5FS7A

Crystal structure of the g262s mutant of human apoptosis inducing factor
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
487
structure length
449
Chain Sequence
b'DKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGSTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Structure/Function Relations in Aifm1 Variants Associated with Neurodegenerative Disorders.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 149
structure length 449
sequence length 487
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fs7A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs7A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs7A01
1IUVA 1TRBA 4OVIA 5M10A 3NK1X 1RSGA 2Y6QA 3CTYA 4ECHA 3KLJA 4H4RA 2R0PA 4OPGA 1RP0A 3BNMA 3SM8A 1S2YA 4Z44A 4K7ZA 3C4AA 3AE8A 4IVOB 2CDUA 1JNRA 4YT0A 4H2PA 1CJ2A 2WU5A 4OCGA 2V3AA 1NG3A 4TM0A 3CNTA 2BS3A 2X50A 1K0JA 4GCMA 3LADA 4HB9A 3UP4A 4C3YA 1PJ7A 2BACA 1LQUA 4YTPA 4O5UA 5KXJA 3NG7X 3V3NA 1H86A 2O9ZA 2WPEA 4H4QA 3AE6A 1NHQA 2RABA 2YVGA 2YR5A 1P2HA 3GYIA 5JCKA 4Z26A 2JK6A 1E1NA 2YG3A 4TM1A 3L8KA 1CHUA 2AR8A 2FJEA 3GMCA 3OC4A 4A5LA 4ZN0A 1FECA 2XDOA 2V6OA 1NPXA 1E6EA 1IJHA 1KDGA 2WQYA 4K2XA 1ZKQA 2V61A 1N1PA 4KX6A 4LIIA 4FK1A 4AP3A 4EM3A 1NHRA 4IA6A 2F5ZA 1D4EA 5HYMA 1E1MA 4H2NA 4LU6A 4IA5A 5KOWA 2X8HA 2EQ8A 4ZCDA 1UKVG 1IUWA 4MJWA 2WDRA 2R4EA 3VRAA 4CY6A 1GREA 2ACZA 1PN0A 2GQWA 3VR8A 4KPRA 3AE5A 3V3OA 2YLTA 3M13A 1ZMCA 2YVFA 2BK4A 2RGJA 3P4QA 1S3BA 3GYJA 3NKSA 3GDPA 5KVIA 3NN6X 4A6NB 4CCQA 3BNUA 1IUUA 4IV9A 2NPXA 3UTFA 3NH3X 5HXIA 1H83A 5HHFA 2YM2A 2ZZ0A 2R4JA 1OJDA 3AB1A 1VRQB 3H8LA 3FG2P 1B4VA 4H2RA 1PXCA 4H50A 1V59A 1GXFA 1E7PA 1HYUA 4K8DA 1KNRA 2UZZA 1GALA 3AEEA 3ALLA 5IPYA 3ALJA 3B6DA 4U8KA 3QJ4A 2WEUA 5L46A 1NHPA 2WPCA 2R0GA 3AD8B 2Q6UA 3BI4A 3UKKA 2YQUA 1M6IA 4J34A 3LB8A 3UKQA 4NTDA 4Z2RA 1EBDA 2YAUA 1NG4A 4GUVA 5HY5A 1CJ4A 4GDPA 3UOZA 5M0ZA 1H7WA 1TYTA 2C3DA 3IHMA 1NAAA 3DGHA 3ATRA 3AYLA 2BA9A 3UKPA 3UOYA 1GESA 1SEZA 3UOVA 1E39A 2JAEA 3NNEA 3UTGA 2DKHA 1PS9A 1H82A 1B37A 4NEVA 2X8CA 3LJPA 3BHFA 1VQWA 2R45A 4UDQA 3VRBA 3SQPA 3URHA 3H8IA 4BJYA 1EL8A 1B8SA 1D4DA 3P9UA 3V76A 3CN8A 2OLNA 1JEHA 4WCTA 2XVEA 4APNA 2B9YA 3UP5A 1JRYA 1BGJA 3ZYXA 2C66A 4Y4LA 1L0VA 2VVLA 1ZK7A 1ZOYA 2Q7VA 2V5ZA 3FPZA 2X3NA 4NEWA 2VOUA 3AEGA 4J31A 1N4VA 4YSYA 3PO7A 1BGNA 1GTHA 2FBWA 3FBSA 1D7YA 4J33A 1LPFA 3GWDA 4P9SA 2XFUA 4TM3A 3PVCA 4FDCB 5BVAA 1TDNA 3UKFA 5KOXA 3G5RA 3O0HA 3CNJA 1F6MA 1E1KA 4YSZA 4U2SA 1YQ3A 2XYOA 3GMBA 1CC6A 3DK9A 3BI2A 1NHSA 3AEBA 1S2QA 4CCRA 3ALMA 2YG6A 1Y56A 2YLSA 3FIMB 4H4SA 4CNKA 2WP5A 4K5SA 4NTEA 3GWFA 3E1TA 2XVFA 3BI5A 1NENA 1GV4A 2NVKX 4AOSA 2C75A 2YLWA 3CGEA 1OJ9A 4CRTA 5KRQA 3AE1A 2IIDA 4GR1A 1Y0PA 4J57A 5IQ1A 5FS9A 3F8PA 3CGBA 2C65A 1PJ6A 3AEDA 3NYCA 3QVPA 2C3CA 3II4A 1PBBA 2WP6A 3IWAA 2A8XA 1TDFA 2GVCA 4B68A 1XPQA 1JNZA 1EL5A 1D7LA 1F8RA 1K0LA 3DJEA 3UTEA 4Y4MA 2BK5A 3UKAA 2HQMA 3D1CA 3F8DA 1L9DA 4GRTA 1NEKA 1MOKA 4H4ZA 4OPCA 4YTNA 1OJAA 1CJ3A 2BCGG 2GF3A 2GAGB 4JNAA 1L9EA 2E4GA 4M52A 2BCPA 2ZZCA 1Z6LA 2Q0LA 3Q6JA 4B66A 3D8XA 2GB0A 5FS6A 3LOVA 3CPIG 2XFPA 1FEAA 1ZP0A 3BHKA 1Q1WA 3NK0X 3HZLA 3T37A 1LJ1A 2VZ2A 2BS2A 3LZXA 3KKJA 2OAMA 1QLBA 1JOAA 1PXBA 2VVMA 2ZBWA 3RP6A 1CJCA 2XLPA 1ZMDA 1DOBA 1TDKA 4YKFA 3GD3A 3DJJA 2I0ZA 2JB2A 4UP3A 5CQFA 1M64A 4H4TA 2C64A 3Q9TA 2YG5A 4PABA 1BZLA 4USRA 3UKHA 2A89A 3GRTA 4C77A 5EB4A 4DSHA 2GEWA 3LXDA 4EMIA 1QJDA 3AWIA 3AXBA 4O5QA 5BULA 3NRNA 4EQSA 1RYIA 2X99A 3K7MX 4XXGA 4ZCCA 1JRZA 4EQXA 3AE9A 1PDHA 4U8IA 4BK1A 4UDPA 2DKIA 4FK1C 3L1RA 1ZOVA 3GRSA 4B69A 4K5RA 3B3RA 3GDNA 2BABA 1TDEA 2GRTA 1QO8A 3C4NA 2AAQA 1EL7A 1O5WA 2CVJA 2QA2A 3CIRA 4H4PA 2XLUA 3NLCA 2WBAA 3DGZA 1CC4A 1H7XA 3CNPA 2QA1A 2WESA 1E1LA 4UDRA 1XDIA 1DJNA 1AOGA 1H81A 1FOHA 3KU9A 2QAEA 5IQ4A 4X9MA 1FL2A 1REOA 2WPFA 4JY3A 2XFOA 2GR2A 2WOVA 4I59A 2V3BA 3G5QA 5FS7A 1Q9IA 3AEAA 3UCLA 4TM4A 2YWLA 4YSXA 3EF6A 1OJTA 3NN0X 2IVDA 3ICRA 4A7AA 2FJDA 2RGOA 4Z24A 4AT2A 2VRLA 2YR4A 3K7QX 3DH9A 1K0IA 1KF6A 3RHAA 4C3XA 2RGHA 2E5VA 1W4XA 4USQA 2EQ9A 2EQ6A 2OA1A 3R9UA 2YG7A 4YSHA 5TR3A 3NGCX 1D5TA 1DNCA 5JCNA 4WX1A 1GERA 2QCUA 4A9WA 5FS8A 1TDOA 2CFYA 4JN9A 3NK2X 4EMWA 1FCDA 4B64A 4U8NA 2Z5YA 4JY2A 4A65A 1ZY8A 4E0VA 2C7GA 2XLTA 5KWFA 2FJAA 3KA7A 4B63A 4Z25A 1LQTA 2CULA 1YKJA 2BK3A 1F8SA 1Q1RA 1PXAA 2GMJA 3ITJA 4J36A 2YLXA 3VRDB 4TLZA 3ABVA 2TMDA 2YLRA 1ONFA 3SFEA 2H89A 1H84A 2PYXA 3AYIA 4A79A 2XFQA 2W0HA 5U63A 4Y4NA 1IUSA 2ARDA 4GDEA 3I6DA 4OPLA 1P2EA 4OPDA 5J7XA 1CL0A 1PBCA 4D03A 1ZDLA 4EIQA 3S5WA 3QSSA 2EQ7A 1X31B 1LTXR 1YQZA 2GAHB 4TLXA 1N4UA 4X4JA 2WOIA 1DOEA 4EQRA 5GRTA 2WETA 1L9CA 2JB3A 1GOSA 5U1OA 3DJDA 3NTDA 4U2LA 4H4UA 4C74A 4D04A 4YXDA 4BJZA 5J60A 1GEUA 1YQ4A 3GSIA 4REKA 4EMJA 1PHHA 1VDCA 1BF3A 2VQBA 2VRMA 3P4SA 3UOXA 2BC1A 1Y56B 3CNSA 3AE3A 3C96A 1GRFA 1N4WA 2ZZBA 2GH5A 2BYBA 4J2WA 2XVIA 2BC0A 2GQFA 2JKCA 2VVLG 3M12A 3AE7A 1JRXA 2APGA 4RG4A 5GSNA 2WP9A 4X9NA 3LZWA 4A6NA 5JCIA 4HA6A 3DJGX 2WOWA 1PBFA 3NYEA 2OLOA 4YTMA 4DGKA 3DMEA 1IUTA 2Y6RA 3P4RA 1GT8A 2WDQA 4ADWA 3F8RA 4NTCA 1B5QA 3DK4A 2YR6A 3SFDA 4EM4A 3QSEA 1F3PA 3ICTA 5EBKA 4XWZA 4JNQA 2C67A 5JCMA 1GRAA 1ELIA 2WU2A 2J3NA 3QFBA 4RG3A 3S61A 4YWOA 1PJ5A 2B76A 1KFYA 4K22A 1YY5A 3GD4A 2V60A 2JBVA 3P1WA 2R9ZA 1KSSA 2YM1A 2BXSA 3QSMA 4U8MA 2WHDA 4EQWA 1TYPA 3H4KA 1COYA 1GTEA 2C72A 3UTHA 4CY8A 4H7UA 5CKUA 1D4CA 2FJBA 4FX9A 4AOXA 2XFNA 3P4PA 2OALA 4U8LA 2AQJA 3IF9A 3NT6A 3IC9A 3I3LA 1MO9A 3KD9A 2B9XA 1KNPA 3AE4A 3EANA 1DOCA 3NYFA 5C2TA 3AD7B 4B65A 5BRTA 1XHCA 4BK3A 1JU2A 3ATQA 4JQ9A 2Z5XA 5EB5A 1GSNA 3NHOX 3QVRA 5FMHA 3OZ2A 4NZHA 3G5SA 2C76A 3AD9B 1CF3A 3AEFA 2E1MA 1BWCA 4IVMB 4OPUA 1LV0A 4PAAA 1GRHA 2B7RA 3CNDA 1CC2A 4CBQA 4H4WA 1OJCA 3EAOA 4BK2A 2R46A 4J56A 5KVHA 5LV9A 4GF7A 4OPTA 3SGLA 4DSGA 1DXLA 3CGDA 1F8WA 4DNAA 2IVEA 1GRGA 3RNMA 2XLSA 2C73A 4AT0A 1LVLA 1NDAA 2H88A 3CPJG 4I58A 5JCLA 4Z2UA 2JB1A 4H4XA 3RP8A 4B67A 3QFAA 2R0CA 3COXA 4OPIA 2YG4A 3VQRA 4CNJA 4BURA 2Q0KA 4JDRA 1GRBA 4EIPA 4U2TA 3M0OA 1FEBA 3WE0A 1S3EA 1MXTA 3CPHG 3FMWA 1BKWA 4ICYA 3REDA 3ZDNA 1H6VA 4H4VA 2C70A 1O95A 4RSLA 4XWRA 2PHHA 4A99A 5U25A 4N9XA 1DJQA 2XCGA 4H4YA 1ZX9A 4U8OA 3K30A 5BUKA 3CGCA 2GR3A 4BV6A 3VR9A 2WDVA 2YLZA 4Z43A 3AE2A 1GRTA 2XVJA 1VG9A 1DODA 3DA1A 4B1BA 3KPFA 3RP7A 1KSUA 3NIXA 2B7SA 3ADAB 3ICSA 1O94A 3KVEA 1GETA 1IUXA 3IHGA 4YKGA 2GMHA 1K4QA 5EOWA 4Z2TA 4H2QA 4C5OA 1XANA 2GR0A 2WS3A 2TPRA 3PS9A 4LA1A 1PBEA 2XVHA 5ER0A 5C3JA 3ISHA 1GNDA 2X8GA 1VG0A 2GR1A 1GPEA 4U8PA 2B9WA 4U8JA 3UKLA 1CBOA 1EL9A 2GV8A 2BXRA 3NTAA 2XLRA 2BS4A 3AYJA 3AECA 3JSKA 5DBJA 2A87A 2VQ7A 3EPTA 4AP1A 3K7TA 1PBDA 2YVJA 3DK8A
chains in the Genus database with same CATH superfamily
3ENLA 1IUVA 1PDZA 4OVIA 2Y6QA 3MSYA 4OPGA 3SM8A 3VCCA 3AE8A 4IVOB 4H2PA 3CNTA 2BS3A 4HB9A 4E5TA 3LADA 1PJ7A 2BACA 2WPEA 4H4QA 3RCYA 2YVGA 1P2HA 1E1NA 2FJEA 4ZN0A 1E6EA 2V61A 1FHUA 4KX6A 2OG9A 4E4FA 4IA6A 1D4EA 4H2NA 3I4KA 1P48A 5KOWA 3T2YA 3RO6A 1UKVG 3VRAA 3VR8A 2OVLA 4KPRA 2YVFA 7ENLA 4TVYA 3GYJA 5KVIA 4A6NB 1T3QC 4JN7A 3DFYA 2POZA 2ZZ0A 3FG2P 1B4VA 2UZZA 1GXFA 4K8DA 5IPYA 3B6DA 3QJ4A 2WEUA 4NNJA 2WPCA 2Q6UA 3BI4A 2YQUA 4J34A 2I5QA 1STZA 1CJ4A 3SZCA 3VC5A 5M0ZA 3DGHA 3AYLA 1GESA 1SEZA 3UOVA 3SZ0A 1PS9A 3LJPA 3VRBA 3SQPA 4BJYA 3GD6A 1B8SA 1D4DA 1JEHA 1BGJA 3ZYXA 3QTPA 1ZOYA 4NEWA 3FBSA 4P9SA 1LPFA 3GWDA 3SYIA 2PTZA 1F6MA 1E1KA 4U2SA 3GMBA 3SXIA 3BI2A 3AEBA 1S2QA 4CCRA 3ALMA 4A3RA 4Z1YA 4H4SA 3P0WA 4K5SA 4NTEA 3GWFA 3DIPA 2NVKX 4CRTA 3AE1A 2IIDA 4GR1A 4J57A 4DN1A 1SB3B 2C65A 2FYMA 2WP6A 3UTEA 2HQMA 2QJJA 4OPCA 2GF3A 3GY1A 1JPMA 3SN1A 3LOVA 2XFPA 1FEAA 3T37A 2VZ2A 2OAMA 4ZCWA 2VVMA 1TDKA 4YKFA 5CQFA 4UP3A 1M64A 3PWIA 2A89A 3KPKA 3SZWA 3LXDA 3AWIA 3NRNA 2P8CA 3BJSA 2PCEA 3P93A 4EQXA 2QJMA 2DKIA 5G5HB 3K1GA 2CVJA 1O5WA 2QA2A 3SSZA 4IHCA 2XLUA 3CMMA 2WBAA 1H7XA 2WESA 1AOGA 5IQ4A 1FL2A 4I59A 3EF6A 3D9XA 1N61C 4Z17A 3NN0X 2IVDA 2FJDA 2RGOA 4K8GA 4USQA 4II3A 3EEZA 2OA1A 3MWCA 1GERA 2CFYA 4B64A 2XLTA 5KWFA 1LQTA 1Q1RA 3ITJA 3MZNA 1H84A 4J1OA 2PYXA 4G73A 5IDZA 3OZMA 3QKEA 4GDEA 4OPLA 1PBCA 1ZDLA 3QSSA 1YQZA 2GAHB 1N4UA 2WOIA 3JW7A 2WETA 4JN8A 1L9CA 2OLAA 4U2LA 3PFRA 1YQ4A 1BF3A 1Y56B 4H1ZA 3CNSA 3PWGA 2ZZBA 2BYBA 3GC2A 2JKCA 2APGA 2OLOA 4YTMA 5ENLA 1IUTA 1H2IA 2WDQA 4ADWA 3F8RA 3STPA 3HRDC 3DK4A 3NFUA 4EM4A 1F3PA 1W6TA 3ICTA 3A7UA 1GRAA 5J04A 3S61A 4K22A 1YY5A 2R9ZA 1EBHA 1TZZA 1COYA 3S5SA 4H7UA 1D4CA 3IC9A 2B9XA 3NYFA 1XHCA 1JU2A 3ATQA 1GSNA 3QVRA 2PA6A 3UJFA 3AD9B 1CF3A 3AEFA 1BWCA 1LV0A 1GRHA 3CNDA 1CC2A 3T2ZA 3EAOA 4DYEA 3SJNA 4J56A 2OZ3A 5LV9A 4GF7A 3T6CA 2HXUA 2IVEA 2XLSA 4E4UA 2C73A 4DHGA 5JCLA 4B67A 3ZLGA 4ZOHB 3COXA 4OPIA 4CNJA 4BURA 4JDRA 1GRBA 4MKSA 1MNSA 4KEMA 1BKWA 1H6VA 2C70A 1O95A 2PHHA 4H4YA 4U8OA 4BV6A 3VR9A 2QQ6A 3R0KA 3AE2A 2XVJA 3KPFA 1KSUA 3NIXA 1O94A 2GMHA 1K4QA 4Z2TA 3GYXA 4C5OA 1XANA 2PP3A 3PS9A 3DEQA 1PBEA 5ER0A 4U8JA 1JROA 5FJOA 3UKLA 2PTXA 2PODA 3AYJA 3NVVB 3NXLA 4AP1A 1PBDA 4TVWA 4H4RA 4NWZA 2OFJA 3OZYA 4Z44A 2CDUA 2WU5A 1MRAA 2V3AA 4C3YA 4GCMA 3UP4A 3T0KA 1LQUA 4YTPA 1ECQA 2RABA 3GYIA 5JCKA 3RR1A 1N60C 3UJSA 3L8KA 2AR8A 3OC4A 2V6OA 1IJHA 1KDGA 1N1PA 4LIIA 5KNLA 4EM3A 1NHRA 3UJRA 2F5ZA 3DESA 1X2HA 3I6EA 4IA5A 4H19A 1JDFA 3MUCA 4MJWA 3IJQA 2R4EA 2WDRA 2ACZA 1PN0A 2GQWA 3ZLHA 3M13A 4CCQA 3BNUA 3ETRB 1IUUA 3ZVHB 4IV9A 5HXIA 1N62C 2PPGA 2R4JA 1OJDA 1VRQB 3H8LA 4H2RA 1PXCA 1E7PA 1KNRA 3N6JA 1GALA 3D46A 5L46A 1EC8A 4Z2RA 3UKQA 4NTDA 4HNLA 4GUVA 1TYTA 3VCNA 2BA9A 3UKPA 2JAEA 2DKHA 2X8CA 4IZGA 3UXLA 3HW2A 3BHFA 3H8IA 1EL8A 2OLNA 2XVEA 1FIQB 4APNA 3V5CA 2B9YA 4F4RA 2VVLA 4J31A 5FJRA 1BGNA 1GTHA 1D7YA 4J33A 2XFUA 2XSXA 2P8BA 1TDNA 3UKFA 3CNJA 4YSZA 3TCSA 1YQ3A 3DK9A 4IP5A 2WP5A 2MUCA 3Q4DA 2XVFA 3DERA 3FYYA 2C75A 3CGEA 1OJ9A 5KMRA 5KRQA 4E6MA 1Y0PA 3ES8A 3UCDA 3NRZB 3F8PA 3QVPA 1PJ6A 3AEDA 3NYCA 3SX6A 2A8XA 1XPQA 1EL5A 3DJEA 1KCZA 1IYXA 3D1CA 3F8DA 2GGEA 1CJ3A 4JNAA 2E4GA 3QLDA 3Q6JA 5FS6A 3CPIG 1Q1WA 3NK0X 3HZLA 2BS2A 2PU1A 1JOAA 2BRYA 2ZBWA 1ZMDA 3GD3A 2I0ZA 1WYGA 2E3TA 2C64A 3Q9TA 1BZLA 3GRTA 3ZVIA 4DSHA 3JZUA 3S47A 2C4CA 4KT2A 2W55A 2PP0A 3AE9A 3BSMA 4BK1A 3CAWA 3L1RA 2W3RA 3GRSA 4B69A 4K5RA 3B3RA 4DX3A 3GDNA 2BABA 4DGKA 2GRTA 1QO8A 3DGZA 1E1LA 2BRAA 4IL0A 1DJNA 1H81A 5KMQA 2QAEA 4JY3A 2GR2A 2WOVA 5FS7A 4TM4A 4YSXA 1OJTA 3ICRA 4A7AA 2VRLA 1K0IA 1KF6A 4C3XA 2MNRA 2E5VA 3R9UA 4YSHA 5TR3A 4G6GA 1D5TA 4A9WA 5FS8A 4EMWA 4U8NA 1ZY8A 4DXKA 2C7GA 4X2PA 2BK3A 2GMJA 3NVYB 2YLXA 3VRDB 4TLZA 3SFEA 3AYIA 2QDDA 2XFQA 5U63A 1IUSA 3I6DA 1P2EA 1CL0A 3T9PA 4EIQA 1X31B 1GOSA 3DJDA 3NTDA 4D04A 5J60A 2DW7A 3P4SA 3UOXA 1EBGA 1N4WA 2XVIA 4M6UA 2WP9A 4A6NA 3UXKA 5JCIA 1PBFA 1N5XA 2XH7A 4HN8A 1R6WA 4NTCA 1N63C 5EBKA 4XWZA 4JNQA 5JCMA 2ZC8A 3KUMA 4GYPA 4RG3A 2B76A 2V60A 1P43A 2BXSA 3QSMA 1KKOA 4EQWA 1GTEA 4KPLA 4CY8A 5CKUA 4FX9A 1SJCA 4IT1A 3KD9A 1KNPA 1DOCA 3AD7B 4HCDA 3NHOX 1N5WC 2C76A 2AKMA 2E1MA 4IVMB 4PAAA 3OTRA 1OJCA 1RVKA 5KVHA 5BOFA 4DNAA 4AT0A 3CPJG 1NDAA 3R25A 4I58A 3T31A 5BOEA 2JB1A 1L8PA 3QFAA 5JRBA 3A7AA 4GAPA 4EIPA 4GMEA 4U2TA 3ZDNA 3FMWA 2W54A 4RSLA 1YEYA 4J3ZA 1JRPA 4N9XA 3SZFA 1DJQA 1ZX9A 5BUKA 3DG6A 2WDVA 3RGTA 3GO2A 4B1BA 3ADAB 3HYXA 1GETA 2GR0A 2TPRA 3N6HA 2X8GA 1CBOA 5DBJA 2A87A 3EPTA 1TRBA 5M10A 3NK1X 4GIRA 3CTYA 4ECHA 3KLJA 2R0PA 3BNMA 4K7ZA 3C4AA 3NVWB 4YT0A 3NS1B 1CJ2A 4OCGA 1NG3A 2HXTA 4TM0A 2X50A 1K0JA 3H7VA 1FHVA 5KXJA 3V3NA 2O9ZA 1NHQA 2YR5A 2JK6A 2YG3A 1XPYA 2GGJA 4A5LA 1FECA 3U9IA 1ZKQA 5HYMA 4LU6A 3FXGA 2X8HA 2AL1A 4ZCDA 1IUWA 4CY6A 3AE5A 3V3OA 1ZMCA 2RGJA 3NN6X 3GDPA 4ENLA 1VDVA 3UTFA 3NH3X 2XGZA 5HHFA 3AB1A 1V59A 3ALLA 4FP1A 4U8KA 3NZGA 1NHPA 3AD8B 2AL2B 1M6IA 3LB8A 1EBDA 3L5OA 3UOZA 1H7WA 2C3DA 3VC6A 3ATRA 1E39A 3MKCA 1B37A 1VQWA 2R45A 3HYVA 3V76A 4A6GA 4WCTA 2OZ8A 1JRYA 4Y4LA 4A35A 3SBFA 1ZK7A 2PTYA 1WUEA 2O56A 3FPZA 2X3NA 3AEGA 1N4VA 4YSYA 2FBWA 3IJLA 3PVCA 2XH4A 3TJ4A 5BVAA 2XYOA 4KWSA 1CC6A 1FFUC 1Y56A 3V5FA 4CNKA 1OEPA 1NENA 3H12A 4AOSA 2YLWA 5IQ1A 5FS9A 3CGBA 3NO1A 2GSHA 2PGWA 1JCTA 1K0LA 2BK5A 3N4FA 3R1ZA 1NEKA 1MOKA 4YTNA 4G9KA 2BCPA 2ZZCA 3D8XA 3P3BA 1LJ1A 3KKJA 1QLBA 1PXBA 3RP6A 1CJCA 2XLPA 4EWJA 3DJJA 2JB2A 4H4TA 3TTEA 3UKHA 4C77A 2GEWA 4EMIA 1QJDA 3AXBA 5BULA 2NQLA 4EQSA 3K7MX 2X99A 2PMQA 4U8IA 6ENLA 1SJAA 1ZOVA 3MQTA 1TDEA 2ZADA 3CK5A 5KMSA 2AAQA 3CIRA 3TJIA 3H70A 4H4PA 1VQZA 3PG6A 1CC4A 3CNPA 2QA1A 2QDEA 4UDRA 1XDIA 3KU9A 4YWSA 2XFOA 2OO6A 2PS2A 3SN0A 3G5QA 2P88A 3V3WA 2CHRA 3DH9A 3RHAA 1W4XA 3NGCX 1DNCA 4WX1A 2QCUA 1KD0A 2E5AA 1TDOA 4JN9A 3NK2X 1FCDA 3A7RA 1KN0A 4HPNA 2Z5YA 4JY2A 4A65A 4M0XA 3Q45A 3OW1A 4B63A 3HYWA 2CULA 1YKJA 1F8SA 1PXAA 4J36A 3SR6B 1ONFA 1E9IA 2GL5A 2H89A 4A79A 4Y4NA 1FO4A 2ARDA 2OX4A 5J7XA 3S5WA 3T2KA 2EQ7A 1LTXR 3R0UA 4TLXA 1DOEA 4EQRA 5U1OA 1ELSA 4C74A 4YXDA 4BJZA 4G8TA 4EMJA 3TWBA 1PHHA 2ONEA 2VRMA 3AE3A 3C96A 1GRFA 3RITA 4J2WA 2BC0A 2GQFA 2VVLG 3AE7A 4RG4A 2XH2A 5GSNA 4X9NA 3DJGX 3ZVHA 1XS2A 3DMEA 2Y6RA 3FV9A 4GISA 2XH0A 2C67A 1ELIA 2WU2A 3QFBA 4YWOA 3U4FA 3P1WA 1KSSA 2YM1A 4U8MA 3H4KA 3UTHA 3I6TA 2XFNA 3P4PA 2OALA 4U8LA 3IF9A 4K2SA 3I3LA 1MO9A 3EANA 5C2TA 1PDYA 4BK3A 2Z5XA 5EB5A 5FMHA 4JHMA 3TWAA 3G5SA 3FJ4A 4OPUA 4CBQA 4H4WA 2R46A 3AMZA 4DSGA 3CGDA 1F8WA 1ZXIC 1GRGA 3RNMA 2H88A 4Z2UA 3RP8A 1DTNA 1KKRA 3PK7A 3DDMA 5FJUA 3VQRA 3WE0A 1S3EA 3CPHG 3REDA 4H4VA 4DWDA 4A99A 3CYJA 3K30A 3CGCA 2YLZA 1GRTA 1VG9A 3B97A 1DODA 3DA1A 1BQGA 2OZTA 3RP7A 3ICSA 1IUXA 4YKGA 3TW9A 4LA1A 1VG0A 1GPEA 4U8PA 2B9WA 1EL9A 2GV8A 5EU9A 3NTAA 2BS4A 3AECA 4GGBA 3K7TA 3DK8A 3VDGA 3EUB3 1SJBA 1RSGA 2PSNA 1RP0A 1S2YA 1JNRA 4GAVA 1TKKA 3THUA 4HYRA 1EC7A 4O5UA 2QJNA 3NG7X 4GGHA 1H86A 3FCPA 3AE6A 4Z26A 4TM1A 3SN4A 1CHUA 3GMCA 2XDOA 1NPXA 4K1WA 4K2XA 2WQYA 3AM9A 4FK1A 4AP3A 1E1MA 2EQ8A 3R07C 1FFVC 1GREA 4HNCA 2YLTA 3P4QA 2BK4A 1S3BA 3NKSA 1RM6B 2NPXA 1H83A 3VA8A 3T8QA 2YM2A 3OPSA 4H50A 1HYUA 3AEEA 2OPJA 3ALJA 3UGVA 2R0GA 3UKKA 2YAUA 3BOXA 1NG4A 5HY5A 5KMPA 4GDPA 1MUCA 3IHMA 1NAAA 3UOYA 3UTGA 3NNEA 2PTWA 2HNEA 1H82A 4NEVA 3B9JB 4UDQA 3OP2A 3URHA 1V97A 3P9UA 3CN8A 3UP5A 2C66A 3V4BA 2AKZA 1L0VA 3TQPA 2Q7VA 2V5ZA 2VOUA 3PO7A 1EC9A 4TM3A 4FDCB 4HCHA 5KOXA 3G5RA 3O0HA 1SJDA 4ZA0A 1NHSA 2YG6A 2YLSA 3FIMB 2QVHA 3DFHA 3E1TA 3BI5A 1GV4A 2C3CA 3II4A 1PBBA 3IWAA 1JPDX 1TDFA 2GVCA 2YVJA 4B68A 1JNZA 1D7LA 1F8RA 4Y4MA 3UKAA 4G74A 1L9DA 4GRTA 4H4ZA 1OJAA 4FI4A 2BCGG 3CT2A 1ONEA 2GAGB 1L9EA 4M52A 1NU5A 2Q0LA 1Z6LA 4B66A 2GB0A 1ZP0A 3BHKA 2HZGA 3FVDA 4G7FA 3LZXA 1DOBA 1R0MA 2YG5A 4PABA 4USRA 3CXBA 5EB4A 3IK4A 4MGGA 4O5QA 1RYIA 4H83A 4XXGA 3IJIA 4ZCCA 1JRZA 3DG3A 4GYPC 1PDHA 4UDPA 4FK1C 3C4NA 1WUFA 3R10A 1EL7A 5FJTA 4IP4A 3NLCA 2PU0A 2W3SA 3QN3A 3VFCA 2OKTA 1FOHA 2DW6A 4X9MA 1REOA 2WPFA 1F9CA 2V3BA 1Q9IA 3AEAA 3UCLA 2YWLA 2PGEA 4AT2A 3ZLFA 4Z24A 2YR4A 3K7QX 2RGHA 2EQ9A 2EQ6A 2YG7A 2PP1A 5JCNA 4H2HA 4E0VA 2FJAA 3KA7A 4Z25A 4G6HA 4IL2A 1MDRA 1NELA 3ABVA 2TMDA 2YLRA 2W0HA 3UCCA 3D47A 4OPDA 4D03A 3SQSA 4X4JA 5GRTA 2JB3A 4H4UA 3H8AA 1GEUA 3GSIA 4REKA 2GDQA 2OQHA 1VDCA 2VQBA 2BC1A 3TOYA 1MDLA 2GH5A 3T14A 1S7MA 4ROPA 4MMWA 2P0IA 3M12A 1JRXA 3LZWA 4HA6A 2WOWA 3NYEA 3P4RA 4GFIA 1GT8A 1B5QA 3SFDA 2YR6A 3HPFA 1X2GA 3DG7A 3QSEA 3NVZB 2J3NA 2AL2A 1PJ5A 1KFYA 3GD4A 2JBVA 5G5GB 2WHDA 1TYPA 2C72A 2FJBA 3CB3A 4AOXA 2AQJA 3NT6A 3ES7A 3AE4A 4B65A 3R11A 5BRTA 4JQ9A 2QGYA 2RDXA 3OZ2A 4NZHA 3MY9A 4E8GA 2B7RA 4BK2A 1TE6A 2FKPA 3UJEA 4OPTA 2OQYA 3SGLA 3EKGA 1DXLA 1LVLA 3N4EA 4II2A 3AN1A 1BKHA 3T4WA 4H4XA 3RRAA 2GGHA 3SY4A 2R0CA 2YG4A 4HCLA 2Q0KA 3UJ2A 3M0OA 1FEBA 1MXTA 4ICYA 4XWRA 5FJPA 5U25A 2XCGA 3JVAA 2GR3A 3QPEA 4Z43A 3DGBA 2GGGA 3CXOA 2B7SA 3KVEA 3IHGA 5EOWA 4H2QA 2WS3A 2P3ZA 2XVHA 5C3JA 3ISHA 1GNDA 2GR1A 2BXRA 2XLRA 3JSKA 2VQ7A 2GGIA
chains in the Genus database with same CATH topology
1IUVA 1TRBA 4OVIA 5M10A 3NK1X 1RSGA 2Y6QA 3CTYA 4ECHA 3KLJA 4H4RA 2R0PA 4NWZA 4OPGA 1RP0A 3BNMA 3SM8A 1S2YA 4Z44A 4K7ZA 3C4AA 3AE8A 4IVOB 2CDUA 1JNRA 4GAVA 4YT0A 4H2PA 1CJ2A 2WU5A 4OCGA 2V3AA 1NG3A 4TM0A 3CNTA 2BS3A 2X50A 1K0JA 4GCMA 3LADA 4HB9A 3UP4A 3T0KA 1PJ7A 2BACA 1LQUA 4YTPA 4O5UA 5KXJA 3NG7X 3V3NA 1H86A 2O9ZA 2WPEA 4H4QA 3AE6A 1NHQA 2RABA 2YVGA 2YR5A 1P2HA 3GYIA 5JCKA 4Z26A 2JK6A 1E1NA 2YG3A 4TM1A 3L8KA 1CHUA 2AR8A 2FJEA 3GMCA 3OC4A 4A5LA 4ZN0A 1FECA 2XDOA 2V6OA 1NPXA 1E6EA 1IJHA 1KDGA 2WQYA 4K2XA 1ZKQA 2V61A 1N1PA 4KX6A 4LIIA 4FK1A 4AP3A 4EM3A 5KNLA 1NHRA 4IA6A 2F5ZA 1D4EA 5HYMA 1E1MA 4H2NA 4LU6A 4IA5A 5KOWA 2X8HA 2EQ8A 3T2YA 4ZCDA 1UKVG 1IUWA 4MJWA 2WDRA 2R4EA 3VRAA 4CY6A 1GREA 2ACZA 1PN0A 2GQWA 3VR8A 4KPRA 3AE5A 3V3OA 2YLTA 3M13A 1ZMCA 2YVFA 2BK4A 2RGJA 3P4QA 1S3BA 3GYJA 3NKSA 3GDPA 5KVIA 3NN6X 4A6NB 4CCQA 3BNUA 1IUUA 4IV9A 2NPXA 3UTFA 3NH3X 5HXIA 1H83A 5HHFA 2YM2A 2ZZ0A 2R4JA 1OJDA 3AB1A 1VRQB 3H8LA 3FG2P 1B4VA 4H2RA 1PXCA 4H50A 1V59A 1GXFA 1E7PA 1HYUA 4K8DA 1KNRA 2UZZA 1GALA 3AEEA 3ALLA 5IPYA 3ALJA 3B6DA 4U8KA 3QJ4A 2WEUA 4NNJA 1NHPA 5L46A 2WPCA 2R0GA 3AD8B 2Q6UA 3BI4A 3UKKA 2YQUA 1M6IA 4J34A 3LB8A 3UKQA 4NTDA 4Z2RA 1EBDA 2YAUA 1NG4A 3L5OA 4GUVA 5HY5A 1CJ4A 3SZCA 5KMPA 4GDPA 3UOZA 5M0ZA 1H7WA 1TYTA 2C3DA 3IHMA 1NAAA 3DGHA 3ATRA 3AYLA 2BA9A 3UKPA 3UOYA 1GESA 1SEZA 3UOVA 1E39A 2JAEA 3NNEA 3UTGA 3SZ0A 2DKHA 1PS9A 1H82A 1B37A 4NEVA 2X8CA 3LJPA 3BHFA 1VQWA 2R45A 4UDQA 3VRBA 3SQPA 3URHA 3H8IA 3HYVA 4BJYA 1EL8A 1B8SA 1D4DA 3P9UA 3V76A 3CN8A 2OLNA 1JEHA 4WCTA 2XVEA 4APNA 2B9YA 3UP5A 1JRYA 1BGJA 3ZYXA 2C66A 4Y4LA 1L0VA 2VVLA 1ZK7A 1ZOYA 2Q7VA 2V5ZA 3FPZA 2X3NA 4NEWA 2VOUA 3AEGA 4J31A 1N4VA 4YSYA 3PO7A 1BGNA 1GTHA 2FBWA 3FBSA 1D7YA 4J33A 1LPFA 3GWDA 4P9SA 3SYIA 2XFUA 4TM3A 3PVCA 4FDCB 5BVAA 1TDNA 3UKFA 5KOXA 3G5RA 3O0HA 3CNJA 1F6MA 1E1KA 4YSZA 4U2SA 1YQ3A 2XYOA 3GMBA 3SXIA 1CC6A 3DK9A 3BI2A 1NHSA 3AEBA 1S2QA 4CCRA 3ALMA 2YG6A 1Y56A 2YLSA 3FIMB 4H4SA 4CNKA 2WP5A 4K5SA 4NTEA 3GWFA 3E1TA 2XVFA 3BI5A 1NENA 1GV4A 2NVKX 4AOSA 2C75A 2YLWA 3CGEA 1OJ9A 4CRTA 5KMRA 3AE1A 2IIDA 5KRQA 4GR1A 1Y0PA 4J57A 5IQ1A 5FS9A 3F8PA 3CGBA 2C65A 1PJ6A 3AEDA 3NYCA 3QVPA 2C3CA 3II4A 1PBBA 3SX6A 2WP6A 3IWAA 2A8XA 1TDFA 2GVCA 4B68A 1XPQA 1JNZA 1EL5A 1D7LA 1F8RA 1K0LA 3DJEA 3UTEA 4Y4MA 2BK5A 3UKAA 2HQMA 3D1CA 4G74A 3F8DA 1L9DA 4GRTA 1NEKA 1MOKA 4H4ZA 4OPCA 4YTNA 1OJAA 4G9KA 1CJ3A 2BCGG 2GF3A 2GAGB 4JNAA 1L9EA 2E4GA 4M52A 2BCPA 2ZZCA 1Z6LA 2Q0LA 3Q6JA 4B66A 3D8XA 2GB0A 5FS6A 3LOVA 3CPIG 2XFPA 1FEAA 1ZP0A 3BHKA 1Q1WA 3NK0X 3HZLA 3T37A 1LJ1A 2VZ2A 2BS2A 3LZXA 3KKJA 2OAMA 1QLBA 1JOAA 1PXBA 2BRYA 2VVMA 2ZBWA 3RP6A 1CJCA 2XLPA 1ZMDA 1DOBA 1TDKA 4YKFA 3GD3A 3DJJA 2I0ZA 2JB2A 4UP3A 5CQFA 1M64A 4H4TA 2C64A 3Q9TA 2YG5A 4PABA 1BZLA 4USRA 3UKHA 2A89A 3GRTA 3KPKA 5EB4A 4C77A 4DSHA 2GEWA 3LXDA 4EMIA 3SZWA 1QJDA 3AWIA 3AXBA 4O5QA 5BULA 3NRNA 4EQSA 1RYIA 2X99A 2C4CA 3K7MX 4XXGA 4C3YA 4ZCCA 1JRZA 4EQXA 3AE9A 1PDHA 4U8IA 4BK1A 4UDPA 2DKIA 4FK1C 3L1RA 1ZOVA 3GRSA 4B69A 4K5RA 3B3RA 3GDNA 2BABA 1TDEA 2GRTA 1QO8A 3C4NA 2AAQA 1EL7A 1O5WA 2CVJA 2QA2A 3CIRA 5KMSA 4H4PA 2XLUA 3CMMA 3NLCA 2WBAA 3DGZA 3PG6A 1CC4A 1H7XA 2QA1A 3CNPA 2WESA 1E1LA 2BRAA 4UDRA 1XDIA 1DJNA 1AOGA 1H81A 1FOHA 5KMQA 3KU9A 2QAEA 5IQ4A 4X9MA 1FL2A 1REOA 2WPFA 4JY3A 2XFOA 2GR2A 2WOVA 4I59A 2V3BA 3G5QA 5FS7A 1Q9IA 3AEAA 3UCLA 4TM4A 2YWLA 4YSXA 3EF6A 1OJTA 3D9XA 3NN0X 2IVDA 3ICRA 4A7AA 2FJDA 2RGOA 4Z24A 4AT2A 2VRLA 2YR4A 3K7QX 3DH9A 1K0IA 1KF6A 3RHAA 4C3XA 2RGHA 2E5VA 1W4XA 4II3A 4USQA 2EQ9A 2EQ6A 2OA1A 3R9UA 2YG7A 4YSHA 5TR3A 3NGCX 4G6GA 1D5TA 1DNCA 5JCNA 4WX1A 1GERA 2QCUA 4A9WA 5FS8A 1TDOA 2CFYA 4JN9A 3NK2X 4EMWA 1FCDA 4B64A 1KN0A 2Z5YA 4U8NA 4JY2A 4A65A 1ZY8A 4E0VA 2C7GA 2XLTA 5KWFA 2FJAA 3KA7A 4B63A 4Z25A 1LQTA 2CULA 3HYWA 1YKJA 2BK3A 1F8SA 4G6HA 1Q1RA 1PXAA 2GMJA 3ITJA 4J36A 2YLXA 3VRDB 4TLZA 3ABVA 2TMDA 2YLRA 1ONFA 3SFEA 2H89A 1H84A 2PYXA 3AYIA 4A79A 2XFQA 4G73A 2W0HA 5U63A 4Y4NA 1IUSA 2ARDA 4GDEA 3I6DA 4OPLA 1P2EA 4OPDA 5J7XA 1CL0A 1PBCA 4D03A 1ZDLA 4EIQA 3S5WA 3QSSA 3T2KA 2EQ7A 1X31B 1LTXR 1YQZA 2GAHB 4TLXA 1N4UA 4X4JA 2WOIA 1DOEA 4EQRA 5GRTA 2WETA 1L9CA 2JB3A 1GOSA 5U1OA 3DJDA 3NTDA 4U2LA 4H4UA 4C74A 4D04A 4YXDA 4BJZA 5J60A 1GEUA 1YQ4A 3GSIA 4REKA 4EMJA 1PHHA 1VDCA 1BF3A 2VQBA 2VRMA 3P4SA 3UOXA 2BC1A 1Y56B 3CNSA 3AE3A 3C96A 1GRFA 1N4WA 2ZZBA 2GH5A 2BYBA 4J2WA 3T14A 2XVIA 1S7MA 2BC0A 2GQFA 2JKCA 2VVLG 3M12A 3AE7A 1JRXA 2APGA 4RG4A 5GSNA 2WP9A 4X9NA 3LZWA 4A6NA 5JCIA 4HA6A 3DJGX 2WOWA 1PBFA 3NYEA 2OLOA 4YTMA 4DGKA 3DMEA 1IUTA 2Y6RA 1H2IA 3P4RA 1GT8A 2WDQA 4ADWA 3F8RA 4NTCA 1B5QA 3DK4A 2YR6A 3SFDA 4EM4A 3QSEA 1F3PA 3ICTA 5EBKA 4XWZA 4JNQA 2C67A 5JCMA 1GRAA 1ELIA 2WU2A 2J3NA 3QFBA 4RG3A 3S61A 4YWOA 1PJ5A 2B76A 1KFYA 4K22A 1YY5A 3GD4A 2V60A 2JBVA 3P1WA 2R9ZA 1KSSA 2YM1A 2BXSA 3QSMA 4U8MA 2WHDA 4EQWA 1TYPA 3H4KA 1COYA 1GTEA 2C72A 3UTHA 4CY8A 4H7UA 5CKUA 1D4CA 2FJBA 4FX9A 4AOXA 2XFNA 3P4PA 2OALA 4U8LA 2AQJA 3IF9A 3NT6A 3IC9A 3I3LA 1MO9A 3KD9A 2B9XA 1KNPA 3AE4A 3EANA 1DOCA 3NYFA 5C2TA 3AD7B 4B65A 5BRTA 1XHCA 4BK3A 1JU2A 3ATQA 4JQ9A 2Z5XA 5EB5A 1GSNA 3NHOX 3QVRA 5FMHA 3OZ2A 4NZHA 3G5SA 2C76A 3AD9B 1CF3A 3AEFA 2E1MA 1BWCA 4IVMB 4OPUA 1LV0A 4PAAA 1GRHA 2B7RA 3CNDA 1CC2A 4CBQA 4H4WA 1OJCA 3T2ZA 3EAOA 4BK2A 2R46A 4J56A 5KVHA 5LV9A 4GF7A 4OPTA 3SGLA 4DSGA 1DXLA 3CGDA 1F8WA 4DNAA 2IVEA 1GRGA 3RNMA 2XLSA 2C73A 4AT0A 1LVLA 1NDAA 2H88A 3CPJG 4I58A 4II2A 3T31A 5JCLA 4Z2UA 2JB1A 4H4XA 3RP8A 4B67A 3SY4A 3QFAA 2R0CA 3COXA 4OPIA 5JRBA 2YG4A 3VQRA 4CNJA 4GAPA 4BURA 2Q0KA 4JDRA 1GRBA 4EIPA 4U2TA 3M0OA 1FEBA 3WE0A 1S3EA 1MXTA 3CPHG 3FMWA 1BKWA 4ICYA 3REDA 3ZDNA 1H6VA 4H4VA 2C70A 1O95A 4RSLA 4XWRA 2PHHA 4A99A 5U25A 4N9XA 3SZFA 1DJQA 2XCGA 4H4YA 1ZX9A 4U8OA 3K30A 5BUKA 3CGCA 2GR3A 4BV6A 3VR9A 2WDVA 2YLZA 4Z43A 3AE2A 1GRTA 2XVJA 1VG9A 1DODA 3DA1A 4B1BA 3KPFA 3RP7A 1KSUA 3NIXA 2B7SA 3ADAB 3ICSA 1O94A 3HYXA 3KVEA 1GETA 1IUXA 3IHGA 4YKGA 2GMHA 1K4QA 5EOWA 4Z2TA 3GYXA 4H2QA 4C5OA 1XANA 2GR0A 2WS3A 2TPRA 3PS9A 4LA1A 1PBEA 2XVHA 5ER0A 5C3JA 3ISHA 1GNDA 2X8GA 1VG0A 2GR1A 1GPEA 4U8PA 2B9WA 4U8JA 3UKLA 1CBOA 1EL9A 2GV8A 2BXRA 3NTAA 2XLRA 2BS4A 3AYJA 3AECA 3JSKA 5DBJA 2A87A 2VQ7A 3EPTA 4AP1A 3K7TA 1PBDA 2YVJA 3DK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IUV A;  1TRB A;  4OVI A;  5M10 A;  3NK1 X;  1RSG A;  2Y6Q A;  3CTY A;  4ECH A;  3KLJ A;  4H4R A;  2R0P A;  4OPG A;  1RP0 A;  3BNM A;  3SM8 A;  1S2Y A;  4Z44 A;  4K7Z A;  3C4A A;  3AE8 A;  4IVO B;  2CDU A;  1JNR A;  4YT0 A;  4H2P A;  1CJ2 A;  2WU5 A;  4OCG A;  2V3A A;  1NG3 A;  4TM0 A;  3CNT A;  2BS3 A;  2X50 A;  1K0J A;  4GCM A;  3LAD A;  4HB9 A;  3UP4 A;  4C3Y A;  1PJ7 A;  2BAC A;  1LQU A;  4YTP A;  4O5U A;  5KXJ A;  3NG7 X;  3V3N A;  1H86 A;  2O9Z A;  2WPE A;  4H4Q A;  3AE6 A;  1NHQ A;  2RAB A;  2YVG A;  2YR5 A;  1P2H A;  3GYI A;  5JCK A;  4Z26 A;  2JK6 A;  1E1N A;  2YG3 A;  4TM1 A;  3L8K A;  1CHU A;  2AR8 A;  2FJE A;  3GMC A;  3OC4 A;  4A5L A;  4ZN0 A;  1FEC A;  2XDO A;  2V6O A;  1NPX A;  1E6E A;  1IJH A;  1KDG A;  2WQY A;  4K2X A;  1ZKQ A;  2V61 A;  1N1P A;  4KX6 A;  4LII A;  4FK1 A;  4AP3 A;  4EM3 A;  1NHR A;  4IA6 A;  2F5Z A;  1D4E A;  5HYM A;  1E1M A;  4H2N A;  4LU6 A;  4IA5 A;  5KOW A;  2X8H A;  2EQ8 A;  4ZCD A;  1UKV G;  1IUW A;  4MJW A;  2WDR A;  2R4E A;  3VRA A;  4CY6 A;  1GRE A;  2ACZ A;  1PN0 A;  2GQW A;  3VR8 A;  4KPR A;  3AE5 A;  3V3O A;  2YLT A;  3M13 A;  1ZMC A;  2YVF A;  2BK4 A;  2RGJ A;  3P4Q A;  1S3B A;  3GYJ A;  3NKS A;  3GDP A;  5KVI A;  3NN6 X;  4A6N B;  4CCQ A;  3BNU A;  1IUU A;  4IV9 A;  2NPX A;  3UTF A;  3NH3 X;  5HXI A;  1H83 A;  5HHF A;  2YM2 A;  2ZZ0 A;  2R4J A;  1OJD A;  3AB1 A;  1VRQ B;  3H8L A;  3FG2 P;  1B4V A;  4H2R A;  1PXC A;  4H50 A;  1V59 A;  1GXF A;  1E7P A;  1HYU A;  4K8D A;  1KNR A;  2UZZ A;  1GAL A;  3AEE A;  3ALL A;  5IPY A;  3ALJ A;  3B6D A;  4U8K A;  3QJ4 A;  2WEU A;  5L46 A;  1NHP A;  2WPC A;  2R0G A;  3AD8 B;  2Q6U A;  3BI4 A;  3UKK A;  2YQU A;  1M6I A;  4J34 A;  3LB8 A;  3UKQ A;  4NTD A;  4Z2R A;  1EBD A;  2YAU A;  1NG4 A;  4GUV A;  5HY5 A;  1CJ4 A;  4GDP A;  3UOZ A;  5M0Z A;  1H7W A;  1TYT A;  2C3D A;  3IHM A;  1NAA A;  3DGH A;  3ATR A;  3AYL A;  2BA9 A;  3UKP A;  3UOY A;  1GES A;  1SEZ A;  3UOV A;  1E39 A;  2JAE A;  3NNE A;  3UTG A;  2DKH A;  1PS9 A;  1H82 A;  1B37 A;  4NEV A;  2X8C A;  3LJP A;  3BHF A;  1VQW A;  2R45 A;  4UDQ A;  3VRB A;  3SQP A;  3URH A;  3H8I A;  4BJY A;  1EL8 A;  1B8S A;  1D4D A;  3P9U A;  3V76 A;  3CN8 A;  2OLN A;  1JEH A;  4WCT A;  2XVE A;  4APN A;  2B9Y A;  3UP5 A;  1JRY A;  1BGJ A;  3ZYX A;  2C66 A;  4Y4L A;  1L0V A;  2VVL A;  1ZK7 A;  1ZOY A;  2Q7V A;  2V5Z A;  3FPZ A;  2X3N A;  4NEW A;  2VOU A;  3AEG A;  4J31 A;  1N4V A;  4YSY A;  3PO7 A;  1BGN A;  1GTH A;  2FBW A;  3FBS A;  1D7Y A;  4J33 A;  1LPF A;  3GWD A;  4P9S A;  2XFU A;  4TM3 A;  3PVC A;  4FDC B;  5BVA A;  1TDN A;  3UKF A;  5KOX A;  3G5R A;  3O0H A;  3CNJ A;  1F6M A;  1E1K A;  4YSZ A;  4U2S A;  1YQ3 A;  2XYO A;  3GMB A;  1CC6 A;  3DK9 A;  3BI2 A;  1NHS A;  3AEB A;  1S2Q A;  4CCR A;  3ALM A;  2YG6 A;  1Y56 A;  2YLS A;  3FIM B;  4H4S A;  4CNK A;  2WP5 A;  4K5S A;  4NTE A;  3GWF A;  3E1T A;  2XVF A;  3BI5 A;  1NEN A;  1GV4 A;  2NVK X;  4AOS A;  2C75 A;  2YLW A;  3CGE A;  1OJ9 A;  4CRT A;  5KRQ A;  3AE1 A;  2IID A;  4GR1 A;  1Y0P A;  4J57 A;  5IQ1 A;  5FS9 A;  3F8P A;  3CGB A;  2C65 A;  1PJ6 A;  3AED A;  3NYC A;  3QVP A;  2C3C A;  3II4 A;  1PBB A;  2WP6 A;  3IWA A;  2A8X A;  1TDF A;  2GVC A;  4B68 A;  1XPQ A;  1JNZ A;  1EL5 A;  1D7L A;  1F8R A;  1K0L A;  3DJE A;  3UTE A;  4Y4M A;  2BK5 A;  3UKA A;  2HQM A;  3D1C A;  3F8D A;  1L9D A;  4GRT A;  1NEK A;  1MOK A;  4H4Z A;  4OPC A;  4YTN A;  1OJA A;  1CJ3 A;  2BCG G;  2GF3 A;  2GAG B;  4JNA A;  1L9E A;  2E4G A;  4M52 A;  2BCP A;  2ZZC A;  1Z6L A;  2Q0L A;  3Q6J A;  4B66 A;  3D8X A;  2GB0 A;  5FS6 A;  3LOV A;  3CPI G;  2XFP A;  1FEA A;  1ZP0 A;  3BHK A;  1Q1W A;  3NK0 X;  3HZL A;  3T37 A;  1LJ1 A;  2VZ2 A;  2BS2 A;  3LZX A;  3KKJ A;  2OAM A;  1QLB A;  1JOA A;  1PXB A;  2VVM A;  2ZBW A;  3RP6 A;  1CJC A;  2XLP A;  1ZMD A;  1DOB A;  1TDK A;  4YKF A;  3GD3 A;  3DJJ A;  2I0Z A;  2JB2 A;  4UP3 A;  5CQF A;  1M64 A;  4H4T A;  2C64 A;  3Q9T A;  2YG5 A;  4PAB A;  1BZL A;  4USR A;  3UKH A;  2A89 A;  3GRT A;  4C77 A;  5EB4 A;  4DSH A;  2GEW A;  3LXD A;  4EMI A;  1QJD A;  3AWI A;  3AXB A;  4O5Q A;  5BUL A;  3NRN A;  4EQS A;  1RYI A;  2X99 A;  3K7M X;  4XXG A;  4ZCC A;  1JRZ A;  4EQX A;  3AE9 A;  1PDH A;  4U8I A;  4BK1 A;  4UDP A;  2DKI A;  4FK1 C;  3L1R A;  1ZOV A;  3GRS A;  4B69 A;  4K5R A;  3B3R A;  3GDN A;  2BAB A;  1TDE A;  2GRT A;  1QO8 A;  3C4N A;  2AAQ A;  1EL7 A;  1O5W A;  2CVJ A;  2QA2 A;  3CIR A;  4H4P A;  2XLU A;  3NLC A;  2WBA A;  3DGZ A;  1CC4 A;  1H7X A;  3CNP A;  2QA1 A;  2WES A;  1E1L A;  4UDR A;  1XDI A;  1DJN A;  1AOG A;  1H81 A;  1FOH A;  3KU9 A;  2QAE A;  5IQ4 A;  4X9M A;  1FL2 A;  1REO A;  2WPF A;  4JY3 A;  2XFO A;  2GR2 A;  2WOV A;  4I59 A;  2V3B A;  3G5Q A;  5FS7 A;  1Q9I A;  3AEA A;  3UCL A;  4TM4 A;  2YWL A;  4YSX A;  3EF6 A;  1OJT A;  3NN0 X;  2IVD A;  3ICR A;  4A7A A;  2FJD A;  2RGO A;  4Z24 A;  4AT2 A;  2VRL A;  2YR4 A;  3K7Q X;  3DH9 A;  1K0I A;  1KF6 A;  3RHA A;  4C3X A;  2RGH A;  2E5V A;  1W4X A;  4USQ A;  2EQ9 A;  2EQ6 A;  2OA1 A;  3R9U A;  2YG7 A;  4YSH A;  5TR3 A;  3NGC X;  1D5T A;  1DNC A;  5JCN A;  4WX1 A;  1GER A;  2QCU A;  4A9W A;  5FS8 A;  1TDO A;  2CFY A;  4JN9 A;  3NK2 X;  4EMW A;  1FCD A;  4B64 A;  4U8N A;  2Z5Y A;  4JY2 A;  4A65 A;  1ZY8 A;  4E0V A;  2C7G A;  2XLT A;  5KWF A;  2FJA A;  3KA7 A;  4B63 A;  4Z25 A;  1LQT A;  2CUL A;  1YKJ A;  2BK3 A;  1F8S A;  1Q1R A;  1PXA A;  2GMJ A;  3ITJ A;  4J36 A;  2YLX A;  3VRD B;  4TLZ A;  3ABV A;  2TMD A;  2YLR A;  1ONF A;  3SFE A;  2H89 A;  1H84 A;  2PYX A;  3AYI A;  4A79 A;  2XFQ A;  2W0H A;  5U63 A;  4Y4N A;  1IUS A;  2ARD A;  4GDE A;  3I6D A;  4OPL A;  1P2E A;  4OPD A;  5J7X A;  1CL0 A;  1PBC A;  4D03 A;  1ZDL A;  4EIQ A;  3S5W A;  3QSS A;  2EQ7 A;  1X31 B;  1LTX R;  1YQZ A;  2GAH B;  4TLX A;  1N4U A;  4X4J A;  2WOI A;  1DOE A;  4EQR A;  5GRT A;  2WET A;  1L9C A;  2JB3 A;  1GOS A;  5U1O A;  3DJD A;  3NTD A;  4U2L A;  4H4U A;  4C74 A;  4D04 A;  4YXD A;  4BJZ A;  5J60 A;  1GEU A;  1YQ4 A;  3GSI A;  4REK A;  4EMJ A;  1PHH A;  1VDC A;  1BF3 A;  2VQB A;  2VRM A;  3P4S A;  3UOX A;  2BC1 A;  1Y56 B;  3CNS A;  3AE3 A;  3C96 A;  1GRF A;  1N4W A;  2ZZB A;  2GH5 A;  2BYB A;  4J2W A;  2XVI A;  2BC0 A;  2GQF A;  2JKC A;  2VVL G;  3M12 A;  3AE7 A;  1JRX A;  2APG A;  4RG4 A;  5GSN A;  2WP9 A;  4X9N A;  3LZW A;  4A6N A;  5JCI A;  4HA6 A;  3DJG X;  2WOW A;  1PBF A;  3NYE A;  2OLO A;  4YTM A;  4DGK A;  3DME A;  1IUT A;  2Y6R A;  3P4R A;  1GT8 A;  2WDQ A;  4ADW A;  3F8R A;  4NTC A;  1B5Q A;  3DK4 A;  2YR6 A;  3SFD A;  4EM4 A;  3QSE A;  1F3P A;  3ICT A;  5EBK A;  4XWZ A;  4JNQ A;  2C67 A;  5JCM A;  1GRA A;  1ELI A;  2WU2 A;  2J3N A;  3QFB A;  4RG3 A;  3S61 A;  4YWO A;  1PJ5 A;  2B76 A;  1KFY A;  4K22 A;  1YY5 A;  3GD4 A;  2V60 A;  2JBV A;  3P1W A;  2R9Z A;  1KSS A;  2YM1 A;  2BXS A;  3QSM A;  4U8M A;  2WHD A;  4EQW A;  1TYP A;  3H4K A;  1COY A;  1GTE A;  2C72 A;  3UTH A;  4CY8 A;  4H7U A;  5CKU A;  1D4C A;  2FJB A;  4FX9 A;  4AOX A;  2XFN A;  3P4P A;  2OAL A;  4U8L A;  2AQJ A;  3IF9 A;  3NT6 A;  3IC9 A;  3I3L A;  1MO9 A;  3KD9 A;  2B9X A;  1KNP A;  3AE4 A;  3EAN A;  1DOC A;  3NYF A;  5C2T A;  3AD7 B;  4B65 A;  5BRT A;  1XHC A;  4BK3 A;  1JU2 A;  3ATQ A;  4JQ9 A;  2Z5X A;  5EB5 A;  1GSN A;  3NHO X;  3QVR A;  5FMH A;  3OZ2 A;  4NZH A;  3G5S A;  2C76 A;  3AD9 B;  1CF3 A;  3AEF A;  2E1M A;  1BWC A;  4IVM B;  4OPU A;  1LV0 A;  4PAA A;  1GRH A;  2B7R A;  3CND A;  1CC2 A;  4CBQ A;  4H4W A;  1OJC A;  3EAO A;  4BK2 A;  2R46 A;  4J56 A;  5KVH A;  5LV9 A;  4GF7 A;  4OPT A;  3SGL A;  4DSG A;  1DXL A;  3CGD A;  1F8W A;  4DNA A;  2IVE A;  1GRG A;  3RNM A;  2XLS A;  2C73 A;  4AT0 A;  1LVL A;  1NDA A;  2H88 A;  3CPJ G;  4I58 A;  5JCL A;  4Z2U A;  2JB1 A;  4H4X A;  3RP8 A;  4B67 A;  3QFA A;  2R0C A;  3COX A;  4OPI A;  2YG4 A;  3VQR A;  4CNJ A;  4BUR A;  2Q0K A;  4JDR A;  1GRB A;  4EIP A;  4U2T A;  3M0O A;  1FEB A;  3WE0 A;  1S3E A;  1MXT A;  3CPH G;  3FMW A;  1BKW A;  4ICY A;  3RED A;  3ZDN A;  1H6V A;  4H4V A;  2C70 A;  1O95 A;  4RSL A;  4XWR A;  2PHH A;  4A99 A;  5U25 A;  4N9X A;  1DJQ A;  2XCG A;  4H4Y A;  1ZX9 A;  4U8O A;  3K30 A;  5BUK A;  3CGC A;  2GR3 A;  4BV6 A;  3VR9 A;  2WDV A;  2YLZ A;  4Z43 A;  3AE2 A;  1GRT A;  2XVJ A;  1VG9 A;  1DOD A;  3DA1 A;  4B1B A;  3KPF A;  3RP7 A;  1KSU A;  3NIX A;  2B7S A;  3ADA B;  3ICS A;  1O94 A;  3KVE A;  1GET A;  1IUX A;  3IHG A;  4YKG A;  2GMH A;  1K4Q A;  5EOW A;  4Z2T A;  4H2Q A;  4C5O A;  1XAN A;  2GR0 A;  2WS3 A;  2TPR A;  3PS9 A;  4LA1 A;  1PBE A;  2XVH A;  5ER0 A;  5C3J A;  3ISH A;  1GND A;  2X8G A;  1VG0 A;  2GR1 A;  1GPE A;  4U8P A;  2B9W A;  4U8J A;  3UKL A;  1CBO A;  1EL9 A;  2GV8 A;  2BXR A;  3NTA A;  2XLR A;  2BS4 A;  3AYJ A;  3AEC A;  3JSK A;  5DBJ A;  2A87 A;  2VQ7 A;  3EPT A;  4AP1 A;  3K7T A;  1PBD A;  2YVJ A;  3DK8 A; 
#chains in the Genus database with same CATH topology
 3ENL A;  1IUV A;  1PDZ A;  4OVI A;  2Y6Q A;  3MSY A;  4OPG A;  3SM8 A;  3VCC A;  3AE8 A;  4IVO B;  4H2P A;  3CNT A;  2BS3 A;  4HB9 A;  4E5T A;  3LAD A;  1PJ7 A;  2BAC A;  2WPE A;  4H4Q A;  3RCY A;  2YVG A;  1P2H A;  1E1N A;  2FJE A;  4ZN0 A;  1E6E A;  2V61 A;  1FHU A;  4KX6 A;  2OG9 A;  4E4F A;  4IA6 A;  1D4E A;  4H2N A;  3I4K A;  1P48 A;  5KOW A;  3T2Y A;  3RO6 A;  1UKV G;  3VRA A;  3VR8 A;  2OVL A;  4KPR A;  2YVF A;  7ENL A;  4TVY A;  3GYJ A;  5KVI A;  4A6N B;  1T3Q C;  4JN7 A;  3DFY A;  2POZ A;  2ZZ0 A;  3FG2 P;  1B4V A;  2UZZ A;  1GXF A;  4K8D A;  5IPY A;  3B6D A;  3QJ4 A;  2WEU A;  4NNJ A;  2WPC A;  2Q6U A;  3BI4 A;  2YQU A;  4J34 A;  2I5Q A;  1STZ A;  1CJ4 A;  3SZC A;  3VC5 A;  5M0Z A;  3DGH A;  3AYL A;  1GES A;  1SEZ A;  3UOV A;  3SZ0 A;  1PS9 A;  3LJP A;  3VRB A;  3SQP A;  4BJY A;  3GD6 A;  1B8S A;  1D4D A;  1JEH A;  1BGJ A;  3ZYX A;  3QTP A;  1ZOY A;  4NEW A;  3FBS A;  4P9S A;  1LPF A;  3GWD A;  3SYI A;  2PTZ A;  1F6M A;  1E1K A;  4U2S A;  3GMB A;  3SXI A;  3BI2 A;  3AEB A;  1S2Q A;  4CCR A;  3ALM A;  4A3R A;  4Z1Y A;  4H4S A;  3P0W A;  4K5S A;  4NTE A;  3GWF A;  3DIP A;  2NVK X;  4CRT A;  3AE1 A;  2IID A;  4GR1 A;  4J57 A;  4DN1 A;  1SB3 B;  2C65 A;  2FYM A;  2WP6 A;  3UTE A;  2HQM A;  2QJJ A;  4OPC A;  2GF3 A;  3GY1 A;  1JPM A;  3SN1 A;  3LOV A;  2XFP A;  1FEA A;  3T37 A;  2VZ2 A;  2OAM A;  4ZCW A;  2VVM A;  1TDK A;  4YKF A;  5CQF A;  4UP3 A;  1M64 A;  3PWI A;  2A89 A;  3KPK A;  3SZW A;  3LXD A;  3AWI A;  3NRN A;  2P8C A;  3BJS A;  2PCE A;  3P93 A;  4EQX A;  2QJM A;  2DKI A;  5G5H B;  3K1G A;  2CVJ A;  1O5W A;  2QA2 A;  3SSZ A;  4IHC A;  2XLU A;  3CMM A;  2WBA A;  1H7X A;  2WES A;  1AOG A;  5IQ4 A;  1FL2 A;  4I59 A;  3EF6 A;  3D9X A;  1N61 C;  4Z17 A;  3NN0 X;  2IVD A;  2FJD A;  2RGO A;  4K8G A;  4USQ A;  4II3 A;  3EEZ A;  2OA1 A;  3MWC A;  1GER A;  2CFY A;  4B64 A;  2XLT A;  5KWF A;  1LQT A;  1Q1R A;  3ITJ A;  3MZN A;  1H84 A;  4J1O A;  2PYX A;  4G73 A;  5IDZ A;  3OZM A;  3QKE A;  4GDE A;  4OPL A;  1PBC A;  1ZDL A;  3QSS A;  1YQZ A;  2GAH B;  1N4U A;  2WOI A;  3JW7 A;  2WET A;  4JN8 A;  1L9C A;  2OLA A;  4U2L A;  3PFR A;  1YQ4 A;  1BF3 A;  1Y56 B;  4H1Z A;  3CNS A;  3PWG A;  2ZZB A;  2BYB A;  3GC2 A;  2JKC A;  2APG A;  2OLO A;  4YTM A;  5ENL A;  1IUT A;  1H2I A;  2WDQ A;  4ADW A;  3F8R A;  3STP A;  3HRD C;  3DK4 A;  3NFU A;  4EM4 A;  1F3P A;  1W6T A;  3ICT A;  3A7U A;  1GRA A;  5J04 A;  3S61 A;  4K22 A;  1YY5 A;  2R9Z A;  1EBH A;  1TZZ A;  1COY A;  3S5S A;  4H7U A;  1D4C A;  3IC9 A;  2B9X A;  3NYF A;  1XHC A;  1JU2 A;  3ATQ A;  1GSN A;  3QVR A;  2PA6 A;  3UJF A;  3AD9 B;  1CF3 A;  3AEF A;  1BWC A;  1LV0 A;  1GRH A;  3CND A;  1CC2 A;  3T2Z A;  3EAO A;  4DYE A;  3SJN A;  4J56 A;  2OZ3 A;  5LV9 A;  4GF7 A;  3T6C A;  2HXU A;  2IVE A;  2XLS A;  4E4U A;  2C73 A;  4DHG A;  5JCL A;  4B67 A;  3ZLG A;  4ZOH B;  3COX A;  4OPI A;  4CNJ A;  4BUR A;  4JDR A;  1GRB A;  4MKS A;  1MNS A;  4KEM A;  1BKW A;  1H6V A;  2C70 A;  1O95 A;  2PHH A;  4H4Y A;  4U8O A;  4BV6 A;  3VR9 A;  2QQ6 A;  3R0K A;  3AE2 A;  2XVJ A;  3KPF A;  1KSU A;  3NIX A;  1O94 A;  2GMH A;  1K4Q A;  4Z2T A;  3GYX A;  4C5O A;  1XAN A;  2PP3 A;  3PS9 A;  3DEQ A;  1PBE A;  5ER0 A;  4U8J A;  1JRO A;  5FJO A;  3UKL A;  2PTX A;  2POD A;  3AYJ A;  3NVV B;  3NXL A;  4AP1 A;  1PBD A;  4TVW A;  4H4R A;  4NWZ A;  2OFJ A;  3OZY A;  4Z44 A;  2CDU A;  2WU5 A;  1MRA A;  2V3A A;  4C3Y A;  4GCM A;  3UP4 A;  3T0K A;  1LQU A;  4YTP A;  1ECQ A;  2RAB A;  3GYI A;  5JCK A;  3RR1 A;  1N60 C;  3UJS A;  3L8K A;  2AR8 A;  3OC4 A;  2V6O A;  1IJH A;  1KDG A;  1N1P A;  4LII A;  5KNL A;  4EM3 A;  1NHR A;  3UJR A;  2F5Z A;  3DES A;  1X2H A;  3I6E A;  4IA5 A;  4H19 A;  1JDF A;  3MUC A;  4MJW A;  3IJQ A;  2R4E A;  2WDR A;  2ACZ A;  1PN0 A;  2GQW A;  3ZLH A;  3M13 A;  4CCQ A;  3BNU A;  3ETR B;  1IUU A;  3ZVH B;  4IV9 A;  5HXI A;  1N62 C;  2PPG A;  2R4J A;  1OJD A;  1VRQ B;  3H8L A;  4H2R A;  1PXC A;  1E7P A;  1KNR A;  3N6J A;  1GAL A;  3D46 A;  5L46 A;  1EC8 A;  4Z2R A;  3UKQ A;  4NTD A;  4HNL A;  4GUV A;  1TYT A;  3VCN A;  2BA9 A;  3UKP A;  2JAE A;  2DKH A;  2X8C A;  4IZG A;  3UXL A;  3HW2 A;  3BHF A;  3H8I A;  1EL8 A;  2OLN A;  2XVE A;  1FIQ B;  4APN A;  3V5C A;  2B9Y A;  4F4R A;  2VVL A;  4J31 A;  5FJR A;  1BGN A;  1GTH A;  1D7Y A;  4J33 A;  2XFU A;  2XSX A;  2P8B A;  1TDN A;  3UKF A;  3CNJ A;  4YSZ A;  3TCS A;  1YQ3 A;  3DK9 A;  4IP5 A;  2WP5 A;  2MUC A;  3Q4D A;  2XVF A;  3DER A;  3FYY A;  2C75 A;  3CGE A;  1OJ9 A;  5KMR A;  5KRQ A;  4E6M A;  1Y0P A;  3ES8 A;  3UCD A;  3NRZ B;  3F8P A;  3QVP A;  1PJ6 A;  3AED A;  3NYC A;  3SX6 A;  2A8X A;  1XPQ A;  1EL5 A;  3DJE A;  1KCZ A;  1IYX A;  3D1C A;  3F8D A;  2GGE A;  1CJ3 A;  4JNA A;  2E4G A;  3QLD A;  3Q6J A;  5FS6 A;  3CPI G;  1Q1W A;  3NK0 X;  3HZL A;  2BS2 A;  2PU1 A;  1JOA A;  2BRY A;  2ZBW A;  1ZMD A;  3GD3 A;  2I0Z A;  1WYG A;  2E3T A;  2C64 A;  3Q9T A;  1BZL A;  3GRT A;  3ZVI A;  4DSH A;  3JZU A;  3S47 A;  2C4C A;  4KT2 A;  2W55 A;  2PP0 A;  3AE9 A;  3BSM A;  4BK1 A;  3CAW A;  3L1R A;  2W3R A;  3GRS A;  4B69 A;  4K5R A;  3B3R A;  4DX3 A;  3GDN A;  2BAB A;  4DGK A;  2GRT A;  1QO8 A;  3DGZ A;  1E1L A;  2BRA A;  4IL0 A;  1DJN A;  1H81 A;  5KMQ A;  2QAE A;  4JY3 A;  2GR2 A;  2WOV A;  5FS7 A;  4TM4 A;  4YSX A;  1OJT A;  3ICR A;  4A7A A;  2VRL A;  1K0I A;  1KF6 A;  4C3X A;  2MNR A;  2E5V A;  3R9U A;  4YSH A;  5TR3 A;  4G6G A;  1D5T A;  4A9W A;  5FS8 A;  4EMW A;  4U8N A;  1ZY8 A;  4DXK A;  2C7G A;  4X2P A;  2BK3 A;  2GMJ A;  3NVY B;  2YLX A;  3VRD B;  4TLZ A;  3SFE A;  3AYI A;  2QDD A;  2XFQ A;  5U63 A;  1IUS A;  3I6D A;  1P2E A;  1CL0 A;  3T9P A;  4EIQ A;  1X31 B;  1GOS A;  3DJD A;  3NTD A;  4D04 A;  5J60 A;  2DW7 A;  3P4S A;  3UOX A;  1EBG A;  1N4W A;  2XVI A;  4M6U A;  2WP9 A;  4A6N A;  3UXK A;  5JCI A;  1PBF A;  1N5X A;  2XH7 A;  4HN8 A;  1R6W A;  4NTC A;  1N63 C;  5EBK A;  4XWZ A;  4JNQ A;  5JCM A;  2ZC8 A;  3KUM A;  4GYP A;  4RG3 A;  2B76 A;  2V60 A;  1P43 A;  2BXS A;  3QSM A;  1KKO A;  4EQW A;  1GTE A;  4KPL A;  4CY8 A;  5CKU A;  4FX9 A;  1SJC A;  4IT1 A;  3KD9 A;  1KNP A;  1DOC A;  3AD7 B;  4HCD A;  3NHO X;  1N5W C;  2C76 A;  2AKM A;  2E1M A;  4IVM B;  4PAA A;  3OTR A;  1OJC A;  1RVK A;  5KVH A;  5BOF A;  4DNA A;  4AT0 A;  3CPJ G;  1NDA A;  3R25 A;  4I58 A;  3T31 A;  5BOE A;  2JB1 A;  1L8P A;  3QFA A;  5JRB A;  3A7A A;  4GAP A;  4EIP A;  4GME A;  4U2T A;  3ZDN A;  3FMW A;  2W54 A;  4RSL A;  1YEY A;  4J3Z A;  1JRP A;  4N9X A;  3SZF A;  1DJQ A;  1ZX9 A;  5BUK A;  3DG6 A;  2WDV A;  3RGT A;  3GO2 A;  4B1B A;  3ADA B;  3HYX A;  1GET A;  2GR0 A;  2TPR A;  3N6H A;  2X8G A;  1CBO A;  5DBJ A;  2A87 A;  3EPT A;  1TRB A;  5M10 A;  3NK1 X;  4GIR A;  3CTY A;  4ECH A;  3KLJ A;  2R0P A;  3BNM A;  4K7Z A;  3C4A A;  3NVW B;  4YT0 A;  3NS1 B;  1CJ2 A;  4OCG A;  1NG3 A;  2HXT A;  4TM0 A;  2X50 A;  1K0J A;  3H7V A;  1FHV A;  5KXJ A;  3V3N A;  2O9Z A;  1NHQ A;  2YR5 A;  2JK6 A;  2YG3 A;  1XPY A;  2GGJ A;  4A5L A;  1FEC A;  3U9I A;  1ZKQ A;  5HYM A;  4LU6 A;  3FXG A;  2X8H A;  2AL1 A;  4ZCD A;  1IUW A;  4CY6 A;  3AE5 A;  3V3O A;  1ZMC A;  2RGJ A;  3NN6 X;  3GDP A;  4ENL A;  1VDV A;  3UTF A;  3NH3 X;  2XGZ A;  5HHF A;  3AB1 A;  1V59 A;  3ALL A;  4FP1 A;  4U8K A;  3NZG A;  1NHP A;  3AD8 B;  2AL2 B;  1M6I A;  3LB8 A;  1EBD A;  3L5O A;  3UOZ A;  1H7W A;  2C3D A;  3VC6 A;  3ATR A;  1E39 A;  3MKC A;  1B37 A;  1VQW A;  2R45 A;  3HYV A;  3V76 A;  4A6G A;  4WCT A;  2OZ8 A;  1JRY A;  4Y4L A;  4A35 A;  3SBF A;  1ZK7 A;  2PTY A;  1WUE A;  2O56 A;  3FPZ A;  2X3N A;  3AEG A;  1N4V A;  4YSY A;  2FBW A;  3IJL A;  3PVC A;  2XH4 A;  3TJ4 A;  5BVA A;  2XYO A;  4KWS A;  1CC6 A;  1FFU C;  1Y56 A;  3V5F A;  4CNK A;  1OEP A;  1NEN A;  3H12 A;  4AOS A;  2YLW A;  5IQ1 A;  5FS9 A;  3CGB A;  3NO1 A;  2GSH A;  2PGW A;  1JCT A;  1K0L A;  2BK5 A;  3N4F A;  3R1Z A;  1NEK A;  1MOK A;  4YTN A;  4G9K A;  2BCP A;  2ZZC A;  3D8X A;  3P3B A;  1LJ1 A;  3KKJ A;  1QLB A;  1PXB A;  3RP6 A;  1CJC A;  2XLP A;  4EWJ A;  3DJJ A;  2JB2 A;  4H4T A;  3TTE A;  3UKH A;  4C77 A;  2GEW A;  4EMI A;  1QJD A;  3AXB A;  5BUL A;  2NQL A;  4EQS A;  3K7M X;  2X99 A;  2PMQ A;  4U8I A;  6ENL A;  1SJA A;  1ZOV A;  3MQT A;  1TDE A;  2ZAD A;  3CK5 A;  5KMS A;  2AAQ A;  3CIR A;  3TJI A;  3H70 A;  4H4P A;  1VQZ A;  3PG6 A;  1CC4 A;  3CNP A;  2QA1 A;  2QDE A;  4UDR A;  1XDI A;  3KU9 A;  4YWS A;  2XFO A;  2OO6 A;  2PS2 A;  3SN0 A;  3G5Q A;  2P88 A;  3V3W A;  2CHR A;  3DH9 A;  3RHA A;  1W4X A;  3NGC X;  1DNC A;  4WX1 A;  2QCU A;  1KD0 A;  2E5A A;  1TDO A;  4JN9 A;  3NK2 X;  1FCD A;  3A7R A;  1KN0 A;  4HPN A;  2Z5Y A;  4JY2 A;  4A65 A;  4M0X A;  3Q45 A;  3OW1 A;  4B63 A;  3HYW A;  2CUL A;  1YKJ A;  1F8S A;  1PXA A;  4J36 A;  3SR6 B;  1ONF A;  1E9I A;  2GL5 A;  2H89 A;  4A79 A;  4Y4N A;  1FO4 A;  2ARD A;  2OX4 A;  5J7X A;  3S5W A;  3T2K A;  2EQ7 A;  1LTX R;  3R0U A;  4TLX A;  1DOE A;  4EQR A;  5U1O A;  1ELS A;  4C74 A;  4YXD A;  4BJZ A;  4G8T A;  4EMJ A;  3TWB A;  1PHH A;  2ONE A;  2VRM A;  3AE3 A;  3C96 A;  1GRF A;  3RIT A;  4J2W A;  2BC0 A;  2GQF A;  2VVL G;  3AE7 A;  4RG4 A;  2XH2 A;  5GSN A;  4X9N A;  3DJG X;  3ZVH A;  1XS2 A;  3DME A;  2Y6R A;  3FV9 A;  4GIS A;  2XH0 A;  2C67 A;  1ELI A;  2WU2 A;  3QFB A;  4YWO A;  3U4F A;  3P1W A;  1KSS A;  2YM1 A;  4U8M A;  3H4K A;  3UTH A;  3I6T A;  2XFN A;  3P4P A;  2OAL A;  4U8L A;  3IF9 A;  4K2S A;  3I3L A;  1MO9 A;  3EAN A;  5C2T A;  1PDY A;  4BK3 A;  2Z5X A;  5EB5 A;  5FMH A;  4JHM A;  3TWA A;  3G5S A;  3FJ4 A;  4OPU A;  4CBQ A;  4H4W A;  2R46 A;  3AMZ A;  4DSG A;  3CGD A;  1F8W A;  1ZXI C;  1GRG A;  3RNM A;  2H88 A;  4Z2U A;  3RP8 A;  1DTN A;  1KKR A;  3PK7 A;  3DDM A;  5FJU A;  3VQR A;  3WE0 A;  1S3E A;  3CPH G;  3RED A;  4H4V A;  4DWD A;  4A99 A;  3CYJ A;  3K30 A;  3CGC A;  2YLZ A;  1GRT A;  1VG9 A;  3B97 A;  1DOD A;  3DA1 A;  1BQG A;  2OZT A;  3RP7 A;  3ICS A;  1IUX A;  4YKG A;  3TW9 A;  4LA1 A;  1VG0 A;  1GPE A;  4U8P A;  2B9W A;  1EL9 A;  2GV8 A;  5EU9 A;  3NTA A;  2BS4 A;  3AEC A;  4GGB A;  3K7T A;  3DK8 A;  3VDG A;  3EUB 3;  1SJB A;  1RSG A;  2PSN A;  1RP0 A;  1S2Y A;  1JNR A;  4GAV A;  1TKK A;  3THU A;  4HYR A;  1EC7 A;  4O5U A;  2QJN A;  3NG7 X;  4GGH A;  1H86 A;  3FCP A;  3AE6 A;  4Z26 A;  4TM1 A;  3SN4 A;  1CHU A;  3GMC A;  2XDO A;  1NPX A;  4K1W A;  4K2X A;  2WQY A;  3AM9 A;  4FK1 A;  4AP3 A;  1E1M A;  2EQ8 A;  3R07 C;  1FFV C;  1GRE A;  4HNC A;  2YLT A;  3P4Q A;  2BK4 A;  1S3B A;  3NKS A;  1RM6 B;  2NPX A;  1H83 A;  3VA8 A;  3T8Q A;  2YM2 A;  3OPS A;  4H50 A;  1HYU A;  3AEE A;  2OPJ A;  3ALJ A;  3UGV A;  2R0G A;  3UKK A;  2YAU A;  3BOX A;  1NG4 A;  5HY5 A;  5KMP A;  4GDP A;  1MUC A;  3IHM A;  1NAA A;  3UOY A;  3UTG A;  3NNE A;  2PTW A;  2HNE A;  1H82 A;  4NEV A;  3B9J B;  4UDQ A;  3OP2 A;  3URH A;  1V97 A;  3P9U A;  3CN8 A;  3UP5 A;  2C66 A;  3V4B A;  2AKZ A;  1L0V A;  3TQP A;  2Q7V A;  2V5Z A;  2VOU A;  3PO7 A;  1EC9 A;  4TM3 A;  4FDC B;  4HCH A;  5KOX A;  3G5R A;  3O0H A;  1SJD A;  4ZA0 A;  1NHS A;  2YG6 A;  2YLS A;  3FIM B;  2QVH A;  3DFH A;  3E1T A;  3BI5 A;  1GV4 A;  2C3C A;  3II4 A;  1PBB A;  3IWA A;  1JPD X;  1TDF A;  2GVC A;  2YVJ A;  4B68 A;  1JNZ A;  1D7L A;  1F8R A;  4Y4M A;  3UKA A;  4G74 A;  1L9D A;  4GRT A;  4H4Z A;  1OJA A;  4FI4 A;  2BCG G;  3CT2 A;  1ONE A;  2GAG B;  1L9E A;  4M52 A;  1NU5 A;  2Q0L A;  1Z6L A;  4B66 A;  2GB0 A;  1ZP0 A;  3BHK A;  2HZG A;  3FVD A;  4G7F A;  3LZX A;  1DOB A;  1R0M A;  2YG5 A;  4PAB A;  4USR A;  3CXB A;  5EB4 A;  3IK4 A;  4MGG A;  4O5Q A;  1RYI A;  4H83 A;  4XXG A;  3IJI A;  4ZCC A;  1JRZ A;  3DG3 A;  4GYP C;  1PDH A;  4UDP A;  4FK1 C;  3C4N A;  1WUF A;  3R10 A;  1EL7 A;  5FJT A;  4IP4 A;  3NLC A;  2PU0 A;  2W3S A;  3QN3 A;  3VFC A;  2OKT A;  1FOH A;  2DW6 A;  4X9M A;  1REO A;  2WPF A;  1F9C A;  2V3B A;  1Q9I A;  3AEA A;  3UCL A;  2YWL A;  2PGE A;  4AT2 A;  3ZLF A;  4Z24 A;  2YR4 A;  3K7Q X;  2RGH A;  2EQ9 A;  2EQ6 A;  2YG7 A;  2PP1 A;  5JCN A;  4H2H A;  4E0V A;  2FJA A;  3KA7 A;  4Z25 A;  4G6H A;  4IL2 A;  1MDR A;  1NEL A;  3ABV A;  2TMD A;  2YLR A;  2W0H A;  3UCC A;  3D47 A;  4OPD A;  4D03 A;  3SQS A;  4X4J A;  5GRT A;  2JB3 A;  4H4U A;  3H8A A;  1GEU A;  3GSI A;  4REK A;  2GDQ A;  2OQH A;  1VDC A;  2VQB A;  2BC1 A;  3TOY A;  1MDL A;  2GH5 A;  3T14 A;  1S7M A;  4ROP A;  4MMW A;  2P0I A;  3M12 A;  1JRX A;  3LZW A;  4HA6 A;  2WOW A;  3NYE A;  3P4R A;  4GFI A;  1GT8 A;  1B5Q A;  3SFD A;  2YR6 A;  3HPF A;  1X2G A;  3DG7 A;  3QSE A;  3NVZ B;  2J3N A;  2AL2 A;  1PJ5 A;  1KFY A;  3GD4 A;  2JBV A;  5G5G B;  2WHD A;  1TYP A;  2C72 A;  2FJB A;  3CB3 A;  4AOX A;  2AQJ A;  3NT6 A;  3ES7 A;  3AE4 A;  4B65 A;  3R11 A;  5BRT A;  4JQ9 A;  2QGY A;  2RDX A;  3OZ2 A;  4NZH A;  3MY9 A;  4E8G A;  2B7R A;  4BK2 A;  1TE6 A;  2FKP A;  3UJE A;  4OPT A;  2OQY A;  3SGL A;  3EKG A;  1DXL A;  1LVL A;  3N4E A;  4II2 A;  3AN1 A;  1BKH A;  3T4W A;  4H4X A;  3RRA A;  2GGH A;  3SY4 A;  2R0C A;  2YG4 A;  4HCL A;  2Q0K A;  3UJ2 A;  3M0O A;  1FEB A;  1MXT A;  4ICY A;  4XWR A;  5FJP A;  5U25 A;  2XCG A;  3JVA A;  2GR3 A;  3QPE A;  4Z43 A;  3DGB A;  2GGG A;  3CXO A;  2B7S A;  3KVE A;  3IHG A;  5EOW A;  4H2Q A;  2WS3 A;  2P3Z A;  2XVH A;  5C3J A;  3ISH A;  1GND A;  2GR1 A;  2BXR A;  2XLR A;  3JSK A;  2VQ7 A;  2GGI A; 
#chains in the Genus database with same CATH homology
 1IUV A;  1TRB A;  4OVI A;  5M10 A;  3NK1 X;  1RSG A;  2Y6Q A;  3CTY A;  4ECH A;  3KLJ A;  4H4R A;  2R0P A;  4NWZ A;  4OPG A;  1RP0 A;  3BNM A;  3SM8 A;  1S2Y A;  4Z44 A;  4K7Z A;  3C4A A;  3AE8 A;  4IVO B;  2CDU A;  1JNR A;  4GAV A;  4YT0 A;  4H2P A;  1CJ2 A;  2WU5 A;  4OCG A;  2V3A A;  1NG3 A;  4TM0 A;  3CNT A;  2BS3 A;  2X50 A;  1K0J A;  4GCM A;  3LAD A;  4HB9 A;  3UP4 A;  3T0K A;  1PJ7 A;  2BAC A;  1LQU A;  4YTP A;  4O5U A;  5KXJ A;  3NG7 X;  3V3N A;  1H86 A;  2O9Z A;  2WPE A;  4H4Q A;  3AE6 A;  1NHQ A;  2RAB A;  2YVG A;  2YR5 A;  1P2H A;  3GYI A;  5JCK A;  4Z26 A;  2JK6 A;  1E1N A;  2YG3 A;  4TM1 A;  3L8K A;  1CHU A;  2AR8 A;  2FJE A;  3GMC A;  3OC4 A;  4A5L A;  4ZN0 A;  1FEC A;  2XDO A;  2V6O A;  1NPX A;  1E6E A;  1IJH A;  1KDG A;  2WQY A;  4K2X A;  1ZKQ A;  2V61 A;  1N1P A;  4KX6 A;  4LII A;  4FK1 A;  4AP3 A;  4EM3 A;  5KNL A;  1NHR A;  4IA6 A;  2F5Z A;  1D4E A;  5HYM A;  1E1M A;  4H2N A;  4LU6 A;  4IA5 A;  5KOW A;  2X8H A;  2EQ8 A;  3T2Y A;  4ZCD A;  1UKV G;  1IUW A;  4MJW A;  2WDR A;  2R4E A;  3VRA A;  4CY6 A;  1GRE A;  2ACZ A;  1PN0 A;  2GQW A;  3VR8 A;  4KPR A;  3AE5 A;  3V3O A;  2YLT A;  3M13 A;  1ZMC A;  2YVF A;  2BK4 A;  2RGJ A;  3P4Q A;  1S3B A;  3GYJ A;  3NKS A;  3GDP A;  5KVI A;  3NN6 X;  4A6N B;  4CCQ A;  3BNU A;  1IUU A;  4IV9 A;  2NPX A;  3UTF A;  3NH3 X;  5HXI A;  1H83 A;  5HHF A;  2YM2 A;  2ZZ0 A;  2R4J A;  1OJD A;  3AB1 A;  1VRQ B;  3H8L A;  3FG2 P;  1B4V A;  4H2R A;  1PXC A;  4H50 A;  1V59 A;  1GXF A;  1E7P A;  1HYU A;  4K8D A;  1KNR A;  2UZZ A;  1GAL A;  3AEE A;  3ALL A;  5IPY A;  3ALJ A;  3B6D A;  4U8K A;  3QJ4 A;  2WEU A;  4NNJ A;  1NHP A;  5L46 A;  2WPC A;  2R0G A;  3AD8 B;  2Q6U A;  3BI4 A;  3UKK A;  2YQU A;  1M6I A;  4J34 A;  3LB8 A;  3UKQ A;  4NTD A;  4Z2R A;  1EBD A;  2YAU A;  1NG4 A;  3L5O A;  4GUV A;  5HY5 A;  1CJ4 A;  3SZC A;  5KMP A;  4GDP A;  3UOZ A;  5M0Z A;  1H7W A;  1TYT A;  2C3D A;  3IHM A;  1NAA A;  3DGH A;  3ATR A;  3AYL A;  2BA9 A;  3UKP A;  3UOY A;  1GES A;  1SEZ A;  3UOV A;  1E39 A;  2JAE A;  3NNE A;  3UTG A;  3SZ0 A;  2DKH A;  1PS9 A;  1H82 A;  1B37 A;  4NEV A;  2X8C A;  3LJP A;  3BHF A;  1VQW A;  2R45 A;  4UDQ A;  3VRB A;  3SQP A;  3URH A;  3H8I A;  3HYV A;  4BJY A;  1EL8 A;  1B8S A;  1D4D A;  3P9U A;  3V76 A;  3CN8 A;  2OLN A;  1JEH A;  4WCT A;  2XVE A;  4APN A;  2B9Y A;  3UP5 A;  1JRY A;  1BGJ A;  3ZYX A;  2C66 A;  4Y4L A;  1L0V A;  2VVL A;  1ZK7 A;  1ZOY A;  2Q7V A;  2V5Z A;  3FPZ A;  2X3N A;  4NEW A;  2VOU A;  3AEG A;  4J31 A;  1N4V A;  4YSY A;  3PO7 A;  1BGN A;  1GTH A;  2FBW A;  3FBS A;  1D7Y A;  4J33 A;  1LPF A;  3GWD A;  4P9S A;  3SYI A;  2XFU A;  4TM3 A;  3PVC A;  4FDC B;  5BVA A;  1TDN A;  3UKF A;  5KOX A;  3G5R A;  3O0H A;  3CNJ A;  1F6M A;  1E1K A;  4YSZ A;  4U2S A;  1YQ3 A;  2XYO A;  3GMB A;  3SXI A;  1CC6 A;  3DK9 A;  3BI2 A;  1NHS A;  3AEB A;  1S2Q A;  4CCR A;  3ALM A;  2YG6 A;  1Y56 A;  2YLS A;  3FIM B;  4H4S A;  4CNK A;  2WP5 A;  4K5S A;  4NTE A;  3GWF A;  3E1T A;  2XVF A;  3BI5 A;  1NEN A;  1GV4 A;  2NVK X;  4AOS A;  2C75 A;  2YLW A;  3CGE A;  1OJ9 A;  4CRT A;  5KMR A;  3AE1 A;  2IID A;  5KRQ A;  4GR1 A;  1Y0P A;  4J57 A;  5IQ1 A;  5FS9 A;  3F8P A;  3CGB A;  2C65 A;  1PJ6 A;  3AED A;  3NYC A;  3QVP A;  2C3C A;  3II4 A;  1PBB A;  3SX6 A;  2WP6 A;  3IWA A;  2A8X A;  1TDF A;  2GVC A;  4B68 A;  1XPQ A;  1JNZ A;  1EL5 A;  1D7L A;  1F8R A;  1K0L A;  3DJE A;  3UTE A;  4Y4M A;  2BK5 A;  3UKA A;  2HQM A;  3D1C A;  4G74 A;  3F8D A;  1L9D A;  4GRT A;  1NEK A;  1MOK A;  4H4Z A;  4OPC A;  4YTN A;  1OJA A;  4G9K A;  1CJ3 A;  2BCG G;  2GF3 A;  2GAG B;  4JNA A;  1L9E A;  2E4G A;  4M52 A;  2BCP A;  2ZZC A;  1Z6L A;  2Q0L A;  3Q6J A;  4B66 A;  3D8X A;  2GB0 A;  5FS6 A;  3LOV A;  3CPI G;  2XFP A;  1FEA A;  1ZP0 A;  3BHK A;  1Q1W A;  3NK0 X;  3HZL A;  3T37 A;  1LJ1 A;  2VZ2 A;  2BS2 A;  3LZX A;  3KKJ A;  2OAM A;  1QLB A;  1JOA A;  1PXB A;  2BRY A;  2VVM A;  2ZBW A;  3RP6 A;  1CJC A;  2XLP A;  1ZMD A;  1DOB A;  1TDK A;  4YKF A;  3GD3 A;  3DJJ A;  2I0Z A;  2JB2 A;  4UP3 A;  5CQF A;  1M64 A;  4H4T A;  2C64 A;  3Q9T A;  2YG5 A;  4PAB A;  1BZL A;  4USR A;  3UKH A;  2A89 A;  3GRT A;  3KPK A;  5EB4 A;  4C77 A;  4DSH A;  2GEW A;  3LXD A;  4EMI A;  3SZW A;  1QJD A;  3AWI A;  3AXB A;  4O5Q A;  5BUL A;  3NRN A;  4EQS A;  1RYI A;  2X99 A;  2C4C A;  3K7M X;  4XXG A;  4C3Y A;  4ZCC A;  1JRZ A;  4EQX A;  3AE9 A;  1PDH A;  4U8I A;  4BK1 A;  4UDP A;  2DKI A;  4FK1 C;  3L1R A;  1ZOV A;  3GRS A;  4B69 A;  4K5R A;  3B3R A;  3GDN A;  2BAB A;  1TDE A;  2GRT A;  1QO8 A;  3C4N A;  2AAQ A;  1EL7 A;  1O5W A;  2CVJ A;  2QA2 A;  3CIR A;  5KMS A;  4H4P A;  2XLU A;  3CMM A;  3NLC A;  2WBA A;  3DGZ A;  3PG6 A;  1CC4 A;  1H7X A;  2QA1 A;  3CNP A;  2WES A;  1E1L A;  2BRA A;  4UDR A;  1XDI A;  1DJN A;  1AOG A;  1H81 A;  1FOH A;  5KMQ A;  3KU9 A;  2QAE A;  5IQ4 A;  4X9M A;  1FL2 A;  1REO A;  2WPF A;  4JY3 A;  2XFO A;  2GR2 A;  2WOV A;  4I59 A;  2V3B A;  3G5Q A;  5FS7 A;  1Q9I A;  3AEA A;  3UCL A;  4TM4 A;  2YWL A;  4YSX A;  3EF6 A;  1OJT A;  3D9X A;  3NN0 X;  2IVD A;  3ICR A;  4A7A A;  2FJD A;  2RGO A;  4Z24 A;  4AT2 A;  2VRL A;  2YR4 A;  3K7Q X;  3DH9 A;  1K0I A;  1KF6 A;  3RHA A;  4C3X A;  2RGH A;  2E5V A;  1W4X A;  4II3 A;  4USQ A;  2EQ9 A;  2EQ6 A;  2OA1 A;  3R9U A;  2YG7 A;  4YSH A;  5TR3 A;  3NGC X;  4G6G A;  1D5T A;  1DNC A;  5JCN A;  4WX1 A;  1GER A;  2QCU A;  4A9W A;  5FS8 A;  1TDO A;  2CFY A;  4JN9 A;  3NK2 X;  4EMW A;  1FCD A;  4B64 A;  1KN0 A;  2Z5Y A;  4U8N A;  4JY2 A;  4A65 A;  1ZY8 A;  4E0V A;  2C7G A;  2XLT A;  5KWF A;  2FJA A;  3KA7 A;  4B63 A;  4Z25 A;  1LQT A;  2CUL A;  3HYW A;  1YKJ A;  2BK3 A;  1F8S A;  4G6H A;  1Q1R A;  1PXA A;  2GMJ A;  3ITJ A;  4J36 A;  2YLX A;  3VRD B;  4TLZ A;  3ABV A;  2TMD A;  2YLR A;  1ONF A;  3SFE A;  2H89 A;  1H84 A;  2PYX A;  3AYI A;  4A79 A;  2XFQ A;  4G73 A;  2W0H A;  5U63 A;  4Y4N A;  1IUS A;  2ARD A;  4GDE A;  3I6D A;  4OPL A;  1P2E A;  4OPD A;  5J7X A;  1CL0 A;  1PBC A;  4D03 A;  1ZDL A;  4EIQ A;  3S5W A;  3QSS A;  3T2K A;  2EQ7 A;  1X31 B;  1LTX R;  1YQZ A;  2GAH B;  4TLX A;  1N4U A;  4X4J A;  2WOI A;  1DOE A;  4EQR A;  5GRT A;  2WET A;  1L9C A;  2JB3 A;  1GOS A;  5U1O A;  3DJD A;  3NTD A;  4U2L A;  4H4U A;  4C74 A;  4D04 A;  4YXD A;  4BJZ A;  5J60 A;  1GEU A;  1YQ4 A;  3GSI A;  4REK A;  4EMJ A;  1PHH A;  1VDC A;  1BF3 A;  2VQB A;  2VRM A;  3P4S A;  3UOX A;  2BC1 A;  1Y56 B;  3CNS A;  3AE3 A;  3C96 A;  1GRF A;  1N4W A;  2ZZB A;  2GH5 A;  2BYB A;  4J2W A;  3T14 A;  2XVI A;  1S7M A;  2BC0 A;  2GQF A;  2JKC A;  2VVL G;  3M12 A;  3AE7 A;  1JRX A;  2APG A;  4RG4 A;  5GSN A;  2WP9 A;  4X9N A;  3LZW A;  4A6N A;  5JCI A;  4HA6 A;  3DJG X;  2WOW A;  1PBF A;  3NYE A;  2OLO A;  4YTM A;  4DGK A;  3DME A;  1IUT A;  2Y6R A;  1H2I A;  3P4R A;  1GT8 A;  2WDQ A;  4ADW A;  3F8R A;  4NTC A;  1B5Q A;  3DK4 A;  2YR6 A;  3SFD A;  4EM4 A;  3QSE A;  1F3P A;  3ICT A;  5EBK A;  4XWZ A;  4JNQ A;  2C67 A;  5JCM A;  1GRA A;  1ELI A;  2WU2 A;  2J3N A;  3QFB A;  4RG3 A;  3S61 A;  4YWO A;  1PJ5 A;  2B76 A;  1KFY A;  4K22 A;  1YY5 A;  3GD4 A;  2V60 A;  2JBV A;  3P1W A;  2R9Z A;  1KSS A;  2YM1 A;  2BXS A;  3QSM A;  4U8M A;  2WHD A;  4EQW A;  1TYP A;  3H4K A;  1COY A;  1GTE A;  2C72 A;  3UTH A;  4CY8 A;  4H7U A;  5CKU A;  1D4C A;  2FJB A;  4FX9 A;  4AOX A;  2XFN A;  3P4P A;  2OAL A;  4U8L A;  2AQJ A;  3IF9 A;  3NT6 A;  3IC9 A;  3I3L A;  1MO9 A;  3KD9 A;  2B9X A;  1KNP A;  3AE4 A;  3EAN A;  1DOC A;  3NYF A;  5C2T A;  3AD7 B;  4B65 A;  5BRT A;  1XHC A;  4BK3 A;  1JU2 A;  3ATQ A;  4JQ9 A;  2Z5X A;  5EB5 A;  1GSN A;  3NHO X;  3QVR A;  5FMH A;  3OZ2 A;  4NZH A;  3G5S A;  2C76 A;  3AD9 B;  1CF3 A;  3AEF A;  2E1M A;  1BWC A;  4IVM B;  4OPU A;  1LV0 A;  4PAA A;  1GRH A;  2B7R A;  3CND A;  1CC2 A;  4CBQ A;  4H4W A;  1OJC A;  3T2Z A;  3EAO A;  4BK2 A;  2R46 A;  4J56 A;  5KVH A;  5LV9 A;  4GF7 A;  4OPT A;  3SGL A;  4DSG A;  1DXL A;  3CGD A;  1F8W A;  4DNA A;  2IVE A;  1GRG A;  3RNM A;  2XLS A;  2C73 A;  4AT0 A;  1LVL A;  1NDA A;  2H88 A;  3CPJ G;  4I58 A;  4II2 A;  3T31 A;  5JCL A;  4Z2U A;  2JB1 A;  4H4X A;  3RP8 A;  4B67 A;  3SY4 A;  3QFA A;  2R0C A;  3COX A;  4OPI A;  5JRB A;  2YG4 A;  3VQR A;  4CNJ A;  4GAP A;  4BUR A;  2Q0K A;  4JDR A;  1GRB A;  4EIP A;  4U2T A;  3M0O A;  1FEB A;  3WE0 A;  1S3E A;  1MXT A;  3CPH G;  3FMW A;  1BKW A;  4ICY A;  3RED A;  3ZDN A;  1H6V A;  4H4V A;  2C70 A;  1O95 A;  4RSL A;  4XWR A;  2PHH A;  4A99 A;  5U25 A;  4N9X A;  3SZF A;  1DJQ A;  2XCG A;  4H4Y A;  1ZX9 A;  4U8O A;  3K30 A;  5BUK A;  3CGC A;  2GR3 A;  4BV6 A;  3VR9 A;  2WDV A;  2YLZ A;  4Z43 A;  3AE2 A;  1GRT A;  2XVJ A;  1VG9 A;  1DOD A;  3DA1 A;  4B1B A;  3KPF A;  3RP7 A;  1KSU A;  3NIX A;  2B7S A;  3ADA B;  3ICS A;  1O94 A;  3HYX A;  3KVE A;  1GET A;  1IUX A;  3IHG A;  4YKG A;  2GMH A;  1K4Q A;  5EOW A;  4Z2T A;  3GYX A;  4H2Q A;  4C5O A;  1XAN A;  2GR0 A;  2WS3 A;  2TPR A;  3PS9 A;  4LA1 A;  1PBE A;  2XVH A;  5ER0 A;  5C3J A;  3ISH A;  1GND A;  2X8G A;  1VG0 A;  2GR1 A;  1GPE A;  4U8P A;  2B9W A;  4U8J A;  3UKL A;  1CBO A;  1EL9 A;  2GV8 A;  2BXR A;  3NTA A;  2XLR A;  2BS4 A;  3AYJ A;  3AEC A;  3JSK A;  5DBJ A;  2A87 A;  2VQ7 A;  3EPT A;  4AP1 A;  3K7T A;  1PBD A;  2YVJ A;  3DK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...