3JZUA

Crystal structure of dipeptide epimerase from enterococcus faecalis v583 complexed with mg and dipeptide l-leu-l-tyr
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
353
structure length
353
Chain Sequence
MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGEGGPGIFITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKISAFAPAAKAAIDIACYDLMGQKAQLPLYQLLGGYDNQVITDITLGIDEPNVMAQKAVEKVKLGFDTLKIKVGTGIEADIARVKAIREAVGFDIKLRLDANQAWTPKDAVKAIQALADYQIELVEQPVKRRDLEGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAEETTIGITAAAHLAAAQKNITRADLDATFGLETAPVTGGVSLEAKPLLELGEAAGLGIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Dipeptide Epimerase
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Enterococcus faecalis v583
total genus 124
structure length 353
sequence length 353
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3jzuA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3jzuA01
3TCSA 3OZYA 4E8GA 2CHRA 4G7FA 4IZGA 2PTWA 4DXKA 3JVAA 4ROPA 3R10A 3EKGA 1W6TA 3ZVIA 2PS2A 4FP1A 4E4FA 1EBGA 4HCDA 4HCHA 2PODA 1ONEA 2PGWA 2FKPA 1EC9A 3FVDA 4G8TA 3ZVHB 3GD6A 4H2HA 3MSYA 4J3ZA 5BOEA 3N4EA 4KEMA 1EBHA 3SJNA 3UJEA 3QN3A 4IL2A 3SN1A 4Z17A 2PP1A 1JPDX 3T8QA 3D47A 1BQGA 2AL2A 3UJFA 2P88A 1FHVA 3H12A 3SSZA 3UJ2A 4K2SA 2QJNA 4KT2A 3R0KA 4MMWA 1MDRA 2XH7A 3T9PA 2OZ8A 3NZGA 1F9CA 3RO6A 4ENLA 3THUA 3S5SA 3U4FA 4E6MA 3UXKA 3DG3A 2PCEA 1P48A 7ENLA 3FYYA 4MGGA 4K8GA 2QDDA 3TOYA 3OP2A 4K1WA 3ZVHA 2GGGA 3KUMA 1EC8A 2OKTA 1TKKA 2OVLA 4GYPA 3OTRA 4E4UA 3P0WA 3SBFA 3VCNA 1MDLA 2OPJA 3PWIA 1JCTA 3VFCA 1KCZA 3MWCA 3NFUA 4KWSA 3TWBA 2OZTA 3DERA 3STPA 2HXUA 4ZCWA 3VDGA 4GMEA 2GGEA 2QQ6A 3QPEA 3MUCA 2DW6A 3IJQA 2GGHA 2OQHA 1E9IA 3EEZA 2RDXA 3DG6A 3UCCA 2OX4A 2PP3A 1NU5A 1PDZA 2AL1A 3FXGA 3B97A 3CT2A 3RITA 3HPFA 1FHUA 3TJ4A 2XH0A 3RRAA 3UGVA 3R1ZA 1YEYA 4M6UA 3SN4A 3S47A 1BKHA 4H1ZA 1RVKA 2P0IA 1ECQA 4A6GA 4DYEA 3QKEA 2XH2A 1EC7A 4JHMA 5FJTA 3NXLA 2OZ3A 4JN8A 5ENLA 2OFJA 2OO6A 3P93A 2HNEA 4YWSA 4X2PA 3RCYA 1WUFA 2PGEA 4GISA 2P8BA 3PWGA 3RGTA 3D46A 1OEPA 1SJCA 3UJRA 3BOXA 1XS2A 2GSHA 2POZA 2GL5A 3VA8A 3SQSA 3H7VA 2O56A 4GGBA 2GGJA 3IK4A 1JPMA 4HCLA 2OLAA 2PA6A 4H83A 3CAWA 2PPGA 5FJOA 3UCDA 3Q4DA 2P3ZA 4FI4A 4HPNA 2I5QA 2PU0A 4GGHA 3T6CA 3K1GA 3SN0A 4IT1A 3H70A 2OQYA 3OZMA 5EU9A 3PFRA 1P43A 1MRAA 1SJAA 3N6HA 3DDMA 3BSMA 3TW9A 2MNRA 3NO1A 1PDYA 3OW1A 4E5TA 5FJPA 2PSNA 1DTNA 3I4KA 3QTPA 5FJUA 3DFHA 1MNSA 3R0UA 3ZLGA 3VCCA 4IL0A 2QGYA 2XGZA 4GFIA 4JN7A 3FCPA 1ELSA 2PU1A 3R11A 4IHCA 3FJ4A 4MKSA 3MY9A 3R25A 2HXTA 1KKOA 4H19A 6ENLA 4HYRA 1IYXA 1KKRA 2OG9A 2NQLA 5BOFA 4A3RA 5FJRA 3QLDA 3JZUA 2QJMA 4F4RA 4IP5A 3RR1A 3TJIA 4HNCA 3U9IA 4Z1YA 3IJLA 1WUEA 3CK5A 3N4FA 2QJJA 3ENLA 4EWJA 3V5CA 3UXLA 2PTZA 2P8CA 3FV9A 4HNLA 2QVHA 2ZADA 4J1OA 1XPYA 4IP4A 3Q45A 3DEQA 2PMQA 3ZLHA 4M0XA 3IJIA 4DHGA 1NELA 2ONEA 3JW7A 2MUCA 1L8PA 5IDZA 3PK7A 3MQTA 1JDFA 2PTYA 3TQPA 3DFYA 3DESA 3T4WA 3GC2A 1MUCA 2AKZA 1TZZA 3ES7A 3P3BA 3DIPA 2XSXA 3TTEA 4A35A 3OPSA 3TWAA 3N6JA 2GGIA 2HZGA 3MZNA 2PP0A 4KPLA 4DX3A 1R6WA 1SJDA 3ES8A 4DN1A 2GDQA 3DG7A 4GIRA 2DW7A 3V4BA 3CYJA 1R0MA 3ZLFA 1SJBA 4HN8A 2FYMA 4GYPC 3BJSA 2PTXA 1KD0A 2XH4A 3I6EA 3V5FA 3I6TA 3UJSA 3DGBA 2ZC8A 5J04A 3H8AA 1TE6A 3CXOA 3V3WA 3GO2A 2QDEA 3MKCA 4DWDA 4ZA0A 2AL2B 2AKMA 3GY1A 3VC6A 3CB3A 3VC5A
chains in the Genus database with same CATH superfamily
1S5VA 4E0CA 4CD8A 4W87A 1WA3A 2YOCA 3TTQA 1XBXA 3BOFA 2FVKA 2PLJA 2YKKA 4RNJA 3FK4A 4LANA 3VD4A 1K8ZA 1TWDA 1MXSA 2QIWA 3N3MA 4XD4A 4MYAA 7CGTA 5C8BB 2XFRA 1GVSA 1UYQA 1Y65A 1RBAA 1UW9A 3MSYA 1B4KA 1XIFA 3ARVA 4DZIA 3FX4A 5H1WA 4KRTA 3LCIA 4JL2A 3PR2A 1BFNA 3OC4A 2CZDA 3HW2A 1XQKA 1N61C 1IQ8A 4OBTA 5HATA 3UPBA 1X1OA 4LY8A 5H2ZA 3STGA 3GXNA 2HJPA 3H2CA 1DIKA 5DN1A 1WZMA 2RDWA 1ZQ5A 1Q6LA 4Z2LA 4AFYA 3R0KA 4GC3A 5C9WA 3W53A 3MCOA 3H23A 1N82A 1Z7AA 4ENLA 3E5BA 1RD5A 3S5SA 3WELA 1NH6A 4AD4A 4LB4A 1BVNP 2LLEA 3GYCA 4HU4A 3DFOA 1ZBWA 4CU8A 3N73A 3BG9A 3I10A 3O9NA 1CXIA 3W27A 4JEJA 3IGHX 1OGGA 1LUCB 4AHQA 1WXJA 3DK9A 3VO0A 1CB7B 4ZSUA 3VOFA 4YMZA 1B1YA 4UTKA 3GIYA 1TB3A 3BW2A 5F2MA 1PVNA 3AXIA 2RABA 3RM8A 2BY0A 3VZXA 4ONVA 1DPMA 2PDMA 3RJXA 2VT0A 4RNHA 4PB3A 2X0SA 3HA1A 3CUJA 1ZY8A 4LAZA 3P82A 1VP5A 4ZR8A 1T3QC 3URNA 1UH4A 2DIEA 3TMLA 3M0KA 4O4WA 3LD5A 3T40A 4OBSA 1XIBA 1LBMA 2L5HA 3TMQA 3UWUA 4QAIA 5IBXA 4TTGA 3MI2A 5EPDA 4DIAA 3IUIA 9XIMA 1PZ2A 5DBUA 3WQFA 5GJPA 4Y8EA 4O1BA 4MWAE 3RITA 4HP5A 3GBEA 3TJ4A 2XH0A 3MWAA 3RRAA 1ME8A 2NZLA 4WDUA 2WKLA 4NY2A 3STEA 4TV5A 4DYEA 2C7FA 4AEFA 3WDQA 2V3AA 1CGYA 3FW6A 3R12A 3NXLA 4A2SA 4JN8A 3B8VA 5HDRA 5ENLA 1PBGA 2Y70A 3N34A 4GKTA 1OYCA 1H4PA 4X2PA 3CUXA 3W0KA 3RCYA 4QAWA 4Q4RA 5I79A 7TAAA 1A5SA 3CLWA 1ML1A 3NTYA 1VFSA 1NHSA 1RPXA 1F4HA 3PSWA 3BSHA 3OVGA 3UJRA 5E70A 5LA0A 2WM0A 4W7UA 1XHGA 2O7SA 1KWGA 1YDNA 3L2LA 4IUGA 4S3BA 3TFXA 1NFPA 1VKFA 2YCJA 4BZYA 3A22A 3RHGA 4MNMA 1E15A 5A6LA 2ZYFA 2OLAA 3KCLA 2XM1A 2O55A 3K1DA 2PZ0A 3IIXA 1RJRA 2Q8LA 3LB0A 1JXJA 2IKJA 3VM5A 4EQWA 3LCWA 4M8UA 3ARRA 4W8LA 5I0DA 3VINA 1VQTA 3KLKA 4XVDA 4C1NA 3SGZA 1QPNA 3FIGA 3DKLA 2J78A 1KGUA 1A4LA 4AZ5A 5D9MA 4I6VA 1FWNA 3BJFA 1GOMA 3BSMA 4FLSA 1P1XA 2W63A 3M07A 2NVDA 3I6RA 2VEPA 5TD4A 4IMCA 3NZRA 4AEEA 4TO8A 4DB7A 5HR7A 1V6XA 3EAUA 3CWHA 1JNDA 4PUWA 3ZFHA 4K8DA 1ZJBA 3L68A 2WQDA 2J47A 2QGYA 4E2DA 2XGZA 2BBFA 3BG3A 4Z1CA 4A2RA 4C6FA 4PN2A 2XN1A 2JALA 4UQCA 3UZWA 3WEZA 1GRFA 1OCJA 1J8VA 4LA1A 5HNNA 4Z1YA 2WKJA 4Z0JA 3OU8A 2INEA 4W88A 2JKAA 1OYAA 2QCDB 3ARPA 3UXLA 2PTZA 3WDPP 3HGSA 1F6KA 3M16A 2DFAA 1WO2A 4QEHA 4ADWA 3L4VA 3LG3A 2DZSA 2V0TA 2QIIA 3EA2A 4ADTA 1BXNA 2PF8A 3QOKA 3M0ZA 1ZP3A 3SY1A 5FCZA 4M52A 1TV2A 3LCLA 4RPPA 3FAWA 1ALDA 4XZWA 5AHIA 1L6GA 4AD0A 1ZAIA 3OZPA 5BRQA 4PUNA 5IDZA 5T9CE 2DU2A 1EWDA 2YW4A 1V6UA 1X7IA 1JCNA 2HDJA 4M7SA 1EDTA 2C3ZA 4AZ7A 1CIUA 1J18A 1V77A 4JIQA 1SO4A 1MW1A 3OPSA 3M6DA 1TUXA 2CYGA 2PD9A 3INPA 3NQFA 1FVPA 1DJHA 4B5WA 5DELA 1RVGA 5C9XA 2R1PA 1GVYA 4QJ1A 3B40A 2POTA 2BXZA 3AMGA 2ATSA 4N4QA 5I07A 4N42A 4AZHA 3EX2A 3N4AA 3KW3A 3QV9A 1DJGA 1NHQA 4LUSB 1I60A 3H53A 1ISVA 5K9CA 4D6DA 4Y2WA 4IPNB 3P67A 1KQYA 4EM4A 1CLXA 1BWLA 1MFVA 2ZZ3A 1WAUA 2J8TA 4DM1A 3P7YA 4W7VA 3RAOA 1OIMA 2CLFA 2WWCA 3M6YA 3ABXA 1BKSA 2PF0A 4UC5A 2Q01A 4MDPA 1OQFA 3AMZA 2EG7A 2IQDA 1WX0A 5HXMA 4QXIA 1C92A 2FTYA 4DWSA 3RLGA 3NURA 4HCDA 5FEZA 4KPRA 1JRCA 3E74A 2P50A 1PAMA 4CEXC 1FFUC 4H9YA 1PHQA 3GD4A 1MZRA 1SW7A 3OIXA 5E9AA 1DWGM 1E3XA 3DJGX 1KGXA 1RPKA 4OV4A 1TRDA 2GRTA 4JHOA 3W71A 3W7CA 1JYVA 2O0TA 1TQJA 4H9XA 5AC4A 4D6IA 4TVCA 1QJWA 3ZS4A 3THUA 2GJRA 4JTUA 1H2IA 1HN1A 4ZTYA 1V97A 4LC8A 4XD5A 1Q8JA 5C7VA 3CWNA 3VIIA 4W85A 5AC8A 1T96A 4H4UA 1HKJA 2G3FA 1GEHA 3RLHA 4M24A 2XFFA 1UKSA 4L65A 3EXSA 5D8WA 4LVFA 1JEHA 3VCNA 3T81A 1KM3A 2D0HA 1BYAA 4J56A 2FB2A 1WBJA 1KCZA 1TV8A 2Q02A 4L6OA 1JUKA 4N2YA 3STPA 1YNPA 3NQBA 4CQ8A 4JKMA 3DHPA 1XICA 2PC8A 3N14A 4JQ4A 4IH3A 2QVNA 4APNA 1XGEA 1H41A 5HA7A 4GMEA 2F2HA 2EKCA 4JNMA 3XINA 3CWOX 2ZTKA 1ZP4A 1BD0A 5FACA 1QNVA 4CD7A 1VYPX 2WYSA 3AYRA 4ILSA 2OQHA 1O6IA 5JCNA 3M5VA 4Y90A 3WLKX 4AVNA 1TR1A 3RO8A 3WENA 3MS8A 2HS8A 3G2GA 5FKYA 4AY1A 4W5ZA 4BQ3A 4LV9A 3MV01 3EKLA 4AZBA 5HUPA 2VOMA 3TYBA 5G5GB 1WOAA 3HTWA 1XIJA 4K7YA 1EJTC 4YYFA 1RD6A 2WNZA 1GEUA 1C9DA 1MOKA 4FPSA 3ZJ6A 2QKFA 4GIAA 4JQAA 2ZVRA 2INZA 2X41A 3ZIZA 4BY3A 1K8YA 3PPHA 1OFAA 4UTHA 1JCMP 3EUB3 4Y9OA 3BANA 2XIQA 3OLIA 5HMFA 1TPFA 3BAIA 4J3TA 3RDKA 2X8GA 1TPUA 3LQGA 3UVIA 3PULA 2AQVA 3N17A 1OEPA 3AN1A 3ZYZA 1IXOA 4C6KA 3MT1A 2NUYA 1E5JA 1G4SA 2REQB 4GRSA 1XH2A 2ZIDA 3UP8A 4C6PA 3APYA 3GDMA 3CEPA 4S1FA 5KZMA 4GVGA 2HV5A 4ECLA 3A23A 2WCGA 4H83A 4JDBA 3VIPA 2ZTJA 3B9EA 2YA2A 4XZLX 4E38A 1ZALA 4QDWA 2BP1A 1SW3A 3VKCA 5CPOA 3GNXA 5G4EA 4U5KA 4HMDA 2FDSA 3EXTA 3HGRA 4HD5A 1VS1A 4RL3A 4BK9A 3WN6A 1OWQA 3L4ZA 4OUEA 3W7JA 3S1WA 4I8DA 5JBEA 2VEIA 3F1QA 3ZR6A 3W6YA 4LS2A 3PVFA 2GQAA 2OLSA 2MNRA 3QQWA 3VGDA 1LQ0A 1A80A 3HQ1A 5AECA 4LRTA 2FGZA 5FJUA 4GI9A 3FA5A 4NX5A 4ERAA 2C1IA 4OV9A 3NL5A 4C6EA 3WZ0E 4Z08A 2PU1A 3A3XA 2Y5JA 4MKSA 4CQAA 1OY0A 3USBA 5CCZA 4JDRA 3ZM8A 3FEQA 1ZZMA 3QLDA 3N12A 4QX4A 2Z1XA 1H51A 4TVYA 5EA9A 3FKKA 4RZ4A 1TE1A 3V5CA 4UFKA 1W17A 3FV9A 1XLMA 1EQPA 3MC5A 3PBUA 1BXBA 2ZUWA 2JKPA 3HQOA 4J3XA 1EX1A 4LALA 2R1LA 3L0GA 2JGQA 4MZYA 1PWMA 1A5UA 3C2RA 3T7VA 1TJPA 5HMSA 2ZZCA 1NDVA 5AZ0A 2EF9A 1E4MM 4I7UA 4A8RA 2I57A 4TX9A 1I2RA 2JBMA 3TROA 3S5OA 2NWRA 3TYCA 1MUCA 1UUMA 2PC4A 3P3BA 3LHZA 3C86A 3UG5A 3M0XA 5LIXX 1JZ8A 1EYWA 3V35A 4LVBA 4BF5A 3I68A 2FTPA 1SJDA 3VABA 1RCOB 2XWEA 4GZIA 4KEUA 3ARXA 3CIWA 1P7TB 3C2YA 1QXLA 2X2GA 3TAOA 3BJSA 3IEBA 3PF3A 1E5NA 2GJXB 2INFA 2O9PA 2DZTA 4S39A 1U1HA 4B92A 1MNZA 4MADA 2CESA 1M3UA 3L5LA 1OX4A 5I3JA 1EHNA 1UUQA 1ODUA 4O0ZA 2E6DA 3AISA 3HO8A 3HG5A 3EWUA 4CNUA 4E2BA 4O57A 2PRHA 5D9PA 3L4YA 4CCEA 4F0SA 4JQ2A 3EWWA 1R3SA 4H4RA 2C18A 4G7FA 4RZBA 4XZNX 3O63A 1ONFA 5HR6A 1K8CA 3AHXA 3ZVIA 4TR9A 4JFTA 4INFA 2ZXBA 1JG9A 4HA4A 2PODA 2PGWA 1XIGA 1NF7A 5K3VA 1XKYA 1RK6A 2JEPA 3LMYA 1NQ6A 1R2TA 1PB0A 2YLAA 4NVTA 4PCSA 3C0QA 5AVHA 1JZ5A 1NDAA 3ONBA 1HG3A 4FAMA 4IL2A 4XUGA 2FZDA 3B8IA 4RDYA 4NNBA 1EXPA 4RW3A 1JOAA 2BFGA 5AHLA 4AU0A 1TWIA 4PMJA 1JVNA 4O50A 1SUXA 2G8ZA 3YPIA 1D3CA 3WK2A 4O17A 1HGYA 1IV8A 2WMHA 4AWUA 3VYLA 1G67A 3MUIA 3C5QA 4ZB0A 4AWEA 1X8FA 5FEWA 2WJZA 1SO6A 3DHDA 1C8QA 1E6NA 1W3LA 3VOHA 4GBDA 4GBUA 1S5TA 2QCLA 3RM9A 1C7SA 4AZCA 3LHVA 2OSYA 1V79A 4GQQA 2OPJA 2E6FA 1XLBA 4CD5A 1BXCA 3CUGA 1E56A 3MDUA 4FNQA 2YVJA 4AF0B 3DERA 1E72M 4F0KA 3SUWA 3JUGA 3FDGA 1X7FA 1NF0A 2HXUA 3PG9A 3ONCA 1J5TA 5D2WA 1Q2SA 5J8LA 3ITVA 4HTBA 2X1IA 4URIA 1VIWA 4OQVA 1DJIA 1BHGA 2CCRA 4YWIA 3E0FA 4C6IA 1R7OA 1UWTA 2Y88A 3WBXA 4ZXOA 3U5UA 1DJYA 1G9HA 2YCKX 4WEVX 3GIPA 1K9EA 3OO2A 4FIRA 3THAA 4GG9A 3DN5A 3STCA 2E67A 3GG7A 1B3WA 1FHDA 1MUMA 3FGCA 1TPVA 3VD3A 3MUXA 4NAFB 2CXEA 4MAZA 2QF7A 3WLIA 4G5DA 2OXNA 4W4QA 3VNKA 4MAVA 1QNOA 1YRRA 4AZCB 3PPFA 1XINA 1UD6A 4NAEB 3W9ZA 1EYEA 2V8ZA 4TVUA 7REQA 1WKDA 4UQDA 1RJQA 4AZGA 1BVWA 3SCQA 3QW3A 2HWGA 4R5EA 4FNSA 2QUVA 4NJGA 3GVVA 1RQEA 1NSJA 1IXNA 3AJXA 1QNQA 3H2MA 1PSCA 4LEFA 3UWVA 3TCEA 2OWXA 2DVUA 2RGMA 4GLEA 1HUVA 5AHFA 4H2CA 5I3IA 3GVGA 2WM1A 3Q58A 5F2GA 3EGJA 4MWAA 2NV2A 1WDDA 4O8AA 1IEIA 3WNOA 1FUYA 1W54A 1F3PA 1QNPA 2ZXDA 4G1KA 3SQSA 1AQMA 5AOUA 4LYPA 4US5A 1TWZA 3CIVA 3BAWA 2O56A 1RR2A 3FHAA 1HKKA 1XC4A 4AVFA 1ICQA 2CLPA 2EEXA 4JL1A 5XIAA 1QASA 3BO9A 4EXQA 2WSYA 4Z42C 2GR3A 3VGEA 3HGJA 2Y7DA 4UTLA 4DWSD 4MG4A 1US3A 3M47A 4H00A 1TPH1 3CV7A 4HZ8A 3D3FA 4HHPA 1W3NA 1XRFA 3BZJA 1ZJHA 2C0AA 4CNPA 4K8HA 3DYOA 2YQUA 1JZ6A 1BTCA 1VBGA 3C61A 3FJNA 4D72A 5JIWA 3TTYA 3DH7A 3UWEA 5KVIA 3MVTA 1C9WA 1F2JA 2CW6A 4LCSA 4IL0A 1EJ7L 3UG3A 3A13A 2QCGA 3NVWB 1GKRA 4N6FA 1OG6A 2CLMA 2CFYA 3E38A 4P2VA 3NVDA 4GHRA 1UOKA 2VX5A 3GYEA 2WVSA 3M64A 3ZOAA 1IYXA 2NQLA 4OHQA 1OF8A 3GUGA 1UASA 1XCFA 2V6AA 1K4QA 3CS2A 4AVOA 3G18A 3PG8A 4KEZA 1LRTA 1P5BA 2VMFA 1LROA 6XIMA 4IQLA 2ZX9A 5LA1A 3BARA 4R7JA 4JTDA 1N8FA 1ZL1A 2PE4A 3N11A 3GSMA 4O12A 1VQZA 2DUZA 2EQ8A 2C6QA 2XGBA 4I9AA 3MUY1 3CXBA 4KS0A 4ROQA 5CBIA 2VWTA 4L9YA 4EKJA 2A79A 1Z32X 5FJJA 1OJXA 1BGAA 1S38A 4DJEC 1XDIA 3KXQA 2Y63A 1U1UA 3LI1A 4ML4A 8XIAA 5EBAA 1C90A 3NQ2A 1GVIA 5CPMA 2ONEA 2QNEA 1GW1A 1X8CA 2AAAA 2X0YA 4PUEA 3PG6A 4MJ2A 1W5PA 3LSBA 2Y5EA 1OHLA 4I90A 3TTEA 4B9ZA 3DJJA 1PIFA 1AH0A 5KINA 4R27A 3TNOA 3M7WA 3PZIA 3PUDA 4ACYA 4Q6XA 2W0HA 1MQPA 4FA3A 4LAUA 4S3JA 5CJNA 4H4PA 3CTLA 1STZA 5EYWA 2CPUA 2BZNA 3AXMA 1G5AA 3T0BA 3I6TA 5CSUA 4DBWA 3NSXA 2YDQA 3H8AA 4QLJA 3CXOA 3W7OA 4YTQA 3RX3A 5I3FA 2QDEA 2VRKA 4DWDA 2WBKA 2AKMA 3ITGA 3IJ7A 4RJEA 3VC5A 3W7HA 3RK8A 3WJYA 2CIPA 1A0EA 3SUVA 4H4WA 4MDOA 4DNMA 4GVHA 3AMKA 2PWGA 3HURA 4PMDA 4IMDA 4GJIA 3K4DA 5CPNA 5F2LA 2Y8KA 5KMYA 1W1YA 3EX4A 3DI1A 5IOBA 4DJDA 3ZVHB 4NZJA 4B2DA 4S2BA 1BTMA 3B0PA 2RH9A 2H8ZA 1EJRC 2X8HA 3QN3A 3U2OA 4NUWA 3IGXA 3LHWA 4EF8A 2C3CA 1JPDX 1P6WA 2NVAA 1NOUA 1GYLA 2QUMA 3RX2A 1FA2A 5JCLA 4XKYB 3KL5A 5DBTA 4MPKA 3NIYA 2O7QA 2DSKA 3OJGA 4UQAA 3WDHA 4B9YA 3WDRA 2PRMA 1NVMA 3W6MA 2XH7A 2EKGA 2OZ8A 2NLIA 5FS8A 1I9CB 3WF3A 3LB8A 4NNCA 3N04A 3P80A 3KDOA 1T0OA 4PH6A 4O16A 3UA3A 1GZ1A 1JD9A 2YDAA 3UZJA 3KBJA 5ER0A 4H6EA 4S3AA 2KX9A 1CLVA 2QDDA 5FF3A 1VGAA 3BLOA 2GGGA 3LHYA 2OVLA 4GYPA 2OEKA 3B9NA 5U7SA 1SFLA 2CWNA 5DY2A 4RXGA 4DXVA 3IVUA 4A3YA 2JK6A 3RCMA 3L4WA 1WQ5A 4PSRA 1P0NA 3GTNA 4H41A 5J5DA 3CHFA 1OINA 5FEPA 3S2NA 3OA3A 4B5XA 2D2GA 1AH4A 2ZRYA 2PWUA 5D05A 3S2JA 3AXKA 1J0KA 1EJWC 4GFSA 3KBWA 3QPEA 2DZBA 1I0DA 4IFRA 1EGMA 5F4SA 3B9AA 1FXQA 2NXGA 4PR4A 2NV9A 3W4RA 5KZDA 1QHPA 1SU5A 1OM0A 1LCOA 1AQ0A 5LIYX 3SRFA 1YDOA 4QQ3A 1J2WA 1KXVA 1SMDA 2ZZ5A 5HJLA 3CT2A 1UROA 3OYXA 3QHOA 2DPEA 3O6DA 1KTBA 3EMQA 2X7VA 1ZTVA 1CGWA 1UHVA 2ZWYA 2VP8A 2CBVA 1Z3NA 4DJFA 3DHUA 2CBIA 5JCKA 2WSRA 4AMCA 4CNOA 3GE7A 3APTA 1FTXA 2GFTA 1RY0A 1DIOA 4LCQA 4RW5A 3GHRA 1Q1WA 1KM1A 1FCBA 1KNWA 3EX6A 3W88A 1KFLA 4AW7A 5AFDA 4IF2A 5HINA 3TYDA 3EOUA 4ASTA 4Q7BA 1UPPA 1XWYA 3NO3A 2NXHA 1WB0A 2W79A 1W8GA 5HUOA 1LBLA 1TJ2A 1RAKA 3PTKA 2ZXAA 1QT1A 4UTWC 4L5ZA 1JNEA 2O9RA 2OMAA 3S2MA 2C79A 3UR2A 1Y8BA 3GZAA 4KIRA 2PDBA 2YPIA 2VZVA 3ABSA 4Z2JA 1VJZA 1SZNA 1GRBA 5E0CA 1SSDA 1WV2A 3WLLA 3VD7A 5AYZA 1I8JA 5BCAA 4Q4MA 1G01A 2PU0A 4F0LA 3R43A 3W84A 3CEUA 1TA3A 3GKFA 2WHKA 2QMKA 1IXQA 1DTUA 2V82A 1GG1A 5IDIA 1UWSA 5ABGA 5LGXA 4S3EA 1KLYA 3R0DA 3UWZA 2D0FA 1IGSA 6CGTA 3M4HA 2WMKA 4W8AA 1Z48A 3GU1A 2BS9A 3IJDA 2PDNA 1P6CA 4LNYA 2GH5A 2IXUA 3IIOA 2OT0A 5JH1A 3B8DA 2OTDA 4LOCA 2VZOA 3K46A 3R4IA 3T07A 3CAVA 4TXEA 3G6MA 3G6LA 4Q8UA 2ZA1A 4Z2GA 3QGAC 4ES4A 3IK2A 1BG4A 4F79A 2CBJA 3W76A 4MZ1A 3SI9A 5A2AA 3QGKC 4NX0A 4C6LA 1WBHA 2Y62A 3EPNA 3UU0A 4DF2A 1RSCA 4H4YA 1XF0A 4GIEA 5F1UA 3BCDA 1GONA 1AJ2A 1JGMA 5BMWA 1TVLA 1KW1A 1EGZA 1OCBA 3NL6A 1Q1RA 3W1QA 5FL1A 1U33A 3UERA 1ITXA 3AALA 2QJJA 2RJHA 1XANA 4BQ5A 3POHA 1J01A 4YCOA 1EOKA 1ONWA 5LA2A 2ZBTA 3ZLHA 3K5XA 1H7XA 1YPXA 4WOQA 3SRHA 3N2TA 3L0KA 3VPLA 1GVRA 4HMEA 3S1XA 3G0XA 2RDUA 2G3IA 1RLDA 4O53A 4W86A 2WXDM 3S42A 3MQTA 4L9ZA 2CZ5A 1W9XA 4X9SA 1B4EA 1H7OA 3NEVA 4HNVA 4PEEA 3BDKA 3WL0A 2AKZA 5E9XA 3KHJA 4PCPA 3TLLA 4HU0A 1MRQA 4ZE5A 2F61A 1J0HA 4FF5A 1E4LA 1DQWA 1XLGA 1YPIA 2J7EA 3J7HA 3SADA 1T7LA 3VIGA 4CUCA 4MIMA 1Q63A 1PL9A 1XYLA 1K70A 2IW0A 4M81A 2OQLA 2ZFAA 1KRCC 3P0XA 4XZMX 2XM2A 3NPWA 5CGQA 4CU6A 1LBFA 3AYVA 3UR7A 1QATA 4JQ1A 2CETA 1XIEA 5A8MA 5IFTA 2G0WA 4IQJA 4YTUA 2ZC8A 2DH3A 3L9CA 3CNYA 2PDPA 4MY9A 5EGRA 5D8ZA 2JGYA 3WNLA 2AL2B 1RALA 1V3KA 5I3GA 4MWAD 2YDSA 4D2JA 2D2HA 1WDWA 2V67A 2V3GA 1UIPA 3M7SA 2X16A 2GR1A 3SIZA 1BWVA 4IG2A 2CHRA 3JVAA 4US5D 4IXHA 1F76A 1GW9A 4FP1A 2C8NA 3I7RA 4AIBA 4DM2A 1EWEA 4PCFA 3W2MA 4AIUA 2E7FA 4Q8NA 4UTUA 4PFMA 3FVDA 4P7QA 4XAFA 1W1TA 1Q65A 2CLOA 3E02A 4Y9MA 4B90A 4EAMA 4KWWA 3WH5A 2J9ZA 2R9RA 1DJWA 1LG1A 2WJEA 1KCXA 4MY8A 1KRBC 2A3AA 4OUIA 1CECA 1I2OA 1Q85A 5AC6A 1PX8A 3VGFA 3PAOA 3AMDA 3U48A 3W73A 1LQAA 2W4XA 5BWFA 3HGOA 1RJPA 5AZ1A 1DWIM 1ISYA 4JTCA 3HOJA 3F4DA 3MVIA 1POJA 2BHYA 2GUYA 1JULA 4AQLA 1X98A 3GNDA 1EO7A 4DELA 4NZ1A 3R7MA 4NI3A 5JCMA 1EIXA 2YCLB 3IJ8A 3O05A 2OKOA 3V0TA 2OYLA 4MJMA 1AMKA 1ECEA 3WBEA 4EVZA 1JAKA 3BV4A 1DNCA 4DAFA 5CEWA 4K8GA 3B4UA 3C52A 4DBUA 3KUMA 2TRSA 3WQGA 3VDHA 2DSUA 2OCZA 1ZDLA 1HL2A 1D9EA 4HU8A 3K4AA 3SJ3A 3SCTA 2HEJA 2R82A 5DCDA 3PUGA 4DUWA 1V3MA 3LBCA 3FJ6A 3TXVA 1SGJA 1QPQA 2TSYA 5DANA 4EQSA 3RMJA 1FWHC 3CHCA 3W82A 1JZ3A 4IMAA 1DEDA 4JTJA 3OOQA 1Q13A 4R85A 3BAYA 1X2HA 4ORMA 1DJNA 4KFPA 2WANA 3LOTA 3LTSA 4CQDA 5CC5A 5LHEA 3K8KA 1TWWA 3V16A 1VENA 4IIDA 4XBKA 4WSHA 2HQAA 4KETA 4UXDA 3ANUA 4MNLA 4QITA 3LEPA 3F5JA 3GUWA 4WIWA 3WLQA 3VIFA 3W01A 1HIZA 2VNCA 4U2YA 3WLPA 1I2PA 4O0QA 4M6UA 4N0RA 1BKHA 4H1ZA 1JYNA 2NX3A 3CMGA 4Q4PA 2DT2A 3GRSA 4UTTA 4JNZA 5K9DA 4JHMA 2E9MA 3BTNA 3LK6A 1GJPA 1OK6A 2HPIA 2V63A 5GNXA 5T9BG 4O14A 4YTRA 2EG6A 1JDAA 1BF2A 1KXQA 3VIOA 2EG8A 2PWVA 4LU0A 3E0VA 2WHLA 1W9BM 2VQUA 2FDMA 1ITUA 2QPSA 4WD0A 4YJ5A 4PMVA 3PJWA 3GTFA 4H4XA 3NL3A 1S5WA 2PDJA 2RUSA 3C2EA 4LCRA 2X09A 3A47A 1OC7A 1TTQA 3ZQ9A 3E5PA 1ZFJA 4TOQA 5DFAA 3KOZA 3K13A 5J5RA 5EB8A 2UV8G 2BDQA 4F9JA 2VVNA 7XIMA 5REQA 4IGHA 4XZIA 1LWHA 1R87A 4I9TA 4ORIA 1IIGA 5TNVA 4POCA 5LZLA 1GPWA 4O1CA 2P3ZA 4L80A 2QZRA 3OG2A 2ZRXA 1R2SA 4P8XA 4C7DA 4B2DD 1GGOA 1KGWA 2NXIA 1X6UA 4Q8PA 3NYDA 3TP4A 1HTIA 4L64A 4PZVA 1TJ0A 2WMGA 2A8XA 3W1PA 3VFLA 1KQZA 3GC5A 2A85A 1NFGA 3KM8A 1MNSA 1F8IA 2E1DA 3TYEA 2X2YA 2E4TA 1XSKA 2A7RA 7PTDA 3IS4A 4PBGA 4ZQPA 1UR0A 4HHLA 5BRPA 4XB3A 4LB3A 2FZ9A 1DQUA 2E8ZA 2YIHA 1FWWA 3USZA 3R25A 1F3WA 4MB3A 4GZJA 1ZMCA 3ZT5A 3LU2A 2CHNA 3LLXA 3NQVA 4JTKA 3JZUA 1HVQA 3K4WA 1H0IA 4NQ1A 3SCWA 3RPMA 3K2GA 4L1XA 4GNVA 1FP8A 3O6CA 4E4PA 3KLJA 4EX4A 1FWGC 4FR1A 4H6QA 2D24A 3AJ7A 2NQ9A 3GWQA 3VUPA 4KRZA 1O94A 3ARYA 4ZE4A 3E12A 4PL2A 3K8MA 3CL7A 5GVJA 4BS0A 4PTXA 4H9MA 4Y96A 5HAOA 4GR1A 5FF2A 4M0XA 4N4PA 1F8WA 5EMUA 1HJSA 2BY2A 2P53A 4IX0A 2P10A 1L6WA 3NCOA 1Q4WA 3AXXA 2BVTA 1G4PA 3CPGA 4OIFA 3GFYA 2MUCA 2ZDSA 1RLCL 2CEQA 1JDFA 4FX9A 3GHTA 1CENA 2OSWA 4QG6A 3BJTA 3P2VA 5DMMA 1MW2A 3B0YA 3LXAA 3BPWA 1NAL1 1YBQA 2I7GA 3CUIA 3NUKA 2G5WA 4FLOA 3EWYA 5BWAA 1WKEA 3LGEA 1OFEA 3WUBA 2AOSA 4S2CA 4F3HA 3HPZA 3LZ5A 2UWFA 1WYIA 1ITCA 5CAKA 4WDWA 4UB9A 2ZKMX 2YL8A 2DW7A 4DJFD 3CYJA 1UKQA 3EXRA 4U10A 2WHJA 2FYMA 2G95A 3LPOA 1G0CA 4GYPC 1OT1A 2AAMA 3VGHA 4A22A 3PZGA 1TUFA 5SWUA 2GQ8A 3S5ZA 2E3ZA 1LOQA 3IIVA 3WLNA 4AHOA 1B57A 2FHFA 3ZR4A 1PJ9A 2E77A 3WIJA 1BYBA 4U28A 1XI3A 1VLIA 1JI2A 2CBUA 2GYIA 4H7VA 3GY1A 2X30A 4Y9NA 3RN6A 4WGHA 2V2HA 1JZ4A 1JRPA 2XVPA 2CLEA 3T2OA 1TIMA 3BLKA 2E6AA 1T99A 3MCNA 5AC7A 4A8LA 4CEUC 3DFTA 1KM2A 1LDCA 3W1TA 2PWFA 1C7TA 1X1NA 3HV9A 3WDJA 2XFYA 1N55A 1N8IA 3ABRA 4I5RA 2GUUA 3PZUA 5BOEA 2IQTA 1EBHA 2GZXA 3AMCA 3TJXA 4EP8C 1R7AA 5A6SA 1VAHA 4BR1A 1PKMA 2PP1A 5LNVA 2W55A 2W54A 2VDHA 4HN4A 2GSEA 3CQ0A 3S4TA 4QBXA 3I7SA 2QXWA 1WKFA 3GNNA 1HL9A 3SSZA 5DMNA 1R85A 4Q8OA 3B03A 3ANYA 2OWWA 1A53A 1X97A 1KWKA 3SURA 3W2JA 3F4WA 3BMVA 4QS5A 1QOQA 3UXKA 3L2IA 1VFFA 1JXKA 1P0EA 4MGGA 4A8IA 3R8HA 1FWCC 1GRAA 3VZYA 1LOSA 5IFPA 3REQA 2Z0IA 1JCTA 4AZIA 3AFBA 2OX1A 3W7EA 3UW6A 2YFNA 1XIIA 4CVUA 1W5QA 4QJ3B 2UBPC 4PBFA 2VFHA 5HANA 5MKGA 3BLIA 1LRNA 3IRDA 1UR8A 4FO4A 4M6VA 2V5BA 2VC7A 4FIQA 3O06A 4XV0A 5IHRA 1LL7A 2VR2A 4FXJA 5C7HA 1Y0EA 2WPFA 2BNJA 3BL3A 1LG2A 5I5RA 5BXSA 1US2A 5DLCA 1FFRA 5HNRA 1XV8A 2OO0A 1XRVA 3ABOA 1Y7VA 2PP3A 3EDKA 3MBDA 4GACA 4DF0A 3VNLA 1B5TA 1GOXA 2EQ9A 1DP0A 4J3WA 2I9UA 4JTQA 3WQDA 2DV0A 5HQEA 2WPGA 1RVKA 1UG6A 2WVVA 3FNDA 3U3HA 1ECQA 4DY1A 1JCLA 1AQFA 3N25A 2YXXA 4BWLA 3WQ4A 3CGTA 1XIHA 1UC4A 2VEGA 2O4QA 4JX5A 3JS3A 4YWSA 2PDCA 1GRTA 1QRQA 1EIBA 3DGZA 1QW7A 3RCNA 3PTMA 3RGTA 3TUUA 1L6FA 4O1EA 3M0IA 1HJVA 2J77A 3CZEA 5FAJA 2ISDA 2TPSA 3GXDA 3KOXA 1D8WA 4BI7A 1VFTA 3NPUA 4O11A 2QAEA 1V3IA 1UBSA 2F9RA 3H7VA 1GV4A 4FSAA 4WLCA 3IC9A 1V0LA 1H7WA 3KTSA 1FQ0A 1GRGA 1DL3A 4M6QA 1JDEA 2F7FA 1LVLA 1TV5A 4W5UA 4LXFA 3WLHA 4D6GA 1UH3A 3G8RA 2DIKA 3TDFA 3RILA 2YBVA 3NDYA 1HP5A 2WMIA 4PODA 1OGSA 4ZFCA 3OGSA 4UFMA 4A3UA 4WVXA 1QUMA 4H8VA 3QMSA 4QCFA 2NSXA 1EEPA 1QNRA 5DMYA 4LIIA 1NFBA 4GQ0A 2PCQA 2XGIA 4DZ5A 3XIMA 3U2CA 3GX9A 3EPOA 4V27A 1B90A 5LKYA 3GHUA 1E0VA 1PIGA 2BC0A 4IGNA 4CNNA 3ATZA 3QBUA 3VMOA 1F4AA 2J9YA 3CL6A 3WCZA 4B5SA 4YTSA 1KBLA 3IUHA 3EB3A 2B7OA 1LWJA 2Y5SA 5FA5A 2XIJA 3GR4A 2VEKA 1LT7A 5FJRA 4LVDA 2EQ6A 4QDMA 3WD0A 2AAQA 1HJWA 3CQHA 1WUEA 2J24A 4UZUA 2VR4A 4FNUA 1W3JA 1EH9A 1XISA 4JEQA 3PUOA 3FYPA 1DIEA 1KTNA 3LQLA 2RAGA 4J1OA 1KR0A 5CLWA 1IF2A 2CXGA 3NA8A 1XPYA 5CPSA 4QROA 3U4AA 2I14A 2QAFA 3TN3A 4XVEA 2R1MA 4JIEA 2VHLA 3UD6A 4Q8WA 1I6NA 4DHGA 3THQA 1UD3A 3LHUA 3WJZA 1QCWA 3UY7A 4GX8A 4DAIA 3HG3A 5KVHA 3DZ1A 4GC4A 3FJLA 3E0IA 4JFSA 5AC5A 3G77A 3T4WA 1Q6FA 1Z69A 1AZ2A 1O66A 4EQRA 4OOUA 2Q09A 3NS1B 3NXFA 3ERPA 2W3RA 2VDGA 1RH9A 2GGIA 1R3RA 4MHBA 1SZFA 3KVJA 2Q8ZA 2DH2A 2QJIA 4DX3A 1H62A 1GT8A 1KFBA 2WVUA 4RZ5A 1PYMA 4GQRA 4JTEA 2AGTA 3M5XA 5EMKA 1E1FA 4HN8A 1XDJA 1E9LA 3ITYA 2FLIA 3CUFA 2ZZ4A 3O2LA 1HVXA 3IV8A 5H6HA 1PKNA 4JS3A 5FF7A 4V2XA 4JKKA 4QGCA 2PBGA 4F48A 3CB3A 1JI1A 2W6RA 3GLCA 4FZIA 2H9AB 1DBTA 1NY1A 1V03A 3OBEA 4WKHA 4HMCA 3WH6A 4ICMA 2ZDRA 3MPGA 3WBWA 1C8VA 1Z42A 1UR9A 4C6MA 2XZ9A 1K6WA 4G8TA 5DMLA 4KQNA 2Y61A 3KRSA 4EPEC 3ID7A 1DJQA 4Z17A 5D04C 1OK4A 3GTHA 1VBRA 3B0UX 3HN3A 3QV6A 1CDGA 2VFFA 4XBJA 4JFUA 3UYIA 3UXDA 1ITQA 1I2NA 4WX2A 3HMJG 1MSSA 3AU2A 3S9ZA 4MJZA 3UJ2A 2D3NA 2VVSA 2PFHA 2C15A 2IKIA 3V1HA 3RX4A 2WKGA 4MMWA 1DE6A 5FS6A 1S2VA 4FX6M 3CAKA 1K7XA 4NYUA 4ZL1A 4XZHA 1EQCA 1GYNA 3BGGA 3CV2A 4CQCA 3P8JA 1FWIC 3WH7A 5CC3A 1FY6A 7ENLA 3FYYA 4AAJA 3TOYA 3NVTA 1CYGA 5CSSA 3II1A 1K8XA 4AXNA 2GPTA 4E4UA 1P1MA 3SY8A 1WDRA 3DGHA 3KX6A 4OECA 4NU7A 3QSTA 3MWCA 4FXRA 4EM3A 2V3DA 3GTXA 4IOTA 1V51A 3OLDA 2IMRA 4AMAA 3BC9A 1Z44A 3LDVA 4NHVA 4WJXA 1QMLA 2HQMA 4B3KA 3VD9A 3NQ8A 3VTRA 4MNKA 2W3ZA 2GGEA 3O8AA 3Q67A 4H9TA 1TFVA 1PV8A 3SQLA 3NDZA 1IXPA 1EPXA 1M03A 4CQ9A 2WVTA 4M1BA 2X1SA 2FPYA 5C9UA 2H6RA 1N5WC 3W26A 1V08A 2YVGA 1V6YA 1KBKA 3HQNA 3V0UA 2PWEA 2ZUNA 2JK2A 4ACZB 2PDHA 5A6BA 5GNYA 1NP2A 3FOKA 3NM1A 4AC1X 1M53A 3GDBA 4I3GA 4XWUA 1DWHM 1ADDA 4A6GA 3HPAA 3PZ9A 1V3JA 3UETA 4ADUA 5HBFA 1OABA 4FS9A 3LNMA 3LNPA 1GQJA 4L4MA 3P93A 2QLYA 4CD4A 4ZODA 5AY7A 2WC7A 1RQBA 2WZEA 2PGEA 3PWGA 3DXIA 3AI0A 4H50A 4O13A 3GH4A 2J27A 3KDNA 1D7YA 5GJNA 3AWOA 3BOXA 2IUZA 3DAQA 2ZICA 2ZZ1A 2OZ0A 3JR2A 4QSFA 3IJ6A 3CM4A 3CO4A 3R5EA 8RUCA 2HVOA 4LUTB 4K39A 1OD8A 4EAYA 4GGBA 3S5YA 3G1HA 4DZAA 4PUKA 3WD3A 2A21A 3FA3A 4P61A 2XVLA 4BEUA 4MVAA 4RKAA 5C2XA 4NJHA 1EOMA 7ODCA 2QHAA 1QDSA 3H55A 1CGVA 3NQDA 1J0ZA 1R3QA 2YJQA 3H70A 3GHSA 3BV7A 3P74A 1TJ1A 1RCXB 1O5KA 2XJ7A 3UY8A 3AIBA 1GZGA 4FX7A 3VNZA 1DHPA 5JRBA 3WD1A 4N7QA 4J3VA 1YXDA 1SMAA 1E73M 2PLKA 5CQ1A 2QCHA 1S2TA 2EPOA 1JUEA 4JBRA 2V3FA 2BASA 3T2QA 1FOBA 1VDVA 3EZ4A 4FOJA 1OX5A 3BSGA 1K77A 3SFWA 3DK8A 3NAVA 1V8EA 4BI5A 3W6LA 4Q7IA 1LT8A 5D09A 3IJ9A 3OQEA 1LWIA 4DO7A 4HYWA 3MY9A 2G3JA 3NQ7A 4FNPA 3S2CA 3MP4A 1XW8A 2YYTA 4XD3A 1EJXC 1DVJA 1FFQA 1M9HA 3RPDA 4NZ5A 5BOOA 4JTLA 5CSYA 3QZAA 4HNCA 4ZGYA 3LERA 1AD1A 4JYDA 3VE7A 2Z28A 4UMBA 2H90A 1C93A 1REQB 3GXIA 4I9MA 4EOUA 3CBWA 1MW0A 1UWIA 1ONXA 5TBOA 3URQA 4R34A 4V28A 1YIXA 2R14A 4MM1A 4P7NA 5FF4A 5HQMA 1Q7QA 4OFCA 1L2UA 4PMOA 4IMEA 4ZO8A 3KS5A 1M65A 3LI0A 4S23A 3UZ5A 4FXFA 3UCQA 2A0NA 3AHTA 3SQPA 2VCBA 5A6TC 4YL2A 1B3ZA 2GJPA 1EGVA 3CZJA 5FIPA 4GI4A 5RUBA 2G3MA 1LRQA 3EDJA 4WY0A 1T8QA 2GDQA 3FG2P 2PD5A 4GIRA 4C60A 5D9NA 2VFDA 5K4XA 1K4HA 4HK5A 3FDKA 1YX1A 5TQLA 1GEQA 2OYMA 1N62C 2V5DA 3WK1A 1BPLB 1O60A 1UD8A 1SSGA 4QJ5B 3IV3A 1GJWA 4KWUA 1MUWA 4D1IA 3NPVA 1MEIA 1Q5MA 1AZ1A 2J7FA 3OVPA 1E1CA 2OLHA 3VKBA 1NWUA 3UPMA 3S2LA 1H5YA 3VDBA 3BUVA 3LV5A 4AD5A 3EWZA 4TX8A 1YPFA 1P0KA 4BCEA 4Y9AA 1ICSA 1M7JA 3FFSA 3H2AA 3A4JA 3TC6A 1EBGA 3LM7A 3MHFA 2A6LA 2DUAA 2ZX5A 4O54A 3AUOA 3L4UA 1UD2A 3WJWA 3OBAA 4QLKA 1K7EA 5CZSA 3WUGA 3Q2DA 3WLJA 3ITLA 5BU9A 1TVNA 1H7NA 2RGLA 4O4VA 2GJLA 1W56A 1K6AA 4GYFA 3VOIA 4IIFA 4ZQOA 4RX0A 3BW4A 4XAPA 3T8QA 3RLVA 2ZOXA 1A47A 5FEXA 3UJFA 1H61A 1O7AA 4X0NA 4NJKA 3NYZA 4IPIA 4K2SA 4DQWA 1VPYA 4NP7A 4WKAA 1H2JA 3ZJ8A 3SW6A 3T9PA 2G4JA 4HNNA 1TTPA 4LS0A 3WDIA 4PC8A 3WNMA 1Q8AA 3W72A 1SFJA 3FY1A 4LS1A 3NR0A 4H3DA 3KZPA 4KESA 5BROA 2IQ0A 4O28A 4W7WA 1BRLA 2ON3A 4F66A 2FPTA 4WXZA 1VFLA 2OKTA 1XIDA 3A5VA 4M80A 2YB4A 3W1XA 5CZJA 1UJQA 3SIMA 1MEWA 3TOPA 3VFCA 4KWSA 3LA4A 1W1VA 2E3TA 1W8SA 1IWBA 1PZ0A 5FI8A 3ARUA 3QZEA 4V1XA 1H50A 3M0JA 1F5ZA 2DJXA 4XZBA 1TRIA 1YMYA 4K7ZA 2TODA 4MF4A 1X2GA 2Y7EA 1BYCA 2YL6A 3TE9A 1M6IA 1T6MA 2OT1A 4YYCA 3W2NA 4ADSA 5ECUA 3MO4A 1E9IA 1MXGA 1PEZA 4CD6A 3U7BA 4IP7A 3DG6A 1HF6A 4KWVA 3UCCA 1YNYA 3VCRA 1UBPC 3HFTA 3KBNA 5K2ZA 1XFBA 3MKVA 3NVZB 1UJPA 5FSEC 3SN4A 3S0CA 2J79A 3WY1A 4G56A 1XLAA 3QKEA 4IPJA 1G4EA 1PCWA 2DIJA 2PDFA 3M0MA 2VDIA 4AYSA 1JZ7A 4JYFA 1UR2A 3ME3A 4EF9A 2J8FA 2NT0A 4C1NB 2VFEA 1FCVA 2QCFA 3BOLA 1CXLA 2OO6A 6A3HA 2OOFA 1U2YA 1NWTA 2WCAA 1S3HA 2P8BA 3IVTA 3SQMA 4JD4A 5HQLA 4IFKA 5AHNA 4HA0A 1M41A 1EF2A 2J7HA 4I7VA 2FVLA 5C71A 4UR7A 4CQBA 4TVDA 3QEZA 3PC0A 5ECVA 3OBKA 4D8AA 1UKPA 1CXFA 4P7LA 1VFOA 3UR5A 3EWDA 2GUBA 4JXCA 3VOGA 4JR5A 1UMYA 3ALGA 5LXEA 1BGGA 1QOPA 4B3LA 2F84A 3WK3A 1HKVA 3EAOA 4KGLA 3FXYA 1HKMA 4IJBA 1J12A 3QM3A 2RJGA 3W38A 2VC6A 2ZUMA 3UQNA 3B4YA 2ALRA 3BLFA 5CZKA 3CL8A 1FWFC 4PBEA 1FCUA 2PUZA 3KS6A 3OZMA 1QBBA 3O6AA 4GXPA 2YB1A 1ZGDA 3TW9A 4LFYA 4ATDA 3CPRA 4R33A 4ZTXA 3UZZA 1PDYA 3WF0A 1GSNA 4BEQA 5HNUA 4EQXA 1EB3A 1SR9A 2EPKX 5HWJA 4D6CA 4QLLA 2Y7FA 1I75A 1XX1A 1FDZA 3VZZA 3QFWA 3VCCA 2P5NA 3H4WA 4L6DA 1A3HA 2V68A 3IGSA 1S2WA 3BXWA 4JN7A 3FCPA 3B9OA 3EX3A 3AZRA 4QJ4B 2WOVA 4PMYA 2OG9A 1GQKA 5DEZA 3HPXA 2G3NA 4GVFA 4QS6A 1E6QM 1ISZA 2NQZA 2UY5A 1LTDA 3AHVA 1THFD 3W24A 4EE9A 1W32A 3CH0A 2YCIX 7TIMA 1VBJA 4G7EA 3MBFA 4GVIA 2FQIA 1AUSL 4AZ6A 1NDWA 4CNSA 4CNTA 1XHCA 2ZADA 3B04A 4IP4A 1KR1A 2WCSA 2J8GA 3URBA 2B0MA 1YDYA 3RF9A 1MI3A 1ZENA 3II4A 4H7ZA 4K6AA 4N9EA 1JPHA 2ZUVA 3GZ3A 5U25A 4RDZA 1VRDA 2NWSA 1DWJM 3JW7A 4NT0A 2NPXA 3TXZA 4F9DA 2PTYA 3GK0A 2Q8XA 1GG0A 1HFBA 1Q6GA 2G41A 3DFNA 3IVSA 1VBHA 4WZHA 1JAEA 3H4XA 5MHBA 5AB3A 2C16A 4X2RA 2ZX8A 5D33A 1SO3A 1FWTA 1R6WA 4DWSB 2C1HA 3BQ6A 1M7OA 2V5CA 3L66A 3G8EA 4M29A 2OJPA 1SJBA 2VI0A 3ZJKA 3GR8A 1VZWA 2Q3OA 4JQ3A 3G1VA 1KD0A 5HJYA 5C5YA 3UR8A 3V75A 3TVAA 1GYMA 3JZEA 1F74A 2EHHA 3KWXA 2E9BA 2PDGA 1ZMDA 1B3YA 4KCVA 5XINA 1W3HA 1TJRA 4LF2A 3ZSTA 2QUNA 4CVWA 2X42A 4FX8A 2GWGA 4TVWA 3PP7A 1IZJA 2V5LA 3N2OA 4E8GA 1EJUC 1S1PA 4MTVA 3C0LA 1SZRA 1IHIA 3AIWA 4EANA 3AXHA 3VE9A 2PS2A 4OU1A 4RUBA 1WZLA 4G2DA 1WXZA 3AOFA 5LYRA 1V02E 4K38A 2GVEA 3A5FA 1O1HA 2ADAA 2VKZG 4Q8TA 2V2DA 3WLSA 3EYPA 3QR1A 3NZ1A 3U57A 4GE8A 4IISA 1XP3A 3EMCA 3SN1A 2BX7A 4YTTA 3PJTA 1QFEA 3TR2A 4X60A 5C55A 1KN0A 6TAAA 4D6HA 1JROA 5GPRA 2WNWA 3WEMA 1EDGA 4UFLA 5HPCA 1ZS2A 2QJNA 4KEVA 4WJ8A 4C6JA 4DUXA 1M5WA 3PZQA 5D4YA 1EUNA 3U0HA 1P0DA 3H4KA 3TW7A 3IIZA 4H9VA 1F9CA 1LQ2A 4TV6A 3RO6A 1IR2A 2V2CA 1FXPA 1U1JA 4C7GA 1BVZA 1TYGA 2YL9A 2PGFA 5AYXA 4KF1A 4HA3A 4UR8A 3QGVA 5I06A 3TQ0A 2CZFA 4K7VA 1ICPA 5TIMA 3CGDA 4XG1A 1A4MA 1DWFM 1V3HA 4C7FA 2VOTA 3BLLA 1XLEA 1YNQA 2PDUA 4CCZA 2OZTA 3OEXA 1Y5VA 3Q6JA 5TR3A 3VX0A 1Q6QA 4LC6A 5F4WA 3TC3A 4D8LA 1EA0A 3LM3A 3PSVA 3TAKA 2OODA 2ZXQA 3LENA 3THCA 3BCJA 1GTHA 1POKA 2JEQA 2CDUA 4M19A 1EDQA 4AY7A 1ZK7A 1V0NA 3IJQA 2GGHA 2JFEX 3MJMA 3EEZA 1F3TA 3ATYA 2BMBA 2VGFA 2OX4A 3BLDA 4WK9A 1TCMA 4GUIA 3U8GA 4X9YA 4B5TA 2YFOA 3WMSA 5ABFA 3HPFA 4NSBA 4XAYA 3SECA 2CC0A 1AH3A 1BWCA 4WOZA 1S2UA 1A3XA 3S47A 1H09A 3K8LA 3QQ1A 4HNTA 1S46A 3AROA 4EK7A 2GK1A 3BVJA 3EWBX 1TV3A 1EC7A 2I1OA 1Q2RA 2VR5A 4NASA 3TW6A 3D6NA 4ZOAA 1ME7A 1QBAA 1JQVA 3BE7A 3WSUA 1JCYA 3VDCA 2MANA 1LLWA 3F03K 1TTIA 2ZRZA 4LYKA 3MMDA 2X1UA 3WQ5A 2J74A 3B9DA 4LF1A 3BZGA 3KRBA 1JFXA 4QHRA 2ZRWA 4AHPA 4DO5A 3QVQA 1ZBVA 3TQKA 5C70A 3G1DA 4WUIA 1D7FA 4KW2A 1ADOA 4PMUA 2ACUA 2QDHA 3LXCA 3L7RA 4U31A 4GK8A 1FH7A 2DZAA 1HGWA 1OVDA 2GGJA 1JPMA 3URHA 3MKKA 4H6KA 1LF1A 4XSMA 1TCDA 1X38A 4C5ZA 4W93A 5ABFB 2E1WA 1V6WA 3CC1A 1YQ2A 5FJOA 2PZNA 1OYBA 3HG4A 5CPTA 3VIJA 3D0CA 4IT1A 2F8QA 5BNKA 3LV6A 3B8TA 3W86A 1Q6CA 4UOQA 4O1DA 5GJMA 4KCTA 4PB5A 4FB7A 3W3OA 2I56A 2WOIA 4LVGA 3W02A 1E6SM 3GXFA 3MP3A 1R46A 5D2TA 2E9LA 5C6MA 1BAGA 1FWJC 3E0WA 4AWTA 2IKHA 4PTMA 4TIMA 2R6OA 3E2QA 4RE2A 1GOQA 3UZYA 2YR1A 3WF4A 2GVYA 4XUYA 1WDQA 3DCPA 5B7ZA 3QQ0A 4JAWA 2BVDA 4ICCX 4S3KA 4Q4QA 4YU1A 3WBAA 1W2PA 2VD8A 2WW5A 3TJIA 1GVQA 4XO7A 3U9IA 5G2HA 5IBXC 5D03A 1GKPA 5A6KA 1XG4A 3G1SA 3HG2A 1GKQA 4N02A 3VGGA 3ENLA 4REQA 1U5JA 3IPWA 1K7FA 3W7QA 5FD0A 4I7WA 4GA8A 3QXBA 4JTHA 2VWSA 1DWAM 2DT0A 2YXGA 4YWOA 3AS3A 3VNDA 3GXMA 1OX4B 4KIEA 4KKXA 3OA5A 4LSBA 2J4GA 3ICJA 3DENA 4GPNA 4Z1DA 1TMQA 2OSXA 3RNMA 2Z7GA 1FECA 1H3GA 3H21A 1XGDA 3CHEA 3DOPA 1RUSA 1UKOA 1XPGA 4FALA 4NRSA 4PUJA 3CUZA 4O1AA 3ES7A 4YIWA 5DF0A 4ZBCA 5CZ0A 4DBDA 2HK0A 3TWAA 3W1UA 4CGTA 1OIFA 3E6EA 2XSAA 4CU7A 1XH0A 3UGRA 5LNSA 3W70A 3B06A 2VZTA 4O1FA 1RCQA 2AMXA 1HXJA 2QYGA 3RFAA 3WNPA 5LIWX 4LH8A 1TV4A 3W7DA 4YVVA 2ZQ0A 1UPMB 4KMQA 1TSIA 3L5OA 1R5YA 4K36A 4S3FA 3CQJA 5A69A 1V59A 2P76A 3TJLA 4H8HA 2VJXA 1JL8A 5CGTA 5J04A 3R58A 3GO2A 4ZA0A 4JICA 3FVMA 3BURA 1CNVA 2VCCA 1X1ZA 3OZYA 4HYVA 3AAMA 4GJ1A 4RDVA 1YXCA 2W91A 4S3GA 1R3WA 3GIQA 1FEAA 4HA1A 3R10A 5C9RA 1OGBA 3FHQA 3ITXA 1ZX9A 5G4WA 3IWPA 3QV7A 2J25A 3ZXWA 5DXXA 1UA3A 1IGWA 2I16A 3LXDA 1OFDA 6TIMA 3VD5A 1W1IE 1J0IA 3MCMA 4H2HA 1E6XM 2X8RA 1LLZA 3WEOA 3IAQA 4LW7A 4CKQA 2JKEA 5U4NA 1EPVA 1B30A 2FZBA 1Q6DA 2PDKA 1UCWA 4CCDA 5JIPA 3VIHA 5JCIA 1ZHAA 2QS8A 1JDDA 1A50A 4QG8A 3GC4A 4AIOA 2WZTA 3NQ6A 1ENUA 2P88A 1ZJIA 2PLMA 4NJJA 3UNTA 4MKNA 1AK5A 1IZKA 3TYUA 1NM9A 2FVMA 3HBLA 3S6OA 3MDWA 4NJIA 1V4YA 4L61A 2W92A 1QW9A 3ZO9A 1BWKA 3LGGA 1XYAA 1FKWA 1ZSXA 1ZCCA 2GVJA 2VFIA 4ZB2A 5CSRA 4E3VA 2HRWA 5F2IA 3PWIA 3FGCB 4LX4A 2G96A 3FS2A 5T26A 2WMFA 1GK8A 1WZKA 4LBUA 5A95A 1HO1A 4LUJA 1MWOA 3RG6A 4HPXA 3KVMA 3CYVA 3COTA 3LADA 2W27A 3CH9A 1GHRA 1TMLA 2ZA2A 5M3WA 3P6LA 1ZJAA 7REQB 1AOGA 5LXXA 4LWWA 4OWGA 3FYOA 2NQHA 4HZMA 5CC6A 4QRNA 1ZU8A 1RXOB 2OEMA 3CQIA 3O0KA 2WOWA 2FHCA 3W85A 3VNIA 2O92A 1HX0A 4UNIA 5ABHA 2VL4A 4EXAA 1FIQB 2X1TA 2DW6A 2CU0A 2FMOA 4YPJA 1H0GA 3TA6A 2P1FA 4MWAB 1FWBC 2RDXA 1QK2A 3IIPA 4U2ZA 3MW7A 1LUCA 2AL1A 1NARA 2DZWA 1D7KA 4I5UA 2PDQA 4U5IA 1D2KA 2R24A 3UGVA 1A5CA 5A6MA 1E6RA 4G6CA 2OOGA 1HJXA 3PZVA 3UG8A 2Y1HA 3QHMA 3TYAA 1TIWA 1FWDC 1XYMA 4WGXA 5E6YA 4FDCB 4JTGA 3CASA 3AQUA 1NP0A 2HE5A 3CMJA 4BF7A 2Y2WA 3XISA 4IMGA 4DWSC 1HQTA 4XTIA 1UR1A 5G1TA 2YA0A 4GY0A 2RHGA 5D2XA 3UA4A 5D02A 4JX4A 4AX6A 1CI1A 1EL3A 2GSHA 3PZMA 4I9JA 1R86A 3KZSA 3KTCA 4HT3A 4DNAA 4JX6A 4RPQA 1JYXA 4PUMA 2WSPA 4BJHA 4E3TA 4JTFA 4DUOA 3A4AA 4GI6A 4US6A 3KVLA 4B15A 3QFEA 4CLMA 1TX2A 3OB8A 3IGUA 1QI5A 4B5NA 1TREA 4FI4A 2V9DA 3H2FA 5I3DA 2DP3A 2R1KA 5CAHA 1DOSA 1LYXA 2IXVA 4HB7A 1AODA 3LPGA 4S3CA 4C90A 2YLLA 2F6KA 4R53A 2YBUA 1SJAA 3TR9A 3N6HA 4GXWA 4J2MA 4UR9A 3Q94A 5LNUA 3NO1A 4FMVA 2J62A 4IGMA 3HQPA 2DT1A 3QTPA 4ZOBA 2OYKA 3A64A 3OG3A 1L9WA 1QPKA 2E5AA 3FSTA 4H4IA 1QAPA 2FMNA 4F0HA 2XWDA 3LCFA 2WNQA 5D32A 4QG9A 2ZZ0A 4ZXLA 1XD1A 1F3EA 2X8CA 3KBSA 2ZZBA 3A4WA 4D9PA 3MZ2A 2WP6A 3PANA 5DCBA 2XU2A 4CN4A 2Z6IA 3T44A 1VF8A 1JCJA 4QFUA 3W2KA 1SPQA 2X1RA 3LCGA 4UZSA 1GQNA 4FOKA 4O18A 1TX0A 1TQXA 1G7VA 3IJLA 3SEPA 3T0DA 3OVRA 4JIPA 4JY9A 1AQHA 1MZHA 5G5IA 2JF7A 2V81A 5AN7A 1DJZA 5C2CA 4DPPA 3B3DA 4GQGA 4TX6A 3M44A 2WJDA 1OBAA 3Q45A 2PDXA 4GXMA 2HBXA 3DFPA 4XZ9A 4J4KA 1PYFA 2WWDA 2ZRVA 4IQEA 5DT5A 1JFHA 4J3UA 4GNKB 3NM3A 1Q4NX 1KRMA 4HNUA 2X40A 3WMLA 1IT8A 2ISVA 1F3XA 3D9XA 1CGUA 4FK9A 4OTKA 3ZR5A 3PK7A 2YCEA 3L21A 3C3UA 3G1AA 3NQGA 3NSNA 2V6OA 3GC2A 2JF6A 4H04A 1V0KA 3EOLA 4UFJA 2W0UA 2R9ZA 2ZZ2A 4F0MA 2XHYA 3GVWA 4MB5A 1T41A 3GBDA 2QUTA 2YW3A 2QCDA 4M6PA 2AGKA 3O16A 4JDYA 1IWAA 3AC0A 2EPMX 4D6JA 4UNLA 3KRUA 3QRHA 4LGXA 3ZLFA 3KCJA 1U5HA 3TX9A 4JN6A 5I09A 2NVKX 1Q45A 4EIVA 3B0VC 2XH4A 3CZLA 1SW0A 3L23A 4PTNA 5AHMA 2SFPA 1OJTA 1K3UA 4D6EA 5BZAA 1OFOA 3PBWA 1YYAA 1ISWA 4WCJA 3LLDA 5IRPA 3KEHA 5I3HA 4QM1A 1VEPA 4BA0A 4Q8MA 2BY1A 5FAGA 1GRHA 5K4ZA 4B91A 3S3GA 5KSWA 4OOZA 2QR6A 1ISXA 3N2MA 1QK0A 1XH1A 1BQCA 1O1ZA 4IZGA 2PTWA 3C2OA 4TU1A 2A3CA 2X7WA 4TQTA 1MQRA 2R91A 1HO4A 5A6JA 1EF3A 3SY5A 5EBKA 4H4VA 3M1ZA 4GUHA 2G37A 3MHUA 2C14A 3NOEA 1PTAA 3I7QA 1VHCA 3ARWA 4LUSA 3AZSA 5CGMA 3TH6A 2BVWA 5M1TA 1OFRA 3G22A 5I24A 3R8RA 4F2UA 2WZIA 4AYGA 3W23A 4IIGA 4K3ZA 3A24A 5KTLA 2BSLA 3DGRA 4MNJA 2DEPA 1CW2A 3HJEA 4WY0F 2OGJA 3W1RA 2W61A 1MDRA 2NT1A 2W66A 4LVAA 1V02A 2D23A 1AVAA 3WL1A 4QSHA 3EDFA 4KBXA 2BCPA 2Q71A 1O5QA 1XRTA 4JPGA 4NRRA 2PCEA 1J93A 5CKSA 4ZOEA 4YVXA 3ZT7A 1IR1A 3SM0A 1W9DM 5D2YA 1M7XA 2D3LA 4MY1A 4JOMA 1J79A 1TKKA 2Y4SA 4UQEA 3AO0A 2DVTA 3M0LA 3N2BA 3GH7A 4UCGA 1EUAA 4HSOA 4JIRA 3IUDA 3KLLA 4HOWA 4BURA 1XLLA 1FO4A 5KETA 4UCFA 4N6EA 4FHAA 4HU3A 4PL1A 1X96A 2TYSA 4Z2HA 4ZCWA 3VDGA 1DORA 3SB0A 2CZVA 1XBVA 3B8UA 3UESA 4BHYA 3WX7A 2C71A 3W87A 3E2RA 5DQPA 2PB1A 1UKTA 1DV7A 1Q7ZA 4ATWA 1XQLA 3B0XA 3MSRA 2Q6ZA 5IHSA 3SUSA 5KZEA 3S83A 4X61A 2J6XA 4B4HA 1UWUA 4GH1A 2DSVA 2IPWA 2VCAA 4Q22A 3MYPA 3L5AA 3ZMRA 1OX6A 2D2OA 3GW3A 1XXXA 4EPKA 5A8OA 3GG0A 1YEYA 3SCSA 1IEWA 1R38A 1ESWA 4RXFA 3VNMA 2JQXA 1CXKA 1GWJA 4FLRA 3ARZA 3GQYA 1VCVA 1NHRA 2XH2A 1LLOA 2B31A 3EF6A 3CGBA 2ZZ7A 3SCVA 4DJEA 5B7YA 2B7NA 2NX1A 1CGTA 2O9OA 2GDUA 3CB8A 1OC6A 5FL0A 1DQXA 3SDOA 1A5NC 6PTDA 2NW0A 1TA3B 1YLVA 2XDFA 2CKSA 2IPJA 3RJYA 5K9XA 3RU6A 4J27A 1PKLA 4GISA 3D3AA 5EL1A 3IARA 4LV4A 4X22A 2VUNA 1GQIA 3WH8A 1TTJA 4AD1A 2GL5A 3R2GA 3VOJA 1V7AA 4PUDA 3WQ6A 2XIIA 4B3ZA 3HZ3A 2W3SA 1TELA 3VMNA 4UFIA 3E96A 5H8MA 1NWSA 3LUTA 4I6KA 1VFHA 1PUDA 3W1NA 4AH7A 1QR7A 1A49A 1TZ7A 3RRXA 1F07A 2UZ9A 1ZBKA 1ZBCA 1L6YA 4PTDA 3Q4DA 3KP1A 2FFIA 2EAWA 2AQWA 4XISA 5E1QA 3SN0A 3GDKA 4Y6GA 2V30A 1XLHA 4GINA 3AZTA 4DYKA 4UIOA 1CXHA 4BV6A 5LGZA 1NWRA 1KBIA 3BAJA 3EB4A 4LBRA 3E0LA 4DEFA 3GAKA 2REQA 3OW1A 4UMCA 1K02A 1N7KA 2WO5A 1YTDA 1M6JA 3I4KA 4EACA 3DFHA 3R0UA 4UQ9A 4GCXA 1E4NA 3PHAA 4NZCA 1C8XA 4AY8A 1QO5A 4ZB5A 4D6FA 3KAOA 1RV8A 3EEGA 2Y8VA 1WDSA 1EJSC 1KKRA 5JVLA 1ME9A 1H1YA 2WAGA 4YLWA 3N19B 1NDYA 1OB0A 2FFCA 4WF7A 4JQ9A 3NO5A 3GU9A 3OHIA 3KOYA 2QT3A 4V15A 4FOUA 1UR4A 4EWJA 3RIKA 4GUJA 2FZNA 2GSJA 2HVMA 2V5JA 2QJGA 3S6TA 1LOLA 3I3BA 1T5AA 1AG1O 2PDYA 5TF0A 4HJWA 1A3WA 4DBEA 3R6IA 1OCNA 2XVGA 1B54A 3WH9A 3W74A 4RE4A 1VIZA 3LTPA 3GDTA 1OZMA 4RE0A 4K1GA 1RM6B 1TG7A 3GFZA 2XZ7A 3TQPA 2GLKA 2Z1VA 3WLOA 1B9BA 2PDWA 2W62A 4JFWA 3NSMA 4IG2B 4MWAC 5GQBA 1RK5A 5ABEA 3N6JA 5JBDA 2WPEA 2HZGA 1J6OA 3VDAA 2PP0A 4KPLA 3IAPA 5I6SA 2HMCA 4C5YA 3TLQA 2RDTA 6ALDA 4W9TA 2DT3A 2FGBA 1M68A 1R0MA 5A1AA 3WF2A 1KV8A 1J96A 3TSMA 5G4HC 3ZJ7A 1JPIA 3VUSA 3I3EA 1XYZA 4GWEA 3TZFA 3C8NA 5IM51 3HJZA 4O0KA 3TIMA 3M0HA 3WF1A 4OBRA 2HPMA 1L6SA 3LRLA 1A5LC 4O19A 4MB1A 2QMJA 2Z2UA 1SZGA 2Z2BA 3T78A 3BWWA 1VLWA 4PFHA 1B0IA 1JPKA 3MKCA 5EY5A 3VILA 4XIAA 1JEZA 3WJSA 3LRMA 3P62A 4A21A 1W3IA 1GUVA 2Z1WA 3O07A 1A5KC 3GRTA 1HT6A 2PWDA 2P3EA 3T08A 2XVNA 5AYYA 4R9OA 5L6UA 1YTEA 3N2CA 4GYJA 3EKGA 3VIMA 3MJYA 4DPQA 1PZ1A 2NSOA 4JCMA 3PZOA 4LPCA 4D1JA 2F2KA 1P7TA 3NQAA 3G0SA 3UNDA 2VTFA 1R47A 3GD6A 4XQ6A 3T1GA 5BW6A 2GJXA 4LNCA 4XX6A 3QFAA 3UEQA 4GABA 2R1NA 1S2CA 2VRQA 3RU8X 4UTWA 3FN9A 2I17A 1XDMA 4PE8A 3EPMA 3D47A 3G5EA 2VEFA 1FHVA 1EHAA 1GOIA 3S1GA 1S3TC 3L0NA 5HULA 1Y5WA 4LAOA 3GAYA 3ANVA 1QVBA 3JRKA 2CWXA 3WQWA 3NZGA 2HNHA 4RR4A 2VURA 1H1NA 2OB3A 3MA8A 3DG3A 3NPXA 3E9AA 4WJEA 2A2IA 3W7PA 3FEMA 3OP2A 4K1WA 4P8UA 2HBVA 3W7IA 3CU2A 3ITCA 1W1A1 1D3GA 3VKJA 3VMPA 3VGBA 2GQ9A 1KM4A 3SSJA 1MQQA 3NFUA 3TWBA 1D3HA 5LNWA 4DJDD 4WQ6A 1I2QA 1Q7MA 3AU6A 3G0UA 2WZHA 1P0BA 5E93A 4JTAA 4C6OA 4EPBC 3BK0A 3EBVA 1QPOA 1L2QA 1BSIA 1XKJA 1QPRA 4BQ2A 4BFAA 2XG9A 3PBVA 5EMYA 3MB9A 4CN6A 3K30A 3AS0A 5EMJA 2NUWA 1VPQA 3LZ3A 3LY0A 2TPRA 5D9OA 1SQ7A 3N6QA 1NU5A 1UQZA 2WP5A 3L2MA 3WQVA 2VX7A 1T40A 3KE0A 2D22A 9XIAA 4MB4A 1W1B1 2FJUB 2XTKA 2A5HA 1DIDA 5EMLA 4AF0A 3LPPA 5REQB 1MW3A 3DBNA 4RV8A 1XRSA 2E40A 1SB3B 3PM6A 3M41A 4UTIA 4WSJA 2VXNA 5AYIA 1JDCA 3OHMB 1AD4A 1Q3NA 3FA4A 2DZUA 4UBPC 2QCMA 2WC3A 4XBSA 4AUBA 3DFQA 4DJDC 4ZFMA 2R8WA 1RZMA 1SZEA 4MKVA 1S5NA 4EMWA 1CTNA 5M2FX 1SM9A 1HJUA 1K9TA 2CLHA 1LM1A 1EKOA 1Y5XA 1PCKA 1W91A 4GUGA 1T8XA 2ANUA 4B4FA 2YAUA 4ZQRA 1XD0A 5GRTA 3S9YA 1UP2A 2IPGA 2UY4A 3GW0A 5FS7A 4L56A 4NAFA 2EO7A 4UOJA 4UQBA 2CLIA 3ZSSA 2PA6A 3QFBA 4DRSA 2DQWA 4OKDA 4NAEA 2XINA 1C91A 3GM8A 3T05A 1AW2A 3RR4A 2A6NA 3UBPC 4DUVA 3QPYA 2PPGA 3CZ8A 1P4CA 4AWSA 4TUFA 3F2CA 2I5GA 4L1GA 3CIXA 1E0UA 3KTXA 4M3PA 4GGHA 1ZKQA 1CB2A 4JTTA 3T6CA 1YE6A 2A3HA 4DLFA 2GDVA 2YBTA 4IWWA 3TZNA 2G50A 8XIMA 5EU9A 1W2VA 3QW4B 1OSEA 3ZWSA 4Q6JA 4PUUA 3VKKA 3WJXA 4LRSA 4MLJA 4R7WA 1F61A 1KFEA 1GOWA 4Z1AA 3EB2A 2VGIA 1UD5A 1B3OA 2HE8A 2R94A 3WO8A 3QC0A 4AG0A 3LGDA 1E51A 1EP3A 3A9IA 1VHNA 4U3AA 4LTSA 4Q32A 5CPQA 1ZRQA 2A7NA 1EP2A 2VFGA 2WPCA 4M7TA 1ELSA 4EPDC 3SR6B 3AWNA 4IHCA 3FJ4A 1OG0A 1IEXA 4LUIA 1KLZA 3AYTA 4WDTA 4IQDA 3UWQA 4F2BA 2CHOA 2XPKA 1U5VA 1I1XA 3GXTA 1XUUA 3BMXA 5AKQA 5BMXA 1GERA 3IACA 2ZA3A 1NOWA 3DC8A 9CGTA 5EMMA 1UA7A 2YSWA 1TPEA 1YBQB 3GR7A 4OJYA 4UTMA 4HPGA 2Z00A 2ABAA 4PEKA 3E2SA 1JZ2A 3T09A 3EMZA 4HNOA 4WSKA 3CZGA 4ZOHB 3C2FA 4PMRA 2ODOA 1FCQA 5HWNA 1OCQA 5PTDA 1VJIA 4MUPA 5C2GA 1PKYA 4HOZA 4U4MA 1H49A 2ZUSA 2YXOA 2WC4A 5DT7A 4DJFC 3IJIA 2A7PA 1E9YB 1LPFA 1F05A 4CCCA 1TZ9A 4NEVA 2RKXA 1SR0A 2JIWA 1Q6OA 3SCPA 2ISWA 4YNGA 1VFUA 4IPPA 1MFUA 4J2PA 2BODX 3V36A 5FF0A 1H11A 5G1MA 1F6YA 3NWRA 1L8NA 2DDXA 3U7VA 3DYPA 5A2CA 4UOZA 3SCOA 1G6CA 2CZEA 5C9ZA 4DF1A 5I02A 1QWGA 3MZNA 4ICNA 2QCNA 1TYTA 1U83A 4HMNA 4L4OA 2V3EA 4E8DA 4H9ZA 2F6UA 3CT7A 1JYWA 4JYEA 3QKZA 4DJED 5KEZA 4ERIA 1CT5A 2ZX7A 4V1YA 2WB5A 3OODA 2ZVIA 1DXLA 2VENA 3L67A 3V5FA 1PPIA 3W29A 2XIOA 4IUOA 1ZAHA 3KVKA 3NZPA 4LAMA 1OD0A 5KZ6A 4FR6A 4NILA 3A21A 5D30A 3SUUA 3MUAA 2EPHA 2GR2A 5XIMA 4NZFA 1LORA 3TCSA 5DX7A 2QPXA 5HMEA 3UWYA 2NQJA 4QDPA 1JD7A 2WJFA 1S39A 1WYGA 1W6TA 2KAUC 3NGFA 2FZMA 4U33A 3VOCA 3ECQA 4MFEA 4ERGA 3NDOA 1Z8AA 4IIBA 4NZ3A 3T2PA 3UFYA 1PX4A 2XIBA 2B7QA 4IX2A 5DRCA 3GRIA 4GH3A 2PLCA 1GVOA 3S9IA 1MEHA 4FEZA 2VUYA 1WAWA 4J3ZA 2XIMA 1K9DA 3N4EA 4NNAA 4KEMA 3RYSA 3REQB 3KHDA 3CTTA 4ZQCA 3PNUA 2WSKA 3AHZA 1E3ZA 4RCXA 3TQVA 3LRKA 3WMCA 3H12A 3A9BA 4E8CA 1XM3A 5I3KA 4PTWA 1GCYA 1TV7A 2PDLA 5MKGB 1Z6KA 3C0SA 1ZPTA 3F2DA 4GYKA 4LQ1A 4QEEA 3BGJA 3U4FA 4E6MA 1W9UA 4LYRA 2C19A 3P8IA 3S5NA 2B4GA 1P48A 4Q4SA 3SR7A 4AD2A 3WD2A 3ZVHA 3W7RA 3BQ5A 3ABQA 4K68A 1OADA 3SBFA 1KM5A 2FH6A 2GWNA 3HIJA 1ZUAX 3I65A 2WVVB 4F2TA 4H4QA 1J9YA 4XKYA 1QI4A 3A7RA 2CNCA 1LZOA 2ZC1A 4X0VA 1FP9A 1J4EA 2HK1A 3C3NA 4NKCA 3AYSA 1WNOA 1W5NA 2ZRUA 1UOZA 3MMWA 1B3XA 4UUIA 2D69A 4UTJA 1S7MA 1H5VA 2YZ5A 1BZLA 2P0OA 3NEHA 3VM7A 1FWAC 2J75A 2BWGA 3S8HA 2VGGA 4NXSA 3S1UA 1DXFA 1OF6A 1YHTA 1B2YA 5CC7A 1OFQA 1KXTA 2UY3A 3HFYA 1XBZA 4ZO6A 4HPJA 2DQXA 4LT9A 2HS6A 4Q8QA 1A5AA 1B9ZA 1XLDA 3UYCA 2EJAA 2GQWA 9RUBA 1SVDA 3HU7A 4UFHA 5JH2A 1RP8A 8TIMA 2PAJA 1RP9A 2QCCA 3PNZA 1G69A 1R2RA 4TMBA 3T42A 7A3HA 4EXBA 3PY2A 1FDYA 1H60A 2ISFA 1UZ4A 5IXEA 4OZOA 4QP0A 4ZENA 4O8RA 3QR3A 3OYZA 2WMIB 1MYRA 2FHBA 5H8UA 4QCEA 3TSBA 3D46A 2J7GA 3BH4A 4MUZA 1JUBA 1FRBA 3B9JB 4LY4A 3MANA 3V1PA 1GESA 4PSPA 3O0HA 3FKRA 4OT7A 4R3UA 1W0MA 3AIRA 3QHNA 1CLKA 1FFVC 4A3HA 3ITOA 2QW5A 3N1AA 4MOZA 3NGJA 1QHZA 4HZ7A 1SFTA 4UNKA 3IK4A 4WRHA 3L5MA 2W67A 4KFOA 4L1WA 4GJJA 4FF7A 4PULA 5H8PA 4QTGA 4XIMA 5D38A 5I03A 3CAWA 5I00A 5C0QA 1R8LA 3LHTA 3NVYB 3OIHA 2BGQA 1P6BA 2XUCA 2WHMA 1QNSA 1YDVA 3NQCA 1ODZA 5ABTA 5G5HB 3SCUA 1P43A 4IXXA 3ARSA 4YN5A 3O3RA 4FXSA 3G1RA 3WQCA 3MHGA 3M5ZA 1IIHA 3BW3A 4L9XA 2PDIA 3TTSA 4E5TA 4JFVA 3QPZA 4I8YA 2KZHA 1WP6A 1W5OA 3N13A 1DTNA 4M82A 3PBGA 5A8QA 3C56A 3LSCA 4AB4A 4WKFA 1EP1A 1FBAA 1PTDA 4Y8FA 5FMHA 2A3BA 1F73A 5M5DA 2J7BA 4ZO7A 1FH8A 3VNYA 5I7GA 4DVOA 2PI6A 1E9ZB 4HPHA 1LL6A 2C3DA 1O4UA 1TPDA 3CV6A 2QUUA 3TYZA 4HYRA 4C1KA 3PFMA 2OEJA 2PWHA 1XYCA 4IIEA 2ZE3A 4F4RA 4IP5A 2XSBA 3PZTA 4HJFA 4NEWA 3T0CA 3LLFA 5DCEA 2CFFA 2GJNA 5E5CA 4PRTA 3B05A 3CK5A 5T91A 1RHCA 1J2BA 3QY7A 3KP0A 3GNRA 3TFCA 2Z1BA 1NTHA 2BXYA 1EZWA 5BRBA 3TU9A 2BXVA 2EPLX 5F4XA 1RBOB 3T8LA 2VZSA 1CZ1A 3QMTA 3W22A 4JTSA 4GZ7A 3OGVA 2CLLA 4UTTC 1TVPA 3BGAA 2Z1KA 3O15A 1UD4A 1KM0A 3V5OA 3DKJA 1RBLA 4PMXA 2PBOA 1L8PA 3WUEA 2E68A 1HNYA 2J7CA 1KV5A 5BXRA 3W25A 1I0BA 1TZZA 3WFZA 1TR9A 3M9YA 1CGXA 2XSXA 4Q4KA 3KOFA 2Y6ZA 3CO8A 1KCLA 3DBPA 1ADSA 1FWEC 3GKAA 5CBBA 1UZ1A 1XGZA 2VX4A 2VZUA 3N3TA 2C91A 3W7NA 3CMFA 5L9FA 3R07C 1MMFA 2F5ZA 1HZYA 2WMJA 4UWMA 2QPUA 1CBGA 4DLMA 3EOEA 1PS9A 3IRSA 4AEOA 3R89A 4GIYA 4JGDA 4M1RA 2VD9A 2RFGA 3UZXA 2E09A 3W00A 2VC5A 4E2OA 2WZMA 2WQPA 1YXYA 3CPUA 3W7KA 5HOSA 1S1RA 3QY6A 1JIBA 3GG1A 2Z26A 3FSUA 1N2VA 1W3TA 5U1OA 2FIQA 3RMEA 1GHSA 4E4FA 4NI8A 1K9FA 1OZQA 3W7MA 2Z2AA 3T4CA 1YTKA 3A12A 1AMYA 3Q37A 4HQVA 3BAKA 2Y7GA 3MUZ1 3V7PA 3AS1A 2HCVA 3TNBA 4Q3MA 4YHEA 5CJ5A 3LN3A 2Y24A 2VX6A 2OR2A 4IICA 3AIVA 3E2VA 4GO9A 3LMZA 5A8PA 1K4GA 5DXYA 3EKZA 5I2UA 1W31A 3PB2A 4XTDA 1AFSA 3L12A 3PTQA 2AL2A 1XFCA 2JE8A 1RY8A 1XBYA 4AXKA 2YA1A 4PB4A 2IPFA 2WBGA 5KITA 2CLKA 5BU6A 2X50A 2OU4A 3WNNA 4DNHA 4ZOCA 1JQXA 1IEQA 2ATMA 4RK8A 3LYEA 1SFSA 2DSWA 5E0FA 3H4GA 4B5VA 3NNTA 2WLYA 4JTIA 5FSDC 3GNPA 4D71A 4ALDA 3W75A 1TYPA 3JU2A 4R7OA 5LIKX 5DY3A 1O5RA 3M46A 3G1FA 2BOGX 3P0WA 2BOFX 4C6DA 1XLIA 5JQ9A 2DY3A 4C6CA 1CCWB 2Y0FA 1PXGA 1U30A 3PB0A 4QIUA 1KBBA 3TV8A 4RLIA 3G3DA 5I77A 3ARQA 4A05A 1WCGA 5LHFA 2Y89A 5H91A 2IS7A 3SRDA 4BKNA 3TTOA 3UVAA 1HJQA 5CBJA 3QH2A 1UC5A 3NOYA 1N60C 2DORA 2YCLA 4HOXA 3NZQA 5EFFA 4TMCA 3M5YA 4DZHA 1DJXA 4ML9A 1UWQA 4XKMA 4QQUA 1VH7A 1FH9A 1KFWA 1XCXA 4IM4A 4ZEPA 4Y9PA 1R3VA 1PDZA 3CZKA 3G1XA 1O68A 4V33A 3FXGA 3B97A 1FHUA 3LXBA 4H4TA 3HMCA 2DZPA 2E28A 3WLMA 4HHHA 3R1ZA 4C91A 1GOOA 5G1YA 4A3QA 5M03A 3LPFA 5BXTA 3CGEA 2W9MA 4PYSA 3ZT6A 3GU2A 1PTGA 1KFKA 3D5HA 5A8NA 3N29A 4LEQA 2OZ3A 3S46A 1JJKA 3EDDA 4P7RA 4MLRA 3NVVB 1R3TA 4Z0SA 4IGSA 2VO5A 1MXDA 4Q33A 4RNIA 1SJCA 1H6VA 2EQ7A 3H54A 2POZA 3H24A 2BTMA 3VA8A 5FOOA 2BG5A