4BURA

Crystal structure of the reduced human apoptosis inducing factor complexed with nad
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
484
structure length
450
Chain Sequence
APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
publication title Structural Insights Into the Coenzyme Mediated Monomer-Dimer Transition of the Pro-Apoptotic Apoptosis Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 136
structure length 450
sequence length 484
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4burA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4burA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4burA01
1NEKA 2BYBA 2JBVA 1ZOYA 2Q0LA 2XCGA 1NDAA 4CY8A 4EIPA 2VZ2A 3BI5A 4YWOA 1MOKA 1GRAA 2X99A 5JCLA 1CHUA 2Y6RA 2YR6A 1LPFA 2YVGA 1BGJA 1GPEA 1YQ4A 1V59A 2BK3A 2E1MA 3C4AA 4I58A 1P2HA 4RG3A 3H8LA 4XWRA 3DJEA 1H7XA 2X3NA 4U8IA 3BHKA 3QVPA 2BA9A 4A7AA 4YSZA 4YKFA 1TYPA 4AOSA 3GD3A 4BJZA 4GUVA 2WPCA 2WOIA 1M6IA 2GRTA 1D7YA 5J60A 4FDCB 4JY2A 1PBEA 2X8CA 3NLCA 3DK4A 2EQ9A 3PVCA 1GETA 4UDPA 3GDPA 1FEBA 1FCDA 1H82A 2JB2A 4Z24A 3AEGA 3G5QA 4WX1A 3CIRA 2JKCA 4GRTA 3IWAA 5U1OA 4ZCDA 2BS2A 3PS9A 3DA1A 1N4WA 3AEBA 1KSSA 1RSGA 5J7XA 4Z44A 1ZP0A 2BABA 2R0CA 4CNKA 1IUWA 1F6MA 4B68A 3BI2A 5FS8A 1Q9IA 2RGJA 3AB1A 4H4ZA 2VQ7A 1MO9A 1KFYA 2R4EA 4LU6A 4PABA 2GH5A 4B63A 1B37A 2XLSA 2CDUA 4AP3A 3I3LA 2C66A 2BCGG 4H2QA 2XFNA 1ONFA 4Y4MA 3LB8A 1AOGA 4BURA 2OALA 4NTEA 3AE5A 1REOA 4KPRA 5U63A 2JB1A 3UKPA 1ZOVA 2V3AA 4GCMA 1VG9A 5GRTA 4TLXA 4A9WA 4K7ZA 3NT6A 2YG6A 1F8WA 1OJCA 1PBDA 4TM1A 3S61A 3F8DA 1JU2A 3NK1X 3UKFA 1ZKQA 4CCQA 1DODA 1O5WA 2APGA 4H4RA 4EQXA 1CC6A 1CBOA 1ZMDA 2C70A 4GR1A 1FL2A 4U8LA 1KNPA 3NYEA 2GEWA 1F8SA 2GR1A 1PHHA 4AP1A 2CVJA 2XLTA 2V6OA 1IUVA 5HYMA 5JCNA 3LOVA 2PHHA 3NK2X 3SGLA 1GV4A 1TDKA 5LV9A 4CRTA 2YG7A 2C67A 4B1BA 3QFAA 4BK3A 1GALA 1BWCA 3GRTA 1OJTA 3VRBA 3VR9A 1YQZA 3UP5A 3UKLA 4I59A 3AE7A 4H4XA 1BGNA 3AXBA 1JOAA 2WQYA 1VRQB 2VQBA 3RP8A 3V76A 1Y56B 3AE2A 2WU2A 5FMHA 2YLWA 3AYLA 3CTYA 3QSEA 1DJNA 4JNQA 4YXDA 4M52A 5BRTA 1Z6LA 2ZZCA 5C2TA 3B6DA 3RHAA 1VG0A 4U8NA 2WPEA 1EL9A 4GDPA 4EMWA 3NIXA 3KLJA 5KXJA 3AEFA 1E1KA 2WESA 5FS6A 3AECA 4OPCA 1YQ3A 4C77A 4Z2UA 5IPYA 4X9MA 4K2XA 1CJCA 3FPZA 4RG4A 3ISHA 4A99A 2X50A 2Z5XA 4BJYA 5CKUA 3ATRA 1IUSA 3B3RA 4OPIA 1NHQA 1ZK7A 2BC0A 3FG2P 3H4KA 2GAGB 2XLRA 3QVRA 1LV0A 2WOVA 1Y0PA 3DMEA 1PBFA 2WPFA 3NN0X 4X9NA 5EB5A 5L46A 1GRTA 3QJ4A 4USQA 4A6NB 4JNAA 3R9UA 1GRBA 1PS9A 2GAHB 3ICRA 1BKWA 4K22A 2YR5A 3UKAA 1LTXR 2DKHA 4J33A 1E7PA 2WDRA 3LADA 3D1CA 1FECA 1GEUA 4C5OA 2QAEA 3AE3A 1ZX9A 3CNJA 4J56A 4H4TA 4N9XA 2J3NA 1PN0A 2XFQA 4IA6A 4Z26A 3KD9A 1KSUA 3EPTA 1L0VA 3DGZA 3NG7X 3DGHA 4EQWA 2E5VA 3ICTA 4OPGA 3IF9A 3P4QA 2YLXA 2WP6A 1K0LA 1YY5A 4B69A 1K0JA 2ZZBA 2I0ZA 3NGCX 2GQWA 2V61A 1NENA 3JSKA 4DNAA 4XXGA 4YT0A 4ZN0A 2TPRA 4H2NA 3QSMA 4B66A 1YKJA 2VRMA 2Z5YA 1KF6A 2QA2A 3K7QX 5DBJA 2B9XA 2C3DA 3VQRA 3NK0X 2V60A 1NHPA 1OJAA 1W4XA 2YWLA 4XWZA 4AOXA 1D4DA 4YTNA 4H4YA 3CNTA 3NTAA 1OJ9A 3AE1A 2OLOA 2EQ6A 1UKVG 2ACZA 2WOWA 3UOVA 1H86A 1E39A 2F5ZA 1FEAA 1EL8A 4OVIA 1NHRA 3ZDNA 2V5ZA 3AEAA 1CJ2A 1ZMCA 2WP9A 4Z2TA 1GNDA 4HA6A 4B65A 1PBBA 2C3CA 3DK9A 2JB3A 4TM4A 3DK8A 4P9SA 3FBSA 1NG4A 2OAMA 3CPHG 3LZWA 2YG5A 4U8KA 4WCTA 4EMJA 1M64A 4NEWA 1FOHA 1CC2A 4IA5A 3GD4A 1NG3A 3GYIA 2YLZA 2NPXA 2ZZ0A 4J57A 1H7WA 1MXTA 1TDEA 2R9ZA 3DJDA 4K5SA 3RP7A 5KRQA 2BS4A 2BXSA 2GR0A 2RABA 3P1WA 2GB0A 5FS7A 4A65A 5IQ4A 2EQ8A 1QO8A 1DNCA 2BC1A 3REDA 4YTPA 4O5QA 4BK2A 1N1PA 2X8HA 3URHA 2AQJA 1S2QA 2DKIA 1GOSA 1GSNA 3AD9B 3AE9A 2FBWA 5JCKA 1O95A 2RGHA 1DJQA 3CGBA 3PO7A 1GESA 2R0PA 2B9YA 2YG3A 5ER0A 1F3PA 3GYJA 4A5LA 1X31B 1IJHA 2JK6A 5HHFA 2FJBA 4U2SA 4EQRA 2XVHA 4GDEA 3O0HA 4EM3A 2A8XA 2BK4A 4HB9A 4U8OA 3CGEA 2GV8A 2Y6QA 3CNDA 4J31A 2C73A 4YSYA 2GQFA 1DOBA 3KA7A 1NAAA 1D4CA 2R46A 4IVOB 5CQFA 3UP4A 1LQTA 2R45A 2XFUA 3SFEA 2O9ZA 1JNZA 1N4VA 4NTDA 5KOWA 3P4SA 2XLUA 1TDNA 1CJ4A 4FK1A 3GDNA 3AD7B 4JN9A 1S3BA 3AE6A 3K7MX 5EBKA 3FIMB 1E1LA 2XVEA 2XVJA 3AWIA 4NTCA 3CPIG 3BNUA 4EIQA 4ECHA 1PXAA 1JNRA 2A89A 3II4A 5FS9A 1F8RA 2UZZA 2VRLA 4JDRA 3EANA 1D4EA 2C7GA 3E1TA 3G5RA 1PDHA 2C76A 3AD8B 3FMWA 3NKSA 2E4GA 2B9WA 2H88A 3ALJA 3KU9A 3UKKA 1GXFA 2AR8A 3VRAA 3P4PA 4U8JA 5KVHA 3LZXA 5BUKA 3CN8A 1JRZA 1KNRA 2B76A 2RGOA 1QJDA 2WBAA 3GWFA 4U8PA 2XVFA 5GSNA 4GF7A 4UP3A 2NVKX 2HQMA 5KVIA 1H6VA 2XLPA 1GRFA 3GWDA 1LQUA 5IQ1A 3T37A 3V3OA 2XVIA 4D03A 4DSGA 1S3EA 1GTHA 1L9CA 2BS3A 3L1RA 4UDQA 2C65A 3V3NA 4ZCCA 3SFDA 2C75A 2YLSA 5EOWA 3QSSA 3C96A 4IV9A 4U2LA 3NN6X 3DJJA 1L9EA 3OC4A 4YKGA 3COXA 2GMJA 4C3XA 3QFBA 2R4JA 2GR2A 1SEZA 3AEEA 1JRYA 3DH9A 1EBDA 2JAEA 2BXRA 5M10A 1S2YA 2OLNA 4H2PA 4OCGA 3VR8A 5BULA 1K0IA 1PXBA 3I6DA 4TLZA 3ALLA 1P2EA 3M12A 2PYXA 1PJ5A 4H4QA 3OZ2A 2ARDA 4H4SA 1H83A 1ELIA 1GERA 2Q7VA 3CPJG 3IHGA 3WE0A 1TDOA 2FJDA 3RP6A 3UCLA 5BVAA 2QA1A 1ZDLA 2YLTA 4OPUA 3LJPA 2EQ7A 1CC4A 1PJ7A 3AEDA 1H84A 1DOCA 5EB4A 1QLBA 1NPXA 4FK1C 4PAAA 4UDRA 2CULA 3NTDA 1XDIA 1RYIA 3GMCA 4LIIA 1EL7A 3M0OA 4TM3A 2W0HA 2WP5A 3M13A 4EMIA 4K8DA 5M0ZA 3UTFA 3NYFA 2WU5A 3UTHA 2Q6UA 3UOZA 1Y56A 2YR4A 3NNEA 3ALMA 1GRHA 1IUUA 2R0GA 3IHMA 3AYIA 1TYTA 1OJDA 2CFYA 2BACA 1GTEA 4YTMA 4J34A 3L8KA 4H4VA 4OPDA 4D04A 2FJEA 3ADAB 3G5SA 1CF3A 3K30A 1VQWA 3KPFA 2XYOA 4CNJA 1JEHA 5KOXA 4Z43A 2X8GA 4DSHA 3UOXA 3D8XA 2VVLA 1CJ3A 1E1MA 4OPTA 2YM1A 1B5QA 2YM2A 3CNPA 4IVMB 1B4VA 3RNMA 4YSHA 3UTGA 3S5WA 4NEVA 2H89A 4AT0A 4B64A 1BF3A 3GMBA 3Q9TA 2WHDA 3SM8A 2ZBWA 1PXCA 1DOEA 3ITJA 1LVLA 4Y4LA 4H50A 2TMDA 4YSXA 2GVCA 3CGCA 2VVMA 3P9UA 4J36A 2VVLG 4USRA 2A87A 2YG4A 4A6NA 2C72A 2FJAA 2YAUA 3H8IA 1CL0A 3GRSA 2OA1A 3CNSA 3EF6A 3VRDB 3BHFA 3HZLA 4APNA 4Z25A 4DGKA 1GREA 5HY5A 1EL5A 2IIDA 2YVFA 3UOYA 2XDOA 3UTEA 2WETA 1XANA 2VOUA 4H4UA 1E6EA 1N4UA 2GMHA 3IC9A 4JY3A 3K7TA 1RP0A 4X4JA 1Q1WA 4ICYA 4ADWA 1XPQA 1O94A 4CBQA 3KVEA 3BI4A 3LXDA 4EM4A 3EAOA 2B7SA 3P4RA 1D7LA 2AAQA 1E1NA 1PBCA 4H7UA 2BCPA 2YVJA 3GSIA 4E0VA 5KWFA 4LA1A 2WDVA 3C4NA 2GR3A 4MJWA 3UKQA 3ZYXA 2B7RA 1JRXA 3ATQA 4TM0A 3DJGX 1IUXA 3NHOX 4AT2A 1NHSA 4CY6A 3AE8A 3AYJA 2GF3A 1GT8A 2V3BA 3UKHA 4Z2RA 2WEUA 3F8PA 1ZY8A 5U25A 4U8MA 1TDFA 2BK5A 3ABVA 3NYCA 4K5RA 1TRBA 1XHCA 4EQSA 4O5UA 4A79A 4C74A 2WS3A 1DXLA 4J2WA 2YLRA 4Y4NA 2XFPA 4BV6A 1BZLA 2XFOA 3NH3X 4H4PA 1LJ1A 4U2TA 2IVDA 1H81A 2IVEA 1IUTA 2QCUA 4JQ9A 4REKA 4FX9A 3F8RA 5HXIA 4NZHA 1GRGA 1Q1RA 1L9DA 3NRNA 4OPLA 2C64A 1COYA 4B67A 1D5TA 1K4QA 3SQPA 1KDGA 5JCIA 4CCRA 2WDQA 3BNMA 1B8SA 4RSLA 2YQUA 2Q0KA 4BK1A 5C3JA 4H4WA 3KKJA 5JCMA 5TR3A 3AE4A 3CGDA 1HYUA 4KX6A 1VDCA 1PJ6A 4C3YA 4H2RA 3ICSA 3Q6JA
chains in the Genus database with same CATH superfamily
3S5SA 2Q0LA 5JCLA 1CHUA 3DG7A 1LPFA 1BGJA 1GPEA 4RG3A 2E1MA 4I58A 3H8LA 4U8IA 3BHKA 2BA9A 4YSZA 1TYPA 4AOSA 3TCSA 2I5QA 4BJZA 4GUVA 1M6IA 2GRTA 1D7YA 1RM6B 3PVCA 4IHCA 4GYPC 3K1GA 2JB2A 2ZADA 4WX1A 2OZTA 3PS9A 1N4WA 4F4RA 3BI2A 4X2PA 1Q9IA 2RGJA 2VQ7A 1MO9A 1KFYA 2R4EA 4LU6A 4B63A 3SZCA 4AP3A 3SSZA 2BCGG 2XFNA 1ONFA 2MNRA 3LB8A 2PODA 5U63A 2P0IA 1REOA 3UKPA 1ZOVA 1IYXA 5GRTA 4K7ZA 1OJCA 4IT1A 1PBDA 3OW1A 3KPKA 3UKFA 2APGA 4EQXA 1ZMDA 3T9PA 1PDZA 2CVJA 5HYMA 3LOVA 2PHHA 3NK2X 4BK3A 1GALA 4II2A 3AE7A 5ENLA 1JOAA 2OX4A 3BJSA 3P93A 4HCHA 3R25A 1VG0A 1EL9A 1SJAA 4J3ZA 5FS6A 4E6MA 1YQ3A 2ZC8A 1CJCA 4RG4A 3ISHA 4BJYA 2E5AA 1NHQA 3T2KA 2WOVA 3DMEA 1GRTA 3GC2A 3FV9A 1ONEA 4TVWA 2HNEA 2WDRA 3LADA 2P88A 3T2YA 1R6WA 3AE3A 3CNJA 4J56A 4N9XA 2XFQA 3P0WA 4IA6A 3NVYB 4EQWA 1YY5A 2I0ZA 4YT0A 4ZN0A 1N62C 3QSMA 1YKJA 2Z5YA 2E3TA 2V60A 1NHPA 4YTNA 3CNTA 3AE1A 4HCLA 1UKVG 2WOWA 1E39A 2F5ZA 3AEAA 2C3CA 3DK8A 3LZWA 1NG4A 4WCTA 3MY9A 1FOHA 3D9XA 1CC2A 1MUCA 2YLZA 2ZZ0A 3RP7A 2BXSA 2GR0A 5FS7A 1ZXIC 1VDVA 4YTPA 4O5QA 3URHA 1GOSA 2FBWA 1DJQA 3VCCA 1X31B 4U2SA 3NXLA 4EM3A 3H8AA 2GV8A 4J31A 2GQFA 3NRZB 5CQFA 1N5WC 1N4VA 3UJFA 1CJ4A 4FK1A 4JN9A 3AD7B 3AE6A 2XVEA 3ZLHA 1PXAA 2UZZA 3EANA 3AD8B 4G8TA 2B9WA 3T0KA 3KU9A 1T3QC 1GXFA 3P4PA 4U8JA 5KVHA 1P43A 1XPYA 4GGBA 2PSNA 4UP3A 1LQUA 4D03A 3T37A 2XVIA 1P48A 1S3EA 1MRAA 3V3NA 3UGVA 2YLSA 3QSSA 2OO6A 2R4JA 1EC7A 1JRYA 3IK4A 5FJPA 5M10A 2OLNA 4G74A 3EKGA 3AN1A 4M0XA 2ARDA 1ELIA 2Q7VA 3WE0A 3RP6A 5BVAA 4OPUA 3ZVHA 2EQ7A 3FJ4A 4FK1C 3RR1A 4EWJA 4EMIA 4K8DA 1FFUC 2BRAA 1BQGA 3NYFA 3MUCA 3UJEA 2Q6UA 3UOZA 2R0GA 3H12A 1OJDA 1GTEA 4J34A 3G5SA 3K30A 4CNJA 1JEHA 2GGHA 2VVLA 4OPTA 4HYRA 3TOYA 3CNPA 3RNMA 4JN8A 4NNJA 4NEVA 2H89A 1N5XA 4AT0A 4A3RA 1F9CA 4IZGA 3STPA 2TMDA 2VVMA 2YG4A 2C72A 1TKKA 3VRDB 3OP2A 3HZLA 3UOYA 3UTEA 1XANA 1E6EA 4JY3A 3IC9A 1Q1WA 3CXOA 1VQZA 4EM4A 3T8QA 3V3WA 2BCPA 3GSIA 4LA1A 2WDVA 3ZYXA 3UKQA 5KMSA 2B7RA 4TM0A 3NHOX 2GF3A 4Z2RA 1ZY8A 4U8MA 1TDFA 1XHCA 4BV6A 1JROA 2IVDA 2DW6A 3V5FA 2IVEA 4KT2A 3DDMA 3ES8A 1Q1RA 1L9DA 3TQPA 4Z1YA 4B67A 1KDGA 2P8BA 2YQUA 2Q0KA 4H4WA 5JCMA 3SZFA 1VDCA 1DTNA 5G5GB 3Q6JA 1NEKA 2XH7A 4EIPA 2X99A 1GRAA 2YR6A 2BK3A 3C4AA 2AL2B 1P2HA 4XWRA 3S47A 1SJCA 3T31A 1TZZA 2WOIA 4FDCB 1PBEA 2EQ9A 4E4UA 1GETA 4UDPA 1FEBA 5U1OA 2BS2A 3AEBA 1RSGA 5J7XA 1IUWA 2XLSA 3I3LA 1AOGA 3AE5A 1JDFA 4GCMA 3HPFA 3S61A 1O5WA 1CC6A 1CBOA 4GR1A 4U8LA 2GEWA 2GR1A 2XLTA 1IUVA 3R1ZA 5JCNA 3SGLA 1GV4A 3EEZA 2PP0A 3RO6A 2XH2A 3GRTA 1YQZA 3UP5A 4DHGA 2HXTA 1KKRA 2WQYA 2PS2A 2YLWA 1N63C 1DJNA 4M52A 5BRTA 1Z6LA 5C2TA 3B6DA 4KEMA 3RHAA 4U8NA 2WPEA 3ETRB 3FYYA 3DIPA 3AEFA 5KXJA 1E1KA 4OPCA 3RCYA 4C77A 4Z2UA 4A99A 3DERA 5CKUA 3ATRA 1IUSA 3B3RA 4OPIA 1ZK7A 3H4KA 3ES7A 3UJ2A 1WUEA 1Y0PA 3Q45A 5EB5A 3R9UA 1GRBA 1BKWA 1LTXR 4KWSA 4J33A 4FI4A 4C5OA 1ZX9A 4H4TA 4Z26A 3T14A 3DFHA 1KSUA 3NG7X 3MWCA 3IF9A 1KCZA 1EBHA 3P4QA 2YLXA 4GAPA 1K0LA 2V61A 4DNAA 1XS2A 2GSHA 1KF6A 2QA2A 2PCEA 3NK0X 4DX3A 1W4XA 4XWZA 1D4DA 3NTAA 3QN3A 2OLOA 2EQ6A 1FEAA 4OVIA 1NHRA 4HCDA 3HYXA 4Z2TA 1H2IA 1GNDA 4TM4A 4P9SA 3FBSA 2OAMA 4U8KA 3RRAA 4NEWA 1NG3A 1L8PA 3HRDC 1H7WA 2R9ZA 1E9IA 3SN1A 3DEQA 4A65A 5IQ4A 2EQ8A 3FXGA 1N1PA 1S2QA 1GSNA 3PO7A 2YG3A 5ER0A 1F3PA 4EQRA 2XVHA 1PDYA 2Y6QA 3CNDA 1YEYA 4YSYA 2XH4A 1NAAA 4IVOB 2R45A 3JW7A 7ENLA 2O9ZA 3VDGA 5KOWA 1TDNA 3GDNA 1KD0A 1S3BA 3K7MX 4NTCA 2A89A 5FS9A 3JVAA 3E1TA 1MNSA 2C7GA 3UXLA 3MZNA 3SN0A 3UKKA 2AR8A 3RGTA 3GD6A 3LZXA 2DW7A 1OEPA 1JRZA 2RGOA 5GSNA 1GRFA 3V3OA 1KKOA 1L9CA 4UDQA 2C65A 2C75A 3C96A 4U2LA 3NN6X 3DJJA 4YKGA 3QFBA 2W3RA 4H2PA 4OCGA 1K0IA 1PXBA 1PJ5A 4H4SA 1H83A 3CPJG 2AKMA 2FJDA 1ZDLA 3BOXA 3LJPA 2OQHA 1DOCA 1NPXA 4PAAA 4UDRA 1XDIA 4HN8A 2WP5A 5M0ZA 5BOEA 3OZMA 3NNEA 3ALMA 3OZYA 3AYIA 3B9JB 2GGGA 4OPDA 3ADAB 5KOXA 4G7FA 3UOXA 1CJ3A 1B5QA 1N60C 3UTGA 2PTYA 3TWBA 3SM8A 4ZCWA 1PXCA 4YSXA 3D47A 4Z17A 3QKEA 2FKPA 4K1WA 2FJAA 2YAUA 1CL0A 3CNSA 2PP1A 1GREA 2W55A 3B97A 2VOUA 4CBQA 4ADWA 3CYJA 2GDQA 4K8GA 2YVJA 4GISA 4AT2A 4CY6A 3UKHA 2V3BA 3F8PA 1MDRA 5U25A 3NYCA 3DESA 1TRBA 4A79A 4JN7A 2YLRA 1BZLA 2XFOA 3NH3X 4H4PA 4U2TA 4JQ9A 4NZHA 1RVKA 1GRGA 5KMPA 4OPLA 1SB3B 2QQ6A 1K4QA 4BK1A 3KKJA 2BRYA 4KX6A 4C3YA 2ONEA 3SR6B 3IJLA 2BYBA 3DGBA 3FVDA 1ZOYA 2OVLA 2XCGA 4CY8A 2VZ2A 1MOKA 2YVGA 1YQ4A 3DJEA 1H7XA 2X3NA 3VFCA 3QVPA 4YKFA 3GD3A 3NVZB 3VCNA 2WPCA 2P8CA 5J60A 3VC5A 4JY2A 3NLCA 2AKZA 1FCDA 3G5QA 2JKCA 4GRTA 3IWAA 4ZCDA 4TVYA 1ELSA 1ZP0A 2BABA 2R0CA 5FS8A 3KUMA 2GH5A 3SBFA 2CDUA 2C66A 4H2QA 3NVWB 3SQSA 4BURA 2OALA 2V3AA 4TLXA 4A9WA 3NT6A 4ROPA 1F8WA 2YG6A 4TM1A 1JU2A 2OQYA 1ZKQA 4CCQA 4H4RA 4ENLA 1KNPA 4AP1A 2V6OA 2MUCA 4DXKA 3MSYA 4CRTA 2YG7A 3I6TA 1BWCA 3VR9A 3UKLA 4H4XA 4DWDA 3AXBA 1VRQB 2POZA 3RP8A 3V76A 1Y56B 3BSMA 2WU2A 3CTYA 1JPMA 4IP5A 4JNQA 1FIQB 3SXIA 4EMWA 3NIXA 1EC8A 2WESA 3AECA 5IPYA 2X50A 4ZOHB 2Z5XA 3TWAA 2QJMA 2BC0A 3FG2P 1EC9A 2GGIA 2XLRA 3NN0X 2WPFA 5L46A 4USQA 4A6NB 1PS9A 2GAHB 4J1OA 4K22A 2GL5A 2YR5A 3AM9A 2DKHA 3D1CA 1FECA 1GEUA 2OLAA 2J3NA 5KMRA 3KD9A 3IJQA 3DGZA 4OPGA 2GQWA 3JSKA 4B66A 3K7QX 5DBJA 2B9XA 2C3DA 3VQRA 4HPNA 1OJAA 2YWLA 4H4YA 3QPEA 1EL8A 4G9KA 1ZMCA 4HA6A 1PBBA 2JB3A 3QLDA 4ZA0A 3CPHG 2YG5A 3P3BA 4IA5A 3GD4A 2NPXA 1MXTA 4J57A 1TDEA 3DJDA 4K5SA 3CXBA 3A7UA 4YWSA 2BS4A 3CB3A 4A35A 2X8HA 3U9IA 5JCKA 2RGHA 3PWGA 1GESA 4A5LA 5HHFA 2FJBA 3O0HA 2A8XA 3NVVB 4HB9A 4GFIA 4MKSA 2AL2A 2C73A 1DOBA 3UP4A 1JNZA 4NTDA 3IJIA 2XLUA 5EBKA 3FIMB 2XVJA 3CPIG 4EIQA 1SJDA 1JNRA 2VRLA 4JDRA 3NKSA 3UCCA 3FMWA 2E4GA 2H88A 3CMMA 5BUKA 3CN8A 2B76A 3GY1A 2WBAA 3N6JA 3GWFA 4U8PA 2XVFA 4GF7A 2HQMA 5IQ1A 2BS3A 3L1RA 4ZCCA 3SFDA 4G6HA 4IV9A 1L9EA 3OC4A 3MKCA 1WYGA 1W6TA 2GMJA 2GR2A 1SEZA 3AEEA 3DH9A 2JAEA 5BULA 1ECQA 3I6DA 4TLZA 2C4CA 1P2EA 3M12A 2PYXA 4H4QA 3OZ2A 4H19A 1GERA 3IHGA 1TDOA 2YLTA 1CC4A 1PJ7A 3AEDA 1H84A 2XGZA 4MMWA 4GAVA 4TM3A 2AL1A 3UTFA 3OTRA 2PMQA 2WU5A 3UTHA 4IL0A 1IUUA 2O56A 1TYTA 3DG6A 4YTMA 5JRBA 3L8KA 1VQWA 3CK5A 3PWIA 4Z43A 2X8GA 4DSHA 3SYIA 3V5CA 3TJIA 6ENLA 3S5WA 3H7VA 1N61C 4B64A 2CHRA 3Q9TA 3DFYA 2WHDA 2ZBWA 1DOEA 1LVLA 4K2SA 4Y4LA 2GVCA 4J36A 2VVLG 3H8IA 3GRSA 2OA1A 3PK7A 3EF6A 3T2ZA 3SN4A 4DGKA 1EL5A 2IIDA 2YVFA 1JRPA 1N4UA 2GMHA 3K7TA 1RP0A 4X4JA 1XPQA 1O94A 3KVEA 3BI4A 3EAOA 1S7MA 1PBCA 5KWFA 3C4NA 2GR3A 4MJWA 3NZGA 1GT8A 2OPJA 5FJRA 2BK5A 3ABVA 4K5RA 4EQSA 4O5UA 4C74A 2WS3A 1DXLA 4Y4NA 2XFPA 4DN1A 5EU9A 2QJNA 2OFJA 3CT2A 4FX9A 4MGGA 3F8RA 1JCTA 2C64A 1D5TA 4CCRA 5JCIA 2WDQA 3BNMA 4RSLA 4H1ZA 5C3JA 3AE4A 3CGDA 1HYUA 1PJ6A 2XH0A 3NTDA 3DG3A 4G6GA 2JBVA 1FO4A 1NDAA 3BI5A 4YWOA 1STZA 2Y6RA 1V59A 4A6GA 4A7AA 1FFVC 2OG9A 1BKHA 3Q4DA 1NELA 2X8CA 3DK4A 3NO1A 2W3SA 3GDPA 1H82A 4Z24A 3AEGA 3CIRA 2PTZA 3ZVIA 3DA1A 3PFRA 1KSSA 4Z44A 4CNKA 1F6MA 4B68A 3AB1A 4H4ZA 4PABA 1B37A 3U4FA 4Y4MA 4NTEA 4KPRA 2JB1A 2QJJA 3L5OA 3R0UA 1VG9A 3R11A 1FHUA 3F8DA 3NK1X 1DODA 2PGEA 2PU0A 2C70A 1FL2A 3MQTA 3NYEA 1F8SA 3H70A 1PHHA 2HXUA 3ZVHB 1TDKA 5LV9A 3CAWA 2OKTA 2C67A 4B1BA 3QFAA 3VRBA 1OJTA 1WUFA 4I59A 1FHVA 3I6EA 1BGNA 2VQBA 4II3A 3AE2A 3ENLA 5FMHA 3AYLA 3NS1B 3QSEA 4YXDA 3ZLGA 2ZZCA 4GDPA 3KLJA 5G5HB 1X2GA 3TTEA 4X9MA 4K2XA 3FPZA 2PTWA 2GAGB 3QVRA 2PA6A 1LV0A 1PBFA 4X9NA 5FJTA 4GIRA 3ZLFA 3QJ4A 4JNAA 3JZUA 3T6CA 3ICRA 2OZ3A 3UKAA 3QTPA 1E7PA 3AMZA 3I4KA 2QAEA 4HNCA 1PN0A 3EPTA 1L0VA 3DGHA 2E5VA 3ICTA 2WP6A 4B69A 1K0JA 2ZZBA 3PG6A 3NGCX 1NENA 4XXGA 2TPRA 4H2NA 2VRMA 4E4FA 2XSXA 4AOXA 1OJ9A 2ACZA 3UOVA 1H86A 3GYXA 3ZDNA 3N4FA 3SZWA 3R10A 2V5ZA 1CJ2A 2WP9A 2PGWA 4B65A 3DK9A 1NU5A 4EMJA 1M64A 3EUB3 3GYIA 5KRQA 2HZGA 2RABA 3P1WA 2GB0A 2P3ZA 1QO8A 1DNCA 2BC1A 3REDA 5KNLA 3UJSA 4BK2A 2AQJA 4IL2A 2DKIA 3AD9B 3AE9A 1O95A 3CGBA 2R0PA 2B9YA 1TE6A 3GYJA 1IJHA 2JK6A 4E5TA 3UXKA 4GDEA 2BK4A 4U8OA 4IP4A 3CGEA 2NQLA 3V4BA 2PTXA 3KA7A 1D4CA 2R46A 1LQTA 3SFEA 2XFUA 1R0MA 4G73A 3P4SA 3UCDA 1E1LA 4FP1A 3AWIA 5FJUA 3BNUA 4ECHA 3II4A 1F8RA 2QDEA 2PU1A 1D4EA 3G5RA 1PDHA 2C76A 2QVHA 3VA8A 2GGJA 3ALJA 5IDZA 3VRAA 1X2HA 1KNRA 1QJDA 2QGYA 1SJBA 3N4EA 2NVKX 5KVIA 2XLPA 1H6VA 3GWDA 3R07C 4DSGA 1GTHA 3A7AA 5EOWA 4H83A 2OZ8A 3COXA 3SY4A 4C3XA 3T4WA 1EBDA 2PP3A 2BXRA 1KN0A 1S2YA 3VR8A 3ALLA 3N6HA 4H2HA 3UCLA 2QA1A 3OPSA 1EBGA 4E8GA 5EB4A 1QLBA 3FCPA 2CULA 1RYIA 3GMCA 4LIIA 1EL7A 3M0OA 2W0HA 3M13A 4DYEA 1Y56A 2YR4A 1GRHA 3IHMA 3TJ4A 2CFYA 2BACA 2QDDA 4H4VA 4D04A 2FJEA 3KPFA 1CF3A 2XYOA 2PPGA 3D8XA 1E1MA 2YM1A 2YM2A 4IVMB 1B4VA 4YSHA 3TW9A 1BF3A 3GMBA 3ITJA 4H50A 3A7RA 3CGCA 3P9UA 4USRA 2A87A 4A6NA 2FYMA 3BHFA 3D46A 4APNA 4Z25A 5HY5A 3RITA 3R0KA 2XDOA 2WETA 1V97A 4H4UA 4JHMA 4ICYA 3HW2A 5J04A 5KMQA 3LXDA 2B7SA 4KPLA 3P4RA 1D7LA 2AAQA 1E1NA 4H7UA 4E0VA 2RDXA 1MDLA 1JRXA 3ATQA 3SZ0A 3DJGX 1IUXA 4GGHA 1JPDX 1NHSA 3HYVA 3AE8A 4M6UA 3AYJA 2WEUA 4GYPA 3SJNA 4J2WA 3UJRA 3HYWA 3NFUA 5FJOA 1LJ1A 1H81A 1IUTA 2QCUA 4HNLA 4REKA 5HXIA 3SX6A 4NWZA 3NRNA 4GMEA 1COYA 3THUA 3SQPA 3GO2A 5BOFA 3VC6A 2GGEA 1B8SA 2W54A 5TR3A 4H2RA 3ICSA
chains in the Genus database with same CATH topology
1NEKA 2BYBA 4G6GA 2JBVA 1ZOYA 2Q0LA 2XCGA 1NDAA 4CY8A 4EIPA 2VZ2A 3BI5A 4YWOA 1MOKA 1GRAA 2X99A 5JCLA 1CHUA 2Y6RA 2YR6A 1LPFA 2YVGA 1BGJA 1GPEA 1YQ4A 1V59A 2BK3A 2E1MA 3C4AA 4I58A 1P2HA 4RG3A 3H8LA 4XWRA 3DJEA 1H7XA 2X3NA 4U8IA 3BHKA 3QVPA 2BA9A 4A7AA 4YSZA 4YKFA 1TYPA 4AOSA 3GD3A 3T31A 4BJZA 4GUVA 2WPCA 2WOIA 1M6IA 2GRTA 1D7YA 5J60A 4FDCB 4JY2A 1PBEA 2X8CA 3NLCA 3DK4A 2EQ9A 3PVCA 1GETA 4UDPA 3GDPA 1FEBA 1FCDA 1H82A 2JB2A 4Z24A 3AEGA 3G5QA 4WX1A 3CIRA 2JKCA 4GRTA 3IWAA 5U1OA 4ZCDA 2BS2A 3PS9A 3DA1A 1N4WA 3AEBA 1KSSA 1RSGA 5J7XA 4Z44A 1ZP0A 2BABA 2R0CA 4CNKA 1IUWA 1F6MA 4B68A 3BI2A 5FS8A 1Q9IA 2RGJA 3AB1A 4H4ZA 2VQ7A 1MO9A 1KFYA 2R4EA 4LU6A 4PABA 2GH5A 4B63A 1B37A 2XLSA 3SZCA 2CDUA 4AP3A 3I3LA 2C66A 2BCGG 4H2QA 2XFNA 1ONFA 4Y4MA 3LB8A 1AOGA 4BURA 2OALA 4NTEA 3AE5A 1REOA 4KPRA 5U63A 2JB1A 3UKPA 1ZOVA 2V3AA 4GCMA 3L5OA 5GRTA 1VG9A 4TLXA 4A9WA 4K7ZA 3NT6A 2YG6A 1F8WA 1OJCA 1PBDA 4TM1A 3S61A 3F8DA 1JU2A 3KPKA 3NK1X 1ZKQA 3UKFA 4CCQA 1DODA 1O5WA 2APGA 4H4RA 4EQXA 1CC6A 1CBOA 1ZMDA 2C70A 4GR1A 1FL2A 4U8LA 1KNPA 3NYEA 2GEWA 1F8SA 2GR1A 1PHHA 4AP1A 2CVJA 2XLTA 2V6OA 1IUVA 5HYMA 5JCNA 3LOVA 2PHHA 3NK2X 3SGLA 1GV4A 1TDKA 5LV9A 4CRTA 2YG7A 2C67A 4B1BA 3QFAA 4BK3A 1GALA 1BWCA 3GRTA 1OJTA 3VRBA 3VR9A 1YQZA 3UP5A 3UKLA 4II2A 4I59A 3AE7A 4H4XA 1BGNA 3AXBA 1JOAA 2WQYA 1VRQB 2VQBA 3RP8A 4II3A 1Y56B 3AE2A 3V76A 2WU2A 5FMHA 2YLWA 3AYLA 3CTYA 3QSEA 1DJNA 4JNQA 4YXDA 4M52A 5BRTA 1Z6LA 2ZZCA 5C2TA 3B6DA 3RHAA 1VG0A 4U8NA 2WPEA 1EL9A 4GDPA 3SXIA 4EMWA 3NIXA 3KLJA 5KXJA 3AEFA 1E1KA 2WESA 5FS6A 3AECA 4OPCA 1YQ3A 4C77A 4Z2UA 5IPYA 4X9MA 4K2XA 1CJCA 3FPZA 4RG4A 3ISHA 4A99A 2X50A 2Z5XA 4BJYA 5CKUA 3ATRA 1IUSA 3B3RA 4OPIA 1NHQA 3T2KA 1ZK7A 2BC0A 3FG2P 3H4KA 2GAGB 2XLRA 3QVRA 1LV0A 2WOVA 1Y0PA 3DMEA 1PBFA 2WPFA 3NN0X 4X9NA 5EB5A 5L46A 1GRTA 3QJ4A 4USQA 4A6NB 4JNAA 3R9UA 1GRBA 1PS9A 2GAHB 3ICRA 1BKWA 4K22A 2YR5A 3UKAA 1LTXR 2DKHA 4J33A 1E7PA 2WDRA 3LADA 3D1CA 1FECA 3T2YA 1GEUA 4C5OA 2QAEA 3AE3A 1ZX9A 3CNJA 4J56A 4H4TA 4N9XA 2J3NA 1PN0A 2XFQA 4IA6A 4Z26A 3T14A 5KMRA 3KD9A 1KSUA 3EPTA 1L0VA 3DGZA 3NG7X 3DGHA 4EQWA 2E5VA 3ICTA 4OPGA 3IF9A 3P4QA 4GAPA 2YLXA 2WP6A 1K0LA 1YY5A 4B69A 1K0JA 2ZZBA 3PG6A 2I0ZA 2GQWA 3NGCX 2V61A 1NENA 3JSKA 4DNAA 4XXGA 4YT0A 4ZN0A 2TPRA 4H2NA 3QSMA 4B66A 1YKJA 2VRMA 2Z5YA 1KF6A 2QA2A 3K7QX 5DBJA 2B9XA 2C3DA 3VQRA 3NK0X 2V60A 1NHPA 1OJAA 1W4XA 2YWLA 4XWZA 4AOXA 1D4DA 4YTNA 4H4YA 3CNTA 3NTAA 1OJ9A 3AE1A 2OLOA 2EQ6A 1UKVG 2ACZA 2WOWA 3UOVA 1H86A 1E39A 2F5ZA 1FEAA 1EL8A 4OVIA 1NHRA 3GYXA 3HYXA 3ZDNA 3SZWA 4G9KA 2V5ZA 3AEAA 1H2IA 1ZMCA 1CJ2A 2WP9A 4Z2TA 1GNDA 4HA6A 4B65A 1PBBA 2C3CA 3DK9A 2JB3A 4TM4A 3DK8A 4P9SA 3FBSA 1NG4A 2OAMA 3CPHG 3LZWA 2YG5A 4U8KA 4WCTA 4EMJA 1M64A 4NEWA 1FOHA 3D9XA 1CC2A 4IA5A 3GD4A 1NG3A 3GYIA 2YLZA 2NPXA 2ZZ0A 4J57A 1H7WA 1MXTA 1TDEA 2R9ZA 3DJDA 4K5SA 3RP7A 5KRQA 2BS4A 2BXSA 2GR0A 2RABA 3P1WA 2GB0A 5FS7A 4A65A 5IQ4A 2EQ8A 1QO8A 1DNCA 2BC1A 3REDA 4YTPA 5KNLA 4O5QA 4BK2A 1N1PA 2X8HA 3URHA 2AQJA 1S2QA 2DKIA 1GOSA 1GSNA 3AD9B 3AE9A 2FBWA 5JCKA 1O95A 2RGHA 1DJQA 3CGBA 3PO7A 1GESA 2R0PA 2B9YA 2YG3A 5ER0A 1F3PA 3GYJA 4A5LA 1X31B 1IJHA 2JK6A 5HHFA 2FJBA 4U2SA 4EQRA 2XVHA 4GDEA 3O0HA 4EM3A 2A8XA 2BK4A 4HB9A 4U8OA 3CGEA 2GV8A 2Y6QA 3CNDA 4J31A 2C73A 4YSYA 2GQFA 1DOBA 3KA7A 1NAAA 1D4CA 2R46A 4IVOB 5CQFA 3UP4A 1LQTA 2R45A 2XFUA 3SFEA 2O9ZA 1JNZA 1N4VA 4G73A 4NTDA 5KOWA 3P4SA 2XLUA 1TDNA 1CJ4A 4FK1A 3GDNA 3AD7B 4JN9A 1S3BA 3AE6A 3K7MX 5EBKA 3FIMB 1E1LA 2XVEA 2XVJA 3AWIA 4NTCA 3CPIG 3BNUA 4EIQA 4ECHA 1PXAA 1JNRA 2A89A 3II4A 5FS9A 1F8RA 2UZZA 2VRLA 4JDRA 3EANA 1D4EA 2C7GA 3E1TA 3G5RA 1PDHA 2C76A 3AD8B 3FMWA 3NKSA 2E4GA 2B9WA 2H88A 3ALJA 3CMMA 3KU9A 3T0KA 3UKKA 1GXFA 2AR8A 3VRAA 3P4PA 4U8JA 5KVHA 3LZXA 5BUKA 3CN8A 1JRZA 1KNRA 2B76A 2RGOA 1QJDA 2WBAA 3GWFA 4U8PA 2XVFA 5GSNA 4GF7A 4UP3A 2NVKX 2HQMA 5KVIA 1H6VA 2XLPA 1GRFA 3GWDA 1LQUA 5IQ1A 3T37A 3V3OA 2XVIA 4D03A 4DSGA 1S3EA 1GTHA 1L9CA 2BS3A 3L1RA 4UDQA 2C65A 3V3NA 4ZCCA 3SFDA 2C75A 2YLSA 5EOWA 3QSSA 4G6HA 3C96A 4IV9A 4U2LA 3NN6X 3DJJA 1L9EA 3OC4A 4YKGA 3COXA 3SY4A 2GMJA 4C3XA 3QFBA 2R4JA 2GR2A 1SEZA 3AEEA 1JRYA 3DH9A 1EBDA 2JAEA 2BXRA 1KN0A 5M10A 1S2YA 2OLNA 4H2PA 4OCGA 3VR8A 4G74A 5BULA 1K0IA 1PXBA 3I6DA 4TLZA 2C4CA 3ALLA 1P2EA 3M12A 2PYXA 1PJ5A 4H4QA 3OZ2A 2ARDA 4H4SA 1H83A 1ELIA 1GERA 2Q7VA 3CPJG 3IHGA 3WE0A 1TDOA 2FJDA 3RP6A 3UCLA 5BVAA 2QA1A 1ZDLA 2YLTA 4OPUA 3LJPA 2EQ7A 1CC4A 1PJ7A 3AEDA 1H84A 1DOCA 5EB4A 1QLBA 1NPXA 4FK1C 4PAAA 4UDRA 2CULA 3NTDA 1XDIA 1RYIA 3GMCA 4LIIA 1EL7A 3M0OA 4GAVA 4TM3A 2W0HA 2WP5A 3M13A 4EMIA 4K8DA 2BRAA 5M0ZA 3UTFA 3NYFA 2WU5A 3UTHA 2Q6UA 3UOZA 1Y56A 2YR4A 3NNEA 3ALMA 1GRHA 1IUUA 2R0GA 3IHMA 3AYIA 1TYTA 1OJDA 2CFYA 5JRBA 1GTEA 2BACA 4YTMA 4J34A 3L8KA 4H4VA 4OPDA 4D04A 2FJEA 3ADAB 3G5SA 1CF3A 3K30A 1VQWA 3KPFA 2XYOA 4CNJA 1JEHA 5KOXA 4Z43A 2X8GA 4DSHA 3SYIA 3UOXA 3D8XA 2VVLA 1CJ3A 1E1MA 4OPTA 2YM1A 1B5QA 2YM2A 3CNPA 4IVMB 1B4VA 3RNMA 4YSHA 3UTGA 3S5WA 4NNJA 4NEVA 2H89A 4AT0A 4B64A 1BF3A 3GMBA 3Q9TA 2WHDA 3SM8A 2ZBWA 1PXCA 1DOEA 3ITJA 1LVLA 4Y4LA 4H50A 2TMDA 4YSXA 2GVCA 3CGCA 2VVMA 3P9UA 4J36A 2VVLG 4USRA 2A87A 2YG4A 4A6NA 2C72A 2FJAA 2YAUA 3H8IA 1CL0A 3GRSA 2OA1A 3CNSA 3EF6A 3VRDB 3BHFA 3HZLA 3T2ZA 4APNA 4Z25A 4DGKA 1GREA 5HY5A 1EL5A 2IIDA 2YVFA 3UOYA 2XDOA 3UTEA 2WETA 1XANA 2VOUA 4H4UA 1E6EA 1N4UA 2GMHA 3IC9A 4JY3A 3K7TA 1RP0A 4X4JA 1Q1WA 4ICYA 4ADWA 1XPQA 1O94A 4CBQA 5KMQA 3KVEA 3BI4A 3LXDA 4EM4A 3EAOA 2B7SA 3P4RA 1S7MA 1D7LA 2AAQA 1E1NA 1PBCA 4H7UA 2BCPA 2YVJA 3GSIA 4E0VA 5KWFA 4LA1A 2WDVA 3C4NA 2GR3A 4MJWA 3UKQA 3ZYXA 5KMSA 2B7RA 1JRXA 3ATQA 4TM0A 3SZ0A 3DJGX 1IUXA 3NHOX 4AT2A 1NHSA 3HYVA 4CY6A 3AE8A 3AYJA 2GF3A 1GT8A 2V3BA 3UKHA 4Z2RA 2WEUA 3F8PA 1ZY8A 5U25A 4U8MA 1TDFA 2BK5A 3ABVA 3NYCA 4K5RA 1TRBA 1XHCA 4EQSA 4O5UA 4A79A 4C74A 2WS3A 1DXLA 4J2WA 2YLRA 4Y4NA 2XFPA 4BV6A 1BZLA 3HYWA 2XFOA 3NH3X 4H4PA 1LJ1A 4U2TA 2IVDA 1H81A 2IVEA 1IUTA 2QCUA 4JQ9A 4REKA 4FX9A 3F8RA 5HXIA 4NZHA 1GRGA 1Q1RA 1L9DA 3SX6A 4NWZA 3NRNA 5KMPA 4OPLA 2C64A 1COYA 4B67A 1D5TA 1K4QA 3SQPA 1KDGA 5JCIA 4CCRA 2WDQA 3BNMA 1B8SA 4RSLA 2YQUA 2Q0KA 4BK1A 5C3JA 4H4WA 3KKJA 5JCMA 5TR3A 2BRYA 3SZFA 3AE4A 3CGDA 1HYUA 4KX6A 1VDCA 1PJ6A 4C3YA 4H2RA 3ICSA 3Q6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEK A;  2BYB A;  2JBV A;  1ZOY A;  2Q0L A;  2XCG A;  1NDA A;  4CY8 A;  4EIP A;  2VZ2 A;  3BI5 A;  4YWO A;  1MOK A;  1GRA A;  2X99 A;  5JCL A;  1CHU A;  2Y6R A;  2YR6 A;  1LPF A;  2YVG A;  1BGJ A;  1GPE A;  1YQ4 A;  1V59 A;  2BK3 A;  2E1M A;  3C4A A;  4I58 A;  1P2H A;  4RG3 A;  3H8L A;  4XWR A;  3DJE A;  1H7X A;  2X3N A;  4U8I A;  3BHK A;  3QVP A;  2BA9 A;  4A7A A;  4YSZ A;  4YKF A;  1TYP A;  4AOS A;  3GD3 A;  4BJZ A;  4GUV A;  2WPC A;  2WOI A;  1M6I A;  2GRT A;  1D7Y A;  5J60 A;  4FDC B;  4JY2 A;  1PBE A;  2X8C A;  3NLC A;  3DK4 A;  2EQ9 A;  3PVC A;  1GET A;  4UDP A;  3GDP A;  1FEB A;  1FCD A;  1H82 A;  2JB2 A;  4Z24 A;  3AEG A;  3G5Q A;  4WX1 A;  3CIR A;  2JKC A;  4GRT A;  3IWA A;  5U1O A;  4ZCD A;  2BS2 A;  3PS9 A;  3DA1 A;  1N4W A;  3AEB A;  1KSS A;  1RSG A;  5J7X A;  4Z44 A;  1ZP0 A;  2BAB A;  2R0C A;  4CNK A;  1IUW A;  1F6M A;  4B68 A;  3BI2 A;  5FS8 A;  1Q9I A;  2RGJ A;  3AB1 A;  4H4Z A;  2VQ7 A;  1MO9 A;  1KFY A;  2R4E A;  4LU6 A;  4PAB A;  2GH5 A;  4B63 A;  1B37 A;  2XLS A;  2CDU A;  4AP3 A;  3I3L A;  2C66 A;  2BCG G;  4H2Q A;  2XFN A;  1ONF A;  4Y4M A;  3LB8 A;  1AOG A;  4BUR A;  2OAL A;  4NTE A;  3AE5 A;  1REO A;  4KPR A;  5U63 A;  2JB1 A;  3UKP A;  1ZOV A;  2V3A A;  4GCM A;  1VG9 A;  5GRT A;  4TLX A;  4A9W A;  4K7Z A;  3NT6 A;  2YG6 A;  1F8W A;  1OJC A;  1PBD A;  4TM1 A;  3S61 A;  3F8D A;  1JU2 A;  3NK1 X;  3UKF A;  1ZKQ A;  4CCQ A;  1DOD A;  1O5W A;  2APG A;  4H4R A;  4EQX A;  1CC6 A;  1CBO A;  1ZMD A;  2C70 A;  4GR1 A;  1FL2 A;  4U8L A;  1KNP A;  3NYE A;  2GEW A;  1F8S A;  2GR1 A;  1PHH A;  4AP1 A;  2CVJ A;  2XLT A;  2V6O A;  1IUV A;  5HYM A;  5JCN A;  3LOV A;  2PHH A;  3NK2 X;  3SGL A;  1GV4 A;  1TDK A;  5LV9 A;  4CRT A;  2YG7 A;  2C67 A;  4B1B A;  3QFA A;  4BK3 A;  1GAL A;  1BWC A;  3GRT A;  1OJT A;  3VRB A;  3VR9 A;  1YQZ A;  3UP5 A;  3UKL A;  4I59 A;  3AE7 A;  4H4X A;  1BGN A;  3AXB A;  1JOA A;  2WQY A;  1VRQ B;  2VQB A;  3RP8 A;  3V76 A;  1Y56 B;  3AE2 A;  2WU2 A;  5FMH A;  2YLW A;  3AYL A;  3CTY A;  3QSE A;  1DJN A;  4JNQ A;  4YXD A;  4M52 A;  5BRT A;  1Z6L A;  2ZZC A;  5C2T A;  3B6D A;  3RHA A;  1VG0 A;  4U8N A;  2WPE A;  1EL9 A;  4GDP A;  4EMW A;  3NIX A;  3KLJ A;  5KXJ A;  3AEF A;  1E1K A;  2WES A;  5FS6 A;  3AEC A;  4OPC A;  1YQ3 A;  4C77 A;  4Z2U A;  5IPY A;  4X9M A;  4K2X A;  1CJC A;  3FPZ A;  4RG4 A;  3ISH A;  4A99 A;  2X50 A;  2Z5X A;  4BJY A;  5CKU A;  3ATR A;  1IUS A;  3B3R A;  4OPI A;  1NHQ A;  1ZK7 A;  2BC0 A;  3FG2 P;  3H4K A;  2GAG B;  2XLR A;  3QVR A;  1LV0 A;  2WOV A;  1Y0P A;  3DME A;  1PBF A;  2WPF A;  3NN0 X;  4X9N A;  5EB5 A;  5L46 A;  1GRT A;  3QJ4 A;  4USQ A;  4A6N B;  4JNA A;  3R9U A;  1GRB A;  1PS9 A;  2GAH B;  3ICR A;  1BKW A;  4K22 A;  2YR5 A;  3UKA A;  1LTX R;  2DKH A;  4J33 A;  1E7P A;  2WDR A;  3LAD A;  3D1C A;  1FEC A;  1GEU A;  4C5O A;  2QAE A;  3AE3 A;  1ZX9 A;  3CNJ A;  4J56 A;  4H4T A;  4N9X A;  2J3N A;  1PN0 A;  2XFQ A;  4IA6 A;  4Z26 A;  3KD9 A;  1KSU A;  3EPT A;  1L0V A;  3DGZ A;  3NG7 X;  3DGH A;  4EQW A;  2E5V A;  3ICT A;  4OPG A;  3IF9 A;  3P4Q A;  2YLX A;  2WP6 A;  1K0L A;  1YY5 A;  4B69 A;  1K0J A;  2ZZB A;  2I0Z A;  3NGC X;  2GQW A;  2V61 A;  1NEN A;  3JSK A;  4DNA A;  4XXG A;  4YT0 A;  4ZN0 A;  2TPR A;  4H2N A;  3QSM A;  4B66 A;  1YKJ A;  2VRM A;  2Z5Y A;  1KF6 A;  2QA2 A;  3K7Q X;  5DBJ A;  2B9X A;  2C3D A;  3VQR A;  3NK0 X;  2V60 A;  1NHP A;  1OJA A;  1W4X A;  2YWL A;  4XWZ A;  4AOX A;  1D4D A;  4YTN A;  4H4Y A;  3CNT A;  3NTA A;  1OJ9 A;  3AE1 A;  2OLO A;  2EQ6 A;  1UKV G;  2ACZ A;  2WOW A;  3UOV A;  1H86 A;  1E39 A;  2F5Z A;  1FEA A;  1EL8 A;  4OVI A;  1NHR A;  3ZDN A;  2V5Z A;  3AEA A;  1CJ2 A;  1ZMC A;  2WP9 A;  4Z2T A;  1GND A;  4HA6 A;  4B65 A;  1PBB A;  2C3C A;  3DK9 A;  2JB3 A;  4TM4 A;  3DK8 A;  4P9S A;  3FBS A;  1NG4 A;  2OAM A;  3CPH G;  3LZW A;  2YG5 A;  4U8K A;  4WCT A;  4EMJ A;  1M64 A;  4NEW A;  1FOH A;  1CC2 A;  4IA5 A;  3GD4 A;  1NG3 A;  3GYI A;  2YLZ A;  2NPX A;  2ZZ0 A;  4J57 A;  1H7W A;  1MXT A;  1TDE A;  2R9Z A;  3DJD A;  4K5S A;  3RP7 A;  5KRQ A;  2BS4 A;  2BXS A;  2GR0 A;  2RAB A;  3P1W A;  2GB0 A;  5FS7 A;  4A65 A;  5IQ4 A;  2EQ8 A;  1QO8 A;  1DNC A;  2BC1 A;  3RED A;  4YTP A;  4O5Q A;  4BK2 A;  1N1P A;  2X8H A;  3URH A;  2AQJ A;  1S2Q A;  2DKI A;  1GOS A;  1GSN A;  3AD9 B;  3AE9 A;  2FBW A;  5JCK A;  1O95 A;  2RGH A;  1DJQ A;  3CGB A;  3PO7 A;  1GES A;  2R0P A;  2B9Y A;  2YG3 A;  5ER0 A;  1F3P A;  3GYJ A;  4A5L A;  1X31 B;  1IJH A;  2JK6 A;  5HHF A;  2FJB A;  4U2S A;  4EQR A;  2XVH A;  4GDE A;  3O0H A;  4EM3 A;  2A8X A;  2BK4 A;  4HB9 A;  4U8O A;  3CGE A;  2GV8 A;  2Y6Q A;  3CND A;  4J31 A;  2C73 A;  4YSY A;  2GQF A;  1DOB A;  3KA7 A;  1NAA A;  1D4C A;  2R46 A;  4IVO B;  5CQF A;  3UP4 A;  1LQT A;  2R45 A;  2XFU A;  3SFE A;  2O9Z A;  1JNZ A;  1N4V A;  4NTD A;  5KOW A;  3P4S A;  2XLU A;  1TDN A;  1CJ4 A;  4FK1 A;  3GDN A;  3AD7 B;  4JN9 A;  1S3B A;  3AE6 A;  3K7M X;  5EBK A;  3FIM B;  1E1L A;  2XVE A;  2XVJ A;  3AWI A;  4NTC A;  3CPI G;  3BNU A;  4EIQ A;  4ECH A;  1PXA A;  1JNR A;  2A89 A;  3II4 A;  5FS9 A;  1F8R A;  2UZZ A;  2VRL A;  4JDR A;  3EAN A;  1D4E A;  2C7G A;  3E1T A;  3G5R A;  1PDH A;  2C76 A;  3AD8 B;  3FMW A;  3NKS A;  2E4G A;  2B9W A;  2H88 A;  3ALJ A;  3KU9 A;  3UKK A;  1GXF A;  2AR8 A;  3VRA A;  3P4P A;  4U8J A;  5KVH A;  3LZX A;  5BUK A;  3CN8 A;  1JRZ A;  1KNR A;  2B76 A;  2RGO A;  1QJD A;  2WBA A;  3GWF A;  4U8P A;  2XVF A;  5GSN A;  4GF7 A;  4UP3 A;  2NVK X;  2HQM A;  5KVI A;  1H6V A;  2XLP A;  1GRF A;  3GWD A;  1LQU A;  5IQ1 A;  3T37 A;  3V3O A;  2XVI A;  4D03 A;  4DSG A;  1S3E A;  1GTH A;  1L9C A;  2BS3 A;  3L1R A;  4UDQ A;  2C65 A;  3V3N A;  4ZCC A;  3SFD A;  2C75 A;  2YLS A;  5EOW A;  3QSS A;  3C96 A;  4IV9 A;  4U2L A;  3NN6 X;  3DJJ A;  1L9E A;  3OC4 A;  4YKG A;  3COX A;  2GMJ A;  4C3X A;  3QFB A;  2R4J A;  2GR2 A;  1SEZ A;  3AEE A;  1JRY A;  3DH9 A;  1EBD A;  2JAE A;  2BXR A;  5M10 A;  1S2Y A;  2OLN A;  4H2P A;  4OCG A;  3VR8 A;  5BUL A;  1K0I A;  1PXB A;  3I6D A;  4TLZ A;  3ALL A;  1P2E A;  3M12 A;  2PYX A;  1PJ5 A;  4H4Q A;  3OZ2 A;  2ARD A;  4H4S A;  1H83 A;  1ELI A;  1GER A;  2Q7V A;  3CPJ G;  3IHG A;  3WE0 A;  1TDO A;  2FJD A;  3RP6 A;  3UCL A;  5BVA A;  2QA1 A;  1ZDL A;  2YLT A;  4OPU A;  3LJP A;  2EQ7 A;  1CC4 A;  1PJ7 A;  3AED A;  1H84 A;  1DOC A;  5EB4 A;  1QLB A;  1NPX A;  4FK1 C;  4PAA A;  4UDR A;  2CUL A;  3NTD A;  1XDI A;  1RYI A;  3GMC A;  4LII A;  1EL7 A;  3M0O A;  4TM3 A;  2W0H A;  2WP5 A;  3M13 A;  4EMI A;  4K8D A;  5M0Z A;  3UTF A;  3NYF A;  2WU5 A;  3UTH A;  2Q6U A;  3UOZ A;  1Y56 A;  2YR4 A;  3NNE A;  3ALM A;  1GRH A;  1IUU A;  2R0G A;  3IHM A;  3AYI A;  1TYT A;  1OJD A;  2CFY A;  2BAC A;  1GTE A;  4YTM A;  4J34 A;  3L8K A;  4H4V A;  4OPD A;  4D04 A;  2FJE A;  3ADA B;  3G5S A;  1CF3 A;  3K30 A;  1VQW A;  3KPF A;  2XYO A;  4CNJ A;  1JEH A;  5KOX A;  4Z43 A;  2X8G A;  4DSH A;  3UOX A;  3D8X A;  2VVL A;  1CJ3 A;  1E1M A;  4OPT A;  2YM1 A;  1B5Q A;  2YM2 A;  3CNP A;  4IVM B;  1B4V A;  3RNM A;  4YSH A;  3UTG A;  3S5W A;  4NEV A;  2H89 A;  4AT0 A;  4B64 A;  1BF3 A;  3GMB A;  3Q9T A;  2WHD A;  3SM8 A;  2ZBW A;  1PXC A;  1DOE A;  3ITJ A;  1LVL A;  4Y4L A;  4H50 A;  2TMD A;  4YSX A;  2GVC A;  3CGC A;  2VVM A;  3P9U A;  4J36 A;  2VVL G;  4USR A;  2A87 A;  2YG4 A;  4A6N A;  2C72 A;  2FJA A;  2YAU A;  3H8I A;  1CL0 A;  3GRS A;  2OA1 A;  3CNS A;  3EF6 A;  3VRD B;  3BHF A;  3HZL A;  4APN A;  4Z25 A;  4DGK A;  1GRE A;  5HY5 A;  1EL5 A;  2IID A;  2YVF A;  3UOY A;  2XDO A;  3UTE A;  2WET A;  1XAN A;  2VOU A;  4H4U A;  1E6E A;  1N4U A;  2GMH A;  3IC9 A;  4JY3 A;  3K7T A;  1RP0 A;  4X4J A;  1Q1W A;  4ICY A;  4ADW A;  1XPQ A;  1O94 A;  4CBQ A;  3KVE A;  3BI4 A;  3LXD A;  4EM4 A;  3EAO A;  2B7S A;  3P4R A;  1D7L A;  2AAQ A;  1E1N A;  1PBC A;  4H7U A;  2BCP A;  2YVJ A;  3GSI A;  4E0V A;  5KWF A;  4LA1 A;  2WDV A;  3C4N A;  2GR3 A;  4MJW A;  3UKQ A;  3ZYX A;  2B7R A;  1JRX A;  3ATQ A;  4TM0 A;  3DJG X;  1IUX A;  3NHO X;  4AT2 A;  1NHS A;  4CY6 A;  3AE8 A;  3AYJ A;  2GF3 A;  1GT8 A;  2V3B A;  3UKH A;  4Z2R A;  2WEU A;  3F8P A;  1ZY8 A;  5U25 A;  4U8M A;  1TDF A;  2BK5 A;  3ABV A;  3NYC A;  4K5R A;  1TRB A;  1XHC A;  4EQS A;  4O5U A;  4A79 A;  4C74 A;  2WS3 A;  1DXL A;  4J2W A;  2YLR A;  4Y4N A;  2XFP A;  4BV6 A;  1BZL A;  2XFO A;  3NH3 X;  4H4P A;  1LJ1 A;  4U2T A;  2IVD A;  1H81 A;  2IVE A;  1IUT A;  2QCU A;  4JQ9 A;  4REK A;  4FX9 A;  3F8R A;  5HXI A;  4NZH A;  1GRG A;  1Q1R A;  1L9D A;  3NRN A;  4OPL A;  2C64 A;  1COY A;  4B67 A;  1D5T A;  1K4Q A;  3SQP A;  1KDG A;  5JCI A;  4CCR A;  2WDQ A;  3BNM A;  1B8S A;  4RSL A;  2YQU A;  2Q0K A;  4BK1 A;  5C3J A;  4H4W A;  3KKJ A;  5JCM A;  5TR3 A;  3AE4 A;  3CGD A;  1HYU A;  4KX6 A;  1VDC A;  1PJ6 A;  4C3Y A;  4H2R A;  3ICS A;  3Q6J A; 
#chains in the Genus database with same CATH topology
 3S5S A;  2Q0L A;  5JCL A;  1CHU A;  3DG7 A;  1LPF A;  1BGJ A;  1GPE A;  4RG3 A;  2E1M A;  4I58 A;  3H8L A;  4U8I A;  3BHK A;  2BA9 A;  4YSZ A;  1TYP A;  4AOS A;  3TCS A;  2I5Q A;  4BJZ A;  4GUV A;  1M6I A;  2GRT A;  1D7Y A;  1RM6 B;  3PVC A;  4IHC A;  4GYP C;  3K1G A;  2JB2 A;  2ZAD A;  4WX1 A;  2OZT A;  3PS9 A;  1N4W A;  4F4R A;  3BI2 A;  4X2P A;  1Q9I A;  2RGJ A;  2VQ7 A;  1MO9 A;  1KFY A;  2R4E A;  4LU6 A;  4B63 A;  3SZC A;  4AP3 A;  3SSZ A;  2BCG G;  2XFN A;  1ONF A;  2MNR A;  3LB8 A;  2POD A;  5U63 A;  2P0I A;  1REO A;  3UKP A;  1ZOV A;  1IYX A;  5GRT A;  4K7Z A;  1OJC A;  4IT1 A;  1PBD A;  3OW1 A;  3KPK A;  3UKF A;  2APG A;  4EQX A;  1ZMD A;  3T9P A;  1PDZ A;  2CVJ A;  5HYM A;  3LOV A;  2PHH A;  3NK2 X;  4BK3 A;  1GAL A;  4II2 A;  3AE7 A;  5ENL A;  1JOA A;  2OX4 A;  3BJS A;  3P93 A;  4HCH A;  3R25 A;  1VG0 A;  1EL9 A;  1SJA A;  4J3Z A;  5FS6 A;  4E6M A;  1YQ3 A;  2ZC8 A;  1CJC A;  4RG4 A;  3ISH A;  4BJY A;  2E5A A;  1NHQ A;  3T2K A;  2WOV A;  3DME A;  1GRT A;  3GC2 A;  3FV9 A;  1ONE A;  4TVW A;  2HNE A;  2WDR A;  3LAD A;  2P88 A;  3T2Y A;  1R6W A;  3AE3 A;  3CNJ A;  4J56 A;  4N9X A;  2XFQ A;  3P0W A;  4IA6 A;  3NVY B;  4EQW A;  1YY5 A;  2I0Z A;  4YT0 A;  4ZN0 A;  1N62 C;  3QSM A;  1YKJ A;  2Z5Y A;  2E3T A;  2V60 A;  1NHP A;  4YTN A;  3CNT A;  3AE1 A;  4HCL A;  1UKV G;  2WOW A;  1E39 A;  2F5Z A;  3AEA A;  2C3C A;  3DK8 A;  3LZW A;  1NG4 A;  4WCT A;  3MY9 A;  1FOH A;  3D9X A;  1CC2 A;  1MUC A;  2YLZ A;  2ZZ0 A;  3RP7 A;  2BXS A;  2GR0 A;  5FS7 A;  1ZXI C;  1VDV A;  4YTP A;  4O5Q A;  3URH A;  1GOS A;  2FBW A;  1DJQ A;  3VCC A;  1X31 B;  4U2S A;  3NXL A;  4EM3 A;  3H8A A;  2GV8 A;  4J31 A;  2GQF A;  3NRZ B;  5CQF A;  1N5W C;  1N4V A;  3UJF A;  1CJ4 A;  4FK1 A;  4JN9 A;  3AD7 B;  3AE6 A;  2XVE A;  3ZLH A;  1PXA A;  2UZZ A;  3EAN A;  3AD8 B;  4G8T A;  2B9W A;  3T0K A;  3KU9 A;  1T3Q C;  1GXF A;  3P4P A;  4U8J A;  5KVH A;  1P43 A;  1XPY A;  4GGB A;  2PSN A;  4UP3 A;  1LQU A;  4D03 A;  3T37 A;  2XVI A;  1P48 A;  1S3E A;  1MRA A;  3V3N A;  3UGV A;  2YLS A;  3QSS A;  2OO6 A;  2R4J A;  1EC7 A;  1JRY A;  3IK4 A;  5FJP A;  5M10 A;  2OLN A;  4G74 A;  3EKG A;  3AN1 A;  4M0X A;  2ARD A;  1ELI A;  2Q7V A;  3WE0 A;  3RP6 A;  5BVA A;  4OPU A;  3ZVH A;  2EQ7 A;  3FJ4 A;  4FK1 C;  3RR1 A;  4EWJ A;  4EMI A;  4K8D A;  1FFU C;  2BRA A;  1BQG A;  3NYF A;  3MUC A;  3UJE A;  2Q6U A;  3UOZ A;  2R0G A;  3H12 A;  1OJD A;  1GTE A;  4J34 A;  3G5S A;  3K30 A;  4CNJ A;  1JEH A;  2GGH A;  2VVL A;  4OPT A;  4HYR A;  3TOY A;  3CNP A;  3RNM A;  4JN8 A;  4NNJ A;  4NEV A;  2H89 A;  1N5X A;  4AT0 A;  4A3R A;  1F9C A;  4IZG A;  3STP A;  2TMD A;  2VVM A;  2YG4 A;  2C72 A;  1TKK A;  3VRD B;  3OP2 A;  3HZL A;  3UOY A;  3UTE A;  1XAN A;  1E6E A;  4JY3 A;  3IC9 A;  1Q1W A;  3CXO A;  1VQZ A;  4EM4 A;  3T8Q A;  3V3W A;  2BCP A;  3GSI A;  4LA1 A;  2WDV A;  3ZYX A;  3UKQ A;  5KMS A;  2B7R A;  4TM0 A;  3NHO X;  2GF3 A;  4Z2R A;  1ZY8 A;  4U8M A;  1TDF A;  1XHC A;  4BV6 A;  1JRO A;  2IVD A;  2DW6 A;  3V5F A;  2IVE A;  4KT2 A;  3DDM A;  3ES8 A;  1Q1R A;  1L9D A;  3TQP A;  4Z1Y A;  4B67 A;  1KDG A;  2P8B A;  2YQU A;  2Q0K A;  4H4W A;  5JCM A;  3SZF A;  1VDC A;  1DTN A;  5G5G B;  3Q6J A;  1NEK A;  2XH7 A;  4EIP A;  2X99 A;  1GRA A;  2YR6 A;  2BK3 A;  3C4A A;  2AL2 B;  1P2H A;  4XWR A;  3S47 A;  1SJC A;  3T31 A;  1TZZ A;  2WOI A;  4FDC B;  1PBE A;  2EQ9 A;  4E4U A;  1GET A;  4UDP A;  1FEB A;  5U1O A;  2BS2 A;  3AEB A;  1RSG A;  5J7X A;  1IUW A;  2XLS A;  3I3L A;  1AOG A;  3AE5 A;  1JDF A;  4GCM A;  3HPF A;  3S61 A;  1O5W A;  1CC6 A;  1CBO A;  4GR1 A;  4U8L A;  2GEW A;  2GR1 A;  2XLT A;  1IUV A;  3R1Z A;  5JCN A;  3SGL A;  1GV4 A;  3EEZ A;  2PP0 A;  3RO6 A;  2XH2 A;  3GRT A;  1YQZ A;  3UP5 A;  4DHG A;  2HXT A;  1KKR A;  2WQY A;  2PS2 A;  2YLW A;  1N63 C;  1DJN A;  4M52 A;  5BRT A;  1Z6L A;  5C2T A;  3B6D A;  4KEM A;  3RHA A;  4U8N A;  2WPE A;  3ETR B;  3FYY A;  3DIP A;  3AEF A;  5KXJ A;  1E1K A;  4OPC A;  3RCY A;  4C77 A;  4Z2U A;  4A99 A;  3DER A;  5CKU A;  3ATR A;  1IUS A;  3B3R A;  4OPI A;  1ZK7 A;  3H4K A;  3ES7 A;  3UJ2 A;  1WUE A;  1Y0P A;  3Q45 A;  5EB5 A;  3R9U A;  1GRB A;  1BKW A;  1LTX R;  4KWS A;  4J33 A;  4FI4 A;  4C5O A;  1ZX9 A;  4H4T A;  4Z26 A;  3T14 A;  3DFH A;  1KSU A;  3NG7 X;  3MWC A;  3IF9 A;  1KCZ A;  1EBH A;  3P4Q A;  2YLX A;  4GAP A;  1K0L A;  2V61 A;  4DNA A;  1XS2 A;  2GSH A;  1KF6 A;  2QA2 A;  2PCE A;  3NK0 X;  4DX3 A;  1W4X A;  4XWZ A;  1D4D A;  3NTA A;  3QN3 A;  2OLO A;  2EQ6 A;  1FEA A;  4OVI A;  1NHR A;  4HCD A;  3HYX A;  4Z2T A;  1H2I A;  1GND A;  4TM4 A;  4P9S A;  3FBS A;  2OAM A;  4U8K A;  3RRA A;  4NEW A;  1NG3 A;  1L8P A;  3HRD C;  1H7W A;  2R9Z A;  1E9I A;  3SN1 A;  3DEQ A;  4A65 A;  5IQ4 A;  2EQ8 A;  3FXG A;  1N1P A;  1S2Q A;  1GSN A;  3PO7 A;  2YG3 A;  5ER0 A;  1F3P A;  4EQR A;  2XVH A;  1PDY A;  2Y6Q A;  3CND A;  1YEY A;  4YSY A;  2XH4 A;  1NAA A;  4IVO B;  2R45 A;  3JW7 A;  7ENL A;  2O9Z A;  3VDG A;  5KOW A;  1TDN A;  3GDN A;  1KD0 A;  1S3B A;  3K7M X;  4NTC A;  2A89 A;  5FS9 A;  3JVA A;  3E1T A;  1MNS A;  2C7G A;  3UXL A;  3MZN A;  3SN0 A;  3UKK A;  2AR8 A;  3RGT A;  3GD6 A;  3LZX A;  2DW7 A;  1OEP A;  1JRZ A;  2RGO A;  5GSN A;  1GRF A;  3V3O A;  1KKO A;  1L9C A;  4UDQ A;  2C65 A;  2C75 A;  3C96 A;  4U2L A;  3NN6 X;  3DJJ A;  4YKG A;  3QFB A;  2W3R A;  4H2P A;  4OCG A;  1K0I A;  1PXB A;  1PJ5 A;  4H4S A;  1H83 A;  3CPJ G;  2AKM A;  2FJD A;  1ZDL A;  3BOX A;  3LJP A;  2OQH A;  1DOC A;  1NPX A;  4PAA A;  4UDR A;  1XDI A;  4HN8 A;  2WP5 A;  5M0Z A;  5BOE A;  3OZM A;  3NNE A;  3ALM A;  3OZY A;  3AYI A;  3B9J B;  2GGG A;  4OPD A;  3ADA B;  5KOX A;  4G7F A;  3UOX A;  1CJ3 A;  1B5Q A;  1N60 C;  3UTG A;  2PTY A;  3TWB A;  3SM8 A;  4ZCW A;  1PXC A;  4YSX A;  3D47 A;  4Z17 A;  3QKE A;  2FKP A;  4K1W A;  2FJA A;  2YAU A;  1CL0 A;  3CNS A;  2PP1 A;  1GRE A;  2W55 A;  3B97 A;  2VOU A;  4CBQ A;  4ADW A;  3CYJ A;  2GDQ A;  4K8G A;  2YVJ A;  4GIS A;  4AT2 A;  4CY6 A;  3UKH A;  2V3B A;  3F8P A;  1MDR A;  5U25 A;  3NYC A;  3DES A;  1TRB A;  4A79 A;  4JN7 A;  2YLR A;  1BZL A;  2XFO A;  3NH3 X;  4H4P A;  4U2T A;  4JQ9 A;  4NZH A;  1RVK A;  1GRG A;  5KMP A;  4OPL A;  1SB3 B;  2QQ6 A;  1K4Q A;  4BK1 A;  3KKJ A;  2BRY A;  4KX6 A;  4C3Y A;  2ONE A;  3SR6 B;  3IJL A;  2BYB A;  3DGB A;  3FVD A;  1ZOY A;  2OVL A;  2XCG A;  4CY8 A;  2VZ2 A;  1MOK A;  2YVG A;  1YQ4 A;  3DJE A;  1H7X A;  2X3N A;  3VFC A;  3QVP A;  4YKF A;  3GD3 A;  3NVZ B;  3VCN A;  2WPC A;  2P8C A;  5J60 A;  3VC5 A;  4JY2 A;  3NLC A;  2AKZ A;  1FCD A;  3G5Q A;  2JKC A;  4GRT A;  3IWA A;  4ZCD A;  4TVY A;  1ELS A;  1ZP0 A;  2BAB A;  2R0C A;  5FS8 A;  3KUM A;  2GH5 A;  3SBF A;  2CDU A;  2C66 A;  4H2Q A;  3NVW B;  3SQS A;  4BUR A;  2OAL A;  2V3A A;  4TLX A;  4A9W A;  3NT6 A;  4ROP A;  1F8W A;  2YG6 A;  4TM1 A;  1JU2 A;  2OQY A;  1ZKQ A;  4CCQ A;  4H4R A;  4ENL A;  1KNP A;  4AP1 A;  2V6O A;  2MUC A;  4DXK A;  3MSY A;  4CRT A;  2YG7 A;  3I6T A;  1BWC A;  3VR9 A;  3UKL A;  4H4X A;  4DWD A;  3AXB A;  1VRQ B;  2POZ A;  3RP8 A;  3V76 A;  1Y56 B;  3BSM A;  2WU2 A;  3CTY A;  1JPM A;  4IP5 A;  4JNQ A;  1FIQ B;  3SXI A;  4EMW A;  3NIX A;  1EC8 A;  2WES A;  3AEC A;  5IPY A;  2X50 A;  4ZOH B;  2Z5X A;  3TWA A;  2QJM A;  2BC0 A;  3FG2 P;  1EC9 A;  2GGI A;  2XLR A;  3NN0 X;  2WPF A;  5L46 A;  4USQ A;  4A6N B;  1PS9 A;  2GAH B;  4J1O A;  4K22 A;  2GL5 A;  2YR5 A;  3AM9 A;  2DKH A;  3D1C A;  1FEC A;  1GEU A;  2OLA A;  2J3N A;  5KMR A;  3KD9 A;  3IJQ A;  3DGZ A;  4OPG A;  2GQW A;  3JSK A;  4B66 A;  3K7Q X;  5DBJ A;  2B9X A;  2C3D A;  3VQR A;  4HPN A;  1OJA A;  2YWL A;  4H4Y A;  3QPE A;  1EL8 A;  4G9K A;  1ZMC A;  4HA6 A;  1PBB A;  2JB3 A;  3QLD A;  4ZA0 A;  3CPH G;  2YG5 A;  3P3B A;  4IA5 A;  3GD4 A;  2NPX A;  1MXT A;  4J57 A;  1TDE A;  3DJD A;  4K5S A;  3CXB A;  3A7U A;  4YWS A;  2BS4 A;  3CB3 A;  4A35 A;  2X8H A;  3U9I A;  5JCK A;  2RGH A;  3PWG A;  1GES A;  4A5L A;  5HHF A;  2FJB A;  3O0H A;  2A8X A;  3NVV B;  4HB9 A;  4GFI A;  4MKS A;  2AL2 A;  2C73 A;  1DOB A;  3UP4 A;  1JNZ A;  4NTD A;  3IJI A;  2XLU A;  5EBK A;  3FIM B;  2XVJ A;  3CPI G;  4EIQ A;  1SJD A;  1JNR A;  2VRL A;  4JDR A;  3NKS A;  3UCC A;  3FMW A;  2E4G A;  2H88 A;  3CMM A;  5BUK A;  3CN8 A;  2B76 A;  3GY1 A;  2WBA A;  3N6J A;  3GWF A;  4U8P A;  2XVF A;  4GF7 A;  2HQM A;  5IQ1 A;  2BS3 A;  3L1R A;  4ZCC A;  3SFD A;  4G6H A;  4IV9 A;  1L9E A;  3OC4 A;  3MKC A;  1WYG A;  1W6T A;  2GMJ A;  2GR2 A;  1SEZ A;  3AEE A;  3DH9 A;  2JAE A;  5BUL A;  1ECQ A;  3I6D A;  4TLZ A;  2C4C A;  1P2E A;  3M12 A;  2PYX A;  4H4Q A;  3OZ2 A;  4H19 A;  1GER A;  3IHG A;  1TDO A;  2YLT A;  1CC4 A;  1PJ7 A;  3AED A;  1H84 A;  2XGZ A;  4MMW A;  4GAV A;  4TM3 A;  2AL1 A;  3UTF A;  3OTR A;  2PMQ A;  2WU5 A;  3UTH A;  4IL0 A;  1IUU A;  2O56 A;  1TYT A;  3DG6 A;  4YTM A;  5JRB A;  3L8K A;  1VQW A;  3CK5 A;  3PWI A;  4Z43 A;  2X8G A;  4DSH A;  3SYI A;  3V5C A;  3TJI A;  6ENL A;  3S5W A;  3H7V A;  1N61 C;  4B64 A;  2CHR A;  3Q9T A;  3DFY A;  2WHD A;  2ZBW A;  1DOE A;  1LVL A;  4K2S A;  4Y4L A;  2GVC A;  4J36 A;  2VVL G;  3H8I A;  3GRS A;  2OA1 A;  3PK7 A;  3EF6 A;  3T2Z A;  3SN4 A;  4DGK A;  1EL5 A;  2IID A;  2YVF A;  1JRP A;  1N4U A;  2GMH A;  3K7T A;  1RP0 A;  4X4J A;  1XPQ A;  1O94 A;  3KVE A;  3BI4 A;  3EAO A;  1S7M A;  1PBC A;  5KWF A;  3C4N A;  2GR3 A;  4MJW A;  3NZG A;  1GT8 A;  2OPJ A;  5FJR A;  2BK5 A;  3ABV A;  4K5R A;  4EQS A;  4O5U A;  4C74 A;  2WS3 A;  1DXL A;  4Y4N A;  2XFP A;  4DN1 A;  5EU9 A;  2QJN A;  2OFJ A;  3CT2 A;  4FX9 A;  4MGG A;  3F8R A;  1JCT A;  2C64 A;  1D5T A;  4CCR A;  5JCI A;  2WDQ A;  3BNM A;  4RSL A;  4H1Z A;  5C3J A;  3AE4 A;  3CGD A;  1HYU A;  1PJ6 A;  2XH0 A;  3NTD A;  3DG3 A;  4G6G A;  2JBV A;  1FO4 A;  1NDA A;  3BI5 A;  4YWO A;  1STZ A;  2Y6R A;  1V59 A;  4A6G A;  4A7A A;  1FFV C;  2OG9 A;  1BKH A;  3Q4D A;  1NEL A;  2X8C A;  3DK4 A;  3NO1 A;  2W3S A;  3GDP A;  1H82 A;  4Z24 A;  3AEG A;  3CIR A;  2PTZ A;  3ZVI A;  3DA1 A;  3PFR A;  1KSS A;  4Z44 A;  4CNK A;  1F6M A;  4B68 A;  3AB1 A;  4H4Z A;  4PAB A;  1B37 A;  3U4F A;  4Y4M A;  4NTE A;  4KPR A;  2JB1 A;  2QJJ A;  3L5O A;  3R0U A;  1VG9 A;  3R11 A;  1FHU A;  3F8D A;  3NK1 X;  1DOD A;  2PGE A;  2PU0 A;  2C70 A;  1FL2 A;  3MQT A;  3NYE A;  1F8S A;  3H70 A;  1PHH A;  2HXU A;  3ZVH B;  1TDK A;  5LV9 A;  3CAW A;  2OKT A;  2C67 A;  4B1B A;  3QFA A;  3VRB A;  1OJT A;  1WUF A;  4I59 A;  1FHV A;  3I6E A;  1BGN A;  2VQB A;  4II3 A;  3AE2 A;  3ENL A;  5FMH A;  3AYL A;  3NS1 B;  3QSE A;  4YXD A;  3ZLG A;  2ZZC A;  4GDP A;  3KLJ A;  5G5H B;  1X2G A;  3TTE A;  4X9M A;  4K2X A;  3FPZ A;  2PTW A;  2GAG B;  3QVR A;  2PA6 A;  1LV0 A;  1PBF A;  4X9N A;  5FJT A;  4GIR A;  3ZLF A;  3QJ4 A;  4JNA A;  3JZU A;  3T6C A;  3ICR A;  2OZ3 A;  3UKA A;  3QTP A;  1E7P A;  3AMZ A;  3I4K A;  2QAE A;  4HNC A;  1PN0 A;  3EPT A;  1L0V A;  3DGH A;  2E5V A;  3ICT A;  2WP6 A;  4B69 A;  1K0J A;  2ZZB A;  3PG6 A;  3NGC X;  1NEN A;  4XXG A;  2TPR A;  4H2N A;  2VRM A;  4E4F A;  2XSX A;  4AOX A;  1OJ9 A;  2ACZ A;  3UOV A;  1H86 A;  3GYX A;  3ZDN A;  3N4F A;  3SZW A;  3R10 A;  2V5Z A;  1CJ2 A;  2WP9 A;  2PGW A;  4B65 A;  3DK9 A;  1NU5 A;  4EMJ A;  1M64 A;  3EUB 3;  3GYI A;  5KRQ A;  2HZG A;  2RAB A;  3P1W A;  2GB0 A;  2P3Z A;  1QO8 A;  1DNC A;  2BC1 A;  3RED A;  5KNL A;  3UJS A;  4BK2 A;  2AQJ A;  4IL2 A;  2DKI A;  3AD9 B;  3AE9 A;  1O95 A;  3CGB A;  2R0P A;  2B9Y A;  1TE6 A;  3GYJ A;  1IJH A;  2JK6 A;  4E5T A;  3UXK A;  4GDE A;  2BK4 A;  4U8O A;  4IP4 A;  3CGE A;  2NQL A;  3V4B A;  2PTX A;  3KA7 A;  1D4C A;  2R46 A;  1LQT A;  3SFE A;  2XFU A;  1R0M A;  4G73 A;  3P4S A;  3UCD A;  1E1L A;  4FP1 A;  3AWI A;  5FJU A;  3BNU A;  4ECH A;  3II4 A;  1F8R A;  2QDE A;  2PU1 A;  1D4E A;  3G5R A;  1PDH A;  2C76 A;  2QVH A;  3VA8 A;  2GGJ A;  3ALJ A;  5IDZ A;  3VRA A;  1X2H A;  1KNR A;  1QJD A;  2QGY A;  1SJB A;  3N4E A;  2NVK X;  5KVI A;  2XLP A;  1H6V A;  3GWD A;  3R07 C;  4DSG A;  1GTH A;  3A7A A;  5EOW A;  4H83 A;  2OZ8 A;  3COX A;  3SY4 A;  4C3X A;  3T4W A;  1EBD A;  2PP3 A;  2BXR A;  1KN0 A;  1S2Y A;  3VR8 A;  3ALL A;  3N6H A;  4H2H A;  3UCL A;  2QA1 A;  3OPS A;  1EBG A;  4E8G A;  5EB4 A;  1QLB A;  3FCP A;  2CUL A;  1RYI A;  3GMC A;  4LII A;  1EL7 A;  3M0O A;  2W0H A;  3M13 A;  4DYE A;  1Y56 A;  2YR4 A;  1GRH A;  3IHM A;  3TJ4 A;  2CFY A;  2BAC A;  2QDD A;  4H4V A;  4D04 A;  2FJE A;  3KPF A;  1CF3 A;  2XYO A;  2PPG A;  3D8X A;  1E1M A;  2YM1 A;  2YM2 A;  4IVM B;  1B4V A;  4YSH A;  3TW9 A;  1BF3 A;  3GMB A;  3ITJ A;  4H50 A;  3A7R A;  3CGC A;  3P9U A;  4USR A;  2A87 A;  4A6N A;  2FYM A;  3BHF A;  3D46 A;  4APN A;  4Z25 A;  5HY5 A;  3RIT A;  3R0K A;  2XDO A;  2WET A;  1V97 A;  4H4U A;  4JHM A;  4ICY A;  3HW2 A;  5J04 A;  5KMQ A;  3LXD A;  2B7S A;  4KPL A;  3P4R A;  1D7L A;  2AAQ A;  1E1N A;  4H7U A;  4E0V A;  2RDX A;  1MDL A;  1JRX A;  3ATQ A;  3SZ0 A;  3DJG X;  1IUX A;  4GGH A;  1JPD X;  1NHS A;  3HYV A;  3AE8 A;  4M6U A;  3AYJ A;  2WEU A;  4GYP A;  3SJN A;  4J2W A;  3UJR A;  3HYW A;  3NFU A;  5FJO A;  1LJ1 A;  1H81 A;  1IUT A;  2QCU A;  4HNL A;  4REK A;  5HXI A;  3SX6 A;  4NWZ A;  3NRN A;  4GME A;  1COY A;  3THU A;  3SQP A;  3GO2 A;  5BOF A;  3VC6 A;  2GGE A;  1B8S A;  2W54 A;  5TR3 A;  4H2R A;  3ICS A; 
#chains in the Genus database with same CATH homology
 1NEK A;  2BYB A;  4G6G A;  2JBV A;  1ZOY A;  2Q0L A;  2XCG A;  1NDA A;  4CY8 A;  4EIP A;  2VZ2 A;  3BI5 A;  4YWO A;  1MOK A;  1GRA A;  2X99 A;  5JCL A;  1CHU A;  2Y6R A;  2YR6 A;  1LPF A;  2YVG A;  1BGJ A;  1GPE A;  1YQ4 A;  1V59 A;  2BK3 A;  2E1M A;  3C4A A;  4I58 A;  1P2H A;  4RG3 A;  3H8L A;  4XWR A;  3DJE A;  1H7X A;  2X3N A;  4U8I A;  3BHK A;  3QVP A;  2BA9 A;  4A7A A;  4YSZ A;  4YKF A;  1TYP A;  4AOS A;  3GD3 A;  3T31 A;  4BJZ A;  4GUV A;  2WPC A;  2WOI A;  1M6I A;  2GRT A;  1D7Y A;  5J60 A;  4FDC B;  4JY2 A;  1PBE A;  2X8C A;  3NLC A;  3DK4 A;  2EQ9 A;  3PVC A;  1GET A;  4UDP A;  3GDP A;  1FEB A;  1FCD A;  1H82 A;  2JB2 A;  4Z24 A;  3AEG A;  3G5Q A;  4WX1 A;  3CIR A;  2JKC A;  4GRT A;  3IWA A;  5U1O A;  4ZCD A;  2BS2 A;  3PS9 A;  3DA1 A;  1N4W A;  3AEB A;  1KSS A;  1RSG A;  5J7X A;  4Z44 A;  1ZP0 A;  2BAB A;  2R0C A;  4CNK A;  1IUW A;  1F6M A;  4B68 A;  3BI2 A;  5FS8 A;  1Q9I A;  2RGJ A;  3AB1 A;  4H4Z A;  2VQ7 A;  1MO9 A;  1KFY A;  2R4E A;  4LU6 A;  4PAB A;  2GH5 A;  4B63 A;  1B37 A;  2XLS A;  3SZC A;  2CDU A;  4AP3 A;  3I3L A;  2C66 A;  2BCG G;  4H2Q A;  2XFN A;  1ONF A;  4Y4M A;  3LB8 A;  1AOG A;  4BUR A;  2OAL A;  4NTE A;  3AE5 A;  1REO A;  4KPR A;  5U63 A;  2JB1 A;  3UKP A;  1ZOV A;  2V3A A;  4GCM A;  3L5O A;  5GRT A;  1VG9 A;  4TLX A;  4A9W A;  4K7Z A;  3NT6 A;  2YG6 A;  1F8W A;  1OJC A;  1PBD A;  4TM1 A;  3S61 A;  3F8D A;  1JU2 A;  3KPK A;  3NK1 X;  1ZKQ A;  3UKF A;  4CCQ A;  1DOD A;  1O5W A;  2APG A;  4H4R A;  4EQX A;  1CC6 A;  1CBO A;  1ZMD A;  2C70 A;  4GR1 A;  1FL2 A;  4U8L A;  1KNP A;  3NYE A;  2GEW A;  1F8S A;  2GR1 A;  1PHH A;  4AP1 A;  2CVJ A;  2XLT A;  2V6O A;  1IUV A;  5HYM A;  5JCN A;  3LOV A;  2PHH A;  3NK2 X;  3SGL A;  1GV4 A;  1TDK A;  5LV9 A;  4CRT A;  2YG7 A;  2C67 A;  4B1B A;  3QFA A;  4BK3 A;  1GAL A;  1BWC A;  3GRT A;  1OJT A;  3VRB A;  3VR9 A;  1YQZ A;  3UP5 A;  3UKL A;  4II2 A;  4I59 A;  3AE7 A;  4H4X A;  1BGN A;  3AXB A;  1JOA A;  2WQY A;  1VRQ B;  2VQB A;  3RP8 A;  4II3 A;  1Y56 B;  3AE2 A;  3V76 A;  2WU2 A;  5FMH A;  2YLW A;  3AYL A;  3CTY A;  3QSE A;  1DJN A;  4JNQ A;  4YXD A;  4M52 A;  5BRT A;  1Z6L A;  2ZZC A;  5C2T A;  3B6D A;  3RHA A;  1VG0 A;  4U8N A;  2WPE A;  1EL9 A;  4GDP A;  3SXI A;  4EMW A;  3NIX A;  3KLJ A;  5KXJ A;  3AEF A;  1E1K A;  2WES A;  5FS6 A;  3AEC A;  4OPC A;  1YQ3 A;  4C77 A;  4Z2U A;  5IPY A;  4X9M A;  4K2X A;  1CJC A;  3FPZ A;  4RG4 A;  3ISH A;  4A99 A;  2X50 A;  2Z5X A;  4BJY A;  5CKU A;  3ATR A;  1IUS A;  3B3R A;  4OPI A;  1NHQ A;  3T2K A;  1ZK7 A;  2BC0 A;  3FG2 P;  3H4K A;  2GAG B;  2XLR A;  3QVR A;  1LV0 A;  2WOV A;  1Y0P A;  3DME A;  1PBF A;  2WPF A;  3NN0 X;  4X9N A;  5EB5 A;  5L46 A;  1GRT A;  3QJ4 A;  4USQ A;  4A6N B;  4JNA A;  3R9U A;  1GRB A;  1PS9 A;  2GAH B;  3ICR A;  1BKW A;  4K22 A;  2YR5 A;  3UKA A;  1LTX R;  2DKH A;  4J33 A;  1E7P A;  2WDR A;  3LAD A;  3D1C A;  1FEC A;  3T2Y A;  1GEU A;  4C5O A;  2QAE A;  3AE3 A;  1ZX9 A;  3CNJ A;  4J56 A;  4H4T A;  4N9X A;  2J3N A;  1PN0 A;  2XFQ A;  4IA6 A;  4Z26 A;  3T14 A;  5KMR A;  3KD9 A;  1KSU A;  3EPT A;  1L0V A;  3DGZ A;  3NG7 X;  3DGH A;  4EQW A;  2E5V A;  3ICT A;  4OPG A;  3IF9 A;  3P4Q A;  4GAP A;  2YLX A;  2WP6 A;  1K0L A;  1YY5 A;  4B69 A;  1K0J A;  2ZZB A;  3PG6 A;  2I0Z A;  2GQW A;  3NGC X;  2V61 A;  1NEN A;  3JSK A;  4DNA A;  4XXG A;  4YT0 A;  4ZN0 A;  2TPR A;  4H2N A;  3QSM A;  4B66 A;  1YKJ A;  2VRM A;  2Z5Y A;  1KF6 A;  2QA2 A;  3K7Q X;  5DBJ A;  2B9X A;  2C3D A;  3VQR A;  3NK0 X;  2V60 A;  1NHP A;  1OJA A;  1W4X A;  2YWL A;  4XWZ A;  4AOX A;  1D4D A;  4YTN A;  4H4Y A;  3CNT A;  3NTA A;  1OJ9 A;  3AE1 A;  2OLO A;  2EQ6 A;  1UKV G;  2ACZ A;  2WOW A;  3UOV A;  1H86 A;  1E39 A;  2F5Z A;  1FEA A;  1EL8 A;  4OVI A;  1NHR A;  3GYX A;  3HYX A;  3ZDN A;  3SZW A;  4G9K A;  2V5Z A;  3AEA A;  1H2I A;  1ZMC A;  1CJ2 A;  2WP9 A;  4Z2T A;  1GND A;  4HA6 A;  4B65 A;  1PBB A;  2C3C A;  3DK9 A;  2JB3 A;  4TM4 A;  3DK8 A;  4P9S A;  3FBS A;  1NG4 A;  2OAM A;  3CPH G;  3LZW A;  2YG5 A;  4U8K A;  4WCT A;  4EMJ A;  1M64 A;  4NEW A;  1FOH A;  3D9X A;  1CC2 A;  4IA5 A;  3GD4 A;  1NG3 A;  3GYI A;  2YLZ A;  2NPX A;  2ZZ0 A;  4J57 A;  1H7W A;  1MXT A;  1TDE A;  2R9Z A;  3DJD A;  4K5S A;  3RP7 A;  5KRQ A;  2BS4 A;  2BXS A;  2GR0 A;  2RAB A;  3P1W A;  2GB0 A;  5FS7 A;  4A65 A;  5IQ4 A;  2EQ8 A;  1QO8 A;  1DNC A;  2BC1 A;  3RED A;  4YTP A;  5KNL A;  4O5Q A;  4BK2 A;  1N1P A;  2X8H A;  3URH A;  2AQJ A;  1S2Q A;  2DKI A;  1GOS A;  1GSN A;  3AD9 B;  3AE9 A;  2FBW A;  5JCK A;  1O95 A;  2RGH A;  1DJQ A;  3CGB A;  3PO7 A;  1GES A;  2R0P A;  2B9Y A;  2YG3 A;  5ER0 A;  1F3P A;  3GYJ A;  4A5L A;  1X31 B;  1IJH A;  2JK6 A;  5HHF A;  2FJB A;  4U2S A;  4EQR A;  2XVH A;  4GDE A;  3O0H A;  4EM3 A;  2A8X A;  2BK4 A;  4HB9 A;  4U8O A;  3CGE A;  2GV8 A;  2Y6Q A;  3CND A;  4J31 A;  2C73 A;  4YSY A;  2GQF A;  1DOB A;  3KA7 A;  1NAA A;  1D4C A;  2R46 A;  4IVO B;  5CQF A;  3UP4 A;  1LQT A;  2R45 A;  2XFU A;  3SFE A;  2O9Z A;  1JNZ A;  1N4V A;  4G73 A;  4NTD A;  5KOW A;  3P4S A;  2XLU A;  1TDN A;  1CJ4 A;  4FK1 A;  3GDN A;  3AD7 B;  4JN9 A;  1S3B A;  3AE6 A;  3K7M X;  5EBK A;  3FIM B;  1E1L A;  2XVE A;  2XVJ A;  3AWI A;  4NTC A;  3CPI G;  3BNU A;  4EIQ A;  4ECH A;  1PXA A;  1JNR A;  2A89 A;  3II4 A;  5FS9 A;  1F8R A;  2UZZ A;  2VRL A;  4JDR A;  3EAN A;  1D4E A;  2C7G A;  3E1T A;  3G5R A;  1PDH A;  2C76 A;  3AD8 B;  3FMW A;  3NKS A;  2E4G A;  2B9W A;  2H88 A;  3ALJ A;  3CMM A;  3KU9 A;  3T0K A;  3UKK A;  1GXF A;  2AR8 A;  3VRA A;  3P4P A;  4U8J A;  5KVH A;  3LZX A;  5BUK A;  3CN8 A;  1JRZ A;  1KNR A;  2B76 A;  2RGO A;  1QJD A;  2WBA A;  3GWF A;  4U8P A;  2XVF A;  5GSN A;  4GF7 A;  4UP3 A;  2NVK X;  2HQM A;  5KVI A;  1H6V A;  2XLP A;  1GRF A;  3GWD A;  1LQU A;  5IQ1 A;  3T37 A;  3V3O A;  2XVI A;  4D03 A;  4DSG A;  1S3E A;  1GTH A;  1L9C A;  2BS3 A;  3L1R A;  4UDQ A;  2C65 A;  3V3N A;  4ZCC A;  3SFD A;  2C75 A;  2YLS A;  5EOW A;  3QSS A;  4G6H A;  3C96 A;  4IV9 A;  4U2L A;  3NN6 X;  3DJJ A;  1L9E A;  3OC4 A;  4YKG A;  3COX A;  3SY4 A;  2GMJ A;  4C3X A;  3QFB A;  2R4J A;  2GR2 A;  1SEZ A;  3AEE A;  1JRY A;  3DH9 A;  1EBD A;  2JAE A;  2BXR A;  1KN0 A;  5M10 A;  1S2Y A;  2OLN A;  4H2P A;  4OCG A;  3VR8 A;  4G74 A;  5BUL A;  1K0I A;  1PXB A;  3I6D A;  4TLZ A;  2C4C A;  3ALL A;  1P2E A;  3M12 A;  2PYX A;  1PJ5 A;  4H4Q A;  3OZ2 A;  2ARD A;  4H4S A;  1H83 A;  1ELI A;  1GER A;  2Q7V A;  3CPJ G;  3IHG A;  3WE0 A;  1TDO A;  2FJD A;  3RP6 A;  3UCL A;  5BVA A;  2QA1 A;  1ZDL A;  2YLT A;  4OPU A;  3LJP A;  2EQ7 A;  1CC4 A;  1PJ7 A;  3AED A;  1H84 A;  1DOC A;  5EB4 A;  1QLB A;  1NPX A;  4FK1 C;  4PAA A;  4UDR A;  2CUL A;  3NTD A;  1XDI A;  1RYI A;  3GMC A;  4LII A;  1EL7 A;  3M0O A;  4GAV A;  4TM3 A;  2W0H A;  2WP5 A;  3M13 A;  4EMI A;  4K8D A;  2BRA A;  5M0Z A;  3UTF A;  3NYF A;  2WU5 A;  3UTH A;  2Q6U A;  3UOZ A;  1Y56 A;  2YR4 A;  3NNE A;  3ALM A;  1GRH A;  1IUU A;  2R0G A;  3IHM A;  3AYI A;  1TYT A;  1OJD A;  2CFY A;  5JRB A;  1GTE A;  2BAC A;  4YTM A;  4J34 A;  3L8K A;  4H4V A;  4OPD A;  4D04 A;  2FJE A;  3ADA B;  3G5S A;  1CF3 A;  3K30 A;  1VQW A;  3KPF A;  2XYO A;  4CNJ A;  1JEH A;  5KOX A;  4Z43 A;  2X8G A;  4DSH A;  3SYI A;  3UOX A;  3D8X A;  2VVL A;  1CJ3 A;  1E1M A;  4OPT A;  2YM1 A;  1B5Q A;  2YM2 A;  3CNP A;  4IVM B;  1B4V A;  3RNM A;  4YSH A;  3UTG A;  3S5W A;  4NNJ A;  4NEV A;  2H89 A;  4AT0 A;  4B64 A;  1BF3 A;  3GMB A;  3Q9T A;  2WHD A;  3SM8 A;  2ZBW A;  1PXC A;  1DOE A;  3ITJ A;  1LVL A;  4Y4L A;  4H50 A;  2TMD A;  4YSX A;  2GVC A;  3CGC A;  2VVM A;  3P9U A;  4J36 A;  2VVL G;  4USR A;  2A87 A;  2YG4 A;  4A6N A;  2C72 A;  2FJA A;  2YAU A;  3H8I A;  1CL0 A;  3GRS A;  2OA1 A;  3CNS A;  3EF6 A;  3VRD B;  3BHF A;  3HZL A;  3T2Z A;  4APN A;  4Z25 A;  4DGK A;  1GRE A;  5HY5 A;  1EL5 A;  2IID A;  2YVF A;  3UOY A;  2XDO A;  3UTE A;  2WET A;  1XAN A;  2VOU A;  4H4U A;  1E6E A;  1N4U A;  2GMH A;  3IC9 A;  4JY3 A;  3K7T A;  1RP0 A;  4X4J A;  1Q1W A;  4ICY A;  4ADW A;  1XPQ A;  1O94 A;  4CBQ A;  5KMQ A;  3KVE A;  3BI4 A;  3LXD A;  4EM4 A;  3EAO A;  2B7S A;  3P4R A;  1S7M A;  1D7L A;  2AAQ A;  1E1N A;  1PBC A;  4H7U A;  2BCP A;  2YVJ A;  3GSI A;  4E0V A;  5KWF A;  4LA1 A;  2WDV A;  3C4N A;  2GR3 A;  4MJW A;  3UKQ A;  3ZYX A;  5KMS A;  2B7R A;  1JRX A;  3ATQ A;  4TM0 A;  3SZ0 A;  3DJG X;  1IUX A;  3NHO X;  4AT2 A;  1NHS A;  3HYV A;  4CY6 A;  3AE8 A;  3AYJ A;  2GF3 A;  1GT8 A;  2V3B A;  3UKH A;  4Z2R A;  2WEU A;  3F8P A;  1ZY8 A;  5U25 A;  4U8M A;  1TDF A;  2BK5 A;  3ABV A;  3NYC A;  4K5R A;  1TRB A;  1XHC A;  4EQS A;  4O5U A;  4A79 A;  4C74 A;  2WS3 A;  1DXL A;  4J2W A;  2YLR A;  4Y4N A;  2XFP A;  4BV6 A;  1BZL A;  3HYW A;  2XFO A;  3NH3 X;  4H4P A;  1LJ1 A;  4U2T A;  2IVD A;  1H81 A;  2IVE A;  1IUT A;  2QCU A;  4JQ9 A;  4REK A;  4FX9 A;  3F8R A;  5HXI A;  4NZH A;  1GRG A;  1Q1R A;  1L9D A;  3SX6 A;  4NWZ A;  3NRN A;  5KMP A;  4OPL A;  2C64 A;  1COY A;  4B67 A;  1D5T A;  1K4Q A;  3SQP A;  1KDG A;  5JCI A;  4CCR A;  2WDQ A;  3BNM A;  1B8S A;  4RSL A;  2YQU A;  2Q0K A;  4BK1 A;  5C3J A;  4H4W A;  3KKJ A;  5JCM A;  5TR3 A;  2BRY A;  3SZF A;  3AE4 A;  3CGD A;  1HYU A;  4KX6 A;  1VDC A;  1PJ6 A;  4C3Y A;  4H2R A;  3ICS A;  3Q6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...