A;  4E6M A;  2I5Q A;  1CC6 A;  2XFU A;  3SZF A;  1KDG A;  5U63 A;  1KD0 A;  3NLC A;  4I58 A;  4B65 A;  3CXO A;  3AE2 A;  3SZC A;  3A7A A;  1GET A;  3VQR A;  1H7X A;  3D46 A;  1E6E A;  3UXK A;  1ELS A;  2C75 A;  2R4J A;  3EKG A;  3CPJ G;  3BNU A;  1TDF A;  1E39 A;  4LA1 A;  3K7T A;  1NPX A;  4A7A A;  1CL0 A;  1S2Q A;  1TDO A;  3DDM A;  3DME A;  3UGV A;  1TDE A;  2ONE A;  4YKF A;  1E9I A;  3T37 A;  1GTH A;  3CXB A;  3D8X A;  1R6W A;  2PS2 A;  5EBK A;  4EMJ A;  3HPF A;  2X50 A;  2WBA A;  3L5O A;  2C7G A;  4OPC A;  3CK5 A;  4ROP A;  3AE5 A;  3DA1 A;  1GRT A;  2C67 A;  4Z43 A;  3CT2 A;  3GWF A;  4A65 A;  4Z24 A;  4F4R A;  4IP4 A;  1DJQ A;  4Z2R A;  4JHM A;  2R45 A;  3CGC A;  4XWR A;  1RM6 B;  1XPY A;  2VRM A;  2OLN A;  1VG9 A;  5KWF A;  3S61 A;  1KSU A;  2OLO A;  3FBS A;  2DW7 A;  3P4Q A;  4DN1 A;  4K8G A;  1JPM A;  3NK1 X;  2UZZ A;  2QJJ A;  2YM2 A;  2WP9 A;  4CY8 A;  2GR1 A;  3UJR A;  3ISH A;  4JDR A;  3THU A;  2X8C A;  3VDG A;  3F8R A;  4CCR A;  2PP3 A;  3DGZ A;  5JCI A;  3DGB A;  1IUV A;  2YR5 A;  2V60 A;  4A99 A;  2QJN A;  3D9X A;  2OAL A;  2OX4 A;  4ZOH B;  4LII A;  4HYR A;  4RG4 A;  3UKK A;  3HYW A;  5HYM A;  3HYX A;  4Z25 A;  3OTR A;  2YG3 A;  3IWA A;  1JCT A;  2BC0 A;  4KEM A;  3AD9 B;  3ATR A;  1XPQ A;  2BRY A;  4LU6 A;  3ES7 A;  1M64 A;  2EQ7 A;  1BGN A;  1L8P A;  1FL2 A;  2AQJ A;  3R07 C;  4FK1 C;  4DWD A;  1D4E A;  4AP3 A;  2XYO A;  4HCL A;  1CJ4 A;  3C4N A;  3KKJ A;  4GYP A;  1GT8 A;  2BYB A;  1PDH A;  1GES A;  1O94 A;  1PN0 A;  2R0G A;  4ZCD A;  4GIR A;  5EOW A;  2FJA A;  3GYX A;  1PXA A;  2YWL A;  4H2R A;  2PP1 A;  1D7Y A;  2W55 A;  3H7V A;  4B63 A;  1LV0 A;  2V5Z A;  3NTA A;  1H81 A;  3ICT A;  3VR8 A;  3UP5 A;  1L9D A;  2OO6 A;  3ABV A;  4U8M A;  2PA6 A;  2V3A A;  3UKQ A;  2B7R A;  1EL5 A;  3CN8 A;  1TE6 A;  1ECQ A;  2QA2 A;  4O5Q A;  1IYX A;  4CNJ A;  1Q1W A;  3EPT A;  3ALL A;  1TZZ A;  3MSY A;  4K5S A;  3FJ4 A;  1S3B A;  3AB1 A;  2XH4 A;  2YQU A;  3UKH A;  1WYG A;  2BS2 A;  4J2W A;  1XAN A;  3FYY A;  2WU5 A;  1O95 A;  3DK8 A;  1M6I A;  2XFO A;  1EC9 A;  3AEF A;  2FJD A;  1FO4 A;  2WES A;  2WDR A;  1LJ1 A;  1NG4 A;  3GC2 A;  3AD7 B;  2GAG B;  5BVA A;  3CGE A;  3VRD B;  4HPN A;  3KPF A;  3P4R A;  3DJD A;  1OEP A;  5U25 A;  1K0J A;  2Q0K A;  1TDK A;  4ADW A;  1VDC A;  3CGB A;  4X4J A;  2XH2 A;  3AEG A;  3BI2 A;  4G6H A;  2WOI A;  3AYJ A;  2FJB A;  1N4V A;  2PCE A;  2Y6Q A;  1H7W A;  1GEU A;  4JNA A;  1PDZ A;  1CF3 A;  1PBC A;  2PU0 A;  1N61 C;  3EAO A;  5FJO A;  2AKM A;  2H88 A;  1IUX A;  1RSG A;  3NVV B;  4EQS A;  5EU9 A;  3UTG A;  3R1Z A;  4NTE A;  3T4W A;  1DOD A;  1JRY A;  4E5T A;  1NG3 A;  3GD6 A;  4ECH A;  2GGE A;  3UTH A;  1DOC A;  1GND A;  2GV8 A;  4JN8 A;  1SJB A;  2JBV A;  4UDR A;  3SQS A;  1SJD A;  4E8G A;  4FI4 A;  2POZ A;  3I4K A;  3AE8 A;  3BHF A;  2W54 A;  3TW9 A;  4C5O A;  4II3 A;  2ZZC A;  2PMQ A;  4J3Z A;  1FEC A;  3RP7 A;  2P0I A;  2PTX A;  4YWO A;  4BJY A;  3IK4 A;  1GSN A;  1STZ A;  4Y4L A;  2YLW A;  1CBO A;  2GL5 A;  5KVH A;  3GDP A;  2WPF A;  1UKV G;  3UCL A;  4GR1 A;  4RSL A;  5U1O A;  3BHK A;  2WET A;  1F9C A;  3UKA A;  2AKZ A;  4USR A;  4TM3 A;  4AOX A;  1N4U A;  1OJC A;  3QPE A;  4OCG A;  5C3J A;  1BWC A;  5G5G B;  3R0U A;  2WP6 A;  3FVD A;  1Y0P A;  4NZH A;  1W4X A;  1DJN A;  4HNC A;  2GQW A;  1Z6L A;  4H2N A;  3JVA A;  2JKC A;  4ZN0 A;  2BAB A;  4EIP A;  3Q45 A;  1FOH A;  3AE3 A;  3RGT A;  2Y6R A;  4UP3 A;  3GSI A;  5DBJ A;  3TOY A;  4D04 A;  1SB3 B;  2OG9 A;  4NTC A;  1D4C A;  4YSY A;  1KN0 A;  4EIQ A;  3DJJ A;  1CJ3 A;  3CNS A;  3QTP A;  4U2L A;  2EQ9 A;  3B3R A;  3H8A A;  1H84 A;  1CJC A;  3N4F A;  2JB3 A;  4X9N A;  3B97 A;  4YT0 A;  3UOX A;  4CRT A;  3BNM A;  4U8L A;  3VCN A;  1PXC A;  1JRZ A;  3CGD A;  3AM9 A;  3KLJ A;  4EMW A;  5IQ1 A;  3NK2 X;  2W0H A;  3OPS A;  3MZN A;  2C4C A;  4U2T A;  4XWZ A;  1D4D A;  2B9X A;  1FIQ B;  1CJ2 A;  3MQT A;  4GME A;  3SY4 A;  2HXT A;  3UTF A;  3RNM A;  2GQF A;  4A3R A;  1JOA A;  4C74 A;  1H86 A;  1KCZ A;  2PPG A;  4H2P A;  3SGL A;  4OPG A;  4FX9 A;  2WU2 A;  4H83 A;  1NEN A;  4K2X A;  2QCU A;  3AYL A;  1CC2 A;  1MO9 A;  2YLT A;  1FFU C;  4H2H A;  1ZOV A;  4IL2 A;  2NQL A;  2GF3 A;  3LJP A;  1LVL A;  4NEW A;  2XLR A;  2GR0 A;  3D1C A;  1NDA A;  4IV9 A;  3SN0 A;  2BC1 A;  3P4S A;  4E0V A;  1PJ6 A;  2EQ6 A;  1ONE A;  3B6D A;  2P3Z A;  5IPY A;  4DSH A;  4TVW A;  1JDF A;  1GRF A;  5FS8 A;  4KPL A;  3M12 A;  3QN3 A;  3GYI A;  1DOE A;  3NKS A;  4FDC B;  1MRA A;  4OPU A;  3BOX A;  2VVL A;  3TJI A;  1QLB A;  2C70 A;  5BUK A;  2B7S A;  3ZVI A;  3D47 A;  3N4E A;  4MJW A;  1YEY A;  1GAL A;  5KMS A;  2Q6U A;  2P8B A;  3OZM A;  2BS4 A;  4U8P A;  1S2Y A;  3UKL A;  3TWB A;  3UJ2 A;  3N6H A;  3SR6 B;  2E4G A;  5GRT A;  4DX3 A;  1PBE A;  4G74 A;  2XVJ A;  1P2H A;  3UKP A;  3PVC A;  2YG4 A;  4YSZ A;  2CUL A;  4J33 A;  1ZDL A;  2C3C A;  4YTM A;  1N4W A;  2WP5 A;  4A9W A;  1ZMD A;  2WS3 A;  2Q7V A;  3LB8 A;  2PU1 A;  2OQH A;  3T14 A;  3OP2 A;  5JRB A;  4GRT A;  1RYI A;  1YQ4 A;  5KXJ A;  4G6G A;  4IL0 A;  1ZY8 A;  2DW6 A;  3IJL A;  3KVE A;  1XDI A;  1NAA A;  4GF7 A;  1XS2 A;  2F5Z A;  1NEK A;  2AL1 A;  2ARD A;  4OPL A;  1MUC A;  3OC4 A;  1PBD A;  2HXU A;  4C3X A;  3EUB 3;  3I6E A;  1S3E A;  4DHG A;  3CYJ A;  2R46 A;  5JCL A;  1X31 B;  4GAV A;  2B9W A;  4EQX A;  3SFD A;  3NHO X;  2BRA A;  3ZLF A;  1YKJ A;  4B66 A;  3VC5 A;  1F6M A;  2YAU A;  1GRG A;  5C2T A;  4AP1 A;  3UCC A;  4NTD A;  4AOS A;  3ICR A;  1NHQ A;  1T3Q C;  3I6D A;  2FYM A;  4B1B A;  3UOY A;  3TWA A;  1GOS A;  2XFP A;  4FP1 A;  3CNJ A;  1GV4 A;  3F8D A;  3CPH G;  3NO1 A;  5FMH A;  1JU2 A;  1KNP A;  3GMC A;  4ZA0 A;  4II2 A;  3DES A;  2GH5 A;  1OJD A;  4K5R A;  1KKR A;  4BK1 A;  2PYX A;  3PFR A;  1MNS A;  1P2E A;  3I6T A;  3M13 A;  5L46 A;  1FHU A;  2RGH A;  3NFU A;  1OJ9 A;  3C4A A;  4IP5 A;  3COX A;  1BKH A;  1NEL A;  4KPR A;  4NWZ A;  3H8I A;  4IVO B;  2R4E A;  2QGY A;  1EL7 A;  3CMM A;  3CNT A;  1ZX9 A;  4YTN A;  4YKG A;  4REK A;  2FBW A;  1ZK7 A;  3T0K A;  2QDE A;  1ELI A;  1N1P A;  2I0Z A;  1H83 A;  4CY6 A;  3JSK A;  3QVR A;  3RIT A;  3IC9 A;  1QO8 A;  1PHH A;  2JB2 A;  4TLX A;  4Z1Y A;  3UCD A;  4JY2 A;  1EC8 A;  5TR3 A;  3DFY A;  3T2K A;  2JK6 A;  3KD9 A;  4K7Z A;  3PS9 A;  3PWI A;  4HCH A;  1GRH A;  4JN9 A;  2X99 A;  4ICY A;  2WHD A;  4G73 A;  1EL9 A;  5HXI A;  5EB5 A;  4C3Y A;  3V4B A;  3TQP A;  3PWG A;  2GVC A;  3GRT A;  1YQZ A;  4ZCC A;  3RCY A;  3SX6 A;  1CHU A;  1E1N A;  4H4T A;  1X2H A;  4U8O A;  2BS3 A;  3I3L A;  2QAE A;  2GDQ A;  3ZLG A;  2VZ2 A;  3DK4 A;  2NPX A;  3T9P A;  4MMW A;  5J04 A;  2GB0 A;  3BSM A;  1IJH A;  4K2S A;  3DK9 A;  2BK4 A;  2R0P A;  3DJG X;  3HW2 A;  2R9Z A;  4DXK A;  2GGJ A;  1IUS A;  4B69 A;  2OVL A;  3A7U A;  1ZXI C;  4A79 A;  3NIX A;  1ZOY A;  2TMD A;  4H1Z A;  1YY5 A;  4D03 A;  4X9M A;  3OW1 A;  3NYF A;  2OQY A;  4TM1 A;  1VQW A;  1WUF A;  1LPF A;  4GCM A;  2AL2 B;  4H4R A;  1N5X A;  1VDV A;  2VVM A;  4EM4 A;  4EQR A;  2C66 A;  5G5H B;  2OFJ A;  3AEE A;  5J7X A;  2GEW A;  4WX1 A;  5BRT A;  3JW7 A;  1KNR A;  2AAQ A;  4ENL A;  3NYC A;  4EM3 A;  1ZMC A;  4H4U A;  3UJF A;  2A89 A;  3P93 A;  1V97 A;  3CPI G;  2EQ8 A;  4H4V A;  1F8S A;  7ENL A;  3V3N A;  4O5U A;  5HY5 A;  1SEZ A;  3T2Z A;  3NK0 X;  4H4Q A;  3T31 A;  3VRA A;  1RP0 A;  3VCC A;  5LV9 A;  4H4X A;  3H8L A;  1OJA A;  2PTW A;  2QVH A;  2OKT A;  3NN6 X;  3FXG A;  3BJS A;  2WPC A;  3JZU A;  2PP0 A;  3DG6 A;  5KMP A;  2XLT A;  1JNR A;  4BK2 A;  4H19 A;  4U8I A;  2YR4 A;  1QJD A;  1BQG A;  1LTX R;  3P9U A;  3KA7 A;  3GRS A;  3NH3 X;  3V3O A;  1IUT A;  2B76 A;  1KFY A;  3CIR A;  2XCG A;  3T2Y A;  3GO2 A;  5HHF A;  4Y4M A;  5M10 A;  2RGO A;  3RRA A;  2BA9 A;  1DXL A;  3AE4 A;  2P8C A;  1XHC A;  3QSM A;  2HZG A;  5FS7 A;  3ZDN A;  1NHS A;  2A87 A;  2AL2 A;  3G5R A;  3NYE A;  3F8P A;  5KOW A;  3V3W A;  3QFB A;  3HZL A;  3FPZ A;  2HQM A;  4BJZ A;  5CQF A;  2V6O A;  4E4U A;  2XDO A;  4Z2U A;  3BI5 A;  2C3D A;  1E1M A;  3ADA B;  4EWJ A;  3RP8 A;  4G9K A;  1GXF A;  4IVM B;  2ZZB A;  3LZW A;  1B4V A;  3NTD A;  6ENL A;  2WPE A;  2ZAD A;  3ATQ A;  3NRZ B;  3SJN A;  2C72 A;  3ALJ A;  1L9E A;  3LOV A;  3EEZ A;  2BK3 A;  5FJR A;  3MY9 A;  3SYI A;  5BOE A;  3AE1 A;  5M0Z A;  4OPT A;  4K8D A;  1SJC A;  5KNL A;  3IHM A;  4C77 A;  2VQ7 A;  3S47 A;  3AYI A;  3TCS A;  3AEC A;  4A6G A;  3SQP A;  2YLS A;  2V3B A;  4GFI A;  1L0V A;  4JN7 A;  1LQU A;  1MOK A;  2GR3 A;  3GYJ A;  4WCT A;  1GRB A;  2PGE A;  5KMQ A;  3Q4D A;  4ZCW A;  4M0X A;  1JEH A;  3L8K A;  3S5W A;  2H89 A;  5ER0 A;  2GGI A;  3DH9 A;  1RVK A;  5ENL A;  3FCP A;  2XLP A;  2BK5 A;  4HB9 A;  3T6C A;  3U4F A;  3QLD A;  1N62 C;  4H2Q A;  3AN1 A;  3RED A;  3ICS A;  3UTE A;  3CNP A;  3HRD C;  2YR6 A;  1FFV C;  1JRO A;  3KUM A;  3V5F A;  4HA6 A;  1GER A;  3ES8 A;  2O56 A;  2WQY A;  4J1O A;  1JRX A;  4IZG A;  2GGG A;  3UOV A;  3KPK A;  4USQ A;  2W3R A;  1H6V A;  3ZLH A;  2OZT A;  2PSN A;  3RHA A;  3FV9 A;  3ETR B;  3GD3 A;  3DG3 A;  1FCD A;  3VR9 A;  3GD4 A;  3ZVH B;  2GAH B;  2PHH A;  1TYT A;  4NEV A;  3URH A;  3FIM B;  2W3S A;  3GMB A;  1P43 A;  2YVG A;  3UP4 A;  2JB1 A;  3LXD A;  4IA5 A;  4A6N B;  1F8R A;  3GDN A;  5IQ4 A;  2XSX A;  2P88 A;  1B8S A;  3LAD A;  1KSS A;  3CND A;  1AOG A;  2J3N A;  1H2I A;  1DOB A;  4GAP A;  2HNE A;  3MUC A;  2R0C A;  4AT0 A;  3QSS A;  2GR2 A;  3TJ4 A;  3QKE A;  3AEB A;  1BGJ A;  3VC6 A;  5BOF A;  4H4W A;  2VVL G;  4YWS A;  4J34 A;  3VRB A;  3OZ2 A;  2YLZ A;  1K4Q A;  3SXI A;  1BF3 A;  4P9S A;  3K7M X;  2XFN A;  3SN4 A;  3EF6 A;  3NVW B;  3P1W A;  2WEU A;  1EBG A;  1HYU A;  1PJ7 A;  4B64 A;  1L9C A;  2BAC A;  4IHC A;  5CKU A;  5FS9 A;  4CNK A;  4K22 A;  3RP6 A;  5JCM A;  4MKS A;  1N60 C;  4BK3 A;  2VQB A;  1FEB A;  3AE7 A;  1EL8 A;  1GTE A;  4M52 A;  4OVI A;  2YVJ A;  3SZW A;  2OZ8 A;  4Z2T A;  2XLS A;  3SZ0 A;  2DKH A;  3EAN A;  3QVP A;  3UXL A;  1TKK A;  3T8Q A;  3SFE A;  4PAA A;  2WDV A;  3ZVH A;  1N63 C;  4HCD A;  3MWC A;  2IVE A;  1Q1R A;  4B67 A;  3ENL A;  1S7M A;  1H82 A;  2XVH A;  1FHV A;  3IJI A;  2C64 A;  4OPI A;  4KWS A;  4A6N A;  5KOX A;  2VRL A;  4H4Z A;  2OA1 A;  3DFH A;  4GIS A;  2GSH A;  2XFQ A;  3ZYX A;  2V61 A;  4J57 A;  5IDZ A;  3NG7 X;  5EB4 A;  1COY A;  4Y4N A;  3STP A; 
#chains in the Genus database with same CATH homology
 1VQW A;  4Z26 A;  1S2Q A;  1TDO A;  4EIQ A;  1LPF A;  4GCM A;  3DJJ A;  4H4R A;  5BUL A;  1CJ3 A;  3DME A;  2QA1 A;  2YM1 A;  3CNS A;  4XXG A;  2VOU A;  2VVM A;  1TDE A;  3ALM A;  4YKF A;  4U2L A;  4EM4 A;  4H50 A;  4EQR A;  2C66 A;  2EQ9 A;  3T37 A;  1GTH A;  3AE9 A;  3AEE A;  5J7X A;  4YSH A;  2GEW A;  3B3R A;  4WX1 A;  3D8X A;  4YSX A;  2YLR A;  3DGH A;  1H84 A;  5BRT A;  2X8G A;  1CJC A;  4H4P A;  1KNR A;  2AAQ A;  2JB3 A;  5EBK A;  3HYV A;  3NYC A;  4EM3 A;  4X9N A;  1ZMC A;  4H4U A;  4APN A;  3UOX A;  4YT0 A;  2A89 A;  4CRT A;  4EMJ A;  3G5Q A;  3FG2 P;  3CPI G;  2X50 A;  2WBA A;  3L5O A;  2EQ8 A;  2C7G A;  3BNM A;  4H4V A;  4OPC A;  1F8S A;  3AE5 A;  4U8L A;  3PG6 A;  3DA1 A;  1GRT A;  2C67 A;  4Z43 A;  1PXC A;  3V3N A;  5KMR A;  1JRZ A;  3CGD A;  4TM0 A;  4O5U A;  3AEA A;  3KLJ A;  5HY5 A;  1SEZ A;  3T2Z A;  4EMW A;  3NK0 X;  5IQ1 A;  3NK2 X;  4H4Q A;  1JNZ A;  3GWF A;  1TRB A;  4A65 A;  2W0H A;  3T31 A;  2YG6 A;  4Z24 A;  2C4C A;  2GMH A;  3C96 A;  4B68 A;  1D7L A;  3VRA A;  4GUV A;  4TLZ A;  1RP0 A;  4U2T A;  4XWZ A;  1D4D A;  5LV9 A;  4EQW A;  2B9X A;  1DJQ A;  4Z2R A;  1CJ2 A;  3Q9T A;  1TYP A;  5FS6 A;  2WDQ A;  4H4X A;  2R45 A;  1GPE A;  2C73 A;  1V59 A;  3CGC A;  4XWR A;  3H8L A;  1OJA A;  4U8K A;  3SY4 A;  2VRM A;  2OLN A;  3NN6 X;  2O9Z A;  3UTF A;  3RNM A;  4JNQ A;  2GQF A;  1VG9 A;  5KWF A;  3AE6 A;  2WPC A;  1JOA A;  3S61 A;  1KSU A;  1H86 A;  2OLO A;  4C74 A;  4AT2 A;  3FBS A;  3P4Q A;  4H2P A;  3SGL A;  2XLT A;  3Q6J A;  4OPG A;  3V76 A;  4FX9 A;  5KMP A;  1NHP A;  1JNR A;  4DSG A;  2E5V A;  3NK1 X;  2OAM A;  2WU2 A;  4BK2 A;  2C65 A;  2UZZ A;  4U8I A;  2X8H A;  2E1M A;  1NEN A;  2YM2 A;  2QCU A;  2YR4 A;  4K2X A;  1KF6 A;  1QJD A;  3AYL A;  1CC2 A;  1LTX R;  2WP9 A;  1MO9 A;  2YLT A;  3P9U A;  3KA7 A;  4YXD A;  4CY8 A;  1ZP0 A;  3PO7 A;  2GR1 A;  3GRS A;  3NH3 X;  4RG3 A;  3V3O A;  1BKW A;  4CBQ A;  2APG A;  3ISH A;  4JDR A;  1ZOV A;  2X8C A;  1IUT A;  2B76 A;  1KFY A;  1PS9 A;  3F8R A;  2GF3 A;  4CCR A;  3LJP A;  2IID A;  4UDP A;  1LVL A;  3DGZ A;  4NEW A;  3E1T A;  2XLR A;  5JCI A;  3CIR A;  2GR0 A;  3UKF A;  1IUV A;  1VRQ B;  2XCG A;  3T2Y A;  2YR5 A;  2V60 A;  3D1C A;  4A99 A;  1NDA A;  3AED A;  3D9X A;  4IV9 A;  2ZZ0 A;  2OAL A;  4U8N A;  4Y4M A;  5HHF A;  4LII A;  2BC1 A;  1IUU A;  5M10 A;  3G5S A;  2RGO A;  3P4S A;  4RG4 A;  2BA9 A;  1DXL A;  3AE4 A;  3HYW A;  2JAE A;  1PJ6 A;  3UKK A;  4E0V A;  2EQ6 A;  5HYM A;  3M0O A;  2BCG G;  3B6D A;  3HYX A;  4Z25 A;  1XHC A;  5JCK A;  4H4S A;  3QSM A;  4DSH A;  3BI4 A;  5IPY A;  2YG3 A;  4A5L A;  5FS7 A;  3IWA A;  4N9X A;  3UOZ A;  3ZDN A;  1NHS A;  2BC0 A;  2A87 A;  3AD9 B;  2AR8 A;  3ATR A;  3G5R A;  3NYE A;  2GMJ A;  1XPQ A;  3ITJ A;  2BRY A;  3F8P A;  1GRF A;  4LU6 A;  1M64 A;  2EQ7 A;  5FS8 A;  5J60 A;  1BGN A;  5KOW A;  3IHG A;  3QFB A;  3M12 A;  3HZL A;  3GYI A;  3FPZ A;  3NN0 X;  2YVF A;  1DOE A;  1E7P A;  1FL2 A;  2AQJ A;  3NKS A;  2HQM A;  1ZKQ A;  4FDC B;  1VG0 A;  2FJE A;  4BJZ A;  5CQF A;  4OPU A;  2VVL A;  4FK1 C;  3K7Q X;  3K30 A;  1QLB A;  2C70 A;  2V6O A;  5BUK A;  4OPD A;  1D4E A;  2B7S A;  2XDO A;  4Z2U A;  3BI5 A;  4AP3 A;  2C3D A;  2XYO A;  1E1M A;  4MJW A;  5KRQ A;  3ADA B;  1MXT A;  2XLU A;  1CJ4 A;  1GAL A;  3C4N A;  3KKJ A;  3RP8 A;  5KMS A;  4G9K A;  1GT8 A;  1OJT A;  1GXF A;  1ONF A;  2BYB A;  4IVM B;  2Q6U A;  2ZZB A;  1PDH A;  3LZW A;  3P4P A;  1B4V A;  2WOV A;  1GRE A;  3NTD A;  1GES A;  2BS4 A;  1O94 A;  1PN0 A;  2WPE A;  2R0G A;  4U8P A;  1S2Y A;  3UKL A;  3ATQ A;  4ZCD A;  4H4Y A;  2WOW A;  2C72 A;  2E4G A;  5GRT A;  1PBE A;  2IVD A;  2XVI A;  3ALJ A;  1L9E A;  2FJA A;  2XVJ A;  3LOV A;  4G74 A;  1P2H A;  4U8J A;  2Z5X A;  3GYX A;  2YG4 A;  3PVC A;  3UKP A;  1PBB A;  5JCN A;  4YSZ A;  2BK3 A;  2CUL A;  4J33 A;  1ZDL A;  2C3C A;  4YTM A;  1N4W A;  1PXA A;  2WP5 A;  2YWL A;  4H2R A;  1ZMD A;  3SYI A;  3AE1 A;  2WS3 A;  4A9W A;  5M0Z A;  1D7Y A;  2Q7V A;  3LB8 A;  4OPT A;  4B63 A;  4K8D A;  1YQ3 A;  5KNL A;  3IHM A;  4C77 A;  1LV0 A;  2V5Z A;  3NTA A;  3T14 A;  5JRB A;  1H81 A;  4GRT A;  1RYI A;  2VQ7 A;  1YQ4 A;  4GDP A;  3AYI A;  3ICT A;  3VR8 A;  5KXJ A;  4G6G A;  3AEC A;  3UP5 A;  1ZY8 A;  1L9D A;  3SQP A;  3ABV A;  1CC4 A;  4U8M A;  2YLS A;  2V3B A;  3II4 A;  2V3A A;  3KVE A;  1XDI A;  1L0V A;  3UKQ A;  1NAA A;  2B7R A;  1LQU A;  1EL5 A;  1MOK A;  2GR3 A;  1E1L A;  3CN8 A;  2XVF A;  2F5Z A;  4GF7 A;  1K0L A;  2QA2 A;  2RAB A;  1B5Q A;  1NEK A;  3NGC X;  2ARD A;  3GYJ A;  4O5Q A;  3OC4 A;  2ACZ A;  4OPL A;  4CNJ A;  1Q1W A;  4WCT A;  4DGK A;  1PBD A;  1GRB A;  3EPT A;  3ALL A;  4U2S A;  5KMQ A;  1F8W A;  5GSN A;  2DKI A;  1JEH A;  4C3X A;  3L8K A;  4K5S A;  2Z5Y A;  1O5W A;  3IF9 A;  3S5W A;  2Q0L A;  4H7U A;  3AXB A;  2H89 A;  4Z44 A;  1S3E A;  5ER0 A;  3QJ4 A;  4GDE A;  2YG5 A;  2R46 A;  5JCL A;  1X31 B;  3DH9 A;  1S3B A;  2BXS A;  3AB1 A;  4GAV A;  4TM4 A;  2BXR A;  2YQU A;  1LQT A;  2X3N A;  2B9W A;  4EQX A;  3SFD A;  2XLP A;  3UKH A;  2RGJ A;  3NHO X;  2BRA A;  2BS2 A;  2BK5 A;  4HB9 A;  4J2W A;  2YLX A;  1XAN A;  1YKJ A;  2WU5 A;  4B66 A;  1O95 A;  4H2Q A;  1IUW A;  1F6M A;  3DK8 A;  2YAU A;  3RED A;  1D5T A;  1E1K A;  1M6I A;  3ICS A;  1GRG A;  2XFO A;  3UTE A;  1K0I A;  3CNP A;  3AEF A;  2FJD A;  4AP1 A;  5C2T A;  2WES A;  2YR6 A;  3AWI A;  4PAB A;  2WDR A;  3O0H A;  1LJ1 A;  1NG4 A;  3AD7 B;  4NTD A;  4NNJ A;  4CCQ A;  3GWD A;  4AOS A;  3ICR A;  1NHQ A;  1Y56 B;  3NT6 A;  3I6D A;  4JQ9 A;  4DNA A;  4HA6 A;  1GER A;  2GAG B;  4B1B A;  5BVA A;  3CGE A;  2WQY A;  3UOY A;  3VRD B;  1GOS A;  3KPF A;  4KX6 A;  3P4R A;  2XFP A;  3CNJ A;  3DJD A;  4BUR A;  1GV4 A;  2CFY A;  3F8D A;  1JRX A;  3CPH G;  4IA6 A;  4UDQ A;  5EOW A;  4EMI A;  3UOV A;  5U25 A;  3KPK A;  5FMH A;  3DJE A;  4USQ A;  1K0J A;  2Q0K A;  3LZX A;  1JU2 A;  1KNP A;  3GMC A;  1H6V A;  1REO A;  1TDK A;  4ADW A;  3KU9 A;  1VDC A;  4II2 A;  1OJD A;  2GH5 A;  4K5R A;  3CGB A;  4J31 A;  4X4J A;  4YTP A;  3AEG A;  3RHA A;  3BI2 A;  4G6H A;  4BK1 A;  1DNC A;  3GD3 A;  2WOI A;  2PYX A;  3AYJ A;  1FCD A;  3VR9 A;  2FJB A;  3GD4 A;  3AD8 B;  1N4V A;  1P2E A;  2Y6Q A;  3M13 A;  5L46 A;  1H7W A;  2RGH A;  1PXB A;  2GAH B;  4I59 A;  1OJ9 A;  3WE0 A;  1GEU A;  2PHH A;  4JNA A;  3C4A A;  4JY3 A;  1TYT A;  4NEV A;  3URH A;  1CF3 A;  1PBC A;  2NVK X;  3COX A;  3FIM B;  3GMB A;  3UP4 A;  2YVG A;  2JB1 A;  3LXD A;  4IA5 A;  4A6N B;  1F8R A;  3GDN A;  1BZL A;  3EAO A;  5IQ4 A;  4KPR A;  2H88 A;  4NWZ A;  1B8S A;  1IUX A;  3LAD A;  1KSS A;  3CND A;  3H8I A;  1RSG A;  4IVO B;  2R4E A;  3CMM A;  1EL7 A;  3CNT A;  2C76 A;  1Q9I A;  4EQS A;  1PBF A;  1ZX9 A;  1TDN A;  3NRN A;  4YTN A;  4YKG A;  4REK A;  1AOG A;  3UTG A;  3R9U A;  4J56 A;  2J3N A;  2FBW A;  1ZK7 A;  3L1R A;  1H2I A;  4NTE A;  3T0K A;  1ELI A;  4BV6 A;  1N1P A;  1DOB A;  1DOD A;  4GAP A;  2I0Z A;  1JRY A;  2ZBW A;  1NG3 A;  1H83 A;  4CY6 A;  2R0C A;  4ECH A;  3NNE A;  3FMW A;  3JSK A;  3QVR A;  3UTH A;  1DOC A;  4AT0 A;  2TPR A;  1GND A;  2GV8 A;  3CTY A;  3QSS A;  3IC9 A;  2GR2 A;  1QO8 A;  2GRT A;  3SXI A;  1PHH A;  2JB2 A;  4TLX A;  2JBV A;  3AEB A;  1PJ5 A;  2YG7 A;  4UDR A;  1BGJ A;  4JY2 A;  1F3P A;  5TR3 A;  3T2K A;  3H4K A;  4H4W A;  2JK6 A;  2VVL G;  3KD9 A;  2CVJ A;  4K7Z A;  3BHF A;  3AE8 A;  3PS9 A;  5KVI A;  4J34 A;  3VRB A;  3OZ2 A;  2YLZ A;  4C5O A;  1K4Q A;  1GRH A;  1NHR A;  1B37 A;  2X99 A;  1BF3 A;  3QFA A;  2B9Y A;  4ICY A;  4JN9 A;  4II3 A;  2WHD A;  4P9S A;  2ZZC A;  3K7M X;  2XFN A;  4G73 A;  3EF6 A;  1EL9 A;  1EBD A;  4FK1 A;  5HXI A;  3SM8 A;  5EB5 A;  3P1W A;  2WEU A;  4C3Y A;  1FEC A;  3RP7 A;  4YWO A;  2A8X A;  4BJY A;  1HYU A;  1PJ7 A;  4B64 A;  1L9C A;  3QSE A;  2BAC A;  1GRA A;  5CKU A;  1FEA A;  5FS9 A;  1Y56 A;  1GSN A;  3GRT A;  2GVC A;  2XVE A;  4K22 A;  4CNK A;  2BCP A;  1YQZ A;  4ZCC A;  4Y4L A;  3SX6 A;  3RP6 A;  2CDU A;  2YLW A;  4J36 A;  1CBO A;  5JCM A;  1CHU A;  1E1N A;  4BK3 A;  4H4T A;  5KVH A;  3GDP A;  2VQB A;  2WPF A;  1FEB A;  1UKV G;  3UCL A;  4GR1 A;  3AE7 A;  4U8O A;  2BS3 A;  4RSL A;  1CC6 A;  1EL8 A;  2QAE A;  3I3L A;  1GTE A;  5U1O A;  4M52 A;  4OVI A;  3BHK A;  2WET A;  2XFU A;  2YVJ A;  2VZ2 A;  3SZF A;  1KDG A;  3DK4 A;  3SZW A;  3UKA A;  2NPX A;  5U63 A;  4Z2T A;  4USR A;  3NLC A;  2XLS A;  4TM3 A;  3SZ0 A;  4I58 A;  4AOX A;  1N4U A;  2DKH A;  1OJC A;  4B65 A;  3EAN A;  3QVP A;  4OCG A;  3AE2 A;  5C3J A;  1BWC A;  3SFE A;  3SZC A;  4PAA A;  2WP6 A;  1GET A;  2WDV A;  1Y0P A;  2GB0 A;  4NZH A;  1H7X A;  3VQR A;  1IJH A;  1E6E A;  1W4X A;  1DJN A;  3DK9 A;  2BK4 A;  2R0P A;  3DJG X;  2IVE A;  2C75 A;  2R9Z A;  1Q1R A;  4B67 A;  2R4J A;  1S7M A;  1H82 A;  2XVH A;  2C64 A;  1IUS A;  4OPI A;  2GQW A;  1Z6L A;  4B69 A;  4A6N A;  4H2N A;  5KOX A;  3CPJ G;  2VRL A;  4H4Z A;  2OA1 A;  2JKC A;  3BNU A;  1TDF A;  4ZN0 A;  2BAB A;  4EIP A;  4A79 A;  1E39 A;  1FOH A;  3NIX A;  4LA1 A;  1ZOY A;  2TMD A;  2XFQ A;  2Y6R A;  3AE3 A;  4UP3 A;  3ZYX A;  1YY5 A;  2V61 A;  4J57 A;  4D03 A;  3GSI A;  4X9M A;  3K7T A;  1NPX A;  3NG7 X;  5DBJ A;  3NYF A;  4D04 A;  5EB4 A;  1COY A;  4NTC A;  4TM1 A;  1D4C A;  4Y4N A;  4YSY A;  4A7A A;  1CL0 A;  1KN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...