4K2SA

Crystal structure of the mutant p317a of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
404
structure length
393
Chain Sequence
SLKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVASSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGATDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords D-mannonate dehydratase
publication title Crystal structure of the mutant P317A of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate
rcsb
source organism Chromohalobacter salexigens
molecule tags Isomerase
total genus 147
structure length 393
sequence length 404
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4k2sA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4k2sA01
2OX4A 3P3BA 2GGHA 3GY1A 3IK4A 4GMEA 3DG7A 3SJNA 3QN3A 4KT2A 4DWDA 3R0UA 4GGBA 2PP3A 3OW1A 4E4FA 4Z1YA 3MY9A 1W6TA 2FKPA 5FJTA 3NO1A 2QDDA 3DFYA 3R10A 3TOYA 2PP0A 3RITA 2MUCA 1L8PA 2PGEA 2OG9A 4DXKA 1TZZA 3V5FA 2GDQA 2OQHA 3DG6A 3V3WA 1OEPA 3U4FA 2HXTA 3TQPA 1KKOA 3Q45A 3T6CA 4IL2A 2PGWA 4DYEA 4ZCWA 2O56A 2DW7A 4K8GA 3JZUA 1EC9A 4A35A 4DN1A 6ENLA 4ZA0A 3GD6A 3P0WA 2AKMA 1JPDX 4H2HA 4DHGA 4X2PA 4KWSA 4IHCA 2PTWA 2QJJA 5ENLA 2GGGA 4EWJA 2PTYA 2FYMA 3S47A 3EKGA 4K1WA 4A6GA 2P3ZA 4FI4A 1TKKA 4FP1A 2QVHA 3I4KA 3VC6A 4MKSA 2NQLA 4KPLA 3U9IA 2PA6A 1ELSA 2PPGA 3SSZA 4HYRA 3DFHA 3TWBA 3SBFA 3R0KA 1R0MA 4HCLA 3H70A 2MNRA 1FHUA 4HCHA 1SJCA 3MQTA 4YWSA 4GYPA 3VCNA 4J3ZA 2OVLA 2PMQA 3N6HA 4DX3A 2XGZA 3ZLFA 1RVKA 3THUA 4E5TA 3CYJA 2OFJA 3UJFA 3PFRA 3QKEA 2OZTA 3RGTA 1MUCA 2PU0A 2QQ6A 3FXGA 3B97A 3N4FA 2AL1A 2OKTA 1PDYA 2OPJA 3ZVIA 1KD0A 4G7FA 3RRAA 3MUCA 3QTPA 1WUEA 1FHVA 3TWAA 5FJPA 3RO6A 4GYPC 1JDFA 2RDXA 3BOXA 1R6WA 1EC7A 1NELA 3ZLGA 2PP1A 3FJ4A 3TCSA 2OZ3A 3FYYA 2OLAA 4IP4A 3VDGA 3I6EA 2CHRA 3OZYA 2OO6A 1NU5A 3D47A 3V4BA 5FJOA 5J04A 1ECQA 1IYXA 2XH2A 3SQSA 4GIRA 1KKRA 3H7VA 2HNEA 3NFUA 1MRAA 2POZA 4H83A 3VA8A 1BQGA 4M6UA 1F9CA 3EEZA 1PDZA 3QLDA 4MMWA 3R11A 3SN0A 2ONEA 3Q4DA 3SN4A 2PCEA 3VC5A 3D46A 4G8TA 1EBGA 4KEMA 2PTXA 1ONEA 2DW6A 4IP5A 3FV9A 3BSMA 4A3RA 4IZGA 2HXUA 3SN1A 3PK7A 4GFIA 3UCDA 3UXKA 3FVDA 3DG3A 3PWIA 2PS2A 3OTRA 2PU1A 2P8BA 3UJRA 3RR1A 4HNCA 4IL0A 4JHMA 2OQYA 3OPSA 3GO2A 5FJUA 2PODA 4IT1A 1WUFA 3UJEA 4HCDA 3QPEA 4H19A 3ZVHA 3IJIA 3GC2A 3TTEA 3MSYA 2ZC8A 3MWCA 7ENLA 3BJSA 1SJDA 3CAWA 3CK5A 1E9IA 2GGIA 4M0XA 4E8GA 3UXLA 3STPA 3V5CA 5BOEA 2XH4A 3MZNA 2P0IA 3TJIA 2OZ8A 3KUMA 3H12A 2QJNA 3PWGA 3OZMA 3JVAA 3MKCA 3ZLHA 5BOFA 2GL5A 1YEYA 3DIPA 3FCPA 3R1ZA 3ZVHB 3DEQA 3DERA 3VCCA 4ENLA 2GSHA 1JPMA 5IDZA 3RCYA 1EBHA 4E4UA 3TJ4A 3NXLA 1MDLA 2AL2A 4K2SA 1XPYA 2XSXA 3CB3A 3ENLA 3NZGA 3IJQA 2XH7A 3CXOA 3DGBA 1JCTA 4F4RA 3HPFA 3K1GA 4JN7A 2QDEA 3T8QA 1MNSA 2QJMA 3P93A 4GGHA 4MGGA 3I6TA 4HPNA 2PSNA 5FJRA 2GGJA 3JW7A 3T4WA 2AKZA 3S5SA 4ROPA 3T9PA 3DESA 4HN8A 1SJAA 5EU9A 2P88A 4HNLA 1XS2A 3R25A 4E6MA 1P48A 3ES8A 2XH0A 4JN8A 2AL2B 3N4EA 1BKHA 2ZADA 3TW9A 2HZGA 3H8AA 3UGVA 1TE6A 3UJ2A 3ES7A 4H1ZA 1DTNA 2QGYA 3UCCA 3VFCA 3IJLA 1P43A 1KCZA 1EC8A 3N6JA 1SJBA 2GGEA 4GISA 3CT2A 1MDRA 3OP2A 4Z17A 2P8CA 3UJSA 4J1OA 2I5QA 3DDMA 2PTZA
chains in the Genus database with same CATH superfamily
2CITA 3BTNA 1H7NA 3N2XA 3BLEA 4GMEA 3A9IA 4IPPA 1XGDA 1VCVA 2WVUA 5DMMA 2A3EA 3AYRA 3BW4A 4GRTA 4I5UA 2IXVA 3C2RA 1V3MA 1MUWA 2D0GA 2FKPA 3MU7A 3SCOA 3LEPA 2YDRA 4WZHA 2XISA 2ZWYA 2V3EA 1LT8A 1X6NA 1WZKA 3IPWA 2PP0A 3WD0A 3PWAA 4MJZA 4M6QA 5JCKA 3FLUA 4IH3A 5MKGA 2BSLA 1LWJA 1L6YA 2OCZA 3GXTA 3WLKX 3EWYA 2WNQA 2YYUA 5C9UA 2CZVA 2XIIA 2TSYA 3CNYA 3RCNA 3G0SA 1QMLA 3I65A 3L5MA 4IL2A 4X2RA 4JDYA 3SRFA 4ZCWA 1DHKA 2O56A 1RPXA 1UPMB 2DW7A 3VKBA 3O0KA 5I6SA 3JZUA 1O94A 2ZBTA 1NFPA 4EK7A 5H2ZA 1YDVA 2C13A 2OSXA 3V35A 5MKGB 4GIEA 2PTWA 2VEIA 7TAAA 1X6LA 2A21A 3B3DA 1H7WA 4E0CA 9XIMA 4MKVA 2ZZ6A 3TW7A 4CD4A 3L2IA 4DEFA 2D2JA 2O4QA 1ME7A 3KP1A 3MV11 4WUIA 1FEAA 1J0KA 1JFHA 5G5GB 3SSZA 3W7CA 3B9JB 1UIOA 3H4KA 1XFBA 5AC5A 1FHUA 5FD0A 3OZPA 3BSGA 2EG7A 1NQ6A 3LZ5A 4DXVA 3HZ3A 1KBKA 4K3ZA 3ZJ6A 4GXMA 1KGXA 2IUZA 3DENA 3WEMA 1K9FA 2OYMA 5LNSA 1Q2RA 3IIOA 1EQPA 4ACZA 3CYJA 4Y9NA 2WJEA 1RBOB 1B30A 1BG9A 3C56A 2QXWA 4QG8A 3WJSA 3A4JA 3GDLA 3PZMA 3V18A 3PBGA 4XX6A 5LKYA 5CAHA 4RV8A 4PCPA 4CU7A 4NAFA 1DWFM 3G5EA 3WBYA 4YTRA 1QI4A 3OQEA 4LCQA 4UFJA 4FA3A 3GKAA 1JFXA 3WL1A 4QS6A 3L0KA 3GFYA 2VXNA 1FHVA 3KFTA 3WENA 1E1CB 3UR8A 1VZWA 4KIEA 4FMVA 4LV9A 4ACZB 3URBA 1NELA 1CWYA 1HJWA 4O18A 5E93A 3IIPA 2XGIA 1X2HA 1P5BA 1KLZA 4AEFA 1R46A 4TX6A 5DCEA 2HVMA 2ZCGA 3PTKA 2R1MA 4KWUA 3N2TA 3H22A 1OFBA 4QDMA 2W0HA 4NAFB 3CMFA 3LNPA 3WMBA 4JL1A 5EMMA 2IS7A 4FR1A 1TA3A 4KFPA 1BYAA 3W6MA 1I2RA 2QMJA 2Y5EA 4CQAA 4PB5A 1W3HA 3LHUA 4AZHA 3EEZA 5BWAA 4ZBCA 5DANA 3ITVA 3SN0A 3EOLA 2PTDA 4O8AA 1I8JA 1YXYA 1IEXA 3ITCA 2VR4A 5GJNA 1E9YB 3ME3A 4XISA 1TX0A 5DCDA 3UYCA 5GRTA 5RUBA 4HSHA 4U31A 1WP6A 2YOCA 3CAKA 4JY8A 1E6PA 1J9YA 2BNJA 2V3GA 2QMKA 1K4HA 4UIOA 2PS2A 2LLEA 1TA3B 3GW0A 4XIMA 2OQYA 3OPSA 1XGEA 5KTLA 3ZVHA 4RNIA 4WQ6A 1QUMA 2PFHA 1UWUA 4MIMA 2ODOA 2ZQ0A 3WF0A 1LWHA 7ENLA 1JOAA 4S3EA 3TROA 2DZTA 3RU8X 4C60A 4X22A 3SQPA 3EMCA 1A3HA 3CK5A 3HG4A 1AH4A 3S5ZA 4IWWA 4MWAE 1VD6A 1VENA 1TIWA 4DZIA 2HBXA 2CBVA 3VIPA 4IM4A 2P0IA 4PBGA 2BBFA 1YTDA 3UVIA 3PBUA 1NSJA 3KBNA 4GNVA 4HHMA 5ABTA 4H7VA 3OVQA 3ZVHB 5JUVA 3D5HA 1S5WA 1ICQA 4M80A 5HQMA 1XYZA 3BE7A 1RALA 3TKFA 3UEQA 1KM2A 3LENA 4X63A 1MDLA 4U28A 3IUDA 2GPTA 1A5NC 2J9ZA 2JK2A 4PMJA 4Q3MA 4ADTA 1Z3NA 4LSBA 4TVDA 2V67A 4AYSA 1UWQA 4RX0A 3SSJA 4AISA 3CZJA 4J28A 3LXAA 4BJHA 2F2KA 1XKJA 1AVAA 3T0DA 2WZMA 1A0DA 2E6FA 1TPFA 1V93A 3AYSA 2HBVA 2YL8A 2OB3A 3VGDA 5CSRA 1MW0A 3GDMA 2WM1A 4PZVA 3O7UA 4GXPA 5A8GA 4U3AA 3MA8A 1OT2A 1AQMA 4HK6A 4AVOA 2VQUA 3QGAC 2X42A 3R43A 4QAIA 1EC8A 2J8GA 4UFMA 1L0PA 1NIUA 4U2ZA 4XO7A 1BYBA 5I3KA 4I3GA 5ABGA 2WP5A 5B80A 2ZUNA 4TTUA 1JGMA 2P8CA 1S2TA 5T26A 1PX4A 4IMDA 3N11A 4H04A 2YXXA 3LPPA 1YTEA 3WQVA 1XINA 2PEVA 4O54A 2ICSA 3W22A 1KA9F 4UZUA 4H4ZA 4R9OA 5JCLA 4AZCA 1DIKA 3R5EA 3CU2A 5KMYA 3EOSA 1ITUA 1G4SA 5LNVA 4DM2A 4PUKA 4HNTA 3NGJA 3A7UA 4GK8A 1LOLA 3XINA 2FZDA 3BLIA 1V6XA 4Z2HA 1A49A 1KLYA 1X38A 3NGFA 3W1XA 5CBJA 1TRIA 1ICSA 3WLQA 3GXDA 1FKXA 1W1ZA 3M6DA 3RPDA 2OG9A 3LCLA 4B2DD 3UWYA 3TV8A 4UQAA 1TZZA 1BSIA 2OQHA 2GJXA 4F2UA 5D05A 3FK4A 1QNVA 2NW0A 1MO0A 4H9YA 5I3DA 2VGIA 4AZCB 1SW0A 2GJLA 1KM3A 3ZFHA 4QITA 3XIMA 3CM4A 1IIGA 5TBOA 1PHQA 3HPXA 3OU8A 2PGWA 3JRKA 2HWGA 3PNUA 3HF3A 2E40A 4H6EA 2NX3A 1OF8A 2CBJA 5HXMA 4GOAA 3U48A 4H2HA 3RJYA 4KWVA 4YN5A 1G5AA 2O0TA 3E6EA 5CKSA 3STCA 5DN1A 3NEHA 1Y65A 4YIWA 1QWGA 5FEXA 3ZM8A 2DIKA 1M7PA 3GR8A 3C86A 1F4AA 1WZAA 3PUDA 4ZQOA 3LTSA 1POKA 4H3DA 3QY6A 1I1WA 3S4TA 4UR9A 3LBCA 1FCVA 3W6LA 4I90A 5I3IA 4HCLA 5CC7A 2GR1A 1JYWA 2XVNA 4AFYA 1SJCA 4EANA 4D71A 3PPHA 4H50A 2VEFA 1VB9A 3NPWA 2QULA 4W88A 5A69A 2OVLA 3E12A 4ZENA 5CG7A 2VZSA 2YYTA 3BSHA 2J24A 3QR3A 2VQTA 1WKDA 3LY0A 2VFFA 3ATYA 5U7SA 3UD6A 2CFYA 2X8CA 1H49A 4LTSA 2NQJA 3GQYA 3O3RA 1JYVA 5BZAA 2R24A 3QC0A 3IC9A 2OSWA 3CQKA 1P1XA 4NHVA 2ZTJA 4EVZA 5D8WA 4IFKA 3EOEA 3RXZA 5A8MA 2OKTA 3YPIA 2E9LA 1NF0A 1WQ5A 1XLEA 3GIPA 3M0HA 1J93A 1WPCA 5CQ1A 3U7VA 2J7CA 4WLCA 1W17A 2VRQA 3SRDA 1J5SA 3FYYA 5I0DA 5FF2A 3UR2A 2BC1A 2V5BA 3CXBA 3GG7A 3WLIA 1QU4A 1ME8A 3GDBA 3ARYA 3H21A 3E2VA 3V4BA 1ECQA 4Q8NA 4AWEA 2BTMA 1HTIA 5D30A 2QGHA 2EQ7A 5G5HB 3BARA 4G7EB 1JRPA 1EEXA 4Y9MA 1KBBA 4O11A 2WVSA 2Q3OA 2I9EA 5LIXX 4GI8A 1UP2A 5DF0A 4C6NA 3H24A 4XAZA 5F7UA 3U2CA 4NNCA 3R11A 3TSDA 5I7GA 3UZZA 1Q6FA 3NRZB 4H4IA 1FWFC 4EQSA 4G8TA 5D2TA 3VFLA 1FP8A 4XZBA 2A8XA 2VD9A 1TQJA 5JVLA 1GPWA 3VKJA 1TZ7A 3VMPA 4HK5A 4XBJA 3MI3A 2IQ0A 3UP8A 3UR7A 2WBGA 3ALFA 4HNNA 2YBTA 2WZEA 4K7VA 2VGFA 3II4A 1WBHA 1R9XA 3FIGA 4D1IA 1IGWA 3RUBL 3SCTA 2DZAA 1S38A 1ZDLA 5LHEA 2ZUTA 4DPQA 8RUCA 3GO2A 1J4EA 2ZYFA 2W5FA 5FJUA 3S6TA 2WQDA 4GG9A 3BVJA 4XVEA 1VPXA 4DJDA 2VENA 4BY3A 1PSCA 1T8XA 1V77A 2HRWA 2CXGA 4K39A 3A47A 2G41A 1TYPA 3CGBA 1T40A 2HEJA 1C29A 4GQ0A 1S46A 2WXDM 4IMEA 3N25A 3SW6A 2YCKX 4HB7A 3VIMA 1VP5A 5DT7A 3GHUA 2XH4A 2Y4SA 3L5AA 4LS2A 4OV4A 3VDAA 1LRNA 1MXDA 2CBUA 3BMWA 2ACUA 5CJ5A 3EYPA 3G0XA 4W7VA 1L6FA 2Y70A 4H9ZA 4NNBA 3RM9A 2E5CA 1BXBA 4ZGYA 3EF6A 5BMXA 3N3TA 4RDZA 3G1YA 1RJPA 4DZAA 1HO1A 1XLLA 3B8DA 4BI6A 1XG4A 4HSOA 4W8LA 4LC6A 4KRTA 3SCRA 2B7QA 3SCSA 2INEA 4MOZA 4O19A 3LCWA 1C7SA 3K1GA 4Q7NA 2I9UA 1FDZA 4M3PA 4YWIA 4FOUA 1ZAIA 3PBMA 2QJMA 2GYIA 4W7UA 3CTLA 3W7EA 4HPNA 3VVGA 4P8VA 1NHSA 3K8LA 2B7OA 1MQRA 1SJAA 1E40A 4MJMA 1WOBA 2GFTA 1XLIA 2R94A 4WEVX 4JEJA 1XC6A 3PZTA 4AY1A 3EUB3 1QPRA 5AHMA 4D1JA 3SIMA 5K9DA 2HZGA 1NHQA 3QYSA 1Y5VA 5EMUA 2I5GA 4NG3A 2CW6A 4WDTA 5CPQA 1GOKA 3SCNA 1XD1A 2D20A 2GVGA 2A7RA 5TD4A 1W8GA 5C9RA 2A1YA 3K5XA 3CMGA 4XIAA 2C18A 1HXJA 1EEPA 1WA3A 4EM4A 3NVTA 1XCXA 4ZB2A 3TR2A 4Z1AA 3WQOA 2DZSA 3DYMA 5CPMA 4E4PA 1KQYA 4V27A 5EMJA 5HWNA 4HA3A 1XBVA 3N4AA 4W5ZA 2E5DA 1MXSA 1AL7A 1UD3A 4JTEA 4IPIA 4EPKA 5AC4A 4O4VA 2KZHA 1KXHA 1M04A 1IEVA 4PTXA 1VFMA 1QNSA 2X1RA 2WNWA 1F6YA 3OLEA 2A3CA 3SJNA 1KM4A 2NT0A 4Q4RA 1A5KC 1DIDA 2ZE0A 4L80A 2QAFA 2ZRVA 1EX1A 4R27A 1GHSA 4GQQA 4ZZ9A 1PIIA 5JBFA 4AC1X 5I03A 2E09A 1E56A 3A5VA 2XWDA 1SW7A 3KBVA 3BWWA 3HG3A 3LMZA 3AJ7A 3F4VA 4DXKA 4Q7IA 4NXSA 3GTNA 3F2CA 2QUTA 5D38A 1OSEA 2X41A 4NZJA 3STFA 4UOZA 4JICA 1FCQA 3TQPA 1IT7A 4OJYA 4M51A 3HB9A 3W75A 3WQFA 4UTWC 5BXTA 4GXWA 4GYJA 4JTHA 1VJSA 1OWQA 3THDA 1LQAA 3BZGA 1HJXA 3KOYA 4NEVA 3TAOA 2C71A 4IHCA 1F3XA 5I78A 4AY7A 4EOUA 1OINA 2E3ZA 1XRTA 3C2YA 3VGGA 5JU6A 1GKRA 2G3MA 3P82A 3RLHA 3Q65A 2W6RA 4FI4A 1L6SA 4KETA 1O95A 4EACA 3LXBA 4LT9A 5HNUA 5D8ZA 4XD5A 3E2SA 5E0KA 2NQLA 1GVIA 1FUYA 1ZPTA 4IX0A 4JYDA 1QBBA 3TEVA 3ARRA 4FXFA 5C0QA 2DZPA 1DE5A 2OYLA 2VEKA 1KM1A 2DU2A 2BP1A 4CKQA 4H8VA 4PUNA 2CKSA 3AXIA 1TVPA 3WNPA 4F2BA 1X1OA 2FZ9A 1R3WA 3GKFA 4DF0A 5KZDA 3GRIA 2OFJA 3RLGA 4NL1A 5KSWA 1J0IA 4Y8FA 1SFLA 3NTYA 4IF2A 1BGAA 5F1UA 3NUKA 3W7JA 1JF5A 3ETRB 1B3WA 3EDDA 2GK1A 3ZO9A 5C5YA 3GH5A 4KFOA 3DOPA 1JDDA 1TJ1A 3FX4A 3IARA 3LCIA 2XVGA 1TJ0A 4BK9A 2BX7A 1KWKA 4JTRA 1TWSA 3MUCA 4GO9A 1C3FA 3GWQA 3W2KA 5AKQA 1LORA 2XFFA 2OGYA 4NKCA 3LTPA 4FF7A 2I16A 1JDFA 1GVOA 5LNWA 5U1OA 2Z1WA 3N9RA 1HF6A 3WJXA 3W7LA 1ONWA 3EEGA 4F9JA 4M52A 1VCFA 2GK1B 3W1QA 1FWTA 1XC4A 3GDTA 3NSNA 1XDLA 2ZX9A 1WE5A 1T99A 3WLRA 1UOKA 1V6UA 5FJOA 2DDXA 3CZ8A 1P7TA 1XX1A 3MDWA 1SR9A 4NZFA 4TMCA 5FIPA 4CCEA 4JYFA 4WCJA 4DO4A 3BXWA 2C3DA 1C7TA 1MSSA 4MMWA 1XSKA 1TV3A 3GXFA 1R5YA 1IZKA 1DYSA 3OA5A 4UTFA 3E3HA 1X8FA 1RQHA 3I7QA 2YDSA 4BR1A 1JVNA 1ONEA 2PBOA 3ZWTA 3FV9A 2VC5A 2DVTA 2FGBA 3VNLA 3SY8A 3CL7A 1PEZA 3GTIA 1F3PA 1W2VA 2C79A 4NASA 5G4HC 1P7TB 1WYGA 1PO9A 4CCZA 3OOQA 3UJRA 2PU1A 3AMZA 4OHQA 3RR1A 2WC7A 5D2WA 3V5OA 4OIFA 1OFAA 3QQ0A 2RABA 5LA2A 1AJ0A 1UA7A 1CW2A 1TWWA 2PODA 4MM1A 1IR1A 3QPEA 3DYOA 3GNDA 4D6GA 3GRTA 3A64A 5CGQA 4W5UA 4M24A 1O68A 4AYGA 7ODCA 4FHAA 4K37A 3AS3A 5I07A 1K70A 2Z29A 4G1NA 4ZE4A 2GGIA 3UPWA 1EUAA 1K3UA 4J56A 1EJWC 5C54A 3C0JA 1I9CB 1OF6A 1FFVC 3NDZA 4IIEA 3VD7A 1H2IA 1GG0A 3T8LA 5CPSA 2OOFA 1UR9A 2ZUWA 3MKCA 4J2PA 2FZMA 2YQUA 1OQFA 2VRJA 4QAWA 5LNRA 4AU0A 3DEQA 1RM6B 4ZQCA 3B4UA 1EKOA 3BUVA 3CV2A 4KCVA 1AZ2A 1MUMA 4F0SA 1XCFA 3RM4A 3F4CA 3QHNA 3PJWA 3BW3A 3UGRA 2NVAA 3CB3A 1OG6A 1C8VA 4MDOA 2W3ZA 3QZ6A 4EE9A 3NQFA 1QOPA 3NPVA 1SMDA 4UR7A 2FPYA 3GVQA 1EO5A 3VKAA 2WMGA 1N82A 4HTBA 1GEHA 3L4XA 1QI5A 3J7HA 2QV5A 3T4WA 4BURA 2XDFA 3OO2A 3KRZA 3WLMA 4JTQA 1Q8JA 1XH0A 3L68A 1XS2A 2HROA 3TYAA 1IQ8A 4JTIA 4NJHA 3L4UA 4WGHA 4LXFA 4HOZA 3FN9A 2WHKA 3N4EA 1XLHA 2H6RA 2W67A 1U5HA 2OLSA 4GINA 1UWTA 2ZZ5A 3VXGA 4AHPA 4GQBA 4NEWA 3T05A 4BKNA 2PDHA 3MKVA 3M4HA 2GZXA 2VEPA 4JDRA 2BOEX 1ISVA 1E4IA 4DWSA 3MO7A 2HS6A 3ZT5A 1B57A 3XISA 1R86A 4QFUA 5F1VA 3ECQA 3W53A 2CZDA 2QKFA 4YTSA 3CEPA 1ZBWA 3PG8A 2ACRA 3POHA 1SB3B 3W7HA 4J1OA 1KB3A 2CERA 1DV7A 1WKFA 2BV9A 3QTGA 1VFHA 1JEZA 3CAVA 2PTZA 3E96A 4XV0A 5BRBA 4AG0A 3EZ4A 4TO8A 3NL5A 1QXLA 3UXAA 3LYEA 3URHA 1W5PA 3WQ6A 4YVVA 4JIEA 1QNRA 4DWSB 4J3WA 1JUBA 3MCMA 2I7GA 3G8RA 1W6TA 1QTWA 1PL9A 2IKHA 2EQDA 2ADAA 3K1DA 3WKZA 1ZFJA 3E5BA 3TK7A 1DJGA 2C8NA 1E9ZB 1GJWA 4B5SA 2PGEA 3R89A 1YIXA 1V6VA 4PH6A 2GLKA 5LA1A 1EPVA 2GSEA 1DQUA 2QVNA 2E68A 4MNKA 3AAMA 4RKAA 1KXQA 1Q6RA 3PZ9A 1D2KA 3GXNA 1LRTA 2VD8A 2ZVIA 3KHJA 2FZBA 1OYAA 2NV9A 4DYEA 1SM9A 5DQPA 4C6KA 1UH3A 1NOFA 2QAEA 3BG9A 1NAL1 3OLIA 3GD6A 4R3UA 3GFZA 4JEQA 2PDPA 4X2PA 4KWSA 2Z27A 5L9FA 1A5AA 2PTYA 2B7NA 2WP6A 4FB7A 3W28A 2Y2WA 4O0KA 5D09A 3G1AA 4RZ4A 5K7JA 2QVHA 1PAMA 4NF7A 5IFPA 4G1KA 4S3GA 2NVKX 1W9BM 5AYBA 1EXPA 2FFIA 1QO2A 1UC5A 1BWVA 4GIYA 3MUAA 3A22A 2YZRA 1QJWA 3ICJA 5A6TC 3BG5A 1J0ZA 4YTTA 2YA2A 4US5A 4PSRA 4EX4A 4N7QA 5U4NA 1V3LA 4S2CA 5BRQA 1Y7VA 2D0FA 3NOEA 1E51A 1HKIA 1RP9A 4OVXA 4NX0A 2VX7A 3IIXA 3THUA 4MY8A 1GVSA 3ZJ8A 1RUSA 3QFWA 1A3XA 1VFLA 3UJFA 3ZSTA 3QKEA 1XSIA 1QHPA 4H9VA 1GOIA 2OZTA 1FECA 3TQVA 3EWUA 1KTBA 3EPOA 1Q6CA 1CLVA 3W70A 2BWGA 1Y8BA 3FG2P 2QV4A 2G8ZA 2JKEA 3A7AA 3VNKA 1HKMA 4EXQA 1PIFA 2OU4A 1O12A 2OPJA 1KD0A 4U4MA 3LA4A 4RLIA 4WXYA 4BV6A 1FWAC 3QTPA 4J40A 5HA7A 1OT1A 3O15A 4RCXA 4L4OA 3UNTA 1E4MM 1F5ZA 2WOVA 1F8IA 4ALDA 1ZTVA 3BH4A 2VDIA 4HZ6A 3LHZA 4NRRA 2ISVA 4KEZA 1NDYA 3SECA 1W5MA 3MVIA 1WAUA 1TRDA 5HR7A 2J4GA 3D47A 5D2XA 1S5NA 3TTSA 3BICA 5I00A 2C1IA 3H7VA 3F2BA 3GRSA 3VUPA 3G77A 1DJYA 1V8EA 3NWRA 5FSDC 1ECEA 1UIPA 2VVNA 4HMDA 4H83A 2DUAA 1IWPA 4UFHA 1F9CA 1H7RA 5HOSA 1PYMA 4N9DA 3SCWA 1HN1A 4HSNA 1Q2SA 1RLCL 3WF1A 2PCQA 1WZLA 2NQ9A 1KRBC 4DJFA 4IP5A 5E0FA 4U10A 4OECA 1UP0A 1JZ8A 3KP0A 3QV9A 5ER0A 4DVOA 1E6RA 2YXGA 4QJ1A 1TPEA 1H0IA 2VELA 4KERA 3UCDA 4EXAA 4C7DA 2A0NA 3WLHA 3PWIA 4QTGA 2VGBA 3TQKA 1VPQA 3HRDC 1JD9A 1OX4A 5HWMA 1VIWA 1K8CA 4EMJA 3EOUA 1E4LA 4B5XA 1HQTA 1ZB5A 1QNOA 4LC8A 1BRLA 1PUDA 3LBMA 1ADOA 1LZOA 5FF7A 5K2ZA 2VCAA 4ZQRA 5KITA 3PN8A 4JQ3A 5IHSA 5GQBA 1G67A 1P6BA 1DORA 1B3ZA 3NQEA 2J6XA 3VUSA 1CGUA 4RL3A 3TA6A 2YBVA 1Z8AA 3VZXA 1UKQA 1W3IA 5J8LA 4GCXA 2QJNA 1TV7A 2D2OA 3K8MA 2W4XA 3GB6A 3M1ZA 3S42A 1TZ9A 1GSNA 5H6HA 1SZNA 3DIPA 4QCEA 3FCPA 3ITTA 4LBUA 3T2PA 4C5ZA 4QSHA 1JPMA 1H2JA 3A24A 1KTCA 2GUYA 4ZO9A 3VOFA 2JKAA 2BGQA 5FSEC 3V7PA 4GUJA 4BF5A 5F2GA 1BVNP 1DTUA 3I3BA 5JIWA 3M5ZA 4JTCA 3CXOA 3CV1A 3DFNA 3POCA 4WDXA 1ZENA 1L2UA 3ARPA 3TUUA 1CX9A 4APNA 3BQ5A 4J9JA 4PBEA 3UYIA 1HJVA 3LI0A 2PSNA 3GTXA 5BU6A 2ZICA 1FH7A 4NYYA 1P1MA 1E0VA 1DKWA 1PTDA 3GLCA 4NJGA 2ABBA 4H9XA 3V1HA 4DZHA 4URIA 1PYFA 1H41A 4IIGA 2PLMA 3MHUA 4D6DA 1Z48A 4TVUA 5AHIA 5HANA 4NIRA 2EF9A 4UTHA 2NXHA 5DFAA 4XUYA 1I45A 2J75A 4H1ZA 1XUZA 4JTSA 4MWAD 4CD7A 5C7HA 1CI1A 3CH9A 1YNQA 2YDQA 3LDVA 3UWVA 4H00A 3N6JA 8A3HA 3WELA 3EXTA 3CT2A 4ZL1A 4F0RA 4HBKA 4NX5A 4Z42C 1JPHA 3ZMRA 4ZO7A 2PC8A 4QRNA 1UBSA 4XUGA 2OX4A 1W1A1 2GGHA 3CMJA 4JDBA 4F9DA 1EDQA 4AMAA 1X96A 3MI2A 9XIAA 3LD5A 4LF1A 2XPKA 3C6CA 1S2WA 1E72M 4E3TA 5CH9A 3VO0A 2PP3A 2HDJA 3AISA 4E4FA 4R33A 3IANA 1XLKA 3HGJA 3MY9A 3P84A 1ZBKA 4QLJA 1HIZA 3SAZA 1UKOA 2G3FA 3DFYA 1V6WA 3TOYA 5AC6A 1B4KA 1HL8A 4RJEA 3OYZA 1B9BA 3DFSA 4X0VA 3W7RA 3RPMA 3PZNA 2VOMA 3QGKC 2HNHA 1TR9A 1W5NA 1PZ2A 4WGXA 2J7BA 5LA0A 1A5SA 2BFGA 1I2PA 5F2IA 1BKSA 1V08A 6CGTA 4UTUA 4KWWA 1W31A 2EHHA 4PUJA 4WOZA 5DXXA 3CPRA 4Z2GA 1PIGA 4P7LA 1VS1A 1E3ZA 4HVXA 4AW7A 1NP2A 3KRBA 1DJIA 2HPMA 1PX3A 4RR4A 3AXKA 2X0YA 2JKPA 7A3HA 3ELFA 1TR1A 2ZX5A 4L9ZA 3W7GA 1OG0A 3MPGA 2FHBA 2PDYA 3UT0A 1BLIA 1TKKA 1VJIA 2YW4A 3CAQA 4NP7A 4KEUA 2OYKA 4RDVA 2R9RA 4RXFA 4DO7A 4HGXA 4KPLA 3CWHA 2D73A 1RK6A 4GVFA 4BHYA 3DFHA 2JGQA 3I4EA 1SSDA 4HU0A 4AHOA 4H8HA 1GRAA 1UOZA 3BGJA 2YVJA 3PTDA 3RN6A 4J7RA 3W07A 2DT2A 1ADSA 3RLUA 3N6HA 4NYUA 5AY7A 1BYDA 1MYRA 1V97A 1LUCA 3SQMA 3W7OA 1JAKA 3NQ7A 1NWTA 2DZUA 1TV4A 1AOGA 2VDGA 4RE4A 4FXJA 2Y62A 3ERPA 1YHTA 1KXVA 1KV5A 5E9XA 1W9DM 1UCWA 2QF7A 4KCUA 1CTNA 3VZYA 1IHIA 1NDZA 2J88A 1JZ5A 4MAZA 1B31A 2PRHA 4KRUA 4CQ8A 4UQEA 6TIMA 3A23A 2AGTA 3TWAA 3PC0A 4JGDA 4PGLA 4AC7C 3VKCA 2POTA 2RDXA 3C61A 4TX9A 5EY5A 2FMOA 4XVDA 1RH9A 4LCSA 3LM3A 1G94A 1JUKA 4A8IA 1F74A 1JXJA 3MS8A 1XCWA 3VDGA 4IGSA 3LHYA 4BCEA 1DWGM 4DJDC 4O14A 4C1NA 1W9XA 4TUFA 4DBSA 3WQ8A 1KC7A 3D3FA 4TMBA 3CBWA 1EJSC 2JK6A 4AUBA 1W37A 3WDJA 1SO3A 2Y7EA 3NVDA 1SVDA 1QAPA 4HIBA 2RGLA 5EMLA 5CXPA 1OVDA 2VTFA 2XN0A 5CBBA 3KDOA 3MC5A 1GEQA 1PDZA 3QLDA 4C90A 1LLOA 1QI2A 2OXNA 2D22A 4JTLA 1BFNA 5M1TA 1JIBA 2PCEA 4B5NA 4FIRA 2DW6A 3GU9A 2PWUA 4WHBA 4MUPA 2E0PA 4C1NB 4NU7A 1W9VA 1EZWA 3U4AA 3SFWA 3UXKA 2VR5A 5L6UA 3T0BA 4V28A 2DJLA 1E0XA 3P8JA 4HNCA 1IR2A 4QJ4B 2V2HA 2DPEA 2X2GA 2B81A 4KEVA 4H9MA 1OC7A 4PE8A 1S2VA 4OUEA 2BVWA 2ZC8A 3MANA 2V69A 1YNPA 1IZCA 3WSUA 1G69A 4GZ7A 3B8SA 3S2MA 3T7VA 1LLZA 3E38A 2DSVA 3MZNA 1E70M 1SYTA 2FH6A 2J62A 3FYPA 1H61A 2HPIA 3KUMA 5CC6A 5AYZA 4ICCX 4I7WA 4AMCA 3HG2A 4S3JA 1JDAA 2QPSA 4H7CA 1YEYA 4CEXC 2GOKA 6XIMA 2XIJA 3DERA 2W91A 4JIHA 2A7NA 2ZZ0A 4KBXA 5JBDA 2CIPA 3F5KA 3AMKA 2EPLX 3VKDA 2V8ZA 1T6MA 3O05A 3OEXA 2XH7A 4D6JA 4I7UA 3W84A 3W85A 4AIBA 3NQGA 1CENA 4W8AA 2R8WA 1TJ2A 4UMCA 4D6HA 3UNDA 3T8QA 3ARUA 3E9AA 5T9BG 3GDRA 4EQWA 1JYNA 2F6KA 1M68A 4HPGA 4CD8A 1XDJA 4UNKA 3IVUA 3A5FA 4IQLA 5JCNA 4HNLA 2CFFA 3W1LA 2HE8A 3IGSA 3R8HA 1RJQA 3QR0A 1DQXA 3LV5A 4REQA 2VI0A 3PSVA 4HZ8A 2ACQA 1H51A 4UR8A 5BXRA 3TW9A 4FALA 3BLFA 4FNTA 4J5NA 4FNUA 1H60A 4P61A 3UJ2A 3ES7A 1EFZA 4KFNA 2VP8A 2O92A 3PG9A 1GRGA 1H1NA 1KCZA 1SZRA 1VF8A 4AD3A 1S5TA 4J3TA 4IG2A 1UBPC 2PB1A 1TV2A 1UQZA 4C6OA 2ZA3A 5XINA 3IIZA 2DUXA 3V75A 1VBJA 1E4NA 5I02A 1XIMA 4REQB 4I8DA 4QP0A 3TDFA 4ZQMA 5DX7A 1AK5A 2WJFA 4QSFA 4JR5A 3ABXA 4PYSA 1FIQB 4UNLA 5TAOA 3QZAA 1GRHA 3OB8A 3MCNA 3UA4A 5FEPA 4LCRA 5DMYA 1W91A 3ABRA 3QW4B 4JL2A 3TC7A 4JFUA 3H23A 1GNXA 5D9NA 4XAYA 5AFDA 2O9OA 1LPFA 3WBEA 3ABZA 4IG2B 3WNMA 2BC0A 3WQDA 1E5JA 3DU0A 3AIEA 1OCNA 3LX9A 4C6BA 3EX1A 3BAKA 3UPBA 3WDIA 4S3BA 3SY1A 1I2NA 3GK0A 3EWBX 4GY1A 1KWGA 1OFOA 1JYXA 3VGBA 3WNKA 1G4EA 2ZRWA 4NZCA 3DG6A 5IDIA 4Q6JA 3N18A 1XLGA 3AS1A 4LQ1A 4JFSA 1RZMA 2QJHA 4GACA 1FWWA 5EYWA 3HOJA 3FNDA 1EP1A 3KS6A 1KFLA 3EA1A 5HJYA 3IJ6A 1O5XA 4FXRA 3AIBA 3QXBA 2AKMA 3NEVA 3QQWA 2WSPA 1NDWA 1OIFA 1WDPA 1BTCA 2W3RA 3KXQA 1EB3A 1ENUA 3RHGA 3FDKA 3EMZA 4HPHA 1Q65A 5CZTA 3L65A 1OK4A 2G50A 1ZQ5A 1FCUA 2C16A 4UCGA 1Q4WA 1SU5A 3WUEA 4JTJA 1KFKA 1A47A 1RQBA 3AHZA 4H4RA 3AUJA 4JD4A 1G4PA 1KTNA 3RG6A 1YYAA 2OWWA 1GOMA 2EGZA 4IJBA 3RMEA 1DXLA 2D3LA 4N4QA 2R1LA 4XSMA 4JQ1A 4B5WA 1QCWA 4MSSA 3VGFA 4MB5A 1HJQA 3W76A 4ATLA 3HURA 4FXSA 4BF9A 5CPNA 2GOUA 1GQLA 1S39A 5BXSA 3W72A 1ZBVA 2HK1A 3AUOA 1OGGA 1VQTA 1JI2A 3M47A 4PR4A 5HJXA 3ANYA 4HA0A 3F4NA 2WCGA 3PNZA 1W1VA 1RY0A 2VL4A 4S1FA 2FTYA 2E9BA 3USBA 3IRSA 4O1BA 1H4PA 5JCIA 4FEZA 4MPKA 4GE8A 3KL5A 4FS9A 1PS9A 4PCFA 3FA4A 3K4WA 4XZMX 4NZ3A 1DP0A 3H2CA 4GJIA 4DM1A 3TYUA 4B9ZA 1PPIA 2IPWA 5HBFA 4FIQA 4N9BA 1F61A 5REQA 2VX4A 5FEZA 3TN4A 4A8LA 2E77A 2VURA 3KWXA 1US3A 2Q8XA 2X40A 3M0ZA 3KCOA 1O5KA 4ZQNA 3VIOA 1HGYA 4K68A 3SQSA 2D69A 1QPKA 2P0OA 1VRDA 1RD5A 5A8NA 2CPUA 2QCNA 3CZLA 2RKXA 4OT7A 3TW6A 3H26A 3WEZA 3M5VA 2VWTA 4OTKA 4CU8A 4EAMA 3VIGA 3B06A 1JJKA 1O5QA 2WCAA 5A6BD 1X2GA 2ZZ4A 2VRKA 1V02E 1WAWA 5REQB 3HBLA 2EPHA 1CGXA 2ZWZA 3EANA 1Y5XA 4ZB0A 2DV0A 1H7OA 1LVLA 4LV4A 1YPXA 2CLLA 4O10A 3IS4A 4OV9A 5C9WA 3FVDA 3NQCA 3FOKA 2NX1A 5I3GA 4Q8VA 1AG1O 4DUOA 4JY9A 4LBRA 4NI3A 3HPSA 2QYGA 1OB0A 1VEMA 3TTEA 1SO5A 2QUUA 3MSYA 5J5DA 3SGZA 4ZVJA 3OGSA 4O4WA 2OEKA 1TB3A 1FVPA 1XIJA 1NWSA 1UKPA 2ZXDA 1Q8AA 3R13A 1LLWA 4MG4A 1LL4A 3F7JA 3GG8A 4JHOA 4JTAA 3WDHA 1VYRA 4QJ3B 1J0HA 1FEBA 3T40A 3WH9A 5FCZA 2BCPA 1BXNA 4JKMA 4HOXA 4M8UA 4U3CA 5TNVA 4B15A 3UZ5A 2ZKMX 1BXCA 3LCFA 2QW5A 1RHCA 1MI3A 1EIBA 3JU2A 4JFVA 3VM5A 4CD6A 2GJNA 3PBVA 2C6QA 3RIKA 1ICPA 4ZOCA 1EBHA 1EJ7L 5A95A 3NXLA 3PULA 2AL2A 4CN1A 4ORIA 4UQ9A 1SZFA 2WO5A 3NZGA 3M0IA 3MYOA 3L2MA 5LIWX 2ATMA 1Q3NA 2WSYA 1AFSA 4WDUA 2H90A 3EPNA 3ONCA 1SO6A 4GGHA 1VR6A 1NFGA 3QJAA 2GGJA 3JW7A 3W7PA 3NL3A 3T9PA 1VKFA 4E2VA 1W54A 1H5YA 3WJYA 1RD6A 3ALGA 3WBAA 5AOUA 3NYZA 2QUMA 1R2RA 1YE4A 1AD4A 2B0MA 2OO0A 1QHOA 4LEQA 1N7KA 5FS6A 1JNEA 1QWKA 4HA4A 3DUGA 2AL2B 3KRUA 1XKYA 3VX1A 1HO4A 3HQOA 1Q6EA 2QCEA 4WY0A 3HV8A 4GD0A 4B16A 1DIOA 1DTNA 1GREA 3W87A 2ZDRA 1UR3M 4H6RA 1GEUA 1DVJA 4A3YA 4G5DA 1UW9A 5I2UA 3LSCA 4P7NA 5G1YA 4Z1DA 5FAGA 1DJNA 4BQ3A 1J01A 3O06A 1GRBA 3C2OA 2GQ3A 4AXNA 2PDXA 3P3BA 3L7RA 2X1SA 4UTWA 4PODA 3WUGA 2RGMA 4WD0A 1QOXA 1HKJA 1OZMA 1VAHA 2CHOA 2NPXA 3R0UA 1FKWA 2JIWA 1I6NA 2QLYA 1CZ1A 3SM0A 1YW1A 3N04A 2VUNA 1Q7MA 2UZ9A 3WD3A 1CB2A 1MEIA 4C6IA 3NO1A 3A3WA 3C0QA 3VIHA 1LDCA 3V0TA 1L8PA 4O1CA 4DYKA 3T78A 1Q1RA 4P7OA 4RE3A 3WQCA 1OYCA 1UZHA 5DRIA 5E0CA 2OODA 1XXXA 3VE9A 4JTTA 4IIFA 2QCDB 1O7AA 4MFDA 3HTWA 3HGOA 1OD8A 2G97A 4F8XA 3VIFA 2XINA 4TOQA 2XVPA 3AYVA 2JIEA 1O6IA 2QR6A 3VD3A 4JHZA 4YVPA 2X8GA 1UUMA 1GQJA 2Q01A 3W2UA 3GM8A 4MPQA 3S9YA 1K9EA 4R5EA 1KFJA 2R82A 1NOUA 1QATA 2GGGA 3AO0A 3G3DA 4DUVA 5AHFA 3MUY1 1R85A 1S1PA 3I10A 3PP7A 3GUGA 1WYIA 1VFOA 3GZ3A 3QY7A 4LY8A 2HVNA 3LQGA 3DAQA 2AQVA 3VC6A 1LBMA 1H09A 3MSDA 2RDTA 5AHNA 3ITOA 3RU6A 4GUHA 1X97A 1ELSA 2DQXA 3SUSA 3KS5A 3CUJA 1IXQA 1FWNA 5HUOA 3HPAA 3F4WA 1Z7AA 1XBZA 2J78A 4CNTA 3O6AA 3FS2A 5IRPA 1O1ZA 1W5QA 4GFSA 3VZZA 1HT6A 3PR2A 4GIAA 3M5YA 4JFWA 2BODX 1RVGA 2UBPC 1JL8A 4HNOA 4KKXA 4C7GA 4FLQA 4GVIA 3S2LA 1UR2A 4TQTA 1THFD 2OR2A 1XLFA 5FMHA 4LB4A 5J5RA 2C19A 2QCFA 3NPXA 2J25A 1XIDA 2CLKA 3DHPA 3RGTA 2YCEA 4U33A 2HISA 2XN1A 3P80A 3EXRA 4WSJA 1K7EA 3B03A 3N3MA 2WANA 4UTTC 3DH9A 1DNCA 5LGZA 2FVLA 5LHFA 4Y8EA 4L56A 5D37A 5G2IA 3H7UA 4XWUA 4GNKB 1E5NA 4YNGA 3PB2A 2DY3A 3FJ4A 3RPTA 1G9HA 1UP3A 4N6EA 2V3BA 4IIHA 3E0IA 3C0LA 2VGGA 3KBWA 1QNQA 5DXYA 1M9HA 4GI6A 1GG1A 1QNPA 2E8ZA 5EMYA 1A5LC 3PJUA 1IT8A 5FACA 3UXDA 2X50A 3Q67A 2V81A 2CBIA 1KKRA 3T08A 5F2MA 3UF9A 3CHCA 2WQPA 3ITGA 3HO8A 3KOXA 3MMWA 1G6CA 3T0TA 2CYGA 1DIEA 3BLKA 3S8HA 2NQHA 2RDWA 3CZGA 1T5AA 1YRRA 1FBAA 1EBGA 4JIQA 5CSUA 2ZRZA 1C8YA 3UPMA 4NZ4A 3PF3A 5KZEA 3VOGA 4AWTA 3NO5A 3N73A 4IZGA 4B2DA 2ISSA 4CN4A 4QJ5B 3QW3A 3IGXA 4N0RA 2XGBA 3WMLA 1GYLA 2GUBA 4EAYA 4D8LA 2JEQA 2OSYA 2VZTA 3M0XA 2ALDA 5MF5A 2OLHA 2F38A 5A2AA 3SGGA 2OWXA 1RLDA 2VVSA 4HNUA 2GQ9A 3STEA 1JF6A 3QF0A 2RDUA 2GWGA 1FWCC 4WVXA 2DZBA 2ALRA 2GJRA 1OFPA 1XDIA 3F5LA 2PLKA 5XIMA 1OIMA 3WIJA 4AB4A 1BTMA 2IKIA 4YJ5A 3BCJA 1H6VA 2C1GA 3H12A 1Q45A 1J8VA 1W3JA 3PPGA 1X7FA 1HVQA 2C91A 2Q09A 4ZOAA 3UWEA 5BOFA 2GL5A 4UWMA 1WO2A 5GJMA 2ZZBA 3CGCA 1A5MC 2W92A 3R2GA 1UA3A 2GSHA 1ZNNA 2XM1A 3FYOA 3OG3A 4XBKA 3CIWA 4E4UA 2YX0A 1N5XA 4Z2KA 1GHRA 2E5BA 2Z25A 4PMNA 2O9RA 2GR0A 3U5UA 1BHGA 3BCDA 3NQBA 2XIMA 1P0KA 3MUIA 3T2QA 4ICNA 2OQLA 1RSCA 2J8FA 4HZ7A 1NWRA 3LM7A 4FO4A 3MWAA 5FJRA 4N6FA 3EX6A 4O13A 1IE7C 5C9XA 3DESA 1XIEA 2ZZCA 4LYPA 1BG4A 1FFQA 2P88A 5HMSA 3A7RA 1SQ7A 3P61A 1M7OA 3BL3A 3IAQA 3KE0A 1LOQA 1VRXA 1JCMP 4YTQA 1UPPA 1K4GA 4L7ZA 1HG3A 1H11A 2IQDA 5K4XA 2W27A 4NRSA 2BHYA 1ONRA 2CU0A 2QGYA 4RNHA 1FOBA 1PTAA 1M1BA 2C15A 1P43A 2FLIA 4GQGA 4AD0A 5ABEA 4Q4MA 4LANA 1AA1B 4GLEA 2W55A 3PUGA 3ANUA 1UG6A 3TE9A 1TCDA 5JRBA 3NSMA 1XUUA 4DY1A 1HUVA 4EPBC 3VD9A 2PDKA 1PBGA 5F4XA 1VLWA 1Q4NX 3DK8A 1F2JA 5U25A 1E1CA 2A6NA 3EGJA 2WM0A 4V1YA 3SQLA 3GY1A 2F8QA 4PMQA 4X60A 1I0BA 3NNTA 2XJ7A 1JCLA 2WZTA 3UESA 5IBXA 4K6AA 5LYRA 1W1IE 3N12A 3STGA 1YADA 2PC4A 3GZAA 1YBQB 4NY2A 2NV2A 4RV3A 3W25A 1AQHA 1NEYA 1K8YA 3OGVA 1P0EA 4X0NA 4LWWA 3WBXA 3W26A 2GQAA 4IISA 1TMHA 3PS7A 2ZZ3A 1YLVA 3QPZA 4EXBA 4DBWA 3GTHA 5KINA 4H9UA 2J13A 3Q45A 3T6CA 4A4AA 1K6WA 1XL9A 4LIIA 4YU1A 4CVWA 1NDAA 2XFWA 4LH8A 1UQYA 1BQCA 1XR2A 2OEJA 3AIVA 3KL3A 1FQ0A 4DHGA 1Q63A 1YTKA 5IHRA 1X1NA 1H1YA 4Q8QA 1S3HA 4HMEA 3W1MA 3B9DA 3APYA 1XANA 1HFBA 3UBPC 3KVMA 1MOKA 2P3ZA 5AVHA 3TMQA 2D2HA 3E2RA 3LZ3A 3CIVA 1KCXA 2Z1BA 2PWVA 4HYVA 5B7YA 2YCIX 1LTDA 5G4EA 1XDMA 1TYGA 1HJUA 2BMBA 2FZNA 1WDDA 4WSHA 4E38A 1OADA 1XGZA 1FXQA 1Q13A 2AQWA 1R0MA 1FX6A 5HAOA 3H70A 2CZ5A 4FX9A 1V51A 1JRCA 4FLOA 2PMQA 3THAA 2I17A 3TNBA 3B8TA 3EA2A 4DX3A 4OZOA 3UZYA 2FMNA 3M0KA 1UYQA 3VOJA 4YYCA 1ZMCA 4J3XA 2NWSA 1U2YA 2F7FA 4INFA 3CUIA 3FEQA 3OHMB 3HGSA 3RX4A 3B9EA 1EIXA 4WKHA 4IQJA 5K4ZA 4C91A 3E0WA 4ZFMA 4QROA 4C1KA 5HPOA 4PMXA 3E5PA 4KESA 4RE0A 5HUPA 4DJFD 1XIFA 2PGFA 2JE8A 4H01A 2QJIA 3CWOX 1NARA 3G2GA 1EH9A 2QHAA 1PDYA 4RW5A 5GNXA 1OZQA 1REQA 1GZ1A 2FVMA 4H8UA 3G1HA 4G7FA 3H4GA 2D0HA 2F5ZA 1AUSL 1DQWA 5HMEA 4LNYA 1BF2A 1PB0A 1EUNA 1R6WA 2WNZA 3I7RA 5CPLA 3UWUA 2DH3A 4E8DA 2YB1A 1SUXA 2DZXA 2NV1A 3EPMA 3B9NA 4UZSA 1NU5A 1JG9A 4DLMA 4U2YA 2J27A 5J04A 1STZA 1AJ2A 4GUGA 3JR2A 3TH6A 2Q8ZA 4AAJA 5CGTA 1REQB 2POZA 3CEUA 1OX5A 4C6MA 2NVDA 1BQGA 3RM8A 3RFAA 4JNMA 1PX8A 2CLEA 2ONEA 2HE5A 3GXPA 1W2PA 3K30A 4RE2A 3FA5A 3GG1A 1J6PA 4UB9A 4Q8TA 1N63C 3TTOA 3S1WA 3ARSA 4MZ1A 1Z44A 2J77A 3BSMA 1XISA 4ZTXA 2DGAA 1POJA 2HMCA 2Y7FA 4IGMA 1BGGA 4XD6A 2WB5A 4ACYA 2KAUC 2NUYA 4MKNA 1PVNA 3R07C 3NPUA 4KRZA 5FJIA 1LJYA 1QR7A 5EB8A 2X1IA 4Q4KA 1D7KA 2IMRA 3IJIA 3TJLA 4L1WA 5FF0A 2PDGA 1B9ZA 2WMHA 8XIAA 5XIAA 2V6AA 5GVJA 1ZCOA 4V15A 1F76A 2VM8A 2DVXA 2ZE3A 4Y2WA 3AM9A 1ZK7A 1U1HA 3C3NA 3UWWA 1SFSA 4I9AA 5BNKA 4EF8A 1VCGA 4AD4A 2Q8LA 4QM1A 4KWOA 4XZ9A 2X0SA 2XTKA 3B0PA 2OT1A 3NVZB 5H8MA 4A21A 3SZ8A 1XIGA 3WLTA 2VX5A 1PKNA 1FWIC 2BLEA 1TPWA 2ANUA 1I75A 2AMXA 4MYXA 4LY4A 1X8CA 2NZLA 3FGCB 4E3VA 2HTMA 4IJCA 1YXCA 3MP3A 3WZ0E 1M01A 4ES4A 3S3GA 3GG0A 2XSXA 2YBUA 4MTVA 4PCSA 3WDRA 3DI0A 4BI7A 2CHNA 3WFZA 1MNSA 1R7OA 3P93A 4L61A 1E0WA 1UZDA 1GKQA 1S2UA 1ZJAA 4IGNA 2AKZA 1TWZA 4HN8A 4M29A 5HATA 5EU9A 5KZ6A 2FB3A 1J79A 2CZEA 2FDSA 1CXKA 1P4CA 2OMAA 3W01A 3IVSA 4ZODA 1P48A 4S38A 2FZ8A 4HHHA 1E15A 5A6AA 1Z9AA 3EWZA 2GVYA 3CHEA 1V3HA 3GU1A 1TE6A 3IK2A 1I4NA 4O28A 1WCGA 2W0UA 5F4WA 1MW3A 1UKTA 3IJLA 3W9ZA 2W54A 1QI0A 5FL1A 4PMDA 3B0YA 3T42A 3G22A 4M7TA 1FWSA 4TXEA 5CAKA 2A3HA 3BOFA 3T81A 2XSBA 3B8IA 3M44A 1YKWA 1XLBA 2OGJA 4HA1A 2YCLA 1AW1A 3KOWA 2E1DA 4HP5A 1BZLA 5G4WA 1CECA 3M0VA 3O8AA 4BZYA 1ISZA 3W6YA 2BASA 4L4LA 4C6FA 3LSBA 3B04A 3BANA 1RCOB 4WRHA 1J11A 3QN3A 3ZT7A 3WQGA 3SDOA 1I0DA 2V30A 1QDSA 2XWEA 3G6LA 3SUWA 3LTYA 4O52A 1WXYA 3CL6A 4ICMA 2CETA 2ZZ7A 1TV5A 4CCCA 1JUEA 1Q6LA 2GUUA 2XM2A 3URQA 1OFRA 4G7EA 2YCLB 5ECUA 5BMWA 2DUZA 3U4FA 1KGUA 2FIQA 4F0LA 4S3KA 4PTMA 2A4AA 3BV7A 2GH5A 1K1DA 4S3CA 1J12A 5AHLA 2EG6A 3VMOA 4GI9A 1OC5A 3HIJA 1EDTA 3UETA 4GPNA 1NF7A 1DJQA 4Q8MA 3RJXA 4GVGA 1EWEA 1MQQA 3NXFA 5E09A 2JQXA 3G1SA 3KDNA 1CDGA 3TYCA 4AQLA 1CGTA 3O07A 4LUYA 5ENLA 2ZA2A 2YL6A 5BYWA 3N13A 1JCXA 3PHAA 3QGVA 4MNLA 4LYKA 4P8WA 3WNOA 3G3MA 5BRPA 1CIUA 1W3TA 1XBYA 3N6QA 3TN3A 5LZLA 4IUOA 1WBJA 1SO4A 3QSRA 3QFAA 2AAAA 4HYRA 1A50A 3CO8A 3W71A 1XH1A 1YE6A 1XSJA 4C5YA 2XVLA 5ABHA 1Y0EA 1K9DA 1UD8A 4YWSA 1ME9A 1VGAA 1ZU8A 3EB3A 3LHWA 3TJXA 3WNLA 4UTMA 4AHQA 2HSAA 1Z32X 3ARXA 2QF8A 1OX6A 1XBXA 2XZ9A 2VFHA 1KRMA 4HN4A 2YSWA 2G3NA 4DJED 1K02A 4YS1A 1MUCA 5FS7A 3WLOA 3GSMA 2WPFA 4Q4SA 4JKLA 3FXGA 1CLKA 1MWOA 1GESA 4OQVA 3OLDA 3HQ1A 1US2A 1DPMA 3G0UA 5GPRA 1A4LA 3ZVIA 4BEQA 4ML4A 1BAGA 2YL9A 1F73A 2UY4A 1UWRA 1KV8A 5FJPA 4GYPC 4A8NA 1DXEA 3BOXA 1IXOA 4D8ZA 5D9MA 1FHDA 5EBAA 2YIHA 4MUZA 3DGRA 4LJ3A 5FESA 2IKJA 1VC4A 3NL6A 3NVVB 1F4HA 1EJTC 5E9AA 3ABOA 1B0IA 1GWJA 4IP4A 4H8NA 3LERA 2Y8KA 3HM7A 3T4CA 2YAUA 4JIPA 3MHFA 4A05A 1R9YA 3Q58A 4KGLA 3BLPX 3M43A 1PZ1A 3SUUA 1YMYA 1Q7ZA 4XTDA 3O6CA 1MRAA 1GQKA 5H8PA 1NWUA 3DECA 9RUBA 3EX3A 3LHTA 3DJJA 3ZR4A 1UMYA 3WG6A 4XO6A 4R7JA 4M56A 2INFA 2XZ7A 4C6PA 3Q4DA 3MHGA 5DBUA 3SN4A 1J96A 1Q6GA 2EPMX 4ILSA 1H5VA 4IPLA 5HQLA 4O0QA 3CHFA 1W56A 2OOGA 4W9TA 2DORA 1XYFA 4HJWA 1YNYA 3GR4A 4A3RA 4CQDA 4O53A 1TG7A 4B5VA 3SN1A 1QO5A 4FK9A 1GPFA 3UZWA 3NZQA 2WVTA 3ITLA 2JALA 2GDUA 1LM1A 4JCMA 3VK5A 1TSIA 4IL0A 1JZ3A 4UXDA 5C55A 3CYVA 3O2LA 4OUIA 1P0NA 3BK0A 4IT1A 5AYIA 1RPKA 3ISIX 3MWCA 5AYYA 4WR3A 4FLSA 3NQVA 3MJYA 2QAPA 3AWNA 4Y9OA 4UTKA 3KVLA 4F0MA 4Q8UA 1C93A 2NQ5A 1EA9C 1W9UA 3V5CA 3REQA 3NJ3A 3GC4A 4BWLC 1K8XA 2IW0A 4UNIA 2OZ8A 1DJHA 3W27A 3OZMA 1OCQA 3FHAA 2RHGA 3W1AA 5FKYA 3GFXA 5HMFA 1K7XA 2H8ZA 5IXEA 3AS2A 2TMDA 4W87A 2UY5A 3IV3A 4ZO8A 4DUXA 4V1XA 4WY0F 4D2JA 4LVFA 5AB3A 2F9RA 2UWFA 3GVGA 5BW6A 1LL6A 1UWIA 1M53A 3FW6A 3GU2A 4S2BA 4XZHA 1X1ZA 3MMDA 4IFRA 5HWJA 2B31A 1AH0A 3G1VA 3C2FA 1MQPA 3REQB 3LPOA 2WPBA 4LUSA 4CU6A 3MMUA 2QEZA 2FGLA 5FL0A 1GGOA 4UTJA 4C1LA 3F5JA 4DBEA 2Y7GA 3KTXA 4H6KA 4WX2A 3AIQA 1XYLA 2DEPA 3URNA 1DEDA 3LRMA 1MEWA 4E6MA 3W7IA 3L4WA 3ES8A 1HX0A 2DSZA 2DIJA 2PZNA 3LGGA 5AZ0A 4DXXA 3ABSA 3LMYA 3U8GA 3KAOA 4LUTB 3CO4A 4LUSB 4IXXA 4LS1A 3GTFA 1FWHC 2FHCA 1VEOA 4FX7A 3VKKA 3PPCA 4QNWA 2VHLA 3GX9A 4WKFA 4UTIA 3FY1A 1J6OA 4S39A 4GBDA 2G5WA 1YDNA 4O12A 3WY1A 2QCHA 4QEHA 1TX2A 1NFBA 3LB0A 3DK9A 1AMYA 3G1DA 3M64A 4OBSA 1ZP4A 2G96A 2EPOA 1S2AA 4FDCB 4NQ1A 4FX6M 3NYDA 4MFEA 4DWDA 4IQEA 1BEUA 1E0UA 1A5UA 4RDWA 2UY3A 3EKLA 4PUDA 2REQB 5JMUA 3HJEA 3WBWA 1J5TA 1B3OA 3EX4A 1QI3A 1XD0A 3CWNA 4IPJA 4RZ6A 3M5XA 1K6AA 1TMLA 2QCMA 3R10A 1GUVA 3T2OA 1VBUA 4JS3A 2PD9A 3NO3A 2WKLA 4PFHA 1WDRA 4K8DA 1TQXA 1W3NA 1Z69A 1UUOA 4PRTA 3V3WA 1BF6A 1KFCA 4I9JA 3QMSA 5A5WA 3PJXA 4PL2A 3R8GA 3I7SA 1TIMA 3WQ4A 2VCBA 4QIUA 1L9WA 4L5ZA 3W37A 2E9MA 4AZGA 1GCYA 1N8IA 3VDBA 2AMGA 1EC9A 3NVYB 2QJJA 3E74A 2PWDA 4E2DA 3P8IA 3W2JA 1DJXA 3EDEA 1P6CA 3M07A 4FNPA 1X7IA 3QRHA 5I24A 1OJTA 1IWAA 3B9OA 3M7WA 4C65A 1J18A 5C2XA 4TTGA 3O6YX 3LK6A 3VINA 1SPQA 1M7JA 2AGKA 2V82A 2YLAA 3CH0A 4D6IA 5HNRA 4KF1A 3H2OA 3N15A 5KZMA 1J0YA 3EA3A 2NUXA 4ZSTA 4NZ1A 3S5YA 1GERA 3TWBA 5AN7A 1KN0A 4O50A 3UZJA 3W86A 2ZC1A 2VC9A 4WOQA 3AWOA 5CSYA 2XIBA 3LI1A 3MQTA 1B3XA 1VYSX 5D4YA 3VAVA 2E28A 2YFOA 4NXKA 2PDIA 4XZIA 1ZAHA 4ZQPA 2A3BA 4CNUA 4LBSA 4IMCA 1R3RA 1A5OC 1Z41A 3TTYA 1GVRA 3C52A 2WBKA 3WUFA 2ZA1A 2QJGA 3QV8A 3W83A 1XIHA 5M2FX 2Y63A 2L5HA 4TR9A 2WJZA 4QE5A 4DI8A 4D8AA 4LRSA 1LYXA 3OQ8A 2WOIA 1WV2A 2GR2A 2ACSA 2G37A 1Z6KA 3M41A 8TIMA 2GSJA 2TPRA 1DWIM 2P3EA 1JAEA 3SY5A 4OE7A 1FWGC 3AXXA 2Z1VA 4AD1A 2NLIA 4EM3A 3U6WA 1E55A 4MWAA 2VC7A 2YFNA 3RO6A 2Z1KA 3WQEA 5EL1A 3WK1A 1GTHA 4WKAA 1AQ0A 2PP1A 4ZMGA 4UFLA 3RX2A 3VDHA 3OJGA 4GJJA 1BVZA 3LXDA 1IGSA 3MTWA 1LROA 3DK4A 1SMAA 2C3ZA 5DCBA 4P8XA 1EBDA 1J10A 2Y61A 2Y8UA 3C8NA 3T07A 4AEOA 5CLWA 4LFYA 1O4UA 4WIWA 2ZZ1A 1FO4A 2NX9A 2DT0A 4MWAB 4TX8A 1VDVA 4N02A 3GVVA 3M46A 5M17A 3N19B 2IPJA 4GABA 3W88A 3GDKA 3HQPA 3AJXA 4LX4A 4GHRA 5G2HA 2YKKA 2OT0A 1UR8A 1W3LA 5EKYA 3B0UX 1MFUA 1VBRA 1Y5WA 2FPVA 3MVTA 4DIAA 3N2MA 5E6ZA 3KLKA 3VE7A 1GQNA 3VABA 3QMRA 3NQ8A 4GFIA 4QR6A 4LNCA 3PZIA 4Z2LA 2V9DA 1XWYA 4H4WA 2CLOA 1ZY9A 3H53A 4FLRA 1ESWA 4QDPA 7TIMA 1TPUA 4AH7A 3W24A 2CLPA 2W9MA 3BGAA 3QEZA 3GAKA 1Q6OA 4LRTA 1SJDA 3DYPA 4FSAA 1ITCA 4B92A 4E8GA 3PTQA 3AICA 1OK6A 4QE4A 2PUZA 1PJ9A 4QLLA 1FWBC 2EQ8A 4MADA 3DXIA 4LVDA 4I9MA 2WMJA 3KBSA 3R1ZA 4OBRA 3WN6A 3E2QA 3GD4A 3KVKA 3VCCA 3W02A 4ENLA 1KFBA 4A29A 3CUFA 4YTUA 4HPXA 2PZ0A 1XPYA 3ENLA 1V4YA 1FFUC 3W2NA 3DI1A 1U1JA 3SB0A 4Z2IA 4PTWA 4IMFA 1E9LA 3P6LA 5FF3A 3ZJ7A 4JN7A 1E6XM 4D6EA 3CV7A 3OHIA 2PI6A 1JEHA 1CNVA 3T44A 3MDUA 3ZQ9A 1ZJBA 4FPSA 1NHRA 1E1EA 3PFMA 4Q8WA 3WF3A 4DAIA 1TV8A 5IBXC 2F6XA 4GR1A 1FA2A 1JDEA 1IXPA 2A7PA 2AAMA 1KRAC 4Q8PA 1XYBA 1VPYA 3AFBA 1RCQA 2V5KA 3AHVA 2XH0A 3CUHA 3WJWA 4JN8A 1UZ1A 1UHVA 4GY0A 2DT3A 3H8AA 3D9XA 1RA0A 2VEGA 5I5RA 1K4QA 4XTIA 2JF6A 4MY9A 1G7VA 2A3LA 1XPGA 6REQA 1LL7A 1TPB1 5E1QA 1DXIA 3U2EA 2IKGA 2YL5A 3BAYA 4IJRA 3MI6A 3LADA 2YW3A 1MW1A 1GKPA 1XLMA 1S7MA 3M0MA 4Z0SA 4BFAA 2NVCA 3FAXA 1PWMA 1W1PA 3DDMA 4YCPA 3BDKA 3GW3A 4ATDA 1F05A 3QBUA 1GRTA 1MFVA 4QLKA 4PTDA 3CUXA 1GT8A 3RR4A 3R12A 4DJEC 3H2NA 1HZYA 5LXEA 4EPEC 2DFAA 4B91A 3NG3A 4ZB5A 4X3ZA 1EYWA 1HP4A 4C6QA 4B90A 2ZRUA 4OU1A 1UD6A 3AOFA 1NHPA 6REQB 1KM6A 1F7BA 4ADUA 3FFSA 2PDCA 5T8GA 1EP2A 2YA0A 2R6OA 4LEFA 2I56A 4R53A 2QZRA 1RA5A 1PXGA 1BSLA 5KETA 2BVTA 4RNJA 1ZX9A 1JZ4A 1I60A 4B3KA 1W8SA 5DY3A 4EIVA 2EO7A 1JCYA 3UG4A 1N55A 3NZRA 3VOCA 3FEMA 4ZOEA 3KZPA 3N29A 3VM7A 2RJGA 2NUWA 1GORA 3CZEA 2BOFX 3LGEA 2DSUA 2Z2BA 4V33A 1O60A 4MVAA 2Y7DA 1TJPA 1S2CA 1VH7A 4O1EA 1BVWA 1RXOB 3IRDA 3DX5A 4ERAA 3SUTA 4GY7A 3QV6A 3VGHA 1RBLA 2EG8A 5AYXA 1A53A 4H9TA 3TOPA 5DO8A 3MMTA 1U5JA 4PTNA 3L67A 3U2ZA 3AU2A 1MRQA 3VNIA 3LG3A 1WXJA 1AL8A 4LGXA 3WLPA 4JX4A 1EP3A 1UWAA 3TSMA 1EGVA 4IMAA 3P2VA 1V7AA 1EGMA 1QPNA 4UTTA 4KGJA 2XYLA 3H54A 2WCSA 2OKOA 1XLCA 1XP3A 1HL9A 3HW2A 2BS9A 1UD2A 3K4DA 3WLNA 5DEZA 1RAKA 1VHCA 1EJVC 2BY1A 3A3XA 3HGRA 1KXTA 5HULA 2PF8A 4AZ6A 5C8BB 1ADDA 2XGZA 3ZLFA 3C3UA 1RVKA 2RUSA 2W62A 3VDCA 3EB2A 1LRQA 4OGZA 3MV01 4XQ6A 3BAWA 4ADWA 4QQUA 4H4QA 3N2CA 1M7XA 5T9CE 5CCZA 2G95A 4FAMA 3QM3A 3BCFA 1M6IA 2J7HA 3LUTA 3CUZA 3EWDA 2WPEA 3LRKA 4G56A 2AL1A 3UVAA 4L1XA 5TR3A 3SJ3A 3DGHA 1HKVA 4PMOA 5HDRA 2WHJA 3QOMA 3GD3A 5I09A 2WSQA 3NCOA 3TN5A 1TCMA 1WUEA 4N4PA 3VU2A 4W84A 1C8QA 3WLJA 2QT3A 2R1KA 3ZLGA 4JPGA 5IM51 3LLFA 2H9AA 4PBFA 3UA3A 4GX9A 3MSRA 4EKJA 2QPXA 3W7MA 1GVYA 2F84A 2EQ6A 2J7EA 4Q8OA 4JYEA 4H2CA 3D6NA 4PMYA 1FWJC 2OO6A 1K7FA 3TX9A 4JZ5A 3UR5A 4ONVA 3G6MA 3W38A 1H7XA 1W3KA 3IACA 2Z6IA 3PANA 4DF1A 3KTCA 3FAWA 2Y0FA 2Z1SA 5I77A 2GJXB 2RAGA 1F6PA 4ZEPA 1M3UA 2ATSA 2Z1XA 4KCWA 1QW9A 3AMGA 1YPIA 2BGNE 2H9AB 4DUWA 4DPPA 2GR3A 4KCTA 3U2OA 4DF2A 4JCLA 1OCJA 3CASA 2BZNA 3QLLA 2PLCA 1V6TA 3BJTA 2VEMA 2W63A 3TZNA 5HNTA 4LPCA 4IXHA 1TTJA 4LOCA 2V68A 4I7VA 1EJUC 4NJJA 5D32A 5M3WA 2Z00A 1XYAA 5GNYA 3H2EA 5ECVA 4BQ4A 3DKJA 4MB4A 4RZBA 2ZRXA 1XYMA 1Z42A 4LF2A 1UR1A 3M16A 3GH7A 2WMFA 1MMFA 4JNZA 3N2BA 4QXIA 1SGJA 1MVYA 3OGRA 5H91A 5CZKA 5BOEA 1FDJA 4QG6A 2FH8A 2PF0A 4XAPA 2FTWA 4IMGA 3W4RA 3S1XA 4DNAA 2H3BA 4GCAA 3GUWA 3TONA 4JTFA 3NVWB 1P6WA 1KGWA 4GI4A 3AALA 3TIMA 3TP4A 3PTMA 3OLGA 5CJNA 1KBIA 2UY2A 4IQDA 4CGTA 3K2GA 4A3HA 3NSXA 2I5IA 4ZOHB 4K2SA 1AZ1A 1N5WC 1JDCA 3MCOA 1I2QA 3LCHA 3SURA 2DIEA 4K1GA 4F4RA 3A4WA 4IFKB 3SCQA 3RK8A 4JX6A 3WF4A 3EAOA 3KBJA 1KM5A 1W1YA 4ROQA 4J3VA 3AS0A 5H1WA 2BY0A 2DP3A 5DELA 1BYCA 1FH9A 1A3WA 3HU7A 5BCAA 3VNMA 4BA0A 1QW8A 1OBAA 1HGWA 4UOQA 4ERIA 2X09A 3R4IA 4HHPA 1B3VA 4X61A 1ISWA 1ZAJA 4G6CA 4UQBA 5CC3A 2PDJA 4I5RA 1JQXA 2Y24A 2QDHA 4ZXOA 2ESCA 4LUIA 4WDWA 2J9XA 3PZVA 3OC4A 2C14A 2ZADA 1XLJA 4WSKA 5DBTA 4HHLA 2ZRYA 1K77A 3VX0A 3P60A 1I2OA 3ZT6A 3UWZA 3CLWA 3SADA 4L6HA 1ZSXA 3HN3A 3S2NA 1E6NA 2WVVA 1G7UA 1MDRA 1WKEA 2EQ9A 3EBVA 3ONBA 4MB1A 2ZUMA 3UJSA 5G2WA 3CT7A 3TLLA 3VCRA 2WC3A 5C2GA 3K13A 1KM0A 4LAOA 2ZIDA 1QK0A 4EQRA 2PAJA 4P8UA 3A4XA 2ZDSA 3THQA 3GBDA 5FAJA 2UV8G 3IK4A 5DRCA 2BDQA 3D3AA 1GVFA 2WWCA 4XKYA 4ZO6A 2XFYA 3H2AA 5A6BA 4H4XA 5A6KA 3SFKA 4Y9PA 3DC8A 2WVVB 1BWKA 1ZHAA 3L4ZA 2QDDA 3NOYA 1S5MA 5CC5A 3CLMA 5A6JA 2FPTA 3LN3A 4B5UA 3TR9A 2HV5A 1ZGDA 2PDMA 5DY2A 2HS8A 3ZSSA 4EWND 2OWCA 1ZRQA 3VMNA 3QYQA 4YLWA 4F48A 4LYRA 4XKYB 4RK8A 5EMKA 4Q4OA 3H2FA 5BXPA 1NQKA 3EWCA 3D0CA 3N2OA 3W73A 4K8GA 1AMKA 3UZXA 1T7LA 4A35A 1IZJA 2WZHA 4PMUA 3LCXA 1WX0A 2HQMA 1OFDA 3E0LA 5AHEA 1M41A 1OCBA 1JZ7A 3KEHA 4CNNA 1V0KA 1ZP3A 1IV8A 1GOXA 5F4SA 4YCOA 3EKGA 3WFAA 4L6OA 4NUWA 3AYTA 1ODZA 3K46A 1GVQA 3WYZA 1CCWB 1GVEA 2J66A 3OVGA 1NH6A 2E3TA 3PBWA 2XSAA 1K8ZA 3P5YA 5FS8A 1MXGA 1ZLPA 3TU9A 3DKLA 5JBEA 2BVYA 1YQZA 3SBFA 3L66A 3OZOA 4YHGA 4Q32A 2C0AA 3EWXA 1KCLA 2CLMA 1IIHA 4HCHA 3ARVA 5I3JA 4UC5A 1DHPA 3TXVA 1KFEA 4HNVA 3MSGA 3R79A 1JGIA 4A3UA 4MNMA 1PE1A 1VLIA 2QPUA 3KLLA 3W7NA 1LOSA 2DJXA 4H7ZA 4W4QA 2OELA 3VNYA 3IVTA 4ZXLA 2ASHA 3VILA 3N9SA 3PFRA 1IT0A 3GXMA 2NSXA 4IICA 4TU1A 3SO7A 4RPPA 3RMJA 1CXFA 1D3CA 5D9OA 3CUGA 2PU0A 4BQ2A 3M9YA 5JCMA 3QVQA 1SSGA 1TFVA 4Y6GA 3N4FA 2Y8VA 4F3HA 1QOQA 3HQNA 4BI5A 3UG5A 2QDGA 3NM3A 3G24A 1QPQA 2V63A 2GDVA 4LW7A 4TIMA 2H8XA 4GUFA 1R3TA 1GK8A 5BU9A 3RNDA 1EC7A 3S2JA 3FJ6A 1LQ0A 2CNCA 3CL8A 1TJRA 5A6LA 1HKKA 1DXFA 4WJ8A 1T3QC 1XHCA 3P14A 3L4YA 1RQEA 3LBOA 1AW2A 3ARZA 4UQCA 4GIRA 4LAUA 1OM0A 4FX8A 2J7DA 4UQDA 2CLIA 4GWEA 1AH3A 3CQHA 3VOHA 4X9YA 3SCVA 1YDYA 3VA8A 1C8XA 1RP8A 3SR6B 2RFGA 1WNOA 2FJKA 2R9ZA 3HMCA 3IGUA 3CGEA 1UWSA 3ZZ1A 4QNEA 2WKGA 3HA1A 3L4VA 2VO5A 4GZJA 8XIMA 3CQ0A 1ISXA 4XSLA 2P76A 4KEMA 4XD4A 3G8EA 4NI8A 2HVOA 4HD5A 3GH4A 4L1GA 3W1RA 3PZUA 4J35A 3NQ6A 4PMRA 1UD4A 3W29A 3TCEA 2HXUA 5HJLA 1M03A 3KLJA 1Q6QA 3DG3A 1V5XA 3BG3A 1XI3A 1PWLA 1PZ0A 1DWHM 3LQLA 1TO3A 3QFBA 1HJSA 4H19A 1QPOA 1EQCA 5GNZA 1X98A 1KRCC 3SCPA 2X99A 4GKTA 3UG8A 4JTUA 2D23A 2PRLA 2VR2A 4P7QA 4O15A 3OODA 1GOOA 3UY7A 3WQPA 1V0NA 1CXLA 2VT0A 1Q1WA 4B3ZA 3WK2A 1DWAM 5LIKX 3TYEA 4CNSA 3P67A 2X30A 1QBAA 1TPH1 4KPRA 3L0NA 3GIYA 1U30A 3B8VA 2GWNA 4G9PA 4DBDA 4M1BA 1EA0A 1KR1A 1ISYA 3MP4A 1R7AA 1BWLA 3H6OA 1CLXA 4GUIA 2G3IA 1CGWA 3O9NA 2YB4A 4X9SA 1TREA 2Z6JA 4LUJA 3PAOA 2ABAA 2J6VA 4NNAA 4PRWA 5GJPA 2DH2A 5AVNA 4RZ5A 4MLJA 1JCTA 3IJDA 3M7SA 1R47A 1BD0A 4A2RA 2ZX6A 3BAIA 5LGXA 1UJPA 3ITXA 3UWQA 3UY8A 3IUIA 2Z2AA 4DAFA 2VDHA 4DYJA 3AHXA 4WJEA 5EGRA 4JIRA 3FSUA 3TYBA 3ATZA 4JTKA 3LLXA 1R87A 1H62A 4B4HA 2ZOXA 4CQBA 5K9XA 5FF4A 2ISFA 4WXZA 1OD0A 5LXXA 3WCZA 4ATWA 5G5IA 3I68A 3JZEA 3DFTA 5IFTA 4CNPA 3QY8A 4YXGA 1H7PA 1EX5A 2NT1A 2C7FA 2TAAA 3Q37A 3Q6JA 4P7RA 3SUVA 1SJBA 1Z89A 1UC4A 3IUHA 2A2IA 1GXFA 4ZE5A 3AIRA 4F79A 4XAFA 1S5VA 2E5AA 3GNXA 4CNOA 1TUFA 1PKYA 2A79A 5CEWA 2OZ0A 2XIOA 3IJ9A 4PCTA 2X1UA 1RK5A 4QE1A 5A6MA 4RW3A 3PB0A 2DT1A 4XZLX 2X8HA 1UH2A 2CWNA 3R7MA 3DG7A 1R3QA 5A1AA 2E6YA 4P5UA 2P53A 4PMZA 2PURA 4OBTA 4IPNB 3BLDA 3OBKA 2DQWA 3P81A 5FJTA 4TV6A 2FGZA 4PTVA 2FHFA 4LVBA 2FQIA 1NVMA 1OYBA 2PDBA 3RITA 7CGTA 1QRQA 3KCLA 4O1FA 1NTHA 3T09A 3S5NA 3QMTA 2PDQA 3E49A 3V5FA 1TPDA 3CHVA 1OFQA 4NAEA 1BPLB 3ZYZA 3N34A 5TQLA 1B54A 1I1XA 4E2BA 3R0DA 3H4WA 1KKOA 1DJZA 2X7WA 3KCJA 3OVPA 3AMDA 1F07A 4PRRA 7REQA 4H4TA 4PC8A 4DJDD 4EPDC 3AHTA 4PEKA 1EYEA 2HQAA 1ZALA 2W61A 2W66A 2E67A 1B90A 3F03K 3HFTA 1VFTA 4L4PA 2XIQA 3CS2A 1JCJA 5AZ1A 5M5DA 2PGRA 2FYMA 5BWFA 4R34A 1M65A 3CTTA 1J2BA 4NAEB 4A6GA 3A9BA 4R7OA 2DVUA 3R6IA 3TFXA 4JQ9A 2XHYA 1KFWA 4QG9A 2FJUB 2E25A 3GR7A 4MKSA 2FVKA 1V3IA 2QCLA 2EXOA 4XKMA 7REQB 1O1HA 4MWAC 5CZ0A 4C7FA 3UCQA 4Q33A 3U0HA 8CGTA 1FP9A 1JQVA 1P0DA 3MW7A 3FKRA 4F0KA 2IPFA 4AZ5A 3W1PA 2VCCA 4GYPA 4J3ZA 3MT1A 2WV8A 3INPA 1PCKA 3NL2A 4XD3A 5CG0A 2PWFA 1XICA 3UG3A 1U83A 5HQEA 3GHSA 4JOMA 1KW1A 2CKRA 3W0KA 4Z1CA 3B8WA 2D3NA 2YPIA 5TIMA 3AMCA 3HPZA 4CEUC 2CCRA 3G1RA 3S6OA 1E43A 4YYFA 1JCNA 1H0GA 2Y1HA 5CSSA 2J47A 3I3EA 1XH2A 4EQXA 4JAWA 4LU0A 3U57A 4AEEA 4I8YA 2NQZA 1MZRA 2Q02A 1XV8A 4Y9AA 3AIWA 3QV7A 1L8NA 5A8PA 3VTRA 2CWXA 2VFGA 1CB7B 3TFCA 9CGTA 4EMWA 3DZ1A 3KBMA 3PUEA 4HZMA 1U1UA 3W23A 2OZ3A 3BJFA 3L4TA 1DOSA 3UW6A 1T96A 4MF4A 4JNYA 3TXZA 1ZMDA 3I6EA 3OZYA 4NJKA 1XW8A 2W79A 3UFYA 2C0HA 5I3FA 4JTGA 4NSBA 2WMIA 2XH2A 4KH2A 4GX8A 3MB9A 2HNEA 1B2YA 2E1WA 3V0SA 2IPGA 3NFUA 3VIJA 3EB4A 2X8RA 1CXHA 3II1A 3Q2DA 3DC0A 4M1RA 3W7QA 3W2MA 2R91A 3B05A 3HG5A 4HKPA 1B4EA 2WHLA 4Z08A 4H4YA 4C6JA 1ITXA 4L65A 4BWLA 1LWIA 3DBPA 4PA8A 3GC5A 3W82A 1QK2A 2E6AA 4Q6XA 2ZUSA 3DHFA 3A12A 5A3HA 2WMIB 2YDAA 4J3SA 2X7VA 4ERGA 1XLAA 2Y6ZA 3WDPP 2O55A 2P8BA 5K9CA 4IFOA 3GYEA 3DFOA 4LB3A 2X0HA 3O1NA 4HMNA 5DMNA 4W89A 4D6CA 3B0VC 4AZIA 1KCKA 4L6DA 4K8HA 2V5LA 3GC2A 2EAWA 1UR4A 4PMVA 4N9EA 3JS3A 2BG5A 3KW3A 3HMJG 4KQNA 1CXIA 2XG9A 3BJSA 1N8FA 5EBKA 3QR1A 2VFEA 4YL2A 1OC6A 3CAWA 3TQ0A 3UXLA 1EL3A 2WNNA 2QCDA 4O1DA 2SFPA 5D33A 4M6PA 1CGVA 1EZ2A 1IEIA 4FZIA 1LT7A 4HJFA 1KR0A 4TVWA 2WK2A 1CT5A 2Z4GA 1CYGA 3EAUA 4YMZA 1YDOA 3KRSA 3GVRA 5FS9A 2XN2A 3E0FA 4AXKA 4I6VA 3WO8A 4F40A 1XFCA 2WSKA 3ZWSA 1D3GA 2WC4A 4PUWA 3TZFA 1V0MA 3G1FA 4EP8C 2WW5A 5AC7A 5FI8A 2JF7A 2V38A 3P62A 5I3HA 4MGGA 4HQVA 1C90A 5LIYX 3TVAA 4GH1A 2IQTA 1NJJA 1H63A 4XG1A 4AD2A 1KQZA 3TMLA 4LALA 2Z24A 3RLVA 2B7PA 1VJZA 4DO6A 5PTDA 1E1FA 3ARQA 2BOGX 1GV4A 2WLZA 3NA8A 2NLYA 4BEUA 1V79A 2QUVA 3VFCA 4GJ1A 1A0EA 3EWWA 1EPXA 3MKKA 3RRXA 2H3DA 1UROA 2GGEA 1ITQA 1VYPX 3NZPA 3DHDA 3IJ7A 3CZKA 3TNOA 4WF7A 2X16A 3EDKA 1TWIA 1RY8A 3WDQA 1ZKQA 4J2MA 1B3YA 4M7SA 3NM1A 3H7RA 1JPKA 3O6DA 2A85A 2WPCA 4K7YA 3QFEA 4Q22A 4D9PA 3HJZA 3DCPA 4DB7A 4RUBA 4PB3A 2Q71A 1E71M 1XJBA 3C2EA 1H3GA 4YPJA 2JBMA 3AI0A 1S3TC 3G1XA 3AZRA 4GGBA 4M6VA 3SRHA 3UU0A 4KW2A 4JIIX 4Z1YA 3LPGA 1OX4B 4PB4A 3AROA 2G3JA 3OIHA 2PLJA 3WQWA 1BRLB 3ORWA 4MNJA 3CQJA 3WQ5A 1GRFA 2W3SA 1UKSA 2AQOA 4IIBA 1VQZA 3TLQA 4GZEA 4UFIA 4N42A 3LU2A 1GETA 1FWRA 1D9EA 1SFJA 1LBFA 1F6KA 3MO4A 4OWGA 1CXEA 2I14A 3B4YA 4DZ5A 2HXTA 1NM9A 5FEWA 4LYQA 4QDWA 3THCA 4R9XA 1SZEA 4JTDA 4JX5A 1K03A 4KS0A 4MYAA 2VMFA 1MNZA 3E0VA 3VD4A 4AIEA 4ZA0A 3P0WA 3CPUA 3L12A 4GO8A 4F2TA 4EWJA 4E2OA 3BOLA 3S47A 4ZFCA 3DFQA 3KOFA 4K1WA 3L0GA 5D04C 2HJPA 2PD5A 3TYZA 2YR1A 3FA3A 1OJXA 1W32A 3E1F1 1G1YA 3S6DA 4NILA 3NURA 3TC6A 3I3DA 3T1GA 3ARWA 3LV6A 3L21A 4DNHA 3R58A 1R2TA 1FCBA 5I06A 2GQ8A 4LA1A 3I6RA 3WD1A 3BMXA 4A3QA 3PPFA 4F66A 1RV8A 3O0HA 2Z2UA 3QC3A 1YQ2A 2VZOA 3WEOA 4EF9A 3LGDA 3RYSA 1ZXIC 1Q7QA 1TPC1 1NOWA 2TPSA 6A3HA 4CUCA 3AXHA 1M6JA 5HPCA 5HNNA 4NZ5A 1W0MA 1W9PA 5C70A 4JFTA 4DNMA 1F3TA 4MLRA 1UH4A 5BOOA 2QQ6A 4TV5A 3W81A 4LAMA 1IXNA 4V2XA 1CBGA 5D03A 4IX2A 3QHOA 1OGBA 4AIOA 3WD2A 4KMQA 4DWSD 4AIUA 1DL3A 3ARTA 2R1NA 3M0LA 4BF7A 2EBNA 3Q94A 2VFIA 3VYLA 1QASA 4TVYA 4TVCA 2VWSA 4QGCA 2BB0A 2G4JA 1VBHA 3R8RA 1VBGA 4PN2A 3S83A 4O0ZA 1XIBA 6TAAA <