5FS7A

Crystal structure of the g262s mutant of human apoptosis inducing factor
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
487
structure length
449
Chain Sequence
DKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGSTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Structure/Function Relations in Aifm1 Variants Associated with Neurodegenerative Disorders.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 149
structure length 449
sequence length 487
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fs7A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs7A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs7A01
3GDPA 2YAUA 1YQ3A 5EOWA 1IUVA 1B4VA 2R4JA 4CCQA 2C72A 2YVJA 1TDEA 1F8RA 3IC9A 1KDGA 1BF3A 4JN9A 4BK2A 1H84A 4CCRA 1RP0A 4H7UA 3NTDA 1OJ9A 1ZP0A 3C4AA 1GXFA 2ARDA 3IHGA 4PABA 3UKPA 4YTPA 3AEBA 4ZN0A 4H4UA 1S3BA 5FMHA 3K7TA 5CKUA 4AOSA 2JBVA 1GEUA 4JDRA 4DSGA 3V3NA 1B5QA 3CTYA 3DH9A 2GF3A 4H2NA 1NHQA 1ZOYA 3NKSA 3AEAA 1XANA 2VQBA 3RHAA 3V3OA 4C5OA 2C76A 4BV6A 4Y4LA 5GSNA 4TM0A 1EL8A 3P4QA 5TR3A 1NAAA 1RYIA 3F8DA 4U8MA 4H2PA 4X9NA 4A6NB 2TMDA 1GV4A 2ZZBA 2VZ2A 2WU5A 1PDHA 1CJ3A 1KNRA 3UKQA 2BK3A 1QO8A 3B3RA 1JRYA 3K7MX 4Z25A 2XFOA 3URHA 5FS6A 3D1CA 5IPYA 2Q0KA 4ECHA 1F3PA 3ATQA 1D4CA 4LIIA 2DKHA 2EQ9A 4C77A 4Z2TA 4IA5A 2GQWA 1W4XA 1GTHA 1LV0A 2ACZA 2YVFA 1IUUA 4U8PA 2GB0A 2R0PA 4O5QA 1EBDA 1MO9A 2GVCA 5KVIA 4J56A 3ICSA 4CRTA 4YSHA 1N4WA 2RGOA 2VVLG 2C3DA 3GRTA 3FPZA 4J33A 2WEUA 3NK2X 1LPFA 3LB8A 3DK4A 4I58A 4YWOA 1DOEA 3KLJA 2E4GA 4RSLA 3SM8A 1Q9IA 4B69A 5KWFA 2ZZCA 3AE1A 4GCMA 3UKHA 4NTCA 3LXDA 5IQ4A 2C66A 3DJJA 3DMEA 2V3AA 3BHFA 3NYCA 5JCIA 2JB1A 2DKIA 4FK1A 1GRTA 4GDEA 3ICTA 2BA9A 3UKLA 2AAQA 2FJAA 3FBSA 1FEBA 1LQUA 4B68A 1TRBA 4YSZA 1O5WA 5HXIA 3BHKA 1O94A 2C70A 4JY3A 1PXAA 2C7GA 4OPGA 3OC4A 2Q7VA 1SEZA 4FX9A 4H4XA 1AOGA 1NG3A 3AE7A 3ABVA 4BJZA 2XLUA 3H8IA 1JU2A 5J7XA 4A79A 4EMIA 5EB4A 2Y6QA 2YM1A 4H2RA 2ZZ0A 3DJEA 2I0ZA 1GREA 1PBEA 1OJCA 1F8SA 1L9CA 3AE6A 2E5VA 2BK5A 1KSSA 2YG6A 4U2TA 3O0HA 1H86A 1KFYA 4A5LA 1FOHA 1L9EA 2CDUA 2B9YA 3DGHA 1E7PA 3UOVA 3GMCA 3EAOA 1K0LA 3F8PA 2B9WA 1BKWA 2OA1A 3RP6A 2JK6A 4NTEA 2CULA 4A65A 4BJYA 4A7AA 4UDRA 3NIXA 3AYJA 4NEWA 1NENA 2YG5A 2X8GA 1PS9A 4USQA 1GRGA 1ELIA 1E39A 4D04A 3DK9A 3P4RA 4HB9A 2VRLA 3EANA 1TDNA 2WPEA 3BI2A 4PAAA 1XDIA 2A87A 3II4A 2GAHB 1PXBA 2VVMA 2JKCA 3BNUA 1TYTA 1TDKA 2XFUA 2WQYA 2EQ8A 3C96A 3CNTA 3REDA 4B67A 4C74A 2YVGA 3SQPA 1CC4A 2YG3A 3AE3A 2BXRA 1XHCA 3AD9B 4H4ZA 4HA6A 1UKVG 4CNKA 2HQMA 5C3JA 1JNRA 1IUTA 2FJDA 3UKAA 2C65A 1GETA 3F8RA 2OAMA 4DSHA 2RABA 1Y56A 3VR9A 2OLOA 4E0VA 2GR2A 4LU6A 1S3EA 4IVOB 4H4YA 3G5QA 1L9DA 4XXGA 5BULA 3AE8A 4EQSA 5U1OA 2R0CA 4D03A 5DBJA 4U8OA 4EQXA 2APGA 2OALA 3FIMB 3ICRA 2XVJA 4Z24A 3DJGX 2J3NA 1BZLA 4APNA 2Z5YA 1VDCA 1S2YA 3LZXA 3ALLA 1NEKA 3NTAA 2H89A 3PS9A 5JCKA 2O9ZA 3LADA 2WHDA 4OCGA 5ER0A 4WX1A 4FDCB 1S2QA 2BC1A 1PJ6A 3EPTA 3NK1X 1LVLA 4OPUA 3GWFA 3CPHG 2RGJA 1DOBA 1O95A 1FECA 1YQZA 4AOXA 4GRTA 2EQ7A 3GYIA 4BK1A 3NLCA 1QJDA 1Z6LA 2X50A 2WP6A 4K2XA 5HYMA 3BI4A 3UP4A 4J31A 2Y6RA 1HYUA 4OPCA 4XWRA 2RGHA 5C2TA 3GRSA 3ISHA 1H7XA 3V76A 1IUXA 1PBCA 2Q6UA 2XVEA 1E1NA 3CNPA 4H4SA 3H8LA 4I59A 3UTGA 2V60A 3CN8A 3VQRA 4EM3A 2AR8A 1Y56B 2E1MA 2BACA 1BGNA 3AEEA 3SFEA 4GUVA 1Q1RA 2C75A 2BCGG 1Y0PA 4U8IA 2GR1A 3K7QX 4H4RA 3KPFA 1E1MA 2XLSA 4K22A 3QFBA 2CFYA 4U2LA 1IUSA 3JSKA 5EBKA 2BS2A 1H6VA 2C3CA 3ZDNA 3H4KA 3IWAA 3BI5A 2WPFA 3CNSA 1ZMDA 4OPTA 2FBWA 4H4VA 1GERA 4B65A 3UOYA 5J60A 2XYOA 3KKJA 3LOVA 2YM2A 4EIQA 1B37A 4B66A 1DXLA 1QLBA 4XWZA 4DGKA 3P4SA 4H4WA 1V59A 1X31B 2WS3A 1ZY8A 2OLNA 1NDAA 4MJWA 1GRHA 1GRFA 1TDFA 4M52A 2JB3A 2YG4A 2YR5A 4Z26A 4B1BA 1DODA 2QA2A 4Z44A 4TLXA 1COYA 3CGDA 2NPXA 3AYLA 4U8JA 2GR3A 3SGLA 1ZMCA 3DJDA 2CVJA 3GDNA 2VRMA 4GDPA 4RG3A 1CBOA 4X4JA 2BC0A 1DJNA 4NEVA 2YLWA 2F5ZA 4YXDA 3NN6X 4TM4A 2QAEA 1OJAA 2IIDA 3AD8B 1E1LA 1GALA 2WOWA 3AD7B 1H83A 2B7SA 3I6DA 4UP3A 3UP5A 1JRXA 4J36A 4YT0A 3NHOX 1EL7A 2PYXA 5LV9A 3HZLA 1D5TA 2B76A 3S61A 4IVMB 4YSYA 5M0ZA 3WE0A 2YLTA 1NPXA 2IVEA 2YG7A 1P2HA 3NYFA 2W0HA 2GV8A 4KX6A 3S5WA 2FJBA 3KVEA 3CGEA 1RSGA 2PHHA 5EB5A 3BNMA 3CPIG 4Y4NA 1B8SA 1TDOA 5IQ1A 1ZKQA 4H4TA 2WESA 1YY5A 4EQWA 5JCMA 3IF9A 2GR0A 3P9UA 3K30A 3QJ4A 4B63A 1F6MA 3L8KA 3AE4A 1VQWA 1GRBA 5U25A 3NNEA 5U63A 1DJQA 4J34A 5HHFA 4AP1A 2EQ6A 3OZ2A 2VVLA 2XLRA 4FK1C 1FEAA 2NVKX 4GR1A 4OVIA 5GRTA 1ZK7A 1CL0A 3GD3A 4H4QA 3AE9A 2YLZA 3VRAA 4C3YA 2X8HA 1JNZA 2B9XA 3CPJG 4J57A 3LJPA 3P1WA 4JQ9A 1D4EA 3UKKA 1GT8A 5KXJA 3B6DA 2R9ZA 1VG0A 2V3BA 1D7YA 3NH3X 2GH5A 5JCLA 3C4NA 3VRDB 3AEFA 3I3LA 1ZDLA 4A99A 3KA7A 4K7ZA 2WOVA 1CC6A 3SFDA 5KRQA 3NK0X 4OPDA 2V6OA 4YTMA 5L46A 3NRNA 1OJDA 2GMJA 1N4UA 2B7RA 2XFQA 3M13A 4K5SA 2BXSA 4U2SA 1CHUA 2R4EA 3GD4A 3G5RA 2GEWA 3DA1A 1H7WA 1KSUA 2X99A 3ZYXA 2ZBWA 2BYBA 2C64A 4CY6A 1VRQB 1VG9A 2XVIA 4YKFA 4CY8A 5KOWA 4AT0A 3AEGA 3ALJA 3CGCA 5BRTA 2YLRA 2BS4A 3UTHA 1E6EA 4N9XA 4JNAA 4U8NA 4U8KA 4UDPA 4B64A 2GAGB 1NHRA 1CJ4A 3AE2A 1P2EA 1PN0A 2WU2A 4DNAA 4TM3A 1KF6A 2GQFA 1YQ4A 5CQFA 4K5RA 3GWDA 1FCDA 4YTNA 5JCNA 2QA1A 4IV9A 4EMWA 1CF3A 2WDRA 1LQTA 1EL5A 2XCGA 3AECA 3CNJA 1NHSA 4JY2A 2VOUA 4K8DA 1M64A 3NGCX 1PJ5A 4EM4A 1EL9A 2UZZA 2WP5A 3ADAB 3QVPA 1K0IA 3UKFA 1F8WA 3VR8A 1PBDA 1PXCA 1H81A 2WPCA 4UDQA 2XFNA 3G5SA 3QSEA 1CC2A 3GMBA 1REOA 3IHMA 2BK4A 2JB2A 4USRA 4NZHA 4Y4MA 1PHHA 3GYJA 4ADWA 1BGJA 3GSIA 4ZCCA 1L0VA 3RP8A 5M10A 4J2WA 1PJ7A 1YKJA 3ALMA 4OPIA 2X8CA 1OJTA 3Q6JA 1CJ2A 4EIPA 3RP7A 3UOXA 3CIRA 3ITJA 1GESA 2Q0LA 1GSNA 4Z2RA 4TLZA 1CJCA 1D4DA 2C73A 1LTXR 4P9SA 3UCLA 3EF6A 3UTFA 4CNJA 3ATRA 1D7LA 1NG4A 3DGZA 3L1RA 2GRTA 4C3XA 5KOXA 1LJ1A 4Z43A 5HY5A 2XLPA 4TM1A 3R9UA 1Q1WA 4ZCDA 4H4PA 1JRZA 4REKA 3NT6A 3E1TA 1NHPA 1KNPA 2FJEA 2R46A 2X3NA 1N4VA 3KD9A 3NYEA 1GOSA 4LA1A 3FMWA 3P4PA 5FS7A 1MXTA 1MOKA 4BURA 3NG7X 1ZX9A 2YLXA 2TPRA 2YR4A 4H50A 2XVFA 1BWCA 4A9WA 2WBAA 3AWIA 2A8XA 5FS9A 2R0GA 1PBFA 5BUKA 3AE5A 1DNCA 3Q9TA 4CBQA 2XVHA 3AYIA 4WCTA 3RNMA 2YQUA 3FG2P 5BVAA 3QSMA 4KPRA 1TYPA 1JOAA 2WDVA 1XPQA 4AP3A 4YKGA 1DOCA 1FL2A 2GMHA 3PVCA 1E1KA 5KVHA 4NTDA 2WOIA 2QCUA 2WP9A 4EMJA 3QFAA 1GPEA 4EQRA 5FS8A 2XFPA 2BS3A 3D8XA 3KU9A 3AEDA 3AB1A 3DK8A 1M6IA 2C67A 4IA6A 4H2QA 2JAEA 1GNDA 3AXBA 3M12A 3VRBA 3CGBA 1N1PA 4AT2A 2WETA 1ZOVA 4OPLA 1GTEA 2R45A 2XDOA 1IJHA 4YSXA 3QVRA 4BK3A 3UTEA 2BCPA 2YR6A 3T37A 1ONFA 2BABA 4X9MA 2VQ7A 4JNQA 2WDQA 2AQJA 4U8LA 2V5ZA 1GRAA 3CNDA 2Z5XA 1H82A 3PO7A 2YLSA 4O5UA 1IUWA 2XLTA 3COXA 3LZWA 1PBBA 3UOZA 2V61A 3M0OA 2YWLA 4ICYA 1JEHA 2H88A 4GF7A 4Z2UA 3QSSA 2A89A 1K4QA 3NN0X 4A6NA 1K0JA 4RG4A 2IVDA
chains in the Genus database with same CATH superfamily
5EOWA 2YAUA 1YQ3A 1IUVA 2R4JA 2YVJA 1F8RA 1KDGA 2OVLA 4CCRA 4H7UA 1ZP0A 3UKPA 3K7TA 5CKUA 1F9CA 3UCDA 3CTYA 4C5OA 3UJ2A 1FO4A 2P0IA 2VZ2A 1PDYA 1PDHA 3QPEA 1SJDA 3UKQA 1JRYA 5FS6A 2EQ9A 4C77A 2GQWA 3P0WA 4HN8A 3UCCA 4U8PA 4O5QA 1MDLA 2GVCA 5KVIA 1N4WA 2RGOA 2VVLG 4HYRA 3CT2A 4J33A 3NK2X 4I58A 3RITA 3DK4A 4YWOA 4RSLA 2E4GA 1Q9IA 4B69A 3D47A 7ENLA 4NTCA 3LXDA 2QJJA 2C66A 3I6TA 3DMEA 4GDEA 3BHFA 2BA9A 2QDEA 2AAQA 2FJAA 3FBSA 1LQUA 1O5WA 1O94A 2C70A 2P8BA 4FX9A 1MUCA 3ABVA 3TJ4A 1E9IA 2XLUA 4GAVA 4A79A 4EMIA 4JHMA 3DJEA 2E5VA 3AMZA 2B9YA 3DGHA 1E7PA 3GMCA 4IL2A 1BKWA 4A65A 3SZCA 3NIXA 3AM9A 2X8GA 1PS9A 1ONEA 4D04A 1E39A 3P4RA 2QJNA 2PP1A 2VRLA 3BI2A 1XDIA 3GD6A 1PXBA 2VVMA 1X2HA 4TVYA 3BNUA 3CAWA 1TDKA 2WQYA 2EQ8A 2YVGA 2YG3A 1XHCA 3EUB3 4H4ZA 2HXTA 1JNRA 2FJDA 4DSHA 3V5FA 4G7FA 3VDGA 2OLOA 1EC8A 4XXGA 3AE8A 4EQSA 4EQXA 3LZXA 3ALLA 2H89A 4GIRA 4OCGA 3TTEA 4A6GA 3AN1A 2PTXA 3GYIA 2X50A 4K2XA 1HYUA 4OPCA 1PBCA 4ZOHB 1EBGA 3DDMA 3OP2A 4GFIA 3SFEA 4GUVA 2C75A 2BCGG 5BOFA 3CMMA 3FVDA 1IUSA 3IJQA 1JDFA 3IWAA 2WPFA 1ZMDA 3UOYA 2CHRA 3LOVA 4B66A 4XWZA 1P43A 1EBHA 1H2IA 4Z26A 3T8QA 3AYLA 3CYJA 4YXDA 3VC5A 4E4UA 1OJAA 2IIDA 3UP5A 2B7SA 4J36A 4YT0A 1ELSA 1EL7A 2B76A 1SJBA 5M0ZA 3WE0A 2YLTA 2GV8A 3R0UA 1RSGA 2PHHA 3BNMA 3QTPA 4EQWA 2GR0A 3K30A 1N5WC 5U63A 1RVKA 4J34A 3DERA 2VVLA 4GR1A 4X2PA 4C3YA 3ZVHA 3CPJG 2FYMA 4J57A 3LJPA 3P1WA 1VG0A 3NH3X 1PDZA 3NK0X 4OPDA 2GMJA 1N4UA 3G5RA 2GEWA 3DA1A 1KSUA 2C64A 2PA6A 3ZLFA 4YKFA 3HW2A 3SN0A 3SY4A 5BRTA 3UTHA 4N9XA 1NHRA 2GGJA 3AE2A 2GQFA 4K5RA 1FCDA 2QA1A 2AKMA 4DSGA 3AECA 2XCGA 1EL5A 5G5GB 2VOUA 3NGCX 1PJ5A 1SJCA 3SZ0A 3NZGA 2UZZA 4G6GA 1H81A 2WPCA 3VA8A 4JN8A 3GYJA 3GSIA 4IT1A 3SZFA 4TVWA 1CJ2A 3RP7A 1GSNA 1FIQB 2C73A 2XH7A 1LTXR 4Z1YA 1NG4A 2GRTA 2E3TA 4C3XA 3VC6A 5KOXA 1Q1WA 4ZCDA 4H4PA 1JRZA 2R46A 3NYEA 1GOSA 1ZX9A 4H50A 4A9WA 3AWIA 1N5XA 4GYPC 2XVHA 3AYIA 3FG2P 3QSMA 1XPQA 3PVCA 1SJAA 2OPJA 4G8TA 2XFPA 1VDVA 4IA6A 3T2ZA 3GYXA 4OPLA 1GTEA 2BABA 2WDQA 2Z5XA 1H82A 4O5UA 1IUWA 3CXBA 2XLTA 1PBBA 3UOZA 2V61A 1FHUA 4ICYA 1K4QA 3T4WA 3GDPA 3U9IA 2C72A 1GXFA 3NRZB 4H4UA 1WUEA 5FJRA 4AOSA 2JBVA 1SB3B 3HPFA 4H2NA 4HCDA 4J3ZA 1ZOYA 3V3OA 4BV6A 3OW1A 1EL8A 1EC7A 4H2PA 4X9NA 4A6NB 4NWZA 4E4FA 4II2A 3K7MX 3K1GA 4Z25A 5IPYA 1F3PA 3ATQA 4LIIA 3MKCA 3TWAA 3JVAA 4G73A 4J1OA 2GB0A 2R0PA 1MO9A 4CRTA 4FP1A 2OKTA 6ENLA 1LPFA 3LB8A 3P93A 2ZZCA 4GCMA 3UKHA 5IQ4A 4FK1A 2DKIA 3ICTA 3UKLA 1TRBA 4YSZA 3ETRB 4JY3A 2XH2A 2HNEA 1SEZA 1AOGA 3NXLA 4BJZA 5FJTA 5JRBA 2Y6QA 3CXOA 2I0ZA 1PBEA 1YEYA 1IYXA 4U2TA 3IJLA 1L9EA 3UOVA 2B9WA 3OZMA 3RP6A 2W54A 1KKRA 4A7AA 3PWGA 3AYJA 4NEWA 4USQA 3N6HA 1ELIA 3DK9A 1KCZA 4HB9A 3EANA 3DFYA 3T6CA 3TWBA 2JKCA 1TYTA 4B67A 3C96A 3SQPA 1CC4A 3AE3A 2BXRA 3B97A 1IUTA 1GETA 4K2SA 3IK4A 2P8CA 2BRYA 2GR2A 4LU6A 1S3EA 4K8GA 3Q4DA 4U8OA 2OALA 3ZVIA 4APNA 4JN9A 3NTAA 4BK2A 1NEKA 3LADA 5ER0A 1S2QA 2BC1A 1FHVA 3GWFA 1KKOA 1DOBA 4AOXA 4GRTA 4BK1A 3NLCA 1Z6LA 2WP6A 2AL1A 4XWRA 5C2TA 2PP0A 3OZYA 2XVEA 4I59A 3UTGA 3T2YA 1Y56B 2E1MA 2GR1A 4H4RA 2MUCA 4K22A 2CFYA 4E5TA 3JSKA 2BS2A 4A3RA 3BI5A 3FJ4A 5FJUA 1KN0A 1GERA 4IHCA 3KKJA 2YM2A 4EIQA 1QLBA 4DGKA 1ZY8A 2OLNA 1NDAA 1GRHA 1GRFA 3A7RA 2YR5A 2ZADA 4Z44A 1COYA 3DJDA 4GDPA 2MNRA 1DJNA 1NELA 1L8PA 4TM4A 3AD7B 1H83A 3NHOX 5LV9A 3S61A 1D5TA 4IVMB 4YSYA 2PMQA 3D46A 2YG7A 2W0HA 2FJBA 3CGEA 3CPIG 1B8SA 1ZKQA 4H4TA 1N63C 1YY5A 3P9UA 3AE4A 3DGBA 3NNEA 2EQ6A 2PU1A 3GO2A 1T3QC 1ZK7A 4H4QA 2B9XA 3UKKA 4JQ9A 1D4EA 4MKSA 4MGGA 1D7YA 3FXGA 2GH5A 2AL2B 3SN1A 4K7ZA 1CC6A 3KPKA 1RM6B 3MSYA 3NRNA 1OJDA 1MNSA 1BQGA 4U2SA 2QJMA 1H7WA 3ZYXA 2X99A 5BOEA 2XVIA 4CY8A 1ECQA 2P3ZA 4AT0A 3ALJA 3OPSA 3SX6A 1PN0A 3GWDA 4IV9A 4EMWA 1LQTA 4JY2A 1NHSA 3TJIA 3QVPA 1F8WA 1JPDX 3ZLHA 1EC9A 3QSEA 3GMBA 2JB2A 4USRA 4IL0A 1PHHA 1BGJA 3RP8A 1PJ7A 1YKJA 3Q6JA 4EIPA 3ITJA 3B9JB 2Q0LA 3NVYB 4TLZA 1CJCA 1D4DA 3L1RA 4DXKA 5FJPA 4E8GA 4YWSA 1LJ1A 5HY5A 2P88A 3R11A 3SQSA 1NHPA 4LA1A 3FMWA 2YLXA 2YR4A 1BWCA 2A8XA 2R0GA 3Q9TA 4CBQA 4WCTA 3RNMA 2YQUA 1TYPA 1JOAA 4YKGA 3RCYA 4AP3A 3SJNA 1WUFA 1DOCA 2QCUA 2WP9A 4EQRA 3D8XA 3AEDA 1OEPA 3CB3A 2E5AA 3PWIA 5EU9A 3R10A 2C67A 4H2QA 1GNDA 4AT2A 1IJHA 1JCTA 3T37A 3DG7A 4M0XA 2QQ6A 2AQJA 1GRAA 3CNDA 3PO7A 3HYWA 3COXA 3PFRA 5KMPA 2PPGA 4GF7A 1N61C 1XS2A 2A89A 3NN0X 4A6NA 2IVDA 4CCQA 1TDEA 1BF3A 3BOXA 1N62C 1H84A 1RP0A 3NTDA 3C4AA 4PABA 2ARDA 4YTPA 1S7MA 5FMHA 3V3NA 1B5QA 2OQHA 3DH9A 2GF3A 1NHQA 3NKSA 2XH0A 3AEAA 1XANA 4Y4LA 3P4QA 1NAAA 4HCHA 1RYIA 4U8MA 3TOYA 3H7VA 3STPA 1KNRA 1QO8A 3B3RA 3L5OA 4ECHA 4KT2A 3FCPA 2DKHA 2POZA 4MMWA 1W4XA 3VFCA 1GTHA 2ACZA 2YVFA 1IUUA 3R07C 1EBDA 2GGIA 3ICSA 4YSHA 2C3DA 2AKZA 2WEUA 3VCNA 3SM8A 3KLJA 3ES8A 3AE1A 2GGGA 3DJJA 2V3AA 3NYCA 2QGYA 4K1WA 5HXIA 4H83A 3A7UA 3ZLGA 1PXAA 3OC4A 4H4XA 1FFUC 3H8IA 4GISA 5EB4A 2YM1A 3OTRA 3SR6B 4H2RA 1GREA 1OJCA 2BK5A 1KSSA 2YG6A 1KFYA 2PTYA 1K0LA 2OZ3A 3ENLA 2OA1A 4BJYA 2CULA 4UDRA 2PTZA 1GRGA 2RDXA 2WPEA 2A87A 3II4A 2PTWA 3REDA 2XFUA 4C74A 4G74A 3AD9B 4HA6A 4CNKA 2HQMA 2OQYA 2C65A 3S5SA 2OAMA 1Y56A 3VR9A 1L9DA 5BULA 1MDRA 5U1OA 5DBJA 3FIMB 2J3NA 2Z5YA 1S2YA 5JCKA 2O9ZA 1TKKA 4WX1A 4FDCB 1PJ6A 3NK1X 1LVLA 3CPHG 4ENLA 3HYVA 1O95A 1FECA 1YQZA 2QVHA 2EQ7A 5HYMA 3HRDC 3UP4A 4J31A 3GRSA 3ISHA 1H7XA 1IUXA 3T0KA 2DW7A 3H8LA 3Q45A 3CN8A 3PG6A 3VQRA 2C4CA 2BACA 3AEEA 1Q1RA 4U8IA 3K7QX 3KPFA 3QFBA 2C3CA 2OX4A 4EWJA 2FBWA 4H4VA 5J60A 2XYOA 4IP4A 1B37A 4H4WA 1V59A 1TDFA 4M52A 2JB3A 4GGBA 4B1BA 4DX3A 1DODA 2QA2A 2ZC8A 4TLXA 2NPXA 2GR3A 2CVJA 4RG3A 2VRMA 4NEVA 2AL2A 3NN6X 3AD8B 1GALA 1DTNA 3I6DA 1JRXA 2PYXA 1W6TA 2IVEA 1P2HA 3NYFA 4KX6A 3IJIA 3RO6A 3JW7A 2WESA 1VQWA 3CK5A 1GRBA 1DJQA 3N4EA 1P48A 3OZ2A 4GMEA 4FK1C 2NVKX 4A35A 2BRAA 3GD3A 3AE9A 1JNZA 1GT8A 5KXJA 3B6DA 2R9ZA 3T31A 3VRDB 3DESA 1ZDLA 3KA7A 2WOVA 3SFDA 5KRQA 5L46A 1X2GA 2GGEA 3M13A 4II3A 1CHUA 3GD4A 1KD0A 2ZBWA 2BYBA 1VRQB 1VG9A 1JRPA 5KOWA 3AEGA 4DWDA 2YLRA 2BS4A 4JNAA 4U8KA 4UDPA 4KPLA 1CJ4A 1P2EA 2WU2A 1KF6A 4H2HA 1YQ4A 2OG9A 4YTNA 3N4FA 2WDRA 4GGHA 3QKEA 1M64A 4EM4A 1EL9A 2WP5A 5KMQA 2PGEA 3VR8A 1PXCA 4UDQA 3G5SA 1CC2A 2PSNA 2BK4A 3IHMA 4Y4MA 4ADWA 3BSMA 1L0VA 4ZCCA 3FYYA 3ALMA 1ZXIC 3H70A 2DW6A 3NVVB 1GESA 3V4BA 3QLDA 4CNJA 4P9SA 3ATRA 3MWCA 2XGZA 1WYGA 3RRAA 4Z43A 3KUMA 4TM1A 4DYEA 4REKA 3E1TA 1KNPA 2FJEA 2X3NA 1N4VA 5KMSA 3D9XA 1MXTA 1MOKA 2TPRA 4NNJA 2XVFA 5FS9A 3HYXA 5J04A 1PBFA 3DEQA 5BUKA 2GMHA 1FL2A 1TE6A 1E1KA 5KVHA 1GPEA 3EEZA 2PCEA 2BS3A 3PK7A 3AB1A 3DK8A 3R0KA 3CGBA 3VCCA 2OZ8A 4YSXA 3QVRA 3UTEA 1ONFA 3TQPA 2V5ZA 1FFVC 3MUCA 2FKPA 3M0OA 2YWLA 3UXLA 2W55A 2H88A 4Z2UA 4ROPA 3A7AA 1K0JA 2GSHA 1B4VA 3BJSA 3IC9A 2PP3A 4F4RA 4IP5A 1OJ9A 3IHGA 4KEMA 3AEBA 3N6JA 3MY9A 4ZN0A 4ZA0A 1S3BA 1GEUA 4JDRA 3T14A 2VQBA 3RHAA 4HCLA 2C76A 2HZGA 3R1ZA 5GSNA 4TM0A 5TR3A 3F8DA 2TMDA 4HPNA 1GV4A 2ZZBA 2WU5A 1CJ3A 4Z17A 2BK3A 2XFOA 3URHA 3D1CA 1JROA 2Q0KA 1D4CA 4Z2TA 4GAPA 4IA5A 1STZA 3UGVA 1LV0A 2GGHA 4J56A 4G6HA 1NU5A 3GRTA 3FPZA 1DOEA 5KWFA 5JCIA 2JB1A 1GRTA 3NFUA 3SN4A 2W3RA 1FEBA 4H1ZA 4B68A 3BHKA 4OPGA 2C7GA 3S47A 2Q7VA 3NS1B 1NG3A 3AE7A 1JU2A 5J7XA 2ZZ0A 2OLAA 1F8SA 1L9CA 3AE6A 5KMRA 3ES7A 3O0HA 1H86A 4A5LA 1FOHA 2CDUA 3EAOA 3F8PA 4ZCWA 5FJOA 2JK6A 4NTEA 3H12A 3P3BA 3EKGA 1NENA 2YG5A 5G5HB 3I6EA 1TDNA 4PAAA 2GAHB 3CNTA 3THUA 3RGTA 3TCSA 4HNCA 1R0MA 2XH4A 1UKVG 5C3JA 3UKAA 3F8RA 2RABA 3V5CA 4E0VA 4IVOB 4JN7A 4H4YA 3G5QA 2R0CA 1MRAA 1JPMA 2APGA 3ICRA 4Z24A 2XVJA 3MQTA 3DJGX 4HNLA 1BZLA 1VDCA 3PS9A 2WHDA 3EPTA 3GY1A 4OPUA 2RGJA 3SSZA 2QDDA 1QJDA 3BI4A 2Y6RA 2RGHA 3V76A 2Q6UA 1E1NA 3CNPA 4H4SA 2V60A 4EM3A 4GYPA 2AR8A 5KNLA 3QN3A 4G9KA 2OO6A 1BGNA 3UJRA 1Y0PA 1E1MA 2XLSA 4U2LA 3NVWB 5EBKA 1H6VA 3ZDNA 3H4KA 3CNSA 4OPTA 4B65A 2I5QA 1DXLA 3P4SA 1X31B 2WS3A 4MJWA 3JZUA 2YG4A 2OFJA 3RR1A 3CGDA 4U8JA 3SGLA 1ZMCA 3GDNA 1CBOA 4X4JA 2BC0A 4IZGA 2YLWA 2F5ZA 3DG6A 2HXUA 2QAEA 1E1LA 4UP3A 2WOWA 5IDZA 3UJSA 3HZLA 1NPXA 3SBFA 3FV9A 3S5WA 3KVEA 2XSXA 5EB5A 4Y4NA 3T9PA 5IQ1A 1TDOA 3DFHA 4M6UA 5JCMA 3IF9A 3QJ4A 4B63A 1F6MA 3SYIA 3L8KA 1TZZA 5U25A 5HHFA 2GL5A 4AP1A 4OVIA 2XLRA 1FEAA 5GRTA 1CL0A 3GC2A 2YLZA 2PU0A 3VRAA 2X8HA 3NO1A 4DN1A 3UJFA 4KWSA 2V3BA 5JCLA 3R25A 3C4NA 3AEFA 3I3LA 4A99A 3SXIA 1N60C 2V6OA 4YTMA 2B7RA 2XFQA 3UJEA 4K5SA 1R6WA 2BXSA 2R4EA 4CY6A 3U4FA 3UXKA 1XPYA 3CGCA 1E6EA 4U8NA 4B64A 2GAGB 4D03A 4TM3A 4DNAA 5CQFA 5JCNA 1CF3A 3CNJA 4FI4A 4K8DA 3ZVHB 2PODA 1VQZA 3DG3A 3ADAB 3T2KA 1K0IA 3UKFA 1BKHA 1PBDA 2GDQA 2XFNA 3V3WA 1REOA 5ENLA 4H19A 2NQLA 4NZHA 5M10A 4J2WA 2OZTA 4OPIA 2O56A 2X8CA 1OJTA 2ONEA 4DHGA 3UOXA 3CIRA 4Z2RA 3UTFA 3UCLA 3EF6A 3MZNA 1D7LA 3NVZB 3DGZA 3SZWA 3I4KA 2XLPA 3R9UA 2PGWA 3NT6A 1V97A 3KD9A 3P4PA 5FS7A 3NG7X 4BURA 2WBAA 3AE5A 1DNCA 5BVAA 2PS2A 4KPRA 2WDVA 3TW9A 4NTDA 2WOIA 4EMJA 3QFAA 5FS8A 3KU9A 1M6IA 2JAEA 3AXBA 3M12A 3VRBA 1N1PA 2WETA 1ZOVA 2R45A 2XDOA 4BK3A 2BCPA 2YR6A 4X9MA 2VQ7A 4JNQA 2W3SA 4U8LA 2YLSA 3H8AA 3DIPA 3LZWA 1JEHA 4E6MA 3QSSA 4RG4A
chains in the Genus database with same CATH topology
3GDPA 2YAUA 1YQ3A 5EOWA 1IUVA 1B4VA 2R4JA 4CCQA 2C72A 2YVJA 1TDEA 1F8RA 3IC9A 1KDGA 1BF3A 4JN9A 4BK2A 1H84A 4CCRA 1RP0A 4H7UA 3NTDA 1OJ9A 1ZP0A 3C4AA 1GXFA 2ARDA 3IHGA 4PABA 3UKPA 4YTPA 3AEBA 4ZN0A 4H4UA 1S3BA 1S7MA 5FMHA 3K7TA 5CKUA 4AOSA 2JBVA 1GEUA 4JDRA 3T14A 4DSGA 3V3NA 1B5QA 3CTYA 3DH9A 2GF3A 4H2NA 1NHQA 1ZOYA 3NKSA 3AEAA 1XANA 2VQBA 3RHAA 3V3OA 4C5OA 2C76A 4BV6A 4Y4LA 5GSNA 4TM0A 1EL8A 3P4QA 5TR3A 1NAAA 1RYIA 3F8DA 4U8MA 4H2PA 4X9NA 4A6NB 2TMDA 4NWZA 1GV4A 2ZZBA 2VZ2A 2WU5A 1PDHA 1CJ3A 1KNRA 4II2A 3UKQA 2BK3A 1QO8A 3B3RA 1JRYA 3K7MX 4Z25A 2XFOA 3URHA 5FS6A 3D1CA 5IPYA 2Q0KA 3L5OA 4ECHA 1F3PA 3ATQA 1D4CA 4LIIA 2DKHA 2EQ9A 4GAPA 4C77A 4IA5A 4Z2TA 2GQWA 4G73A 1W4XA 1GTHA 1LV0A 2ACZA 2YVFA 1IUUA 4U8PA 2GB0A 2R0PA 4O5QA 1EBDA 1MO9A 2GVCA 5KVIA 4J56A 3ICSA 4CRTA 4G6HA 4YSHA 1N4WA 2RGOA 2VVLG 2C3DA 3GRTA 3FPZA 4J33A 2WEUA 3NK2X 1LPFA 3LB8A 3DK4A 4I58A 4YWOA 1DOEA 3KLJA 2E4GA 4RSLA 3SM8A 1Q9IA 4B69A 5KWFA 2ZZCA 3AE1A 4GCMA 3UKHA 4NTCA 3LXDA 5IQ4A 2C66A 3DJJA 3DMEA 2V3AA 3BHFA 3NYCA 5JCIA 2JB1A 2DKIA 4FK1A 1GRTA 4GDEA 3ICTA 2BA9A 3UKLA 2AAQA 2FJAA 3FBSA 1FEBA 1LQUA 4B68A 1TRBA 4YSZA 1O5WA 5HXIA 3BHKA 1O94A 2C70A 4JY3A 1PXAA 2C7GA 4OPGA 3OC4A 2Q7VA 1SEZA 4FX9A 4H4XA 1AOGA 1NG3A 3AE7A 3ABVA 4BJZA 2XLUA 3H8IA 5JRBA 1JU2A 5J7XA 4GAVA 4A79A 4EMIA 5EB4A 2Y6QA 2YM1A 4H2RA 2ZZ0A 3DJEA 2I0ZA 1GREA 1PBEA 1OJCA 1F8SA 1L9CA 3AE6A 5KMRA 2E5VA 2BK5A 1KSSA 2YG6A 4U2TA 3O0HA 1H86A 1KFYA 4A5LA 1FOHA 1L9EA 2CDUA 2B9YA 3DGHA 1E7PA 3UOVA 3GMCA 3EAOA 1K0LA 3F8PA 2B9WA 1BKWA 2OA1A 3RP6A 2JK6A 4NTEA 2CULA 4A65A 4BJYA 3SZCA 4A7AA 4UDRA 3NIXA 3AYJA 4NEWA 1NENA 2YG5A 2X8GA 1PS9A 4USQA 1GRGA 1ELIA 1E39A 4D04A 3DK9A 3P4RA 4HB9A 2VRLA 3EANA 1TDNA 2WPEA 3BI2A 4PAAA 1XDIA 2A87A 3II4A 2GAHB 1PXBA 2VVMA 2JKCA 3BNUA 1TYTA 1TDKA 2XFUA 2WQYA 2EQ8A 3C96A 3CNTA 3REDA 4B67A 4C74A 2YVGA 3SQPA 1CC4A 4G74A 2YG3A 3AE3A 2BXRA 1XHCA 3AD9B 4H4ZA 4HA6A 1UKVG 4CNKA 2HQMA 5C3JA 1JNRA 1IUTA 2FJDA 3UKAA 2C65A 1GETA 3F8RA 2OAMA 4DSHA 2RABA 1Y56A 3VR9A 2BRYA 2OLOA 4E0VA 2GR2A 4LU6A 1S3EA 4IVOB 4H4YA 3G5QA 1L9DA 4XXGA 5BULA 3AE8A 4EQSA 5U1OA 2R0CA 4D03A 5DBJA 4U8OA 4EQXA 2APGA 2OALA 3FIMB 3ICRA 2XVJA 4Z24A 3DJGX 2J3NA 1BZLA 4APNA 2Z5YA 1VDCA 1S2YA 3LZXA 3ALLA 1NEKA 3NTAA 2H89A 3PS9A 5JCKA 2O9ZA 3LADA 2WHDA 4OCGA 5ER0A 4WX1A 4FDCB 1S2QA 2BC1A 1PJ6A 3EPTA 3NK1X 1LVLA 4OPUA 3GWFA 3CPHG 2RGJA 3HYVA 1DOBA 1O95A 1FECA 1YQZA 4AOXA 4GRTA 2EQ7A 3GYIA 4BK1A 3NLCA 1QJDA 1Z6LA 2X50A 2WP6A 4K2XA 5HYMA 3BI4A 3UP4A 4J31A 2Y6RA 1HYUA 4OPCA 4XWRA 2RGHA 5C2TA 3GRSA 3ISHA 1H7XA 3V76A 1IUXA 1PBCA 3T0KA 2Q6UA 2XVEA 1E1NA 3CNPA 4H4SA 3H8LA 4I59A 3UTGA 2V60A 3PG6A 3CN8A 3VQRA 4EM3A 2AR8A 5KNLA 2C4CA 1Y56B 3T2YA 4G9KA 2E1MA 2BACA 1BGNA 3AEEA 3SFEA 4GUVA 1Q1RA 2C75A 2BCGG 1Y0PA 4U8IA 2GR1A 3K7QX 4H4RA 3KPFA 1E1MA 2XLSA 3CMMA 3QFBA 2CFYA 4K22A 4U2LA 1IUSA 3JSKA 5EBKA 2BS2A 1H6VA 2C3CA 3ZDNA 3H4KA 3IWAA 3BI5A 2WPFA 3CNSA 1ZMDA 4OPTA 2FBWA 1KN0A 1GERA 4H4VA 3UOYA 4B65A 5J60A 2XYOA 3KKJA 3LOVA 2YM2A 4EIQA 1B37A 4B66A 1DXLA 1QLBA 4XWZA 4DGKA 3P4SA 4H4WA 1V59A 1X31B 2WS3A 1ZY8A 2OLNA 1NDAA 4MJWA 1GRHA 1GRFA 1TDFA 4M52A 2JB3A 1H2IA 2YG4A 2YR5A 4Z26A 4B1BA 1DODA 2QA2A 4Z44A 4TLXA 1COYA 3CGDA 2NPXA 3AYLA 4U8JA 2GR3A 3SGLA 1ZMCA 3DJDA 2CVJA 3GDNA 2VRMA 4GDPA 4RG3A 1CBOA 4X4JA 2BC0A 1DJNA 4NEVA 2YLWA 2F5ZA 4YXDA 3NN6X 4TM4A 2QAEA 1OJAA 2IIDA 3AD8B 1E1LA 1GALA 2WOWA 3AD7B 1H83A 2B7SA 3I6DA 4UP3A 3UP5A 1JRXA 4J36A 4YT0A 3NHOX 1EL7A 2PYXA 5LV9A 3HZLA 1D5TA 2B76A 3S61A 4IVMB 4YSYA 5M0ZA 3WE0A 2YLTA 1NPXA 2IVEA 2YG7A 1P2HA 3NYFA 2W0HA 2GV8A 4KX6A 3S5WA 2FJBA 3KVEA 3CGEA 1RSGA 2PHHA 5EB5A 3BNMA 3CPIG 4Y4NA 1B8SA 1TDOA 5IQ1A 1ZKQA 4H4TA 2WESA 1YY5A 4EQWA 5JCMA 3IF9A 2GR0A 3P9UA 3K30A 3QJ4A 4B63A 1F6MA 3SYIA 3L8KA 3AE4A 1VQWA 1GRBA 5U25A 3NNEA 5U63A 1DJQA 4J34A 5HHFA 4AP1A 2EQ6A 3OZ2A 2VVLA 2XLRA 4FK1C 1FEAA 2NVKX 4GR1A 4OVIA 5GRTA 1ZK7A 2BRAA 1CL0A 3GD3A 4H4QA 3AE9A 2YLZA 3VRAA 4C3YA 2X8HA 1JNZA 2B9XA 3CPJG 4J57A 3LJPA 3P1WA 4JQ9A 1D4EA 3UKKA 1GT8A 5KXJA 3B6DA 2R9ZA 1VG0A 2V3BA 1D7YA 3T31A 3NH3X 2GH5A 5JCLA 3C4NA 3VRDB 3AEFA 3I3LA 1ZDLA 4A99A 3KA7A 4K7ZA 2WOVA 1CC6A 3KPKA 3SFDA 5KRQA 3NK0X 3SXIA 4OPDA 2V6OA 4YTMA 5L46A 3NRNA 1OJDA 2GMJA 1N4UA 2B7RA 2XFQA 3M13A 4II3A 4K5SA 2BXSA 4U2SA 1CHUA 2R4EA 3GD4A 3G5RA 2GEWA 3DA1A 1H7WA 1KSUA 2X99A 3ZYXA 2ZBWA 2BYBA 2C64A 4CY6A 1VRQB 1VG9A 2XVIA 4YKFA 4CY8A 5KOWA 4AT0A 3AEGA 3ALJA 3SY4A 3CGCA 5BRTA 2YLRA 2BS4A 3UTHA 1E6EA 4N9XA 4JNAA 4U8NA 4U8KA 4UDPA 3SX6A 4B64A 2GAGB 1NHRA 1CJ4A 3AE2A 1P2EA 1PN0A 2WU2A 4DNAA 4TM3A 1KF6A 2GQFA 1YQ4A 5CQFA 4K5RA 3GWDA 1FCDA 4YTNA 5JCNA 2QA1A 4IV9A 4EMWA 1CF3A 2WDRA 1LQTA 1EL5A 2XCGA 3AECA 3CNJA 1NHSA 4JY2A 2VOUA 4K8DA 1M64A 3NGCX 1PJ5A 4EM4A 3SZ0A 1EL9A 2UZZA 2WP5A 3ADAB 3QVPA 5KMQA 1K0IA 3T2KA 3UKFA 1F8WA 4G6GA 3VR8A 1PBDA 1PXCA 1H81A 2WPCA 4UDQA 2XFNA 3G5SA 3QSEA 1CC2A 3GMBA 1REOA 3IHMA 2BK4A 2JB2A 4USRA 4NZHA 4Y4MA 1PHHA 3GYJA 4ADWA 1BGJA 3GSIA 4ZCCA 1L0VA 3RP8A 5M10A 4J2WA 1PJ7A 1YKJA 3ALMA 4OPIA 2X8CA 1OJTA 3Q6JA 1CJ2A 3SZFA 3RP7A 4EIPA 3UOXA 3CIRA 3ITJA 1GESA 2Q0LA 1GSNA 4Z2RA 4TLZA 1CJCA 1D4DA 2C73A 1LTXR 4P9SA 3UCLA 3EF6A 3UTFA 4CNJA 3ATRA 1D7LA 1NG4A 3DGZA 3L1RA 2GRTA 4C3XA 5KOXA 3SZWA 1LJ1A 4Z43A 5HY5A 2XLPA 4TM1A 3R9UA 1Q1WA 4ZCDA 4H4PA 1JRZA 4REKA 3NT6A 3E1TA 1NHPA 1KNPA 2FJEA 2R46A 2X3NA 1N4VA 5KMSA 3KD9A 3NYEA 3D9XA 4LA1A 1GOSA 3FMWA 5FS7A 3P4PA 1MXTA 1MOKA 4BURA 3NG7X 1ZX9A 2YLXA 2TPRA 2YR4A 4NNJA 4H50A 2XVFA 1BWCA 4A9WA 2WBAA 3AWIA 2A8XA 5FS9A 2R0GA 3HYXA 1PBFA 5BUKA 3AE5A 1DNCA 3Q9TA 4CBQA 2XVHA 3AYIA 4WCTA 3RNMA 2YQUA 3FG2P 5BVAA 3QSMA 4KPRA 1TYPA 1JOAA 2WDVA 1XPQA 4AP3A 4YKGA 1DOCA 1FL2A 2GMHA 3PVCA 1E1KA 5KVHA 4NTDA 2WOIA 2QCUA 2WP9A 4EMJA 3QFAA 1GPEA 4EQRA 5FS8A 2XFPA 2BS3A 3D8XA 3KU9A 3AEDA 3AB1A 3DK8A 1M6IA 2C67A 4IA6A 4H2QA 3GYXA 3T2ZA 2JAEA 1GNDA 3AXBA 3M12A 3VRBA 3CGBA 1N1PA 4AT2A 2WETA 1ZOVA 4OPLA 1GTEA 2R45A 2XDOA 1IJHA 4YSXA 3QVRA 4BK3A 3UTEA 2BCPA 2YR6A 3T37A 1ONFA 2BABA 4X9MA 2VQ7A 4JNQA 2WDQA 2AQJA 4U8LA 2V5ZA 1GRAA 3CNDA 2Z5XA 1H82A 3PO7A 3HYWA 2YLSA 4O5UA 1IUWA 2XLTA 3COXA 3LZWA 1PBBA 3UOZA 5KMPA 2V61A 3M0OA 2YWLA 4ICYA 1JEHA 2H88A 4GF7A 4Z2UA 3QSSA 2A89A 1K4QA 3NN0X 4A6NA 1K0JA 4RG4A 2IVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GDP A;  2YAU A;  1YQ3 A;  5EOW A;  1IUV A;  1B4V A;  2R4J A;  4CCQ A;  2C72 A;  2YVJ A;  1TDE A;  1F8R A;  3IC9 A;  1KDG A;  1BF3 A;  4JN9 A;  4BK2 A;  1H84 A;  4CCR A;  1RP0 A;  4H7U A;  3NTD A;  1OJ9 A;  1ZP0 A;  3C4A A;  1GXF A;  2ARD A;  3IHG A;  4PAB A;  3UKP A;  4YTP A;  3AEB A;  4ZN0 A;  4H4U A;  1S3B A;  5FMH A;  3K7T A;  5CKU A;  4AOS A;  2JBV A;  1GEU A;  4JDR A;  4DSG A;  3V3N A;  1B5Q A;  3CTY A;  3DH9 A;  2GF3 A;  4H2N A;  1NHQ A;  1ZOY A;  3NKS A;  3AEA A;  1XAN A;  2VQB A;  3RHA A;  3V3O A;  4C5O A;  2C76 A;  4BV6 A;  4Y4L A;  5GSN A;  4TM0 A;  1EL8 A;  3P4Q A;  5TR3 A;  1NAA A;  1RYI A;  3F8D A;  4U8M A;  4H2P A;  4X9N A;  4A6N B;  2TMD A;  1GV4 A;  2ZZB A;  2VZ2 A;  2WU5 A;  1PDH A;  1CJ3 A;  1KNR A;  3UKQ A;  2BK3 A;  1QO8 A;  3B3R A;  1JRY A;  3K7M X;  4Z25 A;  2XFO A;  3URH A;  5FS6 A;  3D1C A;  5IPY A;  2Q0K A;  4ECH A;  1F3P A;  3ATQ A;  1D4C A;  4LII A;  2DKH A;  2EQ9 A;  4C77 A;  4Z2T A;  4IA5 A;  2GQW A;  1W4X A;  1GTH A;  1LV0 A;  2ACZ A;  2YVF A;  1IUU A;  4U8P A;  2GB0 A;  2R0P A;  4O5Q A;  1EBD A;  1MO9 A;  2GVC A;  5KVI A;  4J56 A;  3ICS A;  4CRT A;  4YSH A;  1N4W A;  2RGO A;  2VVL G;  2C3D A;  3GRT A;  3FPZ A;  4J33 A;  2WEU A;  3NK2 X;  1LPF A;  3LB8 A;  3DK4 A;  4I58 A;  4YWO A;  1DOE A;  3KLJ A;  2E4G A;  4RSL A;  3SM8 A;  1Q9I A;  4B69 A;  5KWF A;  2ZZC A;  3AE1 A;  4GCM A;  3UKH A;  4NTC A;  3LXD A;  5IQ4 A;  2C66 A;  3DJJ A;  3DME A;  2V3A A;  3BHF A;  3NYC A;  5JCI A;  2JB1 A;  2DKI A;  4FK1 A;  1GRT A;  4GDE A;  3ICT A;  2BA9 A;  3UKL A;  2AAQ A;  2FJA A;  3FBS A;  1FEB A;  1LQU A;  4B68 A;  1TRB A;  4YSZ A;  1O5W A;  5HXI A;  3BHK A;  1O94 A;  2C70 A;  4JY3 A;  1PXA A;  2C7G A;  4OPG A;  3OC4 A;  2Q7V A;  1SEZ A;  4FX9 A;  4H4X A;  1AOG A;  1NG3 A;  3AE7 A;  3ABV A;  4BJZ A;  2XLU A;  3H8I A;  1JU2 A;  5J7X A;  4A79 A;  4EMI A;  5EB4 A;  2Y6Q A;  2YM1 A;  4H2R A;  2ZZ0 A;  3DJE A;  2I0Z A;  1GRE A;  1PBE A;  1OJC A;  1F8S A;  1L9C A;  3AE6 A;  2E5V A;  2BK5 A;  1KSS A;  2YG6 A;  4U2T A;  3O0H A;  1H86 A;  1KFY A;  4A5L A;  1FOH A;  1L9E A;  2CDU A;  2B9Y A;  3DGH A;  1E7P A;  3UOV A;  3GMC A;  3EAO A;  1K0L A;  3F8P A;  2B9W A;  1BKW A;  2OA1 A;  3RP6 A;  2JK6 A;  4NTE A;  2CUL A;  4A65 A;  4BJY A;  4A7A A;  4UDR A;  3NIX A;  3AYJ A;  4NEW A;  1NEN A;  2YG5 A;  2X8G A;  1PS9 A;  4USQ A;  1GRG A;  1ELI A;  1E39 A;  4D04 A;  3DK9 A;  3P4R A;  4HB9 A;  2VRL A;  3EAN A;  1TDN A;  2WPE A;  3BI2 A;  4PAA A;  1XDI A;  2A87 A;  3II4 A;  2GAH B;  1PXB A;  2VVM A;  2JKC A;  3BNU A;  1TYT A;  1TDK A;  2XFU A;  2WQY A;  2EQ8 A;  3C96 A;  3CNT A;  3RED A;  4B67 A;  4C74 A;  2YVG A;  3SQP A;  1CC4 A;  2YG3 A;  3AE3 A;  2BXR A;  1XHC A;  3AD9 B;  4H4Z A;  4HA6 A;  1UKV G;  4CNK A;  2HQM A;  5C3J A;  1JNR A;  1IUT A;  2FJD A;  3UKA A;  2C65 A;  1GET A;  3F8R A;  2OAM A;  4DSH A;  2RAB A;  1Y56 A;  3VR9 A;  2OLO A;  4E0V A;  2GR2 A;  4LU6 A;  1S3E A;  4IVO B;  4H4Y A;  3G5Q A;  1L9D A;  4XXG A;  5BUL A;  3AE8 A;  4EQS A;  5U1O A;  2R0C A;  4D03 A;  5DBJ A;  4U8O A;  4EQX A;  2APG A;  2OAL A;  3FIM B;  3ICR A;  2XVJ A;  4Z24 A;  3DJG X;  2J3N A;  1BZL A;  4APN A;  2Z5Y A;  1VDC A;  1S2Y A;  3LZX A;  3ALL A;  1NEK A;  3NTA A;  2H89 A;  3PS9 A;  5JCK A;  2O9Z A;  3LAD A;  2WHD A;  4OCG A;  5ER0 A;  4WX1 A;  4FDC B;  1S2Q A;  2BC1 A;  1PJ6 A;  3EPT A;  3NK1 X;  1LVL A;  4OPU A;  3GWF A;  3CPH G;  2RGJ A;  1DOB A;  1O95 A;  1FEC A;  1YQZ A;  4AOX A;  4GRT A;  2EQ7 A;  3GYI A;  4BK1 A;  3NLC A;  1QJD A;  1Z6L A;  2X50 A;  2WP6 A;  4K2X A;  5HYM A;  3BI4 A;  3UP4 A;  4J31 A;  2Y6R A;  1HYU A;  4OPC A;  4XWR A;  2RGH A;  5C2T A;  3GRS A;  3ISH A;  1H7X A;  3V76 A;  1IUX A;  1PBC A;  2Q6U A;  2XVE A;  1E1N A;  3CNP A;  4H4S A;  3H8L A;  4I59 A;  3UTG A;  2V60 A;  3CN8 A;  3VQR A;  4EM3 A;  2AR8 A;  1Y56 B;  2E1M A;  2BAC A;  1BGN A;  3AEE A;  3SFE A;  4GUV A;  1Q1R A;  2C75 A;  2BCG G;  1Y0P A;  4U8I A;  2GR1 A;  3K7Q X;  4H4R A;  3KPF A;  1E1M A;  2XLS A;  4K22 A;  3QFB A;  2CFY A;  4U2L A;  1IUS A;  3JSK A;  5EBK A;  2BS2 A;  1H6V A;  2C3C A;  3ZDN A;  3H4K A;  3IWA A;  3BI5 A;  2WPF A;  3CNS A;  1ZMD A;  4OPT A;  2FBW A;  4H4V A;  1GER A;  4B65 A;  3UOY A;  5J60 A;  2XYO A;  3KKJ A;  3LOV A;  2YM2 A;  4EIQ A;  1B37 A;  4B66 A;  1DXL A;  1QLB A;  4XWZ A;  4DGK A;  3P4S A;  4H4W A;  1V59 A;  1X31 B;  2WS3 A;  1ZY8 A;  2OLN A;  1NDA A;  4MJW A;  1GRH A;  1GRF A;  1TDF A;  4M52 A;  2JB3 A;  2YG4 A;  2YR5 A;  4Z26 A;  4B1B A;  1DOD A;  2QA2 A;  4Z44 A;  4TLX A;  1COY A;  3CGD A;  2NPX A;  3AYL A;  4U8J A;  2GR3 A;  3SGL A;  1ZMC A;  3DJD A;  2CVJ A;  3GDN A;  2VRM A;  4GDP A;  4RG3 A;  1CBO A;  4X4J A;  2BC0 A;  1DJN A;  4NEV A;  2YLW A;  2F5Z A;  4YXD A;  3NN6 X;  4TM4 A;  2QAE A;  1OJA A;  2IID A;  3AD8 B;  1E1L A;  1GAL A;  2WOW A;  3AD7 B;  1H83 A;  2B7S A;  3I6D A;  4UP3 A;  3UP5 A;  1JRX A;  4J36 A;  4YT0 A;  3NHO X;  1EL7 A;  2PYX A;  5LV9 A;  3HZL A;  1D5T A;  2B76 A;  3S61 A;  4IVM B;  4YSY A;  5M0Z A;  3WE0 A;  2YLT A;  1NPX A;  2IVE A;  2YG7 A;  1P2H A;  3NYF A;  2W0H A;  2GV8 A;  4KX6 A;  3S5W A;  2FJB A;  3KVE A;  3CGE A;  1RSG A;  2PHH A;  5EB5 A;  3BNM A;  3CPI G;  4Y4N A;  1B8S A;  1TDO A;  5IQ1 A;  1ZKQ A;  4H4T A;  2WES A;  1YY5 A;  4EQW A;  5JCM A;  3IF9 A;  2GR0 A;  3P9U A;  3K30 A;  3QJ4 A;  4B63 A;  1F6M A;  3L8K A;  3AE4 A;  1VQW A;  1GRB A;  5U25 A;  3NNE A;  5U63 A;  1DJQ A;  4J34 A;  5HHF A;  4AP1 A;  2EQ6 A;  3OZ2 A;  2VVL A;  2XLR A;  4FK1 C;  1FEA A;  2NVK X;  4GR1 A;  4OVI A;  5GRT A;  1ZK7 A;  1CL0 A;  3GD3 A;  4H4Q A;  3AE9 A;  2YLZ A;  3VRA A;  4C3Y A;  2X8H A;  1JNZ A;  2B9X A;  3CPJ G;  4J57 A;  3LJP A;  3P1W A;  4JQ9 A;  1D4E A;  3UKK A;  1GT8 A;  5KXJ A;  3B6D A;  2R9Z A;  1VG0 A;  2V3B A;  1D7Y A;  3NH3 X;  2GH5 A;  5JCL A;  3C4N A;  3VRD B;  3AEF A;  3I3L A;  1ZDL A;  4A99 A;  3KA7 A;  4K7Z A;  2WOV A;  1CC6 A;  3SFD A;  5KRQ A;  3NK0 X;  4OPD A;  2V6O A;  4YTM A;  5L46 A;  3NRN A;  1OJD A;  2GMJ A;  1N4U A;  2B7R A;  2XFQ A;  3M13 A;  4K5S A;  2BXS A;  4U2S A;  1CHU A;  2R4E A;  3GD4 A;  3G5R A;  2GEW A;  3DA1 A;  1H7W A;  1KSU A;  2X99 A;  3ZYX A;  2ZBW A;  2BYB A;  2C64 A;  4CY6 A;  1VRQ B;  1VG9 A;  2XVI A;  4YKF A;  4CY8 A;  5KOW A;  4AT0 A;  3AEG A;  3ALJ A;  3CGC A;  5BRT A;  2YLR A;  2BS4 A;  3UTH A;  1E6E A;  4N9X A;  4JNA A;  4U8N A;  4U8K A;  4UDP A;  4B64 A;  2GAG B;  1NHR A;  1CJ4 A;  3AE2 A;  1P2E A;  1PN0 A;  2WU2 A;  4DNA A;  4TM3 A;  1KF6 A;  2GQF A;  1YQ4 A;  5CQF A;  4K5R A;  3GWD A;  1FCD A;  4YTN A;  5JCN A;  2QA1 A;  4IV9 A;  4EMW A;  1CF3 A;  2WDR A;  1LQT A;  1EL5 A;  2XCG A;  3AEC A;  3CNJ A;  1NHS A;  4JY2 A;  2VOU A;  4K8D A;  1M64 A;  3NGC X;  1PJ5 A;  4EM4 A;  1EL9 A;  2UZZ A;  2WP5 A;  3ADA B;  3QVP A;  1K0I A;  3UKF A;  1F8W A;  3VR8 A;  1PBD A;  1PXC A;  1H81 A;  2WPC A;  4UDQ A;  2XFN A;  3G5S A;  3QSE A;  1CC2 A;  3GMB A;  1REO A;  3IHM A;  2BK4 A;  2JB2 A;  4USR A;  4NZH A;  4Y4M A;  1PHH A;  3GYJ A;  4ADW A;  1BGJ A;  3GSI A;  4ZCC A;  1L0V A;  3RP8 A;  5M10 A;  4J2W A;  1PJ7 A;  1YKJ A;  3ALM A;  4OPI A;  2X8C A;  1OJT A;  3Q6J A;  1CJ2 A;  4EIP A;  3RP7 A;  3UOX A;  3CIR A;  3ITJ A;  1GES A;  2Q0L A;  1GSN A;  4Z2R A;  4TLZ A;  1CJC A;  1D4D A;  2C73 A;  1LTX R;  4P9S A;  3UCL A;  3EF6 A;  3UTF A;  4CNJ A;  3ATR A;  1D7L A;  1NG4 A;  3DGZ A;  3L1R A;  2GRT A;  4C3X A;  5KOX A;  1LJ1 A;  4Z43 A;  5HY5 A;  2XLP A;  4TM1 A;  3R9U A;  1Q1W A;  4ZCD A;  4H4P A;  1JRZ A;  4REK A;  3NT6 A;  3E1T A;  1NHP A;  1KNP A;  2FJE A;  2R46 A;  2X3N A;  1N4V A;  3KD9 A;  3NYE A;  1GOS A;  4LA1 A;  3FMW A;  3P4P A;  5FS7 A;  1MXT A;  1MOK A;  4BUR A;  3NG7 X;  1ZX9 A;  2YLX A;  2TPR A;  2YR4 A;  4H50 A;  2XVF A;  1BWC A;  4A9W A;  2WBA A;  3AWI A;  2A8X A;  5FS9 A;  2R0G A;  1PBF A;  5BUK A;  3AE5 A;  1DNC A;  3Q9T A;  4CBQ A;  2XVH A;  3AYI A;  4WCT A;  3RNM A;  2YQU A;  3FG2 P;  5BVA A;  3QSM A;  4KPR A;  1TYP A;  1JOA A;  2WDV A;  1XPQ A;  4AP3 A;  4YKG A;  1DOC A;  1FL2 A;  2GMH A;  3PVC A;  1E1K A;  5KVH A;  4NTD A;  2WOI A;  2QCU A;  2WP9 A;  4EMJ A;  3QFA A;  1GPE A;  4EQR A;  5FS8 A;  2XFP A;  2BS3 A;  3D8X A;  3KU9 A;  3AED A;  3AB1 A;  3DK8 A;  1M6I A;  2C67 A;  4IA6 A;  4H2Q A;  2JAE A;  1GND A;  3AXB A;  3M12 A;  3VRB A;  3CGB A;  1N1P A;  4AT2 A;  2WET A;  1ZOV A;  4OPL A;  1GTE A;  2R45 A;  2XDO A;  1IJH A;  4YSX A;  3QVR A;  4BK3 A;  3UTE A;  2BCP A;  2YR6 A;  3T37 A;  1ONF A;  2BAB A;  4X9M A;  2VQ7 A;  4JNQ A;  2WDQ A;  2AQJ A;  4U8L A;  2V5Z A;  1GRA A;  3CND A;  2Z5X A;  1H82 A;  3PO7 A;  2YLS A;  4O5U A;  1IUW A;  2XLT A;  3COX A;  3LZW A;  1PBB A;  3UOZ A;  2V61 A;  3M0O A;  2YWL A;  4ICY A;  1JEH A;  2H88 A;  4GF7 A;  4Z2U A;  3QSS A;  2A89 A;  1K4Q A;  3NN0 X;  4A6N A;  1K0J A;  4RG4 A;  2IVD A; 
#chains in the Genus database with same CATH topology
 5EOW A;  2YAU A;  1YQ3 A;  1IUV A;  2R4J A;  2YVJ A;  1F8R A;  1KDG A;  2OVL A;  4CCR A;  4H7U A;  1ZP0 A;  3UKP A;  3K7T A;  5CKU A;  1F9C A;  3UCD A;  3CTY A;  4C5O A;  3UJ2 A;  1FO4 A;  2P0I A;  2VZ2 A;  1PDY A;  1PDH A;  3QPE A;  1SJD A;  3UKQ A;  1JRY A;  5FS6 A;  2EQ9 A;  4C77 A;  2GQW A;  3P0W A;  4HN8 A;  3UCC A;  4U8P A;  4O5Q A;  1MDL A;  2GVC A;  5KVI A;  1N4W A;  2RGO A;  2VVL G;  4HYR A;  3CT2 A;  4J33 A;  3NK2 X;  4I58 A;  3RIT A;  3DK4 A;  4YWO A;  4RSL A;  2E4G A;  1Q9I A;  4B69 A;  3D47 A;  7ENL A;  4NTC A;  3LXD A;  2QJJ A;  2C66 A;  3I6T A;  3DME A;  4GDE A;  3BHF A;  2BA9 A;  2QDE A;  2AAQ A;  2FJA A;  3FBS A;  1LQU A;  1O5W A;  1O94 A;  2C70 A;  2P8B A;  4FX9 A;  1MUC A;  3ABV A;  3TJ4 A;  1E9I A;  2XLU A;  4GAV A;  4A79 A;  4EMI A;  4JHM A;  3DJE A;  2E5V A;  3AMZ A;  2B9Y A;  3DGH A;  1E7P A;  3GMC A;  4IL2 A;  1BKW A;  4A65 A;  3SZC A;  3NIX A;  3AM9 A;  2X8G A;  1PS9 A;  1ONE A;  4D04 A;  1E39 A;  3P4R A;  2QJN A;  2PP1 A;  2VRL A;  3BI2 A;  1XDI A;  3GD6 A;  1PXB A;  2VVM A;  1X2H A;  4TVY A;  3BNU A;  3CAW A;  1TDK A;  2WQY A;  2EQ8 A;  2YVG A;  2YG3 A;  1XHC A;  3EUB 3;  4H4Z A;  2HXT A;  1JNR A;  2FJD A;  4DSH A;  3V5F A;  4G7F A;  3VDG A;  2OLO A;  1EC8 A;  4XXG A;  3AE8 A;  4EQS A;  4EQX A;  3LZX A;  3ALL A;  2H89 A;  4GIR A;  4OCG A;  3TTE A;  4A6G A;  3AN1 A;  2PTX A;  3GYI A;  2X50 A;  4K2X A;  1HYU A;  4OPC A;  1PBC A;  4ZOH B;  1EBG A;  3DDM A;  3OP2 A;  4GFI A;  3SFE A;  4GUV A;  2C75 A;  2BCG G;  5BOF A;  3CMM A;  3FVD A;  1IUS A;  3IJQ A;  1JDF A;  3IWA A;  2WPF A;  1ZMD A;  3UOY A;  2CHR A;  3LOV A;  4B66 A;  4XWZ A;  1P43 A;  1EBH A;  1H2I A;  4Z26 A;  3T8Q A;  3AYL A;  3CYJ A;  4YXD A;  3VC5 A;  4E4U A;  1OJA A;  2IID A;  3UP5 A;  2B7S A;  4J36 A;  4YT0 A;  1ELS A;  1EL7 A;  2B76 A;  1SJB A;  5M0Z A;  3WE0 A;  2YLT A;  2GV8 A;  3R0U A;  1RSG A;  2PHH A;  3BNM A;  3QTP A;  4EQW A;  2GR0 A;  3K30 A;  1N5W C;  5U63 A;  1RVK A;  4J34 A;  3DER A;  2VVL A;  4GR1 A;  4X2P A;  4C3Y A;  3ZVH A;  3CPJ G;  2FYM A;  4J57 A;  3LJP A;  3P1W A;  1VG0 A;  3NH3 X;  1PDZ A;  3NK0 X;  4OPD A;  2GMJ A;  1N4U A;  3G5R A;  2GEW A;  3DA1 A;  1KSU A;  2C64 A;  2PA6 A;  3ZLF A;  4YKF A;  3HW2 A;  3SN0 A;  3SY4 A;  5BRT A;  3UTH A;  4N9X A;  1NHR A;  2GGJ A;  3AE2 A;  2GQF A;  4K5R A;  1FCD A;  2QA1 A;  2AKM A;  4DSG A;  3AEC A;  2XCG A;  1EL5 A;  5G5G B;  2VOU A;  3NGC X;  1PJ5 A;  1SJC A;  3SZ0 A;  3NZG A;  2UZZ A;  4G6G A;  1H81 A;  2WPC A;  3VA8 A;  4JN8 A;  3GYJ A;  3GSI A;  4IT1 A;  3SZF A;  4TVW A;  1CJ2 A;  3RP7 A;  1GSN A;  1FIQ B;  2C73 A;  2XH7 A;  1LTX R;  4Z1Y A;  1NG4 A;  2GRT A;  2E3T A;  4C3X A;  3VC6 A;  5KOX A;  1Q1W A;  4ZCD A;  4H4P A;  1JRZ A;  2R46 A;  3NYE A;  1GOS A;  1ZX9 A;  4H50 A;  4A9W A;  3AWI A;  1N5X A;  4GYP C;  2XVH A;  3AYI A;  3FG2 P;  3QSM A;  1XPQ A;  3PVC A;  1SJA A;  2OPJ A;  4G8T A;  2XFP A;  1VDV A;  4IA6 A;  3T2Z A;  3GYX A;  4OPL A;  1GTE A;  2BAB A;  2WDQ A;  2Z5X A;  1H82 A;  4O5U A;  1IUW A;  3CXB A;  2XLT A;  1PBB A;  3UOZ A;  2V61 A;  1FHU A;  4ICY A;  1K4Q A;  3T4W A;  3GDP A;  3U9I A;  2C72 A;  1GXF A;  3NRZ B;  4H4U A;  1WUE A;  5FJR A;  4AOS A;  2JBV A;  1SB3 B;  3HPF A;  4H2N A;  4HCD A;  4J3Z A;  1ZOY A;  3V3O A;  4BV6 A;  3OW1 A;  1EL8 A;  1EC7 A;  4H2P A;  4X9N A;  4A6N B;  4NWZ A;  4E4F A;  4II2 A;  3K7M X;  3K1G A;  4Z25 A;  5IPY A;  1F3P A;  3ATQ A;  4LII A;  3MKC A;  3TWA A;  3JVA A;  4G73 A;  4J1O A;  2GB0 A;  2R0P A;  1MO9 A;  4CRT A;  4FP1 A;  2OKT A;  6ENL A;  1LPF A;  3LB8 A;  3P93 A;  2ZZC A;  4GCM A;  3UKH A;  5IQ4 A;  4FK1 A;  2DKI A;  3ICT A;  3UKL A;  1TRB A;  4YSZ A;  3ETR B;  4JY3 A;  2XH2 A;  2HNE A;  1SEZ A;  1AOG A;  3NXL A;  4BJZ A;  5FJT A;  5JRB A;  2Y6Q A;  3CXO A;  2I0Z A;  1PBE A;  1YEY A;  1IYX A;  4U2T A;  3IJL A;  1L9E A;  3UOV A;  2B9W A;  3OZM A;  3RP6 A;  2W54 A;  1KKR A;  4A7A A;  3PWG A;  3AYJ A;  4NEW A;  4USQ A;  3N6H A;  1ELI A;  3DK9 A;  1KCZ A;  4HB9 A;  3EAN A;  3DFY A;  3T6C A;  3TWB A;  2JKC A;  1TYT A;  4B67 A;  3C96 A;  3SQP A;  1CC4 A;  3AE3 A;  2BXR A;  3B97 A;  1IUT A;  1GET A;  4K2S A;  3IK4 A;  2P8C A;  2BRY A;  2GR2 A;  4LU6 A;  1S3E A;  4K8G A;  3Q4D A;  4U8O A;  2OAL A;  3ZVI A;  4APN A;  4JN9 A;  3NTA A;  4BK2 A;  1NEK A;  3LAD A;  5ER0 A;  1S2Q A;  2BC1 A;  1FHV A;  3GWF A;  1KKO A;  1DOB A;  4AOX A;  4GRT A;  4BK1 A;  3NLC A;  1Z6L A;  2WP6 A;  2AL1 A;  4XWR A;  5C2T A;  2PP0 A;  3OZY A;  2XVE A;  4I59 A;  3UTG A;  3T2Y A;  1Y56 B;  2E1M A;  2GR1 A;  4H4R A;  2MUC A;  4K22 A;  2CFY A;  4E5T A;  3JSK A;  2BS2 A;  4A3R A;  3BI5 A;  3FJ4 A;  5FJU A;  1KN0 A;  1GER A;  4IHC A;  3KKJ A;  2YM2 A;  4EIQ A;  1QLB A;  4DGK A;  1ZY8 A;  2OLN A;  1NDA A;  1GRH A;  1GRF A;  3A7R A;  2YR5 A;  2ZAD A;  4Z44 A;  1COY A;  3DJD A;  4GDP A;  2MNR A;  1DJN A;  1NEL A;  1L8P A;  4TM4 A;  3AD7 B;  1H83 A;  3NHO X;  5LV9 A;  3S61 A;  1D5T A;  4IVM B;  4YSY A;  2PMQ A;  3D46 A;  2YG7 A;  2W0H A;  2FJB A;  3CGE A;  3CPI G;  1B8S A;  1ZKQ A;  4H4T A;  1N63 C;  1YY5 A;  3P9U A;  3AE4 A;  3DGB A;  3NNE A;  2EQ6 A;  2PU1 A;  3GO2 A;  1T3Q C;  1ZK7 A;  4H4Q A;  2B9X A;  3UKK A;  4JQ9 A;  1D4E A;  4MKS A;  4MGG A;  1D7Y A;  3FXG A;  2GH5 A;  2AL2 B;  3SN1 A;  4K7Z A;  1CC6 A;  3KPK A;  1RM6 B;  3MSY A;  3NRN A;  1OJD A;  1MNS A;  1BQG A;  4U2S A;  2QJM A;  1H7W A;  3ZYX A;  2X99 A;  5BOE A;  2XVI A;  4CY8 A;  1ECQ A;  2P3Z A;  4AT0 A;  3ALJ A;  3OPS A;  3SX6 A;  1PN0 A;  3GWD A;  4IV9 A;  4EMW A;  1LQT A;  4JY2 A;  1NHS A;  3TJI A;  3QVP A;  1F8W A;  1JPD X;  3ZLH A;  1EC9 A;  3QSE A;  3GMB A;  2JB2 A;  4USR A;  4IL0 A;  1PHH A;  1BGJ A;  3RP8 A;  1PJ7 A;  1YKJ A;  3Q6J A;  4EIP A;  3ITJ A;  3B9J B;  2Q0L A;  3NVY B;  4TLZ A;  1CJC A;  1D4D A;  3L1R A;  4DXK A;  5FJP A;  4E8G A;  4YWS A;  1LJ1 A;  5HY5 A;  2P88 A;  3R11 A;  3SQS A;  1NHP A;  4LA1 A;  3FMW A;  2YLX A;  2YR4 A;  1BWC A;  2A8X A;  2R0G A;  3Q9T A;  4CBQ A;  4WCT A;  3RNM A;  2YQU A;  1TYP A;  1JOA A;  4YKG A;  3RCY A;  4AP3 A;  3SJN A;  1WUF A;  1DOC A;  2QCU A;  2WP9 A;  4EQR A;  3D8X A;  3AED A;  1OEP A;  3CB3 A;  2E5A A;  3PWI A;  5EU9 A;  3R10 A;  2C67 A;  4H2Q A;  1GND A;  4AT2 A;  1IJH A;  1JCT A;  3T37 A;  3DG7 A;  4M0X A;  2QQ6 A;  2AQJ A;  1GRA A;  3CND A;  3PO7 A;  3HYW A;  3COX A;  3PFR A;  5KMP A;  2PPG A;  4GF7 A;  1N61 C;  1XS2 A;  2A89 A;  3NN0 X;  4A6N A;  2IVD A;  4CCQ A;  1TDE A;  1BF3 A;  3BOX A;  1N62 C;  1H84 A;  1RP0 A;  3NTD A;  3C4A A;  4PAB A;  2ARD A;  4YTP A;  1S7M A;  5FMH A;  3V3N A;  1B5Q A;  2OQH A;  3DH9 A;  2GF3 A;  1NHQ A;  3NKS A;  2XH0 A;  3AEA A;  1XAN A;  4Y4L A;  3P4Q A;  1NAA A;  4HCH A;  1RYI A;  4U8M A;  3TOY A;  3H7V A;  3STP A;  1KNR A;  1QO8 A;  3B3R A;  3L5O A;  4ECH A;  4KT2 A;  3FCP A;  2DKH A;  2POZ A;  4MMW A;  1W4X A;  3VFC A;  1GTH A;  2ACZ A;  2YVF A;  1IUU A;  3R07 C;  1EBD A;  2GGI A;  3ICS A;  4YSH A;  2C3D A;  2AKZ A;  2WEU A;  3VCN A;  3SM8 A;  3KLJ A;  3ES8 A;  3AE1 A;  2GGG A;  3DJJ A;  2V3A A;  3NYC A;  2QGY A;  4K1W A;  5HXI A;  4H83 A;  3A7U A;  3ZLG A;  1PXA A;  3OC4 A;  4H4X A;  1FFU C;  3H8I A;  4GIS A;  5EB4 A;  2YM1 A;  3OTR A;  3SR6 B;  4H2R A;  1GRE A;  1OJC A;  2BK5 A;  1KSS A;  2YG6 A;  1KFY A;  2PTY A;  1K0L A;  2OZ3 A;  3ENL A;  2OA1 A;  4BJY A;  2CUL A;  4UDR A;  2PTZ A;  1GRG A;  2RDX A;  2WPE A;  2A87 A;  3II4 A;  2PTW A;  3RED A;  2XFU A;  4C74 A;  4G74 A;  3AD9 B;  4HA6 A;  4CNK A;  2HQM A;  2OQY A;  2C65 A;  3S5S A;  2OAM A;  1Y56 A;  3VR9 A;  1L9D A;  5BUL A;  1MDR A;  5U1O A;  5DBJ A;  3FIM B;  2J3N A;  2Z5Y A;  1S2Y A;  5JCK A;  2O9Z A;  1TKK A;  4WX1 A;  4FDC B;  1PJ6 A;  3NK1 X;  1LVL A;  3CPH G;  4ENL A;  3HYV A;  1O95 A;  1FEC A;  1YQZ A;  2QVH A;  2EQ7 A;  5HYM A;  3HRD C;  3UP4 A;  4J31 A;  3GRS A;  3ISH A;  1H7X A;  1IUX A;  3T0K A;  2DW7 A;  3H8L A;  3Q45 A;  3CN8 A;  3PG6 A;  3VQR A;  2C4C A;  2BAC A;  3AEE A;  1Q1R A;  4U8I A;  3K7Q X;  3KPF A;  3QFB A;  2C3C A;  2OX4 A;  4EWJ A;  2FBW A;  4H4V A;  5J60 A;  2XYO A;  4IP4 A;  1B37 A;  4H4W A;  1V59 A;  1TDF A;  4M52 A;  2JB3 A;  4GGB A;  4B1B A;  4DX3 A;  1DOD A;  2QA2 A;  2ZC8 A;  4TLX A;  2NPX A;  2GR3 A;  2CVJ A;  4RG3 A;  2VRM A;  4NEV A;  2AL2 A;  3NN6 X;  3AD8 B;  1GAL A;  1DTN A;  3I6D A;  1JRX A;  2PYX A;  1W6T A;  2IVE A;  1P2H A;  3NYF A;  4KX6 A;  3IJI A;  3RO6 A;  3JW7 A;  2WES A;  1VQW A;  3CK5 A;  1GRB A;  1DJQ A;  3N4E A;  1P48 A;  3OZ2 A;  4GME A;  4FK1 C;  2NVK X;  4A35 A;  2BRA A;  3GD3 A;  3AE9 A;  1JNZ A;  1GT8 A;  5KXJ A;  3B6D A;  2R9Z A;  3T31 A;  3VRD B;  3DES A;  1ZDL A;  3KA7 A;  2WOV A;  3SFD A;  5KRQ A;  5L46 A;  1X2G A;  2GGE A;  3M13 A;  4II3 A;  1CHU A;  3GD4 A;  1KD0 A;  2ZBW A;  2BYB A;  1VRQ B;  1VG9 A;  1JRP A;  5KOW A;  3AEG A;  4DWD A;  2YLR A;  2BS4 A;  4JNA A;  4U8K A;  4UDP A;  4KPL A;  1CJ4 A;  1P2E A;  2WU2 A;  1KF6 A;  4H2H A;  1YQ4 A;  2OG9 A;  4YTN A;  3N4F A;  2WDR A;  4GGH A;  3QKE A;  1M64 A;  4EM4 A;  1EL9 A;  2WP5 A;  5KMQ A;  2PGE A;  3VR8 A;  1PXC A;  4UDQ A;  3G5S A;  1CC2 A;  2PSN A;  2BK4 A;  3IHM A;  4Y4M A;  4ADW A;  3BSM A;  1L0V A;  4ZCC A;  3FYY A;  3ALM A;  1ZXI C;  3H70 A;  2DW6 A;  3NVV B;  1GES A;  3V4B A;  3QLD A;  4CNJ A;  4P9S A;  3ATR A;  3MWC A;  2XGZ A;  1WYG A;  3RRA A;  4Z43 A;  3KUM A;  4TM1 A;  4DYE A;  4REK A;  3E1T A;  1KNP A;  2FJE A;  2X3N A;  1N4V A;  5KMS A;  3D9X A;  1MXT A;  1MOK A;  2TPR A;  4NNJ A;  2XVF A;  5FS9 A;  3HYX A;  5J04 A;  1PBF A;  3DEQ A;  5BUK A;  2GMH A;  1FL2 A;  1TE6 A;  1E1K A;  5KVH A;  1GPE A;  3EEZ A;  2PCE A;  2BS3 A;  3PK7 A;  3AB1 A;  3DK8 A;  3R0K A;  3CGB A;  3VCC A;  2OZ8 A;  4YSX A;  3QVR A;  3UTE A;  1ONF A;  3TQP A;  2V5Z A;  1FFV C;  3MUC A;  2FKP A;  3M0O A;  2YWL A;  3UXL A;  2W55 A;  2H88 A;  4Z2U A;  4ROP A;  3A7A A;  1K0J A;  2GSH A;  1B4V A;  3BJS A;  3IC9 A;  2PP3 A;  4F4R A;  4IP5 A;  1OJ9 A;  3IHG A;  4KEM A;  3AEB A;  3N6J A;  3MY9 A;  4ZN0 A;  4ZA0 A;  1S3B A;  1GEU A;  4JDR A;  3T14 A;  2VQB A;  3RHA A;  4HCL A;  2C76 A;  2HZG A;  3R1Z A;  5GSN A;  4TM0 A;  5TR3 A;  3F8D A;  2TMD A;  4HPN A;  1GV4 A;  2ZZB A;  2WU5 A;  1CJ3 A;  4Z17 A;  2BK3 A;  2XFO A;  3URH A;  3D1C A;  1JRO A;  2Q0K A;  1D4C A;  4Z2T A;  4GAP A;  4IA5 A;  1STZ A;  3UGV A;  1LV0 A;  2GGH A;  4J56 A;  4G6H A;  1NU5 A;  3GRT A;  3FPZ A;  1DOE A;  5KWF A;  5JCI A;  2JB1 A;  1GRT A;  3NFU A;  3SN4 A;  2W3R A;  1FEB A;  4H1Z A;  4B68 A;  3BHK A;  4OPG A;  2C7G A;  3S47 A;  2Q7V A;  3NS1 B;  1NG3 A;  3AE7 A;  1JU2 A;  5J7X A;  2ZZ0 A;  2OLA A;  1F8S A;  1L9C A;  3AE6 A;  5KMR A;  3ES7 A;  3O0H A;  1H86 A;  4A5L A;  1FOH A;  2CDU A;  3EAO A;  3F8P A;  4ZCW A;  5FJO A;  2JK6 A;  4NTE A;  3H12 A;  3P3B A;  3EKG A;  1NEN A;  2YG5 A;  5G5H B;  3I6E A;  1TDN A;  4PAA A;  2GAH B;  3CNT A;  3THU A;  3RGT A;  3TCS A;  4HNC A;  1R0M A;  2XH4 A;  1UKV G;  5C3J A;  3UKA A;  3F8R A;  2RAB A;  3V5C A;  4E0V A;  4IVO B;  4JN7 A;  4H4Y A;  3G5Q A;  2R0C A;  1MRA A;  1JPM A;  2APG A;  3ICR A;  4Z24 A;  2XVJ A;  3MQT A;  3DJG X;  4HNL A;  1BZL A;  1VDC A;  3PS9 A;  2WHD A;  3EPT A;  3GY1 A;  4OPU A;  2RGJ A;  3SSZ A;  2QDD A;  1QJD A;  3BI4 A;  2Y6R A;  2RGH A;  3V76 A;  2Q6U A;  1E1N A;  3CNP A;  4H4S A;  2V60 A;  4EM3 A;  4GYP A;  2AR8 A;  5KNL A;  3QN3 A;  4G9K A;  2OO6 A;  1BGN A;  3UJR A;  1Y0P A;  1E1M A;  2XLS A;  4U2L A;  3NVW B;  5EBK A;  1H6V A;  3ZDN A;  3H4K A;  3CNS A;  4OPT A;  4B65 A;  2I5Q A;  1DXL A;  3P4S A;  1X31 B;  2WS3 A;  4MJW A;  3JZU A;  2YG4 A;  2OFJ A;  3RR1 A;  3CGD A;  4U8J A;  3SGL A;  1ZMC A;  3GDN A;  1CBO A;  4X4J A;  2BC0 A;  4IZG A;  2YLW A;  2F5Z A;  3DG6 A;  2HXU A;  2QAE A;  1E1L A;  4UP3 A;  2WOW A;  5IDZ A;  3UJS A;  3HZL A;  1NPX A;  3SBF A;  3FV9 A;  3S5W A;  3KVE A;  2XSX A;  5EB5 A;  4Y4N A;  3T9P A;  5IQ1 A;  1TDO A;  3DFH A;  4M6U A;  5JCM A;  3IF9 A;  3QJ4 A;  4B63 A;  1F6M A;  3SYI A;  3L8K A;  1TZZ A;  5U25 A;  5HHF A;  2GL5 A;  4AP1 A;  4OVI A;  2XLR A;  1FEA A;  5GRT A;  1CL0 A;  3GC2 A;  2YLZ A;  2PU0 A;  3VRA A;  2X8H A;  3NO1 A;  4DN1 A;  3UJF A;  4KWS A;  2V3B A;  5JCL A;  3R25 A;  3C4N A;  3AEF A;  3I3L A;  4A99 A;  3SXI A;  1N60 C;  2V6O A;  4YTM A;  2B7R A;  2XFQ A;  3UJE A;  4K5S A;  1R6W A;  2BXS A;  2R4E A;  4CY6 A;  3U4F A;  3UXK A;  1XPY A;  3CGC A;  1E6E A;  4U8N A;  4B64 A;  2GAG B;  4D03 A;  4TM3 A;  4DNA A;  5CQF A;  5JCN A;  1CF3 A;  3CNJ A;  4FI4 A;  4K8D A;  3ZVH B;  2POD A;  1VQZ A;  3DG3 A;  3ADA B;  3T2K A;  1K0I A;  3UKF A;  1BKH A;  1PBD A;  2GDQ A;  2XFN A;  3V3W A;  1REO A;  5ENL A;  4H19 A;  2NQL A;  4NZH A;  5M10 A;  4J2W A;  2OZT A;  4OPI A;  2O56 A;  2X8C A;  1OJT A;  2ONE A;  4DHG A;  3UOX A;  3CIR A;  4Z2R A;  3UTF A;  3UCL A;  3EF6 A;  3MZN A;  1D7L A;  3NVZ B;  3DGZ A;  3SZW A;  3I4K A;  2XLP A;  3R9U A;  2PGW A;  3NT6 A;  1V97 A;  3KD9 A;  3P4P A;  5FS7 A;  3NG7 X;  4BUR A;  2WBA A;  3AE5 A;  1DNC A;  5BVA A;  2PS2 A;  4KPR A;  2WDV A;  3TW9 A;  4NTD A;  2WOI A;  4EMJ A;  3QFA A;  5FS8 A;  3KU9 A;  1M6I A;  2JAE A;  3AXB A;  3M12 A;  3VRB A;  1N1P A;  2WET A;  1ZOV A;  2R45 A;  2XDO A;  4BK3 A;  2BCP A;  2YR6 A;  4X9M A;  2VQ7 A;  4JNQ A;  2W3S A;  4U8L A;  2YLS A;  3H8A A;  3DIP A;  3LZW A;  1JEH A;  4E6M A;  3QSS A;  4RG4 A; 
#chains in the Genus database with same CATH homology
 3GDP A;  2YAU A;  1YQ3 A;  5EOW A;  1IUV A;  1B4V A;  2R4J A;  4CCQ A;  2C72 A;  2YVJ A;  1TDE A;  1F8R A;  3IC9 A;  1KDG A;  1BF3 A;  4JN9 A;  4BK2 A;  1H84 A;  4CCR A;  1RP0 A;  4H7U A;  3NTD A;  1OJ9 A;  1ZP0 A;  3C4A A;  1GXF A;  2ARD A;  3IHG A;  4PAB A;  3UKP A;  4YTP A;  3AEB A;  4ZN0 A;  4H4U A;  1S3B A;  1S7M A;  5FMH A;  3K7T A;  5CKU A;  4AOS A;  2JBV A;  1GEU A;  4JDR A;  3T14 A;  4DSG A;  3V3N A;  1B5Q A;  3CTY A;  3DH9 A;  2GF3 A;  4H2N A;  1NHQ A;  1ZOY A;  3NKS A;  3AEA A;  1XAN A;  2VQB A;  3RHA A;  3V3O A;  4C5O A;  2C76 A;  4BV6 A;  4Y4L A;  5GSN A;  4TM0 A;  1EL8 A;  3P4Q A;  5TR3 A;  1NAA A;  1RYI A;  3F8D A;  4U8M A;  4H2P A;  4X9N A;  4A6N B;  2TMD A;  4NWZ A;  1GV4 A;  2ZZB A;  2VZ2 A;  2WU5 A;  1PDH A;  1CJ3 A;  1KNR A;  4II2 A;  3UKQ A;  2BK3 A;  1QO8 A;  3B3R A;  1JRY A;  3K7M X;  4Z25 A;  2XFO A;  3URH A;  5FS6 A;  3D1C A;  5IPY A;  2Q0K A;  3L5O A;  4ECH A;  1F3P A;  3ATQ A;  1D4C A;  4LII A;  2DKH A;  2EQ9 A;  4GAP A;  4C77 A;  4IA5 A;  4Z2T A;  2GQW A;  4G73 A;  1W4X A;  1GTH A;  1LV0 A;  2ACZ A;  2YVF A;  1IUU A;  4U8P A;  2GB0 A;  2R0P A;  4O5Q A;  1EBD A;  1MO9 A;  2GVC A;  5KVI A;  4J56 A;  3ICS A;  4CRT A;  4G6H A;  4YSH A;  1N4W A;  2RGO A;  2VVL G;  2C3D A;  3GRT A;  3FPZ A;  4J33 A;  2WEU A;  3NK2 X;  1LPF A;  3LB8 A;  3DK4 A;  4I58 A;  4YWO A;  1DOE A;  3KLJ A;  2E4G A;  4RSL A;  3SM8 A;  1Q9I A;  4B69 A;  5KWF A;  2ZZC A;  3AE1 A;  4GCM A;  3UKH A;  4NTC A;  3LXD A;  5IQ4 A;  2C66 A;  3DJJ A;  3DME A;  2V3A A;  3BHF A;  3NYC A;  5JCI A;  2JB1 A;  2DKI A;  4FK1 A;  1GRT A;  4GDE A;  3ICT A;  2BA9 A;  3UKL A;  2AAQ A;  2FJA A;  3FBS A;  1FEB A;  1LQU A;  4B68 A;  1TRB A;  4YSZ A;  1O5W A;  5HXI A;  3BHK A;  1O94 A;  2C70 A;  4JY3 A;  1PXA A;  2C7G A;  4OPG A;  3OC4 A;  2Q7V A;  1SEZ A;  4FX9 A;  4H4X A;  1AOG A;  1NG3 A;  3AE7 A;  3ABV A;  4BJZ A;  2XLU A;  3H8I A;  5JRB A;  1JU2 A;  5J7X A;  4GAV A;  4A79 A;  4EMI A;  5EB4 A;  2Y6Q A;  2YM1 A;  4H2R A;  2ZZ0 A;  3DJE A;  2I0Z A;  1GRE A;  1PBE A;  1OJC A;  1F8S A;  1L9C A;  3AE6 A;  5KMR A;  2E5V A;  2BK5 A;  1KSS A;  2YG6 A;  4U2T A;  3O0H A;  1H86 A;  1KFY A;  4A5L A;  1FOH A;  1L9E A;  2CDU A;  2B9Y A;  3DGH A;  1E7P A;  3UOV A;  3GMC A;  3EAO A;  1K0L A;  3F8P A;  2B9W A;  1BKW A;  2OA1 A;  3RP6 A;  2JK6 A;  4NTE A;  2CUL A;  4A65 A;  4BJY A;  3SZC A;  4A7A A;  4UDR A;  3NIX A;  3AYJ A;  4NEW A;  1NEN A;  2YG5 A;  2X8G A;  1PS9 A;  4USQ A;  1GRG A;  1ELI A;  1E39 A;  4D04 A;  3DK9 A;  3P4R A;  4HB9 A;  2VRL A;  3EAN A;  1TDN A;  2WPE A;  3BI2 A;  4PAA A;  1XDI A;  2A87 A;  3II4 A;  2GAH B;  1PXB A;  2VVM A;  2JKC A;  3BNU A;  1TYT A;  1TDK A;  2XFU A;  2WQY A;  2EQ8 A;  3C96 A;  3CNT A;  3RED A;  4B67 A;  4C74 A;  2YVG A;  3SQP A;  1CC4 A;  4G74 A;  2YG3 A;  3AE3 A;  2BXR A;  1XHC A;  3AD9 B;  4H4Z A;  4HA6 A;  1UKV G;  4CNK A;  2HQM A;  5C3J A;  1JNR A;  1IUT A;  2FJD A;  3UKA A;  2C65 A;  1GET A;  3F8R A;  2OAM A;  4DSH A;  2RAB A;  1Y56 A;  3VR9 A;  2BRY A;  2OLO A;  4E0V A;  2GR2 A;  4LU6 A;  1S3E A;  4IVO B;  4H4Y A;  3G5Q A;  1L9D A;  4XXG A;  5BUL A;  3AE8 A;  4EQS A;  5U1O A;  2R0C A;  4D03 A;  5DBJ A;  4U8O A;  4EQX A;  2APG A;  2OAL A;  3FIM B;  3ICR A;  2XVJ A;  4Z24 A;  3DJG X;  2J3N A;  1BZL A;  4APN A;  2Z5Y A;  1VDC A;  1S2Y A;  3LZX A;  3ALL A;  1NEK A;  3NTA A;  2H89 A;  3PS9 A;  5JCK A;  2O9Z A;  3LAD A;  2WHD A;  4OCG A;  5ER0 A;  4WX1 A;  4FDC B;  1S2Q A;  2BC1 A;  1PJ6 A;  3EPT A;  3NK1 X;  1LVL A;  4OPU A;  3GWF A;  3CPH G;  2RGJ A;  3HYV A;  1DOB A;  1O95 A;  1FEC A;  1YQZ A;  4AOX A;  4GRT A;  2EQ7 A;  3GYI A;  4BK1 A;  3NLC A;  1QJD A;  1Z6L A;  2X50 A;  2WP6 A;  4K2X A;  5HYM A;  3BI4 A;  3UP4 A;  4J31 A;  2Y6R A;  1HYU A;  4OPC A;  4XWR A;  2RGH A;  5C2T A;  3GRS A;  3ISH A;  1H7X A;  3V76 A;  1IUX A;  1PBC A;  3T0K A;  2Q6U A;  2XVE A;  1E1N A;  3CNP A;  4H4S A;  3H8L A;  4I59 A;  3UTG A;  2V60 A;  3PG6 A;  3CN8 A;  3VQR A;  4EM3 A;  2AR8 A;  5KNL A;  2C4C A;  1Y56 B;  3T2Y A;  4G9K A;  2E1M A;  2BAC A;  1BGN A;  3AEE A;  3SFE A;  4GUV A;  1Q1R A;  2C75 A;  2BCG G;  1Y0P A;  4U8I A;  2GR1 A;  3K7Q X;  4H4R A;  3KPF A;  1E1M A;  2XLS A;  3CMM A;  3QFB A;  2CFY A;  4K22 A;  4U2L A;  1IUS A;  3JSK A;  5EBK A;  2BS2 A;  1H6V A;  2C3C A;  3ZDN A;  3H4K A;  3IWA A;  3BI5 A;  2WPF A;  3CNS A;  1ZMD A;  4OPT A;  2FBW A;  1KN0 A;  1GER A;  4H4V A;  3UOY A;  4B65 A;  5J60 A;  2XYO A;  3KKJ A;  3LOV A;  2YM2 A;  4EIQ A;  1B37 A;  4B66 A;  1DXL A;  1QLB A;  4XWZ A;  4DGK A;  3P4S A;  4H4W A;  1V59 A;  1X31 B;  2WS3 A;  1ZY8 A;  2OLN A;  1NDA A;  4MJW A;  1GRH A;  1GRF A;  1TDF A;  4M52 A;  2JB3 A;  1H2I A;  2YG4 A;  2YR5 A;  4Z26 A;  4B1B A;  1DOD A;  2QA2 A;  4Z44 A;  4TLX A;  1COY A;  3CGD A;  2NPX A;  3AYL A;  4U8J A;  2GR3 A;  3SGL A;  1ZMC A;  3DJD A;  2CVJ A;  3GDN A;  2VRM A;  4GDP A;  4RG3 A;  1CBO A;  4X4J A;  2BC0 A;  1DJN A;  4NEV A;  2YLW A;  2F5Z A;  4YXD A;  3NN6 X;  4TM4 A;  2QAE A;  1OJA A;  2IID A;  3AD8 B;  1E1L A;  1GAL A;  2WOW A;  3AD7 B;  1H83 A;  2B7S A;  3I6D A;  4UP3 A;  3UP5 A;  1JRX A;  4J36 A;  4YT0 A;  3NHO X;  1EL7 A;  2PYX A;  5LV9 A;  3HZL A;  1D5T A;  2B76 A;  3S61 A;  4IVM B;  4YSY A;  5M0Z A;  3WE0 A;  2YLT A;  1NPX A;  2IVE A;  2YG7 A;  1P2H A;  3NYF A;  2W0H A;  2GV8 A;  4KX6 A;  3S5W A;  2FJB A;  3KVE A;  3CGE A;  1RSG A;  2PHH A;  5EB5 A;  3BNM A;  3CPI G;  4Y4N A;  1B8S A;  1TDO A;  5IQ1 A;  1ZKQ A;  4H4T A;  2WES A;  1YY5 A;  4EQW A;  5JCM A;  3IF9 A;  2GR0 A;  3P9U A;  3K30 A;  3QJ4 A;  4B63 A;  1F6M A;  3SYI A;  3L8K A;  3AE4 A;  1VQW A;  1GRB A;  5U25 A;  3NNE A;  5U63 A;  1DJQ A;  4J34 A;  5HHF A;  4AP1 A;  2EQ6 A;  3OZ2 A;  2VVL A;  2XLR A;  4FK1 C;  1FEA A;  2NVK X;  4GR1 A;  4OVI A;  5GRT A;  1ZK7 A;  2BRA A;  1CL0 A;  3GD3 A;  4H4Q A;  3AE9 A;  2YLZ A;  3VRA A;  4C3Y A;  2X8H A;  1JNZ A;  2B9X A;  3CPJ G;  4J57 A;  3LJP A;  3P1W A;  4JQ9 A;  1D4E A;  3UKK A;  1GT8 A;  5KXJ A;  3B6D A;  2R9Z A;  1VG0 A;  2V3B A;  1D7Y A;  3T31 A;  3NH3 X;  2GH5 A;  5JCL A;  3C4N A;  3VRD B;  3AEF A;  3I3L A;  1ZDL A;  4A99 A;  3KA7 A;  4K7Z A;  2WOV A;  1CC6 A;  3KPK A;  3SFD A;  5KRQ A;  3NK0 X;  3SXI A;  4OPD A;  2V6O A;  4YTM A;  5L46 A;  3NRN A;  1OJD A;  2GMJ A;  1N4U A;  2B7R A;  2XFQ A;  3M13 A;  4II3 A;  4K5S A;  2BXS A;  4U2S A;  1CHU A;  2R4E A;  3GD4 A;  3G5R A;  2GEW A;  3DA1 A;  1H7W A;  1KSU A;  2X99 A;  3ZYX A;  2ZBW A;  2BYB A;  2C64 A;  4CY6 A;  1VRQ B;  1VG9 A;  2XVI A;  4YKF A;  4CY8 A;  5KOW A;  4AT0 A;  3AEG A;  3ALJ A;  3SY4 A;  3CGC A;  5BRT A;  2YLR A;  2BS4 A;  3UTH A;  1E6E A;  4N9X A;  4JNA A;  4U8N A;  4U8K A;  4UDP A;  3SX6 A;  4B64 A;  2GAG B;  1NHR A;  1CJ4 A;  3AE2 A;  1P2E A;  1PN0 A;  2WU2 A;  4DNA A;  4TM3 A;  1KF6 A;  2GQF A;  1YQ4 A;  5CQF A;  4K5R A;  3GWD A;  1FCD A;  4YTN A;  5JCN A;  2QA1 A;  4IV9 A;  4EMW A;  1CF3 A;  2WDR A;  1LQT A;  1EL5 A;  2XCG A;  3AEC A;  3CNJ A;  1NHS A;  4JY2 A;  2VOU A;  4K8D A;  1M64 A;  3NGC X;  1PJ5 A;  4EM4 A;  3SZ0 A;  1EL9 A;  2UZZ A;  2WP5 A;  3ADA B;  3QVP A;  5KMQ A;  1K0I A;  3T2K A;  3UKF A;  1F8W A;  4G6G A;  3VR8 A;  1PBD A;  1PXC A;  1H81 A;  2WPC A;  4UDQ A;  2XFN A;  3G5S A;  3QSE A;  1CC2 A;  3GMB A;  1REO A;  3IHM A;  2BK4 A;  2JB2 A;  4USR A;  4NZH A;  4Y4M A;  1PHH A;  3GYJ A;  4ADW A;  1BGJ A;  3GSI A;  4ZCC A;  1L0V A;  3RP8 A;  5M10 A;  4J2W A;  1PJ7 A;  1YKJ A;  3ALM A;  4OPI A;  2X8C A;  1OJT A;  3Q6J A;  1CJ2 A;  3SZF A;  3RP7 A;  4EIP A;  3UOX A;  3CIR A;  3ITJ A;  1GES A;  2Q0L A;  1GSN A;  4Z2R A;  4TLZ A;  1CJC A;  1D4D A;  2C73 A;  1LTX R;  4P9S A;  3UCL A;  3EF6 A;  3UTF A;  4CNJ A;  3ATR A;  1D7L A;  1NG4 A;  3DGZ A;  3L1R A;  2GRT A;  4C3X A;  5KOX A;  3SZW A;  1LJ1 A;  4Z43 A;  5HY5 A;  2XLP A;  4TM1 A;  3R9U A;  1Q1W A;  4ZCD A;  4H4P A;  1JRZ A;  4REK A;  3NT6 A;  3E1T A;  1NHP A;  1KNP A;  2FJE A;  2R46 A;  2X3N A;  1N4V A;  5KMS A;  3KD9 A;  3NYE A;  3D9X A;  4LA1 A;  1GOS A;  3FMW A;  5FS7 A;  3P4P A;  1MXT A;  1MOK A;  4BUR A;  3NG7 X;  1ZX9 A;  2YLX A;  2TPR A;  2YR4 A;  4NNJ A;  4H50 A;  2XVF A;  1BWC A;  4A9W A;  2WBA A;  3AWI A;  2A8X A;  5FS9 A;  2R0G A;  3HYX A;  1PBF A;  5BUK A;  3AE5 A;  1DNC A;  3Q9T A;  4CBQ A;  2XVH A;  3AYI A;  4WCT A;  3RNM A;  2YQU A;  3FG2 P;  5BVA A;  3QSM A;  4KPR A;  1TYP A;  1JOA A;  2WDV A;  1XPQ A;  4AP3 A;  4YKG A;  1DOC A;  1FL2 A;  2GMH A;  3PVC A;  1E1K A;  5KVH A;  4NTD A;  2WOI A;  2QCU A;  2WP9 A;  4EMJ A;  3QFA A;  1GPE A;  4EQR A;  5FS8 A;  2XFP A;  2BS3 A;  3D8X A;  3KU9 A;  3AED A;  3AB1 A;  3DK8 A;  1M6I A;  2C67 A;  4IA6 A;  4H2Q A;  3GYX A;  3T2Z A;  2JAE A;  1GND A;  3AXB A;  3M12 A;  3VRB A;  3CGB A;  1N1P A;  4AT2 A;  2WET A;  1ZOV A;  4OPL A;  1GTE A;  2R45 A;  2XDO A;  1IJH A;  4YSX A;  3QVR A;  4BK3 A;  3UTE A;  2BCP A;  2YR6 A;  3T37 A;  1ONF A;  2BAB A;  4X9M A;  2VQ7 A;  4JNQ A;  2WDQ A;  2AQJ A;  4U8L A;  2V5Z A;  1GRA A;  3CND A;  2Z5X A;  1H82 A;  3PO7 A;  3HYW A;  2YLS A;  4O5U A;  1IUW A;  2XLT A;  3COX A;  3LZW A;  1PBB A;  3UOZ A;  5KMP A;  2V61 A;  3M0O A;  2YWL A;  4ICY A;  1JEH A;  2H88 A;  4GF7 A;  4Z2U A;  3QSS A;  2A89 A;  1K4Q A;  3NN0 X;  4A6N A;  1K0J A;  4RG4 A;  2IVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...