5FS7A

Crystal structure of the g262s mutant of human apoptosis inducing factor
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
487
structure length
449
Chain Sequence
DKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGSTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Structure/Function Relations in Aifm1 Variants Associated with Neurodegenerative Disorders.
pubmed doi rcsb
source organism Homo sapiens
total genus 149
structure length 449
sequence length 487
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fs7A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs7A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs7A01
2XVFA 4NTCA 1LQTA 1SEZA 3BI2A 1GALA 2A87A 4Z2TA 4J56A 1FECA 3FBSA 3LJPA 1N4WA 2WP6A 2B7RA 4E0VA 3K7MX 4OPDA 2XVEA 3FG2P 2DKIA 2BC1A 3CNJA 1TDNA 3CNTA 2C3DA 3GYJA 2C72A 2V60A 2XDOA 2B9WA 1O94A 4H4UA 4OPTA 2C76A 5TR3A 2GR3A 3H4KA 4UDPA 1PXCA 1ZK7A 4NTDA 4RG3A 2C3CA 3OC4A 4YXDA 4AT0A 3C96A 3LZXA 3AE8A 1NHPA 2C67A 4AT2A 3KKJA 2C70A 4C74A 4CBQA 3F8RA 4NZHA 2X50A 2GEWA 2XLRA 4UDRA 4BJYA 2X8HA 4A6NB 2X8GA 1N1PA 3AD8B 2WEUA 4Z2UA 4Y4LA 2GMHA 3UTFA 5U63A 1YQ4A 4ICYA 2B76A 2OA1A 3EPTA 3CGBA 4GCMA 3QJ4A 1YKJA 4OPLA 3AYLA 3UTHA 4REKA 3P4PA 2FJDA 2VQ7A 2GQWA 2X8CA 4H4QA 5KVIA 1E1NA 1JRYA 3V3OA 1W4XA 1S3EA 2R0CA 1S3BA 3NK0X 4B65A 3CGCA 4K5SA 3H8IA 3SFDA 3IF9A 1GTHA 4D03A 3ZYXA 1F6MA 5KRQA 4KX6A 2YR5A 4DSHA 4U8LA 3BHKA 3R9UA 2OALA 4WX1A 4CCRA 4H4VA 2X99A 4JN9A 4YSXA 2VQBA 3GDNA 2A8XA 2R9ZA 4KPRA 1CL0A 1H82A 1NENA 2XFQA 3G5QA 1GPEA 4LU6A 1PHHA 4U8PA 3NTAA 3JSKA 3QFAA 1EL9A 1B5QA 4A5LA 2E4GA 3G5RA 4U8MA 3NTDA 2XFUA 2BACA 3BHFA 1QJDA 1ZMDA 3CTYA 4D04A 1YQ3A 4AP1A 3REDA 4EM3A 5L46A 2NPXA 4RG4A 2YLTA 1NG3A 5IQ1A 1QLBA 2BS2A 4APNA 2WDQA 4TM1A 1EL5A 2R0PA 1NHRA 1DOCA 1E1MA 2VRMA 2GR2A 5LV9A 4LIIA 4XXGA 2RABA 2V3BA 2EQ7A 4C77A 5M0ZA 2E1MA 2F5ZA 1DODA 3AEGA 1DXLA 3II4A 3ALJA 3NGCX 1PJ6A 2TPRA 1DJNA 5M10A 2XFNA 4BK3A 4IA6A 4OPIA 4YSZA 1ELIA 3L1RA 4HA6A 1BWCA 3UOZA 2WU2A 4Y4NA 1VQWA 4K8DA 5HXIA 4H2PA 3GWFA 1VG0A 1TDOA 2GR0A 2EQ8A 5JCNA 1NG4A 3UKQA 2OLOA 2YLZA 4IVOB 2BS3A 3CGDA 1E7PA 1NHQA 3FPZA 1EL7A 4XWZA 1Y56B 1ZMCA 3FMWA 2ZBWA 4EQSA 3ISHA 3AE6A 4LA1A 2DKHA 1PXAA 1PDHA 4J34A 2B9YA 3CGEA 3VRAA 1LV0A 1GRAA 4FDCB 4H4TA 1GRBA 1YQZA 3BNMA 4M52A 1H6VA 2XCGA 4BK1A 1D4EA 2CFYA 3P4QA 1L9EA 3P9UA 4X9MA 1H83A 2B9XA 3AE4A 3NK1X 3ITJA 4I59A 2NVKX 1L9CA 4H4PA 2V6OA 2BXRA 3H8LA 2A89A 2GV8A 1CHUA 2JB2A 2Q6UA 2R4EA 1ZOYA 3V76A 1FEBA 3GSIA 2GF3A 3F8DA 2YM1A 4H4WA 3BI5A 3G5SA 4GDPA 2WBAA 2C75A 4B68A 1JNZA 2XFOA 3IHMA 4IVMB 2WPEA 4AOXA 1VG9A 4CCQA 2XLUA 1CJ4A 1H86A 1UKVG 1CJ3A 1MOKA 1NHSA 2WPFA 4EMIA 3NN0X 4H50A 1LVLA 4U2SA 4A6NA 3AE3A 1GRFA 3M0OA 3DK4A 3L8KA 1ZX9A 3UCLA 1TDFA 1O5WA 2BS4A 1LTXR 4FX9A 2BYBA 3LOVA 3QSMA 1NDAA 4JQ9A 2XFPA 3EAOA 3KLJA 1OJCA 3FIMB 1OJTA 4JNAA 1Y0PA 2R45A 1GTEA 4CNKA 1PBBA 3AB1A 2BCPA 1TDEA 4A65A 4B63A 1IUTA 3AE7A 3IC9A 2ZZ0A 3Q6JA 3COXA 4C3YA 2C66A 4EIPA 2YWLA 4TM0A 3NIXA 4H2NA 2Q0LA 3DK9A 1K0JA 2C7GA 1FL2A 2IVEA 2JBVA 3AEEA 1JRZA 3M12A 4P9SA 4CY6A 3VQRA 5KXJA 3CNSA 4H4XA 1CC4A 3GYIA 4PAAA 3IWAA 3UKHA 1PBEA 1ZOVA 3V3NA 5BRTA 2WHDA 2WQYA 3NH3X 2E5VA 1JEHA 3VRDB 1NEKA 4K7ZA 1BZLA 4OPUA 1DOEA 2ZZBA 1XANA 2RGOA 1JOAA 2YVFA 1ZP0A 3SM8A 4A99A 4YTNA 3DMEA 3UOXA 5JCKA 2V61A 2WOVA 1B8SA 2VOUA 3BNUA 3DA1A 3UTGA 3GRTA 3WE0A 3AE9A 2WETA 2C73A 3UKLA 1GERA 2PYXA 2I0ZA 2JK6A 3O0HA 1GRGA 3RHAA 4YSYA 3P4RA 1D4CA 4IV9A 2Q0KA 2CDUA 2XYOA 2B7SA 4J33A 5EB4A 1K4QA 3NK2X 1EBDA 1NAAA 2VZ2A 2YVGA 3K7QX 4JNQA 3P1WA 2WPCA 4U8NA 1GRHA 2XVIA 4B1BA 3ATRA 1NPXA 2EQ9A 3LADA 4H4ZA 1FCDA 3AEDA 4CNJA 1TYPA 5FMHA 2YR4A 5ER0A 3UOYA 4DNAA 3CN8A 3CIRA 5HYMA 4B69A 4H4YA 1GOSA 4ZCCA 5FS7A 2V3AA 3UKKA 5BVAA 1CF3A 2GH5A 1IUVA 1Y56A 3SGLA 2BC0A 2JKCA 2OAMA 1KFYA 2X3NA 2JAEA 3AD9B 3PVCA 4H4RA 1GNDA 3UTEA 2QAEA 1V59A 3CPIG 4JY3A 4Y4MA 2Q7VA 4O5QA 1S2QA 2VRLA 3PO7A 3GDPA 4FK1A 1PBDA 1QO8A 1RSGA 4J57A 1KDGA 4NEVA 3C4NA 3GD4A 4NEWA 1L0VA 3GMBA 2BK3A 4U2TA 1JRXA 1PBCA 1KNPA 3EF6A 5BUKA 1OJDA 4TLXA 3PS9A 1IUUA 1DNCA 1JU2A 2WP9A 4YTPA 1BGNA 3GRSA 4K22A 2WESA 2VVLA 4J31A 5FS6A 4Z43A 4Z25A 3AD7B 4GR1A 2FJAA 1GV4A 4OPCA 4BK2A 2CULA 3ICTA 3DH9A 4YKGA 4B67A 5IQ4A 2YLXA 2YG4A 3RP6A 1CBOA 2GAHB 2RGJA 2AAQA 4FK1C 1LJ1A 3AYIA 4ADWA 4A79A 5DBJA 1AOGA 4YKFA 5KWFA 4YT0A 4GF7A 4MJWA 1BGJA 1E1LA 4OVIA 3VR8A 1N4VA 3UP5A 3HZLA 5BULA 1KNRA 3AECA 2YG5A 3K7TA 1RYIA 2VVLG 3NRNA 1KF6A 1LPFA 2EQ6A 3AXBA 1RP0A 4Z24A 2YAUA 3SQPA 1BF3A 1P2HA 1VRQB 1X31B 4Z2RA 1IUSA 4EQWA 1M6IA 2YR6A 5CKUA 3VRBA 2BK5A 3ATQA 3C4AA 3KPFA 3UOVA 3RNMA 2H89A 4EMWA 5KOWA 1N4UA 4X4JA 5U1OA 3OZ2A 4C5OA 3QVRA 2VVMA 3AE1A 3KA7A 3NYEA 4K2XA 5HY5A 2WS3A 1IJHA 2V5ZA 1O95A 2YG7A 1D7LA 2ACZA 5U25A 3NT6A 4EQRA 1DJQA 5J60A 3NNEA 5FS8A 2WP5A 5C3JA 1OJAA 5IPYA 4EM4A 3UP4A 3F8PA 1F8WA 3KVEA 2AR8A 2C64A 2WDVA 3AYJA 4AOSA 4YSHA 4N9XA 3S61A 3UKAA 1EL8A 3E1TA 4H4SA 2WU5A 3B6DA 2GQFA 1CC6A 4OPGA 4XWRA 5C2TA 4B64A 2BABA 3KD9A 3DGZA 4UDQA 5EB5A 2FBWA 4GDEA 4J36A 5CQFA 1H81A 1E6EA 1HYUA 4JDRA 3D8XA 3Q9TA 1JNRA 1FOHA 1PS9A 2Z5YA 1ZY8A 3CPHG 1ZDLA 3ADAB 3NHOX 4ZN0A 4NTEA 1GESA 1REOA 2R4JA 4USQA 4BJZA 3NLCA 2O9ZA 4WCTA 4X9NA 3ICRA 3ALLA 4Z26A 4RSLA 2QA1A 1TYTA 3RP7A 2YQUA 3DK8A 1D4DA 1GRTA 1IUWA 1PJ5A 3EANA 2WDRA 3T37A 4GUVA 1PJ7A 1F3PA 1PN0A 1K0IA 3KU9A 1M64A 4OCGA 4H7UA 3D1CA 4O5UA 2BCGG 1CC2A 4U8JA 3LZWA 2R46A 2R0GA 2Y6QA 2J3NA 1GT8A 2RGHA 5HHFA 1Q1WA 3QSSA 4K5RA 1ONFA 3DGHA 4CY8A 3CNPA 4H2RA 4USRA 2ZZCA 1L9DA 2WOIA 1FEAA 3AEBA 4TM3A 3AEAA 2YG3A 5JCIA 3ABVA 3UKPA 3ICSA 2IIDA 1Z6LA 3ALMA 2Z5XA 2FJBA 4EQXA 2GAGB 4ECHA 2YVJA 1H7WA 3NYFA 3DJEA 5GSNA 2BA9A 1F8RA 2AQJA 4EIQA 3CPJG 1GEUA 4A7AA 3NYCA 3QFBA 3DJJA 4BURA 4EMJA 4I58A 5JCMA 2XVHA 3ZDNA 1F8SA 1ZKQA 2JB1A 4GRTA 4AP3A 2Y6RA 3K30A 1B4VA 1OJ9A 2YLRA 3BI4A 4U2LA 3QSEA 2CVJA 5EOWA 2PHHA 3QVPA 4YWOA 1XPQA 4YTMA 1P2EA 2YG6A 2WOWA 4U8IA 2IVDA 1H7XA 4DGKA 1GXFA 3IHGA 2GR1A 1TDKA 3AWIA 4C3XA 1KSSA 1VDCA 3I3LA 2C65A 2H88A 4TM4A 4H2QA 1MXTA 1Q9IA 3B3RA 1CJCA 3P4SA 1GETA 1GSNA 2APGA 1MO9A 3S5WA 3M13A 3AE2A 3RP8A 1IUXA 2BK4A 4UP3A 1BKWA 3AEFA 3SFEA 2BXSA 2UZZA 4J2WA 5J7XA 1S2YA 4B66A 1CJ2A 1DOBA 2XLTA 2QCUA 5JCLA 3CNDA 3NG7X 5EBKA 3LXDA 5FS9A 1Q1RA 2GB0A 2GMJA 3DJDA 2FJEA 4A9WA 5KVHA 1YY5A 1TRBA 3GMCA 4ZCDA 2GVCA 4BV6A 4DSGA 1H84A 1GREA 1COYA 1B37A 4TLZA 5KOXA 3LB8A 4U8KA 2XLPA 4IA5A 2HQMA 3UKFA 4PABA 2YLSA 3I6DA 3NKSA 2XVJA 1E39A 2YM2A 1D5TA 3DJGX 3AE5A 3GWDA 4U8OA 3GD3A 4Z44A 4CRTA 2QA2A 2GRTA 2YLWA 5GRTA 1K0LA 2TMDA 3NN6X 1XDIA 1KSUA 2JB3A 1D7YA 1PBFA 2OLNA 1LQUA 4HB9A 1E1KA 1PXBA 3VR9A 2W0HA 2XLSA 3URHA 2ARDA 4JY2A 1XHCA
chains in the Genus database with same CATH superfamily
1SEZA 4E0VA 2QQ6A 4E4UA 4GGBA 4H4UA 2C76A 3CYJA 2GL5A 1ZK7A 4NNJA 3AM9A 3C96A 3AE8A 3KKJA 3HRDC 4UDRA 3SN1A 2WEUA 4Y4LA 2GMHA 5U63A 3EPTA 1YKJA 3AYLA 4REKA 2BRAA 1E9IA 3T14A 4B65A 4K5SA 3R0UA 4G74A 3QPEA 3ZYXA 1ELSA 4KX6A 4U8LA 3BHKA 3R9UA 4WX1A 4H4VA 2X99A 4YSXA 3NVWB 3MWCA 1SJBA 1H82A 3NTAA 3JSKA 3QFAA 1EL9A 3G5RA 4AP1A 3REDA 5IQ1A 3SN0A 4APNA 2OG9A 3PK7A 7ENLA 2VRMA 4DYEA 2GR2A 3SBFA 2EQ7A 2F5ZA 3II4A 3ALJA 3NGCX 2OLAA 5FJRA 2TPRA 4BK3A 2WU2A 4Y4NA 1VQWA 4K8DA 3VFCA 1TDOA 2EQ8A 3UKQA 4IL0A 2PMQA 1EL7A 1Y56B 2HZGA 3FMWA 2ZBWA 4DXKA 4J34A 4FDCB 1YQZA 4M52A 4ROPA 3JW7A 1XPYA 3SQSA 1L9CA 2BXRA 2JB2A 1CHUA 2YM1A 4GDPA 1JNZA 2XFOA 3A7UA 2WPEA 1UKVG 2BRYA 3UXLA 1MOKA 1SB3B 4GISA 3NN0X 2BYBA 4JQ9A 3EAOA 1GTEA 3AB1A 1TDEA 3IC9A 4EIPA 2QVHA 3DK9A 2GGEA 1JRZA 3VQRA 3UCCA 3GYIA 4HNCA 3UKHA 3ZLFA 1FO4A 1JOAA 3BNUA 2OX4A 1GERA 3V5CA 3O0HA 3RHAA 3P4RA 2CDUA 2XYOA 1K4QA 1SJDA 2WPCA 1WUEA 3TCSA 3D46A 2PTYA 2EQ9A 4H4ZA 2W3RA 2W55A 3CIRA 1GOSA 4G9KA 3UKKA 1CF3A 2QJMA 2OAMA 5FJTA 4H4RA 2QAEA 1V59A 4Y4MA 3PO7A 3GDPA 1QO8A 3TQPA 3GO2A 3V4BA 4J57A 4NEVA 3GD4A 4NEWA 5BUKA 4GFIA 3Q45A 1IUUA 1DNCA 3DEQA 1JPDX 2WESA 3A7RA 4GR1A 3SSZA 3TOYA 3AYIA 4FP1A 4ADWA 3U4FA 4GF7A 3OZYA 3VR8A 3UP5A 3HZLA 4GYPC 5BULA 2GSHA 3MQTA 2BK5A 3ATQA 3C4AA 3I6EA 1N4UA 5U1OA 4C5OA 3QVRA 2YG7A 1D7LA 5U25A 4EQRA 1DJQA 3DESA 2OVLA 1OJAA 3F8PA 3AYJA 4IP4A 2OFJA 4N9XA 2W3SA 3E1TA 2WU5A 2GQFA 4OPGA 2XH0A 5CQFA 1E6EA 1HYUA 3Q9TA 4A6GA 2Z5YA 3NHOX 4USQA 3MSYA 3VDGA 4DN1A 4RSLA 1GRTA 3DK8A 5KMQA 3T37A 1PJ7A 1F3PA 1K0IA 4OCGA 3DG6A 4U8JA 2PP1A 2RGHA 1Q1WA 4K5RA 4CY8A 3AEBA 1FEAA 2YG3A 3ALMA 2FJBA 4EQXA 4ECHA 2YVJA 3DJEA 1DTNA 1JRPA 4BURA 3DJJA 3QLDA 1F8SA 4H2HA 4U2LA 2CVJA 2PHHA 3SZWA 1XPQA 2WOWA 4IT1A 2GR1A 1TDKA 3R10A 1KSSA 2H88A 2DW6A 1MXTA 1H2IA 3B3RA 3TJ4A 1CJCA 1MRAA 1GETA 1GSNA 1MO9A 3M13A 3RP8A 3SFEA 2UZZA 2QCUA 3CNDA 1FFUC 3AMZA 3LXDA 1Q1RA 3DJDA 2FJEA 4H1ZA 5KVHA 1TRBA 1B37A 1VDVA 4PABA 2PP3A 3NKSA 2YM2A 4G7FA 3DFHA 4U8OA 3HPFA 4CRTA 2QA2A 1P43A 2O56A 1K0LA 3NN6X 1KSUA 1LQUA 3SY4A 3URHA 3UXKA 2XVFA 3BI2A 1N4WA 2B7RA 3K7MX 4F4RA 2DKIA 3CNTA 4M6UA 2B9WA 2PTWA 4OPTA 4ZCWA 4UDPA 1PXCA 1EC9A 4RG3A 4AT0A 2C67A 3F8RA 4NZHA 2GEWA 1EC8A 3QKEA 4BJYA 4A6NB 5JRBA 2X8GA 3DERA 2PP0A 3AD8B 4Z2UA 1X2GA 1YQ4A 3CXBA 2OA1A 3EUB3 3CGBA 2GQWA 2X8CA 4H4QA 5KVIA 1E1NA 3V3OA 1W4XA 2PGWA 1S3BA 3NK0X 3CGCA 3SFDA 3IF9A 4TVYA 1F6MA 5KRQA 2YR5A 3VC6A 2OALA 4CCRA 2VQBA 2A8XA 2R9ZA 1CL0A 2XFQA 4LU6A 2FKPA 1GPEA 1R0MA 4A5LA 2E4GA 4U8MA 1NELA 4A3RA 1ZMDA 3SR6B 4D04A 2PU1A 4RG4A 2BS2A 2R0PA 1NHRA 4XXGA 2V3BA 4C77A 2E1MA 3AEGA 1DXLA 1PJ6A 4HYRA 5M10A 4OPIA 4YSZA 4HA6A 1BWCA 4M0XA 5HXIA 2GR0A 2OLOA 2YLZA 2BS3A 1E7PA 3FPZA 2PODA 3Q4DA 3SXIA 1LV0A 3V3WA 1N61C 4YWSA 1D4EA 3P4QA 1L9EA 4KT2A 2A89A 2Q6UA 3V76A 1ZOYA 1FEBA 3GSIA 3CB3A 4IVMB 1VG9A 2CHRA 3GYXA 4IP5A 3AE3A 1GRFA 2OO6A 3M0OA 3L8KA 1TDFA 1BQGA 1LTXR 3R07C 1NDAA 3KLJA 3FIMB 1OJTA 1Y0PA 4CNKA 2C66A 2YWLA 3AEEA 1FL2A 3M12A 4H4XA 4PAAA 5BOEA 1PBEA 3V3NA 2WQYA 2E5VA 3VRDB 4K7ZA 1BZLA 4OPUA 1DOEA 3TW9A 1XANA 1ZP0A 4A99A 4YTNA 2WOVA 4FI4A 1B8SA 2VOUA 3DA1A 3L5OA 3OPSA 2C73A 2WETA 2I0ZA 2JK6A 4KPLA 3N6HA 4YSYA 3DIPA 2B7SA 5EB4A 3AN1A 3T2KA 2P8CA 3P1WA 1GRHA 2XVIA 3NRZB 4H83A 1NPXA 3NS1B 4MGGA 5ER0A 3UJ2A 1P48A 1KKRA 4H4YA 3FXGA 5BVAA 2GH5A 3T2YA 1Y56A 5KMPA 2BC0A 3NVVB 2JKCA 2X3NA 3T31A 3NXLA 3UTEA 3CPIG 1S2QA 4FK1A 1KDGA 3NZGA 4K1WA 1PBCA 2P0IA 2ONEA 2WP9A 2XH2A 1BGNA 2VVLA 5G5HB 1ZXIC 3AD7B 4OPCA 1N60C 4MMWA 4BK2A 3ICTA 2YLXA 2YG4A 1CBOA 1LJ1A 4YKFA 4MJWA 1BGJA 4A35A 1E1LA 4OVIA 1JDFA 2EQ6A 1BF3A 1X31B 4Z2RA 4EQWA 1M6IA 2PA6A 3KPFA 3UOVA 3R0KA 3MKCA 1KKOA 2VVMA 3KA7A 3SZCA 2WS3A 3NT6A 5C3JA 2MNRA 4EM4A 3KVEA 3UP4A 2QDDA 4YSHA 3S61A 4II3A 2BABA 2FBWA 4GDEA 4J36A 1FOHA 1ZDLA 1STZA 4ZN0A 2DW7A 1L8PA 3ALLA 2QA1A 1TYTA 3RP7A 4J1OA 2OZ8A 1IUWA 2OPJA 3EANA 4GUVA 3KU9A 3D1CA 2R0GA 3R25A 3QSSA 3DGHA 4H2RA 4Z1YA 1L9DA 2WOIA 4TM3A 3HW2A 1MUCA 5JCIA 3ABVA 3U9IA 3ICSA 3GY1A 4E6MA 1Z6LA 2IIDA 3ZVIA 2Z5XA 3NYFA 2QJJA 2W54A 4EIQA 3T0KA 3NYCA 3QFBA 3ZDNA 2Y6RA 3BI4A 2E5AA 4IL2A 4YTMA 3RO6A 1P2EA 2IVDA 4DGKA 1GXFA 3AWIA 1VDCA 3BJSA 3I3LA 1Q9IA 1SJCA 2C4CA 3K1GA 3AE2A 2BK4A 1BKWA 2BXSA 1DOBA 3RITA 1KN0A 5FS9A 1W6TA 2GB0A 4HPNA 1IYXA 1BKHA 3GMCA 1MDLA 1COYA 4TLZA 4DWDA 2XLPA 4IA5A 2HQMA 1NU5A 3DJGX 3AE5A 3GD3A 1XDIA 3R11A 3DDMA 3A7AA 1E1KA 2XLSA 3R1ZA 2ARDA 2C75A 4NTCA 4Z2TA 1FECA 3FBSA 3LJPA 3PG6A 3ZVHA 1WYGA 2BC1A 3CNJA 3IJIA 1TDNA 2C3DA 3GYJA 2C72A 1FHVA 3P93A 1O94A 5TR3A 2GR3A 3H4KA 3I6TA 4NTDA 2C3CA 5EU9A 4NWZA 4YXDA 2C70A 2I5QA 2XLRA 2X8HA 4K2SA 3ZVHB 3UTFA 3IJQA 2B76A 4GCMA 3QJ4A 1EBGA 3UTHA 3P4PA 2VQ7A 3NFUA 4JN7A 3T6CA 3H8IA 4D03A 3FCPA 5FJOA 2QDEA 4KPRA 1NENA 3G5QA 1PHHA 1B5QA 3NTDA 2XFUA 3BHFA 2OQHA 2OZ3A 4EM3A 5L46A 2NPXA 2YLTA 1NG3A 2GGHA 1QLBA 4TM1A 1EL5A 1E1MA 5LV9A 4LIIA 5M0ZA 4IZGA 1DODA 3FJ4A 3FYYA 3CXOA 4IA6A 1ELIA 3UOZA 4HCHA 5JCNA 2NQLA 3N4FA 3CGDA 4EQSA 4LA1A 2DKHA 1PXAA 2B9YA 3CGEA 1GRAA 1GRBA 1TZZA 1KCZA 1H6VA 4BK1A 5KMRA 1H83A 3TWAA 1FIQB 4I59A 4KWSA 3H8LA 2POZA 2GF3A 3F8DA 3BI5A 3G5SA 3TWBA 4G73A 2ZC8A 3EKGA 1X2HA 5KMSA 2XH7A 1H86A 4A6NA 4U2SA 4H50A 1LVLA 3DK4A 4FX9A 3LOVA 3RGTA 1OJCA 2P88A 1PDYA 4H19A 1PBBA 4B63A 4C3YA 3SZFA 4TM0A 2JBVA 1K0JA 5KXJA 3CNSA 4HN8A 3ZLGA 5BRTA 1MDRA 2PCEA 2WHDA 3NH3X 1JEHA 3TJIA 1S7MA 3JVAA 1NEKA 2ZZBA 2RGOA 3SM8A 3UGVA 3UTGA 3ES8A 2XSXA 2PYXA 4E8GA 3SN4A 1D4CA 2PGEA 3NK2X 1EBDA 2VZ2A 3K7QX 4JNQA 3FVDA 4U8NA 4B1BA 4ENLA 1FCDA 4CNJA 3VA8A 3AEDA 1TYPA 2YR4A 3UOYA 3RCYA 3CN8A 5HYMA 4ZCCA 5FJPA 1IUVA 3SGLA 5J04A 1KFYA 2JAEA 3PVCA 1JROA 3T8QA 1GNDA 4JY3A 2Q7VA 5ENLA 4O5QA 1RSGA 3S47A 1JRXA 3IJLA 4GYPA 3H70A 1T3QC 1OJDA 1JU2A 4YTPA 4K22A 4J31A 4Z25A 3SX6A 5FS6A 3TTEA 5IQ4A 3PWIA 3UJRA 4GIRA 3T4WA 3FV9A 2OZTA 4YT0A 3DG7A 3HYWA 2FYMA 3ETRB 2PS2A 3AECA 2YG5A 1N5XA 3K7TA 1KF6A 3AXBA 1RP0A 1IUSA 2YR6A 3VRBA 3T2ZA 3RNMA 2H89A 5KOWA 3AE1A 3VC5A 1O95A 2ACZA 5FS8A 2WP5A 3SYIA 1F8WA 2C64A 1EL8A 4H4SA 1FHUA 5EB5A 3KD9A 3DGZA 1SJAA 1H81A 4JDRA 3ADAB 2R4JA 1REOA 4WCTA 4Z26A 1D4DA 5KNLA 3OTRA 1PN0A 1M64A 4O5UA 3LZWA 2R46A 4GAPA 2Y6QA 2J3NA 5HHFA 3CNPA 5G5GB 4USRA 2ZZCA 3HYXA 4IHCA 4MKSA 5GSNA 2BA9A 1N62C 1F8RA 2AQJA 3CPJG 1GEUA 4I58A 2PTXA 2JB1A 4GRTA 4AP3A 1OJ9A 3SZ0A 5FJUA 2HXUA 2HNEA 2C65A 4TM4A 4H2QA 4EWJA 3P4SA 4TVWA 1IUXA 4G6GA 4UP3A 3P0WA 3AEFA 5J7XA 1CJ2A 2XLTA 5JCLA 3PFRA 5EBKA 4A9WA 4ZCDA 2GVCA 4BV6A 4DSGA 1GREA 2MUCA 3D9XA 1JPMA 3I4KA 3UKFA 3UJSA 1E39A 3EEZA 4GGHA 1VQZA 2GRTA 5GRTA 2JB3A 1V97A 2OLNA 4HCDA 4JY2A 1LQTA 1GALA 2A87A 4J56A 4G8TA 2WP6A 4OPDA 2XVEA 3FG2P 3GD6A 2V60A 2XDOA 3ENLA 1EBHA 3OC4A 3LZXA 1NHPA 4AT2A 4Z17A 4C74A 4CBQA 2X50A 2XGZA 4X2PA 1N1PA 4ICYA 4OPLA 3KUMA 2FJDA 1JRYA 1S3EA 2R0CA 3V5FA 1GTHA 3H12A 3MZNA 3N6JA 4DSHA 3STPA 4JN9A 3GDNA 4E5TA 4U8PA 2BACA 1QJDA 3CTYA 1YQ3A 3UJEA 2WDQA 1DOCA 4J3ZA 2RABA 2XH4A 1DJNA 2XFNA 3L1RA 4H2PA 3GWFA 1VG0A 3B9JB 3MY9A 1NG4A 4IVOB 2GGJA 1NHQA 4XWZA 1PDZA 1ZMCA 3ISHA 3AE6A 1YEYA 1PDHA 3SJNA 3VRAA 4H4TA 2QGYA 3BNMA 3IK4A 2XCGA 3BSMA 2CFYA 3P9UA 4X9MA 2B9XA 3AE4A 3NK1X 3ITJA 2NVKX 4G6HA 4H4PA 2V6OA 2GV8A 2R4EA 4H4WA 2WBAA 4B68A 3IHMA 4AOXA 4CCQA 2XLUA 1CJ4A 1CJ3A 1NHSA 2WPFA 4EMIA 2PPGA 3RRAA 1XS2A 1ZX9A 3UCLA 2HXTA 2OKTA 3NO1A 1O5WA 2BS4A 3QSMA 2XFPA 2PSNA 3H7VA 4JNAA 2R45A 2BCPA 4A65A 1IUTA 3AE7A 2ZZ0A 3N4EA 3Q6JA 3COXA 3H8AA 3NIXA 3QTPA 4H2NA 2Q0LA 2IVEA 2C7GA 4P9SA 4CY6A 1F9CA 1CC4A 3IWAA 5BOFA 1ZOVA 2P3ZA 3VCCA 3OW1A 2YVFA 3DMEA 3UOXA 5JCKA 2V61A 3GRTA 3WE0A 3JZUA 3AE9A 3UKLA 2RDXA 1GRGA 4IV9A 2Q0KA 3S5SA 3OZMA 4J33A 3CAWA 1NAAA 2YVGA 3BOXA 3NVYB 3ATRA 3LADA 5FMHA 3RR1A 4DNAA 2AKMA 4B69A 5FS7A 3D47A 2V3AA 4GMEA 1OEPA 3AD9B 2VRLA 3VCNA 3MUCA 3P3BA 1PBDA 3C4NA 2OQYA 3GMBA 1L0VA 2BK3A 4U2TA 1ONEA 1KNPA 3EF6A 2GGGA 3UJFA 3DGBA 3NVZB 4TLXA 3PS9A 3GRSA 4Z43A 2PU0A 2FJAA 1GV4A 2CULA 3DH9A 4YKGA 4B67A 4HNLA 3RP6A 2GAHB 2RGJA 2AAQA 4FK1C 4A79A 5DBJA 1AOGA 5KWFA 3THUA 2PTZA 3HYVA 1N4VA 4HCLA 4K8GA 1KNRA 1RYIA 2VVLG 3NRNA 1LPFA 4Z24A 2YAUA 3SQPA 1VRQB 1P2HA 5CKUA 1N63C 3CK5A 4EMWA 3B97A 4X4JA 1WUFA 2AL2A 3OZ2A 3CMMA 3NYEA 4K2XA 5HY5A 1IJHA 2V5ZA 5J60A 3NNEA 3GC2A 2P8BA 5IPYA 4ZOHB 2AR8A 2WDVA 4E4FA 4AOSA 3UKAA 3B6DA 1CC6A 4XWRA 5C2TA 2AL2B 4B64A 4II2A 4UDQA 1EC7A 3ZLHA 3D8XA 1JNRA 3CPHG 1PS9A 1ZY8A 4NTEA 1GESA 4BJZA 3NLCA 2O9ZA 4X9NA 3ICRA 2YQUA 1KD0A 1PJ5A 3DFYA 2WDRA 4H7UA 4DHGA 2BCGG 1CC2A 1GT8A 1TE6A 1ONFA 3AEAA 3UKPA 1ECQA 2GAGB 3OP2A 1H7WA 4KEMA 5IDZA 4A7AA 4DX3A 4JN8A 4EMJA 5JCMA 2XVHA 1ZKQA 3K30A 1B4VA 3ES7A 2YLRA 3T9PA 3QSEA 5EOWA 3PWGA 3QVPA 4YWOA 2YG6A 4U8IA 6ENLA 1H7XA 1RM6B 3IHGA 2QJNA 2AKZA 1RVKA 2ZADA 4C3XA 2E3TA 1TKKA 1N5WC 2APGA 3S5WA 4J2WA 4JHMA 1S2YA 4B66A 3NG7X 2GMJA 3KPKA 1YY5A 1H84A 4GAVA 5KOXA 3LB8A 4U8KA 3UCDA 3DG3A 2YLSA 3I6DA 2XVJA 1D5TA 3QN3A 3GWDA 4Z44A 1FFVC 2AL1A 2YLWA 3CT2A 2TMDA 1JCTA 1D7YA 1PBFA 2GDQA 4HB9A 1R6WA 1PXBA 3VR9A 2W0HA 4ZA0A 1MNSA 1XHCA 2GGIA
chains in the Genus database with same CATH topology
2XVFA 4NTCA 1LQTA 1SEZA 3BI2A 1GALA 2A87A 4Z2TA 4J56A 1FECA 3FBSA 3LJPA 1N4WA 2WP6A 2B7RA 4E0VA 3K7MX 3PG6A 4OPDA 2XVEA 3FG2P 2DKIA 2BC1A 3CNJA 1TDNA 3CNTA 2C3DA 3GYJA 2C72A 2V60A 2XDOA 2B9WA 1O94A 4H4UA 4OPTA 2C76A 5TR3A 2GR3A 3H4KA 4UDPA 1PXCA 1ZK7A 4NTDA 4RG3A 2C3CA 3OC4A 4NWZA 4AT0A 4YXDA 4NNJA 3C96A 3LZXA 3AE8A 1NHPA 2C67A 4AT2A 3KKJA 2C70A 4C74A 4CBQA 3F8RA 4NZHA 2X50A 2GEWA 2XLRA 4UDRA 4BJYA 2X8HA 5JRBA 2X8GA 4A6NB 1N1PA 3AD8B 2WEUA 4Z2UA 4Y4LA 2GMHA 3UTFA 5U63A 1YQ4A 4ICYA 2B76A 2OA1A 3EPTA 3CGBA 4GCMA 3QJ4A 1YKJA 4OPLA 3AYLA 3UTHA 4REKA 3P4PA 2FJDA 2VQ7A 2BRAA 2GQWA 2X8CA 4H4QA 5KVIA 1E1NA 1JRYA 3V3OA 1W4XA 3T14A 1S3EA 2R0CA 1S3BA 3NK0X 4B65A 3CGCA 4K5SA 3H8IA 3SFDA 3IF9A 1GTHA 4G74A 4D03A 3ZYXA 1F6MA 5KRQA 4KX6A 2YR5A 4DSHA 4U8LA 3BHKA 3R9UA 2OALA 4WX1A 4CCRA 4H4VA 2X99A 4JN9A 4YSXA 2VQBA 3GDNA 2A8XA 2R9ZA 4KPRA 1CL0A 1H82A 1NENA 2XFQA 3G5QA 1GPEA 4LU6A 1PHHA 4U8PA 3NTAA 3JSKA 3QFAA 1EL9A 1B5QA 4A5LA 2E4GA 3G5RA 4U8MA 3NTDA 2XFUA 2BACA 3BHFA 1QJDA 1ZMDA 3CTYA 4D04A 1YQ3A 4AP1A 3REDA 4EM3A 5L46A 2NPXA 4RG4A 2YLTA 1NG3A 5IQ1A 1QLBA 2BS2A 4APNA 2WDQA 4TM1A 1EL5A 2R0PA 1NHRA 1DOCA 1E1MA 2VRMA 2GR2A 5LV9A 4LIIA 4XXGA 2RABA 2V3BA 2EQ7A 4C77A 5M0ZA 2E1MA 2F5ZA 1DODA 3AEGA 1DXLA 3II4A 3ALJA 3NGCX 1PJ6A 2TPRA 1DJNA 5M10A 2XFNA 4BK3A 4IA6A 4OPIA 4YSZA 1ELIA 3L1RA 4HA6A 1BWCA 3UOZA 2WU2A 4Y4NA 1VQWA 4K8DA 5HXIA 4H2PA 3GWFA 1VG0A 1TDOA 2GR0A 2EQ8A 5JCNA 1NG4A 3UKQA 2OLOA 2YLZA 4IVOB 2BS3A 3CGDA 1E7PA 1NHQA 3FPZA 1EL7A 4XWZA 1Y56B 1ZMCA 3FMWA 2ZBWA 4EQSA 3ISHA 3AE6A 4LA1A 2DKHA 1PXAA 1PDHA 4J34A 2B9YA 3SXIA 3CGEA 3VRAA 1LV0A 1GRAA 4FDCB 4H4TA 1GRBA 1YQZA 3BNMA 4M52A 1H6VA 2XCGA 4BK1A 1D4EA 2CFYA 3P4QA 1L9EA 3P9UA 5KMRA 4X9MA 1H83A 2B9XA 3AE4A 3NK1X 3ITJA 4I59A 2NVKX 1L9CA 4G6HA 4H4PA 2V6OA 2BXRA 3H8LA 2A89A 2GV8A 1CHUA 2JB2A 2Q6UA 2R4EA 1ZOYA 3V76A 1FEBA 3GSIA 2GF3A 3F8DA 2YM1A 4H4WA 3BI5A 3G5SA 4GDPA 2WBAA 2C75A 4B68A 4G73A 1JNZA 2XFOA 3IHMA 4IVMB 2WPEA 4AOXA 1VG9A 5KMSA 4CCQA 2XLUA 1CJ4A 1H86A 1UKVG 1CJ3A 2BRYA 3GYXA 1MOKA 1NHSA 2WPFA 4EMIA 3NN0X 4H50A 1LVLA 4U2SA 4A6NA 3AE3A 1GRFA 3M0OA 3DK4A 3L8KA 1ZX9A 3UCLA 1TDFA 1O5WA 2BS4A 1LTXR 4FX9A 2BYBA 3LOVA 3QSMA 1NDAA 4JQ9A 2XFPA 3EAOA 3KLJA 1OJCA 3FIMB 1OJTA 4JNAA 1Y0PA 2R45A 1GTEA 4CNKA 1PBBA 3AB1A 2BCPA 1TDEA 4A65A 4B63A 1IUTA 3AE7A 3IC9A 2ZZ0A 3Q6JA 3COXA 4C3YA 2C66A 3SZFA 2YWLA 4TM0A 4EIPA 3NIXA 4H2NA 2Q0LA 3DK9A 1K0JA 2C7GA 1FL2A 2IVEA 2JBVA 3AEEA 1JRZA 3M12A 4P9SA 4CY6A 3VQRA 5KXJA 3CNSA 4H4XA 1CC4A 3GYIA 4PAAA 3IWAA 3UKHA 1PBEA 1ZOVA 3V3NA 5BRTA 2WHDA 2WQYA 3NH3X 2E5VA 1JEHA 3VRDB 1S7MA 1NEKA 4K7ZA 1BZLA 4OPUA 1DOEA 2ZZBA 1XANA 2RGOA 1JOAA 2YVFA 1ZP0A 3SM8A 4A99A 4YTNA 3DMEA 3UOXA 5JCKA 2V61A 2WOVA 1B8SA 2VOUA 3BNUA 3DA1A 3UTGA 3L5OA 3GRTA 3WE0A 3AE9A 2WETA 2C73A 3UKLA 1GERA 2PYXA 2I0ZA 2JK6A 3O0HA 1GRGA 3RHAA 4YSYA 3P4RA 1D4CA 4IV9A 2Q0KA 2CDUA 2XYOA 2B7SA 4J33A 5EB4A 1K4QA 3NK2X 1EBDA 1NAAA 2VZ2A 2YVGA 3T2KA 3K7QX 4JNQA 3P1WA 2WPCA 4U8NA 1GRHA 2XVIA 4B1BA 3ATRA 1NPXA 2EQ9A 3LADA 4H4ZA 1FCDA 3AEDA 4CNJA 1TYPA 5FMHA 2YR4A 5ER0A 3UOYA 4DNAA 3CN8A 3CIRA 5HYMA 4B69A 4H4YA 1GOSA 4ZCCA 4G9KA 5FS7A 2V3AA 3UKKA 5BVAA 1CF3A 2GH5A 3T2YA 1IUVA 1Y56A 3SGLA 5KMPA 2BC0A 2JKCA 2OAMA 1KFYA 2X3NA 2JAEA 3AD9B 3PVCA 4H4RA 1GNDA 3T31A 3UTEA 2QAEA 1V59A 3CPIG 4JY3A 4Y4MA 2Q7VA 4O5QA 1S2QA 2VRLA 3PO7A 3GDPA 4FK1A 1PBDA 1QO8A 1RSGA 4J57A 1KDGA 4NEVA 3C4NA 3GD4A 4NEWA 1L0VA 3GMBA 2BK3A 4U2TA 1JRXA 1PBCA 1KNPA 3EF6A 5BUKA 1OJDA 4TLXA 3PS9A 1IUUA 1DNCA 1JU2A 2WP9A 4YTPA 1BGNA 3GRSA 4K22A 2WESA 2VVLA 4J31A 5FS6A 3SX6A 4Z43A 4Z25A 3AD7B 4GR1A 2FJAA 1GV4A 4OPCA 4BK2A 2CULA 3ICTA 3DH9A 4YKGA 4B67A 5IQ4A 2YLXA 2YG4A 3RP6A 1CBOA 2GAHB 2RGJA 2AAQA 4FK1C 1LJ1A 3AYIA 4ADWA 4A79A 5DBJA 1AOGA 4YKFA 5KWFA 4YT0A 4GF7A 4MJWA 1BGJA 3HYWA 1E1LA 3HYVA 4OVIA 3VR8A 1N4VA 3UP5A 3HZLA 5BULA 1KNRA 3AECA 2YG5A 3K7TA 1RYIA 2VVLG 3NRNA 1KF6A 1LPFA 2EQ6A 3AXBA 1RP0A 4Z24A 2YAUA 3SQPA 1BF3A 1P2HA 1VRQB 1X31B 4Z2RA 1IUSA 4EQWA 1M6IA 2YR6A 5CKUA 3VRBA 2BK5A 3ATQA 3C4AA 3KPFA 3T2ZA 3UOVA 3RNMA 2H89A 4EMWA 5KOWA 1N4UA 4X4JA 5U1OA 3OZ2A 4C5OA 3QVRA 3CMMA 2VVMA 3AE1A 3KA7A 3NYEA 4K2XA 3SZCA 2WS3A 1IJHA 2V5ZA 5HY5A 1O95A 2YG7A 1D7LA 2ACZA 5U25A 3NT6A 4EQRA 1DJQA 5J60A 3NNEA 5FS8A 2WP5A 5C3JA 1OJAA 5IPYA 4EM4A 3SYIA 3F8PA 1F8WA 3KVEA 3UP4A 2AR8A 2C64A 2WDVA 3AYJA 4AOSA 4YSHA 4N9XA 3S61A 3UKAA 1EL8A 3E1TA 4H4SA 2WU5A 3B6DA 2GQFA 4II3A 1CC6A 4OPGA 4XWRA 5C2TA 4B64A 4II2A 2BABA 3KD9A 3DGZA 4UDQA 5EB5A 2FBWA 4GDEA 4J36A 5CQFA 1H81A 1E6EA 1HYUA 4JDRA 3D8XA 3Q9TA 1JNRA 1FOHA 1PS9A 2Z5YA 1ZY8A 3CPHG 1ZDLA 3ADAB 3NHOX 4ZN0A 4NTEA 1GESA 1REOA 2R4JA 4USQA 4BJZA 3NLCA 2O9ZA 4WCTA 4X9NA 3ICRA 3ALLA 4Z26A 4RSLA 2QA1A 1TYTA 3RP7A 2YQUA 3DK8A 1D4DA 1GRTA 5KNLA 1IUWA 1PJ5A 3EANA 2WDRA 5KMQA 3T37A 4GUVA 1PJ7A 1F3PA 1PN0A 1K0IA 3KU9A 1M64A 4OCGA 4H7UA 3D1CA 4O5UA 2BCGG 1CC2A 4U8JA 3LZWA 2R46A 4GAPA 2R0GA 2Y6QA 2J3NA 1GT8A 2RGHA 5HHFA 1Q1WA 3QSSA 4K5RA 1ONFA 3DGHA 4CY8A 3CNPA 4H2RA 4USRA 2ZZCA 1L9DA 2WOIA 1FEAA 3AEBA 4TM3A 3AEAA 2YG3A 5JCIA 3ABVA 3UKPA 3ICSA 2IIDA 1Z6LA 3HYXA 3ALMA 2Z5XA 2FJBA 4EQXA 2GAGB 4ECHA 2YVJA 1H7WA 3NYFA 3DJEA 5GSNA 2BA9A 1F8RA 2AQJA 4EIQA 3CPJG 1GEUA 3T0KA 4A7AA 3NYCA 3QFBA 3DJJA 4BURA 4EMJA 4I58A 5JCMA 2XVHA 3ZDNA 1F8SA 1ZKQA 2JB1A 4GRTA 4AP3A 2Y6RA 3K30A 1B4VA 1OJ9A 2YLRA 3BI4A 4U2LA 3QSEA 2CVJA 5EOWA 2PHHA 3QVPA 4YWOA 3SZWA 1XPQA 4YTMA 1P2EA 2YG6A 2WOWA 4U8IA 2IVDA 1H7XA 4DGKA 1GXFA 3IHGA 2GR1A 3SZ0A 1TDKA 3AWIA 4C3XA 1KSSA 1VDCA 3I3LA 2C65A 2H88A 4TM4A 4H2QA 1MXTA 1H2IA 1Q9IA 3B3RA 2C4CA 1CJCA 3P4SA 1GETA 1GSNA 2APGA 1MO9A 3S5WA 3M13A 3AE2A 3RP8A 1IUXA 2BK4A 4G6GA 4UP3A 1BKWA 3AEFA 3SFEA 2BXSA 2UZZA 4J2WA 5J7XA 1S2YA 4B66A 1CJ2A 1DOBA 2XLTA 2QCUA 5JCLA 3CNDA 3NG7X 5EBKA 1KN0A 3LXDA 5FS9A 1Q1RA 2GB0A 2GMJA 3DJDA 2FJEA 4A9WA 3KPKA 5KVHA 1YY5A 1TRBA 3GMCA 4ZCDA 2GVCA 4BV6A 4DSGA 1H84A 1GREA 1COYA 3D9XA 4GAVA 1B37A 4TLZA 5KOXA 3LB8A 4U8KA 2XLPA 4IA5A 2HQMA 3UKFA 4PABA 2YLSA 3I6DA 3NKSA 2XVJA 1E39A 2YM2A 1D5TA 3DJGX 3AE5A 3GWDA 4U8OA 3GD3A 4Z44A 4CRTA 2QA2A 2GRTA 2YLWA 5GRTA 1K0LA 2TMDA 3NN6X 1XDIA 1KSUA 2JB3A 1D7YA 1PBFA 2OLNA 1LQUA 4HB9A 1E1KA 1PXBA 3VR9A 3SY4A 2W0HA 2XLSA 3URHA 2ARDA 4JY2A 1XHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XVF A;  4NTC A;  1LQT A;  1SEZ A;  3BI2 A;  1GAL A;  2A87 A;  4Z2T A;  4J56 A;  1FEC A;  3FBS A;  3LJP A;  1N4W A;  2WP6 A;  2B7R A;  4E0V A;  3K7M X;  4OPD A;  2XVE A;  3FG2 P;  2DKI A;  2BC1 A;  3CNJ A;  1TDN A;  3CNT A;  2C3D A;  3GYJ A;  2C72 A;  2V60 A;  2XDO A;  2B9W A;  1O94 A;  4H4U A;  4OPT A;  2C76 A;  5TR3 A;  2GR3 A;  3H4K A;  4UDP A;  1PXC A;  1ZK7 A;  4NTD A;  4RG3 A;  2C3C A;  3OC4 A;  4YXD A;  4AT0 A;  3C96 A;  3LZX A;  3AE8 A;  1NHP A;  2C67 A;  4AT2 A;  3KKJ A;  2C70 A;  4C74 A;  4CBQ A;  3F8R A;  4NZH A;  2X50 A;  2GEW A;  2XLR A;  4UDR A;  4BJY A;  2X8H A;  4A6N B;  2X8G A;  1N1P A;  3AD8 B;  2WEU A;  4Z2U A;  4Y4L A;  2GMH A;  3UTF A;  5U63 A;  1YQ4 A;  4ICY A;  2B76 A;  2OA1 A;  3EPT A;  3CGB A;  4GCM A;  3QJ4 A;  1YKJ A;  4OPL A;  3AYL A;  3UTH A;  4REK A;  3P4P A;  2FJD A;  2VQ7 A;  2GQW A;  2X8C A;  4H4Q A;  5KVI A;  1E1N A;  1JRY A;  3V3O A;  1W4X A;  1S3E A;  2R0C A;  1S3B A;  3NK0 X;  4B65 A;  3CGC A;  4K5S A;  3H8I A;  3SFD A;  3IF9 A;  1GTH A;  4D03 A;  3ZYX A;  1F6M A;  5KRQ A;  4KX6 A;  2YR5 A;  4DSH A;  4U8L A;  3BHK A;  3R9U A;  2OAL A;  4WX1 A;  4CCR A;  4H4V A;  2X99 A;  4JN9 A;  4YSX A;  2VQB A;  3GDN A;  2A8X A;  2R9Z A;  4KPR A;  1CL0 A;  1H82 A;  1NEN A;  2XFQ A;  3G5Q A;  1GPE A;  4LU6 A;  1PHH A;  4U8P A;  3NTA A;  3JSK A;  3QFA A;  1EL9 A;  1B5Q A;  4A5L A;  2E4G A;  3G5R A;  4U8M A;  3NTD A;  2XFU A;  2BAC A;  3BHF A;  1QJD A;  1ZMD A;  3CTY A;  4D04 A;  1YQ3 A;  4AP1 A;  3RED A;  4EM3 A;  5L46 A;  2NPX A;  4RG4 A;  2YLT A;  1NG3 A;  5IQ1 A;  1QLB A;  2BS2 A;  4APN A;  2WDQ A;  4TM1 A;  1EL5 A;  2R0P A;  1NHR A;  1DOC A;  1E1M A;  2VRM A;  2GR2 A;  5LV9 A;  4LII A;  4XXG A;  2RAB A;  2V3B A;  2EQ7 A;  4C77 A;  5M0Z A;  2E1M A;  2F5Z A;  1DOD A;  3AEG A;  1DXL A;  3II4 A;  3ALJ A;  3NGC X;  1PJ6 A;  2TPR A;  1DJN A;  5M10 A;  2XFN A;  4BK3 A;  4IA6 A;  4OPI A;  4YSZ A;  1ELI A;  3L1R A;  4HA6 A;  1BWC A;  3UOZ A;  2WU2 A;  4Y4N A;  1VQW A;  4K8D A;  5HXI A;  4H2P A;  3GWF A;  1VG0 A;  1TDO A;  2GR0 A;  2EQ8 A;  5JCN A;  1NG4 A;  3UKQ A;  2OLO A;  2YLZ A;  4IVO B;  2BS3 A;  3CGD A;  1E7P A;  1NHQ A;  3FPZ A;  1EL7 A;  4XWZ A;  1Y56 B;  1ZMC A;  3FMW A;  2ZBW A;  4EQS A;  3ISH A;  3AE6 A;  4LA1 A;  2DKH A;  1PXA A;  1PDH A;  4J34 A;  2B9Y A;  3CGE A;  3VRA A;  1LV0 A;  1GRA A;  4FDC B;  4H4T A;  1GRB A;  1YQZ A;  3BNM A;  4M52 A;  1H6V A;  2XCG A;  4BK1 A;  1D4E A;  2CFY A;  3P4Q A;  1L9E A;  3P9U A;  4X9M A;  1H83 A;  2B9X A;  3AE4 A;  3NK1 X;  3ITJ A;  4I59 A;  2NVK X;  1L9C A;  4H4P A;  2V6O A;  2BXR A;  3H8L A;  2A89 A;  2GV8 A;  1CHU A;  2JB2 A;  2Q6U A;  2R4E A;  1ZOY A;  3V76 A;  1FEB A;  3GSI A;  2GF3 A;  3F8D A;  2YM1 A;  4H4W A;  3BI5 A;  3G5S A;  4GDP A;  2WBA A;  2C75 A;  4B68 A;  1JNZ A;  2XFO A;  3IHM A;  4IVM B;  2WPE A;  4AOX A;  1VG9 A;  4CCQ A;  2XLU A;  1CJ4 A;  1H86 A;  1UKV G;  1CJ3 A;  1MOK A;  1NHS A;  2WPF A;  4EMI A;  3NN0 X;  4H50 A;  1LVL A;  4U2S A;  4A6N A;  3AE3 A;  1GRF A;  3M0O A;  3DK4 A;  3L8K A;  1ZX9 A;  3UCL A;  1TDF A;  1O5W A;  2BS4 A;  1LTX R;  4FX9 A;  2BYB A;  3LOV A;  3QSM A;  1NDA A;  4JQ9 A;  2XFP A;  3EAO A;  3KLJ A;  1OJC A;  3FIM B;  1OJT A;  4JNA A;  1Y0P A;  2R45 A;  1GTE A;  4CNK A;  1PBB A;  3AB1 A;  2BCP A;  1TDE A;  4A65 A;  4B63 A;  1IUT A;  3AE7 A;  3IC9 A;  2ZZ0 A;  3Q6J A;  3COX A;  4C3Y A;  2C66 A;  4EIP A;  2YWL A;  4TM0 A;  3NIX A;  4H2N A;  2Q0L A;  3DK9 A;  1K0J A;  2C7G A;  1FL2 A;  2IVE A;  2JBV A;  3AEE A;  1JRZ A;  3M12 A;  4P9S A;  4CY6 A;  3VQR A;  5KXJ A;  3CNS A;  4H4X A;  1CC4 A;  3GYI A;  4PAA A;  3IWA A;  3UKH A;  1PBE A;  1ZOV A;  3V3N A;  5BRT A;  2WHD A;  2WQY A;  3NH3 X;  2E5V A;  1JEH A;  3VRD B;  1NEK A;  4K7Z A;  1BZL A;  4OPU A;  1DOE A;  2ZZB A;  1XAN A;  2RGO A;  1JOA A;  2YVF A;  1ZP0 A;  3SM8 A;  4A99 A;  4YTN A;  3DME A;  3UOX A;  5JCK A;  2V61 A;  2WOV A;  1B8S A;  2VOU A;  3BNU A;  3DA1 A;  3UTG A;  3GRT A;  3WE0 A;  3AE9 A;  2WET A;  2C73 A;  3UKL A;  1GER A;  2PYX A;  2I0Z A;  2JK6 A;  3O0H A;  1GRG A;  3RHA A;  4YSY A;  3P4R A;  1D4C A;  4IV9 A;  2Q0K A;  2CDU A;  2XYO A;  2B7S A;  4J33 A;  5EB4 A;  1K4Q A;  3NK2 X;  1EBD A;  1NAA A;  2VZ2 A;  2YVG A;  3K7Q X;  4JNQ A;  3P1W A;  2WPC A;  4U8N A;  1GRH A;  2XVI A;  4B1B A;  3ATR A;  1NPX A;  2EQ9 A;  3LAD A;  4H4Z A;  1FCD A;  3AED A;  4CNJ A;  1TYP A;  5FMH A;  2YR4 A;  5ER0 A;  3UOY A;  4DNA A;  3CN8 A;  3CIR A;  5HYM A;  4B69 A;  4H4Y A;  1GOS A;  4ZCC A;  5FS7 A;  2V3A A;  3UKK A;  5BVA A;  1CF3 A;  2GH5 A;  1IUV A;  1Y56 A;  3SGL A;  2BC0 A;  2JKC A;  2OAM A;  1KFY A;  2X3N A;  2JAE A;  3AD9 B;  3PVC A;  4H4R A;  1GND A;  3UTE A;  2QAE A;  1V59 A;  3CPI G;  4JY3 A;  4Y4M A;  2Q7V A;  4O5Q A;  1S2Q A;  2VRL A;  3PO7 A;  3GDP A;  4FK1 A;  1PBD A;  1QO8 A;  1RSG A;  4J57 A;  1KDG A;  4NEV A;  3C4N A;  3GD4 A;  4NEW A;  1L0V A;  3GMB A;  2BK3 A;  4U2T A;  1JRX A;  1PBC A;  1KNP A;  3EF6 A;  5BUK A;  1OJD A;  4TLX A;  3PS9 A;  1IUU A;  1DNC A;  1JU2 A;  2WP9 A;  4YTP A;  1BGN A;  3GRS A;  4K22 A;  2WES A;  2VVL A;  4J31 A;  5FS6 A;  4Z43 A;  4Z25 A;  3AD7 B;  4GR1 A;  2FJA A;  1GV4 A;  4OPC A;  4BK2 A;  2CUL A;  3ICT A;  3DH9 A;  4YKG A;  4B67 A;  5IQ4 A;  2YLX A;  2YG4 A;  3RP6 A;  1CBO A;  2GAH B;  2RGJ A;  2AAQ A;  4FK1 C;  1LJ1 A;  3AYI A;  4ADW A;  4A79 A;  5DBJ A;  1AOG A;  4YKF A;  5KWF A;  4YT0 A;  4GF7 A;  4MJW A;  1BGJ A;  1E1L A;  4OVI A;  3VR8 A;  1N4V A;  3UP5 A;  3HZL A;  5BUL A;  1KNR A;  3AEC A;  2YG5 A;  3K7T A;  1RYI A;  2VVL G;  3NRN A;  1KF6 A;  1LPF A;  2EQ6 A;  3AXB A;  1RP0 A;  4Z24 A;  2YAU A;  3SQP A;  1BF3 A;  1P2H A;  1VRQ B;  1X31 B;  4Z2R A;  1IUS A;  4EQW A;  1M6I A;  2YR6 A;  5CKU A;  3VRB A;  2BK5 A;  3ATQ A;  3C4A A;  3KPF A;  3UOV A;  3RNM A;  2H89 A;  4EMW A;  5KOW A;  1N4U A;  4X4J A;  5U1O A;  3OZ2 A;  4C5O A;  3QVR A;  2VVM A;  3AE1 A;  3KA7 A;  3NYE A;  4K2X A;  5HY5 A;  2WS3 A;  1IJH A;  2V5Z A;  1O95 A;  2YG7 A;  1D7L A;  2ACZ A;  5U25 A;  3NT6 A;  4EQR A;  1DJQ A;  5J60 A;  3NNE A;  5FS8 A;  2WP5 A;  5C3J A;  1OJA A;  5IPY A;  4EM4 A;  3UP4 A;  3F8P A;  1F8W A;  3KVE A;  2AR8 A;  2C64 A;  2WDV A;  3AYJ A;  4AOS A;  4YSH A;  4N9X A;  3S61 A;  3UKA A;  1EL8 A;  3E1T A;  4H4S A;  2WU5 A;  3B6D A;  2GQF A;  1CC6 A;  4OPG A;  4XWR A;  5C2T A;  4B64 A;  2BAB A;  3KD9 A;  3DGZ A;  4UDQ A;  5EB5 A;  2FBW A;  4GDE A;  4J36 A;  5CQF A;  1H81 A;  1E6E A;  1HYU A;  4JDR A;  3D8X A;  3Q9T A;  1JNR A;  1FOH A;  1PS9 A;  2Z5Y A;  1ZY8 A;  3CPH G;  1ZDL A;  3ADA B;  3NHO X;  4ZN0 A;  4NTE A;  1GES A;  1REO A;  2R4J A;  4USQ A;  4BJZ A;  3NLC A;  2O9Z A;  4WCT A;  4X9N A;  3ICR A;  3ALL A;  4Z26 A;  4RSL A;  2QA1 A;  1TYT A;  3RP7 A;  2YQU A;  3DK8 A;  1D4D A;  1GRT A;  1IUW A;  1PJ5 A;  3EAN A;  2WDR A;  3T37 A;  4GUV A;  1PJ7 A;  1F3P A;  1PN0 A;  1K0I A;  3KU9 A;  1M64 A;  4OCG A;  4H7U A;  3D1C A;  4O5U A;  2BCG G;  1CC2 A;  4U8J A;  3LZW A;  2R46 A;  2R0G A;  2Y6Q A;  2J3N A;  1GT8 A;  2RGH A;  5HHF A;  1Q1W A;  3QSS A;  4K5R A;  1ONF A;  3DGH A;  4CY8 A;  3CNP A;  4H2R A;  4USR A;  2ZZC A;  1L9D A;  2WOI A;  1FEA A;  3AEB A;  4TM3 A;  3AEA A;  2YG3 A;  5JCI A;  3ABV A;  3UKP A;  3ICS A;  2IID A;  1Z6L A;  3ALM A;  2Z5X A;  2FJB A;  4EQX A;  2GAG B;  4ECH A;  2YVJ A;  1H7W A;  3NYF A;  3DJE A;  5GSN A;  2BA9 A;  1F8R A;  2AQJ A;  4EIQ A;  3CPJ G;  1GEU A;  4A7A A;  3NYC A;  3QFB A;  3DJJ A;  4BUR A;  4EMJ A;  4I58 A;  5JCM A;  2XVH A;  3ZDN A;  1F8S A;  1ZKQ A;  2JB1 A;  4GRT A;  4AP3 A;  2Y6R A;  3K30 A;  1B4V A;  1OJ9 A;  2YLR A;  3BI4 A;  4U2L A;  3QSE A;  2CVJ A;  5EOW A;  2PHH A;  3QVP A;  4YWO A;  1XPQ A;  4YTM A;  1P2E A;  2YG6 A;  2WOW A;  4U8I A;  2IVD A;  1H7X A;  4DGK A;  1GXF A;  3IHG A;  2GR1 A;  1TDK A;  3AWI A;  4C3X A;  1KSS A;  1VDC A;  3I3L A;  2C65 A;  2H88 A;  4TM4 A;  4H2Q A;  1MXT A;  1Q9I A;  3B3R A;  1CJC A;  3P4S A;  1GET A;  1GSN A;  2APG A;  1MO9 A;  3S5W A;  3M13 A;  3AE2 A;  3RP8 A;  1IUX A;  2BK4 A;  4UP3 A;  1BKW A;  3AEF A;  3SFE A;  2BXS A;  2UZZ A;  4J2W A;  5J7X A;  1S2Y A;  4B66 A;  1CJ2 A;  1DOB A;  2XLT A;  2QCU A;  5JCL A;  3CND A;  3NG7 X;  5EBK A;  3LXD A;  5FS9 A;  1Q1R A;  2GB0 A;  2GMJ A;  3DJD A;  2FJE A;  4A9W A;  5KVH A;  1YY5 A;  1TRB A;  3GMC A;  4ZCD A;  2GVC A;  4BV6 A;  4DSG A;  1H84 A;  1GRE A;  1COY A;  1B37 A;  4TLZ A;  5KOX A;  3LB8 A;  4U8K A;  2XLP A;  4IA5 A;  2HQM A;  3UKF A;  4PAB A;  2YLS A;  3I6D A;  3NKS A;  2XVJ A;  1E39 A;  2YM2 A;  1D5T A;  3DJG X;  3AE5 A;  3GWD A;  4U8O A;  3GD3 A;  4Z44 A;  4CRT A;  2QA2 A;  2GRT A;  2YLW A;  5GRT A;  1K0L A;  2TMD A;  3NN6 X;  1XDI A;  1KSU A;  2JB3 A;  1D7Y A;  1PBF A;  2OLN A;  1LQU A;  4HB9 A;  1E1K A;  1PXB A;  3VR9 A;  2W0H A;  2XLS A;  3URH A;  2ARD A;  4JY2 A;  1XHC A; 
#chains in the Genus database with same CATH topology
 1SEZ A;  4E0V A;  2QQ6 A;  4E4U A;  4GGB A;  4H4U A;  2C76 A;  3CYJ A;  2GL5 A;  1ZK7 A;  4NNJ A;  3AM9 A;  3C96 A;  3AE8 A;  3KKJ A;  3HRD C;  4UDR A;  3SN1 A;  2WEU A;  4Y4L A;  2GMH A;  5U63 A;  3EPT A;  1YKJ A;  3AYL A;  4REK A;  2BRA A;  1E9I A;  3T14 A;  4B65 A;  4K5S A;  3R0U A;  4G74 A;  3QPE A;  3ZYX A;  1ELS A;  4KX6 A;  4U8L A;  3BHK A;  3R9U A;  4WX1 A;  4H4V A;  2X99 A;  4YSX A;  3NVW B;  3MWC A;  1SJB A;  1H82 A;  3NTA A;  3JSK A;  3QFA A;  1EL9 A;  3G5R A;  4AP1 A;  3RED A;  5IQ1 A;  3SN0 A;  4APN A;  2OG9 A;  3PK7 A;  7ENL A;  2VRM A;  4DYE A;  2GR2 A;  3SBF A;  2EQ7 A;  2F5Z A;  3II4 A;  3ALJ A;  3NGC X;  2OLA A;  5FJR A;  2TPR A;  4BK3 A;  2WU2 A;  4Y4N A;  1VQW A;  4K8D A;  3VFC A;  1TDO A;  2EQ8 A;  3UKQ A;  4IL0 A;  2PMQ A;  1EL7 A;  1Y56 B;  2HZG A;  3FMW A;  2ZBW A;  4DXK A;  4J34 A;  4FDC B;  1YQZ A;  4M52 A;  4ROP A;  3JW7 A;  1XPY A;  3SQS A;  1L9C A;  2BXR A;  2JB2 A;  1CHU A;  2YM1 A;  4GDP A;  1JNZ A;  2XFO A;  3A7U A;  2WPE A;  1UKV G;  2BRY A;  3UXL A;  1MOK A;  1SB3 B;  4GIS A;  3NN0 X;  2BYB A;  4JQ9 A;  3EAO A;  1GTE A;  3AB1 A;  1TDE A;  3IC9 A;  4EIP A;  2QVH A;  3DK9 A;  2GGE A;  1JRZ A;  3VQR A;  3UCC A;  3GYI A;  4HNC A;  3UKH A;  3ZLF A;  1FO4 A;  1JOA A;  3BNU A;  2OX4 A;  1GER A;  3V5C A;  3O0H A;  3RHA A;  3P4R A;  2CDU A;  2XYO A;  1K4Q A;  1SJD A;  2WPC A;  1WUE A;  3TCS A;  3D46 A;  2PTY A;  2EQ9 A;  4H4Z A;  2W3R A;  2W55 A;  3CIR A;  1GOS A;  4G9K A;  3UKK A;  1CF3 A;  2QJM A;  2OAM A;  5FJT A;  4H4R A;  2QAE A;  1V59 A;  4Y4M A;  3PO7 A;  3GDP A;  1QO8 A;  3TQP A;  3GO2 A;  3V4B A;  4J57 A;  4NEV A;  3GD4 A;  4NEW A;  5BUK A;  4GFI A;  3Q45 A;  1IUU A;  1DNC A;  3DEQ A;  1JPD X;  2WES A;  3A7R A;  4GR1 A;  3SSZ A;  3TOY A;  3AYI A;  4FP1 A;  4ADW A;  3U4F A;  4GF7 A;  3OZY A;  3VR8 A;  3UP5 A;  3HZL A;  4GYP C;  5BUL A;  2GSH A;  3MQT A;  2BK5 A;  3ATQ A;  3C4A A;  3I6E A;  1N4U A;  5U1O A;  4C5O A;  3QVR A;  2YG7 A;  1D7L A;  5U25 A;  4EQR A;  1DJQ A;  3DES A;  2OVL A;  1OJA A;  3F8P A;  3AYJ A;  4IP4 A;  2OFJ A;  4N9X A;  2W3S A;  3E1T A;  2WU5 A;  2GQF A;  4OPG A;  2XH0 A;  5CQF A;  1E6E A;  1HYU A;  3Q9T A;  4A6G A;  2Z5Y A;  3NHO X;  4USQ A;  3MSY A;  3VDG A;  4DN1 A;  4RSL A;  1GRT A;  3DK8 A;  5KMQ A;  3T37 A;  1PJ7 A;  1F3P A;  1K0I A;  4OCG A;  3DG6 A;  4U8J A;  2PP1 A;  2RGH A;  1Q1W A;  4K5R A;  4CY8 A;  3AEB A;  1FEA A;  2YG3 A;  3ALM A;  2FJB A;  4EQX A;  4ECH A;  2YVJ A;  3DJE A;  1DTN A;  1JRP A;  4BUR A;  3DJJ A;  3QLD A;  1F8S A;  4H2H A;  4U2L A;  2CVJ A;  2PHH A;  3SZW A;  1XPQ A;  2WOW A;  4IT1 A;  2GR1 A;  1TDK A;  3R10 A;  1KSS A;  2H88 A;  2DW6 A;  1MXT A;  1H2I A;  3B3R A;  3TJ4 A;  1CJC A;  1MRA A;  1GET A;  1GSN A;  1MO9 A;  3M13 A;  3RP8 A;  3SFE A;  2UZZ A;  2QCU A;  3CND A;  1FFU C;  3AMZ A;  3LXD A;  1Q1R A;  3DJD A;  2FJE A;  4H1Z A;  5KVH A;  1TRB A;  1B37 A;  1VDV A;  4PAB A;  2PP3 A;  3NKS A;  2YM2 A;  4G7F A;  3DFH A;  4U8O A;  3HPF A;  4CRT A;  2QA2 A;  1P43 A;  2O56 A;  1K0L A;  3NN6 X;  1KSU A;  1LQU A;  3SY4 A;  3URH A;  3UXK A;  2XVF A;  3BI2 A;  1N4W A;  2B7R A;  3K7M X;  4F4R A;  2DKI A;  3CNT A;  4M6U A;  2B9W A;  2PTW A;  4OPT A;  4ZCW A;  4UDP A;  1PXC A;  1EC9 A;  4RG3 A;  4AT0 A;  2C67 A;  3F8R A;  4NZH A;  2GEW A;  1EC8 A;  3QKE A;  4BJY A;  4A6N B;  5JRB A;  2X8G A;  3DER A;  2PP0 A;  3AD8 B;  4Z2U A;  1X2G A;  1YQ4 A;  3CXB A;  2OA1 A;  3EUB 3;  3CGB A;  2GQW A;  2X8C A;  4H4Q A;  5KVI A;  1E1N A;  3V3O A;  1W4X A;  2PGW A;  1S3B A;  3NK0 X;  3CGC A;  3SFD A;  3IF9 A;  4TVY A;  1F6M A;  5KRQ A;  2YR5 A;  3VC6 A;  2OAL A;  4CCR A;  2VQB A;  2A8X A;  2R9Z A;  1CL0 A;  2XFQ A;  4LU6 A;  2FKP A;  1GPE A;  1R0M A;  4A5L A;  2E4G A;  4U8M A;  1NEL A;  4A3R A;  1ZMD A;  3SR6 B;  4D04 A;  2PU1 A;  4RG4 A;  2BS2 A;  2R0P A;  1NHR A;  4XXG A;  2V3B A;  4C77 A;  2E1M A;  3AEG A;  1DXL A;  1PJ6 A;  4HYR A;  5M10 A;  4OPI A;  4YSZ A;  4HA6 A;  1BWC A;  4M0X A;  5HXI A;  2GR0 A;  2OLO A;  2YLZ A;  2BS3 A;  1E7P A;  3FPZ A;  2POD A;  3Q4D A;  3SXI A;  1LV0 A;  3V3W A;  1N61 C;  4YWS A;  1D4E A;  3P4Q A;  1L9E A;  4KT2 A;  2A89 A;  2Q6U A;  3V76 A;  1ZOY A;  1FEB A;  3GSI A;  3CB3 A;  4IVM B;  1VG9 A;  2CHR A;  3GYX A;  4IP5 A;  3AE3 A;  1GRF A;  2OO6 A;  3M0O A;  3L8K A;  1TDF A;  1BQG A;  1LTX R;  3R07 C;  1NDA A;  3KLJ A;  3FIM B;  1OJT A;  1Y0P A;  4CNK A;  2C66 A;  2YWL A;  3AEE A;  1FL2 A;  3M12 A;  4H4X A;  4PAA A;  5BOE A;  1PBE A;  3V3N A;  2WQY A;  2E5V A;  3VRD B;  4K7Z A;  1BZL A;  4OPU A;  1DOE A;  3TW9 A;  1XAN A;  1ZP0 A;  4A99 A;  4YTN A;  2WOV A;  4FI4 A;  1B8S A;  2VOU A;  3DA1 A;  3L5O A;  3OPS A;  2C73 A;  2WET A;  2I0Z A;  2JK6 A;  4KPL A;  3N6H A;  4YSY A;  3DIP A;  2B7S A;  5EB4 A;  3AN1 A;  3T2K A;  2P8C A;  3P1W A;  1GRH A;  2XVI A;  3NRZ B;  4H83 A;  1NPX A;  3NS1 B;  4MGG A;  5ER0 A;  3UJ2 A;  1P48 A;  1KKR A;  4H4Y A;  3FXG A;  5BVA A;  2GH5 A;  3T2Y A;  1Y56 A;  5KMP A;  2BC0 A;  3NVV B;  2JKC A;  2X3N A;  3T31 A;  3NXL A;  3UTE A;  3CPI G;  1S2Q A;  4FK1 A;  1KDG A;  3NZG A;  4K1W A;  1PBC A;  2P0I A;  2ONE A;  2WP9 A;  2XH2 A;  1BGN A;  2VVL A;  5G5H B;  1ZXI C;  3AD7 B;  4OPC A;  1N60 C;  4MMW A;  4BK2 A;  3ICT A;  2YLX A;  2YG4 A;  1CBO A;  1LJ1 A;  4YKF A;  4MJW A;  1BGJ A;  4A35 A;  1E1L A;  4OVI A;  1JDF A;  2EQ6 A;  1BF3 A;  1X31 B;  4Z2R A;  4EQW A;  1M6I A;  2PA6 A;  3KPF A;  3UOV A;  3R0K A;  3MKC A;  1KKO A;  2VVM A;  3KA7 A;  3SZC A;  2WS3 A;  3NT6 A;  5C3J A;  2MNR A;  4EM4 A;  3KVE A;  3UP4 A;  2QDD A;  4YSH A;  3S61 A;  4II3 A;  2BAB A;  2FBW A;  4GDE A;  4J36 A;  1FOH A;  1ZDL A;  1STZ A;  4ZN0 A;  2DW7 A;  1L8P A;  3ALL A;  2QA1 A;  1TYT A;  3RP7 A;  4J1O A;  2OZ8 A;  1IUW A;  2OPJ A;  3EAN A;  4GUV A;  3KU9 A;  3D1C A;  2R0G A;  3R25 A;  3QSS A;  3DGH A;  4H2R A;  4Z1Y A;  1L9D A;  2WOI A;  4TM3 A;  3HW2 A;  1MUC A;  5JCI A;  3ABV A;  3U9I A;  3ICS A;  3GY1 A;  4E6M A;  1Z6L A;  2IID A;  3ZVI A;  2Z5X A;  3NYF A;  2QJJ A;  2W54 A;  4EIQ A;  3T0K A;  3NYC A;  3QFB A;  3ZDN A;  2Y6R A;  3BI4 A;  2E5A A;  4IL2 A;  4YTM A;  3RO6 A;  1P2E A;  2IVD A;  4DGK A;  1GXF A;  3AWI A;  1VDC A;  3BJS A;  3I3L A;  1Q9I A;  1SJC A;  2C4C A;  3K1G A;  3AE2 A;  2BK4 A;  1BKW A;  2BXS A;  1DOB A;  3RIT A;  1KN0 A;  5FS9 A;  1W6T A;  2GB0 A;  4HPN A;  1IYX A;  1BKH A;  3GMC A;  1MDL A;  1COY A;  4TLZ A;  4DWD A;  2XLP A;  4IA5 A;  2HQM A;  1NU5 A;  3DJG X;  3AE5 A;  3GD3 A;  1XDI A;  3R11 A;  3DDM A;  3A7A A;  1E1K A;  2XLS A;  3R1Z A;  2ARD A;  2C75 A;  4NTC A;  4Z2T A;  1FEC A;  3FBS A;  3LJP A;  3PG6 A;  3ZVH A;  1WYG A;  2BC1 A;  3CNJ A;  3IJI A;  1TDN A;  2C3D A;  3GYJ A;  2C72 A;  1FHV A;  3P93 A;  1O94 A;  5TR3 A;  2GR3 A;  3H4K A;  3I6T A;  4NTD A;  2C3C A;  5EU9 A;  4NWZ A;  4YXD A;  2C70 A;  2I5Q A;  2XLR A;  2X8H A;  4K2S A;  3ZVH B;  3UTF A;  3IJQ A;  2B76 A;  4GCM A;  3QJ4 A;  1EBG A;  3UTH A;  3P4P A;  2VQ7 A;  3NFU A;  4JN7 A;  3T6C A;  3H8I A;  4D03 A;  3FCP A;  5FJO A;  2QDE A;  4KPR A;  1NEN A;  3G5Q A;  1PHH A;  1B5Q A;  3NTD A;  2XFU A;  3BHF A;  2OQH A;  2OZ3 A;  4EM3 A;  5L46 A;  2NPX A;  2YLT A;  1NG3 A;  2GGH A;  1QLB A;  4TM1 A;  1EL5 A;  1E1M A;  5LV9 A;  4LII A;  5M0Z A;  4IZG A;  1DOD A;  3FJ4 A;  3FYY A;  3CXO A;  4IA6 A;  1ELI A;  3UOZ A;  4HCH A;  5JCN A;  2NQL A;  3N4F A;  3CGD A;  4EQS A;  4LA1 A;  2DKH A;  1PXA A;  2B9Y A;  3CGE A;  1GRA A;  1GRB A;  1TZZ A;  1KCZ A;  1H6V A;  4BK1 A;  5KMR A;  1H83 A;  3TWA A;  1FIQ B;  4I59 A;  4KWS A;  3H8L A;  2POZ A;  2GF3 A;  3F8D A;  3BI5 A;  3G5S A;  3TWB A;  4G73 A;  2ZC8 A;  3EKG A;  1X2H A;  5KMS A;  2XH7 A;  1H86 A;  4A6N A;  4U2S A;  4H50 A;  1LVL A;  3DK4 A;  4FX9 A;  3LOV A;  3RGT A;  1OJC A;  2P88 A;  1PDY A;  4H19 A;  1PBB A;  4B63 A;  4C3Y A;  3SZF A;  4TM0 A;  2JBV A;  1K0J A;  5KXJ A;  3CNS A;  4HN8 A;  3ZLG A;  5BRT A;  1MDR A;  2PCE A;  2WHD A;  3NH3 X;  1JEH A;  3TJI A;  1S7M A;  3JVA A;  1NEK A;  2ZZB A;  2RGO A;  3SM8 A;  3UGV A;  3UTG A;  3ES8 A;  2XSX A;  2PYX A;  4E8G A;  3SN4 A;  1D4C A;  2PGE A;  3NK2 X;  1EBD A;  2VZ2 A;  3K7Q X;  4JNQ A;  3FVD A;  4U8N A;  4B1B A;  4ENL A;  1FCD A;  4CNJ A;  3VA8 A;  3AED A;  1TYP A;  2YR4 A;  3UOY A;  3RCY A;  3CN8 A;  5HYM A;  4ZCC A;  5FJP A;  1IUV A;  3SGL A;  5J04 A;  1KFY A;  2JAE A;  3PVC A;  1JRO A;  3T8Q A;  1GND A;  4JY3 A;  2Q7V A;  5ENL A;  4O5Q A;  1RSG A;  3S47 A;  1JRX A;  3IJL A;  4GYP A;  3H70 A;  1T3Q C;  1OJD A;  1JU2 A;  4YTP A;  4K22 A;  4J31 A;  4Z25 A;  3SX6 A;  5FS6 A;  3TTE A;  5IQ4 A;  3PWI A;  3UJR A;  4GIR A;  3T4W A;  3FV9 A;  2OZT A;  4YT0 A;  3DG7 A;  3HYW A;  2FYM A;  3ETR B;  2PS2 A;  3AEC A;  2YG5 A;  1N5X A;  3K7T A;  1KF6 A;  3AXB A;  1RP0 A;  1IUS A;  2YR6 A;  3VRB A;  3T2Z A;  3RNM A;  2H89 A;  5KOW A;  3AE1 A;  3VC5 A;  1O95 A;  2ACZ A;  5FS8 A;  2WP5 A;  3SYI A;  1F8W A;  2C64 A;  1EL8 A;  4H4S A;  1FHU A;  5EB5 A;  3KD9 A;  3DGZ A;  1SJA A;  1H81 A;  4JDR A;  3ADA B;  2R4J A;  1REO A;  4WCT A;  4Z26 A;  1D4D A;  5KNL A;  3OTR A;  1PN0 A;  1M64 A;  4O5U A;  3LZW A;  2R46 A;  4GAP A;  2Y6Q A;  2J3N A;  5HHF A;  3CNP A;  5G5G B;  4USR A;  2ZZC A;  3HYX A;  4IHC A;  4MKS A;  5GSN A;  2BA9 A;  1N62 C;  1F8R A;  2AQJ A;  3CPJ G;  1GEU A;  4I58 A;  2PTX A;  2JB1 A;  4GRT A;  4AP3 A;  1OJ9 A;  3SZ0 A;  5FJU A;  2HXU A;  2HNE A;  2C65 A;  4TM4 A;  4H2Q A;  4EWJ A;  3P4S A;  4TVW A;  1IUX A;  4G6G A;  4UP3 A;  3P0W A;  3AEF A;  5J7X A;  1CJ2 A;  2XLT A;  5JCL A;  3PFR A;  5EBK A;  4A9W A;  4ZCD A;  2GVC A;  4BV6 A;  4DSG A;  1GRE A;  2MUC A;  3D9X A;  1JPM A;  3I4K A;  3UKF A;  3UJS A;  1E39 A;  3EEZ A;  4GGH A;  1VQZ A;  2GRT A;  5GRT A;  2JB3 A;  1V97 A;  2OLN A;  4HCD A;  4JY2 A;  1LQT A;  1GAL A;  2A87 A;  4J56 A;  4G8T A;  2WP6 A;  4OPD A;  2XVE A;  3FG2 P;  3GD6 A;  2V60 A;  2XDO A;  3ENL A;  1EBH A;  3OC4 A;  3LZX A;  1NHP A;  4AT2 A;  4Z17 A;  4C74 A;  4CBQ A;  2X50 A;  2XGZ A;  4X2P A;  1N1P A;  4ICY A;  4OPL A;  3KUM A;  2FJD A;  1JRY A;  1S3E A;  2R0C A;  3V5F A;  1GTH A;  3H12 A;  3MZN A;  3N6J A;  4DSH A;  3STP A;  4JN9 A;  3GDN A;  4E5T A;  4U8P A;  2BAC A;  1QJD A;  3CTY A;  1YQ3 A;  3UJE A;  2WDQ A;  1DOC A;  4J3Z A;  2RAB A;  2XH4 A;  1DJN A;  2XFN A;  3L1R A;  4H2P A;  3GWF A;  1VG0 A;  3B9J B;  3MY9 A;  1NG4 A;  4IVO B;  2GGJ A;  1NHQ A;  4XWZ A;  1PDZ A;  1ZMC A;  3ISH A;  3AE6 A;  1YEY A;  1PDH A;  3SJN A;  3VRA A;  4H4T A;  2QGY A;  3BNM A;  3IK4 A;  2XCG A;  3BSM A;  2CFY A;  3P9U A;  4X9M A;  2B9X A;  3AE4 A;  3NK1 X;  3ITJ A;  2NVK X;  4G6H A;  4H4P A;  2V6O A;  2GV8 A;  2R4E A;  4H4W A;  2WBA A;  4B68 A;  3IHM A;  4AOX A;  4CCQ A;  2XLU A;  1CJ4 A;  1CJ3 A;  1NHS A;  2WPF A;  4EMI A;  2PPG A;  3RRA A;  1XS2 A;  1ZX9 A;  3UCL A;  2HXT A;  2OKT A;  3NO1 A;  1O5W A;  2BS4 A;  3QSM A;  2XFP A;  2PSN A;  3H7V A;  4JNA A;  2R45 A;  2BCP A;  4A65 A;  1IUT A;  3AE7 A;  2ZZ0 A;  3N4E A;  3Q6J A;  3COX A;  3H8A A;  3NIX A;  3QTP A;  4H2N A;  2Q0L A;  2IVE A;  2C7G A;  4P9S A;  4CY6 A;  1F9C A;  1CC4 A;  3IWA A;  5BOF A;  1ZOV A;  2P3Z A;  3VCC A;  3OW1 A;  2YVF A;  3DME A;  3UOX A;  5JCK A;  2V61 A;  3GRT A;  3WE0 A;  3JZU A;  3AE9 A;  3UKL A;  2RDX A;  1GRG A;  4IV9 A;  2Q0K A;  3S5S A;  3OZM A;  4J33 A;  3CAW A;  1NAA A;  2YVG A;  3BOX A;  3NVY B;  3ATR A;  3LAD A;  5FMH A;  3RR1 A;  4DNA A;  2AKM A;  4B69 A;  5FS7 A;  3D47 A;  2V3A A;  4GME A;  1OEP A;  3AD9 B;  2VRL A;  3VCN A;  3MUC A;  3P3B A;  1PBD A;  3C4N A;  2OQY A;  3GMB A;  1L0V A;  2BK3 A;  4U2T A;  1ONE A;  1KNP A;  3EF6 A;  2GGG A;  3UJF A;  3DGB A;  3NVZ B;  4TLX A;  3PS9 A;  3GRS A;  4Z43 A;  2PU0 A;  2FJA A;  1GV4 A;  2CUL A;  3DH9 A;  4YKG A;  4B67 A;  4HNL A;  3RP6 A;  2GAH B;  2RGJ A;  2AAQ A;  4FK1 C;  4A79 A;  5DBJ A;  1AOG A;  5KWF A;  3THU A;  2PTZ A;  3HYV A;  1N4V A;  4HCL A;  4K8G A;  1KNR A;  1RYI A;  2VVL G;  3NRN A;  1LPF A;  4Z24 A;  2YAU A;  3SQP A;  1VRQ B;  1P2H A;  5CKU A;  1N63 C;  3CK5 A;  4EMW A;  3B97 A;  4X4J A;  1WUF A;  2AL2 A;  3OZ2 A;  3CMM A;  3NYE A;  4K2X A;  5HY5 A;  1IJH A;  2V5Z A;  5J60 A;  3NNE A;  3GC2 A;  2P8B A;  5IPY A;  4ZOH B;  2AR8 A;  2WDV A;  4E4F A;  4AOS A;  3UKA A;  3B6D A;  1CC6 A;  4XWR A;  5C2T A;  2AL2 B;  4B64 A;  4II2 A;  4UDQ A;  1EC7 A;  3ZLH A;  3D8X A;  1JNR A;  3CPH G;  1PS9 A;  1ZY8 A;  4NTE A;  1GES A;  4BJZ A;  3NLC A;  2O9Z A;  4X9N A;  3ICR A;  2YQU A;  1KD0 A;  1PJ5 A;  3DFY A;  2WDR A;  4H7U A;  4DHG A;  2BCG G;  1CC2 A;  1GT8 A;  1TE6 A;  1ONF A;  3AEA A;  3UKP A;  1ECQ A;  2GAG B;  3OP2 A;  1H7W A;  4KEM A;  5IDZ A;  4A7A A;  4DX3 A;  4JN8 A;  4EMJ A;  5JCM A;  2XVH A;  1ZKQ A;  3K30 A;  1B4V A;  3ES7 A;  2YLR A;  3T9P A;  3QSE A;  5EOW A;  3PWG A;  3QVP A;  4YWO A;  2YG6 A;  4U8I A;  6ENL A;  1H7X A;  1RM6 B;  3IHG A;  2QJN A;  2AKZ A;  1RVK A;  2ZAD A;  4C3X A;  2E3T A;  1TKK A;  1N5W C;  2APG A;  3S5W A;  4J2W A;  4JHM A;  1S2Y A;  4B66 A;  3NG7 X;  2GMJ A;  3KPK A;  1YY5 A;  1H84 A;  4GAV A;  5KOX A;  3LB8 A;  4U8K A;  3UCD A;  3DG3 A;  2YLS A;  3I6D A;  2XVJ A;  1D5T A;  3QN3 A;  3GWD A;  4Z44 A;  1FFV C;  2AL1 A;  2YLW A;  3CT2 A;  2TMD A;  1JCT A;  1D7Y A;  1PBF A;  2GDQ A;  4HB9 A;  1R6W A;  1PXB A;  3VR9 A;  2W0H A;  4ZA0 A;  1MNS A;  1XHC A;  2GGI A; 
#chains in the Genus database with same CATH homology
 2XVF A;  4NTC A;  1LQT A;  1SEZ A;  3BI2 A;  1GAL A;  2A87 A;  4Z2T A;  4J56 A;  1FEC A;  3FBS A;  3LJP A;  1N4W A;  2WP6 A;  2B7R A;  4E0V A;  3K7M X;  3PG6 A;  4OPD A;  2XVE A;  3FG2 P;  2DKI A;  2BC1 A;  3CNJ A;  1TDN A;  3CNT A;  2C3D A;  3GYJ A;  2C72 A;  2V60 A;  2XDO A;  2B9W A;  1O94 A;  4H4U A;  4OPT A;  2C76 A;  5TR3 A;  2GR3 A;  3H4K A;  4UDP A;  1PXC A;  1ZK7 A;  4NTD A;  4RG3 A;  2C3C A;  3OC4 A;  4NWZ A;  4AT0 A;  4YXD A;  4NNJ A;  3C96 A;  3LZX A;  3AE8 A;  1NHP A;  2C67 A;  4AT2 A;  3KKJ A;  2C70 A;  4C74 A;  4CBQ A;  3F8R A;  4NZH A;  2X50 A;  2GEW A;  2XLR A;  4UDR A;  4BJY A;  2X8H A;  5JRB A;  2X8G A;  4A6N B;  1N1P A;  3AD8 B;  2WEU A;  4Z2U A;  4Y4L A;  2GMH A;  3UTF A;  5U63 A;  1YQ4 A;  4ICY A;  2B76 A;  2OA1 A;  3EPT A;  3CGB A;  4GCM A;  3QJ4 A;  1YKJ A;  4OPL A;  3AYL A;  3UTH A;  4REK A;  3P4P A;  2FJD A;  2VQ7 A;  2BRA A;  2GQW A;  2X8C A;  4H4Q A;  5KVI A;  1E1N A;  1JRY A;  3V3O A;  1W4X A;  3T14 A;  1S3E A;  2R0C A;  1S3B A;  3NK0 X;  4B65 A;  3CGC A;  4K5S A;  3H8I A;  3SFD A;  3IF9 A;  1GTH A;  4G74 A;  4D03 A;  3ZYX A;  1F6M A;  5KRQ A;  4KX6 A;  2YR5 A;  4DSH A;  4U8L A;  3BHK A;  3R9U A;  2OAL A;  4WX1 A;  4CCR A;  4H4V A;  2X99 A;  4JN9 A;  4YSX A;  2VQB A;  3GDN A;  2A8X A;  2R9Z A;  4KPR A;  1CL0 A;  1H82 A;  1NEN A;  2XFQ A;  3G5Q A;  1GPE A;  4LU6 A;  1PHH A;  4U8P A;  3NTA A;  3JSK A;  3QFA A;  1EL9 A;  1B5Q A;  4A5L A;  2E4G A;  3G5R A;  4U8M A;  3NTD A;  2XFU A;  2BAC A;  3BHF A;  1QJD A;  1ZMD A;  3CTY A;  4D04 A;  1YQ3 A;  4AP1 A;  3RED A;  4EM3 A;  5L46 A;  2NPX A;  4RG4 A;  2YLT A;  1NG3 A;  5IQ1 A;  1QLB A;  2BS2 A;  4APN A;  2WDQ A;  4TM1 A;  1EL5 A;  2R0P A;  1NHR A;  1DOC A;  1E1M A;  2VRM A;  2GR2 A;  5LV9 A;  4LII A;  4XXG A;  2RAB A;  2V3B A;  2EQ7 A;  4C77 A;  5M0Z A;  2E1M A;  2F5Z A;  1DOD A;  3AEG A;  1DXL A;  3II4 A;  3ALJ A;  3NGC X;  1PJ6 A;  2TPR A;  1DJN A;  5M10 A;  2XFN A;  4BK3 A;  4IA6 A;  4OPI A;  4YSZ A;  1ELI A;  3L1R A;  4HA6 A;  1BWC A;  3UOZ A;  2WU2 A;  4Y4N A;  1VQW A;  4K8D A;  5HXI A;  4H2P A;  3GWF A;  1VG0 A;  1TDO A;  2GR0 A;  2EQ8 A;  5JCN A;  1NG4 A;  3UKQ A;  2OLO A;  2YLZ A;  4IVO B;  2BS3 A;  3CGD A;  1E7P A;  1NHQ A;  3FPZ A;  1EL7 A;  4XWZ A;  1Y56 B;  1ZMC A;  3FMW A;  2ZBW A;  4EQS A;  3ISH A;  3AE6 A;  4LA1 A;  2DKH A;  1PXA A;  1PDH A;  4J34 A;  2B9Y A;  3SXI A;  3CGE A;  3VRA A;  1LV0 A;  1GRA A;  4FDC B;  4H4T A;  1GRB A;  1YQZ A;  3BNM A;  4M52 A;  1H6V A;  2XCG A;  4BK1 A;  1D4E A;  2CFY A;  3P4Q A;  1L9E A;  3P9U A;  5KMR A;  4X9M A;  1H83 A;  2B9X A;  3AE4 A;  3NK1 X;  3ITJ A;  4I59 A;  2NVK X;  1L9C A;  4G6H A;  4H4P A;  2V6O A;  2BXR A;  3H8L A;  2A89 A;  2GV8 A;  1CHU A;  2JB2 A;  2Q6U A;  2R4E A;  1ZOY A;  3V76 A;  1FEB A;  3GSI A;  2GF3 A;  3F8D A;  2YM1 A;  4H4W A;  3BI5 A;  3G5S A;  4GDP A;  2WBA A;  2C75 A;  4B68 A;  4G73 A;  1JNZ A;  2XFO A;  3IHM A;  4IVM B;  2WPE A;  4AOX A;  1VG9 A;  5KMS A;  4CCQ A;  2XLU A;  1CJ4 A;  1H86 A;  1UKV G;  1CJ3 A;  2BRY A;  3GYX A;  1MOK A;  1NHS A;  2WPF A;  4EMI A;  3NN0 X;  4H50 A;  1LVL A;  4U2S A;  4A6N A;  3AE3 A;  1GRF A;  3M0O A;  3DK4 A;  3L8K A;  1ZX9 A;  3UCL A;  1TDF A;  1O5W A;  2BS4 A;  1LTX R;  4FX9 A;  2BYB A;  3LOV A;  3QSM A;  1NDA A;  4JQ9 A;  2XFP A;  3EAO A;  3KLJ A;  1OJC A;  3FIM B;  1OJT A;  4JNA A;  1Y0P A;  2R45 A;  1GTE A;  4CNK A;  1PBB A;  3AB1 A;  2BCP A;  1TDE A;  4A65 A;  4B63 A;  1IUT A;  3AE7 A;  3IC9 A;  2ZZ0 A;  3Q6J A;  3COX A;  4C3Y A;  2C66 A;  3SZF A;  2YWL A;  4TM0 A;  4EIP A;  3NIX A;  4H2N A;  2Q0L A;  3DK9 A;  1K0J A;  2C7G A;  1FL2 A;  2IVE A;  2JBV A;  3AEE A;  1JRZ A;  3M12 A;  4P9S A;  4CY6 A;  3VQR A;  5KXJ A;  3CNS A;  4H4X A;  1CC4 A;  3GYI A;  4PAA A;  3IWA A;  3UKH A;  1PBE A;  1ZOV A;  3V3N A;  5BRT A;  2WHD A;  2WQY A;  3NH3 X;  2E5V A;  1JEH A;  3VRD B;  1S7M A;  1NEK A;  4K7Z A;  1BZL A;  4OPU A;  1DOE A;  2ZZB A;  1XAN A;  2RGO A;  1JOA A;  2YVF A;  1ZP0 A;  3SM8 A;  4A99 A;  4YTN A;  3DME A;  3UOX A;  5JCK A;  2V61 A;  2WOV A;  1B8S A;  2VOU A;  3BNU A;  3DA1 A;  3UTG A;  3L5O A;  3GRT A;  3WE0 A;  3AE9 A;  2WET A;  2C73 A;  3UKL A;  1GER A;  2PYX A;  2I0Z A;  2JK6 A;  3O0H A;  1GRG A;  3RHA A;  4YSY A;  3P4R A;  1D4C A;  4IV9 A;  2Q0K A;  2CDU A;  2XYO A;  2B7S A;  4J33 A;  5EB4 A;  1K4Q A;  3NK2 X;  1EBD A;  1NAA A;  2VZ2 A;  2YVG A;  3T2K A;  3K7Q X;  4JNQ A;  3P1W A;  2WPC A;  4U8N A;  1GRH A;  2XVI A;  4B1B A;  3ATR A;  1NPX A;  2EQ9 A;  3LAD A;  4H4Z A;  1FCD A;  3AED A;  4CNJ A;  1TYP A;  5FMH A;  2YR4 A;  5ER0 A;  3UOY A;  4DNA A;  3CN8 A;  3CIR A;  5HYM A;  4B69 A;  4H4Y A;  1GOS A;  4ZCC A;  4G9K A;  5FS7 A;  2V3A A;  3UKK A;  5BVA A;  1CF3 A;  2GH5 A;  3T2Y A;  1IUV A;  1Y56 A;  3SGL A;  5KMP A;  2BC0 A;  2JKC A;  2OAM A;  1KFY A;  2X3N A;  2JAE A;  3AD9 B;  3PVC A;  4H4R A;  1GND A;  3T31 A;  3UTE A;  2QAE A;  1V59 A;  3CPI G;  4JY3 A;  4Y4M A;  2Q7V A;  4O5Q A;  1S2Q A;  2VRL A;  3PO7 A;  3GDP A;  4FK1 A;  1PBD A;  1QO8 A;  1RSG A;  4J57 A;  1KDG A;  4NEV A;  3C4N A;  3GD4 A;  4NEW A;  1L0V A;  3GMB A;  2BK3 A;  4U2T A;  1JRX A;  1PBC A;  1KNP A;  3EF6 A;  5BUK A;  1OJD A;  4TLX A;  3PS9 A;  1IUU A;  1DNC A;  1JU2 A;  2WP9 A;  4YTP A;  1BGN A;  3GRS A;  4K22 A;  2WES A;  2VVL A;  4J31 A;  5FS6 A;  3SX6 A;  4Z43 A;  4Z25 A;  3AD7 B;  4GR1 A;  2FJA A;  1GV4 A;  4OPC A;  4BK2 A;  2CUL A;  3ICT A;  3DH9 A;  4YKG A;  4B67 A;  5IQ4 A;  2YLX A;  2YG4 A;  3RP6 A;  1CBO A;  2GAH B;  2RGJ A;  2AAQ A;  4FK1 C;  1LJ1 A;  3AYI A;  4ADW A;  4A79 A;  5DBJ A;  1AOG A;  4YKF A;  5KWF A;  4YT0 A;  4GF7 A;  4MJW A;  1BGJ A;  3HYW A;  1E1L A;  3HYV A;  4OVI A;  3VR8 A;  1N4V A;  3UP5 A;  3HZL A;  5BUL A;  1KNR A;  3AEC A;  2YG5 A;  3K7T A;  1RYI A;  2VVL G;  3NRN A;  1KF6 A;  1LPF A;  2EQ6 A;  3AXB A;  1RP0 A;  4Z24 A;  2YAU A;  3SQP A;  1BF3 A;  1P2H A;  1VRQ B;  1X31 B;  4Z2R A;  1IUS A;  4EQW A;  1M6I A;  2YR6 A;  5CKU A;  3VRB A;  2BK5 A;  3ATQ A;  3C4A A;  3KPF A;  3T2Z A;  3UOV A;  3RNM A;  2H89 A;  4EMW A;  5KOW A;  1N4U A;  4X4J A;  5U1O A;  3OZ2 A;  4C5O A;  3QVR A;  3CMM A;  2VVM A;  3AE1 A;  3KA7 A;  3NYE A;  4K2X A;  3SZC A;  2WS3 A;  1IJH A;  2V5Z A;  5HY5 A;  1O95 A;  2YG7 A;  1D7L A;  2ACZ A;  5U25 A;  3NT6 A;  4EQR A;  1DJQ A;  5J60 A;  3NNE A;  5FS8 A;  2WP5 A;  5C3J A;  1OJA A;  5IPY A;  4EM4 A;  3SYI A;  3F8P A;  1F8W A;  3KVE A;  3UP4 A;  2AR8 A;  2C64 A;  2WDV A;  3AYJ A;  4AOS A;  4YSH A;  4N9X A;  3S61 A;  3UKA A;  1EL8 A;  3E1T A;  4H4S A;  2WU5 A;  3B6D A;  2GQF A;  4II3 A;  1CC6 A;  4OPG A;  4XWR A;  5C2T A;  4B64 A;  4II2 A;  2BAB A;  3KD9 A;  3DGZ A;  4UDQ A;  5EB5 A;  2FBW A;  4GDE A;  4J36 A;  5CQF A;  1H81 A;  1E6E A;  1HYU A;  4JDR A;  3D8X A;  3Q9T A;  1JNR A;  1FOH A;  1PS9 A;  2Z5Y A;  1ZY8 A;  3CPH G;  1ZDL A;  3ADA B;  3NHO X;  4ZN0 A;  4NTE A;  1GES A;  1REO A;  2R4J A;  4USQ A;  4BJZ A;  3NLC A;  2O9Z A;  4WCT A;  4X9N A;  3ICR A;  3ALL A;  4Z26 A;  4RSL A;  2QA1 A;  1TYT A;  3RP7 A;  2YQU A;  3DK8 A;  1D4D A;  1GRT A;  5KNL A;  1IUW A;  1PJ5 A;  3EAN A;  2WDR A;  5KMQ A;  3T37 A;  4GUV A;  1PJ7 A;  1F3P A;  1PN0 A;  1K0I A;  3KU9 A;  1M64 A;  4OCG A;  4H7U A;  3D1C A;  4O5U A;  2BCG G;  1CC2 A;  4U8J A;  3LZW A;  2R46 A;  4GAP A;  2R0G A;  2Y6Q A;  2J3N A;  1GT8 A;  2RGH A;  5HHF A;  1Q1W A;  3QSS A;  4K5R A;  1ONF A;  3DGH A;  4CY8 A;  3CNP A;  4H2R A;  4USR A;  2ZZC A;  1L9D A;  2WOI A;  1FEA A;  3AEB A;  4TM3 A;  3AEA A;  2YG3 A;  5JCI A;  3ABV A;  3UKP A;  3ICS A;  2IID A;  1Z6L A;  3HYX A;  3ALM A;  2Z5X A;  2FJB A;  4EQX A;  2GAG B;  4ECH A;  2YVJ A;  1H7W A;  3NYF A;  3DJE A;  5GSN A;  2BA9 A;  1F8R A;  2AQJ A;  4EIQ A;  3CPJ G;  1GEU A;  3T0K A;  4A7A A;  3NYC A;  3QFB A;  3DJJ A;  4BUR A;  4EMJ A;  4I58 A;  5JCM A;  2XVH A;  3ZDN A;  1F8S A;  1ZKQ A;  2JB1 A;  4GRT A;  4AP3 A;  2Y6R A;  3K30 A;  1B4V A;  1OJ9 A;  2YLR A;  3BI4 A;  4U2L A;  3QSE A;  2CVJ A;  5EOW A;  2PHH A;  3QVP A;  4YWO A;  3SZW A;  1XPQ A;  4YTM A;  1P2E A;  2YG6 A;  2WOW A;  4U8I A;  2IVD A;  1H7X A;  4DGK A;  1GXF A;  3IHG A;  2GR1 A;  3SZ0 A;  1TDK A;  3AWI A;  4C3X A;  1KSS A;  1VDC A;  3I3L A;  2C65 A;  2H88 A;  4TM4 A;  4H2Q A;  1MXT A;  1H2I A;  1Q9I A;  3B3R A;  2C4C A;  1CJC A;  3P4S A;  1GET A;  1GSN A;  2APG A;  1MO9 A;  3S5W A;  3M13 A;  3AE2 A;  3RP8 A;  1IUX A;  2BK4 A;  4G6G A;  4UP3 A;  1BKW A;  3AEF A;  3SFE A;  2BXS A;  2UZZ A;  4J2W A;  5J7X A;  1S2Y A;  4B66 A;  1CJ2 A;  1DOB A;  2XLT A;  2QCU A;  5JCL A;  3CND A;  3NG7 X;  5EBK A;  1KN0 A;  3LXD A;  5FS9 A;  1Q1R A;  2GB0 A;  2GMJ A;  3DJD A;  2FJE A;  4A9W A;  3KPK A;  5KVH A;  1YY5 A;  1TRB A;  3GMC A;  4ZCD A;  2GVC A;  4BV6 A;  4DSG A;  1H84 A;  1GRE A;  1COY A;  3D9X A;  4GAV A;  1B37 A;  4TLZ A;  5KOX A;  3LB8 A;  4U8K A;  2XLP A;  4IA5 A;  2HQM A;  3UKF A;  4PAB A;  2YLS A;  3I6D A;  3NKS A;  2XVJ A;  1E39 A;  2YM2 A;  1D5T A;  3DJG X;  3AE5 A;  3GWD A;  4U8O A;  3GD3 A;  4Z44 A;  4CRT A;  2QA2 A;  2GRT A;  2YLW A;  5GRT A;  1K0L A;  2TMD A;  3NN6 X;  1XDI A;  1KSU A;  2JB3 A;  1D7Y A;  1PBF A;  2OLN A;  1LQU A;  4HB9 A;  1E1K A;  1PXB A;  3VR9 A;  3SY4 A;  2W0H A;  2XLS A;  3URH A;  2ARD A;  4JY2 A;  1XHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...