4BURA

Crystal structure of the reduced human apoptosis inducing factor complexed with nad
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
484
structure length
450
Chain Sequence
APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into the Coenzyme Mediated Monomer-Dimer Transition of the Pro-Apoptotic Apoptosis Inducing Factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
total genus 136
structure length 450
sequence length 484
chains with identical sequence B, C, D
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4burA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4burA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4burA01
2C76A 1H81A 4ZCCA 5KXJA 4I58A 4ECHA 5HHFA 2Y6QA 4TM1A 2BCGG 3ICRA 1GESA 1F8SA 1GERA 1RP0A 1PBDA 4U2LA 3NKSA 2BACA 3OZ2A 3PVCA 4AOSA 3GRTA 3IHGA 2YG3A 2YLRA 3CNSA 2A89A 2YLZA 1VDCA 3NYFA 3S5WA 1GRTA 2F5ZA 3NLCA 3NNEA 2RGJA 4JY3A 1TRBA 1HYUA 4OPGA 2V3BA 1REOA 4YKFA 1V59A 3L8KA 1B5QA 4H4ZA 2YR4A 3ATQA 3UOVA 4A6NA 4B63A 1RYIA 4A99A 2QAEA 4FK1A 1K0IA 1UKVG 2E5VA 4YTMA 2GVCA 4DNAA 3NGCX 3UOYA 1PHHA 1GETA 2A8XA 3AEGA 3FIMB 5CQFA 4A79A 1QLBA 4J31A 1GREA 1ELIA 1H82A 5KVHA 4NZHA 2OLOA 3DGZA 2BCPA 1EL5A 2C66A 3GD4A 4U8PA 3ISHA 1DOBA 2JB2A 4C77A 2APGA 1GTHA 2E1MA 4XXGA 1NHQA 1OJTA 1GRAA 1CHUA 1E1NA 1GNDA 2UZZA 3K7TA 2WPFA 4ZCDA 4A7AA 4C5OA 3AD9B 3RHAA 2RGHA 1KNPA 1NG3A 4H7UA 2V6OA 2OAMA 4EMIA 1B4VA 2GV8A 2YLWA 4NTCA 3AYLA 1NHRA 4YSZA 4E0VA 4YTNA 2GQWA 2V3AA 2WQYA 3ATRA 1CJ2A 3SFEA 4GR1A 2WOWA 4H4YA 1CC4A 2FJEA 3AD7B 4LIIA 3DA1A 3LJPA 3LOVA 1IUSA 2YLSA 1XHCA 4U8KA 5C2TA 5J60A 4A65A 2EQ7A 2AAQA 4X9MA 2B9WA 4U8JA 5L46A 4U8IA 1PBCA 2NVKX 4ICYA 4JQ9A 4PAAA 4OPTA 4J36A 4K5SA 5BRTA 3BI4A 4NTEA 4BV6A 1OJDA 3DGHA 4JNAA 1E6EA 4TM0A 2R0CA 3KA7A 4U8OA 3B3RA 3R9UA 1YQ3A 1S2YA 4EMJA 1CC6A 3V3NA 2WU2A 1GEUA 3G5RA 3K30A 3AE9A 3AE1A 3UCLA 2CULA 2R4EA 4TM4A 2R0GA 5KRQA 4GCMA 4H4UA 1XDIA 3ZYXA 3F8DA 1B37A 3NN0X 4GF7A 4CY8A 4YWOA 3BI5A 2GAGB 3GMCA 2YQUA 1CJ3A 1JRYA 1ZP0A 2XFPA 2YG7A 1S2QA 3SM8A 2VVMA 1CJCA 2DKHA 5JCNA 1Y56B 3D8XA 3P9UA 4C3YA 5KVIA 1Q1RA 4RSLA 3DK9A 1MOKA 3CGBA 1OJCA 4CCRA 3M12A 1JU2A 2XYOA 2RGOA 3CPHG 4GRTA 2XLUA 2CFYA 4U8MA 3CGDA 3CGEA 3EPTA 1GTEA 3AYJA 4AT2A 2W0HA 4BK2A 1ZK7A 2TPRA 3GWFA 2GRTA 3CGCA 5BUKA 4KPRA 2JK6A 3COXA 2B7SA 2BC1A 3QFBA 2JAEA 3Q6JA 2WETA 3AE8A 3AE2A 4YT0A 4X4JA 1FOHA 3CIRA 4CRTA 1TDNA 1JOAA 3KU9A 2C7GA 2QA1A 3BI2A 4J33A 5HXIA 3CNJA 1PDHA 4UDQA 3CNDA 5FS8A 2X8GA 1FEBA 1RSGA 3ICTA 1YQZA 4DSHA 1LV0A 2WOIA 3NHOX 1KFYA 4Z44A 1GOSA 4IA6A 1KSUA 2FJDA 4C3XA 4P9SA 3SFDA 2GMJA 3ALMA 3NN6X 4UDPA 5M10A 2GR1A 2FJAA 1NHSA 4AP1A 3SQPA 4BK3A 1GRBA 2A87A 2C64A 4BURA 1TDEA 2VVLG 3K7QX 4OPLA 1H7XA 1KF6A 2WDQA 3GSIA 2NPXA 2WPCA 3IC9A 1O94A 2YWLA 3AEAA 2VRMA 3DJJA 2R9ZA 3NK2X 3PS9A 3ALJA 3AE4A 1H84A 2JB1A 3FG2P 2WDRA 1IUXA 4U2TA 1BGNA 1PBBA 1VG9A 2BK5A 1PJ5A 4IVOB 3NIXA 2WP5A 3QSEA 4HB9A 1JEHA 2XLPA 3AWIA 3AEDA 1LPFA 4H2NA 2BXSA 2WEUA 4YSYA 5EBKA 5CKUA 1D4DA 3CPJG 1EL9A 1JNRA 3Q9TA 3UP4A 3O0HA 1YY5A 1E1MA 1NHPA 1GSNA 2AQJA 1IUUA 1KSSA 3QVPA 4O5UA 4DGKA 4K8DA 2CVJA 1L0VA 1GT8A 1JRZA 3WE0A 4AOXA 5JCLA 1NENA 1S3BA 4B69A 4YXDA 1X31B 1B8SA 3C4NA 4H4QA 1QO8A 4UP3A 4ZN0A 4IV9A 4YKGA 2WU5A 2C72A 2WBAA 3AD8B 4OPCA 2BK4A 3LZXA 2DKIA 2VQBA 2XLTA 3UKQA 1PXAA 3UKKA 1GXFA 5JCIA 1K4QA 2H89A 2YM1A 1K0LA 3VRDB 4OPUA 1PJ6A 3P4RA 1DODA 2O9ZA 2XVJA 4U8NA 2IVEA 2Q0LA 3H8LA 2R46A 3FMWA 3NTAA 1EBDA 3UKFA 4N9XA 4FK1C 4CNKA 3LXDA 4H2PA 3NYCA 1Y56A 4CY6A 2X8HA 1DJQA 2YG4A 4B64A 1CJ4A 3NYEA 3AEBA 1TYPA 2EQ8A 1GRFA 1W4XA 4USRA 3EAOA 1XANA 5FS7A 1MXTA 1Y0PA 4U2SA 1LJ1A 4APNA 2BXRA 1GPEA 2C3CA 5EOWA 1PJ7A 3NT6A 1N4VA 4CBQA 1KDGA 4Y4NA 3II4A 2Z5YA 2PHHA 3L1RA 2I0ZA 5M0ZA 4Z25A 2ZZ0A 1CL0A 1F6MA 2VRLA 1BWCA 3UP5A 1LQUA 2ZZBA 4H4WA 4EM4A 4YSXA 3V76A 4Z2RA 1COYA 3FBSA 4NTDA 1D5TA 1TDOA 2WDVA 3AE6A 1NAAA 2Q6UA 3KVEA 3UOXA 3QVRA 2WP9A 1Q9IA 1H86A 4IA5A 1IUWA 1O95A 4OPDA 1O5WA 1EL7A 2OA1A 3DK4A 1YQ4A 4EQSA 2ZZCA 1VQWA 2BS4A 2JBVA 4J56A 4RG3A 1ZOVA 1CBOA 4EIPA 2RABA 3GDNA 1ZY8A 1L9CA 1DOEA 3AE3A 1LVLA 5HYMA 4EMWA 2BABA 3G5SA 4TM3A 2YG5A 4KX6A 4Z43A 1CF3A 3IF9A 4B66A 4B68A 3NK0X 2OALA 3P4QA 3QSSA 4JY2A 5DBJA 2XVEA 2EQ6A 1E7PA 1DJNA 2FJBA 1ZX9A 4YSHA 4K22A 3DMEA 3GYIA 5U25A 4TLZA 1F8WA 3D1CA 1VRQB 3F8RA 5J7XA 2FBWA 2YLTA 1E39A 4H2QA 2BA9A 3IWAA 4LU6A 3LZWA 1KNRA 3NRNA 3BHFA 1GV4A 2YG6A 3UKPA 3UTFA 4MJWA 3ITJA 1EL8A 1PXCA 3AE7A 4NEVA 2V61A 1P2EA 2GR2A 1M64A 4GDEA 4XWRA 3UTGA 4LA1A 4BK1A 1H7WA 4RG4A 1LTXR 2OLNA 1PS9A 2PYXA 2Q7VA 3UTEA 4DSGA 3AEEA 5U1OA 2WHDA 4Y4MA 3UKLA 4J34A 3AECA 5GSNA 3RP8A 3M13A 4X9NA 1D7LA 3GMBA 5FS6A 3AYIA 5JCKA 2GQFA 2V5ZA 4K7ZA 1ZOYA 1SEZA 4H4RA 2XDOA 4J57A 4A6NB 4B1BA 4FDCB 5KOXA 1ONFA 3UKAA 3KKJA 5JCMA 1BF3A 1DOCA 2YVGA 2X3NA 3JSKA 2Z5XA 4H2RA 4H4SA 3VR9A 2GH5A 2X50A 1NEKA 2ACZA 2AR8A 3GRSA 5GRTA 3CNTA 1E1KA 3ZDNA 5KOWA 3GD3A 3DJGX 3S61A 3GWDA 4K2XA 5BVAA 4EQRA 1PBFA 3VR8A 2TMDA 3AEFA 4PABA 3NK1X 2YAUA 3UOZA 4C74A 5LV9A 2B76A 2WP6A 3CNPA 1AOGA 4K5RA 3QJ4A 4CNJA 3K7MX 1D7YA 1LQTA 2YR5A 1ZKQA 4M52A 2WPEA 5TR3A 1YKJA 2XFQA 1S3EA 2XFOA 1Q1WA 1JNZA 4GUVA 1OJ9A 2H88A 5EB5A 3ADAB 3DK8A 4GDPA 1BZLA 2GEWA 2WOVA 4B65A 2HQMA 4H50A 3NTDA 1JRXA 3QFAA 4BJYA 4EM3A 4USQA 2R0PA 2XVHA 4OPIA 2B7RA 1IUVA 5IQ1A 3VQRA 3UKHA 4A9WA 4Y4LA 1FECA 4JDRA 2QA2A 3GDPA 5C3JA 1ZMDA 2BC0A 3ALLA 2ARDA 2R4JA 2YLXA 3P1WA 3I3LA 1BKWA 1F3PA 4FX9A 4XWZA 3KPFA 2C65A 2XLSA 3P4PA 3VRBA 4D03A 2VOUA 4REKA 4Z2TA 2B9YA 3G5QA 2C75A 3ICSA 3BNMA 3E1TA 4IVMB 2VVLA 4EQXA 4Z24A 1L9DA 1N1PA 1PBEA 1VG0A 4HA6A 3SGLA 5U63A 2XCGA 3DJDA 4U8LA 2YVJA 1IJHA 2XFNA 2J3NA 4H4PA 1QJDA 3C4AA 3LADA 3DH9A 1GRHA 2C70A 3B6DA 3GYJA 1H6VA 2V60A 3EF6A 3ABVA 1D4EA 5HY5A 3QSMA 2CDUA 2C73A 2WESA 2XVFA 3LB8A 4TLXA 1P2HA 2GR0A 4B67A 5IPYA 1M6IA 1CC2A 2BK3A 2XLRA 3PO7A 2ZBWA 3V3OA 3H4KA 1H83A 3T37A 3IHMA 1FL2A 4Z2UA 3BNUA 1TDFA 4H4XA 3KLJA 2GAHB 3RP6A 2YM2A 2BYBA 3EANA 3RNMA 1MO9A 2GF3A 3CTYA 2GB0A 3F8PA 1FEAA 3CPIG 5KWFA 2C3DA 2B9XA 1E1LA 2E4GA 4I59A 4ADWA 4J2WA 4WCTA 4AP3A 2BS2A 4EQWA 1N4UA 2BS3A 2Y6RA 1XPQA 1DXLA 2WS3A 3REDA 3NG7X 2EQ9A 1ZDLA 4YTPA 5ER0A 4EIQA 1DNCA 2YVFA 1GALA 2JB3A 3AE5A 2GR3A 2GMHA 2R45A 4OCGA 4A5LA 1NPXA 3URHA 4CCQA 1TDKA 1PXBA 3CN8A 4WX1A 3OC4A 2QCUA 3H8IA 4O5QA 1N4WA 2XVIA 3FPZA 4OVIA 1NDAA 1IUTA 3BHKA 3KD9A 2Q0KA 1PN0A 1TYTA 4NEWA 2VZ2A 2X99A 5FS9A 4JN9A 1FCDA 3AXBA 5BULA 3NH3X 4JNQA 3HZLA 3VRAA 4BJZA 4H4VA 5EB4A 3P4SA 2VQ7A 2X8CA 5FMHA 1NG4A 2C67A 1Z6LA 4D04A 2JKCA 1D4CA 1F8RA 2IIDA 3RP7A 3UTHA 1K0JA 3DJEA 4Z26A 1OJAA 4AT0A 1GRGA 2XFUA 4H4TA 1BGJA 2IVDA 5IQ4A 3M0OA 1ZMCA 4UDRA 2YR6A 1L9EA 3C96A 3AB1A 3I6DA
chains in the Genus database with same CATH superfamily
3UJ2A 4ECHA 2Y6QA 1E9IA 2BCGG 2BACA 2YLRA 3CNSA 1HYUA 4OPGA 2V3BA 4YKFA 3TTEA 4H4ZA 4A99A 2QAEA 1UKVG 2E5VA 3T31A 3UOYA 4J31A 4J3ZA 3SJNA 3DGZA 3GD4A 4C77A 5BOFA 2AKMA 1OJTA 1GRAA 1E1NA 2QDEA 3VC6A 2RGHA 3RHAA 4EMIA 2OPJA 4YSZA 3N4FA 3T6CA 2NQLA 3ATRA 3A7UA 3SFEA 4GR1A 4H1ZA 4LIIA 2B9WA 5L46A 4U8IA 2NVKX 4OPTA 3QTPA 3DIPA 1E6EA 1CC6A 2XH7A 3G5RA 2XSXA 3AE9A 2CULA 3THUA 4H4UA 1XDIA 3QLDA 1B37A 4CY8A 4JHMA 1CJ3A 1ZP0A 2YG7A 3SM8A 1S2QA 3ZLGA 1CJCA 2DKHA 3T14A 1MOKA 1JU2A 2RGOA 3HYWA 2C4CA 4U8MA 2CFYA 2HNEA 3D47A 3CGEA 3K1GA 3EPTA 3AYJA 4K2SA 1X2HA 3Q6JA 3T2ZA 3NVZB 3KU9A 3OZMA 3ICTA 3NVYB 1YQZA 4GYPA 3NHOX 1KFYA 1GOSA 4IA6A 2FJDA 3SFDA 3NN6X 4DYEA 4UDPA 2GR1A 2QDDA 4MKSA 1TDEA 3K7QX 1KF6A 2WDQA 3GSIA 2YWLA 1O94A 2VRMA 1PDYA 3GD6A 4TVWA 4NWZA 3FG2P 1IUXA 2MUCA 2BK5A 3FJ4A 3AM9A 3AWIA 2XLPA 3AEDA 4H2NA 5EBKA 1EL9A 4Z26A 3O0HA 3KUMA 4O5UA 1KSSA 1S3BA 4B69A 1X31B 1QO8A 1MUCA 4IV9A 3AD8B 3LZXA 2DKIA 2VQBA 1PXAA 3SQSA 3SYIA 3CK5A 3CYJA 2H89A 2IVEA 2Q0LA 2R46A 4DWDA 3N6JA 1F9CA 1DJQA 2YG4A 4B64A 4IL2A 3NYEA 1TYPA 2EQ8A 2PU1A 1FIQB 1MXTA 1XANA 5FS7A 3UXKA 4APNA 5EOWA 1L8PA 1PJ7A 2Z5YA 2PHHA 3L1RA 2I0ZA 5M0ZA 4Z25A 2VRLA 4H4WA 4YSXA 1COYA 2W3SA 3FBSA 2Q6UA 3KVEA 3UOXA 4IA5A 4OPDA 1IUWA 2JBVA 2BS4A 3FCPA 4RG3A 4EIPA 1X2GA 4TM3A 1CF3A 3IF9A 3NK0X 4JY2A 3QSSA 5DBJA 1DJNA 2FJBA 3NRZB 5J7XA 1F8WA 3D1CA 2YLTA 4H2QA 4LU6A 1KNRA 3UTFA 3H7VA 2V61A 4GDEA 3UTGA 3ES8A 2OLNA 2PYXA 3AEEA 3UKLA 3AECA 3M13A 4X9NA 5FS6A 5JCKA 4K7ZA 1SEZA 1N63C 5KOXA 5JCMA 1DOCA 2YVGA 2Z5XA 3VR9A 3TJ4A 3GRSA 1TZZA 3ZDNA 5BVAA 2PODA 3AEFA 4PABA 4GYPC 3CB3A 4CNJA 1FFUC 1D7YA 1YKJA 2O56A 3B9JB 2DW7A 2H88A 2WOVA 2OQYA 3NTDA 5KNLA 3QFAA 2PTZA 3I6TA 1MDRA 4Y4LA 4JDRA 2OFJA 2BC0A 2YLXA 1F3PA 3V5CA 2XLSA 4DHGA 3ICSA 3E1TA 1L9DA 1N1PA 1PBEA 2XCGA 1IJHA 4Z1YA 2V60A 3ABVA 4E6MA 1IYXA 1P2HA 2GR0A 5IPYA 1CC2A 2BK3A 3SZWA 2XLRA 3NVWB 3PO7A 2ZBWA 3V3OA 1H83A 3T37A 3PWGA 4Z2UA 2PCEA 1ECQA 1MO9A 5KMSA 2AL2B 1KKOA 5KWFA 4I59A 3TWAA 2OZ3A 4ADWA 2BS3A 1N4UA 2Y6RA 1DXLA 3NG7X 4YTPA 1GALA 2JB3A 2R45A 3NFUA 4OCGA 1BKHA 1TDKA 2QCUA 2XVIA 4OVIA 1FCDA 5BULA 4H4VA 5EB4A 1NG4A 5FMHA 2C67A 1Z6LA 3RP7A 1F8RA 2IIDA 3HYXA 1K0JA 3MWCA 1GRGA 2MNRA 2IVDA 5IQ4A 2XH2A 2GGJA 1ZMCA 2I5QA 4I58A 5HHFA 2GGEA 2BRYA 4TM1A 1F8SA 1GERA 1RP0A 3UJEA 3UCCA 4U2LA 3NKSA 3OZ2A 4AOSA 3GRTA 3IHGA 4IL0A 1R6WA 2A89A 2YLZA 1GRTA 4HCLA 3NNEA 4JY3A 1TRBA 1REOA 1H2IA 3L8KA 2YR4A 5FJOA 3ATQA 3UOVA 4B63A 1RYIA 1EBGA 2GVCA 1FHUA 4A35A 1GETA 3AEGA 3FIMB 5CQFA 3P0WA 4A79A 1GREA 1EC7A 4YWSA 4U8PA 1DOBA 2JB2A 2E1MA 2UZZA 3CT2A 1KNPA 1NG3A 4H7UA 2V6OA 1B4VA 1VDVA 4G7FA 2YLWA 3AYLA 4E0VA 4YTNA 2OG9A 2V3AA 4TVYA 3OZYA 2WOWA 4H4YA 1CC4A 2FJEA 3DA1A 3LOVA 4FI4A 1XHCA 4U8KA 1PBCA 4PAAA 4JQ9A 4J36A 4K5SA 5BRTA 4NTEA 4BV6A 3EEZA 4TM0A 3KA7A 2OKTA 4U8OA 1YQ3A 1S2YA 4EMJA 1EBHA 3V3NA 2WU2A 2GGHA 4TM4A 2R0GA 5KRQA 3SZCA 3NN0X 4GF7A 2RDXA 2HXTA 3GMCA 2XFPA 1JRYA 1PDZA 3D8XA 1Q1RA 4RSLA 1N5WC 3CGBA 2BRAA 3OP2A 1T3QC 3CGDA 3FXGA 1ZK7A 2GRTA 1WUFA 3CGCA 4KPRA 2B7SA 3AE2A 2WETA 3HPFA 2W54A 4CRTA 3SY4A 2P3ZA 3BI2A 5HXIA 3CNJA 1FEBA 2PS2A 1LV0A 4C3XA 1KSUA 2GL5A 3ALMA 2P8CA 2FJAA 2ZC8A 4KWSA 2VVLG 2PTWA 1H7XA 2WPCA 4IP4A 4K8GA 5KMPA 3DJJA 3PS9A 3ALJA 2JB1A 4GISA 4IVOB 3NIXA 2WP5A 6ENLA 3QSEA 3FYYA 4YSYA 2BXSA 3UP4A 1GSNA 4H83A 4KT2A 1IUUA 2CVJA 3T2YA 1JRZA 4AOXA 5JCLA 1B8SA 3MY9A 4UP3A 4ZN0A 3P93A 3ETRB 1KCZA 4J1OA 2XLTA 2POZA 1P43A 3DFYA 3VRDB 1DODA 2XVJA 1N5XA 2GDQA 5KMRA 3NYCA 1Y56A 3TOYA 1CJ4A 2QVHA 1GRFA 3MSYA 4USRA 3EAOA 3KPKA 4GAPA 3S47A 3NT6A 2QQ6A 1TKKA 1KDGA 1CL0A 1F6MA 3UP5A 2ZZBA 4EM4A 1XPYA 4HNLA 4NTDA 1TDOA 2WDVA 2WP9A 1H86A 3RITA 2OA1A 1ZOVA 3TWBA 1CBOA 1L9CA 5HYMA 2YG5A 2XH0A 4B66A 4B68A 3SZFA 4M6UA 4ROPA 1ZX9A 3CAWA 3HYVA 2PGEA 5U25A 3F8RA 2PTXA 2FBWA 2BA9A 3LZWA 3NRNA 2XGZA 1GV4A 3UKPA 4NEVA 2QGYA 7ENLA 4LA1A 4BK1A 4RG4A 1PS9A 3UTEA 3NS1B 3FVDA 2ONEA 2PP3A 5U1OA 3ZLHA 2WHDA 4Y4MA 3T2KA 5GSNA 4ZA0A 4A6NB 4H4RA 2XDOA 4J57A 3GC2A 3UKAA 3JSKA 2X3NA 2GH5A 2AR8A 5GRTA 3UJFA 3CNTA 3GD3A 3S61A 3HW2A 4EQRA 4G73A 3MZNA 2TMDA 5J04A 3UOZA 3UGVA 5LV9A 3CNPA 4K5RA 3QJ4A 5TR3A 2WPEA 1S3EA 2XFOA 2AL1A 4GUVA 3PG6A 3ADAB 4B65A 1NELA 2PA6A 1ONEA 1JRXA 4BJYA 4USQA 2XVHA 3VDGA 4K1WA 5IQ1A 4A9WA 1FECA 2QA2A 5C3JA 1ZMDA 3V3WA 3SN4A 2ARDA 4G6GA 3ZVHA 3I3LA 1BKWA 4IT1A 4G8TA 4X2PA 3P4PA 4Z2TA 5FJPA 3MUCA 2FKPA 3OW1A 3SSZA 3SGLA 3VC5A 3DJDA 2J3NA 1QJDA 3C4AA 1FHVA 3EF6A 1D4EA 5HY5A 3R11A 3PK7A 3QSMA 2WESA 1M6IA 3DFHA 1FL2A 1BQGA 3BNUA 3RR1A 1TDFA 4G6HA 2GAHB 2BYBA 3EANA 3RNMA 2OLAA 2GF3A 1FEAA 3CPIG 1TE6A 2C3DA 1E1LA 5KMQA 4WCTA 1P48A 2BS2A 1XPQA 3BSMA 1ZDLA 2OO6A 5ENLA 2YVFA 3AE5A 1FO4A 3R0KA 3URHA 3DESA 3NXLA 3CN8A 3KD9A 1PN0A 2VZ2A 3AXBA 2XH4A 3NH3X 3VRAA 3HZLA 2GGGA 3P4SA 2VQ7A 2X8CA 3V4BA 4D04A 3VFCA 4AT0A 3FV9A 4H4TA 3I4KA 3M0OA 3SN1A 2YR6A 3AB1A 1H81A 4ZCCA 3CXBA 4GFIA 1GESA 1PBDA 3PVCA 2OVLA 3NO1A 1YEYA 3NYFA 3NLCA 1V59A 4A6NA 4FK1A 2AKZA 4IP5A 3NGCX 1PHHA 2A8XA 5KVHA 4NZHA 2BCPA 1EL5A 3ISHA 3GYXA 4XXGA 1NHQA 1CHUA 3K7TA 3PFRA 3AD9B 2PP1A 3TCSA 2GV8A 4NTCA 1NHRA 4HCHA 2WQYA 1JCTA 1IUSA 2YLSA 4A65A 4X9MA 1OEPA 3RGTA 1OJDA 3CXOA 3DGHA 2PPGA 3SZ0A 3B3RA 3R9UA 4EWJA 4MGGA 3ZVIA 3AE1A 2R4EA 4GMEA 4GCMA 3F8DA 2YQUA 3B97A 2QJJA 2VVMA 4C3YA 5JCNA 1Y56B 3P9UA 5KVIA 3DK9A 3M12A 2XYOA 3CPHG 3T9PA 1GTEA 4BK2A 2TPRA 3GWFA 5BUKA 2JK6A 3EUB3 4H2HA 4X4JA 2P88A 1FOHA 3CIRA 1TDNA 2C7GA 2QA1A 3U9IA 4UDQA 3CNDA 2X8GA 4DSHA 3QN3A 3OPSA 4Z44A 4P9SA 4AP1A 4BK3A 3SQPA 1GRBA 3U4FA 4BURA 2NPXA 3IC9A 1DTNA 3AE4A 2WDRA 4U2TA 1PBBA 1PJ5A 3H70A 2WEUA 3CPJG 3Q9TA 1YY5A 1NHPA 4DGKA 1GT8A 1N62C 3STPA 3C4NA 4H4QA 1JPMA 4YKGA 2WBAA 3DG6A 3IJLA 3UKQA 4JN7A 1GXFA 5JCIA 2YM1A 1K0LA 1PJ6A 3P4RA 2O9ZA 4U8NA 3FMWA 4N9XA 4FK1C 4CNKA 4CY6A 3AEBA 4IZGA 3IK4A 1W4XA 3L5OA 1Y0PA 4U2SA 1GPEA 2C3CA 1KKRA 3NZGA 4CBQA 4HPNA 2ZZ0A 2OQHA 1R0MA 3DERA 1EL7A 3DK4A 1YQ4A 4EQSA 4J56A 2RABA 1KD0A 1ZY8A 3GDNA 3JVAA 1DOEA 1LVLA 3G5SA 4KX6A 4Z43A 3P4QA 3UXLA 4HCDA 1SJCA 4YSHA 3GY1A 3DMEA 1MNSA 4TLZA 1VRQB 1EC9A 4HYRA 1RVKA 3BHFA 2YG6A 1PXCA 3AE7A 1P2EA 2GR2A 3D9XA 1KN0A 1M64A 3R0UA 1H7WA 1LTXR 2Q7VA 3RP8A 1D7LA 3GMBA 3AYIA 4B1BA 2GQFA 1ZOYA 4H2RA 2DW6A 3DDMA 1NEKA 3DJGX 3GWDA 3VR8A 1FFVC 4ZCWA 4C74A 1SJDA 2OZ8A 2WP6A 1AOGA 5G5GB 3K7MX 1LQTA 4M52A 1JROA 3AMZA 4GDPA 2GEWA 4H50A 4EM3A 1ZXIC 2R0PA 4OPIA 1N60C 3VQRA 3ALLA 4GGBA 3TW9A 2R4JA 3RRAA 3P1WA 2C65A 1W6TA 3VRBA 2VOUA 2B9YA 4IVMB 5FJTA 1RM6B 4A3RA 4EQXA 3TQPA 5U63A 4U8LA 2YVJA 3LADA 3B6DA 2C70A 3GYJA 3MQTA 3A7RA 3AN1A 2C73A 2XVFA 3LB8A 3H4KA 3IHMA 3SN0A 4H4XA 3CTYA 2GB0A 3F8PA 5EU9A 2P8BA 2B9XA 2E4GA 4AP3A 3DGBA 1JRPA 3R10A 2GR3A 2GMHA 4A5LA 2P0IA 1NPXA 4CCQA 3UJSA 1PXBA 2FYMA 3FPZA 3BHKA 2E5AA 4NEWA 2OX4A 2X99A 5FS9A 4KPLA 4JNQA 4BJZA 4M0XA 1XS2A 3V5FA 3RCYA 3GO2A 1D4CA 2JKCA 3JW7A 3UTHA 1OJAA 2XFUA 1BGJA 4UDRA 3C96A 3S5SA 3I6DA 3QPEA 2C76A 3MKCA 5KXJA 3ICRA 3DG3A 3CMMA 3ES7A 3P3BA 2YG3A 1VDCA 3S5WA 2F5ZA 3TJIA 2RGJA 4II2A 1SJBA 2PMQA 1B5QA 3IJIA 1K0IA 4YTMA 4DNAA 3HRDC 1MRAA 4IHCA 1QLBA 1ELIA 1H82A 3ZLFA 2OLOA 2C66A 2APGA 1GTHA 3T8QA 1GNDA 4A7AA 2WPFA 4ZCDA 4C5OA 2QJNA 2OAMA 3I6EA 3BJSA 1N61C 2GQWA 1CJ2A 3AD7B 3LJPA 5C2TA 5J60A 2EQ7A 2AAQA 2PP0A 4U8JA 4ICYA 3BI4A 2PGWA 4JNAA 2R0CA 3H8AA 1GEUA 3K30A 2ZADA 3UCLA 3ZYXA 3BI5A 4YWOA 5JRBA 2GAGB 3NVVB 3R07C 4G74A 1OJCA 4CCRA 3QKEA 4GRTA 2XLUA 4AT2A 2W0HA 4A6GA 3COXA 5IDZA 2BC1A 3QFBA 2JAEA 3AE8A 4YT0A 1JOAA 4J33A 1PDHA 5FS8A 4H19A 1RSGA 2WOIA 1SB3B 2GMJA 2PSNA 5M10A 1NHSA 4E8GA 1WUEA 2A87A 2C64A 4OPLA 3RO6A 3AEAA 2E3TA 2R9ZA 3SBFA 3NK2X 1H84A 3PWIA 1VQZA 3H12A 1BGNA 4HN8A 1NU5A 1VG9A 4KEMA 4HB9A 1JEHA 1LPFA 5CKUA 1D4DA 1JNRA 4GIRA 1E1MA 2AQJA 3QVPA 4K8DA 1L0VA 3WE0A 1NENA 4YXDA 3T4WA 1SJAA 3VCCA 2WU5A 2C72A 1MDLA 4OPCA 2BK4A 3UKKA 3UJRA 1K4QA 4OPUA 2AL2A 3H8LA 3NTAA 1EBDA 5G5HB 3UKFA 3LXDA 4H2PA 2X8HA 4G9KA 3JZUA 1LJ1A 2BXRA 1N4VA 4Y4NA 3II4A 1BWCA 1LQUA 3R1ZA 2GGIA 3V76A 4Z2RA 1D5TA 3AE6A 1NAAA 3QVRA 1Q9IA 1O95A 1O5WA 1VQWA 2HXUA 2ZZCA 3ZVHB 4ENLA 3AE3A 4EMWA 2BABA 3VCNA 1S7MA 2OALA 2XVEA 2EQ6A 1E7PA 3UCDA 1ELSA 4K22A 3GYIA 1E39A 3IWAA 4DN1A 4E5TA 4FP1A 4MJWA 3ITJA 1EL8A 2HZGA 2QJMA 2OZTA 5FJRA 4XWRA 4DSGA 4J34A 1V97A 3R25A 3Q4DA 3SXIA 2V5ZA 3SR6B 4FDCB 1ONFA 3KKJA 1BF3A 5BOEA 4H4SA 2X50A 3N4EA 2ACZA 1E1KA 5KOWA 4K2XA 1PBFA 4GAVA 3NK1X 2YAUA 4E4FA 2B76A 1JPDX 4F4RA 2YR5A 1ZKQA 3N6HA 2XFQA 3Q45A 1Q1WA 1JNZA 5EB5A 1OJ9A 3DK8A 1BZLA 3OTRA 3EKGA 2HQMA 2W55A 2B7RA 1IUVA 3UKHA 3GDPA 3VA8A 4FX9A 4XWZA 3KPFA 1WYGA 4D03A 4REKA 3G5QA 2C75A 3BNMA 2VVLA 4Z24A 1VG0A 4HA6A 2XFNA 4MMWA 4H4PA 3A7AA 3DEQA 1EC8A 3DH9A 1GRHA 1H6VA 3BOXA 4DX3A 2CDUA 4TLXA 4GGHA 4HNCA 4B67A 4NNJA 3KLJA 3RP6A 2YM2A 3DG7A 4J2WA 2CHRA 4EQWA 2WS3A 3REDA 2EQ9A 5ER0A 2PU0A 4EIQA 1DNCA 4E4UA 2PTYA 5FJUA 4DXKA 4Z17A 4ZOHB 4II3A 4WX1A 3OC4A 2GSHA 3H8IA 4O5QA 1N4WA 1NDAA 1IUTA 2Q0KA 1JDFA 1TYTA 1STZA 4JN9A 3IJQA 2W3RA 3D46A 3ENLA 4JN8A 3DJEA 3T0KA 1L9EA 3SX6A
chains in the Genus database with same CATH topology
2C76A 1H81A 4ZCCA 5KXJA 4I58A 4ECHA 5HHFA 2Y6QA 2BRYA 2BCGG 4TM1A 3ICRA 1GESA 1F8SA 1GERA 1RP0A 3CMMA 1PBDA 4U2LA 3NKSA 2BACA 3OZ2A 3PVCA 4AOSA 3GRTA 3IHGA 2YG3A 2YLRA 3CNSA 2A89A 2YLZA 1VDCA 3NYFA 3S5WA 1GRTA 2F5ZA 3NLCA 3NNEA 2RGJA 4JY3A 4II2A 1TRBA 1HYUA 4OPGA 2V3BA 1REOA 1H2IA 4YKFA 1V59A 3L8KA 1B5QA 4H4ZA 2YR4A 3ATQA 3GMCA 3UOVA 4A6NA 4B63A 1RYIA 4A99A 2QAEA 4FK1A 1K0IA 1UKVG 2E5VA 4YTMA 3T31A 2GVCA 4DNAA 3NGCX 3UOYA 1PHHA 1GETA 2A8XA 3AEGA 3FIMB 5CQFA 4A79A 1QLBA 4J31A 1GREA 1ELIA 1H82A 5KVHA 4NZHA 2OLOA 3DGZA 2BCPA 1EL5A 2C66A 3GD4A 4U8PA 3ISHA 1DOBA 2JB2A 3GYXA 4C77A 2APGA 1GTHA 2E1MA 4XXGA 1NHQA 1OJTA 1GRAA 1CHUA 1E1NA 1GNDA 2UZZA 3K7TA 2WPFA 4ZCDA 4A7AA 4C5OA 3AD9B 3RHAA 2RGHA 1KNPA 1NG3A 4H7UA 2V6OA 2OAMA 4EMIA 1B4VA 2GV8A 2YLWA 4NTCA 3AYLA 1NHRA 4YSZA 4E0VA 4YTNA 2GQWA 2V3AA 2WQYA 3ATRA 1CJ2A 3SFEA 4GR1A 2WOWA 4H4YA 1CC4A 2FJEA 3AD7B 4LIIA 3DA1A 3LJPA 3LOVA 1IUSA 2YLSA 1XHCA 4U8KA 5C2TA 5J60A 4A65A 2EQ7A 2AAQA 4X9MA 2B9WA 4U8JA 5L46A 4U8IA 1PBCA 2NVKX 4ICYA 4JQ9A 4PAAA 4OPTA 4J36A 4K5SA 5BRTA 3BI4A 4NTEA 4BV6A 1OJDA 3DGHA 4JNAA 1E6EA 4TM0A 2R0CA 3KA7A 3SZ0A 4U8OA 3B3RA 3R9UA 1YQ3A 1S2YA 4EMJA 1CC6A 3V3NA 2WU2A 1GEUA 3G5RA 3K30A 3AE9A 3AE1A 3UCLA 2CULA 2R4EA 4TM4A 2R0GA 5KRQA 4GCMA 4H4UA 3SZCA 1XDIA 3ZYXA 3F8DA 1B37A 3NN0X 4GF7A 4CY8A 4YWOA 5JRBA 2GAGB 3BI5A 2YQUA 1CJ3A 1JRYA 1ZP0A 2XFPA 2YG7A 1S2QA 3SM8A 2VVMA 1CJCA 2DKHA 5JCNA 1Y56B 3D8XA 3P9UA 3T14A 5KVIA 4C3YA 1Q1RA 4RSLA 3DK9A 1MOKA 4G74A 3CGBA 1OJCA 4CCRA 2BRAA 3M12A 1JU2A 2XYOA 2RGOA 3CPHG 3HYWA 2C4CA 4GRTA 2XLUA 2CFYA 4U8MA 3CGDA 3CGEA 3EPTA 1GTEA 3AYJA 4AT2A 2W0HA 4BK2A 1ZK7A 2TPRA 3GWFA 2GRTA 3CGCA 5BUKA 4KPRA 2JK6A 3COXA 2B7SA 2BC1A 3QFBA 2JAEA 3Q6JA 2WETA 3AE8A 3AE2A 3T2ZA 4YT0A 4X4JA 1FOHA 3CIRA 4CRTA 1TDNA 3SY4A 1JOAA 3KU9A 2C7GA 2QA1A 3BI2A 4J33A 5HXIA 3CNJA 1PDHA 4UDQA 3CNDA 5FS8A 2X8GA 1FEBA 1RSGA 3ICTA 1YQZA 4DSHA 1LV0A 2WOIA 3NHOX 1KFYA 4Z44A 1GOSA 4IA6A 1KSUA 2FJDA 4C3XA 4P9SA 3SFDA 2GMJA 3ALMA 3NN6X 4UDPA 5M10A 2GR1A 2FJAA 1NHSA 4AP1A 3SQPA 4BK3A 1GRBA 2A87A 2C64A 4BURA 1TDEA 2VVLG 3K7QX 4OPLA 1H7XA 1KF6A 2WDQA 3GSIA 2NPXA 2WPCA 3IC9A 1O94A 2YWLA 3AEAA 5KMPA 2VRMA 3DJJA 2R9ZA 3NK2X 3PS9A 3ALJA 3AE4A 1H84A 4NWZA 2JB1A 3FG2P 2WDRA 1IUXA 4U2TA 1BGNA 1PBBA 1VG9A 2BK5A 1PJ5A 4IVOB 3NIXA 2WP5A 3QSEA 4HB9A 1JEHA 2XLPA 3AWIA 3AEDA 1LPFA 4H2NA 2BXSA 2WEUA 4YSYA 5EBKA 5CKUA 1D4DA 3CPJG 1EL9A 1JNRA 3Q9TA 3UP4A 3O0HA 1YY5A 1E1MA 1NHPA 1GSNA 2AQJA 1IUUA 1KSSA 3QVPA 4O5UA 4DGKA 4K8DA 2CVJA 1L0VA 3T2YA 1GT8A 1JRZA 3WE0A 4AOXA 5JCLA 1NENA 1S3BA 4B69A 4YXDA 1X31B 1B8SA 3C4NA 4H4QA 1QO8A 4UP3A 4ZN0A 4IV9A 4YKGA 2WU5A 2C72A 2WBAA 3AD8B 4OPCA 2BK4A 3LZXA 2DKIA 2VQBA 2XLTA 3UKQA 1PXAA 3UKKA 3SYIA 1GXFA 5JCIA 1K4QA 2H89A 2YM1A 1K0LA 3VRDB 4OPUA 1PJ6A 3P4RA 1DODA 2O9ZA 2XVJA 4U8NA 2IVEA 2Q0LA 3H8LA 2R46A 3FMWA 3NTAA 1EBDA 3UKFA 4N9XA 4FK1C 4CNKA 5KMRA 3LXDA 4H2PA 3NYCA 1Y56A 4CY6A 2X8HA 1DJQA 2YG4A 4G9KA 1CJ4A 4B64A 3NYEA 3AEBA 1TYPA 2EQ8A 1GRFA 1W4XA 4USRA 3L5OA 3EAOA 1XANA 5FS7A 1MXTA 1Y0PA 3KPKA 4U2SA 4GAPA 1LJ1A 4APNA 2BXRA 1GPEA 2C3CA 5EOWA 1PJ7A 3NT6A 1N4VA 4CBQA 1KDGA 4Y4NA 3II4A 2Z5YA 2PHHA 3L1RA 2I0ZA 5M0ZA 4Z25A 2ZZ0A 1CL0A 1F6MA 2VRLA 1BWCA 3UP5A 1LQUA 2ZZBA 4H4WA 4EM4A 4YSXA 3V76A 4Z2RA 1COYA 3FBSA 4NTDA 1D5TA 1TDOA 2WDVA 3AE6A 1NAAA 2Q6UA 3KVEA 3UOXA 3QVRA 2WP9A 1Q9IA 1H86A 4IA5A 1IUWA 1O95A 4OPDA 1O5WA 1EL7A 2OA1A 3DK4A 1YQ4A 4EQSA 2ZZCA 1VQWA 2BS4A 2JBVA 4J56A 4RG3A 1ZOVA 1CBOA 4EIPA 2RABA 3GDNA 1ZY8A 1L9CA 1DOEA 3AE3A 1LVLA 5HYMA 4EMWA 2BABA 3G5SA 4TM3A 2YG5A 4KX6A 4Z43A 1CF3A 3IF9A 4B66A 4B68A 1S7MA 3NK0X 2OALA 3P4QA 3QSSA 4JY2A 3SZFA 5DBJA 2XVEA 2EQ6A 1E7PA 1DJNA 2FJBA 1ZX9A 4YSHA 3HYVA 4K22A 3DMEA 3GYIA 5U25A 4TLZA 1F8WA 3D1CA 1VRQB 3F8RA 5J7XA 2FBWA 2YLTA 1E39A 4H2QA 2BA9A 3IWAA 4LU6A 3LZWA 1KNRA 3NRNA 3BHFA 1GV4A 2YG6A 3UKPA 3UTFA 4MJWA 3ITJA 1EL8A 1PXCA 3AE7A 4NEVA 2V61A 1P2EA 2GR2A 3D9XA 1KN0A 1M64A 4GDEA 4XWRA 3UTGA 4LA1A 4BK1A 1H7WA 4RG4A 1LTXR 2OLNA 1PS9A 2PYXA 2Q7VA 3UTEA 4DSGA 3AEEA 5U1OA 3T2KA 2WHDA 4Y4MA 3UKLA 4J34A 3AECA 5GSNA 3RP8A 3M13A 4X9NA 3SXIA 1D7LA 3GMBA 5FS6A 3AYIA 5JCKA 2GQFA 2V5ZA 4K7ZA 1ZOYA 1SEZA 4H4RA 2XDOA 4J57A 4A6NB 4B1BA 4FDCB 5KOXA 1ONFA 3UKAA 3KKJA 5JCMA 1BF3A 1DOCA 2YVGA 2X3NA 3JSKA 2Z5XA 4H2RA 4H4SA 3VR9A 2GH5A 2X50A 1NEKA 2ACZA 2AR8A 3GRSA 5GRTA 3CNTA 1E1KA 3ZDNA 5KOWA 3GD3A 3DJGX 3S61A 3GWDA 4K2XA 5BVAA 4EQRA 1PBFA 3VR8A 4G73A 2TMDA 3AEFA 4GAVA 4PABA 3NK1X 2YAUA 3UOZA 4C74A 5LV9A 2B76A 2WP6A 3CNPA 1AOGA 4K5RA 3QJ4A 4CNJA 3K7MX 1D7YA 1LQTA 2YR5A 1ZKQA 4M52A 2WPEA 5TR3A 1YKJA 2XFQA 1S3EA 2XFOA 1Q1WA 1JNZA 4GUVA 3PG6A 1OJ9A 2H88A 5EB5A 3ADAB 3DK8A 4GDPA 1BZLA 2GEWA 2WOVA 4B65A 2HQMA 4H50A 3NTDA 1JRXA 5KNLA 3QFAA 4BJYA 4EM3A 4USQA 2R0PA 2XVHA 4OPIA 2B7RA 1IUVA 5IQ1A 3VQRA 3UKHA 4A9WA 4Y4LA 1FECA 4JDRA 2QA2A 3GDPA 5C3JA 1ZMDA 2BC0A 3ALLA 2ARDA 4G6GA 2R4JA 2YLXA 3P1WA 3I3LA 1BKWA 1F3PA 4FX9A 4XWZA 3KPFA 2C65A 2XLSA 3P4PA 3VRBA 4D03A 2VOUA 4REKA 4Z2TA 2B9YA 3G5QA 2C75A 3ICSA 3BNMA 3E1TA 4IVMB 2VVLA 4EQXA 4Z24A 1L9DA 1N1PA 1PBEA 1VG0A 4HA6A 3SGLA 5U63A 2XCGA 3DJDA 4U8LA 2YVJA 1IJHA 2XFNA 2J3NA 4H4PA 1QJDA 3C4AA 3LADA 3DH9A 1GRHA 2C70A 3B6DA 3GYJA 1H6VA 2V60A 3EF6A 3ABVA 1D4EA 5HY5A 3QSMA 2CDUA 2C73A 2WESA 2XVFA 3LB8A 4TLXA 1P2HA 2GR0A 4B67A 5IPYA 1M6IA 1CC2A 2BK3A 4NNJA 3SZWA 2XLRA 3PO7A 2ZBWA 3V3OA 3H4KA 1H83A 3T37A 3IHMA 1FL2A 4Z2UA 3BNUA 1TDFA 4H4XA 4G6HA 3KLJA 2GAHB 3RP6A 2YM2A 2BYBA 3EANA 3RNMA 1MO9A 2GF3A 3CTYA 2GB0A 3F8PA 5KMSA 1FEAA 3CPIG 5KWFA 2C3DA 2B9XA 1E1LA 2E4GA 4I59A 5KMQA 4ADWA 4J2WA 4WCTA 4AP3A 2BS2A 4EQWA 1N4UA 2BS3A 2Y6RA 1XPQA 1DXLA 2WS3A 3REDA 3NG7X 2EQ9A 1ZDLA 4YTPA 5ER0A 4EIQA 1DNCA 2YVFA 1GALA 2JB3A 3AE5A 2GR3A 2GMHA 2R45A 4OCGA 4A5LA 1NPXA 3URHA 4CCQA 1TDKA 1PXBA 3CN8A 4II3A 4WX1A 3OC4A 2QCUA 3H8IA 4O5QA 1N4WA 2XVIA 3FPZA 4OVIA 1NDAA 1IUTA 3BHKA 3KD9A 2Q0KA 1PN0A 1TYTA 4NEWA 2VZ2A 2X99A 5FS9A 4JN9A 1FCDA 3AXBA 5BULA 3NH3X 4JNQA 3HZLA 3VRAA 4BJZA 4H4VA 5EB4A 3P4SA 2VQ7A 2X8CA 5FMHA 1NG4A 2C67A 1Z6LA 4D04A 2JKCA 1D4CA 1F8RA 2IIDA 3RP7A 3UTHA 3HYXA 1K0JA 3DJEA 4Z26A 1OJAA 4AT0A 1GRGA 2XFUA 3T0KA 4H4TA 1BGJA 2IVDA 5IQ4A 3M0OA 1ZMCA 4UDRA 2YR6A 1L9EA 3C96A 3AB1A 3I6DA 3SX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C76 A;  1H81 A;  4ZCC A;  5KXJ A;  4I58 A;  4ECH A;  5HHF A;  2Y6Q A;  4TM1 A;  2BCG G;  3ICR A;  1GES A;  1F8S A;  1GER A;  1RP0 A;  1PBD A;  4U2L A;  3NKS A;  2BAC A;  3OZ2 A;  3PVC A;  4AOS A;  3GRT A;  3IHG A;  2YG3 A;  2YLR A;  3CNS A;  2A89 A;  2YLZ A;  1VDC A;  3NYF A;  3S5W A;  1GRT A;  2F5Z A;  3NLC A;  3NNE A;  2RGJ A;  4JY3 A;  1TRB A;  1HYU A;  4OPG A;  2V3B A;  1REO A;  4YKF A;  1V59 A;  3L8K A;  1B5Q A;  4H4Z A;  2YR4 A;  3ATQ A;  3UOV A;  4A6N A;  4B63 A;  1RYI A;  4A99 A;  2QAE A;  4FK1 A;  1K0I A;  1UKV G;  2E5V A;  4YTM A;  2GVC A;  4DNA A;  3NGC X;  3UOY A;  1PHH A;  1GET A;  2A8X A;  3AEG A;  3FIM B;  5CQF A;  4A79 A;  1QLB A;  4J31 A;  1GRE A;  1ELI A;  1H82 A;  5KVH A;  4NZH A;  2OLO A;  3DGZ A;  2BCP A;  1EL5 A;  2C66 A;  3GD4 A;  4U8P A;  3ISH A;  1DOB A;  2JB2 A;  4C77 A;  2APG A;  1GTH A;  2E1M A;  4XXG A;  1NHQ A;  1OJT A;  1GRA A;  1CHU A;  1E1N A;  1GND A;  2UZZ A;  3K7T A;  2WPF A;  4ZCD A;  4A7A A;  4C5O A;  3AD9 B;  3RHA A;  2RGH A;  1KNP A;  1NG3 A;  4H7U A;  2V6O A;  2OAM A;  4EMI A;  1B4V A;  2GV8 A;  2YLW A;  4NTC A;  3AYL A;  1NHR A;  4YSZ A;  4E0V A;  4YTN A;  2GQW A;  2V3A A;  2WQY A;  3ATR A;  1CJ2 A;  3SFE A;  4GR1 A;  2WOW A;  4H4Y A;  1CC4 A;  2FJE A;  3AD7 B;  4LII A;  3DA1 A;  3LJP A;  3LOV A;  1IUS A;  2YLS A;  1XHC A;  4U8K A;  5C2T A;  5J60 A;  4A65 A;  2EQ7 A;  2AAQ A;  4X9M A;  2B9W A;  4U8J A;  5L46 A;  4U8I A;  1PBC A;  2NVK X;  4ICY A;  4JQ9 A;  4PAA A;  4OPT A;  4J36 A;  4K5S A;  5BRT A;  3BI4 A;  4NTE A;  4BV6 A;  1OJD A;  3DGH A;  4JNA A;  1E6E A;  4TM0 A;  2R0C A;  3KA7 A;  4U8O A;  3B3R A;  3R9U A;  1YQ3 A;  1S2Y A;  4EMJ A;  1CC6 A;  3V3N A;  2WU2 A;  1GEU A;  3G5R A;  3K30 A;  3AE9 A;  3AE1 A;  3UCL A;  2CUL A;  2R4E A;  4TM4 A;  2R0G A;  5KRQ A;  4GCM A;  4H4U A;  1XDI A;  3ZYX A;  3F8D A;  1B37 A;  3NN0 X;  4GF7 A;  4CY8 A;  4YWO A;  3BI5 A;  2GAG B;  3GMC A;  2YQU A;  1CJ3 A;  1JRY A;  1ZP0 A;  2XFP A;  2YG7 A;  1S2Q A;  3SM8 A;  2VVM A;  1CJC A;  2DKH A;  5JCN A;  1Y56 B;  3D8X A;  3P9U A;  4C3Y A;  5KVI A;  1Q1R A;  4RSL A;  3DK9 A;  1MOK A;  3CGB A;  1OJC A;  4CCR A;  3M12 A;  1JU2 A;  2XYO A;  2RGO A;  3CPH G;  4GRT A;  2XLU A;  2CFY A;  4U8M A;  3CGD A;  3CGE A;  3EPT A;  1GTE A;  3AYJ A;  4AT2 A;  2W0H A;  4BK2 A;  1ZK7 A;  2TPR A;  3GWF A;  2GRT A;  3CGC A;  5BUK A;  4KPR A;  2JK6 A;  3COX A;  2B7S A;  2BC1 A;  3QFB A;  2JAE A;  3Q6J A;  2WET A;  3AE8 A;  3AE2 A;  4YT0 A;  4X4J A;  1FOH A;  3CIR A;  4CRT A;  1TDN A;  1JOA A;  3KU9 A;  2C7G A;  2QA1 A;  3BI2 A;  4J33 A;  5HXI A;  3CNJ A;  1PDH A;  4UDQ A;  3CND A;  5FS8 A;  2X8G A;  1FEB A;  1RSG A;  3ICT A;  1YQZ A;  4DSH A;  1LV0 A;  2WOI A;  3NHO X;  1KFY A;  4Z44 A;  1GOS A;  4IA6 A;  1KSU A;  2FJD A;  4C3X A;  4P9S A;  3SFD A;  2GMJ A;  3ALM A;  3NN6 X;  4UDP A;  5M10 A;  2GR1 A;  2FJA A;  1NHS A;  4AP1 A;  3SQP A;  4BK3 A;  1GRB A;  2A87 A;  2C64 A;  4BUR A;  1TDE A;  2VVL G;  3K7Q X;  4OPL A;  1H7X A;  1KF6 A;  2WDQ A;  3GSI A;  2NPX A;  2WPC A;  3IC9 A;  1O94 A;  2YWL A;  3AEA A;  2VRM A;  3DJJ A;  2R9Z A;  3NK2 X;  3PS9 A;  3ALJ A;  3AE4 A;  1H84 A;  2JB1 A;  3FG2 P;  2WDR A;  1IUX A;  4U2T A;  1BGN A;  1PBB A;  1VG9 A;  2BK5 A;  1PJ5 A;  4IVO B;  3NIX A;  2WP5 A;  3QSE A;  4HB9 A;  1JEH A;  2XLP A;  3AWI A;  3AED A;  1LPF A;  4H2N A;  2BXS A;  2WEU A;  4YSY A;  5EBK A;  5CKU A;  1D4D A;  3CPJ G;  1EL9 A;  1JNR A;  3Q9T A;  3UP4 A;  3O0H A;  1YY5 A;  1E1M A;  1NHP A;  1GSN A;  2AQJ A;  1IUU A;  1KSS A;  3QVP A;  4O5U A;  4DGK A;  4K8D A;  2CVJ A;  1L0V A;  1GT8 A;  1JRZ A;  3WE0 A;  4AOX A;  5JCL A;  1NEN A;  1S3B A;  4B69 A;  4YXD A;  1X31 B;  1B8S A;  3C4N A;  4H4Q A;  1QO8 A;  4UP3 A;  4ZN0 A;  4IV9 A;  4YKG A;  2WU5 A;  2C72 A;  2WBA A;  3AD8 B;  4OPC A;  2BK4 A;  3LZX A;  2DKI A;  2VQB A;  2XLT A;  3UKQ A;  1PXA A;  3UKK A;  1GXF A;  5JCI A;  1K4Q A;  2H89 A;  2YM1 A;  1K0L A;  3VRD B;  4OPU A;  1PJ6 A;  3P4R A;  1DOD A;  2O9Z A;  2XVJ A;  4U8N A;  2IVE A;  2Q0L A;  3H8L A;  2R46 A;  3FMW A;  3NTA A;  1EBD A;  3UKF A;  4N9X A;  4FK1 C;  4CNK A;  3LXD A;  4H2P A;  3NYC A;  1Y56 A;  4CY6 A;  2X8H A;  1DJQ A;  2YG4 A;  4B64 A;  1CJ4 A;  3NYE A;  3AEB A;  1TYP A;  2EQ8 A;  1GRF A;  1W4X A;  4USR A;  3EAO A;  1XAN A;  5FS7 A;  1MXT A;  1Y0P A;  4U2S A;  1LJ1 A;  4APN A;  2BXR A;  1GPE A;  2C3C A;  5EOW A;  1PJ7 A;  3NT6 A;  1N4V A;  4CBQ A;  1KDG A;  4Y4N A;  3II4 A;  2Z5Y A;  2PHH A;  3L1R A;  2I0Z A;  5M0Z A;  4Z25 A;  2ZZ0 A;  1CL0 A;  1F6M A;  2VRL A;  1BWC A;  3UP5 A;  1LQU A;  2ZZB A;  4H4W A;  4EM4 A;  4YSX A;  3V76 A;  4Z2R A;  1COY A;  3FBS A;  4NTD A;  1D5T A;  1TDO A;  2WDV A;  3AE6 A;  1NAA A;  2Q6U A;  3KVE A;  3UOX A;  3QVR A;  2WP9 A;  1Q9I A;  1H86 A;  4IA5 A;  1IUW A;  1O95 A;  4OPD A;  1O5W A;  1EL7 A;  2OA1 A;  3DK4 A;  1YQ4 A;  4EQS A;  2ZZC A;  1VQW A;  2BS4 A;  2JBV A;  4J56 A;  4RG3 A;  1ZOV A;  1CBO A;  4EIP A;  2RAB A;  3GDN A;  1ZY8 A;  1L9C A;  1DOE A;  3AE3 A;  1LVL A;  5HYM A;  4EMW A;  2BAB A;  3G5S A;  4TM3 A;  2YG5 A;  4KX6 A;  4Z43 A;  1CF3 A;  3IF9 A;  4B66 A;  4B68 A;  3NK0 X;  2OAL A;  3P4Q A;  3QSS A;  4JY2 A;  5DBJ A;  2XVE A;  2EQ6 A;  1E7P A;  1DJN A;  2FJB A;  1ZX9 A;  4YSH A;  4K22 A;  3DME A;  3GYI A;  5U25 A;  4TLZ A;  1F8W A;  3D1C A;  1VRQ B;  3F8R A;  5J7X A;  2FBW A;  2YLT A;  1E39 A;  4H2Q A;  2BA9 A;  3IWA A;  4LU6 A;  3LZW A;  1KNR A;  3NRN A;  3BHF A;  1GV4 A;  2YG6 A;  3UKP A;  3UTF A;  4MJW A;  3ITJ A;  1EL8 A;  1PXC A;  3AE7 A;  4NEV A;  2V61 A;  1P2E A;  2GR2 A;  1M64 A;  4GDE A;  4XWR A;  3UTG A;  4LA1 A;  4BK1 A;  1H7W A;  4RG4 A;  1LTX R;  2OLN A;  1PS9 A;  2PYX A;  2Q7V A;  3UTE A;  4DSG A;  3AEE A;  5U1O A;  2WHD A;  4Y4M A;  3UKL A;  4J34 A;  3AEC A;  5GSN A;  3RP8 A;  3M13 A;  4X9N A;  1D7L A;  3GMB A;  5FS6 A;  3AYI A;  5JCK A;  2GQF A;  2V5Z A;  4K7Z A;  1ZOY A;  1SEZ A;  4H4R A;  2XDO A;  4J57 A;  4A6N B;  4B1B A;  4FDC B;  5KOX A;  1ONF A;  3UKA A;  3KKJ A;  5JCM A;  1BF3 A;  1DOC A;  2YVG A;  2X3N A;  3JSK A;  2Z5X A;  4H2R A;  4H4S A;  3VR9 A;  2GH5 A;  2X50 A;  1NEK A;  2ACZ A;  2AR8 A;  3GRS A;  5GRT A;  3CNT A;  1E1K A;  3ZDN A;  5KOW A;  3GD3 A;  3DJG X;  3S61 A;  3GWD A;  4K2X A;  5BVA A;  4EQR A;  1PBF A;  3VR8 A;  2TMD A;  3AEF A;  4PAB A;  3NK1 X;  2YAU A;  3UOZ A;  4C74 A;  5LV9 A;  2B76 A;  2WP6 A;  3CNP A;  1AOG A;  4K5R A;  3QJ4 A;  4CNJ A;  3K7M X;  1D7Y A;  1LQT A;  2YR5 A;  1ZKQ A;  4M52 A;  2WPE A;  5TR3 A;  1YKJ A;  2XFQ A;  1S3E A;  2XFO A;  1Q1W A;  1JNZ A;  4GUV A;  1OJ9 A;  2H88 A;  5EB5 A;  3ADA B;  3DK8 A;  4GDP A;  1BZL A;  2GEW A;  2WOV A;  4B65 A;  2HQM A;  4H50 A;  3NTD A;  1JRX A;  3QFA A;  4BJY A;  4EM3 A;  4USQ A;  2R0P A;  2XVH A;  4OPI A;  2B7R A;  1IUV A;  5IQ1 A;  3VQR A;  3UKH A;  4A9W A;  4Y4L A;  1FEC A;  4JDR A;  2QA2 A;  3GDP A;  5C3J A;  1ZMD A;  2BC0 A;  3ALL A;  2ARD A;  2R4J A;  2YLX A;  3P1W A;  3I3L A;  1BKW A;  1F3P A;  4FX9 A;  4XWZ A;  3KPF A;  2C65 A;  2XLS A;  3P4P A;  3VRB A;  4D03 A;  2VOU A;  4REK A;  4Z2T A;  2B9Y A;  3G5Q A;  2C75 A;  3ICS A;  3BNM A;  3E1T A;  4IVM B;  2VVL A;  4EQX A;  4Z24 A;  1L9D A;  1N1P A;  1PBE A;  1VG0 A;  4HA6 A;  3SGL A;  5U63 A;  2XCG A;  3DJD A;  4U8L A;  2YVJ A;  1IJH A;  2XFN A;  2J3N A;  4H4P A;  1QJD A;  3C4A A;  3LAD A;  3DH9 A;  1GRH A;  2C70 A;  3B6D A;  3GYJ A;  1H6V A;  2V60 A;  3EF6 A;  3ABV A;  1D4E A;  5HY5 A;  3QSM A;  2CDU A;  2C73 A;  2WES A;  2XVF A;  3LB8 A;  4TLX A;  1P2H A;  2GR0 A;  4B67 A;  5IPY A;  1M6I A;  1CC2 A;  2BK3 A;  2XLR A;  3PO7 A;  2ZBW A;  3V3O A;  3H4K A;  1H83 A;  3T37 A;  3IHM A;  1FL2 A;  4Z2U A;  3BNU A;  1TDF A;  4H4X A;  3KLJ A;  2GAH B;  3RP6 A;  2YM2 A;  2BYB A;  3EAN A;  3RNM A;  1MO9 A;  2GF3 A;  3CTY A;  2GB0 A;  3F8P A;  1FEA A;  3CPI G;  5KWF A;  2C3D A;  2B9X A;  1E1L A;  2E4G A;  4I59 A;  4ADW A;  4J2W A;  4WCT A;  4AP3 A;  2BS2 A;  4EQW A;  1N4U A;  2BS3 A;  2Y6R A;  1XPQ A;  1DXL A;  2WS3 A;  3RED A;  3NG7 X;  2EQ9 A;  1ZDL A;  4YTP A;  5ER0 A;  4EIQ A;  1DNC A;  2YVF A;  1GAL A;  2JB3 A;  3AE5 A;  2GR3 A;  2GMH A;  2R45 A;  4OCG A;  4A5L A;  1NPX A;  3URH A;  4CCQ A;  1TDK A;  1PXB A;  3CN8 A;  4WX1 A;  3OC4 A;  2QCU A;  3H8I A;  4O5Q A;  1N4W A;  2XVI A;  3FPZ A;  4OVI A;  1NDA A;  1IUT A;  3BHK A;  3KD9 A;  2Q0K A;  1PN0 A;  1TYT A;  4NEW A;  2VZ2 A;  2X99 A;  5FS9 A;  4JN9 A;  1FCD A;  3AXB A;  5BUL A;  3NH3 X;  4JNQ A;  3HZL A;  3VRA A;  4BJZ A;  4H4V A;  5EB4 A;  3P4S A;  2VQ7 A;  2X8C A;  5FMH A;  1NG4 A;  2C67 A;  1Z6L A;  4D04 A;  2JKC A;  1D4C A;  1F8R A;  2IID A;  3RP7 A;  3UTH A;  1K0J A;  3DJE A;  4Z26 A;  1OJA A;  4AT0 A;  1GRG A;  2XFU A;  4H4T A;  1BGJ A;  2IVD A;  5IQ4 A;  3M0O A;  1ZMC A;  4UDR A;  2YR6 A;  1L9E A;  3C96 A;  3AB1 A;  3I6D A; 
#chains in the Genus database with same CATH topology
 3UJ2 A;  4ECH A;  2Y6Q A;  1E9I A;  2BCG G;  2BAC A;  2YLR A;  3CNS A;  1HYU A;  4OPG A;  2V3B A;  4YKF A;  3TTE A;  4H4Z A;  4A99 A;  2QAE A;  1UKV G;  2E5V A;  3T31 A;  3UOY A;  4J31 A;  4J3Z A;  3SJN A;  3DGZ A;  3GD4 A;  4C77 A;  5BOF A;  2AKM A;  1OJT A;  1GRA A;  1E1N A;  2QDE A;  3VC6 A;  2RGH A;  3RHA A;  4EMI A;  2OPJ A;  4YSZ A;  3N4F A;  3T6C A;  2NQL A;  3ATR A;  3A7U A;  3SFE A;  4GR1 A;  4H1Z A;  4LII A;  2B9W A;  5L46 A;  4U8I A;  2NVK X;  4OPT A;  3QTP A;  3DIP A;  1E6E A;  1CC6 A;  2XH7 A;  3G5R A;  2XSX A;  3AE9 A;  2CUL A;  3THU A;  4H4U A;  1XDI A;  3QLD A;  1B37 A;  4CY8 A;  4JHM A;  1CJ3 A;  1ZP0 A;  2YG7 A;  3SM8 A;  1S2Q A;  3ZLG A;  1CJC A;  2DKH A;  3T14 A;  1MOK A;  1JU2 A;  2RGO A;  3HYW A;  2C4C A;  4U8M A;  2CFY A;  2HNE A;  3D47 A;  3CGE A;  3K1G A;  3EPT A;  3AYJ A;  4K2S A;  1X2H A;  3Q6J A;  3T2Z A;  3NVZ B;  3KU9 A;  3OZM A;  3ICT A;  3NVY B;  1YQZ A;  4GYP A;  3NHO X;  1KFY A;  1GOS A;  4IA6 A;  2FJD A;  3SFD A;  3NN6 X;  4DYE A;  4UDP A;  2GR1 A;  2QDD A;  4MKS A;  1TDE A;  3K7Q X;  1KF6 A;  2WDQ A;  3GSI A;  2YWL A;  1O94 A;  2VRM A;  1PDY A;  3GD6 A;  4TVW A;  4NWZ A;  3FG2 P;  1IUX A;  2MUC A;  2BK5 A;  3FJ4 A;  3AM9 A;  3AWI A;  2XLP A;  3AED A;  4H2N A;  5EBK A;  1EL9 A;  4Z26 A;  3O0H A;  3KUM A;  4O5U A;  1KSS A;  1S3B A;  4B69 A;  1X31 B;  1QO8 A;  1MUC A;  4IV9 A;  3AD8 B;  3LZX A;  2DKI A;  2VQB A;  1PXA A;  3SQS A;  3SYI A;  3CK5 A;  3CYJ A;  2H89 A;  2IVE A;  2Q0L A;  2R46 A;  4DWD A;  3N6J A;  1F9C A;  1DJQ A;  2YG4 A;  4B64 A;  4IL2 A;  3NYE A;  1TYP A;  2EQ8 A;  2PU1 A;  1FIQ B;  1MXT A;  1XAN A;  5FS7 A;  3UXK A;  4APN A;  5EOW A;  1L8P A;  1PJ7 A;  2Z5Y A;  2PHH A;  3L1R A;  2I0Z A;  5M0Z A;  4Z25 A;  2VRL A;  4H4W A;  4YSX A;  1COY A;  2W3S A;  3FBS A;  2Q6U A;  3KVE A;  3UOX A;  4IA5 A;  4OPD A;  1IUW A;  2JBV A;  2BS4 A;  3FCP A;  4RG3 A;  4EIP A;  1X2G A;  4TM3 A;  1CF3 A;  3IF9 A;  3NK0 X;  4JY2 A;  3QSS A;  5DBJ A;  1DJN A;  2FJB A;  3NRZ B;  5J7X A;  1F8W A;  3D1C A;  2YLT A;  4H2Q A;  4LU6 A;  1KNR A;  3UTF A;  3H7V A;  2V61 A;  4GDE A;  3UTG A;  3ES8 A;  2OLN A;  2PYX A;  3AEE A;  3UKL A;  3AEC A;  3M13 A;  4X9N A;  5FS6 A;  5JCK A;  4K7Z A;  1SEZ A;  1N63 C;  5KOX A;  5JCM A;  1DOC A;  2YVG A;  2Z5X A;  3VR9 A;  3TJ4 A;  3GRS A;  1TZZ A;  3ZDN A;  5BVA A;  2POD A;  3AEF A;  4PAB A;  4GYP C;  3CB3 A;  4CNJ A;  1FFU C;  1D7Y A;  1YKJ A;  2O56 A;  3B9J B;  2DW7 A;  2H88 A;  2WOV A;  2OQY A;  3NTD A;  5KNL A;  3QFA A;  2PTZ A;  3I6T A;  1MDR A;  4Y4L A;  4JDR A;  2OFJ A;  2BC0 A;  2YLX A;  1F3P A;  3V5C A;  2XLS A;  4DHG A;  3ICS A;  3E1T A;  1L9D A;  1N1P A;  1PBE A;  2XCG A;  1IJH A;  4Z1Y A;  2V60 A;  3ABV A;  4E6M A;  1IYX A;  1P2H A;  2GR0 A;  5IPY A;  1CC2 A;  2BK3 A;  3SZW A;  2XLR A;  3NVW B;  3PO7 A;  2ZBW A;  3V3O A;  1H83 A;  3T37 A;  3PWG A;  4Z2U A;  2PCE A;  1ECQ A;  1MO9 A;  5KMS A;  2AL2 B;  1KKO A;  5KWF A;  4I59 A;  3TWA A;  2OZ3 A;  4ADW A;  2BS3 A;  1N4U A;  2Y6R A;  1DXL A;  3NG7 X;  4YTP A;  1GAL A;  2JB3 A;  2R45 A;  3NFU A;  4OCG A;  1BKH A;  1TDK A;  2QCU A;  2XVI A;  4OVI A;  1FCD A;  5BUL A;  4H4V A;  5EB4 A;  1NG4 A;  5FMH A;  2C67 A;  1Z6L A;  3RP7 A;  1F8R A;  2IID A;  3HYX A;  1K0J A;  3MWC A;  1GRG A;  2MNR A;  2IVD A;  5IQ4 A;  2XH2 A;  2GGJ A;  1ZMC A;  2I5Q A;  4I58 A;  5HHF A;  2GGE A;  2BRY A;  4TM1 A;  1F8S A;  1GER A;  1RP0 A;  3UJE A;  3UCC A;  4U2L A;  3NKS A;  3OZ2 A;  4AOS A;  3GRT A;  3IHG A;  4IL0 A;  1R6W A;  2A89 A;  2YLZ A;  1GRT A;  4HCL A;  3NNE A;  4JY3 A;  1TRB A;  1REO A;  1H2I A;  3L8K A;  2YR4 A;  5FJO A;  3ATQ A;  3UOV A;  4B63 A;  1RYI A;  1EBG A;  2GVC A;  1FHU A;  4A35 A;  1GET A;  3AEG A;  3FIM B;  5CQF A;  3P0W A;  4A79 A;  1GRE A;  1EC7 A;  4YWS A;  4U8P A;  1DOB A;  2JB2 A;  2E1M A;  2UZZ A;  3CT2 A;  1KNP A;  1NG3 A;  4H7U A;  2V6O A;  1B4V A;  1VDV A;  4G7F A;  2YLW A;  3AYL A;  4E0V A;  4YTN A;  2OG9 A;  2V3A A;  4TVY A;  3OZY A;  2WOW A;  4H4Y A;  1CC4 A;  2FJE A;  3DA1 A;  3LOV A;  4FI4 A;  1XHC A;  4U8K A;  1PBC A;  4PAA A;  4JQ9 A;  4J36 A;  4K5S A;  5BRT A;  4NTE A;  4BV6 A;  3EEZ A;  4TM0 A;  3KA7 A;  2OKT A;  4U8O A;  1YQ3 A;  1S2Y A;  4EMJ A;  1EBH A;  3V3N A;  2WU2 A;  2GGH A;  4TM4 A;  2R0G A;  5KRQ A;  3SZC A;  3NN0 X;  4GF7 A;  2RDX A;  2HXT A;  3GMC A;  2XFP A;  1JRY A;  1PDZ A;  3D8X A;  1Q1R A;  4RSL A;  1N5W C;  3CGB A;  2BRA A;  3OP2 A;  1T3Q C;  3CGD A;  3FXG A;  1ZK7 A;  2GRT A;  1WUF A;  3CGC A;  4KPR A;  2B7S A;  3AE2 A;  2WET A;  3HPF A;  2W54 A;  4CRT A;  3SY4 A;  2P3Z A;  3BI2 A;  5HXI A;  3CNJ A;  1FEB A;  2PS2 A;  1LV0 A;  4C3X A;  1KSU A;  2GL5 A;  3ALM A;  2P8C A;  2FJA A;  2ZC8 A;  4KWS A;  2VVL G;  2PTW A;  1H7X A;  2WPC A;  4IP4 A;  4K8G A;  5KMP A;  3DJJ A;  3PS9 A;  3ALJ A;  2JB1 A;  4GIS A;  4IVO B;  3NIX A;  2WP5 A;  6ENL A;  3QSE A;  3FYY A;  4YSY A;  2BXS A;  3UP4 A;  1GSN A;  4H83 A;  4KT2 A;  1IUU A;  2CVJ A;  3T2Y A;  1JRZ A;  4AOX A;  5JCL A;  1B8S A;  3MY9 A;  4UP3 A;  4ZN0 A;  3P93 A;  3ETR B;  1KCZ A;  4J1O A;  2XLT A;  2POZ A;  1P43 A;  3DFY A;  3VRD B;  1DOD A;  2XVJ A;  1N5X A;  2GDQ A;  5KMR A;  3NYC A;  1Y56 A;  3TOY A;  1CJ4 A;  2QVH A;  1GRF A;  3MSY A;  4USR A;  3EAO A;  3KPK A;  4GAP A;  3S47 A;  3NT6 A;  2QQ6 A;  1TKK A;  1KDG A;  1CL0 A;  1F6M A;  3UP5 A;  2ZZB A;  4EM4 A;  1XPY A;  4HNL A;  4NTD A;  1TDO A;  2WDV A;  2WP9 A;  1H86 A;  3RIT A;  2OA1 A;  1ZOV A;  3TWB A;  1CBO A;  1L9C A;  5HYM A;  2YG5 A;  2XH0 A;  4B66 A;  4B68 A;  3SZF A;  4M6U A;  4ROP A;  1ZX9 A;  3CAW A;  3HYV A;  2PGE A;  5U25 A;  3F8R A;  2PTX A;  2FBW A;  2BA9 A;  3LZW A;  3NRN A;  2XGZ A;  1GV4 A;  3UKP A;  4NEV A;  2QGY A;  7ENL A;  4LA1 A;  4BK1 A;  4RG4 A;  1PS9 A;  3UTE A;  3NS1 B;  3FVD A;  2ONE A;  2PP3 A;  5U1O A;  3ZLH A;  2WHD A;  4Y4M A;  3T2K A;  5GSN A;  4ZA0 A;  4A6N B;  4H4R A;  2XDO A;  4J57 A;  3GC2 A;  3UKA A;  3JSK A;  2X3N A;  2GH5 A;  2AR8 A;  5GRT A;  3UJF A;  3CNT A;  3GD3 A;  3S61 A;  3HW2 A;  4EQR A;  4G73 A;  3MZN A;  2TMD A;  5J04 A;  3UOZ A;  3UGV A;  5LV9 A;  3CNP A;  4K5R A;  3QJ4 A;  5TR3 A;  2WPE A;  1S3E A;  2XFO A;  2AL1 A;  4GUV A;  3PG6 A;  3ADA B;  4B65 A;  1NEL A;  2PA6 A;  1ONE A;  1JRX A;  4BJY A;  4USQ A;  2XVH A;  3VDG A;  4K1W A;  5IQ1 A;  4A9W A;  1FEC A;  2QA2 A;  5C3J A;  1ZMD A;  3V3W A;  3SN4 A;  2ARD A;  4G6G A;  3ZVH A;  3I3L A;  1BKW A;  4IT1 A;  4G8T A;  4X2P A;  3P4P A;  4Z2T A;  5FJP A;  3MUC A;  2FKP A;  3OW1 A;  3SSZ A;  3SGL A;  3VC5 A;  3DJD A;  2J3N A;  1QJD A;  3C4A A;  1FHV A;  3EF6 A;  1D4E A;  5HY5 A;  3R11 A;  3PK7 A;  3QSM A;  2WES A;  1M6I A;  3DFH A;  1FL2 A;  1BQG A;  3BNU A;  3RR1 A;  1TDF A;  4G6H A;  2GAH B;  2BYB A;  3EAN A;  3RNM A;  2OLA A;  2GF3 A;  1FEA A;  3CPI G;  1TE6 A;  2C3D A;  1E1L A;  5KMQ A;  4WCT A;  1P48 A;  2BS2 A;  1XPQ A;  3BSM A;  1ZDL A;  2OO6 A;  5ENL A;  2YVF A;  3AE5 A;  1FO4 A;  3R0K A;  3URH A;  3DES A;  3NXL A;  3CN8 A;  3KD9 A;  1PN0 A;  2VZ2 A;  3AXB A;  2XH4 A;  3NH3 X;  3VRA A;  3HZL A;  2GGG A;  3P4S A;  2VQ7 A;  2X8C A;  3V4B A;  4D04 A;  3VFC A;  4AT0 A;  3FV9 A;  4H4T A;  3I4K A;  3M0O A;  3SN1 A;  2YR6 A;  3AB1 A;  1H81 A;  4ZCC A;  3CXB A;  4GFI A;  1GES A;  1PBD A;  3PVC A;  2OVL A;  3NO1 A;  1YEY A;  3NYF A;  3NLC A;  1V59 A;  4A6N A;  4FK1 A;  2AKZ A;  4IP5 A;  3NGC X;  1PHH A;  2A8X A;  5KVH A;  4NZH A;  2BCP A;  1EL5 A;  3ISH A;  3GYX A;  4XXG A;  1NHQ A;  1CHU A;  3K7T A;  3PFR A;  3AD9 B;  2PP1 A;  3TCS A;  2GV8 A;  4NTC A;  1NHR A;  4HCH A;  2WQY A;  1JCT A;  1IUS A;  2YLS A;  4A65 A;  4X9M A;  1OEP A;  3RGT A;  1OJD A;  3CXO A;  3DGH A;  2PPG A;  3SZ0 A;  3B3R A;  3R9U A;  4EWJ A;  4MGG A;  3ZVI A;  3AE1 A;  2R4E A;  4GME A;  4GCM A;  3F8D A;  2YQU A;  3B97 A;  2QJJ A;  2VVM A;  4C3Y A;  5JCN A;  1Y56 B;  3P9U A;  5KVI A;  3DK9 A;  3M12 A;  2XYO A;  3CPH G;  3T9P A;  1GTE A;  4BK2 A;  2TPR A;  3GWF A;  5BUK A;  2JK6 A;  3EUB 3;  4H2H A;  4X4J A;  2P88 A;  1FOH A;  3CIR A;  1TDN A;  2C7G A;  2QA1 A;  3U9I A;  4UDQ A;  3CND A;  2X8G A;  4DSH A;  3QN3 A;  3OPS A;  4Z44 A;  4P9S A;  4AP1 A;  4BK3 A;  3SQP A;  1GRB A;  3U4F A;  4BUR A;  2NPX A;  3IC9 A;  1DTN A;  3AE4 A;  2WDR A;  4U2T A;  1PBB A;  1PJ5 A;  3H70 A;  2WEU A;  3CPJ G;  3Q9T A;  1YY5 A;  1NHP A;  4DGK A;  1GT8 A;  1N62 C;  3STP A;  3C4N A;  4H4Q A;  1JPM A;  4YKG A;  2WBA A;  3DG6 A;  3IJL A;  3UKQ A;  4JN7 A;  1GXF A;  5JCI A;  2YM1 A;  1K0L A;  1PJ6 A;  3P4R A;  2O9Z A;  4U8N A;  3FMW A;  4N9X A;  4FK1 C;  4CNK A;  4CY6 A;  3AEB A;  4IZG A;  3IK4 A;  1W4X A;  3L5O A;  1Y0P A;  4U2S A;  1GPE A;  2C3C A;  1KKR A;  3NZG A;  4CBQ A;  4HPN A;  2ZZ0 A;  2OQH A;  1R0M A;  3DER A;  1EL7 A;  3DK4 A;  1YQ4 A;  4EQS A;  4J56 A;  2RAB A;  1KD0 A;  1ZY8 A;  3GDN A;  3JVA A;  1DOE A;  1LVL A;  3G5S A;  4KX6 A;  4Z43 A;  3P4Q A;  3UXL A;  4HCD A;  1SJC A;  4YSH A;  3GY1 A;  3DME A;  1MNS A;  4TLZ A;  1VRQ B;  1EC9 A;  4HYR A;  1RVK A;  3BHF A;  2YG6 A;  1PXC A;  3AE7 A;  1P2E A;  2GR2 A;  3D9X A;  1KN0 A;  1M64 A;  3R0U A;  1H7W A;  1LTX R;  2Q7V A;  3RP8 A;  1D7L A;  3GMB A;  3AYI A;  4B1B A;  2GQF A;  1ZOY A;  4H2R A;  2DW6 A;  3DDM A;  1NEK A;  3DJG X;  3GWD A;  3VR8 A;  1FFV C;  4ZCW A;  4C74 A;  1SJD A;  2OZ8 A;  2WP6 A;  1AOG A;  5G5G B;  3K7M X;  1LQT A;  4M52 A;  1JRO A;  3AMZ A;  4GDP A;  2GEW A;  4H50 A;  4EM3 A;  1ZXI C;  2R0P A;  4OPI A;  1N60 C;  3VQR A;  3ALL A;  4GGB A;  3TW9 A;  2R4J A;  3RRA A;  3P1W A;  2C65 A;  1W6T A;  3VRB A;  2VOU A;  2B9Y A;  4IVM B;  5FJT A;  1RM6 B;  4A3R A;  4EQX A;  3TQP A;  5U63 A;  4U8L A;  2YVJ A;  3LAD A;  3B6D A;  2C70 A;  3GYJ A;  3MQT A;  3A7R A;  3AN1 A;  2C73 A;  2XVF A;  3LB8 A;  3H4K A;  3IHM A;  3SN0 A;  4H4X A;  3CTY A;  2GB0 A;  3F8P A;  5EU9 A;  2P8B A;  2B9X A;  2E4G A;  4AP3 A;  3DGB A;  1JRP A;  3R10 A;  2GR3 A;  2GMH A;  4A5L A;  2P0I A;  1NPX A;  4CCQ A;  3UJS A;  1PXB A;  2FYM A;  3FPZ A;  3BHK A;  2E5A A;  4NEW A;  2OX4 A;  2X99 A;  5FS9 A;  4KPL A;  4JNQ A;  4BJZ A;  4M0X A;  1XS2 A;  3V5F A;  3RCY A;  3GO2 A;  1D4C A;  2JKC A;  3JW7 A;  3UTH A;  1OJA A;  2XFU A;  1BGJ A;  4UDR A;  3C96 A;  3S5S A;  3I6D A;  3QPE A;  2C76 A;  3MKC A;  5KXJ A;  3ICR A;  3DG3 A;  3CMM A;  3ES7 A;  3P3B A;  2YG3 A;  1VDC A;  3S5W A;  2F5Z A;  3TJI A;  2RGJ A;  4II2 A;  1SJB A;  2PMQ A;  1B5Q A;  3IJI A;  1K0I A;  4YTM A;  4DNA A;  3HRD C;  1MRA A;  4IHC A;  1QLB A;  1ELI A;  1H82 A;  3ZLF A;  2OLO A;  2C66 A;  2APG A;  1GTH A;  3T8Q A;  1GND A;  4A7A A;  2WPF A;  4ZCD A;  4C5O A;  2QJN A;  2OAM A;  3I6E A;  3BJS A;  1N61 C;  2GQW A;  1CJ2 A;  3AD7 B;  3LJP A;  5C2T A;  5J60 A;  2EQ7 A;  2AAQ A;  2PP0 A;  4U8J A;  4ICY A;  3BI4 A;  2PGW A;  4JNA A;  2R0C A;  3H8A A;  1GEU A;  3K30 A;  2ZAD A;  3UCL A;  3ZYX A;  3BI5 A;  4YWO A;  5JRB A;  2GAG B;  3NVV B;  3R07 C;  4G74 A;  1OJC A;  4CCR A;  3QKE A;  4GRT A;  2XLU A;  4AT2 A;  2W0H A;  4A6G A;  3COX A;  5IDZ A;  2BC1 A;  3QFB A;  2JAE A;  3AE8 A;  4YT0 A;  1JOA A;  4J33 A;  1PDH A;  5FS8 A;  4H19 A;  1RSG A;  2WOI A;  1SB3 B;  2GMJ A;  2PSN A;  5M10 A;  1NHS A;  4E8G A;  1WUE A;  2A87 A;  2C64 A;  4OPL A;  3RO6 A;  3AEA A;  2E3T A;  2R9Z A;  3SBF A;  3NK2 X;  1H84 A;  3PWI A;  1VQZ A;  3H12 A;  1BGN A;  4HN8 A;  1NU5 A;  1VG9 A;  4KEM A;  4HB9 A;  1JEH A;  1LPF A;  5CKU A;  1D4D A;  1JNR A;  4GIR A;  1E1M A;  2AQJ A;  3QVP A;  4K8D A;  1L0V A;  3WE0 A;  1NEN A;  4YXD A;  3T4W A;  1SJA A;  3VCC A;  2WU5 A;  2C72 A;  1MDL A;  4OPC A;  2BK4 A;  3UKK A;  3UJR A;  1K4Q A;  4OPU A;  2AL2 A;  3H8L A;  3NTA A;  1EBD A;  5G5H B;  3UKF A;  3LXD A;  4H2P A;  2X8H A;  4G9K A;  3JZU A;  1LJ1 A;  2BXR A;  1N4V A;  4Y4N A;  3II4 A;  1BWC A;  1LQU A;  3R1Z A;  2GGI A;  3V76 A;  4Z2R A;  1D5T A;  3AE6 A;  1NAA A;  3QVR A;  1Q9I A;  1O95 A;  1O5W A;  1VQW A;  2HXU A;  2ZZC A;  3ZVH B;  4ENL A;  3AE3 A;  4EMW A;  2BAB A;  3VCN A;  1S7M A;  2OAL A;  2XVE A;  2EQ6 A;  1E7P A;  3UCD A;  1ELS A;  4K22 A;  3GYI A;  1E39 A;  3IWA A;  4DN1 A;  4E5T A;  4FP1 A;  4MJW A;  3ITJ A;  1EL8 A;  2HZG A;  2QJM A;  2OZT A;  5FJR A;  4XWR A;  4DSG A;  4J34 A;  1V97 A;  3R25 A;  3Q4D A;  3SXI A;  2V5Z A;  3SR6 B;  4FDC B;  1ONF A;  3KKJ A;  1BF3 A;  5BOE A;  4H4S A;  2X50 A;  3N4E A;  2ACZ A;  1E1K A;  5KOW A;  4K2X A;  1PBF A;  4GAV A;  3NK1 X;  2YAU A;  4E4F A;  2B76 A;  1JPD X;  4F4R A;  2YR5 A;  1ZKQ A;  3N6H A;  2XFQ A;  3Q45 A;  1Q1W A;  1JNZ A;  5EB5 A;  1OJ9 A;  3DK8 A;  1BZL A;  3OTR A;  3EKG A;  2HQM A;  2W55 A;  2B7R A;  1IUV A;  3UKH A;  3GDP A;  3VA8 A;  4FX9 A;  4XWZ A;  3KPF A;  1WYG A;  4D03 A;  4REK A;  3G5Q A;  2C75 A;  3BNM A;  2VVL A;  4Z24 A;  1VG0 A;  4HA6 A;  2XFN A;  4MMW A;  4H4P A;  3A7A A;  3DEQ A;  1EC8 A;  3DH9 A;  1GRH A;  1H6V A;  3BOX A;  4DX3 A;  2CDU A;  4TLX A;  4GGH A;  4HNC A;  4B67 A;  4NNJ A;  3KLJ A;  3RP6 A;  2YM2 A;  3DG7 A;  4J2W A;  2CHR A;  4EQW A;  2WS3 A;  3RED A;  2EQ9 A;  5ER0 A;  2PU0 A;  4EIQ A;  1DNC A;  4E4U A;  2PTY A;  5FJU A;  4DXK A;  4Z17 A;  4ZOH B;  4II3 A;  4WX1 A;  3OC4 A;  2GSH A;  3H8I A;  4O5Q A;  1N4W A;  1NDA A;  1IUT A;  2Q0K A;  1JDF A;  1TYT A;  1STZ A;  4JN9 A;  3IJQ A;  2W3R A;  3D46 A;  3ENL A;  4JN8 A;  3DJE A;  3T0K A;  1L9E A;  3SX6 A; 
#chains in the Genus database with same CATH homology
 2C76 A;  1H81 A;  4ZCC A;  5KXJ A;  4I58 A;  4ECH A;  5HHF A;  2Y6Q A;  2BRY A;  2BCG G;  4TM1 A;  3ICR A;  1GES A;  1F8S A;  1GER A;  1RP0 A;  3CMM A;  1PBD A;  4U2L A;  3NKS A;  2BAC A;  3OZ2 A;  3PVC A;  4AOS A;  3GRT A;  3IHG A;  2YG3 A;  2YLR A;  3CNS A;  2A89 A;  2YLZ A;  1VDC A;  3NYF A;  3S5W A;  1GRT A;  2F5Z A;  3NLC A;  3NNE A;  2RGJ A;  4JY3 A;  4II2 A;  1TRB A;  1HYU A;  4OPG A;  2V3B A;  1REO A;  1H2I A;  4YKF A;  1V59 A;  3L8K A;  1B5Q A;  4H4Z A;  2YR4 A;  3ATQ A;  3GMC A;  3UOV A;  4A6N A;  4B63 A;  1RYI A;  4A99 A;  2QAE A;  4FK1 A;  1K0I A;  1UKV G;  2E5V A;  4YTM A;  3T31 A;  2GVC A;  4DNA A;  3NGC X;  3UOY A;  1PHH A;  1GET A;  2A8X A;  3AEG A;  3FIM B;  5CQF A;  4A79 A;  1QLB A;  4J31 A;  1GRE A;  1ELI A;  1H82 A;  5KVH A;  4NZH A;  2OLO A;  3DGZ A;  2BCP A;  1EL5 A;  2C66 A;  3GD4 A;  4U8P A;  3ISH A;  1DOB A;  2JB2 A;  3GYX A;  4C77 A;  2APG A;  1GTH A;  2E1M A;  4XXG A;  1NHQ A;  1OJT A;  1GRA A;  1CHU A;  1E1N A;  1GND A;  2UZZ A;  3K7T A;  2WPF A;  4ZCD A;  4A7A A;  4C5O A;  3AD9 B;  3RHA A;  2RGH A;  1KNP A;  1NG3 A;  4H7U A;  2V6O A;  2OAM A;  4EMI A;  1B4V A;  2GV8 A;  2YLW A;  4NTC A;  3AYL A;  1NHR A;  4YSZ A;  4E0V A;  4YTN A;  2GQW A;  2V3A A;  2WQY A;  3ATR A;  1CJ2 A;  3SFE A;  4GR1 A;  2WOW A;  4H4Y A;  1CC4 A;  2FJE A;  3AD7 B;  4LII A;  3DA1 A;  3LJP A;  3LOV A;  1IUS A;  2YLS A;  1XHC A;  4U8K A;  5C2T A;  5J60 A;  4A65 A;  2EQ7 A;  2AAQ A;  4X9M A;  2B9W A;  4U8J A;  5L46 A;  4U8I A;  1PBC A;  2NVK X;  4ICY A;  4JQ9 A;  4PAA A;  4OPT A;  4J36 A;  4K5S A;  5BRT A;  3BI4 A;  4NTE A;  4BV6 A;  1OJD A;  3DGH A;  4JNA A;  1E6E A;  4TM0 A;  2R0C A;  3KA7 A;  3SZ0 A;  4U8O A;  3B3R A;  3R9U A;  1YQ3 A;  1S2Y A;  4EMJ A;  1CC6 A;  3V3N A;  2WU2 A;  1GEU A;  3G5R A;  3K30 A;  3AE9 A;  3AE1 A;  3UCL A;  2CUL A;  2R4E A;  4TM4 A;  2R0G A;  5KRQ A;  4GCM A;  4H4U A;  3SZC A;  1XDI A;  3ZYX A;  3F8D A;  1B37 A;  3NN0 X;  4GF7 A;  4CY8 A;  4YWO A;  5JRB A;  2GAG B;  3BI5 A;  2YQU A;  1CJ3 A;  1JRY A;  1ZP0 A;  2XFP A;  2YG7 A;  1S2Q A;  3SM8 A;  2VVM A;  1CJC A;  2DKH A;  5JCN A;  1Y56 B;  3D8X A;  3P9U A;  3T14 A;  5KVI A;  4C3Y A;  1Q1R A;  4RSL A;  3DK9 A;  1MOK A;  4G74 A;  3CGB A;  1OJC A;  4CCR A;  2BRA A;  3M12 A;  1JU2 A;  2XYO A;  2RGO A;  3CPH G;  3HYW A;  2C4C A;  4GRT A;  2XLU A;  2CFY A;  4U8M A;  3CGD A;  3CGE A;  3EPT A;  1GTE A;  3AYJ A;  4AT2 A;  2W0H A;  4BK2 A;  1ZK7 A;  2TPR A;  3GWF A;  2GRT A;  3CGC A;  5BUK A;  4KPR A;  2JK6 A;  3COX A;  2B7S A;  2BC1 A;  3QFB A;  2JAE A;  3Q6J A;  2WET A;  3AE8 A;  3AE2 A;  3T2Z A;  4YT0 A;  4X4J A;  1FOH A;  3CIR A;  4CRT A;  1TDN A;  3SY4 A;  1JOA A;  3KU9 A;  2C7G A;  2QA1 A;  3BI2 A;  4J33 A;  5HXI A;  3CNJ A;  1PDH A;  4UDQ A;  3CND A;  5FS8 A;  2X8G A;  1FEB A;  1RSG A;  3ICT A;  1YQZ A;  4DSH A;  1LV0 A;  2WOI A;  3NHO X;  1KFY A;  4Z44 A;  1GOS A;  4IA6 A;  1KSU A;  2FJD A;  4C3X A;  4P9S A;  3SFD A;  2GMJ A;  3ALM A;  3NN6 X;  4UDP A;  5M10 A;  2GR1 A;  2FJA A;  1NHS A;  4AP1 A;  3SQP A;  4BK3 A;  1GRB A;  2A87 A;  2C64 A;  4BUR A;  1TDE A;  2VVL G;  3K7Q X;  4OPL A;  1H7X A;  1KF6 A;  2WDQ A;  3GSI A;  2NPX A;  2WPC A;  3IC9 A;  1O94 A;  2YWL A;  3AEA A;  5KMP A;  2VRM A;  3DJJ A;  2R9Z A;  3NK2 X;  3PS9 A;  3ALJ A;  3AE4 A;  1H84 A;  4NWZ A;  2JB1 A;  3FG2 P;  2WDR A;  1IUX A;  4U2T A;  1BGN A;  1PBB A;  1VG9 A;  2BK5 A;  1PJ5 A;  4IVO B;  3NIX A;  2WP5 A;  3QSE A;  4HB9 A;  1JEH A;  2XLP A;  3AWI A;  3AED A;  1LPF A;  4H2N A;  2BXS A;  2WEU A;  4YSY A;  5EBK A;  5CKU A;  1D4D A;  3CPJ G;  1EL9 A;  1JNR A;  3Q9T A;  3UP4 A;  3O0H A;  1YY5 A;  1E1M A;  1NHP A;  1GSN A;  2AQJ A;  1IUU A;  1KSS A;  3QVP A;  4O5U A;  4DGK A;  4K8D A;  2CVJ A;  1L0V A;  3T2Y A;  1GT8 A;  1JRZ A;  3WE0 A;  4AOX A;  5JCL A;  1NEN A;  1S3B A;  4B69 A;  4YXD A;  1X31 B;  1B8S A;  3C4N A;  4H4Q A;  1QO8 A;  4UP3 A;  4ZN0 A;  4IV9 A;  4YKG A;  2WU5 A;  2C72 A;  2WBA A;  3AD8 B;  4OPC A;  2BK4 A;  3LZX A;  2DKI A;  2VQB A;  2XLT A;  3UKQ A;  1PXA A;  3UKK A;  3SYI A;  1GXF A;  5JCI A;  1K4Q A;  2H89 A;  2YM1 A;  1K0L A;  3VRD B;  4OPU A;  1PJ6 A;  3P4R A;  1DOD A;  2O9Z A;  2XVJ A;  4U8N A;  2IVE A;  2Q0L A;  3H8L A;  2R46 A;  3FMW A;  3NTA A;  1EBD A;  3UKF A;  4N9X A;  4FK1 C;  4CNK A;  5KMR A;  3LXD A;  4H2P A;  3NYC A;  1Y56 A;  4CY6 A;  2X8H A;  1DJQ A;  2YG4 A;  4G9K A;  1CJ4 A;  4B64 A;  3NYE A;  3AEB A;  1TYP A;  2EQ8 A;  1GRF A;  1W4X A;  4USR A;  3L5O A;  3EAO A;  1XAN A;  5FS7 A;  1MXT A;  1Y0P A;  3KPK A;  4U2S A;  4GAP A;  1LJ1 A;  4APN A;  2BXR A;  1GPE A;  2C3C A;  5EOW A;  1PJ7 A;  3NT6 A;  1N4V A;  4CBQ A;  1KDG A;  4Y4N A;  3II4 A;  2Z5Y A;  2PHH A;  3L1R A;  2I0Z A;  5M0Z A;  4Z25 A;  2ZZ0 A;  1CL0 A;  1F6M A;  2VRL A;  1BWC A;  3UP5 A;  1LQU A;  2ZZB A;  4H4W A;  4EM4 A;  4YSX A;  3V76 A;  4Z2R A;  1COY A;  3FBS A;  4NTD A;  1D5T A;  1TDO A;  2WDV A;  3AE6 A;  1NAA A;  2Q6U A;  3KVE A;  3UOX A;  3QVR A;  2WP9 A;  1Q9I A;  1H86 A;  4IA5 A;  1IUW A;  1O95 A;  4OPD A;  1O5W A;  1EL7 A;  2OA1 A;  3DK4 A;  1YQ4 A;  4EQS A;  2ZZC A;  1VQW A;  2BS4 A;  2JBV A;  4J56 A;  4RG3 A;  1ZOV A;  1CBO A;  4EIP A;  2RAB A;  3GDN A;  1ZY8 A;  1L9C A;  1DOE A;  3AE3 A;  1LVL A;  5HYM A;  4EMW A;  2BAB A;  3G5S A;  4TM3 A;  2YG5 A;  4KX6 A;  4Z43 A;  1CF3 A;  3IF9 A;  4B66 A;  4B68 A;  1S7M A;  3NK0 X;  2OAL A;  3P4Q A;  3QSS A;  4JY2 A;  3SZF A;  5DBJ A;  2XVE A;  2EQ6 A;  1E7P A;  1DJN A;  2FJB A;  1ZX9 A;  4YSH A;  3HYV A;  4K22 A;  3DME A;  3GYI A;  5U25 A;  4TLZ A;  1F8W A;  3D1C A;  1VRQ B;  3F8R A;  5J7X A;  2FBW A;  2YLT A;  1E39 A;  4H2Q A;  2BA9 A;  3IWA A;  4LU6 A;  3LZW A;  1KNR A;  3NRN A;  3BHF A;  1GV4 A;  2YG6 A;  3UKP A;  3UTF A;  4MJW A;  3ITJ A;  1EL8 A;  1PXC A;  3AE7 A;  4NEV A;  2V61 A;  1P2E A;  2GR2 A;  3D9X A;  1KN0 A;  1M64 A;  4GDE A;  4XWR A;  3UTG A;  4LA1 A;  4BK1 A;  1H7W A;  4RG4 A;  1LTX R;  2OLN A;  1PS9 A;  2PYX A;  2Q7V A;  3UTE A;  4DSG A;  3AEE A;  5U1O A;  3T2K A;  2WHD A;  4Y4M A;  3UKL A;  4J34 A;  3AEC A;  5GSN A;  3RP8 A;  3M13 A;  4X9N A;  3SXI A;  1D7L A;  3GMB A;  5FS6 A;  3AYI A;  5JCK A;  2GQF A;  2V5Z A;  4K7Z A;  1ZOY A;  1SEZ A;  4H4R A;  2XDO A;  4J57 A;  4A6N B;  4B1B A;  4FDC B;  5KOX A;  1ONF A;  3UKA A;  3KKJ A;  5JCM A;  1BF3 A;  1DOC A;  2YVG A;  2X3N A;  3JSK A;  2Z5X A;  4H2R A;  4H4S A;  3VR9 A;  2GH5 A;  2X50 A;  1NEK A;  2ACZ A;  2AR8 A;  3GRS A;  5GRT A;  3CNT A;  1E1K A;  3ZDN A;  5KOW A;  3GD3 A;  3DJG X;  3S61 A;  3GWD A;  4K2X A;  5BVA A;  4EQR A;  1PBF A;  3VR8 A;  4G73 A;  2TMD A;  3AEF A;  4GAV A;  4PAB A;  3NK1 X;  2YAU A;  3UOZ A;  4C74 A;  5LV9 A;  2B76 A;  2WP6 A;  3CNP A;  1AOG A;  4K5R A;  3QJ4 A;  4CNJ A;  3K7M X;  1D7Y A;  1LQT A;  2YR5 A;  1ZKQ A;  4M52 A;  2WPE A;  5TR3 A;  1YKJ A;  2XFQ A;  1S3E A;  2XFO A;  1Q1W A;  1JNZ A;  4GUV A;  3PG6 A;  1OJ9 A;  2H88 A;  5EB5 A;  3ADA B;  3DK8 A;  4GDP A;  1BZL A;  2GEW A;  2WOV A;  4B65 A;  2HQM A;  4H50 A;  3NTD A;  1JRX A;  5KNL A;  3QFA A;  4BJY A;  4EM3 A;  4USQ A;  2R0P A;  2XVH A;  4OPI A;  2B7R A;  1IUV A;  5IQ1 A;  3VQR A;  3UKH A;  4A9W A;  4Y4L A;  1FEC A;  4JDR A;  2QA2 A;  3GDP A;  5C3J A;  1ZMD A;  2BC0 A;  3ALL A;  2ARD A;  4G6G A;  2R4J A;  2YLX A;  3P1W A;  3I3L A;  1BKW A;  1F3P A;  4FX9 A;  4XWZ A;  3KPF A;  2C65 A;  2XLS A;  3P4P A;  3VRB A;  4D03 A;  2VOU A;  4REK A;  4Z2T A;  2B9Y A;  3G5Q A;  2C75 A;  3ICS A;  3BNM A;  3E1T A;  4IVM B;  2VVL A;  4EQX A;  4Z24 A;  1L9D A;  1N1P A;  1PBE A;  1VG0 A;  4HA6 A;  3SGL A;  5U63 A;  2XCG A;  3DJD A;  4U8L A;  2YVJ A;  1IJH A;  2XFN A;  2J3N A;  4H4P A;  1QJD A;  3C4A A;  3LAD A;  3DH9 A;  1GRH A;  2C70 A;  3B6D A;  3GYJ A;  1H6V A;  2V60 A;  3EF6 A;  3ABV A;  1D4E A;  5HY5 A;  3QSM A;  2CDU A;  2C73 A;  2WES A;  2XVF A;  3LB8 A;  4TLX A;  1P2H A;  2GR0 A;  4B67 A;  5IPY A;  1M6I A;  1CC2 A;  2BK3 A;  4NNJ A;  3SZW A;  2XLR A;  3PO7 A;  2ZBW A;  3V3O A;  3H4K A;  1H83 A;  3T37 A;  3IHM A;  1FL2 A;  4Z2U A;  3BNU A;  1TDF A;  4H4X A;  4G6H A;  3KLJ A;  2GAH B;  3RP6 A;  2YM2 A;  2BYB A;  3EAN A;  3RNM A;  1MO9 A;  2GF3 A;  3CTY A;  2GB0 A;  3F8P A;  5KMS A;  1FEA A;  3CPI G;  5KWF A;  2C3D A;  2B9X A;  1E1L A;  2E4G A;  4I59 A;  5KMQ A;  4ADW A;  4J2W A;  4WCT A;  4AP3 A;  2BS2 A;  4EQW A;  1N4U A;  2BS3 A;  2Y6R A;  1XPQ A;  1DXL A;  2WS3 A;  3RED A;  3NG7 X;  2EQ9 A;  1ZDL A;  4YTP A;  5ER0 A;  4EIQ A;  1DNC A;  2YVF A;  1GAL A;  2JB3 A;  3AE5 A;  2GR3 A;  2GMH A;  2R45 A;  4OCG A;  4A5L A;  1NPX A;  3URH A;  4CCQ A;  1TDK A;  1PXB A;  3CN8 A;  4II3 A;  4WX1 A;  3OC4 A;  2QCU A;  3H8I A;  4O5Q A;  1N4W A;  2XVI A;  3FPZ A;  4OVI A;  1NDA A;  1IUT A;  3BHK A;  3KD9 A;  2Q0K A;  1PN0 A;  1TYT A;  4NEW A;  2VZ2 A;  2X99 A;  5FS9 A;  4JN9 A;  1FCD A;  3AXB A;  5BUL A;  3NH3 X;  4JNQ A;  3HZL A;  3VRA A;  4BJZ A;  4H4V A;  5EB4 A;  3P4S A;  2VQ7 A;  2X8C A;  5FMH A;  1NG4 A;  2C67 A;  1Z6L A;  4D04 A;  2JKC A;  1D4C A;  1F8R A;  2IID A;  3RP7 A;  3UTH A;  3HYX A;  1K0J A;  3DJE A;  4Z26 A;  1OJA A;  4AT0 A;  1GRG A;  2XFU A;  3T0K A;  4H4T A;  1BGJ A;  2IVD A;  5IQ4 A;  3M0O A;  1ZMC A;  4UDR A;  2YR6 A;  1L9E A;  3C96 A;  3AB1 A;  3I6D A;  3SX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...