3DGHA

Crystal structure of drosophila thioredoxin reductase, c-terminal 8-residue truncation
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
477
structure length
477
Chain Sequence
SYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDDKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKDKIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase 1, mitochondrial
publication title Crystal Structure of Drosophila Thioredoxin Reductase, C-terminal 8-residue truncation
rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
total genus 155
structure length 477
sequence length 477
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF00890 FAD_binding_2 FAD binding domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3dghA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dghA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dghA02
3H8IA 1NEKA 4K7ZA 1DJNA 3AECA 3BNUA 2YG3A 3KKJA 3AE5A 1KFYA 3FBSA 3OZ2A 1RYIA 1TDKA 3NK1X 2R4JA 1BKWA 3RNMA 1UKVG 2WP6A 5JCLA 2PHHA 2H89A 2QCUA 3BI4A 3NKSA 2CULA 1PBCA 2X8GA 4J36A 2YWLA 4YXDA 1KNRA 4I58A 3AEFA 2YLWA 1K0IA 2XFQA 3AB1A 2XDOA 3SFDA 4YT0A 2C3DA 2EQ9A 3K7MX 3ALLA 2JK6A 5JCKA 4GDEA 2UZZA 3V76A 1PBFA 3URHA 1D4CA 2BXSA 1Y56B 4OPUA 1JEHA 3DGHA 1W4XA 3P4PA 2XCGA 2GMHA 2GAHB 4GRTA 2BK5A 4OVIA 2C76A 2Y6QA 4NEWA 3UKAA 1LPFA 2B9WA 1E1MA 2WS3A 1GERA 3KLJA 3NNEA 3CNPA 4TM1A 2R0PA 3GMCA 3IC9A 1P2EA 2WOVA 4GUVA 3EAOA 1GRAA 2ZZ0A 1HYUA 4TM0A 4B66A 4YTNA 2HQMA 1PHHA 1CJCA 2Q0LA 3F8PA 3KA7A 4RSLA 2GR0A 2XLRA 1N4VA 3O0HA 4YKFA 1REOA 3D1CA 3P4SA 2XFOA 4K22A 3IHGA 3B3RA 4EM4A 2JB1A 4JN9A 1DODA 3DK4A 1F6MA 2GB0A 4OPCA 4JNAA 3AE6A 3BHFA 4LIIA 2YG7A 1PDHA 4OPIA 1LVLA 4EMIA 1BF3A 3AYIA 3ICSA 4WX1A 4J2WA 4H4UA 2ZZBA 2GMJA 4TLXA 5LV9A 4Z2TA 1DJQA 1EBDA 4CCQA 3NRNA 4JQ9A 4M52A 1JNRA 2C65A 4OPDA 2YM2A 4A65A 4EQXA 4AOXA 1LQUA 3NTAA 2WDVA 1MOKA 3FIMB 1ZP0A 2C67A 4U8IA 5ER0A 4H50A 3Q6JA 3CPHG 4A99A 2WPFA 4C3YA 1OJDA 1FEBA 1Q1RA 2GQWA 1L9DA 2QA2A 3IHMA 3UKQA 2C75A 5U63A 3K7TA 4AP1A 3UTFA 1NG3A 4H2PA 4OPTA 2EQ6A 3UKPA 4FX9A 4AP3A 4GDPA 3DK8A 5TR3A 1GESA 2ACZA 2EQ7A 1CJ4A 1GREA 3NHOX 4GF7A 1H6VA 1OJ9A 4H7UA 4B67A 2APGA 3UCLA 1FCDA 3RHAA 4REKA 3LOVA 4Z44A 3DJDA 1CJ2A 1X31B 5CQFA 5EB5A 4EQRA 3NYCA 4D03A 2IVDA 2RGHA 3IWAA 3AEGA 4EM3A 2C73A 1L9EA 1GRGA 4BK3A 3ABVA 2BS2A 5U1OA 2IIDA 3OC4A 2DKHA 5EBKA 3BNMA 3EF6A 1CC4A 3NH3X 3GWDA 1FL2A 2QA1A 3NYFA 1FECA 1EL7A 1Y56A 4K8DA 4YKGA 4ECHA 1LJ1A 4EMWA 1CJ3A 2YLRA 4KPRA 1YQ4A 4A6NB 1GRFA 4FK1C 1PBEA 2PYXA 5CKUA 1H86A 2WP9A 4EIQA 2B76A 4H4YA 1LQTA 4C74A 1BZLA 2BA9A 1OJTA 1NDAA 1B8SA 1QJDA 3I6DA 2WESA 3AD8B 4LU6A 5M0ZA 2X8CA 1K4QA 5FS7A 3AYJA 3AWIA 3S61A 2F5ZA 1E7PA 1FOHA 4MJWA 3K30A 4CY6A 4B69A 3S5WA 1RSGA 3NGCX 1NAAA 4CRTA 3GDPA 2YVFA 1NENA 3GMBA 4YTMA 3ALMA 5BUKA 2XVJA 2E1MA 1DOCA 3SM8A 3ISHA 2WDQA 2X8HA 3GSIA 4N9XA 5FS6A 2YLTA 4U8LA 1NHSA 3JSKA 1QO8A 4P9SA 4BURA 1H7WA 1PJ6A 3ATQA 4XXGA 3LADA 1VDCA 1D4DA 4O5QA 2JB3A 1JRYA 3NN0X 4U2LA 4JY3A 3L8KA 2XLSA 5C2TA 5IPYA 3C4NA 3NYEA 5HXIA 1GRHA 4Z2UA 1E1LA 1S3EA 2V60A 3DH9A 3AEDA 4ADWA 1IUWA 3DJGX 1F8WA 3D8XA 2GQFA 3G5QA 2VRLA 2QAEA 2A8XA 3AE2A 2IVEA 4USQA 4TM3A 1N1PA 3CGBA 4FK1A 4IVMB 3FPZA 4XWZA 3DMEA 1KDGA 2BS4A 4YSHA 5FS9A 3ADAB 3ZDNA 1Y0PA 1DXLA 2XVIA 5KVHA 3AD9B 5IQ4A 4TLZA 3I3LA 2WOWA 1O5WA 2O9ZA 4PABA 1L0VA 3UP4A 4DSGA 3AYLA 1TDEA 1K0LA 1GETA 1PJ7A 4U8KA 1IUTA 2JB2A 3GD4A 4LA1A 5J7XA 1QLBA 3UTEA 2YG5A 1B4VA 5HY5A 4BV6A 1JNZA 3CPIG 1NHPA 1CC6A 2GR3A 1IJHA 1H83A 4A6NA 4DGKA 1PN0A 1GEUA 2BXRA 3CN8A 4H2QA 1D7LA 3M12A 2YM1A 2YLSA 3G5RA 4XWRA 3DGZA 4ZN0A 2OALA 3CNJA 4IA5A 4U8MA 1PBDA 4YSYA 1KSUA 2Y6RA 1F3PA 3UOXA 4AT0A 4Z2RA 1MO9A 1M64A 2VVLA 2GEWA 1ELIA 3BI2A 1BWCA 1Q1WA 3BI5A 3SFEA 2CFYA 1ZOVA 3P9UA 1H81A 3DJJA 4DNAA 1V59A 3EPTA 2E4GA 3GRSA 3PS9A 3ITJA 4Z43A 4H4TA 2Z5YA 4AT2A 2FJDA 3C96A 2AQJA 2TMDA 4H4QA 4YWOA 1ZX9A 3GRTA 2C7GA 3CNSA 3CNDA 2GR1A 4NTCA 1TDOA 3VRBA 4Z24A 1ZMCA 3AE1A 1EL8A 2FJAA 4H4SA 4H4WA 2R45A 3AE8A 3CPJG 2XVEA 2GH5A 1M6IA 2R46A 4RG4A 1PJ5A 3VRAA 2C72A 4PAAA 2BCGG 3ICTA 3IF9A 3CTYA 2RGOA 4OCGA 2Z5XA 3NK0X 2B9YA 3LZXA 2GRTA 3QVPA 2WPCA 2WETA 3II4A 1F8SA 1TYTA 1IUXA 5C3JA 3VR9A 1NG4A 2V6OA 1GNDA 2C70A 1XANA 5FMHA 3REDA 2VOUA 1N4UA 2YG4A 5IQ1A 1GOSA 2BC0A 4CY8A 2BCPA 4YSZA 1BGNA 4IVOB 3AE9A 2YG6A 2JBVA 4A5LA 4H4XA 1GTHA 1XHCA 2V61A 1VG0A 2BC1A 4J34A 3P4RA 4AOSA 1E1NA 1E39A 3LJPA 4B1BA 4X4JA 5J60A 2ZZCA 3H4KA 3WE0A 2VQBA 4CNKA 4B64A 4JY2A 1IUUA 2OLNA 2R0CA 2NPXA 4Y4LA 3GD3A 3KU9A 5KOXA 5M10A 3UKFA 1FEAA 1KSSA 4HB9A 1OJCA 4NTEA 2Q0KA 3E1TA 3V3OA 1H84A 4FDCB 2H88A 3CGCA 1MXTA 2WPEA 4DSHA 2YQUA 1XPQA 1ZOYA 3B6DA 2R9ZA 3SGLA 3AEAA 4EQSA 3NIXA 4BJYA 4C5OA 4H4ZA 2VZ2A 3UTGA 4C3XA 4H4VA 1VQWA 4X9NA 2W0HA 1GXFA 3AE7A 2C64A 4WCTA 3QSEA 1PXAA 3NG7X 2YR6A 4OPLA 1GRBA 4Y4NA 3UKKA 4I59A 1BGJA 1GT8A 1YQ3A 3G5SA 1GRTA 2V3AA 3EANA 2RABA 3T37A 4HA6A 2WQYA 4U8OA 2WU5A 1DOEA 1JRZA 2C66A 2XLUA 1NHQA 4CNJA 5FS8A 1PBBA 2EQ8A 2A87A 2BABA 2GV8A 2VQ7A 2VVLG 4JDRA 3M0OA 4K5SA 2JKCA 3UTHA 3AEEA 5KXJA 1NHRA 3GWFA 3GYIA 1CBOA 3GDNA 3F8DA 3AEBA 2TPRA 5KVIA 4IV9A 1S2QA 3QSMA 4TM4A 1JOAA 3LXDA 4A79A 3KVEA 3C4AA 4EQWA 5BRTA 5HHFA 1IUVA 2NVKX 5GRTA 4H2NA 2YVJA 2OA1A 3ALJA 1ZMDA 2Q6UA 5JCNA 3UOZA 2WP5A 5JCIA 1JU2A 2GR2A 3UOVA 2WBAA 3BHKA 1B5QA 1H7XA 4NZHA 5KWFA 1ZK7A 5BVAA 1IUSA 4U2SA 2CVJA 2V3BA 4APNA 3SQPA 2WU2A 3PVCA 1CF3A 1KNPA 4K2XA 4E0VA 1EL5A 1ZKQA 1YY5A 4CBQA 2WOIA 3RP6A 1ONFA 2R4EA 2XVFA 2JAEA 4EMJA 2OLOA 3RP8A 3H8LA 4BK1A 2GVCA 3QVRA 2AAQA 2XLTA 2BACA 3UKHA 1GPEA 4BK2A 2I0ZA 2YR5A 4H4RA 2GF3A 4KX6A 3UKLA 4YTPA 3Q9TA 3COXA 1VRQB 4U2TA 3GYJA 3PO7A 1O94A 2XLPA 2YLZA 4ICYA 2VRMA 1DNCA 2YAUA 3NK2X 1D7YA 4X9MA 3QFBA 2C3CA 1P2HA 3VRDB 4CCRA 3KPFA 2GAGB 3FMWA 5KRQA 3V3NA 4B68A 5L46A 5DBJA 4GR1A 3AE3A 2X99A 3AXBA 2OAMA 2XFNA 2DKIA 4GCMA 3CIRA 4RG3A 2WDRA 3R9UA 2WEUA 1N4WA 1AOGA 3K7QX 4A7AA 3VQRA 2BYBA 2E5VA 2V5ZA 4ZCCA 1JRXA 1LV0A 1TDFA 4A9WA 5U25A 4USRA 1GALA 2YLXA 4J31A 3QFAA 3P4QA 1NPXA 4EIPA 1SEZA 1S2YA 1PXBA 1DOBA 4J56A 1PS9A 4C77A 3NTDA 4U8JA 1OJAA 3LZWA 2XYOA 1ZDLA 4D04A 3UP5A 5EOWA 3AD7B 1L9CA 1XDIA 2Q7VA 3KD9A 3L1RA 4Y4MA 4U8PA 3NN6X 2B7RA 2FJEA 2RGJA 3CGDA 3DA1A 3QJ4A 1CHUA 1Q9IA 5GSNA 3ZYXA 4UDQA 4Z25A 4BJZA 1KF6A 5HYMA 1GSNA 4J33A 1B37A 2YR4A 4UDRA 1YQZA 4H4PA 2FJBA 1YKJA 1TRBA 3CGEA 1Z6LA 2VVMA 3ATRA 2ZBWA 1GV4A 2ARDA 2BS3A 2X3NA 3AE4A 4OPGA 3M13A 3VR8A 5EB4A 1EL9A 1COYA 3QSSA 1LTXR 3NLCA 5BULA 3CNTA 1CL0A 2FBWA 3LB8A 4Z26A 2XFPA 5KOWA 2BK3A 1E1KA 2BK4A 3ICRA 1TYPA 1CC2A 1D5TA 2B9XA 4H2RA 4K5RA 2X50A 4NTDA 1TDNA 1PXCA 1O95A 3NT6A 2R0GA 4UP3A 1F8RA 4J57A 1VG9A 4U8NA 4B63A 1K0JA 3P1WA 3DJEA 3FG2P 4UDPA 2B7SA 2YVGA 1H82A 2J3NA 1D4EA 3UOYA 2XFUA 1ZY8A 1RP0A 2XVHA 4YSXA 3RP7A 2WHDA 4O5UA 1GTEA 3DK9A 4B65A 4JNQA 2AR8A 3HZLA 2CDUA 1E6EA 2A89A 1S3BA 5JCMA 4IA6A 4NEVA 3F8RA 4ZCDA
chains in the Genus database with same CATH superfamily
1DJNA 3BNUA 3KKJA 1RYIA 3SQSA 5JCLA 3BI4A 2CULA 4J36A 3HYVA 3T8QA 4DWDA 3AEFA 2YLWA 1K0IA 3SFDA 2XDOA 3T14A 3V76A 3PG6A 2JK6A 3URHA 4OPUA 1JEHA 2GMHA 2GAHB 3RR1A 2C76A 4YWSA 4NEWA 1LPFA 2B9WA 3IJLA 3KLJA 3EAOA 4B66A 4A35A 1PHHA 3O0HA 2XFOA 4K22A 2W3RA 3B3RA 2JB1A 1F6MA 3EEZA 2YG7A 4OPIA 1LVLA 4EMIA 1BF3A 4WX1A 2GMJA 3N4EA 5LV9A 2HNEA 1EBDA 1N63C 4A65A 4ROPA 1MOKA 3FIMB 1ZP0A 3OZYA 4H50A 3CPHG 4C3YA 1FEBA 2PTWA 1Q1RA 3UJSA 3K7TA 4AP1A 5TR3A 2ACZA 3T2YA 3NHOX 4B67A 1H6VA 3UCLA 2QVHA 3LOVA 1X31B 4K2SA 2IVDA 4EM3A 3ABVA 3OC4A 1KKRA 3EF6A 1CC4A 3BNMA 3GWDA 2QA1A 3NYFA 4YKGA 4FK1C 1NELA 3H8AA 3R07C 4LU6A 5M0ZA 2X8CA 1K4QA 1PDYA 3AYJA 1FFUC 3S61A 2F5ZA 3K30A 4B69A 3ES8A 3GDPA 5FJRA 3TWAA 1NENA 3ISHA 3DFHA 2QQ6A 2X8HA 4N9XA 4Z1YA 4P9SA 1SJCA 4XXGA 1JRYA 5FJUA 4U2LA 3RITA 4JY3A 3L8KA 2XLSA 3STPA 5JRBA 4A6GA 3AEDA 3DJGX 2QAEA 2A8XA 3CGBA 1JROA 4XWZA 3DMEA 2BS4A 5FS9A 3AD9B 3UP4A 1L0VA 3AYLA 2PTZA 2BRYA 5J7XA 1QLBA 3Q4DA 2YG5A 5HY5A 3CPIG 4DGKA 2BXRA 1D7LA 3M12A 2YM1A 4DN1A 1KSUA 3BI5A 3SFEA 4DNAA 1V59A 3PS9A 3DERA 3SJNA 3MUCA 3C96A 2TMDA 3RRAA 3QN3A 3CNSA 2GR1A 1EL8A 2FJAA 4H4WA 3AE8A 3CPJG 2XVEA 3CTYA 3DG7A 2Z5XA 3NK0X 4GFIA 3LZXA 3QVPA 3S5SA 1NG4A 1GNDA 5FMHA 3MKCA 3ETRB 1N4UA 4K1WA 1GOSA 3ZVHA 2BCPA 4JN8A 2V61A 3DG6A 1E1NA 2XH2A 4B1BA 5J60A 2PODA 4CNKA 4B64A 2R0CA 3R1ZA 3GD3A 3IK4A 1TZZA 3E1TA 1H84A 3SR6B 1MXTA 2WPEA 3OP2A 2R9ZA 3AEAA 3NIXA 4II2A 3T6CA 2VZ2A 1VQWA 1P43A 2W0HA 2P3ZA 2C64A 3I6TA 3NG7X 4Y4NA 3QKEA 2P88A 3EANA 3T37A 2WQYA 4KPLA 3DFYA 4CNJA 4ZCWA 1PBBA 2VQ7A 5KXJA 1CBOA 1H2IA 1R0MA 5KVIA 3SXIA 1JOAA 5JCNA 5JCIA 1FHUA 1N62C 5BVAA 3IJQA 2V3BA 3H7VA 2AKZA 2OLAA 3TW9A 1ZKQA 3RP6A 2OLOA 3RP8A 3H8LA 3QVRA 2AAQA 2BACA 4YTPA 2FYMA 4H4RA 4KX6A 2PP3A 1WUEA 2VRMA 2BRAA 1N61C 4IL0A 2C3CA 4Z17A 1N5XA 1EC9A 3V3NA 5DBJA 4M6UA 2X99A 2DW7A 3ZLFA 2OAMA 3AXBA 3CIRA 4RG3A 2WDRA 2V5ZA 4A9WA 4GMEA 4J31A 1NPXA 4EIPA 1DOBA 3U4FA 4U8JA 1OJAA 3LZWA 2HXUA 5EOWA 4E4UA 3KD9A 4KEMA 2FJEA 4M0XA 3VCNA 1MDRA 1GSNA 4UDRA 1ZXIC 2P8BA 1YQZA 4H4PA 1TRBA 3CXBA 2VVMA 3V5CA 4OPGA 3AE4A 3VR8A 3M13A 3AN1A 3CMMA 2FBWA 5BULA 4H2RA 3D9XA 1TDNA 3A7UA 1O95A 4UP3A 4U8NA 3CXOA 3SSZA 3P1WA 2B7SA 3CT2A 3A7RA 2J3NA 2XFUA 3OPSA 3RP7A 3P3BA 2PGWA 1E6EA 5KMSA 3UCDA 1NEKA 3QTPA 2E5AA 3NK1X 2R4JA 3RNMA 2PHHA 2H89A 4I58A 2C3DA 2EQ9A 3ALLA 2BXSA 3P4PA 4X2PA 2BK5A 4OVIA 2Y6QA 3UKAA 1E1MA 1GERA 3HYXA 5FJPA 1REOA 3IHGA 3NVVB 4MKSA 3AYIA 4DX3A 3TJIA 4J2WA 4H4UA 3T4WA 1DJQA 4CCQA 4NNJA 3NTAA 2WDVA 2GGEA 2C67A 4A99A 3BSMA 1JRPA 4IT1A 4KWSA 1EC8A 2C75A 3R11A 3UTFA 4H2PA 2QJNA 4GF7A 2MUCA 2OFJA 4HCLA 1FCDA 3UXLA 3RHAA 4Z44A 3NYCA 4D03A 2RGHA 5U1OA 2AL2A 3UJEA 1FL2A 1Y56A 4K8DA 1CJ3A 4KPRA 1GRFA 1PBEA 3SX6A 3SN1A 1H86A 2MNRA 2B76A 1LQTA 2BA9A 1QJDA 3HRDC 5FS7A 4CY6A 1RSGA 3SZFA 1NAAA 2GL5A 3GMBA 4YTMA 2PPGA 2E1MA 3OZMA 2C4CA 2PGEA 3JSKA 1H7WA 1PJ6A 3LADA 1D4DA 5C2TA 5IPYA 4Z2UA 1S3EA 2V60A 3UJ2A 3FV9A 3FPZA 3ZDNA 1DXLA 2XVIA 5IQ4A 3VFCA 1O5WA 1EBGA 2JB2A 3UTEA 1B4VA 4BV6A 4DXKA 1IJHA 4A6NA 1GEUA 4GIRA 1P48A 3G5RA 4XWRA 4U8MA 2OVLA 2Y6RA 1F3PA 2PTYA 4Z2RA 3I6EA 3AM9A 2XGZA 3GRSA 1YEYA 2I5QA 4H4TA 2FJDA 2AQJA 4H4QA 3DGBA 1R6WA 3FCPA 4NTCA 1TDOA 4H4SA 2R45A 1M6IA 2C72A 2BCGG 3ICTA 2RGOA 1X2GA 2PS2A 2B9YA 1TYTA 4MMWA 3VR9A 2VOUA 2P0IA 2YG4A 2ZC8A 4CY8A 4YSZA 4H4XA 3UJRA 5EU9A 1VG0A 2VQBA 5G5GB 4ZOHB 3N6HA 5M10A 2PSNA 3UKFA 1FEAA 2PCEA 1OJCA 3CGCA 1XPQA 4C5OA 4H2HA 1SJBA 4WCTA 3QSEA 4OPLA 2YR6A 1GRBA 1YQ3A 1GRTA 4U8OA 4G9KA 2C66A 2XLUA 2BABA 3M0OA 2EQ8A 2GV8A 5KNLA 3AEEA 1NHRA 3NVYB 3GDNA 3AEBA 2TPRA 3QSMA 4TM4A 3DDMA 3SY4A 5BRTA 2GGGA 5GRTA 4H2NA 1JU2A 2GR2A 3UOVA 2WBAA 3TJ4A 4NZHA 3SQPA 4G73A 4CBQA 2JAEA 1S7MA 2XLTA 1IYXA 1GPEA 5KMRA 2I0ZA 2YR5A 1FO4A 7ENLA 4HPNA 1VRQB 4U2TA 3ZLHA 1N5WC 3PO7A 1O94A 5J04A 3QFBA 1P2HA 4CCRA 3KPFA 3EUB3 5KRQA 2QJMA 3PFRA 4E5TA 3R9UA 2WEUA 3K7QX 4USRA 3P4QA 4C77A 1PS9A 3NTDA 3UP5A 3AD7B 1L9CA 3L1RA 4U8PA 3NN6X 2B7RA 3CGDA 3T31A 3DA1A 4J3ZA 1Q9IA 1KF6A 5HYMA 4J33A 2FJBA 3BJSA 1YKJA 3CGEA 3ATRA 2PMQA 2ARDA 1ONEA 1EL9A 1COYA 1LTXR 3LB8A 2BK4A 2OX4A 3ICRA 1TYPA 1CC2A 1D5TA 2X50A 4G74A 3CYJA 4NTDA 4G6HA 3AMZA 3NT6A 4J57A 4IZGA 3GYXA 4UDPA 4E4FA 2GDQA 2XVHA 4B65A 3DK9A 2CDUA 5JCMA 3T0KA 3F8RA 3HYWA 3H8IA 3AECA 1KFYA 3OZ2A 3D46A 4IP5A 3NVZB 1TDKA 4MGGA 1BKWA 1JCTA 1UKVG 2WP6A 2OZTA 1PBCA 2YWLA 4YXDA 1MRAA 4IL2A 1KNRA 2XFQA 3AB1A 4YT0A 3K7MX 5JCKA 2UZZA 1PBFA 1D4CA 3TWBA 4GRTA 2E3TA 2WS3A 3CNPA 1P2EA 3ES7A 2HQMA 2Q0LA 1CJCA 4RSLA 2GR0A 4YKFA 3D1CA 3P4SA 4JN9A 1DODA 4OPCA 4JNAA 3AE6A 5G5HB 5KMQA 1PDHA 3TQPA 5BOFA 3ICSA 3NS1B 4F4RA 4Z2TA 1SJDA 3EKGA 3NRNA 4M52A 1JNRA 4OPDA 2YM2A 4EQXA 4U8IA 5ER0A 1VQZA 3Q6JA 2WPFA 4IHCA 1OJDA 2OO6A 2GQWA 3VC5A 1SB3B 4HCDA 3UKQA 3NO1A 3I4KA 2EQ6A 3UKPA 4FX9A 4AP3A 1GREA 1ECQA 4H7UA 1OJ9A 3VC6A 4REKA 3DJDA 5CQFA 1X2HA 5ENLA 1XS2A 3HW2A 3IWAA 3AEGA 1L9EA 4BK3A 2BS2A 5FJTA 5EBKA 3NH3X 1FECA 4JHMA 4ECHA 2YLRA 1MNSA 4KT2A 1YQ4A 2PYXA 5CKUA 4EIQA 4E8GA 2PP1A 3AD8B 3OW1A 1TE6A 3NVWB 1E7PA 1FOHA 4MJWA 3HPFA 3JZUA 3SM8A 1DOCA 3VA8A 5FS6A 2W55A 1KKOA 1NHSA 1WUFA 1QO8A 4BURA 3H70A 4O5QA 3R0UA 4JN7A 1GRHA 3DH9A 1IUWA 3SYIA 1F8WA 2GQFA 3P0WA 4USQA 1N1PA 4IVMB 3ZVHB 3L5OA 3PK7A 4DSGA 1GETA 4U8KA 3GD4A 3MSYA 1NHPA 1CC6A 2GR3A 1PN0A 3CN8A 4H2QA 3T9PA 4A3RA 2OQHA 2YLSA 1DTNA 2OALA 4IA5A 4YSYA 3MQTA 3UOXA 4AT0A 1MO9A 1M64A 3BI2A 1BWCA 1EC7A 2CFYA 1ZOVA 3P9UA 1H81A 2E4GA 3R10A 3ITJA 4HCHA 4DHGA 2Z5YA 4AT2A 2OPJA 2C7GA 3GC2A 4Z24A 1ZMCA 3CK5A 2GSHA 2GH5A 2R46A 1PJ5A 4IP4A 1FHVA 4PAAA 4OCGA 2GRTA 4H83A 2WPCA 3NXLA 3IJIA 5C3JA 2V6OA 2C70A 1MUCA 2XH7A 1XPYA 2BC0A 4IVOB 3AE9A 4A5LA 1GTHA 1XHCA 4G8TA 1E39A 3LJPA 2ZZCA 3H4KA 3WE0A 1IUUA 2ONEA 2OQYA 3TTEA 3KU9A 2PA6A 4HB9A 4NWZA 4HNCA 1F9CA 2Q0KA 3RO6A 2YQUA 3B6DA 3NRZB 3SGLA 3SBFA 2XSXA 4GISA 3UTGA 3R25A 4H4VA 4X9NA 3AE7A 1GXFA 2HZGA 4GYPA 4HA6A 3MZNA 3KUMA 1DOEA 1JRZA 3GD6A 3NFUA 2A87A 2VVLG 4JDRA 4K5SA 2JKCA 2PP0A 3VCCA 3F8DA 3FJ4A 3SZCA 2XH4A 1S2QA 3KVEA 3C4AA 2NVKX 2YVJA 2OA1A 3ALJA 1ZMDA 1BQGA 2WP5A 3B9JB 3BHKA 1B5QA 2CHRA 1H7XA 1IUSA 4U2SA 2CVJA 2DW6A 2WU2A 3PVCA 1CF3A 1KNPA 4E0VA 1YY5A 2WOIA 5IDZA 3DIPA 4J1OA 3RCYA 4BK1A 2GVCA 3UKHA 2AL1A 4BK2A 2GF3A 3UKLA 2QGYA 3Q9TA 5FJOA 3COXA 1V97A 4ICYA 3ZLGA 3NK2X 4X9MA 3VRDB 3JVAA 2GAGB 4B68A 3AE3A 4GCMA 1N4WA 4A7AA 3VQRA 4ZCCA 1JRXA 1GALA 2YLXA 1L8PA 1SEZA 3V4BA 2RDXA 1ZDLA 2XYOA 4D04A 4Y4MA 3QJ4A 5GSNA 1KCZA 4Z25A 4BJZA 1RVKA 1B37A 4DYEA 1Z6LA 2ZBWA 2X3NA 2PU1A 2OG9A 5EB4A 4Z26A 4HNLA 1PXCA 2R0GA 1KN0A 1F8RA 3N6JA 4B63A 2HXTA 3SN4A 3DJEA 2YVGA 1D4EA 1ZY8A 2GGIA 4YSXA 2WHDA 1GTEA 3HZLA 2A89A 4NEVA 4ZCDA 4K7ZA 2YG3A 3AE5A 3FBSA 3PWGA 2QCUA 3NKSA 4G6GA 2X8GA 4ZA0A 3ZVIA 1N60C 1E9IA 2GGHA 3UXKA 2AL2B 4GDEA 1Y56B 3DGHA 1ELSA 1W4XA 2XCGA 1VDVA 1OEPA 3NNEA 4TM1A 3S47A 2R0PA 3GMCA 3IC9A 2WOVA 4GUVA 1GRAA 2ZZ0A 1HYUA 4TM0A 4YTNA 3F8PA 3KA7A 2XLRA 1N4VA 3DEQA 4G7FA 4EM4A 3DK4A 4ENLA 2GB0A 5KMPA 3BHFA 4LIIA 1T3QC 2ZZBA 4TLXA 2OZ3A 3MWCA 4JQ9A 2W54A 2C65A 4AOXA 1LQUA 3U9IA 1WYGA 3V3WA 5BOEA 1L9DA 2GGJA 3B97A 2QA2A 3IHMA 5U63A 4H19A 4E6MA 1NG3A 4OPTA 4GDPA 3DK8A 1GESA 2EQ7A 1CJ4A 3A7AA 2APGA 1CJ2A 5EB5A 1JPMA 4EQRA 2OZ8A 6ENLA 2C73A 1GRGA 3TCSA 2IIDA 2DKHA 3QPEA 1EL7A 1KD0A 1LJ1A 4EMWA 3SZWA 4A6NB 2WP9A 4H4YA 4C74A 1BZLA 1OJTA 1NDAA 1B8SA 3I6DA 2WESA 4HYRA 3AWIA 3S5WA 3NGCX 4CRTA 2YVFA 3ALMA 5BUKA 2XVJA 2WDQA 3GSIA 2YLTA 4U8LA 3ATQA 1W6TA 1VDCA 2JB3A 3NN0X 4GGBA 3C4NA 3NYEA 5HXIA 2QJJA 3FYYA 1E1LA 3UJFA 4ADWA 3D8XA 3G5QA 2VRLA 3AE2A 2IVEA 1TKKA 4TM3A 4FK1A 3BOXA 1KDGA 4YSHA 3ADAB 1Y0PA 4HN8A 5KVHA 1NU5A 4TLZA 3I3LA 2WOWA 2O9ZA 4PABA 1TDEA 1K0LA 3MY9A 1PJ7A 1IUTA 4LA1A 2ZADA 1JNZA 4GGHA 1H83A 3D47A 3DGZA 4ZN0A 3CAWA 3CNJA 1PBDA 2AKMA 2VVLA 2GEWA 1ELIA 1Q1WA 3DJJA 3EPTA 4Z43A 4YWOA 1ZX9A 3GRTA 3QLDA 3CNDA 2NQLA 2W3SA 3VRBA 3AE1A 4RG4A 3VRAA 3IF9A 3ENLA 2QDEA 2WETA 3II4A 1F8SA 4GYPC 3FXGA 1IUXA 1FFVC 1XANA 3REDA 4II3A 2PU0A 5IQ1A 3TOYA 1BGNA 2YG6A 2JBVA 2QDDA 2BC1A 3OTRA 4J34A 3P4RA 4AOSA 4X4JA 2PTXA 4JY2A 2OLNA 2NPXA 4Y4LA 4FP1A 5KOXA 3SN0A 1KSSA 3P93A 4NTEA 2POZA 3V3OA 4FDCB 2H88A 4DSHA 1ZOYA 1SJAA 3THUA 4EQSA 4GAPA 4BJYA 4H4ZA 4C3XA 3UCCA 1PXAA 3DESA 3UKKA 4I59A 1BGJA 1GT8A 3G5SA 4K8GA 2V3AA 2RABA 4TVWA 2WU5A 1RM6B 1NHQA 5FS8A 3UTHA 4TVYA 3GWFA 3GYIA 3Q45A 2FKPA 4IV9A 3LXDA 4H1ZA 4A79A 4EQWA 5HHFA 1IUVA 3VDGA 2Q6UA 3PWIA 3RGTA 3UOZA 1BKHA 3K1GA 4GAVA 3SZ0A 5KWFA 1ZK7A 4APNA 4K2XA 3UGVA 1EL5A 1ONFA 2R4EA 2XVFA 4EMJA 1PDZA 2P8CA 3DG3A 3GYJA 1JDFA 2XLPA 2YLZA 1DNCA 2YAUA 3FVDA 1D7YA 2OKTA 4FI4A 3FMWA 1EBHA 5L46A 1FIQB 4GR1A 2XFNA 2DKIA 3GO2A 1AOGA 2BYBA 2E5VA 4EWJA 3R0KA 1LV0A 1TDFA 5U25A 3V5FA 3QFAA 1S2YA 1PXBA 4J56A 3GY1A 3CB3A 1XDIA 2Q7VA 3JW7A 2XH0A 2RGJA 1CHUA 3ZYXA 4UDQA 1MDLA 2YR4A 1GV4A 2BS3A 3NZGA 3QSSA 3NLCA 3CNTA 1CL0A 5KOWA 2XFPA 2BK3A 1E1KA 2B9XA 4K5RA 2O56A 3N4FA 1VG9A 3H12A 1K0JA 3FG2P 1STZA 3KPKA 3T2KA 1H82A 1JPDX 3UOYA 1RP0A 3T2ZA 4O5UA 4JNQA 2AR8A 4IA6A 1S3BA
chains in the Genus database with same CATH topology
3H8IA 1NEKA 4K7ZA 1DJNA 3AECA 3BNUA 2YG3A 3KKJA 3AE5A 1KFYA 3FBSA 3OZ2A 1RYIA 1TDKA 3NK1X 2R4JA 1BKWA 3RNMA 1UKVG 2WP6A 5JCLA 2PHHA 2H89A 2QCUA 3BI4A 3NKSA 2CULA 4G6GA 1PBCA 2X8GA 4J36A 2YWLA 4YXDA 3HYVA 1KNRA 4I58A 3AEFA 2YLWA 1K0IA 2XFQA 3AB1A 2XDOA 3SFDA 3T14A 4YT0A 2C3DA 2EQ9A 3PG6A 3ALLA 2JK6A 5JCKA 3K7MX 2UZZA 4GDEA 1PBFA 3V76A 3URHA 1D4CA 2BXSA 1Y56B 4OPUA 1JEHA 3DGHA 1W4XA 3P4PA 2XCGA 2GMHA 2GAHB 4GRTA 2BK5A 4OVIA 2C76A 2Y6QA 4NEWA 3UKAA 1LPFA 2B9WA 1E1MA 2WS3A 1GERA 3KLJA 3NNEA 3CNPA 4TM1A 2R0PA 3GMCA 3IC9A 1P2EA 2WOVA 4GUVA 3EAOA 1GRAA 2ZZ0A 1HYUA 4TM0A 4B66A 4YTNA 2HQMA 1PHHA 1CJCA 2Q0LA 3F8PA 3HYXA 3KA7A 4RSLA 2GR0A 2XLRA 1N4VA 3O0HA 4YKFA 1REOA 3D1CA 3P4SA 2XFOA 4K22A 3IHGA 3B3RA 4EM4A 2JB1A 4JN9A 1DODA 3DK4A 1F6MA 2GB0A 4OPCA 4JNAA 3AE6A 5KMPA 3BHFA 4LIIA 5KMQA 2YG7A 1PDHA 4OPIA 1LVLA 4EMIA 1BF3A 3AYIA 3ICSA 4WX1A 4J2WA 4H4UA 2ZZBA 2GMJA 4TLXA 5LV9A 4Z2TA 1DJQA 1EBDA 4CCQA 3NRNA 4JQ9A 4M52A 4NNJA 1JNRA 2C65A 4OPDA 2YM2A 4A65A 4EQXA 4AOXA 1LQUA 3NTAA 2WDVA 1MOKA 3FIMB 1ZP0A 2C67A 4U8IA 5ER0A 4H50A 3Q6JA 3CPHG 4A99A 2WPFA 4C3YA 1OJDA 1FEBA 1Q1RA 2GQWA 1L9DA 2QA2A 3IHMA 3UKQA 2C75A 5U63A 3K7TA 4AP1A 3UTFA 1NG3A 4H2PA 4OPTA 2EQ6A 3UKPA 4FX9A 4AP3A 4GDPA 3DK8A 5TR3A 1GESA 2ACZA 2EQ7A 1CJ4A 1GREA 3T2YA 3NHOX 4GF7A 1H6VA 1OJ9A 4H7UA 4B67A 2APGA 3UCLA 1FCDA 3RHAA 4REKA 3LOVA 4Z44A 3DJDA 1CJ2A 1X31B 5CQFA 5EB5A 4EQRA 3NYCA 4D03A 2IVDA 2RGHA 3IWAA 3AEGA 4EM3A 2C73A 1L9EA 1GRGA 4BK3A 3ABVA 2BS2A 5U1OA 2IIDA 3OC4A 2DKHA 5EBKA 3BNMA 3EF6A 1CC4A 3NH3X 3GWDA 1FL2A 2QA1A 3NYFA 1FECA 1EL7A 1Y56A 4K8DA 4YKGA 4ECHA 1LJ1A 4EMWA 1CJ3A 2YLRA 3SZWA 4KPRA 1YQ4A 4A6NB 1GRFA 4FK1C 1PBEA 2PYXA 5CKUA 1H86A 3SX6A 2WP9A 4EIQA 2B76A 4H4YA 1LQTA 4C74A 1BZLA 2BA9A 1OJTA 1NDAA 1B8SA 1QJDA 3I6DA 2WESA 3AD8B 4LU6A 5M0ZA 2X8CA 1K4QA 5FS7A 3AYJA 3AWIA 3S61A 2F5ZA 1E7PA 1FOHA 4MJWA 3K30A 4CY6A 4B69A 3S5WA 1RSGA 3SZFA 3NGCX 1NAAA 4CRTA 3GDPA 2YVFA 1NENA 3GMBA 4YTMA 3ALMA 5BUKA 2XVJA 2E1MA 1DOCA 3SM8A 2C4CA 3ISHA 2WDQA 2X8HA 3GSIA 4N9XA 5FS6A 2YLTA 4U8LA 1NHSA 3JSKA 1QO8A 4P9SA 4BURA 1H7WA 1PJ6A 3ATQA 4XXGA 3LADA 1VDCA 1D4DA 4O5QA 2JB3A 1JRYA 3NN0X 4U2LA 4JY3A 3L8KA 2XLSA 5C2TA 5IPYA 3C4NA 3NYEA 5HXIA 1GRHA 5JRBA 4Z2UA 1E1LA 1S3EA 2V60A 3DH9A 3AEDA 4ADWA 1IUWA 3DJGX 1F8WA 3D8XA 3SYIA 2GQFA 3G5QA 2VRLA 2QAEA 2A8XA 3AE2A 2IVEA 4USQA 4TM3A 1N1PA 3CGBA 4FK1A 4IVMB 3FPZA 4XWZA 3DMEA 1KDGA 2BS4A 4YSHA 5FS9A 3ADAB 3ZDNA 1Y0PA 3L5OA 1DXLA 2XVIA 5KVHA 3AD9B 5IQ4A 4TLZA 3I3LA 2WOWA 1O5WA 2O9ZA 4PABA 1L0VA 3UP4A 4DSGA 3AYLA 1TDEA 1K0LA 2BRYA 1GETA 1PJ7A 4U8KA 1IUTA 2JB2A 3GD4A 4LA1A 5J7XA 1QLBA 3UTEA 2YG5A 1B4VA 5HY5A 4BV6A 1JNZA 3CPIG 1NHPA 1CC6A 2GR3A 1IJHA 1H83A 4A6NA 4DGKA 1PN0A 1GEUA 2BXRA 3CN8A 4H2QA 1D7LA 3M12A 2YM1A 2YLSA 3G5RA 4XWRA 3DGZA 4ZN0A 2OALA 3CNJA 4IA5A 4U8MA 1PBDA 4YSYA 1KSUA 2Y6RA 1F3PA 3UOXA 4AT0A 4Z2RA 1MO9A 1M64A 2VVLA 2GEWA 1ELIA 3BI2A 1BWCA 1Q1WA 3BI5A 3SFEA 2CFYA 1ZOVA 3P9UA 1H81A 3DJJA 4DNAA 1V59A 3EPTA 2E4GA 3GRSA 3PS9A 3ITJA 4Z43A 4H4TA 2Z5YA 4AT2A 2FJDA 3C96A 2AQJA 2TMDA 4H4QA 4YWOA 1ZX9A 3GRTA 2C7GA 3CNSA 3CNDA 2GR1A 4NTCA 1TDOA 3VRBA 4Z24A 1ZMCA 3AE1A 1EL8A 2FJAA 4H4SA 4H4WA 2R45A 3AE8A 3CPJG 2XVEA 2GH5A 1M6IA 2R46A 4RG4A 1PJ5A 3VRAA 2C72A 4PAAA 2BCGG 3ICTA 3IF9A 3CTYA 2RGOA 4OCGA 2Z5XA 3NK0X 2B9YA 3LZXA 2GRTA 3QVPA 2WPCA 2WETA 3II4A 1F8SA 1TYTA 1IUXA 5C3JA 3VR9A 1NG4A 2V6OA 1GNDA 2C70A 1XANA 5FMHA 3REDA 2VOUA 1N4UA 4II3A 2YG4A 5IQ1A 1GOSA 2BC0A 4CY8A 2BCPA 4YSZA 1BGNA 4IVOB 3AE9A 2YG6A 2JBVA 4A5LA 4H4XA 1GTHA 1XHCA 2V61A 1VG0A 2BC1A 4J34A 3P4RA 4AOSA 1E1NA 1E39A 3LJPA 4B1BA 4X4JA 5J60A 2ZZCA 3H4KA 3WE0A 2VQBA 4CNKA 4B64A 4JY2A 1IUUA 2OLNA 2R0CA 2NPXA 4Y4LA 3GD3A 3KU9A 5KOXA 5M10A 3UKFA 1FEAA 1KSSA 4HB9A 4NWZA 1OJCA 4NTEA 2Q0KA 3E1TA 3V3OA 1H84A 4FDCB 2H88A 3CGCA 1MXTA 2WPEA 4DSHA 2YQUA 1XPQA 1ZOYA 3B6DA 2R9ZA 3SGLA 3AEAA 4EQSA 3NIXA 4GAPA 4BJYA 4C5OA 4II2A 4H4ZA 2VZ2A 3UTGA 4C3XA 4H4VA 1VQWA 4X9NA 2W0HA 1GXFA 3AE7A 2C64A 4WCTA 3QSEA 1PXAA 3NG7X 2YR6A 4OPLA 1GRBA 4Y4NA 3UKKA 4I59A 1BGJA 1GT8A 1YQ3A 3G5SA 1GRTA 2V3AA 3EANA 2RABA 3T37A 4HA6A 2WQYA 4U8OA 2WU5A 1DOEA 4G9KA 1JRZA 2C66A 2XLUA 1NHQA 4CNJA 5FS8A 1PBBA 2EQ8A 2A87A 2BABA 2GV8A 2VQ7A 2VVLG 4JDRA 3M0OA 4K5SA 3HYWA 2JKCA 3UTHA 3AEEA 5KXJA 5KNLA 1NHRA 3GWFA 3GYIA 1CBOA 3GDNA 3F8DA 1H2IA 3SZCA 3AEBA 2TPRA 5KVIA 4IV9A 3SXIA 1S2QA 3QSMA 4TM4A 1JOAA 3LXDA 4A79A 3SY4A 3KVEA 3C4AA 4EQWA 5BRTA 5HHFA 1IUVA 2NVKX 5GRTA 4H2NA 2YVJA 2OA1A 3ALJA 1ZMDA 2Q6UA 5JCNA 3UOZA 2WP5A 5JCIA 1JU2A 2GR2A 3UOVA 2WBAA 4GAVA 3BHKA 1B5QA 3SZ0A 1H7XA 4NZHA 5KWFA 1ZK7A 5BVAA 1IUSA 4U2SA 2V3BA 2CVJA 4APNA 3SQPA 2WU2A 3PVCA 1CF3A 1KNPA 4K2XA 4E0VA 4G73A 1EL5A 1ZKQA 1YY5A 4CBQA 2WOIA 3RP6A 1ONFA 2R4EA 2XVFA 2JAEA 4EMJA 2OLOA 3RP8A 1S7MA 3H8LA 4BK1A 2GVCA 3QVRA 2AAQA 2XLTA 2BACA 3UKHA 1GPEA 5KMRA 4BK2A 2I0ZA 2YR5A 4H4RA 2GF3A 4KX6A 3UKLA 4YTPA 3Q9TA 3COXA 1VRQB 4U2TA 3GYJA 3PO7A 1O94A 2XLPA 2YLZA 4ICYA 2VRMA 1DNCA 2YAUA 2BRAA 3NK2X 1D7YA 4X9MA 3QFBA 2C3CA 1P2HA 3VRDB 4CCRA 3KPFA 2GAGB 3FMWA 5KRQA 3V3NA 4B68A 5L46A 5DBJA 4GR1A 3AE3A 2X99A 3AXBA 2OAMA 2XFNA 2DKIA 4GCMA 3CIRA 4RG3A 2WDRA 3R9UA 2WEUA 1N4WA 1AOGA 3K7QX 4A7AA 3VQRA 2BYBA 2E5VA 2V5ZA 4ZCCA 1JRXA 1LV0A 1TDFA 4A9WA 5U25A 4USRA 1GALA 2YLXA 4J31A 3QFAA 3P4QA 1NPXA 4EIPA 1SEZA 1S2YA 1PXBA 1DOBA 4J56A 1PS9A 4C77A 3NTDA 4U8JA 1OJAA 3LZWA 2XYOA 1ZDLA 4D04A 3UP5A 5EOWA 3AD7B 1L9CA 1XDIA 2Q7VA 3KD9A 3L1RA 4Y4MA 4U8PA 3NN6X 2B7RA 2FJEA 2RGJA 3CGDA 3T31A 3DA1A 3QJ4A 1CHUA 1Q9IA 5GSNA 3ZYXA 4UDQA 4Z25A 4BJZA 1KF6A 5HYMA 1GSNA 4J33A 1B37A 2YR4A 4UDRA 1YQZA 4H4PA 2FJBA 1YKJA 1TRBA 3CGEA 1Z6LA 2VVMA 3ATRA 2ZBWA 1GV4A 2ARDA 2BS3A 2X3NA 3AE4A 4OPGA 3M13A 3VR8A 5EB4A 1EL9A 1COYA 3QSSA 1LTXR 3NLCA 5BULA 3CNTA 1CL0A 2FBWA 3CMMA 3LB8A 4Z26A 2XFPA 5KOWA 2BK3A 1E1KA 2BK4A 3ICRA 1TYPA 1CC2A 1D5TA 2B9XA 4H2RA 3D9XA 4K5RA 2X50A 4G74A 4NTDA 1TDNA 4G6HA 1PXCA 1O95A 3NT6A 2R0GA 1KN0A 1F8RA 4J57A 1VG9A 4UP3A 4U8NA 4B63A 3GYXA 1K0JA 3P1WA 3DJEA 3FG2P 4UDPA 2B7SA 3KPKA 2YVGA 3T2KA 1H82A 2J3NA 1D4EA 3UOYA 2XFUA 1ZY8A 1RP0A 2XVHA 3T2ZA 4YSXA 3RP7A 2WHDA 4O5UA 1GTEA 3DK9A 4B65A 4JNQA 2AR8A 3HZLA 2CDUA 1E6EA 2A89A 1S3BA 5JCMA 4IA6A 5KMSA 3T0KA 4NEVA 3F8RA 4ZCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8I A;  1NEK A;  4K7Z A;  1DJN A;  3AEC A;  3BNU A;  2YG3 A;  3KKJ A;  3AE5 A;  1KFY A;  3FBS A;  3OZ2 A;  1RYI A;  1TDK A;  3NK1 X;  2R4J A;  1BKW A;  3RNM A;  1UKV G;  2WP6 A;  5JCL A;  2PHH A;  2H89 A;  2QCU A;  3BI4 A;  3NKS A;  2CUL A;  1PBC A;  2X8G A;  4J36 A;  2YWL A;  4YXD A;  1KNR A;  4I58 A;  3AEF A;  2YLW A;  1K0I A;  2XFQ A;  3AB1 A;  2XDO A;  3SFD A;  4YT0 A;  2C3D A;  2EQ9 A;  3K7M X;  3ALL A;  2JK6 A;  5JCK A;  4GDE A;  2UZZ A;  3V76 A;  1PBF A;  3URH A;  1D4C A;  2BXS A;  1Y56 B;  4OPU A;  1JEH A;  3DGH A;  1W4X A;  3P4P A;  2XCG A;  2GMH A;  2GAH B;  4GRT A;  2BK5 A;  4OVI A;  2C76 A;  2Y6Q A;  4NEW A;  3UKA A;  1LPF A;  2B9W A;  1E1M A;  2WS3 A;  1GER A;  3KLJ A;  3NNE A;  3CNP A;  4TM1 A;  2R0P A;  3GMC A;  3IC9 A;  1P2E A;  2WOV A;  4GUV A;  3EAO A;  1GRA A;  2ZZ0 A;  1HYU A;  4TM0 A;  4B66 A;  4YTN A;  2HQM A;  1PHH A;  1CJC A;  2Q0L A;  3F8P A;  3KA7 A;  4RSL A;  2GR0 A;  2XLR A;  1N4V A;  3O0H A;  4YKF A;  1REO A;  3D1C A;  3P4S A;  2XFO A;  4K22 A;  3IHG A;  3B3R A;  4EM4 A;  2JB1 A;  4JN9 A;  1DOD A;  3DK4 A;  1F6M A;  2GB0 A;  4OPC A;  4JNA A;  3AE6 A;  3BHF A;  4LII A;  2YG7 A;  1PDH A;  4OPI A;  1LVL A;  4EMI A;  1BF3 A;  3AYI A;  3ICS A;  4WX1 A;  4J2W A;  4H4U A;  2ZZB A;  2GMJ A;  4TLX A;  5LV9 A;  4Z2T A;  1DJQ A;  1EBD A;  4CCQ A;  3NRN A;  4JQ9 A;  4M52 A;  1JNR A;  2C65 A;  4OPD A;  2YM2 A;  4A65 A;  4EQX A;  4AOX A;  1LQU A;  3NTA A;  2WDV A;  1MOK A;  3FIM B;  1ZP0 A;  2C67 A;  4U8I A;  5ER0 A;  4H50 A;  3Q6J A;  3CPH G;  4A99 A;  2WPF A;  4C3Y A;  1OJD A;  1FEB A;  1Q1R A;  2GQW A;  1L9D A;  2QA2 A;  3IHM A;  3UKQ A;  2C75 A;  5U63 A;  3K7T A;  4AP1 A;  3UTF A;  1NG3 A;  4H2P A;  4OPT A;  2EQ6 A;  3UKP A;  4FX9 A;  4AP3 A;  4GDP A;  3DK8 A;  5TR3 A;  1GES A;  2ACZ A;  2EQ7 A;  1CJ4 A;  1GRE A;  3NHO X;  4GF7 A;  1H6V A;  1OJ9 A;  4H7U A;  4B67 A;  2APG A;  3UCL A;  1FCD A;  3RHA A;  4REK A;  3LOV A;  4Z44 A;  3DJD A;  1CJ2 A;  1X31 B;  5CQF A;  5EB5 A;  4EQR A;  3NYC A;  4D03 A;  2IVD A;  2RGH A;  3IWA A;  3AEG A;  4EM3 A;  2C73 A;  1L9E A;  1GRG A;  4BK3 A;  3ABV A;  2BS2 A;  5U1O A;  2IID A;  3OC4 A;  2DKH A;  5EBK A;  3BNM A;  3EF6 A;  1CC4 A;  3NH3 X;  3GWD A;  1FL2 A;  2QA1 A;  3NYF A;  1FEC A;  1EL7 A;  1Y56 A;  4K8D A;  4YKG A;  4ECH A;  1LJ1 A;  4EMW A;  1CJ3 A;  2YLR A;  4KPR A;  1YQ4 A;  4A6N B;  1GRF A;  4FK1 C;  1PBE A;  2PYX A;  5CKU A;  1H86 A;  2WP9 A;  4EIQ A;  2B76 A;  4H4Y A;  1LQT A;  4C74 A;  1BZL A;  2BA9 A;  1OJT A;  1NDA A;  1B8S A;  1QJD A;  3I6D A;  2WES A;  3AD8 B;  4LU6 A;  5M0Z A;  2X8C A;  1K4Q A;  5FS7 A;  3AYJ A;  3AWI A;  3S61 A;  2F5Z A;  1E7P A;  1FOH A;  4MJW A;  3K30 A;  4CY6 A;  4B69 A;  3S5W A;  1RSG A;  3NGC X;  1NAA A;  4CRT A;  3GDP A;  2YVF A;  1NEN A;  3GMB A;  4YTM A;  3ALM A;  5BUK A;  2XVJ A;  2E1M A;  1DOC A;  3SM8 A;  3ISH A;  2WDQ A;  2X8H A;  3GSI A;  4N9X A;  5FS6 A;  2YLT A;  4U8L A;  1NHS A;  3JSK A;  1QO8 A;  4P9S A;  4BUR A;  1H7W A;  1PJ6 A;  3ATQ A;  4XXG A;  3LAD A;  1VDC A;  1D4D A;  4O5Q A;  2JB3 A;  1JRY A;  3NN0 X;  4U2L A;  4JY3 A;  3L8K A;  2XLS A;  5C2T A;  5IPY A;  3C4N A;  3NYE A;  5HXI A;  1GRH A;  4Z2U A;  1E1L A;  1S3E A;  2V60 A;  3DH9 A;  3AED A;  4ADW A;  1IUW A;  3DJG X;  1F8W A;  3D8X A;  2GQF A;  3G5Q A;  2VRL A;  2QAE A;  2A8X A;  3AE2 A;  2IVE A;  4USQ A;  4TM3 A;  1N1P A;  3CGB A;  4FK1 A;  4IVM B;  3FPZ A;  4XWZ A;  3DME A;  1KDG A;  2BS4 A;  4YSH A;  5FS9 A;  3ADA B;  3ZDN A;  1Y0P A;  1DXL A;  2XVI A;  5KVH A;  3AD9 B;  5IQ4 A;  4TLZ A;  3I3L A;  2WOW A;  1O5W A;  2O9Z A;  4PAB A;  1L0V A;  3UP4 A;  4DSG A;  3AYL A;  1TDE A;  1K0L A;  1GET A;  1PJ7 A;  4U8K A;  1IUT A;  2JB2 A;  3GD4 A;  4LA1 A;  5J7X A;  1QLB A;  3UTE A;  2YG5 A;  1B4V A;  5HY5 A;  4BV6 A;  1JNZ A;  3CPI G;  1NHP A;  1CC6 A;  2GR3 A;  1IJH A;  1H83 A;  4A6N A;  4DGK A;  1PN0 A;  1GEU A;  2BXR A;  3CN8 A;  4H2Q A;  1D7L A;  3M12 A;  2YM1 A;  2YLS A;  3G5R A;  4XWR A;  3DGZ A;  4ZN0 A;  2OAL A;  3CNJ A;  4IA5 A;  4U8M A;  1PBD A;  4YSY A;  1KSU A;  2Y6R A;  1F3P A;  3UOX A;  4AT0 A;  4Z2R A;  1MO9 A;  1M64 A;  2VVL A;  2GEW A;  1ELI A;  3BI2 A;  1BWC A;  1Q1W A;  3BI5 A;  3SFE A;  2CFY A;  1ZOV A;  3P9U A;  1H81 A;  3DJJ A;  4DNA A;  1V59 A;  3EPT A;  2E4G A;  3GRS A;  3PS9 A;  3ITJ A;  4Z43 A;  4H4T A;  2Z5Y A;  4AT2 A;  2FJD A;  3C96 A;  2AQJ A;  2TMD A;  4H4Q A;  4YWO A;  1ZX9 A;  3GRT A;  2C7G A;  3CNS A;  3CND A;  2GR1 A;  4NTC A;  1TDO A;  3VRB A;  4Z24 A;  1ZMC A;  3AE1 A;  1EL8 A;  2FJA A;  4H4S A;  4H4W A;  2R45 A;  3AE8 A;  3CPJ G;  2XVE A;  2GH5 A;  1M6I A;  2R46 A;  4RG4 A;  1PJ5 A;  3VRA A;  2C72 A;  4PAA A;  2BCG G;  3ICT A;  3IF9 A;  3CTY A;  2RGO A;  4OCG A;  2Z5X A;  3NK0 X;  2B9Y A;  3LZX A;  2GRT A;  3QVP A;  2WPC A;  2WET A;  3II4 A;  1F8S A;  1TYT A;  1IUX A;  5C3J A;  3VR9 A;  1NG4 A;  2V6O A;  1GND A;  2C70 A;  1XAN A;  5FMH A;  3RED A;  2VOU A;  1N4U A;  2YG4 A;  5IQ1 A;  1GOS A;  2BC0 A;  4CY8 A;  2BCP A;  4YSZ A;  1BGN A;  4IVO B;  3AE9 A;  2YG6 A;  2JBV A;  4A5L A;  4H4X A;  1GTH A;  1XHC A;  2V61 A;  1VG0 A;  2BC1 A;  4J34 A;  3P4R A;  4AOS A;  1E1N A;  1E39 A;  3LJP A;  4B1B A;  4X4J A;  5J60 A;  2ZZC A;  3H4K A;  3WE0 A;  2VQB A;  4CNK A;  4B64 A;  4JY2 A;  1IUU A;  2OLN A;  2R0C A;  2NPX A;  4Y4L A;  3GD3 A;  3KU9 A;  5KOX A;  5M10 A;  3UKF A;  1FEA A;  1KSS A;  4HB9 A;  1OJC A;  4NTE A;  2Q0K A;  3E1T A;  3V3O A;  1H84 A;  4FDC B;  2H88 A;  3CGC A;  1MXT A;  2WPE A;  4DSH A;  2YQU A;  1XPQ A;  1ZOY A;  3B6D A;  2R9Z A;  3SGL A;  3AEA A;  4EQS A;  3NIX A;  4BJY A;  4C5O A;  4H4Z A;  2VZ2 A;  3UTG A;  4C3X A;  4H4V A;  1VQW A;  4X9N A;  2W0H A;  1GXF A;  3AE7 A;  2C64 A;  4WCT A;  3QSE A;  1PXA A;  3NG7 X;  2YR6 A;  4OPL A;  1GRB A;  4Y4N A;  3UKK A;  4I59 A;  1BGJ A;  1GT8 A;  1YQ3 A;  3G5S A;  1GRT A;  2V3A A;  3EAN A;  2RAB A;  3T37 A;  4HA6 A;  2WQY A;  4U8O A;  2WU5 A;  1DOE A;  1JRZ A;  2C66 A;  2XLU A;  1NHQ A;  4CNJ A;  5FS8 A;  1PBB A;  2EQ8 A;  2A87 A;  2BAB A;  2GV8 A;  2VQ7 A;  2VVL G;  4JDR A;  3M0O A;  4K5S A;  2JKC A;  3UTH A;  3AEE A;  5KXJ A;  1NHR A;  3GWF A;  3GYI A;  1CBO A;  3GDN A;  3F8D A;  3AEB A;  2TPR A;  5KVI A;  4IV9 A;  1S2Q A;  3QSM A;  4TM4 A;  1JOA A;  3LXD A;  4A79 A;  3KVE A;  3C4A A;  4EQW A;  5BRT A;  5HHF A;  1IUV A;  2NVK X;  5GRT A;  4H2N A;  2YVJ A;  2OA1 A;  3ALJ A;  1ZMD A;  2Q6U A;  5JCN A;  3UOZ A;  2WP5 A;  5JCI A;  1JU2 A;  2GR2 A;  3UOV A;  2WBA A;  3BHK A;  1B5Q A;  1H7X A;  4NZH A;  5KWF A;  1ZK7 A;  5BVA A;  1IUS A;  4U2S A;  2CVJ A;  2V3B A;  4APN A;  3SQP A;  2WU2 A;  3PVC A;  1CF3 A;  1KNP A;  4K2X A;  4E0V A;  1EL5 A;  1ZKQ A;  1YY5 A;  4CBQ A;  2WOI A;  3RP6 A;  1ONF A;  2R4E A;  2XVF A;  2JAE A;  4EMJ A;  2OLO A;  3RP8 A;  3H8L A;  4BK1 A;  2GVC A;  3QVR A;  2AAQ A;  2XLT A;  2BAC A;  3UKH A;  1GPE A;  4BK2 A;  2I0Z A;  2YR5 A;  4H4R A;  2GF3 A;  4KX6 A;  3UKL A;  4YTP A;  3Q9T A;  3COX A;  1VRQ B;  4U2T A;  3GYJ A;  3PO7 A;  1O94 A;  2XLP A;  2YLZ A;  4ICY A;  2VRM A;  1DNC A;  2YAU A;  3NK2 X;  1D7Y A;  4X9M A;  3QFB A;  2C3C A;  1P2H A;  3VRD B;  4CCR A;  3KPF A;  2GAG B;  3FMW A;  5KRQ A;  3V3N A;  4B68 A;  5L46 A;  5DBJ A;  4GR1 A;  3AE3 A;  2X99 A;  3AXB A;  2OAM A;  2XFN A;  2DKI A;  4GCM A;  3CIR A;  4RG3 A;  2WDR A;  3R9U A;  2WEU A;  1N4W A;  1AOG A;  3K7Q X;  4A7A A;  3VQR A;  2BYB A;  2E5V A;  2V5Z A;  4ZCC A;  1JRX A;  1LV0 A;  1TDF A;  4A9W A;  5U25 A;  4USR A;  1GAL A;  2YLX A;  4J31 A;  3QFA A;  3P4Q A;  1NPX A;  4EIP A;  1SEZ A;  1S2Y A;  1PXB A;  1DOB A;  4J56 A;  1PS9 A;  4C77 A;  3NTD A;  4U8J A;  1OJA A;  3LZW A;  2XYO A;  1ZDL A;  4D04 A;  3UP5 A;  5EOW A;  3AD7 B;  1L9C A;  1XDI A;  2Q7V A;  3KD9 A;  3L1R A;  4Y4M A;  4U8P A;  3NN6 X;  2B7R A;  2FJE A;  2RGJ A;  3CGD A;  3DA1 A;  3QJ4 A;  1CHU A;  1Q9I A;  5GSN A;  3ZYX A;  4UDQ A;  4Z25 A;  4BJZ A;  1KF6 A;  5HYM A;  1GSN A;  4J33 A;  1B37 A;  2YR4 A;  4UDR A;  1YQZ A;  4H4P A;  2FJB A;  1YKJ A;  1TRB A;  3CGE A;  1Z6L A;  2VVM A;  3ATR A;  2ZBW A;  1GV4 A;  2ARD A;  2BS3 A;  2X3N A;  3AE4 A;  4OPG A;  3M13 A;  3VR8 A;  5EB4 A;  1EL9 A;  1COY A;  3QSS A;  1LTX R;  3NLC A;  5BUL A;  3CNT A;  1CL0 A;  2FBW A;  3LB8 A;  4Z26 A;  2XFP A;  5KOW A;  2BK3 A;  1E1K A;  2BK4 A;  3ICR A;  1TYP A;  1CC2 A;  1D5T A;  2B9X A;  4H2R A;  4K5R A;  2X50 A;  4NTD A;  1TDN A;  1PXC A;  1O95 A;  3NT6 A;  2R0G A;  4UP3 A;  1F8R A;  4J57 A;  1VG9 A;  4U8N A;  4B63 A;  1K0J A;  3P1W A;  3DJE A;  3FG2 P;  4UDP A;  2B7S A;  2YVG A;  1H82 A;  2J3N A;  1D4E A;  3UOY A;  2XFU A;  1ZY8 A;  1RP0 A;  2XVH A;  4YSX A;  3RP7 A;  2WHD A;  4O5U A;  1GTE A;  3DK9 A;  4B65 A;  4JNQ A;  2AR8 A;  3HZL A;  2CDU A;  1E6E A;  2A89 A;  1S3B A;  5JCM A;  4IA6 A;  4NEV A;  3F8R A;  4ZCD A; 
#chains in the Genus database with same CATH topology
 1DJN A;  3BNU A;  3KKJ A;  1RYI A;  3SQS A;  5JCL A;  3BI4 A;  2CUL A;  4J36 A;  3HYV A;  3T8Q A;  4DWD A;  3AEF A;  2YLW A;  1K0I A;  3SFD A;  2XDO A;  3T14 A;  3V76 A;  3PG6 A;  2JK6 A;  3URH A;  4OPU A;  1JEH A;  2GMH A;  2GAH B;  3RR1 A;  2C76 A;  4YWS A;  4NEW A;  1LPF A;  2B9W A;  3IJL A;  3KLJ A;  3EAO A;  4B66 A;  4A35 A;  1PHH A;  3O0H A;  2XFO A;  4K22 A;  2W3R A;  3B3R A;  2JB1 A;  1F6M A;  3EEZ A;  2YG7 A;  4OPI A;  1LVL A;  4EMI A;  1BF3 A;  4WX1 A;  2GMJ A;  3N4E A;  5LV9 A;  2HNE A;  1EBD A;  1N63 C;  4A65 A;  4ROP A;  1MOK A;  3FIM B;  1ZP0 A;  3OZY A;  4H50 A;  3CPH G;  4C3Y A;  1FEB A;  2PTW A;  1Q1R A;  3UJS A;  3K7T A;  4AP1 A;  5TR3 A;  2ACZ A;  3T2Y A;  3NHO X;  4B67 A;  1H6V A;  3UCL A;  2QVH A;  3LOV A;  1X31 B;  4K2S A;  2IVD A;  4EM3 A;  3ABV A;  3OC4 A;  1KKR A;  3EF6 A;  1CC4 A;  3BNM A;  3GWD A;  2QA1 A;  3NYF A;  4YKG A;  4FK1 C;  1NEL A;  3H8A A;  3R07 C;  4LU6 A;  5M0Z A;  2X8C A;  1K4Q A;  1PDY A;  3AYJ A;  1FFU C;  3S61 A;  2F5Z A;  3K30 A;  4B69 A;  3ES8 A;  3GDP A;  5FJR A;  3TWA A;  1NEN A;  3ISH A;  3DFH A;  2QQ6 A;  2X8H A;  4N9X A;  4Z1Y A;  4P9S A;  1SJC A;  4XXG A;  1JRY A;  5FJU A;  4U2L A;  3RIT A;  4JY3 A;  3L8K A;  2XLS A;  3STP A;  5JRB A;  4A6G A;  3AED A;  3DJG X;  2QAE A;  2A8X A;  3CGB A;  1JRO A;  4XWZ A;  3DME A;  2BS4 A;  5FS9 A;  3AD9 B;  3UP4 A;  1L0V A;  3AYL A;  2PTZ A;  2BRY A;  5J7X A;  1QLB A;  3Q4D A;  2YG5 A;  5HY5 A;  3CPI G;  4DGK A;  2BXR A;  1D7L A;  3M12 A;  2YM1 A;  4DN1 A;  1KSU A;  3BI5 A;  3SFE A;  4DNA A;  1V59 A;  3PS9 A;  3DER A;  3SJN A;  3MUC A;  3C96 A;  2TMD A;  3RRA A;  3QN3 A;  3CNS A;  2GR1 A;  1EL8 A;  2FJA A;  4H4W A;  3AE8 A;  3CPJ G;  2XVE A;  3CTY A;  3DG7 A;  2Z5X A;  3NK0 X;  4GFI A;  3LZX A;  3QVP A;  3S5S A;  1NG4 A;  1GND A;  5FMH A;  3MKC A;  3ETR B;  1N4U A;  4K1W A;  1GOS A;  3ZVH A;  2BCP A;  4JN8 A;  2V61 A;  3DG6 A;  1E1N A;  2XH2 A;  4B1B A;  5J60 A;  2POD A;  4CNK A;  4B64 A;  2R0C A;  3R1Z A;  3GD3 A;  3IK4 A;  1TZZ A;  3E1T A;  1H84 A;  3SR6 B;  1MXT A;  2WPE A;  3OP2 A;  2R9Z A;  3AEA A;  3NIX A;  4II2 A;  3T6C A;  2VZ2 A;  1VQW A;  1P43 A;  2W0H A;  2P3Z A;  2C64 A;  3I6T A;  3NG7 X;  4Y4N A;  3QKE A;  2P88 A;  3EAN A;  3T37 A;  2WQY A;  4KPL A;  3DFY A;  4CNJ A;  4ZCW A;  1PBB A;  2VQ7 A;  5KXJ A;  1CBO A;  1H2I A;  1R0M A;  5KVI A;  3SXI A;  1JOA A;  5JCN A;  5JCI A;  1FHU A;  1N62 C;  5BVA A;  3IJQ A;  2V3B A;  3H7V A;  2AKZ A;  2OLA A;  3TW9 A;  1ZKQ A;  3RP6 A;  2OLO A;  3RP8 A;  3H8L A;  3QVR A;  2AAQ A;  2BAC A;  4YTP A;  2FYM A;  4H4R A;  4KX6 A;  2PP3 A;  1WUE A;  2VRM A;  2BRA A;  1N61 C;  4IL0 A;  2C3C A;  4Z17 A;  1N5X A;  1EC9 A;  3V3N A;  5DBJ A;  4M6U A;  2X99 A;  2DW7 A;  3ZLF A;  2OAM A;  3AXB A;  3CIR A;  4RG3 A;  2WDR A;  2V5Z A;  4A9W A;  4GME A;  4J31 A;  1NPX A;  4EIP A;  1DOB A;  3U4F A;  4U8J A;  1OJA A;  3LZW A;  2HXU A;  5EOW A;  4E4U A;  3KD9 A;  4KEM A;  2FJE A;  4M0X A;  3VCN A;  1MDR A;  1GSN A;  4UDR A;  1ZXI C;  2P8B A;  1YQZ A;  4H4P A;  1TRB A;  3CXB A;  2VVM A;  3V5C A;  4OPG A;  3AE4 A;  3VR8 A;  3M13 A;  3AN1 A;  3CMM A;  2FBW A;  5BUL A;  4H2R A;  3D9X A;  1TDN A;  3A7U A;  1O95 A;  4UP3 A;  4U8N A;  3CXO A;  3SSZ A;  3P1W A;  2B7S A;  3CT2 A;  3A7R A;  2J3N A;  2XFU A;  3OPS A;  3RP7 A;  3P3B A;  2PGW A;  1E6E A;  5KMS A;  3UCD A;  1NEK A;  3QTP A;  2E5A A;  3NK1 X;  2R4J A;  3RNM A;  2PHH A;  2H89 A;  4I58 A;  2C3D A;  2EQ9 A;  3ALL A;  2BXS A;  3P4P A;  4X2P A;  2BK5 A;  4OVI A;  2Y6Q A;  3UKA A;  1E1M A;  1GER A;  3HYX A;  5FJP A;  1REO A;  3IHG A;  3NVV B;  4MKS A;  3AYI A;  4DX3 A;  3TJI A;  4J2W A;  4H4U A;  3T4W A;  1DJQ A;  4CCQ A;  4NNJ A;  3NTA A;  2WDV A;  2GGE A;  2C67 A;  4A99 A;  3BSM A;  1JRP A;  4IT1 A;  4KWS A;  1EC8 A;  2C75 A;  3R11 A;  3UTF A;  4H2P A;  2QJN A;  4GF7 A;  2MUC A;  2OFJ A;  4HCL A;  1FCD A;  3UXL A;  3RHA A;  4Z44 A;  3NYC A;  4D03 A;  2RGH A;  5U1O A;  2AL2 A;  3UJE A;  1FL2 A;  1Y56 A;  4K8D A;  1CJ3 A;  4KPR A;  1GRF A;  1PBE A;  3SX6 A;  3SN1 A;  1H86 A;  2MNR A;  2B76 A;  1LQT A;  2BA9 A;  1QJD A;  3HRD C;  5FS7 A;  4CY6 A;  1RSG A;  3SZF A;  1NAA A;  2GL5 A;  3GMB A;  4YTM A;  2PPG A;  2E1M A;  3OZM A;  2C4C A;  2PGE A;  3JSK A;  1H7W A;  1PJ6 A;  3LAD A;  1D4D A;  5C2T A;  5IPY A;  4Z2U A;  1S3E A;  2V60 A;  3UJ2 A;  3FV9 A;  3FPZ A;  3ZDN A;  1DXL A;  2XVI A;  5IQ4 A;  3VFC A;  1O5W A;  1EBG A;  2JB2 A;  3UTE A;  1B4V A;  4BV6 A;  4DXK A;  1IJH A;  4A6N A;  1GEU A;  4GIR A;  1P48 A;  3G5R A;  4XWR A;  4U8M A;  2OVL A;  2Y6R A;  1F3P A;  2PTY A;  4Z2R A;  3I6E A;  3AM9 A;  2XGZ A;  3GRS A;  1YEY A;  2I5Q A;  4H4T A;  2FJD A;  2AQJ A;  4H4Q A;  3DGB A;  1R6W A;  3FCP A;  4NTC A;  1TDO A;  4H4S A;  2R45 A;  1M6I A;  2C72 A;  2BCG G;  3ICT A;  2RGO A;  1X2G A;  2PS2 A;  2B9Y A;  1TYT A;  4MMW A;  3VR9 A;  2VOU A;  2P0I A;  2YG4 A;  2ZC8 A;  4CY8 A;  4YSZ A;  4H4X A;  3UJR A;  5EU9 A;  1VG0 A;  2VQB A;  5G5G B;  4ZOH B;  3N6H A;  5M10 A;  2PSN A;  3UKF A;  1FEA A;  2PCE A;  1OJC A;  3CGC A;  1XPQ A;  4C5O A;  4H2H A;  1SJB A;  4WCT A;  3QSE A;  4OPL A;  2YR6 A;  1GRB A;  1YQ3 A;  1GRT A;  4U8O A;  4G9K A;  2C66 A;  2XLU A;  2BAB A;  3M0O A;  2EQ8 A;  2GV8 A;  5KNL A;  3AEE A;  1NHR A;  3NVY B;  3GDN A;  3AEB A;  2TPR A;  3QSM A;  4TM4 A;  3DDM A;  3SY4 A;  5BRT A;  2GGG A;  5GRT A;  4H2N A;  1JU2 A;  2GR2 A;  3UOV A;  2WBA A;  3TJ4 A;  4NZH A;  3SQP A;  4G73 A;  4CBQ A;  2JAE A;  1S7M A;  2XLT A;  1IYX A;  1GPE A;  5KMR A;  2I0Z A;  2YR5 A;  1FO4 A;  7ENL A;  4HPN A;  1VRQ B;  4U2T A;  3ZLH A;  1N5W C;  3PO7 A;  1O94 A;  5J04 A;  3QFB A;  1P2H A;  4CCR A;  3KPF A;  3EUB 3;  5KRQ A;  2QJM A;  3PFR A;  4E5T A;  3R9U A;  2WEU A;  3K7Q X;  4USR A;  3P4Q A;  4C77 A;  1PS9 A;  3NTD A;  3UP5 A;  3AD7 B;  1L9C A;  3L1R A;  4U8P A;  3NN6 X;  2B7R A;  3CGD A;  3T31 A;  3DA1 A;  4J3Z A;  1Q9I A;  1KF6 A;  5HYM A;  4J33 A;  2FJB A;  3BJS A;  1YKJ A;  3CGE A;  3ATR A;  2PMQ A;  2ARD A;  1ONE A;  1EL9 A;  1COY A;  1LTX R;  3LB8 A;  2BK4 A;  2OX4 A;  3ICR A;  1TYP A;  1CC2 A;  1D5T A;  2X50 A;  4G74 A;  3CYJ A;  4NTD A;  4G6H A;  3AMZ A;  3NT6 A;  4J57 A;  4IZG A;  3GYX A;  4UDP A;  4E4F A;  2GDQ A;  2XVH A;  4B65 A;  3DK9 A;  2CDU A;  5JCM A;  3T0K A;  3F8R A;  3HYW A;  3H8I A;  3AEC A;  1KFY A;  3OZ2 A;  3D46 A;  4IP5 A;  3NVZ B;  1TDK A;  4MGG A;  1BKW A;  1JCT A;  1UKV G;  2WP6 A;  2OZT A;  1PBC A;  2YWL A;  4YXD A;  1MRA A;  4IL2 A;  1KNR A;  2XFQ A;  3AB1 A;  4YT0 A;  3K7M X;  5JCK A;  2UZZ A;  1PBF A;  1D4C A;  3TWB A;  4GRT A;  2E3T A;  2WS3 A;  3CNP A;  1P2E A;  3ES7 A;  2HQM A;  2Q0L A;  1CJC A;  4RSL A;  2GR0 A;  4YKF A;  3D1C A;  3P4S A;  4JN9 A;  1DOD A;  4OPC A;  4JNA A;  3AE6 A;  5G5H B;  5KMQ A;  1PDH A;  3TQP A;  5BOF A;  3ICS A;  3NS1 B;  4F4R A;  4Z2T A;  1SJD A;  3EKG A;  3NRN A;  4M52 A;  1JNR A;  4OPD A;  2YM2 A;  4EQX A;  4U8I A;  5ER0 A;  1VQZ A;  3Q6J A;  2WPF A;  4IHC A;  1OJD A;  2OO6 A;  2GQW A;  3VC5 A;  1SB3 B;  4HCD A;  3UKQ A;  3NO1 A;  3I4K A;  2EQ6 A;  3UKP A;  4FX9 A;  4AP3 A;  1GRE A;  1ECQ A;  4H7U A;  1OJ9 A;  3VC6 A;  4REK A;  3DJD A;  5CQF A;  1X2H A;  5ENL A;  1XS2 A;  3HW2 A;  3IWA A;  3AEG A;  1L9E A;  4BK3 A;  2BS2 A;  5FJT A;  5EBK A;  3NH3 X;  1FEC A;  4JHM A;  4ECH A;  2YLR A;  1MNS A;  4KT2 A;  1YQ4 A;  2PYX A;  5CKU A;  4EIQ A;  4E8G A;  2PP1 A;  3AD8 B;  3OW1 A;  1TE6 A;  3NVW B;  1E7P A;  1FOH A;  4MJW A;  3HPF A;  3JZU A;  3SM8 A;  1DOC A;  3VA8 A;  5FS6 A;  2W55 A;  1KKO A;  1NHS A;  1WUF A;  1QO8 A;  4BUR A;  3H70 A;  4O5Q A;  3R0U A;  4JN7 A;  1GRH A;  3DH9 A;  1IUW A;  3SYI A;  1F8W A;  2GQF A;  3P0W A;  4USQ A;  1N1P A;  4IVM B;  3ZVH B;  3L5O A;  3PK7 A;  4DSG A;  1GET A;  4U8K A;  3GD4 A;  3MSY A;  1NHP A;  1CC6 A;  2GR3 A;  1PN0 A;  3CN8 A;  4H2Q A;  3T9P A;  4A3R A;  2OQH A;  2YLS A;  1DTN A;  2OAL A;  4IA5 A;  4YSY A;  3MQT A;  3UOX A;  4AT0 A;  1MO9 A;  1M64 A;  3BI2 A;  1BWC A;  1EC7 A;  2CFY A;  1ZOV A;  3P9U A;  1H81 A;  2E4G A;  3R10 A;  3ITJ A;  4HCH A;  4DHG A;  2Z5Y A;  4AT2 A;  2OPJ A;  2C7G A;  3GC2 A;  4Z24 A;  1ZMC A;  3CK5 A;  2GSH A;  2GH5 A;  2R46 A;  1PJ5 A;  4IP4 A;  1FHV A;  4PAA A;  4OCG A;  2GRT A;  4H83 A;  2WPC A;  3NXL A;  3IJI A;  5C3J A;  2V6O A;  2C70 A;  1MUC A;  2XH7 A;  1XPY A;  2BC0 A;  4IVO B;  3AE9 A;  4A5L A;  1GTH A;  1XHC A;  4G8T A;  1E39 A;  3LJP A;  2ZZC A;  3H4K A;  3WE0 A;  1IUU A;  2ONE A;  2OQY A;  3TTE A;  3KU9 A;  2PA6 A;  4HB9 A;  4NWZ A;  4HNC A;  1F9C A;  2Q0K A;  3RO6 A;  2YQU A;  3B6D A;  3NRZ B;  3SGL A;  3SBF A;  2XSX A;  4GIS A;  3UTG A;  3R25 A;  4H4V A;  4X9N A;  3AE7 A;  1GXF A;  2HZG A;  4GYP A;  4HA6 A;  3MZN A;  3KUM A;  1DOE A;  1JRZ A;  3GD6 A;  3NFU A;  2A87 A;  2VVL G;  4JDR A;  4K5S A;  2JKC A;  2PP0 A;  3VCC A;  3F8D A;  3FJ4 A;  3SZC A;  2XH4 A;  1S2Q A;  3KVE A;  3C4A A;  2NVK X;  2YVJ A;  2OA1 A;  3ALJ A;  1ZMD A;  1BQG A;  2WP5 A;  3B9J B;  3BHK A;  1B5Q A;  2CHR A;  1H7X A;  1IUS A;  4U2S A;  2CVJ A;  2DW6 A;  2WU2 A;  3PVC A;  1CF3 A;  1KNP A;  4E0V A;  1YY5 A;  2WOI A;  5IDZ A;  3DIP A;  4J1O A;  3RCY A;  4BK1 A;  2GVC A;  3UKH A;  2AL1 A;  4BK2 A;  2GF3 A;  3UKL A;  2QGY A;  3Q9T A;  5FJO A;  3COX A;  1V97 A;  4ICY A;  3ZLG A;  3NK2 X;  4X9M A;  3VRD B;  3JVA A;  2GAG B;  4B68 A;  3AE3 A;  4GCM A;  1N4W A;  4A7A A;  3VQR A;  4ZCC A;  1JRX A;  1GAL A;  2YLX A;  1L8P A;  1SEZ A;  3V4B A;  2RDX A;  1ZDL A;  2XYO A;  4D04 A;  4Y4M A;  3QJ4 A;  5GSN A;  1KCZ A;  4Z25 A;  4BJZ A;  1RVK A;  1B37 A;  4DYE A;  1Z6L A;  2ZBW A;  2X3N A;  2PU1 A;  2OG9 A;  5EB4 A;  4Z26 A;  4HNL A;  1PXC A;  2R0G A;  1KN0 A;  1F8R A;  3N6J A;  4B63 A;  2HXT A;  3SN4 A;  3DJE A;  2YVG A;  1D4E A;  1ZY8 A;  2GGI A;  4YSX A;  2WHD A;  1GTE A;  3HZL A;  2A89 A;  4NEV A;  4ZCD A;  4K7Z A;  2YG3 A;  3AE5 A;  3FBS A;  3PWG A;  2QCU A;  3NKS A;  4G6G A;  2X8G A;  4ZA0 A;  3ZVI A;  1N60 C;  1E9I A;  2GGH A;  3UXK A;  2AL2 B;  4GDE A;  1Y56 B;  3DGH A;  1ELS A;  1W4X A;  2XCG A;  1VDV A;  1OEP A;  3NNE A;  4TM1 A;  3S47 A;  2R0P A;  3GMC A;  3IC9 A;  2WOV A;  4GUV A;  1GRA A;  2ZZ0 A;  1HYU A;  4TM0 A;  4YTN A;  3F8P A;  3KA7 A;  2XLR A;  1N4V A;  3DEQ A;  4G7F A;  4EM4 A;  3DK4 A;  4ENL A;  2GB0 A;  5KMP A;  3BHF A;  4LII A;  1T3Q C;  2ZZB A;  4TLX A;  2OZ3 A;  3MWC A;  4JQ9 A;  2W54 A;  2C65 A;  4AOX A;  1LQU A;  3U9I A;  1WYG A;  3V3W A;  5BOE A;  1L9D A;  2GGJ A;  3B97 A;  2QA2 A;  3IHM A;  5U63 A;  4H19 A;  4E6M A;  1NG3 A;  4OPT A;  4GDP A;  3DK8 A;  1GES A;  2EQ7 A;  1CJ4 A;  3A7A A;  2APG A;  1CJ2 A;  5EB5 A;  1JPM A;  4EQR A;  2OZ8 A;  6ENL A;  2C73 A;  1GRG A;  3TCS A;  2IID A;  2DKH A;  3QPE A;  1EL7 A;  1KD0 A;  1LJ1 A;  4EMW A;  3SZW A;  4A6N B;  2WP9 A;  4H4Y A;  4C74 A;  1BZL A;  1OJT A;  1NDA A;  1B8S A;  3I6D A;  2WES A;  4HYR A;  3AWI A;  3S5W A;  3NGC X;  4CRT A;  2YVF A;  3ALM A;  5BUK A;  2XVJ A;  2WDQ A;  3GSI A;  2YLT A;  4U8L A;  3ATQ A;  1W6T A;  1VDC A;  2JB3 A;  3NN0 X;  4GGB A;  3C4N A;  3NYE A;  5HXI A;  2QJJ A;  3FYY A;  1E1L A;  3UJF A;  4ADW A;  3D8X A;  3G5Q A;  2VRL A;  3AE2 A;  2IVE A;  1TKK A;  4TM3 A;  4FK1 A;  3BOX A;  1KDG A;  4YSH A;  3ADA B;  1Y0P A;  4HN8 A;  5KVH A;  1NU5 A;  4TLZ A;  3I3L A;  2WOW A;  2O9Z A;  4PAB A;  1TDE A;  1K0L A;  3MY9 A;  1PJ7 A;  1IUT A;  4LA1 A;  2ZAD A;  1JNZ A;  4GGH A;  1H83 A;  3D47 A;  3DGZ A;  4ZN0 A;  3CAW A;  3CNJ A;  1PBD A;  2AKM A;  2VVL A;  2GEW A;  1ELI A;  1Q1W A;  3DJJ A;  3EPT A;  4Z43 A;  4YWO A;  1ZX9 A;  3GRT A;  3QLD A;  3CND A;  2NQL A;  2W3S A;  3VRB A;  3AE1 A;  4RG4 A;  3VRA A;  3IF9 A;  3ENL A;  2QDE A;  2WET A;  3II4 A;  1F8S A;  4GYP C;  3FXG A;  1IUX A;  1FFV C;  1XAN A;  3RED A;  4II3 A;  2PU0 A;  5IQ1 A;  3TOY A;  1BGN A;  2YG6 A;  2JBV A;  2QDD A;  2BC1 A;  3OTR A;  4J34 A;  3P4R A;  4AOS A;  4X4J A;  2PTX A;  4JY2 A;  2OLN A;  2NPX A;  4Y4L A;  4FP1 A;  5KOX A;  3SN0 A;  1KSS A;  3P93 A;  4NTE A;  2POZ A;  3V3O A;  4FDC B;  2H88 A;  4DSH A;  1ZOY A;  1SJA A;  3THU A;  4EQS A;  4GAP A;  4BJY A;  4H4Z A;  4C3X A;  3UCC A;  1PXA A;  3DES A;  3UKK A;  4I59 A;  1BGJ A;  1GT8 A;  3G5S A;  4K8G A;  2V3A A;  2RAB A;  4TVW A;  2WU5 A;  1RM6 B;  1NHQ A;  5FS8 A;  3UTH A;  4TVY A;  3GWF A;  3GYI A;  3Q45 A;  2FKP A;  4IV9 A;  3LXD A;  4H1Z A;  4A79 A;  4EQW A;  5HHF A;  1IUV A;  3VDG A;  2Q6U A;  3PWI A;  3RGT A;  3UOZ A;  1BKH A;  3K1G A;  4GAV A;  3SZ0 A;  5KWF A;  1ZK7 A;  4APN A;  4K2X A;  3UGV A;  1EL5 A;  1ONF A;  2R4E A;  2XVF A;  4EMJ A;  1PDZ A;  2P8C A;  3DG3 A;  3GYJ A;  1JDF A;  2XLP A;  2YLZ A;  1DNC A;  2YAU A;  3FVD A;  1D7Y A;  2OKT A;  4FI4 A;  3FMW A;  1EBH A;  5L46 A;  1FIQ B;  4GR1 A;  2XFN A;  2DKI A;  3GO2 A;  1AOG A;  2BYB A;  2E5V A;  4EWJ A;  3R0K A;  1LV0 A;  1TDF A;  5U25 A;  3V5F A;  3QFA A;  1S2Y A;  1PXB A;  4J56 A;  3GY1 A;  3CB3 A;  1XDI A;  2Q7V A;  3JW7 A;  2XH0 A;  2RGJ A;  1CHU A;  3ZYX A;  4UDQ A;  1MDL A;  2YR4 A;  1GV4 A;  2BS3 A;  3NZG A;  3QSS A;  3NLC A;  3CNT A;  1CL0 A;  5KOW A;  2XFP A;  2BK3 A;  1E1K A;  2B9X A;  4K5R A;  2O56 A;  3N4F A;  1VG9 A;  3H12 A;  1K0J A;  3FG2 P;  1STZ A;  3KPK A;  3T2K A;  1H82 A;  1JPD X;  3UOY A;  1RP0 A;  3T2Z A;  4O5U A;  4JNQ A;  2AR8 A;  4IA6 A;  1S3B A; 
#chains in the Genus database with same CATH homology
 3H8I A;  1NEK A;  4K7Z A;  1DJN A;  3AEC A;  3BNU A;  2YG3 A;  3KKJ A;  3AE5 A;  1KFY A;  3FBS A;  3OZ2 A;  1RYI A;  1TDK A;  3NK1 X;  2R4J A;  1BKW A;  3RNM A;  1UKV G;  2WP6 A;  5JCL A;  2PHH A;  2H89 A;  2QCU A;  3BI4 A;  3NKS A;  2CUL A;  4G6G A;  1PBC A;  2X8G A;  4J36 A;  2YWL A;  4YXD A;  3HYV A;  1KNR A;  4I58 A;  3AEF A;  2YLW A;  1K0I A;  2XFQ A;  3AB1 A;  2XDO A;  3SFD A;  3T14 A;  4YT0 A;  2C3D A;  2EQ9 A;  3PG6 A;  3ALL A;  2JK6 A;  5JCK A;  3K7M X;  2UZZ A;  4GDE A;  1PBF A;  3V76 A;  3URH A;  1D4C A;  2BXS A;  1Y56 B;  4OPU A;  1JEH A;  3DGH A;  1W4X A;  3P4P A;  2XCG A;  2GMH A;  2GAH B;  4GRT A;  2BK5 A;  4OVI A;  2C76 A;  2Y6Q A;  4NEW A;  3UKA A;  1LPF A;  2B9W A;  1E1M A;  2WS3 A;  1GER A;  3KLJ A;  3NNE A;  3CNP A;  4TM1 A;  2R0P A;  3GMC A;  3IC9 A;  1P2E A;  2WOV A;  4GUV A;  3EAO A;  1GRA A;  2ZZ0 A;  1HYU A;  4TM0 A;  4B66 A;  4YTN A;  2HQM A;  1PHH A;  1CJC A;  2Q0L A;  3F8P A;  3HYX A;  3KA7 A;  4RSL A;  2GR0 A;  2XLR A;  1N4V A;  3O0H A;  4YKF A;  1REO A;  3D1C A;  3P4S A;  2XFO A;  4K22 A;  3IHG A;  3B3R A;  4EM4 A;  2JB1 A;  4JN9 A;  1DOD A;  3DK4 A;  1F6M A;  2GB0 A;  4OPC A;  4JNA A;  3AE6 A;  5KMP A;  3BHF A;  4LII A;  5KMQ A;  2YG7 A;  1PDH A;  4OPI A;  1LVL A;  4EMI A;  1BF3 A;  3AYI A;  3ICS A;  4WX1 A;  4J2W A;  4H4U A;  2ZZB A;  2GMJ A;  4TLX A;  5LV9 A;  4Z2T A;  1DJQ A;  1EBD A;  4CCQ A;  3NRN A;  4JQ9 A;  4M52 A;  4NNJ A;  1JNR A;  2C65 A;  4OPD A;  2YM2 A;  4A65 A;  4EQX A;  4AOX A;  1LQU A;  3NTA A;  2WDV A;  1MOK A;  3FIM B;  1ZP0 A;  2C67 A;  4U8I A;  5ER0 A;  4H50 A;  3Q6J A;  3CPH G;  4A99 A;  2WPF A;  4C3Y A;  1OJD A;  1FEB A;  1Q1R A;  2GQW A;  1L9D A;  2QA2 A;  3IHM A;  3UKQ A;  2C75 A;  5U63 A;  3K7T A;  4AP1 A;  3UTF A;  1NG3 A;  4H2P A;  4OPT A;  2EQ6 A;  3UKP A;  4FX9 A;  4AP3 A;  4GDP A;  3DK8 A;  5TR3 A;  1GES A;  2ACZ A;  2EQ7 A;  1CJ4 A;  1GRE A;  3T2Y A;  3NHO X;  4GF7 A;  1H6V A;  1OJ9 A;  4H7U A;  4B67 A;  2APG A;  3UCL A;  1FCD A;  3RHA A;  4REK A;  3LOV A;  4Z44 A;  3DJD A;  1CJ2 A;  1X31 B;  5CQF A;  5EB5 A;  4EQR A;  3NYC A;  4D03 A;  2IVD A;  2RGH A;  3IWA A;  3AEG A;  4EM3 A;  2C73 A;  1L9E A;  1GRG A;  4BK3 A;  3ABV A;  2BS2 A;  5U1O A;  2IID A;  3OC4 A;  2DKH A;  5EBK A;  3BNM A;  3EF6 A;  1CC4 A;  3NH3 X;  3GWD A;  1FL2 A;  2QA1 A;  3NYF A;  1FEC A;  1EL7 A;  1Y56 A;  4K8D A;  4YKG A;  4ECH A;  1LJ1 A;  4EMW A;  1CJ3 A;  2YLR A;  3SZW A;  4KPR A;  1YQ4 A;  4A6N B;  1GRF A;  4FK1 C;  1PBE A;  2PYX A;  5CKU A;  1H86 A;  3SX6 A;  2WP9 A;  4EIQ A;  2B76 A;  4H4Y A;  1LQT A;  4C74 A;  1BZL A;  2BA9 A;  1OJT A;  1NDA A;  1B8S A;  1QJD A;  3I6D A;  2WES A;  3AD8 B;  4LU6 A;  5M0Z A;  2X8C A;  1K4Q A;  5FS7 A;  3AYJ A;  3AWI A;  3S61 A;  2F5Z A;  1E7P A;  1FOH A;  4MJW A;  3K30 A;  4CY6 A;  4B69 A;  3S5W A;  1RSG A;  3SZF A;  3NGC X;  1NAA A;  4CRT A;  3GDP A;  2YVF A;  1NEN A;  3GMB A;  4YTM A;  3ALM A;  5BUK A;  2XVJ A;  2E1M A;  1DOC A;  3SM8 A;  2C4C A;  3ISH A;  2WDQ A;  2X8H A;  3GSI A;  4N9X A;  5FS6 A;  2YLT A;  4U8L A;  1NHS A;  3JSK A;  1QO8 A;  4P9S A;  4BUR A;  1H7W A;  1PJ6 A;  3ATQ A;  4XXG A;  3LAD A;  1VDC A;  1D4D A;  4O5Q A;  2JB3 A;  1JRY A;  3NN0 X;  4U2L A;  4JY3 A;  3L8K A;  2XLS A;  5C2T A;  5IPY A;  3C4N A;  3NYE A;  5HXI A;  1GRH A;  5JRB A;  4Z2U A;  1E1L A;  1S3E A;  2V60 A;  3DH9 A;  3AED A;  4ADW A;  1IUW A;  3DJG X;  1F8W A;  3D8X A;  3SYI A;  2GQF A;  3G5Q A;  2VRL A;  2QAE A;  2A8X A;  3AE2 A;  2IVE A;  4USQ A;  4TM3 A;  1N1P A;  3CGB A;  4FK1 A;  4IVM B;  3FPZ A;  4XWZ A;  3DME A;  1KDG A;  2BS4 A;  4YSH A;  5FS9 A;  3ADA B;  3ZDN A;  1Y0P A;  3L5O A;  1DXL A;  2XVI A;  5KVH A;  3AD9 B;  5IQ4 A;  4TLZ A;  3I3L A;  2WOW A;  1O5W A;  2O9Z A;  4PAB A;  1L0V A;  3UP4 A;  4DSG A;  3AYL A;  1TDE A;  1K0L A;  2BRY A;  1GET A;  1PJ7 A;  4U8K A;  1IUT A;  2JB2 A;  3GD4 A;  4LA1 A;  5J7X A;  1QLB A;  3UTE A;  2YG5 A;  1B4V A;  5HY5 A;  4BV6 A;  1JNZ A;  3CPI G;  1NHP A;  1CC6 A;  2GR3 A;  1IJH A;  1H83 A;  4A6N A;  4DGK A;  1PN0 A;  1GEU A;  2BXR A;  3CN8 A;  4H2Q A;  1D7L A;  3M12 A;  2YM1 A;  2YLS A;  3G5R A;  4XWR A;  3DGZ A;  4ZN0 A;  2OAL A;  3CNJ A;  4IA5 A;  4U8M A;  1PBD A;  4YSY A;  1KSU A;  2Y6R A;  1F3P A;  3UOX A;  4AT0 A;  4Z2R A;  1MO9 A;  1M64 A;  2VVL A;  2GEW A;  1ELI A;  3BI2 A;  1BWC A;  1Q1W A;  3BI5 A;  3SFE A;  2CFY A;  1ZOV A;  3P9U A;  1H81 A;  3DJJ A;  4DNA A;  1V59 A;  3EPT A;  2E4G A;  3GRS A;  3PS9 A;  3ITJ A;  4Z43 A;  4H4T A;  2Z5Y A;  4AT2 A;  2FJD A;  3C96 A;  2AQJ A;  2TMD A;  4H4Q A;  4YWO A;  1ZX9 A;  3GRT A;  2C7G A;  3CNS A;  3CND A;  2GR1 A;  4NTC A;  1TDO A;  3VRB A;  4Z24 A;  1ZMC A;  3AE1 A;  1EL8 A;  2FJA A;  4H4S A;  4H4W A;  2R45 A;  3AE8 A;  3CPJ G;  2XVE A;  2GH5 A;  1M6I A;  2R46 A;  4RG4 A;  1PJ5 A;  3VRA A;  2C72 A;  4PAA A;  2BCG G;  3ICT A;  3IF9 A;  3CTY A;  2RGO A;  4OCG A;  2Z5X A;  3NK0 X;  2B9Y A;  3LZX A;  2GRT A;  3QVP A;  2WPC A;  2WET A;  3II4 A;  1F8S A;  1TYT A;  1IUX A;  5C3J A;  3VR9 A;  1NG4 A;  2V6O A;  1GND A;  2C70 A;  1XAN A;  5FMH A;  3RED A;  2VOU A;  1N4U A;  4II3 A;  2YG4 A;  5IQ1 A;  1GOS A;  2BC0 A;  4CY8 A;  2BCP A;  4YSZ A;  1BGN A;  4IVO B;  3AE9 A;  2YG6 A;  2JBV A;  4A5L A;  4H4X A;  1GTH A;  1XHC A;  2V61 A;  1VG0 A;  2BC1 A;  4J34 A;  3P4R A;  4AOS A;  1E1N A;  1E39 A;  3LJP A;  4B1B A;  4X4J A;  5J60 A;  2ZZC A;  3H4K A;  3WE0 A;  2VQB A;  4CNK A;  4B64 A;  4JY2 A;  1IUU A;  2OLN A;  2R0C A;  2NPX A;  4Y4L A;  3GD3 A;  3KU9 A;  5KOX A;  5M10 A;  3UKF A;  1FEA A;  1KSS A;  4HB9 A;  4NWZ A;  1OJC A;  4NTE A;  2Q0K A;  3E1T A;  3V3O A;  1H84 A;  4FDC B;  2H88 A;  3CGC A;  1MXT A;  2WPE A;  4DSH A;  2YQU A;  1XPQ A;  1ZOY A;  3B6D A;  2R9Z A;  3SGL A;  3AEA A;  4EQS A;  3NIX A;  4GAP A;  4BJY A;  4C5O A;  4II2 A;  4H4Z A;  2VZ2 A;  3UTG A;  4C3X A;  4H4V A;  1VQW A;  4X9N A;  2W0H A;  1GXF A;  3AE7 A;  2C64 A;  4WCT A;  3QSE A;  1PXA A;  3NG7 X;  2YR6 A;  4OPL A;  1GRB A;  4Y4N A;  3UKK A;  4I59 A;  1BGJ A;  1GT8 A;  1YQ3 A;  3G5S A;  1GRT A;  2V3A A;  3EAN A;  2RAB A;  3T37 A;  4HA6 A;  2WQY A;  4U8O A;  2WU5 A;  1DOE A;  4G9K A;  1JRZ A;  2C66 A;  2XLU A;  1NHQ A;  4CNJ A;  5FS8 A;  1PBB A;  2EQ8 A;  2A87 A;  2BAB A;  2GV8 A;  2VQ7 A;  2VVL G;  4JDR A;  3M0O A;  4K5S A;  3HYW A;  2JKC A;  3UTH A;  3AEE A;  5KXJ A;  5KNL A;  1NHR A;  3GWF A;  3GYI A;  1CBO A;  3GDN A;  3F8D A;  1H2I A;  3SZC A;  3AEB A;  2TPR A;  5KVI A;  4IV9 A;  3SXI A;  1S2Q A;  3QSM A;  4TM4 A;  1JOA A;  3LXD A;  4A79 A;  3SY4 A;  3KVE A;  3C4A A;  4EQW A;  5BRT A;  5HHF A;  1IUV A;  2NVK X;  5GRT A;  4H2N A;  2YVJ A;  2OA1 A;  3ALJ A;  1ZMD A;  2Q6U A;  5JCN A;  3UOZ A;  2WP5 A;  5JCI A;  1JU2 A;  2GR2 A;  3UOV A;  2WBA A;  4GAV A;  3BHK A;  1B5Q A;  3SZ0 A;  1H7X A;  4NZH A;  5KWF A;  1ZK7 A;  5BVA A;  1IUS A;  4U2S A;  2V3B A;  2CVJ A;  4APN A;  3SQP A;  2WU2 A;  3PVC A;  1CF3 A;  1KNP A;  4K2X A;  4E0V A;  4G73 A;  1EL5 A;  1ZKQ A;  1YY5 A;  4CBQ A;  2WOI A;  3RP6 A;  1ONF A;  2R4E A;  2XVF A;  2JAE A;  4EMJ A;  2OLO A;  3RP8 A;  1S7M A;  3H8L A;  4BK1 A;  2GVC A;  3QVR A;  2AAQ A;  2XLT A;  2BAC A;  3UKH A;  1GPE A;  5KMR A;  4BK2 A;  2I0Z A;  2YR5 A;  4H4R A;  2GF3 A;  4KX6 A;  3UKL A;  4YTP A;  3Q9T A;  3COX A;  1VRQ B;  4U2T A;  3GYJ A;  3PO7 A;  1O94 A;  2XLP A;  2YLZ A;  4ICY A;  2VRM A;  1DNC A;  2YAU A;  2BRA A;  3NK2 X;  1D7Y A;  4X9M A;  3QFB A;  2C3C A;  1P2H A;  3VRD B;  4CCR A;  3KPF A;  2GAG B;  3FMW A;  5KRQ A;  3V3N A;  4B68 A;  5L46 A;  5DBJ A;  4GR1 A;  3AE3 A;  2X99 A;  3AXB A;  2OAM A;  2XFN A;  2DKI A;  4GCM A;  3CIR A;  4RG3 A;  2WDR A;  3R9U A;  2WEU A;  1N4W A;  1AOG A;  3K7Q X;  4A7A A;  3VQR A;  2BYB A;  2E5V A;  2V5Z A;  4ZCC A;  1JRX A;  1LV0 A;  1TDF A;  4A9W A;  5U25 A;  4USR A;  1GAL A;  2YLX A;  4J31 A;  3QFA A;  3P4Q A;  1NPX A;  4EIP A;  1SEZ A;  1S2Y A;  1PXB A;  1DOB A;  4J56 A;  1PS9 A;  4C77 A;  3NTD A;  4U8J A;  1OJA A;  3LZW A;  2XYO A;  1ZDL A;  4D04 A;  3UP5 A;  5EOW A;  3AD7 B;  1L9C A;  1XDI A;  2Q7V A;  3KD9 A;  3L1R A;  4Y4M A;  4U8P A;  3NN6 X;  2B7R A;  2FJE A;  2RGJ A;  3CGD A;  3T31 A;  3DA1 A;  3QJ4 A;  1CHU A;  1Q9I A;  5GSN A;  3ZYX A;  4UDQ A;  4Z25 A;  4BJZ A;  1KF6 A;  5HYM A;  1GSN A;  4J33 A;  1B37 A;  2YR4 A;  4UDR A;  1YQZ A;  4H4P A;  2FJB A;  1YKJ A;  1TRB A;  3CGE A;  1Z6L A;  2VVM A;  3ATR A;  2ZBW A;  1GV4 A;  2ARD A;  2BS3 A;  2X3N A;  3AE4 A;  4OPG A;  3M13 A;  3VR8 A;  5EB4 A;  1EL9 A;  1COY A;  3QSS A;  1LTX R;  3NLC A;  5BUL A;  3CNT A;  1CL0 A;  2FBW A;  3CMM A;  3LB8 A;  4Z26 A;  2XFP A;  5KOW A;  2BK3 A;  1E1K A;  2BK4 A;  3ICR A;  1TYP A;  1CC2 A;  1D5T A;  2B9X A;  4H2R A;  3D9X A;  4K5R A;  2X50 A;  4G74 A;  4NTD A;  1TDN A;  4G6H A;  1PXC A;  1O95 A;  3NT6 A;  2R0G A;  1KN0 A;  1F8R A;  4J57 A;  1VG9 A;  4UP3 A;  4U8N A;  4B63 A;  3GYX A;  1K0J A;  3P1W A;  3DJE A;  3FG2 P;  4UDP A;  2B7S A;  3KPK A;  2YVG A;  3T2K A;  1H82 A;  2J3N A;  1D4E A;  3UOY A;  2XFU A;  1ZY8 A;  1RP0 A;  2XVH A;  3T2Z A;  4YSX A;  3RP7 A;  2WHD A;  4O5U A;  1GTE A;  3DK9 A;  4B65 A;  4JNQ A;  2AR8 A;  3HZL A;  2CDU A;  1E6E A;  2A89 A;  1S3B A;  5JCM A;  4IA6 A;  5KMS A;  3T0K A;  4NEV A;  3F8R A;  4ZCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...