1DTNA

Mandelate racemase mutant d270n co-crystallized with (s)-atrolactate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
357
structure length
357
Chain Sequence
b'EVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALKSLKQLLDDMAAMIVNEPLAPVSLEAMLAKRFCLAGYTGLIRMAAAGIDMAAWDALGKVHETPLVKLLGANARPVQAYDSHSLDGVKLATERAVTAAELGFRAVKTKIGYPALDQDLAVVRSIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMFKALSIGACRLAMPDAMKIGGVTGWIRASALAQQFGIPMSSHLFQEISAHLLAATPTAHWLQRLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWREKEIGKYLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANDELATE RACEMASE
publication title Mechanism of the reaction catalyzed by mandelate racemase: importance of electrophilic catalysis by glutamic acid 317.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Racemase
total genus 132
structure length 357
sequence length 357
ec nomenclature ec 5.1.2.2: Mandelate racemase.
pdb deposition date 1996-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1dtnA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1dtnA01
1F9CA 2QDDA 4EWJA 3SSZA 3QTPA 4Z17A 2PODA 3ZLGA 2ZC8A 4KPLA 3V4BA 4IL2A 5ENLA 4DXKA 1RVKA 5FJRA 2PGEA 3D46A 3DG7A 4MKSA 4E5TA 2P8CA 3UXKA 2PP1A 2OG9A 3P3BA 3GD6A 2OPJA 3TJIA 2AKZA 1JDFA 3TQPA 3ES8A 3R10A 3V5FA 3UJRA 2PP3A 3ZLFA 3CB3A 1EBGA 1L8PA 3DESA 3TCSA 5IDZA 1WUFA 3TOYA 1P48A 4HCLA 1SJBA 1DTNA 3JZUA 2P8BA 1NU5A 3FJ4A 2XSXA 3ZVHB 2OZ8A 3OZYA 4IHCA 4GIRA 4E8GA 2DW7A 4H2HA 2O56A 1IYXA 4M6UA 3RO6A 2GL5A 3TTEA 3K1GA 3SQSA 3I6TA 3EEZA 3TWAA 1E9IA 4H19A 4IP4A 4DWDA 2HXTA 2XGZA 2OLAA 3IJLA 3RGTA 2ONEA 4G8TA 1R0MA 2QGYA 4A35A 4GYPC 3SN1A 1KKOA 4K2SA 2OVLA 1BQGA 3BJSA 2AL1A 3MWCA 1MNSA 2PSNA 2QQ6A 4YWSA 2MNRA 3S5SA 3KUMA 4F4RA 2XH0A 2GGGA 2PU1A 4HPNA 3BSMA 4GISA 1TKKA 3VFCA 4IP5A 3CAWA 3JVAA 3MZNA 1MDRA 5J04A 1EBHA 2QJMA 1BKHA 3RCYA 3VCNA 3THUA 1W6TA 3UJFA 2I5QA 3H70A 1PDZA 2MUCA 3D47A 4K1WA 3ZLHA 3UJEA 1WUEA 3ES7A 1R6WA 3MY9A 3DERA 3ENLA 3B97A 4GGHA 1JPDX 4IZGA 3OTRA 4IT1A 2HZGA 2GGEA 2OO6A 5FJUA 3R0KA 4GFIA 3RITA 3FVDA 3OW1A 1EC7A 4HNLA 2GDQA 3P93A 3TW9A 3TWBA 3FYYA 2P0IA 3NFUA 2QJNA 3S47A 2P3ZA 2DW6A 1JCTA 1SJDA 4ZCWA 3DG3A 4H1ZA 2PGWA 3UGVA 3N6HA 1P43A 3DFYA 4DX3A 4KT2A 3SBFA 3MQTA 1ECQA 1MUCA 3T8QA 3CYJA 3Q45A 4E4UA 4FP1A 5BOFA 3QLDA 1KKRA 5FJPA 1MRAA 3DG6A 4HYRA 3FXGA 3V3WA 2QJJA 2QDEA 3RRAA 1MDLA 4JN8A 3N4FA 1PDYA 3R25A 3CXOA 1SJCA 7ENLA 2PTXA 1YEYA 3H12A 2HNEA 3GO2A 3N4EA 3UJSA 2GGIA 2GSHA 1EC9A 2ZADA 2PU0A 4HCHA 3CK5A 3UCCA 3NZGA 4GMEA 4G7FA 4A3RA 4Z1YA 3UCDA 3PWGA 3DFHA 2PPGA 2OQYA 3FCPA 3OP2A 3VDGA 3IK4A 1NELA 3VA8A 4GYPA 1TZZA 3FV9A 3OPSA 3IJIA 3DEQA 3P0WA 3I6EA 2AL2A 1FHUA 4ROPA 4JHMA 3MUCA 4MMWA 3QPEA 3ZVIA 4K8GA 4DHGA 1ELSA 3U4FA 4MGGA 3JW7A 1TE6A 3SN4A 3MKCA 2PA6A 3SJNA 2PMQA 3V5CA 2XH2A 3UXLA 3CT2A 6ENLA 2OFJA 2GGHA 5FJOA 3I4KA 4M0XA 1KD0A 3PWIA 4HCDA 3MSYA 3VC6A 4FI4A 2PCEA 4A6GA 4GGBA 3SN0A 3NO1A 4JN7A 4X2PA 3R11A 4HN8A 3BOXA 3DGBA 3RR1A 2RDXA 2NQLA 2OX4A 3TJ4A 2PTYA 3H8AA 4E4FA 2PTWA 4DYEA 5FJTA 3VC5A 4H83A 3Q4DA 3GC2A 1JPMA 3IJQA 2P88A 3N6JA 5BOEA 2AL2B 2PP0A 2PTZA 4KWSA 3STPA 3PK7A 3T4WA 1SJAA 2XH4A 1XPYA 1FHVA 3T6CA 3UJ2A 4ENLA 3R0UA 3GY1A 2POZA 3VCCA 3H7VA 4DN1A 3PFRA 4HNCA 2HXUA 1KCZA 1ONEA 1EC8A 3DDMA 2GGJA 3R1ZA 3EKGA 3U9IA 1XS2A 1OEPA 2OZ3A 3NXLA 3T9PA 2XH7A 3QN3A 2FKPA 3DIPA 4IL0A 2QVHA 2AKMA 3OZMA 2OKTA 2CHRA 4J1OA 4E6MA 2FYMA 3HPFA 4J3ZA 4KEMA 2OQHA 3ZVHA 5EU9A 3QKEA 2PS2A 4ZA0A 2OZTA
chains in the Genus database with same CATH superfamily
1YPXA 3MW7A 1VYRA 4UTHA 3VOCA 1NSJA 4GCAA 2YFOA 1DWIM 3FY1A 3CLWA 4FX7A 4PB5A 4MLJA 5DXXA 1S2CA 4IQDA 2A6NA 1Q7QA 1F3WA 1GOXA 4CQ8A 3EB4A 5FJRA 3IVSA 2BHUA 2VRKA 3KAOA 1EUNA 4KH2A 1UR9A 4H9XA 1EGZA 1W5PA 5CJMA 4AG0A 4RKAA 1GYLA 1S5WA 1W3LA 3DHPA 3FGCA 2E1DA 4CUCA 2YDSA 3QC3A 4J40A 2D2HA 5D8ZA 2WZMA 5G5HB 1KM5A 2YW4A 3FJNA 2ZFAA 2XSXA 5G5GB 4HNOA 4TV5A 4LCQA 1XC4A 1XYLA 3EMCA 2YL9A 1W37A 4KRUA 4K8EA 3R94A 3LNPA 3REQB 4H6RA 1NQ6A 1CEOA 1XP3A 5ABFB 3TX9A 2V63A 4JTDA 1ONRA 1EQCA 1NPXA 1ME8A 3IGXA 1KW1A 2NQZA 3DYOA 1CI1A 3QVQA 2FPTA 2HXTA 3OHIA 1VJIA 5CZKA 1EO5A 1W1PA 7XIMA 3AMLA 2FGZA 2GOKA 3ITTA 2QGYA 4RDZA 3C2OA 2QPUA 2B31A 3H2EA 4K2SA 2I9UA 3WK0A 2VEPA 3MZ2A 4NF7A 4XD5A 1NWTA 2OT0A 4MYAA 3ZSSA 3RLGA 2YR1A 5D9OA 1KXQA 2VGFA 5BRBA 1C8QA 4X9SA 1TPC1 1OCNA 2FVMA 3URQA 1XBZA 1XJBA 3CGCA 4XO7A 3ONBA 3WQCA 3EWWA 3LM7A 4N7QA 2YPIA 1E0WA 2YA0A 2JFEX 3GH4A 4DJDC 2J9YA 3N2XA 3TSMA 1ZB5A 2WMHA 4F40A 1G9HA 4PTMA 3CWOX 4PSPA 4WOZA 3F2BA 1NFBA 4Y9NA 2BWGA 1NWRA 2VENA 4LUIA 3QPZA 2QJIA 3FLUA 3BWWA 5T9CE 4ZQMA 4JEJA 4QG9A 1X97A 4LTSA 3OEXA 2HTMA 2HZGA 1PKMA 2ZUTA 1AODA 2V67A 3GG0A 4GY7A 1QK0A 3TH6A 4IF2A 4IG2B 4NZCA 3PG6A 1XLFA 3L4VA 3WKZA 4BQ4A 2GJLA 2DW6A 1JCTA 4IQEA 3MHUA 3PR2A 3W1UA 2Z1VA 2O0TA 3LLFA 1IEIA 3EB3A 4K8DA 4CN1A 1N5XA 1WB0A 4L56A 4AD1A 3LTYA 2WJEA 1TUFA 4E2BA 4QFUA 3PTKA 5HAOA 2CU0A 3GFXA 3AALA 5KTLA 3H7UA 3DK9A 1TV7A 2PBOA 2OYLA 4JTRA 2QPXA 4XK2A 4WEVX 3EMZA 5JUVA 1TRDA 1AW5A 1P0KA 3SDOA 3V3WA 4I5XA 3RRXA 1GG0A 1LRTA 2BB0A 1TB3A 3KBJA 4ZOAA 3G24A 3UETA 3GNDA 1RK6A 2ANUA 2ZE3A 2VD9A 3BVJA 4UC5A 4LB3A 1VBGA 4DBSA 1NFPA 1UP3A 5JH2A 4AU0A 4KESA 4WKHA 4UTUA 1EXPA 2CZDA 2E3TA 1ONWA 1IEXA 2P53A 3EPNA 2Q8ZA 2D0FA 3L4ZA 1FY6A 1W56A 2PDHA 1A53A 4Q33A 4R33A 3WZ0E 3GYCA 1UOKA 3P0WA 2Z0IA 4HMDA 3W1NA 5A6BA 3NS1B 1T8QA 4L5ZA 5CEWA 1FWJC 2VC5A 3G1AA 4AIOA 3A47A 1U1HA 3N11A 1OX5A 2QF8A 3LADA 4AUBA 5FAJA 4EAMA 3NSXA 1K8CA 1GOKA 5EFDA 4UQBA 5C8BB 5HATA 4GOAA 3E1F1 4EQWA 1EYEA 2I16A 2A6LA 1ZFJA 4IX0A 4H4ZA 1XLDA 2IPGA 4HSOA 3M0XA 4HCDA 1FCQA 3ME3A 4POCA 1DYSA 1VYSX 4D6JA 5IFTA 2Z7KA 2C3DA 1HZYA 3BLFA 1GVRA 3TSDA 3HOJA 2E09A 3CZKA 5AOUA 5IRPA 4A05A 3TJ4A 3RFAA 2FTWA 4GIAA 4ACZA 2DIKA 2O9RA 1DJIA 3W7EA 1J5SA 4XD4A 2PDFA 3CL8A 4R85A 4AY1A 2PF0A 3BDKA 3STFA 3PK7A 2WNNA 5MF5A 4DZHA 4D8ZA 3NPVA 1TX0A 3CIVA 3VVGA 4E2VA 3VD7A 3G22A 4CD7A 4PUWA 2HXUA 2GGJA 1H49A 3QFWA 3R0DA 2PBGA 5EKYA 1PO9A 3UD6A 3D0CA 4V2XA 3GC4A 4IL0A 1BZLA 1XYZA 4MNMA 1MVYA 3GW3A 1JZ7A 3DYPA 2UBPC 2OKTA 4RJEA 2OQHA 2QCLA 3L5LA 2C8NA 5EU9A 1FXPA 2GYIA 1UD4A 4DBDA 4CQCA 3PBWA 4DAIA 1V0MA 2PODA 1V97A 1XF0A 1XDIA 3GKFA 4BF9A 4JXCA 2INZA 5DRCA 2P50A 1RVKA 1GZ1A 1VFTA 2VUYA 1UR1A 4Z1CA 1S5NA 1OSEA 3P3BA 3ANVA 2RGLA 3GKAA 2IPFA 3WL0A 3TYUA 1R85A 3C0QA 3WUBA 3K8KA 3CAQA 3P8JA 1UD2A 2XFFA 3LU2A 4BS0A 3RYSA 2HV5A 5GNZA 3CB3A 4K3ZA 1EJTC 3WNMA 4NQ1A 4FR6A 3N29A 1MW0A 2YXOA 2HVMA 3U2OA 4HCLA 4EP8C 4BA0A 2E77A 2HISA 1Q66A 3F5LA 4H2CA 1YDYA 1W9XA 2ASHA 1Q1RA 2ACUA 2DZPA 1R3VA 1TR1A 1OZMA 1S1PA 4XZNX 4O8RA 3SURA 3VE7A 5CSUA 3ZT5A 4UNKA 1FUYA 2VFGA 4K7ZA 1JDEA 3GVVA 4H01A 4A4AA 5FSEC 4F79A 5FI8A 1KXHA 4H19A 1V8EA 1EDQA 3NQMA 3WBAA 4QROA 4FDCB 3K2GA 1XIFA 1ML1A 4LV9A 1E6QM 3HBLA 2XG9A 3S2MA 5HQLA 4XO6A 1FH9A 1PZ2A 3KS6A 4EMJA 3OLIA 1QU4A 1KKOA 3K13A 1J0HA 1PYMA 3G0SA 4CEXC 1I45A 1QCWA 2WKLA 1NDZA 3T44A 4X0NA 1WDQA 4F4RA 2XH0A 4JTIA 5HR7A 3N04A 1UUQA 5FS9A 3I7QA 3PBYA 2WYSA 1G69A 3E02A 4N2YA 1NFGA 3KVMA 3WMSA 3G1HA 4X63A 4I7WA 3HGSA 3L2LA 5HR6A 4HHMA 2DSZA 1GORA 3THUA 1W6TA 4PCNA 3R6IA 4S3JA 4PZVA 4MADA 4QR6A 1K4GA 4GIYA 3L12A 1OC5A 3QOKA 1EXBA 3C2RA 3NZ1A 4UIOA 4GNVA 4YYCA 4LCSA 3VDAA 1JROA 1A0CA 4MAVA 4UWMA 3THQA 1A4LA 2G3IA 1WXZA 1H1YA 4KQNA 4OBSA 4S3CA 3FA5A 3TONA 4OTKA 3EB2A 3E96A 1UZ1A 4WDWA 1N8IA 1MUWA 3N6QA 3NQBA 1GW9A 3S47A 3HG2A 1GKPA 4RNIA 1D8CA 3IV3A 1E0XA 3CHEA 4BFAA 2WMGA 2BY0A 3W07A 4XAZA 2Y70A 3UWUA 3THCA 3WF2A 1JNEA 2P3EA 2E5DA 4H4TA 2ZA2A 3TMLA 4EXBA 1AQHA 1KKRA 3KW3A 1CDGA 1W1B1 2I7GA 1ZY9A 2PF8A 3GNOA 1SZGA 2EKGA 3KXQA 1W5MA 4QQUA 4AMAA 4L4LA 3H12A 5IBXC 1TPEA 4EKJA 3HIJA 3PS7A 4CCEA 3AUOA 1LUCB 2XN1A 2VQUA 4J3UA 1M7XA 1OCQA 2NWRA 3CO4A 3UZWA 4X3ZA 1OD0A 3VDCA 2OQYA 2WVVA 3T0DA 1O1ZA 3NG3A 4AWSA 1XBVA 2RAGA 3QGAC 1TZZA 1R7OA 5TF0A 2W0HA 2W0UA 4F2TA 1ZP3A 4R34A 3IJIA 4DUVA 3A4WA 4LY8A 4PEEA 1RJQA 3VNZA 3PFMA 2D24A 3H55A 2Z00A 1U1UA 1BYDA 3MT1A 4JFSA 1OINA 1ZAIA 1OFBA 4KFOA 4MZ1A 1GKQA 3LHVA 1FVPA 1EKOA 7CGTA 2IQDA 1NH6A 4BV6A 2J4GA 4DO7A 1HJQA 3UXLA 3T08A 3GNPA 1UQYA 4DF1A 4HP5A 4PCTA 4US6A 1GVEA 3AU2A 1QO2A 5GJPA 1DOSA 4O4WA 1JCJA 3T0CA 3NO1A 3TW6A 4PL2A 3EX3A 3U2ZA 4HPHA 3UPBA 1Q5MA 3O16A 3H8AA 4LRTA 1UH2A 3S9IA 2VO5A 3M0MA 2E3ZA 3ORWA 1BXBA 3BAIA 4UTWA 1L0PA 3B0PA 7REQB 3L4UA 3VKKA 1AG1O 1SJAA 1NP2A 3DI0A 3EDKA 3ISIX 4HU8A 2POZA 3M7WA 1N55A 4PB4A 4O10A 4HIBA 4Q4QA 1GEUA 3Q65A 3EKGA 3WD3A 5KINA 3CQJA 3V36A 3ABOA 4W8LA 3SQLA 4PMUA 3VOHA 1WNOA 1C7TA 1QBBA 1W5OA 1UKTA 5AECA 1K8XA 5FCZA 2HE8A 4YVVA 4J1OA 4QIUA 4L6HA 2ZQ0A 2VXNA 1JGIA 2DSUA 3PZUA 5CJ5A 1HNYA 4AFYA 1N7KA 4BKNA 1KA9F 2J9ZA 1UMYA 2BHZA 3W73A 1QNRA 1H1ZA 3A23A 2YL8A 2QS8A 2Z26A 1JD7A 4HA1A 2J47A 4MG4A 2W4XA 1GONA 1E40A 4GC4A 3NEVA 1R46A 3RJYA 3SCUA 4W84A 2QYGA 2EPMX 4IL2A 1IWAA 1Q6LA 4PULA 5C7VA 4JIHA 2WK2A 2BXYA 1QO5A 4YU1A 4M80A 4GJIA 3BV7A 4QNEA 4IIEA 4H8HA 3OODA 3EXTA 1IWBA 2EPOA 5F1UA 3QY8A 1E4LA 4B5NA 1MSSA 4O53A 4LYPA 3MDWA 3U5UA 1VAHA 1A5AA 3EX4A 3WMBA 1P48A 5IHSA 4HHHA 1FWTA 4NT0A 3VOIA 1SFJA 2AAQA 5JCLA 2F6XA 2OR2A 3JZUA 2XSAA 1E15A 2CXEA 3F2DA 5AYZA 4C6OA 2RGMA 4PMJA 2QIWA 3UG4A 4J3WA 1XLGA 3BLIA 4FXJA 1MNZA 2Q8LA 2GL5A 3MDUA 1QPQA 2JIEA 1RBAA 3ABSA 2J8FA 3CPRA 3B05A 3R8RA 1SZRA 4E0CA 4DUWA 2H6RA 3RXZA 4QQ3A 2OTDA 1F6YA 1WDRA 4M52A 3NVDA 1OGSA 2VI0A 2ZZ3A 3EPOA 4A35A 3AHXA 2YLLA 3N17A 3FXYA 4UMCA 4L1GA 1ISYA 1XKJA 5D30A 5JH1A 1RLCL 3IUDA 4DPQA 3UA4A 1W9BM 2XU2A 3GB6A 2A4AA 4MNLA 3APTA 3FIGA 1NOWA 5AYXA 1IGSA 4QCEA 1Q85A 4HPXA 5K4XA 4UTIA 3LB0A 1SFSA 4KCUA 4O13A 2J24A 1GSNA 4O57A 4LA1A 3DFOA 2P10A 3MJYA 3BLPX 3MMUA 1UD3A 4W7VA 3ARYA 1LORA 3TKFA 5DMMA 4GH3A 2VHLA 1FKXA 5FS6A 2WBAA 4HU4A 2OB3A 1H41A 4ONVA 1XR2A 2RHGA 3WUFA 5XINA 4ZO6A 1OM0A 4JS3A 3QFEA 1XISA 3U3HA 3MMTA 1BSIA 1EF3A 1RQEA 3W38A 1DJQA 1X7FA 2F8QA 5HNTA 1Z3NA 2QR6A 3PG8A 4GQRA 4KRZA 1FCBA 4LX4A 3VXGA 3MO7A 1IZKA 3ATYA 3ABZA 3UWVA 2GDQA 2VFEA 4CQ9A 4OU1A 1E4MM 3I3EA 3ETRB 1CIUA 2J8TA 4ZGYA 3CT7A 1G6CA 1K9EA 4Q7NA 5EPDA 2PLKA 4WY0B 1V02E 4PBGA 1F61A 1PPIA 4JCMA 1TPWA 2Y5SA 1WKDA 2FZDA 4ZODA 3DFYA 3W88A 4QE5A 2X7WA 1YADA 4GZIA 1I1WA 3CYJA 4A8IA 5BU6A 1A5KC 3DK4A 3WDRA 4UTKA 4FP1A 3VYLA 2NV1A 4YHEA 3DYMA 1NTHA 3BAJA 3EWDA 1H7RA 3NSMA 4LIIA 2PEVA 1XG3A 4HPGA 3AJ7A 1WO2A 3N2BA 5H8UA 1M3UA 4YIWA 1LRQA 5D32A 3R13A 4Y7EA 1VJSA 5KITA 1KQZA 3SEPA 3HPZA 4RPQA 3CU2A 1A5NC 1KC7A 1GERA 3W7MA 1UZ4A 3T2PA 1GRAA 2WSPA 1XCWA 3N13A 2PU0A 5IXEA 2NV2A 3LSCA 1Q6EA 1Q4NX 1SW0A 4G7FA 1J0YA 3UCQA 1GVYA 1ICQA 1J8VA 5ABEA 2YQUA 4XVDA 4W8BA 1W2VA 4Q4OA 1EJXC 3PZTA 1JPKA 3OIXA 3G0UA 4UCFA 1GETA 1QHOA 1OWQA 3U2EA 1N8WA 1UR8A 1NHPA 1IZJA 4Y9OA 1WPCA 4OIFA 3MA8A 5K4ZA 4NNBA 3UBPC 3QFAA 4Z0JA 4Z2GA 3URHA 3GVWA 3NQ8A 3L5MA 1KCKA 1WA3A 1V3LA 1FFUC 3MSDA 4KS0A 2ZUVA 1VB9A 1HGWA 4JFWA 1W5QA 3RPTA 4GBUA 3UR7A 3KDOA 5LIKX 4Y96A 3FAXA 3AMCA 1UH4A 4B5SA 3BLLA 3MJMA 2WSKA 4L61A 4CD6A 5I3GA 1PIGA 4D2JA 3O0FA 1SR9A 4MB5A 3VC6A 2I5IA 2TPRA 2DJXA 5FA5A 2ZYFA 4DXVA 3VIPA 3K4WA 4PTWA 4IJRA 3RR1A 3AHZA 2CZEA 1KXTA 4S23A 3W1AA 2RKXA 1FKWA 4KGJA 2WXDM 1SGJA 3N9RA 4PMNA 5EMUA 3Q2DA 1E9YB 3AU6A 4LJ3A 5GNXA 3M43A 1BVZA 2AL2B 1AW1A 1UCWA 3M0KA 4WDTA 2C6QA 3ZR4A 3W1RA 1R9ZA 3QSTA 1Q6QA 2AOSA 1GVOA 2OEMA 3PUEA 3UPWA 3E0LA 4RNFA 2CKRA 3HURA 2YA2A 3TR2A 1XS2A 2J79A 1HQTA 1QTWA 1JDCA 1J2BA 1U1JA 4V15A 3LCLA 3ZOAA 2EEXA 3DIPA 1AJ2A 4XTDA 2QT3A 4DJEC 4Q6XA 1TPB1 4XZ9A 3ZVHA 1YTEA 1X39A 3UNTA 3V16A 4MJ4A 1K6WA 3FJLA 1HO1A 4WY0A 3ZJKA 5BWFA 3T42A 1UWAA 3PSWA 1CNVA 3WUGA 5T91A 1IIHA 4LEQA 2WVTA 3W70A 1KM3A 2HEJA 3CUIA 3OLGA 3ZLGA 2ZC8A 2PUZA 1HVXA 3L2MA 5ECVA 5AHNA 1XIDA 1ZZMA 3N73A 2XIMA 3H7RA 3MV11 2ZIDA 4B3KA 3N3TA 4UTJA 5AHMA 1MQPA 4GQQA 2WMIB 4PCPA 3UXKA 1CXIA 4URIA 2YFNA 1IT8A 1PE1A 2DFAA 3SR7A 4LAKA 2VTFA 5C6MA 1YYAA 1Q1WA 2G50A 2CW6A 4F0SA 3QHOA 3CO8A 4UOQA 4AISA 4H4VA 1IR1A 5GVJA 1NY1A 4MJ2A 1XYBA 4R88A 4NRSA 1WP6A 1BPLB 1ZAJA 5LIWX 3VK5A 4IOTA 1NOUA 1US2A 2DU2A 5BZAA 2TSYA 1NU5A 2F9RA 4PGLA 5CPSA 1X2HA 2XDFA 3WK3A 3RM4A 4XQ6A 1OGGA 3TA6A 1GVSA 1BF2A 3WNOA 1PYFA 4M6UA 1IYXA 4QE1A 3MVIA 4GK8A 4JYEA 1TJ2A 5KMYA 1A5UA 5AC7A 3BICA 5EGRA 3W2UA 1XIHA 4EWND 1JZ6A 3WG6A 3EWCA 4UQCA 1V5XA 2EGZA 4BF5A 2NWSA 3EA3A 4MFEA 2VVNA 1W8SA 3NQ2A 1QAPA 2E25A 4G8TA 1PV8A 1R0MA 1KRAC 3HFTA 4E3TA 3DBPA 4JD4A 4LUYA 2I17A 4A21A 2XGIA 1JD9A 2C15A 3QRHA 2PSNA 1FDJA 3I3BA 4L65A 2ZKMX 2IKJA 1UJPA 3W4RA 2J9XA 3Q58A 1PAMA 5J04A 3CYVA 2J7FA 3LEPA 2VWSA 1DJXA 5AC5A 2BNJA 4DZIA 1AH0A 5I3KA 1W1A1 4K7VA 1PDZA 1LWJA 3JZEA 4YL2A 1J0KA 3PBVA 3PJXA 3C3UA 1OIFA 3ITLA 5FF2A 4HJWA 3KCJA 3H53A 5DCEA 3DERA 3M9YA 3HMCA 5AFDA 3AS1A 4ATLA 4AD2A 1OC7A 2RJHA 2QCEA 3PNZA 2FFCA 1R3YA 4S38A 1CGXA 4YCPA 2PRLA 5D2YA 3RO8A 2INFA 2WVUA 3GE7A 4QRNA 1WDDA 3O9NA 3AC0A 4TUFA 2NQJA 3GK0A 2BGNE 2NX3A 3AIEA 3CUHA 5BOOA 1IWPA 4MWAC 3IIZA 3UP8A 2BY3A 2AMXA 4L80A 4QP0A 3DG3A 2VC6A 1JYNA 3WJWA 3FX4A 2WNWA 1SW7A 4M7SA 2C0AA 5D37A 2DH3A 3W84A 5L9FA 1W91A 4RDWA 3AXIA 4HK7A 5LGXA 4LVAA 3W6LA 1FRBA 3HJEA 5CG7A 5BRQA 2DORA 4TXEA 2AGTA 3OA5A 2UY5A 5EFFA 1ESWA 1SU5A 3GUWA 2X8RA 3CZGA 5REQA 3GXNA 3BANA 2EO7A 4DJFD 4AWUA 5FJPA 4TTGA 3LRKA 5DF0A 1AOGA 2KAUC 1NARA 1SJCA 3P81A 4IIHA 3MBFA 1UHVA 4OUEA 3S1UA 4YLWA 2HNEA 4O1CA 3MMWA 1HIZA 1V6VA 4XAGA 4JN6A 1VIWA 5DQPA 3DENA 3AIUA 3LRLA 1A47A 3EYPA 1N8FA 3GBEA 1YIXA 2VCAA 2CLMA 1POKA 5CPTA 2A7RA 3BZGA 4C1NB 6A3HA 3NQ7A 3KZSA 4S3GA 4CNUA 1W3TA 3DFHA 2CNCA 1EQPA 4TR9A 4HQVA 5AHEA 3WJZA 3ZYZA 3OP2A 4FOKA 3PC0A 3VIFA 3IK4A 3O07A 1O94A 2OJPA 2PRMA 3B03A 3M47A 4GY1A 2JKAA 4M7TA 3C56A 1IEVA 1JZ3A 4LAMA 2MANA 2DJLA 3N19B 3O15A 5E0CA 3RX3A 3K1DA 3MI6A 2VX5A 3DN5A 1Z32X 4O16A 1KWKA 3SJNA 2PMQA 1QHPA 1S2TA 2CXGA 1N62C 1QPOA 3APYA 1ZGDA 2PDQA 4QLKA 2WOWA 5E6YA 2DQWA 1IHIA 3THDA 1ZP4A 3FKRA 4QDMA 1W17A 1EGMA 5EY5A 4CU6A 1S5MA 3G1FA 2H9AA 4JN7A 4X2PA 2YL6A 3U7BA 4QJ1A 2GH5A 1AMYA 4TVWA 1HJSA 1J4EA 1E5NA 4P8WA 1Q3NA 2RDXA 2OX4A 1BG4A 1QWKA 5G4HC 3KP0A 4I5UA 1V0KA 4EIVA 3PM6A 4YVXA 4C1LA 2V2HA 4ZO8A 3OQEA 5H2ZA 2B4GA 2O9PA 3VM7A 1G4TA 4MPQA 2PP0A 3VO0A 4FX6M 3CQHA 1KM1A 3EOSA 4DAFA 2NLIA 1QOXA 2XTKA 1NWUA 4PTNA 3LD5A 3EX2A 3WF4A 4HOZA 2X1RA 4M82A 4S2BA 3P74A 1KM2A 1LOLA 2TMDA 5CSYA 4NZ5A 2E6DA 4BQ3A 3W3OA 3T9PA 2YVJA 2Y8KA 3POHA 4H6KA 4RCXA 5LIYX 1GHRA 1W3JA 2D3LA 4PA8A 2CHRA 4E6MA 2FYMA 1U5HA 3ICJA 4KEMA 1N61C 1M68A 5G2WA 2ZX5A 1JYXA 5CAHA 3H21A 5I0DA 1K8ZA 2B0MA 3B0VC 1FDYA 1FDZA 2QCHA 1JXKA 5FF0A 1U2YA 2WNQA 2I57A 2XVGA 1FWNA 1P7TB 2G3NA 4JR5A 3P67A 2LLEA 4JTJA 1JAEA 4WCJA 1GQLA 1H7XA 2PGEA 3IIPA 1RLDA 6ALDA 1IIGA 4KERA 1GGOA 1J96A 3UR8A 4NRRA 4H4WA 4JIIX 1XYCA 2CLOA 4S2CA 2PWFA 5I2UA 2X41A 2J3NA 4MDOA 3W2NA 1YBQB 1A3XA 1L8PA 4ADTA 4JTHA 3S6TA 5BXTA 1KTBA 5CBIA 3U8GA 4MLRA 3NURA 3FFSA 4G7EB 4TMBA 1RPKA 2WSQA 3WLRA 3QHMA 1T0OA 1DQXA 1ZUAX 1VHNA 2PLJA 1G4PA 2XINA 2Q09A 2FZBA 3UZXA 5A6LA 4GHRA 4J5NA 4E8GA 3W7DA 1W54A 5CPNA 1NOFA 3P6LA 1OFPA 4LS2A 1UKSA 4K36A 2ZOXA 1MQQA 3TWAA 2Z29A 4JYDA 4BI7A 2Y7GA 4JQ4A 2ZZ4A 4OECA 4GUHA 4Z1DA 5M17A 1GHSA 5LHEA 2CLPA 3IJLA 3GG1A 4DI9A 5J8LA 1VEMA 2BDQA 3AXXA 4QAWA 3IS4A 4Q8PA 4UR9A 3BZJA 2B7NA 2QUTA 3KX6A 2O4MA 3SUVA 3FJ6A 5JBFA 2GVLA 1MI3A 3T0TA 1BWLA 3Q67A 1WBJA 3OYXA 1XL9A 3MBDA 1VLIA 5SWUA 1HF6A 3H2FA 4GI4A 3SO7A 1QI3A 3IGHX 1NF7A 2DH2A 3NUKA 4C6QA 4DPPA 4J56A 3WBXA 1RK5A 2EHHA 4PRWA 1Q6GA 1OX6A 1E3XA 4FK9A 4IFOA 3V75A 5AHLA 1AUSL 1Z69A 1YMYA 4HB7A 2EQ9A 2ZA3A 2J62A 2TRSA 2R24A 2XZ9A 3NQFA 3E5PA 2V6AA 5FL0A 2ABBA 5HK4A 4KWOA 4HMNA 3ZZ1A 1R6WA 3WMCA 3AS0A 3QR0A 4PUMA 3B97A 2Z7GA 4IX2A 5IM51 4QXIA 2XHYA 4H9TA 1GPFA 3WQWA 1PWMA 3NR0A 4Y2WA 1XICA 1CT5A 2JKEA 4B5UA 1VFSA 2ZXBA 1R8LA 1NDVA 2UZ9A 4KFPA 3BCDA 2XUCA 3ERPA 2DZUA 3PAOA 1QUMA 3UXDA 2EQDA 1UP0A 4LBSA 1FO4A 1RD5A 4S3BA 4LUTA 2IUZA 4YMZA 1FIQB 4MB4A 5KZEA 1MZRA 1FX6A 4DF0A 8TIMA 4HNNA 4TMCA 3UY8A 2VCCA 1XSJA 5A1AA 4BI6A 4U33A 4YS1A 4TU1A 4E4UA 3GVQA 5TD4A 3GUGA 4HYRA 1OT2A 3O0HA 2QDEA 3GTNA 4YTUA 2OSWA 4ERGA 3L5OA 1A0EA 4W85A 4RW5A 2J74A 4WK9A 3RN6A 2NUYA 1X6UA 2D23A 4GUFA 4P8XA 4IIBA 3R5EA 2QAFA 3V0UA 4D6GA 3ARSA 5LIUX 3URAA 2DSVA 3U57A 2XM2A 3GDTA 2NT1A 3TZFA 3GC5A 4JIRA 2F7FA 1A5MC 3BCJA 3IGUA 3KBNA 1DHPA 1YBQA 4RZ4A 3AM9A 1VCFA 3BOLA 1YLVA 2QDGA 5A6BD 2I9EA 5KEZA 2OMAA 1K9DA 4NSBA 2PDKA 5CGTA 1TQJA 4O0ZA 1IXNA 3CGTA 2ZRWA 4RXGA 4QJ5B 4GI9A 1ADOA 5TBOA 1XPGA 4HN4A 3UWWA 4F9DA 4DLFA 4H9UA 3CQIA 5AHIA 3MUY1 1HJUA 1YW1A 4LYQA 3HF3A 2XVLA 3KTSA 4M19A 3A7AA 3USZA 4F0LA 2R1MA 3VKDA 2NUXA 1JDAA 1T41A 4X61A 1ADSA 1DQUA 3SRFA 1SSGA 4JQ2A 4V33A 4ECLA 3E0VA 1TA3A 3G77A 2XH2A 5GRTA 4FOJA 4NAFB 1FWFC 1ME7A 4D6FA 5D03A 3NQVA 4W7WA 4M29A 3DFTA 1B0IA 1Z48A 4WQ6A 3GX9A 3WBEA 1IF2A 1XRFA 2J13A 5BXSA 2RFGA 1NP0A 5F1VA 1YKWA 3QFBA 4Q8OA 3LN3A 5T9BG 4WVXA 3T7VA 3H2OA 4ZE5A 5KZ6A 4M81A 1XIGA 4ZQRA 5LZLA 3VIIA 4HA3A 1KGWA 1ZBCA 5CPQA 4FPSA 4AZCA 3QQ0A 1QT1A 1XKYA 3CHVA 1JPMA 3W26A 4NHVA 3SB0A 2Z1KA 1W1IE 2DV0A 3FHQA 4FXRA 3MS8A 4GVGA 3W28A 4P8UA 1HXJA 2Y7EA 1ZJHA 5A8PA 1VR6A 1JZ5A 4C7FA 4L4OA 1TJ1A 3FN9A 4C7GA 3LMYA 2A21A 2VURA 2X8CA 4RNHA 3VKJA 2CYGA 2DP3A 1QASA 2OZ3A 4GKLA 2C79A 4IUGA 4BWLA 2BGSA 1C9DA 3MWAA 2QVHA 5D9NA 1I2RA 1HX0A 1L6WA 1FWEC 3K5XA 4OV4A 1SO4A 4AD4A 2PD9A 2J7GA 4HTBA 4JX5A 2QLYA 4ZA0A 4DWSD 2ZWZA 2XSBA 2CFFA 3VZXA 1E1CA 3KOYA 2IQ0A 3N4AA 3CPUA 1TJ0A 4KIRA 3VMPA 2ZRUA 2NSOA 4R9OA 2E1WA 1BTMA 4F0RA 3M0ZA 1NHQA 4IXHA 1JRPA 2EKCA 2XPKA 2GOUA 1LQ2A 1FEAA 3ZQ9A 3WFZA 3BLOA 4MY8A 1TRIA 3AYTA 3BSHA 4HGXA 3WJSA 2OPJA 1OJXA 4JTUA 1GQNA 5E09A 3ARVA 1C29A 2NVKX 3GM8A 3P5ZA 4WGHA 5TIMA 3KRUA 4U5IA 4GUJA 5HPOA 3N9SA 1UASA 3IUIA 1C9WA 3A5FA 1F6KA 3GRSA 3HU7A 2WO5A 1A3HA 1J18A 1VD6A 3A9BA 2VFFA 1Y7VA 2W27A 4Q8VA 1POJA 2OWWA 8CGTA 4C65A 2WLYA 3S5NA 3OZYA 4R9XA 1V02A 3OBKA 2Y5JA 3QW4B 4GIRA 3QV6A 4GWEA 1KN0A 4JPGA 3SFKA 4GC3A 1KO0A 2VZTA 4JTEA 2YVGA 3MKVA 2YW3A 5G4EA 4PCFA 1CXEA 5JIPA 4H4SA 3TROA 1E9IA 3W9ZA 1UWRA 4N6EA 1FH7A 3ALGA 5DANA 1DWGM 4D1IA 2DZXA 4DZAA 1GG1A 3WLPA 3RGTA 1XD0A 4A3HA 2QULA 1UWQA 1I4NA 3JUGA 4ZSTA 1DL3A 4O11A 4LCRA 4IFKB 5AHFA 3VKCA 4H4RA 3MWCA 4FZIA 1Q6FA 4LXFA 4RZ6A 7TAAA 3EA1A 2WJFA 3G18A 4UZSA 3LCWA 4XV0A 1K70A 3PZVA 2VX7A 4GISA 3WQDA 3SAZA 3PULA 1O4UA 9RUBA 1PZ1A 1XCFA 2VEKA 2PE4A 3RCYA 3TNOA 2VZUA 1ZMDA 5I7GA 3H70A 2WOIA 2CLFA 4MM1A 1TQXA 2V5DA 1NEYA 5CGMA 4K1WA 2WB5A 5ABHA 4AYSA 3QW3A 3N12A 3QLLA 1M5WA 4TVUA 1VRXA 4FNUA 3W7KA 3PG9A 5IDIA 3CWNA 2VZOA 3GG8A 2GWNA 4Q8UA 5A6MA 3KVJA 1B4KA 4NNAA 3SCOA 1LPFA 4TO8A 1LQ0A 3OW1A 4UTWC 4Q4SA 3CPGA 4HNLA 2BOGX 4IMFA 1RCOB 5KSWA 1GK8A 2CWNA 2QCDA 3WK2A 3BJTA 4M3PA 3T40A 5D2WA 2DQXA 5TQLA 5C54A 3RNDA 4MKVA 5BNKA 1IXQA 5CC6A 1EP3A 1HJWA 4RUBA 3OO2A 2NPXA 3UZ5A 1RD6A 3DHUA 5CSRA 3KBMA 4RV8A 1ECQA 2GDVA 5E1QA 7TIMA 4PUEA 5BCAA 2UV8G 5K9DA 2JK2A 3MI2A 3QLDA 4DO4A 1H1NA 4V1XA 4LOCA 3WF0A 3PPHA 1IR2A 2EPKX 1HFBA 4JNZA 3S42A 3DG6A 4XZHA 1REQB 3GXFA 3WQ6A 5EMYA 1SSDA 5FOOA 1VCVA 1PDYA 6CGTA 3UWEA 5FD0A 1OFAA 2BC0A 2GLKA 4P7LA 2Q02A 4EXAA 3IARA 1A50A 3M0YA 3B0XA 1XLIA 3ARZA 2VDGA 3FSTA 2B7PA 4WSJA 1TV5A 4U3AA 1RUSA 1YDNA 1JQXA 3S9YA 1DPMA 2OU4A 4APNA 3D9XA 1CB2A 3MVTA 5DBUA 3SCQA 2VZVA 1WCGA 2BVWA 3GAKA 3QMRA 3ITOA 1TTIA 1F8WA 2QDHA 3VNJA 1OFQA 2FPYA 1DNCA 4R3UA 1W3HA 3AHYA 4ZSUA 5DY3A 5FS7A 3CUJA 4FXFA 1M65A 4EMWA 3BGJA 3K4DA 4D6IA 3GIYA 4H4XA 4LT9A 3W83A 3M41A 1B57A 4ROPA 1UPMB 3AAMA 3QPEA 3NOEA 4DHGA 3NCOA 1ELSA 1AK5A 3OVQA 4NZ4A 1Z42A 1E73M 3BQ6A 4RE2A 2A3LA 4DB7A 1D2KA 2NZLA 3LTPA 3MKCA 5GJNA 1FECA 7PTDA 3BAKA 1NQKA 3AYSA 4WUIA 4DO6A 3N2TA 3I4KA 4EPBC 4IFKA 2GVJA 4HT3A 4I6KA 4GD0A 4LAZA 2XFRA 3C3NA 1KWGA 4W89A 4EQRA 1OJTA 3R11A 1Q8AA 3TE9A 1QMLA 1NM9A 3CUGA 3OB8A 5RUBA 2X8HA 1WDWA 2DY3A 3TNBA 2BXVA 3W85A 1XI3A 3C8FA 1S2VA 1OK4A 3HG5A 1XIEA 3LGGA 1O95A 4XUYA 4JNYA 1VH7A 1DQWA 3WLSA 1WBHA 3NNTA 4JYFA 1YNQA 2PDNA 5EL1A 3EUB3 2FMNA 3G1DA 3N14A 1PEZA 1I9CB 1OEPA 3NL5A 2BY2A 3AI0A 4CVWA 2FKPA 4OT7A 4ASTA 8XIMA 1X38A 1K77A 4QITA 3LI1A 4DY1A 2OX1A 3WO8A 1KQYA 2F38A 2WANA 3ZFHA 3OBEA 3EX1A 3MKKA 4A3QA 1JEHA 3BH4A 2EAWA 1KCLA 2PS2A 3CAVA 1GESA 2OZTA 3W2LA 3HG4A 3O0KA 4OV9A 5AN7A 2RABA 4MB1A 1Q2SA 2C1HA 1XH2A 1L9WA 4I9MA 4HHLA 2G5WA 2HNHA 1V7AA 4FIQA 3WUEA 4FO4A 3BJFA 1CGUA 4ADWA 1SB3B 3UU0A 3DG7A 3ABXA 3GRIA 3UY7A 2WV8A 3IACA 1LTDA 1DIEA 1RSCA 2PP1A 2ZXAA 4B16A 3UXIA 1EOMA 1REQA 2QV5A 4LF1A 3CHFA 1QW9A 1JGMA 1RA5A 1JDFA 3GR7A 1H60A 2DIJA 1EEPA 1J0JA 3BMVA 2HBVA 3WQGA 3TZNA 3GLCA 1FFVC 2NLYA 3H4GA 2C13A 1XWYA 1XIMA 4FNSA 4C6IA 4PRTA 4ZOCA 3NDOA 1AMKA 2YCLB 5CZ0A 4K39A 1E9LA 4UMAA 2PWVA 3LBOA 2BFGA 3BQ5A 4LY4A 1C90A 2HVOA 5FS8A 2IQTA 3LPFA 3R58A 4P7OA 3UG8A 2FQIA 3G8EA 3K1GA 1G4EA 5CG0A 1VDVA 2OXNA 1A5BA 4LUSA 3W01A 4HSNA 4E4PA 4MAZA 2X09A 5AZ1A 4KPRA 5ABGA 2ACSA 2IS7A 4B91A 4LPCA 2VQTA 3VMOA 1VFLA 1LM1A 1SM9A 2ZA1A 3BOFA 2FHCA 4J3TA 1Z8AA 2XGBA 1ZK7A 3UR2A 4Q3MA 1NF0A 3KEHA 3WL1A 2FH6A 4XZMX 3LZ3A 4IJBA 3CL7A 1Y65A 3O6DA 1IGWA 2E9BA 2AL1A 2EG7A 5F2GA 1UBPC 3B04A 3C5QA 1XYFA 1R3TA 2DZVA 4GG9A 2V9DA 3ITYA 4DJFA 3T1GA 3LV5A 2JIWA 1BYCA 4LVGA 1TIMA 3I68A 1HN1A 4GY0A 2C19A 3CV7A 3BLKA 2IPJA 4WY0F 3VDBA 1XIIA 1S46A 2V2DA 3BMWA 3H6OA 3N2MA 2E6YA 4RDYA 1Q65A 4QLLA 4Y90A 3L23A 3ITGA 4WDUA 4P61A 1GRTA 2WMFA 3N2CA 4WR3A 1WUEA 4KEZA 2YA1A 1DIKA 3L4TA 1DXLA 2D69A 3ENLA 5I23A 2PDWA 2QZRA 3BMXA 4WD0A 3H54A 3OTRA 5JVLA 2CCRA 5LIXX 1EIXA 2XIBA 3ARRA 1MYRA 4JTGA 4NKCA 2ZZ1A 3FA4A 5JIWA 3P93A 4EF8A 3PZQA 3R07C 1I1XA 2A5HA 1V0LA 4IMEA 4TTUA 2WBGA 4I90A 2QUVA 3P60A 1LBFA 3MP5A 1WZMA 2PDBA 3AHVA 4AXKA 3IJDA 4H1ZA 4FEZA 3EAUA 1OB0A 3WLIA 3BW2A 3CNYA 2G3JA 3OBAA 4DX3A 2VR4A 3AXKA 4KT2A 1X2GA 3GU1A 3A3WA 3MQTA 4ZOHB 4MWAE 2VGIA 3B4YA 4G56A 2HQMA 1UWTA 1QXLA 4WSKA 1F2JA 3NSNA 3B0UX 1HP5A 4DM2A 2CEQA 2PURA 2PGFA 4F66A 1MDLA 1QPKA 2I5GA 3M6YA 3EPMA 3MHGA 2W66A 3TC3A 1JCLA 3PBMA 3RIKA 5A6JA 1F05A 3IJ7A 3GO2A 3KL0A 3PJUA 4NNCA 3TYAA 1R2SA 4HCHA 1D7FA 3ONCA 3BAWA 4WIWA 3VOGA 5LNRA 3CC1A 1MFVA 3PWAA 4GZ7A 4M6QA 1F3TA 3ARQA 3NM1A 4GJJA 2HDJA 1YX1A 3VDGA 4LBRA 1JF5A 5LKYA 2ZUNA 5PTDA 4ZXLA 3O6AA 4ICCX 3QR3A 1SVDA 1P0BA 4Q8QA 3R89A 5I3DA 2X1TA 1X8CA 3ITXA 4GYKA 3UWQA 2X0SA 2PC8A 5BW6A 4M1BA 4M24A 2E67A 1BD0A 4PUJA 5HA7A 1O1HA 4NJKA 2WOQA 1SYTA 2Z4GA 4JKLA 3AROA 2A3EA 3M6DA 1IV8A 3E74A 4FXSA 2WSYA 3AHTA 2Z1SA 1TTJA 5MKGA 1KFLA 2FTPA 3V5CA 2X99A 3M16A 3SCWA 1OYAA 3CT2A 3N18A 8A3HA 2GPTA 4ZQNA 1LLOA 4C6FA 3HPSA 1I2PA 1Y0EA 3DFPA 4EPDC 5DMYA 1YTKA 2OOFA 2TYSA 4A2RA 1BGGA 1BWCA 3HB9A 3SN0A 3FG2P 5D2TA 2YX0A 1S2AA 2PWHA 3HG3A 5FF3A 3UFYA 2VZSA 4PMYA 4AX7A 4C1KA 3H24A 2R94A 3BG3A 2DVXA 1LG1A 3LXDA 3EOEA 3COTA 2PLMA 2D0HA 1MO0A 1JYWA 3ZWTA 3RU8X 1UH3A 1VRDA 5I3IA 1SR0A 3GVRA 3W72A 2Y62A 1T8XA 2YB1A 2X7VA 4I8DA 4US5A 3HMJG 3A12A 4GXMA 2V3DA 5U25A 4O1FA 5H91A 1UPPA 1VEOA 1XDJA 2YYUA 3QGVA 1EH9A 1TMHA 3W23A 1CGVA 2PDLA 2X40A 2VR5A 4I3GA 4HOXA 4ACYA 3SUTA 1US3A 1XLMA 3L8KA 1M01A 3SY1A 3W25A 5BROA 1W3NA 3WELA 4ACZB 2YKKA 4MKNA 1CECA 2ISSA 3RAOA 3WEZA 1VJZA 2C18A 2A8XA 3MYOA 4B15A 1S7MA 2BP1A 2ZUUA 1UWIA 4PFHA 3TMQA 2CKSA 4WRHA 1ODZA 2D3NA 3F5JA 3CBWA 3WNLA 3GD6A 2VJXA 1GRGA 1EJRC 1P0NA 4DELA 2BHYA 4DM1A 3TN3A 1RAKA 4HZMA 1PCWA 3POCA 1B31A 4ICNA 3RX2A 3TQPA 1UW9A 3H23A 3KDNA 3CUZA 4NZFA 1WUFA 3VGDA 3GVGA 2YDRA 4H04A 2CC0A 2ZRVA 4EPKA 3LS9A 1JOAA 3QBUA 3EOLA 3W37A 1GEQA 3DKJA 4K68A 2V2CA 3Q94A 4EF9A 1L2UA 2C16A 1MW1A 3WDQA 3LSBA 3NPUA 4QX4A 3F4WA 3SQSA 3I6TA 3UXAA 1LOSA 4B3LA 5DN1A 1JYVA 2C7FA 2Q6ZA 3WN6A 1UA7A 4W4QA 5JCKA 4LS0A 3NL2A 3SY8A 1P4CA 4HHPA 5G2IA 4JKMA 4J3XA 2D2JA 1DTUA 4WGXA 1GKRA 2Z6JA 4DWSB 1WZLA 2ONEA 2REQA 1L6YA 4GO9A 1WYIA 1H5YA 1KBBA 1B2YA 3KS5A 3SN1A 4FIRA 3ANUA 4PMXA 3FVMA 3BTNA 1ZL1A 1IEQA 1XRTA 3VZZA 2OWXA 1KLYA 2CITA 4YWSA 1OD8A 1C93A 3T8LA 3A3XA 3D6NA 3G1SA 3IWPA 3W1XA 2DSKA 4HPNA 4ZQOA 1TKKA 3VFCA 3CAWA 4DBEA 3TAKA 4W88A 1KNWA 3H2CA 3TYDA 3LRMA 3MUXA 2V38A 3RMEA 4Q8TA 3LCIA 1DJNA 2BV9A 3VOFA 5HMSA 4HTYA 3BK0A 2PDPA 3EEGA 3PZOA 3F5KA 1G7VA 3HQOA 2J27A 1B9BA 3VGGA 1TWDA 1XLHA 1J10A 3BSGA 4LF2A 2X05A 3NPXA 2Q01A 3KL5A 3EDJA 2R9ZA 3ELFA 4YJ5A 4ML9A 1V59A 5LSMA 2GGEA 1OADA 3BAYA 2C3CA 3LQGA 4RX0A 5E9AA 5AY7A 3MANA 5LHFA 1ITXA 2WW5A 1EF2A 1QJWA 4EE9A 4CN4A 4CD8A 3EWZA 2QIIA 3KE0A 1Q7MA 4E38A 2QJNA 5A2AA 1BWVA 3Q37A 5EMLA 4J3SA 3S3GA 4H7VA 3WK1A 4PCSA 3WD0A 3DK8A 3VMNA 1ZXIC 2BLEA 1JFHA 2WKJA 4L9ZA 1Q6OA 4CU7A 1VFOA 4NY2A 1D3CA 4U3CA 5CZJA 1JPHA 4WSHA 3SBFA 1QNPA 1BSLA 4FNQA 1KFBA 1TO3A 1YHTA 3EF6A 4XBJA 1DIOA 2ZXDA 3KLJA 2E6AA 4JTAA 1XXXA 4PUUA 5A69A 2C1IA 4CKQA 3W1LA 2V3AA 4EAYA 3HZ3A 4EVZA 3S2NA 4YTSA 1MMFA 3U48A 1HKVA 1E72M 3T0AA 3R7MA 1YEYA 1XLAA 3CHDA 3FA3A 1DJWA 3VAVA 3NTYA 5D4YA 4ADUA 5LNWA 2R1KA 2QCMA 3N4EA 4UTLA 3MV01 3VUPA 1K8YA 4N42A 1U5JA 7A3HA 4HNVA 2EQ7A 4BI5A 4AY7A 1M7PA 3W7OA 3UCCA 3P14A 4IPJA 5XIMA 2GVGA 2GJXA 1GJUA 3V1HA 3MB9A 3L9CA 3TC7A 3WNKA 4AHOA 1VPQA 4KRTA 3PUOA 1NDWA 1US0A 2Y89A 3E5BA 2Y8VA 5LA2A 3NZQA 1EPVA 2WZHA 2R1PA 4H7CA 1NHSA 3MI3A 2P76A 1E4NA 4TV6A 3FAWA 2QUUA 1SPQA 2GVYA 3W82A 1DKWA 2FFIA 1EEXA 4W7UA 3SRKA 4F3HA 3I6EA 1B9ZA 3OZPA 1Z6KA 4PUDA 3VIGA 4MMWA 4GVFA 3W2MA 6XIAA 4O18A 1HL2A 4AIUA 1HJVA 4WJXA 5CBBA 3NO3A 1H7WA 1Z9AA 3GTHA 3SN4A 1JIBA 2FB2A 4DWSA 2ZTJA 3W02A 1BXCA 1TCMA 4U5KA 1V6YA 4H9ZA 3M44A 3TQ0A 2PWDA 1W8GA 3RJXA 1B3XA 4H00A 2DGAA 4FI4A 1A5OC 4G6CA 5M3WA 3KVLA 4QEEA 1ZPTA 1KBJA 5AVNA 1E1EA 3RPMA 1GQIA 4OVXA 4KCVA 3PNUA 1BKSA 3HTWA 2WVVB 3WLMA 2NQLA 3A64A 4ZVJA 2BMBA 1H5VA 2GK1A 4EM4A 4PMZA 2Z2AA 3QV7A 4TVYA 1X7IA 1TYPA 1PJ9A 1GRBA 3AQUA 1E5JA 2GQ9A 1V79A 3STPA 4DXXA 3T4WA 4PTXA 2VT0A 3ECQA 1RP8A 1VQZA 3UJ2A 3R0UA 3VCCA 5F7UA 2ZZ0A 1QBAA 1F8IA 4FX8A 1OZQA 3E2RA 5HANA 2C3ZA 2DSWA 1NDAA 2W63A 1DXEA 5LYRA 2ZE0A 4ZL1A 4GO8A 2D73A 2ZZ6A 2QCCA 1ZY8A 2A7NA 4MYXA 2DVTA 4M8UA 3IJ9A 4LFYA 4ZB0A 1UROA 4UTTA 3QKEA 2ZZ5A 5F2IA 1ZNNA 4F2UA 3GZ3A 3N34A 2F2KA 4H8VA 1EJ7L 5TAOA 3E2QA 3G6LA 1AD4A 1D9EA 2NX1A 3PANA 3MCMA 3BPWA 1I0DA 5AZ0A 1V3KA 2QKFA 3FYOA 2R91A 5CXPA 2WAGA 3KOFA 3KHDA 5L6UA 4MJMA 4WX2A 2J7EA 1QNQA 5AKQA 3LX9A 1NWSA 4NL1A 3PZNA 4L9XA 1R7AA 4H3DA 3QZ6A 2WC3A 2NVCA 1K03A 3VD3A 2AQVA 2Z2BA 1JXJA 4V27A 2ISFA 3AOFA 4HNTA 4QG8A 4B9ZA 2GJRA 3WYZA 1F7BA 4KWVA 1VBRA 4UMBA 4CLMA 2BZNA 4MB3A 2WM0A 2ATMA 2XZ7A 3SGUA 1W1TA 2GZXA 2RUSA 2WP6A 1MW2A 1BWKA 3DZ1A 4JTKA 4AIEA 3G8RA 4AZGA 4UTMA 3LXCA 4C6CA 3A21A 4B92A 4UFKA 2WNZA 3USBA 3B06A 2UY4A 4XAPA 5D33A 2VEIA 4HA4A 4QTGA 1HKIA 1MWOA 3UYCA 4DWDA 1GV4A 5K3VA 2WCSA 2EBNA 4U4MA 4ORMA 1H63A 1GWJA 1TPUA 4MTVA 1VIZA 3CLMA 2VNCA 1PB0A 2RDTA 4IGMA 3STCA 3W6MA 3UNDA 3IVUA 1LL7A 4J2PA 3S5YA 4GUGA 2QXWA 3H2AA 4RZ5A 4GYJA 4KIEA 7ODCA 1RV8A 3T07A 1JI2A 3NL6A 3VE9A 1W1ZA 1M6IA 3JVAA 4MJZA 1ZCCA 4LC6A 3T78A 4ALDA 1EBHA 1FA2A 4QGCA 5HMEA 1AJ0A 2ISDA 4GR1A 1E6XM 1W5NA 2MUCA 3D47A 1E0UA 2XISA 4O19A 2G3MA 4JDYA 1EL3A 5DXYA 2HK0A 3EXSA 3PF3A 2R82A 4HK5A 4AMCA 3CB8A 1SMDA 5BXPA 4TX8A 1IE7C 4DUXA 3ZJ7A 1IQ8A 6TIMA 1T7LA 3ZXWA 2QAEA 3QXBA 2E5BA 3H4KA 2DT2A 4JBRA 1P1XA 2R6OA 4XBSA 3NQGA 4UZUA 3RCNA 4GFIA 2IKGA 2EPLX 4J3VA 3ARUA 4JGDA 1QNVA 2BC1A 3TWBA 4W93A 4Z2JA 3F4NA 3SUSA 3EKLA 5EBKA 1PIIA 5M03A 1A3WA 4PTVA 1BG9A 1K7XA 4IWWA 3SQMA 4H4PA 4ZO9A 3H4WA 4KCWA 3S4TA 2V3EA 4DIAA 3W81A 3NRZB 4QDWA 3VD5A 3S1WA 3VNMA 2V3FA 1JZ2A 2J7HA 4IIDA 4YNGA 2H8XA 4J57A 1EIBA 3O63A 3GDBA 3IEBA 1WDSA 3FXGA 4HK6A 2BVDA 5HNNA 2WPBA 3E9AA 4JN8A 2VKZG 2E4TA 2ZDSA 3LHYA 1EYWA 1ZBKA 4XKYA 1FWCC 1QI4A 5DY2A 4R7JA 1S1RA 1CYGA 1VEPA 4B5WA 3GHSA 3EDDA 1H0GA 4U28A 2Z24A 2J6VA 2CETA 3G3DA 3NZGA 3S1VA 1TSIA 1RBLA 5CH9A 1GREA 2XWEA 3B9EA 4OOUA 3PWGA 1TV2A 1KBLA 1QPNA 1E9ZB 3O1NA 1PTAA 5I77A 4NX0A 1VBJA 3QYSA 5H6HA 3APGA 4RE3A 1MEHA 2DZTA 3TP4A 1S5VA 2D20A 4Q4KA 2O4QA 1KM4A 5C9UA 3WH6A 1G5AA 2PDUA 3RLVA 3AIWA 4P5UA 2XFYA 5D02A 1TG7A 1DBTA 4IH3A 1ZLPA 4GXPA 4JY9A 4O0KA 2PA6A 2WM1A 5CQ1A 4UB9A 3QHNA 3JRKA 4LBUA 5GQBA 1U83A 3DX5A 2Y7FA 3UPMA 3AIBA 1Y8BA 1EJVC 3B9DA 1QWGA 4AZHA 2TPSA 1ZQ5A 3W7JA 4IMCA 3NQCA 4PUNA 1V3IA 3GWQA 4IGNA 3R12A 2OYMA 2ISWA 4JQ9A 3H4XA 1D7YA 2WPFA 2FJKA 2Z6IA 2HSAA 3SRHA 4NJGA 3GDMA 5T26A 4LB4A 2GQ3A 4YPJA 3QYQA 4L6DA 4H83A 3Q4DA 3G1VA 3W87A 5C9RA 1OYBA 2E7FA 3AMKA 2VRQA 1XH0A 1TV8A 2VEMA 4UQEA 1TTPA 3KLLA 3T6CA 3W7CA 2BTMA 3IIOA 5CJNA 4UQDA 3VIKA 5AC8A 4DN1A 4N9BA 2VOMA 2QCFA 1XSKA 3PFRA 5CC7A 3NEHA 2FH8A 2WHLA 3G3MA 2J77A 5H1WA 4XIMA 2WP5A 1XLBA 4I8YA 1EBDA 1KV8A 4ERIA 1LVLA 4F2BA 2VFDA 3CZ8A 3AO0A 3GD3A 4OGZA 1H11A 2XN2A 5DELA 3CMGA 3S5OA 1I2QA 2ZRYA 4C6BA 1S2UA 1ZCOA 4RV3A 5LA1A 5EMKA 5IHRA 3VOJA 4LGXA 4YXGA 3GD4A 1OQFA 1IT0A 1IEWA 4REQA 1JNDA 1TV4A 1J2WA 1BVNP 2B7QA 5BWAA 2FVKA 3RF9A 1ICSA 1PBGA 2CBJA 2V5KA 4DRSA 3VD9A 4WF7A 5LXEA 4L4PA 3SJ3A 3LI0A 4GCXA 3C52A 5ABTA 3UG3A 1GQJA 2X2GA 4FF5A 1JR1A 1OX4A 4Q4RA 3E2VA 3O06A 4JAWA 3R10A 2WHMA 3KOWA 4ZMGA 1TUXA 3WH9A 1CWYA 3HO8A 3ZLFA 4MIMA 5BXRA 2WBKA 4QCFA 1R30A 1NAL1 3A4AA 1H4PA 1M04A 1HGYA 1EOKA 1EWEA 1RJRA 1LT8A 4KKXA 1AZ1A 2F2HA 4D8AA 1HKJA 2J75A 3LYEA 4A3UA 5E9XA 3FJ4A 3ZVHB 4C5YA 3AZRA 5FJIA 4LW7A 2OZ8A 3RNMA 4QSHA 2PDJA 3CXBA 4IHCA 4OZOA 4GNKB 1UQZA 5D2VA 2I1OA 2XN0A 2QUNA 4B4FA 4F9JA 3DKLA 4K6AA 3UVIA 2BODX 5EBUA 4D9PA 4JDRA 4YTRA 4MWAA 3PTQA 5E70A 4NZ3A 3W7HA 1O5QA 4CNOA 2VGGA 3WQ8A 3VIHA 2POTA 1F3PA 4UFLA 2FB3A 1O5KA 2XGZA 3CL6A 4JTCA 5LNUA 1XLCA 1BYBA 1J93A 3W7QA 3OA3A 4EK7A 1OHLA 1GVQA 3I7RA 1UG6A 1ITUA 4YYFA 1M7OA 2IMRA 1RR2A 4FF7A 1CLKA 1B5TA 2GDUA 3BARA 4I7VA 2A3BA 1CPUA 1CXHA 1GOIA 2V68A 1IXPA 2E8YA 3B3DA 3A24A 4UBPC 4C91A 4O0QA 4ZTYA 4O4VA 3R8HA 3WENA 5LNSA 4FLOA 1V77A 4GVIA 1ISWA 1NIUA 1JUEA 1LG2A 3GS6A 4ZQPA 2E8ZA 2R1LA 3OU8A 2G96A 3LBCA 3UJEA 2WCAA 3GFZA 4XWUA 1H09A 3CMFA 2CLLA 4ZENA 2DUZA 5JQ9A 3KRSA 3CIWA 4CGTA 3UG5A 4IQJA 1JPDX 1UUOA 2ZRXA 4AZ5A 1YE4A 4JFVA 4IT1A 1TPVA 4K1GA 1V3JA 2HBXA 5JBEA 2PRHA 2QPSA 4WKFA 2X1UA 1V7YA 5JRBA 2W3ZA 1VS1A 3FVDA 1C8YA 2GSJA 2J88A 3RILA 1YXCA 3GSMA 3TYZA 2JEPA 4NEVA 1B54A 2VVSA 4DF2A 1MW3A 4ZTXA 3TQKA 2GR2A 3HV9A 1UUMA 4ML4A 4DI8A 5KVHA 1H2JA 4FNRA 3VILA 3RHGA 4DNMA 1AZ2A 3EGJA 3CH0A 2VEGA 5CAKA 8XIAA 5T8GA 4XG1A 4PUKA 4L7ZA 1VGAA 4BY3A 3LV6A 1KFEA 1O5XA 3OLDA 2J66A 4ATWA 3TSBA 1R9XA 3NWRA 4CQDA 3EWUA 3WFLA 2ADAA 1CENA 1PX8A 3DJJA 5D09A 1QDSA 4A29A 5F2LA 4JTLA 1BRLA 3FHAA 3O6CA 4IPIA 5BU9A 5K7JA 2YDQA 2JGYA 1BLIA 1Q6RA 1UKPA 4JL2A 2BCPA 4R7OA 3L66A 1XSIA 3GXDA 2GSHA 3DBNA 5K9CA 2J6XA 2YDAA 2JE8A 1HTIA 2RDUA 1V6XA 2OLSA 3VGBA 8RUCA 1R87A 4A3RA 1QVBA 2NUWA 3LZ5A 2GUYA 1KR0A 2NXGA 1K1DA 1S3HA 4EQSA 1YDVA 3M64A 1F07A 1QRQA 4ICMA 4C6NA 3MCNA 2OEKA 4IFRA 1DORA 6REQA 3CIXA 4UOJA 4A8RA 1ICPA 4YN5A 3OIHA 3C2YA 3VTRA 5REQB 3CGBA 1VP5A 4Q22A 1JVNA 3BXWA 4N9CA 3TFCA 1WYGA 4RXFA 4JHMA 1LCOA 3ZVIA 5DX7A 4MGGA 3WLKX 2YYTA 1TE6A 1PX3A 2C91A 4BURA 3T09A 4H4QA 2VRJA 1LF1A 1NJJA 1L2QA 1RA0A 3TN4A 1TWSA 6ENLA 2YL5A 5C7HA 2G4FA 2ZUMA 3TEVA 5E0FA 1OABA 3WLJA 4Z2IA 4XZBA 4NI3A 1XRSA 4PH6A 3GXIA 3B8TA 1RXOB 4LNCA 3DC8A 3ZJ8A 2VP8A 1UR0A 3QEZA 3W2JA 4BHYA 5AYYA 3DAQA 3OLEA 4OHQA 5GJMA 1Z89A 2EXOA 3S1GA 4Q4MA 3GC2A 3B9JB 1UR4A 3IJQA 1OCBA 4DJFC 1FEBA 4YTTA 3VKBA 1PKLA 5U1OA 1BHGA 3A22A 4PODA 2WMJA 1CLXA 2XH4A 3NM3A 2V8ZA 2WZIA 2ZXQA 4XBKA 5M1TA 3H7VA 3L4XA 2ZX7A 4GQBA 2YBUA 1UD5A 2OKOA 1ONEA 3DDMA 4N02A 1M03A 2PWEA 3MSGA 3RK8A 3WQ5A 3LCXA 4R5EA 3WNPA 1VHCA 1TWIA 1WZAA 1X96A 2XH7A 5B80A 3GU9A 4LWWA 5BRPA 1UA3A 4GI8A 3ZWSA 4AZBA 2NV9A 1TPH1 1KRCC 3QH2A 1MXSA 1E0VA 2H9AB 3VINA 5HNRA 4A8NA 1JCYA 3GDLA 4GLEA 3OG2A 2PDGA 3LDVA 2QDDA 4BQ2A 4DJDD 3WF3A 3GR4A 4AC7C 1C8VA 3REQA 2FHFA 3FS2A 1LL4A 5ABFA 1XLEA 2NXHA 1IT7A 5D04C 3W00A 4AZ7A 3JU2A 4E5TA 3TK7A 3AYRA 1MXDA 5A8GA 3ES8A 3A5VA 3F4CA 4O14A 1JCNA 1A4MA 5G1MA 2WKGA 1IXOA 4TQTA 4AZ6A 5DCDA 3GU2A 5BYWA 2V81A 3DESA 3TCSA 1LOQA 2V82A 3TYBA 3GBDA 3RUBL 4MOZA 3VGFA 4Q8WA 3WNNA 4E2OA 2YCJA 2PZ0A 1KM0A 5GPRA 4HZ8A 1PS9A 1XUZA 3TU9A 4S3KA 2FIQA 2QMJA 3ARWA 1GOMA 3WD2A 3WX7A 3HW2A 2Y88A 1MFUA 3R8GA 3EWBX 3RLUA 2NSXA 3E0WA 4FS9A 3W0KA 1OIMA 2CLKA 3P80A 1HP4A 4TX9A 2EG6A 2R1NA 2X42A 3G1XA 2DZAA 1H0IA 5FAGA 2W54A 2EF9A 1I8JA 4MSSA 4IXXA 4C60A 4GXWA 1HKWA 1EX5A 4DBWA 4DYJA 1UYQA 1XYMA 2E9MA 4B3ZA 4IG2A 4NI8A 4PL1A 2YOCA 4MFDA 2OCZA 2W61A 4NEWA 2CZ5A 3KCLA 1Q4WA 2GR1A 1W0MA 2FTYA 1R38A 3MZNA 2XIOA 4QEHA 2XJ7A 3LCFA 2QJMA 4IPNB 3WJXA 3F7JA 3NAVA 5I3JA 2QJGA 2V5BA 1ZBWA 1HL8A 2CESA 3M07A 2ZVIA 4JQAA 3ALFA 2W3RA 1WV2A 2ACRA 2XYLA 4J4KA 4QNWA 2W6RA 5FEPA 4JNMA 4OFCA 4A22A 3H2NA 1DXFA 3ES7A 5KETA 5CPOA 2EJAA 4YWOA 1HKMA 4AVOA 4Y9PA 4U2ZA 4GUIA 1QFEA 4IMDA 3KVKA 1RQBA 4INFA 1QPRA 3IUHA 3UQNA 2OO6A 4HKPA 2HWGA 4JZ5A 3TDFA 4QLJA 2WPCA 3S2CA 3BO9A 3GH7A 3ATZA 5I3HA 1GVIA 3NZRA 2OLHA 1DJZA 4DEFA 3QGKC 2YZ5A 3LY0A 2YZRA 4XISA 4RL3A 3SW6A 4CU8A 1SJDA 5EMJA 2VOTA 4RE0A 2ZZ2A 5FIPA 2I56A 3MC5A 1DVJA 3UZZA 5TR3A 4J2MA 4I7UA 3VIMA 4EACA 3MPGA 2E68A 4Z42C 3OGRA 3GHRA 4RZBA 9XIAA 3PZIA 1T5AA 1E3ZA 3NDYA 1I2NA 3ZS4A 1UB3A 3U5YA 4UFJA 3WQEA 4FA3A 3W29A 3MO4A 4TX6A 3IGSA 1HJXA 1J01A 1XINA 4WLCA 4EPEC 3NA8A 3B0YA 4MNKA 3TLLA 3AMDA 5A3HA 3CEPA 4I9JA 4FALA 3W7GA 3CXOA 4O12A 3WQ4A 3CV6A 3EDFA 4G1KA 7ENLA 3QKZA 4AW7A 4PB3A 4DZ5A 5DRIA 4B90A 1GPWA 1PX4A 2PC4A 1OFEA 2Q8XA 4NU7A 3SCNA 1XIBA 1QW8A 4HOWA 2PGRA 1AFSA 3DGZA 2OEJA 4FOUA 2PDYA 1X8FA 1FWHC 1E6NA 2IXUA 4GMEA 1RY0A 4AXNA 2FZNA 4FB7A 4Z1YA 3UCDA 4LUTB 3O3RA 4BQ5A 3L5AA 4RDVA 4XSMA 3WCZA 1ZMCA 1S39A 2Z2UA 4UTFA 4L1WA 4GYPA 3UA3A 1DXIA 2ZVRA 4P7NA 3S46A 4U2YA 3C8NA 2BG5A 3RR4A 3T2QA 1UMLA 1JEZA 3QSRA 3ZO9A 4YTQA 5C2XA 2D2GA 1XYAA 5HUOA 3U4FA 5A8NA 4QS6A 1VFHA 3TYEA 3PN8A 3BL3A 5D9PA 2ESCA 2HE5A 1WXJA 3B9OA 1ITCA 2PDCA 1TJRA 4H41A 4OJYA 4DNAA 4HU3A 4ROQA 4S3EA 2ZBTA 4S39A 3N9KA 1XM3A 3B8SA 3P62A 2DZWA 4R27A 1ALDA 2ZDRA 1FP9A 3NGFA 3LOTA 4C5ZA 1BAGA 3KTCA 1PTGA 5CLTA 2E6FA 4JTSA 2FMOA 3VNKA 5HPCA 2JQXA 3M0LA 4CQAA 4US5D 4EOUA 5HULA 4DYEA 3I10A 2WPEA 5FJTA 4Z08A 1R3RA 2G8ZA 2WWCA 2CLEA 4CN6A 2PB1A 5EMMA 2GWGA 1XLKA 4KWSA 1N5WC 4IPPA 2Z27A 2H8ZA 4UFMA 4IMAA 3TJLA 4PYSA 3TXVA 4HBKA 4IJCA 5LNVA 2OWCA 4C6MA 2A3HA 3VPLA 3W1MA 3QZEA 4HNCA 3B9NA 3VZYA 3T55A 1KCZA 1M41A 3U9IA 1TA3B 4NUWA 4RE4A 4P2VA 5EA9A 3P82A 3EMQA 3W6YA 4AY8A 1WZKA 1PUDA 2PI6A 3CQKA 1N60C 1XLLA 1X98A 4HA0A 5C71A 3ZM8A 3HPFA 4CNPA 3EZ4A 4LYRA 4KMQA 4CNSA 4LH8A 4UNIA 1Y5WA 3O05A 1BFNA 2JEQA 2Y6ZA 2E40A 2PDXA 2J25A 2FZMA 1QI2A 4JHOA 1M53A 2F6UA 3L67A 4AZCB 4ZZ9A 3II4A 4JIPA 5HWJA 4B2DD 5I24A 2JBMA 3OG3A 1O5RA 4AF0B 4F0HA 3V4BA 3EXRA 1GOOA 1LT7A 2X16A 2VYOA 4FHAA 5CKSA 3HJZA 1D3HA 4MKSA 3T05A 2OG9A 1YXYA 3LM3A 3TJIA 1AH3A 1TELA 4NASA 4D6DA 5HDRA 1LQAA 4LYKA 1ZDLA 2Y63A 1ECEA 4JFTA 4RLIA 2WC7A 3UJRA 2PP3A 1E51A 2X0YA 1EB3A 1AQ0A 5HQEA 2E0PA 4C7DA 4AD5A 4AEOA 3ZR5A 1EBGA 1V51A 2V69A 2XIQA 3I3DA 4LU0A 3W76A 1GQKA 4YVPA 4O1BA 1B4EA 1UJQA 1LYXA 1PZ3A 1SJBA 2QGHA 5C2GA 4P7RA 3IIVA 2P8BA 4UR8A 4X60A 3HQ1A 3V5OA 2G37A 1AL7A 1J12A 4O15A 2OSXA 1V6TA 4C6DA 5AB3A 3CGDA 1LP6A 3C0SA 1E1CB 3B4UA 3RPDA 1R47A 3TTQA 4Y8EA 2OSYA 3TTEA 3NVWB 3KZPA 4OBRA 2D1ZA 2QW5A 1PXGA 2FLIA 4B9YA 3EA2A 4CNNA 4U10A 3FNDA 3SGGA 4PMVA 4E8CA 1T40A 5B7YA 1TCDA 4UFHA 3GTIA 4IP4A 1KRBC 1XHGA 1XX1A 3PHAA 1PWLA 3NQ6A 4D8LA 5CZSA 2WOVA 4GFSA 3MUAA 3ARPA 5M5DA 1QNOA 3LBMA 1A49A 3L65A 1W31A 3VNYA 1GYMA 4G2DA 2PFHA 5MHBA 2ZUWA 3BE7A 1J5TA 2Z1BA 4HD5A 2Y2WA 4E8DA 1FQ0A 3TV8A 2IPWA 2A7PA 3KBWA 2QQ6A 4QHRA 4PMRA 3QY6A 1HL9A 2WHJA 4XZLX 3L4YA 5JCIA 1H51A 4YHGA 5CSSA 5HMDA 4DWSC 3AUJA 2NT0A 3U6WA 3ZIZA 1XGDA 4JTQA 3ZLHA 1JCXA 2A0NA 1P6BA 2DUXA 4GQ0A 4N4QA 1ZTVA 4YWIA 2E5AA 1EGVA 2NX9A 3BGAA 1K9TA 1Q8JA 4D6HA 4NIRA 1O12A 2ODOA 4GGHA 3RX4A 1FCVA 3GHTA 3PBGA 1UWUA 2WZTA 1V08A 3L2IA 3C6CA 1XCXA 3RITA 3AXMA 2GQWA 2CZVA 5A2BA 3BC9A 3SY5A 2O9TA 4N4PA 5I00A 4LVFA 1F73A 3FYYA 1RALA 5D05A 3GNNA 1LUCA 4M5PA 2TAAA 4WKAA 1FWIC 2F5ZA 2EPHA 4KW2A 1H3GA 1AD1A 4W8AA 3SGZA 2ZICA 1QR7A 2QUMA 2V30A 3SIMA 4GPNA 3LHWA 2ALRA 3R43A 4RR4A 1UD6A 3VNIA 1P43A 1WX0A 3T0BA 3EOUA 3ID7A 3QTGA 2J7DA 3VGHA 2V3BA 3WLQA 3LXBA 1TFVA 4AF0A 4QE4A 4F0MA 3WD4A 4UTTC 2E9LA 4WJ8A 3DCPA 3IIXA 5TNVA 4GZEA 1KFCA 2Q3OA 2Y0FA 1Z44A 3MSRA 4GABA 5DFAA 3KLKA 4HPJA 2PD5A 4NAEB 3PB2A 5BMXA 3TLQA 2ZRZA 2DEPA 2GGIA 3LHZA 3Q6JA 1B90A 4HZ6A 4C6PA 3QQ1A 1GEHA 3WQPA 1QNSA 2QCDB 4NYUA 2W91A 3SCSA 5H8MA 1O66A 4AH7A 2BOFX 3KL3A 1EDTA 4FMVA 2YBTA 3D3AA 3STGA 1K7EA 3M0HA 3VUSA 2PDIA 1UKOA 4MY1A 4GI6A 3ITVA 3GDRA 1L6SA 1HT6A 2R14A 3DHDA 4LS1A 2BVYA 4XAYA 5K9XA 1PHQA 5C0QA 3W53A 7REQA 1WDPA 4RNJA 4H9MA 1J0ZA 1CLVA 4XD6A 2VMFA 3ABQA 3HV8A 3L68A 3BW3A 2FPVA 3UWZA 3V1PA 2KZHA 3OJGA 3WQOA 3FSUA 4MHBA 4L64A 1G67A 4KF1A 5LA0A 3G1RA 1W9PA 3TTOA 4PN2A 1SQ7A 1LLZA 4B5XA 3IJ6A 2QJHA 3XISA 5F4SA 1SZNA 1J6PA 1CCWB 4A2SA 5LXXA 4K7YA 2C0HA 2CLIA 1E4IA 1SZEA 1TPFA 4HMCA 4HN8A 1KV5A 2YB4A 4X0VA 5BMWA 1GNXA 2XM1A 1B3ZA 3T4CA 5GNYA 3WH8A 2PTWA 1WAUA 1C92A 3GQYA 1K9FA 1BTCA 4ILSA 1P6WA 4FNPA 5AYIA 1SMAA 4WDXA 2PLCA 1WOBA 3HQNA 1L6GA 3J7HA 1DHKA 4J7RA 2A1YA 1LBMA 1FHVA 5J5DA 4ENLA 3L0NA 2ZX8A 2Y4SA 1FWDC 1ZS2A 1F74A 3W1PA 2ABAA 4QAIA 1CXFA 2VM8A 3ZT6A 3CEUA 4NZ1A 4F0KA 3GXTA 1EC8A 1OF8A 4N0RA 3KWSA 3B8IA 5A95A 2HRWA 3AXHA 2AMGA 3QN3A 5HBFA 2AKMA 2YSWA 3FK4A 3QF0A 3IRSA 2G4JA 4H8UA 1FH8A 2VEFA 4W86A 1W9UA 4FLRA 3NVVB 3QQWA 4V28A 1F9CA 2J7BA 5E0KA 4M56A 2ON3A 2X2YA 4KPLA 5A8OA 4DYKA 4MNJA 1RPXA 1Q13A 4ERAA 4JIEA 4WHBA 1AJZA 2OGJA 1FBAA 3W1QA 5I6SA 4GIEA 1UZDA 2ZC1A 1K7FA 2BVTA 3UYIA 3KRZA 4UQ9A 3KFTA 3UZJA 2F6KA 4S3FA 2KX9A 1ZU8A 1O68A 1AQFA 1R9YA 3FEQA 3UEQA 4NAEA 4E2DA 3E0FA 3TFXA 1GOQA 4TVDA 1VPYA 3UF9A 1X6LA 3GNXA 4GACA 3DFNA 3L4WA 2NXIA 1DTNA 2OO0A 2ZX9A 1NHRA 3VNDA 4HZ7A 3BLDA 1P5BA 4NYYA 4PMQA 3TN5A 1FCUA 1XHCA 4AEEA 2TODA 4NXSA 1E0TA 5HMFA 1B3WA 2HK1A 2DPEA 4BEUA 5ER0A 3W27A 4JKKA 4UR7A 3SM0A 3S0CA 2CBUA 4M1RA 3IVTA 4P7QA 3WD1A 4RPPA 1TJPA 4S1FA 4AAJA 5DCBA 4GBDA 4AVFA 1WXYA 3TN6A 3M1ZA 2GSEA 5I78A 1RBOB 4G9PA 1M9HA 3VI2A 2OVLA 3PY2A 2P1FA 3EWYA 3E2SA 3HM7A 5A6TC 3LTSA 3KRBA 4NJJA 5I07A 3AMGA 4HYWA 3LUTA 2MNRA 4BZYA 1YRRA 1JZ4A 2PU1A 4D72A 3WY1A 2G0WA 3QMTA 3G0XA 3IV8A 1J0IA 2VUNA 4C6KA 1BKHA 4ZR8A 4JTTA 4FAMA 1ZJBA 5HJYA 1UIPA 3NVYB 5A6AA 2XIJA 1SFLA 2WJZA 4LUSB 1QHZA 1F76A 2XVPA 5C9ZA 3S8HA 1QOQA 3HGJA 1R2RA 1DEDA 3XIMA 4AVNA 5DBTA 4X9YA 5A6SA 3V0TA 1G4SA 1QI0A 1XH1A 1XANA 1XFBA 3AFBA 1MEIA 2VFHA 2XWDA 1ISVA 2ATSA 2GR0A 3OVGA 3KHJA 3NJ3A 5JCMA 2JK6A 1ZAHA 1T6MA 4A3YA 2GQ8A 3IAPA 1V4YA 4XZWA 3CTLA 3UVAA 2HPIA 1TPDA 2P3ZA 2WMKA 4QG6A 4LUJA 3KOXA 1TYTA 1JQVA 4GQGA 3W24A 4O54A 2W3SA 3GHUA 1DWHM 4B5TA 3OYZA 5DMNA 1DJHA 5G4WA 3UESA 2HVNA 4H8NA 1A80A 3SRDA 4N6FA 4QM1A 5KVIA 2X1IA 4ZOBA 5JU6A 2QCGA 1TMLA 3IRDA 3VCRA 2PWUA 1MUCA 2WSRA 2YVFA 3Q45A 1C3FA 2QAPA 1XDMA 1Q7ZA 3AIQA 2IW0A 1K6AA 2V5LA 2PWGA 1EJWC 3RRAA 4GVHA 5I09A 4JFUA 3WIJA 1QATA 2A85A 3GNRA 3N1AA 5KZDA 6XIMA 1YQZA 1RJPA 1EA9C 2OQLA 1UWSA 2O7QA 3EKZA 3SCTA 1KBKA 3VABA 2Y24A 3S9ZA 3AIRA 1R3WA 4WJEA 3ARTA 3ZSTA 3GAYA 1SUXA 2ZADA 4DJED 2NVAA 1K4HA 1BQCA 3IJ8A 3GG7A 4Y9MA 3VIJA 5M2FX 3A13A 3O8AA 4JX6A 2VFIA 4IUOA 1U33A 3CHCA 3AICA 3INPA 1R2TA 4YCOA 3G5EA 2E28A 4MUZA 4NILA 3OGSA 4KCTA 3VA8A 5G1TA 4UOZA 3SI9A 4XIAA 3LGEA 3W7IA 1UBSA 3I65A 2BX7A 1GYNA 2J7CA 4OQVA 1A5SA 1W1YA 2AL2A 1CGTA 1XUUA 3T81A 1TIWA 3ZR6A 4K8GA 3WLOA 1RQHA 4CD5A 3F1QA 4NJIA 4FSAA 5F4WA 1KGXA 3TJXA 2CHNA 2FDMA 5HUPA 1I2OA 4JEQA 1LBLA 4LALA 3A7UA 2W79A 4QS5A 3QC0A 3HPAA 3TIMA 2WPGA 3QZAA 1G7UA 4I9TA 3S6OA 4DJDA 1YTDA 2EJ1A 3B8VA 2OZ0A 4MUPA 1V0NA 2JGQA 4M0XA 1X6NA 3QY7A 5FKYA 3PWIA 1P0EA 3PTMA 1VLWA 4MDPA 1GXFA 3HRDC 5CZTA 2PCEA 4A6GA 1UIOA 4NG3A 4IIFA 1N63C 3U0HA 4S3AA 3KBSA 3FDKA 1J6OA 3BOXA 3O6YX 2PTYA 1HG3A 1KGUA 4RK8A 3SFWA 2HS6A 4BK9A 1R86A 1DP0A 3KP1A 2ZX6A 2YCIX 1G01A 4PRRA 5C2CA 2ZTKA 1TVNA 2YJQA 5A8MA 5G2HA 3EANA 2OYKA 2JKPA 4QSFA 3EAOA 2WMIA 3DOPA 1DWJM 3M5YA 3SZ8A 3VX1A 5A8QA 5MKGB 1EJSC 5CGQA 3QMSA 3R1ZA 3WSUA 3WEOA 3MUIA 3RLHA 3LGDA 3W7PA 5H8PA 1F4HA 1I60A 2NW0A 4C90A 2FVLA 1TTQA 2Y7DA 2DVUA 5CC3A 4P8VA 3B8WA 3S6DA 3E49A 4HVXA 3MCOA 3UR5A 3IC9A 3OZOA 1VYPX 2X1SA 1T99A 3CGEA 1MOKA 2O7SA 2VCBA 5U4NA 2R9RA 3IAQA 1Q2RA 3B40A 2Q3RA 4TOQA 1B3YA 2CERA 2A79A 3NDZA 1FWRA 3R2GA 2C14A 2ACQA 4GKTA 2QCNA 3BG5A 1OG6A 1FFQA 3WDJA 3C61A 1O7AA 3A3HA 1JG9A 3P84A 1N82A 5F4XA 3MHFA 3A4XA 1GCYA 1H7OA 1B3OA 2GVEA 2W5FA 4UQAA 4LSBA 1JCMP 3PVFA 3WDPP 2P0OA 4K8HA 3V5FA 4IM4A 1VFUA 1CGYA 3LHTA 1O60A 1ZBVA 3URNA 9CGTA 1CX9A 5IDZA 4I5RA 3M0IA 3L21A 1V6UA 3AN1A 4MWAD 1KFKA 3K46A 3G6MA 3M7SA 4JQ3A 1JPIA 2PDMA 1FOBA 4OOZA 4IP7A 2GFTA 4UXDA 3TCEA 1TVPA 2YLAA 4HJFA 4Q4PA 1VC4A 3LQLA 2O92A 4H2HA 3ZMRA 4XAFA 1JRBA 2DT1A 3UERA 4AYGA 2EQ6A 3NVZB 3DJGX 3OVPA 1GJPA 6TAAA 3HGRA 3UW6A 1X1ZA 3SQPA 2Z1WA 3CMJA 1UOZA 4Q7BA 1EUAA 2F61A 1THFD 4QBXA 1WQ5A 4AC1X 1UR2A 1YNYA 2BY1A 1EFZA 3RG6A 3WDHA 1CW2A 1J79A 2FGBA 2HROA 1VCGA 1OF6A 2V3GA 3GXMA 5EB8A 3E12A 1MNSA 3UT0A 2C71A 3VNLA 3S5SA 5HQMA 4Y9AA 4LNYA 1CBGA 5G5IA 1U30A 4IP5A 4LV4A 3GR8A 1OT1A 3A6OA 4GNJA 4D6EA 3CTTA 3UJFA 1PKNA 2I5QA 4GRTA 5I06A 1EO7A 3OHMB 4ZO7A 4Q8MA 4W5UA 3PSVA 4I9AA 4GX9A 2BBFA 2YIHA 3MY9A 4PBFA 1OCJA 5FESA 1HVQA 3P8IA 2FHBA 1OGBA 3LERA 2REQB 2YXXA 1LROA 1UC4A 2QF7A 1X1OA 3CZLA 2VDIA 3GDKA 3N2OA 3LA4A 5FJUA 5D38A 4Z2KA 3C2FA 1CB7B 3SCVA 3DC0A 2W92A 1YNPA 1FWBC 3TC6A 4CCCA 1E6SM 5HWMA 2P0IA 4LQ1A 3KM8A 3NFUA 4LVBA 4KEUA 1KRMA 4ES4A 3I4EA 1OFRA 1B1YA 4C1NA 4GE8A 4PFMA 1ZJAA 4EANA 2A2IA 1VKFA 4EMIA 2B7OA 2PGWA 1JFXA 4BCEA 1JDDA 2D0GA 4XKMA 2VGBA 5AYBA 4KBXA 3W74A 2B81A 2WZEA 4B5VA 1XIJA 1ODUA 4B4HA 1UD8A 3BGGA 5BOFA 3SUWA 3TR9A 5AVHA 3P2VA 3VGEA