4K2SA

Crystal structure of the mutant p317a of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
404
structure length
393
Chain Sequence
SLKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVASSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGATDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords D-mannonate dehydratase
publication title Crystal structure of the mutant P317A of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate
rcsb
source organism Chromohalobacter salexigens
molecule tags Isomerase
total genus 147
structure length 393
sequence length 404
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4k2sA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4k2sA01
4H2HA 3SN0A 3FVDA 2PS2A 4KPLA 2POZA 3QKEA 4MGGA 2DW7A 3P3BA 4HCDA 2AKMA 1NU5A 4H83A 3OPSA 2OZTA 2PP3A 4HN8A 3CT2A 4H1ZA 4KT2A 4IZGA 3VCCA 2P8BA 4E8GA 4GISA 3TWAA 2OLAA 1TKKA 3RR1A 3T8QA 5IDZA 3I6TA 1SJCA 3JZUA 2XH7A 2CHRA 2FKPA 3TTEA 1R6WA 2QGYA 2PTYA 1SJBA 4GGBA 5FJRA 3GC2A 3QLDA 3TW9A 3ENLA 2PMQA 4IT1A 3FCPA 4HCLA 4GYPA 3BSMA 3UCDA 4Z17A 2AKZA 3GO2A 3N4EA 2P3ZA 4A35A 4JHMA 3K1GA 4IL2A 3Q45A 1PDZA 3VA8A 2OKTA 2GGEA 2HXUA 3P93A 5FJUA 3UJFA 2P0IA 4JN7A 3UCCA 4FP1A 2XGZA 2GGGA 3RGTA 3TOYA 3DGBA 4HYRA 3SQSA 4FI4A 1NELA 4GMEA 3DG6A 1SJAA 3SBFA 2XSXA 1W6TA 3VFCA 2I5QA 1MRAA 2PTXA 1ONEA 3I4KA 6ENLA 3R25A 2PP0A 2ZC8A 1XS2A 4IP4A 4E6MA 3H7VA 1YEYA 4E5TA 3CK5A 3VC6A 4GGHA 2PGWA 2PTZA 2XH0A 1EBHA 3MZNA 3H70A 2RDXA 1EC8A 3MKCA 3V5CA 2PU0A 3H8AA 3T4WA 1MUCA 4MMWA 1JCTA 2PSNA 1FHUA 3GD6A 4G8TA 4H19A 3CB3A 3ZVHB 3TJIA 4A3RA 2GDQA 1BQGA 4YWSA 3PK7A 4M6UA 1TZZA 3UJRA 2GSHA 5J04A 3R11A 5EU9A 1L8PA 5FJTA 3KUMA 3MY9A 3MWCA 1R0MA 3UJ2A 2OZ8A 4DX3A 4ROPA 2OQYA 3CYJA 3THUA 4GYPC 2HNEA 4JN8A 4K8GA 5FJOA 3PWIA 3IJLA 3JVAA 3B97A 3QN3A 3N6HA 3ZLFA 3N4FA 4KWSA 1JPMA 2XH2A 3MUCA 1KD0A 3SSZA 4IP5A 2OVLA 1F9CA 3ES8A 2OX4A 4ZA0A 3FYYA 3BJSA 2FYMA 3NO1A 2OG9A 4X2PA 2GL5A 3NXLA 3RO6A 3MSYA 2GGHA 3VC5A 1MDLA 1P43A 3JW7A 3IK4A 4GIRA 1PDYA 3D46A 3ZVHA 3CXOA 3FXGA 3OW1A 2QDDA 1KCZA 2NQLA 3DIPA 3VCNA 4J3ZA 1ELSA 4DHGA 2QJNA 2MUCA 3SJNA 4F4RA 1MNSA 2OZ3A 3STPA 4DXKA 3V5FA 1MDRA 3UXKA 3FV9A 3GY1A 1TE6A 3DEQA 3NFUA 2OO6A 3QTPA 3NZGA 4IHCA 7ENLA 3MQTA 3IJIA 4DYEA 3P0WA 4HCHA 4HNCA 2PCEA 2ONEA 4M0XA 3HPFA 3D47A 4IL0A 1RVKA 3R0KA 3VDGA 3RRAA 4GFIA 3TWBA 3RITA 3UXLA 1SJDA 2OQHA 5BOFA 4J1OA 1DTNA 2QDEA 2PU1A 4E4UA 2QJMA 2O56A 1EC7A 3OZMA 4A6GA 3OP2A 3RCYA 2QVHA 3DFYA 1ECQA 3UGVA 3TCSA 1BKHA 3IJQA 2GGIA 2HXTA 1P48A 3N6JA 3UJSA 2HZGA 1EC9A 4HPNA 5FJPA 3SN4A 1IYXA 3I6EA 3R10A 2P88A 3PWGA 2XH4A 3DFHA 2AL2B 4E4FA 3Q4DA 5BOEA 3R0UA 3S5SA 3ZLHA 3QPEA 4MKSA 2PP1A 2OFJA 4DN1A 3R1ZA 3V4BA 1FHVA 3PFRA 1KKRA 2QQ6A 2PPGA 3T9PA 2MNRA 4ZCWA 4G7FA 3SN1A 3BOXA 3DESA 1JPDX 3T6CA 3U9IA 1WUEA 1WUFA 1KKOA 1XPYA 3ES7A 2QJJA 3U4FA 3DG3A 3EEZA 2P8CA 2AL1A 2ZADA 3CAWA 2PODA 4ENLA 3ZLGA 4DWDA 3OZYA 3UJEA 1EBGA 2DW6A 2OPJA 3DDMA 3DERA 2GGJA 3TQPA 4Z1YA 3ZVIA 4EWJA 1OEPA 2AL2A 3OTRA 1E9IA 3EKGA 3H12A 4HNLA 3DG7A 5ENLA 3V3WA 4K2SA 2PA6A 3S47A 1JDFA 3TJ4A 3FJ4A 4KEMA 4K1WA 2PTWA 2PGEA
chains in the Genus database with same CATH superfamily
2FQIA 3FVDA 1RQBA 2PUZA 1TRIA 3HG5A 4XSLA 3ARTA 1UHVA 4LU0A 1DWIM 4S3DA 2CLLA 3UWVA 1UD3A 4D71A 5TR3A 1DP0A 1SZNA 3AYVA 2OZTA 3HG3A 3OQ8A 3QPYA 1IE7C 1UR0A 4O15A 1CGTA 1YE6A 3OBKA 3RR1A 2VEKA 3B03A 4H8UA 1BWKA 2HJPA 4A8LA 3TDFA 2WB5A 2FKPA 3ARWA 1D7KA 4Y7EA 2J9ZA 2V3DA 3PBYA 1F6YA 4H7VA 4MFEA 3TA9A 1W9XA 3GC2A 4PL1A 3TW9A 4IJCA 1E51A 3MDWA 3CEPA 3G1FA 3U8GA 3RNDA 4C6KA 4Z1AA 5I3HA 5EMJA 3CO8A 1Q13A 4JIQA 1K6AA 3ITOA 5EA9A 3FN9A 3MUIA 4TV5A 3DBNA 1S5WA 3WJWA 4BWLC 2VCBA 3ZR5A 3WLTA 1JCMP 4XAZA 3EXSA 3AFBA 4ZR8A 1XUUA 3IC9A 4HPGA 3RXZA 4FP1A 1O1HA 1E6NA 4AZBA 4BR1A 3QC3A 3TMLA 1HF6A 1PWMA 2WZTA 9XIMA 1ZHAA 1V6XA 4P61A 4C7GA 4O50A 1QCWA 4C7DA 1IZJA 1JVNA 6TAAA 3ABSA 1TX0A 3RYSA 3QV9A 5G4WA 2C1IA 1J0ZA 4AFYA 4K7VA 1AQFA 1SW0A 3CTTA 3WBYA 2YLLA 2V2HA 5EKYA 3AIUA 5EY5A 1H62A 3BWWA 2VWTA 3RMEA 3NL2A 4LBUA 4HNNA 5AOUA 4Q7BA 1KB3A 2ISWA 3WLSA 2ZZ1A 1MI3A 2YBTA 1OIFA 1W9DM 2NUWA 3AIEA 4XIMA 1XDIA 2DFAA 3UWUA 2W61A 1N5XA 2PSNA 4XO7A 3BJTA 2PDMA 1FH7A 2FDMA 3GW3A 5G5HB 4A3RA 5I24A 4JTFA 4LB4A 1L8NA 3WD2A 3G6LA 2GSHA 1J96A 2Y24A 4GKTA 1MEWA 1SZRA 1G4SA 1XFBA 3KL5A 4BZYA 2FVLA 4ICNA 1A53A 3HPSA 3S46A 1D3CA 2XFRA 6TIMA 1I9CB 1REQB 3S1XA 2FZNA 1W56A 1AD1A 2J62A 2HQAA 1EIBA 3IJLA 4PCNA 6REQB 2EQ7A 1CIUA 3N6HA 3N4FA 1FFQA 2YCEA 5D02A 4ACYA 4QP0A 4EACA 1XLDA 1G4PA 4WUIA 2V5JA 3BJSA 1FFUC 4N9EA 4ADTA 1ITUA 3MSYA 1CGWA 2G41A 2IKGA 4RR4A 3W25A 1OT2A 3T42A 2FDSA 1CYGA 1QOQA 3FXGA 2CU0A 2QDDA 3KTCA 3T0CA 3GDBA 3DK9A 3FJNA 3WSUA 4HU8A 2PURA 1NIUA 1NTHA 3GRTA 4KCWA 5AY7A 2F2KA 2WQPA 1X6UA 3G18A 1ZJHA 3BXWA 1VBGA 3CO4A 4M80A 1F4HA 1A5OC 4DJDC 3AU6A 3NQ8A 1E5NA 1YPFA 1RK6A 1T7LA 1GZJA 7ENLA 5FKYA 4GH3A 3T08A 4ZQNA 1P1XA 1W31A 1XDLA 1PAMA 2ZZ4A 1EWDA 3CZEA 4MVAA 5GVJA 3T2QA 4QQ3A 1OB0A 1RVGA 5BU6A 4UCGA 3GUGA 4DBWA 2Y85A 3CUGA 1HKMA 3QXBA 4GYFA 2Y62A 3A7AA 3O8AA 1VS1A 5ABFA 1KWGA 1TZ7A 1UA7A 4LUJA 2C15A 1AA1B 1QK2A 3L0GA 3QGKC 4H01A 2PZNA 2WV8A 4JCMA 1CXFA 4X9YA 1QBAA 3VOHA 1UD4A 2CBUA 3ZR4A 3SCTA 1GOMA 1P48A 3ARVA 5H1WA 3DHFA 4PTVA 3E02A 1OFBA 4ACZB 3N3TA 1QPQA 4A29A 4PTXA 1AFSA 4FX7A 2CBJA 3DFHA 3II1A 3TU9A 5DBTA 1FCBA 2ACSA 3LN3A 5CGQA 4EIVA 4NUWA 4GNKB 2RH9A 3EB2A 2PP1A 3IJ6A 1M53A 4DN1A 4NJIA 3LU2A 8TIMA 1MO9A 4AXNA 2DQXA 3A4XA 5SWUA 1WXJA 2CPUA 4QJ4B 2GJPA 4UB9A 3BZJA 1T99A 3VD9A 3DGZA 3QQ1A 4IOTA 1C8XA 4MAZA 1FWDC 2D69A 5C0QA 1NM9A 3L5OA 4ATLA 1P6BA 1JG9A 5DO8A 2ZC1A 3MHFA 4Z2KA 3STCA 1M7JA 4GHRA 1GPWA 2QT3A 2EG8A 1AMYA 3TJXA 5HOSA 3TQKA 4OOZA 4DJFC 1TTPA 1G94A 1WDWA 1G7VA 1K9EA 2ACUA 3TC7A 1YNPA 2YBUA 3F4CA 2JGQA 4W93A 3F5KA 4JTAA 4L1XA 1NWTA 4EPDC 4I9AA 4YJ5A 1W3NA 1Q6OA 3CHFA 1EYEA 5JIWA 4JIIX 2VCAA 3W84A 5GNXA 1VRXA 3KP1A 2Z6JA 1V0NA 4QS5A 2PLCA 3QV6A 2QW5A 2A3BA 4S3EA 3P3BA 1BD0A 3WH8A 5CSSA 2F6KA 1JJKA 1F73A 1H7OA 2Z25A 2ZUVA 4S3KA 3O6DA 3H23A 5GNZA 1B3WA 5K4XA 1TKKA 1CGXA 1E6XM 2YL8A 5DY3A 5FS7A 4DJEA 2YSWA 2G95A 4DPQA 2G37A 1W91A 3TYUA 1GONA 1SJBA 4TVCA 2X1SA 4K38A 4P8UA 4PB5A 5FJRA 4IT1A 1UWSA 4XBKA 4Q3MA 3FOKA 3FCPA 4AIBA 2C3DA 1QHZA 4JQ4A 3G3MA 3GO2A 4HU4A 3AI0A 1CLVA 2WSKA 4WY0A 1LLZA 4JNZA 3W22A 3W7RA 1GVRA 3A3WA 1U30A 4C6EA 1QW7A 1XXXA 4OWGA 1BTCA 4Q8PA 3Q94A 4QNWA 3W7EA 1ADOA 3GVQA 4F0KA 2W63A 3WBAA 2GQWA 2WLZA 1R3VA 1PKNA 3IVSA 2J78A 2WYSA 2RAGA 2GQAA 1FDYA 3BH4A 4JFUA 1QFEA 2X8RA 2DUAA 4UBPC 4FI4A 3O7UA 3NQ2A 4FOUA 4W87A 5DQPA 3RJYA 5LNWA 5DANA 3LCIA 3BV4A 3R25A 4Z2HA 3PB2A 1DHPA 2XFYA 5BWAA 4IP4A 3P0XA 4JQAA 1JD9A 3THDA 1CGVA 1GKPA 2HVOA 3VO0A 3L4WA 5MHBA 1N8FA 4OUEA 3VIKA 3MO7A 3IUHA 2O9TA 2WNQA 3GBEA 3GX9A 3VZZA 1TB3A 4WDUA 1GERA 1XBVA 1GZ1A 2A5HA 4JQ1A 1LT8A 4L61A 3FAWA 3T0DA 1ZFJA 2Z26A 3WFAA 2YCJA 1TG7A 3B9NA 5HJXA 1YNYA 4TVWA 3C8NA 2CIPA 4G8TA 3W7QA 1H1YA 4HNVA 1WOAA 4AIOA 5BMWA 3BLKA 5A6SA 3N9SA 1F3EA 3ABQA 4NI8A 4UQDA 2A6NA 3N15A 1Q8JA 4TTUA 1PKLA 1KGXA 2VGBA 2UBPC 1VBRA 3MY9A 5C8BB 3KW3A 1R0MA 4JHOA 2PDWA 4DBUA 4HVXA 1H51A 3HJEA 4ROPA 4JNMA 4N6EA 1VENA 3CUXA 1F6KA 3GD4A 2FB2A 1GREA 4RCXA 1XWYA 4XZWA 2PD9A 3W7CA 1JPMA 1XP3A 1ENUA 1YQZA 3BGAA 3LGDA 2ZZ0A 3I68A 3BCJA 2OX4A 3WUFA 4PTNA 1KXQA 3M1ZA 3MI2A 3TYBA 2XN1A 1HP4A 2YVJA 2G4FA 2P0OA 1Y8BA 4HYWA 4PMRA 3U7BA 4MYAA 3ZVHA 1PX8A 3LHTA 1UKTA 4GFSA 1ODUA 6A3HA 3E5BA 1KCZA 3B05A 3JR2A 2BNJA 5J5RA 4C6CA 1VFOA 1Q6EA 4UZSA 1W5NA 1PX4A 1R3YA 5U25A 1G4TA 2VX6A 4WSKA 4TMBA 3UPBA 4LUTA 1F8IA 4GCAA 2NT1A 3LRKA 1DL3A 4XZMX 1CT5A 3MUAA 1J0JA 3LLFA 3QTPA 2HK1A 3W1XA 5C2CA 4FAMA 3PG9A 3YPIA 2DSKA 1HZYA 4RDZA 5TQLA 4QFUA 4M0XA 3SQPA 3LDVA 1PIFA 1AK5A 2WBGA 3BARA 3QFEA 1EJVC 5CKSA 4AZCB 2J66A 3LERA 3HZ3A 4XG1A 2O4MA 3W76A 1VHNA 1H7WA 1WBJA 1TMHA 3QBUA 3BLDA 3H2NA 1GPFA 1LG1A 1ZTVA 3VKBA 3KBNA 2O56A 4N4QA 1AQMA 3IJ7A 2EPHA 2YCLB 3F4WA 1MYRA 2EQ9A 1XLIA 3OZMA 1DKWA 5LNRA 3GE7A 3TAKA 4W8LA 4P8WA 3UWWA 3CEUA 3EAUA 1ZALA 4XZIA 4EX4A 4UR7A 3MUZ1 3B8DA 1WDSA 3OG3A 4QIUA 4LC6A 1F05A 4RNJA 1N55A 2XDFA 2AGTA 1H5VA 3NTYA 3NDOA 1S2CA 1IXOA 3GDRA 3VKDA 3LXAA 1JXKA 2GJXA 4AVOA 4G1NA 4GUHA 3RDKA 4Y96A 2NZLA 4KW2A 4H4PA 3B0YA 3E0VA 5HAOA 5IRPA 2YXXA 4TXEA 3B0VC 5BCAA 4Z1BA 3CWOX 4HNTA 2PDFA 3LV6A 4JIRA 4POCA 3QTGA 3IEBA 2JE8A 2ZXBA 2WHLA 4JR5A 4KF1A 3EWWA 3BG5A 3EX1A 3WFZA 3SAZA 4CCDA 3GC5A 3LNPA 1B3OA 4WY0F 2OWWA 2OT1A 2GH5A 2Z24A 3TN3A 2W3ZA 5D38A 4QEEA 3W2KA 5JUVA 5C7VA 3VX1A 1KA9F 1KRAC 2VDHA 3LPPA 4MWAB 1J10A 1HIZA 3S5OA 4JFSA 4DELA 3H6OA 1V51A 4ENLA 4TVDA 1QJWA 3P7YA 2QVNA 1OG6A 2GR0A 4QG9A 4KPRA 2ISSA 3VGDA 2XN2A 1G9HA 1KM5A 4AG0A 4BF7A 3AIQA 5D2YA 3V16A 2BVDA 3OTRA 3C0LA 3S2MA 4BI5A 4E2BA 4HQVA 2HBVA 1E55A 5I23A 2X8CA 4PMXA 5CCZA 4K1WA 4PCTA 2PTWA 1BVNP 4MOZA 2NQ5A 3KRUA 1DWHM 4R3UA 5C2XA 4FF5A 1ME7A 2V69A 4YYCA 4UMBA 2UWFA 2FPTA 1V02E 1DYSA 2PP3A 3W75A 4HN8A 3AJXA 1OCNA 1Q4NX 4NHVA 1BXNA 1W2VA 3GXIA 3DU0A 2DJXA 1O4UA 2NWRA 2DZXA 4HJWA 3PUEA 4UQBA 2BFGA 3W27A 4AXKA 5LIXX 4FEZA 3LRLA 3HO8A 1BPLB 4R53A 4OZOA 3V7PA 2PDHA 3MP3A 4GGBA 4D1IA 5BXSA 3V0TA 2HBXA 2CZFA 1LF1A 2CYGA 3N2XA 4JQ2A 3SUTA 1VBUA 4OVXA 2V3GA 3WQ6A 1TV2A 4V27A 1GOXA 4FSAA 2XVKA 1WDPA 3FVMA 3EOLA 2GR3A 2OCZA 4ZFCA 1KW1A 1EEPA 4Y8FA 3LCXA 4JTGA 4CU6A 3CASA 2VTFA 7CGTA 5CZKA 1NPXA 3EWBX 4HHLA 1K6WA 3WK2A 1V7AA 2Y6ZA 3AMLA 5LNVA 3PPFA 4LYPA 4XQ6A 3A21A 3LPGA 2OKTA 2QYGA 4JEJA 5HMEA 4PE8A 1W9VA 2XVPA 4OV9A 5D32A 3KBVA 2ZKMX 5FS8A 5FS9A 1PKMA 2DUXA 1DHKA 3U2ZA 4O13A 4JAWA 1UMLA 3U6WA 4UXDA 2YB1A 4RDWA 4W5ZA 1YDYA 4QR6A 4ZO8A 2R24A 3GG1A 3VFCA 1T40A 2IPFA 4U2YA 3NZ1A 3PTQA 1LOLA 2E68A 2VUNA 7A3HA 2JIEA 1YDNA 2WANA 3DUGA 1GK8A 2GWGA 1BLIA 3NQ6A 4I6KA 4X9SA 4E5TA 4WVXA 4AIUA 1EXPA 4H4QA 3W02A 5IXEA 5CBIA 4JX5A 1I2OA 1J0IA 3DXIA 1FRBA 4GZJA 4JTRA 1A0DA 2RDXA 4HT3A 1EC8A 1QPNA 3GXPA 3GSMA 4IPIA 4Q8NA 3URNA 2Y4SA 2ZDRA 1FHUA 1R7AA 1HP5A 3UERA 1HX0A 2QPXA 1I2NA 4FPSA 1CLKA 3TJIA 3GD3A 1RA5A 1OWQA 2G3MA 4Z1DA 1GRFA 2BOEX 4D6DA 3TIMA 2Q01A 3GFZA 1RZMA 1N5WC 4PGLA 1L8PA 3AUOA 3PPCA 5A6AA 3KUMA 4B5NA 1MQPA 1XSKA 5D30A 3UJ2A 3W1RA 3CUIA 4JFVA 2IW0A 1W9PA 1A5KC 3EA3A 3EOUA 3WD4A 4IFKB 3PPHA 5M03A 1K4QA 3Q6JA 1AJZA 3W1UA 2OVLA 5GNYA 1MFUA 1R9XA 3P80A 5E0CA 3NYZA 4NYUA 4H50A 1XCWA 2V3AA 3OLEA 2W67A 2GGHA 3KOZA 2HK0A 3QOMA 4AY1A 1IWAA 2ZYFA 3NRZB 1UA3A 1E4MM 3WBWA 2OJPA 3XIMA 3M47A 3IV3A 2EQDA 3VD3A 3D0CA 3MCOA 2CLHA 1UZ1A 3UQNA 5E6YA 2IS7A 1OFQA 3WD0A 5I00A 2JALA 4ERAA 4UCFA 2WCGA 4D6HA 1LOQA 2Y88A 1PPIA 1E0WA 3H2OA 3WX7A 3OA5A 1XG3A 4LYRA 4W5UA 4L9YA 1E71M 3V18A 1X1NA 5A6MA 2CXEA 2F84A 3DI0A 3EX6A 1JDAA 3G8RA 1TE6A 3T0TA 4AZGA 3WBEA 3NZGA 1ZS2A 4HP5A 3IJIA 4EXQA 4IFOA 3TN5A 5HUOA 3W1TA 4KMQA 4S3AA 3OLGA 4F0RA 2Z1VA 1VFTA 3D47A 5A95A 3UYCA 1BVZA 1VLIA 2BLEA 4IG2A 1EPVA 4I7UA 1IHIA 2DPEA 2A1YA 4US5D 4CN4A 4MWAC 1E40A 3WO8A 2HTMA 1OT1A 2V5KA 4GX8A 1IR1A 3W83A 2Z1SA 2J13A 2WCSA 1RY0A 3RM8A 3SY8A 2ZRXA 4R7WA 3URBA 5JH2A 1OX4B 3N12A 3S9IA 1Q85A 1ZCOA 3LOTA 1OZQA 2PRLA 1YLVA 3GB6A 1X7FA 3HURA 4RXFA 4XSMA 4HPNA 1M5WA 1S1RA 4RZ4A 3VD4A 4H6KA 3APTA 1QW8A 2DY3A 2A3LA 4P2VA 1W3JA 3Q4DA 1FUYA 1HKKA 1FEBA 2V82A 1BTMA 4P7NA 3LHZA 3SY1A 3L21A 4ERIA 3W6YA 3AMDA 3WUEA 4PUUA 5EMKA 3UA3A 3WQGA 6ALDA 1NVMA 3W2NA 3QFWA 3PG6A 2MNRA 1V6VA 1XGZA 1YMYA 2LLEA 1HL8A 3LXCA 2GVLA 1FVPA 2A6LA 4E3TA 1EUAA 4JTQA 4H3DA 1KKOA 3R58A 1AVAA 3ES7A 3GFXA 4AMAA 2ATMA 1FFRA 3DG3A 4PCFA 3L68A 1KM0A 1UBSA 1VBHA 3F1QA 2NXGA 4H9TA 4GQBA 2I14A 3M0HA 3ITTA 1NWSA 3E2VA 1P6WA 2YXGA 1X6NA 3UBPC 3LQGA 4W88A 1GJPA 3CIXA 2AMGA 3UVAA 3DERA 1UD6A 3NIYA 4LV9A 4D2JA 5EL1A 4EWJA 3M0MA 1SU5A 2J4GA 4HNLA 3S5NA 4K2SA 4WJ8A 4JIEA 3VIJA 3P82A 4UOQA 4RKAA 4JFTA 1SQ7A 2AAQA 4PB3A 3V1HA 3RK8A 3A24A 1RY8A 3AZSA 1UR4A 1TCMA 4OKDA 3SZ8A 4H4RA 2X41A 4N2YA 1C29A 4CN1A 1X98A 2JGYA 2ZA1A 4QLKA 4M81A 2EPLX 3PN8A 3LPFA 3MB9A 4NAFA 2XPKA 1GGOA 4DLMA 3VCCA 3NA8A 4E8GA 2E5CA 2J47A 1OM0A 4EMJA 1V3HA 1T0OA 3L5AA 1M68A 2XH7A 3KCJA 1ZUAX 4YTSA 2ZRVA 2VEGA 3TEVA 2DZTA 3DKLA 2YYTA 2VR5A 1LTDA 3WNOA 3H22A 1XYFA 3AS1A 1PO9A 1TUXA 3VNYA 3WLLA 4NJKA 2QR6A 2CLPA 2DIJA 1GOIA 1TWDA 3HGJA 1U5HA 4PMZA 2CZVA 1W1YA 4OT7A 4WHBA 4J3TA 4UFHA 1SSDA 3AIWA 5JCIA 3HBLA 1PBGA 3BJFA 3WUGA 4Q4KA 3W87A 3H2MA 3VOIA 3T4CA 2WMIA 2TAAA 1TPB1 1K4HA 5DELA 1WX0A 3N9RA 3R07C 2NQJA 4CD7A 1E6ZA 1TVPA 1JGMA 3U7VA 1LBFA 5HWJA 1XIEA 3S5ZA 4H7CA 5C70A 4KWUA 4X0NA 5CBJA 3EBVA 3I7QA 3VIMA 2J8FA 2CHOA 1A5UA 1MRAA 4S3CA 1OYAA 3VI2A 2FMNA 3WQDA 3KVJA 3L23A 1Z6KA 3CUZA 4YIWA 3KE0A 1WPCA 1N63C 3VC6A 3PF3A 5HQLA 1QNOA 4LGXA 3N2MA 4TX9A 3O05A 5E9AA 3FKKA 3VIFA 3NEHA 4R85A 5A6BD 5A8GA 4UTFA 1ZL1A 3GWQA 1ITXA 3T4WA 3TQVA 3OQEA 1TELA 2J25A 1S7MA 3W2MA 3GFYA 1V4YA 2NX1A 2YLAA 5C7HA 1XIIA 1PKYA 1SFJA 3ZR6A 4Q6JA 2VUYA 4PC8A 4XD6A 2GWNA 1ZB5A 4L7ZA 4YWSA 4HGXA 4DAIA 5FOOA 2VRJA 1XHCA 1ZBVA 5AC7A 3NOEA 4GVHA 5B7YA 1QPOA 1F76A 4AEFA 4RDYA 4KWOA 3V0SA 2I17A 1OSEA 4GZ7A 3TK7A 4I9MA 3FEQA 1JDCA 3WMSA 4H9VA 2PD5A 3KAOA 3ABOA 2FZ9A 3VYLA 3F2CA 3JVAA 2R14A 5DLCA 4GC3A 3DH7A 1UMYA 3QGAC 3G1SA 1FECA 3H2EA 3GLCA 1KD0A 3PC0A 4E38A 2XSAA 3CM4A 4KEUA 4L9ZA 2AQVA 4JZ5A 3KL3A 3GW0A 4NYYA 4IGHA 1C8QA 3GH5A 4QSFA 1TPFA 4LRTA 1Z69A 5CEWA 4LUIA 1K7XA 4KCTA 2O7QA 4UC5A 3L9CA 2NPXA 5A6TC 3C0QA 4OU1A 1Y5XA 3T09A 3CXOA 1OCBA 2CLEA 1C93A 4H9ZA 3ZS4A 2I9UA 1XPGA 2WVVB 5G4EA 3BAJA 3VX0A 1JUBA 2I57A 1OG0A 1UH4A 4YHGA 3FX4A 2XU2A 1UIOA 1X96A 3EOOA 1KTBA 1BXBA 1CXKA 1KM3A 2DVTA 3FHQA 5BRQA 5ECUA 2B7NA 1ZPTA 3CGTA 4AVNA 1XYMA 4F0MA 4YVXA 2BVTA 2X7VA 4RK8A 1V6UA 2BS9A 2Y1HA 3DN5A 4J57A 5CG0A 4IMEA 1N8WA 4XIAA 1NHQA 5U7SA 2FTYA 3VVGA 3UD6A 1WKEA 3ARPA 3Q58A 1M3UA 5CSUA 4ICMA 2DEPA 1BAGA 4AD0A 4HNOA 4NZJA 5REQB 3TWBA 4GPNA 2DZAA 4L56A 3O0KA 4PZVA 4CQ8A 3GU1A 2OQHA 2P1FA 1HQTA 4J56A 4MWAE 3CJPA 3QZEA 2CCRA 3B40A 1Q6QA 3ARYA 4LYQA 1TREA 3NVVB 3S2LA 2VZSA 4PBEA 3VGHA 1PIIA 1E4IA 1GOOA 2NLIA 1KCKA 4MM1A 3S2JA 2PLKA 2GGIA 1ZGDA 2VX7A 4KFOA 4DWSB 2EF9A 2FVMA 1XLAA 1LQ2A 5I07A 4S3JA 4XAPA 4A3QA 1UOZA 4MZYA 5C55A 3GR7A 3ZLHA 1OFOA 3VNJA 1GJUA 3OC4A 2J88A 4KEZA 4JTDA 1EQCA 1RLDA 5FL0A 1RP8A 2ZX5A 3S6OA 2PZ0A 2X40A 2VWSA 2CFFA 1JYWA 4KESA 1RCXB 4ORMA 1BYDA 3AALA 2VFGA 4FXRA 3OODA 2Y7DA 2J7HA 3QLLA 1AW1A 4DNAA 2Z29A 4AC1X 1XH0A 3UR8A 1QR7A 1OC6A 4L1WA 1YHTA 3KXQA 3B8UA 4D6IA 4TU1A 2VC7A 3ZWSA 4JYEA 4ONVA 3ZM8A 3FG2P 1QMLA 5KZEA 3UJEA 2Y70A 1KFEA 3NQVA 4LSBA 2C8NA 1ADDA 1JI2A 4FOJA 4JIHA 1HJXA 4ZOCA 2CC0A 3TTQA 3WK0A 2Y2WA 5EBAA 1K9TA 1NFBA 1J18A 1XYAA 1R3TA 2AL2A 1OD8A 2VDIA 2A3EA 4IPJA 2EGZA 3SR6B 4UZUA 3NQDA 4CCZA 4MKNA 3GRIA 4WQ6A 2XINA 1BHGA 3FYOA 4H2HA 4ZOBA 3LPOA 1PB0A 1UW9A 4LQ1A 4HTYA 1CGYA 2VQTA 2GK1B 3VKAA 4W4QA 1XRFA 3OJGA 4HCDA 1XYLA 5JIPA 4Q4OA 1J2BA 4BQ4A 4UFIA 4XD5A 3HQPA 1RUSA 3QFAA 1W1ZA 5XIMA 2X0SA 3ZJ6A 4ZB0A 1XGDA 2XVLA 1ISYA 2ZQ0A 3ANYA 3S2CA 4C1NB 2IXVA 4NJGA 1EL3A 1WZAA 5CC7A 1B31A 3NJ3A 3KTXA 4Y9MA 3ARSA 3NSNA 2ZCGA 2A8XA 4D6CA 5TD4A 1FCVA 2CZ5A 3NYDA 2ANUA 2P3ZA 5A6LA 3VABA 1H11A 3W1MA 3LNMA 5DX7A 5FL1A 4QDMA 4BF9A 3PUOA 3DHPA 1DNCA 5LSMA 1HJSA 4Q33A 4ADSA 4B4HA 1UD5A 5A2CA 1MW2A 1K9FA 3K1DA 3TYCA 1H6VA 3TOYA 4WJXA 3C2OA 3QR0A 1HGYA 2QGHA 3BDKA 1AW5A 3KWSA 3GDMA 4O16A 3BMXA 4RE0A 2OEJA 3MJMA 4NASA 4QAWA 4B9ZA 4RL3A 3UG8A 4HPXA 3WLKX 4A05A 4Y9NA 1GXFA 4FXFA 3GM8A 1BQCA 1FX6A 3GIQA 4J2PA 2GYIA 2OO0A 2Y5JA 3H7VA 3KEHA 1C91A 2P3EA 4CNPA 2FFCA 1E0VA 2WBKA 4AUBA 3TLLA 3LM3A 4HHPA 3SQLA 3PPGA 1XKYA 4Q4QA 4QE1A 2WCAA 2ZA2A 2ZZ2A 2GPTA 2EBNA 1IT8A 3T2PA 1RR2A 3QOKA 4AHPA 3VKCA 3M6DA 4NI3A 4O14A 3BAIA 3LZ5A 3GD6A 2Z0IA 4H19A 1EXBA 2I56A 4HA3A 2GQ8A 1ICPA 2CLMA 1T6MA 4GIYA 4UR9A 4Z2GA 1F8WA 1W2PA 3UJRA 1B3VA 5IM51 1S1PA 3R11A 3RLGA 1VIWA 3ZFHA 4PFHA 3WLNA 1KM4A 3RX4A 4PULA 1JCXA 1JZ6A 5FF0A 2QUNA 2ISDA 3FSTA 3PBWA 2QIIA 3K4AA 4IXHA 1HL9A 1V0KA 2C19A 2B7PA 1FOBA 4IQLA 4Q4RA 5D2TA 3FA4A 5A69A 1J12A 1POKA 5LXEA 4PH6A 1NDYA 2F2HA 3NPXA 2UY2A 1DJHA 4HKPA 4XB3A 3VUSA 1ISVA 4WRHA 4M7SA 3BC9A 4NJJA 1C3FA 3JW7A 1UASA 2C0AA 4KWWA 5JBDA 4DYJA 1JROA 4MB5A 5JCNA 1TJRA 3AXXA 4MPQA 3SADA 3HN3A 2QCHA 2E5DA 4DEFA 4P8XA 3GNNA 5DRIA 3AXIA 2TPRA 5EMLA 4GACA 4LVAA 4J28A 2Z6IA 1J4EA 5DRCA 5JCKA 3DJGX 3BOLA 5K9CA 4AY8A 5AVHA 1M03A 1JPKA 3TC6A 1B5TA 1Q65A 1ONXA 1S5TA 3CNYA 3PUDA 4O1DA 3KS6A 3LB8A 3R89A 3GY1A 4GVFA 4PUJA 1TVNA 3PG8A 1IR2A 1L6WA 3CZLA 3FHAA 3TNBA 3PTDA 4W8AA 3P0WA 2Q8ZA 2WP5A 2P50A 5I77A 4H00A 1E15A 3O15A 1XD0A 4H4TA 1SYTA 4NXKA 5FJJA 3RRAA 3TYZA 1DIDA 3VFLA 1GG0A 3UXLA 2EG7A 1F5ZA 3KTSA 1QWKA 3MS8A 3ITGA 3AYTA 2W5FA 4NEVA 3HOJA 1HUVA 2ZZ5A 2PAJA 1FY6A 1OHLA 3GTXA 4ZZ9A 4IMDA 1OABA 3RAOA 1XICA 1C92A 4GXPA 4QSHA 7REQA 4LA1A 4CD8A 4DBDA 1UH3A 4ECLA 1UWTA 4L6DA 4JDYA 4RNIA 3W24A 5CGTA 4JY8A 5M2FX 4ZOHB 3AZRA 4FMVA 5KZDA 4CD4A 1TA3B 1TPVA 3KX6A 4LCRA 4X60A 3TUUA 1XLHA 4AWSA 2YA0A 3AS3A 3EOEA 1G7UA 1FP9A 4KEVA 3UZWA 3DI1A 1UKQA 4GH1A 3I3BA 3R1ZA 1UIPA 4AU0A 3L4VA 1OY0A 1IWPA 2J9XA 4QTGA 3N25A 1EFZA 1BSIA 3B06A 1BEUA 3N6QA 1YADA 3DK4A 3SCRA 1E9ZB 3EWYA 1XLMA 3SM0A 5F2GA 3VKJA 1KBJA 2DSZA 1VJZA 4ZSUA 1DQXA 3PTKA 5LGZA 3LCLA 2C6QA 3CBWA 1I0DA 2ZADA 3WELA 4HOXA 3LCWA 5K9DA 4WKHA 1BXCA 1RALA 3M0LA 2DW6A 1RHCA 2VX4A 1FO4A 3WDQA 3SJ3A 1W37A 3W7KA 3P8JA 2VGIA 4MHBA 3A6OA 1DE6A 5JBEA 2EKGA 3EWXA 2ZX7A 4NP7A 3DG7A 1YPXA 1E1CA 2VDGA 4XK2A 2PF8A 4RLIA 5I79A 1UUMA 4H4WA 2QMKA 2IKIA 3NO3A 1L9WA 3KBSA 1VEPA 1Q6FA 1RCOB 3MPGA 1A49A 4NZ3A 5LYRA 4AIEA 2XN0A 5E09A 1BF6A 5ECVA 4AHOA 5A8NA 3MP5A 3OPSA 4Q8WA 4DNHA 1KXVA 4DRSA 3H24A 1V3LA 4EF9A 4GO9A 3AS2A 4ZB2A 1A5NC 2QAPA 4PSPA 4XD4A 2XYLA 4WDTA 1S46A 4RNFA 1W1B1 2VJXA 3CZGA 4APNA 4O28A 3UR5A 3NZRA 4AY7A 3CHVA 2PDPA 2JIWA 1XRTA 4HCLA 2BGSA 4CEUC 3WJYA 4Z0JA 3GNRA 1VFMA 4DWSD 2PC4A 3M46A 3LENA 2BP1A 5D37A 3OIXA 2DZSA 2H8XA 4F79A 1GOQA 4HU3A 5E93A 3TQ0A 1B4KA 4GVGA 2E7FA 1CEOA 1PEZA 4QM1A 3CGCA 1KM1A 3IIXA 1C90A 3LHYA 3LMZA 3MSDA 2VX5A 1IXQA 5FD0A 4R33A 1U22A 2QLYA 2HVNA 2WHJA 4JN7A 1G6CA 3LG3A 3L5MA 1CNVA 3CT7A 2EEXA 3VIPA 2OU4A 4EAMA 3TH6A 1JUKA 4GR1A 2QCGA 5HWNA 1P0DA 4DXXA 5HNRA 5HPCA 3VD5A 4WOZA 1QI0A 3MA8A 3EDJA 3LMYA 1XIGA 1H61A 1D3HA 2XSXA 3SBFA 1XIDA 1P4CA 3GH4A 1NDZA 2BASA 3UY8A 5F4XA 5A94A 3I4KA 1CTNA 3GR4A 4E2DA 2WKLA 3WQVA 4K1GA 3REQB 4J9JA 3DZ1A 4Z0SA 4E6MA 3RPMA 2PGRA 1I75A 3RMJA 4J3UA 3Q67A 2ZXAA 3T81A 3VUPA 4FR6A 2FGZA 3EWDA 3MBFA 1P1MA 4V33A 1MXGA 4AZ7A 5HPOA 5CH9A 1Q6GA 5F2LA 3WBXA 2OT0A 2J7EA 4TV6A 1IT0A 3NVTA 3SRHA 2WHKA 5CPMA 3D9XA 4PN2A 3LGGA 4W86A 4L4OA 1TMQA 1OX6A 2VEFA 3O9NA 1H3GA 2YB4A 3S1UA 1KR0A 5E0FA 1R3SA 2J77A 3M16A 4YPJA 5C9WA 3W3OA 2VYOA 5A6JA 2YKKA 2V2CA 3HQOA 4C1KA 1I6NA 3PZ9A 4CVUA 5H8MA 1E70M 4NILA 1X39A 3AXHA 1KQYA 2WAGA 4AEEA 7TIMA 1X6LA 3WLQA 3KM8A 3BMVA 1W8SA 3WNLA 3NM1A 3R2GA 4YTRA 2OYMA 3SRKA 4AYSA 4O4WA 4TQTA 3S9ZA 1IEIA 3PSWA 5D9OA 3RO8A 4Q22A 2P10A 4LOCA 1FWRA 1M7PA 1TQJA 3BLFA 3FYYA 3IIVA 2TYSA 3SY5A 5CAHA 1GRHA 2OG9A 1W9UA 1FXQA 3CZKA 5H6HA 4PFMA 1KQZA 3L5LA 1BWVA 1JZ5A 4J35A 3IJ8A 3SR7A 3CZJA 1PYMA 1YBQB 3CQ0A 3WN6A 1CW2A 4GIRA 2REQA 2TSYA 3N13A 3WMLA 3GXDA 2EPNA 3L0NA 1OF8A 1OZMA 3E9AA 4AD4A 1JRPA 2ZVIA 3BLPX 5BYWA 5AECA 1XQKA 1K70A 3H4XA 3C8FA 4IPPA 2QJNA 4BFAA 1S2WA 1DJIA 1XQLA 1EA0A 4AW7A 4DJED 1XSJA 3M41A 4Y6GA 3W00A 3WDHA 4LAZA 2C0HA 1QAPA 2ZFAA 3V5FA 2X99A 4GUFA 2NXIA 3VM7A 3W0KA 2VI0A 1S39A 1N8IA 1QO2A 4C6IA 4HHMA 1HGWA 2V5LA 5FACA 2VXNA 4HSNA 1UWQA 2RJGA 2E5AA 1FTXA 4HCHA 3BO9A 3O6YX 5CSRA 2DT1A 4KQNA 1RD6A 1R2SA 1V3MA 2QDHA 2WC7A 1D3GA 5DEZA 4UNKA 2R94A 4F2TA 4HA0A 5A3HA 5DT7A 3MV01 1I45A 3CU2A 4H4SA 3LTYA 3NDYA 1QATA 1E1FA 1QRQA 3MUY1 1KRCC 4NG3A 1PHWA 2WKJA 5FF2A 1VR6A 2E09A 1NFGA 3EPOA 1ECQA 3V36A 1XYBA 2PWVA 1H50A 3TYDA 1OX5A 3POCA 4R88A 1TV4A 3UJSA 4H4VA 1QTWA 2JEPA 2R1PA 1S2AA 2XIJA 3GKFA 5MKGA 4FDCB 1VRDA 2OGJA 2R91A 5FSEC 3IGHX 1M41A 2ABAA 3KL0A 1L0PA 5EBUA 4E4FA 2IPJA 5I3GA 4NXSA 1MXDA 1F3XA 1UWRA 1QNVA 4GZEA 2BOFX 1NFPA 3JUGA 5E0KA 3HMJG 3ZJKA 3BG9A 3DESA 3ZWTA 3AHVA 3OHMB 5CPOA 1WUEA 8CGTA 1CZ1A 4QLLA 1H5YA 1XPYA 3AQUA 3BSHA 1N7KA 3IVUA 4ADUA 2P8CA 4Q8MA 4B2DA 4CQ9A 1JFHA 1W1IE 2ICSA 2PDUA 4GYKA 4HHHA 1WXZA 3HPAA 3KBWA 2PTDA 2Z2AA 4NIRA 1JZ3A 1K4GA 1N2VA 3L66A 1AH3A 1UR3M 2QS8A 4JYFA 3BG3A 4DY1A 2V3BA 3S83A 4Z1YA 1KR1A 4LAUA 3KRBA 3LI0A 4GJ1A 2J8TA 3C2RA 3WLHA 4DJDA 4HMEA 5I3KA 1JPIA 5PTDA 5D2VA 4V28A 4M51A 3B0PA 1EO7A 4MGGA 3PS7A 1MUWA 3C52A 1NU5A 4WKAA 3AHYA 1WKFA 5CZTA 3CT2A 4BQ5A 1SO5A 4DM1A 4IZGA 2P8BA 3GG0A 1K8CA 5H8UA 3CIVA 2YVFA 3EB3A 5IBXA 6CGTA 1VIZA 3EWZA 1KGUA 2OSWA 2X1IA 1ZRQA 5K2ZA 3G1DA 4F9JA 4H6EA 3C5QA 4MB3A 4ZO7A 4EP8C 5HA7A 2V5DA 3QHMA 3TZNA 3WFLA 4N4PA 1H7RA 2XIMA 2YL5A 5D9MA 2QCCA 1EF2A 2XIIA 1JAKA 3W23A 3BSMA 1I0BA 1IF2A 4WX2A 1JDDA 4V2XA 3VIGA 5CC5A 3AIRA 3DFSA 2J7BA 3KVLA 2PCQA 2HE8A 2QF7A 4LEQA 1S2TA 2ZUUA 3K1GA 4IF2A 4K3ZA 1RV8A 3LTSA 3UXDA 3F4NA 5HNNA 4R7OA 4J5NA 2A7RA 1A4LA 3QRHA 3T1GA 1XKJA 1VP5A 3TMQA 2GGGA 3VGEA 3MZ2A 1A5BA 4U3AA 1SFLA 4IICA 3SFWA 3TNOA 2ZX8A 4GMEA 4HBKA 3UYIA 2PWEA 3HQ1A 4PRTA 1XIJA 3M0ZA 3AN1A 5I3JA 1XDJA 4ZXLA 1SMAA 1I1XA 4PSRA 4C6OA 3DHUA 5AHLA 3JU2A 5KVHA 5L9FA 3EX4A 3NGFA 1TMLA 1JL8A 1G5AA 2PWFA 5FESA 1GKQA 1Y0EA 4DJFA 4M56A 2W0UA 3UG4A 3O2LA 3B0XA 3DFQA 3PBVA 2HMCA 2CBVA 3BUVA 1UKPA 1US2A 3CHCA 4CKQA 3FGCA 2EXOA 3FJ6A 2PU0A 2G0WA 4PEKA 1AMKA 1G0CA 2R8WA 3QW4B 8XIAA 4H4UA 3FJLA 5AC5A 1D8CA 1XR2A 3CWHA 4H8HA 2ZX9A 4GQQA 3J7HA 2GZXA 1V02A 1VFLA 2RJHA 3CQHA 4O52A 5D2WA 3OGRA 3MWCA 3IAPA 3KFTA 3CPRA 4LV4A 1LYXA 3TW7A 5H91A 3G1VA 1SFTA 2WVSA 2CHNA 5C9ZA 5LIYX 3QY6A 2V6OA 4EMWA 1R85A 2V3FA 2PWHA 2ALRA 2C13A 2YW3A 3B97A 3D6NA 3N04A 5D33A 2A7PA 3R94A 3VINA 3TLQA 1GSNA 3ATYA 4RV8A 1JR1A 4JHZA 3RLHA 4PYSA 2QXWA 4EPKA 1QNSA 3W07A 4O57A 2FYMA 3QV7A 4GXWA 4G5DA 1K1DA 4OECA 1QI4A 3MJYA 2ZZ7A 1MDLA 4I9TA 3HU7A 4GRSA 3CMJA 1E9YB 3AM9A 1XH1A 4AZ5A 2PRHA 1RLCL 1JULA 1TYTA 3KOYA 3OYZA 1PTDA 2NQLA 3LADA 2E9BA 2HPIA 4J3ZA 3MC5A 3BMWA 1OC7A 4C6DA 3S6TA 3W26A 3HGRA 1REQA 3LSCA 1DVJA 2CLKA 4ATDA 5K7JA 2PB1A 3UXIA 2PE4A 6REQA 5BU9A 4YLWA 3KBMA 3FV9A 1JI1A 3GR8A 4XZNX 1N82A 4XWUA 3NFUA 3NQBA 4MG4A 3STGA 3NDZA 1VJSA 2RFGA 4GA8A 4PR4A 2A0NA 3MU7A 3WKZA 3ALGA 1KTCA 2YXOA 1WOBA 1OFEA 3C4UA 3DCPA 4QGCA 1RK5A 1VCVA 3F03K 3DFNA 3W1QA 3I10A 1UPMB 1DXFA 3AHTA 2OQLA 2YL6A 5M3WA 1TR9A 1CBGA 2PDCA 4DZIA 4D6EA 4D72A 1XIMA 1JZ8A 4L4PA 2ZTJA 4WCJA 4JX4A 4Z42C 5T26A 3HPXA 4ZSTA 4AHQA 2D2HA 3VOGA 3L4YA 1EUNA 3V1PA 3O63A 3HQNA 4UQCA 3PHAA 4LANA 1KRMA 3QGVA 5JXQA 3S2NA 3ABRA 1V0LA 4CQAA 2DV0A 4GUGA 1KBBA 3BAKA 3OHIA 1JEZA 3QQ0A 4P5UA 5FJPA 3DBPA 3IGUA 3SN4A 3R10A 3IK2A 4GRTA 4W84A 1WCGA 4A2RA 4QE5A 1AH4A 3EPMA 4AYGA 4ZGYA 3R4IA 2ZRYA 3CV2A 3DC8A 3R0UA 1H41A 4OE7A 3H26A 1TIMA 1EKOA 4P7LA 1QDSA 2BC0A 1CPUA 3K30A 1OGSA 2HWGA 4JTIA 3QPZA 2XZ7A 5CSYA 4HZ7A 4DBSA 1FIQB 4C6NA 5RUBA 4CNNA 2VGGA 1THFD 1US3A 1M65A 3L8KA 5CJ5A 1QASA 1TZ9A 1KNWA 5LIWX 1GOWA 4B3LA 3EZ4A 1PTGA 1YNQA 1F61A 4P7QA 1FHLA 4GNJA 5TBOA 4AEOA 3E49A 1LRNA 5H2ZA 4WD0A 2AL1A 3S42A 2VGFA 5EMYA 3IIPA 1P7TB 2XWEA 3QJAA 3OB8A 4DXVA 5K3VA 1EBGA 1W5QA 2VFFA 3PVFA 3BLEA 2CDUA 1S5MA 4ACZA 3DDMA 3TQPA 1C7SA 4EQSA 1VDVA 1LZOA 2RGLA 3UY7A 2QZRA 2TRSA 3V3WA 2BXVA 2OGYA 3WZ0E 3FJ4A 4LB3A 4RDVA 3SQMA 3CHDA 1FQ0A 3W01A 3CLMA 3WQ8A 4C6LA 4M1BA 2AQWA 1H7NA 1NOWA 1R38A 1LJYA 1RP9A 2E28A 1LLWA 4H83A 1XRVA 1DOSA 3SCSA 2J9YA 1O7AA 1U33A 4XZLX 2A3HA 1BSLA 1NQ6A 3KLLA 1VQTA 5IDZA 2YDQA 1FWEC 3N2BA 1KLYA 4IMAA 1GHSA 3ZZ1A 4GO8A 1SR0A 5G5IA 4LX4A 2F5ZA 1FBAA 2OR2A 3W7DA 2C7FA 3NM3A 1L6YA 1H1ZA 4MJZA 3B9AA 1Q3NA 3O0FA 1G67A 1ZJBA 3SGZA 1S3HA 3N4EA 3I4EA 3UZXA 4A35A 4JHMA 1K9DA 3K4DA 1IZCA 4HZ8A 3WJSA 1YKWA 4O0QA 1W32A 3GNDA 3ERPA 1B1YA 4ZE4A 1WP6A 1LROA 1DBTA 3WLIA 1B9ZA 5D03A 3GG7A 4IIDA 3W2LA 5DMLA 2C71A 1SUXA 5KEZA 4HNUA 1OK6A 3VDBA 5CPNA 2XGIA 2YGYA 3BW4A 1LL6A 1RD5A 2J7CA 5GJPA 1ZBKA 1EH9A 5KSWA 4QHRA 2OTDA 2CLOA 3JZEA 1HKWA 1HVQA 2A4AA 4K7YA 1P0KA 3LCFA 2NVCA 1QNRA 3CMGA 3LQLA 4HA4A 1J2WA 3TSMA 4ML9A 3QHOA 4M6PA 3BAYA 1CWYA 5F7UA 3RLUA 2H3DA 2FZBA 3H70A 5FF3A 4ZOAA 1S5NA 4FNTA 3GZAA 1LT7A 2V30A 4IIBA 3UGRA 3CQIA 4GUIA 3KRZA 1A47A 1LPFA 1G1YA 1TV5A 4FALA 1B4EA 2QAEA 3EX2A 4P8VA 4EKJA 4CD6A 3SCOA 1Q4WA 3ELFA 1VBJA 2CEQA 5IBXC 1BQGA 3GYCA 4M6UA 1TZZA 2PWUA 1KTNA 1CXLA 4MF4A 1Z3NA 4RW5A 2FGLA 1TJ0A 1ZU8A 4KIRA 2WHMA 6PTDA 3E1F1 1EJ7L 3QW3A 4JD4A 4PUEA 5AHFA 4UNIA 3QR3A 4A21A 3QM3A 2Y8VA 2HVMA 1WZLA 2ZOXA 4MYXA 4CNTA 4BA0A 2E6FA 1R30A 2Y8KA 3FW6A 3NPWA 2BWGA 3ME3A 4K37A 3B9EA 1UG6A 1AD4A 3SSZA 4LS0A 1TJPA 1KRBC 5IDIA 3RO6A 3OZPA 1A0EA 4OOUA 1PXGA 3IK4A 5F1UA 5D9NA 5AKQA 3COTA 3GQYA 1B3XA 3RX2A 4QLJA 3WF3A 1J6OA 1PSCA 5GQBA 3NL3A 3C6CA 7XIMA 4UTUA 4AD5A 3M0XA 2W0HA 4WK9A 3WNPA 1K03A 1X1OA 1V77A 1ONWA 2JQXA 4MLJA 5CXPA 4ZODA 6XIMA 4HJFA 1YRRA 1EGVA 3F5LA 5HMSA 3H2CA 4DBEA 2Y63A 5DXYA 2BC1A 5GJMA 4FXJA 4HNCA 3P14A 2X8GA 1J0YA 3G77A 2QMJA 3HPFA 2RKXA 4D8AA 1E73M 2PLMA 4REQA 3RNMA 3K46A 4UIOA 3R0KA 4ZB5A 3MWAA 1M6IA 1C7TA 2E77A 1DIEA 1HXJA 1Z89A 4MY9A 4OBRA 5CQ1A 1P0NA 1JYVA 4A3UA 1KC7A 4TUFA 4IM4A 3BLLA 1QPRA 3UA4A 1QNPA 2FZDA 3DX5A 4W7VA 5BROA 3OP2A 4LAKA 3CUJA 3W7GA 3VKKA 3G1HA 4YTUA 4JDBA 1PHQA 1XGEA 4IPNB 3G22A 4H41A 4X61A 3IIZA 4XTIA 4C60A 2Z4GA 1JRCA 2BODX 1IGWA 4NEWA 4NAEB 1YQ2A 1TPWA 1R5YA 3KZSA 1S2UA 1IQ8A 4AISA 1BFNA 4GCXA 3CLWA 4M6QA 1UC4A 5A1AA 4MY1A 2IPGA 3O6AA 2QCFA 1TX2A 1F74A 4HOZA 2TMDA 2C1GA 4H8NA 4AZCA 1U5VA 3PFRA 1FH8A 3ZT5A 4DB7A 4WEVX 2Y7FA 5C9RA 3GTIA 4MLRA 4Y8EA 3HFTA 3KP0A 4WJEA 3R5EA 1RM6B 3O0HA 3W7JA 1XCXA 3HG2A 4HPHA 4YCPA 1EHAA 4PCSA 2YCLA 5G1TA 3QV8A 3GU2A 4HMNA 4LS2A 3S3GA 4PRRA 1NP2A 5DN1A 2GFTA 4MY8A 3T07A 3IV8A 4GY0A 2D0FA 3UPWA 4M19A 2C3ZA 4FLOA 1E6SM 3W73A 1XX1A 4YCOA 2QHAA 1OJTA 3T8LA 1JPHA 1VAHA 1A4MA 1SW3A 1O60A 2E1DA 1FP8A 1B54A 2Y61A 1OIMA 1L6FA 1GYMA 2D3LA 2BY2A 1GVOA 2EQ8A 1T41A 2D1ZA 2Y5EA 3TVAA 4QS6A 1V0MA 1TWWA 4ZL1A 2NVKX 2EG6A 2WJDA 1OADA 4O1EA 4LCSA 3NVYB 3T8QA 2GUUA 4MWAA 5E5CA 3I6TA 2BX7A 3AZTA 5CPLA 4V1YA 4EM3A 2ZZ6A 4X3ZA 5K9XA 1J01A 3ANVA 1GVIA 2NSXA 4FNUA 1OFPA 3A22A 1YIXA 4IFRA 1VJIA 2YCKX 3E96A 4BEQA 2D2GA 4OJYA 2Q09A 4GBUA 3A7RA 1NDVA 3ONBA 2ZZCA 1I2RA 3IUDA 5EBKA 3WH7A 3WCZA 3UCDA 4L64A 2AKZA 4Z17A 4G7EB 4L6OA 3A7UA 3MYPA 1K8YA 5AHMA 4G6CA 3DYPA 3BLIA 5E6ZA 1IZKA 4JKKA 4OGZA 3U0HA 1T8QA 3VA8A 3CB8A 3H4KA 5HMFA 4MB4A 1B9BA 5I78A 1B57A 2GJRA 4IX2A 4GIEA 4HU0A 1HT6A 4TVUA 3GS6A 2VHLA 1C8VA 2XG9A 1H60A 2Q8LA 1VD6A 3LY0A 3LLDA 4OQVA 5I02A 3H54A 4HYRA 4JYDA 3WF1A 3R43A 3H53A 3ZJ8A 3BOFA 2O4QA 1XRSA 4XTDA 1LVLA 3GYEA 3SQSA 3ITYA 4EOUA 1S38A 3DG6A 4XUGA 3PR2A 2O9OA 1BYCA 2WNNA 3AMGA 1IEXA 1CENA 1EPXA 3QY7A 1ME8A 4IISA 2ZC8A 3WQWA 1VPQA 4A3HA 5CBBA 3DYMA 4LNYA 1OFDA 2IMRA 1DQUA 4WKFA 3TJLA 5I09A 3N29A 1VCGA 3W88A 4DF0A 2CXGA 2VEIA 1VH7A 5T9BG 3QYSA 1GQIA 1Z8AA 3PNUA 4CQDA 4M1RA 2WLYA 5I5RA 1BGAA 4U31A 4X22A 1HKVA 1TYPA 4C6QA 4U28A 2YZRA 5HBFA 3KVKA 1N62C 3AJ7A 4O0ZA 4I90A 1Q6RA 2KAUC 1V7YA 4GXMA 2WM1A 3EXRA 4J7RA 1JCYA 4M7TA 1TV8A 1FWHC 4B92A 1NHRA 3RM4A 3PZVA 2DSVA 2JFEX 5JU6A 5G4HC 2HNEA 2FLIA 3CAQA 4D1JA 4S23A 4URIA 1QOXA 1KFCA 3CTLA 3EOSA 2HRWA 1R2TA 6XIAA 1UP0A 4N9DA 1PS9A 4JS3A 1KM6A 2RDWA 4C90A 2RHGA 2EPOA 3WH6A 5C6MA 3K13A 1QI3A 4WZHA 5AYIA 3IGXA 3OOQA 4Q8OA 4B5VA 4XBJA 3RRXA 4WGXA 4WF7A 2DP3A 4UQ9A 1K02A 3IPWA 4B5TA 4GABA 3ICJA 4O1BA 1EJXC 1EIXA 1VB9A 3VIIA 3FA5A 3OW1A 1VGAA 4N9CA 5BZAA 4M24A 2QEZA 2PWGA 1QHOA 1W3IA 1WNOA 3K4WA 1ELSA 1MNZA 4DHGA 1X38A 2WWCA 3FYPA 2J6VA 4NU7A 2VFEA 4IH3A 2ZRZA 4K7ZA 1E3ZA 4EMIA 3UZ5A 2E3TA 2W92A 2DZWA 3QSRA 3Q2DA 4IFKA 3DYOA 1AUSL 3AXKA 2NQZA 3BPWA 4RJEA 2ACQA 3EA2A 3NNTA 2VZVA 1GHRA 1SB3B 4LVGA 5I7GA 4PMNA 1MEHA 3TN4A 4DYEA 2VL4A 2WSPA 4ILSA 3IS4A 2PCEA 3T7VA 3NQGA 4J3SA 1UD2A 1W54A 1XLBA 2G3JA 3GXMA 3BW2A 1EGZA 1GEHA 1DXLA 4MUZA 5DF0A 3HV9A 3LCHA 2ZICA 4GX9A 1J0HA 1GVYA 3GVVA 4X63A 3PZTA 3RFAA 1GORA 2YA2A 2CBIA 5JH1A 2QJMA 3URAA 1DV7A 2Q71A 3EKLA 5AC4A 1R47A 4XAYA 1QBBA 2BVYA 2A2IA 3SSJA 3CGDA 5EPDA 3KCLA 2HZGA 3EX3A 3VDAA 5D8WA 4NNAA 1CCWB 4QDPA 5I6SA 4CEXC 4DUVA 2EQ6A 4M82A 4B15A 2V2DA 1O1ZA 3A3HA 5LIKX 1EGMA 2VNCA 4EPBC 4CCCA 1GKRA 2DZVA 4MNMA 2XFWA 2V6AA 3FA3A 1TQXA 1XYCA 1UR2A 3UR7A 1CB2A 1NDAA 1E0UA 1AOGA 1KKRA 3MT1A 5F4SA 3ZYZA 3W7PA 1W8GA 3R6IA 1BRLB 4XO6A 2IPWA 1HJQA 3F4DA 1RJQA 4JEQA 2BHUA 4HPJA 3WL1A 1KWKA 1XLEA 2R9ZA 3UWEA 3GH7A 3U4FA 1M04A 4PRWA 4AB4A 1OX4A 4IUOA 5E1QA 4C6PA 2FGBA 2WJEA 3ECQA 2P53A 5AVNA 2PODA 4AWUA 1TV7A 2TODA 3M5XA 1VHCA 3GTNA 1GRTA 2XVGA 1J93A 3U2OA 1QUMA 1JNDA 3TXZA 4GJIA 1PCKA 5D09A 3EWUA 5EMUA 5D4YA 4S3GA 2GSEA 4FNRA 1H1NA 3TJ4A 1W9BM 4KGJA 4KCUA 1PJ9A 2E3ZA 3T0AA 2QUUA 4C91A 3SN0A 5AB3A 2HNHA 1R46A 2POZA 2VMFA 3ITXA 9XIAA 2BXZA 1W1VA 5FJIA 2WMJA 5HNTA 2PF0A 1DEDA 1ISWA 3W6MA 2QDGA 5HUPA 1ZP3A 3L4XA 2X30A 3FNDA 4KT2A 3KHJA 2TPSA 2B81A 1NOUA 1YPIA 4QXIA 2DSWA 3RIKA 1UCWA 4S3BA 2OEMA 2ZRWA 3W1LA 1PZ1A 2ZDSA 3HGSA 4Q4MA 2IQTA 3TTEA 2PTYA 1V8EA 2EO7A 3LYEA 3S4TA 3NQMA 2PMQA 3DFOA 1FEAA 5HATA 4AZ6A 2MANA 4D8LA 4LUSB 1UOKA 3N73A 1FH9A 1P0BA 5C9UA 1LP6A 4YWIA 4UUIA 4NZ4A 3V5OA 4I6VA 1JF5A 1OINA 3CZ8A 5BXRA 5DCEA 2GUBA 2PDJA 2HPMA 3RPTA 4A8IA 3P84A 3E2QA 4JNYA 4ZTXA 1NJJA 3CMFA 3K8LA 4MJ2A 3CUHA 2G4JA 2X0YA 3ETRB 4LBRA 2AOSA 1FWBC 3E74A 4F0HA 2FHCA 4S38A 4MZ1A 5ABHA 1OFAA 1UWIA 2J7GA 4EVZA 4H9XA 4BY3A 3HPZA 1WB0A 3UNDA 1RSCA 4DF2A 3WDJA 2J7DA 3A47A 3M7WA 3F4VA 1E0XA 1F6PA 4H2CA 4UWMA 1ZAHA 5CG7A 2Q6ZA 3WF0A 2INZA 3SFKA 1XLFA 2FH8A 5A8OA 1NH6A 3CK5A 1UR1A 2CZDA 2QV5A 2CKRA 1OVDA 2CLIA 3QYQA 4S3FA 4U10A 4G56A 2KZHA 4EF8A 4JL2A 1EBHA 2ZXDA 1H2IA 4BURA 2OYLA 2FH6A 3WG6A 3MKCA 5BXTA 2J3NA 4DUXA 1DWFM 1XLCA 4YTTA 3H8AA 4DO4A 1LUCB 1Q5MA 4FZIA 1JAEA 3BICA 3H4WA 3N11A 2C1HA 3R13A 1P5BA 3LTPA 2GDVA 3MMDA 2JK6A 4IXXA 3HM7A 2UV8G 1VQZA 4B5SA 4I5XA 4M52A 2BXYA 1J11A 3GHUA 4DI8A 2YOCA 4DM2A 2OZ0A 1OQFA 3FEMA 1HFBA 3PK7A 1OBAA 3NAVA 1DTUA 4KFNA 5KVIA 4L4LA 3CPUA 4IIGA 2OXNA 4QE4A 2X50A 3U2CA 1JYXA 2PI6A 3ALFA 4A8NA 1YTDA 2NWSA 1XL9A 4AX6A 3S0CA 2XM2A 3F5JA 2OQYA 4V15A 4QDWA 1LL4A 1V3JA 5FJOA 5AC8A 4XVEA 3ZLFA 4IGNA 4PTMA 3L4ZA 1Z48A 1YX1A 4CUCA 3TW6A 1KCLA 3EF6A 2WJZA 3ANUA 1V5XA 3NVZB 1ZKQA 4P7RA 4IIHA 4N9BA 3FGCB 1LRTA 2BVWA 4RXGA 2GQ3A 4ZXOA 4L1GA 4X2PA 3NCOA 3NXLA 1WA3A 3GTHA 1DIKA 1G4EA 5JBFA 2ZUWA 1R2RA 5T91A 1PDYA 2X1RA 3PWAA 1GZGA 1U1HA 3WIJA 4CU7A 3EA1A 1DQWA 2HE5A 3M64A 4EANA 4MNJA 3W81A 2XIOA 2B7OA 5CPSA 1AZ2A 2MUCA 1ZMCA 1CX9A 1A3XA 4F4RA 3T44A 3OLIA 3GNOA 2OZ3A 4WXYA 2J75A 1TV3A 3UR2A 4UTHA 3STPA 1AJ2A 3FLUA 3ARXA 2QCLA 4DXKA 2RDTA 1UP2A 5AYBA 3G2GA 4EAYA 1F8MA 3L0KA 2VZTA 5FI8A 2GR2A 3MQTA 3POHA 2V8ZA 3MO4A 3A4AA 2XUCA 3KHDA 2DU2A 1Y5WA 4LF2A 4H9UA 3FAXA 5KTLA 3OZOA 4DVOA 4I7VA 5FF7A 2YDAA 2PDYA 1QT1A 2VFIA 5HJYA 4NZFA 4GFIA 3TR2A 3WF2A 1GYLA 3MSRA 2QCDB 3NSMA 5KZ6A 1EJSC 4ZMGA 1QW9A 2WVVA 1MZHA 2NX9A 1EC7A 1XD1A 4AF0B 2B31A 1KFKA 5M5DA 5CJMA 1D7FA 1SW7A 4BV6A 3TCSA 1V79A 3EDKA 2PDXA 1L6SA 4C6MA 1FWIC 3USZA 3U57A 2BHZA 3H55A 3OVGA 3M5ZA 1UBPC 2B4GA 4NVTA 4O17A 9RUBA 3PWGA 4ORIA 4F66A 3WLMA 5AFDA 4XBSA 1H0GA 5JCMA 1Q1WA 5TIMA 4DAFA 4Q7NA 2WMHA 3OVQA 4R7JA 4RPQA 2CW6A 5K4ZA 4RV3A 4R27A 3SUWA 3E0WA 3B9JB 4PL2A 1VC4A 2PPGA 5REQA 1BZLA 4G7FA 3BOXA 2E67A 4PUKA 2I7GA 1GEQA 1XIBA 3WJXA 2YYUA 1ICSA 5U4NA 1U2YA 4WOQA 2DQWA 2QJJA 1OFRA 1UJPA 1J6PA 1O5KA 1FWGC 3BGJA 4NL1A 3PZMA 5HINA 5IOBA 3CAWA 4E8CA 5IHSA 3U4AA 3APGA 1EX1A 4DWSA 4UTWC 2FJUB 4O53A 2D23A 1GRBA 1H49A 2NUXA 4HYVA 1NSJA 4DPPA 3AWNA 3LK6A 3ZVIA 4U2ZA 3KWXA 4DF1A 5HR7A 3SECA 4Q7IA 1V08A 1D7YA 1MW3A 1L6GA 1SFSA 3UW6A 2ABBA 2PGEA 3HW2A 4AQLA 2PS2A 4MUPA 2X0HA 2ZX6A 4KH2A 1E6RA 3UESA 1E5JA 2YFNA 2PRMA 1G69A 3W70A 1XC6A 4WSJA 3WMCA 2RDUA 2BTMA 1MUMA 3GAKA 2G3FA 4H1ZA 3VDCA 2OWCA 2CITA 1HW6A 5HR6A 2OODA 1FCUA 3NEVA 3GKAA 4K36A 2GR1A 7TAAA 3V75A 2F61A 3EGJA 4O10A 4W85A 3CH9A 3CC1A 3G1XA 3PUGA 3SO7A 4B5XA 1O5QA 4IX0A 4DO7A 2ESCA 1UQZA 4LW7A 3Q37A 2VP8A 1EB3A 3P5YA 2UY3A 1I4NA 3THAA 4J40A 4C1LA 3G0UA 4GI8A 3VOFA 5LA1A 3R79A 4WDXA 4CGTA 4DNMA 5F2IA 2W62A 5KINA 2CNCA 3UZJA 5J8LA 2ZXQA 3KRSA 2GK1A 2FPYA 5JCLA 3V35A 4JQ3A 2DGAA 3CQJA 5C5YA 2GGEA 2HXUA 4HK6A 2V5CA 3TA6A 1U1JA 2W27A 1HVXA 3W82A 3S1VA 3O3RA 5D04C 1GRGA 1C9DA 2QAFA 1VPYA 4UR8A 2WPFA 3B3DA 2NVAA 4C65A 3WD1A 3KS5A 1HKJA 1UWAA 2FB3A 1AQ0A 3RR4A 1RBAA 3VXGA 1VFSA 3CWNA 4KRZA 2QF8A 4C1NA 5CAKA 1UROA 1E43A 1O66A 1XS2A 3QZAA 1LBLA 1PYFA 1E4LA 3LM7A 4PMVA 1ITCA 1PZ3A 2EHHA 2XSBA 4JTTA 3I7RA 1KFLA 2PGWA 5XIAA 5EMMA 4OBTA 1FCQA 4L9XA 1Q8AA 4BS0A 5A6KA 3ZIZA 1RJRA 1VEOA 4ZQRA 2HSAA 1FDJA 1AQHA 2VD9A 1TPC1 1GNXA 5FAJA 2QJGA 4NY2A 4BI6A 3MKKA 1D8WA 4B3KA 3GXNA 4PTWA 1W5MA 3UZYA 1H4PA 5L6UA 4NKCA 2EPMX 4JX6A 4BI7A 5B7ZA 2WMFA 5A5WA 3STEA 1JDEA 5T8GA 3OVPA 2GDQA 3W71A 3PBGA 3C3NA 1Q6LA 3SURA 3W37A 1WKDA 2QUMA 1WQ5A 4W9TA 4E4PA 2YW4A 4I8YA 1HJUA 3NURA 3ITLA 4B2DD 1Q2SA 3W1AA 4US6A 1VFHA 1XW8A 3THUA 3W7OA 2W3SA 1H0IA 1JZ4A 3C2YA 3P60A 4K8GA 3PWIA 3H4GA 1XG4A 3WQFA 4NZ5A 4G2DA 2WC3A 4KRUA 3UF9A 3HA1A 2XH2A 4W7UA 4JTSA 1EDQA 3NPUA 1PWLA 3EDEA 3EPNA 5BW6A 3TAOA 4OHQA 2VC5A 4DJDD 4K6AA 2V67A 3MHUA 1FXPA 5LGXA 3TTOA 5B80A 4GWEA 4CD5A 4ROQA 5BMXA 2DIKA 1VYRA 4PUNA 4ASTA 2E9MA 2YR1A 3DIPA 3HTWA 4PBFA 4R5EA 5ABFB 3NVWB 1CXHA 3UG5A 3W2UA 3KZPA 4N7QA 3VE9A 3SJNA 2QIWA 1K3UA 1XIFA 1A80A 2H9AA 2ZRUA 3IRSA 3M4HA 2HDJA 1ZCCA 4AD2A 2BCPA 1DE5A 1LCOA 2WZEA 4O18A 3NZPA 2C14A 2NSOA 3CH0A 5AZ1A 3SW6A 1TUFA 5AC6A 5DMMA 4M5PA 4U5IA 4EWND 5A8QA 2DORA 2QPSA 2JF6A 4EQWA 1EWEA 3GRSA 4LY4A 1GETA 1UZ4A 3VZXA 1DJQA 2F8QA 4F2BA 1QHPA 4GZIA 4J1OA 1X7IA 4MSSA 4E4UA 4YNGA 1NDWA 1DPMA 3K8KA 4CNSA 2PDIA 4UTLA 1KN0A 3AIBA 3ARZA 3UZZA 4JDRA 5M17A 1MQRA 4FS9A 1AL7A 3B8SA 4RE4A 3APYA 3RJXA 1J5TA 5AZ0A 1B2YA 4DO5A 4ZQOA 1NOFA 3PTMA 3TZFA 5F4WA 4MFDA 4DJFD 2JF7A 3SB0A 3LA4A 2ISFA 2X2GA 3CAVA 4GI9A 4UNLA 3S5SA 1Y7VA 1C8YA 1XBZA 3L4TA 2AMXA 1LLOA 3HJZA 4XV0A 4MKSA 2OFJA 4L5ZA 3V4BA 1M7XA 3GU9A 4REQB 4HSOA 3C0SA 3EKZA 2H6RA 3CV7A 4IJRA 5DMNA 1TCDA 5AYXA 1E1EA 2H90A 1F4AA 1WAWA 3IJDA 2VR2A 3E3HA 2E6DA 1JCLA 4GINA 1YXCA 4AZHA 4CNUA 3EMCA 4Q8TA 3XINA 3U2EA 3O1NA 2W55A 3UP8A 2VFDA 4WSHA 3V0UA 1VLWA 3A64A 4JTEA 1QI2A 4AH7A 1KBIA 3OZYA 1R7OA 4LFYA 2HEJA 3S1GA 2O7SA 3NQEA 3P74A 2A7NA 3TYEA 1SZFA 1JCNA 4KGLA 1TA3A 4FNQA 1UH2A 1E9IA 2E40A 4LF1A 3E2RA 3S47A 3G8EA 1JDFA 4WY0B 2FMOA 3KLKA 2I5IA 1VFFA 3SUUA 3RX3A 2OMAA 2J8GA 2OLSA 3NQAA 1TPDA 2P5NA 1R3WA 4PB4A 4GLEA 4F48A 3QMTA 4S2CA 5FAGA 4DZHA 4W89A 5HQMA 4IWWA 3CV6A 3SGGA 3G1AA 3L65A 1EO5A 4KKXA 4JTHA 1TE1A 2EJ1A 1DWJM 1TVLA 2WO5A 3PZQA 1HG3A 2QGYA 4YVPA 5G2WA 5DT5A 5JMUA 2WSRA 1X2HA 5G1YA 3H7UA 3GDLA 3QLDA 3VMPA 4ZOEA 3PJUA 5GPRA 4GYPA 3T2OA 4J2MA 3T78A 3HF3A 5CZJA 2D24A 4C7FA 4DZAA 3PZNA 1RBOB 3HGOA 3VK5A 4Q8VA 3NGJA 4N0RA 5C54A 1UUQA 4Q4SA 4FB7A 1JZ2A 3IARA 3MI6A 3VGFA 4MNLA 4ZTYA 4WXZA 4B16A 5IFPA 1VFUA 3IUIA 5CGMA 1HJWA 2Q3OA 3B4YA 3P93A 3A9BA 4Z2IA 3UCCA 4AD3A 3W74A 3M43A 4RZ6A 4QJ3B 3RGTA 3ARQA 2EKCA 3DGBA 5ER0A 1U83A 1CDGA 1JFXA 5DFAA 4F2UA 2WPEA 3CL8A 3VNKA 4MDOA 1X8FA 2FVKA 4DWSC 1KFBA 2NV2A 2J7FA 1B90A 3DFPA 4ZQPA 4D6FA 3N3MA 1YEYA 3AHZA 1N60C 4UOZA 1WYIA 1A5MC 2O55A 3D3AA 4DO6A 1VCFA 4NNBA 1OCQA 1ZBWA 3KBJA 2PTZA 4GGHA 4NJHA 3WQCA 3KDNA 2IKHA 2VRKA 2XJ7A 4NX0A 3UEQA 3K2GA 3MZNA 4YVVA 5D8ZA 4XUYA 2AAAA 4B5WA 1WAUA 4OBSA 3MHGA 1D9EA 3N9KA 3VU2A 4O4VA 5AYYA 1VYSX 3LEPA 2G3NA 4C6FA 4GE8A 4QJ5B 4F3HA 3SCWA 2BHYA 4NQ1A 3CYVA 4KWVA 1FA2A 1JCTA 2H8ZA 3EDDA 4JTKA 2F7FA 1ECEA 3AICA 2DJLA 2L5HA 4IJBA 2ZIDA 3DECA 3ZVHB 3T40A 1DJWA 2D2OA 1Q7QA 1Z32X 2D0HA 4J27A 1NEYA 1LORA 7PTDA 4ATWA 4KBXA 3EDFA 4INFA 5EU9A 3SUSA 2Z28A 3NUKA 1KBKA 3I6RA 4TR9A 1XUZA 3C3UA 2OZ8A 4DX3A 4QG6A 4MAVA 3REQA 3O07A 2W79A 4LUTB 3DH9A 5CPTA 1K7EA 3LUTA 2DVXA 1GV4A 4HK5A 1UR9A 4J4KA 5I06A 1K8ZA 3GUWA 2PBGA 1F9CA 3URQA 3NO1A 3WNNA 1LG2A 3TOPA 3BCDA 1Q7MA 2I1OA 1TTIA 5DCBA 4CVWA 3P67A 1MVYA 3WEZA 1CB7B 4JTLA 4KS0A 1TIWA 4JKLA 1ZSXA 2V0TA 3SRFA 3C2FA 1XLLA 1SVDA 3GHTA 3GXFA 3PZUA 2JKPA 1Z42A 2WSYA 1SO4A 2ATSA 4JXCA 2EAWA 4H4XA 2CERA 2NV1A 1YE4A 3GC4A 3UFYA 4ML4A 2VELA 5I3IA 1QNQA 2ZE0A 2O0TA 3WQEA 3ATZA 4QG8A 4DLFA 3KOXA 3F2BA 3UXKA 4AZIA 1KCXA 1Q1RA 1ZXIC 2D73A 3I7SA 4NF7A 4JOMA 1C9WA 2W91A 3CIWA 1GW9A 2V68A 3CQKA 2GJXB 1PUDA 1Z41A 1DJXA 1MW0A 3USBA 1FDZA 4DZ5A 4Q6XA 3CHEA 2W66A 1O68A 3HRDC 1YBQA 5LNSA 3PFMA 2VVNA 2E6YA 4FX8A 4X0VA 5CLTA 4PCPA 2YVGA 2ODOA 1RVKA 4OFCA 4FOKA 2X42A 3VDGA 4H9YA 2IUZA 4R9OA 3B8IA 4DJEC 1V59A 4QBXA 2J6XA 1TRDA 2NXHA 2QDEA 1T96A 2QUVA 4FIRA 4HK7A 1US0A 3RN6A 3EAOA 3SI9A 2F6UA 5HMDA 2G50A 3AOFA 3TV8A 1VF8A 3M0YA 4YYFA 3HV8A 1PVNA 1EYWA 1EDGA 2EPKX 4X2RA 3N6JA 1GYNA 4F0SA 4GIAA 1GVSA 1J8VA 3MCMA 4O1CA 1GCYA 2YJQA 3DKJA 3VD7A 3UWYA 3RM9A 4PMUA 2WPGA 2VCCA 2W6RA 4ZFMA 3ZSTA 2QULA 1CLXA 3LHWA 4O12A 2NUYA 2BGNE 2XIQA 1EHNA 3RPDA 2E25A 4R34A 5HWMA 1LOSA 3I65A 3QH2A 1UWUA 2X16A 1TWIA 3T0BA 1GWJA 3O16A 4GVIA 4NZ1A 1H2JA 2V5BA 3T9PA 1JF6A 5CJNA 2ZZBA 1MXSA 4EPEC 1LL7A 1S5VA 4Y9AA 3M0KA 1RA0A 1JPDX 1DJNA 4PMQA 1BWCA 4O19A 2B0MA 1R9ZA 2ADAA 1O94A 1TJ2A 1HL2A 1UPPA 3MUXA 1UKOA 3CAKA 3VOCA 4D6JA 1IV8A 2WXDM 5DMYA 2YFOA 3GTFA 1EA9C 3A12A 3F2DA 4GUJA 3A9IA 5LHEA 1LDCA 4DWDA 4YMZA 4C6BA 1ZY9A 2UY4A 1R3QA 2OPJA 4GKLA 2GRTA 1VPXA 2OSYA 1IEVA 3HIJA 2O9PA 4W7WA 1M6JA 1EDTA 3CPGA 3LRMA 3UCQA 1I2QA 2E1WA 3C86A 3MI3A 5ENLA 2PC8A 2BSLA 2ZUMA 3WYZA 1RQHA 5G5GB 4G9PA 4KEMA 1WDRA 4TX6A 2XGBA 9CGTA 1PE1A 1MZRA 1W3LA 3GVGA 4Y9OA 3U48A 3IRDA 3ZJ7A 1S3TC 1E9LA 3AIVA 3FK4A 3MCNA 3O06A 3P8IA 3WLPA 4EQXA 2D0GA 3WNKA 2GDUA 5TNVA 3U5YA 1DIOA 3WQ4A 3M9YA 3VCRA 3TWAA 2OLAA 4ZENA 3FFSA 2XIBA 5HNUA 4ZBCA 3PULA 1R6WA 1YDVA 3M0VA 4EK7A 5KZMA 1ZENA 3ORWA 3OGSA 3IACA 1BKSA 3BZGA 1ZBCA 5LHFA 2XHYA 4Y2WA 1XIHA 3TTYA 3NXFA 1Y5VA 3E5PA 4QJ1A 1N61C 4LS1A 3JRKA 3CUFA 3LXBA 1GTHA 3D3FA 3P61A 3P2VA 4MIMA 2ZVRA 4TTGA 1W1TA 3BTNA 2F9RA 2C3CA 2D3NA 4IL2A 1HO1A 4FIQA 3BURA 2BV9A 1H63A 3W1NA 4RX0A 4GG9A 1G01A 2W9MA 4I3GA 2P0IA 2XGZA 5AN7A 2NQHA 2ZUNA 2E5BA 2IQ0A 4FHAA 1NF7A 3NR0A 2G3IA 3DGRA 3L12A 3W29A 3M44A 2C16A 1NELA 1W6TA 4BKNA 1FKWA 1FFVC 2QV4A 1M9HA 4IMGA 4IGMA 3WJZA 4UFMA 3FS2A 3PJTA 2DH3A 3BQ5A 2CFYA 1ODZA 2WNWA 4I9JA 4MDPA 4XKYA 2XH0A 1O95A 1JCJA 3C2EA 3VMNA 2PDNA 4IQDA 2XFFA 2Z1KA 3WEOA 3MTWA 4IQJA 1PTAA 3AMCA 2WMKA 4H7ZA 4S1FA 1W1PA 2DVUA 3UNTA 8A3HA 3CB3A 5EGRA 2YX0A 2ACRA 1J9YA 5G2HA 1GUVA 4IIEA 1CGUA 1GQJA 2NQ9A 4KRTA 1SO3A 1MEIA 4JTCA 2E0PA 3GNXA 5FJTA 4F9DA 1TTQA 2HS6A 3ARUA 4LRSA 2XISA 3FKRA 2WVTA 1Q6CA 1PX3A 1JQVA 1MQQA 4A22A 3WQPA 1POJA 5CZSA 4GYPC 3T05A 3N2OA 1JXJA 3QHNA 3UU0A 3NQ7A 4JIPA 1IXPA 4KWSA 1B0IA 3QZ6A 3W38A 1IIHA 3BW3A 1TPH1 3MUCA 3PANA 4R9XA 1AG1O 4Z2JA 1LM1A 4ZA0A 3WUBA 2CESA 2GJNA 3TX9A 1BYBA 1JUEA 2JEQA 2VC9A 3WQOA 4LXFA 3BK0A 4UFKA 3SGUA 1I8JA 4IG2B 2R1NA 3D46A 2FZMA 3G3DA 3MP4A 1E0TA 3EWCA 4AWTA 1W3TA 5HJLA 4UTJA 4TMCA 1FWNA 4K39A 3TSBA 4V1XA 3M7SA 3MANA 5FA5A 3ARRA 4PMJA 2E8YA 3MVIA 4C5ZA 4MWAD 1R9YA 1Q2RA 4IGSA 2AGKA 3TR9A 4OTKA 2WPBA 3L2IA 2Z00A 1CECA 3H2FA 2VZUA 1T5AA 3HFYA 2PBOA 4BF5A 1XCFA 2IQDA 3E0IA 1TFVA 4J3XA 2OO6A 1XBYA 2DSUA 1LQ0A 1I60A 4EQRA 2ONEA 2WQDA 5DY2A 5HXMA 4L80A 4UTTA 2OX1A 4MADA 2X8HA 3W9ZA 1XLJA 4AMCA 4LYKA 1P0EA 5EB8A 3N34A 1FWSA 5BOFA 2DZUA 3IAQA 1DTNA 4LALA 2YAUA 2Y8UA 3INPA 3UPMA 1DXEA 1SGJA 2CETA 3TSDA 1ZDLA 1O6IA 4BK9A 4DIAA 2X05A 1AODA 3BV7A 1GQLA 1VZWA 2FHFA 3HB9A 3AISA 1R3RA 2QVHA 1WDDA 4N6FA 3TKFA 4Z08A 4ZEPA 1EP3A 2F38A 3BL3A 3IIOA 3WLJA 1XYZA 3R12A 3N17A 4XD3A 3WH9A 3SRDA 4UFJA 3S9YA 1TPEA 3GHSA 4JN6A 3TCEA 5CZ0A 2R1LA 3E2SA 5HK4A 1SZGA 3AC0A 3PJWA 1XFCA 1EZWA 3QC0A 1BF2A 4LVDA 2Y89A 4QCEA 1SR9A 5J5DA 4PBGA 3PAJA 1CI1A 1FHVA 1XANA 5I0DA 5TF0A 4FA3A 1BYAA 4N02A 1GVFA 2JBMA 4D9PA 4NAFB 5I3DA 5LXXA 2YBVA 1MO0A 3B8WA 2BY3A 2XTKA 3FIGA 2VZOA 4GQ0A 2ALDA 3W85A 2GVYA 3LV5A 4ZO6A 2EJAA 1W0MA 3VPLA 1DJZA 4WLCA 1LRQA 3F7JA 2XM1A 1ZNNA 1DJYA 5BXPA 2R1KA 4JTJA 4BCEA 4CQCA 3GZ3A 2PDQA 1RPXA 1UQYA 4MZ8A 3QMSA 2INFA 2VKZG 4LUYA 2YL9A 4GJJA 1R87A 4GYJA 3WLOA 4S39A 2FHBA 3C0JA 1OEPA 4A4AA 3EKGA 3OBEA 4F8XA 2PA6A 4HMCA 2PFHA 4UQEA 2QCMA 2WOIA 4IMCA 1IGSA 3R7MA 1ESWA 3WLRA 2DDXA 4O8RA 4KPLA 3LHUA 2J27A 2DW7A 3ISIX 4PUDA 4ERGA 1SSGA 2WMIB 4UTIA 3RUBL 1Z44A 5KETA 1JNEA 3RF9A 3NL5A 2E6AA 3QQWA 3G24A 4HSHA 2DH2A 3MSGA 1SJCA 4I5UA 1UZDA 3B9DA 1OYBA 4AAJA 5C71A 2BY0A 7ODCA 3MBDA 1P7TA 3WDIA 3W7HA 3L2MA 4ADWA 3UVIA 4B90A 5LA2A 1B3YA 2GUYA 3MVTA 3BAWA 1XV8A 3ENLA 1BWLA 3G0SA 1XM3A 2HCVA 2RABA 1QPKA 5LNUA 3WDRA 3VNIA 4EE9A 1KXTA 4CQBA 1FWWA 1GW1A 1XBXA 3LCGA 4NRSA 3OA3A 3VIHA 1UD8A 3SCQA 3ZQ9A 1M1BA 4JQ9A 5DBUA 4YHEA 3QKZA 1NHSA 4YTQA 2Y5SA 4CU8A 1FKXA 3T55A 3H2AA 1WXYA 3N1AA 3RLVA 1I1WA 3MMWA 2Q02A 3BCFA 3CXBA 1X97A 2VOTA 3UG3A 3TROA 3OBAA 3B04A 4Q8QA 5TAOA 2I9EA 4E2VA 1QI5A 1SJAA 4FXSA 5GRTA 1ZQ5A 1FWJC 2OWXA 1WZMA 1ML1A 4KCVA 5EFDA 2Z2UA 3A4JA 4JTUA 2BDQA 2KX9A 2Z27A 3VNMA 2WWDA 1PCWA 2HQMA 1QXLA 4UMCA 2C79A 4DUOA 3MMTA 3V5CA 3ZOAA 3W72A 2Y7EA 1AZ1A 1V97A 5FEWA 1WE5A 3SEPA 5FS6A 4Q32A 4QX4A 5LZLA 3LB0A 3TXVA 1K77A 3FSUA 2WC4A 1PIGA 3BGGA 4K8HA 3FY1A 3QEZA 2CLFA 5E70A 3LHVA 3B4UA 4WDWA 3NL6A 4LH8A 3B9OA 5J04A 1GG1A 3EANA 1AW2A 5IHRA 3NOYA 3WL0A 4JICA 2VOMA 3EXTA 3P5ZA 4RUBA 1A50A 3WMBA 3CYJA 3SDOA 2VQUA 3G0XA 2IKJA <