3OP2A

Crystal structure of putative mandelate racemase from bordetella bronchiseptica rb50 complexed with 2-oxoglutarate/phosphate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
380
structure length
375
Chain Sequence
SLKITEVKAHALSTPIPERMRVESGAGLKLNRQMILVEVRTDEGVTGVGSPSGPYDLAVLKRAIEDVIGPQLIGEDPANINYLWHKVFHGEVSRSVGIAAMSGVDIALWDLKGRAMNQPIYQLLGGKFHTRGVRAYASSIYWDLTPDQAADELAGWVEQGFTAAKLKVGRAPRKDAANLRAMRQRVGADVEILVDANQSLGRHDALAMLRILDEAGCYWFEEPLSIDDIEGHRILRAQGTPVRIATGENLYTRNAFNDYIRNDAIDVLQADASRAGGITEALAISASAASAHLAWNPHTFNDIITVAANLHLVAASPHPAMFEWDITHNDLMTRLASYDLKLENGLVQPPQGPGLGFEIDWDFVAAHAWKGEPAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Putative mandelate racemase
publication title Crystal structure of putative mandelate racemase from Bordetella bronchiseptica RB50 complexed with 2-oxoglutarate/phosphate
rcsb
source organism Bordetella bronchiseptica
total genus 114
structure length 375
sequence length 380
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3op2A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3op2A01
2AKZA 5FJOA 4HYRA 3GO2A 2PA6A 3D47A 3ZLGA 3TWAA 1KKOA 4JN8A 3PWGA 3DDMA 4HN8A 3BJSA 4H19A 4DXKA 4GYPA 3VFCA 4K8GA 1MNSA 3TQPA 4F4RA 4HNLA 3TW9A 3IJLA 2QQ6A 4DN1A 3DG7A 4KT2A 1P48A 2PGWA 4ROPA 2PCEA 3R1ZA 1MRAA 2P0IA 2ONEA 3OZYA 2HXUA 3VC6A 1L8PA 4IL2A 3T8QA 2OQHA 3CAWA 4IHCA 2XH7A 2PPGA 4A3RA 4DYEA 1MDRA 3DG6A 3DG3A 1MDLA 1KKRA 2MUCA 2FYMA 3QTPA 1BQGA 2CHRA 3EEZA 1EC8A 3NXLA 1SJCA 3OW1A 7ENLA 4DHGA 1IYXA 3UCDA 4G7FA 1F9CA 2OLAA 3UJSA 1WUEA 2GGGA 4H2HA 3UJRA 4DWDA 1R6WA 2GGJA 3NZGA 4KWSA 2P88A 4YWSA 4KEMA 3SSZA 3V3WA 3VA8A 1NELA 3TTEA 3RO6A 2PTZA 5BOEA 2OVLA 4GYPC 1PDZA 3MQTA 4GISA 3SN1A 3UXLA 3MZNA 3FVDA 3SJNA 3PK7A 2POZA 1RVKA 1W6TA 2PP3A 1KCZA 3R0UA 3CT2A 4H83A 3DEQA 3OPSA 3UJFA 5BOFA 3THUA 2DW6A 3VC5A 3CYJA 3PWIA 2QDEA 3TOYA 3DFHA 5FJUA 4Z17A 2XH0A 2OG9A 1SJAA 3R25A 3UJ2A 2ZC8A 3QN3A 6ENLA 3DERA 4ENLA 2PP0A 1PDYA 2FKPA 2OZ8A 3GD6A 5J04A 3Q4DA 3UGVA 2PU0A 4IP5A 1SJBA 3U9IA 1R0MA 3RCYA 4GMEA 3NO1A 1ONEA 1WUFA 5IDZA 2QDDA 4G8TA 2GGHA 2O56A 4GGHA 2PS2A 2PP1A 4IL0A 4KPLA 3I4KA 2OFJA 1EBHA 2AKMA 3ZLHA 1P43A 1KD0A 3N6JA 1EBGA 1ECQA 3CB3A 2AL2A 3STPA 2OKTA 3FYYA 1EC7A 3IJQA 1TZZA 3MY9A 2OO6A 4DX3A 3ES7A 1JPDX 2OZ3A 5EU9A 3MUCA 3P93A 4IT1A 2GGEA 3V5FA 2PTWA 3I6EA 2PU1A 3I6TA 3MKCA 3Q45A 4GIRA 4E5TA 1JCTA 2XH4A 1XPYA 2XGZA 4HCHA 3KUMA 3ZLFA 3ZVHA 3ZVIA 3PFRA 4HNCA 2NQLA 3SBFA 3R11A 4A6GA 3N6HA 5ENLA 4E4UA 4J3ZA 4E6MA 2OX4A 1SJDA 1XS2A 1FHVA 2PMQA 2XH2A 3P0WA 3RITA 4E8GA 3GY1A 5FJRA 2QJNA 3FXGA 4IP4A 1DTNA 2HXTA 2OPJA 3K1GA 3BOXA 3UJEA 3FJ4A 3SN4A 2OZTA 3FV9A 3T9PA 1YEYA 4HCDA 3RR1A 3OZMA 2GL5A 1JDFA 2GDQA 2OQYA 2AL1A 3SN0A 3DIPA 2PTXA 3BSMA 3TCSA 4A35A 1TKKA 3OP2A 3R10A 2GGIA 3IJIA 1EC9A 3DGBA 3S47A 1JPMA 4FP1A 1E9IA 2GSHA 3FCPA 3UCCA 4HCLA 3QKEA 1FHUA 2QJJA 3IK4A 4JHMA 2PODA 3TJIA 4IZGA 4H1ZA 3TJ4A 3H12A 4K1WA 3V5CA 2P3ZA 3OTRA 3VCNA 3D46A 3HPFA 2PTYA 4M0XA 2PGEA 1OEPA 3N4FA 3NFUA 1BKHA 3SQSA 1TE6A 2XSXA 3JW7A 2AL2B 3JZUA 4MGGA 3T4WA 2P8BA 2HZGA 3U4FA 4J1OA 2ZADA 3VDGA 4MKSA 2DW7A 2PSNA 2MNRA 3EKGA 4GGBA 4ZA0A 3GC2A 5FJPA 4EWJA 3QLDA 3TWBA 3RGTA 2QJMA 2QVHA 2I5QA 3DESA 4JN7A 3ENLA 5FJTA 3ES8A 4FI4A 1NU5A 2HNEA 3H7VA 3V4BA 3B97A 2P8CA 3T6CA 4X2PA 4Z1YA 3DFYA 3P3BA 3N4EA 3VCCA 3UXKA 3ZVHB 3RRAA 3JVAA 3H70A 3S5SA 1MUCA 3MWCA 3R0KA 3CXOA 4GFIA 4K2SA 4M6UA 2RDXA 1ELSA 3MSYA 3H8AA 3CK5A 4E4FA 4MMWA 4ZCWA 2QGYA 4HPNA 3QPEA
chains in the Genus database with same CATH superfamily
1NY1A 2AKZA 4MM1A 3USBA 3CQHA 4DI9A 1A4MA 3MS8A 3GXNA 2BV9A 3CC1A 4MB5A 3I3EA 4K37A 3TWAA 2HQAA 3AUOA 1QNQA 3PWGA 4AZ6A 1IGWA 1KCXA 1PZ3A 2QAEA 3NXFA 4O50A 4XV0A 3RCMA 4WRHA 1TZ7A 2C15A 3HIJA 2ZYFA 3AJ7A 1O12A 3TW9A 2NQ9A 4J9JA 2BC0A 2GK1B 2R1MA 3WUEA 3T42A 3NDZA 1UP3A 3QV8A 4ROPA 3EDJA 5CJMA 4JS3A 1WZMA 4F66A 3FKRA 4JYFA 1NP2A 3CAWA 3G3DA 2BY0A 4EACA 2E6FA 4AVFA 3NWRA 4P8XA 3K4AA 2OMAA 3REQA 2BDQA 2WMFA 3C3NA 3OBKA 3AU2A 3QTPA 5DEZA 5CSSA 4QS6A 4YCOA 1X1ZA 4D1JA 4ACZB 1R3TA 2ZX9A 2CW6A 1HJUA 3O63A 3CPUA 1EWDA 1DOSA 4ZO9A 4GE8A 4HN4A 4LC8A 4I6VA 7ENLA 4U2YA 3IARA 4DHGA 3LD5A 3LI1A 3GRSA 3KWXA 4LOCA 3UJSA 3Q94A 1AQ0A 3WMBA 2GQAA 1WUEA 2ZZ5A 4H2HA 3FDKA 3APGA 3AHVA 8RUCA 4HMEA 1RBAA 3HRDC 3VA8A 3T2PA 1PTGA 3M0MA 1Q6GA 3QV7A 2H9AB 2R91A 3GK0A 4TVWA 3MYPA 4CD6A 4QHRA 1UA7A 4MPQA 3HQ1A 2OZ0A 4U28A 1W6TA 4ZB5A 3S5OA 5FESA 4GNKB 1B1YA 1GOKA 3T0CA 3UR2A 2DIJA 3UNTA 2ZUTA 4QSHA 2BWGA 3VPLA 2WBGA 1F7BA 1G1YA 1N63C 2HROA 3QFWA 3OPSA 3UJFA 5FA5A 1EOMA 1MOKA 3DFHA 2XH0A 3V0TA 1AA1B 3H22A 1GVOA 3QMSA 2IXUA 3NR0A 1XIIA 1ISYA 4HIBA 2XJ7A 3NGFA 3W26A 3FEMA 3KHJA 3QSRA 4FX7A 1E0XA 3S2CA 4GWEA 4FO4A 3U9IA 2WPBA 3M43A 3RNDA 2QS8A 5T9BG 2RAGA 3TONA 5FAGA 4H2CA 2O56A 3CGEA 5LNWA 4H9TA 3CHEA 4PR4A 1LQ2A 1OQFA 4W7UA 3EZ4A 4TVDA 3PJXA 5BROA 5AHMA 4GZ7A 4BKNA 3O0KA 1ALDA 1T3QC 1ECQA 2IKGA 4HTYA 4S2CA 4EPKA 1W2VA 2QCFA 3STPA 3MYOA 5CXPA 2I9UA 4KRTA 1VIWA 4NJKA 1V6XA 1KFBA 2YCLA 3LHUA 4DJEC 1Q2SA 3IV8A 5I3DA 2VO5A 1DL3A 3WNNA 1EP2A 4LVFA 1EB3A 2NXHA 3VIKA 1I0DA 1PVNA 1XDLA 4J40A 5DFAA 4UTFA 3W4RA 1LT8A 2XIIA 1JAEA 3BLLA 4MJZA 2ZZ4A 4HU4A 3OG3A 4PCSA 4IG2A 4DO6A 4FZIA 1V79A 3WQVA 1D3GA 1UR2A 3G8RA 3EDKA 4MNKA 3WUBA 2YL5A 3IIPA 1I6NA 4I8YA 3TN5A 4U10A 3PBYA 2PDIA 4JOMA 5ER0A 3ARZA 4LUSA 3WLKX 1CI1A 1V6VA 4RZ4A 4OECA 1VBRA 2HISA 2QCHA 3T08A 4B4HA 3NZQA 2QMJA 1JPHA 2J66A 1JQXA 4DXVA 4HGXA 1C3FA 2WXDM 3GVWA 5GRTA 4JFWA 3AMZA 3OJGA 1YTDA 3SJ3A 1H0IA 2JE8A 3GVGA 2ANUA 3AXHA 3FJ4A 1LG2A 4O52A 1TO3A 1AJZA 1WCGA 3ZR6A 1OJXA 3GG0A 1JL8A 1FOBA 2ZFAA 2INFA 3VKAA 3K1DA 1KWKA 3WJYA 1O5XA 4PMOA 2F7FA 3ARRA 4RE4A 2NZLA 1Q7MA 2EPLX 1S2CA 5G2IA 1E70M 2EPOA 2ZA2A 3URQA 2CETA 1H7RA 1CLXA 5ABFB 1QUMA 4LXFA 3NSNA 4K1WA 3TYAA 1QHOA 4O11A 1GTHA 3VCNA 1TWWA 3PBWA 2ZZ7A 1H7PA 5I3FA 4IPIA 2E8ZA 2FGLA 2RUSA 3L67A 5M03A 1V59A 2BXVA 1AH3A 3AYRA 3UZZA 2C71A 3WK2A 4ERIA 4HK5A 2TODA 3TQVA 2YA0A 2H3BA 2PGFA 5AYZA 2MNRA 4PMDA 1FBAA 4ZOEA 2A3EA 4W8AA 1E1EA 2I5QA 3DESA 4UR8A 2V3GA 3TV8A 5DBUA 3ES8A 4J3VA 4FI4A 1NU5A 1HUVA 1A0EA 1XINA 1AH4A 5A69A 5EA9A 5CC5A 5JBFA 3B3DA 4NAFB 2P8CA 1BVWA 1F73A 1X6NA 3ZJ6A 4B9YA 1PS9A 3HG2A 5FAJA 3GC4A 4BQ5A 3MV01 4Y2WA 2CZVA 4UCGA 4XAZA 1N5XA 3ETRB 2QT3A 4IIGA 4CNTA 4D1IA 1K8XA 2XVGA 4M51A 4DBEA 4GXWA 4HPNA 2QW5A 3D47A 2KAUC 4US6A 1W1VA 1EPVA 3LXCA 5DCDA 1S7MA 3WH6A 4K8EA 4CN6A 3E6EA 1P6BA 4NRSA 4Y9OA 1I2NA 1MNSA 2BVWA 4IJBA 3VNZA 3OC4A 1LRTA 1OFEA 4FLRA 1KBKA 3F2CA 3L4TA 1V51A 1DP0A 1TA3A 1OYCA 3FX4A 3DG7A 4JFTA 3ZOAA 1K9FA 1RY0A 4K6AA 3OZOA 1PB0A 2BHYA 4LS2A 1XPGA 1L8PA 2OQHA 3C0JA 4FAMA 3LU2A 4A3RA 4B3KA 2NVKX 1EZ2A 4O0ZA 5H91A 4DPPA 4GYJA 3VM7A 3FG2P 1EH9A 1XLFA 1UWUA 1NARA 2VNCA 3TH6A 4AD3A 2Y24A 4M1RA 4OKDA 1PWMA 2OTDA 1GK8A 3E0FA 1A50A 4EPEC 2XUCA 1NFPA 2R24A 2GR2A 3W7QA 4KF1A 3TC7A 4GLEA 4GO8A 2DUAA 4CQAA 4XKMA 1PIGA 3VGHA 1H1YA 1W3JA 2A4AA 1BD0A 3USZA 1KFCA 3SGZA 3OA5A 2PTZA 5E09A 1GQKA 2CCRA 3BW3A 1WDPA 1Q6LA 3UXDA 1DXIA 3UXAA 1FCVA 3S1VA 1X7FA 5AYYA 1H41A 4RZ6A 4H6QA 2NW0A 3R94A 1J5SA 2WK2A 5HNNA 4AHOA 3VX0A 3W2MA 5LKYA 3LXBA 5F2IA 1LRQA 3HV9A 1VQTA 2HMCA 2Y61A 1QHPA 1F3PA 2WP5A 5D33A 4NX0A 2J78A 4HPXA 2E9MA 4KETA 3KDOA 3V16A 4PUDA 3WL1A 3P62A 4HK6A 1VBGA 3W1AA 5CSUA 1JAKA 2PFHA 5JH2A 1V6UA 2CZDA 1EOKA 3G8EA 4P8WA 2QUUA 2YZ5A 4DNHA 1GYNA 2QF8A 3RLHA 2Z2AA 5KMYA 2VRQA 2QIWA 4JTTA 1EO5A 3A7UA 3QRHA 4RX0A 3KRZA 2PDPA 3ES7A 1O94A 1TFVA 3VOJA 1S2UA 3VKJA 4F3HA 3W53A 3AAMA 4IMCA 3BZGA 4NILA 2PTWA 3C4UA 3CZEA 5LHFA 3FKKA 4F2TA 5TR3A 4GIRA 2IQ0A 4OUIA 1W56A 3L2LA 3HPAA 4NZ5A 1JCTA 2FZ9A 2REQB 4ZB0A 2XH4A 1XRFA 2EGZA 3IAPA 2W0UA 3IUIA 4QCEA 2X1SA 4LJ3A 3T8LA 3WCZA 3GSMA 1ZHAA 2QKFA 3AIEA 5F1VA 3VMPA 1OGBA 3ZT5A 3VGBA 2PWGA 1EJTC 3QPYA 3P61A 2QCGA 3OIHA 1JR1A 2GUYA 4HU0A 1VYPX 4AHQA 1AUSL 3BDKA 1PKYA 3C2YA 3V0SA 1QOXA 4UOZA 3CLWA 2AQOA 2Y8UA 1W91A 1MYRA 2WMKA 4FX8A 3DFOA 2WO5A 3B9AA 3JZEA 3KS5A 1TPWA 2CKSA 4LU0A 2WBAA 4JFUA 1EJUC 4RE2A 1IQ8A 4H8VA 3Q58A 1HT6A 4UXDA 1MEHA 3UJEA 5CPQA 1CBGA 3B4UA 1KTBA 5LSMA 1E6QM 2OQYA 5D8WA 2CESA 3BUVA 3GDMA 4YPJA 5BXPA 2GJLA 3N2XA 1U5HA 1YXCA 4L4LA 2VEPA 3HPSA 4QM1A 1AH0A 2WOVA 3AOFA 3SY8A 1ICQA 4IGNA 5BRPA 4P8UA 1JCXA 1OVDA 4FNSA 1BWCA 3WJWA 2G97A 1CW2A 2ASHA 1O95A 3TJIA 3HOJA 1T0OA 3MBFA 4GQQA 4PTNA 2P3ZA 4NYYA 4K7ZA 2QCCA 1XSKA 4GRTA 2H3DA 3SQSA 1R38A 3JW7A 1VPXA 4EWND 3R58A 4KEZA 5JCMA 3EOLA 2VOMA 3MUXA 3WYZA 4LVAA 1RHCA 1UCWA 4GGBA 5C2GA 2E9LA 3MSRA 2H90A 1DBTA 2WMIB 4JN7A 5BW6A 3NS1B 3B0XA 2O9PA 1HZYA 3AWOA 1NHQA 4TU1A 5LIXX 3WLOA 1BYBA 4AZGA 2WM0A 3UEQA 2W3SA 1Q66A 4MJMA 5EMYA 2WVVA 1XBXA 2JKAA 3NM1A 4Q8WA 2ZVRA 5XIMA 3SRFA 4MY9A 4ZOBA 5A2AA 3JVAA 5EBKA 3H70A 4PRTA 4RCXA 3N12A 3GU9A 2WZIA 7PTDA 4IMFA 3LB8A 3N9KA 4NUWA 4CQ9A 2DH2A 4JTLA 1I2RA 3L4XA 4IJRA 2RJHA 3GNRA 4IH3A 4XD4A 2Q71A 2GQ3A 2FJKA 4PTDA 3L65A 1KRCC 2YDSA 4WSKA 3H2CA 4A8NA 2A7NA 3SCWA 3GRTA 1NDYA 1FH8A 5AHEA 4LV9A 1YQZA 1YDYA 3SGUA 3FYOA 3ATZA 2J7HA 4FOJA 1GQNA 4YTUA 4UZUA 3M64A 4Q4OA 3KOXA 2PRHA 4IM4A 1MMFA 3CUFA 1QNRA 4J56A 4H19A 1RJPA 2XIQA 4DXKA 4KS0A 4D6GA 1SO5A 4LB4A 2Q8ZA 4OQVA 4Q8PA 3WEOA 1FWGC 1T7LA 4H8UA 2Z29A 2WKJA 4FR1A 1TTIA 4RPQA 3NIYA 3VINA 3OHIA 3THCA 1MRAA 1DJYA 2F6XA 4JICA 2D69A 4ICCX 3WQFA 4REQB 4IL2A 3G1YA 3SFWA 3ITVA 4EQXA 3UP8A 2V68A 4DYEA 1EKOA 2YX0A 3DG6A 2ZUUA 4C1KA 3VNYA 1OB0A 2FDSA 3GBDA 5FS7A 2OWXA 4E4PA 2Y63A 2F6UA 1XP3A 3GR4A 1P6WA 2NQ5A 4W7VA 5I3IA 1K8YA 1EF3A 3RR4A 3WF0A 3ABOA 1SR0A 3W38A 3IJ8A 1ODUA 1HFBA 3AIVA 3M0HA 1VIZA 2E1DA 4AC1X 4G7FA 1VBJA 2V5DA 2WJDA 2H9AA 2J88A 4F48A 4MHBA 1GJWA 1FFVC 1MEWA 4JKMA 3B9JB 3N3MA 2BNJA 3WLHA 1OGSA 2E5CA 3WQCA 2CC0A 3DK4A 1KQYA 3B0VC 1XRVA 4BK9A 4DZIA 3RO6A 3EUB3 5LIYX 1OYBA 2O4QA 2OLSA 2X8CA 1HO1A 3UR7A 4UOQA 4ML9A 2PB1A 2WHJA 1EDGA 4I5RA 2PRMA 4B5UA 2CYGA 1VH7A 2POZA 2PP3A 1H63A 1MXGA 1WDDA 4GBUA 2BOGX 4XX6A 1W0MA 1WKDA 1XH1A 3AMGA 3UWEA 2ZKMX 3AS1A 2ISFA 4AFYA 3OGSA 1XW8A 2X30A 4RNIA 5DT5A 4B2DD 5A2BA 4NAEA 2HE5A 3LPFA 3QR3A 1GQIA 1GVYA 3VZXA 3CV2A 4KKXA 3AIRA 6ENLA 3DERA 3W7RA 1SYTA 4GVGA 2QF7A 3TNBA 1MFUA 3Q4DA 4XSMA 3OGRA 2V2CA 1E9YB 1TX0A 1WXJA 4C90A 4PZVA 1ICPA 4QCFA 3B8DA 3KS6A 5H8PA 1A0DA 4G9PA 2HCVA 5TQLA 3RG6A 3UWWA 5I5RA 3CUIA 3AZSA 2Q8XA 5GNZA 2ZXBA 1QWKA 3GHTA 4AD4A 2WP6A 1Q1WA 3AJXA 5EGRA 4MNMA 4MG4A 4O15A 1V02A 1P43A 1GONA 4ZO7A 4J2MA 2FVMA 3M0YA 4NKCA 4GUGA 2ISWA 4X9YA 5I3KA 4IXXA 4AZ5A 3WDIA 2DH3A 3NQBA 2O9RA 3D3FA 3VNIA 3V1PA 4MF4A 1DQXA 3ABXA 1OF6A 1EGMA 3A12A 3THQA 4DQWA 1LOLA 1U1HA 5CPLA 5HUOA 5FMHA 3G5EA 4MWAA 4CLMA 1M6JA 1PPIA 2JKPA 4XQ6A 3LZ5A 3M7SA 1W54A 1KO0A 1VBUA 1HVXA 1B9BA 1IIHA 3RIKA 1ZP3A 4Q6XA 2V5CA 1R7AA 1TV7A 5JCKA 3ZVHA 3IAQA 3IGSA 1MI3A 1MO0A 4WOQA 5DELA 5REQA 3BOFA 1RCOB 4L64A 3KXQA 2O7SA 1XD0A 4HYVA 4O1FA 4JAWA 5I7GA 3OYZA 4ZQPA 1FWBC 5E0CA 2WVSA 3MMTA 1OFQA 3AMDA 5J5DA 4M82A 4JBRA 5K9XA 2OQLA 1BF6A 3PUDA 1CXEA 1BHGA 3UBPC 4FMVA 2PRLA 2IPFA 3AXMA 5ABGA 4NASA 4ALDA 2J6XA 3CL7A 3LV5A 3NPVA 2ZOXA 4XZIA 4HU3A 3SN4A 3W6LA 4PMYA 4MDPA 3E3HA 2YQUA 1FDYA 1DE5A 3LA4A 2VFEA 4GIYA 4C6CA 4IGSA 3BLOA 4C91A 1MZHA 2PDWA 4IMDA 4DELA 3VYLA 4OGZA 3WO8A 5ABFA 5FF0A 3TXVA 1E9IA 3VXGA 1TV3A 5XIAA 3U0HA 2V5BA 2Y5SA 3SGGA 3WL0A 1GORA 1R9ZA 3GH5A 2DPEA 5A6SA 3KLJA 2EKCA 3NVWB 3PULA 1RVGA 4IZGA 2D3NA 3T40A 1ZAIA 3CJPA 3H12A 4Y6GA 5C9ZA 2Q3RA 3HQPA 4M56A 3UPMA 2WKLA 4LEQA 2A5HA 4ICNA 4L9YA 2OCZA 3P81A 4M52A 2QAFA 2P8BA 1RD5A 2FZMA 2O55A 1O66A 3VMOA 4CQDA 1E51A 3E2VA 1Q3NA 3AS3A 2AAAA 4JQAA 1RJRA 3H24A 1TR9A 5DXXA 3SCRA 3WF2A 4J3UA 1E72M 3BMXA 3A3WA 1S2TA 3K46A 4O18A 3VZYA 1XLBA 3H7VA 3BAWA 3UWZA 1LOQA 4Q6JA 4DJDD 2NUWA 1F6KA 5B80A 2PTDA 4RKAA 1Y5WA 3VILA 3T0TA 1LUCB 1OD8A 1S5VA 4GI8A 4OOUA 4DNAA 2HQMA 1VEMA 3HG4A 3WF1A 3W87A 3N2MA 1QTWA 2ESCA 1JRBA 4DZ5A 2DUXA 2WANA 3GKFA 1VDVA 1GW1A 3DC8A 4AY1A 1EUNA 3FJLA 1JROA 3VZZA 3ARXA 4CQ8A 3EOSA 4HA3A 3DN5A 4S3CA 2WJFA 1KRBC 1RK5A 3EMCA 2NQZA 5I07A 4RPPA 4CU8A 2QYGA 3TE9A 4MZ1A 1V6TA 2BC1A 4L1XA 3UWVA 3ISIX 5CGQA 1OFRA 5FOOA 1V8EA 1VBHA 4HMNA 4PRRA 1A5AA 4URIA 5F4WA 3W29A 4W9TA 2XM2A 3MV11 4H9MA 1FFUC 3GAKA 4Y9PA 2X42A 4P7RA 3UESA 2CXGA 2PGWA 1TZ9A 3GD3A 3RO8A 2BHZA 4DJDA 3AHYA 1Q2RA 3PZQA 1UWTA 1F4AA 3W1QA 2FGZA 3T8QA 4KERA 3QV9A 1DYSA 4ORMA 4Q22A 3GIYA 1YPFA 4AIEA 3HF3A 2ZA3A 1ZJBA 4QX4A 4RLIA 2IKJA 2D2HA 1I2OA 3AHXA 4RZBA 1LLWA 2VEMA 7TIMA 2PWHA 1PO9A 4O12A 2Z2UA 2V67A 3RJYA 1K77A 1E4MM 2D22A 2XN1A 3CB8A 3NXLA 5JXQA 1JOAA 4H6EA 4LB3A 4ZQMA 2AMXA 2WHKA 3W7JA 2WOWA 3AISA 2V3DA 5HMSA 1OD0A 2OLAA 5LIUX 1XLAA 2ZDRA 1M5WA 3T4CA 2ZX5A 2I1OA 1I1WA 4P2VA 3EYPA 4FDCB 2Y8VA 5AKQA 4ZZ9A 3O8AA 4PB5A 3AC0A 2ZUSA 2PWFA 1DIOA 4TVCA 1ZCOA 1PDZA 2VENA 3V1HA 3RX2A 3TZFA 1IE7C 3VDAA 1C8QA 1W5QA 4KQNA 4MFDA 3I10A 3S6DA 1JJKA 4JTFA 1M65A 1SO3A 1QBAA 4RNFA 1DWFM 2VZVA 3MMWA 3SAZA 3WH8A 3O06A 5A8MA 1BLIA 1EYEA 4ZMGA 3GXIA 4TTUA 4QGCA 2A1YA 2BS9A 4I7WA 4RDZA 3GZAA 4NZJA 2X0YA 2DSZA 3N17A 4NZ4A 2QDGA 3A3HA 4PUMA 2X7VA 4MLRA 4UTWC 2CLFA 5AVHA 4PUNA 4YXGA 1QHZA 2OT1A 4J35A 2PP0A 5A2CA 2YCIX 4FOUA 3MTWA 4FNTA 1Z7AA 7A3HA 1WDSA 4NF7A 4B92A 2ZX6A 1SJBA 1FWWA 2E40A 4L4MA 4TVUA 3GXFA 2PAJA 4LBSA 5CJNA 1CGWA 1ONEA 2CLEA 3UZWA 4B9ZA 3FHAA 3EX1A 4K8HA 4LRSA 4G8TA 1OF8A 4ML4A 3AZTA 3D0CA 3R13A 1YE6A 4BY3A 4UWMA 1FCBA 2X99A 4IFOA 1FH9A 1XWYA 1EP1A 1KD0A 4NZFA 4IICA 2QCMA 1GHSA 3L5AA 2XZ7A 3PPFA 2GRTA 1LL4A 3ZJ8A 4R3UA 4V27A 1NDVA 4UQEA 2Q09A 4R7WA 2TAAA 4O1CA 2YA2A 1DJZA 2B81A 5CZJA 3GU2A 4O4VA 4J3TA 3H53A 4IPJA 2V8ZA 3G1XA 3AMCA 3I3BA 2QUTA 3ZR5A 3ELFA 3ZS4A 1K8CA 5I79A 1CPUA 3LPPA 4LAMA 4XZNX 4H4YA 2JKEA 5M17A 1B5TA 4OE7A 4ICMA 4ZR8A 2GWGA 1C8XA 2PZNA 3L4ZA 1NAL1 4APNA 5I2UA 1TMHA 3FAWA 2NX1A 3NO5A 3SBFA 4RXFA 2DT2A 3N6HA 4NXKA 1IT7A 2EG6A 1B57A 1TYTA 5HBFA 3LTSA 1ADOA 4N2YA 1ONXA 1FHVA 1E43A 1I60A 7REQB 3VO0A 1TPC1 5CSYA 3GB6A 1WX0A 4NY2A 4KCTA 1LF1A 3A5FA 4TMBA 1FDJA 1ZY9A 4NYUA 4W87A 3M47A 3H4XA 1F05A 3DH7A 2PEVA 5FIPA 2WCSA 4DWSA 2HXTA 1KN0A 5F2MA 2FPYA 1GXFA 5BRBA 3T9PA 8XIMA 4C6PA 4XBSA 1HXJA 2AL1A 1I2PA 4EQRA 4B91A 4GC3A 4IJCA 5EL1A 4GKLA 2KZHA 3S1UA 3S5YA 1WPCA 2DY3A 3P5YA 3U5UA 2F9RA 3AN1A 1ONRA 1SQ7A 1YPIA 3OOQA 3ABSA 4UTTC 3SCSA 1OT2A 4JX6A 4AQLA 4AY8A 3JRKA 2E67A 4KRUA 1ZAJA 4O8RA 3WLJA 1GYLA 2UY4A 3AHZA 3CUJA 4M6QA 5GQBA 5A5WA 4N9DA 3DYOA 3HO8A 4P61A 2QPSA 3QYSA 5U4NA 1E15A 3SI9A 1CLVA 1FWFC 4IX2A 3N4FA 3RPTA 1E6RA 4H9XA 4MOZA 4U3AA 4JX4A 2EEXA 3M44A 2WMIA 3U4FA 4FX6M 4JKKA 1GTEA 4HOWA 4NI8A 3M0JA 2A7PA 4PUKA 4XTDA 3BL3A 3KTCA 5MKGB 1TUXA 1I2QA 4Q8QA 2VD8A 1SFLA 5CAKA 5BXRA 4L65A 1E71M 1QI3A 3G0SA 3GNDA 3SRKA 1ME8A 1KA9F 3NDOA 1Y5VA 1G9HA 1QW7A 3DECA 3S6OA 3MVIA 4JEQA 4M7SA 1GOQA 2P50A 4HVXA 3VVGA 1F76A 5CZTA 2WC3A 2WB5A 3VGDA 3NPUA 1YYAA 4LF1A 2Q3OA 3O15A 3GNOA 4Q7BA 3MSYA 3B8TA 3QW4B 4H6KA 3MWAA 1IR1A 5FEXA 2PWVA 3GO2A 3UYCA 3VNLA 1SW7A 2HRWA 3CMFA 4AVNA 4F0SA 2YSWA 1GG0A 4F0RA 4LAKA 3ZFHA 1REQB 4XO7A 1AMKA 4UNIA 4KFNA 4YL2A 3TQPA 1G67A 3QC3A 2IPJA 1W9BM 4RJEA 2PDYA 4R9XA 5G5GB 2VFGA 5AC5A 4E8DA 1P48A 3H21A 3W1RA 3TJLA 2E28A 3WUGA 1DWIM 1JF6A 3EMQA 4JN6A 2ONEA 2AMGA 3N18A 2OYKA 1Q6OA 5MHBA 4O1BA 3E0WA 4NVTA 1M04A 4EPBC 3UWQA 3D6NA 1NDZA 2FTPA 4I7VA 4LUJA 3OQ8A 1ISVA 3AYTA 4XVEA 3K8KA 1XDJA 5HWJA 1IWBA 4EF8A 3H2NA 3OVGA 4AF0A 1X1OA 2NX3A 1ZALA 3EEZA 4MKNA 3NQAA 2CKRA 1Q85A 2OSYA 3FK4A 4KESA 1P0BA 3PF3A 3ZWSA 1EC8A 1M3UA 1B9ZA 2QUVA 1VFLA 1EJ7L 2ALDA 3A4AA 1HIZA 3EF6A 8CGTA 5JCLA 4QQUA 1GRBA 3LPGA 3PAJA 2GFTA 4XZMX 3E2SA 3CQ0A 4NHVA 3KOYA 1D3CA 3AICA 4LALA 1XUUA 6PTDA 1W3HA 5EB8A 3LY0A 2G95A 4ES4A 3CV6A 1HO4A 1FWIC 1UH2A 1HKMA 3ECQA 4DVOA 2X8RA 4HBKA 5D2WA 2INZA 1PCWA 2KX9A 3EAOA 4DJDC 4KFPA 1JI1A 4J4KA 3LBOA 1FHLA 5BOFA 2OEMA 1LOSA 3ABRA 1B54A 3WEMA 4XKYB 1DJGA 3PB2A 1Q6CA 3BQ5A 2VP8A 4C6MA 5D09A 3PHAA 2QDEA 2RH9A 1KRMA 3R25A 3UJ2A 4QNWA 4ROQA 1LQ0A 5HXMA 1QXLA 4UNKA 1SM9A 5I09A 1RR2A 2VWSA 1BRLB 1W9DM 2G3IA 3HA1A 2PU0A 3K2GA 1VRDA 1UKQA 3W1PA 4JXCA 3MSGA 1FWCC 3LRLA 3NOEA 1JZ2A 1B31A 4CNUA 1BXNA 4H04A 4JZ5A 3UZ5A 3K5XA 2A8XA 4LX4A 4AH7A 5FCZA 4D6EA 1F3XA 3TMQA 1M9HA 1B2YA 5H8MA 2WQPA 2I9EA 1JCMP 1Q7QA 2F61A 4ADWA 2E6AA 3PZ9A 5CGMA 2TPRA 4LNCA 2I56A 1GVRA 3QMRA 3NQCA 3H2FA 4KW2A 4RNJA 4O0KA 3QGAC 4QP0A 1LM1A 3EWDA 5A8PA 4XZWA 1VCGA 4GZEA 1PBGA 1RALA 4HA1A 4YTSA 2WCGA 2DT0A 1G6CA 1M68A 3KOFA 2J7BA 2X1UA 3F1QA 2CERA 1D7FA 3UXIA 3TQKA 1SFSA 4KEUA 1GQJA 3TJXA 4PSPA 3QLLA 1EJVC 4XAYA 1BWVA 2JIWA 4W86A 4GVHA 3PP7A 4H4WA 3F7JA 3DXIA 5CBJA 3PR2A 4A6GA 5D02A 2ZUVA 1HKIA 3W72A 3TSBA 1PKLA 2OEKA 2QV4A 1SJDA 1TVLA 3DK9A 1UIOA 4JY8A 1W3TA 1SSDA 4LYQA 1RK6A 4LY8A 5A8QA 1J0YA 2J3NA 1OM0A 1S3HA 1HKJA 1KQZA 2XWEA 4G5DA 2ZRYA 5DX7A 5JBEA 2WAGA 5F4XA 2PDJA 3CM4A 1WZLA 3CUHA 1KWGA 3SN0A 4A2RA 5A6BA 3H4GA 4MNJA 4RDYA 3D3AA 1DQUA 1J2WA 3OP2A 1A53A 4LUIA 3A22A 2BY3A 3ZJ7A 1R2RA 1Y5XA 3BW4A 3KP0A 4FSAA 3FCPA 1JFXA 2YB1A 3BO9A 3A9IA 1I8JA 3QKEA 4L1GA 4WX2A 3B8VA 3S5ZA 3V35A 2P53A 2ZC1A 2DVTA 3K8MA 4GRSA 1C29A 1OCJA 2VM8A 1UJQA 5JCIA 3UY8A 3L5MA 3MMUA 4R7JA 1TCDA 3AO0A 2TMDA 5MF5A 3BH4A 2Y88A 2YKKA 2HZGA 1OFBA 1RPXA 2W5FA 2E4TA 3F5KA 2PSNA 3QZAA 2IUZA 3KLLA 3WNPA 1FY6A 4B15A 4HYWA 8XIAA 5SWUA 4ZA0A 2C0HA 4MADA 3SEPA 1NSJA 3RGTA 1HNYA 2X8HA 5AYBA 3GR8A 2ZZ1A 4EMJA 3DHFA 1YBQA 3IS4A 1AVAA 2ZIDA 5IBXA 1OWQA 1IXNA 5D9NA 3VNMA 5LIWX 2C3CA 4UTUA 3LADA 4F40A 3NQDA 2FIQA 4Q7IA 1OK4A 1E4NA 4BS0A 3E2RA 5KZDA 2AOSA 1AQFA 3MVTA 4QISA 3GG8A 1TJ0A 4PFMA 3CO8A 1JFHA 1LLOA 2NXIA 2JEQA 3WEZA 1HKVA 3S2MA 5D2TA 1WAWA 2VX7A 4WDTA 5A95A 3L0NA 3ARPA 3S42A 1EPXA 3CQKA 5G4EA 2FHFA 1DHKA 1M41A 3ZLGA 1S2VA 3PNZA 3MT1A 4JN8A 4DM1A 1NJJA 4QEEA 3NQFA 3S1WA 2YYUA 3DJGX 4JFSA 3GM8A 2I17A 4D8LA 1SZEA 2HV5A 1KBIA 2JEPA 7ODCA 4ADSA 3R8RA 4S3GA 3IJLA 1Z69A 3M6DA 2ZZCA 5CG0A 3PUEA 4AXKA 4QLJA 1G0CA 2H8ZA 4YN5A 3U6WA 4K39A 3LCGA 4AVOA 2VZTA 4K36A 2CNCA 4WQ6A 5LIKX 3W2LA 1XXXA 3VABA 3TW7A 3OZYA 3LLFA 4ADUA 2O7QA 4XSLA 3ANYA 2C13A 1ZBVA 2ACUA 2E25A 4QRNA 5C5YA 2VEGA 3PPCA 1GKRA 2C79A 2WYSA 4Q8UA 1PX4A 1GOXA 3WQGA 1QCWA 1XYZA 3QQ0A 4WCJA 3FFSA 5GJMA 1ECEA 4ZQCA 2J7GA 4DO5A 1J10A 3RNMA 1U2YA 3JS3A 1PIIA 4IOTA 3HURA 3C5QA 1WP6A 1KRAC 2D0GA 1Z48A 2XPKA 1E3ZA 2I16A 2WNZA 4CCZA 4GUHA 3BZJA 2OJPA 4JTDA 4N9BA 3AIUA 1ADDA 4F9JA 1JYXA 4L5ZA 2OLHA 1H7OA 1A3WA 1PZ0A 5EBUA 3NQ7A 4ZXLA 3VOGA 1A5UA 5U25A 1FWDC 1Y65A 1N82A 4IIEA 3MQTA 1AL7A 1YPXA 3ITOA 1XC4A 5HPOA 3W7EA 3VNDA 4DRSA 4FALA 4AD2A 2FHBA 2HPMA 3G1RA 3W81A 2Y7FA 4GG9A 3BLFA 5D03A 4Z0JA 3BG5A 3R0UA 2A21A 3EMZA 1DORA 1V3HA 3EOEA 3IEBA 3THUA 5L9FA 1V6YA 1V93A 4DJFD 3CYJA 1TELA 3BWWA 4JIEA 3SM0A 3FIGA 1JDCA 1ZJIA 1WDRA 4IQJA 3A5VA 1OHLA 3W2JA 4NI3A 1JD9A 1X96A 1ZB5A 3FAXA 1ZJHA 3S0CA 3QN3A 2CLHA 2W3ZA 4TVYA 4ENLA 1JDDA 3UPBA 2DVXA 3MMDA 1W1ZA 1XQKA 5BU6A 4IP5A 1GG1A 2YXGA 3QF0A 1A5SA 5E1QA 5CZSA 1KGXA 1VKFA 3S3GA 1JYNA 2PS2A 3EGJA 2YL9A 1AQMA 3QSTA 1X2HA 1FVPA 1Z8AA 2WSQA 4H4RA 4IP7A 3LHWA 2YCEA 4HK7A 4L61A 4YHEA 3TN4A 1LP6A 3MKKA 1ZBWA 2FLIA 3RF9A 3W7DA 4W88A 3RRXA 1RD6A 1E5NA 3FYYA 5T26A 1E9LA 4CEUC 4IIFA 4H4ZA 3LDVA 3WG6A 1Q6DA 4QROA 1BWLA 3O0FA 3CEPA 4MDOA 4H9ZA 4X22A 2ISVA 3J7HA 1E1CB 2VFIA 1W2PA 3L12A 2W91A 4HPJA 3P93A 4H01A 3C0SA 2VFDA 4Q8VA 3IJ9A 2G37A 4YS1A 4A2SA 3BARA 2EPNA 1FRBA 5BNKA 5AZ0A 2V3FA 1TPDA 3CIWA 1KLZA 2B7OA 2TYSA 3AIWA 2PDLA 3KUMA 3VKBA 2PCQA 4IMGA 1OT1A 3R89A 4FHAA 1R3RA 4O16A 1RM6B 7REQA 5HQLA 5FI8A 1QT1A 2JF7A 1KTNA 2GQ8A 5FF3A 1FKWA 1OZMA 2YDRA 2EQ6A 4CEXC 5C9XA 3MUZ1 1CB7B 3WLIA 1OX6A 1F3WA 1UD3A 3QJAA 4MB1A 2V5LA 1M53A 3P0WA 2YVJA 1L6WA 4XG1A 1XLJA 4PBGA 3CS2A 3RUBL 4J3WA 3TN3A 2XISA 2XN0A 3NG3A 4O10A 2FZDA 3GWQA 1ZP4A 3EB3A 3SCPA 4PE8A 4RZ5A 1OC7A 2E5DA 4PN2A 5D9PA 2OZTA 4AZIA 3RAOA 1SW0A 3CGTA 1BQCA 4H9UA 3URNA 1SU5A 4HCDA 4BI5A 3OZMA 5FSEC 3BVJA 4ZOAA 1UQYA 3G2GA 3I6RA 3QY7A 4DUXA 1QW8A 1CWYA 2XTKA 4CKQA 4TX9A 1OX4B 4FP1A 1RXOB 3CHVA 1CGVA 1FP8A 4I5XA 4J57A 4RXGA 4LTSA 3W76A 3ZM8A 1FHUA 4XVDA 2Z4GA 1OCQA 1V7AA 2JBMA 3TTOA 4WZHA 2QCEA 4M80A 1YDNA 2W0HA 1VHNA 4AMAA 3R79A 3FYPA 3G22A 1Q65A 1RQBA 1VF8A 2AL2B 3M0XA 5BYWA 1DIKA 3BGAA 4Y90A 1X1NA 3TK7A 3N04A 3EWCA 4MVAA 1ZSXA 2YYTA 1QK0A 3NVTA 1F2JA 2NWSA 2ATMA 1KB3A 3GVRA 2WHLA 1JRPA 2E8YA 2R1KA 2XVNA 4EX4A 3DGZA 1DJWA 1ISWA 2OGYA 5AC7A 1MVYA 4O19A 1UWAA 3PBGA 4MPKA 3KEHA 2HNEA 2HNHA 2EPHA 4JDYA 3F2DA 2V5KA 3SUWA 1XH2A 1J01A 2YZRA 2FQIA 4JTIA 3BMWA 3ARUA 3OODA 3N4EA 4GOAA 3VCCA 1TV8A 1XR2A 2VKZG 3O1NA 1QI2A 1X8CA 1LWIA 1WDQA 1ZBCA 3A4JA 3M0IA 3WN6A 3AFBA 1RJQA 1VZWA 1W1A1 2XIBA 3VIPA 5K9DA 6TIMA 4DJEA 4HNNA 4V15A 1QATA 4WXZA 1CCWB 1S5TA 2FH6A 3AHTA 3TMLA 3W0KA 4UTLA 3FGCA 2XFYA 5FS8A 2NV2A 3N2BA 2QGYA 5G2HA 5FJOA 2A3LA 1F5ZA 4LUTA 1AZ2A 4NT0A 1NH6A 3LK6A 4W5UA 1GJUA 4UFLA 5HJYA 3FJ6A 3UR8A 3II4A 3MDWA 1EX1A 2LLEA 3MO4A 4PTWA 4S3JA 1UR9A 3GNNA 1FXQA 4AEEA 2NV1A 5G1YA 1R7OA 3PVFA 4AX7A 2HVNA 2RKXA 3KRSA 2CIPA 3R1ZA 3FY1A 4NSBA 4PTXA 3ZYZA 4W85A 1XHCA 3PAOA 4Q8OA 3EKZA 1V02E 4H3DA 3FHQA 3SB0A 2XH7A 4YTRA 2WM1A 3UR5A 3S83A 2VX4A 3WLRA 4B5TA 2PLJA 4XBJA 3ONCA 3WJXA 2DP3A 2FYMA 5A6AA 3WFZA 2GJXB 1HJSA 5BWFA 2DEPA 3FSUA 3P5ZA 3C52A 5CPMA 1GRTA 4HHHA 1Q8JA 4MWAE 3O6CA 4N6EA 1IYXA 1KCKA 4TXEA 4LANA 3PPHA 1B0IA 4YVVA 3AXXA 4AHPA 4FR6A 1DIDA 3TX9A 4AZCA 4F0HA 2P88A 4KBXA 3ATYA 2PDUA 3QC0A 4PTVA 4JIPA 2XG9A 2NLIA 4DO4A 3LQLA 2QDHA 4TO8A 2GUUA 2ZX8A 5K4XA 3WD1A 2HJPA 3W6YA 3TA6A 2CBIA 3CT2A 1HJWA 4HD5A 1W1PA 4OWGA 1CLKA 1OFPA 1D7KA 1VLWA 5D8ZA 1Q4NX 5H8UA 3H7RA 1XYCA 2C1HA 1QU4A 1BRLA 1IR2A 1CXLA 1PX8A 2CEQA 4MJ2A 4CGTA 1R2TA 3G1VA 1GCYA 1RSCA 1PZ2A 1VFFA 4LVDA 2GPTA 1S3TC 4MNLA 4U31A 2OX1A 4PUUA 3C8NA 1R0MA 3T2OA 2ZE0A 4UFMA 5JUVA 1ZX9A 2HVOA 3WLQA 1MZRA 1C9DA 1JNDA 3URBA 3QTGA 3OBAA 4W4QA 2YPIA 3RU6A 1V3JA 4BJHA 4QDPA 3FNDA 4XUGA 2OFJA 3WLSA 3HV8A 4Z08A 3S2JA 2IS7A 4A3UA 2HE8A 1OIMA 4PBEA 3IUDA 3M5YA 3OIXA 1VRXA 1JCYA 3LZ3A 1N5WC 2VGGA 2EQ9A 1IEQA 1SUXA 1HGWA 3N1AA 5AZ1A 4JYEA 3L7RA 1EQCA 3WNOA 3NEHA 3VK5A 1ITQA 2Q6ZA 2G5WA 2WZMA 2DZBA 3LUTA 4IISA 3I6TA 3I3DA 3MJYA 3OBEA 5HANA 4MTVA 3WUFA 1LRNA 3DJJA 2GVLA 1JXJA 3PZMA 5I0DA 4CNSA 5HNTA 3IIXA 3WKZA 1CT5A 1Z44A 1BSIA 2QPXA 1AMYA 3EPMA 3A9BA 5PTDA 2OX4A 3WBXA 3LRKA 4W89A 2A7RA 3YPIA 1J0HA 1DHPA 4I90A 1EZWA 2BBFA 1G69A 5G1TA 3F2BA 1EWEA 9XIMA 2E68A 5EPDA 1HP5A 2QJNA 3N25A 3VDHA 2P5NA 2C14A 5HINA 2AAQA 3FXGA 3H23A 4JX5A 1F6PA 3N2OA 3ITTA 4DIAA 5HR7A 3H7UA 3G0UA 1H49A 2BX7A 2D0HA 3ZSSA 1C90A 4YTQA 1XLKA 1LVLA 4I9AA 1UH4A 2WBKA 4H00A 4GIEA 3M7WA 4C6JA 2J7DA 4Z42C 3GTIA 1BTMA 4DJFC 3DIPA 3LTPA 3Q2DA 4AD1A 3K13A 1MSSA 3RHGA 5JU6A 3WBAA 5F2GA 1XYBA 3PNUA 1NOFA 1IXQA 3BMVA 4H9VA 5HULA 3RYSA 2WPGA 1A3XA 4OU1A 3WMSA 3AIBA 3PY2A 1KTCA 4W5ZA 2E1WA 3EWZA 3CWHA 5JMUA 3XISA 4MZ8A 5EMUA 2OOFA 2QJJA 1OG6A 1POKA 3NL6A 5I78A 4FF5A 5CZKA 3KVLA 1WA3A 2A3BA 4PTMA 4U4MA 2RABA 4C7GA 9XIAA 5HJXA 5G4WA 2I57A 3OEXA 3LGDA 5JBDA 5KITA 3DI1A 4RK8A 4QNEA 5DANA 3MP5A 1TJ1A 3U7VA 2OB3A 5CPSA 2UY2A 3EA1A 1LROA 3JUGA 2OSXA 1KFEA 2R9RA 2QZRA 3FDGA 1DKWA 3HPZA 3T0AA 2DV0A 3GC2A 4F0LA 2QCDB 3P82A 3QQWA 4YVXA 1B3OA 3OVPA 1MQRA 4PMVA 5FD0A 1C7SA 1H1NA 3O3RA 2J8TA 5HOSA 2ZA1A 2WZEA 1QASA 1JPIA 2A3HA 1OK6A 3EX6A 4Q8TA 1FWTA 3GHUA 2HPIA 3T6CA 2DSUA 1N2VA 2NWRA 2D20A 3WFLA 1UA3A 4A21A 3KBJA 6XIMA 4BQ2A 4PL1A 1FQ0A 4GBDA 1BFNA 3BV7A 3SCUA 1DQWA 1QO5A 1H51A 1ZUAX 3KOZA 2J13A 4D6CA 4H9YA 4FA3A 1PL9A 2Z00A 3GXPA 4DB7A 3PBVA 1SFTA 3A13A 2DJXA 3OGVA 1F61A 1XRTA 4R88A 4A3YA 3W86A 3QEZA 2CLOA 1Y0EA 3P8JA 5A6TC 4PSRA 1HJVA 3W9ZA 3WMLA 2EHHA 2B4GA 2YGYA 4K8GA 4S2BA 2ZX7A 3W1XA 4F4RA 4Z2JA 4ZB2A 4JTCA 2X1RA 2C16A 1NHRA 3CGBA 3VU2A 2HBXA 2YBTA 3W2KA 4WDUA 2IQTA 3POCA 1E73M 3TIMA 2BOEX 2EPKX 2OT0A 4WK9A 3K30A 3LM3A 1CX9A 2PPGA 4QJ4B 1P0EA 5IM51 4H4XA 2FZBA 2GQWA 4O1DA 1H09A 4WY0A 1O1ZA 4D8ZA 4HHLA 4C60A 3EWUA 1B30A 1L6YA 4C65A 2Z26A 2JFEX 3TYUA 5ABHA 1GUVA 2QR6A 4WOZA 2PD5A 2A2IA 1EJSC 5LA0A 2UV8G 3NL3A 4J5NA 4AD0A 2X2YA 2PGRA 1IIGA 1WKYA 1YX1A 3LN3A 5KINA 4PMQA 3UPWA 5E70A 3T2QA 2VZSA 3HGOA 1MXSA 4KH2A 4HU8A 3OLIA 1F3EA 3TTEA 1WYIA 2JF6A 3C61A 3QPZA 1HGYA 2YB4A 1R9YA 1O4UA 4KPRA 5DBTA 1VFTA 2W79A 3NPXA 2NSXA 1EQPA 3WD3A 3E96A 1E55A 1GKPA 2VR2A 3AWNA 4O57A 2X0HA 3ITGA 4XD5A 3DKLA 1NPXA 1XCFA 2VRKA 3VC5A 2VC7A 6A3HA 3C0QA 1QI5A 5A8GA 5M2FX 5GPRA 4GQRA 1GEHA 3W7IA 3RM4A 1XBVA 3H2OA 4FXFA 4JTGA 4LVBA 1D3HA 3W1MA 3C3UA 2VQUA 3APYA 4A3HA 2V30A 2VCBA 2HTMA 4Z1CA 1ODZA 1TMLA 4FPSA 1UKOA 2BMBA 1GW9A 3N3TA 3FSTA 4NEVA 4GC4A 3TEVA 3TKFA 3VNKA 4M3PA 3ZXWA 1YNQA 1E6PA 2C6QA 4NZ3A 4DYJA 1EYWA 2GGHA 1N55A 1U5VA 3S1XA 3T0BA 4N6FA 2DZSA 4H4QA 3LNMA 3KZSA 4RNHA 4FX9A 3DU0A 1RQEA 4DNMA 2WVUA 3P80A 3SECA 5T8GA 4E2VA 1OC5A 3CAKA 3B03A 5JVLA 1X38A 1P6CA 2VC6A 4QLLA 3N73A 3TFXA 2VC5A 4FNRA 4DBUA 1G4PA 2V0TA 1G4EA 2DQWA 3REQB 2PLKA 5G2WA 2ACQA 3DGHA 3LGGA 3A4XA 4DX3A 1ZZMA 4WJXA 5EMJA 2FFIA 5E93A 3KVJA 1LCOA 4YIWA 5EU9A 1GVIA 2C0AA 3V5FA 5LNRA 1XQLA 3FA3A 1LL6A 1EP3A 4YHGA 4CUCA 4D6JA 1GVSA 2PWDA 2RFGA 3IVSA 1F8WA 4P5UA 1W1B1 4MZYA 1K7XA 3EX4A 2XM1A 3I4EA 3PG6A 4PC8A 1N8FA 1XDIA 1JZ7A 1AQHA 3PFRA 4HNCA 1F6YA 2E5AA 1R30A 1C93A 3CYVA 2VEKA 4L9XA 3T05A 1ZCCA 3V18A 2A3AA 3E74A 1NHSA 1TRIA 3GDBA 2R6OA 3P8IA 1RP9A 1E4LA 1XS2A 5DMNA 3GG7A 1NWRA 4HB7A 4IIDA 1GRGA 1VP5A 3THAA 4I9MA 3BLPX 3M46A 4BFAA 4ATWA 3ARTA 3NQMA 1OABA 3VE9A 4ECLA 3EOUA 1IEVA 3B9DA 1H7XA 3N9RA 1H0GA 2AGKA 1ZXIC 3QOKA 1UD6A 1YEYA 5DXYA 2QCLA 3VIMA 3V36A 1LL7A 1KC7A 2Y62A 2R82A 1DTUA 1XGZA 4X3ZA 4U2ZA 1J6PA 3KL3A 3TCSA 4CNPA 4UQBA 1GOOA 2R1PA 5G4HC 5EY5A 4OFCA 3V7PA 4PODA 3VNJA 1JGMA 3NUKA 4AG0A 1YHTA 4K68A 3SRDA 3SR6B 4N4PA 1LTDA 5EMMA 2HSAA 4PCTA 2VJXA 4HA0A 2GH5A 5CLTA 2GVYA 2IKIA 5JCNA 1UUQA 4P8VA 4QIUA 4LEFA 1Z42A 1JUEA 2ZICA 2XSXA 3CLMA 1VYRA 4INFA 1V0MA 2VDHA 4F79A 3T4WA 4W93A 1F8IA 1KXTA 1ZMCA 2WNNA 4D9PA 1W3KA 2JQXA 1ML1A 3B8WA 1XANA 2FMNA 2X0SA 1CIUA 1PTDA 3ZSTA 4EWJA 1TQXA 3LB0A 1XYAA 1IHIA 2QJMA 3W2NA 3ENLA 4GUFA 1QI0A 3SQMA 2G3NA 1TVPA 2VRJA 2V38A 2EG8A 1FWAC 5D2YA 1UIPA 2CWXA 1JPKA 3G18A 4UQCA 4IG2B 4E3VA 2BTMA 2X09A 1M7XA 4LAUA 5KETA 3NQVA 3IACA 2NQHA 1TWSA 2R94A 1YTKA 1TPVA 2EQ7A 3TDFA 1GKQA 4BCEA 2ZUWA 4HNUA 2G41A 1IZCA 3CT7A 2A79A 4LUSB 2IPWA 4P7LA 3W23A 4K2SA 5CBIA 2C3ZA 1BYCA 1CB2A 3LYEA 1CXFA 3WH5A 1GNXA 3AQUA 3A4WA 5D05A 3CL6A 1DJXA 3GVVA 3OHMB 4CNOA 5C2CA 2ZCGA 1E0VA 3M1ZA 3S8HA 3CIVA 3TR2A 1X39A 2EKGA 5EFFA 4QLKA 2UBPC 4GK8A 1UC4A 2WC4A 3G6LA 1UZHA 2QULA 1FX6A 2PC8A 3LHZA 3S9IA 5I3JA 5I00A 3O05A 2R1NA 1EA0A 2QMKA 4G1NA 1SPQA 4WKAA 3R8GA 3HJEA 1VB9A 5A6KA 2G3JA 2ABBA 4Z1AA 1ZNNA 2YW3A 4M6VA 3WSUA 3FLUA 4IHCA 2NX9A 5HR6A 2H8XA 2GJXA 3GC5A 1T96A 3QFBA 1G01A 2GVGA 1KFLA 1YQ2A 1RA5A 3RMEA 2GUBA 3IWPA 1BWKA 1KXHA 2R9ZA 4UMAA 4M6PA 3OU8A 4WJ8A 4LVGA 2YL6A 2CHRA 3LCLA 4H4TA 2X1TA 2BXZA 4OBTA 2CDUA 3A7AA 4YYFA 2L5HA 1NDWA 1AW1A 3W74A 5IHSA 2J7CA 2YFNA 1Z41A 3IJDA 4LT9A 4MUZA 2PF8A 1T6MA 3FEQA 2XVLA 1JULA 4PMZA 3G1SA 2FVLA 3KCLA 4O17A 4B5WA 1I0BA 2Z1BA 1O5KA 4B5XA 3MA8A 4QJ3B 3NRZB 1UPPA 1J0IA 4WR3A 1RQHA 2Z24A 2Y5EA 5K7JA 3LXDA 3DFSA 1ZL1A 2DSWA 1TWIA 2VGBA 3TOPA 3N2TA 3FVDA 3PK7A 4EP8C 2IMRA 1K7FA 3DFTA 2Q8LA 3NPWA 5K2ZA 1R5YA 4GUIA 1JF5A 4JTQA 5E6YA 3C2EA 1IZKA 3DEQA 5KVHA 3WK3A 2O4MA 4JIQA 2J24A 4H7ZA 1S38A 1Q5MA 3VM5A 2OG9A 1ZTVA 4WVXA 1SJAA 5G1MA 3VKCA 2A0NA 1W5MA 1RCXB 3HMCA 3LLDA 3H26A 4PL2A 3W83A 1KGWA 1ZJAA 2NPXA 2J9XA 3HU7A 1JVNA 3W1LA 4AYGA 3FVMA 4I5UA 1D9EA 1UP2A 3NO1A 5CJ5A 4GX8A 4IFKA 1V3LA 2BOFX 4PUEA 3FA4A 2YDQA 4UC5A 2QJHA 3BURA 3CH0A 4XTIA 2GVEA 3KVMA 1TA3B 3KHDA 3IVTA 2E3TA 3GNPA 4S38A 1XLDA 1JCJA 1RH9A 2W3RA 1S2AA 4S1FA 1GRFA 2WOQA 3H54A 5HWMA 4B5NA 3TAOA 2J77A 1WQ5A 1KCLA 1F4HA 7XIMA 2QVNA 2QV5A 3B9OA 4JFVA 3IJQA 3R0DA 1D2KA 1TZZA 2AAMA 3B40A 3E5BA 3BG3A 1EEXA 2YXOA 5IOBA 4MB3A 3IRSA 1Q7ZA 3N4AA 1TPH1 1NOWA 4D71A 4CVWA 3MI2A 5TF0A 1L6GA 1TB3A 1N60C 3BPWA 5IXEA 4B16A 4JQ1A 5IHRA 3M4HA 4GYKA 2D3LA 3IJ7A 1T40A 4HCHA 2NQJA 3LS9A 4GY1A 1U1JA 4WIWA 5HPCA 2XU2A 4R5EA 3GIQA 2HEJA 3LPOA 1SR9A 1EBDA 3CTLA 2FZ8A 2XGIA 1KGUA 5IRPA 3W70A 4O0QA 1GJPA 5DRIA 1K4GA 4L56A 3W6MA 2X2GA 1H2JA 1EJWC 3UVAA 3GY1A 3EXTA 2OSWA 2XFFA 4BV6A 2OU4A 1UJPA 1VS1A 3BE7A 3A3XA 3LCXA 4QDWA 1Q4WA 2OR2A 3IV3A 1GZ1A 4FB7A 1KNWA 3K1GA 3NSMA 3PZGA 4EM4A 1DWGM 3EX3A 4IGMA 3QYQA 4DY1A 4PMRA 5FF4A 4B5VA 2B7PA 1LWJA 3SIZA 1R3YA 4O54A 2GK1A 4B5SA 3HTWA 1VLIA 4GZJA 5BXSA 8A3HA 1WOAA 3R10A 1W1TA 4GQBA 4PA8A 1H6VA 4MY1A 3GFZA 2EJ1A 3WNLA 2QJGA 4XAFA 3QHMA 3HN3A 1ITXA 5C9UA 1WO2A 3DX5A 3ICJA 3FN9A 3UY7A 5XINA 3R4IA 4JHOA 4J28A 5TAOA 3NVVB 1Z3NA 3VAVA 3E49A 4HMCA 3T09A 1RAKA 4QDMA 2EJAA 1OEPA 1R3WA 2PGEA 4ACZA 4Q4PA 4J3SA 2NV9A 1V7YA 3ID7A 4N7QA 4UTWA 2WLYA 4BEQA 1M6IA 2PBGA 2QCDA 2ZXQA 3WDPP 2IPGA 3P84A 2B31A 3NO3A 5C70A 2PURA 2D2OA 3DFNA 1MUWA 3UG3A 5RUBA 3S9YA 4HPHA 3TP4A 3HFYA 2ZXDA 3CZKA 3S2NA 3EA3A 2EPMX 3M16A 4L6OA 1AW2A 1UWIA 3DFYA 2PDXA 3P3BA 3OB8A 1WE5A 3Q65A 2WWCA 3JR2A 2DZVA 2XDFA 1U83A 4O28A 4KIRA 1THFD 2CLIA 2E77A 5KZMA 3CXOA 1ONFA 4KGLA 3C2VA 5GJNA 3SY1A 3KWSA 1C91A 1B3YA 4YU1A 1TPEA 1TTPA 1XLMA 4IQLA 3CK5A 5F2LA 1UUMA 5D32A 5D38A 2IXVA 3NZRA 4UR7A 3ARYA 2VVSA 3EOOA 4GH3A 3WQ4A 1XIGA 4D6HA 5C55A 4EF9A 1SO4A 4RE0A 1M7OA 4WLCA 1W3LA 1K70A 3HQNA 4US5D 3T07A 3HPXA 4MYAA 3FS2A 1V0KA 2GJRA 2POTA 4QE4A 3W7CA 3VOCA 3VTRA 3EXSA 1M03A 2V5JA 3TSDA 1I75A 4YNGA 1XIMA 5KZEA 2P0IA 2J6VA 4NJHA 1EHNA 3INPA 1UQZA 1UWSA 4Z2LA 4C6DA 1YNPA 1O5RA 2GLKA 3DG3A 2V82A 4HSNA 1VEPA 4N9CA 1K4HA 1RV8A 1NFBA 4IPPA 1L2UA 1NIUA 4DUWA 3L2IA 1YDOA 1QMLA 3SQPA 1IT0A 1XKJA 3CGCA 4B2DA 4DF1A 1QO2A 1US2A 3KLKA 5A8OA 2J4GA 1HTIA 4MUPA 1F74A 3PTKA 3CUXA 4TX6A 2DT3A 4UTTA 4DWDA 1G7UA 3EX2A 2GGJA 3AMLA 3N9SA 2JGYA 3NZGA 4KWSA 4Y8FA 5LXEA 2ZQ0A 4ZQNA 1BSLA 1NELA 1RBLA 4I6KA 3EEGA 3HGJA 1JXKA 2ON3A 3HFTA 3CAQA 2WVVB 2BASA 5LNVA 3PANA 1L9WA 1GVFA 4LWWA 2GOKA 1AJ2A 3UA4A 1WOBA 4RW3A 1KCZA 3BSGA 4GIAA 2VT0A 1U5JA 5CSRA 2B0MA 1STZA 4M7TA 1A80A 2Y5JA 2W62A 3M0LA 4IXHA 3NVYB 3KTXA 4UMCA 3HMJG 3LLXA 1P5BA 1NF0A 1TIWA 4OJYA 2ZC8A 5FEWA 4UNLA 3TA9A 4BF9A 1CGYA 4XWUA 1E9ZB 3IRDA 1PDYA 1TJRA 5HNRA 4X0NA 5CZ0A 4UTHA 3M41A 4M29A 5FSDC 1RBOB 3GXDA 5C6MA 3RFAA 4A8LA 1R47A 3KVKA 3W02A 2NSOA 5CC7A 1XG4A 1JGIA 1W1YA 4FEZA 4V1YA 1A0CA 2O92A 2PP1A 4ZTXA 5B7YA 1O6IA 4BWLC 4EK7A 2WMGA 4ONVA 1HF6A 4NEWA 1A5LC 1CECA 4KPLA 3WQ8A 4H4PA 4MLJA 4LQ1A 4GI4A 3CHCA 3CB3A 3KX6A 3S2LA 3ANUA 5T9CE 5E5CA 1TUFA 4V2XA 2VZUA 1KFWA 1QPNA 4CVUA 4PB4A 1EC7A 4GVFA 3M0KA 2VX5A 1K7EA 3WD4A 5E0FA 1EXBA 3N19B 2G3FA 2YL8A 1JPDX 3OYXA 1CYGA 2GDVA 2VZOA 1J0ZA 4IPNB 2EAWA 1BYDA 3GR7A 4NAFA 1IXPA 4E5TA 4OBRA 2CLKA 4L4PA 1IGSA 3OVQA 1J2BA 2ZUMA 2Z0IA 3T0DA 4QJ1A 3TAKA 3GBEA 2VD9A 5A1AA 3BW2A 2QNEA 4TR9A 3WQ5A 1ADSA 4WF7A 4CCDA 4S3BA 3HGSA 4S3EA 2G96A 2W27A 5AYIA 1XIJA 3BCFA 4E4UA 3RM8A 4P7OA 5K9CA 1XI3A 2NVAA 3W88A 2F8QA 1CXIA 3CWNA 3MCMA 3GIPA 4M24A 4F0KA 1HKKA 2QLYA 1ENUA 1H1ZA 4O4WA 3EWBX 1EL3A 3L8KA 4L6DA 4PBFA 1RPKA 2D1ZA 4KCUA 1E0UA 3UVIA 3TROA 1JNEA 4NAEB 3Q67A 3W37A 3BOXA 3ERPA 1SSGA 3PBMA 4HZ8A 3CZGA 4Q8NA 3S9ZA 4QE1A 3A21A 1TG7A 1K8ZA 1ZMDA 2QAPA 1UKPA 1TKKA 4NG3A 1ZQ5A 1R3VA 4GYFA 3BAXA 4U5IA 5DT7A 3UGRA 4BHYA 3VX1A 1YTEA 4E2DA 2GSHA 5CLWA 4S3AA 5DMLA 1N62C 2HK1A 1VQZA 3UCCA 3KRUA 1JDAA 1L0PA 3PC0A 1H3GA 4JL1A 3R8HA 1FO4A 2IKHA 2CLLA 4C7DA 4OZOA 3MPGA 3V5CA 3VD4A 3BJTA 4TV5A 4DM2A 1BG9A 1E5JA 5ECVA 3GW3A 3UA3A 2D24A 3WK1A 3W22A 1KM0A 3W7NA 3RLUA 1FWNA 2DZAA 4HSHA 4LS1A 3BLEA 4E2OA 1YW1A 4MKSA 1PIFA 3STCA 3WLLA 4V33A 4NNCA 3SSJA 4JCLA 4KRZA 3SUVA 5KTLA 3PUGA 3KCOA 3M5XA 4MWAB 4ADTA 3UFYA 2FH8A 3P67A 3V4BA 1UZ4A 1H4PA 3LHYA 4JTKA 3F4VA 4YYCA 1TQJA 3JU2A 2C1GA 4TQTA 1DWAM 3ZVHB 1TJ2A 4LGXA 2OEJA 2H6RA 1QFEA 4IQEA 4D2JA 3OQEA 4KMQA 1BVZA 5REQB 1ZAHA 4QEHA 2OWWA 1QK2A 1EEPA 5D2XA 3B05A 4CD8A 2WPFA 1WDWA 3BQ6A 3LCWA 5BZAA 4YWOA 2WLZA 1ELSA 1TREA 1VYSX 1L6SA 4ZCWA 3DYMA 3P74A 1DJHA 1SFJA 2Y0FA 1WBJA 1K9EA 1XJBA 4A8IA 3WBEA 6ALDA 1JQVA 1W5NA 4GYPA 1B4EA 4WEVX 1JUBA 1KLYA 3W1TA 4HNLA 2QQ6A 1KXQA 3F03K 4Q7NA 1JZ5A 4MSSA 3MSDA 4DN1A 1IT8A 1R9XA 4CQBA 1RCQA 4JY9A 1SZRA 4QS5A 4CNNA 2PDGA 5G5HB 2ZWYA 4OV4A 1Y7VA 2Y70A 5AB3A 3LMYA 5LXXA 1DXLA 3BK0A 4IIBA 4KEVA 1JCNA 4JHZA 1J6OA 2MUCA 4B3LA 4Y9MA 2PLMA 2PDMA 1BQGA 5C8BB 4YMZA 2XSBA 5DN1A 2CBVA 1BGGA 1P4CA 4GCAA 1SJCA 5FS6A 1JEZA 1BG4A 3UCQA 1DXEA 4Z0SA 2REQA 5FEZA 2VWTA 3VE7A 4QXIA 2V2DA 3AS0A 1B3VA 3N2CA 4EVZA 1ME9A 2GGGA 3WD2A 4C6BA 1Q6QA 3QH2A 3EWWA 1FEAA 1ZFJA 3V3WA 2DZWA 3DHPA 3KBVA 2GOUA 4JQ3A 4GH1A 1TIMA 4EIVA 3MJMA 2ZTKA 3RCNA 4GISA 2E9BA 4Q4SA 1OINA 2FB2A 3PS7A 4U3CA 3GE7A 1J0KA 3MUAA 1P7TB 1EDTA 5BRQA 1ICSA 4ZFMA 3TTQA 4ATLA 2YXXA 4H7CA 1I45A 4UQAA 2JK2A 2VQTA 2VUNA 4K8DA 3MP4A 5H6HA 1YXYA 5ABEA 1FXPA 1BZLA 2DW6A 4XO6A 4A8RA 2EG7A 2C19A 2V81A 1I4NA 3U4AA 1BTCA 4GJIA 5HJLA 1FWRA 3L23A 3DFPA 3B4YA 2DZXA 3B0UX 2DT1A 2WOIA 1MW2A 1Z9AA 1JI2A 3GD6A 3N15A 1RZMA 3Q6JA 1BKSA 1XCXA 1OC6A 3QMTA 4FK9A 4WHBA 5JIWA 2CFFA 4FLOA 2WPCA 3RCYA 3H2MA 2QUNA 3BLIA 3EB2A 4JNYA 1WUFA 3BG9A 1NQKA 5E9XA 5CC3A 1YXDA 2DSVA 3ITLA 2E09A 4UFHA 4AU0A 1UKSA 4IL0A 5I06A 3MBDA 4RR4A 5C9RA 1NWSA 1HL8A 2E3ZA 5EBAA 4AXNA 1ZGDA 3W1UA 1HQTA 1PWLA 1MWOA 2YJQA 2JK6A 3GTNA 1CGUA 4K7YA 2BHUA 2OKOA 5A6LA 1MNZA 1RA0A 2OO6A 2CFYA 1NOUA 1L6FA 1XLGA 3CTTA 3AXKA 3IIZA 1FECA 4WD0A 1V3MA 4DBSA 4IT1A 3CQJA 1LWHA 3I6EA 3Q45A 1PUDA 4LNYA 4DUOA 5C7HA 5LNSA 3CO4A 5JQ9A 1M7JA 1A3HA 1KW1A 1LG1A 4IUGA 3ZT7A 4M8UA 3O0HA 2ALRA 3FJNA 2YOCA 3VFLA 3SW6A 4GCXA 3CV1A 3ZVIA 3VGFA 3E9AA 4Z1DA 4H6RA 4UUIA 1K6AA 4ASTA 4MKVA 1K6WA 4IGHA 3A47A 1JCLA 1K9TA 3PJTA 3QOMA 4J3XA 2XH2A 3B9EA 1G94A 3F4DA 1VJIA 3QGKC 4LCRA 3IIOA 3GW0A 4AB4A 2ZRVA 4UOJA 5BU9A 4FXSA 5FJRA 1VCVA 4KWUA 3VUPA 3R43A 4CCCA 3ZO9A 4HZ6A 5HNUA 4N02A 2YAUA 2NXGA 1W5OA 4EE9A 1ITCA 2C7FA 4LBUA 3B8SA 4FLQA 4NJGA 3SCNA 1V5XA 2GR3A 3A7RA 1GYMA 2YFOA 2YLLA 2PTXA 1IWPA 4DZAA 1K4QA 2XFRA 4PFHA 5DMMA 2X7WA 2YCKX 3RILA 4GPNA 1AL8A 3RXZA 3DGBA 1XH0A 1A5NC 1ZENA 1AD1A 2FJUB 1LZOA 4REQA 5DY3A 4WJEA 3C2FA 4HCLA 3BAYA 4HT3A 5AOUA 3CWOX 3K8LA 2PODA 1C9WA 3TJ4A 4QSFA 1PKNA 5FKYA 3W7HA 3I65A 3PTDA 4MAZA 3NFUA 1XLIA 3A24A 4RE3A 3NJ3A 5AN7A 4PULA 2E7FA 3AZRA 1V0LA 3NVDA 1DWHM 4ZBCA 4IUOA 3F4WA 3VOFA 5EKYA 3QZ6A 1N8IA 3UD6A 1SMAA 3EKGA 3LM7A 1U33A 2FMOA 3LRMA 3C8FA 4Y7EA 1IWAA 1T8XA 3TWBA 1FEBA 4E2BA 2J9YA 3QR0A 1ITUA 1WZKA 2W6RA 4I9TA 4JTHA 5FJTA 1VPYA 3T44A 2C1IA 2Z1SA 1J79A 1SW3A 1N61C 3AXIA 2CBUA 2GDUA 1MQPA 2Y1HA 1V77A 1MW3A 1VCFA 1YE4A 2E0PA 4OV9A 1DIEA 1NWTA 3MHUA 1KM2A 1TMQA 4QFUA 4EOUA 4H7VA 3GVQA 1S46A 4FIQA 3PJUA 3GQYA 5B7ZA 1NEYA 1TWZA 3OG2A 4WXYA 3PTMA 4QITA 3RU8X 4M6UA 2AQWA 2J9ZA 5J5RA 3PSVA 1XCWA 1Q13A 1TTQA 4N4QA 4ZL1A 3QPEA 1NFGA 4OVXA 1EA9C 1KKOA 3SIMA 5AVNA 4DWSB 4ERGA 2Z7KA 1WBHA 4LYRA 1B90A 3WJSA 1O68A 2BGSA 2BVDA 5DCBA 4ZGYA 1OSEA 2YA1A 2VGIA 3ZMRA 3IJ6A 2QPUA 4WKHA 1GRAA 1HW6A 1FHDA 3HG5A 2FVKA 4FNQA 1TTJA 2XGBA 1Q6EA 2A85A 1VJZA 2HXUA 4AX6A 4S23A 4NRRA 1CGTA 2Z6JA 4GVIA 1ZLPA 1MDRA 3S4TA 2EXOA 3WLPA 3TR9A 3W24A 2R14A 2PDFA 3B8IA 1K03A 4JL2A 4NQ1A 3KOWA 1MUMA 1X98A 4W7WA 1VR6A 1XLEA 1P1MA 4H4IA 3ABZA 1W9PA 1FWJC 4O13A 4GKTA 2PWEA 4BA0A 3GFYA 2G8ZA 3P0XA 3A64A 3SSZA 3MZ2A 3QHOA 4U33A 1XRSA 4FOKA 1W8GA 2WC7A 4R27A 1MXDA 3T78A 4GI6A 4GYPC 4KIEA 4ILSA 3O7UA 5C2XA 4UR9A 3TZNA 4GZIA 3E0IA 4V28A 1RVKA 4ZENA 3PJWA 1DJQA 4Q4QA 2AGTA 3BTNA 2ACRA 1GERA 2BG5A 3TW6A 1W3IA 4JIHA 1PYMA 1M7PA 4ZOCA 2PC4A 2RDTA 1UKTA 1US0A 2DU2A 2HS8A 1X7IA 4KWVA 3WQPA 3OLDA 4E0CA 4Z17A 1VFMA 3E12A 2F38A 4M5PA 3P2VA 3W71A 1S1RA 4XAPA 5BMWA 3RMJA 1XBZA 3UG5A 1E0TA 2CWNA 3QV6A 4LSBA 3C56A 1W5PA 1A5OC 4WSHA 3GTFA 3SCQA 3KL0A 1QBBA 3IC9A 4XAGA 1CTNA 2J62A 1VEOA 2GVJA 1WXZA 2DJLA 3NAVA 5I24A 4GMEA 1GT8A 3NQEA 1OIFA 5IDZA 2ZZ3A 3C0LA 1UP0A 2FTYA 3EKLA 3LMZA 1LBLA 4XISA 4A4AA 3IK2A 3F5JA 4GNVA 3MDUA 4QE5A 4ZO8A 3SADA 4GY7A 3OVRA 1H5YA 4UB9A 3I4KA 1EBHA 4BF7A 2VX6A 4BURA 3VOHA 5IDIA 4YLWA 1ZK7A 5D30A 1JUKA 3ARWA 1OFDA 3D5HA 1UD8A 2W67A 2XYLA 5DY2A 1S5NA 3DOPA 4Y8EA 3W82A 1T5AA 2WJZA 3S1GA 3TFCA 3KE0A 3RLGA 1F07A 4QR6A 4NJJA 2F6KA 5HAOA 4AF0B 1TWDA 4L7ZA 4J7RA 3H4KA 4N9EA 1YDVA 1KFKA 1M01A 2ZDSA 4UMBA 3DBPA 2X05A 2OXNA 3ZIZA 2Z2BA 3AI0A 3MKCA 2J27A 4NL1A 3SUUA 3MW7A 2VI0A 1WXYA 4RUBA 1V3KA 4Q4KA 1ZS2A 2Q02A 2FB3A 1LUCA 4Q4RA 3DK8A 3EANA 4UTIA 4MAVA 4HSOA 4GO9A 5D37A 2G3MA 5AY7A 5TBOA 4HNTA 4JTSA 3R07C 4EM3A 1ZU8A 4GQGA 2W4XA 2BB0A 2W61A 3RX4A 1A5KC 3KZPA 4AIOA 1XSJA 1H11A 1XL9A 1OX5A 2D2JA 2J75A 3RPMA 3MCNA 3LXAA 2EF9A 1KFJA 3W2UA 1CGXA 3W07A 1Z6KA 1QR7A 2DUZA 3L5LA 2NUYA 4IP4A 1GPFA 4MWAD 3CHDA 4LY4A 3ITXA 4BEUA 3N14A 3LCFA 3S6TA 1J96A 2GR0A 3FV9A 3C2RA 1QVBA 4C6KA 9CGTA 3PUOA 1D7YA 2EQDA 1EX5A 2PZ0A 1H5VA 3UZJA 3PZOA 4A35A 1NWUA 5CPNA 2GGIA 4HJWA 2P76A 1Z89A 4MYXA 1H7WA 5GJPA 1W9XA 2ODOA 1JYVA 2WNWA 1OZQA 3QGVA 2O9TA 4G1KA 1A5MC 1EIBA 1MW0A 3HG3A 1OGGA 1D8CA 5DO8A 1XKYA 2J47A 1ZBKA 3IVUA 3KRBA 3F4CA 1UROA 4EANA 3D46A 3LX9A 1NP0A 2DIEA 3UG4A 1LJYA 3VCRA 3UZXA 4EXBA 1OBAA 1J9YA 4IF2A 2IW0A 3JZUA 1ZKQA 2VFFA 4FIRA 2QGHA 5CH9A 2B7QA 3BSHA 1GOIA 3URAA 2O0TA 4JIIX 4S3KA 2G50A 2VMFA 4X9SA 1E6SM 1HL2A 4GNJA 2J79A 4Q8MA 3CIXA 1WAUA 1XBYA 4BR1A 5CG7A 2BFGA 3I7SA 5D9OA 1XHGA 1K02A 3G1AA 4X2PA 1JZ4A 1TV5A 5KZ6A 4OBSA 1NHPA 1N8WA 1XX1A 3S5SA 1K3UA 1UPMB 3VIIA 1GREA 2EQ8A 4AEOA 1L8NA 3G77A 4GFIA 2PDQA 4ZE4A 2IQDA 2X1IA 4BI7A 1KBJA 2BVTA 4D8AA 4CCEA 3U3HA 2DVUA 4RDWA 1R46A 3ARQA 3L21A 1RLCL 2PA6A 3VKKA 2W9MA 1DV7A 4ZQRA 1HX0A 2DZUA 1H2IA 3DUGA 3SO7A 3LEPA 3BJSA 1MW1A 3WENA 3VIOA 5BXTA 3NYDA 3K4WA 1SGJA 1XGDA 2XWDA 1N7KA 4TIMA 1TV2A 4X2RA 3PPGA 1KM5A 2BGNE 2WSRA 3KBNA 3VD3A 4YTTA 1QPKA 3AS2A 1Q6FA 1XYFA 2RJGA 3GDLA 3GD4A 1HJQA 1XF0A 4DBWA 2PCEA 5JRBA 3XIMA 2BGQA 3CMGA 1QNSA 3S5NA 3QXBA 4C1NB 4LH8A 5BWAA 2BCPA 2OOGA 1J12A 1TE1A 4HOXA 2OWCA 2GQ9A 5LA2A 3UF9A 5HMDA 2FGBA 3BGJA 1MDLA 4JIRA 3BANA 1EHAA 3CASA 2Y7DA 5AYXA 2BXYA 3TN6A 1TR1A 4TUFA 3NTYA 3NNTA 2ZZ0A 2P3EA 4MB4A 5EYWA 2J74A 1FWEC 4ZO6A 4AIBA 4DJFA 4WDWA 3G1FA 3ALFA 3NQ6A 3VGEA 1BF2A 3PN8A 4HHPA 2X8GA 5H1WA 3UCDA 5A8NA 3GYCA 4AW7A 1XGEA 1F9CA 3GXTA 3GHRA 2FPTA 4TX8A 1GGOA 1P7TA 2VELA 5E0KA 1YBQB 1W32A 5BOEA 1X2GA 4QG9A 5LZLA 3DHDA 1PZ1A 5E6ZA 2YW4A 3UXLA 2FPVA 3AALA 2XZ9A 3HW2A 5EFDA 1SO6A 3WQOA 3PZVA 4GQ0A 3BC9A 3TYZA 4XD3A 4FXRA 2VURA 5CBBA 1J8VA 2D73A 3LG3A 3CPRA 4KCWA 4PMJA 1E56A 1Q1RA 2P0OA 4OOZA 4BF5A 4XIAA 2G4JA 3BOLA 3PB0A 3GDRA 4NZCA 2BZNA 1V4YA 1UBSA 3GS6A 4AYSA 4JNMA 2F2HA 1WNOA 1BXCA 1TPUA 2D0FA 3S46A 4EAYA 1NTHA 1PAMA 2XINA 4PB3A 4WSJA 9RUBA 4QAWA 3QFEA 3WH7A 4KFOA 5FS9A 3DHUA 3TLQA 1GETA 3QFAA 2WCAA 2ZTJA 3WLTA 4YCPA 2AKMA 3UW6A 3L2MA 2WNQA 1ZRQA 4FLSA 1UZDA 1TCMA 3TTYA 3W84A 2VR5A 4PCPA 1F8MA 1VENA 2W92A 3CMJA 3WQEA 3WFAA 1QPOA 2VYOA 4H41A 3E38A 2FZNA 3SR7A 4AZBA 3MY9A 1C92A 1VHCA 5MKGA 4LFYA 5CKSA 3W7LA 2DFAA 4BZYA 3TLLA 1S5WA 3IGUA 4A3QA 5C71A 3E0LA 4BQ4A 2PU1A 4IMEA 4R7OA 3WDQA 1I9CB 4NNAA 1QDSA 2I5IA 4DUVA 3ZLFA 1KR0A 4F9DA 2F5ZA 4LIIA 2X16A 1BPLB 3LHTA 4RV3A 1SMDA 3AM9A 1U1UA 1V0NA 2A6LA 3SFKA 1PX3A 3D9XA 1FDZA 3ZWTA 2XVKA 2Y2WA 1O60A 4MFEA 3MUIA 3URHA 3CZ8A 1XDMA 3UT0A 2PMQA 3H4WA 2YVGA 1UMYA 2P10A 1X8FA 1A5BA 4WGHA 2XVPA 3BLKA 1SB3B 5CQ1A 2V6OA 1W37A 5HATA 4L1WA 3QBUA 2OYLA 4PMUA 1AG1O 1LYXA 4XUYA 2C8NA 1FUYA 4B90A 1EGVA 2VTFA 1REQA 1GVQA 1XLLA 1DE6A 3I7RA 3BLDA 1UMLA 3LTYA 5CCZA 3STEA 1UYQA 1POJA 1Y8BA 1UBPC 4I8DA 4LRTA 1GESA 2GDQA 5FL1A 4Y9NA 1KR1A 3UG8A 3PTQA 1MEIA 5GVJA 3AUJA 1DJIA 3DFQA 3LSBA 3C86A 3CHFA 4HQVA 2WQDA 3MI3A 2OELA 3IJIA 3OZPA 1EO7A 3C6CA 3G3MA 2ZE3A 1KBBA 1HN1A 1V03A 4C6IA 1BVNP 3WK0A 4RDVA 4C7FA 3NQ8A 2ZRXA 4HMDA 1YMYA 2EO7A 3IK4A 2XSAA 3KBSA 3NOYA 2UY5A 3WLMA 3UQNA 1RY8A 2Z6IA 3B06A 1YIXA 4CU7A 1EDQA 5DQPA 3HPFA 2V9DA 3NL5A 5HMFA 3TYEA 3L68A 4DWSD 4I3GA 2R1LA 1JEHA 5TNVA 4E38A 4E3TA 2ZADA 3ZJKA 1UHVA 1YKWA 2DW7A 4OTKA 4A22A 2RGMA 4GINA 2JGQA 1UR3M 2YVFA 3B8UA 1KM6A 1KXVA 4C6OA 1VFHA 4IWWA 4PH6A 3MHFA 4DF0A 3TTSA 3IPWA 3W73A 4CD7A 3TC3A 3LOTA 1UOZA 2WW5A 3V5OA 5C0QA 3SUTA 2AQVA 3GXMA 4O1EA 4O14A 3M5VA 3WIJA 3CZJA 4Z1YA 1WZAA 5LNUA 5AHNA 2Y7GA 3AU6A 3L0GA 3QKZA 3KL5A 1HJXA 5AFDA 5D4YA 1W3NA 3BV4A 1Z32X 4P7NA 2DZTA 3KBMA 2TRSA 1IEWA 3P14A 3NQ2A 4NIRA 1IEXA 3VD5A 3R0KA 2Y89A 5U1OA 1ONWA 2YBVA 1CENA 3WH9A 3GUGA 1HVQA 2NT1A 3CXBA 4XKYA 4PCFA 1ZPTA 3VMNA 3LQGA 4C1LA 3U57A 1QOQA 1A4LA 4LAZA 3E2QA 1W1IE 3BJFA 4G2DA 4PMXA 3MP3A 4QG8A 2J8GA 4HYRA 4GUJA 1E4IA 3QR1A 3NA8A 2NVCA 5CAHA 4LBRA 3DENA 1J0JA 3MHGA 1GWJA 5C54A 2Y85A 3H55A 1VGAA 4LA1A 2ZUNA 4A05A 3VFCA 3DCPA 2Z7GA 4LS0A 3EWXA 1V08A 3GHSA 4ACYA 1IZJA 1K9DA 1QJWA 4MWAC 1LQAA 4ZEPA 1AZ1A 2ZRZA 1FTXA 1R2SA 1UOKA 4P7QA 2XIJA 5H2ZA 3XINA 5AHIA 4AZHA 5M1TA 3MU7A 3W7KA 4M81A 1UASA 2TSYA 3EA2A 3GRIA 5I3HA 2C18A 2WV8A 3T55A 1B3ZA 3SDOA 5CEWA 2UZ9A 3PM6A 3L4YA 1QI4A 5I03A 3BICA 5BCAA 1W17A 5HK4A 2E6YA 4TV6A 3O9NA 1XG3A 2F2KA 4WGXA 3MCOA 4L9ZA 1DVJA 1B3WA 2XN2A 1AFSA 4HHMA 4X0VA 4A29A 1B4KA 1FWSA 3VDCA 3CU2A 5AC4A 5F1UA 1LBMA 3CAVA 4M1BA 3SY5A 3VIJA 5JH1A 3W28A 3U5YA 3AROA 4JNZA 2PDNA 3NEVA 4H8HA 3B0PA 3RPDA 6REQB 2HVMA 4HPGA 1MFVA 3IUHA 1WYGA 1X6LA 3APTA 4AWEA 1BYAA 3SN1A 5LYRA 4EKJA 3KTSA 1LPFA 3UYIA 1O7AA 3BCDA 4D6DA 4I9JA 3IANA 4YWIA 1LORA 1MQQA 1EUAA 4DYKA 3WBYA 3WY1A 1ME7A 1ISZA 3ORWA 3N29A 5AECA 1BGAA 2QHAA 4NNBA 1A49A 3L4WA 2FTWA 2WZHA 4XB3A 3W3OA 3QQ1A 4K7VA 4WY0F 2RGLA 3FGCB 3TSMA 5FJUA 1OCBA 4HZMA 4G6CA 4JTAA 1GRHA 3T7VA 4LUTB 5HQMA 1TV4A 5E9AA 3WQDA 1QNOA 5J04A 4HNVA 3W75A 5LA1A 8TIMA 3UGVA 1KM3A 3U2EA 1QNVA 4D72A 4FF7A 7TAAA 1WKFA 4G7EB 3B9NA 4UTKA 3L4UA 3LSCA 5CPOA 4TOQA 4DI8A