3DGHA

Crystal structure of drosophila thioredoxin reductase, c-terminal 8-residue truncation
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
477
structure length
477
Chain Sequence
SYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDDKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKDKIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Drosophila Thioredoxin Reductase, C-terminal 8-residue truncation
rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase 1, mitochondrial
total genus 155
structure length 477
sequence length 477
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF00890 FAD_binding_2 FAD binding domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3dghA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dghA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dghA02
1VDCA 4WX1A 5U63A 2YG6A 2XYOA 2JK6A 1GERA 3BI2A 3NK1X 4AP1A 5KOXA 1E1MA 1GRTA 1ZMDA 4ZN0A 2ACZA 4J31A 2XFUA 2GMJA 1EL9A 5HXIA 4H4UA 4YTPA 2WOVA 3AE4A 3Q6JA 3CIRA 2Q0KA 4GR1A 1FEBA 1N4VA 2YG3A 3BI5A 2VRLA 4C3XA 2W0HA 1TDEA 3IHGA 2VVLA 3H8LA 3I6DA 2X3NA 2JB3A 1ZOVA 4H4WA 2VOUA 3E1TA 3UOXA 1KSUA 1UKVG 4YSYA 1PXAA 3DK4A 1JRZA 4B66A 1B5QA 2EQ7A 2GV8A 2BK4A 3ABVA 3R9UA 4MJWA 4E0VA 3AWIA 4YT0A 1NG4A 1H6VA 4YKFA 2YR5A 4AT2A 1GTEA 2OA1A 3ADAB 3UKPA 4BK3A 1XDIA 3QSEA 3FPZA 1DODA 3C4AA 4UDPA 1GALA 1YQZA 1S2YA 2XFQA 3GD4A 3DK8A 3AE1A 3NYFA 2B76A 3CNTA 3QJ4A 3KA7A 2XVIA 5J7XA 2XLSA 3P4PA 4CCQA 5M10A 5GRTA 1PBFA 5CQFA 3KLJA 1FECA 2DKIA 2YLZA 4IA6A 3AE8A 3NGCX 1N4UA 1GRHA 4H4PA 4BURA 1TYTA 1K0LA 1E39A 3AYIA 1NG3A 5HY5A 4NEWA 5JCMA 4EQSA 3ALMA 4EMJA 3C4NA 4I58A 4IVOB 2WOIA 1PBDA 1W4XA 1CJCA 3VR9A 1N4WA 3AYLA 3NLCA 5BUKA 1K4QA 1S3BA 2YLXA 1JRXA 1MO9A 3H8IA 2A87A 2YQUA 5KXJA 1JOAA 3UKQA 1ZK7A 3B3RA 3NTDA 3EPTA 2UZZA 4H4ZA 1NDAA 2IVEA 4U8MA 2B7SA 3AE2A 3QVRA 1DJNA 4GDEA 5BRTA 1S2QA 1DJQA 3IHMA 2GB0A 4B64A 4X9MA 2YLSA 2V3BA 3BNUA 2C67A 5JCNA 1ELIA 4CBQA 2AQJA 2VRMA 2A89A 2WOWA 3LJPA 3VRDB 1CJ3A 4AOSA 2YR6A 1EL5A 2X50A 3V3OA 1NAAA 5KVHA 2B9YA 1CC6A 1NHQA 2EQ8A 1FCDA 3G5SA 4K8DA 1Q1RA 3NYCA 1QJDA 2O9ZA 4FK1C 2BK5A 1RSGA 4Z2TA 2YLWA 3ATRA 2C3CA 3VQRA 2BC1A 1RP0A 4I59A 1CJ2A 1H81A 4C3YA 3EAOA 4TLZA 2BS2A 1F8SA 4RG4A 1B37A 3DK9A 2BC0A 1NHPA 4EM4A 4EMIA 4O5UA 1CL0A 3QFAA 4Z43A 1GNDA 1PJ7A 3AB1A 5KWFA 3DJGX 2Y6QA 4GF7A 3M12A 1DXLA 4JQ9A 5EB5A 5KRQA 2GQWA 1IUTA 3GD3A 3UKLA 3UP5A 3S5WA 5LV9A 2FBWA 4A79A 4BJZA 2C7GA 3VR8A 1LQUA 5FS8A 3ZYXA 1GEUA 1CC4A 1RYIA 3BNMA 4REKA 3SFEA 2TMDA 3QFBA 5FS9A 2CDUA 4JNAA 1B4VA 1OJ9A 1SEZA 2JB2A 3QVPA 2QAEA 1LTXR 2GAHB 4O5QA 1D4DA 1XHCA 1CC2A 4OVIA 4Z24A 3SQPA 4EIPA 1OJAA 1DOEA 3EF6A 1GOSA 1PXCA 1XPQA 2Q6UA 4K5RA 4OPIA 4H2RA 4LA1A 1OJCA 1GSNA 3NN0X 3NNEA 4B67A 3VRAA 4DSHA 4YSZA 1N1PA 2VZ2A 3IF9A 5BVAA 3D8XA 3ALJA 3ICRA 1COYA 1H86A 3GWDA 3IWAA 3PVCA 3G5QA 2R0GA 3JSKA 1FEAA 2CFYA 1JNZA 3KU9A 5CKUA 5FMHA 2ARDA 2BACA 4FK1A 1E1KA 2IIDA 1CHUA 4A6NB 4BV6A 4HA6A 3SM8A 3AECA 1PS9A 5C3JA 1VG9A 1IUSA 4CCRA 2B7RA 1LV0A 3HZLA 4CY6A 4H50A 2C75A 3LOVA 1EBDA 3AD7B 1KDGA 4U8LA 1TDFA 3M0OA 2FJEA 4IVMB 3UTFA 3AD9B 4RSLA 3L8KA 4H4QA 1D4EA 2QA1A 3AE5A 3DGHA 4FX9A 1E6EA 2C64A 3CNSA 4BJYA 4YSHA 4JY2A 1ZMCA 4H4VA 1KFYA 2CVJA 2JKCA 2R0PA 2RABA 3II4A 4J2WA 1D4CA 4BK2A 4U2SA 3K7MX 4TM1A 1PDHA 4U2TA 1PBBA 1P2HA 4KPRA 2OLOA 3P4SA 4H4YA 1L9CA 4H7UA 2R9ZA 4CNJA 4APNA 2XCGA 4CY8A 4Z26A 4OPDA 3DJJA 1H7XA 3RP8A 2XFPA 1P2EA 4GUVA 2DKHA 2RGHA 2IVDA 5JCIA 1OJDA 4YTNA 4OPLA 2BS4A 3GYIA 1TRBA 2C73A 2YLRA 2WP9A 2CULA 1ZY8A 1GV4A 5EOWA 5ER0A 2V6OA 3T37A 3S61A 2BXSA 1VQWA 4YTMA 2RGJA 4DGKA 5L46A 4DNAA 2C66A 2YVFA 1YKJA 2VVLG 3BHKA 2AAQA 3NK0X 4A5LA 2J3NA 5FS6A 1Y56B 3DMEA 3GMCA 2XDOA 1E1LA 3KKJA 3CGBA 1PN0A 3AE9A 1GESA 3OC4A 4OPCA 3UTGA 1JEHA 1JU2A 4U2LA 1XANA 2WDVA 4YWOA 1OJTA 1H83A 3AEDA 3GDPA 3PO7A 4WCTA 5HYMA 4U8JA 3F8PA 1BF3A 4UDRA 3GDNA 3NHOX 2X8GA 2A8XA 1GRGA 2WU5A 1GRAA 5JCKA 4CRTA 1D5TA 1JNRA 1D7LA 1L9EA 4DSGA 4EQRA 4EIQA 4TM0A 1F3PA 3PS9A 3LXDA 3K30A 4K2XA 1CF3A 5EB4A 1Q1WA 4J33A 3COXA 1F8WA 1PJ5A 3WE0A 4A99A 4B68A 2GEWA 1GETA 1IUWA 4H2PA 1MOKA 2BYBA 4OPUA 1PBCA 2C70A 2RGOA 5BULA 3ICTA 1H7WA 1JRYA 2GR1A 1M64A 2YWLA 3UTHA 3CNDA 2WPEA 1O94A 1DOBA 4XWZA 4Y4NA 2AR8A 3CGEA 3EANA 2YVGA 3LZXA 2VQ7A 2E5VA 2XLPA 2NPXA 2BABA 2BCGG 3LADA 2GRTA 3NTAA 1YQ3A 4B63A 3GSIA 2Z5XA 4H4XA 2WETA 2NVKX 3K7QX 3UOZA 3CTYA 2YAUA 1K0IA 2FJBA 3UOYA 4P9SA 1LVLA 1B8SA 3NT6A 4NEVA 1KNRA 1VRQB 4JNQA 4N9XA 2Q0LA 4PAAA 4OPTA 3CPIG 2E4GA 3KPFA 3AYJA 2GR2A 4A7AA 4Z2RA 3UP4A 4U8KA 2R4JA 3NH3X 3AEEA 4H4TA 3DJEA 4CNKA 3AEAA 3V3NA 4C74A 2YG7A 3IC9A 4U8OA 1PJ6A 3CPHG 1D7YA 2VQBA 1ZKQA 2BA9A 3BHFA 3OZ2A 4A6NA 5U1OA 2QA2A 2GVCA 3NRNA 1IUUA 3UKFA 4B65A 1BKWA 3DGZA 1TDNA 3CGCA 3F8RA 3L1RA 3Q9TA 3QSMA 4LU6A 1BZLA 4TM4A 1NHRA 2I0ZA 2V60A 4USQA 2QCUA 5TR3A 1LQTA 3KVEA 3RP7A 3ZDNA 4K7ZA 4J36A 5M0ZA 3AEGA 1CJ4A 3AXBA 1ONFA 1REOA 2TPRA 3ISHA 2JBVA 1M6IA 1O5WA 3CGDA 2WDQA 3FBSA 3FMWA 4USRA 4ZCDA 1DNCA 3KD9A 3D1CA 5DBJA 2FJAA 3NYEA 3ATQA 5HHFA 4ADWA 3NIXA 3GMBA 4Y4MA 1ZDLA 4NTDA 4AOXA 2WP5A 3NG7X 3RHAA 3UKAA 1LJ1A 5IQ1A 2B9WA 4D03A 2XVFA 3UKKA 1GPEA 2WQYA 1S3EA 4KX6A 4TLXA 2PYXA 1KSSA 4EMWA 1ZX9A 4B1BA 1NPXA 2F5ZA 1Q9IA 2YLTA 3UCLA 1GREA 2XVHA 2BXRA 3P4RA 2YM2A 3SGLA 2GF3A 2WP6A 2Y6RA 4JDRA 4A65A 3GRSA 4J34A 4Z44A 2HQMA 1E7PA 3H4KA 1BWCA 3VRBA 1QO8A 2WEUA 3NKSA 3F8DA 1KF6A 1ZOYA 4K22A 4U8PA 3RP6A 1GRFA 2R0CA 4J56A 3REDA 4K5SA 3LZWA 2C3DA 4FDCB 3GRTA 1FOHA 4NTEA 1NHSA 3M13A 3ALLA 1QLBA 1H82A 2BS3A 1K0JA 4EQWA 1TDKA 2Z5YA 3K7TA 4IV9A 3AEBA 2YM1A 2JB1A 1GT8A 4GCMA 1Z6LA 4NZHA 2E1MA 4C5OA 4YKGA 3G5RA 2GH5A 1EL7A 3NK2X 2XLUA 3B6DA 4XXGA 2VVMA 4ICYA 1Y0PA 1LPFA 3C96A 3P4QA 1GXFA 2GAGB 3AE7A 3UOVA 3GWFA 3QSSA 3I3LA 1HYUA 1IUXA 5FS7A 1L0VA 1VG0A 2XFOA 2GR0A 5EBKA 2C72A 3UTEA 3CN8A 2WESA 2OLNA 3NN6X 4NTCA 2WDRA 3DJDA 3CNJA 2Q7VA 4LIIA 5IQ4A 4YXDA 2JAEA 1NEKA 5J60A 1BGNA 2WPCA 5GSNA 3AD8B 1Y56A 1O95A 1V59A 5KVIA 2XFNA 4HB9A 1X31B 4JN9A 2WU2A 1L9DA 3CNPA 2ZZBA 4UDQA 2YVJA 2BK3A 2EQ9A 2ZBWA 2R45A 5JCLA 4GRTA 1NENA 2V3AA 4PABA 2YG4A 4UP3A 4Y4LA 4U8NA 4Z25A 4A9WA 1PBEA 1F8RA 2BCPA 5KOWA 2R4EA 4TM3A 3P9UA 2XLRA 1E1NA 2GQFA 2V61A 5IPYA 4H4RA 2B9XA 1FL2A 2YG5A 4OCGA 2X99A 4AP3A 2ZZCA 2XLTA 3GYJA 1H84A 4B69A 4ZCCA 3UKHA 1TDOA 2APGA 2H88A 1YY5A 4H2QA 2OALA 2FJDA 1EL8A 1YQ4A 5C2TA 4OPGA 3FG2P 3FIMB 3P1WA 2R46A 4BK1A 2WHDA 1DOCA 4YSXA 1TYPA 1KNPA 2PHHA 3URHA 4ECHA 1MXTA 4EQXA 2OAMA 2GR3A 2GMHA 3AEFA 2WS3A 4C77A 3O0HA 2H89A 4X9NA 4M52A 3RNMA 1GTHA 1CBOA 3ICSA 4JY3A 3V76A 3BI4A 2YR4A 1IUVA 4X4JA 3DA1A 2ZZ0A 3ITJA 4U8IA 4J57A 2XVJA 4AT0A 1PHHA 4RG3A 4EM3A 4Z2UA 2C76A 4D04A 2XVEA 2V5ZA 3AE6A 3CPJG 3SFDA 2WPFA 1IJHA 4XWRA 3AE3A 1F6MA 4H2NA 2X8CA 1AOGA 1PXBA 4GDPA 2EQ6A 3LB8A 4IA5A 2X8HA 5U25A 1ZP0A 3DH9A 2WBAA 1GRBA 1BGJA 2C65A 4H4SA
chains in the Genus database with same CATH superfamily
3A7UA 2XYOA 3NK1X 3BI2A 4AP1A 3VCNA 3S47A 1EL9A 2WOVA 3HYWA 3CIRA 1FEBA 1N4VA 2QDDA 3OPSA 4KEMA 2PTYA 4H4WA 3E1TA 1KSUA 3DK4A 3ZVIA 2EQ7A 3ABVA 3QKEA 4MJWA 3AWIA 3Q45A 4AT2A 3TW9A 3FPZA 1DODA 3VC5A 3NYFA 4A6GA 3QJ4A 3VCCA 3SN0A 2XLSA 4TVYA 4CCQA 1FECA 3AE8A 1N4UA 1K0LA 5HY5A 4IP5A 3C4NA 2WOIA 3VFCA 1CJCA 3R0KA 1K4QA 1ECQA 1MO9A 2YQUA 4JN7A 3UKQA 3BOXA 1NDAA 4GDEA 2P8BA 1S2QA 4X9MA 2PU0A 5FJPA 3BNUA 1ELIA 4CBQA 3VRDB 3S5SA 4AOSA 2YR6A 1MDRA 1QJDA 2O9ZA 1X2GA 2YLWA 3VQRA 1H81A 2QJMA 1SJAA 4RG4A 3DK9A 1NHPA 3PK7A 4O5UA 1CL0A 3DJGX 2Y6QA 3M12A 5EB5A 3UJSA 4A79A 1LQUA 4GYPC 5FS8A 3UGVA 3ZYXA 1GEUA 1CC4A 3BNMA 3QVPA 1JPDX 1CC2A 4EIPA 4G73A 1GOSA 1PXCA 4LA1A 3NN0X 1GSNA 3ALJA 2CFYA 5CKUA 2IIDA 4HA6A 1PS9A 4II2A 1VG9A 2QJNA 2C75A 5IDZA 4GFIA 1KDGA 1TDFA 4IVMB 2QA1A 1D4EA 3DGHA 4JY2A 1JRPA 4KWSA 3K7MX 4TM1A 3P4SA 1MDLA 4ZOHB 4CNJA 2XCGA 4Z26A 3QTPA 3DJJA 1H7XA 4ENLA 1P2EA 4GUVA 2IVDA 4YTNA 1H2IA 2WP9A 3CMMA 2ONEA 3SJNA 4YTMA 1VQWA 2RGJA 1YKJA 3D47A 3BHKA 3MZNA 4A5LA 4H83A 1Y56B 3CGBA 1TZZA 3OC4A 1JEHA 2WDVA 1OJTA 4U8JA 3GDNA 1GRGA 1GRAA 1JNRA 1D7LA 1F3PA 3PS9A 1CF3A 5EB4A 4J33A 3COXA 2PPGA 4DWDA 3WE0A 4B68A 4F4RA 2GEWA 1PBCA 5KMRA 5FJUA 1O94A 4Y4NA 3LZXA 3EANA 2BCGG 2PTZA 3UOZA 3DEQA 1V97A 1B8SA 4NEVA 4JNQA 4N9XA 1DTNA 3CPIG 3KPFA 3PWGA 2GR2A 4Z2RA 4GGBA 2YG7A 3MWCA 5G5GB 3CPHG 2XH0A 1D7YA 3BHFA 1ZKQA 2BA9A 4MMWA 2QA2A 3SXIA 5M0ZA 3ISHA 1RM6B 3IJIA 3FBSA 4ZCDA 3ATQA 3NIXA 5IQ1A 1GPEA 2WQYA 4G8TA 1S3EA 4EMWA 1N5WC 1NPXA 2F5ZA 1Q9IA 1GREA 4G74A 2GGGA 2BXRA 2GF3A 3QN3A 3H4KA 1KF6A 1FOHA 2GDQA 3NFUA 2BS3A 4EQWA 1TDKA 2XH2A 1GT8A 4GCMA 1Z6LA 4YKGA 3D9XA 3NK2X 2XLUA 2GGHA 4Z1YA 4XXGA 4ICYA 3C96A 2AL2B 4E4UA 3QSSA 2GR0A 5EBKA 2WESA 2OLNA 3NN6X 2WDRA 2Q7VA 1FO4A 2JAEA 1NEKA 5J60A 1BGNA 3AD8B 4HB9A 2WU2A 1L9DA 2EQ9A 2V3AA 1N62C 4Y4LA 4Z25A 3T14A 4TM3A 3D46A 2PU1A 5IPYA 2YG5A 3ZVHB 4OCGA 4ZCCA 4IT1A 2APGA 2FJDA 1YQ4A 3JVAA 4OPGA 1T3QC 3SZ0A 3DGBA 1R0MA 2GR3A 2GGIA 4IL0A 3ICSA 3V76A 4JY3A 3BI4A 4U8IA 4AT0A 4RG3A 3MUCA 2C76A 3AE6A 3SFDA 5FJRA 1PXBA 3I6EA 2OZ3A 3DH9A 4U8MA 4H7UA 2C65A 4H4SA 2QDEA 1VDCA 4WX1A 1GERA 3B97A 3CXBA 2ACZA 4J31A 5HXIA 4YTPA 1JROA 2Q0KA 4GR1A 2YG3A 4C3XA 1TDEA 2PP3A 3V5CA 2JB3A 1JRZA 4ZCWA 2GV8A 2BK4A 4YKFA 1XDIA 3C4AA 1YQZA 3AE1A 2FYMA 2XVIA 5J7XA 3P4PA 3NS1B 1PBFA 3KLJA 1GRHA 1TYTA 4NEWA 5JCMA 4EQSA 4EMJA 1SJCA 3T0KA 1N4WA 1S3BA 2I5QA 5KNLA 3UJ2A 5KXJA 3B3RA 3AE2A 1DJQA 1PDZA 4B64A 2AQJA 2WOWA 2W3RA 1EL5A 2X50A 2OO6A 1NAAA 3RO6A 1VQZA 3HPFA 1ELSA 4Z2TA 2OX4A 2BC1A 2QGYA 4TLZA 4EM4A 1JCTA 4EMIA 1DXLA 3NXLA 2OFJA 3UKLA 3UP5A 4JN8A 2FBWA 4E4FA 1FIQB 7ENLA 3IJQA 1RYIA 4REKA 2TMDA 1SEZA 4O5QA 1D4DA 4Z24A 3STPA 1DOEA 2PMQA 3SQSA 4K1WA 2FKPA 4H2RA 1OJCA 3NNEA 1EC9A 3R0UA 3I4KA 3T2ZA 3IWAA 5KMPA 3GWDA 2R0GA 1JNZA 3KU9A 4IHCA 1E1KA 2HNEA 4BV6A 1YEYA 3SM8A 5C3JA 1IUSA 2B7RA 3HZLA 4CY6A 3M0OA 4RSLA 4H4QA 1E6EA 2C64A 1ZMCA 1KFYA 3DDMA 4A35A 2JKCA 3II4A 1X2HA 3P93A 3R1ZA 2GSHA 1PDHA 3HRDC 1P2HA 2OPJA 2GGEA 2PTXA 3DIPA 3OP2A 2W54A 4APNA 4OPDA 3SR6B 1N63C 3VC6A 4G9KA 1ZY8A 3UJEA 5EOWA 4DGKA 2HXUA 5L46A 4DNAA 2C66A 1N61C 2AAQA 5FS6A 3MKCA 2XDOA 3KKJA 3AE9A 1JU2A 3RITA 4TVWA 3GDPA 1BF3A 3SN4A 5ENLA 3NHOX 2X8GA 2A8XA 4EQRA 3TOYA 4GYPA 3SBFA 4TM0A 4H1ZA 3RR1A 1IUWA 1MOKA 1P48A 1JRYA 4E5TA 3FXGA 2VQ7A 2XLPA 1YQ3A 3CTYA 2YAUA 1K0IA 4P9SA 3NT6A 1KNRA 3H70A 2Q0LA 4PAAA 2E4GA 3UP4A 4U8KA 3V3NA 3IC9A 1FHVA 4U8OA 4A6NA 5U1OA 4FI4A 4B65A 3QSMA 3SN1A 1NELA 3R07C 3RP7A 4K7ZA 3AEGA 1REOA 2AKZA 3OW1A 2JBVA 5DBJA 2FJAA 3NYEA 1FFUC 5G5HB 3THUA 2B9WA 3NVZB 3T6CA 4KX6A 2PYXA 5BOEA 3UCLA 2YLTA 3VDGA 3P4RA 4JDRA 3SZCA 4A65A 4Z44A 3VRBA 3NKSA 3HW2A 4U8PA 1GRFA 2P8CA 3REDA 3LZWA 3ALLA 2PSNA 2AL2A 2OVLA 3P4QA 3AE7A 3FYYA 3GWFA 3PG6A 1HYUA 1VG0A 3UTEA 3CN8A 3CNJA 1R6WA 4YXDA 4DHGA 1EBGA 1Y56A 1O95A 5KVIA 2ZZBA 2R45A 3JW7A 1FFVC 1NENA 4PABA 2YG4A 4UP3A 4U8NA 4A9WA 1PBEA 3T8QA 2X99A 3RCYA 3NVYB 1E9IA 1H84A 4A3RA 2QQ6A 2H88A 1YY5A 2OALA 3FIMB 4YSXA 3T4WA 5BOFA 3URHA 3NVWB 2GMHA 3AEFA 2WS3A 3O0HA 4X9NA 3UXKA 1GTHA 1CBOA 2OZ8A 1IUVA 3T2YA 3ITJA 2XVJA 3OTRA 2BRAA 2WPFA 4XWRA 3SSZA 4GDPA 3DFHA 3LB8A 2WBAA 1GRBA 5U63A 2JK6A 2XFUA 2GMJA 4H4UA 3Q6JA 2PP0A 2W0HA 1IYXA 2X3NA 4E8GA 1PXAA 4B66A 1PDYA 3R9UA 4YT0A 1GTEA 2OQHA 3UJRA 4BK3A 3QSEA 3UKPA 4UDPA 1GALA 1S2YA 3GD4A 3DK8A 2B76A 5M10A 5GRTA 2DKIA 2YLZA 4IA6A 3NGCX 2XGZA 4H4PA 2MNRA 1BQGA 3AYIA 3VR9A 3AYLA 3NLCA 4GAVA 1JRXA 3H8IA 4GMEA 2A87A 1ZK7A 3EPTA 5J04A 2UZZA 4H4ZA 2IVEA 2B7SA 3QVRA 3AMZA 3CXOA 2YLSA 2V3BA 5JCNA 4YWSA 1P43A 2CHRA 3LJPA 1CJ3A 3TCSA 1CC6A 1NHQA 2ZADA 3G5SA 3NYCA 4G6HA 1RSGA 1RP0A 1CJ2A 4C3YA 3EAOA 4DXKA 3UCDA 1F8SA 2BC0A 3NVVB 6ENLA 2E5AA 3QFAA 4Z43A 3AB1A 3CAWA 4GF7A 2OZTA 4MKSA 1EC7A 5KRQA 2GQWA 5LV9A 4BJZA 2C7GA 1W6TA 3SFEA 5FS9A 2P88A 2CDUA 4JNAA 3ES7A 1B4VA 1OJ9A 2JB2A 3NRZB 1LTXR 3QLDA 2GAHB 4OVIA 1OJAA 1FHUA 3N4EA 3ZVHA 3R25A 4DSHA 4B67A 2MUCA 4YSZA 1N1PA 2VZ2A 3IF9A 5BVAA 3D8XA 3ICRA 1COYA 1H86A 3JSKA 4J1OA 2BACA 4FK1A 1CHUA 3CYJA 4CCRA 1LV0A 4H50A 4U8LA 1EBDA 3FCPA 3AD9B 3L8KA 2PGWA 4BJYA 4FX9A 4H4VA 3TJ4A 2CVJA 3R10A 2R0PA 2RABA 3GY1A 3KPKA 1D4CA 3R11A 3TWAA 3MSYA 1PBBA 2OLOA 2R9ZA 4HNLA 4CY8A 3SY4A 2PCEA 2XFPA 2RGHA 4ROPA 2AL1A 4OPLA 2C73A 5ER0A 2V6OA 3S61A 3V3WA 3A7AA 3GMCA 4H2HA 1PN0A 3PFRA 4WCTA 4YWOA 3AEDA 5HYMA 3AM9A 1RVKA 4CRTA 3EUB3 4E6MA 1L9EA 3H8AA 1Q1WA 1PJ5A 1GETA 5BULA 3ICTA 1H7WA 1M64A 3UTHA 2RDXA 4GAPA 2ZC8A 1F9CA 2YVGA 1L8PA 2NPXA 2BABA 3LADA 4II3A 2Z5XA 4H4XA 2WETA 2NVKX 3K7QX 1EC8A 4OPTA 2POZA 1JPMA 4A7AA 2W3SA 3NH3X 3AEEA 4H4TA 3DJEA 2XSXA 4CNKA 4EWJA 1PJ6A 3OZ2A 3NRNA 2GVCA 1BKWA 3CK5A 3DGZA 4LU6A 1BZLA 4ZA0A 3N4FA 1NHRA 2QCUA 5TR3A 1LQTA 3UJFA 1WUFA 1ONFA 2TPRA 1O5WA 2WDQA 3CGDA 1DNCA 3D1CA 3IK4A 5HHFA 3GMBA 1ZDLA 2WP5A 3NG7X 2OKTA 3RHAA 3UKAA 1LJ1A 2XVFA 5KMQA 4G7FA 1KSSA 1ZX9A 2XVHA 4K8GA 3TWBA 2YM2A 2WP6A 3GRSA 4J34A 1BWCA 3DFYA 1ZOYA 3A7RA 2R0CA 5FJOA 2QJJA 3GRTA 1OEPA 4NTEA 1NHSA 1STZA 4IV9A 4IZGA 3G5RA 3B9JB 1EL7A 2PP1A 3I6TA 3B6DA 2BRYA 2VVMA 1LPFA 1GXFA 3UOVA 3I3LA 1IUXA 5FS7A 1L0VA 2C72A 3SYIA 4NTCA 3DJDA 5IQ4A 2HXTA 2WPCA 5GSNA 1X31B 4JN9A 3K1GA 3CNPA 3DG3A 4UDQA 2BK3A 2ZBWA 3GD6A 2E3TA 1JDFA 4KPLA 2AKMA 5JRBA 1N5XA 5KOWA 1F8RA 3P3BA 2XLRA 3NO1A 5FJTA 1E1NA 2V61A 4H4RA 1FL2A 4AP3A 2ZZCA 4MGGA 2XLTA 3GYJA 4B69A 3UKHA 1TDOA 3V5FA 5C2TA 3P1WA 2WHDA 1DOCA 1TYPA 2PHHA 4ECHA 1MXTA 4EQXA 2OAMA 3OZYA 3OZMA 3RNMA 2P3ZA 3TTEA 4X4JA 3DA1A 2GL5A 1PHHA 4X2PA 4EM3A 3L5OA 2XVEA 2V5ZA 3CPJG 1IJHA 3BJSA 4H2NA 2X8CA 2XH4A 1AOGA 2EQ6A 4IA5A 1ZP0A 3MY9A 2YG6A 5KOXA 2OLAA 1E1MA 1GRTA 1ZMDA 3ETRB 3TJIA 4ZN0A 4G6GA 3AE4A 3BI5A 2VRLA 3IHGA 2VVLA 3H8LA 3I6DA 2VOUA 1ZOVA 4YSYA 3UOXA 1UKVG 1B5QA 4E0VA 1NG4A 1H6VA 2YR5A 1VDVA 4DX3A 3ADAB 2OA1A 4FP1A 3VA8A 4HCLA 2XFQA 2W55A 3CNTA 3KA7A 3GO2A 5CQFA 4J3ZA 3FJ4A 4BURA 1E39A 1NG3A 3ALMA 4IVOB 4I58A 1PBDA 1W4XA 5BUKA 2YLXA 4Z17A 1JOAA 3NTDA 1DJNA 5BRTA 3N6HA 3IHMA 2GB0A 3T2KA 2C67A 1SB3B 2VRMA 1SJDA 2A89A 1KKOA 3IJLA 3V3OA 5KVHA 3KUMA 2B9YA 2EQ8A 1WYGA 1FCDA 4K8DA 1Q1RA 4FK1C 2BK5A 3ATRA 2C3CA 3HYVA 4I59A 3CT2A 3JZUA 1SJBA 2BS2A 1MUCA 1B37A 4KT2A 3ENLA 4K2SA 2NQLA 4HCDA 1GNDA 1PJ7A 5KWFA 3SX6A 4JQ9A 1IUTA 3GD3A 3S5WA 3EEZA 3ZLGA 5EU9A 3VR8A 3UXLA 1MRAA 3QFBA 2PGEA 2QAEA 3U4FA 1KD0A 1XHCA 3SQPA 1S7MA 2P0IA 3EF6A 1KCZA 1XPQA 2Q6UA 4K5RA 4OPIA 3VRAA 3PVCA 3G5QA 1FEAA 5FMHA 2ARDA 5KMSA 4A6NB 3T31A 3SZWA 3AECA 3PWIA 3GYXA 3AD7B 3LOVA 2FJEA 3UTFA 3AE5A 3CNSA 4YSHA 4J2WA 4BK2A 4U2SA 3T9PA 4U2TA 4KPRA 4H4YA 1L9CA 2O56A 4HYRA 3RP8A 2PA6A 2DKHA 2DW7A 5JCIA 3TQPA 1OJDA 2BS4A 3GYIA 1TRBA 2YLRA 2CULA 1GV4A 2XH7A 4DN1A 3T37A 2BXSA 2YVFA 3NK0X 3DESA 3P0WA 2VVLG 2J3NA 3DMEA 2HZGA 3UCCA 1E1LA 1GESA 3Q4DA 4OPCA 3UTGA 4U2LA 1XANA 3PO7A 1H83A 3F8PA 4UDRA 1MNSA 2WU5A 5JCKA 1D5TA 4NWZA 4DSGA 3QPEA 4EIQA 3LXDA 3K30A 4K2XA 1F8WA 4A99A 4H2PA 3H7VA 4IP4A 2BYBA 2C70A 2RGOA 4OPUA 3DG7A 2GR1A 2YWLA 3CNDA 2WPEA 1DOBA 4XWZA 1XPYA 2AR8A 1KKRA 3CGEA 4M0XA 2E5VA 4GISA 3MQTA 1TKKA 2GRTA 3NTAA 4B63A 3GSIA 3HYXA 2FJBA 3UOYA 2PS2A 1LVLA 3ZLHA 2DW6A 1VRQB 3AYJA 4GGHA 2R4JA 3AEAA 4C74A 3BSMA 3FVDA 2VQBA 3SZFA 1IUUA 3UKFA 1TDNA 2OQYA 3CGCA 3F8RA 3L1RA 3Q9TA 4TM4A 4USQA 1ONEA 1BKHA 2I0ZA 2V60A 3KVEA 3ZDNA 4J36A 1CJ4A 3AXBA 4GIRA 1M6IA 3FMWA 3FV9A 4USRA 3KD9A 4ADWA 4Y4MA 4NTDA 3DERA 4AOXA 1WUEA 4D03A 3NZGA 3UKKA 4TLXA 3EKGA 4NNJA 4B1BA 3SGLA 2Y6RA 4M6UA 3AN1A 2HQMA 3V4BA 1E7PA 1QO8A 2WEUA 3F8DA 4K22A 3RP6A 4DYEA 4J56A 4K5SA 2C3DA 4FDCB 3RRAA 3M13A 1QLBA 1H82A 1K0JA 2C4CA 2Z5YA 3K7TA 3AEBA 2YM1A 3GC2A 3N6JA 2JB1A 4C5OA 4NZHA 2E1MA 2GH5A 4HN8A 1Y0PA 3H12A 2GAGB 1N60C 1EBHA 2XFOA 4JHMA 4LIIA 2PTWA 2XFNA 1V59A 2GGJA 2YVJA 5JCLA 4GRTA 3CB3A 1ZXIC 2BCPA 2R4EA 4H19A 3P9UA 4HNCA 2GQFA 2B9XA 2QVHA 4IL2A 3RGTA 2OG9A 4H2QA 1EL8A 1TE6A 3FG2P 2R46A 4BK1A 1KNPA 3ES8A 4HPNA 3ZLFA 1NU5A 4C77A 2H89A 4M52A 2YR4A 2ZZ0A 4J57A 4Z2UA 3DG6A 4D04A 1KN0A 1XS2A 3AE3A 2PODA 1F6MA 2X8HA 5U25A 4HCHA 3U9IA 1BGJA
chains in the Genus database with same CATH topology
1VDCA 4WX1A 5U63A 2YG6A 2XYOA 2JK6A 1GERA 3BI2A 3NK1X 4AP1A 5KOXA 1E1MA 1GRTA 1ZMDA 4ZN0A 2ACZA 4J31A 2XFUA 2GMJA 1EL9A 5HXIA 4H4UA 4YTPA 4G6GA 2WOVA 3AE4A 3Q6JA 3CIRA 2Q0KA 4GR1A 1FEBA 1N4VA 2YG3A 3BI5A 2VRLA 4C3XA 2W0HA 1TDEA 3IHGA 2VVLA 3H8LA 3I6DA 2X3NA 2JB3A 1ZOVA 4H4WA 2VOUA 3E1TA 3UOXA 1KSUA 1UKVG 4YSYA 1PXAA 3DK4A 1JRZA 4B66A 1B5QA 2EQ7A 2GV8A 2BK4A 3ABVA 3R9UA 4MJWA 4E0VA 3AWIA 4YT0A 1NG4A 1H6VA 4YKFA 2YR5A 4AT2A 1GTEA 2OA1A 3ADAB 3UKPA 4BK3A 1XDIA 3QSEA 3FPZA 1DODA 3C4AA 4UDPA 1GALA 1YQZA 1S2YA 2XFQA 3GD4A 3DK8A 3AE1A 3NYFA 2B76A 3CNTA 3QJ4A 3KA7A 2XVIA 5J7XA 2XLSA 3P4PA 4CCQA 5M10A 5GRTA 1PBFA 5CQFA 3KLJA 1FECA 2DKIA 2YLZA 4IA6A 3AE8A 3NGCX 1N4UA 1GRHA 4H4PA 4BURA 1TYTA 1K0LA 1E39A 3AYIA 1NG3A 5HY5A 4NEWA 5JCMA 4EQSA 3ALMA 4EMJA 3C4NA 4I58A 4IVOB 2WOIA 1PBDA 1W4XA 3T0KA 1CJCA 3VR9A 1N4WA 3AYLA 3NLCA 5BUKA 1K4QA 1S3BA 2YLXA 4GAVA 1JRXA 1MO9A 3H8IA 5KNLA 2A87A 2YQUA 5KXJA 1JOAA 3UKQA 1ZK7A 3B3RA 3NTDA 3EPTA 2UZZA 4H4ZA 1NDAA 2IVEA 4U8MA 2B7SA 3AE2A 3QVRA 1DJNA 4GDEA 5BRTA 1S2QA 1DJQA 3IHMA 2GB0A 4B64A 4X9MA 2YLSA 3T2KA 2V3BA 3BNUA 2C67A 5JCNA 1ELIA 4CBQA 2AQJA 2VRMA 2A89A 2WOWA 3LJPA 3VRDB 1CJ3A 4AOSA 2YR6A 1EL5A 2X50A 3V3OA 1NAAA 5KVHA 2B9YA 1CC6A 1NHQA 2EQ8A 1FCDA 3G5SA 4K8DA 1Q1RA 3NYCA 1QJDA 2O9ZA 4FK1C 2BK5A 4G6HA 1RSGA 4Z2TA 2YLWA 3ATRA 2C3CA 3VQRA 3HYVA 2BC1A 1RP0A 4I59A 1CJ2A 1H81A 4C3YA 3EAOA 4TLZA 2BS2A 1F8SA 4RG4A 1B37A 3DK9A 2BC0A 1NHPA 4EM4A 4EMIA 4O5UA 1CL0A 3QFAA 4Z43A 1GNDA 1PJ7A 3AB1A 5KWFA 3DJGX 2Y6QA 4GF7A 3M12A 1DXLA 3SX6A 4JQ9A 5EB5A 5KRQA 2GQWA 1IUTA 3GD3A 3UKLA 3UP5A 3S5WA 5LV9A 3HYWA 2FBWA 4A79A 4BJZA 2C7GA 3VR8A 1LQUA 5FS8A 3ZYXA 1GEUA 1CC4A 1RYIA 3BNMA 4REKA 3SFEA 2TMDA 3QFBA 5FS9A 2CDUA 4JNAA 1B4VA 1OJ9A 1SEZA 2JB2A 3QVPA 2QAEA 1LTXR 2GAHB 4O5QA 1D4DA 1XHCA 1CC2A 4OVIA 4Z24A 3SQPA 4EIPA 1OJAA 1DOEA 1S7MA 3EF6A 4G73A 1GOSA 1PXCA 1XPQA 2Q6UA 4K5RA 4OPIA 4H2RA 4LA1A 1OJCA 1GSNA 3NN0X 3NNEA 4B67A 3VRAA 4DSHA 4YSZA 1N1PA 2VZ2A 3T2ZA 3IF9A 5BVAA 3D8XA 3ALJA 3ICRA 1COYA 1H86A 3GWDA 3IWAA 3PVCA 3G5QA 5KMPA 2R0GA 3JSKA 1FEAA 2CFYA 1JNZA 3KU9A 5CKUA 5FMHA 2ARDA 2BACA 4FK1A 5KMSA 1E1KA 2IIDA 1CHUA 4A6NB 4BV6A 4HA6A 3SM8A 3SZWA 3T31A 3AECA 1PS9A 4II2A 1VG9A 5C3JA 1IUSA 4CCRA 2B7RA 1LV0A 3HZLA 4CY6A 4H50A 2C75A 3GYXA 1EBDA 3AD7B 1KDGA 3LOVA 4U8LA 1TDFA 3M0OA 2FJEA 4IVMB 3UTFA 3AD9B 4RSLA 3L8KA 4H4QA 1D4EA 2QA1A 3AE5A 3DGHA 4FX9A 1E6EA 2C64A 3CNSA 4BJYA 4YSHA 4JY2A 1ZMCA 4H4VA 1KFYA 2CVJA 2JKCA 2R0PA 2RABA 3II4A 3KPKA 4J2WA 1D4CA 4BK2A 4U2SA 3K7MX 4TM1A 1PDHA 4U2TA 1PBBA 1P2HA 4KPRA 2OLOA 3P4SA 4H4YA 1L9CA 4H7UA 2R9ZA 4CNJA 4APNA 2XCGA 4CY8A 4Z26A 3SY4A 4OPDA 3DJJA 1H7XA 3RP8A 2XFPA 1P2EA 4GUVA 2DKHA 2RGHA 2IVDA 5JCIA 1OJDA 4YTNA 4OPLA 1H2IA 2BS4A 1TRBA 2C73A 2YLRA 3GYIA 4G9KA 2WP9A 2CULA 1ZY8A 1GV4A 5EOWA 3CMMA 5ER0A 2V6OA 3T37A 3S61A 2BXSA 1VQWA 4YTMA 2RGJA 4DGKA 5L46A 4DNAA 2C66A 2YVFA 1YKJA 2VVLG 3BHKA 2AAQA 3NK0X 4A5LA 2J3NA 5FS6A 1Y56B 3DMEA 3GMCA 2XDOA 1E1LA 3KKJA 3CGBA 1PN0A 3AE9A 1GESA 3OC4A 4OPCA 3UTGA 1JEHA 1JU2A 4U2LA 1XANA 2WDVA 4YWOA 1OJTA 1H83A 3AEDA 3GDPA 3PO7A 4WCTA 5HYMA 4U8JA 3F8PA 1BF3A 4UDRA 3GDNA 3NHOX 2X8GA 2A8XA 1GRGA 2WU5A 1GRAA 5JCKA 4CRTA 1D5TA 1JNRA 1D7LA 1L9EA 4NWZA 4DSGA 4EQRA 4EIQA 4TM0A 1F3PA 3PS9A 3LXDA 3K30A 4K2XA 1CF3A 5EB4A 1Q1WA 4J33A 3COXA 1F8WA 1PJ5A 3WE0A 4A99A 4B68A 2GEWA 1GETA 1IUWA 4H2PA 1MOKA 2BYBA 4OPUA 1PBCA 2C70A 2RGOA 5BULA 3ICTA 5KMRA 1H7WA 1JRYA 2GR1A 1M64A 2YWLA 3UTHA 3CNDA 2WPEA 1O94A 1DOBA 4XWZA 4GAPA 4Y4NA 2AR8A 3CGEA 3EANA 2YVGA 3LZXA 2VQ7A 2E5VA 2XLPA 2NPXA 2BABA 2BCGG 3LADA 2GRTA 3NTAA 4II3A 1YQ3A 4B63A 3GSIA 2Z5XA 4H4XA 2WETA 2NVKX 3K7QX 3UOZA 3HYXA 3CTYA 2YAUA 1K0IA 2FJBA 3UOYA 4P9SA 1LVLA 1B8SA 3NT6A 4NEVA 1KNRA 1VRQB 4JNQA 4N9XA 2Q0LA 4PAAA 4OPTA 3CPIG 2E4GA 3KPFA 3AYJA 2GR2A 4A7AA 4Z2RA 3UP4A 4U8KA 2R4JA 3NH3X 3AEEA 4H4TA 3DJEA 4CNKA 3AEAA 3V3NA 4C74A 2YG7A 3IC9A 4U8OA 1PJ6A 3CPHG 1D7YA 2VQBA 1ZKQA 2BA9A 3BHFA 3OZ2A 3SZFA 4A6NA 5U1OA 2QA2A 2GVCA 3NRNA 1IUUA 3UKFA 4B65A 1BKWA 3DGZA 1TDNA 3CGCA 3F8RA 3L1RA 3Q9TA 3QSMA 4LU6A 1BZLA 4TM4A 3SXIA 1NHRA 2I0ZA 2V60A 4USQA 2QCUA 5TR3A 1LQTA 3KVEA 3RP7A 3ZDNA 4K7ZA 4J36A 5M0ZA 3AEGA 1CJ4A 3AXBA 1ONFA 1REOA 2TPRA 3ISHA 2JBVA 1M6IA 1O5WA 3CGDA 2WDQA 3FBSA 3FMWA 4USRA 4ZCDA 1DNCA 3KD9A 3D1CA 5DBJA 2FJAA 3NYEA 3ATQA 5HHFA 4ADWA 3NIXA 3GMBA 4Y4MA 1ZDLA 4NTDA 4AOXA 2WP5A 3NG7X 3RHAA 3UKAA 1LJ1A 5IQ1A 2B9WA 4D03A 2XVFA 3UKKA 1GPEA 2WQYA 1S3EA 4KX6A 4TLXA 4NNJA 5KMQA 2PYXA 1KSSA 4EMWA 1ZX9A 4B1BA 1NPXA 2F5ZA 1Q9IA 2YLTA 3UCLA 1GREA 4G74A 2XVHA 2BXRA 3P4RA 2YM2A 3SGLA 2GF3A 2WP6A 2Y6RA 4JDRA 3SZCA 4A65A 3GRSA 4J34A 4Z44A 2HQMA 1E7PA 3H4KA 1BWCA 3VRBA 1QO8A 2WEUA 3NKSA 3F8DA 1KF6A 1ZOYA 4K22A 4U8PA 3RP6A 1GRFA 2R0CA 4J56A 3REDA 4K5SA 3LZWA 2C3DA 4FDCB 3GRTA 1FOHA 4NTEA 1NHSA 3M13A 3ALLA 1QLBA 1H82A 2BS3A 1K0JA 2C4CA 4EQWA 1TDKA 2Z5YA 3K7TA 4IV9A 3AEBA 2YM1A 2JB1A 1GT8A 4GCMA 1Z6LA 4NZHA 2E1MA 4C5OA 3D9XA 3G5RA 4YKGA 2GH5A 1EL7A 3NK2X 2XLUA 3B6DA 4XXGA 2BRYA 2VVMA 4ICYA 1Y0PA 1LPFA 3C96A 3P4QA 1GXFA 2GAGB 3AE7A 3UOVA 3GWFA 3PG6A 3QSSA 3I3LA 1HYUA 1IUXA 5FS7A 1L0VA 1VG0A 2XFOA 2GR0A 5EBKA 2C72A 3SYIA 3UTEA 3CN8A 2WESA 2OLNA 3NN6X 4NTCA 2WDRA 3DJDA 3CNJA 2Q7VA 4LIIA 5IQ4A 4YXDA 2JAEA 1NEKA 5J60A 1BGNA 2WPCA 5GSNA 3AD8B 1Y56A 1O95A 1V59A 5KVIA 2XFNA 4HB9A 1X31B 4JN9A 2WU2A 1L9DA 3CNPA 2ZZBA 4UDQA 2YVJA 2BK3A 2EQ9A 2ZBWA 2R45A 5JCLA 4GRTA 1NENA 2V3AA 4PABA 2YG4A 4UP3A 4Y4LA 4U8NA 5JRBA 3T14A 4Z25A 4A9WA 1PBEA 1F8RA 2BCPA 5KOWA 2R4EA 4TM3A 3P9UA 2XLRA 1E1NA 2GQFA 2V61A 5IPYA 4H4RA 2B9XA 1FL2A 2YG5A 4OCGA 2X99A 4AP3A 2ZZCA 2XLTA 3GYJA 1H84A 4B69A 4ZCCA 3UKHA 1TDOA 2APGA 2H88A 1YY5A 4H2QA 2OALA 2FJDA 1EL8A 1YQ4A 5C2TA 4OPGA 3FG2P 3FIMB 3P1WA 2R46A 4BK1A 2WHDA 1DOCA 3SZ0A 4YSXA 1TYPA 1KNPA 2PHHA 3URHA 4ECHA 1MXTA 4EQXA 2OAMA 2GR3A 2GMHA 3AEFA 2WS3A 4C77A 3O0HA 2H89A 4X9NA 4M52A 3RNMA 1GTHA 1CBOA 3ICSA 4JY3A 3V76A 3BI4A 2YR4A 1IUVA 4X4JA 3DA1A 2ZZ0A 3T2YA 3ITJA 4U8IA 4J57A 2XVJA 4AT0A 1PHHA 4RG3A 4EM3A 4Z2UA 2C76A 3L5OA 4D04A 2BRAA 2V5ZA 2XVEA 3AE6A 3CPJG 3SFDA 1KN0A 2WPFA 1IJHA 4XWRA 3AE3A 1F6MA 4H2NA 2X8CA 1AOGA 1PXBA 4GDPA 2EQ6A 3LB8A 4IA5A 2X8HA 5U25A 1ZP0A 3DH9A 2WBAA 1GRBA 1BGJA 2C65A 4H4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VDC A;  4WX1 A;  5U63 A;  2YG6 A;  2XYO A;  2JK6 A;  1GER A;  3BI2 A;  3NK1 X;  4AP1 A;  5KOX A;  1E1M A;  1GRT A;  1ZMD A;  4ZN0 A;  2ACZ A;  4J31 A;  2XFU A;  2GMJ A;  1EL9 A;  5HXI A;  4H4U A;  4YTP A;  2WOV A;  3AE4 A;  3Q6J A;  3CIR A;  2Q0K A;  4GR1 A;  1FEB A;  1N4V A;  2YG3 A;  3BI5 A;  2VRL A;  4C3X A;  2W0H A;  1TDE A;  3IHG A;  2VVL A;  3H8L A;  3I6D A;  2X3N A;  2JB3 A;  1ZOV A;  4H4W A;  2VOU A;  3E1T A;  3UOX A;  1KSU A;  1UKV G;  4YSY A;  1PXA A;  3DK4 A;  1JRZ A;  4B66 A;  1B5Q A;  2EQ7 A;  2GV8 A;  2BK4 A;  3ABV A;  3R9U A;  4MJW A;  4E0V A;  3AWI A;  4YT0 A;  1NG4 A;  1H6V A;  4YKF A;  2YR5 A;  4AT2 A;  1GTE A;  2OA1 A;  3ADA B;  3UKP A;  4BK3 A;  1XDI A;  3QSE A;  3FPZ A;  1DOD A;  3C4A A;  4UDP A;  1GAL A;  1YQZ A;  1S2Y A;  2XFQ A;  3GD4 A;  3DK8 A;  3AE1 A;  3NYF A;  2B76 A;  3CNT A;  3QJ4 A;  3KA7 A;  2XVI A;  5J7X A;  2XLS A;  3P4P A;  4CCQ A;  5M10 A;  5GRT A;  1PBF A;  5CQF A;  3KLJ A;  1FEC A;  2DKI A;  2YLZ A;  4IA6 A;  3AE8 A;  3NGC X;  1N4U A;  1GRH A;  4H4P A;  4BUR A;  1TYT A;  1K0L A;  1E39 A;  3AYI A;  1NG3 A;  5HY5 A;  4NEW A;  5JCM A;  4EQS A;  3ALM A;  4EMJ A;  3C4N A;  4I58 A;  4IVO B;  2WOI A;  1PBD A;  1W4X A;  1CJC A;  3VR9 A;  1N4W A;  3AYL A;  3NLC A;  5BUK A;  1K4Q A;  1S3B A;  2YLX A;  1JRX A;  1MO9 A;  3H8I A;  2A87 A;  2YQU A;  5KXJ A;  1JOA A;  3UKQ A;  1ZK7 A;  3B3R A;  3NTD A;  3EPT A;  2UZZ A;  4H4Z A;  1NDA A;  2IVE A;  4U8M A;  2B7S A;  3AE2 A;  3QVR A;  1DJN A;  4GDE A;  5BRT A;  1S2Q A;  1DJQ A;  3IHM A;  2GB0 A;  4B64 A;  4X9M A;  2YLS A;  2V3B A;  3BNU A;  2C67 A;  5JCN A;  1ELI A;  4CBQ A;  2AQJ A;  2VRM A;  2A89 A;  2WOW A;  3LJP A;  3VRD B;  1CJ3 A;  4AOS A;  2YR6 A;  1EL5 A;  2X50 A;  3V3O A;  1NAA A;  5KVH A;  2B9Y A;  1CC6 A;  1NHQ A;  2EQ8 A;  1FCD A;  3G5S A;  4K8D A;  1Q1R A;  3NYC A;  1QJD A;  2O9Z A;  4FK1 C;  2BK5 A;  1RSG A;  4Z2T A;  2YLW A;  3ATR A;  2C3C A;  3VQR A;  2BC1 A;  1RP0 A;  4I59 A;  1CJ2 A;  1H81 A;  4C3Y A;  3EAO A;  4TLZ A;  2BS2 A;  1F8S A;  4RG4 A;  1B37 A;  3DK9 A;  2BC0 A;  1NHP A;  4EM4 A;  4EMI A;  4O5U A;  1CL0 A;  3QFA A;  4Z43 A;  1GND A;  1PJ7 A;  3AB1 A;  5KWF A;  3DJG X;  2Y6Q A;  4GF7 A;  3M12 A;  1DXL A;  4JQ9 A;  5EB5 A;  5KRQ A;  2GQW A;  1IUT A;  3GD3 A;  3UKL A;  3UP5 A;  3S5W A;  5LV9 A;  2FBW A;  4A79 A;  4BJZ A;  2C7G A;  3VR8 A;  1LQU A;  5FS8 A;  3ZYX A;  1GEU A;  1CC4 A;  1RYI A;  3BNM A;  4REK A;  3SFE A;  2TMD A;  3QFB A;  5FS9 A;  2CDU A;  4JNA A;  1B4V A;  1OJ9 A;  1SEZ A;  2JB2 A;  3QVP A;  2QAE A;  1LTX R;  2GAH B;  4O5Q A;  1D4D A;  1XHC A;  1CC2 A;  4OVI A;  4Z24 A;  3SQP A;  4EIP A;  1OJA A;  1DOE A;  3EF6 A;  1GOS A;  1PXC A;  1XPQ A;  2Q6U A;  4K5R A;  4OPI A;  4H2R A;  4LA1 A;  1OJC A;  1GSN A;  3NN0 X;  3NNE A;  4B67 A;  3VRA A;  4DSH A;  4YSZ A;  1N1P A;  2VZ2 A;  3IF9 A;  5BVA A;  3D8X A;  3ALJ A;  3ICR A;  1COY A;  1H86 A;  3GWD A;  3IWA A;  3PVC A;  3G5Q A;  2R0G A;  3JSK A;  1FEA A;  2CFY A;  1JNZ A;  3KU9 A;  5CKU A;  5FMH A;  2ARD A;  2BAC A;  4FK1 A;  1E1K A;  2IID A;  1CHU A;  4A6N B;  4BV6 A;  4HA6 A;  3SM8 A;  3AEC A;  1PS9 A;  5C3J A;  1VG9 A;  1IUS A;  4CCR A;  2B7R A;  1LV0 A;  3HZL A;  4CY6 A;  4H50 A;  2C75 A;  3LOV A;  1EBD A;  3AD7 B;  1KDG A;  4U8L A;  1TDF A;  3M0O A;  2FJE A;  4IVM B;  3UTF A;  3AD9 B;  4RSL A;  3L8K A;  4H4Q A;  1D4E A;  2QA1 A;  3AE5 A;  3DGH A;  4FX9 A;  1E6E A;  2C64 A;  3CNS A;  4BJY A;  4YSH A;  4JY2 A;  1ZMC A;  4H4V A;  1KFY A;  2CVJ A;  2JKC A;  2R0P A;  2RAB A;  3II4 A;  4J2W A;  1D4C A;  4BK2 A;  4U2S A;  3K7M X;  4TM1 A;  1PDH A;  4U2T A;  1PBB A;  1P2H A;  4KPR A;  2OLO A;  3P4S A;  4H4Y A;  1L9C A;  4H7U A;  2R9Z A;  4CNJ A;  4APN A;  2XCG A;  4CY8 A;  4Z26 A;  4OPD A;  3DJJ A;  1H7X A;  3RP8 A;  2XFP A;  1P2E A;  4GUV A;  2DKH A;  2RGH A;  2IVD A;  5JCI A;  1OJD A;  4YTN A;  4OPL A;  2BS4 A;  3GYI A;  1TRB A;  2C73 A;  2YLR A;  2WP9 A;  2CUL A;  1ZY8 A;  1GV4 A;  5EOW A;  5ER0 A;  2V6O A;  3T37 A;  3S61 A;  2BXS A;  1VQW A;  4YTM A;  2RGJ A;  4DGK A;  5L46 A;  4DNA A;  2C66 A;  2YVF A;  1YKJ A;  2VVL G;  3BHK A;  2AAQ A;  3NK0 X;  4A5L A;  2J3N A;  5FS6 A;  1Y56 B;  3DME A;  3GMC A;  2XDO A;  1E1L A;  3KKJ A;  3CGB A;  1PN0 A;  3AE9 A;  1GES A;  3OC4 A;  4OPC A;  3UTG A;  1JEH A;  1JU2 A;  4U2L A;  1XAN A;  2WDV A;  4YWO A;  1OJT A;  1H83 A;  3AED A;  3GDP A;  3PO7 A;  4WCT A;  5HYM A;  4U8J A;  3F8P A;  1BF3 A;  4UDR A;  3GDN A;  3NHO X;  2X8G A;  2A8X A;  1GRG A;  2WU5 A;  1GRA A;  5JCK A;  4CRT A;  1D5T A;  1JNR A;  1D7L A;  1L9E A;  4DSG A;  4EQR A;  4EIQ A;  4TM0 A;  1F3P A;  3PS9 A;  3LXD A;  3K30 A;  4K2X A;  1CF3 A;  5EB4 A;  1Q1W A;  4J33 A;  3COX A;  1F8W A;  1PJ5 A;  3WE0 A;  4A99 A;  4B68 A;  2GEW A;  1GET A;  1IUW A;  4H2P A;  1MOK A;  2BYB A;  4OPU A;  1PBC A;  2C70 A;  2RGO A;  5BUL A;  3ICT A;  1H7W A;  1JRY A;  2GR1 A;  1M64 A;  2YWL A;  3UTH A;  3CND A;  2WPE A;  1O94 A;  1DOB A;  4XWZ A;  4Y4N A;  2AR8 A;  3CGE A;  3EAN A;  2YVG A;  3LZX A;  2VQ7 A;  2E5V A;  2XLP A;  2NPX A;  2BAB A;  2BCG G;  3LAD A;  2GRT A;  3NTA A;  1YQ3 A;  4B63 A;  3GSI A;  2Z5X A;  4H4X A;  2WET A;  2NVK X;  3K7Q X;  3UOZ A;  3CTY A;  2YAU A;  1K0I A;  2FJB A;  3UOY A;  4P9S A;  1LVL A;  1B8S A;  3NT6 A;  4NEV A;  1KNR A;  1VRQ B;  4JNQ A;  4N9X A;  2Q0L A;  4PAA A;  4OPT A;  3CPI G;  2E4G A;  3KPF A;  3AYJ A;  2GR2 A;  4A7A A;  4Z2R A;  3UP4 A;  4U8K A;  2R4J A;  3NH3 X;  3AEE A;  4H4T A;  3DJE A;  4CNK A;  3AEA A;  3V3N A;  4C74 A;  2YG7 A;  3IC9 A;  4U8O A;  1PJ6 A;  3CPH G;  1D7Y A;  2VQB A;  1ZKQ A;  2BA9 A;  3BHF A;  3OZ2 A;  4A6N A;  5U1O A;  2QA2 A;  2GVC A;  3NRN A;  1IUU A;  3UKF A;  4B65 A;  1BKW A;  3DGZ A;  1TDN A;  3CGC A;  3F8R A;  3L1R A;  3Q9T A;  3QSM A;  4LU6 A;  1BZL A;  4TM4 A;  1NHR A;  2I0Z A;  2V60 A;  4USQ A;  2QCU A;  5TR3 A;  1LQT A;  3KVE A;  3RP7 A;  3ZDN A;  4K7Z A;  4J36 A;  5M0Z A;  3AEG A;  1CJ4 A;  3AXB A;  1ONF A;  1REO A;  2TPR A;  3ISH A;  2JBV A;  1M6I A;  1O5W A;  3CGD A;  2WDQ A;  3FBS A;  3FMW A;  4USR A;  4ZCD A;  1DNC A;  3KD9 A;  3D1C A;  5DBJ A;  2FJA A;  3NYE A;  3ATQ A;  5HHF A;  4ADW A;  3NIX A;  3GMB A;  4Y4M A;  1ZDL A;  4NTD A;  4AOX A;  2WP5 A;  3NG7 X;  3RHA A;  3UKA A;  1LJ1 A;  5IQ1 A;  2B9W A;  4D03 A;  2XVF A;  3UKK A;  1GPE A;  2WQY A;  1S3E A;  4KX6 A;  4TLX A;  2PYX A;  1KSS A;  4EMW A;  1ZX9 A;  4B1B A;  1NPX A;  2F5Z A;  1Q9I A;  2YLT A;  3UCL A;  1GRE A;  2XVH A;  2BXR A;  3P4R A;  2YM2 A;  3SGL A;  2GF3 A;  2WP6 A;  2Y6R A;  4JDR A;  4A65 A;  3GRS A;  4J34 A;  4Z44 A;  2HQM A;  1E7P A;  3H4K A;  1BWC A;  3VRB A;  1QO8 A;  2WEU A;  3NKS A;  3F8D A;  1KF6 A;  1ZOY A;  4K22 A;  4U8P A;  3RP6 A;  1GRF A;  2R0C A;  4J56 A;  3RED A;  4K5S A;  3LZW A;  2C3D A;  4FDC B;  3GRT A;  1FOH A;  4NTE A;  1NHS A;  3M13 A;  3ALL A;  1QLB A;  1H82 A;  2BS3 A;  1K0J A;  4EQW A;  1TDK A;  2Z5Y A;  3K7T A;  4IV9 A;  3AEB A;  2YM1 A;  2JB1 A;  1GT8 A;  4GCM A;  1Z6L A;  4NZH A;  2E1M A;  4C5O A;  4YKG A;  3G5R A;  2GH5 A;  1EL7 A;  3NK2 X;  2XLU A;  3B6D A;  4XXG A;  2VVM A;  4ICY A;  1Y0P A;  1LPF A;  3C96 A;  3P4Q A;  1GXF A;  2GAG B;  3AE7 A;  3UOV A;  3GWF A;  3QSS A;  3I3L A;  1HYU A;  1IUX A;  5FS7 A;  1L0V A;  1VG0 A;  2XFO A;  2GR0 A;  5EBK A;  2C72 A;  3UTE A;  3CN8 A;  2WES A;  2OLN A;  3NN6 X;  4NTC A;  2WDR A;  3DJD A;  3CNJ A;  2Q7V A;  4LII A;  5IQ4 A;  4YXD A;  2JAE A;  1NEK A;  5J60 A;  1BGN A;  2WPC A;  5GSN A;  3AD8 B;  1Y56 A;  1O95 A;  1V59 A;  5KVI A;  2XFN A;  4HB9 A;  1X31 B;  4JN9 A;  2WU2 A;  1L9D A;  3CNP A;  2ZZB A;  4UDQ A;  2YVJ A;  2BK3 A;  2EQ9 A;  2ZBW A;  2R45 A;  5JCL A;  4GRT A;  1NEN A;  2V3A A;  4PAB A;  2YG4 A;  4UP3 A;  4Y4L A;  4U8N A;  4Z25 A;  4A9W A;  1PBE A;  1F8R A;  2BCP A;  5KOW A;  2R4E A;  4TM3 A;  3P9U A;  2XLR A;  1E1N A;  2GQF A;  2V61 A;  5IPY A;  4H4R A;  2B9X A;  1FL2 A;  2YG5 A;  4OCG A;  2X99 A;  4AP3 A;  2ZZC A;  2XLT A;  3GYJ A;  1H84 A;  4B69 A;  4ZCC A;  3UKH A;  1TDO A;  2APG A;  2H88 A;  1YY5 A;  4H2Q A;  2OAL A;  2FJD A;  1EL8 A;  1YQ4 A;  5C2T A;  4OPG A;  3FG2 P;  3FIM B;  3P1W A;  2R46 A;  4BK1 A;  2WHD A;  1DOC A;  4YSX A;  1TYP A;  1KNP A;  2PHH A;  3URH A;  4ECH A;  1MXT A;  4EQX A;  2OAM A;  2GR3 A;  2GMH A;  3AEF A;  2WS3 A;  4C77 A;  3O0H A;  2H89 A;  4X9N A;  4M52 A;  3RNM A;  1GTH A;  1CBO A;  3ICS A;  4JY3 A;  3V76 A;  3BI4 A;  2YR4 A;  1IUV A;  4X4J A;  3DA1 A;  2ZZ0 A;  3ITJ A;  4U8I A;  4J57 A;  2XVJ A;  4AT0 A;  1PHH A;  4RG3 A;  4EM3 A;  4Z2U A;  2C76 A;  4D04 A;  2XVE A;  2V5Z A;  3AE6 A;  3CPJ G;  3SFD A;  2WPF A;  1IJH A;  4XWR A;  3AE3 A;  1F6M A;  4H2N A;  2X8C A;  1AOG A;  1PXB A;  4GDP A;  2EQ6 A;  3LB8 A;  4IA5 A;  2X8H A;  5U25 A;  1ZP0 A;  3DH9 A;  2WBA A;  1GRB A;  1BGJ A;  2C65 A;  4H4S A; 
#chains in the Genus database with same CATH topology
 3A7U A;  2XYO A;  3NK1 X;  3BI2 A;  4AP1 A;  3VCN A;  3S47 A;  1EL9 A;  2WOV A;  3HYW A;  3CIR A;  1FEB A;  1N4V A;  2QDD A;  3OPS A;  4KEM A;  2PTY A;  4H4W A;  3E1T A;  1KSU A;  3DK4 A;  3ZVI A;  2EQ7 A;  3ABV A;  3QKE A;  4MJW A;  3AWI A;  3Q45 A;  4AT2 A;  3TW9 A;  3FPZ A;  1DOD A;  3VC5 A;  3NYF A;  4A6G A;  3QJ4 A;  3VCC A;  3SN0 A;  2XLS A;  4TVY A;  4CCQ A;  1FEC A;  3AE8 A;  1N4U A;  1K0L A;  5HY5 A;  4IP5 A;  3C4N A;  2WOI A;  3VFC A;  1CJC A;  3R0K A;  1K4Q A;  1ECQ A;  1MO9 A;  2YQU A;  4JN7 A;  3UKQ A;  3BOX A;  1NDA A;  4GDE A;  2P8B A;  1S2Q A;  4X9M A;  2PU0 A;  5FJP A;  3BNU A;  1ELI A;  4CBQ A;  3VRD B;  3S5S A;  4AOS A;  2YR6 A;  1MDR A;  1QJD A;  2O9Z A;  1X2G A;  2YLW A;  3VQR A;  1H81 A;  2QJM A;  1SJA A;  4RG4 A;  3DK9 A;  1NHP A;  3PK7 A;  4O5U A;  1CL0 A;  3DJG X;  2Y6Q A;  3M12 A;  5EB5 A;  3UJS A;  4A79 A;  1LQU A;  4GYP C;  5FS8 A;  3UGV A;  3ZYX A;  1GEU A;  1CC4 A;  3BNM A;  3QVP A;  1JPD X;  1CC2 A;  4EIP A;  4G73 A;  1GOS A;  1PXC A;  4LA1 A;  3NN0 X;  1GSN A;  3ALJ A;  2CFY A;  5CKU A;  2IID A;  4HA6 A;  1PS9 A;  4II2 A;  1VG9 A;  2QJN A;  2C75 A;  5IDZ A;  4GFI A;  1KDG A;  1TDF A;  4IVM B;  2QA1 A;  1D4E A;  3DGH A;  4JY2 A;  1JRP A;  4KWS A;  3K7M X;  4TM1 A;  3P4S A;  1MDL A;  4ZOH B;  4CNJ A;  2XCG A;  4Z26 A;  3QTP A;  3DJJ A;  1H7X A;  4ENL A;  1P2E A;  4GUV A;  2IVD A;  4YTN A;  1H2I A;  2WP9 A;  3CMM A;  2ONE A;  3SJN A;  4YTM A;  1VQW A;  2RGJ A;  1YKJ A;  3D47 A;  3BHK A;  3MZN A;  4A5L A;  4H83 A;  1Y56 B;  3CGB A;  1TZZ A;  3OC4 A;  1JEH A;  2WDV A;  1OJT A;  4U8J A;  3GDN A;  1GRG A;  1GRA A;  1JNR A;  1D7L A;  1F3P A;  3PS9 A;  1CF3 A;  5EB4 A;  4J33 A;  3COX A;  2PPG A;  4DWD A;  3WE0 A;  4B68 A;  4F4R A;  2GEW A;  1PBC A;  5KMR A;  5FJU A;  1O94 A;  4Y4N A;  3LZX A;  3EAN A;  2BCG G;  2PTZ A;  3UOZ A;  3DEQ A;  1V97 A;  1B8S A;  4NEV A;  4JNQ A;  4N9X A;  1DTN A;  3CPI G;  3KPF A;  3PWG A;  2GR2 A;  4Z2R A;  4GGB A;  2YG7 A;  3MWC A;  5G5G B;  3CPH G;  2XH0 A;  1D7Y A;  3BHF A;  1ZKQ A;  2BA9 A;  4MMW A;  2QA2 A;  3SXI A;  5M0Z A;  3ISH A;  1RM6 B;  3IJI A;  3FBS A;  4ZCD A;  3ATQ A;  3NIX A;  5IQ1 A;  1GPE A;  2WQY A;  4G8T A;  1S3E A;  4EMW A;  1N5W C;  1NPX A;  2F5Z A;  1Q9I A;  1GRE A;  4G74 A;  2GGG A;  2BXR A;  2GF3 A;  3QN3 A;  3H4K A;  1KF6 A;  1FOH A;  2GDQ A;  3NFU A;  2BS3 A;  4EQW A;  1TDK A;  2XH2 A;  1GT8 A;  4GCM A;  1Z6L A;  4YKG A;  3D9X A;  3NK2 X;  2XLU A;  2GGH A;  4Z1Y A;  4XXG A;  4ICY A;  3C96 A;  2AL2 B;  4E4U A;  3QSS A;  2GR0 A;  5EBK A;  2WES A;  2OLN A;  3NN6 X;  2WDR A;  2Q7V A;  1FO4 A;  2JAE A;  1NEK A;  5J60 A;  1BGN A;  3AD8 B;  4HB9 A;  2WU2 A;  1L9D A;  2EQ9 A;  2V3A A;  1N62 C;  4Y4L A;  4Z25 A;  3T14 A;  4TM3 A;  3D46 A;  2PU1 A;  5IPY A;  2YG5 A;  3ZVH B;  4OCG A;  4ZCC A;  4IT1 A;  2APG A;  2FJD A;  1YQ4 A;  3JVA A;  4OPG A;  1T3Q C;  3SZ0 A;  3DGB A;  1R0M A;  2GR3 A;  2GGI A;  4IL0 A;  3ICS A;  3V76 A;  4JY3 A;  3BI4 A;  4U8I A;  4AT0 A;  4RG3 A;  3MUC A;  2C76 A;  3AE6 A;  3SFD A;  5FJR A;  1PXB A;  3I6E A;  2OZ3 A;  3DH9 A;  4U8M A;  4H7U A;  2C65 A;  4H4S A;  2QDE A;  1VDC A;  4WX1 A;  1GER A;  3B97 A;  3CXB A;  2ACZ A;  4J31 A;  5HXI A;  4YTP A;  1JRO A;  2Q0K A;  4GR1 A;  2YG3 A;  4C3X A;  1TDE A;  2PP3 A;  3V5C A;  2JB3 A;  1JRZ A;  4ZCW A;  2GV8 A;  2BK4 A;  4YKF A;  1XDI A;  3C4A A;  1YQZ A;  3AE1 A;  2FYM A;  2XVI A;  5J7X A;  3P4P A;  3NS1 B;  1PBF A;  3KLJ A;  1GRH A;  1TYT A;  4NEW A;  5JCM A;  4EQS A;  4EMJ A;  1SJC A;  3T0K A;  1N4W A;  1S3B A;  2I5Q A;  5KNL A;  3UJ2 A;  5KXJ A;  3B3R A;  3AE2 A;  1DJQ A;  1PDZ A;  4B64 A;  2AQJ A;  2WOW A;  2W3R A;  1EL5 A;  2X50 A;  2OO6 A;  1NAA A;  3RO6 A;  1VQZ A;  3HPF A;  1ELS A;  4Z2T A;  2OX4 A;  2BC1 A;  2QGY A;  4TLZ A;  4EM4 A;  1JCT A;  4EMI A;  1DXL A;  3NXL A;  2OFJ A;  3UKL A;  3UP5 A;  4JN8 A;  2FBW A;  4E4F A;  1FIQ B;  7ENL A;  3IJQ A;  1RYI A;  4REK A;  2TMD A;  1SEZ A;  4O5Q A;  1D4D A;  4Z24 A;  3STP A;  1DOE A;  2PMQ A;  3SQS A;  4K1W A;  2FKP A;  4H2R A;  1OJC A;  3NNE A;  1EC9 A;  3R0U A;  3I4K A;  3T2Z A;  3IWA A;  5KMP A;  3GWD A;  2R0G A;  1JNZ A;  3KU9 A;  4IHC A;  1E1K A;  2HNE A;  4BV6 A;  1YEY A;  3SM8 A;  5C3J A;  1IUS A;  2B7R A;  3HZL A;  4CY6 A;  3M0O A;  4RSL A;  4H4Q A;  1E6E A;  2C64 A;  1ZMC A;  1KFY A;  3DDM A;  4A35 A;  2JKC A;  3II4 A;  1X2H A;  3P93 A;  3R1Z A;  2GSH A;  1PDH A;  3HRD C;  1P2H A;  2OPJ A;  2GGE A;  2PTX A;  3DIP A;  3OP2 A;  2W54 A;  4APN A;  4OPD A;  3SR6 B;  1N63 C;  3VC6 A;  4G9K A;  1ZY8 A;  3UJE A;  5EOW A;  4DGK A;  2HXU A;  5L46 A;  4DNA A;  2C66 A;  1N61 C;  2AAQ A;  5FS6 A;  3MKC A;  2XDO A;  3KKJ A;  3AE9 A;  1JU2 A;  3RIT A;  4TVW A;  3GDP A;  1BF3 A;  3SN4 A;  5ENL A;  3NHO X;  2X8G A;  2A8X A;  4EQR A;  3TOY A;  4GYP A;  3SBF A;  4TM0 A;  4H1Z A;  3RR1 A;  1IUW A;  1MOK A;  1P48 A;  1JRY A;  4E5T A;  3FXG A;  2VQ7 A;  2XLP A;  1YQ3 A;  3CTY A;  2YAU A;  1K0I A;  4P9S A;  3NT6 A;  1KNR A;  3H70 A;  2Q0L A;  4PAA A;  2E4G A;  3UP4 A;  4U8K A;  3V3N A;  3IC9 A;  1FHV A;  4U8O A;  4A6N A;  5U1O A;  4FI4 A;  4B65 A;  3QSM A;  3SN1 A;  1NEL A;  3R07 C;  3RP7 A;  4K7Z A;  3AEG A;  1REO A;  2AKZ A;  3OW1 A;  2JBV A;  5DBJ A;  2FJA A;  3NYE A;  1FFU C;  5G5H B;  3THU A;  2B9W A;  3NVZ B;  3T6C A;  4KX6 A;  2PYX A;  5BOE A;  3UCL A;  2YLT A;  3VDG A;  3P4R A;  4JDR A;  3SZC A;  4A65 A;  4Z44 A;  3VRB A;  3NKS A;  3HW2 A;  4U8P A;  1GRF A;  2P8C A;  3RED A;  3LZW A;  3ALL A;  2PSN A;  2AL2 A;  2OVL A;  3P4Q A;  3AE7 A;  3FYY A;  3GWF A;  3PG6 A;  1HYU A;  1VG0 A;  3UTE A;  3CN8 A;  3CNJ A;  1R6W A;  4YXD A;  4DHG A;  1EBG A;  1Y56 A;  1O95 A;  5KVI A;  2ZZB A;  2R45 A;  3JW7 A;  1FFV C;  1NEN A;  4PAB A;  2YG4 A;  4UP3 A;  4U8N A;  4A9W A;  1PBE A;  3T8Q A;  2X99 A;  3RCY A;  3NVY B;  1E9I A;  1H84 A;  4A3R A;  2QQ6 A;  2H88 A;  1YY5 A;  2OAL A;  3FIM B;  4YSX A;  3T4W A;  5BOF A;  3URH A;  3NVW B;  2GMH A;  3AEF A;  2WS3 A;  3O0H A;  4X9N A;  3UXK A;  1GTH A;  1CBO A;  2OZ8 A;  1IUV A;  3T2Y A;  3ITJ A;  2XVJ A;  3OTR A;  2BRA A;  2WPF A;  4XWR A;  3SSZ A;  4GDP A;  3DFH A;  3LB8 A;  2WBA A;  1GRB A;  5U63 A;  2JK6 A;  2XFU A;  2GMJ A;  4H4U A;  3Q6J A;  2PP0 A;  2W0H A;  1IYX A;  2X3N A;  4E8G A;  1PXA A;  4B66 A;  1PDY A;  3R9U A;  4YT0 A;  1GTE A;  2OQH A;  3UJR A;  4BK3 A;  3QSE A;  3UKP A;  4UDP A;  1GAL A;  1S2Y A;  3GD4 A;  3DK8 A;  2B76 A;  5M10 A;  5GRT A;  2DKI A;  2YLZ A;  4IA6 A;  3NGC X;  2XGZ A;  4H4P A;  2MNR A;  1BQG A;  3AYI A;  3VR9 A;  3AYL A;  3NLC A;  4GAV A;  1JRX A;  3H8I A;  4GME A;  2A87 A;  1ZK7 A;  3EPT A;  5J04 A;  2UZZ A;  4H4Z A;  2IVE A;  2B7S A;  3QVR A;  3AMZ A;  3CXO A;  2YLS A;  2V3B A;  5JCN A;  4YWS A;  1P43 A;  2CHR A;  3LJP A;  1CJ3 A;  3TCS A;  1CC6 A;  1NHQ A;  2ZAD A;  3G5S A;  3NYC A;  4G6H A;  1RSG A;  1RP0 A;  1CJ2 A;  4C3Y A;  3EAO A;  4DXK A;  3UCD A;  1F8S A;  2BC0 A;  3NVV B;  6ENL A;  2E5A A;  3QFA A;  4Z43 A;  3AB1 A;  3CAW A;  4GF7 A;  2OZT A;  4MKS A;  1EC7 A;  5KRQ A;  2GQW A;  5LV9 A;  4BJZ A;  2C7G A;  1W6T A;  3SFE A;  5FS9 A;  2P88 A;  2CDU A;  4JNA A;  3ES7 A;  1B4V A;  1OJ9 A;  2JB2 A;  3NRZ B;  1LTX R;  3QLD A;  2GAH B;  4OVI A;  1OJA A;  1FHU A;  3N4E A;  3ZVH A;  3R25 A;  4DSH A;  4B67 A;  2MUC A;  4YSZ A;  1N1P A;  2VZ2 A;  3IF9 A;  5BVA A;  3D8X A;  3ICR A;  1COY A;  1H86 A;  3JSK A;  4J1O A;  2BAC A;  4FK1 A;  1CHU A;  3CYJ A;  4CCR A;  1LV0 A;  4H50 A;  4U8L A;  1EBD A;  3FCP A;  3AD9 B;  3L8K A;  2PGW A;  4BJY A;  4FX9 A;  4H4V A;  3TJ4 A;  2CVJ A;  3R10 A;  2R0P A;  2RAB A;  3GY1 A;  3KPK A;  1D4C A;  3R11 A;  3TWA A;  3MSY A;  1PBB A;  2OLO A;  2R9Z A;  4HNL A;  4CY8 A;  3SY4 A;  2PCE A;  2XFP A;  2RGH A;  4ROP A;  2AL1 A;  4OPL A;  2C73 A;  5ER0 A;  2V6O A;  3S61 A;  3V3W A;  3A7A A;  3GMC A;  4H2H A;  1PN0 A;  3PFR A;  4WCT A;  4YWO A;  3AED A;  5HYM A;  3AM9 A;  1RVK A;  4CRT A;  3EUB 3;  4E6M A;  1L9E A;  3H8A A;  1Q1W A;  1PJ5 A;  1GET A;  5BUL A;  3ICT A;  1H7W A;  1M64 A;  3UTH A;  2RDX A;  4GAP A;  2ZC8 A;  1F9C A;  2YVG A;  1L8P A;  2NPX A;  2BAB A;  3LAD A;  4II3 A;  2Z5X A;  4H4X A;  2WET A;  2NVK X;  3K7Q X;  1EC8 A;  4OPT A;  2POZ A;  1JPM A;  4A7A A;  2W3S A;  3NH3 X;  3AEE A;  4H4T A;  3DJE A;  2XSX A;  4CNK A;  4EWJ A;  1PJ6 A;  3OZ2 A;  3NRN A;  2GVC A;  1BKW A;  3CK5 A;  3DGZ A;  4LU6 A;  1BZL A;  4ZA0 A;  3N4F A;  1NHR A;  2QCU A;  5TR3 A;  1LQT A;  3UJF A;  1WUF A;  1ONF A;  2TPR A;  1O5W A;  2WDQ A;  3CGD A;  1DNC A;  3D1C A;  3IK4 A;  5HHF A;  3GMB A;  1ZDL A;  2WP5 A;  3NG7 X;  2OKT A;  3RHA A;  3UKA A;  1LJ1 A;  2XVF A;  5KMQ A;  4G7F A;  1KSS A;  1ZX9 A;  2XVH A;  4K8G A;  3TWB A;  2YM2 A;  2WP6 A;  3GRS A;  4J34 A;  1BWC A;  3DFY A;  1ZOY A;  3A7R A;  2R0C A;  5FJO A;  2QJJ A;  3GRT A;  1OEP A;  4NTE A;  1NHS A;  1STZ A;  4IV9 A;  4IZG A;  3G5R A;  3B9J B;  1EL7 A;  2PP1 A;  3I6T A;  3B6D A;  2BRY A;  2VVM A;  1LPF A;  1GXF A;  3UOV A;  3I3L A;  1IUX A;  5FS7 A;  1L0V A;  2C72 A;  3SYI A;  4NTC A;  3DJD A;  5IQ4 A;  2HXT A;  2WPC A;  5GSN A;  1X31 B;  4JN9 A;  3K1G A;  3CNP A;  3DG3 A;  4UDQ A;  2BK3 A;  2ZBW A;  3GD6 A;  2E3T A;  1JDF A;  4KPL A;  2AKM A;  5JRB A;  1N5X A;  5KOW A;  1F8R A;  3P3B A;  2XLR A;  3NO1 A;  5FJT A;  1E1N A;  2V61 A;  4H4R A;  1FL2 A;  4AP3 A;  2ZZC A;  4MGG A;  2XLT A;  3GYJ A;  4B69 A;  3UKH A;  1TDO A;  3V5F A;  5C2T A;  3P1W A;  2WHD A;  1DOC A;  1TYP A;  2PHH A;  4ECH A;  1MXT A;  4EQX A;  2OAM A;  3OZY A;  3OZM A;  3RNM A;  2P3Z A;  3TTE A;  4X4J A;  3DA1 A;  2GL5 A;  1PHH A;  4X2P A;  4EM3 A;  3L5O A;  2XVE A;  2V5Z A;  3CPJ G;  1IJH A;  3BJS A;  4H2N A;  2X8C A;  2XH4 A;  1AOG A;  2EQ6 A;  4IA5 A;  1ZP0 A;  3MY9 A;  2YG6 A;  5KOX A;  2OLA A;  1E1M A;  1GRT A;  1ZMD A;  3ETR B;  3TJI A;  4ZN0 A;  4G6G A;  3AE4 A;  3BI5 A;  2VRL A;  3IHG A;  2VVL A;  3H8L A;  3I6D A;  2VOU A;  1ZOV A;  4YSY A;  3UOX A;  1UKV G;  1B5Q A;  4E0V A;  1NG4 A;  1H6V A;  2YR5 A;  1VDV A;  4DX3 A;  3ADA B;  2OA1 A;  4FP1 A;  3VA8 A;  4HCL A;  2XFQ A;  2W55 A;  3CNT A;  3KA7 A;  3GO2 A;  5CQF A;  4J3Z A;  3FJ4 A;  4BUR A;  1E39 A;  1NG3 A;  3ALM A;  4IVO B;  4I58 A;  1PBD A;  1W4X A;  5BUK A;  2YLX A;  4Z17 A;  1JOA A;  3NTD A;  1DJN A;  5BRT A;  3N6H A;  3IHM A;  2GB0 A;  3T2K A;  2C67 A;  1SB3 B;  2VRM A;  1SJD A;  2A89 A;  1KKO A;  3IJL A;  3V3O A;  5KVH A;  3KUM A;  2B9Y A;  2EQ8 A;  1WYG A;  1FCD A;  4K8D A;  1Q1R A;  4FK1 C;  2BK5 A;  3ATR A;  2C3C A;  3HYV A;  4I59 A;  3CT2 A;  3JZU A;  1SJB A;  2BS2 A;  1MUC A;  1B37 A;  4KT2 A;  3ENL A;  4K2S A;  2NQL A;  4HCD A;  1GND A;  1PJ7 A;  5KWF A;  3SX6 A;  4JQ9 A;  1IUT A;  3GD3 A;  3S5W A;  3EEZ A;  3ZLG A;  5EU9 A;  3VR8 A;  3UXL A;  1MRA A;  3QFB A;  2PGE A;  2QAE A;  3U4F A;  1KD0 A;  1XHC A;  3SQP A;  1S7M A;  2P0I A;  3EF6 A;  1KCZ A;  1XPQ A;  2Q6U A;  4K5R A;  4OPI A;  3VRA A;  3PVC A;  3G5Q A;  1FEA A;  5FMH A;  2ARD A;  5KMS A;  4A6N B;  3T31 A;  3SZW A;  3AEC A;  3PWI A;  3GYX A;  3AD7 B;  3LOV A;  2FJE A;  3UTF A;  3AE5 A;  3CNS A;  4YSH A;  4J2W A;  4BK2 A;  4U2S A;  3T9P A;  4U2T A;  4KPR A;  4H4Y A;  1L9C A;  2O56 A;  4HYR A;  3RP8 A;  2PA6 A;  2DKH A;  2DW7 A;  5JCI A;  3TQP A;  1OJD A;  2BS4 A;  3GYI A;  1TRB A;  2YLR A;  2CUL A;  1GV4 A;  2XH7 A;  4DN1 A;  3T37 A;  2BXS A;  2YVF A;  3NK0 X;  3DES A;  3P0W A;  2VVL G;  2J3N A;  3DME A;  2HZG A;  3UCC A;  1E1L A;  1GES A;  3Q4D A;  4OPC A;  3UTG A;  4U2L A;  1XAN A;  3PO7 A;  1H83 A;  3F8P A;  4UDR A;  1MNS A;  2WU5 A;  5JCK A;  1D5T A;  4NWZ A;  4DSG A;  3QPE A;  4EIQ A;  3LXD A;  3K30 A;  4K2X A;  1F8W A;  4A99 A;  4H2P A;  3H7V A;  4IP4 A;  2BYB A;  2C70 A;  2RGO A;  4OPU A;  3DG7 A;  2GR1 A;  2YWL A;  3CND A;  2WPE A;  1DOB A;  4XWZ A;  1XPY A;  2AR8 A;  1KKR A;  3CGE A;  4M0X A;  2E5V A;  4GIS A;  3MQT A;  1TKK A;  2GRT A;  3NTA A;  4B63 A;  3GSI A;  3HYX A;  2FJB A;  3UOY A;  2PS2 A;  1LVL A;  3ZLH A;  2DW6 A;  1VRQ B;  3AYJ A;  4GGH A;  2R4J A;  3AEA A;  4C74 A;  3BSM A;  3FVD A;  2VQB A;  3SZF A;  1IUU A;  3UKF A;  1TDN A;  2OQY A;  3CGC A;  3F8R A;  3L1R A;  3Q9T A;  4TM4 A;  4USQ A;  1ONE A;  1BKH A;  2I0Z A;  2V60 A;  3KVE A;  3ZDN A;  4J36 A;  1CJ4 A;  3AXB A;  4GIR A;  1M6I A;  3FMW A;  3FV9 A;  4USR A;  3KD9 A;  4ADW A;  4Y4M A;  4NTD A;  3DER A;  4AOX A;  1WUE A;  4D03 A;  3NZG A;  3UKK A;  4TLX A;  3EKG A;  4NNJ A;  4B1B A;  3SGL A;  2Y6R A;  4M6U A;  3AN1 A;  2HQM A;  3V4B A;  1E7P A;  1QO8 A;  2WEU A;  3F8D A;  4K22 A;  3RP6 A;  4DYE A;  4J56 A;  4K5S A;  2C3D A;  4FDC B;  3RRA A;  3M13 A;  1QLB A;  1H82 A;  1K0J A;  2C4C A;  2Z5Y A;  3K7T A;  3AEB A;  2YM1 A;  3GC2 A;  3N6J A;  2JB1 A;  4C5O A;  4NZH A;  2E1M A;  2GH5 A;  4HN8 A;  1Y0P A;  3H12 A;  2GAG B;  1N60 C;  1EBH A;  2XFO A;  4JHM A;  4LII A;  2PTW A;  2XFN A;  1V59 A;  2GGJ A;  2YVJ A;  5JCL A;  4GRT A;  3CB3 A;  1ZXI C;  2BCP A;  2R4E A;  4H19 A;  3P9U A;  4HNC A;  2GQF A;  2B9X A;  2QVH A;  4IL2 A;  3RGT A;  2OG9 A;  4H2Q A;  1EL8 A;  1TE6 A;  3FG2 P;  2R46 A;  4BK1 A;  1KNP A;  3ES8 A;  4HPN A;  3ZLF A;  1NU5 A;  4C77 A;  2H89 A;  4M52 A;  2YR4 A;  2ZZ0 A;  4J57 A;  4Z2U A;  3DG6 A;  4D04 A;  1KN0 A;  1XS2 A;  3AE3 A;  2POD A;  1F6M A;  2X8H A;  5U25 A;  4HCH A;  3U9I A;  1BGJ A; 
#chains in the Genus database with same CATH homology
 1VDC A;  4WX1 A;  5U63 A;  2YG6 A;  2XYO A;  2JK6 A;  1GER A;  3BI2 A;  3NK1 X;  4AP1 A;  5KOX A;  1E1M A;  1GRT A;  1ZMD A;  4ZN0 A;  2ACZ A;  4J31 A;  2XFU A;  2GMJ A;  1EL9 A;  5HXI A;  4H4U A;  4YTP A;  4G6G A;  2WOV A;  3AE4 A;  3Q6J A;  3CIR A;  2Q0K A;  4GR1 A;  1FEB A;  1N4V A;  2YG3 A;  3BI5 A;  2VRL A;  4C3X A;  2W0H A;  1TDE A;  3IHG A;  2VVL A;  3H8L A;  3I6D A;  2X3N A;  2JB3 A;  1ZOV A;  4H4W A;  2VOU A;  3E1T A;  3UOX A;  1KSU A;  1UKV G;  4YSY A;  1PXA A;  3DK4 A;  1JRZ A;  4B66 A;  1B5Q A;  2EQ7 A;  2GV8 A;  2BK4 A;  3ABV A;  3R9U A;  4MJW A;  4E0V A;  3AWI A;  4YT0 A;  1NG4 A;  1H6V A;  4YKF A;  2YR5 A;  4AT2 A;  1GTE A;  2OA1 A;  3ADA B;  3UKP A;  4BK3 A;  1XDI A;  3QSE A;  3FPZ A;  1DOD A;  3C4A A;  4UDP A;  1GAL A;  1YQZ A;  1S2Y A;  2XFQ A;  3GD4 A;  3DK8 A;  3AE1 A;  3NYF A;  2B76 A;  3CNT A;  3QJ4 A;  3KA7 A;  2XVI A;  5J7X A;  2XLS A;  3P4P A;  4CCQ A;  5M10 A;  5GRT A;  1PBF A;  5CQF A;  3KLJ A;  1FEC A;  2DKI A;  2YLZ A;  4IA6 A;  3AE8 A;  3NGC X;  1N4U A;  1GRH A;  4H4P A;  4BUR A;  1TYT A;  1K0L A;  1E39 A;  3AYI A;  1NG3 A;  5HY5 A;  4NEW A;  5JCM A;  4EQS A;  3ALM A;  4EMJ A;  3C4N A;  4I58 A;  4IVO B;  2WOI A;  1PBD A;  1W4X A;  3T0K A;  1CJC A;  3VR9 A;  1N4W A;  3AYL A;  3NLC A;  5BUK A;  1K4Q A;  1S3B A;  2YLX A;  4GAV A;  1JRX A;  1MO9 A;  3H8I A;  5KNL A;  2A87 A;  2YQU A;  5KXJ A;  1JOA A;  3UKQ A;  1ZK7 A;  3B3R A;  3NTD A;  3EPT A;  2UZZ A;  4H4Z A;  1NDA A;  2IVE A;  4U8M A;  2B7S A;  3AE2 A;  3QVR A;  1DJN A;  4GDE A;  5BRT A;  1S2Q A;  1DJQ A;  3IHM A;  2GB0 A;  4B64 A;  4X9M A;  2YLS A;  3T2K A;  2V3B A;  3BNU A;  2C67 A;  5JCN A;  1ELI A;  4CBQ A;  2AQJ A;  2VRM A;  2A89 A;  2WOW A;  3LJP A;  3VRD B;  1CJ3 A;  4AOS A;  2YR6 A;  1EL5 A;  2X50 A;  3V3O A;  1NAA A;  5KVH A;  2B9Y A;  1CC6 A;  1NHQ A;  2EQ8 A;  1FCD A;  3G5S A;  4K8D A;  1Q1R A;  3NYC A;  1QJD A;  2O9Z A;  4FK1 C;  2BK5 A;  4G6H A;  1RSG A;  4Z2T A;  2YLW A;  3ATR A;  2C3C A;  3VQR A;  3HYV A;  2BC1 A;  1RP0 A;  4I59 A;  1CJ2 A;  1H81 A;  4C3Y A;  3EAO A;  4TLZ A;  2BS2 A;  1F8S A;  4RG4 A;  1B37 A;  3DK9 A;  2BC0 A;  1NHP A;  4EM4 A;  4EMI A;  4O5U A;  1CL0 A;  3QFA A;  4Z43 A;  1GND A;  1PJ7 A;  3AB1 A;  5KWF A;  3DJG X;  2Y6Q A;  4GF7 A;  3M12 A;  1DXL A;  3SX6 A;  4JQ9 A;  5EB5 A;  5KRQ A;  2GQW A;  1IUT A;  3GD3 A;  3UKL A;  3UP5 A;  3S5W A;  5LV9 A;  3HYW A;  2FBW A;  4A79 A;  4BJZ A;  2C7G A;  3VR8 A;  1LQU A;  5FS8 A;  3ZYX A;  1GEU A;  1CC4 A;  1RYI A;  3BNM A;  4REK A;  3SFE A;  2TMD A;  3QFB A;  5FS9 A;  2CDU A;  4JNA A;  1B4V A;  1OJ9 A;  1SEZ A;  2JB2 A;  3QVP A;  2QAE A;  1LTX R;  2GAH B;  4O5Q A;  1D4D A;  1XHC A;  1CC2 A;  4OVI A;  4Z24 A;  3SQP A;  4EIP A;  1OJA A;  1DOE A;  1S7M A;  3EF6 A;  4G73 A;  1GOS A;  1PXC A;  1XPQ A;  2Q6U A;  4K5R A;  4OPI A;  4H2R A;  4LA1 A;  1OJC A;  1GSN A;  3NN0 X;  3NNE A;  4B67 A;  3VRA A;  4DSH A;  4YSZ A;  1N1P A;  2VZ2 A;  3T2Z A;  3IF9 A;  5BVA A;  3D8X A;  3ALJ A;  3ICR A;  1COY A;  1H86 A;  3GWD A;  3IWA A;  3PVC A;  3G5Q A;  5KMP A;  2R0G A;  3JSK A;  1FEA A;  2CFY A;  1JNZ A;  3KU9 A;  5CKU A;  5FMH A;  2ARD A;  2BAC A;  4FK1 A;  5KMS A;  1E1K A;  2IID A;  1CHU A;  4A6N B;  4BV6 A;  4HA6 A;  3SM8 A;  3SZW A;  3T31 A;  3AEC A;  1PS9 A;  4II2 A;  1VG9 A;  5C3J A;  1IUS A;  4CCR A;  2B7R A;  1LV0 A;  3HZL A;  4CY6 A;  4H50 A;  2C75 A;  3GYX A;  1EBD A;  3AD7 B;  1KDG A;  3LOV A;  4U8L A;  1TDF A;  3M0O A;  2FJE A;  4IVM B;  3UTF A;  3AD9 B;  4RSL A;  3L8K A;  4H4Q A;  1D4E A;  2QA1 A;  3AE5 A;  3DGH A;  4FX9 A;  1E6E A;  2C64 A;  3CNS A;  4BJY A;  4YSH A;  4JY2 A;  1ZMC A;  4H4V A;  1KFY A;  2CVJ A;  2JKC A;  2R0P A;  2RAB A;  3II4 A;  3KPK A;  4J2W A;  1D4C A;  4BK2 A;  4U2S A;  3K7M X;  4TM1 A;  1PDH A;  4U2T A;  1PBB A;  1P2H A;  4KPR A;  2OLO A;  3P4S A;  4H4Y A;  1L9C A;  4H7U A;  2R9Z A;  4CNJ A;  4APN A;  2XCG A;  4CY8 A;  4Z26 A;  3SY4 A;  4OPD A;  3DJJ A;  1H7X A;  3RP8 A;  2XFP A;  1P2E A;  4GUV A;  2DKH A;  2RGH A;  2IVD A;  5JCI A;  1OJD A;  4YTN A;  4OPL A;  1H2I A;  2BS4 A;  1TRB A;  2C73 A;  2YLR A;  3GYI A;  4G9K A;  2WP9 A;  2CUL A;  1ZY8 A;  1GV4 A;  5EOW A;  3CMM A;  5ER0 A;  2V6O A;  3T37 A;  3S61 A;  2BXS A;  1VQW A;  4YTM A;  2RGJ A;  4DGK A;  5L46 A;  4DNA A;  2C66 A;  2YVF A;  1YKJ A;  2VVL G;  3BHK A;  2AAQ A;  3NK0 X;  4A5L A;  2J3N A;  5FS6 A;  1Y56 B;  3DME A;  3GMC A;  2XDO A;  1E1L A;  3KKJ A;  3CGB A;  1PN0 A;  3AE9 A;  1GES A;  3OC4 A;  4OPC A;  3UTG A;  1JEH A;  1JU2 A;  4U2L A;  1XAN A;  2WDV A;  4YWO A;  1OJT A;  1H83 A;  3AED A;  3GDP A;  3PO7 A;  4WCT A;  5HYM A;  4U8J A;  3F8P A;  1BF3 A;  4UDR A;  3GDN A;  3NHO X;  2X8G A;  2A8X A;  1GRG A;  2WU5 A;  1GRA A;  5JCK A;  4CRT A;  1D5T A;  1JNR A;  1D7L A;  1L9E A;  4NWZ A;  4DSG A;  4EQR A;  4EIQ A;  4TM0 A;  1F3P A;  3PS9 A;  3LXD A;  3K30 A;  4K2X A;  1CF3 A;  5EB4 A;  1Q1W A;  4J33 A;  3COX A;  1F8W A;  1PJ5 A;  3WE0 A;  4A99 A;  4B68 A;  2GEW A;  1GET A;  1IUW A;  4H2P A;  1MOK A;  2BYB A;  4OPU A;  1PBC A;  2C70 A;  2RGO A;  5BUL A;  3ICT A;  5KMR A;  1H7W A;  1JRY A;  2GR1 A;  1M64 A;  2YWL A;  3UTH A;  3CND A;  2WPE A;  1O94 A;  1DOB A;  4XWZ A;  4GAP A;  4Y4N A;  2AR8 A;  3CGE A;  3EAN A;  2YVG A;  3LZX A;  2VQ7 A;  2E5V A;  2XLP A;  2NPX A;  2BAB A;  2BCG G;  3LAD A;  2GRT A;  3NTA A;  4II3 A;  1YQ3 A;  4B63 A;  3GSI A;  2Z5X A;  4H4X A;  2WET A;  2NVK X;  3K7Q X;  3UOZ A;  3HYX A;  3CTY A;  2YAU A;  1K0I A;  2FJB A;  3UOY A;  4P9S A;  1LVL A;  1B8S A;  3NT6 A;  4NEV A;  1KNR A;  1VRQ B;  4JNQ A;  4N9X A;  2Q0L A;  4PAA A;  4OPT A;  3CPI G;  2E4G A;  3KPF A;  3AYJ A;  2GR2 A;  4A7A A;  4Z2R A;  3UP4 A;  4U8K A;  2R4J A;  3NH3 X;  3AEE A;  4H4T A;  3DJE A;  4CNK A;  3AEA A;  3V3N A;  4C74 A;  2YG7 A;  3IC9 A;  4U8O A;  1PJ6 A;  3CPH G;  1D7Y A;  2VQB A;  1ZKQ A;  2BA9 A;  3BHF A;  3OZ2 A;  3SZF A;  4A6N A;  5U1O A;  2QA2 A;  2GVC A;  3NRN A;  1IUU A;  3UKF A;  4B65 A;  1BKW A;  3DGZ A;  1TDN A;  3CGC A;  3F8R A;  3L1R A;  3Q9T A;  3QSM A;  4LU6 A;  1BZL A;  4TM4 A;  3SXI A;  1NHR A;  2I0Z A;  2V60 A;  4USQ A;  2QCU A;  5TR3 A;  1LQT A;  3KVE A;  3RP7 A;  3ZDN A;  4K7Z A;  4J36 A;  5M0Z A;  3AEG A;  1CJ4 A;  3AXB A;  1ONF A;  1REO A;  2TPR A;  3ISH A;  2JBV A;  1M6I A;  1O5W A;  3CGD A;  2WDQ A;  3FBS A;  3FMW A;  4USR A;  4ZCD A;  1DNC A;  3KD9 A;  3D1C A;  5DBJ A;  2FJA A;  3NYE A;  3ATQ A;  5HHF A;  4ADW A;  3NIX A;  3GMB A;  4Y4M A;  1ZDL A;  4NTD A;  4AOX A;  2WP5 A;  3NG7 X;  3RHA A;  3UKA A;  1LJ1 A;  5IQ1 A;  2B9W A;  4D03 A;  2XVF A;  3UKK A;  1GPE A;  2WQY A;  1S3E A;  4KX6 A;  4TLX A;  4NNJ A;  5KMQ A;  2PYX A;  1KSS A;  4EMW A;  1ZX9 A;  4B1B A;  1NPX A;  2F5Z A;  1Q9I A;  2YLT A;  3UCL A;  1GRE A;  4G74 A;  2XVH A;  2BXR A;  3P4R A;  2YM2 A;  3SGL A;  2GF3 A;  2WP6 A;  2Y6R A;  4JDR A;  3SZC A;  4A65 A;  3GRS A;  4J34 A;  4Z44 A;  2HQM A;  1E7P A;  3H4K A;  1BWC A;  3VRB A;  1QO8 A;  2WEU A;  3NKS A;  3F8D A;  1KF6 A;  1ZOY A;  4K22 A;  4U8P A;  3RP6 A;  1GRF A;  2R0C A;  4J56 A;  3RED A;  4K5S A;  3LZW A;  2C3D A;  4FDC B;  3GRT A;  1FOH A;  4NTE A;  1NHS A;  3M13 A;  3ALL A;  1QLB A;  1H82 A;  2BS3 A;  1K0J A;  2C4C A;  4EQW A;  1TDK A;  2Z5Y A;  3K7T A;  4IV9 A;  3AEB A;  2YM1 A;  2JB1 A;  1GT8 A;  4GCM A;  1Z6L A;  4NZH A;  2E1M A;  4C5O A;  3D9X A;  3G5R A;  4YKG A;  2GH5 A;  1EL7 A;  3NK2 X;  2XLU A;  3B6D A;  4XXG A;  2BRY A;  2VVM A;  4ICY A;  1Y0P A;  1LPF A;  3C96 A;  3P4Q A;  1GXF A;  2GAG B;  3AE7 A;  3UOV A;  3GWF A;  3PG6 A;  3QSS A;  3I3L A;  1HYU A;  1IUX A;  5FS7 A;  1L0V A;  1VG0 A;  2XFO A;  2GR0 A;  5EBK A;  2C72 A;  3SYI A;  3UTE A;  3CN8 A;  2WES A;  2OLN A;  3NN6 X;  4NTC A;  2WDR A;  3DJD A;  3CNJ A;  2Q7V A;  4LII A;  5IQ4 A;  4YXD A;  2JAE A;  1NEK A;  5J60 A;  1BGN A;  2WPC A;  5GSN A;  3AD8 B;  1Y56 A;  1O95 A;  1V59 A;  5KVI A;  2XFN A;  4HB9 A;  1X31 B;  4JN9 A;  2WU2 A;  1L9D A;  3CNP A;  2ZZB A;  4UDQ A;  2YVJ A;  2BK3 A;  2EQ9 A;  2ZBW A;  2R45 A;  5JCL A;  4GRT A;  1NEN A;  2V3A A;  4PAB A;  2YG4 A;  4UP3 A;  4Y4L A;  4U8N A;  5JRB A;  3T14 A;  4Z25 A;  4A9W A;  1PBE A;  1F8R A;  2BCP A;  5KOW A;  2R4E A;  4TM3 A;  3P9U A;  2XLR A;  1E1N A;  2GQF A;  2V61 A;  5IPY A;  4H4R A;  2B9X A;  1FL2 A;  2YG5 A;  4OCG A;  2X99 A;  4AP3 A;  2ZZC A;  2XLT A;  3GYJ A;  1H84 A;  4B69 A;  4ZCC A;  3UKH A;  1TDO A;  2APG A;  2H88 A;  1YY5 A;  4H2Q A;  2OAL A;  2FJD A;  1EL8 A;  1YQ4 A;  5C2T A;  4OPG A;  3FG2 P;  3FIM B;  3P1W A;  2R46 A;  4BK1 A;  2WHD A;  1DOC A;  3SZ0 A;  4YSX A;  1TYP A;  1KNP A;  2PHH A;  3URH A;  4ECH A;  1MXT A;  4EQX A;  2OAM A;  2GR3 A;  2GMH A;  3AEF A;  2WS3 A;  4C77 A;  3O0H A;  2H89 A;  4X9N A;  4M52 A;  3RNM A;  1GTH A;  1CBO A;  3ICS A;  4JY3 A;  3V76 A;  3BI4 A;  2YR4 A;  1IUV A;  4X4J A;  3DA1 A;  2ZZ0 A;  3T2Y A;  3ITJ A;  4U8I A;  4J57 A;  2XVJ A;  4AT0 A;  1PHH A;  4RG3 A;  4EM3 A;  4Z2U A;  2C76 A;  3L5O A;  4D04 A;  2BRA A;  2V5Z A;  2XVE A;  3AE6 A;  3CPJ G;  3SFD A;  1KN0 A;  2WPF A;  1IJH A;  4XWR A;  3AE3 A;  1F6M A;  4H2N A;  2X8C A;  1AOG A;  1PXB A;  4GDP A;  2EQ6 A;  3LB8 A;  4IA5 A;  2X8H A;  5U25 A;  1ZP0 A;  3DH9 A;  2WBA A;  1GRB A;  1BGJ A;  2C65 A;  4H4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...