3DGHA

Crystal structure of drosophila thioredoxin reductase, c-terminal 8-residue truncation
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
477
structure length
477
Chain Sequence
SYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDDKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKDKIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase 1, mitochondrial
publication title Crystal Structure of Drosophila Thioredoxin Reductase, C-terminal 8-residue truncation
rcsb
source organism Drosophila melanogaster
total genus 155
structure length 477
sequence length 477
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF00890 FAD_binding_2 FAD binding domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3dghA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dghA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dghA02
3AD9B 4RG4A 2HQMA 1N4UA 5FMHA 1PXBA 3PVCA 1H81A 1K0LA 2WP9A 4H50A 3M0OA 1EL9A 3SQPA 2V60A 4GF7A 4Z44A 3UP4A 3V3OA 4BJZA 2YG6A 2RGJA 1PBBA 5JCKA 1TDKA 2VVMA 3QJ4A 2WDRA 2WESA 3REDA 3DGHA 2WBAA 3URHA 2C75A 4TM0A 2X8HA 4JQ9A 5FS9A 1TDEA 3DJEA 2OAMA 4H2PA 2ZZBA 1L0VA 3CIRA 2NPXA 3T37A 3ABVA 5C3JA 2OALA 4DSGA 2FJEA 2YVFA 4M52A 1VG9A 2BXRA 3ICTA 2GR3A 1CC6A 4LA1A 4GCMA 1UKVG 2IVEA 3NIXA 2R0CA 2YLTA 3ADAB 4ZN0A 1LVLA 1YQ3A 3UKPA 5HYMA 4NTDA 1DOBA 1CJCA 5JCIA 5U1OA 2XFPA 3AE4A 2VQBA 4UDQA 1D4DA 4EM4A 4GRTA 3NN0X 4A79A 2GV8A 2FJBA 3B6DA 4B66A 4HA6A 4U8JA 4Z43A 3SFDA 2V3BA 4OVIA 2DKHA 3AEEA 2EQ7A 1LQUA 2YAUA 3I6DA 1FEBA 1GRTA 2X50A 3GRTA 4FX9A 1GALA 4J31A 2YWLA 3UKHA 1D7YA 3SM8A 3H8LA 3GD3A 2VVLG 3VRBA 4OPUA 1XHCA 4YTNA 2H88A 5HHFA 4OPGA 3DJGX 1L9DA 1E1NA 1GNDA 1Y56A 4H4RA 1E6EA 2OLOA 3KU9A 3EAOA 4TLZA 4U8IA 1CC4A 3GDNA 4GR1A 3CPIG 4AT2A 4ZCDA 5KOWA 2GAHB 1S2YA 4GDEA 4P9SA 4OPIA 2WDVA 2E1MA 4EIPA 4B64A 1L9EA 1GTEA 1PBDA 4EQSA 1B8SA 1S3EA 1GRFA 2DKIA 3LJPA 2C70A 3ZDNA 2GRTA 2VRLA 3CGDA 4EMIA 1TDNA 3CGCA 4X9NA 3LOVA 4OPTA 3GRSA 1FOHA 1N4VA 1YQZA 5BRTA 4JNAA 4NEVA 1OJTA 1ZMDA 1E7PA 3AE2A 1P2HA 1ZKQA 4Z24A 2UZZA 1D5TA 2BYBA 1KNPA 3UOVA 2J3NA 3VQRA 1ZOVA 3UTGA 2E5VA 3P4QA 3S61A 4H4PA 2C67A 3AEDA 1NAAA 1GT8A 1CC2A 2BC1A 4OPDA 2QA1A 2YLRA 4H7UA 3L1RA 1TYTA 1PJ6A 2JAEA 2V61A 4OCGA 3RHAA 1H6VA 1PJ7A 4K2XA 1DNCA 3BNUA 3ITJA 3NN6X 5KWFA 1NG3A 4U2LA 4RSLA 1F8SA 2YR6A 3AWIA 3P1WA 5JCMA 3JSKA 2W0HA 1PS9A 4CCQA 4CY6A 5BULA 1NHSA 5KVHA 3ATQA 1NG4A 1ELIA 3BHFA 3NHOX 4JY2A 3UKFA 1OJDA 1BGNA 4BJYA 3Q9TA 3BI2A 4EM3A 3NTDA 4H2NA 4HB9A 3F8PA 4D03A 1BGJA 2YR4A 2YVJA 3VR9A 1Y0PA 2WU5A 2YLXA 3P4RA 3UOYA 2VVLA 2JK6A 4IVOB 2XCGA 4I59A 1Q9IA 2C76A 3IF9A 2GEWA 5KXJA 4KPRA 2WHDA 3NYEA 3EPTA 1GESA 4ECHA 1H84A 3RP7A 4IA5A 2Q0LA 2XLRA 3S5WA 1GV4A 5HY5A 4NTCA 2B76A 4J57A 2BK5A 2YR5A 1TYPA 4U2TA 4K5RA 3GMCA 2FJAA 4U8KA 4Z2RA 1ZP0A 3NYFA 4Z2TA 2C64A 4JDRA 1XPQA 2WDQA 3ALLA 4Z26A 3DH9A 2AAQA 5GRTA 3BNMA 3NK0X 4BK3A 3ALMA 2WS3A 4PABA 2RABA 4LU6A 3VRAA 2V5ZA 3C4AA 5EOWA 4EMJA 1N4WA 2WOVA 3QSMA 2YLZA 1DJQA 1GOSA 1O94A 3FG2P 2V3AA 1S2QA 2YG7A 4IVMB 3DA1A 2Q0KA 3EF6A 2FJDA 1PHHA 2XVEA 3FPZA 1E39A 3AE5A 3H8IA 4J56A 3PS9A 5JCNA 3UOZA 1K0JA 4GDPA 4WX1A 1ZMCA 4IV9A 1EBDA 4XWZA 4YTPA 2YVGA 2C65A 1S3BA 2Z5XA 2XFQA 4YKFA 4A99A 2OA1A 1TRBA 3VRDB 4UDRA 3VR8A 1JRZA 1E1KA 4CRTA 1O95A 3KKJA 2BA9A 4H4QA 2GR0A 1MOKA 4DSHA 4J2WA 2GMHA 4H4YA 2PHHA 3NG7X 3F8DA 5DBJA 1NENA 3D1CA 3NYCA 1JRYA 3RNMA 1B5QA 2YG3A 4BK1A 4YSYA 2WOIA 2WETA 4H2QA 4Z25A 4RG3A 1SEZA 3M12A 1K0IA 2WEUA 2JB1A 3SFEA 3LZWA 1MXTA 3QFBA 1QLBA 3L8KA 2VOUA 4A9WA 3FBSA 2ACZA 3P4PA 5U63A 1RSGA 4K5SA 1IUVA 4ADWA 4BURA 4NTEA 2GQFA 2BS2A 3UKQA 3COXA 2XFUA 4B65A 1B37A 3AE8A 1BKWA 1QJDA 3ICRA 4A6NB 3QVRA 2WPFA 2YM1A 1LTXR 3C96A 3KD9A 1TDFA 4CBQA 4GUVA 4CNJA 2CVJA 1LV0A 3BI5A 3CTYA 3AE6A 2BK3A 4X4JA 3UKKA 1L9CA 1LJ1A 2CULA 4A5LA 2B9XA 4C3XA 3AD7B 3II4A 4YT0A 4AP1A 3GYJA 5KVIA 2VQ7A 1RP0A 3C4NA 1FL2A 1NHPA 3P9UA 1VQWA 1PXCA 3NK1X 1GTHA 3M13A 2BC0A 3DK8A 4AP3A 5L46A 3AYJA 3AYIA 3GMBA 4XXGA 3F8RA 3FMWA 1JNZA 3GD4A 3AEBA 1D4EA 5EB4A 1VG0A 3UKLA 3CNJA 3NNEA 1BWCA 3K30A 2EQ9A 3OZ2A 1GSNA 4ZCCA 1QO8A 5BUKA 4Y4NA 3O0HA 4B69A 1P2EA 4NZHA 5FS7A 1GREA 2BS4A 1EL5A 3QVPA 1DOEA 3IWAA 5CQFA 2C7GA 3V76A 3AECA 1F6MA 5EBKA 1H83A 1PJ5A 2B9YA 1JEHA 2RGOA 2Z5YA 3AD8B 1ONFA 3CN8A 2XLPA 3ISHA 3K7MX 2NVKX 4B68A 2R46A 1LPFA 4UDPA 2R0GA 1ZOYA 1F8RA 1GXFA 3AEGA 4J33A 2GR1A 3G5RA 5C2TA 1Z6LA 3NK2X 2JKCA 3CNSA 1CJ4A 1PXAA 5CKUA 3QSEA 3ZYXA 1V59A 1DJNA 1JNRA 1KFYA 1OJCA 2BACA 3WE0A 1X31B 1YY5A 2YQUA 3P4SA 4E0VA 4JNQA 3K7TA 4N9XA 1IUSA 3NLCA 3NTAA 3CGEA 3IHMA 2OLNA 2VZ2A 5ER0A 2TMDA 1F3PA 5GSNA 4U8PA 2JB3A 4REKA 1DODA 1M6IA 2ZZCA 2XDOA 4U8NA 5BVAA 2X3NA 1D7LA 4KX6A 3AEAA 5EB5A 4XWRA 4TM3A 3KA7A 3NH3X 3RP6A 1H82A 2GB0A 3V3NA 4AT0A 4H2RA 2BABA 1N1PA 2VRMA 5KOXA 2IVDA 2GAGB 4IA6A 2Y6QA 3GDPA 2Q6UA 4TLXA 2WOWA 1KF6A 4C5OA 3UTHA 1XANA 4H4ZA 4TM4A 1PBEA 4OPLA 1DXLA 1GPEA 2XLUA 3UKAA 4D04A 3IC9A 5U25A 1IUXA 3AE1A 1KDGA 1Y56B 2WQYA 1CJ3A 2BXSA 2YLSA 1MO9A 3DMEA 4K7ZA 5FS8A 2B7SA 2EQ8A 1DOCA 2ARDA 2GR2A 4K8DA 3Q6JA 3KVEA 1GRBA 4O5QA 4J36A 2GF3A 1KSUA 1EL8A 4EQXA 2C3DA 3NGCX 1GEUA 4MJWA 2XLSA 1HYUA 1KSSA 1PN0A 2ZBWA 2PYXA 1YQ4A 2E4GA 3GSIA 3UP5A 4YXDA 2WP6A 1OJ9A 4CCRA 3PO7A 2GVCA 2JBVA 1OJAA 5IQ1A 1PDHA 3D8XA 5TR3A 3LXDA 5JCLA 2WU2A 3UTFA 3AYLA 4B63A 2X99A 1AOGA 1PBCA 3HZLA 4PAAA 4WCTA 4AOSA 2AQJA 4C77A 3G5QA 4U8OA 2B9WA 2A8XA 2RGHA 4B67A 2B7RA 3LB8A 2QAEA 1FECA 1YKJA 3QSSA 2IIDA 4YSZA 4A65A 1W4XA 2R4EA 2JB2A 5KRQA 5J60A 4YWOA 3SGLA 3AEFA 1CJ2A 1CBOA 3AE3A 2XVHA 1NHQA 2APGA 4YKGA 2YLWA 4UP3A 1NEKA 4H4SA 4BV6A 4I58A 1GERA 2XVFA 4C3YA 3ATRA 2BK4A 4JY3A 3IHGA 3NT6A 2YG5A 3DJJA 2XFOA 3BHKA 3CNPA 4EIQA 2BCGG 1ZY8A 2A89A 4Z2UA 4TM1A 1JRXA 4Y4LA 3UTEA 3KLJA 2Y6RA 4FK1A 1COYA 2O9ZA 1IUUA 4K22A 1B4VA 4J34A 1GRGA 1CHUA 4Y4MA 3G5SA 3E1TA 5LV9A 2WPCA 2FBWA 1ZX9A 2EQ6A 4AOXA 3CNTA 3CPHG 3GWFA 1H86A 2GMJA 2XYOA 1NHRA 2GH5A 1E1MA 5IQ4A 4H4XA 1IUWA 2X8CA 2BS3A 3CPJG 2F5ZA 4OPCA 1EL7A 3LZXA 3KPFA 4DGKA 1ZDLA 4EQRA 4CNKA 4BK2A 2C3CA 1BZLA 2R0PA 2QCUA 1Q1RA 3I3LA 3DK4A 3DJDA 4YTMA 1ZK7A 2TPRA 2GQWA 4YSHA 4H4TA 4B1BA 2C73A 2H89A 2Q7VA 3GWDA 4EMWA 4FDCB 3RP8A 2V6OA 2ZZ0A 4A7AA 2BCPA 4X9MA 3NKSA 4A6NA 3H4KA 4H4WA 1BF3A 3AXBA 2C66A 1E1LA 2QA2A 3AB1A 5IPYA 3ICSA 1REOA 3NRNA 2XLTA 4JN9A 4USQA 2C72A 3DK9A 4U8LA 1Q1WA 2CFYA 5FS6A 3K7QX 2XVJA 1KNRA 2X8GA 1XDIA 2A87A 4O5UA 4YSXA 4H4VA 1D4CA 3CNDA 1GETA 1NPXA 4LIIA 4CY8A 3OC4A 2R45A 4USRA 1M64A 3R9UA 2I0ZA 4FK1C 2XFNA 1FCDA 4H4UA 4EQWA 1VDCA 3GYIA 3B3RA 1GRAA 2WP5A 1RYIA 3EANA 3CGBA 1IJHA 5J7XA 3UOXA 3QFAA 2XVIA 2R9ZA 2AR8A 1IUTA 5M0ZA 2WPEA 1PBFA 1GRHA 4ICYA 1LQTA 4NEWA 2CDUA 4U8MA 4APNA 1JU2A 3UCLA 1H7XA 3ALJA 1TDOA 1VRQB 3BI4A 1CF3A 2YM2A 5HXIA 2YG4A 4U2SA 3AE7A 1FEAA 1CL0A 3DGZA 1NDAA 1K4QA 3AE9A 1H7WA 1F8WA 1JOAA 3FIMB 3LADA 1O5WA 2R4JA 4DNAA 5M10A 4C74A
chains in the Genus database with same CATH superfamily
3AD9B 3K1GA 1K0LA 4H50A 1KKOA 3DDMA 4FP1A 4H2PA 3T37A 4DSGA 2FJEA 2BXRA 2AL1A 4GCMA 3ADAB 1E9IA 3AE4A 4A79A 4GRTA 2FJBA 3B6DA 4U8JA 4Z43A 4K8GA 2EQ7A 4FX9A 4A3RA 3SM8A 3VRBA 3DJGX 1E1NA 4MMWA 3SN4A 1GNDA 3EAOA 4AT2A 5KOWA 3A7AA 3MY9A 2WDVA 2E1MA 4B64A 1L9EA 1S3EA 2DKIA 2QGYA 3CGCA 1FOHA 3JVAA 1YQZA 2E3TA 4NEVA 4JNAA 5BOFA 1E7PA 1D5TA 3H7VA 3PWGA 1KNPA 2PP1A 2PTWA 2C4CA 3S61A 3ITJA 3EEZA 3NRZB 3I6TA 4ROPA 4JY2A 4BJYA 4EM3A 4H2NA 4MGGA 3R0UA 1Y0PA 2YLXA 2VVLA 3KUMA 2GEWA 4GGBA 2WHDA 4KPLA 2HXUA 3NYEA 1H84A 3RP7A 5HY5A 4NTCA 2BK5A 2XH7A 3GMCA 3NYFA 2WDQA 3ALLA 5GRTA 3NK0X 4BK3A 2MNRA 5EOWA 1N4WA 2YLZA 1GOSA 2V3AA 1S2QA 2YG7A 3EF6A 3VA8A 3AE5A 4DXKA 3RRAA 5JCNA 3PS9A 3UOZA 4XWZA 2C65A 1ONEA 3UXLA 2W55A 4HYRA 3N4EA 2GR0A 4J2WA 3NG7X 3D1CA 1JRPA 2WOIA 1K0IA 3LZWA 1MXTA 3FBSA 3P4PA 1IUVA 4ADWA 4G8TA 3UKQA 2XFUA 4B65A 2QQ6A 1QJDA 3QVRA 2YM1A 1IYXA 3KD9A 3IJLA 4A5LA 1KKRA 3AD7B 3II4A 1KD0A 4YT0A 3C4NA 1PXCA 4AP3A 2BC0A 3DK8A 3GMBA 3ZLFA 5FJRA 4XXGA 1JNZA 2OZ3A 3GY1A 3K30A 2PCEA 2EQ9A 1N60C 5BUKA 3O0HA 1P2EA 4NZHA 3TCSA 3QVPA 1DOEA 2C7GA 3OP2A 3N6HA 1PJ5A 4U2SA 3ISHA 3SN0A 2Z5YA 2FKPA 3AD8B 1DTNA 2HNEA 2NVKX 2R46A 1LPFA 1BKHA 1GXFA 3AEGA 5C2TA 2GR1A 2OZTA 3G5RA 2POZA 5CKUA 3WE0A 3R1ZA 4EWJA 5FJTA 1X31B 2PMQA 1YY5A 1NELA 2OPJA 4HCDA 1ECQA 2JB3A 1DODA 2ZZCA 4E4UA 2X3NA 1D7LA 4KX6A 3AEAA 4XWRA 2GAGB 4TLXA 3UTHA 1DXLA 2XLUA 4D04A 5U25A 1IUXA 2OG9A 4GIRA 3DMEA 1DOCA 2ARDA 1SB3B 4K8DA 1MUCA 3KVEA 1TE6A 1GEUA 1HYUA 1KSSA 2ZBWA 3VDGA 2E4GA 4YXDA 3N6JA 4M6UA 3AYLA 4PAAA 2PTYA 4C77A 2AKMA 2A8XA 2QJMA 3QSSA 2R4EA 5KRQA 5J60A 3AEFA 1CJ2A 4E4FA 3TW9A 2YLWA 4H4SA 2XVFA 4C3YA 4MKSA 4IHCA 3NT6A 3DJJA 4EIQA 1ZY8A 2A89A 4Z2UA 1P43A 3KLJA 4FK1A 5BOEA 4GMEA 1CHUA 3G5SA 3E1TA 3ES7A 2WPCA 4AOXA 3GD6A 4HNCA 3GWFA 1NHRA 1IUWA 2BS3A 4EQRA 4CNKA 2GSHA 4YTMA 4B1BA 2PGWA 2H89A 2Q7VA 3GWDA 4EMWA 3IJIA 3RP8A 3OZYA 5JRBA 1JPMA 1BF3A 5FJPA 3AXBA 2QA2A 4KEMA 2C72A 4U8LA 1N62C 3V5FA 3JZUA 1D4CA 1GETA 3EKGA 2XFNA 4H4UA 3GYIA 1VDCA 3DG7A 3QFAA 1SJCA 4NEWA 2CDUA 4U8MA 3UCLA 1JDFA 1STZA 1ZXIC 3BI4A 5HXIA 3GC2A 3AE7A 1FHVA 3SJNA 3AE9A 4RG4A 4G6HA 2HQMA 3PVCA 1H81A 3SZWA 4H2HA 1PBBA 2VVMA 3DGHA 3TQPA 2C75A 4TM0A 3VC6A 3BSMA 1L0VA 4M52A 2GR3A 1CC6A 4LA1A 1UKVG 3SYIA 3UKPA 2PP3A 4HA6A 3UJEA 1LQUA 1GRTA 2X50A 3ZLHA 3H8LA 3GD3A 2VVLG 4OPUA 4X2PA 2H88A 5HHFA 2GDQA 5IDZA 4OPGA 1L9DA 4TLZA 3KU9A 1E6EA 4HCLA 2PPGA 4B66A 3P93A 3CPIG 4J3ZA 4GDEA 2BRYA 6ENLA 4EIPA 1GTEA 2C70A 2GRTA 4II2A 4X9NA 4K1WA 3LOVA 3ZVHB 4OPTA 2E5AA 3THUA 1OJTA 4Z24A 2UZZA 3VQRA 1EC9A 2E5VA 3P4QA 3SN1A 2BC1A 2QA1A 2JAEA 1H6VA 4K2XA 3GO2A 1DNCA 5KWFA 4U2LA 4RSLA 3P1WA 5JCMA 3JSKA 3ATQA 3BHFA 4E6MA 3Q9TA 3BI2A 3F8PA 2YR4A 3VR9A 3DERA 3UOYA 2FYMA 4IZGA 3SZCA 2JK6A 2XCGA 4I59A 3MWCA 2OQYA 5KXJA 3NVVB 3EPTA 1VDVA 4ECHA 2XLRA 4K5RA 4U8KA 2FJAA 4Z26A 3BNMA 3ALMA 2WS3A 4IP5A 3CMMA 2V5ZA 3C4AA 2GL5A 3STPA 1O94A 3FJ4A 3DA1A 2FJDA 4IT1A 1E39A 3H8IA 4GDPA 2PU0A 1ZMCA 4IV9A 1EBDA 2YVGA 2XFQA 2OA1A 1TRBA 3DGBA 4H4QA 2DW6A 3D46A 4DSHA 3SXIA 3SY4A 4H4YA 2PHHA 3T2YA 3RNMA 1B5QA 2YG3A 4RG3A 1SEZA 4A9WA 2GGJA 4ENLA 3COXA 3PG6A 1B37A 4A6NB 4GYPC 2WPFA 3A7RA 2OFJA 1LV0A 4NNJA 2B9XA 1XPYA 4AP1A 5KVIA 1TKKA 4G74A 3NK1X 3M13A 3AYJA 3AYIA 1P48A 3GD4A 1D4EA 3DG6A 3UKLA 3NNEA 7ENLA 4Z1YA 1QO8A 3NVYB 1X2HA 4B69A 1WUFA 5FS7A 1GREA 5G5HB 1EL5A 1F6MA 4II3A 2DW7A 1ZOYA 1EC7A 3R0KA 3QKEA 3CNSA 1CJ4A 4GISA 1PXAA 1V59A 2AKZA 1JNRA 1KFYA 2YQUA 1MDLA 4JNQA 3K7TA 3NTAA 4KWSA 3IHMA 2OLNA 2VZ2A 3TJ4A 1F3PA 3IK4A 2XDOA 1JROA 4TM3A 4AT0A 5KOXA 1N1PA 2ZC8A 2Q6UA 4A6GA 1XANA 3TJIA 4OPLA 1CJ3A 1ELSA 1MO9A 4K7ZA 5FS8A 2B7SA 2GR2A 3U9IA 4O5QA 1GRBA 4J36A 3T8QA 1KSUA 2C3DA 1N5XA 3ENLA 1PN0A 1YQ4A 4CCRA 1FIQB 2JBVA 3DEQA 5IQ1A 3S5SA 2P3ZA 3PWIA 2WU2A 2QDDA 4B63A 3T6CA 1PBCA 4WCTA 3JW7A 2RGHA 3LB8A 2JB2A 3SGLA 3UJRA 2XVHA 1NHQA 2APGA 4YKGA 2I5QA 1JCTA 4I58A 3ATRA 2BK4A 4JY3A 5KMQA 4YWSA 1KN0A 3CNPA 3NFUA 2Y6RA 1B4VA 4J34A 2OLAA 2FBWA 1ZX9A 2PGEA 3R10A 3CPHG 1H86A 3RO6A 5IQ4A 4H4XA 2X8CA 3CPJG 3LZXA 2W3RA 1ZDLA 1BZLA 2R0PA 1Q1RA 2TPRA 4YSHA 2C73A 3NKSA 3H4KA 5IPYA 3CAWA 4E8GA 2XLTA 4E5TA 4JN9A 2CFYA 5FS6A 2XVJA 2A87A 1EC8A 4LIIA 4CY8A 2R45A 1GRAA 1RYIA 5J7XA 1IJHA 3RITA 3N4FA 2XVIA 5M0ZA 4DYEA 2PSNA 2AR8A 1PBFA 3HYWA 3ALJA 1VRQB 2YM2A 1CL0A 1H7WA 2R4JA 1N4UA 5FMHA 2WP9A 3M0OA 2RGJA 5JCKA 1TDKA 1F9CA 2WDRA 2X8HA 3CYJA 5FS9A 1TDEA 2ZZBA 3FVDA 5C3JA 2OALA 2HXTA 2YVFA 1VG9A 2R0CA 2YLTA 4ZN0A 1LVLA 3UXKA 4NTDA 3VC5A 1DOBA 4M0XA 5U1OA 2XFPA 4UDQA 2ZADA 3SFDA 2V3BA 3AEEA 1FEBA 3GRTA 1GALA 3UKHA 3RGTA 4YTNA 2OLOA 1Y56A 4H4RA 4U8IA 3GDNA 3D47A 4OPIA 1W6TA 4EQSA 1B8SA 1GRFA 2PU1A 3LJPA 3CGDA 4EMIA 3PK7A 1TDNA 1SJAA 3H70A 5BRTA 3TWAA 3I4KA 3UOVA 2J3NA 3UTGA 3CXOA 4H83A 3CT2A 4H4PA 2C67A 3AEDA 3VFCA 2YLRA 1XS2A 1PJ6A 3RHAA 2V61A 3NXLA 1F8SA 3AWIA 3MQTA 2XH2A 4H1ZA 4CY6A 1NG4A 1ELIA 1YEYA 1BGNA 3ES8A 4D03A 4IVOB 4IL0A 1Q9IA 4KPRA 5ENLA 1H2IA 4IA5A 2Q0LA 1GV4A 4ZA0A 1TYPA 4U2TA 3RCYA 4Z2RA 4Z2TA 3DH9A 3GYXA 4PABA 2RABA 3VRAA 4GYPA 3R25A 3UJSA 4EMJA 3L5OA 1FFUC 2WOVA 3MSYA 3FG2P 2GGIA 2Q0KA 2GGGA 1PHHA 3V3WA 4J56A 3ZVIA 4YTPA 1R0MA 3VR8A 1JRZA 1E1KA 4CRTA 1O95A 3KKJA 3T2ZA 2BA9A 1NENA 4G73A 4YSYA 4Z25A 3OPSA 2WEUA 2JB1A 1V97A 3L8KA 2ACZA 5U63A 1RSGA 4K5SA 4BURA 4NTEA 3AE8A 1BKWA 1TDFA 3SR6B 4GAPA 3R11A 2CVJA 2OKTA 3CTYA 2BK3A 4X4JA 1L9CA 1LJ1A 2CULA 2QVHA 1FO4A 4C3XA 1SJDA 1RP0A 3AM9A 1VQWA 1GTHA 3FMWA 3AEBA 2PP0A 1RVKA 1BWCA 3DESA 3QTPA 4ZCCA 4Y4NA 2BS4A 3V76A 2QDEA 3AECA 1H83A 1JEHA 1ONFA 2XLPA 3MZNA 2R0GA 4J33A 4K2SA 1Z6LA 4DN1A 2JKCA 2AL2B 3ZYXA 4JN8A 3FV9A 3P4SA 4E0VA 4TVYA 1IUSA 3S47A 3NLCA 3CGEA 1VQZA 2NQLA 3OW1A 5ER0A 5GSNA 1X2GA 4U8PA 3NVZB 1M6IA 4U8NA 3NH3X 1H82A 2XGZA 2GB0A 2IVDA 4IA6A 2Y6QA 3GDPA 1KF6A 3U4FA 4H4ZA 1PBEA 4DX3A 1GPEA 1L8PA 2GF3A 1EL8A 4EQXA 3IJQA 3NGCX 2PYXA 3GSIA 1OJ9A 2GVCA 1OJAA 1PDHA 3D8XA 2PA6A 3UCCA 3HZLA 2AQJA 1TZZA 4U8OA 2B9WA 4B67A 4H19A 4YSZA 4YWOA 3UJ2A 5FJOA 3AE3A 5KMPA 4HCHA 2QJJA 4UP3A 2PS2A 4BV6A 1GERA 2OVLA 2YG5A 3Q4DA 2BCGG 4Y4LA 1COYA 4K22A 1GRGA 4Y4MA 3CNTA 3HPFA 2GH5A 1E1MA 2F5ZA 3D9XA 5EU9A 1EL7A 4OPCA 3T2KA 3NO1A 4BK2A 1S7MA 2C3CA 1R6WA 4IL2A 2QCUA 3DK4A 3DJDA 2P0IA 4ZCWA 2BRAA 1BQGA 2PTZA 2ZZ0A 4A7AA 5KMRA 4GGHA 3Q45A 2C66A 1E1LA 3VCCA 4ZOHB 2O56A 4USQA 2XH4A 1Q1WA 3I6EA 3K7QX 2P8CA 2MUCA 2X8GA 1XDIA 4O5UA 4YSXA 4HPNA 3CNDA 3OC4A 1M64A 3R9UA 3P0WA 4EQWA 1FCDA 3B3RA 4GAVA 3EANA 3CGBA 3UOXA 1IUTA 1GRHA 4ICYA 1LQTA 1OEPA 4APNA 1JU2A 1H7XA 1TDOA 2YG4A 2XSXA 3DFHA 1NDAA 1K4QA 4GFIA 1T3QC 3FIMB 4DNAA 1MNSA 5KMSA 1PXBA 4GF7A 3UP4A 3B9JB 1EL9A 3SQPA 2V60A 3V3OA 4Z44A 4BJZA 2YG6A 3QJ4A 2WESA 3REDA 3URHA 2WBAA 1NU5A 4JQ9A 3DJEA 2OAMA 3CIRA 2NPXA 3ABVA 4G7FA 4DHGA 3ICTA 2IVEA 3NIXA 5HYMA 3HW2A 1YQ3A 3BOXA 1RM6B 1CJCA 5JCIA 1PDZA 2VQBA 1D4DA 4EM4A 3NN0X 3NZGA 2GV8A 4OVIA 2DKHA 3T9PA 2YAUA 3I6DA 3HYVA 4J31A 2YWLA 1D7YA 5G5GB 1XHCA 3AN1A 3PFRA 3P3BA 1CC4A 4GR1A 4ZCDA 2GAHB 1S2YA 4HNLA 4F4RA 3NS1B 3OZMA 4P9SA 5KNLA 1PBDA 2XH0A 3ZDNA 2VRLA 3GRSA 1N4VA 1FHUA 1ZMDA 3AE2A 1P2HA 3NVWB 1ZKQA 3TOYA 3FXGA 3UCDA 2BYBA 1ZOVA 1NAAA 1WUEA 1GT8A 1CC2A 4OPDA 4H7UA 3L1RA 1TYTA 4OCGA 2HZGA 3QN3A 1PJ7A 3BNUA 3NN6X 1NG3A 2YR6A 2W0HA 1PS9A 4CCQA 5BULA 3SX6A 1EBGA 1NHSA 5KVHA 3NHOX 3UKFA 1OJDA 3NTDA 4HB9A 1BGJA 3HRDC 2YVJA 2WU5A 3P4RA 2ONEA 2OO6A 1MDRA 3R07C 3CK5A 3IF9A 2C76A 1GESA 3S5WA 1FFVC 2B76A 4J57A 3ZLGA 2YR5A 4TVWA 3SQSA 3RR1A 1ZP0A 2C64A 4JDRA 1XPQA 4NWZA 2AAQA 4LU6A 4KT2A 3QSMA 1DJQA 4Z17A 3T31A 3QPEA 3QLDA 2QJNA 3ETRB 4IVMB 2XVEA 3FPZA 5J04A 1K0JA 4WX1A 1SJBA 3A7UA 1S3BA 2Z5XA 4YKFA 4A99A 3CXBA 3VRDB 4UDRA 4JN7A 4G9KA 1MOKA 2P88A 4JHMA 2GMHA 3SSZA 4DWDA 3F8DA 5DBJA 3NYCA 1JRYA 4G6GA 4BK1A 3TTEA 1N63C 2WETA 4H2QA 3V5CA 3M12A 1N61C 3SFEA 3QFBA 1QLBA 2VOUA 2GQFA 2BS2A 3ICRA 3MUCA 1LTXR 3C96A 4FI4A 3SZFA 4CBQA 4GUVA 3UJFA 4CNJA 4HN8A 3BI5A 3AE6A 3UKKA 2OX4A 3TWBA 3T4WA 3BJSA 3GYJA 2VQ7A 1FL2A 1NHPA 3P9UA 5L46A 3F8RA 5EB4A 1VG0A 3DFYA 3CNJA 2W54A 3OZ2A 1GSNA 3HYXA 3IWAA 5CQFA 4J1OA 5EBKA 2B9YA 3K7MX 2RGOA 3CN8A 4B68A 1JPDX 4UDPA 1F8RA 2OZ8A 3NK2X 3QSEA 2BACA 2P8BA 1DJNA 1OJCA 3ZVHA 4N9XA 2TMDA 2RDXA 3UGVA 3OTRA 4REKA 5BVAA 5EB5A 3KA7A 3RP6A 3V3NA 4H2RA 3SZ0A 2BABA 2VRMA 2WOWA 4C5OA 4TM4A 4A35A 2PTXA 3UKAA 3IC9A 3AE1A 3FYYA 1KDGA 1Y56B 3EUB3 2WQYA 2BXSA 2YLSA 2EQ8A 3KPKA 3Q6JA 2W3SA 4MJWA 2XLSA 2AL2A 3UP5A 2WP6A 3PO7A 2PODA 5TR3A 3LXDA 3H12A 5JCLA 3UTFA 2X99A 1AOGA 4AOSA 3G5QA 2B7RA 2QAEA 1EBHA 1FECA 1YKJA 2IIDA 1KCZA 1W4XA 4A65A 3MKCA 1CBOA 1NEKA 3SBFA 3IHGA 3BHKA 2XFOA 4TM1A 1JRXA 3UTEA 2O9ZA 1IUUA 1MRAA 3T14A 4IP4A 5LV9A 2EQ6A 2GGHA 2GMJA 2XYOA 3V4BA 3KPFA 4DGKA 3DIPA 3I3LA 3VCNA 1ZK7A 3B97A 2GQWA 4H4TA 3CB3A 3T0KA 4FDCB 2V6OA 2BCPA 4X9MA 4A6NA 3FCPA 4H4WA 3AB1A 3ICSA 1REOA 3NRNA 1WYGA 3H8AA 3DK9A 3DG3A 1KNRA 5FJUA 4H4VA 1NPXA 4USRA 2GGEA 2I0ZA 1N5WC 4FK1C 2CHRA 2OQHA 2WP5A 2R9ZA 2WPEA 1CF3A 1FEAA 3DGZA 1PDYA 3AMZA 1F8WA 1JOAA 3LADA 1O5WA 5M10A 4C74A
chains in the Genus database with same CATH topology
3AD9B 4RG4A 4G6HA 2HQMA 1N4UA 5FMHA 1PXBA 3PVCA 1H81A 1K0LA 2WP9A 4H50A 3M0OA 1EL9A 3SQPA 2V60A 4GF7A 4Z44A 3UP4A 3V3OA 4BJZA 3SZWA 2YG6A 2RGJA 1PBBA 5JCKA 1TDKA 2VVMA 3QJ4A 2WDRA 2WESA 3REDA 3DGHA 2WBAA 3URHA 2C75A 4TM0A 2X8HA 4JQ9A 5FS9A 1TDEA 3DJEA 2OAMA 4H2PA 2ZZBA 1L0VA 3CIRA 2NPXA 3T37A 3ABVA 5C3JA 2OALA 4DSGA 2FJEA 2YVFA 4M52A 1VG9A 2BXRA 3ICTA 2GR3A 1CC6A 4LA1A 4GCMA 1UKVG 3SYIA 2IVEA 3NIXA 2R0CA 2YLTA 3ADAB 4ZN0A 1LVLA 1YQ3A 3UKPA 5HYMA 4NTDA 1DOBA 1CJCA 5JCIA 5U1OA 2XFPA 3AE4A 2VQBA 4UDQA 1D4DA 4EM4A 4GRTA 3NN0X 4A79A 2GV8A 2FJBA 3B6DA 4B66A 4HA6A 4U8JA 4Z43A 3SFDA 2V3BA 4OVIA 2DKHA 3AEEA 2EQ7A 1LQUA 2YAUA 3I6DA 1FEBA 1GRTA 2X50A 3GRTA 4FX9A 1GALA 3HYVA 4J31A 2YWLA 3UKHA 1D7YA 3SM8A 3H8LA 3GD3A 2VVLG 3VRBA 4OPUA 1XHCA 4YTNA 2H88A 5HHFA 4OPGA 3DJGX 1L9DA 1E1NA 1GNDA 1Y56A 4H4RA 1E6EA 2OLOA 3KU9A 3EAOA 4TLZA 4U8IA 1CC4A 3GDNA 4GR1A 3CPIG 4AT2A 4ZCDA 5KOWA 2GAHB 1S2YA 4GDEA 2BRYA 4P9SA 4OPIA 2WDVA 2E1MA 4EIPA 5KNLA 4B64A 1L9EA 1GTEA 1PBDA 4EQSA 1B8SA 1S3EA 1GRFA 2DKIA 3LJPA 2C70A 3ZDNA 2GRTA 2VRLA 4II2A 3CGDA 4EMIA 1TDNA 3CGCA 4X9NA 3LOVA 4OPTA 3GRSA 1FOHA 1N4VA 1YQZA 5BRTA 4JNAA 4NEVA 1OJTA 1ZMDA 1E7PA 3AE2A 1P2HA 1ZKQA 4Z24A 2UZZA 1D5TA 2BYBA 1KNPA 3UOVA 2J3NA 3VQRA 1ZOVA 3UTGA 2E5VA 2C4CA 3P4QA 3S61A 4H4PA 2C67A 3AEDA 1NAAA 1GT8A 1CC2A 2BC1A 4OPDA 2QA1A 2YLRA 4H7UA 3L1RA 1TYTA 1PJ6A 2JAEA 2V61A 4OCGA 3RHAA 1H6VA 1PJ7A 4K2XA 1DNCA 3BNUA 3ITJA 3NN6X 5KWFA 5BULA 1NG3A 4U2LA 4RSLA 1F8SA 2YR6A 3AWIA 3P1WA 5JCMA 3JSKA 2W0HA 1PS9A 4CCQA 4CY6A 3SX6A 1NHSA 5KVHA 3ATQA 1NG4A 1ELIA 3BHFA 3NHOX 4JY2A 3UKFA 1OJDA 1BGNA 4BJYA 4II3A 3Q9TA 3BI2A 4EM3A 3NTDA 4H2NA 4HB9A 3F8PA 4D03A 1BGJA 2YR4A 2YVJA 3VR9A 1Y0PA 2WU5A 2YLXA 3P4RA 3UOYA 2VVLA 3SZCA 2JK6A 4IVOB 2XCGA 4I59A 1Q9IA 2C76A 3IF9A 2GEWA 5KXJA 4KPRA 1H2IA 2WHDA 3NYEA 3EPTA 1GESA 4ECHA 1H84A 3RP7A 4IA5A 2Q0LA 2XLRA 3S5WA 1GV4A 5HY5A 4NTCA 2B76A 4J57A 2BK5A 2YR5A 1TYPA 4U2TA 4K5RA 3GMCA 2FJAA 4U8KA 4Z2RA 1ZP0A 3NYFA 4Z2TA 2C64A 4JDRA 1XPQA 2WDQA 3ALLA 4NWZA 4Z26A 3DH9A 2AAQA 5GRTA 3BNMA 3NK0X 4BK3A 3ALMA 2WS3A 3GYXA 4PABA 3CMMA 2RABA 4LU6A 3VRAA 2V5ZA 3C4AA 5EOWA 4EMJA 3L5OA 1N4WA 2WOVA 3QSMA 2YLZA 1DJQA 3T31A 1GOSA 1O94A 3FG2P 2V3AA 1S2QA 2YG7A 4IVMB 3DA1A 2Q0KA 3EF6A 2FJDA 1PHHA 2XVEA 3FPZA 1E39A 3AE5A 3H8IA 4J56A 3PS9A 5JCNA 3UOZA 1K0JA 4GDPA 4WX1A 1ZMCA 4IV9A 1EBDA 4XWZA 4YTPA 2YVGA 2C65A 1S3BA 2Z5XA 2XFQA 4YKFA 4A99A 2OA1A 1TRBA 3VRDB 4UDRA 3VR8A 1JRZA 1E1KA 4CRTA 1O95A 3KKJA 3T2ZA 2BA9A 4H4QA 4G9KA 2GR0A 1MOKA 4DSHA 4J2WA 3SXIA 3SY4A 2GMHA 4H4YA 2PHHA 3NG7X 3F8DA 5DBJA 3T2YA 1NENA 3D1CA 3NYCA 4G73A 1JRYA 3RNMA 1B5QA 2YG3A 4G6GA 4BK1A 4YSYA 2WOIA 2WETA 4H2QA 4Z25A 4RG3A 1SEZA 3M12A 1K0IA 2WEUA 2JB1A 3SFEA 3LZWA 1MXTA 3QFBA 1QLBA 3L8KA 2VOUA 4A9WA 3FBSA 2ACZA 3P4PA 5U63A 1RSGA 4K5SA 1IUVA 4ADWA 4BURA 4NTEA 2GQFA 2BS2A 3UKQA 3COXA 2XFUA 3PG6A 1B37A 3AE8A 1BKWA 1QJDA 3ICRA 4A6NB 3QVRA 4B65A 2WPFA 2YM1A 1LTXR 3C96A 3KD9A 1TDFA 3SZFA 4CBQA 4GUVA 4CNJA 4GAPA 2CVJA 1LV0A 3BI5A 3CTYA 3AE6A 2BK3A 4X4JA 3UKKA 4NNJA 1L9CA 1LJ1A 2CULA 4A5LA 2B9XA 4C3XA 3AD7B 3II4A 4YT0A 4AP1A 3GYJA 5KVIA 2VQ7A 1RP0A 3C4NA 1FL2A 1NHPA 3P9UA 1VQWA 4G74A 1PXCA 3NK1X 1GTHA 3M13A 2BC0A 3DK8A 4AP3A 5L46A 3AYJA 3AYIA 3GMBA 4XXGA 3F8RA 3FMWA 1JNZA 3GD4A 3AEBA 1D4EA 5EB4A 1VG0A 3UKLA 3CNJA 3NNEA 1BWCA 3K30A 2EQ9A 3OZ2A 1GSNA 4ZCCA 1QO8A 5BUKA 4Y4NA 3O0HA 4B69A 1P2EA 4NZHA 3HYXA 5FS7A 1GREA 2BS4A 1EL5A 3QVPA 1DOEA 3IWAA 5CQFA 2C7GA 3V76A 3AECA 1F6MA 5EBKA 1H83A 1PJ5A 2B9YA 1JEHA 2RGOA 2Z5YA 3AD8B 1ONFA 3CN8A 2XLPA 3ISHA 3K7MX 2NVKX 4B68A 2R46A 1LPFA 4UDPA 2R0GA 1ZOYA 1F8RA 1GXFA 3AEGA 4J33A 2GR1A 3G5RA 5C2TA 1Z6LA 3NK2X 2JKCA 3CNSA 1CJ4A 1PXAA 5CKUA 3QSEA 3ZYXA 1V59A 1DJNA 1JNRA 1KFYA 1OJCA 2BACA 3WE0A 1X31B 1YY5A 2YQUA 3P4SA 4E0VA 4JNQA 3K7TA 4N9XA 1IUSA 3NLCA 3NTAA 3CGEA 3IHMA 2OLNA 2VZ2A 5ER0A 2TMDA 1F3PA 5GSNA 4U8PA 2JB3A 4REKA 1DODA 1M6IA 2ZZCA 2XDOA 4U8NA 5BVAA 2X3NA 1D7LA 4KX6A 3AEAA 5EB5A 4XWRA 4TM3A 3KA7A 3NH3X 3RP6A 1H82A 2GB0A 3V3NA 4AT0A 4H2RA 3SZ0A 2BABA 1N1PA 2VRMA 5KOXA 2IVDA 2GAGB 4IA6A 2Y6QA 3GDPA 2Q6UA 4TLXA 2WOWA 1KF6A 4C5OA 3UTHA 1XANA 4H4ZA 4TM4A 1PBEA 4OPLA 1DXLA 1GPEA 2XLUA 3UKAA 4D04A 3IC9A 5U25A 1IUXA 3AE1A 1KDGA 1Y56B 2WQYA 1CJ3A 2BXSA 2YLSA 1MO9A 3DMEA 4K7ZA 5FS8A 2B7SA 2EQ8A 1DOCA 3KPKA 2ARDA 2GR2A 4K8DA 3Q6JA 3KVEA 1GRBA 4O5QA 4J36A 2GF3A 1KSUA 1EL8A 4EQXA 2C3DA 3NGCX 1GEUA 4MJWA 2XLSA 1HYUA 1KSSA 1PN0A 2ZBWA 2PYXA 1YQ4A 2E4GA 3GSIA 3UP5A 4YXDA 2WP6A 1OJ9A 4CCRA 3PO7A 2GVCA 2JBVA 1OJAA 5IQ1A 1PDHA 3D8XA 5TR3A 3LXDA 5JCLA 2WU2A 3UTFA 3AYLA 4B63A 2X99A 1AOGA 1PBCA 3HZLA 4PAAA 4WCTA 4AOSA 2AQJA 4C77A 3G5QA 4U8OA 2B9WA 2A8XA 2RGHA 4B67A 2B7RA 3LB8A 2QAEA 1FECA 1YKJA 3QSSA 2IIDA 4YSZA 4A65A 1W4XA 2R4EA 2JB2A 5KRQA 5J60A 4YWOA 3SGLA 3AEFA 1CJ2A 1CBOA 3AE3A 2XVHA 1NHQA 2APGA 4YKGA 5KMPA 2YLWA 4UP3A 1NEKA 4H4SA 4BV6A 4I58A 1GERA 2XVFA 4C3YA 3ATRA 2BK4A 4JY3A 5KMQA 1KN0A 3IHGA 3NT6A 2YG5A 3DJJA 2XFOA 3BHKA 3CNPA 4EIQA 2BCGG 1ZY8A 2A89A 4Z2UA 4TM1A 1JRXA 4Y4LA 3UTEA 3KLJA 2Y6RA 4FK1A 1COYA 2O9ZA 1IUUA 4K22A 1B4VA 4J34A 3T14A 1GRGA 1CHUA 4Y4MA 3G5SA 3E1TA 5LV9A 2WPCA 2FBWA 1ZX9A 2EQ6A 4AOXA 3CNTA 3CPHG 3GWFA 1H86A 2GMJA 2XYOA 1NHRA 2GH5A 1E1MA 5IQ4A 4H4XA 1IUWA 2X8CA 2BS3A 3CPJG 2F5ZA 3D9XA 4OPCA 1EL7A 3LZXA 3T2KA 3KPFA 4DGKA 1ZDLA 4EQRA 4CNKA 4BK2A 1S7MA 2C3CA 1BZLA 2R0PA 2QCUA 1Q1RA 3I3LA 3DK4A 3DJDA 4YTMA 1ZK7A 2TPRA 2GQWA 4YSHA 4H4TA 4B1BA 2C73A 2H89A 2BRAA 2Q7VA 3GWDA 4EMWA 3T0KA 4FDCB 3RP8A 2V6OA 2ZZ0A 4A7AA 2BCPA 4X9MA 5JRBA 3NKSA 5KMRA 4A6NA 3H4KA 4H4WA 1BF3A 3AXBA 2C66A 1E1LA 2QA2A 3AB1A 5IPYA 3ICSA 1REOA 3NRNA 2XLTA 4JN9A 4USQA 2C72A 3DK9A 4U8LA 1Q1WA 2CFYA 5FS6A 3K7QX 2XVJA 1KNRA 2X8GA 1XDIA 2A87A 4O5UA 4YSXA 4H4VA 1D4CA 3CNDA 1GETA 1NPXA 4LIIA 4CY8A 3OC4A 2R45A 4USRA 1M64A 3R9UA 2I0ZA 4FK1C 2XFNA 1FCDA 4H4UA 4EQWA 1VDCA 3GYIA 3B3RA 1GRAA 2WP5A 4GAVA 1RYIA 3EANA 3CGBA 1IJHA 5J7XA 3UOXA 3QFAA 2XVIA 2R9ZA 2AR8A 1IUTA 5M0ZA 2WPEA 1PBFA 1GRHA 4ICYA 1LQTA 4NEWA 2CDUA 3HYWA 4APNA 4U8MA 1JU2A 3UCLA 1H7XA 3ALJA 1TDOA 1VRQB 3BI4A 1CF3A 2YM2A 5HXIA 2YG4A 4U2SA 3AE7A 1FEAA 1CL0A 3DGZA 1NDAA 1K4QA 3AE9A 1H7WA 1F8WA 1JOAA 3FIMB 3LADA 1O5WA 2R4JA 4DNAA 5M10A 4C74A 5KMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AD9 B;  4RG4 A;  2HQM A;  1N4U A;  5FMH A;  1PXB A;  3PVC A;  1H81 A;  1K0L A;  2WP9 A;  4H50 A;  3M0O A;  1EL9 A;  3SQP A;  2V60 A;  4GF7 A;  4Z44 A;  3UP4 A;  3V3O A;  4BJZ A;  2YG6 A;  2RGJ A;  1PBB A;  5JCK A;  1TDK A;  2VVM A;  3QJ4 A;  2WDR A;  2WES A;  3RED A;  3DGH A;  2WBA A;  3URH A;  2C75 A;  4TM0 A;  2X8H A;  4JQ9 A;  5FS9 A;  1TDE A;  3DJE A;  2OAM A;  4H2P A;  2ZZB A;  1L0V A;  3CIR A;  2NPX A;  3T37 A;  3ABV A;  5C3J A;  2OAL A;  4DSG A;  2FJE A;  2YVF A;  4M52 A;  1VG9 A;  2BXR A;  3ICT A;  2GR3 A;  1CC6 A;  4LA1 A;  4GCM A;  1UKV G;  2IVE A;  3NIX A;  2R0C A;  2YLT A;  3ADA B;  4ZN0 A;  1LVL A;  1YQ3 A;  3UKP A;  5HYM A;  4NTD A;  1DOB A;  1CJC A;  5JCI A;  5U1O A;  2XFP A;  3AE4 A;  2VQB A;  4UDQ A;  1D4D A;  4EM4 A;  4GRT A;  3NN0 X;  4A79 A;  2GV8 A;  2FJB A;  3B6D A;  4B66 A;  4HA6 A;  4U8J A;  4Z43 A;  3SFD A;  2V3B A;  4OVI A;  2DKH A;  3AEE A;  2EQ7 A;  1LQU A;  2YAU A;  3I6D A;  1FEB A;  1GRT A;  2X50 A;  3GRT A;  4FX9 A;  1GAL A;  4J31 A;  2YWL A;  3UKH A;  1D7Y A;  3SM8 A;  3H8L A;  3GD3 A;  2VVL G;  3VRB A;  4OPU A;  1XHC A;  4YTN A;  2H88 A;  5HHF A;  4OPG A;  3DJG X;  1L9D A;  1E1N A;  1GND A;  1Y56 A;  4H4R A;  1E6E A;  2OLO A;  3KU9 A;  3EAO A;  4TLZ A;  4U8I A;  1CC4 A;  3GDN A;  4GR1 A;  3CPI G;  4AT2 A;  4ZCD A;  5KOW A;  2GAH B;  1S2Y A;  4GDE A;  4P9S A;  4OPI A;  2WDV A;  2E1M A;  4EIP A;  4B64 A;  1L9E A;  1GTE A;  1PBD A;  4EQS A;  1B8S A;  1S3E A;  1GRF A;  2DKI A;  3LJP A;  2C70 A;  3ZDN A;  2GRT A;  2VRL A;  3CGD A;  4EMI A;  1TDN A;  3CGC A;  4X9N A;  3LOV A;  4OPT A;  3GRS A;  1FOH A;  1N4V A;  1YQZ A;  5BRT A;  4JNA A;  4NEV A;  1OJT A;  1ZMD A;  1E7P A;  3AE2 A;  1P2H A;  1ZKQ A;  4Z24 A;  2UZZ A;  1D5T A;  2BYB A;  1KNP A;  3UOV A;  2J3N A;  3VQR A;  1ZOV A;  3UTG A;  2E5V A;  3P4Q A;  3S61 A;  4H4P A;  2C67 A;  3AED A;  1NAA A;  1GT8 A;  1CC2 A;  2BC1 A;  4OPD A;  2QA1 A;  2YLR A;  4H7U A;  3L1R A;  1TYT A;  1PJ6 A;  2JAE A;  2V61 A;  4OCG A;  3RHA A;  1H6V A;  1PJ7 A;  4K2X A;  1DNC A;  3BNU A;  3ITJ A;  3NN6 X;  5KWF A;  1NG3 A;  4U2L A;  4RSL A;  1F8S A;  2YR6 A;  3AWI A;  3P1W A;  5JCM A;  3JSK A;  2W0H A;  1PS9 A;  4CCQ A;  4CY6 A;  5BUL A;  1NHS A;  5KVH A;  3ATQ A;  1NG4 A;  1ELI A;  3BHF A;  3NHO X;  4JY2 A;  3UKF A;  1OJD A;  1BGN A;  4BJY A;  3Q9T A;  3BI2 A;  4EM3 A;  3NTD A;  4H2N A;  4HB9 A;  3F8P A;  4D03 A;  1BGJ A;  2YR4 A;  2YVJ A;  3VR9 A;  1Y0P A;  2WU5 A;  2YLX A;  3P4R A;  3UOY A;  2VVL A;  2JK6 A;  4IVO B;  2XCG A;  4I59 A;  1Q9I A;  2C76 A;  3IF9 A;  2GEW A;  5KXJ A;  4KPR A;  2WHD A;  3NYE A;  3EPT A;  1GES A;  4ECH A;  1H84 A;  3RP7 A;  4IA5 A;  2Q0L A;  2XLR A;  3S5W A;  1GV4 A;  5HY5 A;  4NTC A;  2B76 A;  4J57 A;  2BK5 A;  2YR5 A;  1TYP A;  4U2T A;  4K5R A;  3GMC A;  2FJA A;  4U8K A;  4Z2R A;  1ZP0 A;  3NYF A;  4Z2T A;  2C64 A;  4JDR A;  1XPQ A;  2WDQ A;  3ALL A;  4Z26 A;  3DH9 A;  2AAQ A;  5GRT A;  3BNM A;  3NK0 X;  4BK3 A;  3ALM A;  2WS3 A;  4PAB A;  2RAB A;  4LU6 A;  3VRA A;  2V5Z A;  3C4A A;  5EOW A;  4EMJ A;  1N4W A;  2WOV A;  3QSM A;  2YLZ A;  1DJQ A;  1GOS A;  1O94 A;  3FG2 P;  2V3A A;  1S2Q A;  2YG7 A;  4IVM B;  3DA1 A;  2Q0K A;  3EF6 A;  2FJD A;  1PHH A;  2XVE A;  3FPZ A;  1E39 A;  3AE5 A;  3H8I A;  4J56 A;  3PS9 A;  5JCN A;  3UOZ A;  1K0J A;  4GDP A;  4WX1 A;  1ZMC A;  4IV9 A;  1EBD A;  4XWZ A;  4YTP A;  2YVG A;  2C65 A;  1S3B A;  2Z5X A;  2XFQ A;  4YKF A;  4A99 A;  2OA1 A;  1TRB A;  3VRD B;  4UDR A;  3VR8 A;  1JRZ A;  1E1K A;  4CRT A;  1O95 A;  3KKJ A;  2BA9 A;  4H4Q A;  2GR0 A;  1MOK A;  4DSH A;  4J2W A;  2GMH A;  4H4Y A;  2PHH A;  3NG7 X;  3F8D A;  5DBJ A;  1NEN A;  3D1C A;  3NYC A;  1JRY A;  3RNM A;  1B5Q A;  2YG3 A;  4BK1 A;  4YSY A;  2WOI A;  2WET A;  4H2Q A;  4Z25 A;  4RG3 A;  1SEZ A;  3M12 A;  1K0I A;  2WEU A;  2JB1 A;  3SFE A;  3LZW A;  1MXT A;  3QFB A;  1QLB A;  3L8K A;  2VOU A;  4A9W A;  3FBS A;  2ACZ A;  3P4P A;  5U63 A;  1RSG A;  4K5S A;  1IUV A;  4ADW A;  4BUR A;  4NTE A;  2GQF A;  2BS2 A;  3UKQ A;  3COX A;  2XFU A;  4B65 A;  1B37 A;  3AE8 A;  1BKW A;  1QJD A;  3ICR A;  4A6N B;  3QVR A;  2WPF A;  2YM1 A;  1LTX R;  3C96 A;  3KD9 A;  1TDF A;  4CBQ A;  4GUV A;  4CNJ A;  2CVJ A;  1LV0 A;  3BI5 A;  3CTY A;  3AE6 A;  2BK3 A;  4X4J A;  3UKK A;  1L9C A;  1LJ1 A;  2CUL A;  4A5L A;  2B9X A;  4C3X A;  3AD7 B;  3II4 A;  4YT0 A;  4AP1 A;  3GYJ A;  5KVI A;  2VQ7 A;  1RP0 A;  3C4N A;  1FL2 A;  1NHP A;  3P9U A;  1VQW A;  1PXC A;  3NK1 X;  1GTH A;  3M13 A;  2BC0 A;  3DK8 A;  4AP3 A;  5L46 A;  3AYJ A;  3AYI A;  3GMB A;  4XXG A;  3F8R A;  3FMW A;  1JNZ A;  3GD4 A;  3AEB A;  1D4E A;  5EB4 A;  1VG0 A;  3UKL A;  3CNJ A;  3NNE A;  1BWC A;  3K30 A;  2EQ9 A;  3OZ2 A;  1GSN A;  4ZCC A;  1QO8 A;  5BUK A;  4Y4N A;  3O0H A;  4B69 A;  1P2E A;  4NZH A;  5FS7 A;  1GRE A;  2BS4 A;  1EL5 A;  3QVP A;  1DOE A;  3IWA A;  5CQF A;  2C7G A;  3V76 A;  3AEC A;  1F6M A;  5EBK A;  1H83 A;  1PJ5 A;  2B9Y A;  1JEH A;  2RGO A;  2Z5Y A;  3AD8 B;  1ONF A;  3CN8 A;  2XLP A;  3ISH A;  3K7M X;  2NVK X;  4B68 A;  2R46 A;  1LPF A;  4UDP A;  2R0G A;  1ZOY A;  1F8R A;  1GXF A;  3AEG A;  4J33 A;  2GR1 A;  3G5R A;  5C2T A;  1Z6L A;  3NK2 X;  2JKC A;  3CNS A;  1CJ4 A;  1PXA A;  5CKU A;  3QSE A;  3ZYX A;  1V59 A;  1DJN A;  1JNR A;  1KFY A;  1OJC A;  2BAC A;  3WE0 A;  1X31 B;  1YY5 A;  2YQU A;  3P4S A;  4E0V A;  4JNQ A;  3K7T A;  4N9X A;  1IUS A;  3NLC A;  3NTA A;  3CGE A;  3IHM A;  2OLN A;  2VZ2 A;  5ER0 A;  2TMD A;  1F3P A;  5GSN A;  4U8P A;  2JB3 A;  4REK A;  1DOD A;  1M6I A;  2ZZC A;  2XDO A;  4U8N A;  5BVA A;  2X3N A;  1D7L A;  4KX6 A;  3AEA A;  5EB5 A;  4XWR A;  4TM3 A;  3KA7 A;  3NH3 X;  3RP6 A;  1H82 A;  2GB0 A;  3V3N A;  4AT0 A;  4H2R A;  2BAB A;  1N1P A;  2VRM A;  5KOX A;  2IVD A;  2GAG B;  4IA6 A;  2Y6Q A;  3GDP A;  2Q6U A;  4TLX A;  2WOW A;  1KF6 A;  4C5O A;  3UTH A;  1XAN A;  4H4Z A;  4TM4 A;  1PBE A;  4OPL A;  1DXL A;  1GPE A;  2XLU A;  3UKA A;  4D04 A;  3IC9 A;  5U25 A;  1IUX A;  3AE1 A;  1KDG A;  1Y56 B;  2WQY A;  1CJ3 A;  2BXS A;  2YLS A;  1MO9 A;  3DME A;  4K7Z A;  5FS8 A;  2B7S A;  2EQ8 A;  1DOC A;  2ARD A;  2GR2 A;  4K8D A;  3Q6J A;  3KVE A;  1GRB A;  4O5Q A;  4J36 A;  2GF3 A;  1KSU A;  1EL8 A;  4EQX A;  2C3D A;  3NGC X;  1GEU A;  4MJW A;  2XLS A;  1HYU A;  1KSS A;  1PN0 A;  2ZBW A;  2PYX A;  1YQ4 A;  2E4G A;  3GSI A;  3UP5 A;  4YXD A;  2WP6 A;  1OJ9 A;  4CCR A;  3PO7 A;  2GVC A;  2JBV A;  1OJA A;  5IQ1 A;  1PDH A;  3D8X A;  5TR3 A;  3LXD A;  5JCL A;  2WU2 A;  3UTF A;  3AYL A;  4B63 A;  2X99 A;  1AOG A;  1PBC A;  3HZL A;  4PAA A;  4WCT A;  4AOS A;  2AQJ A;  4C77 A;  3G5Q A;  4U8O A;  2B9W A;  2A8X A;  2RGH A;  4B67 A;  2B7R A;  3LB8 A;  2QAE A;  1FEC A;  1YKJ A;  3QSS A;  2IID A;  4YSZ A;  4A65 A;  1W4X A;  2R4E A;  2JB2 A;  5KRQ A;  5J60 A;  4YWO A;  3SGL A;  3AEF A;  1CJ2 A;  1CBO A;  3AE3 A;  2XVH A;  1NHQ A;  2APG A;  4YKG A;  2YLW A;  4UP3 A;  1NEK A;  4H4S A;  4BV6 A;  4I58 A;  1GER A;  2XVF A;  4C3Y A;  3ATR A;  2BK4 A;  4JY3 A;  3IHG A;  3NT6 A;  2YG5 A;  3DJJ A;  2XFO A;  3BHK A;  3CNP A;  4EIQ A;  2BCG G;  1ZY8 A;  2A89 A;  4Z2U A;  4TM1 A;  1JRX A;  4Y4L A;  3UTE A;  3KLJ A;  2Y6R A;  4FK1 A;  1COY A;  2O9Z A;  1IUU A;  4K22 A;  1B4V A;  4J34 A;  1GRG A;  1CHU A;  4Y4M A;  3G5S A;  3E1T A;  5LV9 A;  2WPC A;  2FBW A;  1ZX9 A;  2EQ6 A;  4AOX A;  3CNT A;  3CPH G;  3GWF A;  1H86 A;  2GMJ A;  2XYO A;  1NHR A;  2GH5 A;  1E1M A;  5IQ4 A;  4H4X A;  1IUW A;  2X8C A;  2BS3 A;  3CPJ G;  2F5Z A;  4OPC A;  1EL7 A;  3LZX A;  3KPF A;  4DGK A;  1ZDL A;  4EQR A;  4CNK A;  4BK2 A;  2C3C A;  1BZL A;  2R0P A;  2QCU A;  1Q1R A;  3I3L A;  3DK4 A;  3DJD A;  4YTM A;  1ZK7 A;  2TPR A;  2GQW A;  4YSH A;  4H4T A;  4B1B A;  2C73 A;  2H89 A;  2Q7V A;  3GWD A;  4EMW A;  4FDC B;  3RP8 A;  2V6O A;  2ZZ0 A;  4A7A A;  2BCP A;  4X9M A;  3NKS A;  4A6N A;  3H4K A;  4H4W A;  1BF3 A;  3AXB A;  2C66 A;  1E1L A;  2QA2 A;  3AB1 A;  5IPY A;  3ICS A;  1REO A;  3NRN A;  2XLT A;  4JN9 A;  4USQ A;  2C72 A;  3DK9 A;  4U8L A;  1Q1W A;  2CFY A;  5FS6 A;  3K7Q X;  2XVJ A;  1KNR A;  2X8G A;  1XDI A;  2A87 A;  4O5U A;  4YSX A;  4H4V A;  1D4C A;  3CND A;  1GET A;  1NPX A;  4LII A;  4CY8 A;  3OC4 A;  2R45 A;  4USR A;  1M64 A;  3R9U A;  2I0Z A;  4FK1 C;  2XFN A;  1FCD A;  4H4U A;  4EQW A;  1VDC A;  3GYI A;  3B3R A;  1GRA A;  2WP5 A;  1RYI A;  3EAN A;  3CGB A;  1IJH A;  5J7X A;  3UOX A;  3QFA A;  2XVI A;  2R9Z A;  2AR8 A;  1IUT A;  5M0Z A;  2WPE A;  1PBF A;  1GRH A;  4ICY A;  1LQT A;  4NEW A;  2CDU A;  4U8M A;  4APN A;  1JU2 A;  3UCL A;  1H7X A;  3ALJ A;  1TDO A;  1VRQ B;  3BI4 A;  1CF3 A;  2YM2 A;  5HXI A;  2YG4 A;  4U2S A;  3AE7 A;  1FEA A;  1CL0 A;  3DGZ A;  1NDA A;  1K4Q A;  3AE9 A;  1H7W A;  1F8W A;  1JOA A;  3FIM B;  3LAD A;  1O5W A;  2R4J A;  4DNA A;  5M10 A;  4C74 A; 
#chains in the Genus database with same CATH topology
 3AD9 B;  3K1G A;  1K0L A;  4H50 A;  1KKO A;  3DDM A;  4FP1 A;  4H2P A;  3T37 A;  4DSG A;  2FJE A;  2BXR A;  2AL1 A;  4GCM A;  3ADA B;  1E9I A;  3AE4 A;  4A79 A;  4GRT A;  2FJB A;  3B6D A;  4U8J A;  4Z43 A;  4K8G A;  2EQ7 A;  4FX9 A;  4A3R A;  3SM8 A;  3VRB A;  3DJG X;  1E1N A;  4MMW A;  3SN4 A;  1GND A;  3EAO A;  4AT2 A;  5KOW A;  3A7A A;  3MY9 A;  2WDV A;  2E1M A;  4B64 A;  1L9E A;  1S3E A;  2DKI A;  2QGY A;  3CGC A;  1FOH A;  3JVA A;  1YQZ A;  2E3T A;  4NEV A;  4JNA A;  5BOF A;  1E7P A;  1D5T A;  3H7V A;  3PWG A;  1KNP A;  2PP1 A;  2PTW A;  2C4C A;  3S61 A;  3ITJ A;  3EEZ A;  3NRZ B;  3I6T A;  4ROP A;  4JY2 A;  4BJY A;  4EM3 A;  4H2N A;  4MGG A;  3R0U A;  1Y0P A;  2YLX A;  2VVL A;  3KUM A;  2GEW A;  4GGB A;  2WHD A;  4KPL A;  2HXU A;  3NYE A;  1H84 A;  3RP7 A;  5HY5 A;  4NTC A;  2BK5 A;  2XH7 A;  3GMC A;  3NYF A;  2WDQ A;  3ALL A;  5GRT A;  3NK0 X;  4BK3 A;  2MNR A;  5EOW A;  1N4W A;  2YLZ A;  1GOS A;  2V3A A;  1S2Q A;  2YG7 A;  3EF6 A;  3VA8 A;  3AE5 A;  4DXK A;  3RRA A;  5JCN A;  3PS9 A;  3UOZ A;  4XWZ A;  2C65 A;  1ONE A;  3UXL A;  2W55 A;  4HYR A;  3N4E A;  2GR0 A;  4J2W A;  3NG7 X;  3D1C A;  1JRP A;  2WOI A;  1K0I A;  3LZW A;  1MXT A;  3FBS A;  3P4P A;  1IUV A;  4ADW A;  4G8T A;  3UKQ A;  2XFU A;  4B65 A;  2QQ6 A;  1QJD A;  3QVR A;  2YM1 A;  1IYX A;  3KD9 A;  3IJL A;  4A5L A;  1KKR A;  3AD7 B;  3II4 A;  1KD0 A;  4YT0 A;  3C4N A;  1PXC A;  4AP3 A;  2BC0 A;  3DK8 A;  3GMB A;  3ZLF A;  5FJR A;  4XXG A;  1JNZ A;  2OZ3 A;  3GY1 A;  3K30 A;  2PCE A;  2EQ9 A;  1N60 C;  5BUK A;  3O0H A;  1P2E A;  4NZH A;  3TCS A;  3QVP A;  1DOE A;  2C7G A;  3OP2 A;  3N6H A;  1PJ5 A;  4U2S A;  3ISH A;  3SN0 A;  2Z5Y A;  2FKP A;  3AD8 B;  1DTN A;  2HNE A;  2NVK X;  2R46 A;  1LPF A;  1BKH A;  1GXF A;  3AEG A;  5C2T A;  2GR1 A;  2OZT A;  3G5R A;  2POZ A;  5CKU A;  3WE0 A;  3R1Z A;  4EWJ A;  5FJT A;  1X31 B;  2PMQ A;  1YY5 A;  1NEL A;  2OPJ A;  4HCD A;  1ECQ A;  2JB3 A;  1DOD A;  2ZZC A;  4E4U A;  2X3N A;  1D7L A;  4KX6 A;  3AEA A;  4XWR A;  2GAG B;  4TLX A;  3UTH A;  1DXL A;  2XLU A;  4D04 A;  5U25 A;  1IUX A;  2OG9 A;  4GIR A;  3DME A;  1DOC A;  2ARD A;  1SB3 B;  4K8D A;  1MUC A;  3KVE A;  1TE6 A;  1GEU A;  1HYU A;  1KSS A;  2ZBW A;  3VDG A;  2E4G A;  4YXD A;  3N6J A;  4M6U A;  3AYL A;  4PAA A;  2PTY A;  4C77 A;  2AKM A;  2A8X A;  2QJM A;  3QSS A;  2R4E A;  5KRQ A;  5J60 A;  3AEF A;  1CJ2 A;  4E4F A;  3TW9 A;  2YLW A;  4H4S A;  2XVF A;  4C3Y A;  4MKS A;  4IHC A;  3NT6 A;  3DJJ A;  4EIQ A;  1ZY8 A;  2A89 A;  4Z2U A;  1P43 A;  3KLJ A;  4FK1 A;  5BOE A;  4GME A;  1CHU A;  3G5S A;  3E1T A;  3ES7 A;  2WPC A;  4AOX A;  3GD6 A;  4HNC A;  3GWF A;  1NHR A;  1IUW A;  2BS3 A;  4EQR A;  4CNK A;  2GSH A;  4YTM A;  4B1B A;  2PGW A;  2H89 A;  2Q7V A;  3GWD A;  4EMW A;  3IJI A;  3RP8 A;  3OZY A;  5JRB A;  1JPM A;  1BF3 A;  5FJP A;  3AXB A;  2QA2 A;  4KEM A;  2C72 A;  4U8L A;  1N62 C;  3V5F A;  3JZU A;  1D4C A;  1GET A;  3EKG A;  2XFN A;  4H4U A;  3GYI A;  1VDC A;  3DG7 A;  3QFA A;  1SJC A;  4NEW A;  2CDU A;  4U8M A;  3UCL A;  1JDF A;  1STZ A;  1ZXI C;  3BI4 A;  5HXI A;  3GC2 A;  3AE7 A;  1FHV A;  3SJN A;  3AE9 A;  4RG4 A;  4G6H A;  2HQM A;  3PVC A;  1H81 A;  3SZW A;  4H2H A;  1PBB A;  2VVM A;  3DGH A;  3TQP A;  2C75 A;  4TM0 A;  3VC6 A;  3BSM A;  1L0V A;  4M52 A;  2GR3 A;  1CC6 A;  4LA1 A;  1UKV G;  3SYI A;  3UKP A;  2PP3 A;  4HA6 A;  3UJE A;  1LQU A;  1GRT A;  2X50 A;  3ZLH A;  3H8L A;  3GD3 A;  2VVL G;  4OPU A;  4X2P A;  2H88 A;  5HHF A;  2GDQ A;  5IDZ A;  4OPG A;  1L9D A;  4TLZ A;  3KU9 A;  1E6E A;  4HCL A;  2PPG A;  4B66 A;  3P93 A;  3CPI G;  4J3Z A;  4GDE A;  2BRY A;  6ENL A;  4EIP A;  1GTE A;  2C70 A;  2GRT A;  4II2 A;  4X9N A;  4K1W A;  3LOV A;  3ZVH B;  4OPT A;  2E5A A;  3THU A;  1OJT A;  4Z24 A;  2UZZ A;  3VQR A;  1EC9 A;  2E5V A;  3P4Q A;  3SN1 A;  2BC1 A;  2QA1 A;  2JAE A;  1H6V A;  4K2X A;  3GO2 A;  1DNC A;  5KWF A;  4U2L A;  4RSL A;  3P1W A;  5JCM A;  3JSK A;  3ATQ A;  3BHF A;  4E6M A;  3Q9T A;  3BI2 A;  3F8P A;  2YR4 A;  3VR9 A;  3DER A;  3UOY A;  2FYM A;  4IZG A;  3SZC A;  2JK6 A;  2XCG A;  4I59 A;  3MWC A;  2OQY A;  5KXJ A;  3NVV B;  3EPT A;  1VDV A;  4ECH A;  2XLR A;  4K5R A;  4U8K A;  2FJA A;  4Z26 A;  3BNM A;  3ALM A;  2WS3 A;  4IP5 A;  3CMM A;  2V5Z A;  3C4A A;  2GL5 A;  3STP A;  1O94 A;  3FJ4 A;  3DA1 A;  2FJD A;  4IT1 A;  1E39 A;  3H8I A;  4GDP A;  2PU0 A;  1ZMC A;  4IV9 A;  1EBD A;  2YVG A;  2XFQ A;  2OA1 A;  1TRB A;  3DGB A;  4H4Q A;  2DW6 A;  3D46 A;  4DSH A;  3SXI A;  3SY4 A;  4H4Y A;  2PHH A;  3T2Y A;  3RNM A;  1B5Q A;  2YG3 A;  4RG3 A;  1SEZ A;  4A9W A;  2GGJ A;  4ENL A;  3COX A;  3PG6 A;  1B37 A;  4A6N B;  4GYP C;  2WPF A;  3A7R A;  2OFJ A;  1LV0 A;  4NNJ A;  2B9X A;  1XPY A;  4AP1 A;  5KVI A;  1TKK A;  4G74 A;  3NK1 X;  3M13 A;  3AYJ A;  3AYI A;  1P48 A;  3GD4 A;  1D4E A;  3DG6 A;  3UKL A;  3NNE A;  7ENL A;  4Z1Y A;  1QO8 A;  3NVY B;  1X2H A;  4B69 A;  1WUF A;  5FS7 A;  1GRE A;  5G5H B;  1EL5 A;  1F6M A;  4II3 A;  2DW7 A;  1ZOY A;  1EC7 A;  3R0K A;  3QKE A;  3CNS A;  1CJ4 A;  4GIS A;  1PXA A;  1V59 A;  2AKZ A;  1JNR A;  1KFY A;  2YQU A;  1MDL A;  4JNQ A;  3K7T A;  3NTA A;  4KWS A;  3IHM A;  2OLN A;  2VZ2 A;  3TJ4 A;  1F3P A;  3IK4 A;  2XDO A;  1JRO A;  4TM3 A;  4AT0 A;  5KOX A;  1N1P A;  2ZC8 A;  2Q6U A;  4A6G A;  1XAN A;  3TJI A;  4OPL A;  1CJ3 A;  1ELS A;  1MO9 A;  4K7Z A;  5FS8 A;  2B7S A;  2GR2 A;  3U9I A;  4O5Q A;  1GRB A;  4J36 A;  3T8Q A;  1KSU A;  2C3D A;  1N5X A;  3ENL A;  1PN0 A;  1YQ4 A;  4CCR A;  1FIQ B;  2JBV A;  3DEQ A;  5IQ1 A;  3S5S A;  2P3Z A;  3PWI A;  2WU2 A;  2QDD A;  4B63 A;  3T6C A;  1PBC A;  4WCT A;  3JW7 A;  2RGH A;  3LB8 A;  2JB2 A;  3SGL A;  3UJR A;  2XVH A;  1NHQ A;  2APG A;  4YKG A;  2I5Q A;  1JCT A;  4I58 A;  3ATR A;  2BK4 A;  4JY3 A;  5KMQ A;  4YWS A;  1KN0 A;  3CNP A;  3NFU A;  2Y6R A;  1B4V A;  4J34 A;  2OLA A;  2FBW A;  1ZX9 A;  2PGE A;  3R10 A;  3CPH G;  1H86 A;  3RO6 A;  5IQ4 A;  4H4X A;  2X8C A;  3CPJ G;  3LZX A;  2W3R A;  1ZDL A;  1BZL A;  2R0P A;  1Q1R A;  2TPR A;  4YSH A;  2C73 A;  3NKS A;  3H4K A;  5IPY A;  3CAW A;  4E8G A;  2XLT A;  4E5T A;  4JN9 A;  2CFY A;  5FS6 A;  2XVJ A;  2A87 A;  1EC8 A;  4LII A;  4CY8 A;  2R45 A;  1GRA A;  1RYI A;  5J7X A;  1IJH A;  3RIT A;  3N4F A;  2XVI A;  5M0Z A;  4DYE A;  2PSN A;  2AR8 A;  1PBF A;  3HYW A;  3ALJ A;  1VRQ B;  2YM2 A;  1CL0 A;  1H7W A;  2R4J A;  1N4U A;  5FMH A;  2WP9 A;  3M0O A;  2RGJ A;  5JCK A;  1TDK A;  1F9C A;  2WDR A;  2X8H A;  3CYJ A;  5FS9 A;  1TDE A;  2ZZB A;  3FVD A;  5C3J A;  2OAL A;  2HXT A;  2YVF A;  1VG9 A;  2R0C A;  2YLT A;  4ZN0 A;  1LVL A;  3UXK A;  4NTD A;  3VC5 A;  1DOB A;  4M0X A;  5U1O A;  2XFP A;  4UDQ A;  2ZAD A;  3SFD A;  2V3B A;  3AEE A;  1FEB A;  3GRT A;  1GAL A;  3UKH A;  3RGT A;  4YTN A;  2OLO A;  1Y56 A;  4H4R A;  4U8I A;  3GDN A;  3D47 A;  4OPI A;  1W6T A;  4EQS A;  1B8S A;  1GRF A;  2PU1 A;  3LJP A;  3CGD A;  4EMI A;  3PK7 A;  1TDN A;  1SJA A;  3H70 A;  5BRT A;  3TWA A;  3I4K A;  3UOV A;  2J3N A;  3UTG A;  3CXO A;  4H83 A;  3CT2 A;  4H4P A;  2C67 A;  3AED A;  3VFC A;  2YLR A;  1XS2 A;  1PJ6 A;  3RHA A;  2V61 A;  3NXL A;  1F8S A;  3AWI A;  3MQT A;  2XH2 A;  4H1Z A;  4CY6 A;  1NG4 A;  1ELI A;  1YEY A;  1BGN A;  3ES8 A;  4D03 A;  4IVO B;  4IL0 A;  1Q9I A;  4KPR A;  5ENL A;  1H2I A;  4IA5 A;  2Q0L A;  1GV4 A;  4ZA0 A;  1TYP A;  4U2T A;  3RCY A;  4Z2R A;  4Z2T A;  3DH9 A;  3GYX A;  4PAB A;  2RAB A;  3VRA A;  4GYP A;  3R25 A;  3UJS A;  4EMJ A;  3L5O A;  1FFU C;  2WOV A;  3MSY A;  3FG2 P;  2GGI A;  2Q0K A;  2GGG A;  1PHH A;  3V3W A;  4J56 A;  3ZVI A;  4YTP A;  1R0M A;  3VR8 A;  1JRZ A;  1E1K A;  4CRT A;  1O95 A;  3KKJ A;  3T2Z A;  2BA9 A;  1NEN A;  4G73 A;  4YSY A;  4Z25 A;  3OPS A;  2WEU A;  2JB1 A;  1V97 A;  3L8K A;  2ACZ A;  5U63 A;  1RSG A;  4K5S A;  4BUR A;  4NTE A;  3AE8 A;  1BKW A;  1TDF A;  3SR6 B;  4GAP A;  3R11 A;  2CVJ A;  2OKT A;  3CTY A;  2BK3 A;  4X4J A;  1L9C A;  1LJ1 A;  2CUL A;  2QVH A;  1FO4 A;  4C3X A;  1SJD A;  1RP0 A;  3AM9 A;  1VQW A;  1GTH A;  3FMW A;  3AEB A;  2PP0 A;  1RVK A;  1BWC A;  3DES A;  3QTP A;  4ZCC A;  4Y4N A;  2BS4 A;  3V76 A;  2QDE A;  3AEC A;  1H83 A;  1JEH A;  1ONF A;  2XLP A;  3MZN A;  2R0G A;  4J33 A;  4K2S A;  1Z6L A;  4DN1 A;  2JKC A;  2AL2 B;  3ZYX A;  4JN8 A;  3FV9 A;  3P4S A;  4E0V A;  4TVY A;  1IUS A;  3S47 A;  3NLC A;  3CGE A;  1VQZ A;  2NQL A;  3OW1 A;  5ER0 A;  5GSN A;  1X2G A;  4U8P A;  3NVZ B;  1M6I A;  4U8N A;  3NH3 X;  1H82 A;  2XGZ A;  2GB0 A;  2IVD A;  4IA6 A;  2Y6Q A;  3GDP A;  1KF6 A;  3U4F A;  4H4Z A;  1PBE A;  4DX3 A;  1GPE A;  1L8P A;  2GF3 A;  1EL8 A;  4EQX A;  3IJQ A;  3NGC X;  2PYX A;  3GSI A;  1OJ9 A;  2GVC A;  1OJA A;  1PDH A;  3D8X A;  2PA6 A;  3UCC A;  3HZL A;  2AQJ A;  1TZZ A;  4U8O A;  2B9W A;  4B67 A;  4H19 A;  4YSZ A;  4YWO A;  3UJ2 A;  5FJO A;  3AE3 A;  5KMP A;  4HCH A;  2QJJ A;  4UP3 A;  2PS2 A;  4BV6 A;  1GER A;  2OVL A;  2YG5 A;  3Q4D A;  2BCG G;  4Y4L A;  1COY A;  4K22 A;  1GRG A;  4Y4M A;  3CNT A;  3HPF A;  2GH5 A;  1E1M A;  2F5Z A;  3D9X A;  5EU9 A;  1EL7 A;  4OPC A;  3T2K A;  3NO1 A;  4BK2 A;  1S7M A;  2C3C A;  1R6W A;  4IL2 A;  2QCU A;  3DK4 A;  3DJD A;  2P0I A;  4ZCW A;  2BRA A;  1BQG A;  2PTZ A;  2ZZ0 A;  4A7A A;  5KMR A;  4GGH A;  3Q45 A;  2C66 A;  1E1L A;  3VCC A;  4ZOH B;  2O56 A;  4USQ A;  2XH4 A;  1Q1W A;  3I6E A;  3K7Q X;  2P8C A;  2MUC A;  2X8G A;  1XDI A;  4O5U A;  4YSX A;  4HPN A;  3CND A;  3OC4 A;  1M64 A;  3R9U A;  3P0W A;  4EQW A;  1FCD A;  3B3R A;  4GAV A;  3EAN A;  3CGB A;  3UOX A;  1IUT A;  1GRH A;  4ICY A;  1LQT A;  1OEP A;  4APN A;  1JU2 A;  1H7X A;  1TDO A;  2YG4 A;  2XSX A;  3DFH A;  1NDA A;  1K4Q A;  4GFI A;  1T3Q C;  3FIM B;  4DNA A;  1MNS A;  5KMS A;  1PXB A;  4GF7 A;  3UP4 A;  3B9J B;  1EL9 A;  3SQP A;  2V60 A;  3V3O A;  4Z44 A;  4BJZ A;  2YG6 A;  3QJ4 A;  2WES A;  3RED A;  3URH A;  2WBA A;  1NU5 A;  4JQ9 A;  3DJE A;  2OAM A;  3CIR A;  2NPX A;  3ABV A;  4G7F A;  4DHG A;  3ICT A;  2IVE A;  3NIX A;  5HYM A;  3HW2 A;  1YQ3 A;  3BOX A;  1RM6 B;  1CJC A;  5JCI A;  1PDZ A;  2VQB A;  1D4D A;  4EM4 A;  3NN0 X;  3NZG A;  2GV8 A;  4OVI A;  2DKH A;  3T9P A;  2YAU A;  3I6D A;  3HYV A;  4J31 A;  2YWL A;  1D7Y A;  5G5G B;  1XHC A;  3AN1 A;  3PFR A;  3P3B A;  1CC4 A;  4GR1 A;  4ZCD A;  2GAH B;  1S2Y A;  4HNL A;  4F4R A;  3NS1 B;  3OZM A;  4P9S A;  5KNL A;  1PBD A;  2XH0 A;  3ZDN A;  2VRL A;  3GRS A;  1N4V A;  1FHU A;  1ZMD A;  3AE2 A;  1P2H A;  3NVW B;  1ZKQ A;  3TOY A;  3FXG A;  3UCD A;  2BYB A;  1ZOV A;  1NAA A;  1WUE A;  1GT8 A;  1CC2 A;  4OPD A;  4H7U A;  3L1R A;  1TYT A;  4OCG A;  2HZG A;  3QN3 A;  1PJ7 A;  3BNU A;  3NN6 X;  1NG3 A;  2YR6 A;  2W0H A;  1PS9 A;  4CCQ A;  5BUL A;  3SX6 A;  1EBG A;  1NHS A;  5KVH A;  3NHO X;  3UKF A;  1OJD A;  3NTD A;  4HB9 A;  1BGJ A;  3HRD C;  2YVJ A;  2WU5 A;  3P4R A;  2ONE A;  2OO6 A;  1MDR A;  3R07 C;  3CK5 A;  3IF9 A;  2C76 A;  1GES A;  3S5W A;  1FFV C;  2B76 A;  4J57 A;  3ZLG A;  2YR5 A;  4TVW A;  3SQS A;  3RR1 A;  1ZP0 A;  2C64 A;  4JDR A;  1XPQ A;  4NWZ A;  2AAQ A;  4LU6 A;  4KT2 A;  3QSM A;  1DJQ A;  4Z17 A;  3T31 A;  3QPE A;  3QLD A;  2QJN A;  3ETR B;  4IVM B;  2XVE A;  3FPZ A;  5J04 A;  1K0J A;  4WX1 A;  1SJB A;  3A7U A;  1S3B A;  2Z5X A;  4YKF A;  4A99 A;  3CXB A;  3VRD B;  4UDR A;  4JN7 A;  4G9K A;  1MOK A;  2P88 A;  4JHM A;  2GMH A;  3SSZ A;  4DWD A;  3F8D A;  5DBJ A;  3NYC A;  1JRY A;  4G6G A;  4BK1 A;  3TTE A;  1N63 C;  2WET A;  4H2Q A;  3V5C A;  3M12 A;  1N61 C;  3SFE A;  3QFB A;  1QLB A;  2VOU A;  2GQF A;  2BS2 A;  3ICR A;  3MUC A;  1LTX R;  3C96 A;  4FI4 A;  3SZF A;  4CBQ A;  4GUV A;  3UJF A;  4CNJ A;  4HN8 A;  3BI5 A;  3AE6 A;  3UKK A;  2OX4 A;  3TWB A;  3T4W A;  3BJS A;  3GYJ A;  2VQ7 A;  1FL2 A;  1NHP A;  3P9U A;  5L46 A;  3F8R A;  5EB4 A;  1VG0 A;  3DFY A;  3CNJ A;  2W54 A;  3OZ2 A;  1GSN A;  3HYX A;  3IWA A;  5CQF A;  4J1O A;  5EBK A;  2B9Y A;  3K7M X;  2RGO A;  3CN8 A;  4B68 A;  1JPD X;  4UDP A;  1F8R A;  2OZ8 A;  3NK2 X;  3QSE A;  2BAC A;  2P8B A;  1DJN A;  1OJC A;  3ZVH A;  4N9X A;  2TMD A;  2RDX A;  3UGV A;  3OTR A;  4REK A;  5BVA A;  5EB5 A;  3KA7 A;  3RP6 A;  3V3N A;  4H2R A;  3SZ0 A;  2BAB A;  2VRM A;  2WOW A;  4C5O A;  4TM4 A;  4A35 A;  2PTX A;  3UKA A;  3IC9 A;  3AE1 A;  3FYY A;  1KDG A;  1Y56 B;  3EUB 3;  2WQY A;  2BXS A;  2YLS A;  2EQ8 A;  3KPK A;  3Q6J A;  2W3S A;  4MJW A;  2XLS A;  2AL2 A;  3UP5 A;  2WP6 A;  3PO7 A;  2POD A;  5TR3 A;  3LXD A;  3H12 A;  5JCL A;  3UTF A;  2X99 A;  1AOG A;  4AOS A;  3G5Q A;  2B7R A;  2QAE A;  1EBH A;  1FEC A;  1YKJ A;  2IID A;  1KCZ A;  1W4X A;  4A65 A;  3MKC A;  1CBO A;  1NEK A;  3SBF A;  3IHG A;  3BHK A;  2XFO A;  4TM1 A;  1JRX A;  3UTE A;  2O9Z A;  1IUU A;  1MRA A;  3T14 A;  4IP4 A;  5LV9 A;  2EQ6 A;  2GGH A;  2GMJ A;  2XYO A;  3V4B A;  3KPF A;  4DGK A;  3DIP A;  3I3L A;  3VCN A;  1ZK7 A;  3B97 A;  2GQW A;  4H4T A;  3CB3 A;  3T0K A;  4FDC B;  2V6O A;  2BCP A;  4X9M A;  4A6N A;  3FCP A;  4H4W A;  3AB1 A;  3ICS A;  1REO A;  3NRN A;  1WYG A;  3H8A A;  3DK9 A;  3DG3 A;  1KNR A;  5FJU A;  4H4V A;  1NPX A;  4USR A;  2GGE A;  2I0Z A;  1N5W C;  4FK1 C;  2CHR A;  2OQH A;  2WP5 A;  2R9Z A;  2WPE A;  1CF3 A;  1FEA A;  3DGZ A;  1PDY A;  3AMZ A;  1F8W A;  1JOA A;  3LAD A;  1O5W A;  5M10 A;  4C74 A; 
#chains in the Genus database with same CATH homology
 3AD9 B;  4RG4 A;  4G6H A;  2HQM A;  1N4U A;  5FMH A;  1PXB A;  3PVC A;  1H81 A;  1K0L A;  2WP9 A;  4H50 A;  3M0O A;  1EL9 A;  3SQP A;  2V60 A;  4GF7 A;  4Z44 A;  3UP4 A;  3V3O A;  4BJZ A;  3SZW A;  2YG6 A;  2RGJ A;  1PBB A;  5JCK A;  1TDK A;  2VVM A;  3QJ4 A;  2WDR A;  2WES A;  3RED A;  3DGH A;  2WBA A;  3URH A;  2C75 A;  4TM0 A;  2X8H A;  4JQ9 A;  5FS9 A;  1TDE A;  3DJE A;  2OAM A;  4H2P A;  2ZZB A;  1L0V A;  3CIR A;  2NPX A;  3T37 A;  3ABV A;  5C3J A;  2OAL A;  4DSG A;  2FJE A;  2YVF A;  4M52 A;  1VG9 A;  2BXR A;  3ICT A;  2GR3 A;  1CC6 A;  4LA1 A;  4GCM A;  1UKV G;  3SYI A;  2IVE A;  3NIX A;  2R0C A;  2YLT A;  3ADA B;  4ZN0 A;  1LVL A;  1YQ3 A;  3UKP A;  5HYM A;  4NTD A;  1DOB A;  1CJC A;  5JCI A;  5U1O A;  2XFP A;  3AE4 A;  2VQB A;  4UDQ A;  1D4D A;  4EM4 A;  4GRT A;  3NN0 X;  4A79 A;  2GV8 A;  2FJB A;  3B6D A;  4B66 A;  4HA6 A;  4U8J A;  4Z43 A;  3SFD A;  2V3B A;  4OVI A;  2DKH A;  3AEE A;  2EQ7 A;  1LQU A;  2YAU A;  3I6D A;  1FEB A;  1GRT A;  2X50 A;  3GRT A;  4FX9 A;  1GAL A;  3HYV A;  4J31 A;  2YWL A;  3UKH A;  1D7Y A;  3SM8 A;  3H8L A;  3GD3 A;  2VVL G;  3VRB A;  4OPU A;  1XHC A;  4YTN A;  2H88 A;  5HHF A;  4OPG A;  3DJG X;  1L9D A;  1E1N A;  1GND A;  1Y56 A;  4H4R A;  1E6E A;  2OLO A;  3KU9 A;  3EAO A;  4TLZ A;  4U8I A;  1CC4 A;  3GDN A;  4GR1 A;  3CPI G;  4AT2 A;  4ZCD A;  5KOW A;  2GAH B;  1S2Y A;  4GDE A;  2BRY A;  4P9S A;  4OPI A;  2WDV A;  2E1M A;  4EIP A;  5KNL A;  4B64 A;  1L9E A;  1GTE A;  1PBD A;  4EQS A;  1B8S A;  1S3E A;  1GRF A;  2DKI A;  3LJP A;  2C70 A;  3ZDN A;  2GRT A;  2VRL A;  4II2 A;  3CGD A;  4EMI A;  1TDN A;  3CGC A;  4X9N A;  3LOV A;  4OPT A;  3GRS A;  1FOH A;  1N4V A;  1YQZ A;  5BRT A;  4JNA A;  4NEV A;  1OJT A;  1ZMD A;  1E7P A;  3AE2 A;  1P2H A;  1ZKQ A;  4Z24 A;  2UZZ A;  1D5T A;  2BYB A;  1KNP A;  3UOV A;  2J3N A;  3VQR A;  1ZOV A;  3UTG A;  2E5V A;  2C4C A;  3P4Q A;  3S61 A;  4H4P A;  2C67 A;  3AED A;  1NAA A;  1GT8 A;  1CC2 A;  2BC1 A;  4OPD A;  2QA1 A;  2YLR A;  4H7U A;  3L1R A;  1TYT A;  1PJ6 A;  2JAE A;  2V61 A;  4OCG A;  3RHA A;  1H6V A;  1PJ7 A;  4K2X A;  1DNC A;  3BNU A;  3ITJ A;  3NN6 X;  5KWF A;  5BUL A;  1NG3 A;  4U2L A;  4RSL A;  1F8S A;  2YR6 A;  3AWI A;  3P1W A;  5JCM A;  3JSK A;  2W0H A;  1PS9 A;  4CCQ A;  4CY6 A;  3SX6 A;  1NHS A;  5KVH A;  3ATQ A;  1NG4 A;  1ELI A;  3BHF A;  3NHO X;  4JY2 A;  3UKF A;  1OJD A;  1BGN A;  4BJY A;  4II3 A;  3Q9T A;  3BI2 A;  4EM3 A;  3NTD A;  4H2N A;  4HB9 A;  3F8P A;  4D03 A;  1BGJ A;  2YR4 A;  2YVJ A;  3VR9 A;  1Y0P A;  2WU5 A;  2YLX A;  3P4R A;  3UOY A;  2VVL A;  3SZC A;  2JK6 A;  4IVO B;  2XCG A;  4I59 A;  1Q9I A;  2C76 A;  3IF9 A;  2GEW A;  5KXJ A;  4KPR A;  1H2I A;  2WHD A;  3NYE A;  3EPT A;  1GES A;  4ECH A;  1H84 A;  3RP7 A;  4IA5 A;  2Q0L A;  2XLR A;  3S5W A;  1GV4 A;  5HY5 A;  4NTC A;  2B76 A;  4J57 A;  2BK5 A;  2YR5 A;  1TYP A;  4U2T A;  4K5R A;  3GMC A;  2FJA A;  4U8K A;  4Z2R A;  1ZP0 A;  3NYF A;  4Z2T A;  2C64 A;  4JDR A;  1XPQ A;  2WDQ A;  3ALL A;  4NWZ A;  4Z26 A;  3DH9 A;  2AAQ A;  5GRT A;  3BNM A;  3NK0 X;  4BK3 A;  3ALM A;  2WS3 A;  3GYX A;  4PAB A;  3CMM A;  2RAB A;  4LU6 A;  3VRA A;  2V5Z A;  3C4A A;  5EOW A;  4EMJ A;  3L5O A;  1N4W A;  2WOV A;  3QSM A;  2YLZ A;  1DJQ A;  3T31 A;  1GOS A;  1O94 A;  3FG2 P;  2V3A A;  1S2Q A;  2YG7 A;  4IVM B;  3DA1 A;  2Q0K A;  3EF6 A;  2FJD A;  1PHH A;  2XVE A;  3FPZ A;  1E39 A;  3AE5 A;  3H8I A;  4J56 A;  3PS9 A;  5JCN A;  3UOZ A;  1K0J A;  4GDP A;  4WX1 A;  1ZMC A;  4IV9 A;  1EBD A;  4XWZ A;  4YTP A;  2YVG A;  2C65 A;  1S3B A;  2Z5X A;  2XFQ A;  4YKF A;  4A99 A;  2OA1 A;  1TRB A;  3VRD B;  4UDR A;  3VR8 A;  1JRZ A;  1E1K A;  4CRT A;  1O95 A;  3KKJ A;  3T2Z A;  2BA9 A;  4H4Q A;  4G9K A;  2GR0 A;  1MOK A;  4DSH A;  4J2W A;  3SXI A;  3SY4 A;  2GMH A;  4H4Y A;  2PHH A;  3NG7 X;  3F8D A;  5DBJ A;  3T2Y A;  1NEN A;  3D1C A;  3NYC A;  4G73 A;  1JRY A;  3RNM A;  1B5Q A;  2YG3 A;  4G6G A;  4BK1 A;  4YSY A;  2WOI A;  2WET A;  4H2Q A;  4Z25 A;  4RG3 A;  1SEZ A;  3M12 A;  1K0I A;  2WEU A;  2JB1 A;  3SFE A;  3LZW A;  1MXT A;  3QFB A;  1QLB A;  3L8K A;  2VOU A;  4A9W A;  3FBS A;  2ACZ A;  3P4P A;  5U63 A;  1RSG A;  4K5S A;  1IUV A;  4ADW A;  4BUR A;  4NTE A;  2GQF A;  2BS2 A;  3UKQ A;  3COX A;  2XFU A;  3PG6 A;  1B37 A;  3AE8 A;  1BKW A;  1QJD A;  3ICR A;  4A6N B;  3QVR A;  4B65 A;  2WPF A;  2YM1 A;  1LTX R;  3C96 A;  3KD9 A;  1TDF A;  3SZF A;  4CBQ A;  4GUV A;  4CNJ A;  4GAP A;  2CVJ A;  1LV0 A;  3BI5 A;  3CTY A;  3AE6 A;  2BK3 A;  4X4J A;  3UKK A;  4NNJ A;  1L9C A;  1LJ1 A;  2CUL A;  4A5L A;  2B9X A;  4C3X A;  3AD7 B;  3II4 A;  4YT0 A;  4AP1 A;  3GYJ A;  5KVI A;  2VQ7 A;  1RP0 A;  3C4N A;  1FL2 A;  1NHP A;  3P9U A;  1VQW A;  4G74 A;  1PXC A;  3NK1 X;  1GTH A;  3M13 A;  2BC0 A;  3DK8 A;  4AP3 A;  5L46 A;  3AYJ A;  3AYI A;  3GMB A;  4XXG A;  3F8R A;  3FMW A;  1JNZ A;  3GD4 A;  3AEB A;  1D4E A;  5EB4 A;  1VG0 A;  3UKL A;  3CNJ A;  3NNE A;  1BWC A;  3K30 A;  2EQ9 A;  3OZ2 A;  1GSN A;  4ZCC A;  1QO8 A;  5BUK A;  4Y4N A;  3O0H A;  4B69 A;  1P2E A;  4NZH A;  3HYX A;  5FS7 A;  1GRE A;  2BS4 A;  1EL5 A;  3QVP A;  1DOE A;  3IWA A;  5CQF A;  2C7G A;  3V76 A;  3AEC A;  1F6M A;  5EBK A;  1H83 A;  1PJ5 A;  2B9Y A;  1JEH A;  2RGO A;  2Z5Y A;  3AD8 B;  1ONF A;  3CN8 A;  2XLP A;  3ISH A;  3K7M X;  2NVK X;  4B68 A;  2R46 A;  1LPF A;  4UDP A;  2R0G A;  1ZOY A;  1F8R A;  1GXF A;  3AEG A;  4J33 A;  2GR1 A;  3G5R A;  5C2T A;  1Z6L A;  3NK2 X;  2JKC A;  3CNS A;  1CJ4 A;  1PXA A;  5CKU A;  3QSE A;  3ZYX A;  1V59 A;  1DJN A;  1JNR A;  1KFY A;  1OJC A;  2BAC A;  3WE0 A;  1X31 B;  1YY5 A;  2YQU A;  3P4S A;  4E0V A;  4JNQ A;  3K7T A;  4N9X A;  1IUS A;  3NLC A;  3NTA A;  3CGE A;  3IHM A;  2OLN A;  2VZ2 A;  5ER0 A;  2TMD A;  1F3P A;  5GSN A;  4U8P A;  2JB3 A;  4REK A;  1DOD A;  1M6I A;  2ZZC A;  2XDO A;  4U8N A;  5BVA A;  2X3N A;  1D7L A;  4KX6 A;  3AEA A;  5EB5 A;  4XWR A;  4TM3 A;  3KA7 A;  3NH3 X;  3RP6 A;  1H82 A;  2GB0 A;  3V3N A;  4AT0 A;  4H2R A;  3SZ0 A;  2BAB A;  1N1P A;  2VRM A;  5KOX A;  2IVD A;  2GAG B;  4IA6 A;  2Y6Q A;  3GDP A;  2Q6U A;  4TLX A;  2WOW A;  1KF6 A;  4C5O A;  3UTH A;  1XAN A;  4H4Z A;  4TM4 A;  1PBE A;  4OPL A;  1DXL A;  1GPE A;  2XLU A;  3UKA A;  4D04 A;  3IC9 A;  5U25 A;  1IUX A;  3AE1 A;  1KDG A;  1Y56 B;  2WQY A;  1CJ3 A;  2BXS A;  2YLS A;  1MO9 A;  3DME A;  4K7Z A;  5FS8 A;  2B7S A;  2EQ8 A;  1DOC A;  3KPK A;  2ARD A;  2GR2 A;  4K8D A;  3Q6J A;  3KVE A;  1GRB A;  4O5Q A;  4J36 A;  2GF3 A;  1KSU A;  1EL8 A;  4EQX A;  2C3D A;  3NGC X;  1GEU A;  4MJW A;  2XLS A;  1HYU A;  1KSS A;  1PN0 A;  2ZBW A;  2PYX A;  1YQ4 A;  2E4G A;  3GSI A;  3UP5 A;  4YXD A;  2WP6 A;  1OJ9 A;  4CCR A;  3PO7 A;  2GVC A;  2JBV A;  1OJA A;  5IQ1 A;  1PDH A;  3D8X A;  5TR3 A;  3LXD A;  5JCL A;  2WU2 A;  3UTF A;  3AYL A;  4B63 A;  2X99 A;  1AOG A;  1PBC A;  3HZL A;  4PAA A;  4WCT A;  4AOS A;  2AQJ A;  4C77 A;  3G5Q A;  4U8O A;  2B9W A;  2A8X A;  2RGH A;  4B67 A;  2B7R A;  3LB8 A;  2QAE A;  1FEC A;  1YKJ A;  3QSS A;  2IID A;  4YSZ A;  4A65 A;  1W4X A;  2R4E A;  2JB2 A;  5KRQ A;  5J60 A;  4YWO A;  3SGL A;  3AEF A;  1CJ2 A;  1CBO A;  3AE3 A;  2XVH A;  1NHQ A;  2APG A;  4YKG A;  5KMP A;  2YLW A;  4UP3 A;  1NEK A;  4H4S A;  4BV6 A;  4I58 A;  1GER A;  2XVF A;  4C3Y A;  3ATR A;  2BK4 A;  4JY3 A;  5KMQ A;  1KN0 A;  3IHG A;  3NT6 A;  2YG5 A;  3DJJ A;  2XFO A;  3BHK A;  3CNP A;  4EIQ A;  2BCG G;  1ZY8 A;  2A89 A;  4Z2U A;  4TM1 A;  1JRX A;  4Y4L A;  3UTE A;  3KLJ A;  2Y6R A;  4FK1 A;  1COY A;  2O9Z A;  1IUU A;  4K22 A;  1B4V A;  4J34 A;  3T14 A;  1GRG A;  1CHU A;  4Y4M A;  3G5S A;  3E1T A;  5LV9 A;  2WPC A;  2FBW A;  1ZX9 A;  2EQ6 A;  4AOX A;  3CNT A;  3CPH G;  3GWF A;  1H86 A;  2GMJ A;  2XYO A;  1NHR A;  2GH5 A;  1E1M A;  5IQ4 A;  4H4X A;  1IUW A;  2X8C A;  2BS3 A;  3CPJ G;  2F5Z A;  3D9X A;  4OPC A;  1EL7 A;  3LZX A;  3T2K A;  3KPF A;  4DGK A;  1ZDL A;  4EQR A;  4CNK A;  4BK2 A;  1S7M A;  2C3C A;  1BZL A;  2R0P A;  2QCU A;  1Q1R A;  3I3L A;  3DK4 A;  3DJD A;  4YTM A;  1ZK7 A;  2TPR A;  2GQW A;  4YSH A;  4H4T A;  4B1B A;  2C73 A;  2H89 A;  2BRA A;  2Q7V A;  3GWD A;  4EMW A;  3T0K A;  4FDC B;  3RP8 A;  2V6O A;  2ZZ0 A;  4A7A A;  2BCP A;  4X9M A;  5JRB A;  3NKS A;  5KMR A;  4A6N A;  3H4K A;  4H4W A;  1BF3 A;  3AXB A;  2C66 A;  1E1L A;  2QA2 A;  3AB1 A;  5IPY A;  3ICS A;  1REO A;  3NRN A;  2XLT A;  4JN9 A;  4USQ A;  2C72 A;  3DK9 A;  4U8L A;  1Q1W A;  2CFY A;  5FS6 A;  3K7Q X;  2XVJ A;  1KNR A;  2X8G A;  1XDI A;  2A87 A;  4O5U A;  4YSX A;  4H4V A;  1D4C A;  3CND A;  1GET A;  1NPX A;  4LII A;  4CY8 A;  3OC4 A;  2R45 A;  4USR A;  1M64 A;  3R9U A;  2I0Z A;  4FK1 C;  2XFN A;  1FCD A;  4H4U A;  4EQW A;  1VDC A;  3GYI A;  3B3R A;  1GRA A;  2WP5 A;  4GAV A;  1RYI A;  3EAN A;  3CGB A;  1IJH A;  5J7X A;  3UOX A;  3QFA A;  2XVI A;  2R9Z A;  2AR8 A;  1IUT A;  5M0Z A;  2WPE A;  1PBF A;  1GRH A;  4ICY A;  1LQT A;  4NEW A;  2CDU A;  3HYW A;  4APN A;  4U8M A;  1JU2 A;  3UCL A;  1H7X A;  3ALJ A;  1TDO A;  1VRQ B;  3BI4 A;  1CF3 A;  2YM2 A;  5HXI A;  2YG4 A;  4U2S A;  3AE7 A;  1FEA A;  1CL0 A;  3DGZ A;  1NDA A;  1K4Q A;  3AE9 A;  1H7W A;  1F8W A;  1JOA A;  3FIM B;  3LAD A;  1O5W A;  2R4J A;  4DNA A;  5M10 A;  4C74 A;  5KMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...