1DTNA

Mandelate racemase mutant d270n co-crystallized with (s)-atrolactate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
357
structure length
357
Chain Sequence
EVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALKSLKQLLDDMAAMIVNEPLAPVSLEAMLAKRFCLAGYTGLIRMAAAGIDMAAWDALGKVHETPLVKLLGANARPVQAYDSHSLDGVKLATERAVTAAELGFRAVKTKIGYPALDQDLAVVRSIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMFKALSIGACRLAMPDAMKIGGVTGWIRASALAQQFGIPMSSHLFQEISAHLLAATPTAHWLQRLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWREKEIGKYLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the reaction catalyzed by mandelate racemase: importance of electrophilic catalysis by glutamic acid 317.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Racemase
molecule keywords MANDELATE RACEMASE
total genus 132
structure length 357
sequence length 357
ec nomenclature ec 5.1.2.2: Mandelate racemase.
pdb deposition date 1996-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1dtnA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1dtnA01
1ELSA 4E6MA 2HZGA 3KUMA 1JPDX 2QQ6A 4DHGA 3MUCA 4KPLA 3ENLA 3FYYA 3V3WA 2HXTA 1SJBA 1XS2A 3RCYA 4MGGA 4ZCWA 3NXLA 4E4FA 4GGBA 4A6GA 3CT2A 4KT2A 5BOEA 2PGWA 1MRAA 1KCZA 3FJ4A 3TTEA 3SQSA 2QJJA 2FYMA 3JVAA 3GC2A 3FV9A 2PSNA 1NU5A 3TW9A 4MMWA 1TKKA 3V4BA 3PFRA 3H70A 1OEPA 3R10A 1JCTA 3TWBA 4H1ZA 3GD6A 2XH4A 3QTPA 2AKZA 2AL1A 5FJPA 2XGZA 3MY9A 3VC6A 1WUEA 1P43A 2PMQA 1KD0A 3OZMA 5FJOA 1KKOA 4IL0A 4J3ZA 2P0IA 2XH2A 3DIPA 4HPNA 3VCNA 3BOXA 3FCPA 2QDDA 3FXGA 3T8QA 3OPSA 2PS2A 4GYPA 3PK7A 1MUCA 3BJSA 3V5CA 1SJDA 2DW6A 3R11A 2GGGA 3S5SA 4DN1A 3H12A 3ZLGA 3VDGA 3RITA 3R1ZA 4K1WA 4FP1A 4G8TA 4GYPC 3SBFA 2PCEA 2PGEA 2GGJA 3QPEA 2FKPA 4FI4A 2PTYA 1W6TA 4YWSA 1F9CA 4E8GA 2GL5A 2QGYA 1JPMA 3VFCA 2GGIA 3R0KA 4A3RA 3EKGA 2QJMA 3IJIA 3R25A 3UJRA 5ENLA 3OTRA 3CK5A 2MNRA 4H2HA 4DXKA 2P8CA 3NO1A 3GO2A 4IT1A 4G7FA 3MWCA 3I4KA 2XH7A 2OZ8A 4EWJA 3UJFA 4KEMA 3UJ2A 3S47A 3ZLHA 2ONEA 2PTWA 2OQYA 3UJSA 1ECQA 3ES8A 4J1OA 2OPJA 2QDEA 3QKEA 2P3ZA 4ZA0A 3JZUA 3THUA 4DYEA 3HPFA 3VA8A 2PU1A 1EC8A 1TZZA 4HCDA 2GDQA 3D46A 3MQTA 1SJAA 4HCLA 3NFUA 1WUFA 2ZC8A 4GISA 2PODA 3B97A 3RR1A 3ZVHB 4K2SA 2PP0A 3DESA 3ES7A 3U4FA 6ENLA 1BKHA 2P8BA 3UGVA 2PP3A 2GSHA 3DFHA 4JN7A 1P48A 2PA6A 3TJIA 2GGHA 4DX3A 1MDRA 2POZA 2OFJA 2NQLA 3PWGA 3T9PA 3STPA 4MKSA 3I6EA 2PU0A 4GFIA 2XH0A 4Z17A 1EBGA 3DG7A 3N4EA 3R0UA 3Q45A 3DERA 4HNCA 3UXLA 1EBHA 2OKTA 3UJEA 2OQHA 3IJQA 2I5QA 2OLAA 3V5FA 1FHVA 2DW7A 4IHCA 2HXUA 3IJLA 1RVKA 3NZGA 4X2PA 2AL2A 7ENLA 1DTNA 3H8AA 2OVLA 2OO6A 1KKRA 4Z1YA 3RRAA 2QVHA 2PP1A 1SJCA 3FVDA 4IL2A 1EC7A 4F4RA 3SN0A 3SN4A 3N4FA 4GIRA 3UCDA 3K1GA 4H19A 4GMEA 4JHMA 3ZVIA 2O56A 4HCHA 2P88A 2MUCA 3JW7A 1BQGA 5BOFA 3CYJA 5FJRA 3ZVHA 4HN8A 3RGTA 3PWIA 4E4UA 4K8GA 4HYRA 3TQPA 1PDZA 3IK4A 3TOYA 3SN1A 1R6WA 2QJNA 2AKMA 3MZNA 4E5TA 3UCCA 3P93A 3DEQA 2HNEA 5FJUA 2AL2B 1MDLA 4H83A 2PTZA 3BSMA 2OX4A 3MSYA 3OZYA 4ROPA 3EEZA 2RDXA 3DG3A 3DFYA 1ONEA 1EC9A 3Q4DA 1NELA 1E9IA 2GGEA 3QLDA 3DDMA 3N6HA 3SJNA 4ENLA 3TCSA 3P0WA 1TE6A 4JN8A 3RO6A 5J04A 3ZLFA 3T6CA 3GY1A 1IYXA 4A35A 3SSZA 2CHRA 4IZGA 1MNSA 3DGBA 1JDFA 3TWAA 4IP5A 5EU9A 3CXOA 3VC5A 3QN3A 2ZADA 3T4WA 2PTXA 2XSXA 4KWSA 3CAWA 4DWDA 2OZTA 4M0XA 3CB3A 3TJ4A 3DG6A 3D47A 2OZ3A 3OP2A 4HNLA 3VCCA 4M6UA 1L8PA 3U9IA 3N6JA 3OW1A 3H7VA 1XPYA 3UXKA 1PDYA 3MKCA 5IDZA 4IP4A 1R0MA 3P3BA 1FHUA 1YEYA 3I6TA 2OG9A 4GGHA 5FJTA 2PPGA
chains in the Genus database with same CATH superfamily
4MY8A 4NNCA 5HUPA 1F4AA 4AWSA 4UB9A 2PDWA 4TVDA 4NJHA 3WNOA 3ARTA 3R07C 3F4VA 4ZCWA 1EX1A 2P53A 2OSYA 1EGVA 4FA3A 3PBUA 4N4PA 3NTYA 3MYOA 1QPRA 1NM9A 1KRMA 3L5AA 3PZ9A 2GUYA 4MJ2A 1JAEA 3B9OA 2F9RA 4RDYA 1A5AA 2QHAA 4FALA 1CPUA 2W3SA 3FV9A 3P5ZA 1VLIA 5I00A 2X09A 5I79A 3CWOX 4IPJA 1VLWA 2J6VA 1OIMA 4MDOA 1CCWB 1TPDA 3GNNA 1PEZA 3GD4A 1VCVA 3R10A 2I56A 5F7UA 4ZQOA 4HTBA 4LVBA 1XG4A 2O4QA 1I45A 3II4A 2G96A 3CV7A 3LERA 1W1IE 4YTTA 1C29A 4ADTA 2QJHA 1S2UA 3LYEA 3QGAC 4M51A 4LYQA 4PUKA 1F7BA 1LOQA 1TV8A 4LTSA 1ICSA 4JQAA 1EP1A 3C0QA 3K13A 4RNFA 1ZQ5A 1UZ4A 2PD9A 2Q09A 4AY7A 3GRSA 3QZ6A 5C6MA 3NIYA 3PBGA 3E2QA 3PPFA 2WKJA 4F8XA 1RSCA 4QFUA 2Z1BA 1K03A 3LNMA 3QHOA 2DSZA 3VDCA 2OB3A 2JALA 4WY0B 5HOSA 1ZB5A 2BNJA 1OSEA 3ZLGA 3QM3A 1J93A 3S2CA 2QCCA 1UA3A 3WLIA 3GR7A 1UD4A 3AI0A 4QS5A 1AQ0A 3WIJA 1ISWA 4DXXA 3R0DA 2WJEA 3D3FA 3KTCA 1EPVA 1MUMA 1NP0A 3ITVA 3PFMA 2J24A 1B9BA 1XQKA 5DQPA 1IEWA 1RBLA 1HXJA 3EKGA 4O50A 4RE0A 1DJHA 3STCA 3KOXA 4G7EB 2UY3A 3UW6A 2QLYA 5A8PA 4FX7A 4JL1A 1R9ZA 4BEQA 2OLHA 3NZPA 4OOUA 2BOGX 2OZ8A 4MB4A 1HKWA 4LVFA 1TSIA 3WENA 1O1ZA 1TQXA 2ONEA 2WPCA 2RFGA 1CXLA 1YMYA 3GX9A 4OUEA 2OQYA 1YNYA 2DIKA 5C7HA 3AMLA 1VYPX 1PBGA 2QDEA 1DIEA 3QKEA 2ZX9A 3VD9A 4W84A 3V5OA 1WV2A 1F3PA 2UY5A 3KRUA 4Q6XA 4TO8A 1E5JA 3S46A 3SB0A 2WSQA 3NPUA 2JKEA 3CV1A 4ZOAA 2ACRA 1E73M 4LYPA 5K7JA 3AROA 2WPGA 4B9YA 2PP0A 3AIUA 3MJYA 2Y8KA 2CLKA 3UGVA 3BSGA 1XLBA 1FWTA 4AIEA 3Q37A 2E40A 4XAZA 3A4JA 3H22A 4DJEC 2POZA 3ZZ1A 3T9PA 4KWVA 4UFHA 4XVEA 3BGAA 1XDLA 3TQVA 5E5CA 5DO8A 1SMAA 3KWSA 1TYTA 2ZFAA 2WC7A 4J28A 4JTHA 1HKKA 3MW7A 3PPCA 4XK2A 2C8NA 2VD8A 2QS8A 3W1RA 1OG6A 2BVWA 4HOWA 2HMCA 4TX9A 3WELA 4A3QA 3DN5A 3IJLA 4NI3A 4QQ3A 3R12A 1WZMA 2EEXA 1IGSA 3ITGA 1E6PA 1W1B1 3EPOA 2NVDA 4HU0A 3CIWA 3IJ7A 3RJYA 4Y9AA 2GOKA 2RABA 2PWHA 3IGUA 3HG5A 3SN0A 2YX0A 2J8FA 1LTDA 2WHJA 4RJEA 3UR7A 1T40A 4HA1A 5DCBA 3LD5A 3QV7A 1JZ6A 1K4GA 2GLKA 3URAA 3GUWA 1LRTA 3ECQA 3VDAA 4IMAA 3ZMRA 2YFOA 1M7JA 1OC6A 4LH8A 4DJFD 4FS9A 3GRIA 2IKJA 3DI1A 4B4FA 1H5VA 3EOSA 5FCZA 1M41A 1W0MA 2RDXA 2V0TA 4MNKA 3FNDA 1DOSA 2GGEA 2X40A 1Z44A 3VABA 3DDMA 4OUIA 1V97A 2FPYA 3DKJA 3MMDA 3H2NA 5A69A 4NQ1A 3FYOA 5ECUA 1CENA 4ZB5A 1GZJA 1YBQA 2WO5A 1C8VA 3RO6A 3CV6A 4OT7A 2C1GA 5DBUA 3T6CA 3TC6A 4J2PA 3T0BA 1C7SA 5CSSA 3LX9A 3FK4A 2C16A 3EA3A 4F9DA 3QPYA 1E70M 1OFRA 1XLJA 2WC3A 3UXDA 4W86A 4FEZA 4GQQA 4XBKA 1CXKA 3LDVA 3TYUA 2VEPA 1Q7ZA 4YL2A 3WQEA 3CQ0A 3TJ4A 1SSGA 3PNUA 3D47A 2EPMX 2PDKA 1DYSA 1FWGC 4W9TA 2YA0A 3DHDA 1XD1A 4Y7EA 4QR6A 3CGTA 1O5RA 2O9RA 4IFOA 3PC0A 3AXHA 3QR0A 1JPHA 4ILSA 3L23A 1EIXA 5D8WA 3C8FA 1SR0A 4AMCA 4IGMA 5JH1A 3G3DA 1J79A 1ZBKA 2DUXA 1UH3A 4H4RA 2V81A 3ATZA 4GGHA 2VEKA 2PWGA 1Y7VA 5AFDA 4F48A 5T8GA 4JFVA 4NJGA 1PS9A 5REQA 3VUPA 3HPZA 4TVUA 3CQKA 2HZGA 5CPQA 4CLMA 2J25A 4POCA 4GUHA 4PTDA 2BVDA 5C0QA 1W9VA 4HSNA 5LXXA 1LP6A 4E4FA 4R53A 2VVNA 5BOEA 4WQ6A 4GFSA 1XUUA 1KLZA 1OY0A 1HJSA 1QOXA 1V93A 1ODZA 1ZJAA 4CU7A 1SU5A 3SRHA 2GSJA 4X2RA 5G2WA 3W2LA 4I7WA 3BPWA 3SAZA 2C91A 2CEQA 2W54A 2XSAA 1XSKA 3N73A 1EZ2A 4IMDA 4JIHA 1FCVA 1OCJA 2BY0A 4HB7A 4PL1A 1PWMA 1EDQA 1UMLA 5FL1A 2WOVA 1PIIA 1KRCC 3DC8A 2OQLA 3GHTA 3E2RA 2V30A 2OGJA 3GXIA 2NQJA 3E2SA 1FXPA 3DC0A 4PMXA 1WUEA 1Q1WA 1UPPA 1VBUA 1F3WA 2NV1A 1JNDA 4GYJA 4HPNA 2WBGA 2QEZA 3LQLA 3ANUA 1BWVA 1XYBA 4WJXA 3FXGA 4NG3A 1R38A 5DXYA 2JF7A 4XZHA 2WKGA 1G4SA 4Q4SA 1KLYA 4H6EA 4JTDA 4IIEA 2OKOA 2WQDA 1Z7AA 3WJXA 2GGGA 3THAA 2V6AA 3IUHA 4QE4A 5F1VA 3L5OA 3DFPA 1KFLA 1ZBCA 3LBOA 1E0UA 1DQUA 2D23A 3AICA 1GTHA 3SGGA 4E3TA 4JYDA 4FI4A 2IQ0A 3TTYA 3RLHA 3TYCA 4Q8OA 2O9TA 1VYSX 4GZEA 1F9CA 4GBUA 3W3OA 3NQBA 2I9EA 2GL5A 4UUIA 1CGYA 1GRAA 2DIEA 1CLXA 1VFLA 3DYMA 1GERA 2WOQA 2QJMA 2DZVA 2WWCA 3UA3A 3BCFA 3R25A 1L6YA 1EOMA 4NJJA 5CPMA 1VCFA 3ZSSA 2ZZCA 4U3CA 2F8QA 3IWPA 5AN7A 4C6PA 4L1GA 4R5EA 5C2CA 4FX8A 4N7QA 3MP4A 5AHMA 2CCRA 1NQKA 1UIOA 3C52A 2RDUA 1W5QA 3SRKA 4WDUA 1QXLA 2RJHA 3A3HA 4WDXA 1S39A 2HQAA 3EWXA 4HZ6A 1J4EA 3G1DA 1AQHA 1MVYA 1E6XM 2ABAA 4N42A 2PLKA 4DM2A 3ZT5A 3APTA 2PWFA 4M24A 1TV2A 1DQXA 4MF4A 3NURA 3CUHA 1PWLA 2NQ9A 1OYCA 1MEIA 1ICPA 3ARZA 2D2HA 1H4PA 4GVGA 1HF6A 3O2LA 3WQCA 3SZ8A 4JN7A 3KE0A 2DJXA 4MZ8A 3LI1A 3W2MA 2G50A 4GD0A 4L4MA 2PLJA 4Q6JA 2XFWA 1P7TB 4H4XA 3MO7A 4KFNA 4J2MA 1H7XA 4JEQA 4HK6A 3W7QA 1ONFA 3STPA 4MJ4A 3GBEA 3NUKA 4IH3A 4W7WA 3GHRA 1KFWA 1KO0A 1VIZA 1XYMA 3STFA 2ZE0A 1PCWA 2E6YA 4EPBC 4IJCA 2OKTA 4ZXLA 3DH7A 1B0IA 4I9MA 2VP8A 3V5FA 2ZX7A 5XIAA 1WZKA 2HXUA 4Y2WA 2EHHA 2ISSA 3ARSA 1DJGA 4GCXA 4UTUA 3C61A 1RCXB 2QVHA 1Y5WA 2VHLA 1R86A 2PDPA 4FB7A 1TRDA 3BLIA 5D37A 1TV4A 2ZRUA 2ZZ7A 2C7FA 4TTUA 2O56A 1UWTA 1I0DA 4C6KA 5C2XA 1GNXA 4DBWA 2OEMA 1AW1A 1P6WA 4P2VA 3URBA 3SR6B 4E2OA 4XAYA 1WYGA 3CASA 3F03K 1Z9AA 2D22A 2FHFA 3W23A 3P8IA 3NQ2A 4BF9A 3SQPA 2A4AA 3AS0A 2H6RA 4HU8A 3LTPA 4XSMA 2VUYA 3GNOA 1D8WA 4E5TA 3UCCA 4AVNA 2WXDM 2YVJA 3AZSA 3W07A 4HNVA 5M03A 3SEPA 3K30A 4H00A 1IR2A 2V2HA 3TAKA 1V6UA 4FLSA 1EJRC 1BHGA 2G41A 3A9BA 3WBYA 4NNBA 4OIFA 4FSAA 3NSXA 3RPMA 4YYCA 3LLDA 1GKRA 4FK9A 5C9XA 2NX3A 1O7AA 4BF5A 4J3SA 1O94A 2QZRA 1VCGA 1V4YA 4BI6A 4C6BA 2AQWA 4DNMA 4F2BA 3BOLA 2DV0A 2A3EA 3DGBA 3B05A 1B57A 5EU9A 5FAJA 3SECA 3C2OA 5DRCA 2V82A 2FJUB 3QN3A 5CG0A 3W01A 3LUTA 2BLEA 3Q6JA 1POKA 2I16A 2QCFA 1J6PA 4NI8A 4RPPA 1SFTA 2V8ZA 1OQFA 1GYNA 3FJ6A 1EWEA 3VCCA 4YCPA 2G3FA 2WOIA 2HSAA 1NF7A 3SY5A 1GZGA 3U2ZA 1AW2A 3GXDA 4IQJA 1WZLA 5CLWA 1A0EA 1HZYA 1F6YA 3NQDA 3TMQA 2OG9A 3CHEA 4DYKA 1N55A 3U4AA 3TDFA 1BWKA 4JQ2A 2DIJA 1ITUA 2O4MA 4MADA 1UG6A 5CPLA 1B3VA 3NVDA 1GG0A 4KGJA 1K8XA 4KWWA 2HXTA 4PMUA 3WBXA 4EE9A 1YDOA 4XSLA 2F84A 4ZO6A 1W3HA 1Q7MA 3GKFA 2DT3A 2BC1A 1QI2A 1ZCOA 3SCRA 1YRRA 2ZZ5A 1I1WA 1ISYA 1XCWA 2BZNA 4JZ5A 5DMNA 3BG9A 3NSNA 1UP3A 1VFSA 4XZIA 2HRWA 2OSXA 2D2GA 4A21A 1V8EA 3MYPA 4BS0A 1XKJA 5HXMA 5U25A 4ZO9A 3QYQA 3QOMA 4AVOA 4Q8NA 4WVXA 3T05A 4N02A 1EJ7L 3WK2A 6REQB 3EOUA 3MB9A 4MPKA 5K3VA 4D9PA 1SUXA 5FJJA 1S5TA 4BI7A 1H7RA 1ME7A 2QUVA 2EAWA 4YTSA 2D0GA 3QMRA 1ITXA 2PDNA 3VGHA 1EKOA 2QDHA 4JTKA 2NUXA 1GT8A 2V5LA 4O4VA 3GU9A 3WG6A 1J5SA 2PWEA 3LY0A 4FNUA 3P67A 3A6OA 2V2DA 3NQGA 1C9WA 3FKRA 2WP5A 3H12A 1KXQA 4IGNA 3CXBA 3HQPA 3O63A 1R5YA 4JTJA 2VJXA 3W7JA 3CMGA 1JG9A 3OVPA 6PTDA 1LG1A 3QMSA 1GQNA 3L66A 3VOJA 3LS9A 3IUIA 1F05A 2ZICA 1DE5A 3KBNA 7TIMA 3O07A 2WVTA 4CEXC 1J5TA 3E49A 2QGYA 3I7QA 1FOBA 4MG4A 4MTVA 2W79A 3LPFA 3RDKA 3HMCA 2NXGA 3UZZA 5ENLA 1HQTA 4RV8A 3NEHA 4HPXA 1BXCA 1UD5A 2A3HA 2YFNA 4IFRA 3GO2A 1MXDA 3GFZA 3MWCA 3A64A 3GG7A 1GVEA 2XH7A 1QMLA 1CX9A 1W91A 3R4IA 3F5KA 4XZWA 4CCCA 4DJED 1REQB 5JCIA 4O0ZA 4JIQA 2HE5A 2VCBA 1X7FA 3EUB3 3ES8A 1A3WA 2YCKX 4X9SA 1GORA 4N0RA 4M81A 2D0FA 3JZUA 1KXVA 4JTSA 3NM3A 3SCTA 1Q6FA 4D1IA 5FSEC 4ML9A 4DZHA 1ISXA 4FLRA 5HR6A 5BRPA 5D02A 1UASA 1XCFA 3MQTA 4ZO7A 1V3MA 3B97A 3ZVHB 2NVCA 1F61A 3VIHA 3DGZA 1BKHA 4GKTA 2W0HA 3LU2A 1XLAA 4BHYA 1IT0A 2PDYA 5AY7A 2FFIA 3W73A 1MDRA 4NZ3A 3PULA 1ZX9A 4WJ8A 5AZ0A 4UZSA 3WK1A 4DUVA 2EQ7A 1BVWA 5CKSA 3CZGA 4EF8A 4L4OA 3W7NA 1XLFA 2HK1A 3N4EA 3BCDA 1VKFA 3QY6A 3AYRA 4ML4A 4YNGA 1IEIA 1LLZA 3UZXA 3MUZ1 4L56A 1DKWA 5CQ1A 4NF7A 4HPHA 2QCHA 3ONCA 5HPOA 3TMLA 1W5MA 4Y9PA 4X61A 3CHFA 1A5MC 4B2DA 4LY4A 4HIBA 4FNTA 1YW1A 1ZMCA 1XIGA 5AVNA 3L7RA 2OO6A 5GVJA 1KA9F 4OBSA 3RRAA 4I8YA 1GPFA 2YL8A 2OSWA 4LW7A 3EWYA 4IL2A 5SWUA 1CGUA 1EC7A 1V5XA 4MPQA 4XD3A 1J0IA 2DY3A 1ADSA 5GNYA 1WCGA 1GHSA 3WFZA 1XG3A 4PSRA 2MUCA 5U7SA 1HJUA 2QF8A 1UCWA 4HN8A 5F2GA 2TAAA 5LNRA 3N1AA 3RGTA 3U2CA 4D71A 4DWSC 2D24A 2ABBA 3TH6A 3WLNA 4S3KA 3U8GA 5E9AA 2YXOA 4WRHA 4PBFA 4N6EA 1B3WA 4HZ7A 3YPIA 1ONWA 3WFLA 4ZMGA 3BGGA 2PEVA 3DCPA 3BSMA 2OX4A 3RIKA 1NQ6A 2ESCA 3CMFA 3EKLA 4CNOA 3WH9A 3NPWA 4EMJA 3N2BA 3QFBA 4OOZA 3VE7A 2QCLA 1PZ2A 1OB0A 1W3IA 1DWHM 2L5HA 3N4AA 1ZGDA 3ZLFA 1C8YA 5HJYA 2PBOA 3SY8A 4AQLA 4TUFA 4D8ZA 3SSJA 4RL3A 4URIA 1ZP3A 2VDGA 2BOEX 2R1PA 4GX8A 3G18A 1L6SA 3VC5A 1U1HA 4HHHA 4LB4A 3CGBA 3G6MA 4YTUA 4I5RA 4W87A 2QUMA 3CUGA 4I90A 5FF2A 4ERGA 4DWDA 2EG6A 3Q67A 4UFJA 2FMNA 4QJ1A 1UJPA 3MP5A 1E4IA 1HP4A 1GCYA 2GJLA 3CLMA 5D2VA 1XSJA 3IGSA 1OF8A 1RVGA 2EQ6A 1A5OC 1MMFA 3MV01 2WANA 1YEYA 1K9FA 1G01A 3F1QA 3G1HA 3CPGA 5I78A 1AJ0A 4JTLA 2ZUSA 2OWXA 2BFGA 2G4JA 4FIQA 1S5MA 3IV8A 4O10A 4W7UA 1UA7A 3ITLA 5JBFA 1TVNA 2H9AA 4B90A 4DWSB 1ONXA 3UYCA 3GYEA 3NXLA 4NJIA 3GKAA 4DUWA 1OVDA 1VFOA 3SCOA 1YDVA 3M0XA 1HO1A 2Y62A 3BQ6A 4Z2JA 1LG2A 1A3HA 3G1RA 4LFYA 3SQSA 4X0VA 5JU6A 2IKIA 2QJJA 2E3TA 4LNYA 3ZIZA 3WJYA 1FIQB 1QK0A 3AIRA 4PUEA 4JCMA 3TW9A 3QBUA 1RALA 4Q4KA 4P7QA 4RV3A 1UKOA 2A85A 4R7JA 3M7SA 4GI8A 2VZUA 4TVWA 5G5IA 2DZUA 3L4XA 4IWWA 2QIWA 4IISA 2AKZA 1D3CA 1R30A 3CZ8A 2VL4A 1BEUA 5A6BD 1TVPA 4WY0F 4PUWA 1P6CA 3GLCA 5FJOA 3TTQA 3TNOA 3POCA 4JDRA 1UB3A 3BQ5A 5IOBA 3A4XA 1UYQA 2J78A 2WNZA 4R27A 3P8JA 1T96A 4BR1A 1I4NA 4QJ3B 1VAHA 3ARRA 2WP6A 3IEBA 4D6IA 3PK7A 1H62A 4TV5A 4CQ8A 3OVGA 3IRSA 1KGUA 5HNRA 2R14A 3F4DA 3B40A 1EXBA 4RE4A 2OODA 3LCLA 4IGSA 5CPNA 4GVHA 3VOGA 4EOUA 3GHUA 3UR5A 1WP6A 1E0WA 4IPPA 2Z7GA 4HMNA 1H7PA 5HJLA 1EDTA 1OBAA 5H8UA 1MFVA 1GPWA 3QVQA 4UTLA 3PUDA 1CNVA 3WJZA 3NL5A 4L9XA 2RDWA 4OWGA 5K9XA 3A7RA 4S3DA 4XO7A 2I9UA 3KRBA 4PMRA 2V5CA 4PCNA 1LBLA 2CLMA 1JDDA 1WKFA 2VXNA 3HZ3A 4WKAA 5HAOA 3ZR5A 1TYPA 3AHVA 3GUGA 3GXNA 4LIIA 4TR9A 3NRZB 4AYSA 2CLLA 4HZMA 4EWJA 1NHRA 1DXEA 1PHQA 2HJPA 2J8TA 1RCOB 4IX0A 2Y7FA 4LA1A 2XIOA 1KFBA 1ECQA 3IV3A 1L6FA 1S2VA 5E9XA 4PUJA 5AYZA 5IRPA 1GVOA 5EBAA 4ROQA 1NFBA 1R7AA 4UC5A 2DU2A 2OEKA 1XHGA 3W74A 1C92A 3RFAA 4HCDA 3NR0A 1B5TA 4XBJA 2AQOA 3F2BA 4O14A 2PWUA 1IXQA 3LPOA 4JQ1A 3GNPA 3VUSA 4A05A 3R13A 4UTJA 4NZ4A 4QNEA 5CGTA 3VNLA 3W7CA 3RNDA 1C90A 2E25A 1T0OA 3F2DA 3QV9A 3KOFA 2IW0A 1RJPA 5BU9A 3AMGA 1P0KA 1Z3NA 1U30A 3WF2A 2QJGA 3WD0A 4O1FA 2ZA2A 4DJDA 3UPBA 1YTEA 4ZQMA 3QV8A 2OOGA 4G7EA 1BG9A 1QDSA 2DQWA 4WDWA 2DJLA 1N8FA 4LAOA 3PG8A 1DHKA 4D8AA 2W3RA 3MANA 1LUCA 2AAQA 3NOEA 2YIHA 1H2JA 1QR7A 1P0DA 1FHVA 2DW7A 1VFHA 2GVGA 4FHAA 1T8XA 3NZGA 2OVLA 4PRTA 5A8GA 3PVFA 4HU3A 4XZMX 3T78A 1EEXA 4ZE5A 2D3LA 1TUFA 3MDUA 2E6AA 3I68A 3BLLA 4GIRA 3PM6A 2OWWA 2WLYA 3W7OA 4CEUC 2NUYA 4FZIA 4OZOA 4FOUA 3M5ZA 1LLWA 2CZ5A 1Q2SA 2YZRA 1FWSA 2VR4A 4YXGA 7CGTA 3IGXA 3VGFA 2Y61A 4XZLX 4CNUA 3TOYA 4S2CA 4TX8A 3I7SA 5LA0A 1ZS2A 3D9XA 4F0RA 4LS2A 2F61A 3AALA 2XU2A 4AG0A 4K36A 2HWGA 4AD5A 3LHUA 3B9AA 3HFYA 1QNPA 1W1A1 4MWAD 2OMAA 1JYNA 3QQWA 2XN1A 2X7VA 2Y89A 1XUZA 3OLEA 4LXFA 3VIJA 3PB0A 1SYTA 1UW9A 4AC7C 3WNMA 1V3HA 4N4QA 4O15A 1GVSA 2CHRA 3ITCA 4AWTA 1H50A 4A8LA 1RBOB 3SFWA 4O18A 1TX2A 3W4RA 3IJ6A 1W3NA 1BWCA 3C6CA 3EB2A 3W88A 4S1FA 1D9EA 1OFDA 2XSXA 3EXSA 3URNA 4KWSA 4MFDA 2FH6A 5FESA 4XUGA 4DWSA 4M8UA 2A6LA 3B06A 4M0XA 4YVPA 3W81A 1BD0A 3DG6A 3QW3A 3WLOA 1VBHA 3AIQA 3MPGA 1VQZA 2ISWA 4UTWA 3CO4A 4BQ4A 3M0LA 5D4YA 3WUBA 4M6UA 1WAWA 1WKYA 3NDOA 3AUJA 4DLFA 5IDZA 1KQZA 5A8QA 1R0MA 2GOUA 3W9ZA 4EMWA 4ZOHB 3FDGA 3POHA 3W82A 2Y88A 1K9DA 2ZUUA 2GVEA 1FDYA 1FWFC 4O17A 2VURA 1LYXA 1XYAA 2WZTA 2QUUA 4NYYA 3BC9A 3AHTA 1VYRA 1ZUAX 4CD6A 2ZXAA 1QI3A 2OXNA 2WHKA 3QPZA 1W1ZA 1JPDX 4C5YA 2H3BA 4JHZA 4MHBA 4HMCA 3BOFA 3ENLA 1XINA 3EXRA 3B8UA 3WMSA 1EJWC 3JRKA 5ER0A 4UTKA 1AJZA 3AIBA 3CT2A 2CZEA 4CQ9A 1TV5A 7ODCA 5C9ZA 2R82A 2J27A 5D9NA 4D6DA 2Y2WA 4ONVA 2QAFA 1U2YA 4PB3A 3TSDA 1YE6A 3H2CA 1D2KA 4W8AA 1RLCL 1AD4A 4WSHA 1KCLA 3V4BA 5BXSA 1PIFA 1WNOA 3ZXWA 1XI3A 1CI1A 1Q45A 5CPTA 1FFRA 4JX4A 3W1PA 1P43A 2CWNA 3M44A 4Q8TA 1ZAJA 3DHFA 3BAKA 3R89A 3SQLA 3M5VA 4J3ZA 3BAYA 3BOXA 1V77A 1CXEA 3PJUA 4V15A 3EOLA 3M9YA 2QDDA 1V3KA 1DJYA 3OGRA 1HL9A 1WDRA 2OWCA 5KZ6A 3M64A 4O1EA 5E1QA 3PNZA 3DI0A 3KM8A 3REQB 3VNJA 4GZJA 4KQNA 1XIBA 3G6LA 4GQBA 2YW3A 1O6IA 2J77A 3D0CA 2ZZ6A 1QNQA 4ZQCA 1XIHA 5I03A 3BSHA 1WDSA 4UMCA 1M7XA 2IKGA 4B5NA 3M07A 2WVVA 4DO7A 2GVYA 1NF0A 4B5SA 1E71M 3DYPA 1H5YA 4ZQRA 1WKEA 4CNTA 3FJLA 2CDUA 2PGRA 1JZ2A 5C9WA 4WCJA 2C13A 1C93A 1SO4A 2ZRWA 3GVQA 4MSSA 2FFCA 3NQ6A 3UZYA 3W7DA 2QDGA 3H2MA 4KETA 4DF0A 4H4PA 1OC7A 2MNRA 2G0WA 4JKLA 3HBLA 2W27A 3K8KA 1TR9A 4FLOA 1ZY9A 2WMIB 4PODA 4RDWA 2E5CA 2VC9A 1NIUA 3JS3A 5AHFA 4AIUA 3ABOA 2VDHA 5I3HA 3HMJG 2QT3A 2PTDA 3IAQA 3S47A 2X30A 3EPNA 2OYMA 1BYAA 4IIGA 5DFAA 1G7VA 2FDMA 3QEZA 4XB3A 2V9DA 1E9LA 2J7GA 4WR3A 3P6LA 3VKCA 1YQZA 4P8WA 5A2BA 2C3ZA 1NDAA 2VEIA 4JL2A 5AHIA 2IQDA 3WMBA 3CGDA 4UQDA 3T08A 4BQ5A 5D8ZA 3WQPA 4YS1A 1TV3A 4ZODA 4HHMA 3WDRA 1TZZA 4QCEA 3SUUA 1JPKA 2DZTA 3U2OA 3VZZA 3PBYA 4HCLA 3M0VA 1E40A 1P5BA 1QPNA 2PODA 3QHMA 1CDGA 3GVRA 1EJUC 4JTQA 4M56A 5CLTA 3HA1A 5AC8A 4UQCA 3PB2A 2A79A 5KEZA 3QR3A 2XINA 5DY3A 3OHMB 2A3BA 4ECLA 1D8CA 1QFEA 1PTGA 5AECA 5CEWA 2EPOA 2YW4A 1Q85A 4TOQA 2WOWA 4S23A 3DERA 4MWAC 1E15A 4N2YA 4I9AA 3GXMA 1Q6OA 4H8HA 4J56A 2I17A 1KXTA 1X6UA 1YXYA 4ZENA 3SADA 1UUQA 4XKMA 3EMZA 4F0MA 3CIVA 2DZAA 3TONA 4XZBA 1RAKA 3EX6A 2J7HA 1DJIA 3H4WA 4OQVA 1B9ZA 3PUEA 1ZLPA 3UT0A 1Q65A 3LZ3A 2RDTA 1PX8A 1JRPA 4H19A 1TA3B 1BQCA 2BX7A 1QI0A 2PE4A 1BQGA 1JJKA 4PUNA 4C5ZA 1HNYA 4HP5A 4H4SA 1E56A 4V1YA 3W7HA 4LOCA 4PTNA 4QTGA 1J8VA 4UZUA 3MZNA 4UTWC 3QSTA 3DEQA 4A2RA 3HGJA 1H1ZA 1NJJA 2FVMA 4TIMA 1TUXA 2INZA 3OZYA 3LSCA 1JRBA 1VR6A 9CGTA 4PMJA 1UD3A 4J40A 2WZHA 3EZ4A 3Q4DA 3RU8X 2W91A 5KINA 4NAFA 1GW1A 1EJTC 3N6HA 5EMKA 4KEVA 4B2DD 2XZ7A 4GA8A 2NSXA 1PKYA 4HHPA 3HGSA 2BC0A 1XW8A 4NJKA 3ABSA 2WMKA 1D7KA 4XTIA 3K4DA 2SFPA 4PSPA 3W85A 3WKZA 1I75A 5A6JA 2V5DA 4AC1X 5D04C 1XIJA 4WZHA 3V36A 3VNIA 4GIYA 2J9ZA 1PKNA 3OA3A 1PX3A 4I3GA 1OZMA 1ZAIA 3T4WA 1FWCC 3TUUA 1Q6DA 4J35A 1B4EA 2Y7EA 3TJLA 3AQUA 2WM1A 3H2AA 2FZ9A 8XIAA 3N18A 1XRVA 3N2TA 1JD9A 4O0QA 1E55A 2XHYA 3H4XA 4GVFA 3WLSA 4JQ3A 3WLHA 4UTFA 1FWIC 4YTRA 7REQB 2ZDSA 4UNLA 4PRWA 3ME3A 4IP7A 4PRRA 3ABRA 3P3BA 5GRTA 1H51A 2HISA 3KZSA 4LYRA 1W54A 3QR1A 4HNNA 3AN1A 4C6EA 4U2YA 1ELSA 2Y7GA 1AVAA 3W7RA 1DBTA 3QGVA 1GXFA 3S6DA 2QQ6A 3O6CA 2QNEA 4KPLA 3L21A 3V3WA 1SJBA 1XS2A 3O8AA 4ORMA 1L6GA 5J5DA 4GGBA 2J47A 5DMLA 3P5YA 2PCQA 4ZEPA 4WIWA 2W61A 2W55A 5HMDA 1MYRA 4LF2A 3NDZA 1W3LA 3VIKA 2E67A 3NNTA 1JQXA 5I7GA 3JVAA 3ITOA 4AHPA 1WOBA 5A6SA 4GJJA 1TWSA 2V5BA 1OM0A 7A3HA 2C1HA 4Q32A 1TKKA 1BSLA 1L2UA 3O1NA 5BWAA 1M01A 1BSIA 5LIKX 3H4KA 3DBNA 3NVWB 3FJNA 3BTNA 2XH4A 2ZE3A 1W2PA 1VHCA 1TTIA 1J12A 2JFEX 5M3WA 3OVQA 1T8QA 2UBPC 2EGZA 4IFKA 4JQ9A 5HQLA 4K39A 3A24A 1JCMP 1G67A 1EX5A 2WWDA 1JI2A 2JGQA 3ZO9A 2QUNA 4F0HA 5C9RA 5AC7A 4GXMA 4UFMA 4ACZA 3PZGA 1HKMA 3R58A 4C1KA 4GNVA 3RMJA 4OV9A 4RCXA 4DUOA 2HTMA 5DEZA 1R2SA 1J10A 3VCRA 2PDUA 3B0PA 3K2GA 1XISA 3OQEA 3T55A 1TWZA 4J9JA 2BY2A 3IVTA 1W56A 4IMEA 1EA9C 3RM4A 4YN5A 1S2AA 2CETA 5G1YA 3FGCA 2WMFA 2A1YA 4QAWA 5D2XA 5HATA 3OIHA 4ZE4A 5U1OA 3B0VC 4UOQA 5FL0A 1J0ZA 4JTUA 4B5TA 3KOWA 1FFQA 2I7GA 3T07A 1JULA 4U5KA 2B0MA 2RH9A 3IIPA 3ZYZA 4I9TA 3QHNA 4G5DA 4KERA 3ZQ9A 2VRQA 1XDJA 4ZZ9A 4XWUA 3FOKA 4G7FA 4M29A 4A8RA 3URQA 4M5PA 4NL1A 2AMGA 1PTDA 1E72M 2VEFA 2PDCA 1EQCA 2FZMA 3VILA 1O68A 4LCSA 2ZKMX 4MDPA 4GH3A 3TXZA 4PN2A 1VEPA 4M3PA 4J1OA 1H61A 1UR2A 4L5ZA 1AMYA 1LVLA 3LBMA 4I7VA 2IPWA 3THUA 4ZQNA 3UETA 3LXBA 3OYXA 2GDUA 2UY2A 2VKZG 4TXEA 3NPVA 3W84A 1DPMA 1NTHA 5ABEA 5TR3A 1JCYA 2X2GA 4WD0A 4XIMA 5F2LA 1XXXA 3FA5A 1WUFA 4E2DA 4GISA 4F0LA 3RR1A 4K2SA 2A3LA 3VD7A 1Z48A 3W1UA 4W89A 6A3HA 3RILA 4F66A 2UY4A 3N2XA 4REQA 2NX1A 1M7OA 4E4PA 2IXUA 4DF1A 2ZXBA 2AQVA 2I5GA 4JOMA 4WX2A 1KXHA 1KR0A 4G1KA 2GR3A 4KCWA 1CTNA 3LRLA 4UCGA 1AG1O 3ORWA 1OYBA 3FIGA 2WBKA 4EPKA 3SUVA 2WZEA 4M1BA 4APNA 3BG5A 1GKQA 1LQAA 4HNCA 4MLRA 2YPIA 1EBHA 4KW2A 1VP5A 1JIBA 4EK7A 2BSLA 2J79A 4QX4A 4A8IA 4BK9A 2ZRZA 3AISA 3OYZA 3HGOA 4MYAA 4MWAE 5CZ0A 1TPH1 3WUFA 4NU7A 2AL2A 1RD5A 1SFLA 2Y70A 4BEUA 5BCAA 3BICA 1W8SA 3S1XA 4IFKB 5LZLA 2JBMA 1GJUA 2YCLA 3EDJA 1K9EA 1E51A 4M6VA 5FMHA 1LL6A 1Q6CA 4X63A 2BBFA 3MSRA 4FNQA 3VKAA 4NXKA 4EWND 1LROA 2G37A 2UWFA 4HYRA 3M41A 4BFAA 4GO9A 1XIFA 2ZRXA 5KMYA 3FA4A 3LXDA 4UOJA 5BROA 4LF1A 1IR1A 1MI3A 3V75A 3S3GA 4JKMA 3WQDA 1WQ5A 4A22A 3LCIA 4LGXA 3N6QA 4HU4A 2VQTA 4QSFA 2VGFA 3R8HA 3ITXA 1NELA 1E9IA 4IUOA 3UESA 3NVZB 4NEVA 3TFCA 3VD5A 4A4AA 3E38A 4XD5A 4AISA 3BAXA 3GH5A 3SJNA 1LZOA 3W38A 4ATWA 4DBUA 3RX4A 1QRQA 1EUNA 5HR7A 3ZJ7A 3WDQA 3M5XA 4AZ5A 2E9BA 4IZGA 3LTSA 3TU9A 3WO8A 1W8GA 3DGRA 2D2JA 2QCMA 5CAHA 1F76A 1TCDA 5AHNA 4AHOA 3EOEA 4DJDD 4XTDA 4PCFA 2Z1VA 2QUTA 2W5FA 2ZXQA 3IUDA 3B3DA 1GOWA 2PRMA 4D6FA 1GQLA 3N9RA 2GSEA 2XSBA 3LQGA 3OW1A 3A47A 3CO8A 4MKVA 1ME8A 1PDYA 2XGIA 1QNOA 3CMJA 3U7BA 3FSTA 3S83A 1JDAA 1GRGA 1RV8A 5CGQA 5BNKA 2YYTA 3T2PA 4S3EA 1MW0A 3I10A 1CGTA 2QV5A 4JTFA 1MOKA 1NWUA 3SIMA 1O66A 4I7UA 2P10A 1LPFA 4ZR8A 4MB1A 4XUYA 2R91A 2WMIA 2V69A 2R1NA 3SW6A 2WCGA 5LIWX 3RU6A 1ONRA 4Z0SA 1E6SM 1NWRA 2DH2A 4BWLA 1YTKA 1BXNA 3T4CA 8RUCA 3SGZA 1GRHA 2J9XA 3IIOA 4QDMA 4LS0A 2YDQA 1GVRA 1UKPA 3RCYA 5DX7A 2C0HA 4GRTA 5KETA 4L6DA 2QAEA 1KM5A 1ML1A 1MEWA 3LV5A 3WBAA 1MRAA 3NJ3A 4AH7A 1JVNA 1K8ZA 3ALGA 4OJYA 3CTLA 1G69A 3I3EA 3OBKA 3GFYA 3V1HA 1XWYA 3VNDA 2OR2A 2TMDA 1LL4A 3QQ1A 1VBJA 5A6AA 1QPKA 3H70A 7PTDA 4O13A 3MUXA 3EPMA 3QTPA 1DIKA 3SURA 3TLLA 4HNUA 4Q33A 2E4TA 2X1TA 1AH4A 3MY9A 3ZS4A 2Y7DA 3UWYA 4JKKA 1B3YA 1JDEA 3OZMA 3A3XA 3C56A 4Y9MA 1SGJA 3DIPA 1ZMDA 4HT3A 4P8XA 1X97A 1XV8A 2BOFX 3TKFA 5I77A 1FECA 3MP3A 1B90A 5EB8A 2Q8LA 2VVSA 4IQLA 4IXXA 2VDIA 4US5A 4ZSTA 3UNTA 1Q5MA 5DBTA 2W0UA 4MWAA 3O3RA 1AQMA 2VR5A 1JOAA 1SZGA 4BCEA 2CFYA 1GOQA 2CLHA 3LHWA 1B1YA 1RPXA 4QHRA 1OT2A 3PWAA 3S2MA 4K1WA 3SIZA 2Z1SA 3PSWA 5ECVA 2NZLA 2QCGA 5HBFA 2TYSA 1R46A 2QPUA 1LBMA 5D9OA 1Q13A 2QV4A 3QV6A 4QXIA 3RPDA 3BARA 3WF4A 1NDYA 1AMKA 1KWGA 1OFOA 3B8SA 1I9CB 1ZCCA 1BTCA 2W63A 4MNLA 1FWJC 1SZNA 4IJRA 1A5KC 4C7FA 3GZ3A 4L7ZA 4GWEA 3KBVA 2ATSA 3FEMA 1L2QA 2HBXA 4CN1A 2ZX5A 3BJFA 4K8DA 1VEMA 5FEXA 3MBDA 8TIMA 1XPGA 2PDQA 5AC4A 1G94A 3MMTA 1J96A 2ZZ4A 1VB9A 4QSHA 1MWOA 4K37A 2WJZA 3W28A 4WHBA 4JTGA 1J01A 3SCPA 2IS7A 4GQ0A 5HQMA 2A7RA 5FACA 1JZ4A 4OFCA 3CGEA 5T91A 2REQA 1E9ZB 1VIWA 3EX3A 4GABA 2VEMA 5G4EA 3WL0A 1FA2A 2X0HA 1VFTA 2HS6A 4JN6A 4ZA0A 1I2OA 3MO4A 4EACA 2V6OA 5CXPA 5EMUA 3WNLA 1KRAC 2OGYA 3K4WA 3MMWA 4N9CA 4RE3A 4AMAA 5FEZA 3TZFA 3IGHX 1P6BA 3L4UA 4G1NA 4OECA 1J0KA 2I14A 3LCHA 2F7FA 1J0HA 2W66A 3AO0A 5ABHA 1FCQA 5BRQA 3CS2A 2GR0A 2CBIA 2P1FA 2Z26A 6ALDA 4D72A 2FZDA 1UOKA 1E0VA 5CJMA 4F2TA 3B8TA 3TZNA 3GU1A 3QF0A 4Z17A 1EBGA 2AOSA 5FS6A 1EJVC 3URHA 5JXQA 5D2WA 5L6UA 3R0UA 4B92A 4CN4A 4AEEA 5C8BB 1PKMA 5BMWA 1VFFA 2WCAA 4PTVA 5A8MA 1MNZA 3ISIX 1QW9A 3T81A 4WSJA 3C0LA 4UXDA 1LLOA 3UR2A 5IFTA 2JK2A 3ARYA 1TWIA 5LNUA 3EB4A 3EWDA 3EX2A 1U5JA 3LCXA 3R6IA 4U31A 2VD9A 4GIEA 4Z2LA 4JPGA 1GOIA 4FXRA 1FH7A 4BY3A 3LHZA 1NARA 1W3JA 4P8VA 2VYOA 3LXAA 2RAGA 2WVVB 2EKCA 4ZVJA 1UC5A 3QXBA 3PZQA 3GTXA 2CBVA 2HROA 1S2TA 3N14A 4ZBCA 2VZTA 3SI9A 3IJDA 2X99A 4C6JA 4PTWA 3HIJA 2O9OA 3M0JA 3FFSA 2VC7A 3M0YA 1REQA 4JFUA 3VIIA 1POJA 2CZVA 3NXFA 2XTKA 2ATMA 4NAEB 2A3AA 4IMGA 4LAUA 2NLYA 2EPLX 4RW3A 3N2CA 4C6FA 1VQTA 3OG3A 1IT7A 3BMXA 4CNSA 4QLKA 3IACA 4DEFA 1YX1A 5FF3A 6TAAA 1RK6A 2NX9A 1UQZA 1JGMA 5D09A 4A3YA 3WK0A 3P0WA 2D20A 1W3TA 3WEMA 2D69A 3K8MA 4EIVA 5EKYA 4JGDA 3VNKA 1S5VA 3TR9A 3ITTA 1FDJA 4UFIA 4FR1A 3W7KA 4PE8A 3UFYA 1U5VA 3B9DA 1BTMA 3E02A 4NAFB 3FA3A 3QY8A 4GO8A 4DYJA 3W2JA 4JNMA 2VMFA 2X2YA 3F2CA 3MA8A 1TMQA 4AY1A 3U9IA 1QK2A 2JK6A 1UQYA 3UZ5A 2PLMA 3MKCA 4S38A 4YJ5A 3N29A 4AF0A 3OGSA 2JE8A 1K7FA 2X16A 5G2IA 2E68A 1GG1A 3QW4B 1XGEA 3APYA 4MLJA 4LU0A 4AFYA 1LL7A 2EBNA 1ZL1A 4P8UA 4HJWA 1GYMA 4GYKA 2HQMA 4ZOCA 3U57A 3WLQA 4DJEA 1I60A 3GBDA 4DNAA 2VFEA 4A6GA 1N5XA 1GOXA 4I5XA 1XM3A 3TTEA 1S38A 3T09A 3WL1A 1FBAA 1XBVA 3ID7A 1L6WA 4A8NA 1IHIA 2Y85A 1N82A 3WY1A 2F2KA 3C2VA 5AKQA 3F4WA 1LBFA 2VQUA 1M65A 1QVBA 5EMJA 4AD1A 1AH3A 2NPXA 3GD6A 4KRZA 4RZBA 3MCNA 3TV8A 4O8AA 2ZIDA 2FJKA 2W62A 2XGZA 3U5UA 3WF3A 3UG4A 1KV5A 1OADA 2ZUTA 2PI6A 9XIMA 1Q2RA 4PA8A 3NQVA 2ODOA 2YSWA 6TIMA 1LDCA 3ZJ6A 1KBJA 4GBDA 4UBPC 2GJPA 3VDHA 4RX0A 3CWNA 4S2BA 3NGJA 1K8YA 1EHAA 4EM4A 5C5YA 4DJFC 3KHDA 4O12A 4Q8QA 1SMDA 3SQMA 2E5AA 1D7FA 4HHLA 3PZOA 3IS4A 4Q4QA 3PPHA 2DW6A 1TPWA 2G95A 3G0UA 3PP7A 3RG6A 3PZUA 3S5SA 2Z00A 5HA7A 4DN1A 4GVIA 3VVGA 3PTMA 1HKVA 1KW1A 4LC6A 4YLWA 4M80A 5LHEA 4AZGA 1TELA 2EPKX 5TF0A 3IIZA 3VDBA 2ZCGA 4GUFA 2BGNE 1EJSC 3VKBA 3RRXA 3ZOAA 1VRXA 1TWWA 2D3NA 5HMFA 4PH6A 1H09A 4WK9A 3HQOA 1FFVC 1BYDA 2NQHA 4XISA 5LA1A 5GNZA 4LVAA 3W86A 1GZ1A 4L9YA 2WSRA 7XIMA 4M19A 1SO3A 1HFBA 5EMMA 3UJRA 4H2HA 4HKPA 1VF8A 1UWUA 1OGBA 1A5UA 3EANA 4H4YA 4M6QA 1W9DM 1GV4A 5TNVA 3P80A 4O19A 5REQB 2XVPA 4Z0JA 2V63A 1K4HA 4KEMA 4UQBA 2XISA 3SRFA 4HA0A 3UJSA 3TVAA 2P3EA 4CCDA 5A95A 1JZ7A 1YADA 1X6NA 1DJWA 5E70A 1BYCA 1DXIA 4Z1BA 4RZ6A 3WH5A 1NDVA 1RP9A 3EB3A 3H6OA 4PMQA 1MZHA 4PFMA 4J3TA 3G1AA 1HJVA 2W6RA 4WKFA 3KZPA 1EC8A 1R85A 4LVGA 3VX0A 3G8RA 1HX0A 3NEVA 1SR9A 3QY7A 4PMZA 4V1XA 3NAVA 1PZ1A 4ZXOA 3DESA 1P0BA 4AY8A 1PB0A 2Z1KA 4LJ3A 1GEQA 4C1LA 3CWHA 3GNXA 4DX3A 4FNRA 3RX2A 3U7VA 1KGWA 3UF9A 1LT8A 4ZFMA 2GK1B 1GJPA 2XH0A 5I6SA 3OIXA 1XLLA 4RKAA 3TW6A 3VMOA 3S9YA 4B3KA 2C6QA 1QNSA 3E6EA 4LS1A 3DH9A 3UP8A 1TMHA 1QJWA 5JBDA 1XC6A 4UR7A 2R8WA 3OOQA 3L0KA 5D03A 3W29A 4LANA 3H23A 5MKGA 5H91A 4OGZA 4IHCA 4F0KA 4E0CA 1IEXA 1O5QA 1DTNA 3S5ZA 4LB3A 4KF1A 1C7TA 1IWPA 4GNKB 3C8NA 3WFAA 4AZCB 3DENA 3OB8A 3B0XA 2YB1A 1F8WA 4RNJA 5A8NA 4MJMA 2C1IA 1MFUA 4GACA 3IJ9A 4G2DA 2R94A 3BAIA 4HCHA 4B5XA 1JI1A 4IG2B 4QJ5B 3LB8A 2JIEA 2DEPA 3HPAA 5EBKA 1EWDA 2CWXA 2YOCA 3LGDA 4IGHA 3L12A 5AZ1A 1X6LA 1RLDA 2X8GA 4GI4A 2AL2B 1MDLA 4AZHA 4QISA 5D9PA 3BLOA 2Z25A 2PDLA 3QZAA 1THFD 1AZ1A 4AB4A 3A23A 1OX6A 2FH8A 4MUZA 2E28A 3C3NA 4IICA 3CL8A 4OV4A 1ITQA 3T7VA 5G1TA 4JIIX 5C71A 4Q8VA 3S1UA 1DE6A 1XDMA 5HWJA 3KBJA 1KTNA 4EXBA 2CKRA 2CXEA 4JN8A 1E5NA 4R7WA 4H7VA 2C19A 4GY7A 2FVKA 4H4VA 1ADDA 5KITA 3MHUA 2QAPA 2OO0A 2ZVIA 3LXCA 4H4IA 4J57A 3KCOA 2WBAA 4AEOA 3QQ0A 4Z2IA 1Q6EA 4FX6M 3HF3A 3KX6A 4TMCA 4UTMA 4HA4A 3C5QA 2XN2A 4AXNA 1BLIA 4WUIA 4HK7A 3P7YA 3B04A 4AZIA 3A7UA 2O92A 4WXZA 4BF7A 4L65A 2P76A 3SUWA 1P1MA 3VIFA 3W2UA 3KL3A 6CGTA 3UXKA 4C6CA 1TJ2A 2QXWA 4IP4A 1U33A 3MCMA 2XZ9A 3GDTA 1DWGM 3QC3A 4CD5A 1F4HA 3N15A 2ZX6A 4IIBA 3WQGA 1TIWA 4WDTA 1PKLA 3GW0A 1NPXA 2Z2BA 3MT1A 3PHAA 4UR9A 4W85A 3KLJA 4TX6A 3VYLA 3H2FA 1MXGA 2OX1A 4GPNA 3VIMA 3PZIA 3G3MA 4PMDA 4MGGA 3NQMA 3LI0A 3O9NA 3AM9A 5LIYX 3GC5A 3WQOA 5DT5A 3A9IA 1W37A 1GGOA 3DHPA 4BWLC 1KC7A 5IHSA 1A49A 4ADWA 1BGAA 5JVLA 2WVUA 4LAZA 5GJMA 4EPDC 2IPFA 1U83A 3FS2A 3RHGA 3PFRA 3O6DA 3RNMA 2EPNA 4I5UA 1D7YA 3GSMA 1O5XA 2XVLA 3CZJA 1O95A 5FJPA 1AJ2A 2DVUA 3QLLA 2IKHA 4JY8A 1V0NA 3DUGA 1TTJA 1Z69A 3S5NA 5HANA 1V6TA 1GEHA 4Y6GA 3M0ZA 1CGVA 3UWWA 1YYAA 5CC7A 1WDQA 2YLAA 3M1ZA 3MBFA 1RQBA 3OPSA 4Q8PA 4GYPA 1XYFA 1LRQA 2NXHA 2ZZBA 1S2CA 2INFA 4ZL1A 3TLQA 1Q3NA 1VH7A 4KCUA 1JDCA 3OEXA 2NW0A 8XIMA 4QG6A 3N19B 2QMKA 3W02A 1IE7C 5AYXA 3MDWA 4D2JA 3L5MA 3DHUA 1BAGA 3F7JA 2WZMA 3CBWA 5H8PA 4XBSA 1OK6A 1XICA 2FZ8A 5CPSA 2O7QA 5AB3A 4R88A 2FKPA 3E12A 1QI4A 5HMEA 5C54A 3B8VA 1KFJA 1J9YA 4P7LA 5BZAA 5MHBA 3F5JA 2Q71A 1OHLA 5I3JA 1YXCA 3QTGA 1GRBA 2VFDA 3VGGA 4D6EA 3UVIA 1NH6A 1UWRA 3WD3A 1X98A 1XJBA 4LUSA 3WEZA 2QGHA 1O60A 1XDIA 3CK5A 1KWKA 1RJQA 1TFVA 2P5NA 1N8WA 1J0JA 1MW1A 1YDNA 1E1FA 1H60A 3E9AA 2O55A 4WXYA 4EPEC 1VJZA 1S5WA 3UWVA 1UUOA 5KSWA 2F6KA 2G3MA 3LLXA 3GXFA 3DFNA 1TVLA 5T26A 1VFMA 3RO8A 3KLKA 4H3DA 1V79A 3I65A 4LYKA 1NDWA 4UMAA 1S2WA 5HPCA 3F4CA 4YWIA 5ABGA 5A6MA 4DLMA 3FHAA 2J75A 3MJMA 1EPXA 2NV2A 5C55A 2ACSA 3TCEA 2JF6A 3GH4A 4AIOA 5LKYA 3CQJA 3CUXA 1QW8A 1EDGA 4ZQPA 3LMZA 1KR1A 3A3WA 3L0NA 4LUJA 4ADUA 1XLGA 4FNPA 4UFLA 4MB3A 2ZTKA 2WSPA 3CHCA 3VPLA 2A7NA 1YNPA 1GRFA 1MEHA 6REQA 4OBRA 4ZB0A 3OLIA 1JFHA 1WAUA 4I9JA 3I4EA 3ZM8A 4EX4A 4ICMA 3LPPA 2VI0A 3S2JA 4U3AA 1ZDLA 3NGFA 5LIUX 1GUVA 4NRRA 4J3XA 3LM7A 2DGAA 1PPIA 1IF2A 4E8DA 1KM4A 1F3XA 5CPOA 3UXLA 2Q8ZA 4MYXA 1QOPA 1V7YA 1VZWA 2DZSA 3VO0A 3JZEA 3ELFA 4EF9A 2RKXA 4HPJA 4H04A 5I3IA 1KV8A 1HJWA 2PDBA 4IF2A 4XQ6A 3PTQA 1K77A 4G56A 3WH6A 1H7OA 4OE7A 2YBVA 4GH1A 1V0MA 4H8UA 1QATA 1TPB1 1E3XA 1DWIM 3NOYA 3FVDA 3EWWA 2FLIA 4B5VA 1G5AA 1R3YA 4XG1A 1OD8A 4EM3A 3B4YA 4UNIA 2P88A 4P5UA 1TV7A 3WUEA 5C2GA 1G6CA 1ZKQA 4RUBA 2RGLA 1NDZA 4GY1A 4IJBA 1OX4B 3LPGA 5TBOA 4OHQA 1O4UA 3S8HA 3FKKA 5G4WA 1YPFA 5I3DA 3DGHA 5K9DA 4LV9A 4O28A 5KZMA 3J7HA 3SUTA 5BOOA 4C6IA 4LEQA 1WDDA 4O1DA 1I6NA 1W31A 1XIEA 5TIMA 5DANA 1QI5A 5XIMA 2AGKA 4EANA 1DTUA 3I6RA 4ZGYA 2W4XA 2PFHA 3KL5A 4PEKA 2XPKA 3BLDA 3WD2A 2XYLA 1E6QM 3FLUA 4FOJA 4B3LA 3GZAA 3PAOA 2WHLA 4I6VA 4H9XA 6XIMA 3NVTA 1YE4A 1GVIA 1XH1A 4IQEA 3UCQA 4AD3A 1TIMA 4H41A 4EQSA 2FVLA 3SSZA 3BXWA 3WQFA 1JDFA 3TWAA 2QYGA 2Z0IA 4IP5A 3W6LA 2VO5A 1GJWA 5LGXA 1XH0A 3BLPX 3AXKA 3CAKA 3CAWA 5M5DA 2H90A 2XM1A 4JNYA 3FG2P 1V0KA 3A5FA 3VE9A 4HNLA 4HD5A 1L8PA 3SCUA 4AUBA 1A53A 1BF6A 1US0A 2GQWA 2B4GA 1V6VA 2ON3A 3LTYA 3UZWA 4FIRA 3TYEA 4R33A 3PY2A 3H54A 1G1YA 1QHPA 4GQGA 4BQ2A 1UKTA 1H7NA 5FJTA 5A2AA 3AIEA 4E3VA 2QR6A 1M5WA 4NYUA 5GJPA 4UR8A 3QFAA 4H4QA 3L65A 4FDCB 2IQTA 5BXPA 5EY5A 1J0YA 1EBDA 3H2EA 1S7MA 2X42A 2VENA 3UG3A 3TN6A 3S2NA 5DXXA 1FWHC 1OFAA 2PGWA 3SJ3A 1EYEA 1ZTVA 1JZ8A 1UP0A 4Z1CA 2FYMA 3EDEA 5HNNA 3TR2A 1SZEA 1UWIA 3VKDA 3PZMA 5C70A 4MMWA 4DZ5A 3FVMA 1FTXA 1OEPA 5K2ZA 3TWBA 1KNWA 4H1ZA 5D2TA 2V5KA 1M68A 4B91A 4QEEA 3G77A 1QPOA 4Q4RA 3ATYA 4C65A 3TEVA 1EO5A 1OFBA 2VOMA 3QZEA 4Q7NA 3TJXA 3ZWTA 1SZRA 3UERA 2J7FA 9XIAA 2P0IA 2XH2A 5CZTA 2IUZA 5M1TA 3UD6A 4C6NA 1TA3A 1XF0A 3WK3A 1LUCB 1OINA 2PS2A 1L0PA 2R6OA 3SCNA 3U3HA 2BVTA 5I02A 3RM9A 3V5CA 2V3DA 1XBYA 5FF4A 4AX6A 3DZ1A 1SJDA 3R11A 1CWYA 1L9WA 5E0FA 2RJGA 2Y5JA 1FWEC 3ZFHA 2PBGA 2PB1A 3RITA 1VBRA 4G8TA 1DEDA 1A0CA 1PCKA 3LHTA 2GGJA 1WDPA 2VWSA 1RCQA 2OOFA 2JKPA 2DSKA 2YLLA 1EP3A 3M16A 3C2EA 4H7ZA 1JUBA 4H7CA 3CZKA 2OELA 4F2UA 2CW6A 4A29A 1GYLA 3OBAA 1KTCA 3EF6A 2FB2A 1Q4WA 4QG9A 4G9PA 3BZGA 3LENA 5I3FA 4JYFA 1HJXA 5D38A 3WCZA 4A3UA 3OTRA 1JNEA 4RE2A 1XLEA 2FGBA 3ITYA 1YPXA 1LRNA 1XRTA 4S3BA 5CZSA 1HVQA 3BLEA 4H01A 4H9MA 4M6PA 1UZDA 2Q6ZA 1NSJA 4QLLA 4Q7BA 2ZZ1A 5RUBA 2OLSA 3LSBA 3LV6A 3MV11 2V3FA 1ESWA 2HVNA 4YTQA 4IMFA 4BA0A 4H4UA 3AAMA 3LRMA 1VBGA 3L9CA 1TRIA 4JTCA 1QAPA 4PCTA 4WGHA 4JFTA 1LT7A 1W9XA 2HDJA 4U28A 1EHNA 2C0AA 2IPJA 4UQAA 1Z32X 1NFPA 3EXTA 2YCLB 3CH9A 4TQTA 1XR2A 3MUY1 2H8ZA 4GI9A 1EP2A 3PJWA 5FS7A 3LGEA 4TU1A 1OX4A 1K6WA 2GQAA 2WW5A 3M0IA 3T2OA 4GZ7A 3VA8A 1TZ7A 4Q4OA 1BRLB 3TOPA 4PUUA 1U22A 1W1VA 4IX2A 1AOGA 3D46A 1JEZA 4IMCA 1SJAA 3NFUA 2J62A 3M0KA 1OT1A 1HGYA 2XG9A 1MZRA 2GSHA 1BG4A 1KFEA 3HG2A 3WEOA 1E3ZA 1SW3A 3H4GA 1YPIA 1TCMA 3ZWSA 4HMDA 2VFFA 3AYVA 5I23A 1NEYA 2J9YA 1F2JA 2D1ZA 3H55A 4PEEA 3TA9A 1R3TA 2AAAA 1IT8A 3EX4A 3DG7A 4EVZA 1XLHA 1FWDC 4NP7A 3U2EA 1ADOA 4HPGA 1JZ5A 1E4NA 1TPVA 1W5NA 4CKQA 1QHZA 3UY7A 5FEWA 4V28A 3KCJA 4DVOA 3HGRA 1EA0A 1KN0A 1H49A 4GINA 1W1PA 4TVCA 3E2VA 4YVXA 5HWMA 4FNSA 2OQHA 1JCXA 2INEA 4W88A 5EFDA 6XIAA 4DZIA 3GIQA 1CXHA 1ZENA 5EBUA 3VOIA 3H8AA 1J6OA 2YAUA 2EG8A 3WF1A 5IDIA 4FPSA 1JQVA 3RLVA 4H9YA 2NWRA 4JTTA 4K7VA 2I57A 3AS1A 4F4RA 3SN4A 4B9ZA 3S2LA 3ZVIA 4AF0B 2YGYA 2QPXA 4E2VA 1TJ0A 2GR1A 4MY1A 3WBEA 3UBPC 3TAOA 3CL7A 4IIFA 4UTIA 4CQAA 1Y65A 1A5BA 3TQPA 4HOZA 3K46A 3NQEA 2X7WA 2QJNA 1W3KA 1XGZA 4CVWA 2AKMA 1X8FA 3P93A 4KEUA 3UR8A 5JQ9A 3ETRB 4CQBA 3E3HA 3AMZA 3NG3A 1E4LA 3OZOA 4JXCA 2DP3A 1E0XA 1R9YA 4KEZA 4JAWA 5CAKA 3QYSA 3W6YA 1IXOA 2XIQA 4NXSA 3W1MA 3MS8A 1IEQA 4Z08A 4C6DA 4ALDA 4JQ4A 3UWEA 3MTWA 4MJZA 3TCSA 1UD6A 1GQKA 4D6HA 3GYCA 1GESA 2XIMA 1RK5A 3W83A 2WSYA 2CPUA 3MSGA 3BGJA 1VPYA 1T7LA 5J5RA 5DN1A 1UR9A 3K4AA 1UR8A 3R8GA 3HG3A 1WXYA 1K7XA 3L68A 3DOPA 1A0DA 4CNPA 3KEHA 4Z42C 3WJSA 4RDVA 2B7QA 5G2HA 4YWOA 3GTIA 1ZP4A 2BHZA 4AXKA 1QPQA 3AIWA 2Z1XA 3THDA 3UY8A 2W67A 1E6ZA 3MKVA 1EL3A 1W5OA 3NDYA 3BWWA 1JROA 1UC4A 2VR2A 3BO9A 1TTPA 3QKZA 1TG7A 3REQA 2HBVA 1KM6A 2DZXA 3B0UX 5HINA 4FO4A 1G4TA 1C9DA 4O11A 2C3CA 4MVAA 1QU4A 2GZXA 2HVOA 3II1A 2ZZ2A 5FF7A 2J74A 5HWNA 4G6CA 1W32A 4JIPA 2ZC1A 1ECEA 1L8NA 2E5BA 4Y9OA 1WKDA 1VC4A 2XUCA 2CLIA 1GETA 3LCWA 3VU2A 1DJQA 1R9XA 2DT0A 5TQLA 1UR0A 2IPGA 1X39A 1BF2A 1JCJA 1VJIA 5E6ZA 1MQRA 1A5NC 4MY9A 4DB7A 1GKPA 1NU5A 2BWGA 4Y90A 2V67A 4JX5A 3LB0A 3HW2A 2WLZA 1GRTA 3LCFA 4ZOEA 2WHMA 3GIYA 2WYSA 1KBLA 3VGDA 3PZVA 2NVKX 4U5IA 2X05A 3L4ZA 1CGWA 4H6KA 3WX7A 4MZ1A 3LN3A 4AWUA 1KD0A 4Q8UA 2BS9A 1GSNA 5EA9A 5ABFB 4IG2A 2X1IA 4PUMA 2D0HA 3USZA 5G5HB 2GJRA 1FEBA 5D32A 4K38A 3Q94A 4WJEA 3VFLA 3OGVA 3N9KA 3CC1A 1EIBA 2EQ8A 5LGZA 4U4MA 2KAUC 3INPA 3CPRA 1UH4A 2H3DA 4X3ZA 2V68A 3NSMA 4GYPC 4UFKA 3ANYA 3QPEA 3G2GA 1M7PA 4K1GA 2E1WA 4ZB2A 2BHUA 1W6TA 4EMIA 2A7PA 4GKLA 3FDKA 3W7EA 4PBGA 2CERA 2P0OA 4E8GA 3E96A 2X1UA 4JICA 3ARXA 1AA1B 2WJFA 4NT0A 3R0KA 5CC6A 4XKYA 5JMUA 2GK1A 3SCWA 1DJXA 3WQ8A 2B81A 3P84A 4S3FA 4L80A 2P8CA 1C8XA 2Y1HA 3QJAA 3BLKA 2H9AB 3KP1A 5FEPA 4C6MA 5CZJA 4GUGA 2NQ5A 5B7ZA 3UJ2A 2R24A 2DZPA 5ABTA 3DU0A 3S42A 3TYZA 1M6IA 1Q4NX 4JYEA 3LK6A 3HV8A 4HSHA 3S1VA 1IWBA 1K7EA 3VZXA 3WDIA 4FF5A 2JEQA 3WLJA 1XHCA 1QBBA 3AWNA 1CYGA 4PULA 4DYEA 1FWNA 3W37A 3L67A 4QAIA 3BH4A 1MQQA 1PSCA 3FXYA 1UWQA 1SO5A 2XM2A 1VS1A 3GTHA 1T99A 2E77A 2FB3A 2GDQA 4JY9A 3WLMA 1RP8A 5F2IA 3AMCA 4KESA 3PBVA 3DK4A 2O7SA 3W22A 2BV9A 2P8BA 2ZA1A 3DFHA 4IXHA 4FR6A 2Y24A 3KRZA 4PMVA 3W26A 2V3AA 1LM1A 5CC3A 3W1XA 4F9JA 3GDBA 4ZTXA 4GCAA 3CUFA 2GUUA 2ICSA 1K8CA 1E1CB 4N6FA 2BODX 4MKSA 4NZCA 3M6YA 1PZ3A 3N3MA 2EG7A 3C0SA 5LXEA 1EH9A 3IPWA 5D33A 2CLPA 2WNQA 2CU0A 3UWZA 3EA2A 5FS9A 4GX9A 3SFKA 3OJGA 3O0KA 5GPRA 1V0LA 3MCOA 3MZ2A 2WPFA 3C0JA 3G1FA 3RCMA 2W3ZA 1XBXA 3SCQA 2XN0A 1Q1RA 3LLFA 1Q7QA 4MNMA 4KFPA 1PHWA 4RXGA 3EWBX 3HFTA 4PGLA 3AMKA 3QFEA 4XAGA 1P7TA 3CZEA 4PUDA 3LHYA 3GR8A 4RNIA 1JCLA 2DUZA 4U2ZA 2WK2A 1FCUA 3UCDA 2YL6A 2C3DA 2FMOA 4H9ZA 4LRTA 1XYLA 1FP9A 3KHJA 5BXTA 4KRTA 3ERPA 4DJFA 4IIDA 1PVNA 3RM8A 4CD8A 1SVDA 1EF2A 4PZVA 3WNPA 1M9HA 2X41A 3AZRA 1EB3A 2BASA 1HIZA 3M4HA 4HZ8A 3B0YA 3WLPA 5H1WA 2BHYA 4F0SA 2HNEA 1JRCA 5FJUA 4H83A 3M0HA 5HDRA 3BMVA 2PGFA 1BZLA 2Q01A 3SDOA 3RCNA 1VPXA 2G5WA 1J11A 2BP1A 1QO2A 3M5YA 1NOFA 4CN6A 3L0GA 1TPC1 3K8LA 4H9TA 4AZ6A 5I06A 4H9UA 1JUKA 2QCDA 1OFEA 4EQXA 3RLUA 3P14A 5IBXC 3G5EA 3TC7A 5HK4A 3NM1A 4MM1A 4RXFA 1IYXA 3E0FA 8CGTA 3RXZA 4LVDA 3TQ0A 3NQFA 1WBJA 4DBDA 3P0XA 2ZUWA 4ICCX 4L4LA 4O1AA 2J4GA 1MQPA 4WOZA 2PTXA 4M7TA 2Z6IA 4L9ZA 3USBA 1STZA 2QCNA 2V3GA 3CB3A 3T40A 2XGBA 2E3ZA 4ORIA 2LLEA 1IXNA 4W4QA 1FKWA 4GIAA 3OP2A 3QMTA 2DSUA 1H11A 3L2IA 4UWMA 3H7VA 4XD6A 2G97A 2HS8A 3W71A 4QE5A 1BXBA 1Q6GA 1XX1A 2RGMA 3NS1B 1Y8BA 3E0IA 2E9LA 4BJHA 3DFOA 3T0DA 2OT0A 3FHQA 1H1YA 1J18A 1W9UA 4D6CA 3FAWA 3WDJA 4QG8A 3BUVA 3SGUA 4C6QA 4E6MA 1J2WA 3PUOA 3VI2A 1CT5A 1FP8A 1U5HA 5A94A 3KUMA 4DHGA 3TYAA 3FYYA 3K5XA 4DPQA 3WD1A 3VIOA 2OCZA 5DT7A 1G9HA 1QNVA 3BL3A 1HL2A 2CLFA 1NAL1 1S3TC 1A5LC 3UWUA 3TC3A 1KCZA 3VK5A 2Z2AA 4U33A 3FJ4A 3OQ8A 1ZPTA 1K70A 1KM3A 1W1TA 4KMQA 1N7KA 2CESA 5FS8A 3UPWA 2QKFA 3L2MA 2PSNA 3SR7A 2F38A 3CEUA 1PJ9A 3CZLA 4DO4A 5DRIA 1JCTA 5J8LA 2X1SA 1FFUC 2ZXDA 1XYZA 1B4KA 1OFQA 1WA3A 4KCTA 1QHOA 2XJ7A 4NZ1A 3EWUA 2W9MA 1DXLA 4UNKA 1MUWA 4C1NA 3E1F1 2VT0A 2Y5EA 1KKOA 4IL0A 1ZALA 3GHSA 4L6HA 3S6OA 1DHPA 3MUAA 4XX6A 3AYSA 3BAJA 3G22A 1X7IA 1RQHA 3AHXA 3A7AA 5CGMA 2GWNA 2I1OA 1W17A 4DUXA 4YU1A 3NYZA 2NUWA 1QBAA 4UTTC 4Y8FA 4J4KA 2CKSA 1NP2A 5DMYA 1K4QA 5T9BG 4NZ5A 1XCXA 3R1ZA 1TWDA 3OLDA 5AOUA 1YDYA 3SBFA 2PCEA 5AYYA 4TTGA 1XRSA 4FOKA 4WLCA 5BWFA 4RLIA 1UUMA 3W24A 1FUYA 2A5HA 4YWSA 1US3A 1GW9A 1QNRA 3TXVA 3B8IA 1WOAA 4LAKA 2VFHA 3VFCA 2F2HA 1IV8A 1UBSA 5JH2A 4GY0A 2B31A 2WV8A 4CU8A 4DBSA 2EO7A 1N63C 1M3UA 5I24A 3LOTA 1CBGA 3NO1A 4Y9NA 2ALRA 1Q8JA 2GYIA 3BE7A 3GQYA 4MFEA 3U5YA 1V6WA 3L4VA 4D1JA 3VD4A 4US6A 3UJFA 4XO6A 4YHGA 1TX0A 3APGA 2J88A 3L4YA 1GEUA 1JXJA 1KBIA 4QIUA 4KBXA 3M46A 3T2QA 4O53A 3PF3A 3HQNA 3TK7A 2WB5A 1CGXA 5CCZA 2OPJA 4DAFA 4MAVA 2P3ZA 2GQ8A 3VGEA 2HVMA 1LORA 3BANA 4YVVA 1YHTA 1N60C 1RR2A 3H7UA 4ZO8A 1MO0A 2GRTA 1F3EA 1VEOA 3FSUA 4EQWA 1VENA 2DQXA 3W87A 3LG3A 5CBIA 1PZ0A 3UQNA 3VNMA 1X38A 1RY8A 4N9BA 1DL3A 2CC0A 4WGXA 3O7UA 2DPEA 5LA2A 2VC5A 2AAMA 3W6MA 2PZNA 3PSVA 3NVYB 1OZQA 2HNHA 3BLFA 3RN6A 1MW3A 4ADSA 4DIAA 3U6WA 1XLDA 1ME9A 3R7MA 1DNCA 2CNCA 5G1MA 2PWDA 2E8YA 3DJGX 1Z6KA 2CBUA 5BMXA 3GIPA 1NOUA 3C2YA 5E09A 4RZ5A 2CHOA 5E0CA 4J7RA 5EFFA 4Q8WA 1VRDA 3UJEA 1AUSL 3A22A 2Q3RA 2I5QA 4FMVA 1AD1A 2Y5SA 3CV2A 2ZRVA 2G8ZA 4Z2GA 1IIHA 4J3WA 2KZHA 2NV9A 3R2GA 3UU0A 3WNKA 5IXEA 1Q6LA 1CXIA 2WVSA 1UKQA 2PAJA 2PP1A 2VEGA 3I3DA 4GJIA 3S9IA 1NY1A 1EGMA 1V51A 4W5ZA 2VRKA 3WNNA 4X9YA 4F3HA 4QE1A 3Q2DA 1EUAA 4GMEA 3W25A 4GG9A 3WQ5A 2O9PA 3LGGA 2ZBTA 1PUDA 3MHFA 1WB0A 2XVGA 3N25A 3IVUA 3STEA 5CBBA 3IARA 5F4SA 4NNAA 2Z2UA 3GVWA 4TMBA 1PYMA 3CHDA 1X2HA 4UMBA 1RZMA 4AVFA 3FX4A 4N9DA 3IIXA 4QS6A 1XRFA 5H8MA 3N12A 3QFWA 1ZAHA 3TE9A 2G3NA 1T5AA 3W7MA 3IAPA 3TN4A 1Z42A 3PBMA 5CSYA 3EEZA 4C1NB 1CLVA 1V7AA 1KFKA 3NA8A 4IIHA 3CEPA 1EC9A 1XIDA 2EQDA 3MUIA 5AC6A 3GU2A 3RAOA 3GDMA 3W1NA 2BVYA 4HSOA 1EZWA 1CEOA 3OZPA 5I3KA 4R9XA 2VTFA 5JCLA 4ZTYA 1AL7A 2VFGA 2J7CA 4HN4A 5A1AA 2TPSA 1Q63A 3OVRA 3AXXA 4JR5A 2FTYA 3WSUA 1F73A 5K9CA 2A6NA 3CAQA 3WLTA 1U1UA 3PTKA 2EJAA 1OGSA 5GNXA 5TAOA 1MRQA 1W9PA 1XIIA 2DH3A 3AHYA 2DSWA 4Y96A 2MANA 2YB4A 1EJXC 4GZIA 3GM8A 4YPJA 3NZQA 3FW6A 4CGTA 5HMSA 5BRBA 3HG4A 4NY2A 4EXQA 5AVHA 1ZZMA 4DNHA 2X0YA 1TPEA 5A8OA 1QW7A 3O6AA 3G1XA 1EQPA 5AHEA 5A6BA 4MB5A 4GUJA 4NIRA 4F40A 2FGZA 1UBPC 3NL2A 3I6TA 2PPGA 4LQ1A 4W93A 3WBWA 1DV7A 3H26A 3KBWA 3GB6A 1KBKA 2B7PA 2DUAA 4QJ4B 3VNZA 3U48A 1HVXA 3HPSA 3R43A 2J7EA 3MUCA 1DJZA 1XYCA 1E4MM 4UQ9A 1ZU8A 3BAWA 3KWXA 3S1WA 2RUSA 1Z8AA 2ZOXA 3PANA 3JUGA 2BGQA 3AS3A 5KZDA 2DT2A 2YKKA 4D6JA 1SB3B 1IWAA 1LQ0A 3TFXA 2Z24A 4QROA 5LNWA 4YCOA 4B15A 2DSVA 3CNYA 4GR1A 4AEFA 4DM1A 4YMZA 3DAQA 1R47A 3GC2A 2BXYA 4YIWA 1Y5VA 1B3ZA 3PJTA 2ZRYA 4LUYA 1WZAA 3NO3A 4MZYA 4K7YA 4PC8A 5FOOA 3THQA 3LCGA 1XP3A 1TZ9A 3B03A 3GK0A 2Y4SA 3NCOA 4C6OA 1I2PA 3HJEA 3I3BA 5F2MA 3EDDA 2A8XA 4OKDA 4LNCA 1FKXA 1GHRA 2HE8A 3N2MA 3VCNA 5AYIA 1B54A 3PR2A 3COTA 2TPRA 2YDAA 3RLGA 3KBMA 3V35A 2WQPA 3GDLA 1F6KA 1T3QC 1G7UA 3OLGA 4GC3A 2BGSA 1LWIA 3CUJA 3PJXA 1S1PA 3OHIA 4ZOBA 4S3CA 2PDIA 5TD4A 1XLIA 2FZBA 2HEJA 3GVVA 3NQ8A 3EAUA 3AZTA 4FAMA 5I07A 1WO2A 2DVXA 1S1RA 2GDVA 1M6JA 2DT1A 4H8VA 5M2FX 3PZTA 1Z89A 4AIBA 4KIEA 2A21A 1I0BA 4XIAA 1P1XA 3UEQA 3CM4A 3BMWA 3A21A 3MSDA 5JIWA 4RK8A 3W76A 4UIOA 1SFSA 2CFFA 3V0TA 4AYGA 3XINA 3PZNA 2ASHA 1AW5A 3R8RA 3GTFA 4ERIA 1YKWA 1IZJA 1HT6A 5JCMA 3IJIA 1SPQA 4NX5A 3EEGA 1TREA 5PTDA 3H53A 4B4HA 4DXKA 5FAGA 5A6TC 4X60A 4ATDA 3MVTA 2AMXA 2PDFA 3D5HA 2XVNA 4QNWA 1ZSXA 1OK4A 3EYPA 3OU8A 3BW4A 4AHQA 3IVSA 3U0HA 1IQ8A 4KKXA 3AC0A 2PDGA 3SRDA 4ERAA 4AZCA 4WSKA 2Z1WA 2WC4A 4QEHA 3MVIA 1Y5XA 3CPUA 3I7RA 2BMBA 4RZ4A 2NQZA 3C2RA 2NVAA 3PBWA 1H7WA 3B8DA 3P74A 3WH8A 3ZR4A 4D8LA 3DBPA 3GG1A 2WCSA 3MHGA 1ZFJA 2BB0A 2Q8XA 4Z1AA 4AZ7A 3P2VA 3W72A 3AWOA 3ZT7A 1NFGA 2PRHA 5HUOA 2QULA 2YCIX 3VMPA 1OX5A 1YLVA 3TIMA 1O12A 4X22A 1ISZA 4EQRA 4XKYB 1C3FA 4J3UA 4PB5A 1GOMA 2ZYFA 4L6OA 1V3JA 3KW3A 2PA6A 1TE1A 3V0UA 2GGHA 1LOSA 4OTKA 4NVTA 2R9ZA 4CD4A 2REQB 3L4TA 2WNNA 2ZUVA 4FLQA 2V5JA 4TVYA 4HMEA 3DFSA 3T42A 1XD0A 2GUBA 1NHPA 3STGA 2YZ5A 3Q45A 2DDXA 2OU4A 4P7RA 3W7GA 2P50A 4LUSB 3SCVA 3TNBA 4Q22A 1V08A 4IPLA 3JR2A 1RPKA 3IJQA 3KP0A 1E9YB 2HCVA 2WSKA 4JDBA 4EAYA 3KS5A 3GVGA 1UOZA 4JS3A 4X2PA 3UG8A 3BZJA 2E5DA 2WJDA 3GRTA 4Y8EA 1KKRA 4D6GA 1GWJA 4H50A 4AD2A 1K1DA 2OEJA 4HOXA 2C15A 4CQDA 3B8WA 3W1AA 2YA1A 1HG3A 4QQUA 3N4FA 2D73A 1E1EA 2A0NA 4UTHA 2R1MA 5BOFA 5FJRA 1JEHA 4P7NA 1DORA 1SFJA 3VKKA 1UD8A 3GH7A 4E4UA 2GQ9A 1C8QA 2G3JA 4UTTA 3KVLA 3NPXA 1RA5A 4DJDC 4XAFA 2CYGA 3OA5A 1KRBC 3CIXA 3MKKA 1UP2A 1SW7A 2CZFA 2VFIA 4ES4A 2VZVA 3BDKA 5BW6A 2PTZA 1OF6A 5I09A 4KPRA 1MW2A 2V3EA 1V6XA 4LALA 2YVFA 2VGBA 4W7VA 2QIIA 4AD0A 2Y6ZA 1FWWA 4R7OA 2GVJA 1CXFA 1AQFA 4HGXA 2Z4GA 1VHNA 4GJ1A 1UR1A 4JIEA 3TQKA 4E8CA 1NHQA 1LCOA 2IXVA 3RMEA 1UWAA 3LMYA 2Y8VA 4R3UA 1V02A 3KRSA 1OYAA 4H4WA 4LAMA 2POTA 4PMNA 1H0IA 1UH2A 4QLJA 2B7NA 3CH0A 2CIPA 4QCFA 5MKGB 1OJTA 1E1CA 1RY0A 2YR1A 4KGLA 1QWKA 4GNJA 3GNRA 3V1PA 5CH9A 4J5NA 2ZADA 4K8EA 3AMDA 5KTLA 3EWCA 1A4MA 1JUEA 1O1HA 2ZUMA 3VOCA 2VC6A 4O4WA 4PCPA 4MIMA 4LPCA 3ARQA 3WUGA 4LBSA 3GTNA 2WM0A 5DY2A 2ZWYA 5CJNA 3WQ4A 4HK5A 2YQUA 5LSMA 4S3JA 3UPMA 1ZY8A 5T9CE 5JCNA 4DQWA 2VGIA 3LZ5A 3N34A 1QO5A 3S9ZA 2Z7KA 3WZ0E 1FEAA 4J27A 8A3HA 1ZBWA 1Q66A 1OG0A 4C91A 5IHRA 1FHLA 4BV6A 4OBTA 3CL6A 5AHLA 2PC8A 3CGCA 3N04A 4B5WA 3KOZA 1SQ7A 1GREA 5F4WA 2H8XA 1HL8A 1LJYA 1TR1A 3L5LA 2ZWZA 3UYIA 1FY6A 4H4TA 4AWEA 5MF5A 1YBQB 2ISDA 3B9EA 4ATLA 3ABQA 3IIVA 1JD7A 4LY8A 3VKJA 5KVHA 4KCVA 5CG7A 4O1BA 1ITCA 2V2CA 5FD0A 3BVJA 5C9UA 1R3WA 1KFCA 1XLMA 1OCQA 3QOKA 2B7OA 1XH2A 2TODA 4V33A 1SM9A 3EDKA 1FWAC 3W53A 1FVPA 1JGIA 1H6VA 3HRDC 4I6KA 3CYVA 3ZJ8A 4IOTA 1TO3A 4QP0A 3MI2A 2J7BA 3WYZA 1V02E 1HP5A 3DJJA 4DPPA 3TN3A 2AL1A 2AGTA 2YXGA 2CHNA 1DWFM 1N8IA 2PMQA 3HQ1A 2DVTA 3PUGA 3QGKC 4LT9A 1KCXA 2NLIA 3HPXA 3F4NA 3DKLA 3FAXA 1UJQA 4MKNA 3CLWA 3T44A 1VPQA 3S6TA 3EMQA 4PYSA 4A2SA 3WQ6A 3LM3A 3D3AA 3S4TA 4CUCA 1XSIA 4NZFA 4Q4MA 4CQCA 1JL8A 1TPUA 3T8QA 4PMYA 2WPBA 3B9JB 1BRLA 4K6AA 3NVVB 3VZYA 1ISVA 3AIVA 1MUCA 1LF1A 3BJSA 5FI8A 3TSBA 3QSRA 5CC5A 3W75A 1S5NA 1UR3M 3VM5A 3VDGA 3CUZA 1Y0EA 5D30A 4FP1A 3W70A 3CTTA 4AW7A 3M43A 2CLEA 1ZXIC 1QTWA 1E6RA 2XFYA 4IUGA 2PGEA 3AYTA 1OD0A 2VNCA 3GAKA 2J13A 5A6KA 2VCCA 4M1RA 3N9SA 3C2FA 3A5VA 3GG0A 2F6XA 2BXVA 3RR4A 3HO8A 2OJPA 4K3ZA 3EBVA 4N9EA 1B30A 5KZEA 3OODA 4PTMA 3PS7A 1ZJHA 2BTMA 2PD5A 4IPIA 1FO4A 1VGAA 3I4KA 5IFPA 2YCJA 3IK2A 4KFOA 1D3HA 3FEQA 1BVNP 4ASTA 3V18A 3KLLA 3ZLHA 1BWLA 3RX3A 4JHOA 1TJ1A 5XINA 1TQJA 2PTWA 4F79A 3RYSA 3FYPA 3KS6A 3ZT6A 2XVKA 4IM4A 2PDHA 5I2UA 1GTEA 1FDZA 4PFHA 4ZFCA 4PCSA 3HPFA 4IPNB 3O6YX 2PU1A 4IQDA 3E0WA