4BV6A

Refined crystal structure of the human apoptosis inducing factor
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
Knots found
sequence length
484
structure length
471
Chain Sequence
KAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Structural Insights Into the Coenzyme Mediated Monomer-Dimer Transition of the Pro-Apoptotic Apoptosis Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 147
structure length 471
sequence length 484
other databases KnotProt 2.0: S -31
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4bv6A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4bv6A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4bv6A01
5TR3A 4WCTA 4U8OA 5HYMA 3ICTA 1JRZA 1D4DA 1PBFA 1CC6A 4HB9A 3L1RA 4H4VA 1TDOA 3KVEA 3UKHA 3GYIA 4K7ZA 1ZOYA 1E1KA 3IC9A 1ELIA 1GOSA 1MOKA 3D8XA 3ITJA 1Q9IA 4JNQA 4NTCA 4UDRA 3RP7A 3CNTA 3NYCA 2UZZA 2WU5A 4GR1A 2WPCA 1IUXA 1L9EA 3CPHG 1L0VA 3UKAA 4K22A 3V3NA 1JU2A 2WOWA 3AXBA 1Y56A 3L8KA 2BK5A 5HHFA 4BK2A 2R0PA 3PS9A 3AE1A 3F8DA 4H7UA 4ZCCA 4AOSA 4C5OA 2JBVA 1ZOVA 2QCUA 3FBSA 3SQPA 5DBJA 5FS9A 4B65A 4GUVA 3P1WA 1IUUA 2RABA 3UOYA 3NRNA 3ADAB 2GVCA 2V60A 1IUSA 2B9WA 2GB0A 4YKGA 2YQUA 2XFQA 1TYPA 3VQRA 2GR0A 1JEHA 1DNCA 4U8PA 3FPZA 1LJ1A 2XFPA 4PABA 1IJHA 2YG6A 3UCLA 2BYBA 4B68A 3OC4A 1TDNA 4LA1A 2BACA 4DSHA 1GNDA 3NT6A 3QSSA 3P4QA 3AE8A 2WP9A 2C73A 5U63A 3UKLA 3QSMA 2YM2A 2BCPA 1RP0A 4K5SA 1CJ4A 3I6DA 5HXIA 1COYA 1ZMDA 1IUWA 2C7GA 4NEWA 4EQRA 1EL7A 3AE3A 3SFEA 1CC2A 1H7XA 2YLZA 3V3OA 4C74A 1PJ7A 3AD8B 1S3BA 3SM8A 4U8KA 1DXLA 2GMJA 2QA2A 3I3LA 2GV8A 1OJDA 2VRMA 3GRTA 3DJDA 3EPTA 1QO8A 3NKSA 3QVPA 4BV6A 4AT0A 1FOHA 1NG3A 2ZZBA 3JSKA 4OPDA 1FCDA 4EQXA 4OPCA 2FJEA 2C3DA 2GR3A 5FS8A 2B9XA 2R4EA 2OLOA 1GTHA 4FK1A 1F8SA 1PJ5A 3SFDA 3BHFA 4ZN0A 2Q0KA 2R46A 4BJZA 4D03A 4EQSA 4CY6A 3ZYXA 4X9NA 2ZZ0A 4Y4NA 1LQTA 4MJWA 1K4QA 4JQ9A 2ZZCA 3GD3A 2PYXA 3KKJA 3Q9TA 2R9ZA 1VRQB 2C66A 2XCGA 4H2NA 4OPGA 3GWDA 4U8JA 4CRTA 1F3PA 5BVAA 2IVEA 2X99A 5ER0A 5BUKA 3NYEA 2V6OA 5GSNA 3QVRA 1CF3A 2O9ZA 1N4UA 2V61A 2V5ZA 4A5LA 2BA9A 1F8RA 1F6MA 4GF7A 5JCLA 2HQMA 4TM1A 4J33A 4CNJA 3NG7X 2ACZA 1E1LA 2GH5A 2XLRA 3GMCA 1ZX9A 4EM3A 3RNMA 2GQWA 2J3NA 1NEKA 4USRA 2ARDA 3H8LA 1D4CA 4REKA 5HY5A 4A79A 1OJCA 3ATRA 3NTDA 4TLXA 3WE0A 1PHHA 1FEBA 1VQWA 4A6NB 3IF9A 3IHMA 4YTNA 4J31A 2R0CA 1D4EA 2PHHA 3GMBA 3ABVA 2FJAA 3ATQA 2EQ9A 2GRTA 1N1PA 4O5UA 1GRTA 4BURA 1S3EA 3FIMB 2AQJA 2YWLA 1BZLA 1LVLA 2OLNA 4XXGA 4U8IA 4J57A 2YVJA 1TDKA 4DSGA 1ZP0A 1YKJA 3P4RA 1REOA 1OJAA 1Q1WA 2FJDA 1PBBA 2WU2A 2XYOA 2YG3A 2BC0A 3LOVA 4NTEA 1Y56B 2Q7VA 3H8IA 1PBDA 3RHAA 1BGNA 2CVJA 3CNDA 2WEUA 3GDPA 1H7WA 3AYLA 3AE6A 3K7MX 2X8CA 4C77A 4C3YA 1GT8A 2BC1A 2WDQA 4KX6A 2WBAA 1OJTA 3AE7A 3II4A 5JCIA 1PS9A 1H81A 2TMDA 2WP5A 4Z2UA 3CPJG 5BRTA 1EL9A 2X8GA 2XFUA 3G5SA 1GRAA 4A99A 1XPQA 2WETA 4J36A 3S5WA 3QFAA 2JAEA 5J7XA 3M13A 3UKQA 3UOVA 3NGCX 3SGLA 2XVEA 1KSUA 4OPLA 4YSHA 2YG5A 1LV0A 1B8SA 2DKHA 2NVKX 1OJ9A 4Z26A 3FG2P 3C96A 3NIXA 4K5RA 3R9UA 3K30A 3UP5A 1ZK7A 3KLJA 1DOBA 4H4XA 4FK1C 4YT0A 1JNZA 3GSIA 2B7RA 1LTXR 3ALJA 1FL2A 3PVCA 3AYJA 1E7PA 2WP6A 1GSNA 2RGOA 3B6DA 4P9SA 4ADWA 3UP4A 4U8MA 3CGEA 2C67A 1E39A 2OALA 4DGKA 4NEVA 1GV4A 3K7TA 1LQUA 1LPFA 3CPIG 1KDGA 1Z6LA 2YG4A 4C3XA 4X4JA 3UTFA 3NK0X 3AD9B 1H84A 2VQ7A 2XVHA 2Y6RA 4YTPA 3AECA 1GPEA 3DMEA 1E6EA 4A9WA 4RG4A 3BHKA 3VR8A 3P9UA 1GREA 4H2PA 2C64A 3BI5A 2EQ8A 2YR5A 5EB4A 3BI2A 1NDAA 1D7YA 2R4JA 2VZ2A 4B64A 1H83A 4CBQA 2X3NA 2XLSA 3QFBA 3UTEA 1GXFA 4JDRA 4EIPA 2OAMA 2JK6A 1X31B 3CNJA 4Z43A 2A87A 1VDCA 1Y0PA 4FDCB 2DKIA 4KPRA 1B5QA 3NNEA 3ZDNA 2JB3A 3NTAA 3GDNA 1B4VA 2NPXA 2XFNA 2H89A 3S61A 4Z2TA 4HA6A 2GQFA 4E0VA 4K2XA 2ZBWA 2XVJA 2VOUA 3AE2A 1GETA 2X50A 1D7LA 2GMHA 4ICYA 4DNAA 4I59A 5C2TA 1CHUA 1KF6A 2EQ7A 5JCNA 3ISHA 3EAOA 1JRYA 1L9DA 2YVFA 5KWFA 3AE4A 3CIRA 1K0JA 4BJYA 3QJ4A 4IA6A 1YY5A 5L46A 2H88A 2WQYA 1NHSA 1HYUA 2WDVA 2WS3A 4U2TA 2GF3A 4BK3A 3NH3X 4I58A 1B37A 1GRHA 1EL5A 1PBCA 4APNA 1P2HA 2WESA 3REDA 2E1MA 4JNAA 4Z24A 3LZXA 4H50A 4UP3A 2YLRA 4OPUA 2TPRA 3AE5A 2RGJA 3COXA 4N9XA 1FECA 2A89A 4IVOB 2YM1A 2GR2A 4OPIA 4A65A 3T37A 4EM4A 4EMIA 4XWZA 4Z25A 1ZDLA 2C3CA 2C65A 2VQBA 2GR1A 2XDOA 4M52A 4H2RA 1FEAA 1GRBA 3AB1A 3D1CA 3ICRA 3VRBA 3EF6A 4AOXA 5BULA 4OVIA 1GEUA 3C4NA 1JOAA 3LZWA 1NAAA 1VG0A 2C76A 3UKFA 4YXDA 4YSYA 1E1MA 1DODA 4OPTA 1GERA 3BI4A 3DGZA 3RP6A 4H4WA 3NN0X 2YLXA 3DK9A 4H4UA 3F8PA 1V59A 5KXJA 4H4ZA 2V3AA 4IA5A 4GDEA 1PN0A 4H4RA 3P4PA 2R45A 4USQA 3H4KA 1GALA 4H4TA 5EBKA 3C4AA 4B69A 1EBDA 1NG4A 1BWCA 4U2LA 1N4WA 3B3RA 1KFYA 3DJJA 2BS2A 3UOZA 3CGBA 1RSGA 3AEDA 3VR9A 4H2QA 2E4GA 2FJBA 3OZ2A 4CY8A 1F8WA 1H6VA 2VVLA 2WPFA 2B7SA 3CGDA 1DOCA 4GDPA 5GRTA 1PBEA 2JB1A 5KOWA 4GRTA 2CULA 4H4SA 2BK4A 1CJ2A 3NLCA 3QSEA 2Q6UA 2F5ZA 3HZLA 1CJCA 1K0LA 4OCGA 2Z5XA 1SEZA 2C72A 2GAHB 5FS6A 2YR4A 3G5RA 3AD7B 3VRDB 2XLPA 4AP3A 2Y6QA 4FX9A 3KPFA 4ECHA 5IQ1A 3EANA 2EQ6A 1KNRA 4ZCDA 4LIIA 4D04A 3CGCA 3DA1A 5EOWA 5KOXA 1PXAA 5FMHA 2WOVA 2WDRA 3NHOX 1CBOA 4B1BA 1QJDA 2FBWA 1H82A 5FS7A 1EL8A 2BS4A 2C75A 4BK1A 3DK8A 5KVHA 4YKFA 2YAUA 1M6IA 3BNMA 1L9CA 3F8RA 5IQ4A 5J60A 2Z5YA 3GWFA 2YLWA 3DJEA 5JCKA 5EB5A 2W0HA 2JB2A 1GRFA 3AE9A 2XLUA 2APGA 1TYTA 1PXCA 1S2YA 2A8XA 1CL0A 4AP1A 1PJ6A 4CCQA 1BGJA 1BKWA 3ALLA 4YSXA 3LB8A 1O94A 3UOXA 3M12A 2YVGA 2B9YA 1GRGA 1JRXA 3E1TA 4TM0A 4J2WA 2B76A 1CC4A 4UDPA 3AEGA 2YR6A 4TM3A 2RGHA 4H4QA 2IVDA 1NENA 2GAGB 3AEBA 3VRAA 1BF3A 1GTEA 2BXSA 4Y4LA 5C3JA 2BS3A 2CFYA 3CNSA 4TM4A 1TDEA 2BXRA 4TLZA 3ALMA 2X8HA 1KNPA 1NHRA 4RSLA 4EMJA 1VG9A 2I0ZA 4NZHA 4B66A 1K0IA 4B63A 3UTGA 3IWAA 1ZY8A 3Q6JA 1TDFA 4X9MA 1P2EA 4YTMA 1MXTA 3G5QA 3V76A 3AYIA 2R0GA 1QLBA 3AEFA 3NK1X 2VRLA 1XHCA 3NK2X 4IV9A 3LXDA 3PO7A 2AAQA 4NTDA 4YWOA 1IUTA 5KRQA 1ONFA 4GCMA 4O5QA 4EMWA 2GEWA 2QAEA 3DH9A 1UKVG 3GD4A 3KA7A 4JN9A 2BK3A 2WOIA 4K8DA 1PDHA 3URHA 2XVIA 3ICSA 4JY2A 3CNPA 1GESA 3DGHA 2YLTA 2AR8A 1ZMCA 4U8LA 3GYJA 5KVIA 2YLSA 1H86A 3GRSA 5U1OA 4LU6A 4YSZA 1ZKQA 4EIQA 3AWIA 4AT2A 3LADA 1YQZA 2Q0LA 1NHPA 2QA1A 3NYFA 4CNKA 4A7AA 1Q1RA 1KSSA 1O95A 4JY3A 1NHQA 1W4XA 1M64A 3RP8A 3FMWA 5U25A 3CTYA 1D5TA 3K7QX 1S2QA 2VVMA 1AOGA 1JNRA 4UDQA 3UKPA 2E5VA 3M0OA 2WPEA 2JKCA 2YG7A 2XLTA 4EQWA 3AEAA 4B67A 5JCMA 2VVLG 1E1NA 4Z2RA 4H4YA 2XVFA 1YQ4A 5CQFA 2V3BA 3IHGA 3KD9A 1N4VA 4WX1A 3UTHA 1MO9A 1DJQA 4H4PA 2WHDA 4Z44A 3P4SA 5LV9A 1YQ3A 2XFOA 4CCRA 3CN8A 3DK4A 3BNUA 3UKKA 4U2SA 1CJ3A 4Y4MA 3KU9A 5IPYA 3DJGX 3O0HA 1PXBA 2BABA 4RG3A 2OA1A 3NN6X 1TRBA 3LJPA 1DOEA 1XANA 1XDIA 5M0ZA 5CKUA 2IIDA 1RYIA 4J56A 1DJNA 1NPXA 4XWRA 2CDUA 4IVMB 1IUVA 4U8NA 5M10A 1O5WA 2C70A 3AEEA 4A6NA 4PAAA 2BCGG 4J34A
chains in the Genus database with same CATH superfamily
5TR3A 4WCTA 5HYMA 1D4DA 1FFUC 1KKOA 4H4VA 1TDOA 3UKHA 4K7ZA 3ITJA 3RGTA 4GR1A 3AXBA 1Y56A 4BK2A 4H7UA 4AOSA 2JBVA 3FBSA 5DBJA 3P1WA 2RABA 2PP0A 4KWSA 3ADAB 2GVCA 4YKGA 2YQUA 3VC6A 2XFQA 2GR0A 1JEHA 3FPZA 1LJ1A 2XFPA 2YG6A 2BYBA 4B68A 2XGZA 3NT6A 2PP1A 4HN8A 2C73A 1RP0A 1COYA 1ZMDA 1IUWA 4NEWA 4EQRA 1CC2A 3ZLHA 2QA2A 3DJDA 3EPTA 3QVPA 4BV6A 2OVLA 2P8BA 5BOEA 1VQZA 2C3DA 2GR3A 3H12A 2B9XA 2R4EA 2OLOA 3I6EA 4D03A 4EQSA 4IP5A 4MJWA 3KKJA 3Q9TA 4OPGA 3S47A 4DXKA 4CRTA 5BVAA 5ER0A 1FFVC 5BUKA 3NYEA 2QQ6A 5GSNA 3ZLGA 1CF3A 2O9ZA 3P0WA 2GH5A 3ZLFA 2GQWA 2J3NA 3H8LA 1D4CA 2PU1A 5HY5A 3KUMA 3PFRA 4TLXA 4J1OA 3IF9A 3SN1A 3D47A 2DW6A 3SBFA 3GMBA 3ABVA 2GRTA 1W6TA 2YWLA 1LVLA 4II3A 3MY9A 5FJTA 3CXBA 3UGVA 1REOA 1BGNA 3CNDA 3AE6A 2X8CA 2BC1A 4KX6A 3AE7A 5BRTA 3G5SA 4A99A 3NGCX 3UCCA 4YSHA 2DKHA 2HXTA 3NIXA 3UP5A 3IJQA 3ZVHB 1ZK7A 4ENLA 3GSIA 3T2ZA 1FL2A 2RGOA 4HPNA 4P9SA 4ADWA 4U8MA 2OALA 3UTFA 3NK0X 1N5XA 1H84A 4RG4A 4NNJA 3BHKA 3BJSA 3T2KA 4G8TA 4CBQA 1NDAA 1D7YA 1N60C 1WUEA 3UTEA 2OAMA 1X31B 4Z43A 1Y0PA 4FDCB 4KPRA 1B5QA 2JB3A 4GYPC 4HA6A 2XVJA 2VOUA 2X50A 3EEZA 1CHUA 2EQ7A 5JCNA 3CIRA 2W3SA 4IA6A 1YY5A 5L46A 1NHSA 2GF3A 5KMPA 4H50A 2GGIA 4UP3A 2YLRA 3AE5A 3GY1A 3CMMA 3HW2A 2GR2A 1ZDLA 2XDOA 1FEAA 1GRBA 3EF6A 4AOXA 3C4NA 3FV9A 1GERA 2GGGA 3RP6A 4H4UA 1P43A 4GDEA 1KCZA 4A6GA 3P4PA 2R45A 4H4TA 3VC5A 3C4AA 3QKEA 1N4WA 3DJJA 2BS2A 3UOZA 3AEDA 4H2QA 4A35A 2WPFA 1TKKA 1DOCA 5KOWA 5KNLA 3T8QA 3QPEA 3SZFA 1FIQB 1K0LA 1SEZA 2GAHB 5FS6A 3VFCA 2YR4A 4HCDA 4E6MA 3V5CA 3KPFA 5IQ1A 3D46A 3EANA 3CGCA 5EOWA 2WOVA 4HYRA 1CBOA 4BK1A 5KVHA 2YAUA 3F8RA 3GWFA 3DJEA 5EB5A 3TOYA 1SJDA 2P3ZA 3RITA 3AE9A 1S2YA 3NXLA 3H8AA 4YSXA 1BKWA 2OPJA 3LB8A 3M12A 1JRXA 3E1TA 4TM0A 1CC4A 2OQYA 2YR6A 2RGHA 2POZA 2QJMA 1GTEA 2BXSA 5C3JA 3OTRA 1XPYA 3ALMA 1KNPA 1VG9A 2FYMA 4NZHA 1K0IA 3IWAA 3Q6JA 5FJOA 4X9MA 6ENLA 3ENLA 3AYIA 1QLBA 2VRLA 1XHCA 3STPA 4NTDA 1IUTA 1ONFA 2W55A 3TW9A 4EMWA 3EUB3 4JN9A 2WOIA 1PDHA 4BJYA 3URHA 4U8LA 2GDQA 3CNPA 2AR8A 1FO4A 4GAPA 3GRSA 5U1OA 4YSZA 3H70A 1ZKQA 3AWIA 4AT2A 1JPMA 1RM6B 1W4XA 3FMWA 3K7QX 3DG6A 2VVMA 3UKPA 1NU5A 4WX1A 1N4VA 4H4PA 1YQ3A 4CCRA 3VCNA 4HNCA 3DJGX 2HNEA 1H2IA 3O0HA 2OA1A 3V4BA 1TRBA 3LJPA 1XANA 2DW7A 5M0ZA 5CKUA 3JVAA 1DJNA 3HYWA 1O5WA 4A6NA 4KEMA 3OZMA 3ICTA 3HYXA 1JRZA 3NS1B 3L1RA 3KVEA 3SZCA 2OX4A 1E1KA 1GOSA 3D8XA 1Q9IA 4JNQA 4UDRA 3NYCA 2MUCA 5FJUA 3V3NA 2HZGA 2WOWA 2BK5A 3PS9A 3F8DA 4ZCCA 2OZTA 3SQPA 5FS9A 2GGHA 1IUUA 2QJJA 1IUSA 2B9WA 4U8PA 4DN1A 1MDRA 3SR6B 4FP1A 1ECQA 2BACA 1GNDA 2PS2A 4EWJA 1XS2A 3I6DA 1EL7A 3AE3A 1H7XA 2YLZA 5KMSA 3I3LA 2GV8A 2XH4A 2OZ3A 1ELSA 3T9PA 1NG3A 2ZZBA 4EQXA 3A7RA 1PJ5A 3SFDA 3BHFA 2QDEA 4ZA0A 3ZYXA 4X9NA 2ZZ0A 4FI4A 4JQ9A 2ZZCA 3B97A 3DG3A 4JN7A 2PYXA 1EC9A 2XCGA 2IVEA 2V5ZA 2BA9A 5KMRA 4GF7A 5JCLA 4TM1A 3NG7X 3GMCA 2XSXA 3RNMA 4IP4A 4REKA 3NTDA 3CXOA 1FEBA 1EC7A 3R25A 3PWIA 2FJAA 3TJIA 1N1PA 4O5UA 1GRTA 2XH7A 2AQJA 1BZLA 4XXGA 2RDXA 4U8IA 2YVJA 1TDKA 2PSNA 1PBBA 2YG3A 2BC0A 3GC2A 1Y56B 3PG6A 2CVJA 3GDPA 1H7WA 1R6WA 3RCYA 5JCIA 2WP5A 2PP3A 1GRAA 1XPQA 3S5WA 5G5GB 3QFAA 3M13A 4IL0A 1KSUA 3IJIA 1LV0A 3QTPA 1EBHA 3R9UA 3K30A 1SJAA 3DESA 4YT0A 3ALJA 3PVCA 3I4KA 3AYJA 3NVYB 1E39A 4NEVA 1GV4A 3CPIG 1PDYA 3MWCA 1Z6LA 4C3XA 4X4JA 2VQ7A 2XVHA 1WYGA 3DMEA 2GSHA 4A9WA 2PGEA 3P9UA 1GREA 2ZADA 5EB4A 4B64A 1H83A 1SB3B 2X3NA 2XLSA 1GXFA 1V97A 2DKIA 2P88A 2XFNA 1MNSA 3S61A 1P48A 1GETA 4II2A 1D7LA 1SJCA 3TWAA 3ISHA 1JRYA 3AE4A 2PTZA 1K0JA 4U2TA 4I58A 1B37A 2WESA 1PBCA 3REDA 3LZXA 3EKGA 2TPRA 4OPUA 4YWSA 2A89A 4IVOB 4OPIA 3AB1A 3D1CA 1JOAA 2C76A 3UKFA 4YXDA 3SN4A 2E5AA 1E1MA 3NN0X 4TVWA 4IA5A 2P0IA 3UXLA 3H4KA 1WUFA 5EBKA 3JZUA 4Z17A 2FJBA 4CY8A 2PPGA 2VVLA 4KPLA 1PBEA 3R0KA 4H4SA 2BK4A 2CULA 2GL5A 3NLCA 4H2HA 2Z5XA 2C72A 3G5RA 3VRDB 2XLPA 4AP3A 4FX9A 2QVHA 1YEYA 4LIIA 5FMHA 4B1BA 5J04A 5J60A 5JCKA 2W0HA 1GRFA 2XLUA 2APGA 1KD0A 2C4CA 2AL1A 3ALLA 1O94A 1GRGA 2B76A 3SQSA 3AEGA 4TM3A 4H4QA 2PTYA 1NENA 2GAGB 3AEBA 3SJNA 4Y4LA 4TLZA 3TWBA 4EMJA 3THUA 3VCCA 4TVYA 4YTMA 3G5QA 3V76A 4IV9A 3LXDA 3PO7A 2GEWA 1IYXA 3DH9A 1UKVG 4NWZA 2BK3A 4JY2A 3ICSA 3DGHA 3AMZA 3UJ2A 3GYJA 2GGEA 4GAVA 2YLSA 1EC8A 1N63C 2OLAA 2QA1A 3NYFA 4IT1A 1KSSA 4JY3A 3A7AA 1M64A 1NELA 3RP8A 3QLDA 3CTYA 1D5TA 1S2QA 1AOGA 3MKCA 2E5VA 3M0OA 2YG7A 3Q45A 4B67A 4A3RA 4H4YA 2XVFA 3KD9A 4DHGA 3UTHA 1MO9A 2WHDA 3GD6A 1E9IA 4ROPA 4Y4MA 3P93A 4RG3A 3CT2A 2W54A 2IIDA 1RYIA 4J56A 3DEQA 4IVMB 2C70A 2BCGG 5HHFA 3GYIA 1ZOYA 1ELIA 2UZZA 1L0VA 4K22A 2R0PA 3AE1A 4C5OA 1ZOVA 2OG9A 1JCTA 4KT2A 2GB0A 1TYPA 1DNCA 4MMWA 1TDNA 4G6GA 4DSHA 1X2GA 3QSSA 3P4QA 4E4FA 3UKLA 3QSMA 2YM2A 2BCPA 3NVVB 2OO6A 2C7GA 3V3OA 3SM8A 1S3BA 1DXLA 2AL2B 2E3TA 1QO8A 1FOHA 3JSKA 4OPDA 3N4FA 2AKZA 5FS8A 4ZN0A 3UJRA 3TTEA 1LQTA 4Y4NA 3GWDA 4JN8A 3B9JB 2V6OA 3QVRA 4A5LA 1F8RA 1F6MA 2HQMA 4CNJA 1E1LA 4GGBA 2XLRA 1ZX9A 3RO6A 4H83A 4USRA 2ARDA 3DIPA 4A79A 1OJCA 3JW7A 3ATRA 3WE0A 1PHHA 2QJNA 1VQWA 3R1ZA 4A6NB 3IHMA 4J31A 2R0CA 3T31A 3ATQA 2EQ9A 4IZGA 1S3EA 3FIMB 3RRAA 2OLNA 3HPFA 4HCHA 3P4RA 3ETRB 1OJAA 2WU2A 2XYOA 3LOVA 4NTEA 1TZZA 2PMQA 3H8IA 3FVDA 3RHAA 2WEUA 4C77A 1GT8A 4G73A 2PA6A 1OJTA 1PS9A 4ZCWA 1H81A 3CPJG 2XFUA 4J36A 5J7XA 3SGLA 2XVEA 2YG5A 1B8SA 1OJ9A 3C96A 2XH0A 3KLJA 1DOBA 4H4XA 4FK1C 3UP4A 3CGEA 2C67A 1LPFA 1KDGA 3AD9B 3GO2A 2Y6RA 3AECA 4YTPA 3FXGA 3CK5A 1GPEA 3VR8A 4H2PA 2C64A 3CAWA 3CNJA 1VDCA 3K1GA 1RVKA 1B4VA 2GQFA 3FYYA 3AE2A 4ICYA 4I59A 5EU9A 1KF6A 5FJPA 3EAOA 4IL2A 7ENLA 5KWFA 1ONEA 4GFIA 2H88A 2WQYA 2I5QA 2WDVA 2WS3A 2QGYA 3NH3X 1N5WC 4APNA 4Z24A 4K8GA 3COXA 4N9XA 4A65A 4XWZA 4Z25A 2C3CA 2C65A 2VQBA 4M52A 1OEPA 3T2YA 5BULA 1GEUA 3LZWA 1NAAA 1VG0A 3HYVA 4G6HA 1DODA 4OPTA 1JPDX 3DGZA 4H4WA 2YLXA 5KXJA 1V59A 2V3AA 4H4ZA 5ENLA 1KN0A 3SZWA 4USQA 1GALA 3T4WA 3IK4A 4B69A 1EBDA 4U2LA 3VR9A 2E4GA 1F8WA 1H6VA 2B7SA 3CGDA 4X2PA 4GRTA 3QSEA 3HZLA 1CJCA 4OCGA 4Z1YA 2Y6QA 3TJ4A 4ECHA 4D04A 2EQ6A 4H1ZA 4ZCDA 3DA1A 5KOXA 1PXAA 2WDRA 3NHOX 3MUCA 1QJDA 3KPKA 5FS7A 1EL8A 2BS4A 4ZOHB 3BNMA 2Z5YA 4K1WA 2YLWA 1TYTA 4AP1A 4DWDA 1PJ6A 4CCQA 3IJLA 1BGJA 2YVGA 2B9YA 3SN0A 4J2WA 4UDPA 4G74A 2OQHA 3VRAA 3R11A 1BF3A 2BS3A 2CFYA 2BXRA 2X8HA 1NHRA 3VA8A 2I0ZA 4RSLA 1ZY8A 1TDFA 1P2EA 4G9KA 3AEFA 5G5HB 5KMQA 2PU0A 4H19A 2XVIA 1GESA 2YLTA 1ZMCA 3TCSA 3MSYA 1JRPA 5KVIA 3OZYA 3R0UA 3DERA 4EIQA 3LADA 4CNKA 1R0MA 1Q1RA 1O95A 1NHQA 1JNRA 4UDQA 1DTNA 2WPEA 2JKCA 4EQWA 3PK7A 5JCMA 4Z2RA 3CYJA 3R10A 1DJQA 3P4SA 2XFOA 4E4UA 3ES7A 3DK4A 3BNUA 3UKKA 4U2SA 1CJ3A 3KU9A 3NZGA 1PXBA 2O56A 3NN6X 1JDFA 1EBGA 1XDIA 4XWRA 1IUVA 2HXUA 4J34A 4MGGA 4U8OA 3NVZB 5IDZA 1PBFA 1CC6A 4HB9A 1ZXIC 3IC9A 1MOKA 4NTCA 3RP7A 3CNTA 3SY4A 2WU5A 1TE6A 3CPHG 2WPCA 1IUXA 1L9EA 4G7FA 3UKAA 3AN1A 1MDLA 3N4EA 1JU2A 3L8KA 3UXKA 4GISA 2QCUA 4B65A 4GUVA 3UJFA 3UOYA 3NRNA 2V60A 3Q4DA 2AKMA 3SYIA 2QDDA 3VQRA 4PABA 2PODA 1IJHA 3P3BA 3UCLA 3OC4A 4LA1A 2GGJA 3TQPA 3AE8A 2WP9A 5U63A 3ZVHA 3D9XA 4K5SA 1CJ4A 3FCPA 5HXIA 3T14A 3SFEA 4C74A 3RR1A 1PJ7A 3AD8B 3MQTA 4U8KA 2GMJA 4JHMA 1OJDA 2VRMA 3GRTA 3GYXA 3NKSA 4AT0A 1FCDA 3SSZA 4OPCA 2FJEA 1GTHA 4FK1A 1F8SA 4MKSA 2Q0KA 2R46A 3UJSA 4BJZA 4CY6A 1K4QA 3T6CA 3GD3A 4U8JA 2R9ZA 1VRQB 2C66A 4H2NA 1F3PA 2X99A 1STZA 4M0XA 4GMEA 3PWGA 3S5SA 1N4UA 2PTXA 2V61A 4J33A 2ACZA 3QN3A 4EM3A 2FKPA 3DFYA 1NEKA 3OW1A 4HNLA 4YTNA 1D4EA 2PHHA 4BURA 1BQGA 4J57A 4DSGA 1ZP0A 1YKJA 1Q1WA 2FJDA 2Q7VA 1PBDA 3A7UA 3AYLA 3K7MX 4C3YA 2WDQA 2WBAA 3L5OA 3II4A 3VDGA 2TMDA 4Z2UA 1N61C 1EL9A 2X8GA 3CB3A 2WETA 2JAEA 3UKQA 3UOVA 2P8CA 3H7VA 4OPLA 2NVKX 4Z26A 3FG2P 4E8GA 4K5RA 1MUCA 4DX3A 1JNZA 2B7RA 1LTXR 1E7PA 2WP6A 1GSNA 3B6DA 3UJEA 4DGKA 3K7TA 1LQUA 2YG4A 3HRDC 2W3RA 1E6EA 2BRYA 3BI5A 2EQ8A 2YR5A 3BI2A 2R4JA 2VZ2A 4EIPA 3QFBA 4JDRA 3OPSA 2JK6A 2NQLA 2A87A 2ONEA 3NNEA 3ZDNA 3NTAA 2NPXA 2H89A 4Z2TA 4E0VA 4K2XA 2ZBWA 4GIRA 3SZ0A 2CHRA 2GMHA 4DNAA 5C2TA 3V5FA 1KKRA 2OKTA 1L9DA 3FJ4A 2YVFA 1PDZA 3QJ4A 3DGBA 1HYUA 4BK3A 1GRHA 1EL5A 1P2HA 4HCLA 2E1MA 4JNAA 4J3ZA 2AL2A 2RGJA 1FECA 2YM1A 3T37A 4EM4A 3NRZB 4EMIA 1FHUA 4E5TA 2GR1A 4H2RA 3DFHA 2ZC8A 3ICRA 3VRBA 4OVIA 2PGWA 2OFJA 3MZNA 5FJRA 4YSYA 3ZVIA 1BKHA 1JROA 3BI4A 3V3WA 4DYEA 3DG7A 3DK9A 3F8PA 1S7MA 1PN0A 2MNRA 4H4RA 1N62C 1MRAA 1NG4A 1BWCA 3B3RA 1KFYA 3CGBA 3AM9A 1RSGA 1L8PA 3OZ2A 3SX6A 4GDPA 5GRTA 2JB1A 1CJ2A 3NO1A 2Q6UA 2F5ZA 3AD7B 4IHCA 1KNRA 2FBWA 1H82A 2C75A 3DK8A 4YKFA 1M6IA 1L9CA 5IQ4A 2JB2A 1PXCA 2A8XA 1CL0A 3SXIA 2PTWA 3BOXA 3UOXA 2BRAA 3I6TA 1X2HA 3NVWB 2XH2A 2IVDA 3CNSA 4TM4A 3N6JA 1TDEA 3R07C 4B63A 4B66A 3U9IA 3UTGA 1F9CA 3T0KA 1MXTA 2R0GA 3NK1X 3NK2X 3ES8A 2AAQA 4YWOA 5KRQA 4GCMA 4O5QA 2QAEA 3KA7A 3GD4A 4K8DA 4M6UA 1H86A 4LU6A 2PCEA 2Q0LA 1YQZA 1NHPA 4A7AA 2OZ8A 3DDMA 4K2SA 5U25A 1FHVA 3U4FA 3BSMA 2XLTA 3AEAA 4GGHA 2VVLG 1E1NA 1YQ4A 5CQFA 2V3BA 3IHGA 1SJBA 4F4RA 4Z44A 5LV9A 3CN8A 3UCDA 3OP2A 4GYPA 5IPYA 1VDVA 2BABA 5BOFA 3N6HA 5JRBA 1DOEA 3NFUA 1T3QC 1NPXA 2CDUA 4U8NA 5M10A 3AEEA 4PAAA 3GDNA
chains in the Genus database with same CATH topology
5TR3A 4WCTA 4U8OA 5HYMA 3ICTA 3HYXA 1JRZA 1D4DA 1PBFA 1CC6A 4HB9A 3L1RA 4H4VA 1TDOA 3KVEA 3SZCA 3UKHA 3GYIA 4K7ZA 1ZOYA 1E1KA 3IC9A 1ELIA 1GOSA 1MOKA 3D8XA 3ITJA 1Q9IA 4JNQA 4NTCA 4UDRA 3RP7A 3CNTA 3SY4A 3NYCA 2UZZA 2WU5A 4GR1A 2WPCA 1IUXA 1L9EA 3CPHG 1L0VA 3UKAA 4K22A 3V3NA 1JU2A 2WOWA 3AXBA 1Y56A 3L8KA 2BK5A 5HHFA 4BK2A 2R0PA 3PS9A 3AE1A 3F8DA 4H7UA 4ZCCA 4AOSA 4C5OA 2JBVA 1ZOVA 2QCUA 3FBSA 3SQPA 5DBJA 5FS9A 4B65A 4GUVA 3P1WA 1IUUA 2RABA 3UOYA 3NRNA 3ADAB 2GVCA 2V60A 1IUSA 2B9WA 2GB0A 4YKGA 2YQUA 2XFQA 3SYIA 1TYPA 3VQRA 2GR0A 1JEHA 1DNCA 4U8PA 3FPZA 1LJ1A 2XFPA 4PABA 1IJHA 2YG6A 3UCLA 2BYBA 4B68A 3OC4A 1TDNA 4LA1A 4G6GA 2BACA 4DSHA 1GNDA 3NT6A 3QSSA 3P4QA 3AE8A 2WP9A 2C73A 5U63A 3UKLA 3QSMA 2YM2A 2BCPA 3D9XA 1RP0A 4K5SA 1CJ4A 3I6DA 5HXIA 1COYA 1ZMDA 1IUWA 2C7GA 3T14A 4NEWA 4EQRA 1EL7A 3AE3A 3SFEA 1CC2A 1H7XA 2YLZA 3V3OA 4C74A 1PJ7A 3AD8B 1S3BA 3SM8A 4U8KA 1DXLA 2GMJA 2QA2A 3I3LA 5KMSA 2GV8A 1OJDA 2VRMA 3GRTA 3DJDA 3EPTA 1QO8A 3GYXA 3NKSA 3QVPA 4BV6A 4AT0A 1FOHA 1NG3A 2ZZBA 3JSKA 4OPDA 1FCDA 4EQXA 4OPCA 2FJEA 2C3DA 2GR3A 5FS8A 2B9XA 2R4EA 2OLOA 1GTHA 4FK1A 1F8SA 1PJ5A 3SFDA 3BHFA 4ZN0A 2Q0KA 2R46A 4BJZA 4D03A 4EQSA 4CY6A 3ZYXA 4X9NA 2ZZ0A 4Y4NA 1LQTA 4MJWA 1K4QA 4JQ9A 2ZZCA 3GD3A 2PYXA 3KKJA 3Q9TA 2R9ZA 1VRQB 2C66A 2XCGA 4H2NA 4OPGA 3GWDA 4U8JA 4CRTA 1F3PA 5BVAA 2IVEA 2X99A 5ER0A 5BUKA 3NYEA 2V6OA 5GSNA 3QVRA 1CF3A 2O9ZA 1N4UA 2V61A 2V5ZA 4A5LA 2BA9A 1F8RA 1F6MA 5KMRA 4GF7A 5JCLA 2HQMA 4TM1A 4J33A 4CNJA 3NG7X 2ACZA 1E1LA 2GH5A 2XLRA 3GMCA 1ZX9A 4EM3A 3RNMA 2GQWA 2J3NA 1NEKA 4USRA 2ARDA 3H8LA 1D4CA 4REKA 5HY5A 4A79A 1OJCA 3ATRA 3NTDA 4TLXA 3WE0A 1PHHA 1FEBA 1VQWA 4A6NB 3IF9A 3IHMA 4YTNA 4J31A 2R0CA 1D4EA 2PHHA 3GMBA 3T31A 3ABVA 2FJAA 3ATQA 2EQ9A 2GRTA 1N1PA 4O5UA 1GRTA 4BURA 1S3EA 3FIMB 2AQJA 2YWLA 1BZLA 1LVLA 2OLNA 4XXGA 4U8IA 4J57A 4II3A 2YVJA 1TDKA 4DSGA 1ZP0A 1YKJA 3P4RA 1REOA 1OJAA 1Q1WA 2FJDA 1PBBA 2WU2A 2XYOA 2YG3A 2BC0A 3LOVA 4NTEA 1Y56B 2Q7VA 3H8IA 3PG6A 1PBDA 3RHAA 1BGNA 2CVJA 3CNDA 2WEUA 3GDPA 1H7WA 3AYLA 3AE6A 3K7MX 2X8CA 4C77A 4C3YA 1GT8A 2BC1A 2WDQA 4KX6A 2WBAA 4G73A 3L5OA 1OJTA 3AE7A 3II4A 5JCIA 1PS9A 1H81A 2TMDA 2WP5A 4Z2UA 3CPJG 5BRTA 1EL9A 2X8GA 2XFUA 3G5SA 1GRAA 4A99A 1XPQA 2WETA 4J36A 3S5WA 3QFAA 2JAEA 5J7XA 3M13A 3UKQA 3UOVA 3NGCX 3SGLA 2XVEA 1KSUA 4OPLA 4YSHA 2YG5A 1LV0A 1B8SA 2DKHA 2NVKX 1OJ9A 4Z26A 3FG2P 3C96A 3NIXA 4K5RA 3R9UA 3K30A 3UP5A 1ZK7A 3KLJA 1DOBA 4H4XA 4FK1C 4YT0A 1JNZA 3GSIA 2B7RA 1LTXR 3T2ZA 3ALJA 1FL2A 3PVCA 3AYJA 1E7PA 2WP6A 1GSNA 2RGOA 3B6DA 4P9SA 4ADWA 3UP4A 4U8MA 3CGEA 2C67A 1E39A 2OALA 4DGKA 4NEVA 1GV4A 3K7TA 1LQUA 1LPFA 3CPIG 1KDGA 1Z6LA 2YG4A 4C3XA 4X4JA 3UTFA 3NK0X 3AD9B 1H84A 2VQ7A 2XVHA 2Y6RA 4YTPA 3AECA 1GPEA 3DMEA 1E6EA 2BRYA 4RG4A 4NNJA 4A9WA 3BHKA 3VR8A 3P9UA 1GREA 4H2PA 3T2KA 2C64A 3BI5A 2EQ8A 2YR5A 5EB4A 3BI2A 1NDAA 1D7YA 2R4JA 2VZ2A 4B64A 1H83A 4CBQA 2X3NA 2XLSA 3QFBA 3UTEA 1GXFA 4JDRA 4EIPA 2OAMA 2JK6A 1X31B 3CNJA 4Z43A 2A87A 1VDCA 1Y0PA 4FDCB 2DKIA 4KPRA 1B5QA 3NNEA 3ZDNA 2JB3A 3NTAA 3GDNA 1B4VA 2NPXA 2XFNA 2H89A 3S61A 4Z2TA 4HA6A 2GQFA 4E0VA 4K2XA 2ZBWA 2XVJA 3SZ0A 2VOUA 3AE2A 1GETA 2X50A 1D7LA 2GMHA 4ICYA 4II2A 4DNAA 4I59A 5C2TA 1CHUA 1KF6A 2EQ7A 5JCNA 3ISHA 3EAOA 1JRYA 1L9DA 2YVFA 5KWFA 3AE4A 3CIRA 1K0JA 4BJYA 3QJ4A 4IA6A 1YY5A 5L46A 2H88A 2WQYA 1NHSA 1HYUA 2WDVA 2WS3A 4U2TA 2GF3A 4BK3A 3NH3X 4I58A 1B37A 1GRHA 1EL5A 1PBCA 4APNA 1P2HA 2WESA 5KMPA 3REDA 2E1MA 4JNAA 4Z24A 3LZXA 4H50A 4UP3A 2YLRA 4OPUA 2TPRA 3AE5A 2RGJA 3COXA 4N9XA 3CMMA 1FECA 2A89A 4IVOB 2YM1A 2GR2A 4OPIA 4A65A 3T37A 4EM4A 4EMIA 4XWZA 4Z25A 1ZDLA 2C3CA 2C65A 2VQBA 2GR1A 2XDOA 4M52A 4H2RA 1FEAA 1GRBA 3AB1A 3D1CA 3ICRA 3T2YA 3EF6A 3VRBA 4AOXA 4OVIA 1GEUA 3C4NA 5BULA 1JOAA 3LZWA 1NAAA 1VG0A 2C76A 3UKFA 4YXDA 3HYVA 4G6HA 4YSYA 1E1MA 1DODA 4OPTA 1GERA 3BI4A 3DGZA 3RP6A 4H4WA 3NN0X 2YLXA 3DK9A 4H4UA 3F8PA 1V59A 1S7MA 5KXJA 2V3AA 4H4ZA 4IA5A 4GDEA 1KN0A 1PN0A 4H4RA 3P4PA 3SZWA 2R45A 4USQA 3H4KA 1GALA 4H4TA 5EBKA 3C4AA 4B69A 1EBDA 1NG4A 1BWCA 4U2LA 1N4WA 3B3RA 1KFYA 3DJJA 2BS2A 3UOZA 3CGBA 1RSGA 3AEDA 3VR9A 4H2QA 2E4GA 2FJBA 3OZ2A 3SX6A 1F8WA 1H6VA 4CY8A 2VVLA 2WPFA 2B7SA 3CGDA 1DOCA 4GDPA 5GRTA 1PBEA 2JB1A 5KOWA 5KNLA 4GRTA 2CULA 4H4SA 2BK4A 1CJ2A 3NLCA 3QSEA 3SZFA 2Q6UA 2F5ZA 3HZLA 1CJCA 1K0LA 4OCGA 2Z5XA 1SEZA 2C72A 2GAHB 5FS6A 2YR4A 3G5RA 3AD7B 3VRDB 2XLPA 4AP3A 2Y6QA 4FX9A 3KPFA 4ECHA 5IQ1A 3EANA 2EQ6A 1KNRA 4ZCDA 4LIIA 4D04A 3CGCA 3DA1A 5EOWA 5KOXA 1PXAA 5FMHA 2WOVA 2WDRA 3NHOX 1CBOA 4B1BA 1QJDA 2FBWA 3KPKA 1H82A 5FS7A 1EL8A 2BS4A 2C75A 4BK1A 3DK8A 5KVHA 4YKFA 2YAUA 1M6IA 3BNMA 1L9CA 3F8RA 5IQ4A 5J60A 2Z5YA 3GWFA 2YLWA 3DJEA 5JCKA 5EB5A 2W0HA 2JB2A 1GRFA 3AE9A 2XLUA 2APGA 1TYTA 1PXCA 1S2YA 2A8XA 1CL0A 3SXIA 4AP1A 1PJ6A 4CCQA 2C4CA 1BGJA 1BKWA 3ALLA 4YSXA 3LB8A 1O94A 3UOXA 3M12A 2YVGA 2BRAA 2B9YA 1GRGA 1JRXA 3E1TA 4TM0A 4J2WA 2B76A 1CC4A 4UDPA 3AEGA 2YR6A 4G74A 4TM3A 2RGHA 4H4QA 2IVDA 1NENA 2GAGB 3AEBA 3VRAA 1BF3A 1GTEA 2BXSA 4Y4LA 5C3JA 2BS3A 2CFYA 3CNSA 4TM4A 1TDEA 2BXRA 4TLZA 3ALMA 2X8HA 1KNPA 1NHRA 4RSLA 4EMJA 1VG9A 2I0ZA 4NZHA 4B66A 1K0IA 4B63A 3UTGA 3IWAA 1ZY8A 3Q6JA 1TDFA 4X9MA 1P2EA 4G9KA 3T0KA 4YTMA 1MXTA 3G5QA 3V76A 3AYIA 2R0GA 1QLBA 3AEFA 3NK1X 2VRLA 1XHCA 3NK2X 4IV9A 3LXDA 3PO7A 2AAQA 4NTDA 4YWOA 1IUTA 5KRQA 1ONFA 5KMQA 4GCMA 4O5QA 4EMWA 2GEWA 2QAEA 4NWZA 3DH9A 1UKVG 3GD4A 3KA7A 4JN9A 2BK3A 2WOIA 4K8DA 1PDHA 3URHA 2XVIA 3ICSA 4JY2A 3CNPA 1GESA 3DGHA 2YLTA 2AR8A 1ZMCA 4U8LA 3GYJA 4GAVA 5KVIA 2YLSA 1H86A 3GRSA 4GAPA 5U1OA 4LU6A 4YSZA 1ZKQA 4EIQA 3AWIA 4AT2A 3LADA 1YQZA 2Q0LA 1NHPA 2QA1A 3NYFA 4CNKA 4A7AA 1Q1RA 1KSSA 1O95A 4JY3A 1NHQA 1W4XA 1M64A 3RP8A 3FMWA 5U25A 3CTYA 1D5TA 3K7QX 1S2QA 2VVMA 1AOGA 1JNRA 4UDQA 3UKPA 2E5VA 3M0OA 2WPEA 2JKCA 2YG7A 2XLTA 4EQWA 3AEAA 4B67A 5JCMA 2VVLG 1E1NA 4Z2RA 4H4YA 2XVFA 1YQ4A 5CQFA 2V3BA 3IHGA 3KD9A 1N4VA 4WX1A 3UTHA 1MO9A 1DJQA 4H4PA 2WHDA 4Z44A 3P4SA 5LV9A 1YQ3A 2XFOA 4CCRA 3CN8A 3DK4A 3BNUA 3UKKA 4U2SA 1CJ3A 4Y4MA 3KU9A 5IPYA 3DJGX 1H2IA 3O0HA 1PXBA 2BABA 4RG3A 2OA1A 3NN6X 1TRBA 3LJPA 5JRBA 1XANA 1XDIA 1DOEA 5M0ZA 5CKUA 2IIDA 1RYIA 4J56A 1DJNA 3HYWA 1NPXA 4XWRA 2CDUA 4IVMB 1IUVA 4U8NA 5M10A 1O5WA 2C70A 3AEEA 4A6NA 4PAAA 2BCGG 4J34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TR3 A;  4WCT A;  4U8O A;  5HYM A;  3ICT A;  1JRZ A;  1D4D A;  1PBF A;  1CC6 A;  4HB9 A;  3L1R A;  4H4V A;  1TDO A;  3KVE A;  3UKH A;  3GYI A;  4K7Z A;  1ZOY A;  1E1K A;  3IC9 A;  1ELI A;  1GOS A;  1MOK A;  3D8X A;  3ITJ A;  1Q9I A;  4JNQ A;  4NTC A;  4UDR A;  3RP7 A;  3CNT A;  3NYC A;  2UZZ A;  2WU5 A;  4GR1 A;  2WPC A;  1IUX A;  1L9E A;  3CPH G;  1L0V A;  3UKA A;  4K22 A;  3V3N A;  1JU2 A;  2WOW A;  3AXB A;  1Y56 A;  3L8K A;  2BK5 A;  5HHF A;  4BK2 A;  2R0P A;  3PS9 A;  3AE1 A;  3F8D A;  4H7U A;  4ZCC A;  4AOS A;  4C5O A;  2JBV A;  1ZOV A;  2QCU A;  3FBS A;  3SQP A;  5DBJ A;  5FS9 A;  4B65 A;  4GUV A;  3P1W A;  1IUU A;  2RAB A;  3UOY A;  3NRN A;  3ADA B;  2GVC A;  2V60 A;  1IUS A;  2B9W A;  2GB0 A;  4YKG A;  2YQU A;  2XFQ A;  1TYP A;  3VQR A;  2GR0 A;  1JEH A;  1DNC A;  4U8P A;  3FPZ A;  1LJ1 A;  2XFP A;  4PAB A;  1IJH A;  2YG6 A;  3UCL A;  2BYB A;  4B68 A;  3OC4 A;  1TDN A;  4LA1 A;  2BAC A;  4DSH A;  1GND A;  3NT6 A;  3QSS A;  3P4Q A;  3AE8 A;  2WP9 A;  2C73 A;  5U63 A;  3UKL A;  3QSM A;  2YM2 A;  2BCP A;  1RP0 A;  4K5S A;  1CJ4 A;  3I6D A;  5HXI A;  1COY A;  1ZMD A;  1IUW A;  2C7G A;  4NEW A;  4EQR A;  1EL7 A;  3AE3 A;  3SFE A;  1CC2 A;  1H7X A;  2YLZ A;  3V3O A;  4C74 A;  1PJ7 A;  3AD8 B;  1S3B A;  3SM8 A;  4U8K A;  1DXL A;  2GMJ A;  2QA2 A;  3I3L A;  2GV8 A;  1OJD A;  2VRM A;  3GRT A;  3DJD A;  3EPT A;  1QO8 A;  3NKS A;  3QVP A;  4BV6 A;  4AT0 A;  1FOH A;  1NG3 A;  2ZZB A;  3JSK A;  4OPD A;  1FCD A;  4EQX A;  4OPC A;  2FJE A;  2C3D A;  2GR3 A;  5FS8 A;  2B9X A;  2R4E A;  2OLO A;  1GTH A;  4FK1 A;  1F8S A;  1PJ5 A;  3SFD A;  3BHF A;  4ZN0 A;  2Q0K A;  2R46 A;  4BJZ A;  4D03 A;  4EQS A;  4CY6 A;  3ZYX A;  4X9N A;  2ZZ0 A;  4Y4N A;  1LQT A;  4MJW A;  1K4Q A;  4JQ9 A;  2ZZC A;  3GD3 A;  2PYX A;  3KKJ A;  3Q9T A;  2R9Z A;  1VRQ B;  2C66 A;  2XCG A;  4H2N A;  4OPG A;  3GWD A;  4U8J A;  4CRT A;  1F3P A;  5BVA A;  2IVE A;  2X99 A;  5ER0 A;  5BUK A;  3NYE A;  2V6O A;  5GSN A;  3QVR A;  1CF3 A;  2O9Z A;  1N4U A;  2V61 A;  2V5Z A;  4A5L A;  2BA9 A;  1F8R A;  1F6M A;  4GF7 A;  5JCL A;  2HQM A;  4TM1 A;  4J33 A;  4CNJ A;  3NG7 X;  2ACZ A;  1E1L A;  2GH5 A;  2XLR A;  3GMC A;  1ZX9 A;  4EM3 A;  3RNM A;  2GQW A;  2J3N A;  1NEK A;  4USR A;  2ARD A;  3H8L A;  1D4C A;  4REK A;  5HY5 A;  4A79 A;  1OJC A;  3ATR A;  3NTD A;  4TLX A;  3WE0 A;  1PHH A;  1FEB A;  1VQW A;  4A6N B;  3IF9 A;  3IHM A;  4YTN A;  4J31 A;  2R0C A;  1D4E A;  2PHH A;  3GMB A;  3ABV A;  2FJA A;  3ATQ A;  2EQ9 A;  2GRT A;  1N1P A;  4O5U A;  1GRT A;  4BUR A;  1S3E A;  3FIM B;  2AQJ A;  2YWL A;  1BZL A;  1LVL A;  2OLN A;  4XXG A;  4U8I A;  4J57 A;  2YVJ A;  1TDK A;  4DSG A;  1ZP0 A;  1YKJ A;  3P4R A;  1REO A;  1OJA A;  1Q1W A;  2FJD A;  1PBB A;  2WU2 A;  2XYO A;  2YG3 A;  2BC0 A;  3LOV A;  4NTE A;  1Y56 B;  2Q7V A;  3H8I A;  1PBD A;  3RHA A;  1BGN A;  2CVJ A;  3CND A;  2WEU A;  3GDP A;  1H7W A;  3AYL A;  3AE6 A;  3K7M X;  2X8C A;  4C77 A;  4C3Y A;  1GT8 A;  2BC1 A;  2WDQ A;  4KX6 A;  2WBA A;  1OJT A;  3AE7 A;  3II4 A;  5JCI A;  1PS9 A;  1H81 A;  2TMD A;  2WP5 A;  4Z2U A;  3CPJ G;  5BRT A;  1EL9 A;  2X8G A;  2XFU A;  3G5S A;  1GRA A;  4A99 A;  1XPQ A;  2WET A;  4J36 A;  3S5W A;  3QFA A;  2JAE A;  5J7X A;  3M13 A;  3UKQ A;  3UOV A;  3NGC X;  3SGL A;  2XVE A;  1KSU A;  4OPL A;  4YSH A;  2YG5 A;  1LV0 A;  1B8S A;  2DKH A;  2NVK X;  1OJ9 A;  4Z26 A;  3FG2 P;  3C96 A;  3NIX A;  4K5R A;  3R9U A;  3K30 A;  3UP5 A;  1ZK7 A;  3KLJ A;  1DOB A;  4H4X A;  4FK1 C;  4YT0 A;  1JNZ A;  3GSI A;  2B7R A;  1LTX R;  3ALJ A;  1FL2 A;  3PVC A;  3AYJ A;  1E7P A;  2WP6 A;  1GSN A;  2RGO A;  3B6D A;  4P9S A;  4ADW A;  3UP4 A;  4U8M A;  3CGE A;  2C67 A;  1E39 A;  2OAL A;  4DGK A;  4NEV A;  1GV4 A;  3K7T A;  1LQU A;  1LPF A;  3CPI G;  1KDG A;  1Z6L A;  2YG4 A;  4C3X A;  4X4J A;  3UTF A;  3NK0 X;  3AD9 B;  1H84 A;  2VQ7 A;  2XVH A;  2Y6R A;  4YTP A;  3AEC A;  1GPE A;  3DME A;  1E6E A;  4A9W A;  4RG4 A;  3BHK A;  3VR8 A;  3P9U A;  1GRE A;  4H2P A;  2C64 A;  3BI5 A;  2EQ8 A;  2YR5 A;  5EB4 A;  3BI2 A;  1NDA A;  1D7Y A;  2R4J A;  2VZ2 A;  4B64 A;  1H83 A;  4CBQ A;  2X3N A;  2XLS A;  3QFB A;  3UTE A;  1GXF A;  4JDR A;  4EIP A;  2OAM A;  2JK6 A;  1X31 B;  3CNJ A;  4Z43 A;  2A87 A;  1VDC A;  1Y0P A;  4FDC B;  2DKI A;  4KPR A;  1B5Q A;  3NNE A;  3ZDN A;  2JB3 A;  3NTA A;  3GDN A;  1B4V A;  2NPX A;  2XFN A;  2H89 A;  3S61 A;  4Z2T A;  4HA6 A;  2GQF A;  4E0V A;  4K2X A;  2ZBW A;  2XVJ A;  2VOU A;  3AE2 A;  1GET A;  2X50 A;  1D7L A;  2GMH A;  4ICY A;  4DNA A;  4I59 A;  5C2T A;  1CHU A;  1KF6 A;  2EQ7 A;  5JCN A;  3ISH A;  3EAO A;  1JRY A;  1L9D A;  2YVF A;  5KWF A;  3AE4 A;  3CIR A;  1K0J A;  4BJY A;  3QJ4 A;  4IA6 A;  1YY5 A;  5L46 A;  2H88 A;  2WQY A;  1NHS A;  1HYU A;  2WDV A;  2WS3 A;  4U2T A;  2GF3 A;  4BK3 A;  3NH3 X;  4I58 A;  1B37 A;  1GRH A;  1EL5 A;  1PBC A;  4APN A;  1P2H A;  2WES A;  3RED A;  2E1M A;  4JNA A;  4Z24 A;  3LZX A;  4H50 A;  4UP3 A;  2YLR A;  4OPU A;  2TPR A;  3AE5 A;  2RGJ A;  3COX A;  4N9X A;  1FEC A;  2A89 A;  4IVO B;  2YM1 A;  2GR2 A;  4OPI A;  4A65 A;  3T37 A;  4EM4 A;  4EMI A;  4XWZ A;  4Z25 A;  1ZDL A;  2C3C A;  2C65 A;  2VQB A;  2GR1 A;  2XDO A;  4M52 A;  4H2R A;  1FEA A;  1GRB A;  3AB1 A;  3D1C A;  3ICR A;  3VRB A;  3EF6 A;  4AOX A;  5BUL A;  4OVI A;  1GEU A;  3C4N A;  1JOA A;  3LZW A;  1NAA A;  1VG0 A;  2C76 A;  3UKF A;  4YXD A;  4YSY A;  1E1M A;  1DOD A;  4OPT A;  1GER A;  3BI4 A;  3DGZ A;  3RP6 A;  4H4W A;  3NN0 X;  2YLX A;  3DK9 A;  4H4U A;  3F8P A;  1V59 A;  5KXJ A;  4H4Z A;  2V3A A;  4IA5 A;  4GDE A;  1PN0 A;  4H4R A;  3P4P A;  2R45 A;  4USQ A;  3H4K A;  1GAL A;  4H4T A;  5EBK A;  3C4A A;  4B69 A;  1EBD A;  1NG4 A;  1BWC A;  4U2L A;  1N4W A;  3B3R A;  1KFY A;  3DJJ A;  2BS2 A;  3UOZ A;  3CGB A;  1RSG A;  3AED A;  3VR9 A;  4H2Q A;  2E4G A;  2FJB A;  3OZ2 A;  4CY8 A;  1F8W A;  1H6V A;  2VVL A;  2WPF A;  2B7S A;  3CGD A;  1DOC A;  4GDP A;  5GRT A;  1PBE A;  2JB1 A;  5KOW A;  4GRT A;  2CUL A;  4H4S A;  2BK4 A;  1CJ2 A;  3NLC A;  3QSE A;  2Q6U A;  2F5Z A;  3HZL A;  1CJC A;  1K0L A;  4OCG A;  2Z5X A;  1SEZ A;  2C72 A;  2GAH B;  5FS6 A;  2YR4 A;  3G5R A;  3AD7 B;  3VRD B;  2XLP A;  4AP3 A;  2Y6Q A;  4FX9 A;  3KPF A;  4ECH A;  5IQ1 A;  3EAN A;  2EQ6 A;  1KNR A;  4ZCD A;  4LII A;  4D04 A;  3CGC A;  3DA1 A;  5EOW A;  5KOX A;  1PXA A;  5FMH A;  2WOV A;  2WDR A;  3NHO X;  1CBO A;  4B1B A;  1QJD A;  2FBW A;  1H82 A;  5FS7 A;  1EL8 A;  2BS4 A;  2C75 A;  4BK1 A;  3DK8 A;  5KVH A;  4YKF A;  2YAU A;  1M6I A;  3BNM A;  1L9C A;  3F8R A;  5IQ4 A;  5J60 A;  2Z5Y A;  3GWF A;  2YLW A;  3DJE A;  5JCK A;  5EB5 A;  2W0H A;  2JB2 A;  1GRF A;  3AE9 A;  2XLU A;  2APG A;  1TYT A;  1PXC A;  1S2Y A;  2A8X A;  1CL0 A;  4AP1 A;  1PJ6 A;  4CCQ A;  1BGJ A;  1BKW A;  3ALL A;  4YSX A;  3LB8 A;  1O94 A;  3UOX A;  3M12 A;  2YVG A;  2B9Y A;  1GRG A;  1JRX A;  3E1T A;  4TM0 A;  4J2W A;  2B76 A;  1CC4 A;  4UDP A;  3AEG A;  2YR6 A;  4TM3 A;  2RGH A;  4H4Q A;  2IVD A;  1NEN A;  2GAG B;  3AEB A;  3VRA A;  1BF3 A;  1GTE A;  2BXS A;  4Y4L A;  5C3J A;  2BS3 A;  2CFY A;  3CNS A;  4TM4 A;  1TDE A;  2BXR A;  4TLZ A;  3ALM A;  2X8H A;  1KNP A;  1NHR A;  4RSL A;  4EMJ A;  1VG9 A;  2I0Z A;  4NZH A;  4B66 A;  1K0I A;  4B63 A;  3UTG A;  3IWA A;  1ZY8 A;  3Q6J A;  1TDF A;  4X9M A;  1P2E A;  4YTM A;  1MXT A;  3G5Q A;  3V76 A;  3AYI A;  2R0G A;  1QLB A;  3AEF A;  3NK1 X;  2VRL A;  1XHC A;  3NK2 X;  4IV9 A;  3LXD A;  3PO7 A;  2AAQ A;  4NTD A;  4YWO A;  1IUT A;  5KRQ A;  1ONF A;  4GCM A;  4O5Q A;  4EMW A;  2GEW A;  2QAE A;  3DH9 A;  1UKV G;  3GD4 A;  3KA7 A;  4JN9 A;  2BK3 A;  2WOI A;  4K8D A;  1PDH A;  3URH A;  2XVI A;  3ICS A;  4JY2 A;  3CNP A;  1GES A;  3DGH A;  2YLT A;  2AR8 A;  1ZMC A;  4U8L A;  3GYJ A;  5KVI A;  2YLS A;  1H86 A;  3GRS A;  5U1O A;  4LU6 A;  4YSZ A;  1ZKQ A;  4EIQ A;  3AWI A;  4AT2 A;  3LAD A;  1YQZ A;  2Q0L A;  1NHP A;  2QA1 A;  3NYF A;  4CNK A;  4A7A A;  1Q1R A;  1KSS A;  1O95 A;  4JY3 A;  1NHQ A;  1W4X A;  1M64 A;  3RP8 A;  3FMW A;  5U25 A;  3CTY A;  1D5T A;  3K7Q X;  1S2Q A;  2VVM A;  1AOG A;  1JNR A;  4UDQ A;  3UKP A;  2E5V A;  3M0O A;  2WPE A;  2JKC A;  2YG7 A;  2XLT A;  4EQW A;  3AEA A;  4B67 A;  5JCM A;  2VVL G;  1E1N A;  4Z2R A;  4H4Y A;  2XVF A;  1YQ4 A;  5CQF A;  2V3B A;  3IHG A;  3KD9 A;  1N4V A;  4WX1 A;  3UTH A;  1MO9 A;  1DJQ A;  4H4P A;  2WHD A;  4Z44 A;  3P4S A;  5LV9 A;  1YQ3 A;  2XFO A;  4CCR A;  3CN8 A;  3DK4 A;  3BNU A;  3UKK A;  4U2S A;  1CJ3 A;  4Y4M A;  3KU9 A;  5IPY A;  3DJG X;  3O0H A;  1PXB A;  2BAB A;  4RG3 A;  2OA1 A;  3NN6 X;  1TRB A;  3LJP A;  1DOE A;  1XAN A;  1XDI A;  5M0Z A;  5CKU A;  2IID A;  1RYI A;  4J56 A;  1DJN A;  1NPX A;  4XWR A;  2CDU A;  4IVM B;  1IUV A;  4U8N A;  5M10 A;  1O5W A;  2C70 A;  3AEE A;  4A6N A;  4PAA A;  2BCG G;  4J34 A; 
#chains in the Genus database with same CATH topology
 5TR3 A;  4WCT A;  5HYM A;  1D4D A;  1FFU C;  1KKO A;  4H4V A;  1TDO A;  3UKH A;  4K7Z A;  3ITJ A;  3RGT A;  4GR1 A;  3AXB A;  1Y56 A;  4BK2 A;  4H7U A;  4AOS A;  2JBV A;  3FBS A;  5DBJ A;  3P1W A;  2RAB A;  2PP0 A;  4KWS A;  3ADA B;  2GVC A;  4YKG A;  2YQU A;  3VC6 A;  2XFQ A;  2GR0 A;  1JEH A;  3FPZ A;  1LJ1 A;  2XFP A;  2YG6 A;  2BYB A;  4B68 A;  2XGZ A;  3NT6 A;  2PP1 A;  4HN8 A;  2C73 A;  1RP0 A;  1COY A;  1ZMD A;  1IUW A;  4NEW A;  4EQR A;  1CC2 A;  3ZLH A;  2QA2 A;  3DJD A;  3EPT A;  3QVP A;  4BV6 A;  2OVL A;  2P8B A;  5BOE A;  1VQZ A;  2C3D A;  2GR3 A;  3H12 A;  2B9X A;  2R4E A;  2OLO A;  3I6E A;  4D03 A;  4EQS A;  4IP5 A;  4MJW A;  3KKJ A;  3Q9T A;  4OPG A;  3S47 A;  4DXK A;  4CRT A;  5BVA A;  5ER0 A;  1FFV C;  5BUK A;  3NYE A;  2QQ6 A;  5GSN A;  3ZLG A;  1CF3 A;  2O9Z A;  3P0W A;  2GH5 A;  3ZLF A;  2GQW A;  2J3N A;  3H8L A;  1D4C A;  2PU1 A;  5HY5 A;  3KUM A;  3PFR A;  4TLX A;  4J1O A;  3IF9 A;  3SN1 A;  3D47 A;  2DW6 A;  3SBF A;  3GMB A;  3ABV A;  2GRT A;  1W6T A;  2YWL A;  1LVL A;  4II3 A;  3MY9 A;  5FJT A;  3CXB A;  3UGV A;  1REO A;  1BGN A;  3CND A;  3AE6 A;  2X8C A;  2BC1 A;  4KX6 A;  3AE7 A;  5BRT A;  3G5S A;  4A99 A;  3NGC X;  3UCC A;  4YSH A;  2DKH A;  2HXT A;  3NIX A;  3UP5 A;  3IJQ A;  3ZVH B;  1ZK7 A;  4ENL A;  3GSI A;  3T2Z A;  1FL2 A;  2RGO A;  4HPN A;  4P9S A;  4ADW A;  4U8M A;  2OAL A;  3UTF A;  3NK0 X;  1N5X A;  1H84 A;  4RG4 A;  4NNJ A;  3BHK A;  3BJS A;  3T2K A;  4G8T A;  4CBQ A;  1NDA A;  1D7Y A;  1N60 C;  1WUE A;  3UTE A;  2OAM A;  1X31 B;  4Z43 A;  1Y0P A;  4FDC B;  4KPR A;  1B5Q A;  2JB3 A;  4GYP C;  4HA6 A;  2XVJ A;  2VOU A;  2X50 A;  3EEZ A;  1CHU A;  2EQ7 A;  5JCN A;  3CIR A;  2W3S A;  4IA6 A;  1YY5 A;  5L46 A;  1NHS A;  2GF3 A;  5KMP A;  4H50 A;  2GGI A;  4UP3 A;  2YLR A;  3AE5 A;  3GY1 A;  3CMM A;  3HW2 A;  2GR2 A;  1ZDL A;  2XDO A;  1FEA A;  1GRB A;  3EF6 A;  4AOX A;  3C4N A;  3FV9 A;  1GER A;  2GGG A;  3RP6 A;  4H4U A;  1P43 A;  4GDE A;  1KCZ A;  4A6G A;  3P4P A;  2R45 A;  4H4T A;  3VC5 A;  3C4A A;  3QKE A;  1N4W A;  3DJJ A;  2BS2 A;  3UOZ A;  3AED A;  4H2Q A;  4A35 A;  2WPF A;  1TKK A;  1DOC A;  5KOW A;  5KNL A;  3T8Q A;  3QPE A;  3SZF A;  1FIQ B;  1K0L A;  1SEZ A;  2GAH B;  5FS6 A;  3VFC A;  2YR4 A;  4HCD A;  4E6M A;  3V5C A;  3KPF A;  5IQ1 A;  3D46 A;  3EAN A;  3CGC A;  5EOW A;  2WOV A;  4HYR A;  1CBO A;  4BK1 A;  5KVH A;  2YAU A;  3F8R A;  3GWF A;  3DJE A;  5EB5 A;  3TOY A;  1SJD A;  2P3Z A;  3RIT A;  3AE9 A;  1S2Y A;  3NXL A;  3H8A A;  4YSX A;  1BKW A;  2OPJ A;  3LB8 A;  3M12 A;  1JRX A;  3E1T A;  4TM0 A;  1CC4 A;  2OQY A;  2YR6 A;  2RGH A;  2POZ A;  2QJM A;  1GTE A;  2BXS A;  5C3J A;  3OTR A;  1XPY A;  3ALM A;  1KNP A;  1VG9 A;  2FYM A;  4NZH A;  1K0I A;  3IWA A;  3Q6J A;  5FJO A;  4X9M A;  6ENL A;  3ENL A;  3AYI A;  1QLB A;  2VRL A;  1XHC A;  3STP A;  4NTD A;  1IUT A;  1ONF A;  2W55 A;  3TW9 A;  4EMW A;  3EUB 3;  4JN9 A;  2WOI A;  1PDH A;  4BJY A;  3URH A;  4U8L A;  2GDQ A;  3CNP A;  2AR8 A;  1FO4 A;  4GAP A;  3GRS A;  5U1O A;  4YSZ A;  3H70 A;  1ZKQ A;  3AWI A;  4AT2 A;  1JPM A;  1RM6 B;  1W4X A;  3FMW A;  3K7Q X;  3DG6 A;  2VVM A;  3UKP A;  1NU5 A;  4WX1 A;  1N4V A;  4H4P A;  1YQ3 A;  4CCR A;  3VCN A;  4HNC A;  3DJG X;  2HNE A;  1H2I A;  3O0H A;  2OA1 A;  3V4B A;  1TRB A;  3LJP A;  1XAN A;  2DW7 A;  5M0Z A;  5CKU A;  3JVA A;  1DJN A;  3HYW A;  1O5W A;  4A6N A;  4KEM A;  3OZM A;  3ICT A;  3HYX A;  1JRZ A;  3NS1 B;  3L1R A;  3KVE A;  3SZC A;  2OX4 A;  1E1K A;  1GOS A;  3D8X A;  1Q9I A;  4JNQ A;  4UDR A;  3NYC A;  2MUC A;  5FJU A;  3V3N A;  2HZG A;  2WOW A;  2BK5 A;  3PS9 A;  3F8D A;  4ZCC A;  2OZT A;  3SQP A;  5FS9 A;  2GGH A;  1IUU A;  2QJJ A;  1IUS A;  2B9W A;  4U8P A;  4DN1 A;  1MDR A;  3SR6 B;  4FP1 A;  1ECQ A;  2BAC A;  1GND A;  2PS2 A;  4EWJ A;  1XS2 A;  3I6D A;  1EL7 A;  3AE3 A;  1H7X A;  2YLZ A;  5KMS A;  3I3L A;  2GV8 A;  2XH4 A;  2OZ3 A;  1ELS A;  3T9P A;  1NG3 A;  2ZZB A;  4EQX A;  3A7R A;  1PJ5 A;  3SFD A;  3BHF A;  2QDE A;  4ZA0 A;  3ZYX A;  4X9N A;  2ZZ0 A;  4FI4 A;  4JQ9 A;  2ZZC A;  3B97 A;  3DG3 A;  4JN7 A;  2PYX A;  1EC9 A;  2XCG A;  2IVE A;  2V5Z A;  2BA9 A;  5KMR A;  4GF7 A;  5JCL A;  4TM1 A;  3NG7 X;  3GMC A;  2XSX A;  3RNM A;  4IP4 A;  4REK A;  3NTD A;  3CXO A;  1FEB A;  1EC7 A;  3R25 A;  3PWI A;  2FJA A;  3TJI A;  1N1P A;  4O5U A;  1GRT A;  2XH7 A;  2AQJ A;  1BZL A;  4XXG A;  2RDX A;  4U8I A;  2YVJ A;  1TDK A;  2PSN A;  1PBB A;  2YG3 A;  2BC0 A;  3GC2 A;  1Y56 B;  3PG6 A;  2CVJ A;  3GDP A;  1H7W A;  1R6W A;  3RCY A;  5JCI A;  2WP5 A;  2PP3 A;  1GRA A;  1XPQ A;  3S5W A;  5G5G B;  3QFA A;  3M13 A;  4IL0 A;  1KSU A;  3IJI A;  1LV0 A;  3QTP A;  1EBH A;  3R9U A;  3K30 A;  1SJA A;  3DES A;  4YT0 A;  3ALJ A;  3PVC A;  3I4K A;  3AYJ A;  3NVY B;  1E39 A;  4NEV A;  1GV4 A;  3CPI G;  1PDY A;  3MWC A;  1Z6L A;  4C3X A;  4X4J A;  2VQ7 A;  2XVH A;  1WYG A;  3DME A;  2GSH A;  4A9W A;  2PGE A;  3P9U A;  1GRE A;  2ZAD A;  5EB4 A;  4B64 A;  1H83 A;  1SB3 B;  2X3N A;  2XLS A;  1GXF A;  1V97 A;  2DKI A;  2P88 A;  2XFN A;  1MNS A;  3S61 A;  1P48 A;  1GET A;  4II2 A;  1D7L A;  1SJC A;  3TWA A;  3ISH A;  1JRY A;  3AE4 A;  2PTZ A;  1K0J A;  4U2T A;  4I58 A;  1B37 A;  2WES A;  1PBC A;  3RED A;  3LZX A;  3EKG A;  2TPR A;  4OPU A;  4YWS A;  2A89 A;  4IVO B;  4OPI A;  3AB1 A;  3D1C A;  1JOA A;  2C76 A;  3UKF A;  4YXD A;  3SN4 A;  2E5A A;  1E1M A;  3NN0 X;  4TVW A;  4IA5 A;  2P0I A;  3UXL A;  3H4K A;  1WUF A;  5EBK A;  3JZU A;  4Z17 A;  2FJB A;  4CY8 A;  2PPG A;  2VVL A;  4KPL A;  1PBE A;  3R0K A;  4H4S A;  2BK4 A;  2CUL A;  2GL5 A;  3NLC A;  4H2H A;  2Z5X A;  2C72 A;  3G5R A;  3VRD B;  2XLP A;  4AP3 A;  4FX9 A;  2QVH A;  1YEY A;  4LII A;  5FMH A;  4B1B A;  5J04 A;  5J60 A;  5JCK A;  2W0H A;  1GRF A;  2XLU A;  2APG A;  1KD0 A;  2C4C A;  2AL1 A;  3ALL A;  1O94 A;  1GRG A;  2B76 A;  3SQS A;  3AEG A;  4TM3 A;  4H4Q A;  2PTY A;  1NEN A;  2GAG B;  3AEB A;  3SJN A;  4Y4L A;  4TLZ A;  3TWB A;  4EMJ A;  3THU A;  3VCC A;  4TVY A;  4YTM A;  3G5Q A;  3V76 A;  4IV9 A;  3LXD A;  3PO7 A;  2GEW A;  1IYX A;  3DH9 A;  1UKV G;  4NWZ A;  2BK3 A;  4JY2 A;  3ICS A;  3DGH A;  3AMZ A;  3UJ2 A;  3GYJ A;  2GGE A;  4GAV A;  2YLS A;  1EC8 A;  1N63 C;  2OLA A;  2QA1 A;  3NYF A;  4IT1 A;  1KSS A;  4JY3 A;  3A7A A;  1M64 A;  1NEL A;  3RP8 A;  3QLD A;  3CTY A;  1D5T A;  1S2Q A;  1AOG A;  3MKC A;  2E5V A;  3M0O A;  2YG7 A;  3Q45 A;  4B67 A;  4A3R A;  4H4Y A;  2XVF A;  3KD9 A;  4DHG A;  3UTH A;  1MO9 A;  2WHD A;  3GD6 A;  1E9I A;  4ROP A;  4Y4M A;  3P93 A;  4RG3 A;  3CT2 A;  2W54 A;  2IID A;  1RYI A;  4J56 A;  3DEQ A;  4IVM B;  2C70 A;  2BCG G;  5HHF A;  3GYI A;  1ZOY A;  1ELI A;  2UZZ A;  1L0V A;  4K22 A;  2R0P A;  3AE1 A;  4C5O A;  1ZOV A;  2OG9 A;  1JCT A;  4KT2 A;  2GB0 A;  1TYP A;  1DNC A;  4MMW A;  1TDN A;  4G6G A;  4DSH A;  1X2G A;  3QSS A;  3P4Q A;  4E4F A;  3UKL A;  3QSM A;  2YM2 A;  2BCP A;  3NVV B;  2OO6 A;  2C7G A;  3V3O A;  3SM8 A;  1S3B A;  1DXL A;  2AL2 B;  2E3T A;  1QO8 A;  1FOH A;  3JSK A;  4OPD A;  3N4F A;  2AKZ A;  5FS8 A;  4ZN0 A;  3UJR A;  3TTE A;  1LQT A;  4Y4N A;  3GWD A;  4JN8 A;  3B9J B;  2V6O A;  3QVR A;  4A5L A;  1F8R A;  1F6M A;  2HQM A;  4CNJ A;  1E1L A;  4GGB A;  2XLR A;  1ZX9 A;  3RO6 A;  4H83 A;  4USR A;  2ARD A;  3DIP A;  4A79 A;  1OJC A;  3JW7 A;  3ATR A;  3WE0 A;  1PHH A;  2QJN A;  1VQW A;  3R1Z A;  4A6N B;  3IHM A;  4J31 A;  2R0C A;  3T31 A;  3ATQ A;  2EQ9 A;  4IZG A;  1S3E A;  3FIM B;  3RRA A;  2OLN A;  3HPF A;  4HCH A;  3P4R A;  3ETR B;  1OJA A;  2WU2 A;  2XYO A;  3LOV A;  4NTE A;  1TZZ A;  2PMQ A;  3H8I A;  3FVD A;  3RHA A;  2WEU A;  4C77 A;  1GT8 A;  4G73 A;  2PA6 A;  1OJT A;  1PS9 A;  4ZCW A;  1H81 A;  3CPJ G;  2XFU A;  4J36 A;  5J7X A;  3SGL A;  2XVE A;  2YG5 A;  1B8S A;  1OJ9 A;  3C96 A;  2XH0 A;  3KLJ A;  1DOB A;  4H4X A;  4FK1 C;  3UP4 A;  3CGE A;  2C67 A;  1LPF A;  1KDG A;  3AD9 B;  3GO2 A;  2Y6R A;  3AEC A;  4YTP A;  3FXG A;  3CK5 A;  1GPE A;  3VR8 A;  4H2P A;  2C64 A;  3CAW A;  3CNJ A;  1VDC A;  3K1G A;  1RVK A;  1B4V A;  2GQF A;  3FYY A;  3AE2 A;  4ICY A;  4I59 A;  5EU9 A;  1KF6 A;  5FJP A;  3EAO A;  4IL2 A;  7ENL A;  5KWF A;  1ONE A;  4GFI A;  2H88 A;  2WQY A;  2I5Q A;  2WDV A;  2WS3 A;  2QGY A;  3NH3 X;  1N5W C;  4APN A;  4Z24 A;  4K8G A;  3COX A;  4N9X A;  4A65 A;  4XWZ A;  4Z25 A;  2C3C A;  2C65 A;  2VQB A;  4M52 A;  1OEP A;  3T2Y A;  5BUL A;  1GEU A;  3LZW A;  1NAA A;  1VG0 A;  3HYV A;  4G6H A;  1DOD A;  4OPT A;  1JPD X;  3DGZ A;  4H4W A;  2YLX A;  5KXJ A;  1V59 A;  2V3A A;  4H4Z A;  5ENL A;  1KN0 A;  3SZW A;  4USQ A;  1GAL A;  3T4W A;  3IK4 A;  4B69 A;  1EBD A;  4U2L A;  3VR9 A;  2E4G A;  1F8W A;  1H6V A;  2B7S A;  3CGD A;  4X2P A;  4GRT A;  3QSE A;  3HZL A;  1CJC A;  4OCG A;  4Z1Y A;  2Y6Q A;  3TJ4 A;  4ECH A;  4D04 A;  2EQ6 A;  4H1Z A;  4ZCD A;  3DA1 A;  5KOX A;  1PXA A;  2WDR A;  3NHO X;  3MUC A;  1QJD A;  3KPK A;  5FS7 A;  1EL8 A;  2BS4 A;  4ZOH B;  3BNM A;  2Z5Y A;  4K1W A;  2YLW A;  1TYT A;  4AP1 A;  4DWD A;  1PJ6 A;  4CCQ A;  3IJL A;  1BGJ A;  2YVG A;  2B9Y A;  3SN0 A;  4J2W A;  4UDP A;  4G74 A;  2OQH A;  3VRA A;  3R11 A;  1BF3 A;  2BS3 A;  2CFY A;  2BXR A;  2X8H A;  1NHR A;  3VA8 A;  2I0Z A;  4RSL A;  1ZY8 A;  1TDF A;  1P2E A;  4G9K A;  3AEF A;  5G5H B;  5KMQ A;  2PU0 A;  4H19 A;  2XVI A;  1GES A;  2YLT A;  1ZMC A;  3TCS A;  3MSY A;  1JRP A;  5KVI A;  3OZY A;  3R0U A;  3DER A;  4EIQ A;  3LAD A;  4CNK A;  1R0M A;  1Q1R A;  1O95 A;  1NHQ A;  1JNR A;  4UDQ A;  1DTN A;  2WPE A;  2JKC A;  4EQW A;  3PK7 A;  5JCM A;  4Z2R A;  3CYJ A;  3R10 A;  1DJQ A;  3P4S A;  2XFO A;  4E4U A;  3ES7 A;  3DK4 A;  3BNU A;  3UKK A;  4U2S A;  1CJ3 A;  3KU9 A;  3NZG A;  1PXB A;  2O56 A;  3NN6 X;  1JDF A;  1EBG A;  1XDI A;  4XWR A;  1IUV A;  2HXU A;  4J34 A;  4MGG A;  4U8O A;  3NVZ B;  5IDZ A;  1PBF A;  1CC6 A;  4HB9 A;  1ZXI C;  3IC9 A;  1MOK A;  4NTC A;  3RP7 A;  3CNT A;  3SY4 A;  2WU5 A;  1TE6 A;  3CPH G;  2WPC A;  1IUX A;  1L9E A;  4G7F A;  3UKA A;  3AN1 A;  1MDL A;  3N4E A;  1JU2 A;  3L8K A;  3UXK A;  4GIS A;  2QCU A;  4B65 A;  4GUV A;  3UJF A;  3UOY A;  3NRN A;  2V60 A;  3Q4D A;  2AKM A;  3SYI A;  2QDD A;  3VQR A;  4PAB A;  2POD A;  1IJH A;  3P3B A;  3UCL A;  3OC4 A;  4LA1 A;  2GGJ A;  3TQP A;  3AE8 A;  2WP9 A;  5U63 A;  3ZVH A;  3D9X A;  4K5S A;  1CJ4 A;  3FCP A;  5HXI A;  3T14 A;  3SFE A;  4C74 A;  3RR1 A;  1PJ7 A;  3AD8 B;  3MQT A;  4U8K A;  2GMJ A;  4JHM A;  1OJD A;  2VRM A;  3GRT A;  3GYX A;  3NKS A;  4AT0 A;  1FCD A;  3SSZ A;  4OPC A;  2FJE A;  1GTH A;  4FK1 A;  1F8S A;  4MKS A;  2Q0K A;  2R46 A;  3UJS A;  4BJZ A;  4CY6 A;  1K4Q A;  3T6C A;  3GD3 A;  4U8J A;  2R9Z A;  1VRQ B;  2C66 A;  4H2N A;  1F3P A;  2X99 A;  1STZ A;  4M0X A;  4GME A;  3PWG A;  3S5S A;  1N4U A;  2PTX A;  2V61 A;  4J33 A;  2ACZ A;  3QN3 A;  4EM3 A;  2FKP A;  3DFY A;  1NEK A;  3OW1 A;  4HNL A;  4YTN A;  1D4E A;  2PHH A;  4BUR A;  1BQG A;  4J57 A;  4DSG A;  1ZP0 A;  1YKJ A;  1Q1W A;  2FJD A;  2Q7V A;  1PBD A;  3A7U A;  3AYL A;  3K7M X;  4C3Y A;  2WDQ A;  2WBA A;  3L5O A;  3II4 A;  3VDG A;  2TMD A;  4Z2U A;  1N61 C;  1EL9 A;  2X8G A;  3CB3 A;  2WET A;  2JAE A;  3UKQ A;  3UOV A;  2P8C A;  3H7V A;  4OPL A;  2NVK X;  4Z26 A;  3FG2 P;  4E8G A;  4K5R A;  1MUC A;  4DX3 A;  1JNZ A;  2B7R A;  1LTX R;  1E7P A;  2WP6 A;  1GSN A;  3B6D A;  3UJE A;  4DGK A;  3K7T A;  1LQU A;  2YG4 A;  3HRD C;  2W3R A;  1E6E A;  2BRY A;  3BI5 A;  2EQ8 A;  2YR5 A;  3BI2 A;  2R4J A;  2VZ2 A;  4EIP A;  3QFB A;  4JDR A;  3OPS A;  2JK6 A;  2NQL A;  2A87 A;  2ONE A;  3NNE A;  3ZDN A;  3NTA A;  2NPX A;  2H89 A;  4Z2T A;  4E0V A;  4K2X A;  2ZBW A;  4GIR A;  3SZ0 A;  2CHR A;  2GMH A;  4DNA A;  5C2T A;  3V5F A;  1KKR A;  2OKT A;  1L9D A;  3FJ4 A;  2YVF A;  1PDZ A;  3QJ4 A;  3DGB A;  1HYU A;  4BK3 A;  1GRH A;  1EL5 A;  1P2H A;  4HCL A;  2E1M A;  4JNA A;  4J3Z A;  2AL2 A;  2RGJ A;  1FEC A;  2YM1 A;  3T37 A;  4EM4 A;  3NRZ B;  4EMI A;  1FHU A;  4E5T A;  2GR1 A;  4H2R A;  3DFH A;  2ZC8 A;  3ICR A;  3VRB A;  4OVI A;  2PGW A;  2OFJ A;  3MZN A;  5FJR A;  4YSY A;  3ZVI A;  1BKH A;  1JRO A;  3BI4 A;  3V3W A;  4DYE A;  3DG7 A;  3DK9 A;  3F8P A;  1S7M A;  1PN0 A;  2MNR A;  4H4R A;  1N62 C;  1MRA A;  1NG4 A;  1BWC A;  3B3R A;  1KFY A;  3CGB A;  3AM9 A;  1RSG A;  1L8P A;  3OZ2 A;  3SX6 A;  4GDP A;  5GRT A;  2JB1 A;  1CJ2 A;  3NO1 A;  2Q6U A;  2F5Z A;  3AD7 B;  4IHC A;  1KNR A;  2FBW A;  1H82 A;  2C75 A;  3DK8 A;  4YKF A;  1M6I A;  1L9C A;  5IQ4 A;  2JB2 A;  1PXC A;  2A8X A;  1CL0 A;  3SXI A;  2PTW A;  3BOX A;  3UOX A;  2BRA A;  3I6T A;  1X2H A;  3NVW B;  2XH2 A;  2IVD A;  3CNS A;  4TM4 A;  3N6J A;  1TDE A;  3R07 C;  4B63 A;  4B66 A;  3U9I A;  3UTG A;  1F9C A;  3T0K A;  1MXT A;  2R0G A;  3NK1 X;  3NK2 X;  3ES8 A;  2AAQ A;  4YWO A;  5KRQ A;  4GCM A;  4O5Q A;  2QAE A;  3KA7 A;  3GD4 A;  4K8D A;  4M6U A;  1H86 A;  4LU6 A;  2PCE A;  2Q0L A;  1YQZ A;  1NHP A;  4A7A A;  2OZ8 A;  3DDM A;  4K2S A;  5U25 A;  1FHV A;  3U4F A;  3BSM A;  2XLT A;  3AEA A;  4GGH A;  2VVL G;  1E1N A;  1YQ4 A;  5CQF A;  2V3B A;  3IHG A;  1SJB A;  4F4R A;  4Z44 A;  5LV9 A;  3CN8 A;  3UCD A;  3OP2 A;  4GYP A;  5IPY A;  1VDV A;  2BAB A;  5BOF A;  3N6H A;  5JRB A;  1DOE A;  3NFU A;  1T3Q C;  1NPX A;  2CDU A;  4U8N A;  5M10 A;  3AEE A;  4PAA A;  3GDN A; 
#chains in the Genus database with same CATH homology
 5TR3 A;  4WCT A;  4U8O A;  5HYM A;  3ICT A;  3HYX A;  1JRZ A;  1D4D A;  1PBF A;  1CC6 A;  4HB9 A;  3L1R A;  4H4V A;  1TDO A;  3KVE A;  3SZC A;  3UKH A;  3GYI A;  4K7Z A;  1ZOY A;  1E1K A;  3IC9 A;  1ELI A;  1GOS A;  1MOK A;  3D8X A;  3ITJ A;  1Q9I A;  4JNQ A;  4NTC A;  4UDR A;  3RP7 A;  3CNT A;  3SY4 A;  3NYC A;  2UZZ A;  2WU5 A;  4GR1 A;  2WPC A;  1IUX A;  1L9E A;  3CPH G;  1L0V A;  3UKA A;  4K22 A;  3V3N A;  1JU2 A;  2WOW A;  3AXB A;  1Y56 A;  3L8K A;  2BK5 A;  5HHF A;  4BK2 A;  2R0P A;  3PS9 A;  3AE1 A;  3F8D A;  4H7U A;  4ZCC A;  4AOS A;  4C5O A;  2JBV A;  1ZOV A;  2QCU A;  3FBS A;  3SQP A;  5DBJ A;  5FS9 A;  4B65 A;  4GUV A;  3P1W A;  1IUU A;  2RAB A;  3UOY A;  3NRN A;  3ADA B;  2GVC A;  2V60 A;  1IUS A;  2B9W A;  2GB0 A;  4YKG A;  2YQU A;  2XFQ A;  3SYI A;  1TYP A;  3VQR A;  2GR0 A;  1JEH A;  1DNC A;  4U8P A;  3FPZ A;  1LJ1 A;  2XFP A;  4PAB A;  1IJH A;  2YG6 A;  3UCL A;  2BYB A;  4B68 A;  3OC4 A;  1TDN A;  4LA1 A;  4G6G A;  2BAC A;  4DSH A;  1GND A;  3NT6 A;  3QSS A;  3P4Q A;  3AE8 A;  2WP9 A;  2C73 A;  5U63 A;  3UKL A;  3QSM A;  2YM2 A;  2BCP A;  3D9X A;  1RP0 A;  4K5S A;  1CJ4 A;  3I6D A;  5HXI A;  1COY A;  1ZMD A;  1IUW A;  2C7G A;  3T14 A;  4NEW A;  4EQR A;  1EL7 A;  3AE3 A;  3SFE A;  1CC2 A;  1H7X A;  2YLZ A;  3V3O A;  4C74 A;  1PJ7 A;  3AD8 B;  1S3B A;  3SM8 A;  4U8K A;  1DXL A;  2GMJ A;  2QA2 A;  3I3L A;  5KMS A;  2GV8 A;  1OJD A;  2VRM A;  3GRT A;  3DJD A;  3EPT A;  1QO8 A;  3GYX A;  3NKS A;  3QVP A;  4BV6 A;  4AT0 A;  1FOH A;  1NG3 A;  2ZZB A;  3JSK A;  4OPD A;  1FCD A;  4EQX A;  4OPC A;  2FJE A;  2C3D A;  2GR3 A;  5FS8 A;  2B9X A;  2R4E A;  2OLO A;  1GTH A;  4FK1 A;  1F8S A;  1PJ5 A;  3SFD A;  3BHF A;  4ZN0 A;  2Q0K A;  2R46 A;  4BJZ A;  4D03 A;  4EQS A;  4CY6 A;  3ZYX A;  4X9N A;  2ZZ0 A;  4Y4N A;  1LQT A;  4MJW A;  1K4Q A;  4JQ9 A;  2ZZC A;  3GD3 A;  2PYX A;  3KKJ A;  3Q9T A;  2R9Z A;  1VRQ B;  2C66 A;  2XCG A;  4H2N A;  4OPG A;  3GWD A;  4U8J A;  4CRT A;  1F3P A;  5BVA A;  2IVE A;  2X99 A;  5ER0 A;  5BUK A;  3NYE A;  2V6O A;  5GSN A;  3QVR A;  1CF3 A;  2O9Z A;  1N4U A;  2V61 A;  2V5Z A;  4A5L A;  2BA9 A;  1F8R A;  1F6M A;  5KMR A;  4GF7 A;  5JCL A;  2HQM A;  4TM1 A;  4J33 A;  4CNJ A;  3NG7 X;  2ACZ A;  1E1L A;  2GH5 A;  2XLR A;  3GMC A;  1ZX9 A;  4EM3 A;  3RNM A;  2GQW A;  2J3N A;  1NEK A;  4USR A;  2ARD A;  3H8L A;  1D4C A;  4REK A;  5HY5 A;  4A79 A;  1OJC A;  3ATR A;  3NTD A;  4TLX A;  3WE0 A;  1PHH A;  1FEB A;  1VQW A;  4A6N B;  3IF9 A;  3IHM A;  4YTN A;  4J31 A;  2R0C A;  1D4E A;  2PHH A;  3GMB A;  3T31 A;  3ABV A;  2FJA A;  3ATQ A;  2EQ9 A;  2GRT A;  1N1P A;  4O5U A;  1GRT A;  4BUR A;  1S3E A;  3FIM B;  2AQJ A;  2YWL A;  1BZL A;  1LVL A;  2OLN A;  4XXG A;  4U8I A;  4J57 A;  4II3 A;  2YVJ A;  1TDK A;  4DSG A;  1ZP0 A;  1YKJ A;  3P4R A;  1REO A;  1OJA A;  1Q1W A;  2FJD A;  1PBB A;  2WU2 A;  2XYO A;  2YG3 A;  2BC0 A;  3LOV A;  4NTE A;  1Y56 B;  2Q7V A;  3H8I A;  3PG6 A;  1PBD A;  3RHA A;  1BGN A;  2CVJ A;  3CND A;  2WEU A;  3GDP A;  1H7W A;  3AYL A;  3AE6 A;  3K7M X;  2X8C A;  4C77 A;  4C3Y A;  1GT8 A;  2BC1 A;  2WDQ A;  4KX6 A;  2WBA A;  4G73 A;  3L5O A;  1OJT A;  3AE7 A;  3II4 A;  5JCI A;  1PS9 A;  1H81 A;  2TMD A;  2WP5 A;  4Z2U A;  3CPJ G;  5BRT A;  1EL9 A;  2X8G A;  2XFU A;  3G5S A;  1GRA A;  4A99 A;  1XPQ A;  2WET A;  4J36 A;  3S5W A;  3QFA A;  2JAE A;  5J7X A;  3M13 A;  3UKQ A;  3UOV A;  3NGC X;  3SGL A;  2XVE A;  1KSU A;  4OPL A;  4YSH A;  2YG5 A;  1LV0 A;  1B8S A;  2DKH A;  2NVK X;  1OJ9 A;  4Z26 A;  3FG2 P;  3C96 A;  3NIX A;  4K5R A;  3R9U A;  3K30 A;  3UP5 A;  1ZK7 A;  3KLJ A;  1DOB A;  4H4X A;  4FK1 C;  4YT0 A;  1JNZ A;  3GSI A;  2B7R A;  1LTX R;  3T2Z A;  3ALJ A;  1FL2 A;  3PVC A;  3AYJ A;  1E7P A;  2WP6 A;  1GSN A;  2RGO A;  3B6D A;  4P9S A;  4ADW A;  3UP4 A;  4U8M A;  3CGE A;  2C67 A;  1E39 A;  2OAL A;  4DGK A;  4NEV A;  1GV4 A;  3K7T A;  1LQU A;  1LPF A;  3CPI G;  1KDG A;  1Z6L A;  2YG4 A;  4C3X A;  4X4J A;  3UTF A;  3NK0 X;  3AD9 B;  1H84 A;  2VQ7 A;  2XVH A;  2Y6R A;  4YTP A;  3AEC A;  1GPE A;  3DME A;  1E6E A;  2BRY A;  4RG4 A;  4NNJ A;  4A9W A;  3BHK A;  3VR8 A;  3P9U A;  1GRE A;  4H2P A;  3T2K A;  2C64 A;  3BI5 A;  2EQ8 A;  2YR5 A;  5EB4 A;  3BI2 A;  1NDA A;  1D7Y A;  2R4J A;  2VZ2 A;  4B64 A;  1H83 A;  4CBQ A;  2X3N A;  2XLS A;  3QFB A;  3UTE A;  1GXF A;  4JDR A;  4EIP A;  2OAM A;  2JK6 A;  1X31 B;  3CNJ A;  4Z43 A;  2A87 A;  1VDC A;  1Y0P A;  4FDC B;  2DKI A;  4KPR A;  1B5Q A;  3NNE A;  3ZDN A;  2JB3 A;  3NTA A;  3GDN A;  1B4V A;  2NPX A;  2XFN A;  2H89 A;  3S61 A;  4Z2T A;  4HA6 A;  2GQF A;  4E0V A;  4K2X A;  2ZBW A;  2XVJ A;  3SZ0 A;  2VOU A;  3AE2 A;  1GET A;  2X50 A;  1D7L A;  2GMH A;  4ICY A;  4II2 A;  4DNA A;  4I59 A;  5C2T A;  1CHU A;  1KF6 A;  2EQ7 A;  5JCN A;  3ISH A;  3EAO A;  1JRY A;  1L9D A;  2YVF A;  5KWF A;  3AE4 A;  3CIR A;  1K0J A;  4BJY A;  3QJ4 A;  4IA6 A;  1YY5 A;  5L46 A;  2H88 A;  2WQY A;  1NHS A;  1HYU A;  2WDV A;  2WS3 A;  4U2T A;  2GF3 A;  4BK3 A;  3NH3 X;  4I58 A;  1B37 A;  1GRH A;  1EL5 A;  1PBC A;  4APN A;  1P2H A;  2WES A;  5KMP A;  3RED A;  2E1M A;  4JNA A;  4Z24 A;  3LZX A;  4H50 A;  4UP3 A;  2YLR A;  4OPU A;  2TPR A;  3AE5 A;  2RGJ A;  3COX A;  4N9X A;  3CMM A;  1FEC A;  2A89 A;  4IVO B;  2YM1 A;  2GR2 A;  4OPI A;  4A65 A;  3T37 A;  4EM4 A;  4EMI A;  4XWZ A;  4Z25 A;  1ZDL A;  2C3C A;  2C65 A;  2VQB A;  2GR1 A;  2XDO A;  4M52 A;  4H2R A;  1FEA A;  1GRB A;  3AB1 A;  3D1C A;  3ICR A;  3T2Y A;  3EF6 A;  3VRB A;  4AOX A;  4OVI A;  1GEU A;  3C4N A;  5BUL A;  1JOA A;  3LZW A;  1NAA A;  1VG0 A;  2C76 A;  3UKF A;  4YXD A;  3HYV A;  4G6H A;  4YSY A;  1E1M A;  1DOD A;  4OPT A;  1GER A;  3BI4 A;  3DGZ A;  3RP6 A;  4H4W A;  3NN0 X;  2YLX A;  3DK9 A;  4H4U A;  3F8P A;  1V59 A;  1S7M A;  5KXJ A;  2V3A A;  4H4Z A;  4IA5 A;  4GDE A;  1KN0 A;  1PN0 A;  4H4R A;  3P4P A;  3SZW A;  2R45 A;  4USQ A;  3H4K A;  1GAL A;  4H4T A;  5EBK A;  3C4A A;  4B69 A;  1EBD A;  1NG4 A;  1BWC A;  4U2L A;  1N4W A;  3B3R A;  1KFY A;  3DJJ A;  2BS2 A;  3UOZ A;  3CGB A;  1RSG A;  3AED A;  3VR9 A;  4H2Q A;  2E4G A;  2FJB A;  3OZ2 A;  3SX6 A;  1F8W A;  1H6V A;  4CY8 A;  2VVL A;  2WPF A;  2B7S A;  3CGD A;  1DOC A;  4GDP A;  5GRT A;  1PBE A;  2JB1 A;  5KOW A;  5KNL A;  4GRT A;  2CUL A;  4H4S A;  2BK4 A;  1CJ2 A;  3NLC A;  3QSE A;  3SZF A;  2Q6U A;  2F5Z A;  3HZL A;  1CJC A;  1K0L A;  4OCG A;  2Z5X A;  1SEZ A;  2C72 A;  2GAH B;  5FS6 A;  2YR4 A;  3G5R A;  3AD7 B;  3VRD B;  2XLP A;  4AP3 A;  2Y6Q A;  4FX9 A;  3KPF A;  4ECH A;  5IQ1 A;  3EAN A;  2EQ6 A;  1KNR A;  4ZCD A;  4LII A;  4D04 A;  3CGC A;  3DA1 A;  5EOW A;  5KOX A;  1PXA A;  5FMH A;  2WOV A;  2WDR A;  3NHO X;  1CBO A;  4B1B A;  1QJD A;  2FBW A;  3KPK A;  1H82 A;  5FS7 A;  1EL8 A;  2BS4 A;  2C75 A;  4BK1 A;  3DK8 A;  5KVH A;  4YKF A;  2YAU A;  1M6I A;  3BNM A;  1L9C A;  3F8R A;  5IQ4 A;  5J60 A;  2Z5Y A;  3GWF A;  2YLW A;  3DJE A;  5JCK A;  5EB5 A;  2W0H A;  2JB2 A;  1GRF A;  3AE9 A;  2XLU A;  2APG A;  1TYT A;  1PXC A;  1S2Y A;  2A8X A;  1CL0 A;  3SXI A;  4AP1 A;  1PJ6 A;  4CCQ A;  2C4C A;  1BGJ A;  1BKW A;  3ALL A;  4YSX A;  3LB8 A;  1O94 A;  3UOX A;  3M12 A;  2YVG A;  2BRA A;  2B9Y A;  1GRG A;  1JRX A;  3E1T A;  4TM0 A;  4J2W A;  2B76 A;  1CC4 A;  4UDP A;  3AEG A;  2YR6 A;  4G74 A;  4TM3 A;  2RGH A;  4H4Q A;  2IVD A;  1NEN A;  2GAG B;  3AEB A;  3VRA A;  1BF3 A;  1GTE A;  2BXS A;  4Y4L A;  5C3J A;  2BS3 A;  2CFY A;  3CNS A;  4TM4 A;  1TDE A;  2BXR A;  4TLZ A;  3ALM A;  2X8H A;  1KNP A;  1NHR A;  4RSL A;  4EMJ A;  1VG9 A;  2I0Z A;  4NZH A;  4B66 A;  1K0I A;  4B63 A;  3UTG A;  3IWA A;  1ZY8 A;  3Q6J A;  1TDF A;  4X9M A;  1P2E A;  4G9K A;  3T0K A;  4YTM A;  1MXT A;  3G5Q A;  3V76 A;  3AYI A;  2R0G A;  1QLB A;  3AEF A;  3NK1 X;  2VRL A;  1XHC A;  3NK2 X;  4IV9 A;  3LXD A;  3PO7 A;  2AAQ A;  4NTD A;  4YWO A;  1IUT A;  5KRQ A;  1ONF A;  5KMQ A;  4GCM A;  4O5Q A;  4EMW A;  2GEW A;  2QAE A;  4NWZ A;  3DH9 A;  1UKV G;  3GD4 A;  3KA7 A;  4JN9 A;  2BK3 A;  2WOI A;  4K8D A;  1PDH A;  3URH A;  2XVI A;  3ICS A;  4JY2 A;  3CNP A;  1GES A;  3DGH A;  2YLT A;  2AR8 A;  1ZMC A;  4U8L A;  3GYJ A;  4GAV A;  5KVI A;  2YLS A;  1H86 A;  3GRS A;  4GAP A;  5U1O A;  4LU6 A;  4YSZ A;  1ZKQ A;  4EIQ A;  3AWI A;  4AT2 A;  3LAD A;  1YQZ A;  2Q0L A;  1NHP A;  2QA1 A;  3NYF A;  4CNK A;  4A7A A;  1Q1R A;  1KSS A;  1O95 A;  4JY3 A;  1NHQ A;  1W4X A;  1M64 A;  3RP8 A;  3FMW A;  5U25 A;  3CTY A;  1D5T A;  3K7Q X;  1S2Q A;  2VVM A;  1AOG A;  1JNR A;  4UDQ A;  3UKP A;  2E5V A;  3M0O A;  2WPE A;  2JKC A;  2YG7 A;  2XLT A;  4EQW A;  3AEA A;  4B67 A;  5JCM A;  2VVL G;  1E1N A;  4Z2R A;  4H4Y A;  2XVF A;  1YQ4 A;  5CQF A;  2V3B A;  3IHG A;  3KD9 A;  1N4V A;  4WX1 A;  3UTH A;  1MO9 A;  1DJQ A;  4H4P A;  2WHD A;  4Z44 A;  3P4S A;  5LV9 A;  1YQ3 A;  2XFO A;  4CCR A;  3CN8 A;  3DK4 A;  3BNU A;  3UKK A;  4U2S A;  1CJ3 A;  4Y4M A;  3KU9 A;  5IPY A;  3DJG X;  1H2I A;  3O0H A;  1PXB A;  2BAB A;  4RG3 A;  2OA1 A;  3NN6 X;  1TRB A;  3LJP A;  5JRB A;  1XAN A;  1XDI A;  1DOE A;  5M0Z A;  5CKU A;  2IID A;  1RYI A;  4J56 A;  1DJN A;  3HYW A;  1NPX A;  4XWR A;  2CDU A;  4IVM B;  1IUV A;  4U8N A;  5M10 A;  1O5W A;  2C70 A;  3AEE A;  4A6N A;  4PAA A;  2BCG G;  4J34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...