3JZUA

Crystal structure of dipeptide epimerase from enterococcus faecalis v583 complexed with mg and dipeptide l-leu-l-tyr
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
353
structure length
353
Chain Sequence
b'MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGEGGPGIFITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKISAFAPAAKAAIDIACYDLMGQKAQLPLYQLLGGYDNQVITDITLGIDEPNVMAQKAVEKVKLGFDTLKIKVGTGIEADIARVKAIREAVGFDIKLRLDANQAWTPKDAVKAIQALADYQIELVEQPVKRRDLEGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAEETTIGITAAAHLAAAQKNITRADLDATFGLETAPVTGGVSLEAKPLLELGEAAGLGIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptide Epimerase
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Enterococcus faecalis v583
molecule tags Isomerase
total genus 124
structure length 353
sequence length 353
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3jzuA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3jzuA01
3T4WA 3R1ZA 3UCCA 2PGWA 3IK4A 4GIRA 2OPJA 2PTZA 2HXTA 5J04A 4YWSA 3UXKA 3JW7A 3KUMA 3P0WA 3MUCA 3QKEA 3BSMA 4H19A 3GC2A 3V5FA 1FHVA 2P88A 2AL2A 3B97A 3OZYA 2XSXA 3PFRA 1EBHA 2OQYA 3VA8A 4KWSA 3DGBA 4DYEA 4MKSA 4G7FA 2PP0A 2PU0A 2PU1A 3V3WA 3QPEA 2HZGA 2AL2B 3D46A 2OVLA 1ONEA 3ES8A 2ONEA 4E6MA 1RVKA 2QJJA 3CT2A 3UGVA 3PK7A 3EKGA 5FJOA 3ENLA 3PWGA 4GGBA 1NELA 3FJ4A 4HPNA 4M0XA 3QLDA 2P8CA 1XPYA 3EEZA 3DG7A 2PSNA 3VCNA 3UJEA 1KKOA 3MQTA 3OP2A 4MMWA 3SN1A 2OKTA 2ZC8A 4FP1A 4ZCWA 3VFCA 4KEMA 4X2PA 3DESA 3ZLFA 7ENLA 1SJDA 3OW1A 3DIPA 1P43A 4HN8A 3DEQA 3SQSA 4DHGA 3DG3A 2PTWA 3THUA 2QGYA 4IT1A 3SBFA 4JHMA 3FYYA 2GGGA 5FJUA 2GSHA 4FI4A 3H12A 4F4RA 4DN1A 3GY1A 4KPLA 3TTEA 3U9IA 4J3ZA 3UJRA 3TWBA 3DDMA 5FJTA 2OO6A 3R25A 3RR1A 1R6WA 2GGIA 4Z17A 1PDZA 1BQGA 3TWAA 3MY9A 4A3RA 4HYRA 3CK5A 3TQPA 1MNSA 4K8GA 2PS2A 1SJAA 5FJPA 3GO2A 1XS2A 3RITA 3MKCA 3FV9A 2FKPA 3T8QA 3S47A 2AKZA 3UJFA 1BKHA 2GGHA 3UXLA 3I6TA 4GISA 4GFIA 3JVAA 4E4FA 3DERA 3QN3A 3ZVIA 3CB3A 3FCPA 2QDEA 4H2HA 3ES7A 5ENLA 2MUCA 3VCCA 4A35A 4M6UA 3RCYA 4IP5A 3R0UA 1F9CA 1JCTA 1TE6A 3RGTA 2XH2A 3NZGA 2OFJA 3D47A 3IJIA 2XH0A 1YEYA 3CYJA 3SJNA 1TZZA 3PWIA 3I4KA 3CXOA 2POZA 2AL1A 4KT2A 1R0MA 4GYPC 3ZLHA 4K2SA 3BOXA 2HXUA 4DWDA 4GMEA 1PDYA 1MDLA 1OEPA 3JZUA 4IHCA 3N4FA 3Q45A 3VC5A 3TW9A 2QJMA 3P3BA 3R0KA 3T6CA 3MZNA 3N6JA 1E9IA 4E4UA 1SJBA 2O56A 3DFHA 4IL0A 3TJ4A 4HCLA 3QTPA 3H70A 1IYXA 2MNRA 1EC8A 3IJLA 4E5TA 3VC6A 2P3ZA 2P0IA 1TKKA 2GGJA 3UJSA 3N4EA 5EU9A 2QDDA 1MRAA 1EC9A 4GYPA 3U4FA 3TOYA 4ZA0A 3Q4DA 2PA6A 3RO6A 4EWJA 3HPFA 1L8PA 3OTRA 4ROPA 1KCZA 2OZ8A 1MUCA 4H1ZA 3FXGA 3H8AA 2XGZA 2GDQA 4JN8A 2PCEA 2PMQA 3NO1A 4E8GA 3UCDA 1W6TA 4GGHA 2XH7A 2PP3A 3NFUA 4JN7A 2QJNA 1EC7A 2I5QA 2PGEA 3H7VA 2DW6A 2CHRA 4H83A 1KD0A 1JPDX 4J1OA 4MGGA 4DXKA 3I6EA 2OX4A 3CAWA 4IP4A 2QQ6A 3UJ2A 1EBGA 3T9PA 2NQLA 2DW7A 4IZGA 1SJCA 4K1WA 3DFYA 4Z1YA 2PP1A 3BJSA 1DTNA 2FYMA 3TJIA 3V5CA 2RDXA 2QVHA 3FVDA 4HCHA 3S5SA 3OZMA 4HCDA 5IDZA 3MSYA 2HNEA 4ENLA 3VDGA 1JPMA 2PPGA 3STPA 4A6GA 2OZ3A 2AKMA 3R10A 1MDRA 3N6HA 3ZVHA 5BOEA 4DX3A 2OZTA 3K1GA 3NXLA 3GD6A 3IJQA 1ELSA 4G8TA 3R11A 2PTYA 2ZADA 2OQHA 3ZVHB 3SSZA 4HNCA 3RRAA 2GGEA 3P93A 2XH4A 1NU5A 3DG6A 1P48A 2OG9A 3V4BA 2PODA 3MWCA 3OPSA 1WUEA 1JDFA 1ECQA 1KKRA 6ENLA 4HNLA 3SN4A 1WUFA 2OLAA 3SN0A 4IL2A 3ZLGA 1FHUA 3TCSA 5FJRA 2PTXA 2GL5A 2P8BA 5BOFA
chains in the Genus database with same CATH superfamily
5TBOA 2ZRWA 4R85A 5D37A 2Z6JA 5FS9A 1SZFA 3P0WA 3LPGA 2DFAA 5D32A 1VHNA 5ABGA 1DQUA 2VEGA 4H19A 1J12A 2CZ5A 3OIXA 3V5FA 4LH8A 1V02A 3LQGA 1HUVA 1UWIA 3FXYA 1C93A 3B9JB 1VIWA 2WQDA 3OZYA 3BJFA 1Q6EA 3QHNA 4JEQA 3W9ZA 3VNIA 1GPWA 3C4UA 2A7RA 3M16A 2O9RA 5BWFA 2ZWYA 1HP5A 5FOOA 2WC4A 2HZGA 4FF5A 1XX1A 3SM0A 3VTRA 4AD2A 3KL5A 3COTA 5FF4A 2GJNA 2YYTA 2XVLA 1V8EA 3NSMA 3PWGA 3R5EA 3MC5A 1RBOB 4O53A 4TV6A 1TELA 3MO7A 1PTAA 3DG7A 1AL7A 1Q45A 4W5ZA 1XQKA 2OKTA 3KBNA 1BWVA 3MCOA 4RX0A 1KBKA 3WF2A 2ESCA 5H2ZA 4H8HA 3ITXA 4K68A 2OWCA 3VDBA 1K9TA 2E3ZA 2GDVA 1B4EA 3L4ZA 1BFNA 4H8UA 1WKDA 1H63A 4W9TA 1LRNA 2ACQA 1DP0A 4GUIA 1G7VA 5HJXA 1XDJA 3EX2A 3N13A 1OQFA 4AZ7A 4U28A 3BPWA 1YXCA 4X2RA 3AISA 5LNWA 2XIIA 4F40A 1VD6A 3WD0A 4KPRA 3V75A 3A21A 1WX0A 5BU9A 2TAAA 4JKMA 4IIEA 2PFHA 3MU7A 1KBIA 4ROQA 2OGJA 2IPFA 1VBHA 2VOTA 2H8XA 4UMBA 1OD0A 1GOXA 4ZOCA 4KETA 3DDMA 4XKMA 1RXOB 4IP7A 2B7QA 3VNJA 1SO3A 2V2CA 3PUOA 4GFSA 3RO8A 1NHQA 1KRCC 3MMDA 2ZRUA 3LADA 1N7KA 2W0UA 1DJQA 4A3RA 3FJ6A 1MO9A 4ZOAA 1CBGA 1OG6A 3RITA 4OOUA 1E0UA 2WJZA 3TZNA 2QR6A 4UTTC 1BD0A 2XFWA 2D2OA 1Z32X 4S3DA 2JBMA 4Y2WA 3ARUA 3Q94A 3MBFA 2RGMA 3STCA 1IR1A 1TWSA 2OQLA 1JEZA 3RDKA 1KFJA 4JL2A 4S2CA 5IBXA 2ANUA 4V27A 1DOSA 1BYCA 3GZ3A 3L12A 1H4PA 2C0HA 3NZGA 3HV9A 3T09A 3KWSA 2V9DA 2G3MA 1E0TA 1YNPA 4H4WA 2ZZCA 1GONA 1CLVA 2AGKA 1R3RA 3NYZA 1C8VA 2X7VA 2G5WA 3WDRA 1TJ0A 5G2HA 3TNOA 4KT2A 1DQWA 4IPPA 1ME8A 2EQ8A 2I14A 1KV8A 1GW9A 3ARQA 3T40A 1UIOA 4IMFA 5DX7A 5E0FA 1WZAA 3DFSA 5CC7A 2Z28A 3L5MA 1GRBA 5ABHA 1D3HA 1DYSA 3VNZA 4LC8A 3O05A 4HSOA 1EWDA 4IIGA 3GDMA 4HB7A 1YTKA 3AJXA 1U5JA 3M0VA 3PTQA 5DRCA 5C8BB 2FGZA 3S9ZA 2MNRA 1M68A 3VIOA 4GIYA 3V1HA 2VWSA 4PB3A 1W3LA 2V5KA 2EBNA 5LGZA 3IRSA 5I02A 4QCEA 1HJWA 1PKNA 1MRAA 2V38A 1CXIA 4JCMA 1JNDA 5E0CA 3SRDA 3IANA 3TTQA 3VPLA 3DH7A 3GB6A 4EKJA 3HQPA 3VIKA 4HVXA 2XHYA 1YDOA 1XLMA 5B80A 4YIWA 3MPGA 3OTRA 4HT3A 3R8RA 4QNWA 3QQWA 5FL0A 3WK1A 3VILA 3UNTA 4DJDC 4BWLC 1OX5A 3UVAA 3WH9A 1UWAA 4QCFA 1P0DA 1E6ZA 5CG7A 2VRJA 4LY4A 3NFUA 2NT1A 4U33A 1JCNA 4LB3A 3SCSA 4WGHA 2BWGA 4JICA 4NU7A 3W38A 3DYPA 3OLGA 1KA9F 4ADTA 1UH2A 3H2AA 4B5NA 2E5AA 2P3EA 4IP4A 3W1MA 1RJPA 4HOWA 3PJWA 1IIHA 3NO5A 4H6QA 2YAUA 4IPLA 3N1AA 1S2UA 2OOGA 1TO3A 3PBYA 3FN9A 3L65A 4GY0A 4OUEA 1FTXA 4UZUA 1WDPA 3B04A 2Y7GA 4WSHA 1YPFA 3RJXA 5AYYA 5BNKA 2PDQA 4BURA 3H54A 5JVLA 2QVNA 3M0YA 5ECUA 3M0JA 3STPA 2PRMA 2Z7KA 1DWHM 1H7WA 1KM2A 3TCEA 3CZJA 4MY9A 1X1OA 1Q6QA 3WK2A 2GQ8A 1LJYA 5LYRA 1AW1A 4H7ZA 4PZVA 3QZEA 1H11A 1FWEC 3PPCA 1IV8A 4CU7A 3DECA 3CGBA 5D8ZA 1XINA 3CAKA 1ZMCA 2FZNA 2GJLA 3CTLA 3ORWA 3W70A 2NSOA 1GREA 1VF8A 2ZKMX 4NZCA 3K4WA 1W3IA 3DFOA 2V63A 3NAVA 3ZOAA 3V7PA 5HR7A 3LGGA 2X05A 3AZRA 4JYDA 1WUEA 3W1NA 1JULA 1ECQA 1XXXA 1X97A 4Q8VA 1OSEA 2EXOA 4RW3A 3NUKA 1XLFA 5BOFA 4M5PA 4HBKA 2C91A 1PS9A 5F4SA 2VFIA 4MKVA 4QISA 3VIPA 1KNWA 3CZGA 1X6UA 4LY8A 4YVXA 1HNYA 2CBVA 2UY3A 4MJ4A 4KFNA 1MEWA 4R27A 3IACA 4NYUA 5C70A 1LOQA 3CGTA 3ONBA 2CKRA 4NNAA 2B4GA 3PUGA 4H4IA 4RJEA 4GC4A 3TIMA 3FVMA 5I09A 4GWEA 3WMBA 5L9FA 4KWSA 1HKKA 1HL9A 4JTFA 1SM9A 3V3WA 3QPEA 3UY7A 3AZTA 4HA4A 2NXIA 1GERA 5G5IA 3PTMA 1DNCA 4J56A 1K3UA 1MMFA 4I9AA 1J6OA 3BURA 2JIEA 3BH4A 4XZNX 1PTGA 1EPXA 2V0TA 2F6UA 5E70A 4A3HA 1F8MA 3HU7A 1ZL1A 2QCLA 3N6QA 1Y0EA 1Q1WA 4Q4RA 4J3UA 1OGBA 2XSAA 1UD5A 4JIEA 2ZTKA 2TMDA 1R3SA 3CHFA 3FHQA 3GH5A 1CYGA 3TVAA 1Y65A 1IWBA 2J6VA 4EPKA 3LGEA 4UCFA 3VFCA 2OO0A 3A64A 3WJSA 2VD8A 2X8GA 3NVVB 2R91A 2TYSA 3S3GA 3AUJA 1A53A 5AHIA 1JUBA 4QR6A 4MNJA 1WAWA 3WMSA 2XZ7A 3A4XA 5H8MA 4C6NA 3H22A 2WO5A 4BI6A 1US3A 4O1AA 1J0IA 5AVHA 3U2CA 4CQDA 1OX4A 2VZOA 4XX6A 3Q2DA 4G7EA 4JDYA 1V4YA 2H6RA 4GO8A 5A6TC 2GFTA 3CHCA 3SGZA 4AQLA 4YYFA 2ZX8A 4RE2A 1F3TA 3CLMA 1T99A 1ZENA 3M1ZA 2ZA2A 5XIAA 3HG2A 1OC6A 1UMYA 3TQPA 2PWEA 1HO4A 3O6DA 3PC0A 3TNBA 4W84A 3VGHA 4QX4A 2V5DA 3CGDA 4S3GA 1M9HA 3G1FA 3BDKA 2D2GA 3B05A 3W73A 5HWNA 4HMEA 3UY8A 3A3XA 1Z7AA 2Q6ZA 3WNLA 4C6KA 1GVQA 4GFIA 1GV4A 1KGXA 2QCFA 2OLSA 3F1QA 2CYGA 1SPQA 2VZUA 1XIGA 4BQ3A 1PWLA 2WPBA 3UPMA 2PDFA 3GTFA 4JDBA 2VDIA 1EYWA 3PNUA 3WLRA 2Z4GA 4A35A 4JYFA 3R0UA 3UR5A 1OY0A 1XRFA 1YNYA 4IX2A 1R38A 4JHZA 3CT7A 3GFYA 4LAKA 1TJ1A 4FX9A 5AYXA 1E72M 1FEBA 2PTDA 5EKYA 1JFHA 4PSPA 5D03A 1EPVA 1MW3A 2BNJA 3M64A 3W01A 4MLRA 4K2SA 2ZCGA 2BG5A 4GMEA 4ILSA 4XB3A 5LGXA 5C54A 2QIWA 2ZX7A 2PF0A 2W27A 2B7PA 1VQZA 4MSSA 1IXNA 1O95A 3MSGA 3FEQA 5D2WA 1O5XA 2FZ8A 1MUWA 1E4NA 3UNDA 4O19A 3QFEA 4GZ7A 1TREA 2QV4A 4QAWA 1BGAA 1OG0A 3E2SA 3GDKA 3LI0A 2HBVA 2EKCA 1FFUC 3S5OA 1D7KA 4ZSUA 3E12A 1KWKA 1N62C 3CB8A 4IGNA 3WBXA 2XM2A 3BL3A 3UJSA 4ML4A 4KGJA 5AYBA 1HX0A 1SMDA 1SSDA 3K4AA 1KBJA 3AS3A 2OEMA 2FH8A 4HYWA 4Z2JA 3LOTA 2FB2A 2ZUVA 4ZA0A 1XC6A 5CJ5A 4PCTA 2CEQA 2PCQA 5KZ6A 1QNVA 4ROPA 3FFSA 3BARA 1F6KA 5DBTA 1JRPA 2D0FA 2INEA 1TX2A 4MHBA 6ALDA 5FAJA 1WBJA 1X7IA 2Y4SA 3HFYA 3UVIA 2Z25A 3A22A 2HSAA 3VX0A 4HPXA 3WELA 1LYXA 3PUEA 2O7SA 1UR8A 2FB3A 2Q01A 1FWAC 5G2IA 4ZO8A 3UWWA 4C6LA 3LG3A 4J35A 3TQVA 4FNQA 2VURA 1S5MA 1CCWB 4J2PA 3V5OA 3M41A 3TZFA 3TTOA 1GRGA 4UQ9A 3HG4A 5C5YA 3IIXA 2ZUTA 3UXIA 1WE5A 3C3UA 3EXRA 5T9CE 1WV2A 2QF7A 3G1HA 5BRQA 4ATWA 2IQ0A 5FEPA 4IICA 5DXXA 1KXTA 2QCNA 4QLKA 4GXPA 1PIIA 3GXMA 2O9PA 2ABAA 5DMMA 3UWVA 3VNMA 3WUBA 3W87A 1UR2A 1H7NA 1I2QA 3F5JA 5IDZA 1G69A 2GR3A 1MOKA 5AN7A 4JY8A 3DKJA 4W93A 2Y6ZA 1EZWA 3QXBA 2PDGA 2VFEA 1RK6A 4LAZA 3II1A 1W5QA 3IUHA 2OYMA 4H4TA 1ELSA 2XN2A 1UWQA 1OABA 2AAQA 3PY2A 3R11A 3BLLA 2CERA 2WBAA 3BE7A 1V3MA 3AIQA 2J9YA 2O7QA 4I6KA 4ZQNA 2FMOA 4TTUA 1T0OA 2HVNA 1WOAA 4LC6A 4FXFA 3TSBA 2PODA 3MWCA 5FD0A 4CD8A 4AY7A 4S38A 1AVAA 2R14A 5CQ1A 4Q4MA 1MUMA 3L5OA 1TWDA 2FZ9A 3C86A 1VLIA 2OLAA 2WVVA 4L6OA 7REQA 1VP5A 4GABA 4CNUA 3DUGA 3NQCA 2Z26A 2C1GA 4RZ5A 3AS0A 3CQKA 2GVJA 2FDSA 2C6QA 2NX3A 1AH4A 2PTZA 1YE6A 3ARYA 1JR1A 3KUMA 4BI5A 3S6DA 3ABXA 4CNOA 4OBRA 5A6BA 2FJUB 4WDUA 4DBEA 1CXLA 1QW9A 3MYPA 2XSXA 3P84A 4PMDA 1L6YA 3PZMA 1EJSC 4DJEC 3IVSA 2UY5A 4GXWA 3LHTA 1IE7C 4GH3A 3VGEA 4Z1DA 3GG0A 2Q3OA 1RLDA 3M5YA 2P1FA 3K30A 4H2CA 3S42A 4LVAA 4X0VA 2LLEA 3WH5A 3ALFA 1HGWA 1P0EA 2X1UA 3GHSA 3WD1A 2FTPA 3KAOA 2QUMA 4QITA 1JROA 4LSBA 2GVYA 2YBUA 1M41A 1OYAA 3CUIA 5K2ZA 4E2OA 4FP1A 3KDOA 4FLRA 2XIBA 3MWAA 3MUZ1 5AECA 1P7TB 4LF2A 3THQA 6REQB 1SJDA 1M7PA 1H09A 2DQWA 3DIPA 4NKCA 2HE8A 3E38A 3NQ6A 1B3OA 2CCRA 3WLTA 4UIOA 2VX5A 2DQXA 2R94A 4ORIA 5FF0A 4OFCA 1PO9A 2YIHA 3N2OA 3MI2A 3THUA 5CGTA 1W5MA 3B3DA 4UTWA 4AEEA 5FJUA 1PBGA 1GKRA 4FMVA 3IAPA 2E1WA 2IPGA 4QE4A 4D6IA 1J2WA 4F2UA 5F1UA 2C19A 2VGBA 1OFQA 3EB4A 1T41A 1FCQA 1WBHA 4NZ5A 2BBFA 5SWUA 1UUOA 3UJRA 3VD9A 1RM6B 3VOIA 1LWHA 2CLPA 4MNKA 1PCWA 3BW4A 1XLDA 3SEPA 5BROA 3UXAA 3G3DA 1IT7A 1HJQA 1T40A 4Q6JA 1NQ6A 2ALRA 1GT8A 3W7PA 4OGZA 3NL2A 2DIJA 3FV9A 1VBGA 4REQB 1FHLA 3CQ0A 3QV9A 4NI3A 3AIBA 4MB1A 1QPKA 2J47A 2G3IA 2QT3A 1R9YA 4HD5A 5TF0A 5D8WA 4JTCA 4D1IA 2PDYA 3O0KA 1OCQA 3DBNA 2WP5A 1LRTA 3UYCA 1C3FA 2PDUA 2IUZA 2EEXA 1W31A 1YXYA 3VNLA 4ZQCA 3AWNA 4G56A 2VYOA 1VCGA 1YRRA 3PM6A 1JVNA 1NHPA 1HJXA 5BYWA 4BF5A 5M1TA 3W7IA 3GNRA 4NYYA 4GY1A 5A8QA 1WDWA 3WLNA 5A6LA 1FDJA 3AYTA 5LA2A 2E4TA 1LT8A 4R7JA 1ISZA 3LRKA 3VUPA 1E15A 4AZ5A 2Z1KA 4O1BA 5E1QA 2A3CA 4NVTA 3N4FA 1M04A 2VO5A 3TA6A 2QJMA 3WL0A 4KCTA 3PAOA 3T6CA 4RDWA 3WEZA 3XINA 1DXLA 1KM1A 3NURA 1S7MA 1H1YA 2R9ZA 2O56A 3DFHA 3N2MA 1GSNA 1EA0A 2VX4A 4ZFMA 2E25A 4UOZA 4GD0A 5DO8A 1E40A 5BCAA 1W1TA 1R3TA 4QIUA 3UEQA 4BQ2A 1NDWA 1XSJA 1GJPA 2DT3A 3G3MA 4TQTA 5FACA 1H49A 2QJGA 5E5CA 4DUWA 5I3GA 1ZDLA 2GZXA 3PZUA 2O9OA 3GHTA 3UWUA 2VQUA 5FS8A 2FFCA 2OZ8A 1Q13A 5G4WA 4C1LA 4JQ2A 2RHGA 4O1DA 4MB3A 3AYRA 2WVTA 1RALA 4YVPA 4NRSA 1VJZA 1PX3A 1G01A 4QJ3B 3VE9A 3LCGA 5EA9A 3IRDA 1Q63A 4BEUA 2XGBA 3WJWA 1V03A 4PEKA 4DO7A 1ZJHA 2NXHA 2XINA 3UGRA 3VINA 1AODA 5EFDA 4S3CA 2GYIA 2C3ZA 5I00A 3APTA 3VIJA 3WLLA 3PWAA 3KDNA 1A5NC 1P6WA 1HN1A 1S46A 3T9PA 2HWGA 3I10A 3DFYA 4O0ZA 4P7QA 1XJBA 2A3BA 4OQVA 4H00A 3L8KA 1PB0A 4LCRA 4ZB5A 4MTVA 1NF7A 3GLCA 4RXGA 4H9ZA 3K2GA 1DHKA 1GRFA 2OZ3A 5I0DA 3LLDA 3PTDA 3QSTA 4HOXA 3GR8A 3M47A 5I23A 4MJ2A 3A47A 4CU8A 2CBJA 4EP8C 2YL8A 3PB2A 4FIQA 2Z27A 1MW0A 2FQIA 4LGXA 4GUFA 1FWCC 3A24A 2PWGA 2Y5SA 2WMJA 3KHJA 1VDVA 2CLMA 1GKQA 1QI2A 4JD4A 2VI0A 1ZSXA 5A2CA 2Y2WA 1R2RA 4IFRA 3TYAA 1W1YA 4Q33A 1EJRC 5JBFA 4UZSA 3BLDA 4LALA 4JN6A 1QBBA 3S2CA 5GNYA 3ZWSA 1UZHA 1N8IA 3WCZA 2PZ0A 1EJTC 4NNCA 5LNVA 2JGYA 4WGXA 3UCCA 2OPJA 4GVFA 1VFUA 1BVWA 3GTXA 5K3VA 2ZOXA 5FEWA 1B30A 2QCCA 2GJPA 3BV4A 3ICJA 3KZPA 3I3BA 1DWGM 3QLLA 3GBDA 1HKJA 3AHXA 4KCVA 4GACA 2A5HA 2INFA 3WQEA 3WQOA 3WLKX 4HU8A 1J2BA 3UG8A 1RA0A 4FF7A 1NY1A 1T6MA 4W4QA 4N2YA 1GQIA 3BUVA 1P6CA 1P0NA 1BPLB 3VNKA 5BRBA 4INFA 3DN5A 2J78A 4CD6A 4YTQA 2ONEA 1E3XA 2VKZG 4JFWA 1RVKA 3GIPA 4B9YA 5C9WA 4LJ3A 1VFHA 3SQMA 3KS5A 3I4EA 4WQ6A 3WBWA 3VZXA 4EK7A 3U3HA 3VNDA 4LRSA 1R3YA 2NLIA 3NL6A 2DEPA 1F5ZA 1LROA 4C1KA 3C5QA 1S39A 4FOJA 1QNOA 4JTAA 3DESA 3IGXA 1K8XA 3C0LA 3RX3A 3WLHA 3SY8A 4B91A 2NVKX 4J5NA 4FHAA 2IKJA 4K1GA 4XTDA 3ZFHA 1OF8A 5CGMA 5CAKA 2EPKX 5IRPA 3P5ZA 1JQXA 2J74A 1KBLA 3FYYA 5LXXA 1G94A 4Z0JA 2JK2A 4K8HA 4QBXA 3PSWA 4DBDA 4KPLA 4UFJA 1U1HA 1ZBKA 1KR1A 2IKGA 2UV8G 2W4XA 5AC4A 3LZ3A 3EYPA 4TX9A 1STZA 2WNZA 3AM9A 1G6CA 2J7FA 1EDTA 3LI1A 1CGWA 2WOQA 1QI5A 4FXJA 3RR1A 1R6WA 2FH6A 1XWYA 4Z17A 5HWJA 2Z2BA 4IFKB 3Q37A 4AHQA 4GQRA 3LM7A 3RU8X 2CXGA 5H6HA 2QIIA 4PMRA 1MSSA 1JCMP 2YW3A 1JIBA 2FGLA 3LRMA 4O8AA 1VGAA 2CPUA 4D6HA 4JQ1A 4ICMA 2REQB 1WYGA 2WZIA 1FWSA 1REQA 4FK9A 3JVAA 4RE3A 4X0NA 3LCLA 5HAOA 4C6CA 1K9EA 4NI8A 1TA3A 3PFMA 3WNMA 3AROA 3B9DA 3IS4A 3PANA 4MZYA 4F0RA 3W7HA 1EX5A 4C90A 4L56A 3HGOA 1Q6FA 1RCOB 2TODA 4O50A 4P5UA 2VRKA 3WBYA 4WF7A 1MXDA 1YEYA 4YPJA 4A21A 3N04A 3VU2A 2F6KA 4W86A 1IF2A 3I4KA 4XD4A 4UTFA 1WAUA 2AL1A 3PJUA 3W6MA 1EHNA 4O14A 3HB9A 1TJPA 2QHAA 1JDAA 5FJJA 5HDRA 2WHJA 4CVWA 4RE0A 4YS1A 2XSBA 3WDHA 3DC0A 3W84A 2EPOA 3V0SA 3GM8A 3L0NA 1HKWA 4C7DA 1FRBA 2BXYA 4O54A 1E51A 1UP0A 3DI0A 4F2BA 4IL0A 1WDRA 2YDQA 4JL1A 3GTIA 1VCVA 4GR1A 3EXSA 5AHMA 3M0IA 2HVMA 3VKDA 5DF0A 3PPFA 1FCBA 1UR4A 1US2A 3N4EA 1Q1RA 1SYTA 5FL1A 3H55A 5EMUA 1A49A 1QW7A 1KCXA 1K8YA 1AH0A 1B2YA 2QAPA 4PR4A 3MT1A 8CGTA 4KS0A 1J18A 4LVFA 1KFBA 1GZ1A 1GEHA 2AMGA 1W9BM 2I7GA 5E6ZA 3GUGA 2NVCA 2PLKA 3B8SA 1RD6A 4DO4A 4UR7A 1IGSA 3QRHA 3GAKA 3N2BA 3OVPA 3MDWA 4DZHA 3H7VA 2TSYA 2J75A 1L6WA 3E0WA 1M01A 1DPMA 3MP5A 3CPGA 4XV0A 2C1IA 1FH7A 3NSXA 4F79A 4N9EA 1Q8JA 2CHNA 4O13A 5HA7A 3F2CA 1W8SA 4GRSA 2GJRA 3AS1A 4A2SA 4AVOA 2OZ0A 2WNQA 2BOGX 3E02A 1ENUA 3VM5A 4IPNB 1TPEA 5IHRA 3MS8A 3U2EA 3E0IA 2W79A 3SIMA 3G5EA 4Y9NA 3TYDA 5FS6A 1RK5A 2JFEX 3MSYA 4OE7A 1KM0A 5I7GA 2OT1A 4ASTA 1VJIA 3OHMB 1B3ZA 2EG8A 3CAVA 3TMLA 4I90A 4AC7C 3WLQA 4S39A 3GQYA 1QPNA 3I6RA 4BF7A 4DX3A 4WR3A 1LUCB 1IQ8A 1BEUA 1FIQB 3OZPA 3OYXA 1V3LA 1LQAA 3T44A 3N12A 3VZZA 1TYTA 1I75A 4DB7A 1XF0A 2QNEA 3KVLA 1HJUA 4IIBA 4M81A 3NSNA 4UBPC 4V33A 4KIEA 3BCDA 3QOKA 2OSYA 1GPFA 5BOOA 3CPRA 4M7SA 6ENLA 1UKOA 3TYEA 3SN0A 4AX7A 2W92A 1FCUA 3PBMA 1SW7A 3BLPX 4B15A 1ZAHA 1IT8A 4WCJA 5T91A 4HPGA 3MV11 4B5WA 4TV5A 1BYDA 4XIAA 1UR3M 4EAMA 5J04A 1TPC1 1YQ2A 3UXKA 3RCNA 1AD4A 4B5UA 1KM5A 2WBGA 5G1MA 1GYLA 3GW0A 2C18A 5CJMA 4LUTA 3EZ4A 1HW6A 3C2RA 1ZJAA 3T2OA 4HZMA 4HJWA 2ZUMA 3DGBA 1X98A 4MKSA 3R43A 1J0YA 2PU0A 3MUXA 4IMGA 4GXMA 2FGBA 1CT5A 4FS9A 3W27A 2OELA 5I3HA 1RSCA 1JQVA 1UD6A 3ITCA 3URHA 1JAEA 1I9CB 3H4KA 3ES8A 1X96A 1YPIA 2QDGA 4C7GA 1MFUA 4AHOA 2O0TA 2VEKA 4AW7A 3W1UA 4XVEA 3LTPA 1UH3A 1MXGA 3PK7A 4US5A 2RAGA 3PHAA 3BAYA 4IUOA 2PWDA 4XAFA 2GH5A 4C60A 3CGCA 1XLBA 3DAQA 1TQJA 2HS8A 4UTHA 5DY3A 2VL4A 5AHEA 3QZAA 1RQHA 3T0AA 3NQGA 5I5RA 3CHVA 1FKWA 1QK2A 4ZO6A 4DUXA 3E2RA 1W2VA 4XK2A 1Q4NX 5CLTA 3TN6A 3WBAA 4S3EA 4Q4KA 4J57A 5LHEA 3I68A 2WLYA 3ATYA 1GOOA 4ZQPA 4JHMA 1CB2A 1A5BA 1S5WA 3LN3A 3EWDA 4D6CA 4CNNA 3VD7A 4QJ4B 4BKNA 3TTEA 1RZMA 1HL2A 2EGZA 4UTJA 5AYIA 3VYLA 3FX4A 4H4QA 1FH9A 2E9LA 3F7JA 3OLDA 9XIMA 1R85A 2HNHA 4A2RA 2BGNE 4NXSA 1GQLA 3U5YA 1MVYA 4NF7A 4R3UA 3USBA 3HRDC 2RUSA 1OD8A 4YTSA 1SMAA 2EPHA 3LXDA 2WW5A 3WN6A 4M56A 1H1ZA 2RKXA 1LF1A 3G1SA 5G1TA 3NZRA 3RRXA 3V35A 1ITUA 2AKZA 5F2MA 4GBDA 2WKLA 4M29A 4WHBA 2G97A 3HZ3A 2YOCA 5FMHA 1BKHA 3LHWA 1F8IA 3NEVA 3QPZA 4LNCA 4B2DA 4MPKA 4WUIA 1JCXA 1O5QA 1Q7QA 3CEPA 4RR4A 2Q3RA 4JTUA 1NJJA 4FDCB 5FCZA 2FVLA 1EJWC 3O7UA 3RMEA 4UFIA 3TAOA 5A8NA 4MAVA 4NX0A 2QV5A 4EQSA 2J8GA 1AQ0A 3GVQA 4F2TA 4ZL1A 1SO6A 4O15A 1GVYA 2WMKA 3PZTA 4V2XA 2E28A 1UKSA 3CQHA 5FI8A 3JR2A 2BHYA 4U5KA 3NIYA 2D3NA 3SJNA 3NM3A 3T1GA 4KGLA 1HFBA 4GJJA 2HCVA 1BRLA 2ZVRA 4AEFA 2P53A 2HXUA 3CIWA 4DWDA 4H6RA 3P81A 1EO5A 2C14A 1U22A 5DN1A 3QKZA 3NQMA 1JNEA 3KOFA 1NWRA 4XG1A 1AK5A 1E9IA 1RAKA 3LV6A 1DIOA 1Z42A 4C1NB 3N2XA 1XC4A 3QMTA 4Q4SA 3TP4A 3M0MA 4PGLA 2XISA 4Y9AA 2ICSA 3VIMA 2PDMA 1V6UA 3GTNA 3PBVA 1PZ2A 3MMTA 1E70M 4E5TA 2YA1A 1I4NA 1MQPA 3A3HA 4BCEA 5K4XA 1J6PA 1JCLA 4K38A 3QGAC 3WJYA 1ZCOA 4J27A 3S2LA 4MYXA 4JX6A 4XQ6A 4LUSB 2QAEA 3TOYA 1KXQA 3C52A 4YCOA 4UTIA 1GVIA 4OJYA 2OJPA 1DBTA 2XPKA 4ERAA 1V6VA 4C6DA 2X0SA 1F6YA 1BF2A 4ZVJA 4Y90A 3DK4A 4WY0A 3CH9A 1X2HA 1UQYA 1R30A 3QR0A 3ARSA 1EGVA 3WFAA 1JYXA 1W3NA 5D2XA 4PTMA 3FJNA 5KINA 4RUBA 3VOGA 1KRMA 3D3AA 1ZCCA 3PZNA 4Y8FA 3AYSA 1AD1A 4G2DA 4PCNA 3FK4A 1UASA 3M7WA 3HMCA 2NV2A 2X99A 1XLCA 4HMDA 4OT7A 4J1OA 2YB1A 3TR9A 3R6IA 4DXKA 4B16A 4IPIA 1ZK7A 2E77A 3CYVA 5M03A 2VX6A 2YW4A 3FGCA 4MM1A 3MYOA 1UA7A 2YGYA 3NS1B 3EWUA 2QPUA 3KTXA 1KN0A 4NSBA 2VUYA 3PULA 1W9DM 2WMIA 4K1WA 3EOSA 3WLMA 1UPPA 2XVKA 2DY3A 1UBPC 2OCZA 3PZVA 4I9TA 3DGZA 3BQ6A 3RPDA 2JALA 3KP1A 1EDQA 1RPXA 3PBWA 3STEA 2NW0A 1TCMA 2UZ9A 2GR0A 3MUAA 1O1ZA 4KWVA 2D2JA 3SCRA 4NG3A 3SGGA 4X60A 3VOFA 1NHRA 1AJ2A 1CECA 1JZ7A 1HG3A 3IV8A 2VC7A 4TVUA 3SY5A 1XSIA 1XKJA 2YLLA 5JXQA 4JBRA 5CH9A 3G0SA 3REQA 4AAJA 4AUBA 3T07A 1NIUA 1GQKA 3LPPA 2ACUA 3T4CA 2OYKA 2WPCA 3W7CA 4ZOEA 4ZMGA 3LNPA 4C6PA 1VC4A 2GK1A 3T0DA 2ZFAA 3HJEA 4LTSA 3R8HA 4IGSA 4UQEA 5LIYX 2G96A 2WM0A 1JGMA 2W6RA 3DG6A 4QJ5B 1AQMA 3IPWA 1EF2A 4GQ0A 4NHVA 4KBXA 3PPGA 3E5PA 3EAUA 1J10A 1X8FA 1ZBVA 1U33A 3TLQA 4AZCA 3AXHA 2O4MA 5I3IA 2R1KA 1EQCA 4IL2A 3QQ0A 3A4WA 1V3IA 4OWGA 1SZEA 2F6XA 4L5ZA 1VYSX 1IXPA 2PGWA 2WHMA 1NWSA 1A4MA 1I2PA 3FA5A 4YWSA 5J8LA 4ZFCA 1JCYA 2X2GA 4C6BA 2BY0A 4GUHA 1C90A 3MUCA 3QKEA 5IXEA 2NWSA 4WVXA 3MA8A 4F9DA 5CZSA 3GC2A 2NVDA 2DUXA 3NVTA 1B9ZA 5H1WA 3NPUA 2Y63A 1X38A 4GYKA 1UUMA 4ZZ9A 1R87A 1EBHA 3GDBA 3CIXA 3AQUA 1NOFA 1EJUC 3AMZA 2E9BA 3TC7A 4MKNA 1KC7A 4UB9A 3WEMA 7A3HA 3CJPA 1Q2SA 3BGJA 1VBRA 2V6AA 4XAPA 2QJJA 4FNPA 3CZKA 4ICNA 4J3SA 4KERA 2X0YA 4JKLA 4CN1A 3T0BA 5CCZA 3M46A 4AMCA 5I79A 4AIOA 2VCCA 1P6BA 4H4VA 1E9LA 3S2NA 3PZGA 2PSNA 3ECQA 1QFEA 2YSWA 1JPHA 1J93A 4LRTA 1A0EA 1JUEA 3WLJA 2WC3A 2D0HA 3RM8A 4KEMA 1QWKA 4G6CA 2ABBA 3CC1A 1ZBCA 4LBSA 1UC4A 3C8FA 4IMEA 3VK5A 1VENA 1VZWA 3W1XA 3OVQA 4IT1A 5EMYA 3TFXA 4XAZA 1C7TA 3C2FA 4LXFA 1DJYA 1TJ2A 1S2AA 1XPGA 2DV0A 4AWEA 2VEPA 4QG9A 3W7MA 1E43A 1F2JA 4YWOA 5F7UA 1XIBA 1DE5A 5LIUX 1N8WA 1XG3A 2WK2A 3EOOA 3L2LA 1F7BA 1ODUA 3DGHA 1QU4A 2F38A 3GR4A 1OWQA 1DORA 3WQVA 4AD1A 3WJXA 4EACA 1IZCA 5CPLA 3PP7A 4JTQA 4KWOA 1KQZA 1WB0A 3FDGA 4LB4A 5JCIA 1NDAA 3H21A 3TN5A 2VUNA 4YTTA 1XS2A 2A6LA 1VFTA 1FUYA 1KFWA 1KFEA 1F6PA 3UCQA 3M0HA 5CZ0A 3ARWA 4B5TA 1SW3A 1Z44A 1NHSA 1CEOA 1L6FA 3GSMA 2QYGA 4WDXA 3ZVIA 3B4UA 2DZSA 4KCWA 3UZWA 2C13A 3K5XA 2WHKA 4H2HA 4LEQA 1VCFA 4GQBA 1OYCA 3O0FA 1VPQA 3GYCA 1FHDA 4UTWC 2CBUA 4D6FA 3G1DA 1A5SA 3RGTA 3ZR4A 2ALDA 3RU6A 1YTEA 2Z2UA 3TXZA 3IJIA 3PSVA 5FSEC 3CEUA 1S2WA 1V3JA 1QPQA 5C7HA 2W3ZA 2ZRYA 5FA5A 4YTRA 1UWSA 1E5JA 1GQNA 5EB8A 3HQNA 4OIFA 2GUUA 4A8RA 1PYFA 4AIBA 4P61A 1D2KA 3PJXA 4UXDA 5HXMA 5DANA 1NTHA 1XIHA 1E1CB 4FPSA 2C8NA 3KBSA 2WKGA 2D73A 4WDTA 3N6JA 2XTKA 2WHLA 4DJFA 3OVGA 2J7DA 1H2JA 5GNZA 4AISA 2VVNA 2PDXA 1FX6A 3W76A 2BXVA 1JZ5A 1SU5A 3D9XA 4M3PA 3OGRA 2HTMA 4G7EB 4R53A 2ACSA 2RDTA 3AMGA 1W5OA 3G1YA 1ITQA 1ME9A 3RLVA 1LQ2A 4ERGA 2VC5A 3WUGA 3VOCA 5CPTA 2F8QA 3GK0A 4GLEA 3GRIA 3QGKC 4KESA 3T2PA 1IEWA 1M03A 3UP8A 1N63C 2HK0A 4CEXC 3S5ZA 2YL5A 3TK7A 3AHVA 4JN8A 3U48A 3TLLA 3GH7A 1S2VA 3ZMRA 4F0MA 4RW5A 5G4HC 3WDJA 5CPSA 3VKAA 2FVKA 2BVTA 2ZQ0A 1K6WA 4DQWA 4JPGA 1EP1A 4JTTA 4LBRA 4IQJA 4PUEA 1AUSL 3R12A 4LV4A 2Y5EA 1UHVA 4NZ3A 4ZO9A 1JPDX 5A8PA 1W9UA 4IPJA 2PGRA 4AVFA 3O6CA 1X7FA 1UKQA 5FEXA 4OTKA 4L61A 4O0QA 2GUBA 4HNTA 2OX4A 3C56A 3W2LA 2GQ9A 4WJEA 1N55A 1SJCA 3CV1A 3BG5A 4EWND 1YDVA 3EOLA 2WNWA 3AS2A 2WQPA 3P8JA 2WP6A 4HTYA 1IEXA 1LG1A 1UP3A 2OGYA 3W81A 2A4AA 1TE1A 4D6DA 4XO7A 1GGOA 3MCMA 4S3KA 5AZ1A 4NAFB 3RIKA 4D8LA 4DWSA 1MDRA 3WYZA 1PWMA 4PUMA 2HDJA 4E3VA 2XZ9A 4N02A 5BOEA 1O66A 5DT5A 1R9XA 5TAOA 1OFRA 5HINA 1H2IA 2YZRA 3PJTA 4K8EA 1OGSA 4Q7IA 4R7WA 3EPNA 4TXEA 4XZIA 1WDDA 2CFYA 1OFDA 2G50A 1MQQA 4LT9A 4AIEA 3GNXA 3MB9A 2BV9A 5I6SA 4C5ZA 3RM4A 1S5VA 3W25A 2WANA 2HVOA 3CUXA 3EWYA 3UZXA 3KXQA 4C6QA 2D3LA 5AC5A 3FA4A 4L1XA 1OC7A 4GCXA 4Q4QA 4ZBCA 4DF1A 3P7YA 3DJJA 4J28A 1KB3A 1PTDA 5FIPA 4GIAA 1TV7A 3L2IA 4ADSA 4C5YA 3U6WA 3C0JA 1Y8BA 7PTDA 1TRIA 4RV8A 3NR0A 2YDSA 3UYIA 2DT0A 4U3CA 3PFRA 2PLCA 1R7OA 2R8WA 3FKKA 4L6HA 5I3JA 2Q8XA 2TRSA 4WY0F 3HJZA 2W3RA 1IEQA 1E4LA 1XANA 3D46A 2OVLA 3CQJA 3OBEA 4M1RA 1U5VA 4LYKA 2PD9A 1XFCA 4QJ1A 1AOGA 2PDKA 1KRBC 2YXGA 2Z1WA 3N17A 4JTDA 3EKGA 1LLZA 4NEVA 3S83A 1SZRA 4ADWA 1GVOA 3QHMA 3ITVA 4MAZA 3QF0A 2UBPC 4QLLA 1JEHA 4MMWA 2PC4A 1V08A 3N11A 4ZCWA 1W2PA 4Q8QA 1C8YA 1JJKA 1M6JA 4X2PA 2I56A 3VGBA 8RUCA 4X22A 3OU8A 4NUWA 1XLEA 3WQCA 1H51A 1HIZA 2YCIX 3B0XA 1Z41A 3DU0A 4HN8A 2XFYA 1AL8A 5I03A 1E6NA 1I1XA 2PTWA 3SBFA 3ABQA 5CSRA 2QKFA 5BMXA 4LYPA 3MKVA 4YWIA 4J9JA 1VBUA 4HNUA 3KCOA 3OBAA 7TIMA 3OLEA 3B8UA 2UY4A 3B8TA 3J7HA 2NSXA 2V5JA 3GC5A 3VX1A 4UR9A 2C1HA 3VXGA 5EGRA 3HOJA 4AG0A 4GKLA 2G4FA 1OC5A 5HULA 1WZLA 3GYEA 1FWRA 5FF2A 3O06A 7REQB 3WH6A 2E0PA 1WZMA 1U5HA 4N6FA 3WQ8A 5DMNA 2CBIA 4WEVX 3ZT7A 5U25A 3QR3A 3SRHA 2WC7A 1GVRA 5HANA 2NV9A 3LA4A 3M9YA 4ICCX 2VFFA 4HGXA 1XGZA 2GGHA 2XN1A 4Q32A 4I5UA 3O15A 1FWTA 8A3HA 2WOIA 4PL1A 2FZMA 1YXDA 2ZXDA 3N14A 3EDKA 2WCSA 2FMNA 1L0PA 4IMAA 3EA1A 3UWZA 2GOUA 1AZ1A 4QE1A 3GDLA 2P5NA 1W9XA 3TYCA 1Z48A 1H0GA 1GUVA 2J7EA 2GOKA 3H2FA 2H9AB 3RCYA 3HFTA 3MMWA 2ZE0A 1IR2A 4IOTA 2HPMA 4HP5A 4NJJA 3WSUA 2NQHA 3WQFA 4UNLA 1DKWA 1W1VA 1H6VA 3W74A 3QY8A 3H6OA 3BXWA 4IIDA 5JCKA 4JHOA 3BLFA 1BAGA 3CXOA 4CD7A 5JMUA 1JL8A 3TH6A 4JFSA 4GYPC 3VKCA 3ZLHA 3EEGA 3S4TA 1EA9C 1POJA 1V79A 1XCXA 1N8FA 2A1YA 4IJRA 3D0CA 4NNBA 1OM0A 3Q6JA 1JD7A 1U2YA 3IVTA 2YDAA 3W26A 3S5NA 3RJYA 1UMLA 2BSLA 1YIXA 2Y8UA 3H70A 3W75A 1TTIA 5E09A 4MWAA 3G1RA 4KRUA 5E0KA 1S3TC 2CLIA 1WCGA 3IARA 4CUCA 1D8CA 5DEZA 3WD3A 4TX8A 4S2BA 3B8DA 1OB0A 4MJZA 2PDHA 3L4UA 1WP6A 2BS9A 3SIZA 6CGTA 1F3PA 4GJ1A 4RKAA 3W1PA 2QCDB 4ML9A 2HK1A 1UG6A 3S9IA 4V1XA 1B3WA 1S2TA 1QOPA 5A8MA 1KCZA 4E8CA 2P76A 2VP8A 3GXIA 5AOUA 3FLUA 1FWBC 4QNEA 2H8ZA 2IQTA 2PCEA 2ZZ4A 1LQ0A 4RNHA 4E8GA 4E4PA 3NRZB 5F2GA 1LCOA 4L7ZA 1FWFC 1P5BA 4P7NA 1X2GA 4PTDA 1QPOA 1DXFA 3B06A 4QSHA 5TNVA 3EAOA 2ON3A 4F0SA 3LCWA 4XSLA 4YJ5A 4UTLA 4AEOA 3H2OA 4JAWA 4Q3MA 3CAQA 2BGSA 3KFTA 3CBWA 3QW3A 4BQ4A 1JFXA 5DBUA 4K39A 4IG2B 1CENA 3QR1A 3HIJA 4DJDD 3VFLA 1NOUA 1UWRA 4KRTA 4GCAA 2R1PA 1PIFA 2SFPA 2QUVA 3G0UA 3BLOA 5I06A 2W63A 1O5RA 2BHZA 5LHFA 1B3YA 2V3DA 3NG3A 1QAPA 2E6DA 1FFRA 2QCEA 2XFFA 3TKFA 1TMQA 3V5CA 4GQGA 3B40A 3BQ5A 3W28A 4XBSA 2V82A 4CCEA 2ZXBA 3HQOA 1TPVA 4GUGA 1H7RA 4KEUA 1UD4A 2Z00A 3HPXA 2VT0A 4XBKA 4XZMX 3B8WA 3C0QA 1X39A 3QHOA 3AC0A 1MZHA 1B5TA 1V93A 3SCWA 3OC4A 3SFWA 1MO0A 2Y61A 3NXLA 3LMYA 4G8TA 4IMCA 4GI9A 4W7WA 4AY1A 4DBUA 3WLPA 4UWMA 1EQPA 3OEXA 4QDMA 3B9EA 3VIFA 1G4TA 1LP6A 2OODA 5G4EA 3MCNA 1RJQA 1TIWA 4KWWA 1MEHA 2IMRA 5IFTA 3T0TA 3EF6A 1VFLA 3S2MA 2EF9A 3U2ZA 1DEDA 3UW6A 3VIHA 3S2JA 4MB5A 1MYRA 3TCSA 5A1AA 3UCDA 5KZMA 3DK9A 3W1RA 4U4MA 4YU1A 1XW8A 4XO6A 2GQ3A 4HU3A 5AFDA 4I7VA 4IM4A 1E71M 2PWVA 4CN6A 1A47A 3RAOA 3VDCA 2RJGA 1GRAA 2VR4A 3BSMA 2I5GA 3R7MA 1H3GA 5CSYA 1NQKA 1YTDA 1W91A 2Z29A 5A3HA 4F8XA 3W6LA 1SO4A 4WXYA 1T5AA 3SUVA 1BGGA 3F4CA 1WXJA 3QMRA 3NQDA 3TOPA 3BLIA 4V28A 2AL2B 1W54A 1YMYA 2VJXA 4H4UA 4DNMA 1F4HA 1V97A 2NQJA 1ZB5A 3AXMA 1AH3A 1LM1A 1A50A 3WG6A 5T9BG 4JQAA 1K7EA 1KXVA 4GGBA 3RX2A 1P7TA 2DSKA 1J11A 6REQA 3EEZA 3TMQA 4ZB0A 5JCMA 3UPBA 1GORA 3GWQA 3UJEA 1B57A 2HMCA 1VB9A 3NWRA 1K03A 2G95A 2WJDA 7ENLA 3I3DA 1ZS2A 4I3GA 3KBJA 1ADOA 4IFOA 4FNUA 1XYCA 2CZFA 1DWAM 2G0WA 1UB3A 4FXRA 4M7TA 4S3FA 4J3VA 5AC6A 3NL3A 1OCBA 3G1VA 3ZJ6A 4GG9A 2GGGA 3O0HA 1OCNA 4O4WA 1KGWA 1A4LA 4C6IA 2I16A 3I7RA 5TQLA 2XVNA 2WCGA 1ZY8A 3P61A 2UY2A 3GG8A 2IS7A 1K4HA 2RDWA 1DJNA 3R25A 3W1AA 1EJVC 2QJHA 1E55A 3H2EA 3EX6A 5K7JA 1RUSA 3SJ3A 2PGFA 4CU6A 2YL6A 4HOZA 3OGVA 3WFLA 4K8GA 3E6EA 1SJAA 4GJIA 4GNKB 4WK9A 2BTMA 4P7OA 4CQBA 2CLKA 3W6YA 4O1CA 3T8QA 1R47A 1SO5A 2DT1A 4LU0A 1OZQA 2G3FA 3LQLA 1Z3NA 2EG6A 3EGJA 4XZ9A 4DXVA 1H60A 3ZR5A 2WV8A 5DCDA 3FSTA 1N2VA 1R9ZA 5KITA 1UZ4A 3GTHA 4PMQA 3E0VA 4QQ3A 2Z1VA 3WL1A 1W17A 2WLZA 3LD5A 4D1JA 1QI3A 2A0NA 4IP5A 3NQFA 1FBAA 3L9CA 4LUYA 4NIRA 1G4SA 4F9JA 5CG0A 3ZXWA 1EH9A 3FY1A 2FPVA 4UFHA 2VVSA 3VOHA 1K8ZA 4W7VA 1TZZA 3GR7A 4BZYA 3EX3A 3W2UA 3AIRA 1Q65A 2D23A 3SW6A 3II4A 3RG6A 4B3ZA 5EL1A 4QS5A 5GPRA 3SCUA 4HPHA 3LX9A 3PG8A 4E4UA 3LHUA 1YQZA 4L65A 2P50A 1HVXA 3N25A 2VFHA 4ATDA 3IJLA 4DY1A 2P0IA 2GGJA 3VGFA 1WKFA 3T42A 2YR1A 4H6EA 3WJZA 3N73A 5ABFB 4S23A 3EX1A 4IISA 4IWWA 5C7VA 3MP3A 4FLSA 1RJRA 3WH8A 1S3HA 2ZE3A 3Q4DA 2BXZA 5GQBA 2ZZ6A 3RO6A 4EWJA 2X2YA 4NT0A 1L8PA 3P80A 1OYBA 2FHBA 3ALGA 5E6YA 1XGDA 1LORA 3H8AA 4MPQA 3A5VA 1AMYA 3PZ9A 4PCPA 4L64A 4RK8A 1OFEA 3WMCA 3IIVA 1NSJA 1D3GA 4L6DA 4DPPA 2YLAA 4Q7BA 4QGCA 1KGUA 1MI3A 3GRSA 4GVIA 4PC8A 1GOMA 2ZYFA 4UTKA 5JIWA 2GVEA 3G22A 4PMZA 4HZ8A 4RL3A 4GI8A 1GTEA 2ZUSA 1JZ4A 2DSWA 1ZAJA 3V16A 3WFZA 5D9MA 4GUJA 4YCPA 2J4GA 1ITXA 1UCWA 2WZEA 4DYJA 1LOLA 4I5XA 3KOXA 5DMYA 4C6JA 1RQBA 4OVXA 5D33A 4AZHA 5LIXX 5DXYA 3ZQ9A 1VS1A 2WPFA 3FHAA 1WZKA 3A4JA 1FOBA 4J3TA 3WD2A 4RZ6A 1LVLA 2E6AA 2YCLB 2CXEA 4LANA 1EEXA 2E67A 4XUYA 2PUZA 2DPEA 1K9FA 5G1YA 1T8XA 3WENA 4F0KA 1QRQA 3THCA 4JFVA 1CLKA 4Y6GA 1BF6A 5LZLA 2WPEA 3DFPA 1SR9A 3EB2A 2J6XA 3NPWA 1XLLA 3GVWA 1GOWA 4L80A 1J0ZA 3HQ1A 1KR0A 3W7OA 3EWBX 4UC5A 3IJQA 5AC7A 2ZXAA 2I57A 3W4RA 2OWXA 4J40A 2ZZ3A 2PTYA 1JZ6A 2OQHA 3ZVHB 1EJ7L 1DHPA 3ABZA 2V67A 4L4LA 3SSZA 1U83A 4JDRA 4MZ1A 2J13A 2Q09A 4ACYA 1DXEA 2XH4A 2PWHA 4ACZB 2G3JA 2OG9A 4XKYB 3D6NA 4YHGA 2PC8A 1XP3A 1PX4A 4XZWA 3AN1A 3OYZA 1HQTA 3QV8A 2J7CA 5FKYA 1BVZA 4XISA 2AMXA 9RUBA 4Q8OA 2OKOA 4MUPA 1TPDA 1N60C 1BHGA 3E5BA 4RDVA 3N3TA 3INPA 3GX9A 4TUFA 3AHTA 3RFAA 4D6EA 3LCXA 5CC6A 4BV6A 2GDUA 1T7LA 3VUSA 4OHQA 4W7UA 2G8ZA 2DUAA 3QQ1A 2VC9A 2VDHA 1SVDA 4EMWA 3ITYA 4PEEA 3ZZ1A 3EMCA 3HW2A 3RCMA 3DOPA 3XISA 2RJHA 3W2NA 2B31A 3S1UA 2VTFA 3R58A 1JDEA 1E56A 2PU1A 1L8NA 4K36A 2QLYA 3QZ6A 4EF8A 4AX6A 4PRTA 3L21A 2OYLA 5I24A 3FA3A 4CGTA 3WLSA 4L4OA 4APNA 1FP9A 3TE9A 3N15A 3IV3A 4UCGA 4C91A 2F5ZA 1PEZA 3BAXA 2ATMA 2J88A 2P8CA 1EXPA 4R33A 1VFMA 1SUXA 2CFFA 4DJED 1J8VA 4MG4A 3W85A 1E3ZA 2EQ9A 2ZC8A 4J2MA 1Q85A 2QCHA 2BHUA 2PBGA 1QVBA 4HA0A 3URNA 1JGIA 3OW1A 4IGHA 4H50A 1UC5A 5A6AA 3WQGA 3NO3A 4N4PA 1TMLA 2J9ZA 5D2YA 3TYZA 4Q7NA 1GVEA 3L5AA 3NDOA 2C3DA 3H12A 5C9XA 2DZVA 3N9KA 1XH0A 1EX1A 4IFKA 2YZ5A 2HISA 3ARTA 3RMJA 3ZJ7A 4UQBA 4ZQRA 3VKJA 2ZXQA 2X1SA 4PA8A 1XIIA 1DIEA 1ZJIA 3KEHA 2J27A 3FAXA 4PL2A 2FZDA 2QUUA 4L1WA 2FLIA 2REQA 3N29A 1ADSA 4TVWA 3NQVA 3R13A 1MNSA 3PBUA 3AIWA 1FWDC 2EKGA 5BWAA 2AQWA 2Y8VA 3C61A 4NASA 2KAUC 3G8EA 3CS2A 4WSKA 2FKPA 1Q7ZA 2VX7A 4JIHA 4GY7A 3IWPA 3UXLA 3I6TA 1R5YA 2YYUA 4E4FA 2PDLA 4HYVA 2Y5JA 4UUIA 1IEVA 1I45A 3SO7A 2NUWA 3TN4A 4DVOA 2CWXA 3RNDA 1SR0A 2VXNA 5ENLA 2GUYA 1C7SA 2DZWA 3GD4A 1E0VA 1GRTA 2VM8A 3IAQA 2YKKA 3NQ2A 2GSJA 5I3DA 1GOKA 4LA1A 3GHRA 1BXNA 1EGMA 3VOJA 1W3TA 1A5AA 3EBVA 1DJHA 1PUDA 5D30A 1XH1A 2VEMA 5F4WA 4NAEB 4RV3A 2ADAA 3W88A 4PN2A 2I17A 3SI9A 1LT7A 4E2BA 5REQB 1EZ2A 4UOQA 1N5WC 4IUGA 4J3WA 3CPUA 4NP7A 4WJ8A 3QH2A 4IMDA 5HQEA 1QO5A 4QSFA 1HZYA 3WX7A 2EJ1A 1O12A 3DCPA 4UQDA 1BZLA 1VLWA 3SGUA 3KLKA 4D71A 3KTCA 3HPSA 2QW5A 1XHGA 3S6TA 1M3UA 3C8NA 3QY7A 5I2UA 4O52A 4IJCA 3QTPA 3LEPA 1VKFA 3UG3A 1RP9A 2Y7FA 4S3BA 3T2QA 1EC8A 4EAYA 4U31A 1KRAC 4BA0A 1A3WA 1M6IA 1I8JA 2CKSA 5LKYA 2DZAA 3RYSA 4C6MA 4G5DA 2PWFA 1EDGA 4I7UA 5KEZA 2J7HA 1W1B1 3JU2A 4Q6XA 3VO0A 6TAAA 3DXIA 3FG2P 9CGTA 3SSJA 4B3LA 1YW1A 3LBMA 1K02A 3HG5A 5DQPA 3LHVA 1OT2A 3A7UA 4EM4A 2W9MA 1NP2A 3YPIA 2RABA 5KMYA 3NO1A 1JAKA 4KW2A 3RLHA 4K6AA 1T96A 3EB3A 4JTGA 5G5GB 1CXFA 3DX5A 1XBVA 4C65A 2CHRA 2Y8KA 5CJNA 3DH9A 3UG5A 4XZHA 3VDAA 3WH7A 4FALA 2FDMA 5AZ0A 4DJFC 1FWJC 1PZ0A 1HL8A 3ID7A 4AB4A 4O57A 2NXGA 3UJ2A 4CVUA 1EBGA 2WKJA 4CCZA 4IZGA 5J5RA 3K1DA 1E0XA 1ZY9A 4HU4A 1ME7A 3W2KA 3MVTA 1W3JA 1XLAA 4HK6A 2QVHA 5A6SA 3NZ1A 4JS3A 4BF9A 3GD3A 1JUKA 5D4YA 5BXPA 2VCBA 4RDYA 1K70A 4TVYA 4A6GA 2W0HA 5K4ZA 3WUEA 5HMSA 4IH3A 1UJQA 3WDIA 1GHRA 4EPDC 1YE4A 2XFRA 2BC0A 1NVMA 4H9UA 1BKSA 2OZTA 3K1GA 4ECLA 3A7AA 3AXKA 3UPWA 3H2NA 3F4DA 3SCOA 1XBZA 2Y85A 4BQ5A 2ZRXA 4GE8A 4LUIA 4LIIA 4G9PA 3M6YA 2ZZBA 2ZUNA 3WO8A 1F8WA 3KCLA 2VFDA 5A6JA 3S8HA 3ABOA 2VEIA 4HSHA 3I7QA 3TTYA 5CC3A 5EBUA 3DYMA 2PDBA 4FIRA 3M0XA 2W61A 3ANYA 2X40A 2WZTA 3VKKA 2F84A 2WAGA 2AQVA 3NTYA 1N82A 4WOZA 5KVIA 1UR9A 3M5XA 1CGUA 3T4WA 2DZXA 3O9NA 4GIRA 1CGTA 3A12A 3S5YA 4DF0A 2OLHA 4ZOHB 1SW0A 3BOLA 4WY0B 4C6FA 4TVDA 5CBBA 3EOUA 3WF3A 1ZHAA 4H4PA 3LCHA 1QXLA 1EWEA 3AALA 3QOMA 3F03K 3WBEA 2V3FA 2XWEA 5JU6A 4DWSC 3E96A 3CMJA 1LL4A 3VIGA 3CO4A 5A2BA 1YDYA 4DYEA 4FR1A 3QPYA 1M7OA 4HK7A 3AO0A 1OVDA 2ZDRA 3A7RA 4AD4A 4GYJA 1Q2RA 3L5LA 5HWMA 1DIKA 1W3HA 2XU2A 1FWIC 3ZR6A 1ZLPA 2BFGA 5CAHA 3BOFA 3MMUA 3GXNA 1DWFM 5HNNA 2PEVA 5HR6A 2WXDM 1IIGA 2AGTA 1EJXC 5T8GA 3LV5A 3U2OA 1S5NA 1XL9A 1TPUA 1NDVA 3QFWA 4JTHA 4QROA 1T8QA 5EMLA 3W00A 1SFSA 4H4RA 2A3AA 4JIRA 3G8RA 8TIMA 3LCIA 3P8IA 5LA1A 1UJPA 3LXCA 4L9YA 3KL0A 5CBIA 4RZ4A 3H7RA 1SZNA 2EPMX 1C92A 3M5ZA 4DO6A 1G5AA 4JTIA 3WDQA 3CZLA 1QUMA 3GW3A 1F3EA 3TW7A 4ZE4A 4H4ZA 2NQ5A 3EKLA 3TDFA 1EL3A 3A13A 5DY2A 1TG7A 2E5CA 4US6A 2HV5A 3OODA 2ASHA 4GRTA 4R7OA 1TV4A 1PDZA 2RGLA 4N7QA 4AZCB 2VD9A 3MY9A 4WX2A 5LNUA 1SQ7A 4TR9A 7ODCA 5FJPA 2YVFA 3N3MA 2ZC1A 1OADA 3WF0A 1EKOA 1QNRA 3ZS4A 3PB0A 4L4PA 3CH0A 4V15A 3DERA 1HF6A 4QEEA 3GKFA 2I5IA 5A8OA 1XDLA 2X50A 3K13A 1OINA 3ZJ8A 2NPXA 1NWUA 3VCCA 4W8AA 1DTUA 4RE4A 5EMMA 3WMLA 4XVDA 1F9CA 3QV7A 3TJLA 3MJYA 4X9SA 5HQMA 2WWCA 5HMDA 1S1PA 3UR7A 1U30A 1VBJA 3QW4B 5C9UA 1WDQA 3BK0A 2YX0A 2NQZA 2X42A 4PFHA 2OX1A 1DJXA 1NM9A 2WYSA 1R0MA 2JKAA 3LB8A 3B0PA 4OECA 4QQUA 4C1NA 4IHCA 3AHZA 1RBAA 3Q45A 1G0CA 4PBGA 1NAL1 2E68A 2YCKX 1QNQA 4PTXA 2DVXA 2VNCA 2DJLA 1XHCA 2CZDA 2WWDA 3O2LA 1JYNA 4A4AA 3ANUA 1C8QA 3LENA 3TJ4A 3CHDA 5A5WA 1IYXA 3WZ0E 4W87A 2A85A 4LUSA 1G7UA 2DP3A 3RM9A 1V6TA 2QUNA 1QI4A 4ONVA 1JPIA 4PUKA 1WKYA 1E6QM 1KO0A 4J4KA 2HBXA 3WK3A 3W0KA 1E1EA 4O18A 2DIKA 2JEQA 3GZAA 3CUJA 1F4AA 2ZZ1A 1MEIA 1ONXA 5HBFA 1FA2A 1V0MA 3HPFA 1I6NA 3K46A 1H50A 1QJWA 1HP4A 1GTHA 1LL7A 1K7XA 3GU1A 4NXKA 2IPWA 4EQRA 3IJ9A 3P2VA 4CQAA 5CBJA 1PX8A 1O7AA 5K9DA 4EOUA 5AHLA 4IIFA 2QMJA 3PNZA 2A3LA 4WOQA 3G1XA 1EOMA 2I5QA 4QAIA 4K7YA 4LNYA 3UZYA 1X6LA 1AZ2A 3T0CA 2W66A 4F0LA 1O6IA 2D0GA 5D38A 4RZBA 3KM8A 2J7BA 4PMYA 4U5IA 3CAWA 3LLFA 1ZU8A 3PTKA 3MVIA 4MWAC 3KLJA 5B7ZA 3MUIA 1YADA 3VIIA 3JUGA 4H4SA 1JG9A 3NDZA 2YJQA 4FX7A 4AHPA 3HPAA 2I1OA 1WO2A 3TC6A 1YX1A 5CPMA 5GJPA 4F0HA 1UOZA 3KOWA 4G1NA 5D04C 2GJXB 3WLIA 4W8LA 1TWWA 4HSNA 2PWUA 1K4GA 3KVMA 5DMLA 2E1DA 3WD4A 1AW5A 3BC9A 1A5LC 1HKVA 3UZZA 4NEWA 3OJGA 1XUZA 3AOFA 2BVDA 3DK8A 3SCQA 4HJFA 1XYMA 3H24A 1TTJA 3PUDA 2ZADA 1EP2A 1C91A 3S0CA 2PE4A 4HNCA 3OOQA 1WNOA 3STGA 3LZ5A 4TMBA 2A3EA 2GQWA 3W7RA 3NNTA 4FAMA 3W83A 1KTCA 3BMXA 1V6XA 3JZEA 2Y7DA 2V3BA 1QR7A 4JFTA 1RPKA 2P8BA 1Q66A 2X1TA 1KTBA 2QJIA 4CEUC 2CZVA 3IK4A 3M4HA 2EO7A 1J0KA 3TXVA 4Y9PA 3R8GA 4A8NA 3G6LA 4GX9A 1RHCA 3D5HA 1GVSA 3DYOA 2MANA 2FIQA 4PUDA 2X8CA 1H7OA 5BW6A 2OEJA 2IXUA 2NQ9A 4QXIA 3W22A 3W7DA 3U57A 1ZZMA 5HUOA 4PUNA 4XD5A 3DKLA 3UR8A 1OX6A 3AU6A 2HRWA 3BTNA 1PZ3A 2E8ZA 3SCVA 4M8UA 4RPPA 4HMCA 4D6GA 1XH2A 3H23A 4Q8PA 3CZ8A 3EDJA 4KRZA 4E6MA 1EP3A 4Z2GA 3CWOX 1JRCA 1X8CA 4AWUA 4KWUA 2WSRA 4NILA 3KX6A 1P4CA 1D7YA 2TPRA 3ZWTA 3AMCA 1E0WA 3LMZA 4HPNA 3NVDA 2QMKA 1QHPA 3DZ1A 2Z1XA 4K7ZA 4XD6A 1YBQB 2YVGA 3L4VA 5DCEA 1XI3A 3CWNA 1PKYA 1JZ3A 4RXFA 2ODOA 4GH1A 1E73M 5FSDC 5C9ZA 3VDHA 3R07C 3DEQA 4DWSB 4CQCA 3DC8A 2ISDA 3BVJA 5D2TA 1YYAA 2P0OA 2BB0A 1FWGC 1OT1A 3W24A 3LK6A 4TIMA 3RK8A 4KMQA 2INZA 2GR2A 2H3DA 4DN1A 2DGAA 2JKEA 4D72A 2EG7A 3OG3A 3U7BA 3BANA 3VCRA 3U9IA 2J8TA 1Q7MA 3FDKA 4IF2A 1ONWA 4NZ1A 1BG4A 3JRKA 5IBXC 3F4VA 1VJSA 3KL3A 3KHDA 3EWXA 1B4KA 4JNMA 4FXSA 3CMFA 3KZSA 3Q65A 1JYVA 4UQAA 3CK5A 4MF4A 5C2CA 1TB3A 1P1XA 4WSJA 4FLOA 4M1BA 2C16A 3PBGA 3EDDA 1E6SM 1XKYA 2Y62A 4S1FA 2QPXA 1UWUA 4W88A 1GQJA 4GISA 1TYPA 3HG3A 3CV2A 1Z9AA 5H8PA 2V3EA 3BSGA 2NT0A 3L4XA 2WOVA 3CB3A 2ZRVA 4H7CA 1THFD 4E3TA 3USZA 3UFYA 4M6UA 1F73A 3ELFA 4XZBA 4JNZA 4Q4PA 5PTDA 1TE6A 4H9VA 2HEJA 3C2YA 4AH7A 1WPCA 1ODZA 4URIA 1MXSA 3HM7A 5HNRA 4FNSA 4DM1A 5DLCA 1EGZA 2CNCA 3KRSA 4O8RA 1E1CA 5HK4A 2E40A 5KSWA 3WEOA 3AUOA 3WQPA 4TO8A 3NVWB 2J62A 3KP0A 2EQ6A 4LEFA 3F4NA 3V1PA 1CGVA 3R89A 4NJKA 3R0KA 3W2JA 4AF0B 4KEZA 3UA4A 4LS2A 3OLIA 3QGVA 5EPDA 3O1NA 3HF3A 2POTA 3LU2A 5JCNA 4LAOA 1A5UA 5M3WA 1NOWA 1ZPTA 3KWXA 2YXXA 3BWWA 3W02A 1HTIA 3O63A 5CSSA 5EU9A 1H0IA 2C0AA 4IGMA 1EC9A 1CDGA 4MFEA 4G1KA 5LIWX 3T81A 3WIJA 1FO4A 3WNOA 3QV6A 2Y24A 4EE9A 5MKGA 1JOAA 4AD5A 1C9DA 1CIUA 4W8BA 4BEQA 4PRRA 1K8CA 1UZ1A 4GNVA 1QWGA 3URBA 1WKEA 1W5PA 4MYAA 3CO8A 1VPXA 4LVBA 1W1IE 3FXGA 1W37A 2PMQA 2VR5A 4JYEA 1PPIA 3IVUA 4JTEA 5TIMA 3TYUA 4GGHA 3E9AA 1JZ8A 2O92A 5JH1A 3S9YA 1WA3A 3W86A 4MY8A 5LSMA 1QOQA 4BFAA 3GKAA 4IQDA 5C2GA 3MSDA 3SCTA 3UR2A 1ECEA 3C2OA 3P67A 2DW6A 1TV8A 4U2YA 2ZICA 3UD6A 4D8AA 3VKBA 4EF9A 3W07A 1DV7A 3BICA 1XLHA 5AY7A 5D05A 4QEHA 4E2DA 2JGQA 1WXYA 3DHFA 4X3ZA 2FYMA 8XIAA 3LLXA 4S3JA 3CV6A 4NAFA 5KETA 2E6YA 4HHPA 5A69A 2CC0A 5IFPA 1OGGA 2EAWA 3SDOA 2BDQA 4AC1X 4P8WA 3SB0A 4CNTA 1UKTA 1FDYA 1XIJA 1JPMA 2PPGA 1DJIA 2BY3A 4AZIA 1Y5VA 4M6QA 2DH3A 5AYZA 3N6HA 3NJ3A 2XVGA 3CUZA 2FJKA 3MZ2A 1GCYA 1LBLA 2YL9A 1FQ0A 3FNDA 1PVNA 3E74A 5DELA 2QF8A 4DBSA 2PD5A 1RQEA 4ERIA 1Q6DA 1E5NA 1XYBA 4WXZA 3APYA 3EPOA 2WJFA 2WNNA 3B8VA 3UWEA 2VENA 3N34A 3T55A 3LBCA 4JY9A 4LW7A 3GG1A 4MWAB 2ZX9A 2EQ7A 5E93A 3NGJA 1G1YA 1L6GA 1TR9A 1MRQA 3ME3A 3U7VA 1JZ2A 1OJTA 3FS2A 2ZZ5A 3NOYA 1FHUA 4TU1A 1TV2A 1ZRQA 3LYEA 2W55A 1Z69A 1V51A 4JZ5A 4OOZA 3I3EA 2FZBA 1TIMA 3HA1A 3DHDA 1ZBWA 2BC1A 2E9MA 1OF6A 3WF1A 1L2UA 5DCBA 1Y5WA 3A5FA 1KFLA 4JTSA 4GZEA 3FAWA 5CPOA 3W29A 1ZUAX 1OZMA 2HQAA 1RY8A 5D9OA 3W7GA 4DI8A 1BSIA 3LTYA 4ADUA 2ISSA 3TC3A 5C71A 1FEAA 4QG8A 3AI0A 2PP0A 2IW0A 3ZIZA 3B0UX 3PPHA 4ZR8A 1QK0A 4PB5A 3M7SA 3LBOA 3SRFA 1QNPA 1FXPA 4A3YA 1EUNA 3BG9A 2YCEA 3A9IA 2B0MA 4LUJA 4MIMA 2V2DA 3R2GA 4O1EA 1NELA 1A5KC 3CASA 2G4JA 4O12A 1Q6OA 3A23A 2Z24A 1XLJA 4DF2A 1ZGDA 3DHPA 4KFOA 1T3QC 4C7FA 3QBUA 3OP2A 3P6LA 2ZBTA 1G67A 2J8FA 2NLYA 4YL2A 3TEVA 4FNTA 3E49A 4PMJA 3RPTA 3LY0A 4EPBC 3UXDA 3FYOA 2HROA 4BY3A 4H41A 2O55A 2VGIA 4CCCA 1E1FA 2XDFA 3N2CA 4PUJA 5F2LA 1PYMA 2BVYA 2PF8A 2V69A 2OMAA 4PB4A 2VGGA 3MANA 1IZKA 2D1ZA 3ATZA 1RA5A 3CL6A 5IHSA 4UFMA 4UFKA 3VD5A 4F3HA 3L2MA 1XIEA 3OQ8A 4AMAA 4AY8A 2D24A 2CLLA 3MHUA 2BLEA 3RR4A 3TWBA 5G2WA 1Z6KA 4U10A 5FJTA 2YA2A 1CGXA 2DSZA 2HE5A 3GIQA 3KLLA 4NZFA 5A6BD 1TVPA 2OB3A 3TU9A 5LA0A 1FFQA 3RHGA 1JI2A 4R5EA 3DJGX 5J5DA 2PZNA 4HYRA 5JUVA 1VIZA 1R3QA 3LPFA 3UERA 3GO2A 4WIWA 1A5OC 1ZNNA 3CL8A 1H1NA 3NQBA 3UJFA 1IWPA 2V5LA 3E0LA 4X61A 2FFIA 4CQ9A 3M44A 5GJNA 4WKHA 4AXNA 1LWJA 1DE6A 1H62A 2ZZ7A 2H9AA 3QN3A 4LVDA 4RCXA 1YKWA 3ZYZA 3JS3A 2Z1BA 3B9OA 1M65A 2F2KA 2VFGA 3BG3A 3FYPA 3B03A 3VGGA 1QDSA 2OT0A 4TMCA 1BWLA 4IXXA 1XYAA 4FX8A 4HA3A 3D47A 4QE5A 4UNKA 1H7XA 1RCQA 3QFAA 3ITLA 2X1IA 4DM2A 3PS7A 2VHLA 4C6OA 3TQ0A 2Q8ZA 4JQ9A 1XM3A 5C2XA 5BZAA 1F3XA 2AAMA 3CV7A 1FY6A 1OHLA 3HGRA 3SY1A 3WQWA 1CWYA 4B4HA 1V0NA 3IJ6A 4RPQA 1KM3A 2ISVA 1CPUA 4HHHA 3P3BA 3U0HA 4HPJA 4GO9A 3EWCA 1NFBA 2JQXA 3QYSA 4JCLA 4YHEA 1LLWA 3H4GA 1AA1B 1RY0A 5I77A 3GNOA 5IOBA 3IGUA 4EMIA 4LF1A 2PLJA 3G77A 3TSMA 4GI4A 1M7JA 2AQOA 2P3ZA 2QCDA 3MTWA 1TKKA 3RUBL 2VMFA 2QDDA 3S46A 2VZTA 3KW3A 3VAVA 5HUPA 4GINA 3KVKA 5CLWA 1BWCA 4O16A 3ZM8A 3CUGA 1DJZA 1TPH1 2PA6A 4DPQA 4Z1BA 4XBJA 1XD1A 6XIMA 3B9AA 1BLIA 1NPXA 4I8YA 1SGJA 3W3OA 3BAJA 1OFOA 1X1ZA 4Z2KA 1E9ZB 1LTDA 4GPNA 3LTSA 5HJYA 1JXJA 4BK9A 4GYFA 3LERA 2BVWA 2QJNA 1I0DA 2PRLA 1XIFA 1BSLA 4IG2A 3IJ7A 1XCWA 2Y0FA 4KQNA 3RXZA 2OEKA 1LBFA 2ZA3A 4ZOBA 4ZTYA 1B31A 3HMJG 4H01A 4Z42C 2GR1A 3BCJA 4QRNA 2FTYA 2PBOA 3WKZA 1JDDA 4XZLX 5C6MA 1XIDA 4A3QA 3NOEA 4HN4A 3CL7A 3DHUA 3W53A 1JYWA 3KRZA 1H41A 3L67A 2E8YA 4Q8WA 1QT1A 5H91A 3FVDA 1J0JA 4QP0A 5M2FX 1L9WA 1TVNA 4NJIA 4NY2A 2ZUUA 1XRSA 3PZOA 2CZEA 3PZIA 3W1TA 2VRQA 5B7YA 2DSVA 4KFPA 3HN3A 1V5XA 2QULA 3GVGA 5A94A 2NUXA 3I7SA 3LM3A 4WKAA 3W7LA 3LXBA 9XIAA 1SB3B 4EPEC 3CWHA 3E0FA 1I60A 1XBYA 3TQKA 2QS8A 3HTWA 4DAIA 1NFGA 1B9BA 3ABRA 2GGEA 1CXHA 2Y70A 3V36A 3H7UA 3NDYA 4AU0A 2XWDA 4LV9A 4O0KA 2XIOA 4I9MA 3WQ4A 4MUZA 3ZLGA 1CLXA 2H90A 4EXBA 3R4IA 5FJRA 1IGWA 3W37A 4JQ3A 4P7LA 5IM51 3W7KA 3OGSA 4Q4OA 1DXIA 2ZA1A 3HPZA 4EANA 4E38A 3TUUA 1ONFA 4R9XA 5I78A 3S1WA 2WSKA 4MOZA 3UU0A 1FHVA 4GZJA 4DYKA 3UG4A 2AL2A 4PYSA 3EUB3 2Z7GA 3VA8A 1CXKA 3NGFA 1S2CA 5BXTA 2PDCA 3AFBA 1A5CA 1BTCA 3GS6A 3TX9A 6XIAA 1SFJA 1XDIA 4WLCA 2XIMA 4PMOA 4LBUA 4O1FA 4UOJA 1EIXA 2C79A 3GNPA 4DZIA 3POHA 2BOFX 2BZNA 3LRLA 1KCKA 4Z08A 5FJOA 2BY2A 4CLMA 3BAIA 2Y7EA 3CUFA 5HNUA 3QYQA 2CDUA 2Z6IA 4M82A 4FX6M 5CPQA 1F74A 2QAFA 1LZOA 4DLFA 1O4UA 3SN1A 3TFCA 1XDMA 1GETA 4EM3A 3SADA 2CLOA 1HKIA 2RFGA 4H9MA 2FHFA 4TOQA 1KLZA 1KM4A 3OA3A 1B3XA 3QC0A 2ZVIA 3GXTA 1NEYA 1TZ7A 5JH2A 1CXEA 1TX0A 3WK0A 6TIMA 3ZSSA 7CGTA 5H8UA 2QGYA 4DELA 1TWZA 3P62A 4AXKA 2QCGA 1U1UA 1VPYA 4N42A 4UR8A 4DO5A 2YBVA 2R9RA 1EIBA 1XISA 3GY1A 3ABSA 2C71A 5ABEA 3FJLA 4Q8TA 1NWTA 3GXDA 4HIBA 1OX4B 1J5SA 2WMGA 3ITOA 1JI1A 3NPVA 4L9XA 5FS7A 2OO6A 1J01A 3RILA 3H2CA 1ZQ5A 4EQWA 1BQGA 5ABTA 4YN5A 3TWAA 1OJXA 3HBLA 3F5LA 5BXRA 3IC9A 3Q58A 1TUFA 4A29A 2Z0IA 1OCJA 1EXBA 3FIGA 1BYAA 3Q67A 5TD4A 1FXQA 4EQXA 2IXVA 3OZOA 2WOWA 1GJUA 1V7AA 1J9YA 5HPCA 3MKKA 3SFKA 4EXQA 3LGDA 5U7SA 4AD3A 4K8DA 5F2IA 4OV9A 3M07A 5FF3A 3ARXA 1TV5A 3H4WA 3VI2A 5FF7A 3MHGA 1V77A 3EMZA 3G24A 1OIMA 1NDYA 3MI6A 4X63A 4JX5A 4DUVA 4B9ZA 1EF3A 1LOSA 3B0VC 5CGQA 5KZEA 2OFJA 1PL9A 5CC5A 2WSYA 1TCDA 2PLMA 3KBMA 1C9WA 3C0SA 1CX9A 1AQFA 3KS6A 4ES4A 2XJ7A 3L7RA 4E2VA 1TTPA 1W1PA 2R1LA 4MNMA 2GQAA 1GYMA 1TWIA 2V5BA 2WVSA 1FDZA 4N9BA 3WLOA 1J4EA 4JGDA 4R9OA 4K7VA 2FPTA 1OK4A 4GVHA 3M5VA 1MWOA 2V30A 3BW2A 3L23A 3D3FA 2OWWA 3VC5A 1E6RA 1MNZA 1K77A 1PV8A 1QNSA 1KW1A 2YFNA 3IIOA 3TN3A 4Z0SA 1SZGA 1Q3NA 4AZBA 4ZODA 3RF9A 3TW6A 1YLVA 3T78A 4JIIX 2FTWA 5ABFA 4A22A 4DXXA 1JD9A 4NX5A 1E4MM 1NH6A 4LS1A 3VD4A 4AWTA 3GXFA 2WM1A 4DRSA 3UZ5A 3FW6A 3RNMA 3H53A 2RH9A 3AYVA 4GYPA 5D2VA 4HTBA 3H4XA 1UUQA 2D69A 2R24A 1ZP4A 1EFZA 1F76A 3ZJKA 2YQUA 4AFYA 4MLJA 1I0BA 1VAHA 2WSPA 3ZT6A 1BXBA 1C29A 2J25A 5GJMA 3GDTA 2J9XA 2VZVA 3BSHA 3BJTA 1Y5XA 1IT0A 1ZAIA 3CXBA 1UZDA 2Z1SA 2XIJA 3VNYA 1N5XA 3P60A 5U4NA 1ISWA 1P1MA 4OKDA 4DI9A 4H8VA 4H04A 4DIAA 1S38A 2ZUWA 3GVRA 2ZTJA 3E2VA 3FKRA 5D9NA 5DT7A 1UKPA 1EC7A 5I3FA 1LPFA 4CQ8A 3KTSA 3WQDA 4J3XA 1KQYA 1TV3A 4B90A 4E8DA 3FOKA 3C6CA 4MGGA 4WRHA 3NQEA 2R1NA 1IXOA 3NXFA 3L0KA 4GZIA 3K8LA 4JTRA 3NVYB 4CNPA 2TPSA 2YCLA 3A6OA 1W56A 2YCJA 2JIWA 2W3SA 1GZGA 4RNIA 3TV8A 4N9CA 4BHYA 4P2VA 1RP8A 2NX1A 1XUUA 1DTNA 1QO2A 3STFA 1FWHC 3E3HA 3TJIA 2RDXA 3BGAA 2XM1A 4GX8A 3LSBA 3W7QA 4NL1A 3OZMA 1QI0A 4W5UA 3TA9A 3BAWA 3MW7A 3DFNA 4RDZA 1M5WA 5I07A 4N4QA 1V59A 3T08A 4JTKA 3XIMA 3KBVA 3VMOA 2DVUA 3CHEA 2J3NA 3ZVHA 4OBSA 3WNKA 4YYCA 3NL5A 4JX4A 1JPKA 4UNIA 5CSUA 4M6PA 3KRBA 1UD8A 1VH7A 5KTLA 4W89A 4ACZA 1XLIA 2W5FA 2CITA 4CN4A 1EYEA 4XKYA 1AFSA 1E6XM 3O6AA 3QTGA 2OU4A 3VM7A 3O16A 1UH4A 5HJLA 4ZQMA 3SCPA 1UYQA 4LAMA 1H5VA 3UWYA 3MJMA 5AC8A 5CPNA 1H5YA 2CW6A 3WNPA 8XIMA 5IDIA 1JDFA 4YLWA 1WDSA 4L4MA 4Q8UA 3N2TA 1BG9A 4D2JA 1S1RA 4XUGA 1VEPA 1GOIA 1A3XA 1V3HA 3RN6A 4ZE5A 1QATA 3G6MA 2QXWA 2NVAA 4Y8EA 5MF5A 1PXGA 4BI7A 2WVVB 2YDRA 1ZFJA 1QOXA 3ISIX 4WKFA 2NX9A 2QEZA 4ATLA 3NQ8A 1XV8A 3AJ7A 5KZDA 4GBUA 2VWTA 3B97A 1MZRA 5CZKA 5XINA 1ZX9A 3VGDA 2ATSA 1R8LA 1ZMDA 4B3KA 2JK6A 2WBKA 3FSUA 2A8XA 2DZUA 3EWZA 4XWUA 4FB7A 3GNDA 3LUTA 4DZAA 1Z8AA 3WUFA 1KXHA 2O9TA 1ZALA 1N61C 3LSCA 3ENLA 3MBDA 3BO9A 4FNRA 2X09A 2GWNA 3FJ4A 3ARPA 3BLKA 4M0XA 5LNRA 1XPYA 3VCNA 3AMDA 4TTGA 2JE8A 4QTGA 3THAA 5JCLA 4UTTA 4HMNA 4NQ1A 1OIFA 1GZJA 5AB3A 1PAMA 2NUYA 7TAAA 3W23A 1ML1A 2O4QA 1GYNA 4ZQOA 1RLCL 3T8LA 3AHYA 4Y9OA 3VD3A 1BVNP 1PHQA 2BOEX 2JF7A 1D9EA 3DG3A 3AZSA 4Z2HA 1XR2A 2EHHA 3MUY1 4AYGA 3K4DA 1VRDA 1UBSA 3TONA 3P0XA 4JIPA 1FWWA 5L6UA 2V6OA 1TSIA 4LVGA 3U5UA 2X8HA 4ZXLA 4B5VA 1NP0A 4GQQA 5TR3A 3KOZA 1FWNA 2YPIA 1UD2A 2QPSA 2GGIA 3DBPA 3IIZA 1B54A 3O6YX 3OVRA 4I7WA 3IK2A 4I8DA 4GI6A 5DRIA 3M0LA 1BYBA 1MFVA 5CKSA 5D09A 1YPXA 2PS2A 3G18A 1VHCA 2Y88A 1KTNA 5EY5A 1L2QA 2H3BA 1LDCA 3S1GA 1XSKA 4WDWA 4UTMA 3S47A 1QASA 4P8VA 5K9CA 4PUWA 1OFPA 2ZWZA 3WY1A 1B1YA 2XIQA 3B0YA 1QW8A 1G4EA 3UWQA 4KH2A 3GBEA 5EBAA 4DAFA 4US5D 3CQIA 2MUCA 2PDPA 4H4XA 1O68A 1QBAA 1D7FA 1IHIA 1UOKA 1AQHA 4NAEA 1JCTA 1UROA 1FECA 2V2HA 1W9PA 3OG2A 1XCFA 2I9EA 3F4WA 4RNFA 4Q8MA 1I1WA 5E9XA 2OSXA 5REQA 1EOKA 4DJDA 4HNVA 4BWLA 1R86A 4KCUA 3AICA 3NA8A 2E5DA 1K6AA 3AXXA 2POZA 4DBWA 4PMXA 4UMCA 2C15A 5JBDA 2YB4A 1VFOA 4M80A 4W85A</