5FS7A

Crystal structure of the g262s mutant of human apoptosis inducing factor
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
487
structure length
449
Chain Sequence
DKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGSTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure/Function Relations in Aifm1 Variants Associated with Neurodegenerative Disorders.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
total genus 149
structure length 449
sequence length 487
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fs7A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs7A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs7A01
1TDOA 1PBFA 4Y4LA 4AOSA 2R45A 5FS8A 4H4VA 4CNJA 1LPFA 3P1WA 3IC9A 1D7LA 2YG6A 1ELIA 3NN0X 4A79A 2BS4A 3FPZA 2OAMA 3UKAA 4YSHA 3BHKA 3P4SA 3DGHA 5FS6A 2HQMA 4K2XA 1O5WA 1XANA 2V3AA 3DJDA 2YLSA 3RP7A 1D4DA 2PYXA 1GREA 4JDRA 2WP6A 2DKHA 2OA1A 3NRNA 5KRQA 5L46A 1GEUA 3P4RA 2QAEA 3DGZA 1EL5A 4LA1A 2A8XA 2BA9A 3EPTA 4U2SA 1JNRA 3QVRA 3LZWA 1CF3A 1Y56A 1GV4A 4IVMB 2V6OA 5LV9A 4OCGA 4JY3A 4U8OA 3SM8A 1GT8A 1ZK7A 2WHDA 3PVCA 4U8JA 5J60A 4C3YA 4YTNA 1RSGA 5KXJA 2UZZA 2E1MA 1KDGA 3F8PA 5BVAA 2H88A 4FK1C 1LJ1A 4IA6A 4Z44A 2B7RA 1H83A 4EIQA 1YY5A 2XYOA 1EL8A 1GTHA 2IIDA 1GRGA 4H4RA 1RP0A 3AEAA 4PABA 2FJDA 1DNCA 1PXCA 5BUKA 3VRAA 3IWAA 3NT6A 1FECA 1FEAA 3DJJA 1D5TA 4IA5A 1B37A 2E4GA 2GAHB 1CJ2A 2WOWA 2ZZBA 2BS3A 2VVLA 5TR3A 1TYPA 2CDUA 1LQUA 3CNSA 3CPHG 4BJYA 1KSUA 5CQFA 2FJEA 1E6EA 3NH3X 5HY5A 1PN0A 1H6VA 2EQ7A 2YAUA 5KVHA 1TDNA 3F8RA 2BYBA 3PS9A 4RG4A 3NYEA 1QJDA 2Q6UA 4A99A 4K7ZA 2YR5A 1S2YA 1ZOYA 5EBKA 5CKUA 5BULA 5FS9A 1K4QA 1JU2A 2V3BA 1GNDA 4A6NA 2BC1A 4Z43A 3VRBA 4C5OA 3BHFA 1TYTA 4OPIA 3QFBA 1BGJA 1CL0A 2WDQA 3UP5A 4DSHA 2VQBA 1GRTA 4UP3A 3AECA 5GRTA 2XLRA 3CPJG 3AE9A 3GD3A 4K8DA 1IJHA 4EM4A 4AP3A 1OJDA 3M13A 1N4WA 4TM3A 3AB1A 4H2PA 1GETA 3BNMA 1IUSA 1P2HA 3GMBA 1CJ3A 3CIRA 2R0GA 1JNZA 1DOCA 1X31B 4EMJA 1UKVG 3I6DA 2Z5YA 1F8RA 3UTFA 4EQXA 5HYMA 1NDAA 2Y6QA 3UP4A 4D03A 3L1RA 2GV8A 2PHHA 4BK2A 1YQ3A 1S3BA 2BS2A 1H82A 3VQRA 4YSYA 1E1KA 3C4NA 4EQWA 1CC4A 1DJNA 1NAAA 4HA6A 1DODA 1GRHA 1TDEA 2ARDA 3K7MX 3M0OA 3UKKA 3V3NA 5KOWA 3QFAA 3AE1A 4X9NA 4WCTA 3K7TA 4TLZA 4D04A 1BZLA 4A9WA 2YM2A 3UOZA 4TM1A 3SFDA 3LADA 2TMDA 3IHMA 4OPDA 2Q7VA 2QCUA 2WPEA 1ONFA 1CHUA 1YQZA 1RYIA 1SEZA 4WX1A 4ZCDA 4MJWA 4O5QA 5EOWA 1IUVA 4Y4MA 4ADWA 4M52A 2Q0KA 4K5SA 4LIIA 2WETA 1EBDA 2XVJA 2JAEA 3AE2A 1EL9A 3URHA 1PBBA 2JB2A 2OALA 1GRBA 3AE4A 4TLXA 4A65A 2B9YA 2WS3A 2YG3A 3RP6A 3EF6A 1PHHA 3UOXA 4RSLA 4YTPA 5JCLA 4AT0A 1OJAA 3UKPA 3K7QX 4AOXA 2BCGG 4EQRA 3FG2P 5FMHA 2BK4A 3BI4A 4YXDA 1KF6A 2GQFA 4USRA 2V5ZA 2GQWA 4C74A 3RHAA 4Z2TA 1K0LA 3D1CA 2AAQA 3GDPA 3HZLA 2EQ9A 3SGLA 2XDOA 3M12A 4J36A 4U8LA 2TPRA 4P9SA 2VZ2A 4B66A 2FBWA 3AE7A 1PJ7A 4PAAA 1LVLA 1PJ6A 3AWIA 4NZHA 5JCMA 2APGA 4GCMA 2O9ZA 1VRQB 4JY2A 1PDHA 5IQ1A 3AYJA 4K5RA 2W0HA 3UKHA 4X4JA 2JB3A 3H4KA 3DK9A 1Y56B 4NTCA 1L9EA 1PBDA 4CCQA 2ZBWA 2X8CA 4HB9A 5M0ZA 1IUWA 1JEHA 2WP9A 1E1LA 3CTYA 1CJCA 4H4ZA 4BV6A 3D8XA 3AE5A 4IV9A 2YVJA 3DJGX 1GERA 3SFEA 5KWFA 1GESA 4GUVA 2C7GA 1NHPA 2YR6A 3REDA 4CRTA 1O95A 1GPEA 1L0VA 2ZZCA 3BNUA 3FIMB 3UTEA 4H7UA 4Z24A 3ATQA 2GH5A 1BF3A 3GSIA 2YQUA 1E7PA 2YVFA 4B1BA 1E1MA 2WU2A 3H8LA 3LZXA 4B69A 4OPGA 1LV0A 4H4YA 1MO9A 4YKGA 4EM3A 1HYUA 1KFYA 3AEGA 5HXIA 2C67A 1Y0PA 4X9MA 3UCLA 2GAGB 4BK3A 1ZX9A 3CNTA 2XFPA 4H2RA 4XXGA 1F6MA 2R4EA 4B64A 3CGEA 4K22A 4J57A 3KPFA 2JK6A 3DK8A 2C72A 3K30A 2X99A 2WDRA 3AE6A 2J3NA 2B7SA 4FDCB 3DMEA 4YSXA 4BURA 1DXLA 1NPXA 2WP5A 1F3PA 3G5SA 3BI5A 1ZOVA 2BXRA 4AT2A 2JKCA 1NENA 4ECHA 2QA1A 3DJEA 3KKJA 5IPYA 3IHGA 1BKWA 2WOIA 2RGHA 5C3JA 2XVHA 2XVEA 3AD9B 2YG7A 4OPTA 1COYA 2WESA 3CGCA 4CCRA 3CN8A 4APNA 4FK1A 2GRTA 4JN9A 1O94A 1XDIA 2A87A 2NVKX 4U8PA 1NHRA 2YLTA 4U8KA 2GVCA 3R9UA 3NK2X 4U2TA 1DOBA 3ISHA 3UKLA 2VQ7A 3KU9A 1XHCA 3AE3A 2XVFA 4A5LA 3GRSA 1VG0A 2OLNA 4U2LA 3GMCA 3QSSA 4NTEA 3S5WA 4Z25A 5C2TA 3F8DA 3LOVA 3UTHA 1IUTA 3KVEA 3O0HA 3EAOA 2C70A 2FJAA 3FBSA 2C3DA 3AEDA 2JB1A 2X8GA 1YKJA 2Z5XA 1ZP0A 1S2QA 3QSEA 1PJ5A 3VR9A 1EL7A 2X3NA 3BI2A 3QSMA 1N1PA 4ICYA 3NNEA 4GDEA 4UDQA 4XWRA 4Z2RA 1QO8A 3AEEA 2VVLG 2XLTA 2XFUA 2EQ8A 2WU5A 5ER0A 2XVIA 3NLCA 2YR4A 5GSNA 3I3LA 1PBCA 2YLXA 4O5UA 3ALLA 1GSNA 5HHFA 3V76A 1K0JA 5U63A 3UKQA 1KSSA 1ZMDA 3AE8A 3FMWA 2XLUA 3AXBA 4TM4A 1MXTA 1V59A 4YKFA 3EANA 4NTDA 3AD7B 2YG5A 1NG4A 2YLRA 3GWFA 2BC0A 2XLSA 3NTDA 4BK1A 2RABA 4YSZA 3NGCX 1PXBA 1H7XA 2C75A 1B4VA 2VOUA 3CNPA 5JCNA 2R46A 4RG3A 3V3OA 1JRZA 5FS7A 1LQTA 2C73A 4U8IA 2BK3A 2V60A 3NYCA 2B9XA 3PO7A 2GR0A 1TRBA 3COXA 3ITJA 4OVIA 4USQA 5JCIA 1GALA 2R0PA 1H7WA 5KOXA 2X8HA 3P4PA 3CPIG 4I58A 4H4PA 3Q6JA 4H4WA 3G5RA 3B6DA 3II4A 4OPCA 1PBEA 2C3CA 2WPFA 1CC6A 3KLJA 1F8SA 3ALMA 3VR8A 5BRTA 1LTXR 1DOEA 4H50A 1CJ4A 4EMWA 3UOVA 1E1NA 1H84A 3DA1A 4DSGA 3NTAA 3CNDA 3AD8B 4CNKA 4N9XA 1FOHA 1FL2A 2RGJA 2WBAA 5EB4A 4GRTA 2BCPA 1KNPA 2XCGA 3UKFA 4YWOA 3NYFA 2GR3A 2VVMA 2XFQA 3ZYXA 4BJZA 1GRAA 4J56A 1E39A 4CBQA 4ZN0A 4U8MA 3GWDA 4JNAA 1OJ9A 2Q0LA 2V61A 2GB0A 1JRYA 3ATRA 2WOVA 2NPXA 4A6NB 4E0VA 4FX9A 3AEBA 2AR8A 1IUXA 1ZY8A 4YT0A 1VDCA 2YLWA 5U25A 1D4CA 4GF7A 3OC4A 4REKA 4B63A 1ZMCA 2CVJA 1PS9A 1VG9A 1XPQA 2C76A 4J34A 2BK5A 3DK4A 4DNAA 2ACZA 2E5VA 5IQ4A 1NG3A 3KD9A 1F8WA 1S3EA 4AP1A 1KNRA 2GR2A 2XLPA 3IF9A 3GRTA 4XWZA 2FJBA 4NEVA 2GEWA 1DJQA 2JBVA 2IVDA 2AQJA 3ICTA 3NG7X 2R4JA 1NHQA 3VRDB 2C64A 3L8KA 1JRXA 3CNJA 2CULA 4B65A 1BWCA 3OZ2A 4H4SA 2C65A 1Q1RA 5KVIA 3QVPA 5DBJA 2A89A 3RNMA 2VRLA 3AYLA 2XFNA 2YG4A 3H8IA 1GOSA 3T37A 4LU6A 4EQSA 1JOAA 2OLOA 4Y4NA 3NKSA 2DKIA 4CY6A 1FCDA 2BACA 3C96A 3P9UA 4UDPA 1TDFA 2GMHA 2ZZ0A 1P2EA 4IVOB 3ADAB 1B8SA 1L9DA 3ALJA 4UDRA 1GRFA 3GD4A 5U1OA 1Q9IA 2GMJA 2XFOA 2Y6RA 3C4AA 3DH9A 1H81A 1NEKA 3GYJA 3CGDA 1VQWA 3QJ4A 4I59A 1PXAA 2C66A 2WEUA 2BABA 4J2WA 1ZKQA 2CFYA 1B5QA 2WQYA 3LB8A 4H2QA 3AYIA 4C77A 1AOGA 4OPLA 2YVGA 1YQ4A 1BGNA 2IVEA 4GDPA 2BXSA 4J33A 4OPUA 1OJTA 1OJCA 4KX6A 4EIPA 3LXDA 1D4EA 3B3RA 2WPCA 4JNQA 1CBOA 3UOYA 1FEBA 2B76A 5J7XA 2GR1A 4NEWA 2R0CA 1TDKA 2YWLA 1IUUA 1REOA 1H86A 4YTMA 3ABVA 4Z26A 2F5ZA 3KA7A 4GR1A 3E1TA 3Q9TA 1W4XA 1ZDLA 3G5QA 3NHOX 5M10A 4H4UA 2QA2A 3RP8A 1M64A 3UTGA 1NHSA 2R9ZA 3CGBA 4EMIA 1GXFA 3GDNA 1QLBA 2YM1A 3NK0X 2X50A 3NN6X 2YLZA 4H4XA 1GTEA 2WDVA 1L9CA 4KPRA 2H89A 2VRMA 4B68A 4DGKA 1D7YA 1N4UA 4J31A 1Z6LA 3ICRA 3S61A 3JSKA 3LJPA 2EQ6A 2I0ZA 1MOKA 4H4TA 3P4QA 4A7AA 4H4QA 1Q1WA 5EB5A 3ICSA 1N4VA 4ZCCA 1K0IA 4TM0A 3GYIA 3NK1X 3WE0A 3NIXA 4C3XA 4Z2UA 2GF3A 4U8NA 3ZDNA 4CY8A 3AEFA 3SQPA 5JCKA 2RGOA 4H2NA 1M6IA 4B67A 4JQ9A 2B9WA 1CC2A
chains in the Genus database with same CATH superfamily
3NXLA 3FVDA 3ETRB 1D7LA 3VCNA 3FPZA 3UKAA 4YSHA 1WUFA 4K2XA 2V3AA 3RITA 2AL1A 4H19A 1GREA 4NWZA 4EWJA 2OVLA 2A8XA 4IT1A 2BA9A 3RO6A 4U2SA 3LZWA 1Y56A 4OCGA 3PVCA 4U8JA 5BVAA 4FK1C 1LJ1A 3HYXA 2B7RA 4Z44A 2XYOA 3AEAA 2FJDA 3VRAA 3GD6A 1FEAA 4IA5A 2GAHB 2WOWA 1TYPA 2CDUA 1EBHA 1RM6B 3B97A 3NH3X 1E6EA 5HY5A 1H6VA 2YAUA 3F8RA 3TQPA 1QJDA 2FKPA 4A99A 4K7ZA 2YR5A 1S2YA 1ZOYA 5EBKA 5CKUA 5BULA 1K4QA 1GNDA 4C5OA 4OPIA 3K1GA 3AECA 4DWDA 4EM4A 4AP3A 3AB1A 4HN8A 3BNMA 1IUSA 3GMBA 3CIRA 4EQXA 1NDAA 2Y6QA 3MUCA 2GV8A 4BK2A 1YQ3A 4YSYA 2BS2A 1E1KA 3VC6A 1DJNA 4HA6A 3V3NA 5KOWA 3QFAA 4A9WA 3A7UA 3SFDA 3LADA 3IHMA 3OW1A 1N60C 1CHUA 1YQZA 1RYIA 4WX1A 3OZYA 3IJIA 4MJWA 3QTPA 4O5QA 4Y4MA 4K5SA 2QDDA 1EBDA 3AE2A 2JAEA 3IJLA 1PBBA 4TLXA 3GC2A 5JCLA 3UKPA 3K7QX 3FG2P 5J04A 2GL5A 2V5ZA 3RHAA 2DW6A 3UGVA 1BQGA 3SGLA 4J36A 4B66A 2VZ2A 1FO4A 2FBWA 3AE7A 2APGA 4JY2A 1VRQB 2OLAA 5IQ1A 2NQLA 3NZGA 3DK9A 4NTCA 2XH2A 4HCDA 4GISA 1JEHA 1E1LA 3TW9A 4BV6A 3D8XA 3D9XA 2YVJA 1GESA 3DGBA 3REDA 3H7VA 1O95A 1GPEA 3EKGA 4H7UA 4Z24A 3UCDA 2WU2A 3H8LA 3LZXA 1LV0A 1HYUA 3UCLA 4BK3A 3Q45A 2R4EA 2OFJA 4G8TA 1X2GA 3AE6A 3CAWA 1S7MA 3G5SA 2BXRA 2PA6A 3P0WA 4ECHA 3KKJA 2XH0A 3IHGA 2GGIA 1BKWA 2XVHA 4IP4A 4OPTA 1COYA 3CGCA 4CCRA 2W3SA 3CN8A 4JN9A 4U8PA 1NHRA 4U8KA 4U2TA 3UKLA 3KU9A 3D47A 1XHCA 1VG0A 3MWCA 3GMCA 3QSSA 4NTEA 4Z25A 3CMMA 2BRYA 3F8DA 3LOVA 1R0MA 2C3DA 3AEDA 2X8GA 1YKJA 1S2QA 2QDEA 4XWRA 3NNEA 3ZVIA 4Z2RA 1QO8A 2VVLG 1KKOA 2YR4A 2YLXA 2GGGA 1KN0A 2I5QA 1KSSA 1ZMDA 3AE8A 1MXTA 1V59A 2CHRA 1NG4A 2YLRA 3GWFA 3NTDA 1V97A 4BK1A 1EC9A 4RG3A 5FJUA 3UXKA 3NYCA 2B9XA 3PO7A 3COXA 5JCIA 2R0PA 3N4EA 2PS2A 3Q6JA 4OPCA 5BRTA 3OP2A 1F8SA 4G73A 4DSGA 3NTAA 3AD8B 2WBAA 3BSMA 2XFQA 3RGTA 4BJZA 4J56A 4ZN0A 4U8MA 2Q0LA 3ATRA 3HYVA 2WOVA 3N4FA 4E0VA 3SYIA 2AR8A 4MMWA 4YT0A 4GF7A 3OC4A 3P93A 1VG9A 2ACZA 1S3EA 1KNRA 2GR2A 2GEWA 2IVDA 3OZMA 2R4JA 3NVYB 3L8KA 1JRXA 3CNJA 3EEZA 1BWCA 3OZ2A 2E5AA 5FJOA 5KVIA 2A89A 3RNMA 3H8IA 2XFNA 2YG4A 5KNLA 4LU6A 1KKRA 3MZNA 2BACA 3C96A 4UDPA 3P9UA 1SJDA 1P2EA 4E5TA 3R25A 1L9DA 2P0IA 2Y6RA 3TJ4A 5BOEA 2PP1A 1N5XA 2OPJA 3AYIA 4C77A 1AOGA 1BGNA 4GDPA 4OPUA 2WPCA 3H12A 3UOYA 4IHCA 2GR1A 3N6JA 3AMZA 1IUUA 2AL2B 3FYYA 4YTMA 3TTEA 1W4XA 2QA2A 3RP8A 2PTWA 1QLBA 2X50A 4ROPA 4H4XA 2WDVA 2H89A 3LJPA 3CT2A 2PU0A 5IDZA 5EB5A 4ZCCA 1JCTA 2ONEA 3NK1X 4U8NA 3AEFA 2POZA 3QLDA 1TDOA 4CNJA 3IC9A 4A79A 3THUA 1OEPA 2OAMA 3BHKA 3DGHA 5FS6A 2HQMA 1XANA 1D4DA 2WP6A 3NRNA 1GEUA 3P4RA 1EL5A 4G9KA 3EPTA 1JNRA 1TE6A 1GV4A 2V6OA 5LV9A 1ZK7A 2WHDA 3AN1A 5J60A 4KT2A 4JN7A 1RSGA 2UZZA 3F8PA 3PG6A 4IA6A 1YY5A 2IIDA 1GRGA 4H4RA 1RP0A 1PDYA 1PXCA 2OZ3A 4H1ZA 3IWAA 3NT6A 1FECA 3T8QA 4BJYA 3V5CA 1KSUA 1PN0A 2BYBA 3PS9A 2V3BA 4A6NA 3VRBA 1CL0A 4UP3A 3V4BA 2XLRA 4HCLA 3NS1B 1N4WA 3JVAA 4H2PA 1GETA 3T4WA 1DOCA 3SN1A 1SJAA 3UTFA 4A6GA 3UCCA 4EQWA 1CC4A 3CK5A 1NAAA 1TDEA 3M0OA 4WCTA 4D04A 2YM2A 2TMDA 3R07C 2Q7VA 4K8GA 4DYEA 1SEZA 5EOWA 1IUVA 2Q0KA 4LIIA 2WETA 3TCSA 1EL9A 3PFRA 3URHA 3QN3A 2YG3A 4YTPA 3L5OA 3RRAA 2BCGG 4EQRA 5FMHA 2BK4A 3BI4A 4C74A 4Z2TA 1K0LA 2AAQA 2EQ9A 2GSHA 4P9SA 1PJ7A 4PAAA 1LVLA 1PJ6A 3AYJA 4IL0A 2JB3A 3H4KA 1PBDA 1WYGA 3CTYA 3UJSA 4CRTA 2YR6A 3BNUA 3FIMB 3GYXA 3ATQA 2YQUA 1P48A 1E7PA 5FJTA 3CNTA 2XFPA 3SY4A 1F6MA 4J57A 3KPFA 3SSZA 2C72A 1JDFA 2J3NA 4FDCB 2WP5A 3NVZB 1F3PA 4MGGA 3BI5A 2JKCA 5EU9A 1NENA 2QA1A 2XVEA 3AD9B 2AL2A 4FK1A 7ENLA 2W55A 2GVCA 3R9UA 3N6HA 3DG6A 2XVFA 3GRSA 4ZCWA 2OLNA 1ONEA 4U2LA 3S5WA 3BOXA 4GFIA 3KVEA 3EAOA 2FJAA 3FBSA 3QSEA 1PJ5A 3VR9A 4UDQA 2X3NA 3AEEA 2XLTA 2EQ8A 1WUEA 4O5UA 1PBCA 3ALLA 1GSNA 3ZVHA 1K0JA 4TM4A 2O56A 4YKFA 3AD7B 2YG5A 4DX3A 3NGCX 2C75A 4JN8A 1JRZA 2C73A 3SZCA 3ITJA 4OVIA 4USQA 1H7WA 3FJ4A 2PGEA 3G5RA 2XGZA 3B6DA 3II4A 1PBEA 2C3CA 3VR8A 3SQSA 4EMWA 3UOVA 3U4FA 3VFCA 1JPMA 3T2KA 3MKCA 4CNKA 1FL2A 3UKFA 4GRTA 2BCPA 2QVHA 3SR6B 4YWOA 3R0KA 3ZYXA 1GRAA 4CBQA 3GWDA 2V61A 1JRYA 1NU5A 2QQ6A 1T3QC 1VDCA 5U25A 3ZVHB 1D4CA 4B63A 1ZMCA 1JROA 2ZADA 3DK4A 2PMQA 2OX4A 4AP1A 3IF9A 2XLPA 3GRTA 4XWZA 1DJQA 2JBVA 3ICTA 2HXUA 4IZGA 4II3A 1NHQA 4K1WA 1Q1RA 2PP3A 3AYLA 3H70A 2OLOA 3T0KA 1ECQA 3TWAA 1FFUC 1TDFA 2GMHA 2ZZ0A 3R1ZA 4UDRA 2GMJA 5U1OA 2XFOA 4Z1YA 1NEKA 1VQWA 1PXAA 2BABA 4J2WA 2WQYA 3LB8A 4H2QA 2YVGA 2IVEA 4J33A 1OJCA 4KX6A 3ZLGA 5J7XA 4NEWA 1TDKA 3TJIA 4HYRA 2GGEA 3SX6A 4GR1A 3E1TA 3G5QA 2XH7A 5M10A 4H4UA 3T6CA 4KWSA 2R9ZA 3CGBA 2OZ8A 3B9JB 1L9CA 4B68A 2VRMA 4X2PA 4GYPA 4H4TA 2PTXA 4H4QA 4KEMA 4HPNA 1XS2A 4K2SA 3WE0A 3MSYA 3NIXA 4C3XA 2MUCA 4H2NA 1M6IA 4JQ9A 4FI4A 1MRAA 3HW2A 1MNSA 1PBFA 4Y4LA 5FS8A 4H4VA 4TVYA 3P1WA 3P4SA 3RP7A 2PYXA 2OA1A 3I4KA 3CXOA 4A35A 3RCYA 2QJJA 1VQZA 3QVRA 4HNCA 1CF3A 4IVMB 3DEQA 4U8OA 5FJRA 4YTNA 5KXJA 3A7AA 2E1MA 1KDGA 1H83A 4EIQA 1EL8A 1GTHA 4JHMA 1PDZA 1DNCA 5KMPA 3DJJA 1W6TA 1D5TA 3ENLA 1B37A 2E4GA 2PSNA 2DW7A 3HPFA 2VVLA 1FFVC 5TR3A 1LQUA 2FJEA 2EQ7A 2HXTA 3VA8A 1BKHA 2Q6UA 4FP1A 4E4FA 5FS9A 1JU2A 1EC7A 4M6UA 4DSHA 3QFBA 1BGJA 3UP5A 2VQBA 1GRTA 1IYXA 3CPJG 5GRTA 3GD3A 4K8DA 1IJHA 5JRBA 1P2HA 1CJ3A 2R0GA 3CB3A 2MNRA 1X31B 1VDVA 2Z5YA 3UJ2A 5HYMA 3UP4A 4D03A 3L1RA 2PHHA 1S3BA 1H82A 3C4NA 1GRHA 3UKKA 3K7TA 4TLZA 1BZLA 3UOZA 4TM1A 4OPDA 1ONFA 4ZCDA 2E3TA 4ADWA 1EBGA 2OALA 3ZLFA 2GGJA 3MY9A 1PHHA 4AT0A 1OJAA 4GGHA 4YXDA 1KF6A 3V3WA 4J1OA 3D1CA 3GDPA 3HZLA 2XDOA 3M12A 4U8LA 2TPRA 3UJEA 3AWIA 2O9ZA 1PDHA 2W0HA 1Y56B 1L9EA 4CCQA 2ZBWA 5M0ZA 1IUWA 2WP9A 3AE5A 3DJGX 1GERA 5KWFA 2C7GA 1KCZA 3UTEA 4B1BA 1E1MA 1MO9A 3AEGA 5HXIA 1Y0PA 4X9MA 2GAGB 3A7RA 1FHUA 3ES7A 2W54A 4B64A 3CGEA 3AM9A 4K22A 4G6GA 4Z17A 3DMEA 4YSXA 4BURA 1NPXA 1DXLA 1ZOVA 3BJSA 3DJEA 5IPYA 2RGHA 2YG7A 4TVWA 4APNA 2GRTA 1XDIA 2NVKX 2YLTA 3NK2X 3ISHA 3MQTA 2VQ7A 2P3ZA 2GDQA 3SZ0A 3AE3A 2P8CA 3NFUA 1X2HA 2C70A 2JB1A 1ZP0A 3VDGA 4H2HA 1EL7A 3QSMA 2WU5A 5ER0A 6ENLA 3I3LA 5KMRA 5HHFA 3V76A 5U63A 1R6WA 3KUMA 3FMWA 2XLUA 3AXBA 3EANA 2QGYA 2OZTA 2BC0A 2XLSA 2RABA 4YSZA 1PXBA 1H7XA 2VOUA 1B4VA 5JCNA 2R46A 5FS7A 2GR0A 1GALA 5KOXA 2X8HA 3CPIG 2RDXA 4H4WA 1FHVA 2WPFA 1LTXR 4GMEA 2HZGA 1E1NA 1H84A 3DA1A 3HRDC 2P8BA 1FOHA 2XCGA 3NYFA 2VVMA 3ES8A 3OTRA 4A6NB 3FV9A 4FX9A 3R11A 2YLWA 3PK7A 4REKA 2CVJA 1XPQA 4DNAA 1NG3A 3KD9A 2XH4A 3I6EA 4NEVA 1TKKA 4HNLA 2AQJA 4M0XA 3NG7X 3I6TA 3VRDB 2C64A 4KPLA 4B65A 4H4SA 4G74A 3QVPA 2VRLA 4EQSA 1JOAA 4CY6A 1JPDX 3NVWB 4IVOB 1SJCA 1B8SA 4E8GA 1GRFA 1Q9IA 2C4CA 3DH9A 3CGDA 3DIPA 4I59A 3QJ4A 2C66A 2WEUA 3EUB3 4OPLA 2BXSA 1OJTA 5KMQA 4EIPA 3DERA 3SXIA 1CBOA 1FEBA 2B76A 3SZFA 1H86A 3ABVA 2F5ZA 3DG3A 2HNEA 1M64A 3UTGA 4EMIA 1GXFA 2YM1A 3NN6X 1GTEA 4DGKA 1KD0A 2I0ZA 1MOKA 3P4QA 4A7AA 1Q1WA 3ICSA 1N62C 4TM0A 3GYIA 2GF3A 3ZDNA 4CY8A 5JCKA 4GYPC 4B67A 4F4RA 2B9WA 3FXGA 3GY1A 2OKTA 4AOSA 2R45A 1LPFA 4DN1A 3T2YA 2YG6A 1ELIA 3NN0X 3GO2A 4GIRA 4DHGA 2BS4A 3R0UA 1O5WA 3DJDA 2PU1A 2YLSA 4JDRA 5L46A 1N61C 3PWIA 2DKHA 5KRQA 4A3RA 2QAEA 1MUCA 3DGZA 4LA1A 3UJRA 2QJMA 4ENLA 4JY3A 3SM8A 1GT8A 1P43A 4G7FA 4C3YA 1L8PA 2H88A 1MDLA 4HCHA 3T14A 4PABA 3DDMA 3RR1A 5BUKA 1CJ2A 2ZZBA 2BS3A 3CPHG 3CNSA 5CQFA 3CYJA 1ZXIC 5KVHA 1TDNA 3VCCA 4RG4A 3NYEA 1SB3B 1F9CA 4GGBA 2BC1A 4Z43A 1N5WC 3BHFA 1TYTA 2WDQA 3S5SA 3AE9A 1OJDA 3M13A 4TM3A 4NNJA 1JNZA 4EMJA 1UKVG 3I6DA 1F8RA 4IP5A 1MDRA 3VQRA 1DODA 2ARDA 3K7MX 3AE1A 4X9NA 4H83A 3NO1A 2QCUA 2WPEA 2XSXA 3DFYA 3TOYA 4M52A 5KMSA 2XVJA 2JB2A 4A65A 1GRBA 3QKEA 3AE4A 2B9YA 2WS3A 3RP6A 3EF6A 3UOXA 4RSLA 2AKMA 4AOXA 2GQFA 4USRA 2GQWA 3DESA 1NELA 3VC5A 4NZHA 5JCMA 4GCMA 3V5FA 4K5RA 2PODA 3UKHA 4X4JA 2X8CA 4HB9A 3H8AA 1CJCA 4H4ZA 1RVKA 3IK4A 4IV9A 3SFEA 4GUVA 1EC8A 1NHPA 2OQYA 1L0VA 2OO6A 2ZZCA 1E9IA 2GH5A 1BF3A 3GSIA 2YVFA 4B69A 3S47A 4OPGA 4H4YA 4YKGA 4EM3A 1KFYA 2C67A 3SJNA 1ZX9A 4H2RA 4XXGA 2AKZA 2JK6A 3DK8A 3IJQA 3K30A 2X99A 2WDRA 2B7SA 2PPGA 4AT2A 2WOIA 5C3JA 2OQHA 2WESA 1O94A 2A87A 1DOBA 2ZC8A 4A5LA 5G5HB 4DXKA 5C2TA 3UXLA 3UTHA 1IUTA 3O0HA 1N63C 3DFHA 2W3RA 2Z5XA 3NVVB 4G6HA 3BI2A 4ICYA 1N1PA 4GDEA 2PTZA 2XFUA 2XVIA 3NLCA 3Q4DA 5GSNA 4J3ZA 3UKQA 4NTDA 3ZLHA 2P88A 3JW7A 3STPA 3CNPA 3V3OA 1LQTA 1XPYA 4GAVA 4U8IA 2BK3A 1YEYA 2V60A 1TRBA 3KPKA 4YWSA 1DTNA 1STZA 3P4PA 3DG7A 4I58A 4H4PA 3OPSA 2QJNA 1TZZA 1CC6A 3ALMA 3KLJA 3HYWA 1DOEA 4H50A 5FJPA 1CJ4A 3SZWA 3CNDA 4N9XA 2RGJA 5EB4A 1KNPA 2GR3A 3P3BA 1E39A 4JNAA 1OJ9A 2GB0A 2NPXA 3AEBA 1IUXA 2PP0A 1ZY8A 2FYMA 3JZUA 3T9PA 1PS9A 2C76A 4J34A 2BK5A 5IQ4A 2E5VA 4GAPA 1F8WA 1JRPA 4IL2A 2FJBA 2PTYA 3FCPA 3SN4A 3TWBA 2CULA 3T2ZA 2C65A 3NRZB 5DBJA 5BOFA 1GOSA 3T37A 4E4UA 4Y4NA 3CXBA 3NKSA 2DKIA 5ENLA 1FCDA 3SBFA 4II2A 3ADAB 2GGHA 4E6MA 3ALJA 3GD4A 4MKSA 3C4AA 1H81A 3GYJA 3UJFA 2PGWA 1ZKQA 2CFYA 1B5QA 3PWGA 1YQ4A 2PCEA 4JNQA 3LXDA 1D4EA 3B3RA 2R0CA 2YWLA 1REOA 4Z26A 3KA7A 3Q9TA 3SN0A 3NHOX 1ZDLA 3QPEA 1NHSA 5G5GB 3GDNA 3NK0X 2YLZA 1ELSA 3T31A 1SJBA 4KPRA 1D7YA 1N4UA 4J31A 1Z6LA 3ICRA 3S61A 3JSKA 1H2IA 2EQ6A 3D46A 4ZOHB 4ZA0A 2BRAA 1N4VA 2OG9A 1K0IA 4Z2UA 3R10A 1FIQB 3SQPA 3U9IA 2RGOA 1CC2A
chains in the Genus database with same CATH topology
1TDOA 1PBFA 4Y4LA 4AOSA 2R45A 5FS8A 4H4VA 4CNJA 1LPFA 3T2YA 3P1WA 3IC9A 1D7LA 2YG6A 1ELIA 3NN0X 4A79A 2BS4A 3FPZA 2OAMA 3UKAA 4YSHA 3BHKA 3P4SA 3DGHA 5FS6A 2HQMA 4K2XA 2V3AA 1XANA 1O5WA 3DJDA 2YLSA 3RP7A 1D4DA 2PYXA 1GREA 4JDRA 2WP6A 2DKHA 2OA1A 3NRNA 5KRQA 5L46A 4NWZA 1GEUA 3P4RA 2QAEA 3DGZA 1EL5A 4LA1A 2A8XA 2BA9A 4G9KA 3EPTA 4U2SA 1JNRA 3QVRA 3LZWA 1CF3A 1Y56A 1GV4A 4IVMB 2V6OA 5LV9A 4OCGA 4JY3A 4U8OA 3SM8A 1GT8A 1ZK7A 2WHDA 3PVCA 4U8JA 5J60A 4C3YA 4YTNA 1RSGA 5KXJA 2UZZA 2E1MA 1KDGA 3F8PA 5BVAA 3PG6A 2H88A 4FK1C 1LJ1A 4IA6A 3HYXA 2B7RA 1H83A 4Z44A 3T14A 4EIQA 1YY5A 2XYOA 1EL8A 1GTHA 2IIDA 1GRGA 4H4RA 1RP0A 3AEAA 4PABA 2FJDA 1DNCA 1PXCA 5BUKA 3VRAA 5KMPA 3IWAA 3NT6A 1FECA 1FEAA 3DJJA 1D5TA 4IA5A 1B37A 2E4GA 2GAHB 1CJ2A 2WOWA 2ZZBA 2BS3A 2VVLA 5TR3A 1TYPA 2CDUA 1LQUA 3CNSA 3CPHG 4BJYA 1KSUA 5CQFA 2FJEA 1E6EA 3NH3X 5HY5A 1PN0A 1H6VA 2EQ7A 2YAUA 5KVHA 1TDNA 3F8RA 2BYBA 3PS9A 4RG4A 3NYEA 1QJDA 2Q6UA 4A99A 4K7ZA 2YR5A 1S2YA 1ZOYA 5EBKA 5CKUA 5BULA 5FS9A 1K4QA 1JU2A 2V3BA 1GNDA 4A6NA 2BC1A 4Z43A 3VRBA 4C5OA 3BHFA 1TYTA 4OPIA 3QFBA 1BGJA 1CL0A 2WDQA 3UP5A 4DSHA 2VQBA 1GRTA 4UP3A 3AECA 5GRTA 2XLRA 3CPJG 3AE9A 3GD3A 4K8DA 1IJHA 4EM4A 4AP3A 1OJDA 5JRBA 3M13A 1N4WA 4TM3A 3AB1A 4H2PA 1GETA 3BNMA 1IUSA 1P2HA 3GMBA 4NNJA 1CJ3A 3CIRA 2R0GA 1JNZA 1DOCA 1X31B 4EMJA 1UKVG 3I6DA 2Z5YA 1F8RA 3UTFA 4EQXA 5HYMA 1NDAA 2Y6QA 3UP4A 4D03A 3L1RA 2GV8A 2PHHA 4BK2A 1YQ3A 1S3BA 2BS2A 1H82A 3VQRA 4YSYA 1E1KA 3C4NA 4EQWA 1CC4A 1DJNA 1NAAA 4HA6A 1DODA 1GRHA 1TDEA 2ARDA 3K7MX 3M0OA 3UKKA 3V3NA 5KOWA 3QFAA 3AE1A 4X9NA 4WCTA 3K7TA 4TLZA 4D04A 1BZLA 4A9WA 2YM2A 3UOZA 4TM1A 3SFDA 3LADA 2TMDA 3IHMA 4OPDA 2Q7VA 2QCUA 2WPEA 1ONFA 1CHUA 1YQZA 1RYIA 1SEZA 4WX1A 4ZCDA 4MJWA 4O5QA 5EOWA 1IUVA 4Y4MA 4ADWA 4M52A 2Q0KA 4K5SA 4LIIA 2WETA 1EBDA 2XVJA 2JAEA 3AE2A 5KMSA 1EL9A 3URHA 1PBBA 2JB2A 2OALA 1GRBA 3AE4A 4TLXA 4A65A 2B9YA 2WS3A 2YG3A 3RP6A 3EF6A 1PHHA 3UOXA 4RSLA 4YTPA 5JCLA 4AT0A 1OJAA 3UKPA 3K7QX 3L5OA 4AOXA 2BCGG 4EQRA 3FG2P 5FMHA 2BK4A 3BI4A 4YXDA 1KF6A 2GQFA 4USRA 2V5ZA 2GQWA 4C74A 3RHAA 4Z2TA 1K0LA 3D1CA 2AAQA 3GDPA 3HZLA 2EQ9A 3SGLA 2XDOA 3M12A 4J36A 4U8LA 2TPRA 4P9SA 2VZ2A 4B66A 2FBWA 3AE7A 1PJ7A 4PAAA 1LVLA 1PJ6A 3AWIA 4NZHA 5JCMA 2APGA 4GCMA 2O9ZA 1VRQB 4JY2A 1PDHA 5IQ1A 3AYJA 4K5RA 2W0HA 3UKHA 4X4JA 2JB3A 3H4KA 3DK9A 1Y56B 4NTCA 1L9EA 1PBDA 4CCQA 2ZBWA 2X8CA 4HB9A 5M0ZA 1IUWA 1JEHA 2WP9A 1E1LA 3CTYA 1CJCA 4H4ZA 4BV6A 3D8XA 3D9XA 3AE5A 4IV9A 2YVJA 3DJGX 1GERA 3SFEA 5KWFA 1GESA 4GUVA 2C7GA 1NHPA 2YR6A 3REDA 4CRTA 1O95A 1GPEA 1L0VA 2ZZCA 3BNUA 3FIMB 3UTEA 4H7UA 3GYXA 4Z24A 3ATQA 2GH5A 1BF3A 3GSIA 2YQUA 1E7PA 2YVFA 4B1BA 1E1MA 2WU2A 3H8LA 3LZXA 4B69A 4OPGA 1LV0A 4H4YA 1MO9A 4YKGA 4EM3A 1HYUA 1KFYA 3AEGA 5HXIA 2C67A 1Y0PA 4X9MA 3UCLA 2GAGB 4BK3A 1ZX9A 3CNTA 2XFPA 3SY4A 4H2RA 4XXGA 1F6MA 2R4EA 4B64A 3CGEA 4K22A 4J57A 3KPFA 2JK6A 3DK8A 2C72A 3K30A 2X99A 2WDRA 4G6GA 3AE6A 2J3NA 2B7SA 4FDCB 3DMEA 4YSXA 1S7MA 4BURA 1DXLA 1NPXA 2WP5A 1F3PA 3G5SA 3BI5A 1ZOVA 2BXRA 4AT2A 2JKCA 1NENA 4ECHA 2QA1A 3DJEA 3KKJA 5IPYA 3IHGA 1BKWA 2WOIA 2RGHA 5C3JA 2XVHA 2XVEA 3AD9B 2YG7A 4OPTA 1COYA 2WESA 3CGCA 4CCRA 3CN8A 4APNA 4FK1A 2GRTA 4JN9A 1O94A 1XDIA 2A87A 2NVKX 4U8PA 1NHRA 2YLTA 4U8KA 2GVCA 3R9UA 3NK2X 4U2TA 1DOBA 3ISHA 3UKLA 2VQ7A 3KU9A 1XHCA 3SZ0A 3AE3A 2XVFA 4A5LA 3GRSA 1VG0A 2OLNA 4U2LA 3GMCA 3QSSA 4NTEA 3S5WA 4Z25A 5C2TA 3CMMA 2BRYA 3F8DA 3LOVA 3UTHA 1IUTA 3KVEA 3O0HA 3EAOA 2C70A 2FJAA 3FBSA 2C3DA 3AEDA 2JB1A 2X8GA 1YKJA 2Z5XA 1ZP0A 1S2QA 3QSEA 1PJ5A 3VR9A 4G6HA 1EL7A 2X3NA 3BI2A 3QSMA 1N1PA 4ICYA 3NNEA 4GDEA 4UDQA 4XWRA 4Z2RA 1QO8A 3AEEA 2VVLG 2XLTA 2XFUA 2EQ8A 2WU5A 5ER0A 2XVIA 3NLCA 2YR4A 5GSNA 3I3LA 1PBCA 2YLXA 4O5UA 3ALLA 1GSNA 5HHFA 3V76A 1KN0A 1K0JA 5U63A 5KMRA 3UKQA 1KSSA 1ZMDA 3AE8A 3FMWA 2XLUA 3AXBA 4TM4A 1MXTA 1V59A 4YKFA 3EANA 4NTDA 3AD7B 2YG5A 1NG4A 2YLRA 3GWFA 2BC0A 2XLSA 3NTDA 4BK1A 2RABA 4YSZA 3NGCX 1PXBA 1H7XA 2C75A 1B4VA 2VOUA 3CNPA 5JCNA 2R46A 4RG3A 3V3OA 1JRZA 5FS7A 1LQTA 4GAVA 2C73A 4U8IA 2BK3A 2V60A 3NYCA 2B9XA 3PO7A 3SZCA 2GR0A 1TRBA 3COXA 3ITJA 3KPKA 4OVIA 4USQA 5JCIA 1GALA 2R0PA 1H7WA 5KOXA 2X8HA 3P4PA 3CPIG 4I58A 4H4PA 3Q6JA 4H4WA 3G5RA 3B6DA 3II4A 4OPCA 1PBEA 2C3CA 2WPFA 1CC6A 3KLJA 1F8SA 3ALMA 3HYWA 4G73A 3VR8A 5BRTA 1LTXR 1DOEA 4H50A 1CJ4A 4EMWA 3UOVA 1E1NA 1H84A 3DA1A 4DSGA 3NTAA 3SZWA 3CNDA 3T2KA 3AD8B 4CNKA 4N9XA 1FOHA 1FL2A 2RGJA 2WBAA 5EB4A 4GRTA 2BCPA 1KNPA 2XCGA 3UKFA 4YWOA 3NYFA 2GR3A 2VVMA 2XFQA 3ZYXA 4BJZA 1GRAA 4J56A 1E39A 4CBQA 4ZN0A 4U8MA 3GWDA 4JNAA 1OJ9A 2Q0LA 2V61A 2GB0A 1JRYA 3ATRA 2WOVA 2NPXA 3HYVA 4A6NB 4E0VA 4FX9A 3AEBA 2AR8A 1IUXA 3SYIA 1ZY8A 4YT0A 1VDCA 2YLWA 5U25A 1D4CA 4GF7A 3OC4A 4REKA 4B63A 1ZMCA 2CVJA 1PS9A 1VG9A 1XPQA 2C76A 4J34A 2BK5A 3DK4A 4DNAA 2ACZA 2E5VA 5IQ4A 1NG3A 3KD9A 4GAPA 1F8WA 1S3EA 4AP1A 1KNRA 2GR2A 2XLPA 3IF9A 3GRTA 4XWZA 2FJBA 4NEVA 2GEWA 1DJQA 2JBVA 2IVDA 2AQJA 3ICTA 4II3A 3NG7X 2R4JA 1NHQA 3VRDB 2C64A 3L8KA 1JRXA 3CNJA 2CULA 3T2ZA 4B65A 1BWCA 3OZ2A 4H4SA 2C65A 1Q1RA 4G74A 5KVIA 3QVPA 5DBJA 2A89A 3RNMA 2VRLA 3AYLA 2XFNA 2YG4A 3H8IA 1GOSA 3T37A 5KNLA 4LU6A 4EQSA 1JOAA 2OLOA 4Y4NA 3T0KA 3NKSA 2DKIA 4CY6A 1FCDA 2BACA 3C96A 3P9UA 4UDPA 1TDFA 2GMHA 2ZZ0A 1P2EA 4II2A 4IVOB 3ADAB 1B8SA 1L9DA 3ALJA 4UDRA 1GRFA 3GD4A 5U1OA 1Q9IA 2GMJA 2XFOA 2Y6RA 3C4AA 2C4CA 3DH9A 1H81A 1NEKA 3GYJA 3CGDA 1VQWA 3QJ4A 4I59A 1PXAA 2C66A 2WEUA 2BABA 4J2WA 1ZKQA 2CFYA 1B5QA 2WQYA 3LB8A 4H2QA 3AYIA 4C77A 1AOGA 4OPLA 2YVGA 1YQ4A 1BGNA 2IVEA 4GDPA 2BXSA 4J33A 4OPUA 1OJTA 1OJCA 4KX6A 5KMQA 4EIPA 3LXDA 1D4EA 3B3RA 2WPCA 4JNQA 3SXIA 1CBOA 3UOYA 1FEBA 2B76A 3SZFA 5J7XA 2GR1A 4NEWA 2R0CA 1TDKA 2YWLA 1IUUA 1REOA 1H86A 4YTMA 3ABVA 4Z26A 3SX6A 2F5ZA 3KA7A 4GR1A 3E1TA 3Q9TA 1W4XA 1ZDLA 3G5QA 3NHOX 5M10A 4H4UA 2QA2A 3RP8A 1M64A 3UTGA 1NHSA 2R9ZA 3CGBA 4EMIA 1GXFA 3GDNA 1QLBA 2YM1A 3NK0X 2X50A 3NN6X 2YLZA 4H4XA 3T31A 1GTEA 2WDVA 1L9CA 4KPRA 2H89A 2VRMA 4B68A 4DGKA 1D7YA 1N4UA 4J31A 1Z6LA 3ICRA 3S61A 3JSKA 3LJPA 1H2IA 2EQ6A 1MOKA 4H4TA 2I0ZA 3P4QA 4A7AA 4H4QA 2BRAA 1Q1WA 5EB5A 3ICSA 1N4VA 4ZCCA 1K0IA 4TM0A 3GYIA 3NK1X 3WE0A 3NIXA 4C3XA 4Z2UA 2GF3A 4U8NA 3ZDNA 4CY8A 3AEFA 3SQPA 5JCKA 2RGOA 4H2NA 1M6IA 4B67A 4JQ9A 2B9WA 1CC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TDO A;  1PBF A;  4Y4L A;  4AOS A;  2R45 A;  5FS8 A;  4H4V A;  4CNJ A;  1LPF A;  3P1W A;  3IC9 A;  1D7L A;  2YG6 A;  1ELI A;  3NN0 X;  4A79 A;  2BS4 A;  3FPZ A;  2OAM A;  3UKA A;  4YSH A;  3BHK A;  3P4S A;  3DGH A;  5FS6 A;  2HQM A;  4K2X A;  1O5W A;  1XAN A;  2V3A A;  3DJD A;  2YLS A;  3RP7 A;  1D4D A;  2PYX A;  1GRE A;  4JDR A;  2WP6 A;  2DKH A;  2OA1 A;  3NRN A;  5KRQ A;  5L46 A;  1GEU A;  3P4R A;  2QAE A;  3DGZ A;  1EL5 A;  4LA1 A;  2A8X A;  2BA9 A;  3EPT A;  4U2S A;  1JNR A;  3QVR A;  3LZW A;  1CF3 A;  1Y56 A;  1GV4 A;  4IVM B;  2V6O A;  5LV9 A;  4OCG A;  4JY3 A;  4U8O A;  3SM8 A;  1GT8 A;  1ZK7 A;  2WHD A;  3PVC A;  4U8J A;  5J60 A;  4C3Y A;  4YTN A;  1RSG A;  5KXJ A;  2UZZ A;  2E1M A;  1KDG A;  3F8P A;  5BVA A;  2H88 A;  4FK1 C;  1LJ1 A;  4IA6 A;  4Z44 A;  2B7R A;  1H83 A;  4EIQ A;  1YY5 A;  2XYO A;  1EL8 A;  1GTH A;  2IID A;  1GRG A;  4H4R A;  1RP0 A;  3AEA A;  4PAB A;  2FJD A;  1DNC A;  1PXC A;  5BUK A;  3VRA A;  3IWA A;  3NT6 A;  1FEC A;  1FEA A;  3DJJ A;  1D5T A;  4IA5 A;  1B37 A;  2E4G A;  2GAH B;  1CJ2 A;  2WOW A;  2ZZB A;  2BS3 A;  2VVL A;  5TR3 A;  1TYP A;  2CDU A;  1LQU A;  3CNS A;  3CPH G;  4BJY A;  1KSU A;  5CQF A;  2FJE A;  1E6E A;  3NH3 X;  5HY5 A;  1PN0 A;  1H6V A;  2EQ7 A;  2YAU A;  5KVH A;  1TDN A;  3F8R A;  2BYB A;  3PS9 A;  4RG4 A;  3NYE A;  1QJD A;  2Q6U A;  4A99 A;  4K7Z A;  2YR5 A;  1S2Y A;  1ZOY A;  5EBK A;  5CKU A;  5BUL A;  5FS9 A;  1K4Q A;  1JU2 A;  2V3B A;  1GND A;  4A6N A;  2BC1 A;  4Z43 A;  3VRB A;  4C5O A;  3BHF A;  1TYT A;  4OPI A;  3QFB A;  1BGJ A;  1CL0 A;  2WDQ A;  3UP5 A;  4DSH A;  2VQB A;  1GRT A;  4UP3 A;  3AEC A;  5GRT A;  2XLR A;  3CPJ G;  3AE9 A;  3GD3 A;  4K8D A;  1IJH A;  4EM4 A;  4AP3 A;  1OJD A;  3M13 A;  1N4W A;  4TM3 A;  3AB1 A;  4H2P A;  1GET A;  3BNM A;  1IUS A;  1P2H A;  3GMB A;  1CJ3 A;  3CIR A;  2R0G A;  1JNZ A;  1DOC A;  1X31 B;  4EMJ A;  1UKV G;  3I6D A;  2Z5Y A;  1F8R A;  3UTF A;  4EQX A;  5HYM A;  1NDA A;  2Y6Q A;  3UP4 A;  4D03 A;  3L1R A;  2GV8 A;  2PHH A;  4BK2 A;  1YQ3 A;  1S3B A;  2BS2 A;  1H82 A;  3VQR A;  4YSY A;  1E1K A;  3C4N A;  4EQW A;  1CC4 A;  1DJN A;  1NAA A;  4HA6 A;  1DOD A;  1GRH A;  1TDE A;  2ARD A;  3K7M X;  3M0O A;  3UKK A;  3V3N A;  5KOW A;  3QFA A;  3AE1 A;  4X9N A;  4WCT A;  3K7T A;  4TLZ A;  4D04 A;  1BZL A;  4A9W A;  2YM2 A;  3UOZ A;  4TM1 A;  3SFD A;  3LAD A;  2TMD A;  3IHM A;  4OPD A;  2Q7V A;  2QCU A;  2WPE A;  1ONF A;  1CHU A;  1YQZ A;  1RYI A;  1SEZ A;  4WX1 A;  4ZCD A;  4MJW A;  4O5Q A;  5EOW A;  1IUV A;  4Y4M A;  4ADW A;  4M52 A;  2Q0K A;  4K5S A;  4LII A;  2WET A;  1EBD A;  2XVJ A;  2JAE A;  3AE2 A;  1EL9 A;  3URH A;  1PBB A;  2JB2 A;  2OAL A;  1GRB A;  3AE4 A;  4TLX A;  4A65 A;  2B9Y A;  2WS3 A;  2YG3 A;  3RP6 A;  3EF6 A;  1PHH A;  3UOX A;  4RSL A;  4YTP A;  5JCL A;  4AT0 A;  1OJA A;  3UKP A;  3K7Q X;  4AOX A;  2BCG G;  4EQR A;  3FG2 P;  5FMH A;  2BK4 A;  3BI4 A;  4YXD A;  1KF6 A;  2GQF A;  4USR A;  2V5Z A;  2GQW A;  4C74 A;  3RHA A;  4Z2T A;  1K0L A;  3D1C A;  2AAQ A;  3GDP A;  3HZL A;  2EQ9 A;  3SGL A;  2XDO A;  3M12 A;  4J36 A;  4U8L A;  2TPR A;  4P9S A;  2VZ2 A;  4B66 A;  2FBW A;  3AE7 A;  1PJ7 A;  4PAA A;  1LVL A;  1PJ6 A;  3AWI A;  4NZH A;  5JCM A;  2APG A;  4GCM A;  2O9Z A;  1VRQ B;  4JY2 A;  1PDH A;  5IQ1 A;  3AYJ A;  4K5R A;  2W0H A;  3UKH A;  4X4J A;  2JB3 A;  3H4K A;  3DK9 A;  1Y56 B;  4NTC A;  1L9E A;  1PBD A;  4CCQ A;  2ZBW A;  2X8C A;  4HB9 A;  5M0Z A;  1IUW A;  1JEH A;  2WP9 A;  1E1L A;  3CTY A;  1CJC A;  4H4Z A;  4BV6 A;  3D8X A;  3AE5 A;  4IV9 A;  2YVJ A;  3DJG X;  1GER A;  3SFE A;  5KWF A;  1GES A;  4GUV A;  2C7G A;  1NHP A;  2YR6 A;  3RED A;  4CRT A;  1O95 A;  1GPE A;  1L0V A;  2ZZC A;  3BNU A;  3FIM B;  3UTE A;  4H7U A;  4Z24 A;  3ATQ A;  2GH5 A;  1BF3 A;  3GSI A;  2YQU A;  1E7P A;  2YVF A;  4B1B A;  1E1M A;  2WU2 A;  3H8L A;  3LZX A;  4B69 A;  4OPG A;  1LV0 A;  4H4Y A;  1MO9 A;  4YKG A;  4EM3 A;  1HYU A;  1KFY A;  3AEG A;  5HXI A;  2C67 A;  1Y0P A;  4X9M A;  3UCL A;  2GAG B;  4BK3 A;  1ZX9 A;  3CNT A;  2XFP A;  4H2R A;  4XXG A;  1F6M A;  2R4E A;  4B64 A;  3CGE A;  4K22 A;  4J57 A;  3KPF A;  2JK6 A;  3DK8 A;  2C72 A;  3K30 A;  2X99 A;  2WDR A;  3AE6 A;  2J3N A;  2B7S A;  4FDC B;  3DME A;  4YSX A;  4BUR A;  1DXL A;  1NPX A;  2WP5 A;  1F3P A;  3G5S A;  3BI5 A;  1ZOV A;  2BXR A;  4AT2 A;  2JKC A;  1NEN A;  4ECH A;  2QA1 A;  3DJE A;  3KKJ A;  5IPY A;  3IHG A;  1BKW A;  2WOI A;  2RGH A;  5C3J A;  2XVH A;  2XVE A;  3AD9 B;  2YG7 A;  4OPT A;  1COY A;  2WES A;  3CGC A;  4CCR A;  3CN8 A;  4APN A;  4FK1 A;  2GRT A;  4JN9 A;  1O94 A;  1XDI A;  2A87 A;  2NVK X;  4U8P A;  1NHR A;  2YLT A;  4U8K A;  2GVC A;  3R9U A;  3NK2 X;  4U2T A;  1DOB A;  3ISH A;  3UKL A;  2VQ7 A;  3KU9 A;  1XHC A;  3AE3 A;  2XVF A;  4A5L A;  3GRS A;  1VG0 A;  2OLN A;  4U2L A;  3GMC A;  3QSS A;  4NTE A;  3S5W A;  4Z25 A;  5C2T A;  3F8D A;  3LOV A;  3UTH A;  1IUT A;  3KVE A;  3O0H A;  3EAO A;  2C70 A;  2FJA A;  3FBS A;  2C3D A;  3AED A;  2JB1 A;  2X8G A;  1YKJ A;  2Z5X A;  1ZP0 A;  1S2Q A;  3QSE A;  1PJ5 A;  3VR9 A;  1EL7 A;  2X3N A;  3BI2 A;  3QSM A;  1N1P A;  4ICY A;  3NNE A;  4GDE A;  4UDQ A;  4XWR A;  4Z2R A;  1QO8 A;  3AEE A;  2VVL G;  2XLT A;  2XFU A;  2EQ8 A;  2WU5 A;  5ER0 A;  2XVI A;  3NLC A;  2YR4 A;  5GSN A;  3I3L A;  1PBC A;  2YLX A;  4O5U A;  3ALL A;  1GSN A;  5HHF A;  3V76 A;  1K0J A;  5U63 A;  3UKQ A;  1KSS A;  1ZMD A;  3AE8 A;  3FMW A;  2XLU A;  3AXB A;  4TM4 A;  1MXT A;  1V59 A;  4YKF A;  3EAN A;  4NTD A;  3AD7 B;  2YG5 A;  1NG4 A;  2YLR A;  3GWF A;  2BC0 A;  2XLS A;  3NTD A;  4BK1 A;  2RAB A;  4YSZ A;  3NGC X;  1PXB A;  1H7X A;  2C75 A;  1B4V A;  2VOU A;  3CNP A;  5JCN A;  2R46 A;  4RG3 A;  3V3O A;  1JRZ A;  5FS7 A;  1LQT A;  2C73 A;  4U8I A;  2BK3 A;  2V60 A;  3NYC A;  2B9X A;  3PO7 A;  2GR0 A;  1TRB A;  3COX A;  3ITJ A;  4OVI A;  4USQ A;  5JCI A;  1GAL A;  2R0P A;  1H7W A;  5KOX A;  2X8H A;  3P4P A;  3CPI G;  4I58 A;  4H4P A;  3Q6J A;  4H4W A;  3G5R A;  3B6D A;  3II4 A;  4OPC A;  1PBE A;  2C3C A;  2WPF A;  1CC6 A;  3KLJ A;  1F8S A;  3ALM A;  3VR8 A;  5BRT A;  1LTX R;  1DOE A;  4H50 A;  1CJ4 A;  4EMW A;  3UOV A;  1E1N A;  1H84 A;  3DA1 A;  4DSG A;  3NTA A;  3CND A;  3AD8 B;  4CNK A;  4N9X A;  1FOH A;  1FL2 A;  2RGJ A;  2WBA A;  5EB4 A;  4GRT A;  2BCP A;  1KNP A;  2XCG A;  3UKF A;  4YWO A;  3NYF A;  2GR3 A;  2VVM A;  2XFQ A;  3ZYX A;  4BJZ A;  1GRA A;  4J56 A;  1E39 A;  4CBQ A;  4ZN0 A;  4U8M A;  3GWD A;  4JNA A;  1OJ9 A;  2Q0L A;  2V61 A;  2GB0 A;  1JRY A;  3ATR A;  2WOV A;  2NPX A;  4A6N B;  4E0V A;  4FX9 A;  3AEB A;  2AR8 A;  1IUX A;  1ZY8 A;  4YT0 A;  1VDC A;  2YLW A;  5U25 A;  1D4C A;  4GF7 A;  3OC4 A;  4REK A;  4B63 A;  1ZMC A;  2CVJ A;  1PS9 A;  1VG9 A;  1XPQ A;  2C76 A;  4J34 A;  2BK5 A;  3DK4 A;  4DNA A;  2ACZ A;  2E5V A;  5IQ4 A;  1NG3 A;  3KD9 A;  1F8W A;  1S3E A;  4AP1 A;  1KNR A;  2GR2 A;  2XLP A;  3IF9 A;  3GRT A;  4XWZ A;  2FJB A;  4NEV A;  2GEW A;  1DJQ A;  2JBV A;  2IVD A;  2AQJ A;  3ICT A;  3NG7 X;  2R4J A;  1NHQ A;  3VRD B;  2C64 A;  3L8K A;  1JRX A;  3CNJ A;  2CUL A;  4B65 A;  1BWC A;  3OZ2 A;  4H4S A;  2C65 A;  1Q1R A;  5KVI A;  3QVP A;  5DBJ A;  2A89 A;  3RNM A;  2VRL A;  3AYL A;  2XFN A;  2YG4 A;  3H8I A;  1GOS A;  3T37 A;  4LU6 A;  4EQS A;  1JOA A;  2OLO A;  4Y4N A;  3NKS A;  2DKI A;  4CY6 A;  1FCD A;  2BAC A;  3C96 A;  3P9U A;  4UDP A;  1TDF A;  2GMH A;  2ZZ0 A;  1P2E A;  4IVO B;  3ADA B;  1B8S A;  1L9D A;  3ALJ A;  4UDR A;  1GRF A;  3GD4 A;  5U1O A;  1Q9I A;  2GMJ A;  2XFO A;  2Y6R A;  3C4A A;  3DH9 A;  1H81 A;  1NEK A;  3GYJ A;  3CGD A;  1VQW A;  3QJ4 A;  4I59 A;  1PXA A;  2C66 A;  2WEU A;  2BAB A;  4J2W A;  1ZKQ A;  2CFY A;  1B5Q A;  2WQY A;  3LB8 A;  4H2Q A;  3AYI A;  4C77 A;  1AOG A;  4OPL A;  2YVG A;  1YQ4 A;  1BGN A;  2IVE A;  4GDP A;  2BXS A;  4J33 A;  4OPU A;  1OJT A;  1OJC A;  4KX6 A;  4EIP A;  3LXD A;  1D4E A;  3B3R A;  2WPC A;  4JNQ A;  1CBO A;  3UOY A;  1FEB A;  2B76 A;  5J7X A;  2GR1 A;  4NEW A;  2R0C A;  1TDK A;  2YWL A;  1IUU A;  1REO A;  1H86 A;  4YTM A;  3ABV A;  4Z26 A;  2F5Z A;  3KA7 A;  4GR1 A;  3E1T A;  3Q9T A;  1W4X A;  1ZDL A;  3G5Q A;  3NHO X;  5M10 A;  4H4U A;  2QA2 A;  3RP8 A;  1M64 A;  3UTG A;  1NHS A;  2R9Z A;  3CGB A;  4EMI A;  1GXF A;  3GDN A;  1QLB A;  2YM1 A;  3NK0 X;  2X50 A;  3NN6 X;  2YLZ A;  4H4X A;  1GTE A;  2WDV A;  1L9C A;  4KPR A;  2H89 A;  2VRM A;  4B68 A;  4DGK A;  1D7Y A;  1N4U A;  4J31 A;  1Z6L A;  3ICR A;  3S61 A;  3JSK A;  3LJP A;  2EQ6 A;  2I0Z A;  1MOK A;  4H4T A;  3P4Q A;  4A7A A;  4H4Q A;  1Q1W A;  5EB5 A;  3ICS A;  1N4V A;  4ZCC A;  1K0I A;  4TM0 A;  3GYI A;  3NK1 X;  3WE0 A;  3NIX A;  4C3X A;  4Z2U A;  2GF3 A;  4U8N A;  3ZDN A;  4CY8 A;  3AEF A;  3SQP A;  5JCK A;  2RGO A;  4H2N A;  1M6I A;  4B67 A;  4JQ9 A;  2B9W A;  1CC2 A; 
#chains in the Genus database with same CATH topology
 3NXL A;  3FVD A;  3ETR B;  1D7L A;  3VCN A;  3FPZ A;  3UKA A;  4YSH A;  1WUF A;  4K2X A;  2V3A A;  3RIT A;  2AL1 A;  4H19 A;  1GRE A;  4NWZ A;  4EWJ A;  2OVL A;  2A8X A;  4IT1 A;  2BA9 A;  3RO6 A;  4U2S A;  3LZW A;  1Y56 A;  4OCG A;  3PVC A;  4U8J A;  5BVA A;  4FK1 C;  1LJ1 A;  3HYX A;  2B7R A;  4Z44 A;  2XYO A;  3AEA A;  2FJD A;  3VRA A;  3GD6 A;  1FEA A;  4IA5 A;  2GAH B;  2WOW A;  1TYP A;  2CDU A;  1EBH A;  1RM6 B;  3B97 A;  3NH3 X;  1E6E A;  5HY5 A;  1H6V A;  2YAU A;  3F8R A;  3TQP A;  1QJD A;  2FKP A;  4A99 A;  4K7Z A;  2YR5 A;  1S2Y A;  1ZOY A;  5EBK A;  5CKU A;  5BUL A;  1K4Q A;  1GND A;  4C5O A;  4OPI A;  3K1G A;  3AEC A;  4DWD A;  4EM4 A;  4AP3 A;  3AB1 A;  4HN8 A;  3BNM A;  1IUS A;  3GMB A;  3CIR A;  4EQX A;  1NDA A;  2Y6Q A;  3MUC A;  2GV8 A;  4BK2 A;  1YQ3 A;  4YSY A;  2BS2 A;  1E1K A;  3VC6 A;  1DJN A;  4HA6 A;  3V3N A;  5KOW A;  3QFA A;  4A9W A;  3A7U A;  3SFD A;  3LAD A;  3IHM A;  3OW1 A;  1N60 C;  1CHU A;  1YQZ A;  1RYI A;  4WX1 A;  3OZY A;  3IJI A;  4MJW A;  3QTP A;  4O5Q A;  4Y4M A;  4K5S A;  2QDD A;  1EBD A;  3AE2 A;  2JAE A;  3IJL A;  1PBB A;  4TLX A;  3GC2 A;  5JCL A;  3UKP A;  3K7Q X;  3FG2 P;  5J04 A;  2GL5 A;  2V5Z A;  3RHA A;  2DW6 A;  3UGV A;  1BQG A;  3SGL A;  4J36 A;  4B66 A;  2VZ2 A;  1FO4 A;  2FBW A;  3AE7 A;  2APG A;  4JY2 A;  1VRQ B;  2OLA A;  5IQ1 A;  2NQL A;  3NZG A;  3DK9 A;  4NTC A;  2XH2 A;  4HCD A;  4GIS A;  1JEH A;  1E1L A;  3TW9 A;  4BV6 A;  3D8X A;  3D9X A;  2YVJ A;  1GES A;  3DGB A;  3RED A;  3H7V A;  1O95 A;  1GPE A;  3EKG A;  4H7U A;  4Z24 A;  3UCD A;  2WU2 A;  3H8L A;  3LZX A;  1LV0 A;  1HYU A;  3UCL A;  4BK3 A;  3Q45 A;  2R4E A;  2OFJ A;  4G8T A;  1X2G A;  3AE6 A;  3CAW A;  1S7M A;  3G5S A;  2BXR A;  2PA6 A;  3P0W A;  4ECH A;  3KKJ A;  2XH0 A;  3IHG A;  2GGI A;  1BKW A;  2XVH A;  4IP4 A;  4OPT A;  1COY A;  3CGC A;  4CCR A;  2W3S A;  3CN8 A;  4JN9 A;  4U8P A;  1NHR A;  4U8K A;  4U2T A;  3UKL A;  3KU9 A;  3D47 A;  1XHC A;  1VG0 A;  3MWC A;  3GMC A;  3QSS A;  4NTE A;  4Z25 A;  3CMM A;  2BRY A;  3F8D A;  3LOV A;  1R0M A;  2C3D A;  3AED A;  2X8G A;  1YKJ A;  1S2Q A;  2QDE A;  4XWR A;  3NNE A;  3ZVI A;  4Z2R A;  1QO8 A;  2VVL G;  1KKO A;  2YR4 A;  2YLX A;  2GGG A;  1KN0 A;  2I5Q A;  1KSS A;  1ZMD A;  3AE8 A;  1MXT A;  1V59 A;  2CHR A;  1NG4 A;  2YLR A;  3GWF A;  3NTD A;  1V97 A;  4BK1 A;  1EC9 A;  4RG3 A;  5FJU A;  3UXK A;  3NYC A;  2B9X A;  3PO7 A;  3COX A;  5JCI A;  2R0P A;  3N4E A;  2PS2 A;  3Q6J A;  4OPC A;  5BRT A;  3OP2 A;  1F8S A;  4G73 A;  4DSG A;  3NTA A;  3AD8 B;  2WBA A;  3BSM A;  2XFQ A;  3RGT A;  4BJZ A;  4J56 A;  4ZN0 A;  4U8M A;  2Q0L A;  3ATR A;  3HYV A;  2WOV A;  3N4F A;  4E0V A;  3SYI A;  2AR8 A;  4MMW A;  4YT0 A;  4GF7 A;  3OC4 A;  3P93 A;  1VG9 A;  2ACZ A;  1S3E A;  1KNR A;  2GR2 A;  2GEW A;  2IVD A;  3OZM A;  2R4J A;  3NVY B;  3L8K A;  1JRX A;  3CNJ A;  3EEZ A;  1BWC A;  3OZ2 A;  2E5A A;  5FJO A;  5KVI A;  2A89 A;  3RNM A;  3H8I A;  2XFN A;  2YG4 A;  5KNL A;  4LU6 A;  1KKR A;  3MZN A;  2BAC A;  3C96 A;  4UDP A;  3P9U A;  1SJD A;  1P2E A;  4E5T A;  3R25 A;  1L9D A;  2P0I A;  2Y6R A;  3TJ4 A;  5BOE A;  2PP1 A;  1N5X A;  2OPJ A;  3AYI A;  4C77 A;  1AOG A;  1BGN A;  4GDP A;  4OPU A;  2WPC A;  3H12 A;  3UOY A;  4IHC A;  2GR1 A;  3N6J A;  3AMZ A;  1IUU A;  2AL2 B;  3FYY A;  4YTM A;  3TTE A;  1W4X A;  2QA2 A;  3RP8 A;  2PTW A;  1QLB A;  2X50 A;  4ROP A;  4H4X A;  2WDV A;  2H89 A;  3LJP A;  3CT2 A;  2PU0 A;  5IDZ A;  5EB5 A;  4ZCC A;  1JCT A;  2ONE A;  3NK1 X;  4U8N A;  3AEF A;  2POZ A;  3QLD A;  1TDO A;  4CNJ A;  3IC9 A;  4A79 A;  3THU A;  1OEP A;  2OAM A;  3BHK A;  3DGH A;  5FS6 A;  2HQM A;  1XAN A;  1D4D A;  2WP6 A;  3NRN A;  1GEU A;  3P4R A;  1EL5 A;  4G9K A;  3EPT A;  1JNR A;  1TE6 A;  1GV4 A;  2V6O A;  5LV9 A;  1ZK7 A;  2WHD A;  3AN1 A;  5J60 A;  4KT2 A;  4JN7 A;  1RSG A;  2UZZ A;  3F8P A;  3PG6 A;  4IA6 A;  1YY5 A;  2IID A;  1GRG A;  4H4R A;  1RP0 A;  1PDY A;  1PXC A;  2OZ3 A;  4H1Z A;  3IWA A;  3NT6 A;  1FEC A;  3T8Q A;  4BJY A;  3V5C A;  1KSU A;  1PN0 A;  2BYB A;  3PS9 A;  2V3B A;  4A6N A;  3VRB A;  1CL0 A;  4UP3 A;  3V4B A;  2XLR A;  4HCL A;  3NS1 B;  1N4W A;  3JVA A;  4H2P A;  1GET A;  3T4W A;  1DOC A;  3SN1 A;  1SJA A;  3UTF A;  4A6G A;  3UCC A;  4EQW A;  1CC4 A;  3CK5 A;  1NAA A;  1TDE A;  3M0O A;  4WCT A;  4D04 A;  2YM2 A;  2TMD A;  3R07 C;  2Q7V A;  4K8G A;  4DYE A;  1SEZ A;  5EOW A;  1IUV A;  2Q0K A;  4LII A;  2WET A;  3TCS A;  1EL9 A;  3PFR A;  3URH A;  3QN3 A;  2YG3 A;  4YTP A;  3L5O A;  3RRA A;  2BCG G;  4EQR A;  5FMH A;  2BK4 A;  3BI4 A;  4C74 A;  4Z2T A;  1K0L A;  2AAQ A;  2EQ9 A;  2GSH A;  4P9S A;  1PJ7 A;  4PAA A;  1LVL A;  1PJ6 A;  3AYJ A;  4IL0 A;  2JB3 A;  3H4K A;  1PBD A;  1WYG A;  3CTY A;  3UJS A;  4CRT A;  2YR6 A;  3BNU A;  3FIM B;  3GYX A;  3ATQ A;  2YQU A;  1P48 A;  1E7P A;  5FJT A;  3CNT A;  2XFP A;  3SY4 A;  1F6M A;  4J57 A;  3KPF A;  3SSZ A;  2C72 A;  1JDF A;  2J3N A;  4FDC B;  2WP5 A;  3NVZ B;  1F3P A;  4MGG A;  3BI5 A;  2JKC A;  5EU9 A;  1NEN A;  2QA1 A;  2XVE A;  3AD9 B;  2AL2 A;  4FK1 A;  7ENL A;  2W55 A;  2GVC A;  3R9U A;  3N6H A;  3DG6 A;  2XVF A;  3GRS A;  4ZCW A;  2OLN A;  1ONE A;  4U2L A;  3S5W A;  3BOX A;  4GFI A;  3KVE A;  3EAO A;  2FJA A;  3FBS A;  3QSE A;  1PJ5 A;  3VR9 A;  4UDQ A;  2X3N A;  3AEE A;  2XLT A;  2EQ8 A;  1WUE A;  4O5U A;  1PBC A;  3ALL A;  1GSN A;  3ZVH A;  1K0J A;  4TM4 A;  2O56 A;  4YKF A;  3AD7 B;  2YG5 A;  4DX3 A;  3NGC X;  2C75 A;  4JN8 A;  1JRZ A;  2C73 A;  3SZC A;  3ITJ A;  4OVI A;  4USQ A;  1H7W A;  3FJ4 A;  2PGE A;  3G5R A;  2XGZ A;  3B6D A;  3II4 A;  1PBE A;  2C3C A;  3VR8 A;  3SQS A;  4EMW A;  3UOV A;  3U4F A;  3VFC A;  1JPM A;  3T2K A;  3MKC A;  4CNK A;  1FL2 A;  3UKF A;  4GRT A;  2BCP A;  2QVH A;  3SR6 B;  4YWO A;  3R0K A;  3ZYX A;  1GRA A;  4CBQ A;  3GWD A;  2V61 A;  1JRY A;  1NU5 A;  2QQ6 A;  1T3Q C;  1VDC A;  5U25 A;  3ZVH B;  1D4C A;  4B63 A;  1ZMC A;  1JRO A;  2ZAD A;  3DK4 A;  2PMQ A;  2OX4 A;  4AP1 A;  3IF9 A;  2XLP A;  3GRT A;  4XWZ A;  1DJQ A;  2JBV A;  3ICT A;  2HXU A;  4IZG A;  4II3 A;  1NHQ A;  4K1W A;  1Q1R A;  2PP3 A;  3AYL A;  3H70 A;  2OLO A;  3T0K A;  1ECQ A;  3TWA A;  1FFU C;  1TDF A;  2GMH A;  2ZZ0 A;  3R1Z A;  4UDR A;  2GMJ A;  5U1O A;  2XFO A;  4Z1Y A;  1NEK A;  1VQW A;  1PXA A;  2BAB A;  4J2W A;  2WQY A;  3LB8 A;  4H2Q A;  2YVG A;  2IVE A;  4J33 A;  1OJC A;  4KX6 A;  3ZLG A;  5J7X A;  4NEW A;  1TDK A;  3TJI A;  4HYR A;  2GGE A;  3SX6 A;  4GR1 A;  3E1T A;  3G5Q A;  2XH7 A;  5M10 A;  4H4U A;  3T6C A;  4KWS A;  2R9Z A;  3CGB A;  2OZ8 A;  3B9J B;  1L9C A;  4B68 A;  2VRM A;  4X2P A;  4GYP A;  4H4T A;  2PTX A;  4H4Q A;  4KEM A;  4HPN A;  1XS2 A;  4K2S A;  3WE0 A;  3MSY A;  3NIX A;  4C3X A;  2MUC A;  4H2N A;  1M6I A;  4JQ9 A;  4FI4 A;  1MRA A;  3HW2 A;  1MNS A;  1PBF A;  4Y4L A;  5FS8 A;  4H4V A;  4TVY A;  3P1W A;  3P4S A;  3RP7 A;  2PYX A;  2OA1 A;  3I4K A;  3CXO A;  4A35 A;  3RCY A;  2QJJ A;  1VQZ A;  3QVR A;  4HNC A;  1CF3 A;  4IVM B;  3DEQ A;  4U8O A;  5FJR A;  4YTN A;  5KXJ A;  3A7A A;  2E1M A;  1KDG A;  1H83 A;  4EIQ A;  1EL8 A;  1GTH A;  4JHM A;  1PDZ A;  1DNC A;  5KMP A;  3DJJ A;  1W6T A;  1D5T A;  3ENL A;  1B37 A;  2E4G A;  2PSN A;  2DW7 A;  3HPF A;  2VVL A;  1FFV C;  5TR3 A;  1LQU A;  2FJE A;  2EQ7 A;  2HXT A;  3VA8 A;  1BKH A;  2Q6U A;  4FP1 A;  4E4F A;  5FS9 A;  1JU2 A;  1EC7 A;  4M6U A;  4DSH A;  3QFB A;  1BGJ A;  3UP5 A;  2VQB A;  1GRT A;  1IYX A;  3CPJ G;  5GRT A;  3GD3 A;  4K8D A;  1IJH A;  5JRB A;  1P2H A;  1CJ3 A;  2R0G A;  3CB3 A;  2MNR A;  1X31 B;  1VDV A;  2Z5Y A;  3UJ2 A;  5HYM A;  3UP4 A;  4D03 A;  3L1R A;  2PHH A;  1S3B A;  1H82 A;  3C4N A;  1GRH A;  3UKK A;  3K7T A;  4TLZ A;  1BZL A;  3UOZ A;  4TM1 A;  4OPD A;  1ONF A;  4ZCD A;  2E3T A;  4ADW A;  1EBG A;  2OAL A;  3ZLF A;  2GGJ A;  3MY9 A;  1PHH A;  4AT0 A;  1OJA A;  4GGH A;  4YXD A;  1KF6 A;  3V3W A;  4J1O A;  3D1C A;  3GDP A;  3HZL A;  2XDO A;  3M12 A;  4U8L A;  2TPR A;  3UJE A;  3AWI A;  2O9Z A;  1PDH A;  2W0H A;  1Y56 B;  1L9E A;  4CCQ A;  2ZBW A;  5M0Z A;  1IUW A;  2WP9 A;  3AE5 A;  3DJG X;  1GER A;  5KWF A;  2C7G A;  1KCZ A;  3UTE A;  4B1B A;  1E1M A;  1MO9 A;  3AEG A;  5HXI A;  1Y0P A;  4X9M A;  2GAG B;  3A7R A;  1FHU A;  3ES7 A;  2W54 A;  4B64 A;  3CGE A;  3AM9 A;  4K22 A;  4G6G A;  4Z17 A;  3DME A;  4YSX A;  4BUR A;  1NPX A;  1DXL A;  1ZOV A;  3BJS A;  3DJE A;  5IPY A;  2RGH A;  2YG7 A;  4TVW A;  4APN A;  2GRT A;  1XDI A;  2NVK X;  2YLT A;  3NK2 X;  3ISH A;  3MQT A;  2VQ7 A;  2P3Z A;  2GDQ A;  3SZ0 A;  3AE3 A;  2P8C A;  3NFU A;  1X2H A;  2C70 A;  2JB1 A;  1ZP0 A;  3VDG A;  4H2H A;  1EL7 A;  3QSM A;  2WU5 A;  5ER0 A;  6ENL A;  3I3L A;  5KMR A;  5HHF A;  3V76 A;  5U63 A;  1R6W A;  3KUM A;  3FMW A;  2XLU A;  3AXB A;  3EAN A;  2QGY A;  2OZT A;  2BC0 A;  2XLS A;  2RAB A;  4YSZ A;  1PXB A;  1H7X A;  2VOU A;  1B4V A;  5JCN A;  2R46 A;  5FS7 A;  2GR0 A;  1GAL A;  5KOX A;  2X8H A;  3CPI G;  2RDX A;  4H4W A;  1FHV A;  2WPF A;  1LTX R;  4GME A;  2HZG A;  1E1N A;  1H84 A;  3DA1 A;  3HRD C;  2P8B A;  1FOH A;  2XCG A;  3NYF A;  2VVM A;  3ES8 A;  3OTR A;  4A6N B;  3FV9 A;  4FX9 A;  3R11 A;  2YLW A;  3PK7 A;  4REK A;  2CVJ A;  1XPQ A;  4DNA A;  1NG3 A;  3KD9 A;  2XH4 A;  3I6E A;  4NEV A;  1TKK A;  4HNL A;  2AQJ A;  4M0X A;  3NG7 X;  3I6T A;  3VRD B;  2C64 A;  4KPL A;  4B65 A;  4H4S A;  4G74 A;  3QVP A;  2VRL A;  4EQS A;  1JOA A;  4CY6 A;  1JPD X;  3NVW B;  4IVO B;  1SJC A;  1B8S A;  4E8G A;  1GRF A;  1Q9I A;  2C4C A;  3DH9 A;  3CGD A;  3DIP A;  4I59 A;  3QJ4 A;  2C66 A;  2WEU A;  3EUB 3;  4OPL A;  2BXS A;  1OJT A;  5KMQ A;  4EIP A;  3DER A;  3SXI A;  1CBO A;  1FEB A;  2B76 A;  3SZF A;  1H86 A;  3ABV A;  2F5Z A;  3DG3 A;  2HNE A;  1M64 A;  3UTG A;  4EMI A;  1GXF A;  2YM1 A;  3NN6 X;  1GTE A;  4DGK A;  1KD0 A;  2I0Z A;  1MOK A;  3P4Q A;  4A7A A;  1Q1W A;  3ICS A;  1N62 C;  4TM0 A;  3GYI A;  2GF3 A;  3ZDN A;  4CY8 A;  5JCK A;  4GYP C;  4B67 A;  4F4R A;  2B9W A;  3FXG A;  3GY1 A;  2OKT A;  4AOS A;  2R45 A;  1LPF A;  4DN1 A;  3T2Y A;  2YG6 A;  1ELI A;  3NN0 X;  3GO2 A;  4GIR A;  4DHG A;  2BS4 A;  3R0U A;  1O5W A;  3DJD A;  2PU1 A;  2YLS A;  4JDR A;  5L46 A;  1N61 C;  3PWI A;  2DKH A;  5KRQ A;  4A3R A;  2QAE A;  1MUC A;  3DGZ A;  4LA1 A;  3UJR A;  2QJM A;  4ENL A;  4JY3 A;  3SM8 A;  1GT8 A;  1P43 A;  4G7F A;  4C3Y A;  1L8P A;  2H88 A;  1MDL A;  4HCH A;  3T14 A;  4PAB A;  3DDM A;  3RR1 A;  5BUK A;  1CJ2 A;  2ZZB A;  2BS3 A;  3CPH G;  3CNS A;  5CQF A;  3CYJ A;  1ZXI C;  5KVH A;  1TDN A;  3VCC A;  4RG4 A;  3NYE A;  1SB3 B;  1F9C A;  4GGB A;  2BC1 A;  4Z43 A;  1N5W C;  3BHF A;  1TYT A;  2WDQ A;  3S5S A;  3AE9 A;  1OJD A;  3M13 A;  4TM3 A;  4NNJ A;  1JNZ A;  4EMJ A;  1UKV G;  3I6D A;  1F8R A;  4IP5 A;  1MDR A;  3VQR A;  1DOD A;  2ARD A;  3K7M X;  3AE1 A;  4X9N A;  4H83 A;  3NO1 A;  2QCU A;  2WPE A;  2XSX A;  3DFY A;  3TOY A;  4M52 A;  5KMS A;  2XVJ A;  2JB2 A;  4A65 A;  1GRB A;  3QKE A;  3AE4 A;  2B9Y A;  2WS3 A;  3RP6 A;  3EF6 A;  3UOX A;  4RSL A;  2AKM A;  4AOX A;  2GQF A;  4USR A;  2GQW A;  3DES A;  1NEL A;  3VC5 A;  4NZH A;  5JCM A;  4GCM A;  3V5F A;  4K5R A;  2POD A;  3UKH A;  4X4J A;  2X8C A;  4HB9 A;  3H8A A;  1CJC A;  4H4Z A;  1RVK A;  3IK4 A;  4IV9 A;  3SFE A;  4GUV A;  1EC8 A;  1NHP A;  2OQY A;  1L0V A;  2OO6 A;  2ZZC A;  1E9I A;  2GH5 A;  1BF3 A;  3GSI A;  2YVF A;  4B69 A;  3S47 A;  4OPG A;  4H4Y A;  4YKG A;  4EM3 A;  1KFY A;  2C67 A;  3SJN A;  1ZX9 A;  4H2R A;  4XXG A;  2AKZ A;  2JK6 A;  3DK8 A;  3IJQ A;  3K30 A;  2X99 A;  2WDR A;  2B7S A;  2PPG A;  4AT2 A;  2WOI A;  5C3J A;  2OQH A;  2WES A;  1O94 A;  2A87 A;  1DOB A;  2ZC8 A;  4A5L A;  5G5H B;  4DXK A;  5C2T A;  3UXL A;  3UTH A;  1IUT A;  3O0H A;  1N63 C;  3DFH A;  2W3R A;  2Z5X A;  3NVV B;  4G6H A;  3BI2 A;  4ICY A;  1N1P A;  4GDE A;  2PTZ A;  2XFU A;  2XVI A;  3NLC A;  3Q4D A;  5GSN A;  4J3Z A;  3UKQ A;  4NTD A;  3ZLH A;  2P88 A;  3JW7 A;  3STP A;  3CNP A;  3V3O A;  1LQT A;  1XPY A;  4GAV A;  4U8I A;  2BK3 A;  1YEY A;  2V60 A;  1TRB A;  3KPK A;  4YWS A;  1DTN A;  1STZ A;  3P4P A;  3DG7 A;  4I58 A;  4H4P A;  3OPS A;  2QJN A;  1TZZ A;  1CC6 A;  3ALM A;  3KLJ A;  3HYW A;  1DOE A;  4H50 A;  5FJP A;  1CJ4 A;  3SZW A;  3CND A;  4N9X A;  2RGJ A;  5EB4 A;  1KNP A;  2GR3 A;  3P3B A;  1E39 A;  4JNA A;  1OJ9 A;  2GB0 A;  2NPX A;  3AEB A;  1IUX A;  2PP0 A;  1ZY8 A;  2FYM A;  3JZU A;  3T9P A;  1PS9 A;  2C76 A;  4J34 A;  2BK5 A;  5IQ4 A;  2E5V A;  4GAP A;  1F8W A;  1JRP A;  4IL2 A;  2FJB A;  2PTY A;  3FCP A;  3SN4 A;  3TWB A;  2CUL A;  3T2Z A;  2C65 A;  3NRZ B;  5DBJ A;  5BOF A;  1GOS A;  3T37 A;  4E4U A;  4Y4N A;  3CXB A;  3NKS A;  2DKI A;  5ENL A;  1FCD A;  3SBF A;  4II2 A;  3ADA B;  2GGH A;  4E6M A;  3ALJ A;  3GD4 A;  4MKS A;  3C4A A;  1H81 A;  3GYJ A;  3UJF A;  2PGW A;  1ZKQ A;  2CFY A;  1B5Q A;  3PWG A;  1YQ4 A;  2PCE A;  4JNQ A;  3LXD A;  1D4E A;  3B3R A;  2R0C A;  2YWL A;  1REO A;  4Z26 A;  3KA7 A;  3Q9T A;  3SN0 A;  3NHO X;  1ZDL A;  3QPE A;  1NHS A;  5G5G B;  3GDN A;  3NK0 X;  2YLZ A;  1ELS A;  3T31 A;  1SJB A;  4KPR A;  1D7Y A;  1N4U A;  4J31 A;  1Z6L A;  3ICR A;  3S61 A;  3JSK A;  1H2I A;  2EQ6 A;  3D46 A;  4ZOH B;  4ZA0 A;  2BRA A;  1N4V A;  2OG9 A;  1K0I A;  4Z2U A;  3R10 A;  1FIQ B;  3SQP A;  3U9I A;  2RGO A;  1CC2 A; 
#chains in the Genus database with same CATH homology
 1TDO A;  1PBF A;  4Y4L A;  4AOS A;  2R45 A;  5FS8 A;  4H4V A;  4CNJ A;  1LPF A;  3T2Y A;  3P1W A;  3IC9 A;  1D7L A;  2YG6 A;  1ELI A;  3NN0 X;  4A79 A;  2BS4 A;  3FPZ A;  2OAM A;  3UKA A;  4YSH A;  3BHK A;  3P4S A;  3DGH A;  5FS6 A;  2HQM A;  4K2X A;  2V3A A;  1XAN A;  1O5W A;  3DJD A;  2YLS A;  3RP7 A;  1D4D A;  2PYX A;  1GRE A;  4JDR A;  2WP6 A;  2DKH A;  2OA1 A;  3NRN A;  5KRQ A;  5L46 A;  4NWZ A;  1GEU A;  3P4R A;  2QAE A;  3DGZ A;  1EL5 A;  4LA1 A;  2A8X A;  2BA9 A;  4G9K A;  3EPT A;  4U2S A;  1JNR A;  3QVR A;  3LZW A;  1CF3 A;  1Y56 A;  1GV4 A;  4IVM B;  2V6O A;  5LV9 A;  4OCG A;  4JY3 A;  4U8O A;  3SM8 A;  1GT8 A;  1ZK7 A;  2WHD A;  3PVC A;  4U8J A;  5J60 A;  4C3Y A;  4YTN A;  1RSG A;  5KXJ A;  2UZZ A;  2E1M A;  1KDG A;  3F8P A;  5BVA A;  3PG6 A;  2H88 A;  4FK1 C;  1LJ1 A;  4IA6 A;  3HYX A;  2B7R A;  1H83 A;  4Z44 A;  3T14 A;  4EIQ A;  1YY5 A;  2XYO A;  1EL8 A;  1GTH A;  2IID A;  1GRG A;  4H4R A;  1RP0 A;  3AEA A;  4PAB A;  2FJD A;  1DNC A;  1PXC A;  5BUK A;  3VRA A;  5KMP A;  3IWA A;  3NT6 A;  1FEC A;  1FEA A;  3DJJ A;  1D5T A;  4IA5 A;  1B37 A;  2E4G A;  2GAH B;  1CJ2 A;  2WOW A;  2ZZB A;  2BS3 A;  2VVL A;  5TR3 A;  1TYP A;  2CDU A;  1LQU A;  3CNS A;  3CPH G;  4BJY A;  1KSU A;  5CQF A;  2FJE A;  1E6E A;  3NH3 X;  5HY5 A;  1PN0 A;  1H6V A;  2EQ7 A;  2YAU A;  5KVH A;  1TDN A;  3F8R A;  2BYB A;  3PS9 A;  4RG4 A;  3NYE A;  1QJD A;  2Q6U A;  4A99 A;  4K7Z A;  2YR5 A;  1S2Y A;  1ZOY A;  5EBK A;  5CKU A;  5BUL A;  5FS9 A;  1K4Q A;  1JU2 A;  2V3B A;  1GND A;  4A6N A;  2BC1 A;  4Z43 A;  3VRB A;  4C5O A;  3BHF A;  1TYT A;  4OPI A;  3QFB A;  1BGJ A;  1CL0 A;  2WDQ A;  3UP5 A;  4DSH A;  2VQB A;  1GRT A;  4UP3 A;  3AEC A;  5GRT A;  2XLR A;  3CPJ G;  3AE9 A;  3GD3 A;  4K8D A;  1IJH A;  4EM4 A;  4AP3 A;  1OJD A;  5JRB A;  3M13 A;  1N4W A;  4TM3 A;  3AB1 A;  4H2P A;  1GET A;  3BNM A;  1IUS A;  1P2H A;  3GMB A;  4NNJ A;  1CJ3 A;  3CIR A;  2R0G A;  1JNZ A;  1DOC A;  1X31 B;  4EMJ A;  1UKV G;  3I6D A;  2Z5Y A;  1F8R A;  3UTF A;  4EQX A;  5HYM A;  1NDA A;  2Y6Q A;  3UP4 A;  4D03 A;  3L1R A;  2GV8 A;  2PHH A;  4BK2 A;  1YQ3 A;  1S3B A;  2BS2 A;  1H82 A;  3VQR A;  4YSY A;  1E1K A;  3C4N A;  4EQW A;  1CC4 A;  1DJN A;  1NAA A;  4HA6 A;  1DOD A;  1GRH A;  1TDE A;  2ARD A;  3K7M X;  3M0O A;  3UKK A;  3V3N A;  5KOW A;  3QFA A;  3AE1 A;  4X9N A;  4WCT A;  3K7T A;  4TLZ A;  4D04 A;  1BZL A;  4A9W A;  2YM2 A;  3UOZ A;  4TM1 A;  3SFD A;  3LAD A;  2TMD A;  3IHM A;  4OPD A;  2Q7V A;  2QCU A;  2WPE A;  1ONF A;  1CHU A;  1YQZ A;  1RYI A;  1SEZ A;  4WX1 A;  4ZCD A;  4MJW A;  4O5Q A;  5EOW A;  1IUV A;  4Y4M A;  4ADW A;  4M52 A;  2Q0K A;  4K5S A;  4LII A;  2WET A;  1EBD A;  2XVJ A;  2JAE A;  3AE2 A;  5KMS A;  1EL9 A;  3URH A;  1PBB A;  2JB2 A;  2OAL A;  1GRB A;  3AE4 A;  4TLX A;  4A65 A;  2B9Y A;  2WS3 A;  2YG3 A;  3RP6 A;  3EF6 A;  1PHH A;  3UOX A;  4RSL A;  4YTP A;  5JCL A;  4AT0 A;  1OJA A;  3UKP A;  3K7Q X;  3L5O A;  4AOX A;  2BCG G;  4EQR A;  3FG2 P;  5FMH A;  2BK4 A;  3BI4 A;  4YXD A;  1KF6 A;  2GQF A;  4USR A;  2V5Z A;  2GQW A;  4C74 A;  3RHA A;  4Z2T A;  1K0L A;  3D1C A;  2AAQ A;  3GDP A;  3HZL A;  2EQ9 A;  3SGL A;  2XDO A;  3M12 A;  4J36 A;  4U8L A;  2TPR A;  4P9S A;  2VZ2 A;  4B66 A;  2FBW A;  3AE7 A;  1PJ7 A;  4PAA A;  1LVL A;  1PJ6 A;  3AWI A;  4NZH A;  5JCM A;  2APG A;  4GCM A;  2O9Z A;  1VRQ B;  4JY2 A;  1PDH A;  5IQ1 A;  3AYJ A;  4K5R A;  2W0H A;  3UKH A;  4X4J A;  2JB3 A;  3H4K A;  3DK9 A;  1Y56 B;  4NTC A;  1L9E A;  1PBD A;  4CCQ A;  2ZBW A;  2X8C A;  4HB9 A;  5M0Z A;  1IUW A;  1JEH A;  2WP9 A;  1E1L A;  3CTY A;  1CJC A;  4H4Z A;  4BV6 A;  3D8X A;  3D9X A;  3AE5 A;  4IV9 A;  2YVJ A;  3DJG X;  1GER A;  3SFE A;  5KWF A;  1GES A;  4GUV A;  2C7G A;  1NHP A;  2YR6 A;  3RED A;  4CRT A;  1O95 A;  1GPE A;  1L0V A;  2ZZC A;  3BNU A;  3FIM B;  3UTE A;  4H7U A;  3GYX A;  4Z24 A;  3ATQ A;  2GH5 A;  1BF3 A;  3GSI A;  2YQU A;  1E7P A;  2YVF A;  4B1B A;  1E1M A;  2WU2 A;  3H8L A;  3LZX A;  4B69 A;  4OPG A;  1LV0 A;  4H4Y A;  1MO9 A;  4YKG A;  4EM3 A;  1HYU A;  1KFY A;  3AEG A;  5HXI A;  2C67 A;  1Y0P A;  4X9M A;  3UCL A;  2GAG B;  4BK3 A;  1ZX9 A;  3CNT A;  2XFP A;  3SY4 A;  4H2R A;  4XXG A;  1F6M A;  2R4E A;  4B64 A;  3CGE A;  4K22 A;  4J57 A;  3KPF A;  2JK6 A;  3DK8 A;  2C72 A;  3K30 A;  2X99 A;  2WDR A;  4G6G A;  3AE6 A;  2J3N A;  2B7S A;  4FDC B;  3DME A;  4YSX A;  1S7M A;  4BUR A;  1DXL A;  1NPX A;  2WP5 A;  1F3P A;  3G5S A;  3BI5 A;  1ZOV A;  2BXR A;  4AT2 A;  2JKC A;  1NEN A;  4ECH A;  2QA1 A;  3DJE A;  3KKJ A;  5IPY A;  3IHG A;  1BKW A;  2WOI A;  2RGH A;  5C3J A;  2XVH A;  2XVE A;  3AD9 B;  2YG7 A;  4OPT A;  1COY A;  2WES A;  3CGC A;  4CCR A;  3CN8 A;  4APN A;  4FK1 A;  2GRT A;  4JN9 A;  1O94 A;  1XDI A;  2A87 A;  2NVK X;  4U8P A;  1NHR A;  2YLT A;  4U8K A;  2GVC A;  3R9U A;  3NK2 X;  4U2T A;  1DOB A;  3ISH A;  3UKL A;  2VQ7 A;  3KU9 A;  1XHC A;  3SZ0 A;  3AE3 A;  2XVF A;  4A5L A;  3GRS A;  1VG0 A;  2OLN A;  4U2L A;  3GMC A;  3QSS A;  4NTE A;  3S5W A;  4Z25 A;  5C2T A;  3CMM A;  2BRY A;  3F8D A;  3LOV A;  3UTH A;  1IUT A;  3KVE A;  3O0H A;  3EAO A;  2C70 A;  2FJA A;  3FBS A;  2C3D A;  3AED A;  2JB1 A;  2X8G A;  1YKJ A;  2Z5X A;  1ZP0 A;  1S2Q A;  3QSE A;  1PJ5 A;  3VR9 A;  4G6H A;  1EL7 A;  2X3N A;  3BI2 A;  3QSM A;  1N1P A;  4ICY A;  3NNE A;  4GDE A;  4UDQ A;  4XWR A;  4Z2R A;  1QO8 A;  3AEE A;  2VVL G;  2XLT A;  2XFU A;  2EQ8 A;  2WU5 A;  5ER0 A;  2XVI A;  3NLC A;  2YR4 A;  5GSN A;  3I3L A;  1PBC A;  2YLX A;  4O5U A;  3ALL A;  1GSN A;  5HHF A;  3V76 A;  1KN0 A;  1K0J A;  5U63 A;  5KMR A;  3UKQ A;  1KSS A;  1ZMD A;  3AE8 A;  3FMW A;  2XLU A;  3AXB A;  4TM4 A;  1MXT A;  1V59 A;  4YKF A;  3EAN A;  4NTD A;  3AD7 B;  2YG5 A;  1NG4 A;  2YLR A;  3GWF A;  2BC0 A;  2XLS A;  3NTD A;  4BK1 A;  2RAB A;  4YSZ A;  3NGC X;  1PXB A;  1H7X A;  2C75 A;  1B4V A;  2VOU A;  3CNP A;  5JCN A;  2R46 A;  4RG3 A;  3V3O A;  1JRZ A;  5FS7 A;  1LQT A;  4GAV A;  2C73 A;  4U8I A;  2BK3 A;  2V60 A;  3NYC A;  2B9X A;  3PO7 A;  3SZC A;  2GR0 A;  1TRB A;  3COX A;  3ITJ A;  3KPK A;  4OVI A;  4USQ A;  5JCI A;  1GAL A;  2R0P A;  1H7W A;  5KOX A;  2X8H A;  3P4P A;  3CPI G;  4I58 A;  4H4P A;  3Q6J A;  4H4W A;  3G5R A;  3B6D A;  3II4 A;  4OPC A;  1PBE A;  2C3C A;  2WPF A;  1CC6 A;  3KLJ A;  1F8S A;  3ALM A;  3HYW A;  4G73 A;  3VR8 A;  5BRT A;  1LTX R;  1DOE A;  4H50 A;  1CJ4 A;  4EMW A;  3UOV A;  1E1N A;  1H84 A;  3DA1 A;  4DSG A;  3NTA A;  3SZW A;  3CND A;  3T2K A;  3AD8 B;  4CNK A;  4N9X A;  1FOH A;  1FL2 A;  2RGJ A;  2WBA A;  5EB4 A;  4GRT A;  2BCP A;  1KNP A;  2XCG A;  3UKF A;  4YWO A;  3NYF A;  2GR3 A;  2VVM A;  2XFQ A;  3ZYX A;  4BJZ A;  1GRA A;  4J56 A;  1E39 A;  4CBQ A;  4ZN0 A;  4U8M A;  3GWD A;  4JNA A;  1OJ9 A;  2Q0L A;  2V61 A;  2GB0 A;  1JRY A;  3ATR A;  2WOV A;  2NPX A;  3HYV A;  4A6N B;  4E0V A;  4FX9 A;  3AEB A;  2AR8 A;  1IUX A;  3SYI A;  1ZY8 A;  4YT0 A;  1VDC A;  2YLW A;  5U25 A;  1D4C A;  4GF7 A;  3OC4 A;  4REK A;  4B63 A;  1ZMC A;  2CVJ A;  1PS9 A;  1VG9 A;  1XPQ A;  2C76 A;  4J34 A;  2BK5 A;  3DK4 A;  4DNA A;  2ACZ A;  2E5V A;  5IQ4 A;  1NG3 A;  3KD9 A;  4GAP A;  1F8W A;  1S3E A;  4AP1 A;  1KNR A;  2GR2 A;  2XLP A;  3IF9 A;  3GRT A;  4XWZ A;  2FJB A;  4NEV A;  2GEW A;  1DJQ A;  2JBV A;  2IVD A;  2AQJ A;  3ICT A;  4II3 A;  3NG7 X;  2R4J A;  1NHQ A;  3VRD B;  2C64 A;  3L8K A;  1JRX A;  3CNJ A;  2CUL A;  3T2Z A;  4B65 A;  1BWC A;  3OZ2 A;  4H4S A;  2C65 A;  1Q1R A;  4G74 A;  5KVI A;  3QVP A;  5DBJ A;  2A89 A;  3RNM A;  2VRL A;  3AYL A;  2XFN A;  2YG4 A;  3H8I A;  1GOS A;  3T37 A;  5KNL A;  4LU6 A;  4EQS A;  1JOA A;  2OLO A;  4Y4N A;  3T0K A;  3NKS A;  2DKI A;  4CY6 A;  1FCD A;  2BAC A;  3C96 A;  3P9U A;  4UDP A;  1TDF A;  2GMH A;  2ZZ0 A;  1P2E A;  4II2 A;  4IVO B;  3ADA B;  1B8S A;  1L9D A;  3ALJ A;  4UDR A;  1GRF A;  3GD4 A;  5U1O A;  1Q9I A;  2GMJ A;  2XFO A;  2Y6R A;  3C4A A;  2C4C A;  3DH9 A;  1H81 A;  1NEK A;  3GYJ A;  3CGD A;  1VQW A;  3QJ4 A;  4I59 A;  1PXA A;  2C66 A;  2WEU A;  2BAB A;  4J2W A;  1ZKQ A;  2CFY A;  1B5Q A;  2WQY A;  3LB8 A;  4H2Q A;  3AYI A;  4C77 A;  1AOG A;  4OPL A;  2YVG A;  1YQ4 A;  1BGN A;  2IVE A;  4GDP A;  2BXS A;  4J33 A;  4OPU A;  1OJT A;  1OJC A;  4KX6 A;  5KMQ A;  4EIP A;  3LXD A;  1D4E A;  3B3R A;  2WPC A;  4JNQ A;  3SXI A;  1CBO A;  3UOY A;  1FEB A;  2B76 A;  3SZF A;  5J7X A;  2GR1 A;  4NEW A;  2R0C A;  1TDK A;  2YWL A;  1IUU A;  1REO A;  1H86 A;  4YTM A;  3ABV A;  4Z26 A;  3SX6 A;  2F5Z A;  3KA7 A;  4GR1 A;  3E1T A;  3Q9T A;  1W4X A;  1ZDL A;  3G5Q A;  3NHO X;  5M10 A;  4H4U A;  2QA2 A;  3RP8 A;  1M64 A;  3UTG A;  1NHS A;  2R9Z A;  3CGB A;  4EMI A;  1GXF A;  3GDN A;  1QLB A;  2YM1 A;  3NK0 X;  2X50 A;  3NN6 X;  2YLZ A;  4H4X A;  3T31 A;  1GTE A;  2WDV A;  1L9C A;  4KPR A;  2H89 A;  2VRM A;  4B68 A;  4DGK A;  1D7Y A;  1N4U A;  4J31 A;  1Z6L A;  3ICR A;  3S61 A;  3JSK A;  3LJP A;  1H2I A;  2EQ6 A;  1MOK A;  4H4T A;  2I0Z A;  3P4Q A;  4A7A A;  4H4Q A;  2BRA A;  1Q1W A;  5EB5 A;  3ICS A;  1N4V A;  4ZCC A;  1K0I A;  4TM0 A;  3GYI A;  3NK1 X;  3WE0 A;  3NIX A;  4C3X A;  4Z2U A;  2GF3 A;  4U8N A;  3ZDN A;  4CY8 A;  3AEF A;  3SQP A;  5JCK A;  2RGO A;  4H2N A;  1M6I A;  4B67 A;  4JQ9 A;  2B9W A;  1CC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...