4BURA

Crystal structure of the reduced human apoptosis inducing factor complexed with nad
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
484
structure length
450
Chain Sequence
APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into the Coenzyme Mediated Monomer-Dimer Transition of the Pro-Apoptotic Apoptosis Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
total genus 136
structure length 450
sequence length 484
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4burA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4burA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4burA01
3LADA 4RSLA 3T37A 3VR8A 4Z26A 2FJAA 2X8CA 1GRTA 4X4JA 1O94A 3QSEA 2R45A 3GYIA 1GRAA 4EMWA 1QJDA 3FIMB 1H7XA 5KVHA 1GALA 1Z6LA 4GCMA 3NHOX 4TLZA 3SFDA 3V3OA 4BV6A 2BYBA 3AEFA 3DJEA 3GMBA 3UKHA 2E4GA 5TR3A 1BGJA 4C3XA 3KU9A 2H89A 3VQRA 1TDEA 1D4CA 1CJ2A 1H83A 2RGOA 3BHKA 4TM1A 2Y6RA 2BXSA 4B65A 2I0ZA 3UKKA 4UP3A 4U2LA 1FL2A 2GH5A 4D04A 2A8XA 1H7WA 4B68A 4B64A 2YR5A 4H2QA 5BUKA 3DJDA 3NN0X 4YWOA 4CNKA 1TDNA 2BCGG 3CPJG 3NYCA 4K7ZA 1JNRA 3DJJA 1PBBA 1CJCA 4AP3A 5BVAA 4USRA 5HXIA 3AYLA 2H88A 4GDEA 5J60A 1VQWA 2XLRA 5CQFA 4H4YA 1B5QA 4EIPA 2VQBA 4YTPA 4O5UA 3BI4A 2YG7A 3GWFA 1EL9A 2VVLA 2X8GA 3ALJA 1IJHA 3PVCA 1GSNA 4CNJA 2C3DA 1O5WA 4IVOB 3BI5A 3ICRA 1B8SA 4K22A 4KPRA 1JRYA 2GQFA 3I3LA 3AE7A 2B9WA 4WCTA 3L8KA 1LQUA 3GSIA 1DJQA 3DK4A 4JY3A 3P9UA 4ECHA 3G5SA 3UOXA 3M0OA 5BULA 1K0JA 1K4QA 1TYTA 1F6MA 3K7TA 2XDOA 5KWFA 2GRTA 4FX9A 3AWIA 3QSSA 4K5RA 3G5RA 1D4EA 4BK1A 5BRTA 2OA1A 3CPHG 4FK1C 4YKFA 3RHAA 3CGBA 3UTEA 1NDAA 1QO8A 5LV9A 1ZP0A 2GQWA 2C67A 3ABVA 3Q9TA 4H4ZA 2YAUA 2WP5A 2ACZA 4XWRA 1XDIA 4GUVA 1FOHA 3IHGA 4J36A 2Z5XA 3H4KA 1EL5A 3AE6A 2GV8A 3QJ4A 2GVCA 4I59A 1L9CA 2OLNA 1NPXA 1CJ3A 3KD9A 4DNAA 3RP8A 1DOEA 4EIQA 2FJDA 1REOA 3P1WA 4H2PA 1D7YA 3DK9A 5EB5A 4FDCB 3FG2P 3M13A 2C70A 2RGHA 2R9ZA 2WU5A 3SQPA 2JB3A 4U8KA 4H7UA 4ICYA 1CJ4A 2GF3A 2C7GA 3CNPA 2VZ2A 4X9NA 3AE3A 1LJ1A 4U2TA 1GT8A 2YR4A 3UKPA 2GAHB 1COYA 5FS7A 3LJPA 1NHSA 5M10A 2QCUA 2WPCA 1ZKQA 1JRXA 1NHPA 5JCLA 2XVHA 3LB8A 2YLTA 4NZHA 4U8MA 4H4TA 5JCMA 4CCRA 2OALA 3K30A 3NN6X 4B69A 2EQ8A 5IPYA 3AE5A 2JK6A 3CGEA 4OPGA 4YTMA 4H4XA 1OJDA 4EQXA 1L9EA 2XVJA 2YLZA 3D8XA 1GESA 2JAEA 1GRHA 2JB1A 1PDHA 3V3NA 3CGCA 2W0HA 1H86A 5IQ1A 2F5ZA 1GOSA 5CKUA 1SEZA 4Y4LA 2YLXA 3VRAA 1GRBA 1NHRA 3NRNA 4YSHA 1KSUA 4C3YA 4Y4MA 4YXDA 2YG4A 2CVJA 4U8OA 2WOWA 4ZCDA 2V3BA 3CGDA 3NG7X 5M0ZA 4CBQA 5KRQA 1ZX9A 3GYJA 4USQA 1PXCA 2QA1A 2GR2A 3ICSA 1OJ9A 5JCKA 3PS9A 4OPIA 1NG3A 4OPTA 2CFYA 2XCGA 3VRBA 4ADWA 3AEBA 4REKA 1FEBA 4XXGA 4RG4A 4GDPA 1DOBA 2VQ7A 1BWCA 1MOKA 2V6OA 4H4WA 4YTNA 2C72A 3S61A 3EANA 2R4JA 1RYIA 2Q6UA 3ALMA 4APNA 4C74A 4OPLA 4J2WA 2GR1A 2BABA 4HB9A 4OPUA 4A65A 4TM0A 1XHCA 3B6DA 1YQZA 3REDA 1ZK7A 2R0GA 4A99A 4Z2UA 4EQSA 4I58A 3VRDB 3DGHA 1VRQB 2GMHA 3IHMA 1CC6A 3GRSA 2Q7VA 2NPXA 1K0IA 1X31B 3GWDA 4LIIA 3KVEA 4GF7A 2ZZBA 2OLOA 2YWLA 4Y4NA 3M12A 4ZN0A 3NGCX 1TYPA 1KDGA 1MXTA 3H8IA 3NNEA 1N4UA 4EMJA 2C73A 3EAOA 3UTFA 2PHHA 3KKJA 2GMJA 1KNRA 2E5VA 4YT0A 1B4VA 1PJ5A 2IIDA 2EQ6A 2WPEA 1GPEA 1XPQA 2C65A 1ZDLA 2BXRA 2V3AA 2XLPA 4B67A 2C3CA 4H4SA 2ARDA 1VG0A 3UOYA 1DXLA 1Y56B 2APGA 1CHUA 3PO7A 1S3BA 5FS9A 2YM2A 4J33A 3DJGX 2WP9A 3SM8A 3CIRA 2DKHA 1P2EA 4EMIA 1GREA 2YG5A 1KNPA 4A6NB 3CPIG 3UCLA 2YG6A 1O95A 4OCGA 1PHHA 1Y56A 2ZZ0A 2BK5A 5KOXA 2BC1A 4H4PA 5U25A 4CY6A 1P2HA 2WEUA 1FECA 2R4EA 1ELIA 1OJCA 4OVIA 1D5TA 3I6DA 5EBKA 2XFOA 3AEDA 3NH3X 1KFYA 1DODA 3NK0X 3V76A 4UDRA 3LXDA 2XFNA 1GV4A 2WDRA 2XYOA 3K7MX 3NLCA 1PJ6A 4D03A 4BJZA 3OZ2A 4H4VA 1IUTA 4JNQA 3ITJA 3AEAA 1OJAA 4UDQA 2XFQA 4NEWA 2VRMA 2YLRA 5KVIA 4AT0A 5JCIA 3ATRA 1H6VA 2YLWA 4H4QA 5EB4A 1YKJA 5U1OA 2BACA 2RGJA 2UZZA 2XVIA 3HZLA 3B3RA 4J56A 1S3EA 3FPZA 1RP0A 4PABA 4B63A 3C4AA 1IUVA 1YQ4A 5KXJA 2EQ7A 3KA7A 2C66A 2QAEA 5FS6A 4MJWA 2TMDA 1L0VA 1D7LA 2VVMA 3ZYXA 4CCQA 5HYMA 3COXA 1TDOA 4YSYA 1NAAA 5FS8A 4LU6A 1HYUA 4EQRA 1CBOA 4K2XA 2OAMA 5KOWA 3KLJA 3NIXA 3O0HA 1H84A 2FJBA 3CNTA 1N1PA 1CC2A 1GTEA 1PBFA 1PN0A 1VG9A 2GB0A 2XLTA 3P4SA 4OPCA 4P9SA 2FJEA 3BNUA 1YY5A 3AE2A 2VVLG 5ER0A 3II4A 3AE4A 2V60A 4LA1A 3P4RA 1E7PA 4KX6A 2AQJA 4JY2A 4AT2A 2YLSA 4ZCCA 1JRZA 2YVGA 2BK4A 3CTYA 3AYIA 3UP5A 3DH9A 4U8IA 3ALLA 1KSSA 3URHA 2Z5YA 1PS9A 4BURA 4Z24A 2XLUA 3OC4A 1Q9IA 3GRTA 4H50A 2B76A 4Z2RA 1E1NA 3SFEA 2AR8A 3AB1A 2WDQA 4AOXA 4EM3A 1B37A 1S2YA 3BNMA 5GSNA 4O5QA 4B1BA 1JU2A 2YG3A 3AEGA 4JN9A 5C3JA 1E39A 2B9YA 3AE1A 1FCDA 1UKVG 4Z44A 1E1KA 2ZBWA 4AOSA 3AECA 2YQUA 3E1TA 2XFPA 3AD7B 3JSKA 3QVPA 4EQWA 5GRTA 2YM1A 3AD8B 1PBEA 3QVRA 2AAQA 3QSMA 3ZDNA 1DNCA 4CRTA 3NTDA 4XWZA 3H8LA 1E6EA 1RSGA 5U63A 4DSHA 5C2TA 1PXAA 1Q1RA 1NHQA 3ADAB 3RP6A 4AP1A 3AXBA 3UTHA 3NKSA 4Z25A 2WP6A 1F8SA 1Q1WA 2C76A 2Q0KA 2V61A 2A87A 4NTDA 2B7RA 1LVLA 3QFAA 2GR0A 1GTHA 2R0CA 2DKIA 2NVKX 5HHFA 4TM3A 1LTXR 3AE9A 4K5SA 2ZZCA 4A7AA 3CN8A 3KPFA 3UOZA 1LPFA 1JOAA 3AEEA 1IUUA 3G5QA 2WU2A 2YVFA 2X50A 1BKWA 3NYEA 3ISHA 2WESA 4C77A 3GD4A 3AYJA 1IUXA 2GAGB 3S5WA 3CNSA 2IVDA 5FMHA 3ATQA 3ICTA 3L1RA 2XVFA 2X8HA 2WOVA 1L9DA 3NK2X 4M52A 2B7SA 1CL0A 1GRFA 3QFBA 1QLBA 4NTEA 1Y0PA 4BK3A 1MO9A 2WBAA 2IVEA 1E1LA 1F8WA 3DGZA 3RNMA 4IA5A 2C64A 1IUSA 1BGNA 2VRLA 3AD9B 4Z43A 2C75A 1GEUA 1ZMCA 2WOIA 3DA1A 5DBJA 3Q6JA 3UP4A 4H4UA 1K0LA 3NYFA 1ZOVA 4BK2A 2EQ9A 3NK1X 4A9WA 1M64A 3DK8A 2WQYA 4N9XA 1H81A 2XFUA 2Y6QA 1GNDA 2BCPA 1TDFA 1EL7A 1PBDA 2R0PA 4WX1A 1S2QA 4YSZA 1ZY8A 2BA9A 4JNAA 1IUWA 1NEKA 3UKFA 3C96A 4J31A 4IV9A 1JEHA 1GETA 2O9ZA 4A79A 2JB2A 2GEWA 4IVMB 2TPRA 4NEVA 1TDKA 3F8DA 5HY5A 2GR3A 3EF6A 4IA6A 2J3NA 4H2NA 2XLSA 1DOCA 3UKQA 3P4QA 1OJTA 3LZWA 1NG4A 4TM4A 2HQMA 3IC9A 2YR6A 4NTCA 1W4XA 2V5ZA 4OPDA 1GERA 3P4PA 1E1MA 3CNDA 3SGLA 1PBCA 3FMWA 4DGKA 4EM4A 1LV0A 1PJ7A 1DJNA 2QA2A 3GD3A 1GXFA 2WPFA 1H82A 1N4VA 2BC0A 2WHDA 3NTAA 2WETA 4PAAA 1LQTA 3UTGA 4U8NA 3BI2A 1F3PA 1F8RA 3EPTA 4HA6A 4RG3A 4U8JA 3LOVA 3D1CA 3UKAA 3UKLA 2R46A 2BS4A 2WDVA 2CULA 1M6IA 1XANA 1EL8A 3AE8A 1TRBA 1V59A 3GDPA 4FK1A 2PYXA 4H4RA 2X3NA 3NT6A 5J7XA 4J34A 2Q0LA 4UDPA 4DSGA 1N4WA 2E1MA 4YSXA 1KF6A 3R9UA 1BF3A 4BJYA 1VDCA 2XVEA 5IQ4A 3RP7A 4YKGA 4TLXA 1EBDA 2BS3A 1FEAA 3VR9A 2B9XA 4U2SA 1ONFA 3F8RA 3WE0A 4U8PA 4H2RA 5L46A 3F8PA 4J57A 3BHFA 2RABA 4JQ9A 5JCNA 1NENA 4A5LA 1GRGA 2JBVA 1CC4A 3DMEA 1D4DA 4A6NA 4JDRA 2BK3A 1AOGA 4E0VA 3K7QX 3IF9A 4Z2TA 2A89A 1BZLA 1JNZA 4B66A 4CY8A 3UOVA 2WS3A 4GRTA 1ZOYA 3CNJA 4U8LA 4X9MA 4K8DA 3GMCA 2X99A 2BS2A 4C5OA 1ZMDA 1CF3A 2JKCA 3IWAA 2CDUA 4GR1A 2FBWA 3FBSA 3GDNA 2VOUA 5EOWA 1PXBA 3C4NA 2YVJA 1YQ3A 3LZXA
chains in the Genus database with same CATH superfamily
3LADA 4RSLA 3T37A 2X8CA 3VDGA 4TVYA 3UXKA 1IYXA 4GCMA 3SFDA 3V3OA 5TR3A 4C3XA 3VQRA 1KKOA 3DIPA 4TM1A 1KCZA 4DYEA 2BXSA 3UJRA 1ZXIC 3SX6A 4II3A 1FL2A 1H7WA 1N60C 3DFHA 3DJDA 3NN0X 2DW7A 3CPJG 3EUB3 2W3RA 5BVAA 2CHRA 3VC5A 1VQWA 2XLRA 4EIPA 3GWFA 3N4EA 3SBFA 2X8GA 3ZVHA 1B8SA 4KPRA 1JRYA 1TE6A 3BSMA 3AE7A 2GGHA 1WUFA 3L8KA 1LQUA 3GSIA 1DJQA 3R11A 2P0IA 3P9UA 5BULA 2W3SA 1F6MA 3K7TA 3NRZB 5KWFA 4YKFA 3RHAA 3DG6A 2GGJA 3UTEA 4H4ZA 2WP5A 2ACZA 3SYIA 1FOHA 2QJJA 2GGIA 3H4KA 4IP5A 1EL5A 3STPA 1L9CA 3VA8A 4EIQA 1REOA 1D7YA 2OKTA 4H7UA 4ICYA 3CNPA 1GT8A 3UKPA 2GAHB 5FS7A 5JCLA 2XVHA 4U8MA 3SN1A 4CCRA 2OALA 3NN6X 4B69A 2EQ8A 3CGEA 4YTMA 4H4XA 2JAEA 5FJTA 4J1OA 2W0HA 3P0WA 1GOSA 5CKUA 4Y4LA 4YSHA 4C3YA 4YXDA 3P93A 3EEZA 3TTEA 2CVJA 5KRQA 1ZX9A 4USQA 2GR2A 3PS9A 3ICSA 4OPTA 3ZLHA 3DG7A 1FEBA 3FCPA 4RG4A 4GGHA 1BWCA 2V6OA 3EANA 3I6TA 4C74A 4OPLA 1E9IA 4X2PA 4JN8A 1XHCA 3MSYA 4A99A 2PU1A 2XH7A 3VRDB 1VRQB 1CC6A 2Q7VA 2NPXA 4Y4NA 3M12A 4ZN0A 6ENLA 3QPEA 1MXTA 1N4UA 2PHHA 2GMJA 2E5VA 5BOEA 4YT0A 2EQ6A 1XPQA 1ZDLA 4H4SA 2ARDA 3UOYA 1CHUA 3PO7A 2YM2A 1MRAA 2WP9A 4HPNA 3TWAA 2YG5A 3CPIG 2YG6A 4OCGA 5KMQA 2ZZ0A 5KOXA 4CY6A 1P2HA 1FECA 4ZOHB 1OJCA 2OQYA 2OZ3A 1DODA 3NK0X 4KPLA 1GV4A 2XYOA 3K7MX 4H1ZA 1TKKA 4JNQA 1MDRA 2XFQA 2YLRA 1JCTA 3ATRA 1H6VA 2YLWA 2RGJA 1IUVA 5KXJA 4MJWA 2TMDA 2VVMA 3ZYXA 3COXA 4EQRA 3KLJA 3O0HA 1H84A 4IL2A 1N1PA 1GTEA 1PBFA 4P9SA 4OPCA 3VFCA 1YY5A 3AE2A 4LA1A 1JROA 5EU9A 1JRZA 2BK4A 1EBHA 3AYIA 3ZVHB 3ALLA 4BURA 2XLUA 1Q9IA 2B76A 3SFEA 2AR8A 3PWGA 4AOXA 1S2YA 4K1WA 5GSNA 3AEGA 2QDEA 1E39A 2B9YA 3ZLFA 4AOSA 2YM1A 3AD8B 3QSMA 3NTDA 1E6EA 5C2TA 4K8GA 1Q1RA 4GFIA 4FI4A 4NTDA 3V5CA 2P88A 3FXGA 1JOAA 1IUUA 3G5QA 2YVFA 2X50A 1BKWA 3NYEA 2GSHA 3ISHA 4C77A 3NVVB 3CNSA 2IVDA 1N5XA 3NXLA 3OP2A 4MGGA 3L1RA 5IDZA 3QFBA 2OZTA 2C64A 2VRLA 4YWSA 4Z43A 2WOIA 3DA1A 3Q6JA 1N62C 4A9WA 4N9XA 3DK8A 2WQYA 3DESA 2XFUA 4HCHA 5FJOA 4K2SA 3U9IA 3C96A 2AKZA 1GETA 2JB2A 4IVMB 4FP1A 1TDKA 3T6CA 4IA6A 3UKQA 1OJTA 1ONEA 3SN4A 1RM6B 1E1MA 3CNDA 3FV9A 1DJNA 3GD3A 1GXFA 2WPFA 1H82A 3NTAA 2BC0A 1H2IA 4U8NA 4RG3A 2R46A 3Q4DA 3R0UA 1XANA 1TRBA 4H4RA 2X3NA 3L5OA 4UDPA 2E1MA 4KEMA 3H70A 3IJQA 3CAWA 5IQ4A 3SR6B 1V97A 3WE0A 4J57A 3BHFA 2PP0A 2RABA 5JCNA 4A6NA 2QDDA 4E0VA 3IF9A 3DG3A 4GRTA 4U8LA 2JKCA 2CDUA 2VOUA 2PTWA 4Z26A 3IJLA 2OZ8A 4EMWA 1QJDA 1GALA 3CMMA 3T4WA 4DWDA 2BYBA 3DJEA 3GMBA 3KU9A 1D4CA 4HYRA 3UCCA 1CJ2A 2GH5A 4D04A 2A8XA 4E4FA 4H2QA 4G6GA 4HCDA 1TDNA 4K7ZA 3DJJA 4GAVA 5HXIA 2C4CA 3DERA 2H88A 5J60A 4HCLA 2VQBA 3BI4A 2YG7A 1EL9A 2PGWA 3THUA 3BI5A 3ICRA 4K22A 2B9WA 2OPJA 4G6HA 1K0JA 4FX9A 3AWIA 1NDAA 1QO8A 2BRYA 3KPKA 3Q9TA 1XDIA 2PA6A 4GUVA 2Z5XA 2GV8A 3QJ4A 2GVCA 3NFUA 1NPXA 1T3QC 5FJUA 3DK9A 4FDCB 3M13A 2R9ZA 3SQPA 4U8KA 1CJ4A 2C7GA 4X9NA 1BKHA 3AE3A 4HN8A 5G5HB 4U2TA 2PGEA 5M10A 2QCUA 3SZWA 4NZHA 3SSZA 3K30A 3GYXA 2JK6A 2P8CA 1OJDA 4EQXA 1L9EA 2YLZA 3VC6A 3GC2A 3D8XA 3CGCA 2YLXA 3VRAA 1GRBA 3NRNA 1SJCA 1PDYA 4Y4MA 4Z17A 4H2HA 5M0ZA 2HXUA 1PXCA 1OJ9A 5JCKA 1NG3A 4NNJA 1P43A 2CFYA 3VRBA 3AEBA 4XXGA 1DOBA 4YTNA 2C72A 3S61A 1R0MA 2GR1A 3B6DA 3REDA 1ZK7A 1K0IA 3GWDA 5G5GB 3KVEA 3N6JA 4A3RA 1TYPA 2C73A 3V5FA 4MMWA 3N4FA 2IIDA 2V3AA 4J33A 1S3BA 1N61C 4A6NB 3UCLA 1Y56A 2BK5A 3NS1B 2BC1A 5U25A 1X2GA 3UXLA 2R4EA 1ELIA 3NVZB 1D5TA 3T2ZA 3OPSA 3RCYA 4BJZA 3OZ2A 1IUTA 3AEAA 1OJAA 4UDQA 4AT0A 3TWBA 2VRMA 4M0XA 2GGGA 1FHUA 3T9PA 2BACA 3HZLA 3FPZA 4PABA 3C4AA 2EQ7A 2C66A 2QAEA 4KT2A 1L0VA 5HYMA 2OLAA 3B97A 3UGVA 5KOWA 3CNTA 1PN0A 2GB0A 3P4SA 3N6HA 2P8BA 3II4A 3AE4A 1E7PA 4JY2A 3HW2A 1WYGA 2MUCA 3IJIA 2YLSA 3CYJA 4G9KA 3UJFA 1NELA 3ENLA 2FKPA 4Z24A 2WDQA 4EM3A 3BNMA 4B1BA 2YG3A 5C3JA 3FVDA 3V4BA 1UKVG 1JPMA 1E1KA 2ZBWA 2YQUA 3I6EA 3AD7B 5GRTA 3QVRA 1PBEA 4CRTA 3H8LA 3CXBA 5U63A 1NHQA 4AP1A 2MNRA 2WP6A 1Q1WA 2V61A 2A87A 1NU5A 3UCDA 4TM3A 1LTXR 3AE9A 4A7AA 3QN3A 3UOZA 2WU2A 3GD4A 3AYJA 1IUXA 3JVAA 3ATQA 3ICTA 1DTNA 1L9DA 4M52A 1F9CA 2B7SA 4NTEA 1QLBA 3RNMA 4IA5A 2C75A 3S5SA 3UP4A 4H4UA 4BK2A 4A35A 2Y6QA 2BCPA 3RGTA 1PBDA 4JHMA 3R10A 4WX1A 4G7FA 4YSZA 2BA9A 4IV9A 2QJMA 2O9ZA 2ZADA 2PS2A 2TPRA 3EF6A 2XLSA 1DOCA 1KD0A 1NG4A 4TM4A 4NTCA 3SGLA 1PBCA 3FMWA 4EM4A 1LV0A 2QA2A 1RVKA 2PTYA 3UTGA 3A7UA 1F8RA 3EPTA 3R07C 3CXOA 3D1CA 2WDVA 1EL8A 3T14A 2GGEA 5J7XA 3PFRA 1JDFA 1VDCA 2XVEA 3MUCA 3RP7A 4TLXA 4U8PA 5L46A 4KWSA 3F8PA 1NENA 4JQ9A 4A5LA 1GRGA 1D4DA 2QGYA 4JDRA 1AOGA 2BK3A 3BJSA 2A89A 4G73A 3UOVA 5J04A 1ZOYA 4K8DA 3GMCA 2BS2A 1CF3A 3P3BA 3ES8A 3GDNA 5EOWA 1XS2A 1PXBA 3R1ZA 4X4JA 3TOYA 3QSEA 3GYIA 1GRAA 5KVHA 1Z6LA 4TLZA 3AEFA 3SZCA 3D47A 2Y6RA 4B65A 4ROPA 4GISA 4G74A 4GAPA 1PDZA 4B68A 4GYPC 2YR5A 4F4RA 2QVHA 2BCGG 3ZVIA 1PBBA 1CJCA 4AP3A 4GDEA 5CQFA 4H4YA 2E5AA 3ALJA 3PVCA 1VQZA 3PG6A 2C3DA 4IVOB 2GQFA 4HNLA 3CK5A 4JY3A 4ECHA 3M0OA 1TYTA 2XDOA 2GRTA 3G5RA 1D4EA 5BRTA 4II2A 3CGBA 3ABVA 2C67A 2YAUA 4XWRA 3AM9A 3IHGA 4J36A 1SB3B 4I59A 2OLNA 1CJ3A 3KD9A 3RP8A 3VCNA 2C70A 4E6MA 3DDMA 2AL2B 2GF3A 4A6GA 4DN1A 2ONEA 2YLTA 2QQ6A 3A7AA 4IL0A 3AE5A 4OPGA 1MNSA 1L8PA 4HNCA 5KMRA 1GESA 2JB1A 1EC8A 1H86A 3MY9A 2ZC8A 2BRAA 1SEZA 1NHRA 4U8OA 3CGDA 3NG7X 3GYJA 2QA1A 3V3WA 2XCGA 5JRBA 3MKCA 4GDPA 1RYIA 2DW6A 3ALMA 3SXIA 3H12A 5KMSA 4APNA 1N63C 4J3ZA 4OPUA 2R0GA 4EQSA 1EBGA 3IHMA 1X31B 4GF7A 2ZZBA 4IP4A 3H8IA 2OQHA 4IZGA 4EMJA 3EAOA 3B9JB 1ELSA 3KKJA 1KNRA 5BOFA 2HZGA 1PJ5A 3D9XA 1GPEA 2XLPA 2P3ZA 1XPYA 1Y56B 2APGA 5FS9A 3DJGX 3SM8A 2DKHA 1P2EA 4EMIA 1SJAA 1O95A 5KMPA 4H4PA 2POZA 3I6DA 2XFOA 3NH3X 1KFYA 4TVWA 4UDRA 2XFNA 2WDRA 5FJRA 2OFJA 1PJ6A 4H4VA 3AMZA 4EWJA 2PCEA 4DXKA 2E3TA 4H4QA 4E4UA 5U1OA 2UZZA 2XVIA 3HPFA 5FS6A 1TDOA 4LU6A 2OAMA 2FJBA 4ZCDA 1VG9A 4DX3A 2VVLG 3P4RA 4KX6A 2AQJA 4AT2A 3H7VA 3UJEA 4ZCCA 4GGBA 2OX4A 3CTYA 3UJ2A 3DH9A 4U8IA 4Z1YA 3URHA 2Z5YA 1PS9A 2PTXA 3OC4A 4H50A 3MZNA 4O5QA 4JN9A 3TQPA 3HYXA 3AE1A 3FJ4A 1FCDA 1TZZA 4Z44A 3E1TA 2XFPA 1W6TA 3JSKA 3QVPA 4H19A 3SQSA 1RSGA 4E5TA 3AXBA 3UTHA 1KKRA 1F8SA 3T2KA 2Q0KA 2B7RA 1LVLA 2GR0A 3JW7A 2DKIA 2NVKX 2FYMA 4K5SA 3CN8A 4MKSA 3KPFA 2AL1A 3S5WA 1FFVC 1MUCA 3TW9A 5FMHA 2X8HA 4BK3A 2IVEA 3DGZA 3OZMA 3HYWA 3AD9B 4DHGA 1GEUA 5DBJA 1K0LA 3NYFA 3NK1X 1M64A 1GNDA 1TDFA 1EL7A 3SZFA 2XH0A 1S2QA 4JNAA 1IUWA 1NEKA 3UKFA 4IHCA 4J31A 1JEHA 4NEVA 2GR3A 3TJ4A 3AN1A 3LZWA 2PTZA 2HQMA 1W4XA 2V5ZA 1GERA 3P4PA 3QLDA 4DGKA 3CT2A 2WHDA 2WETA 1LQTA 1F3PA 4HA6A 3H8AA 4U8JA 3UKLA 1M6IA 1YEYA 3GDPA 3OZYA 4FK1A 3CB3A 2Q0LA 2XGZA 3R9UA 1BF3A 1FIQB 3SN0A 2BS3A 3VR9A 1ONFA 3F8RA 3DGBA 4H2RA 3R25A 3ETRB 3K7QX 4Z2TA 1BZLA 1SJBA 3CNJA 4X9MA 4C5OA 1ZMDA 3IWAA 3FBSA 2XH4A 3C4NA 2YVJA 1YQ3A 3LZXA 3QKEA 3VR8A 2FJAA 1GRTA 1O94A 2R45A 3DFYA 3FIMB 1H7XA 3IK4A 3NHOX 4BV6A 3UKHA 2E4GA 3S47A 1BGJA 2H89A 1TDEA 2RGOA 1H83A 3BHKA 3VCCA 2I0ZA 3UKKA 4UP3A 4U2LA 4B64A 5BUKA 4YWOA 4CNKA 3NYCA 1JNRA 4USRA 3AYLA 1B5QA 4YTPA 4O5UA 2VVLA 4IT1A 1IJHA 2PU0A 1GSNA 4CNJA 1O5WA 4GIRA 2I5QA 2XSXA 3I3LA 4WCTA 4ZA0A 3DK4A 3RR1A 3G5SA 3UOXA 1K4QA 3QSSA 4K5RA 3UJSA 7ENLA 4BK1A 2OA1A 3CPHG 4FK1C 3K1GA 5LV9A 1ZP0A 2GQWA 4ENLA 3GD6A 3T2YA 4NWZA 4E8GA 2AL2A 3AE6A 3T0KA 3NO1A 3A7RA 4DNAA 1DOEA 2FJDA 3P1WA 4M6UA 4H2PA 5EB5A 3FG2P 2RGHA 2WU5A 2JB3A 2VZ2A 1LJ1A 2YR4A 1COYA 3LJPA 2O56A 1NHSA 1SJDA 1ZKQA 2GL5A 1NHPA 2WPCA 1JRXA 3LB8A 4H4TA 5JCMA 5IPYA 1WUEA 2XVJA 1GRHA 1PDHA 3V3NA 2W54A 5IQ1A 2F5ZA 3HRDC 1KN0A 1FFUC 1KSUA 2YG4A 2PMQA 2WOWA 2V3BA 4CBQA 2XH2A 3OTRA 4OPIA 2RDXA 4ADWA 4REKA 3NVYB 2VQ7A 1MOKA 4H4WA 2HXTA 3JZUA 2R4JA 2Q6UA 2HNEA 1R6WA 3SZ0A 4J2WA 4A65A 2BABA 4HB9A 1JPDX 4TM0A 1YQZA 2GDQA 4Z2UA 3HYVA 4I58A 1EC7A 3DGHA 2GMHA 3GRSA 3SY4A 4LIIA 2OLOA 2YWLA 3NGCX 1KDGA 3NNEA 1MDLA 3UTFA 1B4VA 2WPEA 2C65A 2BXRA 4B67A 3NVWB 2C3CA 1VG0A 3PK7A 1DXLA 3DEQA 2NQLA 3CIRA 1GREA 2OVLA 1KNPA 3I4KA 1PHHA 4GMEA 2WEUA 4OVIA 3RITA 3AEDA 5EBKA 1STZA 2AKMA 3TCSA 3PWIA 2PPGA 3V76A 3LXDA 3NLCA 4D03A 3U4FA 3ITJA 4NEWA 5KVIA 5JCIA 3SJNA 5EB4A 3NZGA 1YKJA 4H83A 1FHVA 2PSNA 3B3RA 4J56A 1S3EA 1RP0A 4B63A 1YQ4A 3KA7A 4CCQA 1D7LA 3GY1A 1NAAA 4YSYA 5FS8A 1HYUA 1CBOA 4K2XA 3NIXA 1CC2A 2XLTA 4GYPA 2FJEA 3BNUA 5ER0A 2V60A 3KUMA 2YVGA 1FO4A 3UP5A 1KSSA 5KNLA 2QJNA 3GRTA 4Z2RA 1E1NA 3AB1A 2W55A 1B37A 3OW1A 4JN7A 1JU2A 1JRPA 1N5WC 1BQGA 1VDVA 3AECA 4EQWA 2AAQA 3ZDNA 1DNCA 4XWZA 1ECQA 4DSHA 1PXAA 2PP3A 3ADAB 3RP6A 4Z25A 3NKSA 2C76A 2OG9A 3QFAA 1GTHA 5FJPA 2R0CA 5HHFA 2ZZCA 3QTPA 3ZLGA 1LPFA 3AEEA 2PODA 2WESA 1S7MA 2GAGB 3FYYA 2XVFA 2WOVA 3NK2X 1CL0A 1GRFA 1Y0PA 1MO9A 2WBAA 1E1LA 1F8WA 1IUSA 1BGNA 1ZMCA 4ZCWA 1ZOVA 1X2HA 2EQ9A 3RO6A 1H81A 3T8QA 2R0PA 1P48A 1ZY8A 4A79A 3RRAA 2GEWA 3GO2A 3F8DA 5HY5A 2J3NA 4H2NA 3P4QA 3R0KA 3IC9A 2YR6A 2PP1A 3MWCA 4OPDA 3Q45A 1EC9A 1PJ7A 1N4VA 4PAAA 3BI2A 3D46A 3LOVA 3UKAA 3MQTA 2BS4A 2CULA 3AE8A 1V59A 2PYXA 3NT6A 4J34A 4DSGA 2OO6A 1N4WA 4YSXA 1KF6A 3BOXA 4BJYA 4G8TA 5ENLA 4YKGA 1EBDA 1FEAA 2B9XA 4U2SA 3EKGA 1OEPA 2JBVA 1CC4A 3DMEA 1JNZA 4B66A 4CY8A 3ES7A 2WS3A 2X99A 4GR1A 2FBWA 3TJIA 3T31A
chains in the Genus database with same CATH topology
3LADA 4RSLA 3T37A 3VR8A 4Z26A 2FJAA 2X8CA 1GRTA 4X4JA 1O94A 3QSEA 2R45A 3GYIA 1GRAA 4EMWA 1QJDA 3FIMB 1H7XA 5KVHA 1GALA 1Z6LA 3CMMA 3NHOX 4GCMA 4TLZA 3SFDA 3V3OA 4BV6A 2BYBA 3AEFA 3DJEA 3SZCA 3GMBA 3UKHA 2E4GA 5TR3A 1BGJA 4C3XA 3KU9A 2H89A 3VQRA 1TDEA 1D4CA 1CJ2A 1H83A 2RGOA 3BHKA 4TM1A 2Y6RA 2BXSA 4B65A 2I0ZA 3UKKA 4UP3A 3SX6A 4U2LA 4II3A 1FL2A 2GH5A 4G74A 4D04A 4GAPA 2A8XA 1H7WA 4B68A 4B64A 2YR5A 4H2QA 5BUKA 3DJDA 3NN0X 4G6GA 4YWOA 4CNKA 1TDNA 2BCGG 3CPJG 3NYCA 4K7ZA 1JNRA 3DJJA 1PBBA 1CJCA 4AP3A 5BVAA 4GAVA 4USRA 5HXIA 2C4CA 3AYLA 2H88A 4GDEA 5J60A 1VQWA 2XLRA 5CQFA 4H4YA 1B5QA 4EIPA 2VQBA 4YTPA 4O5UA 3BI4A 2YG7A 3GWFA 1EL9A 2VVLA 2X8GA 3ALJA 1IJHA 3PVCA 3PG6A 1GSNA 4CNJA 2C3DA 1O5WA 4IVOB 3BI5A 3ICRA 1B8SA 4K22A 4KPRA 1JRYA 2GQFA 3I3LA 3AE7A 2B9WA 4WCTA 3L8KA 4G6HA 1LQUA 3GSIA 1DJQA 3DK4A 4JY3A 3P9UA 4ECHA 3G5SA 3UOXA 3M0OA 5BULA 1K0JA 1K4QA 1TYTA 1F6MA 3K7TA 2XDOA 5KWFA 2GRTA 4FX9A 3AWIA 3QSSA 4K5RA 3G5RA 1D4EA 4BK1A 5BRTA 2OA1A 3CPHG 4FK1C 4II2A 4YKFA 3CGBA 3RHAA 1NDAA 1QO8A 3UTEA 1ZP0A 2BRYA 2GQWA 2C67A 3ABVA 5LV9A 3KPKA 3Q9TA 4H4ZA 3T2YA 2YAUA 2WP5A 2ACZA 4XWRA 4NWZA 1XDIA 3SYIA 4GUVA 1FOHA 3IHGA 4J36A 2Z5XA 3H4KA 1EL5A 3AE6A 2GV8A 3QJ4A 3T0KA 2GVCA 4I59A 1L9CA 2OLNA 1NPXA 1CJ3A 3KD9A 4DNAA 3RP8A 1DOEA 4EIQA 2FJDA 1REOA 3P1WA 4H2PA 1D7YA 3DK9A 5EB5A 4FDCB 3FG2P 3M13A 2C70A 2RGHA 2R9ZA 2WU5A 3SQPA 2JB3A 4U8KA 4H7UA 4ICYA 1CJ4A 2GF3A 2C7GA 3CNPA 2VZ2A 4X9NA 3AE3A 1LJ1A 4U2TA 1GT8A 2YR4A 3UKPA 2GAHB 1COYA 5FS7A 3LJPA 1NHSA 5M10A 2QCUA 2WPCA 1ZKQA 1JRXA 1NHPA 5JCLA 2XVHA 3LB8A 2YLTA 4NZHA 4U8MA 3SZWA 4H4TA 5JCMA 4CCRA 2OALA 3K30A 3NN6X 4B69A 3GYXA 2EQ8A 5IPYA 3AE5A 2JK6A 3CGEA 4OPGA 4YTMA 4H4XA 1OJDA 4EQXA 1L9EA 2XVJA 2YLZA 3D8XA 5KMRA 1GESA 2JAEA 1GRHA 2JB1A 1PDHA 3V3NA 3CGCA 2W0HA 1H86A 5IQ1A 2F5ZA 1GOSA 2BRAA 5CKUA 1KN0A 1SEZA 4Y4LA 2YLXA 3VRAA 1GRBA 1NHRA 3NRNA 4YSHA 1KSUA 4C3YA 4Y4MA 4YXDA 2YG4A 2CVJA 4U8OA 2WOWA 4ZCDA 2V3BA 3CGDA 3NG7X 5M0ZA 4CBQA 5KRQA 1ZX9A 3GYJA 4USQA 1PXCA 2QA1A 2GR2A 3ICSA 1OJ9A 5JCKA 3PS9A 4OPIA 1NG3A 4OPTA 2CFYA 4NNJA 2XCGA 5JRBA 3VRBA 4ADWA 3AEBA 4REKA 1FEBA 2IIDA 4RG4A 4GDPA 1DOBA 4XXGA 2VQ7A 1BWCA 1MOKA 2V6OA 4H4WA 4YTNA 2C72A 3S61A 3EANA 2R4JA 1RYIA 2Q6UA 3ALMA 3SXIA 5KMSA 4APNA 3SZ0A 4C74A 4OPLA 4J2WA 2GR1A 2BABA 4HB9A 4OPUA 4A65A 4TM0A 1XHCA 3B6DA 1YQZA 3REDA 1ZK7A 2R0GA 4A99A 4Z2UA 3HYVA 4EQSA 4I58A 3VRDB 3DGHA 1VRQB 2GMHA 3IHMA 1CC6A 3GRSA 2Q7VA 2NPXA 1K0IA 1X31B 3GWDA 3SY4A 4LIIA 3KVEA 4GF7A 2ZZBA 2OLOA 2YWLA 4Y4NA 3M12A 4ZN0A 3NGCX 1TYPA 1KDGA 1MXTA 3H8IA 3NNEA 1N4UA 4EMJA 2C73A 3EAOA 3UTFA 2PHHA 3KKJA 2GMJA 1KNRA 2E5VA 4YT0A 1B4VA 1PJ5A 3D9XA 2EQ6A 2WPEA 1GPEA 1XPQA 2C65A 1ZDLA 2BXRA 2V3AA 2XLPA 4B67A 2C3CA 4H4SA 2ARDA 1VG0A 3UOYA 1DXLA 1Y56B 2APGA 1CHUA 3PO7A 1S3BA 5FS9A 2YM2A 4J33A 3DJGX 2WP9A 3SM8A 3CIRA 2DKHA 1P2EA 4EMIA 1GREA 2YG5A 1KNPA 4A6NB 3CPIG 3UCLA 2YG6A 1O95A 4OCGA 1PHHA 1Y56A 5KMQA 5KMPA 2ZZ0A 2BK5A 5KOXA 2BC1A 4H4PA 5U25A 4CY6A 1P2HA 2WEUA 1FECA 2R4EA 1ELIA 1OJCA 4OVIA 1D5TA 3I6DA 5EBKA 2XFOA 3AEDA 3NH3X 1KFYA 1DODA 3NK0X 3V76A 4UDRA 3T2ZA 3LXDA 2XFNA 1GV4A 2WDRA 2XYOA 3K7MX 3NLCA 1PJ6A 4D03A 4BJZA 3OZ2A 4H4VA 1IUTA 4JNQA 3ITJA 3AEAA 1OJAA 4UDQA 2XFQA 4NEWA 2VRMA 2YLRA 5KVIA 4AT0A 5JCIA 3ATRA 1H6VA 2YLWA 4H4QA 5EB4A 1YKJA 5U1OA 2BACA 2RGJA 2UZZA 2XVIA 3HZLA 3B3RA 4J56A 1S3EA 3FPZA 1RP0A 4PABA 4B63A 3C4AA 1IUVA 1YQ4A 5KXJA 2EQ7A 3KA7A 2C66A 2QAEA 5FS6A 4MJWA 2TMDA 1L0VA 1D7LA 2VVMA 3ZYXA 4CCQA 5HYMA 3COXA 1TDOA 4YSYA 1NAAA 5FS8A 4LU6A 1HYUA 4EQRA 1CBOA 4K2XA 2OAMA 5KOWA 3KLJA 3NIXA 3O0HA 1H84A 2FJBA 3CNTA 1N1PA 1CC2A 1GTEA 1PBFA 1PN0A 1VG9A 2GB0A 2XLTA 3P4SA 4OPCA 4P9SA 2FJEA 3BNUA 1YY5A 3AE2A 2VVLG 5ER0A 3II4A 3AE4A 2V60A 4LA1A 3P4RA 1E7PA 4KX6A 2AQJA 4JY2A 4AT2A 2YLSA 4ZCCA 1JRZA 2YVGA 2BK4A 4G9KA 3CTYA 3AYIA 3UP5A 3DH9A 4U8IA 3ALLA 1KSSA 5KNLA 3URHA 2Z5YA 1PS9A 4BURA 4Z24A 2XLUA 3OC4A 1Q9IA 3GRTA 4H50A 2B76A 4Z2RA 1E1NA 3SFEA 2AR8A 3AB1A 2WDQA 4AOXA 4EM3A 1B37A 1S2YA 3BNMA 5GSNA 4O5QA 4B1BA 1JU2A 2YG3A 3AEGA 3HYXA 4JN9A 5C3JA 1E39A 2B9YA 3AE1A 1FCDA 1UKVG 4Z44A 1E1KA 2ZBWA 4AOSA 3AECA 2YQUA 3E1TA 2XFPA 3AD7B 3JSKA 3QVPA 4EQWA 5GRTA 2YM1A 3AD8B 1PBEA 3QVRA 2AAQA 3QSMA 3ZDNA 1DNCA 4CRTA 3NTDA 4XWZA 3H8LA 1E6EA 1RSGA 5U63A 4DSHA 5C2TA 1PXAA 1Q1RA 1NHQA 3ADAB 3RP6A 4AP1A 3AXBA 3UTHA 3NKSA 4Z25A 2WP6A 1F8SA 3T2KA 1Q1WA 2C76A 2Q0KA 2V61A 2A87A 4NTDA 2B7RA 1LVLA 3QFAA 2GR0A 1GTHA 2R0CA 2DKIA 2NVKX 5HHFA 4TM3A 1LTXR 3AE9A 4K5SA 2ZZCA 4A7AA 3CN8A 3KPFA 3UOZA 1LPFA 1JOAA 3AEEA 1IUUA 3G5QA 2WU2A 2YVFA 2X50A 1BKWA 3NYEA 3ISHA 2WESA 4C77A 3GD4A 3AYJA 1S7MA 1IUXA 2GAGB 3S5WA 3CNSA 2IVDA 5FMHA 3ATQA 3ICTA 3L1RA 2XVFA 2X8HA 2WOVA 1L9DA 3NK2X 4M52A 2B7SA 1CL0A 1GRFA 3QFBA 1QLBA 4NTEA 1Y0PA 4BK3A 1MO9A 2WBAA 2IVEA 1E1LA 1F8WA 3DGZA 3RNMA 4IA5A 2C64A 1IUSA 3HYWA 1BGNA 2VRLA 3AD9B 4Z43A 2C75A 1GEUA 1ZMCA 2WOIA 3DA1A 5DBJA 3Q6JA 3UP4A 4H4UA 1K0LA 3NYFA 1ZOVA 4BK2A 2EQ9A 3NK1X 4A9WA 1M64A 3DK8A 2WQYA 4N9XA 1H81A 2XFUA 2Y6QA 1GNDA 2BCPA 1TDFA 1EL7A 1PBDA 2R0PA 3SZFA 4WX1A 1S2QA 4YSZA 1ZY8A 2BA9A 4JNAA 1IUWA 1NEKA 3UKFA 3C96A 4J31A 4IV9A 1JEHA 1GETA 2O9ZA 4A79A 2JB2A 2GEWA 4IVMB 2TPRA 4NEVA 1TDKA 3F8DA 5HY5A 2GR3A 3EF6A 4IA6A 2J3NA 4H2NA 2XLSA 1DOCA 3UKQA 3P4QA 1OJTA 3LZWA 1NG4A 4TM4A 2HQMA 3IC9A 2YR6A 4NTCA 1W4XA 2V5ZA 4OPDA 1GERA 3P4PA 1E1MA 3CNDA 3SGLA 1PBCA 3FMWA 4DGKA 4EM4A 1LV0A 1PJ7A 1DJNA 2QA2A 3GD3A 1GXFA 2WPFA 1H82A 1N4VA 2BC0A 2WHDA 3NTAA 2WETA 4PAAA 1LQTA 3UTGA 1H2IA 4U8NA 3BI2A 1F3PA 1F8RA 3EPTA 4HA6A 4RG3A 4U8JA 3LOVA 3D1CA 3UKAA 3UKLA 2R46A 2BS4A 2WDVA 2CULA 1M6IA 1XANA 1EL8A 3AE8A 3T14A 1TRBA 1V59A 3GDPA 4FK1A 2PYXA 4H4RA 2X3NA 3NT6A 3L5OA 5J7XA 4J34A 2Q0LA 4UDPA 4DSGA 1N4WA 2E1MA 4YSXA 1KF6A 3R9UA 1BF3A 4BJYA 1VDCA 2XVEA 5IQ4A 3RP7A 4YKGA 4TLXA 1EBDA 2BS3A 1FEAA 3VR9A 2B9XA 4U2SA 1ONFA 3F8RA 3WE0A 4U8PA 4H2RA 5L46A 3F8PA 4J57A 3BHFA 2RABA 4JQ9A 5JCNA 1NENA 4A5LA 1GRGA 2JBVA 1CC4A 3DMEA 1D4DA 4A6NA 4JDRA 2BK3A 1AOGA 4E0VA 3K7QX 3IF9A 4Z2TA 2A89A 1BZLA 1JNZA 4G73A 4B66A 3UOVA 4CY8A 2WS3A 4GRTA 1ZOYA 3CNJA 4U8LA 4X9MA 4K8DA 3GMCA 2X99A 2BS2A 4C5OA 1ZMDA 1CF3A 2JKCA 3IWAA 2CDUA 4GR1A 2FBWA 3FBSA 3GDNA 2VOUA 5EOWA 1PXBA 3C4NA 2YVJA 1YQ3A 3LZXA 3T31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LAD A;  4RSL A;  3T37 A;  3VR8 A;  4Z26 A;  2FJA A;  2X8C A;  1GRT A;  4X4J A;  1O94 A;  3QSE A;  2R45 A;  3GYI A;  1GRA A;  4EMW A;  1QJD A;  3FIM B;  1H7X A;  5KVH A;  1GAL A;  1Z6L A;  4GCM A;  3NHO X;  4TLZ A;  3SFD A;  3V3O A;  4BV6 A;  2BYB A;  3AEF A;  3DJE A;  3GMB A;  3UKH A;  2E4G A;  5TR3 A;  1BGJ A;  4C3X A;  3KU9 A;  2H89 A;  3VQR A;  1TDE A;  1D4C A;  1CJ2 A;  1H83 A;  2RGO A;  3BHK A;  4TM1 A;  2Y6R A;  2BXS A;  4B65 A;  2I0Z A;  3UKK A;  4UP3 A;  4U2L A;  1FL2 A;  2GH5 A;  4D04 A;  2A8X A;  1H7W A;  4B68 A;  4B64 A;  2YR5 A;  4H2Q A;  5BUK A;  3DJD A;  3NN0 X;  4YWO A;  4CNK A;  1TDN A;  2BCG G;  3CPJ G;  3NYC A;  4K7Z A;  1JNR A;  3DJJ A;  1PBB A;  1CJC A;  4AP3 A;  5BVA A;  4USR A;  5HXI A;  3AYL A;  2H88 A;  4GDE A;  5J60 A;  1VQW A;  2XLR A;  5CQF A;  4H4Y A;  1B5Q A;  4EIP A;  2VQB A;  4YTP A;  4O5U A;  3BI4 A;  2YG7 A;  3GWF A;  1EL9 A;  2VVL A;  2X8G A;  3ALJ A;  1IJH A;  3PVC A;  1GSN A;  4CNJ A;  2C3D A;  1O5W A;  4IVO B;  3BI5 A;  3ICR A;  1B8S A;  4K22 A;  4KPR A;  1JRY A;  2GQF A;  3I3L A;  3AE7 A;  2B9W A;  4WCT A;  3L8K A;  1LQU A;  3GSI A;  1DJQ A;  3DK4 A;  4JY3 A;  3P9U A;  4ECH A;  3G5S A;  3UOX A;  3M0O A;  5BUL A;  1K0J A;  1K4Q A;  1TYT A;  1F6M A;  3K7T A;  2XDO A;  5KWF A;  2GRT A;  4FX9 A;  3AWI A;  3QSS A;  4K5R A;  3G5R A;  1D4E A;  4BK1 A;  5BRT A;  2OA1 A;  3CPH G;  4FK1 C;  4YKF A;  3RHA A;  3CGB A;  3UTE A;  1NDA A;  1QO8 A;  5LV9 A;  1ZP0 A;  2GQW A;  2C67 A;  3ABV A;  3Q9T A;  4H4Z A;  2YAU A;  2WP5 A;  2ACZ A;  4XWR A;  1XDI A;  4GUV A;  1FOH A;  3IHG A;  4J36 A;  2Z5X A;  3H4K A;  1EL5 A;  3AE6 A;  2GV8 A;  3QJ4 A;  2GVC A;  4I59 A;  1L9C A;  2OLN A;  1NPX A;  1CJ3 A;  3KD9 A;  4DNA A;  3RP8 A;  1DOE A;  4EIQ A;  2FJD A;  1REO A;  3P1W A;  4H2P A;  1D7Y A;  3DK9 A;  5EB5 A;  4FDC B;  3FG2 P;  3M13 A;  2C70 A;  2RGH A;  2R9Z A;  2WU5 A;  3SQP A;  2JB3 A;  4U8K A;  4H7U A;  4ICY A;  1CJ4 A;  2GF3 A;  2C7G A;  3CNP A;  2VZ2 A;  4X9N A;  3AE3 A;  1LJ1 A;  4U2T A;  1GT8 A;  2YR4 A;  3UKP A;  2GAH B;  1COY A;  5FS7 A;  3LJP A;  1NHS A;  5M10 A;  2QCU A;  2WPC A;  1ZKQ A;  1JRX A;  1NHP A;  5JCL A;  2XVH A;  3LB8 A;  2YLT A;  4NZH A;  4U8M A;  4H4T A;  5JCM A;  4CCR A;  2OAL A;  3K30 A;  3NN6 X;  4B69 A;  2EQ8 A;  5IPY A;  3AE5 A;  2JK6 A;  3CGE A;  4OPG A;  4YTM A;  4H4X A;  1OJD A;  4EQX A;  1L9E A;  2XVJ A;  2YLZ A;  3D8X A;  1GES A;  2JAE A;  1GRH A;  2JB1 A;  1PDH A;  3V3N A;  3CGC A;  2W0H A;  1H86 A;  5IQ1 A;  2F5Z A;  1GOS A;  5CKU A;  1SEZ A;  4Y4L A;  2YLX A;  3VRA A;  1GRB A;  1NHR A;  3NRN A;  4YSH A;  1KSU A;  4C3Y A;  4Y4M A;  4YXD A;  2YG4 A;  2CVJ A;  4U8O A;  2WOW A;  4ZCD A;  2V3B A;  3CGD A;  3NG7 X;  5M0Z A;  4CBQ A;  5KRQ A;  1ZX9 A;  3GYJ A;  4USQ A;  1PXC A;  2QA1 A;  2GR2 A;  3ICS A;  1OJ9 A;  5JCK A;  3PS9 A;  4OPI A;  1NG3 A;  4OPT A;  2CFY A;  2XCG A;  3VRB A;  4ADW A;  3AEB A;  4REK A;  1FEB A;  4XXG A;  4RG4 A;  4GDP A;  1DOB A;  2VQ7 A;  1BWC A;  1MOK A;  2V6O A;  4H4W A;  4YTN A;  2C72 A;  3S61 A;  3EAN A;  2R4J A;  1RYI A;  2Q6U A;  3ALM A;  4APN A;  4C74 A;  4OPL A;  4J2W A;  2GR1 A;  2BAB A;  4HB9 A;  4OPU A;  4A65 A;  4TM0 A;  1XHC A;  3B6D A;  1YQZ A;  3RED A;  1ZK7 A;  2R0G A;  4A99 A;  4Z2U A;  4EQS A;  4I58 A;  3VRD B;  3DGH A;  1VRQ B;  2GMH A;  3IHM A;  1CC6 A;  3GRS A;  2Q7V A;  2NPX A;  1K0I A;  1X31 B;  3GWD A;  4LII A;  3KVE A;  4GF7 A;  2ZZB A;  2OLO A;  2YWL A;  4Y4N A;  3M12 A;  4ZN0 A;  3NGC X;  1TYP A;  1KDG A;  1MXT A;  3H8I A;  3NNE A;  1N4U A;  4EMJ A;  2C73 A;  3EAO A;  3UTF A;  2PHH A;  3KKJ A;  2GMJ A;  1KNR A;  2E5V A;  4YT0 A;  1B4V A;  1PJ5 A;  2IID A;  2EQ6 A;  2WPE A;  1GPE A;  1XPQ A;  2C65 A;  1ZDL A;  2BXR A;  2V3A A;  2XLP A;  4B67 A;  2C3C A;  4H4S A;  2ARD A;  1VG0 A;  3UOY A;  1DXL A;  1Y56 B;  2APG A;  1CHU A;  3PO7 A;  1S3B A;  5FS9 A;  2YM2 A;  4J33 A;  3DJG X;  2WP9 A;  3SM8 A;  3CIR A;  2DKH A;  1P2E A;  4EMI A;  1GRE A;  2YG5 A;  1KNP A;  4A6N B;  3CPI G;  3UCL A;  2YG6 A;  1O95 A;  4OCG A;  1PHH A;  1Y56 A;  2ZZ0 A;  2BK5 A;  5KOX A;  2BC1 A;  4H4P A;  5U25 A;  4CY6 A;  1P2H A;  2WEU A;  1FEC A;  2R4E A;  1ELI A;  1OJC A;  4OVI A;  1D5T A;  3I6D A;  5EBK A;  2XFO A;  3AED A;  3NH3 X;  1KFY A;  1DOD A;  3NK0 X;  3V76 A;  4UDR A;  3LXD A;  2XFN A;  1GV4 A;  2WDR A;  2XYO A;  3K7M X;  3NLC A;  1PJ6 A;  4D03 A;  4BJZ A;  3OZ2 A;  4H4V A;  1IUT A;  4JNQ A;  3ITJ A;  3AEA A;  1OJA A;  4UDQ A;  2XFQ A;  4NEW A;  2VRM A;  2YLR A;  5KVI A;  4AT0 A;  5JCI A;  3ATR A;  1H6V A;  2YLW A;  4H4Q A;  5EB4 A;  1YKJ A;  5U1O A;  2BAC A;  2RGJ A;  2UZZ A;  2XVI A;  3HZL A;  3B3R A;  4J56 A;  1S3E A;  3FPZ A;  1RP0 A;  4PAB A;  4B63 A;  3C4A A;  1IUV A;  1YQ4 A;  5KXJ A;  2EQ7 A;  3KA7 A;  2C66 A;  2QAE A;  5FS6 A;  4MJW A;  2TMD A;  1L0V A;  1D7L A;  2VVM A;  3ZYX A;  4CCQ A;  5HYM A;  3COX A;  1TDO A;  4YSY A;  1NAA A;  5FS8 A;  4LU6 A;  1HYU A;  4EQR A;  1CBO A;  4K2X A;  2OAM A;  5KOW A;  3KLJ A;  3NIX A;  3O0H A;  1H84 A;  2FJB A;  3CNT A;  1N1P A;  1CC2 A;  1GTE A;  1PBF A;  1PN0 A;  1VG9 A;  2GB0 A;  2XLT A;  3P4S A;  4OPC A;  4P9S A;  2FJE A;  3BNU A;  1YY5 A;  3AE2 A;  2VVL G;  5ER0 A;  3II4 A;  3AE4 A;  2V60 A;  4LA1 A;  3P4R A;  1E7P A;  4KX6 A;  2AQJ A;  4JY2 A;  4AT2 A;  2YLS A;  4ZCC A;  1JRZ A;  2YVG A;  2BK4 A;  3CTY A;  3AYI A;  3UP5 A;  3DH9 A;  4U8I A;  3ALL A;  1KSS A;  3URH A;  2Z5Y A;  1PS9 A;  4BUR A;  4Z24 A;  2XLU A;  3OC4 A;  1Q9I A;  3GRT A;  4H50 A;  2B76 A;  4Z2R A;  1E1N A;  3SFE A;  2AR8 A;  3AB1 A;  2WDQ A;  4AOX A;  4EM3 A;  1B37 A;  1S2Y A;  3BNM A;  5GSN A;  4O5Q A;  4B1B A;  1JU2 A;  2YG3 A;  3AEG A;  4JN9 A;  5C3J A;  1E39 A;  2B9Y A;  3AE1 A;  1FCD A;  1UKV G;  4Z44 A;  1E1K A;  2ZBW A;  4AOS A;  3AEC A;  2YQU A;  3E1T A;  2XFP A;  3AD7 B;  3JSK A;  3QVP A;  4EQW A;  5GRT A;  2YM1 A;  3AD8 B;  1PBE A;  3QVR A;  2AAQ A;  3QSM A;  3ZDN A;  1DNC A;  4CRT A;  3NTD A;  4XWZ A;  3H8L A;  1E6E A;  1RSG A;  5U63 A;  4DSH A;  5C2T A;  1PXA A;  1Q1R A;  1NHQ A;  3ADA B;  3RP6 A;  4AP1 A;  3AXB A;  3UTH A;  3NKS A;  4Z25 A;  2WP6 A;  1F8S A;  1Q1W A;  2C76 A;  2Q0K A;  2V61 A;  2A87 A;  4NTD A;  2B7R A;  1LVL A;  3QFA A;  2GR0 A;  1GTH A;  2R0C A;  2DKI A;  2NVK X;  5HHF A;  4TM3 A;  1LTX R;  3AE9 A;  4K5S A;  2ZZC A;  4A7A A;  3CN8 A;  3KPF A;  3UOZ A;  1LPF A;  1JOA A;  3AEE A;  1IUU A;  3G5Q A;  2WU2 A;  2YVF A;  2X50 A;  1BKW A;  3NYE A;  3ISH A;  2WES A;  4C77 A;  3GD4 A;  3AYJ A;  1IUX A;  2GAG B;  3S5W A;  3CNS A;  2IVD A;  5FMH A;  3ATQ A;  3ICT A;  3L1R A;  2XVF A;  2X8H A;  2WOV A;  1L9D A;  3NK2 X;  4M52 A;  2B7S A;  1CL0 A;  1GRF A;  3QFB A;  1QLB A;  4NTE A;  1Y0P A;  4BK3 A;  1MO9 A;  2WBA A;  2IVE A;  1E1L A;  1F8W A;  3DGZ A;  3RNM A;  4IA5 A;  2C64 A;  1IUS A;  1BGN A;  2VRL A;  3AD9 B;  4Z43 A;  2C75 A;  1GEU A;  1ZMC A;  2WOI A;  3DA1 A;  5DBJ A;  3Q6J A;  3UP4 A;  4H4U A;  1K0L A;  3NYF A;  1ZOV A;  4BK2 A;  2EQ9 A;  3NK1 X;  4A9W A;  1M64 A;  3DK8 A;  2WQY A;  4N9X A;  1H81 A;  2XFU A;  2Y6Q A;  1GND A;  2BCP A;  1TDF A;  1EL7 A;  1PBD A;  2R0P A;  4WX1 A;  1S2Q A;  4YSZ A;  1ZY8 A;  2BA9 A;  4JNA A;  1IUW A;  1NEK A;  3UKF A;  3C96 A;  4J31 A;  4IV9 A;  1JEH A;  1GET A;  2O9Z A;  4A79 A;  2JB2 A;  2GEW A;  4IVM B;  2TPR A;  4NEV A;  1TDK A;  3F8D A;  5HY5 A;  2GR3 A;  3EF6 A;  4IA6 A;  2J3N A;  4H2N A;  2XLS A;  1DOC A;  3UKQ A;  3P4Q A;  1OJT A;  3LZW A;  1NG4 A;  4TM4 A;  2HQM A;  3IC9 A;  2YR6 A;  4NTC A;  1W4X A;  2V5Z A;  4OPD A;  1GER A;  3P4P A;  1E1M A;  3CND A;  3SGL A;  1PBC A;  3FMW A;  4DGK A;  4EM4 A;  1LV0 A;  1PJ7 A;  1DJN A;  2QA2 A;  3GD3 A;  1GXF A;  2WPF A;  1H82 A;  1N4V A;  2BC0 A;  2WHD A;  3NTA A;  2WET A;  4PAA A;  1LQT A;  3UTG A;  4U8N A;  3BI2 A;  1F3P A;  1F8R A;  3EPT A;  4HA6 A;  4RG3 A;  4U8J A;  3LOV A;  3D1C A;  3UKA A;  3UKL A;  2R46 A;  2BS4 A;  2WDV A;  2CUL A;  1M6I A;  1XAN A;  1EL8 A;  3AE8 A;  1TRB A;  1V59 A;  3GDP A;  4FK1 A;  2PYX A;  4H4R A;  2X3N A;  3NT6 A;  5J7X A;  4J34 A;  2Q0L A;  4UDP A;  4DSG A;  1N4W A;  2E1M A;  4YSX A;  1KF6 A;  3R9U A;  1BF3 A;  4BJY A;  1VDC A;  2XVE A;  5IQ4 A;  3RP7 A;  4YKG A;  4TLX A;  1EBD A;  2BS3 A;  1FEA A;  3VR9 A;  2B9X A;  4U2S A;  1ONF A;  3F8R A;  3WE0 A;  4U8P A;  4H2R A;  5L46 A;  3F8P A;  4J57 A;  3BHF A;  2RAB A;  4JQ9 A;  5JCN A;  1NEN A;  4A5L A;  1GRG A;  2JBV A;  1CC4 A;  3DME A;  1D4D A;  4A6N A;  4JDR A;  2BK3 A;  1AOG A;  4E0V A;  3K7Q X;  3IF9 A;  4Z2T A;  2A89 A;  1BZL A;  1JNZ A;  4B66 A;  4CY8 A;  3UOV A;  2WS3 A;  4GRT A;  1ZOY A;  3CNJ A;  4U8L A;  4X9M A;  4K8D A;  3GMC A;  2X99 A;  2BS2 A;  4C5O A;  1ZMD A;  1CF3 A;  2JKC A;  3IWA A;  2CDU A;  4GR1 A;  2FBW A;  3FBS A;  3GDN A;  2VOU A;  5EOW A;  1PXB A;  3C4N A;  2YVJ A;  1YQ3 A;  3LZX A; 
#chains in the Genus database with same CATH topology
 3LAD A;  4RSL A;  3T37 A;  2X8C A;  3VDG A;  4TVY A;  3UXK A;  1IYX A;  4GCM A;  3SFD A;  3V3O A;  5TR3 A;  4C3X A;  3VQR A;  1KKO A;  3DIP A;  4TM1 A;  1KCZ A;  4DYE A;  2BXS A;  3UJR A;  1ZXI C;  3SX6 A;  4II3 A;  1FL2 A;  1H7W A;  1N60 C;  3DFH A;  3DJD A;  3NN0 X;  2DW7 A;  3CPJ G;  3EUB 3;  2W3R A;  5BVA A;  2CHR A;  3VC5 A;  1VQW A;  2XLR A;  4EIP A;  3GWF A;  3N4E A;  3SBF A;  2X8G A;  3ZVH A;  1B8S A;  4KPR A;  1JRY A;  1TE6 A;  3BSM A;  3AE7 A;  2GGH A;  1WUF A;  3L8K A;  1LQU A;  3GSI A;  1DJQ A;  3R11 A;  2P0I A;  3P9U A;  5BUL A;  2W3S A;  1F6M A;  3K7T A;  3NRZ B;  5KWF A;  4YKF A;  3RHA A;  3DG6 A;  2GGJ A;  3UTE A;  4H4Z A;  2WP5 A;  2ACZ A;  3SYI A;  1FOH A;  2QJJ A;  2GGI A;  3H4K A;  4IP5 A;  1EL5 A;  3STP A;  1L9C A;  3VA8 A;  4EIQ A;  1REO A;  1D7Y A;  2OKT A;  4H7U A;  4ICY A;  3CNP A;  1GT8 A;  3UKP A;  2GAH B;  5FS7 A;  5JCL A;  2XVH A;  4U8M A;  3SN1 A;  4CCR A;  2OAL A;  3NN6 X;  4B69 A;  2EQ8 A;  3CGE A;  4YTM A;  4H4X A;  2JAE A;  5FJT A;  4J1O A;  2W0H A;  3P0W A;  1GOS A;  5CKU A;  4Y4L A;  4YSH A;  4C3Y A;  4YXD A;  3P93 A;  3EEZ A;  3TTE A;  2CVJ A;  5KRQ A;  1ZX9 A;  4USQ A;  2GR2 A;  3PS9 A;  3ICS A;  4OPT A;  3ZLH A;  3DG7 A;  1FEB A;  3FCP A;  4RG4 A;  4GGH A;  1BWC A;  2V6O A;  3EAN A;  3I6T A;  4C74 A;  4OPL A;  1E9I A;  4X2P A;  4JN8 A;  1XHC A;  3MSY A;  4A99 A;  2PU1 A;  2XH7 A;  3VRD B;  1VRQ B;  1CC6 A;  2Q7V A;  2NPX A;  4Y4N A;  3M12 A;  4ZN0 A;  6ENL A;  3QPE A;  1MXT A;  1N4U A;  2PHH A;  2GMJ A;  2E5V A;  5BOE A;  4YT0 A;  2EQ6 A;  1XPQ A;  1ZDL A;  4H4S A;  2ARD A;  3UOY A;  1CHU A;  3PO7 A;  2YM2 A;  1MRA A;  2WP9 A;  4HPN A;  3TWA A;  2YG5 A;  3CPI G;  2YG6 A;  4OCG A;  5KMQ A;  2ZZ0 A;  5KOX A;  4CY6 A;  1P2H A;  1FEC A;  4ZOH B;  1OJC A;  2OQY A;  2OZ3 A;  1DOD A;  3NK0 X;  4KPL A;  1GV4 A;  2XYO A;  3K7M X;  4H1Z A;  1TKK A;  4JNQ A;  1MDR A;  2XFQ A;  2YLR A;  1JCT A;  3ATR A;  1H6V A;  2YLW A;  2RGJ A;  1IUV A;  5KXJ A;  4MJW A;  2TMD A;  2VVM A;  3ZYX A;  3COX A;  4EQR A;  3KLJ A;  3O0H A;  1H84 A;  4IL2 A;  1N1P A;  1GTE A;  1PBF A;  4P9S A;  4OPC A;  3VFC A;  1YY5 A;  3AE2 A;  4LA1 A;  1JRO A;  5EU9 A;  1JRZ A;  2BK4 A;  1EBH A;  3AYI A;  3ZVH B;  3ALL A;  4BUR A;  2XLU A;  1Q9I A;  2B76 A;  3SFE A;  2AR8 A;  3PWG A;  4AOX A;  1S2Y A;  4K1W A;  5GSN A;  3AEG A;  2QDE A;  1E39 A;  2B9Y A;  3ZLF A;  4AOS A;  2YM1 A;  3AD8 B;  3QSM A;  3NTD A;  1E6E A;  5C2T A;  4K8G A;  1Q1R A;  4GFI A;  4FI4 A;  4NTD A;  3V5C A;  2P88 A;  3FXG A;  1JOA A;  1IUU A;  3G5Q A;  2YVF A;  2X50 A;  1BKW A;  3NYE A;  2GSH A;  3ISH A;  4C77 A;  3NVV B;  3CNS A;  2IVD A;  1N5X A;  3NXL A;  3OP2 A;  4MGG A;  3L1R A;  5IDZ A;  3QFB A;  2OZT A;  2C64 A;  2VRL A;  4YWS A;  4Z43 A;  2WOI A;  3DA1 A;  3Q6J A;  1N62 C;  4A9W A;  4N9X A;  3DK8 A;  2WQY A;  3DES A;  2XFU A;  4HCH A;  5FJO A;  4K2S A;  3U9I A;  3C96 A;  2AKZ A;  1GET A;  2JB2 A;  4IVM B;  4FP1 A;  1TDK A;  3T6C A;  4IA6 A;  3UKQ A;  1OJT A;  1ONE A;  3SN4 A;  1RM6 B;  1E1M A;  3CND A;  3FV9 A;  1DJN A;  3GD3 A;  1GXF A;  2WPF A;  1H82 A;  3NTA A;  2BC0 A;  1H2I A;  4U8N A;  4RG3 A;  2R46 A;  3Q4D A;  3R0U A;  1XAN A;  1TRB A;  4H4R A;  2X3N A;  3L5O A;  4UDP A;  2E1M A;  4KEM A;  3H70 A;  3IJQ A;  3CAW A;  5IQ4 A;  3SR6 B;  1V97 A;  3WE0 A;  4J57 A;  3BHF A;  2PP0 A;  2RAB A;  5JCN A;  4A6N A;  2QDD A;  4E0V A;  3IF9 A;  3DG3 A;  4GRT A;  4U8L A;  2JKC A;  2CDU A;  2VOU A;  2PTW A;  4Z26 A;  3IJL A;  2OZ8 A;  4EMW A;  1QJD A;  1GAL A;  3CMM A;  3T4W A;  4DWD A;  2BYB A;  3DJE A;  3GMB A;  3KU9 A;  1D4C A;  4HYR A;  3UCC A;  1CJ2 A;  2GH5 A;  4D04 A;  2A8X A;  4E4F A;  4H2Q A;  4G6G A;  4HCD A;  1TDN A;  4K7Z A;  3DJJ A;  4GAV A;  5HXI A;  2C4C A;  3DER A;  2H88 A;  5J60 A;  4HCL A;  2VQB A;  3BI4 A;  2YG7 A;  1EL9 A;  2PGW A;  3THU A;  3BI5 A;  3ICR A;  4K22 A;  2B9W A;  2OPJ A;  4G6H A;  1K0J A;  4FX9 A;  3AWI A;  1NDA A;  1QO8 A;  2BRY A;  3KPK A;  3Q9T A;  1XDI A;  2PA6 A;  4GUV A;  2Z5X A;  2GV8 A;  3QJ4 A;  2GVC A;  3NFU A;  1NPX A;  1T3Q C;  5FJU A;  3DK9 A;  4FDC B;  3M13 A;  2R9Z A;  3SQP A;  4U8K A;  1CJ4 A;  2C7G A;  4X9N A;  1BKH A;  3AE3 A;  4HN8 A;  5G5H B;  4U2T A;  2PGE A;  5M10 A;  2QCU A;  3SZW A;  4NZH A;  3SSZ A;  3K30 A;  3GYX A;  2JK6 A;  2P8C A;  1OJD A;  4EQX A;  1L9E A;  2YLZ A;  3VC6 A;  3GC2 A;  3D8X A;  3CGC A;  2YLX A;  3VRA A;  1GRB A;  3NRN A;  1SJC A;  1PDY A;  4Y4M A;  4Z17 A;  4H2H A;  5M0Z A;  2HXU A;  1PXC A;  1OJ9 A;  5JCK A;  1NG3 A;  4NNJ A;  1P43 A;  2CFY A;  3VRB A;  3AEB A;  4XXG A;  1DOB A;  4YTN A;  2C72 A;  3S61 A;  1R0M A;  2GR1 A;  3B6D A;  3RED A;  1ZK7 A;  1K0I A;  3GWD A;  5G5G B;  3KVE A;  3N6J A;  4A3R A;  1TYP A;  2C73 A;  3V5F A;  4MMW A;  3N4F A;  2IID A;  2V3A A;  4J33 A;  1S3B A;  1N61 C;  4A6N B;  3UCL A;  1Y56 A;  2BK5 A;  3NS1 B;  2BC1 A;  5U25 A;  1X2G A;  3UXL A;  2R4E A;  1ELI A;  3NVZ B;  1D5T A;  3T2Z A;  3OPS A;  3RCY A;  4BJZ A;  3OZ2 A;  1IUT A;  3AEA A;  1OJA A;  4UDQ A;  4AT0 A;  3TWB A;  2VRM A;  4M0X A;  2GGG A;  1FHU A;  3T9P A;  2BAC A;  3HZL A;  3FPZ A;  4PAB A;  3C4A A;  2EQ7 A;  2C66 A;  2QAE A;  4KT2 A;  1L0V A;  5HYM A;  2OLA A;  3B97 A;  3UGV A;  5KOW A;  3CNT A;  1PN0 A;  2GB0 A;  3P4S A;  3N6H A;  2P8B A;  3II4 A;  3AE4 A;  1E7P A;  4JY2 A;  3HW2 A;  1WYG A;  2MUC A;  3IJI A;  2YLS A;  3CYJ A;  4G9K A;  3UJF A;  1NEL A;  3ENL A;  2FKP A;  4Z24 A;  2WDQ A;  4EM3 A;  3BNM A;  4B1B A;  2YG3 A;  5C3J A;  3FVD A;  3V4B A;  1UKV G;  1JPM A;  1E1K A;  2ZBW A;  2YQU A;  3I6E A;  3AD7 B;  5GRT A;  3QVR A;  1PBE A;  4CRT A;  3H8L A;  3CXB A;  5U63 A;  1NHQ A;  4AP1 A;  2MNR A;  2WP6 A;  1Q1W A;  2V61 A;  2A87 A;  1NU5 A;  3UCD A;  4TM3 A;  1LTX R;  3AE9 A;  4A7A A;  3QN3 A;  3UOZ A;  2WU2 A;  3GD4 A;  3AYJ A;  1IUX A;  3JVA A;  3ATQ A;  3ICT A;  1DTN A;  1L9D A;  4M52 A;  1F9C A;  2B7S A;  4NTE A;  1QLB A;  3RNM A;  4IA5 A;  2C75 A;  3S5S A;  3UP4 A;  4H4U A;  4BK2 A;  4A35 A;  2Y6Q A;  2BCP A;  3RGT A;  1PBD A;  4JHM A;  3R10 A;  4WX1 A;  4G7F A;  4YSZ A;  2BA9 A;  4IV9 A;  2QJM A;  2O9Z A;  2ZAD A;  2PS2 A;  2TPR A;  3EF6 A;  2XLS A;  1DOC A;  1KD0 A;  1NG4 A;  4TM4 A;  4NTC A;  3SGL A;  1PBC A;  3FMW A;  4EM4 A;  1LV0 A;  2QA2 A;  1RVK A;  2PTY A;  3UTG A;  3A7U A;  1F8R A;  3EPT A;  3R07 C;  3CXO A;  3D1C A;  2WDV A;  1EL8 A;  3T14 A;  2GGE A;  5J7X A;  3PFR A;  1JDF A;  1VDC A;  2XVE A;  3MUC A;  3RP7 A;  4TLX A;  4U8P A;  5L46 A;  4KWS A;  3F8P A;  1NEN A;  4JQ9 A;  4A5L A;  1GRG A;  1D4D A;  2QGY A;  4JDR A;  1AOG A;  2BK3 A;  3BJS A;  2A89 A;  4G73 A;  3UOV A;  5J04 A;  1ZOY A;  4K8D A;  3GMC A;  2BS2 A;  1CF3 A;  3P3B A;  3ES8 A;  3GDN A;  5EOW A;  1XS2 A;  1PXB A;  3R1Z A;  4X4J A;  3TOY A;  3QSE A;  3GYI A;  1GRA A;  5KVH A;  1Z6L A;  4TLZ A;  3AEF A;  3SZC A;  3D47 A;  2Y6R A;  4B65 A;  4ROP A;  4GIS A;  4G74 A;  4GAP A;  1PDZ A;  4B68 A;  4GYP C;  2YR5 A;  4F4R A;  2QVH A;  2BCG G;  3ZVI A;  1PBB A;  1CJC A;  4AP3 A;  4GDE A;  5CQF A;  4H4Y A;  2E5A A;  3ALJ A;  3PVC A;  1VQZ A;  3PG6 A;  2C3D A;  4IVO B;  2GQF A;  4HNL A;  3CK5 A;  4JY3 A;  4ECH A;  3M0O A;  1TYT A;  2XDO A;  2GRT A;  3G5R A;  1D4E A;  5BRT A;  4II2 A;  3CGB A;  3ABV A;  2C67 A;  2YAU A;  4XWR A;  3AM9 A;  3IHG A;  4J36 A;  1SB3 B;  4I59 A;  2OLN A;  1CJ3 A;  3KD9 A;  3RP8 A;  3VCN A;  2C70 A;  4E6M A;  3DDM A;  2AL2 B;  2GF3 A;  4A6G A;  4DN1 A;  2ONE A;  2YLT A;  2QQ6 A;  3A7A A;  4IL0 A;  3AE5 A;  4OPG A;  1MNS A;  1L8P A;  4HNC A;  5KMR A;  1GES A;  2JB1 A;  1EC8 A;  1H86 A;  3MY9 A;  2ZC8 A;  2BRA A;  1SEZ A;  1NHR A;  4U8O A;  3CGD A;  3NG7 X;  3GYJ A;  2QA1 A;  3V3W A;  2XCG A;  5JRB A;  3MKC A;  4GDP A;  1RYI A;  2DW6 A;  3ALM A;  3SXI A;  3H12 A;  5KMS A;  4APN A;  1N63 C;  4J3Z A;  4OPU A;  2R0G A;  4EQS A;  1EBG A;  3IHM A;  1X31 B;  4GF7 A;  2ZZB A;  4IP4 A;  3H8I A;  2OQH A;  4IZG A;  4EMJ A;  3EAO A;  3B9J B;  1ELS A;  3KKJ A;  1KNR A;  5BOF A;  2HZG A;  1PJ5 A;  3D9X A;  1GPE A;  2XLP A;  2P3Z A;  1XPY A;  1Y56 B;  2APG A;  5FS9 A;  3DJG X;  3SM8 A;  2DKH A;  1P2E A;  4EMI A;  1SJA A;  1O95 A;  5KMP A;  4H4P A;  2POZ A;  3I6D A;  2XFO A;  3NH3 X;  1KFY A;  4TVW A;  4UDR A;  2XFN A;  2WDR A;  5FJR A;  2OFJ A;  1PJ6 A;  4H4V A;  3AMZ A;  4EWJ A;  2PCE A;  4DXK A;  2E3T A;  4H4Q A;  4E4U A;  5U1O A;  2UZZ A;  2XVI A;  3HPF A;  5FS6 A;  1TDO A;  4LU6 A;  2OAM A;  2FJB A;  4ZCD A;  1VG9 A;  4DX3 A;  2VVL G;  3P4R A;  4KX6 A;  2AQJ A;  4AT2 A;  3H7V A;  3UJE A;  4ZCC A;  4GGB A;  2OX4 A;  3CTY A;  3UJ2 A;  3DH9 A;  4U8I A;  4Z1Y A;  3URH A;  2Z5Y A;  1PS9 A;  2PTX A;  3OC4 A;  4H50 A;  3MZN A;  4O5Q A;  4JN9 A;  3TQP A;  3HYX A;  3AE1 A;  3FJ4 A;  1FCD A;  1TZZ A;  4Z44 A;  3E1T A;  2XFP A;  1W6T A;  3JSK A;  3QVP A;  4H19 A;  3SQS A;  1RSG A;  4E5T A;  3AXB A;  3UTH A;  1KKR A;  1F8S A;  3T2K A;  2Q0K A;  2B7R A;  1LVL A;  2GR0 A;  3JW7 A;  2DKI A;  2NVK X;  2FYM A;  4K5S A;  3CN8 A;  4MKS A;  3KPF A;  2AL1 A;  3S5W A;  1FFV C;  1MUC A;  3TW9 A;  5FMH A;  2X8H A;  4BK3 A;  2IVE A;  3DGZ A;  3OZM A;  3HYW A;  3AD9 B;  4DHG A;  1GEU A;  5DBJ A;  1K0L A;  3NYF A;  3NK1 X;  1M64 A;  1GND A;  1TDF A;  1EL7 A;  3SZF A;  2XH0 A;  1S2Q A;  4JNA A;  1IUW A;  1NEK A;  3UKF A;  4IHC A;  4J31 A;  1JEH A;  4NEV A;  2GR3 A;  3TJ4 A;  3AN1 A;  3LZW A;  2PTZ A;  2HQM A;  1W4X A;  2V5Z A;  1GER A;  3P4P A;  3QLD A;  4DGK A;  3CT2 A;  2WHD A;  2WET A;  1LQT A;  1F3P A;  4HA6 A;  3H8A A;  4U8J A;  3UKL A;  1M6I A;  1YEY A;  3GDP A;  3OZY A;  4FK1 A;  3CB3 A;  2Q0L A;  2XGZ A;  3R9U A;  1BF3 A;  1FIQ B;  3SN0 A;  2BS3 A;  3VR9 A;  1ONF A;  3F8R A;  3DGB A;  4H2R A;  3R25 A;  3ETR B;  3K7Q X;  4Z2T A;  1BZL A;  1SJB A;  3CNJ A;  4X9M A;  4C5O A;  1ZMD A;  3IWA A;  3FBS A;  2XH4 A;  3C4N A;  2YVJ A;  1YQ3 A;  3LZX A;  3QKE A;  3VR8 A;  2FJA A;  1GRT A;  1O94 A;  2R45 A;  3DFY A;  3FIM B;  1H7X A;  3IK4 A;  3NHO X;  4BV6 A;  3UKH A;  2E4G A;  3S47 A;  1BGJ A;  2H89 A;  1TDE A;  2RGO A;  1H83 A;  3BHK A;  3VCC A;  2I0Z A;  3UKK A;  4UP3 A;  4U2L A;  4B64 A;  5BUK A;  4YWO A;  4CNK A;  3NYC A;  1JNR A;  4USR A;  3AYL A;  1B5Q A;  4YTP A;  4O5U A;  2VVL A;  4IT1 A;  1IJH A;  2PU0 A;  1GSN A;  4CNJ A;  1O5W A;  4GIR A;  2I5Q A;  2XSX A;  3I3L A;  4WCT A;  4ZA0 A;  3DK4 A;  3RR1 A;  3G5S A;  3UOX A;  1K4Q A;  3QSS A;  4K5R A;  3UJS A;  7ENL A;  4BK1 A;  2OA1 A;  3CPH G;  4FK1 C;  3K1G A;  5LV9 A;  1ZP0 A;  2GQW A;  4ENL A;  3GD6 A;  3T2Y A;  4NWZ A;  4E8G A;  2AL2 A;  3AE6 A;  3T0K A;  3NO1 A;  3A7R A;  4DNA A;  1DOE A;  2FJD A;  3P1W A;  4M6U A;  4H2P A;  5EB5 A;  3FG2 P;  2RGH A;  2WU5 A;  2JB3 A;  2VZ2 A;  1LJ1 A;  2YR4 A;  1COY A;  3LJP A;  2O56 A;  1NHS A;  1SJD A;  1ZKQ A;  2GL5 A;  1NHP A;  2WPC A;  1JRX A;  3LB8 A;  4H4T A;  5JCM A;  5IPY A;  1WUE A;  2XVJ A;  1GRH A;  1PDH A;  3V3N A;  2W54 A;  5IQ1 A;  2F5Z A;  3HRD C;  1KN0 A;  1FFU C;  1KSU A;  2YG4 A;  2PMQ A;  2WOW A;  2V3B A;  4CBQ A;  2XH2 A;  3OTR A;  4OPI A;  2RDX A;  4ADW A;  4REK A;  3NVY B;  2VQ7 A;  1MOK A;  4H4W A;  2HXT A;  3JZU A;  2R4J A;  2Q6U A;  2HNE A;  1R6W A;  3SZ0 A;  4J2W A;  4A65 A;  2BAB A;  4HB9 A;  1JPD X;  4TM0 A;  1YQZ A;  2GDQ A;  4Z2U A;  3HYV A;  4I58 A;  1EC7 A;  3DGH A;  2GMH A;  3GRS A;  3SY4 A;  4LII A;  2OLO A;  2YWL A;  3NGC X;  1KDG A;  3NNE A;  1MDL A;  3UTF A;  1B4V A;  2WPE A;  2C65 A;  2BXR A;  4B67 A;  3NVW B;  2C3C A;  1VG0 A;  3PK7 A;  1DXL A;  3DEQ A;  2NQL A;  3CIR A;  1GRE A;  2OVL A;  1KNP A;  3I4K A;  1PHH A;  4GME A;  2WEU A;  4OVI A;  3RIT A;  3AED A;  5EBK A;  1STZ A;  2AKM A;  3TCS A;  3PWI A;  2PPG A;  3V76 A;  3LXD A;  3NLC A;  4D03 A;  3U4F A;  3ITJ A;  4NEW A;  5KVI A;  5JCI A;  3SJN A;  5EB4 A;  3NZG A;  1YKJ A;  4H83 A;  1FHV A;  2PSN A;  3B3R A;  4J56 A;  1S3E A;  1RP0 A;  4B63 A;  1YQ4 A;  3KA7 A;  4CCQ A;  1D7L A;  3GY1 A;  1NAA A;  4YSY A;  5FS8 A;  1HYU A;  1CBO A;  4K2X A;  3NIX A;  1CC2 A;  2XLT A;  4GYP A;  2FJE A;  3BNU A;  5ER0 A;  2V60 A;  3KUM A;  2YVG A;  1FO4 A;  3UP5 A;  1KSS A;  5KNL A;  2QJN A;  3GRT A;  4Z2R A;  1E1N A;  3AB1 A;  2W55 A;  1B37 A;  3OW1 A;  4JN7 A;  1JU2 A;  1JRP A;  1N5W C;  1BQG A;  1VDV A;  3AEC A;  4EQW A;  2AAQ A;  3ZDN A;  1DNC A;  4XWZ A;  1ECQ A;  4DSH A;  1PXA A;  2PP3 A;  3ADA B;  3RP6 A;  4Z25 A;  3NKS A;  2C76 A;  2OG9 A;  3QFA A;  1GTH A;  5FJP A;  2R0C A;  5HHF A;  2ZZC A;  3QTP A;  3ZLG A;  1LPF A;  3AEE A;  2POD A;  2WES A;  1S7M A;  2GAG B;  3FYY A;  2XVF A;  2WOV A;  3NK2 X;  1CL0 A;  1GRF A;  1Y0P A;  1MO9 A;  2WBA A;  1E1L A;  1F8W A;  1IUS A;  1BGN A;  1ZMC A;  4ZCW A;  1ZOV A;  1X2H A;  2EQ9 A;  3RO6 A;  1H81 A;  3T8Q A;  2R0P A;  1P48 A;  1ZY8 A;  4A79 A;  3RRA A;  2GEW A;  3GO2 A;  3F8D A;  5HY5 A;  2J3N A;  4H2N A;  3P4Q A;  3R0K A;  3IC9 A;  2YR6 A;  2PP1 A;  3MWC A;  4OPD A;  3Q45 A;  1EC9 A;  1PJ7 A;  1N4V A;  4PAA A;  3BI2 A;  3D46 A;  3LOV A;  3UKA A;  3MQT A;  2BS4 A;  2CUL A;  3AE8 A;  1V59 A;  2PYX A;  3NT6 A;  4J34 A;  4DSG A;  2OO6 A;  1N4W A;  4YSX A;  1KF6 A;  3BOX A;  4BJY A;  4G8T A;  5ENL A;  4YKG A;  1EBD A;  1FEA A;  2B9X A;  4U2S A;  3EKG A;  1OEP A;  2JBV A;  1CC4 A;  3DME A;  1JNZ A;  4B66 A;  4CY8 A;  3ES7 A;  2WS3 A;  2X99 A;  4GR1 A;  2FBW A;  3TJI A;  3T31 A; 
#chains in the Genus database with same CATH homology
 3LAD A;  4RSL A;  3T37 A;  3VR8 A;  4Z26 A;  2FJA A;  2X8C A;  1GRT A;  4X4J A;  1O94 A;  3QSE A;  2R45 A;  3GYI A;  1GRA A;  4EMW A;  1QJD A;  3FIM B;  1H7X A;  5KVH A;  1GAL A;  1Z6L A;  3CMM A;  3NHO X;  4GCM A;  4TLZ A;  3SFD A;  3V3O A;  4BV6 A;  2BYB A;  3AEF A;  3DJE A;  3SZC A;  3GMB A;  3UKH A;  2E4G A;  5TR3 A;  1BGJ A;  4C3X A;  3KU9 A;  2H89 A;  3VQR A;  1TDE A;  1D4C A;  1CJ2 A;  1H83 A;  2RGO A;  3BHK A;  4TM1 A;  2Y6R A;  2BXS A;  4B65 A;  2I0Z A;  3UKK A;  4UP3 A;  3SX6 A;  4U2L A;  4II3 A;  1FL2 A;  2GH5 A;  4G74 A;  4D04 A;  4GAP A;  2A8X A;  1H7W A;  4B68 A;  4B64 A;  2YR5 A;  4H2Q A;  5BUK A;  3DJD A;  3NN0 X;  4G6G A;  4YWO A;  4CNK A;  1TDN A;  2BCG G;  3CPJ G;  3NYC A;  4K7Z A;  1JNR A;  3DJJ A;  1PBB A;  1CJC A;  4AP3 A;  5BVA A;  4GAV A;  4USR A;  5HXI A;  2C4C A;  3AYL A;  2H88 A;  4GDE A;  5J60 A;  1VQW A;  2XLR A;  5CQF A;  4H4Y A;  1B5Q A;  4EIP A;  2VQB A;  4YTP A;  4O5U A;  3BI4 A;  2YG7 A;  3GWF A;  1EL9 A;  2VVL A;  2X8G A;  3ALJ A;  1IJH A;  3PVC A;  3PG6 A;  1GSN A;  4CNJ A;  2C3D A;  1O5W A;  4IVO B;  3BI5 A;  3ICR A;  1B8S A;  4K22 A;  4KPR A;  1JRY A;  2GQF A;  3I3L A;  3AE7 A;  2B9W A;  4WCT A;  3L8K A;  4G6H A;  1LQU A;  3GSI A;  1DJQ A;  3DK4 A;  4JY3 A;  3P9U A;  4ECH A;  3G5S A;  3UOX A;  3M0O A;  5BUL A;  1K0J A;  1K4Q A;  1TYT A;  1F6M A;  3K7T A;  2XDO A;  5KWF A;  2GRT A;  4FX9 A;  3AWI A;  3QSS A;  4K5R A;  3G5R A;  1D4E A;  4BK1 A;  5BRT A;  2OA1 A;  3CPH G;  4FK1 C;  4II2 A;  4YKF A;  3CGB A;  3RHA A;  1NDA A;  1QO8 A;  3UTE A;  1ZP0 A;  2BRY A;  2GQW A;  2C67 A;  3ABV A;  5LV9 A;  3KPK A;  3Q9T A;  4H4Z A;  3T2Y A;  2YAU A;  2WP5 A;  2ACZ A;  4XWR A;  4NWZ A;  1XDI A;  3SYI A;  4GUV A;  1FOH A;  3IHG A;  4J36 A;  2Z5X A;  3H4K A;  1EL5 A;  3AE6 A;  2GV8 A;  3QJ4 A;  3T0K A;  2GVC A;  4I59 A;  1L9C A;  2OLN A;  1NPX A;  1CJ3 A;  3KD9 A;  4DNA A;  3RP8 A;  1DOE A;  4EIQ A;  2FJD A;  1REO A;  3P1W A;  4H2P A;  1D7Y A;  3DK9 A;  5EB5 A;  4FDC B;  3FG2 P;  3M13 A;  2C70 A;  2RGH A;  2R9Z A;  2WU5 A;  3SQP A;  2JB3 A;  4U8K A;  4H7U A;  4ICY A;  1CJ4 A;  2GF3 A;  2C7G A;  3CNP A;  2VZ2 A;  4X9N A;  3AE3 A;  1LJ1 A;  4U2T A;  1GT8 A;  2YR4 A;  3UKP A;  2GAH B;  1COY A;  5FS7 A;  3LJP A;  1NHS A;  5M10 A;  2QCU A;  2WPC A;  1ZKQ A;  1JRX A;  1NHP A;  5JCL A;  2XVH A;  3LB8 A;  2YLT A;  4NZH A;  4U8M A;  3SZW A;  4H4T A;  5JCM A;  4CCR A;  2OAL A;  3K30 A;  3NN6 X;  4B69 A;  3GYX A;  2EQ8 A;  5IPY A;  3AE5 A;  2JK6 A;  3CGE A;  4OPG A;  4YTM A;  4H4X A;  1OJD A;  4EQX A;  1L9E A;  2XVJ A;  2YLZ A;  3D8X A;  5KMR A;  1GES A;  2JAE A;  1GRH A;  2JB1 A;  1PDH A;  3V3N A;  3CGC A;  2W0H A;  1H86 A;  5IQ1 A;  2F5Z A;  1GOS A;  2BRA A;  5CKU A;  1KN0 A;  1SEZ A;  4Y4L A;  2YLX A;  3VRA A;  1GRB A;  1NHR A;  3NRN A;  4YSH A;  1KSU A;  4C3Y A;  4Y4M A;  4YXD A;  2YG4 A;  2CVJ A;  4U8O A;  2WOW A;  4ZCD A;  2V3B A;  3CGD A;  3NG7 X;  5M0Z A;  4CBQ A;  5KRQ A;  1ZX9 A;  3GYJ A;  4USQ A;  1PXC A;  2QA1 A;  2GR2 A;  3ICS A;  1OJ9 A;  5JCK A;  3PS9 A;  4OPI A;  1NG3 A;  4OPT A;  2CFY A;  4NNJ A;  2XCG A;  5JRB A;  3VRB A;  4ADW A;  3AEB A;  4REK A;  1FEB A;  2IID A;  4RG4 A;  4GDP A;  1DOB A;  4XXG A;  2VQ7 A;  1BWC A;  1MOK A;  2V6O A;  4H4W A;  4YTN A;  2C72 A;  3S61 A;  3EAN A;  2R4J A;  1RYI A;  2Q6U A;  3ALM A;  3SXI A;  5KMS A;  4APN A;  3SZ0 A;  4C74 A;  4OPL A;  4J2W A;  2GR1 A;  2BAB A;  4HB9 A;  4OPU A;  4A65 A;  4TM0 A;  1XHC A;  3B6D A;  1YQZ A;  3RED A;  1ZK7 A;  2R0G A;  4A99 A;  4Z2U A;  3HYV A;  4EQS A;  4I58 A;  3VRD B;  3DGH A;  1VRQ B;  2GMH A;  3IHM A;  1CC6 A;  3GRS A;  2Q7V A;  2NPX A;  1K0I A;  1X31 B;  3GWD A;  3SY4 A;  4LII A;  3KVE A;  4GF7 A;  2ZZB A;  2OLO A;  2YWL A;  4Y4N A;  3M12 A;  4ZN0 A;  3NGC X;  1TYP A;  1KDG A;  1MXT A;  3H8I A;  3NNE A;  1N4U A;  4EMJ A;  2C73 A;  3EAO A;  3UTF A;  2PHH A;  3KKJ A;  2GMJ A;  1KNR A;  2E5V A;  4YT0 A;  1B4V A;  1PJ5 A;  3D9X A;  2EQ6 A;  2WPE A;  1GPE A;  1XPQ A;  2C65 A;  1ZDL A;  2BXR A;  2V3A A;  2XLP A;  4B67 A;  2C3C A;  4H4S A;  2ARD A;  1VG0 A;  3UOY A;  1DXL A;  1Y56 B;  2APG A;  1CHU A;  3PO7 A;  1S3B A;  5FS9 A;  2YM2 A;  4J33 A;  3DJG X;  2WP9 A;  3SM8 A;  3CIR A;  2DKH A;  1P2E A;  4EMI A;  1GRE A;  2YG5 A;  1KNP A;  4A6N B;  3CPI G;  3UCL A;  2YG6 A;  1O95 A;  4OCG A;  1PHH A;  1Y56 A;  5KMQ A;  5KMP A;  2ZZ0 A;  2BK5 A;  5KOX A;  2BC1 A;  4H4P A;  5U25 A;  4CY6 A;  1P2H A;  2WEU A;  1FEC A;  2R4E A;  1ELI A;  1OJC A;  4OVI A;  1D5T A;  3I6D A;  5EBK A;  2XFO A;  3AED A;  3NH3 X;  1KFY A;  1DOD A;  3NK0 X;  3V76 A;  4UDR A;  3T2Z A;  3LXD A;  2XFN A;  1GV4 A;  2WDR A;  2XYO A;  3K7M X;  3NLC A;  1PJ6 A;  4D03 A;  4BJZ A;  3OZ2 A;  4H4V A;  1IUT A;  4JNQ A;  3ITJ A;  3AEA A;  1OJA A;  4UDQ A;  2XFQ A;  4NEW A;  2VRM A;  2YLR A;  5KVI A;  4AT0 A;  5JCI A;  3ATR A;  1H6V A;  2YLW A;  4H4Q A;  5EB4 A;  1YKJ A;  5U1O A;  2BAC A;  2RGJ A;  2UZZ A;  2XVI A;  3HZL A;  3B3R A;  4J56 A;  1S3E A;  3FPZ A;  1RP0 A;  4PAB A;  4B63 A;  3C4A A;  1IUV A;  1YQ4 A;  5KXJ A;  2EQ7 A;  3KA7 A;  2C66 A;  2QAE A;  5FS6 A;  4MJW A;  2TMD A;  1L0V A;  1D7L A;  2VVM A;  3ZYX A;  4CCQ A;  5HYM A;  3COX A;  1TDO A;  4YSY A;  1NAA A;  5FS8 A;  4LU6 A;  1HYU A;  4EQR A;  1CBO A;  4K2X A;  2OAM A;  5KOW A;  3KLJ A;  3NIX A;  3O0H A;  1H84 A;  2FJB A;  3CNT A;  1N1P A;  1CC2 A;  1GTE A;  1PBF A;  1PN0 A;  1VG9 A;  2GB0 A;  2XLT A;  3P4S A;  4OPC A;  4P9S A;  2FJE A;  3BNU A;  1YY5 A;  3AE2 A;  2VVL G;  5ER0 A;  3II4 A;  3AE4 A;  2V60 A;  4LA1 A;  3P4R A;  1E7P A;  4KX6 A;  2AQJ A;  4JY2 A;  4AT2 A;  2YLS A;  4ZCC A;  1JRZ A;  2YVG A;  2BK4 A;  4G9K A;  3CTY A;  3AYI A;  3UP5 A;  3DH9 A;  4U8I A;  3ALL A;  1KSS A;  5KNL A;  3URH A;  2Z5Y A;  1PS9 A;  4BUR A;  4Z24 A;  2XLU A;  3OC4 A;  1Q9I A;  3GRT A;  4H50 A;  2B76 A;  4Z2R A;  1E1N A;  3SFE A;  2AR8 A;  3AB1 A;  2WDQ A;  4AOX A;  4EM3 A;  1B37 A;  1S2Y A;  3BNM A;  5GSN A;  4O5Q A;  4B1B A;  1JU2 A;  2YG3 A;  3AEG A;  3HYX A;  4JN9 A;  5C3J A;  1E39 A;  2B9Y A;  3AE1 A;  1FCD A;  1UKV G;  4Z44 A;  1E1K A;  2ZBW A;  4AOS A;  3AEC A;  2YQU A;  3E1T A;  2XFP A;  3AD7 B;  3JSK A;  3QVP A;  4EQW A;  5GRT A;  2YM1 A;  3AD8 B;  1PBE A;  3QVR A;  2AAQ A;  3QSM A;  3ZDN A;  1DNC A;  4CRT A;  3NTD A;  4XWZ A;  3H8L A;  1E6E A;  1RSG A;  5U63 A;  4DSH A;  5C2T A;  1PXA A;  1Q1R A;  1NHQ A;  3ADA B;  3RP6 A;  4AP1 A;  3AXB A;  3UTH A;  3NKS A;  4Z25 A;  2WP6 A;  1F8S A;  3T2K A;  1Q1W A;  2C76 A;  2Q0K A;  2V61 A;  2A87 A;  4NTD A;  2B7R A;  1LVL A;  3QFA A;  2GR0 A;  1GTH A;  2R0C A;  2DKI A;  2NVK X;  5HHF A;  4TM3 A;  1LTX R;  3AE9 A;  4K5S A;  2ZZC A;  4A7A A;  3CN8 A;  3KPF A;  3UOZ A;  1LPF A;  1JOA A;  3AEE A;  1IUU A;  3G5Q A;  2WU2 A;  2YVF A;  2X50 A;  1BKW A;  3NYE A;  3ISH A;  2WES A;  4C77 A;  3GD4 A;  3AYJ A;  1S7M A;  1IUX A;  2GAG B;  3S5W A;  3CNS A;  2IVD A;  5FMH A;  3ATQ A;  3ICT A;  3L1R A;  2XVF A;  2X8H A;  2WOV A;  1L9D A;  3NK2 X;  4M52 A;  2B7S A;  1CL0 A;  1GRF A;  3QFB A;  1QLB A;  4NTE A;  1Y0P A;  4BK3 A;  1MO9 A;  2WBA A;  2IVE A;  1E1L A;  1F8W A;  3DGZ A;  3RNM A;  4IA5 A;  2C64 A;  1IUS A;  3HYW A;  1BGN A;  2VRL A;  3AD9 B;  4Z43 A;  2C75 A;  1GEU A;  1ZMC A;  2WOI A;  3DA1 A;  5DBJ A;  3Q6J A;  3UP4 A;  4H4U A;  1K0L A;  3NYF A;  1ZOV A;  4BK2 A;  2EQ9 A;  3NK1 X;  4A9W A;  1M64 A;  3DK8 A;  2WQY A;  4N9X A;  1H81 A;  2XFU A;  2Y6Q A;  1GND A;  2BCP A;  1TDF A;  1EL7 A;  1PBD A;  2R0P A;  3SZF A;  4WX1 A;  1S2Q A;  4YSZ A;  1ZY8 A;  2BA9 A;  4JNA A;  1IUW A;  1NEK A;  3UKF A;  3C96 A;  4J31 A;  4IV9 A;  1JEH A;  1GET A;  2O9Z A;  4A79 A;  2JB2 A;  2GEW A;  4IVM B;  2TPR A;  4NEV A;  1TDK A;  3F8D A;  5HY5 A;  2GR3 A;  3EF6 A;  4IA6 A;  2J3N A;  4H2N A;  2XLS A;  1DOC A;  3UKQ A;  3P4Q A;  1OJT A;  3LZW A;  1NG4 A;  4TM4 A;  2HQM A;  3IC9 A;  2YR6 A;  4NTC A;  1W4X A;  2V5Z A;  4OPD A;  1GER A;  3P4P A;  1E1M A;  3CND A;  3SGL A;  1PBC A;  3FMW A;  4DGK A;  4EM4 A;  1LV0 A;  1PJ7 A;  1DJN A;  2QA2 A;  3GD3 A;  1GXF A;  2WPF A;  1H82 A;  1N4V A;  2BC0 A;  2WHD A;  3NTA A;  2WET A;  4PAA A;  1LQT A;  3UTG A;  1H2I A;  4U8N A;  3BI2 A;  1F3P A;  1F8R A;  3EPT A;  4HA6 A;  4RG3 A;  4U8J A;  3LOV A;  3D1C A;  3UKA A;  3UKL A;  2R46 A;  2BS4 A;  2WDV A;  2CUL A;  1M6I A;  1XAN A;  1EL8 A;  3AE8 A;  3T14 A;  1TRB A;  1V59 A;  3GDP A;  4FK1 A;  2PYX A;  4H4R A;  2X3N A;  3NT6 A;  3L5O A;  5J7X A;  4J34 A;  2Q0L A;  4UDP A;  4DSG A;  1N4W A;  2E1M A;  4YSX A;  1KF6 A;  3R9U A;  1BF3 A;  4BJY A;  1VDC A;  2XVE A;  5IQ4 A;  3RP7 A;  4YKG A;  4TLX A;  1EBD A;  2BS3 A;  1FEA A;  3VR9 A;  2B9X A;  4U2S A;  1ONF A;  3F8R A;  3WE0 A;  4U8P A;  4H2R A;  5L46 A;  3F8P A;  4J57 A;  3BHF A;  2RAB A;  4JQ9 A;  5JCN A;  1NEN A;  4A5L A;  1GRG A;  2JBV A;  1CC4 A;  3DME A;  1D4D A;  4A6N A;  4JDR A;  2BK3 A;  1AOG A;  4E0V A;  3K7Q X;  3IF9 A;  4Z2T A;  2A89 A;  1BZL A;  1JNZ A;  4G73 A;  4B66 A;  3UOV A;  4CY8 A;  2WS3 A;  4GRT A;  1ZOY A;  3CNJ A;  4U8L A;  4X9M A;  4K8D A;  3GMC A;  2X99 A;  2BS2 A;  4C5O A;  1ZMD A;  1CF3 A;  2JKC A;  3IWA A;  2CDU A;  4GR1 A;  2FBW A;  3FBS A;  3GDN A;  2VOU A;  5EOW A;  1PXB A;  3C4N A;  2YVJ A;  1YQ3 A;  3LZX A;  3T31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...