5U1OA

2.3 angstrom resolution crystal structure of glutathione reductase from vibrio parahaemolyticus in complex with fad.
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
450
structure length
450
Chain Sequence
ATHFDYICIGGGSGGIASANRAAMYGAKVALIEAQDLGGTCVNVGCVPKKVMWHGAQIAEAMNLYAEDYGFDVDVKGFDWSKLVESRQAYIGRIHQSYDRVLGNNKVNVIKGFAKFVDEKTVEVNGEHYTADHILIAVGGRPTIPNIPGAEYGIDSNGFFDLAEQPKRVAVVGAGYIAVEIAGVLHALGTETHLFVRKESPLRSFDPMIIDTLVEVMEAEGPTLHTHSVPKEVVKEADGSLTLHLENGESQNVDQLIWAIGRHPATDAINLASTGVATNEKGYIKVDEYQETNVKGIYCVGDIMEGGIELTPVAVKAGRQLSERLFNNKPNAKMDYDLVPTVVFSHPPIGTIGLTTQEAEEKYGKDNIKVYTSGFTAMYTAVTKHRQPCKMKLVCAGEEETVVGLHGIGFTVDEMIQGFGVAMKMGATKADFDSVVAIHPTGSEEFVTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione reductase
publication title 2.3 Angstrom Resolution Crystal Structure of Glutathione Reductase from Vibrio parahaemolyticus in Complex with FAD.
rcsb
source organism Vibrio parahaemolyticus serotype o3:k6 (strain rimd 2210633)
molecule tags Lipid binding protein
total genus 146
structure length 450
sequence length 450
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5u1oA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5u1oA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5u1oA02
1PJ6A 3AE1A 2B7SA 2CDUA 3NG7X 1LPFA 3BNMA 2XFOA 2A8XA 3DGZA 2Z5XA 3AE3A 3LJPA 3VR8A 3EANA 2WU2A 5CKUA 1F8RA 3KU9A 4H2RA 3ALLA 1D5TA 2WOWA 3AECA 1BF3A 1XDIA 2WPCA 5HXIA 1KNRA 1GESA 2XCGA 1PXAA 1PBFA 2R0PA 2EQ7A 2WS3A 5U63A 2CULA 1DODA 3DJEA 1NPXA 4Y4LA 2QA2A 3DGHA 4BK1A 3GWFA 1GRAA 3NK1X 4C5OA 4XWZA 2XYOA 3CPHG 3CIRA 5L46A 2I0ZA 3CNPA 4AOSA 4DNAA 3AEGA 1CJCA 2Z5YA 1MXTA 3BI4A 5BVAA 4A6NB 3P4PA 2YAUA 2X8CA 1BGNA 2XVJA 2YQUA 2YM2A 4K2XA 2FJBA 4APNA 1ZMDA 1E1MA 2BYBA 2DKHA 2A89A 4OPTA 2RGJA 1B8SA 1NEKA 1VDCA 4AP3A 3CNSA 2BA9A 3AE4A 4BV6A 2FBWA 4NZHA 3SFEA 1EBDA 4X9MA 1FECA 1TDOA 4DGKA 3GSIA 4YSHA 3GDPA 4GR1A 5GSNA 1RSGA 2PHHA 4AT0A 1GETA 4NTEA 1OJDA 1TYTA 2GB0A 3FBSA 3O0HA 4TM4A 4U2TA 4CCRA 1FEBA 1CBOA 1GTEA 2FJDA 3NK2X 3V3NA 2UZZA 1DNCA 5JCNA 3LZXA 1P2EA 2HQMA 5KVHA 1EL9A 3AEEA 3IHMA 2X99A 3NN0X 1DOCA 1TDKA 3LOVA 1ZY8A 4A9WA 1K0JA 2XLRA 1ZOYA 2C65A 3GRSA 4ZCCA 1ZOVA 2GH5A 2R0GA 3AYLA 2XVEA 3LB8A 3IC9A 1KNPA 5JCMA 3G5QA 4EM4A 3AE6A 2V3BA 4H4YA 2GMHA 4Y4NA 2C75A 3NKSA 3SM8A 1MO9A 5FS8A 4YKFA 1CC6A 2WOVA 2ARDA 2BXRA 3NTAA 1JRZA 2BS2A 2C7GA 1TYPA 2NPXA 2WEUA 4B67A 3QVPA 4K7ZA 3ADAB 3PO7A 3CN8A 3ISHA 2XLPA 4OPUA 3CGEA 2BXSA 3RP8A 1E6EA 1PJ5A 4E0VA 2R46A 2YG6A 3NTDA 1EL5A 4EMJA 2C64A 3QFBA 5C2TA 2YR4A 5HHFA 4U2LA 1CJ4A 3VQRA 3UKLA 1K4QA 4YSYA 4TLXA 1D4EA 3FIMB 2WHDA 2V3AA 2GQFA 2Y6QA 4RG3A 4BK3A 1E1LA 1PXBA 2WP9A 3QSMA 2ZZBA 4U8LA 3RHAA 2VVMA 2C73A 2JB2A 1H86A 3BI5A 1S3BA 4EM3A 3PVCA 2ZBWA 2WQYA 2YLSA 1S2YA 1W4XA 1H7WA 3UKFA 1DOBA 4JNQA 3NYEA 5EOWA 1D4CA 4DSHA 1LVLA 2YLRA 1PHHA 3UP5A 1S3EA 3NH3X 1GPEA 1TDNA 2XVFA 1JRYA 2XVHA 4EIPA 2BS3A 4D04A 1OJAA 3AE5A 1BKWA 3NRNA 3F8DA 1GREA 5HY5A 1VRQB 1K0LA 2IVEA 2WBAA 2R0CA 2AAQA 4WX1A 4X9NA 4B66A 1IJHA 1TDEA 3FPZA 3QSSA 4J2WA 5FS9A 2Q0KA 4EIQA 1VG0A 2YVJA 3UKQA 3AE7A 1E1NA 3GD3A 3UKPA 3L1RA 3NT6A 3VRBA 3ZYXA 4A7AA 1PN0A 4BK2A 1OJCA 2GR3A 5KRQA 3B3RA 3REDA 4GUVA 2X8GA 1FL2A 2BK4A 2OLOA 3ICRA 3GYJA 3WE0A 3AD9B 2XFUA 4LA1A 2XFPA 1JNZA 1KSUA 2WU5A 2VOUA 1LQUA 4YTNA 2FJAA 3I3LA 4IA5A 1F3PA 2GRTA 2BK3A 1B4VA 4JQ9A 1XPQA 3GYIA 2OLNA 3EPTA 2ZZCA 3K30A 1CJ3A 2GF3A 4I58A 3QFAA 4IVOB 1XANA 4OPLA 5FMHA 5C3JA 3NGCX 4GDEA 2V5ZA 3AEAA 4HA6A 3AYJA 4WCTA 5JCLA 2V61A 1F6MA 4CBQA 1MOKA 1Y56A 4TM1A 1L9EA 4CY8A 4H4WA 2BS4A 1NG3A 1SEZA 3FG2P 2GVCA 2YG3A 4H2QA 2C3DA 1DJNA 1ELIA 1GOSA 4PAAA 4NTCA 1O5WA 3ALMA 2GAHB 3S5WA 2BABA 4OCGA 4U8MA 1ONFA 2WP5A 1PDHA 1TDFA 3KA7A 4YTPA 4EQXA 4J34A 3NHOX 3K7TA 3LXDA 1JRXA 3SQPA 3UP4A 2QCUA 1GT8A 3AE9A 1YQ3A 4U8OA 3EAOA 1M64A 3COXA 1IUUA 2Q7VA 1Q1RA 1GRTA 5EB4A 2WOIA 3CPIG 1IUVA 1NHRA 2XLSA 1NHPA 3UOXA 1F8SA 4A99A 4OPCA 1DJQA 1YKJA 2XLUA 3KLJA 1Y0PA 2E4GA 1CJ2A 4CNJA 1GEUA 1V59A 2VZ2A 4HB9A 3CGCA 3DJGX 1FEAA 3OZ2A 4GRTA 1N4WA 5KOXA 2A87A 2J3NA 4YWOA 1K0IA 3NYFA 2YR5A 2QAEA 4NEWA 2TMDA 2XDOA 2QA1A 1IUXA 4K8DA 4J33A 5J7XA 1NG4A 1RP0A 2BK5A 3IWAA 3KVEA 1VQWA 4I59A 4NEVA 5TR3A 3QVRA 2GR1A 5U1OA 1S2QA 2R45A 2OA1A 1L9DA 3LADA 4K22A 2XFQA 3NLCA 3VR9A 1O95A 3BI2A 4A65A 3DA1A 2H89A 4RSLA 2VVLA 3GWDA 2IVDA 3K7MX 4KPRA 2WPFA 2F5ZA 2X3NA 4U8PA 2OAMA 1H84A 3G5RA 2GR0A 4CRTA 4X4JA 1EL7A 4C3YA 2NVKX 1AOGA 2C66A 3GMCA 2BC1A 3RP7A 2B9XA 2YG5A 4LU6A 1XHCA 2VQBA 3PS9A 4D03A 3DJDA 3AEFA 4REKA 5J60A 1JU2A 2RGOA 3GRTA 1JOAA 4CNKA 4Z2RA 2B7RA 3E1TA 3IHGA 1CC4A 1Y56B 1GNDA 1NAAA 2YR6A 4IVMB 1L0VA 1BZLA 3VRDB 3ICSA 2EQ8A 1GRHA 2C76A 2EQ6A 1LJ1A 4K5RA 4H7UA 4B68A 4C74A 4USQA 2R4JA 2WESA 1KFYA 2BC0A 4U2SA 3CGBA 2E5VA 5LV9A 4J57A 1PBEA 4NTDA 4B64A 2WETA 4RG4A 1H81A 2W0HA 3Q6JA 3FMWA 1PJ7A 1REOA 3D1CA 4Z25A 4JNAA 1IUSA 4OPDA 3AD7B 4H50A 1Q1WA 1H7XA 4JY3A 4B69A 1H6VA 5ER0A 3QJ4A 3AXBA 4J56A 4A79A 4BJYA 4LIIA 4JDRA 1EL8A 4ZN0A 2GQWA 5JCKA 1UKVG 3CTYA 4H4PA 1GRFA 3GMBA 3UTFA 3ABVA 2ACZA 1CC2A 4GDPA 4B65A 4H4QA 2WDRA 2BCGG 2Y6RA 1BGJA 3UKKA 4GCMA 1QO8A 4H2PA 2JB3A 3ALJA 2YLZA 1OJ9A 3JSKA 3URHA 1O94A 4YXDA 1GERA 4EMWA 4YKGA 3UOYA 3II4A 3ICTA 3ZDNA 4H4VA 3AE2A 1JEHA 2VVLG 1H83A 2VRMA 2YWLA 3VRAA 4YSXA 5KVIA 2VQ7A 4Y4MA 4AOXA 1PBDA 4USRA 5JCIA 2C67A 3KPFA 5IQ1A 5BRTA 2YLXA 4DSGA 2C70A 1PXCA 1ZX9A 1X31B 3S61A 1CL0A 1FOHA 4PABA 1E1KA 3SGLA 5BUKA 4EQSA 1KSSA 4FDCB 1PBBA 2JBVA 3AE8A 4FK1A 4CCQA 3AD8B 1DXLA 3P4QA 4EQWA 3NYCA 3SFDA 3QSEA 1ZP0A 3BHFA 2GEWA 2YG4A 4N9XA 2YLTA 3M13A 3V3OA 3UTEA 4MJWA 1VG9A 2JKCA 2DKIA 3UOZA 2C3CA 1L9CA 4OPIA 3DK9A 3AB1A 4CY6A 2EQ9A 3DMEA 1B37A 1E7PA 1M6IA 3AWIA 1TRBA 2WPEA 2RABA 1KDGA 4Z2TA 2C72A 3B6DA 4U8KA 3H8IA 1DOEA 4J36A 4Z26A 1LV0A 2GR2A 3IF9A 4ICYA 3UKHA 4TLZA 3UTHA 1IUWA 1YQ4A 2WP6A 2BACA 2FJEA 2WDQA 1N4VA 3P9UA 4JN9A 4XXGA 5CQFA 5M0ZA 4FK1C 1GV4A 2YG7A 3BHKA 3DJJA 1KF6A 3CGDA 3HZLA 5BULA 2YVFA 3D8XA 3GDNA 2XLTA 3CNDA 4ECHA 1ZDLA 3I6DA 2RGHA 3UCLA 4B1BA 3V76A 2O9ZA 3BNUA 3C4NA 3K7QX 1OJTA 4H4XA 1FCDA 2B9YA 1LQTA 2B76A 4H2NA 4OPGA 3UOVA 2BCPA 3ITJA 1YQZA 1YY5A 4C77A 1D4DA 3LZWA 3H4KA 5EBKA 1NHSA 2APGA 1GRGA 2X50A 2IIDA 4A5LA 1ZMCA 3DK4A 3R9UA 4OVIA 4AT2A 4U8JA 3Q9TA 5FS7A 5M10A 3NN6X 1LTXR 1GXFA 4EQRA 1GSNA 2CVJA 2GAGB 2X8HA 1QLBA 2B9WA 4UP3A 4U8IA 3M0OA 4O5QA 1HYUA 3P1WA 2E1MA 3F8PA 1CF3A 3ATRA 4IV9A 2JK6A 4IA6A 1PS9A 2XFNA 1B5QA 4KX6A 4TM3A 5EB5A 4J31A 5IPYA 2YLWA 2YVGA 3NIXA 3H8LA 4YT0A 4H4ZA 2ZZ0A 4H4SA 4JY2A 4YTMA 1CHUA 2YM1A 1ZKQA 2R4EA 4UDPA 2V6OA 3KKJA 3C4AA 3CNJA 4A6NA 1BWCA 3CPJG 1H82A 5KOWA 3GD4A 5HYMA 5FS6A 2JB1A 4Z44A 4B63A 2AR8A 1NDAA 1ZK7A 4EMIA 4Z2UA 2VRLA 2PYXA 1IUTA 3C96A 5DBJA 1PBCA 1N4UA 4P9SA 2CFYA 2XVIA 3DK8A 2WDVA 4UDRA 5KXJA 5GRTA 3EF6A 3AYIA 4GF7A 4H4TA 4BURA 2Q0LA 4TM0A 3OC4A 3DH9A 3RP6A 1GALA 1QJDA 4Z24A 1NENA 3ATQA 4YSZA 4U8NA 5U25A 2JAEA 1Q9IA 4XWRA 2R9ZA 1RYIA 4ZCDA 3M12A 4K5SA 4Z43A 5IQ4A 1NHQA 3NK0X 2TPRA 3AEDA 2AQJA 3P4SA 3P4RA 4H4RA 4O5UA 3UKAA 3RNMA 4ADWA 1COYA 4FX9A 4AP1A 1N1PA 2GMJA 3L8KA 3AEBA 2Q6UA 3G5SA 4BJZA 3T37A 2GV8A 4M52A 3CNTA 1E39A 1Z6LA 3KD9A 4UDQA 1GTHA 3NNEA 1F8WA 2V60A 2H88A 2OALA 1P2HA 1GRBA 4C3XA 4H4UA 1JNRA 5KWFA 1D7LA 1D7YA 3UTGA 3F8RA
chains in the Genus database with same CATH superfamily
2GGHA 3NG7X 1LPFA 1W6TA 2A8XA 3MSYA 3AE3A 1JCTA 4MMWA 4H2RA 3T2KA 2WOWA 2OZ3A 5HXIA 2XCGA 2R0PA 2PTYA 1DODA 3DJEA 1NPXA 4BK1A 3SXIA 3DGHA 3MKCA 2I0ZA 2Z5YA 2XVJA 1E1MA 2BYBA 2DKHA 5ENLA 1WYGA 1EC8A 1VDCA 2PU0A 3SFEA 4X9MA 1FECA 4DGKA 1RSGA 2PHHA 1GETA 4U2TA 4CCRA 1FEBA 1GTEA 3NK2X 3V3NA 3LZXA 1P2EA 3DG6A 1DOCA 3VCNA 1K0JA 4K2SA 1ZOYA 4ZOHB 1ZOVA 1ELSA 3CMMA 3THUA 3QKEA 5FJPA 4EM4A 2V3BA 4Y4NA 2C75A 3NVZB 1MNSA 2BXRA 2DW6A 3ADAB 3PO7A 1H2IA 3CGEA 2BXSA 2XH0A 3NTDA 1EL5A 3QFBA 1XPYA 2YR4A 5HHFA 1CJ4A 1K4QA 4YSYA 4Z17A 2WHDA 2V3AA 2GQFA 2Y6QA 2ZZBA 3ZLFA 5G5HB 3RHAA 2C73A 4EM3A 2FYMA 3PVCA 4GISA 3OTRA 4JNQA 4JN7A 1S3EA 4H19A 2GGEA 3NRNA 1GREA 1K0LA 2WBAA 4WX1A 1TDEA 4J2WA 5FS9A 3UKQA 3SR6B 3AE7A 3R1ZA 3R07C 3VFCA 4GUVA 3WE0A 2WU5A 4YTNA 2GRTA 1B4VA 3DEQA 5C3JA 3NGCX 4GDEA 3AEAA 4WCTA 4CBQA 2ONEA 1Y56A 1L9EA 4H4WA 1FO4A 2YG3A 3S5WA 2WP5A 1PDHA 3NHOX 1JRXA 3STPA 4MGGA 1M64A 2Q7VA 5EB4A 3PWGA 2XLSA 1NHPA 4A99A 1YKJA 3RCYA 7ENLA 4CNJA 3CGCA 3DJGX 1FEAA 1N4WA 5KOXA 2J3NA 3NYFA 2YR5A 2QAEA 4NEWA 2XDOA 4J33A 2BK5A 3QVRA 3VC5A 2OA1A 3LADA 2XFQA 4RSLA 2H89A 3GWDA 2HNEA 2WPFA 2OAMA 2GR0A 1VQZA 1EL7A 2C66A 3RP7A 2B9XA 3CT2A 4LU6A 1XHCA 3PS9A 4D03A 3DJDA 3TWAA 4REKA 1JU2A 3T0KA 3TWBA 3E1TA 1Y56B 3K1GA 1GNDA 1NAAA 4E4UA 4IVMB 1BZLA 1SB3B 2EQ6A 3EKGA 2ZC8A 4USQA 2R4JA 4J57A 2W0HA 4Z25A 4E8GA 3R0KA 3AD7B 4H50A 3OZMA 2OPJA 1FFUC 4JDRA 1EL8A 1UKVG 3CTYA 1GRFA 4KEMA 3I6EA 4H4QA 3B9JB 3SN0A 2JB3A 3ALJA 2YLZA 1OJ9A 3JSKA 2QJNA 4EMWA 3ZDNA 4H4VA 4YSXA 2YWLA 3UJRA 3OZYA 1PBDA 3GO2A 5IQ1A 4FP1A 4A35A 5BUKA 3DGBA 4EQSA 1KSSA 1PBBA 2JBVA 1KCZA 1DXLA 4X2PA 1ZP0A 3BHFA 3V3OA 2YG4A 3M13A 2JKCA 4OPIA 1L9CA 3KPKA 1KDGA 3B6DA 4U8KA 3H8IA 1DOEA 4J36A 4A6GA 4Z26A 3KUMA 4H2HA 4TLZA 1IUWA 4JN9A 2P8BA 2YG7A 3DJJA 3CGDA 5BULA 4ECHA 1ZDLA 4B1BA 4H2NA 1FCDA 2B76A 3ZLGA 1YQZA 1D4DA 5EBKA 4DYEA 4A5LA 4GAVA 1ZMCA 4OVIA 4HCLA 3NN6X 1LTXR 2GAGB 4O5QA 3F8PA 1CF3A 4IA6A 1ONEA 1B5QA 4TM3A 4J31A 3RGTA 4YT0A 4FI4A 2PTWA 2OKTA 1ZKQA 3C4AA 1BWCA 3CPJG 4B63A 2AR8A 4EMIA 2VRLA 3HYVA 5GRTA 3EF6A 4H4TA 4E5TA 3OC4A 3DH9A 1GALA 3I6TA 1FHUA 1Q9IA 3RR1A 1T3QC 4O5UA 2PGWA 4AP1A 1N1PA 3G5SA 4G73A 2Q6UA 4BJZA 3T37A 3KD9A 1Z6LA 3NNEA 2OALA 3UJSA 3Q45A 1MRAA 2XGZA 4C3XA 4H4UA 1D7LA 2OZ8A 3DESA 3MY9A 2CDUA 3UCDA 3DGZA 2DW7A 3R11A 2WU2A 3NS1B 1F8RA 1D5TA 3AECA 2WPCA 1GESA 1PBFA 2EQ7A 5U63A 4G7FA 4IL2A 4Y4LA 3SZWA 1GRAA 4C5OA 4XWZA 2OLAA 5BOFA 5J04A 2XYOA 4DNAA 2PODA 3AEGA 3R0UA 1CJCA 1MXTA 2YM2A 4II2A 4K2XA 2GSHA 4HN8A 1B8SA 1L8PA 3CNSA 2BA9A 4AP3A 3AE4A 1TKKA 3GSIA 4GR1A 4IP4A 4NTEA 5FJRA 2GB0A 3FBSA 1CBOA 2FJDA 2HXTA 1EL9A 3IHMA 3DFYA 3GRSA 1R6WA 4HNLA 2GH5A 3AYLA 1P48A 5JCMA 3AE6A 4H4YA 3NKSA 3SM8A 1MO9A 5FS8A 2WOVA 3PWIA 5FJTA 1JRZA 1TYPA 3ISHA 2XLPA 3RP8A 3NO1A 4E0VA 2YG6A 1R0MA 2C64A 3T2ZA 5C2TA 4U2LA 2P8CA 3AM9A 4BK3A 3BI5A 1S3BA 1S2YA 1W4XA 1WUFA 5EOWA 3RO6A 1D4CA 3UP5A 3NH3X 1GPEA 2XVFA 4EIPA 1BKWA 3A7RA 2IVEA 2AAQA 1N60C 3R25A 2P3ZA 1SJAA 1VG0A 2YVJA 2QJMA 1WUEA 4A7AA 4BK2A 3VRBA 2GGJA 5KRQA 3B3RA 3GYJA 3AD9B 2XFUA 3CAWA 1JNZA 3MQTA 4JHMA 2BK3A 3UJEA 4JQ9A 3UGVA 1XPQA 3EPTA 4I58A 4ZN0A 5JRBA 4OPLA 1IYXA 1PDZA 3AYJA 4G6GA 3UJFA 4TM1A 2W3SA 1DJNA 4PAAA 4NTCA 1TZZA 2QDDA 4U8MA 4ZCWA 4YTPA 4J34A 1NELA 3K7TA 4II3A 3LXDA 1N63C 1GT8A 4IZGA 2QCUA 2PGEA 4U8OA 3EAOA 1IUUA 1GRTA 3SZCA 5G5GB 4HCHA 3JW7A 1NHRA 3UOXA 1V59A 2GGIA 2MNRA 3HYXA 1NU5A 4YWOA 1K0IA 1X2GA 5J7XA 1RP0A 3FYYA 3IWAA 3QLDA 2GR1A 5U1OA 2PP3A 1OEPA 4K22A 1JROA 3DA1A 2OVLA 2VVLA 2IVDA 4KPRA 1H84A 3H8AA 1ECQA 2YG5A 1JOAA 3N4EA 2EQ8A 3T9PA 4K5RA 4MKSA 4B68A 3D9XA 5LV9A 1H81A 1REOA 3NFUA 1Q1WA 4JY3A 4B69A 3DFHA 1H6VA 3SN1A 4A79A 2GQWA 5EU9A 5JCKA 3D46A 3UTFA 3ABVA 4GDPA 4B65A 2Y6RA 3UKKA 1BGJA 1QO8A 1DTNA 4TVYA 5FJOA 4GGHA 3ICTA 2QJJA 3AE2A 1JEHA 1H83A 2VRMA 4Y4MA 3FXGA 2C67A 5BRTA 2YLXA 2C70A 2P0IA 1CL0A 4IHCA 4FDCB 4KWSA 3P4QA 3SFDA 3QSEA 2GEWA 2XH2A 2YLTA 4MJWA 3UOZA 3CB3A 1JDFA 1B37A 1E7PA 1M6IA 2WPEA 3T4WA 2GR2A 3IF9A 4ICYA 1FHVA 1YQ4A 2BACA 2WDQA 1N4VA 5CQFA 5M0ZA 4FK1C 1GV4A 3BHKA 3UXKA 3HZLA 3I6DA 3UCLA 3BNUA 3K7QX 1OJTA 4H4XA 3U4FA 2B9YA 1XS2A 2BCPA 3ITJA 4C77A 1YY5A 3N6JA 2PTZA 2CHRA 1GRGA 4HPNA 3L5OA 3DK4A 4GFIA 3R9UA 4AT2A 4U8JA 3SN4A 5FS7A 1KKOA 1GXFA 2X8HA 3P1WA 2E1MA 3ATRA 3CXOA 5EB5A 2YLWA 4JY2A 4YTMA 2R4EA 3NVWB 4A6NA 3GD4A 5FS6A 4DWDA 1NDAA 2PYXA 5DBJA 3FJ4A 2XVIA 4TM0A 3ES8A 1NENA 3ATQA 4TVWA 4XWRA 1RYIA 1NHQA 3UKAA 4KT2A 4A3RA 3S5SA 2V60A 5KMQA 1P2HA 1GRBA 1JNRA 1N61C 3TQPA 3AE1A 2XFOA 3EANA 3ALLA 1BF3A 1KNRA 2RDXA 2W55A 4M0XA 3IJLA 3GWFA 5FJUA 3CPHG 3CIRA 3PG6A 3RITA 4A6NB 3P4PA 2YAUA 2X8CA 5KMSA 4APNA 1ZMDA 3P93A 2A89A 3FVDA 1E9IA 2RGJA 4BV6A 1EBDA 3GDPA 5GSNA 1N62C 1TYTA 3O0HA 4TM4A 1DNCA 5JCNA 5KVHA 3R10A 2GDQA 4G8TA 1TDKA 1ZY8A 4A9WA 2E5AA 2XLRA 2C65A 4ZCCA 4NNJA 3PFRA 3IC9A 1KNPA 3SJNA 3G5QA 2GMHA 3FV9A 3NTAA 2C7GA 2NPXA 3QVPA 1JPDX 3CN8A 4OPUA 1E6EA 1PJ5A 3N4FA 4EMJA 4GYPA 3TCSA 1FFVC 3VQRA 2BRAA 3UKLA 4TLXA 1D4EA 3QTPA 3FIMB 4RG3A 1E1LA 2WP9A 3T8QA 4U8LA 2JB2A 1H86A 2ZBWA 2WQYA 2YLSA 4H83A 3ZVHA 2YLRA 4DSHA 1JRYA 2XVHA 2W3RA 3AE5A 3IJIA 3DDMA 3F8DA 2R0CA 3CXBA 4X9NA 4B66A 3FPZA 4EIQA 2FKPA 3L1RA 3ZYXA 2W54A 3REDA 2OLOA 2XFPA 2VOUA 1LQUA 2FJAA 3I3LA 4GIRA 1XANA 2PSNA 2PCEA 1SJCA 1MDRA 5JCLA 4CY8A 3FG2P 3JVAA 3T14A 3HW2A 3ENLA 2C3DA 1ELIA 1GOSA 3ALMA 1ONFA 2AKZA 1TDFA 2OG9A 4EQXA 4H1ZA 3SQPA 3AE9A 3COXA 4IL0A 1Q1RA 4G74A 2WOIA 1IUVA 3UJ2A 4OPCA 3KLJA 2E4GA 3T6CA 3OPSA 1GEUA 2VZ2A 3ZVHB 3OZ2A 1TE6A 3D47A 4GRTA 2A87A 2QA1A 1IUXA 4K8DA 1NG4A 3KVEA 4NEVA 4GAPA 1S2QA 3NLCA 3VR9A 1RVKA 3K7MX 1JRPA 4U8PA 2X3NA 4X4JA 4C3YA 2NVKX 1AOGA 3EEZA 3MUCA 3BJSA 3BSMA 2ZADA 3T31A 2RGOA 4Z2RA 2B7RA 3HYWA 3IHGA 3NVVB 1L0VA 3ICSA 2C76A 4H7UA 3PK7A 4C74A 3HRDC 4HCDA 3CGBA 4B64A 2WETA 1SJDA 4RG4A 1MUCA 1PJ7A 3DG3A 1IUSA 2OO6A 4OPDA 1H7XA 4ZA0A 3AXBA 4BJYA 4JN8A 1X2HA 4H4PA 5IDZA 2OX4A 4GCMA 3AN1A 3A7UA 4H2PA 1PDYA 4K8GA 4YXDA 1GERA 3Q4DA 4YKGA 3II4A 3SYIA 1EBGA 3VRAA 4DX3A 4DSGA 1ZX9A 3S61A 4PABA 3SGLA 3DIPA 2BRYA 3QN3A 4CCQA 4EQWA 3UTEA 4N9XA 3V3WA 1VG9A 2DKIA 3V5FA 2EQ9A 3DMEA 4DXKA 1TRBA 2RABA 4Z2TA 2C72A 4J1OA 1LV0A 4F4RA 3UKHA 3MZNA 2POZA 2XH4A 1KKRA 1N5WC 2QDEA 2YVFA 3GDNA 2XLTA 3CNDA 4ENLA 3UOVA 3LZWA 2AKMA 2X50A 2IIDA 3Q9TA 4EQRA 1GSNA 4UP3A 1QLBA 3N6HA 3M0OA 1HYUA 4IV9A 3A7AA 1PS9A 2XFNA 2OQYA 2GGGA 3NIXA 3IK4A 1KN0A 2ZZ0A 4KPLA 4G9KA 4H4SA 2YM1A 4UDPA 3KKJA 3CNJA 5KMPA 3OW1A 2JB1A 1ZK7A 3C96A 4P9SA 4UDRA 2WDVA 3AYIA 2Q0LA 3T2YA 3AMZA 4EWJA 1QJDA 4Z24A 4YSZA 4E4FA 4U8NA 5U25A 2JAEA 4ZCDA 4Z43A 5IQ4A 3P4RA 2AQJA 4H4RA 4ADWA 2GMJA 3L8KA 4M52A 1E39A 4UDQA 2QQ6A 1F8WA 2H88A 4GYPC 2QVHA 1D7YA 1PJ6A 2B7SA 2OFJA 3BNMA 2Z5XA 3LJPA 3VR8A 5CKUA 3KU9A 1XDIA 1EC7A 3ZLHA 1PXAA 5BOEA 2WS3A 2CULA 2QA2A 3NK1X 2PA6A 5L46A 3CNPA 4AOSA 3BI4A 5BVAA 3JZUA 1BGNA 2YQUA 3V4BA 3GC2A 2FJBA 1JPMA 3H70A 4OPTA 4ROPA 4M6UA 1NEKA 2FBWA 4NZHA 1TDOA 3TJIA 4YSHA 3V5CA 3U9IA 2HZGA 4AT0A 1MDLA 3TOYA 1OJDA 2I5QA 4NWZA 2UZZA 2HQMA 3EUB3 3AEEA 2X99A 3NN0X 3LOVA 2PP1A 2R0GA 2XVEA 3LB8A 4Z1YA 4YKFA 1CC6A 3SX6A 2ARDA 1FIQB 1SJBA 2WEUA 2BS2A 4B67A 4K7ZA 1P43A 2R46A 1EBHA 3NVYB 3VCCA 2XH7A 1PXBA 2OQHA 3DG7A 1N5XA 3QSMA 2PU1A 2VVMA 2O56A 1H7WA 3UKFA 1DOBA 3CYJA 3TJ4A 3NYEA 3FCPA 1LVLA 1PHHA 1TDNA 3DERA 2BS3A 4D04A 1OJAA 3UXLA 5HY5A 1VRQB 4GMEA 1IJHA 3QSSA 2Q0KA 3CK5A 3SZFA 3VDGA 1E1NA 3GD3A 3UKPA 3NT6A 1PN0A 1OJCA 2GR3A 2X8GA 1FL2A 2BK4A 3ICRA 4LA1A 1KSUA 4IA5A 1F3PA 3GYIA 2OLNA 4IVOB 2ZZCA 3K30A 1CJ3A 3QPEA 3UCCA 3QFAA 2GF3A 5FMHA 2PP0A 3GYXA 2V5ZA 4HA6A 3SY4A 2V61A 1F6MA 1MOKA 2AL2A 2BS4A 1NG3A 1SEZA 2GVCA 4H2QA 3GY1A 1O5WA 2GAHB 2BABA 4OCGA 1BQGA 1VDVA 3ES7A 3KA7A 4IT1A 1EC9A 4IP5A 3UP4A 1YQ3A 2XSXA 2PTXA 3NXLA 4HNCA 4DHGA 3NRZB 3CPIG 5KNLA 1F8SA 3MWCA 1DJQA 4K1WA 2XLUA 1Y0PA 1CJ2A 4HB9A 3H7VA 2TMDA 4I59A 1VQWA 5TR3A 2R45A 1L9DA 4A65A 1O95A 3BI2A 2E3TA 3RRAA 2F5ZA 3G5RA 2GL5A 4CRTA 4HYRA 3GMCA 2BC1A 2VQBA 3AEFA 5J60A 3S47A 4CNKA 3H12A 3GRTA 1BKHA 1CC4A 2AL2B 2YR6A 3BOXA 3SBFA 3VRDB 1GRHA 1LJ1A 2WESA 1KFYA 2BC0A 4U2SA 4DN1A 2E5VA 1PBEA 4NTDA 2PS2A 3Q6JA 3FMWA 3D1CA 4JNAA 3SQSA 5ER0A 3QJ4A 2NQLA 4J56A 3I4KA 2P88A 4LIIA 3VC6A 3GMBA 2ACZA 1CC2A 2WDRA 2BCGG 2C4CA 3URHA 1O94A 2AL1A 4G6HA 3UOYA 2PMQA 2VVLG 1YEYA 5KVIA 2VQ7A 4AOXA 4USRA 5JCIA 3KPFA 1PXCA 1X31B 1FOHA 3TW9A 1E1KA 3SZ0A 3AE8A 4FK1A 3VA8A 3AD8B 1S7MA 3NYCA 2PPGA 3SSZA 2C3CA 3DK9A 3AB1A 4CY6A 3AWIA 2OZTA 3TTEA 3ETRB 5KMRA 3NZGA 3UTHA 2WP6A 2FJEA 3P9UA 4XXGA 3GD6A 2MUCA 4GGBA 1KF6A 3D8XA 2RGHA 3V76A 2O9ZA 3C4NA 4OPGA 1LQTA 3H4KA 1NHSA 1STZA 2APGA 3B97A 5M10A 3IJQA 2CVJA 1ZXIC 2B9WA 3HPFA 4U8IA 2JK6A 4KX6A 3OP2A 4YWSA 5IPYA 2YVGA 3H8LA 4H4ZA 6ENLA 2QGYA 1CHUA 2V6OA 1H82A 5KOWA 5HYMA 4Z44A 4Z2UA 1IUTA 1PBCA 1N4UA 2CFYA 3ZVIA 1RM6B 3DK8A 5KXJA 4GF7A 4BURA 3RP6A 1KD0A 3P0WA 2R9ZA 3P3BA 3M12A 4K5SA 3NK0X 2TPRA 3AEDA 3P4SA 2HXUA 3RNMA 1COYA 4FX9A 4J3ZA 3AEBA 4E6MA 1V97A 2GV8A 3CNTA 1GTHA 5KWFA 1F9CA 3UTGA 3F8RA
chains in the Genus database with same CATH topology
1PJ6A 3AE1A 2B7SA 2CDUA 3NG7X 1LPFA 3BNMA 2XFOA 2A8XA 3DGZA 2Z5XA 3AE3A 3LJPA 3VR8A 3EANA 2WU2A 5CKUA 1F8RA 3KU9A 4H2RA 3ALLA 3T2KA 1D5TA 2WOWA 3AECA 1BF3A 1XDIA 2WPCA 5HXIA 1KNRA 1GESA 2XCGA 1PXAA 1PBFA 2R0PA 2EQ7A 2WS3A 5U63A 2CULA 1DODA 3DJEA 1NPXA 4Y4LA 2QA2A 3DGHA 3SXIA 3SZWA 3GWFA 1GRAA 3NK1X 4BK1A 4C5OA 4XWZA 2XYOA 3CPHG 3CIRA 5L46A 2I0ZA 3PG6A 3CNPA 4AOSA 4DNAA 3AEGA 1CJCA 2Z5YA 1MXTA 3BI4A 5BVAA 4A6NB 3P4PA 2YAUA 2X8CA 1BGNA 2XVJA 2YQUA 2YM2A 4II2A 5KMSA 4K2XA 2FJBA 4APNA 1ZMDA 1E1MA 2BYBA 2DKHA 2A89A 4OPTA 2RGJA 1B8SA 1NEKA 1VDCA 4AP3A 3CNSA 2BA9A 3AE4A 4BV6A 2FBWA 4NZHA 3SFEA 1EBDA 4X9MA 1FECA 1TDOA 4DGKA 3GSIA 4YSHA 3GDPA 4GR1A 5GSNA 1RSGA 2PHHA 4AT0A 1GETA 4NTEA 1OJDA 1TYTA 2GB0A 3FBSA 4NWZA 3O0HA 4TM4A 4U2TA 4CCRA 1FEBA 1CBOA 1GTEA 2FJDA 3NK2X 3V3NA 2UZZA 1DNCA 5JCNA 3LZXA 1P2EA 2HQMA 5KVHA 1EL9A 3AEEA 3IHMA 2X99A 3NN0X 1DOCA 1TDKA 3LOVA 1ZY8A 4A9WA 1K0JA 2XLRA 1ZOYA 2C65A 3GRSA 4ZCCA 1ZOVA 2GH5A 4NNJA 2R0GA 3AYLA 3CMMA 2XVEA 3LB8A 3IC9A 1KNPA 5JCMA 3G5QA 4EM4A 3AE6A 2V3BA 4H4YA 2GMHA 4Y4NA 2C75A 3NKSA 3SM8A 1MO9A 5FS8A 4YKFA 1CC6A 3SX6A 2WOVA 2ARDA 2BXRA 3NTAA 1JRZA 2BS2A 2C7GA 1TYPA 2NPXA 2WEUA 4B67A 3QVPA 4K7ZA 3ADAB 3PO7A 1H2IA 3CN8A 3ISHA 2XLPA 4OPUA 3CGEA 2BXSA 3RP8A 1E6EA 1PJ5A 4E0VA 2R46A 2YG6A 3NTDA 1EL5A 4EMJA 2C64A 3QFBA 3T2ZA 5C2TA 2YR4A 5HHFA 4U2LA 1CJ4A 3VQRA 2BRAA 3UKLA 1K4QA 4YSYA 4TLXA 1D4EA 3FIMB 2WHDA 2V3AA 2GQFA 2Y6QA 4RG3A 4BK3A 1E1LA 1PXBA 2WP9A 3QSMA 2ZZBA 4U8LA 3RHAA 2VVMA 2C73A 2JB2A 1H86A 3BI5A 1S3BA 4EM3A 3PVCA 2ZBWA 2WQYA 2YLSA 1S2YA 1W4XA 1H7WA 3UKFA 1DOBA 4JNQA 3NYEA 5EOWA 1D4CA 4DSHA 1LVLA 2YLRA 1PHHA 3UP5A 1S3EA 3NH3X 1GPEA 1TDNA 2XVFA 1JRYA 2XVHA 4EIPA 2BS3A 4D04A 1OJAA 3AE5A 1BKWA 3NRNA 3F8DA 1GREA 5HY5A 1VRQB 1K0LA 2IVEA 2WBAA 2R0CA 2AAQA 4WX1A 4X9NA 4B66A 1IJHA 1TDEA 3FPZA 3QSSA 4J2WA 5FS9A 2Q0KA 4EIQA 1VG0A 2YVJA 3SZFA 3UKQA 3AE7A 1E1NA 3GD3A 3UKPA 3L1RA 3NT6A 3VRBA 3ZYXA 4A7AA 1PN0A 4BK2A 1OJCA 2GR3A 5KRQA 3B3RA 3REDA 4GUVA 2X8GA 1FL2A 2BK4A 2OLOA 3ICRA 3GYJA 3WE0A 3AD9B 2XFUA 4LA1A 2XFPA 1JNZA 1KSUA 2WU5A 2VOUA 1LQUA 4YTNA 2FJAA 3I3LA 4IA5A 1F3PA 2GRTA 2BK3A 1B4VA 4JQ9A 1XPQA 3GYIA 2OLNA 3EPTA 2ZZCA 3K30A 5JRBA 1CJ3A 2GF3A 3QFAA 4IVOB 1XANA 4OPLA 5FMHA 5C3JA 3NGCX 4GDEA 3GYXA 2V5ZA 3AEAA 4HA6A 3AYJA 4WCTA 3SY4A 5JCLA 2V61A 1F6MA 4G6GA 4CBQA 1MOKA 1Y56A 4TM1A 1L9EA 4CY8A 4H4WA 2BS4A 1NG3A 1SEZA 3FG2P 3T14A 2GVCA 2YG3A 4H2QA 2C3DA 1DJNA 1ELIA 1GOSA 4PAAA 4NTCA 1O5WA 3ALMA 2GAHB 3S5WA 2BABA 4OCGA 4U8MA 1ONFA 2WP5A 1PDHA 1TDFA 3KA7A 4YTPA 4EQXA 4J34A 3NHOX 3K7TA 4II3A 3LXDA 1JRXA 3SQPA 3UP4A 2QCUA 1GT8A 3AE9A 1YQ3A 4U8OA 3EAOA 1M64A 3COXA 1IUUA 2Q7VA 1Q1RA 1GRTA 3SZCA 5EB4A 4G74A 2WOIA 3CPIG 1IUVA 1NHRA 2XLSA 1NHPA 3UOXA 1F8SA 4A99A 5KNLA 4OPCA 1DJQA 1YKJA 2XLUA 3KLJA 1Y0PA 2E4GA 1CJ2A 4CNJA 1GEUA 1V59A 2VZ2A 4HB9A 3CGCA 3DJGX 1FEAA 3OZ2A 3HYXA 4GRTA 1N4WA 5KOXA 2A87A 2J3NA 4YWOA 1K0IA 3NYFA 2YR5A 2QAEA 4NEWA 2TMDA 2XDOA 2QA1A 1IUXA 4K8DA 4J33A 5J7XA 1NG4A 1RP0A 2BK5A 3IWAA 3KVEA 1VQWA 4I59A 4NEVA 5TR3A 3QVRA 4GAPA 2GR1A 5U1OA 1S2QA 2R45A 2OA1A 1L9DA 3LADA 4K22A 2XFQA 3NLCA 3VR9A 1O95A 3BI2A 4A65A 3DA1A 2H89A 4RSLA 2VVLA 3GWDA 2IVDA 3K7MX 4KPRA 2WPFA 2F5ZA 2X3NA 4U8PA 2OAMA 1H84A 3G5RA 2GR0A 4CRTA 4X4JA 1EL7A 4C3YA 2NVKX 1AOGA 2C66A 3GMCA 2BC1A 3RP7A 2B9XA 2YG5A 4LU6A 1XHCA 2VQBA 3PS9A 4D03A 3DJDA 3T31A 3AEFA 4REKA 5J60A 1JU2A 2RGOA 3GRTA 1JOAA 3T0KA 4CNKA 4Z2RA 2B7RA 3HYWA 3E1TA 3IHGA 1CC4A 1Y56B 1GNDA 1NAAA 2YR6A 4IVMB 1L0VA 1BZLA 3VRDB 3ICSA 2EQ8A 1GRHA 2C76A 2EQ6A 1LJ1A 4K5RA 4H7UA 4B68A 4C74A 4USQA 2R4JA 2WESA 1KFYA 2BC0A 4U2SA 3D9XA 3CGBA 2E5VA 5LV9A 4J57A 1PBEA 4NTDA 4B64A 2WETA 4RG4A 1H81A 2W0HA 3Q6JA 3FMWA 1PJ7A 1REOA 3D1CA 4Z25A 4JNAA 1IUSA 4OPDA 3AD7B 4H50A 1Q1WA 1H7XA 4JY3A 4B69A 1H6VA 5ER0A 3QJ4A 3AXBA 4J56A 4A79A 4BJYA 4LIIA 4JDRA 1EL8A 4ZN0A 2GQWA 5JCKA 1UKVG 3CTYA 4H4PA 1GRFA 3GMBA 3UTFA 3ABVA 2ACZA 1CC2A 4GDPA 4B65A 4H4QA 2WDRA 2BCGG 2Y6RA 1BGJA 3UKKA 4GCMA 1QO8A 4H2PA 2JB3A 2C4CA 3ALJA 2YLZA 1OJ9A 3JSKA 3URHA 1O94A 4YXDA 1GERA 4EMWA 4YKGA 4G6HA 3UOYA 3II4A 3SYIA 3ICTA 3ZDNA 4H4VA 3AE2A 1JEHA 2VVLG 1H83A 2VRMA 2YWLA 3VRAA 4YSXA 5KVIA 2VQ7A 4Y4MA 4AOXA 1PBDA 4USRA 5JCIA 2C67A 3KPFA 5IQ1A 5BRTA 2YLXA 4DSGA 2C70A 1PXCA 1ZX9A 1X31B 3S61A 1CL0A 1FOHA 4PABA 1E1KA 3SGLA 2BRYA 5BUKA 4EQSA 1KSSA 4FDCB 1PBBA 3SZ0A 2JBVA 3AE8A 4FK1A 4CCQA 3AD8B 1DXLA 1S7MA 4EQWA 3NYCA 3P4QA 3SFDA 3QSEA 1ZP0A 3BHFA 2GEWA 2YG4A 4N9XA 2YLTA 3M13A 3V3OA 3UTEA 4MJWA 1VG9A 2JKCA 2DKIA 3UOZA 2C3CA 1L9CA 4OPIA 3KPKA 3DK9A 3AB1A 4CY6A 2EQ9A 3DMEA 1B37A 1E7PA 1M6IA 3AWIA 1TRBA 2WPEA 2RABA 1KDGA 4Z2TA 2C72A 3B6DA 4U8KA 3H8IA 1DOEA 4J36A 4Z26A 1LV0A 5KMRA 2GR2A 3IF9A 4ICYA 3UKHA 4TLZA 3UTHA 1IUWA 1YQ4A 2WP6A 2BACA 2FJEA 2WDQA 1N4VA 3P9UA 4JN9A 4XXGA 5CQFA 5M0ZA 4FK1C 1GV4A 2YG7A 3BHKA 3DJJA 1KF6A 3CGDA 3HZLA 5BULA 2YVFA 3D8XA 3GDNA 2XLTA 3CNDA 4ECHA 1ZDLA 3I6DA 2RGHA 3UCLA 4B1BA 3V76A 2O9ZA 3BNUA 3C4NA 3K7QX 1OJTA 4H4XA 1FCDA 2B9YA 1LQTA 2B76A 4H2NA 4OPGA 3UOVA 2BCPA 3ITJA 1YQZA 1YY5A 4C77A 1D4DA 3LZWA 3H4KA 5EBKA 1NHSA 2APGA 1GRGA 2X50A 2IIDA 4GAVA 4A5LA 1ZMCA 3DK4A 3L5OA 3R9UA 4OVIA 4AT2A 4U8JA 3Q9TA 5FS7A 5M10A 3NN6X 1LTXR 1GXFA 4EQRA 1GSNA 2CVJA 2GAGB 2X8HA 1QLBA 2B9WA 4UP3A 4U8IA 3M0OA 4O5QA 1HYUA 3P1WA 2E1MA 3F8PA 1CF3A 3ATRA 4IV9A 2JK6A 4IA6A 1PS9A 2XFNA 1B5QA 4KX6A 4TM3A 5EB5A 4J31A 5IPYA 2YLWA 2YVGA 3NIXA 3H8LA 4YT0A 1KN0A 4H4ZA 2ZZ0A 4G9KA 4H4SA 4JY2A 4YTMA 1CHUA 2YM1A 1ZKQA 2R4EA 4UDPA 2V6OA 3KKJA 3C4AA 3CNJA 4A6NA 1BWCA 3CPJG 1H82A 5KMPA 5KOWA 3GD4A 5HYMA 5FS6A 2JB1A 4Z44A 4B63A 2AR8A 1NDAA 1ZK7A 4EMIA 4Z2UA 2VRLA 2PYXA 1IUTA 3C96A 5DBJA 1PBCA 3HYVA 1N4UA 4P9SA 2CFYA 2XVIA 3DK8A 2WDVA 4UDRA 5KXJA 5GRTA 3EF6A 3AYIA 4GF7A 4H4TA 4BURA 2Q0LA 4TM0A 3OC4A 3T2YA 3DH9A 3RP6A 1GALA 1QJDA 4Z24A 1NENA 3ATQA 4YSZA 4U8NA 5U25A 2JAEA 1Q9IA 4XWRA 2R9ZA 1RYIA 4ZCDA 3M12A 4K5SA 4Z43A 5IQ4A 1NHQA 3NK0X 2TPRA 3AEDA 2AQJA 3P4SA 3P4RA 4H4RA 4O5UA 3UKAA 3RNMA 4ADWA 1COYA 4FX9A 4AP1A 1N1PA 2GMJA 3L8KA 3AEBA 2Q6UA 3G5SA 4G73A 3T37A 4BJZA 2GV8A 4M52A 3CNTA 1E39A 1Z6LA 3KD9A 4I58A 4UDQA 1GTHA 3NNEA 1F8WA 2V60A 2H88A 2OALA 5KMQA 1P2HA 1GRBA 4C3XA 4H4UA 1JNRA 5KWFA 1D7LA 1D7YA 3UTGA 3F8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PJ6 A;  3AE1 A;  2B7S A;  2CDU A;  3NG7 X;  1LPF A;  3BNM A;  2XFO A;  2A8X A;  3DGZ A;  2Z5X A;  3AE3 A;  3LJP A;  3VR8 A;  3EAN A;  2WU2 A;  5CKU A;  1F8R A;  3KU9 A;  4H2R A;  3ALL A;  1D5T A;  2WOW A;  3AEC A;  1BF3 A;  1XDI A;  2WPC A;  5HXI A;  1KNR A;  1GES A;  2XCG A;  1PXA A;  1PBF A;  2R0P A;  2EQ7 A;  2WS3 A;  5U63 A;  2CUL A;  1DOD A;  3DJE A;  1NPX A;  4Y4L A;  2QA2 A;  3DGH A;  4BK1 A;  3GWF A;  1GRA A;  3NK1 X;  4C5O A;  4XWZ A;  2XYO A;  3CPH G;  3CIR A;  5L46 A;  2I0Z A;  3CNP A;  4AOS A;  4DNA A;  3AEG A;  1CJC A;  2Z5Y A;  1MXT A;  3BI4 A;  5BVA A;  4A6N B;  3P4P A;  2YAU A;  2X8C A;  1BGN A;  2XVJ A;  2YQU A;  2YM2 A;  4K2X A;  2FJB A;  4APN A;  1ZMD A;  1E1M A;  2BYB A;  2DKH A;  2A89 A;  4OPT A;  2RGJ A;  1B8S A;  1NEK A;  1VDC A;  4AP3 A;  3CNS A;  2BA9 A;  3AE4 A;  4BV6 A;  2FBW A;  4NZH A;  3SFE A;  1EBD A;  4X9M A;  1FEC A;  1TDO A;  4DGK A;  3GSI A;  4YSH A;  3GDP A;  4GR1 A;  5GSN A;  1RSG A;  2PHH A;  4AT0 A;  1GET A;  4NTE A;  1OJD A;  1TYT A;  2GB0 A;  3FBS A;  3O0H A;  4TM4 A;  4U2T A;  4CCR A;  1FEB A;  1CBO A;  1GTE A;  2FJD A;  3NK2 X;  3V3N A;  2UZZ A;  1DNC A;  5JCN A;  3LZX A;  1P2E A;  2HQM A;  5KVH A;  1EL9 A;  3AEE A;  3IHM A;  2X99 A;  3NN0 X;  1DOC A;  1TDK A;  3LOV A;  1ZY8 A;  4A9W A;  1K0J A;  2XLR A;  1ZOY A;  2C65 A;  3GRS A;  4ZCC A;  1ZOV A;  2GH5 A;  2R0G A;  3AYL A;  2XVE A;  3LB8 A;  3IC9 A;  1KNP A;  5JCM A;  3G5Q A;  4EM4 A;  3AE6 A;  2V3B A;  4H4Y A;  2GMH A;  4Y4N A;  2C75 A;  3NKS A;  3SM8 A;  1MO9 A;  5FS8 A;  4YKF A;  1CC6 A;  2WOV A;  2ARD A;  2BXR A;  3NTA A;  1JRZ A;  2BS2 A;  2C7G A;  1TYP A;  2NPX A;  2WEU A;  4B67 A;  3QVP A;  4K7Z A;  3ADA B;  3PO7 A;  3CN8 A;  3ISH A;  2XLP A;  4OPU A;  3CGE A;  2BXS A;  3RP8 A;  1E6E A;  1PJ5 A;  4E0V A;  2R46 A;  2YG6 A;  3NTD A;  1EL5 A;  4EMJ A;  2C64 A;  3QFB A;  5C2T A;  2YR4 A;  5HHF A;  4U2L A;  1CJ4 A;  3VQR A;  3UKL A;  1K4Q A;  4YSY A;  4TLX A;  1D4E A;  3FIM B;  2WHD A;  2V3A A;  2GQF A;  2Y6Q A;  4RG3 A;  4BK3 A;  1E1L A;  1PXB A;  2WP9 A;  3QSM A;  2ZZB A;  4U8L A;  3RHA A;  2VVM A;  2C73 A;  2JB2 A;  1H86 A;  3BI5 A;  1S3B A;  4EM3 A;  3PVC A;  2ZBW A;  2WQY A;  2YLS A;  1S2Y A;  1W4X A;  1H7W A;  3UKF A;  1DOB A;  4JNQ A;  3NYE A;  5EOW A;  1D4C A;  4DSH A;  1LVL A;  2YLR A;  1PHH A;  3UP5 A;  1S3E A;  3NH3 X;  1GPE A;  1TDN A;  2XVF A;  1JRY A;  2XVH A;  4EIP A;  2BS3 A;  4D04 A;  1OJA A;  3AE5 A;  1BKW A;  3NRN A;  3F8D A;  1GRE A;  5HY5 A;  1VRQ B;  1K0L A;  2IVE A;  2WBA A;  2R0C A;  2AAQ A;  4WX1 A;  4X9N A;  4B66 A;  1IJH A;  1TDE A;  3FPZ A;  3QSS A;  4J2W A;  5FS9 A;  2Q0K A;  4EIQ A;  1VG0 A;  2YVJ A;  3UKQ A;  3AE7 A;  1E1N A;  3GD3 A;  3UKP A;  3L1R A;  3NT6 A;  3VRB A;  3ZYX A;  4A7A A;  1PN0 A;  4BK2 A;  1OJC A;  2GR3 A;  5KRQ A;  3B3R A;  3RED A;  4GUV A;  2X8G A;  1FL2 A;  2BK4 A;  2OLO A;  3ICR A;  3GYJ A;  3WE0 A;  3AD9 B;  2XFU A;  4LA1 A;  2XFP A;  1JNZ A;  1KSU A;  2WU5 A;  2VOU A;  1LQU A;  4YTN A;  2FJA A;  3I3L A;  4IA5 A;  1F3P A;  2GRT A;  2BK3 A;  1B4V A;  4JQ9 A;  1XPQ A;  3GYI A;  2OLN A;  3EPT A;  2ZZC A;  3K30 A;  1CJ3 A;  2GF3 A;  4I58 A;  3QFA A;  4IVO B;  1XAN A;  4OPL A;  5FMH A;  5C3J A;  3NGC X;  4GDE A;  2V5Z A;  3AEA A;  4HA6 A;  3AYJ A;  4WCT A;  5JCL A;  2V61 A;  1F6M A;  4CBQ A;  1MOK A;  1Y56 A;  4TM1 A;  1L9E A;  4CY8 A;  4H4W A;  2BS4 A;  1NG3 A;  1SEZ A;  3FG2 P;  2GVC A;  2YG3 A;  4H2Q A;  2C3D A;  1DJN A;  1ELI A;  1GOS A;  4PAA A;  4NTC A;  1O5W A;  3ALM A;  2GAH B;  3S5W A;  2BAB A;  4OCG A;  4U8M A;  1ONF A;  2WP5 A;  1PDH A;  1TDF A;  3KA7 A;  4YTP A;  4EQX A;  4J34 A;  3NHO X;  3K7T A;  3LXD A;  1JRX A;  3SQP A;  3UP4 A;  2QCU A;  1GT8 A;  3AE9 A;  1YQ3 A;  4U8O A;  3EAO A;  1M64 A;  3COX A;  1IUU A;  2Q7V A;  1Q1R A;  1GRT A;  5EB4 A;  2WOI A;  3CPI G;  1IUV A;  1NHR A;  2XLS A;  1NHP A;  3UOX A;  1F8S A;  4A99 A;  4OPC A;  1DJQ A;  1YKJ A;  2XLU A;  3KLJ A;  1Y0P A;  2E4G A;  1CJ2 A;  4CNJ A;  1GEU A;  1V59 A;  2VZ2 A;  4HB9 A;  3CGC A;  3DJG X;  1FEA A;  3OZ2 A;  4GRT A;  1N4W A;  5KOX A;  2A87 A;  2J3N A;  4YWO A;  1K0I A;  3NYF A;  2YR5 A;  2QAE A;  4NEW A;  2TMD A;  2XDO A;  2QA1 A;  1IUX A;  4K8D A;  4J33 A;  5J7X A;  1NG4 A;  1RP0 A;  2BK5 A;  3IWA A;  3KVE A;  1VQW A;  4I59 A;  4NEV A;  5TR3 A;  3QVR A;  2GR1 A;  5U1O A;  1S2Q A;  2R45 A;  2OA1 A;  1L9D A;  3LAD A;  4K22 A;  2XFQ A;  3NLC A;  3VR9 A;  1O95 A;  3BI2 A;  4A65 A;  3DA1 A;  2H89 A;  4RSL A;  2VVL A;  3GWD A;  2IVD A;  3K7M X;  4KPR A;  2WPF A;  2F5Z A;  2X3N A;  4U8P A;  2OAM A;  1H84 A;  3G5R A;  2GR0 A;  4CRT A;  4X4J A;  1EL7 A;  4C3Y A;  2NVK X;  1AOG A;  2C66 A;  3GMC A;  2BC1 A;  3RP7 A;  2B9X A;  2YG5 A;  4LU6 A;  1XHC A;  2VQB A;  3PS9 A;  4D03 A;  3DJD A;  3AEF A;  4REK A;  5J60 A;  1JU2 A;  2RGO A;  3GRT A;  1JOA A;  4CNK A;  4Z2R A;  2B7R A;  3E1T A;  3IHG A;  1CC4 A;  1Y56 B;  1GND A;  1NAA A;  2YR6 A;  4IVM B;  1L0V A;  1BZL A;  3VRD B;  3ICS A;  2EQ8 A;  1GRH A;  2C76 A;  2EQ6 A;  1LJ1 A;  4K5R A;  4H7U A;  4B68 A;  4C74 A;  4USQ A;  2R4J A;  2WES A;  1KFY A;  2BC0 A;  4U2S A;  3CGB A;  2E5V A;  5LV9 A;  4J57 A;  1PBE A;  4NTD A;  4B64 A;  2WET A;  4RG4 A;  1H81 A;  2W0H A;  3Q6J A;  3FMW A;  1PJ7 A;  1REO A;  3D1C A;  4Z25 A;  4JNA A;  1IUS A;  4OPD A;  3AD7 B;  4H50 A;  1Q1W A;  1H7X A;  4JY3 A;  4B69 A;  1H6V A;  5ER0 A;  3QJ4 A;  3AXB A;  4J56 A;  4A79 A;  4BJY A;  4LII A;  4JDR A;  1EL8 A;  4ZN0 A;  2GQW A;  5JCK A;  1UKV G;  3CTY A;  4H4P A;  1GRF A;  3GMB A;  3UTF A;  3ABV A;  2ACZ A;  1CC2 A;  4GDP A;  4B65 A;  4H4Q A;  2WDR A;  2BCG G;  2Y6R A;  1BGJ A;  3UKK A;  4GCM A;  1QO8 A;  4H2P A;  2JB3 A;  3ALJ A;  2YLZ A;  1OJ9 A;  3JSK A;  3URH A;  1O94 A;  4YXD A;  1GER A;  4EMW A;  4YKG A;  3UOY A;  3II4 A;  3ICT A;  3ZDN A;  4H4V A;  3AE2 A;  1JEH A;  2VVL G;  1H83 A;  2VRM A;  2YWL A;  3VRA A;  4YSX A;  5KVI A;  2VQ7 A;  4Y4M A;  4AOX A;  1PBD A;  4USR A;  5JCI A;  2C67 A;  3KPF A;  5IQ1 A;  5BRT A;  2YLX A;  4DSG A;  2C70 A;  1PXC A;  1ZX9 A;  1X31 B;  3S61 A;  1CL0 A;  1FOH A;  4PAB A;  1E1K A;  3SGL A;  5BUK A;  4EQS A;  1KSS A;  4FDC B;  1PBB A;  2JBV A;  3AE8 A;  4FK1 A;  4CCQ A;  3AD8 B;  1DXL A;  3P4Q A;  4EQW A;  3NYC A;  3SFD A;  3QSE A;  1ZP0 A;  3BHF A;  2GEW A;  2YG4 A;  4N9X A;  2YLT A;  3M13 A;  3V3O A;  3UTE A;  4MJW A;  1VG9 A;  2JKC A;  2DKI A;  3UOZ A;  2C3C A;  1L9C A;  4OPI A;  3DK9 A;  3AB1 A;  4CY6 A;  2EQ9 A;  3DME A;  1B37 A;  1E7P A;  1M6I A;  3AWI A;  1TRB A;  2WPE A;  2RAB A;  1KDG A;  4Z2T A;  2C72 A;  3B6D A;  4U8K A;  3H8I A;  1DOE A;  4J36 A;  4Z26 A;  1LV0 A;  2GR2 A;  3IF9 A;  4ICY A;  3UKH A;  4TLZ A;  3UTH A;  1IUW A;  1YQ4 A;  2WP6 A;  2BAC A;  2FJE A;  2WDQ A;  1N4V A;  3P9U A;  4JN9 A;  4XXG A;  5CQF A;  5M0Z A;  4FK1 C;  1GV4 A;  2YG7 A;  3BHK A;  3DJJ A;  1KF6 A;  3CGD A;  3HZL A;  5BUL A;  2YVF A;  3D8X A;  3GDN A;  2XLT A;  3CND A;  4ECH A;  1ZDL A;  3I6D A;  2RGH A;  3UCL A;  4B1B A;  3V76 A;  2O9Z A;  3BNU A;  3C4N A;  3K7Q X;  1OJT A;  4H4X A;  1FCD A;  2B9Y A;  1LQT A;  2B76 A;  4H2N A;  4OPG A;  3UOV A;  2BCP A;  3ITJ A;  1YQZ A;  1YY5 A;  4C77 A;  1D4D A;  3LZW A;  3H4K A;  5EBK A;  1NHS A;  2APG A;  1GRG A;  2X50 A;  2IID A;  4A5L A;  1ZMC A;  3DK4 A;  3R9U A;  4OVI A;  4AT2 A;  4U8J A;  3Q9T A;  5FS7 A;  5M10 A;  3NN6 X;  1LTX R;  1GXF A;  4EQR A;  1GSN A;  2CVJ A;  2GAG B;  2X8H A;  1QLB A;  2B9W A;  4UP3 A;  4U8I A;  3M0O A;  4O5Q A;  1HYU A;  3P1W A;  2E1M A;  3F8P A;  1CF3 A;  3ATR A;  4IV9 A;  2JK6 A;  4IA6 A;  1PS9 A;  2XFN A;  1B5Q A;  4KX6 A;  4TM3 A;  5EB5 A;  4J31 A;  5IPY A;  2YLW A;  2YVG A;  3NIX A;  3H8L A;  4YT0 A;  4H4Z A;  2ZZ0 A;  4H4S A;  4JY2 A;  4YTM A;  1CHU A;  2YM1 A;  1ZKQ A;  2R4E A;  4UDP A;  2V6O A;  3KKJ A;  3C4A A;  3CNJ A;  4A6N A;  1BWC A;  3CPJ G;  1H82 A;  5KOW A;  3GD4 A;  5HYM A;  5FS6 A;  2JB1 A;  4Z44 A;  4B63 A;  2AR8 A;  1NDA A;  1ZK7 A;  4EMI A;  4Z2U A;  2VRL A;  2PYX A;  1IUT A;  3C96 A;  5DBJ A;  1PBC A;  1N4U A;  4P9S A;  2CFY A;  2XVI A;  3DK8 A;  2WDV A;  4UDR A;  5KXJ A;  5GRT A;  3EF6 A;  3AYI A;  4GF7 A;  4H4T A;  4BUR A;  2Q0L A;  4TM0 A;  3OC4 A;  3DH9 A;  3RP6 A;  1GAL A;  1QJD A;  4Z24 A;  1NEN A;  3ATQ A;  4YSZ A;  4U8N A;  5U25 A;  2JAE A;  1Q9I A;  4XWR A;  2R9Z A;  1RYI A;  4ZCD A;  3M12 A;  4K5S A;  4Z43 A;  5IQ4 A;  1NHQ A;  3NK0 X;  2TPR A;  3AED A;  2AQJ A;  3P4S A;  3P4R A;  4H4R A;  4O5U A;  3UKA A;  3RNM A;  4ADW A;  1COY A;  4FX9 A;  4AP1 A;  1N1P A;  2GMJ A;  3L8K A;  3AEB A;  2Q6U A;  3G5S A;  4BJZ A;  3T37 A;  2GV8 A;  4M52 A;  3CNT A;  1E39 A;  1Z6L A;  3KD9 A;  4UDQ A;  1GTH A;  3NNE A;  1F8W A;  2V60 A;  2H88 A;  2OAL A;  1P2H A;  1GRB A;  4C3X A;  4H4U A;  1JNR A;  5KWF A;  1D7L A;  1D7Y A;  3UTG A;  3F8R A; 
#chains in the Genus database with same CATH topology
 2GGH A;  3NG7 X;  1LPF A;  1W6T A;  2A8X A;  3MSY A;  3AE3 A;  1JCT A;  4MMW A;  4H2R A;  3T2K A;  2WOW A;  2OZ3 A;  5HXI A;  2XCG A;  2R0P A;  2PTY A;  1DOD A;  3DJE A;  1NPX A;  4BK1 A;  3SXI A;  3DGH A;  3MKC A;  2I0Z A;  2Z5Y A;  2XVJ A;  1E1M A;  2BYB A;  2DKH A;  5ENL A;  1WYG A;  1EC8 A;  1VDC A;  2PU0 A;  3SFE A;  4X9M A;  1FEC A;  4DGK A;  1RSG A;  2PHH A;  1GET A;  4U2T A;  4CCR A;  1FEB A;  1GTE A;  3NK2 X;  3V3N A;  3LZX A;  1P2E A;  3DG6 A;  1DOC A;  3VCN A;  1K0J A;  4K2S A;  1ZOY A;  4ZOH B;  1ZOV A;  1ELS A;  3CMM A;  3THU A;  3QKE A;  5FJP A;  4EM4 A;  2V3B A;  4Y4N A;  2C75 A;  3NVZ B;  1MNS A;  2BXR A;  2DW6 A;  3ADA B;  3PO7 A;  1H2I A;  3CGE A;  2BXS A;  2XH0 A;  3NTD A;  1EL5 A;  3QFB A;  1XPY A;  2YR4 A;  5HHF A;  1CJ4 A;  1K4Q A;  4YSY A;  4Z17 A;  2WHD A;  2V3A A;  2GQF A;  2Y6Q A;  2ZZB A;  3ZLF A;  5G5H B;  3RHA A;  2C73 A;  4EM3 A;  2FYM A;  3PVC A;  4GIS A;  3OTR A;  4JNQ A;  4JN7 A;  1S3E A;  4H19 A;  2GGE A;  3NRN A;  1GRE A;  1K0L A;  2WBA A;  4WX1 A;  1TDE A;  4J2W A;  5FS9 A;  3UKQ A;  3SR6 B;  3AE7 A;  3R1Z A;  3R07 C;  3VFC A;  4GUV A;  3WE0 A;  2WU5 A;  4YTN A;  2GRT A;  1B4V A;  3DEQ A;  5C3J A;  3NGC X;  4GDE A;  3AEA A;  4WCT A;  4CBQ A;  2ONE A;  1Y56 A;  1L9E A;  4H4W A;  1FO4 A;  2YG3 A;  3S5W A;  2WP5 A;  1PDH A;  3NHO X;  1JRX A;  3STP A;  4MGG A;  1M64 A;  2Q7V A;  5EB4 A;  3PWG A;  2XLS A;  1NHP A;  4A99 A;  1YKJ A;  3RCY A;  7ENL A;  4CNJ A;  3CGC A;  3DJG X;  1FEA A;  1N4W A;  5KOX A;  2J3N A;  3NYF A;  2YR5 A;  2QAE A;  4NEW A;  2XDO A;  4J33 A;  2BK5 A;  3QVR A;  3VC5 A;  2OA1 A;  3LAD A;  2XFQ A;  4RSL A;  2H89 A;  3GWD A;  2HNE A;  2WPF A;  2OAM A;  2GR0 A;  1VQZ A;  1EL7 A;  2C66 A;  3RP7 A;  2B9X A;  3CT2 A;  4LU6 A;  1XHC A;  3PS9 A;  4D03 A;  3DJD A;  3TWA A;  4REK A;  1JU2 A;  3T0K A;  3TWB A;  3E1T A;  1Y56 B;  3K1G A;  1GND A;  1NAA A;  4E4U A;  4IVM B;  1BZL A;  1SB3 B;  2EQ6 A;  3EKG A;  2ZC8 A;  4USQ A;  2R4J A;  4J57 A;  2W0H A;  4Z25 A;  4E8G A;  3R0K A;  3AD7 B;  4H50 A;  3OZM A;  2OPJ A;  1FFU C;  4JDR A;  1EL8 A;  1UKV G;  3CTY A;  1GRF A;  4KEM A;  3I6E A;  4H4Q A;  3B9J B;  3SN0 A;  2JB3 A;  3ALJ A;  2YLZ A;  1OJ9 A;  3JSK A;  2QJN A;  4EMW A;  3ZDN A;  4H4V A;  4YSX A;  2YWL A;  3UJR A;  3OZY A;  1PBD A;  3GO2 A;  5IQ1 A;  4FP1 A;  4A35 A;  5BUK A;  3DGB A;  4EQS A;  1KSS A;  1PBB A;  2JBV A;  1KCZ A;  1DXL A;  4X2P A;  1ZP0 A;  3BHF A;  3V3O A;  2YG4 A;  3M13 A;  2JKC A;  4OPI A;  1L9C A;  3KPK A;  1KDG A;  3B6D A;  4U8K A;  3H8I A;  1DOE A;  4J36 A;  4A6G A;  4Z26 A;  3KUM A;  4H2H A;  4TLZ A;  1IUW A;  4JN9 A;  2P8B A;  2YG7 A;  3DJJ A;  3CGD A;  5BUL A;  4ECH A;  1ZDL A;  4B1B A;  4H2N A;  1FCD A;  2B76 A;  3ZLG A;  1YQZ A;  1D4D A;  5EBK A;  4DYE A;  4A5L A;  4GAV A;  1ZMC A;  4OVI A;  4HCL A;  3NN6 X;  1LTX R;  2GAG B;  4O5Q A;  3F8P A;  1CF3 A;  4IA6 A;  1ONE A;  1B5Q A;  4TM3 A;  4J31 A;  3RGT A;  4YT0 A;  4FI4 A;  2PTW A;  2OKT A;  1ZKQ A;  3C4A A;  1BWC A;  3CPJ G;  4B63 A;  2AR8 A;  4EMI A;  2VRL A;  3HYV A;  5GRT A;  3EF6 A;  4H4T A;  4E5T A;  3OC4 A;  3DH9 A;  1GAL A;  3I6T A;  1FHU A;  1Q9I A;  3RR1 A;  1T3Q C;  4O5U A;  2PGW A;  4AP1 A;  1N1P A;  3G5S A;  4G73 A;  2Q6U A;  4BJZ A;  3T37 A;  3KD9 A;  1Z6L A;  3NNE A;  2OAL A;  3UJS A;  3Q45 A;  1MRA A;  2XGZ A;  4C3X A;  4H4U A;  1D7L A;  2OZ8 A;  3DES A;  3MY9 A;  2CDU A;  3UCD A;  3DGZ A;  2DW7 A;  3R11 A;  2WU2 A;  3NS1 B;  1F8R A;  1D5T A;  3AEC A;  2WPC A;  1GES A;  1PBF A;  2EQ7 A;  5U63 A;  4G7F A;  4IL2 A;  4Y4L A;  3SZW A;  1GRA A;  4C5O A;  4XWZ A;  2OLA A;  5BOF A;  5J04 A;  2XYO A;  4DNA A;  2POD A;  3AEG A;  3R0U A;  1CJC A;  1MXT A;  2YM2 A;  4II2 A;  4K2X A;  2GSH A;  4HN8 A;  1B8S A;  1L8P A;  3CNS A;  2BA9 A;  4AP3 A;  3AE4 A;  1TKK A;  3GSI A;  4GR1 A;  4IP4 A;  4NTE A;  5FJR A;  2GB0 A;  3FBS A;  1CBO A;  2FJD A;  2HXT A;  1EL9 A;  3IHM A;  3DFY A;  3GRS A;  1R6W A;  4HNL A;  2GH5 A;  3AYL A;  1P48 A;  5JCM A;  3AE6 A;  4H4Y A;  3NKS A;  3SM8 A;  1MO9 A;  5FS8 A;  2WOV A;  3PWI A;  5FJT A;  1JRZ A;  1TYP A;  3ISH A;  2XLP A;  3RP8 A;  3NO1 A;  4E0V A;  2YG6 A;  1R0M A;  2C64 A;  3T2Z A;  5C2T A;  4U2L A;  2P8C A;  3AM9 A;  4BK3 A;  3BI5 A;  1S3B A;  1S2Y A;  1W4X A;  1WUF A;  5EOW A;  3RO6 A;  1D4C A;  3UP5 A;  3NH3 X;  1GPE A;  2XVF A;  4EIP A;  1BKW A;  3A7R A;  2IVE A;  2AAQ A;  1N60 C;  3R25 A;  2P3Z A;  1SJA A;  1VG0 A;  2YVJ A;  2QJM A;  1WUE A;  4A7A A;  4BK2 A;  3VRB A;  2GGJ A;  5KRQ A;  3B3R A;  3GYJ A;  3AD9 B;  2XFU A;  3CAW A;  1JNZ A;  3MQT A;  4JHM A;  2BK3 A;  3UJE A;  4JQ9 A;  3UGV A;  1XPQ A;  3EPT A;  4I58 A;  4ZN0 A;  5JRB A;  4OPL A;  1IYX A;  1PDZ A;  3AYJ A;  4G6G A;  3UJF A;  4TM1 A;  2W3S A;  1DJN A;  4PAA A;  4NTC A;  1TZZ A;  2QDD A;  4U8M A;  4ZCW A;  4YTP A;  4J34 A;  1NEL A;  3K7T A;  4II3 A;  3LXD A;  1N63 C;  1GT8 A;  4IZG A;  2QCU A;  2PGE A;  4U8O A;  3EAO A;  1IUU A;  1GRT A;  3SZC A;  5G5G B;  4HCH A;  3JW7 A;  1NHR A;  3UOX A;  1V59 A;  2GGI A;  2MNR A;  3HYX A;  1NU5 A;  4YWO A;  1K0I A;  1X2G A;  5J7X A;  1RP0 A;  3FYY A;  3IWA A;  3QLD A;  2GR1 A;  5U1O A;  2PP3 A;  1OEP A;  4K22 A;  1JRO A;  3DA1 A;  2OVL A;  2VVL A;  2IVD A;  4KPR A;  1H84 A;  3H8A A;  1ECQ A;  2YG5 A;  1JOA A;  3N4E A;  2EQ8 A;  3T9P A;  4K5R A;  4MKS A;  4B68 A;  3D9X A;  5LV9 A;  1H81 A;  1REO A;  3NFU A;  1Q1W A;  4JY3 A;  4B69 A;  3DFH A;  1H6V A;  3SN1 A;  4A79 A;  2GQW A;  5EU9 A;  5JCK A;  3D46 A;  3UTF A;  3ABV A;  4GDP A;  4B65 A;  2Y6R A;  3UKK A;  1BGJ A;  1QO8 A;  1DTN A;  4TVY A;  5FJO A;  4GGH A;  3ICT A;  2QJJ A;  3AE2 A;  1JEH A;  1H83 A;  2VRM A;  4Y4M A;  3FXG A;  2C67 A;  5BRT A;  2YLX A;  2C70 A;  2P0I A;  1CL0 A;  4IHC A;  4FDC B;  4KWS A;  3P4Q A;  3SFD A;  3QSE A;  2GEW A;  2XH2 A;  2YLT A;  4MJW A;  3UOZ A;  3CB3 A;  1JDF A;  1B37 A;  1E7P A;  1M6I A;  2WPE A;  3T4W A;  2GR2 A;  3IF9 A;  4ICY A;  1FHV A;  1YQ4 A;  2BAC A;  2WDQ A;  1N4V A;  5CQF A;  5M0Z A;  4FK1 C;  1GV4 A;  3BHK A;  3UXK A;  3HZL A;  3I6D A;  3UCL A;  3BNU A;  3K7Q X;  1OJT A;  4H4X A;  3U4F A;  2B9Y A;  1XS2 A;  2BCP A;  3ITJ A;  4C77 A;  1YY5 A;  3N6J A;  2PTZ A;  2CHR A;  1GRG A;  4HPN A;  3L5O A;  3DK4 A;  4GFI A;  3R9U A;  4AT2 A;  4U8J A;  3SN4 A;  5FS7 A;  1KKO A;  1GXF A;  2X8H A;  3P1W A;  2E1M A;  3ATR A;  3CXO A;  5EB5 A;  2YLW A;  4JY2 A;  4YTM A;  2R4E A;  3NVW B;  4A6N A;  3GD4 A;  5FS6 A;  4DWD A;  1NDA A;  2PYX A;  5DBJ A;  3FJ4 A;  2XVI A;  4TM0 A;  3ES8 A;  1NEN A;  3ATQ A;  4TVW A;  4XWR A;  1RYI A;  1NHQ A;  3UKA A;  4KT2 A;  4A3R A;  3S5S A;  2V60 A;  5KMQ A;  1P2H A;  1GRB A;  1JNR A;  1N61 C;  3TQP A;  3AE1 A;  2XFO A;  3EAN A;  3ALL A;  1BF3 A;  1KNR A;  2RDX A;  2W55 A;  4M0X A;  3IJL A;  3GWF A;  5FJU A;  3CPH G;  3CIR A;  3PG6 A;  3RIT A;  4A6N B;  3P4P A;  2YAU A;  2X8C A;  5KMS A;  4APN A;  1ZMD A;  3P93 A;  2A89 A;  3FVD A;  1E9I A;  2RGJ A;  4BV6 A;  1EBD A;  3GDP A;  5GSN A;  1N62 C;  1TYT A;  3O0H A;  4TM4 A;  1DNC A;  5JCN A;  5KVH A;  3R10 A;  2GDQ A;  4G8T A;  1TDK A;  1ZY8 A;  4A9W A;  2E5A A;  2XLR A;  2C65 A;  4ZCC A;  4NNJ A;  3PFR A;  3IC9 A;  1KNP A;  3SJN A;  3G5Q A;  2GMH A;  3FV9 A;  3NTA A;  2C7G A;  2NPX A;  3QVP A;  1JPD X;  3CN8 A;  4OPU A;  1E6E A;  1PJ5 A;  3N4F A;  4EMJ A;  4GYP A;  3TCS A;  1FFV C;  3VQR A;  2BRA A;  3UKL A;  4TLX A;  1D4E A;  3QTP A;  3FIM B;  4RG3 A;  1E1L A;  2WP9 A;  3T8Q A;  4U8L A;  2JB2 A;  1H86 A;  2ZBW A;  2WQY A;  2YLS A;  4H83 A;  3ZVH A;  2YLR A;  4DSH A;  1JRY A;  2XVH A;  2W3R A;  3AE5 A;  3IJI A;  3DDM A;  3F8D A;  2R0C A;  3CXB A;  4X9N A;  4B66 A;  3FPZ A;  4EIQ A;  2FKP A;  3L1R A;  3ZYX A;  2W54 A;  3RED A;  2OLO A;  2XFP A;  2VOU A;  1LQU A;  2FJA A;  3I3L A;  4GIR A;  1XAN A;  2PSN A;  2PCE A;  1SJC A;  1MDR A;  5JCL A;  4CY8 A;  3FG2 P;  3JVA A;  3T14 A;  3HW2 A;  3ENL A;  2C3D A;  1ELI A;  1GOS A;  3ALM A;  1ONF A;  2AKZ A;  1TDF A;  2OG9 A;  4EQX A;  4H1Z A;  3SQP A;  3AE9 A;  3COX A;  4IL0 A;  1Q1R A;  4G74 A;  2WOI A;  1IUV A;  3UJ2 A;  4OPC A;  3KLJ A;  2E4G A;  3T6C A;  3OPS A;  1GEU A;  2VZ2 A;  3ZVH B;  3OZ2 A;  1TE6 A;  3D47 A;  4GRT A;  2A87 A;  2QA1 A;  1IUX A;  4K8D A;  1NG4 A;  3KVE A;  4NEV A;  4GAP A;  1S2Q A;  3NLC A;  3VR9 A;  1RVK A;  3K7M X;  1JRP A;  4U8P A;  2X3N A;  4X4J A;  4C3Y A;  2NVK X;  1AOG A;  3EEZ A;  3MUC A;  3BJS A;  3BSM A;  2ZAD A;  3T31 A;  2RGO A;  4Z2R A;  2B7R A;  3HYW A;  3IHG A;  3NVV B;  1L0V A;  3ICS A;  2C76 A;  4H7U A;  3PK7 A;  4C74 A;  3HRD C;  4HCD A;  3CGB A;  4B64 A;  2WET A;  1SJD A;  4RG4 A;  1MUC A;  1PJ7 A;  3DG3 A;  1IUS A;  2OO6 A;  4OPD A;  1H7X A;  4ZA0 A;  3AXB A;  4BJY A;  4JN8 A;  1X2H A;  4H4P A;  5IDZ A;  2OX4 A;  4GCM A;  3AN1 A;  3A7U A;  4H2P A;  1PDY A;  4K8G A;  4YXD A;  1GER A;  3Q4D A;  4YKG A;  3II4 A;  3SYI A;  1EBG A;  3VRA A;  4DX3 A;  4DSG A;  1ZX9 A;  3S61 A;  4PAB A;  3SGL A;  3DIP A;  2BRY A;  3QN3 A;  4CCQ A;  4EQW A;  3UTE A;  4N9X A;  3V3W A;  1VG9 A;  2DKI A;  3V5F A;  2EQ9 A;  3DME A;  4DXK A;  1TRB A;  2RAB A;  4Z2T A;  2C72 A;  4J1O A;  1LV0 A;  4F4R A;  3UKH A;  3MZN A;  2POZ A;  2XH4 A;  1KKR A;  1N5W C;  2QDE A;  2YVF A;  3GDN A;  2XLT A;  3CND A;  4ENL A;  3UOV A;  3LZW A;  2AKM A;  2X50 A;  2IID A;  3Q9T A;  4EQR A;  1GSN A;  4UP3 A;  1QLB A;  3N6H A;  3M0O A;  1HYU A;  4IV9 A;  3A7A A;  1PS9 A;  2XFN A;  2OQY A;  2GGG A;  3NIX A;  3IK4 A;  1KN0 A;  2ZZ0 A;  4KPL A;  4G9K A;  4H4S A;  2YM1 A;  4UDP A;  3KKJ A;  3CNJ A;  5KMP A;  3OW1 A;  2JB1 A;  1ZK7 A;  3C96 A;  4P9S A;  4UDR A;  2WDV A;  3AYI A;  2Q0L A;  3T2Y A;  3AMZ A;  4EWJ A;  1QJD A;  4Z24 A;  4YSZ A;  4E4F A;  4U8N A;  5U25 A;  2JAE A;  4ZCD A;  4Z43 A;  5IQ4 A;  3P4R A;  2AQJ A;  4H4R A;  4ADW A;  2GMJ A;  3L8K A;  4M52 A;  1E39 A;  4UDQ A;  2QQ6 A;  1F8W A;  2H88 A;  4GYP C;  2QVH A;  1D7Y A;  1PJ6 A;  2B7S A;  2OFJ A;  3BNM A;  2Z5X A;  3LJP A;  3VR8 A;  5CKU A;  3KU9 A;  1XDI A;  1EC7 A;  3ZLH A;  1PXA A;  5BOE A;  2WS3 A;  2CUL A;  2QA2 A;  3NK1 X;  2PA6 A;  5L46 A;  3CNP A;  4AOS A;  3BI4 A;  5BVA A;  3JZU A;  1BGN A;  2YQU A;  3V4B A;  3GC2 A;  2FJB A;  1JPM A;  3H70 A;  4OPT A;  4ROP A;  4M6U A;  1NEK A;  2FBW A;  4NZH A;  1TDO A;  3TJI A;  4YSH A;  3V5C A;  3U9I A;  2HZG A;  4AT0 A;  1MDL A;  3TOY A;  1OJD A;  2I5Q A;  4NWZ A;  2UZZ A;  2HQM A;  3EUB 3;  3AEE A;  2X99 A;  3NN0 X;  3LOV A;  2PP1 A;  2R0G A;  2XVE A;  3LB8 A;  4Z1Y A;  4YKF A;  1CC6 A;  3SX6 A;  2ARD A;  1FIQ B;  1SJB A;  2WEU A;  2BS2 A;  4B67 A;  4K7Z A;  1P43 A;  2R46 A;  1EBH A;  3NVY B;  3VCC A;  2XH7 A;  1PXB A;  2OQH A;  3DG7 A;  1N5X A;  3QSM A;  2PU1 A;  2VVM A;  2O56 A;  1H7W A;  3UKF A;  1DOB A;  3CYJ A;  3TJ4 A;  3NYE A;  3FCP A;  1LVL A;  1PHH A;  1TDN A;  3DER A;  2BS3 A;  4D04 A;  1OJA A;  3UXL A;  5HY5 A;  1VRQ B;  4GME A;  1IJH A;  3QSS A;  2Q0K A;  3CK5 A;  3SZF A;  3VDG A;  1E1N A;  3GD3 A;  3UKP A;  3NT6 A;  1PN0 A;  1OJC A;  2GR3 A;  2X8G A;  1FL2 A;  2BK4 A;  3ICR A;  4LA1 A;  1KSU A;  4IA5 A;  1F3P A;  3GYI A;  2OLN A;  4IVO B;  2ZZC A;  3K30 A;  1CJ3 A;  3QPE A;  3UCC A;  3QFA A;  2GF3 A;  5FMH A;  2PP0 A;  3GYX A;  2V5Z A;  4HA6 A;  3SY4 A;  2V61 A;  1F6M A;  1MOK A;  2AL2 A;  2BS4 A;  1NG3 A;  1SEZ A;  2GVC A;  4H2Q A;  3GY1 A;  1O5W A;  2GAH B;  2BAB A;  4OCG A;  1BQG A;  1VDV A;  3ES7 A;  3KA7 A;  4IT1 A;  1EC9 A;  4IP5 A;  3UP4 A;  1YQ3 A;  2XSX A;  2PTX A;  3NXL A;  4HNC A;  4DHG A;  3NRZ B;  3CPI G;  5KNL A;  1F8S A;  3MWC A;  1DJQ A;  4K1W A;  2XLU A;  1Y0P A;  1CJ2 A;  4HB9 A;  3H7V A;  2TMD A;  4I59 A;  1VQW A;  5TR3 A;  2R45 A;  1L9D A;  4A65 A;  1O95 A;  3BI2 A;  2E3T A;  3RRA A;  2F5Z A;  3G5R A;  2GL5 A;  4CRT A;  4HYR A;  3GMC A;  2BC1 A;  2VQB A;  3AEF A;  5J60 A;  3S47 A;  4CNK A;  3H12 A;  3GRT A;  1BKH A;  1CC4 A;  2AL2 B;  2YR6 A;  3BOX A;  3SBF A;  3VRD B;  1GRH A;  1LJ1 A;  2WES A;  1KFY A;  2BC0 A;  4U2S A;  4DN1 A;  2E5V A;  1PBE A;  4NTD A;  2PS2 A;  3Q6J A;  3FMW A;  3D1C A;  4JNA A;  3SQS A;  5ER0 A;  3QJ4 A;  2NQL A;  4J56 A;  3I4K A;  2P88 A;  4LII A;  3VC6 A;  3GMB A;  2ACZ A;  1CC2 A;  2WDR A;  2BCG G;  2C4C A;  3URH A;  1O94 A;  2AL1 A;  4G6H A;  3UOY A;  2PMQ A;  2VVL G;  1YEY A;  5KVI A;  2VQ7 A;  4AOX A;  4USR A;  5JCI A;  3KPF A;  1PXC A;  1X31 B;  1FOH A;  3TW9 A;  1E1K A;  3SZ0 A;  3AE8 A;  4FK1 A;  3VA8 A;  3AD8 B;  1S7M A;  3NYC A;  2PPG A;  3SSZ A;  2C3C A;  3DK9 A;  3AB1 A;  4CY6 A;  3AWI A;  2OZT A;  3TTE A;  3ETR B;  5KMR A;  3NZG A;  3UTH A;  2WP6 A;  2FJE A;  3P9U A;  4XXG A;  3GD6 A;  2MUC A;  4GGB A;  1KF6 A;  3D8X A;  2RGH A;  3V76 A;  2O9Z A;  3C4N A;  4OPG A;  1LQT A;  3H4K A;  1NHS A;  1STZ A;  2APG A;  3B97 A;  5M10 A;  3IJQ A;  2CVJ A;  1ZXI C;  2B9W A;  3HPF A;  4U8I A;  2JK6 A;  4KX6 A;  3OP2 A;  4YWS A;  5IPY A;  2YVG A;  3H8L A;  4H4Z A;  6ENL A;  2QGY A;  1CHU A;  2V6O A;  1H82 A;  5KOW A;  5HYM A;  4Z44 A;  4Z2U A;  1IUT A;  1PBC A;  1N4U A;  2CFY A;  3ZVI A;  1RM6 B;  3DK8 A;  5KXJ A;  4GF7 A;  4BUR A;  3RP6 A;  1KD0 A;  3P0W A;  2R9Z A;  3P3B A;  3M12 A;  4K5S A;  3NK0 X;  2TPR A;  3AED A;  3P4S A;  2HXU A;  3RNM A;  1COY A;  4FX9 A;  4J3Z A;  3AEB A;  4E6M A;  1V97 A;  2GV8 A;  3CNT A;  1GTH A;  5KWF A;  1F9C A;  3UTG A;  3F8R A; 
#chains in the Genus database with same CATH homology
 1PJ6 A;  3AE1 A;  2B7S A;  2CDU A;  3NG7 X;  1LPF A;  3BNM A;  2XFO A;  2A8X A;  3DGZ A;  2Z5X A;  3AE3 A;  3LJP A;  3VR8 A;  3EAN A;  2WU2 A;  5CKU A;  1F8R A;  3KU9 A;  4H2R A;  3ALL A;  3T2K A;  1D5T A;  2WOW A;  3AEC A;  1BF3 A;  1XDI A;  2WPC A;  5HXI A;  1KNR A;  1GES A;  2XCG A;  1PXA A;  1PBF A;  2R0P A;  2EQ7 A;  2WS3 A;  5U63 A;  2CUL A;  1DOD A;  3DJE A;  1NPX A;  4Y4L A;  2QA2 A;  3DGH A;  3SXI A;  3SZW A;  3GWF A;  1GRA A;  3NK1 X;  4BK1 A;  4C5O A;  4XWZ A;  2XYO A;  3CPH G;  3CIR A;  5L46 A;  2I0Z A;  3PG6 A;  3CNP A;  4AOS A;  4DNA A;  3AEG A;  1CJC A;  2Z5Y A;  1MXT A;  3BI4 A;  5BVA A;  4A6N B;  3P4P A;  2YAU A;  2X8C A;  1BGN A;  2XVJ A;  2YQU A;  2YM2 A;  4II2 A;  5KMS A;  4K2X A;  2FJB A;  4APN A;  1ZMD A;  1E1M A;  2BYB A;  2DKH A;  2A89 A;  4OPT A;  2RGJ A;  1B8S A;  1NEK A;  1VDC A;  4AP3 A;  3CNS A;  2BA9 A;  3AE4 A;  4BV6 A;  2FBW A;  4NZH A;  3SFE A;  1EBD A;  4X9M A;  1FEC A;  1TDO A;  4DGK A;  3GSI A;  4YSH A;  3GDP A;  4GR1 A;  5GSN A;  1RSG A;  2PHH A;  4AT0 A;  1GET A;  4NTE A;  1OJD A;  1TYT A;  2GB0 A;  3FBS A;  4NWZ A;  3O0H A;  4TM4 A;  4U2T A;  4CCR A;  1FEB A;  1CBO A;  1GTE A;  2FJD A;  3NK2 X;  3V3N A;  2UZZ A;  1DNC A;  5JCN A;  3LZX A;  1P2E A;  2HQM A;  5KVH A;  1EL9 A;  3AEE A;  3IHM A;  2X99 A;  3NN0 X;  1DOC A;  1TDK A;  3LOV A;  1ZY8 A;  4A9W A;  1K0J A;  2XLR A;  1ZOY A;  2C65 A;  3GRS A;  4ZCC A;  1ZOV A;  2GH5 A;  4NNJ A;  2R0G A;  3AYL A;  3CMM A;  2XVE A;  3LB8 A;  3IC9 A;  1KNP A;  5JCM A;  3G5Q A;  4EM4 A;  3AE6 A;  2V3B A;  4H4Y A;  2GMH A;  4Y4N A;  2C75 A;  3NKS A;  3SM8 A;  1MO9 A;  5FS8 A;  4YKF A;  1CC6 A;  3SX6 A;  2WOV A;  2ARD A;  2BXR A;  3NTA A;  1JRZ A;  2BS2 A;  2C7G A;  1TYP A;  2NPX A;  2WEU A;  4B67 A;  3QVP A;  4K7Z A;  3ADA B;  3PO7 A;  1H2I A;  3CN8 A;  3ISH A;  2XLP A;  4OPU A;  3CGE A;  2BXS A;  3RP8 A;  1E6E A;  1PJ5 A;  4E0V A;  2R46 A;  2YG6 A;  3NTD A;  1EL5 A;  4EMJ A;  2C64 A;  3QFB A;  3T2Z A;  5C2T A;  2YR4 A;  5HHF A;  4U2L A;  1CJ4 A;  3VQR A;  2BRA A;  3UKL A;  1K4Q A;  4YSY A;  4TLX A;  1D4E A;  3FIM B;  2WHD A;  2V3A A;  2GQF A;  2Y6Q A;  4RG3 A;  4BK3 A;  1E1L A;  1PXB A;  2WP9 A;  3QSM A;  2ZZB A;  4U8L A;  3RHA A;  2VVM A;  2C73 A;  2JB2 A;  1H86 A;  3BI5 A;  1S3B A;  4EM3 A;  3PVC A;  2ZBW A;  2WQY A;  2YLS A;  1S2Y A;  1W4X A;  1H7W A;  3UKF A;  1DOB A;  4JNQ A;  3NYE A;  5EOW A;  1D4C A;  4DSH A;  1LVL A;  2YLR A;  1PHH A;  3UP5 A;  1S3E A;  3NH3 X;  1GPE A;  1TDN A;  2XVF A;  1JRY A;  2XVH A;  4EIP A;  2BS3 A;  4D04 A;  1OJA A;  3AE5 A;  1BKW A;  3NRN A;  3F8D A;  1GRE A;  5HY5 A;  1VRQ B;  1K0L A;  2IVE A;  2WBA A;  2R0C A;  2AAQ A;  4WX1 A;  4X9N A;  4B66 A;  1IJH A;  1TDE A;  3FPZ A;  3QSS A;  4J2W A;  5FS9 A;  2Q0K A;  4EIQ A;  1VG0 A;  2YVJ A;  3SZF A;  3UKQ A;  3AE7 A;  1E1N A;  3GD3 A;  3UKP A;  3L1R A;  3NT6 A;  3VRB A;  3ZYX A;  4A7A A;  1PN0 A;  4BK2 A;  1OJC A;  2GR3 A;  5KRQ A;  3B3R A;  3RED A;  4GUV A;  2X8G A;  1FL2 A;  2BK4 A;  2OLO A;  3ICR A;  3GYJ A;  3WE0 A;  3AD9 B;  2XFU A;  4LA1 A;  2XFP A;  1JNZ A;  1KSU A;  2WU5 A;  2VOU A;  1LQU A;  4YTN A;  2FJA A;  3I3L A;  4IA5 A;  1F3P A;  2GRT A;  2BK3 A;  1B4V A;  4JQ9 A;  1XPQ A;  3GYI A;  2OLN A;  3EPT A;  2ZZC A;  3K30 A;  5JRB A;  1CJ3 A;  2GF3 A;  3QFA A;  4IVO B;  1XAN A;  4OPL A;  5FMH A;  5C3J A;  3NGC X;  4GDE A;  3GYX A;  2V5Z A;  3AEA A;  4HA6 A;  3AYJ A;  4WCT A;  3SY4 A;  5JCL A;  2V61 A;  1F6M A;  4G6G A;  4CBQ A;  1MOK A;  1Y56 A;  4TM1 A;  1L9E A;  4CY8 A;  4H4W A;  2BS4 A;  1NG3 A;  1SEZ A;  3FG2 P;  3T14 A;  2GVC A;  2YG3 A;  4H2Q A;  2C3D A;  1DJN A;  1ELI A;  1GOS A;  4PAA A;  4NTC A;  1O5W A;  3ALM A;  2GAH B;  3S5W A;  2BAB A;  4OCG A;  4U8M A;  1ONF A;  2WP5 A;  1PDH A;  1TDF A;  3KA7 A;  4YTP A;  4EQX A;  4J34 A;  3NHO X;  3K7T A;  4II3 A;  3LXD A;  1JRX A;  3SQP A;  3UP4 A;  2QCU A;  1GT8 A;  3AE9 A;  1YQ3 A;  4U8O A;  3EAO A;  1M64 A;  3COX A;  1IUU A;  2Q7V A;  1Q1R A;  1GRT A;  3SZC A;  5EB4 A;  4G74 A;  2WOI A;  3CPI G;  1IUV A;  1NHR A;  2XLS A;  1NHP A;  3UOX A;  1F8S A;  4A99 A;  5KNL A;  4OPC A;  1DJQ A;  1YKJ A;  2XLU A;  3KLJ A;  1Y0P A;  2E4G A;  1CJ2 A;  4CNJ A;  1GEU A;  1V59 A;  2VZ2 A;  4HB9 A;  3CGC A;  3DJG X;  1FEA A;  3OZ2 A;  3HYX A;  4GRT A;  1N4W A;  5KOX A;  2A87 A;  2J3N A;  4YWO A;  1K0I A;  3NYF A;  2YR5 A;  2QAE A;  4NEW A;  2TMD A;  2XDO A;  2QA1 A;  1IUX A;  4K8D A;  4J33 A;  5J7X A;  1NG4 A;  1RP0 A;  2BK5 A;  3IWA A;  3KVE A;  1VQW A;  4I59 A;  4NEV A;  5TR3 A;  3QVR A;  4GAP A;  2GR1 A;  5U1O A;  1S2Q A;  2R45 A;  2OA1 A;  1L9D A;  3LAD A;  4K22 A;  2XFQ A;  3NLC A;  3VR9 A;  1O95 A;  3BI2 A;  4A65 A;  3DA1 A;  2H89 A;  4RSL A;  2VVL A;  3GWD A;  2IVD A;  3K7M X;  4KPR A;  2WPF A;  2F5Z A;  2X3N A;  4U8P A;  2OAM A;  1H84 A;  3G5R A;  2GR0 A;  4CRT A;  4X4J A;  1EL7 A;  4C3Y A;  2NVK X;  1AOG A;  2C66 A;  3GMC A;  2BC1 A;  3RP7 A;  2B9X A;  2YG5 A;  4LU6 A;  1XHC A;  2VQB A;  3PS9 A;  4D03 A;  3DJD A;  3T31 A;  3AEF A;  4REK A;  5J60 A;  1JU2 A;  2RGO A;  3GRT A;  1JOA A;  3T0K A;  4CNK A;  4Z2R A;  2B7R A;  3HYW A;  3E1T A;  3IHG A;  1CC4 A;  1Y56 B;  1GND A;  1NAA A;  2YR6 A;  4IVM B;  1L0V A;  1BZL A;  3VRD B;  3ICS A;  2EQ8 A;  1GRH A;  2C76 A;  2EQ6 A;  1LJ1 A;  4K5R A;  4H7U A;  4B68 A;  4C74 A;  4USQ A;  2R4J A;  2WES A;  1KFY A;  2BC0 A;  4U2S A;  3D9X A;  3CGB A;  2E5V A;  5LV9 A;  4J57 A;  1PBE A;  4NTD A;  4B64 A;  2WET A;  4RG4 A;  1H81 A;  2W0H A;  3Q6J A;  3FMW A;  1PJ7 A;  1REO A;  3D1C A;  4Z25 A;  4JNA A;  1IUS A;  4OPD A;  3AD7 B;  4H50 A;  1Q1W A;  1H7X A;  4JY3 A;  4B69 A;  1H6V A;  5ER0 A;  3QJ4 A;  3AXB A;  4J56 A;  4A79 A;  4BJY A;  4LII A;  4JDR A;  1EL8 A;  4ZN0 A;  2GQW A;  5JCK A;  1UKV G;  3CTY A;  4H4P A;  1GRF A;  3GMB A;  3UTF A;  3ABV A;  2ACZ A;  1CC2 A;  4GDP A;  4B65 A;  4H4Q A;  2WDR A;  2BCG G;  2Y6R A;  1BGJ A;  3UKK A;  4GCM A;  1QO8 A;  4H2P A;  2JB3 A;  2C4C A;  3ALJ A;  2YLZ A;  1OJ9 A;  3JSK A;  3URH A;  1O94 A;  4YXD A;  1GER A;  4EMW A;  4YKG A;  4G6H A;  3UOY A;  3II4 A;  3SYI A;  3ICT A;  3ZDN A;  4H4V A;  3AE2 A;  1JEH A;  2VVL G;  1H83 A;  2VRM A;  2YWL A;  3VRA A;  4YSX A;  5KVI A;  2VQ7 A;  4Y4M A;  4AOX A;  1PBD A;  4USR A;  5JCI A;  2C67 A;  3KPF A;  5IQ1 A;  5BRT A;  2YLX A;  4DSG A;  2C70 A;  1PXC A;  1ZX9 A;  1X31 B;  3S61 A;  1CL0 A;  1FOH A;  4PAB A;  1E1K A;  3SGL A;  2BRY A;  5BUK A;  4EQS A;  1KSS A;  4FDC B;  1PBB A;  3SZ0 A;  2JBV A;  3AE8 A;  4FK1 A;  4CCQ A;  3AD8 B;  1DXL A;  1S7M A;  4EQW A;  3NYC A;  3P4Q A;  3SFD A;  3QSE A;  1ZP0 A;  3BHF A;  2GEW A;  2YG4 A;  4N9X A;  2YLT A;  3M13 A;  3V3O A;  3UTE A;  4MJW A;  1VG9 A;  2JKC A;  2DKI A;  3UOZ A;  2C3C A;  1L9C A;  4OPI A;  3KPK A;  3DK9 A;  3AB1 A;  4CY6 A;  2EQ9 A;  3DME A;  1B37 A;  1E7P A;  1M6I A;  3AWI A;  1TRB A;  2WPE A;  2RAB A;  1KDG A;  4Z2T A;  2C72 A;  3B6D A;  4U8K A;  3H8I A;  1DOE A;  4J36 A;  4Z26 A;  1LV0 A;  5KMR A;  2GR2 A;  3IF9 A;  4ICY A;  3UKH A;  4TLZ A;  3UTH A;  1IUW A;  1YQ4 A;  2WP6 A;  2BAC A;  2FJE A;  2WDQ A;  1N4V A;  3P9U A;  4JN9 A;  4XXG A;  5CQF A;  5M0Z A;  4FK1 C;  1GV4 A;  2YG7 A;  3BHK A;  3DJJ A;  1KF6 A;  3CGD A;  3HZL A;  5BUL A;  2YVF A;  3D8X A;  3GDN A;  2XLT A;  3CND A;  4ECH A;  1ZDL A;  3I6D A;  2RGH A;  3UCL A;  4B1B A;  3V76 A;  2O9Z A;  3BNU A;  3C4N A;  3K7Q X;  1OJT A;  4H4X A;  1FCD A;  2B9Y A;  1LQT A;  2B76 A;  4H2N A;  4OPG A;  3UOV A;  2BCP A;  3ITJ A;  1YQZ A;  1YY5 A;  4C77 A;  1D4D A;  3LZW A;  3H4K A;  5EBK A;  1NHS A;  2APG A;  1GRG A;  2X50 A;  2IID A;  4GAV A;  4A5L A;  1ZMC A;  3DK4 A;  3L5O A;  3R9U A;  4OVI A;  4AT2 A;  4U8J A;  3Q9T A;  5FS7 A;  5M10 A;  3NN6 X;  1LTX R;  1GXF A;  4EQR A;  1GSN A;  2CVJ A;  2GAG B;  2X8H A;  1QLB A;  2B9W A;  4UP3 A;  4U8I A;  3M0O A;  4O5Q A;  1HYU A;  3P1W A;  2E1M A;  3F8P A;  1CF3 A;  3ATR A;  4IV9 A;  2JK6 A;  4IA6 A;  1PS9 A;  2XFN A;  1B5Q A;  4KX6 A;  4TM3 A;  5EB5 A;  4J31 A;  5IPY A;  2YLW A;  2YVG A;  3NIX A;  3H8L A;  4YT0 A;  1KN0 A;  4H4Z A;  2ZZ0 A;  4G9K A;  4H4S A;  4JY2 A;  4YTM A;  1CHU A;  2YM1 A;  1ZKQ A;  2R4E A;  4UDP A;  2V6O A;  3KKJ A;  3C4A A;  3CNJ A;  4A6N A;  1BWC A;  3CPJ G;  1H82 A;  5KMP A;  5KOW A;  3GD4 A;  5HYM A;  5FS6 A;  2JB1 A;  4Z44 A;  4B63 A;  2AR8 A;  1NDA A;  1ZK7 A;  4EMI A;  4Z2U A;  2VRL A;  2PYX A;  1IUT A;  3C96 A;  5DBJ A;  1PBC A;  3HYV A;  1N4U A;  4P9S A;  2CFY A;  2XVI A;  3DK8 A;  2WDV A;  4UDR A;  5KXJ A;  5GRT A;  3EF6 A;  3AYI A;  4GF7 A;  4H4T A;  4BUR A;  2Q0L A;  4TM0 A;  3OC4 A;  3T2Y A;  3DH9 A;  3RP6 A;  1GAL A;  1QJD A;  4Z24 A;  1NEN A;  3ATQ A;  4YSZ A;  4U8N A;  5U25 A;  2JAE A;  1Q9I A;  4XWR A;  2R9Z A;  1RYI A;  4ZCD A;  3M12 A;  4K5S A;  4Z43 A;  5IQ4 A;  1NHQ A;  3NK0 X;  2TPR A;  3AED A;  2AQJ A;  3P4S A;  3P4R A;  4H4R A;  4O5U A;  3UKA A;  3RNM A;  4ADW A;  1COY A;  4FX9 A;  4AP1 A;  1N1P A;  2GMJ A;  3L8K A;  3AEB A;  2Q6U A;  3G5S A;  4G73 A;  3T37 A;  4BJZ A;  2GV8 A;  4M52 A;  3CNT A;  1E39 A;  1Z6L A;  3KD9 A;  4I58 A;  4UDQ A;  1GTH A;  3NNE A;  1F8W A;  2V60 A;  2H88 A;  2OAL A;  5KMQ A;  1P2H A;  1GRB A;  4C3X A;  4H4U A;  1JNR A;  5KWF A;  1D7L A;  1D7Y A;  3UTG A;  3F8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...