5U1OA

2.3 angstrom resolution crystal structure of glutathione reductase from vibrio parahaemolyticus in complex with fad.
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
450
structure length
450
Chain Sequence
ATHFDYICIGGGSGGIASANRAAMYGAKVALIEAQDLGGTCVNVGCVPKKVMWHGAQIAEAMNLYAEDYGFDVDVKGFDWSKLVESRQAYIGRIHQSYDRVLGNNKVNVIKGFAKFVDEKTVEVNGEHYTADHILIAVGGRPTIPNIPGAEYGIDSNGFFDLAEQPKRVAVVGAGYIAVEIAGVLHALGTETHLFVRKESPLRSFDPMIIDTLVEVMEAEGPTLHTHSVPKEVVKEADGSLTLHLENGESQNVDQLIWAIGRHPATDAINLASTGVATNEKGYIKVDEYQETNVKGIYCVGDIMEGGIELTPVAVKAGRQLSERLFNNKPNAKMDYDLVPTVVFSHPPIGTIGLTTQEAEEKYGKDNIKVYTSGFTAMYTAVTKHRQPCKMKLVCAGEEETVVGLHGIGFTVDEMIQGFGVAMKMGATKADFDSVVAIHPTGSEEFVTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Glutathione reductase
publication title 2.3 Angstrom Resolution Crystal Structure of Glutathione Reductase from Vibrio parahaemolyticus in Complex with FAD.
rcsb
source organism Vibrio parahaemolyticus serotype o3:k6 (strain rimd 2210633)
total genus 146
structure length 450
sequence length 450
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5u1oA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5u1oA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5u1oA02
1JRXA 4IA5A 1F8WA 2YVJA 3DJGX 4A7AA 1CL0A 1GRHA 4OPGA 3CIRA 3NTDA 1TYPA 2CULA 2YM1A 4U8NA 4AOXA 2ZZBA 1L0VA 1K4QA 2V3BA 2X50A 2Q7VA 1H81A 3V76A 2C73A 5KVIA 2RGJA 3AE2A 1SEZA 4OPCA 1GV4A 1CJ2A 3QVRA 3KLJA 4APNA 1Q9IA 2AQJA 1CF3A 2C7GA 1MO9A 3RP7A 3GDNA 3AWIA 3LOVA 4JN9A 4A79A 4A9WA 1IUSA 4B66A 4EQWA 2AR8A 3AEBA 4CNKA 3RP6A 3AECA 1PBBA 2WU5A 3WE0A 5KOWA 1S3EA 2XCGA 3SFDA 4C77A 3GDPA 2WPEA 1TDNA 2R0CA 1TDEA 2EQ9A 3UTGA 5M10A 3NYCA 4Y4MA 5ER0A 1GETA 2QAEA 4J57A 1UKVG 2ZBWA 1BKWA 3RHAA 1CC6A 3EF6A 1O95A 4ICYA 1FECA 3GMBA 2WP6A 1RSGA 3C96A 3NLCA 4K5RA 4U8LA 4H4RA 4EQSA 3M0OA 4JY3A 1F8SA 4WX1A 3ICRA 1YY5A 1D5TA 2YG5A 4YTMA 3AEGA 3BI5A 3FG2P 1D7YA 2X99A 1H86A 3LB8A 1IUVA 2YG4A 3SGLA 1B37A 2XLTA 4YSYA 1PJ6A 4FDCB 2JB2A 3AYJA 2XLUA 1N4UA 4D03A 3QSSA 5BRTA 3ALJA 3K30A 1OJCA 3AXBA 3SM8A 3NN0X 3NYEA 2A89A 2Q6UA 1GRAA 4PABA 4OCGA 4X4JA 1ZOVA 2WU2A 5HY5A 1OJ9A 3FBSA 1TDFA 1YQ4A 2ZZ0A 1KDGA 2VVMA 1LV0A 5TR3A 1DODA 1DJNA 3B3RA 4K8DA 4B68A 2YG3A 4NEVA 1E1MA 4UDQA 4BV6A 2JKCA 3ATQA 3BNUA 3D8XA 2WP5A 4H4QA 5JCMA 2YR4A 2ARDA 1VQWA 4JNQA 5GSNA 4CY6A 2H88A 1ZP0A 2RGHA 4GCMA 3KPFA 4NTEA 4CNJA 2VQBA 1NG4A 1TDKA 3IF9A 3URHA 2C67A 3LJPA 4ZCDA 1QLBA 1P2HA 1PBEA 2X8CA 1F8RA 3NIXA 2GF3A 2IVEA 4H4WA 3BNMA 4A65A 1YQZA 1IUUA 4AT0A 4GUVA 2C70A 2W0HA 1ZKQA 3K7TA 2XDOA 2RGOA 3COXA 1S2YA 2VVLA 3DGZA 2GAGB 1DOCA 2OAMA 3ISHA 4EMJA 1YKJA 2XFUA 3UP5A 4A5LA 3PS9A 3NG7X 2XLPA 5KRQA 4REKA 3AB1A 4H2PA 2RABA 2B7RA 1PXBA 4U2LA 1IUWA 3ICTA 4CCQA 4DNAA 2C65A 2WHDA 4K5SA 4HA6A 4K22A 5JCIA 4H4UA 3GMCA 1VG9A 1NG3A 3QSMA 1GALA 4ZCCA 1CHUA 3AEDA 4JY2A 2J3NA 3I6DA 3BHKA 4Z24A 1JU2A 2UZZA 3ALMA 4RG4A 1IUXA 3L8KA 4KX6A 4MJWA 4Z26A 5L46A 4H4TA 3BI2A 3RP8A 1B4VA 1VRQB 1AOGA 1E1KA 3T37A 3D1CA 3G5QA 2XFOA 4Z44A 2H89A 2JK6A 2YLWA 2A8XA 2AAQA 4GRTA 2A87A 2NVKX 3CPHG 1XHCA 1CJCA 2F5ZA 1NENA 2BABA 3IHGA 4YSXA 2YVFA 1B5QA 1E7PA 3AEEA 3OZ2A 1IJHA 2GR2A 3AD9B 3VR9A 4H4YA 2JB3A 1BWCA 2Y6QA 4A99A 5EBKA 4EM3A 2BACA 4OPTA 1N4WA 4IVMB 4YSZA 4YKFA 3NN6X 3AEFA 3UTFA 5C2TA 3DJDA 2Z5YA 4IA6A 2GEWA 2WP9A 4EQXA 3VR8A 4TM4A 2B9YA 1W4XA 1TDOA 4TM1A 4K2XA 3E1TA 4A6NA 2WBAA 1K0IA 2FJDA 3GD4A 2C76A 4B67A 4EQRA 1GPEA 2PYXA 4ZN0A 1H7XA 1L9DA 3R9UA 2V3AA 4A6NB 1JEHA 3RNMA 1S3BA 4J33A 2I0ZA 1ONFA 1E1LA 2YR6A 1NPXA 1RP0A 3ADAB 2TPRA 1F6MA 5CQFA 4IV9A 3DGHA 4B64A 4AP3A 1JNRA 4NTCA 3ATRA 1KNPA 3CNDA 1DNCA 3UKHA 5CKUA 4H4ZA 4BK3A 1LJ1A 1DOBA 2YVGA 4LA1A 2B9XA 4Y4LA 3VRDB 3VQRA 3AE7A 2BK4A 2ZZCA 4Z43A 2YLZA 5BUKA 4JQ9A 1DOEA 1RYIA 3DK8A 4M52A 1LTXR 2TMDA 2ACZA 3F8RA 3K7QX 2XFNA 1GRFA 4O5UA 1EL5A 2XLRA 3AD7B 1BGNA 2WPFA 4B1BA 3CNJA 1KSSA 4LU6A 2R0PA 3ABVA 5M0ZA 5U63A 2R9ZA 5HYMA 3UP4A 1PDHA 4YTNA 4GDEA 2YG6A 2VZ2A 2FBWA 1N1PA 1O5WA 1ZDLA 4YTPA 2X3NA 1PBFA 2R45A 2V61A 3F8PA 4IVOB 3NK1X 4O5QA 3KA7A 3EANA 2YQUA 4H50A 3ICSA 3Q9TA 2GMJA 4USRA 1OJDA 4U2SA 2WOVA 4WCTA 3SFEA 4C3YA 1GTHA 3G5RA 3CNPA 4LIIA 2E4GA 2CVJA 3M12A 3NK0X 4BURA 4GF7A 4C74A 4OPUA 4H4SA 4B69A 2OALA 4FK1A 3EAOA 5EB4A 1GREA 3UOXA 4N9XA 1KFYA 2GV8A 4J31A 1MOKA 3AE5A 3IWAA 2BXRA 2C75A 4CBQA 5FS7A 3QVPA 1D4CA 2V60A 4KPRA 5JCLA 2B7SA 1HYUA 4BJZA 5HXIA 1EL8A 1Q1WA 3DJJA 4EM4A 4TM0A 4CCRA 5IQ1A 3CGBA 2OLOA 3AYLA 3P4RA 4FK1C 2XFPA 4XWZA 2IVDA 3DJEA 1LVLA 3NT6A 2BC1A 3CPIG 3CTYA 1E6EA 2BXSA 2YLRA 4I58A 4FX9A 3I3LA 1GRGA 3QFBA 2FJBA 3REDA 5IPYA 1Y56A 1H83A 1JRZA 1XDIA 4H2QA 1D4EA 4X9MA 1BF3A 2BYBA 2Q0LA 3GRSA 4BK2A 2XVFA 3F8DA 1H7WA 1K0LA 1P2EA 1Y56B 1GESA 2FJEA 4U8KA 2R4EA 4NEWA 2Q0KA 3P1WA 4PAAA 4U2TA 1NHSA 4TLZA 2X8HA 3NKSA 1FOHA 3DK9A 3DK4A 1QJDA 2WDRA 1ZY8A 3AYIA 1GSNA 2DKHA 4U8OA 3VRBA 4ECHA 4GR1A 4JDRA 3ZYXA 1GRTA 1GERA 4H4PA 2BCPA 2JBVA 3CGEA 1IUTA 3V3NA 2WS3A 2YLXA 1NDAA 2GAHB 2HQMA 2BS2A 2C72A 4U8PA 4P9SA 4EIQA 3JSKA 2EQ8A 4XXGA 1Y0PA 2WOIA 3NNEA 2FJAA 4YKGA 1CC4A 4U8MA 1LQTA 3NRNA 2YLTA 3P4SA 4AT2A 1Z6LA 3UOZA 4D04A 2WOWA 1VDCA 4OPIA 2WQYA 2WDQA 4E0VA 2VQ7A 2E1MA 3KU9A 2R46A 3LZWA 4H7UA 5DBJA 4H2RA 2QA1A 1COYA 2EQ6A 5KXJA 2GR1A 5FS9A 1PBDA 3LADA 4BJYA 5GRTA 1KSUA 2BK5A 3VRAA 3IHMA 3AD8B 3FPZA 4EMWA 1TRBA 1XPQA 4AP1A 5KOXA 2Z5XA 4J34A 4U8JA 4J2WA 1PN0A 2YG7A 4U8IA 3UKPA 2XVJA 3UOYA 2XVHA 1FEBA 5EB5A 4DGKA 1ZOYA 3LXDA 2IIDA 1L9CA 2CFYA 3FIMB 4TM3A 1LPFA 1N4VA 2XFQA 4OPDA 1ZMCA 3SQPA 1EL9A 1ELIA 2GMHA 5HHFA 2WESA 4B63A 2YR5A 5JCNA 4Y4NA 2X8GA 3GD3A 2VOUA 3KVEA 4BK1A 3P4QA 1M6IA 2R4JA 3QFAA 1ZMDA 4I59A 1GEUA 5JCKA 1H84A 4CRTA 1KF6A 1MXTA 1REOA 3UKFA 5KVHA 2Y6RA 1NAAA 4DSGA 2PHHA 3NH3X 3CPJG 4NZHA 2WDVA 4EMIA 1FEAA 1QO8A 3ZDNA 1Q1RA 3CGCA 3C4AA 4OVIA 1S2QA 4H4VA 4YT0A 3UTEA 4C3XA 1E39A 4CY8A 1EL7A 1V59A 4B65A 2WEUA 2XLSA 2GB0A 1GT8A 4RSLA 5BVAA 1O94A 1DJQA 3EPTA 4USQA 5LV9A 3AEAA 1JNZA 3CNSA 3GYJA 3H8LA 3H8IA 1NHQA 3UCLA 2VRMA 3S61A 2BC0A 4YWOA 1L9EA 4X9NA 5BULA 4YSHA 2BCGG 1JRYA 3NK2X 1KNRA 3QSEA 2R0GA 1GXFA 2CDUA 3NYFA 2C3CA 3P4PA 2GRTA 1NHRA 4DSHA 1BZLA 3CN8A 3KKJA 4UP3A 1GRBA 3H4KA 2APGA 2B76A 4UDRA 4XWRA 2BS3A 4ADWA 3UTHA 1K0JA 3DH9A 3AE9A 2GVCA 5J7XA 3DMEA 1GNDA 3NHOX 4H2NA 4YXDA 4JNAA 2QA2A 1B8SA 4RG3A 1D4DA 3AE1A 2B9WA 2DKIA 4EIPA 3UKKA 3NGCX 1CC2A 4Z2UA 2C64A 5KWFA 1CJ4A 1F3PA 1JOAA 2WETA 3M13A 3DA1A 3GYIA 2GQFA 2GQWA 1H82A 1YQ3A 2OLNA 3GSIA 3UKAA 1PHHA 2WPCA 3CGDA 3LZXA 3C4NA 1PXAA 3AE4A 1OJTA 5FS8A 3BHFA 5FS6A 3UOVA 3AE3A 2O9ZA 3GWDA 2XVIA 2GR0A 2YAUA 1PBCA 1DXLA 3UKLA 2V5ZA 1PS9A 1FL2A 2QCUA 3Q6JA 5U1OA 1D7LA 2YWLA 4Z2TA 2YM2A 3ITJA 2GR3A 1M64A 4GDPA 4UDPA 1OJAA 3BI4A 3PVCA 3OC4A 1NHPA 3K7MX 4Z25A 1BGJA 1ZX9A 2E5VA 3P9UA 3NTAA 4H4XA 1VG0A 3GRTA 2C66A 3ALLA 3B6DA 3CNTA 4NTDA 5J60A 2NPXA 1CBOA 3HZLA 2V6OA 1E1NA 2YLSA 5EOWA 1FCDA 1XANA 3G5SA 3PO7A 2BK3A 3QJ4A 1GOSA 3FMWA 2JB1A 3L1RA 3AE8A 4C5OA 4J56A 2VVLG 5C3JA 1LQUA 2EQ7A 4Z2RA 3KD9A 2VRLA 3GWFA 1PJ7A 2XYOA 1ZK7A 3O0HA 2OA1A 4AOSA 5IQ4A 1EBDA 2JAEA 2XVEA 4OPLA 1NEKA 3IC9A 1GTEA 2GH5A 4HB9A 3V3OA 3UKQA 3II4A 5FMHA 4K7ZA 4TLXA 2BS4A 1CJ3A 1PXCA 2BA9A 1PJ5A 4J36A 3AE6A 1TYTA 1H6VA 5U25A 2C3DA 1X31B 3S5WA
chains in the Genus database with same CATH superfamily
4A7AA 3DFHA 1GRHA 3H8AA 1K4QA 5KVIA 2RGJA 1GV4A 2AQJA 2E5AA 1CF3A 3RP7A 4JN9A 2PTWA 4MMWA 4B66A 1JCTA 4EQWA 4CNKA 3AECA 3UJRA 3SFDA 4EWJA 3NFUA 3T2ZA 3KUMA 4GGHA 1BKWA 3UXKA 1CC6A 1O95A 3GMBA 6ENLA 3NLCA 3HYWA 3M0OA 3RITA 2YG5A 1D7YA 1FHVA 1IUVA 4YSYA 1N4UA 4D03A 3OTRA 5BRTA 3QTPA 3NN0X 3NYEA 2A89A 1GRAA 2WU2A 3TQPA 1TDFA 2VVMA 1MRAA 1E1MA 3GDNA 3BNUA 1RVKA 3AN1A 4CY6A 2ARDA 4JNQA 3SZFA 4GCMA 1TZZA 4CNJA 2VQBA 4ZCDA 2GF3A 4A65A 4AT0A 4GUVA 3COXA 2I5QA 2PP3A 2OAMA 3ISHA 3PS9A 1WYGA 4H2PA 2GGJA 2WHDA 4K5SA 1SJAA 4HA6A 4GIRA 4H4UA 4YWSA 1NELA 2J3NA 3BHKA 3L8KA 4E4UA 2JK6A 2H89A 1SJBA 2PP0A 2A87A 3CPHG 2P88A 1XHCA 4YSXA 1E7PA 1IJHA 3TOYA 4H4YA 4A99A 4EM3A 4OPTA 4JN7A 3AEFA 2Z5YA 3R1ZA 4K2XA 3E1TA 2WBAA 3GD4A 2W3RA 1H7XA 2V3AA 3T0KA 1RP0A 3ADAB 1F6MA 5CQFA 2GDQA 4A3RA 3SZCA 4Y4LA 4IHCA 4M52A 3K7QX 3F8RA 5KMPA 3ZLFA 3UCCA 2WPFA 1KSSA 3DESA 4II3A 2FBWA 1O5WA 3DFYA 2X3NA 3F8PA 2R45A 2OPJA 4O5QA 3KA7A 2YQUA 3I4KA 2GMJA 4U2SA 4C3YA 3SFEA 2PTYA 2XH0A 4LIIA 2E4GA 4BURA 4GF7A 3K1GA 1MOKA 2GGEA 3IWAA 4A6GA 4CBQA 5JCLA 2B7SA 3ES7A 3UXLA 5HXIA 1Q1WA 4EM4A 3JVAA 4FK1C 3P4RA 4XWZA 1E6EA 3MSYA 1SJDA 4K1WA 4FX9A 1GRGA 2FJBA 3REDA 1Y56A 1H83A 4KPLA 2PU1A 3B9JB 2DW6A 3F8DA 1H7WA 1K0LA 1Y56B 2BRAA 2FJEA 4U8KA 4PAAA 1N5WC 4Z17A 3NKSA 2WDRA 3ZYXA 1GERA 2JBVA 1IUTA 3AMZA 2YLXA 1NDAA 4U8PA 4P9SA 2EQ8A 4XXGA 1Y0PA 2WOIA 1LQTA 2YLTA 3UJSA 2WDQA 4E0VA 2VQ7A 2E1MA 2R46A 3LZWA 1COYA 2EQ6A 3T8QA 3LADA 2HXTA 3IHMA 3AD8B 1FFVC 4GMEA 2YG7A 3KPKA 2P3ZA 3HRDC 4TM3A 2XFQA 3SQPA 1FO4A 3QKEA 3CK5A 3KVEA 4DX3A 5BOEA 5IDZA 3P4QA 2PSNA 1KF6A 3V5FA 3SN1A 4NZHA 1N62C 1S2QA 4YT0A 3CMMA 1X2HA 3FXGA 3SQSA 2WEUA 2GB0A 3U4FA 3AEAA 2HNEA 1NHQA 3R11A 3UCLA 3Q4DA 3DIPA 3CYJA 1L9EA 4HNCA 5BULA 1JRYA 3NK2X 4DSHA 4FI4A 1GRBA 2APGA 3NRZB 3OW1A 1K0JA 3AE9A 1TKKA 4HCDA 2B9WA 2DKIA 2WETA 1JOAA 3M13A 2WPCA 3C4NA 3S5SA 1OJTA 3AE3A 3GWDA 2MUCA 1RM6B 2QCUA 3Q6JA 1D7LA 2YM2A 1M64A 4UDPA 4HCHA 1OJAA 3BI4A 3VCCA 2OQHA 3OC4A 1ZX9A 1BQGA 1CBOA 3HZLA 2ZADA 3G5SA 3L1RA 2NQLA 5ENLA 2OA1A 4HPNA 1EBDA 4GYPA 3IC9A 3T14A 3PWGA 1H6VA 3AEGA 1X31B 3RO6A 1JRXA 1F8WA 2YVJA 3DJGX 3FJ4A 1TYPA 3UGVA 4U8NA 4MGGA 2ZC8A 2V3BA 2W3SA 3DEQA 2QDDA 3TJ4A 1CJ2A 1JDFA 4APNA 1MO9A 3T4WA 3AWIA 3LOVA 4II2A 1JROA 4A9WA 1IUSA 2AR8A 3RP6A 2WU5A 2WPEA 3EUB3 1TDNA 3UTGA 2P8BA 5M10A 1GETA 4HNLA 3EF6A 3NVYB 4H4RA 3GO2A 2W55A 3ICRA 1H86A 2POZA 3VC5A 1PJ6A 4IL2A 1R0MA 1ZOVA 1YQ4A 2ZZ0A 4B68A 1LV0A 3B3RA 4K8DA 2JKCA 2WP5A 1ZP0A 5KMQA 2RGHA 2CHRA 1NG4A 2C67A 1ECQA 2X8CA 1F8RA 3BNMA 1YQZA 2C70A 3K7TA 1ZKQA 4IP4A 2GL5A 1S2YA 3SBFA 4EMJA 2RDXA 4REKA 5JRBA 2B7RA 1VQZA 4ZCWA 5JCIA 3ZVIA 1NG3A 3QSMA 4ZCCA 3FYYA 1JU2A 2UZZA 1N63C 4RG4A 1IUXA 4MJWA 5L46A 2OG9A 1VRQB 3T37A 3PFRA 1E1KA 3D1CA 3G5QA 4Z44A 3CAWA 2A8XA 2PGWA 1NENA 3AEEA 3OZ2A 2GR2A 3VR9A 2Y6QA 2BACA 4IVMB 5C2TA 4IA6A 2GEWA 4EQXA 1TDOA 4GAPA 1K0IA 4EQRA 4ZN0A 4IL0A 1L9DA 3R9UA 3PK7A 4J33A 3P93A 2I0ZA 3QLDA 1E1LA 3V3WA 3CNDA 1DNCA 1DTNA 3JW7A 4TVYA 3VRDB 3VQRA 2YLZA 4JQ9A 4O5UA 3CB3A 5U63A 2R9ZA 3UP4A 4YTNA 4GDEA 2YG6A 2VZ2A 1N1PA 4YTPA 2AL1A 1PBFA 4IVOB 3Q9TA 4WCTA 4E4FA 2CVJA 4C74A 1E9IA 4GAVA 3EAOA 1GREA 3UOXA 4NNJA 3AE5A 3TWBA 2BXRA 2C75A 2V60A 5IQ1A 3CGBA 3AYLA 2XFPA 3NT6A 3Q45A 3QFBA 3UJ2A 1EC8A 1JRZA 1XDIA 3HW2A 3GRSA 4BK2A 2XVFA 1BKHA 1R6WA 1NHSA 4TLZA 3SZ0A 3DK9A 2PPGA 1QJDA 4ECHA 2DKHA 4GR1A 1N61C 4GFIA 3CGEA 3V3NA 2HQMA 4JN8A 2BS2A 3TW9A 2QDEA 3NRNA 3RRAA 1KCZA 3UOZA 2GGGA 4D04A 4OPIA 3KU9A 2PA6A 5FS9A 3H70A 4BJYA 3GD6A 3MZNA 1KSUA 1MUCA 2BK5A 1ZXIC 3CXOA 1TRBA 1XPQA 4J34A 4NWZA 4GISA 4G7FA 4J2WA 3UOYA 3IJIA 1FEBA 5EB5A 3LXDA 2IIDA 2CFYA 4OPDA 3BSMA 5HHFA 3MUCA 5JCNA 4Y4NA 2X8GA 2VOUA 1X2GA 2R4JA 4H19A 1GEUA 4CRTA 1MNSA 1MXTA 3OZYA 1NAAA 1QO8A 1Q1RA 3C4AA 4OVIA 4H2HA 1E39A 4CY8A 1EL7A 1V59A 4B65A 5BVAA 1O94A 3ZLHA 4USQA 5LV9A 3CNSA 1JNZA 3H8LA 4YSHA 4K2SA 4ZA0A 1KNRA 2R0GA 3NYFA 2B76A 4XWRA 2BS3A 3SYIA 1ONEA 2OLAA 3DH9A 1JPMA 5J7XA 3DMEA 4YXDA 1B8SA 3DG3A 4EIPA 3NGCX 2C64A 3ZVHA 1YQ3A 3OZMA 1PHHA 3LZXA 3ZVHB 2O56A 3BHFA 5FS6A 3B97A 2XVIA 2GR0A 1DXLA 3UKLA 2V5ZA 1FL2A 4Z2TA 2YWLA 2PP1A 3PVCA 3K7MX 3NTAA 4H4XA 1VG0A 3GRTA 3ALLA 1E1NA 2YLSA 1FCDA 2XH4A 3FMWA 4C5OA 2P8CA 2EQ7A 4J3ZA 2PCEA 3GWFA 5IQ4A 4OPLA 1NEKA 2GH5A 3S47A 3MQTA 5FMHA 3T6CA 4K7ZA 1P48A 3S5WA 4GYPC 3CIRA 4ENLA 2CULA 4AOXA 2ZZBA 1L0VA 2Q7VA 3R25A 1H81A 2C73A 1SEZA 3NZGA 1Q9IA 2DW7A 2C7GA 3L5OA 3AEBA 1PBBA 3WE0A 4C77A 3GDPA 4MKSA 2R0CA 1TDEA 2EQ9A 5G5GB 4M6UA 4Y4MA 3BJSA 5ER0A 4J57A 2ZBWA 4K8GA 2WP6A 1RSGA 3C96A 4U8LA 3SZWA 3SXIA 4EQSA 1F8SA 2X99A 2JB2A 4FDCB 3AYJA 2XLUA 1W6TA 1OJCA 3AXBA 2XSXA 1KDGA 1DODA 1DJNA 4NEVA 4UDQA 3UCDA 3D8XA 3ATQA 2AKZA 4DSGA 5GSNA 2H88A 1TDKA 3IF9A 2FYMA 3URHA 3LJPA 1QLBA 1P2HA 1PBEA 3NIXA 2IVEA 4H4WA 1IUUA 7ENLA 3JZUA 2W0HA 4TVWA 1SJCA 2XDOA 2VVLA 3DGZA 2XFUA 4A5LA 3NG7X 2XLPA 5KRQA 1IUWA 4CCQA 3GYXA 4X2PA 5FJOA 2AKMA 1KKOA 3AEDA 4JY2A 3I6DA 4JHMA 3DGBA 3ALMA 4IT1A 4KX6A 4H4TA 3BI2A 3RP8A 1B4VA 3NS1B 1AOGA 5FJUA 2NVKX 1CJCA 3IHGA 3IJLA 3SSZA 3AD9B 1BWCA 2XH7A 5EBKA 4YKFA 3NN6X 4H1ZA 3UTFA 3DJDA 2WP9A 3HYVA 3VR8A 2B9YA 1W4XA 4TM1A 4A6NA 2C76A 4B67A 2PYXA 4A6NB 1S3BA 3RNMA 1ONFA 1OEPA 1NPXA 1P43A 2TPRA 4IV9A 3DGHA 1JNRA 3STPA 1KNPA 1DOBA 4KT2A 2BK4A 1DOEA 1RYIA 3DK8A 1LTXR 3CT2A 1JPDX 1EL5A 4LU6A 5HYMA 3R07C 1PDHA 3NK1X 3EANA 1OJDA 2WOVA 1GTHA 3G5RA 3CNPA 2OVLA 3M12A 3NK0X 3RGTA 3NVZB 4IZGA 4B69A 5EB4A 2OFJA 4HCLA 3VC6A 1KFYA 4J31A 1KKRA 5FS7A 1D4CA 4KPRA 1HYUA 4BJZA 1EL8A 3DJJA 4G9KA 2BC1A 2BXSA 1VDVA 1EBHA 4I58A 3MWCA 5IPYA 1ELSA 4DXKA 3QPEA 4DHGA 1D4EA 1BF3A 2BYBA 3MKCA 1GESA 2R4EA 2Q0KA 3P1WA 3CXBA 1N5XA 2P0IA 3DK4A 1ZY8A 1GSNA 3VRBA 4U8OA 3P0WA 3A7UA 2C72A 4EIQA 1S7MA 3NNEA 2FJAA 4U8MA 1Z6LA 3SJNA 2WOWA 1VDCA 2WQYA 2FKPA 4M0XA 4H7UA 4H2RA 2QA1A 5KXJA 2GR1A 3OPSA 3VRAA 4EMWA 2Z5XA 4U8JA 1PN0A 4U8IA 3UKPA 3FIMB 1LPFA 4DYEA 1N4VA 1ZMCA 1ELIA 2GMHA 1KD0A 3GD3A 3DDMA 4BK1A 1ZMDA 3SY4A 1H84A 5JCKA 3SN4A 4Z1YA 5KVHA 3UJFA 2Y6RA 2PHHA 3NH3X 2WDVA 3ZDNA 1N60C 1STZA 3NVVB 3VCNA 4C3XA 3SN0A 4RSLA 1DJQA 5KNLA 3H8IA 3S61A 2BCGG 3V5CA 2C3CA 3P4PA 4G73A 1NHRA 1BZLA 3KKJA 3IK4A 3H4KA 4UDRA 3UTHA 3VFCA 1GNDA 3NHOX 4JNAA 3RR1A 4FP1A 2QA2A 3AE1A 3UKKA 4Z2UA 1CJ4A 1F3PA 2GQWA 3H7VA 2OLNA 2OO6A 2QVHA 2O9ZA 1PS9A 2GR3A 1NHPA 4Z25A 1BGJA 2E5VA 1MDLA 5G5HB 3P9UA 3CNTA 2OZ3A 2C66A 3B6DA 4NTDA 3UJEA 5J60A 2V6OA 3D47A 1TE6A 3PO7A 2BK3A 3QJ4A 1GOSA 1H2IA 4J56A 2VVLG 5FJRA 5C3JA 3T31A 1FHUA 3N4FA 4DN1A 3KD9A 1T3QC 4F4RA 2XYOA 3O0HA 4AOSA 2JAEA 1GTEA 5KMRA 1EC7A 4TLXA 4J36A 2BA9A 1PJ5A 3AE6A 5U25A 2C3DA 2OZTA 3I6TA 4IA5A 2C4CA 1CL0A 4OPGA 2BRYA 2YM1A 3NTDA 3N6JA 2X50A 3V76A 2ONEA 3AE2A 4OPCA 3QVRA 3KLJA 3THUA 3ETRB 4A79A 2OZ8A 3FCPA 3I6EA 1IYXA 5KOWA 1S3EA 2XCGA 3ENLA 3RCYA 5KMSA 3NYCA 2PGEA 2QAEA 1UKVG 2OKTA 3DERA 4HYRA 3RHAA 4ICYA 1FECA 3PG6A 4K5RA 1EBGA 3P3BA 3EEZA 4JY3A 4WX1A 1YY5A 1D5TA 4YTMA 3BI5A 3FG2P 2YG4A 3LB8A 3V4BA 3SGLA 1B37A 2XLTA 3QSSA 3PWIA 3ALJA 3K30A 3SM8A 1FFUC 2PODA 3GY1A 2Q6UA 4PABA 4X4JA 4OCGA 5HY5A 1OJ9A 3FVDA 3FBSA 5TR3A 2YG3A 4BV6A 2PMQA 4H4QA 5JCMA 2YR4A 1VQWA 1YEYA 3KPFA 4NTEA 3SR6B 3T2YA 1PDZA 4IP5A 2RGOA 3BOXA 2GAGB 1DOCA 1YKJA 3UP5A 3DG6A 3AB1A 2RABA 2QGYA 4ROPA 1PXBA 4U2LA 3ICTA 3AM9A 4DNAA 2C65A 4K22A 3GMCA 1VG9A 1GALA 1CHUA 3T9PA 4Z24A 2QJNA 3H12A 4Z26A 4KEMA 2XFOA 2YLWA 2AAQA 4GRTA 2BABA 2F5ZA 2MNRA 4J1OA 2YVFA 1B5QA 2JB3A 4E5TA 1N4WA 4YSZA 3VA8A 3VDGA 2E3TA 3TTEA 2PTXA 1KN0A 4TM4A 2FJDA 1GPEA 4G8TA 1JEHA 3EKGA 2YR6A 4B64A 4AP3A 4NTCA 2AL2A 5FJPA 3ATRA 3UKHA 5CKUA 4H4ZA 4BK3A 1LJ1A 2GGIA 2AL2B 2YVGA 4LA1A 2B9XA 5EU9A 3AE7A 2ZZCA 4Z43A 5BUKA 2TMDA 2ACZA 2XFNA 1GRFA 2XLRA 3AD7B 1BGNA 4B1BA 3CNJA 2R0PA 3ABVA 5M0ZA 3GC2A 3NO1A 1ZDLA 2V61A 4E8GA 2GGHA 4H50A 3ICSA 4USRA 2QJJA 4GGBA 3TWAA 3NVWB 4OPUA 4H4SA 2OALA 4FK1A 2QQ6A 4N9XA 2GV8A 3SX6A 2PU0A 3QVPA 4HN8A 4TM0A 4CCRA 2HZGA 2OLOA 1XS2A 2IVDA 3DJEA 1LVLA 3CPIG 3CTYA 1NU5A 2YLRA 3I3LA 4H2QA 4X9MA 1PDYA 2Q0LA 3U9IA 1EC9A 1P2EA 3R10A 4G74A 4NEWA 4U2TA 2X8HA 1FOHA 3AYIA 3N6HA 4JDRA 1GRTA 4H4PA 2BCPA 3FV9A 3TJIA 2WS3A 2XGZA 2GAHB 3JSKA 3R0KA 4YKGA 1CC4A 2HXUA 3P4SA 4AT2A 1FIQB 3TCSA 3HYXA 5DBJA 4H83A 3T2KA 1PBDA 5GRTA 4ZOHB 2W54A 3D9XA 3FPZA 2XH2A 5KOXA 4AP1A 2XVJA 2XVHA 4DGKA 1ZOYA 3A7RA 4KWSA 5BOFA 1L9CA 4E6MA 1EL9A 4B63A 2WESA 2YR5A 3R0UA 1M6IA 3QFAA 1V97A 4I59A 2GSHA 1REOA 3UKFA 1WUEA 3CPJG 4EMIA 1FEAA 3CGCA 4H4VA 3UTEA 2XLSA 3ZLGA 3N4EA 1GT8A 3EPTA 3HPFA 1JRPA 3GYJA 2PS2A 2VRMA 2BC0A 4YWOA 4X9NA 4G6HA 3QSEA 1GXFA 2CDUA 3D46A 2GRTA 3QN3A 3CN8A 4UP3A 4G6GA 4ADWA 3NXLA 2OQYA 3ES8A 2GVCA 1L8PA 4H2NA 4RG3A 1D4DA 4DWDA 1CC2A 1MDRA 5KWFA 3DA1A 3GYIA 2GQFA 1H82A 3GSIA 3UKAA 3CGDA 1PXAA 3AE4A 5FS8A 5FJTA 3UOVA 2YAUA 1PBCA 5J04A 1F9CA 5U1OA 3ITJA 4GDPA 2PTZA 2QJMA 4A35A 3DG7A 1XPYA 1SB3B 2NPXA 5EOWA 1XANA 1WUFA 2JB1A 3AE8A 1LQUA 4Z2RA 3MY9A 2VRLA 1PJ7A 1ZK7A 2XVEA 4HB9A 3A7AA 3V3OA 3UKQA 3II4A 3IJQA 2BS4A 1CJ3A 1PXCA 2OX4A 3OP2A 1TYTA
chains in the Genus database with same CATH topology
1JRXA 4IA5A 1F8WA 2YVJA 3DJGX 2C4CA 4A7AA 1CL0A 1GRHA 4OPGA 3CIRA 2BRYA 1TYPA 2CULA 2YM1A 3NTDA 4U8NA 4AOXA 2ZZBA 1L0VA 1K4QA 2V3BA 2X50A 2Q7VA 1H81A 3V76A 2C73A 5KVIA 2RGJA 3AE2A 1SEZA 4OPCA 1GV4A 1CJ2A 3QVRA 3KLJA 4APNA 1Q9IA 2AQJA 1CF3A 2C7GA 1MO9A 3RP7A 3GDNA 3AWIA 3LOVA 4JN9A 4II2A 4A79A 4A9WA 1IUSA 4B66A 3L5OA 4EQWA 2AR8A 3AEBA 4CNKA 3RP6A 3AECA 1PBBA 2WU5A 3WE0A 5KOWA 1S3EA 2XCGA 3SFDA 4C77A 3GDPA 2WPEA 1TDNA 5KMSA 2R0CA 1TDEA 2EQ9A 3UTGA 5M10A 3NYCA 4Y4MA 5ER0A 3T2ZA 1GETA 2QAEA 4J57A 1UKVG 2ZBWA 1BKWA 3RHAA 1CC6A 3EF6A 1O95A 4ICYA 1FECA 3GMBA 2WP6A 1RSGA 3C96A 3PG6A 3NLCA 4K5RA 4U8LA 3SZWA 3SXIA 3HYWA 4H4RA 4EQSA 3M0OA 4JY3A 1F8SA 4WX1A 3ICRA 1YY5A 1D5TA 2YG5A 4YTMA 3AEGA 3BI5A 3FG2P 1D7YA 2X99A 1H86A 3LB8A 1IUVA 2YG4A 3SGLA 1B37A 2XLTA 4YSYA 1PJ6A 4FDCB 2JB2A 3AYJA 2XLUA 1N4UA 4D03A 3QSSA 5BRTA 3ALJA 3K30A 1OJCA 3AXBA 3SM8A 3NN0X 3NYEA 2A89A 2Q6UA 1GRAA 4PABA 4OCGA 4X4JA 1ZOVA 2WU2A 5HY5A 1OJ9A 3FBSA 1TDFA 1YQ4A 2ZZ0A 1KDGA 2VVMA 1LV0A 5TR3A 1DODA 1DJNA 3B3RA 4K8DA 4B68A 2YG3A 4NEVA 1E1MA 4UDQA 4BV6A 2JKCA 3ATQA 3BNUA 3D8XA 2WP5A 4H4QA 5JCMA 2YR4A 2ARDA 1VQWA 4JNQA 5GSNA 4CY6A 2H88A 1ZP0A 5KMQA 2RGHA 3SZFA 4GCMA 3KPFA 4NTEA 4CNJA 2VQBA 1NG4A 1TDKA 3IF9A 3URHA 2C67A 3LJPA 4ZCDA 1QLBA 1P2HA 3T2YA 1PBEA 2X8CA 1F8RA 3NIXA 2GF3A 2IVEA 4H4WA 3BNMA 4A65A 1YQZA 1IUUA 4AT0A 4GUVA 2C70A 2W0HA 1ZKQA 3K7TA 2XDOA 2RGOA 3COXA 1S2YA 2VVLA 3DGZA 2GAGB 1DOCA 2OAMA 3ISHA 4EMJA 1YKJA 2XFUA 3UP5A 4A5LA 3PS9A 3NG7X 2XLPA 5KRQA 4REKA 3AB1A 4H2PA 5JRBA 2RABA 2B7RA 1PXBA 4U2LA 1IUWA 3ICTA 4CCQA 4DNAA 2C65A 3GYXA 2WHDA 4K5SA 4HA6A 4K22A 5JCIA 4H4UA 3GMCA 1VG9A 1NG3A 3QSMA 1GALA 4ZCCA 1CHUA 3AEDA 4JY2A 2J3NA 3I6DA 3BHKA 4Z24A 1JU2A 2UZZA 3ALMA 4RG4A 1IUXA 3L8KA 4KX6A 4MJWA 4Z26A 5L46A 4H4TA 3BI2A 3RP8A 1B4VA 1VRQB 1AOGA 1E1KA 3T37A 3D1CA 3G5QA 2XFOA 4Z44A 2H89A 2JK6A 2YLWA 2A8XA 2AAQA 4GRTA 2A87A 2NVKX 3CPHG 1XHCA 1CJCA 2F5ZA 1NENA 2BABA 3IHGA 4YSXA 2YVFA 1B5QA 1E7PA 3AEEA 3OZ2A 1IJHA 2GR2A 3AD9B 3VR9A 4H4YA 2JB3A 1BWCA 2Y6QA 4A99A 5EBKA 4EM3A 2BACA 4OPTA 1N4WA 4IVMB 4YSZA 4YKFA 3NN6X 3AEFA 3UTFA 5C2TA 3DJDA 2Z5YA 4IA6A 2GEWA 1KN0A 4EQXA 2WP9A 3HYVA 3VR8A 4TM4A 2B9YA 1W4XA 1TDOA 4TM1A 4K2XA 3E1TA 4GAPA 4A6NA 2WBAA 1K0IA 2FJDA 3GD4A 2C76A 4B67A 4EQRA 1GPEA 2PYXA 4ZN0A 1H7XA 1L9DA 3R9UA 2V3AA 4A6NB 1JEHA 3RNMA 1S3BA 4J33A 3T0KA 2I0ZA 1ONFA 1E1LA 2YR6A 1NPXA 1RP0A 3ADAB 2TPRA 1F6MA 5CQFA 4IV9A 3DGHA 4B64A 4AP3A 1JNRA 4NTCA 3ATRA 1KNPA 3CNDA 1DNCA 3UKHA 5CKUA 4H4ZA 4BK3A 1LJ1A 1DOBA 2YVGA 3SZCA 4LA1A 2B9XA 4Y4LA 3VRDB 3VQRA 3AE7A 2BK4A 2ZZCA 4Z43A 2YLZA 5BUKA 4JQ9A 1DOEA 1RYIA 3DK8A 4M52A 1LTXR 2TMDA 2ACZA 3F8RA 3K7QX 2XFNA 5KMPA 1GRFA 4O5UA 1EL5A 2XLRA 3AD7B 1BGNA 2WPFA 4B1BA 3CNJA 1KSSA 4LU6A 2R0PA 3ABVA 5M0ZA 5U63A 2R9ZA 5HYMA 3UP4A 1PDHA 4YTNA 4GDEA 4II3A 2YG6A 2VZ2A 2FBWA 1N1PA 1O5WA 1ZDLA 4YTPA 2X3NA 1PBFA 2R45A 2V61A 3F8PA 4IVOB 3NK1X 4O5QA 3KA7A 3EANA 2YQUA 4H50A 3ICSA 3Q9TA 2GMJA 4USRA 1OJDA 4U2SA 2WOVA 4WCTA 3SFEA 4C3YA 1GTHA 3G5RA 3CNPA 4LIIA 2E4GA 2CVJA 3M12A 3NK0X 4BURA 4GF7A 4C74A 4OPUA 4H4SA 4B69A 2OALA 4GAVA 4FK1A 3EAOA 5EB4A 1GREA 3UOXA 4NNJA 4N9XA 1KFYA 2GV8A 4J31A 1MOKA 3SX6A 3AE5A 3IWAA 2BXRA 2C75A 4CBQA 5FS7A 3QVPA 1D4CA 2V60A 4KPRA 5JCLA 2B7SA 1HYUA 4BJZA 5HXIA 1EL8A 1Q1WA 3DJJA 4EM4A 4TM0A 4G9KA 4CCRA 5IQ1A 3CGBA 2OLOA 3AYLA 3P4RA 4FK1C 2XFPA 4XWZA 2IVDA 3DJEA 1LVLA 3NT6A 2BC1A 3CPIG 3CTYA 1E6EA 2BXSA 2YLRA 4I58A 4FX9A 3I3LA 1GRGA 3QFBA 2FJBA 3REDA 5IPYA 1Y56A 1H83A 1JRZA 1XDIA 4H2QA 1D4EA 4X9MA 1BF3A 2BYBA 2Q0LA 3GRSA 4BK2A 2XVFA 3F8DA 1H7WA 1K0LA 1P2EA 1Y56B 1GESA 2BRAA 2FJEA 4G74A 2R4EA 4U8KA 4NEWA 2Q0KA 3P1WA 4PAAA 4U2TA 1NHSA 4TLZA 3SZ0A 2X8HA 3NKSA 1FOHA 3DK9A 3DK4A 1QJDA 2WDRA 1ZY8A 3AYIA 1GSNA 2DKHA 4U8OA 3VRBA 4ECHA 4GR1A 4JDRA 3ZYXA 1GRTA 1GERA 4H4PA 2BCPA 2JBVA 3CGEA 1IUTA 3V3NA 2WS3A 2YLXA 1NDAA 2GAHB 2HQMA 2BS2A 2C72A 4U8PA 4P9SA 1S7MA 3JSKA 4EIQA 2EQ8A 4XXGA 1Y0PA 2WOIA 3NNEA 2FJAA 4YKGA 1CC4A 4U8MA 1LQTA 3NRNA 2YLTA 3P4SA 4AT2A 1Z6LA 3UOZA 4D04A 2WOWA 1VDCA 4OPIA 2WQYA 3HYXA 2WDQA 4E0VA 2VQ7A 2E1MA 3KU9A 2R46A 3LZWA 4H7UA 5DBJA 4H2RA 2QA1A 1COYA 2EQ6A 5KXJA 2GR1A 5FS9A 3T2KA 1PBDA 3LADA 4BJYA 5GRTA 1KSUA 2BK5A 3VRAA 3IHMA 3AD8B 3D9XA 3FPZA 4EMWA 1TRBA 1XPQA 4AP1A 5KOXA 2Z5XA 4J34A 4U8JA 4NWZA 4J2WA 1PN0A 2YG7A 4U8IA 3KPKA 3UKPA 2XVJA 3UOYA 2XVHA 1FEBA 5EB5A 4DGKA 1ZOYA 3LXDA 2IIDA 1L9CA 2CFYA 3FIMB 4TM3A 1LPFA 1N4VA 2XFQA 4OPDA 1ZMCA 3SQPA 1EL9A 1ELIA 2GMHA 5HHFA 2WESA 4B63A 2YR5A 5JCNA 4Y4NA 2X8GA 3GD3A 2VOUA 3KVEA 4BK1A 3P4QA 1M6IA 2R4JA 3QFAA 1ZMDA 4I59A 3SY4A 1GEUA 5JCKA 1H84A 4CRTA 1KF6A 1MXTA 1REOA 3UKFA 5KVHA 2Y6RA 1NAAA 4DSGA 2PHHA 3NH3X 3CPJG 4NZHA 2WDVA 4EMIA 1FEAA 1QO8A 3ZDNA 1Q1RA 3CGCA 3C4AA 4OVIA 1S2QA 4H4VA 4YT0A 3UTEA 3CMMA 4C3XA 1E39A 4CY8A 1EL7A 1V59A 4B65A 2WEUA 2XLSA 2GB0A 1GT8A 4RSLA 5BVAA 1O94A 1DJQA 3EPTA 4USQA 5LV9A 3AEAA 1JNZA 3CNSA 3GYJA 5KNLA 3H8LA 3H8IA 1NHQA 3UCLA 2VRMA 3S61A 2BC0A 4YWOA 1L9EA 4X9NA 4G6HA 5BULA 4YSHA 2BCGG 1JRYA 3NK2X 1KNRA 3QSEA 2R0GA 1GXFA 2CDUA 3NYFA 2C3CA 3P4PA 4G73A 2GRTA 1NHRA 4DSHA 1BZLA 3CN8A 3KKJA 4UP3A 4G6GA 1GRBA 3H4KA 2APGA 2B76A 4UDRA 4XWRA 2BS3A 4ADWA 3SYIA 3UTHA 1K0JA 3DH9A 3AE9A 2GVCA 5J7XA 3DMEA 1GNDA 3NHOX 4H2NA 4YXDA 4JNAA 2QA2A 1B8SA 4RG3A 1D4DA 3AE1A 2B9WA 2DKIA 4EIPA 3UKKA 3NGCX 1CC2A 4Z2UA 2C64A 5KWFA 1CJ4A 1F3PA 1JOAA 2WETA 3M13A 3DA1A 3GYIA 2GQFA 2GQWA 1H82A 1YQ3A 2OLNA 3GSIA 3UKAA 1PHHA 2WPCA 3CGDA 3LZXA 3C4NA 1PXAA 3AE4A 1OJTA 5FS8A 3BHFA 5FS6A 3UOVA 3AE3A 2O9ZA 3GWDA 2XVIA 2GR0A 2YAUA 1PBCA 1DXLA 3UKLA 2V5ZA 1PS9A 1FL2A 2QCUA 3Q6JA 5U1OA 1D7LA 2YWLA 4Z2TA 2YM2A 3ITJA 2GR3A 1M64A 4GDPA 4UDPA 1OJAA 3BI4A 3PVCA 3OC4A 1NHPA 3K7MX 4Z25A 1BGJA 1ZX9A 2E5VA 3P9UA 3NTAA 4H4XA 1VG0A 3GRTA 2C66A 3ALLA 3B6DA 3CNTA 4NTDA 5J60A 2NPXA 1CBOA 3HZLA 2V6OA 1E1NA 2YLSA 5EOWA 1FCDA 1XANA 3G5SA 3PO7A 2BK3A 3QJ4A 1GOSA 3FMWA 2JB1A 1H2IA 3AE8A 3L1RA 4J56A 4C5OA 2VVLG 5C3JA 1LQUA 3T31A 2EQ7A 4Z2RA 3KD9A 2VRLA 3GWFA 1PJ7A 2XYOA 1ZK7A 3O0HA 2OA1A 4AOSA 5IQ4A 1EBDA 2JAEA 2XVEA 4OPLA 1NEKA 3IC9A 1GTEA 2GH5A 4HB9A 5KMRA 3T14A 3V3OA 3UKQA 3II4A 5FMHA 4K7ZA 4TLXA 2BS4A 1CJ3A 1PXCA 2BA9A 1PJ5A 4J36A 3AE6A 1TYTA 1H6VA 5U25A 2C3DA 1X31B 3S5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRX A;  4IA5 A;  1F8W A;  2YVJ A;  3DJG X;  4A7A A;  1CL0 A;  1GRH A;  4OPG A;  3CIR A;  3NTD A;  1TYP A;  2CUL A;  2YM1 A;  4U8N A;  4AOX A;  2ZZB A;  1L0V A;  1K4Q A;  2V3B A;  2X50 A;  2Q7V A;  1H81 A;  3V76 A;  2C73 A;  5KVI A;  2RGJ A;  3AE2 A;  1SEZ A;  4OPC A;  1GV4 A;  1CJ2 A;  3QVR A;  3KLJ A;  4APN A;  1Q9I A;  2AQJ A;  1CF3 A;  2C7G A;  1MO9 A;  3RP7 A;  3GDN A;  3AWI A;  3LOV A;  4JN9 A;  4A79 A;  4A9W A;  1IUS A;  4B66 A;  4EQW A;  2AR8 A;  3AEB A;  4CNK A;  3RP6 A;  3AEC A;  1PBB A;  2WU5 A;  3WE0 A;  5KOW A;  1S3E A;  2XCG A;  3SFD A;  4C77 A;  3GDP A;  2WPE A;  1TDN A;  2R0C A;  1TDE A;  2EQ9 A;  3UTG A;  5M10 A;  3NYC A;  4Y4M A;  5ER0 A;  1GET A;  2QAE A;  4J57 A;  1UKV G;  2ZBW A;  1BKW A;  3RHA A;  1CC6 A;  3EF6 A;  1O95 A;  4ICY A;  1FEC A;  3GMB A;  2WP6 A;  1RSG A;  3C96 A;  3NLC A;  4K5R A;  4U8L A;  4H4R A;  4EQS A;  3M0O A;  4JY3 A;  1F8S A;  4WX1 A;  3ICR A;  1YY5 A;  1D5T A;  2YG5 A;  4YTM A;  3AEG A;  3BI5 A;  3FG2 P;  1D7Y A;  2X99 A;  1H86 A;  3LB8 A;  1IUV A;  2YG4 A;  3SGL A;  1B37 A;  2XLT A;  4YSY A;  1PJ6 A;  4FDC B;  2JB2 A;  3AYJ A;  2XLU A;  1N4U A;  4D03 A;  3QSS A;  5BRT A;  3ALJ A;  3K30 A;  1OJC A;  3AXB A;  3SM8 A;  3NN0 X;  3NYE A;  2A89 A;  2Q6U A;  1GRA A;  4PAB A;  4OCG A;  4X4J A;  1ZOV A;  2WU2 A;  5HY5 A;  1OJ9 A;  3FBS A;  1TDF A;  1YQ4 A;  2ZZ0 A;  1KDG A;  2VVM A;  1LV0 A;  5TR3 A;  1DOD A;  1DJN A;  3B3R A;  4K8D A;  4B68 A;  2YG3 A;  4NEV A;  1E1M A;  4UDQ A;  4BV6 A;  2JKC A;  3ATQ A;  3BNU A;  3D8X A;  2WP5 A;  4H4Q A;  5JCM A;  2YR4 A;  2ARD A;  1VQW A;  4JNQ A;  5GSN A;  4CY6 A;  2H88 A;  1ZP0 A;  2RGH A;  4GCM A;  3KPF A;  4NTE A;  4CNJ A;  2VQB A;  1NG4 A;  1TDK A;  3IF9 A;  3URH A;  2C67 A;  3LJP A;  4ZCD A;  1QLB A;  1P2H A;  1PBE A;  2X8C A;  1F8R A;  3NIX A;  2GF3 A;  2IVE A;  4H4W A;  3BNM A;  4A65 A;  1YQZ A;  1IUU A;  4AT0 A;  4GUV A;  2C70 A;  2W0H A;  1ZKQ A;  3K7T A;  2XDO A;  2RGO A;  3COX A;  1S2Y A;  2VVL A;  3DGZ A;  2GAG B;  1DOC A;  2OAM A;  3ISH A;  4EMJ A;  1YKJ A;  2XFU A;  3UP5 A;  4A5L A;  3PS9 A;  3NG7 X;  2XLP A;  5KRQ A;  4REK A;  3AB1 A;  4H2P A;  2RAB A;  2B7R A;  1PXB A;  4U2L A;  1IUW A;  3ICT A;  4CCQ A;  4DNA A;  2C65 A;  2WHD A;  4K5S A;  4HA6 A;  4K22 A;  5JCI A;  4H4U A;  3GMC A;  1VG9 A;  1NG3 A;  3QSM A;  1GAL A;  4ZCC A;  1CHU A;  3AED A;  4JY2 A;  2J3N A;  3I6D A;  3BHK A;  4Z24 A;  1JU2 A;  2UZZ A;  3ALM A;  4RG4 A;  1IUX A;  3L8K A;  4KX6 A;  4MJW A;  4Z26 A;  5L46 A;  4H4T A;  3BI2 A;  3RP8 A;  1B4V A;  1VRQ B;  1AOG A;  1E1K A;  3T37 A;  3D1C A;  3G5Q A;  2XFO A;  4Z44 A;  2H89 A;  2JK6 A;  2YLW A;  2A8X A;  2AAQ A;  4GRT A;  2A87 A;  2NVK X;  3CPH G;  1XHC A;  1CJC A;  2F5Z A;  1NEN A;  2BAB A;  3IHG A;  4YSX A;  2YVF A;  1B5Q A;  1E7P A;  3AEE A;  3OZ2 A;  1IJH A;  2GR2 A;  3AD9 B;  3VR9 A;  4H4Y A;  2JB3 A;  1BWC A;  2Y6Q A;  4A99 A;  5EBK A;  4EM3 A;  2BAC A;  4OPT A;  1N4W A;  4IVM B;  4YSZ A;  4YKF A;  3NN6 X;  3AEF A;  3UTF A;  5C2T A;  3DJD A;  2Z5Y A;  4IA6 A;  2GEW A;  2WP9 A;  4EQX A;  3VR8 A;  4TM4 A;  2B9Y A;  1W4X A;  1TDO A;  4TM1 A;  4K2X A;  3E1T A;  4A6N A;  2WBA A;  1K0I A;  2FJD A;  3GD4 A;  2C76 A;  4B67 A;  4EQR A;  1GPE A;  2PYX A;  4ZN0 A;  1H7X A;  1L9D A;  3R9U A;  2V3A A;  4A6N B;  1JEH A;  3RNM A;  1S3B A;  4J33 A;  2I0Z A;  1ONF A;  1E1L A;  2YR6 A;  1NPX A;  1RP0 A;  3ADA B;  2TPR A;  1F6M A;  5CQF A;  4IV9 A;  3DGH A;  4B64 A;  4AP3 A;  1JNR A;  4NTC A;  3ATR A;  1KNP A;  3CND A;  1DNC A;  3UKH A;  5CKU A;  4H4Z A;  4BK3 A;  1LJ1 A;  1DOB A;  2YVG A;  4LA1 A;  2B9X A;  4Y4L A;  3VRD B;  3VQR A;  3AE7 A;  2BK4 A;  2ZZC A;  4Z43 A;  2YLZ A;  5BUK A;  4JQ9 A;  1DOE A;  1RYI A;  3DK8 A;  4M52 A;  1LTX R;  2TMD A;  2ACZ A;  3F8R A;  3K7Q X;  2XFN A;  1GRF A;  4O5U A;  1EL5 A;  2XLR A;  3AD7 B;  1BGN A;  2WPF A;  4B1B A;  3CNJ A;  1KSS A;  4LU6 A;  2R0P A;  3ABV A;  5M0Z A;  5U63 A;  2R9Z A;  5HYM A;  3UP4 A;  1PDH A;  4YTN A;  4GDE A;  2YG6 A;  2VZ2 A;  2FBW A;  1N1P A;  1O5W A;  1ZDL A;  4YTP A;  2X3N A;  1PBF A;  2R45 A;  2V61 A;  3F8P A;  4IVO B;  3NK1 X;  4O5Q A;  3KA7 A;  3EAN A;  2YQU A;  4H50 A;  3ICS A;  3Q9T A;  2GMJ A;  4USR A;  1OJD A;  4U2S A;  2WOV A;  4WCT A;  3SFE A;  4C3Y A;  1GTH A;  3G5R A;  3CNP A;  4LII A;  2E4G A;  2CVJ A;  3M12 A;  3NK0 X;  4BUR A;  4GF7 A;  4C74 A;  4OPU A;  4H4S A;  4B69 A;  2OAL A;  4FK1 A;  3EAO A;  5EB4 A;  1GRE A;  3UOX A;  4N9X A;  1KFY A;  2GV8 A;  4J31 A;  1MOK A;  3AE5 A;  3IWA A;  2BXR A;  2C75 A;  4CBQ A;  5FS7 A;  3QVP A;  1D4C A;  2V60 A;  4KPR A;  5JCL A;  2B7S A;  1HYU A;  4BJZ A;  5HXI A;  1EL8 A;  1Q1W A;  3DJJ A;  4EM4 A;  4TM0 A;  4CCR A;  5IQ1 A;  3CGB A;  2OLO A;  3AYL A;  3P4R A;  4FK1 C;  2XFP A;  4XWZ A;  2IVD A;  3DJE A;  1LVL A;  3NT6 A;  2BC1 A;  3CPI G;  3CTY A;  1E6E A;  2BXS A;  2YLR A;  4I58 A;  4FX9 A;  3I3L A;  1GRG A;  3QFB A;  2FJB A;  3RED A;  5IPY A;  1Y56 A;  1H83 A;  1JRZ A;  1XDI A;  4H2Q A;  1D4E A;  4X9M A;  1BF3 A;  2BYB A;  2Q0L A;  3GRS A;  4BK2 A;  2XVF A;  3F8D A;  1H7W A;  1K0L A;  1P2E A;  1Y56 B;  1GES A;  2FJE A;  4U8K A;  2R4E A;  4NEW A;  2Q0K A;  3P1W A;  4PAA A;  4U2T A;  1NHS A;  4TLZ A;  2X8H A;  3NKS A;  1FOH A;  3DK9 A;  3DK4 A;  1QJD A;  2WDR A;  1ZY8 A;  3AYI A;  1GSN A;  2DKH A;  4U8O A;  3VRB A;  4ECH A;  4GR1 A;  4JDR A;  3ZYX A;  1GRT A;  1GER A;  4H4P A;  2BCP A;  2JBV A;  3CGE A;  1IUT A;  3V3N A;  2WS3 A;  2YLX A;  1NDA A;  2GAH B;  2HQM A;  2BS2 A;  2C72 A;  4U8P A;  4P9S A;  4EIQ A;  3JSK A;  2EQ8 A;  4XXG A;  1Y0P A;  2WOI A;  3NNE A;  2FJA A;  4YKG A;  1CC4 A;  4U8M A;  1LQT A;  3NRN A;  2YLT A;  3P4S A;  4AT2 A;  1Z6L A;  3UOZ A;  4D04 A;  2WOW A;  1VDC A;  4OPI A;  2WQY A;  2WDQ A;  4E0V A;  2VQ7 A;  2E1M A;  3KU9 A;  2R46 A;  3LZW A;  4H7U A;  5DBJ A;  4H2R A;  2QA1 A;  1COY A;  2EQ6 A;  5KXJ A;  2GR1 A;  5FS9 A;  1PBD A;  3LAD A;  4BJY A;  5GRT A;  1KSU A;  2BK5 A;  3VRA A;  3IHM A;  3AD8 B;  3FPZ A;  4EMW A;  1TRB A;  1XPQ A;  4AP1 A;  5KOX A;  2Z5X A;  4J34 A;  4U8J A;  4J2W A;  1PN0 A;  2YG7 A;  4U8I A;  3UKP A;  2XVJ A;  3UOY A;  2XVH A;  1FEB A;  5EB5 A;  4DGK A;  1ZOY A;  3LXD A;  2IID A;  1L9C A;  2CFY A;  3FIM B;  4TM3 A;  1LPF A;  1N4V A;  2XFQ A;  4OPD A;  1ZMC A;  3SQP A;  1EL9 A;  1ELI A;  2GMH A;  5HHF A;  2WES A;  4B63 A;  2YR5 A;  5JCN A;  4Y4N A;  2X8G A;  3GD3 A;  2VOU A;  3KVE A;  4BK1 A;  3P4Q A;  1M6I A;  2R4J A;  3QFA A;  1ZMD A;  4I59 A;  1GEU A;  5JCK A;  1H84 A;  4CRT A;  1KF6 A;  1MXT A;  1REO A;  3UKF A;  5KVH A;  2Y6R A;  1NAA A;  4DSG A;  2PHH A;  3NH3 X;  3CPJ G;  4NZH A;  2WDV A;  4EMI A;  1FEA A;  1QO8 A;  3ZDN A;  1Q1R A;  3CGC A;  3C4A A;  4OVI A;  1S2Q A;  4H4V A;  4YT0 A;  3UTE A;  4C3X A;  1E39 A;  4CY8 A;  1EL7 A;  1V59 A;  4B65 A;  2WEU A;  2XLS A;  2GB0 A;  1GT8 A;  4RSL A;  5BVA A;  1O94 A;  1DJQ A;  3EPT A;  4USQ A;  5LV9 A;  3AEA A;  1JNZ A;  3CNS A;  3GYJ A;  3H8L A;  3H8I A;  1NHQ A;  3UCL A;  2VRM A;  3S61 A;  2BC0 A;  4YWO A;  1L9E A;  4X9N A;  5BUL A;  4YSH A;  2BCG G;  1JRY A;  3NK2 X;  1KNR A;  3QSE A;  2R0G A;  1GXF A;  2CDU A;  3NYF A;  2C3C A;  3P4P A;  2GRT A;  1NHR A;  4DSH A;  1BZL A;  3CN8 A;  3KKJ A;  4UP3 A;  1GRB A;  3H4K A;  2APG A;  2B76 A;  4UDR A;  4XWR A;  2BS3 A;  4ADW A;  3UTH A;  1K0J A;  3DH9 A;  3AE9 A;  2GVC A;  5J7X A;  3DME A;  1GND A;  3NHO X;  4H2N A;  4YXD A;  4JNA A;  2QA2 A;  1B8S A;  4RG3 A;  1D4D A;  3AE1 A;  2B9W A;  2DKI A;  4EIP A;  3UKK A;  3NGC X;  1CC2 A;  4Z2U A;  2C64 A;  5KWF A;  1CJ4 A;  1F3P A;  1JOA A;  2WET A;  3M13 A;  3DA1 A;  3GYI A;  2GQF A;  2GQW A;  1H82 A;  1YQ3 A;  2OLN A;  3GSI A;  3UKA A;  1PHH A;  2WPC A;  3CGD A;  3LZX A;  3C4N A;  1PXA A;  3AE4 A;  1OJT A;  5FS8 A;  3BHF A;  5FS6 A;  3UOV A;  3AE3 A;  2O9Z A;  3GWD A;  2XVI A;  2GR0 A;  2YAU A;  1PBC A;  1DXL A;  3UKL A;  2V5Z A;  1PS9 A;  1FL2 A;  2QCU A;  3Q6J A;  5U1O A;  1D7L A;  2YWL A;  4Z2T A;  2YM2 A;  3ITJ A;  2GR3 A;  1M64 A;  4GDP A;  4UDP A;  1OJA A;  3BI4 A;  3PVC A;  3OC4 A;  1NHP A;  3K7M X;  4Z25 A;  1BGJ A;  1ZX9 A;  2E5V A;  3P9U A;  3NTA A;  4H4X A;  1VG0 A;  3GRT A;  2C66 A;  3ALL A;  3B6D A;  3CNT A;  4NTD A;  5J60 A;  2NPX A;  1CBO A;  3HZL A;  2V6O A;  1E1N A;  2YLS A;  5EOW A;  1FCD A;  1XAN A;  3G5S A;  3PO7 A;  2BK3 A;  3QJ4 A;  1GOS A;  3FMW A;  2JB1 A;  3L1R A;  3AE8 A;  4C5O A;  4J56 A;  2VVL G;  5C3J A;  1LQU A;  2EQ7 A;  4Z2R A;  3KD9 A;  2VRL A;  3GWF A;  1PJ7 A;  2XYO A;  1ZK7 A;  3O0H A;  2OA1 A;  4AOS A;  5IQ4 A;  1EBD A;  2JAE A;  2XVE A;  4OPL A;  1NEK A;  3IC9 A;  1GTE A;  2GH5 A;  4HB9 A;  3V3O A;  3UKQ A;  3II4 A;  5FMH A;  4K7Z A;  4TLX A;  2BS4 A;  1CJ3 A;  1PXC A;  2BA9 A;  1PJ5 A;  4J36 A;  3AE6 A;  1TYT A;  1H6V A;  5U25 A;  2C3D A;  1X31 B;  3S5W A; 
#chains in the Genus database with same CATH topology
 4A7A A;  3DFH A;  1GRH A;  3H8A A;  1K4Q A;  5KVI A;  2RGJ A;  1GV4 A;  2AQJ A;  2E5A A;  1CF3 A;  3RP7 A;  4JN9 A;  2PTW A;  4MMW A;  4B66 A;  1JCT A;  4EQW A;  4CNK A;  3AEC A;  3UJR A;  3SFD A;  4EWJ A;  3NFU A;  3T2Z A;  3KUM A;  4GGH A;  1BKW A;  3UXK A;  1CC6 A;  1O95 A;  3GMB A;  6ENL A;  3NLC A;  3HYW A;  3M0O A;  3RIT A;  2YG5 A;  1D7Y A;  1FHV A;  1IUV A;  4YSY A;  1N4U A;  4D03 A;  3OTR A;  5BRT A;  3QTP A;  3NN0 X;  3NYE A;  2A89 A;  1GRA A;  2WU2 A;  3TQP A;  1TDF A;  2VVM A;  1MRA A;  1E1M A;  3GDN A;  3BNU A;  1RVK A;  3AN1 A;  4CY6 A;  2ARD A;  4JNQ A;  3SZF A;  4GCM A;  1TZZ A;  4CNJ A;  2VQB A;  4ZCD A;  2GF3 A;  4A65 A;  4AT0 A;  4GUV A;  3COX A;  2I5Q A;  2PP3 A;  2OAM A;  3ISH A;  3PS9 A;  1WYG A;  4H2P A;  2GGJ A;  2WHD A;  4K5S A;  1SJA A;  4HA6 A;  4GIR A;  4H4U A;  4YWS A;  1NEL A;  2J3N A;  3BHK A;  3L8K A;  4E4U A;  2JK6 A;  2H89 A;  1SJB A;  2PP0 A;  2A87 A;  3CPH G;  2P88 A;  1XHC A;  4YSX A;  1E7P A;  1IJH A;  3TOY A;  4H4Y A;  4A99 A;  4EM3 A;  4OPT A;  4JN7 A;  3AEF A;  2Z5Y A;  3R1Z A;  4K2X A;  3E1T A;  2WBA A;  3GD4 A;  2W3R A;  1H7X A;  2V3A A;  3T0K A;  1RP0 A;  3ADA B;  1F6M A;  5CQF A;  2GDQ A;  4A3R A;  3SZC A;  4Y4L A;  4IHC A;  4M52 A;  3K7Q X;  3F8R A;  5KMP A;  3ZLF A;  3UCC A;  2WPF A;  1KSS A;  3DES A;  4II3 A;  2FBW A;  1O5W A;  3DFY A;  2X3N A;  3F8P A;  2R45 A;  2OPJ A;  4O5Q A;  3KA7 A;  2YQU A;  3I4K A;  2GMJ A;  4U2S A;  4C3Y A;  3SFE A;  2PTY A;  2XH0 A;  4LII A;  2E4G A;  4BUR A;  4GF7 A;  3K1G A;  1MOK A;  2GGE A;  3IWA A;  4A6G A;  4CBQ A;  5JCL A;  2B7S A;  3ES7 A;  3UXL A;  5HXI A;  1Q1W A;  4EM4 A;  3JVA A;  4FK1 C;  3P4R A;  4XWZ A;  1E6E A;  3MSY A;  1SJD A;  4K1W A;  4FX9 A;  1GRG A;  2FJB A;  3RED A;  1Y56 A;  1H83 A;  4KPL A;  2PU1 A;  3B9J B;  2DW6 A;  3F8D A;  1H7W A;  1K0L A;  1Y56 B;  2BRA A;  2FJE A;  4U8K A;  4PAA A;  1N5W C;  4Z17 A;  3NKS A;  2WDR A;  3ZYX A;  1GER A;  2JBV A;  1IUT A;  3AMZ A;  2YLX A;  1NDA A;  4U8P A;  4P9S A;  2EQ8 A;  4XXG A;  1Y0P A;  2WOI A;  1LQT A;  2YLT A;  3UJS A;  2WDQ A;  4E0V A;  2VQ7 A;  2E1M A;  2R46 A;  3LZW A;  1COY A;  2EQ6 A;  3T8Q A;  3LAD A;  2HXT A;  3IHM A;  3AD8 B;  1FFV C;  4GME A;  2YG7 A;  3KPK A;  2P3Z A;  3HRD C;  4TM3 A;  2XFQ A;  3SQP A;  1FO4 A;  3QKE A;  3CK5 A;  3KVE A;  4DX3 A;  5BOE A;  5IDZ A;  3P4Q A;  2PSN A;  1KF6 A;  3V5F A;  3SN1 A;  4NZH A;  1N62 C;  1S2Q A;  4YT0 A;  3CMM A;  1X2H A;  3FXG A;  3SQS A;  2WEU A;  2GB0 A;  3U4F A;  3AEA A;  2HNE A;  1NHQ A;  3R11 A;  3UCL A;  3Q4D A;  3DIP A;  3CYJ A;  1L9E A;  4HNC A;  5BUL A;  1JRY A;  3NK2 X;  4DSH A;  4FI4 A;  1GRB A;  2APG A;  3NRZ B;  3OW1 A;  1K0J A;  3AE9 A;  1TKK A;  4HCD A;  2B9W A;  2DKI A;  2WET A;  1JOA A;  3M13 A;  2WPC A;  3C4N A;  3S5S A;  1OJT A;  3AE3 A;  3GWD A;  2MUC A;  1RM6 B;  2QCU A;  3Q6J A;  1D7L A;  2YM2 A;  1M64 A;  4UDP A;  4HCH A;  1OJA A;  3BI4 A;  3VCC A;  2OQH A;  3OC4 A;  1ZX9 A;  1BQG A;  1CBO A;  3HZL A;  2ZAD A;  3G5S A;  3L1R A;  2NQL A;  5ENL A;  2OA1 A;  4HPN A;  1EBD A;  4GYP A;  3IC9 A;  3T14 A;  3PWG A;  1H6V A;  3AEG A;  1X31 B;  3RO6 A;  1JRX A;  1F8W A;  2YVJ A;  3DJG X;  3FJ4 A;  1TYP A;  3UGV A;  4U8N A;  4MGG A;  2ZC8 A;  2V3B A;  2W3S A;  3DEQ A;  2QDD A;  3TJ4 A;  1CJ2 A;  1JDF A;  4APN A;  1MO9 A;  3T4W A;  3AWI A;  3LOV A;  4II2 A;  1JRO A;  4A9W A;  1IUS A;  2AR8 A;  3RP6 A;  2WU5 A;  2WPE A;  3EUB 3;  1TDN A;  3UTG A;  2P8B A;  5M10 A;  1GET A;  4HNL A;  3EF6 A;  3NVY B;  4H4R A;  3GO2 A;  2W55 A;  3ICR A;  1H86 A;  2POZ A;  3VC5 A;  1PJ6 A;  4IL2 A;  1R0M A;  1ZOV A;  1YQ4 A;  2ZZ0 A;  4B68 A;  1LV0 A;  3B3R A;  4K8D A;  2JKC A;  2WP5 A;  1ZP0 A;  5KMQ A;  2RGH A;  2CHR A;  1NG4 A;  2C67 A;  1ECQ A;  2X8C A;  1F8R A;  3BNM A;  1YQZ A;  2C70 A;  3K7T A;  1ZKQ A;  4IP4 A;  2GL5 A;  1S2Y A;  3SBF A;  4EMJ A;  2RDX A;  4REK A;  5JRB A;  2B7R A;  1VQZ A;  4ZCW A;  5JCI A;  3ZVI A;  1NG3 A;  3QSM A;  4ZCC A;  3FYY A;  1JU2 A;  2UZZ A;  1N63 C;  4RG4 A;  1IUX A;  4MJW A;  5L46 A;  2OG9 A;  1VRQ B;  3T37 A;  3PFR A;  1E1K A;  3D1C A;  3G5Q A;  4Z44 A;  3CAW A;  2A8X A;  2PGW A;  1NEN A;  3AEE A;  3OZ2 A;  2GR2 A;  3VR9 A;  2Y6Q A;  2BAC A;  4IVM B;  5C2T A;  4IA6 A;  2GEW A;  4EQX A;  1TDO A;  4GAP A;  1K0I A;  4EQR A;  4ZN0 A;  4IL0 A;  1L9D A;  3R9U A;  3PK7 A;  4J33 A;  3P93 A;  2I0Z A;  3QLD A;  1E1L A;  3V3W A;  3CND A;  1DNC A;  1DTN A;  3JW7 A;  4TVY A;  3VRD B;  3VQR A;  2YLZ A;  4JQ9 A;  4O5U A;  3CB3 A;  5U63 A;  2R9Z A;  3UP4 A;  4YTN A;  4GDE A;  2YG6 A;  2VZ2 A;  1N1P A;  4YTP A;  2AL1 A;  1PBF A;  4IVO B;  3Q9T A;  4WCT A;  4E4F A;  2CVJ A;  4C74 A;  1E9I A;  4GAV A;  3EAO A;  1GRE A;  3UOX A;  4NNJ A;  3AE5 A;  3TWB A;  2BXR A;  2C75 A;  2V60 A;  5IQ1 A;  3CGB A;  3AYL A;  2XFP A;  3NT6 A;  3Q45 A;  3QFB A;  3UJ2 A;  1EC8 A;  1JRZ A;  1XDI A;  3HW2 A;  3GRS A;  4BK2 A;  2XVF A;  1BKH A;  1R6W A;  1NHS A;  4TLZ A;  3SZ0 A;  3DK9 A;  2PPG A;  1QJD A;  4ECH A;  2DKH A;  4GR1 A;  1N61 C;  4GFI A;  3CGE A;  3V3N A;  2HQM A;  4JN8 A;  2BS2 A;  3TW9 A;  2QDE A;  3NRN A;  3RRA A;  1KCZ A;  3UOZ A;  2GGG A;  4D04 A;  4OPI A;  3KU9 A;  2PA6 A;  5FS9 A;  3H70 A;  4BJY A;  3GD6 A;  3MZN A;  1KSU A;  1MUC A;  2BK5 A;  1ZXI C;  3CXO A;  1TRB A;  1XPQ A;  4J34 A;  4NWZ A;  4GIS A;  4G7F A;  4J2W A;  3UOY A;  3IJI A;  1FEB A;  5EB5 A;  3LXD A;  2IID A;  2CFY A;  4OPD A;  3BSM A;  5HHF A;  3MUC A;  5JCN A;  4Y4N A;  2X8G A;  2VOU A;  1X2G A;  2R4J A;  4H19 A;  1GEU A;  4CRT A;  1MNS A;  1MXT A;  3OZY A;  1NAA A;  1QO8 A;  1Q1R A;  3C4A A;  4OVI A;  4H2H A;  1E39 A;  4CY8 A;  1EL7 A;  1V59 A;  4B65 A;  5BVA A;  1O94 A;  3ZLH A;  4USQ A;  5LV9 A;  3CNS A;  1JNZ A;  3H8L A;  4YSH A;  4K2S A;  4ZA0 A;  1KNR A;  2R0G A;  3NYF A;  2B76 A;  4XWR A;  2BS3 A;  3SYI A;  1ONE A;  2OLA A;  3DH9 A;  1JPM A;  5J7X A;  3DME A;  4YXD A;  1B8S A;  3DG3 A;  4EIP A;  3NGC X;  2C64 A;  3ZVH A;  1YQ3 A;  3OZM A;  1PHH A;  3LZX A;  3ZVH B;  2O56 A;  3BHF A;  5FS6 A;  3B97 A;  2XVI A;  2GR0 A;  1DXL A;  3UKL A;  2V5Z A;  1FL2 A;  4Z2T A;  2YWL A;  2PP1 A;  3PVC A;  3K7M X;  3NTA A;  4H4X A;  1VG0 A;  3GRT A;  3ALL A;  1E1N A;  2YLS A;  1FCD A;  2XH4 A;  3FMW A;  4C5O A;  2P8C A;  2EQ7 A;  4J3Z A;  2PCE A;  3GWF A;  5IQ4 A;  4OPL A;  1NEK A;  2GH5 A;  3S47 A;  3MQT A;  5FMH A;  3T6C A;  4K7Z A;  1P48 A;  3S5W A;  4GYP C;  3CIR A;  4ENL A;  2CUL A;  4AOX A;  2ZZB A;  1L0V A;  2Q7V A;  3R25 A;  1H81 A;  2C73 A;  1SEZ A;  3NZG A;  1Q9I A;  2DW7 A;  2C7G A;  3L5O A;  3AEB A;  1PBB A;  3WE0 A;  4C77 A;  3GDP A;  4MKS A;  2R0C A;  1TDE A;  2EQ9 A;  5G5G B;  4M6U A;  4Y4M A;  3BJS A;  5ER0 A;  4J57 A;  2ZBW A;  4K8G A;  2WP6 A;  1RSG A;  3C96 A;  4U8L A;  3SZW A;  3SXI A;  4EQS A;  1F8S A;  2X99 A;  2JB2 A;  4FDC B;  3AYJ A;  2XLU A;  1W6T A;  1OJC A;  3AXB A;  2XSX A;  1KDG A;  1DOD A;  1DJN A;  4NEV A;  4UDQ A;  3UCD A;  3D8X A;  3ATQ A;  2AKZ A;  4DSG A;  5GSN A;  2H88 A;  1TDK A;  3IF9 A;  2FYM A;  3URH A;  3LJP A;  1QLB A;  1P2H A;  1PBE A;  3NIX A;  2IVE A;  4H4W A;  1IUU A;  7ENL A;  3JZU A;  2W0H A;  4TVW A;  1SJC A;  2XDO A;  2VVL A;  3DGZ A;  2XFU A;  4A5L A;  3NG7 X;  2XLP A;  5KRQ A;  1IUW A;  4CCQ A;  3GYX A;  4X2P A;  5FJO A;  2AKM A;  1KKO A;  3AED A;  4JY2 A;  3I6D A;  4JHM A;  3DGB A;  3ALM A;  4IT1 A;  4KX6 A;  4H4T A;  3BI2 A;  3RP8 A;  1B4V A;  3NS1 B;  1AOG A;  5FJU A;  2NVK X;  1CJC A;  3IHG A;  3IJL A;  3SSZ A;  3AD9 B;  1BWC A;  2XH7 A;  5EBK A;  4YKF A;  3NN6 X;  4H1Z A;  3UTF A;  3DJD A;  2WP9 A;  3HYV A;  3VR8 A;  2B9Y A;  1W4X A;  4TM1 A;  4A6N A;  2C76 A;  4B67 A;  2PYX A;  4A6N B;  1S3B A;  3RNM A;  1ONF A;  1OEP A;  1NPX A;  1P43 A;  2TPR A;  4IV9 A;  3DGH A;  1JNR A;  3STP A;  1KNP A;  1DOB A;  4KT2 A;  2BK4 A;  1DOE A;  1RYI A;  3DK8 A;  1LTX R;  3CT2 A;  1JPD X;  1EL5 A;  4LU6 A;  5HYM A;  3R07 C;  1PDH A;  3NK1 X;  3EAN A;  1OJD A;  2WOV A;  1GTH A;  3G5R A;  3CNP A;  2OVL A;  3M12 A;  3NK0 X;  3RGT A;  3NVZ B;  4IZG A;  4B69 A;  5EB4 A;  2OFJ A;  4HCL A;  3VC6 A;  1KFY A;  4J31 A;  1KKR A;  5FS7 A;  1D4C A;  4KPR A;  1HYU A;  4BJZ A;  1EL8 A;  3DJJ A;  4G9K A;  2BC1 A;  2BXS A;  1VDV A;  1EBH A;  4I58 A;  3MWC A;  5IPY A;  1ELS A;  4DXK A;  3QPE A;  4DHG A;  1D4E A;  1BF3 A;  2BYB A;  3MKC A;  1GES A;  2R4E A;  2Q0K A;  3P1W A;  3CXB A;  1N5X A;  2P0I A;  3DK4 A;  1ZY8 A;  1GSN A;  3VRB A;  4U8O A;  3P0W A;  3A7U A;  2C72 A;  4EIQ A;  1S7M A;  3NNE A;  2FJA A;  4U8M A;  1Z6L A;  3SJN A;  2WOW A;  1VDC A;  2WQY A;  2FKP A;  4M0X A;  4H7U A;  4H2R A;  2QA1 A;  5KXJ A;  2GR1 A;  3OPS A;  3VRA A;  4EMW A;  2Z5X A;  4U8J A;  1PN0 A;  4U8I A;  3UKP A;  3FIM B;  1LPF A;  4DYE A;  1N4V A;  1ZMC A;  1ELI A;  2GMH A;  1KD0 A;  3GD3 A;  3DDM A;  4BK1 A;  1ZMD A;  3SY4 A;  1H84 A;  5JCK A;  3SN4 A;  4Z1Y A;  5KVH A;  3UJF A;  2Y6R A;  2PHH A;  3NH3 X;  2WDV A;  3ZDN A;  1N60 C;  1STZ A;  3NVV B;  3VCN A;  4C3X A;  3SN0 A;  4RSL A;  1DJQ A;  5KNL A;  3H8I A;  3S61 A;  2BCG G;  3V5C A;  2C3C A;  3P4P A;  4G73 A;  1NHR A;  1BZL A;  3KKJ A;  3IK4 A;  3H4K A;  4UDR A;  3UTH A;  3VFC A;  1GND A;  3NHO X;  4JNA A;  3RR1 A;  4FP1 A;  2QA2 A;  3AE1 A;  3UKK A;  4Z2U A;  1CJ4 A;  1F3P A;  2GQW A;  3H7V A;  2OLN A;  2OO6 A;  2QVH A;  2O9Z A;  1PS9 A;  2GR3 A;  1NHP A;  4Z25 A;  1BGJ A;  2E5V A;  1MDL A;  5G5H B;  3P9U A;  3CNT A;  2OZ3 A;  2C66 A;  3B6D A;  4NTD A;  3UJE A;  5J60 A;  2V6O A;  3D47 A;  1TE6 A;  3PO7 A;  2BK3 A;  3QJ4 A;  1GOS A;  1H2I A;  4J56 A;  2VVL G;  5FJR A;  5C3J A;  3T31 A;  1FHU A;  3N4F A;  4DN1 A;  3KD9 A;  1T3Q C;  4F4R A;  2XYO A;  3O0H A;  4AOS A;  2JAE A;  1GTE A;  5KMR A;  1EC7 A;  4TLX A;  4J36 A;  2BA9 A;  1PJ5 A;  3AE6 A;  5U25 A;  2C3D A;  2OZT A;  3I6T A;  4IA5 A;  2C4C A;  1CL0 A;  4OPG A;  2BRY A;  2YM1 A;  3NTD A;  3N6J A;  2X50 A;  3V76 A;  2ONE A;  3AE2 A;  4OPC A;  3QVR A;  3KLJ A;  3THU A;  3ETR B;  4A79 A;  2OZ8 A;  3FCP A;  3I6E A;  1IYX A;  5KOW A;  1S3E A;  2XCG A;  3ENL A;  3RCY A;  5KMS A;  3NYC A;  2PGE A;  2QAE A;  1UKV G;  2OKT A;  3DER A;  4HYR A;  3RHA A;  4ICY A;  1FEC A;  3PG6 A;  4K5R A;  1EBG A;  3P3B A;  3EEZ A;  4JY3 A;  4WX1 A;  1YY5 A;  1D5T A;  4YTM A;  3BI5 A;  3FG2 P;  2YG4 A;  3LB8 A;  3V4B A;  3SGL A;  1B37 A;  2XLT A;  3QSS A;  3PWI A;  3ALJ A;  3K30 A;  3SM8 A;  1FFU C;  2POD A;  3GY1 A;  2Q6U A;  4PAB A;  4X4J A;  4OCG A;  5HY5 A;  1OJ9 A;  3FVD A;  3FBS A;  5TR3 A;  2YG3 A;  4BV6 A;  2PMQ A;  4H4Q A;  5JCM A;  2YR4 A;  1VQW A;  1YEY A;  3KPF A;  4NTE A;  3SR6 B;  3T2Y A;  1PDZ A;  4IP5 A;  2RGO A;  3BOX A;  2GAG B;  1DOC A;  1YKJ A;  3UP5 A;  3DG6 A;  3AB1 A;  2RAB A;  2QGY A;  4ROP A;  1PXB A;  4U2L A;  3ICT A;  3AM9 A;  4DNA A;  2C65 A;  4K22 A;  3GMC A;  1VG9 A;  1GAL A;  1CHU A;  3T9P A;  4Z24 A;  2QJN A;  3H12 A;  4Z26 A;  4KEM A;  2XFO A;  2YLW A;  2AAQ A;  4GRT A;  2BAB A;  2F5Z A;  2MNR A;  4J1O A;  2YVF A;  1B5Q A;  2JB3 A;  4E5T A;  1N4W A;  4YSZ A;  3VA8 A;  3VDG A;  2E3T A;  3TTE A;  2PTX A;  1KN0 A;  4TM4 A;  2FJD A;  1GPE A;  4G8T A;  1JEH A;  3EKG A;  2YR6 A;  4B64 A;  4AP3 A;  4NTC A;  2AL2 A;  5FJP A;  3ATR A;  3UKH A;  5CKU A;  4H4Z A;  4BK3 A;  1LJ1 A;  2GGI A;  2AL2 B;  2YVG A;  4LA1 A;  2B9X A;  5EU9 A;  3AE7 A;  2ZZC A;  4Z43 A;  5BUK A;  2TMD A;  2ACZ A;  2XFN A;  1GRF A;  2XLR A;  3AD7 B;  1BGN A;  4B1B A;  3CNJ A;  2R0P A;  3ABV A;  5M0Z A;  3GC2 A;  3NO1 A;  1ZDL A;  2V61 A;  4E8G A;  2GGH A;  4H50 A;  3ICS A;  4USR A;  2QJJ A;  4GGB A;  3TWA A;  3NVW B;  4OPU A;  4H4S A;  2OAL A;  4FK1 A;  2QQ6 A;  4N9X A;  2GV8 A;  3SX6 A;  2PU0 A;  3QVP A;  4HN8 A;  4TM0 A;  4CCR A;  2HZG A;  2OLO A;  1XS2 A;  2IVD A;  3DJE A;  1LVL A;  3CPI G;  3CTY A;  1NU5 A;  2YLR A;  3I3L A;  4H2Q A;  4X9M A;  1PDY A;  2Q0L A;  3U9I A;  1EC9 A;  1P2E A;  3R10 A;  4G74 A;  4NEW A;  4U2T A;  2X8H A;  1FOH A;  3AYI A;  3N6H A;  4JDR A;  1GRT A;  4H4P A;  2BCP A;  3FV9 A;  3TJI A;  2WS3 A;  2XGZ A;  2GAH B;  3JSK A;  3R0K A;  4YKG A;  1CC4 A;  2HXU A;  3P4S A;  4AT2 A;  1FIQ B;  3TCS A;  3HYX A;  5DBJ A;  4H83 A;  3T2K A;  1PBD A;  5GRT A;  4ZOH B;  2W54 A;  3D9X A;  3FPZ A;  2XH2 A;  5KOX A;  4AP1 A;  2XVJ A;  2XVH A;  4DGK A;  1ZOY A;  3A7R A;  4KWS A;  5BOF A;  1L9C A;  4E6M A;  1EL9 A;  4B63 A;  2WES A;  2YR5 A;  3R0U A;  1M6I A;  3QFA A;  1V97 A;  4I59 A;  2GSH A;  1REO A;  3UKF A;  1WUE A;  3CPJ G;  4EMI A;  1FEA A;  3CGC A;  4H4V A;  3UTE A;  2XLS A;  3ZLG A;  3N4E A;  1GT8 A;  3EPT A;  3HPF A;  1JRP A;  3GYJ A;  2PS2 A;  2VRM A;  2BC0 A;  4YWO A;  4X9N A;  4G6H A;  3QSE A;  1GXF A;  2CDU A;  3D46 A;  2GRT A;  3QN3 A;  3CN8 A;  4UP3 A;  4G6G A;  4ADW A;  3NXL A;  2OQY A;  3ES8 A;  2GVC A;  1L8P A;  4H2N A;  4RG3 A;  1D4D A;  4DWD A;  1CC2 A;  1MDR A;  5KWF A;  3DA1 A;  3GYI A;  2GQF A;  1H82 A;  3GSI A;  3UKA A;  3CGD A;  1PXA A;  3AE4 A;  5FS8 A;  5FJT A;  3UOV A;  2YAU A;  1PBC A;  5J04 A;  1F9C A;  5U1O A;  3ITJ A;  4GDP A;  2PTZ A;  2QJM A;  4A35 A;  3DG7 A;  1XPY A;  1SB3 B;  2NPX A;  5EOW A;  1XAN A;  1WUF A;  2JB1 A;  3AE8 A;  1LQU A;  4Z2R A;  3MY9 A;  2VRL A;  1PJ7 A;  1ZK7 A;  2XVE A;  4HB9 A;  3A7A A;  3V3O A;  3UKQ A;  3II4 A;  3IJQ A;  2BS4 A;  1CJ3 A;  1PXC A;  2OX4 A;  3OP2 A;  1TYT A; 
#chains in the Genus database with same CATH homology
 1JRX A;  4IA5 A;  1F8W A;  2YVJ A;  3DJG X;  2C4C A;  4A7A A;  1CL0 A;  1GRH A;  4OPG A;  3CIR A;  2BRY A;  1TYP A;  2CUL A;  2YM1 A;  3NTD A;  4U8N A;  4AOX A;  2ZZB A;  1L0V A;  1K4Q A;  2V3B A;  2X50 A;  2Q7V A;  1H81 A;  3V76 A;  2C73 A;  5KVI A;  2RGJ A;  3AE2 A;  1SEZ A;  4OPC A;  1GV4 A;  1CJ2 A;  3QVR A;  3KLJ A;  4APN A;  1Q9I A;  2AQJ A;  1CF3 A;  2C7G A;  1MO9 A;  3RP7 A;  3GDN A;  3AWI A;  3LOV A;  4JN9 A;  4II2 A;  4A79 A;  4A9W A;  1IUS A;  4B66 A;  3L5O A;  4EQW A;  2AR8 A;  3AEB A;  4CNK A;  3RP6 A;  3AEC A;  1PBB A;  2WU5 A;  3WE0 A;  5KOW A;  1S3E A;  2XCG A;  3SFD A;  4C77 A;  3GDP A;  2WPE A;  1TDN A;  5KMS A;  2R0C A;  1TDE A;  2EQ9 A;  3UTG A;  5M10 A;  3NYC A;  4Y4M A;  5ER0 A;  3T2Z A;  1GET A;  2QAE A;  4J57 A;  1UKV G;  2ZBW A;  1BKW A;  3RHA A;  1CC6 A;  3EF6 A;  1O95 A;  4ICY A;  1FEC A;  3GMB A;  2WP6 A;  1RSG A;  3C96 A;  3PG6 A;  3NLC A;  4K5R A;  4U8L A;  3SZW A;  3SXI A;  3HYW A;  4H4R A;  4EQS A;  3M0O A;  4JY3 A;  1F8S A;  4WX1 A;  3ICR A;  1YY5 A;  1D5T A;  2YG5 A;  4YTM A;  3AEG A;  3BI5 A;  3FG2 P;  1D7Y A;  2X99 A;  1H86 A;  3LB8 A;  1IUV A;  2YG4 A;  3SGL A;  1B37 A;  2XLT A;  4YSY A;  1PJ6 A;  4FDC B;  2JB2 A;  3AYJ A;  2XLU A;  1N4U A;  4D03 A;  3QSS A;  5BRT A;  3ALJ A;  3K30 A;  1OJC A;  3AXB A;  3SM8 A;  3NN0 X;  3NYE A;  2A89 A;  2Q6U A;  1GRA A;  4PAB A;  4OCG A;  4X4J A;  1ZOV A;  2WU2 A;  5HY5 A;  1OJ9 A;  3FBS A;  1TDF A;  1YQ4 A;  2ZZ0 A;  1KDG A;  2VVM A;  1LV0 A;  5TR3 A;  1DOD A;  1DJN A;  3B3R A;  4K8D A;  4B68 A;  2YG3 A;  4NEV A;  1E1M A;  4UDQ A;  4BV6 A;  2JKC A;  3ATQ A;  3BNU A;  3D8X A;  2WP5 A;  4H4Q A;  5JCM A;  2YR4 A;  2ARD A;  1VQW A;  4JNQ A;  5GSN A;  4CY6 A;  2H88 A;  1ZP0 A;  5KMQ A;  2RGH A;  3SZF A;  4GCM A;  3KPF A;  4NTE A;  4CNJ A;  2VQB A;  1NG4 A;  1TDK A;  3IF9 A;  3URH A;  2C67 A;  3LJP A;  4ZCD A;  1QLB A;  1P2H A;  3T2Y A;  1PBE A;  2X8C A;  1F8R A;  3NIX A;  2GF3 A;  2IVE A;  4H4W A;  3BNM A;  4A65 A;  1YQZ A;  1IUU A;  4AT0 A;  4GUV A;  2C70 A;  2W0H A;  1ZKQ A;  3K7T A;  2XDO A;  2RGO A;  3COX A;  1S2Y A;  2VVL A;  3DGZ A;  2GAG B;  1DOC A;  2OAM A;  3ISH A;  4EMJ A;  1YKJ A;  2XFU A;  3UP5 A;  4A5L A;  3PS9 A;  3NG7 X;  2XLP A;  5KRQ A;  4REK A;  3AB1 A;  4H2P A;  5JRB A;  2RAB A;  2B7R A;  1PXB A;  4U2L A;  1IUW A;  3ICT A;  4CCQ A;  4DNA A;  2C65 A;  3GYX A;  2WHD A;  4K5S A;  4HA6 A;  4K22 A;  5JCI A;  4H4U A;  3GMC A;  1VG9 A;  1NG3 A;  3QSM A;  1GAL A;  4ZCC A;  1CHU A;  3AED A;  4JY2 A;  2J3N A;  3I6D A;  3BHK A;  4Z24 A;  1JU2 A;  2UZZ A;  3ALM A;  4RG4 A;  1IUX A;  3L8K A;  4KX6 A;  4MJW A;  4Z26 A;  5L46 A;  4H4T A;  3BI2 A;  3RP8 A;  1B4V A;  1VRQ B;  1AOG A;  1E1K A;  3T37 A;  3D1C A;  3G5Q A;  2XFO A;  4Z44 A;  2H89 A;  2JK6 A;  2YLW A;  2A8X A;  2AAQ A;  4GRT A;  2A87 A;  2NVK X;  3CPH G;  1XHC A;  1CJC A;  2F5Z A;  1NEN A;  2BAB A;  3IHG A;  4YSX A;  2YVF A;  1B5Q A;  1E7P A;  3AEE A;  3OZ2 A;  1IJH A;  2GR2 A;  3AD9 B;  3VR9 A;  4H4Y A;  2JB3 A;  1BWC A;  2Y6Q A;  4A99 A;  5EBK A;  4EM3 A;  2BAC A;  4OPT A;  1N4W A;  4IVM B;  4YSZ A;  4YKF A;  3NN6 X;  3AEF A;  3UTF A;  5C2T A;  3DJD A;  2Z5Y A;  4IA6 A;  2GEW A;  1KN0 A;  4EQX A;  2WP9 A;  3HYV A;  3VR8 A;  4TM4 A;  2B9Y A;  1W4X A;  1TDO A;  4TM1 A;  4K2X A;  3E1T A;  4GAP A;  4A6N A;  2WBA A;  1K0I A;  2FJD A;  3GD4 A;  2C76 A;  4B67 A;  4EQR A;  1GPE A;  2PYX A;  4ZN0 A;  1H7X A;  1L9D A;  3R9U A;  2V3A A;  4A6N B;  1JEH A;  3RNM A;  1S3B A;  4J33 A;  3T0K A;  2I0Z A;  1ONF A;  1E1L A;  2YR6 A;  1NPX A;  1RP0 A;  3ADA B;  2TPR A;  1F6M A;  5CQF A;  4IV9 A;  3DGH A;  4B64 A;  4AP3 A;  1JNR A;  4NTC A;  3ATR A;  1KNP A;  3CND A;  1DNC A;  3UKH A;  5CKU A;  4H4Z A;  4BK3 A;  1LJ1 A;  1DOB A;  2YVG A;  3SZC A;  4LA1 A;  2B9X A;  4Y4L A;  3VRD B;  3VQR A;  3AE7 A;  2BK4 A;  2ZZC A;  4Z43 A;  2YLZ A;  5BUK A;  4JQ9 A;  1DOE A;  1RYI A;  3DK8 A;  4M52 A;  1LTX R;  2TMD A;  2ACZ A;  3F8R A;  3K7Q X;  2XFN A;  5KMP A;  1GRF A;  4O5U A;  1EL5 A;  2XLR A;  3AD7 B;  1BGN A;  2WPF A;  4B1B A;  3CNJ A;  1KSS A;  4LU6 A;  2R0P A;  3ABV A;  5M0Z A;  5U63 A;  2R9Z A;  5HYM A;  3UP4 A;  1PDH A;  4YTN A;  4GDE A;  4II3 A;  2YG6 A;  2VZ2 A;  2FBW A;  1N1P A;  1O5W A;  1ZDL A;  4YTP A;  2X3N A;  1PBF A;  2R45 A;  2V61 A;  3F8P A;  4IVO B;  3NK1 X;  4O5Q A;  3KA7 A;  3EAN A;  2YQU A;  4H50 A;  3ICS A;  3Q9T A;  2GMJ A;  4USR A;  1OJD A;  4U2S A;  2WOV A;  4WCT A;  3SFE A;  4C3Y A;  1GTH A;  3G5R A;  3CNP A;  4LII A;  2E4G A;  2CVJ A;  3M12 A;  3NK0 X;  4BUR A;  4GF7 A;  4C74 A;  4OPU A;  4H4S A;  4B69 A;  2OAL A;  4GAV A;  4FK1 A;  3EAO A;  5EB4 A;  1GRE A;  3UOX A;  4NNJ A;  4N9X A;  1KFY A;  2GV8 A;  4J31 A;  1MOK A;  3SX6 A;  3AE5 A;  3IWA A;  2BXR A;  2C75 A;  4CBQ A;  5FS7 A;  3QVP A;  1D4C A;  2V60 A;  4KPR A;  5JCL A;  2B7S A;  1HYU A;  4BJZ A;  5HXI A;  1EL8 A;  1Q1W A;  3DJJ A;  4EM4 A;  4TM0 A;  4G9K A;  4CCR A;  5IQ1 A;  3CGB A;  2OLO A;  3AYL A;  3P4R A;  4FK1 C;  2XFP A;  4XWZ A;  2IVD A;  3DJE A;  1LVL A;  3NT6 A;  2BC1 A;  3CPI G;  3CTY A;  1E6E A;  2BXS A;  2YLR A;  4I58 A;  4FX9 A;  3I3L A;  1GRG A;  3QFB A;  2FJB A;  3RED A;  5IPY A;  1Y56 A;  1H83 A;  1JRZ A;  1XDI A;  4H2Q A;  1D4E A;  4X9M A;  1BF3 A;  2BYB A;  2Q0L A;  3GRS A;  4BK2 A;  2XVF A;  3F8D A;  1H7W A;  1K0L A;  1P2E A;  1Y56 B;  1GES A;  2BRA A;  2FJE A;  4G74 A;  2R4E A;  4U8K A;  4NEW A;  2Q0K A;  3P1W A;  4PAA A;  4U2T A;  1NHS A;  4TLZ A;  3SZ0 A;  2X8H A;  3NKS A;  1FOH A;  3DK9 A;  3DK4 A;  1QJD A;  2WDR A;  1ZY8 A;  3AYI A;  1GSN A;  2DKH A;  4U8O A;  3VRB A;  4ECH A;  4GR1 A;  4JDR A;  3ZYX A;  1GRT A;  1GER A;  4H4P A;  2BCP A;  2JBV A;  3CGE A;  1IUT A;  3V3N A;  2WS3 A;  2YLX A;  1NDA A;  2GAH B;  2HQM A;  2BS2 A;  2C72 A;  4U8P A;  4P9S A;  1S7M A;  3JSK A;  4EIQ A;  2EQ8 A;  4XXG A;  1Y0P A;  2WOI A;  3NNE A;  2FJA A;  4YKG A;  1CC4 A;  4U8M A;  1LQT A;  3NRN A;  2YLT A;  3P4S A;  4AT2 A;  1Z6L A;  3UOZ A;  4D04 A;  2WOW A;  1VDC A;  4OPI A;  2WQY A;  3HYX A;  2WDQ A;  4E0V A;  2VQ7 A;  2E1M A;  3KU9 A;  2R46 A;  3LZW A;  4H7U A;  5DBJ A;  4H2R A;  2QA1 A;  1COY A;  2EQ6 A;  5KXJ A;  2GR1 A;  5FS9 A;  3T2K A;  1PBD A;  3LAD A;  4BJY A;  5GRT A;  1KSU A;  2BK5 A;  3VRA A;  3IHM A;  3AD8 B;  3D9X A;  3FPZ A;  4EMW A;  1TRB A;  1XPQ A;  4AP1 A;  5KOX A;  2Z5X A;  4J34 A;  4U8J A;  4NWZ A;  4J2W A;  1PN0 A;  2YG7 A;  4U8I A;  3KPK A;  3UKP A;  2XVJ A;  3UOY A;  2XVH A;  1FEB A;  5EB5 A;  4DGK A;  1ZOY A;  3LXD A;  2IID A;  1L9C A;  2CFY A;  3FIM B;  4TM3 A;  1LPF A;  1N4V A;  2XFQ A;  4OPD A;  1ZMC A;  3SQP A;  1EL9 A;  1ELI A;  2GMH A;  5HHF A;  2WES A;  4B63 A;  2YR5 A;  5JCN A;  4Y4N A;  2X8G A;  3GD3 A;  2VOU A;  3KVE A;  4BK1 A;  3P4Q A;  1M6I A;  2R4J A;  3QFA A;  1ZMD A;  4I59 A;  3SY4 A;  1GEU A;  5JCK A;  1H84 A;  4CRT A;  1KF6 A;  1MXT A;  1REO A;  3UKF A;  5KVH A;  2Y6R A;  1NAA A;  4DSG A;  2PHH A;  3NH3 X;  3CPJ G;  4NZH A;  2WDV A;  4EMI A;  1FEA A;  1QO8 A;  3ZDN A;  1Q1R A;  3CGC A;  3C4A A;  4OVI A;  1S2Q A;  4H4V A;  4YT0 A;  3UTE A;  3CMM A;  4C3X A;  1E39 A;  4CY8 A;  1EL7 A;  1V59 A;  4B65 A;  2WEU A;  2XLS A;  2GB0 A;  1GT8 A;  4RSL A;  5BVA A;  1O94 A;  1DJQ A;  3EPT A;  4USQ A;  5LV9 A;  3AEA A;  1JNZ A;  3CNS A;  3GYJ A;  5KNL A;  3H8L A;  3H8I A;  1NHQ A;  3UCL A;  2VRM A;  3S61 A;  2BC0 A;  4YWO A;  1L9E A;  4X9N A;  4G6H A;  5BUL A;  4YSH A;  2BCG G;  1JRY A;  3NK2 X;  1KNR A;  3QSE A;  2R0G A;  1GXF A;  2CDU A;  3NYF A;  2C3C A;  3P4P A;  4G73 A;  2GRT A;  1NHR A;  4DSH A;  1BZL A;  3CN8 A;  3KKJ A;  4UP3 A;  4G6G A;  1GRB A;  3H4K A;  2APG A;  2B76 A;  4UDR A;  4XWR A;  2BS3 A;  4ADW A;  3SYI A;  3UTH A;  1K0J A;  3DH9 A;  3AE9 A;  2GVC A;  5J7X A;  3DME A;  1GND A;  3NHO X;  4H2N A;  4YXD A;  4JNA A;  2QA2 A;  1B8S A;  4RG3 A;  1D4D A;  3AE1 A;  2B9W A;  2DKI A;  4EIP A;  3UKK A;  3NGC X;  1CC2 A;  4Z2U A;  2C64 A;  5KWF A;  1CJ4 A;  1F3P A;  1JOA A;  2WET A;  3M13 A;  3DA1 A;  3GYI A;  2GQF A;  2GQW A;  1H82 A;  1YQ3 A;  2OLN A;  3GSI A;  3UKA A;  1PHH A;  2WPC A;  3CGD A;  3LZX A;  3C4N A;  1PXA A;  3AE4 A;  1OJT A;  5FS8 A;  3BHF A;  5FS6 A;  3UOV A;  3AE3 A;  2O9Z A;  3GWD A;  2XVI A;  2GR0 A;  2YAU A;  1PBC A;  1DXL A;  3UKL A;  2V5Z A;  1PS9 A;  1FL2 A;  2QCU A;  3Q6J A;  5U1O A;  1D7L A;  2YWL A;  4Z2T A;  2YM2 A;  3ITJ A;  2GR3 A;  1M64 A;  4GDP A;  4UDP A;  1OJA A;  3BI4 A;  3PVC A;  3OC4 A;  1NHP A;  3K7M X;  4Z25 A;  1BGJ A;  1ZX9 A;  2E5V A;  3P9U A;  3NTA A;  4H4X A;  1VG0 A;  3GRT A;  2C66 A;  3ALL A;  3B6D A;  3CNT A;  4NTD A;  5J60 A;  2NPX A;  1CBO A;  3HZL A;  2V6O A;  1E1N A;  2YLS A;  5EOW A;  1FCD A;  1XAN A;  3G5S A;  3PO7 A;  2BK3 A;  3QJ4 A;  1GOS A;  3FMW A;  2JB1 A;  1H2I A;  3AE8 A;  3L1R A;  4J56 A;  4C5O A;  2VVL G;  5C3J A;  1LQU A;  3T31 A;  2EQ7 A;  4Z2R A;  3KD9 A;  2VRL A;  3GWF A;  1PJ7 A;  2XYO A;  1ZK7 A;  3O0H A;  2OA1 A;  4AOS A;  5IQ4 A;  1EBD A;  2JAE A;  2XVE A;  4OPL A;  1NEK A;  3IC9 A;  1GTE A;  2GH5 A;  4HB9 A;  5KMR A;  3T14 A;  3V3O A;  3UKQ A;  3II4 A;  5FMH A;  4K7Z A;  4TLX A;  2BS4 A;  1CJ3 A;  1PXC A;  2BA9 A;  1PJ5 A;  4J36 A;  3AE6 A;  1TYT A;  1H6V A;  5U25 A;  2C3D A;  1X31 B;  3S5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...