1DTNA

Mandelate racemase mutant d270n co-crystallized with (s)-atrolactate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
357
structure length
357
Chain Sequence
EVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALKSLKQLLDDMAAMIVNEPLAPVSLEAMLAKRFCLAGYTGLIRMAAAGIDMAAWDALGKVHETPLVKLLGANARPVQAYDSHSLDGVKLATERAVTAAELGFRAVKTKIGYPALDQDLAVVRSIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMFKALSIGACRLAMPDAMKIGGVTGWIRASALAQQFGIPMSSHLFQEISAHLLAATPTAHWLQRLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWREKEIGKYLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Racemase
molecule keywords MANDELATE RACEMASE
publication title Mechanism of the reaction catalyzed by mandelate racemase: importance of electrophilic catalysis by glutamic acid 317.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 132
structure length 357
sequence length 357
ec nomenclature ec 5.1.2.2: Mandelate racemase.
pdb deposition date 1996-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1dtnA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1dtnA01
3UXKA 4KWSA 3R10A 5J04A 3BOXA 2GGGA 5BOFA 3R1ZA 3RR1A 3S5SA 1PDZA 3Q4DA 2PCEA 2OG9A 4HN8A 5FJRA 3UGVA 2PGEA 4JN8A 2AL1A 4G8TA 4JN7A 3TQPA 4IZGA 1P48A 1DTNA 3V3WA 2GL5A 2PP3A 4KPLA 3FYYA 7ENLA 4IP4A 2OKTA 3DG7A 3UJSA 1JPMA 3MWCA 2XH0A 3IJIA 3SSZA 3OZYA 3V5CA 2QJMA 2FYMA 2HXUA 3KUMA 4ROPA 2PGWA 3U4FA 4HNLA 3Q45A 1EBGA 2ZC8A 3K1GA 3P0WA 4IP5A 3D46A 3SN1A 3MSYA 3UCDA 4H19A 3DGBA 3VFCA 2PTYA 3PWIA 2AKZA 1RVKA 4DWDA 1SJDA 2OX4A 3QPEA 2DW7A 1EC9A 3I6TA 3NZGA 4GGBA 4GYPC 3N4FA 4H83A 4GGHA 2OO6A 1TKKA 3T6CA 2PODA 2MNRA 3NFUA 2XGZA 3ES7A 1NELA 2PTWA 2PSNA 3JVAA 2QGYA 3DFHA 2QVHA 1F9CA 2OZTA 4GISA 2OQYA 2DW6A 1IYXA 3VA8A 4M6UA 1R6WA 3CXOA 3P93A 1XPYA 6ENLA 3H7VA 4H2HA 4DHGA 1KCZA 3H12A 4HNCA 3MUCA 3OW1A 4IL0A 4KEMA 2AKMA 2QJJA 4E5TA 2ONEA 2P88A 4M0XA 3ENLA 3CB3A 3MY9A 4KT2A 1JDFA 1FHUA 2PP1A 1E9IA 1MNSA 3N6JA 4GFIA 1MDLA 1P43A 3MQTA 4E4UA 1ELSA 3B97A 3GO2A 3SBFA 1MDRA 3V4BA 3VDGA 3T4WA 4ZA0A 1SJBA 3N4EA 4K1WA 3VCCA 5EU9A 3CAWA 3JZUA 2XH4A 1EC7A 1BQGA 2POZA 2P8CA 3QN3A 3SQSA 1WUEA 4GYPA 1W6TA 3ES8A 4E6MA 3FV9A 2QDEA 3UCCA 3OPSA 5FJUA 3UXLA 3ZLFA 3ZVHB 3VCNA 2QQ6A 3FVDA 2PS2A 2PU1A 3T9PA 1FHVA 5BOEA 1YEYA 4A6GA 2CHRA 3D47A 5ENLA 4ENLA 1MUCA 5FJPA 5IDZA 1KKOA 4JHMA 3R0KA 3DESA 2GSHA 3NXLA 3JW7A 3N6HA 1WUFA 3H70A 2PTXA 3TWBA 3ZVHA 3QKEA 4E8GA 1SJCA 2XSXA 1KD0A 1XS2A 2MUCA 4ZCWA 3CT2A 4Z1YA 2XH2A 1EC8A 4MGGA 3GC2A 3DG6A 3PFRA 3STPA 3T8QA 3RITA 4DX3A 1OEPA 3FJ4A 3HPFA 4MKSA 3OTRA 2QDDA 1SJAA 3DIPA 2P3ZA 3TOYA 1L8PA 1MRAA 3R11A 4J3ZA 3TCSA 3NO1A 4DXKA 3ZLGA 4Z17A 2RDXA 4HPNA 3DFYA 2OZ8A 3DERA 3OZMA 3I6EA 4GMEA 1R0MA 3DEQA 3IJLA 4DYEA 2PTZA 2OVLA 2OLAA 2P8BA 4IT1A 3UJRA 1EBHA 4HCLA 3TW9A 3UJFA 4EWJA 2GGHA 1JCTA 4YWSA 2ZADA 3SN0A 4HCHA 1JPDX 3H8AA 3UJEA 3TJIA 3UJ2A 3U9IA 2XH7A 2AL2A 2OFJA 4GIRA 4A3RA 3R25A 3VC5A 3SN4A 4X2PA 4J1OA 1PDYA 2PP0A 3MZNA 3BJSA 3RRAA 2P0IA 2PU0A 4MMWA 3TWAA 2NQLA 3EKGA 4A35A 4IHCA 3BSMA 1NU5A 3CYJA 1BKHA 3QLDA 3TJ4A 3CK5A 4E4FA 3RGTA 4H1ZA 4IL2A 3EEZA 3PK7A 3TTEA 3QTPA 3OP2A 4HCDA 2PA6A 3S47A 3SJNA 2HXTA 3RO6A 3I4KA 2OZ3A 3P3BA 2FKPA 2OPJA 3ZVIA 3DDMA 3THUA 2GGJA 3IJQA 3V5FA 1ECQA 2O56A 3DG3A 3MKCA 4K2SA 3FCPA 4FP1A 3ZLHA 2QJNA 1KKRA 3GD6A 3VC6A 3PWGA 4K8GA 2PPGA 2GGIA 2PMQA 4F4RA 2GGEA 4HYRA 2OQHA 3R0UA 3GY1A 4G7FA 4FI4A 3IK4A 1ONEA 3RCYA 1TZZA 5FJTA 4DN1A 2I5QA 2HNEA 2AL2B 5FJOA 1TE6A 2GDQA 3FXGA 2HZGA
chains in the Genus database with same CATH superfamily
2GK1A 4GQQA 1BQCA 4GKLA 1TWSA 5DBUA 4UTUA 1Z6KA 2PZNA 4O1EA 3TTQA 1DWJM 2X1SA 3VU2A 2PCEA 3VDCA 4L4MA 2ICSA 2ANUA 4H4WA 4KEVA 2OT0A 3TQPA 1PAMA 4NZFA 1UP3A 5IRPA 4J5NA 3WMBA 2PDPA 2A5HA 5M5DA 4K36A 1TSIA 2PWVA 3UP8A 3VDAA 1PB0A 3C0QA 5XIAA 4JTDA 3QY8A 3LOTA 2F8QA 2O9OA 4NEWA 3UZWA 3KCOA 3L4ZA 1T0OA 4MLJA 4WKHA 2ZQ0A 3IWPA 4PL2A 1VZWA 3S2LA 5AFDA 4PN2A 3GBEA 2X40A 4L6HA 1PWLA 3L5AA 3UR8A 3QPEA 3RN6A 4FNSA 4W7UA 1M6IA 1H7WA 4IPIA 3AHYA 4I9AA 2WOWA 5K4ZA 3SQMA 1J2BA 1JDAA 3WJWA 4UTIA 1JPKA 1DXEA 3RMEA 3CHEA 4GG9A 1VCVA 4ONVA 1XDIA 4Q6JA 3VKBA 1UASA 1X6UA 1GK8A 1KRBC 1FP8A 1UUOA 3A22A 4O57A 4EQRA 1XRVA 3CC1A 3SQLA 2Z6JA 3PC0A 4HB7A 3S46A 3BO9A 4M0XA 4DUOA 3VKCA 4FDCB 2D23A 1KTCA 4CD5A 1DYSA 3M4HA 1TPUA 2P53A 1YDNA 3ZFHA 2DUXA 1XRTA 4CU7A 4R7OA 5A69A 1QPRA 1TJ1A 1NHSA 1UR3M 5JCKA 3OU8A 5C7VA 1P43A 1GVFA 1C9WA 2YKKA 1BG4A 3PUGA 3KXQA 4Q8VA 3GDBA 1AFSA 4MYXA 2V6OA 1XL9A 3ZJ8A 4L1GA 1IHIA 4HHPA 5LXXA 1NFGA 1VJIA 1HJWA 4O16A 2D2HA 3IJDA 1FKXA 1OINA 3WBXA 2DZSA 3FG2P 4CLMA 1K8YA 3RPTA 4GRTA 1V6WA 3RMJA 3UXLA 1VFFA 2CNCA 4JQAA 1JIBA 3DFNA 5ABEA 1EJVC 1NJJA 1XYBA 4AB4A 3GXNA 1IE7C 5C70A 3K2GA 2GQ9A 4A6GA 2IXUA 4RZ4A 3TOPA 3O6YX 1ADDA 1HQTA 3S8HA 3F2BA 3LHTA 5EMKA 4L1WA 7REQA 3PPCA 3TN4A 3SO7A 3WF2A 1I2QA 3AYRA 1YIXA 3AMLA 1GW1A 1CB2A 2DORA 3B4UA 2PTXA 3QQ1A 4X0VA 3R6IA 4JFTA 4I9TA 3UESA 5CEWA 3G1XA 5CBBA 2UV8G 2J7DA 4GJIA 4NZCA 3BLLA 4QS6A 3EA2A 3KBNA 3WUFA 3WEMA 3U3HA 2GDVA 3EX6A 4Q4QA 1O94A 1H1YA 3AMKA 4JYDA 4TU1A 1C3FA 1HJXA 3N34A 4GLEA 1WBHA 2GJPA 3PG9A 1T3QC 1HKVA 4DXKA 2PDYA 2ZX8A 4KEUA 1K02A 1AJ2A 3VDHA 4HK6A 1YBQA 3S2CA 4DBUA 1OGGA 3TYAA 7TAAA 2YCKX 1JG9A 2OVLA 1XLJA 3H22A 1BRLB 3URBA 2J4GA 4LUIA 1EXBA 4DZHA 1X97A 1Q7MA 1WDSA 4BWLC 3SZ8A 1A0CA 4X9YA 2B7OA 2EPLX 2CXGA 4UWMA 1ZXIC 1W1VA 1XV8A 1O5KA 2XFRA 5DT7A 3GDTA 1OFAA 1XIFA 1K9DA 1PDYA 3MZNA 1V7YA 1RH9A 4FOJA 4QSHA 1GOXA 2GVLA 1ML1A 2NQ5A 3L4UA 3ITGA 4EMIA 3SCRA 4LEQA 1OX6A 3BSMA 1UWIA 3AU6A 4RZ6A 4ADTA 3UERA 3HF3A 4U3CA 4YMZA 4LALA 3RHGA 3TTEA 3DGRA 4DI9A 4R9XA 3W7PA 3HG4A 2MANA 4EM3A 3LCFA 4GIAA 3HPZA 4P7RA 4IUOA 1L2UA 4YWIA 5CPQA 4GI8A 4C5YA 1H41A 2C6QA 5BXPA 2NLYA 4FLQA 3LCGA 2CCRA 2YCIX 2SFPA 1NDYA 2XGIA 4AZBA 3AZTA 3AS0A 3OA5A 2HE8A 3UD6A 3WMLA 4IGHA 4QP0A 1TREA 1Q6LA 1M3UA 4IJRA 3F4NA 4Y8EA 1G01A 5DXXA 3EWXA 4ZSUA 1UCWA 4KCTA 3DENA 3DXIA 1KV5A 2AQOA 4HYRA 2OXNA 4XTIA 3W1UA 4BCEA 4DBWA 1TPFA 3P5YA 2PDBA 1XDMA 3MUXA 5K9CA 4K6AA 2C71A 3IVTA 3BW2A 1CLXA 4D8LA 2OLHA 4FO4A 4IOTA 1JCNA 4HA4A 2UY3A 1GXFA 3CGCA 2HZGA 4LBRA 1ZCCA 2PDQA 2X09A 3H53A 4LAOA 1XI3A 4QEHA 1SW7A 4AYGA 3SCPA 1Y5XA 4HD5A 1TTQA 1BGAA 1Q6EA 2QIIA 1B3YA 1YQZA 4XG1A 3L5MA 4EQXA 1EJSC 2E40A 2DP3A 3LHWA 1S1PA 3HTWA 4FNRA 4F66A 4AIBA 4JN7A 4KWOA 2OOGA 1RBAA 2X0SA 3SIZA 3FYYA 3EDEA 4NZJA 1FWWA 2HQAA 2ZXBA 3PJTA 1HL2A 1SR0A 4IX2A 2BMBA 3C2FA 4WJEA 3WBAA 5I0DA 5C71A 1FBAA 2GJXB 4AISA 2C13A 1H3GA 2XIMA 4HMCA 3QFAA 1Y65A 4UNLA 1MW0A 4AWEA 1KFBA 3CZ8A 3N1AA 5IM51 1E1FA 4H4VA 1G9HA 4EP8C 5GPRA 1Q63A 5A8GA 3I3EA 1C7SA 2V5LA 4Q4KA 1LZOA 3PWIA 1SZRA 1LROA 4DWDA 4LJ3A 1QI5A 1KXVA 3FOKA 3DH7A 3UR5A 3W38A 1QNPA 4IM4A 1ZAIA 3H2FA 5G4HC 1NTHA 4CN1A 2PWDA 3EKLA 3NFUA 1KCXA 4CCZA 1D7KA 3L67A 1FEBA 2DEPA 4H9TA 3V36A 1Q45A 2QS8A 4P7LA 1BZLA 3WLTA 5A95A 1LQAA 2OQYA 3WDJA 2EQ8A 1FKWA 4ZZ9A 1CW2A 3CEPA 1R6WA 1V4YA 4US6A 3E2VA 4GIYA 5CH9A 3G22A 1ZU8A 1KBKA 3H12A 8TIMA 3A6OA 3TYCA 2Y4SA 2HVNA 1OX4B 3WDHA 4WKFA 3URHA 4P8XA 1XLMA 3W23A 4A8LA 4NP7A 4ASTA 5FS6A 4IQDA 3L4VA 5B7YA 4JOMA 1D7FA 1UJPA 1TJ2A 3KCLA 3PM6A 1WCGA 4C1KA 3PWAA 3WENA 4YWOA 3FGCB 2WKGA 4HA0A 3SFWA 5F2IA 3IJ6A 5AHIA 3L12A 2BLEA 2YBTA 3GO2A 5CZJA 2OYLA 3E0LA 3SY8A 4CD7A 4IGMA 2VEKA 3KOXA 3WH5A 2WAGA 3M64A 5KZMA 4JIIX 3IUHA 2W4XA 1PZ0A 2E25A 2YA1A 3LTSA 4Q7IA 4PEEA 2W9MA 1M68A 4Y96A 3F4CA 3MUY1 2P8CA 4HA1A 4AMCA 4GPNA 1R38A 4L9XA 4KFOA 1E6PA 4M3PA 2FHBA 3GS6A 2Y5SA 3B8UA 5FEWA 2INFA 4GH1A 3WLRA 5E09A 1OFBA 1JD7A 4XIMA 3GRTA 2ZZ2A 4IG2A 1JGIA 4H8HA 4JNYA 2VEFA 4TX6A 4NKCA 3LM3A 4EWND 5D2XA 4H7ZA 4E38A 3DESA 4A4AA 1E4IA 3VE9A 5I23A 3VM7A 4I5XA 3TJXA 4XZLX 4O12A 4BY3A 1H7PA 3S5NA 4DQWA 4LANA 5LIYX 4NYYA 3GE7A 2YB4A 2OR2A 4PGLA 3V18A 1V3IA 5DQPA 4XKMA 1EGZA 1A5CA 4H4TA 3GDRA 3USBA 1DP0A 1DE5A 3W7RA 1KRMA 3R0DA 4PULA 1OZQA 3GWQA 4I7WA 5A8NA 3S1UA 2OGYA 4KWWA 3VOFA 1JD9A 4B5NA 3W4RA 2PURA 1C8YA 2AAMA 3CB8A 1VFUA 3GU9A 4S2CA 3GW3A 4EKJA 3H26A 1JI2A 1C29A 1TJPA 2JALA 3BJFA 5D8ZA 2W61A 5D05A 3TOYA 1J12A 2G5WA 1QHOA 2Y85A 2VURA 1HJVA 3LLFA 3N3MA 4ERIA 1OCNA 3CM4A 1A5LC 1KRAC 1YDVA 2QKFA 1EP3A 3I6EA 3II4A 4CNTA 2VZSA 1BXBA 1R0MA 4NZ4A 3F4DA 1EJXC 3SUWA 1YDYA 1Z8AA 3AHVA 1N8IA 1UD2A 3UJRA 5G2HA 3REQB 3W2UA 2YVJA 2GGHA 1PS9A 4Z2JA 4WXZA 3DGZA 4CU8A 1PIIA 3W88A 2ZUWA 4MY1A 3C6CA 3UJEA 4ZFMA 3W81A 3O1NA 2UBPC 5EL1A 1F7BA 2YJQA 5G1MA 4CNOA 3CWHA 1KTBA 2BHUA 1PBGA 3VYLA 2D22A 4LEFA 3U8GA 4AWSA 3SADA 2DFAA 2VUYA 3CYJA 1BKHA 3B0UX 2VFGA 3CQIA 5CKSA 4LY8A 3D9XA 2CBUA 4QFUA 3VD4A 1AMKA 2W67A 3CWOX 1U30A 1Q6OA 4QG8A 4X9SA 3DAQA 2ZRWA 1RZMA 4DJFC 2W54A 1BPLB 1BTCA 1VFOA 3N19B 4YNGA 1GTHA 1SZNA 2NQJA 5T9CE 2IPFA 3CHFA 4AZ6A 3QC3A 1XJBA 2IPJA 3K46A 4QLKA 3BMXA 1TQXA 2F61A 4C1NB 1WZKA 3QQ0A 3DN5A 1XIEA 4GVFA 4QDWA 1OT2A 1S5WA 3KRSA 4PTDA 5LNWA 4H04A 2QJNA 1DJNA 4NZ1A 2D69A 4QRNA 3N2CA 1UKSA 3R0UA 4J3SA 2Y24A 3WEOA 2CWNA 4C6NA 4ICMA 4D6HA 2I5QA 3CGBA 2ZZ1A 3MCNA 3BW4A 2YDQA 4FX6M 1HL8A 2J25A 1KRCC 1UWAA 2BVWA 1QW8A 3ID7A 5FSDC 1G4TA 1UP2A 1EDQA 3O0HA 1ADSA 1PEZA 4RLIA 1XRSA 3VIFA 4JN6A 1IXNA 4B16A 4PE8A 4AY8A 3NJ3A 3STFA 1SSDA 3WLPA 4XVEA 4YTSA 2ABBA 2ZZ7A 2DJXA 4APNA 3ARZA 1AZ1A 5AVHA 3WJZA 4MUPA 4OOZA 2WMJA 4KPLA 1XX1A 3N11A 5I3JA 3JR2A 4F2TA 2E6DA 5JRBA 3VMNA 1RAKA 4DJDD 4EANA 1R8LA 4X2RA 1MWOA 2QCFA 8XIAA 3QV8A 3GKAA 1HKWA 4M6VA 4UFHA 3APGA 5AHMA 5AZ1A 1PHWA 1F07A 3UWEA 3GSMA 1QDSA 1A3HA 3D46A 4GVGA 4MZ1A 1NF0A 3F5JA 3MSYA 3SN1A 1LWIA 2QR6A 5CC5A 3W7QA 4H9XA 4N6FA 3TN3A 1H5VA 5ABTA 4ZSTA 3STEA 1SJDA 1O66A 4W7WA 3D0CA 3WQFA 3W3OA 1W3IA 3M0LA 3TMQA 5A8OA 2MNRA 3CV6A 4POCA 3UVIA 2FH8A 1TYPA 4KWVA 4LVFA 3WSUA 2QGYA 2X1TA 2WSKA 1F9CA 2YZ5A 1NP0A 4FK9A 1RLCL 1XICA 2C91A 2XTKA 6ENLA 2XYLA 2NVKX 1X96A 3VCRA 3PPGA 2QDGA 3AROA 1GT8A 4Z2HA 3SY5A 1S2VA 2JKEA 2BSLA 1E5NA 3NYZA 1N55A 2XFWA 1YE6A 2WPEA 5JXQA 3O6DA 1R3VA 3C5QA 2P88A 3NUKA 4DUXA 1WXYA 2PWHA 1AMYA 2DGAA 3N2BA 3OBEA 1HKKA 3FHQA 3KE0A 4KESA 1XRFA 1W1TA 1JZ4A 5JCIA 1E9IA 3W7HA 2OSXA 4DJED 4TX9A 5FF4A 4JTIA 2HE5A 3RIKA 4HMDA 5FF3A 4LT9A 4O4VA 2ZUVA 3LCWA 4M56A 2BWGA 1QOQA 3G1SA 3TJLA 4Y6GA 4JAWA 4RNJA 4L1XA 1XYZA 4XZIA 4AZGA 2IQ0A 3WJXA 1Y5VA 3QMRA 1FTXA 4O1DA 3WFAA 1DL3A 4AY7A 4HNNA 4S3AA 1S3TC 4DNHA 3Q65A 3FV9A 4DXXA 5CCZA 4LNCA 1JPHA 3VZXA 4CEXC 4DZ5A 4U10A 2QV5A 1WZMA 3FSTA 4ML9A 1P6BA 1B54A 3SCVA 1Q6CA 3RX3A 2Q02A 3PUOA 1XR2A 4L61A 4D8AA 2W62A 5A8PA 3HZ3A 1UA7A 2PLMA 4UB9A 5DCBA 1N63C 2YL6A 2V5JA 2XVGA 3KZPA 4B90A 1AW5A 1GZ1A 4LC8A 2NX3A 2NQ9A 1GEQA 3WQDA 1KO0A 5AYZA 1LBMA 2VFEA 3W1NA 4C60A 4LBSA 3MP4A 2Q6ZA 3B0YA 1OD0A 1Q8JA 2IKIA 3L7RA 1QPQA 2V5DA 2QZRA 3ZO9A 2QAEA 3A5FA 1HG3A 2V3EA 3B9OA 2PI6A 3BSHA 3EOSA 2WNNA 3CZKA 3JUGA 1XLGA 4R7JA 4KIRA 1R86A 1CGUA 2P3EA 2YXGA 4P61A 2Q71A 1G4EA 1NOFA 1WQ5A 4J4KA 2Y63A 1RPXA 3NEVA 3PHAA 4ZE5A 4YCOA 4JTTA 1J9YA 3H4XA 3O16A 3AHZA 4TX8A 5G1TA 3DERA 1OZMA 4PC8A 2EGZA 3PG6A 5CG7A 3VD3A 3P7YA 3W87A 3W7GA 5CSRA 3URNA 1YNQA 4NX0A 3EKZA 2BZNA 2IKHA 3ITYA 2R24A 4DYEA 3VOHA 4Q8WA 2OLAA 3GR4A 2QW5A 3JS3A 4M1RA 3VIPA 4NIRA 2VD9A 3L68A 1EHNA 3DBNA 5J5RA 3TV8A 3MCOA 1FO4A 2CXEA 1ZS2A 2FZ9A 1NM9A 5E5CA 4QDPA 4YL2A 3BZJA 1E6QM 2VDIA 5BROA 1TV8A 3HW2A 1W3HA 3BMVA 5HWJA 3PS7A 1R85A 2DIKA 1A0EA 2WHMA 3NDYA 4HOWA 4PCNA 1G4SA 4S3JA 1I0DA 3ZZ1A 3W1RA 3QR3A 4PODA 3KS6A 1BRLA 3GQYA 4MKVA 2ISDA 4XKYB 3RRAA 5K3VA 3RPMA 5C8BB 4HJFA 1W31A 4IIBA 1SZEA 1O1ZA 2ZX5A 4KFNA 1XKJA 2GSEA 3W2LA 4FEZA 3LCLA 4Q4PA 2IMRA 1MUWA 3KVMA 4XSLA 1H61A 3TJ4A 2R14A 2GVGA 1VH7A 4IWWA 5B7ZA 1SFJA 4HHMA 2ISVA 4BZYA 1HJUA 2ZKMX 3M5XA 5I03A 2XIOA 1RK5A 4LAUA 4K7ZA 1WV2A 1HIZA 1UD4A 2ZRYA 2FZ8A 1KA9F 2PAJA 2PWGA 4QNEA 3TFXA 5D02A 3NZ1A 2NQHA 1QT1A 2VFFA 3PULA 3THUA 2Z2AA 4Q7NA 1UR1A 2KZHA 1CYGA 4PFMA 2JEPA 1DORA 3NZRA 2EF9A 4XUGA 3CHDA 4ZQMA 2NVDA 1TPH1 2X2YA 4O4WA 3UG5A 4PTVA 1KKRA 3W7CA 3PWGA 3M41A 2F2HA 2VJXA 3DYOA 4QG9A 5I5RA 4F4RA 3LADA 2IW0A 4O1CA 1LYXA 4AWTA 3LLDA 3IK4A 1V6YA 1RD5A 3P8IA 2W66A 4MB5A 1TV2A 2GDQA 3PZIA 3UG8A 2YOCA 2OO0A 3I7SA 4NYUA 1M7XA 4C7GA 1CX9A 4HZ8A 3UXKA 4OU1A 3KLJA 1AW1A 4LU0A 3TTSA 3MW7A 2CLLA 1R2RA 1C9DA 1SSGA 2QXWA 4MKNA 3F5KA 5CSYA 1UKPA 3JZEA 4KBXA 3G6MA 3CGEA 1I45A 1XSKA 3RR1A 2O9TA 1XYAA 3TSMA 4X3ZA 3B0VC 3QHOA 4NEVA 3TC6A 3G1AA 5I6SA 4ICNA 4W93A 3LXBA 2NW0A 1B3VA 4U4MA 1M04A 4Q8OA 1P1XA 3GHTA 3L65A 4O52A 1MFVA 5B80A 2GRTA 4YLWA 3MC5A 5ECUA 3SGZA 5AYYA 2WJFA 1KM5A 3WLNA 4BJHA 4PMVA 1SB3B 4HSNA 2DVTA 3QJAA 4IQLA 3HV8A 1ZK7A 1IEWA 5TBOA 2G96A 2DZAA 1QOPA 5DCEA 3G1FA 3SIMA 4IP5A 1P1MA 3WCZA 2FPYA 5LNSA 4HU8A 4X22A 1EYEA 1GHSA 1RUSA 5E9AA 4CCEA 1RVKA 2GJXA 2Z7GA 4E8DA 2GVEA 2E7FA 1EIXA 4JTAA 3FAWA 3SM0A 5AC6A 1GERA 1MSSA 3I6TA 2B81A 4NL1A 3CS2A 4F8XA 2PTWA 4JFVA 4M7TA 1SUXA 4LOCA 1AOGA 3N2OA 2VCBA 4RNHA 1J6PA 3FYOA 4GISA 5LGZA 4ADSA 2VUNA 1DEDA 1ONXA 3VA8A 7XIMA 1FDYA 3MMTA 1L9WA 4TV6A 4Y8FA 5MHBA 1YNYA 1EL3A 2QCEA 3OW1A 5LYRA 4IL0A 1VFLA 3EWCA 2RGMA 3BAJA 3T08A 4IFRA 1MZRA 1QW9A 4UUIA 5M2FX 4MPKA 2NX9A 1JDFA 5SWUA 2FVMA 1LVLA 1RPKA 3RILA 2REQA 4QLLA 3DHPA 3TMLA 2VEGA 1ME9A 4GBUA 1XP3A 2X8RA 4EAMA 5IBXA 4RCXA 1FH8A 1UR9A 4JBRA 1O7AA 3RNMA 3T4WA 1WOBA 3QQWA 1SJBA 1R2SA 4K1WA 3CLMA 4LA1A 1W5QA 4OBTA 3JZUA 3G0UA 4DVOA 1UD3A 4ZO8A 3GNDA 1PZ1A 2IPWA 1FWJC 1TWDA 3VIIA 1AH4A 4E6MA 2WM0A 4K8EA 5D03A 3GFZA 5ABHA 1F4HA 3QZEA 1FCUA 2YIHA 3WY1A 4A21A 4PYSA 2DZTA 1W3JA 5FJPA 1E72M 3EOEA 3N2XA 4LBUA 3NXLA 4V1XA 1A5BA 5CQ1A 1TA3B 3I3DA 4DJEC 4J35A 1PIGA 4WDTA 3ARVA 4WSJA 5GJNA 3TWBA 3QKEA 3W82A 3R8GA 4HMEA 1KC7A 1NWTA 3CT2A 1TO3A 1TCMA 3AWOA 5JUVA 1OFEA 5C9WA 1LF1A 2C3ZA 4H4IA 3ORWA 3TXZA 1OEPA 1M7PA 4KFPA 1UPPA 1VYRA 2VTFA 1JGMA 3WDPP 3FDKA 3W2NA 4Q4MA 2DV0A 5D9PA 3M5VA 1TVNA 5M1TA 3OBKA 4DM1A 3OC4A 1ZY9A 4Y9MA 4ERAA 5EB8A 5BU9A 3PUDA 2XJ7A 5HR7A 4G56A 1QCWA 2DZWA 2HSAA 1W1IE 4W86A 3N29A 1KGUA 3DEQA 4GA8A 3HURA 4AZHA 2HRWA 2ZYFA 3VGFA 4C65A 2W6RA 4U3AA 4EX4A 3EX3A 3VXGA 4IT1A 2OMAA 1Z41A 1ONWA 3E96A 4XB3A 3TSDA 1DHPA 1NF7A 3II1A 4EIVA 4GQBA 1SU5A 3PBWA 2FB3A 3EOLA 2BBFA 1HT6A 3TJIA 4OV9A 1FUYA 2PRMA 2CHOA 1JUEA 4W8LA 4Z1BA 2VC9A 1EO5A 1XBVA 3CZEA 1MOKA 1Z48A 2TPRA 1J18A 3R94A 2P0IA 2QVNA 1ZHAA 4OV4A 3CUGA 1NPXA 2ZXAA 1XHGA 1TVPA 4NI8A 3GG0A 3GVWA 3OJGA 4NZ3A 2WZMA 3MBDA 3QFBA 1ZMDA 3QGVA 4IFKB 3RLVA 4XZNX 1VENA 2A0NA 5I3IA 4R33A 3TR2A 4MVAA 5DANA 4J57A 3KRZA 1VFTA 3VOIA 1GGOA 2PRHA 4RDVA 1KXQA 4U31A 2E5AA 2GVYA 4L56A 3RNDA 3GH4A 3GR8A 3W6YA 1KM0A 1SFSA 1I75A 1RCXB 2WMKA 3L0KA 2F6UA 1OCJA 2GQ3A 2I14A 3IRDA 4LH8A 4GHRA 3MBFA 5ABGA 4BQ3A 4TUFA 2D20A 4B92A 1J10A 5IOBA 3WNMA 3ZLHA 4M1BA 1KM4A 3WYZA 4GC4A 3BSGA 5CLTA 1WXJA 3MV11 1QW7A 4Q8UA 1H7OA 4IFOA 1W5MA 2A7PA 2WBKA 2XFYA 1A0DA 4EVZA 4C1NA 5DMLA 5L6UA 4LSBA 4AD4A 4C5ZA 2W55A 3RLHA 4UQEA 2ZBTA 3EF6A 1QNSA 1H1ZA 3C61A 5FJJA 1DJZA 1E4LA 2Y8UA 3P8JA 1SO4A 2ZX6A 1UH2A 3AICA 3W1QA 1N61C 1JPIA 3VO0A 4DLFA 4XV0A 1LUCB 1OBAA 4L9ZA 1BF6A 3HG2A 1KWKA 1P4CA 4GINA 3UETA 1DJXA 1BWVA 1W91A 5LKYA 3MHGA 1HGYA 1V0NA 3MA8A 1IF2A 3DJGX 4HA3A 1JPMA 2Y70A 3IJIA 1F05A 5A6BA 1J0HA 3OVRA 1MW3A 1C91A 2ATSA 1KW1A 1GQKA 3FFSA 1QBBA 5ER0A 4W4QA 3AZRA 1HN1A 1K8CA 4JDBA 5I3DA 2R94A 1ZPTA 3N6QA 3GYEA 1G5AA 9XIMA 4XAPA 4FSAA 1LWHA 1R5YA 2PDWA 3UWUA 4LGXA 4C6DA 2UY2A 1LM1A 4QX4A 3MHUA 3LA4A 4A8NA 1VR6A 2HDJA 3RUBL 2H3DA 4H9YA 3RAOA 3H23A 5D09A 1FWIC 5XIMA 1YRRA 1ZJAA 4UTFA 4KEZA 3ES7A 3QRHA 1PIFA 3CT7A 4H4XA 1QVBA 2V2CA 2E8ZA 2DH2A 1NWUA 4RUBA 2V6AA 4H4YA 2ACSA 3G8RA 1VBUA 4QCEA 2QCNA 3H7VA 2WMGA 6TAAA 3CQ0A 5JH1A 3EWBX 4JIHA 2FTWA 4CGTA 3KCJA 1FCVA 4E5TA 1XHCA 2FVKA 1NQ6A 3NVYB 2ONEA 3N9KA 4JY8A 1FDJA 3PR2A 3HJEA 2PWUA 3HQPA 1V6UA 4D8ZA 2PP1A 3LK6A 4DYJA 4IPNB 3N6JA 1J0YA 1XFCA 4Q22A 4E4UA 6ALDA 2V9DA 1MI3A 2J7HA 2J6XA 4MOZA 3E6EA 3SBFA 1EA0A 2Z1XA 1JF5A 3WQGA 1QNOA 1MDRA 1XIIA 1JYNA 2QEZA 1TE1A 3QZAA 3E0IA 5A6JA 2H6RA 4ZA0A 3N4EA 5LA2A 4PR4A 2OEKA 1X1OA 4MF4A 4GYPA 1S2TA 4TVWA 3S83A 3UCCA 3EAUA 3APTA 1VEMA 3VCNA 2PS2A 2QJGA 2QF8A 3LHYA 1FFRA 5HMSA 4H8UA 4ATWA 3R8RA 1I60A 4QITA 2ISSA 3BMWA 3HG5A 4A29A 4F2UA 3LN3A 3DC8A 4DO4A 5D37A 4B5UA 1EF2A 1I2PA 4EOUA 2E67A 2JGYA 3VGGA 4F2BA 2R1KA 2A85A 3P67A 1FWDC 4GYJA 1DQUA 3LLXA 2NXIA 3AJXA 1A3WA 3AIVA 1HVXA 2ZOXA 4B15A 1H4PA 1TYGA 5IFTA 2BVDA 2VO5A 2XH2A 2DT0A 3PZ9A 5G2IA 3GVQA 5EPDA 2FTPA 2WM1A 2EPMX 3TROA 1Q13A 5G5GB 1OYBA 5HNUA 4EQSA 1SW0A 1J0ZA 2P0OA 1TV5A 1JEHA 3HPXA 3UWWA 3I7QA 5JBEA 5KVIA 3EWZA 1JAEA 1O68A 4FIRA 3AAMA 1H51A 3B9JB 1NFPA 1US0A 2GJRA 3TLLA 3G6LA 4Z17A 3DI1A 2DH3A 3C2YA 2J27A 2OTDA 2YFNA 3OBAA 1E6RA 2R6OA 2OZ8A 4JGDA 3W7MA 1Q1WA 1NWRA 3L4TA 3U2CA 3T55A 4BF9A 4TR9A 4AD1A 1WBJA 1GONA 3DHDA 3GH5A 1PKYA 3IJLA 2A79A 3M16A 1IZKA 2WNZA 4JTFA 4Y7EA 1V0LA 1JI1A 3LPPA 4OQVA 5G2WA 1JCTA 4QISA 4GVHA 4IF2A 4I9JA 3A7AA 3U7VA 1K77A 2WHJA 2ZADA 1TMHA 2YSWA 1DKWA 3FX4A 3VOJA 5LA1A 1V3MA 4FXSA 1XIBA 3U7BA 3AXKA 2YVGA 4AFYA 3L66A 3G2GA 4REQB 4C6LA 2Z1VA 3MV01 3AJ7A 1G69A 1RK6A 1DWHM 3LI0A 2ACRA 3MMDA 4LUTB 3H2AA 1AJ0A 4V1YA 1T99A 3GZ3A 2V67A 3TC3A 4NAFB 4FR1A 2FH6A 4KPRA 2DSUA 2WK2A 3QYQA 1W5OA 3GTIA 4JEJA 3WQ6A 1OHLA 4GFSA 1EFZA 1XCWA 2QJIA 3WQOA 1US2A 2Z29A 4ZTYA 5REQB 4XKYA 2QF7A 2QIWA 3GVRA 1U1HA 3AYTA 1GOOA 3KBMA 1LBLA 1EJUC 1UIOA 4D71A 5BWFA 4C6CA 1R9XA 3I6RA 3TYEA 1THFD 4GVIA 4JIQA 1XW8A 1CZ1A 1S5NA 1FWCC 2YCEA 4NXSA 5F4XA 5EMUA 2XWDA 3CYVA 2QLYA 4H4PA 3MKCA 3WDIA 1X7FA 3PBYA 3NTYA 1WXZA 4UOZA 5CXPA 4H6KA 4W5ZA 5M3WA 4GK8A 2E3ZA 3URQA 3PAJA 5AN7A 2OELA 4GYFA 2UY5A 2KX9A 2ZA3A 4H2CA 5FJTA 4XBKA 5CBIA 3UEQA 2AL2B 2YYTA 1SPQA 4JTRA 4DAIA 1XIJA 3UR2A 3A3HA 2WMIA 3ONBA 4YTTA 3DECA 1ISZA 3S5YA 4JQ9A 3KBWA 4NNAA 2H9AA 4LRTA 8RUCA 3MSDA 1SW3A 1ZMCA 4F9DA 2A4AA 4ROQA 5JIPA 2PDFA 3GTNA 5BOFA 2X7WA 1Z32X 4IXHA 3U4AA 5BMXA 1XLLA 2A3EA 3IV3A 3AZSA 2RDUA 5DN1A 3PANA 3B4YA 2J47A 1L2QA 4NZ5A 2PGEA 3HBLA 1FFUC 3CO8A 2P1FA 4C6PA 4QQ3A 2ZRUA 5CGTA 3OB8A 3VNYA 5LNRA 1DTNA 1KN0A 3GFXA 1E1CA 1MXDA 3I65A 2OKTA 3WFZA 4CVUA 3UPBA 2AQVA 2X1UA 3V5CA 3POCA 4FXRA 3B03A 2PGWA 2QCDA 4DO5A 1UMLA 4WOQA 4P8VA 3CV2A 1EEPA 1UZDA 2ZWYA 1WKEA 3WNOA 1XPGA 4R88A 4JICA 4IISA 3BARA 4PUDA 4QXIA 2VXNA 6REQB 4Y9PA 1ZFJA 1Q65A 5BRQA 1BF2A 1DTUA 3TA6A 4P7NA 4M81A 1JYVA 2BOFX 1WDWA 3H2EA 3T09A 4ZB0A 3ETRB 4GGHA 3UXDA 4IIDA 3YPIA 2V8ZA 1RVGA 3JVAA 4ACZA 2JGQA 4ZOHB 4DBDA 4A05A 2YCLB 4W9TA 5AYIA 3NS1B 1GEUA 1EO7A 4Z1CA 5HJYA 1GVYA 1G7UA 3B8DA 5HJLA 1H1NA 3BDKA 4FX7A 3FSUA 2PF0A 3PPFA 5FS7A 2V81A 3ZSSA 3AISA 3FA4A 1JCYA 1J0IA 3PBMA 2VX6A 1PTGA 4DUWA 3GM8A 1N2VA 1QAPA 1ZENA 5BYWA 3E2SA 2A21A 1P0NA 2IPGA 1E3XA 3W76A 2F2KA 3CMJA 3M7WA 1Q3NA 1S5MA 1EDGA 3KW3A 3N15A 3P84A 2YXOA 1NAL1 3L4YA 4DPQA 4UBPC 2OKOA 3TSBA 1XLKA 1JDEA 2C3CA 3PB0A 3N9RA 2Z7KA 2POZA 2Z1BA 4GC3A 4F40A 2ZZ0A 4FIQA 3GX9A 1W9BM 3Q37A 5BWAA 1STZA 4EMJA 2VT0A 1W6TA 3W1LA 3J7HA 3GD4A 1CLKA 1KXTA 1WA3A 3PB2A 2GJNA 2PB1A 4UNIA 4WY0B 2WO5A 3HGOA 9CGTA 2QQ6A 5FEZA 1M65A 1M9HA 3BE7A 5CG0A 5A2BA 1JZ6A 3KS5A 1MRQA 4GJJA 4LIIA 4TIMA 3WQ4A 4ZEPA 3VNKA 3WD0A 2E3TA 1NIUA 2B7PA 3LNPA 5XINA 1VKFA 1POJA 1ISWA 3IGXA 3CUIA 3I7RA 1JCMP 4RZ5A 4F0KA 4ZODA 4UR7A 3H24A 2FGBA 1AQHA 3RCMA 4HQVA 3FN9A 1YPXA 4DWSA 2DSKA 2VDGA 3PZTA 1BWKA 3O6CA 3V1HA 2GQWA 1UPMB 3PFRA 4RW3A 3T8QA 1SVDA 1U5HA 1TA3A 3NM1A 4ZOAA 5MF5A 3E5BA 3LRKA 4TMBA 4XAYA 2OSWA 1QU4A 3CL7A 3WLIA 3PZGA 1XQKA 4PUUA 3NZPA 2NZLA 2WMFA 4NVTA 5A8MA 5KZDA 4B5WA 1DJGA 2TAAA 4JQ2A 3O06A 1HX0A 1E70M 2RDXA 4HPNA 2CZVA 2E0PA 3VNLA 1KQYA 7A3HA 4HTYA 3OZMA 3CPGA 2ZE0A 3BPWA 3IIXA 3HG3A 4HU4A 1W9PA 3TYDA 1E73M 2Z0IA 5A6MA 2G41A 1MUMA 3NA8A 3LBMA 4PTMA 2RDWA 4TO8A 5HA7A 4G7EB 2B0MA 3DKLA 2BVTA 4E0CA 3TW9A 3WJYA 2FDMA 1IV8A 4HVXA 4XWUA 3WKZA 2INEA 4PMZA 4RK8A 4L4OA 5DMMA 1JPDX 3G1VA 2XGBA 3W28A 3DX5A 3BANA 3R2GA 5G1YA 2YA2A 2ACQA 4YJ5A 2Z1WA 2F5ZA 3G3MA 1NSJA 3SI9A 3PJUA 4HHLA 4QBXA 1JNEA 5CPLA 2J66A 3LRLA 3A21A 4HKPA 2Z26A 5HMFA 1I2OA 4TTGA 3M6YA 5D2VA 4C7FA 4CNUA 3O2LA 5DX7A 3GDLA 1ZX9A 5F7UA 2QMJA 4XD5A 2X05A 1NDVA 3SJNA 3VIGA 4UQAA 3RO6A 1RCOB 2Y89A 2Z6IA 3EYPA 1R3YA 3T0BA 5F1UA 2C79A 3NDOA 3UYCA 3M0VA 1BFNA 5C2XA 1ZZMA 1EGMA 3AS3A 3EEGA 5HANA 4P2VA 2O55A 4IFKA 4ZL1A 4G2DA 3W7EA 3OYZA 4OOUA 3IJQA 3SDOA 2O56A 4LAZA 4LYPA 1UZ4A 3W1XA 2VP8A 4PRRA 3WJSA 4XD4A 3U2OA 4BWLA 2ZA1A 3ZJ7A 1JZ3A 1MMFA 4NNBA 5EMJA 2J7CA 1RQHA 4WHBA 3KHDA 4JX6A 1ZP4A 1M41A 4PB4A 4Y9NA 1TZZA 1H60A 5H91A 2WQDA 4IMGA 2HNEA 3WG6A 4WD0A 1XIGA 3IJ8A 1SFTA 2D3NA 3FK4A 3VGHA 5DBTA 4PUEA 1MVYA 1BSIA 4RPPA 4MTVA 1QO5A 1Q6QA 5HR6A 4IP7A 1UWTA 1S5TA 1VJZA 2ZVIA 1YXCA 3ZYZA 7PTDA 2ZRVA 1DE6A 4HN8A 5EFDA 3EXTA 4QJ3B 4JD4A 1Q5MA 2O4MA 3LB0A 1WDQA 5K7JA 3F4VA 2E6FA 3RJXA 5CSUA 2Q3OA 4ES4A 3L8KA 4GABA 2XG9A 1S46A 4AVNA 3WLLA 4R85A 1OCQA 3VZZA 5I77A 2G37A 5MKGA 3MHFA 4GCXA 2R1NA 1LUCA 1XSIA 3B9DA 2WHKA 1OC7A 4NF7A 2DIEA 4JDRA 4GUIA 3K1GA 1NEYA 1UP0A 3PNUA 3SUTA 4AUBA 5I24A 1Z9AA 2G3FA 3B8WA 5CLWA 1J5TA 1V93A 4O50A 3Q67A 2V63A 4C90A 4F3HA 3KDOA 3ZR6A 1TUFA 1W32A 5HDRA 4AC7C 5C2GA 2Q8ZA 2ALDA 5E0CA 4TVUA 1V77A 4GGBA 4H83A 2WOQA 2JIWA 2UZ9A 3SR6B 3CPUA 3R79A 2PSNA 2R1LA 4AZCA 1D3HA 4UFLA 4D72A 2QJHA 4CEUC 1IXPA 3IGUA 1JJKA 5A8QA 1KQZA 1M7OA 3PFMA 1FVPA 2ZFAA 3COTA 1MQQA 3RG6A 2NQZA 1UBSA 2WXDM 3HMJG 4I6VA 3EPMA 5CPTA 5KEZA 4M6QA 4TVCA 1KB3A 1X7IA 1NVMA 2BP1A 5FIPA 5HWMA 4PUWA 1RALA 3C2EA 5U4NA 1V02E 3CB3A 3CH0A 4QIUA 1VAHA 3IJ7A 3DHUA 3TFCA 3EB4A 3MTWA 1XYFA 4MJ4A 1GKQA 3A47A 3CUHA 4PSPA 5CPOA 3OGRA 4EPBC 3QEZA 2BDQA 2EG8A 3SCWA 4HPXA 2D3LA 3SY1A 1RV8A 3VFLA 3B9AA 5F2MA 3PF3A 4EMWA 3T05A 1IEXA 2J75A 1REQB 3IIOA 2XM2A 2CBJA 2A7RA 3TONA 2XSBA 3HQOA 3O9NA 3FHAA 5C0QA 2TODA 4DI8A 1S5VA 3GC5A 1OFQA 3O7UA 3DU0A 4H50A 1TQJA 4ZQRA 3QY6A 4GZJA 3T81A 5LXEA 2NSOA 3KX6A 4JS3A 2BGNE 1N60C 3OYXA 1FWGC 3KTCA 2WSQA 1RQBA 4CQ8A 3NO5A 4GNJA 2J7EA 2CHRA 3ARUA 3W85A 4Z1AA 3I10A 3NQVA 1UOZA 4Q3MA 4V28A 1HL9A 2YDAA 3ITXA 5H6HA 2ZUNA 3KWXA 1P0EA 3VX1A 1P0DA 5BW6A 3S9IA 4N9CA 1OADA 4TOQA 1GVRA 2J8TA 3BG5A 1TCDA 1YTEA 4V27A 5EY5A 1LLZA 4A3YA 4AZ5A 4YIWA 3BICA 4UR8A 4GE8A 1Q66A 4UTLA 3FDGA 2VR5A 4DX3A 2V38A 1VJSA 4WGHA 3T8LA 3EA1A 3AXIA 1H0IA 2E5BA 3K13A 1GZGA 2UY4A 4RPQA 2QDDA 1CXLA 2WVVA 1J93A 4KW2A 4O1AA 2FZDA 3QMTA 5DMNA 3CHCA 4RL3A 1OK6A 3WMCA 2D1ZA 1Z69A 1JFHA 3W1TA 1XQLA 3NQCA 3DYPA 3TKFA 3CAKA 2RFGA 3SB0A 6XIMA 1AH3A 1SZGA 2CKRA 2DIJA 3FY1A 2JBMA 2WOIA 4OWGA 1CECA 3OLGA 4QLJA 5HPCA 3BQ6A 2VZVA 4A2RA 1UROA 3HA1A 2D24A 4OUIA 4MJ2A 4HIBA 2FLIA 2V2DA 4IICA 3PSVA 3KRUA 2PDCA 2BX7A 2QUTA 1V03A 1ZGDA 1N62C 3WLJA 3UG4A 2E9BA 3CAVA 3TYBA 1LL4A 2VZTA 5CPNA 2CITA 4M82A 5AHFA 3OLEA 2BGQA 4J28A 3S4TA 2CLEA 1MYRA 4GOAA 3TWAA 3RJYA 5KZEA 4ECLA 1F61A 3HPSA 3C52A 3AMGA 4DM2A 1LT7A 3N2MA 3QZ6A 3QLDA 1YMYA 2AGKA 3AALA 3Q94A 1WDPA 3ZXWA 1OG0A 2R9RA 3PJWA 1B3ZA 3C0LA 3BUVA 1MEHA 3NQ2A 3M0XA 2FZNA 1PL9A 4LY4A 3GXTA 6A3HA 1W3LA 2O9RA 3S47A 4LUTA 1GKRA 2E4TA 2XVLA 5CJ5A 4J3WA 4INFA 3NQ6A 1JCJA 2I57A 4LTSA 1GJPA 3HQ1A 3RM8A 4NAFA 5AKQA 1YTDA 1AA1B 4Z2LA 2BC1A 4IIGA 1KBLA 2XPKA 2R91A 1IWAA 4GCAA 3OLIA 4NRSA 5REQA 3W6MA 1EOMA 2CESA 2PBOA 5BU6A 3WBEA 5JQ9A 1ZSXA 4WGXA 3EBVA 1EP2A 1F3WA 2GGIA 2NWRA 3DK4A 3LTYA 2QYGA 3MUAA 3THCA 4MWAE 4AD3A 4Q6XA 4CQDA 4F9JA 3UT0A 2WNWA 2YW3A 3THQA 3IC9A 2PC8A 2WZTA 3AUJA 4H6QA 1CTNA 2EJ1A 3W6LA 1UWQA 4AZIA 2CZ5A 2J9ZA 5HQEA 3A4AA 1XGDA 1OT1A 1RXOB 2G3IA 1WX0A 3XINA 3KBJA 1BKSA 1XD1A 3OLDA 4JTLA 3WFLA 4ERGA 3WUEA 4UXDA 4IIEA 3WF3A 5FCZA 4ZQOA 3HV9A 2DSZA 3O6AA 1DWIM 2V3BA 2VQTA 3QC0A 1S3HA 4ZB5A 1OY0A 4G1NA 2OB3A 3IUIA 1AUSL 1QASA 4UMCA 3GTHA 4HOZA 1LOSA 2X16A 3GXDA 4S3GA 4DJFA 1VFSA 1JUBA 1XH2A 1UUQA 4LVGA 3MKKA 3TYZA 2VGFA 4PZVA 5A6BD 5I2UA 1W1B1 4FLOA 1ZB5A 3IIPA 3CV1A 4UTWC 4C1LA 1VYSX 4ZO6A 3MWCA 1TJ0A 2CZFA 2XIQA 2CERA 1YNPA 2EEXA 4O0ZA 4C6IA 1BD0A 3KLLA 3CTTA 3MO7A 4CCCA 4K38A 3FS2A 4I8DA 1KFKA 1KBBA 2EXOA 3P0WA 3TN5A 3KRBA 1AZ2A 3OHIA 3GVVA 5AHEA 3ZR4A 4U5KA 3WBYA 1I4NA 2PUZA 3MS8A 2E5CA 3BLKA 1RA5A 4ZMGA 3NEHA 4MY9A 4QR6A 2VC7A 3VM5A 5I00A 4D6DA 2E77A 2J13A 1JVNA 3N4FA 2V3AA 3M1ZA 4GZ7A 3VVGA 1NELA 2GK1B 3LGGA 1CI1A 1GCYA 3BL3A 6REQA 3L9CA 3VD9A 3LHVA 3TNBA 3P93A 2EKGA 2XINA 1X8FA 5CZSA 3FLUA 4MADA 3VKAA 2VRQA 3INPA 4GUJA 1E9ZB 2ESCA 4ZGYA 3LD5A 5EFFA 3EX2A 2FFIA 2V3DA 3AHTA 3V35A 2ZE3A 1P7TA 2EBNA 1BVWA 2V30A 1IEQA 3VPLA 3EA3A 2YCLA 3RU8X 3GDKA 3U2ZA 4KT2A 2WANA 3VNZA 2BS9A 4O1FA 1M7JA 5BRBA 3N04A 4S39A 1MEIA 2XFFA 1OFOA 1GVIA 1H2IA 2JK2A 2VENA 4FX8A 4FXJA 1LTDA 2OSYA 2PDUA 4N9EA 1GEHA 1XLIA 4K8DA 1RBLA 1EPVA 4JKLA 3GIQA 1DQXA 1XYLA 3BLDA 3TTYA 2EHHA 1BQGA 2YAUA 1W1A1 4ATLA 1IGWA 5AYBA 3ZS4A 3MO4A 1E40A 3QN3A 4BHYA 4J3UA 4LVBA 3CJPA 3AMZA 3H2NA 4NX5A 1I2RA 3ZLFA 3ZVHB 2ZZ5A 4LYQA 2PU1A 1IWPA 3ANYA 3PBUA 4G6CA 5DF0A 4MSSA 1V59A 2Y0FA 4H9ZA 4QQUA 4C6QA 1QPKA 4E8CA 5IBXC 1LG1A 4J3TA 4DLMA 1GQNA 3C8NA 4P7OA 4XQ6A 1PV8A 3BLEA 1RQEA 2ABAA 1GOIA 2W79A 1VP5A 1KXHA 1V3LA 2WB5A 2DUAA 2MUCA 3MANA 1GRFA 3BJTA 4JTKA 5D9OA 3MUZ1 1A3XA 4NSBA 3WLSA 4B3ZA 4AY1A 4QROA 3IPWA 2DU2A 4R7WA 1QWKA 3ZSTA 5CC7A 1WO2A 4ACYA 5L9FA 5HINA 1JRCA 3S1GA 1OFRA 1V8EA 2PEVA 4Z2GA 2C8NA 3DIPA 4I9MA 2WSRA 1PCWA 4Q7BA 4K1GA 2YLAA 4OZOA 2X2GA 3NGFA 2A2IA 3NO1A 4XVDA 1R2TA 3H6OA 2YBVA 3FXYA 2Y6ZA 1R46A 2NT1A 4AZ7A 1PKMA 4KKXA 1TPC1 4JTUA 1QNQA 4IUGA 4HNUA 2B31A 1UB3A 4GMEA 1VPQA 1UD6A 3U0HA 1DV7A 3GXPA 3W74A 1ONFA 3NPXA 4HCLA 1VRDA 1P5BA 4XK2A 3WH8A 1GPFA 4AXKA 3EOOA 3SRDA 3HFYA 1BYCA 3A3WA 3CXBA 4RE4A 1UKQA 2ISWA 1AJZA 3JU2A 1GQLA 1O4UA 3F2CA 4UR9A 4C6FA 3KDNA 2BHZA 5KVHA 4LXFA 4ZR8A 3LGEA 3IVUA 4YTRA 2DY3A 2O92A 3ZWSA 1O5QA 4JTJA 3KBVA 4J3XA 1S39A 4CQBA 5FMHA 3OHMB 2YX0A 3UFYA 2CBIA 3P61A 1FQ0A 3NQFA 3NQ7A 1NU5A 3WNPA 4PCTA 2ZCGA 3ABQA 4C6JA 3HMCA 4NJJA 3CPRA 3EEZA 4MWAC 2O4QA 4AIEA 2WSPA 5DRCA 2HXTA 4AF0B 3QTGA 1VEPA 4WDUA 3PPHA 4FNTA 1F3EA 3A7RA 2DSWA 2NXGA 3P3BA 3CWNA 1DWAM 4UOJA 3W2KA 3RF9A 2NV2A 4U33A 1WZLA 4LRSA 3GHUA 2W27A 2QUUA 1F2JA 1ISYA 2CLHA 4O18A 2ZWZA 2C1GA 1ITUA 5TR3A 3K4DA 4K8GA 5CPSA 4HJWA 2Y7GA 5KITA 3W2JA 3EMZA 2VWTA 4PMRA 2OOFA 4G7FA 4IMEA 4N4PA 5A2AA 4YYFA 1VQZA 2Q3RA 1GRTA 2QAPA 2VZOA 5CGQA 1F76A 2GDUA 1SR9A 3TEVA 4RV8A 3B0PA 5FF7A 1VIWA 3VD5A 1TWZA 1S7MA 1FEAA 3STGA 3DHFA 4ORIA 1SM9A 3SURA 1A4LA 1T41A 5J04A 1X98A 5G5IA 1HNYA 3ATZA 3VABA 3NR0A 2GOKA 4QE5A 3P80A 2Z27A 4OECA 1W17A 2NPXA 1TIMA 3M5YA 1ZJIA 4Q8TA 3G1HA 2BY3A 2FFCA 3AC0A 4PRTA 3UF9A 2LLEA 4LS1A 4JYEA 2E1WA 5T8GA 1MO9A 4HPJA 2E5DA 3TC7A 4D2JA 1W2PA 3VIJA 2VWSA 4O13A 3T44A 1FH7A 1HZYA 3KOWA 1PKLA 1EQCA 1BTMA 1S2UA 1PYFA 3NL5A 1FOBA 4HNLA 2H90A 4Q8NA 2YGYA 1VPXA 1VB9A 4ZVJA 2Z24A 2ZC8A 1GQJA 4FAMA 2PF8A 4Q32A 3ARQA 1QHPA 1TRIA 3ARWA 4GR1A 3E02A 1F3PA 3UCDA 1GYNA 2V0TA 1N8FA 5FAGA 1VLIA 1IR1A 1L6SA 5T91A 4L64A 1BEUA 1LQ2A 2W63A 3NQ8A 2X8GA 3NGJA 4DF2A 2BXYA 2OT1A 3IAQA 2EPNA 3EMQA 2ZA2A 4LW7A 2QVHA 1DBTA 4MY8A 3W7DA 3VGEA 1T5AA 3W01A 4EK7A 4JIEA 3CXOA 3ZJKA 1G0CA 4K8HA 1B90A 1SMDA 4E3VA 3BQ5A 3R58A 2GWGA 4LX4A 1W9DM 1EH9A 3B8IA 4E2OA 2A1YA 2J3NA 2VRJA 5AB3A 2QJJA 3WH9A 5EBAA 3CHVA 4AX7A 1IWBA 3LDVA 4BI7A 3S3GA 2WLZA 3MCMA 3BAIA 1Z44A 3N9SA 1UR8A 5A3HA 1G94A 1YDOA 3O07A 3IUDA 2WPBA 1XIMA 4GFIA 2GR1A 2IKJA 4JHZA 4QJ1A 1XYMA 4XIAA 3WLMA 3MQTA 2W91A 4B9ZA 5CGMA 3GU1A 1B3WA 2WMHA 4OJYA 3NOYA 1E9YB 1FWAC 3VDGA 4WJXA 4Z42C 2HWGA 1DXIA 2E28A 5KZ6A 4AEEA 5AYXA 4LV4A 4AYSA 4GUGA 1SO3A 1XKYA 4TVDA 3P14A 2EQ7A 2BHYA 4H4QA 3HFTA 4GBDA 4GACA 1R3SA 4XSMA 4MJMA 1AODA 4L4PA 2GR2A 2A3LA 1X2GA 3R4IA 3GIYA 3EXRA 4D1IA 4UQCA 1YEYA 3GW0A 1CEOA 4FX9A 2XISA 3WN6A 1CB7B 1REQA 1QI0A 1ODZA 4CD6A 1W9UA 3E12A 1LRNA 4DWSD 1EHAA 2BOEX 5A2CA 1A5KC 3QV9A 1FFQA 3QOMA 4XO6A 1LWJA 3PZMA 1YPFA 1UZ1A 3UXAA 2QUNA 1F5ZA 5JCNA 5AC4A 1B57A 5EA9A 3PVFA 3ABXA 3C56A 5D2WA 1KD0A 3V16A 5DT5A 3V7PA 1JUKA 4MFDA 1EC8A 3ABSA 4FS9A 5JMUA 4QJ5B 3BLIA 4AIOA 3CIXA 7TIMA 3LUTA 2D2OA 3QLLA 3OGVA 1EB3A 3PP7A 3BLFA 3RLUA 4M51A 4H4UA 1H62A 4XZBA 1ZP3A 2DZUA 2JFEX 3WD2A 2QHAA 4EXAA 2ZVRA 3UY8A 5AVNA 1W37A 4UFIA 2VGGA 1FXPA 3TUUA 4NJIA 4CN4A 4Y9AA 2TYSA 3WNLA 4UNKA 2WW5A 2P8BA 2O7QA 3WK3A 4DY1A 3N12A 1XXXA 5T26A 5FEPA 4P8UA 4EWJA 4MJZA 5HQLA 3HIJA 3LGDA 2B7NA 4B2DD 4YWSA 1DNCA 1OFDA 4IG2B 2P50A 1MW2A 3XISA 3NPUA 4OFCA 3QGAC 5BXRA 2OFJA 4PCSA 3W22A 2XIIA 4IQEA 4AD2A 4JFUA 1VHCA 1O12A 4OTKA 3LTPA 2PP0A 5RUBA 1UR2A 4FLRA 4MMWA 1VBHA 1ZNNA 3P2VA 2RDTA 1J79A 2CLKA 3KVLA 3NNTA 1ZAHA 4D6CA 1B2YA 1M53A 2BASA 3HJZA 4N42A 3GKFA 1AD1A 1CGXA 3E5PA 2D0GA 1UD5A 4RR4A 1CXIA 4BFAA 3M0YA 3PBVA 2ZZ4A 3UWZA 2HJPA 5LIUX 4WJ8A 3NG3A 3OO2A 1WP6A 3PY2A 1YPIA 3GG1A 2TPSA 3F7JA 3LV5A 4CNPA 1I8JA 2C19A 3WQ5A 4XZWA 4HNTA 4GQ0A 1UIPA 1TJRA 3LY0A 5ABFB 3ARTA 4HN4A 3EANA 1TTPA 1ZY8A 4JDYA 4RNFA 1VS1A 1V3JA 4FP1A 4ZB2A 1A50A 2XVKA 4ZE4A 4BI6A 1LOLA 3MWAA 3H7RA 2VC6A 3CMGA 4YVXA 1XUZA 1H5YA 2OQHA 4JQ3A 4X61A 1IT8A 3UG3A 2NUWA 4URIA 2NUXA 3TZFA 4HZMA 1I2NA 3IK2A 1EBDA 4O15A 4YYCA 1V0MA 5FJOA 5JH2A 4PUMA 3HGJA 3KZSA 4I8YA 4Y90A 4GO8A 2OWXA 5AZ0A 3WQEA 4GJ1A 1L6YA 2FZBA 1KM6A 3A24A 3W53A 2G95A 3DCPA 3T2QA 2HVOA 4LUYA 5F1VA 2RJHA 3WQCA 3PSWA 3QPYA 2WBAA 2OG9A 4TVYA 3DFSA 3OIHA 1VBRA 1D9EA 3CZJA 4GO9A 2EPKX 2OEJA 4H6RA 1B30A 2PD5A 1PX4A 2PE4A 3TNOA 4JL2A 3SCOA 4IGSA 2H8ZA 1JRBA 1B3XA 1MXGA 2Z28A 1CIUA 2HEJA 3DZ1A 1OGSA 5AC8A 1YLVA 3BWWA 2C1IA 5ECVA 3KUMA 3M07A 1X6NA 4HNVA 2ZRZA 4PH6A 3IRSA 3FW6A 4ZO9A 4J2PA 4PB5A 1P0KA 2OQLA 5EBKA 1BYDA 5I7GA 1JULA 6TIMA 2QT3A 4N9BA 4A3QA 1VC4A 4OUEA 1HO4A 3PZVA 3T42A 4EACA 4LNYA 4JTQA 1S2CA 3PZUA 2BCPA 2PTYA 3QM3A 2R8WA 2X0HA 3CUJA 3EMCA 1I6NA 2FGLA 4W89A 3BGGA 2ZICA 2OO6A 2XGZA 4XD3A 1E6NA 1VD6A 4QEEA 5CJMA 1GZJA 1EZ2A 1GREA 3ARSA 4I7UA 4F0SA 2I9EA 2DW6A 1IYXA 1GRAA 1C90A 2JF7A 1KCZA 4G9PA 5TIMA 5GJMA 4H9MA 3MZ2A 1R3TA 4QNWA 4Z0JA 2NT0A 1GORA 5LZLA 3NPVA 1ENUA 3WX7A 4IMFA 3ECQA 5FACA 4AX6A 4NILA 1ICQA 4K7VA 3C0JA 5HNNA 1AQMA 1GRGA 4YN5A 3CQJA 3G5EA 1WAUA 1SO5A 1KFEA 1ADOA 4D1JA 4WRHA 1QATA 1ESWA 3MDUA 4UQ9A 4XX6A 3E3HA 1Q2RA 3NQEA 3WNNA 1QNRA 3EPNA 3CZGA 2QMKA 3POHA 1J2WA 3R89A 1YXDA 2YL5A 3V4BA 4A8IA 3PTDA 3T0DA 3MYOA 3AFBA 1F3XA 1IEIA 5H8MA 1EEXA 5FEXA 3K5XA 3AMCA 3C86A 4XBSA 3GXIA 3LHUA 2VX4A 3NYDA 4BQ5A 4GYKA 4JNZA 3KTXA 4M6PA 4EAYA 4UTMA 1DIEA 2PDNA 1G1YA 3FAXA 4NJGA 1RJQA 1UJQA 3P0XA 3TQKA 1DJWA 1TV7A 3QV7A 5BOEA 4W84A 1KR1A 1LRTA 4HBKA 2PC4A 1JQXA 4ZXLA 4DELA 3EWDA 3H4GA 5BZAA 5HK4A 3FJLA 5HOSA 2Q8LA 3GLCA 5D33A 3V0TA 5DEZA 1DXFA 2F6KA 1MFUA 4GY1A 5U25A 3ZVHA 1UR0A 2OCZA 4E8GA 1E6ZA 5IHRA 3BCJA 1ICSA 3QSTA 3G1YA 4LF1A 2NUYA 1XS2A 2FVLA 3WQWA 4PL1A 3EPOA 3VUPA 4MGGA 1E4NA 4KGLA 3BXWA 2VCCA 3NAVA 4LS0A 2WBGA 3DG6A 2ATMA 1TZ9A 1DHKA 5G5HB 1W56A 1IEVA 2QNEA 4NQ1A 1JZ2A 3QW4B 2CZDA 1JYWA 1J6OA 1MRAA 1FP9A 2ZTJA 3LCIA 4HMNA 1GQIA 3GXFA 4ZXOA 3G77A 2V2HA 3BGAA 3UZZA 3DC0A 4UFMA 2WVUA 5E0KA 4DWSC 3ZT7A 3EDFA 1AVAA 1GYMA 5FS9A 2FMOA 1UD8A 3R12A 2D2JA 2XZ7A 4G1KA 2C0HA 3PN8A 4FNQA 3AU2A 1GWJA 4CD8A 1JCLA 2HS8A 4N4QA 2PLJA 1OG6A 5A5WA 3CBWA 4YS1A 1ODUA 2X8CA 1AK5A 3TQ0A 4GIRA 4FF7A 2G3MA 3W7OA 5IHSA 4W8BA 3E0FA 4X2PA 3SN4A 3VIOA 1KWGA 4GZEA 2X30A 1XG4A 4PMUA 2Z2UA 1POKA 3K8LA 2RABA 3O63A 3NQGA 2C16A 3VOGA 1U5VA 5F4WA 2W0UA 1PVNA 4IHCA 5CZ0A 5F4SA 3V0UA 3KM8A 9RUBA 3C2RA 2QPUA 3UZYA 4PMYA 3L0NA 3OP2A 2YFOA 1OC5A 2PA6A 3TR9A 4LFYA 3HU7A 2PLCA 3H2OA 3W29A 1JDDA 1UA3A 4DEFA 1XBZA 3H2MA 2OZ3A 5I3KA 5JCMA 2QCLA 3GTXA 5EMMA 3UWYA 2FKPA 5GNYA 1XBXA 2XN2A 1B4KA 4GUFA 2JIEA 3ONCA 5C2CA 3FYPA 3SUUA 1I9CB 5D2TA 5K9DA 4AF0A 3OVQA 1TRDA 3VD7A 2JKAA 1NHPA 4RZBA 1H11A 3S5OA 3GAYA 4DJDC 3MVIA 3W37A 2HROA 1UWUA 4NAEB 1EF3A 5HPOA 1XLCA 3V1PA 3RCYA 1R7AA 3UBPC 3K4WA 4S2BA 2A7NA 1T40A 1R47A 2BC0A 4GZIA 1QRQA 1VDVA 1IQ8A 4D6FA 4I3GA 4DJFD 1FWFC 3NSXA 2CLOA 4LCRA 5BNKA 2DDXA 4N9DA 1NP2A 3QR0A 1A5UA 3S5SA 3EX1A 1YHTA 5CJNA 4DF0A 4RNIA 3VIHA 4AVOA 1OX4A 4MDOA 1DIOA 3LBCA 3Q58A 3HRDC 1J5SA 1W9VA 4JN8A 3CU2A 3GRIA 4L7ZA 1U33A 4FA3A 2PP3A 2HTMA 3S1XA 4DB7A 3TW6A 4JY9A 3FGCA 5DMYA 2VX5A 4E2DA 1CT5A 4JXCA 1ZBCA 3ZR5A 2P5NA 1PO9A 2FYMA 2Y8VA 3QY7A 3GUGA 3CZLA 4PB3A 3TLQA 4GX9A 1OJTA 1CENA 3PG8A 3O0KA 3LB8A 1Q2SA 2VGBA 4BA0A 1W3TA 1BXCA 4HK7A 5C7HA 3VZYA 1KM1A 4L4LA 3UYIA 3KOYA 2PWFA 3R5EA 3BVJA 1F8WA 4A3HA 4E4PA 1OC6A 4US5A 5CAKA 2F6XA 5D30A 1GRBA 3NVVB 1GVQA 1CNVA 3T6CA 3OEXA 3KOZA 3N13A 3T40A 2ZIDA 5FAJA 3DFHA 3GTFA 4W7VA 3EX4A 1RP9A 2Z2BA 2YR1A 2YQUA 3A9BA 3ZIZA 4R27A 3UCQA 4HNOA 4DHGA 3GNRA 2VDHA 4HNCA 4J3VA 3NM3A 3P62A 3MUCA 4GIEA 4M80A 3W0KA 4KEMA 2VM8A 3DH9A 3AIBA 4JTGA 1KV8A 3GZAA 1PYMA 3L2LA 3B0XA 3EDKA 4LPCA 1Y5WA 1K7EA 4ILSA 2QGHA 4I7VA 1GW9A 1B3OA 4IGNA 3WO8A 3ITTA 2B7QA 2HBXA 3H7UA 4TTUA 3UZ5A 2NLIA 3BGJA 3S6DA 1NY1A 5JBFA 3WNKA 2BY2A 5D32A 1ELSA 3IJ9A 4H9VA 4V15A 4ZTXA 3G0XA 3THDA 1NQKA 3R07C 1K1DA 4K3ZA 4W8AA 5EMYA 3AIUA 2A3AA 2WKJA 2H8XA 1V51A 4UFJA 1LBFA 3ABRA 3O05A 1K7XA 2YA0A 1YKWA 1AL7A 2FMNA 1FWTA 4AEFA 2WCGA 2J8FA 4D6JA 2X7VA 1BVNP 2XSAA 2Y7DA 2GYIA 3FKKA 3REQA 5C9UA 4GY7A 1A80A 3ATYA 5C6MA 3KOFA 4LAMA 1Y0EA 3W70A 2PWEA 1V6XA 2J8GA 4K37A 3AS2A 2RUSA 4DZIA 3F1QA 2J88A 2CLFA 4RDYA 2DJLA 2GSHA 4YVPA 3MP5A 1WYGA 1M6JA 3A3XA 5FF2A 2WC3A 4HYWA 3E74A 1EKOA 2EJAA 4S23A 4BV6A 2YDSA 3E38A 1DXLA 4WY0F 3S9ZA 2WOVA 1DQWA 1W9XA 3FVMA 5KSWA 2FJUB 4YU1A 2ODOA 3TIMA 1O95A 5HBFA 4PTXA 3I4EA 4U2ZA 1IR2A 1XCXA 4W87A 2OU4A 1OIMA 3TK7A 1F4AA 2I7GA 1ALDA 2RAGA 3IV8A 3FJ4A 1JXKA 3GIPA 1A4MA 3SRFA 4HU0A 1KM3A 1F6PA 1CXHA 5AHNA 1F73A 2REQB 3WLOA 1C8VA 4XO7A 2DZXA 2QUMA 3UZJA 1F8IA 2ZTKA 1E0XA 2YBUA 2JEQA 3AM9A 5AC7A 2GLKA 1ITQA 4WIWA 3NCOA 2BXVA 3W73A 1D3GA 3H54A 1KGWA 2E68A 3RM4A 4ZOEA 3EB3A 1C7TA 2C14A 3VE7A 1OSEA 1K4HA 3M7SA 1TPB1 3S9YA 1E0VA 1QJWA 1VRXA 1VYPX 5A6LA 3GHSA 3TN6A 4WUIA 1XM3A 3GFYA 1FIQB 3BAKA 3NSMA 3N17A 2ZZCA 5CZTA 1OX5A 3P81A 2DZVA 3H8AA 1H6VA 3A9IA 1UKOA 3F4WA 1J01A 4G5DA 5E70A 1OCBA 4FHAA 3TE9A 1CGTA 3W75A 5A6KA 1FX6A 4A3RA 3R25A 3KVKA 1ISXA 8CGTA 3BJSA 1FY6A 1FRBA 5G4EA 1LLOA 3L4XA 4JTEA 4RE0A 5E0FA 4AH7A 1HJSA 1FH9A 1V3KA 2WWDA 2GUBA 3EKGA 1PWMA 1Q6DA 3AMDA 5DRIA 3LNMA 3PTKA 4E4FA 3SCSA 3R13A 4IL2A 3W27A 3PK7A 3QTPA 4KCUA 5TQLA 1KNWA 1E0TA 5HWNA 4LUSB 2WJZA 3FIGA 3I4KA 1XIHA 2VC5A 5H8UA 1JEZA 3GG7A 3UNTA 3CGDA 3MDWA 3VI2A 4WCJA 3LCXA 4XAFA 3SCUA 4UTTA 4GD0A 4AXNA 3ZWTA 1ZTVA 4HK5A 3UPWA 1JR1A 3ITCA 2PDIA 3ZVIA 1P6CA 4AD5A 3WDQA 4H7CA 2GGJA 2C0AA 2D2GA 1A53A 1M1BA 3TYUA 1QUMA 1CXFA 1QMLA 2QDHA 5A6SA 1T6MA 3NL6A 4UMAA 5I02A 4FLSA 4OIFA 2D0FA 4L6DA 1YW1A 3LZ3A 4QS5A 4RDWA 3SW6A 5FKYA 3P60A 4AW7A 1M5WA 3AUOA 1JRPA 4MWAB 3VNDA 1NARA 1JCXA 4JZ5A 4GI4A 2PD9A 1BSLA 3SRKA 4DN1A 5ABFA 5FSEC 3TU9A 2V5CA 1YQ2A 2BOGX 1VPYA 3MSGA 3MI6A 3D3AA 3GUWA 3PUEA 1NOWA 1GG0A 3LQLA 3IVSA 1Q6FA 3BG3A 4JIRA 2IKGA 4OGZA 3ARXA 2EO7A 3E49A 2A6NA 1ZJHA 4DAFA 2WLYA 3BOXA 4ICCX 4EQWA 2VFIA 4HTBA 2W92A 1PDZA 2CLPA 4CKQA 3KEHA 4R9OA 2GWNA 4UTHA 5F2LA 5I09A 1XYCA 2FB2A 1KFCA 2QCHA 3LXDA 4IP4A 3BURA 1XISA 4N6EA 1MXSA 4KIEA 4WZHA 2XH0A 3ARYA 3AHXA 5GQBA 1EJTC 4KWUA 4MIMA 4KRZA 2XVNA 2QJMA 1E0UA 1ECEA 3M6DA 5JVLA 3GDMA 3B8SA 3UGRA 4L5ZA 1YXYA 1K9TA 4Z0SA 2QPSA 1BVZA 3LBOA 2YLLA 1A49A 1BWCA 3AQUA 4EE9A 2X42A 4H19A 3ABZA 4H01A 1GV4A 1UQZA 3WK1A 1GJUA 3KP1A 1K9EA 4LVDA 1PTAA 1U2YA 1L0PA 4ZQNA 5DLCA 3VX0A 1FHDA 3BC9A 2DW7A 2PODA 3N3TA 3F2DA 2DPEA 2CYGA 4ORMA 4CQAA 1TIWA 1XDLA 2QCCA 3NQAA 5FL0A 5IXEA 3RXZA 4C6BA 1UR4A 1HUVA 2EKCA 3ZQ9A 1DIKA 3UR7A 4A3UA 4OBSA 3W2MA 4HOXA 4DUVA 1GNXA 1TMQA 1QNVA 4PBEA 1UUMA 2EQDA 3E2RA 3C2OA 3OZOA 1H50A 4N0RA 2XHYA 4KS0A 1OFPA 3AN1A 3GNPA 3DYMA 4MB1A 3CV7A 4JPGA 3RK8A 2AQWA 4FXFA 1Q4NX 3A4JA 3BTNA 3LXAA 3T1GA 1FHUA 3BCFA 3UZXA 4IMAA 3GR7A 1XH0A 1ME8A 1MNZA 4JCLA 3TQVA 1QTWA 4LCSA 4BI5A 2Y5EA 3B97A 1QOXA 1VQTA 4HGXA 1XD0A 2ZX9A 4AHQA 3G24A 4PUJA 3AIRA 4J7RA 3KFTA 2IQTA 1SO6A 3VCCA 5AY7A 2JQXA 2R82A 4JQ1A 1EC7A 3A64A 3W7LA 3DGHA 3PBGA 3RFAA 4PRWA 1WDRA 1JFXA 2INZA 5T9BG 2V68A 4EPKA 4C6OA 3OVPA 2A3BA 4H4ZA 1HP4A 3MMWA 4S1FA 1OGBA 3DKJA 4YVVA 1IXOA 1VF8A 3LS9A 3LMZA 4Q8QA 4IPJA 1PTDA 1XLEA 1XWYA 1ZCOA 1Q6RA 1CGWA 2DQXA 3NL2A 2WZEA 4QAIA 1AQFA 3S1WA 2WCSA 1KLZA 1H63A 3N6HA 1WUFA 2D0HA 3L2MA 4B91A 3SUVA 3ZMRA 1R87A 3F03K 3K4AA 1LG2A 2ZUUA 1WE5A 1SJCA 1J0KA 1JQVA 1CGYA 2XSXA 2XN0A 1WB0A 1V97A 3WQVA 4GXWA 1PXGA 4Z1YA 3ICJA 4S38A 1ITCA 1TPDA 4WEVX 4GI9A 3T7VA 1YYAA 3LPFA 1QFEA 2XIJA 3SR7A 1NHRA 3OTRA 1PX8A 2ZDRA 1YADA 2J7FA 1E9LA 3W1MA 1L8PA 3NL3A 3R11A 4QM1A 2G4JA 3SGGA 3Q2DA 3LCHA 3H2CA 2BVYA 2W3ZA 4GQGA 1FFVC 3ZLGA 5E93A 1VHNA 1TG7A 2VI0A 1VFHA 3RM9A 4WSHA 5LGXA 3CGTA 1J0JA 4WXYA 4IX0A 1OABA 2I9UA 1BGGA 4LCQA 2PTZA 2Q09A 3M46A 1L6GA 1HTIA 4JKMA 2JK6A 4W5UA 1ZBVA 1RR2A 4OT7A 3OZPA 2DT1A 1KFJA 5C9ZA 1DWGM 4O8RA 3CAQA 4QDMA 4OBRA 5DXYA 2WVSA 2WZIA 1Q1RA 3U9IA 2EG7A 2ACUA 1B0IA 2J78A 5D04C 3NZQA 4KMQA 2BG5A 1QHZA 5CSSA 1RA0A 2OWWA 5HUOA 4LVAA 5I3GA 5HNRA 3NURA 1RBOB 3G18A 1W5PA 4B5SA 2OZ0A 3CUZA 2OYKA 4FF5A 7CGTA 1QI2A 4R34A 4NHVA 4A35A 1O5XA 3BW3A 4LYKA 5K4XA 2EAWA 3CK5A 2NVAA 1GUVA 4H1ZA 1BLIA 3KVJA 4LAKA 1KGXA 1VCFA 2HPIA 1UC4A 4X0NA 1WKYA 4WDWA 1RCQA 2EQ9A 4U2YA 4CQCA 4EXBA 2OJPA 3P6LA 1AD4A 1QPNA 5HATA 1QI4A 1ME7A 3T2OA 5JCLA 3M44A 3MJMA 3SCQA 2CWXA 3S5ZA 4RJEA 1XC6A 4K2SA 1SZFA 4I90A 2WV8A 1E5JA 4F48A 1QI3A 3GYCA 2GZXA 3W71A 1A5NC 4BKNA 1ZKQA 3CTLA 1H2JA 3LMYA 2WPGA 2CLIA 4B5TA 1KCLA 1LQ0A 2PGFA 1K3UA 1RLDA 1E1EA 4UZSA 4JYFA 2WYSA 1IIGA 1FECA 5GJPA 3P5ZA 2WJDA 5IFPA 1W8GA 3FJNA 4NASA 4YCPA 5LNUA 2A6LA 1ISVA 3FXGA 3S1VA 2G0WA 4Q33A 4MB3A 2Z4GA 3W84A 5C5YA 4HPGA 1ZLPA 1OQFA 4H8NA 2WWCA 4NAEA 4KRUA 1N7KA 4LB4A 2OX1A 1V79A 1WKDA 3L21A 1K8XA 3VKJA 1X38A 4ZO7A 5D9MA 3MU7A 3USZA 4HSHA 1PCKA 1LPFA 5M17A 3H55A 3W00A 3OIXA 3IS4A 3ZJ6A 5E9XA 1HKMA 1ZBKA 2P76A 1NDWA 4O54A 5EBUA 4L9YA 3LG3A 2HNHA 3SRHA 7ENLA 2TSYA 2V5BA 3OQEA 1VGAA 3W83A 1H7NA 3DG7A 1BYAA 1DWFM 4PEKA 2X0YA 2GH5A 3D6NA 3C3UA 3EB2A 4JR5A 4ROPA 5C9RA 5M03A 5GVJA 1EBGA 1CPUA 2CPUA 2UWFA 4DNAA 1RM6B 5E6YA 2POTA 3MJYA 4UQDA 3NRZB 3MT1A 3UVAA 2QPXA 3DGBA 3K30A 5CZKA 4BS0A 3VGBA 3UU0A 5DY2A 1A47A 3PTMA 3A7UA 3QXBA 4CUCA 2I5IA 3ANUA 4GNVA 3W02A 4AD0A 1TPVA 3PAOA 3SAZA 3VUSA 4HPHA 2WKLA 5H1WA 1JXJA 3LPOA 3TH6A 4QCFA 4RKAA 3H4WA 1T8QA 2WMIB 2ZZ6A 2PCQA 3U2EA 1QWGA 1UMYA 3AYVA 4FOKA 3W7NA 2ZUSA 2H9AB 3NQMA 2GPTA 1XPYA 3L5LA 2ZC1A 4TXEA 1TVLA 4Y9OA 1E55A 5TAOA 3W9ZA 1KBIA 4ADWA 2PFHA 4J40A 3IARA 2W3RA 3M0MA 4YTUA 1FWEC 4OE7A 4B4HA 4UTWA 3V0SA 3P74A 1R7OA 3ENLA 4H4SA 3ISIX 4UTKA 4D6GA 2ON3A 1TWIA 3NO3A 2F7FA 1E1CB 2ZUMA 5DY3A 4E3TA 1T96A 2AOSA 1UH4A 5G4WA 8A3HA 3MMUA 4AQLA 4ZQCA 2HISA 2QCDB 4ZBCA 2GQ8A 2OGJA 2IQDA 2NX1A 4ZOBA 1W5NA 3CUFA 3GG8A 1U22A 1Y7VA 1V02A 3CAWA 4GNKB 1GTEA 4S3FA 1BAGA 3MPGA 3SQSA 5A6TC 1WUEA 2CLMA 2DVXA 5CPMA 1XSJA 4IQJA 3Q6JA 5HMEA 4PA8A 2GJLA 4IMDA 4S3KA 2R1PA 3S6TA 2FPVA 3M47A 3FVDA 4F0MA 1HF6A 2YL9A 3EWUA 4XZMX 1W1YA 3TTOA 1GPWA 1GSNA 2CZEA 4XUYA 1ZJBA 1FHVA 3HM7A 3R8HA 3MSRA 4ENLA 4ACZB 5HQMA 2CC0A 3JW7A 3ME3A 3T78A 3WQPA 1GJWA 2ZXQA 2CIPA 3WD4A 4E2VA 2WC4A 2HVMA 1WYIA 3C3NA 2GUYA 3AIQA 3H70A 4O0KA 3W07A 1LRQA 3SCNA 2FZMA 1NHQA 2XVPA 2VX7A 3EOUA 4PMXA 1XDJA 3NPWA 2G3NA 4AWUA 3KBSA 4QE4A 5FF0A 5CBJA 3CEUA 4BURA 3SEPA 5BMWA 1K6AA 1PZ3A 3SCTA 3L5OA 1Q4WA 3WZ0E 3NVDA 3EAOA 1LL6A 4WVXA 4D9PA 1AH0A 1MEWA 5KTLA 5GNZA 1K9FA 2C15A 2I56A 1EP1A 4JQ4A 3S6OA 3VILA 3L23A 1EWDA 2O9PA 4XISA 4FNUA 2P3ZA 3UWVA 4MZYA 3GB6A 3TCSA 1W2VA 3SUSA 3APYA 2VL4A 4MNKA 3UQNA 4UZUA 3IIZA 1EJWC 5BXTA 2EQ6A 2NXHA 5I06A 4KCWA 1N5WC 1K4GA 2HK0A 5LSMA 4Z2IA 1BG9A 4LUJA 1TTJA 4J9JA 3MI3A 5BRPA 5I78A 4ATDA 1O6IA 3RCNA 1N8WA 3E0WA 4PMQA 1FHLA 1N82A 1H7RA 4E2BA 1TUXA 3UJFA 1AW2A 4NT0A 3CH9A 3LYEA 1F6YA 3WL0A 1TR9A 2Q8XA 3CASA 3EDDA 1GVEA 2XU2A 4KGJA 2YXXA 4HCHA 1XLBA 2ZZ3A 4FR6A 3BH4A 3HN3A 2G8ZA 2OLSA 3VC5A 5GRTA 4J1OA 2GR3A 3AWNA 4UFKA 1CDGA 1I1WA 4XZ9A 4DO7A 1SQ7A 1L6FA 2YVFA 5HNTA 4AG0A 4LQ1A 3N25A 4DWSB 3G3DA 2HQMA 1BHGA 1DPMA 1B4EA 5HAOA 1VLWA 3F5LA 3O0FA 4O14A 3CUXA 3BAXA 4NUWA 4FALA 4JNMA 1Q6GA 2G50A 4LF2A 3BZGA 4TV5A 1LOQA 5DO8A 2V5KA 3EWYA 3SFKA 3K8MA 3CIVA 4CQ9A 2Z1SA 1S38A 1EX1A 3WLQA 1GRHA 3CMFA 3KTSA 3HPAA 2OPJA 3R7MA 3VMPA 2J24A 2BODX 1FCQA 1ECQA 1HFBA 2E6AA 4PUNA 4WSKA 5D8WA 5A6AA 4EF8A 3DG3A 1EXPA 3UNDA 4M19A 4WK9A 4LUSA 2Z25A 3GD6A 3LXCA 4AEOA 1VCGA 1SFLA 1WDDA 1CGVA 2O7SA 1R9ZA 3DBPA 4R53A 2GGEA 3B8TA 2Y7EA 4B5VA 2GR0A 3VKKA 3QV6A 3S0CA 2ZRXA 3D3FA 3ELFA 4WF7A 5C55A 2Q01A 2BGSA 3GRSA 4IJBA 4PMDA 2E1DA 3PZOA 4B3KA 3ARPA 3RR4A 4OHQA 4JFSA 1JROA 4WOZA 1NFBA 4DBSA 1PHQA 4N2YA 3DFPA 4KWSA 3NIYA 1A5AA 4N02A 2Y1HA 4PCPA 4MAVA 1F3TA 5AOUA 1HJQA 3EGJA 1PJ9A 4MWAA 3B06A 3R1ZA 3QBUA 4KRTA 1BYBA 2XN1A 3SSJA 2XUCA 4DF1A 4XZHA 5FJRA 1EA9C 3KL5A 5J8LA 3CIWA 3PNZA 4G8TA 4NG3A 2DZBA 1NWSA 2VELA 4NNCA 4J2MA 3W7IA 1JF6A 3GXMA 2E8YA 1UBPC 5LIKX 5JBDA 2C18A 2GL5A 2XWEA 1EZWA 1FXQA 3JRKA 4S3EA 1OIFA 2VYOA 2YW4A 1OF8A 3M9YA 1LL7A 4B4FA 2X99A 2FPTA 1EDTA 1H49A 4RV3A 2WP5A 3U4FA 4H4RA 2G97A 4I6KA 4R3UA 3AO0A 4U28A 3Q45A 2JE8A 1FWSA 3HB9A 1DJHA 1RD6A 3RU6A 3W7JA 4US5D 1EX5A 4AHPA 5HUPA 3OODA 3QMSA 3VFCA 2JF6A 4IPPA 5D9NA 2C7FA 2J9XA 1A5SA 2VQUA 1VIZA 4EPEC 3VMOA 4L80A 3NZGA 4IH3A 5CC6A 4KERA 3RX2A 1EUNA 3S42A 1UQYA 3GNXA 4HU3A 1H0GA 1IZCA 1CBGA 4WDXA 3VTRA 1G7VA 3NVZB 1CWYA 2VR2A 2QCGA 1QPOA 2CETA 4K39A 5A1AA 3UY7A 2WVTA 3TDFA 3WIJA 4UIOA 4CD4A 3B8VA 3E0VA 3KWSA 3TX9A 1E4MM 3PZNA 3DFTA 3S2MA 2NV1A 1Q8AA 4CNSA 3AIEA 5CC3A 4MPQA 3LSCA 5H2ZA 4Y2WA 4BQ2A 2VVNA 2TRSA 1GESA 4UCGA 1OB0A 4PUKA 4BEQA 1KLYA 1TX0A 4RE2A 1V08A 2BNJA 5MKGB 1MDLA 1R9YA 4MZ8A 1DIDA 3VK5A 2ISFA 4UOQA 1ZQ5A 3GHRA 4O1BA 3TAOA 4PBGA 4JX5A 1X2HA 3DFQA 1GG1A 1GKPA 2Y62A 4AAJA 4MG4A 7ODCA 5AHLA 4J56A