4BV6A

Refined crystal structure of the human apoptosis inducing factor
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
Knots found
sequence length
484
structure length
471
Chain Sequence
b'KAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Structural Insights Into the Coenzyme Mediated Monomer-Dimer Transition of the Pro-Apoptotic Apoptosis Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 147
structure length 471
sequence length 484
other databases KnotProt 2.0: S -31
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4bv6A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4bv6A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4bv6A01
3VR9A 4ICYA 1LTXR 1NDAA 3DMEA 1CF3A 1JRYA 2GR3A 4GDEA 1PBEA 2XLSA 3ALMA 3NTAA 3UKAA 2YG5A 5BRTA 2BACA 1QO8A 1GRTA 3GSIA 3ALLA 1F8RA 4H4VA 4H7UA 3I6DA 4B63A 2WP6A 4EM3A 2WOWA 3GD4A 3AE1A 1DXLA 3AD8B 4FK1A 3G5SA 1VG9A 1ZOVA 4NTEA 1JRZA 3NN6X 2C73A 3UTGA 3QFBA 4A7AA 3RNMA 1NHQA 2AR8A 2B76A 1KSUA 5IQ4A 5GSNA 5IPYA 1K0IA 1CBOA 1PDHA 1IJHA 2XLRA 4H4PA 4AOXA 1V59A 2FBWA 3AE3A 5J7XA 3UOVA 4FDCB 5EBKA 2YM1A 3FPZA 3S5WA 2IVDA 3AYJA 1Y56B 1GT8A 2WS3A 4WX1A 4A79A 1DOEA 2W0HA 2XLUA 1YQ3A 3UTHA 4DGKA 3BI4A 1IUSA 3AEDA 4D04A 3UKFA 3CPIG 3UKPA 3AEEA 2A89A 1D4DA 1TYTA 1FCDA 3BHKA 2XVEA 3C4NA 3CNDA 3K7QX 2Z5XA 3AYIA 3KD9A 2QAEA 2VQ7A 1YY5A 3CN8A 4H4TA 3G5RA 4K2XA 4U8OA 4ZCCA 4YT0A 4EM4A 3DH9A 1TDNA 4U8JA 3ABVA 5CQFA 5M0ZA 4XXGA 4IVOB 2FJEA 3UOYA 3DJDA 2CVJA 2OALA 3RP7A 3UKKA 3ZDNA 5KVHA 4J2WA 3ATQA 4P9SA 4C77A 4PABA 1PBDA 1OJTA 4U8NA 5HHFA 2JK6A 4ECHA 1F3PA 4APNA 1O95A 4TM1A 4H4UA 2VQBA 3WE0A 5KOXA 5BVAA 1XDIA 3II4A 2YVGA 1CL0A 3AE4A 3LOVA 4H2QA 1N4VA 4UP3A 4AP3A 1ZKQA 2FJAA 1NENA 2FJBA 2JB1A 3K30A 2FJDA 3NNEA 5KRQA 2WU5A 1DNCA 1K0JA 1Y0PA 1GALA 2BS4A 2XFNA 3GRSA 2C67A 3RHAA 4CCQA 1B5QA 1NHPA 5BUKA 3LADA 1EBDA 1Q1RA 4IA5A 4CBQA 2OA1A 2Q0KA 4TLXA 4Y4NA 2C75A 2JBVA 4OPDA 3ICSA 4OPLA 4Z24A 4Z26A 3GMCA 3P4QA 1LPFA 1MO9A 2GVCA 2R0PA 2UZZA 3KVEA 2JKCA 1BKWA 4IVMB 3LZXA 1KF6A 4U2TA 4A9WA 2YQUA 3UCLA 2YM2A 3AXBA 4EQXA 1ELIA 1O94A 2O9ZA 1LQTA 3AD9B 3AEBA 2H89A 4U8LA 3KKJA 4YTPA 2WDQA 3P4SA 4B67A 4TM4A 3PS9A 3UKLA 4K7ZA 4J56A 5HY5A 3K7TA 1GERA 1GTHA 4AP1A 4RSLA 4YTNA 2XVHA 3AEGA 3D8XA 3C96A 4ZCDA 3ADAB 1TYPA 4GCMA 4PAAA 4UDRA 2E5VA 1FL2A 4YWOA 4CY8A 3CTYA 2X8HA 3Q6JA 3QSEA 4JY3A 4JQ9A 1VQWA 2WHDA 2Y6RA 3ISHA 4Y4LA 4J57A 1BF3A 2XLPA 2IIDA 2R4JA 3B6DA 1GRFA 2WBAA 3EANA 2VRMA 3NH3X 4BJYA 1D7YA 1GXFA 3KU9A 3NG7X 4I58A 1PXCA 1BGNA 1XANA 4H2NA 4X4JA 4Y4MA 2E1MA 3IF9A 5EOWA 2E4GA 4RG4A 3SFEA 1L0VA 1S2YA 5KVIA 3FIMB 3D1CA 4KX6A 2C65A 3VRBA 4B65A 2X8CA 3FMWA 2BCPA 2C3CA 3ITJA 1EL8A 2WQYA 4NEWA 3NHOX 3P4RA 1NHRA 4HA6A 3VRAA 4BK2A 1F8WA 4OPGA 3NGCX 2YAUA 1KNRA 3P4PA 2OLOA 2YG3A 3B3RA 3G5QA 2GRTA 1PJ5A 2ACZA 2YR5A 4U8IA 2B9WA 3CGBA 1LVLA 1F6MA 2VOUA 4YSZA 3M0OA 3DK9A 2BABA 5KOWA 2EQ9A 1YQ4A 5FMHA 3H8IA 4D03A 1REOA 4OPIA 3SFDA 1S3BA 4EIQA 3CGCA 3V3OA 5FS9A 1PJ6A 1DOCA 1PJ7A 3NK2X 2X8GA 1S2QA 2V60A 2YR4A 3SQPA 2XFUA 3SM8A 3EAOA 4X9MA 1EL9A 2WESA 4A5LA 1IUXA 1NHSA 3VRDB 4BK1A 4BK3A 5U1OA 1RYIA 1SEZA 4TM0A 4H4ZA 2XCGA 3AD7B 4TLZA 3SGLA 3GWFA 2C3DA 4H50A 1FEBA 3NT6A 3PVCA 3GYJA 1H82A 4NZHA 4DNAA 1BZLA 5JCLA 2TPRA 1H83A 3QSSA 3NYCA 4OPUA 4YSYA 4K22A 4IV9A 1NEKA 4C3XA 2J3NA 1N4WA 3COXA 2GR2A 2GAGB 2BS3A 2NVKX 4U8KA 3V3NA 2DKIA 1E1NA 1CC4A 1K4QA 5FS8A 4KPRA 3LJPA 4OPTA 4B1BA 2Q0LA 1OJ9A 2BYBA 1N1PA 2Z5YA 4USQA 1JEHA 1M6IA 4GRTA 2RGOA 3DJEA 4NTDA 3AECA 1E1LA 4Z25A 4YXDA 4O5QA 1GREA 1W4XA 3DK4A 1AOGA 1X31B 2C72A 2C76A 2Q6UA 1D5TA 2YLSA 3AWIA 1GESA 4USRA 5M10A 3CNPA 2GV8A 1VRQB 4J31A 4EMJA 1E7PA 3NYFA 1S3EA 2C66A 2B9XA 3IC9A 2BA9A 3CIRA 4LA1A 3CNJA 2PHHA 2JAEA 1XHCA 4RG3A 4LU6A 4DSGA 2WDVA 5TR3A 1IUWA 1ZMCA 4H4QA 1D4CA 4I59A 1IUVA 4NTCA 5J60A 3M12A 2YR6A 1NPXA 2GH5A 5KWFA 3DK8A 2VVLG 1PHHA 1MOKA 1GTEA 1MXTA 5BULA 2XDOA 1Z6LA 1CJ2A 5FS6A 3CPJG 3GD3A 1DJQA 1N4UA 1FOHA 5U25A 1H84A 4GR1A 1GEUA 3I3LA 2C70A 3AE8A 3GRTA 2RGJA 4H2RA 1PS9A 3QJ4A 3NN0X 3ICRA 3NLCA 1JU2A 3CGEA 1GPEA 3DJJA 5ER0A 4EQRA 2V3AA 3UKQA 1B4VA 1ONFA 1B37A 3UP4A 1ZDLA 1TDFA 4BV6A 1O5WA 1VDCA 1KSSA 4H2PA 3AE2A 4OVIA 1GETA 2WPEA 3DGZA 5CKUA 2YG4A 2EQ8A 1CJ4A 3KA7A 3L8KA 1DOBA 2CULA 3KPFA 4HB9A 1NG4A 4MJWA 2OLNA 1K0LA 3DGHA 1JRXA 4J33A 4AT0A 1LQUA 3CNTA 2I0ZA 1YKJA 5C2TA 3NTDA 4JNQA 2R0GA 3AEAA 1ZK7A 2GMJA 3GDPA 2WP5A 1PBFA 3RP8A 1ZOYA 2YLTA 2BS2A 4K5RA 2F5ZA 2NPXA 1XPQA 4LIIA 3AB1A 2ZZBA 2ZBWA 3RP6A 2PYXA 1CC2A 1D7LA 3ALJA 4B64A 3REDA 1F8SA 1RSGA 5HYMA 3NK0X 3QVRA 4K8DA 1JOAA 2WU2A 3QFAA 1IUUA 2JB3A 4UDPA 1FECA 2X3NA 3NRNA 4H4YA 5IQ1A 4XWZA 1NAAA 2Q7VA 2QCUA 5JCNA 1D4EA 3AE5A 1PN0A 3JSKA 4YKGA 3DJGX 2WP9A 1GRHA 1E6EA 2H88A 2V6OA 1EL5A 4H4XA 1GSNA 2A8XA 4GF7A 4XWRA 2YLWA 2EQ6A 2AQJA 3EPTA 1GNDA 3NKSA 1KNPA 3UP5A 2BCGG 3M13A 4M52A 2WETA 2XVJA 3CGDA 1ZMDA 3KLJA 1TDKA 1VG0A 4E0VA 4EMWA 2XLTA 2AAQA 1OJDA 3PO7A 2VRLA 2YG6A 4YKFA 2GQWA 2XVIA 2VVMA 2ZZ0A 1GRGA 4EQWA 4AOSA 2ARDA 3GYIA 3R9UA 2GMHA 2WPCA 2YLZA 2XFQA 1TDEA 3AYLA 3IWAA 2QA2A 1ZX9A 1E39A 2XFPA 3UOZA 3F8DA 2CFYA 4EQSA 4C74A 5KXJA 5EB4A 5GRTA 2GQFA 4X9NA 4ADWA 3AE6A 2XYOA 2YLXA 4AT2A 2BK3A 4OPCA 3GWDA 1FEAA 1DODA 1BWCA 3BNMA 3HZLA 4N9XA 2BK4A 3L1RA 2V3BA 1LV0A 5L46A 2BC0A 3LB8A 2QA1A 2B7RA 2XVFA 4CRTA 1B8SA 2ZZCA 1KDGA 4YSHA 1IUTA 3BI2A 3OZ2A 4JN9A 4JNAA 5EB5A 3NK1X 3UTFA 2X99A 5JCKA 4B66A 4C3YA 3F8RA 3E1TA 4IA6A 1P2HA 4CY6A 2IVEA 3P9UA 4J34A 3LZWA 3Q9TA 4U8MA 4A99A 3AE7A 4H4RA 3H4KA 2CDUA 4UDQA 1QJDA 1NG3A 4U2LA 2GAHB 5U63A 3DA1A 2GR0A 1GOSA 2HQMA 4EMIA 4J36A 2R4EA 4TM3A 1JNRA 4FK1C 2BK5A 2V5ZA 4NEVA 4GDPA 4K5SA 3GDNA 4Z2UA 1RP0A 5DBJA 2GR1A 4O5UA 2C7GA 1JNZA 2GF3A 3H8LA 4U8PA 1TRBA 4A6NA 2EQ7A 3EF6A 5C3JA 1HYUA 5JCIA 1CJ3A 2A87A 2B9YA 2WOIA 2XFOA 1H7WA 1UKVG 1E1MA 1L9DA 4CNJA 1YQZA 2APGA 3NYEA 1EL7A 2DKHA 3VQRA 1E1KA 4JDRA 3K7MX 2YWLA 2C64A 1CC6A 2BXSA 1QLBA 1L9EA 1PBBA 3QSMA 2WOVA 3VR8A 3BI5A 1TDOA 1KFYA 1P2EA 1M64A 4YTMA 4YSXA 1OJAA 4WCTA 2YVFA 3UOXA 4B69A 4B68A 3S61A 4FX9A 1H6VA 2VVLA 3OC4A 4REKA 3UTEA 5FS7A 1CJCA 5LV9A 2JB2A 1H86A 2TMDA 4BJZA 5JCMA 2GB0A 3IHGA 1OJCA 2YVJA 1PXAA 3C4AA 4BURA 4A65A 2V61A 1Y56A 2WDRA 3CPHG 4H4WA 3NIXA 3QVPA 1H81A 1COYA 2GEWA 4Z2RA 4CCRA 3ICTA 1ZP0A 2X50A 1GV4A 2R46A 4C5OA 2RGHA 2R9ZA 3IHMA 1LJ1A 4Z2TA 3FG2P 3UKHA 2BC1A 3P1WA 4OCGA 2Y6QA 3AE9A 3T37A 2WEUA 1PXBA 3LXDA 3AEFA 1PBCA 4U2SA 4DSHA 3ATRA 2WPFA 2YLRA 4CNKA 4Z43A 1GRBA 2R45A 3CNSA 2YG7A 4EIPA 4H4SA 3BHFA 2BXRA 2OAMA 4Z44A 3V76A 1H7XA 3FBSA 4JY2A 4ZN0A 5HXIA 2B7SA 2R0CA 3ZYXA 2VZ2A 3GMBA 4GUVA 2RABA 1Q9IA 3F8PA 1DJNA 3O0HA 1CHUA 1Q1WA 3BNUA 4A6NB 3URHA 1BGJA 1ZY8A 1GRAA 1L9CA
chains in the Genus database with same CATH superfamily
3VR9A 3D9XA 3QLDA 1MNSA 2GR3A 4GDEA 3MWCA 3N4EA 3ALMA 3V4BA 2YG5A 1N63C 1GRTA 2OX4A 3OZMA 2WOWA 1VG9A 3NN6X 4A7AA 2FKPA 3THUA 5IQ4A 1PDHA 4AOXA 2FBWA 3AE3A 5J7XA 3AYJA 2QDDA 2XLUA 4DGKA 1IUSA 3AEDA 4D04A 3C4NA 2Z5XA 3KD9A 2VQ7A 4U8OA 3CN8A 4YT0A 4H4TA 4EM4A 3DH9A 1TDNA 5M0ZA 4IVOB 3DJDA 2OALA 1FFVC 4J2WA 3HYVA 4PABA 1OJTA 4ECHA 4APNA 1O95A 4H4UA 1XDIA 3LOVA 1ZKQA 3T2ZA 2WU5A 3VA8A 1X2GA 1GALA 2C67A 3RHAA 1B5QA 1NHPA 1JPMA 5IDZA 3VCNA 4MKSA 4CBQA 4TLXA 4OPDA 4OPLA 4Z24A 1MO9A 3KVEA 4IVMB 3LZXA 3NS1B 4A9WA 3FYYA 3AXBA 1O94A 2O9ZA 1LQTA 2AKMA 2WDQA 4YTPA 2OKTA 4J56A 3AMZA 1EC9A 3K7TA 1XPYA 1GTHA 3SZCA 4PAAA 4UDRA 3SN0A 1F9CA 2Y6RA 4GYPA 2VRMA 4BJYA 3KU9A 4I58A 1BGNA 1XANA 4IHCA 3I6TA 3D1CA 4B65A 2HZGA 4OPGA 3TQPA 3G5QA 3B3RA 2GRTA 1PJ5A 2B9WA 2C4CA 2VOUA 2QDEA 4JN8A 3DEQA 2OVLA 3S5SA 1YQ4A 1JCTA 1S3BA 5FS9A 1PJ6A 1PJ7A 1S2QA 2YR4A 2XFUA 1IUXA 5U1OA 1RYIA 1SEZA 4TM0A 4TLZA 1FEBA 3GYJA 4YSYA 1H83A 4K22A 4GAPA 1SJBA 2BS3A 4U8KA 1MDRA 1K4QA 5BOEA 2Q0LA 1OJ9A 1N1PA 2Z5YA 4YXDA 1W4XA 3DK4A 2Q6UA 1D5TA 4USRA 1E7PA 4A3RA 2C66A 4E8GA 4LA1A 2PA6A 2JAEA 4RG3A 1ZMCA 2OZTA 2GL5A 4KEMA 5J60A 4H19A 1Z6LA 1CJ2A 5FS6A 3CPJG 1N4UA 1FOHA 5U25A 4GR1A 1GEUA 1PS9A 3QJ4A 2GGGA 3VCCA 1JU2A 3CGEA 1B4VA 1O5WA 1EBGA 3FXGA 2EQ8A 3KPFA 4HB9A 1DOBA 1NG4A 4MJWA 1JRXA 3CNTA 3OTRA 1PBFA 3DGBA 4K5RA 2NPXA 1CC2A 1D7LA 4B64A 3T31A 4H1ZA 2PGEA 1JOAA 5KMPA 2JB3A 4UDPA 4DWDA 1NAAA 5JCNA 2MUCA 1PN0A 3JSKA 4YKGA 1SJAA 2WP9A 3ZLFA 2V6OA 2GGHA 4H4XA 2XH0A 4GF7A 1KKOA 1GNDA 3NO1A 3T6CA 2BCGG 2WETA 4II2A 3KLJA 4EMWA 3DG7A 2XVIA 2ZZ0A 1GRGA 4EQWA 3GYXA 3R9UA 4FI4A 5GRTA 4E4UA 3R1ZA 4OPCA 3TCSA 3HZLA 4TVWA 3L1RA 3IJIA 4IP4A 2BC0A 3LB8A 1SJCA 2ZZCA 1KDGA 1IUTA 3OZ2A 1JPDX 4JNAA 5EB5A 3AM9A 3TW9A 3HYXA 5JCKA 4C3YA 3LZWA 1S7MA 1NG3A 3SQSA 4KWSA 3T2YA 1EBHA 4MGGA 3L5OA 2HQMA 4EMIA 2DW7A 4TM3A 2BK5A 5DBJA 4O5UA 3H8LA 1TRBA 4M6UA 2P88A 1HYUA 5JCIA 1T3QC 3SZFA 3R0KA 2XFOA 3QPEA 1E1MA 3EUB3 1EL7A 1E1KA 6ENLA 1SB3B 1QLBA 1L9EA 4Z1YA 1PBBA 3QSMA 3VR8A 4YSXA 5KMSA 4WCTA 4B69A 1H6VA 2VVLA 3RCYA 5JCMA 3H7VA 3CPHG 1W6TA 3ICTA 4E4FA 3IHMA 1LJ1A 3P1WA 3N6HA 1PXBA 4U2SA 4DSHA 2WPFA 2YLRA 4CNKA 2R45A 4EIPA 3BHFA 2BXRA 4Z44A 3SN4A 5HXIA 3ZYXA 2VZ2A 1Q1WA 5FJUA 3URHA 1GRAA 4JN7A 3SR6B 3DMEA 1CF3A 3RR1A 5BRTA 4H4VA 4B63A 2WP6A 4EM3A 5J04A 3AE1A 1DXLA 3AD8B 4NTEA 2C73A 1NHQA 2AR8A 4X2PA 1K0IA 4H4PA 3UOVA 2YM1A 4KT2A 4WX1A 1DOEA 3DIPA 3UTHA 2A89A 2I5QA 1TZZA 4ZA0A 2XVEA 3MUCA 5G5GB 4K2XA 3RITA 4GFIA 4E5TA 4U8JA 4XXGA 2FJEA 3NVZB 3T2KA 2AKZA 2XH2A 4U8NA 2PP0A 2HXTA 2VQBA 3DG3A 3AE4A 3V3WA 4AP3A 2FJAA 3K30A 3HRDC 2RDXA 3UJSA 4DHGA 1EBDA 1DTNA 3T8QA 3ICSA 4Z26A 2GVCA 2JKCA 1BKWA 2ONEA 3P4SA 4B67A 1MRAA 3PS9A 4ENLA 2PODA 3GO2A 3N6JA 4YTNA 1TYPA 3T0KA 4JHMA 4YWOA 4CY8A 2X8HA 1X2HA 4JY3A 4JQ9A 2WHDA 1BF3A 2IIDA 3EANA 4H2NA 5EOWA 3SFEA 1L0VA 1S2YA 3HPFA 3FIMB 3VRBA 4G6GA 2BCPA 3ITJA 3VRAA 3P4RA 3MSYA 3DFYA 3V5CA 4BK2A 1F8WA 3NGCX 3P4PA 2YG3A 2ACZA 1STZA 3ZVHA 1F6MA 3M0OA 1JRPA 2BABA 2PSNA 3H8IA 2V60A 4X9MA 1EL9A 2WESA 2XCGA 4H50A 3SZWA 3NT6A 4K8GA 3I4KA 1BZLA 4DNAA 2TPRA 3GD6A 3SBFA 4IV9A 1NEKA 1N4WA 3COXA 4NNJA 4J1OA 2NVKX 3V3NA 5FS8A 1N60C 2W55A 1JEHA 1M6IA 2QJMA 3AECA 1E1LA 4HN8A 4MMWA 3AWIA 5M10A 4J31A 3BOXA 1IYXA 1S3EA 1MUCA 2BA9A 3CIRA 3DG6A 2ZADA 1WUFA 2OO6A 5G5HB 4NTCA 1NPXA 1GTEA 1MXTA 3NRZB 2XDOA 3ZVHB 3CXOA 4H2RA 1H2IA 3NLCA 1GPEA 3DJJA 5ER0A 2V3AA 1TDFA 1VDCA 4OVIA 2WPEA 2YG4A 3KA7A 3L8KA 4GIRA 3DGHA 4J33A 1NELA 1YKJA 5C2TA 1BKHA 1SJDA 3DDMA 1ZK7A 2PTWA 2QJNA 2BS2A 4FP1A 3IK4A 3AB1A 2ZZBA 3ALJA 3ZVIA 3FCPA 3QVRA 4K8DA 1IUUA 4H4YA 5EU9A 2DW6A 1E6EA 2A8XA 3ENLA 1FO4A 4XWRA 3EPTA 3NKSA 3M13A 2XVJA 4E0VA 1R0MA 2ZC8A 3PO7A 2VRLA 2GQWA 3GYIA 1TDEA 3SZ0A 2QA2A 1KKRA 5EB4A 3B9JB 2V3BA 1LV0A 2XVFA 3PWIA 2X99A 4B66A 3E1TA 4CY6A 2IVEA 4U8MA 3P3BA 3OZYA 1FHUA 4J36A 4K5SA 3DERA 4NEVA 4IZGA 1RP0A 2GR1A 3A7AA 2EQ7A 3EF6A 1CJ3A 2BRAA 4DYEA 1H7WA 4GISA 3VQRA 3BSMA 3IJLA 4JDRA 3K7MX 3UCDA 2YWLA 2BXSA 2PCEA 1TDOA 4Z17A 1OJAA 2FYMA 4B68A 3UGVA 4DN1A 3OC4A 3JW7A 1CJCA 2JB2A 1H86A 2TMDA 1OJCA 4BURA 1Y56A 3MZNA 3QVPA 1H81A 2GEWA 4CCRA 2X50A 1GV4A 3MKCA 3R07C 2AL2A 5FJPA 4Z2TA 3FG2P 1TE6A 3T37A 3LXDA 3T9PA 2OPJA 5FJRA 4Z43A 5JRBA 3CNSA 2OAMA 2PU1A 4G8TA 1H7XA 1FFUC 4JY2A 2B7SA 4GUVA 3U4FA 4ZCWA 4DX3A 1DJNA 3BNUA 1BGJA 1ZY8A 2GGJA 1L9CA 2HNEA 1FIQB 3Q4DA 4ICYA 1JRYA 1PBEA 3GSIA 3ALLA 1F8RA 4H7UA 3I6DA 4FK1A 3G5SA 4ZOHB 1ZOVA 1JRZA 3UTGA 3QFBA 3RNMA 3R25A 2B76A 1CBOA 2XLRA 1IJHA 4TVYA 1V59A 4G6HA 2OQYA 4FDCB 5EBKA 3S5WA 1Y56B 3OPSA 2WS3A 2W0HA 1P48A 3CPIG 3AEEA 1D4DA 2AL2B 3BHKA 1KD0A 1WUEA 1YY5A 4ZCCA 3G5RA 3ABVA 5CQFA 4M0XA 2O56A 3ZLGA 3RP7A 3IJQA 3UKKA 3ZDNA 2GGIA 3ATQA 4P9SA 4C77A 1F3PA 4K1WA 4TM1A 5KOXA 5BVAA 3II4A 1ELSA 1CL0A 2OZ3A 2FJBA 2JB1A 2BS4A 2XFNA 5BUKA 3LADA 4IA5A 2OA1A 2C75A 2JBVA 3VFCA 3AN1A 3GMCA 1LPFA 2R0PA 1KF6A 4U2TA 3UJ2A 2YQUA 3N4FA 2YM2A 4EQXA 4GGHA 3AEBA 3AD9B 4U8LA 1GERA 1EC7A 3KUMA 4RSLA 1V97A 3JVAA 3C96A 4ZCDA 3ADAB 3CTYA 2PMQA 3UXLA 2WBAA 7ENLA 1GXFA 3NG7X 1PXCA 4Y4MA 2E1MA 3IF9A 4RG4A 3NVWB 5KVIA 2X8CA 3FMWA 2XGZA 2C3CA 3MY9A 4NEWA 3PK7A 3NHOX 1NHRA 3D47A 1KNRA 3CGBA 4YSZA 3DK9A 5FMHA 4GAVA 1ECQA 3GC2A 3SFDA 3CGCA 3V3OA 1DOCA 3NK2X 2X8GA 3U9IA 3TWBA 3EAOA 4DXKA 3TWAA 2C3DA 1H82A 5JCLA 3QSSA 2J3NA 3OW1A 2GR2A 3EKGA 2DKIA 1E1NA 2P0IA 4KPRA 4B1BA 2BYBA 1NU5A 4XWZA 4GRTA 2GSHA 3DJEA 4Z25A 4O5QA 1GREA 1GESA 2GV8A 3RGTA 1VRQB 3CNJA 1N5XA 2PHHA 4DSGA 5TR3A 1N61C 1D4CA 4I59A 4H4QA 2W54A 1IUVA 2POZA 2YR6A 2GH5A 5KWFA 3DK8A 2PP1A 1DJQA 4EWJA 3I3LA 3STPA 3AE8A 3ICRA 2PTYA 1B37A 3UP4A 4BV6A 1KSSA 3AE2A 1GETA 3DGZA 5CKUA 2OLNA 2P8CA 4AT0A 3NTDA 2R0GA 2GMJA 2F5ZA 3SSZA 1XPQA 4LIIA 2ZBWA 1TKKA 1OEPA 3REDA 1F8SA 3TJIA 4IT1A 3PG6A 3NK0X 4J3ZA 2X3NA 4A35A 5IQ1A 2Q7VA 3UXKA 1D4EA 3AE5A 3S47A 3DJGX 1EL5A 2MNRA 3ES7A 1GSNA 2YLWA 2AQJA 4M52A 3CGDA 1ZMDA 5KMRA 2XH7A 2XLTA 2AAQA 2YG6A 4YKFA 2VVMA 2ARDA 3I6EA 2GMHA 2YLZA 2XFQA 3AYLA 1ZX9A 1KN0A 3VC6A 3FJ4A 1E39A 2XFPA 2CFYA 4EQSA 4C74A 5KXJA 3QTPA 4ADWA 3AE6A 1R6WA 2YLXA 2BK3A 1P43A 3KPKA 3BNMA 3R10A 5L46A 2XSXA 1XS2A 2QA1A 1B8SA 3BI2A 4JN9A 2BRYA 4HYRA 3NK1X 3F8RA 3NXLA 4IA6A 3P9UA 4J34A 4HNCA 3AE7A 3H4KA 2CDUA 4UDQA 2GAHB 3DA1A 2GR0A 3ZLHA 1GOSA 1RVKA 2V5ZA 5ENLA 2C7GA 1JNZA 4U8PA 4A6NA 5C3JA 3UJFA 2A87A 2B9YA 2P8BA 2WOIA 3HYWA 1FHVA 1UKVG 4CNJA 1YQZA 2APGA 3BI5A 4YTMA 3T4WA 3UOXA 4YWSA 5LV9A 5FS7A 1PDZA 4BJZA 2GB0A 3ES8A 2YVJA 3C4AA 2V61A 2WDRA 4H4WA 1COYA 1ZP0A 2R46A 4C5OA 2R9ZA 3PWGA 3UKHA 2BC1A 4IL0A 2Y6QA 3QKEA 3AE9A 2WEUA 4KPLA 2QVHA 4GGBA 2W3RA 2YG7A 4ZN0A 3V76A 5FJTA 3SX6A 2GDQA 2R0CA 3GMBA 2RABA 1Q9IA 3O0HA 1CHUA 4II3A 2QQ6A 4A6NB 2P3ZA 4HPNA 1LTXR 1NDAA 2XLSA 3NTAA 3UKAA 3H8AA 2BACA 1QO8A 3CB3A 3GD4A 1KCZA 1KSUA 5GSNA 5IPYA 3Q45A 1PDYA 3SN1A 1ZXIC 3FPZA 2IVDA 1GT8A 4A79A 1N5WC 1YQ3A 3BI4A 3UKFA 3UKPA 2QJJA 1TYTA 4HNLA 5FJOA 1FCDA 3CNDA 3K7QX 3AYIA 2QAEA 2OLAA 3VC5A 3R11A 3RRAA 3UOYA 2CVJA 3VDGA 2OFJA 5KVHA 1PBDA 5HHFA 2JK6A 3WE0A 2YVGA 4H2QA 1N4VA 4UP3A 1NENA 2FJDA 3NNEA 5KRQA 1DNCA 1K0JA 1Y0PA 1ONEA 2PGWA 3GRSA 4IL2A 4CCQA 1JDFA 1E9IA 1Q1RA 3A7RA 4G74A 2Q0KA 4Y4NA 1N62C 2PU0A 3P4QA 2UZZA 3NZGA 3H12A 3UCLA 1ELIA 2H89A 3KKJA 4TM4A 3UKLA 3SY4A 4K7ZA 5HY5A 4AP1A 2XVHA 3AEGA 3D8XA 3JZUA 4GCMA 2E5VA 1FL2A 3K1GA 3Q6JA 3QSEA 1VQWA 3ISHA 4Y4LA 4J57A 2XLPA 3B6DA 2R4JA 1GRFA 3NH3X 3A7UA 1D7YA 3QN3A 4X4JA 2NQLA 2E4GA 4KX6A 2C65A 4HA6A 1EL8A 2WQYA 3RO6A 2XH4A 2YAUA 2OLOA 2YR5A 4U8IA 2OQHA 3FVDA 1LVLA 4K2SA 5KOWA 2EQ9A 3TTEA 4D03A 1REOA 4OPIA 4EIQA 4GYPC 3SQPA 2PS2A 3EEZA 3SM8A 4A5LA 3VRDB 1NHSA 4BK1A 2PTZA 4BK3A 4H4ZA 3AD7B 3SGLA 3GWFA 1L8PA 4H2HA 3PVCA 4NZHA 3CAWA 4OPUA 3MQTA 3NYCA 4C3XA 2GAGB 4G73A 1CC4A 3LJPA 4OPTA 4USQA 2RGOA 4NTDA 4HCHA 1AOGA 1X31B 3GY1A 2C72A 2C76A 2YLSA 4G9KA 2E3TA 3CNPA 4EMJA 5KNLA 3NYFA 2B9XA 3IC9A 4F4RA 2E5AA 3CXBA 1XHCA 4LU6A 4NWZA 2WDVA 1IUWA 2OG9A 3M12A 3H70A 2VVLG 2W3SA 1PHHA 1MOKA 3DESA 5BULA 1JROA 3NFUA 3GD3A 4E6MA 1H84A 4ROPA 3B97A 2C70A 3GRTA 2RGJA 3D46A 3NN0X 4EQRA 3UKQA 3NVVB 1ONFA 1ZDLA 2OZ8A 4H2PA 5BOFA 2AL1A 1CJ4A 2CULA 1K0LA 1LQUA 1EC8A 2I0ZA 4JNQA 3AEAA 3PFRA 3GDPA 2WP5A 3RP8A 1ZOYA 2YLTA 3ETRB 3RP6A 2PYXA 3OP2A 1RSGA 5HYMA 3SXIA 2WU2A 3QFAA 4G7FA 1FECA 3NRNA 2QCUA 1GRHA 2H88A 3BJSA 3P93A 3CYJA 2EQ6A 3NVYB 1KNPA 3UP5A 3T14A 1TDKA 1VG0A 1OJDA 3CK5A 4AOSA 2WPCA 3IWAA 3P0WA 3UOZA 3F8DA 1RM6B 3SYIA 3FV9A 2GQFA 4X9NA 2XYOA 4AT2A 4HCLA 3GWDA 1FEAA 1DODA 2GGEA 1BWCA 4N9XA 2BK4A 3V5FA 2B7RA 4CRTA 4YSHA 1WYGA 3UTFA 1P2HA 1VQZA 3Q9TA 4A99A 1BQGA 4H4RA 3SJNA 1QJDA 4U2LA 5U63A 3UJEA 4IP5A 3CT2A 2R4EA 1JNRA 4FK1C 4GDPA 4Z2UA 3GDNA 3CMMA 2GF3A 4GMEA 2QGYA 4H83A 3DFHA 3R0UA 3UJRA 2HXUA 3UCCA 3TJ4A 4HCDA 2PP3A 4A6GA 1L9DA 3NYEA 2DKHA 2PTXA 2C64A 1CC6A 2WOVA 1KFYA 1P2EA 1M64A 2YVFA 3S61A 4FX9A 4REKA 3UTEA 3IHGA 1PXAA 4A65A 1YEYA 2CHRA 3NIXA 4Z2RA 2RGHA 1VDVA 4OCGA 3HW2A 2PPGA 3AEFA 1PBCA 3ATRA 1GRBA 4H4SA 5KMQA 3FBSA 1MDLA 3F8PA 3TOYA
chains in the Genus database with same CATH topology
3VR9A 3D9XA 4ICYA 1LTXR 1NDAA 3DMEA 1CF3A 1JRYA 2GR3A 4GDEA 1PBEA 2XLSA 3ALMA 3NTAA 3UKAA 2YG5A 5BRTA 2BACA 1QO8A 1GRTA 3GSIA 3ALLA 1F8RA 4H4VA 4H7UA 3I6DA 4B63A 2WP6A 4EM3A 2WOWA 3GD4A 3AE1A 1DXLA 3AD8B 4FK1A 3G5SA 1VG9A 1ZOVA 4NTEA 1JRZA 3NN6X 2C73A 3UTGA 3QFBA 4A7AA 3RNMA 1NHQA 2AR8A 2B76A 1KSUA 5IQ4A 5GSNA 5IPYA 1K0IA 1CBOA 1PDHA 1IJHA 2XLRA 4H4PA 4AOXA 1V59A 2FBWA 3AE3A 4G6HA 5J7XA 3UOVA 4FDCB 5EBKA 2YM1A 3FPZA 3S5WA 2IVDA 3AYJA 1Y56B 1GT8A 2WS3A 4WX1A 4A79A 1DOEA 2W0HA 2XLUA 1YQ3A 3UTHA 4DGKA 3BI4A 1IUSA 3AEDA 4D04A 3UKFA 3CPIG 3UKPA 3AEEA 2A89A 1D4DA 1TYTA 1FCDA 3BHKA 2XVEA 3C4NA 3CNDA 3K7QX 2Z5XA 3AYIA 3KD9A 2QAEA 2VQ7A 1YY5A 3CN8A 4H4TA 3G5RA 4K2XA 4U8OA 4ZCCA 4YT0A 4EM4A 3DH9A 1TDNA 4U8JA 3ABVA 5CQFA 5M0ZA 4XXGA 4IVOB 2FJEA 3UOYA 3DJDA 2CVJA 2OALA 3RP7A 3UKKA 3ZDNA 5KVHA 4J2WA 3ATQA 4P9SA 3T2KA 4C77A 3HYVA 4PABA 1PBDA 1OJTA 4U8NA 5HHFA 2JK6A 4ECHA 1F3PA 4APNA 1O95A 4TM1A 4H4UA 2VQBA 3WE0A 5KOXA 5BVAA 1XDIA 3II4A 2YVGA 1CL0A 3AE4A 3LOVA 4H2QA 1N4VA 4UP3A 4AP3A 1ZKQA 2FJAA 1NENA 2FJBA 2JB1A 3K30A 2FJDA 3NNEA 3T2ZA 5KRQA 2WU5A 1DNCA 1K0JA 1Y0PA 1GALA 2BS4A 2XFNA 3GRSA 2C67A 3RHAA 4CCQA 1B5QA 1NHPA 5BUKA 3LADA 1EBDA 1Q1RA 4G74A 4IA5A 4CBQA 2OA1A 2Q0KA 4TLXA 4Y4NA 2C75A 2JBVA 4OPDA 3ICSA 4OPLA 4Z24A 4Z26A 3GMCA 3P4QA 1LPFA 1MO9A 2GVCA 2R0PA 2UZZA 3KVEA 2JKCA 1BKWA 4IVMB 3LZXA 1KF6A 4U2TA 4A9WA 2YQUA 3UCLA 2YM2A 3AXBA 4EQXA 1ELIA 1O94A 2O9ZA 1LQTA 3AD9B 3AEBA 2H89A 4U8LA 3KKJA 4YTPA 2WDQA 3P4SA 4B67A 4TM4A 3PS9A 3UKLA 3SY4A 4K7ZA 4J56A 5HY5A 3K7TA 1GERA 1GTHA 4AP1A 4RSLA 3SZCA 4YTNA 2XVHA 3AEGA 3D8XA 3C96A 4ZCDA 3ADAB 1TYPA 4GCMA 4PAAA 3T0KA 4UDRA 2E5VA 1FL2A 4YWOA 4CY8A 3CTYA 2X8HA 3Q6JA 3QSEA 4JY3A 4JQ9A 1VQWA 2WHDA 2Y6RA 3ISHA 4Y4LA 4J57A 1BF3A 2XLPA 2IIDA 2R4JA 3B6DA 1GRFA 2WBAA 3EANA 2VRMA 3NH3X 4BJYA 1D7YA 1GXFA 3KU9A 3NG7X 4I58A 1PXCA 1BGNA 1XANA 4H2NA 4X4JA 4Y4MA 2E1MA 3IF9A 5EOWA 2E4GA 4RG4A 3SFEA 1L0VA 1S2YA 5KVIA 3FIMB 3D1CA 4KX6A 2C65A 3VRBA 4B65A 2X8CA 3FMWA 4G6GA 2BCPA 2C3CA 3ITJA 1EL8A 2WQYA 4NEWA 3NHOX 3P4RA 1NHRA 4HA6A 3VRAA 4BK2A 1F8WA 4OPGA 3NGCX 2YAUA 1KNRA 3P4PA 2OLOA 2YG3A 3B3RA 3G5QA 2GRTA 1PJ5A 2ACZA 2YR5A 4U8IA 2B9WA 3CGBA 1LVLA 2C4CA 1F6MA 2VOUA 4YSZA 3M0OA 3DK9A 2BABA 5KOWA 2EQ9A 1YQ4A 5FMHA 4GAVA 3H8IA 4D03A 1REOA 4OPIA 3SFDA 1S3BA 4EIQA 3CGCA 3V3OA 5FS9A 1PJ6A 1DOCA 1PJ7A 3NK2X 2X8GA 1S2QA 2V60A 2YR4A 3SQPA 2XFUA 3SM8A 3EAOA 4X9MA 1EL9A 2WESA 4A5LA 1IUXA 1NHSA 3VRDB 4BK1A 4BK3A 5U1OA 1RYIA 1SEZA 4TM0A 4H4ZA 2XCGA 3AD7B 4TLZA 3SGLA 3GWFA 2C3DA 4H50A 3SZWA 1FEBA 3NT6A 3PVCA 3GYJA 1H82A 4NZHA 4DNAA 1BZLA 5JCLA 2TPRA 1H83A 3QSSA 3NYCA 4OPUA 4YSYA 4K22A 4IV9A 4GAPA 1NEKA 4C3XA 2J3NA 1N4WA 3COXA 4NNJA 2GR2A 2GAGB 2BS3A 2NVKX 4G73A 4U8KA 2DKIA 3V3NA 1E1NA 1CC4A 1K4QA 5FS8A 4KPRA 3LJPA 4OPTA 4B1BA 2Q0LA 1OJ9A 2BYBA 1N1PA 2Z5YA 4USQA 1JEHA 1M6IA 4GRTA 2RGOA 3DJEA 4NTDA 3AECA 1E1LA 4Z25A 4YXDA 4O5QA 1GREA 1W4XA 3DK4A 1AOGA 1X31B 2C72A 2C76A 2Q6UA 1D5TA 2YLSA 3AWIA 1GESA 4G9KA 4USRA 5M10A 3CNPA 2GV8A 1VRQB 4J31A 4EMJA 5KNLA 1E7PA 3NYFA 1S3EA 2C66A 2B9XA 3IC9A 2BA9A 3CIRA 4LA1A 3CNJA 2PHHA 2JAEA 1XHCA 4RG3A 4LU6A 4NWZA 4DSGA 2WDVA 5TR3A 1IUWA 1ZMCA 4H4QA 1D4CA 4I59A 1IUVA 4NTCA 5J60A 3M12A 2YR6A 1NPXA 2GH5A 5KWFA 3DK8A 2VVLG 1PHHA 1MOKA 1GTEA 1MXTA 5BULA 2XDOA 1Z6LA 1CJ2A 5FS6A 3CPJG 3GD3A 1DJQA 1N4UA 1FOHA 5U25A 1H84A 4GR1A 1GEUA 3I3LA 2C70A 3AE8A 3GRTA 2RGJA 4H2RA 1PS9A 3QJ4A 3NN0X 1H2IA 3ICRA 3NLCA 1JU2A 3CGEA 1GPEA 3DJJA 5ER0A 2V3AA 4EQRA 3UKQA 1B4VA 1ONFA 1B37A 3UP4A 1ZDLA 1TDFA 4BV6A 1O5WA 1VDCA 1KSSA 4H2PA 3AE2A 4OVIA 1GETA 2WPEA 3DGZA 5CKUA 2YG4A 2EQ8A 1CJ4A 3KA7A 3L8KA 1DOBA 2CULA 3KPFA 4HB9A 1NG4A 4MJWA 2OLNA 1K0LA 3DGHA 1JRXA 4J33A 4AT0A 1LQUA 3CNTA 2I0ZA 1YKJA 5C2TA 3NTDA 4JNQA 2R0GA 3AEAA 1ZK7A 2GMJA 3GDPA 2WP5A 1PBFA 3RP8A 1ZOYA 2YLTA 2BS2A 4K5RA 2F5ZA 2NPXA 1XPQA 4LIIA 3AB1A 2ZZBA 2ZBWA 3RP6A 2PYXA 1CC2A 1D7LA 3ALJA 4B64A 3T31A 3REDA 1F8SA 1RSGA 3PG6A 5HYMA 3NK0X 3QVRA 4K8DA 3SXIA 1JOAA 2WU2A 5KMPA 3QFAA 1IUUA 2JB3A 4UDPA 1FECA 2X3NA 3NRNA 4H4YA 5IQ1A 4XWZA 1NAAA 2Q7VA 2QCUA 5JCNA 1D4EA 3AE5A 1PN0A 3JSKA 4YKGA 3DJGX 2WP9A 1GRHA 1E6EA 2H88A 2V6OA 1EL5A 4H4XA 1GSNA 2A8XA 4GF7A 4XWRA 2YLWA 2EQ6A 2AQJA 3EPTA 1GNDA 3NKSA 1KNPA 3UP5A 2BCGG 3M13A 4M52A 2WETA 2XVJA 3CGDA 1ZMDA 3KLJA 4II2A 1TDKA 3T14A 1VG0A 5KMRA 4E0VA 4EMWA 2XLTA 2AAQA 1OJDA 3PO7A 2VRLA 2YG6A 4YKFA 2GQWA 2XVIA 2VVMA 2ZZ0A 1GRGA 4EQWA 4AOSA 2ARDA 3GYIA 3GYXA 3R9UA 2GMHA 2WPCA 2YLZA 2XFQA 1TDEA 3AYLA 3SZ0A 3IWAA 2QA2A 1ZX9A 1KN0A 1E39A 2XFPA 3UOZA 3F8DA 2CFYA 4EQSA 4C74A 5KXJA 5EB4A 3SYIA 5GRTA 2GQFA 4X9NA 4ADWA 3AE6A 2XYOA 2YLXA 4AT2A 2BK3A 4OPCA 3GWDA 1FEAA 1DODA 3KPKA 1BWCA 3BNMA 3HZLA 4N9XA 2BK4A 3L1RA 2V3BA 1LV0A 5L46A 2BC0A 3LB8A 2QA1A 2B7RA 2XVFA 4CRTA 1B8SA 2ZZCA 1KDGA 4YSHA 1IUTA 3BI2A 3OZ2A 4JN9A 2BRYA 4JNAA 5EB5A 3NK1X 3UTFA 2X99A 3HYXA 5JCKA 4B66A 4C3YA 3F8RA 3E1TA 4IA6A 1P2HA 4CY6A 2IVEA 3P9UA 4J34A 3LZWA 3Q9TA 4U8MA 4A99A 3AE7A 4H4RA 3H4KA 2CDUA 1S7MA 4UDQA 1QJDA 1NG3A 4U2LA 2GAHB 5U63A 3DA1A 3T2YA 2GR0A 3L5OA 1GOSA 2HQMA 4EMIA 4J36A 2R4EA 4TM3A 1JNRA 4FK1C 2BK5A 2V5ZA 4NEVA 4GDPA 4K5SA 3GDNA 4Z2UA 1RP0A 5DBJA 2GR1A 4O5UA 2C7GA 1JNZA 2GF3A 3CMMA 3H8LA 4U8PA 1TRBA 4A6NA 2EQ7A 3EF6A 5C3JA 1HYUA 5JCIA 1CJ3A 3SZFA 2A87A 2B9YA 2BRAA 2WOIA 3HYWA 2XFOA 1H7WA 1UKVG 1E1MA 1L9DA 4CNJA 1YQZA 2APGA 3NYEA 1EL7A 2DKHA 3VQRA 1E1KA 4JDRA 3K7MX 2YWLA 2C64A 1CC6A 2BXSA 1QLBA 1L9EA 1PBBA 3QSMA 2WOVA 3VR8A 3BI5A 1TDOA 1KFYA 1P2EA 1M64A 4YTMA 4YSXA 5KMSA 1OJAA 4WCTA 2YVFA 3UOXA 4B69A 4B68A 3S61A 4FX9A 1H6VA 2VVLA 3OC4A 4REKA 3UTEA 5FS7A 1CJCA 5LV9A 2JB2A 1H86A 2TMDA 4BJZA 5JCMA 2GB0A 3IHGA 1OJCA 2YVJA 1PXAA 3C4AA 4BURA 4A65A 2V61A 1Y56A 2WDRA 3CPHG 4H4WA 3NIXA 3QVPA 1H81A 1COYA 2GEWA 4Z2RA 4CCRA 3ICTA 1ZP0A 2X50A 1GV4A 2R46A 4C5OA 2RGHA 2R9ZA 3IHMA 1LJ1A 4Z2TA 3FG2P 3UKHA 2BC1A 3P1WA 4OCGA 2Y6QA 3AE9A 3T37A 2WEUA 1PXBA 3LXDA 3AEFA 1PBCA 4U2SA 4DSHA 3ATRA 2WPFA 2YLRA 4CNKA 4Z43A 5JRBA 1GRBA 2R45A 3CNSA 2YG7A 4EIPA 4H4SA 3BHFA 2BXRA 2OAMA 5KMQA 4Z44A 1H7XA 3FBSA 4JY2A 3V76A 4ZN0A 5HXIA 3SX6A 2B7SA 2R0CA 3ZYXA 2VZ2A 3GMBA 4GUVA 2RABA 1Q9IA 3F8PA 1DJNA 3O0HA 1CHUA 4II3A 1Q1WA 3BNUA 4A6NB 3URHA 1BGJA 1ZY8A 1GRAA 1L9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VR9 A;  4ICY A;  1LTX R;  1NDA A;  3DME A;  1CF3 A;  1JRY A;  2GR3 A;  4GDE A;  1PBE A;  2XLS A;  3ALM A;  3NTA A;  3UKA A;  2YG5 A;  5BRT A;  2BAC A;  1QO8 A;  1GRT A;  3GSI A;  3ALL A;  1F8R A;  4H4V A;  4H7U A;  3I6D A;  4B63 A;  2WP6 A;  4EM3 A;  2WOW A;  3GD4 A;  3AE1 A;  1DXL A;  3AD8 B;  4FK1 A;  3G5S A;  1VG9 A;  1ZOV A;  4NTE A;  1JRZ A;  3NN6 X;  2C73 A;  3UTG A;  3QFB A;  4A7A A;  3RNM A;  1NHQ A;  2AR8 A;  2B76 A;  1KSU A;  5IQ4 A;  5GSN A;  5IPY A;  1K0I A;  1CBO A;  1PDH A;  1IJH A;  2XLR A;  4H4P A;  4AOX A;  1V59 A;  2FBW A;  3AE3 A;  5J7X A;  3UOV A;  4FDC B;  5EBK A;  2YM1 A;  3FPZ A;  3S5W A;  2IVD A;  3AYJ A;  1Y56 B;  1GT8 A;  2WS3 A;  4WX1 A;  4A79 A;  1DOE A;  2W0H A;  2XLU A;  1YQ3 A;  3UTH A;  4DGK A;  3BI4 A;  1IUS A;  3AED A;  4D04 A;  3UKF A;  3CPI G;  3UKP A;  3AEE A;  2A89 A;  1D4D A;  1TYT A;  1FCD A;  3BHK A;  2XVE A;  3C4N A;  3CND A;  3K7Q X;  2Z5X A;  3AYI A;  3KD9 A;  2QAE A;  2VQ7 A;  1YY5 A;  3CN8 A;  4H4T A;  3G5R A;  4K2X A;  4U8O A;  4ZCC A;  4YT0 A;  4EM4 A;  3DH9 A;  1TDN A;  4U8J A;  3ABV A;  5CQF A;  5M0Z A;  4XXG A;  4IVO B;  2FJE A;  3UOY A;  3DJD A;  2CVJ A;  2OAL A;  3RP7 A;  3UKK A;  3ZDN A;  5KVH A;  4J2W A;  3ATQ A;  4P9S A;  4C77 A;  4PAB A;  1PBD A;  1OJT A;  4U8N A;  5HHF A;  2JK6 A;  4ECH A;  1F3P A;  4APN A;  1O95 A;  4TM1 A;  4H4U A;  2VQB A;  3WE0 A;  5KOX A;  5BVA A;  1XDI A;  3II4 A;  2YVG A;  1CL0 A;  3AE4 A;  3LOV A;  4H2Q A;  1N4V A;  4UP3 A;  4AP3 A;  1ZKQ A;  2FJA A;  1NEN A;  2FJB A;  2JB1 A;  3K30 A;  2FJD A;  3NNE A;  5KRQ A;  2WU5 A;  1DNC A;  1K0J A;  1Y0P A;  1GAL A;  2BS4 A;  2XFN A;  3GRS A;  2C67 A;  3RHA A;  4CCQ A;  1B5Q A;  1NHP A;  5BUK A;  3LAD A;  1EBD A;  1Q1R A;  4IA5 A;  4CBQ A;  2OA1 A;  2Q0K A;  4TLX A;  4Y4N A;  2C75 A;  2JBV A;  4OPD A;  3ICS A;  4OPL A;  4Z24 A;  4Z26 A;  3GMC A;  3P4Q A;  1LPF A;  1MO9 A;  2GVC A;  2R0P A;  2UZZ A;  3KVE A;  2JKC A;  1BKW A;  4IVM B;  3LZX A;  1KF6 A;  4U2T A;  4A9W A;  2YQU A;  3UCL A;  2YM2 A;  3AXB A;  4EQX A;  1ELI A;  1O94 A;  2O9Z A;  1LQT A;  3AD9 B;  3AEB A;  2H89 A;  4U8L A;  3KKJ A;  4YTP A;  2WDQ A;  3P4S A;  4B67 A;  4TM4 A;  3PS9 A;  3UKL A;  4K7Z A;  4J56 A;  5HY5 A;  3K7T A;  1GER A;  1GTH A;  4AP1 A;  4RSL A;  4YTN A;  2XVH A;  3AEG A;  3D8X A;  3C96 A;  4ZCD A;  3ADA B;  1TYP A;  4GCM A;  4PAA A;  4UDR A;  2E5V A;  1FL2 A;  4YWO A;  4CY8 A;  3CTY A;  2X8H A;  3Q6J A;  3QSE A;  4JY3 A;  4JQ9 A;  1VQW A;  2WHD A;  2Y6R A;  3ISH A;  4Y4L A;  4J57 A;  1BF3 A;  2XLP A;  2IID A;  2R4J A;  3B6D A;  1GRF A;  2WBA A;  3EAN A;  2VRM A;  3NH3 X;  4BJY A;  1D7Y A;  1GXF A;  3KU9 A;  3NG7 X;  4I58 A;  1PXC A;  1BGN A;  1XAN A;  4H2N A;  4X4J A;  4Y4M A;  2E1M A;  3IF9 A;  5EOW A;  2E4G A;  4RG4 A;  3SFE A;  1L0V A;  1S2Y A;  5KVI A;  3FIM B;  3D1C A;  4KX6 A;  2C65 A;  3VRB A;  4B65 A;  2X8C A;  3FMW A;  2BCP A;  2C3C A;  3ITJ A;  1EL8 A;  2WQY A;  4NEW A;  3NHO X;  3P4R A;  1NHR A;  4HA6 A;  3VRA A;  4BK2 A;  1F8W A;  4OPG A;  3NGC X;  2YAU A;  1KNR A;  3P4P A;  2OLO A;  2YG3 A;  3B3R A;  3G5Q A;  2GRT A;  1PJ5 A;  2ACZ A;  2YR5 A;  4U8I A;  2B9W A;  3CGB A;  1LVL A;  1F6M A;  2VOU A;  4YSZ A;  3M0O A;  3DK9 A;  2BAB A;  5KOW A;  2EQ9 A;  1YQ4 A;  5FMH A;  3H8I A;  4D03 A;  1REO A;  4OPI A;  3SFD A;  1S3B A;  4EIQ A;  3CGC A;  3V3O A;  5FS9 A;  1PJ6 A;  1DOC A;  1PJ7 A;  3NK2 X;  2X8G A;  1S2Q A;  2V60 A;  2YR4 A;  3SQP A;  2XFU A;  3SM8 A;  3EAO A;  4X9M A;  1EL9 A;  2WES A;  4A5L A;  1IUX A;  1NHS A;  3VRD B;  4BK1 A;  4BK3 A;  5U1O A;  1RYI A;  1SEZ A;  4TM0 A;  4H4Z A;  2XCG A;  3AD7 B;  4TLZ A;  3SGL A;  3GWF A;  2C3D A;  4H50 A;  1FEB A;  3NT6 A;  3PVC A;  3GYJ A;  1H82 A;  4NZH A;  4DNA A;  1BZL A;  5JCL A;  2TPR A;  1H83 A;  3QSS A;  3NYC A;  4OPU A;  4YSY A;  4K22 A;  4IV9 A;  1NEK A;  4C3X A;  2J3N A;  1N4W A;  3COX A;  2GR2 A;  2GAG B;  2BS3 A;  2NVK X;  4U8K A;  3V3N A;  2DKI A;  1E1N A;  1CC4 A;  1K4Q A;  5FS8 A;  4KPR A;  3LJP A;  4OPT A;  4B1B A;  2Q0L A;  1OJ9 A;  2BYB A;  1N1P A;  2Z5Y A;  4USQ A;  1JEH A;  1M6I A;  4GRT A;  2RGO A;  3DJE A;  4NTD A;  3AEC A;  1E1L A;  4Z25 A;  4YXD A;  4O5Q A;  1GRE A;  1W4X A;  3DK4 A;  1AOG A;  1X31 B;  2C72 A;  2C76 A;  2Q6U A;  1D5T A;  2YLS A;  3AWI A;  1GES A;  4USR A;  5M10 A;  3CNP A;  2GV8 A;  1VRQ B;  4J31 A;  4EMJ A;  1E7P A;  3NYF A;  1S3E A;  2C66 A;  2B9X A;  3IC9 A;  2BA9 A;  3CIR A;  4LA1 A;  3CNJ A;  2PHH A;  2JAE A;  1XHC A;  4RG3 A;  4LU6 A;  4DSG A;  2WDV A;  5TR3 A;  1IUW A;  1ZMC A;  4H4Q A;  1D4C A;  4I59 A;  1IUV A;  4NTC A;  5J60 A;  3M12 A;  2YR6 A;  1NPX A;  2GH5 A;  5KWF A;  3DK8 A;  2VVL G;  1PHH A;  1MOK A;  1GTE A;  1MXT A;  5BUL A;  2XDO A;  1Z6L A;  1CJ2 A;  5FS6 A;  3CPJ G;  3GD3 A;  1DJQ A;  1N4U A;  1FOH A;  5U25 A;  1H84 A;  4GR1 A;  1GEU A;  3I3L A;  2C70 A;  3AE8 A;  3GRT A;  2RGJ A;  4H2R A;  1PS9 A;  3QJ4 A;  3NN0 X;  3ICR A;  3NLC A;  1JU2 A;  3CGE A;  1GPE A;  3DJJ A;  5ER0 A;  4EQR A;  2V3A A;  3UKQ A;  1B4V A;  1ONF A;  1B37 A;  3UP4 A;  1ZDL A;  1TDF A;  4BV6 A;  1O5W A;  1VDC A;  1KSS A;  4H2P A;  3AE2 A;  4OVI A;  1GET A;  2WPE A;  3DGZ A;  5CKU A;  2YG4 A;  2EQ8 A;  1CJ4 A;  3KA7 A;  3L8K A;  1DOB A;  2CUL A;  3KPF A;  4HB9 A;  1NG4 A;  4MJW A;  2OLN A;  1K0L A;  3DGH A;  1JRX A;  4J33 A;  4AT0 A;  1LQU A;  3CNT A;  2I0Z A;  1YKJ A;  5C2T A;  3NTD A;  4JNQ A;  2R0G A;  3AEA A;  1ZK7 A;  2GMJ A;  3GDP A;  2WP5 A;  1PBF A;  3RP8 A;  1ZOY A;  2YLT A;  2BS2 A;  4K5R A;  2F5Z A;  2NPX A;  1XPQ A;  4LII A;  3AB1 A;  2ZZB A;  2ZBW A;  3RP6 A;  2PYX A;  1CC2 A;  1D7L A;  3ALJ A;  4B64 A;  3RED A;  1F8S A;  1RSG A;  5HYM A;  3NK0 X;  3QVR A;  4K8D A;  1JOA A;  2WU2 A;  3QFA A;  1IUU A;  2JB3 A;  4UDP A;  1FEC A;  2X3N A;  3NRN A;  4H4Y A;  5IQ1 A;  4XWZ A;  1NAA A;  2Q7V A;  2QCU A;  5JCN A;  1D4E A;  3AE5 A;  1PN0 A;  3JSK A;  4YKG A;  3DJG X;  2WP9 A;  1GRH A;  1E6E A;  2H88 A;  2V6O A;  1EL5 A;  4H4X A;  1GSN A;  2A8X A;  4GF7 A;  4XWR A;  2YLW A;  2EQ6 A;  2AQJ A;  3EPT A;  1GND A;  3NKS A;  1KNP A;  3UP5 A;  2BCG G;  3M13 A;  4M52 A;  2WET A;  2XVJ A;  3CGD A;  1ZMD A;  3KLJ A;  1TDK A;  1VG0 A;  4E0V A;  4EMW A;  2XLT A;  2AAQ A;  1OJD A;  3PO7 A;  2VRL A;  2YG6 A;  4YKF A;  2GQW A;  2XVI A;  2VVM A;  2ZZ0 A;  1GRG A;  4EQW A;  4AOS A;  2ARD A;  3GYI A;  3R9U A;  2GMH A;  2WPC A;  2YLZ A;  2XFQ A;  1TDE A;  3AYL A;  3IWA A;  2QA2 A;  1ZX9 A;  1E39 A;  2XFP A;  3UOZ A;  3F8D A;  2CFY A;  4EQS A;  4C74 A;  5KXJ A;  5EB4 A;  5GRT A;  2GQF A;  4X9N A;  4ADW A;  3AE6 A;  2XYO A;  2YLX A;  4AT2 A;  2BK3 A;  4OPC A;  3GWD A;  1FEA A;  1DOD A;  1BWC A;  3BNM A;  3HZL A;  4N9X A;  2BK4 A;  3L1R A;  2V3B A;  1LV0 A;  5L46 A;  2BC0 A;  3LB8 A;  2QA1 A;  2B7R A;  2XVF A;  4CRT A;  1B8S A;  2ZZC A;  1KDG A;  4YSH A;  1IUT A;  3BI2 A;  3OZ2 A;  4JN9 A;  4JNA A;  5EB5 A;  3NK1 X;  3UTF A;  2X99 A;  5JCK A;  4B66 A;  4C3Y A;  3F8R A;  3E1T A;  4IA6 A;  1P2H A;  4CY6 A;  2IVE A;  3P9U A;  4J34 A;  3LZW A;  3Q9T A;  4U8M A;  4A99 A;  3AE7 A;  4H4R A;  3H4K A;  2CDU A;  4UDQ A;  1QJD A;  1NG3 A;  4U2L A;  2GAH B;  5U63 A;  3DA1 A;  2GR0 A;  1GOS A;  2HQM A;  4EMI A;  4J36 A;  2R4E A;  4TM3 A;  1JNR A;  4FK1 C;  2BK5 A;  2V5Z A;  4NEV A;  4GDP A;  4K5S A;  3GDN A;  4Z2U A;  1RP0 A;  5DBJ A;  2GR1 A;  4O5U A;  2C7G A;  1JNZ A;  2GF3 A;  3H8L A;  4U8P A;  1TRB A;  4A6N A;  2EQ7 A;  3EF6 A;  5C3J A;  1HYU A;  5JCI A;  1CJ3 A;  2A87 A;  2B9Y A;  2WOI A;  2XFO A;  1H7W A;  1UKV G;  1E1M A;  1L9D A;  4CNJ A;  1YQZ A;  2APG A;  3NYE A;  1EL7 A;  2DKH A;  3VQR A;  1E1K A;  4JDR A;  3K7M X;  2YWL A;  2C64 A;  1CC6 A;  2BXS A;  1QLB A;  1L9E A;  1PBB A;  3QSM A;  2WOV A;  3VR8 A;  3BI5 A;  1TDO A;  1KFY A;  1P2E A;  1M64 A;  4YTM A;  4YSX A;  1OJA A;  4WCT A;  2YVF A;  3UOX A;  4B69 A;  4B68 A;  3S61 A;  4FX9 A;  1H6V A;  2VVL A;  3OC4 A;  4REK A;  3UTE A;  5FS7 A;  1CJC A;  5LV9 A;  2JB2 A;  1H86 A;  2TMD A;  4BJZ A;  5JCM A;  2GB0 A;  3IHG A;  1OJC A;  2YVJ A;  1PXA A;  3C4A A;  4BUR A;  4A65 A;  2V61 A;  1Y56 A;  2WDR A;  3CPH G;  4H4W A;  3NIX A;  3QVP A;  1H81 A;  1COY A;  2GEW A;  4Z2R A;  4CCR A;  3ICT A;  1ZP0 A;  2X50 A;  1GV4 A;  2R46 A;  4C5O A;  2RGH A;  2R9Z A;  3IHM A;  1LJ1 A;  4Z2T A;  3FG2 P;  3UKH A;  2BC1 A;  3P1W A;  4OCG A;  2Y6Q A;  3AE9 A;  3T37 A;  2WEU A;  1PXB A;  3LXD A;  3AEF A;  1PBC A;  4U2S A;  4DSH A;  3ATR A;  2WPF A;  2YLR A;  4CNK A;  4Z43 A;  1GRB A;  2R45 A;  3CNS A;  2YG7 A;  4EIP A;  4H4S A;  3BHF A;  2BXR A;  2OAM A;  4Z44 A;  3V76 A;  1H7X A;  3FBS A;  4JY2 A;  4ZN0 A;  5HXI A;  2B7S A;  2R0C A;  3ZYX A;  2VZ2 A;  3GMB A;  4GUV A;  2RAB A;  1Q9I A;  3F8P A;  1DJN A;  3O0H A;  1CHU A;  1Q1W A;  3BNU A;  4A6N B;  3URH A;  1BGJ A;  1ZY8 A;  1GRA A;  1L9C A; 
#chains in the Genus database with same CATH topology
 3VR9 A;  3D9X A;  3QLD A;  1MNS A;  2GR3 A;  4GDE A;  3MWC A;  3N4E A;  3ALM A;  3V4B A;  2YG5 A;  1N63 C;  1GRT A;  2OX4 A;  3OZM A;  2WOW A;  1VG9 A;  3NN6 X;  4A7A A;  2FKP A;  3THU A;  5IQ4 A;  1PDH A;  4AOX A;  2FBW A;  3AE3 A;  5J7X A;  3AYJ A;  2QDD A;  2XLU A;  4DGK A;  1IUS A;  3AED A;  4D04 A;  3C4N A;  2Z5X A;  3KD9 A;  2VQ7 A;  4U8O A;  3CN8 A;  4YT0 A;  4H4T A;  4EM4 A;  3DH9 A;  1TDN A;  5M0Z A;  4IVO B;  3DJD A;  2OAL A;  1FFV C;  4J2W A;  3HYV A;  4PAB A;  1OJT A;  4ECH A;  4APN A;  1O95 A;  4H4U A;  1XDI A;  3LOV A;  1ZKQ A;  3T2Z A;  2WU5 A;  3VA8 A;  1X2G A;  1GAL A;  2C67 A;  3RHA A;  1B5Q A;  1NHP A;  1JPM A;  5IDZ A;  3VCN A;  4MKS A;  4CBQ A;  4TLX A;  4OPD A;  4OPL A;  4Z24 A;  1MO9 A;  3KVE A;  4IVM B;  3LZX A;  3NS1 B;  4A9W A;  3FYY A;  3AXB A;  1O94 A;  2O9Z A;  1LQT A;  2AKM A;  2WDQ A;  4YTP A;  2OKT A;  4J56 A;  3AMZ A;  1EC9 A;  3K7T A;  1XPY A;  1GTH A;  3SZC A;  4PAA A;  4UDR A;  3SN0 A;  1F9C A;  2Y6R A;  4GYP A;  2VRM A;  4BJY A;  3KU9 A;  4I58 A;  1BGN A;  1XAN A;  4IHC A;  3I6T A;  3D1C A;  4B65 A;  2HZG A;  4OPG A;  3TQP A;  3G5Q A;  3B3R A;  2GRT A;  1PJ5 A;  2B9W A;  2C4C A;  2VOU A;  2QDE A;  4JN8 A;  3DEQ A;  2OVL A;  3S5S A;  1YQ4 A;  1JCT A;  1S3B A;  5FS9 A;  1PJ6 A;  1PJ7 A;  1S2Q A;  2YR4 A;  2XFU A;  1IUX A;  5U1O A;  1RYI A;  1SEZ A;  4TM0 A;  4TLZ A;  1FEB A;  3GYJ A;  4YSY A;  1H83 A;  4K22 A;  4GAP A;  1SJB A;  2BS3 A;  4U8K A;  1MDR A;  1K4Q A;  5BOE A;  2Q0L A;  1OJ9 A;  1N1P A;  2Z5Y A;  4YXD A;  1W4X A;  3DK4 A;  2Q6U A;  1D5T A;  4USR A;  1E7P A;  4A3R A;  2C66 A;  4E8G A;  4LA1 A;  2PA6 A;  2JAE A;  4RG3 A;  1ZMC A;  2OZT A;  2GL5 A;  4KEM A;  5J60 A;  4H19 A;  1Z6L A;  1CJ2 A;  5FS6 A;  3CPJ G;  1N4U A;  1FOH A;  5U25 A;  4GR1 A;  1GEU A;  1PS9 A;  3QJ4 A;  2GGG A;  3VCC A;  1JU2 A;  3CGE A;  1B4V A;  1O5W A;  1EBG A;  3FXG A;  2EQ8 A;  3KPF A;  4HB9 A;  1DOB A;  1NG4 A;  4MJW A;  1JRX A;  3CNT A;  3OTR A;  1PBF A;  3DGB A;  4K5R A;  2NPX A;  1CC2 A;  1D7L A;  4B64 A;  3T31 A;  4H1Z A;  2PGE A;  1JOA A;  5KMP A;  2JB3 A;  4UDP A;  4DWD A;  1NAA A;  5JCN A;  2MUC A;  1PN0 A;  3JSK A;  4YKG A;  1SJA A;  2WP9 A;  3ZLF A;  2V6O A;  2GGH A;  4H4X A;  2XH0 A;  4GF7 A;  1KKO A;  1GND A;  3NO1 A;  3T6C A;  2BCG G;  2WET A;  4II2 A;  3KLJ A;  4EMW A;  3DG7 A;  2XVI A;  2ZZ0 A;  1GRG A;  4EQW A;  3GYX A;  3R9U A;  4FI4 A;  5GRT A;  4E4U A;  3R1Z A;  4OPC A;  3TCS A;  3HZL A;  4TVW A;  3L1R A;  3IJI A;  4IP4 A;  2BC0 A;  3LB8 A;  1SJC A;  2ZZC A;  1KDG A;  1IUT A;  3OZ2 A;  1JPD X;  4JNA A;  5EB5 A;  3AM9 A;  3TW9 A;  3HYX A;  5JCK A;  4C3Y A;  3LZW A;  1S7M A;  1NG3 A;  3SQS A;  4KWS A;  3T2Y A;  1EBH A;  4MGG A;  3L5O A;  2HQM A;  4EMI A;  2DW7 A;  4TM3 A;  2BK5 A;  5DBJ A;  4O5U A;  3H8L A;  1TRB A;  4M6U A;  2P88 A;  1HYU A;  5JCI A;  1T3Q C;  3SZF A;  3R0K A;  2XFO A;  3QPE A;  1E1M A;  3EUB 3;  1EL7 A;  1E1K A;  6ENL A;  1SB3 B;  1QLB A;  1L9E A;  4Z1Y A;  1PBB A;  3QSM A;  3VR8 A;  4YSX A;  5KMS A;  4WCT A;  4B69 A;  1H6V A;  2VVL A;  3RCY A;  5JCM A;  3H7V A;  3CPH G;  1W6T A;  3ICT A;  4E4F A;  3IHM A;  1LJ1 A;  3P1W A;  3N6H A;  1PXB A;  4U2S A;  4DSH A;  2WPF A;  2YLR A;  4CNK A;  2R45 A;  4EIP A;  3BHF A;  2BXR A;  4Z44 A;  3SN4 A;  5HXI A;  3ZYX A;  2VZ2 A;  1Q1W A;  5FJU A;  3URH A;  1GRA A;  4JN7 A;  3SR6 B;  3DME A;  1CF3 A;  3RR1 A;  5BRT A;  4H4V A;  4B63 A;  2WP6 A;  4EM3 A;  5J04 A;  3AE1 A;  1DXL A;  3AD8 B;  4NTE A;  2C73 A;  1NHQ A;  2AR8 A;  4X2P A;  1K0I A;  4H4P A;  3UOV A;  2YM1 A;  4KT2 A;  4WX1 A;  1DOE A;  3DIP A;  3UTH A;  2A89 A;  2I5Q A;  1TZZ A;  4ZA0 A;  2XVE A;  3MUC A;  5G5G B;  4K2X A;  3RIT A;  4GFI A;  4E5T A;  4U8J A;  4XXG A;  2FJE A;  3NVZ B;  3T2K A;  2AKZ A;  2XH2 A;  4U8N A;  2PP0 A;  2HXT A;  2VQB A;  3DG3 A;  3AE4 A;  3V3W A;  4AP3 A;  2FJA A;  3K30 A;  3HRD C;  2RDX A;  3UJS A;  4DHG A;  1EBD A;  1DTN A;  3T8Q A;  3ICS A;  4Z26 A;  2GVC A;  2JKC A;  1BKW A;  2ONE A;  3P4S A;  4B67 A;  1MRA A;  3PS9 A;  4ENL A;  2POD A;  3GO2 A;  3N6J A;  4YTN A;  1TYP A;  3T0K A;  4JHM A;  4YWO A;  4CY8 A;  2X8H A;  1X2H A;  4JY3 A;  4JQ9 A;  2WHD A;  1BF3 A;  2IID A;  3EAN A;  4H2N A;  5EOW A;  3SFE A;  1L0V A;  1S2Y A;  3HPF A;  3FIM B;  3VRB A;  4G6G A;  2BCP A;  3ITJ A;  3VRA A;  3P4R A;  3MSY A;  3DFY A;  3V5C A;  4BK2 A;  1F8W A;  3NGC X;  3P4P A;  2YG3 A;  2ACZ A;  1STZ A;  3ZVH A;  1F6M A;  3M0O A;  1JRP A;  2BAB A;  2PSN A;  3H8I A;  2V60 A;  4X9M A;  1EL9 A;  2WES A;  2XCG A;  4H50 A;  3SZW A;  3NT6 A;  4K8G A;  3I4K A;  1BZL A;  4DNA A;  2TPR A;  3GD6 A;  3SBF A;  4IV9 A;  1NEK A;  1N4W A;  3COX A;  4NNJ A;  4J1O A;  2NVK X;  3V3N A;  5FS8 A;  1N60 C;  2W55 A;  1JEH A;  1M6I A;  2QJM A;  3AEC A;  1E1L A;  4HN8 A;  4MMW A;  3AWI A;  5M10 A;  4J31 A;  3BOX A;  1IYX A;  1S3E A;  1MUC A;  2BA9 A;  3CIR A;  3DG6 A;  2ZAD A;  1WUF A;  2OO6 A;  5G5H B;  4NTC A;  1NPX A;  1GTE A;  1MXT A;  3NRZ B;  2XDO A;  3ZVH B;  3CXO A;  4H2R A;  1H2I A;  3NLC A;  1GPE A;  3DJJ A;  5ER0 A;  2V3A A;  1TDF A;  1VDC A;  4OVI A;  2WPE A;  2YG4 A;  3KA7 A;  3L8K A;  4GIR A;  3DGH A;  4J33 A;  1NEL A;  1YKJ A;  5C2T A;  1BKH A;  1SJD A;  3DDM A;  1ZK7 A;  2PTW A;  2QJN A;  2BS2 A;  4FP1 A;  3IK4 A;  3AB1 A;  2ZZB A;  3ALJ A;  3ZVI A;  3FCP A;  3QVR A;  4K8D A;  1IUU A;  4H4Y A;  5EU9 A;  2DW6 A;  1E6E A;  2A8X A;  3ENL A;  1FO4 A;  4XWR A;  3EPT A;  3NKS A;  3M13 A;  2XVJ A;  4E0V A;  1R0M A;  2ZC8 A;  3PO7 A;  2VRL A;  2GQW A;  3GYI A;  1TDE A;  3SZ0 A;  2QA2 A;  1KKR A;  5EB4 A;  3B9J B;  2V3B A;  1LV0 A;  2XVF A;  3PWI A;  2X99 A;  4B66 A;  3E1T A;  4CY6 A;  2IVE A;  4U8M A;  3P3B A;  3OZY A;  1FHU A;  4J36 A;  4K5S A;  3DER A;  4NEV A;  4IZG A;  1RP0 A;  2GR1 A;  3A7A A;  2EQ7 A;  3EF6 A;  1CJ3 A;  2BRA A;  4DYE A;  1H7W A;  4GIS A;  3VQR A;  3BSM A;  3IJL A;  4JDR A;  3K7M X;  3UCD A;  2YWL A;  2BXS A;  2PCE A;  1TDO A;  4Z17 A;  1OJA A;  2FYM A;  4B68 A;  3UGV A;  4DN1 A;  3OC4 A;  3JW7 A;  1CJC A;  2JB2 A;  1H86 A;  2TMD A;  1OJC A;  4BUR A;  1Y56 A;  3MZN A;  3QVP A;  1H81 A;  2GEW A;  4CCR A;  2X50 A;  1GV4 A;  3MKC A;  3R07 C;  2AL2 A;  5FJP A;  4Z2T A;  3FG2 P;  1TE6 A;  3T37 A;  3LXD A;  3T9P A;  2OPJ A;  5FJR A;  4Z43 A;  5JRB A;  3CNS A;  2OAM A;  2PU1 A;  4G8T A;  1H7X A;  1FFU C;  4JY2 A;  2B7S A;  4GUV A;  3U4F A;  4ZCW A;  4DX3 A;  1DJN A;  3BNU A;  1BGJ A;  1ZY8 A;  2GGJ A;  1L9C A;  2HNE A;  1FIQ B;  3Q4D A;  4ICY A;  1JRY A;  1PBE A;  3GSI A;  3ALL A;  1F8R A;  4H7U A;  3I6D A;  4FK1 A;  3G5S A;  4ZOH B;  1ZOV A;  1JRZ A;  3UTG A;  3QFB A;  3RNM A;  3R25 A;  2B76 A;  1CBO A;  2XLR A;  1IJH A;  4TVY A;  1V59 A;  4G6H A;  2OQY A;  4FDC B;  5EBK A;  3S5W A;  1Y56 B;  3OPS A;  2WS3 A;  2W0H A;  1P48 A;  3CPI G;  3AEE A;  1D4D A;  2AL2 B;  3BHK A;  1KD0 A;  1WUE A;  1YY5 A;  4ZCC A;  3G5R A;  3ABV A;  5CQF A;  4M0X A;  2O56 A;  3ZLG A;  3RP7 A;  3IJQ A;  3UKK A;  3ZDN A;  2GGI A;  3ATQ A;  4P9S A;  4C77 A;  1F3P A;  4K1W A;  4TM1 A;  5KOX A;  5BVA A;  3II4 A;  1ELS A;  1CL0 A;  2OZ3 A;  2FJB A;  2JB1 A;  2BS4 A;  2XFN A;  5BUK A;  3LAD A;  4IA5 A;  2OA1 A;  2C75 A;  2JBV A;  3VFC A;  3AN1 A;  3GMC A;  1LPF A;  2R0P A;  1KF6 A;  4U2T A;  3UJ2 A;  2YQU A;  3N4F A;  2YM2 A;  4EQX A;  4GGH A;  3AEB A;  3AD9 B;  4U8L A;  1GER A;  1EC7 A;  3KUM A;  4RSL A;  1V97 A;  3JVA A;  3C96 A;  4ZCD A;  3ADA B;  3CTY A;  2PMQ A;  3UXL A;  2WBA A;  7ENL A;  1GXF A;  3NG7 X;  1PXC A;  4Y4M A;  2E1M A;  3IF9 A;  4RG4 A;  3NVW B;  5KVI A;  2X8C A;  3FMW A;  2XGZ A;  2C3C A;  3MY9 A;  4NEW A;  3PK7 A;  3NHO X;  1NHR A;  3D47 A;  1KNR A;  3CGB A;  4YSZ A;  3DK9 A;  5FMH A;  4GAV A;  1ECQ A;  3GC2 A;  3SFD A;  3CGC A;  3V3O A;  1DOC A;  3NK2 X;  2X8G A;  3U9I A;  3TWB A;  3EAO A;  4DXK A;  3TWA A;  2C3D A;  1H82 A;  5JCL A;  3QSS A;  2J3N A;  3OW1 A;  2GR2 A;  3EKG A;  2DKI A;  1E1N A;  2P0I A;  4KPR A;  4B1B A;  2BYB A;  1NU5 A;  4XWZ A;  4GRT A;  2GSH A;  3DJE A;  4Z25 A;  4O5Q A;  1GRE A;  1GES A;  2GV8 A;  3RGT A;  1VRQ B;  3CNJ A;  1N5X A;  2PHH A;  4DSG A;  5TR3 A;  1N61 C;  1D4C A;  4I59 A;  4H4Q A;  2W54 A;  1IUV A;  2POZ A;  2YR6 A;  2GH5 A;  5KWF A;  3DK8 A;  2PP1 A;  1DJQ A;  4EWJ A;  3I3L A;  3STP A;  3AE8 A;  3ICR A;  2PTY A;  1B37 A;  3UP4 A;  4BV6 A;  1KSS A;  3AE2 A;  1GET A;  3DGZ A;  5CKU A;  2OLN A;  2P8C A;  4AT0 A;  3NTD A;  2R0G A;  2GMJ A;  2F5Z A;  3SSZ A;  1XPQ A;  4LII A;  2ZBW A;  1TKK A;  1OEP A;  3RED A;  1F8S A;  3TJI A;  4IT1 A;  3PG6 A;  3NK0 X;  4J3Z A;  2X3N A;  4A35 A;  5IQ1 A;  2Q7V A;  3UXK A;  1D4E A;  3AE5 A;  3S47 A;  3DJG X;  1EL5 A;  2MNR A;  3ES7 A;  1GSN A;  2YLW A;  2AQJ A;  4M52 A;  3CGD A;  1ZMD A;  5KMR A;  2XH7 A;  2XLT A;  2AAQ A;  2YG6 A;  4YKF A;  2VVM A;  2ARD A;  3I6E A;  2GMH A;  2YLZ A;  2XFQ A;  3AYL A;  1ZX9 A;  1KN0 A;  3VC6 A;  3FJ4 A;  1E39 A;  2XFP A;  2CFY A;  4EQS A;  4C74 A;  5KXJ A;  3QTP A;  4ADW A;  3AE6 A;  1R6W A;  2YLX A;  2BK3 A;  1P43 A;  3KPK A;  3BNM A;  3R10 A;  5L46 A;  2XSX A;  1XS2 A;  2QA1 A;  1B8S A;  3BI2 A;  4JN9 A;  2BRY A;  4HYR A;  3NK1 X;  3F8R A;  3NXL A;  4IA6 A;  3P9U A;  4J34 A;  4HNC A;  3AE7 A;  3H4K A;  2CDU A;  4UDQ A;  2GAH B;  3DA1 A;  2GR0 A;  3ZLH A;  1GOS A;  1RVK A;  2V5Z A;  5ENL A;  2C7G A;  1JNZ A;  4U8P A;  4A6N A;  5C3J A;  3UJF A;  2A87 A;  2B9Y A;  2P8B A;  2WOI A;  3HYW A;  1FHV A;  1UKV G;  4CNJ A;  1YQZ A;  2APG A;  3BI5 A;  4YTM A;  3T4W A;  3UOX A;  4YWS A;  5LV9 A;  5FS7 A;  1PDZ A;  4BJZ A;  2GB0 A;  3ES8 A;  2YVJ A;  3C4A A;  2V61 A;  2WDR A;  4H4W A;  1COY A;  1ZP0 A;  2R46 A;  4C5O A;  2R9Z A;  3PWG A;  3UKH A;  2BC1 A;  4IL0 A;  2Y6Q A;  3QKE A;  3AE9 A;  2WEU A;  4KPL A;  2QVH A;  4GGB A;  2W3R A;  2YG7 A;  4ZN0 A;  3V76 A;  5FJT A;  3SX6 A;  2GDQ A;  2R0C A;  3GMB A;  2RAB A;  1Q9I A;  3O0H A;  1CHU A;  4II3 A;  2QQ6 A;  4A6N B;  2P3Z A;  4HPN A;  1LTX R;  1NDA A;  2XLS A;  3NTA A;  3UKA A;  3H8A A;  2BAC A;  1QO8 A;  3CB3 A;  3GD4 A;  1KCZ A;  1KSU A;  5GSN A;  5IPY A;  3Q45 A;  1PDY A;  3SN1 A;  1ZXI C;  3FPZ A;  2IVD A;  1GT8 A;  4A79 A;  1N5W C;  1YQ3 A;  3BI4 A;  3UKF A;  3UKP A;  2QJJ A;  1TYT A;  4HNL A;  5FJO A;  1FCD A;  3CND A;  3K7Q X;  3AYI A;  2QAE A;  2OLA A;  3VC5 A;  3R11 A;  3RRA A;  3UOY A;  2CVJ A;  3VDG A;  2OFJ A;  5KVH A;  1PBD A;  5HHF A;  2JK6 A;  3WE0 A;  2YVG A;  4H2Q A;  1N4V A;  4UP3 A;  1NEN A;  2FJD A;  3NNE A;  5KRQ A;  1DNC A;  1K0J A;  1Y0P A;  1ONE A;  2PGW A;  3GRS A;  4IL2 A;  4CCQ A;  1JDF A;  1E9I A;  1Q1R A;  3A7R A;  4G74 A;  2Q0K A;  4Y4N A;  1N62 C;  2PU0 A;  3P4Q A;  2UZZ A;  3NZG A;  3H12 A;  3UCL A;  1ELI A;  2H89 A;  3KKJ A;  4TM4 A;  3UKL A;  3SY4 A;  4K7Z A;  5HY5 A;  4AP1 A;  2XVH A;  3AEG A;  3D8X A;  3JZU A;  4GCM A;  2E5V A;  1FL2 A;  3K1G A;  3Q6J A;  3QSE A;  1VQW A;  3ISH A;  4Y4L A;  4J57 A;  2XLP A;  3B6D A;  2R4J A;  1GRF A;  3NH3 X;  3A7U A;  1D7Y A;  3QN3 A;  4X4J A;  2NQL A;  2E4G A;  4KX6 A;  2C65 A;  4HA6 A;  1EL8 A;  2WQY A;  3RO6 A;  2XH4 A;  2YAU A;  2OLO A;  2YR5 A;  4U8I A;  2OQH A;  3FVD A;  1LVL A;  4K2S A;  5KOW A;  2EQ9 A;  3TTE A;  4D03 A;  1REO A;  4OPI A;  4EIQ A;  4GYP C;  3SQP A;  2PS2 A;  3EEZ A;  3SM8 A;  4A5L A;  3VRD B;  1NHS A;  4BK1 A;  2PTZ A;  4BK3 A;  4H4Z A;  3AD7 B;  3SGL A;  3GWF A;  1L8P A;  4H2H A;  3PVC A;  4NZH A;  3CAW A;  4OPU A;  3MQT A;  3NYC A;  4C3X A;  2GAG B;  4G73 A;  1CC4 A;  3LJP A;  4OPT A;  4USQ A;  2RGO A;  4NTD A;  4HCH A;  1AOG A;  1X31 B;  3GY1 A;  2C72 A;  2C76 A;  2YLS A;  4G9K A;  2E3T A;  3CNP A;  4EMJ A;  5KNL A;  3NYF A;  2B9X A;  3IC9 A;  4F4R A;  2E5A A;  3CXB A;  1XHC A;  4LU6 A;  4NWZ A;  2WDV A;  1IUW A;  2OG9 A;  3M12 A;  3H70 A;  2VVL G;  2W3S A;  1PHH A;  1MOK A;  3DES A;  5BUL A;  1JRO A;  3NFU A;  3GD3 A;  4E6M A;  1H84 A;  4ROP A;  3B97 A;  2C70 A;  3GRT A;  2RGJ A;  3D46 A;  3NN0 X;  4EQR A;  3UKQ A;  3NVV B;  1ONF A;  1ZDL A;  2OZ8 A;  4H2P A;  5BOF A;  2AL1 A;  1CJ4 A;  2CUL A;  1K0L A;  1LQU A;  1EC8 A;  2I0Z A;  4JNQ A;  3AEA A;  3PFR A;  3GDP A;  2WP5 A;  3RP8 A;  1ZOY A;  2YLT A;  3ETR B;  3RP6 A;  2PYX A;  3OP2 A;  1RSG A;  5HYM A;  3SXI A;  2WU2 A;  3QFA A;  4G7F A;  1FEC A;  3NRN A;  2QCU A;  1GRH A;  2H88 A;  3BJS A;  3P93 A;  3CYJ A;  2EQ6 A;  3NVY B;  1KNP A;  3UP5 A;  3T14 A;  1TDK A;  1VG0 A;  1OJD A;  3CK5 A;  4AOS A;  2WPC A;  3IWA A;  3P0W A;  3UOZ A;  3F8D A;  1RM6 B;  3SYI A;  3FV9 A;  2GQF A;  4X9N A;  2XYO A;  4AT2 A;  4HCL A;  3GWD A;  1FEA A;  1DOD A;  2GGE A;  1BWC A;  4N9X A;  2BK4 A;  3V5F A;  2B7R A;  4CRT A;  4YSH A;  1WYG A;  3UTF A;  1P2H A;  1VQZ A;  3Q9T A;  4A99 A;  1BQG A;  4H4R A;  3SJN A;  1QJD A;  4U2L A;  5U63 A;  3UJE A;  4IP5 A;  3CT2 A;  2R4E A;  1JNR A;  4FK1 C;  4GDP A;  4Z2U A;  3GDN A;  3CMM A;  2GF3 A;  4GME A;  2QGY A;  4H83 A;  3DFH A;  3R0U A;  3UJR A;  2HXU A;  3UCC A;  3TJ4 A;  4HCD A;  2PP3 A;  4A6G A;  1L9D A;  3NYE A;  2DKH A;  2PTX A;  2C64 A;  1CC6 A;  2WOV A;  1KFY A;  1P2E A;  1M64 A;  2YVF A;  3S61 A;  4FX9 A;  4REK A;  3UTE A;  3IHG A;  1PXA A;  4A65 A;  1YEY A;  2CHR A;  3NIX A;  4Z2R A;  2RGH A;  1VDV A;  4OCG A;  3HW2 A;  2PPG A;  3AEF A;  1PBC A;  3ATR A;  1GRB A;  4H4S A;  5KMQ A;  3FBS A;  1MDL A;  3F8P A;  3TOY A; 
#chains in the Genus database with same CATH homology
 3VR9 A;  3D9X A;  4ICY A;  1LTX R;  1NDA A;  3DME A;  1CF3 A;  1JRY A;  2GR3 A;  4GDE A;  1PBE A;  2XLS A;  3ALM A;  3NTA A;  3UKA A;  2YG5 A;  5BRT A;  2BAC A;  1QO8 A;  1GRT A;  3GSI A;  3ALL A;  1F8R A;  4H4V A;  4H7U A;  3I6D A;  4B63 A;  2WP6 A;  4EM3 A;  2WOW A;  3GD4 A;  3AE1 A;  1DXL A;  3AD8 B;  4FK1 A;  3G5S A;  1VG9 A;  1ZOV A;  4NTE A;  1JRZ A;  3NN6 X;  2C73 A;  3UTG A;  3QFB A;  4A7A A;  3RNM A;  1NHQ A;  2AR8 A;  2B76 A;  1KSU A;  5IQ4 A;  5GSN A;  5IPY A;  1K0I A;  1CBO A;  1PDH A;  1IJH A;  2XLR A;  4H4P A;  4AOX A;  1V59 A;  2FBW A;  3AE3 A;  4G6H A;  5J7X A;  3UOV A;  4FDC B;  5EBK A;  2YM1 A;  3FPZ A;  3S5W A;  2IVD A;  3AYJ A;  1Y56 B;  1GT8 A;  2WS3 A;  4WX1 A;  4A79 A;  1DOE A;  2W0H A;  2XLU A;  1YQ3 A;  3UTH A;  4DGK A;  3BI4 A;  1IUS A;  3AED A;  4D04 A;  3UKF A;  3CPI G;  3UKP A;  3AEE A;  2A89 A;  1D4D A;  1TYT A;  1FCD A;  3BHK A;  2XVE A;  3C4N A;  3CND A;  3K7Q X;  2Z5X A;  3AYI A;  3KD9 A;  2QAE A;  2VQ7 A;  1YY5 A;  3CN8 A;  4H4T A;  3G5R A;  4K2X A;  4U8O A;  4ZCC A;  4YT0 A;  4EM4 A;  3DH9 A;  1TDN A;  4U8J A;  3ABV A;  5CQF A;  5M0Z A;  4XXG A;  4IVO B;  2FJE A;  3UOY A;  3DJD A;  2CVJ A;  2OAL A;  3RP7 A;  3UKK A;  3ZDN A;  5KVH A;  4J2W A;  3ATQ A;  4P9S A;  3T2K A;  4C77 A;  3HYV A;  4PAB A;  1PBD A;  1OJT A;  4U8N A;  5HHF A;  2JK6 A;  4ECH A;  1F3P A;  4APN A;  1O95 A;  4TM1 A;  4H4U A;  2VQB A;  3WE0 A;  5KOX A;  5BVA A;  1XDI A;  3II4 A;  2YVG A;  1CL0 A;  3AE4 A;  3LOV A;  4H2Q A;  1N4V A;  4UP3 A;  4AP3 A;  1ZKQ A;  2FJA A;  1NEN A;  2FJB A;  2JB1 A;  3K30 A;  2FJD A;  3NNE A;  3T2Z A;  5KRQ A;  2WU5 A;  1DNC A;  1K0J A;  1Y0P A;  1GAL A;  2BS4 A;  2XFN A;  3GRS A;  2C67 A;  3RHA A;  4CCQ A;  1B5Q A;  1NHP A;  5BUK A;  3LAD A;  1EBD A;  1Q1R A;  4G74 A;  4IA5 A;  4CBQ A;  2OA1 A;  2Q0K A;  4TLX A;  4Y4N A;  2C75 A;  2JBV A;  4OPD A;  3ICS A;  4OPL A;  4Z24 A;  4Z26 A;  3GMC A;  3P4Q A;  1LPF A;  1MO9 A;  2GVC A;  2R0P A;  2UZZ A;  3KVE A;  2JKC A;  1BKW A;  4IVM B;  3LZX A;  1KF6 A;  4U2T A;  4A9W A;  2YQU A;  3UCL A;  2YM2 A;  3AXB A;  4EQX A;  1ELI A;  1O94 A;  2O9Z A;  1LQT A;  3AD9 B;  3AEB A;  2H89 A;  4U8L A;  3KKJ A;  4YTP A;  2WDQ A;  3P4S A;  4B67 A;  4TM4 A;  3PS9 A;  3UKL A;  3SY4 A;  4K7Z A;  4J56 A;  5HY5 A;  3K7T A;  1GER A;  1GTH A;  4AP1 A;  4RSL A;  3SZC A;  4YTN A;  2XVH A;  3AEG A;  3D8X A;  3C96 A;  4ZCD A;  3ADA B;  1TYP A;  4GCM A;  4PAA A;  3T0K A;  4UDR A;  2E5V A;  1FL2 A;  4YWO A;  4CY8 A;  3CTY A;  2X8H A;  3Q6J A;  3QSE A;  4JY3 A;  4JQ9 A;  1VQW A;  2WHD A;  2Y6R A;  3ISH A;  4Y4L A;  4J57 A;  1BF3 A;  2XLP A;  2IID A;  2R4J A;  3B6D A;  1GRF A;  2WBA A;  3EAN A;  2VRM A;  3NH3 X;  4BJY A;  1D7Y A;  1GXF A;  3KU9 A;  3NG7 X;  4I58 A;  1PXC A;  1BGN A;  1XAN A;  4H2N A;  4X4J A;  4Y4M A;  2E1M A;  3IF9 A;  5EOW A;  2E4G A;  4RG4 A;  3SFE A;  1L0V A;  1S2Y A;  5KVI A;  3FIM B;  3D1C A;  4KX6 A;  2C65 A;  3VRB A;  4B65 A;  2X8C A;  3FMW A;  4G6G A;  2BCP A;  2C3C A;  3ITJ A;  1EL8 A;  2WQY A;  4NEW A;  3NHO X;  3P4R A;  1NHR A;  4HA6 A;  3VRA A;  4BK2 A;  1F8W A;  4OPG A;  3NGC X;  2YAU A;  1KNR A;  3P4P A;  2OLO A;  2YG3 A;  3B3R A;  3G5Q A;  2GRT A;  1PJ5 A;  2ACZ A;  2YR5 A;  4U8I A;  2B9W A;  3CGB A;  1LVL A;  2C4C A;  1F6M A;  2VOU A;  4YSZ A;  3M0O A;  3DK9 A;  2BAB A;  5KOW A;  2EQ9 A;  1YQ4 A;  5FMH A;  4GAV A;  3H8I A;  4D03 A;  1REO A;  4OPI A;  3SFD A;  1S3B A;  4EIQ A;  3CGC A;  3V3O A;  5FS9 A;  1PJ6 A;  1DOC A;  1PJ7 A;  3NK2 X;  2X8G A;  1S2Q A;  2V60 A;  2YR4 A;  3SQP A;  2XFU A;  3SM8 A;  3EAO A;  4X9M A;  1EL9 A;  2WES A;  4A5L A;  1IUX A;  1NHS A;  3VRD B;  4BK1 A;  4BK3 A;  5U1O A;  1RYI A;  1SEZ A;  4TM0 A;  4H4Z A;  2XCG A;  3AD7 B;  4TLZ A;  3SGL A;  3GWF A;  2C3D A;  4H50 A;  3SZW A;  1FEB A;  3NT6 A;  3PVC A;  3GYJ A;  1H82 A;  4NZH A;  4DNA A;  1BZL A;  5JCL A;  2TPR A;  1H83 A;  3QSS A;  3NYC A;  4OPU A;  4YSY A;  4K22 A;  4IV9 A;  4GAP A;  1NEK A;  4C3X A;  2J3N A;  1N4W A;  3COX A;  4NNJ A;  2GR2 A;  2GAG B;  2BS3 A;  2NVK X;  4G73 A;  4U8K A;  2DKI A;  3V3N A;  1E1N A;  1CC4 A;  1K4Q A;  5FS8 A;  4KPR A;  3LJP A;  4OPT A;  4B1B A;  2Q0L A;  1OJ9 A;  2BYB A;  1N1P A;  2Z5Y A;  4USQ A;  1JEH A;  1M6I A;  4GRT A;  2RGO A;  3DJE A;  4NTD A;  3AEC A;  1E1L A;  4Z25 A;  4YXD A;  4O5Q A;  1GRE A;  1W4X A;  3DK4 A;  1AOG A;  1X31 B;  2C72 A;  2C76 A;  2Q6U A;  1D5T A;  2YLS A;  3AWI A;  1GES A;  4G9K A;  4USR A;  5M10 A;  3CNP A;  2GV8 A;  1VRQ B;  4J31 A;  4EMJ A;  5KNL A;  1E7P A;  3NYF A;  1S3E A;  2C66 A;  2B9X A;  3IC9 A;  2BA9 A;  3CIR A;  4LA1 A;  3CNJ A;  2PHH A;  2JAE A;  1XHC A;  4RG3 A;  4LU6 A;  4NWZ A;  4DSG A;  2WDV A;  5TR3 A;  1IUW A;  1ZMC A;  4H4Q A;  1D4C A;  4I59 A;  1IUV A;  4NTC A;  5J60 A;  3M12 A;  2YR6 A;  1NPX A;  2GH5 A;  5KWF A;  3DK8 A;  2VVL G;  1PHH A;  1MOK A;  1GTE A;  1MXT A;  5BUL A;  2XDO A;  1Z6L A;  1CJ2 A;  5FS6 A;  3CPJ G;  3GD3 A;  1DJQ A;  1N4U A;  1FOH A;  5U25 A;  1H84 A;  4GR1 A;  1GEU A;  3I3L A;  2C70 A;  3AE8 A;  3GRT A;  2RGJ A;  4H2R A;  1PS9 A;  3QJ4 A;  3NN0 X;  1H2I A;  3ICR A;  3NLC A;  1JU2 A;  3CGE A;  1GPE A;  3DJJ A;  5ER0 A;  2V3A A;  4EQR A;  3UKQ A;  1B4V A;  1ONF A;  1B37 A;  3UP4 A;  1ZDL A;  1TDF A;  4BV6 A;  1O5W A;  1VDC A;  1KSS A;  4H2P A;  3AE2 A;  4OVI A;  1GET A;  2WPE A;  3DGZ A;  5CKU A;  2YG4 A;  2EQ8 A;  1CJ4 A;  3KA7 A;  3L8K A;  1DOB A;  2CUL A;  3KPF A;  4HB9 A;  1NG4 A;  4MJW A;  2OLN A;  1K0L A;  3DGH A;  1JRX A;  4J33 A;  4AT0 A;  1LQU A;  3CNT A;  2I0Z A;  1YKJ A;  5C2T A;  3NTD A;  4JNQ A;  2R0G A;  3AEA A;  1ZK7 A;  2GMJ A;  3GDP A;  2WP5 A;  1PBF A;  3RP8 A;  1ZOY A;  2YLT A;  2BS2 A;  4K5R A;  2F5Z A;  2NPX A;  1XPQ A;  4LII A;  3AB1 A;  2ZZB A;  2ZBW A;  3RP6 A;  2PYX A;  1CC2 A;  1D7L A;  3ALJ A;  4B64 A;  3T31 A;  3RED A;  1F8S A;  1RSG A;  3PG6 A;  5HYM A;  3NK0 X;  3QVR A;  4K8D A;  3SXI A;  1JOA A;  2WU2 A;  5KMP A;  3QFA A;  1IUU A;  2JB3 A;  4UDP A;  1FEC A;  2X3N A;  3NRN A;  4H4Y A;  5IQ1 A;  4XWZ A;  1NAA A;  2Q7V A;  2QCU A;  5JCN A;  1D4E A;  3AE5 A;  1PN0 A;  3JSK A;  4YKG A;  3DJG X;  2WP9 A;  1GRH A;  1E6E A;  2H88 A;  2V6O A;  1EL5 A;  4H4X A;  1GSN A;  2A8X A;  4GF7 A;  4XWR A;  2YLW A;  2EQ6 A;  2AQJ A;  3EPT A;  1GND A;  3NKS A;  1KNP A;  3UP5 A;  2BCG G;  3M13 A;  4M52 A;  2WET A;  2XVJ A;  3CGD A;  1ZMD A;  3KLJ A;  4II2 A;  1TDK A;  3T14 A;  1VG0 A;  5KMR A;  4E0V A;  4EMW A;  2XLT A;  2AAQ A;  1OJD A;  3PO7 A;  2VRL A;  2YG6 A;  4YKF A;  2GQW A;  2XVI A;  2VVM A;  2ZZ0 A;  1GRG A;  4EQW A;  4AOS A;  2ARD A;  3GYI A;  3GYX A;  3R9U A;  2GMH A;  2WPC A;  2YLZ A;  2XFQ A;  1TDE A;  3AYL A;  3SZ0 A;  3IWA A;  2QA2 A;  1ZX9 A;  1KN0 A;  1E39 A;  2XFP A;  3UOZ A;  3F8D A;  2CFY A;  4EQS A;  4C74 A;  5KXJ A;  5EB4 A;  3SYI A;  5GRT A;  2GQF A;  4X9N A;  4ADW A;  3AE6 A;  2XYO A;  2YLX A;  4AT2 A;  2BK3 A;  4OPC A;  3GWD A;  1FEA A;  1DOD A;  3KPK A;  1BWC A;  3BNM A;  3HZL A;  4N9X A;  2BK4 A;  3L1R A;  2V3B A;  1LV0 A;  5L46 A;  2BC0 A;  3LB8 A;  2QA1 A;  2B7R A;  2XVF A;  4CRT A;  1B8S A;  2ZZC A;  1KDG A;  4YSH A;  1IUT A;  3BI2 A;  3OZ2 A;  4JN9 A;  2BRY A;  4JNA A;  5EB5 A;  3NK1 X;  3UTF A;  2X99 A;  3HYX A;  5JCK A;  4B66 A;  4C3Y A;  3F8R A;  3E1T A;  4IA6 A;  1P2H A;  4CY6 A;  2IVE A;  3P9U A;  4J34 A;  3LZW A;  3Q9T A;  4U8M A;  4A99 A;  3AE7 A;  4H4R A;  3H4K A;  2CDU A;  1S7M A;  4UDQ A;  1QJD A;  1NG3 A;  4U2L A;  2GAH B;  5U63 A;  3DA1 A;  3T2Y A;  2GR0 A;  3L5O A;  1GOS A;  2HQM A;  4EMI A;  4J36 A;  2R4E A;  4TM3 A;  1JNR A;  4FK1 C;  2BK5 A;  2V5Z A;  4NEV A;  4GDP A;  4K5S A;  3GDN A;  4Z2U A;  1RP0 A;  5DBJ A;  2GR1 A;  4O5U A;  2C7G A;  1JNZ A;  2GF3 A;  3CMM A;  3H8L A;  4U8P A;  1TRB A;  4A6N A;  2EQ7 A;  3EF6 A;  5C3J A;  1HYU A;  5JCI A;  1CJ3 A;  3SZF A;  2A87 A;  2B9Y A;  2BRA A;  2WOI A;  3HYW A;  2XFO A;  1H7W A;  1UKV G;  1E1M A;  1L9D A;  4CNJ A;  1YQZ A;  2APG A;  3NYE A;  1EL7 A;  2DKH A;  3VQR A;  1E1K A;  4JDR A;  3K7M X;  2YWL A;  2C64 A;  1CC6 A;  2BXS A;  1QLB A;  1L9E A;  1PBB A;  3QSM A;  2WOV A;  3VR8 A;  3BI5 A;  1TDO A;  1KFY A;  1P2E A;  1M64 A;  4YTM A;  4YSX A;  5KMS A;  1OJA A;  4WCT A;  2YVF A;  3UOX A;  4B69 A;  4B68 A;  3S61 A;  4FX9 A;  1H6V A;  2VVL A;  3OC4 A;  4REK A;  3UTE A;  5FS7 A;  1CJC A;  5LV9 A;  2JB2 A;  1H86 A;  2TMD A;  4BJZ A;  5JCM A;  2GB0 A;  3IHG A;  1OJC A;  2YVJ A;  1PXA A;  3C4A A;  4BUR A;  4A65 A;  2V61 A;  1Y56 A;  2WDR A;  3CPH G;  4H4W A;  3NIX A;  3QVP A;  1H81 A;  1COY A;  2GEW A;  4Z2R A;  4CCR A;  3ICT A;  1ZP0 A;  2X50 A;  1GV4 A;  2R46 A;  4C5O A;  2RGH A;  2R9Z A;  3IHM A;  1LJ1 A;  4Z2T A;  3FG2 P;  3UKH A;  2BC1 A;  3P1W A;  4OCG A;  2Y6Q A;  3AE9 A;  3T37 A;  2WEU A;  1PXB A;  3LXD A;  3AEF A;  1PBC A;  4U2S A;  4DSH A;  3ATR A;  2WPF A;  2YLR A;  4CNK A;  4Z43 A;  5JRB A;  1GRB A;  2R45 A;  3CNS A;  2YG7 A;  4EIP A;  4H4S A;  3BHF A;  2BXR A;  2OAM A;  5KMQ A;  4Z44 A;  1H7X A;  3FBS A;  4JY2 A;  3V76 A;  4ZN0 A;  5HXI A;  3SX6 A;  2B7S A;  2R0C A;  3ZYX A;  2VZ2 A;  3GMB A;  4GUV A;  2RAB A;  1Q9I A;  3F8P A;  1DJN A;  3O0H A;  1CHU A;  4II3 A;  1Q1W A;  3BNU A;  4A6N B;  3URH A;  1BGJ A;  1ZY8 A;  1GRA A;  1L9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...