5U1OA

2.3 angstrom resolution crystal structure of glutathione reductase from vibrio parahaemolyticus in complex with fad.
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
450
structure length
450
Chain Sequence
ATHFDYICIGGGSGGIASANRAAMYGAKVALIEAQDLGGTCVNVGCVPKKVMWHGAQIAEAMNLYAEDYGFDVDVKGFDWSKLVESRQAYIGRIHQSYDRVLGNNKVNVIKGFAKFVDEKTVEVNGEHYTADHILIAVGGRPTIPNIPGAEYGIDSNGFFDLAEQPKRVAVVGAGYIAVEIAGVLHALGTETHLFVRKESPLRSFDPMIIDTLVEVMEAEGPTLHTHSVPKEVVKEADGSLTLHLENGESQNVDQLIWAIGRHPATDAINLASTGVATNEKGYIKVDEYQETNVKGIYCVGDIMEGGIELTPVAVKAGRQLSERLFNNKPNAKMDYDLVPTVVFSHPPIGTIGLTTQEAEEKYGKDNIKVYTSGFTAMYTAVTKHRQPCKMKLVCAGEEETVVGLHGIGFTVDEMIQGFGVAMKMGATKADFDSVVAIHPTGSEEFVTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.3 Angstrom Resolution Crystal Structure of Glutathione Reductase from Vibrio parahaemolyticus in Complex with FAD.
rcsb
source organism Vibrio parahaemolyticus serotype o3:k6 (strain rimd 2210633)
molecule tags Lipid binding protein
molecule keywords Glutathione reductase
total genus 146
structure length 450
sequence length 450
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5u1oA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5u1oA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5u1oA02
4YSYA 5EB5A 1PHHA 3QSSA 4YSZA 4BK3A 1QJDA 2R46A 4B68A 5HYMA 3KLJA 1LVLA 4GR1A 4C3XA 2WP5A 1TDKA 4OPUA 1KFYA 4IV9A 4EQXA 4TM4A 3NKSA 1MOKA 1CJCA 1K0JA 1YY5A 2R4EA 1MXTA 2V60A 1REOA 3AWIA 4UDQA 1TDOA 4XXGA 3K7QX 4BJYA 4DSGA 2E1MA 1ZOVA 4NTEA 1GPEA 2GEWA 4NEWA 3NT6A 3CPHG 2B9YA 3CPIG 2VVLA 5GRTA 2XFNA 3COXA 2XDOA 4FK1A 4JQ9A 2E5VA 5JCIA 2C73A 4YT0A 5JCMA 5DBJA 1GSNA 3CN8A 1NENA 3UKAA 4BJZA 1GV4A 2VVMA 1H81A 2B7RA 3AE4A 4AP1A 3FBSA 4O5UA 1NDAA 5FS8A 1TDEA 5ER0A 1N4UA 3P4QA 3H8IA 3DJJA 2WESA 4OPDA 4DNAA 1IUVA 2YLRA 1Q1WA 4NTCA 4LA1A 1H7XA 1YQZA 3NYEA 1GOSA 1DJQA 3KU9A 4Y4NA 2EQ9A 3DGHA 3AE8A 3S61A 4K7ZA 3VR8A 4H4TA 4H7UA 1M6IA 1BKWA 3AYJA 4TM1A 4H2PA 3UCLA 3VQRA 2BABA 4A9WA 2GR1A 2QA1A 3DMEA 4JY2A 1QLBA 4H4ZA 3P4SA 4UP3A 2EQ7A 1GRBA 1P2EA 1IUWA 4H4SA 2BK3A 2H88A 1LPFA 1ZDLA 4IA5A 2YLWA 1XPQA 3LADA 3GMCA 1LV0A 4EQRA 1D4CA 1ZMCA 2XCGA 1D7LA 1EL8A 4AOSA 1ZKQA 1JNRA 2PHHA 3ISHA 4H4QA 4WX1A 3SM8A 2B9WA 1S2QA 3S5WA 1OJAA 2C7GA 2C65A 2GQFA 3SFEA 1OJCA 1FOHA 1PN0A 2F5ZA 2WPFA 3AYIA 3KPFA 5BUKA 3IF9A 1GERA 2X99A 3CNDA 3VRBA 2CVJA 5C3JA 4EMWA 2A89A 4C5OA 1PBFA 3GYIA 1DOEA 1TYPA 1IUXA 2OLOA 2C76A 3K7MX 3D8XA 3GDPA 3PS9A 4GF7A 1S3BA 4GDPA 5FS9A 4K5RA 3UTHA 1PDHA 3RNMA 3UOVA 5EBKA 1GEUA 2JK6A 4Z44A 2JBVA 3ATRA 1H83A 3NRNA 5KXJA 3BI5A 3EAOA 1E7PA 1TDNA 2YLZA 3NK2X 4A7AA 5M0ZA 1NHSA 3DH9A 5KVIA 3NN0X 3P4RA 1PS9A 4N9XA 2XVEA 2BCGG 2GQWA 1D4DA 3II4A 2BACA 1CHUA 1Q1RA 4FDCB 4REKA 3RHAA 3ZYXA 2YLTA 4DGKA 2AQJA 5LV9A 2GR0A 2C70A 1QO8A 3WE0A 2C3DA 2Z5XA 3DJEA 4NEVA 1IUUA 4EMJA 1IUSA 2WETA 3AE6A 3B6DA 4KPRA 1FCDA 2YG6A 3V76A 2IIDA 2ZBWA 3GSIA 4XWZA 2YR4A 2WP6A 1TRBA 4U8MA 2VVLG 4OVIA 4U8LA 4Z43A 1KDGA 2GMJA 1KSSA 3AEAA 4YSXA 1X31B 4O5QA 3V3NA 3I3LA 2R0CA 2WS3A 2ZZCA 2TPRA 2VZ2A 1IJHA 1DNCA 1L0VA 2VRLA 3LOVA 4CBQA 4P9SA 1F8RA 3KA7A 4GCMA 2Q6UA 1XDIA 1LJ1A 1Y56B 3ALLA 3FPZA 1B8SA 3GDNA 1EBDA 1XANA 4M52A 1GALA 1UKVG 4X9NA 4TLXA 1JOAA 1PXAA 4CY8A 3NK0X 3GYJA 4A79A 2W0HA 1O95A 2XVIA 1KNPA 1GT8A 3HZLA 4ZCCA 3OC4A 3AEFA 3GRTA 3NH3X 4AOXA 2A87A 2PYXA 2WQYA 4JN9A 2A8XA 5J7XA 4ZN0A 3KVEA 3RP6A 1LTXR 2BYBA 2C67A 2O9ZA 2YR5A 4Z2TA 5FS7A 1DOBA 2XLUA 3LB8A 1N4VA 1NPXA 3E1TA 3NYFA 3BI2A 2RABA 2VQ7A 2BS3A 3R9UA 4YTNA 1F8SA 4ZCDA 2DKHA 4U2TA 3GMBA 2CULA 3AE3A 1ZOYA 5KWFA 3CNPA 3L1RA 1B5QA 3C4NA 3GWDA 1NAAA 2BK5A 3UKLA 2BCPA 4A5LA 2JAEA 1YQ3A 1RYIA 5CKUA 4EM3A 4J2WA 5U63A 4EMIA 1GRHA 1PBDA 3FMWA 4U8JA 2VRMA 1B4VA 4PABA 4C74A 4J34A 3PO7A 3UTEA 5U1OA 1BGJA 3NK1X 3P9UA 2YVJA 1NHQA 4YKFA 1GNDA 2WPCA 1H82A 4YTPA 4IVMB 1NHPA 2BXSA 1CF3A 3AE1A 4H4RA 1PJ5A 4Y4MA 5HXIA 4ICYA 1ZK7A 3DK9A 1Q9IA 4JDRA 3GD3A 3O0HA 2CFYA 4Z24A 1JRYA 1L9CA 3JSKA 4AT0A 2DKIA 4CNJA 3NN6X 3AECA 4IA6A 1ONFA 4Z2RA 3ALMA 3DJDA 1GRAA 4LU6A 1GRFA 2R0GA 4YWOA 2YLXA 1CL0A 2R0PA 1E1KA 4UDPA 5KRQA 3IWAA 2GB0A 1GESA 2J3NA 3M12A 4FX9A 2JB3A 1VG9A 4X9MA 2XLTA 4CRTA 1EL9A 1GREA 2V5ZA 2GV8A 2JB1A 3UOYA 1DOCA 1TYTA 2GRTA 4Z2UA 5KOXA 4BURA 2OALA 3ADAB 4FK1C 2XFQA 4H2NA 1RP0A 2NPXA 1JRZA 1TDFA 2H89A 2I0ZA 3QVPA 2YM2A 4RG4A 4C77A 3BNUA 4MJWA 1GETA 4E0VA 2XFUA 1OJDA 2YAUA 3LXDA 5BULA 5JCKA 2XYOA 4OPLA 3CGCA 1CC4A 2C3CA 3QSEA 2UZZA 1F6MA 1BZLA 3AD8B 1L9DA 1O94A 2FJDA 2V61A 4HA6A 4PAAA 2V6OA 1FECA 4K2XA 4WCTA 3CGEA 3EPTA 4CCRA 4CY6A 4EQWA 4EQSA 4U8OA 3UTFA 4U2LA 4USQA 1E6EA 3RP7A 3AB1A 2QCUA 2VQBA 1P2HA 1VRQB 4OPTA 3UOXA 5J60A 4H4WA 4YKGA 5L46A 3RP8A 3AXBA 4H4UA 4RSLA 1Z6LA 1F8WA 1BWCA 1NG3A 2TMDA 3BHKA 2YVGA 1K0IA 1KF6A 3BI4A 3H4KA 4YXDA 2BA9A 5HHFA 3NLCA 2OAMA 1CC2A 2WEUA 5KVHA 1LQTA 3EF6A 4K22A 1E39A 3DGZA 1H7WA 2B9XA 2FBWA 2XLPA 3OZ2A 4JNQA 4C3YA 5BRTA 4Y4LA 3PVCA 1ZP0A 3UKHA 3ZDNA 4A65A 2FJBA 1CC6A 2EQ6A 4J36A 1O5WA 5KOWA 2YR6A 4BK2A 3KKJA 4GUVA 4JNAA 5FMHA 4TM3A 3KD9A 2Q0KA 2VOUA 5IPYA 1L9EA 3GD4A 2YVFA 1E1MA 2YG3A 3AEEA 4OPGA 2YLSA 2YQUA 4H2RA 4APNA 4X4JA 1CJ2A 3NYCA 4OCGA 3IHMA 4U8PA 3NHOX 4B63A 3LZWA 3SQPA 4RG3A 2XVFA 4B69A 1COYA 1DJNA 3QFBA 1S3EA 2X8GA 4UDRA 2WU5A 4H4YA 4U8NA 2Q0LA 1MO9A 2BS4A 2GMHA 1NEKA 3AE9A 3UOZA 1F3PA 2BC0A 5TR3A 3VRAA 2AR8A 3QVRA 4J57A 2JKCA 2C72A 4YTMA 2IVDA 3UP5A 1N1PA 2HQMA 3AEBA 4CCQA 4OPCA 1JRXA 1H6VA 4EM4A 1VG0A 3ALJA 2X50A 3ABVA 1D5TA 3G5QA 5FS6A 3UKPA 2Z5YA 2EQ8A 2APGA 1XHCA 3AYLA 1D7YA 1BGNA 2XVJA 2WPEA 1S2YA 1OJ9A 3NIXA 3F8DA 4B66A 3AEGA 4Z26A 4XWRA 2BXRA 2GVCA 2RGHA 3REDA 4H4PA 3ITJA 3FG2P 3GWFA 4HB9A 5CQFA 2WOWA 3K30A 4H2QA 2Q7VA 2WOIA 2XFOA 4ADWA 2WDRA 1EL7A 4U2SA 3VR9A 2CDUA 3DA1A 3UTGA 1PBBA 1PXBA 2ACZA 1PBEA 3GRSA 2GR2A 1IUTA 3K7TA 2ARDA 3AD7B 1JU2A 1YQ4A 1BF3A 3IHGA 2WHDA 2OA1A 3F8PA 3AE5A 4CNKA 2X8HA 4ECHA 5JCLA 1Y0PA 2Y6RA 3P1WA 1GRTA 4OPIA 3AE2A 1VQWA 3AD9B 2YG7A 3CTYA 1ELIA 4EIQA 1AOGA 2V3BA 2C75A 3B3RA 2GF3A 1CJ4A 5U25A 2GAHB 4U8KA 2WOVA 3L8KA 1DODA 2AAQA 2C66A 2V3AA 2WDVA 3BNMA 3QJ4A 5IQ4A 1CJ3A 2XFPA 4A6NB 4BK1A 3NG7X 3CGBA 3Q9TA 3IC9A 4GRTA 3G5RA 2WP9A 3T37A 1FL2A 2R4JA 2WDQA 5BVAA 1RSGA 4YSHA 3DK4A 3URHA 1V59A 2YWLA 3QFAA 3NNEA 3CGDA 4I58A 4B67A 4IVOB 3ICTA 3VRDB 3F8RA 3DK8A 1KNRA 5GSNA 4NTDA 1K0LA 1ZY8A 4I59A 3SFDA 1H84A 1M64A 3NTAA 2E4GA 3C96A 4K8DA 3BHFA 4NZHA 2FJEA 4B65A 4KX6A 2FJAA 3D1CA 4H4XA 1PXCA 2Y6QA 2B76A 3UKFA 1JEHA 2X8CA 1W4XA 3M0OA 3CNJA 2BS2A 2BK4A 2IVEA 4AT2A 1H86A 3Q6JA 4USRA 4AP3A 4GDEA 4J33A 3ATQA 3ICRA 5HY5A 3SGLA 1JNZA 4BV6A 4D03A 1KSUA 1PJ7A 2QA2A 1PJ6A 2X3NA 1EL5A 3EANA 2YG4A 4TLZA 1N4WA 1CBOA 1OJTA 1LQUA 3H8LA 1E1LA 3QSMA 1PBCA 3CNSA 4U8IA 2YM1A 3LJPA 5EB4A 2XVHA 3P4PA 5M10A 4DSHA 4B64A 2GR3A 3NGCX 2NVKX 2R45A 3I6DA 4A6NA 4EIPA 1ZX9A 1K4QA 4TM0A 4A99A 4B1BA 4LIIA 2GAGB 1ZMDA 1NG4A 1NHRA 3CIRA 3CPJG 3UKQA 1FEAA 2OLNA 3ICSA 5C2TA 1HYUA 2XLRA 3LZXA 3NTDA 2QAEA 3DJGX 3AEDA 4Z25A 3FIMB 2R9ZA 4J56A 1D4EA 1VDCA 5JCNA 4H50A 2C64A 2XLSA 2B7SA 3G5SA 3V3OA 4K5SA 5IQ1A 1YKJA 2JB2A 3AE7A 5EOWA 1E1NA 2ZZ0A 1GTHA 4J31A 1FEBA 4H4VA 1SEZA 1GXFA 2RGJA 4JY3A 3UKKA 4D04A 2RGOA 1DXLA 3C4AA 2BC1A 1GTEA 3UP4A 1B37A 2WU2A 3CNTA 2ZZBA 3M13A 1Y56A 2YG5A 2WBAA 1GRGA 2GH5A
chains in the Genus database with same CATH superfamily
4YSYA 1PHHA 3QSSA 4YSZA 2R46A 1LVLA 3DFYA 3AM9A 3OW1A 2R4EA 1CJCA 1K0JA 3AWIA 3TJIA 1REOA 3GD6A 3K7QX 4BJYA 4DSGA 3HYWA 4NEWA 3CPHG 2E5VA 5JCIA 4E5TA 2C73A 4YT0A 1S7MA 3UKAA 3NXLA 1GV4A 3AE4A 3FBSA 5ER0A 3P4QA 2ZC8A 3DJJA 2WESA 3NVZB 4NTCA 3R11A 1H7XA 3KU9A 4H4TA 1BKWA 3DMEA 4H4ZA 1P2EA 4H4SA 2YLWA 1LV0A 2XCGA 1D7LA 1EL8A 4AOSA 2B9WA 3S5WA 5FJOA 3VCCA 3GC2A 2WPFA 3VRBA 4EMWA 4J3ZA 1DOEA 1TYPA 3RNMA 3TTEA 5JRBA 2BRAA 5EBKA 2JK6A 3DG3A 2YLZA 3DH9A 3NN0X 2GQWA 3II4A 4FDCB 2YLTA 2AQJA 4Z17A 3WE0A 1IUUA 4EMJA 2WETA 3AE6A 1FHVA 2NQLA 2IIDA 2YR4A 1JRPA 3DGBA 4OVIA 2GMJA 1KSSA 2W3SA 1N5XA 3I3LA 2R0CA 1KKOA 4GYPC 2VZ2A 1DNCA 2DW6A 2VRLA 1LJ1A 3FPZA 1B8SA 1EBDA 1N63C 4G74A 4M52A 4TLXA 4A6GA 2W0HA 4DYEA 3GRTA 4AOXA 4DX3A 3QKEA 2AKZA 5FS7A 2PTXA 2OZTA 3CT2A 3NYFA 1NPXA 2DKHA 3OZYA 3GWDA 1NAAA 3UKLA 4A5LA 4A3RA 2AKMA 3SZ0A 2VRMA 3UJ2A 3T2ZA 3T14A 4EWJA 3P9UA 1NHQA 3DG7A 3R1ZA 2BXSA 4Y4MA 4ICYA 2P3ZA 4Z24A 1JRYA 1L9CA 4AT0A 2PCEA 1ONFA 4KT2A 1GRFA 3DDMA 2R0GA 4UDPA 3IWAA 2V5ZA 4H2HA 5KOXA 4FK1C 2I0ZA 2XYOA 2C3CA 3T9PA 1BZLA 4PAAA 3CGEA 1WUEA 4JN8A 1F9CA 4USQA 2MNRA 1SJAA 4YKGA 1F8WA 1K0IA 4YXDA 3NLCA 5KNLA 2OAMA 2E5AA 1CC2A 2RDXA 2W3RA 1FIQB 3EF6A 2B9XA 4JNQA 3CMMA 1ZP0A 1TKKA 2PP3A 3RGTA 4BK2A 3KKJA 4TM3A 1R6WA 2Q0KA 2YG3A 3AEEA 4M0XA 3IHMA 2BRYA 3SZCA 3SQPA 2XVFA 1COYA 1S3EA 3QN3A 4UDRA 3A7AA 3T4WA 4ZCWA 3RO6A 1TZZA 2BS4A 5TR3A 3QVRA 2JKCA 2C72A 3AEBA 3P0WA 2X50A 1D5TA 7ENLA 3UKPA 2EQ8A 3ENLA 4J1OA 1RVKA 1S2YA 1OJ9A 3REDA 3FG2P 2WOWA 3VR9A 4G9KA 3GRSA 1IUTA 2ARDA 3N4FA 1YQ4A 1BF3A 3PFRA 3F8PA 3AE5A 2X8HA 3P1WA 2Y6RA 4OPIA 3AD9B 2YG7A 3CTYA 1ELIA 2GF3A 1DTNA 3R10A 2C66A 2V3AA 3QJ4A 5KMQA 1YEYA 3Q9TA 2WP9A 5ENLA 4KEMA 1RSGA 1ECQA 4B67A 3VRDB 4NTDA 1K0LA 1ZY8A 3SFDA 2QDDA 3C96A 3H12A 4NZHA 2FJEA 3JW7A 3FVDA 1PXCA 2Y6QA 1JEHA 3M0OA 3MUCA 3Q6JA 4ROPA 3T6CA 3BOXA 4H1ZA 1JNZA 1PJ7A 1RM6B 2HXTA 3SY4A 1OJTA 3EUB3 1E1LA 2YM1A 3LJPA 1H2IA 5M10A 4DXKA 3I6TA 2GR3A 3NGCX 2R45A 4EIPA 1K4QA 4B1BA 3CPJG 2OLNA 5C2TA 2QAEA 3MQTA 3AEDA 1P43A 2R9ZA 4J56A 4H50A 3A7RA 2XLSA 3D47A 5IQ1A 4J31A 4H4VA 1GXFA 3OZMA 3UKKA 2RGOA 3AN1A 3UP4A 2BC1A 3CNTA 1Y56A 5KMPA 1GRGA 3S47A 4BK3A 3S5SA 4GR1A 1TDKA 4OPUA 1KFYA 3NKSA 1YY5A 2V60A 3ZLGA 4GISA 3NVVB 4XXGA 2GEWA 5BOEA 4ZOHB 4TVWA 2B9YA 2VVLA 2QJJA 3CN8A 3ZVIA 2VVMA 1TDEA 4GGHA 3H8IA 3IJLA 3A7UA 2YLRA 2OQYA 4G73A 1DJQA 3AE8A 3VR8A 4H7UA 3AYJA 2BABA 4A9WA 2QA1A 3CAWA 1QLBA 3P4SA 2EQ7A 1GRBA 2H88A 3GYXA 1ZDLA 4IA5A 4IZGA 3P93A 1ZKQA 3ISHA 1V97A 2AL2B 2QDEA 2GDQA 1S2QA 1OJAA 3B97A 3SFEA 3AYIA 3KUMA 4G6HA 1GERA 2X99A 1W6TA 4C5OA 3H70A 4TM4A 4GF7A 4GDPA 3GDPA 5FS9A 4K5RA 3UTHA 4TVYA 1GEUA 4Z44A 3FV9A 2I5QA 3BI5A 3ES8A 3NK2X 4N9XA 2ONEA 1D4DA 5LV9A 2GR0A 2C70A 4X2PA 3SZFA 4E6MA 1QO8A 3DJEA 1IUSA 4KPRA 2YG6A 4U8MA 4U8LA 1KDGA 4YSXA 4O5QA 2WS3A 2ZZCA 1JPMA 1IJHA 1L0VA 3PK7A 3SJNA 4GCMA 2PU0A 1JOAA 1PXAA 4A79A 1O95A 2XVIA 1KNPA 4ZCCA 2PYXA 4JN9A 1LTXR 2O9ZA 1N60C 1P48A 3E1TA 3R0KA 2RABA 4YTNA 4ZCDA 3H7VA 3U9IA 3AE3A 5KWFA 3C4NA 4HPNA 3AMZA 2BK5A 2BCPA 4KWSA 1RYIA 1YQ3A 5CKUA 2OZ3A 1PBDA 3FMWA 4GFIA 4U8JA 4PABA 1MDRA 4J34A 3PO7A 2YVJA 5KMRA 4II2A 4YTPA 1CF3A 3RCYA 3AE1A 1PJ5A 4M6UA 3GD3A 3DESA 3I4KA 1OEPA 3VCNA 3JSKA 3NN6X 4IA6A 3ALMA 3DJDA 2YLXA 1TE6A 2OVLA 4IP4A 2GB0A 2J3NA 3M12A 4FX9A 2FYMA 2XLTA 4CRTA 1EL9A 1N5WC 2XFQA 2NPXA 1TDFA 3QVPA 2YM2A 3BNUA 1GETA 2XFUA 3QLDA 5BULA 3CGCA 1CC4A 3QSEA 1F6MA 2FJDA 2V61A 4WCTA 1FECA 3EPTA 4CCRA 4HNCA 3DG6A 2QGYA 4EQWA 4EQSA 3UTFA 3RP7A 2QCUA 4FI4A 1P2HA 1VRQB 5J60A 4H4WA 3AXBA 1Z6LA 1NG3A 1BWCA 2TMDA 3UCCA 1KF6A 3BI4A 5HHFA 3ZVHA 3QPEA 1LQTA 1X2HA 1IYXA 2OO6A 3V3WA 3ZDNA 4A65A 2FJBA 1KCZA 5KOWA 3VC6A 4K2SA 3IJQA 3SBFA 2VOUA 1E1MA 1BQGA 4OPGA 2AL2A 3NO1A 1CJ2A 3NHOX 3SQSA 4GAVA 1DJNA 3QFBA 3UOZA 2GMHA 3AE9A 1N1PA 3T2KA 1JRXA 3V4BA 3ABVA 5FS6A 2Z5YA 4Z26A 3AEGA 3T0KA 5CQFA 3FYYA 2PGEA 4H2QA 2Q7VA 2C4CA 3HW2A 1VDVA 2CDUA 3B9JB 2GGIA 1FO4A 1PBBA 2ACZA 3SN4A 1JDFA 1NELA 2WHDA 2OA1A 3JVAA 1Y0PA 1VQWA 2QJMA 4EIQA 2V3BA 2GAHB 4U8KA 1DODA 4BK1A 3NG7X 3CGBA 3IC9A 4GRTA 3T37A 4ZA0A 4IHCA 2AL1A 4HCHA 4E4FA 3EEZA 4IVOB 3ICTA 4I59A 1H84A 1M64A 3DIPA 3MSYA 2PODA 3BHFA 4B65A 3KPKA 4H4XA 1MRAA 2FKPA 3R0UA 2X8CA 4GAPA 3CNJA 2BK4A 4AT2A 1H86A 4USRA 4AP3A 4GDEA 5HY5A 3MWCA 4D03A 3EKGA 1EL5A 2PGWA 2YG4A 1N4WA 4H83A 2XVHA 2NVKX 4TM0A 4A99A 2W55A 1NG4A 3SXIA 3UKQA 3ICSA 1HYUA 2XLRA 4Z25A 4IL0A 1D4EA 1VDCA 2C64A 3NVWB 3V3OA 1YKJA 4JHMA 5EOWA 1E1NA 1GTHA 1SEZA 2PTZA 3RRAA 3CK5A 2E3TA 3C4AA 4DHGA 1B37A 2WU2A 2ZZBA 3TWBA 2YG5A 1QJDA 5HYMA 1MNSA 3KLJA 2XGZA 4IV9A 1MOKA 4UDQA 3TW9A 1EC9A 1TDOA 1ZOVA 4NTEA 1KD0A 5GRTA 3H8AA 3COXA 1EC8A 2XH2A 5JCMA 5DBJA 1NENA 3NVYB 4GIRA 4AP1A 4O5UA 5FS8A 3Q45A 4OPDA 4DNAA 1IUVA 1Q1WA 2PA6A 3UCDA 3NYEA 4Y4NA 3DGHA 3S61A 4K7ZA 3TOYA 4K8GA 4H2PA 3UCLA 2QVHA 2GR1A 4JY2A 4UP3A 1ONEA 2BK3A 1IUWA 1LPFA 1JPDX 1XPQA 4A35A 1ZMCA 1D4CA 2P88A 4WX1A 3SM8A 2C7GA 3MKCA 3TWAA 3KPFA 3IF9A 3CNDA 2CVJA 5C3JA 3PWIA 3VFCA 1PBFA 3GYIA 3K7MX 2PS2A 2C76A 2OLOA 1S3BA 2O56A 3P3BA 3FXGA 3SN0A 3T2YA 2JBVA 3ATRA 1H83A 3NRNA 5KXJA 1E7PA 4A7AA 5M0ZA 5KVIA 1N61C 3P4RA 1PS9A 2BACA 1CHUA 1Q1RA 3ZYXA 2C3DA 2Z5XA 2W54A 4NEVA 2MUCA 2POZA 3SZWA 2WP6A 2VVLG 3T8QA 3D9XA 2QJNA 3V3NA 3UXKA 1F8RA 3KA7A 1XDIA 1UKVG 2GGJA 1SJDA 3GYJA 4GMEA 1GT8A 3OC4A 3AEFA 4FP1A 2A87A 2WQYA 3MY9A 5J7XA 3KVEA 3THUA 3RP6A 2BYBA 3FJ4A 4Z2TA 2YR5A 3DEQA 2VQ7A 1XS2A 3R9UA 4U2TA 1JROA 3CNPA 3R07C 2JAEA 5U63A 1GRHA 1B4VA 3UTEA 5U1OA 1BGJA 1NHPA 4H4RA 2XH7A 5HXIA 1ZK7A 4JDRA 1Q9IA 2GGGA 3O0HA 3UGVA 4Z2RA 1GRAA 4LU6A 2R0PA 5KRQA 3CXOA 5KMSA 2JB3A 1VG9A 4DN1A 2JB1A 1DOCA 5FJTA 4H2NA 4MJWA 3TQPA 4E0VA 3LXDA 5JCKA 2P0IA 3CXBA 2UZZA 3AD8B 3ZLFA 1L9DA 4HA6A 5J04A 4CY6A 3HRDC 4U2LA 3AB1A 2VQBA 4OPTA 5L46A 4RSLA 5G5GB 1FFUC 3BHKA 2YVGA 2BA9A 2PTWA 4G7FA 5KVHA 4K22A 1E39A 4DWDA 1H7WA 2FBWA 2XLPA 3OZ2A 3PVCA 3HYXA 2YR6A 4GUVA 4JNAA 1L9EA 3GD4A 1SJCA 2YQUA 4H2RA 4B63A 3OP2A 4B69A 2X8GA 1KKRA 2PU1A 4H4YA 4KPLA 4U8NA 1F3PA 3OTRA 2OKTA 4EM4A 1VG0A 3ALJA 3UJEA 5FJPA 2APGA 1STZA 1XHCA 3AYLA 1D7YA 1BGNA 3NIXA 2GVCA 4ENLA 2RGHA 4H4PA 3ITJA 3GWFA 4HB9A 3K30A 1X2GA 2XFOA 2WDRA 1EL7A 4U2SA 3DA1A 2OFJA 3UTGA 1PBEA 3AD7B 2DW7A 3IHGA 4ECHA 5JCLA 1E9IA 3B3RA 3IJIA 3UJSA 2WOVA 3BNMA 4HCLA 3G5RA 3GO2A 2R4JA 2WDQA 5BVAA 2CHRA 3DK4A 2P8BA 2YWLA 3QFAA 3F8RA 3DK8A 4K1WA 5GSNA 3RR1A 3SYIA 2HZGA 3CB3A 3D1CA 4GYPA 3UKFA 1W4XA 2ZADA 4IL2A 4J33A 3SGLA 4BV6A 1PJ6A 3EANA 3Q4DA 1N62C 1CBOA 1LQUA 3MZNA 3QSMA 2OPJA 1PBCA 3CNSA 4U8IA 2P8CA 5EB4A 3SSZA 4LIIA 2GAGB 4NWZA 1NHRA 3CIRA 2PP1A 4H19A 4HCDA 3NTDA 3DJGX 3FIMB 5JCNA 3G5SA 3VA8A 4K5SA 3VC5A 1ELSA 2RGJA 2PP0A 4JY3A 1MUCA 1GTEA 4MGGA 3T31A 2WBAA 2GH5A 5EB5A 3BSMA 4B68A 3K1GA 4C3XA 2WP5A 4EQXA 5IPYA 4G6GA 1MXTA 6ENLA 2E1MA 1GPEA 3NT6A 3OPSA 3CPIG 2XFNA 5IDZA 2XDOA 4FK1A 4JQ9A 3JZUA 1GSNA 4BJZA 4GGBA 1H81A 1FFVC 2B7RA 1PDZA 1NDAA 1N4UA 4LA1A 1YQZA 1GOSA 2EQ9A 1SJBA 3BJSA 3UXLA 1M6IA 4TM1A 3VQRA 1WYGA 3SN1A 3QTPA 3LADA 3GMCA 4IP5A 4EQRA 1JNRA 2PHHA 4H4QA 3DERA 2C65A 2GQFA 1PDYA 1OJCA 1FOHA 2F5ZA 1PN0A 5BUKA 2QQ6A 2A89A 3NFUA 1IUXA 3D8XA 3PS9A 1PDHA 3UOVA 2XSXA 3NS1B 4HYRA 3EAOA 1TDNA 1NHSA 2GSHA 2XVEA 2BCGG 3FCPA 3R25A 3ZLHA 4DGKA 3RHAA 1T3QC 1SB3B 1NU5A 5FJUA 3B6DA 1FCDA 3V76A 1BKHA 2ZBWA 3GSIA 4XWZA 1TRBA 4Z43A 3ZVHB 3AEAA 1X31B 2TPRA 2GGHA 3LOVA 3ETRB 4JN7A 4CBQA 4P9SA 1ZXIC 2Q6UA 1Y56B 3ALLA 3GDNA 1XANA 4IT1A 1GALA 4X9NA 3SR6B 4CY8A 3NK0X 3RITA 3HZLA 3NH3X 2A8XA 4ZN0A 3NRZB 2C67A 1DOBA 3NZGA 2XLUA 3LB8A 1N4VA 3BI2A 2BS3A 1F8SA 3GMBA 5FJRA 2CULA 3SX6A 2PMQA 1ZOYA 3L1RA 1B5QA 3PWGA 1R0MA 4EM3A 4J2WA 4EMIA 2OX4A 2PPGA 4C74A 2PTYA 3HPFA 3UJFA 3NK1X 2XH0A 4YKFA 1GNDA 2WPCA 1H82A 4IVMB 3GY1A 3DK9A 2CFYA 4CNJA 2DKIA 3AECA 3I6EA 4YWOA 1CL0A 3V5FA 1E1KA 2OZ8A 1XPYA 1GESA 4E4UA 1GREA 3N6HA 2GV8A 3UOYA 4Z2UA 1TYTA 2GRTA 4BURA 2OALA 3ADAB 4X9MA 4D04A 1RP0A 1JRZA 2H89A 4RG4A 4C77A 1OJDA 2YAUA 1VQZA 4OPLA 3HYVA 1O94A 1WUFA 2V6OA 4K2XA 4NNJA 3UJRA 4U8OA 4MKSA 1E6EA 3UOXA 5G5HB 3RP8A 4H4UA 3H4KA 2WEUA 3DGZA 5BRTA 4C3YA 4Y4LA 4YWSA 3UKHA 1CC6A 2EQ6A 4J36A 1O5WA 5FMHA 3KD9A 2YVFA 2YLSA 4APNA 4X4JA 3NYCA 4OCGA 4U8PA 3LZWA 4RG3A 3DFHA 3STPA 2HXUA 2WU5A 2Q0LA 1MO9A 1NEKA 2BC0A 3VRAA 2AR8A 3UP5A 4J57A 4YTMA 4CCQA 2GL5A 2IVDA 3IK4A 2HQMA 3PG6A 4OPCA 1H6VA 3G5QA 2XVJA 2WPEA 4B66A 4HNLA 3F8DA 4XWRA 3N4EA 2BXRA 2WOIA 4ADWA 2XH4A 1PXBA 5BOFA 2GR2A 3K7TA 1JU2A 1EBHA 4CNKA 1GRTA 1EC7A 3AE2A 1AOGA 2C75A 1CJ4A 5U25A 3L8KA 2AAQA 2WDVA 5IQ4A 1CJ3A 2XFPA 4A6NB 1FL2A 3V5CA 3ES7A 4YSHA 3URHA 1V59A 3NNEA 3CGDA 4I58A 3L5OA 1KNRA 1JCTA 5EU9A 3NTAA 2E4GA 4K8DA 2HNEA 3D46A 4KX6A 2FJAA 4II3A 2B76A 2BS2A 2IVEA 1KN0A 4F4RA 3TJ4A 3VDGA 3ATQA 3ICRA 1KSUA 1L8PA 4Z1YA 2QA2A 2X3NA 4TLZA 3H8LA 2OLAA 3P4PA 4DSHA 4B64A 1FHUA 3I6DA 4A6NA 1ZX9A 4HN8A 1EBGA 3TCSA 1ZMDA 2GGEA 1FEAA 2OG9A 3N6JA 3LZXA 4MMWA 2B7SA 4E8GA 2JB2A 1MDLA 3AE7A 2ZZ0A 1FEBA 2PSNA 2OQHA 1DXLA 3CYJA 4G8TA 3M13A 3U4FA 4REKA
chains in the Genus database with same CATH topology
4YSYA 5EB5A 1PHHA 3QSSA 4YSZA 4BK3A 1QJDA 2R46A 4B68A 5HYMA 3KLJA 1LVLA 4GR1A 4C3XA 2WP5A 1TDKA 4OPUA 1KFYA 4IV9A 4EQXA 4TM4A 3NKSA 1MOKA 1CJCA 1K0JA 1YY5A 2R4EA 1MXTA 2V60A 1REOA 3AWIA 4G6GA 4UDQA 1TDOA 4XXGA 3K7QX 4BJYA 4DSGA 2E1MA 1ZOVA 3HYWA 1GPEA 2GEWA 4NEWA 3NT6A 3CPHG 4NTEA 2B9YA 3CPIG 2VVLA 5GRTA 2XFNA 3COXA 2XDOA 4FK1A 4JQ9A 2E5VA 5JCIA 2C73A 4YT0A 5JCMA 5DBJA 1GSNA 1S7MA 3CN8A 1NENA 3UKAA 4BJZA 1GV4A 2VVMA 1H81A 2B7RA 3AE4A 4AP1A 3FBSA 4O5UA 1NDAA 5FS8A 1TDEA 5ER0A 1N4UA 3P4QA 3H8IA 3DJJA 2WESA 4OPDA 4DNAA 1IUVA 2YLRA 1Q1WA 4NTCA 4LA1A 1H7XA 1YQZA 3NYEA 1GOSA 1DJQA 3KU9A 4G73A 4Y4NA 2EQ9A 3DGHA 3AE8A 3S61A 4K7ZA 3VR8A 4H4TA 4H7UA 1M6IA 1BKWA 3AYJA 4TM1A 4H2PA 3UCLA 3VQRA 2BABA 4A9WA 2GR1A 2QA1A 3DMEA 4JY2A 1QLBA 4H4ZA 3P4SA 4UP3A 2EQ7A 1GRBA 1P2EA 1IUWA 4H4SA 2BK3A 2H88A 3GYXA 1LPFA 1ZDLA 4IA5A 2YLWA 1XPQA 3LADA 3GMCA 1LV0A 4EQRA 1D4CA 1ZMCA 2XCGA 1D7LA 1EL8A 4AOSA 1ZKQA 1JNRA 2PHHA 3ISHA 4H4QA 4WX1A 3SM8A 2B9WA 1S2QA 3S5WA 1OJAA 2C7GA 2C65A 2GQFA 3SFEA 1OJCA 1FOHA 2F5ZA 1PN0A 2WPFA 3AYIA 3KPFA 5BUKA 4G6HA 3IF9A 1GERA 2X99A 3CNDA 3VRBA 2CVJA 5C3JA 4EMWA 2A89A 4C5OA 1PBFA 3GYIA 1DOEA 1TYPA 1IUXA 2OLOA 2C76A 3K7MX 3D8XA 3GDPA 3PS9A 4GF7A 1S3BA 4GDPA 5FS9A 4K5RA 3UTHA 1PDHA 3RNMA 5JRBA 2BRAA 3UOVA 5EBKA 1GEUA 2JK6A 3T2YA 4Z44A 2JBVA 3ATRA 1H83A 3NRNA 5KXJA 3BI5A 3EAOA 1E7PA 1TDNA 2YLZA 3NK2X 4A7AA 5M0ZA 1NHSA 3DH9A 5KVIA 3NN0X 3P4RA 1PS9A 4N9XA 2XVEA 2BCGG 2GQWA 1D4DA 3II4A 2BACA 1CHUA 1Q1RA 4FDCB 4REKA 3RHAA 3ZYXA 2YLTA 4DGKA 2AQJA 5LV9A 2GR0A 2C70A 3SZFA 1QO8A 3WE0A 2C3DA 2Z5XA 3DJEA 4NEVA 1IUUA 4EMJA 1IUSA 2WETA 3AE6A 3B6DA 4KPRA 1FCDA 2YG6A 3V76A 3SZWA 2IIDA 2ZBWA 3GSIA 4XWZA 2YR4A 2WP6A 1TRBA 4U8MA 2VVLG 4OVIA 4U8LA 4Z43A 1KDGA 2GMJA 1KSSA 3AEAA 4YSXA 1X31B 3D9XA 4O5QA 3V3NA 3I3LA 2R0CA 2WS3A 2ZZCA 2TPRA 2VZ2A 1IJHA 1DNCA 1L0VA 2VRLA 3LOVA 4CBQA 4P9SA 1F8RA 3KA7A 4GCMA 2Q6UA 1XDIA 1LJ1A 1Y56B 3ALLA 3FPZA 1B8SA 3GDNA 1EBDA 4G74A 1XANA 4M52A 1GALA 1UKVG 4X9NA 4TLXA 1JOAA 1PXAA 4CY8A 3NK0X 3GYJA 4A79A 2W0HA 1O95A 2XVIA 1KNPA 1GT8A 3HZLA 4ZCCA 3OC4A 3AEFA 3GRTA 3NH3X 4AOXA 2A87A 2PYXA 2WQYA 4JN9A 2A8XA 5J7XA 4ZN0A 3KVEA 3RP6A 1LTXR 2BYBA 2C67A 2O9ZA 2YR5A 4Z2TA 5FS7A 1DOBA 2XLUA 3LB8A 1N4VA 1NPXA 3E1TA 3NYFA 3BI2A 2RABA 2VQ7A 2BS3A 3R9UA 4YTNA 1F8SA 4ZCDA 2DKHA 4U2TA 3GMBA 3SX6A 2CULA 3AE3A 1ZOYA 5KWFA 3CNPA 3L1RA 1B5QA 3C4NA 3GWDA 1NAAA 2BK5A 3UKLA 2BCPA 4A5LA 2JAEA 1YQ3A 1RYIA 5CKUA 4EM3A 4J2WA 5U63A 4EMIA 3SZ0A 1GRHA 1PBDA 3FMWA 4U8JA 2VRMA 1B4VA 4PABA 4C74A 4J34A 3T2ZA 3PO7A 3T14A 3UTEA 5U1OA 1BGJA 3NK1X 3P9UA 2YVJA 1NHQA 5KMRA 4II2A 4YKFA 1GNDA 2WPCA 1H82A 4YTPA 4IVMB 1NHPA 2BXSA 1CF3A 3AE1A 4H4RA 1PJ5A 4Y4MA 5HXIA 4ICYA 1ZK7A 3DK9A 4JDRA 1Q9IA 3GD3A 3O0HA 2CFYA 4Z24A 1JRYA 1L9CA 3JSKA 4AT0A 2DKIA 4CNJA 3NN6X 3AECA 4IA6A 1ONFA 4Z2RA 3ALMA 3DJDA 1GRAA 4LU6A 1GRFA 2R0GA 4YWOA 2YLXA 1CL0A 2R0PA 1E1KA 4UDPA 5KRQA 3IWAA 2GB0A 1GESA 2J3NA 3M12A 4FX9A 5KMSA 2JB3A 1VG9A 4X9MA 2XLTA 4CRTA 1EL9A 1GREA 2V5ZA 2GV8A 2JB1A 3UOYA 1DOCA 1TYTA 2GRTA 4Z2UA 5KOXA 4BURA 2OALA 3ADAB 4FK1C 2XFQA 4H2NA 1RP0A 2NPXA 1JRZA 1TDFA 2H89A 2I0ZA 3QVPA 2YM2A 4RG4A 4C77A 3BNUA 4MJWA 1GETA 4E0VA 2XFUA 1OJDA 2YAUA 3LXDA 5BULA 5JCKA 2XYOA 4OPLA 3HYVA 3CGCA 1CC4A 2C3CA 3QSEA 2UZZA 1F6MA 1BZLA 3AD8B 1L9DA 1O94A 2FJDA 2V61A 4HA6A 4PAAA 2V6OA 1FECA 4K2XA 4WCTA 3CGEA 3EPTA 4CCRA 4NNJA 4CY6A 4EQWA 4EQSA 4U8OA 3UTFA 4U2LA 4USQA 1E6EA 3RP7A 3AB1A 2QCUA 2VQBA 1P2HA 1VRQB 4OPTA 3UOXA 5J60A 4H4WA 4YKGA 5L46A 3RP8A 3AXBA 4H4UA 4RSLA 1Z6LA 1F8WA 1BWCA 1NG3A 2TMDA 3BHKA 2YVGA 1K0IA 1KF6A 3BI4A 3H4KA 4YXDA 2BA9A 5HHFA 3NLCA 5KNLA 2OAMA 1CC2A 2WEUA 5KVHA 1LQTA 3EF6A 4K22A 1E39A 3DGZA 1H7WA 2B9XA 2FBWA 2XLPA 3OZ2A 3CMMA 4JNQA 4C3YA 4Y4LA 5BRTA 3PVCA 1ZP0A 3UKHA 3ZDNA 4A65A 3HYXA 2FJBA 1CC6A 2EQ6A 4J36A 1O5WA 5KOWA 2YR6A 4BK2A 3KKJA 4GUVA 4JNAA 5FMHA 4TM3A 3KD9A 2Q0KA 2VOUA 5IPYA 1L9EA 3GD4A 2YVFA 1E1MA 2YG3A 3AEEA 4OPGA 2YLSA 2YQUA 4H2RA 4APNA 4X4JA 1CJ2A 3NYCA 4OCGA 3IHMA 4U8PA 2BRYA 3NHOX 4B63A 3LZWA 3SZCA 3SQPA 4RG3A 2XVFA 4B69A 4GAVA 1COYA 1DJNA 3QFBA 1S3EA 2X8GA 4UDRA 2WU5A 4H4YA 4U8NA 2Q0LA 1MO9A 2BS4A 2GMHA 1NEKA 3AE9A 3UOZA 1F3PA 2BC0A 5TR3A 3VRAA 2AR8A 3QVRA 4J57A 2JKCA 2C72A 4YTMA 2IVDA 3UP5A 1N1PA 2HQMA 3PG6A 3AEBA 3T2KA 4CCQA 4OPCA 1JRXA 1H6VA 4EM4A 1VG0A 3ALJA 2X50A 3ABVA 1D5TA 3G5QA 5FS6A 3UKPA 2Z5YA 2EQ8A 2APGA 1XHCA 3AYLA 1D7YA 1BGNA 2XVJA 2WPEA 1S2YA 1OJ9A 3NIXA 3F8DA 4B66A 3AEGA 4Z26A 4XWRA 2BXRA 2GVCA 2RGHA 3T0KA 3REDA 4H4PA 3ITJA 3FG2P 3GWFA 4HB9A 5CQFA 2WOWA 3K30A 4H2QA 2Q7VA 2C4CA 2WOIA 2XFOA 4ADWA 2WDRA 1EL7A 4U2SA 3VR9A 2CDUA 3DA1A 3UTGA 1PBBA 1PXBA 2ACZA 1PBEA 4G9KA 3GRSA 2GR2A 1IUTA 3K7TA 2ARDA 3AD7B 1JU2A 1YQ4A 1BF3A 3IHGA 2WHDA 2OA1A 3F8PA 3AE5A 4CNKA 2X8HA 4ECHA 5JCLA 1Y0PA 2Y6RA 3P1WA 1GRTA 4OPIA 3AE2A 1VQWA 3AD9B 2YG7A 3CTYA 1ELIA 4EIQA 1AOGA 2V3BA 2C75A 3B3RA 2GF3A 1CJ4A 5U25A 2GAHB 4U8KA 2WOVA 3L8KA 1DODA 2AAQA 2V3AA 2C66A 2WDVA 3BNMA 3QJ4A 5IQ4A 1CJ3A 2XFPA 5KMQA 4A6NB 4BK1A 3NG7X 3CGBA 3Q9TA 3IC9A 4GRTA 3G5RA 2WP9A 3T37A 1FL2A 2R4JA 2WDQA 5BVAA 1RSGA 4YSHA 3DK4A 3URHA 1V59A 2YWLA 3QFAA 3NNEA 3CGDA 4I58A 3L5OA 4B67A 4IVOB 3ICTA 3VRDB 3F8RA 3DK8A 1KNRA 5GSNA 4NTDA 1K0LA 1ZY8A 4I59A 3SFDA 1H84A 1M64A 3SYIA 3NTAA 2E4GA 3C96A 4K8DA 3BHFA 4NZHA 2FJEA 4B65A 4KX6A 2FJAA 3KPKA 4II3A 3D1CA 4H4XA 1PXCA 2Y6QA 2B76A 3UKFA 1JEHA 2X8CA 1W4XA 3M0OA 3CNJA 4GAPA 2BS2A 2BK4A 2IVEA 1KN0A 4AT2A 1H86A 3Q6JA 4USRA 4AP3A 4GDEA 4J33A 3ATQA 3ICRA 5HY5A 3SGLA 1JNZA 4BV6A 4D03A 1KSUA 1PJ7A 2QA2A 1PJ6A 2X3NA 1EL5A 3EANA 2YG4A 4TLZA 3SY4A 1N4WA 1CBOA 1OJTA 1LQUA 3H8LA 1E1LA 3QSMA 1PBCA 3CNSA 4U8IA 2YM1A 3LJPA 1H2IA 5EB4A 2XVHA 3P4PA 5M10A 4DSHA 4B64A 2GR3A 3NGCX 2NVKX 2R45A 3I6DA 4A6NA 4EIPA 1ZX9A 1K4QA 4TM0A 4A99A 4B1BA 4LIIA 2GAGB 1ZMDA 1NG4A 4NWZA 1NHRA 3CIRA 3SXIA 3CPJG 3UKQA 1FEAA 2OLNA 3ICSA 5C2TA 1HYUA 2XLRA 3LZXA 3NTDA 2QAEA 3DJGX 3AEDA 4Z25A 3FIMB 2R9ZA 4J56A 1D4EA 1VDCA 5JCNA 4H50A 2C64A 2XLSA 2B7SA 3G5SA 3V3OA 4K5SA 5IQ1A 1YKJA 2JB2A 3AE7A 5EOWA 1E1NA 2ZZ0A 1GTHA 4J31A 1FEBA 4H4VA 1SEZA 1GXFA 2RGJA 4JY3A 3UKKA 4D04A 2RGOA 1DXLA 3C4AA 2BC1A 1GTEA 3UP4A 1B37A 2WU2A 3CNTA 2ZZBA 3M13A 1Y56A 2YG5A 3T31A 2WBAA 5KMPA 1GRGA 2GH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YSY A;  5EB5 A;  1PHH A;  3QSS A;  4YSZ A;  4BK3 A;  1QJD A;  2R46 A;  4B68 A;  5HYM A;  3KLJ A;  1LVL A;  4GR1 A;  4C3X A;  2WP5 A;  1TDK A;  4OPU A;  1KFY A;  4IV9 A;  4EQX A;  4TM4 A;  3NKS A;  1MOK A;  1CJC A;  1K0J A;  1YY5 A;  2R4E A;  1MXT A;  2V60 A;  1REO A;  3AWI A;  4UDQ A;  1TDO A;  4XXG A;  3K7Q X;  4BJY A;  4DSG A;  2E1M A;  1ZOV A;  4NTE A;  1GPE A;  2GEW A;  4NEW A;  3NT6 A;  3CPH G;  2B9Y A;  3CPI G;  2VVL A;  5GRT A;  2XFN A;  3COX A;  2XDO A;  4FK1 A;  4JQ9 A;  2E5V A;  5JCI A;  2C73 A;  4YT0 A;  5JCM A;  5DBJ A;  1GSN A;  3CN8 A;  1NEN A;  3UKA A;  4BJZ A;  1GV4 A;  2VVM A;  1H81 A;  2B7R A;  3AE4 A;  4AP1 A;  3FBS A;  4O5U A;  1NDA A;  5FS8 A;  1TDE A;  5ER0 A;  1N4U A;  3P4Q A;  3H8I A;  3DJJ A;  2WES A;  4OPD A;  4DNA A;  1IUV A;  2YLR A;  1Q1W A;  4NTC A;  4LA1 A;  1H7X A;  1YQZ A;  3NYE A;  1GOS A;  1DJQ A;  3KU9 A;  4Y4N A;  2EQ9 A;  3DGH A;  3AE8 A;  3S61 A;  4K7Z A;  3VR8 A;  4H4T A;  4H7U A;  1M6I A;  1BKW A;  3AYJ A;  4TM1 A;  4H2P A;  3UCL A;  3VQR A;  2BAB A;  4A9W A;  2GR1 A;  2QA1 A;  3DME A;  4JY2 A;  1QLB A;  4H4Z A;  3P4S A;  4UP3 A;  2EQ7 A;  1GRB A;  1P2E A;  1IUW A;  4H4S A;  2BK3 A;  2H88 A;  1LPF A;  1ZDL A;  4IA5 A;  2YLW A;  1XPQ A;  3LAD A;  3GMC A;  1LV0 A;  4EQR A;  1D4C A;  1ZMC A;  2XCG A;  1D7L A;  1EL8 A;  4AOS A;  1ZKQ A;  1JNR A;  2PHH A;  3ISH A;  4H4Q A;  4WX1 A;  3SM8 A;  2B9W A;  1S2Q A;  3S5W A;  1OJA A;  2C7G A;  2C65 A;  2GQF A;  3SFE A;  1OJC A;  1FOH A;  1PN0 A;  2F5Z A;  2WPF A;  3AYI A;  3KPF A;  5BUK A;  3IF9 A;  1GER A;  2X99 A;  3CND A;  3VRB A;  2CVJ A;  5C3J A;  4EMW A;  2A89 A;  4C5O A;  1PBF A;  3GYI A;  1DOE A;  1TYP A;  1IUX A;  2OLO A;  2C76 A;  3K7M X;  3D8X A;  3GDP A;  3PS9 A;  4GF7 A;  1S3B A;  4GDP A;  5FS9 A;  4K5R A;  3UTH A;  1PDH A;  3RNM A;  3UOV A;  5EBK A;  1GEU A;  2JK6 A;  4Z44 A;  2JBV A;  3ATR A;  1H83 A;  3NRN A;  5KXJ A;  3BI5 A;  3EAO A;  1E7P A;  1TDN A;  2YLZ A;  3NK2 X;  4A7A A;  5M0Z A;  1NHS A;  3DH9 A;  5KVI A;  3NN0 X;  3P4R A;  1PS9 A;  4N9X A;  2XVE A;  2BCG G;  2GQW A;  1D4D A;  3II4 A;  2BAC A;  1CHU A;  1Q1R A;  4FDC B;  4REK A;  3RHA A;  3ZYX A;  2YLT A;  4DGK A;  2AQJ A;  5LV9 A;  2GR0 A;  2C70 A;  1QO8 A;  3WE0 A;  2C3D A;  2Z5X A;  3DJE A;  4NEV A;  1IUU A;  4EMJ A;  1IUS A;  2WET A;  3AE6 A;  3B6D A;  4KPR A;  1FCD A;  2YG6 A;  3V76 A;  2IID A;  2ZBW A;  3GSI A;  4XWZ A;  2YR4 A;  2WP6 A;  1TRB A;  4U8M A;  2VVL G;  4OVI A;  4U8L A;  4Z43 A;  1KDG A;  2GMJ A;  1KSS A;  3AEA A;  4YSX A;  1X31 B;  4O5Q A;  3V3N A;  3I3L A;  2R0C A;  2WS3 A;  2ZZC A;  2TPR A;  2VZ2 A;  1IJH A;  1DNC A;  1L0V A;  2VRL A;  3LOV A;  4CBQ A;  4P9S A;  1F8R A;  3KA7 A;  4GCM A;  2Q6U A;  1XDI A;  1LJ1 A;  1Y56 B;  3ALL A;  3FPZ A;  1B8S A;  3GDN A;  1EBD A;  1XAN A;  4M52 A;  1GAL A;  1UKV G;  4X9N A;  4TLX A;  1JOA A;  1PXA A;  4CY8 A;  3NK0 X;  3GYJ A;  4A79 A;  2W0H A;  1O95 A;  2XVI A;  1KNP A;  1GT8 A;  3HZL A;  4ZCC A;  3OC4 A;  3AEF A;  3GRT A;  3NH3 X;  4AOX A;  2A87 A;  2PYX A;  2WQY A;  4JN9 A;  2A8X A;  5J7X A;  4ZN0 A;  3KVE A;  3RP6 A;  1LTX R;  2BYB A;  2C67 A;  2O9Z A;  2YR5 A;  4Z2T A;  5FS7 A;  1DOB A;  2XLU A;  3LB8 A;  1N4V A;  1NPX A;  3E1T A;  3NYF A;  3BI2 A;  2RAB A;  2VQ7 A;  2BS3 A;  3R9U A;  4YTN A;  1F8S A;  4ZCD A;  2DKH A;  4U2T A;  3GMB A;  2CUL A;  3AE3 A;  1ZOY A;  5KWF A;  3CNP A;  3L1R A;  1B5Q A;  3C4N A;  3GWD A;  1NAA A;  2BK5 A;  3UKL A;  2BCP A;  4A5L A;  2JAE A;  1YQ3 A;  1RYI A;  5CKU A;  4EM3 A;  4J2W A;  5U63 A;  4EMI A;  1GRH A;  1PBD A;  3FMW A;  4U8J A;  2VRM A;  1B4V A;  4PAB A;  4C74 A;  4J34 A;  3PO7 A;  3UTE A;  5U1O A;  1BGJ A;  3NK1 X;  3P9U A;  2YVJ A;  1NHQ A;  4YKF A;  1GND A;  2WPC A;  1H82 A;  4YTP A;  4IVM B;  1NHP A;  2BXS A;  1CF3 A;  3AE1 A;  4H4R A;  1PJ5 A;  4Y4M A;  5HXI A;  4ICY A;  1ZK7 A;  3DK9 A;  1Q9I A;  4JDR A;  3GD3 A;  3O0H A;  2CFY A;  4Z24 A;  1JRY A;  1L9C A;  3JSK A;  4AT0 A;  2DKI A;  4CNJ A;  3NN6 X;  3AEC A;  4IA6 A;  1ONF A;  4Z2R A;  3ALM A;  3DJD A;  1GRA A;  4LU6 A;  1GRF A;  2R0G A;  4YWO A;  2YLX A;  1CL0 A;  2R0P A;  1E1K A;  4UDP A;  5KRQ A;  3IWA A;  2GB0 A;  1GES A;  2J3N A;  3M12 A;  4FX9 A;  2JB3 A;  1VG9 A;  4X9M A;  2XLT A;  4CRT A;  1EL9 A;  1GRE A;  2V5Z A;  2GV8 A;  2JB1 A;  3UOY A;  1DOC A;  1TYT A;  2GRT A;  4Z2U A;  5KOX A;  4BUR A;  2OAL A;  3ADA B;  4FK1 C;  2XFQ A;  4H2N A;  1RP0 A;  2NPX A;  1JRZ A;  1TDF A;  2H89 A;  2I0Z A;  3QVP A;  2YM2 A;  4RG4 A;  4C77 A;  3BNU A;  4MJW A;  1GET A;  4E0V A;  2XFU A;  1OJD A;  2YAU A;  3LXD A;  5BUL A;  5JCK A;  2XYO A;  4OPL A;  3CGC A;  1CC4 A;  2C3C A;  3QSE A;  2UZZ A;  1F6M A;  1BZL A;  3AD8 B;  1L9D A;  1O94 A;  2FJD A;  2V61 A;  4HA6 A;  4PAA A;  2V6O A;  1FEC A;  4K2X A;  4WCT A;  3CGE A;  3EPT A;  4CCR A;  4CY6 A;  4EQW A;  4EQS A;  4U8O A;  3UTF A;  4U2L A;  4USQ A;  1E6E A;  3RP7 A;  3AB1 A;  2QCU A;  2VQB A;  1P2H A;  1VRQ B;  4OPT A;  3UOX A;  5J60 A;  4H4W A;  4YKG A;  5L46 A;  3RP8 A;  3AXB A;  4H4U A;  4RSL A;  1Z6L A;  1F8W A;  1BWC A;  1NG3 A;  2TMD A;  3BHK A;  2YVG A;  1K0I A;  1KF6 A;  3BI4 A;  3H4K A;  4YXD A;  2BA9 A;  5HHF A;  3NLC A;  2OAM A;  1CC2 A;  2WEU A;  5KVH A;  1LQT A;  3EF6 A;  4K22 A;  1E39 A;  3DGZ A;  1H7W A;  2B9X A;  2FBW A;  2XLP A;  3OZ2 A;  4JNQ A;  4C3Y A;  5BRT A;  4Y4L A;  3PVC A;  1ZP0 A;  3UKH A;  3ZDN A;  4A65 A;  2FJB A;  1CC6 A;  2EQ6 A;  4J36 A;  1O5W A;  5KOW A;  2YR6 A;  4BK2 A;  3KKJ A;  4GUV A;  4JNA A;  5FMH A;  4TM3 A;  3KD9 A;  2Q0K A;  2VOU A;  5IPY A;  1L9E A;  3GD4 A;  2YVF A;  1E1M A;  2YG3 A;  3AEE A;  4OPG A;  2YLS A;  2YQU A;  4H2R A;  4APN A;  4X4J A;  1CJ2 A;  3NYC A;  4OCG A;  3IHM A;  4U8P A;  3NHO X;  4B63 A;  3LZW A;  3SQP A;  4RG3 A;  2XVF A;  4B69 A;  1COY A;  1DJN A;  3QFB A;  1S3E A;  2X8G A;  4UDR A;  2WU5 A;  4H4Y A;  4U8N A;  2Q0L A;  1MO9 A;  2BS4 A;  2GMH A;  1NEK A;  3AE9 A;  3UOZ A;  1F3P A;  2BC0 A;  5TR3 A;  3VRA A;  2AR8 A;  3QVR A;  4J57 A;  2JKC A;  2C72 A;  4YTM A;  2IVD A;  3UP5 A;  1N1P A;  2HQM A;  3AEB A;  4CCQ A;  4OPC A;  1JRX A;  1H6V A;  4EM4 A;  1VG0 A;  3ALJ A;  2X50 A;  3ABV A;  1D5T A;  3G5Q A;  5FS6 A;  3UKP A;  2Z5Y A;  2EQ8 A;  2APG A;  1XHC A;  3AYL A;  1D7Y A;  1BGN A;  2XVJ A;  2WPE A;  1S2Y A;  1OJ9 A;  3NIX A;  3F8D A;  4B66 A;  3AEG A;  4Z26 A;  4XWR A;  2BXR A;  2GVC A;  2RGH A;  3RED A;  4H4P A;  3ITJ A;  3FG2 P;  3GWF A;  4HB9 A;  5CQF A;  2WOW A;  3K30 A;  4H2Q A;  2Q7V A;  2WOI A;  2XFO A;  4ADW A;  2WDR A;  1EL7 A;  4U2S A;  3VR9 A;  2CDU A;  3DA1 A;  3UTG A;  1PBB A;  1PXB A;  2ACZ A;  1PBE A;  3GRS A;  2GR2 A;  1IUT A;  3K7T A;  2ARD A;  3AD7 B;  1JU2 A;  1YQ4 A;  1BF3 A;  3IHG A;  2WHD A;  2OA1 A;  3F8P A;  3AE5 A;  4CNK A;  2X8H A;  4ECH A;  5JCL A;  1Y0P A;  2Y6R A;  3P1W A;  1GRT A;  4OPI A;  3AE2 A;  1VQW A;  3AD9 B;  2YG7 A;  3CTY A;  1ELI A;  4EIQ A;  1AOG A;  2V3B A;  2C75 A;  3B3R A;  2GF3 A;  1CJ4 A;  5U25 A;  2GAH B;  4U8K A;  2WOV A;  3L8K A;  1DOD A;  2AAQ A;  2C66 A;  2V3A A;  2WDV A;  3BNM A;  3QJ4 A;  5IQ4 A;  1CJ3 A;  2XFP A;  4A6N B;  4BK1 A;  3NG7 X;  3CGB A;  3Q9T A;  3IC9 A;  4GRT A;  3G5R A;  2WP9 A;  3T37 A;  1FL2 A;  2R4J A;  2WDQ A;  5BVA A;  1RSG A;  4YSH A;  3DK4 A;  3URH A;  1V59 A;  2YWL A;  3QFA A;  3NNE A;  3CGD A;  4I58 A;  4B67 A;  4IVO B;  3ICT A;  3VRD B;  3F8R A;  3DK8 A;  1KNR A;  5GSN A;  4NTD A;  1K0L A;  1ZY8 A;  4I59 A;  3SFD A;  1H84 A;  1M64 A;  3NTA A;  2E4G A;  3C96 A;  4K8D A;  3BHF A;  4NZH A;  2FJE A;  4B65 A;  4KX6 A;  2FJA A;  3D1C A;  4H4X A;  1PXC A;  2Y6Q A;  2B76 A;  3UKF A;  1JEH A;  2X8C A;  1W4X A;  3M0O A;  3CNJ A;  2BS2 A;  2BK4 A;  2IVE A;  4AT2 A;  1H86 A;  3Q6J A;  4USR A;  4AP3 A;  4GDE A;  4J33 A;  3ATQ A;  3ICR A;  5HY5 A;  3SGL A;  1JNZ A;  4BV6 A;  4D03 A;  1KSU A;  1PJ7 A;  2QA2 A;  1PJ6 A;  2X3N A;  1EL5 A;  3EAN A;  2YG4 A;  4TLZ A;  1N4W A;  1CBO A;  1OJT A;  1LQU A;  3H8L A;  1E1L A;  3QSM A;  1PBC A;  3CNS A;  4U8I A;  2YM1 A;  3LJP A;  5EB4 A;  2XVH A;  3P4P A;  5M10 A;  4DSH A;  4B64 A;  2GR3 A;  3NGC X;  2NVK X;  2R45 A;  3I6D A;  4A6N A;  4EIP A;  1ZX9 A;  1K4Q A;  4TM0 A;  4A99 A;  4B1B A;  4LII A;  2GAG B;  1ZMD A;  1NG4 A;  1NHR A;  3CIR A;  3CPJ G;  3UKQ A;  1FEA A;  2OLN A;  3ICS A;  5C2T A;  1HYU A;  2XLR A;  3LZX A;  3NTD A;  2QAE A;  3DJG X;  3AED A;  4Z25 A;  3FIM B;  2R9Z A;  4J56 A;  1D4E A;  1VDC A;  5JCN A;  4H50 A;  2C64 A;  2XLS A;  2B7S A;  3G5S A;  3V3O A;  4K5S A;  5IQ1 A;  1YKJ A;  2JB2 A;  3AE7 A;  5EOW A;  1E1N A;  2ZZ0 A;  1GTH A;  4J31 A;  1FEB A;  4H4V A;  1SEZ A;  1GXF A;  2RGJ A;  4JY3 A;  3UKK A;  4D04 A;  2RGO A;  1DXL A;  3C4A A;  2BC1 A;  1GTE A;  3UP4 A;  1B37 A;  2WU2 A;  3CNT A;  2ZZB A;  3M13 A;  1Y56 A;  2YG5 A;  2WBA A;  1GRG A;  2GH5 A; 
#chains in the Genus database with same CATH topology
 4YSY A;  1PHH A;  3QSS A;  4YSZ A;  2R46 A;  1LVL A;  3DFY A;  3AM9 A;  3OW1 A;  2R4E A;  1CJC A;  1K0J A;  3AWI A;  3TJI A;  1REO A;  3GD6 A;  3K7Q X;  4BJY A;  4DSG A;  3HYW A;  4NEW A;  3CPH G;  2E5V A;  5JCI A;  4E5T A;  2C73 A;  4YT0 A;  1S7M A;  3UKA A;  3NXL A;  1GV4 A;  3AE4 A;  3FBS A;  5ER0 A;  3P4Q A;  2ZC8 A;  3DJJ A;  2WES A;  3NVZ B;  4NTC A;  3R11 A;  1H7X A;  3KU9 A;  4H4T A;  1BKW A;  3DME A;  4H4Z A;  1P2E A;  4H4S A;  2YLW A;  1LV0 A;  2XCG A;  1D7L A;  1EL8 A;  4AOS A;  2B9W A;  3S5W A;  5FJO A;  3VCC A;  3GC2 A;  2WPF A;  3VRB A;  4EMW A;  4J3Z A;  1DOE A;  1TYP A;  3RNM A;  3TTE A;  5JRB A;  2BRA A;  5EBK A;  2JK6 A;  3DG3 A;  2YLZ A;  3DH9 A;  3NN0 X;  2GQW A;  3II4 A;  4FDC B;  2YLT A;  2AQJ A;  4Z17 A;  3WE0 A;  1IUU A;  4EMJ A;  2WET A;  3AE6 A;  1FHV A;  2NQL A;  2IID A;  2YR4 A;  1JRP A;  3DGB A;  4OVI A;  2GMJ A;  1KSS A;  2W3S A;  1N5X A;  3I3L A;  2R0C A;  1KKO A;  4GYP C;  2VZ2 A;  1DNC A;  2DW6 A;  2VRL A;  1LJ1 A;  3FPZ A;  1B8S A;  1EBD A;  1N63 C;  4G74 A;  4M52 A;  4TLX A;  4A6G A;  2W0H A;  4DYE A;  3GRT A;  4AOX A;  4DX3 A;  3QKE A;  2AKZ A;  5FS7 A;  2PTX A;  2OZT A;  3CT2 A;  3NYF A;  1NPX A;  2DKH A;  3OZY A;  3GWD A;  1NAA A;  3UKL A;  4A5L A;  4A3R A;  2AKM A;  3SZ0 A;  2VRM A;  3UJ2 A;  3T2Z A;  3T14 A;  4EWJ A;  3P9U A;  1NHQ A;  3DG7 A;  3R1Z A;  2BXS A;  4Y4M A;  4ICY A;  2P3Z A;  4Z24 A;  1JRY A;  1L9C A;  4AT0 A;  2PCE A;  1ONF A;  4KT2 A;  1GRF A;  3DDM A;  2R0G A;  4UDP A;  3IWA A;  2V5Z A;  4H2H A;  5KOX A;  4FK1 C;  2I0Z A;  2XYO A;  2C3C A;  3T9P A;  1BZL A;  4PAA A;  3CGE A;  1WUE A;  4JN8 A;  1F9C A;  4USQ A;  2MNR A;  1SJA A;  4YKG A;  1F8W A;  1K0I A;  4YXD A;  3NLC A;  5KNL A;  2OAM A;  2E5A A;  1CC2 A;  2RDX A;  2W3R A;  1FIQ B;  3EF6 A;  2B9X A;  4JNQ A;  3CMM A;  1ZP0 A;  1TKK A;  2PP3 A;  3RGT A;  4BK2 A;  3KKJ A;  4TM3 A;  1R6W A;  2Q0K A;  2YG3 A;  3AEE A;  4M0X A;  3IHM A;  2BRY A;  3SZC A;  3SQP A;  2XVF A;  1COY A;  1S3E A;  3QN3 A;  4UDR A;  3A7A A;  3T4W A;  4ZCW A;  3RO6 A;  1TZZ A;  2BS4 A;  5TR3 A;  3QVR A;  2JKC A;  2C72 A;  3AEB A;  3P0W A;  2X50 A;  1D5T A;  7ENL A;  3UKP A;  2EQ8 A;  3ENL A;  4J1O A;  1RVK A;  1S2Y A;  1OJ9 A;  3RED A;  3FG2 P;  2WOW A;  3VR9 A;  4G9K A;  3GRS A;  1IUT A;  2ARD A;  3N4F A;  1YQ4 A;  1BF3 A;  3PFR A;  3F8P A;  3AE5 A;  2X8H A;  3P1W A;  2Y6R A;  4OPI A;  3AD9 B;  2YG7 A;  3CTY A;  1ELI A;  2GF3 A;  1DTN A;  3R10 A;  2C66 A;  2V3A A;  3QJ4 A;  5KMQ A;  1YEY A;  3Q9T A;  2WP9 A;  5ENL A;  4KEM A;  1RSG A;  1ECQ A;  4B67 A;  3VRD B;  4NTD A;  1K0L A;  1ZY8 A;  3SFD A;  2QDD A;  3C96 A;  3H12 A;  4NZH A;  2FJE A;  3JW7 A;  3FVD A;  1PXC A;  2Y6Q A;  1JEH A;  3M0O A;  3MUC A;  3Q6J A;  4ROP A;  3T6C A;  3BOX A;  4H1Z A;  1JNZ A;  1PJ7 A;  1RM6 B;  2HXT A;  3SY4 A;  1OJT A;  3EUB 3;  1E1L A;  2YM1 A;  3LJP A;  1H2I A;  5M10 A;  4DXK A;  3I6T A;  2GR3 A;  3NGC X;  2R45 A;  4EIP A;  1K4Q A;  4B1B A;  3CPJ G;  2OLN A;  5C2T A;  2QAE A;  3MQT A;  3AED A;  1P43 A;  2R9Z A;  4J56 A;  4H50 A;  3A7R A;  2XLS A;  3D47 A;  5IQ1 A;  4J31 A;  4H4V A;  1GXF A;  3OZM A;  3UKK A;  2RGO A;  3AN1 A;  3UP4 A;  2BC1 A;  3CNT A;  1Y56 A;  5KMP A;  1GRG A;  3S47 A;  4BK3 A;  3S5S A;  4GR1 A;  1TDK A;  4OPU A;  1KFY A;  3NKS A;  1YY5 A;  2V60 A;  3ZLG A;  4GIS A;  3NVV B;  4XXG A;  2GEW A;  5BOE A;  4ZOH B;  4TVW A;  2B9Y A;  2VVL A;  2QJJ A;  3CN8 A;  3ZVI A;  2VVM A;  1TDE A;  4GGH A;  3H8I A;  3IJL A;  3A7U A;  2YLR A;  2OQY A;  4G73 A;  1DJQ A;  3AE8 A;  3VR8 A;  4H7U A;  3AYJ A;  2BAB A;  4A9W A;  2QA1 A;  3CAW A;  1QLB A;  3P4S A;  2EQ7 A;  1GRB A;  2H88 A;  3GYX A;  1ZDL A;  4IA5 A;  4IZG A;  3P93 A;  1ZKQ A;  3ISH A;  1V97 A;  2AL2 B;  2QDE A;  2GDQ A;  1S2Q A;  1OJA A;  3B97 A;  3SFE A;  3AYI A;  3KUM A;  4G6H A;  1GER A;  2X99 A;  1W6T A;  4C5O A;  3H70 A;  4TM4 A;  4GF7 A;  4GDP A;  3GDP A;  5FS9 A;  4K5R A;  3UTH A;  4TVY A;  1GEU A;  4Z44 A;  3FV9 A;  2I5Q A;  3BI5 A;  3ES8 A;  3NK2 X;  4N9X A;  2ONE A;  1D4D A;  5LV9 A;  2GR0 A;  2C70 A;  4X2P A;  3SZF A;  4E6M A;  1QO8 A;  3DJE A;  1IUS A;  4KPR A;  2YG6 A;  4U8M A;  4U8L A;  1KDG A;  4YSX A;  4O5Q A;  2WS3 A;  2ZZC A;  1JPM A;  1IJH A;  1L0V A;  3PK7 A;  3SJN A;  4GCM A;  2PU0 A;  1JOA A;  1PXA A;  4A79 A;  1O95 A;  2XVI A;  1KNP A;  4ZCC A;  2PYX A;  4JN9 A;  1LTX R;  2O9Z A;  1N60 C;  1P48 A;  3E1T A;  3R0K A;  2RAB A;  4YTN A;  4ZCD A;  3H7V A;  3U9I A;  3AE3 A;  5KWF A;  3C4N A;  4HPN A;  3AMZ A;  2BK5 A;  2BCP A;  4KWS A;  1RYI A;  1YQ3 A;  5CKU A;  2OZ3 A;  1PBD A;  3FMW A;  4GFI A;  4U8J A;  4PAB A;  1MDR A;  4J34 A;  3PO7 A;  2YVJ A;  5KMR A;  4II2 A;  4YTP A;  1CF3 A;  3RCY A;  3AE1 A;  1PJ5 A;  4M6U A;  3GD3 A;  3DES A;  3I4K A;  1OEP A;  3VCN A;  3JSK A;  3NN6 X;  4IA6 A;  3ALM A;  3DJD A;  2YLX A;  1TE6 A;  2OVL A;  4IP4 A;  2GB0 A;  2J3N A;  3M12 A;  4FX9 A;  2FYM A;  2XLT A;  4CRT A;  1EL9 A;  1N5W C;  2XFQ A;  2NPX A;  1TDF A;  3QVP A;  2YM2 A;  3BNU A;  1GET A;  2XFU A;  3QLD A;  5BUL A;  3CGC A;  1CC4 A;  3QSE A;  1F6M A;  2FJD A;  2V61 A;  4WCT A;  1FEC A;  3EPT A;  4CCR A;  4HNC A;  3DG6 A;  2QGY A;  4EQW A;  4EQS A;  3UTF A;  3RP7 A;  2QCU A;  4FI4 A;  1P2H A;  1VRQ B;  5J60 A;  4H4W A;  3AXB A;  1Z6L A;  1NG3 A;  1BWC A;  2TMD A;  3UCC A;  1KF6 A;  3BI4 A;  5HHF A;  3ZVH A;  3QPE A;  1LQT A;  1X2H A;  1IYX A;  2OO6 A;  3V3W A;  3ZDN A;  4A65 A;  2FJB A;  1KCZ A;  5KOW A;  3VC6 A;  4K2S A;  3IJQ A;  3SBF A;  2VOU A;  1E1M A;  1BQG A;  4OPG A;  2AL2 A;  3NO1 A;  1CJ2 A;  3NHO X;  3SQS A;  4GAV A;  1DJN A;  3QFB A;  3UOZ A;  2GMH A;  3AE9 A;  1N1P A;  3T2K A;  1JRX A;  3V4B A;  3ABV A;  5FS6 A;  2Z5Y A;  4Z26 A;  3AEG A;  3T0K A;  5CQF A;  3FYY A;  2PGE A;  4H2Q A;  2Q7V A;  2C4C A;  3HW2 A;  1VDV A;  2CDU A;  3B9J B;  2GGI A;  1FO4 A;  1PBB A;  2ACZ A;  3SN4 A;  1JDF A;  1NEL A;  2WHD A;  2OA1 A;  3JVA A;  1Y0P A;  1VQW A;  2QJM A;  4EIQ A;  2V3B A;  2GAH B;  4U8K A;  1DOD A;  4BK1 A;  3NG7 X;  3CGB A;  3IC9 A;  4GRT A;  3T37 A;  4ZA0 A;  4IHC A;  2AL1 A;  4HCH A;  4E4F A;  3EEZ A;  4IVO B;  3ICT A;  4I59 A;  1H84 A;  1M64 A;  3DIP A;  3MSY A;  2POD A;  3BHF A;  4B65 A;  3KPK A;  4H4X A;  1MRA A;  2FKP A;  3R0U A;  2X8C A;  4GAP A;  3CNJ A;  2BK4 A;  4AT2 A;  1H86 A;  4USR A;  4AP3 A;  4GDE A;  5HY5 A;  3MWC A;  4D03 A;  3EKG A;  1EL5 A;  2PGW A;  2YG4 A;  1N4W A;  4H83 A;  2XVH A;  2NVK X;  4TM0 A;  4A99 A;  2W55 A;  1NG4 A;  3SXI A;  3UKQ A;  3ICS A;  1HYU A;  2XLR A;  4Z25 A;  4IL0 A;  1D4E A;  1VDC A;  2C64 A;  3NVW B;  3V3O A;  1YKJ A;  4JHM A;  5EOW A;  1E1N A;  1GTH A;  1SEZ A;  2PTZ A;  3RRA A;  3CK5 A;  2E3T A;  3C4A A;  4DHG A;  1B37 A;  2WU2 A;  2ZZB A;  3TWB A;  2YG5 A;  1QJD A;  5HYM A;  1MNS A;  3KLJ A;  2XGZ A;  4IV9 A;  1MOK A;  4UDQ A;  3TW9 A;  1EC9 A;  1TDO A;  1ZOV A;  4NTE A;  1KD0 A;  5GRT A;  3H8A A;  3COX A;  1EC8 A;  2XH2 A;  5JCM A;  5DBJ A;  1NEN A;  3NVY B;  4GIR A;  4AP1 A;  4O5U A;  5FS8 A;  3Q45 A;  4OPD A;  4DNA A;  1IUV A;  1Q1W A;  2PA6 A;  3UCD A;  3NYE A;  4Y4N A;  3DGH A;  3S61 A;  4K7Z A;  3TOY A;  4K8G A;  4H2P A;  3UCL A;  2QVH A;  2GR1 A;  4JY2 A;  4UP3 A;  1ONE A;  2BK3 A;  1IUW A;  1LPF A;  1JPD X;  1XPQ A;  4A35 A;  1ZMC A;  1D4C A;  2P88 A;  4WX1 A;  3SM8 A;  2C7G A;  3MKC A;  3TWA A;  3KPF A;  3IF9 A;  3CND A;  2CVJ A;  5C3J A;  3PWI A;  3VFC A;  1PBF A;  3GYI A;  3K7M X;  2PS2 A;  2C76 A;  2OLO A;  1S3B A;  2O56 A;  3P3B A;  3FXG A;  3SN0 A;  3T2Y A;  2JBV A;  3ATR A;  1H83 A;  3NRN A;  5KXJ A;  1E7P A;  4A7A A;  5M0Z A;  5KVI A;  1N61 C;  3P4R A;  1PS9 A;  2BAC A;  1CHU A;  1Q1R A;  3ZYX A;  2C3D A;  2Z5X A;  2W54 A;  4NEV A;  2MUC A;  2POZ A;  3SZW A;  2WP6 A;  2VVL G;  3T8Q A;  3D9X A;  2QJN A;  3V3N A;  3UXK A;  1F8R A;  3KA7 A;  1XDI A;  1UKV G;  2GGJ A;  1SJD A;  3GYJ A;  4GME A;  1GT8 A;  3OC4 A;  3AEF A;  4FP1 A;  2A87 A;  2WQY A;  3MY9 A;  5J7X A;  3KVE A;  3THU A;  3RP6 A;  2BYB A;  3FJ4 A;  4Z2T A;  2YR5 A;  3DEQ A;  2VQ7 A;  1XS2 A;  3R9U A;  4U2T A;  1JRO A;  3CNP A;  3R07 C;  2JAE A;  5U63 A;  1GRH A;  1B4V A;  3UTE A;  5U1O A;  1BGJ A;  1NHP A;  4H4R A;  2XH7 A;  5HXI A;  1ZK7 A;  4JDR A;  1Q9I A;  2GGG A;  3O0H A;  3UGV A;  4Z2R A;  1GRA A;  4LU6 A;  2R0P A;  5KRQ A;  3CXO A;  5KMS A;  2JB3 A;  1VG9 A;  4DN1 A;  2JB1 A;  1DOC A;  5FJT A;  4H2N A;  4MJW A;  3TQP A;  4E0V A;  3LXD A;  5JCK A;  2P0I A;  3CXB A;  2UZZ A;  3AD8 B;  3ZLF A;  1L9D A;  4HA6 A;  5J04 A;  4CY6 A;  3HRD C;  4U2L A;  3AB1 A;  2VQB A;  4OPT A;  5L46 A;  4RSL A;  5G5G B;  1FFU C;  3BHK A;  2YVG A;  2BA9 A;  2PTW A;  4G7F A;  5KVH A;  4K22 A;  1E39 A;  4DWD A;  1H7W A;  2FBW A;  2XLP A;  3OZ2 A;  3PVC A;  3HYX A;  2YR6 A;  4GUV A;  4JNA A;  1L9E A;  3GD4 A;  1SJC A;  2YQU A;  4H2R A;  4B63 A;  3OP2 A;  4B69 A;  2X8G A;  1KKR A;  2PU1 A;  4H4Y A;  4KPL A;  4U8N A;  1F3P A;  3OTR A;  2OKT A;  4EM4 A;  1VG0 A;  3ALJ A;  3UJE A;  5FJP A;  2APG A;  1STZ A;  1XHC A;  3AYL A;  1D7Y A;  1BGN A;  3NIX A;  2GVC A;  4ENL A;  2RGH A;  4H4P A;  3ITJ A;  3GWF A;  4HB9 A;  3K30 A;  1X2G A;  2XFO A;  2WDR A;  1EL7 A;  4U2S A;  3DA1 A;  2OFJ A;  3UTG A;  1PBE A;  3AD7 B;  2DW7 A;  3IHG A;  4ECH A;  5JCL A;  1E9I A;  3B3R A;  3IJI A;  3UJS A;  2WOV A;  3BNM A;  4HCL A;  3G5R A;  3GO2 A;  2R4J A;  2WDQ A;  5BVA A;  2CHR A;  3DK4 A;  2P8B A;  2YWL A;  3QFA A;  3F8R A;  3DK8 A;  4K1W A;  5GSN A;  3RR1 A;  3SYI A;  2HZG A;  3CB3 A;  3D1C A;  4GYP A;  3UKF A;  1W4X A;  2ZAD A;  4IL2 A;  4J33 A;  3SGL A;  4BV6 A;  1PJ6 A;  3EAN A;  3Q4D A;  1N62 C;  1CBO A;  1LQU A;  3MZN A;  3QSM A;  2OPJ A;  1PBC A;  3CNS A;  4U8I A;  2P8C A;  5EB4 A;  3SSZ A;  4LII A;  2GAG B;  4NWZ A;  1NHR A;  3CIR A;  2PP1 A;  4H19 A;  4HCD A;  3NTD A;  3DJG X;  3FIM B;  5JCN A;  3G5S A;  3VA8 A;  4K5S A;  3VC5 A;  1ELS A;  2RGJ A;  2PP0 A;  4JY3 A;  1MUC A;  1GTE A;  4MGG A;  3T31 A;  2WBA A;  2GH5 A;  5EB5 A;  3BSM A;  4B68 A;  3K1G A;  4C3X A;  2WP5 A;  4EQX A;  5IPY A;  4G6G A;  1MXT A;  6ENL A;  2E1M A;  1GPE A;  3NT6 A;  3OPS A;  3CPI G;  2XFN A;  5IDZ A;  2XDO A;  4FK1 A;  4JQ9 A;  3JZU A;  1GSN A;  4BJZ A;  4GGB A;  1H81 A;  1FFV C;  2B7R A;  1PDZ A;  1NDA A;  1N4U A;  4LA1 A;  1YQZ A;  1GOS A;  2EQ9 A;  1SJB A;  3BJS A;  3UXL A;  1M6I A;  4TM1 A;  3VQR A;  1WYG A;  3SN1 A;  3QTP A;  3LAD A;  3GMC A;  4IP5 A;  4EQR A;  1JNR A;  2PHH A;  4H4Q A;  3DER A;  2C65 A;  2GQF A;  1PDY A;  1OJC A;  1FOH A;  2F5Z A;  1PN0 A;  5BUK A;  2QQ6 A;  2A89 A;  3NFU A;  1IUX A;  3D8X A;  3PS9 A;  1PDH A;  3UOV A;  2XSX A;  3NS1 B;  4HYR A;  3EAO A;  1TDN A;  1NHS A;  2GSH A;  2XVE A;  2BCG G;  3FCP A;  3R25 A;  3ZLH A;  4DGK A;  3RHA A;  1T3Q C;  1SB3 B;  1NU5 A;  5FJU A;  3B6D A;  1FCD A;  3V76 A;  1BKH A;  2ZBW A;  3GSI A;  4XWZ A;  1TRB A;  4Z43 A;  3ZVH B;  3AEA A;  1X31 B;  2TPR A;  2GGH A;  3LOV A;  3ETR B;  4JN7 A;  4CBQ A;  4P9S A;  1ZXI C;  2Q6U A;  1Y56 B;  3ALL A;  3GDN A;  1XAN A;  4IT1 A;  1GAL A;  4X9N A;  3SR6 B;  4CY8 A;  3NK0 X;  3RIT A;  3HZL A;  3NH3 X;  2A8X A;  4ZN0 A;  3NRZ B;  2C67 A;  1DOB A;  3NZG A;  2XLU A;  3LB8 A;  1N4V A;  3BI2 A;  2BS3 A;  1F8S A;  3GMB A;  5FJR A;  2CUL A;  3SX6 A;  2PMQ A;  1ZOY A;  3L1R A;  1B5Q A;  3PWG A;  1R0M A;  4EM3 A;  4J2W A;  4EMI A;  2OX4 A;  2PPG A;  4C74 A;  2PTY A;  3HPF A;  3UJF A;  3NK1 X;  2XH0 A;  4YKF A;  1GND A;  2WPC A;  1H82 A;  4IVM B;  3GY1 A;  3DK9 A;  2CFY A;  4CNJ A;  2DKI A;  3AEC A;  3I6E A;  4YWO A;  1CL0 A;  3V5F A;  1E1K A;  2OZ8 A;  1XPY A;  1GES A;  4E4U A;  1GRE A;  3N6H A;  2GV8 A;  3UOY A;  4Z2U A;  1TYT A;  2GRT A;  4BUR A;  2OAL A;  3ADA B;  4X9M A;  4D04 A;  1RP0 A;  1JRZ A;  2H89 A;  4RG4 A;  4C77 A;  1OJD A;  2YAU A;  1VQZ A;  4OPL A;  3HYV A;  1O94 A;  1WUF A;  2V6O A;  4K2X A;  4NNJ A;  3UJR A;  4U8O A;  4MKS A;  1E6E A;  3UOX A;  5G5H B;  3RP8 A;  4H4U A;  3H4K A;  2WEU A;  3DGZ A;  5BRT A;  4C3Y A;  4Y4L A;  4YWS A;  3UKH A;  1CC6 A;  2EQ6 A;  4J36 A;  1O5W A;  5FMH A;  3KD9 A;  2YVF A;  2YLS A;  4APN A;  4X4J A;  3NYC A;  4OCG A;  4U8P A;  3LZW A;  4RG3 A;  3DFH A;  3STP A;  2HXU A;  2WU5 A;  2Q0L A;  1MO9 A;  1NEK A;  2BC0 A;  3VRA A;  2AR8 A;  3UP5 A;  4J57 A;  4YTM A;  4CCQ A;  2GL5 A;  2IVD A;  3IK4 A;  2HQM A;  3PG6 A;  4OPC A;  1H6V A;  3G5Q A;  2XVJ A;  2WPE A;  4B66 A;  4HNL A;  3F8D A;  4XWR A;  3N4E A;  2BXR A;  2WOI A;  4ADW A;  2XH4 A;  1PXB A;  5BOF A;  2GR2 A;  3K7T A;  1JU2 A;  1EBH A;  4CNK A;  1GRT A;  1EC7 A;  3AE2 A;  1AOG A;  2C75 A;  1CJ4 A;  5U25 A;  3L8K A;  2AAQ A;  2WDV A;  5IQ4 A;  1CJ3 A;  2XFP A;  4A6N B;  1FL2 A;  3V5C A;  3ES7 A;  4YSH A;  3URH A;  1V59 A;  3NNE A;  3CGD A;  4I58 A;  3L5O A;  1KNR A;  1JCT A;  5EU9 A;  3NTA A;  2E4G A;  4K8D A;  2HNE A;  3D46 A;  4KX6 A;  2FJA A;  4II3 A;  2B76 A;  2BS2 A;  2IVE A;  1KN0 A;  4F4R A;  3TJ4 A;  3VDG A;  3ATQ A;  3ICR A;  1KSU A;  1L8P A;  4Z1Y A;  2QA2 A;  2X3N A;  4TLZ A;  3H8L A;  2OLA A;  3P4P A;  4DSH A;  4B64 A;  1FHU A;  3I6D A;  4A6N A;  1ZX9 A;  4HN8 A;  1EBG A;  3TCS A;  1ZMD A;  2GGE A;  1FEA A;  2OG9 A;  3N6J A;  3LZX A;  4MMW A;  2B7S A;  4E8G A;  2JB2 A;  1MDL A;  3AE7 A;  2ZZ0 A;  1FEB A;  2PSN A;  2OQH A;  1DXL A;  3CYJ A;  4G8T A;  3M13 A;  3U4F A;  4REK A; 
#chains in the Genus database with same CATH homology
 4YSY A;  5EB5 A;  1PHH A;  3QSS A;  4YSZ A;  4BK3 A;  1QJD A;  2R46 A;  4B68 A;  5HYM A;  3KLJ A;  1LVL A;  4GR1 A;  4C3X A;  2WP5 A;  1TDK A;  4OPU A;  1KFY A;  4IV9 A;  4EQX A;  4TM4 A;  3NKS A;  1MOK A;  1CJC A;  1K0J A;  1YY5 A;  2R4E A;  1MXT A;  2V60 A;  1REO A;  3AWI A;  4G6G A;  4UDQ A;  1TDO A;  4XXG A;  3K7Q X;  4BJY A;  4DSG A;  2E1M A;  1ZOV A;  3HYW A;  1GPE A;  2GEW A;  4NEW A;  3NT6 A;  3CPH G;  4NTE A;  2B9Y A;  3CPI G;  2VVL A;  5GRT A;  2XFN A;  3COX A;  2XDO A;  4FK1 A;  4JQ9 A;  2E5V A;  5JCI A;  2C73 A;  4YT0 A;  5JCM A;  5DBJ A;  1GSN A;  1S7M A;  3CN8 A;  1NEN A;  3UKA A;  4BJZ A;  1GV4 A;  2VVM A;  1H81 A;  2B7R A;  3AE4 A;  4AP1 A;  3FBS A;  4O5U A;  1NDA A;  5FS8 A;  1TDE A;  5ER0 A;  1N4U A;  3P4Q A;  3H8I A;  3DJJ A;  2WES A;  4OPD A;  4DNA A;  1IUV A;  2YLR A;  1Q1W A;  4NTC A;  4LA1 A;  1H7X A;  1YQZ A;  3NYE A;  1GOS A;  1DJQ A;  3KU9 A;  4G73 A;  4Y4N A;  2EQ9 A;  3DGH A;  3AE8 A;  3S61 A;  4K7Z A;  3VR8 A;  4H4T A;  4H7U A;  1M6I A;  1BKW A;  3AYJ A;  4TM1 A;  4H2P A;  3UCL A;  3VQR A;  2BAB A;  4A9W A;  2GR1 A;  2QA1 A;  3DME A;  4JY2 A;  1QLB A;  4H4Z A;  3P4S A;  4UP3 A;  2EQ7 A;  1GRB A;  1P2E A;  1IUW A;  4H4S A;  2BK3 A;  2H88 A;  3GYX A;  1LPF A;  1ZDL A;  4IA5 A;  2YLW A;  1XPQ A;  3LAD A;  3GMC A;  1LV0 A;  4EQR A;  1D4C A;  1ZMC A;  2XCG A;  1D7L A;  1EL8 A;  4AOS A;  1ZKQ A;  1JNR A;  2PHH A;  3ISH A;  4H4Q A;  4WX1 A;  3SM8 A;  2B9W A;  1S2Q A;  3S5W A;  1OJA A;  2C7G A;  2C65 A;  2GQF A;  3SFE A;  1OJC A;  1FOH A;  2F5Z A;  1PN0 A;  2WPF A;  3AYI A;  3KPF A;  5BUK A;  4G6H A;  3IF9 A;  1GER A;  2X99 A;  3CND A;  3VRB A;  2CVJ A;  5C3J A;  4EMW A;  2A89 A;  4C5O A;  1PBF A;  3GYI A;  1DOE A;  1TYP A;  1IUX A;  2OLO A;  2C76 A;  3K7M X;  3D8X A;  3GDP A;  3PS9 A;  4GF7 A;  1S3B A;  4GDP A;  5FS9 A;  4K5R A;  3UTH A;  1PDH A;  3RNM A;  5JRB A;  2BRA A;  3UOV A;  5EBK A;  1GEU A;  2JK6 A;  3T2Y A;  4Z44 A;  2JBV A;  3ATR A;  1H83 A;  3NRN A;  5KXJ A;  3BI5 A;  3EAO A;  1E7P A;  1TDN A;  2YLZ A;  3NK2 X;  4A7A A;  5M0Z A;  1NHS A;  3DH9 A;  5KVI A;  3NN0 X;  3P4R A;  1PS9 A;  4N9X A;  2XVE A;  2BCG G;  2GQW A;  1D4D A;  3II4 A;  2BAC A;  1CHU A;  1Q1R A;  4FDC B;  4REK A;  3RHA A;  3ZYX A;  2YLT A;  4DGK A;  2AQJ A;  5LV9 A;  2GR0 A;  2C70 A;  3SZF A;  1QO8 A;  3WE0 A;  2C3D A;  2Z5X A;  3DJE A;  4NEV A;  1IUU A;  4EMJ A;  1IUS A;  2WET A;  3AE6 A;  3B6D A;  4KPR A;  1FCD A;  2YG6 A;  3V76 A;  3SZW A;  2IID A;  2ZBW A;  3GSI A;  4XWZ A;  2YR4 A;  2WP6 A;  1TRB A;  4U8M A;  2VVL G;  4OVI A;  4U8L A;  4Z43 A;  1KDG A;  2GMJ A;  1KSS A;  3AEA A;  4YSX A;  1X31 B;  3D9X A;  4O5Q A;  3V3N A;  3I3L A;  2R0C A;  2WS3 A;  2ZZC A;  2TPR A;  2VZ2 A;  1IJH A;  1DNC A;  1L0V A;  2VRL A;  3LOV A;  4CBQ A;  4P9S A;  1F8R A;  3KA7 A;  4GCM A;  2Q6U A;  1XDI A;  1LJ1 A;  1Y56 B;  3ALL A;  3FPZ A;  1B8S A;  3GDN A;  1EBD A;  4G74 A;  1XAN A;  4M52 A;  1GAL A;  1UKV G;  4X9N A;  4TLX A;  1JOA A;  1PXA A;  4CY8 A;  3NK0 X;  3GYJ A;  4A79 A;  2W0H A;  1O95 A;  2XVI A;  1KNP A;  1GT8 A;  3HZL A;  4ZCC A;  3OC4 A;  3AEF A;  3GRT A;  3NH3 X;  4AOX A;  2A87 A;  2PYX A;  2WQY A;  4JN9 A;  2A8X A;  5J7X A;  4ZN0 A;  3KVE A;  3RP6 A;  1LTX R;  2BYB A;  2C67 A;  2O9Z A;  2YR5 A;  4Z2T A;  5FS7 A;  1DOB A;  2XLU A;  3LB8 A;  1N4V A;  1NPX A;  3E1T A;  3NYF A;  3BI2 A;  2RAB A;  2VQ7 A;  2BS3 A;  3R9U A;  4YTN A;  1F8S A;  4ZCD A;  2DKH A;  4U2T A;  3GMB A;  3SX6 A;  2CUL A;  3AE3 A;  1ZOY A;  5KWF A;  3CNP A;  3L1R A;  1B5Q A;  3C4N A;  3GWD A;  1NAA A;  2BK5 A;  3UKL A;  2BCP A;  4A5L A;  2JAE A;  1YQ3 A;  1RYI A;  5CKU A;  4EM3 A;  4J2W A;  5U63 A;  4EMI A;  3SZ0 A;  1GRH A;  1PBD A;  3FMW A;  4U8J A;  2VRM A;  1B4V A;  4PAB A;  4C74 A;  4J34 A;  3T2Z A;  3PO7 A;  3T14 A;  3UTE A;  5U1O A;  1BGJ A;  3NK1 X;  3P9U A;  2YVJ A;  1NHQ A;  5KMR A;  4II2 A;  4YKF A;  1GND A;  2WPC A;  1H82 A;  4YTP A;  4IVM B;  1NHP A;  2BXS A;  1CF3 A;  3AE1 A;  4H4R A;  1PJ5 A;  4Y4M A;  5HXI A;  4ICY A;  1ZK7 A;  3DK9 A;  4JDR A;  1Q9I A;  3GD3 A;  3O0H A;  2CFY A;  4Z24 A;  1JRY A;  1L9C A;  3JSK A;  4AT0 A;  2DKI A;  4CNJ A;  3NN6 X;  3AEC A;  4IA6 A;  1ONF A;  4Z2R A;  3ALM A;  3DJD A;  1GRA A;  4LU6 A;  1GRF A;  2R0G A;  4YWO A;  2YLX A;  1CL0 A;  2R0P A;  1E1K A;  4UDP A;  5KRQ A;  3IWA A;  2GB0 A;  1GES A;  2J3N A;  3M12 A;  4FX9 A;  5KMS A;  2JB3 A;  1VG9 A;  4X9M A;  2XLT A;  4CRT A;  1EL9 A;  1GRE A;  2V5Z A;  2GV8 A;  2JB1 A;  3UOY A;  1DOC A;  1TYT A;  2GRT A;  4Z2U A;  5KOX A;  4BUR A;  2OAL A;  3ADA B;  4FK1 C;  2XFQ A;  4H2N A;  1RP0 A;  2NPX A;  1JRZ A;  1TDF A;  2H89 A;  2I0Z A;  3QVP A;  2YM2 A;  4RG4 A;  4C77 A;  3BNU A;  4MJW A;  1GET A;  4E0V A;  2XFU A;  1OJD A;  2YAU A;  3LXD A;  5BUL A;  5JCK A;  2XYO A;  4OPL A;  3HYV A;  3CGC A;  1CC4 A;  2C3C A;  3QSE A;  2UZZ A;  1F6M A;  1BZL A;  3AD8 B;  1L9D A;  1O94 A;  2FJD A;  2V61 A;  4HA6 A;  4PAA A;  2V6O A;  1FEC A;  4K2X A;  4WCT A;  3CGE A;  3EPT A;  4CCR A;  4NNJ A;  4CY6 A;  4EQW A;  4EQS A;  4U8O A;  3UTF A;  4U2L A;  4USQ A;  1E6E A;  3RP7 A;  3AB1 A;  2QCU A;  2VQB A;  1P2H A;  1VRQ B;  4OPT A;  3UOX A;  5J60 A;  4H4W A;  4YKG A;  5L46 A;  3RP8 A;  3AXB A;  4H4U A;  4RSL A;  1Z6L A;  1F8W A;  1BWC A;  1NG3 A;  2TMD A;  3BHK A;  2YVG A;  1K0I A;  1KF6 A;  3BI4 A;  3H4K A;  4YXD A;  2BA9 A;  5HHF A;  3NLC A;  5KNL A;  2OAM A;  1CC2 A;  2WEU A;  5KVH A;  1LQT A;  3EF6 A;  4K22 A;  1E39 A;  3DGZ A;  1H7W A;  2B9X A;  2FBW A;  2XLP A;  3OZ2 A;  3CMM A;  4JNQ A;  4C3Y A;  4Y4L A;  5BRT A;  3PVC A;  1ZP0 A;  3UKH A;  3ZDN A;  4A65 A;  3HYX A;  2FJB A;  1CC6 A;  2EQ6 A;  4J36 A;  1O5W A;  5KOW A;  2YR6 A;  4BK2 A;  3KKJ A;  4GUV A;  4JNA A;  5FMH A;  4TM3 A;  3KD9 A;  2Q0K A;  2VOU A;  5IPY A;  1L9E A;  3GD4 A;  2YVF A;  1E1M A;  2YG3 A;  3AEE A;  4OPG A;  2YLS A;  2YQU A;  4H2R A;  4APN A;  4X4J A;  1CJ2 A;  3NYC A;  4OCG A;  3IHM A;  4U8P A;  2BRY A;  3NHO X;  4B63 A;  3LZW A;  3SZC A;  3SQP A;  4RG3 A;  2XVF A;  4B69 A;  4GAV A;  1COY A;  1DJN A;  3QFB A;  1S3E A;  2X8G A;  4UDR A;  2WU5 A;  4H4Y A;  4U8N A;  2Q0L A;  1MO9 A;  2BS4 A;  2GMH A;  1NEK A;  3AE9 A;  3UOZ A;  1F3P A;  2BC0 A;  5TR3 A;  3VRA A;  2AR8 A;  3QVR A;  4J57 A;  2JKC A;  2C72 A;  4YTM A;  2IVD A;  3UP5 A;  1N1P A;  2HQM A;  3PG6 A;  3AEB A;  3T2K A;  4CCQ A;  4OPC A;  1JRX A;  1H6V A;  4EM4 A;  1VG0 A;  3ALJ A;  2X50 A;  3ABV A;  1D5T A;  3G5Q A;  5FS6 A;  3UKP A;  2Z5Y A;  2EQ8 A;  2APG A;  1XHC A;  3AYL A;  1D7Y A;  1BGN A;  2XVJ A;  2WPE A;  1S2Y A;  1OJ9 A;  3NIX A;  3F8D A;  4B66 A;  3AEG A;  4Z26 A;  4XWR A;  2BXR A;  2GVC A;  2RGH A;  3T0K A;  3RED A;  4H4P A;  3ITJ A;  3FG2 P;  3GWF A;  4HB9 A;  5CQF A;  2WOW A;  3K30 A;  4H2Q A;  2Q7V A;  2C4C A;  2WOI A;  2XFO A;  4ADW A;  2WDR A;  1EL7 A;  4U2S A;  3VR9 A;  2CDU A;  3DA1 A;  3UTG A;  1PBB A;  1PXB A;  2ACZ A;  1PBE A;  4G9K A;  3GRS A;  2GR2 A;  1IUT A;  3K7T A;  2ARD A;  3AD7 B;  1JU2 A;  1YQ4 A;  1BF3 A;  3IHG A;  2WHD A;  2OA1 A;  3F8P A;  3AE5 A;  4CNK A;  2X8H A;  4ECH A;  5JCL A;  1Y0P A;  2Y6R A;  3P1W A;  1GRT A;  4OPI A;  3AE2 A;  1VQW A;  3AD9 B;  2YG7 A;  3CTY A;  1ELI A;  4EIQ A;  1AOG A;  2V3B A;  2C75 A;  3B3R A;  2GF3 A;  1CJ4 A;  5U25 A;  2GAH B;  4U8K A;  2WOV A;  3L8K A;  1DOD A;  2AAQ A;  2V3A A;  2C66 A;  2WDV A;  3BNM A;  3QJ4 A;  5IQ4 A;  1CJ3 A;  2XFP A;  5KMQ A;  4A6N B;  4BK1 A;  3NG7 X;  3CGB A;  3Q9T A;  3IC9 A;  4GRT A;  3G5R A;  2WP9 A;  3T37 A;  1FL2 A;  2R4J A;  2WDQ A;  5BVA A;  1RSG A;  4YSH A;  3DK4 A;  3URH A;  1V59 A;  2YWL A;  3QFA A;  3NNE A;  3CGD A;  4I58 A;  3L5O A;  4B67 A;  4IVO B;  3ICT A;  3VRD B;  3F8R A;  3DK8 A;  1KNR A;  5GSN A;  4NTD A;  1K0L A;  1ZY8 A;  4I59 A;  3SFD A;  1H84 A;  1M64 A;  3SYI A;  3NTA A;  2E4G A;  3C96 A;  4K8D A;  3BHF A;  4NZH A;  2FJE A;  4B65 A;  4KX6 A;  2FJA A;  3KPK A;  4II3 A;  3D1C A;  4H4X A;  1PXC A;  2Y6Q A;  2B76 A;  3UKF A;  1JEH A;  2X8C A;  1W4X A;  3M0O A;  3CNJ A;  4GAP A;  2BS2 A;  2BK4 A;  2IVE A;  1KN0 A;  4AT2 A;  1H86 A;  3Q6J A;  4USR A;  4AP3 A;  4GDE A;  4J33 A;  3ATQ A;  3ICR A;  5HY5 A;  3SGL A;  1JNZ A;  4BV6 A;  4D03 A;  1KSU A;  1PJ7 A;  2QA2 A;  1PJ6 A;  2X3N A;  1EL5 A;  3EAN A;  2YG4 A;  4TLZ A;  3SY4 A;  1N4W A;  1CBO A;  1OJT A;  1LQU A;  3H8L A;  1E1L A;  3QSM A;  1PBC A;  3CNS A;  4U8I A;  2YM1 A;  3LJP A;  1H2I A;  5EB4 A;  2XVH A;  3P4P A;  5M10 A;  4DSH A;  4B64 A;  2GR3 A;  3NGC X;  2NVK X;  2R45 A;  3I6D A;  4A6N A;  4EIP A;  1ZX9 A;  1K4Q A;  4TM0 A;  4A99 A;  4B1B A;  4LII A;  2GAG B;  1ZMD A;  1NG4 A;  4NWZ A;  1NHR A;  3CIR A;  3SXI A;  3CPJ G;  3UKQ A;  1FEA A;  2OLN A;  3ICS A;  5C2T A;  1HYU A;  2XLR A;  3LZX A;  3NTD A;  2QAE A;  3DJG X;  3AED A;  4Z25 A;  3FIM B;  2R9Z A;  4J56 A;  1D4E A;  1VDC A;  5JCN A;  4H50 A;  2C64 A;  2XLS A;  2B7S A;  3G5S A;  3V3O A;  4K5S A;  5IQ1 A;  1YKJ A;  2JB2 A;  3AE7 A;  5EOW A;  1E1N A;  2ZZ0 A;  1GTH A;  4J31 A;  1FEB A;  4H4V A;  1SEZ A;  1GXF A;  2RGJ A;  4JY3 A;  3UKK A;  4D04 A;  2RGO A;  1DXL A;  3C4A A;  2BC1 A;  1GTE A;  3UP4 A;  1B37 A;  2WU2 A;  3CNT A;  2ZZB A;  3M13 A;  1Y56 A;  2YG5 A;  3T31 A;  2WBA A;  5KMP A;  1GRG A;  2GH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...