4K2SA

Crystal structure of the mutant p317a of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
404
structure length
393
Chain Sequence
SLKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVASSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGATDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords D-mannonate dehydratase
publication title Crystal structure of the mutant P317A of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate
rcsb
source organism Chromohalobacter salexigens
total genus 147
structure length 393
sequence length 404
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4k2sA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4k2sA01
4GFIA 2XH2A 1EC7A 2ZC8A 4K2SA 5ENLA 3CB3A 3FYYA 2XH7A 4DHGA 3NXLA 4A6GA 2PU1A 1KCZA 1KKRA 4ROPA 3IJLA 3V5FA 4X2PA 2I5QA 5FJPA 3ES8A 4IP5A 2QVHA 1TKKA 2GGIA 3QLDA 5EU9A 1KD0A 1RVKA 3KUMA 3THUA 3SQSA 1KKOA 2GGEA 4MKSA 2PODA 3DGBA 2CHRA 4GYPA 5IDZA 2PA6A 1ONEA 3IJIA 2PP0A 4HPNA 2OFJA 3STPA 2ONEA 3B97A 3DFHA 3OW1A 1XS2A 3GC2A 3FXGA 3P0WA 1JDFA 1E9IA 3QN3A 3BJSA 3MSYA 4E4UA 3U4FA 3TCSA 3DG6A 3ZLGA 5FJOA 3DESA 3DDMA 4KEMA 2P8CA 5J04A 3N6JA 3PFRA 1NELA 1WUEA 2QGYA 4GISA 3NO1A 4IL0A 3UJFA 4GYPC 2PS2A 2QJNA 3RRAA 3MY9A 3JZUA 3PWIA 3VDGA 3ENLA 2MNRA 1WUFA 3IK4A 3QKEA 3PWGA 2OQYA 3K1GA 4JN7A 3T8QA 1L8PA 3TQPA 2AL2A 3MZNA 3BOXA 5FJTA 1SJAA 1SJBA 2PTWA 3DG7A 3R25A 4GMEA 3TWBA 3RITA 2ZADA 4A35A 3N4FA 2XGZA 3OZYA 2O56A 2OKTA 1JCTA 2OLAA 4HCLA 4HNCA 3S5SA 3H7VA 3N4EA 1P48A 1OEPA 4GGHA 3CYJA 3JW7A 2PU0A 4HNLA 2PSNA 1EBGA 4J1OA 4GGBA 3P3BA 2GGGA 3RR1A 4H83A 2HZGA 3EKGA 3UCDA 4HYRA 3VC6A 4JN8A 3Q45A 3JVAA 3TWAA 3CK5A 2OZ3A 3MWCA 3GD6A 3UCCA 4E5TA 3R0KA 4MMWA 4KPLA 3ZVHA 2PPGA 2AL1A 4KWSA 4M0XA 1BKHA 4IHCA 2OQHA 2XSXA 3H8AA 3QTPA 3SN0A 4A3RA 3FCPA 3VC5A 1W6TA 2GDQA 1JPDX 1EC9A 3Q4DA 4G8TA 2DW7A 2QDDA 3HPFA 2P0IA 3BSMA 2FKPA 2GL5A 3R11A 3I6EA 3GY1A 3SJNA 3V5CA 3TTEA 1FHUA 3UJ2A 4F4RA 7ENLA 3DERA 3SN1A 3N6HA 4Z1YA 2PMQA 1MNSA 1FHVA 2PGWA 1R6WA 3R1ZA 3SBFA 5FJRA 2PTZA 4EWJA 3T9PA 1EBHA 1MDLA 4HCDA 3RCYA 4GIRA 3T4WA 4IL2A 3MKCA 1F9CA 1R0MA 3DG3A 1XPYA 4H19A 3S47A 3SN4A 4FP1A 3FV9A 5BOFA 2AKMA 3R10A 1P43A 3IJQA 3TW9A 1BQGA 2P3ZA 3D47A 6ENLA 1EC8A 3VCCA 3GO2A 1MDRA 3VA8A 3TJ4A 2OG9A 1SJCA 3FVDA 2GGHA 4H1ZA 3UXKA 1PDZA 3TJIA 4DX3A 2MUCA 5FJUA 2QJMA 4K8GA 1MRAA 3VFCA 2OZ8A 2XH0A 3H12A 4IZGA 4HN8A 4IT1A 4KT2A 3UGVA 2AKZA 4ZCWA 4M6UA 2POZA 3I4KA 3RO6A 2P8BA 3ZLFA 1NU5A 3D46A 2PTXA 3FJ4A 4E4FA 3QPEA 1PDYA 4DWDA 4IP4A 3UJEA 4MGGA 2GSHA 2AL2B 2HNEA 3MQTA 3DEQA 2P88A 2NQLA 3ES7A 1SJDA 4ZA0A 4JHMA 2GGJA 3TOYA 3T6CA 4ENLA 4YWSA 3OPSA 4DN1A 4DXKA 2OX4A 3V4BA 2QDEA 3ZVIA 3U9IA 3SSZA 1DTNA 4H2HA 3OZMA 3MUCA 2RDXA 2PP3A 1ELSA 3PK7A 2OVLA 2PGEA 4E6MA 1TE6A 3VCNA 3ZLHA 5BOEA 2OPJA 2HXUA 4E8GA 4HCHA 3CAWA 1TZZA 3OP2A 3DFYA 3DIPA 1ECQA 2PTYA 2QQ6A 3UJRA 4J3ZA 2QJJA 4FI4A 3UJSA 3P93A 3ZVHB 2XH4A 3I6TA 4Z17A 1MUCA 3CXOA 3OTRA 3UXLA 1JPMA 2HXTA 3CT2A 1YEYA 3RGTA 2OO6A 2PP1A 3NZGA 2PCEA 3EEZA 3V3WA 2OZTA 3H70A 3NFUA 3R0UA 4K1WA 2FYMA 1IYXA 4DYEA 2DW6A 4G7FA
chains in the Genus database with same CATH superfamily
2ZKMX 5CC7A 1X7FA 1RPXA 2XH2A 1L8NA 4MB5A 1VQTA 3BH4A 3U5UA 3OZOA 4H3DA 4R7WA 3STCA 4PSPA 1UYQA 3U6WA 1SFTA 3H24A 3K8KA 4WDTA 4A2RA 2NLIA 4ZFMA 1S3HA 1B90A 2EQ7A 3L5OA 4CCDA 4I8DA 1KKRA 3BAKA 1RK5A 3IJLA 4DWSD 3PZVA 4AY7A 3PZNA 3LGGA 2R91A 3TXZA 3H7RA 4RZ4A 4JTLA 4X2PA 4UQCA 5LIUX 1VFUA 4FAMA 5K4XA 1CGTA 1UR9A 1JXKA 1E1FA 4FLSA 3KDOA 3H55A 1UJPA 2GGEA 1O6IA 2PAJA 4YS1A 2BDQA 4IMDA 1SZGA 1UD4A 4LCQA 2PP0A 4WLCA 4B16A 3W01A 3MHFA 1JGIA 4Q8OA 4ILSA 2FHCA 3VX1A 4HB7A 3TYDA 1SW3A 3R8RA 3M4HA 2CETA 2Y7FA 3SY1A 2YFNA 2OU4A 4NEWA 4A22A 4DF1A 3DKJA 1JOAA 3HJEA 2TSYA 4PMOA 3II4A 5ECUA 2VX7A 2F8QA 1QHPA 4HJFA 4UIOA 3N6JA 3PTQA 4RDZA 3GM8A 1G6CA 1ODUA 2CLMA 2WHMA 4ZMGA 3GAYA 3UJFA 4ORMA 4GI8A 4IUOA 2G4JA 3DZ1A 3OJGA 3T44A 4JFWA 2HE8A 4W84A 3FG2P 2DZAA 3UG4A 1VIWA 1FFRA 4QITA 1L8PA 1PTGA 3I10A 3HO8A 3EXTA 1OADA 3A3WA 2F5ZA 2GYIA 5EMLA 4EM4A 3S1WA 3E0VA 4GMEA 3SIZA 4LS0A 1JG9A 2O56A 3W7GA 3SM0A 5D02A 3A5VA 4GA8A 1JCNA 4NNBA 3VNZA 4IIFA 1H09A 1W54A 4NZ5A 3P6LA 4Q4RA 1XKJA 1KBLA 5FEWA 4MNMA 3P3BA 2GGGA 3B8UA 2XSBA 3NEVA 3S83A 1CPUA 1WXJA 1R2RA 1KW1A 4PUJA 5I6SA 2WQPA 5LGXA 3WLMA 2GJLA 4TX8A 2X40A 1HKVA 1WYIA 5F2IA 5TQLA 2VCBA 2F2KA 4GRSA 2V5JA 2CFFA 3AU6A 3GTIA 4MUZA 1G5AA 4ONVA 5LYRA 2PC8A 2PGRA 1LT8A 4Q4KA 3O6DA 2O4MA 2WAGA 4ZBCA 3EDEA 2OWWA 1G4TA 5AHIA 3ZMRA 2IPGA 1EQCA 2R1MA 4AC7C 4N9EA 2PWDA 1RAKA 1DEDA 2OGJA 4GBDA 5HA7A 3LHVA 4AD2A 1R3RA 4YLWA 3M16A 1GJUA 4ZQRA 1IGSA 3OO2A 1BYAA 1VD6A 1Q6LA 4BWLA 1FH8A 3UG3A 5FEXA 2IQTA 1S1PA 2X99A 2X50A 3B40A 4IQDA 1E6ZA 3U3HA 3M0HA 3S6TA 4HA4A 2HMCA 1GK8A 1TX0A 3KRUA 3W1MA 4A3UA 3KL0A 3ANVA 1TWSA 4D6HA 1W91A 4YPJA 4MYAA 3WH5A 3WBEA 6PTDA 4H7CA 4KFOA 1EC8A 1WDPA 1J5SA 4AY1A 2YDQA 1M03A 1WKEA 1T99A 2OG9A 3TJ4A 1JZ7A 4RV3A 3FVDA 3V7PA 3F7JA 2X2YA 3AOFA 4GUJA 3HMJG 2CYGA 3AS0A 2EGZA 4AVNA 4JEJA 3W85A 2VVNA 4F48A 1R9YA 4OV4A 1L0PA 1JFHA 2WC4A 2PF8A 4IF2A 1ZAJA 4AUBA 2INEA 2Y88A 3PC0A 4WX2A 3R8GA 4MGGA 2HNHA 3KTXA 2GSHA 3GW0A 3QV8A 3AXMA 4LGXA 3ZJKA 3MQTA 3CH9A 4Y7EA 1XCFA 4AZCB 2DUXA 4GNJA 4UQ9A 4W8BA 3BDKA 1NQKA 3ABOA 4PEEA 2XTKA 4IPLA 3V4BA 3PB2A 2GJRA 2JE8A 3SUWA 4JAWA 4DB7A 3UYIA 1CDGA 3E2VA 1TZ7A 4HIBA 1W56A 2BP1A 1VJIA 3RU6A 4IX2A 4YCOA 1XWYA 1GVFA 1VYRA 3TYAA 3T40A 5F2LA 3SZ8A 3MANA 1Q65A 4GO9A 2QQ6A 4LB3A 4Z1DA 1WDDA 4GZIA 1LOLA 2QJJA 3UJSA 5G5GB 2VZSA 1BVZA 3PBVA 5E0KA 1XIJA 3T1GA 3UXLA 3EA3A 3IAPA 5EGRA 5CPOA 3PJXA 5EB8A 5F1UA 2OYMA 2PP1A 2R6OA 3RK8A 1DIOA 1MFUA 4H8VA 4HMNA 1AW2A 3RMJA 1RCQA 3W1QA 1VBUA 4JN6A 3VCRA 1Q7ZA 2ZQ0A 4PMZA 1V4YA 4O54A 2YYUA 2Z2UA 2W9MA 4Q4PA 1OBAA 5GRTA 5CLTA 2ZZ2A 3N2XA 4NI8A 4GI4A 2VENA 4TXEA 4GJ1A 1FIQB 2YBTA 3GW3A 3DBNA 4HBKA 5FJIA 2VFGA 2C3DA 1N62C 1PKMA 4G7FA 4UTKA 3VIHA 3ALFA 4ECLA 3CPGA 3H4GA 3LERA 1RP8A 4XG1A 4DJEC 3F4DA 3K1DA 4I7WA 3CL8A 3WF2A 2AQOA 2J13A 4PC8A 1THFD 2WVVA 4G9PA 3WH9A 1IXNA 1CNVA 3S3GA 1F8MA 4JTQA 4DBUA 3GU2A 2AMGA 3MDWA 1LL4A 1X2GA 3DK4A 2X1UA 2EQ8A 1PYFA 2WKGA 1K8XA 4GVIA 1H50A 3QZAA 2DGAA 3ITLA 2ABBA 5AC7A 3W1RA 5JCIA 4BS0A 2CHRA 2R9RA 4CD7A 4JXCA 3UR8A 2WM0A 4BQ3A 1VR6A 5EMKA 2ZUWA 4QHRA 4JQ3A 2IXUA 3STPA 4JTRA 1YQZA 5AHNA 5D03A 1B9BA 1I1WA 3VGEA 2X0SA 4GFSA 4H01A 1TYTA 3LENA 1CGVA 1VBGA 2PE4A 3SRHA 1AH3A 3L0KA 1QVBA 3MSYA 3U4FA 3RLHA 1QPOA 4NX5A 2A3HA 3VX0A 2JGYA 4LPCA 1MW2A 1U33A 2ZXQA 4WOQA 1ITXA 3W29A 2NX1A 3WDRA 4P7QA 2QGYA 1R9ZA 1LJYA 3PTMA 2TPRA 1EYEA 4UTHA 1M6JA 1ISVA 2QNEA 1NHQA 4AWUA 3V1HA 4JICA 2PWVA 3GHRA 2NVCA 2IUZA 3MPGA 1XYFA 1J79A 3TQPA 2DT0A 4O4WA 4LF2A 1GEQA 4G1NA 4IPPA 2DZVA 4CQCA 3MV01 4WQ6A 1KLYA 4M24A 4O17A 2KAUC 3N4FA 1W8SA 1PB0A 1NDAA 5REQB 1O1HA 4FX6M 2WMJA 3O6AA 3EX6A 1V03A 4F79A 1YXYA 3C0SA 4ZQCA 1EX1A 4FK9A 1ISWA 4NZJA 2XYLA 3W7KA 1FTXA 4FNUA 5JCNA 1GEUA 1EA0A 3C2VA 5JBEA 4M5PA 3OBEA 2GJXA 1PHWA 4AZ5A 3H23A 1EL3A 1BLIA 3G5EA 4XBJA 2YCLB 1XLBA 4JIPA 1U5HA 4JPGA 2CNCA 4W86A 4KWWA 1WYGA 1BKHA 3WFZA 5C0QA 4EK7A 3QHMA 3MHGA 4CUCA 4ZOHB 1VIZA 1NHRA 4FX8A 1V8EA 5K9DA 3S9YA 1GRHA 3IACA 3G6MA 2VL4A 4AC1X 1Y0EA 3BSHA 3MI2A 1A3XA 3DC0A 3O3RA 3RPTA 1E3ZA 6XIAA 2I5GA 1TWDA 3T0CA 1HL9A 4H9YA 4JOMA 3UESA 4JTUA 1AVAA 1J0HA 4M82A 2ZRVA 1I75A 5FAJA 5CJ5A 2Y61A 2V8ZA 1FCUA 1WQ5A 5KZ6A 2O9RA 5KMYA 2GRTA 3R5EA 2CWXA 3ABSA 1C9DA 3O07A 3UPWA 4E4PA 4DO4A 2Q3RA 2QCLA 2QCHA 1XINA 4H4YA 1JYNA 2FPVA 3MKCA 1O12A 1XLJA 3BW2A 4WUIA 3INPA 3H54A 4FNTA 1PCKA 3PG6A 3E74A 3QHOA 4M7SA 2ISVA 3N19B 3R10A 4ICCX 4XISA 2PWHA 1FDZA 4GYKA 4RX0A 2BWGA 1ZNNA 2GPTA 4IGNA 4LW7A 1H7NA 6ENLA 3PZQA 5I09A 3TC6A 5I3IA 3KCLA 2CWNA 4UR7A 3P82A 4DO6A 1W9PA 3IIXA 5CZSA 4H41A 4IMEA 4ZTYA 1XHGA 2F61A 3WD3A 3NPUA 3ZT5A 3DK9A 4C5ZA 1CZ1A 1JQVA 4AD5A 1LUCB 3W7EA 1T7LA 4ZCWA 2POZA 1XP3A 6REQB 3N15A 4BY3A 4KIRA 3VNDA 4DWDA 8A3HA 4H6QA 3AALA 1L6GA 4J2PA 1XGDA 4YTUA 4HZMA 1UBPC 1P1XA 1SJDA 2QW5A 4K6AA 3T6CA 1W2VA 4LUSA 1EIBA 3VUPA 2V5BA 1WDSA 4PRRA 3UEQA 2A6NA 1FCVA 1R3WA 5AC8A 5AYXA 1WXYA 1TMLA 1LL7A 4NZ4A 1NEYA 4HK6A 4KBXA 3O16A 3B3DA 4U10A 3CH0A 3A24A 4AHPA 1E0UA 1KTBA 3O0HA 3CUHA 2ZUSA 5CPSA 1GKPA 2EJAA 3M0IA 1DBTA 3WJSA 4Q8WA 1G4SA 4F2UA 4I5RA 2DT1A 4QM1A 2FTPA 3OQEA 1Q13A 4DJEA 1LOSA 3P8IA 1G01A 5BXPA 2DZUA 2QZRA 3GXDA 1M53A 1TJ2A 1CLVA 2FDSA 3CIWA 5A3HA 2E5CA 2W67A 1IR1A 3FKRA 1S39A 5HJLA 4ATDA 1WDWA 4LFYA 1ME7A 1XM3A 2OLHA 3LHYA 3I7RA 1BHGA 4E38A 4GY0A 4DQWA 2E5BA 3R0UA 1G1YA 4U31A 1Y5XA 4Q8TA 3PNUA 1FH7A 2JGQA 4QG8A 3W24A 1FWEC 2X05A 4B15A 5HATA 1DXEA 3QGKC 4ZO9A 4Q4OA 4GX9A 2C79A 5LKYA 4AHQA 4M6QA 5CGMA 3VINA 3PJWA 2PBGA 3G1DA 3WNOA 4EQWA 4WXYA 4RXGA 4WDUA 3GNRA 1BG9A 5AHFA 2VFEA 4H8UA 3NQMA 4W7WA 1Z44A 3CHFA 3EXRA 2E1WA 4GYFA 3V18A 1A5OC 1BXCA 2FPYA 1MYRA 4OKDA 4RE3A 3R7MA 2I5QA 1LQ2A 5HINA 1KXTA 1EBDA 5F4SA 4UBPC 4TVYA 1SO6A 1KD0A 3PPHA 3KBMA 4O14A 3ARRA 3QZEA 2OTDA 4C6IA 1H6VA 3DI1A 1M6IA 4L56A 3M0ZA 3FIGA 4ZODA 3HIJA 3PAOA 3PUDA 3UZZA 3MP5A 2C1IA 2BVWA 3QN3A 5IOBA 1Y65A 4YXGA 1PZ2A 3L68A 4U3AA 4LA1A 3BW3A 2F9RA 2X42A 3TYUA 3SCQA 3W83A 2D22A 4M3PA 3S46A 2HVOA 2YOCA 4KFNA 4DBDA 5AVNA 1F3TA 1QPNA 2ZA1A 4HU3A 3KRSA 4JTSA 3NO1A 1UIPA 2Y2WA 2CESA 9RUBA 4LU0A 4DM2A 4H4RA 3NDZA 4DLFA 4I7UA 4XZNX 4RE0A 4NNAA 4NZCA 3ENLA 3N29A 4LUJA 4YMZA 2GSEA 3N3MA 1ZL1A 1NM9A 1S5VA 4AD3A 3PVFA 3BOXA 3IANA 1PKYA 5FJTA 4FF7A 4C6KA 1A80A 3MJYA 2ZADA 5C7VA 3AXIA 1O94A 3VE7A 4FLQA 1UUQA 1JCTA 3OG3A 2Z1KA 2OKOA 4RZ6A 3S5NA 1AA1B 1FHDA 1SW0A 4UC5A 2XFWA 1TPDA 2OELA 4UCGA 1H1ZA 1DJHA 1NDWA 3KS5A 3N6QA 5E6YA 3LBMA 3WNKA 4C6CA 1CEOA 1EJRC 3C2YA 2J8GA 4IMFA 2HZGA 1YNPA 1W1B1 3R79A 4JX5A 1XIDA 1JYXA 3W75A 5G2HA 2BXYA 1J93A 4K7VA 3Q6JA 2QCFA 2UBPC 1EJTC 3IGHX 3AYSA 1LROA 2VP8A 1PAMA 4LUTA 4JTKA 5G4HC 5TF0A 5EBUA 5C9ZA 2RABA 3ZZ1A 2YCIX 1AZ1A 2HROA 1E71M 5BRBA 3GD4A 2C14A 2DW7A 3W22A 1GYLA 3UXIA 1R3YA 2J75A 3BAYA 2BS9A 1WB0A 3URNA 3XIMA 3E2SA 1ZJAA 4X0NA 3A22A 3QR3A 1V02A 4W87A 3LLXA 4KESA 1TVPA 3NAVA 3M0XA 2EPNA 1TZ9A 4LB4A 5AECA 3EX4A 1A3HA 1HKKA 3WBYA 4GY7A 2Q02A 1PZ1A 1K3UA 3IIVA 4A3HA 1FHVA 3GDKA 1LLWA 4TMCA 2GDVA 1UH2A 2PTZA 4EWJA 2F6XA 3CV2A 4R85A 3VOIA 2JEQA 2X1SA 3QC3A 3L4XA 1MVYA 2VFDA 4J3XA 1UC5A 4ZQNA 3DG3A 3L0NA 2OO0A 5BCAA 5F2MA 3WQVA 1EDQA 4L6DA 3EPMA 5HNNA 1V5XA 3RR4A 5LNWA 3UWZA 2ZTKA 1DJNA 3USZA 3TP4A 1GTHA 4H4SA 3KVKA 3EKZA 3FW6A 3OGVA 3CNYA 3CJPA 2Y1HA 2NSOA 1WCGA 3PANA 3C52A 3PPGA 4UFLA 1XRVA 1JRPA 1Q8JA 3HG2A 3VNIA 1W1IE 3WLPA 1BZLA 4MDPA 1OWQA 3ZT6A 5CC6A 4M81A 5EL1A 3TJIA 4DX3A 1TPVA 1BWCA 1IIHA 2L5HA 3SY5A 4WZHA 5IXEA 3BMXA 3AUJA 1Q4WA 1UCWA 3RN6A 2GUUA 4N6FA 7XIMA 2G97A 3A5FA 2IQDA 2ACUA 1ZDLA 4QROA 3CT7A 4WXZA 3J7HA 3GXNA 3POCA 2B31A 7REQB 1EGVA 2AAAA 1VGAA 3S2MA 2OMAA 1OT2A 4Q6XA 2G4FA 1V02E 4QDWA 2XN0A 1AH4A 3T0DA 3THCA 1HP4A 1SSGA 4WY0F 3WL1A 4ES4A 1P6WA 1XX1A 1KV8A 3Q58A 4AQLA 2NWSA 1N63C 1FHLA 2V68A 4O1BA 3BG5A 1WE5A 1Z32X 4NJGA 4I90A 1IEIA 2OX4A 3V0SA 4CGTA 3DYOA 4IMGA 1TRDA 4O1CA 2WHKA 5CZ0A 3FDGA 2ZRUA 2VDIA 2WBKA 3KRBA 3OZMA 3L21A 1ZSXA 2B7OA 5H91A 2ON3A 3PN8A 1SVDA 3M46A 3WD2A 3VCNA 3BICA 2A0NA 3SR7A 3H2CA 1TZZA 3NZRA 4FEZA 2ASHA 1YPXA 1NWSA 2ZX8A 1Y7VA 2NT1A 1ECQA 1AZ2A 2NWRA 4A21A 1S5WA 1PTDA 1MUCA 3HQPA 5ER0A 2C16A 4GUIA 1FRBA 3MO7A 4PCSA 2OO6A 1OFQA 1DIKA 4A05A 4A2SA 1YPIA 3L65A 1C90A 2WKJA 3NOEA 1NOFA 1XDMA 3CM4A 1W31A 2WVTA 4HTBA 5DT7A 5TIMA 4DYEA 3SQPA 3THQA 3NA8A 4LTSA 4QJ4B 3RPMA 2CW6A 4AZCA 3VIKA 1GRAA 1GORA 3P61A 1I2OA 4JFTA 3LN3A 1RLCL 1GZJA 1J6OA 3BGJA 8XIMA 2WSKA 1ICSA 3MCNA 3K5XA 3CIXA 3WIJA 2BBFA 3B9EA 4POCA 4WK9A 3VD3A 4CCEA 4L9XA 3AI0A 3VPLA 4N7QA 1MO0A 3LYEA 4C1NB 3QMSA 1V3LA 4GG9A 4ZOEA 2VELA 3HOJA 1PX3A 5KTLA 2QS8A 1K4QA 3NO3A 3QLDA 2WVSA 3W1UA 2YCJA 3QSTA 4V2XA 4LC8A 1VFTA 3BAXA 2OOGA 3VIPA 5FI8A 4ACZB 1YYAA 3COTA 1UOZA 3G0UA 1M7XA 4EXBA 1QOXA 1VZWA 1XYAA 1R46A 3VGBA 4PCFA 5F4WA 2FVKA 4NT0A 4BA0A 2O0TA 4MNKA 2XDFA 3N34A 3O2LA 3QF0A 1HTIA 3KBSA 3ZR5A 1IZKA 3RXZA 4NILA 3NQVA 5CJMA 3ZLGA 2ABAA 4AZBA 4IGSA 1NVMA 1XFCA 2YA2A 1QU4A 2QEZA 1UBSA 1E0TA 2XIMA 4HOWA 1AL8A 2Y4SA 2D0HA 4M80A 1F7BA 1TR9A 5B7ZA 1WAWA 3JZUA 2XUCA 3FDKA 3CC1A 4GZEA 3U2EA 1XH0A 1CXKA 3M0YA 4EX4A 2CXEA 1A3WA 5FIPA 4I9MA 3TA6A 1EUAA 3OOQA 3T55A 1BVNP 3ITTA 1OCJA 4EE9A 3USBA 3I3DA 2EBNA 2E0PA 5LGZA 1EGMA 2PLKA 3T7VA 3TWBA 2XWDA 5AHMA 3LXAA 2PEVA 1IQ8A 4REQA 2AQWA 4A35A 2OZ0A 3VIGA 1SSDA 4C91A 1HF6A 3EDKA 5JBDA 1K8YA 1NDYA 1E56A 1LP6A 3S5SA 5E6ZA 4BK9A 4MJ2A 3HG5A 2B0MA 1J96A 3AJXA 1A5MC 3B0PA 4O50A 5IFPA 3KVLA 1D8WA 3BARA 1OSEA 4HK7A 1W1ZA 2QPUA 8XIAA 2DUZA 3MVTA 3W27A 3WDJA 3W1AA 4UR8A 1H3GA 2VXNA 4K68A 2NXIA 2H6RA 3WFAA 1TPH1 1RD6A 2W3RA 3P81A 2PWGA 1DQXA 3PBUA 2GJNA 2WMKA 3L8KA 3RX4A 2XHYA 1AK5A 4Q33A 1JUKA 3JUGA 3M5XA 4LY8A 1R7OA 3NGJA 2I1OA 1FH9A 3RG6A 1XICA 1ITUA 1UW9A 3EWZA 1UD6A 2YA1A 3L67A 4OE7A 1XBVA 3ZSSA 3E5PA 3B9DA 4MWAB 2GVGA 4U5IA 1XIIA 2DPEA 4HHLA 2VFIA 2E7FA 3THAA 4CLMA 4Z2IA 2VKZG 1R30A 2JFEX 4J3TA 2WPEA 1A5SA 3T42A 3CMFA 1M65A 2NUXA 5I2UA 1FEAA 2PUZA 5REQA 4AG0A 5A6SA 3NM1A 3E2QA 1E55A 3LPPA 1E6XM 4MAVA 3W84A 1WA3A 1V0KA 2Z7KA 1OX4B 4QG9A 4KCUA 3LCWA 1MWOA 2DDXA 4GZ7A 3SO7A 1R0MA 4PR4A 1V97A 5HMSA 1DPMA 4G7EB 3QQWA 4FP1A 4LNCA 4UQBA 3EWWA 1DHKA 5C9UA 2V6OA 4WDWA 3H2FA 3AXHA 5RUBA 3N9KA 5BRPA 4N9BA 3B8VA 4WHBA 1FWSA 2BMBA 2VC5A 4UTWA 3L2IA 2PB1A 1GOWA 2DZBA 1UD5A 1KR1A 4RV8A 1GVOA 3RRXA 5A6BD 1SJCA 5LSMA 4JZ5A 1YNYA 3U2ZA 4I8YA 1ZAHA 1K7FA 4S3DA 4KRZA 1AD1A 3N73A 3L9CA 5EBAA 4AX7A 3DGZA 3MV11 2GH5A 3EYPA 5A8QA 3LV6A 1S2CA 2YBVA 3AISA 4Q3MA 4IG2B 2V3DA 3ZLFA 1UWQA 4G6CA 3UY7A 2GDUA 2ESCA 3NSNA 3UZXA 4IP4A 3M64A 4UMAA 4KWUA 1ZCOA 1WBHA 1UJQA 2VO5A 4RE4A 4BHYA 1WKDA 4ENLA 4XBKA 4XBSA 1OY0A 1UWIA 3L5MA 3LCLA 3PULA 4IFOA 2X7WA 3DENA 4Y96A 1CENA 3KX6A 3NWRA 4QSHA 1IT8A 4KIEA 4GQQA 2ZRZA 1RCXB 2Z1WA 1B57A 1Q6CA 1JEZA 3KOFA 1F3EA 1U5JA 1ZU8A 4QS6A 4CU6A 1I0BA 4LWWA 2I57A 1V3IA 4F0MA 1F6PA 4FALA 3PJTA 4AW7A 4ZENA 2ZVRA 2WZIA 1OK6A 1N7KA 3NQGA 1XGEA 1GETA 1VFSA 2BODX 3EWXA 4PMVA 3NL2A 4QLKA 3LI0A 1LUCA 4LUYA 3GK0A 2DIJA 3KS6A 2PCEA 2J3NA 6REQA 1K70A 2ZZ0A 2QCEA 2UWFA 3SFKA 4JTDA 3ZYZA 1I1XA 4CD6A 1C8VA 4ICMA 1YXDA 2FYMA 3A4AA 1KQYA 4JQ9A 2Y6ZA 1T41A 3ARXA 2WP5A 2VWTA 4DYJA 3HGSA 1ZLPA 3L4YA 2DY3A 1JPKA 4O0ZA 1XIEA 1US0A 2WK2A 3TFXA 4L80A 1TA3B 2YW3A 2ZZ1A 4XUYA 3AICA 3W3OA 1MRQA 1TQXA 3VAVA 1F3XA 4RPQA 3N17A 3D3FA 4ZE4A 4K39A 4IICA 1H7OA 3FYYA 5GQBA 2XH7A 3W72A 2WMIA 1UZHA 1ZY9A 2VDHA 3QHNA 3WQPA 2FH8A 2OQLA 2REQA 4PBGA 2O92A 3FVMA 4TX6A 3IV8A 2BZNA 5CG7A 5FJPA 3ES8A 3F5LA 1ONXA 3WEMA 1B3XA 1PWMA 2J7BA 3M5ZA 1TCDA 2GR3A 3UW6A 4BQ5A 3SCWA 3H26A 4UZSA 1OB0A 1DVJA 3RFAA 3SCTA 2XIJA 4WIWA 3NG3A 5I3GA 4PMQA 4QGCA 4NJIA 1O4UA 1TWWA 3WNLA 5C71A 1W9UA 4TO8A 1PO9A 5M1TA 2VNCA 3GC2A 5FA5A 1BF2A 5T26A 2GFTA 3C8FA 3WD0A 4EPDC 1W9BM 2Y8VA 4QE5A 3UXAA 4LAOA 4FOJA 1Z41A 2JKAA 3C6CA 3PR2A 2V3AA 3KOWA 3VKJA 2QYGA 4LYRA 4LVGA 1LZOA 4NAEB 3HN3A 5BWAA 4L5ZA 1JFXA 4XKYB 4AZ6A 3WSUA 3VGHA 4NXKA 2CDUA 3GVVA 4LAUA 2CKRA 4ZO6A 4ZQMA 4LVFA 3EMCA 3WF4A 1JDDA 2E9MA 2C18A 4W8AA 1PX8A 4JN7A 4W88A 4L65A 4H9ZA 1YW1A 1PS9A 4UOZA 4FOUA 2DQXA 4RNJA 1SJBA 1KM1A 4MY1A 1VFOA 4J28A 3BG3A 1RY0A 4WJXA 1AW5A 2X1IA 4Y9MA 3EMZA 3VABA 4WY0B 2WZHA 3GQYA 3LHWA 3GU1A 1OG6A 3WH6A 1BYDA 1CXHA 3H7VA 3KVMA 3EX2A 3LTSA 4L64A 3DYPA 4O10A 4Y9PA 5A8OA 4BR1A 2FH6A 3N11A 1BVWA 1D7YA 4BEUA 1GESA 4F0SA 3VVGA 3SJ3A 4JN8A 1TPUA 1W1A1 5JBFA 4OWGA 2PDPA 4C90A 4RZ5A 3QMTA 4AIBA 4ALDA 3MWCA 2W0HA 1EJWC 1S2WA 2ZZBA 3GBDA 2FIQA 4K7YA 3KL5A 1L6WA 5G2IA 4UCFA 4TTUA 5H2ZA 3LB0A 1HGWA 4UFIA 3EUB3 1QT1A 1CXFA 1W6TA 1PE1A 3GWQA 4DJDC 1TTIA 2ZFAA 1OM0A 1HGYA 2C15A 4JYEA 8TIMA 2WSYA 2Q8ZA 2P0IA 2D2OA 2GLKA 4XQ6A 4MY9A 3E0LA 1XJBA 1HKWA 3UU0A 3GIYA 1E6PA 2V63A 1FHUA 4INFA 4H7ZA 4RDWA 2VEIA 3T0TA 5AY7A 2WVUA 3CPUA 4J7RA 3PUOA 4L7ZA 3BTNA 4IJCA 1HJQA 2QUUA 3PF3A 5HWJA 2P76A 1FCQA 3Q65A 3P80A 1FWJC 4WKAA 3PG9A 4JNZA 2B4GA 1KM6A 1BXNA 3THDA 4F40A 3TQVA 3WNMA 2YCKX 4D9PA 1EJSC 4F66A 5L9FA 2JIWA 2W63A 1GOIA 1U30A 3QH2A 4BF7A 4PUNA 1H7PA 2CLEA 2Y7DA 1J4EA 3EX3A 3H2AA 4Q4MA 4OT7A 3VDHA 3VGDA 3WJZA 4PSRA 1FWDC 3WDPP 3Q37A 1J2WA 4M19A 3I3EA 2NXHA 3S6OA 3C2FA 2ODOA 5FS6A 5JH2A 4RKAA 2GGHA 2WSPA 2XISA 3LCXA 1KFEA 4HA1A 4WJEA 1PDZA 1OD8A 1VEOA 2YLAA 4JKMA 1LT7A 4RLIA 3CL7A 4KW2A 4IJRA 4DVOA 4S23A 1N60C 1J0YA 3LCGA 4Q8UA 3GBEA 2VRQA 2O7SA 1GZGA 3W02A 4LS1A 1SGJA 3RO6A 1F74A 1GYMA 3QY8A 4XVDA 4JIHA 4LV9A 3SFWA 3FJ4A 4YWOA 4GIYA 4J5NA 3KLLA 4N2YA 5GVJA 5HR7A 1KQZA 3VNLA 3NVVB 2E6FA 3BE7A 1RY8A 4IFRA 3CTTA 4OECA 2VX6A 1SO4A 1RLDA 4PB5A 3MMUA 4GD0A 2G3JA 1SW7A 3R89A 3TOYA 4J2MA 2FJKA 2ZZ4A 3TAKA 1CLKA 5BNKA 3IVSA 2JKEA 4DY1A 4AYSA 3LB8A 4UMBA 4N0RA 5DELA 1HJWA 1JCXA 1AQFA 5XIMA 4U2ZA 4AZHA 1V77A 1VH7A 4G2DA 5CSRA 3HZ3A 4KFPA 3UNTA 4XO7A 3BSGA 1WKFA 5G4EA 4U4MA 1BRLB 2BOEX 3S1XA 3BLOA 3DFYA 3ARUA 3LZ5A 1W3NA 2WCSA 3EKLA 3W2JA 1MZHA 2XH4A 1TVLA 3U8GA 1I6NA 3OYZA 5A8GA 3I6TA 3ZOAA 4MZ8A 4PTDA 4O1DA 3GE7A 4PYSA 4JTGA 4QDPA 2EO7A 2X0HA 3WF0A 2GOKA 5XIAA 6XIMA 1GW1A 1S7MA 4AEEA 1E6RA 2IPJA 1BXBA 3GC4A 3FSTA 1IYXA 5M17A 4EF9A 1OABA 2DW6A 2VVSA 2XN2A 5LIWX 4A3QA 2DIKA 3DFOA 5JMUA 2E25A 2EQ6A 1O66A 2A6LA 4TV5A 2XIIA 2A79A 5AC6A 4PUKA 3UVIA 4DJFD 4EPBC 4AIOA 4ZSTA 1P6CA 4XTDA 3KZPA 3GC5A 1K77A 4GH1A 1SZNA 2WOWA 3UWQA 3DAQA 1XFBA 4JFSA 5A2BA 1E1EA 1OQFA 2XIBA 3GNOA 1EO5A 1MEHA 3W7DA 2Q8LA 4QJ5B 1UP2A 1C8YA 1LLZA 4X2RA 3HPSA 4H6RA 2QVHA 3U57A 3VIMA 5HUOA 1DJWA 1F8WA 2C3ZA 5JCKA 3TYCA 3DHUA 1Q45A 1US3A 1TUFA 2INZA 4NVTA 3B0XA 2ZDSA 1W3TA 1A5BA 5D9NA 3BAWA 3M5YA 4OJYA 2DT3A 3SUVA 2VZUA 5LA2A 4IJBA 5CZTA 1QK0A 2G3NA 2G96A 2ZRYA 3FXGA 3LXDA 3IARA 4LEQA 3TX9A 5JIWA 1Y5VA 4E4UA 1AOGA 4J3VA 3PS7A 4KEVA 4Z2GA 3OLGA 3T2OA 3PTDA 2DH3A 5FJOA 3EGJA 2ATSA 3QTGA 2J8TA 1QO2A 2PLJA 5AB3A 3WLRA 4LVBA 5BXSA 5EKYA 4X61A 2ZIDA 3C61A 3V35A 1XYLA 4JHOA 3RRAA 3WLLA 3EZ4A 3NZPA 4LYPA 2CLHA 2FB2A 1KBBA 2DSWA 4HJWA 2VGFA 1E70M 5B7YA 4D8LA 5M3WA 5EMYA 1FA2A 2BASA 3BPWA 3CAVA 4C1NA 1JAKA 2WV8A 3DG7A 1SYTA 1OCNA 4ZQOA 1UG6A 2A85A 2XGZA 3NQBA 4LV4A 1IEXA 3B05A 3GR4A 1Q7MA 4HCLA 1V6VA 3IIPA 2XSAA 2NVAA 2KZHA 5IBXC 1P5BA 4GGHA 4M29A 2BCPA 3UNDA 1GEHA 2OT0A 3ZJ8A 1RBAA 2QV5A 5D32A 1VHCA 4C6MA 3U7BA 3F2DA 1VC4A 3BLEA 3QZ6A 4OBSA 1AJ0A 1N8FA 1VF8A 2A1YA 4CEXC 3GG0A 1Z6KA 4IIBA 4KWSA 3B04A 4PH6A 4CNPA 5BYWA 3SN0A 2WPFA 3GYEA 1C29A 1U1HA 1KCKA 4MYXA 1Q7QA 2QUTA 4Y90A 5AYZA 2OSXA 3B06A 4GBUA 2VR2A 4XO6A 1O5XA 1WO2A 3EMQA 3ECQA 1HP5A 3O0FA 2F2HA 2WVVB 4OU1A 3WLKX 3L4VA 3LM3A 4XAYA 5HBFA 3CLMA 2YFOA 1PZ0A 1U2YA 1AUSL 3CMGA 4KETA 1LRNA 3MA8A 3QLLA 4UFKA 3OYXA 2DZXA 2C0HA 3JS3A 4L9YA 1R6WA 2BY1A 3TONA 3NDYA 3NM3A 1H0IA 3TMLA 3UETA 1XYBA 4RNFA 4H50A 2WQDA 4FXSA 2CEQA 2CBVA 1FDJA 1FBAA 1RR2A 2WJDA 5BOFA 5LIYX 3TKFA 1ONRA 2ZTJA 1W1YA 2Z25A 2W5FA 4S3CA 3EWUA 4AISA 2ZDRA 4FXJA 5HQMA 1RPKA 4H2CA 4JBRA 1IEVA 4O0KA 3MKVA 4L4MA 1KGXA 4U28A 3A4WA 4RJEA 3AXKA 3W1PA 2ZBTA 2D20A 1HKIA 1U5VA 3AWOA 1WX0A 5KVHA 2BXZA 3VZYA 2NQ9A 1PIIA 1XIFA 3N18A 1BPLB 2OSWA 4WKHA 2V82A 2WJZA 2QJMA 4BI5A 3T78A 5D4YA 4LAZA 1XC4A 4US5A 1W3JA 1XUZA 1TWZA 4D6CA 1W0MA 2XVGA 4NHVA 3F5JA 5DY2A 4NRSA 1RVGA 4KT2A 3UGVA 2ZVIA 1FKXA 1FDYA 4CNOA 4M6UA 4MWAA 3MUY1 2QJHA 2PTXA 3H21A 1M68A 1F4HA 3BCJA 4B91A 3T0AA 1C8XA 3BCDA 1J6PA 3HTWA 2HNEA 3HU7A 3O06A 5U4NA 3W00A 2PDXA 3RMEA 3VD7A 2QAFA 2FQIA 1KA9F 2EXOA 3UG8A 1LDCA 3TV8A 4LSBA 3GDLA 3C0JA 1RUSA 3VMNA 4Q22A 4DN1A 3GXMA 3ITXA 5FL1A 1AQHA 3LY0A 3MUCA 1WOAA 4IXXA 4GUGA 2YL8A 1UASA 3LA4A 4JL2A 5HWMA 2J27A 2GJXB 1K1DA 1E40A 4ZO8A 3VKDA 2V6AA 1BGAA 1XRTA 1EOKA 2A3CA 3G24A 5IRPA 3C4UA 2B81A 4LYKA 4H4TA 3P7YA 4YTSA 5LHEA 2TMDA 4L1GA 2YL5A 4AD4A 3NQ2A 4WOZA 1SZFA 4NXSA 1OK4A 4FR1A 1Q85A 1JEHA 4IX0A 3TN5A 1I2NA 2UZ9A 3WLJA 2HXTA 4DBEA 3SR6B 1YEYA 2ZCGA 5DANA 3OLDA 2E6YA 2DORA 1TWIA 3NL5A 2PDNA 2FLIA 3DFSA 4MWAE 2Y70A 4K1WA 2DVTA 3TLQA 4ADTA 4HHMA 4PL1A 2CBJA 3G1XA 4FA3A 4YTQA 1Q63A 1EX5A 4GI6A 2J7EA 1UZDA 2OEMA 1VEMA 1KWKA 4MF4A 3NEHA 4J3SA 1V6WA 2HS6A 3EAOA 5DX7A 3O0KA 1F6KA 4AD1A 2QIIA 3WQOA 4E2DA 2WPCA 1HW6A 1RBOB 3CB3A 2NXGA 3AMCA 2X30A 1PZ3A 1Q6FA 4MUPA 5A6AA 2PDHA 4DHGA 4GXWA 1WZKA 2J4GA 4A6GA 4A8RA 4ADSA 4GJJA 2V5CA 3DJGX 2Z1VA 3E3HA 2QVNA 3ABZA 4WSKA 3ARSA 4EMWA 4EQXA 3IVUA 1STZA 2R9ZA 1LQAA 1R85A 4LYQA 4K38A 4P7OA 1UWTA 3GDRA 4G5DA 1RSCA 2D2HA 1YRRA 3BZJA 3DGBA 3IJ7A 3W7PA 3VILA 3MYPA 3SW6A 1TPC1 4JTHA 3UPMA 3TN6A 3OW1A 2FVLA 3G3DA 1FXPA 4MLRA 1QWGA 4HOXA 3MVIA 2VD8A 1ZTVA 1FX6A 4PCNA 4R3UA 4XAPA 3H4WA 2A7RA 4K36A 2DT2A 4XX6A 4MTVA 4TMBA 4DELA 3CHEA 5C9WA 2XVKA 3IVTA 2FHBA 3T81A 3WMBA 1YPFA 5FF7A 4LH8A 3O1NA 3KE0A 3EBVA 1GHSA 2YZRA 2P5NA 1TA3A 4FF5A 4GISA 5CAHA 1JYVA 5HJXA 2QKFA 4MFEA 3W2UA 1E9ZB 1I2PA 3VNKA 3IJ8A 1OZQA 1VFMA 5IBXA 2QF7A 3PWIA 1J18A 2EG7A 4LUSB 3WL0A 1WUFA 4ASTA 1TG7A 2V3EA 4DWSB 1WAUA 3TXVA 1LWJA 2RHGA 3CEPA 1E51A 5F1VA 4R33A 3ARWA 4D6JA 3FA4A 1SJAA 2C6QA 5SWUA 1ZZMA 3E0FA 2QDHA 3ID7A 1BGGA 1PL9A 3G77A 2VHLA 2HWGA 3PZOA 4GH3A 1KFWA 1ITCA 3RDKA 4AYGA 4HHPA 1FO4A 3EB2A 3TK7A 3LNMA 3U2CA 1POKA 5C2GA 4O53A 1KRBC 1QWKA 2PU0A 1DJGA 1X1NA 2EG6A 2UY5A 4EAMA 4HD5A 3OQ8A 1JZ4A 1XXXA 3VOJA 1PUDA 3WQFA 4O11A 4H7VA 1H61A 3AZRA 4AWEA 3QFBA 2P0OA 2Z26A 4IQEA 4MMWA 4CN6A 3ZVHA 1I0DA 1LRTA 2W91A 3MUAA 2R1NA 4JR5A 3C2EA 1MXSA 3XISA 2XFFA 4OZOA 4XD5A 1Q6DA 1JPDX 4HZ6A 1J0IA 1EC9A 5FOOA 1GJPA 1W5MA 4GY1A 2X8GA 3EANA 2J7FA 3P60A 2QDDA 4XZLX 1NOUA 1UC4A 1EGZA 2CZFA 1JROA 4JQ1A 7A3HA 3M1ZA 4FX7A 2YIHA 4AZGA 4FHAA 3QYSA 2B7PA 5LXEA 1YTEA 1JNEA 1B3OA 1QW7A 1RBLA 3H22A 2P50A 4AEFA 4ERGA 1Z8AA 1R47A 4L4OA 2XVLA 2UY2A 1EH9A 1GW9A 1VAHA 2QDGA 4E2VA 5FS9A 3SN1A 3CHDA 3QV7A 2HS8A 4H8HA 1UPPA 1NWRA 3G8EA 1WNOA 4WJ8A 3TTSA 1TJRA 2TODA 1QPQA 5AC4A 1EBHA 1MXDA 3B4YA 3MUZ1 4OOZA 1GV4A 1K7EA 4RL3A 4WVXA 3UZWA 3W9ZA 1XPYA 4P8WA 1WBJA 3I68A 3TH6A 4N02A 2PDBA 3Q94A 2V3BA 3VOGA 1E6SM 3AHVA 5C8BB 3WQCA 3VZZA 4F3HA 4AXNA 2WB5A 2WYSA 1FXQA 4C6NA 4OQVA 3UD6A 1GOKA 4I6VA 1Z69A 3CGTA 1TPWA 2HK1A 3IV3A 3HG3A 5I24A 1V6XA 5MF5A 1Q6GA 3AIQA 1KXHA 5HOSA 3N4AA 1WOBA 4GIEA 3I7SA 4DF2A 1ZHAA 4Q6JA 4M1RA 1R3SA 1FVPA 5BMWA 1POJA 3SRKA 3VGGA 4EPEC 3ITOA 1IHIA 3BQ5A 3CWHA 1W3HA 4HA0A 1ADDA 3I4KA 4HNVA 1GOMA 1UWRA 2EPMX 4H4VA 3W71A 2WNNA 1X1ZA 2D1ZA 1OINA 2Y89A 3K8LA 5EBKA 1GKRA 3URBA 3MSGA 3GHSA 4HNTA 2W3SA 2BY0A 3ARTA 3M7WA 3ZS4A 5TR3A 3HA1A 1DL3A 3AXXA 3ZM8A 4R88A 3NS1B 4EOUA 1F73A 2UV8G 3OGSA 4Y2WA 3GB6A 4C65A 4NF7A 4IM4A 1GQLA 4NP7A 5BMXA 3S8HA 3WCZA 4BF5A 2PDUA 1IEQA 4OFCA 5H8PA 3RM8A 4ZFCA 3WEZA 1F3PA 2Z1XA 5EFDA 1Q1RA 1MW0A 3MT1A 3ABQA 4MIMA 4GC4A 5AYYA 3C3UA 5CBIA 3PK7A 4FZIA 4QJ1A 5CG0A 3W76A 2VEFA 4ZXLA 4W4QA 3ZLHA 3Q2DA 3CV7A 4HCHA 1TE1A 2RDWA 1VLIA 2GWNA 3MO4A 1BTCA 1PIFA 2X2GA 2Z4GA 3MUXA 3E0IA 2BVTA 5JUVA 2C71A 4LUTB 5PTDA 1L2UA 4JFVA 3FAXA 1NFPA 3PTKA 5DMLA 1O5QA 2ZA2A 3FKKA 1QTWA 1S2UA 3GH4A 3PAJA 3QYQA 4Q4SA 4OVXA 5DMYA 3AYTA 4B2DA 1FWFC 2WCGA 4PRWA 4O57A 5C54A 3ARYA 2RH9A 1EDGA 1K6AA 3LQLA 4NG3A 1GVYA 3AM9A 1XRFA 3DC8A 1CGXA 1NWTA 3OLIA 2WP6A 4HU0A 3WD1A 1X39A 2ZXBA 3RPDA 2VGBA 3B9JB 1RXOB 3BUVA 5EFFA 3BLLA 3NXLA 5CEWA 3C8NA 1EZ2A 3SCOA 4ZB5A 3GG1A 1MW3A 3OG2A 1EDTA 4Y8EA 5HQEA 1O7AA 3GDTA 4Y9NA 1BRLA 3DX5A 5AYBA 4A8NA 1CXIA 1KNWA 2VMFA 1UKQA 3BZGA 1H62A 4RE2A 3GVGA 3KAOA 3BJFA 1GVRA 4EVZA 1KV5A 1TPB1 5HULA 3LEPA 1MZRA 1YE6A 3FJNA 2ONEA 3PZMA 1OFBA 2AGTA 5G1TA 3TAOA 3VIFA 3TOPA 2J7CA 3CB8A 3R43A 3NL6A 4N42A 1ZBWA 4AVFA 3ATYA 2OSYA 4NZ3A 3TCSA 5L6UA 3V36A 3G8RA 4AU0A 5D37A 4FR6A 3DESA 3AHTA 2GR1A 1E3XA 1MFVA 4C1LA 2OLSA 1UP3A 3OVPA 3TA9A 5T8GA 2WKLA 2ZA3A 3DBPA 1EHAA 3O15A 1D8CA 4KEUA 1JZ6A 4R9OA 1MNZA 3L23A 1NFGA 3QSRA 1Z48A 1O95A 5AZ0A 1XG3A 1A50A 5CXPA 3L4WA 4PE8A 3ARPA 3K1GA 4A29A 1A5AA 2PC4A 3GU9A 3T0BA 1W37A 4N9DA 1TJ1A 3QFAA 2OT1A 3WF3A 2D3NA 4NKCA 4PODA 3KBNA 4ORIA 1DTUA 1QO5A 3S9ZA 4FNRA 3B0UX 1RJPA 2G8ZA 3V0TA 1E73M 1WPCA 3IIOA 2DIEA 3PBWA 3M41A 5EY5A 3UR5A 2AMXA 3LX9A 1L6YA 4JTCA 1CCWB 1ALDA 3GFZA 5KSWA 1W8GA 4HNLA 1H11A 1EBGA 4IOTA 4J1OA 4GGBA 3NZ1A 5T91A 3G1VA 5A6KA 5ECVA 4JHZA 4XZMX 4UTFA 3VM5A 1DWAM 1W3KA 2G37A 4MOZA 4LVAA 2YGYA 1GYNA 4PUDA 1NSJA 5A6LA 1R2SA 3W7HA 1KM0A 4CKQA 5CBBA 2VZOA 1IZCA 1ESWA 4MAZA 2V9DA 4EAYA 3W1XA 3GS6A 2D2GA 5G2WA 4BQ2A 1PJ9A 2XIQA 3M0KA 4DUVA 4KS0A 1JI2A 3MCOA 2FKPA 1B3VA 4L6HA 5KEZA 1JL8A 4JGDA 2WNQA 1RM6B 4LBUA 1EEPA 3TTEA 3QXBA 4R7OA 3MTWA 4URIA 1E9YB 1FFQA 2BXVA 1NHPA 1VCGA 1VYPX 3DH7A 3GRTA 1MSSA 2PMQA 3AMKA 1V6TA 1UZ4A 3QBUA 5DXXA 3WG6A 1FKWA 1XH2A 3LGDA 1IIGA 5HMDA 1T40A 1PPIA 4HCDA 3T4WA 1SMDA 5G5HB 1KFLA 2QPXA 4IL2A 1YADA 4YNGA 1VPYA 2CHNA 2OEJA 1F9CA 3CGDA 1H49A 1B4KA 3TE9A 4NAFA 4DWSC 1XL9A 3FV9A 4DZIA 3LM7A 1OF8A 3B0VC 3NCOA 2YL6A 5HR6A 4N4PA 4WKFA 1D9EA 1MW1A 3QY6A 4EMJA 2Q71A 1KCLA 4CNTA 3VCCA 1A5KC 1KO0A 1P0KA 1Q5MA 4JQ2A 4Y8FA 3KOXA 1TV2A 4A4AA 1WP6A 5CSYA 4S39A 4KCVA 3AHZA 5H8UA 2GQ3A 3QMRA 5LNUA 1GVQA 1K9TA 4CD8A 4HYWA 3NYDA 2CZEA 1ODZA 2NQJA 1UHVA 2R24A 1LBFA 1OG0A 2VWSA 1FWHC 3D46A 1MI3A 2PBOA 2AAMA 3QPEA 4O12A 3UJEA 3UVAA 3GXIA 4GZJA 1DXFA 4JQAA 3W26A 1GOOA 1CI1A 1CXEA 2G50A 4S1FA 3TNBA 4GX8A 3CQHA 4XK2A 1B30A 3FSUA 2NQLA 4I5XA 5C9RA 1H60A 1R2TA 1FWBC 3IRDA 4REQB 3AMDA 1UMLA 3S2JA 1TYPA 3OPSA 5IHRA 4Z42C 5KETA 1K02A 2C1GA 4UQEA 2YVGA 3U9IA 2Y5EA 1J11A 4JKLA 3LGEA 2I16A 1GRGA 3B8TA 3WDIA 4M52A 2PWEA 5C7HA 3BLKA 1G9HA 1B1YA 2Z6IA 3KVJA 1O5RA 2PLMA 1HVQA 2PWUA 1UMYA 4OUIA 4ATWA 3BURA 2WNZA 2HXUA 3DHDA 3AN1A 4HQVA 3LSBA 2R94A 1XLEA 4HSOA 4MPKA 3RO8A 4I7VA 1US2A 4HGXA 3MB9A 3HBLA 5D8WA 5I07A 5K3VA 3FFSA 4QFUA 5CKSA 4C7GA 1JAEA 4BJHA 1XR2A 5A8PA 4OBRA 1NDZA 3SCPA 1N55A 1FWIC 5FL0A 5G1YA 5ABFA 3BV4A 2VCAA 5J5DA 3L4ZA 1Z89A 4PCTA 3OA3A 2CIPA 1REQB 3DXIA 4MM1A 3W2KA 3E02A 1P0BA 2DSUA 4PUMA 5I3JA 3E49A 5A94A 3A64A 2QR6A 2MANA 2WOQA 3C2OA 1EC7A 4HMEA 5CSSA 1HT6A 3JRKA 4XAGA 4Q8NA 3KL3A 2RDUA 2B7QA 2OWXA 4I3GA 3LCIA 3EOSA 1UR0A 4V33A 2Z6JA 1VCVA 3IJ9A 2W79A 3VFLA 2PU1A 1HG3A 4LNYA 3CQ0A 5XINA 4PN2A 3QQ1A 3G2GA 3IIZA 1QNPA 5I0DA 1UD2A 5EMUA 1BG4A 3LBOA 3KFTA 4GJIA 4D8AA 3W86A 3QGAC 3E0WA 1IE7C 2ZUTA 1RVKA 4M6VA 4HMCA 4O28A 4LX4A 4V27A 3GTNA 1E0WA 2QULA 4AB4A 3W1TA 2J88A 3V1PA 2FMNA 1I4NA 1DHPA 2GVYA 4HPNA 2W62A 1KM3A 4IMAA 2TAAA 5T9BG 5C6MA 1PHQA 4GO8A 5BXRA 3FS2A 2QPSA 3WQ6A 4AVOA 5GNZA 2NQHA 5C2CA 1XBYA 3P14A 1ZBVA 2HTMA 2NW0A 4BF9A 3B8IA 2YZ5A 2IKGA 2NX9A 1SPQA 3DG6A 1ISZA 1H41A 2YLLA 2Z1BA 1T0OA 3DDMA 2P8CA 4GVFA 4X0VA 2VGIA 2ISSA 1WUEA 3IWPA 1G7UA 4KF1A 2QAEA 1JJKA 3O8AA 5FEZA 1ZCCA 4MB3A 2X8CA 1C92A 3UWWA 1OFEA 5E0FA 2E67A 3WO8A 1HVXA 2EJ1A 4ADWA 2WMGA 4RW5A 4J3WA 2Y5SA 3K2GA 4GIAA 3HM7A 5I03A 4GQGA 5DRCA 3NQFA 4ATLA 4XSLA 3G1HA 3PPFA 1TX2A 2HSAA 1SZRA 2ZUMA 3L5AA 2QCMA 4UB9A 7TAAA 2A3LA 3W7NA 4LVDA 1YHTA 3S2LA 4FSAA 3S6DA 3AO0A 2OKTA 3PY2A 2V30A 7TIMA 1BF6A 1OEPA 1W5QA 2QT3A 3FHAA 1CX9A 2I5IA 3HPXA 2DEPA 3IUHA 1VEPA 1HJUA 1RALA 3UR2A 2W66A 3G1SA 3PBMA 3EDDA 3NVDA 5FESA 1F3WA 4LEFA 2A21A 3O6CA 4C6JA 3APGA 1I8JA 3V0UA 4UTLA 2A3EA 1OCQA 2AL1A 3FJLA 1LPFA 1EJ7L 3EWDA 3NQCA 4DRSA 3N2CA 3FCPA 1A0CA 4HN4A 3SECA 5U25A 2X8RA 3T09A 1R9XA 3EB3A 4EXAA 2CPUA 2GDQA 4GNKB 1S1RA 1AJZA 1SUXA 2W55A 2YB4A 4QX4A 2E6AA 3B9NA 4H9UA 4R53A 2WW5A 3ANUA 1YBQA 4DWSA 3CPRA 4H9TA 2GL5A 3AIUA 1IT7A 2VDGA 2NVDA 1SM9A 2WMIB 2RUSA 1H7WA 3HB9A 1PWLA 4ZB0A 3VOCA 3IGSA 3PPCA 3M5VA 3R6IA 4QEEA 1T96A 2REQB 4P5UA 4F4RA 1JYWA 4BCEA 4CQ8A 4BI7A 1XDLA 3QKZA 3N6HA 3WMSA 1TV8A 2I14A 1MNSA 3RM9A 3CU2A 2WMFA 4KKXA 4F0RA 2IKIA 5FJRA 2G41A 2BHUA 1WDRA 3T9PA 2O9OA 3WKZA 3GR8A 3WUFA 2G95A 5C55A 3L4TA 4XZBA 1QI5A 3R8HA 2NQZA 1JCJA 4FS9A 5I23A 2LLEA 5GPRA 4QDMA 1R5YA 3AROA 2B7NA 1QW9A 1DOSA 3AJ7A 5LIKX 3MP3A 1R3VA 4ZGYA 3FEMA 3ITVA 4ZR8A 4RNHA 2VX4A 1JZ5A 1S46A 1XYMA 3NOYA 3GG8A 3DU0A 2VFHA 1EEXA 1ZMCA 3IUIA 3AMLA 1V3KA 1CGWA 4MNLA 1D3GA 4B3KA 3M0JA 3WLHA 4ZOCA 3WQDA 1KBIA 5H1WA 3MSRA 3FGCB 1KFKA 4FXFA 3AHXA 4JS3A 1XV8A 1T3QC 3C86A 1UR1A 1J10A 3GH5A 2P8BA 1H7RA 3CQKA 5TNVA 1GVSA 1UKOA 4WD0A 3TC3A 1XD1A 1PDYA 3SCRA 3R07C 2PDCA 1V79A 3LSCA 3P74A 3W2MA 2E77A 1P7TB 4ZA0A 1JDCA 2QUNA 3GFXA 3L5LA 1S3TC 1GJWA 3HF3A 2A5HA 4DUXA 4PULA 2WC3A 4LRSA 1V93A 1IR2A 1G4EA 5HJYA 1K9FA 2VEMA 5A6JA 3SGGA 1IWBA 3LG3A 3GKFA 3VNYA 1BWKA 1UWAA 4UTTC 2PRHA 1CGYA 3EWYA 5HK4A 3IGUA 4HZ7A 3CASA 2BG5A 4KGJA 2QHAA 1Q2RA 3DYMA 2UY4A 1UP0A 4PTNA 4S3GA 2CZ5A 2TRSA 3EOEA 3AU2A 4JTFA 4MZYA 1RQBA 1W2PA 1XIHA 3E12A 4J56A 3FX4A 1KRCC 1QI4A 1JVNA 3P93A 2DJXA 4CQ9A 1WKYA 3E2RA 3W81A 1Y8BA 3SCUA 3CXOA 3LBCA 3PWAA 4XKMA 4WSHA 1P6BA 3PBYA 3M07A 1HO4A 1J8VA 4BURA 3HPZA 5BU9A 4IPJA 2X1TA 5MKGA 3GLCA 3H70A 3CGEA 1QR7A 3A3HA 2D23A 2VUYA 1N8WA 1PEZA 4HPXA 4E3TA 3NDOA 2V2CA 4BWLC 1UD3A 1X6LA 1FWNA 3O05A 2ZC8A 2BC0A 1GVIA 5CPNA 5DY3A 4IPIA 1MQPA 3HGOA 4WGHA 5HAOA 4H9MA 4P7RA 4LAMA 1A5LC 1LBLA 1VBJA 2E3TA 3GXFA 1JUEA 5BOOA 2YKKA 1QBAA 2BFGA 3M0MA 1GOQA 3MP4A 4K3ZA 2QIWA 1L2QA 1NJJA 5D30A 1XD0A 4B5TA 1TKKA 3L12A 2GGIA 3BV7A 3CLWA 3KDNA 4GVHA 2J25A 2XVPA 4GWEA 3OGRA 3JU2A 4B92A 2CU0A 3N2BA 5EU9A 1XUUA 3CUFA 1G69A 5JVLA 1CGUA 5AYIA 1KR0A 1TELA 1JNDA 4LXFA 1OJXA 3WQ4A 5I00A 1EXBA 4B5WA 3WZ0E 1ONEA 3VGFA 3DHFA 3WQ8A 5JCLA 3LLDA 4U33A 2G3IA 1X97A 1DIEA 4QSFA 4K8DA 1H63A 1K4GA 4EIVA 3EPOA 3HQNA 3LHZA 4GHRA 3SADA 4UQAA 2BGSA 2VR4A 3B9AA 1J9YA 3O6YX 1HKJA 2BY3A 2Z24A 4PTWA 1J0ZA 3R94A 1R87A 3A7UA 1V7AA 1GTEA 4MG4A 4QG6A 4D1JA 3A9BA 1ZPTA 2QGHA 3OIHA 4M1BA 3NXFA 3UR7A 2X41A 2PS2A 4FLRA 1BSIA 4H00A 2OQYA 2PI6A 4MSSA 4FO4A 2IKJA 4HNOA 3T8QA 5E70A 4RDYA 4JY9A 3N9SA 2A7PA 2H90A 1LBMA 1GREA 3EDJA 3LCHA 3BW4A 3C0LA 3AAMA 1BYCA 1UR4A 2HRWA 3S5ZA 5FD0A 3WK1A 2C91A 2VURA 1TJ0A 2PURA 4P8XA 1MEIA 4XB3A 1F07A 2BVYA 3JW7A 3TEVA 1EFZA 3WDHA 2E68A 2DZTA 3ICJA 3LCFA 2IMRA 1XLDA 3SIMA 3DK8A 4G56A 2X1RA 2WO5A 3V75A 1XQLA 3RNMA 3EWCA 4D72A 4AWSA 1YTDA 2EAWA 5CH9A 2XM1A 3R0KA 1XLCA 1D3CA 3BOLA 1BD0A 4CNNA 2CHOA 2CLPA 3QOMA 2GZXA 2CLFA 4GXMA 4MPQA 4K37A 2E4TA 2WBGA 2HVNA 4NZ1A 3BAJA 1QRQA 4DJED 1K7XA 3TU9A 1XPGA 3CWOX 2H8XA 3VKBA 1AH0A 5EA9A 5C2XA 2QJIA 3W6LA 1WZAA 4CVWA 1KXQA 3BAIA 4O8AA 5CPMA 3LLFA 1AFSA 1YLVA 2NUWA 1VRDA 3U7VA 1E15A 3GY1A 3DGRA 4CVUA 4GRTA 3SJNA 2GQAA 1H5YA 1UA3A 2ZX6A 3DUGA 4NQ1A 3KHDA 1LF1A 4EP8C 4M7TA 1R86A 3O7UA 3EX1A 2PGWA 4U3CA 2NSXA 3QY7A 3M0VA 3NIYA 4PMJA 4F0LA 4IQJA 2PLCA 1DWGM 3RCYA 4GUHA 2RAGA 3ARZA 5FKYA 5HANA 2ZZ7A 4IGHA 3SN4A 1QCWA 3OC4A 2VFFA 4ZQPA 2BSLA 1MQRA 4Q32A 4QLLA 1ZP3A 2CXGA 3S1UA 1Z7AA 3IJQA 1DKWA 4PUWA 3UXDA 4PL2A 4PZVA 4W7UA 1NF0A 3OU8A 3L4UA 1IT0A 2OJPA 1IXPA 1TIWA 1TPFA 3GO2A 3SY8A 1FFVC 3W4RA 1Z9AA 1L9WA 1Q4NX 3W23A 4NEVA 3RJYA 3GXPA 3RX2A 5HPOA 1YQ2A 3ZIZA 1OC6A 4IUGA 3VKAA 4JTEA 1PSCA 3CZLA 4OGZA 1B3WA 5EMMA 2KX9A 1MMFA 1JZ3A 1E4LA 2PWFA 3TR9A 4IIHA 3VIIA 1GUVA 3CGBA 4UTTA 2DZWA 1M41A 1ICQA 2YPIA 2FFCA 3W82A 3GUGA 4JTTA 3TIMA 1DJZA 4E4FA 4KGLA 4YYFA 4S3FA 1LYXA 2P88A 3URHA 1EF3A 4BI6A 2GGJA 4YWIA 3C56A 2J6XA 3TYEA 1EWDA 4TX9A 3QQ0A 1BAGA 1TQJA 3QJAA 2RJHA 5IHSA 3U5YA 2POTA 1ZB5A 3PUEA 4LT9A 2WZEA 2OVLA 1H51A 1TE6A 2ZRWA 1AJ2A 1DXLA 3H6OA 2O55A 3PZTA 1EF2A 4QRNA 1B0IA 3G22A 4MB4A 5BWFA 5A6MA 2VC7A 3W07A 3BK0A 3PFMA 3MYOA 1I2QA 3EOUA 3RJXA 3MDUA 1HL8A 2X7VA 4NYUA 4RDVA 1A0DA 4MKVA 3SGUA 3DFTA 4P8UA 1X6NA 3TSBA 2YXXA 4JEQA 4XTIA 4KRUA 2Y85A 2PZ0A 3NFUA 4YVXA 5IM51 2HVMA 3BMWA 3ZJ7A 4MY8A 3B0YA 1ZJHA 5G4WA 5GNYA 3HG4A 1QNRA 4HU8A 3UP8A 3AQUA 3FAWA 1HN1A 4HHHA 2WXDM 1LRQA 2R1KA 4PB3A 8CGTA 2C8NA 1SB3B 1ICPA 3I6RA 4AZIA 2Z2AA 5HDRA 4AWTA 4L4LA 1ZUAX 2VD9A 4HA3A 4AZ7A 3B9OA 4B5NA 2PDIA 5ENLA 3V16A 1A4MA 3LMYA 2HPMA 2HEJA 2FZ8A 3AMZA 2VQTA 3IRSA 2V3GA 1JRBA 1DQWA 3FLUA 3SQLA 3ZJ6A 3ERPA 1XBXA 2V2HA 2ISDA 2ZWYA 2YXOA 4W5ZA 3ARVA 1OYAA 4WDXA 5HMFA 2DSKA 3N2OA 3SUUA 4YL2A 2EKCA 1MO9A 2D2JA 3S4TA 4HZ8A 4QBXA 2GUYA 3VD5A 2O7QA 4JYFA 4JX4A 4NYYA 2PZNA 1KN0A 2OEKA 4KRTA 1U22A 1FUYA 3LMZA 1RJRA 3GIQA 4M51A 2DVUA 3UCQA 4AF0A 1HIZA 2E28A 1V3MA 3KWXA 5I3FA 4UZUA 9XIAA 4IP7A 1REQA 3WQWA 2VCCA 3URAA 4TOQA 5A95A 3OB8A 3I4EA 2WCAA 1DORA 4QNWA 4KEMA 4X60A 5J04A 1JR1A 2Q09A 3PFRA 1NELA 4OBTA 4Q4QA 4IFKB 2GVJA 3WELA 1D7FA 3UBPC 1EIXA 1UA7A 1ZXIC 1FY6A 8RUCA 4I9AA 1FWAC 4J57A 3QKEA 4W7VA 1JPHA 3PWGA 4JTAA 3QM3A 4CU7A 2VUNA 3VE9A 1XLIA 3GAKA 2ZE3A 2AL2A 2BX7A 3MMDA 4QISA 3OLEA 3DFQA 3EXSA 4C6DA 2EPKX 5KZDA 2DQWA 3Q67A 4D2JA 3ZFHA 2OLAA 1UKPA 4E0CA 3VK5A 1HO1A 4PTVA 2J7DA 3ATZA 5KZMA 3HQOA 3GDMA 1BEUA 4LF1A 3WLIA 3LUTA 5DXYA 4C6EA 5KVIA 3HJZA 3TSMA 4GR1A 3UCDA 3RM4A 4C60A 4IIEA 2XIOA 3SCSA 3VDCA 3VOFA 1E6NA 3Q45A 3R2GA 3TYZA 3GNXA 2HISA 4O8RA 3MUIA 1V08A 4KPLA 2D0FA 1VFLA 5LA0A 4AMAA 2ZUNA 4UFMA 3LTYA 1RQHA 4H9VA 4DUOA 1L6SA 3TCEA 4G8TA 5HPCA 3HPFA 3KOZA 3F4NA 4Z1BA 3BC9A 2VJXA 3F5KA 3M9YA 3LPFA 2W92A 1ZS2A 1JUBA 1EZWA 1NAL1 1I45A 7ENLA 3C5QA 4B9YA 4V28A 3DERA 2O9PA 4EWND 3NRZB 1PKNA 4Z1YA 4NASA 4KQNA 2XG9A 3FYOA 2J74A 2C7FA 5D05A 4PB4A 6TIMA 1JULA 4L1XA 3TROA 5EPDA 1XDJA 2H9AA 1QNOA 3S1GA 3D5HA 5DEZA 3TW7A 4DBSA 4K1GA 3HMCA 3KCOA 4YIWA 4UTMA 1XBZA 2GQWA 4GOAA 3OVGA 2IPFA 1IGWA 1O68A 3REQB 1QPRA 5K7JA 2YQUA 3LRLA 2FZMA 1RH9A 2FTWA 4CQBA 4QQ3A 4KERA 3DJJA 3EF6A 2E8YA 5EYWA 2F7FA 5AKQA 2WLZA 1E43A 1DJYA 1QI2A 4PMDA 3MI3A 1HUVA 3UXKA 4LJ3A 4TVWA 5FSEC 1DE5A 3TN4A 3KP0A 1W5NA 3GVQA 4ROQA 4Z0JA 3RU8X 3TTOA 3TJLA 1CW2A 3UWVA 4BZYA 1T8XA 4GE8A 2EKGA 1NY1A 1UWSA 3PBGA 1NU5A 4AFYA 1J0KA 1ZJIA 1NWUA 1RQEA 4XUGA 1KBKA 1QOPA 1JRCA 3MBFA 4XZWA 1OFPA 2VRJA 1TSIA 4S3KA 1TPEA 1CB2A 2CZDA 2XWEA 4UUIA 1RP9A 1BTMA 4DXKA 4JX6A 1J2BA 2RDXA 1OD0A 3LHTA 1ELSA 1TO3A 4JQ4A 1GPFA 5BROA 5AVHA 3SUTA 2WPGA 4E6MA 3PZIA 2EEXA 1B3YA 3WJXA 5BOEA 4IISA 3CAWA 1YKWA 1JDEA 4MB1A 2BGQA 3MS8A 1ITQA 2V5KA 2FZDA 3WLSA 1VRXA 4EXQA 1A4LA 3SUSA 4Q7BA 3CUZA 3ZVHB 1VDVA 2J24A 4D8ZA 3AUOA 3KTSA 3T05A 2J8FA 3IPWA 3VTRA 3OTRA 2QCGA 4O4VA 3FGCA 4QS5A 3VDBA 2V5LA 3ARQA 1IWPA 4Q8QA 3V3WA 3WLTA 2PDJA 4LUIA 1VPXA 3DGHA 1XLFA 4I9JA 2FTYA 2XFRA 3W7LA 4HPHA 3UQNA 5KZEA 2CC0A 1TREA 3WJWA 3EAUA 1JD9A 4O0QA 3RNDA 3AIBA 4GFIA 2NVKX 1P7TA 1S5NA 3H2MA 3IUDA 3WBXA 1M7JA 5CZKA 1UWUA 2DSVA 3WNNA 3A7AA 1XKYA 3NSXA 3W38A 2DZPA 5K9CA 2QMKA 1J0JA 1QASA 4F0HA 1I2RA 1N5XA 1GWJA 1ISYA 1KCZA 3QFWA 1Q8AA 1TFVA 3P8JA 3D3AA 3K30A 3UZ5A 3O9NA 2QF8A 3CV6A 4HK5A 3OA5A 1BKSA 1BWLA 3QRHA 3WJYA 3A12A 1QNSA 2E3ZA 3NYZA 1C7TA 5T9CE 4PMRA 2GSJA 5ABTA 4GC3A 4M8UA 5D38A 1CYGA 2ZRXA 5D09A 2AQVA 3CZ8A 4TU1A 2W61A 1V51A 4Q8MA 2FVMA 3ALGA 5LZLA 1W32A 4AMCA 2XN1A 3MMTA 3QW3A 5AHEA 2ZUVA 1LCOA 2XGIA 5E0CA 5I06A 1C93A 5J8LA 2D24A 4HNNA 3WK3A 4O19A 3WMLA 3N13A 1Q66A 2ZYFA 3MKKA 4LCSA 3M6DA 1A0EA 1G7VA 5FF3A 3W1LA 2PRLA 4PTMA 5JIPA 2VEKA 1D2KA 5GNXA 3TC7A 1VCFA 3L2MA 1W1PA 2AOSA 2ISWA 1UUOA 4TVCA 6ALDA 2PDLA 4O15A 2H3DA 5AHLA 1DP0A 2ACQA 4L6OA 1F05A 2XZ9A 5GJNA 3T2QA 4HNUA 5D9OA 2SFPA 1VQZA 1NH6A 1JQXA 2FHFA 2GR0A 4XD4A 4QR6A 2I9EA 3TJXA 3L7RA 3SDOA 1SZEA 1M7PA 1GKQA 3W37A 2XGBA 1E0VA 1OC5A 3W70A 3UF9A 2A2IA 3NVYB 3M47A 1V3JA 4OHQA 5FEPA 1KBJA 3B8SA 2X09A 4J3UA 1C7SA 3TR2A 2O9TA 5FACA 3GRIA 3LXBA 3DOPA 1Q3NA 4Q8PA 2XJ7A 3BWWA 3SCNA 4ACYA 4S2CA 3BMVA 3UGRA 4KCWA 4QAWA 3GH7A 2OODA 1R38A 2CBUA 3BLFA 2ACRA 4PBEA 4N4QA 3B03A 3F2BA 1OGBA 3W6YA 4A3RA 3LZ3A 3VYLA 3VC5A 1OIFA 1SO5A 2IS7A 2NQ5A 4E8DA 4JIEA 1WV2A 3DKLA 3I65A 1VPQA 3VNMA 4H4XA 1A47A 5CSUA 3KLKA 1RV8A 4FLOA 3BSMA 3S9IA 1F76A 4PRTA 1WZLA 3P5YA 1DQUA 2ADAA 3CS2A 1TMHA 4F8XA 4LAKA 4AXKA 3WBWA 5K9XA 3F4WA 3GSMA 4Q7IA 2F6UA 1OFRA 4PEKA 3OHMB 5H6HA 2Q6ZA 4LC6A 2HCVA 3KM8A 3ELFA 3KP1A 3CUIA 4JIQA 2ZE0A 3TNOA 4HSNA 1LOQA 1K03A 4CD5A 4C5YA 1MDLA 1IWAA 4GIRA 1OVDA 3E5BA 4QJ3B 3XINA 2P1FA 1WDQA 3W7JA 4DUWA 3ABRA 1GZ1A 4N9CA 1X98A 1KFCA 3LHUA 2GQ9A 3IC9A 3FK4A 4UWMA 1P43A 2I17A 3MI6A 3APYA 1B3ZA 1BQGA 2BB0A 3ITGA 3STEA 3NSMA 4DZHA 5DLCA 1VHNA 1X8FA 1UOKA 2ZXDA 1YDYA 2C19A 3KOYA 1EP1A 2PRMA 3PM6A 4KEZA 4WSJA 3W73A 4E3VA 2FZ9A 4LS2A 2G3FA 2WNWA 2FZBA 3F4CA 4Y6GA 2OZ8A 2XH0A 2R1LA 4K8EA 3KTCA 3E96A 2OB3A 3GUWA 3UPBA 2GR2A 3LS9A 4R27A 4IT1A 4MLJA 1PBGA 4L4PA 2CFYA 2YXGA 4KPRA 3LXCA 3R0DA 2JQXA 1ZKQA 3CZGA 4UTIA 4U5KA 3RUBL 5D2WA 4JY8A 4O18A 2YYTA 2TPSA 3NPXA 3ORWA 1TTQA 1WXZA 2Z28A 1M9HA 4MHBA 3JZEA 3QOKA 1KXVA 1B4EA 3G3MA 3W53A 1SU5A 3DN5A 2ZXAA 4Y9OA 3VKCA 2DH2A 4Q7NA 5TD4A 4C6FA 1SR0A 1TYGA 2DJLA 4LANA 1T8QA 1JF5A 2X16A 1YMYA 3APTA 4C6OA 9CGTA 3OBKA 5FF2A 3UYCA 4E8GA 4GKTA 1VP5A 2R14A 3OP2A 3AC0A 4GVGA 3ZWTA 2ZOXA 2J66A 1XSJA 2QUVA 2JK2A 3KWSA 3T4CA 1XF0A 5A8NA 2OX1A 3VO0A 1JPMA 1Q6QA 1UB3A 3WD4A 4XWUA 3RGTA 1JCLA 1B5TA 5CBJA 2VEPA 3NTYA 3CBWA 1JDAA 4XIMA 5TBOA 1FWGC 2QCDB 2DP3A 3GFYA 3FA5A 4PCPA 1XIMA 2J9XA 1FWCC 1FOBA 2XZ7A 4O1FA 4I9TA 2ZWZA 5IFTA 2FFIA 3YPIA 2ICSA 3ZO9A 4MJZA 3VKKA 2Y8UA 2FB3A 4X9SA 4DNMA 2W27A 4MDOA 3CXBA 5FSDC 1YTKA 5DO8A 5BU6A 4V1YA 4S38A 4RNIA 1GQKA 4PGLA 2QCNA 3GYCA 1VYSX 1G94A 1N8IA 2GK1B 4DJDA 4UR9A 7ODCA 5MHBA 3IS4A 5I02A 5LXXA 2VTFA 2J9YA 3LU2A 4NAFB 4D71A 1KM5A 2PCQA 5A8MA 4UTWC 4IP5A 2RFGA 3QR0A 4XSMA 3VUSA 3GR7A 3AIEA 2YDSA 5F7UA 2YX0A 4EANA 4HOZA 3TTQA 5A6BA 1TV7A 3KUMA 1GXFA 4MKSA 1O1ZA 3TZNA 3JR2A 5IDZA 3RCNA 2PA6A 3STGA 3KXQA 4TIMA 3IJIA 1E4MM 2Y8KA 2NUYA 4MJMA 5LNSA 2EPOA 3VIJA 3B97A 4F0KA 3PSWA 3B4UA 5CCZA 1E9IA 1EPXA 1P0NA 1FFUC 3BJSA 3LD5A 5LNRA 2IXVA 3AS3A 2WHJA 2J7HA 1PYMA 4YTTA 4WCJA 4FOKA 4A3YA 1EHNA 4NUWA 1Y5WA 1V59A 4FPSA 1LL6A 4DYKA 2VOTA 4G1KA 1KCXA 4IL0A 5I77A 3STFA 1OYCA 3FOKA 1C8QA 1TTPA 2Y7GA 5FF0A 4HMDA 1E1CB 1QW8A 4ZSUA 1XYZA 3MY9A 2E8ZA 3G0XA 1F5ZA 4XZIA 4LALA 4LQ1A 3S42A 1MOKA 1KFJA 1VBHA 3LPOA 1O5KA 3HV8A 4ZTXA 1ZRQA 2E1DA 1VLWA 2E5AA 1ADOA 1DWHM 4HTYA 1FWRA 1AW1A 1H1NA 4I6KA 3UFYA 1MUWA 2PTWA 1RD5A 3WH7A 4L61A 1X7IA 3P84A 1X1OA 2QXWA 3CL6A 1IEWA 2I56A 4J35A 4NU7A 3GHTA 1JGMA 1M01A 3WNPA 4HNCA 2PF0A 1IZJA 1NTHA 2CERA 2PSNA 4HVXA 4EMIA 1ZP4A 3A7RA 2VC9A 1A5CA 3WLQA 1FP8A 1B9ZA 1IXOA 4HYRA 3VC6A 4M6PA 5ABFB 1ONWA 3JVAA 3TWAA 3G6LA 3BLIA 1UQZA 4FXRA 3LRMA 3NQ8A 2PPGA 1OYBA 4M0XA 4KH2A 1S5TA 4IFKA 1LWHA 1OX6A 3EEGA 4QLJA 4DXVA 4OUEA 4YVPA 2V0TA 3RLGA 3CHVA 1NIUA 3MZ2A 1JZ2A 1V6YA 2BY2A 2YR1A 2HPIA 3D6NA 2V3FA 3WBAA 2VZTA 5E9XA 2Y5JA 4P61A 1TR1A 3G1FA 3ETRB 3H7UA 1UZ1A 2BC1A 2IKHA 2DVXA 4B4HA 3V5CA 4W5UA 3F1QA 3UJ2A 5DT5A 1EJXC 4YU1A 3C0QA 2YBUA 5KITA 3EA1A 3FN9A 3T8LA 1S2VA 4L9ZA 5FAGA 1EOMA 3SBFA 1XIBA 4DJFC 4S3EA 1YE4A 4M56A 2O4QA 3TW6A 2JEPA 4TR9A 3M6YA 1UD8A 3AFBA 2QAPA 4H19A 3S47A 4CQAA 3II1A 2YVJA 4UFHA 2J9ZA 1XLKA 3DFNA 3AS2A 2WOIA 1W5PA 5E09A 2P3ZA 1A49A 5DBUA 5A2CA 3TUUA 4XZHA 1MDRA 4AY8A 1ZMDA 3CQIA 1UIOA 2CCRA 4TVUA 4H4ZA 1AG1O 4K8GA 3HFTA 1MRAA 2PD5A 4JNMA 4EKJA 3W7OA 2Z27A 1CIUA 1XG4A 1E72M 4GQ0A 3TN3A 1GPWA 4O13A 5B80A 3LK6A 4JL1A 2P3EA 1F4AA 3VMOA 4V1XA 5J5RA 4EQRA 1NOWA 4F9JA 3L66A 2V38A 4JHMA 1XLHA 1S38A 1XC6A 3A3XA 4HYVA 2Z1SA 2WZTA 4YWSA 3AYVA 3H53A 4ML9A 2BOGX 3ISIX 1S5MA 3A21A 1E4IA 3HFYA 4C6LA 2QDEA 4MFDA 2A8XA 3PJUA 3IJDA 3SSZA 4DO7A 1KTCA 1EPVA 3FY1A 4R7JA 4UOJA 2VZVA 4C6QA 1XLAA 1VFFA 3REQA 1K9DA 3N2TA 2YDAA 2BNJA 4H4IA 3C2RA 3CUXA 1QNQA 2OPJA 3CQJA 3KZSA 2EPLX 4PMUA 1DIDA 3WUBA 1ML1A 1Q6OA 3DIPA 3CO8A 4FNQA 4TQTA 1XH1A 3PP7A 2E5DA 3OEXA 2C3CA 3QEZA 3LADA 2Q01A 3EOOA 4AH7A 2V67A 1VJZA 2NZLA 5DQPA 2NV9A 2Y24A 4W85A 1QUMA 1CLXA 1XCWA 4DJDD 4H9XA 2F38A 4P8VA 5CQ1A 5U7SA 6CGTA 3NZGA 5A1AA 2CITA 4UQDA 3VD9A 2YCLA 4RXFA 5D9PA 1YBQB 4GQRA 3BO9A 1KM4A 2H8ZA 4QCFA 4C7DA 3S0CA 1QI0A 3MCMA 3G1AA 1ZFJA 3G1RA 2ZX7A 1AMYA 4FNPA 2EG8A 2C13A 1QATA 2ZZ5A 2BTMA 5F2GA 1ZBCA 4H4UA 3RCMA 4NI3A 2YAUA 4LOCA 1EQPA 1N61C 2OWCA 3AZTA 1GHRA 3G1YA 3SAZA 3HURA 3U4AA 4CN4A 3PNZA 3CZKA 3GRSA 3W0KA 4GNVA 5AFDA 1E0XA 1RK6A 1VENA 1YX1A 2JF6A 2XM2A 1V3HA 4QAIA 2WMHA 4J4KA 4HP5A 3T07A 1EUNA 1JD7A 2E40A 3CV1A 4PFMA 4IIDA 2FJUB 2XU2A 1W1VA 4CNSA 4TUFA 1P4CA 4J40A 1JPIA 2VT0A 3THUA 1KKOA 4ERAA 1E5NA 3QVQA 2PDYA 4C6BA 1GSNA 3A23A 4X63A 3LTPA 2BHYA 4Z2KA 1Z3NA 2OFJA 4X9YA 1ONFA 5JQ9A 4H4PA 3DFHA 3VOHA 1XDIA 4K7ZA 4D6EA 2J77A 3P0WA 1TIMA 4E8CA 4X22A 4V15A 3N9RA 2J6VA 4RUBA 1U1JA 4F2TA 2WANA 1JCMP 1QDSA 3K46A 1NDVA 1PKLA 4JDRA 4QTGA 2YDRA 4J9JA 3OZPA 1GRBA 2YCEA 4XAFA 2G0WA 4P7NA 1HL2A 1KGUA 1RHCA 2PDGA 1ISXA 1E5JA 3AWNA 1EJVC 2J47A 4XD3A 5CC3A 5I3KA 4GYPC 2Z7GA 1X2HA 3NZQA 3W7RA 3W1NA 1H5VA 3BXWA 4ZOAA 3VDGA 2MNRA 2XFYA 3WEOA 1QPKA 3IK4A 3E38A 4HSHA 4D6DA 4US5D 1TV3A 2A3BA 4GACA 4JD4A 2FGBA 5DMMA 3MHUA 4MNJA 4DO5A 3ONBA 3CO4A 1OFOA 3NO5A 1KRMA 2BVDA 3ZWSA 1HKMA 1EB3A 3BOFA 5AN7A 4MWAD 4OV9A 4US6A 1OX5A 2HDJA 3KLJA 4GXPA 1ENUA 4DI9A 5DCDA 4GLEA 5I79A 1DNCA 1V0MA 1X38A 1EP3A 1EKOA 4R5EA 3NQ7A 3BLPX 2J62A 1B54A 1OF6A 3NQEA 5CJNA 2DSZA 1P48A 3HV9A 3SRFA 3PHAA 3LRKA 4Z2HA 2DUAA 1ZAIA 3ZR4A 1KFBA 2CLIA 3FXYA 2F6KA 3ONCA 3IEBA 1AODA 1OFAA 4L1WA 2D69A 4W8LA 3M44A 3WY1A 4KWVA 2VM8A 1X8CA 3WH8A 4S2BA 3PZUA 5GJMA 2VEGA 5ABGA 1AQMA 4YJ5A 1G67A 5MKGB 2QV4A 4J27A 1W17A 5FMHA 4B3LA 2RDTA 3HGJA 2QCCA 3K4WA 2XSXA 1EWEA 3E9AA 3A47A 4IIGA 4DJFA 5LA1A 3SQMA 4B5VA 3RILA 3FHQA 1P1MA 4PUUA 2WPBA 1HJVA 1IV8A 5I7GA 3B8WA 3E6EA 2YSWA 2CLOA 3PUGA 3UZYA 3I6EA 4YHEA 1EJUC 1M7OA 3TMQA 3WQGA 4CNUA 3P67A 5AZ1A 1DJIA 2NX3A 1H7XA 4MKNA 4DNHA 4NJKA 2GWGA 4JDYA 4JCLA 3HQ1A 3UT0A 5D2TA 4BEQA 1YXCA 3QR1A 1TJPA 3AMGA 3CTLA 4KWOA 1HJSA 1IF2A 2GUBA 3TDFA