3OP2A

Crystal structure of putative mandelate racemase from bordetella bronchiseptica rb50 complexed with 2-oxoglutarate/phosphate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
380
structure length
375
Chain Sequence
SLKITEVKAHALSTPIPERMRVESGAGLKLNRQMILVEVRTDEGVTGVGSPSGPYDLAVLKRAIEDVIGPQLIGEDPANINYLWHKVFHGEVSRSVGIAAMSGVDIALWDLKGRAMNQPIYQLLGGKFHTRGVRAYASSIYWDLTPDQAADELAGWVEQGFTAAKLKVGRAPRKDAANLRAMRQRVGADVEILVDANQSLGRHDALAMLRILDEAGCYWFEEPLSIDDIEGHRILRAQGTPVRIATGENLYTRNAFNDYIRNDAIDVLQADASRAGGITEALAISASAASAHLAWNPHTFNDIITVAANLHLVAASPHPAMFEWDITHNDLMTRLASYDLKLENGLVQPPQGPGLGFEIDWDFVAAHAWKGEPAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative mandelate racemase
publication title Crystal structure of putative mandelate racemase from Bordetella bronchiseptica RB50 complexed with 2-oxoglutarate/phosphate
rcsb
source organism Bordetella bronchiseptica
molecule tags Isomerase
total genus 114
structure length 375
sequence length 380
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3op2A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3op2A01
2OQHA 3I6TA 1R0MA 3N6HA 3CT2A 3TWAA 2PTWA 3DFHA 3MUCA 3QLDA 1P43A 2PU1A 4H83A 4IZGA 1KKOA 3ZLFA 4IL0A 2AL2A 4IT1A 3VCNA 4X2PA 2XH0A 1NELA 2PP3A 2HXTA 2PU0A 3TCSA 3THUA 3TTEA 3MSYA 4DHGA 2OZ8A 3BSMA 2PA6A 1BKHA 5FJPA 4MGGA 1WUEA 3ZLHA 2PP0A 3I4KA 2AKMA 3UJFA 2OPJA 2HZGA 3UGVA 3NO1A 3BJSA 4FI4A 1EC8A 3EKGA 3V5FA 4M0XA 4KWSA 5BOEA 3H70A 1MNSA 3MZNA 3IJQA 2I5QA 4GYPC 2PPGA 2QQ6A 4ENLA 1EBHA 5FJOA 3FJ4A 2GGJA 3ES7A 2DW6A 4G8TA 3D46A 4G7FA 3OPSA 1JCTA 4ZCWA 1TZZA 4M6UA 2GL5A 3PK7A 4K8GA 3IK4A 2XGZA 3SQSA 3T9PA 4DN1A 3TQPA 3U9IA 1NU5A 4GYPA 3QPEA 2PP1A 3DG6A 3DEQA 4FP1A 2QJNA 2PODA 2FYMA 5ENLA 2OZTA 2OQYA 1XPYA 2MNRA 3S5SA 4EWJA 3JVAA 5J04A 4ZA0A 3SN0A 4E4FA 4IL2A 1KCZA 2QJJA 4A3RA 3PWGA 1ONEA 7ENLA 2ZC8A 4JN8A 3ZVHA 3VA8A 2GSHA 3OZMA 3UJRA 1TKKA 3FV9A 2GDQA 4H19A 3MWCA 2GGIA 3DERA 2PTYA 1MUCA 3DG3A 1FHVA 2GGGA 3Q45A 3DFYA 3NXLA 4H2HA 1MDRA 3N4FA 2P0IA 3CB3A 2PTXA 1DTNA 3ES8A 3H8AA 1JPMA 2ZADA 2MUCA 4J1OA 2XH4A 3UJSA 4E4UA 4GFIA 3V5CA 2P8CA 2QDDA 1XS2A 4IHCA 1BQGA 3PFRA 4GIRA 2PGWA 3IJLA 3JW7A 3R11A 3H7VA 4IP4A 4A6GA 2OZ3A 3UXLA 3R0UA 3UCDA 1SJDA 3T6CA 3T8QA 3OW1A 2PSNA 1TE6A 3TOYA 3BOXA 3R10A 1L8PA 4DYEA 4HNCA 3SN1A 1YEYA 2NQLA 4KPLA 5BOFA 3FVDA 4GGBA 4DXKA 3P93A 3UCCA 2XSXA 3TWBA 3D47A 1E9IA 1SJAA 4H1ZA 2OVLA 4K1WA 2XH7A 1P48A 1KD0A 3PWIA 4HYRA 3V4BA 2POZA 3R1ZA 3B97A 1R6WA 3ZVIA 3QTPA 4MKSA 1WUFA 3GO2A 3VFCA 2GGHA 4E6MA 2P8BA 4F4RA 3CXOA 3U4FA 3N6JA 3RO6A 1ECQA 4GGHA 4JN7A 3DIPA 3TJIA 2CHRA 2AL1A 2ONEA 4HPNA 3MY9A 1PDYA 5FJUA 3QKEA 4DWDA 4A35A 3CAWA 2QGYA 3IJIA 2DW7A 1IYXA 2PS2A 2QDEA 2HNEA 6ENLA 4KT2A 3VDGA 4HCHA 4GISA 3HPFA 3KUMA 3OZYA 1SJCA 3CYJA 3TJ4A 4Z1YA 3OP2A 3ZVHB 3NFUA 3P3BA 4MMWA 3RCYA 2OLAA 3FXGA 3V3WA 1PDZA 3GC2A 3UJ2A 2O56A 3QN3A 1RVKA 2OO6A 3SBFA 3MKCA 4KEMA 3DGBA 1MDLA 2OG9A 2OKTA 2AL2B 3R0KA 4Z17A 3I6EA 2OX4A 4HNLA 3DG7A 3VC5A 1SJBA 4HCLA 3EEZA 2AKZA 2PTZA 3ZLGA 5FJRA 2PCEA 2XH2A 3FCPA 4HCDA 1F9CA 4DX3A 3RRAA 4K2SA 1EBGA 4E5TA 1KKRA 3T4WA 1JDFA 1ELSA 3GD6A 2FKPA 4GMEA 3OTRA 3MQTA 3H12A 4HN8A 3UJEA 1MRAA 5EU9A 3GY1A 3VCCA 3STPA 3DESA 3Q4DA 3ENLA 3CK5A 3P0WA 1OEPA 5IDZA 3SN4A 5FJTA 3DDMA 3UXKA 2RDXA 3RGTA 1EC7A 3TW9A 3FYYA 2QVHA 2P3ZA 2P88A 2OFJA 3RITA 2PMQA 3NZGA 4ROPA 3JZUA 3R25A 4YWSA 4E8GA 4J3ZA 3VC6A 3K1GA 3RR1A 2HXUA 3SJNA 1EC9A 4IP5A 2GGEA 4JHMA 3N4EA 2PGEA 1FHUA 1W6TA 3S47A 3SSZA 1JPDX 2QJMA
chains in the Genus database with same CATH superfamily
2NT0A 3UWEA 1KO0A 3OEXA 2D2OA 4AMCA 1GRHA 4YVVA 1H1NA 4W8AA 1QT1A 3U0HA 1IT0A 3TWAA 3U5YA 5CSSA 1KM4A 3KS5A 1ODZA 3QLDA 2PU1A 3ANUA 4FLRA 3CYVA 4JOMA 3M16A 3WSUA 2R82A 3BGAA 4EANA 1G4SA 4QAIA 4DVOA 3GUWA 3EWCA 2FPVA 4X2PA 3VYLA 1XANA 1QHZA 1ITQA 2OWXA 1X1OA 2Q71A 3N73A 3UNTA 2DSZA 2IPFA 4RZBA 2J9YA 3UY7A 3VNDA 3QGAC 3B8UA 5LIYX 1RCXB 3EKGA 3BMWA 4B15A 2XPKA 3AALA 4DBSA 3GVQA 1IXNA 2I5QA 4UQDA 4LUTB 3VZZA 1DL3A 3GIQA 4YVXA 5CXPA 2DH2A 2PDMA 4L9XA 2V9DA 3VMNA 3W2LA 2WMFA 3BSHA 4K38A 4HTYA 1EP1A 1B9ZA 5REQB 3GLCA 2X7WA 2E1WA 3WLIA 3EB3A 4RV3A 2R24A 4NU7A 4TTUA 2CEQA 2Z1KA 3G77A 2YL9A 8RUCA 3CBWA 3C52A 3S5YA 1KW1A 2J9ZA 1GQJA 4B91A 3LYEA 1XW8A 3U3HA 3UWQA 3GD3A 3DG6A 4GY1A 3B06A 4K7VA 2ZFAA 4C6NA 3GH4A 5CG0A 1GJUA 5CC3A 3EWYA 2G3JA 2TYSA 4I9TA 4HYVA 3S2JA 2PEVA 3NDOA 4ZZ9A 1W9UA 4DXVA 2NQZA 3H2FA 3H7RA 3W07A 1UP3A 1RLCL 3W3OA 3QC3A 4IMGA 2BVYA 2D3LA 2ZQ0A 4MDOA 3VIKA 4Q8NA 5C2XA 1BG9A 1A3HA 2JGQA 4MYAA 3LHYA 4LAZA 1EJVC 4D8AA 3IGUA 1XLIA 3TMLA 3VIMA 4D6JA 4JNZA 1NVMA 4PBGA 1GT8A 2A8XA 1P0BA 2ZYFA 1FH7A 3PTDA 4JY8A 3IJ8A 2E5AA 3T0BA 1XISA 2JKPA 5U25A 4XAFA 1CZ1A 1GONA 2W3SA 1OZQA 4ZL1A 2X42A 2GZXA 2P0IA 3M0YA 3H8AA 3NGFA 3FVMA 2FGBA 4GFIA 2Y85A 1NARA 3CIXA 4C6PA 4EM4A 2Y8VA 3OGRA 4FIQA 3R11A 5M5DA 1P6WA 5TR3A 2OZ3A 5T8GA 4EWND 4R34A 3LV5A 3EF6A 4S39A 3VDAA 1UROA 2OSYA 3NVDA 5FAJA 3PJWA 4LUTA 1XH0A 3TQVA 2VZUA 2XSXA 4EACA 1SYTA 1ZP4A 1KD0A 4HYRA 4PUEA 3W73A 3A6OA 4B2DA 4JIEA 3ZVIA 2J74A 3V7PA 5REQA 3KCJA 3A9BA 4A8LA 4NZCA 5AHIA 4W4QA 1HFBA 6XIMA 2WZTA 1NHSA 5TAOA 3K4WA 4IQDA 2VM8A 3VD7A 4DZIA 3N19B 3PFMA 3DZ1A 3ZJ7A 4TIMA 3CHCA 1CLKA 1BKSA 4JCLA 4DI9A 4DWDA 1EH9A 1WKDA 2HSAA 2E0PA 4AVNA 1CXFA 2EHHA 3LU2A 1BSLA 4UQBA 1F2JA 1Z89A 4U4MA 4GIYA 4ZODA 3Q2DA 5HOSA 4NXSA 1IEXA 2VCCA 3AJ7A 2F38A 3I7SA 1P0DA 3PP7A 4QJ3B 1XCFA 1KGUA 4QLLA 4GI4A 3VX0A 3KVLA 3F4DA 3W2KA 3FA5A 1MEIA 1J2WA 2YA0A 3QSTA 1Z48A 4DYJA 1BWVA 4L9ZA 3G1XA 2WPBA 2BY0A 3UWUA 2X8RA 3WL1A 1MXDA 3NQDA 2O9PA 5E9AA 4UFLA 2C16A 1YHTA 3UWVA 1GVRA 4AWUA 3CUJA 2ZX6A 4YS1A 5JIWA 2X16A 5C2GA 5A2AA 2HWGA 1I45A 1SJBA 3PBMA 2VCBA 4O1DA 1BZLA 1ZHAA 1JXJA 3UZJA 5FSEC 1MSSA 2VZSA 3KP0A 1FWFC 1N60C 1BG4A 2HE5A 4D1IA 4C6JA 5LA0A 2FZBA 3S5ZA 4BJHA 4D6CA 1QWKA 3V16A 4ZOHB 5FMHA 3CL7A 2CETA 3WDPP 1SM9A 2GSEA 1TVLA 4HVXA 2CLHA 1OK4A 3QW3A 1J79A 5IM51 1D7FA 5B7ZA 3S2MA 3CIVA 3L4UA 4FR1A 3MTWA 4PCSA 3RGTA 3GNOA 5DMMA 1F76A 2C6QA 4AW7A 1JUEA 2FHFA 4S2BA 1MW0A 4EP8C 1SO5A 4IUOA 3M0IA 3KTSA 4JICA 3W86A 5AYYA 3ZQ9A 3WY1A 4IIEA 4D6FA 3FYOA 3AICA 3L5MA 1Q6GA 1XYZA 2WNWA 2QJMA 4PRTA 2OQHA 2RH9A 3I6TA 5BCAA 5FESA 3VINA 5FEXA 3OA5A 1VLIA 2YZRA 2X41A 3VNZA 3HQNA 3C2OA 4N42A 1K6WA 3GNDA 4ROQA 2ZVRA 5K2ZA 1E72M 4AD3A 3DBNA 1J0KA 4UCFA 3NAVA 3OYZA 4UFMA 3B05A 4ZB0A 4QP0A 3AS3A 3L0NA 1H5YA 4WLCA 3PSVA 4IGNA 1I4NA 4MZ1A 1SB3B 1MEWA 3VXGA 4FX9A 2HK0A 2PP0A 2AKMA 1M6IA 4O18A 2XIJA 2Z6JA 4GO9A 4QGCA 4NY2A 2Y24A 4NZJA 4CCCA 3M64A 2V3DA 4MJ4A 3G1DA 3KBSA 4AH7A 4JQAA 1CENA 2Z1BA 4Z0JA 1LPFA 1P7TB 3G1YA 2JIWA 4K37A 1HO4A 1FWAC 2ZTKA 4J27A 3I6RA 3GFYA 3R6IA 2CHNA 2FPYA 4FOKA 5D8ZA 2A1YA 2E5CA 2FFIA 3SCNA 5I5RA 4K7ZA 2KX9A 5M03A 1XR2A 1NQ6A 3C86A 3W9ZA 2OR2A 3UT0A 3W81A 1LLWA 2CLFA 1KM3A 2OEKA 3G2GA 1QHPA 3UA4A 4GNVA 2P1FA 5D8WA 3CH0A 4UIOA 4PL2A 3DGZA 2EPLX 2QS8A 3GBDA 1FWSA 1DJHA 1W9VA 3WQ6A 4YHGA 5C55A 2Y8UA 1E43A 1U5HA 3SECA 1I8JA 3NQ8A 3ECQA 4AHPA 5D2VA 1I0DA 5I02A 5CH9A 5CAHA 3KLLA 2NXIA 1J5SA 3H23A 3QH2A 3WENA 1GPWA 3KXQA 2XGBA 1F7BA 4X3ZA 2CYGA 3NSMA 5A8QA 2C0HA 1TTJA 3FJLA 4GCAA 3CL8A 3AIQA 1H60A 1BGAA 1ADSA 4JTCA 2YL6A 4UWMA 3I3EA 2C91A 5BXTA 1MUCA 4JTRA 4LS1A 4GVIA 2GQWA 3NRZB 2CLMA 2IPGA 1IE7C 2WKJA 1P6BA 1CT5A 3AI0A 4X0VA 4HNVA 2XN0A 3SY8A 3PR2A 1QMLA 1R3VA 3KVJA 1TJ0A 3HG4A 4HA3A 1NFGA 4IP4A 2AMXA 5LHEA 3EBVA 3R0UA 1B9BA 4KCWA 1UD2A 1B5TA 1JD7A 2PGRA 1OT2A 3KDNA 1RPKA 3LCXA 3STCA 3TW7A 1P7TA 3U4AA 4LWWA 1XLMA 1JJKA 4DXKA 5CAKA 1OGGA 3TWBA 3D47A 1T3QC 1HZYA 3SY5A 3S0CA 2EBNA 2QW5A 3EDKA 4PBFA 1TA3B 1G69A 3B97A 4H9UA 4KPRA 2VYOA 4Z08A 4MKSA 1I2RA 1US3A 2Y2WA 1D9EA 3UXDA 3K30A 1FOBA 4PGLA 3T0TA 3MO4A 1M7JA 1B54A 2VC9A 1RBAA 3LX9A 1KBBA 4Q8OA 3U4FA 1PZ1A 3EA2A 1DP0A 3V36A 4F2UA 1EPXA 8A3HA 3GTHA 1CGTA 3BCJA 2DT0A 3SFKA 4HOWA 2ONEA 1DJWA 1W31A 4JTEA 2QUUA 1ZALA 4NILA 4AZCB 3NVZB 1OC5A 1QJWA 3IUIA 5CQ1A 5HA7A 3M41A 2D2HA 3TYZA 5E9XA 3KVKA 2C14A 4LFYA 3VIFA 1GKQA 1R7OA 2ZBTA 4AZ7A 3A9IA 1K9TA 2OT0A 3BGGA 2EF9A 1BYAA 2H8XA 1TWDA 1GTEA 4UTWA 2V6AA 1VH7A 4XVDA 5DMYA 2VFDA 2E3TA 2FQIA 1QI4A 4XV0A 1E55A 2HQMA 4WKFA 3KUMA 3TX9A 4S38A 4N2YA 1KA9F 1EXBA 4QROA 5AN7A 3P3BA 3TVAA 1GEHA 3RCYA 1XH1A 4L1XA 1UQYA 5I6SA 5HNNA 3E02A 3AROA 3TTYA 1CGWA 1WOAA 5GQBA 1PDZA 1I2NA 1HT6A 1GVYA 3P5YA 2ACSA 4EAMA 4HK7A 4NI8A 3EA1A 2BTMA 1J5TA 2ZRUA 4AY7A 3LNMA 1C3FA 3OBEA 4NJGA 4AXKA 4G6CA 5DN1A 1F05A 1Y5WA 1D3GA 9XIMA 3GZAA 1RBLA 4A3UA 2DSKA 3QGKC 1SR0A 3AHVA 4H2CA 4ADSA 1S2AA 1VEMA 2XH2A 1AA1B 4JDBA 4X2RA 1EJWC 2WQDA 3I65A 1TMLA 1WBJA 3WUFA 3D3FA 1JCLA 1EO5A 5LNUA 4L4PA 3G1FA 1NOUA 4US5A 3IWPA 2NVCA 1V0KA 3N6QA 1OQFA 1TA3A 1GZJA 2ISFA 2PLCA 3CZEA 1ZU8A 1QO5A 1W1VA 4I3GA 4XKYA 4AIEA 3W1TA 3S2NA 2PCQA 1TIWA 3EPNA 4UMAA 2QMJA 1M65A 3PUEA 2X1TA 3HF3A 3Q58A 4S3JA 1OEPA 3S9YA 1O95A 1KXHA 2EJ1A 3AWOA 5CPNA 4AFYA 5G1TA 2RGMA 2FTPA 3RU6A 1LWIA 4AC1X 3WLOA 1Z9AA 3P8IA 1XQKA 4AZCA 2G8ZA 1UA3A 2H9AB 4DWSB 3VMPA 2DU2A 4X60A 3CAQA 3CV1A 1DYSA 5BYWA 1TPC1 3LBOA 1W8SA 2E6DA 2DDXA 4NEWA 4U3AA 2XJ7A 1YPXA 2RDTA 4HK5A 1FRBA 3GDLA 2C3ZA 4UFKA 3IPWA 4JHMA 2H90A 1R2TA 2EPNA 2E4TA 1W6TA 1AQFA 3PAOA 4IISA 1K9DA 3N3TA 3RX3A 1YKWA 1EZ2A 3E0WA 4QQ3A 1QATA 4UTMA 3P8JA 3TJXA 2NZLA 4PRRA 1XC4A 1IEVA 5LIXX 3LGDA 5I3GA 3BLIA 1GHSA 2Z26A 1VDVA 3TE9A 2PUZA 3S6OA 5TF0A 3SFWA 2Y7GA 5IRPA 4DLFA 5IHSA 3NYZA 4FEZA 3H24A 1RLDA 2JALA 3NQAA 3QMSA 2O55A 4LPCA 4QLJA 1F8WA 3S4TA 3AXXA 2PP3A 3MHFA 2PU0A 3MSYA 3BSMA 4LUSB 5F2GA 1PL9A 3SQMA 5GVJA 3WK1A 1JCMP 1DBTA 4LVAA 1Q6DA 4KWOA 4OTKA 3VZYA 4KWSA 4AWSA 5BOEA 3CHDA 3GVVA 3WF1A 3M7SA 4FS9A 3IVSA 1E6SM 2PPGA 3AIWA 4IXXA 3NQFA 1BRLB 3BAXA 3KBNA 1E56A 4PUDA 3DECA 3DH7A 3TA6A 4BQ5A 1BVZA 4IMFA 4U10A 4DO7A 1T41A 1LT8A 3MUIA 4RPPA 4AIBA 1XIEA 4G7FA 3OPSA 5A1AA 3IIPA 5I0DA 1J93A 2VL4A 3BZGA 1I75A 5G4WA 3AIEA 3NL2A 1GRGA 4TX8A 1Q3NA 4DWSA 2H9AA 1L6WA 1QK2A 3DEQA 1W56A 1QAPA 3MUZ1 3WZ0E 5AFDA 2W3RA 1BTCA 4H4QA 1QO2A 1XIMA 4EIVA 2ZX7A 2YKKA 3IIZA 3HB9A 3AYSA 3GNPA 2RDUA 5HMSA 3ITLA 2V69A 5LXXA 3BXWA 2RJGA 4QISA 1NP2A 3WDHA 3QC0A 3NZPA 4GXMA 3R94A 1J12A 3H2OA 4L6OA 3AMKA 1VFTA 1JYVA 1UWSA 1F61A 3S83A 1RSCA 4HHPA 4XTDA 5DCEA 2PTYA 1LORA 3IGSA 4MAVA 1X38A 4KRUA 2GGGA 1BAGA 4AX6A 2D22A 4DEFA 1V6YA 2JKEA 3SI9A 2C15A 4IIFA 2INFA 3AZSA 3DC0A 3GAYA 1VPYA 2JK2A 4C5YA 1R85A 3CJPA 2DZBA 1BEUA 3M6DA 4HU4A 3SUUA 3MMTA 4MLJA 3HQ1A 3UR8A 4AQLA 3C56A 5FACA 5A6TC 3BLFA 2PF8A 3TK7A 3B0VC 1LROA 3QSRA 3ZO9A 3ZT7A 1G7UA 1FFQA 1XSKA 2QMKA 2XN2A 2QULA 1TZ9A 2BFGA 4QJ4B 1L8PA 1W0MA 2W66A 4ZSUA 3C2RA 5C9WA 4BWLA 4N02A 1BRLA 2A0NA 2QCHA 3T0AA 4UZUA 3VKKA 4GZIA 2OVLA 4GUIA 3F4VA 4H9TA 2FZNA 5A8MA 5J8LA 3OC4A 1TVNA 1DJYA 1MUMA 2QPXA 5H8UA 1GPFA 3S42A 2Y5SA 2D69A 3H4WA 5KSWA 1E3XA 1I2QA 5C0QA 1B4KA 3IRSA 2OYLA 1DWAM 4JNMA 4UTJA 1FFUC 3KL3A 1GYNA 1MVYA 1O7AA 4OE7A 3KLJA 4E2DA 4LVDA 3TJIA 4GVFA 3SRHA 2Z29A 2AL1A 4Q8UA 2QAFA 1KTCA 1JQVA 4OOZA 1GVOA 1OYBA 4LS2A 4QNEA 4BQ2A 1QCWA 1DJQA 1YPIA 1LCOA 3TR9A 4PRWA 5CLTA 2ZZ3A 3ARUA 2J27A 1TJ2A 3RLUA 4HCHA 2E9LA 1H61A 3PPGA 3QY8A 1Q2SA 3GTFA 4LAOA 1SJCA 2NXHA 1MOKA 3KBVA 4Z1CA 5FI8A 4AY1A 3E2VA 3U2EA 3BLLA 3QMTA 4FSAA 5C9XA 3QR1A 1FH9A 1S2CA 1J6PA 1SW3A 3N9KA 3QM3A 3QV9A 1VHNA 1RVKA 1YW1A 3APYA 2OKTA 2CFYA 4LY8A 3BL3A 1R86A 2EAWA 4O8RA 3KOZA 3GG1A 1Y8BA 4FIRA 4QBXA 4MB1A 4IOTA 1OFRA 4KESA 1GOWA 4LBSA 4IQEA 3RJXA 4HCLA 3G8EA 3EEZA 1O5QA 3ABRA 4ONVA 2PCEA 4AVOA 4XAPA 3FCPA 2PF0A 2VRJA 3VIOA 4TO8A 2V3GA 4AY8A 1GVQA 1O1ZA 2TAAA 2Y8KA 3HV8A 4P7OA 1EOKA 1AVAA 3W0KA 4HNOA 1AD4A 1WDSA 3NO5A 2D2JA 3EPOA 1H09A 3FEQA 5DCBA 4UTWC 2XSAA 5A2CA 4H9VA 5CLWA 1TR1A 5I77A 4YPJA 3NPWA 1PO9A 1QHOA 1FWCC 4AD4A 3QHNA 1TPFA 3L21A 3H2AA 3VI2A 2X05A 3GG8A 3DCPA 5KINA 1U30A 1KCXA 2CNCA 3S2LA 4FF7A 4MY8A 1NOFA 1S2UA 3IIVA 2VTFA 1Q6OA 3B8TA 3LTSA 2XVPA 3PY2A 3BG5A 1J10A 4BURA 3R25A 1JFXA 3N9RA 3WJYA 4V28A 2YDSA 3U7BA 1G5AA 3VC6A 3W22A 4MADA 1JD9A 4ZEPA 1TELA 1LLOA 3LD5A 2QV5A 1JZ3A 4GQGA 2OEMA 2QVNA 1UBPC 1IXPA 1YE6A 3SR7A 1FWBC 4KETA 4Q22A 3NR0A 5K7JA 3N6HA 2D1ZA 3KW3A 7ODCA 2Z1SA 5D30A 2VX6A 1U1JA 4I5UA 4LBRA 1H2IA 3DFHA 2WW5A 1T99A 1F8MA 3C2FA 3S5OA 4CNTA 3CEPA 2DZVA 3BVJA 1QI3A 4NJIA 4D6EA 3THQA 4F79A 2W91A 3R07C 3O15A 1V3JA 4FX8A 2BWGA 1G01A 1B3OA 2DP3A 4S3BA 2O9RA 1TB3A 4JCMA 4V1XA 4Z2KA 1RJPA 3BJSA 4RNJA 3SCRA 4O54A 4Q8TA 1UZ1A 2VR4A 3WKZA 5ABEA 1FWHC 2ZRWA 1XYFA 3OODA 3W7GA 2PWEA 4PUUA 4QSFA 4YJ5A 4DY1A 1ALDA 1PB0A 3THCA 2HS8A 4Q8VA 2FFCA 2XN1A 4XD5A 3L5OA 4CQAA 3OVPA 4DUVA 3BAWA 3FJ4A 2J13A 2IMRA 4M1BA 3B40A 2JFEX 1XG4A 2DW6A 4QJ1A 1R3SA 2YPIA 1DE5A 1NHQA 4NKCA 2Z7KA 4H7ZA 4EXQA 4M6UA 1OC7A 1GK8A 4CCDA 1U22A 1DWHM 3W70A 1UIOA 3VPLA 4MG4A 4ZMGA 1T8XA 1RJRA 4Q8PA 5F4XA 2ZVIA 3DKJA 3AOFA 4F2TA 1TPH1 5FS7A 3IJ6A 5A6AA 4XBJA 1VEPA 2O0TA 1KCZA 4DM1A 4IMEA 4M1RA 1D3HA 1XF0A 1ZBCA 3QEZA 2PDCA 2BXVA 1IZCA 3CZGA 4U2YA 1V3KA 4FLSA 3FV9A 3TH6A 2Y62A 2EG8A 4P8WA 4XKMA 3UYCA 4IM4A 1IGSA 4ZXOA 2Y0FA 3L68A 4DELA 4OT7A 2XM2A 5BZAA 4ADWA 1V4YA 5A6BD 3A4WA 4IQJA 1CB7B 1MDRA 2BLEA 2XFWA 3M0JA 5BWFA 4PCTA 3ES8A 4J3UA 2BXZA 2WMHA 3MDWA 1JPMA 2MUCA 4F40A 4J1OA 1KFCA 5XIAA 1DTUA 5ABTA 1BQGA 1IZKA 3DK8A 4H04A 3W26A 3H7VA 1HQTA 4GRSA 3WJZA 4FXJA 4HPXA 5I24A 2WC3A 4XTIA 4H9MA 4PTNA 2EQ7A 1W1IE 4A22A 1V6VA 3KWXA 1IR1A 3WMSA 1YRRA 5BXPA 1TE6A 2XIQA 4DWSC 4NF7A 4XBKA 1A4MA 2V30A 3MBDA 5AB3A 4TU1A 2ACQA 4GGBA 3P93A 2PBGA 4PMYA 3KOFA 4HK6A 2GWNA 3R58A 4B3KA 1XGZA 1P48A 5E0CA 1S38A 4KMQA 2MANA 4JXCA 4A4AA 2ZUTA 3FXYA 4MPQA 2NX3A 3T4CA 4KFPA 4M81A 2P8BA 4F4RA 2GPTA 2GQ8A 1ME7A 1NPXA 1VENA 3DU0A 1XIHA 1W1PA 4JN7A 2CPUA 2BGNE 3MW7A 3FA3A 4HPNA 1CBGA 2V82A 4F0RA 3OVQA 3QKEA 3ARSA 2ZXQA 3IJIA 1RQEA 4GUGA 1TWWA 3E9AA 5DQPA 5HWJA 4GJJA 4G7EB 1WXZA 3FS2A 2XINA 2WBGA 4MF4A 4DO4A 1X6LA 4QE5A 3RMJA 3VZXA 1X8CA 4JKLA 3HPFA 5D02A 3MHGA 5CJNA 3GWQA 1VB9A 1W2PA 3HV9A 3TSBA 2GUUA 5HMFA 3K8LA 4U3CA 3GB6A 4YYFA 1EGVA 4LUYA 3QKZA 1Q1RA 4BWLC 1ML1A 1PX3A 1CB2A 3DYOA 2OGJA 3LGGA 2ADAA 3CASA 3VNKA 2ZA2A 3A13A 2OXNA 3HTWA 4LT9A 2OO6A 1THFD 3OVGA 3TLLA 1UZHA 3O05A 1KR1A 2TPSA 4OUIA 2HVMA 1GSNA 3IS4A 2A7PA 1RH9A 2DZXA 3S46A 3HW2A 1GREA 4I9AA 5FJRA 2DVUA 4URIA 3F2BA 3GU2A 3CUIA 2W27A 2WSRA 3CPGA 1OJXA 5FS9A 2YL5A 4AD5A 5AHMA 3B0PA 1ELSA 3RNDA 1UKQA 1UR8A 2IXVA 3GD6A 4AVFA 2GJNA 5BRBA 4NX0A 3SUTA 3APGA 2WWDA 4FNUA 1E6QM 2V8ZA 5EU9A 1T5AA 3PZUA 4O17A 4O0ZA 1KLYA 3KTCA 5A5WA 1XM3A 3NCOA 4HSOA 2GR3A 4CKQA 3A4JA 1PWLA 3TV8A 3P0WA 5CJ5A 5I07A 4MNLA 4Q4QA 2D73A 2HVNA 2ZUUA 5D9PA 2JQXA 3W84A 1KFLA 4R27A 3IIXA 3QFAA 3OOQA 5TQLA 1AL8A 3G18A 2VMFA 3EWWA 3WD4A 2X1UA 1OFEA 2J24A 2Z4GA 1VR6A 2WJFA 1H1YA 1OD8A 1T6MA 3GDBA 1A5OC 4GHRA 3H54A 2WP6A 4U33A 3CTTA 3CQJA 5BOOA 3QQWA 2NPXA 1UIPA 4D6DA 2QV4A 2J78A 1HXJA 4M82A 5HQLA 3PZOA 4RW5A 3WQDA 4RDWA 1XBVA 4H8VA 5MKGB 4LNCA 4GY0A 3S1XA 5U1OA 1G9HA 3N4AA 4U2ZA 1RBOB 5DX7A 1DOSA 3L65A 4PTMA 4GR1A 2GJLA 2RDWA 1BTMA 3W6YA 2YA1A 4HMNA 1KFWA 2PTWA 3QR3A 5D37A 4JDRA 1UD5A 4O19A 3MMUA 3EMQA 5C2CA 1GEUA 1F73A 1V51A 1XYMA 1NY1A 3ZLFA 3WX7A 5AHNA 3AYVA 4IL0A 4QJ5B 4C6FA 1UPPA 1ZAJA 4LYRA 2FZDA 4UQ9A 4DJFC 1ONFA 4J5NA 2UY5A 4NZ1A 3ZM8A 4ZGYA 1EHAA 3NQBA 4MNKA 4B90A 1DHKA 2HNHA 1OCBA 1NM9A 2VX5A 2HZGA 4R33A 1JZ5A 2XIBA 2QLYA 3RDKA 1V5XA 1ZJBA 3L0KA 3M5ZA 1RZMA 3WLMA 5GNZA 5H8PA 2CERA 3OB8A 2ZZ7A 3CHEA 3H70A 3AXMA 3AUOA 1QI0A 1BFNA 5C9UA 3NPXA 2PWUA 1WAWA 2GUBA 3TNBA 1A3XA 1LBLA 3RNMA 3RMEA 4RZ4A 3W88A 2DIKA 1B3WA 2O4MA 3WQPA 2PZ0A 2DZSA 2BHYA 3BSGA 2J7HA 5CZJA 1X6NA 1XYCA 2BP1A 1H49A 3MSRA 3PZNA 1QWGA 5C9RA 1XV8A 2DT2A 4L64A 4PMDA 2WVTA 3H21A 3CZLA 2GUYA 3BICA 1FUYA 3BW4A 3B9JB 3EPMA 3EWDA 2F6UA 1G4TA 1L0PA 5D04C 4LUJA 4J7RA 1KXVA 2X40A 2CW6A 1UHVA 5H8MA 2OQYA 3MKVA 4YVPA 4ZTYA 1UR0A 1WZKA 3WQEA 5CCZA 3LG3A 2ZXBA 1QFEA 2WLYA 4JTUA 5MKGA 4EXAA 4NASA 4RNIA 3VA8A 1LWHA 3G22A 3TTSA 1V03A 3T1GA 1DWJM 3HPZA 3TONA 1R7AA 3VOFA 2C3CA 4FNPA 3WBAA 1KM1A 3MU7A 4Q6JA 1B0IA 4BEQA 3L4TA 4H6KA 3PPHA 3NXLA 4DPPA 2J4GA 4JX5A 4XAZA 3W82A 2ASHA 1C29A 3KS6A 3UG3A 3HPSA 1SFLA 1XP3A 2Y5EA 2VCAA 2W92A 2QCFA 2WZIA 3V5CA 1WDDA 4TTGA 3T08A 3NQ2A 3QOMA 2R94A 3B9EA 3UF9A 2WVVB 3PB2A 3UCQA 2J3NA 1S2WA 2XWDA 5DRCA 1M68A 2OT1A 5CBIA 1XLHA 3D5HA 4EPKA 3LXCA 2CFFA 4AZBA 4IUGA 3S8HA 4M52A 2Y70A 1NTHA 3KVMA 4UR8A 1E6RA 3WD3A 5HWMA 3GIPA 2JIEA 2QF8A 4UQAA 5BXSA 4H1ZA 3A7UA 3GBEA 1J0IA 3SUSA 3V4BA 3H6OA 4BI6A 4NJKA 7A3HA 1R6WA 3CU2A 1WUFA 1TUXA 3GO2A 2NQ9A 1YXCA 4KIEA 4LV9A 5F1VA 3CXOA 1SZRA 1K6AA 3N6JA 1W1A1 1DPMA 1G4EA 2WZEA 1ZY8A 1ONWA 1TPDA 3N2XA 3DGHA 2O7SA 1KNWA 2VEPA 4LRTA 2FHBA 5G1YA 3UPBA 1QUMA 2CITA 4AIUA 2CBVA 4H4XA 3QGVA 2VGFA 4A35A 1EA9C 2E8YA 4ZQRA 5EMKA 4UFJA 2A21A 2J6VA 5FF7A 4YTQA 1ZAHA 1O4UA 2QDHA 4H4ZA 1GQLA 5BU6A 3FFSA 1QNOA 1FP9A 3E0IA 4H8UA 1XRTA 3VM5A 5I00A 1O1HA 3CYJA 2FDSA 4JYFA 1NFPA 3WBXA 1EJXC 5CJMA 2TODA 3EDJA 3TQKA 3N12A 3UG4A 3BV4A 3P5ZA 2ZZ4A 3F4CA 3IUDA 6CGTA 1FH8A 4FMVA 1JG9A 3AXKA 3DGBA 3LB8A 1HKMA 1D8WA 3R0KA 3OLGA 5CZTA 1LWJA 2WVVA 3O2LA 1OZMA 4RKAA 3BAYA 5LNVA 1UB3A 2OX4A 5GNYA 1HJVA 2DH3A 4IJCA 1UOKA 4LVFA 4W86A 2Z2BA 3UZZA 3AMZA 1XLEA 1Z41A 3QZ6A 1SSGA 4LX4A 1KFJA 3PBWA 2X8HA 4Q7BA 3C8FA 4B9ZA 3UESA 4RL3A 3HIJA 1W1B1 1VFFA 4UR9A 3DFTA 5K9CA 2BB0A 3URNA 3V1PA 4A2RA 3IRDA 5EMUA 1YIXA 2GJRA 3WMBA 3QV8A 2F6KA 3O0HA 4HMDA 2VOTA 3I10A 4JKMA 5EFFA 1EEPA 4TV6A 4S23A 3K8MA 2ACRA 1HJUA 3B0UX 2DJXA 2W0HA 1B2YA 1ISVA 1EF2A 1SGJA 2ATMA 1JVNA 3NZGA 4ROPA 5HXMA 1OX4B 4YWSA 4OV4A 3GHRA 4OV9A 1EC9A 1G4PA 4QSHA 4JHOA 2FGZA 1GQKA 5GJMA 4JQ2A 1F07A 2RHGA 4BF9A 3SSZA 3L4ZA 2XFFA 1K1DA 3A3HA 1ZBKA 3NL3A 2WSKA 4Q3MA 2VWTA 4ZXLA 3R7MA 3CUFA 4W87A 5DXXA 5MF5A 4I9JA 3VOHA 3ANYA 3R43A 1EDTA 1KRBC 2JF6A 4P7NA 1MWOA 5FF2A 3PJTA 2EPOA 4C1LA 3N11A 1LQ0A 3AFBA 3TA9A 1GUVA 2YXGA 1NELA 2PDHA 4TVDA 4J3WA 4QQUA 5T91A 3GVGA 4LA1A 2CWNA 3LCLA 4P2VA 1G0CA 3TW6A 4GH3A 4CD4A 2REQB 2W0UA 1F3EA 2Q3OA 5M1TA 3ZLHA 2ZX8A 4HNNA 3ZSSA 1XYBA 1E9ZB 3SJ3A 3QF0A 4LC6A 4RE4A 3OA3A 1EXPA 2WOIA 3M0XA 3VNIA 1US2A 2A6LA 2YGYA 4IJBA 2Z6IA 1YDVA 2FH8A 1UZ4A 4RDZA 1M3UA 3BAJA 4D2JA 3ABZA 1ZBWA 1IWPA 1H7NA 1W5OA 3PF3A 1CYGA 5G4HC 4C6MA 4A05A 4WUIA 3NDZA 1IR2A 1TV7A 5GJPA 4NVTA 2FHCA 2AGKA 3E0LA 4N0RA 4F0KA 2KAUC 3PK7A 5BW6A 3WH6A 3BK0A 3IK4A 1YXDA 2XGZA 4GFSA 4W8BA 3SQSA 4M80A 1XJBA 3DI1A 2BC1A 4QG9A 4WSKA 3ZR5A 3K46A 5GPRA 3EWZA 1JDCA 1UKSA 1OX4A 5CZ0A 4O0QA 1RCOB 4EWJA 3VD5A 3ITYA 4AB4A 2XDFA 2ZC1A 2WKGA 2R1MA 3VABA 3CO4A 3ZVHA 4PB3A 2VEIA 2J77A 1E6PA 1EJUC 5CC7A 4WDXA 1LUCB 9RUBA 2CBJA 3VKDA 4X9YA 3XISA 2GGIA 4JIQA 4CD8A 1LM1A 4DF0A 3NQEA 1EPVA 1XCWA 3T2QA 1LLZA 2DT3A 2NUWA 3HZ3A 2EQ9A 2FTYA 4MUZA 4HOZA 4I7VA 2XVGA 1A3WA 3V1HA 2YQUA 1UP0A 4GUHA 4N6EA 2C18A 4OECA 5I09A 4GIRA 3EB2A 4MHBA 3PAJA 4UMCA 4B16A 3UNDA 3AAMA 2WHJA 2OO0A 4CNSA 3TKFA 3VDBA 3SUWA 1HIZA 5LNWA 3QLLA 3CGBA 4DYEA 1PSCA 1ODUA 2V6OA 3LCFA 5AC6A 3UCCA 3FGCB 2XZ9A 1XIDA 3WEZA 4UOQA 4RUBA 4RK8A 3Q67A 5G2IA 5DMNA 4H01A 3U2OA 5AC5A 3E2SA 2Y6ZA 2IKIA 1RR2A 3FLUA 3CV7A 3W1RA 2UZ9A 3K13A 5DRIA 2A3EA 2GSJA 4UTFA 4UOZA 1HW6A 4Y9NA 4OKDA 4KWWA 2YA2A 3NYDA 2A7NA 1V79A 1W54A 1S2TA 4WY0B 1ZAIA 1FHDA 2CHRA 3OGSA 5A2BA 1HL8A 4CVWA 1JEZA 3GZ3A 1VFUA 4TX9A 1HO1A 1IT8A 3QYSA 4WKHA 4PH6A 4YIWA 2ZKMX 3A7RA 1PUDA 1LP6A 4P7LA 4GC3A 2J79A 2J7DA 2WB5A 3SRKA 3WBWA 3LHTA 4TVWA 2O92A 2QDEA 3WEMA 2NXGA 4H4PA 3MI6A 2HTMA 4HN4A 3LPGA 3OBKA 4GISA 1A0DA 1NF7A 3NEVA 3RX2A 4N9BA 3MJYA 1EOMA 4L4OA 1EFZA 1LUCA 3R79A 3UPMA 1UUQA 2PWDA 4OIFA 3THDA 4RZ6A 3FJ6A 4H4UA 5M2FX 3L2MA 2YXOA 2WZHA 1KXQA 3W72A 4DBUA 1FWJC 1PTAA 2O56A 3TEVA 3QN3A 4IH3A 3DFPA 1J11A 1V0MA 2FVKA 1WCGA 4NNBA 2CIPA 2A6NA 1JZ7A 1WZMA 2Y88A 2OOFA 4IXHA 1I1XA 4OZOA 3LTYA 3QYQA 1DORA 4H9ZA 1WE5A 3GR4A 3OGVA 5D33A 6REQB 1K8CA 1PKMA 3BJTA 4HCDA 4O15A 3CGDA 1K03A 5D05A 1TCMA 3O06A 3ARQA 1TX0A 1EBGA 3LQGA 3FGCA 2QCMA 5E09A 2OYKA 2CZDA 3KZSA 1XGDA 1RVGA 4FX6M 2FZMA 4IFOA 1VRXA 1DQUA 3LEPA 1Z7AA 5FD0A 3CK5A 1HP4A 2RUSA 4C6OA 1Q2RA 1BYBA 3DYPA 3O1NA 2QAEA 1HX0A 1XDJA 5M17A 4JKKA 2PURA 4JD4A 1QNRA 4H7VA 3BLPX 3CMFA 3DDMA 4WY0A 3AMLA 3CWHA 4CUCA 3T09A 1CLVA 2EPHA 2I5IA 4PMVA 1TYGA 3RO8A 1WYIA 2SFPA 4XIAA 3A5VA 5CPLA 3N1AA 1QOPA 3EOSA 5HR7A 1TTPA 2PMQA 3LSBA 3H26A 1R3YA 4NJHA 3LZ3A 1IIGA 1OWQA 3GXMA 2V67A 1ZNNA 3GTXA 2G3IA 1M1BA 4GIEA 1QK0A 3K1GA 1PCWA 4TMBA 4XZBA 5T9BG 2GR0A 2DVTA 3LHWA 3E2QA 3WQFA 2Z1XA 2V3EA 1HKJA 3O16A 1NQKA 3PM6A 4PUJA 4WJXA 2ZRVA 1PTDA 5AYBA 3HGJA 2WHMA 4H6QA 4QR6A 4PC8A 1P1XA 1CWYA 5HATA 4DBDA 1VYPX 3PUGA 3NVTA 3CHVA 2QDGA 2XFRA 1E70M 1EQPA 3MUCA 1PHWA 1PKNA 4AZ5A 3IACA 4Q8WA 2FGLA 2J88A 4U31A 1Q66A 2ACUA 2GVYA 1LJYA 2HPIA 3B0YA 4V27A 2X1SA 4JTTA 3BH4A 4EPBC 1KKOA 3T0DA 3ETRB 3FKKA 1LTDA 1UUMA 1BGGA 3VCNA 4HA0A 1UW9A 2Y1HA 2OQLA 3MDUA 2NV1A 1NWSA 1J8VA 4DHGA 3TUUA 3N18A 2X2YA 4YLWA 2CWXA 4AU0A 3B9AA 2X1RA 6REQA 4W93A 1XYLA 4O14A 1AODA 3BARA 1EC8A 1TQJA 3W24A 3DHUA 1AW2A 2PDKA 3FKRA 2XGIA 2RJHA 2D0FA 3QW4B 4W88A 1TFVA 3KHDA 4E3TA 4OHQA 4RV8A 4ZQPA 4PUWA 1EZWA 3VGBA 4X9SA 2WPGA 2IQ0A 4HZ8A 1A53A 3QHMA 1WBHA 2G3FA 2EQ8A 4EF8A 4G8TA 2A3HA 2CDUA 3ITOA 2ODOA 2Y7FA 3R13A 4ZO7A 1TCDA 1K7XA 2POTA 3EMCA 1M03A 4B5SA 1KBIA 3L4VA 4HMCA 4YCOA 2VDHA 1T96A 1EYWA 4S3KA 3PZ9A 1KC7A 3ITVA 5ABHA 1CXKA 2W61A 2DVXA 3W7CA 4FOJA 3PPFA 3N2MA 1FP8A 2XIMA 4EOUA 3EX4A 3VDCA 2WC7A 3UVIA 2CZEA 3L4WA 4EMWA 3GDMA 4UBPC 4NL1A 3SN0A 1X96A 3VGFA 4A3RA 3IK2A 1W37A 2PE4A 4AYSA 4LV4A 1DE6A 1XLDA 1XLCA 2GSHA 3ZSTA 3RF9A 5G2HA 1P0EA 4O57A 3TYDA 4QDWA 4JX6A 3SCUA 4HPGA 3SCQA 1C7SA 4CU6A 3A64A 4MB4A 4G1KA 3WLHA 1D8CA 2BY2A 4LF2A 1TPEA 3DFYA 3IIOA 4LOCA 1GOIA 4J3XA 3EDDA 3L66A 1JCXA 1W9BM 2WO5A 3G0SA 1ZQ5A 3UJSA 3W83A 1B57A 5A8OA 1Q85A 5CZSA 1XLGA 3JW7A 3ALGA 3I7RA 4JL2A 4JPGA 7CGTA 2QJGA 1GTHA 1G7VA 4KCUA 4RX0A 4D9PA 1E5JA 3R8HA 4E8DA 1WPCA 2YCKX 1XRVA 3BC9A 1CGUA 1EP2A 4IIDA 2YB4A 1S3TC 3GIYA 3R10A 2NLYA 4WR3A 4G1NA 4F2BA 4CN1A 1PCKA 4RR4A 3HG5A 4JIHA 1XLLA 2QHAA 3IJ7A 4C1KA 3GD4A 3NO3A 4R5EA 2V68A 1E15A 1MZRA 3GS6A 4ZB2A 1KBLA 3ZT6A 1RHCA 4YTRA 3T2PA 4GNJA 3P2VA 3T2OA 3AIUA 2ABBA 1V08A 3WH8A 3BWWA 3NDYA 1XXXA 1B90A 1T7LA 1XLKA 3JUGA 5D2XA 4D6GA 2F6XA 1E40A 4DNHA 2I9UA 1O6IA 5LNRA 4ZQNA 1YADA 3P74A 2DGAA 5LNSA 1EDQA 3ITGA 3TN6A 4HPHA 5FJUA 2RAGA 4HSHA 3CWNA 3GC5A 1K4HA 3LN3A 3HU7A 4I7WA 2FZ8A 2QGYA 4KGJA 4M51A 1QNQA 1ZL1A 4DZHA 2DW7A 2PS2A 4Q33A 5KITA 1KGXA 3MCMA 1F3WA 3O6DA 4IPNB 5I78A 1ZPTA 1EX1A 1XYAA 1HUVA 4HPJA 4P61A 3M46A 1VFSA 1YTDA 3BW2A 1BSIA 1OC6A 4BKNA 2ZWYA 2ZXDA 3TU9A 4B5TA 1TV2A 1UJQA 3VKJA 2Y89A 2FMOA 4Z2JA 3A22A 2W63A 4JFSA 3URAA 3HM7A 5E6YA 2W55A 3SIMA 2OLAA 2IKJA 3K1DA 3EXTA 3FXGA 1XICA 5KZDA 3BDKA 3ZZ1A 3UJ2A 4G56A 4WY0F 2G0WA 2VDIA 2OG9A 3D3AA 5J5RA 1UMYA 2WSQA 3G1AA 3MC5A 4P7RA 3L4XA 2PDXA 3N29A 4AAJA 2G97A 2AQOA 1V6UA 3AO0A 2ZX5A 4J28A 5DMLA 3E38A 1DWGM 4W89A 1Q6FA 2VENA 3AYRA 3DG7A 3SIZA 4GYKA 4JZ5A 3UR7A 4GINA 3AHXA 4IMAA 4K2SA 4REQB 3TROA 1QDSA 1YPFA 4LJ3A 4WK9A 2R6OA 4XZHA 5HPOA 5CPQA 1RXOB 3OVRA 2QF7A 5KETA 5H2ZA 3Q4DA 4GI6A 3TXZA 3EAOA 1UPMB 2QPSA 1R3QA 3OQEA 3TTOA 3LBCA 4UFHA 3UY8A 1M7PA 4W7VA 1FWDC 2J6XA 1STZA 3AC0A 2UBPC 5FJTA 3AWNA 4EMIA 4DYKA 4HGXA 2VUNA 4I8DA 3PC0A 4IFRA 1KFKA 1W91A 3WNLA 2OFJA 2PRHA 3RITA 4LAMA 3PPCA 1JDEA 3CWOX 1ZTVA 3JZUA 3VMOA 4BZYA 3LSCA 4D72A 4J3ZA 3GDTA 3HQOA 2QCDB 4YNGA 3MV11 1WKFA 1R5YA 3DI0A 2IXUA 4WVXA 5F4SA 3NTYA 1Q6EA 2XFYA 3KTXA 4HNTA 3O63A 4M5PA 4B5UA 1HKKA 1E3ZA 4FXSA 3PTMA 3CEUA 4YTUA 4IGHA 1SO4A 3KL5A 3KBMA 1P0NA 5EY5A 4XD6A 1C7TA 1LZOA 3F4NA 2QAPA 3EYPA 1E73M 4UZSA 4KBXA 5DF0A 1N5WC 3LRLA 3B4YA 3BANA 2E25A 2PC8A 4XAYA 3SADA 2HXTA 3L0GA 1XUZA 3THUA 4BEUA 1XHCA 2YB1A 3M5XA 4AISA 1A47A 1RD5A 3MI3A 3NO1A 3CLMA 2OLSA 8XIMA 2C19A 3HGOA 5EBUA 2NQHA 4DNMA 1JDDA 4ZQCA 1M7XA 3DGRA 3BQ5A 1QTWA 1IWBA 4UNIA 4REQA 5FL0A 5L9FA 3QFBA 1RA0A 4GYPC 3TAKA 2DSWA 3DENA 2KZHA 1TYTA 2RFGA 5AYIA 1YDOA 3BJFA 1S5NA 3MSGA 3S9ZA 3GW3A 4XO7A 3QZAA 1EGMA 1RAKA 1QOXA 1OINA 4BQ4A 3Q65A 4C6BA 1SSDA 4HIBA 3DHFA 4HT3A 3S2CA 5BRPA 4MUPA 3BG3A 1M41A 1XL9A 2E6YA 4S3DA 3N3MA 1TE1A 3CMJA 1A5LC 2PD9A 2YBVA 4WZHA 4W9TA 2F9RA 3OLDA 5K9XA 1MQPA 2V5DA 1DHPA 2PODA 1ZCOA 4GOAA 4ML9A 2YIHA 4N4QA 1UR4A 1K9FA 1TPUA 1LG2A 5DLCA 2QCDA 2OEJA 2EKCA 1XCXA 4IL2A 1V3HA 1RQHA 1S46A 1E6ZA 3WLSA 2ZC8A 3CH9A 5T26A 2E67A 3G1VA 5GNXA 3W7QA 3AMCA 3UJRA 2GDQA 1RUSA 3DAQA 3SM0A 5D2TA 4BS0A 4EQRA 3W2UA 1QRQA 1MQRA 4ATDA 2VRQA 1FHVA 4GCXA 3A23A 4JTIA 3MA8A 1SVDA 1O60A 2GK1B 4AUBA 2QGHA 3FSTA 1AH0A 3WDIA 4B3ZA 3BCFA 3UBPC 4FNTA 3AHTA 1QBBA 1DTNA 1TMHA 3DJGX 1H1ZA 5KZMA 2WP5A 3LPFA 3IVTA 1MXGA 4E4UA 4DZ5A 3W7LA 2YCLB 1GXFA 3PFRA 4A3QA 2PGFA 3QBUA 3W75A 2VELA 2YR1A 2CHOA 5K3VA 1EYEA 1NWTA 4A3YA 1FDYA 2YAUA 3WD1A 1LT7A 2DIEA 3OO2A 5A94A 1GJPA 3HN3A 3O8AA 2VGIA 1XIBA 4QG8A 4PA8A 3MI2A 3WLLA 3AIRA 3TLQA 2G95A 5TBOA 3EWXA 3W1QA 5BXRA 1XHGA 4EMJA 1NIUA 3ORWA 3AZRA 2VFFA 4HJFA 4H4VA 4S3FA 1OFPA 1JNDA 5HUOA 4E6MA 1SMAA 3W7KA 1CPUA 1FWEC 1Q7ZA 4I5XA 3PNUA 1WDRA 4QM1A 2IQDA 3RO6A 2J25A 5EBAA 2NV9A 1E4IA 3OBAA 3GQYA 3SURA 3ARYA 3CV6A 1KCKA 3ABOA 3L5LA 1N8FA 3A7AA 3ZXWA 2IPWA 1HJXA 3P62A 5CC5A 3E96A 3B3DA 3FA4A 3CAWA 1H6VA 3LHUA 3O0FA 1TREA 3L5AA 2NLIA 5ABGA 3HJEA 3CGCA 2A4AA 3EEGA 3PS7A 3NPVA 3O6AA 1O94A 5M3WA 3IGHX 3TQ0A 4PMXA 6TAAA 1EB3A 4PFHA 3VOJA 4F66A 3E74A 3HO8A 3CB8A 1RD6A 2QPUA 4TQTA 2DPEA 2YLAA 1NSJA 4DJED 1R9YA 2GK1A 2QJIA 3A12A 2WBAA 1TTQA 1EQCA 1E1FA 4XSLA 5CPMA 4ATWA 1W5MA 2XU2A 3SY1A 1X98A 4IIBA 4C6KA 3HPXA 2YCLA 4JTQA 4PZVA 2C1IA 2QCEA 4RW3A 3WBYA 1UWAA 3CV2A 4DUXA 2GR1A 2V5KA 3DK4A 2BDQA 3T81A 2AKZA 2PTZA 3ZLGA 3EX2A 4XAGA 2O4QA 1MFUA 1J9YA 4LNYA 2PDPA 1R2RA 3RRAA 2ZIDA 2Y7DA 2HJPA 4JTSA 2J7FA 3KP1A 1Z69A 3T4WA 1JAEA 1A0EA 3QHOA 5FAGA 1UCWA 5DCDA 4ZSTA 4C6IA 4CLMA 4C6QA 4UNLA 5JMUA 4AZIA 4WKAA 2E09A 4GZEA 3WD2A 4J2MA 1HF6A 2NUXA 3DH9A 2BVTA 3QV7A 2IQTA 4W8LA 2P50A 4EXBA 4MWAE 3SB0A 1NHPA 2Z2AA 1L2QA 1NAL1 1R30A 1JGMA 3LPOA 4H6EA 2WC4A 4L1WA 2HPMA 1E9LA 1FVPA 3K5XA 5KZEA 4Q8MA 4INFA 2PWFA 4GC4A 2VUYA 1UWUA 1SMDA 3SW6A 3JU2A 5A6BA 2YFNA 1HKVA 3UVAA 4JTDA 2OKOA 4X0NA 4I8YA 2BY1A 2NSOA 3UR5A 1W1ZA 4ACYA 1GORA 1JCNA 1L6SA 2HRWA 3N14A 4IP5A 3MB9A 2VEMA 1JROA 4ZO9A 3STFA 1YYAA 4GQQA 1D7KA 1GZ1A 1HJSA 4D6HA 3WK2A 3K8KA 4F0LA 3GNRA 4WXYA 1UUOA 1UA7A 1U5JA 1YNPA 3GXDA 1ZUAX 5DT5A 5FJIA 5ER0A 4DBWA 1OFOA 4KWUA 1DXLA 1HTIA 2VEKA 1DIKA 2GVLA 1P43A 1H5VA 5EKYA 1SW0A 3C0JA 2J7CA 3QFWA 1LRQA 4JAWA 1AZ1A 5IHRA 4JTHA 1S3HA 4LB3A 3AM9A 3L2LA 1MRQA 2OX1A 5DELA 4R9OA 1GVSA 3NQ7A 1FCBA 2QCNA 2WKLA 3CUZA 3HPAA 4MWAD 1VHCA 3WO8A 1ENUA 2DIJA 1KLZA 3URHA 1JRPA 1A5AA 1RQBA 1PEZA 2R1KA 5AY7A 2GYIA 2WANA 5AC7A 5FF4A 1V8EA 1XWYA 1GG0A 1WB0A 4W5UA 1XSJA 1LDCA 3VNYA 3W2MA 1NDAA 1DVJA 2CZ5A 2EO7A 1W5PA 3P82A 1V93A 3FOKA 4MB3A 3E0VA 4EPEC 3TYCA 1GKPA 4PMJA 1KRMA 4XKYB 2DZWA 2GL5A 1PYMA 4K8GA 3WNNA 1WYGA 1J0ZA 3NOEA 1BHGA 4MKVA 3CPUA 2D0GA 4RNHA 4GA8A 1HKIA 4NIRA 4FP1A 3D9XA 4QG6A 1XKJA 3IEBA 3KBJA 4RDVA 2OMAA 4GVHA 3MP5A 1GKRA 1ZSXA 2NVKX 5HK4A 5J04A 3I3DA 3QV6A 4NAFB 3VO0A 3APTA 2ISDA 3SEPA 4UUIA 1ME8A 3WIJA 2W6RA 3M0LA 7ENLA 2PC4A 1UOZA 1C90A 3QY7A 3TC6A 1M6JA 3R5EA 4FNSA 1NFBA 4PMNA 1F4HA 1U33A 4H19A 3BLDA 2NVAA 3DERA 4UTTA 3WMLA 8TIMA 2AMGA 2X1IA 1G67A 2E40A 1ICQA 4EQSA 2VDGA 1GYMA 3G6MA 3WK3A 2VWSA 6XIAA 2ALDA 2X0YA 4H9XA 3B03A 3SRFA 1VF8A 1Q4NX 4CN4A 2ZADA 4HQVA 4A2SA 5HAOA 1V0NA 4FXRA 2ZXAA 4Y8FA 1XS2A 4O1BA 4OBTA 4K39A 4OFCA 3MSDA 1KN0A 2GOKA 1I2OA 4K8DA 4Q7NA 4GQ0A 1R3RA 4QDMA 3FAWA 1SU5A 3TOYA 3W7NA 4LYQA 3NS1B 2D24A 5FEWA 2BVWA 3G1HA 1HL9A 4Q7IA 1JR1A 4C90A 3USZA 4JR5A 2UWFA 3C8NA 3WLTA 4PUMA 3EX1A 1ISYA 3BAIA 3NURA 1WO2A 3PHAA 4XZMX 1R3WA 1UH4A 1H7RA 4J56A 4MJZA 4JTLA 4XZ9A 1X6UA 4LEQA 2WOWA 1AMKA 3UWWA 1JEHA 1A5KC 1CGXA 1NDVA 1PYFA 4TX6A 3LMYA 1EJSC 4PCPA 5FKYA 4K1GA 3BUVA 4MTVA 1CXIA 1S5MA 1FWIC 3KOWA 4NUWA 3FY1A 1EP3A 1PDYA 5JH2A 2I56A 5CPSA 2IKHA 1JRCA 1XPGA 1MO0A 2PZNA 4O0KA 1IYXA 2F7FA 2I57A 4Y9OA 3KFTA 3DUGA 4NAFA 2HNEA 3CIWA 2HROA 4H9YA 4GI8A 2BOGX 1W3IA 2HK1A 1GV4A 3R12A 3ZJ6A 1E0WA 3W27A 1GVEA 3EWUA 3TYAA 4JDYA 2WQPA 2BOEX 4GI9A 4YU1A 1HP5A 4LAKA 3TJ4A 3DKLA 4IX2A 5B7YA 4GLEA 3WNMA 3W7HA 4YTTA 4MMWA 3B9NA 5E93A 4AG0A 5C8BB 4UR7A 2YBUA 3RLHA 1LRTA 1OG6A 2CLEA 2WJZA 4JEJA 3MV01 4KERA 1EO7A 3KEHA 3SBFA 1AUSL 2XWEA 3BG9A 1GEQA 1R47A 1Q6LA 3UW6A 4BF7A 1N2VA 1PZ2A 4NQ1A 1DJNA 1W3KA 1F8IA 1Q1WA 3VC5A 4GQRA 2GVEA 1JL8A 4EE9A 2AGTA 7REQA 4J40A 3ITCA 2GFTA 5LKYA 4KCTA 4RXFA 1F9CA 3BOLA 3T7VA 1DJIA 1QPNA 2VKZG 4B9YA 4NP7A 1WNOA 1YQ2A 3VIPA 5TD4A 1GOXA 4C5ZA 3EA3A 4KFOA 3G6LA 4HN8A 1OCJA 1XLFA 4GX8A 1H11A 3W1AA 4W7WA 1X2GA 3GY1A 5JVLA 1KWKA 2UY3A 3P6LA 3M5VA 4MZYA 4JTAA 3OG3A 1RY8A 3CXBA 4D1JA 1FTXA 1A5SA 1GETA 2ABAA 3II4A 2ZWZA 4JIPA 5I3HA 3WLRA 3V35A 4GG9A 4ZO6A 3UXKA 2NT1A 2WOVA 4L5ZA 2BV9A 3VU2A 2Z2UA 1XX1A 1SUXA 3TW9A 3S1VA 2QUTA 4MKNA 5T9CE 1KQZA 1NJJA 3HFTA 1NOWA 4O28A 3UG8A 1ZXIC 2HQAA 5EMLA 4B5VA 2GGEA 1GQIA 2RABA 4M6VA 4XG1A 4H4RA 3RN6A 3PG8A 5EPDA 1VAHA 4QHRA 4TV5A 2VC5A 1EHNA 1TPVA 4WDUA 3UERA 4Z2IA 3GU1A 3PZIA 1H7WA 2QZRA 5HNUA 2DORA 3W1XA 1VJIA 1PV8A 2LLEA 1AJ2A 2W5FA 8CGTA 3GXPA 1GW1A 3AS1A 2X99A 1B4EA 3NL5A 4H83A 3SQLA 5EMJA 2EXOA 2ZZ2A 4TR9A 3CQHA 3CTLA 4M7TA 4GZ7A 4Q4PA 3C0QA 3UWYA 1NDYA 1E6NA 1YNYA 5CG7A 1SO6A 1XIIA 2HMCA 3PUOA 2INZA 2D2GA 1ONRA 5EGRA 3ZT5A 5I23A 1FEBA 3S1GA 4PTWA 3VE9A 3W25A 1S39A 1WUEA 3C5QA 5IFPA 4ERGA 4Y7EA 4HOXA 3G1RA 3QTGA 3STEA 1W8GA 5HJXA 2PRMA 2I16A 3WUGA 3H2EA 3HG3A 2FZ9A 1ECEA 3M47A 1RK6A 1XINA 1LYXA 2QQ6A 3U7VA 1JPHA 3AHYA 1UH2A 3H2CA 3WFLA 4AZGA 1A5CA 1E6XM 4XK2A 5FJOA 3N25A 3PZQA 3D46A 1HG3A 2BS9A 4H00A 4APNA 1TUFA 1JCTA 1W9DM 2ZRZA 1Y0EA 5FSDC 5CEWA 3VIHA 3FHQA 3REQA 1VQZA 1CXLA 1UD3A 4CEXC 2B81A 4XUGA 1W3HA 1AG1O 4L4LA 4YXGA 2WBKA 4U28A 3RPMA 1VPQA 1UWRA 6TIMA 3NQVA 1S2VA 3G1SA 4IGSA 2B7QA 1AL7A 1CGVA 4WF7A 2DUAA 4DUOA 4PN2A 4IPPA 4CQDA 4B3LA 1QR7A 3PN8A 4K6AA 4LANA 4PMRA 3C0SA 4C7GA 1FIQB 2BSLA 5ECUA 1J6OA 2B7NA 4M3PA 3WF0A 2NVDA 4PCNA 2I14A 1PIGA 3LY0A 4E4PA 4X63A 3GSMA 1LL4A 4GX9A 9CGTA 2V3FA 3CUHA 2PI6A 4DJDD 5HBFA 4WJEA 2WPFA 2GWGA 1V7YA 3LRMA 1UYQA 3MUAA 4QEEA 3VOGA 2HE8A 4PTXA 2DZTA 1BYDA 1ZJAA 4QNWA 1SZFA 4IHCA 5EYWA 4P7QA 3UR2A 3SCVA 1ONXA 3PB0A 3OG2A 1V3LA 1OFAA 4O8AA 2Y63A 2E8ZA 4N6FA 3OW1A 4ZQMA 1XDLA 2VGBA 5FEPA 1ZENA 1FY6A 3HMJG 4PMUA 1RK5A 4AYGA 2JF7A 3LHVA 3XIMA 4WGHA 3MVTA 1H7OA 1TMQA 3FVDA 1GCYA 3DHDA 2J7BA 4X22A 5A8GA 1JF6A 1W2VA 1E9IA 4L56A 5DXYA 1TWZA 4IICA 4K8EA 1XIJA 2EPKX 5A69A 3N15A 3M5YA 1YLVA 4FXFA 1BXCA 3E12A 3ABXA 3A4XA 3ARZA 3DOPA 1EUNA 2GQ3A 1QASA 1C8YA 5KVHA 1KB3A 4HD5A 1UD8A 4UTTC 1ZK7A 1KTBA 4CGTA 4XQ6A 5CBJA 3S9IA 5FS8A 3WLPA 3SGGA 1JCJA 1A5NC 2OELA 1E4MM 1OADA 1XI3A 1TO3A 4ORMA 1M5WA 1C9WA 1UMLA 3T07A 1K02A 3U6WA 1WAUA 3EMZA 3WLJA 1E0VA 1QNSA 2X8GA 3BV7A 1PKYA 4GK8A 4MY1A 1W5QA 3MUY1 4GYJA 1TPB1 2E5BA 1PXGA 2QUVA 3G8RA 2R1LA 2B4GA 3TJLA 2HCVA 3MS8A 4N9CA 1OF8A 1Q7QA 1E4NA 2XISA 5AVNA 1VCGA 3NZ1A 3R89A 3WL0A 5XINA 3H4KA 2GQ9A 3ABQA 1POKA 1AOGA 1MDLA 2L5HA 1DXIA 2Z24A 4AD0A 3FNDA 4H41A 1BVNP 2F61A 1TIMA 2Z1VA 2AAQA 3CUXA 3PG9A 5LSMA 4CVUA 3TNOA 4HNLA 1DXFA 1ITXA 2UY4A 4UOJA 1FWTA 2E3ZA 2G96A 2CLPA 2BGSA 1FEAA 4AD2A 1JFHA 5J5DA 4ES4A 3AQUA 4FO4A 3RCNA 5IOBA 1OGSA 2E9BA 1W1TA 3M43A 3DX5A 2PWVA 3H4XA 1EIXA 2EG6A 3TYBA 3QQ1A 4YHEA 3B9DA 2PDNA 4ATLA 1IGWA 3SSJA 4HSNA 2Z00A 1PE1A 1XDIA 5BMWA 1N7KA 1C9DA 3WH9A 3GFZA 2JK6A 1JUBA 4IPIA 1L9WA 3MCNA 4ZE4A 3RM8A 3TN3A 3O6CA 5I3FA 3B8SA 4CD7A 4L9YA 3VOCA 4R9XA 4GXPA 1PX4A 1Q45A 3GKFA 3BTNA 3ITXA 4N9EA 1U2YA 3UZXA 3WYZA 3RR1A 1UQZA 3BPWA 1UASA 1LBMA 1V02E 4J4KA 2P10A 4LTSA 1EJRC 2V5BA 5FJJA 2VC7A 3FK4A 3NSXA 1VPXA 1X1ZA 4EF9A 2WJDA 1VBUA 3L2IA 3TYEA 3FG2P 2O7QA 4YN5A 2A7RA 2C1GA 1IQ8A 3W7JA 1LF1A 4Q4MA 2BXYA 3VVGA 1JDAA 5C6MA 1RP9A 5A6JA 1DXEA 1J4EA 1QW9A 2X2GA 4OVXA 2R9ZA 4HBKA 3UYIA 3NM1A 4AMAA 2OLHA 1Q13A 1C93A 3SDOA 4DUWA 4ZB5A 3VCRA 4ILSA 2IPJA 1ZRQA 2A2IA 1KV8A 5EA9A 5LA2A 2WSPA 2PDJA 5FJPA 4W84A 1KV5A 3WQGA 4IX0A 1SW7A 3HOJA 1GVIA 4NG3A 2OPJA 3FYPA 1OX5A 3BGJA 4ZOCA 2G37A 3VX1A 4MPKA 1HVQA 4KRTA 1XC6A 2JBMA 3S1UA 4LXFA 3R8RA 1NDZA 4GJ1A 4FHAA 3UWZA 5LIWX 4ENLA 3NQ6A 4US6A 4FF5A 5BRQA 3JRKA 3DYMA 3IC9A 5CPOA 3PANA 2BVDA 1SO3A 1KFEA 4M7SA 1U83A 3RJYA 2HISA 3L7RA 1PZ0A 1I6NA 2WVSA 5FEZA 3DBPA 5K9DA 1W1YA 1E9YB 3TR2A 3HGRA 3W28A 4GBUA 1VEOA 3SCOA 3ONCA 4DN1A 3VGGA 2VX7A 1NU5A 2PP1A 3GDRA 1QVBA 2CXGA 4QCFA 1LG1A 3W1NA 3R8GA 4EAYA 1A50A 2P53A 4Z42C 3N2CA 3MO7A 4AWEA 4GNKB 5C71A 1JGIA 1K4GA 3S5SA 3GTNA 5DFAA 3PZGA 4OU1A 2R91A 3TC7A 2QKFA 1HGYA 1JULA 2XHYA 2PAJA 1M04A 4PEKA 4L7ZA 3BAKA 3OZMA 4EQXA 2F2HA 5AYXA 1TKKA 1MYRA 4FPSA 2J7GA 5F1UA 3SQPA 1A4LA 2EQ6A 3CC1A 3LPPA 4CQBA 1EBDA 4W85A 5LGZA 4ZBCA 2E9MA 4HU8A 3CPRA 3VKCA 2Q3RA 4AEEA 1D3CA 4FLQA 3Q6JA 1W5NA 4G5DA 4IPJA 1MW3A 5DEZA 3CB3A 2D23A 3V0SA 3LCHA 4CU8A 2PLMA 1SPQA 4PFMA 3CO8A 4D6IA 3RUBL 3IJLA 4AEOA 4S3AA 3QPZA 2CCRA 1OYAA 4PCFA 4V2XA 1POJA 2HDJA 1SQ7A 2VHLA 3UCDA 4XZIA 1IEWA 4WCJA 5CZKA 1OM0A 2VP8A 3PWAA 3BOXA 4Z1AA 1A5MC 4NT0A 4LSBA 2NQLA 2ATSA 1GRFA 3C4UA 2Z25A 4FLOA 2J62A 2NUYA 4WX2A 4PL1A 5AZ1A 1GRAA 1E0XA 2R9RA 4O1EA 2RKXA 1A5UA 1W3LA 4OQVA 1KBKA 4UCGA 3W85A 4FK9A 1Q7MA 3CS2A 4H50A 4XIMA 3NEHA 1F3TA 4XISA 4XD3A 3U57A 1ADOA 1GYLA 3WG6A 5C70A 5D9MA 5FCZA 4JGDA 3BLEA 1IT7A 5G5HB 1AJ0A 3TFXA 3VIGA 3WDRA 1FXPA 3EWBX 2H6RA 1Z3NA 4GH1A 3LXBA 4J57A 4GABA 2ZZ5A 2J7EA 3IJ9A 3NA8A 3SZ8A 3W7MA 2XVNA 6ENLA 3F5JA 3KX6A 1IZJA 1XSIA 1OK6A 4FA3A 1N61C 2Q09A 2E68A 2D20A 2O9TA 4HU3A 4QX4A 3AYTA 3E5BA 3H2MA 5DBTA 3OP2A 9XIAA 1H7XA 1JPKA 3WF4A 3FJNA 3GNXA 2VZOA 4HZ6A 3HRDC 2VR5A 2VGGA 2Z1WA 3C2EA 1JIBA 4W5ZA 3BW3A 1US0A 1Q4WA 3WLKX 4ERIA 3B8DA 3LMZA 3MKCA 5C7HA 4NZFA 4DB7A 3MMWA 3TAOA 1AW1A 2E7FA 5I7GA 1UG6A 1F6YA 3AHZA 2PWHA 4KF1A 2IUZA 3VAVA 4JTKA 3OU8A 1S5WA 1XGEA 3P84A 1TV5A 3RAOA 5JH1A 1Q6CA 2BZNA 3LV6A 1UC4A 2WAGA 1OCQA 1ZGDA 3NOYA 4E5TA 3SUVA 1CEOA 4U5IA 3SAZA 3N04A 4V1YA 3VDHA 4WD0A 3A3WA 4BQ3A 1MRAA 1FWWA 3J7HA 4EM3A 1TRDA 2IS7A 3CAVA 3VCCA 3A3XA 2AOSA 2ZICA 3TP4A 3A24A 2F2KA 2QUMA 3HBLA 1JYWA 1VS1A 1HJWA 2I7GA 3BQ6A 5JBEA 4M6QA 5F2LA 3OIHA 4KGLA 3GXIA 3AIBA 3QQ0A 4M29A 3ERPA 3WQVA 2VFGA 2QEZA 2BHZA 3STGA 1DEDA 4ZQOA 1K70A 2H3DA 4ZR8A 5AKQA 1V7AA 3AUJA 1EC7A 3H2NA 4E8CA 5AZ0A 3BO9A 4A21A 3LENA 3GH5A 3H7UA 4ZOEA 2VXNA 2ZUVA 2C79A 3VKBA 5JCIA 3NL6A 3T55A 5HWNA 1L6FA 4LCRA 4E8GA 1YTKA 3DC8A 2WHKA 1LOLA 4H4TA 1XLBA 3DFNA 3WELA 1WDWA 4QAWA 3GXTA 4L80A 4JIRA 4MLRA 4Q4KA 4Q4RA 2ZUNA 1D7YA 4Y8EA 2GJXB 3UP8A 4B5WA 2HVOA 3RX4A 3M4HA 3PBUA 1WDPA 1L6GA 3CT2A 1PJ9A 1SFSA 4LVBA 2YCIX 2GH5A 2C3DA 4JS3A 4XZLX 2YVGA 1M01A 4H4YA 4CCEA 3RLGA 4QXIA 1NHRA 5HJYA 5KEZA 1JPIA 2VC6A 3CAKA 4C91A 3LQLA 3MYOA 4PTVA 4HJWA 4G9PA 4ZFMA 1I2PA 4IPLA 3VD3A 3PULA 4ZO8A 2OZ8A 3ALFA 3QXBA 1FKXA 1P6CA 2TRSA 4CQCA 1I0BA 3E5PA 2G5WA 3CQ0A 4BR1A 5E0FA 4I6KA 3UG5A 3LZ5A 5MHBA 3MYPA 1MNSA 4LB4A 4Y6GA 3IJDA 4EKJA 3GXNA 1OFBA 4AHOA 1XG3A 3NM3A 3VGEA 2YX0A 3NVVB 1YTEA 2Y4SA 3ZWSA 1Q8JA 2FIQA 2GVGA 1KQYA 4J35A 2DV0A 2V38A 4F9DA 4QLKA 3KLKA 1O66A 3NSNA 4H4SA 3HFYA 1VCVA 1R8LA 3UU0A 1V6WA 4LY4A 3XINA 3T9PA 3CLWA 4M19A 3U9IA 2PDGA 3IAPA 1OG0A 3QZEA 4GUFA 3F5LA 4IGMA 1EA0A 5JIPA 1JOAA 1NWUA 4O53A 3L12A 3NZRA 1FO4A 1RA5A 1X7IA 3N13A 1GQNA 5ENLA 2QYGA 3WFZA 1XPYA 1OFQA 1YNQA 5CKSA 3INPA 3JZEA 4PMOA 3PBVA 1XLAA 1M53A 4OBSA 5A8NA 3VIJA 6ALDA 1GOKA 3GR7A 3KRZA 3I4EA 1OD0A 2OOGA 3E0FA 2GJXA 1YBQB 3PJUA 2YZ5A 3MMDA 2WCGA 3ATYA 4CCZA 3CM4A 1BYCA 5FA5A 1S5TA 4GWEA 3MVIA 1VRDA 3K4AA 3AJXA 3KCLA 3K2GA 3IANA 5F2IA 3VILA 3AXHA 4V15A 3N4FA 4C6LA 3AS0A 1FQ0A 1ZLPA 3CHFA 2WCSA 2BODX 2CESA 4JFUA 2P3EA 4C6CA 3C3NA 3LGEA 5LGXA 4IWWA 2ON3A 3Q94A 4Q4OA 1C92A 2E6AA 4N7QA 5CSRA 3MT1A 5LXEA 1CECA 3IGXA 5D9NA 1SJDA 3T6CA 3T8QA 3W71A 4GVGA 1TV3A 4MVAA 2FDMA 3OZOA 1BWLA 2VEFA 5BOFA 5I3KA 1TZ7A 1XFCA 1GESA 4HA1A 3NXFA 2CZFA 1F4AA 1AQHA 2X0SA 3NNTA 2DY3A 4E0CA 1GWJA 2YLLA 3E49A 1F3XA 1TV4A 3IAQA 2XH7A 1DQXA 1H7PA 1OB0A 2DQXA 1AD1A 4UTIA 3EDFA 1GRBA 4BHYA 5C9ZA 3CT7A 5EFDA 1EUAA 3LLXA 4XZWA 3VK5A 2GGHA 4D71A 4PB5A 2ZRYA 4NZ4A 4WQ6A 4CD5A 1KRAC 2PLJA 1W9XA 5JBDA 3MP4A 1SFJA 4GGHA 5I3JA 2E5DA 1AH3A 4GRTA 3DIPA 3TOPA 4JX4A 1Z44A 1TYPA 3LBMA 3MY9A 4Y2WA 4HNUA 3ZR6A 1Z42A 4ERAA 2GVJA 3M7WA 4PTDA 3LXAA 4GBDA 2VVSA 3VD9A 3VNJA 2DUZA 3CZKA 3EX3A 1EWDA 3ANVA 1QPKA 1LRNA 3R2GA 1JQXA 1YBQA 2FLIA 3W37A 3OYXA 1E4LA 3UQNA 4J9JA 1N8WA 3ZVHB 4ICCX 3W7DA 2HBVA 4GD0A 3NJ3A 4BI5A 1ZB5A 3U5UA 1KXTA 1VBJA 4PMQA 4DM2A 2P5NA 3LOTA 1Q6RA 2WV8A 1G6CA 5HNTA 4NRRA 5ABFB 1UR3M 2AL2B 4LUSA 3T05A 1QI5A 3UGRA 1JF5A 2ZZ1A 1F3PA 1Q8AA 1ZJHA 2NV2A 3FAXA 3TYUA 1TTIA 2FB2A 4AHQA 4O4VA 1LQAA 1CX9A 2PDQA 3EKZA 4OGZA 7PTDA 4RNFA 1WV2A 3V5OA 1JRBA 4JY9A 3YPIA 4RLIA 1UWTA 2BBFA 1GGOA 4JTFA 4G2DA 3OTRA 1MO9A 3WMCA 1BPLB 3LCWA 1FFRA 4KCVA 4ZVJA 4YWOA 3TN5A 3OQ8A 2PWGA 3EXSA 2XUCA 2Y7EA 1KWGA 3GRIA 2UV8G 4UMBA 1VIZA 3TZFA 3WEOA 1MQQA 4WDTA 4FZIA 5IDZA 1LL7A 3OJGA 5A8PA 5F2MA 2CBUA 1JYNA 3AISA 2EGZA 1S1RA 1Y5XA 2QR6A 5JQ9A 2GDVA 3T8LA 1KBJA 1N62C 1Y5VA 5F4WA 1X2HA 3UXAA 4IIHA 1TJPA 1UD4A 2XIIA 1U1UA 3ZS4A 3B8WA 4A3HA 2D3NA 1LOSA 4IIGA 2ZDSA 1UKPA 5HQEA 4XO6A 1TVPA 2R14A 3F03K 1MUWA 2DFAA 4B2DD 3EOLA 1VBRA 4ADTA 4LBUA 1O68A 1DNCA 1Y7VA 1EEXA 1B3VA 2ZZ0A 3GDKA 1MI3A 3TSDA 2VT0A 2PDBA 2YW4A 3EDEA 4L65A 3FSUA 1U1HA 3C2YA 1DV7A 2TMDA 4PEEA 2VVNA 5A6LA 3MP3A 5HJLA 4UXDA 3RG6A 2VFEA 2WM1A 3VNMA 2XIOA 3VUSA 4BY3A 4FDCB 1FCQA 5CGMA 3DFQA 3BMVA 3PTQA 5ABFA 2AL2A 3O6YX 3SCPA 3WLQA 1H0GA 2QT3A 3V18A 1W3NA 2VD9A 4C7FA 3KRUA 3CZJA 1BWCA 3MCOA 2PDYA 3EOUA 4A8IA 1OIFA 2AQWA 1V3MA 3WD0A 3GNNA 3ICJA 4J2PA 2CLLA 5SWUA 4M0XA 4NRSA 1MXSA 2ISVA 1WKEA 4XUYA 1PWMA 1A49A 1XIGA 3AU2A 4C60A 3PVFA 1DJXA 1SZGA 2G4FA 4H6RA 2A85A 2W62A 3QPYA 4TMCA 2XTKA 4DJFA 2WK2A 1IXQA 2OJPA 3ES7A 4QRNA 2WWCA 4KRZA 4LQ1A 3AZTA 4CNNA 4WGXA 3DN5A 4POCA 1K4QA 3W7PA 4BF5A 2Z0IA 4DJEA 3I68A 3ARRA 1PPIA 3N2OA 4JQ3A 3LLFA 3EUB3 3ELFA 4XZNX 3WF3A 4KKXA 2OZTA 4QS5A 2MNRA 1JAKA 1GJWA 1TV8A 4RPQA 4WIWA 3DFSA 3TIMA 5AOUA 2EQDA 2FPTA 1CXHA 4AEFA 4O50A 3PZTA 3UD6A 3EOOA 4H7CA 4WSJA 2PB1A 4MWAB 4HZ7A 5DBUA 4LGXA 4O16A 2Z27A 2ZUSA 3RYSA 2J8FA 1WXYA 4F9JA 4FR6A 1XD1A 4IG2B 4GPNA 2DSUA 1JI1A 2V3BA 3WDQA 3WBEA 1BXNA 1ICSA 5DY3A 1DKWA 1DWFM 1GNXA 4DAIA 3DG3A 3M07A 2ZA1A 4PBEA 4E2VA 3T44A 3ZYZA 4WSHA 3NQMA 4H8NA 3GX9A 1M9HA 4R7WA 4N9DA 2PTXA 2DSVA 1L2UA 3M44A 4RE0A 1MEHA 3P81A 1FWRA 1AJZA 3VIIA 3ISIX 4KEZA 1FBAA 4NJJA 1AMYA 5HMDA 4MZ8A 4A6GA 1LOQA 1C8VA 3R4IA 3MZ2A 3NQCA 2WM0A 1XD0A 2PDFA 3PBYA 1PS9A 3U2ZA 4UC5A 3ME3A 3ARXA 3RXZA 3VNLA 2J75A 2X50A 3WQ5A 1NH6A 4AXNA 4KEVA 1SFTA 1YEYA 3KDOA 2BMBA 4WXZA 4PMZA 2P76A 3OIXA 4HU0A 4F3HA 4F0SA 4NNCA 3BOFA 3VGDA 3EX6A 1SJAA 2EKGA 1TWIA 1W9PA 3VD4A 4DLMA 4NZ5A 2POZA 4LYKA 4PUNA 3KRSA 3ZWTA 1OHLA 5BU9A 2IKGA 4JQ4A 2OYMA 1Q63A 1WP6A 2WCAA 2BASA 1GHRA 2A3CA 3LM3A 2VFHA 3LM7A 1YX1A 4ADUA 5JCNA 1ME9A 3S1WA 2Y5JA 4DPQA 4EX4A 5PTDA 4U5KA 1ECQA 2X7VA 2BG5A 5EMYA 3UZYA 1Q6QA 4LYPA 1S1PA 2XVLA 5BNKA 5L6UA 4UTHA 5KZ6A 2VR2A 2WMJA 2NWRA 3UZ5A 2ZOXA 3RM4A 4FOUA 3M0VA 3SO7A 1NEYA 1O5XA 1V77A 3MHUA 4MWAA 3W7RA 2CKRA 5I3DA 4RCXA 3W02A 1FX6A 1VCFA 4LCQA 1CDGA 4IG2A 1E1EA 2VURA 2FJUB 1EX5A 1UWIA 4ASTA 3ARVA 2AAAA 3NFUA 1DIEA 1XKYA 4PUKA 4DBEA 3GH7A 3NVYB 1ISWA 4YMZA 3RCMA 2G3MA 2Q8ZA 4ZTXA 1RY0A 3B4UA 4TVUA 3V3WA 2Z7GA 4B5XA 1QXLA 3GG7A 3POHA 3N2TA 2PD5A 3UETA 4PYSA 4Z17A 3OHMB 3L8KA 2ALRA 3W01A 1GOMA 1XFBA 1Q65A 2C8NA 3I6EA 3WNOA 3V0UA 5D03A 3GK0A 4C1NB 1HNYA 3R0DA 2ZZBA 4PB4A 4E3VA 1H50A 2QCCA 4DX3A 1W32A 5G4EA 2G3NA 3VUPA 1VKFA 4O1FA 3UEQA 3TCEA 4F48A 1CLXA 1KKRA 3G0UA 2FTWA 3IV3A 2QUNA 1WZLA 3ZR4A 1EWEA 4GZJA 5E6ZA 4P8VA 2JE8A 3DESA 3U8GA 4K68A 4JQ1A 2ISSA 3ENLA 2YSWA 1MW1A 5HUPA 2CXEA 1IIHA 2F8QA 4UB9A 1PAMA 3W6MA 3ID7A 3GYCA 4XBSA 3VFLA 1TPWA 5LA1A 3GTIA 5JCLA 1F6PA 3LI0A 1RCQA 1X8FA 3W1UA 1EDGA 3QRHA 1R9XA 5E1QA 3TMQA 4XVEA 3FYYA 1BLIA 4Z2GA 3RR4A 2OZ0A 4NEVA 5LIKX 1VFMA 2P3ZA 3WQCA 1H63A 3RPDA 4OUEA 2ZTJA 3EB4A 3KHJA 1OABA 4P8XA 3C2VA 1KGWA 2OODA 4GUJA 5HQMA 5AVHA 4Y96A 3T40A 1XQLA 5EMMA 4CEUC 2VOMA 1K7EA 2PGEA 3HJZA 1TQXA 2VQTA 3S47A 2J8GA 4CD6A 1JCYA 1KFBA 3IARA 5TIMA 1ICPA 4NYUA 2G41A 3LK6A 1GW9A 4JFWA 3DFOA 4GO8A 1R87A 1DIOA 5IBXA 1FWNA 4MAZA 1IXOA 5HINA 4CNPA 4YL2A 4I7UA 4L6DA 4Y90A 2R1PA 1W17A 4IZGA 2I9EA 4JFVA 3GHUA 4O13A 2VJXA 2INEA 2V5CA 4RE3A 5D4YA 1J0JA 4L4MA 3CMGA 3Q37A 3KRBA 4TOQA 4AWTA 1OJTA 4C1NA 1H62A 1U5VA 2XVKA 2V3AA 3A5FA 3LI1A 2WPEA 2PFHA 3DK9A 3EANA 3TFCA 2XG9A 4DO6A 4HMEA 1DQWA 2OGYA 1OCNA 3RK8A 4FI4A 4N4PA 3ZMRA 4QS6A 5FOOA 3MZNA 1V59A 3IJQA 1B3ZA 1UZDA 3L67A 1EKOA 2XSBA 2YDAA 3FN9A 4LS0A 4PR4A 3KBWA 3GKAA 1QW8A 2VO5A 2WXDM 4JYDA 4E2BA 2YL8A 3G3DA 2YVJA 2GGJA 4ZE5A 5CC6A 4IQLA 1VJZA 1PBGA 3LS9A 2GR2A 1ZMCA 4F0HA 4QTGA 1TJ1A 4GACA 3KE0A 2OSWA 5JCMA 3TQPA 4GE8A 3WJSA 3ITTA 2ISWA 4J3SA 3B04A 1NWRA 2Q8LA 3F4WA 3BE7A 5K4ZA 4G7EA 1F74A 1ZBVA 2WYSA 2V5JA 1IV8A 4MNJA 4US5D 2PBOA 4ZA0A 1H2JA 1KCLA 1TRIA 4E4FA 4P8UA 3T78A 3N2BA 4DQWA 5AYZA 4J3VA 2QJJA 4CNUA 1V97A 4LIIA 1EIBA 1TWSA 3M0HA 1SZNA 1E51A 4GY7A 1H41A 3TC3A 2WNQA 3RRXA 2WPCA 1FA2A 1OF6A 1FKWA 1GOQA 1NP0A 3L23A 5A6SA 1RJQA 4PODA 5G5IA 2IW0A 4CU7A 1CW2A 1Z32X 4WDWA 4MSSA 4JHZA 2PLKA 5D38A 3NVWB 4ZOBA 4H2HA 4QCEA 1ZP3A 3M0MA 4BK9A 4GKLA 3CNYA 3QR0A 4NAEB 1RP8A 1VGAA 5C54A 4RZ5A 2XH4A 2ZA3A 1UC5A 3IUHA 2P8CA 4JTJA 3W23A 4AZHA 4M6PA 1N5XA 4QFUA 2PGWA 4LVGA 2W79A 2CU0A 2PSNA 1GRTA 4DJEC 2WNNA 4QE1A 3RHGA 1ZCCA 2WJEA 4KPLA 3IV8A 3FHAA 4ML4A 4MFDA 3QJAA 1MMFA 1EL3A 2C13A