5U1OA

2.3 angstrom resolution crystal structure of glutathione reductase from vibrio parahaemolyticus in complex with fad.
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
450
structure length
450
Chain Sequence
ATHFDYICIGGGSGGIASANRAAMYGAKVALIEAQDLGGTCVNVGCVPKKVMWHGAQIAEAMNLYAEDYGFDVDVKGFDWSKLVESRQAYIGRIHQSYDRVLGNNKVNVIKGFAKFVDEKTVEVNGEHYTADHILIAVGGRPTIPNIPGAEYGIDSNGFFDLAEQPKRVAVVGAGYIAVEIAGVLHALGTETHLFVRKESPLRSFDPMIIDTLVEVMEAEGPTLHTHSVPKEVVKEADGSLTLHLENGESQNVDQLIWAIGRHPATDAINLASTGVATNEKGYIKVDEYQETNVKGIYCVGDIMEGGIELTPVAVKAGRQLSERLFNNKPNAKMDYDLVPTVVFSHPPIGTIGLTTQEAEEKYGKDNIKVYTSGFTAMYTAVTKHRQPCKMKLVCAGEEETVVGLHGIGFTVDEMIQGFGVAMKMGATKADFDSVVAIHPTGSEEFVTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.3 Angstrom Resolution Crystal Structure of Glutathione Reductase from Vibrio parahaemolyticus in Complex with FAD.
rcsb
source organism Vibrio parahaemolyticus serotype o3:k6 (strain rimd 2210633)
molecule tags Lipid binding protein
molecule keywords Glutathione reductase
total genus 146
structure length 450
sequence length 450
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5u1oA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5u1oA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5u1oA02
3K7QX 4OVIA 1TDFA 2RGJA 1H7XA 5GRTA 2C64A 3AWIA 4N9XA 2IVEA 3CNTA 2BS4A 1NHQA 1KSSA 3R9UA 4DSGA 1D4CA 1Q1WA 5J7XA 3DK8A 2APGA 1F3PA 3AXBA 3NK0X 4OPTA 5DBJA 1GALA 4USQA 1BWCA 2GR3A 2WESA 5KVHA 4NEWA 3IWAA 4A99A 4Z25A 1TDNA 4JNQA 4K5RA 4Z2TA 4RG3A 1ELIA 3CGBA 4H4YA 3GD4A 4PAAA 4NTCA 4H7UA 3Q9TA 4CBQA 3L1RA 4J36A 2YR5A 3P4RA 4C74A 2WP5A 5FS9A 3I6DA 3V3NA 1DXLA 1EL5A 2A87A 2VQBA 3E1TA 4IA5A 3BI4A 2BCPA 3P4QA 1NG3A 1BZLA 4P9SA 3AE7A 1GERA 3JSKA 1GRGA 1ZY8A 1P2EA 3NNEA 1PN0A 2I0ZA 2E1MA 3UKQA 2EQ6A 5EOWA 1PXCA 1RSGA 4NTDA 2OAMA 2VVMA 3UKAA 4O5QA 3SFDA 3GYIA 3ICSA 3NGCX 4EMWA 2AR8A 2FJAA 4U2SA 1LPFA 3B3RA 4H4ZA 2WP6A 2B7SA 2WHDA 2DKHA 3K30A 1ZDLA 3RNMA 1FCDA 3M12A 3NK1X 3BI2A 4YTMA 2OALA 2YG3A 3GD3A 4AOSA 3Q6JA 3IF9A 4CCRA 3URHA 1FL2A 2BS3A 5ER0A 4O5UA 1H81A 3D8XA 2QA1A 4H4TA 1H86A 3GDPA 2R0PA 5M10A 3FPZA 1XANA 4HA6A 1DNCA 4C3YA 2GR1A 1E1LA 1L9DA 3CGEA 3NN6X 4YSZA 1S2YA 5U63A 4USRA 4Y4LA 1E1MA 3ATQA 3NKSA 3DGZA 2TMDA 4BK2A 2JAEA 4GDPA 3NLCA 4ZN0A 1NHRA 4FK1A 4ICYA 1F8SA 1O94A 3S5WA 1YQ4A 3SFEA 5KOWA 4EM4A 3KA7A 3D1CA 3NYCA 4TLXA 4AP3A 3ZYXA 2XLPA 2VZ2A 3NYFA 2GH5A 3NTDA 1GREA 2GVCA 3UKKA 4DSHA 1M6IA 3C4NA 3AE9A 3UOZA 4D03A 4CCQA 2XFOA 4FK1C 4RG4A 1GT8A 1CC4A 1UKVG 4E0VA 4MJWA 4EMJA 3FG2P 4GR1A 1DJNA 2GF3A 4CNKA 4FX9A 5EBKA 2BK3A 1Q9IA 2E4GA 2C75A 1OJTA 2YVFA 2GQWA 2AAQA 4KPRA 4YWOA 1IUXA 1E1KA 2CDUA 2GAHB 2H88A 3NIXA 4B65A 4X9MA 1ZP0A 5BVAA 1EL8A 1GXFA 2WPCA 3VQRA 1B8SA 4K22A 3VR8A 1CF3A 4J33A 2XVJA 1RP0A 1KF6A 2GAGB 5C3JA 4KX6A 2QCUA 4Z26A 5FS8A 3NG7X 1ONFA 3L8KA 3DJJA 4OPUA 3P1WA 2X8CA 1FOHA 3AEGA 3AEEA 4LIIA 4B69A 4CY8A 1B4VA 2WBAA 3IC9A 1PS9A 2YLSA 1JU2A 2XVHA 2JKCA 2WU5A 1NAAA 2ACZA 2B76A 2XVEA 3CTYA 5KRQA 3C96A 3RHAA 1COYA 2R4EA 1CJ3A 4REKA 2OA1A 3KPFA 3LXDA 1GTEA 4NEVA 2FJBA 3AE8A 3ALLA 1IUUA 3AE1A 3DA1A 1GESA 2AQJA 4I58A 1GRFA 3AE2A 1BGJA 1JRXA 1NPXA 2BA9A 1GSNA 2R9ZA 3GYJA 2HQMA 1PHHA 2X99A 2CFYA 4H4VA 1N4UA 1S3EA 2C66A 4BJZA 2UZZA 3LB8A 1E7PA 2JB2A 3AE6A 2YLWA 4XWRA 2V6OA 1GRAA 2YQUA 4J56A 2JBVA 1OJ9A 2J3NA 2WDQA 2YLZA 3DJDA 2FJEA 3PVCA 3QVPA 1TYTA 1H83A 1S3BA 4H2QA 4JY3A 3LZWA 1F8WA 1YY5A 4X4JA 5J60A 4B66A 4BK1A 3EAOA 4EQWA 4J34A 5JCKA 4U8PA 1EL7A 1V59A 4C3XA 2VRLA 2H89A 2WDRA 1TRBA 2WOIA 2YG5A 4U8KA 4Z2UA 4ADWA 2EQ9A 1DOEA 4A7AA 1Q1RA 4OPDA 2VRMA 2YWLA 3OZ2A 4J2WA 4K5SA 2GMJA 4Z43A 2JB1A 2IVDA 2XLTA 1D5TA 1DOCA 1RYIA 2BXSA 3AEDA 3EPTA 3FIMB 1X31B 3UOXA 4IVOB 2NVKX 3UTFA 1FEBA 4U2TA 3AE3A 1GV4A 4A9WA 4U8NA 5KVIA 3I3LA 3UKPA 1ZMDA 1LV0A 3AD8B 4A6NB 2GR2A 4YT0A 4M52A 5IPYA 4JNAA 5IQ4A 3K7TA 1GEUA 3CPIG 4BURA 3OC4A 4OPLA 3F8RA 4FDCB 2BC0A 2BXRA 2YG6A 1DJQA 4I59A 4B68A 1EL9A 2WQYA 3F8PA 1JNRA 1KFYA 1VG9A 1FEAA 1PBCA 3GMBA 1CC6A 4OPIA 2ZBWA 5BULA 3AE4A 2PHHA 1Y0PA 4EIPA 3AYIA 1JEHA 4RSLA 5HY5A 2JK6A 3GRTA 1SEZA 2YG4A 1TDEA 3SM8A 2GEWA 5TR3A 3C4AA 3H8IA 3NHOX 2YVGA 4U2LA 4WX1A 4YSHA 3CGCA 1JRYA 1PXAA 3PO7A 4U8OA 3IHGA 1KNRA 3ICRA 4TM3A 2PYXA 5KWFA 4NZHA 1VG0A 1QLBA 4DNAA 1GETA 2XFQA 4AT0A 1GOSA 1ZOYA 4HB9A 3IHMA 3VR9A 1IJHA 2TPRA 2E5VA 2XLSA 3BHKA 2QAEA 1VRQB 2WETA 2XFPA 2YLTA 1L0VA 1D4DA 4AP1A 5GSNA 3ALMA 3QFAA 4U8MA 2EQ7A 5JCNA 3ABVA 1AOGA 1VQWA 4U8IA 3T37A 4IVMB 2C65A 3UP4A 4EM3A 5HXIA 3UTHA 2CULA 2V3BA 4BV6A 5JCIA 2WS3A 2Z5YA 4H4SA 1N4VA 1IUVA 4EMIA 1JOAA 1N1PA 1EBDA 1QO8A 4ECHA 4Z24A 1L9EA 2V5ZA 3AYLA 2GB0A 3V76A 1CL0A 3BNUA 4D04A 1PBDA 2Y6RA 1QJDA 4PABA 1CJ4A 3CNSA 3P4PA 1H84A 1PJ7A 4GDEA 5FS6A 4C5OA 1CHUA 3KKJA 2ZZ0A 3V3OA 1H82A 3RP7A 1ZK7A 2RGOA 4UDPA 3ITJA 1PJ5A 3DH9A 1K0JA 2B7RA 1PJ6A 2BC1A 1Y56B 3UKLA 5CKUA 2BCGG 3HZLA 3UOYA 5EB5A 1DOBA 3G5RA 5KOXA 4LU6A 2BYBA 4YTPA 2Q7VA 1H6VA 1ZKQA 4EQXA 3RP6A 2C73A 2XVFA 3UTGA 2BACA 3UKHA 1TYPA 1ZX9A 3DGHA 1LQUA 2NPXA 1M64A 2O9ZA 2WU2A 2YR4A 2RABA 4A79A 2Q0KA 4H4WA 2OLOA 2ZZBA 4YKGA 2Q0LA 3DK4A 2WP9A 2X3NA 2XYOA 4Y4MA 1REOA 3AEFA 2C3DA 1HYUA 1XDIA 1D7LA 1E1NA 2V60A 3AYJA 5M0ZA 1ZMCA 2FJDA 5C2TA 1JNZA 2BK5A 2GRTA 3K7MX 4ZCCA 3P4SA 4IV9A 2WOWA 3EF6A 4AOXA 3KD9A 1CJCA 3DJGX 2XVIA 2R4JA 5U1OA 3H8LA 2BS2A 3AEAA 3KU9A 3FMWA 4K7ZA 1W4XA 1XPQA 3P9UA 3M0OA 4J57A 4Z2RA 3REDA 1NENA 4TLZA 4BJYA 4YSYA 3DJEA 3CNPA 2XFUA 2VVLA 2YLRA 2V3AA 3GWDA 3QJ4A 2Z5XA 4YXDA 1D7YA 4EQRA 3KVEA 1NDAA 2VVLG 4X9NA 4H2PA 2DKIA 1MXTA 5U25A 4DGKA 4ZCDA 3AEBA 4A6NA 3FBSA 3ISHA 3UCLA 2X8HA 2Q6UA 1NG4A 3VRAA 3G5SA 2C76A 2GQFA 1KSUA 1PDHA 4K8DA 4IA6A 2XLUA 3BNMA 4EIQA 1PBBA 2WDVA 2Y6QA 4Y4NA 3ICTA 3II4A 2GR0A 1CC2A 1GPEA 1GRTA 1D4EA 3AECA 3CIRA 3QSSA 5KXJA 5FS7A 4H2NA 3WE0A 4OCGA 1K0IA 4UDRA 1GTHA 4H2RA 5JCLA 4CRTA 3H4KA 3LZXA 4U8JA 3GWFA 3CPJG 4H4QA 3GMCA 1GRBA 3NH3X 4Z44A 4CNJA 5HYMA 1O95A 3SQPA 1YQ3A 1O5WA 2FBWA 2B9YA 1S2QA 1LQTA 2XDOA 2X8GA 4XXGA 1LTXR 1CJ2A 3O0HA 2ZZCA 1GNDA 3LJPA 2JB3A 3ATRA 2WPEA 2YM2A 1KDGA 3AD9B 1YQZA 3NRNA 3CNJA 3CN8A 3GSIA 2XCGA 3KLJA 3QFBA 3G5QA 1MOKA 3CPHG 1TDKA 3NYEA 4LA1A 1OJCA 3RP8A 2B9WA 4EQSA 2GV8A 1MO9A 1BGNA 1CBOA 2IIDA 4GUVA 4H4XA 1LJ1A 1NEKA 3S61A 2YG7A 3UOVA 1YKJA 2VQ7A 2C7GA 2R45A 3B6DA 4H4UA 4GF7A 3F8DA 3ZDNA 1F8RA 4JQ9A 4JY2A 3BI5A 3AE5A 1JRZA 3GDNA 5BRTA 2QA2A 1OJDA 2ARDA 2CVJA 2R0CA 5BUKA 1NHSA 2WOVA 3EANA 3GRSA 4YTNA 2YVJA 3QSMA 4GCMA 2XLRA 4J31A 2C72A 4WCTA 2OLNA 1PBEA 4XWZA 3UKFA 5HHFA 1TDOA 2A89A 4H4RA 2C67A 3AB1A 2V61A 3NK2X 4OPGA 3ALJA 1Y56A 4YSXA 1H7WA 2C3CA 1F6MA 3PS9A 4OPCA 3LOVA 3CGDA 2R46A 2BABA 2YLXA 3QVRA 4TM4A 1P2HA 1E39A 2XFNA 4A65A 1L9CA 4CY6A 1B5QA 4UDQA 2VOUA 1IUTA 4H50A 4TM1A 4YKFA 4A5LA 1B37A 4B67A 4B64A 4B1BA 4B63A 1BKWA 3CNDA 4AT2A 3SGLA 2C70A 5JCMA 1OJAA 1FECA 1N4WA 1PBFA 2B9XA 2EQ8A 3NN0X 1E6EA 2A8XA 2YAUA 4UP3A 2YR6A 1IUWA 1Z6LA 1BF3A 5CQFA 1IUSA 1K4QA 5EB4A 3NTAA 2WPFA 2W0HA 1LVLA 1K0LA 3AD7B 4JN9A 3UP5A 3UTEA 3VRDB 5IQ1A 3DK9A 5FMHA 1KNPA 1VDCA 3QSEA 4K2XA 3NT6A 1NHPA 1GRHA 4NTEA 4C77A 5LV9A 1DODA 4U8LA 2BK4A 2F5ZA 3BHFA 2RGHA 4GRTA 4TM0A 3ADAB 4BK3A 2X50A 1PXBA 1XHCA 4JDRA 3LADA 2R0GA 1ZOVA 2WEUA 3VRBA 5L46A 4APNA 2GMHA 3M13A 3COXA 4H4PA 3DMEA 2YM1A
chains in the Genus database with same CATH superfamily
2QDEA 4N9XA 2C64A 3JZUA 5J7XA 1GALA 4NEWA 4RG3A 3CGBA 2GGHA 2W3SA 4PAAA 3Q9TA 3L1RA 4J36A 2YR5A 5FS9A 3V3NA 3DIPA 4ENLA 3BI4A 3P4QA 3T9PA 1X2GA 4P9SA 3JSKA 1SB3B 3NNEA 1EC9A 2E1MA 5EOWA 1PXCA 3NVVB 2OAMA 3ICSA 3NGCX 1FHUA 3FXGA 1FCDA 2OALA 2YG3A 2XSXA 3Q6JA 3IF9A 4CCRA 1FL2A 2HZGA 3CXOA 3GDPA 3UJEA 3NVYB 2PP3A 3NN6X 1S2YA 1WUFA 4BK2A 1NHRA 4FK1A 1O94A 3S5WA 3SFEA 4KWSA 4DX3A 3NYFA 3P3BA 3NTDA 2GVCA 3C4NA 3VCNA 3UOZA 2OKTA 3PG6A 2XFOA 4E0VA 5EBKA 2E4GA 2YVFA 2GQWA 2AAQA 4KPRA 2GAHB 1IUXA 3NIXA 3MY9A 1L8PA 4X9MA 1B8SA 3TTEA 1RP0A 4JN8A 5C3JA 3NS1B 4KX6A 2QCUA 3DJJA 3P1WA 3AEGA 4CY8A 2JKCA 2WU5A 2XVEA 3CTYA 1CJ3A 2OA1A 3NVWB 3CYJA 3ALLA 3SX6A 2BA9A 3GYJA 2R9ZA 2HQMA 4BJZA 1PHHA 1S3EA 4GIRA 2GL5A 2V6OA 2YQUA 4J56A 2JBVA 5FJRA 2J3NA 2WDQA 3DJDA 2FJEA 1S3BA 4FP1A 1F8WA 4EQWA 4U8PA 4J34A 5JCKA 3S47A 2H89A 1PDZA 4IZGA 3SZCA 1ELSA 2XH2A 2QJNA 4K5SA 1D5TA 3N6HA 3UOXA 2NVKX 1FEBA 3QKEA 4U2TA 3SY4A 3I3LA 3UKPA 2AKZA 3MWCA 4BURA 3SYIA 4OPLA 3F8RA 2WQYA 1JNRA 3AMZA 1CC6A 4H1ZA 2ZBWA 4OPIA 4MGGA 1Y0PA 2PS2A 1JEHA 3MKCA 2JK6A 1TDEA 3N4EA 2W54A 3NHOX 4DN1A 3T2YA 4II3A 4U8OA 3IHGA 3ICRA 3T14A 2P0IA 1VG0A 1TE6A 1ZOYA 3IHMA 2TPRA 2E5VA 2QAEA 3R07C 1L0VA 1D4DA 3ABVA 3IJIA 2C65A 3UP4A 3UTHA 2Z5YA 1YEYA 1N4VA 1QO8A 2QQ6A 2HNEA 2V5ZA 3V76A 1CL0A 4D04A 1PBDA 1QJDA 3AM9A 5FJOA 5FS6A 1CHUA 3KKJA 3RP7A 1ZK7A 2RGOA 4ZOHB 2BC1A 3HZLA 5EB5A 1EC7A 3G5RA 4JHMA 2PP1A 1ZX9A 1LQUA 2WU2A 2OLOA 1STZA 4YKGA 2WP9A 2XYOA 4Y4MA 1REOA 2C3DA 1ZXIC 1XDIA 1E1NA 3QTPA 3B9JB 2BK5A 3MSYA 3EF6A 3KD9A 1CJCA 2R4JA 3H8LA 3U9IA 3AEAA 1W4XA 4J57A 1N60C 3REDA 3MZNA 1NENA 4TLZA 3DJEA 3CNPA 2VVLA 2PTWA 3Q4DA 1TZZA 1NDAA 5JRBA 1PDHA 3HW2A 2GDQA 4IA6A 2XLUA 3BNMA 7ENLA 4Y4NA 3ICTA 4G73A 1CC2A 1D4EA 1XS2A 2BRAA 4CRTA 3CPJG 3SQPA 1O95A 1YQ3A 1O5WA 2FBWA 4G6GA 2X8GA 3TOYA 3LJPA 2YM2A 3AD9B 1EBGA 1KKRA 3G5QA 2ONEA 2MNRA 4LA1A 2B9WA 2PA6A 4EQSA 1BGNA 4YWSA 3SN0A 3S61A 1V97A 3ZDNA 3B97A 3DERA 1YKJA 4A65A 1OJDA 3UJSA 5BUKA 3VFCA 4YTNA 3QSMA 2OLNA 1TDOA 4H4RA 2V61A 4OPGA 2C3CA 3PS9A 3LOVA 3R25A 3QVRA 3TW9A 4TM4A 1P2HA 3ZVHA 2NQLA 3DESA 3TWBA 3PWIA 1B5QA 4H50A 4TM1A 1KN0A 1B37A 4B67A 4B64A 4B1BA 4AT2A 3SGLA 2C70A 2B9XA 2OQYA 5BOEA 2YR6A 1IUWA 1BF3A 3T2ZA 4ZA0A 3UTEA 1IYXA 1RVKA 5FMHA 1VDCA 1GRHA 4C77A 2P8BA 2F5ZA 3H7VA 2RGHA 4K8GA 3ADAB 3RR1A 3DMEA 3VR9A 3FYYA 1FFUC 4OVIA 3QPEA 2RGJA 1H7XA 3RCYA 2BS4A 1SJDA 3DK8A 3AXBA 3NK0X 3UCDA 4USQA 1BWCA 5KVHA 3NXLA 4K5RA 4GISA 3CB3A 3P4RA 4C74A 3E1TA 4IA5A 4ROPA 4G74A 1GERA 2PTXA 2I0ZA 3UKQA 4NTDA 4G6HA 4EMWA 2OVLA 4U2SA 2PSNA 2B7SA 1ZDLA 3SZ0A 4YTMA 2BS3A 4HNCA 3D8XA 3FPZA 1XANA 1DTNA 4HA6A 4C3YA 3H70A 3DEQA 4E5TA 4USRA 3IJLA 4Y4LA 3NKSA 3DGZA 4GDPA 3HYWA 1VQZA 4KT2A 4TLXA 4KPLA 3ZYXA 4HCDA 1GREA 3UKKA 1M6IA 3SN4A 3AE9A 3QN3A 2QDDA 4D03A 4CCQA 1P43A 4FK1C 4MJWA 3FG2P 4GR1A 2GF3A 2H88A 3ZLFA 1EL8A 2WPCA 2GAGB 3FV9A 2OG9A 3NG7X 3L8KA 1BKHA 3AEEA 4B69A 2WBAA 3IC9A 2YLSA 2XVHA 4A3RA 1NAAA 2ACZA 3RHAA 3H8AA 2R4EA 4IP5A 4REKA 3KPFA 3I6EA 3LXDA 1VDVA 4NEVA 1GRFA 3AE2A 1BGJA 1JRXA 3RP6A 1GSNA 4ICYA 3P0WA 4H4VA 2C66A 3AN1A 3LB8A 3RRAA 3ZVIA 1GRAA 1OJ9A 4GMEA 1H83A 4H2QA 3LZWA 4MKSA 5J60A 4BK1A 3DDMA 1EL7A 4TVYA 1TRBA 2WOIA 3OZYA 3NRZB 4H2HA 1DOEA 2YWLA 4J2WA 1DOCA 1RYIA 3UJ2A 1GV4A 1OEPA 2PCEA 1ZMDA 3A7AA 4M52A 5IQ4A 3K7TA 3CPIG 2YG6A 1EL9A 1PBCA 5BULA 3AE4A 2PHHA 3AYIA 5HY5A 3GRTA 3PWGA 3SZWA 3SM8A 4A6GA 2YVGA 4IHCA 4YSHA 3PO7A 3EUB3 2PYXA 1QLBA 3BHKA 3UCCA 2WETA 3DFYA 3ETRB 2EQ7A 4U8IA 4IVMB 4EM3A 2V3BA 4BV6A 4H4SA 1IUVA 1N1PA 1MUCA 1S7MA 2GB0A 5BOFA 3CNSA 3P4PA 1BQGA 4Z1YA 1PJ5A 1PJ6A 1Y56B 3HYVA 3UOYA 4YTPA 1H6VA 3L5OA 1ZKQA 2PP0A 2OPJA 2C73A 2BACA 2OZTA 4A79A 2NPXA 2ZZBA 2X3NA 1HYUA 4E4UA 3D9XA 1ZMCA 3TJ4A 2FJDA 5KMSA 4ZCCA 4IV9A 2WOWA 4AOXA 3NO1A 2XVIA 3FCPA 3CAWA 3P9UA 5EU9A 3M0OA 4BJYA 4YSYA 3HPFA 3GWDA 3RO6A 1D7YA 3KVEA 2VVLG 3UJRA 1MXTA 5U25A 3AEBA 4A6NA 3VRAA 1W6TA 4GFIA 5J04A 2GQFA 1KSUA 4K8DA 1PBBA 2Y6QA 3T2KA 3AECA 3U4FA 3WE0A 1K0IA 3R1ZA 1GTHA 3H4KA 4HNLA 4H4QA 3NZGA 4CNJA 5HYMA 1N61C 4IP4A 2B9YA 4DYEA 2XDOA 4XXGA 1LTXR 1CJ2A 3O0HA 2ZZCA 2JB3A 1YQZA 3NRNA 3GSIA 3SBFA 1MOKA 5KMPA 1WUEA 3RP8A 1NEKA 4HCLA 4Z17A 2VQ7A 2R45A 1F8RA 4JQ9A 4JY2A 3AE5A 1JRZA 3CMMA 2ARDA 1NHSA 2WOVA 4GCMA 2XLRA 4J31A 1PBEA 2A89A 2C67A 1ONEA 3AB1A 3ALJA 3VC5A 3CXBA 2R46A 2BABA 2YLXA 1ECQA 1E39A 2GGJA 2C4CA 4UDQA 3FJ4A 4YKFA 4A5LA 1NU5A 1BKWA 1E9IA 1FECA 2P88A 2A8XA 3P93A 3VC6A 2WPFA 3UP5A 3VRDB 2GSHA 1SJCA 1KNPA 4K2XA 1NHPA 3A7RA 3ES8A 3BHFA 3QLDA 4JDRA 5L46A 2WEUA 2QJMA 3M13A 5KRQA 3T37A 2YM1A 3K7QX 1TDFA 3AWIA 5GRTA 3CNTA 1NHQA 3R9UA 4DSGA 3HRDC 1F3PA 2GR3A 2WESA 4A99A 4Z25A 2AL1A 2PPGA 1TDNA 1WYGA 2PTYA 3IK4A 4JNQA 2CHRA 2E5AA 4H4YA 3GD4A 1MDRA 3S5SA 3I6DA 2HXUA 1EL5A 2VQBA 2BCPA 4J1OA 1NG3A 1BZLA 5KMRA 5G5HB 1P2EA 2EQ6A 4DXKA 1RSGA 1FIQB 4O5QA 3SFDA 3GYIA 2AR8A 4K2SA 3K30A 4H4ZA 2WP6A 3B3RA 3M12A 3NK1X 3MUCA 5ER0A 4O5UA 1H81A 4H4TA 1H86A 3ZVHB 2R0PA 2GGEA 2GR1A 4GAPA 4YSZA 5U63A 1E1MA 4H83A 3ATQA 2JAEA 3NLCA 4ZN0A 1RM6B 1YQ4A 3VDGA 5KOWA 3KA7A 3D1CA 3NYCA 4AP3A 1P48A 2XLPA 2GH5A 4EWJA 1CC4A 1UKVG 4EMJA 1DJNA 4CNKA 4FX9A 1E1KA 2CDUA 3DG6A 3SZFA 1ZP0A 5BVAA 3R0UA 3VQRA 3VR8A 1CF3A 4GGBA 1KF6A 1ONFA 3OTRA 2OX4A 2X8CA 2OFJA 2B76A 1COYA 1H2IA 1GTEA 1XPYA 1IUUA 3AE1A 1GESA 2AQJA 4I58A 2X99A 2CFYA 3ES7A 1E7PA 2JB2A 2YLWA 2MUCA 3PK7A 3PVCA 3QVPA 4JY3A 3DFHA 1JPMA 1YY5A 4X4JA 2FYMA 3EAOA 2ZC8A 1V59A 2VRLA 5KMQA 1JRPA 2YG5A 4J3ZA 4U8KA 4Z2UA 4ADWA 2EQ9A 4A7AA 1Q1RA 2VRMA 3OZ2A 2JB1A 3TCSA 2XLTA 1T3QC 2BXSA 3AEDA 1X31B 3UTFA 3JW7A 4A9WA 5KVIA 3V5CA 1LV0A 3AD8B 4A6NB 2GR2A 5IPYA 4JNAA 1GEUA 1MNSA 3OC4A 2BXRA 4I59A 4B68A 1VG9A 4EIPA 4RSLA 1SEZA 5TR3A 3H8IA 3CGCA 1JRYA 2AKMA 1KNRA 4TM3A 2P3ZA 4NZHA 4DNAA 1GETA 2XFQA 4IL0A 1IJHA 2XLSA 1VRQB 2ZADA 4AP1A 2YLTA 2PGEA 3V3WA 1PDYA 4GYPA 2CULA 5JCIA 4EMIA 1JOAA 4ECHA 4Z24A 1L9EA 2DW6A 1PJ7A 4GDEA 3V3OA 4UDPA 3ITJA 5KNLA 1DOBA 3R0KA 5KOXA 1R0MA 2BYBA 4EQXA 3UKHA 1TYPA 3DGHA 3RITA 2RABA 4H4WA 3GD6A 2Q0LA 3RGTA 3SJNA 1FHVA 2V60A 5FJUA 5M0ZA 1JNZA 2GRTA 3K7MX 1N5WC 3NVZB 3KU9A 2PU0A 4K7ZA 3FMWA 1XPQA 4F4RA 4Z2RA 2XFUA 2YLRA 3QJ4A 1FFVC 4YXDA 4E6MA 4EQRA 4X9NA 2DKIA 4DGKA 4A35A 3ISHA 2XH7A 3CK5A 2XH4A 1NG4A 1SJBA 3QSSA 5FS7A 4OCGA 4H2RA 5JCLA 2P8CA 3I4KA 3VCCA 3LZXA 3GMCA 4Z44A 3N6JA 1F9CA 3SR6B 3PFRA 4KEMA 5ENLA 1KDGA 3CPHG 3I6TA 2GV8A 2IIDA 4GUVA 3OW1A 3SN1A 4FI4A 2C7GA 3B6DA 4GF7A 4H4UA 5BRTA 3F8DA 3GDNA 2QA2A 2HXTA 3T8QA 3EANA 2YVJA 2C72A 4XWZA 3UKFA 5HHFA 3GYXA 1Y56A 3FVDA 4E4FA 1F6MA 1H7WA 3CGDA 3GY1A 4X2PA 3NFUA 1JROA 1L9CA 2VOUA 3V4BA 1OJAA 3NN0X 4M6UA 1PBFA 2EQ8A 1E6EA 2YAUA 3OPSA 2PMQA 1IUSA 1K4QA 5EB4A 1LVLA 1K0LA 3TWAA 3DK9A 3T4WA 5LV9A 4IL2A 1DODA 4MMWA 4U8LA 3DGBA 4GRTA 4TM0A 1EC8A 2X50A 1PXBA 1XHCA 2R0GA 4G7FA 4TVWA 3GC2A 3R10A 2IVEA 3N4FA 1KSSA 1D4CA 1Q1WA 2APGA 4OPTA 5DBJA 3OP2A 3IWAA 4DWDA 2DW7A 4Z2TA 1ELIA 4NTCA 4H7UA 2W55A 4CBQA 2WP5A 1DXLA 2A87A 3DG7A 3T31A 3AE7A 1GRGA 1ZY8A 1PN0A 3JVAA 2VVMA 3UKAA 3GO2A 3K1GA 2FJAA 1LPFA 2QJJA 2WHDA 2DKHA 3RNMA 3T6CA 3BI2A 3BSMA 3GD3A 4AOSA 3URHA 3KPKA 2QA1A 1N63C 1MRAA 5M10A 1DNCA 2PGWA 2OQHA 1E1LA 1L9DA 3CGEA 2BRYA 1FO4A 2TMDA 4G8TA 1F8SA 3ENLA 4EM4A 4H19A 2VZ2A 3HYXA 4DSHA 2PTZA 4RG4A 1GT8A 4NNJA 2BK3A 1Q9IA 2C75A 1OJTA 4G9KA 4YWOA 4K1WA 4B65A 4II2A 1GXFA 2QGYA 4K22A 4J33A 2XVJA 3TQPA 3IJQA 4Z26A 5FS8A 4OPUA 1FOHA 4LIIA 1MDLA 1B4VA 2AL2B 1PS9A 2OO6A 1JU2A 1N5XA 4NWZA 3STPA 3C96A 3SQSA 2FJBA 3AE8A 5FJTA 3DA1A 1NPXA 3NT6A 1N4UA 2UZZA 3AE6A 3KUMA 4XWRA 2YLZA 1TYTA 4B66A 3VA8A 4C3XA 2WDRA 3SXIA 4OPDA 1N62C 2GMJA 3MQTA 4Z43A 2IVDA 1JCTA 1KCZA 3EPTA 3FIMB 4IVOB 3AE3A 4U8NA 3UJFA 4YT0A 3EEZA 4FDCB 2BC0A 2GGGA 1DJQA 3F8PA 1KFYA 1FEAA 3GMBA 2O56A 1KKOA 2FKPA 2YG4A 1SJAA 2GEWA 3C4AA 4U2LA 4WX1A 5FJPA 1PXAA 3SSZA 3A7UA 5KWFA 2XGZA 1R6WA 4AT0A 2OZ3A 1GOSA 4HB9A 3T0KA 2XFPA 5GSNA 3ALMA 3QFAA 4U8MA 5JCNA 1AOGA 3UXKA 1VQWA 5HXIA 1NELA 2WS3A 5G5GB 1EBDA 3D46A 4JN7A 3AYLA 3BNUA 2Y6RA 4PABA 1CJ4A 4GAVA 1H84A 4C5OA 2ZZ0A 1H82A 2RDXA 3DH9A 1K0JA 2B7RA 3UKLA 5CKUA 2BCGG 4LU6A 2Q7VA 3BJSA 2XVFA 3UTGA 1M64A 2O9ZA 2YR4A 2XH0A 2Q0KA 3DK4A 3AEFA 2GGIA 1D7LA 2I5QA 3AYJA 3BOXA 3R11A 5C2TA 3V5FA 3P4SA 1X2HA 1EBHA 3DJGX 2W3RA 5U1OA 2BS2A 2V3AA 2Z5XA 4E8GA 3Q45A 4H2PA 1JPDX 4ZCDA 3THUA 3FBSA 4HCHA 3UCLA 2X8HA 2Q6UA 4GYPC 3G5SA 2C76A 4EIQA 2WDVA 3II4A 2GR0A 1GPEA 1GRTA 2OLAA 3CIRA 5KXJA 4H2NA 4UDRA 3UGVA 4U8JA 3GWFA 2POZA 1GRBA 3NH3X 4HPNA 3H12A 1S2QA 1LQTA 1GNDA 3ATRA 2WPEA 3CNJA 3CN8A 2XCGA 3KLJA 3QFBA 1TDKA 3NYEA 1OJCA 4GGHA 1MO9A 3ZLGA 1CBOA 4H4XA 4DHGA 1LJ1A 4M0XA 2YG7A 3UOVA 3BI5A 1TKKA 2QVHA 3UXLA 2CVJA 2R0CA 3GRSA 3OZMA 4IT1A 4WCTA 2PU1A 3NK2X 4YSXA 4OPCA 2E3TA 3EKGA 4HN8A 6ENLA 2XFNA 4CY6A 4HYRA 1IUTA 3ZLHA 4ZCWA 3D47A 4B63A 3CNDA 5JCMA 1N4WA 2AL2A 2OZ8A 4UP3A 1Z6LA 5CQFA 3NTAA 2W0HA 4JN9A 3CT2A 3AD7B 3DG3A 5IQ1A 2PODA 3QSEA 4NTEA 2BK4A 4BK3A 3VRBA 3LADA 3TJIA 5IDZA 1ZOVA 1KD0A 4APNA 2GMHA 3COXA 4H4PA 1JDFA
chains in the Genus database with same CATH topology
3K7QX 4OVIA 1TDFA 2RGJA 1H7XA 5GRTA 2C64A 3AWIA 4N9XA 2IVEA 3CNTA 2BS4A 1NHQA 1KSSA 3R9UA 4DSGA 1D4CA 1Q1WA 5J7XA 3DK8A 2APGA 1F3PA 3AXBA 3NK0X 4OPTA 5DBJA 1GALA 4USQA 1BWCA 2GR3A 2WESA 5KVHA 4NEWA 3IWAA 4A99A 4Z25A 1TDNA 4JNQA 4K5RA 4Z2TA 4RG3A 1ELIA 3CGBA 4H4YA 3GD4A 4PAAA 4NTCA 4H7UA 3Q9TA 4CBQA 3L1RA 4J36A 2YR5A 3P4RA 4C74A 2WP5A 5FS9A 3I6DA 3V3NA 1DXLA 1EL5A 2A87A 3T31A 2VQBA 3E1TA 4IA5A 3BI4A 2BCPA 3P4QA 1NG3A 1BZLA 4G74A 4P9SA 5KMRA 3AE7A 1GERA 3JSKA 1GRGA 1ZY8A 1P2EA 3NNEA 1PN0A 2I0ZA 2E1MA 3UKQA 2EQ6A 5EOWA 1PXCA 1RSGA 4NTDA 2OAMA 2VVMA 3UKAA 4O5QA 3SFDA 3GYIA 3ICSA 3NGCX 4EMWA 2AR8A 4G6HA 2FJAA 4U2SA 1LPFA 3B3RA 4H4ZA 2WP6A 2B7SA 2WHDA 2DKHA 3K30A 1ZDLA 3RNMA 1FCDA 3M12A 3NK1X 3BI2A 3SZ0A 4YTMA 2OALA 2YG3A 3GD3A 4AOSA 3Q6JA 3IF9A 4CCRA 3URHA 1FL2A 2BS3A 5ER0A 3KPKA 1H81A 3D8XA 2QA1A 4O5UA 4H4TA 1H86A 3GDPA 2R0PA 5M10A 3FPZA 1XANA 4HA6A 1DNCA 4C3YA 2GR1A 1E1LA 1L9DA 3CGEA 2BRYA 3NN6X 4GAPA 4YSZA 1S2YA 5U63A 4USRA 4Y4LA 1E1MA 3ATQA 3NKSA 3DGZA 2TMDA 4BK2A 2JAEA 4GDPA 3NLCA 4ZN0A 1NHRA 4FK1A 4ICYA 3HYWA 1F8SA 1O94A 3S5WA 1YQ4A 3SFEA 5KOWA 4EM4A 3KA7A 3D1CA 3NYCA 4TLXA 4AP3A 3ZYXA 2XLPA 2VZ2A 3NYFA 2GH5A 3HYXA 3NTDA 1GREA 2GVCA 3UKKA 4DSHA 1M6IA 3C4NA 3AE9A 3UOZA 3PG6A 4D03A 4CCQA 2XFOA 4FK1C 4RG4A 1GT8A 4NNJA 1CC4A 1UKVG 4E0VA 4MJWA 4EMJA 3FG2P 4GR1A 1DJNA 2GF3A 4CNKA 4FX9A 5EBKA 2BK3A 1Q9IA 2E4GA 2C75A 1OJTA 2YVFA 2GQWA 4G9KA 2AAQA 4KPRA 4YWOA 1IUXA 1E1KA 2CDUA 2GAHB 2H88A 3NIXA 4B65A 4II2A 4X9MA 3SZFA 1ZP0A 5BVAA 1EL8A 1GXFA 2WPCA 3VQRA 1B8SA 4K22A 3VR8A 1CF3A 4J33A 2XVJA 1RP0A 1KF6A 2GAGB 5C3JA 4KX6A 2QCUA 4Z26A 5FS8A 3NG7X 1ONFA 3L8KA 3DJJA 4OPUA 3P1WA 2X8CA 1FOHA 3AEGA 3AEEA 4LIIA 4B69A 4CY8A 1B4VA 2WBAA 3IC9A 1PS9A 2YLSA 1JU2A 2XVHA 2JKCA 2WU5A 1NAAA 2ACZA 2B76A 2XVEA 4NWZA 3CTYA 5KRQA 3C96A 3RHAA 1COYA 2R4EA 1CJ3A 4REKA 2OA1A 1H2IA 3KPFA 3LXDA 1GTEA 4NEVA 2FJBA 3AE8A 3ALLA 1IUUA 3AE1A 3SX6A 3DA1A 1GESA 2AQJA 4I58A 1GRFA 3AE2A 1JRXA 1BGJA 1NPXA 2BA9A 1GSNA 2R9ZA 3GYJA 2HQMA 1PHHA 2X99A 2CFYA 4H4VA 1N4UA 1S3EA 2C66A 4BJZA 2UZZA 3LB8A 1E7PA 2JB2A 3AE6A 2YLWA 4XWRA 2V6OA 1GRAA 2YQUA 4J56A 2JBVA 1OJ9A 2J3NA 2WDQA 2YLZA 3DJDA 2FJEA 3PVCA 3QVPA 1TYTA 1H83A 1S3BA 4H2QA 4JY3A 3LZWA 1F8WA 1YY5A 4X4JA 5J60A 4B66A 4BK1A 3EAOA 4EQWA 4J34A 5JCKA 4U8PA 1EL7A 1V59A 4C3XA 2VRLA 2H89A 2WDRA 5KMQA 1TRBA 2WOIA 3SXIA 2YG5A 4U8KA 4Z2UA 4ADWA 2EQ9A 1DOEA 4A7AA 1Q1RA 4OPDA 3SZCA 2VRMA 2YWLA 3OZ2A 4J2WA 4K5SA 2GMJA 4Z43A 2JB1A 2IVDA 2XLTA 1D5TA 1DOCA 1RYIA 2BXSA 3AEDA 3EPTA 3FIMB 1X31B 3UOXA 4IVOB 2NVKX 3UTFA 1FEBA 4U2TA 3SY4A 3AE3A 1GV4A 4A9WA 4U8NA 5KVIA 3I3LA 3UKPA 1ZMDA 1LV0A 3AD8B 4A6NB 2GR2A 4YT0A 4M52A 5IPYA 4JNAA 5IQ4A 3K7TA 1GEUA 3CPIG 4BURA 3SYIA 3OC4A 4OPLA 3F8RA 4FDCB 2BC0A 2BXRA 2YG6A 1DJQA 4I59A 4B68A 1EL9A 2WQYA 3F8PA 1JNRA 1KFYA 1VG9A 1FEAA 1PBCA 3GMBA 1CC6A 4OPIA 2ZBWA 5BULA 3AE4A 2PHHA 1Y0PA 4EIPA 3AYIA 1JEHA 4RSLA 5HY5A 2JK6A 3GRTA 1SEZA 2YG4A 1TDEA 3SZWA 3SM8A 2GEWA 5TR3A 3C4AA 3H8IA 3NHOX 2YVGA 4U2LA 4WX1A 4YSHA 3CGCA 1JRYA 3T2YA 1PXAA 3PO7A 4II3A 4U8OA 3IHGA 1KNRA 3ICRA 4TM3A 2PYXA 3T14A 5KWFA 4NZHA 1VG0A 1QLBA 4DNAA 1GETA 2XFQA 4AT0A 1GOSA 1ZOYA 4HB9A 3IHMA 3VR9A 1IJHA 2TPRA 2E5VA 2XLSA 3BHKA 3T0KA 2QAEA 1VRQB 2WETA 2XFPA 2YLTA 1L0VA 1D4DA 4AP1A 5GSNA 3ALMA 3QFAA 4U8MA 2EQ7A 5JCNA 3ABVA 1AOGA 1VQWA 4U8IA 3T37A 4IVMB 2C65A 3UP4A 4EM3A 5HXIA 3UTHA 2CULA 2V3BA 4BV6A 5JCIA 2WS3A 2Z5YA 4H4SA 1N4VA 1IUVA 4EMIA 1JOAA 1N1PA 1EBDA 1QO8A 4ECHA 4Z24A 1L9EA 2V5ZA 1S7MA 2GB0A 3AYLA 1CL0A 3BNUA 3V76A 4D04A 1PBDA 2Y6RA 1QJDA 4PABA 1CJ4A 3CNSA 3P4PA 4GAVA 1H84A 1PJ7A 4GDEA 5FS6A 4C5OA 1CHUA 3KKJA 2ZZ0A 3V3OA 1H82A 3RP7A 1ZK7A 2RGOA 4UDPA 3ITJA 1PJ5A 5KNLA 3DH9A 1K0JA 2B7RA 1PJ6A 2BC1A 1Y56B 3UKLA 5CKUA 3HYVA 2BCGG 3HZLA 3UOYA 5EB5A 1DOBA 3G5RA 5KOXA 4LU6A 2BYBA 4YTPA 2Q7VA 1H6VA 3L5OA 1ZKQA 4EQXA 3RP6A 2C73A 2XVFA 3UTGA 2BACA 3UKHA 1TYPA 1ZX9A 3DGHA 1LQUA 2NPXA 1M64A 2O9ZA 2WU2A 2YR4A 2RABA 4A79A 2Q0KA 4H4WA 2OLOA 2ZZBA 4YKGA 2Q0LA 3DK4A 2WP9A 2X3NA 2XYOA 4Y4MA 1REOA 3AEFA 2C3DA 1HYUA 1XDIA 1D7LA 1E1NA 2V60A 3AYJA 5M0ZA 3D9XA 1ZMCA 2FJDA 5KMSA 5C2TA 1JNZA 2BK5A 2GRTA 3K7MX 4ZCCA 3P4SA 4IV9A 2WOWA 3EF6A 4AOXA 3KD9A 1CJCA 3DJGX 2XVIA 2R4JA 5U1OA 3H8LA 2BS2A 3AEAA 3KU9A 3FMWA 4K7ZA 1W4XA 1XPQA 3P9UA 3M0OA 4J57A 4Z2RA 3REDA 1NENA 4TLZA 4BJYA 4YSYA 3DJEA 3CNPA 2XFUA 2VVLA 2YLRA 2V3AA 3GWDA 3QJ4A 2Z5XA 4YXDA 1D7YA 4EQRA 3KVEA 1NDAA 2VVLG 4X9NA 4H2PA 2DKIA 1MXTA 5U25A 4DGKA 4ZCDA 3AEBA 4A6NA 3FBSA 3ISHA 3UCLA 2X8HA 5JRBA 2Q6UA 1NG4A 3VRAA 3G5SA 2C76A 2GQFA 1KSUA 1PDHA 4K8DA 4IA6A 2XLUA 3BNMA 4EIQA 1PBBA 2WDVA 2Y6QA 3T2KA 4Y4NA 3ICTA 4G73A 3II4A 2GR0A 1CC2A 1GPEA 1GRTA 1D4EA 3AECA 3CIRA 3QSSA 5KXJA 5FS7A 4H2NA 3WE0A 4OCGA 1K0IA 4UDRA 1GTHA 2BRAA 5JCLA 4H2RA 4CRTA 3H4KA 3LZXA 4U8JA 3GWFA 3CPJG 4H4QA 3GMCA 1GRBA 3NH3X 4Z44A 4CNJA 5HYMA 1O95A 3SQPA 1YQ3A 1O5WA 2FBWA 2B9YA 4G6GA 1S2QA 1LQTA 2XDOA 2X8GA 4XXGA 1LTXR 1CJ2A 3O0HA 2ZZCA 1GNDA 3LJPA 2JB3A 3ATRA 2WPEA 2YM2A 1KDGA 3AD9B 1YQZA 3NRNA 3CNJA 3CN8A 3GSIA 2XCGA 3KLJA 3QFBA 3G5QA 1MOKA 3CPHG 5KMPA 1TDKA 3NYEA 4LA1A 1OJCA 3RP8A 2B9WA 4EQSA 2GV8A 1MO9A 1BGNA 1CBOA 2IIDA 4GUVA 4H4XA 1LJ1A 1NEKA 3S61A 2YG7A 3UOVA 1YKJA 2VQ7A 2C7GA 2R45A 3B6DA 4H4UA 4GF7A 3F8DA 3ZDNA 1F8RA 4JQ9A 4JY2A 3BI5A 3AE5A 1JRZA 3GDNA 5BRTA 2QA2A 1OJDA 3CMMA 2ARDA 2CVJA 2R0CA 5BUKA 1NHSA 2WOVA 3EANA 3GRSA 4YTNA 2YVJA 3QSMA 4GCMA 2XLRA 4J31A 2C72A 4WCTA 2OLNA 1PBEA 4XWZA 3UKFA 5HHFA 1TDOA 2A89A 4H4RA 2C67A 3AB1A 2V61A 3GYXA 3NK2X 3ALJA 1Y56A 4OPGA 4YSXA 1H7WA 2C3CA 1F6MA 3PS9A 4OPCA 3LOVA 3CGDA 2R46A 2BABA 2YLXA 3QVRA 4TM4A 1P2HA 1E39A 2XFNA 4A65A 1L9CA 4CY6A 1B5QA 2C4CA 4UDQA 2VOUA 1IUTA 4H50A 4TM1A 1KN0A 4YKFA 1B37A 4A5LA 4B67A 4B64A 4B1BA 4B63A 1BKWA 3CNDA 4AT2A 3SGLA 2C70A 5JCMA 1OJAA 1FECA 1N4WA 1PBFA 2B9XA 2EQ8A 3NN0X 1E6EA 2A8XA 2YAUA 4UP3A 2YR6A 1IUWA 1Z6LA 1BF3A 5CQFA 1IUSA 3T2ZA 1K4QA 5EB4A 3NTAA 2WPFA 2W0HA 1LVLA 1K0LA 3AD7B 4JN9A 3UP5A 3UTEA 3VRDB 5IQ1A 3DK9A 5FMHA 1KNPA 1VDCA 3QSEA 4K2XA 3NT6A 1NHPA 1GRHA 4NTEA 4C77A 5LV9A 1DODA 4U8LA 2BK4A 2F5ZA 3BHFA 2RGHA 4GRTA 4TM0A 3ADAB 4BK3A 2X50A 1PXBA 1XHCA 4JDRA 3LADA 2R0GA 1ZOVA 2WEUA 3VRBA 5L46A 4APNA 2GMHA 3M13A 3COXA 4H4PA 3DMEA 2YM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7Q X;  4OVI A;  1TDF A;  2RGJ A;  1H7X A;  5GRT A;  2C64 A;  3AWI A;  4N9X A;  2IVE A;  3CNT A;  2BS4 A;  1NHQ A;  1KSS A;  3R9U A;  4DSG A;  1D4C A;  1Q1W A;  5J7X A;  3DK8 A;  2APG A;  1F3P A;  3AXB A;  3NK0 X;  4OPT A;  5DBJ A;  1GAL A;  4USQ A;  1BWC A;  2GR3 A;  2WES A;  5KVH A;  4NEW A;  3IWA A;  4A99 A;  4Z25 A;  1TDN A;  4JNQ A;  4K5R A;  4Z2T A;  4RG3 A;  1ELI A;  3CGB A;  4H4Y A;  3GD4 A;  4PAA A;  4NTC A;  4H7U A;  3Q9T A;  4CBQ A;  3L1R A;  4J36 A;  2YR5 A;  3P4R A;  4C74 A;  2WP5 A;  5FS9 A;  3I6D A;  3V3N A;  1DXL A;  1EL5 A;  2A87 A;  2VQB A;  3E1T A;  4IA5 A;  3BI4 A;  2BCP A;  3P4Q A;  1NG3 A;  1BZL A;  4P9S A;  3AE7 A;  1GER A;  3JSK A;  1GRG A;  1ZY8 A;  1P2E A;  3NNE A;  1PN0 A;  2I0Z A;  2E1M A;  3UKQ A;  2EQ6 A;  5EOW A;  1PXC A;  1RSG A;  4NTD A;  2OAM A;  2VVM A;  3UKA A;  4O5Q A;  3SFD A;  3GYI A;  3ICS A;  3NGC X;  4EMW A;  2AR8 A;  2FJA A;  4U2S A;  1LPF A;  3B3R A;  4H4Z A;  2WP6 A;  2B7S A;  2WHD A;  2DKH A;  3K30 A;  1ZDL A;  3RNM A;  1FCD A;  3M12 A;  3NK1 X;  3BI2 A;  4YTM A;  2OAL A;  2YG3 A;  3GD3 A;  4AOS A;  3Q6J A;  3IF9 A;  4CCR A;  3URH A;  1FL2 A;  2BS3 A;  5ER0 A;  4O5U A;  1H81 A;  3D8X A;  2QA1 A;  4H4T A;  1H86 A;  3GDP A;  2R0P A;  5M10 A;  3FPZ A;  1XAN A;  4HA6 A;  1DNC A;  4C3Y A;  2GR1 A;  1E1L A;  1L9D A;  3CGE A;  3NN6 X;  4YSZ A;  1S2Y A;  5U63 A;  4USR A;  4Y4L A;  1E1M A;  3ATQ A;  3NKS A;  3DGZ A;  2TMD A;  4BK2 A;  2JAE A;  4GDP A;  3NLC A;  4ZN0 A;  1NHR A;  4FK1 A;  4ICY A;  1F8S A;  1O94 A;  3S5W A;  1YQ4 A;  3SFE A;  5KOW A;  4EM4 A;  3KA7 A;  3D1C A;  3NYC A;  4TLX A;  4AP3 A;  3ZYX A;  2XLP A;  2VZ2 A;  3NYF A;  2GH5 A;  3NTD A;  1GRE A;  2GVC A;  3UKK A;  4DSH A;  1M6I A;  3C4N A;  3AE9 A;  3UOZ A;  4D03 A;  4CCQ A;  2XFO A;  4FK1 C;  4RG4 A;  1GT8 A;  1CC4 A;  1UKV G;  4E0V A;  4MJW A;  4EMJ A;  3FG2 P;  4GR1 A;  1DJN A;  2GF3 A;  4CNK A;  4FX9 A;  5EBK A;  2BK3 A;  1Q9I A;  2E4G A;  2C75 A;  1OJT A;  2YVF A;  2GQW A;  2AAQ A;  4KPR A;  4YWO A;  1IUX A;  1E1K A;  2CDU A;  2GAH B;  2H88 A;  3NIX A;  4B65 A;  4X9M A;  1ZP0 A;  5BVA A;  1EL8 A;  1GXF A;  2WPC A;  3VQR A;  1B8S A;  4K22 A;  3VR8 A;  1CF3 A;  4J33 A;  2XVJ A;  1RP0 A;  1KF6 A;  2GAG B;  5C3J A;  4KX6 A;  2QCU A;  4Z26 A;  5FS8 A;  3NG7 X;  1ONF A;  3L8K A;  3DJJ A;  4OPU A;  3P1W A;  2X8C A;  1FOH A;  3AEG A;  3AEE A;  4LII A;  4B69 A;  4CY8 A;  1B4V A;  2WBA A;  3IC9 A;  1PS9 A;  2YLS A;  1JU2 A;  2XVH A;  2JKC A;  2WU5 A;  1NAA A;  2ACZ A;  2B76 A;  2XVE A;  3CTY A;  5KRQ A;  3C96 A;  3RHA A;  1COY A;  2R4E A;  1CJ3 A;  4REK A;  2OA1 A;  3KPF A;  3LXD A;  1GTE A;  4NEV A;  2FJB A;  3AE8 A;  3ALL A;  1IUU A;  3AE1 A;  3DA1 A;  1GES A;  2AQJ A;  4I58 A;  1GRF A;  3AE2 A;  1BGJ A;  1JRX A;  1NPX A;  2BA9 A;  1GSN A;  2R9Z A;  3GYJ A;  2HQM A;  1PHH A;  2X99 A;  2CFY A;  4H4V A;  1N4U A;  1S3E A;  2C66 A;  4BJZ A;  2UZZ A;  3LB8 A;  1E7P A;  2JB2 A;  3AE6 A;  2YLW A;  4XWR A;  2V6O A;  1GRA A;  2YQU A;  4J56 A;  2JBV A;  1OJ9 A;  2J3N A;  2WDQ A;  2YLZ A;  3DJD A;  2FJE A;  3PVC A;  3QVP A;  1TYT A;  1H83 A;  1S3B A;  4H2Q A;  4JY3 A;  3LZW A;  1F8W A;  1YY5 A;  4X4J A;  5J60 A;  4B66 A;  4BK1 A;  3EAO A;  4EQW A;  4J34 A;  5JCK A;  4U8P A;  1EL7 A;  1V59 A;  4C3X A;  2VRL A;  2H89 A;  2WDR A;  1TRB A;  2WOI A;  2YG5 A;  4U8K A;  4Z2U A;  4ADW A;  2EQ9 A;  1DOE A;  4A7A A;  1Q1R A;  4OPD A;  2VRM A;  2YWL A;  3OZ2 A;  4J2W A;  4K5S A;  2GMJ A;  4Z43 A;  2JB1 A;  2IVD A;  2XLT A;  1D5T A;  1DOC A;  1RYI A;  2BXS A;  3AED A;  3EPT A;  3FIM B;  1X31 B;  3UOX A;  4IVO B;  2NVK X;  3UTF A;  1FEB A;  4U2T A;  3AE3 A;  1GV4 A;  4A9W A;  4U8N A;  5KVI A;  3I3L A;  3UKP A;  1ZMD A;  1LV0 A;  3AD8 B;  4A6N B;  2GR2 A;  4YT0 A;  4M52 A;  5IPY A;  4JNA A;  5IQ4 A;  3K7T A;  1GEU A;  3CPI G;  4BUR A;  3OC4 A;  4OPL A;  3F8R A;  4FDC B;  2BC0 A;  2BXR A;  2YG6 A;  1DJQ A;  4I59 A;  4B68 A;  1EL9 A;  2WQY A;  3F8P A;  1JNR A;  1KFY A;  1VG9 A;  1FEA A;  1PBC A;  3GMB A;  1CC6 A;  4OPI A;  2ZBW A;  5BUL A;  3AE4 A;  2PHH A;  1Y0P A;  4EIP A;  3AYI A;  1JEH A;  4RSL A;  5HY5 A;  2JK6 A;  3GRT A;  1SEZ A;  2YG4 A;  1TDE A;  3SM8 A;  2GEW A;  5TR3 A;  3C4A A;  3H8I A;  3NHO X;  2YVG A;  4U2L A;  4WX1 A;  4YSH A;  3CGC A;  1JRY A;  1PXA A;  3PO7 A;  4U8O A;  3IHG A;  1KNR A;  3ICR A;  4TM3 A;  2PYX A;  5KWF A;  4NZH A;  1VG0 A;  1QLB A;  4DNA A;  1GET A;  2XFQ A;  4AT0 A;  1GOS A;  1ZOY A;  4HB9 A;  3IHM A;  3VR9 A;  1IJH A;  2TPR A;  2E5V A;  2XLS A;  3BHK A;  2QAE A;  1VRQ B;  2WET A;  2XFP A;  2YLT A;  1L0V A;  1D4D A;  4AP1 A;  5GSN A;  3ALM A;  3QFA A;  4U8M A;  2EQ7 A;  5JCN A;  3ABV A;  1AOG A;  1VQW A;  4U8I A;  3T37 A;  4IVM B;  2C65 A;  3UP4 A;  4EM3 A;  5HXI A;  3UTH A;  2CUL A;  2V3B A;  4BV6 A;  5JCI A;  2WS3 A;  2Z5Y A;  4H4S A;  1N4V A;  1IUV A;  4EMI A;  1JOA A;  1N1P A;  1EBD A;  1QO8 A;  4ECH A;  4Z24 A;  1L9E A;  2V5Z A;  3AYL A;  2GB0 A;  3V76 A;  1CL0 A;  3BNU A;  4D04 A;  1PBD A;  2Y6R A;  1QJD A;  4PAB A;  1CJ4 A;  3CNS A;  3P4P A;  1H84 A;  1PJ7 A;  4GDE A;  5FS6 A;  4C5O A;  1CHU A;  3KKJ A;  2ZZ0 A;  3V3O A;  1H82 A;  3RP7 A;  1ZK7 A;  2RGO A;  4UDP A;  3ITJ A;  1PJ5 A;  3DH9 A;  1K0J A;  2B7R A;  1PJ6 A;  2BC1 A;  1Y56 B;  3UKL A;  5CKU A;  2BCG G;  3HZL A;  3UOY A;  5EB5 A;  1DOB A;  3G5R A;  5KOX A;  4LU6 A;  2BYB A;  4YTP A;  2Q7V A;  1H6V A;  1ZKQ A;  4EQX A;  3RP6 A;  2C73 A;  2XVF A;  3UTG A;  2BAC A;  3UKH A;  1TYP A;  1ZX9 A;  3DGH A;  1LQU A;  2NPX A;  1M64 A;  2O9Z A;  2WU2 A;  2YR4 A;  2RAB A;  4A79 A;  2Q0K A;  4H4W A;  2OLO A;  2ZZB A;  4YKG A;  2Q0L A;  3DK4 A;  2WP9 A;  2X3N A;  2XYO A;  4Y4M A;  1REO A;  3AEF A;  2C3D A;  1HYU A;  1XDI A;  1D7L A;  1E1N A;  2V60 A;  3AYJ A;  5M0Z A;  1ZMC A;  2FJD A;  5C2T A;  1JNZ A;  2BK5 A;  2GRT A;  3K7M X;  4ZCC A;  3P4S A;  4IV9 A;  2WOW A;  3EF6 A;  4AOX A;  3KD9 A;  1CJC A;  3DJG X;  2XVI A;  2R4J A;  5U1O A;  3H8L A;  2BS2 A;  3AEA A;  3KU9 A;  3FMW A;  4K7Z A;  1W4X A;  1XPQ A;  3P9U A;  3M0O A;  4J57 A;  4Z2R A;  3RED A;  1NEN A;  4TLZ A;  4BJY A;  4YSY A;  3DJE A;  3CNP A;  2XFU A;  2VVL A;  2YLR A;  2V3A A;  3GWD A;  3QJ4 A;  2Z5X A;  4YXD A;  1D7Y A;  4EQR A;  3KVE A;  1NDA A;  2VVL G;  4X9N A;  4H2P A;  2DKI A;  1MXT A;  5U25 A;  4DGK A;  4ZCD A;  3AEB A;  4A6N A;  3FBS A;  3ISH A;  3UCL A;  2X8H A;  2Q6U A;  1NG4 A;  3VRA A;  3G5S A;  2C76 A;  2GQF A;  1KSU A;  1PDH A;  4K8D A;  4IA6 A;  2XLU A;  3BNM A;  4EIQ A;  1PBB A;  2WDV A;  2Y6Q A;  4Y4N A;  3ICT A;  3II4 A;  2GR0 A;  1CC2 A;  1GPE A;  1GRT A;  1D4E A;  3AEC A;  3CIR A;  3QSS A;  5KXJ A;  5FS7 A;  4H2N A;  3WE0 A;  4OCG A;  1K0I A;  4UDR A;  1GTH A;  4H2R A;  5JCL A;  4CRT A;  3H4K A;  3LZX A;  4U8J A;  3GWF A;  3CPJ G;  4H4Q A;  3GMC A;  1GRB A;  3NH3 X;  4Z44 A;  4CNJ A;  5HYM A;  1O95 A;  3SQP A;  1YQ3 A;  1O5W A;  2FBW A;  2B9Y A;  1S2Q A;  1LQT A;  2XDO A;  2X8G A;  4XXG A;  1LTX R;  1CJ2 A;  3O0H A;  2ZZC A;  1GND A;  3LJP A;  2JB3 A;  3ATR A;  2WPE A;  2YM2 A;  1KDG A;  3AD9 B;  1YQZ A;  3NRN A;  3CNJ A;  3CN8 A;  3GSI A;  2XCG A;  3KLJ A;  3QFB A;  3G5Q A;  1MOK A;  3CPH G;  1TDK A;  3NYE A;  4LA1 A;  1OJC A;  3RP8 A;  2B9W A;  4EQS A;  2GV8 A;  1MO9 A;  1BGN A;  1CBO A;  2IID A;  4GUV A;  4H4X A;  1LJ1 A;  1NEK A;  3S61 A;  2YG7 A;  3UOV A;  1YKJ A;  2VQ7 A;  2C7G A;  2R45 A;  3B6D A;  4H4U A;  4GF7 A;  3F8D A;  3ZDN A;  1F8R A;  4JQ9 A;  4JY2 A;  3BI5 A;  3AE5 A;  1JRZ A;  3GDN A;  5BRT A;  2QA2 A;  1OJD A;  2ARD A;  2CVJ A;  2R0C A;  5BUK A;  1NHS A;  2WOV A;  3EAN A;  3GRS A;  4YTN A;  2YVJ A;  3QSM A;  4GCM A;  2XLR A;  4J31 A;  2C72 A;  4WCT A;  2OLN A;  1PBE A;  4XWZ A;  3UKF A;  5HHF A;  1TDO A;  2A89 A;  4H4R A;  2C67 A;  3AB1 A;  2V61 A;  3NK2 X;  4OPG A;  3ALJ A;  1Y56 A;  4YSX A;  1H7W A;  2C3C A;  1F6M A;  3PS9 A;  4OPC A;  3LOV A;  3CGD A;  2R46 A;  2BAB A;  2YLX A;  3QVR A;  4TM4 A;  1P2H A;  1E39 A;  2XFN A;  4A65 A;  1L9C A;  4CY6 A;  1B5Q A;  4UDQ A;  2VOU A;  1IUT A;  4H50 A;  4TM1 A;  4YKF A;  4A5L A;  1B37 A;  4B67 A;  4B64 A;  4B1B A;  4B63 A;  1BKW A;  3CND A;  4AT2 A;  3SGL A;  2C70 A;  5JCM A;  1OJA A;  1FEC A;  1N4W A;  1PBF A;  2B9X A;  2EQ8 A;  3NN0 X;  1E6E A;  2A8X A;  2YAU A;  4UP3 A;  2YR6 A;  1IUW A;  1Z6L A;  1BF3 A;  5CQF A;  1IUS A;  1K4Q A;  5EB4 A;  3NTA A;  2WPF A;  2W0H A;  1LVL A;  1K0L A;  3AD7 B;  4JN9 A;  3UP5 A;  3UTE A;  3VRD B;  5IQ1 A;  3DK9 A;  5FMH A;  1KNP A;  1VDC A;  3QSE A;  4K2X A;  3NT6 A;  1NHP A;  1GRH A;  4NTE A;  4C77 A;  5LV9 A;  1DOD A;  4U8L A;  2BK4 A;  2F5Z A;  3BHF A;  2RGH A;  4GRT A;  4TM0 A;  3ADA B;  4BK3 A;  2X50 A;  1PXB A;  1XHC A;  4JDR A;  3LAD A;  2R0G A;  1ZOV A;  2WEU A;  3VRB A;  5L46 A;  4APN A;  2GMH A;  3M13 A;  3COX A;  4H4P A;  3DME A;  2YM1 A; 
#chains in the Genus database with same CATH topology
 2QDE A;  4N9X A;  2C64 A;  3JZU A;  5J7X A;  1GAL A;  4NEW A;  4RG3 A;  3CGB A;  2GGH A;  2W3S A;  4PAA A;  3Q9T A;  3L1R A;  4J36 A;  2YR5 A;  5FS9 A;  3V3N A;  3DIP A;  4ENL A;  3BI4 A;  3P4Q A;  3T9P A;  1X2G A;  4P9S A;  3JSK A;  1SB3 B;  3NNE A;  1EC9 A;  2E1M A;  5EOW A;  1PXC A;  3NVV B;  2OAM A;  3ICS A;  3NGC X;  1FHU A;  3FXG A;  1FCD A;  2OAL A;  2YG3 A;  2XSX A;  3Q6J A;  3IF9 A;  4CCR A;  1FL2 A;  2HZG A;  3CXO A;  3GDP A;  3UJE A;  3NVY B;  2PP3 A;  3NN6 X;  1S2Y A;  1WUF A;  4BK2 A;  1NHR A;  4FK1 A;  1O94 A;  3S5W A;  3SFE A;  4KWS A;  4DX3 A;  3NYF A;  3P3B A;  3NTD A;  2GVC A;  3C4N A;  3VCN A;  3UOZ A;  2OKT A;  3PG6 A;  2XFO A;  4E0V A;  5EBK A;  2E4G A;  2YVF A;  2GQW A;  2AAQ A;  4KPR A;  2GAH B;  1IUX A;  3NIX A;  3MY9 A;  1L8P A;  4X9M A;  1B8S A;  3TTE A;  1RP0 A;  4JN8 A;  5C3J A;  3NS1 B;  4KX6 A;  2QCU A;  3DJJ A;  3P1W A;  3AEG A;  4CY8 A;  2JKC A;  2WU5 A;  2XVE A;  3CTY A;  1CJ3 A;  2OA1 A;  3NVW B;  3CYJ A;  3ALL A;  3SX6 A;  2BA9 A;  3GYJ A;  2R9Z A;  2HQM A;  4BJZ A;  1PHH A;  1S3E A;  4GIR A;  2GL5 A;  2V6O A;  2YQU A;  4J56 A;  2JBV A;  5FJR A;  2J3N A;  2WDQ A;  3DJD A;  2FJE A;  1S3B A;  4FP1 A;  1F8W A;  4EQW A;  4U8P A;  4J34 A;  5JCK A;  3S47 A;  2H89 A;  1PDZ A;  4IZG A;  3SZC A;  1ELS A;  2XH2 A;  2QJN A;  4K5S A;  1D5T A;  3N6H A;  3UOX A;  2NVK X;  1FEB A;  3QKE A;  4U2T A;  3SY4 A;  3I3L A;  3UKP A;  2AKZ A;  3MWC A;  4BUR A;  3SYI A;  4OPL A;  3F8R A;  2WQY A;  1JNR A;  3AMZ A;  1CC6 A;  4H1Z A;  2ZBW A;  4OPI A;  4MGG A;  1Y0P A;  2PS2 A;  1JEH A;  3MKC A;  2JK6 A;  1TDE A;  3N4E A;  2W54 A;  3NHO X;  4DN1 A;  3T2Y A;  4II3 A;  4U8O A;  3IHG A;  3ICR A;  3T14 A;  2P0I A;  1VG0 A;  1TE6 A;  1ZOY A;  3IHM A;  2TPR A;  2E5V A;  2QAE A;  3R07 C;  1L0V A;  1D4D A;  3ABV A;  3IJI A;  2C65 A;  3UP4 A;  3UTH A;  2Z5Y A;  1YEY A;  1N4V A;  1QO8 A;  2QQ6 A;  2HNE A;  2V5Z A;  3V76 A;  1CL0 A;  4D04 A;  1PBD A;  1QJD A;  3AM9 A;  5FJO A;  5FS6 A;  1CHU A;  3KKJ A;  3RP7 A;  1ZK7 A;  2RGO A;  4ZOH B;  2BC1 A;  3HZL A;  5EB5 A;  1EC7 A;  3G5R A;  4JHM A;  2PP1 A;  1ZX9 A;  1LQU A;  2WU2 A;  2OLO A;  1STZ A;  4YKG A;  2WP9 A;  2XYO A;  4Y4M A;  1REO A;  2C3D A;  1ZXI C;  1XDI A;  1E1N A;  3QTP A;  3B9J B;  2BK5 A;  3MSY A;  3EF6 A;  3KD9 A;  1CJC A;  2R4J A;  3H8L A;  3U9I A;  3AEA A;  1W4X A;  4J57 A;  1N60 C;  3RED A;  3MZN A;  1NEN A;  4TLZ A;  3DJE A;  3CNP A;  2VVL A;  2PTW A;  3Q4D A;  1TZZ A;  1NDA A;  5JRB A;  1PDH A;  3HW2 A;  2GDQ A;  4IA6 A;  2XLU A;  3BNM A;  7ENL A;  4Y4N A;  3ICT A;  4G73 A;  1CC2 A;  1D4E A;  1XS2 A;  2BRA A;  4CRT A;  3CPJ G;  3SQP A;  1O95 A;  1YQ3 A;  1O5W A;  2FBW A;  4G6G A;  2X8G A;  3TOY A;  3LJP A;  2YM2 A;  3AD9 B;  1EBG A;  1KKR A;  3G5Q A;  2ONE A;  2MNR A;  4LA1 A;  2B9W A;  2PA6 A;  4EQS A;  1BGN A;  4YWS A;  3SN0 A;  3S61 A;  1V97 A;  3ZDN A;  3B97 A;  3DER A;  1YKJ A;  4A65 A;  1OJD A;  3UJS A;  5BUK A;  3VFC A;  4YTN A;  3QSM A;  2OLN A;  1TDO A;  4H4R A;  2V61 A;  4OPG A;  2C3C A;  3PS9 A;  3LOV A;  3R25 A;  3QVR A;  3TW9 A;  4TM4 A;  1P2H A;  3ZVH A;  2NQL A;  3DES A;  3TWB A;  3PWI A;  1B5Q A;  4H50 A;  4TM1 A;  1KN0 A;  1B37 A;  4B67 A;  4B64 A;  4B1B A;  4AT2 A;  3SGL A;  2C70 A;  2B9X A;  2OQY A;  5BOE A;  2YR6 A;  1IUW A;  1BF3 A;  3T2Z A;  4ZA0 A;  3UTE A;  1IYX A;  1RVK A;  5FMH A;  1VDC A;  1GRH A;  4C77 A;  2P8B A;  2F5Z A;  3H7V A;  2RGH A;  4K8G A;  3ADA B;  3RR1 A;  3DME A;  3VR9 A;  3FYY A;  1FFU C;  4OVI A;  3QPE A;  2RGJ A;  1H7X A;  3RCY A;  2BS4 A;  1SJD A;  3DK8 A;  3AXB A;  3NK0 X;  3UCD A;  4USQ A;  1BWC A;  5KVH A;  3NXL A;  4K5R A;  4GIS A;  3CB3 A;  3P4R A;  4C74 A;  3E1T A;  4IA5 A;  4ROP A;  4G74 A;  1GER A;  2PTX A;  2I0Z A;  3UKQ A;  4NTD A;  4G6H A;  4EMW A;  2OVL A;  4U2S A;  2PSN A;  2B7S A;  1ZDL A;  3SZ0 A;  4YTM A;  2BS3 A;  4HNC A;  3D8X A;  3FPZ A;  1XAN A;  1DTN A;  4HA6 A;  4C3Y A;  3H70 A;  3DEQ A;  4E5T A;  4USR A;  3IJL A;  4Y4L A;  3NKS A;  3DGZ A;  4GDP A;  3HYW A;  1VQZ A;  4KT2 A;  4TLX A;  4KPL A;  3ZYX A;  4HCD A;  1GRE A;  3UKK A;  1M6I A;  3SN4 A;  3AE9 A;  3QN3 A;  2QDD A;  4D03 A;  4CCQ A;  1P43 A;  4FK1 C;  4MJW A;  3FG2 P;  4GR1 A;  2GF3 A;  2H88 A;  3ZLF A;  1EL8 A;  2WPC A;  2GAG B;  3FV9 A;  2OG9 A;  3NG7 X;  3L8K A;  1BKH A;  3AEE A;  4B69 A;  2WBA A;  3IC9 A;  2YLS A;  2XVH A;  4A3R A;  1NAA A;  2ACZ A;  3RHA A;  3H8A A;  2R4E A;  4IP5 A;  4REK A;  3KPF A;  3I6E A;  3LXD A;  1VDV A;  4NEV A;  1GRF A;  3AE2 A;  1BGJ A;  1JRX A;  3RP6 A;  1GSN A;  4ICY A;  3P0W A;  4H4V A;  2C66 A;  3AN1 A;  3LB8 A;  3RRA A;  3ZVI A;  1GRA A;  1OJ9 A;  4GME A;  1H83 A;  4H2Q A;  3LZW A;  4MKS A;  5J60 A;  4BK1 A;  3DDM A;  1EL7 A;  4TVY A;  1TRB A;  2WOI A;  3OZY A;  3NRZ B;  4H2H A;  1DOE A;  2YWL A;  4J2W A;  1DOC A;  1RYI A;  3UJ2 A;  1GV4 A;  1OEP A;  2PCE A;  1ZMD A;  3A7A A;  4M52 A;  5IQ4 A;  3K7T A;  3CPI G;  2YG6 A;  1EL9 A;  1PBC A;  5BUL A;  3AE4 A;  2PHH A;  3AYI A;  5HY5 A;  3GRT A;  3PWG A;  3SZW A;  3SM8 A;  4A6G A;  2YVG A;  4IHC A;  4YSH A;  3PO7 A;  3EUB 3;  2PYX A;  1QLB A;  3BHK A;  3UCC A;  2WET A;  3DFY A;  3ETR B;  2EQ7 A;  4U8I A;  4IVM B;  4EM3 A;  2V3B A;  4BV6 A;  4H4S A;  1IUV A;  1N1P A;  1MUC A;  1S7M A;  2GB0 A;  5BOF A;  3CNS A;  3P4P A;  1BQG A;  4Z1Y A;  1PJ5 A;  1PJ6 A;  1Y56 B;  3HYV A;  3UOY A;  4YTP A;  1H6V A;  3L5O A;  1ZKQ A;  2PP0 A;  2OPJ A;  2C73 A;  2BAC A;  2OZT A;  4A79 A;  2NPX A;  2ZZB A;  2X3N A;  1HYU A;  4E4U A;  3D9X A;  1ZMC A;  3TJ4 A;  2FJD A;  5KMS A;  4ZCC A;  4IV9 A;  2WOW A;  4AOX A;  3NO1 A;  2XVI A;  3FCP A;  3CAW A;  3P9U A;  5EU9 A;  3M0O A;  4BJY A;  4YSY A;  3HPF A;  3GWD A;  3RO6 A;  1D7Y A;  3KVE A;  2VVL G;  3UJR A;  1MXT A;  5U25 A;  3AEB A;  4A6N A;  3VRA A;  1W6T A;  4GFI A;  5J04 A;  2GQF A;  1KSU A;  4K8D A;  1PBB A;  2Y6Q A;  3T2K A;  3AEC A;  3U4F A;  3WE0 A;  1K0I A;  3R1Z A;  1GTH A;  3H4K A;  4HNL A;  4H4Q A;  3NZG A;  4CNJ A;  5HYM A;  1N61 C;  4IP4 A;  2B9Y A;  4DYE A;  2XDO A;  4XXG A;  1LTX R;  1CJ2 A;  3O0H A;  2ZZC A;  2JB3 A;  1YQZ A;  3NRN A;  3GSI A;  3SBF A;  1MOK A;  5KMP A;  1WUE A;  3RP8 A;  1NEK A;  4HCL A;  4Z17 A;  2VQ7 A;  2R45 A;  1F8R A;  4JQ9 A;  4JY2 A;  3AE5 A;  1JRZ A;  3CMM A;  2ARD A;  1NHS A;  2WOV A;  4GCM A;  2XLR A;  4J31 A;  1PBE A;  2A89 A;  2C67 A;  1ONE A;  3AB1 A;  3ALJ A;  3VC5 A;  3CXB A;  2R46 A;  2BAB A;  2YLX A;  1ECQ A;  1E39 A;  2GGJ A;  2C4C A;  4UDQ A;  3FJ4 A;  4YKF A;  4A5L A;  1NU5 A;  1BKW A;  1E9I A;  1FEC A;  2P88 A;  2A8X A;  3P93 A;  3VC6 A;  2WPF A;  3UP5 A;  3VRD B;  2GSH A;  1SJC A;  1KNP A;  4K2X A;  1NHP A;  3A7R A;  3ES8 A;  3BHF A;  3QLD A;  4JDR A;  5L46 A;  2WEU A;  2QJM A;  3M13 A;  5KRQ A;  3T37 A;  2YM1 A;  3K7Q X;  1TDF A;  3AWI A;  5GRT A;  3CNT A;  1NHQ A;  3R9U A;  4DSG A;  3HRD C;  1F3P A;  2GR3 A;  2WES A;  4A99 A;  4Z25 A;  2AL1 A;  2PPG A;  1TDN A;  1WYG A;  2PTY A;  3IK4 A;  4JNQ A;  2CHR A;  2E5A A;  4H4Y A;  3GD4 A;  1MDR A;  3S5S A;  3I6D A;  2HXU A;  1EL5 A;  2VQB A;  2BCP A;  4J1O A;  1NG3 A;  1BZL A;  5KMR A;  5G5H B;  1P2E A;  2EQ6 A;  4DXK A;  1RSG A;  1FIQ B;  4O5Q A;  3SFD A;  3GYI A;  2AR8 A;  4K2S A;  3K30 A;  4H4Z A;  2WP6 A;  3B3R A;  3M12 A;  3NK1 X;  3MUC A;  5ER0 A;  4O5U A;  1H81 A;  4H4T A;  1H86 A;  3ZVH B;  2R0P A;  2GGE A;  2GR1 A;  4GAP A;  4YSZ A;  5U63 A;  1E1M A;  4H83 A;  3ATQ A;  2JAE A;  3NLC A;  4ZN0 A;  1RM6 B;  1YQ4 A;  3VDG A;  5KOW A;  3KA7 A;  3D1C A;  3NYC A;  4AP3 A;  1P48 A;  2XLP A;  2GH5 A;  4EWJ A;  1CC4 A;  1UKV G;  4EMJ A;  1DJN A;  4CNK A;  4FX9 A;  1E1K A;  2CDU A;  3DG6 A;  3SZF A;  1ZP0 A;  5BVA A;  3R0U A;  3VQR A;  3VR8 A;  1CF3 A;  4GGB A;  1KF6 A;  1ONF A;  3OTR A;  2OX4 A;  2X8C A;  2OFJ A;  2B76 A;  1COY A;  1H2I A;  1GTE A;  1XPY A;  1IUU A;  3AE1 A;  1GES A;  2AQJ A;  4I58 A;  2X99 A;  2CFY A;  3ES7 A;  1E7P A;  2JB2 A;  2YLW A;  2MUC A;  3PK7 A;  3PVC A;  3QVP A;  4JY3 A;  3DFH A;  1JPM A;  1YY5 A;  4X4J A;  2FYM A;  3EAO A;  2ZC8 A;  1V59 A;  2VRL A;  5KMQ A;  1JRP A;  2YG5 A;  4J3Z A;  4U8K A;  4Z2U A;  4ADW A;  2EQ9 A;  4A7A A;  1Q1R A;  2VRM A;  3OZ2 A;  2JB1 A;  3TCS A;  2XLT A;  1T3Q C;  2BXS A;  3AED A;  1X31 B;  3UTF A;  3JW7 A;  4A9W A;  5KVI A;  3V5C A;  1LV0 A;  3AD8 B;  4A6N B;  2GR2 A;  5IPY A;  4JNA A;  1GEU A;  1MNS A;  3OC4 A;  2BXR A;  4I59 A;  4B68 A;  1VG9 A;  4EIP A;  4RSL A;  1SEZ A;  5TR3 A;  3H8I A;  3CGC A;  1JRY A;  2AKM A;  1KNR A;  4TM3 A;  2P3Z A;  4NZH A;  4DNA A;  1GET A;  2XFQ A;  4IL0 A;  1IJH A;  2XLS A;  1VRQ B;  2ZAD A;  4AP1 A;  2YLT A;  2PGE A;  3V3W A;  1PDY A;  4GYP A;  2CUL A;  5JCI A;  4EMI A;  1JOA A;  4ECH A;  4Z24 A;  1L9E A;  2DW6 A;  1PJ7 A;  4GDE A;  3V3O A;  4UDP A;  3ITJ A;  5KNL A;  1DOB A;  3R0K A;  5KOX A;  1R0M A;  2BYB A;  4EQX A;  3UKH A;  1TYP A;  3DGH A;  3RIT A;  2RAB A;  4H4W A;  3GD6 A;  2Q0L A;  3RGT A;  3SJN A;  1FHV A;  2V60 A;  5FJU A;  5M0Z A;  1JNZ A;  2GRT A;  3K7M X;  1N5W C;  3NVZ B;  3KU9 A;  2PU0 A;  4K7Z A;  3FMW A;  1XPQ A;  4F4R A;  4Z2R A;  2XFU A;  2YLR A;  3QJ4 A;  1FFV C;  4YXD A;  4E6M A;  4EQR A;  4X9N A;  2DKI A;  4DGK A;  4A35 A;  3ISH A;  2XH7 A;  3CK5 A;  2XH4 A;  1NG4 A;  1SJB A;  3QSS A;  5FS7 A;  4OCG A;  4H2R A;  5JCL A;  2P8C A;  3I4K A;  3VCC A;  3LZX A;  3GMC A;  4Z44 A;  3N6J A;  1F9C A;  3SR6 B;  3PFR A;  4KEM A;  5ENL A;  1KDG A;  3CPH G;  3I6T A;  2GV8 A;  2IID A;  4GUV A;  3OW1 A;  3SN1 A;  4FI4 A;  2C7G A;  3B6D A;  4GF7 A;  4H4U A;  5BRT A;  3F8D A;  3GDN A;  2QA2 A;  2HXT A;  3T8Q A;  3EAN A;  2YVJ A;  2C72 A;  4XWZ A;  3UKF A;  5HHF A;  3GYX A;  1Y56 A;  3FVD A;  4E4F A;  1F6M A;  1H7W A;  3CGD A;  3GY1 A;  4X2P A;  3NFU A;  1JRO A;  1L9C A;  2VOU A;  3V4B A;  1OJA A;  3NN0 X;  4M6U A;  1PBF A;  2EQ8 A;  1E6E A;  2YAU A;  3OPS A;  2PMQ A;  1IUS A;  1K4Q A;  5EB4 A;  1LVL A;  1K0L A;  3TWA A;  3DK9 A;  3T4W A;  5LV9 A;  4IL2 A;  1DOD A;  4MMW A;  4U8L A;  3DGB A;  4GRT A;  4TM0 A;  1EC8 A;  2X50 A;  1PXB A;  1XHC A;  2R0G A;  4G7F A;  4TVW A;  3GC2 A;  3R10 A;  2IVE A;  3N4F A;  1KSS A;  1D4C A;  1Q1W A;  2APG A;  4OPT A;  5DBJ A;  3OP2 A;  3IWA A;  4DWD A;  2DW7 A;  4Z2T A;  1ELI A;  4NTC A;  4H7U A;  2W55 A;  4CBQ A;  2WP5 A;  1DXL A;  2A87 A;  3DG7 A;  3T31 A;  3AE7 A;  1GRG A;  1ZY8 A;  1PN0 A;  3JVA A;  2VVM A;  3UKA A;  3GO2 A;  3K1G A;  2FJA A;  1LPF A;  2QJJ A;  2WHD A;  2DKH A;  3RNM A;  3T6C A;  3BI2 A;  3BSM A;  3GD3 A;  4AOS A;  3URH A;  3KPK A;  2QA1 A;  1N63 C;  1MRA A;  5M10 A;  1DNC A;  2PGW A;  2OQH A;  1E1L A;  1L9D A;  3CGE A;  2BRY A;  1FO4 A;  2TMD A;  4G8T A;  1F8S A;  3ENL A;  4EM4 A;  4H19 A;  2VZ2 A;  3HYX A;  4DSH A;  2PTZ A;  4RG4 A;  1GT8 A;  4NNJ A;  2BK3 A;  1Q9I A;  2C75 A;  1OJT A;  4G9K A;  4YWO A;  4K1W A;  4B65 A;  4II2 A;  1GXF A;  2QGY A;  4K22 A;  4J33 A;  2XVJ A;  3TQP A;  3IJQ A;  4Z26 A;  5FS8 A;  4OPU A;  1FOH A;  4LII A;  1MDL A;  1B4V A;  2AL2 B;  1PS9 A;  2OO6 A;  1JU2 A;  1N5X A;  4NWZ A;  3STP A;  3C96 A;  3SQS A;  2FJB A;  3AE8 A;  5FJT A;  3DA1 A;  1NPX A;  3NT6 A;  1N4U A;  2UZZ A;  3AE6 A;  3KUM A;  4XWR A;  2YLZ A;  1TYT A;  4B66 A;  3VA8 A;  4C3X A;  2WDR A;  3SXI A;  4OPD A;  1N62 C;  2GMJ A;  3MQT A;  4Z43 A;  2IVD A;  1JCT A;  1KCZ A;  3EPT A;  3FIM B;  4IVO B;  3AE3 A;  4U8N A;  3UJF A;  4YT0 A;  3EEZ A;  4FDC B;  2BC0 A;  2GGG A;  1DJQ A;  3F8P A;  1KFY A;  1FEA A;  3GMB A;  2O56 A;  1KKO A;  2FKP A;  2YG4 A;  1SJA A;  2GEW A;  3C4A A;  4U2L A;  4WX1 A;  5FJP A;  1PXA A;  3SSZ A;  3A7U A;  5KWF A;  2XGZ A;  1R6W A;  4AT0 A;  2OZ3 A;  1GOS A;  4HB9 A;  3T0K A;  2XFP A;  5GSN A;  3ALM A;  3QFA A;  4U8M A;  5JCN A;  1AOG A;  3UXK A;  1VQW A;  5HXI A;  1NEL A;  2WS3 A;  5G5G B;  1EBD A;  3D46 A;  4JN7 A;  3AYL A;  3BNU A;  2Y6R A;  4PAB A;  1CJ4 A;  4GAV A;  1H84 A;  4C5O A;  2ZZ0 A;  1H82 A;  2RDX A;  3DH9 A;  1K0J A;  2B7R A;  3UKL A;  5CKU A;  2BCG G;  4LU6 A;  2Q7V A;  3BJS A;  2XVF A;  3UTG A;  1M64 A;  2O9Z A;  2YR4 A;  2XH0 A;  2Q0K A;  3DK4 A;  3AEF A;  2GGI A;  1D7L A;  2I5Q A;  3AYJ A;  3BOX A;  3R11 A;  5C2T A;  3V5F A;  3P4S A;  1X2H A;  1EBH A;  3DJG X;  2W3R A;  5U1O A;  2BS2 A;  2V3A A;  2Z5X A;  4E8G A;  3Q45 A;  4H2P A;  1JPD X;  4ZCD A;  3THU A;  3FBS A;  4HCH A;  3UCL A;  2X8H A;  2Q6U A;  4GYP C;  3G5S A;  2C76 A;  4EIQ A;  2WDV A;  3II4 A;  2GR0 A;  1GPE A;  1GRT A;  2OLA A;  3CIR A;  5KXJ A;  4H2N A;  4UDR A;  3UGV A;  4U8J A;  3GWF A;  2POZ A;  1GRB A;  3NH3 X;  4HPN A;  3H12 A;  1S2Q A;  1LQT A;  1GND A;  3ATR A;  2WPE A;  3CNJ A;  3CN8 A;  2XCG A;  3KLJ A;  3QFB A;  1TDK A;  3NYE A;  1OJC A;  4GGH A;  1MO9 A;  3ZLG A;  1CBO A;  4H4X A;  4DHG A;  1LJ1 A;  4M0X A;  2YG7 A;  3UOV A;  3BI5 A;  1TKK A;  2QVH A;  3UXL A;  2CVJ A;  2R0C A;  3GRS A;  3OZM A;  4IT1 A;  4WCT A;  2PU1 A;  3NK2 X;  4YSX A;  4OPC A;  2E3T A;  3EKG A;  4HN8 A;  6ENL A;  2XFN A;  4CY6 A;  4HYR A;  1IUT A;  3ZLH A;  4ZCW A;  3D47 A;  4B63 A;  3CND A;  5JCM A;  1N4W A;  2AL2 A;  2OZ8 A;  4UP3 A;  1Z6L A;  5CQF A;  3NTA A;  2W0H A;  4JN9 A;  3CT2 A;  3AD7 B;  3DG3 A;  5IQ1 A;  2POD A;  3QSE A;  4NTE A;  2BK4 A;  4BK3 A;  3VRB A;  3LAD A;  3TJI A;  5IDZ A;  1ZOV A;  1KD0 A;  4APN A;  2GMH A;  3COX A;  4H4P A;  1JDF A; 
#chains in the Genus database with same CATH homology
 3K7Q X;  4OVI A;  1TDF A;  2RGJ A;  1H7X A;  5GRT A;  2C64 A;  3AWI A;  4N9X A;  2IVE A;  3CNT A;  2BS4 A;  1NHQ A;  1KSS A;  3R9U A;  4DSG A;  1D4C A;  1Q1W A;  5J7X A;  3DK8 A;  2APG A;  1F3P A;  3AXB A;  3NK0 X;  4OPT A;  5DBJ A;  1GAL A;  4USQ A;  1BWC A;  2GR3 A;  2WES A;  5KVH A;  4NEW A;  3IWA A;  4A99 A;  4Z25 A;  1TDN A;  4JNQ A;  4K5R A;  4Z2T A;  4RG3 A;  1ELI A;  3CGB A;  4H4Y A;  3GD4 A;  4PAA A;  4NTC A;  4H7U A;  3Q9T A;  4CBQ A;  3L1R A;  4J36 A;  2YR5 A;  3P4R A;  4C74 A;  2WP5 A;  5FS9 A;  3I6D A;  3V3N A;  1DXL A;  1EL5 A;  2A87 A;  3T31 A;  2VQB A;  3E1T A;  4IA5 A;  3BI4 A;  2BCP A;  3P4Q A;  1NG3 A;  1BZL A;  4G74 A;  4P9S A;  5KMR A;  3AE7 A;  1GER A;  3JSK A;  1GRG A;  1ZY8 A;  1P2E A;  3NNE A;  1PN0 A;  2I0Z A;  2E1M A;  3UKQ A;  2EQ6 A;  5EOW A;  1PXC A;  1RSG A;  4NTD A;  2OAM A;  2VVM A;  3UKA A;  4O5Q A;  3SFD A;  3GYI A;  3ICS A;  3NGC X;  4EMW A;  2AR8 A;  4G6H A;  2FJA A;  4U2S A;  1LPF A;  3B3R A;  4H4Z A;  2WP6 A;  2B7S A;  2WHD A;  2DKH A;  3K30 A;  1ZDL A;  3RNM A;  1FCD A;  3M12 A;  3NK1 X;  3BI2 A;  3SZ0 A;  4YTM A;  2OAL A;  2YG3 A;  3GD3 A;  4AOS A;  3Q6J A;  3IF9 A;  4CCR A;  3URH A;  1FL2 A;  2BS3 A;  5ER0 A;  3KPK A;  1H81 A;  3D8X A;  2QA1 A;  4O5U A;  4H4T A;  1H86 A;  3GDP A;  2R0P A;  5M10 A;  3FPZ A;  1XAN A;  4HA6 A;  1DNC A;  4C3Y A;  2GR1 A;  1E1L A;  1L9D A;  3CGE A;  2BRY A;  3NN6 X;  4GAP A;  4YSZ A;  1S2Y A;  5U63 A;  4USR A;  4Y4L A;  1E1M A;  3ATQ A;  3NKS A;  3DGZ A;  2TMD A;  4BK2 A;  2JAE A;  4GDP A;  3NLC A;  4ZN0 A;  1NHR A;  4FK1 A;  4ICY A;  3HYW A;  1F8S A;  1O94 A;  3S5W A;  1YQ4 A;  3SFE A;  5KOW A;  4EM4 A;  3KA7 A;  3D1C A;  3NYC A;  4TLX A;  4AP3 A;  3ZYX A;  2XLP A;  2VZ2 A;  3NYF A;  2GH5 A;  3HYX A;  3NTD A;  1GRE A;  2GVC A;  3UKK A;  4DSH A;  1M6I A;  3C4N A;  3AE9 A;  3UOZ A;  3PG6 A;  4D03 A;  4CCQ A;  2XFO A;  4FK1 C;  4RG4 A;  1GT8 A;  4NNJ A;  1CC4 A;  1UKV G;  4E0V A;  4MJW A;  4EMJ A;  3FG2 P;  4GR1 A;  1DJN A;  2GF3 A;  4CNK A;  4FX9 A;  5EBK A;  2BK3 A;  1Q9I A;  2E4G A;  2C75 A;  1OJT A;  2YVF A;  2GQW A;  4G9K A;  2AAQ A;  4KPR A;  4YWO A;  1IUX A;  1E1K A;  2CDU A;  2GAH B;  2H88 A;  3NIX A;  4B65 A;  4II2 A;  4X9M A;  3SZF A;  1ZP0 A;  5BVA A;  1EL8 A;  1GXF A;  2WPC A;  3VQR A;  1B8S A;  4K22 A;  3VR8 A;  1CF3 A;  4J33 A;  2XVJ A;  1RP0 A;  1KF6 A;  2GAG B;  5C3J A;  4KX6 A;  2QCU A;  4Z26 A;  5FS8 A;  3NG7 X;  1ONF A;  3L8K A;  3DJJ A;  4OPU A;  3P1W A;  2X8C A;  1FOH A;  3AEG A;  3AEE A;  4LII A;  4B69 A;  4CY8 A;  1B4V A;  2WBA A;  3IC9 A;  1PS9 A;  2YLS A;  1JU2 A;  2XVH A;  2JKC A;  2WU5 A;  1NAA A;  2ACZ A;  2B76 A;  2XVE A;  4NWZ A;  3CTY A;  5KRQ A;  3C96 A;  3RHA A;  1COY A;  2R4E A;  1CJ3 A;  4REK A;  2OA1 A;  1H2I A;  3KPF A;  3LXD A;  1GTE A;  4NEV A;  2FJB A;  3AE8 A;  3ALL A;  1IUU A;  3AE1 A;  3SX6 A;  3DA1 A;  1GES A;  2AQJ A;  4I58 A;  1GRF A;  3AE2 A;  1JRX A;  1BGJ A;  1NPX A;  2BA9 A;  1GSN A;  2R9Z A;  3GYJ A;  2HQM A;  1PHH A;  2X99 A;  2CFY A;  4H4V A;  1N4U A;  1S3E A;  2C66 A;  4BJZ A;  2UZZ A;  3LB8 A;  1E7P A;  2JB2 A;  3AE6 A;  2YLW A;  4XWR A;  2V6O A;  1GRA A;  2YQU A;  4J56 A;  2JBV A;  1OJ9 A;  2J3N A;  2WDQ A;  2YLZ A;  3DJD A;  2FJE A;  3PVC A;  3QVP A;  1TYT A;  1H83 A;  1S3B A;  4H2Q A;  4JY3 A;  3LZW A;  1F8W A;  1YY5 A;  4X4J A;  5J60 A;  4B66 A;  4BK1 A;  3EAO A;  4EQW A;  4J34 A;  5JCK A;  4U8P A;  1EL7 A;  1V59 A;  4C3X A;  2VRL A;  2H89 A;  2WDR A;  5KMQ A;  1TRB A;  2WOI A;  3SXI A;  2YG5 A;  4U8K A;  4Z2U A;  4ADW A;  2EQ9 A;  1DOE A;  4A7A A;  1Q1R A;  4OPD A;  3SZC A;  2VRM A;  2YWL A;  3OZ2 A;  4J2W A;  4K5S A;  2GMJ A;  4Z43 A;  2JB1 A;  2IVD A;  2XLT A;  1D5T A;  1DOC A;  1RYI A;  2BXS A;  3AED A;  3EPT A;  3FIM B;  1X31 B;  3UOX A;  4IVO B;  2NVK X;  3UTF A;  1FEB A;  4U2T A;  3SY4 A;  3AE3 A;  1GV4 A;  4A9W A;  4U8N A;  5KVI A;  3I3L A;  3UKP A;  1ZMD A;  1LV0 A;  3AD8 B;  4A6N B;  2GR2 A;  4YT0 A;  4M52 A;  5IPY A;  4JNA A;  5IQ4 A;  3K7T A;  1GEU A;  3CPI G;  4BUR A;  3SYI A;  3OC4 A;  4OPL A;  3F8R A;  4FDC B;  2BC0 A;  2BXR A;  2YG6 A;  1DJQ A;  4I59 A;  4B68 A;  1EL9 A;  2WQY A;  3F8P A;  1JNR A;  1KFY A;  1VG9 A;  1FEA A;  1PBC A;  3GMB A;  1CC6 A;  4OPI A;  2ZBW A;  5BUL A;  3AE4 A;  2PHH A;  1Y0P A;  4EIP A;  3AYI A;  1JEH A;  4RSL A;  5HY5 A;  2JK6 A;  3GRT A;  1SEZ A;  2YG4 A;  1TDE A;  3SZW A;  3SM8 A;  2GEW A;  5TR3 A;  3C4A A;  3H8I A;  3NHO X;  2YVG A;  4U2L A;  4WX1 A;  4YSH A;  3CGC A;  1JRY A;  3T2Y A;  1PXA A;  3PO7 A;  4II3 A;  4U8O A;  3IHG A;  1KNR A;  3ICR A;  4TM3 A;  2PYX A;  3T14 A;  5KWF A;  4NZH A;  1VG0 A;  1QLB A;  4DNA A;  1GET A;  2XFQ A;  4AT0 A;  1GOS A;  1ZOY A;  4HB9 A;  3IHM A;  3VR9 A;  1IJH A;  2TPR A;  2E5V A;  2XLS A;  3BHK A;  3T0K A;  2QAE A;  1VRQ B;  2WET A;  2XFP A;  2YLT A;  1L0V A;  1D4D A;  4AP1 A;  5GSN A;  3ALM A;  3QFA A;  4U8M A;  2EQ7 A;  5JCN A;  3ABV A;  1AOG A;  1VQW A;  4U8I A;  3T37 A;  4IVM B;  2C65 A;  3UP4 A;  4EM3 A;  5HXI A;  3UTH A;  2CUL A;  2V3B A;  4BV6 A;  5JCI A;  2WS3 A;  2Z5Y A;  4H4S A;  1N4V A;  1IUV A;  4EMI A;  1JOA A;  1N1P A;  1EBD A;  1QO8 A;  4ECH A;  4Z24 A;  1L9E A;  2V5Z A;  1S7M A;  2GB0 A;  3AYL A;  1CL0 A;  3BNU A;  3V76 A;  4D04 A;  1PBD A;  2Y6R A;  1QJD A;  4PAB A;  1CJ4 A;  3CNS A;  3P4P A;  4GAV A;  1H84 A;  1PJ7 A;  4GDE A;  5FS6 A;  4C5O A;  1CHU A;  3KKJ A;  2ZZ0 A;  3V3O A;  1H82 A;  3RP7 A;  1ZK7 A;  2RGO A;  4UDP A;  3ITJ A;  1PJ5 A;  5KNL A;  3DH9 A;  1K0J A;  2B7R A;  1PJ6 A;  2BC1 A;  1Y56 B;  3UKL A;  5CKU A;  3HYV A;  2BCG G;  3HZL A;  3UOY A;  5EB5 A;  1DOB A;  3G5R A;  5KOX A;  4LU6 A;  2BYB A;  4YTP A;  2Q7V A;  1H6V A;  3L5O A;  1ZKQ A;  4EQX A;  3RP6 A;  2C73 A;  2XVF A;  3UTG A;  2BAC A;  3UKH A;  1TYP A;  1ZX9 A;  3DGH A;  1LQU A;  2NPX A;  1M64 A;  2O9Z A;  2WU2 A;  2YR4 A;  2RAB A;  4A79 A;  2Q0K A;  4H4W A;  2OLO A;  2ZZB A;  4YKG A;  2Q0L A;  3DK4 A;  2WP9 A;  2X3N A;  2XYO A;  4Y4M A;  1REO A;  3AEF A;  2C3D A;  1HYU A;  1XDI A;  1D7L A;  1E1N A;  2V60 A;  3AYJ A;  5M0Z A;  3D9X A;  1ZMC A;  2FJD A;  5KMS A;  5C2T A;  1JNZ A;  2BK5 A;  2GRT A;  3K7M X;  4ZCC A;  3P4S A;  4IV9 A;  2WOW A;  3EF6 A;  4AOX A;  3KD9 A;  1CJC A;  3DJG X;  2XVI A;  2R4J A;  5U1O A;  3H8L A;  2BS2 A;  3AEA A;  3KU9 A;  3FMW A;  4K7Z A;  1W4X A;  1XPQ A;  3P9U A;  3M0O A;  4J57 A;  4Z2R A;  3RED A;  1NEN A;  4TLZ A;  4BJY A;  4YSY A;  3DJE A;  3CNP A;  2XFU A;  2VVL A;  2YLR A;  2V3A A;  3GWD A;  3QJ4 A;  2Z5X A;  4YXD A;  1D7Y A;  4EQR A;  3KVE A;  1NDA A;  2VVL G;  4X9N A;  4H2P A;  2DKI A;  1MXT A;  5U25 A;  4DGK A;  4ZCD A;  3AEB A;  4A6N A;  3FBS A;  3ISH A;  3UCL A;  2X8H A;  5JRB A;  2Q6U A;  1NG4 A;  3VRA A;  3G5S A;  2C76 A;  2GQF A;  1KSU A;  1PDH A;  4K8D A;  4IA6 A;  2XLU A;  3BNM A;  4EIQ A;  1PBB A;  2WDV A;  2Y6Q A;  3T2K A;  4Y4N A;  3ICT A;  4G73 A;  3II4 A;  2GR0 A;  1CC2 A;  1GPE A;  1GRT A;  1D4E A;  3AEC A;  3CIR A;  3QSS A;  5KXJ A;  5FS7 A;  4H2N A;  3WE0 A;  4OCG A;  1K0I A;  4UDR A;  1GTH A;  2BRA A;  5JCL A;  4H2R A;  4CRT A;  3H4K A;  3LZX A;  4U8J A;  3GWF A;  3CPJ G;  4H4Q A;  3GMC A;  1GRB A;  3NH3 X;  4Z44 A;  4CNJ A;  5HYM A;  1O95 A;  3SQP A;  1YQ3 A;  1O5W A;  2FBW A;  2B9Y A;  4G6G A;  1S2Q A;  1LQT A;  2XDO A;  2X8G A;  4XXG A;  1LTX R;  1CJ2 A;  3O0H A;  2ZZC A;  1GND A;  3LJP A;  2JB3 A;  3ATR A;  2WPE A;  2YM2 A;  1KDG A;  3AD9 B;  1YQZ A;  3NRN A;  3CNJ A;  3CN8 A;  3GSI A;  2XCG A;  3KLJ A;  3QFB A;  3G5Q A;  1MOK A;  3CPH G;  5KMP A;  1TDK A;  3NYE A;  4LA1 A;  1OJC A;  3RP8 A;  2B9W A;  4EQS A;  2GV8 A;  1MO9 A;  1BGN A;  1CBO A;  2IID A;  4GUV A;  4H4X A;  1LJ1 A;  1NEK A;  3S61 A;  2YG7 A;  3UOV A;  1YKJ A;  2VQ7 A;  2C7G A;  2R45 A;  3B6D A;  4H4U A;  4GF7 A;  3F8D A;  3ZDN A;  1F8R A;  4JQ9 A;  4JY2 A;  3BI5 A;  3AE5 A;  1JRZ A;  3GDN A;  5BRT A;  2QA2 A;  1OJD A;  3CMM A;  2ARD A;  2CVJ A;  2R0C A;  5BUK A;  1NHS A;  2WOV A;  3EAN A;  3GRS A;  4YTN A;  2YVJ A;  3QSM A;  4GCM A;  2XLR A;  4J31 A;  2C72 A;  4WCT A;  2OLN A;  1PBE A;  4XWZ A;  3UKF A;  5HHF A;  1TDO A;  2A89 A;  4H4R A;  2C67 A;  3AB1 A;  2V61 A;  3GYX A;  3NK2 X;  3ALJ A;  1Y56 A;  4OPG A;  4YSX A;  1H7W A;  2C3C A;  1F6M A;  3PS9 A;  4OPC A;  3LOV A;  3CGD A;  2R46 A;  2BAB A;  2YLX A;  3QVR A;  4TM4 A;  1P2H A;  1E39 A;  2XFN A;  4A65 A;  1L9C A;  4CY6 A;  1B5Q A;  2C4C A;  4UDQ A;  2VOU A;  1IUT A;  4H50 A;  4TM1 A;  1KN0 A;  4YKF A;  1B37 A;  4A5L A;  4B67 A;  4B64 A;  4B1B A;  4B63 A;  1BKW A;  3CND A;  4AT2 A;  3SGL A;  2C70 A;  5JCM A;  1OJA A;  1FEC A;  1N4W A;  1PBF A;  2B9X A;  2EQ8 A;  3NN0 X;  1E6E A;  2A8X A;  2YAU A;  4UP3 A;  2YR6 A;  1IUW A;  1Z6L A;  1BF3 A;  5CQF A;  1IUS A;  3T2Z A;  1K4Q A;  5EB4 A;  3NTA A;  2WPF A;  2W0H A;  1LVL A;  1K0L A;  3AD7 B;  4JN9 A;  3UP5 A;  3UTE A;  3VRD B;  5IQ1 A;  3DK9 A;  5FMH A;  1KNP A;  1VDC A;  3QSE A;  4K2X A;  3NT6 A;  1NHP A;  1GRH A;  4NTE A;  4C77 A;  5LV9 A;  1DOD A;  4U8L A;  2BK4 A;  2F5Z A;  3BHF A;  2RGH A;  4GRT A;  4TM0 A;  3ADA B;  4BK3 A;  2X50 A;  1PXB A;  1XHC A;  4JDR A;  3LAD A;  2R0G A;  1ZOV A;  2WEU A;  3VRB A;  5L46 A;  4APN A;  2GMH A;  3M13 A;  3COX A;  4H4P A;  3DME A;  2YM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...