3JZUA

Crystal structure of dipeptide epimerase from enterococcus faecalis v583 complexed with mg and dipeptide l-leu-l-tyr
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
353
structure length
353
Chain Sequence
MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGEGGPGIFITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKISAFAPAAKAAIDIACYDLMGQKAQLPLYQLLGGYDNQVITDITLGIDEPNVMAQKAVEKVKLGFDTLKIKVGTGIEADIARVKAIREAVGFDIKLRLDANQAWTPKDAVKAIQALADYQIELVEQPVKRRDLEGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAEETTIGITAAAHLAAAQKNITRADLDATFGLETAPVTGGVSLEAKPLLELGEAAGLGIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptide Epimerase
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Enterococcus faecalis v583
molecule tags Isomerase
total genus 124
structure length 353
sequence length 353
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3jzuA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3jzuA01
3BOXA 4HCDA 3PWGA 3UCCA 2P8BA 3EKGA 3UJ2A 2POZA 1NELA 3U9IA 3ZLGA 3I6EA 1ONEA 4GYPA 1MDRA 2XH0A 4Z1YA 4IT1A 2QVHA 3QN3A 3PFRA 4HN8A 3DERA 4EWJA 1OEPA 1PDZA 4K8GA 4GGBA 1IYXA 3NXLA 3VCNA 3JW7A 3ES8A 3SN4A 2PA6A 4IP5A 7ENLA 1E9IA 4K2SA 2OG9A 1EBHA 3V5FA 3VC5A 2AKZA 3GD6A 2O56A 4GYPC 1JCTA 3UJRA 4E4FA 1SJBA 2PPGA 4ROPA 4M0XA 3TWAA 3PK7A 2P8CA 1KKOA 1MUCA 3FJ4A 1TKKA 3TJ4A 1R0MA 4E5TA 1BKHA 3CXOA 4DN1A 4HPNA 1EC7A 3UJEA 1EBGA 2GSHA 3V3WA 2AL2A 2OZ8A 3SN0A 2OZTA 2PGWA 2HXUA 3ZLHA 3IJLA 4GGHA 3IK4A 3IJIA 4MKSA 2OO6A 2XH4A 2QJNA 3OZMA 3VCCA 1KD0A 3SJNA 4A6GA 2HNEA 3K1GA 4KPLA 3UJFA 4HCLA 1BQGA 5IDZA 3HPFA 2OKTA 3UCDA 2PTZA 3DFHA 4FP1A 1RVKA 3UJSA 4A35A 3TOYA 1FHVA 1JPDX 3FXGA 3DEQA 3QLDA 5J04A 3DG7A 3RCYA 2XH7A 4GFIA 2PGEA 3QKEA 3STPA 2AL2B 3H7VA 2DW6A 3I4KA 2PODA 5FJTA 4MMWA 5ENLA 2FYMA 1ECQA 3MWCA 2GL5A 3DG6A 4K1WA 3TCSA 4MGGA 1JPMA 4DXKA 4KT2A 4FI4A 2HZGA 5FJUA 4G8TA 1MRAA 3CT2A 4KEMA 3MSYA 1KCZA 3RO6A 4HNLA 3RITA 3RGTA 3CK5A 3OZYA 3H70A 3FVDA 3H12A 1KKRA 3MUCA 3OP2A 2PU1A 3T4WA 3S47A 3FYYA 2I5QA 3UGVA 1WUFA 2DW7A 2OFJA 2RDXA 3BJSA 2OPJA 3MZNA 4M6UA 2PP3A 2QDDA 2FKPA 3UXKA 3R11A 3P3BA 4X2PA 2XH2A 1L8PA 4H2HA 1TZZA 4IL0A 1W6TA 2PP0A 1MNSA 2PU0A 3RR1A 3R0KA 3MKCA 4YWSA 3DFYA 3MQTA 4JN7A 3N4FA 2XGZA 3Q45A 3UXLA 4DHGA 3KUMA 3N4EA 2PTWA 3TJIA 4DWDA 1EC8A 3H8AA 5BOFA 2OQYA 3N6JA 2MNRA 3R1ZA 4ZCWA 4HCHA 3QTPA 2AKMA 3VFCA 3D46A 6ENLA 1F9CA 4E8GA 2OZ3A 3VDGA 2PSNA 3GC2A 3GO2A 1P48A 1MDLA 1EC9A 3NFUA 4J3ZA 3QPEA 2OLAA 3RRAA 4IZGA 3S5SA 3TWBA 3FV9A 3R25A 1R6WA 2P3ZA 1DTNA 2GGEA 2PTXA 3ENLA 3OW1A 3ZVHA 3JVAA 2PTYA 4HNCA 2ZADA 3I6TA 4J1OA 3P93A 2ONEA 3TTEA 3ZLFA 2GGHA 3T9PA 4IP4A 4H19A 3DIPA 3BSMA 2GGJA 3CYJA 1SJCA 4H1ZA 2PMQA 4ZA0A 1JDFA 1PDYA 3GY1A 3DDMA 4GMEA 4H83A 3R0UA 2P88A 3NO1A 3MY9A 3DGBA 4E6MA 3CAWA 4JN8A 4ENLA 5BOEA 3SQSA 2QJJA 2OQHA 4G7FA 2OX4A 3V5CA 1ELSA 3CB3A 3B97A 2MUCA 3OTRA 1XPYA 3TQPA 2QGYA 4E4UA 3EEZA 4JHMA 4GISA 3N6HA 3DESA 3ZVHB 4DX3A 2QQ6A 2QJMA 2PS2A 2P0IA 1FHUA 3DG3A 3V4BA 5FJPA 3THUA 3IJQA 2PP1A 2GGGA 4HYRA 4Z17A 3ZVIA 2HXTA 2GGIA 4IHCA 3VA8A 1WUEA 3ES7A 3PWIA 3P0WA 1P43A 4IL2A 1XS2A 3SSZA 3TW9A 3FCPA 5FJOA 1SJAA 5EU9A 1TE6A 2AL1A 2XSXA 4F4RA 3U4FA 3D47A 1NU5A 2ZC8A 3VC6A 3SN1A 1SJDA 3T6CA 3NZGA 2PCEA 2GDQA 4DYEA 3Q4DA 3T8QA 3JZUA 4GIRA 2OVLA 2QDEA 3R10A 4KWSA 3OPSA 5FJRA 3SBFA 2NQLA 2CHRA 1YEYA 4A3RA
chains in the Genus database with same CATH superfamily
3S1UA 4KGJA 3NYZA 3TA9A 3EKGA 3EOSA 4KETA 4ZO7A 2QDHA 2WZHA 2VURA 5ECVA 4EOUA 2VXNA 2VOTA 3HM7A 3E6EA 1VFOA 2Z1BA 2BXYA 1IGSA 1VRDA 2OT1A 4PODA 3I7QA 3TX9A 3QFWA 3R7MA 4AZHA 1HX0A 3GZ3A 4R34A 4H04A 1XQKA 3UR7A 2AQOA 4A8LA 4US6A 3ITGA 1N82A 3TR2A 1D7FA 1P6WA 3A5FA 4MWAA 3VIJA 1Q6LA 2WJEA 4E4FA 1SJBA 4XUYA 2XTKA 5TAOA 2ZRVA 4C1LA 3OA5A 5A6KA 4M0XA 2YGYA 1UQZA 4YIWA 3TWAA 1QJWA 4XVEA 2ZRYA 3WDRA 1KKOA 4UTUA 3VGDA 3MUAA 3WH6A 1T0OA 1OFPA 3OB8A 2WNZA 4X2RA 2DSWA 4PMZA 3NVTA 2E6AA 1J10A 4BQ5A 2CWXA 1UWSA 2BVWA 4YXGA 1ICQA 5AVHA 4RE4A 4PC8A 2Y2WA 3W53A 4UUIA 3UJFA 4JKLA 5DY2A 4G5DA 1K02A 5AC7A 2OEJA 1SFTA 2PTZA 2QCNA 4GCXA 1R3SA 3BMVA 3WDJA 1KXTA 1S5NA 1AH0A 2DIJA 3WY1A 1U30A 3G1VA 4GRTA 5FI8A 4HTBA 1FFVC 3FGCA 2J7GA 4IGSA 3VDCA 1GRFA 4JX5A 5EPDA 1TUXA 2EQ8A 4IJCA 3YPIA 5ENLA 2YPIA 2GOUA 4U5KA 4UMBA 1I45A 4UZSA 3UWZA 1BPLB 4KT2A 4FI4A 4XSLA 3LTSA 2QAPA 4M56A 2HZGA 2WANA 4K7YA 4C6KA 3DUGA 3DAQA 4C6OA 2WNWA 3BSHA 4G8TA 2YDSA 3AYVA 3RO6A 3WH5A 2EG6A 4EP8C 1JZ8A 5HOSA 5BRBA 1UWAA 3N2BA 4NJGA 1S2VA 1AH4A 1DJIA 3ARQA 2E77A 1TVLA 2WOQA 2VDHA 5U25A 4CNOA 4XO6A 2BGNE 2C14A 2OFJA 4MAZA 4DF0A 4E0CA 3BC9A 4UFIA 3LPOA 2OPJA 2QAFA 3TN4A 3EMZA 3HOJA 3GRIA 4IIHA 5JIWA 2WPGA 2NLIA 1VBGA 1EJTC 2P53A 1W6TA 6ALDA 4JTSA 1IEQA 1JCYA 4AD2A 5BNKA 1FEAA 4K37A 3WUEA 1YKWA 2PTWA 3W7PA 1SZRA 4N6EA 1NSJA 1LOLA 4LY4A 2IKIA 3VOCA 4UNKA 3ERPA 2P5NA 2GDUA 2I9EA 3LHVA 5D9NA 3RF9A 1CTNA 3R1ZA 3T2QA 2FZ9A 2R1PA 3CZ8A 3KZSA 4JD4A 3VFCA 1BWCA 1US0A 1BLIA 1RUSA 2C3ZA 5E0CA 1KRAC 1QI4A 4FS9A 1NF7A 1JRPA 4MSSA 2RABA 1LPFA 5CKSA 4KWVA 1ODZA 2WC4A 3TSBA 4H9TA 1UYQA 1T40A 3NVVB 4XG1A 2YR1A 1TV3A 1M6IA 3PUDA 2ZADA 4JTLA 1OX6A 3A9IA 2UBPC 3KRZA 5T8GA 1FECA 8XIMA 4S3GA 4MNMA 2XN0A 1V6VA 1QFEA 4ZA0A 1KQYA 3T2PA 1T99A 2EBNA 2R9ZA 3A9BA 4FNPA 3C0JA 1VJIA 3U5YA 3W24A 1TR1A 2EF9A 3B4YA 4EXQA 3N3TA 7A3HA 2X09A 3CAWA 1KN0A 4IMAA 3LV5A 3GXPA 3DX5A 1A0EA 1JPKA 2CETA 4HOWA 3P84A 2F7FA 3V5CA 3VABA 1J6PA 4KCVA 2GDVA 2MUCA 1CI1A 1C8YA 3URBA 3ZT5A 1BAGA 3MUIA 3N6HA 2WZIA 5HBFA 5ER0A 4CUCA 4DX3A 1MUMA 3L7RA 4NX0A 2BY2A 3RLVA 3OVRA 3W85A 1VCVA 1X6UA 1WE5A 5ABFB 1FO4A 1GVEA 3VVGA 2PP1A 2FMOA 3GXNA 1XGZA 3W38A 3B3DA 1M1BA 1H5VA 5BMXA 2C6QA 4ERGA 4KEVA 1CXFA 2ZIDA 4AD3A 2CLFA 2F6KA 3DC8A 3VKKA 2A3EA 4IFRA 1RQBA 7PTDA 4AZCA 4AVFA 1G4PA 1N55A 1Q8JA 3MPGA 6A3HA 1BVZA 5LGZA 3TEVA 3GDBA 4GD0A 1PKMA 5DX7A 4OTKA 3SIMA 1XJBA 3WLSA 3GHUA 2OQLA 4B91A 5H2ZA 4Y96A 2E5AA 4H4XA 2G3FA 2W3SA 5DELA 1ZPTA 3GFXA 4UBPC 3MHGA 2WSRA 1OCBA 2YL5A 4JPGA 4DUVA 4LPCA 4AY1A 3W6LA 1UQYA 2R1MA 1X1ZA 4BI6A 3TSMA 3ARZA 1AMKA 1MXGA 4JIPA 1XSIA 2WK2A 3PJWA 3QGVA 3GIQA 3VKCA 1MEHA 2XN1A 1TG7A 1LVLA 4N42A 1Q3NA 3ZWSA 3NXFA 3LZ3A 1C9DA 4BR1A 1PWMA 2CCRA 1R8LA 3OGRA 3HPAA 1TRDA 1KRMA 3NSNA 3G1DA 1W5PA 3GIPA 3PUOA 1T6MA 4DLFA 2NWSA 4IP5A 7ENLA 1E9IA 3II4A 1QNRA 5KEZA 3VX0A 1JGMA 2X7WA 2YZRA 4APNA 1ISWA 3WQ5A 3SUUA 4X9SA 3QFBA 3R8GA 3ABOA 1VJZA 3AC0A 4J35A 2WMHA 4BI7A 1REQA 4K3ZA 2HWGA 1R0MA 3QC0A 3FW6A 4D72A 1WYGA 5A6BA 1ZGDA 1CIUA 3V3WA 3EB2A 1NAL1 2ADAA 1HP5A 1B9BA 4ADTA 1FXPA 5C70A 3CQJA 3WLHA 3W83A 3EX1A 3GHSA 1PKLA 4M80A 3NCOA 4J3WA 4LCSA 4JY9A 2J8GA 4EPEC 2WQDA 1A53A 3MKVA 3LXDA 5C7VA 4LVGA 3HPFA 4H4QA 2C91A 3EEGA 3UY7A 1OYCA 2ICSA 3SCTA 2H6RA 3Q65A 1EJVC 1RVKA 2BP1A 4HSNA 2IQTA 5CLWA 2A8XA 4YWIA 2FQIA 1G94A 3M47A 2F5ZA 3GU9A 4CN1A 4LVFA 3KCJA 1P7TB 3IIVA 4C65A 3BMWA 2QUVA 4ZQRA 1F6KA 3OLGA 4YYFA 2YXOA 4J3TA 4EQRA 3URHA 3I4KA 3UU0A 4MMWA 1EGMA 8CGTA 3D9XA 3PUEA 1HJWA 3DENA 3PNZA 4NY2A 2J27A 3QQ1A 2FYMA 1ECQA 3GD4A 1MXSA 4MYAA 1SSGA 1P0EA 1J0KA 4P7OA 3NA8A 4TUFA 1ISZA 2BMBA 4QIUA 4A22A 2ZDSA 2RHGA 3LM7A 4XAGA 1A5AA 3KP0A 1FP8A 2WHMA 1E72M 3CK5A 4QP0A 3BMXA 4W86A 4TX6A 3MVIA 1S3TC 4XAFA 2YB4A 4YCOA 3MI6A 3H12A 3U48A 4PTNA 3H26A 3MUY1 2NWRA 3KS6A 2I5QA 1W9XA 3SR7A 2RDXA 2W92A 2ZXBA 3W2NA 4EM3A 4XZIA 3E0IA 1QK0A 1GEUA 3G8EA 2GVEA 1NDVA 4XSMA 1SQ7A 2XH2A 4P7QA 2CNCA 1E4LA 3SCUA 1OT1A 3N9KA 1C90A 2GK1B 2YZ5A 3R0KA 4IUGA 3ZR4A 2R14A 4IIDA 2X1RA 3W7MA 5G4HC 2GQ9A 1K77A 3VOIA 2BB0A 3M0HA 2Q01A 3NO5A 3N4FA 1V6YA 3BLOA 3Q45A 1WO2A 3GM8A 5EGRA 5CJ5A 3FS2A 1UUOA 3FK4A 2EPLX 3KZPA 4I7VA 4PMUA 4WR3A 1H7XA 4EM4A 3GBDA 4C90A 4H9MA 1HJSA 4ZB0A 3LPGA 3RX2A 6ENLA 1F9CA 1SFJA 7REQB 4S23A 1G0CA 2EKCA 5BYWA 1VZWA 4IMDA 4LRTA 3NFUA 3WLOA 3S5SA 4IZGA 5G5GB 2F6UA 3KTXA 1X1OA 3VOFA 3QV6A 4MY8A 1N5WC 3GVVA 4UQEA 1ZMCA 4Z2GA 4Y2WA 1XYMA 1XIGA 2W63A 4JQ4A 2Y5SA 4U10A 2C19A 2FJUB 4OBSA 3BO9A 2YVGA 3S6OA 2X1UA 3P93A 4FMVA 1P5BA 4GINA 1ME7A 1UG6A 1V5XA 2FGZA 2JFEX 3SY8A 3IVSA 3MMTA 3PTMA 1DXEA 4UFLA 1KCKA 3SURA 2PGFA 2YYUA 5EBUA 4CNPA 1IXQA 4P8UA 1DJWA 1PHQA 2FVMA 3MY9A 4Q4QA 4R7OA 4HZ7A 3W23A 2BCPA 2QJJA 4HD5A 3W7GA 1I2OA 3HQOA 1UR8A 5A8GA 3SGGA 1GRHA 3EGJA 4JTDA 1LZOA 3U2ZA 4YNGA 3VCRA 1KM4A 5AC8A 2YBUA 3EXSA 1DQXA 5KVIA 3KHJA 4GNKB 2V38A 1AODA 3CGEA 1LG1A 3MVTA 2B81A 5FJPA 2EO7A 7XIMA 3I7SA 4DUWA 1UR2A 3DJJA 1Q6CA 4KIEA 4MB5A 3TJLA 4DZAA 4IPJA 1KC7A 2DT0A 1YHTA 1ZFJA 1OFRA 4OFCA 3KRBA 2D0HA 2OO0A 2PURA 2VWSA 4PMOA 3RFAA 2VEPA 1S2AA 4ICNA 5HQEA 3R2GA 2VTFA 1CLKA 2G97A 3OBEA 1I4NA 3VZZA 2WC3A 2ANUA 4L4OA 1HKKA 4G56A 1T8XA 3PBUA 1UWIA 2HCVA 1EIBA 4ECLA 2G8ZA 3W7CA 3CHEA 1VCFA 2XIIA 2J25A 1JYXA 4DI8A 3M0XA 5FACA 3F2BA 3TSDA 5DN1A 2NVCA 2PLCA 3U57A 4ZE5A 4LC8A 4B4FA 2OOFA 4B4HA 4D6CA 2YJQA 1NWRA 4EANA 1UPPA 1RQHA 3BANA 3IARA 3T6CA 3SQPA 1K4HA 3W1RA 3NDYA 4MUPA 1I1XA 3RX3A 3JZUA 3NQMA 3EZ4A 2QDEA 5SWUA 4KWSA 2NVDA 1VFHA 3G22A 4IJBA 3KOYA 1UOZA 5D2TA 2W62A 1R47A 4FXJA 2YXXA 4JFSA 3IV3A 4B9ZA 3LCFA 3TYCA 4LV9A 2POZA 5AHIA 2D2HA 4R53A 3U9IA 1F05A 3M6DA 3O1NA 1W0MA 2QJHA 4V33A 2YVJA 4MB1A 3AYRA 4B2DA 2FIQA 3NSMA 3PBYA 1TPWA 4IF2A 4K8GA 3WL1A 1VF8A 3ES8A 4H6RA 2PA6A 2VUNA 1T41A 2WWCA 4C6CA 4C7GA 3KBMA 4F0KA 1XYLA 3EWCA 1MYRA 5A6JA 4QE1A 2VVSA 2Q8XA 4D6GA 1HO4A 4EACA 1RQEA 1NHQA 3A3XA 2WCAA 4UTKA 1XYAA 3MWAA 6PTDA 5JBEA 1WYIA 2PEVA 1BWKA 4PMXA 4XTDA 1F8WA 1FCUA 4Y8EA 3IRSA 2FZNA 1SR0A 2DZPA 4US5A 2ZWYA 1YQ2A 3WH8A 4FX9A 1UR1A 4CGTA 5HNRA 4NYYA 5I2UA 2ZXAA 1B90A 4NVTA 4RPQA 3PPCA 5CZ0A 1NDAA 4IUOA 4S2BA 2PRHA 4W5UA 1XLHA 1XKJA 4JIHA 4IXXA 4GBDA 3PP7A 4DY1A 2YQUA 4FNSA 3ATYA 1EYEA 4FP1A 3PC0A 5DQPA 5EMKA 2EEXA 3OZPA 4UTHA 1CDGA 3OYXA 2WXDM 3FXGA 4JKKA 3A7AA 5EL1A 4AYSA 1CBGA 2IPFA 5AYXA 3SCRA 3B0YA 3M7SA 1XDMA 2IKHA 3G2GA 3LQLA 3GH7A 1N8WA 1TWZA 4KESA 3VE9A 2QJGA 2ZA3A 4CD4A 1W1PA 1NOFA 2VFDA 1IE7C 1KCZA 5CZKA 3SCOA 3F4DA 1JAEA 1W3LA 1OVDA 2DDXA 3PF3A 2ZOXA 4MNKA 2RUSA 3TW7A 4E2VA 4BZYA 1M03A 2D73A 2QS8A 4IMCA 2FPTA 1R38A 1CLVA 3FVDA 3CH0A 4AVNA 1EXPA 1RH9A 4D8AA 5D2YA 2O7QA 4OOZA 5AECA 5HPOA 2V68A 1QHPA 1GRTA 3TQVA 4U2ZA 1QNSA 2WSYA 2ZX8A 1UR3M 2OT0A 4GJJA 4EWND 1EGVA 5A6MA 1EPVA 4X61A 2QNEA 3FSTA 2VRKA 3HFTA 1KFCA 3D3AA 3A3HA 2HMCA 1EFZA 1GERA 4X2PA 4H4IA 4XZLX 4GUJA 3PB0A 5G4EA 4N9CA 1OX4A 2I5GA 4DWSB 5FSEC 2WPEA 4TVCA 3ECQA 3MMWA 3W70A 3R07C 3BAXA 3SAZA 3IUHA 4Y9AA 4JTHA 1X2GA 1FDZA 3N4EA 5E6ZA 5FEWA 1U1JA 3GTHA 4O52A 3E0VA 1Q65A 3P0XA 4Z1BA 1K7EA 3G1YA 1RP8A 4EQSA 2MNRA 3AIEA 3BAYA 3MS8A 6REQA 3EWBX 3SSJA 5KETA 3L4VA 5I09A 1B1YA 3UZYA 4P8WA 3SUVA 3PBVA 5T9BG 5L9FA 2XYLA 2D3NA 4KGLA 4W7VA 2OZ3A 2J62A 3UZ5A 4GBUA 3L2IA 2DU2A 1XG3A 3NPVA 3VGEA 4GYFA 5I3KA 1KTCA 1NIUA 3H4GA 3E0FA 3FAWA 4JFVA 1HQTA 5D8ZA 4WY0A 3OLDA 3E0LA 2H9AB 1DIKA 2DZWA 1W9VA 5HNUA 1MQRA 1V3MA 3TMLA 4IIEA 1Q6QA 2IQ0A 1GQIA 3EB4A 2WCSA 3VOHA 4F2TA 3BOLA 4NHVA 3CYJA 3H7UA 4DNAA 1QPOA 1XH0A 2XIBA 2WMIA 5A8NA 1R3RA 3M0MA 3P82A 3DGZA 4WHBA 5IM51 4GRSA 2D2GA 3WBEA 1CPUA 2GJXA 4XV0A 2CBUA 4G7FA 3GWQA 2YYTA 1EKOA 2WPBA 5DBUA 2J47A 4Q4MA 4LF1A 3QTGA 1K7XA 2FFIA 3LXCA 2Z24A 4E4UA 3S3GA 1WA3A 4NAFA 1DE6A 1XH2A 3WMCA 1F8IA 4JX4A 1AW2A 4MUZA 1QW7A 2PDIA 4A3YA 1V3IA 3LMZA 1OHLA 4Z1AA 3V5OA 2E1DA 1QU4A 1N2VA 4LX4A 4QJ3B 3A22A 2Y89A 3MP3A 5H91A 3FJNA 2NUXA 4AD0A 3DOPA 1AH3A 2ALDA 1N8FA 2IS7A 4DJED 3SCQA 5HNNA 2PDUA 3NQ6A 5CEWA 1OCJA 1KCXA 3AJXA 1P43A 3HQPA 2GQ3A 4H7ZA 3B9JB 1LL6A 4FIRA 4WSJA 2BY3A 2GR1A 4I5UA 4UTIA 2YXGA 2O9OA 3LCIA 3M5YA 4ES4A 3CLMA 2J7HA 1PZ3A 2GVGA 3CZEA 4LF2A 2QVNA 4GFSA 5TR3A 2QJIA 2TPRA 2INFA 1O4UA 4DYKA 1NDZA 3PJXA 4GI6A 3Q4DA 3L9CA 4DM2A 3V36A 1AQHA 3KWXA 3W37A 4QROA 2W0UA 1DJNA 2FZBA 1KNWA 2DPEA 1JL8A 4C5ZA 1BSIA 4CNUA 1NARA 5D9MA 2IW0A 3F4VA 5FIPA 1OJTA 3AHZA 1FFQA 1R87A 4O19A 1TTJA 1HKVA 2G3MA 3UCCA 3GNRA 4AZIA 1HG3A 5A2BA 3TMQA 3HW2A 4M6PA 1GTHA 1EPXA 3MYOA 2Z1KA 3SB0A 1YIXA 2DVTA 2YFOA 3AFBA 3GXTA 1IYXA 3THAA 3VNLA 1LWHA 1AJ0A 2E8YA 3B06A 4A8NA 3GW3A 5HPCA 1H09A 3CH9A 1S2UA 1XGEA 3NQ7A 2VMFA 3CLWA 4ADUA 4S39A 4OU1A 3W7QA 1AQFA 1XIJA 1K7FA 1MUCA 4KW2A 4KH2A 1NWSA 1N61C 3GC4A 3E12A 1XCXA 3AMDA 1XBZA 2PCQA 1S2WA 3NL3A 3UG5A 3S2LA 2HQMA 3MBDA 1KM2A 4LVBA 3INPA 1DORA 1IT7A 3VPLA 1V0NA 1BFNA 4H4SA 5CAHA 1UJQA 4C5YA 4R7JA 4WSHA 5BWFA 3TV8A 3IC9A 3K1GA 1SZEA 1UD8A 4K7VA 1H1YA 2F8QA 4ZEPA 2QV5A 4DYJA 3LRMA 1B4KA 1AOGA 1JPDX 2HS8A 3WQPA 3KHDA 1TJ0A 2QPUA 2Q8ZA 4PMNA 3C8FA 4PTVA 3CC1A 1B3XA 3C2VA 3LS9A 4PTWA 3M7WA 1OGSA 2DW6A 3GXDA 1OIMA 2A5HA 1RXOB 3WD1A 3U8GA 4J27A 2ODOA 4RPPA 3W25A 3W7EA 3GDTA 1QRQA 3MHFA 4H8NA 3QV9A 3BGJA 2ISWA 4EK7A 2ZVRA 1BD0A 4G6CA 4O14A 4EPBC 3M64A 2VGGA 4QS5A 1E0UA 1XRSA 3H6OA 3S1XA 1S2CA 3WQDA 1D8CA 2C1IA 3AWNA 3QZ6A 4UTTC 3CB8A 4MY1A 2DORA 1G69A 3HPZA 2DJXA 3OP2A 2O9PA 4H00A 4IMGA 2EPMX 4PE8A 4UMCA 3UZZA 1V3LA 4ZO8A 5G5IA 1G7VA 2GWGA 5LA1A 5HR7A 3FGCB 4NI8A 3MZNA 3GXFA 3OODA 3S2MA 1XC4A 3CMFA 3IAPA 4JIIX 1SGJA 4WOZA 4G2DA 5A5WA 1V03A 4NAEA 1FWFC 2E5CA 3GNPA 4AU0A 4MFDA 1XV8A 4DJFD 2CZFA 4I9MA 4ZO9A 1OCQA 3WNKA 2D20A 3FA5A 3ZFHA 2YA2A 3RM8A 1CENA 2GPTA 3EWXA 5FSDC 1W3KA 1QASA 3SY5A 4GX8A 1M3UA 3C3NA 4BCEA 2VQTA 2RFGA 1F3XA 1U22A 2XGIA 3CTLA 1U83A 2X1IA 1MZRA 2ON3A 2WBGA 3NQGA 4A2RA 1V3HA 2G96A 1HKWA 5GJMA 4M1BA 3UWEA 3M9YA 1K70A 4CN6A 4LUJA 4IP7A 3W7HA 4PB4A 1EDTA 1QK2A 4XTIA 1GYNA 3AO0A 5C6MA 3GHTA 6TAAA 3SGZA 2GQ8A 4GZIA 1H5YA 4CU7A 1JCMP 1MRQA 3I4EA 3VUSA 4GNVA 1TV7A 2CBVA 3TKFA 1HKMA 3EOEA 2AMXA 2Z6IA 3ELFA 4IQDA 4D1JA 3HGJA 2NXIA 5LA0A 1RPKA 4AY7A 4JTIA 4WSKA 3OW1A 2C8NA 4KQNA 3E2RA 2INZA 3AI0A 5F7UA 4HNNA 4GCAA 4H50A 4GWEA 3VNZA 2O9RA 3RLHA 3DC0A 3P8JA 4O1FA 5FAJA 2QIIA 3HFYA 3T9PA 3TLLA 4AH7A 3UR8A 3MBFA 5A95A 2NXGA 3SR6B 2D0FA 1JJKA 3VMNA 3LI0A 3M16A 2VL4A 4GVIA 3W0KA 2PZNA 1E0XA 1JDCA 1ITXA 3A23A 4LXFA 3RLGA 1MEWA 3L4WA 3TZNA 1A47A 3GH4A 1UWUA 3NQFA 2Y6ZA 4HP5A 3WDHA 2QV4A 3R4IA 1E0WA 8RUCA 3A4AA 4LVAA 3M07A 2J9XA 3BJTA 2CC0A 1DEDA 1FKWA 4GISA 1J2BA 4ERAA 3F5LA 2VEFA 3B9DA 3SJ3A 2RAGA 4C6IA 3ABXA 3S6DA 3E49A 1HVXA 3V4BA 5XIAA 3PPFA 1XIEA 3I3DA 1FHDA 2ZFAA 4YYCA 4L1XA 1LUCA 3A4XA 3O07A 3EWDA 5TQLA 1WBHA 4NNBA 2E3ZA 4CVUA 2TMDA 1LLOA 1EJSC 3DHFA 1TX2A 2Z4GA 2HDJA 2C15A 1VIWA 1UKOA 1TWIA 4L1WA 2X50A 1H50A 2PC8A 1XIBA 4DJDD 3CPUA 4MNLA 3V35A 2VM8A 1FWHC 4W7UA 2PWEA 5EMLA 2CYGA 2BZNA 5FJOA 2J88A 4LW7A 1XQLA 5HQMA 2MANA 5GVJA 1NHPA 3BLLA 2FTYA 4WVXA 2AL1A 4Q8PA 2BG5A 3N18A 2ZA1A 2I7GA 2QYGA 3D47A 5HUOA 1Y5VA 3QR3A 4FIQA 1MQPA 4B5VA 2GDQA 4DBWA 3E0WA 4PBGA 4ADSA 4MG4A 1FY6A 1WX0A 2Y7FA 3PNUA 4JEJA 2VDGA 3EANA 3WLIA 4TX9A 3W7IA 3N15A 2CHRA 3RCNA 2NX1A 4A3RA 2VNCA 3BOXA 1QNOA 3W7OA 1GJPA 3O6CA 3VMPA 4AC7C 5CPSA 4AZCB 4NZFA 4HU8A 4WKHA 2F84A 1S2TA 3NVWB 4E4PA 1PX4A 3W1TA 3WJYA 4W4QA 3NQ2A 4LUTB 3HBLA 1HFBA 5CH9A 5CBIA 4RZ4A 4M24A 3URNA 3CWNA 3GNDA 3WLPA 2WVTA 1M7OA 4P61A 3QOKA 4R7WA 2W61A 3PJUA 2O56A 3HG4A 2C0HA 4AIEA 3T0DA 3TQKA 1S1PA 3IGSA 5IBXA 3PG8A 3QLLA 2QAEA 5EFDA 2QLYA 2CLEA 5HDRA 1UKSA 1XCWA 4FXSA 4XUGA 5CAKA 5HNTA 4BWLA 2W3RA 1JF5A 3TTSA 3ZJKA 3H22A 1H6VA 1EBGA 4W93A 4PCFA 1JAKA 3SN0A 4R88A 4B5WA 3N9RA 3OG3A 2RGMA 3EWYA 3ZLHA 1H1NA 5FF2A 4FA3A 3IJIA 1VHNA 1GT8A 2WHLA 5CPOA 5FKYA 3W27A 2V3BA 5K9CA 3P6LA 4E2OA 4AZ5A 3XINA 5J8LA 2X16A 2YBVA 5FEXA 3SUTA 3NRZB 5A6LA 4IOTA 3M5VA 4BY3A 5BROA 3UD6A 2QZRA 5D04C 5C2XA 3W6MA 2EJ1A 3V1HA 5EFFA 2XSBA 2OYMA 1I2PA 1X7FA 1YDVA 3IAQA 4LUIA 1ZP4A 2I9UA 4UQBA 3MCOA 1UC4A 1C92A 4JTFA 1RY8A 5FF3A 3UG3A 7TIMA 5I06A 3H7VA 4BQ2A 4BQ4A 1JUEA 4W5ZA 2A79A 1ADOA 1Q8AA 1XDJA 3KM8A 2DT1A 4Z1DA 3F1QA 1BXNA 2VFIA 3W7LA 1YTEA 1XL9A 5I5RA 2BDQA 1WKYA 4WOQA 3TYZA 2QDGA 4DXXA 3TJXA 4HMDA 2Y5EA 2CWNA 4CEUC 2Z00A 1EBDA 1LROA 5A8PA 2JK6A 2WPCA 4O18A 3CPGA 1K8XA 1NF0A 3WQVA 3VD9A 2PDFA 3L12A 2CLHA 2DSZA 1Q4NX 3A47A 2WP5A 5H1WA 3RK8A 3WN6A 1XYCA 4GO8A 1O60A 4JTCA 4P7LA 2QDDA 2H8ZA 5HANA 4LALA 3ZJ7A 4KCTA 2E1WA 4H9UA 2UZ9A 1G4TA 3G6MA 3VDBA 2X0YA 1VRXA 3C4UA 3ONCA 1D3CA 4H4YA 5DXYA 4PH6A 4LQ1A 1TA3B 1QPRA 4RK8A 4WX2A 1OB0A 4DWDA 2E3TA 5CZJA 1FWTA 5HA7A 3JR2A 1M5WA 5BOFA 3KP1A 3E1F1 3N6JA 4I9JA 2I1OA 4HK7A 3ARRA 2CXGA 1E55A 1U1HA 1GOQA 2Y24A 4H6KA 2OYKA 1QNVA 4ATWA 4AHQA 3ZS4A 1PAMA 3IACA 1H7RA 4O1BA 1YXCA 2G50A 2YAUA 1E6QM 1V0KA 1ZAIA 2Y1HA 3LY0A 1VIZA 1XBYA 4K38A 4WLCA 1M68A 1GVYA 4NX5A 1QO2A 3RRAA 1XC6A 4WKAA 4ATLA 2DEPA 4A8IA 3CAVA 3WD2A 1IHIA 1DE5A 3ZT6A 3ARPA 4O1EA 1FWWA 1XLMA 2GGEA 1Y7VA 1J2WA 3ENLA 4JHZA 4ORMA 5LHFA 2PTYA 1IR2A 1GRBA 1JEHA 4DZ5A 3IK2A 2VGFA 4RV8A 4RDVA 1C7TA 1SM9A 1SJCA 3V18A 3WDIA 1PDYA 1TPH1 3NAVA 4GMEA 4HA4A 5DMNA 3GU2A 2Y4SA 4IGNA 4NZ5A 2WBKA 2CDUA 3L5LA 3MANA 3RG6A 1XX1A 1TYPA 2INEA 1W9UA 2OQHA 5AB3A 4AIBA 4Z2KA 4XIMA 2E6YA 1KV8A 1V77A 1ZJBA 1IXPA 1G4SA 3TQPA 3MUXA 5AC4A 1DPMA 2HROA 4V2XA 5DBTA 2V67A 5MHBA 1UBSA 2QCMA 5A6AA 2ZWZA 2PS2A 1V3JA 5ABEA 4URIA 3AS0A 3C56A 5K4XA 4RL3A 1RK6A 1LQ0A 1ZALA 4ZO6A 1C3FA 4JQ9A 5KMYA 3UPBA 1BXBA 2VEMA 3IJ7A 4D6IA 4JNZA 1PCKA 2REQB 1PTDA 2ZUTA 5DEZA 1B31A 1EH9A 4O0KA 2CU0A 3DYOA 1R85A 2WB5A 7TAAA 3F2DA 1QAPA 2H90A 2JF7A 3RN6A 3GS6A 2HPMA 1BTCA 4CD7A 2J7FA 3S1WA 4YTSA 2JBMA 4L1GA 2AAAA 4OHQA 3WD4A 1V51A 2WPFA 3OJGA 3WELA 1E15A 1UROA 2CITA 4DYEA 3B9AA 1G67A 1AUSL 1H4PA 3P60A 4FEZA 4IISA 3W86A 5EYWA 3KVMA 3BAKA 4DI9A 3GTNA 3LYEA 2PDMA 1XIMA 2WKGA 5FEZA 5M17A 1J5TA 9XIAA 2QEZA 2R8WA 4D6FA 1O66A 3I6EA 2VR5A 1KRCC 1GPWA 4TTGA 1UWRA 1WXJA 3NWRA 1SR9A 2I5IA 2WOVA 4H9YA 3B0UX 3W29A 2ZUUA 3OBKA 3ZR5A 3E96A 1MOKA 1UZ4A 4XD4A 4PGLA 3V0TA 4EMIA 1KBJA 2C1GA 2DT3A 4AWEA 4K2SA 1LORA 3MO4A 4RZ6A 4XB3A 1VLWA 1BVNP 4J9JA 4YHEA 1AQMA 2W79A 1ML1A 2Y70A 2YBTA 3H7RA 3KDNA 3A24A 1LOQA 3SW6A 4JYEA 2CHOA 5D09A 2X2GA 4DXVA 1IWAA 2WVVA 4HPXA 1GKPA 2ATSA 4TV5A 1C29A 1HP4A 2J6VA 3LCGA 1EO5A 3REQA 3WX7A 4MJ4A 3P5ZA 1RP9A 2PLMA 4Q4KA 4DO4A 4GGHA 5I3JA 4MNJA 3EA1A 2QJNA 4S3FA 5HMDA 2ZDRA 4AWSA 2X05A 4HA3A 2FGLA 2ZZ2A 1HW6A 2UWFA 2OODA 2WMKA 1GOOA 1SYTA 4ICCX 1PL9A 3WMBA 2A7PA 1BGGA 1VFFA 4C6DA 3PG9A 1NOUA 3S1VA 2G5WA 3KVLA 4AXKA 4M7SA 2B31A 3B8IA 3VZYA 4YLWA 4QCFA 4YWOA 1DWIM 4FALA 1UD3A 4UCFA 2H3BA 4MIMA 4BA0A 2DP3A 4TMCA 3VE7A 1YQZA 3AUOA 3BAJA 4ML9A 1CEOA 2ZZ1A 2QUMA 1EL3A 2GJPA 1J12A 3WLTA 5FESA 3CMGA 3VIMA 4XZNX 4UR7A 3CIXA 2R9RA 3DFNA 3PTQA 3EXTA 4REQB 2CBJA 2DZBA 2JGQA 3LCWA 1JZ6A 5E0KA 3F7JA 2GQAA 1JDAA 1JPMA 2V5JA 3GD3A 2DFAA 5FJUA 3HA1A 4AX7A 4I9AA 3PZ9A 3KBSA 3CYVA 4HK6A 3RITA 5H8PA 3W76A 2EQ7A 2VOMA 4JQ3A 4FPSA 4HTYA 4UOJA 1R3TA 3VK5A 1JNDA 3BWWA 2PWFA 3HV8A 4RDYA 3H70A 2BVTA 3R0DA 1UH4A 1OGGA 4P8VA 1E56A 2PU1A 4DWSD 3TAOA 4K8EA 3K4WA 1KWKA 3LUTA 4DUOA 1EO7A 1NTHA 1HJQA 4NJHA 5DCBA 2Z2BA 3RMJA 3A7UA 4N6FA 1GKRA 3LEPA 3PBGA 2O4QA 1KFLA 4JS3A 1TV5A 3TH6A 4NSBA 1E1CA 4PUUA 1HKJA 2PDNA 3HG2A 1RSCA 3UXKA 4RE0A 3O15A 2G41A 4RCXA 2W66A 2G3IA 2HQAA 2ZC1A 1H1ZA 1U1UA 5JBFA 1OD8A 1Z9AA 3VNYA 2R82A 3ABRA 4EKJA 1DJYA 1W3HA 1JFXA 1ZCCA 3TYAA 3CV1A 1I8JA 1ZBWA 4TOQA 4E38A 1O1ZA 2W4XA 2CLKA 1CGXA 5I77A 1BTMA 2JKPA 1BHGA 8XIAA 1XLLA 4MB4A 4J2MA 4HVXA 3R43A 3WK0A 1VR6A 2J7CA 4LA1A 1VJSA 3KS5A 4F66A 3VOJA 4G1NA 4Q7NA 1I9CB 3GLCA 4EMWA 1US3A 4QLJA 2VO5A 3WNMA 4ONVA 1FWIC 3T0CA 1Z69A 1TUFA 3W2MA 1GUVA 1DYSA 1OG0A 5BXRA 5D2XA 1LT8A 1P48A 5H8UA 2BODX 2UY2A 2Z27A 1XIFA 5BU9A 1R3WA 1VEOA 5GPRA 3AU6A 2NT1A 5A2CA 1TPVA 4QLKA 4N9BA 1KGWA 2PF8A 3HJEA 3AMZA 3R25A 4NZ3A 1D9EA 3NZQA 4M7TA 1YLVA 2ZX7A 2W5FA 4W9TA 3LLDA 2J7BA 5I3IA 1WXZA 3B8DA 3B8WA 1V0LA 1FIQB 2X41A 1Q85A 1EJ7L 4IPNB 1ITQA 5HXMA 5J5DA 1XLDA 4ZOBA 3VIHA 4IP4A 3W1AA 1OQFA 1IXNA 3QR1A 4LGXA 3L4ZA 3LHTA 4LYKA 6REQB 3AOFA 3G1SA 3QMSA 2Q8LA 4C91A 2YCKX 1DJGA 2FZMA 3KLLA 1EB3A 2XISA 3FAXA 5J5RA 5EY5A 1A5BA 2NZLA 5I3FA 4L6HA 2WMGA 3B8TA 1Q2RA 4LS0A 4UFJA 2OX4A 2IXUA 3QGAC 3WUFA 5DY3A 3OTRA 4J56A 3L5AA 5K9XA 4RNHA 1OFEA 4S3AA 3SEPA 3GG0A 4Q8OA 1H11A 3ARWA 2DSKA 3APGA 1VEMA 4WUIA 3KBVA 2LLEA 1TMLA 3NQCA 2OX1A 3O63A 1FXQA 1ONRA 1TREA 3EDFA 1UR0A 3TIMA 2FB3A 3SCSA 3K8MA 4J57A 5FF4A 4HMNA 2VX6A 3FNDA 5IDIA 2AAQA 3AN1A 3Q94A 4PUJA 2OLHA 1P1XA 1U33A 1F07A 3B04A 3RILA 3QY7A 1U5JA 2V3DA 1JROA 3CIWA 2VD9A 1J0YA 4Q8UA 3OGSA 5CGMA 4QRNA 3P7YA 2PDPA 3CL7A 3FN9A 4DAFA 3QY6A 4NAFB 1U2YA 3NL2A 2P76A 2BY0A 1VKFA 5JU6A 3LQGA 2ZC8A 3VNJA 3LXAA 1TR9A 1ZCOA 3UPWA 1HO1A 4CD5A 1PZ2A 3POCA 4PUMA 4HBKA 2V0TA 3S42A 1S5TA 4KCWA 4PMRA 1K9DA 4S3BA 1CX9A 4B92A 1UP0A 4WEVX 3UG4A 4F3HA 3C3UA 1C8XA 2J4GA 3U3HA 2VRJA 4D71A 2XH0A 4PB3A 4E3TA 4NI3A 1E6NA 1VDVA 3G8RA 1R46A 1UWQA 1SU5A 2OYLA 1QW8A 3ZR6A 4JQAA 3GVGA 1ZJAA 1OEPA 1JXKA 3OO2A 3N9SA 1YTDA 4YTRA 4YS1A 2DZAA 4E2BA 3T1GA 3K4AA 2Y61A 4FOKA 2OG9A 3DYMA 3V5FA 4CD8A 4CQCA 4XKYA 3TTYA 1TFVA 1GV4A 2L5HA 5TF0A 3W7KA 4DJEA 1AJ2A 2Y5JA 1TE1A 1TTPA 1E4NA 3W7JA 1GOKA 4NEWA 3EPMA 4W89A 2HISA 3N13A 1UP2A 1E73M 3WENA 1ISXA 1XD1A 2YIHA 3W1XA 3IPWA 4X0VA 5H8MA 3WLQA 5G5HB 1H7NA 3FA3A 4X0NA 5HAOA 3WDQA 4GIYA 1KD0A 4L6OA 4FR1A 3WLLA 3GVQA 1TPUA 1HL9A 3AHTA 4D1IA 5IXEA 1TWSA 1TTIA 1LG2A 2J8TA 4O0QA 1O6IA 3G6LA 4HOXA 3CUZA 4OECA 2NW0A 1OWQA 1GGOA 4M19A 1LP6A 4IQLA 2BFGA 2BC1A 9CGTA 1GEQA 1ODUA 4NU7A 4DPPA 4YCPA 3DG7A 3CO8A 3RCYA 3SRKA 6XIMA 1GOIA 2QMJA 2PRLA 3CWOX 5E09A 1XHCA 3P74A 3MP4A 1ZZMA 1X98A 3QF0A 1KQZA 2PODA 5FJTA 4MDPA 1Z6KA 4XKMA 5FA5A 3WDPP 3N2TA 3UG8A 3VD5A 1DJXA 1KO0A 4C6QA 1LBMA 3QBUA 1W9BM 2TRSA 2GL5A 3C2FA 5LHEA 1SO3A 1YNPA 3DECA 2GWNA 3ZIZA 5BW6A 3BAIA 1EJWC 1JFHA 1TZ7A 4GACA 1ZX9A 2GJLA 2HJPA 3FIGA 1D7YA 2UV8G 1IEVA 2P50A 5C8BB 3NPXA 3NZRA 1KKRA 2C18A 3MDUA 1V4YA 4E2DA 3TN5A 2YLLA 3L0NA 1FKXA 5TNVA 3I7RA 4JDRA 4HJWA 1FBAA 2XVGA 3GG8A 2PP3A 3LB0A 2PDKA 2QCCA 2J8FA 1XRFA 2J7DA 1K9EA 3U7BA 3H2CA 4M1RA 1J0JA 2I14A 5JRBA 4EIVA 3EXRA 3NDZA 2DSVA 1V6WA 2NX3A 2POTA 3SDOA 1W2VA 5I03A 3BQ5A 1MVYA 5LYRA 1Y65A 4F0LA 1XYFA 2ZRXA 4DZHA 3U2EA 3UF9A 5HJXA 2ZZCA 4H01A 3WG6A 1AQ0A 3ITOA 5GNXA 4PZVA 4J28A 3VD4A 1HT6A 1M9HA 2EGZA 5LIKX 1AD4A 1NJJA 4A3HA 3AZRA 1SZNA 3ETRB 2A3BA 2VD8A 3W7RA 1Y8BA 3WD3A 3WQ6A 1IIGA 3QV7A 5DT7A 2J9YA 4QE4A 3VGBA 2KAUC 5ECUA 3W81A 5G2WA 1BQCA 3C5QA 4NIRA 4NAEB 1OJXA 2E6FA 3EBVA 3VKDA 3RNDA 2GR2A 4LIIA 1DQWA 2ZUVA 3WD0A 1KR0A 4YVXA 4Q6JA 2VZUA 4Q4RA 1F3EA 1WOAA 1TJRA 2P3ZA 4XZBA 1DTNA 1XICA 1VFSA 3UBPC 2UY4A 2F2KA 2V5DA 1KFBA 4HNCA 4GUHA 4J1OA 4HZMA 2GGHA 4O1CA 5JIPA 3FG2P 1VENA 3PULA 1OFDA 5A94A 3IV8A 3NYDA 2G3NA 3LI1A 2GGJA 3OEXA 3AYTA 3DFTA 3S9ZA 2VDIA 5A8QA 1S5MA 2G4FA 4V15A 1TQJA 3GYCA 3K5XA 1LRQA 3S1GA 4UTWC 5M3WA 3Q37A 3I6RA 5I3HA 3GH5A 3LV6A 1AZ1A 1ONXA 2V30A 3FOKA 2OGJA 2DZSA 3WEZA 4AY8A 4I6KA 4DJFA 4NRSA 3PZTA 1TMQA 2PB1A 3UGRA 1EJXC 2ZRWA 3EX4A 2QGYA 3EEZA 1R3VA 5D05A 4IQEA 1RK5A 2QQ6A 4JTEA 3O06A 3S8HA 1XM3A 2EHHA 3AU2A 2QCDA 1W31A 2JGYA 2XM1A 1G4EA 5DF0A 3ANYA 3LTPA 1FFRA 1WCGA 3IJQA 5CG0A 4MJZA 2FDMA 4HNUA 5CZSA 4UQDA 1EA0A 2A6LA 3ZVIA 1KWGA 1E6RA 1O94A 4H3DA 2OSYA 1EP1A 4W7WA 5F2GA 2Y0FA 5JCKA 2F9RA 3DK4A 4ICMA 2XJ7A 4OT7A 4GABA 4RXGA 4BQ3A 2QW5A 3NGJA 4GX9A 4AEFA 2WM0A 5CSUA 1V7AA 4YTQA 1N5XA 2B7OA 4AD4A 4IG2B 2DSUA 1QO5A 4NASA 2ISVA 3TTOA 1PYFA 3VGGA 4O50A 4MPKA 3BLEA 4GIRA 3M0IA 1CYGA 1LUCB 5I79A 1PBGA 2W6RA 3GG7A 4EXBA 1WDRA 2NT0A 3VIGA 2ISDA 2VGBA 5K7JA 4YL2A 1O95A 4M6QA 1U5HA 4QAIA 4JZ5A 5DCDA 2Z7GA 3DH9A 3TXVA 4GYPA 2W27A 2HE5A 3TN3A 1VH7A 4XBSA 4CU8A 1I2QA 4GGBA 3MMUA 3EDKA 5AZ0A 3MI3A 4MM1A 3ITYA 4XIAA 4H9XA 2C3DA 1G9HA 2Y62A 1PWLA 3S9YA 1R86A 3I3BA 3NQDA 1BGAA 1W1IE 4FSAA 4C6PA 4B5TA 4GXPA 2TYSA 3BG9A 4KPRA 4O17A 4ACZB 1X97A 3PK7A 2P8CA 2Y85A 4DJDA 2GRTA 3W72A 1XUUA 1OM0A 3S5YA 2QULA 1EHAA 1C7SA 1LBLA 1ZDLA 1ONWA 3EX6A 3LGGA 3ALGA 1UR9A 3VKBA 1KBKA 3I68A 3QYQA 3FLUA 2XM2A 3QPYA 1A4LA 3B8SA 4FR6A 3QSTA 2V9DA 1XDIA 1DXFA 4A6GA 1FCVA 4NRRA 1K8YA 2A3CA 3WLJA 5JBDA 4E8DA 4QS6A 1OX5A 3PR2A 1KTBA 4PUDA 2OOGA 4PUNA 3SQLA 3HB9A 4BEUA 5AN7A 1QBBA 5FJIA 1GOWA 4D2JA 1XINA 1FHVA 1F61A 1J9YA 4DEFA 3QLDA 3BXWA 1W3TA 3AMGA 5J04A 5FS6A 2Z25A 4XAZA 1US2A 1KCLA 4AC1X 1B54A 7ODCA 1W91A 1I1WA 3STPA 4U33A 5CPTA 2CBIA 1W8GA 4Y8FA 1A80A 2FTWA 1N63C 2C79A 1G1YA 5D9OA 5LIYX 2EPNA 3AYSA 3MWCA 5C2GA 1WDQA 1Q6GA 1RD6A 3DG6A 3GTFA 3AM9A 3NPUA 1WAUA 4LV4A 2V2HA 4V1XA 3TYUA 3TC7A 3A3WA 2VKZG 1GZJA 4ZR8A 3O6YX 4AWUA 5L6UA 1J0ZA 3N14A 5A69A 3EDDA 3W7DA 1MO9A 2XVKA 3LD5A 4DWSC 1WDSA 5A6TC 1IZJA 1PO9A 4IGHA 4CQDA 2V2CA 2DW7A 3AIBA 4JFUA 3Q2DA 2IKGA 3A4WA 3I65A 2ZTKA 4S3DA 1ZUAX 4QXIA 5BWAA 4LYQA 2GSEA 4EVZA 4FHAA 4RV3A 3NQEA 1B3WA 1L8PA 5DANA 1ICSA 1VBJA 4PMQA 3W02A 3AHYA 1VB9A 1ENUA 1CB2A 2AMGA 1Z89A 4QGCA 3STFA 2B4GA 2EJAA 3H8AA 2WSKA 4Z0SA 3M41A 2X42A 1LDCA 3ATZA 1YBQA 5C9RA 1M65A 3KL5A 1EXBA 3DJGX 4RW5A 3QJAA 1NQ6A 3A7RA 3NEHA 3T08A 4PRRA 2E4TA 2DUXA 1PB0A 4JHOA 3Q67A 1YTKA 1PS9A 2V81A 2WW5A 4B16A 2A6NA 3CGCA 3QPEA 1XD0A 3FYOA 3ZJ8A 1XSKA 1PEZA 4UQ9A 5LIWX 4JDYA 1IXOA 1YE4A 1EHNA 3UWUA 3WCZA 4KF1A 2Q3RA 1UZDA 3BUVA 5I3GA 4BF7A 3EB3A 2FFCA 4QEEA 1B5TA 1PXGA 4FB7A 3APTA 1XANA 3ZSTA 5JUVA 1SPQA 3VU2A 1C91A 1Q4WA 3AJ7A 1DJHA 3LA4A 2Y8KA 2HVNA 2V3FA 3ZJ6A 2GQWA 4F40A 1DV7A 2ZZ4A 1AW5A 1X6LA 4ZQMA 5HULA 1W1VA 3P62A 4QNEA 5KVHA 4H1ZA 1M7XA 3LB8A 2HV5A 2X0SA 1Q7ZA 2CPUA 4TXEA 3AMKA 4QDPA 2RDTA 1R3QA 2OWCA 3O9NA 4O28A 3E74A 3CM4A 3AXXA 3GR8A 1L6WA 1OABA 2CLOA 2ZUNA 3SQSA 4LJ3A 1HVQA 3C0LA 1CGWA 1GQNA 3VIKA 3AS1A 4GJ1A 2E9MA 3R58A 1UWTA 7REQA 3B97A 3C2OA 1XPYA 2FGBA 3UYCA 5CG7A 4IMEA 1HTIA 3CO4A 4DQWA 2YL8A 5F2IA 3A21A 1Q45A 3WEMA 1ZAJA 2XFYA 2YCIX 3FEQA 1DTUA 1V8EA 5JCLA 5D9PA 3TXZA 3H55A 2OR2A 1E70M 3LHYA 3HTWA 2R94A 3DG3A 1X39A 3BW2A 4HZ8A 5CPNA 2YW3A 1W3NA 5M03A 2O92A 2A85A 4YPJA 2VZOA 3OYZA 3ARTA 3VIOA 1H2JA 4RJEA 1JPHA 3VO0A 2Z1VA 3H2NA 3HZ3A 2PTDA 3CUGA 3FYPA 4H2CA 5D02A 1BKSA 1XHGA 2E8ZA 1OGBA 1XS2A 1BWLA 2DH2A 3WMLA 1X6NA 3UXAA 3THDA 4NQ1A 1SZFA 1EOMA 3PZQA 3WQEA 3AXHA 1VQZA 3HGRA 2VC5A 3WIJA 2X8CA 2ACSA 4MJ2A 2FLIA 1OC5A 2NSXA 2QF8A 3VC6A 1E9YB 3UCQA 1Q6EA 3SECA 4GG9A 3EWZA 4CNSA 3M43A 3EWUA 1XCFA 2VENA 3R10A 3CWHA 4HOZA 1RA5A 4U3CA 1BEUA 4RLIA 2WZEA 1WZKA 3WK3A 1YEYA 4E3VA 1WDPA 3CEUA 4J3UA 1NELA 4NNCA 1DJZA 1H63A 5U7SA 3C52A 2OU4A 1OINA 4Z2JA 3B0PA 4GYKA 3CQHA 1J4EA 5M5DA 2QVHA 2ZZ3A 3K13A 2OSXA 1EF3A 1DHKA 3RLUA 3V75A 3CUXA 2F38A 3H24A 3SN4A 5ABHA 4UTFA 1LWJA 2YW4A 3TYBA 4XD5A 1TV4A 2EG7A 3ZQ9A 3RPTA 4PTMA 3BSGA 4CU6A 3GUWA 5CPMA 3WO8A 4QG6A 2ZVIA 5C54A 3OVPA 4LH8A 5CLTA 4ZMGA 1AL7A 5F2MA 5C9UA 1NQKA 1TKKA 2TAAA 1XP3A 3QHMA 1F73A 2TPSA 4I5RA 3SM0A 1ZY9A 2OZ8A 1XPGA 3H21A 3Q6JA 4MWAC 2JK2A 4LNYA 3WBYA 3USBA 4HPGA 3CZKA 1B9ZA 1NVMA 5AYBA 1A5MC 4KBXA 3RM9A 1R9ZA 1KBBA 1EGZA 2HNEA 3SUSA 4H9VA 4JCMA 1EP3A 1VCGA 5LSMA 4F9JA 3AIUA 4HCLA 1JZ4A 1GHRA 1Q66A 1KLYA 4GZJA 2NV2A 3S5OA 3M0ZA 1IWPA 4R9OA 1OD0A 1R7OA 5CC7A 4G9PA 3L0KA 4H6QA 2ATMA 3WK1A 3TOYA 2B7PA 1FWBC 2NQZA 2PDBA 1LLZA 3BARA 3IS4A 5HWJA 4FX8A 3ZZ1A 1KA9F 1L2UA 3REQB 3SCVA 2QCLA 1NFGA 1ZL1A 4JIQA 4Q8TA 2ABAA 1SUXA 4QSHA 4JOMA 2X8RA 2GVLA 4PEKA 3HF3A 3MC5A 3AHXA 1G5AA 3AIQA 2X40A 4GHRA 1QI0A 1UUQA 4GIAA 4MGGA 4O4VA 4DXKA 5CQ1A 4D6EA 4JTJA 2WP6A 2YKKA 3EOLA 4F8XA 1ECEA 3MSYA 3B05A 1XLKA 3MKKA 1RBLA 3GXIA 4MTVA 3CNYA 3HMJG 2I16A 2XVLA 5AHMA 1W1ZA 1OIFA 5LNUA 3NL6A 3VKJA 2GJNA 3S83A 1W1A1 4K6AA 2OJPA 4O11A 3VGFA 3JZEA 4LOCA 4AW7A 1W1B1 2GOKA 4FDCB 4Z2HA 4QAWA 1O5QA 1PZ0A 3S0CA 4M6UA 1NPXA 3HGOA 3QM3A 4EMJA 4Y7EA 2PWDA 4FZIA 5FS7A 1C8QA 3AXKA 3WNPA 3P3BA 2CXEA 4WDWA 3WQWA 4DNMA 3VIFA 3EAOA 5RUBA 5F4XA 3GBEA 2PU0A 1D3GA 1DIOA 3B8VA 1Z7AA 1H2IA 3S2CA 3T44A 4BEQA 2Z28A 5AFDA 2YL6A 3UXLA 3LGEA 1JULA 3BURA 2VCCA 2WWDA 1K4GA 1RD5A 1Z44A 4ADWA 3FVMA 1WPCA 3LRKA 4GA8A 3RXZA 1UMLA 3BCJA 1QMLA 1FTXA 1XLJA 3NOEA 3T81A 3CS2A 1T8QA 4OBRA 2ZUWA 2D3LA 4UR9A 4ZCWA 1VPYA 2E0PA 4IFKA 1OADA 1ZY8A 3ITLA 1OYAA 1ZXIC 5AY7A 3MJYA 5B80A 4B3KA 1P0BA 4HHPA 2JF6A 2C1HA 5F2LA 4DO5A 1K9TA 5TIMA 3L4YA 2P3EA 3K4DA 3IJ8A 4GUFA 3RRXA 1LT7A 2VFFA 3RNMA 3G0XA 2W91A 1P0DA 3ARSA 3VIIA 1O68A 3T7VA 2ZUMA 1O5RA 1OCNA 5EBKA 3PTDA 4U2YA 1XLFA 4M29A 3ITCA 2PTXA 3W1LA 4A8RA 1TELA 1BYAA 1KTNA 2YLAA 1UKQA 5EB8A 4CEXC 3WJWA 2ONEA 5CJMA 3ZLFA 2WOIA 2VX4A 2CZDA 3WZ0E 3UVIA 4RDWA 4L6DA 2BV9A 4L64A 2WQPA 3HU7A 3GY1A 4JIRA 3UWWA 2BGQA 4H83A 1Q6FA 1UD6A 2X1SA 3M46A 3DGRA 4H4RA 4IICA 3DBNA 3IGXA 2A7NA 3QFAA 3CB3A 1YADA 1A49A 1TWWA 1OFOA 3A64A 3AXIA 1SO5A 1TVNA 2Z6JA 1J5SA 1FRBA 4AXNA 5K9DA 3W1MA 1X7IA 5CPLA 5DCEA 2I56A 3RX4A 2Z1WA 1R5YA 2D23A 3GDLA 1VS1A 3ITTA 4RKAA 1VEPA 1CW2A 3FEMA 4Z17A 5GNYA 2OMAA 4MZ1A 4H7VA 2AQVA 1WQ5A 3UA3A 1V7YA 4OQVA 4UQCA 4W84A 3KLJA 3VIPA 4TIMA 3PWIA 4GH3A 3EWWA 4MPQA 3UY8A 2R1NA 5FF0A 1G7UA 4JFWA 3PPGA 3LDVA 4TTUA 1J11A 1PKYA 3KXQA 1VFUA 3GNNA 1UD4A 3BGGA 2J77A 5EU9A 4WKFA 2X30A 4KWUA 4XX6A 3OQ8A 2XFWA 2QCGA 4S3EA 4I5XA 3EKZA 2DVUA 3WQ4A 3FX4A 1MEIA 2G37A 3DN5A 1SW0A 5KZEA 1GVFA 1V6XA 4WDUA 3KRSA 5E0FA 4ZBCA 4PMDA 3DFOA 5FJRA 5MKGA 5FL1A 3GNXA 1QI3A 4PCSA 4CKQA 2VELA 2QUUA 3PN8A 2EAWA 3PWGA 4ALDA 3BVJA 1UR4A 3W3OA 2PAJA 1CNVA 4KEUA 4PUEA 5HINA 3CHVA 5FJJA 4F2UA 1ZS2A 4J3VA 1KM3A 1HJUA 3RUBL 3TTQA 1GW9A 1DWHM 4PMVA 3JW7A 3FSUA 4Z08A 2NX9A 4PYSA 1LRTA 1GQLA 3FJ6A 2PWHA 3R79A 4HU4A 3S2JA 2CLMA 4ZSUA 1XRVA 3GRTA 1SB3B 3GG1A 1XGDA 1FH8A 2R1LA 3LHZA 2AGKA 4NXSA 4S3JA 4B3LA 4MFEA 3OOQA 5DXXA 4AB4A 3KBNA 1GVIA 3QVQA 1PIFA 1N60C 3ZT7A 1JIBA 3LMYA 3KE0A 4RR4A 2GSHA 2AL2A 3R12A 4MYXA 4A3QA 3PUGA 1ISYA 3ARXA 4MADA 3L4TA 1CB7B 4AG0A 1VBUA 2JE8A 2D22A 3KDOA 1H61A 2ZRZA 3E02A 3U2OA 4OZOA 1QNQA 1GVSA 4GQRA 4KS0A 2PDJA 2E7FA 2YDAA 2YCJA 2FHCA 4J3XA 3W26A 1KBIA 3TR9A 4GQGA 1FUYA 4TU1A 3UJSA 4A35A 5FS9A 1CXEA 2FPVA 5B7YA 1WDWA 3O16A 2NV1A 3DGHA 4K68A 2HS6A 2EQ9A 3C0QA 1PTAA 5F4SA 3HGSA 2V5KA 4M3PA 2DGAA 2TODA 4AF0B 1LYXA 3GR4A 4LSBA 2E28A 1V02E 3SI9A 4LYPA 2D1ZA 4K1WA 1DIEA 1GPFA 3QRHA 3WYZA 2BTMA 4M52A 4HNLA 2PRMA 3O6DA 2DJLA 4RE3A 2HNHA 1YW1A 5D2WA 2DUZA 3P14A 4PEEA 1JYVA 1AW1A 1PJ9A 1F3TA 1WV2A 2ZZ5A 5C71A 3T4WA 5CCZA 4XZWA 3PFMA 3PY2A 2NV9A 3MJMA 3CXBA 3MSDA 1BG9A 2A21A 4PSRA 4NJIA 3I3EA 1E4IA 4GXMA 3CT7A 5EA9A 4JNYA 4DB7A 5H6HA 1PIIA 2FKPA 1GNXA 4RE2A 3SADA 3K8KA 3SO7A 1XI3A 1JCLA 1W32A 4XQ6A 1ZTVA 1EWEA 1R2SA 1UA3A 2C3CA 3PZOA 4W8LA 3CTTA 2YDRA 3AIRA 4FF5A 4TR9A 3RR1A 3CQKA 3VD3A 4OWGA 3MQTA 5A8OA 3LERA 3K1DA 2WO5A 1XWYA 3GSMA 4AHPA 1CLXA 3HPSA 3VAVA 1EC8A 2PDLA 3BPWA 1EF2A 3GR7A 4KEZA 4PTDA 3PSWA 2EQDA 3SCWA 3GW0A 5CBJA 3QHOA 1H0GA 2XUCA 3GZAA 5D4YA 4C6FA 3MYPA 3MB9A 5GRTA 2VFGA 1GYLA 1A5UA 1S46A 3QTPA 4IH3A 1J0HA 3STCA 1VFLA 1W8SA 3STGA 3L0GA 4M82A 4YMZA 2ACUA 2HK0A 1E9ZB 3LOTA 2NVKX 4AAJA 4DPQA 4H8UA 1JGIA 1MWOA 1BRLB 4XAPA 2VCAA 3TK7A 3W75A 1PPIA 2Q09A 1UHVA 3B0XA 1EZ2A 2NQ5A 5DO8A 4CCEA 5A2AA 5GQBA 4NUWA 1K8CA 4LS1A 2DZTA 3QZEA 1Q13A 4WJ8A 4ZQCA 3WBAA 1KFEA 1KR1A 1E43A 4LAKA 4PCPA 4H19A 1K9FA 1D7KA 9RUBA 2PMQA 3XIMA 3FA4A 4S1FA 1YXYA 1V08A 3TFCA 5KINA 5AZ1A 1H41A 3MZ2A 4GI4A 3NDOA 4KWOA 4NZ1A 3IJDA 1DOSA 1UW9A 3WQ8A 1GZGA 3T2OA 3GHRA 2CLIA 3UT0A 4P2VA 1DJQA 4QJ5B 4H7CA 4Y9NA 1DL3A 5I00A 4KERA 3L68A 3TFXA 1JCJA 3EDJA 4PBFA 2I57A 2QJMA 4GY1A 3TNOA 1E6SM 3N2MA 1ITUA 3N73A 4OOUA 3T55A 1G01A 2XN2A 3W88A 1GG1A 4FNUA 1MW2A 2VZTA 1J93A 3QEZA 3TLQA 1JZ3A 5LIXX 2WMFA 2X8HA 1BSLA 4IHCA 3VA8A 4LFYA 3L21A 1XBXA 4LT9A 2E40A 1E6XM 1MW0A 2YA1A 3GIYA 4XO7A 4YU1A 3SSZA 3L4UA 1WKEA 3G0UA 4MLJA 4CNNA 4KRUA 1O5XA 3ME3A 1TZ9A 1LL4A 4MWAB 1V02A 1TE6A 4KRZA 2C0AA 1NU5A 1J96A 1AG1O 2XVNA 4A4AA 3HO8A 3PZVA 3L5MA 4NT0A 1GONA 2QCDB 3BW3A 1IQ8A 2Q6ZA 1VLIA 1IWBA 2IPGA 3LM3A 1JYWA 2DH3A 1JRBA 1X38A 2WC7A 3AZTA 3M44A 1I6NA 4BV6A 1OFBA 2FTPA 2NQLA 4WQ6A 1I2NA 2P8BA 1YXDA 3JRKA 3NVDA 3W84A 2J6XA 1K6AA 4C1KA 1ONEA 3W2JA 1GWJA 1O5KA 5HATA 5BRPA 5ABGA 3URAA 1UASA 1I2RA 1ZKQA 3PFRA 5XINA 4QE5A 2OGYA 4HN8A 3DERA 3W9ZA 4EWJA 1XIIA 2DIKA 1AMYA 1YDOA 1TVPA 3UA4A 1Q1RA 3CIVA 3UEQA 4L9YA 3VILA 2YCLA 4LBSA 1EBHA 4X9YA 4PN2A 4U31A 3TNBA 3WH9A 4GE8A 4ZB2A 5LA2A 3FY1A 4IMFA 2PPGA 2OEMA 4GYJA 2BASA 1PYMA 3MP5A 3USZA 2CIPA 3LN3A 1IZCA 1WKFA 3WQFA 1ZLPA 3LPPA 4M81A 4ZFCA 3UZXA 4GH1A 2YX0A 1MXDA 4RZ5A 1EC7A 3BLIA 1V0MA 3OQEA 3TC6A 5DMYA 2VC6A 5JXQA 2PGWA 1ZK7A 3UXIA 1SW3A 3EX2A 3O6AA 5I02A 3LBOA 2OO6A 1Z42A 2VRQA 3DHDA 1L0PA 1JOAA 3JUGA 4HT3A 4OV9A 1VBHA 2CFYA 3WFAA 3WEOA 4AQLA 1KGUA 3DK8A 1KFJA 4FF7A 2DUAA 3V0UA 5AHFA 3S4TA 1JZ5A 3PG6A 4DVOA 1BQGA 4YVPA 4LUTA 3RYSA 2Q71A 2ZE3A 2QKFA 3G0SA 5HUPA 1EIXA 2BX7A 3CUHA 2J75A 3GDMA 1WZLA 4C1NA 4M6VA 3DHPA 3DEQA 4C60A 1A4MA 2E5BA 3VM5A 1RCOB 1TB3A 2YSWA 3W1QA 4J7RA 4IIBA 4NJKA 1V6TA 4Y9MA 2VZSA 5KZDA 3CAKA 1M7PA 1EUNA 2PDGA 3EA3A 5BXTA 4UTMA 3L8KA 1SFLA 2JEPA 4JNMA 1L6SA 3C8NA 3BLKA 4HHMA 1M41A 2IPJA 1DXLA 4IX2A 4AZBA 1EZWA 3SY1A 4EPDC 5LNWA 3W6YA 3KOXA 1EX5A 1JVNA 2HPIA 1HNYA 1OZQA 4GKTA 2WSPA 2ZICA 3L4XA 4QX4A 1F6YA 2EKGA 3RGTA 2XFRA 1GW1A 3B4UA 3F4CA 2BNJA 1DWJM 3OZYA 5I3DA 1F5ZA 3O2LA 2VX5A 1TRIA 4U28A 3FYYA 5BOOA 1OF6A 3EDEA 3GNOA 3EX3A 4Q3MA 3UGVA 3W1NA 2E9LA 1TWDA 3EMCA 1HF6A 3KBJA 1TJ1A 1UCWA 5KTLA 3KBWA 3VNKA 1E3ZA 3W22A 3K8LA 1TYTA 3E2VA 2Z29A 4MZ8A 2F61A 4JR5A 4XBKA 4IL0A 3F03K 4QQUA 1YRRA 1HIZA 2RDUA 4XISA 1MNSA 1WZMA 4Q6XA 3E38A 1BWVA 4GVFA 4TVDA 3LZ5A 2BBFA 4BKNA 2F2HA 3L5OA 4EE9A 2PC4A 4UCGA 3CMJA 4Q8MA 5IOBA 1LCOA 3NVYB 3N1AA 4WJXA 3NL5A 3RMEA 4WK9A 1B57A 1UPMB 3AMLA 2Z1SA 3E5BA 1QI2A 4GY0A 4DBEA 4MZYA 3JU2A 5K3VA 1CXIA 3VTRA 4IPIA 2W9MA 4TX8A 4XZ9A 3W87A 1RM6B 3PHAA 1RLDA 4E8GA 4C7FA 1B3YA 1LOSA 2W0HA 3K46A 4RNJA 1JUBA 1V93A 4RNFA 1GHSA 3H2OA 1YPIA 2ZA2A 3TWBA 1S5WA 3VFLA 3ORWA 2E09A 1FDYA 1JI2A 5KZMA 3OVGA 1R6WA 1TQXA 1Z8AA 3KLKA 4CQBA 1FP9A 3IGHX 1LLWA 5HMSA 2BLEA 2Y7GA 1WAWA 1UB3A 3NS1B 4N02A 4PL2A 1LQAA 1YBQB 2XIMA 4EF9A 3I6TA 3AS2A 5C0QA 4C6LA 3WF0A 4MY9A 1MFUA 4FOJA 4XD3A 4ZQNA 4JYFA 1TA3A 3H2EA 3THCA 3DIPA 1AK5A 5K4ZA 4JN6A 2FVLA 1IZKA 4QITA 3B40A 3U0HA 3DDMA 5A6SA 3KCOA 3NEVA 1SZGA 5EMJA 4JN8A 4DAIA 4Z2LA 3D3FA 1CT5A 3AWOA 5I0DA 2W55A 3IVUA 4LVDA 3UWVA 3G77A 4GLEA 1X1NA 3WJZA 3UERA 5GJNA 4Y90A 1EOKA 3MMDA 1B30A 4EX4A 3HG5A 4CQ8A 1R2RA 4V1YA 1XRTA 3PBWA 4K8DA 3EOOA 1PKNA 3W73A 1HJVA 3FKKA 5ABTA 1GG0A 3T4CA 4FLQA 4GQQA 4O54A 2ZZ0A 4RDZA 2ISFA 1Q6RA 4LTSA 1L6GA 4H4PA 1UKPA 2V5LA 1YMYA 2CERA 1PZ1A 1EEPA 1BXCA 4ZQPA 1XUZA 3ISIX 1W5OA 1IGWA 3MO7A 5AC6A 1VAHA 5FCZA 4FNTA 1EA9C 3IIOA 4K36A 1V97A 4I9TA 5FOOA 5TBOA 3AIWA 3T07A 2WJFA 3TE9A 2PDQA 1SO6A 3DHUA 3IIZA 3KOZA 5I07A 1REQB 4Q8QA 2V63A 3S5ZA 2SFPA 1JDDA 4BF9A 3V16A 2ZCGA 3PM6A 4NKCA 4QHRA 1ZNNA 2E68A 2A0NA 2NSOA 3LTYA 5G1MA 4HK5A 1N62C 4R85A 1HGYA 1JUKA 5K2ZA 3VMOA 3KWSA 4HCDA 4JBRA 4LUSA 1RY0A 3BZGA 3UJ2A 1ZSXA 1DXIA 3IVTA 1SMAA 2PUZA 4WIWA 3A4JA 3OLIA 1Y5XA 5C9WA 2REQA 1Q63A 1VFMA 1P6BA 3AHVA 3QFEA 4L4MA 3VNIA 4CVWA 4GXWA 1MW1A 3AIVA 2Z1XA 2DZVA 2OTDA 4H4UA 3PZMA 1UH3A 3NXLA 3VCNA 2XU2A 1GK8A 5JH2A 3MUZ1 4MLRA 2YDQA 5PTDA 1QOXA 4GQBA 2ZXQA 3TP4A 1VGAA 1W9PA 4U4MA 3DKJA 4DBDA 4BURA 3M0LA 5G1YA 4UOZA 3TJ4A 4HKPA 1BKHA 3V0SA 4QJ1A 3W71A 2WVSA 1KM1A 5D2VA 4HPNA 1W5MA 1NP2A 3HV9A 4KMQA 3OLEA 4BF5A 4HA0A 2OZTA 1E6ZA 2V8ZA 1YPXA 3TC3A 4LCQA 3VYLA 3QH2A 1ZHAA 1FQ0A 4PMJA 3SZ8A 1GETA 3QHNA 5IFTA 1ADDA 2BVYA 1UUMA 5FMHA 1JYNA 1XLEA 1HGWA 5F4WA 1J79A 1H0IA 3GFZA 1BVWA 5EKYA 1GCYA 1EP2A 4K8HA 4GVHA 3PBMA 3EMQA 3DI0A 1GOMA 4B9YA 3WLKX 3PAJA 4O1DA 4JX6A 4ZENA 1QW9A 3WK2A 5JH1A 2V82A 2XIQA 4QQ3A 1PSCA 4Y6GA 2OCZA 1IT8A 3T42A 3EAUA 5BZAA 4PRWA 3WH7A 4KRTA 4UR8A 1GSNA 4GR1A 1L2QA 4UTTA 2R1KA 3MCNA 4Q32A 1BG4A 4DM1A 3NPWA 4NZJA 4WXYA 4QDWA 4Q8VA 3ZWTA 1RVGA 3SIZA 3WJSA 2Y63A 4LB4A 5LXEA 1LL7A 4IFOA 2X1TA 4EXAA 3BG3A 1C8VA 2FHFA 5IHSA 2WYSA 3W2KA 4F48A 4BJHA 2A1YA 3P8IA 2FZ8A 3IIXA 4N4PA 1ZQ5A 1NWUA 4HMEA 2BOFX 1QHZA 3SFKA 1J01A 1V59A 3S47A 1PVNA 3W74A 2NLYA 2FJKA 4XWUA 4RX0A 3KTSA 2XG9A 3UESA 2D0GA 2WBAA 1TPEA 2FHBA 3LXBA 5G1TA 4EQXA 3N12A 2AOSA 3QQ0A 2DZXA 4X3ZA 5HJYA 3MA8A 1DVJA 3LSBA 3QZAA 1UH2A 2CESA 3PZIA 3CEPA 4N4QA 1HZYA 3BCFA 1XW8A 3BW4A 1HL2A 5BU6A 4I8YA 2QIWA 2A3HA 4UFHA 4O0ZA 1XLBA 1JG9A 4FNQA 4REQA 1GORA 2XGZA 4L4LA 4MVAA 4A29A 3AQUA 3TJIA 6CGTA 1E71M 3W00A 4XZHA 3PJTA 3IUDA 1PIGA 3A5VA 1EUAA 1PCWA 3V7PA 3OHMB 4FX6M 4HZ6A 1J18A 4YJ5A 2WHJA 3VDHA 3NJ3A 2CW6A 3C61A 4OGZA 3EYPA 1ADSA 1ME8A 3T0TA 3KFTA 3RU8X 3GFYA 2QMKA 4GY7A 3NR0A 4P7NA 3R8RA 5BMWA 3HG3A 1MDLA 4UOQA 3S9IA 4J3ZA 5T9CE 2OLAA 2PLJA 3OC4A 2JALA 1GVRA 3GXMA 2W3ZA 4DBSA 3ZOAA 3CV7A 2D2JA 4OIFA 4LNCA 3KX6A 4L65A 4H6EA 5LIUX 1CXLA 1XIHA 4MJMA 3ZVHA 4LANA 4Y9PA 3ONBA 4PCNA 4S38A 2VZVA 3STEA 4I3GA 4DF2A 4ORIA 4LWWA 1L6FA 3M0YA 4ZL1A 1MUWA 3TN6A 1MO0A 4HHLA 4IFKB 5EBAA 1Y5WA 1L6YA 2WKLA 4A2SA 3BL3A 2O7SA 1QWKA 4YVVA 3RAOA 3RJXA 2GUBA 3II1A 5D33A 3BV7A 4HU3A 3DGBA 4E6MA 3ZO9A 1EWDA 4OJYA 1ITCA 1K3UA 2X8GA 2J24A 4HNTA 2O55A 4NNAA 1QPKA 4LYRA 1W17A 3TROA 1QDSA 3PZGA 6TIMA 1Q5MA 1GOXA 3W2UA 1F4HA 3ZM8A 3LNMA 3HRDC 1R9YA 5CXPA 4N7QA 3B9EA 1RJRA 4Q8NA 4FLOA 4UIOA 4Z42C 2PWUA 3ABZA 2A2IA 3XISA 3ALFA 4CNTA 3L23A 3WUBA 2DZUA 5REQA 3THUA 4ZFMA 3LGDA 2FPYA 2R91A 2NQJA 2QCHA 4PRTA 1HL8A 1B0IA 1ZBVA 5JCNA 3HMCA 3R6IA 5M2FX 2UY5A 3N19B 1KGXA 4HYRA 1DWAM 4DIAA 4ZOHB 2B7NA 3VNDA 4XBJA 1EYWA 1GESA 3GRSA 3OU8A 1XH1A 1MW3A 3BTNA 1PV8A 1TCDA 2GVYA 3DK9A 3ES7A 2HTMA 2QR6A 2XIOA 3P0WA 3QMTA 1KXQA 1W56A 2ZX6A 1A3XA 4PSPA 3NTYA 3NVZB 3AROA 3KRUA 1V6UA 4DNHA 3NQVA 3WBXA 1CGUA 3TU9A 1A0DA 3WMSA 4HA1A 3DU0A 3L2MA 4DLMA 4G7EA 4TMBA 4HSOA 3TCEA 3QW3A 1OT2A 3BCDA 1PX3A 4L9XA 3FDGA 2WZMA 3NZGA 1DP0A 3W4RA 3ANUA 3WLNA 3GDRA 4B5SA 2E5DA 2OKOA 4BHYA 3GX9A 2YVFA 4WRHA 2OVLA 2OEKA 3QQWA 1UMYA 3OPSA 3GDKA 3E9AA 4O57A 4NILA 3F2CA 1R3YA 2BSLA 1JF6A 1GVOA 1FCQA 4P5UA 3HN3A 2O0TA 3RCMA 1MDRA 5CSYA 4C6BA 3WBWA 3QN3A 2BOEX 5HMFA 2WJZA 1VYRA 1S5VA 3SCNA 1ZMDA 1ICPA 2PDCA 4DRSA 5CC3A 1JQXA 4QG8A 3WLRA 1XXXA 3UZWA 1FDJA 3RHGA 1T7LA 1JD7A 4BI5A 3LU2A 2CLPA 1VD6A 1JCTA 4JY8A 2PLKA 1OK6A 3O7UA 4KFNA 1YDYA 1CCWB 5BCAA 4AUBA 1H51A 1N7KA 4JTUA 4ZTYA 3QYSA 2FDSA 5MKGB 4D8ZA 3PSVA 3EPOA 4E5TA 4WJEA 2XZ7A 5BXPA 4Q4PA 4AEOA 3UJEA 1TIWA 3LLFA 4DZIA 1NY1A 4O8AA 4UNLA 2WMJA 2HXUA 1NHSA 2QUNA 1E3XA 3IK4A 1RA0A 5IBXC 3VCCA 8TIMA 1RCQA 4EPKA 5GJPA 3W7NA 2ZZ7A 3WNOA 1AD1A 5E93A 5AYZA 4BWLC 1UJPA 1PHWA 4L56A 4ZOEA 2ZKMX 2OKTA 4XAYA 2OSWA 2ASHA 3NUKA 4GKLA 3D6NA 3TZFA 3M4HA 3VUPA 2GZXA 5CJNA 3L67A 3TW6A 1FWEC 4G1KA 4AMCA 3QMRA 1P0KA 4D6HA 3HQNA 1KM0A 3OIXA 1G6CA 5G2HA 3CPRA 1MSSA 4W8AA 3WF4A 3W2LA 2HBVA 1XKYA 3QKEA 4I8DA 2AL2B 1OX4B 4MKVA 2KX9A 4JIEA 1AA1B 3OG2A 4JCLA 2BC0A 2XIJA 4AX6A 4JICA 1W9DM 3F5JA 2BHUA 1KW1A 1BF2A 2RGLA 2AQWA 3E2QA 2CFFA 4F0SA 1AL8A 3TDFA 4IM4A 4ZODA 5MF5A 4QBXA 1QOPA 1WB0A 3CGDA 4Q4SA 1DWGM 2IPWA 1IEIA 3A6OA 1W3JA 1FWCC 2VI0A 2Y7DA 3V1PA 4JTKA 5BXSA 1E4MM 1DIDA 1UZHA 4ZSTA 1GQKA 1NHRA 1LQ2A 3LBCA 1T96A 3LSCA 3POHA 4IJRA 3EOUA 3BDKA 2Z2AA 4N9EA 1RZMA 3M0KA 4QISA 1S39A 5LZLA 3LHUA 2G4JA 4J2PA 3LADA 4AYGA 3NNTA 3S5NA 1QTWA 1MI3A 3OIHA 4WY0B 2OZ0A 4GQ0A 3BLPX 1TJPA 4ZVJA 2VGIA 2PP0A 1B4EA 3ZXWA 2QUTA 2D69A 4RZBA 3VI2A 1S38A 3H23A 4Q33A 1W1YA 3DFYA 3BV4A 1SVDA 4DHGA 4PFMA 4AHOA 4R9XA 3HURA 2QF7A 3IIPA 5LKYA 2HVMA 4IPPA 1FWSA 3M5ZA 2WMIB 5AC5A 3DYPA 3N2CA 4YTUA 1NDYA 5DT5A 2PDYA 3MV01 1B3ZA 3N2XA 5D30A 4HCHA 2ISSA 2GJXB 3M1ZA 3HQ1A 3ITXA 5C9ZA 2QPXA 3VDGA 3OBAA 3MDWA 1W54A 5T91A 1A3HA 4EF8A 2BGSA 1AFSA 4WF7A 1GKQA 3KVJA 5FL0A 1RPXA 4CN4A 4ZXLA 3PVFA 2BVDA 1UD5A 2WHKA 3NZPA 2WVUA 3KW3A 5XIMA 4AIUA 1D3HA 5DFAA 1W5QA 1TMHA 3RJYA 1EX1A 3CHCA 3CZGA 3C2YA 1DBTA 3MHUA 2ZUSA 3BSMA 3W1PA 3GYEA 1GREA 4LBUA 3TVAA 1EQPA 3N11A 4UTJA 1UBPC 3NQAA 4TVYA 4FK9A 3LENA 4WXZA 1ESWA 4PFHA 2BWGA 1YNYA 4QSFA 3CU2A 5JCMA 4JXCA 5LGXA 1FWNA 1P6CA 5HR6A 3QOMA 5U4NA 3SQMA 4RNIA 1JDEA 4JFTA 1M01A 2E9BA 2VHLA 4RW3A 1O1HA 5E1QA 4FOUA 2VFHA 3R8HA 4IWWA 3BE7A 4RUBA 5LNSA 4Q4OA 1UP3A 4GJIA 2G0WA 4GUGA 1PE1A 5C9XA 2VP8A 3KOWA 2PWGA 3OHIA 1I0BA 4NG3A 4HHHA 3IEBA 3OZOA 4FLRA 4MHBA 2DIEA 3UXDA 4WGHA 1K4QA 1Z32X 3DFSA 4MWAD 3CAQA 3LRLA 2HXTA 1RJQA 4X60A 4HYWA 2E67A 3KCLA 4YN5A 3NG3A 3MU7A 2VEKA 3M5XA 2YCEA 3QSRA 4QNWA 3VOGA 1OYBA 3R94A 1S3HA 1RBOB 1WP6A 1XYZA 2UY3A 4QR6A 3TW9A 2QCEA 4U5IA 5CBBA 5D8WA 2Z0IA 3C0SA 3NQBA 1UIOA 3SCPA 2P1FA 1ZB5A 1WBJA 4WCJA 5D38A 2D24A 4F4RA 2G3JA 3PAOA 2VC9A 1KV5A 2GJRA 1F7BA 4LU0A 4UB9A 1RAKA 5JVLA 2JIEA 2XPKA 4S3CA 5EMYA 5LXXA 2HK1A 3T0BA 1YE6A 4FAMA 3PZNA 4ZOCA 4ZB5A 1OY0A 2VWTA 1YDNA 3CHDA 3VD7A 4Z2IA 3BLFA 1GYMA 2WKJA 1Q6OA 1IIHA 3T40A 5HK4A 1IR1A 1NH6A 4R3UA 3G1HA 4JEQA 1XLAA 2BHYA 1F74A 3DFPA 4AIOA 1JCNA 1K6WA 1TYGA 4ASTA 3RO8A 3QGKC 3U5UA 3FFSA 2JKAA 3VNMA 1VHCA 3LCLA 3FXYA 3VC5A 3AICA 4ZXOA 1A3WA 2RH9A 1BYDA 4U3AA 4IG2A 4GC3A 3WF1A 2WZTA 2KZHA 1QHOA 2EXOA 3R89A 2DQXA 3CBWA 5DRIA 2GFTA 4KIRA 4XD6A 4QJ4B 1ZJIA 2JQXA 3WFZA 3SRHA 2PF0A 4DO7A 2XH4A 3PS7A 5D32A 5GNZA 3SUWA 3G1RA 3NQ8A 1O7AA 2HRWA 3O3RA 2XWDA 4Z0JA 1FX6A 5IDZA 2YCLB 3UCDA 1GJWA 2V6OA 1Q7QA 3UQNA 2NUWA 3CV6A 3H53A 3RPMA 4UFKA 2GH5A 4OVXA 1GXFA 4UXDA 1FWJC 4DELA 1XF0A 1RBAA 3TUUA 2XWEA 4GI8A 4GFIA 1RHCA 3P80A 2CZEA 2NXHA 3QW4B 4ACZA 1F2JA 3MSRA 2NQ9A 3LHWA 1SSDA 2BOGX 1DKWA 1TV2A 2BHZA 1XIDA 1NEYA 2QXWA 1CGVA 3EA2A 3MW7A 2Q02A 1UOKA 3TCSA 3S2NA 5AYIA 3CZLA 2XFFA 3DZ1A 1JI1A 3CT2A 4IIGA 4UFMA 2DQWA 2A3AA 3N4AA 1JQVA 2QGHA 2ZRUA 8A3HA 1ZENA 1XLGA 4EAYA 3GE7A 2V3AA 1FWGC 2WOWA 3MUCA 4C1NB 4O10A 4O1AA 2A7RA 3H54A 4MF4A 4LEQA 4O53A 3TQ0A 1E1EA 4N2YA 4B3ZA 3F4WA 2PDWA 2PWVA 1DQUA 1TTQA 5FEPA 3IRDA 3FHAA 4K1GA 5T26A 2ZZBA 1C9WA 3T8LA 1VC4A 1OK4A 1F6PA 4Q7BA 5B7ZA 3L66A 1KBLA 2J74A 4LAMA 1T5AA 2CLLA 2GVJA 3FHQA 2O9TA 3R11A 4V28A 4H2HA 5FD0A 4KFOA 1F3PA 1QBAA 2R24A <