5U1OA

2.3 angstrom resolution crystal structure of glutathione reductase from vibrio parahaemolyticus in complex with fad.
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
450
structure length
450
Chain Sequence
b'ATHFDYICIGGGSGGIASANRAAMYGAKVALIEAQDLGGTCVNVGCVPKKVMWHGAQIAEAMNLYAEDYGFDVDVKGFDWSKLVESRQAYIGRIHQSYDRVLGNNKVNVIKGFAKFVDEKTVEVNGEHYTADHILIAVGGRPTIPNIPGAEYGIDSNGFFDLAEQPKRVAVVGAGYIAVEIAGVLHALGTETHLFVRKESPLRSFDPMIIDTLVEVMEAEGPTLHTHSVPKEVVKEADGSLTLHLENGESQNVDQLIWAIGRHPATDAINLASTGVATNEKGYIKVDEYQETNVKGIYCVGDIMEGGIELTPVAVKAGRQLSERLFNNKPNAKMDYDLVPTVVFSHPPIGTIGLTTQEAEEKYGKDNIKVYTSGFTAMYTAVTKHRQPCKMKLVCAGEEETVVGLHGIGFTVDEMIQGFGVAMKMGATKADFDSVVAIHPTGSEEFVTMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione reductase
publication title 2.3 Angstrom Resolution Crystal Structure of Glutathione Reductase from Vibrio parahaemolyticus in Complex with FAD.
rcsb
source organism Vibrio parahaemolyticus serotype o3:k6 (strain rimd 2210633)
molecule tags Lipid binding protein
total genus 146
structure length 450
sequence length 450
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5u1oA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5u1oA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5u1oA02
3UTGA 4EQXA 3NNEA 2O9ZA 2E5VA 3QVRA 2BA9A 1GV4A 3RNMA 3PO7A 2JB1A 5L46A 3EF6A 2FJAA 1GETA 3DK9A 2C3CA 4J56A 1IUSA 4WX1A 3SM8A 3P4PA 3GMBA 4B69A 2BC1A 3EPTA 3P4SA 1BZLA 5LV9A 4TM0A 2H89A 1OJDA 5J7XA 3AEBA 2OLOA 1CL0A 1E7PA 1KDGA 2A89A 4GF7A 3NK2X 4B65A 1RP0A 3F8RA 3NHOX 3DJJA 2B9WA 4JNQA 4B64A 2VVLG 2WPEA 3CPJG 3NT6A 2GF3A 5BUKA 4JN9A 3CGDA 3HZLA 1CC4A 1RYIA 2WU5A 1ONFA 3AEGA 3ISHA 3L1RA 3K7MX 4YSHA 4OPUA 4H4ZA 1P2EA 3T37A 2Q0LA 5BULA 4J33A 4NEVA 3Q6JA 3C4NA 3IWAA 4B63A 3BNUA 1PBEA 1S2QA 1GRBA 3PVCA 3UKAA 3UKPA 1PXBA 2V61A 3AWIA 1E1KA 3AYJA 3IHMA 1VDCA 2EQ7A 1GRGA 2R4JA 1EL7A 1D4EA 2JAEA 4DSHA 4C3XA 1KNPA 4YSXA 4ECHA 2X8GA 3I6DA 2JB2A 2GQFA 4I58A 2WP6A 4AT0A 3E1TA 2YR5A 2ACZA 1NHQA 3NG7X 4IVMB 2FBWA 4GRTA 3UKHA 1B4VA 3UKFA 1GRFA 1KFYA 2C76A 3GMCA 1DOCA 3QSEA 2GQWA 1L9DA 1NHPA 4Z2UA 1H84A 3ZYXA 3FG2P 1NAAA 5EOWA 5KVIA 1HYUA 2Z5YA 3ZDNA 1DOEA 3CGCA 1TDEA 2OALA 2YLZA 5M0ZA 5IPYA 4J34A 4KPRA 5U25A 1B5QA 4U8KA 2W0HA 2YVJA 4EMJA 2B9XA 4O5UA 2GR1A 4LIIA 2GB0A 4A7AA 2BS4A 4JY2A 1V59A 3QFBA 1VG0A 2IIDA 2V3AA 1PJ5A 2YG3A 1XPQA 1OJ9A 3LZWA 2I0ZA 3GYIA 4J57A 5TR3A 3ITJA 2RGHA 1ZP0A 1ZMCA 2GAHB 2JB3A 4TLXA 3VQRA 3V3NA 3EANA 2A87A 3BHFA 3DJEA 1CC6A 2QCUA 3P9UA 2X99A 4ICYA 1BKWA 1IUXA 4H4SA 3OC4A 3C4AA 4PABA 4X9NA 3VR8A 3EAOA 1PXAA 3BHKA 3KA7A 2BABA 2RABA 2VZ2A 3NKSA 1ZY8A 3II4A 4JDRA 2BK4A 4A79A 1DJQA 2XLRA 2QAEA 1DNCA 2WOVA 1X31B 3AEEA 4OPDA 2JK6A 1VQWA 4YTPA 1XHCA 1Y0PA 1PBDA 3CGEA 5BRTA 3S61A 4J31A 1N4UA 3LB8A 4AT2A 1NG4A 4EQWA 2AR8A 3KPFA 3NIXA 4U2TA 3AE4A 1E1LA 3AE5A 1ZOYA 4GR1A 3LOVA 3ALJA 3GDPA 3KLJA 3SFDA 2GR2A 1ZDLA 2WQYA 4CBQA 3PS9A 3R9UA 1REOA 1FL2A 1F8RA 2YG5A 1OJTA 3BNMA 2WPFA 1PJ6A 3ATRA 4N9XA 4H50A 3P1WA 2XFUA 5J60A 1FOHA 4BJZA 1CC2A 3GDNA 2R9ZA 4IVOB 1E1MA 2RGOA 4K8DA 2BACA 3KU9A 1KNRA 3VRDB 1S3EA 5JCMA 1LJ1A 3B6DA 1KSUA 4NTDA 2R4EA 1S3BA 1Z6LA 3V3OA 1JOAA 4PAAA 4AP1A 2C3DA 1EL8A 2OAMA 2Y6QA 4J2WA 2V6OA 4A5LA 3NN0X 5U1OA 1TYTA 4ZCDA 2WP5A 1FEAA 3L8KA 3ICSA 2BC0A 2WDRA 5FS6A 3B3RA 4EMWA 2XVJA 1GRAA 1H7XA 3CIRA 1E39A 3M12A 1Q9IA 2GR3A 2BS3A 3H8LA 4DSGA 3FPZA 4A65A 2F5ZA 1B37A 2OA1A 2EQ6A 1JRYA 1TDOA 1JNZA 1H83A 4B1BA 1GPEA 4YTMA 4Z2RA 1PHHA 2HQMA 3ICRA 3NH3X 3UTFA 1ZX9A 3CNSA 4LU6A 4X9MA 2CULA 4C3YA 1NEKA 1K0JA 2XVHA 1L9CA 3KD9A 2XFQA 3AE8A 2XLUA 4Z2TA 3COXA 2WOIA 4NEWA 3IHGA 3FBSA 3UKLA 2DKIA 3DMEA 1LV0A 3LADA 5HYMA 4O5QA 1Y56A 4HB9A 2YAUA 3DGZA 1FEBA 3NLCA 1NPXA 1IJHA 1GXFA 1MXTA 1OJAA 2BK5A 4UDPA 5U63A 3WE0A 3URHA 2XVEA 1ZMDA 1LTXR 5KOWA 3GD3A 1TDKA 2XLSA 3RP6A 3BI5A 1PS9A 1Y56B 2V5ZA 3IC9A 3NTAA 1QJDA 1YQZA 1H81A 2GVCA 2X8HA 2NPXA 4RSLA 3GYJA 4TM1A 3AE6A 1B8SA 4YT0A 2ZZ0A 3M13A 2IVDA 2R0CA 2XFPA 1EL9A 4H4RA 3GSIA 2ZZBA 2C75A 2FJBA 3AD9B 1K4QA 1E6EA 4MJWA 1MO9A 2C67A 4A6NB 1PBBA 3DK4A 5FS7A 2RGJA 4XWRA 4EMIA 2XYOA 3S5WA 1F8SA 1Q1RA 3SGLA 4AOSA 3UOVA 2YQUA 2C72A 1ZK7A 3DJDA 4C77A 1OJCA 1K0IA 2BXSA 4YKFA 2BCGG 3KKJA 3VRBA 1D7YA 4U8PA 1TDNA 4BK1A 4TM3A 4Y4MA 3UOXA 2GV8A 4EM3A 4GDEA 4GUVA 2JKCA 4REKA 4B67A 4BK3A 4BK2A 1YQ4A 2APGA 4FDCB 1JRXA 5CQFA 3NRNA 3GWFA 2VVLA 2AQJA 1JNRA 3SFEA 4EQRA 4DGKA 4U8JA 2DKHA 3ALLA 4A9WA 2VQ7A 1H86A 4H2RA 3O0HA 4IV9A 3FIMB 2XCGA 1BF3A 1CF3A 4Y4NA 1JU2A 4U8MA 1ZKQA 4HA6A 1GSNA 1PDHA 2C66A 3D1CA 4ADWA 2C70A 4CNJA 4AP3A 5GSNA 3AB1A 4J36A 3DGHA 2B9YA 1DOBA 2WDVA 3JSKA 3CGBA 1LQUA 3UKKA 3NYCA 4U8NA 2XVFA 4EM4A 3ALMA 1LQTA 4UDRA 2GH5A 5FS9A 4UDQA 5M10A 2VOUA 2WESA 4NZHA 1GT8A 1JRZA 1N4VA 3ATQA 1FCDA 1EL5A 3AXBA 3AE2A 5EB5A 4CCRA 5HY5A 2XFNA 4RG3A 2XLTA 3K7TA 2YR6A 3DH9A 5FS8A 3ABVA 3QVPA 4OCGA 4EQSA 4DNAA 4E0VA 4Z24A 2YVFA 3CTYA 2VRMA 4WCTA 1GREA 1CJ2A 1TRBA 4OPIA 4TLZA 4U8IA 2Q6UA 5HXIA 4H4YA 1GERA 4USRA 4APNA 4U8OA 5IQ4A 2QA2A 2OLNA 1W4XA 4AOXA 1FECA 2X50A 1H7WA 3UP4A 1PBCA 4YXDA 3Q9TA 4TM4A 2X3NA 2J3NA 4K22A 1GRTA 4NTEA 1D4CA 4D03A 4YWOA 1YQ3A 5HHFA 1PXCA 2ARDA 1KSSA 3C96A 2VQBA 1GTEA 1N1PA 1BWCA 2GR0A 3BI2A 3CPHG 3NYFA 4X4JA 4CNKA 1L9EA 1QO8A 4XWZA 1GALA 1IUTA 1COYA 2QA1A 4H2QA 4OPGA 3AE9A 2TPRA 2YWLA 3UTHA 2ZBWA 3OZ2A 4K5RA 3F8DA 5KRQA 2AAQA 4FK1C 4CY6A 1EBDA 2WPCA 1M64A 1N4WA 4IA6A 4H4XA 3GRTA 1CBOA 4H4UA 5JCLA 4JQ9A 2C7GA 4B68A 2R0PA 3F8PA 5C2TA 5JCIA 2R46A 2XVIA 3D8XA 1KF6A 1CJCA 2UZZA 1DJNA 1GEUA 1VRQB 4USQA 1F3PA 4YTNA 1F8WA 2BXRA 1NHSA 1XANA 3AEAA 4JY3A 4OVIA 2GMJA 5EB4A 1D7LA 2CVJA 5DBJA 4A6NA 1H6VA 4Y4LA 4Z25A 2PYXA 1LVLA 2GAGB 4H4TA 2XDOA 3ADAB 1O94A 1PJ7A 2WS3A 4NTCA 3AEFA 2EQ9A 3AE1A 3GWDA 2V3BA 3I3LA 3DK8A 2YR4A 3AE3A 4B66A 3VR9A 1BGJA 1MOKA 2B76A 1AOGA 3DA1A 4LA1A 1DXLA 3AYIA 3NK0X 1ELIA 2WHDA 4C74A 2BK3A 3SQPA 1GOSA 2B7RA 3G5SA 4IA5A 1IUUA 1PBFA 1ZOVA 3GD4A 1GESA 4H4QA 3V76A 3QSMA 2BCPA 3CNDA 3NYEA 1K0LA 1YKJA 2VVMA 3LJPA 4K7ZA 2JBVA 1E1NA 2E4GA 2X8CA 4K5SA 3UOYA 2CFYA 2YG4A 2E1MA 4D04A 3NK1X 2YM2A 3UCLA 2YG7A 1D4DA 4UP3A 4BV6A 2CDUA 2R45A 4OPLA 4U8LA 1O5WA 2YG6A 3CPIG 3RP7A 3GRSA 3UTEA 3NTDA 3P4QA 1NHRA 5KXJA 4U2SA 2WBAA 1O95A 4A99A 1RSGA 4CCQA 4FK1A 1P2HA 4C5OA 2B7SA 5JCNA 1S2YA 2WETA 3H4KA 1PN0A 3AE7A 3LXDA 3LZXA 1LPFA 2A8XA 1JEHA 2Q7VA 5EBKA 4M52A 3K30A 1NG3A 3RHAA 1H82A 2BS2A 4BJYA 5C3JA 2XLPA 2IVEA 2YM1A 3CNJA 2Y6RA 4H7UA 2WP9A 3RP8A 4FX9A 4YSYA 2C73A 4ZN0A 2C65A 1QLBA 2GMHA 1NDAA 1SEZA 3BI4A 4XXGA 5CKUA 1IUVA 1GNDA 2PHHA 2WDQA 1IUWA 3NGCX 1CJ4A 1M6IA 3AD8B 3NN6X 2V60A 4K2XA 5KOXA 2Z5XA 1XDIA 4H4WA 1L0VA 4EIPA 4CY8A 4Z43A 3UKQA 5GRTA 4KX6A 1GRHA 2Q0KA 1CJ3A 4GCMA 4I59A 1GTHA 2YLSA 1BGNA 4H2PA 4P9SA 3AECA 5FMHA 3P4RA 2YLXA 2YLRA 1F6MA 1CHUA 3AYLA 1TYPA 2WU2A 4EIQA 3G5QA 5BVAA 4RG4A 4GDPA 3QJ4A 2FJEA 4OPTA 2GRTA 4Z26A 3CNPA 3CNTA 2FJDA 2YLTA 1TDFA 3H8IA 3IF9A 2C64A 3QFAA 4H2NA 5KWFA 2VRLA 3AEDA 4ZCCA 2EQ8A 3AD7B 4JNAA 3QSSA 3VRAA 1VG9A 3K7QX 3FMWA 3KVEA 3G5RA 4H4PA 4Z44A 2R0GA 1Q1WA 4U2LA 5IQ1A 4YKGA 1NENA 3DJGX 5KVHA 2WOWA 4BURA 1D5TA 5JCKA 2H88A 4OPCA 2TMDA 3ICTA 3REDA 1DODA 2ZZCA 2WEUA 2XFOA 2BYBA 4YSZA 1YY5A 3UOZA 1UKVG 3CN8A 2YVGA 2YLWA 2NVKX 5ER0A 4CRTA 3M0OA 3UP5A 2GEWA 4H4VA
chains in the Genus database with same CATH superfamily
4EQXA 3RNMA 2FJAA 3DK9A 3SM8A 3RGTA 3P4PA 3U9IA 3UXLA 3P4SA 5BOFA 4TM0A 5J7XA 4J3ZA 2OLOA 1CL0A 1E7PA 1KDGA 2A89A 1RP0A 1JPMA 2VVLG 4JN9A 1T3QC 3UCCA 3K7MX 3SZ0A 3IWAA 3ZVHB 4B63A 3EEZA 1GRBA 3RRAA 3UKPA 3AYJA 2EQ7A 4EWJA 2R4JA 4DSHA 3MWCA 1KNPA 4ECHA 3FCPA 2GQFA 3NG7X 3UKHA 1GRFA 1KFYA 3ZYXA 3FG2P 1NAAA 1HYUA 3CGCA 2OALA 5M0ZA 5IPYA 4MMWA 1B5QA 2HZGA 4JY2A 1TZZA 2PP0A 1OJ9A 3GYIA 4J57A 1P48A 2GAHB 4TLXA 3V3NA 4HCLA 1CC6A 4ICYA 1X2GA 3Q4DA 1IUXA 3JW7A 4H4SA 3OC4A 3VR8A 3EAOA 2OQYA 3IJQA 1DNCA 4IZGA 3ZLHA 3FXGA 1PBDA 3CGEA 2FYMA 3CMMA 3OZYA 3NIXA 1ZOYA 3GDPA 3EKGA 2XH7A 1FHVA 3PS9A 1OJTA 3CXBA 3BNMA 4N9XA 5J60A 3T2ZA 1VDVA 4IVOB 4K8DA 3KU9A 1S3EA 4A3RA 3IK4A 2C3DA 4K2SA 1MUCA 4J2WA 5U1OA 3OPSA 3DFYA 3ICSA 3NZGA 4EMWA 2XVJA 3FYYA 5KNLA 3DG6A 4E6MA 1Q9IA 4DSGA 5KMQA 1JNZA 2XH2A 1H83A 4GAVA 2HQMA 3D46A 4MGGA 3SN4A 4X9MA 1L9CA 3KD9A 2XLUA 2WOIA 3FBSA 4DX3A 3T14A 5HYMA 2YAUA 1FEBA 3NLCA 5U63A 4G73A 3URHA 1LTXR 5KOWA 3GD3A 1TDKA 1PS9A 3S47A 4E5TA 2OO6A 1Y56B 4HNCA 1QJDA 2X8HA 4TM1A 4YT0A 2IVDA 4H4RA 2ZZBA 2FJBA 3DK4A 3UJEA 4XWRA 4AOSA 1OJCA 2BCGG 3KKJA 3B9JB 1SJCA 3UOXA 2GV8A 4B67A 4GDEA 4REKA 4BK3A 4BK2A 1JRXA 2AQJA 2I5QA 4DGKA 3VC6A 3D9XA 3FIMB 4Y4NA 4U8MA 1ONEA 4DYEA 2C70A 2BRAA 5GSNA 1JCTA 3DGHA 4G9KA 1DOBA 3ENLA 1LQTA 3A7AA 2VOUA 1FCDA 1EL5A 1JRPA 5EB5A 3K7TA 5FS8A 4Z24A 2XSXA 4Z17A 3SX6A 4OPIA 4TLZA 2Q6UA 4USRA 4U8OA 2QA2A 1EBGA 1EC9A 3CXOA 3NYFA 1GTEA 2OFJA 4X4JA 4KWSA 2HXUA 1QO8A 2QA1A 2PP1A 3AE9A 3JVAA 2ZBWA 3OZ2A 4K5RA 1R6WA 2AAQA 4FK1C 1N4WA 4IA6A 2PSNA 1CBOA 4H4UA 3TWBA 2R0PA 3R11A 2R46A 1KF6A 1DJNA 4USQA 4IHCA 4JY3A 2GMJA 3R1ZA 3HPFA 2PYXA 1LVLA 3ADAB 3JZUA 3ETRB 3SN0A 3AEFA 2V3BA 4B66A 1BGJA 3NK0X 2WHDA 4FP1A 2BK3A 4IA5A 1GOSA 2GGIA 4K7ZA 4K5SA 4D04A 3NK1X 1O5WA 3RP7A 2OZ8A 5KXJA 2PU1A 4U2SA 4A99A 3OP2A 1P2HA 3AE7A 1BKHA 2AKMA 3LZXA 2A8XA 4II2A 1JDFA 2XLPA 2IVEA 2YM1A 3NRZB 3PFRA 2Y6RA 4H7UA 2P88A 2WP9A 2C65A 1SEZA 4G8TA 2PHHA 5KOXA 1WUEA 2W54A 3UKQA 4KX6A 1GRHA 1GTHA 1N5WC 5FMHA 4JN7A 2AL2A 4RG4A 3PWIA 4ZOHB 3N6HA 2P3ZA 3QJ4A 5KWFA 3IF9A 2C64A 2VRLA 3G5RA 2R0GA 2ONEA 1NENA 3DJGX 3REDA 2QGYA 1YY5A 2NVKX 1EC8A 2E5VA 3QVRA 3H8AA 2GGJA 3PO7A 2JB1A 4DXKA 2C3CA 1L8PA 3GMBA 2BC1A 3EPTA 4G74A 2DW7A 1BZLA 2FKPA 2H89A 1OJDA 3AEBA 3HYVA 3F8RA 4JNQA 4B64A 3CGDA 1CC4A 2WU5A 1ONFA 4OPUA 3PWGA 2PS2A 4GISA 4GIRA 3T37A 5BULA 4NEVA 2CHRA 3GYXA 4G7FA 2HXTA 1N61C 3IHMA 1EL7A 3RITA 3CK5A 2WP6A 2YR5A 1NHQA 3UKFA 3VCNA 2QDEA 2C76A 3GMCA 4KT2A 1L9DA 1H84A 5EOWA 2Z5YA 3ZDNA 2YLZA 3DESA 2OG9A 1V59A 3QFBA 1VG0A 2V3AA 1PJ5A 2YG3A 2XH0A 1XPQA 2RGHA 3MUCA 1N60C 3HYWA 3VQRA 3EANA 3VFCA 2QCUA 3C4AA 3BHKA 2BABA 2VZ2A 2BK4A 3TQPA 4A79A 1XHCA 1Y0PA 3LB8A 4AT2A 4ZA0A 1NG4A 4EQWA 3AE4A 1SJDA 1E1LA 3AE5A 4GR1A 3KLJA 4CBQA 3R9UA 1REOA 1PJ6A 5IDZA 2XFUA 2C4CA 2R9ZA 3S5SA 1KNRA 5JCMA 3B6DA 1S3BA 4AP1A 3V3OA 4PAAA 3T4WA 4H1ZA 4A5LA 3NN0X 2WP5A 3I6EA 1FEAA 3L8KA 2ZC8A 2WDRA 3HW2A 3B3RA 5KMRA 1ELSA 4HCDA 2GR3A 2BS3A 2F5ZA 3NFUA 2NQLA 2E5AA 3L5OA 4B1BA 1GPEA 4Z2RA 3UTFA 3NH3X 1ZX9A 4LU6A 1K0JA 2OQHA 3AE8A 4H2HA 3IHGA 3LADA 3TOYA 4HB9A 3DGZA 1GXFA 1MXTA 3MSYA 2OZ3A 3VDGA 3GYJA 2R0CA 4MJWA 1E6EA 1MO9A 1PBBA 2RGJA 4HPNA 2XYOA 1Q1RA 2YQUA 1K0IA 2BXSA 4YKFA 4U8PA 1TDNA 4BK1A 4EM3A 2JKCA 3NRNA 3SFEA 2GL5A 3ALLA 2VQ7A 4H2RA 1MRAA 1CF3A 4A6GA 4HA6A 1IYXA 4HN8A 3AB1A 3CGBA 6ENLA 1W6TA 3V5CA 1LQUA 3NYCA 4UDRA 4EM4A 3NVYB 2GH5A 5M10A 2QJJA 2OLAA 2GSHA 4CCRA 2MNRA 2XLTA 2YR6A 1PDYA 3UJSA 3QVPA 3P93A 4DNAA 3DERA 3OZMA 1GREA 4U8IA 1S7MA 2OLNA 1ECQA 3NS1B 3SZCA 1PBCA 4TM4A 4K22A 1D4CA 4D03A 1YQ3A 4JHMA 1PXCA 2ARDA 1KSSA 3C96A 1N1PA 1BWCA 2GR0A 3CAWA 4H2QA 2YWLA 4KEMA 3F8DA 1EBDA 1M64A 3GRTA 5JCLA 1CJCA 1VRQB 1F8WA 4OVIA 3DGBA 5EB4A 1D7LA 4A6NA 3IJIA 3BSMA 2GAGB 2EQ9A 3I3LA 2YR4A 4F4RA 3V4BA 1AOGA 3AYIA 3A7RA 3GD4A 1GESA 1YEYA 2BCPA 3LJPA 3UOYA 1E1NA 2E1MA 2OVLA 3R0UA 3CPIG 5FJTA 4GAPA 4CCQA 4FK1A 4C5OA 2B7SA 2WETA 1PN0A 1JROA 4M52A 3RHAA 2BS2A 4BJYA 3CNJA 3RP8A 2C73A 1QLBA 3BI4A 1NDAA 5CKUA 1IUVA 1GNDA 2WDQA 4K2XA 1CJ4A 1M6IA 1XDIA 4DWDA 1L0VA 5GRTA 1MDRA 1CJ3A 1N5XA 1BGNA 3CT2A 3P4RA 1WYGA 4JN8A 1F6MA 1MNSA 1TYPA 3G5QA 3CYJA 1FO4A 4GGBA 2FJEA 3CNTA 2YLTA 3H70A 1EC7A 2PTXA 1TDFA 1R0MA 4JNAA 3TW9A 3VRAA 3QSSA 1VG9A 3K7QX 3SZFA 4H4PA 4Z44A 1TE6A 4ENLA 5JCKA 3SY4A 1DODA 2WEUA 2BYBA 4YSZA 3V5FA 2YLWA 4CRTA 3M0OA 3UP5A 2X3NA 3NNEA 2BA9A 4K1WA 1GV4A 4J56A 4WX1A 5LV9A 3D47A 4IP5A 4II3A 3NK2X 3NHOX 2B9WA 3ZVHA 5BUKA 3HZLA 3AEGA 3NVWB 4H4ZA 3B97A 2RDXA 2Q0LA 3C4NA 3BNUA 5KMSA 1H2IA 3PVCA 5FJPA 1PXBA 3AWIA 1E1KA 1D4EA 4I58A 3T2KA 4AT0A 3E1TA 2ACZA 4Z1YA 4GRTA 3SZWA 3CB3A 1B4VA 3N4FA 3BJSA 1DOCA 2GQWA 4Z2UA 5KVIA 3DG3A 1TDEA 4U8KA 2W0HA 4EMJA 2B9XA 3HYXA 2GR1A 4O5UA 2GB0A 2BS4A 3LZWA 2I0ZA 5TR3A 3MKCA 1ZMCA 1SJBA 2A87A 3STPA 3DJEA 1TKKA 1P43A 3RO6A 4X9NA 1PXAA 2RABA 3NKSA 1ZY8A 3II4A 1DJQA 2XLRA 2QAEA 2QJMA 2JK6A 1VQWA 4YTPA 3S61A 4J31A 3TCSA 1N4UA 3KPFA 2AR8A 3LOVA 3ALJA 2PTYA 1FL2A 1F8RA 4DN1A 2YG5A 1RM6B 3HRDC 3I6TA 3GO2A 4GYPA 1CC2A 3GDNA 1E1MA 2RGOA 2BACA 3UCDA 3VRDB 1KSUA 4NTDA 1Z6LA 1EL8A 2Y6QA 3SSZA 2BC0A 3I4KA 5FS6A 1GRAA 3PK7A 1H7XA 3ZLGA 4E8GA 3FPZA 4A65A 1B37A 2EQ6A 2MUCA 1TDOA 1PHHA 4M0XA 3CNSA 2XVHA 4Z2TA 4NEWA 3UKLA 2DKIA 1LV0A 3DEQA 1F9CA 4O5QA 1Y56A 1NPXA 1OJAA 2BK5A 4UDPA 3WE0A 3T2YA 1ZMDA 3R07C 3RCYA 3TTEA 5EU9A 4HCHA 3BI5A 2V5ZA 3IC9A 3NTAA 1H81A 3SN1A 2GVCA 4RSLA 3AE6A 2ZZ0A 2XFPA 3GSIA 2C75A 4A6NB 3AD9B 2C67A 2OPJA 4GYPC 4EMIA 1F8SA 4GMEA 3DJDA 3ZVIA 4TM3A 4NNJA 4Y4MA 4GUVA 2APGA 2QVHA 1KKRA 2VVLA 4EQRA 4U8JA 2AKZA 3QPEA 4IV9A 2XCGA 1BF3A 4IT1A 1ZKQA 1GSNA 3T8QA 2C66A 4ADWA 4AP3A 2BRYA 5JRBA 3JSKA 3UKKA 2XVFA 3ALMA 4UDQA 4NZHA 1GT8A 5HY5A 2XFNA 3DH9A 3ZLFA 3ABVA 4IL2A 4X2PA 1NELA 2VRMA 2PODA 3SBFA 5HXIA 4H4YA 3MZNA 5IQ4A 1W4XA 4AOXA 1FECA 1H7WA 4YXDA 3Q9TA 2J3NA 3NO1A 4YWOA 2VQBA 4CY8A 3AM9A 3BI2A 1L9EA 4XWZA 4OPGA 5KRQA 4CY6A 3AN1A 2WPCA 2PU0A 2GGGA 3K1GA 3F8PA 1FIQB 5C2TA 2PPGA 2XVIA 3D8XA 5FJUA 2UZZA 1GEUA 3ES7A 2BXRA 3DDMA 4ROPA 1XANA 3SQSA 3AEAA 5DBJA 2PA6A 4Y4LA 4H4TA 1O94A 4NTCA 4NWZA 3AE1A 2HNEA 2P8CA 1MOKA 3Q45A 1N63C 3DA1A 4ZCWA 4C74A 3G5SA 2B7RA 3T0KA 1KD0A 3ES8A 3QSMA 3CNDA 3NYEA 2PGWA 1YKJA 2VVMA 3VA8A 2YG4A 2YG7A 1D4DA 3FJ4A 4U8LA 2YG6A 3UTEA 3GRSA 1FFVC 3P4QA 1NHRA 2WBAA 1O95A 3TJIA 5FJOA 3H4KA 3LXDA 1JEHA 2POZA 2Q7VA 3BOXA 1NG3A 3N4EA 4IP4A 1FFUC 4G6GA 2GMHA 3NGCX 1IUWA 3AD8B 3NN6X 2V60A 2Z5XA 3R10A 4EIPA 4Z43A 4GCMA 3AECA 3T9PA 3FVDA 2YLXA 3AYLA 4EIQA 2PCEA 5BVAA 2PP3A 2GRTA 3CNPA 3NXLA 5BOEA 3AEDA 3AD7B 2AL2B 3UJ2A 1Q1WA 3TWAA 4KPLA 2QJNA 2WOWA 4BURA 5KVHA 1XS2A 3U4FA 1D5TA 3UTGA 2ZZCA 4M6UA 5KMPA 4H4VA 4G6HA 2O9ZA 5L46A 3EF6A 4IL0A 2DW6A 1GETA 1IUSA 1VQZA 1OEPA 3KPKA 1DTNA 4GF7A 4B65A 1N62C 3DJJA 3UXKA 3CPJG 2WPEA 3NT6A 3NVZB 2GF3A 1RYIA 3ISHA 3L1RA 3OTRA 4YSHA 1P2EA 1V97A 4J33A 3Q6JA 1PBEA 1S2QA 3UKAA 2V61A 1VDCA 1GRGA 4K8GA 2JAEA 4C3XA 4YSXA 2X8GA 3I6DA 2JB2A 4IVMB 2FBWA 4GGHA 1STZA 4H19A 3QSEA 1NHPA 1DOEA 4J34A 4KPRA 5U25A 1SJAA 2YVJA 4LIIA 3R0KA 4A7AA 2IIDA 7ENLA 4E4UA 3ITJA 1ZP0A 5G5GB 2JB3A 3MY9A 3BHFA 1FHUA 3P9UA 2X99A 4GFIA 1BKWA 3MQTA 4PABA 3N6JA 4YWSA 3KA7A 2ZADA 4JDRA 4A35A 2WOVA 1X31B 3AEEA 4OPDA 1JPDX 5BRTA 3QLDA 5ENLA 4U2TA 5J04A 3SFDA 2GR2A 1ZDLA 2WQYA 3UJRA 3V3WA 2WPFA 3ATRA 4H50A 3P1WA 1FOHA 3SYIA 4BJZA 4E4FA 3NVVB 1LJ1A 2R4EA 1JOAA 2OAMA 2V6OA 1TYTA 3EUB3 4ZCDA 2PTZA 3CIRA 1E39A 3M12A 3QKEA 3H8LA 1KCZA 1E9IA 2OA1A 1JRYA 4YTMA 3ICRA 4FI4A 2CULA 4C3YA 1NEKA 2XFQA 3IJLA 3COXA 3AMZA 3DMEA 2PTWA 1ZXIC 3P3BA 1IJHA 5FJRA 2XVEA 3QN3A 2XLSA 3RP6A 3GC2A 1YQZA 2W55A 2NPXA 1MDLA 1B8SA 3M13A 4TVWA 1EL9A 1X2HA 1K4QA 5FS7A 3S5WA 3SGLA 3UOVA 2C72A 3R25A 1ZK7A 1RVKA 4C77A 3QTPA 3OW1A 2E3TA 3VRBA 1D7YA 1XPYA 1YQ4A 2OZTA 4FDCB 5CQFA 3GWFA 1JNRA 1NU5A 4HYRA 2DKHA 2P8BA 4A9WA 1H86A 3O0HA 1JU2A 1PDHA 3D1CA 3DIPA 3FV9A 4CNJA 4DHGA 4J36A 2B9YA 2WDVA 4U8NA 2OX4A 5FS9A 2WESA 1JRZA 1BQGA 1N4VA 3ATQA 3SXIA 3AXBA 3AE2A 3RR1A 4RG3A 3H7VA 4TVYA 4OCGA 2QDDA 4EQSA 4E0VA 3THUA 2P0IA 2YVFA 2QQ6A 3CTYA 4WCTA 1CJ2A 1TRBA 1GERA 3UGVA 4APNA 2X50A 3UP4A 2W3RA 4MKSA 1EBHA 3UJFA 3H12A 1GRTA 4NTEA 2XGZA 5HHFA 3CPHG 3SJNA 3DFHA 4CNKA 1WUFA 1GALA 4J1OA 1IUTA 1COYA 2TPRA 4H83A 3GD6A 3SR6B 3UTHA 4HNLA 1PDZA 3A7UA 4H4XA 4B68A 4JQ9A 2C7GA 5JCIA 4YTNA 1F3PA 1NHSA 2PGEA 2CVJA 4Z25A 1H6VA 2XDOA 2PMQA 1PJ7A 2WS3A 3GWDA 3DK8A 3AE3A 3VR9A 2B76A 3GY1A 1DXLA 4LA1A 2XH4A 1ELIA 2OKTA 3SQPA 1IUUA 1PBFA 1ZOVA 4H4QA 3V76A 3DG7A 2GGEA 3VC5A 1K0LA 2JBVA 2E4GA 2X8CA 2CFYA 2YM2A 3UCLA 2AL1A 4UP3A 4BV6A 2CDUA 2R45A 4OPLA 3NTDA 2GDQA 1KKOA 1RSGA 2W3SA 5JCNA 1S2YA 1LPFA 5EBKA 3K30A 1H82A 5C3JA 1KN0A 3P0WA 4YSYA 4FX9A 4ZN0A 4XXGA 2O56A 3VCCA 3T31A 4H4WA 2Q0KA 3PG6A 4I59A 2YLSA 4H2PA 4P9SA 3TJ4A 5G5HB 2YLRA 1CHUA 2WU2A 2GGHA 4GDPA 4OPTA 4Z26A 1SB3B 2FJDA 3H8IA 4H2NA 3KUMA 3QFAA 4ZCCA 2EQ8A 3FMWA 3KVEA 4U2LA 5IQ1A 4YKGA 2H88A 3T6CA 4B69A 4OPCA 2TMDA 3ICTA 2XFOA 3UOZA 1UKVG 3CN8A 2YVGA 5ER0A 2GEWA
chains in the Genus database with same CATH topology
4G6HA 3UTGA 4EQXA 3NNEA 2O9ZA 2E5VA 3QVRA 2BA9A 1GV4A 3RNMA 3PO7A 2JB1A 5L46A 3EF6A 2FJAA 1GETA 3DK9A 2C3CA 4J56A 1IUSA 4WX1A 3SM8A 3P4PA 3GMBA 4B69A 2BC1A 3EPTA 4G74A 3P4SA 1BZLA 3KPKA 5LV9A 4TM0A 2H89A 1OJDA 5J7XA 3AEBA 3HYVA 2OLOA 1CL0A 1E7PA 1KDGA 2A89A 4GF7A 3NK2X 4II3A 4B65A 1RP0A 3F8RA 3NHOX 3DJJA 2B9WA 4JNQA 4B64A 2VVLG 2WPEA 3CPJG 3NT6A 2GF3A 5BUKA 4JN9A 3CGDA 3HZLA 1CC4A 1RYIA 2WU5A 1ONFA 3AEGA 3ISHA 3L1RA 3K7MX 4YSHA 4OPUA 3SZ0A 4H4ZA 1P2EA 3T37A 2Q0LA 5BULA 4J33A 4NEVA 3Q6JA 3C4NA 3IWAA 4B63A 3BNUA 3GYXA 1PBEA 5KMSA 1S2QA 1GRBA 1H2IA 3PVCA 3UKAA 3UKPA 1PXBA 2V61A 3AWIA 1E1KA 3AYJA 3IHMA 1VDCA 2EQ7A 1GRGA 2R4JA 1EL7A 1D4EA 2JAEA 4DSHA 4C3XA 1KNPA 4YSXA 4ECHA 2X8GA 3I6DA 2JB2A 2GQFA 4I58A 2WP6A 3T2KA 4AT0A 3E1TA 2YR5A 2ACZA 1NHQA 3NG7X 4IVMB 2FBWA 4GRTA 3SZWA 3UKHA 1B4VA 3UKFA 1GRFA 1KFYA 2C76A 3GMCA 1DOCA 3QSEA 2GQWA 1L9DA 1NHPA 4Z2UA 1H84A 3ZYXA 3FG2P 1NAAA 5EOWA 5KVIA 1HYUA 2Z5YA 3ZDNA 1DOEA 3CGCA 1TDEA 2OALA 2YLZA 5M0ZA 5IPYA 4J34A 4KPRA 5U25A 1B5QA 4U8KA 2W0HA 2YVJA 4EMJA 2B9XA 3HYXA 2GR1A 4O5UA 4LIIA 2GB0A 4A7AA 2BS4A 4JY2A 1V59A 3QFBA 1VG0A 2IIDA 2V3AA 1PJ5A 2YG3A 1XPQA 1OJ9A 3LZWA 2I0ZA 3GYIA 4J57A 5TR3A 3ITJA 2RGHA 1ZP0A 3HYWA 1ZMCA 2GAHB 2JB3A 4TLXA 3VQRA 3V3NA 3EANA 2A87A 3BHFA 3DJEA 1CC6A 2QCUA 3P9UA 2X99A 4ICYA 1BKWA 1IUXA 4H4SA 3OC4A 3C4AA 4PABA 4X9NA 3VR8A 3EAOA 1PXAA 3BHKA 3KA7A 2BABA 2RABA 2VZ2A 3NKSA 1ZY8A 3II4A 4JDRA 2BK4A 4A79A 1DJQA 2XLRA 2QAEA 1DNCA 2WOVA 1X31B 3AEEA 4OPDA 2JK6A 1VQWA 4YTPA 1XHCA 1Y0PA 1PBDA 3CGEA 5BRTA 3CMMA 3S61A 4J31A 1N4UA 3LB8A 4AT2A 1NG4A 4EQWA 2AR8A 3KPFA 3NIXA 4U2TA 3AE4A 1E1LA 3AE5A 1ZOYA 4GR1A 3LOVA 3ALJA 3GDPA 3KLJA 3SFDA 2GR2A 1ZDLA 2WQYA 4CBQA 3PS9A 3R9UA 1REOA 1FL2A 1F8RA 2YG5A 1OJTA 3BNMA 2WPFA 1PJ6A 3ATRA 4N9XA 4H50A 3P1WA 2XFUA 5J60A 1FOHA 3SYIA 4BJZA 2C4CA 1CC2A 3T2ZA 3GDNA 2R9ZA 4IVOB 1E1MA 2RGOA 4K8DA 2BACA 3KU9A 1KNRA 3VRDB 1S3EA 5JCMA 1LJ1A 3B6DA 1KSUA 4NTDA 2R4EA 1S3BA 1Z6LA 3V3OA 1JOAA 4PAAA 4AP1A 2C3DA 1EL8A 2OAMA 2Y6QA 4J2WA 2V6OA 4A5LA 3NN0X 5U1OA 1TYTA 4ZCDA 2WP5A 1FEAA 3L8KA 3ICSA 2BC0A 2WDRA 5FS6A 3B3RA 4EMWA 2XVJA 1GRAA 1H7XA 3CIRA 5KNLA 1E39A 5KMRA 3M12A 1Q9IA 2GR3A 2BS3A 3H8LA 4DSGA 3FPZA 5KMQA 4A65A 2F5ZA 1B37A 2OA1A 2EQ6A 1JRYA 1TDOA 1JNZA 3L5OA 1H83A 4B1BA 1GPEA 4YTMA 4Z2RA 1PHHA 4GAVA 2HQMA 3ICRA 3NH3X 3UTFA 1ZX9A 3CNSA 4LU6A 4X9MA 2CULA 4C3YA 1NEKA 1K0JA 2XVHA 1L9CA 3KD9A 2XFQA 3AE8A 2XLUA 4Z2TA 3COXA 2WOIA 4NEWA 3IHGA 3FBSA 3UKLA 2DKIA 3DMEA 1LV0A 3LADA 3T14A 5HYMA 4O5QA 1Y56A 4HB9A 2YAUA 3DGZA 1FEBA 3NLCA 1NPXA 1IJHA 1GXFA 1MXTA 1OJAA 2BK5A 4UDPA 4G73A 5U63A 3T2YA 3URHA 3WE0A 2XVEA 1ZMDA 1LTXR 5KOWA 3GD3A 1TDKA 2XLSA 3RP6A 3BI5A 1PS9A 1Y56B 2V5ZA 3IC9A 3NTAA 1QJDA 1YQZA 1H81A 2GVCA 2X8HA 2NPXA 4RSLA 3GYJA 4TM1A 3AE6A 1B8SA 4YT0A 2ZZ0A 3M13A 2IVDA 2R0CA 2XFPA 1EL9A 4H4RA 3GSIA 2ZZBA 2C75A 2FJBA 3AD9B 1K4QA 1E6EA 4MJWA 1MO9A 2C67A 4A6NB 1PBBA 3DK4A 5FS7A 2RGJA 4XWRA 4EMIA 2XYOA 3S5WA 1F8SA 1Q1RA 3SGLA 4AOSA 3UOVA 2YQUA 2C72A 1ZK7A 3DJDA 4C77A 1OJCA 1K0IA 2BXSA 4YKFA 2BCGG 3KKJA 3VRBA 1D7YA 4U8PA 1TDNA 4BK1A 4TM3A 4NNJA 4Y4MA 3UOXA 2GV8A 4EM3A 4GDEA 4GUVA 2JKCA 4REKA 4B67A 4BK3A 4BK2A 1YQ4A 2APGA 4FDCB 1JRXA 5CQFA 3NRNA 3GWFA 2VVLA 2AQJA 1JNRA 3SFEA 4EQRA 4DGKA 4U8JA 2DKHA 3D9XA 3ALLA 4A9WA 2VQ7A 1H86A 4H2RA 3O0HA 4IV9A 3FIMB 2XCGA 1BF3A 1CF3A 4Y4NA 1JU2A 4U8MA 1ZKQA 4HA6A 1GSNA 1PDHA 2C66A 3D1CA 4ADWA 2C70A 4CNJA 4AP3A 2BRAA 3AB1A 4J36A 5GSNA 3DGHA 2BRYA 4G9KA 2B9YA 5JRBA 1DOBA 2WDVA 3JSKA 3CGBA 1LQUA 3UKKA 3NYCA 4U8NA 2XVFA 4EM4A 3ALMA 1LQTA 4UDRA 2GH5A 5FS9A 4UDQA 5M10A 2VOUA 2WESA 4NZHA 1GT8A 1JRZA 1N4VA 3ATQA 1FCDA 1EL5A 3SXIA 3AXBA 3AE2A 5EB5A 4CCRA 5HY5A 2XFNA 4RG3A 2XLTA 3K7TA 2YR6A 3DH9A 5FS8A 3ABVA 3QVPA 4OCGA 4EQSA 4DNAA 4E0VA 4Z24A 2YVFA 3CTYA 2VRMA 4WCTA 3SX6A 1GREA 1CJ2A 1TRBA 4OPIA 4TLZA 4U8IA 2Q6UA 1S7MA 5HXIA 4H4YA 1GERA 4USRA 4APNA 4U8OA 5IQ4A 2QA2A 2OLNA 1W4XA 4AOXA 1FECA 2X50A 1H7WA 3SZCA 3UP4A 1PBCA 4YXDA 3Q9TA 4TM4A 2X3NA 2J3NA 4K22A 1GRTA 4NTEA 1D4CA 4D03A 4YWOA 1YQ3A 5HHFA 1PXCA 2ARDA 1KSSA 3C96A 2VQBA 1GTEA 1N1PA 1BWCA 2GR0A 3BI2A 3CPHG 3NYFA 4X4JA 4CNKA 1L9EA 1QO8A 4XWZA 1GALA 1IUTA 1COYA 2QA1A 4H2QA 4OPGA 3AE9A 2TPRA 2YWLA 3UTHA 2ZBWA 3OZ2A 4K5RA 3F8DA 5KRQA 2AAQA 4FK1C 4CY6A 1EBDA 2WPCA 1M64A 1N4WA 4IA6A 4H4XA 3GRTA 1CBOA 4H4UA 5JCLA 4JQ9A 2C7GA 4B68A 2R0PA 3F8PA 5C2TA 5JCIA 2R46A 2XVIA 3D8XA 1KF6A 1CJCA 2UZZA 1DJNA 1GEUA 1VRQB 4USQA 1F3PA 4YTNA 1F8WA 2BXRA 1NHSA 1XANA 3AEAA 4JY3A 4OVIA 2GMJA 5EB4A 1D7LA 2CVJA 5DBJA 4A6NA 1H6VA 4Y4LA 4Z25A 2PYXA 1LVLA 2GAGB 4H4TA 2XDOA 3ADAB 1O94A 1PJ7A 2WS3A 4NTCA 4NWZA 3AEFA 2EQ9A 3AE1A 3GWDA 2V3BA 3I3LA 3DK8A 2YR4A 3AE3A 4B66A 3VR9A 1BGJA 1MOKA 2B76A 1AOGA 3DA1A 4LA1A 1DXLA 3AYIA 3NK0X 1ELIA 2WHDA 4C74A 2BK3A 3SQPA 1GOSA 2B7RA 3G5SA 4IA5A 3T0KA 1IUUA 1PBFA 1ZOVA 3GD4A 1GESA 4H4QA 3V76A 3QSMA 2BCPA 3CNDA 3NYEA 1K0LA 1YKJA 2VVMA 3LJPA 4K7ZA 2JBVA 1E1NA 2E4GA 2X8CA 4K5SA 3UOYA 2CFYA 2YG4A 2E1MA 4D04A 3NK1X 2YM2A 3UCLA 2YG7A 1D4DA 4UP3A 4BV6A 2CDUA 2R45A 4OPLA 4U8LA 1O5WA 2YG6A 3CPIG 3RP7A 3GRSA 3UTEA 3NTDA 3P4QA 1NHRA 5KXJA 4U2SA 2WBAA 1O95A 4GAPA 1RSGA 4A99A 4FK1A 1P2HA 4C5OA 4CCQA 2B7SA 5JCNA 1S2YA 2WETA 3H4KA 1PN0A 3AE7A 3LXDA 3LZXA 1LPFA 2A8XA 1JEHA 4II2A 2Q7VA 5EBKA 4M52A 3K30A 1NG3A 3RHAA 1H82A 2BS2A 4BJYA 5C3JA 2XLPA 1KN0A 2IVEA 2YM1A 3CNJA 2Y6RA 4G6GA 4H7UA 2WP9A 3RP8A 4FX9A 4YSYA 2C73A 4ZN0A 2C65A 1QLBA 2GMHA 1NDAA 1SEZA 3BI4A 4XXGA 5CKUA 1IUVA 1GNDA 2PHHA 2WDQA 1IUWA 3NGCX 1CJ4A 1M6IA 3AD8B 3NN6X 2V60A 4K2XA 5KOXA 2Z5XA 1XDIA 3T31A 4H4WA 1L0VA 4EIPA 4CY8A 4Z43A 3UKQA 5GRTA 4KX6A 1GRHA 2Q0KA 1CJ3A 4GCMA 3PG6A 4I59A 1GTHA 2YLSA 1BGNA 4H2PA 4P9SA 3AECA 5FMHA 3P4RA 2YLXA 2YLRA 1F6MA 1CHUA 3AYLA 1TYPA 2WU2A 4EIQA 3G5QA 5BVAA 4RG4A 4GDPA 3QJ4A 2FJEA 4OPTA 2GRTA 4Z26A 3CNPA 3CNTA 2FJDA 2YLTA 1TDFA 3H8IA 3IF9A 2C64A 3QFAA 4H2NA 5KWFA 2VRLA 3AEDA 4ZCCA 2EQ8A 3AD7B 4JNAA 3QSSA 3VRAA 1VG9A 3K7QX 3FMWA 3KVEA 3G5RA 3SZFA 4H4PA 4Z44A 2R0GA 1Q1WA 4U2LA 5IQ1A 4YKGA 1NENA 3DJGX 5KVHA 2WOWA 4BURA 1D5TA 5JCKA 2H88A 4OPCA 2TMDA 3ICTA 3REDA 1DODA 2ZZCA 2WEUA 2XFOA 2BYBA 3SY4A 4YSZA 1YY5A 3UOZA 1UKVG 3CN8A 2YVGA 2YLWA 2NVKX 5ER0A 4CRTA 3M0OA 3UP5A 2GEWA 5KMPA 4H4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTG A;  4EQX A;  3NNE A;  2O9Z A;  2E5V A;  3QVR A;  2BA9 A;  1GV4 A;  3RNM A;  3PO7 A;  2JB1 A;  5L46 A;  3EF6 A;  2FJA A;  1GET A;  3DK9 A;  2C3C A;  4J56 A;  1IUS A;  4WX1 A;  3SM8 A;  3P4P A;  3GMB A;  4B69 A;  2BC1 A;  3EPT A;  3P4S A;  1BZL A;  5LV9 A;  4TM0 A;  2H89 A;  1OJD A;  5J7X A;  3AEB A;  2OLO A;  1CL0 A;  1E7P A;  1KDG A;  2A89 A;  4GF7 A;  3NK2 X;  4B65 A;  1RP0 A;  3F8R A;  3NHO X;  3DJJ A;  2B9W A;  4JNQ A;  4B64 A;  2VVL G;  2WPE A;  3CPJ G;  3NT6 A;  2GF3 A;  5BUK A;  4JN9 A;  3CGD A;  3HZL A;  1CC4 A;  1RYI A;  2WU5 A;  1ONF A;  3AEG A;  3ISH A;  3L1R A;  3K7M X;  4YSH A;  4OPU A;  4H4Z A;  1P2E A;  3T37 A;  2Q0L A;  5BUL A;  4J33 A;  4NEV A;  3Q6J A;  3C4N A;  3IWA A;  4B63 A;  3BNU A;  1PBE A;  1S2Q A;  1GRB A;  3PVC A;  3UKA A;  3UKP A;  1PXB A;  2V61 A;  3AWI A;  1E1K A;  3AYJ A;  3IHM A;  1VDC A;  2EQ7 A;  1GRG A;  2R4J A;  1EL7 A;  1D4E A;  2JAE A;  4DSH A;  4C3X A;  1KNP A;  4YSX A;  4ECH A;  2X8G A;  3I6D A;  2JB2 A;  2GQF A;  4I58 A;  2WP6 A;  4AT0 A;  3E1T A;  2YR5 A;  2ACZ A;  1NHQ A;  3NG7 X;  4IVM B;  2FBW A;  4GRT A;  3UKH A;  1B4V A;  3UKF A;  1GRF A;  1KFY A;  2C76 A;  3GMC A;  1DOC A;  3QSE A;  2GQW A;  1L9D A;  1NHP A;  4Z2U A;  1H84 A;  3ZYX A;  3FG2 P;  1NAA A;  5EOW A;  5KVI A;  1HYU A;  2Z5Y A;  3ZDN A;  1DOE A;  3CGC A;  1TDE A;  2OAL A;  2YLZ A;  5M0Z A;  5IPY A;  4J34 A;  4KPR A;  5U25 A;  1B5Q A;  4U8K A;  2W0H A;  2YVJ A;  4EMJ A;  2B9X A;  4O5U A;  2GR1 A;  4LII A;  2GB0 A;  4A7A A;  2BS4 A;  4JY2 A;  1V59 A;  3QFB A;  1VG0 A;  2IID A;  2V3A A;  1PJ5 A;  2YG3 A;  1XPQ A;  1OJ9 A;  3LZW A;  2I0Z A;  3GYI A;  4J57 A;  5TR3 A;  3ITJ A;  2RGH A;  1ZP0 A;  1ZMC A;  2GAH B;  2JB3 A;  4TLX A;  3VQR A;  3V3N A;  3EAN A;  2A87 A;  3BHF A;  3DJE A;  1CC6 A;  2QCU A;  3P9U A;  2X99 A;  4ICY A;  1BKW A;  1IUX A;  4H4S A;  3OC4 A;  3C4A A;  4PAB A;  4X9N A;  3VR8 A;  3EAO A;  1PXA A;  3BHK A;  3KA7 A;  2BAB A;  2RAB A;  2VZ2 A;  3NKS A;  1ZY8 A;  3II4 A;  4JDR A;  2BK4 A;  4A79 A;  1DJQ A;  2XLR A;  2QAE A;  1DNC A;  2WOV A;  1X31 B;  3AEE A;  4OPD A;  2JK6 A;  1VQW A;  4YTP A;  1XHC A;  1Y0P A;  1PBD A;  3CGE A;  5BRT A;  3S61 A;  4J31 A;  1N4U A;  3LB8 A;  4AT2 A;  1NG4 A;  4EQW A;  2AR8 A;  3KPF A;  3NIX A;  4U2T A;  3AE4 A;  1E1L A;  3AE5 A;  1ZOY A;  4GR1 A;  3LOV A;  3ALJ A;  3GDP A;  3KLJ A;  3SFD A;  2GR2 A;  1ZDL A;  2WQY A;  4CBQ A;  3PS9 A;  3R9U A;  1REO A;  1FL2 A;  1F8R A;  2YG5 A;  1OJT A;  3BNM A;  2WPF A;  1PJ6 A;  3ATR A;  4N9X A;  4H50 A;  3P1W A;  2XFU A;  5J60 A;  1FOH A;  4BJZ A;  1CC2 A;  3GDN A;  2R9Z A;  4IVO B;  1E1M A;  2RGO A;  4K8D A;  2BAC A;  3KU9 A;  1KNR A;  3VRD B;  1S3E A;  5JCM A;  1LJ1 A;  3B6D A;  1KSU A;  4NTD A;  2R4E A;  1S3B A;  1Z6L A;  3V3O A;  1JOA A;  4PAA A;  4AP1 A;  2C3D A;  1EL8 A;  2OAM A;  2Y6Q A;  4J2W A;  2V6O A;  4A5L A;  3NN0 X;  5U1O A;  1TYT A;  4ZCD A;  2WP5 A;  1FEA A;  3L8K A;  3ICS A;  2BC0 A;  2WDR A;  5FS6 A;  3B3R A;  4EMW A;  2XVJ A;  1GRA A;  1H7X A;  3CIR A;  1E39 A;  3M12 A;  1Q9I A;  2GR3 A;  2BS3 A;  3H8L A;  4DSG A;  3FPZ A;  4A65 A;  2F5Z A;  1B37 A;  2OA1 A;  2EQ6 A;  1JRY A;  1TDO A;  1JNZ A;  1H83 A;  4B1B A;  1GPE A;  4YTM A;  4Z2R A;  1PHH A;  2HQM A;  3ICR A;  3NH3 X;  3UTF A;  1ZX9 A;  3CNS A;  4LU6 A;  4X9M A;  2CUL A;  4C3Y A;  1NEK A;  1K0J A;  2XVH A;  1L9C A;  3KD9 A;  2XFQ A;  3AE8 A;  2XLU A;  4Z2T A;  3COX A;  2WOI A;  4NEW A;  3IHG A;  3FBS A;  3UKL A;  2DKI A;  3DME A;  1LV0 A;  3LAD A;  5HYM A;  4O5Q A;  1Y56 A;  4HB9 A;  2YAU A;  3DGZ A;  1FEB A;  3NLC A;  1NPX A;  1IJH A;  1GXF A;  1MXT A;  1OJA A;  2BK5 A;  4UDP A;  5U63 A;  3WE0 A;  3URH A;  2XVE A;  1ZMD A;  1LTX R;  5KOW A;  3GD3 A;  1TDK A;  2XLS A;  3RP6 A;  3BI5 A;  1PS9 A;  1Y56 B;  2V5Z A;  3IC9 A;  3NTA A;  1QJD A;  1YQZ A;  1H81 A;  2GVC A;  2X8H A;  2NPX A;  4RSL A;  3GYJ A;  4TM1 A;  3AE6 A;  1B8S A;  4YT0 A;  2ZZ0 A;  3M13 A;  2IVD A;  2R0C A;  2XFP A;  1EL9 A;  4H4R A;  3GSI A;  2ZZB A;  2C75 A;  2FJB A;  3AD9 B;  1K4Q A;  1E6E A;  4MJW A;  1MO9 A;  2C67 A;  4A6N B;  1PBB A;  3DK4 A;  5FS7 A;  2RGJ A;  4XWR A;  4EMI A;  2XYO A;  3S5W A;  1F8S A;  1Q1R A;  3SGL A;  4AOS A;  3UOV A;  2YQU A;  2C72 A;  1ZK7 A;  3DJD A;  4C77 A;  1OJC A;  1K0I A;  2BXS A;  4YKF A;  2BCG G;  3KKJ A;  3VRB A;  1D7Y A;  4U8P A;  1TDN A;  4BK1 A;  4TM3 A;  4Y4M A;  3UOX A;  2GV8 A;  4EM3 A;  4GDE A;  4GUV A;  2JKC A;  4REK A;  4B67 A;  4BK3 A;  4BK2 A;  1YQ4 A;  2APG A;  4FDC B;  1JRX A;  5CQF A;  3NRN A;  3GWF A;  2VVL A;  2AQJ A;  1JNR A;  3SFE A;  4EQR A;  4DGK A;  4U8J A;  2DKH A;  3ALL A;  4A9W A;  2VQ7 A;  1H86 A;  4H2R A;  3O0H A;  4IV9 A;  3FIM B;  2XCG A;  1BF3 A;  1CF3 A;  4Y4N A;  1JU2 A;  4U8M A;  1ZKQ A;  4HA6 A;  1GSN A;  1PDH A;  2C66 A;  3D1C A;  4ADW A;  2C70 A;  4CNJ A;  4AP3 A;  5GSN A;  3AB1 A;  4J36 A;  3DGH A;  2B9Y A;  1DOB A;  2WDV A;  3JSK A;  3CGB A;  1LQU A;  3UKK A;  3NYC A;  4U8N A;  2XVF A;  4EM4 A;  3ALM A;  1LQT A;  4UDR A;  2GH5 A;  5FS9 A;  4UDQ A;  5M10 A;  2VOU A;  2WES A;  4NZH A;  1GT8 A;  1JRZ A;  1N4V A;  3ATQ A;  1FCD A;  1EL5 A;  3AXB A;  3AE2 A;  5EB5 A;  4CCR A;  5HY5 A;  2XFN A;  4RG3 A;  2XLT A;  3K7T A;  2YR6 A;  3DH9 A;  5FS8 A;  3ABV A;  3QVP A;  4OCG A;  4EQS A;  4DNA A;  4E0V A;  4Z24 A;  2YVF A;  3CTY A;  2VRM A;  4WCT A;  1GRE A;  1CJ2 A;  1TRB A;  4OPI A;  4TLZ A;  4U8I A;  2Q6U A;  5HXI A;  4H4Y A;  1GER A;  4USR A;  4APN A;  4U8O A;  5IQ4 A;  2QA2 A;  2OLN A;  1W4X A;  4AOX A;  1FEC A;  2X50 A;  1H7W A;  3UP4 A;  1PBC A;  4YXD A;  3Q9T A;  4TM4 A;  2X3N A;  2J3N A;  4K22 A;  1GRT A;  4NTE A;  1D4C A;  4D03 A;  4YWO A;  1YQ3 A;  5HHF A;  1PXC A;  2ARD A;  1KSS A;  3C96 A;  2VQB A;  1GTE A;  1N1P A;  1BWC A;  2GR0 A;  3BI2 A;  3CPH G;  3NYF A;  4X4J A;  4CNK A;  1L9E A;  1QO8 A;  4XWZ A;  1GAL A;  1IUT A;  1COY A;  2QA1 A;  4H2Q A;  4OPG A;  3AE9 A;  2TPR A;  2YWL A;  3UTH A;  2ZBW A;  3OZ2 A;  4K5R A;  3F8D A;  5KRQ A;  2AAQ A;  4FK1 C;  4CY6 A;  1EBD A;  2WPC A;  1M64 A;  1N4W A;  4IA6 A;  4H4X A;  3GRT A;  1CBO A;  4H4U A;  5JCL A;  4JQ9 A;  2C7G A;  4B68 A;  2R0P A;  3F8P A;  5C2T A;  5JCI A;  2R46 A;  2XVI A;  3D8X A;  1KF6 A;  1CJC A;  2UZZ A;  1DJN A;  1GEU A;  1VRQ B;  4USQ A;  1F3P A;  4YTN A;  1F8W A;  2BXR A;  1NHS A;  1XAN A;  3AEA A;  4JY3 A;  4OVI A;  2GMJ A;  5EB4 A;  1D7L A;  2CVJ A;  5DBJ A;  4A6N A;  1H6V A;  4Y4L A;  4Z25 A;  2PYX A;  1LVL A;  2GAG B;  4H4T A;  2XDO A;  3ADA B;  1O94 A;  1PJ7 A;  2WS3 A;  4NTC A;  3AEF A;  2EQ9 A;  3AE1 A;  3GWD A;  2V3B A;  3I3L A;  3DK8 A;  2YR4 A;  3AE3 A;  4B66 A;  3VR9 A;  1BGJ A;  1MOK A;  2B76 A;  1AOG A;  3DA1 A;  4LA1 A;  1DXL A;  3AYI A;  3NK0 X;  1ELI A;  2WHD A;  4C74 A;  2BK3 A;  3SQP A;  1GOS A;  2B7R A;  3G5S A;  4IA5 A;  1IUU A;  1PBF A;  1ZOV A;  3GD4 A;  1GES A;  4H4Q A;  3V76 A;  3QSM A;  2BCP A;  3CND A;  3NYE A;  1K0L A;  1YKJ A;  2VVM A;  3LJP A;  4K7Z A;  2JBV A;  1E1N A;  2E4G A;  2X8C A;  4K5S A;  3UOY A;  2CFY A;  2YG4 A;  2E1M A;  4D04 A;  3NK1 X;  2YM2 A;  3UCL A;  2YG7 A;  1D4D A;  4UP3 A;  4BV6 A;  2CDU A;  2R45 A;  4OPL A;  4U8L A;  1O5W A;  2YG6 A;  3CPI G;  3RP7 A;  3GRS A;  3UTE A;  3NTD A;  3P4Q A;  1NHR A;  5KXJ A;  4U2S A;  2WBA A;  1O95 A;  4A99 A;  1RSG A;  4CCQ A;  4FK1 A;  1P2H A;  4C5O A;  2B7S A;  5JCN A;  1S2Y A;  2WET A;  3H4K A;  1PN0 A;  3AE7 A;  3LXD A;  3LZX A;  1LPF A;  2A8X A;  1JEH A;  2Q7V A;  5EBK A;  4M52 A;  3K30 A;  1NG3 A;  3RHA A;  1H82 A;  2BS2 A;  4BJY A;  5C3J A;  2XLP A;  2IVE A;  2YM1 A;  3CNJ A;  2Y6R A;  4H7U A;  2WP9 A;  3RP8 A;  4FX9 A;  4YSY A;  2C73 A;  4ZN0 A;  2C65 A;  1QLB A;  2GMH A;  1NDA A;  1SEZ A;  3BI4 A;  4XXG A;  5CKU A;  1IUV A;  1GND A;  2PHH A;  2WDQ A;  1IUW A;  3NGC X;  1CJ4 A;  1M6I A;  3AD8 B;  3NN6 X;  2V60 A;  4K2X A;  5KOX A;  2Z5X A;  1XDI A;  4H4W A;  1L0V A;  4EIP A;  4CY8 A;  4Z43 A;  3UKQ A;  5GRT A;  4KX6 A;  1GRH A;  2Q0K A;  1CJ3 A;  4GCM A;  4I59 A;  1GTH A;  2YLS A;  1BGN A;  4H2P A;  4P9S A;  3AEC A;  5FMH A;  3P4R A;  2YLX A;  2YLR A;  1F6M A;  1CHU A;  3AYL A;  1TYP A;  2WU2 A;  4EIQ A;  3G5Q A;  5BVA A;  4RG4 A;  4GDP A;  3QJ4 A;  2FJE A;  4OPT A;  2GRT A;  4Z26 A;  3CNP A;  3CNT A;  2FJD A;  2YLT A;  1TDF A;  3H8I A;  3IF9 A;  2C64 A;  3QFA A;  4H2N A;  5KWF A;  2VRL A;  3AED A;  4ZCC A;  2EQ8 A;  3AD7 B;  4JNA A;  3QSS A;  3VRA A;  1VG9 A;  3K7Q X;  3FMW A;  3KVE A;  3G5R A;  4H4P A;  4Z44 A;  2R0G A;  1Q1W A;  4U2L A;  5IQ1 A;  4YKG A;  1NEN A;  3DJG X;  5KVH A;  2WOW A;  4BUR A;  1D5T A;  5JCK A;  2H88 A;  4OPC A;  2TMD A;  3ICT A;  3RED A;  1DOD A;  2ZZC A;  2WEU A;  2XFO A;  2BYB A;  4YSZ A;  1YY5 A;  3UOZ A;  1UKV G;  3CN8 A;  2YVG A;  2YLW A;  2NVK X;  5ER0 A;  4CRT A;  3M0O A;  3UP5 A;  2GEW A;  4H4V A; 
#chains in the Genus database with same CATH topology
 4EQX A;  3RNM A;  2FJA A;  3DK9 A;  3SM8 A;  3RGT A;  3P4P A;  3U9I A;  3UXL A;  3P4S A;  5BOF A;  4TM0 A;  5J7X A;  4J3Z A;  2OLO A;  1CL0 A;  1E7P A;  1KDG A;  2A89 A;  1RP0 A;  1JPM A;  2VVL G;  4JN9 A;  1T3Q C;  3UCC A;  3K7M X;  3SZ0 A;  3IWA A;  3ZVH B;  4B63 A;  3EEZ A;  1GRB A;  3RRA A;  3UKP A;  3AYJ A;  2EQ7 A;  4EWJ A;  2R4J A;  4DSH A;  3MWC A;  1KNP A;  4ECH A;  3FCP A;  2GQF A;  3NG7 X;  3UKH A;  1GRF A;  1KFY A;  3ZYX A;  3FG2 P;  1NAA A;  1HYU A;  3CGC A;  2OAL A;  5M0Z A;  5IPY A;  4MMW A;  1B5Q A;  2HZG A;  4JY2 A;  1TZZ A;  2PP0 A;  1OJ9 A;  3GYI A;  4J57 A;  1P48 A;  2GAH B;  4TLX A;  3V3N A;  4HCL A;  1CC6 A;  4ICY A;  1X2G A;  3Q4D A;  1IUX A;  3JW7 A;  4H4S A;  3OC4 A;  3VR8 A;  3EAO A;  2OQY A;  3IJQ A;  1DNC A;  4IZG A;  3ZLH A;  3FXG A;  1PBD A;  3CGE A;  2FYM A;  3CMM A;  3OZY A;  3NIX A;  1ZOY A;  3GDP A;  3EKG A;  2XH7 A;  1FHV A;  3PS9 A;  1OJT A;  3CXB A;  3BNM A;  4N9X A;  5J60 A;  3T2Z A;  1VDV A;  4IVO B;  4K8D A;  3KU9 A;  1S3E A;  4A3R A;  3IK4 A;  2C3D A;  4K2S A;  1MUC A;  4J2W A;  5U1O A;  3OPS A;  3DFY A;  3ICS A;  3NZG A;  4EMW A;  2XVJ A;  3FYY A;  5KNL A;  3DG6 A;  4E6M A;  1Q9I A;  4DSG A;  5KMQ A;  1JNZ A;  2XH2 A;  1H83 A;  4GAV A;  2HQM A;  3D46 A;  4MGG A;  3SN4 A;  4X9M A;  1L9C A;  3KD9 A;  2XLU A;  2WOI A;  3FBS A;  4DX3 A;  3T14 A;  5HYM A;  2YAU A;  1FEB A;  3NLC A;  5U63 A;  4G73 A;  3URH A;  1LTX R;  5KOW A;  3GD3 A;  1TDK A;  1PS9 A;  3S47 A;  4E5T A;  2OO6 A;  1Y56 B;  4HNC A;  1QJD A;  2X8H A;  4TM1 A;  4YT0 A;  2IVD A;  4H4R A;  2ZZB A;  2FJB A;  3DK4 A;  3UJE A;  4XWR A;  4AOS A;  1OJC A;  2BCG G;  3KKJ A;  3B9J B;  1SJC A;  3UOX A;  2GV8 A;  4B67 A;  4GDE A;  4REK A;  4BK3 A;  4BK2 A;  1JRX A;  2AQJ A;  2I5Q A;  4DGK A;  3VC6 A;  3D9X A;  3FIM B;  4Y4N A;  4U8M A;  1ONE A;  4DYE A;  2C70 A;  2BRA A;  5GSN A;  1JCT A;  3DGH A;  4G9K A;  1DOB A;  3ENL A;  1LQT A;  3A7A A;  2VOU A;  1FCD A;  1EL5 A;  1JRP A;  5EB5 A;  3K7T A;  5FS8 A;  4Z24 A;  2XSX A;  4Z17 A;  3SX6 A;  4OPI A;  4TLZ A;  2Q6U A;  4USR A;  4U8O A;  2QA2 A;  1EBG A;  1EC9 A;  3CXO A;  3NYF A;  1GTE A;  2OFJ A;  4X4J A;  4KWS A;  2HXU A;  1QO8 A;  2QA1 A;  2PP1 A;  3AE9 A;  3JVA A;  2ZBW A;  3OZ2 A;  4K5R A;  1R6W A;  2AAQ A;  4FK1 C;  1N4W A;  4IA6 A;  2PSN A;  1CBO A;  4H4U A;  3TWB A;  2R0P A;  3R11 A;  2R46 A;  1KF6 A;  1DJN A;  4USQ A;  4IHC A;  4JY3 A;  2GMJ A;  3R1Z A;  3HPF A;  2PYX A;  1LVL A;  3ADA B;  3JZU A;  3ETR B;  3SN0 A;  3AEF A;  2V3B A;  4B66 A;  1BGJ A;  3NK0 X;  2WHD A;  4FP1 A;  2BK3 A;  4IA5 A;  1GOS A;  2GGI A;  4K7Z A;  4K5S A;  4D04 A;  3NK1 X;  1O5W A;  3RP7 A;  2OZ8 A;  5KXJ A;  2PU1 A;  4U2S A;  4A99 A;  3OP2 A;  1P2H A;  3AE7 A;  1BKH A;  2AKM A;  3LZX A;  2A8X A;  4II2 A;  1JDF A;  2XLP A;  2IVE A;  2YM1 A;  3NRZ B;  3PFR A;  2Y6R A;  4H7U A;  2P88 A;  2WP9 A;  2C65 A;  1SEZ A;  4G8T A;  2PHH A;  5KOX A;  1WUE A;  2W54 A;  3UKQ A;  4KX6 A;  1GRH A;  1GTH A;  1N5W C;  5FMH A;  4JN7 A;  2AL2 A;  4RG4 A;  3PWI A;  4ZOH B;  3N6H A;  2P3Z A;  3QJ4 A;  5KWF A;  3IF9 A;  2C64 A;  2VRL A;  3G5R A;  2R0G A;  2ONE A;  1NEN A;  3DJG X;  3RED A;  2QGY A;  1YY5 A;  2NVK X;  1EC8 A;  2E5V A;  3QVR A;  3H8A A;  2GGJ A;  3PO7 A;  2JB1 A;  4DXK A;  2C3C A;  1L8P A;  3GMB A;  2BC1 A;  3EPT A;  4G74 A;  2DW7 A;  1BZL A;  2FKP A;  2H89 A;  1OJD A;  3AEB A;  3HYV A;  3F8R A;  4JNQ A;  4B64 A;  3CGD A;  1CC4 A;  2WU5 A;  1ONF A;  4OPU A;  3PWG A;  2PS2 A;  4GIS A;  4GIR A;  3T37 A;  5BUL A;  4NEV A;  2CHR A;  3GYX A;  4G7F A;  2HXT A;  1N61 C;  3IHM A;  1EL7 A;  3RIT A;  3CK5 A;  2WP6 A;  2YR5 A;  1NHQ A;  3UKF A;  3VCN A;  2QDE A;  2C76 A;  3GMC A;  4KT2 A;  1L9D A;  1H84 A;  5EOW A;  2Z5Y A;  3ZDN A;  2YLZ A;  3DES A;  2OG9 A;  1V59 A;  3QFB A;  1VG0 A;  2V3A A;  1PJ5 A;  2YG3 A;  2XH0 A;  1XPQ A;  2RGH A;  3MUC A;  1N60 C;  3HYW A;  3VQR A;  3EAN A;  3VFC A;  2QCU A;  3C4A A;  3BHK A;  2BAB A;  2VZ2 A;  2BK4 A;  3TQP A;  4A79 A;  1XHC A;  1Y0P A;  3LB8 A;  4AT2 A;  4ZA0 A;  1NG4 A;  4EQW A;  3AE4 A;  1SJD A;  1E1L A;  3AE5 A;  4GR1 A;  3KLJ A;  4CBQ A;  3R9U A;  1REO A;  1PJ6 A;  5IDZ A;  2XFU A;  2C4C A;  2R9Z A;  3S5S A;  1KNR A;  5JCM A;  3B6D A;  1S3B A;  4AP1 A;  3V3O A;  4PAA A;  3T4W A;  4H1Z A;  4A5L A;  3NN0 X;  2WP5 A;  3I6E A;  1FEA A;  3L8K A;  2ZC8 A;  2WDR A;  3HW2 A;  3B3R A;  5KMR A;  1ELS A;  4HCD A;  2GR3 A;  2BS3 A;  2F5Z A;  3NFU A;  2NQL A;  2E5A A;  3L5O A;  4B1B A;  1GPE A;  4Z2R A;  3UTF A;  3NH3 X;  1ZX9 A;  4LU6 A;  1K0J A;  2OQH A;  3AE8 A;  4H2H A;  3IHG A;  3LAD A;  3TOY A;  4HB9 A;  3DGZ A;  1GXF A;  1MXT A;  3MSY A;  2OZ3 A;  3VDG A;  3GYJ A;  2R0C A;  4MJW A;  1E6E A;  1MO9 A;  1PBB A;  2RGJ A;  4HPN A;  2XYO A;  1Q1R A;  2YQU A;  1K0I A;  2BXS A;  4YKF A;  4U8P A;  1TDN A;  4BK1 A;  4EM3 A;  2JKC A;  3NRN A;  3SFE A;  2GL5 A;  3ALL A;  2VQ7 A;  4H2R A;  1MRA A;  1CF3 A;  4A6G A;  4HA6 A;  1IYX A;  4HN8 A;  3AB1 A;  3CGB A;  6ENL A;  1W6T A;  3V5C A;  1LQU A;  3NYC A;  4UDR A;  4EM4 A;  3NVY B;  2GH5 A;  5M10 A;  2QJJ A;  2OLA A;  2GSH A;  4CCR A;  2MNR A;  2XLT A;  2YR6 A;  1PDY A;  3UJS A;  3QVP A;  3P93 A;  4DNA A;  3DER A;  3OZM A;  1GRE A;  4U8I A;  1S7M A;  2OLN A;  1ECQ A;  3NS1 B;  3SZC A;  1PBC A;  4TM4 A;  4K22 A;  1D4C A;  4D03 A;  1YQ3 A;  4JHM A;  1PXC A;  2ARD A;  1KSS A;  3C96 A;  1N1P A;  1BWC A;  2GR0 A;  3CAW A;  4H2Q A;  2YWL A;  4KEM A;  3F8D A;  1EBD A;  1M64 A;  3GRT A;  5JCL A;  1CJC A;  1VRQ B;  1F8W A;  4OVI A;  3DGB A;  5EB4 A;  1D7L A;  4A6N A;  3IJI A;  3BSM A;  2GAG B;  2EQ9 A;  3I3L A;  2YR4 A;  4F4R A;  3V4B A;  1AOG A;  3AYI A;  3A7R A;  3GD4 A;  1GES A;  1YEY A;  2BCP A;  3LJP A;  3UOY A;  1E1N A;  2E1M A;  2OVL A;  3R0U A;  3CPI G;  5FJT A;  4GAP A;  4CCQ A;  4FK1 A;  4C5O A;  2B7S A;  2WET A;  1PN0 A;  1JRO A;  4M52 A;  3RHA A;  2BS2 A;  4BJY A;  3CNJ A;  3RP8 A;  2C73 A;  1QLB A;  3BI4 A;  1NDA A;  5CKU A;  1IUV A;  1GND A;  2WDQ A;  4K2X A;  1CJ4 A;  1M6I A;  1XDI A;  4DWD A;  1L0V A;  5GRT A;  1MDR A;  1CJ3 A;  1N5X A;  1BGN A;  3CT2 A;  3P4R A;  1WYG A;  4JN8 A;  1F6M A;  1MNS A;  1TYP A;  3G5Q A;  3CYJ A;  1FO4 A;  4GGB A;  2FJE A;  3CNT A;  2YLT A;  3H70 A;  1EC7 A;  2PTX A;  1TDF A;  1R0M A;  4JNA A;  3TW9 A;  3VRA A;  3QSS A;  1VG9 A;  3K7Q X;  3SZF A;  4H4P A;  4Z44 A;  1TE6 A;  4ENL A;  5JCK A;  3SY4 A;  1DOD A;  2WEU A;  2BYB A;  4YSZ A;  3V5F A;  2YLW A;  4CRT A;  3M0O A;  3UP5 A;  2X3N A;  3NNE A;  2BA9 A;  4K1W A;  1GV4 A;  4J56 A;  4WX1 A;  5LV9 A;  3D47 A;  4IP5 A;  4II3 A;  3NK2 X;  3NHO X;  2B9W A;  3ZVH A;  5BUK A;  3HZL A;  3AEG A;  3NVW B;  4H4Z A;  3B97 A;  2RDX A;  2Q0L A;  3C4N A;  3BNU A;  5KMS A;  1H2I A;  3PVC A;  5FJP A;  1PXB A;  3AWI A;  1E1K A;  1D4E A;  4I58 A;  3T2K A;  4AT0 A;  3E1T A;  2ACZ A;  4Z1Y A;  4GRT A;  3SZW A;  3CB3 A;  1B4V A;  3N4F A;  3BJS A;  1DOC A;  2GQW A;  4Z2U A;  5KVI A;  3DG3 A;  1TDE A;  4U8K A;  2W0H A;  4EMJ A;  2B9X A;  3HYX A;  2GR1 A;  4O5U A;  2GB0 A;  2BS4 A;  3LZW A;  2I0Z A;  5TR3 A;  3MKC A;  1ZMC A;  1SJB A;  2A87 A;  3STP A;  3DJE A;  1TKK A;  1P43 A;  3RO6 A;  4X9N A;  1PXA A;  2RAB A;  3NKS A;  1ZY8 A;  3II4 A;  1DJQ A;  2XLR A;  2QAE A;  2QJM A;  2JK6 A;  1VQW A;  4YTP A;  3S61 A;  4J31 A;  3TCS A;  1N4U A;  3KPF A;  2AR8 A;  3LOV A;  3ALJ A;  2PTY A;  1FL2 A;  1F8R A;  4DN1 A;  2YG5 A;  1RM6 B;  3HRD C;  3I6T A;  3GO2 A;  4GYP A;  1CC2 A;  3GDN A;  1E1M A;  2RGO A;  2BAC A;  3UCD A;  3VRD B;  1KSU A;  4NTD A;  1Z6L A;  1EL8 A;  2Y6Q A;  3SSZ A;  2BC0 A;  3I4K A;  5FS6 A;  1GRA A;  3PK7 A;  1H7X A;  3ZLG A;  4E8G A;  3FPZ A;  4A65 A;  1B37 A;  2EQ6 A;  2MUC A;  1TDO A;  1PHH A;  4M0X A;  3CNS A;  2XVH A;  4Z2T A;  4NEW A;  3UKL A;  2DKI A;  1LV0 A;  3DEQ A;  1F9C A;  4O5Q A;  1Y56 A;  1NPX A;  1OJA A;  2BK5 A;  4UDP A;  3WE0 A;  3T2Y A;  1ZMD A;  3R07 C;  3RCY A;  3TTE A;  5EU9 A;  4HCH A;  3BI5 A;  2V5Z A;  3IC9 A;  3NTA A;  1H81 A;  3SN1 A;  2GVC A;  4RSL A;  3AE6 A;  2ZZ0 A;  2XFP A;  3GSI A;  2C75 A;  4A6N B;  3AD9 B;  2C67 A;  2OPJ A;  4GYP C;  4EMI A;  1F8S A;  4GME A;  3DJD A;  3ZVI A;  4TM3 A;  4NNJ A;  4Y4M A;  4GUV A;  2APG A;  2QVH A;  1KKR A;  2VVL A;  4EQR A;  4U8J A;  2AKZ A;  3QPE A;  4IV9 A;  2XCG A;  1BF3 A;  4IT1 A;  1ZKQ A;  1GSN A;  3T8Q A;  2C66 A;  4ADW A;  4AP3 A;  2BRY A;  5JRB A;  3JSK A;  3UKK A;  2XVF A;  3ALM A;  4UDQ A;  4NZH A;  1GT8 A;  5HY5 A;  2XFN A;  3DH9 A;  3ZLF A;  3ABV A;  4IL2 A;  4X2P A;  1NEL A;  2VRM A;  2POD A;  3SBF A;  5HXI A;  4H4Y A;  3MZN A;  5IQ4 A;  1W4X A;  4AOX A;  1FEC A;  1H7W A;  4YXD A;  3Q9T A;  2J3N A;  3NO1 A;  4YWO A;  2VQB A;  4CY8 A;  3AM9 A;  3BI2 A;  1L9E A;  4XWZ A;  4OPG A;  5KRQ A;  4CY6 A;  3AN1 A;  2WPC A;  2PU0 A;  2GGG A;  3K1G A;  3F8P A;  1FIQ B;  5C2T A;  2PPG A;  2XVI A;  3D8X A;  5FJU A;  2UZZ A;  1GEU A;  3ES7 A;  2BXR A;  3DDM A;  4ROP A;  1XAN A;  3SQS A;  3AEA A;  5DBJ A;  2PA6 A;  4Y4L A;  4H4T A;  1O94 A;  4NTC A;  4NWZ A;  3AE1 A;  2HNE A;  2P8C A;  1MOK A;  3Q45 A;  1N63 C;  3DA1 A;  4ZCW A;  4C74 A;  3G5S A;  2B7R A;  3T0K A;  1KD0 A;  3ES8 A;  3QSM A;  3CND A;  3NYE A;  2PGW A;  1YKJ A;  2VVM A;  3VA8 A;  2YG4 A;  2YG7 A;  1D4D A;  3FJ4 A;  4U8L A;  2YG6 A;  3UTE A;  3GRS A;  1FFV C;  3P4Q A;  1NHR A;  2WBA A;  1O95 A;  3TJI A;  5FJO A;  3H4K A;  3LXD A;  1JEH A;  2POZ A;  2Q7V A;  3BOX A;  1NG3 A;  3N4E A;  4IP4 A;  1FFU C;  4G6G A;  2GMH A;  3NGC X;  1IUW A;  3AD8 B;  3NN6 X;  2V60 A;  2Z5X A;  3R10 A;  4EIP A;  4Z43 A;  4GCM A;  3AEC A;  3T9P A;  3FVD A;  2YLX A;  3AYL A;  4EIQ A;  2PCE A;  5BVA A;  2PP3 A;  2GRT A;  3CNP A;  3NXL A;  5BOE A;  3AED A;  3AD7 B;  2AL2 B;  3UJ2 A;  1Q1W A;  3TWA A;  4KPL A;  2QJN A;  2WOW A;  4BUR A;  5KVH A;  1XS2 A;  3U4F A;  1D5T A;  3UTG A;  2ZZC A;  4M6U A;  5KMP A;  4H4V A;  4G6H A;  2O9Z A;  5L46 A;  3EF6 A;  4IL0 A;  2DW6 A;  1GET A;  1IUS A;  1VQZ A;  1OEP A;  3KPK A;  1DTN A;  4GF7 A;  4B65 A;  1N62 C;  3DJJ A;  3UXK A;  3CPJ G;  2WPE A;  3NT6 A;  3NVZ B;  2GF3 A;  1RYI A;  3ISH A;  3L1R A;  3OTR A;  4YSH A;  1P2E A;  1V97 A;  4J33 A;  3Q6J A;  1PBE A;  1S2Q A;  3UKA A;  2V61 A;  1VDC A;  1GRG A;  4K8G A;  2JAE A;  4C3X A;  4YSX A;  2X8G A;  3I6D A;  2JB2 A;  4IVM B;  2FBW A;  4GGH A;  1STZ A;  4H19 A;  3QSE A;  1NHP A;  1DOE A;  4J34 A;  4KPR A;  5U25 A;  1SJA A;  2YVJ A;  4LII A;  3R0K A;  4A7A A;  2IID A;  7ENL A;  4E4U A;  3ITJ A;  1ZP0 A;  5G5G B;  2JB3 A;  3MY9 A;  3BHF A;  1FHU A;  3P9U A;  2X99 A;  4GFI A;  1BKW A;  3MQT A;  4PAB A;  3N6J A;  4YWS A;  3KA7 A;  2ZAD A;  4JDR A;  4A35 A;  2WOV A;  1X31 B;  3AEE A;  4OPD A;  1JPD X;  5BRT A;  3QLD A;  5ENL A;  4U2T A;  5J04 A;  3SFD A;  2GR2 A;  1ZDL A;  2WQY A;  3UJR A;  3V3W A;  2WPF A;  3ATR A;  4H50 A;  3P1W A;  1FOH A;  3SYI A;  4BJZ A;  4E4F A;  3NVV B;  1LJ1 A;  2R4E A;  1JOA A;  2OAM A;  2V6O A;  1TYT A;  3EUB 3;  4ZCD A;  2PTZ A;  3CIR A;  1E39 A;  3M12 A;  3QKE A;  3H8L A;  1KCZ A;  1E9I A;  2OA1 A;  1JRY A;  4YTM A;  3ICR A;  4FI4 A;  2CUL A;  4C3Y A;  1NEK A;  2XFQ A;  3IJL A;  3COX A;  3AMZ A;  3DME A;  2PTW A;  1ZXI C;  3P3B A;  1IJH A;  5FJR A;  2XVE A;  3QN3 A;  2XLS A;  3RP6 A;  3GC2 A;  1YQZ A;  2W55 A;  2NPX A;  1MDL A;  1B8S A;  3M13 A;  4TVW A;  1EL9 A;  1X2H A;  1K4Q A;  5FS7 A;  3S5W A;  3SGL A;  3UOV A;  2C72 A;  3R25 A;  1ZK7 A;  1RVK A;  4C77 A;  3QTP A;  3OW1 A;  2E3T A;  3VRB A;  1D7Y A;  1XPY A;  1YQ4 A;  2OZT A;  4FDC B;  5CQF A;  3GWF A;  1JNR A;  1NU5 A;  4HYR A;  2DKH A;  2P8B A;  4A9W A;  1H86 A;  3O0H A;  1JU2 A;  1PDH A;  3D1C A;  3DIP A;  3FV9 A;  4CNJ A;  4DHG A;  4J36 A;  2B9Y A;  2WDV A;  4U8N A;  2OX4 A;  5FS9 A;  2WES A;  1JRZ A;  1BQG A;  1N4V A;  3ATQ A;  3SXI A;  3AXB A;  3AE2 A;  3RR1 A;  4RG3 A;  3H7V A;  4TVY A;  4OCG A;  2QDD A;  4EQS A;  4E0V A;  3THU A;  2P0I A;  2YVF A;  2QQ6 A;  3CTY A;  4WCT A;  1CJ2 A;  1TRB A;  1GER A;  3UGV A;  4APN A;  2X50 A;  3UP4 A;  2W3R A;  4MKS A;  1EBH A;  3UJF A;  3H12 A;  1GRT A;  4NTE A;  2XGZ A;  5HHF A;  3CPH G;  3SJN A;  3DFH A;  4CNK A;  1WUF A;  1GAL A;  4J1O A;  1IUT A;  1COY A;  2TPR A;  4H83 A;  3GD6 A;  3SR6 B;  3UTH A;  4HNL A;  1PDZ A;  3A7U A;  4H4X A;  4B68 A;  4JQ9 A;  2C7G A;  5JCI A;  4YTN A;  1F3P A;  1NHS A;  2PGE A;  2CVJ A;  4Z25 A;  1H6V A;  2XDO A;  2PMQ A;  1PJ7 A;  2WS3 A;  3GWD A;  3DK8 A;  3AE3 A;  3VR9 A;  2B76 A;  3GY1 A;  1DXL A;  4LA1 A;  2XH4 A;  1ELI A;  2OKT A;  3SQP A;  1IUU A;  1PBF A;  1ZOV A;  4H4Q A;  3V76 A;  3DG7 A;  2GGE A;  3VC5 A;  1K0L A;  2JBV A;  2E4G A;  2X8C A;  2CFY A;  2YM2 A;  3UCL A;  2AL1 A;  4UP3 A;  4BV6 A;  2CDU A;  2R45 A;  4OPL A;  3NTD A;  2GDQ A;  1KKO A;  1RSG A;  2W3S A;  5JCN A;  1S2Y A;  1LPF A;  5EBK A;  3K30 A;  1H82 A;  5C3J A;  1KN0 A;  3P0W A;  4YSY A;  4FX9 A;  4ZN0 A;  4XXG A;  2O56 A;  3VCC A;  3T31 A;  4H4W A;  2Q0K A;  3PG6 A;  4I59 A;  2YLS A;  4H2P A;  4P9S A;  3TJ4 A;  5G5H B;  2YLR A;  1CHU A;  2WU2 A;  2GGH A;  4GDP A;  4OPT A;  4Z26 A;  1SB3 B;  2FJD A;  3H8I A;  4H2N A;  3KUM A;  3QFA A;  4ZCC A;  2EQ8 A;  3FMW A;  3KVE A;  4U2L A;  5IQ1 A;  4YKG A;  2H88 A;  3T6C A;  4B69 A;  4OPC A;  2TMD A;  3ICT A;  2XFO A;  3UOZ A;  1UKV G;  3CN8 A;  2YVG A;  5ER0 A;  2GEW A; 
#chains in the Genus database with same CATH homology
 4G6H A;  3UTG A;  4EQX A;  3NNE A;  2O9Z A;  2E5V A;  3QVR A;  2BA9 A;  1GV4 A;  3RNM A;  3PO7 A;  2JB1 A;  5L46 A;  3EF6 A;  2FJA A;  1GET A;  3DK9 A;  2C3C A;  4J56 A;  1IUS A;  4WX1 A;  3SM8 A;  3P4P A;  3GMB A;  4B69 A;  2BC1 A;  3EPT A;  4G74 A;  3P4S A;  1BZL A;  3KPK A;  5LV9 A;  4TM0 A;  2H89 A;  1OJD A;  5J7X A;  3AEB A;  3HYV A;  2OLO A;  1CL0 A;  1E7P A;  1KDG A;  2A89 A;  4GF7 A;  3NK2 X;  4II3 A;  4B65 A;  1RP0 A;  3F8R A;  3NHO X;  3DJJ A;  2B9W A;  4JNQ A;  4B64 A;  2VVL G;  2WPE A;  3CPJ G;  3NT6 A;  2GF3 A;  5BUK A;  4JN9 A;  3CGD A;  3HZL A;  1CC4 A;  1RYI A;  2WU5 A;  1ONF A;  3AEG A;  3ISH A;  3L1R A;  3K7M X;  4YSH A;  4OPU A;  3SZ0 A;  4H4Z A;  1P2E A;  3T37 A;  2Q0L A;  5BUL A;  4J33 A;  4NEV A;  3Q6J A;  3C4N A;  3IWA A;  4B63 A;  3BNU A;  3GYX A;  1PBE A;  5KMS A;  1S2Q A;  1GRB A;  1H2I A;  3PVC A;  3UKA A;  3UKP A;  1PXB A;  2V61 A;  3AWI A;  1E1K A;  3AYJ A;  3IHM A;  1VDC A;  2EQ7 A;  1GRG A;  2R4J A;  1EL7 A;  1D4E A;  2JAE A;  4DSH A;  4C3X A;  1KNP A;  4YSX A;  4ECH A;  2X8G A;  3I6D A;  2JB2 A;  2GQF A;  4I58 A;  2WP6 A;  3T2K A;  4AT0 A;  3E1T A;  2YR5 A;  2ACZ A;  1NHQ A;  3NG7 X;  4IVM B;  2FBW A;  4GRT A;  3SZW A;  3UKH A;  1B4V A;  3UKF A;  1GRF A;  1KFY A;  2C76 A;  3GMC A;  1DOC A;  3QSE A;  2GQW A;  1L9D A;  1NHP A;  4Z2U A;  1H84 A;  3ZYX A;  3FG2 P;  1NAA A;  5EOW A;  5KVI A;  1HYU A;  2Z5Y A;  3ZDN A;  1DOE A;  3CGC A;  1TDE A;  2OAL A;  2YLZ A;  5M0Z A;  5IPY A;  4J34 A;  4KPR A;  5U25 A;  1B5Q A;  4U8K A;  2W0H A;  2YVJ A;  4EMJ A;  2B9X A;  3HYX A;  2GR1 A;  4O5U A;  4LII A;  2GB0 A;  4A7A A;  2BS4 A;  4JY2 A;  1V59 A;  3QFB A;  1VG0 A;  2IID A;  2V3A A;  1PJ5 A;  2YG3 A;  1XPQ A;  1OJ9 A;  3LZW A;  2I0Z A;  3GYI A;  4J57 A;  5TR3 A;  3ITJ A;  2RGH A;  1ZP0 A;  3HYW A;  1ZMC A;  2GAH B;  2JB3 A;  4TLX A;  3VQR A;  3V3N A;  3EAN A;  2A87 A;  3BHF A;  3DJE A;  1CC6 A;  2QCU A;  3P9U A;  2X99 A;  4ICY A;  1BKW A;  1IUX A;  4H4S A;  3OC4 A;  3C4A A;  4PAB A;  4X9N A;  3VR8 A;  3EAO A;  1PXA A;  3BHK A;  3KA7 A;  2BAB A;  2RAB A;  2VZ2 A;  3NKS A;  1ZY8 A;  3II4 A;  4JDR A;  2BK4 A;  4A79 A;  1DJQ A;  2XLR A;  2QAE A;  1DNC A;  2WOV A;  1X31 B;  3AEE A;  4OPD A;  2JK6 A;  1VQW A;  4YTP A;  1XHC A;  1Y0P A;  1PBD A;  3CGE A;  5BRT A;  3CMM A;  3S61 A;  4J31 A;  1N4U A;  3LB8 A;  4AT2 A;  1NG4 A;  4EQW A;  2AR8 A;  3KPF A;  3NIX A;  4U2T A;  3AE4 A;  1E1L A;  3AE5 A;  1ZOY A;  4GR1 A;  3LOV A;  3ALJ A;  3GDP A;  3KLJ A;  3SFD A;  2GR2 A;  1ZDL A;  2WQY A;  4CBQ A;  3PS9 A;  3R9U A;  1REO A;  1FL2 A;  1F8R A;  2YG5 A;  1OJT A;  3BNM A;  2WPF A;  1PJ6 A;  3ATR A;  4N9X A;  4H50 A;  3P1W A;  2XFU A;  5J60 A;  1FOH A;  3SYI A;  4BJZ A;  2C4C A;  1CC2 A;  3T2Z A;  3GDN A;  2R9Z A;  4IVO B;  1E1M A;  2RGO A;  4K8D A;  2BAC A;  3KU9 A;  1KNR A;  3VRD B;  1S3E A;  5JCM A;  1LJ1 A;  3B6D A;  1KSU A;  4NTD A;  2R4E A;  1S3B A;  1Z6L A;  3V3O A;  1JOA A;  4PAA A;  4AP1 A;  2C3D A;  1EL8 A;  2OAM A;  2Y6Q A;  4J2W A;  2V6O A;  4A5L A;  3NN0 X;  5U1O A;  1TYT A;  4ZCD A;  2WP5 A;  1FEA A;  3L8K A;  3ICS A;  2BC0 A;  2WDR A;  5FS6 A;  3B3R A;  4EMW A;  2XVJ A;  1GRA A;  1H7X A;  3CIR A;  5KNL A;  1E39 A;  5KMR A;  3M12 A;  1Q9I A;  2GR3 A;  2BS3 A;  3H8L A;  4DSG A;  3FPZ A;  5KMQ A;  4A65 A;  2F5Z A;  1B37 A;  2OA1 A;  2EQ6 A;  1JRY A;  1TDO A;  1JNZ A;  3L5O A;  1H83 A;  4B1B A;  1GPE A;  4YTM A;  4Z2R A;  1PHH A;  4GAV A;  2HQM A;  3ICR A;  3NH3 X;  3UTF A;  1ZX9 A;  3CNS A;  4LU6 A;  4X9M A;  2CUL A;  4C3Y A;  1NEK A;  1K0J A;  2XVH A;  1L9C A;  3KD9 A;  2XFQ A;  3AE8 A;  2XLU A;  4Z2T A;  3COX A;  2WOI A;  4NEW A;  3IHG A;  3FBS A;  3UKL A;  2DKI A;  3DME A;  1LV0 A;  3LAD A;  3T14 A;  5HYM A;  4O5Q A;  1Y56 A;  4HB9 A;  2YAU A;  3DGZ A;  1FEB A;  3NLC A;  1NPX A;  1IJH A;  1GXF A;  1MXT A;  1OJA A;  2BK5 A;  4UDP A;  4G73 A;  5U63 A;  3T2Y A;  3URH A;  3WE0 A;  2XVE A;  1ZMD A;  1LTX R;  5KOW A;  3GD3 A;  1TDK A;  2XLS A;  3RP6 A;  3BI5 A;  1PS9 A;  1Y56 B;  2V5Z A;  3IC9 A;  3NTA A;  1QJD A;  1YQZ A;  1H81 A;  2GVC A;  2X8H A;  2NPX A;  4RSL A;  3GYJ A;  4TM1 A;  3AE6 A;  1B8S A;  4YT0 A;  2ZZ0 A;  3M13 A;  2IVD A;  2R0C A;  2XFP A;  1EL9 A;  4H4R A;  3GSI A;  2ZZB A;  2C75 A;  2FJB A;  3AD9 B;  1K4Q A;  1E6E A;  4MJW A;  1MO9 A;  2C67 A;  4A6N B;  1PBB A;  3DK4 A;  5FS7 A;  2RGJ A;  4XWR A;  4EMI A;  2XYO A;  3S5W A;  1F8S A;  1Q1R A;  3SGL A;  4AOS A;  3UOV A;  2YQU A;  2C72 A;  1ZK7 A;  3DJD A;  4C77 A;  1OJC A;  1K0I A;  2BXS A;  4YKF A;  2BCG G;  3KKJ A;  3VRB A;  1D7Y A;  4U8P A;  1TDN A;  4BK1 A;  4TM3 A;  4NNJ A;  4Y4M A;  3UOX A;  2GV8 A;  4EM3 A;  4GDE A;  4GUV A;  2JKC A;  4REK A;  4B67 A;  4BK3 A;  4BK2 A;  1YQ4 A;  2APG A;  4FDC B;  1JRX A;  5CQF A;  3NRN A;  3GWF A;  2VVL A;  2AQJ A;  1JNR A;  3SFE A;  4EQR A;  4DGK A;  4U8J A;  2DKH A;  3D9X A;  3ALL A;  4A9W A;  2VQ7 A;  1H86 A;  4H2R A;  3O0H A;  4IV9 A;  3FIM B;  2XCG A;  1BF3 A;  1CF3 A;  4Y4N A;  1JU2 A;  4U8M A;  1ZKQ A;  4HA6 A;  1GSN A;  1PDH A;  2C66 A;  3D1C A;  4ADW A;  2C70 A;  4CNJ A;  4AP3 A;  2BRA A;  3AB1 A;  4J36 A;  5GSN A;  3DGH A;  2BRY A;  4G9K A;  2B9Y A;  5JRB A;  1DOB A;  2WDV A;  3JSK A;  3CGB A;  1LQU A;  3UKK A;  3NYC A;  4U8N A;  2XVF A;  4EM4 A;  3ALM A;  1LQT A;  4UDR A;  2GH5 A;  5FS9 A;  4UDQ A;  5M10 A;  2VOU A;  2WES A;  4NZH A;  1GT8 A;  1JRZ A;  1N4V A;  3ATQ A;  1FCD A;  1EL5 A;  3SXI A;  3AXB A;  3AE2 A;  5EB5 A;  4CCR A;  5HY5 A;  2XFN A;  4RG3 A;  2XLT A;  3K7T A;  2YR6 A;  3DH9 A;  5FS8 A;  3ABV A;  3QVP A;  4OCG A;  4EQS A;  4DNA A;  4E0V A;  4Z24 A;  2YVF A;  3CTY A;  2VRM A;  4WCT A;  3SX6 A;  1GRE A;  1CJ2 A;  1TRB A;  4OPI A;  4TLZ A;  4U8I A;  2Q6U A;  1S7M A;  5HXI A;  4H4Y A;  1GER A;  4USR A;  4APN A;  4U8O A;  5IQ4 A;  2QA2 A;  2OLN A;  1W4X A;  4AOX A;  1FEC A;  2X50 A;  1H7W A;  3SZC A;  3UP4 A;  1PBC A;  4YXD A;  3Q9T A;  4TM4 A;  2X3N A;  2J3N A;  4K22 A;  1GRT A;  4NTE A;  1D4C A;  4D03 A;  4YWO A;  1YQ3 A;  5HHF A;  1PXC A;  2ARD A;  1KSS A;  3C96 A;  2VQB A;  1GTE A;  1N1P A;  1BWC A;  2GR0 A;  3BI2 A;  3CPH G;  3NYF A;  4X4J A;  4CNK A;  1L9E A;  1QO8 A;  4XWZ A;  1GAL A;  1IUT A;  1COY A;  2QA1 A;  4H2Q A;  4OPG A;  3AE9 A;  2TPR A;  2YWL A;  3UTH A;  2ZBW A;  3OZ2 A;  4K5R A;  3F8D A;  5KRQ A;  2AAQ A;  4FK1 C;  4CY6 A;  1EBD A;  2WPC A;  1M64 A;  1N4W A;  4IA6 A;  4H4X A;  3GRT A;  1CBO A;  4H4U A;  5JCL A;  4JQ9 A;  2C7G A;  4B68 A;  2R0P A;  3F8P A;  5C2T A;  5JCI A;  2R46 A;  2XVI A;  3D8X A;  1KF6 A;  1CJC A;  2UZZ A;  1DJN A;  1GEU A;  1VRQ B;  4USQ A;  1F3P A;  4YTN A;  1F8W A;  2BXR A;  1NHS A;  1XAN A;  3AEA A;  4JY3 A;  4OVI A;  2GMJ A;  5EB4 A;  1D7L A;  2CVJ A;  5DBJ A;  4A6N A;  1H6V A;  4Y4L A;  4Z25 A;  2PYX A;  1LVL A;  2GAG B;  4H4T A;  2XDO A;  3ADA B;  1O94 A;  1PJ7 A;  2WS3 A;  4NTC A;  4NWZ A;  3AEF A;  2EQ9 A;  3AE1 A;  3GWD A;  2V3B A;  3I3L A;  3DK8 A;  2YR4 A;  3AE3 A;  4B66 A;  3VR9 A;  1BGJ A;  1MOK A;  2B76 A;  1AOG A;  3DA1 A;  4LA1 A;  1DXL A;  3AYI A;  3NK0 X;  1ELI A;  2WHD A;  4C74 A;  2BK3 A;  3SQP A;  1GOS A;  2B7R A;  3G5S A;  4IA5 A;  3T0K A;  1IUU A;  1PBF A;  1ZOV A;  3GD4 A;  1GES A;  4H4Q A;  3V76 A;  3QSM A;  2BCP A;  3CND A;  3NYE A;  1K0L A;  1YKJ A;  2VVM A;  3LJP A;  4K7Z A;  2JBV A;  1E1N A;  2E4G A;  2X8C A;  4K5S A;  3UOY A;  2CFY A;  2YG4 A;  2E1M A;  4D04 A;  3NK1 X;  2YM2 A;  3UCL A;  2YG7 A;  1D4D A;  4UP3 A;  4BV6 A;  2CDU A;  2R45 A;  4OPL A;  4U8L A;  1O5W A;  2YG6 A;  3CPI G;  3RP7 A;  3GRS A;  3UTE A;  3NTD A;  3P4Q A;  1NHR A;  5KXJ A;  4U2S A;  2WBA A;  1O95 A;  4GAP A;  1RSG A;  4A99 A;  4FK1 A;  1P2H A;  4C5O A;  4CCQ A;  2B7S A;  5JCN A;  1S2Y A;  2WET A;  3H4K A;  1PN0 A;  3AE7 A;  3LXD A;  3LZX A;  1LPF A;  2A8X A;  1JEH A;  4II2 A;  2Q7V A;  5EBK A;  4M52 A;  3K30 A;  1NG3 A;  3RHA A;  1H82 A;  2BS2 A;  4BJY A;  5C3J A;  2XLP A;  1KN0 A;  2IVE A;  2YM1 A;  3CNJ A;  2Y6R A;  4G6G A;  4H7U A;  2WP9 A;  3RP8 A;  4FX9 A;  4YSY A;  2C73 A;  4ZN0 A;  2C65 A;  1QLB A;  2GMH A;  1NDA A;  1SEZ A;  3BI4 A;  4XXG A;  5CKU A;  1IUV A;  1GND A;  2PHH A;  2WDQ A;  1IUW A;  3NGC X;  1CJ4 A;  1M6I A;  3AD8 B;  3NN6 X;  2V60 A;  4K2X A;  5KOX A;  2Z5X A;  1XDI A;  3T31 A;  4H4W A;  1L0V A;  4EIP A;  4CY8 A;  4Z43 A;  3UKQ A;  5GRT A;  4KX6 A;  1GRH A;  2Q0K A;  1CJ3 A;  4GCM A;  3PG6 A;  4I59 A;  1GTH A;  2YLS A;  1BGN A;  4H2P A;  4P9S A;  3AEC A;  5FMH A;  3P4R A;  2YLX A;  2YLR A;  1F6M A;  1CHU A;  3AYL A;  1TYP A;  2WU2 A;  4EIQ A;  3G5Q A;  5BVA A;  4RG4 A;  4GDP A;  3QJ4 A;  2FJE A;  4OPT A;  2GRT A;  4Z26 A;  3CNP A;  3CNT A;  2FJD A;  2YLT A;  1TDF A;  3H8I A;  3IF9 A;  2C64 A;  3QFA A;  4H2N A;  5KWF A;  2VRL A;  3AED A;  4ZCC A;  2EQ8 A;  3AD7 B;  4JNA A;  3QSS A;  3VRA A;  1VG9 A;  3K7Q X;  3FMW A;  3KVE A;  3G5R A;  3SZF A;  4H4P A;  4Z44 A;  2R0G A;  1Q1W A;  4U2L A;  5IQ1 A;  4YKG A;  1NEN A;  3DJG X;  5KVH A;  2WOW A;  4BUR A;  1D5T A;  5JCK A;  2H88 A;  4OPC A;  2TMD A;  3ICT A;  3RED A;  1DOD A;  2ZZC A;  2WEU A;  2XFO A;  2BYB A;  3SY4 A;  4YSZ A;  1YY5 A;  3UOZ A;  1UKV G;  3CN8 A;  2YVG A;  2YLW A;  2NVK X;  5ER0 A;  4CRT A;  3M0O A;  3UP5 A;  2GEW A;  5KMP A;  4H4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...