4BV6A

Refined crystal structure of the human apoptosis inducing factor
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
Knots found
sequence length
484
structure length
471
Chain Sequence
KAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Structural Insights Into the Coenzyme Mediated Monomer-Dimer Transition of the Pro-Apoptotic Apoptosis Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 147
structure length 471
sequence length 484
other databases KnotProt 2.0: S -31
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4bv6A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4bv6A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4bv6A01
1Y0PA 1ELIA 1BZLA 3BI4A 1GV4A 3H4KA 1IUXA 3CPJG 3IC9A 1CC6A 1KNRA 2B9YA 2GVCA 1S2YA 4GCMA 4CRTA 3VR9A 2VQ7A 3NGCX 4NEVA 2A87A 4DSGA 2GR1A 1GETA 1TDNA 1YQ4A 3URHA 1B8SA 4C5OA 3BI5A 2RGOA 4EMWA 1JRZA 1ZOYA 1GXFA 2XVFA 4BJYA 2H88A 1IUUA 2Q0LA 3C4AA 3DA1A 4IA5A 4TM1A 4IA6A 4TM0A 2YG7A 4U8PA 4EM4A 1VDCA 4TM3A 3CNPA 3H8LA 3QSSA 3S5WA 1GPEA 4NEWA 4B67A 1K0IA 4FDCB 2Y6QA 1NEKA 2R0CA 2XVJA 2RGHA 1GEUA 2WBAA 2WDVA 2BACA 3ICRA 4IVOB 4YT0A 2JK6A 4ADWA 2W0HA 4OCGA 3NTAA 2E4GA 2IIDA 1KSUA 4H4SA 2QA2A 1F6MA 1LQTA 4TM4A 3P4RA 2Q7VA 3AD7B 1N4WA 4BJZA 5L46A 1VG0A 2NVKX 3P1WA 1Y56B 2VRMA 3ICTA 1O94A 2XLTA 5KRQA 4JY2A 4C3XA 3SFDA 4AOXA 5KOXA 2O9ZA 3LJPA 4EMJA 5IQ1A 1KF6A 4Z43A 5ER0A 3LXDA 5FS7A 4YXDA 2WP5A 5GRTA 3UP5A 4AP3A 3LADA 1ZOVA 4PABA 4H4UA 3GWDA 2R4JA 3RP7A 1Z6LA 2GAHB 4JN9A 2BYBA 3UKQA 2EQ9A 1S3BA 2OA1A 3NYCA 4Z25A 5J7XA 4Z2TA 1ONFA 2YM2A 1VG9A 2GR0A 1LJ1A 4YTNA 1ZKQA 2XFPA 1NHQA 3DK9A 1H83A 5KVIA 1EL7A 2YM1A 3AE1A 3NYFA 3CGEA 3AEAA 5FMHA 3NN0X 4K7ZA 3DMEA 1NAAA 5KVHA 3R9UA 3UTFA 4EM3A 2B9WA 3D8XA 3RP6A 4B64A 2PYXA 5JCLA 3NK1X 5BUKA 3IHGA 2EQ6A 3DH9A 3GD4A 4O5QA 5C3JA 2WU5A 1PDHA 4K2XA 2GMJA 3ISHA 1KNPA 1GRFA 1D7LA 4RG4A 3AEFA 2C73A 3DJDA 1M64A 2VRLA 1DXLA 1ZY8A 2WPEA 1F8SA 3CPHG 5DBJA 4CNKA 2BC1A 4Z26A 5U25A 1CJ4A 1H7XA 2BK5A 1E7PA 4B68A 2XLRA 1ZP0A 4OPCA 1FEBA 1PJ5A 3P9UA 4GR1A 4U8MA 4H4YA 3ALMA 3VQRA 2FJAA 1NHPA 3OC4A 5JCKA 1CHUA 1PJ6A 3BHKA 2X8HA 3M0OA 3OZ2A 5EOWA 4BK1A 5FS9A 2BXSA 1FEAA 3VRDB 2AR8A 3F8DA 3P4SA 4EIQA 2WS3A 4J33A 4LIIA 5KOWA 1MOKA 3F8RA 3CGBA 1E6EA 5KWFA 5JCNA 3QSMA 3V3OA 3C4NA 1CC2A 2DKHA 4XWZA 3REDA 3AEEA 1E1KA 4H4VA 1KDGA 4OPGA 2QAEA 3K7QX 1ZX9A 2YVGA 1EL9A 4A6NA 4FX9A 4Y4LA 3ABVA 3E1TA 2AAQA 4Z2UA 1K0LA 2RGJA 4YKGA 1L9EA 3AE5A 2R4EA 4J2WA 3FMWA 2X50A 2XFOA 1XANA 2JKCA 2WHDA 1K4QA 3AXBA 4WX1A 3QVPA 4O5UA 1VQWA 3LZXA 4PAAA 4U2TA 3QFBA 2JB3A 2APGA 2YLZA 3ITJA 1D4CA 4D03A 1DJNA 4JDRA 3AE6A 3VR8A 5TR3A 2BCPA 3B6DA 4AT0A 2BS3A 3NK2X 1PS9A 4HB9A 1TDFA 1CL0A 5LV9A 4REKA 2IVDA 4UDPA 5M0ZA 4B69A 1O95A 4J56A 3UCLA 3PO7A 3SFEA 2XVIA 4A99A 4H4XA 4A9WA 3CNTA 3ATQA 2BXRA 1JEHA 4P9SA 3DJJA 3KLJA 1N4VA 3EPTA 3G5SA 3PVCA 3IF9A 1NDAA 1KSSA 1JOAA 2C3DA 1PBBA 1D4EA 5CKUA 2V5ZA 2VQBA 3CNSA 4GUVA 4U2SA 4K5SA 4CY6A 3EF6A 2B7SA 2JB1A 2ACZA 3K7MX 4RSLA 1IUWA 1NENA 3EAOA 2WPCA 4H4QA 2YG4A 3L8KA 2TMDA 4NZHA 4UDRA 1GRBA 1F8WA 1PXAA 3KA7A 3Q6JA 3UKPA 5U1OA 4K5RA 4AOSA 2ZZBA 2JB2A 5C2TA 4Y4MA 2V60A 3L1RA 5IPYA 4D04A 2BS2A 2YLSA 3UTGA 2GR2A 3AE8A 4U8LA 2XVHA 1L9CA 1BGJA 1H86A 1L0VA 2GEWA 2R0GA 4OPLA 2WP9A 1DOBA 1KFYA 1TYTA 4NTDA 3AE9A 3VRBA 2BK3A 3CTYA 4E0VA 3AE4A 1GOSA 1H84A 1GTEA 1PBDA 3B3RA 1VRQB 3KPFA 3NK0X 5FS6A 2YQUA 3NRNA 1E39A 3QJ4A 4EQSA 2C76A 3UKHA 4A5LA 1NG3A 2BA9A 3II4A 3QFAA 1B37A 4BK3A 2A8XA 4GDPA 3AE7A 3SM8A 3UTHA 1GREA 2JBVA 2BC0A 2VVLA 5BULA 3GYIA 1Q1WA 4CCQA 1H82A 1N4UA 4YTPA 2GV8A 1NHSA 3F8PA 4TLXA 1TDEA 5JCIA 3NH3X 2X3NA 3ALJA 1DODA 3GDNA 1LPFA 4K22A 1GRTA 2YAUA 2FJEA 4OPDA 3WE0A 1S2QA 5HXIA 2V61A 1B4VA 1Y56A 2E5VA 3LZWA 5GSNA 1ZDLA 1IUSA 2C67A 3UOZA 1P2EA 3GMBA 2BS4A 1FECA 1PXBA 3CGCA 1CC4A 1OJAA 2GR3A 2R0PA 2Q6UA 4H7UA 3I6DA 1NPXA 2WEUA 3GRSA 2B76A 2XDOA 1O5WA 3GWFA 3K30A 3NG7X 4ZCCA 4CCRA 5JCMA 1F8RA 1UKVG 2YVFA 1X31B 2A89A 4YTMA 2BCGG 1D7YA 4JY3A 1LQUA 2WDRA 1B5QA 2FBWA 1JRXA 1FCDA 3FIMB 4Z2RA 1JNZA 2GRTA 1E1NA 2C75A 4J31A 2NPXA 1YQ3A 2Q0KA 3K7TA 5BVAA 2OLNA 4CBQA 2OAMA 4K8DA 3UOXA 3P4QA 4APNA 2GQWA 2C66A 3VRAA 4JQ9A 3NHOX 4ZN0A 4C77A 2B9XA 1PJ7A 2E1MA 4EQXA 3CNDA 3M12A 1TRBA 3NLCA 2YR5A 3SGLA 2OALA 3ADAB 2VZ2A 4MJWA 4UP3A 4GF7A 3DK8A 1MXTA 2XVEA 2YLXA 4BV6A 1L9DA 3M13A 4GDEA 4A79A 5U63A 3FPZA 2V3AA 2ZZCA 2IVEA 4H4TA 1ZMDA 1E1MA 4NTCA 1V59A 2WPFA 1DJQA 3AB1A 1H6VA 2YLTA 3RNMA 1EL5A 1GTHA 1MO9A 2B7RA 2BK4A 3AECA 2C3CA 3GMCA 2GQFA 2TPRA 4B66A 4EQRA 1CF3A 4A65A 3GRTA 4LU6A 4CNJA 4ECHA 4Z44A 3ATRA 2QA1A 1YKJA 1BKWA 1M6IA 1P2HA 1IUVA 2Z5XA 2R45A 1BGNA 1PBCA 3AEBA 3BNUA 3AE3A 4FK1A 2H89A 3S61A 3BHFA 2V3BA 4M52A 2I0ZA 1IUTA 2YG5A 3DJGX 2GF3A 4EQWA 3IWAA 3ALLA 4OPUA 4RG3A 4EIPA 3FG2P 1EL8A 3EANA 2CVJA 3CNJA 3LB8A 4U8IA 3CIRA 2QCUA 4BURA 4USRA 1CJCA 2VOUA 2UZZA 1OJTA 1JRYA 4JNQA 3NNEA 1RYIA 4X4JA 2CDUA 4J34A 2OLOA 1GALA 5EBKA 3G5QA 4CY8A 3Q9TA 4JNAA 1ZMCA 3JSKA 4AP1A 3UOYA 3KVEA 1QLBA 3GD3A 2YR6A 4I59A 5M10A 2C65A 2WQYA 3RHAA 1F3PA 1GSNA 1EBDA 1IJHA 3NIXA 1TDKA 4AT2A 2WETA 1TDOA 4YSYA 1GT8A 4ICYA 3LOVA 4H2NA 1PHHA 1SEZA 3AWIA 2WOIA 3G5RA 1GNDA 4HA6A 1PBFA 3P4PA 2XFQA 2ZZ0A 1XHCA 4A7AA 3HZLA 1N1PA 3UP4A 5HYMA 2X8CA 3NT6A 4DNAA 4XWRA 4H50A 5HHFA 2C72A 3QVRA 1S3EA 3AEDA 4ZCDA 1RSGA 4OPTA 1JU2A 2HQMA 2CULA 3NN6X 1PN0A 2GAGB 4U8NA 3CGDA 3AYJA 1OJCA 3BI2A 3IHMA 1GESA 3UKKA 1OJ9A 2VVLG 3QSEA 3UTEA 4DGKA 1FOHA 1Q9IA 2X8GA 2XLPA 4USQA 3GYJA 1E1LA 3NTDA 4XXGA 1D5TA 3DK4A 3AD8B 3T37A 2XYOA 3RP8A 2YR4A 2CFYA 4YWOA 2WESA 1FL2A 3ICSA 1COYA 5BRTA 1YY5A 2WOWA 2PHHA 1ZK7A 2R9ZA 3GDPA 3V3NA 2YLRA 4U8KA 3AE2A 1LVLA 4NTEA 4KX6A 2WDQA 3BNMA 3I3LA 4H2RA 4U2LA 5EB5A 1GRHA 4C3YA 4H4PA 4YSHA 4YSZA 3KU9A 5CQFA 3V76A 1DOCA 4YSXA 3DJEA 1W4XA 1XPQA 3CPIG 5KXJA 1Q1RA 4IV9A 5HY5A 1GRGA 2FJDA 1HYUA 4I58A 2XFUA 4YKFA 2DKIA 4IVMB 3DGHA 2YG6A 4Z24A 5IQ4A 2Z5YA 4J57A 2XLUA 4LA1A 1NHRA 3AYIA 1REOA 2JAEA 4N9XA 3UKFA 2AQJA 4A6NB 4KPRA 1K0JA 1QJDA 1XDIA 4H4RA 1CJ2A 1NG4A 3AEGA 3FBSA 1LTXR 2R46A 4TLZA 5J60A 1OJDA 3NYEA 1JNRA 3SQPA 1DNCA 3O0HA 4GRTA 3D1CA 4DSHA 2J3NA 4EMIA 2F5ZA 1RP0A 2FJBA 2GMHA 3PS9A 4OPIA 2C7GA 4Y4NA 4B63A 4H4ZA 1BF3A 3CN8A 1CBOA 5FS8A 5EB4A 2X99A 2V6OA 2WOVA 2ARDA 4U8JA 1DOEA 3GSIA 2WP6A 1D4DA 4J36A 4OVIA 1H81A 2WU2A 2BABA 2ZBWA 4UDQA 2C70A 3UKLA 1PBEA 4H2QA 2RABA 3UKAA 4B1BA 1H7WA 4X9NA 3ZDNA 3AD9B 2XLSA 3AYLA 2YWLA 1QO8A 2C64A 3NKSA 2EQ7A 2VVMA 2YG3A 2EQ8A 3COXA 4B65A 3KKJA 3UOVA 4WCTA 4BK2A 1PXCA 2YLWA 1GERA 2YVJA 1CJ3A 3ZYXA 2XCGA 1BWCA 3DGZA 3KD9A 2XFNA 1TYPA 2GH5A 2GB0A 3H8IA 4U8OA 1YQZA 4H4WA 4X9MA 4C74A 3C96A 4H2PA 4FK1C 1LV0A 2Y6RA 1GRAA 1AOGA
chains in the Genus database with same CATH superfamily
3CB3A 3BI4A 1GV4A 4JN7A 2AL1A 3QN3A 1R6WA 4GCMA 4CRTA 3NGCX 4C5OA 4EMWA 1JRZA 1ZOYA 4BJYA 1IUUA 2Q0LA 1SJCA 3DA1A 4TM1A 2YG7A 3PFRA 4EM4A 1VDCA 3CYJA 2DW7A 3QSSA 3NRZB 2Y6QA 2R0CA 2RGHA 2WBAA 2WDVA 3ICRA 1F6MA 4TM4A 3BJSA 2Q7VA 1N4WA 1Y56B 3ICTA 3DDMA 4JY2A 3SN4A 2W54A 2WP5A 5GRTA 1SJBA 4H4UA 3T2YA 3RP7A 2BYBA 4Z25A 3NYCA 5J7XA 3UJ2A 3R0KA 4Z2TA 4ZOHB 4YTNA 1ZKQA 2PPGA 3DK9A 5KVIA 3AEAA 2OO6A 1NAAA 5KVHA 3R9UA 2B9WA 3RP6A 3D46A 4DWDA 3H12A 3IHGA 3T4WA 3DH9A 2GMJA 1GRFA 1D7LA 3ZVIA 3CMMA 2P3ZA 1DXLA 1ZY8A 5U25A 1CJ4A 1H7XA 2BK5A 2O56A 2XLRA 4B68A 1FEBA 1PJ5A 3P3BA 1RVKA 3M0OA 5JCKA 1PJ6A 1CHUA 4EIQA 4J33A 3CGBA 3QSMA 3V3OA 5FJTA 4NNJA 1MUCA 4FX9A 3ABVA 1K0LA 2R4EA 3L5OA 5FJOA 4WX1A 3VCNA 4FI4A 3LZXA 4PAAA 3SZ0A 4D03A 1DJNA 2IVDA 3MWCA 4A99A 4A9WA 3G5SA 3PVCA 1D4EA 4CY6A 4DX3A 3UCDA 1IUWA 1NENA 3EAOA 2YG4A 4NZHA 4A35A 3TWAA 1PXAA 4AOSA 2V60A 2BS2A 3QKEA 5J04A 2GR2A 4U8LA 2W55A 1L9CA 1BGJA 1H86A 3SBFA 2GEWA 2R0GA 2WP9A 1KFYA 2P88A 3AE4A 3KPFA 3NRNA 3QJ4A 2C76A 1NG3A 3II4A 1B37A 2I5QA 4E4UA 1FHUA 2OVLA 5BULA 3GYIA 1Q1WA 4YTPA 1N4UA 3TJIA 4E6MA 1RM6B 3ALJA 3GDNA 1EBHA 1S2QA 3LZWA 3T31A 1IUSA 1NELA 3GMBA 3CGCA 1CC4A 1MDLA 4FP1A 3I6DA 1NPXA 2PA6A 3OW1A 2PTZA 4DN1A 1SJDA 1LQUA 2FBWA 4GGHA 2C75A 5BVAA 4J31A 3N6HA 2GQWA 1KKOA 3VRAA 3EUB3 3NHOX 2OALA 3H7VA 2VZ2A 4GDEA 3M13A 3EKGA 1L9DA 3TWBA 4G8TA 1H6VA 2YLTA 1GTHA 2BK4A 2ONEA 1N60C 4ZA0A 4A65A 4CNJA 3GRTA 2QA1A 1WYGA 1P2HA 1IUVA 4FK1A 2OZ3A 4M52A 2YG5A 3IWAA 4RG3A 3DJGX 3ALLA 4EIPA 3FG2P 2CVJA 3CNJA 2UZZA 4JNQA 4X4JA 4J34A 1GALA 3G5QA 4CY8A 1PDYA 1ZMCA 1T3QC 1QLBA 4I59A 2C65A 3RHAA 1GSNA 1EBDA 1ELSA 1NU5A 3NIXA 2MNRA 4JHMA 4YSYA 1KKRA 4H2NA 2WOIA 3G5RA 1PBFA 2ZZ0A 4XWRA 5HHFA 2C72A 3KUMA 3QVRA 3T9PA 3V5FA 1RSGA 1JU2A 2HQMA 2GAGB 3AYJA 5KMPA 3IHMA 1GESA 2VVLG 1VDVA 4DGKA 1Q9IA 2XLPA 3P0WA 3NTDA 3DK4A 3RP8A 2QJMA 2YR4A 3TJ4A 4Z1YA 2HZGA 2WOWA 3VCCA 5KMRA 2OQHA 2OZTA 1LVLA 2WDQA 6ENLA 5EB5A 2AL2B 3CPIG 3VA8A 2FJDA 1HYUA 3I4KA 4YKFA 1IYXA 3T0KA 2Z5YA 4J57A 1NHRA 1REOA 3UKFA 1EC8A 1QJDA 1CJ2A 1NG4A 3FBSA 2R46A 3R0UA 3DEQA 3VFCA 4DSHA 2GDQA 2F5ZA 4Y4NA 2C7GA 4H4ZA 1BF3A 3CN8A 2X99A 2V6OA 5BOFA 2QQ6A 4UDQA 2ZBWA 4HN8A 2RABA 4X9NA 3AD9B 4E5TA 3AYLA 2EQ7A 2EQ8A 3UJRA 3UOVA 4WCTA 1FFVC 2XCGA 1BWCA 2GH5A 4DXKA 3ZLFA 4H4WA 3C96A 4FK1C 3OPSA 3SSZA 1Y0PA 2HXTA 1YEYA 3OZMA 3GY1A 4A3RA 1EC7A 2QDEA 2GGJA 1KNRA 3Q45A 2VQ7A 4NEVA 2A87A 4DSGA 3URHA 1B8SA 4IA6A 4TM0A 5KMSA 4U8PA 2OKTA 1GPEA 1V97A 3Q4DA 3DFYA 1K0IA 2OPJA 3CXOA 2W0HA 4OCGA 3NTAA 3AD7B 2NQLA 3DERA 3UJSA 1DTNA 3OZYA 5KRQA 1P43A 5KOXA 2O9ZA 5IQ1A 5ER0A 5FS7A 4YXDA 4HNLA 2PSNA 2XH0A 2HNEA 3GWDA 3UKQA 2HXUA 1Z6LA 2GAHB 2EQ9A 4J1OA 1S3BA 2YM2A 1LJ1A 2XFPA 1NHQA 1H83A 1EL7A 3S47A 3MSYA 2YM1A 5FMHA 4EM3A 3D8XA 3THUA 2PP3A 4G74A 5JCLA 5C3JA 1JRPA 4RG4A 3AEFA 2C73A 3DJDA 3GD6A 1M64A 2VRLA 3MQTA 3CPHG 3RR1A 2MUCA 3P9UA 4GR1A 3ALMA 2FJAA 2PU1A 1NHPA 5EOWA 2BXSA 3F8DA 2WS3A 1EBGA 5KOWA 2FKPA 1E6EA 5KWFA 5JCNA 1CC2A 2PGEA 3D9XA 3AEEA 1KDGA 3SZWA 4M6UA 2YVGA 1N62C 4MKSA 1EL9A 4Y4LA 3E1TA 2RGJA 2X50A 1XANA 2WHDA 3NVVB 1VQWA 4U2TA 3ITJA 1D4CA 3VR8A 3B6DA 2BS3A 2PS2A 4UDPA 7ENLA 3UCLA 2BXRA 1JEHA 1WUEA 3DJJA 4X2PA 3EPTA 1PBBA 2V5ZA 3A7RA 3CNSA 4GUVA 4U2SA 2B7SA 3AM9A 5FJRA 3D47A 1F8WA 3UKPA 5U1OA 4K5RA 2JB2A 1TE6A 3L1RA 5IPYA 4D04A 2RDXA 2P8CA 2XVHA 3DG6A 4H19A 4OPLA 4NTDA 3NFUA 3VRBA 2BK3A 3DG7A 1GOSA 1PBDA 5FS6A 1E39A 4EQSA 3QFAA 2E3TA 4GDPA 3SM8A 3UTHA 2JBVA 2GGHA 4CCQA 2XSXA 4TLXA 1TDEA 2QDDA 3U9IA 2CHRA 1DODA 3AMZA 3OTRA 4OPDA 2FJEA 4YWSA 3WE0A 5HXIA 2V61A 1B4VA 1ZDLA 2C67A 1PXBA 2R0PA 1OJAA 2WEUA 3K30A 1F8RA 4YTMA 2YVFA 1X31B 2BCGG 3T2KA 4JY3A 3SZCA 1B5QA 2OX4A 3K7TA 1YQ3A 2Q0KA 2OLNA 4CBQA 3UOXA 1XS2A 3P4QA 4APNA 1N63C 4M0XA 2B9XA 2E1MA 3M12A 1KN0A 2YLXA 4A79A 2ZZCA 4H4TA 4HYRA 1DJQA 1ECQA 2PP1A 3GMCA 4DYEA 2W3RA 2TPRA 4EQRA 4LU6A 3ATRA 1YKJA 1BKWA 2PTWA 1PBCA 3AE3A 3I6EA 3BHFA 3H70A 2I0ZA 4U8IA 3NZGA 1CJCA 3FXGA 1JRYA 2OLAA 3Q9TA 1F3PA 4HCLA 1IJHA 3UGVA 2WETA 3LOVA 1SEZA 1GNDA 3P4PA 5FJPA 1XHCA 4A7AA 3HZLA 1GRAA 5HYMA 2X8CA 3NT6A 1S3EA 3AEDA 1ONEA 3UCCA 2PCEA 4U8NA 3BI2A 4IZGA 1OJ9A 3QSEA 3UTEA 3U4FA 4USQA 4NWZA 3R10A 1E1LA 1MRAA 4H1ZA 1D5TA 2XYOA 4YWOA 2WESA 3ICSA 3VC5A 5BRTA 4KT2A 2FYMA 2R9ZA 3GDPA 4IHCA 4U8KA 4NTEA 2XH7A 3I3LA 4H2RA 4ENLA 4U2LA 4H4PA 3ZVHA 1H2IA 1PDZA 2PODA 2OZ8A 3OP2A 2W3SA 3ZLGA 2XLUA 1X2HA 2JAEA 4N9XA 3FVDA 1K0JA 1OJDA 3KPKA 5KNLA 4GRTA 4EMIA 3PS9A 3SX6A 5EB4A 5FS8A 4U8JA 2WP6A 4OVIA 2BABA 2C70A 1H7WA 1QO8A 3DG3A 3ZLHA 2VVMA 2YG3A 4H83A 3COXA 3KKJA 1GERA 1CJ3A 3ZYXA 3KD9A 2BRAA 2GB0A 4U8OA 1YQZA 1X2GA 3AE8A 3B9JB 1ELIA 2BRYA 3CPJG 2PGWA 3IC9A 1CC6A 2B9YA 2GVCA 3VR9A 3T6CA 1TDNA 1YQ4A 3QPEA 3BI5A 2RGOA 2P0IA 3N6JA 2H88A 4IA5A 3TTEA 3IK4A 3H8LA 3S5WA 4B67A 4F4RA 1NEKA 2XVJA 1GEUA 4E8GA 2BACA 4IVOB 2E4GA 1KSUA 4H4SA 1LQTA 1VG0A 2NVKX 3HYXA 4AOXA 2P8BA 4HPNA 3LXDA 4IP4A 2OFJA 4JN8A 3LADA 4PABA 2R4JA 1ONFA 1VG9A 1TKKA 1KCZA 3NYFA 3CGEA 3JZUA 2OG9A 4K7ZA 3DMEA 3FYYA 2PYXA 2EQ6A 3GD4A 4O5QA 3JW7A 1PDHA 4K2XA 1KNPA 4IL0A 4H2HA 2WPEA 1ZP0A 4OPCA 4K1WA 3OC4A 3VRDB 3P4SA 3ENLA 4LIIA 3CAWA 3REDA 1E1KA 4H4VA 2QAEA 3K7QX 1ZX9A 3EEZA 4A6NA 3R1ZA 4YKGA 3AE5A 3STPA 4G73A 3BOXA 1K4QA 4O5UA 3QFBA 4JDRA 3AE6A 4AT0A 3NK2X 1PS9A 4HB9A 1TDFA 1CL0A 5LV9A 4REKA 3PG6A 3FCPA 5M0ZA 4B69A 3SFEA 4P9SA 3KLJA 1N4VA 3IF9A 1NDAA 1KSSA 3DESA 2C3DA 5CKUA 2VQBA 3EF6A 3L8KA 2TMDA 4UDRA 3BSMA 3KA7A 3Q6JA 4Y4MA 1WUFA 3UTGA 1MNSA 3MZNA 3RITA 1DOBA 1TYTA 3AE9A 3B3RA 3JVAA 1H84A 1GTEA 1VRQB 3NK0X 2YQUA 3UKHA 2BA9A 3QTPA 4BK3A 2A8XA 3SN0A 3AE7A 1GREA 3UXLA 2QJJA 2GV8A 5JCIA 4IL2A 1LPFA 4K22A 1GRTA 1Y56A 3UOZA 1P2EA 2BS4A 1FECA 2XDOA 4KPLA 3GRSA 4CCRA 3NG7X 1O5WA 1UKVG 1D7YA 3TCSA 2WDRA 1FCDA 2NPXA 4K8DA 2XH4A 4ZN0A 4C77A 1PJ7A 4EQXA 3CNDA 3NLCA 3ADAB 2PTXA 4MJWA 4BV6A 5U63A 3FPZA 3ETRB 1ZMDA 1E1MA 4NTCA 3AB1A 3A7AA 4Z44A 1F9CA 1M6IA 2Z5XA 1E9IA 1BGNA 3AEBA 3S61A 2H89A 3GO2A 2V3BA 3NVZB 1JROA 4EQWA 2C4CA 4OPUA 1TZZA 1EL8A 3EANA 3CIRA 4BURA 4USRA 2VOUA 3NNEA 5EBKA 3MKCA 3KVEA 3GD3A 5FJUA 5M10A 2PTYA 1TDKA 2DW6A 3DGBA 2E5AA 3PK7A 1GT8A 4ICYA 4E4FA 1BQGA 1PHHA 3UP4A 3SN1A 4H50A 4OPTA 4IP5A 3NN6X 3CGDA 3V4BA 3UKKA 4IT1A 2PU0A 2X8GA 3N4EA 2OQYA 4XXGA 3T37A 2CFYA 4GISA 3UJEA 1COYA 1L8PA 4II2A 4HCDA 1YY5A 2PHHA 1SB3B 2YLRA 4KX6A 3BNMA 4C3YA 1GRHA 4Z17A 1JDFA 4YSZA 3V76A 1ZXIC 1DOCA 4GAVA 1XPQA 4IV9A 5HY5A 1GRGA 3V3WA 2DKIA 4IVMB 4Z24A 3NVWB 4LA1A 4TVYA 4HNCA 2AQJA 2PP0A 3VC6A 3AEGA 4TLZA 3NYEA 1JNRA 1DNCA 3O0HA 5IDZA 3D1CA 2J3NA 1JCTA 4OPIA 1RP0A 2FJBA 4G6GA 2ARDA 1DOEA 1H81A 2WU2A 4MGGA 4H2QA 3UKAA 4B1BA 3ZDNA 1SJAA 2XLSA 3NVYB 2C64A 3T2ZA 4B65A 1XPYA 2YLWA 2YVJA 3DGZA 1TYPA 3H8IA 2XH2A 4X9MA 4H2PA 3HRDC 1LV0A 2Y6RA 4GYPA 5BOEA 1BZLA 3H4KA 4EWJA 1IUXA 5JRBA 3CK5A 3SYIA 1S2YA 1FHVA 2QJNA 1MDRA 2GR1A 1GETA 2XVFA 1GXFA 3HYVA 3UJFA 3C4AA 2QGYA 4TM3A 3CNPA 4NEWA 3RO6A 4FDCB 4YT0A 2JK6A 3SJNA 4ADWA 2IIDA 2QA2A 3R11A 3S5SA 3P4RA 4BJZA 5L46A 3TQPA 3R25A 3P1WA 2VRMA 4KWSA 1OEPA 1O94A 2XLTA 4C3XA 3P93A 3SFDA 3LJPA 4II3A 4EMJA 1KF6A 4Z43A 4TVWA 1W6TA 3UP5A 4AP3A 3TOYA 1ZOVA 4JN9A 2OA1A 2GR0A 3NS1B 3AE1A 3NN0X 3ES8A 3UTFA 2AKMA 4B64A 3NK1X 5BUKA 3RGTA 3DIPA 2WU5A 3ISHA 1BKHA 1F8SA 5DBJA 4CNKA 2BC1A 4Z26A 1E7PA 4U8MA 2AL2A 4H4YA 3VQRA 3BHKA 3OZ2A 2X8HA 5FS9A 5G5HB 1FEAA 2AR8A 1MOKA 2AKZA 3F8RA 3C4NA 2DKHA 4XWZA 4OPGA 3DFHA 2AAQA 4Z2UA 1L9EA 3GYXA 4J2WA 3FMWA 2XFOA 3RCYA 2JKCA 3AXBA 3QVPA 2JB3A 2APGA 2ZADA 2YLZA 5TR3A 2BCPA 3MY9A 5G5GB 4GFIA 3TW9A 1O95A 4J56A 3PO7A 2XVIA 4H4XA 3CNTA 3ATQA 4GYPC 3SZFA 1JOAA 3I6TA 3N4FA 4K8GA 4K5SA 2JB1A 2ACZA 3K7MX 4RSLA 4ZCWA 3FJ4A 2WPCA 4H4QA 3VDGA 1GRBA 3T8QA 5C2TA 2ZZBA 4KEMA 1KD0A 3FV9A 3HPFA 2YLSA 1N5WC 4MMWA 5KMQA 3IJLA 4HCHA 4DHGA 1L0VA 4G7FA 5ENLA 3ZVHB 3CTYA 4E0VA 1R0MA 3GC2A 4A5LA 3V5CA 5EU9A 3T14A 2BC0A 3IJIA 2VVLA 1H82A 3F8PA 1NHSA 3A7UA 3NH3X 2X3NA 2YAUA 5GSNA 2E5VA 2POZA 4H7UA 2GR3A 2Q6UA 3GWFA 2B76A 3AN1A 4ZCCA 5JCMA 2A89A 3PWGA 4Z2RA 1JRXA 3FIMB 1JNZA 2GRTA 1E1NA 3B97A 2OAMA 2C66A 4JQ9A 1VQZA 1TRBA 2YR5A 3SGLA 4K2SA 4UP3A 4GF7A 3DK8A 1MXTA 2XVEA 2V3AA 2IVEA 1V59A 2WPFA 3AECA 4BK1A 3RNMA 1EL5A 2B7RA 2C3CA 2GQFA 1N61C 4B66A 2GL5A 2XGZA 1CF3A 2GGGA 4ECHA 2QVHA 3HW2A 3IJQA 2R45A 4GGBA 3BNUA 1FFUC 1P48A 1IUTA 2GF3A 3ES7A 3LB8A 2QCUA 1OJTA 1RYIA 4G6HA 2CDUA 2OLOA 4GIRA 4JNAA 3JSKA 4AP1A 3UOYA 3UXKA 2YR6A 2WQYA 3PWIA 4AT2A 1TDOA 4G9KA 3AWIA 4HA6A 2XFQA 3SQSA 1N1PA 4DNAA 1STZA 1FO4A 4ROPA 3MUCA 4ZCDA 2CULA 4GMEA 1PN0A 3K1GA 1OJCA 1FOHA 3SXIA 3GYJA 1N5XA 3AD8B 1JPMA 3NXLA 1FL2A 3RRAA 1ZK7A 3V3NA 3AE2A 3QLDA 4YSHA 3KU9A 5CQFA 4YSXA 2GGIA 3DJEA 1W4XA 3NO1A 5KXJA 1Q1RA 2PMQA 4I58A 2XFUA 3DGHA 2YG6A 5IQ4A 4GAPA 1JPDX 3CXBA 3AYIA 3H8AA 4KPRA 4A6NB 1XDIA 4H4RA 3SY4A 1LTXR 5J60A 3SQPA 4A6GA 2GMHA 4B63A 1EC9A 1CBOA 2WOVA 3SR6B 3GSIA 4J36A 1D4DA 2GGEA 4J3ZA 3UKLA 1PBEA 3CT2A 2YWLA 3NKSA 2ZC8A 3HYWA 4BK2A 1PXCA 2GSHA 2XFNA 3R07C 1S7MA 4C74A 1FIQB 1MO9A 1AOGA
chains in the Genus database with same CATH topology
1Y0PA 1ELIA 1BZLA 3BI4A 1GV4A 3H4KA 1IUXA 2BRYA 3CPJG 3IC9A 5JRBA 1CC6A 3SYIA 1KNRA 2B9YA 2GVCA 1S2YA 4GCMA 4CRTA 3VR9A 2VQ7A 3NGCX 4NEVA 2A87A 4DSGA 2GR1A 1GETA 1TDNA 1YQ4A 3URHA 1B8SA 4C5OA 3BI5A 2RGOA 4EMWA 1JRZA 1ZOYA 1GXFA 2XVFA 4BJYA 2H88A 1IUUA 2Q0LA 3C4AA 3DA1A 3HYVA 4IA5A 4TM1A 4IA6A 4TM0A 5KMSA 2YG7A 4U8PA 4EM4A 1VDCA 4TM3A 3CNPA 3H8LA 3QSSA 3S5WA 1GPEA 4NEWA 4B67A 1K0IA 4FDCB 2Y6QA 1NEKA 2R0CA 2XVJA 2RGHA 1GEUA 2WBAA 2WDVA 2BACA 3ICRA 4IVOB 4YT0A 2JK6A 4ADWA 2W0HA 4OCGA 3NTAA 2E4GA 2IIDA 1KSUA 4H4SA 2QA2A 1F6MA 1LQTA 4TM4A 3P4RA 2Q7VA 3AD7B 1N4WA 4BJZA 5L46A 1VG0A 2NVKX 3P1WA 1Y56B 2VRMA 3ICTA 1O94A 2XLTA 5KRQA 4JY2A 4C3XA 3HYXA 3SFDA 4AOXA 2O9ZA 3LJPA 5KOXA 4II3A 4EMJA 5IQ1A 1KF6A 4Z43A 5ER0A 3LXDA 5FS7A 4YXDA 2WP5A 5GRTA 3UP5A 4AP3A 3LADA 1ZOVA 4PABA 4H4UA 3GWDA 3T2YA 2R4JA 3RP7A 1Z6LA 2GAHB 4JN9A 2BYBA 3UKQA 2EQ9A 1S3BA 2OA1A 3NYCA 4Z25A 5J7XA 4Z2TA 1ONFA 2YM2A 1VG9A 2GR0A 1LJ1A 4YTNA 1ZKQA 2XFPA 1NHQA 3DK9A 1H83A 5KVIA 1EL7A 2YM1A 3AE1A 3NYFA 3CGEA 3AEAA 5FMHA 3NN0X 4K7ZA 3DMEA 1NAAA 5KVHA 3R9UA 3UTFA 4EM3A 2B9WA 3D8XA 3RP6A 4B64A 2PYXA 4G74A 5JCLA 3NK1X 5BUKA 3IHGA 2EQ6A 3DH9A 3GD4A 4O5QA 5C3JA 2WU5A 1PDHA 4K2XA 2GMJA 3ISHA 1KNPA 1GRFA 1D7LA 4RG4A 3AEFA 2C73A 3DJDA 1M64A 2VRLA 3CMMA 1DXLA 1ZY8A 2WPEA 1F8SA 3CPHG 5DBJA 4CNKA 2BC1A 4Z26A 5U25A 1CJ4A 1H7XA 2BK5A 1E7PA 4B68A 2XLRA 1ZP0A 4OPCA 1FEBA 1PJ5A 3P9UA 4GR1A 4U8MA 4H4YA 3ALMA 3VQRA 2FJAA 1NHPA 3OC4A 5JCKA 1CHUA 1PJ6A 3BHKA 2X8HA 3M0OA 3OZ2A 5EOWA 4BK1A 5FS9A 2BXSA 1FEAA 3VRDB 2AR8A 3F8DA 3P4SA 4EIQA 2WS3A 4J33A 4LIIA 5KOWA 1MOKA 3F8RA 3CGBA 1E6EA 5KWFA 5JCNA 3QSMA 3V3OA 3C4NA 1CC2A 2DKHA 4XWZA 3REDA 3D9XA 3AEEA 1E1KA 4H4VA 1KDGA 4OPGA 2QAEA 3K7QX 4NNJA 3SZWA 1ZX9A 2YVGA 1EL9A 4A6NA 4FX9A 4Y4LA 3ABVA 3E1TA 2AAQA 4Z2UA 1K0LA 2RGJA 4YKGA 1L9EA 3AE5A 2R4EA 3GYXA 4J2WA 3L5OA 3FMWA 2X50A 2XFOA 4G73A 1XANA 2JKCA 2WHDA 1K4QA 3AXBA 4WX1A 3QVPA 4O5UA 1VQWA 3LZXA 4PAAA 4U2TA 3QFBA 2JB3A 2APGA 2YLZA 3ITJA 1D4CA 3SZ0A 1DJNA 4JDRA 3AE6A 3VR8A 5TR3A 2BCPA 3B6DA 4AT0A 2BS3A 3NK2X 1PS9A 4HB9A 1TDFA 1CL0A 5LV9A 4REKA 3PG6A 2IVDA 4UDPA 5M0ZA 4B69A 1O95A 4J56A 3UCLA 3PO7A 3SFEA 2XVIA 4A99A 4H4XA 4A9WA 3CNTA 3ATQA 2BXRA 1JEHA 4P9SA 3DJJA 3KLJA 1N4VA 3EPTA 3G5SA 3PVCA 3IF9A 1NDAA 1KSSA 3SZFA 1JOAA 2C3DA 1PBBA 1D4EA 5CKUA 2V5ZA 2VQBA 3CNSA 4GUVA 4U2SA 4K5SA 4CY6A 3EF6A 2B7SA 2JB1A 2ACZA 3K7MX 4RSLA 1IUWA 1NENA 3EAOA 2WPCA 4H4QA 2YG4A 3L8KA 2TMDA 4NZHA 4UDRA 1GRBA 1F8WA 1PXAA 3KA7A 3Q6JA 3UKPA 5U1OA 4K5RA 4AOSA 2ZZBA 2JB2A 5C2TA 4Y4MA 2V60A 3L1RA 5IPYA 4D04A 2BS2A 2YLSA 3UTGA 2GR2A 3AE8A 4U8LA 5KMQA 2XVHA 1L9CA 1BGJA 1H86A 1L0VA 2GEWA 2R0GA 4OPLA 2WP9A 1DOBA 1KFYA 1TYTA 4NTDA 3AE9A 3VRBA 2BK3A 3CTYA 4E0VA 3AE4A 1GOSA 1H84A 1GTEA 1PBDA 3B3RA 1VRQB 3KPFA 3NK0X 5FS6A 2YQUA 3NRNA 1E39A 3QJ4A 4EQSA 2C76A 3UKHA 4A5LA 1NG3A 2BA9A 3II4A 3QFAA 1B37A 4BK3A 2A8XA 4GDPA 3AE7A 3SM8A 3UTHA 3T14A 1GREA 2JBVA 2BC0A 2VVLA 5BULA 3GYIA 1Q1WA 4CCQA 1H82A 1N4UA 4YTPA 2GV8A 1NHSA 3F8PA 4TLXA 1TDEA 5JCIA 3NH3X 2X3NA 3ALJA 1DODA 3GDNA 1LPFA 4K22A 1GRTA 2YAUA 2FJEA 4OPDA 3WE0A 1S2QA 5HXIA 2V61A 1B4VA 1Y56A 2E5VA 3LZWA 5GSNA 1ZDLA 1IUSA 2C67A 3T31A 3UOZA 1P2EA 3GMBA 2BS4A 1FECA 1PXBA 3CGCA 1CC4A 1OJAA 2GR3A 2R0PA 2Q6UA 4H7UA 3I6DA 1NPXA 2WEUA 3GRSA 2B76A 2XDOA 1O5WA 3GWFA 3K30A 3NG7X 4ZCCA 4CCRA 5JCMA 1F8RA 1UKVG 2YVFA 1X31B 2A89A 4YTMA 2BCGG 1D7YA 3T2KA 4JY3A 1LQUA 2WDRA 3SZCA 1B5QA 2FBWA 1JRXA 1FCDA 3FIMB 4Z2RA 1JNZA 2GRTA 1E1NA 2C75A 4J31A 2NPXA 1YQ3A 2Q0KA 3K7TA 5BVAA 2OLNA 4CBQA 2OAMA 4K8DA 3UOXA 3P4QA 4APNA 2GQWA 2C66A 3VRAA 4JQ9A 3NHOX 4ZN0A 4C77A 2B9XA 1PJ7A 2E1MA 4EQXA 3CNDA 3M12A 1TRBA 3NLCA 2YR5A 3SGLA 2OALA 3ADAB 2VZ2A 1KN0A 4MJWA 4UP3A 4GF7A 3DK8A 1MXTA 2XVEA 2YLXA 4BV6A 1L9DA 3M13A 4GDEA 4A79A 5U63A 3FPZA 2V3AA 2ZZCA 2IVEA 4H4TA 1ZMDA 1E1MA 4NTCA 1V59A 2WPFA 1DJQA 3AB1A 1H6VA 2YLTA 3RNMA 1EL5A 1GTHA 1MO9A 2B7RA 2BK4A 3AECA 2C3CA 3GMCA 2GQFA 2TPRA 4B66A 4EQRA 1CF3A 4A65A 3GRTA 4LU6A 4CNJA 4ECHA 4Z44A 3ATRA 2QA1A 1YKJA 1BKWA 1M6IA 1P2HA 1IUVA 2Z5XA 2R45A 1BGNA 1PBCA 3AEBA 3BNUA 3AE3A 4FK1A 2H89A 3S61A 3BHFA 2V3BA 4M52A 2I0ZA 1IUTA 2YG5A 3DJGX 2GF3A 4EQWA 3IWAA 3ALLA 2C4CA 4OPUA 4RG3A 3FG2P 4EIPA 1EL8A 3EANA 2CVJA 3CNJA 3LB8A 4U8IA 3CIRA 2QCUA 4BURA 4USRA 1CJCA 2VOUA 2UZZA 1OJTA 1JRYA 4JNQA 3NNEA 1RYIA 4G6HA 4X4JA 2CDUA 4J34A 2OLOA 1GALA 5EBKA 3G5QA 4CY8A 3Q9TA 4JNAA 1ZMCA 3JSKA 4AP1A 3UOYA 3KVEA 1QLBA 3GD3A 2YR6A 4I59A 5M10A 2C65A 2WQYA 3RHAA 1F3PA 1GSNA 1EBDA 1IJHA 3NIXA 1TDKA 4AT2A 2WETA 1TDOA 4YSYA 1GT8A 4ICYA 4G9KA 3LOVA 4H2NA 1PHHA 1SEZA 3AWIA 2WOIA 3G5RA 1GNDA 4HA6A 1PBFA 3P4PA 2XFQA 2ZZ0A 1XHCA 4A7AA 3HZLA 1N1PA 3UP4A 5HYMA 2X8CA 3NT6A 4DNAA 4XWRA 4H50A 5HHFA 2C72A 3QVRA 1S3EA 3AEDA 4ZCDA 1RSGA 4OPTA 1JU2A 2HQMA 2CULA 3NN6X 1PN0A 2GAGB 4U8NA 3CGDA 3AYJA 5KMPA 1OJCA 3BI2A 3IHMA 1GESA 3UKKA 1OJ9A 2VVLG 3QSEA 3UTEA 4DGKA 1FOHA 1Q9IA 3SXIA 2X8GA 2XLPA 4USQA 4NWZA 3GYJA 1E1LA 3NTDA 4XXGA 1D5TA 3DK4A 3AD8B 3T37A 2XYOA 3RP8A 2YR4A 2CFYA 4YWOA 2WESA 1FL2A 3ICSA 1COYA 5BRTA 4II2A 1YY5A 2WOWA 2PHHA 1ZK7A 2R9ZA 3GDPA 5KMRA 3V3NA 2YLRA 4U8KA 3AE2A 1LVLA 4NTEA 4KX6A 4B63A 2WDQA 3BNMA 3I3LA 4H2RA 4U2LA 5EB5A 1GRHA 4C3YA 4H4PA 4YSHA 4YSZA 3KU9A 5CQFA 3V76A 1DOCA 4YSXA 3DJEA 4GAVA 1W4XA 1H2IA 1XPQA 3CPIG 5KXJA 1Q1RA 4IV9A 5HY5A 1GRGA 2FJDA 1HYUA 4I58A 2XFUA 4YKFA 2DKIA 4IVMB 3DGHA 2YG6A 4Z24A 3T0KA 4GAPA 5IQ4A 2Z5YA 4J57A 2XLUA 4LA1A 1NHRA 3AYIA 1REOA 2JAEA 4N9XA 3UKFA 2AQJA 4A6NB 4KPRA 1K0JA 1QJDA 1XDIA 4H4RA 1CJ2A 1NG4A 3AEGA 3FBSA 3SY4A 1LTXR 2R46A 4TLZA 5J60A 1OJDA 3NYEA 3KPKA 1JNRA 3SQPA 1DNCA 3O0HA 5KNLA 4GRTA 3D1CA 4DSHA 2J3NA 4EMIA 2F5ZA 1RP0A 2FJBA 2GMHA 3PS9A 4OPIA 2C7GA 4G6GA 4Y4NA 4H4ZA 1BF3A 3CN8A 3SX6A 1CBOA 5FS8A 5EB4A 2X99A 2V6OA 2WOVA 2ARDA 4U8JA 1DOEA 3GSIA 2WP6A 1D4DA 4J36A 4OVIA 1H81A 2WU2A 2BABA 2ZBWA 4UDQA 2C70A 3UKLA 1PBEA 4H2QA 2RABA 3UKAA 4B1BA 1H7WA 4X9NA 3ZDNA 3AD9B 2XLSA 3AYLA 4D03A 2YWLA 1QO8A 2C64A 3NKSA 3T2ZA 2EQ7A 2VVMA 2YG3A 2EQ8A 3COXA 4B65A 3KKJA 3UOVA 4WCTA 3HYWA 4BK2A 1PXCA 2YLWA 1GERA 2YVJA 1CJ3A 3ZYXA 2XCGA 1BWCA 3DGZA 3KD9A 2XFNA 1TYPA 2GH5A 2BRAA 2GB0A 3H8IA 1S7MA 4U8OA 1YQZA 4H4WA 4X9MA 4C74A 3C96A 4H2PA 4FK1C 1LV0A 2Y6RA 1GRAA 1AOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0P A;  1ELI A;  1BZL A;  3BI4 A;  1GV4 A;  3H4K A;  1IUX A;  3CPJ G;  3IC9 A;  1CC6 A;  1KNR A;  2B9Y A;  2GVC A;  1S2Y A;  4GCM A;  4CRT A;  3VR9 A;  2VQ7 A;  3NGC X;  4NEV A;  2A87 A;  4DSG A;  2GR1 A;  1GET A;  1TDN A;  1YQ4 A;  3URH A;  1B8S A;  4C5O A;  3BI5 A;  2RGO A;  4EMW A;  1JRZ A;  1ZOY A;  1GXF A;  2XVF A;  4BJY A;  2H88 A;  1IUU A;  2Q0L A;  3C4A A;  3DA1 A;  4IA5 A;  4TM1 A;  4IA6 A;  4TM0 A;  2YG7 A;  4U8P A;  4EM4 A;  1VDC A;  4TM3 A;  3CNP A;  3H8L A;  3QSS A;  3S5W A;  1GPE A;  4NEW A;  4B67 A;  1K0I A;  4FDC B;  2Y6Q A;  1NEK A;  2R0C A;  2XVJ A;  2RGH A;  1GEU A;  2WBA A;  2WDV A;  2BAC A;  3ICR A;  4IVO B;  4YT0 A;  2JK6 A;  4ADW A;  2W0H A;  4OCG A;  3NTA A;  2E4G A;  2IID A;  1KSU A;  4H4S A;  2QA2 A;  1F6M A;  1LQT A;  4TM4 A;  3P4R A;  2Q7V A;  3AD7 B;  1N4W A;  4BJZ A;  5L46 A;  1VG0 A;  2NVK X;  3P1W A;  1Y56 B;  2VRM A;  3ICT A;  1O94 A;  2XLT A;  5KRQ A;  4JY2 A;  4C3X A;  3SFD A;  4AOX A;  5KOX A;  2O9Z A;  3LJP A;  4EMJ A;  5IQ1 A;  1KF6 A;  4Z43 A;  5ER0 A;  3LXD A;  5FS7 A;  4YXD A;  2WP5 A;  5GRT A;  3UP5 A;  4AP3 A;  3LAD A;  1ZOV A;  4PAB A;  4H4U A;  3GWD A;  2R4J A;  3RP7 A;  1Z6L A;  2GAH B;  4JN9 A;  2BYB A;  3UKQ A;  2EQ9 A;  1S3B A;  2OA1 A;  3NYC A;  4Z25 A;  5J7X A;  4Z2T A;  1ONF A;  2YM2 A;  1VG9 A;  2GR0 A;  1LJ1 A;  4YTN A;  1ZKQ A;  2XFP A;  1NHQ A;  3DK9 A;  1H83 A;  5KVI A;  1EL7 A;  2YM1 A;  3AE1 A;  3NYF A;  3CGE A;  3AEA A;  5FMH A;  3NN0 X;  4K7Z A;  3DME A;  1NAA A;  5KVH A;  3R9U A;  3UTF A;  4EM3 A;  2B9W A;  3D8X A;  3RP6 A;  4B64 A;  2PYX A;  5JCL A;  3NK1 X;  5BUK A;  3IHG A;  2EQ6 A;  3DH9 A;  3GD4 A;  4O5Q A;  5C3J A;  2WU5 A;  1PDH A;  4K2X A;  2GMJ A;  3ISH A;  1KNP A;  1GRF A;  1D7L A;  4RG4 A;  3AEF A;  2C73 A;  3DJD A;  1M64 A;  2VRL A;  1DXL A;  1ZY8 A;  2WPE A;  1F8S A;  3CPH G;  5DBJ A;  4CNK A;  2BC1 A;  4Z26 A;  5U25 A;  1CJ4 A;  1H7X A;  2BK5 A;  1E7P A;  4B68 A;  2XLR A;  1ZP0 A;  4OPC A;  1FEB A;  1PJ5 A;  3P9U A;  4GR1 A;  4U8M A;  4H4Y A;  3ALM A;  3VQR A;  2FJA A;  1NHP A;  3OC4 A;  5JCK A;  1CHU A;  1PJ6 A;  3BHK A;  2X8H A;  3M0O A;  3OZ2 A;  5EOW A;  4BK1 A;  5FS9 A;  2BXS A;  1FEA A;  3VRD B;  2AR8 A;  3F8D A;  3P4S A;  4EIQ A;  2WS3 A;  4J33 A;  4LII A;  5KOW A;  1MOK A;  3F8R A;  3CGB A;  1E6E A;  5KWF A;  5JCN A;  3QSM A;  3V3O A;  3C4N A;  1CC2 A;  2DKH A;  4XWZ A;  3RED A;  3AEE A;  1E1K A;  4H4V A;  1KDG A;  4OPG A;  2QAE A;  3K7Q X;  1ZX9 A;  2YVG A;  1EL9 A;  4A6N A;  4FX9 A;  4Y4L A;  3ABV A;  3E1T A;  2AAQ A;  4Z2U A;  1K0L A;  2RGJ A;  4YKG A;  1L9E A;  3AE5 A;  2R4E A;  4J2W A;  3FMW A;  2X50 A;  2XFO A;  1XAN A;  2JKC A;  2WHD A;  1K4Q A;  3AXB A;  4WX1 A;  3QVP A;  4O5U A;  1VQW A;  3LZX A;  4PAA A;  4U2T A;  3QFB A;  2JB3 A;  2APG A;  2YLZ A;  3ITJ A;  1D4C A;  4D03 A;  1DJN A;  4JDR A;  3AE6 A;  3VR8 A;  5TR3 A;  2BCP A;  3B6D A;  4AT0 A;  2BS3 A;  3NK2 X;  1PS9 A;  4HB9 A;  1TDF A;  1CL0 A;  5LV9 A;  4REK A;  2IVD A;  4UDP A;  5M0Z A;  4B69 A;  1O95 A;  4J56 A;  3UCL A;  3PO7 A;  3SFE A;  2XVI A;  4A99 A;  4H4X A;  4A9W A;  3CNT A;  3ATQ A;  2BXR A;  1JEH A;  4P9S A;  3DJJ A;  3KLJ A;  1N4V A;  3EPT A;  3G5S A;  3PVC A;  3IF9 A;  1NDA A;  1KSS A;  1JOA A;  2C3D A;  1PBB A;  1D4E A;  5CKU A;  2V5Z A;  2VQB A;  3CNS A;  4GUV A;  4U2S A;  4K5S A;  4CY6 A;  3EF6 A;  2B7S A;  2JB1 A;  2ACZ A;  3K7M X;  4RSL A;  1IUW A;  1NEN A;  3EAO A;  2WPC A;  4H4Q A;  2YG4 A;  3L8K A;  2TMD A;  4NZH A;  4UDR A;  1GRB A;  1F8W A;  1PXA A;  3KA7 A;  3Q6J A;  3UKP A;  5U1O A;  4K5R A;  4AOS A;  2ZZB A;  2JB2 A;  5C2T A;  4Y4M A;  2V60 A;  3L1R A;  5IPY A;  4D04 A;  2BS2 A;  2YLS A;  3UTG A;  2GR2 A;  3AE8 A;  4U8L A;  2XVH A;  1L9C A;  1BGJ A;  1H86 A;  1L0V A;  2GEW A;  2R0G A;  4OPL A;  2WP9 A;  1DOB A;  1KFY A;  1TYT A;  4NTD A;  3AE9 A;  3VRB A;  2BK3 A;  3CTY A;  4E0V A;  3AE4 A;  1GOS A;  1H84 A;  1GTE A;  1PBD A;  3B3R A;  1VRQ B;  3KPF A;  3NK0 X;  5FS6 A;  2YQU A;  3NRN A;  1E39 A;  3QJ4 A;  4EQS A;  2C76 A;  3UKH A;  4A5L A;  1NG3 A;  2BA9 A;  3II4 A;  3QFA A;  1B37 A;  4BK3 A;  2A8X A;  4GDP A;  3AE7 A;  3SM8 A;  3UTH A;  1GRE A;  2JBV A;  2BC0 A;  2VVL A;  5BUL A;  3GYI A;  1Q1W A;  4CCQ A;  1H82 A;  1N4U A;  4YTP A;  2GV8 A;  1NHS A;  3F8P A;  4TLX A;  1TDE A;  5JCI A;  3NH3 X;  2X3N A;  3ALJ A;  1DOD A;  3GDN A;  1LPF A;  4K22 A;  1GRT A;  2YAU A;  2FJE A;  4OPD A;  3WE0 A;  1S2Q A;  5HXI A;  2V61 A;  1B4V A;  1Y56 A;  2E5V A;  3LZW A;  5GSN A;  1ZDL A;  1IUS A;  2C67 A;  3UOZ A;  1P2E A;  3GMB A;  2BS4 A;  1FEC A;  1PXB A;  3CGC A;  1CC4 A;  1OJA A;  2GR3 A;  2R0P A;  2Q6U A;  4H7U A;  3I6D A;  1NPX A;  2WEU A;  3GRS A;  2B76 A;  2XDO A;  1O5W A;  3GWF A;  3K30 A;  3NG7 X;  4ZCC A;  4CCR A;  5JCM A;  1F8R A;  1UKV G;  2YVF A;  1X31 B;  2A89 A;  4YTM A;  2BCG G;  1D7Y A;  4JY3 A;  1LQU A;  2WDR A;  1B5Q A;  2FBW A;  1JRX A;  1FCD A;  3FIM B;  4Z2R A;  1JNZ A;  2GRT A;  1E1N A;  2C75 A;  4J31 A;  2NPX A;  1YQ3 A;  2Q0K A;  3K7T A;  5BVA A;  2OLN A;  4CBQ A;  2OAM A;  4K8D A;  3UOX A;  3P4Q A;  4APN A;  2GQW A;  2C66 A;  3VRA A;  4JQ9 A;  3NHO X;  4ZN0 A;  4C77 A;  2B9X A;  1PJ7 A;  2E1M A;  4EQX A;  3CND A;  3M12 A;  1TRB A;  3NLC A;  2YR5 A;  3SGL A;  2OAL A;  3ADA B;  2VZ2 A;  4MJW A;  4UP3 A;  4GF7 A;  3DK8 A;  1MXT A;  2XVE A;  2YLX A;  4BV6 A;  1L9D A;  3M13 A;  4GDE A;  4A79 A;  5U63 A;  3FPZ A;  2V3A A;  2ZZC A;  2IVE A;  4H4T A;  1ZMD A;  1E1M A;  4NTC A;  1V59 A;  2WPF A;  1DJQ A;  3AB1 A;  1H6V A;  2YLT A;  3RNM A;  1EL5 A;  1GTH A;  1MO9 A;  2B7R A;  2BK4 A;  3AEC A;  2C3C A;  3GMC A;  2GQF A;  2TPR A;  4B66 A;  4EQR A;  1CF3 A;  4A65 A;  3GRT A;  4LU6 A;  4CNJ A;  4ECH A;  4Z44 A;  3ATR A;  2QA1 A;  1YKJ A;  1BKW A;  1M6I A;  1P2H A;  1IUV A;  2Z5X A;  2R45 A;  1BGN A;  1PBC A;  3AEB A;  3BNU A;  3AE3 A;  4FK1 A;  2H89 A;  3S61 A;  3BHF A;  2V3B A;  4M52 A;  2I0Z A;  1IUT A;  2YG5 A;  3DJG X;  2GF3 A;  4EQW A;  3IWA A;  3ALL A;  4OPU A;  4RG3 A;  4EIP A;  3FG2 P;  1EL8 A;  3EAN A;  2CVJ A;  3CNJ A;  3LB8 A;  4U8I A;  3CIR A;  2QCU A;  4BUR A;  4USR A;  1CJC A;  2VOU A;  2UZZ A;  1OJT A;  1JRY A;  4JNQ A;  3NNE A;  1RYI A;  4X4J A;  2CDU A;  4J34 A;  2OLO A;  1GAL A;  5EBK A;  3G5Q A;  4CY8 A;  3Q9T A;  4JNA A;  1ZMC A;  3JSK A;  4AP1 A;  3UOY A;  3KVE A;  1QLB A;  3GD3 A;  2YR6 A;  4I59 A;  5M10 A;  2C65 A;  2WQY A;  3RHA A;  1F3P A;  1GSN A;  1EBD A;  1IJH A;  3NIX A;  1TDK A;  4AT2 A;  2WET A;  1TDO A;  4YSY A;  1GT8 A;  4ICY A;  3LOV A;  4H2N A;  1PHH A;  1SEZ A;  3AWI A;  2WOI A;  3G5R A;  1GND A;  4HA6 A;  1PBF A;  3P4P A;  2XFQ A;  2ZZ0 A;  1XHC A;  4A7A A;  3HZL A;  1N1P A;  3UP4 A;  5HYM A;  2X8C A;  3NT6 A;  4DNA A;  4XWR A;  4H50 A;  5HHF A;  2C72 A;  3QVR A;  1S3E A;  3AED A;  4ZCD A;  1RSG A;  4OPT A;  1JU2 A;  2HQM A;  2CUL A;  3NN6 X;  1PN0 A;  2GAG B;  4U8N A;  3CGD A;  3AYJ A;  1OJC A;  3BI2 A;  3IHM A;  1GES A;  3UKK A;  1OJ9 A;  2VVL G;  3QSE A;  3UTE A;  4DGK A;  1FOH A;  1Q9I A;  2X8G A;  2XLP A;  4USQ A;  3GYJ A;  1E1L A;  3NTD A;  4XXG A;  1D5T A;  3DK4 A;  3AD8 B;  3T37 A;  2XYO A;  3RP8 A;  2YR4 A;  2CFY A;  4YWO A;  2WES A;  1FL2 A;  3ICS A;  1COY A;  5BRT A;  1YY5 A;  2WOW A;  2PHH A;  1ZK7 A;  2R9Z A;  3GDP A;  3V3N A;  2YLR A;  4U8K A;  3AE2 A;  1LVL A;  4NTE A;  4KX6 A;  2WDQ A;  3BNM A;  3I3L A;  4H2R A;  4U2L A;  5EB5 A;  1GRH A;  4C3Y A;  4H4P A;  4YSH A;  4YSZ A;  3KU9 A;  5CQF A;  3V76 A;  1DOC A;  4YSX A;  3DJE A;  1W4X A;  1XPQ A;  3CPI G;  5KXJ A;  1Q1R A;  4IV9 A;  5HY5 A;  1GRG A;  2FJD A;  1HYU A;  4I58 A;  2XFU A;  4YKF A;  2DKI A;  4IVM B;  3DGH A;  2YG6 A;  4Z24 A;  5IQ4 A;  2Z5Y A;  4J57 A;  2XLU A;  4LA1 A;  1NHR A;  3AYI A;  1REO A;  2JAE A;  4N9X A;  3UKF A;  2AQJ A;  4A6N B;  4KPR A;  1K0J A;  1QJD A;  1XDI A;  4H4R A;  1CJ2 A;  1NG4 A;  3AEG A;  3FBS A;  1LTX R;  2R46 A;  4TLZ A;  5J60 A;  1OJD A;  3NYE A;  1JNR A;  3SQP A;  1DNC A;  3O0H A;  4GRT A;  3D1C A;  4DSH A;  2J3N A;  4EMI A;  2F5Z A;  1RP0 A;  2FJB A;  2GMH A;  3PS9 A;  4OPI A;  2C7G A;  4Y4N A;  4B63 A;  4H4Z A;  1BF3 A;  3CN8 A;  1CBO A;  5FS8 A;  5EB4 A;  2X99 A;  2V6O A;  2WOV A;  2ARD A;  4U8J A;  1DOE A;  3GSI A;  2WP6 A;  1D4D A;  4J36 A;  4OVI A;  1H81 A;  2WU2 A;  2BAB A;  2ZBW A;  4UDQ A;  2C70 A;  3UKL A;  1PBE A;  4H2Q A;  2RAB A;  3UKA A;  4B1B A;  1H7W A;  4X9N A;  3ZDN A;  3AD9 B;  2XLS A;  3AYL A;  2YWL A;  1QO8 A;  2C64 A;  3NKS A;  2EQ7 A;  2VVM A;  2YG3 A;  2EQ8 A;  3COX A;  4B65 A;  3KKJ A;  3UOV A;  4WCT A;  4BK2 A;  1PXC A;  2YLW A;  1GER A;  2YVJ A;  1CJ3 A;  3ZYX A;  2XCG A;  1BWC A;  3DGZ A;  3KD9 A;  2XFN A;  1TYP A;  2GH5 A;  2GB0 A;  3H8I A;  4U8O A;  1YQZ A;  4H4W A;  4X9M A;  4C74 A;  3C96 A;  4H2P A;  4FK1 C;  1LV0 A;  2Y6R A;  1GRA A;  1AOG A; 
#chains in the Genus database with same CATH topology
 3CB3 A;  3BI4 A;  1GV4 A;  4JN7 A;  2AL1 A;  3QN3 A;  1R6W A;  4GCM A;  4CRT A;  3NGC X;  4C5O A;  4EMW A;  1JRZ A;  1ZOY A;  4BJY A;  1IUU A;  2Q0L A;  1SJC A;  3DA1 A;  4TM1 A;  2YG7 A;  3PFR A;  4EM4 A;  1VDC A;  3CYJ A;  2DW7 A;  3QSS A;  3NRZ B;  2Y6Q A;  2R0C A;  2RGH A;  2WBA A;  2WDV A;  3ICR A;  1F6M A;  4TM4 A;  3BJS A;  2Q7V A;  1N4W A;  1Y56 B;  3ICT A;  3DDM A;  4JY2 A;  3SN4 A;  2W54 A;  2WP5 A;  5GRT A;  1SJB A;  4H4U A;  3T2Y A;  3RP7 A;  2BYB A;  4Z25 A;  3NYC A;  5J7X A;  3UJ2 A;  3R0K A;  4Z2T A;  4ZOH B;  4YTN A;  1ZKQ A;  2PPG A;  3DK9 A;  5KVI A;  3AEA A;  2OO6 A;  1NAA A;  5KVH A;  3R9U A;  2B9W A;  3RP6 A;  3D46 A;  4DWD A;  3H12 A;  3IHG A;  3T4W A;  3DH9 A;  2GMJ A;  1GRF A;  1D7L A;  3ZVI A;  3CMM A;  2P3Z A;  1DXL A;  1ZY8 A;  5U25 A;  1CJ4 A;  1H7X A;  2BK5 A;  2O56 A;  2XLR A;  4B68 A;  1FEB A;  1PJ5 A;  3P3B A;  1RVK A;  3M0O A;  5JCK A;  1PJ6 A;  1CHU A;  4EIQ A;  4J33 A;  3CGB A;  3QSM A;  3V3O A;  5FJT A;  4NNJ A;  1MUC A;  4FX9 A;  3ABV A;  1K0L A;  2R4E A;  3L5O A;  5FJO A;  4WX1 A;  3VCN A;  4FI4 A;  3LZX A;  4PAA A;  3SZ0 A;  4D03 A;  1DJN A;  2IVD A;  3MWC A;  4A99 A;  4A9W A;  3G5S A;  3PVC A;  1D4E A;  4CY6 A;  4DX3 A;  3UCD A;  1IUW A;  1NEN A;  3EAO A;  2YG4 A;  4NZH A;  4A35 A;  3TWA A;  1PXA A;  4AOS A;  2V60 A;  2BS2 A;  3QKE A;  5J04 A;  2GR2 A;  4U8L A;  2W55 A;  1L9C A;  1BGJ A;  1H86 A;  3SBF A;  2GEW A;  2R0G A;  2WP9 A;  1KFY A;  2P88 A;  3AE4 A;  3KPF A;  3NRN A;  3QJ4 A;  2C76 A;  1NG3 A;  3II4 A;  1B37 A;  2I5Q A;  4E4U A;  1FHU A;  2OVL A;  5BUL A;  3GYI A;  1Q1W A;  4YTP A;  1N4U A;  3TJI A;  4E6M A;  1RM6 B;  3ALJ A;  3GDN A;  1EBH A;  1S2Q A;  3LZW A;  3T31 A;  1IUS A;  1NEL A;  3GMB A;  3CGC A;  1CC4 A;  1MDL A;  4FP1 A;  3I6D A;  1NPX A;  2PA6 A;  3OW1 A;  2PTZ A;  4DN1 A;  1SJD A;  1LQU A;  2FBW A;  4GGH A;  2C75 A;  5BVA A;  4J31 A;  3N6H A;  2GQW A;  1KKO A;  3VRA A;  3EUB 3;  3NHO X;  2OAL A;  3H7V A;  2VZ2 A;  4GDE A;  3M13 A;  3EKG A;  1L9D A;  3TWB A;  4G8T A;  1H6V A;  2YLT A;  1GTH A;  2BK4 A;  2ONE A;  1N60 C;  4ZA0 A;  4A65 A;  4CNJ A;  3GRT A;  2QA1 A;  1WYG A;  1P2H A;  1IUV A;  4FK1 A;  2OZ3 A;  4M52 A;  2YG5 A;  3IWA A;  4RG3 A;  3DJG X;  3ALL A;  4EIP A;  3FG2 P;  2CVJ A;  3CNJ A;  2UZZ A;  4JNQ A;  4X4J A;  4J34 A;  1GAL A;  3G5Q A;  4CY8 A;  1PDY A;  1ZMC A;  1T3Q C;  1QLB A;  4I59 A;  2C65 A;  3RHA A;  1GSN A;  1EBD A;  1ELS A;  1NU5 A;  3NIX A;  2MNR A;  4JHM A;  4YSY A;  1KKR A;  4H2N A;  2WOI A;  3G5R A;  1PBF A;  2ZZ0 A;  4XWR A;  5HHF A;  2C72 A;  3KUM A;  3QVR A;  3T9P A;  3V5F A;  1RSG A;  1JU2 A;  2HQM A;  2GAG B;  3AYJ A;  5KMP A;  3IHM A;  1GES A;  2VVL G;  1VDV A;  4DGK A;  1Q9I A;  2XLP A;  3P0W A;  3NTD A;  3DK4 A;  3RP8 A;  2QJM A;  2YR4 A;  3TJ4 A;  4Z1Y A;  2HZG A;  2WOW A;  3VCC A;  5KMR A;  2OQH A;  2OZT A;  1LVL A;  2WDQ A;  6ENL A;  5EB5 A;  2AL2 B;  3CPI G;  3VA8 A;  2FJD A;  1HYU A;  3I4K A;  4YKF A;  1IYX A;  3T0K A;  2Z5Y A;  4J57 A;  1NHR A;  1REO A;  3UKF A;  1EC8 A;  1QJD A;  1CJ2 A;  1NG4 A;  3FBS A;  2R46 A;  3R0U A;  3DEQ A;  3VFC A;  4DSH A;  2GDQ A;  2F5Z A;  4Y4N A;  2C7G A;  4H4Z A;  1BF3 A;  3CN8 A;  2X99 A;  2V6O A;  5BOF A;  2QQ6 A;  4UDQ A;  2ZBW A;  4HN8 A;  2RAB A;  4X9N A;  3AD9 B;  4E5T A;  3AYL A;  2EQ7 A;  2EQ8 A;  3UJR A;  3UOV A;  4WCT A;  1FFV C;  2XCG A;  1BWC A;  2GH5 A;  4DXK A;  3ZLF A;  4H4W A;  3C96 A;  4FK1 C;  3OPS A;  3SSZ A;  1Y0P A;  2HXT A;  1YEY A;  3OZM A;  3GY1 A;  4A3R A;  1EC7 A;  2QDE A;  2GGJ A;  1KNR A;  3Q45 A;  2VQ7 A;  4NEV A;  2A87 A;  4DSG A;  3URH A;  1B8S A;  4IA6 A;  4TM0 A;  5KMS A;  4U8P A;  2OKT A;  1GPE A;  1V97 A;  3Q4D A;  3DFY A;  1K0I A;  2OPJ A;  3CXO A;  2W0H A;  4OCG A;  3NTA A;  3AD7 B;  2NQL A;  3DER A;  3UJS A;  1DTN A;  3OZY A;  5KRQ A;  1P43 A;  5KOX A;  2O9Z A;  5IQ1 A;  5ER0 A;  5FS7 A;  4YXD A;  4HNL A;  2PSN A;  2XH0 A;  2HNE A;  3GWD A;  3UKQ A;  2HXU A;  1Z6L A;  2GAH B;  2EQ9 A;  4J1O A;  1S3B A;  2YM2 A;  1LJ1 A;  2XFP A;  1NHQ A;  1H83 A;  1EL7 A;  3S47 A;  3MSY A;  2YM1 A;  5FMH A;  4EM3 A;  3D8X A;  3THU A;  2PP3 A;  4G74 A;  5JCL A;  5C3J A;  1JRP A;  4RG4 A;  3AEF A;  2C73 A;  3DJD A;  3GD6 A;  1M64 A;  2VRL A;  3MQT A;  3CPH G;  3RR1 A;  2MUC A;  3P9U A;  4GR1 A;  3ALM A;  2FJA A;  2PU1 A;  1NHP A;  5EOW A;  2BXS A;  3F8D A;  2WS3 A;  1EBG A;  5KOW A;  2FKP A;  1E6E A;  5KWF A;  5JCN A;  1CC2 A;  2PGE A;  3D9X A;  3AEE A;  1KDG A;  3SZW A;  4M6U A;  2YVG A;  1N62 C;  4MKS A;  1EL9 A;  4Y4L A;  3E1T A;  2RGJ A;  2X50 A;  1XAN A;  2WHD A;  3NVV B;  1VQW A;  4U2T A;  3ITJ A;  1D4C A;  3VR8 A;  3B6D A;  2BS3 A;  2PS2 A;  4UDP A;  7ENL A;  3UCL A;  2BXR A;  1JEH A;  1WUE A;  3DJJ A;  4X2P A;  3EPT A;  1PBB A;  2V5Z A;  3A7R A;  3CNS A;  4GUV A;  4U2S A;  2B7S A;  3AM9 A;  5FJR A;  3D47 A;  1F8W A;  3UKP A;  5U1O A;  4K5R A;  2JB2 A;  1TE6 A;  3L1R A;  5IPY A;  4D04 A;  2RDX A;  2P8C A;  2XVH A;  3DG6 A;  4H19 A;  4OPL A;  4NTD A;  3NFU A;  3VRB A;  2BK3 A;  3DG7 A;  1GOS A;  1PBD A;  5FS6 A;  1E39 A;  4EQS A;  3QFA A;  2E3T A;  4GDP A;  3SM8 A;  3UTH A;  2JBV A;  2GGH A;  4CCQ A;  2XSX A;  4TLX A;  1TDE A;  2QDD A;  3U9I A;  2CHR A;  1DOD A;  3AMZ A;  3OTR A;  4OPD A;  2FJE A;  4YWS A;  3WE0 A;  5HXI A;  2V61 A;  1B4V A;  1ZDL A;  2C67 A;  1PXB A;  2R0P A;  1OJA A;  2WEU A;  3K30 A;  1F8R A;  4YTM A;  2YVF A;  1X31 B;  2BCG G;  3T2K A;  4JY3 A;  3SZC A;  1B5Q A;  2OX4 A;  3K7T A;  1YQ3 A;  2Q0K A;  2OLN A;  4CBQ A;  3UOX A;  1XS2 A;  3P4Q A;  4APN A;  1N63 C;  4M0X A;  2B9X A;  2E1M A;  3M12 A;  1KN0 A;  2YLX A;  4A79 A;  2ZZC A;  4H4T A;  4HYR A;  1DJQ A;  1ECQ A;  2PP1 A;  3GMC A;  4DYE A;  2W3R A;  2TPR A;  4EQR A;  4LU6 A;  3ATR A;  1YKJ A;  1BKW A;  2PTW A;  1PBC A;  3AE3 A;  3I6E A;  3BHF A;  3H70 A;  2I0Z A;  4U8I A;  3NZG A;  1CJC A;  3FXG A;  1JRY A;  2OLA A;  3Q9T A;  1F3P A;  4HCL A;  1IJH A;  3UGV A;  2WET A;  3LOV A;  1SEZ A;  1GND A;  3P4P A;  5FJP A;  1XHC A;  4A7A A;  3HZL A;  1GRA A;  5HYM A;  2X8C A;  3NT6 A;  1S3E A;  3AED A;  1ONE A;  3UCC A;  2PCE A;  4U8N A;  3BI2 A;  4IZG A;  1OJ9 A;  3QSE A;  3UTE A;  3U4F A;  4USQ A;  4NWZ A;  3R10 A;  1E1L A;  1MRA A;  4H1Z A;  1D5T A;  2XYO A;  4YWO A;  2WES A;  3ICS A;  3VC5 A;  5BRT A;  4KT2 A;  2FYM A;  2R9Z A;  3GDP A;  4IHC A;  4U8K A;  4NTE A;  2XH7 A;  3I3L A;  4H2R A;  4ENL A;  4U2L A;  4H4P A;  3ZVH A;  1H2I A;  1PDZ A;  2POD A;  2OZ8 A;  3OP2 A;  2W3S A;  3ZLG A;  2XLU A;  1X2H A;  2JAE A;  4N9X A;  3FVD A;  1K0J A;  1OJD A;  3KPK A;  5KNL A;  4GRT A;  4EMI A;  3PS9 A;  3SX6 A;  5EB4 A;  5FS8 A;  4U8J A;  2WP6 A;  4OVI A;  2BAB A;  2C70 A;  1H7W A;  1QO8 A;  3DG3 A;  3ZLH A;  2VVM A;  2YG3 A;  4H83 A;  3COX A;  3KKJ A;  1GER A;  1CJ3 A;  3ZYX A;  3KD9 A;  2BRA A;  2GB0 A;  4U8O A;  1YQZ A;  1X2G A;  3AE8 A;  3B9J B;  1ELI A;  2BRY A;  3CPJ G;  2PGW A;  3IC9 A;  1CC6 A;  2B9Y A;  2GVC A;  3VR9 A;  3T6C A;  1TDN A;  1YQ4 A;  3QPE A;  3BI5 A;  2RGO A;  2P0I A;  3N6J A;  2H88 A;  4IA5 A;  3TTE A;  3IK4 A;  3H8L A;  3S5W A;  4B67 A;  4F4R A;  1NEK A;  2XVJ A;  1GEU A;  4E8G A;  2BAC A;  4IVO B;  2E4G A;  1KSU A;  4H4S A;  1LQT A;  1VG0 A;  2NVK X;  3HYX A;  4AOX A;  2P8B A;  4HPN A;  3LXD A;  4IP4 A;  2OFJ A;  4JN8 A;  3LAD A;  4PAB A;  2R4J A;  1ONF A;  1VG9 A;  1TKK A;  1KCZ A;  3NYF A;  3CGE A;  3JZU A;  2OG9 A;  4K7Z A;  3DME A;  3FYY A;  2PYX A;  2EQ6 A;  3GD4 A;  4O5Q A;  3JW7 A;  1PDH A;  4K2X A;  1KNP A;  4IL0 A;  4H2H A;  2WPE A;  1ZP0 A;  4OPC A;  4K1W A;  3OC4 A;  3VRD B;  3P4S A;  3ENL A;  4LII A;  3CAW A;  3RED A;  1E1K A;  4H4V A;  2QAE A;  3K7Q X;  1ZX9 A;  3EEZ A;  4A6N A;  3R1Z A;  4YKG A;  3AE5 A;  3STP A;  4G73 A;  3BOX A;  1K4Q A;  4O5U A;  3QFB A;  4JDR A;  3AE6 A;  4AT0 A;  3NK2 X;  1PS9 A;  4HB9 A;  1TDF A;  1CL0 A;  5LV9 A;  4REK A;  3PG6 A;  3FCP A;  5M0Z A;  4B69 A;  3SFE A;  4P9S A;  3KLJ A;  1N4V A;  3IF9 A;  1NDA A;  1KSS A;  3DES A;  2C3D A;  5CKU A;  2VQB A;  3EF6 A;  3L8K A;  2TMD A;  4UDR A;  3BSM A;  3KA7 A;  3Q6J A;  4Y4M A;  1WUF A;  3UTG A;  1MNS A;  3MZN A;  3RIT A;  1DOB A;  1TYT A;  3AE9 A;  3B3R A;  3JVA A;  1H84 A;  1GTE A;  1VRQ B;  3NK0 X;  2YQU A;  3UKH A;  2BA9 A;  3QTP A;  4BK3 A;  2A8X A;  3SN0 A;  3AE7 A;  1GRE A;  3UXL A;  2QJJ A;  2GV8 A;  5JCI A;  4IL2 A;  1LPF A;  4K22 A;  1GRT A;  1Y56 A;  3UOZ A;  1P2E A;  2BS4 A;  1FEC A;  2XDO A;  4KPL A;  3GRS A;  4CCR A;  3NG7 X;  1O5W A;  1UKV G;  1D7Y A;  3TCS A;  2WDR A;  1FCD A;  2NPX A;  4K8D A;  2XH4 A;  4ZN0 A;  4C77 A;  1PJ7 A;  4EQX A;  3CND A;  3NLC A;  3ADA B;  2PTX A;  4MJW A;  4BV6 A;  5U63 A;  3FPZ A;  3ETR B;  1ZMD A;  1E1M A;  4NTC A;  3AB1 A;  3A7A A;  4Z44 A;  1F9C A;  1M6I A;  2Z5X A;  1E9I A;  1BGN A;  3AEB A;  3S61 A;  2H89 A;  3GO2 A;  2V3B A;  3NVZ B;  1JRO A;  4EQW A;  2C4C A;  4OPU A;  1TZZ A;  1EL8 A;  3EAN A;  3CIR A;  4BUR A;  4USR A;  2VOU A;  3NNE A;  5EBK A;  3MKC A;  3KVE A;  3GD3 A;  5FJU A;  5M10 A;  2PTY A;  1TDK A;  2DW6 A;  3DGB A;  2E5A A;  3PK7 A;  1GT8 A;  4ICY A;  4E4F A;  1BQG A;  1PHH A;  3UP4 A;  3SN1 A;  4H50 A;  4OPT A;  4IP5 A;  3NN6 X;  3CGD A;  3V4B A;  3UKK A;  4IT1 A;  2PU0 A;  2X8G A;  3N4E A;  2OQY A;  4XXG A;  3T37 A;  2CFY A;  4GIS A;  3UJE A;  1COY A;  1L8P A;  4II2 A;  4HCD A;  1YY5 A;  2PHH A;  1SB3 B;  2YLR A;  4KX6 A;  3BNM A;  4C3Y A;  1GRH A;  4Z17 A;  1JDF A;  4YSZ A;  3V76 A;  1ZXI C;  1DOC A;  4GAV A;  1XPQ A;  4IV9 A;  5HY5 A;  1GRG A;  3V3W A;  2DKI A;  4IVM B;  4Z24 A;  3NVW B;  4LA1 A;  4TVY A;  4HNC A;  2AQJ A;  2PP0 A;  3VC6 A;  3AEG A;  4TLZ A;  3NYE A;  1JNR A;  1DNC A;  3O0H A;  5IDZ A;  3D1C A;  2J3N A;  1JCT A;  4OPI A;  1RP0 A;  2FJB A;  4G6G A;  2ARD A;  1DOE A;  1H81 A;  2WU2 A;  4MGG A;  4H2Q A;  3UKA A;  4B1B A;  3ZDN A;  1SJA A;  2XLS A;  3NVY B;  2C64 A;  3T2Z A;  4B65 A;  1XPY A;  2YLW A;  2YVJ A;  3DGZ A;  1TYP A;  3H8I A;  2XH2 A;  4X9M A;  4H2P A;  3HRD C;  1LV0 A;  2Y6R A;  4GYP A;  5BOE A;  1BZL A;  3H4K A;  4EWJ A;  1IUX A;  5JRB A;  3CK5 A;  3SYI A;  1S2Y A;  1FHV A;  2QJN A;  1MDR A;  2GR1 A;  1GET A;  2XVF A;  1GXF A;  3HYV A;  3UJF A;  3C4A A;  2QGY A;  4TM3 A;  3CNP A;  4NEW A;  3RO6 A;  4FDC B;  4YT0 A;  2JK6 A;  3SJN A;  4ADW A;  2IID A;  2QA2 A;  3R11 A;  3S5S A;  3P4R A;  4BJZ A;  5L46 A;  3TQP A;  3R25 A;  3P1W A;  2VRM A;  4KWS A;  1OEP A;  1O94 A;  2XLT A;  4C3X A;  3P93 A;  3SFD A;  3LJP A;  4II3 A;  4EMJ A;  1KF6 A;  4Z43 A;  4TVW A;  1W6T A;  3UP5 A;  4AP3 A;  3TOY A;  1ZOV A;  4JN9 A;  2OA1 A;  2GR0 A;  3NS1 B;  3AE1 A;  3NN0 X;  3ES8 A;  3UTF A;  2AKM A;  4B64 A;  3NK1 X;  5BUK A;  3RGT A;  3DIP A;  2WU5 A;  3ISH A;  1BKH A;  1F8S A;  5DBJ A;  4CNK A;  2BC1 A;  4Z26 A;  1E7P A;  4U8M A;  2AL2 A;  4H4Y A;  3VQR A;  3BHK A;  3OZ2 A;  2X8H A;  5FS9 A;  5G5H B;  1FEA A;  2AR8 A;  1MOK A;  2AKZ A;  3F8R A;  3C4N A;  2DKH A;  4XWZ A;  4OPG A;  3DFH A;  2AAQ A;  4Z2U A;  1L9E A;  3GYX A;  4J2W A;  3FMW A;  2XFO A;  3RCY A;  2JKC A;  3AXB A;  3QVP A;  2JB3 A;  2APG A;  2ZAD A;  2YLZ A;  5TR3 A;  2BCP A;  3MY9 A;  5G5G B;  4GFI A;  3TW9 A;  1O95 A;  4J56 A;  3PO7 A;  2XVI A;  4H4X A;  3CNT A;  3ATQ A;  4GYP C;  3SZF A;  1JOA A;  3I6T A;  3N4F A;  4K8G A;  4K5S A;  2JB1 A;  2ACZ A;  3K7M X;  4RSL A;  4ZCW A;  3FJ4 A;  2WPC A;  4H4Q A;  3VDG A;  1GRB A;  3T8Q A;  5C2T A;  2ZZB A;  4KEM A;  1KD0 A;  3FV9 A;  3HPF A;  2YLS A;  1N5W C;  4MMW A;  5KMQ A;  3IJL A;  4HCH A;  4DHG A;  1L0V A;  4G7F A;  5ENL A;  3ZVH B;  3CTY A;  4E0V A;  1R0M A;  3GC2 A;  4A5L A;  3V5C A;  5EU9 A;  3T14 A;  2BC0 A;  3IJI A;  2VVL A;  1H82 A;  3F8P A;  1NHS A;  3A7U A;  3NH3 X;  2X3N A;  2YAU A;  5GSN A;  2E5V A;  2POZ A;  4H7U A;  2GR3 A;  2Q6U A;  3GWF A;  2B76 A;  3AN1 A;  4ZCC A;  5JCM A;  2A89 A;  3PWG A;  4Z2R A;  1JRX A;  3FIM B;  1JNZ A;  2GRT A;  1E1N A;  3B97 A;  2OAM A;  2C66 A;  4JQ9 A;  1VQZ A;  1TRB A;  2YR5 A;  3SGL A;  4K2S A;  4UP3 A;  4GF7 A;  3DK8 A;  1MXT A;  2XVE A;  2V3A A;  2IVE A;  1V59 A;  2WPF A;  3AEC A;  4BK1 A;  3RNM A;  1EL5 A;  2B7R A;  2C3C A;  2GQF A;  1N61 C;  4B66 A;  2GL5 A;  2XGZ A;  1CF3 A;  2GGG A;  4ECH A;  2QVH A;  3HW2 A;  3IJQ A;  2R45 A;  4GGB A;  3BNU A;  1FFU C;  1P48 A;  1IUT A;  2GF3 A;  3ES7 A;  3LB8 A;  2QCU A;  1OJT A;  1RYI A;  4G6H A;  2CDU A;  2OLO A;  4GIR A;  4JNA A;  3JSK A;  4AP1 A;  3UOY A;  3UXK A;  2YR6 A;  2WQY A;  3PWI A;  4AT2 A;  1TDO A;  4G9K A;  3AWI A;  4HA6 A;  2XFQ A;  3SQS A;  1N1P A;  4DNA A;  1STZ A;  1FO4 A;  4ROP A;  3MUC A;  4ZCD A;  2CUL A;  4GME A;  1PN0 A;  3K1G A;  1OJC A;  1FOH A;  3SXI A;  3GYJ A;  1N5X A;  3AD8 B;  1JPM A;  3NXL A;  1FL2 A;  3RRA A;  1ZK7 A;  3V3N A;  3AE2 A;  3QLD A;  4YSH A;  3KU9 A;  5CQF A;  4YSX A;  2GGI A;  3DJE A;  1W4X A;  3NO1 A;  5KXJ A;  1Q1R A;  2PMQ A;  4I58 A;  2XFU A;  3DGH A;  2YG6 A;  5IQ4 A;  4GAP A;  1JPD X;  3CXB A;  3AYI A;  3H8A A;  4KPR A;  4A6N B;  1XDI A;  4H4R A;  3SY4 A;  1LTX R;  5J60 A;  3SQP A;  4A6G A;  2GMH A;  4B63 A;  1EC9 A;  1CBO A;  2WOV A;  3SR6 B;  3GSI A;  4J36 A;  1D4D A;  2GGE A;  4J3Z A;  3UKL A;  1PBE A;  3CT2 A;  2YWL A;  3NKS A;  2ZC8 A;  3HYW A;  4BK2 A;  1PXC A;  2GSH A;  2XFN A;  3R07 C;  1S7M A;  4C74 A;  1FIQ B;  1MO9 A;  1AOG A; 
#chains in the Genus database with same CATH homology
 1Y0P A;  1ELI A;  1BZL A;  3BI4 A;  1GV4 A;  3H4K A;  1IUX A;  2BRY A;  3CPJ G;  3IC9 A;  5JRB A;  1CC6 A;  3SYI A;  1KNR A;  2B9Y A;  2GVC A;  1S2Y A;  4GCM A;  4CRT A;  3VR9 A;  2VQ7 A;  3NGC X;  4NEV A;  2A87 A;  4DSG A;  2GR1 A;  1GET A;  1TDN A;  1YQ4 A;  3URH A;  1B8S A;  4C5O A;  3BI5 A;  2RGO A;  4EMW A;  1JRZ A;  1ZOY A;  1GXF A;  2XVF A;  4BJY A;  2H88 A;  1IUU A;  2Q0L A;  3C4A A;  3DA1 A;  3HYV A;  4IA5 A;  4TM1 A;  4IA6 A;  4TM0 A;  5KMS A;  2YG7 A;  4U8P A;  4EM4 A;  1VDC A;  4TM3 A;  3CNP A;  3H8L A;  3QSS A;  3S5W A;  1GPE A;  4NEW A;  4B67 A;  1K0I A;  4FDC B;  2Y6Q A;  1NEK A;  2R0C A;  2XVJ A;  2RGH A;  1GEU A;  2WBA A;  2WDV A;  2BAC A;  3ICR A;  4IVO B;  4YT0 A;  2JK6 A;  4ADW A;  2W0H A;  4OCG A;  3NTA A;  2E4G A;  2IID A;  1KSU A;  4H4S A;  2QA2 A;  1F6M A;  1LQT A;  4TM4 A;  3P4R A;  2Q7V A;  3AD7 B;  1N4W A;  4BJZ A;  5L46 A;  1VG0 A;  2NVK X;  3P1W A;  1Y56 B;  2VRM A;  3ICT A;  1O94 A;  2XLT A;  5KRQ A;  4JY2 A;  4C3X A;  3HYX A;  3SFD A;  4AOX A;  2O9Z A;  3LJP A;  5KOX A;  4II3 A;  4EMJ A;  5IQ1 A;  1KF6 A;  4Z43 A;  5ER0 A;  3LXD A;  5FS7 A;  4YXD A;  2WP5 A;  5GRT A;  3UP5 A;  4AP3 A;  3LAD A;  1ZOV A;  4PAB A;  4H4U A;  3GWD A;  3T2Y A;  2R4J A;  3RP7 A;  1Z6L A;  2GAH B;  4JN9 A;  2BYB A;  3UKQ A;  2EQ9 A;  1S3B A;  2OA1 A;  3NYC A;  4Z25 A;  5J7X A;  4Z2T A;  1ONF A;  2YM2 A;  1VG9 A;  2GR0 A;  1LJ1 A;  4YTN A;  1ZKQ A;  2XFP A;  1NHQ A;  3DK9 A;  1H83 A;  5KVI A;  1EL7 A;  2YM1 A;  3AE1 A;  3NYF A;  3CGE A;  3AEA A;  5FMH A;  3NN0 X;  4K7Z A;  3DME A;  1NAA A;  5KVH A;  3R9U A;  3UTF A;  4EM3 A;  2B9W A;  3D8X A;  3RP6 A;  4B64 A;  2PYX A;  4G74 A;  5JCL A;  3NK1 X;  5BUK A;  3IHG A;  2EQ6 A;  3DH9 A;  3GD4 A;  4O5Q A;  5C3J A;  2WU5 A;  1PDH A;  4K2X A;  2GMJ A;  3ISH A;  1KNP A;  1GRF A;  1D7L A;  4RG4 A;  3AEF A;  2C73 A;  3DJD A;  1M64 A;  2VRL A;  3CMM A;  1DXL A;  1ZY8 A;  2WPE A;  1F8S A;  3CPH G;  5DBJ A;  4CNK A;  2BC1 A;  4Z26 A;  5U25 A;  1CJ4 A;  1H7X A;  2BK5 A;  1E7P A;  4B68 A;  2XLR A;  1ZP0 A;  4OPC A;  1FEB A;  1PJ5 A;  3P9U A;  4GR1 A;  4U8M A;  4H4Y A;  3ALM A;  3VQR A;  2FJA A;  1NHP A;  3OC4 A;  5JCK A;  1CHU A;  1PJ6 A;  3BHK A;  2X8H A;  3M0O A;  3OZ2 A;  5EOW A;  4BK1 A;  5FS9 A;  2BXS A;  1FEA A;  3VRD B;  2AR8 A;  3F8D A;  3P4S A;  4EIQ A;  2WS3 A;  4J33 A;  4LII A;  5KOW A;  1MOK A;  3F8R A;  3CGB A;  1E6E A;  5KWF A;  5JCN A;  3QSM A;  3V3O A;  3C4N A;  1CC2 A;  2DKH A;  4XWZ A;  3RED A;  3D9X A;  3AEE A;  1E1K A;  4H4V A;  1KDG A;  4OPG A;  2QAE A;  3K7Q X;  4NNJ A;  3SZW A;  1ZX9 A;  2YVG A;  1EL9 A;  4A6N A;  4FX9 A;  4Y4L A;  3ABV A;  3E1T A;  2AAQ A;  4Z2U A;  1K0L A;  2RGJ A;  4YKG A;  1L9E A;  3AE5 A;  2R4E A;  3GYX A;  4J2W A;  3L5O A;  3FMW A;  2X50 A;  2XFO A;  4G73 A;  1XAN A;  2JKC A;  2WHD A;  1K4Q A;  3AXB A;  4WX1 A;  3QVP A;  4O5U A;  1VQW A;  3LZX A;  4PAA A;  4U2T A;  3QFB A;  2JB3 A;  2APG A;  2YLZ A;  3ITJ A;  1D4C A;  3SZ0 A;  1DJN A;  4JDR A;  3AE6 A;  3VR8 A;  5TR3 A;  2BCP A;  3B6D A;  4AT0 A;  2BS3 A;  3NK2 X;  1PS9 A;  4HB9 A;  1TDF A;  1CL0 A;  5LV9 A;  4REK A;  3PG6 A;  2IVD A;  4UDP A;  5M0Z A;  4B69 A;  1O95 A;  4J56 A;  3UCL A;  3PO7 A;  3SFE A;  2XVI A;  4A99 A;  4H4X A;  4A9W A;  3CNT A;  3ATQ A;  2BXR A;  1JEH A;  4P9S A;  3DJJ A;  3KLJ A;  1N4V A;  3EPT A;  3G5S A;  3PVC A;  3IF9 A;  1NDA A;  1KSS A;  3SZF A;  1JOA A;  2C3D A;  1PBB A;  1D4E A;  5CKU A;  2V5Z A;  2VQB A;  3CNS A;  4GUV A;  4U2S A;  4K5S A;  4CY6 A;  3EF6 A;  2B7S A;  2JB1 A;  2ACZ A;  3K7M X;  4RSL A;  1IUW A;  1NEN A;  3EAO A;  2WPC A;  4H4Q A;  2YG4 A;  3L8K A;  2TMD A;  4NZH A;  4UDR A;  1GRB A;  1F8W A;  1PXA A;  3KA7 A;  3Q6J A;  3UKP A;  5U1O A;  4K5R A;  4AOS A;  2ZZB A;  2JB2 A;  5C2T A;  4Y4M A;  2V60 A;  3L1R A;  5IPY A;  4D04 A;  2BS2 A;  2YLS A;  3UTG A;  2GR2 A;  3AE8 A;  4U8L A;  5KMQ A;  2XVH A;  1L9C A;  1BGJ A;  1H86 A;  1L0V A;  2GEW A;  2R0G A;  4OPL A;  2WP9 A;  1DOB A;  1KFY A;  1TYT A;  4NTD A;  3AE9 A;  3VRB A;  2BK3 A;  3CTY A;  4E0V A;  3AE4 A;  1GOS A;  1H84 A;  1GTE A;  1PBD A;  3B3R A;  1VRQ B;  3KPF A;  3NK0 X;  5FS6 A;  2YQU A;  3NRN A;  1E39 A;  3QJ4 A;  4EQS A;  2C76 A;  3UKH A;  4A5L A;  1NG3 A;  2BA9 A;  3II4 A;  3QFA A;  1B37 A;  4BK3 A;  2A8X A;  4GDP A;  3AE7 A;  3SM8 A;  3UTH A;  3T14 A;  1GRE A;  2JBV A;  2BC0 A;  2VVL A;  5BUL A;  3GYI A;  1Q1W A;  4CCQ A;  1H82 A;  1N4U A;  4YTP A;  2GV8 A;  1NHS A;  3F8P A;  4TLX A;  1TDE A;  5JCI A;  3NH3 X;  2X3N A;  3ALJ A;  1DOD A;  3GDN A;  1LPF A;  4K22 A;  1GRT A;  2YAU A;  2FJE A;  4OPD A;  3WE0 A;  1S2Q A;  5HXI A;  2V61 A;  1B4V A;  1Y56 A;  2E5V A;  3LZW A;  5GSN A;  1ZDL A;  1IUS A;  2C67 A;  3T31 A;  3UOZ A;  1P2E A;  3GMB A;  2BS4 A;  1FEC A;  1PXB A;  3CGC A;  1CC4 A;  1OJA A;  2GR3 A;  2R0P A;  2Q6U A;  4H7U A;  3I6D A;  1NPX A;  2WEU A;  3GRS A;  2B76 A;  2XDO A;  1O5W A;  3GWF A;  3K30 A;  3NG7 X;  4ZCC A;  4CCR A;  5JCM A;  1F8R A;  1UKV G;  2YVF A;  1X31 B;  2A89 A;  4YTM A;  2BCG G;  1D7Y A;  3T2K A;  4JY3 A;  1LQU A;  2WDR A;  3SZC A;  1B5Q A;  2FBW A;  1JRX A;  1FCD A;  3FIM B;  4Z2R A;  1JNZ A;  2GRT A;  1E1N A;  2C75 A;  4J31 A;  2NPX A;  1YQ3 A;  2Q0K A;  3K7T A;  5BVA A;  2OLN A;  4CBQ A;  2OAM A;  4K8D A;  3UOX A;  3P4Q A;  4APN A;  2GQW A;  2C66 A;  3VRA A;  4JQ9 A;  3NHO X;  4ZN0 A;  4C77 A;  2B9X A;  1PJ7 A;  2E1M A;  4EQX A;  3CND A;  3M12 A;  1TRB A;  3NLC A;  2YR5 A;  3SGL A;  2OAL A;  3ADA B;  2VZ2 A;  1KN0 A;  4MJW A;  4UP3 A;  4GF7 A;  3DK8 A;  1MXT A;  2XVE A;  2YLX A;  4BV6 A;  1L9D A;  3M13 A;  4GDE A;  4A79 A;  5U63 A;  3FPZ A;  2V3A A;  2ZZC A;  2IVE A;  4H4T A;  1ZMD A;  1E1M A;  4NTC A;  1V59 A;  2WPF A;  1DJQ A;  3AB1 A;  1H6V A;  2YLT A;  3RNM A;  1EL5 A;  1GTH A;  1MO9 A;  2B7R A;  2BK4 A;  3AEC A;  2C3C A;  3GMC A;  2GQF A;  2TPR A;  4B66 A;  4EQR A;  1CF3 A;  4A65 A;  3GRT A;  4LU6 A;  4CNJ A;  4ECH A;  4Z44 A;  3ATR A;  2QA1 A;  1YKJ A;  1BKW A;  1M6I A;  1P2H A;  1IUV A;  2Z5X A;  2R45 A;  1BGN A;  1PBC A;  3AEB A;  3BNU A;  3AE3 A;  4FK1 A;  2H89 A;  3S61 A;  3BHF A;  2V3B A;  4M52 A;  2I0Z A;  1IUT A;  2YG5 A;  3DJG X;  2GF3 A;  4EQW A;  3IWA A;  3ALL A;  2C4C A;  4OPU A;  4RG3 A;  3FG2 P;  4EIP A;  1EL8 A;  3EAN A;  2CVJ A;  3CNJ A;  3LB8 A;  4U8I A;  3CIR A;  2QCU A;  4BUR A;  4USR A;  1CJC A;  2VOU A;  2UZZ A;  1OJT A;  1JRY A;  4JNQ A;  3NNE A;  1RYI A;  4G6H A;  4X4J A;  2CDU A;  4J34 A;  2OLO A;  1GAL A;  5EBK A;  3G5Q A;  4CY8 A;  3Q9T A;  4JNA A;  1ZMC A;  3JSK A;  4AP1 A;  3UOY A;  3KVE A;  1QLB A;  3GD3 A;  2YR6 A;  4I59 A;  5M10 A;  2C65 A;  2WQY A;  3RHA A;  1F3P A;  1GSN A;  1EBD A;  1IJH A;  3NIX A;  1TDK A;  4AT2 A;  2WET A;  1TDO A;  4YSY A;  1GT8 A;  4ICY A;  4G9K A;  3LOV A;  4H2N A;  1PHH A;  1SEZ A;  3AWI A;  2WOI A;  3G5R A;  1GND A;  4HA6 A;  1PBF A;  3P4P A;  2XFQ A;  2ZZ0 A;  1XHC A;  4A7A A;  3HZL A;  1N1P A;  3UP4 A;  5HYM A;  2X8C A;  3NT6 A;  4DNA A;  4XWR A;  4H50 A;  5HHF A;  2C72 A;  3QVR A;  1S3E A;  3AED A;  4ZCD A;  1RSG A;  4OPT A;  1JU2 A;  2HQM A;  2CUL A;  3NN6 X;  1PN0 A;  2GAG B;  4U8N A;  3CGD A;  3AYJ A;  5KMP A;  1OJC A;  3BI2 A;  3IHM A;  1GES A;  3UKK A;  1OJ9 A;  2VVL G;  3QSE A;  3UTE A;  4DGK A;  1FOH A;  1Q9I A;  3SXI A;  2X8G A;  2XLP A;  4USQ A;  4NWZ A;  3GYJ A;  1E1L A;  3NTD A;  4XXG A;  1D5T A;  3DK4 A;  3AD8 B;  3T37 A;  2XYO A;  3RP8 A;  2YR4 A;  2CFY A;  4YWO A;  2WES A;  1FL2 A;  3ICS A;  1COY A;  5BRT A;  4II2 A;  1YY5 A;  2WOW A;  2PHH A;  1ZK7 A;  2R9Z A;  3GDP A;  5KMR A;  3V3N A;  2YLR A;  4U8K A;  3AE2 A;  1LVL A;  4NTE A;  4KX6 A;  4B63 A;  2WDQ A;  3BNM A;  3I3L A;  4H2R A;  4U2L A;  5EB5 A;  1GRH A;  4C3Y A;  4H4P A;  4YSH A;  4YSZ A;  3KU9 A;  5CQF A;  3V76 A;  1DOC A;  4YSX A;  3DJE A;  4GAV A;  1W4X A;  1H2I A;  1XPQ A;  3CPI G;  5KXJ A;  1Q1R A;  4IV9 A;  5HY5 A;  1GRG A;  2FJD A;  1HYU A;  4I58 A;  2XFU A;  4YKF A;  2DKI A;  4IVM B;  3DGH A;  2YG6 A;  4Z24 A;  3T0K A;  4GAP A;  5IQ4 A;  2Z5Y A;  4J57 A;  2XLU A;  4LA1 A;  1NHR A;  3AYI A;  1REO A;  2JAE A;  4N9X A;  3UKF A;  2AQJ A;  4A6N B;  4KPR A;  1K0J A;  1QJD A;  1XDI A;  4H4R A;  1CJ2 A;  1NG4 A;  3AEG A;  3FBS A;  3SY4 A;  1LTX R;  2R46 A;  4TLZ A;  5J60 A;  1OJD A;  3NYE A;  3KPK A;  1JNR A;  3SQP A;  1DNC A;  3O0H A;  5KNL A;  4GRT A;  3D1C A;  4DSH A;  2J3N A;  4EMI A;  2F5Z A;  1RP0 A;  2FJB A;  2GMH A;  3PS9 A;  4OPI A;  2C7G A;  4G6G A;  4Y4N A;  4H4Z A;  1BF3 A;  3CN8 A;  3SX6 A;  1CBO A;  5FS8 A;  5EB4 A;  2X99 A;  2V6O A;  2WOV A;  2ARD A;  4U8J A;  1DOE A;  3GSI A;  2WP6 A;  1D4D A;  4J36 A;  4OVI A;  1H81 A;  2WU2 A;  2BAB A;  2ZBW A;  4UDQ A;  2C70 A;  3UKL A;  1PBE A;  4H2Q A;  2RAB A;  3UKA A;  4B1B A;  1H7W A;  4X9N A;  3ZDN A;  3AD9 B;  2XLS A;  3AYL A;  4D03 A;  2YWL A;  1QO8 A;  2C64 A;  3NKS A;  3T2Z A;  2EQ7 A;  2VVM A;  2YG3 A;  2EQ8 A;  3COX A;  4B65 A;  3KKJ A;  3UOV A;  4WCT A;  3HYW A;  4BK2 A;  1PXC A;  2YLW A;  1GER A;  2YVJ A;  1CJ3 A;  3ZYX A;  2XCG A;  1BWC A;  3DGZ A;  3KD9 A;  2XFN A;  1TYP A;  2GH5 A;  2BRA A;  2GB0 A;  3H8I A;  1S7M A;  4U8O A;  1YQZ A;  4H4W A;  4X9M A;  4C74 A;  3C96 A;  4H2P A;  4FK1 C;  1LV0 A;  2Y6R A;  1GRA A;  1AOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...