4BV6A

Refined crystal structure of the human apoptosis inducing factor
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
Knots found
sequence length
484
structure length
471
Chain Sequence
KAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into the Coenzyme Mediated Monomer-Dimer Transition of the Pro-Apoptotic Apoptosis Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
total genus 147
structure length 471
sequence length 484
other databases KnotProt 2.0: S -31
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4bv6A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4bv6A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4bv6A01
1GTEA 4D04A 1NHPA 3UKLA 3GWDA 3AE8A 1F8RA 1B8SA 3ALJA 2R4EA 1S2QA 5IQ4A 4U8JA 2WHDA 4ICYA 3NG7X 4Z24A 2JBVA 2VOUA 4Z2TA 3P4RA 4RSLA 3F8PA 4YSZA 4Z25A 3F8DA 4J31A 4GRTA 3GRSA 2GMHA 3G5RA 1HYUA 4EQXA 2YQUA 4H4SA 2C75A 3QVRA 3IC9A 1NHRA 4KX6A 3AEGA 1OJTA 5HHFA 2GR3A 2VVMA 4U2SA 4YTNA 5HYMA 4IA6A 4TLXA 3CNJA 3UOYA 4K5SA 1ZY8A 3IF9A 2YLXA 4ZCDA 3V76A 1Y56A 3RNMA 1COYA 2BACA 3DH9A 2BS2A 4U2TA 4Y4NA 3GD4A 1K0IA 1DODA 5JCNA 1GSNA 1BKWA 1DOEA 5U25A 4I59A 2GAGB 2QCUA 2C70A 3AD7B 1CC6A 4H4WA 1PJ5A 5JCMA 4OCGA 3FBSA 5FS8A 3S5WA 1Y0PA 3HZLA 1S2YA 4B69A 1CHUA 3NK2X 4C5OA 1FECA 1AOGA 3ICSA 3QFAA 3NN6X 4X9NA 2X8GA 4Z2UA 2GR0A 2RABA 3NIXA 3ICRA 4USRA 4NTEA 4IA5A 1ZK7A 2Q6UA 1E1MA 4K8DA 3IWAA 3JSKA 3I6DA 2GQWA 1VRQB 1P2HA 2VVLG 4B65A 4JN9A 2GAHB 2B9XA 1BGJA 2CDUA 4CNKA 5CKUA 1DOCA 4RG4A 4CBQA 2YG5A 4YTPA 1Q1RA 5TR3A 1H6VA 3AECA 3CGDA 3DMEA 3AE7A 3IHMA 1LQUA 1PJ7A 1PBEA 3CGEA 1L9EA 3CPJG 4AT2A 2WEUA 4O5UA 1GRGA 2Z5YA 3NYCA 1K4QA 2QAEA 4B64A 4YSYA 3QFBA 5FMHA 1DXLA 1BZLA 3V3OA 2JK6A 2VVLA 1NAAA 3GMBA 3CTYA 2QA1A 2BK5A 4USQA 3GD3A 1OJ9A 3AEFA 1D7YA 2OLOA 2Y6RA 1PBCA 2R0PA 3AE3A 1CJ3A 3NT6A 1OJCA 2E5VA 4C74A 1CC4A 3COXA 1KFYA 1VDCA 4DGKA 1EL7A 3AE1A 4FK1A 1PXBA 2XVIA 1GESA 3ISHA 4CCRA 4H2RA 2XFUA 4NTCA 4B63A 1P2EA 4K7ZA 5GSNA 4YT0A 3SQPA 5GRTA 4KPRA 1H82A 5KOWA 1N4UA 2ARDA 4CRTA 5U63A 2E1MA 1LV0A 3BNUA 3DJEA 2FJBA 1NHQA 3LADA 1TDKA 1PJ6A 2BYBA 1PBDA 4EM3A 4BURA 4OPIA 4H4UA 1D4EA 2H89A 3EF6A 4N9XA 3RP6A 2VQBA 3DGZA 3NTDA 2XVJA 3QVPA 4H4RA 3AE2A 4ZN0A 3GDNA 4Z2RA 3UKQA 3F8RA 4BK3A 4A99A 3AEBA 3G5QA 1GETA 1CJCA 2DKIA 4OPLA 1D4DA 3NK1X 4I58A 2WPFA 3KLJA 3LZWA 5FS6A 4FDCB 4K22A 1H86A 2X99A 2GF3A 4C3XA 2WP6A 4H2PA 3QSSA 1TYPA 3AE6A 3H4KA 2GRTA 2V61A 4FX9A 4BJZA 3NRNA 3QSMA 1PBBA 1PHHA 2XFNA 2OLNA 2BC0A 2B7SA 3NTAA 1H83A 4BK2A 2B76A 1CF3A 4MJWA 4LIIA 3CPHG 3FIMB 4H2NA 4H4ZA 2JB3A 2XYOA 2GR2A 1GNDA 2JAEA 4TM3A 5ER0A 4E0VA 1Q9IA 2A8XA 3DGHA 1PXCA 2C76A 4A9WA 4YSHA 2R9ZA 2XDOA 4JNAA 3K7MX 1TYTA 2APGA 3DA1A 1GRTA 1GTHA 5BRTA 3Q6JA 3K30A 3P1WA 5C3JA 3B3RA 1GALA 2A87A 1VG0A 4YSXA 4H4YA 3AE9A 1JNZA 3CNSA 1ZP0A 1TDFA 3ADAB 3P4SA 1NPXA 4EQSA 2EQ8A 1KSUA 2WP5A 3UKHA 3UKAA 2V5ZA 2WU5A 2YG3A 3UP5A 5U1OA 1JRYA 3M13A 1FCDA 2CFYA 5EB4A 4ZCCA 5HY5A 1JRXA 2C3CA 2YR6A 1F3PA 3L8KA 1IUTA 4CNJA 1NEKA 2YVGA 2GV8A 2VZ2A 3BI5A 2AAQA 2XFQA 3K7QX 4APNA 5KWFA 3H8LA 1H84A 4H4TA 1NG4A 1CJ4A 1F8WA 1NENA 2YR4A 2J3NA 1ZMCA 1IUWA 1GRAA 4PABA 2BK3A 3EANA 2YG7A 3C4NA 4TM4A 1PN0A 3UKKA 3QJ4A 1M6IA 4EM4A 2WOWA 3DJGX 1B37A 4Y4MA 2EQ7A 3LOVA 4P9SA 1L9CA 2UZZA 2R46A 1MO9A 2ZZ0A 3DK9A 4B68A 3PO7A 1O94A 4AP1A 1B4VA 2ZZBA 2Z5XA 2GVCA 3LB8A 3UTGA 2HQMA 1F8SA 1UKVG 1ZDLA 4J33A 4TM1A 4JQ9A 1L9DA 2C73A 3UKFA 4CY6A 3S61A 4K5RA 1DJNA 3FG2P 4GR1A 1GEUA 2XVHA 4GCMA 4OPDA 4U2LA 4J56A 2YR5A 3UOVA 2FJAA 2WESA 2BCGG 5KRQA 1LPFA 2XVFA 3NKSA 2NVKX 1H7XA 1E1LA 3GSIA 3SGLA 2JKCA 4H4XA 2YM2A 1VG9A 4A7AA 2F5ZA 1OJAA 3B6DA 4OPGA 3UKPA 3LXDA 3C4AA 2OA1A 1KNPA 4C3YA 3GWFA 3P9UA 5L46A 1S3EA 3DK4A 4CCQA 4OPTA 1CBOA 4EIPA 3P4QA 4U8LA 2C65A 3DJDA 4WCTA 2IVEA 3UOZA 5CQFA 1REOA 2GMJA 5JCKA 4AP3A 3AD8B 4JDRA 3IHGA 2DKHA 4PAAA 3CIRA 1H7WA 4UDRA 3FPZA 1YQ3A 1N4WA 2WETA 2X8CA 3H8IA 2V3AA 3AE5A 3NK0X 4XWRA 3D1CA 3EPTA 3C96A 4C77A 2Q0KA 1GPEA 1JEHA 1TDOA 1X31B 4H50A 2O9ZA 4Y4LA 2TPRA 2V60A 2WDRA 4BV6A 1CL0A 1O95A 2XLTA 1H81A 2JB1A 1TDNA 2GEWA 3R9UA 1GREA 5JCLA 1ZOVA 2E4GA 3NGCX 4B1BA 2R0CA 3Q9TA 1XPQA 1MOKA 2RGOA 3RP8A 4DSHA 4AT0A 1GRFA 2YLWA 4JY2A 3LJPA 1PS9A 1NDAA 1Y56B 2C66A 1V59A 2YWLA 3DJJA 2CULA 2GB0A 2GR1A 2TMDA 2YG6A 4Z43A 1BWCA 4EQRA 1CC2A 1IUSA 2YM1A 2XLPA 2H88A 4GF7A 2A89A 5BULA 4EMJA 3O0HA 3M0OA 4ECHA 2YAUA 4J2WA 4H4QA 1FOHA 1KNRA 2BA9A 3CGCA 1Z6LA 1N1PA 2JB2A 5BVAA 3KD9A 1RSGA 2BS3A 1ZX9A 2YG4A 4U8IA 3CNPA 4U8OA 4JNQA 2Q0LA 4X9MA 3FMWA 4XWZA 4IVMB 2WDVA 3BHKA 1JOAA 2ZBWA 4GDPA 2GH5A 3SFEA 2VQ7A 2VRMA 3EAOA 1FEBA 3WE0A 2BXRA 3AEEA 3UP4A 2R4JA 4H4PA 3VR9A 5DBJA 2WQYA 2WOIA 1GOSA 2FBWA 4U8NA 3VRBA 1FEAA 2OALA 5EBKA 2WOVA 4H7UA 3I3LA 1GRBA 5KVHA 1TDEA 5FS7A 5JCIA 3NH3X 4LU6A 3ATQA 3REDA 2BC1A 4AOSA 2C3DA 2Q7VA 2CVJA 2XFPA 5KVIA 1D5TA 1IUUA 1LVLA 2B7RA 3AE4A 3KKJA 5FS9A 4IV9A 2V6OA 1XDIA 1OJDA 4A6NB 4BK1A 4JY3A 5LV9A 2R0GA 1E6EA 3BHFA 3T37A 3AD9B 1E7PA 1KDGA 2BABA 1JNRA 4CY8A 2AR8A 1N4VA 3UTHA 4J57A 4X4JA 4Z44A 2BCPA 2PHHA 1IUVA 4K2XA 3RP7A 2B9WA 4GUVA 4EIQA 5KXJA 3SM8A 2B9YA 1EL8A 3DK8A 2YLZA 2WBAA 1KSSA 2BS4A 2EQ9A 2C64A 5EB5A 1PXAA 1XANA 1B5QA 2R45A 2YLSA 4HA6A 2EQ6A 2X8HA 4O5QA 3GDPA 3GMCA 2WU2A 1DOBA 3NLCA 3GYIA 2IIDA 2YLTA 1D4CA 2X3NA 4EMIA 2AQJA 3ABVA 4UDPA 1VQWA 4J36A 1EL5A 4ADWA 2XFOA 4U8KA 2WPCA 2WP9A 4LA1A 2PYXA 2W0HA 4BJYA 2V3BA 4DSGA 4UP3A 3CNTA 2C67A 4EMWA 1L0VA 2YVJA 2I0ZA 4H4VA 5BUKA 3URHA 2ACZA 3CN8A 4OPUA 5C2TA 2X50A 1O5WA 3AEAA 3UTEA 1RYIA 4A6NA 5KOXA 4OVIA 3D8XA 2IVDA 1RP0A 4AOXA 3CGBA 3PS9A 5IQ1A 4RG3A 1SEZA 3ATRA 2BXSA 3UTFA 1GERA 1BGNA 4NZHA 4YXDA 3KPFA 1YQZA 5M10A 4B67A 4NEVA 3KVEA 1W4XA 2XVEA 4TLZA 3QSEA 3BNMA 5J7XA 4Z26A 1KF6A 3G5SA 1YY5A 3OZ2A 1GXFA 3II4A 1JRZA 3ZDNA 4YTMA 4M52A 1DNCA 5M0ZA 1LTXR 1ZOYA 3AYJA 1YKJA 3SFDA 3AEDA 5J60A 1IUXA 1E1KA 3BI4A 3LZXA 1K0JA 5IPYA 2WS3A 3AB1A 1MXTA 1ZMDA 1DJQA 1GT8A 1M64A 2ZZCA 3NN0X 4A5LA 1NHSA 3M12A 2WDQA 3VQRA 1ELIA 2C72A 3ZYXA 4NTDA 4FK1C 3KU9A 3L1RA 1ONFA 5HXIA 2BK4A 3E1TA 3NNEA 4EQWA 1K0LA 4REKA 5EOWA 3CNDA 3CPIG 2FJDA 4WX1A 1F6MA 1QLBA 1E39A 3PVCA 2XLSA 2XLRA 4D03A 4TM0A 3VRDB 1Q1WA 1EBDA 3AWIA 3K7TA 4U8PA 2NPXA 1NG3A 2RGHA 1E1NA 3VRAA 3OC4A 3NYFA 1JU2A 4YWOA 4J34A 2OAMA 4IVOB 1XHCA 1CJ2A 1EL9A 1PBFA 1GV4A 1QJDA 3AYIA 3ITJA 3VR8A 3KA7A 3RHAA 1D7LA 1ZKQA 1LQTA 2YLRA 3UCLA 4U8MA 3NYEA 3AXBA 1TRBA 1YQ4A 2FJEA 4B66A 4DNAA 1LJ1A 4XXGA 2XCGA 3AYLA 4A65A 2XLUA 1BF3A 2VRLA 3BI2A 4YKFA 2YVFA 4YKGA 3GRTA 1PDHA 1FL2A 1QO8A 3P4PA 2Y6QA 4H2QA 2C7GA 3UOXA 3NHOX 1S3BA 2QA2A 2RGJA 3ICTA 4HB9A 1IJHA 4NEWA 4UDQA 3V3NA 2WPEA 3ALMA 4A79A 4OPCA 3GYJA 3ALLA 2GQFA 1GRHA 4GDEA
chains in the Genus database with same CATH superfamily
4ZA0A 4D04A 1NHPA 3AE8A 1F8RA 5IQ4A 1S2QA 4F4RA 3NG7X 3P4RA 4Z25A 4ENLA 1JDFA 5HHFA 3CT2A 2P88A 3CNJA 3UOYA 4HNCA 1ZY8A 3SN0A 3V76A 1Y56A 2BACA 2BS2A 4U2TA 3B9JB 5U25A 2GAGB 3AD7B 1CC6A 5JCMA 1Y0PA 4ZCWA 1AOGA 1JCTA 2Q6UA 1N62C 2PPGA 1P2HA 2GAHB 1DOCA 1H6VA 3N6JA 1PJ7A 3CPJG 4O5UA 1GRGA 2Z5YA 3QFBA 5FMHA 3V3OA 2VVLA 2BK5A 3GD3A 2Y6RA 3NT6A 1VDCA 1EL7A 4H19A 1PXBA 2XVIA 3ISHA 4H2RA 2PGWA 4K7ZA 4YT0A 1W6TA 4KPRA 2ARDA 4CRTA 1TDKA 3LADA 1PBDA 4EM3A 3DERA 4BURA 4OPIA 1D4EA 3AE2A 2OQYA 3R1ZA 3T2ZA 3VFCA 4BK3A 4A99A 3G5QA 4OPLA 2WPFA 3LZWA 4K22A 2I5QA 2GF3A 4C3XA 2WP6A 4H2PA 3U9IA 1S7MA 1TYPA 3AE6A 3H4KA 4FX9A 3QSMA 2BC0A 3TW9A 4X2PA 4MJWA 2QDEA 3FIMB 2GR2A 1GNDA 5ER0A 1Q9IA 2A8XA 4A9WA 5J04A 2XDOA 1R6WA 5JRBA 5FJRA 3K30A 5FJTA 3DIPA 3AE9A 4GGBA 1TDFA 1E9IA 4IL0A 3P4SA 5KMRA 2OX4A 1KSUA 2WU5A 5U1OA 3M13A 2GGGA 3ES8A 3R0UA 4ZCCA 2C3CA 2GV8A 1NG4A 1CJ4A 2YR4A 2GGJA 2AL1A 3T8QA 1PN0A 3C4NA 2EQ7A 4P9SA 3FJ4A 4EWJA 1DTNA 3UTGA 4CY6A 3OZYA 3CMMA 3T2KA 1GEUA 2XVHA 4GCMA 3UOVA 1L8PA 1LPFA 2XVFA 3N6HA 2JKCA 4H4XA 3DG6A 3UKPA 3C4AA 3DK4A 4CCQA 3IK4A 3P4QA 2OZTA 3TWAA 5KMSA 2IVEA 1REOA 1MUCA 4KWSA 2X8CA 3AE5A 3D1CA 3C96A 4C77A 3DEQA 4E5TA 1X31B 4BV6A 3S5SA 1O95A 1H81A 2JB1A 2GEWA 1GREA 4GYPA 1XPQA 3SBFA 2YLWA 1P48A 2C66A 1CC2A 2QJJA 2XLPA 4GF7A 5BULA 3Q4DA 4J2WA 1FOHA 1KNRA 4DX3A 3KD9A 3CB3A 2GL5A 4JNQA 3SQSA 4GDPA 3SFEA 2VQ7A 3SZWA 2VRMA 3WE0A 2BXRA 3T4WA 3IJLA 3VR9A 2WOIA 1GOSA 4G7FA 5EBKA 5EU9A 3V3WA 1GRBA 2PTYA 1KKRA 3R0KA 3ENLA 3R07C 2XH2A 4TVYA 5KVIA 4A6GA 3QKEA 2B7RA 5LV9A 2R0GA 3T37A 4CY8A 3ZVHA 1KDGA 3AD9B 3A7UA 3THUA 4X4JA 5G5GB 2QDDA 3CXOA 3I6TA 2B9WA 3SM8A 3D9XA 3DK8A 1EC7A 3DFHA 2YLZA 2WBAA 3I6EA 4HA6A 2R45A 3FCPA 2YLSA 3GDPA 2YLTA 2P8BA 2XH0A 2AQJA 4HNLA 1VQWA 4J36A 1EL5A 2WP9A 4LA1A 2W55A 1L0VA 4H4VA 4G74A 3CN8A 3UTEA 1RYIA 4OVIA 3D46A 3D8XA 4AOXA 4K1WA 1P43A 3NVVB 4ZOHB 1BGNA 4YXDA 3KPFA 5M10A 4IT1A 1ELSA 2OZ3A 4II2A 4E4UA 3OZ2A 1GXFA 3II4A 5M0ZA 1ZOYA 2OLAA 1YKJA 4IZGA 3OZMA 1E1KA 3BI4A 1MXTA 4KPLA 3M12A 2WDQA 3VQRA 3ZYXA 2BK4A 1XPYA 1STZA 1RM6B 4E6MA 3PVCA 3RRAA 4D03A 4TM0A 2NPXA 1E1NA 3UXLA 3EEZA 4YWOA 1F9CA 1CJ2A 1EL9A 3DGBA 3ITJA 3KA7A 3NYEA 1OEPA 2FJEA 4A65A 2XCGA 5BOFA 2YVFA 4YKGA 3GRTA 1QO8A 2Y6QA 4H2QA 3UOXA 3NVWB 6ENLA 4II3A 4DYEA 3ALLA 3UJRA 1GTEA 3UKLA 1B8SA 3ALJA 2QQ6A 3V5FA 4ICYA 4Z24A 3QLDA 3P0WA 3S47A 1VQZA 3BSMA 3G5RA 4EQXA 1ECQA 2YQUA 4H4SA 3QVRA 3NS1B 3QN3A 4Z1YA 5HYMA 2OKTA 2QVHA 4TLXA 2QJNA 4K5SA 1COYA 4DXKA 1DOEA 4OCGA 1PJ5A 3S5WA 1VDVA 1JROA 4C5OA 3FYYA 3MSYA 2X8GA 4Z2UA 2GR0A 3ICRA 4USRA 4IA5A 1ZK7A 2MUCA 1ZXIC 3JSKA 3I6DA 2GQWA 1VRQB 2VVLG 4JN9A 2ZC8A 4GYPC 5TR3A 3DMEA 3CGDA 3AE7A 3BOXA 1PBEA 2WEUA 3SN1A 3OTRA 1KKOA 2QAEA 3V4BA 2BRYA 2QA1A 2OLOA 4J1OA 1CJ3A 2E5VA 4C74A 3COXA 1KFYA 3AE1A 3K1GA 2NQLA 3SQPA 3BNUA 3ZLGA 1PJ6A 1N61C 4N9XA 3EF6A 4H4RA 2OZ8A 2P8CA 3UKQA 3F8RA 3FVDA 2DKIA 3A7AA 3QSSA 1FHUA 2MNRA 2V61A 1PBBA 2OLNA 1CF3A 2PS2A 2XYOA 1PXCA 2C76A 3K7MX 1GTHA 1GALA 2A87A 1VG0A 3CNSA 3ADAB 2PU0A 2V5ZA 1MDRA 3UP5A 2PTXA 1JRYA 1YEYA 3SXIA 2YR6A 3L8KA 1WUFA 1IUTA 2AAQA 1H84A 4H4TA 1F8WA 1NENA 2XH4A 2J3NA 1ZMCA 1IUWA 4TM4A 1GRAA 2WOWA 2ZZ0A 4B68A 2GGEA 3PO7A 1O94A 4AP1A 1B4VA 3ETRB 2PMQA 1UKVG 3CK5A 1PDYA 3MUCA 3TWBA 1DJNA 3FV9A 4OPDA 1SJAA 4J56A 2BCGG 5KRQA 2NVKX 3GSIA 3SGLA 4A7AA 1VG9A 2F5ZA 2OPJA 3B6DA 4OPGA 2FYMA 3LXDA 4C3YA 3H7VA 3P9UA 1CBOA 4U8LA 4WCTA 3TJ4A 3UOZA 5JCKA 4GAVA 3IHGA 1YQ3A 1N4WA 1H2IA 2WETA 2V3AA 3NK0X 2ZADA 1JEHA 2W3SA 2V60A 2WDRA 1CL0A 2XLTA 3VC5A 3NGCX 4YWSA 3Q9TA 1MOKA 3UJSA 4AT0A 1GRFA 4JY2A 1V59A 4Z43A 1SJCA 2PU1A 3STPA 4H4QA 3CGCA 1N1PA 1FO4A 3OP2A 1EBHA 3DESA 3FMWA 1TE6A 2WDVA 3BHKA 3P93A 2W3RA 3AEEA 2R4JA 1BKHA 2FBWA 4U8NA 1FEAA 4H7UA 3I3LA 3Q45A 2QGYA 5JCIA 3TQPA 3ATQA 2Q7VA 2GDQA 1D5TA 1IUUA 1LVLA 3R25A 1XDIA 1OJDA 3BHFA 5BOEA 2BABA 1JNRA 1N4VA 4GIRA 3RP7A 4KEMA 4GUVA 2HZGA 3HYWA 1WUEA 2BS4A 2EQ9A 4DHGA 1XANA 2EQ6A 3GMCA 4HCDA 3AM9A 4A35A 1DOBA 3NLCA 3GYIA 2IIDA 1D4CA 3ABVA 4UDPA 4U8KA 2DW7A 4UP3A 2YVJA 3URHA 2ACZA 5C2TA 2X50A 3TJIA 1O5WA 4A6NA 4IL2A 3ES7A 1RP0A 2PTZA 3UTFA 1GERA 4NZHA 3KVEA 1W4XA 5J7XA 4Z26A 3HRDC 2P3ZA 1KF6A 1YY5A 2E5AA 4YTMA 3AYJA 3H8AA 4G6GA 5IPYA 2WS3A 3KUMA 1DJQA 1M64A 2ZZCA 4MKSA 3PWGA 4FK1C 3E1TA 4EQWA 4WX1A 3D47A 3MZNA 1SJDA 1Q1WA 3K7TA 4U8PA 1NG3A 2RGHA 3DFYA 3CAWA 3NYFA 3CXBA 1JU2A 3AYIA 1XHCA 5ENLA 3VR8A 3TCSA 3T31A 2YLRA 1BQGA 4DNAA 2PP1A 2XLUA 1BF3A 3BI2A 4IHCA 3RR1A 3PFRA 3HYVA 2C7GA 3T14A 2QA2A 5KMPA 2WPEA 3ALMA 4A79A 4OPCA 3GYJA 1GRHA 2PA6A 2WHDA 3H70A 2JBVA 2VOUA 2AKZA 4YSZA 4IP5A 4J31A 3PWIA 2PCEA 2GMHA 1HYUA 3HW2A 3HPFA 3UXKA 3AEGA 4HN8A 2VVMA 4U2SA 4IA6A 4A3RA 1X2GA 5IDZA 4ZCDA 3RNMA 4Y4NA 1DODA 3N4FA 1GSNA 1BKWA 2QCUA 3H12A 3FBSA 3RCYA 3HZLA 3NK2X 3ICSA 3NN6X 2RABA 3NIXA 4NTEA 1E1MA 4K8DA 4G8TA 2B9XA 1BGJA 5CKUA 3U4FA 4RG4A 1KD0A 2YG5A 4YTPA 1Q1RA 3AECA 4Z17A 3CGEA 1L9EA 4AT2A 3SR6B 1NELA 2GGIA 4B64A 2JK6A 3GMBA 4USQA 3AEFA 1D7YA 4GAPA 1PBCA 1CC4A 4DGKA 4FK1A 4CCRA 1GESA 2XFUA 4NTCA 5GSNA 4JHMA 2O56A 2FJBA 4ROPA 2BYBA 1ONEA 3NFUA 3RP6A 3QVPA 3VA8A 4ZN0A 3AEBA 1GETA 1CJCA 5KNLA 4I58A 3KLJA 4FDCB 1H86A 4BJZA 3T2YA 1PHHA 2B7SA 3SZ0A 2HXTA 4H2NA 2JB3A 2JAEA 4E0VA 3DGHA 4YSHA 4JNAA 1RVKA 3VCCA 5C3JA 1ZP0A 4EQSA 3UKHA 3T9PA 2YG3A 1FCDA 5EB4A 1F3PA 4CNJA 2YVGA 3BI5A 4APNA 5KWFA 2BK3A 2YG7A 3QJ4A 2GGHA 3AN1A 4Y4MA 3LOVA 3GC2A 3ZLFA 2R46A 1MO9A 3DK9A 3GYXA 2ZZBA 2Z5XA 2GVCA 3LB8A 2HQMA 1F8SA 3L5OA 4GISA 4FP1A 1L9DA 2C73A 3S61A 4K5RA 3NO1A 1E1LA 2YM2A 1KNPA 4OPTA 4IP4A 2C65A 3DJDA 3SYIA 2ONEA 2PGEA 2GMJA 3AD8B 2DKHA 4UDRA 3FPZA 3H8IA 1SB3B 4JN8A 4H2HA 2Q0KA 1KN0A 4Y4LA 3EUB3 2P0IA 4KT2A 3R9UA 1ZOVA 4B1BA 2R0CA 3RP8A 3LJPA 1PS9A 1Y56B 2YWLA 3DJJA 2YG6A 2GR1A 2YM1A 3ZVIA 2RDXA 3O0HA 4ECHA 2YAUA 2BA9A 2JB2A 5BVAA 1RSGA 1MDLA 1ZX9A 2YG4A 4U8IA 4X9MA 2Q0LA 4XWZA 3TOYA 2OG9A 3EKGA 3EAOA 1R0MA 2PP3A 4GFIA 3UP4A 1FFVC 4H4PA 5DBJA 1X2HA 2WOVA 1EC8A 5FS7A 3NH3X 3BJSA 2BC1A 2C3DA 3GY1A 4IV9A 3KKJA 2POZA 2V6OA 2GSHA 4JY3A 3OW1A 1E6EA 2AR8A 4Z44A 2BCPA 2PHHA 4K2XA 1KSSA 5EB5A 3RO6A 2C64A 4O5QA 1B5QA 3VC6A 3QTPA 4HPNA 2DW6A 3VDGA 4EMIA 2XFOA 2W0HA 4BJYA 4NNJA 2V3BA 4FI4A 3CNTA 2C67A 5BUKA 3TTEA 3AEAA 3SSZA 3SY4A 4RG3A 4B67A 3ZLHA 2XVEA 4TLZA 4M52A 1DNCA 4G9KA 1LTXR 1XS2A 3AEDA 4NWZA 2AL2B 1IUXA 3LZXA 1K0JA 3UJEA 1GT8A 3NN0X 2C72A 3KU9A 1ONFA 5HXIA 3NNEA 4REKA 5EOWA 3SX6A 3CNDA 4M6UA 3CPIG 3JW7A 1QLBA 2XLSA 2XLRA 1EBDA 3AWIA 3NVZB 2AL2A 3VRAA 3OC4A 4J34A 4IVOB 3UCDA 1GV4A 3PK7A 1QJDA 1D7LA 1ZKQA 1LQTA 4U8MA 1YQ4A 4B66A 4XXGA 3AYLA 3DG7A 4YKFA 2AKMA 1PDHA 1MNSA 2OQHA 1FL2A 3CYJA 1S3BA 4UDQA 4NEWA 2PTWA 1MRAA 3GWDA 2R4EA 4U8JA 4Z2TA 4RSLA 3F8PA 3F8DA 4GRTA 3GRSA 5FJPA 2C75A 3IC9A 4K8GA 1NHRA 5G5HB 4KX6A 1SJBA 3MY9A 3QPEA 1OJTA 3DDMA 2GR3A 4YTNA 3SN4A 3IF9A 2YLXA 3DH9A 3GD4A 2QJMA 1K0IA 5JCNA 4I59A 2C70A 3JZUA 4H4WA 5FS8A 1S2YA 4B69A 1CHUA 1FECA 3QFAA 4X9NA 3RGTA 3IWAA 3DG3A 3SZCA 4B65A 2CDUA 4CNKA 4CBQA 2E3TA 3OPSA 3IHMA 1LQUA 1TZZA 3NYCA 1K4QA 3P3BA 4YSYA 3IJIA 1DXLA 1BZLA 4GMEA 1NAAA 3CTYA 3V5CA 3VCNA 1OJ9A 2R0PA 3AE3A 1OJCA 1V97A 4B63A 1P2EA 1WYGA 5GRTA 1H82A 5KOWA 1N4UA 4H83A 1PDZA 5U63A 2E1MA 1LV0A 3DJEA 1NHQA 4H4UA 2H89A 2VQBA 3DGZA 3NTDA 2XVJA 4G73A 1FFUC 3GDNA 4Z2RA 4HCHA 2HXUA 2W54A 1D4DA 3NK1X 1T3QC 5FS6A 2X99A 2PODA 4TVWA 2GRTA 3NRNA 2XFNA 1EC9A 3NTAA 3UGVA 1H83A 4BK2A 2B76A 1EBGA 4LIIA 3CPHG 4H4ZA 4TM3A 2R9ZA 4MGGA 1TYTA 2APGA 3DA1A 1GRTA 5BRTA 3Q6JA 3P1WA 3B3RA 4YSXA 4H4YA 4DWDA 1JNZA 1NPXA 2EQ8A 2WP5A 3UKAA 3SJNA 1IYXA 2CFYA 1NU5A 2PP0A 1JRXA 5HY5A 3R10A 1NEKA 3I4KA 2VZ2A 2XFQA 1N63C 3K7QX 3H8LA 3N4EA 4PABA 3UKKA 3EANA 3RITA 1M6IA 4EM4A 3DJGX 1B37A 5FJUA 2FKPA 4H1ZA 1L9CA 2UZZA 3NRZB 3KPKA 3SZFA 4MMWA 4J33A 1ZDLA 4TM1A 4JQ9A 3UKFA 2XGZA 3FG2P 4GR1A 4E4FA 4U2LA 2YR5A 2FJAA 2WESA 3NKSA 1H7XA 1OJAA 2OA1A 4DN1A 3GWFA 2OO6A 5L46A 1S3EA 4EIPA 3NVYB 5CQFA 4AP3A 2HNEA 4JDRA 4PAAA 3CIRA 1H7WA 4XWRA 2XSXA 3EPTA 3NXLA 1GPEA 2O9ZA 1TDOA 4H50A 2TPRA 1JPMA 4G6HA 3UJ2A 1TDNA 3MKCA 5JCLA 2E4GA 2RGOA 3UJFA 3MQTA 4DSHA 4HCLA 1NDAA 2CULA 2GB0A 2TMDA 1BWCA 4EQRA 1IUSA 2H88A 2A89A 4EMJA 3M0OA 2XH7A 3UCCA 1Z6LA 2BS3A 3CNPA 1N5WC 4U8OA 4IVMB 2PSNA 1JOAA 2ZBWA 1FIQB 2GH5A 1FEBA 4J3ZA 2WQYA 3VRBA 2OALA 2CHRA 5KVHA 1TDEA 7ENLA 4LU6A 3REDA 4AOSA 2CVJA 2XFPA 3AE4A 5FS9A 4A6NB 4BK1A 3GO2A 1E7PA 1KCZA 1TKKA 3UTHA 5KMQA 4J57A 1JPDX 2OFJA 1IUVA 4EIQA 5KXJA 2B9YA 1EL8A 2C4CA 3ZVHB 1PXAA 2X8HA 2WU2A 4K2SA 3AMZA 5FJOA 2X3NA 3FXGA 4ADWA 2WPCA 2PYXA 3R11A 2BRAA 4DSGA 4EMWA 2I0ZA 4OPUA 5KOXA 2IVDA 4GGHA 3PG6A 3CGBA 3PS9A 5IQ1A 1SEZA 3ATRA 2BXSA 2OVLA 1YQZA 4NEVA 3HYXA 3QSEA 3BNMA 3G5SA 3A7RA 1JRZA 3ZDNA 3SFDA 3B97A 4HYRA 5J60A 1N60C 3AB1A 1ZMDA 4A5LA 1FHVA 4M0XA 1NHSA 1ELIA 4NTDA 1JRPA 3L1RA 1K0LA 2FJDA 3NZGA 1F6MA 1E39A 3T0KA 3JVAA 3VRDB 3MWCA 2OAMA 1PBFA 3RHAA 1N5XA 3UCLA 3AXBA 4JN7A 1TRBA 1LJ1A 2VRLA 3GD6A 3P4PA 3IJQA 3NHOX 2RGJA 3ICTA 4HB9A 4E8GA 1IJHA 3V3NA 3T6CA 2GQFA 4GDEA
chains in the Genus database with same CATH topology
1GTEA 4D04A 1NHPA 3UKLA 3GWDA 3AE8A 1F8RA 1B8SA 3ALJA 2R4EA 1S2QA 5IQ4A 4U8JA 2WHDA 4ICYA 3NG7X 4Z24A 2JBVA 2VOUA 4Z2TA 3P4RA 4RSLA 3F8PA 4YSZA 4Z25A 3F8DA 4J31A 4GRTA 3GRSA 2GMHA 3G5RA 1HYUA 4EQXA 2YQUA 4H4SA 2C75A 3QVRA 3IC9A 1NHRA 4KX6A 3AEGA 1OJTA 5HHFA 2GR3A 2VVMA 4U2SA 4YTNA 5HYMA 4IA6A 4TLXA 3CNJA 3UOYA 4K5SA 1ZY8A 3IF9A 2YLXA 4ZCDA 3V76A 1Y56A 3RNMA 1COYA 2BACA 3DH9A 2BS2A 4U2TA 4Y4NA 3GD4A 1K0IA 1DODA 5JCNA 1GSNA 1BKWA 1DOEA 5U25A 4I59A 2GAGB 2QCUA 2C70A 3AD7B 1CC6A 4H4WA 1PJ5A 5JCMA 4OCGA 3FBSA 5FS8A 3S5WA 1Y0PA 3HZLA 1S2YA 4B69A 1CHUA 3NK2X 4C5OA 1FECA 1AOGA 3ICSA 3QFAA 3NN6X 4X9NA 2X8GA 4Z2UA 2GR0A 2RABA 3NIXA 3ICRA 4USRA 4NTEA 4IA5A 1ZK7A 2Q6UA 1E1MA 4K8DA 3IWAA 3JSKA 3I6DA 2GQWA 1VRQB 1P2HA 2VVLG 3SZCA 4B65A 4JN9A 2GAHB 2B9XA 1BGJA 2CDUA 4CNKA 5CKUA 1DOCA 4RG4A 4CBQA 2YG5A 4YTPA 1Q1RA 5TR3A 1H6VA 3AECA 3CGDA 3DMEA 3AE7A 3IHMA 1LQUA 1PJ7A 1PBEA 3CGEA 1L9EA 3CPJG 4AT2A 2WEUA 4O5UA 1GRGA 2Z5YA 3NYCA 1K4QA 2QAEA 4B64A 4YSYA 3QFBA 5FMHA 1DXLA 1BZLA 3V3OA 2JK6A 2VVLA 1NAAA 3GMBA 2BRYA 3CTYA 2QA1A 2BK5A 4USQA 3GD3A 1OJ9A 3AEFA 1D7YA 2OLOA 4GAPA 2Y6RA 1PBCA 2R0PA 3AE3A 1CJ3A 3NT6A 1OJCA 2E5VA 4C74A 1CC4A 3COXA 1KFYA 1VDCA 4DGKA 1EL7A 3AE1A 4FK1A 1PXBA 2XVIA 1GESA 3ISHA 4CCRA 4H2RA 2XFUA 4NTCA 4B63A 1P2EA 4K7ZA 5GSNA 4YT0A 3SQPA 5GRTA 4KPRA 1H82A 5KOWA 1N4UA 2ARDA 4CRTA 5U63A 2E1MA 1LV0A 3BNUA 3DJEA 2FJBA 1NHQA 3LADA 1TDKA 1PJ6A 2BYBA 1PBDA 4EM3A 4BURA 4OPIA 4H4UA 1D4EA 2H89A 3EF6A 4N9XA 3RP6A 2VQBA 3DGZA 3NTDA 2XVJA 3QVPA 4H4RA 4G73A 3AE2A 4ZN0A 3GDNA 4Z2RA 3T2ZA 3UKQA 3F8RA 4BK3A 4A99A 3AEBA 3G5QA 1GETA 1CJCA 2DKIA 4OPLA 5KNLA 1D4DA 3NK1X 4I58A 2WPFA 3KLJA 3LZWA 5FS6A 4FDCB 4K22A 1H86A 2X99A 2GF3A 4C3XA 2WP6A 4H2PA 3QSSA 1S7MA 1TYPA 3AE6A 3H4KA 2GRTA 2V61A 4FX9A 4BJZA 3NRNA 3QSMA 1PBBA 3T2YA 1PHHA 2XFNA 2OLNA 2BC0A 2B7SA 3NTAA 1H83A 4BK2A 2B76A 1CF3A 3SZ0A 4MJWA 4LIIA 3CPHG 3FIMB 4H2NA 4H4ZA 2JB3A 2XYOA 2GR2A 1GNDA 2JAEA 4TM3A 5ER0A 4E0VA 1Q9IA 2A8XA 3DGHA 1PXCA 2C76A 4A9WA 4YSHA 2R9ZA 2XDOA 4JNAA 5JRBA 3K7MX 1TYTA 2APGA 3DA1A 1GRTA 1GTHA 5BRTA 3Q6JA 3K30A 3P1WA 5C3JA 3B3RA 1GALA 2A87A 1VG0A 4YSXA 4H4YA 3AE9A 1JNZA 3CNSA 1ZP0A 1TDFA 3ADAB 3P4SA 5KMRA 1NPXA 4EQSA 2EQ8A 1KSUA 2WP5A 3UKHA 3UKAA 2V5ZA 2WU5A 2YG3A 3UP5A 5U1OA 1JRYA 3M13A 1FCDA 2CFYA 5EB4A 3SXIA 4ZCCA 5HY5A 1JRXA 2C3CA 2YR6A 1F3PA 3L8KA 1IUTA 4CNJA 1NEKA 2YVGA 2GV8A 2VZ2A 3BI5A 2AAQA 2XFQA 3K7QX 4APNA 5KWFA 3H8LA 1H84A 4H4TA 1NG4A 1CJ4A 1F8WA 1NENA 2YR4A 2J3NA 1ZMCA 1IUWA 1GRAA 4PABA 2BK3A 3EANA 2YG7A 3C4NA 4TM4A 1PN0A 3UKKA 3QJ4A 1M6IA 4EM4A 2WOWA 3DJGX 1B37A 4Y4MA 2EQ7A 3LOVA 4P9SA 1L9CA 2UZZA 2R46A 1MO9A 2ZZ0A 3DK9A 3GYXA 4B68A 3KPKA 3PO7A 1O94A 4AP1A 1B4VA 2ZZBA 2Z5XA 3SZFA 2GVCA 3LB8A 3UTGA 2HQMA 1F8SA 1UKVG 1ZDLA 4J33A 4TM1A 3L5OA 4JQ9A 1L9DA 2C73A 3UKFA 4CY6A 3S61A 3CMMA 4K5RA 1DJNA 3FG2P 4GR1A 3T2KA 1GEUA 2XVHA 4GCMA 4OPDA 4U2LA 4J56A 2YR5A 3UOVA 2FJAA 2WESA 2BCGG 5KRQA 1LPFA 2XVFA 3NKSA 2NVKX 1H7XA 1E1LA 3GSIA 3SGLA 2JKCA 4H4XA 2YM2A 1VG9A 4A7AA 2F5ZA 1OJAA 3B6DA 4OPGA 3UKPA 3LXDA 3C4AA 2OA1A 1KNPA 4C3YA 3GWFA 3P9UA 5L46A 1S3EA 3DK4A 4CCQA 4OPTA 1CBOA 4EIPA 3P4QA 4U8LA 2C65A 3DJDA 4WCTA 3SYIA 5KMSA 2IVEA 3UOZA 5CQFA 1REOA 2GMJA 5JCKA 4AP3A 3AD8B 4GAVA 4JDRA 3IHGA 2DKHA 4PAAA 3CIRA 1H7WA 4UDRA 3FPZA 1YQ3A 1N4WA 1H2IA 2X8CA 2WETA 2V3AA 3AE5A 3H8IA 3NK0X 4XWRA 3D1CA 3EPTA 3C96A 4C77A 2Q0KA 1KN0A 1GPEA 1JEHA 1TDOA 1X31B 4H50A 2O9ZA 4Y4LA 2TPRA 2V60A 2WDRA 4BV6A 1CL0A 4G6HA 1O95A 2XLTA 1H81A 2JB1A 1TDNA 2GEWA 3R9UA 1GREA 5JCLA 1ZOVA 2E4GA 3NGCX 4B1BA 2R0CA 3Q9TA 1XPQA 1MOKA 2RGOA 3RP8A 4DSHA 4AT0A 1GRFA 2YLWA 4JY2A 3LJPA 1PS9A 1NDAA 1Y56B 2C66A 1V59A 2YWLA 3DJJA 2CULA 2GB0A 2GR1A 2TMDA 2YG6A 4Z43A 1BWCA 4EQRA 1CC2A 1IUSA 2YM1A 2XLPA 2H88A 4GF7A 2A89A 5BULA 4EMJA 3O0HA 3M0OA 4ECHA 2YAUA 4J2WA 4H4QA 1FOHA 1KNRA 2BA9A 3CGCA 1Z6LA 1N1PA 2JB2A 5BVAA 3KD9A 1RSGA 2BS3A 1ZX9A 2YG4A 4U8IA 3CNPA 4U8OA 4JNQA 2Q0LA 4X9MA 3FMWA 4XWZA 4IVMB 2WDVA 3BHKA 1JOAA 2ZBWA 4GDPA 2GH5A 3SFEA 2VQ7A 3SZWA 2VRMA 3EAOA 1FEBA 3WE0A 2BXRA 3AEEA 3UP4A 2R4JA 4H4PA 3VR9A 5DBJA 2WQYA 2WOIA 1GOSA 2FBWA 4U8NA 3VRBA 1FEAA 2OALA 5EBKA 2WOVA 4H7UA 3I3LA 1GRBA 5KVHA 1TDEA 5FS7A 5JCIA 3NH3X 4LU6A 3ATQA 3REDA 2BC1A 4AOSA 2C3DA 2Q7VA 2CVJA 2XFPA 5KVIA 1D5TA 1IUUA 1LVLA 2B7RA 3AE4A 3KKJA 5FS9A 4IV9A 2V6OA 1XDIA 1OJDA 4A6NB 4BK1A 4JY3A 5LV9A 2R0GA 1E6EA 3BHFA 3T37A 3AD9B 1E7PA 1KDGA 2BABA 1JNRA 4CY8A 2AR8A 1N4VA 3UTHA 5KMQA 4J57A 4X4JA 4Z44A 2BCPA 2PHHA 1IUVA 4K2XA 3RP7A 2B9WA 4GUVA 4EIQA 5KXJA 3SM8A 2B9YA 3D9XA 1EL8A 3DK8A 3HYWA 2YLZA 2WBAA 1KSSA 2C4CA 2BS4A 2EQ9A 2C64A 5EB5A 1PXAA 1XANA 1B5QA 2R45A 2YLSA 4HA6A 2EQ6A 2X8HA 4O5QA 3GDPA 3GMCA 2WU2A 1DOBA 3NLCA 3GYIA 2IIDA 2YLTA 1D4CA 2X3NA 4EMIA 2AQJA 3ABVA 4UDPA 1VQWA 4J36A 1EL5A 4ADWA 2XFOA 4U8KA 2WPCA 2WP9A 4LA1A 2PYXA 2W0HA 4BJYA 4NNJA 2V3BA 2BRAA 4DSGA 4UP3A 3CNTA 2C67A 4EMWA 1L0VA 2YVJA 2I0ZA 4H4VA 4G74A 3URHA 2ACZA 3CN8A 4OPUA 5C2TA 2X50A 1O5WA 3AEAA 3UTEA 1RYIA 4A6NA 5KOXA 4OVIA 3D8XA 2IVDA 3SY4A 1RP0A 4AOXA 3PG6A 3CGBA 3PS9A 5IQ1A 4RG3A 1SEZA 3ATRA 2BXSA 3UTFA 1GERA 1BGNA 4NZHA 4YXDA 3KPFA 1YQZA 5M10A 4B67A 4NEVA 3HYXA 1W4XA 2XVEA 3KVEA 4TLZA 3QSEA 3BNMA 5J7XA 4II2A 4Z26A 1KF6A 3G5SA 1YY5A 3OZ2A 1GXFA 3II4A 1JRZA 3ZDNA 4YTMA 4M52A 1DNCA 4G9KA 5M0ZA 1LTXR 1ZOYA 3AYJA 1YKJA 3SFDA 4G6GA 3AEDA 4NWZA 5J60A 1IUXA 1E1KA 3BI4A 3LZXA 1K0JA 5IPYA 2WS3A 3AB1A 1MXTA 1ZMDA 1DJQA 1GT8A 1M64A 2ZZCA 3NN0X 4A5LA 1NHSA 3M12A 2WDQA 3VQRA 1ELIA 2C72A 3ZYXA 4NTDA 4FK1C 3KU9A 3L1RA 1ONFA 5HXIA 2BK4A 3E1TA 3NNEA 4EQWA 1K0LA 4REKA 5EOWA 3SX6A 3CNDA 3CPIG 2FJDA 4WX1A 1F6MA 1QLBA 1E39A 3PVCA 2XLSA 2XLRA 3T0KA 4D03A 4TM0A 3VRDB 1Q1WA 1EBDA 3AWIA 3K7TA 5BUKA 4U8PA 2NPXA 1NG3A 2RGHA 1E1NA 3VRAA 3OC4A 3NYFA 1JU2A 4YWOA 4J34A 2OAMA 4IVOB 1XHCA 1CJ2A 1EL9A 1PBFA 1GV4A 1QJDA 3AYIA 3ITJA 3VR8A 3KA7A 3RHAA 1D7LA 1ZKQA 1LQTA 3T31A 2YLRA 3UCLA 4U8MA 3NYEA 3AXBA 1TRBA 1YQ4A 2FJEA 4B66A 4DNAA 1LJ1A 4XXGA 2XCGA 3AYLA 4A65A 2XLUA 1BF3A 2VRLA 3BI2A 4YKFA 2YVFA 4YKGA 3GRTA 1PDHA 1FL2A 1QO8A 3P4PA 2Y6QA 3HYVA 2C7GA 4H2QA 3UOXA 3NHOX 3T14A 1S3BA 2QA2A 2RGJA 3ICTA 4HB9A 1IJHA 4NEWA 4UDQA 5KMPA 3V3NA 2WPEA 3ALMA 4A79A 4II3A 4OPCA 3GYJA 3ALLA 2GQFA 1GRHA 4GDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GTE A;  4D04 A;  1NHP A;  3UKL A;  3GWD A;  3AE8 A;  1F8R A;  1B8S A;  3ALJ A;  2R4E A;  1S2Q A;  5IQ4 A;  4U8J A;  2WHD A;  4ICY A;  3NG7 X;  4Z24 A;  2JBV A;  2VOU A;  4Z2T A;  3P4R A;  4RSL A;  3F8P A;  4YSZ A;  4Z25 A;  3F8D A;  4J31 A;  4GRT A;  3GRS A;  2GMH A;  3G5R A;  1HYU A;  4EQX A;  2YQU A;  4H4S A;  2C75 A;  3QVR A;  3IC9 A;  1NHR A;  4KX6 A;  3AEG A;  1OJT A;  5HHF A;  2GR3 A;  2VVM A;  4U2S A;  4YTN A;  5HYM A;  4IA6 A;  4TLX A;  3CNJ A;  3UOY A;  4K5S A;  1ZY8 A;  3IF9 A;  2YLX A;  4ZCD A;  3V76 A;  1Y56 A;  3RNM A;  1COY A;  2BAC A;  3DH9 A;  2BS2 A;  4U2T A;  4Y4N A;  3GD4 A;  1K0I A;  1DOD A;  5JCN A;  1GSN A;  1BKW A;  1DOE A;  5U25 A;  4I59 A;  2GAG B;  2QCU A;  2C70 A;  3AD7 B;  1CC6 A;  4H4W A;  1PJ5 A;  5JCM A;  4OCG A;  3FBS A;  5FS8 A;  3S5W A;  1Y0P A;  3HZL A;  1S2Y A;  4B69 A;  1CHU A;  3NK2 X;  4C5O A;  1FEC A;  1AOG A;  3ICS A;  3QFA A;  3NN6 X;  4X9N A;  2X8G A;  4Z2U A;  2GR0 A;  2RAB A;  3NIX A;  3ICR A;  4USR A;  4NTE A;  4IA5 A;  1ZK7 A;  2Q6U A;  1E1M A;  4K8D A;  3IWA A;  3JSK A;  3I6D A;  2GQW A;  1VRQ B;  1P2H A;  2VVL G;  4B65 A;  4JN9 A;  2GAH B;  2B9X A;  1BGJ A;  2CDU A;  4CNK A;  5CKU A;  1DOC A;  4RG4 A;  4CBQ A;  2YG5 A;  4YTP A;  1Q1R A;  5TR3 A;  1H6V A;  3AEC A;  3CGD A;  3DME A;  3AE7 A;  3IHM A;  1LQU A;  1PJ7 A;  1PBE A;  3CGE A;  1L9E A;  3CPJ G;  4AT2 A;  2WEU A;  4O5U A;  1GRG A;  2Z5Y A;  3NYC A;  1K4Q A;  2QAE A;  4B64 A;  4YSY A;  3QFB A;  5FMH A;  1DXL A;  1BZL A;  3V3O A;  2JK6 A;  2VVL A;  1NAA A;  3GMB A;  3CTY A;  2QA1 A;  2BK5 A;  4USQ A;  3GD3 A;  1OJ9 A;  3AEF A;  1D7Y A;  2OLO A;  2Y6R A;  1PBC A;  2R0P A;  3AE3 A;  1CJ3 A;  3NT6 A;  1OJC A;  2E5V A;  4C74 A;  1CC4 A;  3COX A;  1KFY A;  1VDC A;  4DGK A;  1EL7 A;  3AE1 A;  4FK1 A;  1PXB A;  2XVI A;  1GES A;  3ISH A;  4CCR A;  4H2R A;  2XFU A;  4NTC A;  4B63 A;  1P2E A;  4K7Z A;  5GSN A;  4YT0 A;  3SQP A;  5GRT A;  4KPR A;  1H82 A;  5KOW A;  1N4U A;  2ARD A;  4CRT A;  5U63 A;  2E1M A;  1LV0 A;  3BNU A;  3DJE A;  2FJB A;  1NHQ A;  3LAD A;  1TDK A;  1PJ6 A;  2BYB A;  1PBD A;  4EM3 A;  4BUR A;  4OPI A;  4H4U A;  1D4E A;  2H89 A;  3EF6 A;  4N9X A;  3RP6 A;  2VQB A;  3DGZ A;  3NTD A;  2XVJ A;  3QVP A;  4H4R A;  3AE2 A;  4ZN0 A;  3GDN A;  4Z2R A;  3UKQ A;  3F8R A;  4BK3 A;  4A99 A;  3AEB A;  3G5Q A;  1GET A;  1CJC A;  2DKI A;  4OPL A;  1D4D A;  3NK1 X;  4I58 A;  2WPF A;  3KLJ A;  3LZW A;  5FS6 A;  4FDC B;  4K22 A;  1H86 A;  2X99 A;  2GF3 A;  4C3X A;  2WP6 A;  4H2P A;  3QSS A;  1TYP A;  3AE6 A;  3H4K A;  2GRT A;  2V61 A;  4FX9 A;  4BJZ A;  3NRN A;  3QSM A;  1PBB A;  1PHH A;  2XFN A;  2OLN A;  2BC0 A;  2B7S A;  3NTA A;  1H83 A;  4BK2 A;  2B76 A;  1CF3 A;  4MJW A;  4LII A;  3CPH G;  3FIM B;  4H2N A;  4H4Z A;  2JB3 A;  2XYO A;  2GR2 A;  1GND A;  2JAE A;  4TM3 A;  5ER0 A;  4E0V A;  1Q9I A;  2A8X A;  3DGH A;  1PXC A;  2C76 A;  4A9W A;  4YSH A;  2R9Z A;  2XDO A;  4JNA A;  3K7M X;  1TYT A;  2APG A;  3DA1 A;  1GRT A;  1GTH A;  5BRT A;  3Q6J A;  3K30 A;  3P1W A;  5C3J A;  3B3R A;  1GAL A;  2A87 A;  1VG0 A;  4YSX A;  4H4Y A;  3AE9 A;  1JNZ A;  3CNS A;  1ZP0 A;  1TDF A;  3ADA B;  3P4S A;  1NPX A;  4EQS A;  2EQ8 A;  1KSU A;  2WP5 A;  3UKH A;  3UKA A;  2V5Z A;  2WU5 A;  2YG3 A;  3UP5 A;  5U1O A;  1JRY A;  3M13 A;  1FCD A;  2CFY A;  5EB4 A;  4ZCC A;  5HY5 A;  1JRX A;  2C3C A;  2YR6 A;  1F3P A;  3L8K A;  1IUT A;  4CNJ A;  1NEK A;  2YVG A;  2GV8 A;  2VZ2 A;  3BI5 A;  2AAQ A;  2XFQ A;  3K7Q X;  4APN A;  5KWF A;  3H8L A;  1H84 A;  4H4T A;  1NG4 A;  1CJ4 A;  1F8W A;  1NEN A;  2YR4 A;  2J3N A;  1ZMC A;  1IUW A;  1GRA A;  4PAB A;  2BK3 A;  3EAN A;  2YG7 A;  3C4N A;  4TM4 A;  1PN0 A;  3UKK A;  3QJ4 A;  1M6I A;  4EM4 A;  2WOW A;  3DJG X;  1B37 A;  4Y4M A;  2EQ7 A;  3LOV A;  4P9S A;  1L9C A;  2UZZ A;  2R46 A;  1MO9 A;  2ZZ0 A;  3DK9 A;  4B68 A;  3PO7 A;  1O94 A;  4AP1 A;  1B4V A;  2ZZB A;  2Z5X A;  2GVC A;  3LB8 A;  3UTG A;  2HQM A;  1F8S A;  1UKV G;  1ZDL A;  4J33 A;  4TM1 A;  4JQ9 A;  1L9D A;  2C73 A;  3UKF A;  4CY6 A;  3S61 A;  4K5R A;  1DJN A;  3FG2 P;  4GR1 A;  1GEU A;  2XVH A;  4GCM A;  4OPD A;  4U2L A;  4J56 A;  2YR5 A;  3UOV A;  2FJA A;  2WES A;  2BCG G;  5KRQ A;  1LPF A;  2XVF A;  3NKS A;  2NVK X;  1H7X A;  1E1L A;  3GSI A;  3SGL A;  2JKC A;  4H4X A;  2YM2 A;  1VG9 A;  4A7A A;  2F5Z A;  1OJA A;  3B6D A;  4OPG A;  3UKP A;  3LXD A;  3C4A A;  2OA1 A;  1KNP A;  4C3Y A;  3GWF A;  3P9U A;  5L46 A;  1S3E A;  3DK4 A;  4CCQ A;  4OPT A;  1CBO A;  4EIP A;  3P4Q A;  4U8L A;  2C65 A;  3DJD A;  4WCT A;  2IVE A;  3UOZ A;  5CQF A;  1REO A;  2GMJ A;  5JCK A;  4AP3 A;  3AD8 B;  4JDR A;  3IHG A;  2DKH A;  4PAA A;  3CIR A;  1H7W A;  4UDR A;  3FPZ A;  1YQ3 A;  1N4W A;  2WET A;  2X8C A;  3H8I A;  2V3A A;  3AE5 A;  3NK0 X;  4XWR A;  3D1C A;  3EPT A;  3C96 A;  4C77 A;  2Q0K A;  1GPE A;  1JEH A;  1TDO A;  1X31 B;  4H50 A;  2O9Z A;  4Y4L A;  2TPR A;  2V60 A;  2WDR A;  4BV6 A;  1CL0 A;  1O95 A;  2XLT A;  1H81 A;  2JB1 A;  1TDN A;  2GEW A;  3R9U A;  1GRE A;  5JCL A;  1ZOV A;  2E4G A;  3NGC X;  4B1B A;  2R0C A;  3Q9T A;  1XPQ A;  1MOK A;  2RGO A;  3RP8 A;  4DSH A;  4AT0 A;  1GRF A;  2YLW A;  4JY2 A;  3LJP A;  1PS9 A;  1NDA A;  1Y56 B;  2C66 A;  1V59 A;  2YWL A;  3DJJ A;  2CUL A;  2GB0 A;  2GR1 A;  2TMD A;  2YG6 A;  4Z43 A;  1BWC A;  4EQR A;  1CC2 A;  1IUS A;  2YM1 A;  2XLP A;  2H88 A;  4GF7 A;  2A89 A;  5BUL A;  4EMJ A;  3O0H A;  3M0O A;  4ECH A;  2YAU A;  4J2W A;  4H4Q A;  1FOH A;  1KNR A;  2BA9 A;  3CGC A;  1Z6L A;  1N1P A;  2JB2 A;  5BVA A;  3KD9 A;  1RSG A;  2BS3 A;  1ZX9 A;  2YG4 A;  4U8I A;  3CNP A;  4U8O A;  4JNQ A;  2Q0L A;  4X9M A;  3FMW A;  4XWZ A;  4IVM B;  2WDV A;  3BHK A;  1JOA A;  2ZBW A;  4GDP A;  2GH5 A;  3SFE A;  2VQ7 A;  2VRM A;  3EAO A;  1FEB A;  3WE0 A;  2BXR A;  3AEE A;  3UP4 A;  2R4J A;  4H4P A;  3VR9 A;  5DBJ A;  2WQY A;  2WOI A;  1GOS A;  2FBW A;  4U8N A;  3VRB A;  1FEA A;  2OAL A;  5EBK A;  2WOV A;  4H7U A;  3I3L A;  1GRB A;  5KVH A;  1TDE A;  5FS7 A;  5JCI A;  3NH3 X;  4LU6 A;  3ATQ A;  3RED A;  2BC1 A;  4AOS A;  2C3D A;  2Q7V A;  2CVJ A;  2XFP A;  5KVI A;  1D5T A;  1IUU A;  1LVL A;  2B7R A;  3AE4 A;  3KKJ A;  5FS9 A;  4IV9 A;  2V6O A;  1XDI A;  1OJD A;  4A6N B;  4BK1 A;  4JY3 A;  5LV9 A;  2R0G A;  1E6E A;  3BHF A;  3T37 A;  3AD9 B;  1E7P A;  1KDG A;  2BAB A;  1JNR A;  4CY8 A;  2AR8 A;  1N4V A;  3UTH A;  4J57 A;  4X4J A;  4Z44 A;  2BCP A;  2PHH A;  1IUV A;  4K2X A;  3RP7 A;  2B9W A;  4GUV A;  4EIQ A;  5KXJ A;  3SM8 A;  2B9Y A;  1EL8 A;  3DK8 A;  2YLZ A;  2WBA A;  1KSS A;  2BS4 A;  2EQ9 A;  2C64 A;  5EB5 A;  1PXA A;  1XAN A;  1B5Q A;  2R45 A;  2YLS A;  4HA6 A;  2EQ6 A;  2X8H A;  4O5Q A;  3GDP A;  3GMC A;  2WU2 A;  1DOB A;  3NLC A;  3GYI A;  2IID A;  2YLT A;  1D4C A;  2X3N A;  4EMI A;  2AQJ A;  3ABV A;  4UDP A;  1VQW A;  4J36 A;  1EL5 A;  4ADW A;  2XFO A;  4U8K A;  2WPC A;  2WP9 A;  4LA1 A;  2PYX A;  2W0H A;  4BJY A;  2V3B A;  4DSG A;  4UP3 A;  3CNT A;  2C67 A;  4EMW A;  1L0V A;  2YVJ A;  2I0Z A;  4H4V A;  5BUK A;  3URH A;  2ACZ A;  3CN8 A;  4OPU A;  5C2T A;  2X50 A;  1O5W A;  3AEA A;  3UTE A;  1RYI A;  4A6N A;  5KOX A;  4OVI A;  3D8X A;  2IVD A;  1RP0 A;  4AOX A;  3CGB A;  3PS9 A;  5IQ1 A;  4RG3 A;  1SEZ A;  3ATR A;  2BXS A;  3UTF A;  1GER A;  1BGN A;  4NZH A;  4YXD A;  3KPF A;  1YQZ A;  5M10 A;  4B67 A;  4NEV A;  3KVE A;  1W4X A;  2XVE A;  4TLZ A;  3QSE A;  3BNM A;  5J7X A;  4Z26 A;  1KF6 A;  3G5S A;  1YY5 A;  3OZ2 A;  1GXF A;  3II4 A;  1JRZ A;  3ZDN A;  4YTM A;  4M52 A;  1DNC A;  5M0Z A;  1LTX R;  1ZOY A;  3AYJ A;  1YKJ A;  3SFD A;  3AED A;  5J60 A;  1IUX A;  1E1K A;  3BI4 A;  3LZX A;  1K0J A;  5IPY A;  2WS3 A;  3AB1 A;  1MXT A;  1ZMD A;  1DJQ A;  1GT8 A;  1M64 A;  2ZZC A;  3NN0 X;  4A5L A;  1NHS A;  3M12 A;  2WDQ A;  3VQR A;  1ELI A;  2C72 A;  3ZYX A;  4NTD A;  4FK1 C;  3KU9 A;  3L1R A;  1ONF A;  5HXI A;  2BK4 A;  3E1T A;  3NNE A;  4EQW A;  1K0L A;  4REK A;  5EOW A;  3CND A;  3CPI G;  2FJD A;  4WX1 A;  1F6M A;  1QLB A;  1E39 A;  3PVC A;  2XLS A;  2XLR A;  4D03 A;  4TM0 A;  3VRD B;  1Q1W A;  1EBD A;  3AWI A;  3K7T A;  4U8P A;  2NPX A;  1NG3 A;  2RGH A;  1E1N A;  3VRA A;  3OC4 A;  3NYF A;  1JU2 A;  4YWO A;  4J34 A;  2OAM A;  4IVO B;  1XHC A;  1CJ2 A;  1EL9 A;  1PBF A;  1GV4 A;  1QJD A;  3AYI A;  3ITJ A;  3VR8 A;  3KA7 A;  3RHA A;  1D7L A;  1ZKQ A;  1LQT A;  2YLR A;  3UCL A;  4U8M A;  3NYE A;  3AXB A;  1TRB A;  1YQ4 A;  2FJE A;  4B66 A;  4DNA A;  1LJ1 A;  4XXG A;  2XCG A;  3AYL A;  4A65 A;  2XLU A;  1BF3 A;  2VRL A;  3BI2 A;  4YKF A;  2YVF A;  4YKG A;  3GRT A;  1PDH A;  1FL2 A;  1QO8 A;  3P4P A;  2Y6Q A;  4H2Q A;  2C7G A;  3UOX A;  3NHO X;  1S3B A;  2QA2 A;  2RGJ A;  3ICT A;  4HB9 A;  1IJH A;  4NEW A;  4UDQ A;  3V3N A;  2WPE A;  3ALM A;  4A79 A;  4OPC A;  3GYJ A;  3ALL A;  2GQF A;  1GRH A;  4GDE A; 
#chains in the Genus database with same CATH topology
 4ZA0 A;  4D04 A;  1NHP A;  3AE8 A;  1F8R A;  5IQ4 A;  1S2Q A;  4F4R A;  3NG7 X;  3P4R A;  4Z25 A;  4ENL A;  1JDF A;  5HHF A;  3CT2 A;  2P88 A;  3CNJ A;  3UOY A;  4HNC A;  1ZY8 A;  3SN0 A;  3V76 A;  1Y56 A;  2BAC A;  2BS2 A;  4U2T A;  3B9J B;  5U25 A;  2GAG B;  3AD7 B;  1CC6 A;  5JCM A;  1Y0P A;  4ZCW A;  1AOG A;  1JCT A;  2Q6U A;  1N62 C;  2PPG A;  1P2H A;  2GAH B;  1DOC A;  1H6V A;  3N6J A;  1PJ7 A;  3CPJ G;  4O5U A;  1GRG A;  2Z5Y A;  3QFB A;  5FMH A;  3V3O A;  2VVL A;  2BK5 A;  3GD3 A;  2Y6R A;  3NT6 A;  1VDC A;  1EL7 A;  4H19 A;  1PXB A;  2XVI A;  3ISH A;  4H2R A;  2PGW A;  4K7Z A;  4YT0 A;  1W6T A;  4KPR A;  2ARD A;  4CRT A;  1TDK A;  3LAD A;  1PBD A;  4EM3 A;  3DER A;  4BUR A;  4OPI A;  1D4E A;  3AE2 A;  2OQY A;  3R1Z A;  3T2Z A;  3VFC A;  4BK3 A;  4A99 A;  3G5Q A;  4OPL A;  2WPF A;  3LZW A;  4K22 A;  2I5Q A;  2GF3 A;  4C3X A;  2WP6 A;  4H2P A;  3U9I A;  1S7M A;  1TYP A;  3AE6 A;  3H4K A;  4FX9 A;  3QSM A;  2BC0 A;  3TW9 A;  4X2P A;  4MJW A;  2QDE A;  3FIM B;  2GR2 A;  1GND A;  5ER0 A;  1Q9I A;  2A8X A;  4A9W A;  5J04 A;  2XDO A;  1R6W A;  5JRB A;  5FJR A;  3K30 A;  5FJT A;  3DIP A;  3AE9 A;  4GGB A;  1TDF A;  1E9I A;  4IL0 A;  3P4S A;  5KMR A;  2OX4 A;  1KSU A;  2WU5 A;  5U1O A;  3M13 A;  2GGG A;  3ES8 A;  3R0U A;  4ZCC A;  2C3C A;  2GV8 A;  1NG4 A;  1CJ4 A;  2YR4 A;  2GGJ A;  2AL1 A;  3T8Q A;  1PN0 A;  3C4N A;  2EQ7 A;  4P9S A;  3FJ4 A;  4EWJ A;  1DTN A;  3UTG A;  4CY6 A;  3OZY A;  3CMM A;  3T2K A;  1GEU A;  2XVH A;  4GCM A;  3UOV A;  1L8P A;  1LPF A;  2XVF A;  3N6H A;  2JKC A;  4H4X A;  3DG6 A;  3UKP A;  3C4A A;  3DK4 A;  4CCQ A;  3IK4 A;  3P4Q A;  2OZT A;  3TWA A;  5KMS A;  2IVE A;  1REO A;  1MUC A;  4KWS A;  2X8C A;  3AE5 A;  3D1C A;  3C96 A;  4C77 A;  3DEQ A;  4E5T A;  1X31 B;  4BV6 A;  3S5S A;  1O95 A;  1H81 A;  2JB1 A;  2GEW A;  1GRE A;  4GYP A;  1XPQ A;  3SBF A;  2YLW A;  1P48 A;  2C66 A;  1CC2 A;  2QJJ A;  2XLP A;  4GF7 A;  5BUL A;  3Q4D A;  4J2W A;  1FOH A;  1KNR A;  4DX3 A;  3KD9 A;  3CB3 A;  2GL5 A;  4JNQ A;  3SQS A;  4GDP A;  3SFE A;  2VQ7 A;  3SZW A;  2VRM A;  3WE0 A;  2BXR A;  3T4W A;  3IJL A;  3VR9 A;  2WOI A;  1GOS A;  4G7F A;  5EBK A;  5EU9 A;  3V3W A;  1GRB A;  2PTY A;  1KKR A;  3R0K A;  3ENL A;  3R07 C;  2XH2 A;  4TVY A;  5KVI A;  4A6G A;  3QKE A;  2B7R A;  5LV9 A;  2R0G A;  3T37 A;  4CY8 A;  3ZVH A;  1KDG A;  3AD9 B;  3A7U A;  3THU A;  4X4J A;  5G5G B;  2QDD A;  3CXO A;  3I6T A;  2B9W A;  3SM8 A;  3D9X A;  3DK8 A;  1EC7 A;  3DFH A;  2YLZ A;  2WBA A;  3I6E A;  4HA6 A;  2R45 A;  3FCP A;  2YLS A;  3GDP A;  2YLT A;  2P8B A;  2XH0 A;  2AQJ A;  4HNL A;  1VQW A;  4J36 A;  1EL5 A;  2WP9 A;  4LA1 A;  2W55 A;  1L0V A;  4H4V A;  4G74 A;  3CN8 A;  3UTE A;  1RYI A;  4OVI A;  3D46 A;  3D8X A;  4AOX A;  4K1W A;  1P43 A;  3NVV B;  4ZOH B;  1BGN A;  4YXD A;  3KPF A;  5M10 A;  4IT1 A;  1ELS A;  2OZ3 A;  4II2 A;  4E4U A;  3OZ2 A;  1GXF A;  3II4 A;  5M0Z A;  1ZOY A;  2OLA A;  1YKJ A;  4IZG A;  3OZM A;  1E1K A;  3BI4 A;  1MXT A;  4KPL A;  3M12 A;  2WDQ A;  3VQR A;  3ZYX A;  2BK4 A;  1XPY A;  1STZ A;  1RM6 B;  4E6M A;  3PVC A;  3RRA A;  4D03 A;  4TM0 A;  2NPX A;  1E1N A;  3UXL A;  3EEZ A;  4YWO A;  1F9C A;  1CJ2 A;  1EL9 A;  3DGB A;  3ITJ A;  3KA7 A;  3NYE A;  1OEP A;  2FJE A;  4A65 A;  2XCG A;  5BOF A;  2YVF A;  4YKG A;  3GRT A;  1QO8 A;  2Y6Q A;  4H2Q A;  3UOX A;  3NVW B;  6ENL A;  4II3 A;  4DYE A;  3ALL A;  3UJR A;  1GTE A;  3UKL A;  1B8S A;  3ALJ A;  2QQ6 A;  3V5F A;  4ICY A;  4Z24 A;  3QLD A;  3P0W A;  3S47 A;  1VQZ A;  3BSM A;  3G5R A;  4EQX A;  1ECQ A;  2YQU A;  4H4S A;  3QVR A;  3NS1 B;  3QN3 A;  4Z1Y A;  5HYM A;  2OKT A;  2QVH A;  4TLX A;  2QJN A;  4K5S A;  1COY A;  4DXK A;  1DOE A;  4OCG A;  1PJ5 A;  3S5W A;  1VDV A;  1JRO A;  4C5O A;  3FYY A;  3MSY A;  2X8G A;  4Z2U A;  2GR0 A;  3ICR A;  4USR A;  4IA5 A;  1ZK7 A;  2MUC A;  1ZXI C;  3JSK A;  3I6D A;  2GQW A;  1VRQ B;  2VVL G;  4JN9 A;  2ZC8 A;  4GYP C;  5TR3 A;  3DME A;  3CGD A;  3AE7 A;  3BOX A;  1PBE A;  2WEU A;  3SN1 A;  3OTR A;  1KKO A;  2QAE A;  3V4B A;  2BRY A;  2QA1 A;  2OLO A;  4J1O A;  1CJ3 A;  2E5V A;  4C74 A;  3COX A;  1KFY A;  3AE1 A;  3K1G A;  2NQL A;  3SQP A;  3BNU A;  3ZLG A;  1PJ6 A;  1N61 C;  4N9X A;  3EF6 A;  4H4R A;  2OZ8 A;  2P8C A;  3UKQ A;  3F8R A;  3FVD A;  2DKI A;  3A7A A;  3QSS A;  1FHU A;  2MNR A;  2V61 A;  1PBB A;  2OLN A;  1CF3 A;  2PS2 A;  2XYO A;  1PXC A;  2C76 A;  3K7M X;  1GTH A;  1GAL A;  2A87 A;  1VG0 A;  3CNS A;  3ADA B;  2PU0 A;  2V5Z A;  1MDR A;  3UP5 A;  2PTX A;  1JRY A;  1YEY A;  3SXI A;  2YR6 A;  3L8K A;  1WUF A;  1IUT A;  2AAQ A;  1H84 A;  4H4T A;  1F8W A;  1NEN A;  2XH4 A;  2J3N A;  1ZMC A;  1IUW A;  4TM4 A;  1GRA A;  2WOW A;  2ZZ0 A;  4B68 A;  2GGE A;  3PO7 A;  1O94 A;  4AP1 A;  1B4V A;  3ETR B;  2PMQ A;  1UKV G;  3CK5 A;  1PDY A;  3MUC A;  3TWB A;  1DJN A;  3FV9 A;  4OPD A;  1SJA A;  4J56 A;  2BCG G;  5KRQ A;  2NVK X;  3GSI A;  3SGL A;  4A7A A;  1VG9 A;  2F5Z A;  2OPJ A;  3B6D A;  4OPG A;  2FYM A;  3LXD A;  4C3Y A;  3H7V A;  3P9U A;  1CBO A;  4U8L A;  4WCT A;  3TJ4 A;  3UOZ A;  5JCK A;  4GAV A;  3IHG A;  1YQ3 A;  1N4W A;  1H2I A;  2WET A;  2V3A A;  3NK0 X;  2ZAD A;  1JEH A;  2W3S A;  2V60 A;  2WDR A;  1CL0 A;  2XLT A;  3VC5 A;  3NGC X;  4YWS A;  3Q9T A;  1MOK A;  3UJS A;  4AT0 A;  1GRF A;  4JY2 A;  1V59 A;  4Z43 A;  1SJC A;  2PU1 A;  3STP A;  4H4Q A;  3CGC A;  1N1P A;  1FO4 A;  3OP2 A;  1EBH A;  3DES A;  3FMW A;  1TE6 A;  2WDV A;  3BHK A;  3P93 A;  2W3R A;  3AEE A;  2R4J A;  1BKH A;  2FBW A;  4U8N A;  1FEA A;  4H7U A;  3I3L A;  3Q45 A;  2QGY A;  5JCI A;  3TQP A;  3ATQ A;  2Q7V A;  2GDQ A;  1D5T A;  1IUU A;  1LVL A;  3R25 A;  1XDI A;  1OJD A;  3BHF A;  5BOE A;  2BAB A;  1JNR A;  1N4V A;  4GIR A;  3RP7 A;  4KEM A;  4GUV A;  2HZG A;  3HYW A;  1WUE A;  2BS4 A;  2EQ9 A;  4DHG A;  1XAN A;  2EQ6 A;  3GMC A;  4HCD A;  3AM9 A;  4A35 A;  1DOB A;  3NLC A;  3GYI A;  2IID A;  1D4C A;  3ABV A;  4UDP A;  4U8K A;  2DW7 A;  4UP3 A;  2YVJ A;  3URH A;  2ACZ A;  5C2T A;  2X50 A;  3TJI A;  1O5W A;  4A6N A;  4IL2 A;  3ES7 A;  1RP0 A;  2PTZ A;  3UTF A;  1GER A;  4NZH A;  3KVE A;  1W4X A;  5J7X A;  4Z26 A;  3HRD C;  2P3Z A;  1KF6 A;  1YY5 A;  2E5A A;  4YTM A;  3AYJ A;  3H8A A;  4G6G A;  5IPY A;  2WS3 A;  3KUM A;  1DJQ A;  1M64 A;  2ZZC A;  4MKS A;  3PWG A;  4FK1 C;  3E1T A;  4EQW A;  4WX1 A;  3D47 A;  3MZN A;  1SJD A;  1Q1W A;  3K7T A;  4U8P A;  1NG3 A;  2RGH A;  3DFY A;  3CAW A;  3NYF A;  3CXB A;  1JU2 A;  3AYI A;  1XHC A;  5ENL A;  3VR8 A;  3TCS A;  3T31 A;  2YLR A;  1BQG A;  4DNA A;  2PP1 A;  2XLU A;  1BF3 A;  3BI2 A;  4IHC A;  3RR1 A;  3PFR A;  3HYV A;  2C7G A;  3T14 A;  2QA2 A;  5KMP A;  2WPE A;  3ALM A;  4A79 A;  4OPC A;  3GYJ A;  1GRH A;  2PA6 A;  2WHD A;  3H70 A;  2JBV A;  2VOU A;  2AKZ A;  4YSZ A;  4IP5 A;  4J31 A;  3PWI A;  2PCE A;  2GMH A;  1HYU A;  3HW2 A;  3HPF A;  3UXK A;  3AEG A;  4HN8 A;  2VVM A;  4U2S A;  4IA6 A;  4A3R A;  1X2G A;  5IDZ A;  4ZCD A;  3RNM A;  4Y4N A;  1DOD A;  3N4F A;  1GSN A;  1BKW A;  2QCU A;  3H12 A;  3FBS A;  3RCY A;  3HZL A;  3NK2 X;  3ICS A;  3NN6 X;  2RAB A;  3NIX A;  4NTE A;  1E1M A;  4K8D A;  4G8T A;  2B9X A;  1BGJ A;  5CKU A;  3U4F A;  4RG4 A;  1KD0 A;  2YG5 A;  4YTP A;  1Q1R A;  3AEC A;  4Z17 A;  3CGE A;  1L9E A;  4AT2 A;  3SR6 B;  1NEL A;  2GGI A;  4B64 A;  2JK6 A;  3GMB A;  4USQ A;  3AEF A;  1D7Y A;  4GAP A;  1PBC A;  1CC4 A;  4DGK A;  4FK1 A;  4CCR A;  1GES A;  2XFU A;  4NTC A;  5GSN A;  4JHM A;  2O56 A;  2FJB A;  4ROP A;  2BYB A;  1ONE A;  3NFU A;  3RP6 A;  3QVP A;  3VA8 A;  4ZN0 A;  3AEB A;  1GET A;  1CJC A;  5KNL A;  4I58 A;  3KLJ A;  4FDC B;  1H86 A;  4BJZ A;  3T2Y A;  1PHH A;  2B7S A;  3SZ0 A;  2HXT A;  4H2N A;  2JB3 A;  2JAE A;  4E0V A;  3DGH A;  4YSH A;  4JNA A;  1RVK A;  3VCC A;  5C3J A;  1ZP0 A;  4EQS A;  3UKH A;  3T9P A;  2YG3 A;  1FCD A;  5EB4 A;  1F3P A;  4CNJ A;  2YVG A;  3BI5 A;  4APN A;  5KWF A;  2BK3 A;  2YG7 A;  3QJ4 A;  2GGH A;  3AN1 A;  4Y4M A;  3LOV A;  3GC2 A;  3ZLF A;  2R46 A;  1MO9 A;  3DK9 A;  3GYX A;  2ZZB A;  2Z5X A;  2GVC A;  3LB8 A;  2HQM A;  1F8S A;  3L5O A;  4GIS A;  4FP1 A;  1L9D A;  2C73 A;  3S61 A;  4K5R A;  3NO1 A;  1E1L A;  2YM2 A;  1KNP A;  4OPT A;  4IP4 A;  2C65 A;  3DJD A;  3SYI A;  2ONE A;  2PGE A;  2GMJ A;  3AD8 B;  2DKH A;  4UDR A;  3FPZ A;  3H8I A;  1SB3 B;  4JN8 A;  4H2H A;  2Q0K A;  1KN0 A;  4Y4L A;  3EUB 3;  2P0I A;  4KT2 A;  3R9U A;  1ZOV A;  4B1B A;  2R0C A;  3RP8 A;  3LJP A;  1PS9 A;  1Y56 B;  2YWL A;  3DJJ A;  2YG6 A;  2GR1 A;  2YM1 A;  3ZVI A;  2RDX A;  3O0H A;  4ECH A;  2YAU A;  2BA9 A;  2JB2 A;  5BVA A;  1RSG A;  1MDL A;  1ZX9 A;  2YG4 A;  4U8I A;  4X9M A;  2Q0L A;  4XWZ A;  3TOY A;  2OG9 A;  3EKG A;  3EAO A;  1R0M A;  2PP3 A;  4GFI A;  3UP4 A;  1FFV C;  4H4P A;  5DBJ A;  1X2H A;  2WOV A;  1EC8 A;  5FS7 A;  3NH3 X;  3BJS A;  2BC1 A;  2C3D A;  3GY1 A;  4IV9 A;  3KKJ A;  2POZ A;  2V6O A;  2GSH A;  4JY3 A;  3OW1 A;  1E6E A;  2AR8 A;  4Z44 A;  2BCP A;  2PHH A;  4K2X A;  1KSS A;  5EB5 A;  3RO6 A;  2C64 A;  4O5Q A;  1B5Q A;  3VC6 A;  3QTP A;  4HPN A;  2DW6 A;  3VDG A;  4EMI A;  2XFO A;  2W0H A;  4BJY A;  4NNJ A;  2V3B A;  4FI4 A;  3CNT A;  2C67 A;  5BUK A;  3TTE A;  3AEA A;  3SSZ A;  3SY4 A;  4RG3 A;  4B67 A;  3ZLH A;  2XVE A;  4TLZ A;  4M52 A;  1DNC A;  4G9K A;  1LTX R;  1XS2 A;  3AED A;  4NWZ A;  2AL2 B;  1IUX A;  3LZX A;  1K0J A;  3UJE A;  1GT8 A;  3NN0 X;  2C72 A;  3KU9 A;  1ONF A;  5HXI A;  3NNE A;  4REK A;  5EOW A;  3SX6 A;  3CND A;  4M6U A;  3CPI G;  3JW7 A;  1QLB A;  2XLS A;  2XLR A;  1EBD A;  3AWI A;  3NVZ B;  2AL2 A;  3VRA A;  3OC4 A;  4J34 A;  4IVO B;  3UCD A;  1GV4 A;  3PK7 A;  1QJD A;  1D7L A;  1ZKQ A;  1LQT A;  4U8M A;  1YQ4 A;  4B66 A;  4XXG A;  3AYL A;  3DG7 A;  4YKF A;  2AKM A;  1PDH A;  1MNS A;  2OQH A;  1FL2 A;  3CYJ A;  1S3B A;  4UDQ A;  4NEW A;  2PTW A;  1MRA A;  3GWD A;  2R4E A;  4U8J A;  4Z2T A;  4RSL A;  3F8P A;  3F8D A;  4GRT A;  3GRS A;  5FJP A;  2C75 A;  3IC9 A;  4K8G A;  1NHR A;  5G5H B;  4KX6 A;  1SJB A;  3MY9 A;  3QPE A;  1OJT A;  3DDM A;  2GR3 A;  4YTN A;  3SN4 A;  3IF9 A;  2YLX A;  3DH9 A;  3GD4 A;  2QJM A;  1K0I A;  5JCN A;  4I59 A;  2C70 A;  3JZU A;  4H4W A;  5FS8 A;  1S2Y A;  4B69 A;  1CHU A;  1FEC A;  3QFA A;  4X9N A;  3RGT A;  3IWA A;  3DG3 A;  3SZC A;  4B65 A;  2CDU A;  4CNK A;  4CBQ A;  2E3T A;  3OPS A;  3IHM A;  1LQU A;  1TZZ A;  3NYC A;  1K4Q A;  3P3B A;  4YSY A;  3IJI A;  1DXL A;  1BZL A;  4GME A;  1NAA A;  3CTY A;  3V5C A;  3VCN A;  1OJ9 A;  2R0P A;  3AE3 A;  1OJC A;  1V97 A;  4B63 A;  1P2E A;  1WYG A;  5GRT A;  1H82 A;  5KOW A;  1N4U A;  4H83 A;  1PDZ A;  5U63 A;  2E1M A;  1LV0 A;  3DJE A;  1NHQ A;  4H4U A;  2H89 A;  2VQB A;  3DGZ A;  3NTD A;  2XVJ A;  4G73 A;  1FFU C;  3GDN A;  4Z2R A;  4HCH A;  2HXU A;  2W54 A;  1D4D A;  3NK1 X;  1T3Q C;  5FS6 A;  2X99 A;  2POD A;  4TVW A;  2GRT A;  3NRN A;  2XFN A;  1EC9 A;  3NTA A;  3UGV A;  1H83 A;  4BK2 A;  2B76 A;  1EBG A;  4LII A;  3CPH G;  4H4Z A;  4TM3 A;  2R9Z A;  4MGG A;  1TYT A;  2APG A;  3DA1 A;  1GRT A;  5BRT A;  3Q6J A;  3P1W A;  3B3R A;  4YSX A;  4H4Y A;  4DWD A;  1JNZ A;  1NPX A;  2EQ8 A;  2WP5 A;  3UKA A;  3SJN A;  1IYX A;  2CFY A;  1NU5 A;  2PP0 A;  1JRX A;  5HY5 A;  3R10 A;  1NEK A;  3I4K A;  2VZ2 A;  2XFQ A;  1N63 C;  3K7Q X;  3H8L A;  3N4E A;  4PAB A;  3UKK A;  3EAN A;  3RIT A;  1M6I A;  4EM4 A;  3DJG X;  1B37 A;  5FJU A;  2FKP A;  4H1Z A;  1L9C A;  2UZZ A;  3NRZ B;  3KPK A;  3SZF A;  4MMW A;  4J33 A;  1ZDL A;  4TM1 A;  4JQ9 A;  3UKF A;  2XGZ A;  3FG2 P;  4GR1 A;  4E4F A;  4U2L A;  2YR5 A;  2FJA A;  2WES A;  3NKS A;  1H7X A;  1OJA A;  2OA1 A;  4DN1 A;  3GWF A;  2OO6 A;  5L46 A;  1S3E A;  4EIP A;  3NVY B;  5CQF A;  4AP3 A;  2HNE A;  4JDR A;  4PAA A;  3CIR A;  1H7W A;  4XWR A;  2XSX A;  3EPT A;  3NXL A;  1GPE A;  2O9Z A;  1TDO A;  4H50 A;  2TPR A;  1JPM A;  4G6H A;  3UJ2 A;  1TDN A;  3MKC A;  5JCL A;  2E4G A;  2RGO A;  3UJF A;  3MQT A;  4DSH A;  4HCL A;  1NDA A;  2CUL A;  2GB0 A;  2TMD A;  1BWC A;  4EQR A;  1IUS A;  2H88 A;  2A89 A;  4EMJ A;  3M0O A;  2XH7 A;  3UCC A;  1Z6L A;  2BS3 A;  3CNP A;  1N5W C;  4U8O A;  4IVM B;  2PSN A;  1JOA A;  2ZBW A;  1FIQ B;  2GH5 A;  1FEB A;  4J3Z A;  2WQY A;  3VRB A;  2OAL A;  2CHR A;  5KVH A;  1TDE A;  7ENL A;  4LU6 A;  3RED A;  4AOS A;  2CVJ A;  2XFP A;  3AE4 A;  5FS9 A;  4A6N B;  4BK1 A;  3GO2 A;  1E7P A;  1KCZ A;  1TKK A;  3UTH A;  5KMQ A;  4J57 A;  1JPD X;  2OFJ A;  1IUV A;  4EIQ A;  5KXJ A;  2B9Y A;  1EL8 A;  2C4C A;  3ZVH B;  1PXA A;  2X8H A;  2WU2 A;  4K2S A;  3AMZ A;  5FJO A;  2X3N A;  3FXG A;  4ADW A;  2WPC A;  2PYX A;  3R11 A;  2BRA A;  4DSG A;  4EMW A;  2I0Z A;  4OPU A;  5KOX A;  2IVD A;  4GGH A;  3PG6 A;  3CGB A;  3PS9 A;  5IQ1 A;  1SEZ A;  3ATR A;  2BXS A;  2OVL A;  1YQZ A;  4NEV A;  3HYX A;  3QSE A;  3BNM A;  3G5S A;  3A7R A;  1JRZ A;  3ZDN A;  3SFD A;  3B97 A;  4HYR A;  5J60 A;  1N60 C;  3AB1 A;  1ZMD A;  4A5L A;  1FHV A;  4M0X A;  1NHS A;  1ELI A;  4NTD A;  1JRP A;  3L1R A;  1K0L A;  2FJD A;  3NZG A;  1F6M A;  1E39 A;  3T0K A;  3JVA A;  3VRD B;  3MWC A;  2OAM A;  1PBF A;  3RHA A;  1N5X A;  3UCL A;  3AXB A;  4JN7 A;  1TRB A;  1LJ1 A;  2VRL A;  3GD6 A;  3P4P A;  3IJQ A;  3NHO X;  2RGJ A;  3ICT A;  4HB9 A;  4E8G A;  1IJH A;  3V3N A;  3T6C A;  2GQF A;  4GDE A; 
#chains in the Genus database with same CATH homology
 1GTE A;  4D04 A;  1NHP A;  3UKL A;  3GWD A;  3AE8 A;  1F8R A;  1B8S A;  3ALJ A;  2R4E A;  1S2Q A;  5IQ4 A;  4U8J A;  2WHD A;  4ICY A;  3NG7 X;  4Z24 A;  2JBV A;  2VOU A;  4Z2T A;  3P4R A;  4RSL A;  3F8P A;  4YSZ A;  4Z25 A;  3F8D A;  4J31 A;  4GRT A;  3GRS A;  2GMH A;  3G5R A;  1HYU A;  4EQX A;  2YQU A;  4H4S A;  2C75 A;  3QVR A;  3IC9 A;  1NHR A;  4KX6 A;  3AEG A;  1OJT A;  5HHF A;  2GR3 A;  2VVM A;  4U2S A;  4YTN A;  5HYM A;  4IA6 A;  4TLX A;  3CNJ A;  3UOY A;  4K5S A;  1ZY8 A;  3IF9 A;  2YLX A;  4ZCD A;  3V76 A;  1Y56 A;  3RNM A;  1COY A;  2BAC A;  3DH9 A;  2BS2 A;  4U2T A;  4Y4N A;  3GD4 A;  1K0I A;  1DOD A;  5JCN A;  1GSN A;  1BKW A;  1DOE A;  5U25 A;  4I59 A;  2GAG B;  2QCU A;  2C70 A;  3AD7 B;  1CC6 A;  4H4W A;  1PJ5 A;  5JCM A;  4OCG A;  3FBS A;  5FS8 A;  3S5W A;  1Y0P A;  3HZL A;  1S2Y A;  4B69 A;  1CHU A;  3NK2 X;  4C5O A;  1FEC A;  1AOG A;  3ICS A;  3QFA A;  3NN6 X;  4X9N A;  2X8G A;  4Z2U A;  2GR0 A;  2RAB A;  3NIX A;  3ICR A;  4USR A;  4NTE A;  4IA5 A;  1ZK7 A;  2Q6U A;  1E1M A;  4K8D A;  3IWA A;  3JSK A;  3I6D A;  2GQW A;  1VRQ B;  1P2H A;  2VVL G;  3SZC A;  4B65 A;  4JN9 A;  2GAH B;  2B9X A;  1BGJ A;  2CDU A;  4CNK A;  5CKU A;  1DOC A;  4RG4 A;  4CBQ A;  2YG5 A;  4YTP A;  1Q1R A;  5TR3 A;  1H6V A;  3AEC A;  3CGD A;  3DME A;  3AE7 A;  3IHM A;  1LQU A;  1PJ7 A;  1PBE A;  3CGE A;  1L9E A;  3CPJ G;  4AT2 A;  2WEU A;  4O5U A;  1GRG A;  2Z5Y A;  3NYC A;  1K4Q A;  2QAE A;  4B64 A;  4YSY A;  3QFB A;  5FMH A;  1DXL A;  1BZL A;  3V3O A;  2JK6 A;  2VVL A;  1NAA A;  3GMB A;  2BRY A;  3CTY A;  2QA1 A;  2BK5 A;  4USQ A;  3GD3 A;  1OJ9 A;  3AEF A;  1D7Y A;  2OLO A;  4GAP A;  2Y6R A;  1PBC A;  2R0P A;  3AE3 A;  1CJ3 A;  3NT6 A;  1OJC A;  2E5V A;  4C74 A;  1CC4 A;  3COX A;  1KFY A;  1VDC A;  4DGK A;  1EL7 A;  3AE1 A;  4FK1 A;  1PXB A;  2XVI A;  1GES A;  3ISH A;  4CCR A;  4H2R A;  2XFU A;  4NTC A;  4B63 A;  1P2E A;  4K7Z A;  5GSN A;  4YT0 A;  3SQP A;  5GRT A;  4KPR A;  1H82 A;  5KOW A;  1N4U A;  2ARD A;  4CRT A;  5U63 A;  2E1M A;  1LV0 A;  3BNU A;  3DJE A;  2FJB A;  1NHQ A;  3LAD A;  1TDK A;  1PJ6 A;  2BYB A;  1PBD A;  4EM3 A;  4BUR A;  4OPI A;  4H4U A;  1D4E A;  2H89 A;  3EF6 A;  4N9X A;  3RP6 A;  2VQB A;  3DGZ A;  3NTD A;  2XVJ A;  3QVP A;  4H4R A;  4G73 A;  3AE2 A;  4ZN0 A;  3GDN A;  4Z2R A;  3T2Z A;  3UKQ A;  3F8R A;  4BK3 A;  4A99 A;  3AEB A;  3G5Q A;  1GET A;  1CJC A;  2DKI A;  4OPL A;  5KNL A;  1D4D A;  3NK1 X;  4I58 A;  2WPF A;  3KLJ A;  3LZW A;  5FS6 A;  4FDC B;  4K22 A;  1H86 A;  2X99 A;  2GF3 A;  4C3X A;  2WP6 A;  4H2P A;  3QSS A;  1S7M A;  1TYP A;  3AE6 A;  3H4K A;  2GRT A;  2V61 A;  4FX9 A;  4BJZ A;  3NRN A;  3QSM A;  1PBB A;  3T2Y A;  1PHH A;  2XFN A;  2OLN A;  2BC0 A;  2B7S A;  3NTA A;  1H83 A;  4BK2 A;  2B76 A;  1CF3 A;  3SZ0 A;  4MJW A;  4LII A;  3CPH G;  3FIM B;  4H2N A;  4H4Z A;  2JB3 A;  2XYO A;  2GR2 A;  1GND A;  2JAE A;  4TM3 A;  5ER0 A;  4E0V A;  1Q9I A;  2A8X A;  3DGH A;  1PXC A;  2C76 A;  4A9W A;  4YSH A;  2R9Z A;  2XDO A;  4JNA A;  5JRB A;  3K7M X;  1TYT A;  2APG A;  3DA1 A;  1GRT A;  1GTH A;  5BRT A;  3Q6J A;  3K30 A;  3P1W A;  5C3J A;  3B3R A;  1GAL A;  2A87 A;  1VG0 A;  4YSX A;  4H4Y A;  3AE9 A;  1JNZ A;  3CNS A;  1ZP0 A;  1TDF A;  3ADA B;  3P4S A;  5KMR A;  1NPX A;  4EQS A;  2EQ8 A;  1KSU A;  2WP5 A;  3UKH A;  3UKA A;  2V5Z A;  2WU5 A;  2YG3 A;  3UP5 A;  5U1O A;  1JRY A;  3M13 A;  1FCD A;  2CFY A;  5EB4 A;  3SXI A;  4ZCC A;  5HY5 A;  1JRX A;  2C3C A;  2YR6 A;  1F3P A;  3L8K A;  1IUT A;  4CNJ A;  1NEK A;  2YVG A;  2GV8 A;  2VZ2 A;  3BI5 A;  2AAQ A;  2XFQ A;  3K7Q X;  4APN A;  5KWF A;  3H8L A;  1H84 A;  4H4T A;  1NG4 A;  1CJ4 A;  1F8W A;  1NEN A;  2YR4 A;  2J3N A;  1ZMC A;  1IUW A;  1GRA A;  4PAB A;  2BK3 A;  3EAN A;  2YG7 A;  3C4N A;  4TM4 A;  1PN0 A;  3UKK A;  3QJ4 A;  1M6I A;  4EM4 A;  2WOW A;  3DJG X;  1B37 A;  4Y4M A;  2EQ7 A;  3LOV A;  4P9S A;  1L9C A;  2UZZ A;  2R46 A;  1MO9 A;  2ZZ0 A;  3DK9 A;  3GYX A;  4B68 A;  3KPK A;  3PO7 A;  1O94 A;  4AP1 A;  1B4V A;  2ZZB A;  2Z5X A;  3SZF A;  2GVC A;  3LB8 A;  3UTG A;  2HQM A;  1F8S A;  1UKV G;  1ZDL A;  4J33 A;  4TM1 A;  3L5O A;  4JQ9 A;  1L9D A;  2C73 A;  3UKF A;  4CY6 A;  3S61 A;  3CMM A;  4K5R A;  1DJN A;  3FG2 P;  4GR1 A;  3T2K A;  1GEU A;  2XVH A;  4GCM A;  4OPD A;  4U2L A;  4J56 A;  2YR5 A;  3UOV A;  2FJA A;  2WES A;  2BCG G;  5KRQ A;  1LPF A;  2XVF A;  3NKS A;  2NVK X;  1H7X A;  1E1L A;  3GSI A;  3SGL A;  2JKC A;  4H4X A;  2YM2 A;  1VG9 A;  4A7A A;  2F5Z A;  1OJA A;  3B6D A;  4OPG A;  3UKP A;  3LXD A;  3C4A A;  2OA1 A;  1KNP A;  4C3Y A;  3GWF A;  3P9U A;  5L46 A;  1S3E A;  3DK4 A;  4CCQ A;  4OPT A;  1CBO A;  4EIP A;  3P4Q A;  4U8L A;  2C65 A;  3DJD A;  4WCT A;  3SYI A;  5KMS A;  2IVE A;  3UOZ A;  5CQF A;  1REO A;  2GMJ A;  5JCK A;  4AP3 A;  3AD8 B;  4GAV A;  4JDR A;  3IHG A;  2DKH A;  4PAA A;  3CIR A;  1H7W A;  4UDR A;  3FPZ A;  1YQ3 A;  1N4W A;  1H2I A;  2X8C A;  2WET A;  2V3A A;  3AE5 A;  3H8I A;  3NK0 X;  4XWR A;  3D1C A;  3EPT A;  3C96 A;  4C77 A;  2Q0K A;  1KN0 A;  1GPE A;  1JEH A;  1TDO A;  1X31 B;  4H50 A;  2O9Z A;  4Y4L A;  2TPR A;  2V60 A;  2WDR A;  4BV6 A;  1CL0 A;  4G6H A;  1O95 A;  2XLT A;  1H81 A;  2JB1 A;  1TDN A;  2GEW A;  3R9U A;  1GRE A;  5JCL A;  1ZOV A;  2E4G A;  3NGC X;  4B1B A;  2R0C A;  3Q9T A;  1XPQ A;  1MOK A;  2RGO A;  3RP8 A;  4DSH A;  4AT0 A;  1GRF A;  2YLW A;  4JY2 A;  3LJP A;  1PS9 A;  1NDA A;  1Y56 B;  2C66 A;  1V59 A;  2YWL A;  3DJJ A;  2CUL A;  2GB0 A;  2GR1 A;  2TMD A;  2YG6 A;  4Z43 A;  1BWC A;  4EQR A;  1CC2 A;  1IUS A;  2YM1 A;  2XLP A;  2H88 A;  4GF7 A;  2A89 A;  5BUL A;  4EMJ A;  3O0H A;  3M0O A;  4ECH A;  2YAU A;  4J2W A;  4H4Q A;  1FOH A;  1KNR A;  2BA9 A;  3CGC A;  1Z6L A;  1N1P A;  2JB2 A;  5BVA A;  3KD9 A;  1RSG A;  2BS3 A;  1ZX9 A;  2YG4 A;  4U8I A;  3CNP A;  4U8O A;  4JNQ A;  2Q0L A;  4X9M A;  3FMW A;  4XWZ A;  4IVM B;  2WDV A;  3BHK A;  1JOA A;  2ZBW A;  4GDP A;  2GH5 A;  3SFE A;  2VQ7 A;  3SZW A;  2VRM A;  3EAO A;  1FEB A;  3WE0 A;  2BXR A;  3AEE A;  3UP4 A;  2R4J A;  4H4P A;  3VR9 A;  5DBJ A;  2WQY A;  2WOI A;  1GOS A;  2FBW A;  4U8N A;  3VRB A;  1FEA A;  2OAL A;  5EBK A;  2WOV A;  4H7U A;  3I3L A;  1GRB A;  5KVH A;  1TDE A;  5FS7 A;  5JCI A;  3NH3 X;  4LU6 A;  3ATQ A;  3RED A;  2BC1 A;  4AOS A;  2C3D A;  2Q7V A;  2CVJ A;  2XFP A;  5KVI A;  1D5T A;  1IUU A;  1LVL A;  2B7R A;  3AE4 A;  3KKJ A;  5FS9 A;  4IV9 A;  2V6O A;  1XDI A;  1OJD A;  4A6N B;  4BK1 A;  4JY3 A;  5LV9 A;  2R0G A;  1E6E A;  3BHF A;  3T37 A;  3AD9 B;  1E7P A;  1KDG A;  2BAB A;  1JNR A;  4CY8 A;  2AR8 A;  1N4V A;  3UTH A;  5KMQ A;  4J57 A;  4X4J A;  4Z44 A;  2BCP A;  2PHH A;  1IUV A;  4K2X A;  3RP7 A;  2B9W A;  4GUV A;  4EIQ A;  5KXJ A;  3SM8 A;  2B9Y A;  3D9X A;  1EL8 A;  3DK8 A;  3HYW A;  2YLZ A;  2WBA A;  1KSS A;  2C4C A;  2BS4 A;  2EQ9 A;  2C64 A;  5EB5 A;  1PXA A;  1XAN A;  1B5Q A;  2R45 A;  2YLS A;  4HA6 A;  2EQ6 A;  2X8H A;  4O5Q A;  3GDP A;  3GMC A;  2WU2 A;  1DOB A;  3NLC A;  3GYI A;  2IID A;  2YLT A;  1D4C A;  2X3N A;  4EMI A;  2AQJ A;  3ABV A;  4UDP A;  1VQW A;  4J36 A;  1EL5 A;  4ADW A;  2XFO A;  4U8K A;  2WPC A;  2WP9 A;  4LA1 A;  2PYX A;  2W0H A;  4BJY A;  4NNJ A;  2V3B A;  2BRA A;  4DSG A;  4UP3 A;  3CNT A;  2C67 A;  4EMW A;  1L0V A;  2YVJ A;  2I0Z A;  4H4V A;  4G74 A;  3URH A;  2ACZ A;  3CN8 A;  4OPU A;  5C2T A;  2X50 A;  1O5W A;  3AEA A;  3UTE A;  1RYI A;  4A6N A;  5KOX A;  4OVI A;  3D8X A;  2IVD A;  3SY4 A;  1RP0 A;  4AOX A;  3PG6 A;  3CGB A;  3PS9 A;  5IQ1 A;  4RG3 A;  1SEZ A;  3ATR A;  2BXS A;  3UTF A;  1GER A;  1BGN A;  4NZH A;  4YXD A;  3KPF A;  1YQZ A;  5M10 A;  4B67 A;  4NEV A;  3HYX A;  1W4X A;  2XVE A;  3KVE A;  4TLZ A;  3QSE A;  3BNM A;  5J7X A;  4II2 A;  4Z26 A;  1KF6 A;  3G5S A;  1YY5 A;  3OZ2 A;  1GXF A;  3II4 A;  1JRZ A;  3ZDN A;  4YTM A;  4M52 A;  1DNC A;  4G9K A;  5M0Z A;  1LTX R;  1ZOY A;  3AYJ A;  1YKJ A;  3SFD A;  4G6G A;  3AED A;  4NWZ A;  5J60 A;  1IUX A;  1E1K A;  3BI4 A;  3LZX A;  1K0J A;  5IPY A;  2WS3 A;  3AB1 A;  1MXT A;  1ZMD A;  1DJQ A;  1GT8 A;  1M64 A;  2ZZC A;  3NN0 X;  4A5L A;  1NHS A;  3M12 A;  2WDQ A;  3VQR A;  1ELI A;  2C72 A;  3ZYX A;  4NTD A;  4FK1 C;  3KU9 A;  3L1R A;  1ONF A;  5HXI A;  2BK4 A;  3E1T A;  3NNE A;  4EQW A;  1K0L A;  4REK A;  5EOW A;  3SX6 A;  3CND A;  3CPI G;  2FJD A;  4WX1 A;  1F6M A;  1QLB A;  1E39 A;  3PVC A;  2XLS A;  2XLR A;  3T0K A;  4D03 A;  4TM0 A;  3VRD B;  1Q1W A;  1EBD A;  3AWI A;  3K7T A;  5BUK A;  4U8P A;  2NPX A;  1NG3 A;  2RGH A;  1E1N A;  3VRA A;  3OC4 A;  3NYF A;  1JU2 A;  4YWO A;  4J34 A;  2OAM A;  4IVO B;  1XHC A;  1CJ2 A;  1EL9 A;  1PBF A;  1GV4 A;  1QJD A;  3AYI A;  3ITJ A;  3VR8 A;  3KA7 A;  3RHA A;  1D7L A;  1ZKQ A;  1LQT A;  3T31 A;  2YLR A;  3UCL A;  4U8M A;  3NYE A;  3AXB A;  1TRB A;  1YQ4 A;  2FJE A;  4B66 A;  4DNA A;  1LJ1 A;  4XXG A;  2XCG A;  3AYL A;  4A65 A;  2XLU A;  1BF3 A;  2VRL A;  3BI2 A;  4YKF A;  2YVF A;  4YKG A;  3GRT A;  1PDH A;  1FL2 A;  1QO8 A;  3P4P A;  2Y6Q A;  3HYV A;  2C7G A;  4H2Q A;  3UOX A;  3NHO X;  3T14 A;  1S3B A;  2QA2 A;  2RGJ A;  3ICT A;  4HB9 A;  1IJH A;  4NEW A;  4UDQ A;  5KMP A;  3V3N A;  2WPE A;  3ALM A;  4A79 A;  4II3 A;  4OPC A;  3GYJ A;  3ALL A;  2GQF A;  1GRH A;  4GDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...