4BURA

Crystal structure of the reduced human apoptosis inducing factor complexed with nad
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
484
structure length
450
Chain Sequence
APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
publication title Structural Insights Into the Coenzyme Mediated Monomer-Dimer Transition of the Pro-Apoptotic Apoptosis Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 136
structure length 450
sequence length 484
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4burA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4burA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4burA01
5J60A 1N4WA 3I3LA 2YWLA 1PXBA 4D03A 1XPQA 4X9MA 2BA9A 2C64A 3IC9A 3VR9A 1GPEA 3L8KA 4GDPA 3LZWA 2R46A 2C73A 2X3NA 4GDEA 3CGEA 1PJ7A 3AEBA 3ADAB 3KA7A 3AECA 1BKWA 2BK5A 4KX6A 1S3BA 4OCGA 5KXJA 1CJ3A 3FMWA 5HY5A 1CJCA 4JN9A 3O0HA 4U8MA 3DGHA 2OA1A 4M52A 1YKJA 2C67A 4XWZA 4CY8A 3UKQA 1GRFA 3HZLA 1K0IA 3K30A 2YLZA 2RGJA 1GETA 2XLRA 4J34A 3NRNA 4H7UA 1FECA 1DNCA 3FIMB 2V61A 3LADA 1LTXR 5KOWA 3GD4A 4JNQA 3ATRA 4LA1A 3AEEA 3NK2X 1QJDA 1OJ9A 2XVIA 3UOYA 1V59A 3PVCA 2X50A 3S61A 4B64A 1MXTA 1RYIA 3CPHG 2WBAA 4UDPA 1ZX9A 1E39A 2Q6UA 2GR2A 3VR8A 4YXDA 1PDHA 3CNPA 5HYMA 5LV9A 1GRHA 2BS2A 1H83A 1IUWA 4EM3A 2RGOA 4K22A 4BK1A 4RSLA 1O94A 1PN0A 3AWIA 2BC1A 4Z43A 4USQA 1HYUA 1FOHA 2JAEA 3UKKA 2X99A 4JY3A 2TMDA 1KNPA 4H4QA 2BACA 2BC0A 3LXDA 1L0VA 4UDRA 3KD9A 1COYA 1GESA 3F8PA 2XCGA 3GMCA 3NIXA 4A99A 4C3XA 3DGZA 2YQUA 4EM4A 4TM1A 1IUTA 2ZZ0A 3ISHA 2YR6A 4ZN0A 1YY5A 4K8DA 3DJEA 3QVRA 1KSSA 2GMHA 1OJTA 3C4NA 1ZDLA 3CIRA 2YVJA 1VG9A 2FBWA 4BK3A 1GALA 1EL8A 2X8CA 4BJYA 3M12A 4YSYA 3H4KA 3EANA 4TM3A 3GWFA 1GNDA 1PBFA 1NG3A 2C3DA 4GCMA 1XDIA 4FK1C 2B7RA 2WESA 4JQ9A 3IWAA 5KVHA 1H7WA 4B66A 1K0JA 2YVGA 1TDOA 3FBSA 2XFOA 1L9CA 4U8KA 5JCLA 2DKHA 5U1OA 1DOBA 3AE3A 3ICSA 2VVMA 3DJJA 1EL7A 2VOUA 2CDUA 4UP3A 5CQFA 1N4VA 5EB4A 1NHQA 3AD7B 1PBEA 3II4A 1TDKA 4A5LA 5C2TA 2BABA 4WX1A 5BUKA 3GWDA 3AD9B 1EL5A 4ZCDA 3GSIA 3CNTA 2GR3A 2HQMA 1CL0A 2FJDA 4EIQA 3CGBA 3AE8A 3GYJA 2QAEA 1S2YA 3CTYA 4ADWA 2R45A 4NTEA 1BGJA 1H6VA 1JNZA 3NN0X 3VRAA 4H4RA 3BHFA 4H4ZA 3BNMA 2V60A 3R9UA 4A6NA 2O9ZA 5CKUA 1CC6A 4DNAA 2YG4A 5GSNA 1DXLA 4AP3A 1DOEA 2VVLA 2BXSA 2Y6QA 2YR4A 3FG2P 2A8XA 1RSGA 4GUVA 1W4XA 4CBQA 3D1CA 3REDA 3ALLA 3UP5A 2B76A 4TLZA 2OAMA 4J2WA 3AYJA 4D04A 5C3JA 1FCDA 3DH9A 4IVOB 1D4EA 3VRBA 5JCMA 2GRTA 3UKAA 1VDCA 3UOXA 2OLOA 3NYEA 1OJAA 4B69A 4CCRA 5IQ4A 4FX9A 1H86A 3SGLA 1PBCA 4CNKA 3H8IA 4A7AA 5EBKA 3LB8A 5KOXA 1F3PA 2V5ZA 4EMWA 2YG7A 3Q9TA 1B4VA 1D5TA 2GMJA 2JKCA 3CPIG 3F8RA 5KVIA 1IUUA 4IVMB 2XLSA 2NVKX 4H4UA 4KPRA 1KF6A 1O95A 2ZZBA 3QSMA 3QVPA 4TM0A 3KU9A 3NHOX 1X31B 3UOVA 2XLPA 1N4UA 4OPIA 1F6MA 2Z5XA 4ECHA 1O5WA 1ELIA 1ZK7A 3C96A 2F5ZA 3DJDA 4U8PA 2C65A 1NDAA 3BI2A 3LOVA 3UTEA 2WHDA 4IV9A 4AOSA 4A79A 3P9UA 4Y4MA 2PHHA 3P4RA 4C74A 3K7TA 3M13A 1B5QA 2XLTA 3AEAA 1DODA 1LPFA 1TDNA 4U8JA 4OPDA 1GTEA 2AR8A 1AOGA 2V3AA 1DOCA 2WPEA 2YG3A 1ZKQA 3C4AA 3M0OA 4J36A 4E0VA 1Q1RA 1RP0A 1BGNA 4NEWA 2IIDA 4J57A 3G5SA 4I58A 4H4SA 1P2HA 4X4JA 3BNUA 4Z26A 3CNSA 2VRLA 1ZMDA 3ICTA 5FS7A 2DKIA 2QA2A 2XFPA 3AE9A 3AE1A 4U8LA 4U2LA 5IPYA 3I6DA 1E7PA 4BK2A 5M10A 1F8WA 4H2PA 1CJ4A 1BWCA 2E5VA 3NG7X 4C77A 3GDNA 2JB3A 2VVLG 1D4CA 1B37A 2YG6A 3IF9A 4Z25A 3UP4A 4LIIA 1LQUA 3V3NA 1JEHA 2BCGG 3AE5A 3NN6X 4XXGA 2RABA 3P4SA 5ER0A 4TLXA 4J56A 3T37A 2X8HA 3BI4A 2UZZA 3K7MX 1S2QA 4OPUA 1PJ6A 4HA6A 2W0HA 3GMBA 4B63A 4TM4A 4H4XA 4OPGA 1NHRA 3NT6A 4U8NA 1EL9A 2V3BA 2AAQA 1BF3A 1JOAA 3RP6A 3Q6JA 2Q0KA 1GXFA 2YLXA 4P9SA 4JY2A 4IA5A 1TDEA 4Z44A 5EOWA 5BULA 4U8OA 2VQBA 5L46A 1KNRA 2WDRA 5KWFA 4FDCB 3UCLA 3BHKA 1PXCA 2GB0A 1MO9A 3V76A 1H7XA 2I0ZA 1LVLA 2JBVA 4XWRA 2BK4A 3AD8B 2XFNA 3OZ2A 3EAOA 3NYFA 5JCKA 5M0ZA 5IQ1A 4BURA 3AB1A 3COXA 4USRA 4EIPA 4YTNA 4A65A 3AXBA 3EF6A 4DGKA 3ZDNA 1FEBA 5EB5A 1LQTA 2WS3A 2A87A 1CC4A 2WOVA 3B3RA 2R9ZA 3K7QX 3GRSA 1CHUA 1PXAA 4AT2A 2YM2A 1L9DA 3CGDA 4FK1A 3G5QA 5TR3A 4RG3A 1F8RA 2OLNA 1YQZA 1IUXA 1E1KA 3E1TA 2WU2A 5DBJA 3NTAA 2CFYA 4H2RA 2Y6RA 1Q1WA 3CNDA 3NLCA 4Y4LA 3SM8A 2CVJA 1LV0A 2FJBA 1JRZA 1IJHA 1DJQA 1Q9IA 4ICYA 1GRGA 1KFYA 2YLSA 2JB1A 4AOXA 3VRDB 1ZP0A 1CJ2A 4Z24A 3NYCA 1M6IA 2EQ7A 4NZHA 3ICRA 1TYPA 4U2SA 4U2TA 4YSZA 4WCTA 4YSHA 1KDGA 2YR5A 4EQXA 3ITJA 4YTMA 1NEKA 1E1LA 1B8SA 4EQRA 1H84A 3L1RA 2B7SA 2YLTA 2EQ6A 1GSNA 2WQYA 1FEAA 4OPCA 3RP8A 2OALA 4H50A 1GT8A 4CNJA 1TRBA 4YTPA 1OJCA 4Y4NA 1GEUA 3AYLA 4H2QA 3ALMA 4IA6A 3LZXA 2XDOA 2WEUA 4U8IA 1ZOYA 4JDRA 3ALJA 2X8GA 4J31A 2C76A 4UDQA 4Z2RA 1ONFA 5HXIA 1E1MA 4ZCCA 2EQ9A 2CULA 2R0CA 3GDPA 4HB9A 1NG4A 4PAAA 4RG4A 2YLWA 2BCPA 1YQ3A 4C5OA 3CN8A 5BRTA 2ARDA 2JB2A 2XFUA 3NGCX 2WP5A 1TDFA 3NK0X 1TYTA 1CF3A 3P4QA 3GRTA 5FMHA 1SEZA 2XVEA 2XVHA 3ABVA 3KPFA 5KRQA 1YQ4A 3ATQA 4AT0A 3D8XA 2C7GA 3UOZA 1ZMCA 2VZ2A 1Z6LA 2IVEA 1S3EA 2E1MA 5U25A 3F8DA 1PHHA 4YWOA 1JRXA 2EQ8A 2WOIA 4YSXA 1PS9A 2Q7VA 2BXRA 3PS9A 3AE6A 1D4DA 3LJPA 5FS9A 1GOSA 3NTDA 1PJ5A 3KVEA 1FL2A 4BV6A 2R4EA 2H89A 2BK3A 3DK4A 2WU5A 4YT0A 3AE7A 2IVDA 2WP9A 2YM1A 1E1NA 1L9EA 4REKA 2R0GA 2Z5YA 4OPTA 4B1BA 4H4VA 2WOWA 4EQWA 2BS4A 4YKGA 2FJEA 3H8LA 1H82A 4CY6A 4APNA 4B67A 2AQJA 1Y56A 4B68A 3QFAA 2E4GA 2XVJA 2ZBWA 3CNJA 3IHMA 1VQWA 4JNAA 3UKLA 1N1PA 3DMEA 3DJGX 3DK8A 1MOKA 2GAHB 1CBOA 4H4PA 1REOA 2V6OA 2Q0LA 4K5SA 4NTDA 1XHCA 1LJ1A 2TPRA 2APGA 3KLJA 2C70A 1GTHA 1ZOVA 1P2EA 3ZYXA 2C75A 3QSSA 3UKHA 1UKVG 2C3CA 4OPLA 2XVFA 1Y56B 4CCQA 2BS3A 1ZY8A 1VG0A 2GR0A 3S5WA 2GH5A 3G5RA 3RP7A 4K5RA 1E6EA 3QJ4A 3UKPA 1CC2A 3BI5A 1QLBA 2PYXA 3PO7A 2WPCA 3IHGA 3CGCA 4EMJA 1F8SA 1PBBA 3AE4A 3WE0A 4O5QA 3UKFA 1NHSA 3VQRA 2A89A 2GQFA 3OC4A 3RNMA 5FS8A 5JCIA 5GRTA 3NK1X 4GF7A 5HHFA 2H88A 2VRMA 4K7ZA 1IUSA 1JU2A 3AE2A 1D7YA 3B6DA 2XLUA 2RGHA 3V3OA 1GRBA 2ACZA 2GAGB 4Z2TA 3GD3A 5BVAA 2YLRA 3JSKA 3UTHA 4H4WA 2XFQA 2VQ7A 1NHPA 4K2XA 2YG5A 4PABA 2GVCA 3AEGA 2B9WA 2BYBA 4I59A 3P1WA 1DJNA 4GRTA 5J7XA 3KKJA 3CPJG 2YAUA 4GR1A 3RHAA 1NENA 4A9WA 4B65A 4Z2UA 1JNRA 1GRTA 2JK6A 1GRAA 1M64A 4CRTA 1KSUA 3NH3X 1K4QA 2GR1A 2YVFA 2GQWA 4DSHA 5JCNA 1JRYA 1XANA 2R4JA 2B9YA 2QA1A 4DSGA 2WP6A 2FJAA 1BZLA 4N9XA 3SFDA 5FS6A 4H2NA 3SQPA 3AEDA 4YKFA 4AP1A 2ZZCA 4H4TA 2WDQA 1K0LA 3FPZA 5U63A 3UTGA 3P4PA 2GEWA 3AYIA 3DK9A 4BJZA 2GF3A 2XYOA 2J3NA 2WDVA 4NEVA 1QO8A 1D7LA 4EMIA 3EPTA 1GREA 4O5UA 1GERA 1Y0PA 1OJDA 1NPXA 1EBDA 3QSEA 3SFEA 1VRQB 4X9NA 1IUVA 4H4YA 4J33A 4NTCA 4MJWA 1NAAA 2C72A 2C66A 1GV4A 3URHA 1PBDA 2GV8A 2QCUA 3GYIA 3AEFA 3NNEA 4OVIA 3NKSA 2R0PA 4LU6A 1H81A 2WPFA 4A6NB 2B9XA 2WETA 3UTFA 3QFBA 2NPXA 4EQSA 3DA1A 4C3YA
chains in the Genus database with same CATH superfamily
1PXBA 4X9MA 3IC9A 3VR9A 3R10A 2C73A 2X3NA 3AEBA 3SYIA 5KXJA 1CJCA 4JN9A 5BOEA 3NXLA 1K0IA 4J34A 1FECA 3I4KA 4LA1A 3UOYA 3PVCA 2X50A 1MXTA 2W3RA 1YEYA 4K1WA 2GGJA 2XH7A 3A7AA 1H83A 2GDQA 5KMQA 4EM3A 2RGOA 2QGYA 1PN0A 4Z43A 1FOHA 4IP4A 1JPMA 1KNPA 4H4QA 2BC0A 1L0VA 3FJ4A 3F8PA 3NIXA 3DGZA 2YQUA 4EM4A 4TM1A 2ZZ0A 3NZGA 1KSSA 1OJTA 2YVJA 3MZNA 2X8CA 4BJYA 3M12A 4TM3A 3UXLA 3GWFA 2C3DA 1XDIA 4G73A 2B7RA 2WESA 4ZOHB 1K0JA 2YVGA 3FBSA 1DOBA 3AE3A 2VVMA 3THUA 5CQFA 4IL2A 4A5LA 1EL5A 3SXIA 1S2YA 3CTYA 4NTEA 1H6VA 3VRAA 3BHFA 2V60A 4DNAA 2POZA 1DXLA 3OZYA 2BXSA 3PWGA 2I5QA 3IJLA 3QLDA 4J2WA 5JCMA 2GRTA 3UOXA 3NYEA 3H12A 4FX9A 2GL5A 3EUB3 4CNKA 5KOXA 1TKKA 3Q9TA 5BOFA 2JKCA 4KPRA 1KF6A 2OQYA 4TM0A 3QVPA 1N4UA 1JPDX 4DYEA 2WHDA 4GGBA 3K7TA 2PPGA 1B5QA 3SN0A 1N62C 4U8JA 2PU1A 3C4AA 4J36A 1X2GA 3T6CA 4H4SA 1JRPA 3ICTA 2XFPA 3AE9A 4GFIA 4BK2A 1F8WA 2PP0A 3DGBA 2E5VA 3NG7X 4C77A 2VVLG 1D4CA 2PP1A 5IDZA 5KNLA 3N4FA 5FJTA 2UZZA 2W0HA 1P48A 4OPGA 4U8NA 2AAQA 3RP6A 3Q6JA 1GXFA 2YLXA 4Z44A 1TDEA 5KWFA 3U9IA 3UCLA 1H7XA 1EBGA 4XWRA 1MDLA 3ZVIA 3AD8B 3EAOA 3NYFA 2P8BA 3AB1A 3UGVA 4EIPA 4YTNA 4A65A 3AXBA 4DGKA 3K7QX 2XH2A 2WOVA 1EC8A 1CHUA 3UJ2A 1L9DA 5TR3A 1F8RA 5DBJA 3CNDA 4G7FA 1JRZA 3VCNA 1GRGA 1KFYA 1ZP0A 1CJ2A 4Z24A 3NYCA 1TYPA 4YWSA 2PS2A 2YR5A 4YTMA 1E1LA 4EQRA 2YLTA 2EQ6A 1GSNA 4M6UA 4OPCA 4CNJA 4YTPA 4Y4NA 3TCSA 2P3ZA 3ZLFA 1ZOYA 4Z2RA 4ZCCA 3GDPA 1NG4A 4RG4A 1KCZA 1YQ3A 3A7RA 2XFUA 2C4CA 5FMHA 2XVEA 3ABVA 3FYYA 5KRQA 1YQ4A 4AT0A 4HYRA 3R0UA 3UOZA 2VZ2A 5U25A 1PHHA 1ONEA 1GOSA 4DX3A 3DK4A 2WU5A 3SBFA 1L9EA 3NO1A 4EQWA 4YKGA 2PTWA 3H8LA 2W55A 1Y56A 4B68A 3QKEA 2XVJA 3CNJA 4IP5A 3UKLA 2GAHB 3QTPA 2V6OA 3OTRA 1WUEA 1XHCA 3GY1A 2APGA 3CYJA 1GTHA 3ZYXA 3UKHA 1Y56B 3UXKA 2PP3A 1ZXIC 4G9KA 1F8SA 1PBBA 4KWSA 3OC4A 1F9CA 5FS8A 2AKMA 2HXUA 2ZC8A 4K7ZA 5KMRA 2BRYA 3JSKA 3UTHA 2XFQA 2YG5A 3NVYB 2B9WA 4I59A 5J7XA 1PDZA 4GR1A 4Z2UA 7ENLA 3NH3X 1JRYA 1BZLA 4YKFA 2ZZCA 1H2IA 2DW7A 3BJSA 4BJZA 2GF3A 1MNSA 2XYOA 3NVWB 2WDVA 1GREA 1GERA 3SFEA 3MY9A 3CT2A 1SJDA 1IUVA 4H19A 1DTNA 2QCUA 3AEFA 3NKSA 3H7VA 3RR1A 4GGHA 3QFBA 4U8IA 4GDPA 4D03A 3TOYA 4DXKA 2C64A 1RM6B 4OCGA 1S3BA 5HY5A 4GISA 3O0HA 4M52A 1YKJA 2C67A 4H2HA 3HZLA 3PG6A 2RGJA 1DNCA 4JNQA 3D46A 3NK2X 2XVIA 1V59A 3S61A 3CPHG 2WBAA 1ZX9A 3RCYA 3VR8A 5HYMA 4MGGA 4K22A 1O94A 2BC1A 2QJNA 1HYUA 4JY3A 2TMDA 2BACA 3SY4A 3KD9A 3GMCA 2PCEA 1IUTA 1N60C 4F4RA 4K8DA 1BKHA 3CIRA 4BK3A 1GALA 2P88A 3EANA 1OEPA 1GNDA 4GCMA 1H7WA 4B66A 4Z1YA 1R0MA 1L9CA 3DJJA 1EL7A 2CDUA 4UP3A 5EB4A 2BABA 4WX1A 3AD9B 2OPJA 3CNTA 2GR3A 3GO2A 3CGBA 3AE8A 4J3ZA 3GYJA 1JDFA 3SZFA 3SQSA 2R45A 2PTYA 1BGJA 1JNZA 3BNMA 1CC6A 2YG4A 3NFUA 1DOEA 2VVLA 2Y6QA 1RSGA 2A8XA 4GUVA 3ALLA 2B76A 2ONEA 3SZCA 3AYJA 3DH9A 4IVOB 3JZUA 3T9PA 1VDCA 1OJAA 4CCRA 2GGHA 5IQ4A 2GGGA 2OFJA 3ES8A 5EBKA 3SZWA 2GMJA 1EC7A 2XLSA 2ZZBA 4H1ZA 1X31B 1F6MA 4ECHA 3FV9A 1ZK7A 3B97A 3UTEA 4IV9A 3T2YA 4A79A 2RDXA 3M13A 1LPFA 3V3WA 1XPYA 1EC9A 1ZKQA 3M0OA 4E0VA 2IIDA 1P2HA 1ZMDA 2DKIA 3AE1A 4U8LA 3P3BA 3I6DA 1V97A 1E7PA 5M10A 4H2PA 3FVDA 3IF9A 3TW9A 1MRAA 4LIIA 1LQUA 3V3NA 2BCGG 2W3SA 4XXGA 1N5XA 3ZLHA 4TLXA 4J56A 3T37A 3ES7A 2X8HA 3BI4A 3K7MX 3TQPA 1PJ6A 4HA6A 3KUMA 4A35A 4TM4A 3NT6A 1EL9A 1BF3A 2BRAA 4JY2A 4IA5A 1KNRA 3V4BA 3QPEA 4FDCB 3BHKA 3EKGA 2AL2A 4DWDA 2JBVA 2BK4A 2XGZA 2OLAA 5IQ1A 3COXA 4USRA 2QDDA 3EF6A 5EB5A 1LQTA 2WS3A 2A87A 2R9ZA 3GRSA 2HXTA 1PXAA 2YM2A 3CAWA 2AL2B 3MKCA 4RG3A 2OLNA 3NLCA 2CVJA 1LV0A 2FJBA 1IJHA 2YLSA 2JB1A 3ZVHA 4ZA0A 4U2TA 4U2SA 1B8SA 1FFUC 4HCDA 3CB3A 3TWAA 2WQYA 1FEAA 1GT8A 1OJCA 4IA6A 3SR6B 3LZXA 2WEUA 3ZVHB 2X8GA 2EQ9A 6ENLA 4HB9A 2BCPA 1SJCA 3BOXA 3NGCX 1SEZA 3U4FA 3KPFA 3IJIA 2C7GA 3SZ0A 1ZMCA 2QQ6A 1S3EA 3F8DA 3TWBA 3RRAA 2EQ8A 3CK5A 2QVHA 3AE6A 1D4DA 3KVEA 2R4EA 4BV6A 4YT0A 3AE7A 4J1OA 2IVDA 4JHMA 4G6HA 2YM1A 1E1NA 2R0GA 2Z5YA 2FJEA 1H82A 4APNA 2E3TA 3P0WA 3QFAA 3T31A 3Q45A 1N1PA 3DMEA 1N5WC 4H4PA 2Q0LA 4K5SA 4E4UA 1LJ1A 4TVWA 1ZOVA 1P2EA 1UKVG 4CCQA 2GR0A 3UKPA 3BI5A 3NS1B 3CGCA 4O5QA 3VQRA 2ZADA 3P93A 1IUSA 2OVLA 2ACZA 5BVAA 3GD3A 4FI4A 2VQ7A 3AEGA 1DJNA 3CPJG 1NENA 4IHCA 1GRAA 4HCLA 2YVFA 4GAVA 3DFHA 1JROA 4NWZA 4H2NA 3SQPA 3AEDA 4H4TA 1K0LA 3UTGA 3P4PA 2GEWA 3DERA 4II3A 2J3NA 1QO8A 1SJAA 1EBDA 3R0KA 4H4YA 3UCCA 4J33A 4NTCA 2C72A 2C66A 2QJJA 3GYIA 4OVIA 1H81A 4A6NB 3UTFA 4OPLA 2YWLA 1XPQA 4G74A 1JCTA 2PGWA 3VC5A 4DHGA 3Q4DA 1GPEA 3L8KA 3CGEA 3KA7A 3AECA 1BKWA 2OA1A 3PFRA 3UKQA 1GRFA 3K30A 1GETA 3NRNA 4H7UA 3FIMB 2V61A 1LTXR 1KKRA 3GD4A 3N6JA 1FHVA 4GYPC 3UJRA 4B64A 1RYIA 2DW6A 2GR2A 1PDHA 3CNPA 1MUCA 1SJBA 1GRHA 4K8GA 2BS2A 4BK1A 3AWIA 4EWJA 2JAEA 3CMMA 3VCCA 3LXDA 1COYA 4A99A 3VDGA 3SJNA 3DJEA 4E5TA 3QVRA 3C4NA 2FBWA 1EL8A 5G5GB 3H4KA 4FK1C 3IWAA 3VA8A 4MMWA 1EBHA 1TDOA 2XFOA 4U8KA 5JCLA 2DKHA 3NVZB 2VOUA 1T3QC 4G8TA 1PBEA 3SX6A 5C2TA 5ENLA 3GWDA 4ZCDA 4KEMA 5JRBA 2FKPA 3GSIA 2FJDA 4IZGA 3HRDC 3NRZB 2OX4A 5G5HB 3NN0X 4H4RA 4H4ZA 2OZTA 4AP3A 2YR4A 3FG2P 1W4XA 4CBQA 3REDA 2OAMA 4M0XA 4D04A 5C3JA 1FCDA 3UJFA 3VRBA 4HCHA 3SGLA 4ZCWA 3H8IA 4HNCA 4A7AA 3IK4A 2YG7A 3CPIG 1FHUA 5KVIA 2W54A 4IVMB 2NVKX 4H4UA 3NHOX 3H70A 2XLPA 3UOVA 1ELSA 5EU9A 4G6GA 2Z5XA 3C96A 3DJDA 2OZ8A 4U8PA 3T0KA 3V5FA 1NDAA 1RVKA 4NNJA 3P9UA 4C74A 3AEAA 1DODA 3TJIA 4DN1A 4Z17A 1AOGA 2V3AA 1DOCA 2WPEA 1Q1RA 1BGNA 3VC6A 4I58A 3CNSA 2VRLA 3GC2A 2QA2A 5FJUA 1CJ4A 3GDNA 4Z25A 3UP4A 5KMPA 4GAPA 3NN6X 2RABA 3P4SA 5ER0A 4OPUA 3RGTA 3I6EA 4B63A 1JOAA 4P9SA 4U8OA 2VQBA 2WDRA 1PXCA 2GB0A 1MO9A 1LVLA 2XFNA 3OZ2A 5JCKA 5FJOA 3HYWA 2PODA 3ZDNA 1FEBA 3B3RA 4AT2A 3G5QA 1KKOA 1YQZA 1IUXA 3E1TA 4H2RA 2Y6RA 3VFCA 1Q1WA 1FIQB 4Y4LA 3R25A 3SM8A 2GSHA 3T2ZA 1DJQA 4ICYA 4JN7A 1WYGA 4YSZA 1KDGA 3ITJA 1NEKA 3JW7A 2NQLA 2B7SA 4IT1A 3RP8A 4HNLA 1TRBA 4H2QA 3AYLA 3ALMA 1E9IA 4JDRA 2FYMA 3UJEA 5HXIA 1ONFA 2R0CA 1W6TA 4C5OA 2ARDA 2JB2A 3HW2A 2PTXA 1TDFA 1TYTA 3P4QA 3ATQA 4TVYA 1Z6LA 2IVEA 4KT2A 1JRXA 2WOIA 1PS9A 2Q7VA 4IL0A 2OKTA 3TTEA 5FS9A 3NTDA 3DG7A 2H89A 2WP9A 3CXBA 4REKA 4OPTA 4B1BA 2BS4A 4MKSA 4B67A 2ZBWA 4JNAA 3AN1A 3DK8A 1MOKA 1CBOA 2CHRA 4NTDA 3T14A 2TPRA 2C70A 4H83A 1KD0A 2C75A 3SSZA 2BS3A 1ZY8A 3RP7A 4K5RA 4E4FA 1E6EA 3QJ4A 3MWCA 2WPCA 4EMJA 1PDYA 3RNMA 3OW1A 3NK1X 1ECQA 2VRMA 3AE2A 1D7YA 2XLUA 2RGHA 4HN8A 4Z2TA 4K2XA 2GVCA 2BYBA 3KKJA 3RHAA 4A9WA 1JNRA 2JK6A 4CRTA 1K4QA 2GR1A 2GQWA 4GIRA 1XANA 2WP6A 2FJAA 5FS6A 1XS2A 2WDQA 1S7MA 3FPZA 2PMQA 3AYIA 3DK9A 3BSMA 3DEQA 4A3RA 1D7LA 3B9JB 4EMIA 3EPTA 1Y0PA 1OJDA 1VRQB 4X9NA 4MJWA 1GV4A 3NNEA 2R0PA 4LU6A 2B9XA 5KMSA 4EQSA 3PS9A 3H8AA 4C3YA 5J60A 1N4WA 3I3LA 3KPKA 3RO6A 3DG6A 2BA9A 3LZWA 2R46A 4GDEA 1PJ7A 3ADAB 4KX6A 2BK5A 1CJ3A 3FMWA 4U8MA 3DGHA 4XWZA 4CY8A 3L5OA 2PTZA 2YLZA 4JN8A 1SB3B 2XLRA 3LADA 5KOWA 3ATRA 3AEEA 1QJDA 1OJ9A 3UJSA 2XSXA 3T8QA 4UDPA 1E39A 2Q6UA 4YXDA 2E5AA 1VDVA 5LV9A 1IUWA 2P8CA 4RSLA 4USQA 3UKKA 2X99A 4UDRA 1GESA 4C3XA 2XCGA 3HPFA 3ISHA 2YR6A 1R6WA 4ZN0A 1YY5A 2GMHA 1ZDLA 1VG9A 3FCPA 4YSYA 1PBFA 1NG3A 4JQ9A 5KVHA 2AL1A 5U1OA 3ICSA 3DG3A 2OG9A 4K2SA 2MUCA 1N4VA 1NHQA 3AD7B 4HPNA 4II2A 3II4A 1TDKA 5BUKA 1N63C 3GD6A 2HQMA 1CL0A 4EIQA 2QAEA 4ADWA 1TZZA 3R11A 3R9UA 4A6NA 2O9ZA 5CKUA 5GSNA 4X2PA 3D1CA 3UP5A 3PK7A 4TLZA 2GGIA 3DDMA 3NVVB 3SN1A 2OQHA 1D4EA 3UKAA 4ROPA 2OLOA 3TJ4A 4B69A 3OZMA 1H86A 1FO4A 4E8GA 1PBCA 3IJQA 2QDEA 3LB8A 4GMEA 1F3PA 2V5ZA 4EMWA 1B4VA 1D5TA 3F8RA 1IUUA 2HZGA 1O95A 3QSMA 3N4EA 1TE6A 3KU9A 4OPIA 1O5WA 2PSNA 1KN0A 1ELIA 2F5ZA 2O56A 2C65A 3BI2A 3LOVA 4AOSA 1L8PA 1NELA 2PHHA 3P4RA 4Y4MA 2XLTA 1NU5A 1X2HA 1TDNA 4OPDA 1GTEA 2AR8A 2YG3A 1RP0A 3G5SA 4NEWA 4J57A 4X4JA 4Z26A 3BNUA 5FS7A 5IPYA 3V5CA 4U2LA 1BWCA 2JB3A 1B37A 5FJPA 3S5SA 2YG6A 3STPA 1JEHA 3AE5A 3JVAA 4ENLA 1S2QA 4GYPA 2PU0A 3GMBA 4H4XA 2GGEA 1NHRA 2V3BA 5J04A 2Q0KA 5BULA 5EOWA 5L46A 3FXGA 3V76A 2OO6A 2I0ZA 5M0ZA 4BURA 2AKZA 1STZA 3MUCA 1CC4A 3D9XA 3HYXA 3CGDA 4FK1A 5FJRA 4KPLA 1E1KA 2WU2A 1IYXA 1VQZA 3NTAA 2CFYA 3AM9A 1Q9IA 4AOXA 3T4WA 3VRDB 3RITA 4NZHA 1M6IA 2EQ7A 3ICRA 4WCTA 4YSHA 2OZ3A 4A6GA 4EQXA 3QN3A 2P0IA 1H84A 3ETRB 3L1RA 1WUFA 2OALA 4H50A 1GEUA 3N6HA 2XDOA 3ALJA 3DIPA 4J31A 2C76A 4UDQA 1E1MA 2CULA 4PAAA 2YLWA 3AMZA 3CN8A 5BRTA 2PA6A 2WP5A 3NK0X 1CF3A 3GRTA 2XVHA 3DFYA 3D8XA 3GYXA 3UCDA 2E1MA 4YWOA 4YSXA 2BXRA 1FFVC 3LJPA 3OP2A 1PJ5A 1FL2A 2BK3A 3SN4A 2XH0A 4H4VA 2WOWA 3DESA 4CY6A 2AQJA 2E4GA 3IHMA 1VQWA 3I6TA 3DJGX 1REOA 3OPSA 3ZLGA 4E6MA 3CXOA 3KLJA 3QSSA 2C3CA 2XVFA 1VG0A 3S5WA 2GH5A 3G5RA 3R1ZA 3EEZA 1CC2A 1QLBA 2PYXA 3PO7A 3IHGA 3AE4A 3WE0A 3UKFA 1NHSA 2A89A 2GQFA 1N61C 5JCIA 5GRTA 4GF7A 5HHFA 2H88A 3D47A 1JU2A 3B6DA 3V3OA 1GRBA 2GAGB 3K1GA 2YLRA 4H4WA 1NHPA 4PABA 3P1WA 3S47A 4GRTA 1MDRA 4FP1A 2YAUA 3MQTA 4B65A 1GRTA 1M64A 1KSUA 2PGEA 4DSHA 5JCNA 2R4JA 2B9YA 2QA1A 4DSGA 3PWIA 4N9XA 3SFDA 3MSYA 4AP1A 1P43A 5U63A 2QJMA 4NEVA 3A7UA 3R07C 3ENLA 4O5UA 1NPXA 3QSEA 3HYVA 3T2KA 1BQGA 1NAAA 2GV8A 3URHA 1PBDA 2XH4A 2MNRA 2HNEA 2WPFA 2WETA 2NPXA 3DA1A
chains in the Genus database with same CATH topology
5J60A 1N4WA 3I3LA 3KPKA 2YWLA 1PXBA 4D03A 1XPQA 4X9MA 4G74A 2BA9A 2C64A 3IC9A 3VR9A 1GPEA 3L8KA 4GDPA 3LZWA 2R46A 2C73A 2X3NA 4GDEA 3CGEA 1PJ7A 3AEBA 3SYIA 3ADAB 3KA7A 3AECA 1BKWA 2BK5A 4KX6A 1S3BA 4OCGA 5KXJA 1CJ3A 3FMWA 5HY5A 1CJCA 4JN9A 3O0HA 4U8MA 3DGHA 2OA1A 4M52A 1YKJA 2C67A 4XWZA 4CY8A 3L5OA 3UKQA 1GRFA 3HZLA 1K0IA 3K30A 2YLZA 3PG6A 2RGJA 1GETA 2XLRA 4J34A 3NRNA 4H7UA 1FECA 1DNCA 3FIMB 2V61A 3LADA 1LTXR 5KOWA 3GD4A 4JNQA 3ATRA 4LA1A 3AEEA 3NK2X 1QJDA 1OJ9A 2XVIA 3UOYA 1V59A 3PVCA 2X50A 3S61A 4B64A 1MXTA 1RYIA 3CPHG 2WBAA 4UDPA 1ZX9A 1E39A 2Q6UA 2GR2A 3VR8A 4YXDA 1PDHA 3CNPA 5HYMA 5LV9A 1GRHA 2BS2A 1H83A 1IUWA 5KMQA 4EM3A 2RGOA 4K22A 4BK1A 4RSLA 1O94A 1PN0A 3AWIA 2BC1A 4Z43A 4USQA 1HYUA 1FOHA 2JAEA 3UKKA 2X99A 4JY3A 2TMDA 1KNPA 3CMMA 4H4QA 2BACA 3SY4A 2BC0A 3LXDA 1L0VA 4UDRA 3KD9A 1COYA 1GESA 3F8PA 2XCGA 3GMCA 3NIXA 4A99A 4C3XA 3DGZA 2YQUA 4EM4A 4TM1A 1IUTA 2ZZ0A 3ISHA 2YR6A 4ZN0A 1YY5A 4K8DA 3DJEA 3QVRA 1KSSA 2GMHA 1OJTA 3C4NA 1ZDLA 3CIRA 2YVJA 1VG9A 2FBWA 4BK3A 1GALA 1EL8A 2X8CA 4BJYA 3M12A 4YSYA 3H4KA 3EANA 4TM3A 3GWFA 1GNDA 1PBFA 1NG3A 2C3DA 4GCMA 1XDIA 4FK1C 4G73A 2B7RA 2WESA 4JQ9A 3IWAA 5KVHA 1H7WA 4B66A 1K0JA 2YVGA 1TDOA 3FBSA 2XFOA 1L9CA 4U8KA 5JCLA 2DKHA 5U1OA 1DOBA 3AE3A 3ICSA 2VVMA 3DJJA 1EL7A 2VOUA 2CDUA 4UP3A 5CQFA 1N4VA 5EB4A 1NHQA 3AD7B 1PBEA 4II2A 3SX6A 3II4A 1TDKA 4A5LA 5C2TA 2BABA 4WX1A 5BUKA 3GWDA 3AD9B 1EL5A 4ZCDA 5JRBA 3CNTA 3GSIA 2GR3A 2HQMA 3SXIA 1CL0A 2FJDA 4EIQA 3CGBA 3AE8A 3GYJA 2QAEA 1S2YA 3CTYA 3SZFA 4ADWA 2R45A 4NTEA 1BGJA 1H6VA 1JNZA 3NN0X 3VRAA 4H4RA 3BHFA 4H4ZA 3BNMA 2V60A 3R9UA 4A6NA 2O9ZA 5CKUA 1CC6A 4DNAA 2YG4A 5GSNA 1DXLA 4AP3A 1DOEA 2VVLA 2BXSA 2Y6QA 2YR4A 3FG2P 2A8XA 1RSGA 4GUVA 1W4XA 4CBQA 3D1CA 3REDA 3ALLA 3UP5A 2B76A 4TLZA 3SZCA 2OAMA 4J2WA 3AYJA 4D04A 5C3JA 1FCDA 3DH9A 4IVOB 1D4EA 3VRBA 5JCMA 2GRTA 3UKAA 1VDCA 3UOXA 2OLOA 3NYEA 1OJAA 4B69A 4CCRA 5IQ4A 4FX9A 1H86A 3SGLA 1PBCA 4CNKA 3H8IA 4A7AA 5EBKA 3LB8A 3SZWA 5KOXA 1F3PA 2V5ZA 4EMWA 2YG7A 3Q9TA 1B4VA 1D5TA 2GMJA 2JKCA 3CPIG 3F8RA 5KVIA 1IUUA 4IVMB 2XLSA 2NVKX 4H4UA 4KPRA 1KF6A 1O95A 2ZZBA 3QSMA 3QVPA 4TM0A 3KU9A 3NHOX 1X31B 3UOVA 2XLPA 1N4UA 4OPIA 4G6GA 1F6MA 2Z5XA 4ECHA 1O5WA 1KN0A 1ELIA 1ZK7A 3C96A 2F5ZA 3DJDA 4U8PA 3T0KA 2C65A 1NDAA 3BI2A 3LOVA 3UTEA 2WHDA 4IV9A 4AOSA 3T2YA 4A79A 4NNJA 3P9UA 4Y4MA 2PHHA 3P4RA 4C74A 3K7TA 3M13A 1B5QA 2XLTA 3AEAA 1DODA 1LPFA 1TDNA 4U8JA 4OPDA 1GTEA 2AR8A 1AOGA 2V3AA 1DOCA 2WPEA 2YG3A 1ZKQA 3C4AA 3M0OA 4J36A 4E0VA 1Q1RA 1RP0A 1BGNA 4NEWA 2IIDA 4J57A 3G5SA 4I58A 4H4SA 1P2HA 4X4JA 3BNUA 4Z26A 3CNSA 2VRLA 1ZMDA 3ICTA 5FS7A 2DKIA 2QA2A 2XFPA 3AE9A 3AE1A 4U8LA 4U2LA 5IPYA 3I6DA 1E7PA 4BK2A 5M10A 1F8WA 4H2PA 1CJ4A 1BWCA 2E5VA 3NG7X 4C77A 3GDNA 2JB3A 2VVLG 1D4CA 1B37A 2YG6A 3IF9A 4Z25A 3UP4A 4LIIA 1LQUA 5KMPA 3V3NA 1JEHA 2BCGG 4GAPA 3AE5A 3NN6X 4XXGA 2RABA 5KNLA 3P4SA 5ER0A 4TLXA 4J56A 3T37A 2X8HA 3BI4A 2UZZA 3K7MX 1S2QA 4OPUA 1PJ6A 4HA6A 2W0HA 3GMBA 4B63A 4TM4A 4H4XA 4OPGA 1NHRA 3NT6A 4U8NA 2V3BA 1EL9A 2AAQA 1BF3A 2BRAA 1JOAA 3RP6A 3Q6JA 2Q0KA 1GXFA 2YLXA 4P9SA 4JY2A 4IA5A 1TDEA 4Z44A 5EOWA 5BULA 4U8OA 2VQBA 5L46A 1KNRA 2WDRA 5KWFA 4FDCB 3UCLA 3BHKA 1PXCA 2GB0A 1MO9A 3V76A 1H7XA 2I0ZA 1LVLA 2JBVA 4XWRA 2BK4A 3AD8B 2XFNA 3OZ2A 3EAOA 3NYFA 5JCKA 5M0ZA 5IQ1A 4BURA 3AB1A 3COXA 4USRA 4EIPA 4YTNA 4A65A 3AXBA 3EF6A 3HYWA 4DGKA 3ZDNA 1FEBA 5EB5A 1LQTA 2WS3A 2A87A 1CC4A 2WOVA 3B3RA 2R9ZA 3K7QX 3GRSA 1CHUA 3D9XA 1PXAA 4AT2A 3HYXA 2YM2A 1L9DA 3CGDA 4FK1A 3G5QA 5TR3A 4RG3A 1F8RA 2OLNA 1YQZA 1IUXA 1E1KA 3E1TA 2WU2A 5DBJA 3NTAA 2CFYA 4H2RA 2Y6RA 1Q1WA 3CNDA 3NLCA 4Y4LA 3SM8A 2CVJA 1LV0A 2FJBA 1JRZA 3T2ZA 1IJHA 1DJQA 1Q9IA 4ICYA 1GRGA 1KFYA 2YLSA 2JB1A 4AOXA 3VRDB 1ZP0A 1CJ2A 4Z24A 3NYCA 1M6IA 2EQ7A 4NZHA 3ICRA 1TYPA 4U2SA 4U2TA 4YSZA 4WCTA 4YSHA 1KDGA 2YR5A 4EQXA 3ITJA 4YTMA 1NEKA 1E1LA 1B8SA 4EQRA 1H84A 3L1RA 2B7SA 2YLTA 2EQ6A 1GSNA 2WQYA 1FEAA 4OPCA 3RP8A 2OALA 4H50A 1GT8A 4CNJA 1TRBA 4YTPA 1OJCA 4Y4NA 1GEUA 3AYLA 4H2QA 3ALMA 4IA6A 3LZXA 2XDOA 2WEUA 4U8IA 1ZOYA 4JDRA 3ALJA 2X8GA 4J31A 2C76A 4UDQA 4Z2RA 1ONFA 5HXIA 1E1MA 4ZCCA 2EQ9A 2CULA 2R0CA 3GDPA 4HB9A 1NG4A 4PAAA 4RG4A 2YLWA 2BCPA 1YQ3A 4C5OA 3CN8A 5BRTA 2ARDA 2JB2A 2XFUA 2C4CA 3NGCX 2WP5A 1TDFA 3NK0X 1TYTA 1CF3A 3P4QA 3GRTA 5FMHA 1SEZA 2XVEA 2XVHA 3ABVA 3KPFA 5KRQA 1YQ4A 3ATQA 4AT0A 3D8XA 2C7GA 3SZ0A 3UOZA 1ZMCA 2VZ2A 1Z6LA 2IVEA 3GYXA 1S3EA 2E1MA 5U25A 3F8DA 1PHHA 4YWOA 1JRXA 2EQ8A 2WOIA 4YSXA 1PS9A 2Q7VA 2BXRA 3PS9A 3AE6A 1D4DA 3LJPA 5FS9A 1GOSA 3NTDA 1PJ5A 3KVEA 1FL2A 4BV6A 2R4EA 2H89A 2BK3A 3DK4A 2WU5A 4YT0A 3AE7A 2IVDA 2WP9A 4G6HA 2YM1A 1E1NA 1L9EA 4REKA 2R0GA 2Z5YA 4OPTA 4B1BA 4H4VA 2WOWA 4EQWA 2BS4A 4YKGA 2FJEA 3H8LA 1H82A 4CY6A 4APNA 4B67A 2AQJA 1Y56A 4B68A 3QFAA 3T31A 2E4GA 2XVJA 2ZBWA 3CNJA 3IHMA 1VQWA 4JNAA 3UKLA 1N1PA 3DMEA 3DJGX 3DK8A 1MOKA 2GAHB 1CBOA 4H4PA 1REOA 2V6OA 2Q0LA 4K5SA 4NTDA 3T14A 1XHCA 1LJ1A 2TPRA 2APGA 3KLJA 2C70A 1GTHA 1ZOVA 1P2EA 3ZYXA 2C75A 3QSSA 3UKHA 1UKVG 2C3CA 4OPLA 2XVFA 1Y56B 4CCQA 2BS3A 1ZY8A 1VG0A 2GR0A 3S5WA 2GH5A 3G5RA 3RP7A 4K5RA 1E6EA 3QJ4A 3UKPA 1CC2A 3BI5A 1QLBA 2PYXA 3PO7A 2WPCA 4G9KA 3IHGA 3CGCA 4EMJA 1F8SA 1PBBA 3AE4A 3WE0A 4O5QA 3UKFA 1NHSA 3VQRA 2A89A 2GQFA 3OC4A 3RNMA 5FS8A 5JCIA 5GRTA 3NK1X 4GF7A 5HHFA 2H88A 2VRMA 4K7ZA 1IUSA 1JU2A 3AE2A 1D7YA 3B6DA 2XLUA 2RGHA 5KMRA 3V3OA 2BRYA 1GRBA 2ACZA 2GAGB 4Z2TA 3GD3A 5BVAA 2YLRA 3JSKA 3UTHA 4H4WA 2XFQA 2VQ7A 1NHPA 4K2XA 2YG5A 4PABA 2GVCA 3AEGA 2B9WA 2BYBA 4I59A 3P1WA 1DJNA 4GRTA 5J7XA 3KKJA 3CPJG 2YAUA 4GR1A 3RHAA 1NENA 4A9WA 4B65A 4Z2UA 1JNRA 1GRTA 2JK6A 1GRAA 1M64A 4CRTA 1KSUA 3NH3X 1K4QA 2GR1A 2YVFA 2GQWA 4DSHA 5JCNA 1JRYA 4GAVA 1XANA 2R4JA 2B9YA 2QA1A 4DSGA 4NWZA 2WP6A 2FJAA 1BZLA 4N9XA 3SFDA 5FS6A 4H2NA 3SQPA 3AEDA 4YKFA 4AP1A 2ZZCA 4H4TA 1H2IA 2WDQA 1S7MA 1K0LA 3FPZA 5U63A 3UTGA 3P4PA 2GEWA 3AYIA 3DK9A 4BJZA 2GF3A 2XYOA 4II3A 2J3NA 2WDVA 4NEVA 1QO8A 1D7LA 4EMIA 3EPTA 1GREA 4O5UA 1GERA 1Y0PA 1OJDA 1NPXA 1EBDA 3QSEA 3SFEA 1VRQB 3HYVA 4X9NA 1IUVA 4H4YA 3T2KA 4J33A 4NTCA 4MJWA 1NAAA 2C72A 2C66A 1GV4A 3URHA 1PBDA 2GV8A 2QCUA 3GYIA 3AEFA 3NNEA 4OVIA 3NKSA 2R0PA 4LU6A 1H81A 2WPFA 4A6NB 2B9XA 2WETA 3UTFA 5KMSA 3QFBA 2NPXA 4EQSA 3DA1A 4C3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J60 A;  1N4W A;  3I3L A;  2YWL A;  1PXB A;  4D03 A;  1XPQ A;  4X9M A;  2BA9 A;  2C64 A;  3IC9 A;  3VR9 A;  1GPE A;  3L8K A;  4GDP A;  3LZW A;  2R46 A;  2C73 A;  2X3N A;  4GDE A;  3CGE A;  1PJ7 A;  3AEB A;  3ADA B;  3KA7 A;  3AEC A;  1BKW A;  2BK5 A;  4KX6 A;  1S3B A;  4OCG A;  5KXJ A;  1CJ3 A;  3FMW A;  5HY5 A;  1CJC A;  4JN9 A;  3O0H A;  4U8M A;  3DGH A;  2OA1 A;  4M52 A;  1YKJ A;  2C67 A;  4XWZ A;  4CY8 A;  3UKQ A;  1GRF A;  3HZL A;  1K0I A;  3K30 A;  2YLZ A;  2RGJ A;  1GET A;  2XLR A;  4J34 A;  3NRN A;  4H7U A;  1FEC A;  1DNC A;  3FIM B;  2V61 A;  3LAD A;  1LTX R;  5KOW A;  3GD4 A;  4JNQ A;  3ATR A;  4LA1 A;  3AEE A;  3NK2 X;  1QJD A;  1OJ9 A;  2XVI A;  3UOY A;  1V59 A;  3PVC A;  2X50 A;  3S61 A;  4B64 A;  1MXT A;  1RYI A;  3CPH G;  2WBA A;  4UDP A;  1ZX9 A;  1E39 A;  2Q6U A;  2GR2 A;  3VR8 A;  4YXD A;  1PDH A;  3CNP A;  5HYM A;  5LV9 A;  1GRH A;  2BS2 A;  1H83 A;  1IUW A;  4EM3 A;  2RGO A;  4K22 A;  4BK1 A;  4RSL A;  1O94 A;  1PN0 A;  3AWI A;  2BC1 A;  4Z43 A;  4USQ A;  1HYU A;  1FOH A;  2JAE A;  3UKK A;  2X99 A;  4JY3 A;  2TMD A;  1KNP A;  4H4Q A;  2BAC A;  2BC0 A;  3LXD A;  1L0V A;  4UDR A;  3KD9 A;  1COY A;  1GES A;  3F8P A;  2XCG A;  3GMC A;  3NIX A;  4A99 A;  4C3X A;  3DGZ A;  2YQU A;  4EM4 A;  4TM1 A;  1IUT A;  2ZZ0 A;  3ISH A;  2YR6 A;  4ZN0 A;  1YY5 A;  4K8D A;  3DJE A;  3QVR A;  1KSS A;  2GMH A;  1OJT A;  3C4N A;  1ZDL A;  3CIR A;  2YVJ A;  1VG9 A;  2FBW A;  4BK3 A;  1GAL A;  1EL8 A;  2X8C A;  4BJY A;  3M12 A;  4YSY A;  3H4K A;  3EAN A;  4TM3 A;  3GWF A;  1GND A;  1PBF A;  1NG3 A;  2C3D A;  4GCM A;  1XDI A;  4FK1 C;  2B7R A;  2WES A;  4JQ9 A;  3IWA A;  5KVH A;  1H7W A;  4B66 A;  1K0J A;  2YVG A;  1TDO A;  3FBS A;  2XFO A;  1L9C A;  4U8K A;  5JCL A;  2DKH A;  5U1O A;  1DOB A;  3AE3 A;  3ICS A;  2VVM A;  3DJJ A;  1EL7 A;  2VOU A;  2CDU A;  4UP3 A;  5CQF A;  1N4V A;  5EB4 A;  1NHQ A;  3AD7 B;  1PBE A;  3II4 A;  1TDK A;  4A5L A;  5C2T A;  2BAB A;  4WX1 A;  5BUK A;  3GWD A;  3AD9 B;  1EL5 A;  4ZCD A;  3GSI A;  3CNT A;  2GR3 A;  2HQM A;  1CL0 A;  2FJD A;  4EIQ A;  3CGB A;  3AE8 A;  3GYJ A;  2QAE A;  1S2Y A;  3CTY A;  4ADW A;  2R45 A;  4NTE A;  1BGJ A;  1H6V A;  1JNZ A;  3NN0 X;  3VRA A;  4H4R A;  3BHF A;  4H4Z A;  3BNM A;  2V60 A;  3R9U A;  4A6N A;  2O9Z A;  5CKU A;  1CC6 A;  4DNA A;  2YG4 A;  5GSN A;  1DXL A;  4AP3 A;  1DOE A;  2VVL A;  2BXS A;  2Y6Q A;  2YR4 A;  3FG2 P;  2A8X A;  1RSG A;  4GUV A;  1W4X A;  4CBQ A;  3D1C A;  3RED A;  3ALL A;  3UP5 A;  2B76 A;  4TLZ A;  2OAM A;  4J2W A;  3AYJ A;  4D04 A;  5C3J A;  1FCD A;  3DH9 A;  4IVO B;  1D4E A;  3VRB A;  5JCM A;  2GRT A;  3UKA A;  1VDC A;  3UOX A;  2OLO A;  3NYE A;  1OJA A;  4B69 A;  4CCR A;  5IQ4 A;  4FX9 A;  1H86 A;  3SGL A;  1PBC A;  4CNK A;  3H8I A;  4A7A A;  5EBK A;  3LB8 A;  5KOX A;  1F3P A;  2V5Z A;  4EMW A;  2YG7 A;  3Q9T A;  1B4V A;  1D5T A;  2GMJ A;  2JKC A;  3CPI G;  3F8R A;  5KVI A;  1IUU A;  4IVM B;  2XLS A;  2NVK X;  4H4U A;  4KPR A;  1KF6 A;  1O95 A;  2ZZB A;  3QSM A;  3QVP A;  4TM0 A;  3KU9 A;  3NHO X;  1X31 B;  3UOV A;  2XLP A;  1N4U A;  4OPI A;  1F6M A;  2Z5X A;  4ECH A;  1O5W A;  1ELI A;  1ZK7 A;  3C96 A;  2F5Z A;  3DJD A;  4U8P A;  2C65 A;  1NDA A;  3BI2 A;  3LOV A;  3UTE A;  2WHD A;  4IV9 A;  4AOS A;  4A79 A;  3P9U A;  4Y4M A;  2PHH A;  3P4R A;  4C74 A;  3K7T A;  3M13 A;  1B5Q A;  2XLT A;  3AEA A;  1DOD A;  1LPF A;  1TDN A;  4U8J A;  4OPD A;  1GTE A;  2AR8 A;  1AOG A;  2V3A A;  1DOC A;  2WPE A;  2YG3 A;  1ZKQ A;  3C4A A;  3M0O A;  4J36 A;  4E0V A;  1Q1R A;  1RP0 A;  1BGN A;  4NEW A;  2IID A;  4J57 A;  3G5S A;  4I58 A;  4H4S A;  1P2H A;  4X4J A;  3BNU A;  4Z26 A;  3CNS A;  2VRL A;  1ZMD A;  3ICT A;  5FS7 A;  2DKI A;  2QA2 A;  2XFP A;  3AE9 A;  3AE1 A;  4U8L A;  4U2L A;  5IPY A;  3I6D A;  1E7P A;  4BK2 A;  5M10 A;  1F8W A;  4H2P A;  1CJ4 A;  1BWC A;  2E5V A;  3NG7 X;  4C77 A;  3GDN A;  2JB3 A;  2VVL G;  1D4C A;  1B37 A;  2YG6 A;  3IF9 A;  4Z25 A;  3UP4 A;  4LII A;  1LQU A;  3V3N A;  1JEH A;  2BCG G;  3AE5 A;  3NN6 X;  4XXG A;  2RAB A;  3P4S A;  5ER0 A;  4TLX A;  4J56 A;  3T37 A;  2X8H A;  3BI4 A;  2UZZ A;  3K7M X;  1S2Q A;  4OPU A;  1PJ6 A;  4HA6 A;  2W0H A;  3GMB A;  4B63 A;  4TM4 A;  4H4X A;  4OPG A;  1NHR A;  3NT6 A;  4U8N A;  1EL9 A;  2V3B A;  2AAQ A;  1BF3 A;  1JOA A;  3RP6 A;  3Q6J A;  2Q0K A;  1GXF A;  2YLX A;  4P9S A;  4JY2 A;  4IA5 A;  1TDE A;  4Z44 A;  5EOW A;  5BUL A;  4U8O A;  2VQB A;  5L46 A;  1KNR A;  2WDR A;  5KWF A;  4FDC B;  3UCL A;  3BHK A;  1PXC A;  2GB0 A;  1MO9 A;  3V76 A;  1H7X A;  2I0Z A;  1LVL A;  2JBV A;  4XWR A;  2BK4 A;  3AD8 B;  2XFN A;  3OZ2 A;  3EAO A;  3NYF A;  5JCK A;  5M0Z A;  5IQ1 A;  4BUR A;  3AB1 A;  3COX A;  4USR A;  4EIP A;  4YTN A;  4A65 A;  3AXB A;  3EF6 A;  4DGK A;  3ZDN A;  1FEB A;  5EB5 A;  1LQT A;  2WS3 A;  2A87 A;  1CC4 A;  2WOV A;  3B3R A;  2R9Z A;  3K7Q X;  3GRS A;  1CHU A;  1PXA A;  4AT2 A;  2YM2 A;  1L9D A;  3CGD A;  4FK1 A;  3G5Q A;  5TR3 A;  4RG3 A;  1F8R A;  2OLN A;  1YQZ A;  1IUX A;  1E1K A;  3E1T A;  2WU2 A;  5DBJ A;  3NTA A;  2CFY A;  4H2R A;  2Y6R A;  1Q1W A;  3CND A;  3NLC A;  4Y4L A;  3SM8 A;  2CVJ A;  1LV0 A;  2FJB A;  1JRZ A;  1IJH A;  1DJQ A;  1Q9I A;  4ICY A;  1GRG A;  1KFY A;  2YLS A;  2JB1 A;  4AOX A;  3VRD B;  1ZP0 A;  1CJ2 A;  4Z24 A;  3NYC A;  1M6I A;  2EQ7 A;  4NZH A;  3ICR A;  1TYP A;  4U2S A;  4U2T A;  4YSZ A;  4WCT A;  4YSH A;  1KDG A;  2YR5 A;  4EQX A;  3ITJ A;  4YTM A;  1NEK A;  1E1L A;  1B8S A;  4EQR A;  1H84 A;  3L1R A;  2B7S A;  2YLT A;  2EQ6 A;  1GSN A;  2WQY A;  1FEA A;  4OPC A;  3RP8 A;  2OAL A;  4H50 A;  1GT8 A;  4CNJ A;  1TRB A;  4YTP A;  1OJC A;  4Y4N A;  1GEU A;  3AYL A;  4H2Q A;  3ALM A;  4IA6 A;  3LZX A;  2XDO A;  2WEU A;  4U8I A;  1ZOY A;  4JDR A;  3ALJ A;  2X8G A;  4J31 A;  2C76 A;  4UDQ A;  4Z2R A;  1ONF A;  5HXI A;  1E1M A;  4ZCC A;  2EQ9 A;  2CUL A;  2R0C A;  3GDP A;  4HB9 A;  1NG4 A;  4PAA A;  4RG4 A;  2YLW A;  2BCP A;  1YQ3 A;  4C5O A;  3CN8 A;  5BRT A;  2ARD A;  2JB2 A;  2XFU A;  3NGC X;  2WP5 A;  1TDF A;  3NK0 X;  1TYT A;  1CF3 A;  3P4Q A;  3GRT A;  5FMH A;  1SEZ A;  2XVE A;  2XVH A;  3ABV A;  3KPF A;  5KRQ A;  1YQ4 A;  3ATQ A;  4AT0 A;  3D8X A;  2C7G A;  3UOZ A;  1ZMC A;  2VZ2 A;  1Z6L A;  2IVE A;  1S3E A;  2E1M A;  5U25 A;  3F8D A;  1PHH A;  4YWO A;  1JRX A;  2EQ8 A;  2WOI A;  4YSX A;  1PS9 A;  2Q7V A;  2BXR A;  3PS9 A;  3AE6 A;  1D4D A;  3LJP A;  5FS9 A;  1GOS A;  3NTD A;  1PJ5 A;  3KVE A;  1FL2 A;  4BV6 A;  2R4E A;  2H89 A;  2BK3 A;  3DK4 A;  2WU5 A;  4YT0 A;  3AE7 A;  2IVD A;  2WP9 A;  2YM1 A;  1E1N A;  1L9E A;  4REK A;  2R0G A;  2Z5Y A;  4OPT A;  4B1B A;  4H4V A;  2WOW A;  4EQW A;  2BS4 A;  4YKG A;  2FJE A;  3H8L A;  1H82 A;  4CY6 A;  4APN A;  4B67 A;  2AQJ A;  1Y56 A;  4B68 A;  3QFA A;  2E4G A;  2XVJ A;  2ZBW A;  3CNJ A;  3IHM A;  1VQW A;  4JNA A;  3UKL A;  1N1P A;  3DME A;  3DJG X;  3DK8 A;  1MOK A;  2GAH B;  1CBO A;  4H4P A;  1REO A;  2V6O A;  2Q0L A;  4K5S A;  4NTD A;  1XHC A;  1LJ1 A;  2TPR A;  2APG A;  3KLJ A;  2C70 A;  1GTH A;  1ZOV A;  1P2E A;  3ZYX A;  2C75 A;  3QSS A;  3UKH A;  1UKV G;  2C3C A;  4OPL A;  2XVF A;  1Y56 B;  4CCQ A;  2BS3 A;  1ZY8 A;  1VG0 A;  2GR0 A;  3S5W A;  2GH5 A;  3G5R A;  3RP7 A;  4K5R A;  1E6E A;  3QJ4 A;  3UKP A;  1CC2 A;  3BI5 A;  1QLB A;  2PYX A;  3PO7 A;  2WPC A;  3IHG A;  3CGC A;  4EMJ A;  1F8S A;  1PBB A;  3AE4 A;  3WE0 A;  4O5Q A;  3UKF A;  1NHS A;  3VQR A;  2A89 A;  2GQF A;  3OC4 A;  3RNM A;  5FS8 A;  5JCI A;  5GRT A;  3NK1 X;  4GF7 A;  5HHF A;  2H88 A;  2VRM A;  4K7Z A;  1IUS A;  1JU2 A;  3AE2 A;  1D7Y A;  3B6D A;  2XLU A;  2RGH A;  3V3O A;  1GRB A;  2ACZ A;  2GAG B;  4Z2T A;  3GD3 A;  5BVA A;  2YLR A;  3JSK A;  3UTH A;  4H4W A;  2XFQ A;  2VQ7 A;  1NHP A;  4K2X A;  2YG5 A;  4PAB A;  2GVC A;  3AEG A;  2B9W A;  2BYB A;  4I59 A;  3P1W A;  1DJN A;  4GRT A;  5J7X A;  3KKJ A;  3CPJ G;  2YAU A;  4GR1 A;  3RHA A;  1NEN A;  4A9W A;  4B65 A;  4Z2U A;  1JNR A;  1GRT A;  2JK6 A;  1GRA A;  1M64 A;  4CRT A;  1KSU A;  3NH3 X;  1K4Q A;  2GR1 A;  2YVF A;  2GQW A;  4DSH A;  5JCN A;  1JRY A;  1XAN A;  2R4J A;  2B9Y A;  2QA1 A;  4DSG A;  2WP6 A;  2FJA A;  1BZL A;  4N9X A;  3SFD A;  5FS6 A;  4H2N A;  3SQP A;  3AED A;  4YKF A;  4AP1 A;  2ZZC A;  4H4T A;  2WDQ A;  1K0L A;  3FPZ A;  5U63 A;  3UTG A;  3P4P A;  2GEW A;  3AYI A;  3DK9 A;  4BJZ A;  2GF3 A;  2XYO A;  2J3N A;  2WDV A;  4NEV A;  1QO8 A;  1D7L A;  4EMI A;  3EPT A;  1GRE A;  4O5U A;  1GER A;  1Y0P A;  1OJD A;  1NPX A;  1EBD A;  3QSE A;  3SFE A;  1VRQ B;  4X9N A;  1IUV A;  4H4Y A;  4J33 A;  4NTC A;  4MJW A;  1NAA A;  2C72 A;  2C66 A;  1GV4 A;  3URH A;  1PBD A;  2GV8 A;  2QCU A;  3GYI A;  3AEF A;  3NNE A;  4OVI A;  3NKS A;  2R0P A;  4LU6 A;  1H81 A;  2WPF A;  4A6N B;  2B9X A;  2WET A;  3UTF A;  3QFB A;  2NPX A;  4EQS A;  3DA1 A;  4C3Y A; 
#chains in the Genus database with same CATH topology
 1PXB A;  4X9M A;  3IC9 A;  3VR9 A;  3R10 A;  2C73 A;  2X3N A;  3AEB A;  3SYI A;  5KXJ A;  1CJC A;  4JN9 A;  5BOE A;  3NXL A;  1K0I A;  4J34 A;  1FEC A;  3I4K A;  4LA1 A;  3UOY A;  3PVC A;  2X50 A;  1MXT A;  2W3R A;  1YEY A;  4K1W A;  2GGJ A;  2XH7 A;  3A7A A;  1H83 A;  2GDQ A;  5KMQ A;  4EM3 A;  2RGO A;  2QGY A;  1PN0 A;  4Z43 A;  1FOH A;  4IP4 A;  1JPM A;  1KNP A;  4H4Q A;  2BC0 A;  1L0V A;  3FJ4 A;  3F8P A;  3NIX A;  3DGZ A;  2YQU A;  4EM4 A;  4TM1 A;  2ZZ0 A;  3NZG A;  1KSS A;  1OJT A;  2YVJ A;  3MZN A;  2X8C A;  4BJY A;  3M12 A;  4TM3 A;  3UXL A;  3GWF A;  2C3D A;  1XDI A;  4G73 A;  2B7R A;  2WES A;  4ZOH B;  1K0J A;  2YVG A;  3FBS A;  1DOB A;  3AE3 A;  2VVM A;  3THU A;  5CQF A;  4IL2 A;  4A5L A;  1EL5 A;  3SXI A;  1S2Y A;  3CTY A;  4NTE A;  1H6V A;  3VRA A;  3BHF A;  2V60 A;  4DNA A;  2POZ A;  1DXL A;  3OZY A;  2BXS A;  3PWG A;  2I5Q A;  3IJL A;  3QLD A;  4J2W A;  5JCM A;  2GRT A;  3UOX A;  3NYE A;  3H12 A;  4FX9 A;  2GL5 A;  3EUB 3;  4CNK A;  5KOX A;  1TKK A;  3Q9T A;  5BOF A;  2JKC A;  4KPR A;  1KF6 A;  2OQY A;  4TM0 A;  3QVP A;  1N4U A;  1JPD X;  4DYE A;  2WHD A;  4GGB A;  3K7T A;  2PPG A;  1B5Q A;  3SN0 A;  1N62 C;  4U8J A;  2PU1 A;  3C4A A;  4J36 A;  1X2G A;  3T6C A;  4H4S A;  1JRP A;  3ICT A;  2XFP A;  3AE9 A;  4GFI A;  4BK2 A;  1F8W A;  2PP0 A;  3DGB A;  2E5V A;  3NG7 X;  4C77 A;  2VVL G;  1D4C A;  2PP1 A;  5IDZ A;  5KNL A;  3N4F A;  5FJT A;  2UZZ A;  2W0H A;  1P48 A;  4OPG A;  4U8N A;  2AAQ A;  3RP6 A;  3Q6J A;  1GXF A;  2YLX A;  4Z44 A;  1TDE A;  5KWF A;  3U9I A;  3UCL A;  1H7X A;  1EBG A;  4XWR A;  1MDL A;  3ZVI A;  3AD8 B;  3EAO A;  3NYF A;  2P8B A;  3AB1 A;  3UGV A;  4EIP A;  4YTN A;  4A65 A;  3AXB A;  4DGK A;  3K7Q X;  2XH2 A;  2WOV A;  1EC8 A;  1CHU A;  3UJ2 A;  1L9D A;  5TR3 A;  1F8R A;  5DBJ A;  3CND A;  4G7F A;  1JRZ A;  3VCN A;  1GRG A;  1KFY A;  1ZP0 A;  1CJ2 A;  4Z24 A;  3NYC A;  1TYP A;  4YWS A;  2PS2 A;  2YR5 A;  4YTM A;  1E1L A;  4EQR A;  2YLT A;  2EQ6 A;  1GSN A;  4M6U A;  4OPC A;  4CNJ A;  4YTP A;  4Y4N A;  3TCS A;  2P3Z A;  3ZLF A;  1ZOY A;  4Z2R A;  4ZCC A;  3GDP A;  1NG4 A;  4RG4 A;  1KCZ A;  1YQ3 A;  3A7R A;  2XFU A;  2C4C A;  5FMH A;  2XVE A;  3ABV A;  3FYY A;  5KRQ A;  1YQ4 A;  4AT0 A;  4HYR A;  3R0U A;  3UOZ A;  2VZ2 A;  5U25 A;  1PHH A;  1ONE A;  1GOS A;  4DX3 A;  3DK4 A;  2WU5 A;  3SBF A;  1L9E A;  3NO1 A;  4EQW A;  4YKG A;  2PTW A;  3H8L A;  2W55 A;  1Y56 A;  4B68 A;  3QKE A;  2XVJ A;  3CNJ A;  4IP5 A;  3UKL A;  2GAH B;  3QTP A;  2V6O A;  3OTR A;  1WUE A;  1XHC A;  3GY1 A;  2APG A;  3CYJ A;  1GTH A;  3ZYX A;  3UKH A;  1Y56 B;  3UXK A;  2PP3 A;  1ZXI C;  4G9K A;  1F8S A;  1PBB A;  4KWS A;  3OC4 A;  1F9C A;  5FS8 A;  2AKM A;  2HXU A;  2ZC8 A;  4K7Z A;  5KMR A;  2BRY A;  3JSK A;  3UTH A;  2XFQ A;  2YG5 A;  3NVY B;  2B9W A;  4I59 A;  5J7X A;  1PDZ A;  4GR1 A;  4Z2U A;  7ENL A;  3NH3 X;  1JRY A;  1BZL A;  4YKF A;  2ZZC A;  1H2I A;  2DW7 A;  3BJS A;  4BJZ A;  2GF3 A;  1MNS A;  2XYO A;  3NVW B;  2WDV A;  1GRE A;  1GER A;  3SFE A;  3MY9 A;  3CT2 A;  1SJD A;  1IUV A;  4H19 A;  1DTN A;  2QCU A;  3AEF A;  3NKS A;  3H7V A;  3RR1 A;  4GGH A;  3QFB A;  4U8I A;  4GDP A;  4D03 A;  3TOY A;  4DXK A;  2C64 A;  1RM6 B;  4OCG A;  1S3B A;  5HY5 A;  4GIS A;  3O0H A;  4M52 A;  1YKJ A;  2C67 A;  4H2H A;  3HZL A;  3PG6 A;  2RGJ A;  1DNC A;  4JNQ A;  3D46 A;  3NK2 X;  2XVI A;  1V59 A;  3S61 A;  3CPH G;  2WBA A;  1ZX9 A;  3RCY A;  3VR8 A;  5HYM A;  4MGG A;  4K22 A;  1O94 A;  2BC1 A;  2QJN A;  1HYU A;  4JY3 A;  2TMD A;  2BAC A;  3SY4 A;  3KD9 A;  3GMC A;  2PCE A;  1IUT A;  1N60 C;  4F4R A;  4K8D A;  1BKH A;  3CIR A;  4BK3 A;  1GAL A;  2P88 A;  3EAN A;  1OEP A;  1GND A;  4GCM A;  1H7W A;  4B66 A;  4Z1Y A;  1R0M A;  1L9C A;  3DJJ A;  1EL7 A;  2CDU A;  4UP3 A;  5EB4 A;  2BAB A;  4WX1 A;  3AD9 B;  2OPJ A;  3CNT A;  2GR3 A;  3GO2 A;  3CGB A;  3AE8 A;  4J3Z A;  3GYJ A;  1JDF A;  3SZF A;  3SQS A;  2R45 A;  2PTY A;  1BGJ A;  1JNZ A;  3BNM A;  1CC6 A;  2YG4 A;  3NFU A;  1DOE A;  2VVL A;  2Y6Q A;  1RSG A;  2A8X A;  4GUV A;  3ALL A;  2B76 A;  2ONE A;  3SZC A;  3AYJ A;  3DH9 A;  4IVO B;  3JZU A;  3T9P A;  1VDC A;  1OJA A;  4CCR A;  2GGH A;  5IQ4 A;  2GGG A;  2OFJ A;  3ES8 A;  5EBK A;  3SZW A;  2GMJ A;  1EC7 A;  2XLS A;  2ZZB A;  4H1Z A;  1X31 B;  1F6M A;  4ECH A;  3FV9 A;  1ZK7 A;  3B97 A;  3UTE A;  4IV9 A;  3T2Y A;  4A79 A;  2RDX A;  3M13 A;  1LPF A;  3V3W A;  1XPY A;  1EC9 A;  1ZKQ A;  3M0O A;  4E0V A;  2IID A;  1P2H A;  1ZMD A;  2DKI A;  3AE1 A;  4U8L A;  3P3B A;  3I6D A;  1V97 A;  1E7P A;  5M10 A;  4H2P A;  3FVD A;  3IF9 A;  3TW9 A;  1MRA A;  4LII A;  1LQU A;  3V3N A;  2BCG G;  2W3S A;  4XXG A;  1N5X A;  3ZLH A;  4TLX A;  4J56 A;  3T37 A;  3ES7 A;  2X8H A;  3BI4 A;  3K7M X;  3TQP A;  1PJ6 A;  4HA6 A;  3KUM A;  4A35 A;  4TM4 A;  3NT6 A;  1EL9 A;  1BF3 A;  2BRA A;  4JY2 A;  4IA5 A;  1KNR A;  3V4B A;  3QPE A;  4FDC B;  3BHK A;  3EKG A;  2AL2 A;  4DWD A;  2JBV A;  2BK4 A;  2XGZ A;  2OLA A;  5IQ1 A;  3COX A;  4USR A;  2QDD A;  3EF6 A;  5EB5 A;  1LQT A;  2WS3 A;  2A87 A;  2R9Z A;  3GRS A;  2HXT A;  1PXA A;  2YM2 A;  3CAW A;  2AL2 B;  3MKC A;  4RG3 A;  2OLN A;  3NLC A;  2CVJ A;  1LV0 A;  2FJB A;  1IJH A;  2YLS A;  2JB1 A;  3ZVH A;  4ZA0 A;  4U2T A;  4U2S A;  1B8S A;  1FFU C;  4HCD A;  3CB3 A;  3TWA A;  2WQY A;  1FEA A;  1GT8 A;  1OJC A;  4IA6 A;  3SR6 B;  3LZX A;  2WEU A;  3ZVH B;  2X8G A;  2EQ9 A;  6ENL A;  4HB9 A;  2BCP A;  1SJC A;  3BOX A;  3NGC X;  1SEZ A;  3U4F A;  3KPF A;  3IJI A;  2C7G A;  3SZ0 A;  1ZMC A;  2QQ6 A;  1S3E A;  3F8D A;  3TWB A;  3RRA A;  2EQ8 A;  3CK5 A;  2QVH A;  3AE6 A;  1D4D A;  3KVE A;  2R4E A;  4BV6 A;  4YT0 A;  3AE7 A;  4J1O A;  2IVD A;  4JHM A;  4G6H A;  2YM1 A;  1E1N A;  2R0G A;  2Z5Y A;  2FJE A;  1H82 A;  4APN A;  2E3T A;  3P0W A;  3QFA A;  3T31 A;  3Q45 A;  1N1P A;  3DME A;  1N5W C;  4H4P A;  2Q0L A;  4K5S A;  4E4U A;  1LJ1 A;  4TVW A;  1ZOV A;  1P2E A;  1UKV G;  4CCQ A;  2GR0 A;  3UKP A;  3BI5 A;  3NS1 B;  3CGC A;  4O5Q A;  3VQR A;  2ZAD A;  3P93 A;  1IUS A;  2OVL A;  2ACZ A;  5BVA A;  3GD3 A;  4FI4 A;  2VQ7 A;  3AEG A;  1DJN A;  3CPJ G;  1NEN A;  4IHC A;  1GRA A;  4HCL A;  2YVF A;  4GAV A;  3DFH A;  1JRO A;  4NWZ A;  4H2N A;  3SQP A;  3AED A;  4H4T A;  1K0L A;  3UTG A;  3P4P A;  2GEW A;  3DER A;  4II3 A;  2J3N A;  1QO8 A;  1SJA A;  1EBD A;  3R0K A;  4H4Y A;  3UCC A;  4J33 A;  4NTC A;  2C72 A;  2C66 A;  2QJJ A;  3GYI A;  4OVI A;  1H81 A;  4A6N B;  3UTF A;  4OPL A;  2YWL A;  1XPQ A;  4G74 A;  1JCT A;  2PGW A;  3VC5 A;  4DHG A;  3Q4D A;  1GPE A;  3L8K A;  3CGE A;  3KA7 A;  3AEC A;  1BKW A;  2OA1 A;  3PFR A;  3UKQ A;  1GRF A;  3K30 A;  1GET A;  3NRN A;  4H7U A;  3FIM B;  2V61 A;  1LTX R;  1KKR A;  3GD4 A;  3N6J A;  1FHV A;  4GYP C;  3UJR A;  4B64 A;  1RYI A;  2DW6 A;  2GR2 A;  1PDH A;  3CNP A;  1MUC A;  1SJB A;  1GRH A;  4K8G A;  2BS2 A;  4BK1 A;  3AWI A;  4EWJ A;  2JAE A;  3CMM A;  3VCC A;  3LXD A;  1COY A;  4A99 A;  3VDG A;  3SJN A;  3DJE A;  4E5T A;  3QVR A;  3C4N A;  2FBW A;  1EL8 A;  5G5G B;  3H4K A;  4FK1 C;  3IWA A;  3VA8 A;  4MMW A;  1EBH A;  1TDO A;  2XFO A;  4U8K A;  5JCL A;  2DKH A;  3NVZ B;  2VOU A;  1T3Q C;  4G8T A;  1PBE A;  3SX6 A;  5C2T A;  5ENL A;  3GWD A;  4ZCD A;  4KEM A;  5JRB A;  2FKP A;  3GSI A;  2FJD A;  4IZG A;  3HRD C;  3NRZ B;  2OX4 A;  5G5H B;  3NN0 X;  4H4R A;  4H4Z A;  2OZT A;  4AP3 A;  2YR4 A;  3FG2 P;  1W4X A;  4CBQ A;  3RED A;  2OAM A;  4M0X A;  4D04 A;  5C3J A;  1FCD A;  3UJF A;  3VRB A;  4HCH A;  3SGL A;  4ZCW A;  3H8I A;  4HNC A;  4A7A A;  3IK4 A;  2YG7 A;  3CPI G;  1FHU A;  5KVI A;  2W54 A;  4IVM B;  2NVK X;  4H4U A;  3NHO X;  3H70 A;  2XLP A;  3UOV A;  1ELS A;  5EU9 A;  4G6G A;  2Z5X A;  3C96 A;  3DJD A;  2OZ8 A;  4U8P A;  3T0K A;  3V5F A;  1NDA A;  1RVK A;  4NNJ A;  3P9U A;  4C74 A;  3AEA A;  1DOD A;  3TJI A;  4DN1 A;  4Z17 A;  1AOG A;  2V3A A;  1DOC A;  2WPE A;  1Q1R A;  1BGN A;  3VC6 A;  4I58 A;  3CNS A;  2VRL A;  3GC2 A;  2QA2 A;  5FJU A;  1CJ4 A;  3GDN A;  4Z25 A;  3UP4 A;  5KMP A;  4GAP A;  3NN6 X;  2RAB A;  3P4S A;  5ER0 A;  4OPU A;  3RGT A;  3I6E A;  4B63 A;  1JOA A;  4P9S A;  4U8O A;  2VQB A;  2WDR A;  1PXC A;  2GB0 A;  1MO9 A;  1LVL A;  2XFN A;  3OZ2 A;  5JCK A;  5FJO A;  3HYW A;  2POD A;  3ZDN A;  1FEB A;  3B3R A;  4AT2 A;  3G5Q A;  1KKO A;  1YQZ A;  1IUX A;  3E1T A;  4H2R A;  2Y6R A;  3VFC A;  1Q1W A;  1FIQ B;  4Y4L A;  3R25 A;  3SM8 A;  2GSH A;  3T2Z A;  1DJQ A;  4ICY A;  4JN7 A;  1WYG A;  4YSZ A;  1KDG A;  3ITJ A;  1NEK A;  3JW7 A;  2NQL A;  2B7S A;  4IT1 A;  3RP8 A;  4HNL A;  1TRB A;  4H2Q A;  3AYL A;  3ALM A;  1E9I A;  4JDR A;  2FYM A;  3UJE A;  5HXI A;  1ONF A;  2R0C A;  1W6T A;  4C5O A;  2ARD A;  2JB2 A;  3HW2 A;  2PTX A;  1TDF A;  1TYT A;  3P4Q A;  3ATQ A;  4TVY A;  1Z6L A;  2IVE A;  4KT2 A;  1JRX A;  2WOI A;  1PS9 A;  2Q7V A;  4IL0 A;  2OKT A;  3TTE A;  5FS9 A;  3NTD A;  3DG7 A;  2H89 A;  2WP9 A;  3CXB A;  4REK A;  4OPT A;  4B1B A;  2BS4 A;  4MKS A;  4B67 A;  2ZBW A;  4JNA A;  3AN1 A;  3DK8 A;  1MOK A;  1CBO A;  2CHR A;  4NTD A;  3T14 A;  2TPR A;  2C70 A;  4H83 A;  1KD0 A;  2C75 A;  3SSZ A;  2BS3 A;  1ZY8 A;  3RP7 A;  4K5R A;  4E4F A;  1E6E A;  3QJ4 A;  3MWC A;  2WPC A;  4EMJ A;  1PDY A;  3RNM A;  3OW1 A;  3NK1 X;  1ECQ A;  2VRM A;  3AE2 A;  1D7Y A;  2XLU A;  2RGH A;  4HN8 A;  4Z2T A;  4K2X A;  2GVC A;  2BYB A;  3KKJ A;  3RHA A;  4A9W A;  1JNR A;  2JK6 A;  4CRT A;  1K4Q A;  2GR1 A;  2GQW A;  4GIR A;  1XAN A;  2WP6 A;  2FJA A;  5FS6 A;  1XS2 A;  2WDQ A;  1S7M A;  3FPZ A;  2PMQ A;  3AYI A;  3DK9 A;  3BSM A;  3DEQ A;  4A3R A;  1D7L A;  3B9J B;  4EMI A;  3EPT A;  1Y0P A;  1OJD A;  1VRQ B;  4X9N A;  4MJW A;  1GV4 A;  3NNE A;  2R0P A;  4LU6 A;  2B9X A;  5KMS A;  4EQS A;  3PS9 A;  3H8A A;  4C3Y A;  5J60 A;  1N4W A;  3I3L A;  3KPK A;  3RO6 A;  3DG6 A;  2BA9 A;  3LZW A;  2R46 A;  4GDE A;  1PJ7 A;  3ADA B;  4KX6 A;  2BK5 A;  1CJ3 A;  3FMW A;  4U8M A;  3DGH A;  4XWZ A;  4CY8 A;  3L5O A;  2PTZ A;  2YLZ A;  4JN8 A;  1SB3 B;  2XLR A;  3LAD A;  5KOW A;  3ATR A;  3AEE A;  1QJD A;  1OJ9 A;  3UJS A;  2XSX A;  3T8Q A;  4UDP A;  1E39 A;  2Q6U A;  4YXD A;  2E5A A;  1VDV A;  5LV9 A;  1IUW A;  2P8C A;  4RSL A;  4USQ A;  3UKK A;  2X99 A;  4UDR A;  1GES A;  4C3X A;  2XCG A;  3HPF A;  3ISH A;  2YR6 A;  1R6W A;  4ZN0 A;  1YY5 A;  2GMH A;  1ZDL A;  1VG9 A;  3FCP A;  4YSY A;  1PBF A;  1NG3 A;  4JQ9 A;  5KVH A;  2AL1 A;  5U1O A;  3ICS A;  3DG3 A;  2OG9 A;  4K2S A;  2MUC A;  1N4V A;  1NHQ A;  3AD7 B;  4HPN A;  4II2 A;  3II4 A;  1TDK A;  5BUK A;  1N63 C;  3GD6 A;  2HQM A;  1CL0 A;  4EIQ A;  2QAE A;  4ADW A;  1TZZ A;  3R11 A;  3R9U A;  4A6N A;  2O9Z A;  5CKU A;  5GSN A;  4X2P A;  3D1C A;  3UP5 A;  3PK7 A;  4TLZ A;  2GGI A;  3DDM A;  3NVV B;  3SN1 A;  2OQH A;  1D4E A;  3UKA A;  4ROP A;  2OLO A;  3TJ4 A;  4B69 A;  3OZM A;  1H86 A;  1FO4 A;  4E8G A;  1PBC A;  3IJQ A;  2QDE A;  3LB8 A;  4GME A;  1F3P A;  2V5Z A;  4EMW A;  1B4V A;  1D5T A;  3F8R A;  1IUU A;  2HZG A;  1O95 A;  3QSM A;  3N4E A;  1TE6 A;  3KU9 A;  4OPI A;  1O5W A;  2PSN A;  1KN0 A;  1ELI A;  2F5Z A;  2O56 A;  2C65 A;  3BI2 A;  3LOV A;  4AOS A;  1L8P A;  1NEL A;  2PHH A;  3P4R A;  4Y4M A;  2XLT A;  1NU5 A;  1X2H A;  1TDN A;  4OPD A;  1GTE A;  2AR8 A;  2YG3 A;  1RP0 A;  3G5S A;  4NEW A;  4J57 A;  4X4J A;  4Z26 A;  3BNU A;  5FS7 A;  5IPY A;  3V5C A;  4U2L A;  1BWC A;  2JB3 A;  1B37 A;  5FJP A;  3S5S A;  2YG6 A;  3STP A;  1JEH A;  3AE5 A;  3JVA A;  4ENL A;  1S2Q A;  4GYP A;  2PU0 A;  3GMB A;  4H4X A;  2GGE A;  1NHR A;  2V3B A;  5J04 A;  2Q0K A;  5BUL A;  5EOW A;  5L46 A;  3FXG A;  3V76 A;  2OO6 A;  2I0Z A;  5M0Z A;  4BUR A;  2AKZ A;  1STZ A;  3MUC A;  1CC4 A;  3D9X A;  3HYX A;  3CGD A;  4FK1 A;  5FJR A;  4KPL A;  1E1K A;  2WU2 A;  1IYX A;  1VQZ A;  3NTA A;  2CFY A;  3AM9 A;  1Q9I A;  4AOX A;  3T4W A;  3VRD B;  3RIT A;  4NZH A;  1M6I A;  2EQ7 A;  3ICR A;  4WCT A;  4YSH A;  2OZ3 A;  4A6G A;  4EQX A;  3QN3 A;  2P0I A;  1H84 A;  3ETR B;  3L1R A;  1WUF A;  2OAL A;  4H50 A;  1GEU A;  3N6H A;  2XDO A;  3ALJ A;  3DIP A;  4J31 A;  2C76 A;  4UDQ A;  1E1M A;  2CUL A;  4PAA A;  2YLW A;  3AMZ A;  3CN8 A;  5BRT A;  2PA6 A;  2WP5 A;  3NK0 X;  1CF3 A;  3GRT A;  2XVH A;  3DFY A;  3D8X A;  3GYX A;  3UCD A;  2E1M A;  4YWO A;  4YSX A;  2BXR A;  1FFV C;  3LJP A;  3OP2 A;  1PJ5 A;  1FL2 A;  2BK3 A;  3SN4 A;  2XH0 A;  4H4V A;  2WOW A;  3DES A;  4CY6 A;  2AQJ A;  2E4G A;  3IHM A;  1VQW A;  3I6T A;  3DJG X;  1REO A;  3OPS A;  3ZLG A;  4E6M A;  3CXO A;  3KLJ A;  3QSS A;  2C3C A;  2XVF A;  1VG0 A;  3S5W A;  2GH5 A;  3G5R A;  3R1Z A;  3EEZ A;  1CC2 A;  1QLB A;  2PYX A;  3PO7 A;  3IHG A;  3AE4 A;  3WE0 A;  3UKF A;  1NHS A;  2A89 A;  2GQF A;  1N61 C;  5JCI A;  5GRT A;  4GF7 A;  5HHF A;  2H88 A;  3D47 A;  1JU2 A;  3B6D A;  3V3O A;  1GRB A;  2GAG B;  3K1G A;  2YLR A;  4H4W A;  1NHP A;  4PAB A;  3P1W A;  3S47 A;  4GRT A;  1MDR A;  4FP1 A;  2YAU A;  3MQT A;  4B65 A;  1GRT A;  1M64 A;  1KSU A;  2PGE A;  4DSH A;  5JCN A;  2R4J A;  2B9Y A;  2QA1 A;  4DSG A;  3PWI A;  4N9X A;  3SFD A;  3MSY A;  4AP1 A;  1P43 A;  5U63 A;  2QJM A;  4NEV A;  3A7U A;  3R07 C;  3ENL A;  4O5U A;  1NPX A;  3QSE A;  3HYV A;  3T2K A;  1BQG A;  1NAA A;  2GV8 A;  3URH A;  1PBD A;  2XH4 A;  2MNR A;  2HNE A;  2WPF A;  2WET A;  2NPX A;  3DA1 A; 
#chains in the Genus database with same CATH homology
 5J60 A;  1N4W A;  3I3L A;  3KPK A;  2YWL A;  1PXB A;  4D03 A;  1XPQ A;  4X9M A;  4G74 A;  2BA9 A;  2C64 A;  3IC9 A;  3VR9 A;  1GPE A;  3L8K A;  4GDP A;  3LZW A;  2R46 A;  2C73 A;  2X3N A;  4GDE A;  3CGE A;  1PJ7 A;  3AEB A;  3SYI A;  3ADA B;  3KA7 A;  3AEC A;  1BKW A;  2BK5 A;  4KX6 A;  1S3B A;  4OCG A;  5KXJ A;  1CJ3 A;  3FMW A;  5HY5 A;  1CJC A;  4JN9 A;  3O0H A;  4U8M A;  3DGH A;  2OA1 A;  4M52 A;  1YKJ A;  2C67 A;  4XWZ A;  4CY8 A;  3L5O A;  3UKQ A;  1GRF A;  3HZL A;  1K0I A;  3K30 A;  2YLZ A;  3PG6 A;  2RGJ A;  1GET A;  2XLR A;  4J34 A;  3NRN A;  4H7U A;  1FEC A;  1DNC A;  3FIM B;  2V61 A;  3LAD A;  1LTX R;  5KOW A;  3GD4 A;  4JNQ A;  3ATR A;  4LA1 A;  3AEE A;  3NK2 X;  1QJD A;  1OJ9 A;  2XVI A;  3UOY A;  1V59 A;  3PVC A;  2X50 A;  3S61 A;  4B64 A;  1MXT A;  1RYI A;  3CPH G;  2WBA A;  4UDP A;  1ZX9 A;  1E39 A;  2Q6U A;  2GR2 A;  3VR8 A;  4YXD A;  1PDH A;  3CNP A;  5HYM A;  5LV9 A;  1GRH A;  2BS2 A;  1H83 A;  1IUW A;  5KMQ A;  4EM3 A;  2RGO A;  4K22 A;  4BK1 A;  4RSL A;  1O94 A;  1PN0 A;  3AWI A;  2BC1 A;  4Z43 A;  4USQ A;  1HYU A;  1FOH A;  2JAE A;  3UKK A;  2X99 A;  4JY3 A;  2TMD A;  1KNP A;  3CMM A;  4H4Q A;  2BAC A;  3SY4 A;  2BC0 A;  3LXD A;  1L0V A;  4UDR A;  3KD9 A;  1COY A;  1GES A;  3F8P A;  2XCG A;  3GMC A;  3NIX A;  4A99 A;  4C3X A;  3DGZ A;  2YQU A;  4EM4 A;  4TM1 A;  1IUT A;  2ZZ0 A;  3ISH A;  2YR6 A;  4ZN0 A;  1YY5 A;  4K8D A;  3DJE A;  3QVR A;  1KSS A;  2GMH A;  1OJT A;  3C4N A;  1ZDL A;  3CIR A;  2YVJ A;  1VG9 A;  2FBW A;  4BK3 A;  1GAL A;  1EL8 A;  2X8C A;  4BJY A;  3M12 A;  4YSY A;  3H4K A;  3EAN A;  4TM3 A;  3GWF A;  1GND A;  1PBF A;  1NG3 A;  2C3D A;  4GCM A;  1XDI A;  4FK1 C;  4G73 A;  2B7R A;  2WES A;  4JQ9 A;  3IWA A;  5KVH A;  1H7W A;  4B66 A;  1K0J A;  2YVG A;  1TDO A;  3FBS A;  2XFO A;  1L9C A;  4U8K A;  5JCL A;  2DKH A;  5U1O A;  1DOB A;  3AE3 A;  3ICS A;  2VVM A;  3DJJ A;  1EL7 A;  2VOU A;  2CDU A;  4UP3 A;  5CQF A;  1N4V A;  5EB4 A;  1NHQ A;  3AD7 B;  1PBE A;  4II2 A;  3SX6 A;  3II4 A;  1TDK A;  4A5L A;  5C2T A;  2BAB A;  4WX1 A;  5BUK A;  3GWD A;  3AD9 B;  1EL5 A;  4ZCD A;  5JRB A;  3CNT A;  3GSI A;  2GR3 A;  2HQM A;  3SXI A;  1CL0 A;  2FJD A;  4EIQ A;  3CGB A;  3AE8 A;  3GYJ A;  2QAE A;  1S2Y A;  3CTY A;  3SZF A;  4ADW A;  2R45 A;  4NTE A;  1BGJ A;  1H6V A;  1JNZ A;  3NN0 X;  3VRA A;  4H4R A;  3BHF A;  4H4Z A;  3BNM A;  2V60 A;  3R9U A;  4A6N A;  2O9Z A;  5CKU A;  1CC6 A;  4DNA A;  2YG4 A;  5GSN A;  1DXL A;  4AP3 A;  1DOE A;  2VVL A;  2BXS A;  2Y6Q A;  2YR4 A;  3FG2 P;  2A8X A;  1RSG A;  4GUV A;  1W4X A;  4CBQ A;  3D1C A;  3RED A;  3ALL A;  3UP5 A;  2B76 A;  4TLZ A;  3SZC A;  2OAM A;  4J2W A;  3AYJ A;  4D04 A;  5C3J A;  1FCD A;  3DH9 A;  4IVO B;  1D4E A;  3VRB A;  5JCM A;  2GRT A;  3UKA A;  1VDC A;  3UOX A;  2OLO A;  3NYE A;  1OJA A;  4B69 A;  4CCR A;  5IQ4 A;  4FX9 A;  1H86 A;  3SGL A;  1PBC A;  4CNK A;  3H8I A;  4A7A A;  5EBK A;  3LB8 A;  3SZW A;  5KOX A;  1F3P A;  2V5Z A;  4EMW A;  2YG7 A;  3Q9T A;  1B4V A;  1D5T A;  2GMJ A;  2JKC A;  3CPI G;  3F8R A;  5KVI A;  1IUU A;  4IVM B;  2XLS A;  2NVK X;  4H4U A;  4KPR A;  1KF6 A;  1O95 A;  2ZZB A;  3QSM A;  3QVP A;  4TM0 A;  3KU9 A;  3NHO X;  1X31 B;  3UOV A;  2XLP A;  1N4U A;  4OPI A;  4G6G A;  1F6M A;  2Z5X A;  4ECH A;  1O5W A;  1KN0 A;  1ELI A;  1ZK7 A;  3C96 A;  2F5Z A;  3DJD A;  4U8P A;  3T0K A;  2C65 A;  1NDA A;  3BI2 A;  3LOV A;  3UTE A;  2WHD A;  4IV9 A;  4AOS A;  3T2Y A;  4A79 A;  4NNJ A;  3P9U A;  4Y4M A;  2PHH A;  3P4R A;  4C74 A;  3K7T A;  3M13 A;  1B5Q A;  2XLT A;  3AEA A;  1DOD A;  1LPF A;  1TDN A;  4U8J A;  4OPD A;  1GTE A;  2AR8 A;  1AOG A;  2V3A A;  1DOC A;  2WPE A;  2YG3 A;  1ZKQ A;  3C4A A;  3M0O A;  4J36 A;  4E0V A;  1Q1R A;  1RP0 A;  1BGN A;  4NEW A;  2IID A;  4J57 A;  3G5S A;  4I58 A;  4H4S A;  1P2H A;  4X4J A;  3BNU A;  4Z26 A;  3CNS A;  2VRL A;  1ZMD A;  3ICT A;  5FS7 A;  2DKI A;  2QA2 A;  2XFP A;  3AE9 A;  3AE1 A;  4U8L A;  4U2L A;  5IPY A;  3I6D A;  1E7P A;  4BK2 A;  5M10 A;  1F8W A;  4H2P A;  1CJ4 A;  1BWC A;  2E5V A;  3NG7 X;  4C77 A;  3GDN A;  2JB3 A;  2VVL G;  1D4C A;  1B37 A;  2YG6 A;  3IF9 A;  4Z25 A;  3UP4 A;  4LII A;  1LQU A;  5KMP A;  3V3N A;  1JEH A;  2BCG G;  4GAP A;  3AE5 A;  3NN6 X;  4XXG A;  2RAB A;  5KNL A;  3P4S A;  5ER0 A;  4TLX A;  4J56 A;  3T37 A;  2X8H A;  3BI4 A;  2UZZ A;  3K7M X;  1S2Q A;  4OPU A;  1PJ6 A;  4HA6 A;  2W0H A;  3GMB A;  4B63 A;  4TM4 A;  4H4X A;  4OPG A;  1NHR A;  3NT6 A;  4U8N A;  2V3B A;  1EL9 A;  2AAQ A;  1BF3 A;  2BRA A;  1JOA A;  3RP6 A;  3Q6J A;  2Q0K A;  1GXF A;  2YLX A;  4P9S A;  4JY2 A;  4IA5 A;  1TDE A;  4Z44 A;  5EOW A;  5BUL A;  4U8O A;  2VQB A;  5L46 A;  1KNR A;  2WDR A;  5KWF A;  4FDC B;  3UCL A;  3BHK A;  1PXC A;  2GB0 A;  1MO9 A;  3V76 A;  1H7X A;  2I0Z A;  1LVL A;  2JBV A;  4XWR A;  2BK4 A;  3AD8 B;  2XFN A;  3OZ2 A;  3EAO A;  3NYF A;  5JCK A;  5M0Z A;  5IQ1 A;  4BUR A;  3AB1 A;  3COX A;  4USR A;  4EIP A;  4YTN A;  4A65 A;  3AXB A;  3EF6 A;  3HYW A;  4DGK A;  3ZDN A;  1FEB A;  5EB5 A;  1LQT A;  2WS3 A;  2A87 A;  1CC4 A;  2WOV A;  3B3R A;  2R9Z A;  3K7Q X;  3GRS A;  1CHU A;  3D9X A;  1PXA A;  4AT2 A;  3HYX A;  2YM2 A;  1L9D A;  3CGD A;  4FK1 A;  3G5Q A;  5TR3 A;  4RG3 A;  1F8R A;  2OLN A;  1YQZ A;  1IUX A;  1E1K A;  3E1T A;  2WU2 A;  5DBJ A;  3NTA A;  2CFY A;  4H2R A;  2Y6R A;  1Q1W A;  3CND A;  3NLC A;  4Y4L A;  3SM8 A;  2CVJ A;  1LV0 A;  2FJB A;  1JRZ A;  3T2Z A;  1IJH A;  1DJQ A;  1Q9I A;  4ICY A;  1GRG A;  1KFY A;  2YLS A;  2JB1 A;  4AOX A;  3VRD B;  1ZP0 A;  1CJ2 A;  4Z24 A;  3NYC A;  1M6I A;  2EQ7 A;  4NZH A;  3ICR A;  1TYP A;  4U2S A;  4U2T A;  4YSZ A;  4WCT A;  4YSH A;  1KDG A;  2YR5 A;  4EQX A;  3ITJ A;  4YTM A;  1NEK A;  1E1L A;  1B8S A;  4EQR A;  1H84 A;  3L1R A;  2B7S A;  2YLT A;  2EQ6 A;  1GSN A;  2WQY A;  1FEA A;  4OPC A;  3RP8 A;  2OAL A;  4H50 A;  1GT8 A;  4CNJ A;  1TRB A;  4YTP A;  1OJC A;  4Y4N A;  1GEU A;  3AYL A;  4H2Q A;  3ALM A;  4IA6 A;  3LZX A;  2XDO A;  2WEU A;  4U8I A;  1ZOY A;  4JDR A;  3ALJ A;  2X8G A;  4J31 A;  2C76 A;  4UDQ A;  4Z2R A;  1ONF A;  5HXI A;  1E1M A;  4ZCC A;  2EQ9 A;  2CUL A;  2R0C A;  3GDP A;  4HB9 A;  1NG4 A;  4PAA A;  4RG4 A;  2YLW A;  2BCP A;  1YQ3 A;  4C5O A;  3CN8 A;  5BRT A;  2ARD A;  2JB2 A;  2XFU A;  2C4C A;  3NGC X;  2WP5 A;  1TDF A;  3NK0 X;  1TYT A;  1CF3 A;  3P4Q A;  3GRT A;  5FMH A;  1SEZ A;  2XVE A;  2XVH A;  3ABV A;  3KPF A;  5KRQ A;  1YQ4 A;  3ATQ A;  4AT0 A;  3D8X A;  2C7G A;  3SZ0 A;  3UOZ A;  1ZMC A;  2VZ2 A;  1Z6L A;  2IVE A;  3GYX A;  1S3E A;  2E1M A;  5U25 A;  3F8D A;  1PHH A;  4YWO A;  1JRX A;  2EQ8 A;  2WOI A;  4YSX A;  1PS9 A;  2Q7V A;  2BXR A;  3PS9 A;  3AE6 A;  1D4D A;  3LJP A;  5FS9 A;  1GOS A;  3NTD A;  1PJ5 A;  3KVE A;  1FL2 A;  4BV6 A;  2R4E A;  2H89 A;  2BK3 A;  3DK4 A;  2WU5 A;  4YT0 A;  3AE7 A;  2IVD A;  2WP9 A;  4G6H A;  2YM1 A;  1E1N A;  1L9E A;  4REK A;  2R0G A;  2Z5Y A;  4OPT A;  4B1B A;  4H4V A;  2WOW A;  4EQW A;  2BS4 A;  4YKG A;  2FJE A;  3H8L A;  1H82 A;  4CY6 A;  4APN A;  4B67 A;  2AQJ A;  1Y56 A;  4B68 A;  3QFA A;  3T31 A;  2E4G A;  2XVJ A;  2ZBW A;  3CNJ A;  3IHM A;  1VQW A;  4JNA A;  3UKL A;  1N1P A;  3DME A;  3DJG X;  3DK8 A;  1MOK A;  2GAH B;  1CBO A;  4H4P A;  1REO A;  2V6O A;  2Q0L A;  4K5S A;  4NTD A;  3T14 A;  1XHC A;  1LJ1 A;  2TPR A;  2APG A;  3KLJ A;  2C70 A;  1GTH A;  1ZOV A;  1P2E A;  3ZYX A;  2C75 A;  3QSS A;  3UKH A;  1UKV G;  2C3C A;  4OPL A;  2XVF A;  1Y56 B;  4CCQ A;  2BS3 A;  1ZY8 A;  1VG0 A;  2GR0 A;  3S5W A;  2GH5 A;  3G5R A;  3RP7 A;  4K5R A;  1E6E A;  3QJ4 A;  3UKP A;  1CC2 A;  3BI5 A;  1QLB A;  2PYX A;  3PO7 A;  2WPC A;  4G9K A;  3IHG A;  3CGC A;  4EMJ A;  1F8S A;  1PBB A;  3AE4 A;  3WE0 A;  4O5Q A;  3UKF A;  1NHS A;  3VQR A;  2A89 A;  2GQF A;  3OC4 A;  3RNM A;  5FS8 A;  5JCI A;  5GRT A;  3NK1 X;  4GF7 A;  5HHF A;  2H88 A;  2VRM A;  4K7Z A;  1IUS A;  1JU2 A;  3AE2 A;  1D7Y A;  3B6D A;  2XLU A;  2RGH A;  5KMR A;  3V3O A;  2BRY A;  1GRB A;  2ACZ A;  2GAG B;  4Z2T A;  3GD3 A;  5BVA A;  2YLR A;  3JSK A;  3UTH A;  4H4W A;  2XFQ A;  2VQ7 A;  1NHP A;  4K2X A;  2YG5 A;  4PAB A;  2GVC A;  3AEG A;  2B9W A;  2BYB A;  4I59 A;  3P1W A;  1DJN A;  4GRT A;  5J7X A;  3KKJ A;  3CPJ G;  2YAU A;  4GR1 A;  3RHA A;  1NEN A;  4A9W A;  4B65 A;  4Z2U A;  1JNR A;  1GRT A;  2JK6 A;  1GRA A;  1M64 A;  4CRT A;  1KSU A;  3NH3 X;  1K4Q A;  2GR1 A;  2YVF A;  2GQW A;  4DSH A;  5JCN A;  1JRY A;  4GAV A;  1XAN A;  2R4J A;  2B9Y A;  2QA1 A;  4DSG A;  4NWZ A;  2WP6 A;  2FJA A;  1BZL A;  4N9X A;  3SFD A;  5FS6 A;  4H2N A;  3SQP A;  3AED A;  4YKF A;  4AP1 A;  2ZZC A;  4H4T A;  1H2I A;  2WDQ A;  1S7M A;  1K0L A;  3FPZ A;  5U63 A;  3UTG A;  3P4P A;  2GEW A;  3AYI A;  3DK9 A;  4BJZ A;  2GF3 A;  2XYO A;  4II3 A;  2J3N A;  2WDV A;  4NEV A;  1QO8 A;  1D7L A;  4EMI A;  3EPT A;  1GRE A;  4O5U A;  1GER A;  1Y0P A;  1OJD A;  1NPX A;  1EBD A;  3QSE A;  3SFE A;  1VRQ B;  3HYV A;  4X9N A;  1IUV A;  4H4Y A;  3T2K A;  4J33 A;  4NTC A;  4MJW A;  1NAA A;  2C72 A;  2C66 A;  1GV4 A;  3URH A;  1PBD A;  2GV8 A;  2QCU A;  3GYI A;  3AEF A;  3NNE A;  4OVI A;  3NKS A;  2R0P A;  4LU6 A;  1H81 A;  2WPF A;  4A6N B;  2B9X A;  2WET A;  3UTF A;  5KMS A;  3QFB A;  2NPX A;  4EQS A;  3DA1 A;  4C3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...