3DGHA

Crystal structure of drosophila thioredoxin reductase, c-terminal 8-residue truncation
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
477
structure length
477
Chain Sequence
b'SYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDDKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKDKIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase 1, mitochondrial
publication title Crystal Structure of Drosophila Thioredoxin Reductase, C-terminal 8-residue truncation
rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
total genus 155
structure length 477
sequence length 477
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF00890 FAD_binding_2 FAD binding domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3dghA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dghA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dghA02
2QAEA 3BHKA 1ZOYA 2C75A 2QCUA 1TDFA 4DGKA 3PS9A 3DK9A 2BCPA 3GWDA 5GRTA 4JNQA 3E1TA 1JU2A 1H83A 3RHAA 3QFBA 1IUTA 2WS3A 4BK3A 2QA2A 4RG3A 4B66A 3FG2P 1B8SA 1PHHA 1GTHA 1PJ7A 2GVCA 2XDOA 1V59A 2VVLA 3ICRA 2I0ZA 2VVMA 5IPYA 4OVIA 2C76A 2XFPA 5DBJA 5BUKA 3SGLA 4CY6A 2JAEA 2JK6A 2PYXA 1NG3A 5BVAA 4B64A 3AD7B 3RNMA 4J36A 3KA7A 2GEWA 1BF3A 4Z25A 1LPFA 5EBKA 3SQPA 1NDAA 1GT8A 4B65A 2GV8A 3QSEA 5CKUA 3C96A 4JN9A 2GR3A 2B9WA 2Z5YA 2V6OA 1PN0A 4Z24A 4NTEA 1F3PA 4U8KA 4TLZA 3UKAA 1F8WA 4H4RA 1CC2A 4FK1C 1EL7A 1DNCA 5KOWA 1B37A 3CNDA 4NTDA 3ALMA 4H2PA 1EL9A 4YSXA 3BNMA 4GRTA 2XLUA 4ECHA 2BS2A 3BNUA 2X8CA 4RG4A 2ZZ0A 3UCLA 3S61A 2GAGB 4K5SA 3NG7X 2X8GA 4B67A 3AE4A 1E6EA 4K7ZA 4CBQA 2C64A 2X8HA 5EOWA 4U8LA 3LJPA 3BI4A 1CF3A 3GDPA 3UTGA 4H50A 1E7PA 2FJDA 1GESA 1NHPA 3ITJA 1F6MA 4NEVA 3ABVA 1H82A 1NPXA 1CBOA 3SM8A 4DSGA 1GERA 4EIQA 1TDNA 3ICSA 1OJCA 1DOEA 2XLSA 2WEUA 1FEAA 3AECA 1CJ2A 1DODA 2WOWA 1KNPA 3F8RA 1IUVA 2H89A 3AEGA 1CJCA 3NNEA 4DSHA 3UTEA 5BULA 1VG9A 3C4NA 3NGCX 3AEAA 4CNJA 3ICTA 2YR6A 3UOZA 1TYTA 2ZZBA 2A87A 1BZLA 1S3BA 3LOVA 3VR8A 1S3EA 4XWRA 2WP6A 3BI5A 1QJDA 3O0HA 4A6NA 1PXAA 2F5ZA 1EL8A 2BC1A 1CC6A 1YQ3A 3UP4A 3PO7A 1GRFA 4N9XA 2XFOA 1O95A 3I6DA 4Z2TA 4AT0A 1GXFA 2YVJA 1GPEA 1KDGA 2RABA 1TDOA 2GB0A 2V60A 3CNJA 2B9XA 3DK4A 4H4QA 4B63A 3DJJA 2VQ7A 4J2WA 2EQ8A 3H8LA 2WOVA 2RGHA 5JCIA 3UKQA 2GAHB 2CVJA 3H8IA 1DOCA 3VQRA 3LXDA 1VQWA 2GQFA 1NHRA 4H7UA 3NK1X 1XDIA 2YWLA 3NN6X 3CGDA 2J3NA 4A5LA 2YM2A 5CQFA 3V76A 2IVEA 3AEFA 3QSMA 1M64A 3NN0X 3CGBA 2FJEA 2BS4A 1Q1WA 1ZY8A 2E4GA 4MJWA 4H2QA 2RGOA 5KVHA 1K0JA 4FK1A 4LA1A 3BI2A 2WPFA 1H84A 2CULA 1EBDA 1JRYA 3BHFA 4AP1A 3FMWA 1ZOVA 1RSGA 4Y4NA 4UP3A 1O94A 3K7MX 1GRAA 2BXSA 1S2QA 1L9CA 2YVFA 5HYMA 1IUUA 1GRHA 3CGEA 3P1WA 4GDPA 3M12A 4H2NA 2WDVA 2BXRA 1MXTA 2XVJA 1NHSA 5JCNA 4O5UA 4D04A 4EQSA 2FJAA 2ZZCA 3DJDA 2BS3A 4H2RA 2BABA 4USRA 1PXCA 2GQWA 5KOXA 1N4WA 4OPTA 3P4RA 4BURA 1O5WA 2VVLG 2YLZA 4YSHA 5FS7A 2GRTA 4OPCA 4H4PA 4OPGA 1PBDA 4FDCB 1Y56B 1ONFA 1NEKA 3UKKA 1FECA 3JSKA 3CNPA 3GMBA 1B4VA 3WE0A 1QLBA 3ALLA 4ZCDA 5KVIA 2JKCA 1E1KA 1ZMDA 3GRTA 1TYPA 1ZKQA 1NENA 2XLPA 1CL0A 3LZWA 3KLJA 2ARDA 3M0OA 1OJAA 1OJDA 4H4YA 3CIRA 1PXBA 3AE7A 3KKJA 4AOXA 3NYEA 2WBAA 3AEDA 3T37A 5U63A 4YT0A 1JRXA 4H4ZA 4EM3A 1XANA 1D7LA 2YR4A 2C7GA 3LADA 3Q6JA 3KU9A 4EMIA 3CPIG 3NIXA 2R0PA 3Q9TA 3UKFA 2EQ9A 4OCGA 4C74A 4USQA 3EAOA 3ATQA 4U8OA 1DJQA 4CRTA 4K8DA 1LTXR 2C67A 1VG0A 4BK1A 4ZN0A 2W0HA 3DMEA 3GMCA 4AT2A 4A7AA 4OPLA 3VRDB 1GSNA 1IJHA 1LJ1A 1AOGA 3P4SA 1EL5A 2APGA 3KVEA 5FS8A 3QVRA 2R4EA 3NHOX 3URHA 4NZHA 1D4CA 4PABA 2C3CA 3RP7A 4GUVA 4DNAA 3AXBA 2VOUA 3RP8A 2VZ2A 3P4PA 4U8JA 3D8XA 4X9MA 2WESA 4AP3A 1D5TA 2DKIA 1BGNA 3ADAB 1H7XA 4APNA 1P2EA 5IQ4A 1FEBA 3L8KA 2UZZA 3QJ4A 2Q0KA 1GRBA 4UDRA 1BKWA 2YM1A 4Z44A 3G5RA 4K5RA 1TRBA 2BA9A 1E1MA 4B1BA 1COYA 3CGCA 2XFUA 1CJ4A 2AR8A 2FJBA 4Z43A 3AYJA 5JCMA 2YLWA 3EPTA 3B3RA 4H4XA 2R0GA 1W4XA 4Z2UA 2JB2A 1FCDA 2XYOA 2XCGA 4YTNA 3L1RA 3AD9B 1CC4A 2WQYA 2WP9A 3DJGX 2YG4A 2C72A 3NLCA 5HHFA 1GRTA 1PBCA 3AE1A 3UOXA 1H6VA 2JB3A 2X99A 4U2LA 3ZDNA 4XWZA 2R4JA 4B68A 2C66A 2YLXA 4XXGA 3AD8B 1JRZA 1DXLA 2GH5A 2ZBWA 5JCKA 2DKHA 3AE8A 2PHHA 4IA5A 3GRSA 4EIPA 2JB1A 1ZX9A 4CCQA 3IF9A 3AYLA 3NT6A 1N4UA 2V61A 1L0VA 2YLRA 4REKA 3OC4A 2YG7A 4J56A 1F8SA 1IUWA 1UKVG 3DGHA 2YG3A 2B7SA 3ISHA 4JQ9A 4JY2A 2YVGA 1KF6A 1JEHA 2GR2A 3IHMA 2WPEA 4YSZA 1FL2A 2V3AA 2Z5XA 4HA6A 4GCMA 1OJ9A 1GRGA 4X9NA 1Y0PA 2WU2A 2WU5A 1D7YA 1LV0A 5IQ1A 1Q1RA 4P9SA 1L9DA 2C70A 2VRMA 1Y56A 3K7QX 3K30A 3KPFA 4JDRA 3AYIA 4EM4A 5EB5A 4CCRA 5FMHA 2XLRA 2CDUA 3GWFA 3QFAA 3B6DA 3RP6A 1JOAA 4B69A 2BK5A 3UTFA 1VDCA 1XPQA 5TR3A 5FS6A 3AB1A 3OZ2A 1OJTA 3EF6A 4LU6A 2TMDA 2R46A 3FPZA 1H86A 3ATRA 2OAMA 2BYBA 2YLSA 4I59A 3CN8A 2A8XA 1K4QA 3UOVA 3DJEA 4Z2RA 1PDHA 4A65A 2Q0LA 1BGJA 3SFDA 2HQMA 4H4TA 4TM3A 1KNRA 3GDNA 4YKGA 4U8PA 1ZMCA 2B76A 1MO9A 4UDPA 2XFNA 3NYCA 5BRTA 2NVKX 4U2TA 3NRNA 4A99A 1NHQA 1N1PA 3CPHG 4K22A 3FIMB 3PVCA 1L9EA 4GDEA 5M10A 2YQUA 1IUXA 3UKLA 1E39A 2Y6QA 5KXJA 3IHGA 2CFYA 1GOSA 4EQRA 1YY5A 2WETA 5U25A 1H7WA 2B9YA 4YTMA 4WCTA 4J34A 2WPCA 5GSNA 5KRQA 4OPIA 3G5QA 3CTYA 3KD9A 4BV6A 4ICYA 3AE5A 1GV4A 3AE9A 3REDA 4JNAA 1RYIA 4BJZA 4U8NA 3G5SA 1PS9A 4RSLA 3NK2X 1K0IA 3GD3A 3NKSA 3I3LA 4OPDA 3GYJA 4H4UA 1SEZA 2H88A 4IV9A 1KSSA 3AE3A 4BJYA 3UKPA 3VRBA 3FBSA 5EB4A 2A89A 3COXA 2BK4A 1LQUA 2XVIA 1D4EA 1S2YA 2WDRA 2XVHA 4YXDA 1ELIA 1D4DA 1X31B 2B7RA 1XHCA 4GR1A 2WP5A 1REOA 2WDQA 4NEWA 4GF7A 5HXIA 4TLXA 3NTDA 4ADWA 2X50A 2OLNA 4U8MA 4J57A 3C4AA 4I58A 3IWAA 1VRQB 4EQXA 1HYUA 2OA1A 3S5WA 2TPRA 2AAQA 4WX1A 1BWCA 2VRLA 4Z26A 1K0LA 1YKJA 3D1CA 4EQWA 5JCLA 2RGJA 4TM0A 3P9UA 3UTHA 4C3YA 4C3XA 1B5QA 3AEEA 4YTPA 1DJNA 5U1OA 4KX6A 2QA1A 2V3BA 3GYIA 3QSSA 5J7XA 3VRAA 4C77A 3NTAA 3P4QA 2XLTA 3GD4A 2Q6UA 4IVMB 5C3JA 1NAAA 4X4JA 2E1MA 2WHDA 2IIDA 2C73A 2XVFA 2C3DA 4M52A 3HZLA 2XFQA 1PBEA 2GMJA 3II4A 2BC0A 3LZXA 2GR1A 4U8IA 2GR0A 3DH9A 2OALA 4J33A 1LVLA 3LB8A 1PBBA 2EQ7A 3F8PA 1FOHA 3QVPA 4H4WA 1IUSA 5ER0A 4EMWA 3F8DA 4PAAA 4IVOB 4A79A 1GNDA 2YG5A 1CHUA 1P2HA 3DGZA 4YKFA 1GEUA 2WOIA 4KPRA 2XVEA 5LV9A 2BCGG 4A9WA 1F8RA 4UDQA 4BK2A 3IC9A 1NG4A 3DK8A 3GSIA 3M13A 4K2XA 1LQTA 2GMHA 4YWOA 2OLOA 5M0ZA 4ZCCA 3ZYXA 3CNSA 1YQZA 2O9ZA 2YLTA 3AEBA 3AE6A 3DA1A 1TDEA 2GF3A 2Y6RA 2IVDA 4D03A 1ZK7A 1H81A 2R45A 3NYFA 1ZDLA 4HB9A 2VQBA 1PJ6A 4EMJA 3NK0X 5L46A 2Q7VA 3K7TA 4JY3A 5C2TA 1GREA 2YAUA 3UKHA 4H4VA 1GALA 1KSUA 1PJ5A 1QO8A 2E5VA 4CNKA 3H4KA 1RP0A 5KWFA 1CJ3A 2FBWA 4AOSA 4YSYA 2BACA 2BK3A 4E0VA 1GETA 2YR5A 3V3OA 3EANA 3CPJG 1Q9IA 4U2SA 1PBFA 4NTCA 4TM4A 2NPXA 3UP5A 2EQ6A 1JNZA 3NH3X 1E1NA 1ZP0A 3ALJA 3V3NA 3UOYA 3AWIA 1YQ4A 4Y4MA 1DOBA 3VR9A 4J31A 2YG6A 1M6IA 4TM1A 1GTEA 2ACZA 4IA6A 1N4VA 4H4SA 2C65A 4C5OA 4FX9A 3R9UA 4OPUA 1Z6LA 2R0CA 5HY5A 2V5ZA 3CNTA 2AQJA 4A6NB 1E1LA 5J60A 1KFYA 3SFEA 1JNRA 3AE2A 4O5QA 2X3NA 5FS9A 4CY8A 2JBVA 4LIIA 1MOKA 4Y4LA 1TDKA 2R9ZA
chains in the Genus database with same CATH superfamily
2GDQA 3BHKA 4IL2A 5GRTA 3NVWB 1JU2A 3R07C 1IUTA 3FG2P 3NK1X 2GVCA 2XDOA 5IPYA 2C76A 5BUKA 4CY6A 2JAEA 2NQLA 3RNMA 3R10A 4Z25A 1GT8A 5CKUA 3C96A 2PGEA 5KMRA 1F3PA 4TLZA 5KOWA 4MKSA 1EC7A 3ALMA 4DXKA 2ZZ0A 2OPJA 3S61A 1PDYA 3NO1A 4HCLA 3DDMA 4H50A 2FJDA 1F6MA 1NPXA 4G74A 4EIQA 1OJCA 3AECA 1DODA 1CJCA 3NXLA 3NGCX 3ICTA 3BOXA 2ZZBA 1BZLA 3VR8A 1S3EA 2PU0A 4XWRA 4E5TA 3AN1A 4GFIA 3QLDA 1PXAA 4A6NA 2BC1A 1CC6A 3DG3A 4N9XA 2XGZA 2GB0A 2B9XA 3DJJA 2VQ7A 1JDFA 2WOVA 2RGHA 2PTZA 3UKQA 4A5LA 3V76A 1N60C 4DYEA 3NZGA 3AEFA 3VCNA 2FJEA 1N62C 2BS4A 4MJWA 2P8CA 3HRDC 5KVHA 3BI2A 1EBDA 1ZOVA 3QKEA 3HW2A 2OVLA 2PA6A 3RCYA 2YVFA 1GRHA 4H2NA 4HNCA 4K2SA 4EWJA 1MXTA 5JCNA 4O5UA 4D04A 2ZZCA 1PXCA 2GQWA 3P4RA 4BURA 3SXIA 4H4PA 4MGGA 4GAVA 1PBDA 3OW1A 1ONFA 1FECA 1B4VA 3T6CA 2JKCA 4II3A 1ZKQA 1NENA 2XLPA 3M0OA 4H4YA 1PXBA 1MDRA 3KKJA 4AOXA 4YT0A 4H4ZA 1D7LA 2C7GA 3LADA 3NIXA 4EMIA 3CPIG 3Q9TA 3UKFA 2GSHA 3DESA 3JVAA 3EAOA 3TQPA 4K8DA 2C67A 3GMCA 1GSNA 2PP1A 1EL5A 3KVEA 4NZHA 3URHA 3VC5A 3RP7A 4GAPA 1D5TA 1H7XA 3I6TA 1P2EA 1FEBA 3L8KA 1SJBA 3G5RA 4K5RA 1TRBA 3CGCA 1CJ4A 4M0XA 2YLWA 3EPTA 3B3RA 2PP3A 2XH0A 3AD9B 3HYVA 2WQYA 1KKOA 3UXKA 1H6VA 2JB3A 3MUCA 2R4JA 4B68A 3VC6A 4GIRA 1JRZA 1MNSA 5JCKA 2PHHA 4ENLA 1L0VA 4TVWA 2YG3A 2YG7A 1UKVG 3ISHA 1E9IA 2V3AA 1STZA 5IQ1A 3PWGA 5FJPA 1L9DA 3KPFA 3TWBA 5EB5A 3ZLHA 4CCRA 3RP6A 1VDCA 3QTPA 4LU6A 2R46A 3FPZA 1H86A 2OAMA 2ZADA 5KMPA 5BOFA 2W3SA 1JRPA 4IZGA 2QQ6A 1BGJA 2E5AA 3AM9A 2NVKX 4U2TA 1NHQA 1N1PA 4X2PA 3NRZB 2YQUA 1E39A 2WETA 2WPCA 5GSNA 3AE9A 3REDA 4IT1A 2OKTA 3GD3A 3GYJA 4H19A 4IV9A 3VRBA 5EB4A 1JPMA 2BK4A 2XVIA 2OG9A 2B7RA 1XHCA 4GR1A 3V3WA 4GF7A 5HXIA 3SN4A 4TLXA 2X50A 2OLNA 3GC2A 4U8MA 3K1GA 4I58A 2GGGA 2OA1A 2TPRA 1FHUA 2AAQA 3CYJA 4M6UA 1YKJA 4C3XA 5U1OA 3GYIA 1NU5A 4C77A 3P4QA 3GD4A 2E1MA 2C3DA 4G8TA 3II4A 3T4WA 4J33A 1H2IA 3LB8A 1PBBA 1FOHA 4H4WA 4EMWA 4KEMA 2XH2A 2YG5A 4YKFA 1F8RA 4UDQA 1NG4A 3M13A 4K2XA 2OLOA 4ZCCA 2GGJA 2O9ZA 3AE6A 4HYRA 2OO6A 4D03A 1ZDLA 3Q4DA 3STPA 1GREA 2YAUA 1GALA 4CNKA 1PJ5A 2FBWA 4AOSA 3CXOA 3OP2A 4E0VA 3BJSA 4IP4A 3T8QA 3UP5A 1E1NA 3R25A 1DOBA 2YG6A 3VA8A 4FI4A 1GTEA 2ACZA 4IA6A 4FX9A 3CNTA 3BSMA 7ENLA 2AQJA 4A6NB 2AL2A 3SFEA 1FHVA 1JNRA 3AE2A 3UJEA 4CY8A 4LIIA 2QAEA 2C75A 2QCUA 2BCPA 4JNQA 1H83A 3RHAA 3FXGA 4ZCWA 2WS3A 4BK3A 1PJ7A 1GTHA 2VVLA 2I0ZA 2VVMA 3SGLA 3FYYA 2QJNA 4G6GA 5BVAA 3AD7B 4J36A 3KA7A 1BF3A 4E4FA 2V6OA 1PN0A 4U8KA 1X2GA 1DNCA 1JPDX 1B37A 4H2PA 1EL9A 2GL5A 2XLUA 3D9XA 2FKPA 4K5SA 3NG7X 4B67A 3LJPA 3BI4A 1GESA 1NHPA 1WYGA 3SJNA 3R1ZA 1GERA 2O56A 3ICSA 2XLSA 4H1ZA 2WEUA 1FEAA 3SBFA 1CJ2A 2H89A 3AEGA 3PK7A 1VG9A 2PSNA 5FJRA 3RRAA 2YR6A 1TYTA 3LOVA 2WP6A 1QJDA 3O0HA 4JHMA 1FIQB 1GRFA 2ONEA 2QVHA 2YVJA 2RABA 1TDOA 4H4QA 4J2WA 2EQ8A 3H8LA 3R0KA 2GAHB 3H8IA 2GQFA 2YWLA 1IYXA 2J3NA 3QSMA 4FK1A 1H84A 2CULA 2C4CA 4Y4NA 5KNLA 4UP3A 3K7MX 5HYMA 3P1WA 2WDVA 2BXRA 1NHSA 3SZFA 1N4WA 1O5WA 2YLZA 4YSHA 5FS7A 3V4BA 1EC9A 3ALLA 5KVIA 1ZMDA 1TYPA 3FVDA 3KLJA 1OJAA 3T0KA 3AEDA 1JRXA 3V5FA 3KU9A 3UJFA 1XANA 3Q6JA 3UCCA 4OCGA 4ZN0A 1VG0A 4E4UA 2W0HA 3DMEA 3VRDB 4FP1A 1LJ1A 3QVRA 1D4CA 2C3CA 3S5SA 4GUVA 2VOUA 3P4PA 4U8JA 5IQ4A 3QJ4A 2PS2A 4UDRA 3R0UA 2OZ3A 1COYA 2FJBA 2QDDA 5JRBA 1W4XA 2XYOA 3SY4A 2XCGA 3ZVHA 5HHFA 3AE1A 4II2A 4U2LA 3ZDNA 1RVKA 3OPSA 4XXGA 3TJ4A 3FV9A 3ZLFA 2ZBWA 3P0WA 3GRSA 2JB1A 3AYLA 2YLRA 4REKA 4J56A 1F8SA 1IUWA 3DGHA 2YVGA 2WPEA 1FL2A 4GCMA 1OJ9A 2WU2A 1LV0A 2AKMA 1Y56A 5FMHA 2CDUA 3GWFA 4B69A 2BK5A 3T2KA 5TR3A 5FS6A 3EF6A 4GYPA 5G5HB 3ATRA 3UOVA 1PDHA 3FJ4A 4A65A 3SFDA 4TM3A 2CHRA 4YKGA 2B76A 3NYCA 3PFRA 3DFHA 3PVCA 1L9EA 5M10A 1IUXA 5KXJA 1TZZA 1YY5A 5U25A 1H7WA 4J34A 4OPIA 3I6EA 1X2HA 4BJZA 4OPDA 4H4UA 3SN0A 1KSSA 4BJYA 1LQUA 1D4EA 1S2YA 1D4DA 1X31B 4K1WA 2AL2B 2WP5A 3DERA 2WDQA 2I5QA 4J57A 1VRQB 1HYUA 4Z26A 1BWCA 3OZYA 3D1CA 4KX6A 3TW9A 4IVMB 5C3JA 3IJIA 2WHDA 2C73A 3HPFA 2DW6A 4M52A 1KCZA 4U8IA 1MRAA 1PBEA 2BC0A 3LZXA 3DH9A 2OALA 3B9JB 1LVLA 1T3QC 5ER0A 1P48A 3ZLGA 4IVOB 5FJOA 3T9PA 1GEUA 4KPRA 2XVEA 2BCGG 3N4EA 3IC9A 3GSIA 3U9IA 2QJMA 3ZYXA 3A7RA 3DA1A 3CT2A 1TDEA 2IVDA 1ZK7A 2R45A 3NK0X 5L46A 4JY3A 3A7AA 2PPGA 2E5VA 5KWFA 1RP0A 3V3OA 3EANA 1Q9IA 4TM4A 1KD0A 2EQ6A 1JNZA 3V3NA 1YQ4A 3VR9A 1KN0A 3R9UA 1Z6LA 5HY5A 4KWSA 3A7UA 5FJTA 2JBVA 1EC8A 4Y4LA 2QA1A 1XS2A 1ZOYA 4DGKA 3PWIA 3T14A 3DK9A 3E1TA 3IJLA 3QFBA 5J04A 4B66A 1B8SA 1PHHA 1V59A 3ICRA 4OVIA 3RR1A 2XFPA 2GGIA 2JK6A 2PYXA 4B64A 3EUB3 1LPFA 5EBKA 2XSXA 3OTRA 2HZGA 1FO4A 4Z24A 4FK1C 4NTDA 4YSXA 3DGBA 3BNMA 1WUFA 3H70A 2BS2A 3L5OA 4Z17A 3UCLA 3MKCA 1P43A 4HNLA 5KMSA 1E6EA 3D46A 2C64A 2X8HA 4U8LA 1CF3A 3GDPA 1E7PA 2P3ZA 3ITJA 1R0MA 4NEVA 3THUA 4NNJA 1TDNA 1TKKA 1DOEA 2P0IA 3HYWA 1KNPA 3F8RA 4DSHA 4G7FA 5BULA 3C4NA 3JW7A 2QGYA 4DN1A 2A87A 1S3BA 3N6JA 3RITA 3BI5A 3P93A 3I4KA 1FFVC 3T31A 3UP4A 2P88A 3T2YA 3PO7A 1O95A 3I6DA 4AT0A 1GXFA 2AL1A 1KDGA 1GPEA 4IL0A 1F9CA 5JCIA 4NWZA 3CGDA 2IVEA 3SSZA 1M64A 3ZVHB 1XPYA 1Q1WA 1RM6B 4H2QA 2RGOA 1K0JA 2GGHA 4LA1A 2WPFA 3BHFA 3FMWA 1O94A 1GRAA 3NVVB 1S2QA 1L9CA 4IP5A 4GDPA 3TCSA 2QJJA 2ZC8A 2HNEA 2FJAA 2BABA 2PTWA 4OPTA 4DWDA 2GRTA 4OPCA 6ENLA 1FFUC 4FDCB 1Y56B 1NEKA 3UKKA 4Z1YA 3CNPA 3GMBA 4ZCDA 2R9ZA 1CL0A 2ARDA 5BOEA 3CIRA 3AE7A 3T37A 4JN7A 5U63A 2YR4A 4A3RA 2R0PA 4C74A 3DEQA 4USQA 4GYPC 3ATQA 4CRTA 1DJQA 1LTXR 4A7AA 1IJHA 2APGA 4P9SA 5FS8A 3SYIA 3NHOX 2OQHA 4DNAA 3AXBA 3RP8A 4E6MA 4X9MA 2WESA 1N5XA 1BGNA 4APNA 3IK4A 2UZZA 2Q0KA 1BKWA 1E1MA 4H4XA 2R0GA 1FCDA 4GGBA 3L1RA 1CC4A 3MZNA 2YG4A 2C72A 3V5CA 1PBCA 3UOXA 2X99A 2BRAA 2C66A 2YLXA 3AD8B 2DKHA 3AE8A 4IA5A 4EIPA 4CCQA 1ZX9A 3IF9A 3NT6A 4TVYA 3MWCA 3OC4A 2B7SA 1KF6A 1JEHA 2GR2A 3IHMA 1GRGA 1Y0PA 1TE6A 2VRMA 2C70A 3K7QX 3CXBA 3AYIA 1EBGA 1WUEA 1JOAA 3UTFA 1XPQA 3AB1A 1VDVA 1BQGA 4I59A 3CN8A 3UJSA 2A8XA 1K4QA 3DJEA 2PTYA 4Z2RA 4KPLA 1SB3B 2Q0LA 4H4TA 3GDNA 4U8PA 1ZMCA 1MO9A 4YWSA 3FIMB 3SZWA 3UKLA 2Y6QA 3IHGA 2CFYA 3MSYA 1GOSA 4GGHA 4EQRA 3GD6A 4WCTA 4J1OA 1MUCA 4ICYA 4BV6A 1RYIA 4U8NA 3G5SA 1SJDA 1K0IA 3I3LA 3UGVA 4A6GA 1SEZA 1ECQA 2H88A 3CK5A 2WDRA 2XVHA 3GO2A 2HXTA 1REOA 3TTEA 4ROPA 3UJRA 3NTDA 3C4AA 1JCTA 3QPEA 3IWAA 4EQXA 2VRLA 1K0LA 4TM0A 5JCLA 3ENLA 4YTPA 1PDZA 2V3BA 3QSSA 3N4FA 3NTAA 2XLTA 2Q6UA 1NAAA 4X4JA 3ES7A 2IIDA 4MMWA 2XFQA 2GMJA 3DG6A 2EQ7A 3F8PA 1ONEA 1CHUA 1P2HA 3DGZA 2WOIA 4A9WA 4BK2A 1L8PA 1LQTA 2PU1A 4G73A 5M0ZA 1OEPA 1YQZA 2YLTA 3AEBA 2Y6RA 3NYFA 1PJ6A 2Q7VA 3K7TA 3B97A 5C2TA 2XH4A 1KSUA 3H4KA 1N61C 4YSYA 2BACA 3ES8A 1GETA 2YR5A 3CMMA 1EBHA 4HCHA 3CPJG 4U2SA 4NTCA 1ZP0A 3ALJA 2OLAA 3AWIA 4Y4MA 4J31A 1M6IA 1R6WA 3RO6A 4H4SA 2C65A 4C5OA 4OPUA 4F4RA 2V5ZA 1KFYA 4DHGA 2X3NA 5FS9A 1TDFA 3PS9A 3GWDA 3H12A 2QA2A 4RG3A 4A35A 5DBJA 2PTXA 3H7VA 2XH7A 1NG3A 2OFJA 2GEWA 4B65A 3SQPA 1NDAA 2GV8A 3QSEA 4JN9A 2GR3A 3R11A 2B9WA 2Z5YA 3DIPA 3VCCA 3HYXA 4NTEA 3UJ2A 3UKAA 1F8WA 4H4RA 4HN8A 1CC2A 1YEYA 1EL7A 3CNDA 4GRTA 4ECHA 2QDEA 3BNUA 2X8CA 4RG4A 2GAGB 2X8GA 3AE4A 4K7ZA 4CBQA 5EOWA 5IDZA 4K8GA 3UTGA 3QN3A 1H82A 3ABVA 1CBOA 3SM8A 4DSGA 3EEZA 4E8GA 3CAWA 2WOWA 1IUVA 3NNEA 3AMZA 3SR6B 3UTEA 3AEAA 4CNJA 3UOZA 2F5ZA 4IHCA 1EL8A 1YQ3A 3ETRB 2XFOA 4Z2TA 3UCDA 2V60A 3CNJA 3DK4A 4B63A 3VQRA 1DOCA 3LXDA 1VQWA 1NHRA 4H7UA 1XDIA 3NN6X 3CB3A 2YM2A 5CQFA 3TWAA 3NN0X 3CGBA 1ZY8A 2E4GA 2FYMA 1JRYA 4AP1A 1RSGA 3T2ZA 2BXSA 2MNRA 1IUUA 1DTNA 3CGEA 3M12A 3PG6A 2XVJA 3VDGA 4EQSA 3DJDA 2BS3A 4H2RA 4USRA 2VVLG 4OPGA 2HXUA 1KKRA 3JSKA 3WE0A 1QLBA 1E1KA 5KMQA 3GRTA 3SQSA 3VFCA 4HCDA 3LZWA 1OJDA 3NYEA 2WBAA 2AKZA 4EM3A 3UXLA 2EQ9A 4U8OA 4BK1A 5KOXA 4AT2A 3KPKA 4OPLA 1AOGA 3P4SA 3UKPA 4PABA 2R4EA 3SZ0A 2VZ2A 3D8XA 4DX3A 4AP3A 2DKIA 3ADAB 3ZVIA 1GRBA 2YM1A 4Z44A 3RGTA 4B1BA 2BA9A 2XFUA 2MUCA 3P3BA 2AR8A 3AYJA 4Z43A 5JCMA 3TOYA 4Z2UA 2JB2A 4YTNA 2PMQA 2WP9A 2OZTA 3DJGX 3NS1B 3NLCA 1GRTA 4XWZA 1JROA 2W3RA 1DXLA 2GH5A 3N6HA 3SN1A 4KT2A 1N5WC 1N4UA 2V61A 1ZXIC 4JQ9A 4JY2A 3DFYA 4YSZA 2W54A 4HA6A 2Z5XA 2E3TA 4X9NA 3MQTA 3NFUA 2WU5A 1D7YA 1Q1RA 2P8BA 3K30A 4JDRA 2OX4A 2PP0A 4EM4A 1N63C 2PGWA 2XLRA 3QFAA 3B6DA 3TJIA 3OZ2A 1OJTA 4GISA 3Q45A 2TMDA 4JN8A 2BYBA 2YLSA 3JZUA 1BKHA 1ELSA 4ZOHB 2HQMA 2DW7A 1KNRA 2POZA 4UDPA 2XFNA 5BRTA 3NRNA 4A99A 3SX6A 3CPHG 4K22A 3OZMA 4GDEA 3SZCA 1VQZA 2B9YA 2BRYA 4YTMA 1MDLA 5KRQA 1SJCA 3GYXA 4G9KA 3G5QA 3CTYA 3KD9A 3S47A 3AE5A 3EKGA 1GV4A 4JNAA 1PS9A 4RSLA 3NK2X 3NKSA 1SJAA 2PCEA 3AE3A 3FBSA 2A89A 3COXA 4H2HA 1NELA 3IJQA 4YXDA 1ELIA 4NEWA 4ADWA 3NVZB 5FJUA 3S5WA 4WX1A 4G6HA 4C3YA 4EQWA 2RGJA 3P9UA 3UTHA 1B5QA 3AEEA 1DJNA 3VRAA 1S7MA 5J7XA 3MY9A 3FCPA 2XVFA 2GGEA 3HZLA 2GR1A 1V97A 2GR0A 2W55A 3QVPA 1IUSA 3F8DA 4PAAA 4A79A 1GNDA 4HPNA 4ZA0A 5LV9A 5G5GB 4H83A 3DK8A 2GMHA 1W6TA 4YWOA 3CNSA 2GF3A 1H81A 5EU9A 4HB9A 2VQBA 4EMJA 3UKHA 4H4VA 1QO8A 2OQYA 3GY1A 1CJ3A 2BK3A 3U4FA 3DG7A 1PBFA 5ENLA 2NPXA 3NH3X 3UOYA 2PODA 4TM1A 4J3ZA 1N4VA 2RDXA 2OZ8A 2R0CA 3D47A 5J60A 3NVYB 1E1LA 4O5QA 4GMEA 3H8AA 1MOKA 3KUMA 1TDKA 2CVJA
chains in the Genus database with same CATH topology
2QAEA 3BHKA 1ZOYA 2C75A 2QCUA 1TDFA 4DGKA 3T14A 3PS9A 3DK9A 2BCPA 3GWDA 5GRTA 4JNQA 3E1TA 1JU2A 1H83A 3RHAA 3QFBA 1IUTA 2WS3A 4BK3A 2QA2A 4RG3A 4B66A 3FG2P 1B8SA 1PHHA 1GTHA 1PJ7A 2GVCA 2XDOA 1V59A 2VVLA 3ICRA 2I0ZA 2VVMA 5IPYA 4OVIA 2C76A 2XFPA 5DBJA 5BUKA 3SGLA 4CY6A 2JAEA 2JK6A 2PYXA 4G6GA 1NG3A 5BVAA 4B64A 3AD7B 3RNMA 4J36A 3KA7A 2GEWA 1BF3A 4Z25A 1LPFA 5EBKA 3SQPA 1NDAA 1GT8A 4B65A 2GV8A 3QSEA 5CKUA 3C96A 4JN9A 2GR3A 2B9WA 5KMRA 2Z5YA 2V6OA 1PN0A 3HYXA 4NTEA 4Z24A 1F3PA 4U8KA 4TLZA 3UKAA 1F8WA 4H4RA 1CC2A 4FK1C 1EL7A 1DNCA 5KOWA 1B37A 3CNDA 4NTDA 3ALMA 4H2PA 1EL9A 4YSXA 3BNMA 4GRTA 2XLUA 4ECHA 2BS2A 3BNUA 3D9XA 2X8CA 4RG4A 3L5OA 2ZZ0A 3UCLA 3S61A 2GAGB 4K5SA 3NG7X 2X8GA 4B67A 3AE4A 5KMSA 1E6EA 4K7ZA 4CBQA 2C64A 2X8HA 5EOWA 4U8LA 3LJPA 3BI4A 1CF3A 3GDPA 3UTGA 4H50A 1E7PA 2FJDA 1GESA 1NHPA 3ITJA 1F6MA 4NEVA 3ABVA 1H82A 1NPXA 4NNJA 1CBOA 3SM8A 4DSGA 1GERA 4G74A 4EIQA 1TDNA 3ICSA 1OJCA 1DOEA 2XLSA 2WEUA 1FEAA 3AECA 1CJ2A 3HYWA 1DODA 2WOWA 1KNPA 3F8RA 1IUVA 2H89A 3AEGA 1CJCA 3NNEA 4DSHA 3UTEA 5BULA 1VG9A 3C4NA 3NGCX 3AEAA 4CNJA 3ICTA 2YR6A 3UOZA 1TYTA 2ZZBA 2A87A 1BZLA 1S3BA 3LOVA 3VR8A 1S3EA 4XWRA 2WP6A 3BI5A 1QJDA 3O0HA 3T31A 4A6NA 1PXAA 2F5ZA 1EL8A 2BC1A 1CC6A 1YQ3A 3UP4A 3T2YA 3PO7A 1GRFA 4N9XA 2XFOA 1O95A 3I6DA 4Z2TA 4AT0A 1GXFA 2YVJA 1GPEA 1KDGA 2RABA 1TDOA 2GB0A 2V60A 3CNJA 2B9XA 3DK4A 4H4QA 4B63A 3DJJA 2VQ7A 4J2WA 2EQ8A 3H8LA 2WOVA 2RGHA 5JCIA 3UKQA 2GAHB 2CVJA 3H8IA 1DOCA 3VQRA 3LXDA 1VQWA 2GQFA 1NHRA 4H7UA 3NK1X 1XDIA 2YWLA 3NN6X 4NWZA 3CGDA 2J3NA 4A5LA 2YM2A 5CQFA 3V76A 2IVEA 3AEFA 3QSMA 1M64A 3NN0X 3CGBA 2FJEA 2BS4A 1Q1WA 1ZY8A 2E4GA 4MJWA 4H2QA 2RGOA 5KVHA 1K0JA 4FK1A 4LA1A 3BI2A 2WPFA 1H84A 2CULA 1EBDA 1JRYA 2C4CA 3BHFA 3FMWA 1ZOVA 4AP1A 1RSGA 4Y4NA 5KNLA 4UP3A 1O94A 3T2ZA 3K7MX 1GRAA 2BXSA 1S2QA 1L9CA 2YVFA 5HYMA 1IUUA 1GRHA 3CGEA 3P1WA 4GDPA 3M12A 4H2NA 2WDVA 3PG6A 2BXRA 1MXTA 2XVJA 1NHSA 3SZFA 5JCNA 4O5UA 4D04A 4EQSA 2FJAA 2ZZCA 3DJDA 2BS3A 4H2RA 2BABA 4USRA 1PXCA 2GQWA 5KOXA 1N4WA 4OPTA 3P4RA 4BURA 1O5WA 2VVLG 2YLZA 3SXIA 5FS7A 4YSHA 2GRTA 4OPCA 4H4PA 4GAVA 4OPGA 1PBDA 4FDCB 1Y56B 1ONFA 1NEKA 3UKKA 1FECA 3JSKA 3CNPA 3GMBA 1B4VA 3WE0A 1QLBA 3ALLA 4ZCDA 5KVIA 2JKCA 4II3A 1E1KA 5KMQA 1ZMDA 3GRTA 1TYPA 1ZKQA 1NENA 2XLPA 1CL0A 3LZWA 3KLJA 2ARDA 3M0OA 1OJAA 1OJDA 3T0KA 4H4YA 3CIRA 1PXBA 3AE7A 3KKJA 4AOXA 3NYEA 2WBAA 3AEDA 3T37A 5U63A 4YT0A 1JRXA 4H4ZA 4EM3A 1XANA 1D7LA 2YR4A 2C7GA 3LADA 3Q6JA 3KU9A 4EMIA 3CPIG 3NIXA 2R0PA 3Q9TA 3UKFA 2EQ9A 4OCGA 4C74A 4USQA 3EAOA 3ATQA 4U8OA 1DJQA 4CRTA 4K8DA 1LTXR 2C67A 1VG0A 4BK1A 4ZN0A 2W0HA 3DMEA 3GMCA 4AT2A 3KPKA 4OPLA 3VRDB 4A7AA 1GSNA 1IJHA 1LJ1A 1AOGA 3P4SA 1EL5A 2APGA 3KVEA 5FS8A 3QVRA 2R4EA 3NHOX 3URHA 4NZHA 1D4CA 4PABA 2C3CA 3RP7A 4GAPA 3SZ0A 4GUVA 4DNAA 3AXBA 2VOUA 3RP8A 2VZ2A 3P4PA 4U8JA 3D8XA 4X9MA 2WESA 4AP3A 1D5TA 2DKIA 1BGNA 3ADAB 1H7XA 4APNA 1P2EA 5IQ4A 1FEBA 3L8KA 2UZZA 3QJ4A 2Q0KA 1GRBA 4UDRA 1BKWA 2YM1A 4Z44A 3G5RA 4K5RA 1TRBA 2BA9A 1E1MA 4B1BA 1COYA 3CGCA 2XFUA 1CJ4A 2AR8A 2FJBA 4Z43A 3AYJA 5JCMA 2YLWA 5JRBA 3EPTA 3B3RA 4H4XA 2R0GA 1W4XA 4Z2UA 2JB2A 1FCDA 2XYOA 3SY4A 2XCGA 4YTNA 3L1RA 3AD9B 1CC4A 3HYVA 2WQYA 2WP9A 3DJGX 2YG4A 2C72A 3NLCA 5HHFA 1GRTA 1PBCA 3AE1A 3UOXA 1H6VA 2JB3A 2X99A 4II2A 2BRAA 4U2LA 3ZDNA 4XWZA 2R4JA 4B68A 2C66A 2YLXA 4XXGA 3AD8B 1JRZA 1DXLA 2GH5A 2ZBWA 5JCKA 2DKHA 3AE8A 2PHHA 4IA5A 3GRSA 4EIPA 2JB1A 1ZX9A 4CCQA 3IF9A 3AYLA 3NT6A 1N4UA 2V61A 1L0VA 2YLRA 4REKA 3OC4A 2YG7A 4J56A 1F8SA 1IUWA 1UKVG 3DGHA 2YG3A 2B7SA 3ISHA 4JQ9A 4JY2A 2YVGA 1KF6A 1JEHA 2GR2A 3IHMA 2WPEA 4YSZA 1FL2A 2V3AA 2Z5XA 4HA6A 4GCMA 1OJ9A 1GRGA 4X9NA 1Y0PA 2WU2A 2WU5A 1D7YA 1LV0A 5IQ1A 1Q1RA 4P9SA 1L9DA 2C70A 2VRMA 1Y56A 3K7QX 3K30A 3KPFA 4JDRA 3AYIA 4EM4A 5EB5A 4CCRA 5FMHA 2XLRA 2CDUA 3GWFA 3QFAA 3B6DA 3RP6A 1JOAA 4B69A 2BK5A 3UTFA 1VDCA 1XPQA 3T2KA 5TR3A 5FS6A 3AB1A 3OZ2A 1OJTA 3EF6A 4LU6A 2TMDA 2R46A 3FPZA 1H86A 3ATRA 2OAMA 2BYBA 2YLSA 4I59A 5KMPA 3CN8A 2A8XA 1K4QA 3UOVA 3DJEA 4Z2RA 1PDHA 4A65A 2Q0LA 1BGJA 3SFDA 2HQMA 4H4TA 4TM3A 1KNRA 3GDNA 4YKGA 4U8PA 1ZMCA 2B76A 1MO9A 4UDPA 2XFNA 3NYCA 5BRTA 2NVKX 4U2TA 3NRNA 4A99A 1NHQA 1N1PA 3SX6A 3CPHG 4K22A 3FIMB 3PVCA 1L9EA 4GDEA 5M10A 3SZWA 2YQUA 1IUXA 3UKLA 1E39A 2Y6QA 5KXJA 3IHGA 2CFYA 1GOSA 3SZCA 4EQRA 1YY5A 2WETA 5U25A 1H7WA 2B9YA 2BRYA 4YTMA 4WCTA 4J34A 2WPCA 5GSNA 5KRQA 4OPIA 3GYXA 4G9KA 3G5QA 3CTYA 3KD9A 4BV6A 4ICYA 3AE5A 1GV4A 3AE9A 3REDA 4JNAA 1RYIA 4BJZA 4U8NA 3G5SA 1PS9A 4RSLA 3NK2X 1K0IA 3GD3A 3NKSA 3I3LA 4OPDA 3GYJA 4H4UA 1SEZA 2H88A 4IV9A 1KSSA 3AE3A 4BJYA 3UKPA 3VRBA 3FBSA 5EB4A 2A89A 3COXA 2BK4A 1LQUA 2XVIA 1D4EA 1S2YA 2WDRA 2XVHA 4YXDA 1ELIA 1D4DA 1X31B 2B7RA 1XHCA 4GR1A 2WP5A 1REOA 2WDQA 4NEWA 4GF7A 5HXIA 4TLXA 3NTDA 4ADWA 2X50A 2OLNA 4U8MA 4J57A 3C4AA 4I58A 3IWAA 1VRQB 4EQXA 1HYUA 2OA1A 3S5WA 2TPRA 2AAQA 4WX1A 1BWCA 2VRLA 4Z26A 1K0LA 1YKJA 3D1CA 4EQWA 5JCLA 2RGJA 4G6HA 3P9UA 4TM0A 3UTHA 4C3YA 1B5QA 4C3XA 3AEEA 4YTPA 1DJNA 5U1OA 4KX6A 2V3BA 2QA1A 1S7MA 3GYIA 3QSSA 5J7XA 3VRAA 3NTAA 3P4QA 4C77A 2XLTA 3GD4A 2Q6UA 4IVMB 5C3JA 1NAAA 4X4JA 2E1MA 2WHDA 2IIDA 2C73A 2XVFA 2C3DA 4M52A 3HZLA 2XFQA 1PBEA 2GMJA 3II4A 2BC0A 3LZXA 2GR1A 4U8IA 2GR0A 3DH9A 2OALA 4J33A 1H2IA 3SYIA 1LVLA 3LB8A 1PBBA 2EQ7A 3F8PA 1FOHA 3QVPA 4H4WA 1IUSA 5ER0A 4EMWA 3F8DA 4PAAA 4IVOB 4A79A 1GNDA 2YG5A 1CHUA 1P2HA 3DGZA 4YKFA 1GEUA 2WOIA 4KPRA 2XVEA 5LV9A 2BCGG 4A9WA 1F8RA 4UDQA 4BK2A 3IC9A 1NG4A 3DK8A 3GSIA 3M13A 4K2XA 1LQTA 4G73A 2GMHA 4YWOA 2OLOA 5M0ZA 4ZCCA 3ZYXA 3CNSA 1YQZA 2O9ZA 2YLTA 3AEBA 3AE6A 3DA1A 1TDEA 2GF3A 2Y6RA 2IVDA 4D03A 1ZK7A 1H81A 2R45A 3NYFA 1ZDLA 4HB9A 2VQBA 1PJ6A 4EMJA 3NK0X 5L46A 2Q7VA 3K7TA 4JY3A 5C2TA 1GREA 2YAUA 3UKHA 4H4VA 1GALA 1KSUA 1PJ5A 1QO8A 2E5VA 4CNKA 3H4KA 1RP0A 5KWFA 1CJ3A 2FBWA 4AOSA 4YSYA 2BACA 2BK3A 4E0VA 1GETA 2YR5A 3CMMA 3V3OA 3EANA 3CPJG 1Q9IA 4U2SA 1PBFA 4NTCA 4TM4A 2NPXA 3UP5A 2EQ6A 1JNZA 3NH3X 1E1NA 1ZP0A 3ALJA 3V3NA 3UOYA 3AWIA 1YQ4A 4Y4MA 1DOBA 3VR9A 4J31A 2YG6A 1M6IA 4TM1A 1GTEA 2ACZA 4IA6A 1N4VA 4H4SA 1KN0A 2C65A 4FX9A 3R9UA 4C5OA 4OPUA 1Z6LA 2R0CA 5HY5A 2V5ZA 3CNTA 2AQJA 4A6NB 1E1LA 5J60A 1KFYA 3SFEA 1JNRA 3AE2A 4O5QA 2X3NA 5FS9A 4CY8A 2JBVA 4LIIA 1MOKA 4Y4LA 1TDKA 2R9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAE A;  3BHK A;  1ZOY A;  2C75 A;  2QCU A;  1TDF A;  4DGK A;  3PS9 A;  3DK9 A;  2BCP A;  3GWD A;  5GRT A;  4JNQ A;  3E1T A;  1JU2 A;  1H83 A;  3RHA A;  3QFB A;  1IUT A;  2WS3 A;  4BK3 A;  2QA2 A;  4RG3 A;  4B66 A;  3FG2 P;  1B8S A;  1PHH A;  1GTH A;  1PJ7 A;  2GVC A;  2XDO A;  1V59 A;  2VVL A;  3ICR A;  2I0Z A;  2VVM A;  5IPY A;  4OVI A;  2C76 A;  2XFP A;  5DBJ A;  5BUK A;  3SGL A;  4CY6 A;  2JAE A;  2JK6 A;  2PYX A;  1NG3 A;  5BVA A;  4B64 A;  3AD7 B;  3RNM A;  4J36 A;  3KA7 A;  2GEW A;  1BF3 A;  4Z25 A;  1LPF A;  5EBK A;  3SQP A;  1NDA A;  1GT8 A;  4B65 A;  2GV8 A;  3QSE A;  5CKU A;  3C96 A;  4JN9 A;  2GR3 A;  2B9W A;  2Z5Y A;  2V6O A;  1PN0 A;  4Z24 A;  4NTE A;  1F3P A;  4U8K A;  4TLZ A;  3UKA A;  1F8W A;  4H4R A;  1CC2 A;  4FK1 C;  1EL7 A;  1DNC A;  5KOW A;  1B37 A;  3CND A;  4NTD A;  3ALM A;  4H2P A;  1EL9 A;  4YSX A;  3BNM A;  4GRT A;  2XLU A;  4ECH A;  2BS2 A;  3BNU A;  2X8C A;  4RG4 A;  2ZZ0 A;  3UCL A;  3S61 A;  2GAG B;  4K5S A;  3NG7 X;  2X8G A;  4B67 A;  3AE4 A;  1E6E A;  4K7Z A;  4CBQ A;  2C64 A;  2X8H A;  5EOW A;  4U8L A;  3LJP A;  3BI4 A;  1CF3 A;  3GDP A;  3UTG A;  4H50 A;  1E7P A;  2FJD A;  1GES A;  1NHP A;  3ITJ A;  1F6M A;  4NEV A;  3ABV A;  1H82 A;  1NPX A;  1CBO A;  3SM8 A;  4DSG A;  1GER A;  4EIQ A;  1TDN A;  3ICS A;  1OJC A;  1DOE A;  2XLS A;  2WEU A;  1FEA A;  3AEC A;  1CJ2 A;  1DOD A;  2WOW A;  1KNP A;  3F8R A;  1IUV A;  2H89 A;  3AEG A;  1CJC A;  3NNE A;  4DSH A;  3UTE A;  5BUL A;  1VG9 A;  3C4N A;  3NGC X;  3AEA A;  4CNJ A;  3ICT A;  2YR6 A;  3UOZ A;  1TYT A;  2ZZB A;  2A87 A;  1BZL A;  1S3B A;  3LOV A;  3VR8 A;  1S3E A;  4XWR A;  2WP6 A;  3BI5 A;  1QJD A;  3O0H A;  4A6N A;  1PXA A;  2F5Z A;  1EL8 A;  2BC1 A;  1CC6 A;  1YQ3 A;  3UP4 A;  3PO7 A;  1GRF A;  4N9X A;  2XFO A;  1O95 A;  3I6D A;  4Z2T A;  4AT0 A;  1GXF A;  2YVJ A;  1GPE A;  1KDG A;  2RAB A;  1TDO A;  2GB0 A;  2V60 A;  3CNJ A;  2B9X A;  3DK4 A;  4H4Q A;  4B63 A;  3DJJ A;  2VQ7 A;  4J2W A;  2EQ8 A;  3H8L A;  2WOV A;  2RGH A;  5JCI A;  3UKQ A;  2GAH B;  2CVJ A;  3H8I A;  1DOC A;  3VQR A;  3LXD A;  1VQW A;  2GQF A;  1NHR A;  4H7U A;  3NK1 X;  1XDI A;  2YWL A;  3NN6 X;  3CGD A;  2J3N A;  4A5L A;  2YM2 A;  5CQF A;  3V76 A;  2IVE A;  3AEF A;  3QSM A;  1M64 A;  3NN0 X;  3CGB A;  2FJE A;  2BS4 A;  1Q1W A;  1ZY8 A;  2E4G A;  4MJW A;  4H2Q A;  2RGO A;  5KVH A;  1K0J A;  4FK1 A;  4LA1 A;  3BI2 A;  2WPF A;  1H84 A;  2CUL A;  1EBD A;  1JRY A;  3BHF A;  4AP1 A;  3FMW A;  1ZOV A;  1RSG A;  4Y4N A;  4UP3 A;  1O94 A;  3K7M X;  1GRA A;  2BXS A;  1S2Q A;  1L9C A;  2YVF A;  5HYM A;  1IUU A;  1GRH A;  3CGE A;  3P1W A;  4GDP A;  3M12 A;  4H2N A;  2WDV A;  2BXR A;  1MXT A;  2XVJ A;  1NHS A;  5JCN A;  4O5U A;  4D04 A;  4EQS A;  2FJA A;  2ZZC A;  3DJD A;  2BS3 A;  4H2R A;  2BAB A;  4USR A;  1PXC A;  2GQW A;  5KOX A;  1N4W A;  4OPT A;  3P4R A;  4BUR A;  1O5W A;  2VVL G;  2YLZ A;  4YSH A;  5FS7 A;  2GRT A;  4OPC A;  4H4P A;  4OPG A;  1PBD A;  4FDC B;  1Y56 B;  1ONF A;  1NEK A;  3UKK A;  1FEC A;  3JSK A;  3CNP A;  3GMB A;  1B4V A;  3WE0 A;  1QLB A;  3ALL A;  4ZCD A;  5KVI A;  2JKC A;  1E1K A;  1ZMD A;  3GRT A;  1TYP A;  1ZKQ A;  1NEN A;  2XLP A;  1CL0 A;  3LZW A;  3KLJ A;  2ARD A;  3M0O A;  1OJA A;  1OJD A;  4H4Y A;  3CIR A;  1PXB A;  3AE7 A;  3KKJ A;  4AOX A;  3NYE A;  2WBA A;  3AED A;  3T37 A;  5U63 A;  4YT0 A;  1JRX A;  4H4Z A;  4EM3 A;  1XAN A;  1D7L A;  2YR4 A;  2C7G A;  3LAD A;  3Q6J A;  3KU9 A;  4EMI A;  3CPI G;  3NIX A;  2R0P A;  3Q9T A;  3UKF A;  2EQ9 A;  4OCG A;  4C74 A;  4USQ A;  3EAO A;  3ATQ A;  4U8O A;  1DJQ A;  4CRT A;  4K8D A;  1LTX R;  2C67 A;  1VG0 A;  4BK1 A;  4ZN0 A;  2W0H A;  3DME A;  3GMC A;  4AT2 A;  4A7A A;  4OPL A;  3VRD B;  1GSN A;  1IJH A;  1LJ1 A;  1AOG A;  3P4S A;  1EL5 A;  2APG A;  3KVE A;  5FS8 A;  3QVR A;  2R4E A;  3NHO X;  3URH A;  4NZH A;  1D4C A;  4PAB A;  2C3C A;  3RP7 A;  4GUV A;  4DNA A;  3AXB A;  2VOU A;  3RP8 A;  2VZ2 A;  3P4P A;  4U8J A;  3D8X A;  4X9M A;  2WES A;  4AP3 A;  1D5T A;  2DKI A;  1BGN A;  3ADA B;  1H7X A;  4APN A;  1P2E A;  5IQ4 A;  1FEB A;  3L8K A;  2UZZ A;  3QJ4 A;  2Q0K A;  1GRB A;  4UDR A;  1BKW A;  2YM1 A;  4Z44 A;  3G5R A;  4K5R A;  1TRB A;  2BA9 A;  1E1M A;  4B1B A;  1COY A;  3CGC A;  2XFU A;  1CJ4 A;  2AR8 A;  2FJB A;  4Z43 A;  3AYJ A;  5JCM A;  2YLW A;  3EPT A;  3B3R A;  4H4X A;  2R0G A;  1W4X A;  4Z2U A;  2JB2 A;  1FCD A;  2XYO A;  2XCG A;  4YTN A;  3L1R A;  3AD9 B;  1CC4 A;  2WQY A;  2WP9 A;  3DJG X;  2YG4 A;  2C72 A;  3NLC A;  5HHF A;  1GRT A;  1PBC A;  3AE1 A;  3UOX A;  1H6V A;  2JB3 A;  2X99 A;  4U2L A;  3ZDN A;  4XWZ A;  2R4J A;  4B68 A;  2C66 A;  2YLX A;  4XXG A;  3AD8 B;  1JRZ A;  1DXL A;  2GH5 A;  2ZBW A;  5JCK A;  2DKH A;  3AE8 A;  2PHH A;  4IA5 A;  3GRS A;  4EIP A;  2JB1 A;  1ZX9 A;  4CCQ A;  3IF9 A;  3AYL A;  3NT6 A;  1N4U A;  2V61 A;  1L0V A;  2YLR A;  4REK A;  3OC4 A;  2YG7 A;  4J56 A;  1F8S A;  1IUW A;  1UKV G;  3DGH A;  2YG3 A;  2B7S A;  3ISH A;  4JQ9 A;  4JY2 A;  2YVG A;  1KF6 A;  1JEH A;  2GR2 A;  3IHM A;  2WPE A;  4YSZ A;  1FL2 A;  2V3A A;  2Z5X A;  4HA6 A;  4GCM A;  1OJ9 A;  1GRG A;  4X9N A;  1Y0P A;  2WU2 A;  2WU5 A;  1D7Y A;  1LV0 A;  5IQ1 A;  1Q1R A;  4P9S A;  1L9D A;  2C70 A;  2VRM A;  1Y56 A;  3K7Q X;  3K30 A;  3KPF A;  4JDR A;  3AYI A;  4EM4 A;  5EB5 A;  4CCR A;  5FMH A;  2XLR A;  2CDU A;  3GWF A;  3QFA A;  3B6D A;  3RP6 A;  1JOA A;  4B69 A;  2BK5 A;  3UTF A;  1VDC A;  1XPQ A;  5TR3 A;  5FS6 A;  3AB1 A;  3OZ2 A;  1OJT A;  3EF6 A;  4LU6 A;  2TMD A;  2R46 A;  3FPZ A;  1H86 A;  3ATR A;  2OAM A;  2BYB A;  2YLS A;  4I59 A;  3CN8 A;  2A8X A;  1K4Q A;  3UOV A;  3DJE A;  4Z2R A;  1PDH A;  4A65 A;  2Q0L A;  1BGJ A;  3SFD A;  2HQM A;  4H4T A;  4TM3 A;  1KNR A;  3GDN A;  4YKG A;  4U8P A;  1ZMC A;  2B76 A;  1MO9 A;  4UDP A;  2XFN A;  3NYC A;  5BRT A;  2NVK X;  4U2T A;  3NRN A;  4A99 A;  1NHQ A;  1N1P A;  3CPH G;  4K22 A;  3FIM B;  3PVC A;  1L9E A;  4GDE A;  5M10 A;  2YQU A;  1IUX A;  3UKL A;  1E39 A;  2Y6Q A;  5KXJ A;  3IHG A;  2CFY A;  1GOS A;  4EQR A;  1YY5 A;  2WET A;  5U25 A;  1H7W A;  2B9Y A;  4YTM A;  4WCT A;  4J34 A;  2WPC A;  5GSN A;  5KRQ A;  4OPI A;  3G5Q A;  3CTY A;  3KD9 A;  4BV6 A;  4ICY A;  3AE5 A;  1GV4 A;  3AE9 A;  3RED A;  4JNA A;  1RYI A;  4BJZ A;  4U8N A;  3G5S A;  1PS9 A;  4RSL A;  3NK2 X;  1K0I A;  3GD3 A;  3NKS A;  3I3L A;  4OPD A;  3GYJ A;  4H4U A;  1SEZ A;  2H88 A;  4IV9 A;  1KSS A;  3AE3 A;  4BJY A;  3UKP A;  3VRB A;  3FBS A;  5EB4 A;  2A89 A;  3COX A;  2BK4 A;  1LQU A;  2XVI A;  1D4E A;  1S2Y A;  2WDR A;  2XVH A;  4YXD A;  1ELI A;  1D4D A;  1X31 B;  2B7R A;  1XHC A;  4GR1 A;  2WP5 A;  1REO A;  2WDQ A;  4NEW A;  4GF7 A;  5HXI A;  4TLX A;  3NTD A;  4ADW A;  2X50 A;  2OLN A;  4U8M A;  4J57 A;  3C4A A;  4I58 A;  3IWA A;  1VRQ B;  4EQX A;  1HYU A;  2OA1 A;  3S5W A;  2TPR A;  2AAQ A;  4WX1 A;  1BWC A;  2VRL A;  4Z26 A;  1K0L A;  1YKJ A;  3D1C A;  4EQW A;  5JCL A;  2RGJ A;  4TM0 A;  3P9U A;  3UTH A;  4C3Y A;  4C3X A;  1B5Q A;  3AEE A;  4YTP A;  1DJN A;  5U1O A;  4KX6 A;  2QA1 A;  2V3B A;  3GYI A;  3QSS A;  5J7X A;  3VRA A;  4C77 A;  3NTA A;  3P4Q A;  2XLT A;  3GD4 A;  2Q6U A;  4IVM B;  5C3J A;  1NAA A;  4X4J A;  2E1M A;  2WHD A;  2IID A;  2C73 A;  2XVF A;  2C3D A;  4M52 A;  3HZL A;  2XFQ A;  1PBE A;  2GMJ A;  3II4 A;  2BC0 A;  3LZX A;  2GR1 A;  4U8I A;  2GR0 A;  3DH9 A;  2OAL A;  4J33 A;  1LVL A;  3LB8 A;  1PBB A;  2EQ7 A;  3F8P A;  1FOH A;  3QVP A;  4H4W A;  1IUS A;  5ER0 A;  4EMW A;  3F8D A;  4PAA A;  4IVO B;  4A79 A;  1GND A;  2YG5 A;  1CHU A;  1P2H A;  3DGZ A;  4YKF A;  1GEU A;  2WOI A;  4KPR A;  2XVE A;  5LV9 A;  2BCG G;  4A9W A;  1F8R A;  4UDQ A;  4BK2 A;  3IC9 A;  1NG4 A;  3DK8 A;  3GSI A;  3M13 A;  4K2X A;  1LQT A;  2GMH A;  4YWO A;  2OLO A;  5M0Z A;  4ZCC A;  3ZYX A;  3CNS A;  1YQZ A;  2O9Z A;  2YLT A;  3AEB A;  3AE6 A;  3DA1 A;  1TDE A;  2GF3 A;  2Y6R A;  2IVD A;  4D03 A;  1ZK7 A;  1H81 A;  2R45 A;  3NYF A;  1ZDL A;  4HB9 A;  2VQB A;  1PJ6 A;  4EMJ A;  3NK0 X;  5L46 A;  2Q7V A;  3K7T A;  4JY3 A;  5C2T A;  1GRE A;  2YAU A;  3UKH A;  4H4V A;  1GAL A;  1KSU A;  1PJ5 A;  1QO8 A;  2E5V A;  4CNK A;  3H4K A;  1RP0 A;  5KWF A;  1CJ3 A;  2FBW A;  4AOS A;  4YSY A;  2BAC A;  2BK3 A;  4E0V A;  1GET A;  2YR5 A;  3V3O A;  3EAN A;  3CPJ G;  1Q9I A;  4U2S A;  1PBF A;  4NTC A;  4TM4 A;  2NPX A;  3UP5 A;  2EQ6 A;  1JNZ A;  3NH3 X;  1E1N A;  1ZP0 A;  3ALJ A;  3V3N A;  3UOY A;  3AWI A;  1YQ4 A;  4Y4M A;  1DOB A;  3VR9 A;  4J31 A;  2YG6 A;  1M6I A;  4TM1 A;  1GTE A;  2ACZ A;  4IA6 A;  1N4V A;  4H4S A;  2C65 A;  4C5O A;  4FX9 A;  3R9U A;  4OPU A;  1Z6L A;  2R0C A;  5HY5 A;  2V5Z A;  3CNT A;  2AQJ A;  4A6N B;  1E1L A;  5J60 A;  1KFY A;  3SFE A;  1JNR A;  3AE2 A;  4O5Q A;  2X3N A;  5FS9 A;  4CY8 A;  2JBV A;  4LII A;  1MOK A;  4Y4L A;  1TDK A;  2R9Z A; 
#chains in the Genus database with same CATH topology
 2GDQ A;  3BHK A;  4IL2 A;  5GRT A;  3NVW B;  1JU2 A;  3R07 C;  1IUT A;  3FG2 P;  3NK1 X;  2GVC A;  2XDO A;  5IPY A;  2C76 A;  5BUK A;  4CY6 A;  2JAE A;  2NQL A;  3RNM A;  3R10 A;  4Z25 A;  1GT8 A;  5CKU A;  3C96 A;  2PGE A;  5KMR A;  1F3P A;  4TLZ A;  5KOW A;  4MKS A;  1EC7 A;  3ALM A;  4DXK A;  2ZZ0 A;  2OPJ A;  3S61 A;  1PDY A;  3NO1 A;  4HCL A;  3DDM A;  4H50 A;  2FJD A;  1F6M A;  1NPX A;  4G74 A;  4EIQ A;  1OJC A;  3AEC A;  1DOD A;  1CJC A;  3NXL A;  3NGC X;  3ICT A;  3BOX A;  2ZZB A;  1BZL A;  3VR8 A;  1S3E A;  2PU0 A;  4XWR A;  4E5T A;  3AN1 A;  4GFI A;  3QLD A;  1PXA A;  4A6N A;  2BC1 A;  1CC6 A;  3DG3 A;  4N9X A;  2XGZ A;  2GB0 A;  2B9X A;  3DJJ A;  2VQ7 A;  1JDF A;  2WOV A;  2RGH A;  2PTZ A;  3UKQ A;  4A5L A;  3V76 A;  1N60 C;  4DYE A;  3NZG A;  3AEF A;  3VCN A;  2FJE A;  1N62 C;  2BS4 A;  4MJW A;  2P8C A;  3HRD C;  5KVH A;  3BI2 A;  1EBD A;  1ZOV A;  3QKE A;  3HW2 A;  2OVL A;  2PA6 A;  3RCY A;  2YVF A;  1GRH A;  4H2N A;  4HNC A;  4K2S A;  4EWJ A;  1MXT A;  5JCN A;  4O5U A;  4D04 A;  2ZZC A;  1PXC A;  2GQW A;  3P4R A;  4BUR A;  3SXI A;  4H4P A;  4MGG A;  4GAV A;  1PBD A;  3OW1 A;  1ONF A;  1FEC A;  1B4V A;  3T6C A;  2JKC A;  4II3 A;  1ZKQ A;  1NEN A;  2XLP A;  3M0O A;  4H4Y A;  1PXB A;  1MDR A;  3KKJ A;  4AOX A;  4YT0 A;  4H4Z A;  1D7L A;  2C7G A;  3LAD A;  3NIX A;  4EMI A;  3CPI G;  3Q9T A;  3UKF A;  2GSH A;  3DES A;  3JVA A;  3EAO A;  3TQP A;  4K8D A;  2C67 A;  3GMC A;  1GSN A;  2PP1 A;  1EL5 A;  3KVE A;  4NZH A;  3URH A;  3VC5 A;  3RP7 A;  4GAP A;  1D5T A;  1H7X A;  3I6T A;  1P2E A;  1FEB A;  3L8K A;  1SJB A;  3G5R A;  4K5R A;  1TRB A;  3CGC A;  1CJ4 A;  4M0X A;  2YLW A;  3EPT A;  3B3R A;  2PP3 A;  2XH0 A;  3AD9 B;  3HYV A;  2WQY A;  1KKO A;  3UXK A;  1H6V A;  2JB3 A;  3MUC A;  2R4J A;  4B68 A;  3VC6 A;  4GIR A;  1JRZ A;  1MNS A;  5JCK A;  2PHH A;  4ENL A;  1L0V A;  4TVW A;  2YG3 A;  2YG7 A;  1UKV G;  3ISH A;  1E9I A;  2V3A A;  1STZ A;  5IQ1 A;  3PWG A;  5FJP A;  1L9D A;  3KPF A;  3TWB A;  5EB5 A;  3ZLH A;  4CCR A;  3RP6 A;  1VDC A;  3QTP A;  4LU6 A;  2R46 A;  3FPZ A;  1H86 A;  2OAM A;  2ZAD A;  5KMP A;  5BOF A;  2W3S A;  1JRP A;  4IZG A;  2QQ6 A;  1BGJ A;  2E5A A;  3AM9 A;  2NVK X;  4U2T A;  1NHQ A;  1N1P A;  4X2P A;  3NRZ B;  2YQU A;  1E39 A;  2WET A;  2WPC A;  5GSN A;  3AE9 A;  3RED A;  4IT1 A;  2OKT A;  3GD3 A;  3GYJ A;  4H19 A;  4IV9 A;  3VRB A;  5EB4 A;  1JPM A;  2BK4 A;  2XVI A;  2OG9 A;  2B7R A;  1XHC A;  4GR1 A;  3V3W A;  4GF7 A;  5HXI A;  3SN4 A;  4TLX A;  2X50 A;  2OLN A;  3GC2 A;  4U8M A;  3K1G A;  4I58 A;  2GGG A;  2OA1 A;  2TPR A;  1FHU A;  2AAQ A;  3CYJ A;  4M6U A;  1YKJ A;  4C3X A;  5U1O A;  3GYI A;  1NU5 A;  4C77 A;  3P4Q A;  3GD4 A;  2E1M A;  2C3D A;  4G8T A;  3II4 A;  3T4W A;  4J33 A;  1H2I A;  3LB8 A;  1PBB A;  1FOH A;  4H4W A;  4EMW A;  4KEM A;  2XH2 A;  2YG5 A;  4YKF A;  1F8R A;  4UDQ A;  1NG4 A;  3M13 A;  4K2X A;  2OLO A;  4ZCC A;  2GGJ A;  2O9Z A;  3AE6 A;  4HYR A;  2OO6 A;  4D03 A;  1ZDL A;  3Q4D A;  3STP A;  1GRE A;  2YAU A;  1GAL A;  4CNK A;  1PJ5 A;  2FBW A;  4AOS A;  3CXO A;  3OP2 A;  4E0V A;  3BJS A;  4IP4 A;  3T8Q A;  3UP5 A;  1E1N A;  3R25 A;  1DOB A;  2YG6 A;  3VA8 A;  4FI4 A;  1GTE A;  2ACZ A;  4IA6 A;  4FX9 A;  3CNT A;  3BSM A;  7ENL A;  2AQJ A;  4A6N B;  2AL2 A;  3SFE A;  1FHV A;  1JNR A;  3AE2 A;  3UJE A;  4CY8 A;  4LII A;  2QAE A;  2C75 A;  2QCU A;  2BCP A;  4JNQ A;  1H83 A;  3RHA A;  3FXG A;  4ZCW A;  2WS3 A;  4BK3 A;  1PJ7 A;  1GTH A;  2VVL A;  2I0Z A;  2VVM A;  3SGL A;  3FYY A;  2QJN A;  4G6G A;  5BVA A;  3AD7 B;  4J36 A;  3KA7 A;  1BF3 A;  4E4F A;  2V6O A;  1PN0 A;  4U8K A;  1X2G A;  1DNC A;  1JPD X;  1B37 A;  4H2P A;  1EL9 A;  2GL5 A;  2XLU A;  3D9X A;  2FKP A;  4K5S A;  3NG7 X;  4B67 A;  3LJP A;  3BI4 A;  1GES A;  1NHP A;  1WYG A;  3SJN A;  3R1Z A;  1GER A;  2O56 A;  3ICS A;  2XLS A;  4H1Z A;  2WEU A;  1FEA A;  3SBF A;  1CJ2 A;  2H89 A;  3AEG A;  3PK7 A;  1VG9 A;  2PSN A;  5FJR A;  3RRA A;  2YR6 A;  1TYT A;  3LOV A;  2WP6 A;  1QJD A;  3O0H A;  4JHM A;  1FIQ B;  1GRF A;  2ONE A;  2QVH A;  2YVJ A;  2RAB A;  1TDO A;  4H4Q A;  4J2W A;  2EQ8 A;  3H8L A;  3R0K A;  2GAH B;  3H8I A;  2GQF A;  2YWL A;  1IYX A;  2J3N A;  3QSM A;  4FK1 A;  1H84 A;  2CUL A;  2C4C A;  4Y4N A;  5KNL A;  4UP3 A;  3K7M X;  5HYM A;  3P1W A;  2WDV A;  2BXR A;  1NHS A;  3SZF A;  1N4W A;  1O5W A;  2YLZ A;  4YSH A;  5FS7 A;  3V4B A;  1EC9 A;  3ALL A;  5KVI A;  1ZMD A;  1TYP A;  3FVD A;  3KLJ A;  1OJA A;  3T0K A;  3AED A;  1JRX A;  3V5F A;  3KU9 A;  3UJF A;  1XAN A;  3Q6J A;  3UCC A;  4OCG A;  4ZN0 A;  1VG0 A;  4E4U A;  2W0H A;  3DME A;  3VRD B;  4FP1 A;  1LJ1 A;  3QVR A;  1D4C A;  2C3C A;  3S5S A;  4GUV A;  2VOU A;  3P4P A;  4U8J A;  5IQ4 A;  3QJ4 A;  2PS2 A;  4UDR A;  3R0U A;  2OZ3 A;  1COY A;  2FJB A;  2QDD A;  5JRB A;  1W4X A;  2XYO A;  3SY4 A;  2XCG A;  3ZVH A;  5HHF A;  3AE1 A;  4II2 A;  4U2L A;  3ZDN A;  1RVK A;  3OPS A;  4XXG A;  3TJ4 A;  3FV9 A;  3ZLF A;  2ZBW A;  3P0W A;  3GRS A;  2JB1 A;  3AYL A;  2YLR A;  4REK A;  4J56 A;  1F8S A;  1IUW A;  3DGH A;  2YVG A;  2WPE A;  1FL2 A;  4GCM A;  1OJ9 A;  2WU2 A;  1LV0 A;  2AKM A;  1Y56 A;  5FMH A;  2CDU A;  3GWF A;  4B69 A;  2BK5 A;  3T2K A;  5TR3 A;  5FS6 A;  3EF6 A;  4GYP A;  5G5H B;  3ATR A;  3UOV A;  1PDH A;  3FJ4 A;  4A65 A;  3SFD A;  4TM3 A;  2CHR A;  4YKG A;  2B76 A;  3NYC A;  3PFR A;  3DFH A;  3PVC A;  1L9E A;  5M10 A;  1IUX A;  5KXJ A;  1TZZ A;  1YY5 A;  5U25 A;  1H7W A;  4J34 A;  4OPI A;  3I6E A;  1X2H A;  4BJZ A;  4OPD A;  4H4U A;  3SN0 A;  1KSS A;  4BJY A;  1LQU A;  1D4E A;  1S2Y A;  1D4D A;  1X31 B;  4K1W A;  2AL2 B;  2WP5 A;  3DER A;  2WDQ A;  2I5Q A;  4J57 A;  1VRQ B;  1HYU A;  4Z26 A;  1BWC A;  3OZY A;  3D1C A;  4KX6 A;  3TW9 A;  4IVM B;  5C3J A;  3IJI A;  2WHD A;  2C73 A;  3HPF A;  2DW6 A;  4M52 A;  1KCZ A;  4U8I A;  1MRA A;  1PBE A;  2BC0 A;  3LZX A;  3DH9 A;  2OAL A;  3B9J B;  1LVL A;  1T3Q C;  5ER0 A;  1P48 A;  3ZLG A;  4IVO B;  5FJO A;  3T9P A;  1GEU A;  4KPR A;  2XVE A;  2BCG G;  3N4E A;  3IC9 A;  3GSI A;  3U9I A;  2QJM A;  3ZYX A;  3A7R A;  3DA1 A;  3CT2 A;  1TDE A;  2IVD A;  1ZK7 A;  2R45 A;  3NK0 X;  5L46 A;  4JY3 A;  3A7A A;  2PPG A;  2E5V A;  5KWF A;  1RP0 A;  3V3O A;  3EAN A;  1Q9I A;  4TM4 A;  1KD0 A;  2EQ6 A;  1JNZ A;  3V3N A;  1YQ4 A;  3VR9 A;  1KN0 A;  3R9U A;  1Z6L A;  5HY5 A;  4KWS A;  3A7U A;  5FJT A;  2JBV A;  1EC8 A;  4Y4L A;  2QA1 A;  1XS2 A;  1ZOY A;  4DGK A;  3PWI A;  3T14 A;  3DK9 A;  3E1T A;  3IJL A;  3QFB A;  5J04 A;  4B66 A;  1B8S A;  1PHH A;  1V59 A;  3ICR A;  4OVI A;  3RR1 A;  2XFP A;  2GGI A;  2JK6 A;  2PYX A;  4B64 A;  3EUB 3;  1LPF A;  5EBK A;  2XSX A;  3OTR A;  2HZG A;  1FO4 A;  4Z24 A;  4FK1 C;  4NTD A;  4YSX A;  3DGB A;  3BNM A;  1WUF A;  3H70 A;  2BS2 A;  3L5O A;  4Z17 A;  3UCL A;  3MKC A;  1P43 A;  4HNL A;  5KMS A;  1E6E A;  3D46 A;  2C64 A;  2X8H A;  4U8L A;  1CF3 A;  3GDP A;  1E7P A;  2P3Z A;  3ITJ A;  1R0M A;  4NEV A;  3THU A;  4NNJ A;  1TDN A;  1TKK A;  1DOE A;  2P0I A;  3HYW A;  1KNP A;  3F8R A;  4DSH A;  4G7F A;  5BUL A;  3C4N A;  3JW7 A;  2QGY A;  4DN1 A;  2A87 A;  1S3B A;  3N6J A;  3RIT A;  3BI5 A;  3P93 A;  3I4K A;  1FFV C;  3T31 A;  3UP4 A;  2P88 A;  3T2Y A;  3PO7 A;  1O95 A;  3I6D A;  4AT0 A;  1GXF A;  2AL1 A;  1KDG A;  1GPE A;  4IL0 A;  1F9C A;  5JCI A;  4NWZ A;  3CGD A;  2IVE A;  3SSZ A;  1M64 A;  3ZVH B;  1XPY A;  1Q1W A;  1RM6 B;  4H2Q A;  2RGO A;  1K0J A;  2GGH A;  4LA1 A;  2WPF A;  3BHF A;  3FMW A;  1O94 A;  1GRA A;  3NVV B;  1S2Q A;  1L9C A;  4IP5 A;  4GDP A;  3TCS A;  2QJJ A;  2ZC8 A;  2HNE A;  2FJA A;  2BAB A;  2PTW A;  4OPT A;  4DWD A;  2GRT A;  4OPC A;  6ENL A;  1FFU C;  4FDC B;  1Y56 B;  1NEK A;  3UKK A;  4Z1Y A;  3CNP A;  3GMB A;  4ZCD A;  2R9Z A;  1CL0 A;  2ARD A;  5BOE A;  3CIR A;  3AE7 A;  3T37 A;  4JN7 A;  5U63 A;  2YR4 A;  4A3R A;  2R0P A;  4C74 A;  3DEQ A;  4USQ A;  4GYP C;  3ATQ A;  4CRT A;  1DJQ A;  1LTX R;  4A7A A;  1IJH A;  2APG A;  4P9S A;  5FS8 A;  3SYI A;  3NHO X;  2OQH A;  4DNA A;  3AXB A;  3RP8 A;  4E6M A;  4X9M A;  2WES A;  1N5X A;  1BGN A;  4APN A;  3IK4 A;  2UZZ A;  2Q0K A;  1BKW A;  1E1M A;  4H4X A;  2R0G A;  1FCD A;  4GGB A;  3L1R A;  1CC4 A;  3MZN A;  2YG4 A;  2C72 A;  3V5C A;  1PBC A;  3UOX A;  2X99 A;  2BRA A;  2C66 A;  2YLX A;  3AD8 B;  2DKH A;  3AE8 A;  4IA5 A;  4EIP A;  4CCQ A;  1ZX9 A;  3IF9 A;  3NT6 A;  4TVY A;  3MWC A;  3OC4 A;  2B7S A;  1KF6 A;  1JEH A;  2GR2 A;  3IHM A;  1GRG A;  1Y0P A;  1TE6 A;  2VRM A;  2C70 A;  3K7Q X;  3CXB A;  3AYI A;  1EBG A;  1WUE A;  1JOA A;  3UTF A;  1XPQ A;  3AB1 A;  1VDV A;  1BQG A;  4I59 A;  3CN8 A;  3UJS A;  2A8X A;  1K4Q A;  3DJE A;  2PTY A;  4Z2R A;  4KPL A;  1SB3 B;  2Q0L A;  4H4T A;  3GDN A;  4U8P A;  1ZMC A;  1MO9 A;  4YWS A;  3FIM B;  3SZW A;  3UKL A;  2Y6Q A;  3IHG A;  2CFY A;  3MSY A;  1GOS A;  4GGH A;  4EQR A;  3GD6 A;  4WCT A;  4J1O A;  1MUC A;  4ICY A;  4BV6 A;  1RYI A;  4U8N A;  3G5S A;  1SJD A;  1K0I A;  3I3L A;  3UGV A;  4A6G A;  1SEZ A;  1ECQ A;  2H88 A;  3CK5 A;  2WDR A;  2XVH A;  3GO2 A;  2HXT A;  1REO A;  3TTE A;  4ROP A;  3UJR A;  3NTD A;  3C4A A;  1JCT A;  3QPE A;  3IWA A;  4EQX A;  2VRL A;  1K0L A;  4TM0 A;  5JCL A;  3ENL A;  4YTP A;  1PDZ A;  2V3B A;  3QSS A;  3N4F A;  3NTA A;  2XLT A;  2Q6U A;  1NAA A;  4X4J A;  3ES7 A;  2IID A;  4MMW A;  2XFQ A;  2GMJ A;  3DG6 A;  2EQ7 A;  3F8P A;  1ONE A;  1CHU A;  1P2H A;  3DGZ A;  2WOI A;  4A9W A;  4BK2 A;  1L8P A;  1LQT A;  2PU1 A;  4G73 A;  5M0Z A;  1OEP A;  1YQZ A;  2YLT A;  3AEB A;  2Y6R A;  3NYF A;  1PJ6 A;  2Q7V A;  3K7T A;  3B97 A;  5C2T A;  2XH4 A;  1KSU A;  3H4K A;  1N61 C;  4YSY A;  2BAC A;  3ES8 A;  1GET A;  2YR5 A;  3CMM A;  1EBH A;  4HCH A;  3CPJ G;  4U2S A;  4NTC A;  1ZP0 A;  3ALJ A;  2OLA A;  3AWI A;  4Y4M A;  4J31 A;  1M6I A;  1R6W A;  3RO6 A;  4H4S A;  2C65 A;  4C5O A;  4OPU A;  4F4R A;  2V5Z A;  1KFY A;  4DHG A;  2X3N A;  5FS9 A;  1TDF A;  3PS9 A;  3GWD A;  3H12 A;  2QA2 A;  4RG3 A;  4A35 A;  5DBJ A;  2PTX A;  3H7V A;  2XH7 A;  1NG3 A;  2OFJ A;  2GEW A;  4B65 A;  3SQP A;  1NDA A;  2GV8 A;  3QSE A;  4JN9 A;  2GR3 A;  3R11 A;  2B9W A;  2Z5Y A;  3DIP A;  3VCC A;  3HYX A;  4NTE A;  3UJ2 A;  3UKA A;  1F8W A;  4H4R A;  4HN8 A;  1CC2 A;  1YEY A;  1EL7 A;  3CND A;  4GRT A;  4ECH A;  2QDE A;  3BNU A;  2X8C A;  4RG4 A;  2GAG B;  2X8G A;  3AE4 A;  4K7Z A;  4CBQ A;  5EOW A;  5IDZ A;  4K8G A;  3UTG A;  3QN3 A;  1H82 A;  3ABV A;  1CBO A;  3SM8 A;  4DSG A;  3EEZ A;  4E8G A;  3CAW A;  2WOW A;  1IUV A;  3NNE A;  3AMZ A;  3SR6 B;  3UTE A;  3AEA A;  4CNJ A;  3UOZ A;  2F5Z A;  4IHC A;  1EL8 A;  1YQ3 A;  3ETR B;  2XFO A;  4Z2T A;  3UCD A;  2V60 A;  3CNJ A;  3DK4 A;  4B63 A;  3VQR A;  1DOC A;  3LXD A;  1VQW A;  1NHR A;  4H7U A;  1XDI A;  3NN6 X;  3CB3 A;  2YM2 A;  5CQF A;  3TWA A;  3NN0 X;  3CGB A;  1ZY8 A;  2E4G A;  2FYM A;  1JRY A;  4AP1 A;  1RSG A;  3T2Z A;  2BXS A;  2MNR A;  1IUU A;  1DTN A;  3CGE A;  3M12 A;  3PG6 A;  2XVJ A;  3VDG A;  4EQS A;  3DJD A;  2BS3 A;  4H2R A;  4USR A;  2VVL G;  4OPG A;  2HXU A;  1KKR A;  3JSK A;  3WE0 A;  1QLB A;  1E1K A;  5KMQ A;  3GRT A;  3SQS A;  3VFC A;  4HCD A;  3LZW A;  1OJD A;  3NYE A;  2WBA A;  2AKZ A;  4EM3 A;  3UXL A;  2EQ9 A;  4U8O A;  4BK1 A;  5KOX A;  4AT2 A;  3KPK A;  4OPL A;  1AOG A;  3P4S A;  3UKP A;  4PAB A;  2R4E A;  3SZ0 A;  2VZ2 A;  3D8X A;  4DX3 A;  4AP3 A;  2DKI A;  3ADA B;  3ZVI A;  1GRB A;  2YM1 A;  4Z44 A;  3RGT A;  4B1B A;  2BA9 A;  2XFU A;  2MUC A;  3P3B A;  2AR8 A;  3AYJ A;  4Z43 A;  5JCM A;  3TOY A;  4Z2U A;  2JB2 A;  4YTN A;  2PMQ A;  2WP9 A;  2OZT A;  3DJG X;  3NS1 B;  3NLC A;  1GRT A;  4XWZ A;  1JRO A;  2W3R A;  1DXL A;  2GH5 A;  3N6H A;  3SN1 A;  4KT2 A;  1N5W C;  1N4U A;  2V61 A;  1ZXI C;  4JQ9 A;  4JY2 A;  3DFY A;  4YSZ A;  2W54 A;  4HA6 A;  2Z5X A;  2E3T A;  4X9N A;  3MQT A;  3NFU A;  2WU5 A;  1D7Y A;  1Q1R A;  2P8B A;  3K30 A;  4JDR A;  2OX4 A;  2PP0 A;  4EM4 A;  1N63 C;  2PGW A;  2XLR A;  3QFA A;  3B6D A;  3TJI A;  3OZ2 A;  1OJT A;  4GIS A;  3Q45 A;  2TMD A;  4JN8 A;  2BYB A;  2YLS A;  3JZU A;  1BKH A;  1ELS A;  4ZOH B;  2HQM A;  2DW7 A;  1KNR A;  2POZ A;  4UDP A;  2XFN A;  5BRT A;  3NRN A;  4A99 A;  3SX6 A;  3CPH G;  4K22 A;  3OZM A;  4GDE A;  3SZC A;  1VQZ A;  2B9Y A;  2BRY A;  4YTM A;  1MDL A;  5KRQ A;  1SJC A;  3GYX A;  4G9K A;  3G5Q A;  3CTY A;  3KD9 A;  3S47 A;  3AE5 A;  3EKG A;  1GV4 A;  4JNA A;  1PS9 A;  4RSL A;  3NK2 X;  3NKS A;  1SJA A;  2PCE A;  3AE3 A;  3FBS A;  2A89 A;  3COX A;  4H2H A;  1NEL A;  3IJQ A;  4YXD A;  1ELI A;  4NEW A;  4ADW A;  3NVZ B;  5FJU A;  3S5W A;  4WX1 A;  4G6H A;  4C3Y A;  4EQW A;  2RGJ A;  3P9U A;  3UTH A;  1B5Q A;  3AEE A;  1DJN A;  3VRA A;  1S7M A;  5J7X A;  3MY9 A;  3FCP A;  2XVF A;  2GGE A;  3HZL A;  2GR1 A;  1V97 A;  2GR0 A;  2W55 A;  3QVP A;  1IUS A;  3F8D A;  4PAA A;  4A79 A;  1GND A;  4HPN A;  4ZA0 A;  5LV9 A;  5G5G B;  4H83 A;  3DK8 A;  2GMH A;  1W6T A;  4YWO A;  3CNS A;  2GF3 A;  1H81 A;  5EU9 A;  4HB9 A;  2VQB A;  4EMJ A;  3UKH A;  4H4V A;  1QO8 A;  2OQY A;  3GY1 A;  1CJ3 A;  2BK3 A;  3U4F A;  3DG7 A;  1PBF A;  5ENL A;  2NPX A;  3NH3 X;  3UOY A;  2POD A;  4TM1 A;  4J3Z A;  1N4V A;  2RDX A;  2OZ8 A;  2R0C A;  3D47 A;  5J60 A;  3NVY B;  1E1L A;  4O5Q A;  4GME A;  3H8A A;  1MOK A;  3KUM A;  1TDK A;  2CVJ A; 
#chains in the Genus database with same CATH homology
 2QAE A;  3BHK A;  1ZOY A;  2C75 A;  2QCU A;  1TDF A;  4DGK A;  3T14 A;  3PS9 A;  3DK9 A;  2BCP A;  3GWD A;  5GRT A;  4JNQ A;  3E1T A;  1JU2 A;  1H83 A;  3RHA A;  3QFB A;  1IUT A;  2WS3 A;  4BK3 A;  2QA2 A;  4RG3 A;  4B66 A;  3FG2 P;  1B8S A;  1PHH A;  1GTH A;  1PJ7 A;  2GVC A;  2XDO A;  1V59 A;  2VVL A;  3ICR A;  2I0Z A;  2VVM A;  5IPY A;  4OVI A;  2C76 A;  2XFP A;  5DBJ A;  5BUK A;  3SGL A;  4CY6 A;  2JAE A;  2JK6 A;  2PYX A;  4G6G A;  1NG3 A;  5BVA A;  4B64 A;  3AD7 B;  3RNM A;  4J36 A;  3KA7 A;  2GEW A;  1BF3 A;  4Z25 A;  1LPF A;  5EBK A;  3SQP A;  1NDA A;  1GT8 A;  4B65 A;  2GV8 A;  3QSE A;  5CKU A;  3C96 A;  4JN9 A;  2GR3 A;  2B9W A;  5KMR A;  2Z5Y A;  2V6O A;  1PN0 A;  3HYX A;  4NTE A;  4Z24 A;  1F3P A;  4U8K A;  4TLZ A;  3UKA A;  1F8W A;  4H4R A;  1CC2 A;  4FK1 C;  1EL7 A;  1DNC A;  5KOW A;  1B37 A;  3CND A;  4NTD A;  3ALM A;  4H2P A;  1EL9 A;  4YSX A;  3BNM A;  4GRT A;  2XLU A;  4ECH A;  2BS2 A;  3BNU A;  3D9X A;  2X8C A;  4RG4 A;  3L5O A;  2ZZ0 A;  3UCL A;  3S61 A;  2GAG B;  4K5S A;  3NG7 X;  2X8G A;  4B67 A;  3AE4 A;  5KMS A;  1E6E A;  4K7Z A;  4CBQ A;  2C64 A;  2X8H A;  5EOW A;  4U8L A;  3LJP A;  3BI4 A;  1CF3 A;  3GDP A;  3UTG A;  4H50 A;  1E7P A;  2FJD A;  1GES A;  1NHP A;  3ITJ A;  1F6M A;  4NEV A;  3ABV A;  1H82 A;  1NPX A;  4NNJ A;  1CBO A;  3SM8 A;  4DSG A;  1GER A;  4G74 A;  4EIQ A;  1TDN A;  3ICS A;  1OJC A;  1DOE A;  2XLS A;  2WEU A;  1FEA A;  3AEC A;  1CJ2 A;  3HYW A;  1DOD A;  2WOW A;  1KNP A;  3F8R A;  1IUV A;  2H89 A;  3AEG A;  1CJC A;  3NNE A;  4DSH A;  3UTE A;  5BUL A;  1VG9 A;  3C4N A;  3NGC X;  3AEA A;  4CNJ A;  3ICT A;  2YR6 A;  3UOZ A;  1TYT A;  2ZZB A;  2A87 A;  1BZL A;  1S3B A;  3LOV A;  3VR8 A;  1S3E A;  4XWR A;  2WP6 A;  3BI5 A;  1QJD A;  3O0H A;  3T31 A;  4A6N A;  1PXA A;  2F5Z A;  1EL8 A;  2BC1 A;  1CC6 A;  1YQ3 A;  3UP4 A;  3T2Y A;  3PO7 A;  1GRF A;  4N9X A;  2XFO A;  1O95 A;  3I6D A;  4Z2T A;  4AT0 A;  1GXF A;  2YVJ A;  1GPE A;  1KDG A;  2RAB A;  1TDO A;  2GB0 A;  2V60 A;  3CNJ A;  2B9X A;  3DK4 A;  4H4Q A;  4B63 A;  3DJJ A;  2VQ7 A;  4J2W A;  2EQ8 A;  3H8L A;  2WOV A;  2RGH A;  5JCI A;  3UKQ A;  2GAH B;  2CVJ A;  3H8I A;  1DOC A;  3VQR A;  3LXD A;  1VQW A;  2GQF A;  1NHR A;  4H7U A;  3NK1 X;  1XDI A;  2YWL A;  3NN6 X;  4NWZ A;  3CGD A;  2J3N A;  4A5L A;  2YM2 A;  5CQF A;  3V76 A;  2IVE A;  3AEF A;  3QSM A;  1M64 A;  3NN0 X;  3CGB A;  2FJE A;  2BS4 A;  1Q1W A;  1ZY8 A;  2E4G A;  4MJW A;  4H2Q A;  2RGO A;  5KVH A;  1K0J A;  4FK1 A;  4LA1 A;  3BI2 A;  2WPF A;  1H84 A;  2CUL A;  1EBD A;  1JRY A;  2C4C A;  3BHF A;  3FMW A;  1ZOV A;  4AP1 A;  1RSG A;  4Y4N A;  5KNL A;  4UP3 A;  1O94 A;  3T2Z A;  3K7M X;  1GRA A;  2BXS A;  1S2Q A;  1L9C A;  2YVF A;  5HYM A;  1IUU A;  1GRH A;  3CGE A;  3P1W A;  4GDP A;  3M12 A;  4H2N A;  2WDV A;  3PG6 A;  2BXR A;  1MXT A;  2XVJ A;  1NHS A;  3SZF A;  5JCN A;  4O5U A;  4D04 A;  4EQS A;  2FJA A;  2ZZC A;  3DJD A;  2BS3 A;  4H2R A;  2BAB A;  4USR A;  1PXC A;  2GQW A;  5KOX A;  1N4W A;  4OPT A;  3P4R A;  4BUR A;  1O5W A;  2VVL G;  2YLZ A;  3SXI A;  5FS7 A;  4YSH A;  2GRT A;  4OPC A;  4H4P A;  4GAV A;  4OPG A;  1PBD A;  4FDC B;  1Y56 B;  1ONF A;  1NEK A;  3UKK A;  1FEC A;  3JSK A;  3CNP A;  3GMB A;  1B4V A;  3WE0 A;  1QLB A;  3ALL A;  4ZCD A;  5KVI A;  2JKC A;  4II3 A;  1E1K A;  5KMQ A;  1ZMD A;  3GRT A;  1TYP A;  1ZKQ A;  1NEN A;  2XLP A;  1CL0 A;  3LZW A;  3KLJ A;  2ARD A;  3M0O A;  1OJA A;  1OJD A;  3T0K A;  4H4Y A;  3CIR A;  1PXB A;  3AE7 A;  3KKJ A;  4AOX A;  3NYE A;  2WBA A;  3AED A;  3T37 A;  5U63 A;  4YT0 A;  1JRX A;  4H4Z A;  4EM3 A;  1XAN A;  1D7L A;  2YR4 A;  2C7G A;  3LAD A;  3Q6J A;  3KU9 A;  4EMI A;  3CPI G;  3NIX A;  2R0P A;  3Q9T A;  3UKF A;  2EQ9 A;  4OCG A;  4C74 A;  4USQ A;  3EAO A;  3ATQ A;  4U8O A;  1DJQ A;  4CRT A;  4K8D A;  1LTX R;  2C67 A;  1VG0 A;  4BK1 A;  4ZN0 A;  2W0H A;  3DME A;  3GMC A;  4AT2 A;  3KPK A;  4OPL A;  3VRD B;  4A7A A;  1GSN A;  1IJH A;  1LJ1 A;  1AOG A;  3P4S A;  1EL5 A;  2APG A;  3KVE A;  5FS8 A;  3QVR A;  2R4E A;  3NHO X;  3URH A;  4NZH A;  1D4C A;  4PAB A;  2C3C A;  3RP7 A;  4GAP A;  3SZ0 A;  4GUV A;  4DNA A;  3AXB A;  2VOU A;  3RP8 A;  2VZ2 A;  3P4P A;  4U8J A;  3D8X A;  4X9M A;  2WES A;  4AP3 A;  1D5T A;  2DKI A;  1BGN A;  3ADA B;  1H7X A;  4APN A;  1P2E A;  5IQ4 A;  1FEB A;  3L8K A;  2UZZ A;  3QJ4 A;  2Q0K A;  1GRB A;  4UDR A;  1BKW A;  2YM1 A;  4Z44 A;  3G5R A;  4K5R A;  1TRB A;  2BA9 A;  1E1M A;  4B1B A;  1COY A;  3CGC A;  2XFU A;  1CJ4 A;  2AR8 A;  2FJB A;  4Z43 A;  3AYJ A;  5JCM A;  2YLW A;  5JRB A;  3EPT A;  3B3R A;  4H4X A;  2R0G A;  1W4X A;  4Z2U A;  2JB2 A;  1FCD A;  2XYO A;  3SY4 A;  2XCG A;  4YTN A;  3L1R A;  3AD9 B;  1CC4 A;  3HYV A;  2WQY A;  2WP9 A;  3DJG X;  2YG4 A;  2C72 A;  3NLC A;  5HHF A;  1GRT A;  1PBC A;  3AE1 A;  3UOX A;  1H6V A;  2JB3 A;  2X99 A;  4II2 A;  2BRA A;  4U2L A;  3ZDN A;  4XWZ A;  2R4J A;  4B68 A;  2C66 A;  2YLX A;  4XXG A;  3AD8 B;  1JRZ A;  1DXL A;  2GH5 A;  2ZBW A;  5JCK A;  2DKH A;  3AE8 A;  2PHH A;  4IA5 A;  3GRS A;  4EIP A;  2JB1 A;  1ZX9 A;  4CCQ A;  3IF9 A;  3AYL A;  3NT6 A;  1N4U A;  2V61 A;  1L0V A;  2YLR A;  4REK A;  3OC4 A;  2YG7 A;  4J56 A;  1F8S A;  1IUW A;  1UKV G;  3DGH A;  2YG3 A;  2B7S A;  3ISH A;  4JQ9 A;  4JY2 A;  2YVG A;  1KF6 A;  1JEH A;  2GR2 A;  3IHM A;  2WPE A;  4YSZ A;  1FL2 A;  2V3A A;  2Z5X A;  4HA6 A;  4GCM A;  1OJ9 A;  1GRG A;  4X9N A;  1Y0P A;  2WU2 A;  2WU5 A;  1D7Y A;  1LV0 A;  5IQ1 A;  1Q1R A;  4P9S A;  1L9D A;  2C70 A;  2VRM A;  1Y56 A;  3K7Q X;  3K30 A;  3KPF A;  4JDR A;  3AYI A;  4EM4 A;  5EB5 A;  4CCR A;  5FMH A;  2XLR A;  2CDU A;  3GWF A;  3QFA A;  3B6D A;  3RP6 A;  1JOA A;  4B69 A;  2BK5 A;  3UTF A;  1VDC A;  1XPQ A;  3T2K A;  5TR3 A;  5FS6 A;  3AB1 A;  3OZ2 A;  1OJT A;  3EF6 A;  4LU6 A;  2TMD A;  2R46 A;  3FPZ A;  1H86 A;  3ATR A;  2OAM A;  2BYB A;  2YLS A;  4I59 A;  5KMP A;  3CN8 A;  2A8X A;  1K4Q A;  3UOV A;  3DJE A;  4Z2R A;  1PDH A;  4A65 A;  2Q0L A;  1BGJ A;  3SFD A;  2HQM A;  4H4T A;  4TM3 A;  1KNR A;  3GDN A;  4YKG A;  4U8P A;  1ZMC A;  2B76 A;  1MO9 A;  4UDP A;  2XFN A;  3NYC A;  5BRT A;  2NVK X;  4U2T A;  3NRN A;  4A99 A;  1NHQ A;  1N1P A;  3SX6 A;  3CPH G;  4K22 A;  3FIM B;  3PVC A;  1L9E A;  4GDE A;  5M10 A;  3SZW A;  2YQU A;  1IUX A;  3UKL A;  1E39 A;  2Y6Q A;  5KXJ A;  3IHG A;  2CFY A;  1GOS A;  3SZC A;  4EQR A;  1YY5 A;  2WET A;  5U25 A;  1H7W A;  2B9Y A;  2BRY A;  4YTM A;  4WCT A;  4J34 A;  2WPC A;  5GSN A;  5KRQ A;  4OPI A;  3GYX A;  4G9K A;  3G5Q A;  3CTY A;  3KD9 A;  4BV6 A;  4ICY A;  3AE5 A;  1GV4 A;  3AE9 A;  3RED A;  4JNA A;  1RYI A;  4BJZ A;  4U8N A;  3G5S A;  1PS9 A;  4RSL A;  3NK2 X;  1K0I A;  3GD3 A;  3NKS A;  3I3L A;  4OPD A;  3GYJ A;  4H4U A;  1SEZ A;  2H88 A;  4IV9 A;  1KSS A;  3AE3 A;  4BJY A;  3UKP A;  3VRB A;  3FBS A;  5EB4 A;  2A89 A;  3COX A;  2BK4 A;  1LQU A;  2XVI A;  1D4E A;  1S2Y A;  2WDR A;  2XVH A;  4YXD A;  1ELI A;  1D4D A;  1X31 B;  2B7R A;  1XHC A;  4GR1 A;  2WP5 A;  1REO A;  2WDQ A;  4NEW A;  4GF7 A;  5HXI A;  4TLX A;  3NTD A;  4ADW A;  2X50 A;  2OLN A;  4U8M A;  4J57 A;  3C4A A;  4I58 A;  3IWA A;  1VRQ B;  4EQX A;  1HYU A;  2OA1 A;  3S5W A;  2TPR A;  2AAQ A;  4WX1 A;  1BWC A;  2VRL A;  4Z26 A;  1K0L A;  1YKJ A;  3D1C A;  4EQW A;  5JCL A;  2RGJ A;  4G6H A;  3P9U A;  4TM0 A;  3UTH A;  4C3Y A;  1B5Q A;  4C3X A;  3AEE A;  4YTP A;  1DJN A;  5U1O A;  4KX6 A;  2V3B A;  2QA1 A;  1S7M A;  3GYI A;  3QSS A;  5J7X A;  3VRA A;  3NTA A;  3P4Q A;  4C77 A;  2XLT A;  3GD4 A;  2Q6U A;  4IVM B;  5C3J A;  1NAA A;  4X4J A;  2E1M A;  2WHD A;  2IID A;  2C73 A;  2XVF A;  2C3D A;  4M52 A;  3HZL A;  2XFQ A;  1PBE A;  2GMJ A;  3II4 A;  2BC0 A;  3LZX A;  2GR1 A;  4U8I A;  2GR0 A;  3DH9 A;  2OAL A;  4J33 A;  1H2I A;  3SYI A;  1LVL A;  3LB8 A;  1PBB A;  2EQ7 A;  3F8P A;  1FOH A;  3QVP A;  4H4W A;  1IUS A;  5ER0 A;  4EMW A;  3F8D A;  4PAA A;  4IVO B;  4A79 A;  1GND A;  2YG5 A;  1CHU A;  1P2H A;  3DGZ A;  4YKF A;  1GEU A;  2WOI A;  4KPR A;  2XVE A;  5LV9 A;  2BCG G;  4A9W A;  1F8R A;  4UDQ A;  4BK2 A;  3IC9 A;  1NG4 A;  3DK8 A;  3GSI A;  3M13 A;  4K2X A;  1LQT A;  4G73 A;  2GMH A;  4YWO A;  2OLO A;  5M0Z A;  4ZCC A;  3ZYX A;  3CNS A;  1YQZ A;  2O9Z A;  2YLT A;  3AEB A;  3AE6 A;  3DA1 A;  1TDE A;  2GF3 A;  2Y6R A;  2IVD A;  4D03 A;  1ZK7 A;  1H81 A;  2R45 A;  3NYF A;  1ZDL A;  4HB9 A;  2VQB A;  1PJ6 A;  4EMJ A;  3NK0 X;  5L46 A;  2Q7V A;  3K7T A;  4JY3 A;  5C2T A;  1GRE A;  2YAU A;  3UKH A;  4H4V A;  1GAL A;  1KSU A;  1PJ5 A;  1QO8 A;  2E5V A;  4CNK A;  3H4K A;  1RP0 A;  5KWF A;  1CJ3 A;  2FBW A;  4AOS A;  4YSY A;  2BAC A;  2BK3 A;  4E0V A;  1GET A;  2YR5 A;  3CMM A;  3V3O A;  3EAN A;  3CPJ G;  1Q9I A;  4U2S A;  1PBF A;  4NTC A;  4TM4 A;  2NPX A;  3UP5 A;  2EQ6 A;  1JNZ A;  3NH3 X;  1E1N A;  1ZP0 A;  3ALJ A;  3V3N A;  3UOY A;  3AWI A;  1YQ4 A;  4Y4M A;  1DOB A;  3VR9 A;  4J31 A;  2YG6 A;  1M6I A;  4TM1 A;  1GTE A;  2ACZ A;  4IA6 A;  1N4V A;  4H4S A;  1KN0 A;  2C65 A;  4FX9 A;  3R9U A;  4C5O A;  4OPU A;  1Z6L A;  2R0C A;  5HY5 A;  2V5Z A;  3CNT A;  2AQJ A;  4A6N B;  1E1L A;  5J60 A;  1KFY A;  3SFE A;  1JNR A;  3AE2 A;  4O5Q A;  2X3N A;  5FS9 A;  4CY8 A;  2JBV A;  4LII A;  1MOK A;  4Y4L A;  1TDK A;  2R9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...