3DGHA

Crystal structure of drosophila thioredoxin reductase, c-terminal 8-residue truncation
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
477
structure length
477
Chain Sequence
SYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDDKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEESEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKDKIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase 1, mitochondrial
publication title Crystal Structure of Drosophila Thioredoxin Reductase, C-terminal 8-residue truncation
rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase
total genus 155
structure length 477
sequence length 477
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2008-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF00890 FAD_binding_2 FAD binding domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3dghA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dghA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dghA02
1NG3A 4RG4A 3LXDA 1PJ6A 3FIMB 3L8KA 3GMBA 5JCMA 4UDRA 3F8RA 4UDPA 3H8IA 1E6EA 4Z2TA 2B76A 4EIPA 3OC4A 2YVGA 4K2XA 2WETA 4OCGA 4YTMA 4A65A 4Z2UA 1TDFA 1O94A 2YR6A 3QSSA 2C67A 4XWRA 3UOXA 4B69A 4IA5A 2JBVA 4TM4A 4CCRA 1GERA 1S2YA 1GRHA 2V60A 1Q1RA 5M10A 5FS8A 3H4KA 1GNDA 4IVOB 3NHOX 3RP7A 3AEGA 2GVCA 4J33A 1BKWA 1NHRA 2YLZA 3IHGA 3Q9TA 2XFQA 1KNRA 2YG6A 1K0LA 1GRTA 4IV9A 1B5QA 1JNZA 1PBCA 3GDPA 3L1RA 3DGZA 2WU2A 3NGCX 2WPCA 2NVKX 1OJCA 4D04A 2VRMA 3VRDB 4BK3A 2Y6QA 2BYBA 1S2QA 2XFOA 2BA9A 2XLUA 3DH9A 5CKUA 4Z43A 2CDUA 1GTHA 3C4AA 5BRTA 3SQPA 4H2QA 4U8NA 1PS9A 1E39A 4GR1A 1GEUA 4U8LA 1GOSA 2JB3A 3ITJA 2BS2A 3CPIG 4DSHA 2YG5A 2TMDA 3NYEA 4FK1C 2YG7A 1LTXR 5JCIA 4A6NB 1TDEA 1BZLA 1CBOA 1COYA 1RP0A 1GREA 1GRFA 3GMCA 2YM1A 3QVPA 3K7TA 5BVAA 4YSYA 1Y56A 3AEBA 4OVIA 4UDQA 1K0JA 2C3DA 2JAEA 4JDRA 4U2LA 2YLXA 3NYCA 4K5SA 3VQRA 2H88A 2WOIA 2C65A 3RP8A 4C3XA 1H6VA 1EL8A 3KVEA 1DJQA 2RGJA 4FDCB 3V76A 1S3EA 3HZLA 2BXSA 4TLXA 2GAGB 3O0HA 2ZBWA 3AYLA 2F5ZA 2R0CA 1REOA 4YTNA 1V59A 1CJ2A 3JSKA 3NK2X 4H7UA 2BC1A 1FCDA 5M0ZA 4B64A 2A8XA 1UKVG 2FJBA 3VR9A 4AOXA 4Z2RA 5BUKA 2FBWA 3AEAA 4CNJA 4B1BA 4BV6A 3GDNA 3GYIA 5KWFA 3ALMA 4Z26A 1L9EA 1PN0A 4H2NA 3LJPA 2WPEA 2UZZA 4TM3A 3UKFA 3SFEA 3BI4A 3WE0A 4C74A 4A7AA 3DMEA 4C5OA 3DK9A 1CC6A 3EAOA 1GESA 1LPFA 2E5VA 1XDIA 1ZY8A 3CGEA 2OA1A 2EQ8A 2C66A 4H50A 2APGA 2XVEA 4A9WA 1VDCA 2R45A 4U2SA 4PAAA 4K5RA 3UP4A 1XANA 2X8GA 2BS3A 4BJYA 1GV4A 1KNPA 1QO8A 3QFAA 2B7RA 3ICRA 2Z5XA 3FPZA 1D4DA 1IUVA 3KPFA 2WDQA 3NK0X 4KX6A 4U8KA 1N1PA 3QVRA 1H82A 4CY6A 4YTPA 1YQZA 3P4QA 1LVLA 3LOVA 1VRQB 2YR5A 1FEAA 2ACZA 4GRTA 1QJDA 3B3RA 3CNDA 3KU9A 2HQMA 3S61A 1CJCA 2C75A 1RYIA 4JNAA 1PBDA 3C4NA 1E1LA 5ER0A 3VR8A 1CC2A 1M6IA 4J31A 2NPXA 2JB2A 2J3NA 1F6MA 3E1TA 2R4JA 4A99A 4Y4NA 1ELIA 1ONFA 1GETA 4NEWA 1ZOYA 3NNEA 1VG9A 1L9DA 1N4WA 1PJ7A 1E1NA 1D7YA 3ZYXA 1KF6A 1TYPA 3KLJA 4FX9A 1JNRA 4HB9A 2XLRA 1NAAA 2YLSA 4FK1A 4BK1A 1E7PA 1N4UA 2XFUA 3AE2A 4H2PA 1CJ4A 3LADA 3KKJA 2YLWA 3T37A 1NENA 4U8OA 1CF3A 2XLSA 2XLTA 3DJEA 2WP9A 4WCTA 4RSLA 3QSEA 3ICTA 2Q7VA 3AE8A 2GQWA 4DSGA 3CGDA 1E1MA 1SEZA 5IQ1A 4NEVA 4D03A 3DK4A 2BXRA 3GD4A 3IC9A 5KOWA 1K4QA 2GR0A 4GCMA 1VQWA 3CN8A 4YSXA 3FMWA 3K7MX 4JQ9A 3NK1X 4AOSA 1OJAA 3UKPA 5L46A 2WHDA 1OJ9A 1FOHA 1YQ4A 2V61A 3AWIA 3UTHA 3GRSA 1GXFA 1CC4A 4PABA 4WX1A 2XFNA 2C64A 2O9ZA 2XDOA 5KVIA 4CCQA 1JOAA 2IVEA 2BACA 3LZXA 3DJGX 1RSGA 4H4ZA 2GB0A 2Q0KA 1FECA 4A79A 3UCLA 2WDVA 3VRAA 4YWOA 1X31B 1ZMDA 5HY5A 2YM2A 4OPCA 3FBSA 5EB4A 2GR2A 4B67A 3CNTA 1LJ1A 2YWLA 3P4PA 4Y4MA 1Y0PA 2V6OA 1PBFA 5JCKA 2Z5YA 5JCNA 1PXCA 1E1KA 2XFPA 3IWAA 4GUVA 4OPTA 4ICYA 4I58A 1JRZA 2WBAA 3AE3A 4Y4LA 2VZ2A 3F8DA 1ZOVA 5U63A 5TR3A 2JK6A 3II4A 4A5LA 2R4EA 1ZK7A 4P9SA 4OPDA 2V3BA 1AOGA 2IIDA 1BGJA 5EBKA 4DNAA 1DJNA 2R0PA 1DOCA 4EQSA 2BCGG 3AE1A 3G5SA 2C3CA 4J56A 3NLCA 2GMJA 4ZCCA 2RABA 1KSSA 2VRLA 4B63A 1O5WA 2BK5A 3M12A 1DOBA 2GQFA 3NH3X 4Z25A 1BWCA 4H4PA 2XVJA 4XWZA 3GSIA 3UKQA 5IQ4A 2BCPA 3BHKA 3PO7A 4EM4A 3EPTA 1Q1WA 5FS9A 1IUWA 4J2WA 3CGCA 1NDAA 1EBDA 1ZDLA 1KSUA 4EQWA 1NG4A 1P2HA 2XLPA 3AB1A 3ATQA 2X8CA 3GWFA 5HHFA 3RHAA 1H86A 3AYIA 1NEKA 2YG4A 4U8PA 4EMIA 4CBQA 3RNMA 1KDGA 2GMHA 3I6DA 3AEEA 2XYOA 3BNMA 4RG3A 4H4YA 4ADWA 1NHQA 5J60A 2B9XA 5LV9A 1L9CA 4EMJA 1Q9IA 4BURA 3URHA 1ZP0A 4H4SA 3ICSA 3REDA 5EB5A 1F8WA 1K0IA 1YKJA 1Z6LA 3NRNA 3CNPA 2XVHA 2JKCA 1JRXA 4APNA 3AD9B 4U8MA 4JNQA 4HA6A 3S5WA 5C2TA 2CFYA 2WESA 2VQBA 1PHHA 3V3OA 4AP3A 2CVJA 1TYTA 1DODA 4B66A 4KPRA 1NHSA 3AE9A 4O5QA 1PBEA 1Y56B 2IVDA 2BS4A 2GV8A 4YKGA 3QJ4A 2EQ9A 3COXA 3NN0X 3NT6A 5KOXA 4OPIA 1QLBA 1D7LA 3AE4A 3GWDA 4AT2A 5CQFA 4EMWA 4EM3A 5C3JA 3ADAB 2OLNA 2FJDA 3KA7A 4REKA 4H4VA 5FMHA 1DNCA 3ABVA 2YR4A 2R9ZA 4H4TA 2ZZBA 5KXJA 3NTDA 1B8SA 2WOWA 4LIIA 1FL2A 4X9NA 4GDPA 2BK3A 2C72A 1NPXA 4K7ZA 3NYFA 1PXBA 1ZKQA 1H7XA 4N9XA 3C96A 1S3BA 1LQTA 2OALA 2ZZ0A 1PBBA 4B68A 2AQJA 3GRTA 1GRBA 4M52A 2QAEA 1IUTA 1LQUA 2XVFA 3UTFA 1FEBA 3CTYA 2PYXA 2C76A 2YLTA 3KD9A 1HYUA 3OZ2A 3AXBA 1TDOA 5BULA 1OJDA 3R9UA 2E1MA 4J36A 5U25A 3NIXA 1D5TA 4LA1A 3AD8B 4AP1A 3QSMA 4OPLA 2VVLA 4NZHA 4A6NA 1BGNA 4I59A 2PHHA 4NTCA 5HYMA 4K8DA 1GTEA 1H83A 1M64A 1P2EA 1NHPA 1MXTA 1YY5A 2YQUA 2OAMA 3CNJA 4UP3A 2I0ZA 2V5ZA 2OLOA 3DK8A 3EF6A 1W4XA 4EQRA 4BJZA 2EQ7A 1TDNA 2GR3A 3G5QA 4ECHA 3IHMA 5U1OA 1JRYA 1EL9A 4TM0A 4H2RA 4OPGA 3LB8A 3K7QX 4EIQA 2WQYA 2X8HA 2Q0LA 1CHUA 3F8PA 4USQA 1VG0A 5EOWA 2QCUA 2VQ7A 3I3LA 3AECA 4CRTA 2QA2A 4H4UA 3AE5A 1L0VA 4GDEA 1TDKA 2YAUA 5JCLA 3AD7B 1EL5A 4LU6A 4YSZA 4JN9A 4U8JA 2GR1A 3H8LA 2ARDA 1TRBA 4YSHA 3P4SA 3CPHG 3UOZA 3UKAA 2YLRA 3P9UA 5KRQA 2WP5A 1B4VA 1ZX9A 1PJ5A 2BK4A 3AEDA 3NG7X 4K22A 4NTEA 4Z44A 3UP5A 1DXLA 3UTEA 3BI5A 3DJJA 3ATRA 2XVIA 2DKHA 4X9MA 4U2TA 3NTAA 2WP6A 2C7GA 1JEHA 4H4XA 2B7SA 4IVMB 4OPUA 5IPYA 2EQ6A 1LV0A 2RGHA 2YVFA 4IA6A 2H89A 2AR8A 3VRBA 2QA1A 4MJWA 1GRAA 3Q6JA 2BC0A 3BHFA 3CGBA 3P4RA 3D8XA 1H7WA 1DOEA 2Q6UA 1O95A 2YVJA 1D4EA 3D1CA 2FJAA 1OJTA 3GD3A 4YXDA 2C70A 2C73A 4Z24A 4J34A 5FS7A 2R0GA 3UOVA 4YKFA 2WDRA 4TM1A 2GH5A 3G5RA 1IUSA 3V3NA 3SFDA 1F3PA 3UOYA 1KFYA 3UKKA 2W0HA 4ZCDA 3ISHA 4ZN0A 1BF3A 1H84A 2TPRA 2X99A 2X3NA 2XCGA 4TLZA 5GRTA 2BABA 1GT8A 3UKLA 2JB1A 4XXGA 4CY8A 1CL0A 2X50A 3P1WA 2GF3A 1IJHA 1ZMCA 1PXAA 1EL7A 1GPEA 3AEFA 2B9YA 2DKIA 2Y6RA 3AYJA 3QFBA 2ZZCA 2GEWA 2CULA 2AAQA 1IUXA 3DJDA 3GYJA 3M13A 3LZWA 3PVCA 3SGLA 4U8IA 4USRA 3UKHA 2GRTA 3UTGA 1PDHA 2WPFA 1CJ3A 5FS6A 2YG3A 3FG2P 3K30A 3DA1A 3DGHA 1F8SA 4JY3A 3IF9A 1JU2A 3EANA 4JY2A 4EQXA 5DBJA 1GRGA 1XHCA 5KVHA 1MO9A 1B37A 4O5UA 2V3AA 5GSNA 2R46A 3ALJA 2VVMA 2FJEA 2WEUA 2WU5A 4H4QA 4NTDA 1YQ3A 3NN6X 4C77A 1GSNA 4CNKA 1IUUA 3B6DA 1N4VA 4H4WA 3RP6A 2B9WA 3SM8A 2WOVA 4B65A 2GAHB 4J57A 3CPJG 2RGOA 3PS9A 2WS3A 1GALA 4DGKA 4H4RA 3M0OA 3BI2A 4E0VA 2E4GA 3AE6A 3ZDNA 1XPQA 3NKSA 1MOKA 3ALLA 3BNUA 4X4JA 2A89A 4YT0A 2A87A 5HXIA 5J7XA 1H81A 2VVLG 1F8RA 4AT0A 4C3YA 3CIRA 4BK2A 3CNSA 4GF7A 2VOUA 3AE7A 1D4CA
chains in the Genus database with same CATH superfamily
1VQZA 3FIMB 3F8RA 3NFUA 1E6EA 4Z2TA 4MKSA 4Z2UA 2C67A 3IJLA 4IVOB 2GVCA 1NHRA 2XFQA 1P43A 3R1ZA 1B5QA 3GDPA 1OJCA 1FFVC 5FJRA 3DESA 4Z43A 1GTHA 1E39A 4GR1A 4U8LA 1SJAA 3ZLGA 2BS2A 4DSHA 2YG5A 3NYEA 3DIPA 2YG7A 3IJQA 5JCIA 1BZLA 1CBOA 3GC2A 1RP0A 1GREA 1GRFA 3GMCA 3AEBA 1L8PA 2YLXA 4K5SA 2H88A 2WOIA 3RP8A 4C3XA 1DJQA 3V76A 4TLXA 1KD0A 2F5ZA 1REOA 1V59A 2QVHA 3MWCA 5JRBA 2BC1A 1FCDA 5M0ZA 1UKVG 4AOXA 4Z2RA 4GGBA 1FHUA 5KNLA 4TM3A 3UKFA 3SX6A 4C74A 3WE0A 3EAOA 1GESA 2E5VA 3DGBA 3TOYA 4A9WA 1VDCA 4J3ZA 2PCEA 5KMQA 3FPZA 1D4DA 4FI4A 4YTPA 3QVRA 1YQZA 3P4QA 3LOVA 1VRQB 2XH2A 1E9IA 3CNDA 3KU9A 2HQMA 4G6HA 3C4NA 4KEMA 2NPXA 2JB2A 1F6MA 1SJCA 2R4JA 2NQLA 4E5TA 2XH0A 1ZOYA 3N6JA 1VG9A 1E1NA 1TYPA 3Q4DA 4FX9A 3KPKA 2BRAA 3R25A 2XFUA 2YLWA 4U8OA 2XLSA 2DW7A 4DSGA 1SEZA 4NEVA 1K4QA 1TZZA 2GR0A 4GCMA 3CN8A 3FMWA 3HRDC 3VCCA 2WHDA 3T2KA 3AWIA 3JVAA 2XFNA 4CCQA 1JOAA 3ZVIA 2BACA 3SQSA 3DJGX 4H4ZA 4A79A 1H2IA 2WDVA 1ZMDA 2GR2A 1SB3B 4Y4MA 2PU0A 5JCNA 1E1KA 1PXCA 2XFPA 3KUMA 2JK6A 4P9SA 4OPDA 3D9XA 3MY9A 5EBKA 3G5SA 3GYXA 2C3CA 2GMJA 2BK5A 1DOBA 3DFYA 1BWCA 3BHKA 3EPTA 1N5XA 5FS9A 1NDAA 1KSUA 3ATQA 5HHFA 2X8CA 3RHAA 1MRAA 2OQHA 3RRAA 3AEEA 4RG3A 4H4YA 5J60A 5LV9A 3V4BA 3URHA 5EB5A 4U8MA 2VQBA 3V3OA 1NHSA 3AE9A 3EEZA 3GWDA 1QLBA 4AT2A 2AL2A 5CQFA 3FVDA 3KA7A 4H4VA 5FMHA 2YR4A 4H4TA 3GO2A 3U9IA 3SY4A 2WOWA 3D46A 4X9NA 2POZA 4GDPA 4II3A 1SJDA 1PXBA 2E3TA 4N9XA 2AQJA 1FEBA 2C76A 2YLTA 1HYUA 3R9UA 4LA1A 4MGGA 2VVLA 4HPNA 4NZHA 4I59A 3CB3A 4TVYA 2I0ZA 4ECHA 4GMEA 5FJTA 3NVYB 3K7QX 2WQYA 1CHUA 1FFUC 3AECA 3DG6A 3AE5A 4GDEA 4DHGA 5G5HB 5KRQA 1DXLA 3DJJA 3DFHA 2WP6A 1X2GA 2C7GA 4IVMB 4OPUA 5IPYA 2EQ6A 2W54A 2QA1A 4MJWA 1N60C 3CGBA 1H7WA 1DOEA 2FJAA 3UOVA 4YKFA 4TM1A 3G5RA 2PTWA 1IUSA 3V3NA 4ZCDA 3AN1A 1H84A 2X99A 2XCGA 1EC7A 2PS2A 2ZADA 1CL0A 3V3WA 3SZCA 1IJHA 1ZMCA 2B9YA 2DKIA 3OP2A 3QFBA 2CULA 3M13A 3SGLA 2GRTA 2XH4A 2PP3A 3SN0A 4G6GA 3SR6B 1JU2A 5DBJA 4O5UA 2V3AA 3ALJA 2VVMA 4H4QA 4EWJA 3H8AA 4M0XA 1YQ3A 3NS1B 4C77A 4CNKA 3L5OA 1IUUA 4B65A 2GAHB 3CPJG 2RGOA 2WS3A 3QKEA 4E0VA 3NKSA 3ALLA 2A89A 1H81A 1F8RA 4C3YA 1D4CA 1NG3A 3L8KA 3GMBA 4UDRA 3H8IA 3FYYA 2B76A 4EIPA 4K2XA 4A65A 1TDFA 1O94A 3UOXA 2AL2B 4TM4A 4CCRA 1GRHA 5M10A 3H4KA 3AEGA 2YLZA 2P8CA 3Q9TA 3DG7A 3GD6A 2WU2A 2AKMA 3JZUA 4D04A 2P0IA 2OZ3A 1ONEA 2BYBA 2XFOA 2FYMA 4IT1A 3DH9A 2CDUA 5BRTA 3SQPA 2GSHA 2E5AA 3CXOA 4HNCA 5FJPA 2HXTA 3BOXA 5KMSA 1ZXIC 2OFJA 2YM1A 5BVAA 3K7TA 2HNEA 2MUCA 4OVIA 4ENLA 4IL2A 3VQRA 3T0KA 4HCLA 3KVEA 4FDCB 2GAGB 1BKHA 3O0HA 2ZBWA 2R0CA 4YTNA 1CJ2A 4Z17A 2FJBA 3VR9A 5BUKA 3AEAA 4G73A 1PN0A 2UZZA 3SFEA 4C5OA 1EBGA 3DK9A 1LPFA 1XDIA 1P48A 1ZY8A 3CGEA 2EQ8A 3OZMA 4U2SA 4K5RA 1KNPA 3QFAA 3ICRA 2QGYA 4KX6A 4U8KA 1H82A 4CY6A 4JHMA 4DXKA 4GRTA 3EKGA 3B3RA 2GGJA 2C75A 4IHCA 1PDZA 5ER0A 1CC2A 2OZ8A 2AKZA 3E1TA 1ELIA 1ONFA 3MSYA 1N4WA 1D7YA 1WUEA 2PTYA 4HB9A 3T8QA 3RR1A 5BOFA 3HYVA 2YLSA 3ZLFA 3AE2A 4Z1YA 1CJ4A 3T37A 1CF3A 2XLTA 3DJEA 3ZLHA 1TE6A 3VC6A 1NU5A 3ICTA 3AE8A 2GQWA 3Q45A 2W3RA 4D03A 3GD4A 3IC9A 3T9PA 4YSXA 1JRPA 3K7MX 3NK1X 4A3RA 4AOSA 3UKPA 1OEPA 1YQ4A 2V61A 3GRSA 2FKPA 5KVIA 1RSGA 1FECA 3HW2A 1X31B 3HYWA 1LJ1A 5JCKA 2Z5YA 2P8BA 4I58A 1JRZA 2WBAA 3F8DA 1ECQA 5U63A 4A5LA 1MUCA 1ZK7A 3ES8A 3ES7A 2IIDA 3FJ4A 1DJNA 1DOCA 2BCGG 3UXLA 2RABA 3RITA 1KSSA 4B63A 4E6MA 1O5WA 3M12A 4H4PA 4XWZA 3GSIA 3UKQA 3MKCA 5IQ4A 3PO7A 3N4FA 1ZDLA 2XLPA 1H86A 4HN8A 1NEKA 4CBQA 3RNMA 1KDGA 3I6DA 2OQYA 3UCCA 2XYOA 1L9CA 1Q9IA 4BURA 1ZP0A 3SZWA 3REDA 4KPLA 1K0IA 3THUA 3CNPA 4GISA 2XVHA 1W6TA 1JRXA 2PP0A 2XH7A 4HA6A 4JNQA 3S5WA 2CFYA 2CVJA 1DODA 4KPRA 4O5QA 1FHVA 2EQ9A 3NT6A 5KOXA 3RGTA 3AE4A 4EMWA 5C3JA 1DNCA 3ABVA 5KXJA 3NTDA 4LIIA 1FL2A 2C72A 1NPXA 3MUCA 4M6UA 1ZKQA 1H7XA 2GGHA 1LQTA 2ZZ0A 2XVFA 3A7RA 3CTYA 3I6TA 1T3QC 3AXBA 4J36A 1D5TA 3AD8B 2DW6A 1BGNA 1P2EA 1YY5A 1MXTA 3OZYA 4H2HA 3QLDA 2MNRA 4EQRA 1W4XA 2GR3A 3PWIA 1JRYA 1EL9A 3S5SA 4OPGA 4EIQA 4G74A 4USQA 3VC5A 1VG0A 2QA2A 4JN9A 1FIQB 2GR1A 1YEYA 3P4SA 3UKAA 3EUB3 2WP5A 1ZX9A 1PJ5A 3BI5A 4U2TA 2B7SA 1LV0A 2RGHA 4IA6A 2AR8A 1KN0A 4JN8A 3Q6JA 3P4RA 2C4CA 1O95A 2YVJA 1D4EA 2QDDA 1OJTA 3A7AA 4IP4A 3GD3A 4YXDA 2BRYA 4J34A 5FS7A 3SFDA 1F3PA 3NVWB 5EU9A 3ISHA 3RO6A 5FJUA 2TPRA 2OPJA 1GT8A 3STPA 1PXAA 3AEFA 4DN1A 3AYJA 3T6CA 2AAQA 1CJ3A 1EBHA 3DA1A 3PK7A 1F8SA 1RVKA 4JY3A 3IF9A 4JY2A 2XGZA 2QJNA 3N6HA 4JN7A 5KVHA 3UJRA 1B37A 3T14A 5GSNA 1XS2A 2R46A 2FJEA 3R0KA 2GL5A 2ZC8A 3UJ2A 3B6DA 3RP6A 3SM8A 3TQPA 1GALA 3RCYA 2E4GA 3ZDNA 1MOKA 4X4JA 4IZGA 2PTXA 1NELA 2PSNA 5HXIA 4AT0A 4GF7A 2VOUA 3NRZB 3LXDA 1PJ6A 5JCMA 2YVGA 4YTMA 3QSSA 2JBVA 1R6WA 3T31A 2V60A 1Q1RA 3RP7A 3I6EA 1KNRA 4IV9A 1JNZA 1PBCA 3L1RA 3DGZA 2P3ZA 2NVKX 2VRMA 4BK3A 3DERA 2Y6QA 1S7MA 2XLUA 5CKUA 3BSMA 2JB3A 2TMDA 1LTXR 1TDEA 1COYA 1F9CA 4X2PA 3IJIA 4UDQA 4JDRA 3UGVA 2C65A 2RGJA 1S3EA 3HZLA 2CHRA 3UJSA 3JSKA 3NK2X 2RDXA 2A8XA 2FBWA 4CNJA 4B1BA 4BV6A 3GDNA 3GYIA 4Z26A 1L9EA 1N61C 3DG3A 4H2NA 2WPEA 4A7AA 2OX4A 1CC6A 1R0MA 2OA1A 5J04A 2C66A 4H50A 2APGA 2R45A 2BS3A 4BJYA 2GGIA 1GV4A 5KMRA 1QO8A 2Z5XA 1IUVA 7ENLA 3KPFA 2WDQA 3NK0X 2ONEA 1SJBA 1QJDA 1TKKA 3UXKA 3S61A 1CJCA 1RYIA 3T4WA 3VR8A 1M6IA 3CAWA 4Y4NA 3NNEA 1L9DA 1PJ7A 3KLJA 1JNRA 1NAAA 4BK1A 4H2PA 3LADA 3KKJA 4ROPA 2WP9A 3QSEA 2Q7VA 3R11A 3CGDA 1E1MA 3DK4A 3K1GA 1VQWA 3PWGA 4JQ9A 5L46A 3NVVB 2C64A 2XDOA 3H12A 3UCLA 4YWOA 3D47A 4GAVA 3P4PA 1Y0PA 2V6OA 3T2YA 1WUFA 3IWAA 4GUVA 4ICYA 3AE3A 3V5FA 4Y4LA 2VZ2A 5TR3A 1IYXA 1BQGA 2V3BA 4E8GA 2R0PA 3OW1A 4EQSA 3SZFA 3NLCA 4J56A 4ZCCA 2VRLA 3VCNA 2HXUA 3TJ4A 3CK5A 1DTNA 4EM4A 1Q1WA 1IUWA 4J2WA 3OPSA 1P2HA 4EQWA 3AYIA 2GDQA 4U8PA 2GMHA 1MDLA 1JCTA 3H7VA 3BNMA 4ADWA 3FV9A 1NHQA 2AL1A 4EMJA 4GIRA 4H4SA 3ICSA 1YKJA 5IDZA 2JKCA 3AD9B 5C2TA 4AP3A 1PHHA 4B66A 6ENLA 2BS4A 2GV8A 4YKGA 3QJ4A 3COXA 4OPIA 1D7LA 3GY1A 4HCDA 4EM3A 3ADAB 2OLNA 2FJDA 2ZZBA 3P93A 1B8SA 2QQ6A 4J1OA 2BK3A 4K7ZA 3NVZB 3C96A 1S3BA 2OALA 3GRTA 1GRBA 4M52A 2QAEA 1LQUA 3UTFA 3ETRB 4G9KA 4GGHA 2PODA 3KD9A 1TDOA 1OJDA 2QDEA 2E1MA 5U25A 3NIXA 4AP1A 4OPLA 4A6NA 2PHHA 5HYMA 4K8DA 2PMQA 1GTEA 1M64A 2YQUA 4UP3A 2V5ZA 4ZA0A 3G5QA 3NO1A 3IHMA 4A35A 3SN4A 2W3SA 3LB8A 3FXGA 2GGEA 3F8PA 2Q0LA 2QCUA 3I3LA 4CRTA 4DYEA 4F4RA 1TDKA 2YAUA 4HNLA 4YSZA 3H8LA 2ARDA 3UOZA 2YLRA 1B4VA 4K22A 4Z44A 4NTEA 3UP5A 2XVIA 4A6GA 2DKHA 4X9MA 3NTAA 1JEHA 4H4XA 2H89A 3VRBA 3U4FA 1GRAA 3TWBA 3BHFA 3UJEA 2C70A 4Z24A 3TTEA 2R0GA 4DWDA 3UOYA 1KFYA 2W0HA 4GYPC 1BF3A 2GGGA 2X3NA 3CYJA 5GRTA 2BABA 2JB1A 4CY8A 3T2ZA 2X50A 1EL7A 1V97A 4ZOHB 2ZZCA 3CMMA 2GEWA 3I4KA 1IUXA 3PVCA 3LZWA 3UKHA 2WPFA 5FS6A 2PA6A 3AM9A 4II2A 4YWSA 3ZVHA 3R07C 3EANA 4EQXA 4G7FA 1MO9A 2XSXA 3PG6A 4FP1A 2OZTA 4NTDA 1PDYA 3QPEA 3NN6X 1GSNA 1N4VA 4H4WA 2B9WA 3PS9A 4DGKA 4H4RA 3M0OA 1ELSA 3BI2A 3DEQA 3SN1A 2OG9A 3AE6A 1XPQA 1XPYA 3PFRA 3BNUA 4GFIA 4YT0A 1N63C 2A87A 5J7XA 2PP1A 2VVLG 3CIRA 3CNSA 4E4FA 3AE7A 4NNJA 4RG4A 4UDPA 3OC4A 4OCGA 2WETA 4K1WA 2YR6A 4XWRA 4B69A 4IA5A 4E4UA 1GERA 1S2YA 5FS8A 4GYPA 1GNDA 3NHOX 4J33A 3SXIA 1BKWA 3IHGA 2PPGA 2YG6A 1K0LA 1GRTA 3NGCX 2WPCA 1EC8A 3VRDB 1JPDX 1S2QA 2BA9A 3B9JB 3UJFA 1X2HA 2OVLA 3C4AA 4H2QA 4ZCWA 4U8NA 1PS9A 2PGWA 1GEUA 1GOSA 3A7UA 4KT2A 3ITJA 3CPIG 4FK1C 3R0UA 3FCPA 3CXBA 4A6NB 3AMZA 2I5QA 3QVPA 4YSYA 1Y56A 1STZA 1VDVA 2HZGA 1K0JA 3SYIA 2C3DA 2JAEA 4U2LA 3NYCA 1H6VA 1EL8A 3OTRA 2BXSA 3SBFA 3AYLA 4H7UA 3N4EA 2PGEA 3QTPA 4B64A 3SSZA 5KWFA 3ALMA 3LJPA 3BI4A 3DMEA 3H70A 5KMPA 2XVEA 4PAAA 3UP4A 1XANA 2X8GA 2B7RA 3P0WA 1N1PA 3SZ0A 1LVLA 2YR5A 1FEAA 2ACZA 5FJOA 1KKOA 4JNAA 1PBDA 1E1LA 3CT2A 4J31A 3UCDA 2J3NA 1JDFA 4A99A 1GETA 4NEWA 3ZYXA 1KF6A 3IK4A 4KWSA 2XLRA 4FK1A 1E7PA 1N4UA 3TWAA 1KCZA 1NENA 4WCTA 4RSLA 3ZVHB 5IQ1A 2BXRA 3NXLA 5KOWA 3P3BA 1OJAA 1OJ9A 1FOHA 2P88A 3UTHA 4HCHA 1GXFA 4IL0A 1CC4A 4PABA 4WX1A 2O9ZA 2IVEA 3LZXA 2GB0A 2Q0KA 3VRAA 5HY5A 2YM2A 4OPCA 3FBSA 5EB4A 4B67A 3CNTA 2YWLA 1PBFA 1MDRA 4OPTA 1ZOVA 3II4A 2R4EA 1EC9A 1AOGA 1BGJA 4GAPA 4DNAA 3AE1A 3BJSA 2GQFA 3NH3X 4Z25A 2XVJA 4K8GA 2BCPA 2O56A 4G8TA 3CGCA 1EBDA 1N62C 1NG4A 3AB1A 3GWFA 3ENLA 2YG4A 4EMIA 4HYRA 2B9XA 1F8WA 1Z6LA 3NRNA 3B97A 4H19A 4H83A 4APNA 2WESA 1TYTA 1MNSA 1PBEA 1Y56B 2IVDA 3NN0X 4REKA 2R9ZA 2OO6A 3HYXA 4H1ZA 3NYFA 3DDMA 3MQTA 3R10A 1PBBA 4B68A 1IUTA 2PYXA 2OLAA 4DX3A 3TW9A 3OZ2A 5BULA 3SJNA 3QSMA 3TJIA 1KKRA 4NWZA 4NTCA 1H83A 1NHPA 2OAMA 3CNJA 2OKTA 3HPFA 2OLOA 2QJMA 3DK8A 3EF6A 4BJZA 1N5WC 2EQ7A 1TDNA 5U1OA 4TM0A 4H2RA 5G5GB 3NZGA 5BOEA 2X8HA 5EOWA 2VQ7A 4H4UA 1L0VA 4MMWA 3AD7B 5JCLA 1EL5A 4LU6A 4U8JA 5ENLA 4IP5A 1TRBA 4YSHA 3CPHG 3P9UA 2BK4A 3NG7X 3AEDA 3UTEA 3ATRA 4TVWA 2YVFA 3MZNA 2BC0A 3D8XA 2Q6UA 3D1CA 2C73A 2WDRA 2GH5A 3VDGA 3UKKA 4ZN0A 3TCSA 2QJJA 4TLZA 3VA8A 3UKLA 4XXGA 3P1WA 3VFCA 2GF3A 1GPEA 2Y6RA 1JROA 4K2SA 2PU1A 3DJDA 3GYJA 4U8IA 4USRA 3UTGA 1PDHA 2YG3A 3FG2P 3K30A 3DGHA 1GRGA 3JW7A 1WYGA 1XHCA 2PTZA 3QN3A 1JPMA 2WEUA 2W55A 2WU5A 1FO4A 2WOVA 4J57A 1RM6B 3V5CA 3S47A 4BK2A
chains in the Genus database with same CATH topology
1NG3A 4NNJA 4RG4A 3LXDA 1PJ6A 3FIMB 3L8KA 3GMBA 5JCMA 4UDRA 3F8RA 4UDPA 3H8IA 1E6EA 4Z2TA 2B76A 4EIPA 3OC4A 2YVGA 4K2XA 2WETA 4OCGA 4YTMA 4A65A 4Z2UA 1TDFA 1O94A 2YR6A 3QSSA 2C67A 4XWRA 3UOXA 4B69A 4IA5A 2JBVA 4TM4A 4CCRA 3T31A 1GERA 1S2YA 1GRHA 2V60A 1Q1RA 5M10A 5FS8A 3H4KA 1GNDA 4IVOB 3NHOX 3RP7A 3AEGA 2GVCA 4J33A 3SXIA 1BKWA 1NHRA 2YLZA 3IHGA 3Q9TA 2XFQA 1KNRA 2YG6A 1K0LA 1GRTA 4IV9A 1B5QA 1JNZA 1PBCA 3GDPA 3L1RA 3DGZA 2WU2A 3NGCX 2WPCA 2NVKX 1OJCA 4D04A 2VRMA 3VRDB 4BK3A 2Y6QA 1S7MA 1S2QA 2BYBA 2XFOA 2BA9A 2XLUA 3DH9A 5CKUA 4Z43A 2CDUA 1GTHA 3C4AA 5BRTA 3SQPA 4H2QA 4U8NA 1PS9A 1E39A 4GR1A 1GEUA 4U8LA 1GOSA 2JB3A 3ITJA 2BS2A 3CPIG 4DSHA 2YG5A 2TMDA 3NYEA 4FK1C 2YG7A 1LTXR 5KMSA 5JCIA 4A6NB 1TDEA 1BZLA 1CBOA 1COYA 1RP0A 1GREA 1GRFA 3GMCA 2YM1A 3QVPA 3K7TA 5BVAA 4YSYA 1Y56A 3AEBA 4OVIA 4UDQA 1K0JA 3SYIA 2C3DA 2JAEA 4JDRA 4U2LA 2YLXA 3NYCA 4K5SA 3VQRA 2H88A 2WOIA 2C65A 3RP8A 3T0KA 4C3XA 1H6VA 1EL8A 3KVEA 1DJQA 2RGJA 4FDCB 3V76A 1S3EA 3HZLA 2BXSA 4TLXA 2GAGB 3O0HA 2ZBWA 3AYLA 2F5ZA 2R0CA 1REOA 4YTNA 1V59A 5JRBA 1CJ2A 3JSKA 3NK2X 4H7UA 2BC1A 1FCDA 5M0ZA 4B64A 2A8XA 1UKVG 2FJBA 3VR9A 4AOXA 4Z2RA 5BUKA 2FBWA 3AEAA 4G73A 4CNJA 4B1BA 4BV6A 3GDNA 3GYIA 5KWFA 3ALMA 4Z26A 1L9EA 5KNLA 1PN0A 4H2NA 3LJPA 2WPEA 2UZZA 4TM3A 3UKFA 3SX6A 3SFEA 3BI4A 3WE0A 4C74A 4A7AA 3DMEA 4C5OA 3DK9A 1CC6A 3EAOA 1GESA 1LPFA 2E5VA 1XDIA 1ZY8A 3CGEA 2OA1A 2EQ8A 2C66A 4H50A 5KMPA 2APGA 2XVEA 4A9WA 1VDCA 2R45A 4U2SA 4PAAA 4K5RA 3UP4A 1XANA 2X8GA 2BS3A 4BJYA 1GV4A 1KNPA 5KMRA 1QO8A 3QFAA 2B7RA 3ICRA 2Z5XA 5KMQA 3FPZA 1D4DA 1IUVA 3KPFA 2WDQA 3NK0X 4KX6A 4U8KA 1N1PA 3QVRA 1H82A 4CY6A 4YTPA 1YQZA 3P4QA 3SZ0A 1LVLA 3LOVA 1VRQB 2YR5A 1FEAA 2ACZA 4GRTA 1QJDA 3B3RA 3CNDA 3KU9A 2HQMA 3S61A 1CJCA 2C75A 1RYIA 4G6HA 4JNAA 1PBDA 3C4NA 1E1LA 5ER0A 3VR8A 1CC2A 1M6IA 4J31A 2NPXA 2JB2A 2J3NA 1F6MA 3E1TA 2R4JA 4A99A 4Y4NA 1ELIA 1ONFA 1GETA 4NEWA 1ZOYA 3NNEA 1VG9A 1L9DA 1N4WA 1PJ7A 1E1NA 1D7YA 3ZYXA 1KF6A 1TYPA 3KLJA 4FX9A 1JNRA 3KPKA 4HB9A 3HYVA 2XLRA 1NAAA 2YLSA 4FK1A 4BK1A 1E7PA 2BRAA 1N4UA 2XFUA 3AE2A 4H2PA 1CJ4A 3LADA 3KKJA 2YLWA 3T37A 1NENA 4U8OA 1CF3A 2XLSA 2XLTA 3DJEA 2WP9A 4WCTA 4RSLA 3QSEA 3ICTA 2Q7VA 3AE8A 2GQWA 4DSGA 3CGDA 1E1MA 1SEZA 5IQ1A 4NEVA 4D03A 3DK4A 2BXRA 3GD4A 3IC9A 5KOWA 1K4QA 2GR0A 4GCMA 1VQWA 3CN8A 4YSXA 3FMWA 3K7MX 4JQ9A 3NK1X 4AOSA 1OJAA 3UKPA 5L46A 2WHDA 1OJ9A 1FOHA 1YQ4A 2V61A 3T2KA 3AWIA 3UTHA 3GRSA 1GXFA 1CC4A 4PABA 4WX1A 2XFNA 2C64A 2O9ZA 2XDOA 5KVIA 4CCQA 1JOAA 2IVEA 2BACA 3LZXA 3DJGX 3SZFA 1RSGA 4H4ZA 2GB0A 2Q0KA 1FECA 4A79A 1H2IA 3UCLA 2WDVA 3VRAA 4YWOA 1X31B 1ZMDA 5HY5A 2YM2A 3HYWA 3FBSA 4OPCA 5EB4A 2GR2A 4B67A 3CNTA 1LJ1A 2YWLA 3P4PA 4GAVA 1Y0PA 2V6OA 1PBFA 5JCKA 4Y4MA 2Z5YA 3T2YA 5JCNA 1PXCA 1E1KA 2XFPA 3IWAA 4GUVA 4OPTA 4ICYA 4I58A 1JRZA 2WBAA 3AE3A 4Y4LA 2VZ2A 3F8DA 1ZOVA 5U63A 5TR3A 2JK6A 3II4A 4A5LA 2R4EA 1ZK7A 4P9SA 4OPDA 2V3BA 1AOGA 2IIDA 1BGJA 3D9XA 4GAPA 5EBKA 4DNAA 1DJNA 2R0PA 1DOCA 4EQSA 2BCGG 3AE1A 3G5SA 2C3CA 4J56A 3GYXA 2GMJA 3NLCA 2RABA 4ZCCA 1KSSA 2VRLA 4B63A 1O5WA 2BK5A 3M12A 1DOBA 2GQFA 3NH3X 4Z25A 1BWCA 4H4PA 2XVJA 4XWZA 3GSIA 3UKQA 5IQ4A 2BCPA 3BHKA 3PO7A 4EM4A 3EPTA 1Q1WA 5FS9A 1IUWA 4J2WA 3CGCA 1NDAA 1EBDA 1ZDLA 1KSUA 4EQWA 1NG4A 1P2HA 2XLPA 3AB1A 3ATQA 2X8CA 3GWFA 5HHFA 3RHAA 1H86A 3AYIA 1NEKA 2YG4A 4U8PA 4EMIA 4CBQA 3RNMA 1KDGA 2GMHA 3I6DA 3AEEA 2XYOA 3BNMA 4RG3A 4H4YA 4ADWA 1NHQA 5J60A 2B9XA 5LV9A 1L9CA 4EMJA 1Q9IA 4BURA 3URHA 1ZP0A 3SZWA 4H4SA 3ICSA 3REDA 5EB5A 1F8WA 1K0IA 1YKJA 1Z6LA 3NRNA 3CNPA 2XVHA 2JKCA 1JRXA 4APNA 3AD9B 4U8MA 4JNQA 4HA6A 3S5WA 5C2TA 2CFYA 2WESA 2VQBA 1PHHA 3V3OA 4AP3A 2CVJA 1TYTA 1DODA 4B66A 4KPRA 1NHSA 3AE9A 4O5QA 1PBEA 1Y56B 2IVDA 2BS4A 2GV8A 4YKGA 3QJ4A 2EQ9A 3COXA 3NN0X 3NT6A 5KOXA 4OPIA 1QLBA 1D7LA 3AE4A 3GWDA 4AT2A 5CQFA 4EMWA 4EM3A 5C3JA 3ADAB 2OLNA 2FJDA 3KA7A 4REKA 4H4VA 5FMHA 1DNCA 3ABVA 2YR4A 2R9ZA 4H4TA 2ZZBA 5KXJA 3NTDA 1B8SA 3SY4A 2WOWA 4LIIA 1FL2A 4X9NA 4GDPA 3HYXA 2BK3A 2C72A 1NPXA 4K7ZA 3NYFA 4II3A 1PXBA 1ZKQA 1H7XA 4N9XA 3C96A 1S3BA 1LQTA 2OALA 2ZZ0A 1PBBA 4B68A 2AQJA 3GRTA 1GRBA 4M52A 2QAEA 1IUTA 1LQUA 2XVFA 3UTFA 1FEBA 3CTYA 4G9KA 2PYXA 2C76A 2YLTA 3KD9A 1HYUA 3OZ2A 3AXBA 1TDOA 5BULA 1OJDA 3R9UA 2E1MA 4J36A 5U25A 3NIXA 1D5TA 4LA1A 3AD8B 4AP1A 3QSMA 4OPLA 2VVLA 4NZHA 4NWZA 1BGNA 4A6NA 4I59A 2PHHA 4NTCA 5HYMA 4K8DA 1GTEA 1H83A 1M64A 1P2EA 1NHPA 1MXTA 1YY5A 2YQUA 2OAMA 3CNJA 4UP3A 2I0ZA 2V5ZA 2OLOA 3DK8A 3EF6A 1W4XA 4EQRA 4BJZA 2EQ7A 1TDNA 2GR3A 3G5QA 4ECHA 3IHMA 5U1OA 1JRYA 1EL9A 4TM0A 4H2RA 4OPGA 3LB8A 3K7QX 4EIQA 2WQYA 4G74A 2X8HA 2Q0LA 1CHUA 3F8PA 4USQA 1VG0A 5EOWA 2QCUA 2VQ7A 3I3LA 3AECA 4CRTA 2QA2A 4H4UA 3AE5A 1L0VA 4GDEA 1TDKA 2YAUA 5JCLA 3AD7B 1EL5A 4LU6A 4YSZA 4JN9A 4U8JA 2GR1A 3H8LA 2ARDA 1TRBA 4YSHA 3P4SA 3CPHG 3UOZA 3UKAA 2YLRA 3P9UA 5KRQA 2WP5A 1B4VA 1ZX9A 1PJ5A 2BK4A 3AEDA 3NG7X 4K22A 4NTEA 4Z44A 3UP5A 1DXLA 3UTEA 3BI5A 3DJJA 3ATRA 2XVIA 2DKHA 4X9MA 4U2TA 3NTAA 2WP6A 2C7GA 1JEHA 4H4XA 2B7SA 4IVMB 4OPUA 5IPYA 2EQ6A 1LV0A 2RGHA 2YVFA 4IA6A 2H89A 2AR8A 3VRBA 2QA1A 1KN0A 4MJWA 1GRAA 3Q6JA 2BC0A 3BHFA 3CGBA 3P4RA 3D8XA 1H7WA 1DOEA 2Q6UA 2C4CA 1O95A 2YVJA 1D4EA 3D1CA 2FJAA 1OJTA 3GD3A 4YXDA 2C70A 2C73A 4Z24A 2BRYA 4J34A 5FS7A 2R0GA 3UOVA 4YKFA 2WDRA 4TM1A 2GH5A 3G5RA 1IUSA 3V3NA 3SFDA 1F3PA 3UOYA 1KFYA 3UKKA 2W0HA 4ZCDA 3ISHA 4ZN0A 1BF3A 1H84A 2TPRA 2X99A 2X3NA 2XCGA 4TLZA 5GRTA 2BABA 1GT8A 3UKLA 2JB1A 4XXGA 4CY8A 3T2ZA 1CL0A 2X50A 3P1WA 3SZCA 2GF3A 1IJHA 1ZMCA 1PXAA 1EL7A 1GPEA 3AEFA 2B9YA 2DKIA 2Y6RA 3AYJA 3QFBA 2ZZCA 3CMMA 2GEWA 2CULA 2AAQA 1IUXA 3DJDA 3GYJA 3M13A 3LZWA 3PVCA 3SGLA 4U8IA 4USRA 3UKHA 2GRTA 3UTGA 1PDHA 2WPFA 1CJ3A 5FS6A 2YG3A 3FG2P 3K30A 3DA1A 4G6GA 3DGHA 4II2A 1F8SA 4JY3A 3IF9A 1JU2A 3EANA 4JY2A 4EQXA 5DBJA 1GRGA 1XHCA 5KVHA 1MO9A 1B37A 4O5UA 3T14A 2V3AA 3PG6A 5GSNA 2R46A 3ALJA 2VVMA 2FJEA 2WEUA 2WU5A 4H4QA 4NTDA 1YQ3A 3NN6X 4C77A 1GSNA 4CNKA 3L5OA 1IUUA 3B6DA 1N4VA 4H4WA 3RP6A 2B9WA 3SM8A 2WOVA 4B65A 2GAHB 4J57A 3CPJG 2RGOA 3PS9A 2WS3A 1GALA 4DGKA 4H4RA 3M0OA 3BI2A 4E0VA 2E4GA 3AE6A 3ZDNA 1XPQA 3NKSA 1MOKA 3ALLA 3BNUA 4X4JA 2A89A 4YT0A 2A87A 5HXIA 5J7XA 1H81A 2VVLG 1F8RA 4AT0A 4C3YA 3CIRA 4BK2A 3CNSA 4GF7A 2VOUA 3AE7A 1D4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NG3 A;  4RG4 A;  3LXD A;  1PJ6 A;  3FIM B;  3L8K A;  3GMB A;  5JCM A;  4UDR A;  3F8R A;  4UDP A;  3H8I A;  1E6E A;  4Z2T A;  2B76 A;  4EIP A;  3OC4 A;  2YVG A;  4K2X A;  2WET A;  4OCG A;  4YTM A;  4A65 A;  4Z2U A;  1TDF A;  1O94 A;  2YR6 A;  3QSS A;  2C67 A;  4XWR A;  3UOX A;  4B69 A;  4IA5 A;  2JBV A;  4TM4 A;  4CCR A;  1GER A;  1S2Y A;  1GRH A;  2V60 A;  1Q1R A;  5M10 A;  5FS8 A;  3H4K A;  1GND A;  4IVO B;  3NHO X;  3RP7 A;  3AEG A;  2GVC A;  4J33 A;  1BKW A;  1NHR A;  2YLZ A;  3IHG A;  3Q9T A;  2XFQ A;  1KNR A;  2YG6 A;  1K0L A;  1GRT A;  4IV9 A;  1B5Q A;  1JNZ A;  1PBC A;  3GDP A;  3L1R A;  3DGZ A;  2WU2 A;  3NGC X;  2WPC A;  2NVK X;  1OJC A;  4D04 A;  2VRM A;  3VRD B;  4BK3 A;  2Y6Q A;  2BYB A;  1S2Q A;  2XFO A;  2BA9 A;  2XLU A;  3DH9 A;  5CKU A;  4Z43 A;  2CDU A;  1GTH A;  3C4A A;  5BRT A;  3SQP A;  4H2Q A;  4U8N A;  1PS9 A;  1E39 A;  4GR1 A;  1GEU A;  4U8L A;  1GOS A;  2JB3 A;  3ITJ A;  2BS2 A;  3CPI G;  4DSH A;  2YG5 A;  2TMD A;  3NYE A;  4FK1 C;  2YG7 A;  1LTX R;  5JCI A;  4A6N B;  1TDE A;  1BZL A;  1CBO A;  1COY A;  1RP0 A;  1GRE A;  1GRF A;  3GMC A;  2YM1 A;  3QVP A;  3K7T A;  5BVA A;  4YSY A;  1Y56 A;  3AEB A;  4OVI A;  4UDQ A;  1K0J A;  2C3D A;  2JAE A;  4JDR A;  4U2L A;  2YLX A;  3NYC A;  4K5S A;  3VQR A;  2H88 A;  2WOI A;  2C65 A;  3RP8 A;  4C3X A;  1H6V A;  1EL8 A;  3KVE A;  1DJQ A;  2RGJ A;  4FDC B;  3V76 A;  1S3E A;  3HZL A;  2BXS A;  4TLX A;  2GAG B;  3O0H A;  2ZBW A;  3AYL A;  2F5Z A;  2R0C A;  1REO A;  4YTN A;  1V59 A;  1CJ2 A;  3JSK A;  3NK2 X;  4H7U A;  2BC1 A;  1FCD A;  5M0Z A;  4B64 A;  2A8X A;  1UKV G;  2FJB A;  3VR9 A;  4AOX A;  4Z2R A;  5BUK A;  2FBW A;  3AEA A;  4CNJ A;  4B1B A;  4BV6 A;  3GDN A;  3GYI A;  5KWF A;  3ALM A;  4Z26 A;  1L9E A;  1PN0 A;  4H2N A;  3LJP A;  2WPE A;  2UZZ A;  4TM3 A;  3UKF A;  3SFE A;  3BI4 A;  3WE0 A;  4C74 A;  4A7A A;  3DME A;  4C5O A;  3DK9 A;  1CC6 A;  3EAO A;  1GES A;  1LPF A;  2E5V A;  1XDI A;  1ZY8 A;  3CGE A;  2OA1 A;  2EQ8 A;  2C66 A;  4H50 A;  2APG A;  2XVE A;  4A9W A;  1VDC A;  2R45 A;  4U2S A;  4PAA A;  4K5R A;  3UP4 A;  1XAN A;  2X8G A;  2BS3 A;  4BJY A;  1GV4 A;  1KNP A;  1QO8 A;  3QFA A;  2B7R A;  3ICR A;  2Z5X A;  3FPZ A;  1D4D A;  1IUV A;  3KPF A;  2WDQ A;  3NK0 X;  4KX6 A;  4U8K A;  1N1P A;  3QVR A;  1H82 A;  4CY6 A;  4YTP A;  1YQZ A;  3P4Q A;  1LVL A;  3LOV A;  1VRQ B;  2YR5 A;  1FEA A;  2ACZ A;  4GRT A;  1QJD A;  3B3R A;  3CND A;  3KU9 A;  2HQM A;  3S61 A;  1CJC A;  2C75 A;  1RYI A;  4JNA A;  1PBD A;  3C4N A;  1E1L A;  5ER0 A;  3VR8 A;  1CC2 A;  1M6I A;  4J31 A;  2NPX A;  2JB2 A;  2J3N A;  1F6M A;  3E1T A;  2R4J A;  4A99 A;  4Y4N A;  1ELI A;  1ONF A;  1GET A;  4NEW A;  1ZOY A;  3NNE A;  1VG9 A;  1L9D A;  1N4W A;  1PJ7 A;  1E1N A;  1D7Y A;  3ZYX A;  1KF6 A;  1TYP A;  3KLJ A;  4FX9 A;  1JNR A;  4HB9 A;  2XLR A;  1NAA A;  2YLS A;  4FK1 A;  4BK1 A;  1E7P A;  1N4U A;  2XFU A;  3AE2 A;  4H2P A;  1CJ4 A;  3LAD A;  3KKJ A;  2YLW A;  3T37 A;  1NEN A;  4U8O A;  1CF3 A;  2XLS A;  2XLT A;  3DJE A;  2WP9 A;  4WCT A;  4RSL A;  3QSE A;  3ICT A;  2Q7V A;  3AE8 A;  2GQW A;  4DSG A;  3CGD A;  1E1M A;  1SEZ A;  5IQ1 A;  4NEV A;  4D03 A;  3DK4 A;  2BXR A;  3GD4 A;  3IC9 A;  5KOW A;  1K4Q A;  2GR0 A;  4GCM A;  1VQW A;  3CN8 A;  4YSX A;  3FMW A;  3K7M X;  4JQ9 A;  3NK1 X;  4AOS A;  1OJA A;  3UKP A;  5L46 A;  2WHD A;  1OJ9 A;  1FOH A;  1YQ4 A;  2V61 A;  3AWI A;  3UTH A;  3GRS A;  1GXF A;  1CC4 A;  4PAB A;  4WX1 A;  2XFN A;  2C64 A;  2O9Z A;  2XDO A;  5KVI A;  4CCQ A;  1JOA A;  2IVE A;  2BAC A;  3LZX A;  3DJG X;  1RSG A;  4H4Z A;  2GB0 A;  2Q0K A;  1FEC A;  4A79 A;  3UCL A;  2WDV A;  3VRA A;  4YWO A;  1X31 B;  1ZMD A;  5HY5 A;  2YM2 A;  4OPC A;  3FBS A;  5EB4 A;  2GR2 A;  4B67 A;  3CNT A;  1LJ1 A;  2YWL A;  3P4P A;  4Y4M A;  1Y0P A;  2V6O A;  1PBF A;  5JCK A;  2Z5Y A;  5JCN A;  1PXC A;  1E1K A;  2XFP A;  3IWA A;  4GUV A;  4OPT A;  4ICY A;  4I58 A;  1JRZ A;  2WBA A;  3AE3 A;  4Y4L A;  2VZ2 A;  3F8D A;  1ZOV A;  5U63 A;  5TR3 A;  2JK6 A;  3II4 A;  4A5L A;  2R4E A;  1ZK7 A;  4P9S A;  4OPD A;  2V3B A;  1AOG A;  2IID A;  1BGJ A;  5EBK A;  4DNA A;  1DJN A;  2R0P A;  1DOC A;  4EQS A;  2BCG G;  3AE1 A;  3G5S A;  2C3C A;  4J56 A;  3NLC A;  2GMJ A;  4ZCC A;  2RAB A;  1KSS A;  2VRL A;  4B63 A;  1O5W A;  2BK5 A;  3M12 A;  1DOB A;  2GQF A;  3NH3 X;  4Z25 A;  1BWC A;  4H4P A;  2XVJ A;  4XWZ A;  3GSI A;  3UKQ A;  5IQ4 A;  2BCP A;  3BHK A;  3PO7 A;  4EM4 A;  3EPT A;  1Q1W A;  5FS9 A;  1IUW A;  4J2W A;  3CGC A;  1NDA A;  1EBD A;  1ZDL A;  1KSU A;  4EQW A;  1NG4 A;  1P2H A;  2XLP A;  3AB1 A;  3ATQ A;  2X8C A;  3GWF A;  5HHF A;  3RHA A;  1H86 A;  3AYI A;  1NEK A;  2YG4 A;  4U8P A;  4EMI A;  4CBQ A;  3RNM A;  1KDG A;  2GMH A;  3I6D A;  3AEE A;  2XYO A;  3BNM A;  4RG3 A;  4H4Y A;  4ADW A;  1NHQ A;  5J60 A;  2B9X A;  5LV9 A;  1L9C A;  4EMJ A;  1Q9I A;  4BUR A;  3URH A;  1ZP0 A;  4H4S A;  3ICS A;  3RED A;  5EB5 A;  1F8W A;  1K0I A;  1YKJ A;  1Z6L A;  3NRN A;  3CNP A;  2XVH A;  2JKC A;  1JRX A;  4APN A;  3AD9 B;  4U8M A;  4JNQ A;  4HA6 A;  3S5W A;  5C2T A;  2CFY A;  2WES A;  2VQB A;  1PHH A;  3V3O A;  4AP3 A;  2CVJ A;  1TYT A;  1DOD A;  4B66 A;  4KPR A;  1NHS A;  3AE9 A;  4O5Q A;  1PBE A;  1Y56 B;  2IVD A;  2BS4 A;  2GV8 A;  4YKG A;  3QJ4 A;  2EQ9 A;  3COX A;  3NN0 X;  3NT6 A;  5KOX A;  4OPI A;  1QLB A;  1D7L A;  3AE4 A;  3GWD A;  4AT2 A;  5CQF A;  4EMW A;  4EM3 A;  5C3J A;  3ADA B;  2OLN A;  2FJD A;  3KA7 A;  4REK A;  4H4V A;  5FMH A;  1DNC A;  3ABV A;  2YR4 A;  2R9Z A;  4H4T A;  2ZZB A;  5KXJ A;  3NTD A;  1B8S A;  2WOW A;  4LII A;  1FL2 A;  4X9N A;  4GDP A;  2BK3 A;  2C72 A;  1NPX A;  4K7Z A;  3NYF A;  1PXB A;  1ZKQ A;  1H7X A;  4N9X A;  3C96 A;  1S3B A;  1LQT A;  2OAL A;  2ZZ0 A;  1PBB A;  4B68 A;  2AQJ A;  3GRT A;  1GRB A;  4M52 A;  2QAE A;  1IUT A;  1LQU A;  2XVF A;  3UTF A;  1FEB A;  3CTY A;  2PYX A;  2C76 A;  2YLT A;  3KD9 A;  1HYU A;  3OZ2 A;  3AXB A;  1TDO A;  5BUL A;  1OJD A;  3R9U A;  2E1M A;  4J36 A;  5U25 A;  3NIX A;  1D5T A;  4LA1 A;  3AD8 B;  4AP1 A;  3QSM A;  4OPL A;  2VVL A;  4NZH A;  4A6N A;  1BGN A;  4I59 A;  2PHH A;  4NTC A;  5HYM A;  4K8D A;  1GTE A;  1H83 A;  1M64 A;  1P2E A;  1NHP A;  1MXT A;  1YY5 A;  2YQU A;  2OAM A;  3CNJ A;  4UP3 A;  2I0Z A;  2V5Z A;  2OLO A;  3DK8 A;  3EF6 A;  1W4X A;  4EQR A;  4BJZ A;  2EQ7 A;  1TDN A;  2GR3 A;  3G5Q A;  4ECH A;  3IHM A;  5U1O A;  1JRY A;  1EL9 A;  4TM0 A;  4H2R A;  4OPG A;  3LB8 A;  3K7Q X;  4EIQ A;  2WQY A;  2X8H A;  2Q0L A;  1CHU A;  3F8P A;  4USQ A;  1VG0 A;  5EOW A;  2QCU A;  2VQ7 A;  3I3L A;  3AEC A;  4CRT A;  2QA2 A;  4H4U A;  3AE5 A;  1L0V A;  4GDE A;  1TDK A;  2YAU A;  5JCL A;  3AD7 B;  1EL5 A;  4LU6 A;  4YSZ A;  4JN9 A;  4U8J A;  2GR1 A;  3H8L A;  2ARD A;  1TRB A;  4YSH A;  3P4S A;  3CPH G;  3UOZ A;  3UKA A;  2YLR A;  3P9U A;  5KRQ A;  2WP5 A;  1B4V A;  1ZX9 A;  1PJ5 A;  2BK4 A;  3AED A;  3NG7 X;  4K22 A;  4NTE A;  4Z44 A;  3UP5 A;  1DXL A;  3UTE A;  3BI5 A;  3DJJ A;  3ATR A;  2XVI A;  2DKH A;  4X9M A;  4U2T A;  3NTA A;  2WP6 A;  2C7G A;  1JEH A;  4H4X A;  2B7S A;  4IVM B;  4OPU A;  5IPY A;  2EQ6 A;  1LV0 A;  2RGH A;  2YVF A;  4IA6 A;  2H89 A;  2AR8 A;  3VRB A;  2QA1 A;  4MJW A;  1GRA A;  3Q6J A;  2BC0 A;  3BHF A;  3CGB A;  3P4R A;  3D8X A;  1H7W A;  1DOE A;  2Q6U A;  1O95 A;  2YVJ A;  1D4E A;  3D1C A;  2FJA A;  1OJT A;  3GD3 A;  4YXD A;  2C70 A;  2C73 A;  4Z24 A;  4J34 A;  5FS7 A;  2R0G A;  3UOV A;  4YKF A;  2WDR A;  4TM1 A;  2GH5 A;  3G5R A;  1IUS A;  3V3N A;  3SFD A;  1F3P A;  3UOY A;  1KFY A;  3UKK A;  2W0H A;  4ZCD A;  3ISH A;  4ZN0 A;  1BF3 A;  1H84 A;  2TPR A;  2X99 A;  2X3N A;  2XCG A;  4TLZ A;  5GRT A;  2BAB A;  1GT8 A;  3UKL A;  2JB1 A;  4XXG A;  4CY8 A;  1CL0 A;  2X50 A;  3P1W A;  2GF3 A;  1IJH A;  1ZMC A;  1PXA A;  1EL7 A;  1GPE A;  3AEF A;  2B9Y A;  2DKI A;  2Y6R A;  3AYJ A;  3QFB A;  2ZZC A;  2GEW A;  2CUL A;  2AAQ A;  1IUX A;  3DJD A;  3GYJ A;  3M13 A;  3LZW A;  3PVC A;  3SGL A;  4U8I A;  4USR A;  3UKH A;  2GRT A;  3UTG A;  1PDH A;  2WPF A;  1CJ3 A;  5FS6 A;  2YG3 A;  3FG2 P;  3K30 A;  3DA1 A;  3DGH A;  1F8S A;  4JY3 A;  3IF9 A;  1JU2 A;  3EAN A;  4JY2 A;  4EQX A;  5DBJ A;  1GRG A;  1XHC A;  5KVH A;  1MO9 A;  1B37 A;  4O5U A;  2V3A A;  5GSN A;  2R46 A;  3ALJ A;  2VVM A;  2FJE A;  2WEU A;  2WU5 A;  4H4Q A;  4NTD A;  1YQ3 A;  3NN6 X;  4C77 A;  1GSN A;  4CNK A;  1IUU A;  3B6D A;  1N4V A;  4H4W A;  3RP6 A;  2B9W A;  3SM8 A;  2WOV A;  4B65 A;  2GAH B;  4J57 A;  3CPJ G;  2RGO A;  3PS9 A;  2WS3 A;  1GAL A;  4DGK A;  4H4R A;  3M0O A;  3BI2 A;  4E0V A;  2E4G A;  3AE6 A;  3ZDN A;  1XPQ A;  3NKS A;  1MOK A;  3ALL A;  3BNU A;  4X4J A;  2A89 A;  4YT0 A;  2A87 A;  5HXI A;  5J7X A;  1H81 A;  2VVL G;  1F8R A;  4AT0 A;  4C3Y A;  3CIR A;  4BK2 A;  3CNS A;  4GF7 A;  2VOU A;  3AE7 A;  1D4C A; 
#chains in the Genus database with same CATH topology
 1VQZ A;  3FIM B;  3F8R A;  3NFU A;  1E6E A;  4Z2T A;  4MKS A;  4Z2U A;  2C67 A;  3IJL A;  4IVO B;  2GVC A;  1NHR A;  2XFQ A;  1P43 A;  3R1Z A;  1B5Q A;  3GDP A;  1OJC A;  1FFV C;  5FJR A;  3DES A;  4Z43 A;  1GTH A;  1E39 A;  4GR1 A;  4U8L A;  1SJA A;  3ZLG A;  2BS2 A;  4DSH A;  2YG5 A;  3NYE A;  3DIP A;  2YG7 A;  3IJQ A;  5JCI A;  1BZL A;  1CBO A;  3GC2 A;  1RP0 A;  1GRE A;  1GRF A;  3GMC A;  3AEB A;  1L8P A;  2YLX A;  4K5S A;  2H88 A;  2WOI A;  3RP8 A;  4C3X A;  1DJQ A;  3V76 A;  4TLX A;  1KD0 A;  2F5Z A;  1REO A;  1V59 A;  2QVH A;  3MWC A;  5JRB A;  2BC1 A;  1FCD A;  5M0Z A;  1UKV G;  4AOX A;  4Z2R A;  4GGB A;  1FHU A;  5KNL A;  4TM3 A;  3UKF A;  3SX6 A;  4C74 A;  3WE0 A;  3EAO A;  1GES A;  2E5V A;  3DGB A;  3TOY A;  4A9W A;  1VDC A;  4J3Z A;  2PCE A;  5KMQ A;  3FPZ A;  1D4D A;  4FI4 A;  4YTP A;  3QVR A;  1YQZ A;  3P4Q A;  3LOV A;  1VRQ B;  2XH2 A;  1E9I A;  3CND A;  3KU9 A;  2HQM A;  4G6H A;  3C4N A;  4KEM A;  2NPX A;  2JB2 A;  1F6M A;  1SJC A;  2R4J A;  2NQL A;  4E5T A;  2XH0 A;  1ZOY A;  3N6J A;  1VG9 A;  1E1N A;  1TYP A;  3Q4D A;  4FX9 A;  3KPK A;  2BRA A;  3R25 A;  2XFU A;  2YLW A;  4U8O A;  2XLS A;  2DW7 A;  4DSG A;  1SEZ A;  4NEV A;  1K4Q A;  1TZZ A;  2GR0 A;  4GCM A;  3CN8 A;  3FMW A;  3HRD C;  3VCC A;  2WHD A;  3T2K A;  3AWI A;  3JVA A;  2XFN A;  4CCQ A;  1JOA A;  3ZVI A;  2BAC A;  3SQS A;  3DJG X;  4H4Z A;  4A79 A;  1H2I A;  2WDV A;  1ZMD A;  2GR2 A;  1SB3 B;  4Y4M A;  2PU0 A;  5JCN A;  1E1K A;  1PXC A;  2XFP A;  3KUM A;  2JK6 A;  4P9S A;  4OPD A;  3D9X A;  3MY9 A;  5EBK A;  3G5S A;  3GYX A;  2C3C A;  2GMJ A;  2BK5 A;  1DOB A;  3DFY A;  1BWC A;  3BHK A;  3EPT A;  1N5X A;  5FS9 A;  1NDA A;  1KSU A;  3ATQ A;  5HHF A;  2X8C A;  3RHA A;  1MRA A;  2OQH A;  3RRA A;  3AEE A;  4RG3 A;  4H4Y A;  5J60 A;  5LV9 A;  3V4B A;  3URH A;  5EB5 A;  4U8M A;  2VQB A;  3V3O A;  1NHS A;  3AE9 A;  3EEZ A;  3GWD A;  1QLB A;  4AT2 A;  2AL2 A;  5CQF A;  3FVD A;  3KA7 A;  4H4V A;  5FMH A;  2YR4 A;  4H4T A;  3GO2 A;  3U9I A;  3SY4 A;  2WOW A;  3D46 A;  4X9N A;  2POZ A;  4GDP A;  4II3 A;  1SJD A;  1PXB A;  2E3T A;  4N9X A;  2AQJ A;  1FEB A;  2C76 A;  2YLT A;  1HYU A;  3R9U A;  4LA1 A;  4MGG A;  2VVL A;  4HPN A;  4NZH A;  4I59 A;  3CB3 A;  4TVY A;  2I0Z A;  4ECH A;  4GME A;  5FJT A;  3NVY B;  3K7Q X;  2WQY A;  1CHU A;  1FFU C;  3AEC A;  3DG6 A;  3AE5 A;  4GDE A;  4DHG A;  5G5H B;  5KRQ A;  1DXL A;  3DJJ A;  3DFH A;  2WP6 A;  1X2G A;  2C7G A;  4IVM B;  4OPU A;  5IPY A;  2EQ6 A;  2W54 A;  2QA1 A;  4MJW A;  1N60 C;  3CGB A;  1H7W A;  1DOE A;  2FJA A;  3UOV A;  4YKF A;  4TM1 A;  3G5R A;  2PTW A;  1IUS A;  3V3N A;  4ZCD A;  3AN1 A;  1H84 A;  2X99 A;  2XCG A;  1EC7 A;  2PS2 A;  2ZAD A;  1CL0 A;  3V3W A;  3SZC A;  1IJH A;  1ZMC A;  2B9Y A;  2DKI A;  3OP2 A;  3QFB A;  2CUL A;  3M13 A;  3SGL A;  2GRT A;  2XH4 A;  2PP3 A;  3SN0 A;  4G6G A;  3SR6 B;  1JU2 A;  5DBJ A;  4O5U A;  2V3A A;  3ALJ A;  2VVM A;  4H4Q A;  4EWJ A;  3H8A A;  4M0X A;  1YQ3 A;  3NS1 B;  4C77 A;  4CNK A;  3L5O A;  1IUU A;  4B65 A;  2GAH B;  3CPJ G;  2RGO A;  2WS3 A;  3QKE A;  4E0V A;  3NKS A;  3ALL A;  2A89 A;  1H81 A;  1F8R A;  4C3Y A;  1D4C A;  1NG3 A;  3L8K A;  3GMB A;  4UDR A;  3H8I A;  3FYY A;  2B76 A;  4EIP A;  4K2X A;  4A65 A;  1TDF A;  1O94 A;  3UOX A;  2AL2 B;  4TM4 A;  4CCR A;  1GRH A;  5M10 A;  3H4K A;  3AEG A;  2YLZ A;  2P8C A;  3Q9T A;  3DG7 A;  3GD6 A;  2WU2 A;  2AKM A;  3JZU A;  4D04 A;  2P0I A;  2OZ3 A;  1ONE A;  2BYB A;  2XFO A;  2FYM A;  4IT1 A;  3DH9 A;  2CDU A;  5BRT A;  3SQP A;  2GSH A;  2E5A A;  3CXO A;  4HNC A;  5FJP A;  2HXT A;  3BOX A;  5KMS A;  1ZXI C;  2OFJ A;  2YM1 A;  5BVA A;  3K7T A;  2HNE A;  2MUC A;  4OVI A;  4ENL A;  4IL2 A;  3VQR A;  3T0K A;  4HCL A;  3KVE A;  4FDC B;  2GAG B;  1BKH A;  3O0H A;  2ZBW A;  2R0C A;  4YTN A;  1CJ2 A;  4Z17 A;  2FJB A;  3VR9 A;  5BUK A;  3AEA A;  4G73 A;  1PN0 A;  2UZZ A;  3SFE A;  4C5O A;  1EBG A;  3DK9 A;  1LPF A;  1XDI A;  1P48 A;  1ZY8 A;  3CGE A;  2EQ8 A;  3OZM A;  4U2S A;  4K5R A;  1KNP A;  3QFA A;  3ICR A;  2QGY A;  4KX6 A;  4U8K A;  1H82 A;  4CY6 A;  4JHM A;  4DXK A;  4GRT A;  3EKG A;  3B3R A;  2GGJ A;  2C75 A;  4IHC A;  1PDZ A;  5ER0 A;  1CC2 A;  2OZ8 A;  2AKZ A;  3E1T A;  1ELI A;  1ONF A;  3MSY A;  1N4W A;  1D7Y A;  1WUE A;  2PTY A;  4HB9 A;  3T8Q A;  3RR1 A;  5BOF A;  3HYV A;  2YLS A;  3ZLF A;  3AE2 A;  4Z1Y A;  1CJ4 A;  3T37 A;  1CF3 A;  2XLT A;  3DJE A;  3ZLH A;  1TE6 A;  3VC6 A;  1NU5 A;  3ICT A;  3AE8 A;  2GQW A;  3Q45 A;  2W3R A;  4D03 A;  3GD4 A;  3IC9 A;  3T9P A;  4YSX A;  1JRP A;  3K7M X;  3NK1 X;  4A3R A;  4AOS A;  3UKP A;  1OEP A;  1YQ4 A;  2V61 A;  3GRS A;  2FKP A;  5KVI A;  1RSG A;  1FEC A;  3HW2 A;  1X31 B;  3HYW A;  1LJ1 A;  5JCK A;  2Z5Y A;  2P8B A;  4I58 A;  1JRZ A;  2WBA A;  3F8D A;  1ECQ A;  5U63 A;  4A5L A;  1MUC A;  1ZK7 A;  3ES8 A;  3ES7 A;  2IID A;  3FJ4 A;  1DJN A;  1DOC A;  2BCG G;  3UXL A;  2RAB A;  3RIT A;  1KSS A;  4B63 A;  4E6M A;  1O5W A;  3M12 A;  4H4P A;  4XWZ A;  3GSI A;  3UKQ A;  3MKC A;  5IQ4 A;  3PO7 A;  3N4F A;  1ZDL A;  2XLP A;  1H86 A;  4HN8 A;  1NEK A;  4CBQ A;  3RNM A;  1KDG A;  3I6D A;  2OQY A;  3UCC A;  2XYO A;  1L9C A;  1Q9I A;  4BUR A;  1ZP0 A;  3SZW A;  3RED A;  4KPL A;  1K0I A;  3THU A;  3CNP A;  4GIS A;  2XVH A;  1W6T A;  1JRX A;  2PP0 A;  2XH7 A;  4HA6 A;  4JNQ A;  3S5W A;  2CFY A;  2CVJ A;  1DOD A;  4KPR A;  4O5Q A;  1FHV A;  2EQ9 A;  3NT6 A;  5KOX A;  3RGT A;  3AE4 A;  4EMW A;  5C3J A;  1DNC A;  3ABV A;  5KXJ A;  3NTD A;  4LII A;  1FL2 A;  2C72 A;  1NPX A;  3MUC A;  4M6U A;  1ZKQ A;  1H7X A;  2GGH A;  1LQT A;  2ZZ0 A;  2XVF A;  3A7R A;  3CTY A;  3I6T A;  1T3Q C;  3AXB A;  4J36 A;  1D5T A;  3AD8 B;  2DW6 A;  1BGN A;  1P2E A;  1YY5 A;  1MXT A;  3OZY A;  4H2H A;  3QLD A;  2MNR A;  4EQR A;  1W4X A;  2GR3 A;  3PWI A;  1JRY A;  1EL9 A;  3S5S A;  4OPG A;  4EIQ A;  4G74 A;  4USQ A;  3VC5 A;  1VG0 A;  2QA2 A;  4JN9 A;  1FIQ B;  2GR1 A;  1YEY A;  3P4S A;  3UKA A;  3EUB 3;  2WP5 A;  1ZX9 A;  1PJ5 A;  3BI5 A;  4U2T A;  2B7S A;  1LV0 A;  2RGH A;  4IA6 A;  2AR8 A;  1KN0 A;  4JN8 A;  3Q6J A;  3P4R A;  2C4C A;  1O95 A;  2YVJ A;  1D4E A;  2QDD A;  1OJT A;  3A7A A;  4IP4 A;  3GD3 A;  4YXD A;  2BRY A;  4J34 A;  5FS7 A;  3SFD A;  1F3P A;  3NVW B;  5EU9 A;  3ISH A;  3RO6 A;  5FJU A;  2TPR A;  2OPJ A;  1GT8 A;  3STP A;  1PXA A;  3AEF A;  4DN1 A;  3AYJ A;  3T6C A;  2AAQ A;  1CJ3 A;  1EBH A;  3DA1 A;  3PK7 A;  1F8S A;  1RVK A;  4JY3 A;  3IF9 A;  4JY2 A;  2XGZ A;  2QJN A;  3N6H A;  4JN7 A;  5KVH A;  3UJR A;  1B37 A;  3T14 A;  5GSN A;  1XS2 A;  2R46 A;  2FJE A;  3R0K A;  2GL5 A;  2ZC8 A;  3UJ2 A;  3B6D A;  3RP6 A;  3SM8 A;  3TQP A;  1GAL A;  3RCY A;  2E4G A;  3ZDN A;  1MOK A;  4X4J A;  4IZG A;  2PTX A;  1NEL A;  2PSN A;  5HXI A;  4AT0 A;  4GF7 A;  2VOU A;  3NRZ B;  3LXD A;  1PJ6 A;  5JCM A;  2YVG A;  4YTM A;  3QSS A;  2JBV A;  1R6W A;  3T31 A;  2V60 A;  1Q1R A;  3RP7 A;  3I6E A;  1KNR A;  4IV9 A;  1JNZ A;  1PBC A;  3L1R A;  3DGZ A;  2P3Z A;  2NVK X;  2VRM A;  4BK3 A;  3DER A;  2Y6Q A;  1S7M A;  2XLU A;  5CKU A;  3BSM A;  2JB3 A;  2TMD A;  1LTX R;  1TDE A;  1COY A;  1F9C A;  4X2P A;  3IJI A;  4UDQ A;  4JDR A;  3UGV A;  2C65 A;  2RGJ A;  1S3E A;  3HZL A;  2CHR A;  3UJS A;  3JSK A;  3NK2 X;  2RDX A;  2A8X A;  2FBW A;  4CNJ A;  4B1B A;  4BV6 A;  3GDN A;  3GYI A;  4Z26 A;  1L9E A;  1N61 C;  3DG3 A;  4H2N A;  2WPE A;  4A7A A;  2OX4 A;  1CC6 A;  1R0M A;  2OA1 A;  5J04 A;  2C66 A;  4H50 A;  2APG A;  2R45 A;  2BS3 A;  4BJY A;  2GGI A;  1GV4 A;  5KMR A;  1QO8 A;  2Z5X A;  1IUV A;  7ENL A;  3KPF A;  2WDQ A;  3NK0 X;  2ONE A;  1SJB A;  1QJD A;  1TKK A;  3UXK A;  3S61 A;  1CJC A;  1RYI A;  3T4W A;  3VR8 A;  1M6I A;  3CAW A;  4Y4N A;  3NNE A;  1L9D A;  1PJ7 A;  3KLJ A;  1JNR A;  1NAA A;  4BK1 A;  4H2P A;  3LAD A;  3KKJ A;  4ROP A;  2WP9 A;  3QSE A;  2Q7V A;  3R11 A;  3CGD A;  1E1M A;  3DK4 A;  3K1G A;  1VQW A;  3PWG A;  4JQ9 A;  5L46 A;  3NVV B;  2C64 A;  2XDO A;  3H12 A;  3UCL A;  4YWO A;  3D47 A;  4GAV A;  3P4P A;  1Y0P A;  2V6O A;  3T2Y A;  1WUF A;  3IWA A;  4GUV A;  4ICY A;  3AE3 A;  3V5F A;  4Y4L A;  2VZ2 A;  5TR3 A;  1IYX A;  1BQG A;  2V3B A;  4E8G A;  2R0P A;  3OW1 A;  4EQS A;  3SZF A;  3NLC A;  4J56 A;  4ZCC A;  2VRL A;  3VCN A;  2HXU A;  3TJ4 A;  3CK5 A;  1DTN A;  4EM4 A;  1Q1W A;  1IUW A;  4J2W A;  3OPS A;  1P2H A;  4EQW A;  3AYI A;  2GDQ A;  4U8P A;  2GMH A;  1MDL A;  1JCT A;  3H7V A;  3BNM A;  4ADW A;  3FV9 A;  1NHQ A;  2AL1 A;  4EMJ A;  4GIR A;  4H4S A;  3ICS A;  1YKJ A;  5IDZ A;  2JKC A;  3AD9 B;  5C2T A;  4AP3 A;  1PHH A;  4B66 A;  6ENL A;  2BS4 A;  2GV8 A;  4YKG A;  3QJ4 A;  3COX A;  4OPI A;  1D7L A;  3GY1 A;  4HCD A;  4EM3 A;  3ADA B;  2OLN A;  2FJD A;  2ZZB A;  3P93 A;  1B8S A;  2QQ6 A;  4J1O A;  2BK3 A;  4K7Z A;  3NVZ B;  3C96 A;  1S3B A;  2OAL A;  3GRT A;  1GRB A;  4M52 A;  2QAE A;  1LQU A;  3UTF A;  3ETR B;  4G9K A;  4GGH A;  2POD A;  3KD9 A;  1TDO A;  1OJD A;  2QDE A;  2E1M A;  5U25 A;  3NIX A;  4AP1 A;  4OPL A;  4A6N A;  2PHH A;  5HYM A;  4K8D A;  2PMQ A;  1GTE A;  1M64 A;  2YQU A;  4UP3 A;  2V5Z A;  4ZA0 A;  3G5Q A;  3NO1 A;  3IHM A;  4A35 A;  3SN4 A;  2W3S A;  3LB8 A;  3FXG A;  2GGE A;  3F8P A;  2Q0L A;  2QCU A;  3I3L A;  4CRT A;  4DYE A;  4F4R A;  1TDK A;  2YAU A;  4HNL A;  4YSZ A;  3H8L A;  2ARD A;  3UOZ A;  2YLR A;  1B4V A;  4K22 A;  4Z44 A;  4NTE A;  3UP5 A;  2XVI A;  4A6G A;  2DKH A;  4X9M A;  3NTA A;  1JEH A;  4H4X A;  2H89 A;  3VRB A;  3U4F A;  1GRA A;  3TWB A;  3BHF A;  3UJE A;  2C70 A;  4Z24 A;  3TTE A;  2R0G A;  4DWD A;  3UOY A;  1KFY A;  2W0H A;  4GYP C;  1BF3 A;  2GGG A;  2X3N A;  3CYJ A;  5GRT A;  2BAB A;  2JB1 A;  4CY8 A;  3T2Z A;  2X50 A;  1EL7 A;  1V97 A;  4ZOH B;  2ZZC A;  3CMM A;  2GEW A;  3I4K A;  1IUX A;  3PVC A;  3LZW A;  3UKH A;  2WPF A;  5FS6 A;  2PA6 A;  3AM9 A;  4II2 A;  4YWS A;  3ZVH A;  3R07 C;  3EAN A;  4EQX A;  4G7F A;  1MO9 A;  2XSX A;  3PG6 A;  4FP1 A;  2OZT A;  4NTD A;  1PDY A;  3QPE A;  3NN6 X;  1GSN A;  1N4V A;  4H4W A;  2B9W A;  3PS9 A;  4DGK A;  4H4R A;  3M0O A;  1ELS A;  3BI2 A;  3DEQ A;  3SN1 A;  2OG9 A;  3AE6 A;  1XPQ A;  1XPY A;  3PFR A;  3BNU A;  4GFI A;  4YT0 A;  1N63 C;  2A87 A;  5J7X A;  2PP1 A;  2VVL G;  3CIR A;  3CNS A;  4E4F A;  3AE7 A;  4NNJ A;  4RG4 A;  4UDP A;  3OC4 A;  4OCG A;  2WET A;  4K1W A;  2YR6 A;  4XWR A;  4B69 A;  4IA5 A;  4E4U A;  1GER A;  1S2Y A;  5FS8 A;  4GYP A;  1GND A;  3NHO X;  4J33 A;  3SXI A;  1BKW A;  3IHG A;  2PPG A;  2YG6 A;  1K0L A;  1GRT A;  3NGC X;  2WPC A;  1EC8 A;  3VRD B;  1JPD X;  1S2Q A;  2BA9 A;  3B9J B;  3UJF A;  1X2H A;  2OVL A;  3C4A A;  4H2Q A;  4ZCW A;  4U8N A;  1PS9 A;  2PGW A;  1GEU A;  1GOS A;  3A7U A;  4KT2 A;  3ITJ A;  3CPI G;  4FK1 C;  3R0U A;  3FCP A;  3CXB A;  4A6N B;  3AMZ A;  2I5Q A;  3QVP A;  4YSY A;  1Y56 A;  1STZ A;  1VDV A;  2HZG A;  1K0J A;  3SYI A;  2C3D A;  2JAE A;  4U2L A;  3NYC A;  1H6V A;  1EL8 A;  3OTR A;  2BXS A;  3SBF A;  3AYL A;  4H7U A;  3N4E A;  2PGE A;  3QTP A;  4B64 A;  3SSZ A;  5KWF A;  3ALM A;  3LJP A;  3BI4 A;  3DME A;  3H70 A;  5KMP A;  2XVE A;  4PAA A;  3UP4 A;  1XAN A;  2X8G A;  2B7R A;  3P0W A;  1N1P A;  3SZ0 A;  1LVL A;  2YR5 A;  1FEA A;  2ACZ A;  5FJO A;  1KKO A;  4JNA A;  1PBD A;  1E1L A;  3CT2 A;  4J31 A;  3UCD A;  2J3N A;  1JDF A;  4A99 A;  1GET A;  4NEW A;  3ZYX A;  1KF6 A;  3IK4 A;  4KWS A;  2XLR A;  4FK1 A;  1E7P A;  1N4U A;  3TWA A;  1KCZ A;  1NEN A;  4WCT A;  4RSL A;  3ZVH B;  5IQ1 A;  2BXR A;  3NXL A;  5KOW A;  3P3B A;  1OJA A;  1OJ9 A;  1FOH A;  2P88 A;  3UTH A;  4HCH A;  1GXF A;  4IL0 A;  1CC4 A;  4PAB A;  4WX1 A;  2O9Z A;  2IVE A;  3LZX A;  2GB0 A;  2Q0K A;  3VRA A;  5HY5 A;  2YM2 A;  4OPC A;  3FBS A;  5EB4 A;  4B67 A;  3CNT A;  2YWL A;  1PBF A;  1MDR A;  4OPT A;  1ZOV A;  3II4 A;  2R4E A;  1EC9 A;  1AOG A;  1BGJ A;  4GAP A;  4DNA A;  3AE1 A;  3BJS A;  2GQF A;  3NH3 X;  4Z25 A;  2XVJ A;  4K8G A;  2BCP A;  2O56 A;  4G8T A;  3CGC A;  1EBD A;  1N62 C;  1NG4 A;  3AB1 A;  3GWF A;  3ENL A;  2YG4 A;  4EMI A;  4HYR A;  2B9X A;  1F8W A;  1Z6L A;  3NRN A;  3B97 A;  4H19 A;  4H83 A;  4APN A;  2WES A;  1TYT A;  1MNS A;  1PBE A;  1Y56 B;  2IVD A;  3NN0 X;  4REK A;  2R9Z A;  2OO6 A;  3HYX A;  4H1Z A;  3NYF A;  3DDM A;  3MQT A;  3R10 A;  1PBB A;  4B68 A;  1IUT A;  2PYX A;  2OLA A;  4DX3 A;  3TW9 A;  3OZ2 A;  5BUL A;  3SJN A;  3QSM A;  3TJI A;  1KKR A;  4NWZ A;  4NTC A;  1H83 A;  1NHP A;  2OAM A;  3CNJ A;  2OKT A;  3HPF A;  2OLO A;  2QJM A;  3DK8 A;  3EF6 A;  4BJZ A;  1N5W C;  2EQ7 A;  1TDN A;  5U1O A;  4TM0 A;  4H2R A;  5G5G B;  3NZG A;  5BOE A;  2X8H A;  5EOW A;  2VQ7 A;  4H4U A;  1L0V A;  4MMW A;  3AD7 B;  5JCL A;  1EL5 A;  4LU6 A;  4U8J A;  5ENL A;  4IP5 A;  1TRB A;  4YSH A;  3CPH G;  3P9U A;  2BK4 A;  3NG7 X;  3AED A;  3UTE A;  3ATR A;  4TVW A;  2YVF A;  3MZN A;  2BC0 A;  3D8X A;  2Q6U A;  3D1C A;  2C73 A;  2WDR A;  2GH5 A;  3VDG A;  3UKK A;  4ZN0 A;  3TCS A;  2QJJ A;  4TLZ A;  3VA8 A;  3UKL A;  4XXG A;  3P1W A;  3VFC A;  2GF3 A;  1GPE A;  2Y6R A;  1JRO A;  4K2S A;  2PU1 A;  3DJD A;  3GYJ A;  4U8I A;  4USR A;  3UTG A;  1PDH A;  2YG3 A;  3FG2 P;  3K30 A;  3DGH A;  1GRG A;  3JW7 A;  1WYG A;  1XHC A;  2PTZ A;  3QN3 A;  1JPM A;  2WEU A;  2W55 A;  2WU5 A;  1FO4 A;  2WOV A;  4J57 A;  1RM6 B;  3V5C A;  3S47 A;  4BK2 A; 
#chains in the Genus database with same CATH homology
 1NG3 A;  4NNJ A;  4RG4 A;  3LXD A;  1PJ6 A;  3FIM B;  3L8K A;  3GMB A;  5JCM A;  4UDR A;  3F8R A;  4UDP A;  3H8I A;  1E6E A;  4Z2T A;  2B76 A;  4EIP A;  3OC4 A;  2YVG A;  4K2X A;  2WET A;  4OCG A;  4YTM A;  4A65 A;  4Z2U A;  1TDF A;  1O94 A;  2YR6 A;  3QSS A;  2C67 A;  4XWR A;  3UOX A;  4B69 A;  4IA5 A;  2JBV A;  4TM4 A;  4CCR A;  3T31 A;  1GER A;  1S2Y A;  1GRH A;  2V60 A;  1Q1R A;  5M10 A;  5FS8 A;  3H4K A;  1GND A;  4IVO B;  3NHO X;  3RP7 A;  3AEG A;  2GVC A;  4J33 A;  3SXI A;  1BKW A;  1NHR A;  2YLZ A;  3IHG A;  3Q9T A;  2XFQ A;  1KNR A;  2YG6 A;  1K0L A;  1GRT A;  4IV9 A;  1B5Q A;  1JNZ A;  1PBC A;  3GDP A;  3L1R A;  3DGZ A;  2WU2 A;  3NGC X;  2WPC A;  2NVK X;  1OJC A;  4D04 A;  2VRM A;  3VRD B;  4BK3 A;  2Y6Q A;  1S7M A;  1S2Q A;  2BYB A;  2XFO A;  2BA9 A;  2XLU A;  3DH9 A;  5CKU A;  4Z43 A;  2CDU A;  1GTH A;  3C4A A;  5BRT A;  3SQP A;  4H2Q A;  4U8N A;  1PS9 A;  1E39 A;  4GR1 A;  1GEU A;  4U8L A;  1GOS A;  2JB3 A;  3ITJ A;  2BS2 A;  3CPI G;  4DSH A;  2YG5 A;  2TMD A;  3NYE A;  4FK1 C;  2YG7 A;  1LTX R;  5KMS A;  5JCI A;  4A6N B;  1TDE A;  1BZL A;  1CBO A;  1COY A;  1RP0 A;  1GRE A;  1GRF A;  3GMC A;  2YM1 A;  3QVP A;  3K7T A;  5BVA A;  4YSY A;  1Y56 A;  3AEB A;  4OVI A;  4UDQ A;  1K0J A;  3SYI A;  2C3D A;  2JAE A;  4JDR A;  4U2L A;  2YLX A;  3NYC A;  4K5S A;  3VQR A;  2H88 A;  2WOI A;  2C65 A;  3RP8 A;  3T0K A;  4C3X A;  1H6V A;  1EL8 A;  3KVE A;  1DJQ A;  2RGJ A;  4FDC B;  3V76 A;  1S3E A;  3HZL A;  2BXS A;  4TLX A;  2GAG B;  3O0H A;  2ZBW A;  3AYL A;  2F5Z A;  2R0C A;  1REO A;  4YTN A;  1V59 A;  5JRB A;  1CJ2 A;  3JSK A;  3NK2 X;  4H7U A;  2BC1 A;  1FCD A;  5M0Z A;  4B64 A;  2A8X A;  1UKV G;  2FJB A;  3VR9 A;  4AOX A;  4Z2R A;  5BUK A;  2FBW A;  3AEA A;  4G73 A;  4CNJ A;  4B1B A;  4BV6 A;  3GDN A;  3GYI A;  5KWF A;  3ALM A;  4Z26 A;  1L9E A;  5KNL A;  1PN0 A;  4H2N A;  3LJP A;  2WPE A;  2UZZ A;  4TM3 A;  3UKF A;  3SX6 A;  3SFE A;  3BI4 A;  3WE0 A;  4C74 A;  4A7A A;  3DME A;  4C5O A;  3DK9 A;  1CC6 A;  3EAO A;  1GES A;  1LPF A;  2E5V A;  1XDI A;  1ZY8 A;  3CGE A;  2OA1 A;  2EQ8 A;  2C66 A;  4H50 A;  5KMP A;  2APG A;  2XVE A;  4A9W A;  1VDC A;  2R45 A;  4U2S A;  4PAA A;  4K5R A;  3UP4 A;  1XAN A;  2X8G A;  2BS3 A;  4BJY A;  1GV4 A;  1KNP A;  5KMR A;  1QO8 A;  3QFA A;  2B7R A;  3ICR A;  2Z5X A;  5KMQ A;  3FPZ A;  1D4D A;  1IUV A;  3KPF A;  2WDQ A;  3NK0 X;  4KX6 A;  4U8K A;  1N1P A;  3QVR A;  1H82 A;  4CY6 A;  4YTP A;  1YQZ A;  3P4Q A;  3SZ0 A;  1LVL A;  3LOV A;  1VRQ B;  2YR5 A;  1FEA A;  2ACZ A;  4GRT A;  1QJD A;  3B3R A;  3CND A;  3KU9 A;  2HQM A;  3S61 A;  1CJC A;  2C75 A;  1RYI A;  4G6H A;  4JNA A;  1PBD A;  3C4N A;  1E1L A;  5ER0 A;  3VR8 A;  1CC2 A;  1M6I A;  4J31 A;  2NPX A;  2JB2 A;  2J3N A;  1F6M A;  3E1T A;  2R4J A;  4A99 A;  4Y4N A;  1ELI A;  1ONF A;  1GET A;  4NEW A;  1ZOY A;  3NNE A;  1VG9 A;  1L9D A;  1N4W A;  1PJ7 A;  1E1N A;  1D7Y A;  3ZYX A;  1KF6 A;  1TYP A;  3KLJ A;  4FX9 A;  1JNR A;  3KPK A;  4HB9 A;  3HYV A;  2XLR A;  1NAA A;  2YLS A;  4FK1 A;  4BK1 A;  1E7P A;  2BRA A;  1N4U A;  2XFU A;  3AE2 A;  4H2P A;  1CJ4 A;  3LAD A;  3KKJ A;  2YLW A;  3T37 A;  1NEN A;  4U8O A;  1CF3 A;  2XLS A;  2XLT A;  3DJE A;  2WP9 A;  4WCT A;  4RSL A;  3QSE A;  3ICT A;  2Q7V A;  3AE8 A;  2GQW A;  4DSG A;  3CGD A;  1E1M A;  1SEZ A;  5IQ1 A;  4NEV A;  4D03 A;  3DK4 A;  2BXR A;  3GD4 A;  3IC9 A;  5KOW A;  1K4Q A;  2GR0 A;  4GCM A;  1VQW A;  3CN8 A;  4YSX A;  3FMW A;  3K7M X;  4JQ9 A;  3NK1 X;  4AOS A;  1OJA A;  3UKP A;  5L46 A;  2WHD A;  1OJ9 A;  1FOH A;  1YQ4 A;  2V61 A;  3T2K A;  3AWI A;  3UTH A;  3GRS A;  1GXF A;  1CC4 A;  4PAB A;  4WX1 A;  2XFN A;  2C64 A;  2O9Z A;  2XDO A;  5KVI A;  4CCQ A;  1JOA A;  2IVE A;  2BAC A;  3LZX A;  3DJG X;  3SZF A;  1RSG A;  4H4Z A;  2GB0 A;  2Q0K A;  1FEC A;  4A79 A;  1H2I A;  3UCL A;  2WDV A;  3VRA A;  4YWO A;  1X31 B;  1ZMD A;  5HY5 A;  2YM2 A;  3HYW A;  3FBS A;  4OPC A;  5EB4 A;  2GR2 A;  4B67 A;  3CNT A;  1LJ1 A;  2YWL A;  3P4P A;  4GAV A;  1Y0P A;  2V6O A;  1PBF A;  5JCK A;  4Y4M A;  2Z5Y A;  3T2Y A;  5JCN A;  1PXC A;  1E1K A;  2XFP A;  3IWA A;  4GUV A;  4OPT A;  4ICY A;  4I58 A;  1JRZ A;  2WBA A;  3AE3 A;  4Y4L A;  2VZ2 A;  3F8D A;  1ZOV A;  5U63 A;  5TR3 A;  2JK6 A;  3II4 A;  4A5L A;  2R4E A;  1ZK7 A;  4P9S A;  4OPD A;  2V3B A;  1AOG A;  2IID A;  1BGJ A;  3D9X A;  4GAP A;  5EBK A;  4DNA A;  1DJN A;  2R0P A;  1DOC A;  4EQS A;  2BCG G;  3AE1 A;  3G5S A;  2C3C A;  4J56 A;  3GYX A;  2GMJ A;  3NLC A;  2RAB A;  4ZCC A;  1KSS A;  2VRL A;  4B63 A;  1O5W A;  2BK5 A;  3M12 A;  1DOB A;  2GQF A;  3NH3 X;  4Z25 A;  1BWC A;  4H4P A;  2XVJ A;  4XWZ A;  3GSI A;  3UKQ A;  5IQ4 A;  2BCP A;  3BHK A;  3PO7 A;  4EM4 A;  3EPT A;  1Q1W A;  5FS9 A;  1IUW A;  4J2W A;  3CGC A;  1NDA A;  1EBD A;  1ZDL A;  1KSU A;  4EQW A;  1NG4 A;  1P2H A;  2XLP A;  3AB1 A;  3ATQ A;  2X8C A;  3GWF A;  5HHF A;  3RHA A;  1H86 A;  3AYI A;  1NEK A;  2YG4 A;  4U8P A;  4EMI A;  4CBQ A;  3RNM A;  1KDG A;  2GMH A;  3I6D A;  3AEE A;  2XYO A;  3BNM A;  4RG3 A;  4H4Y A;  4ADW A;  1NHQ A;  5J60 A;  2B9X A;  5LV9 A;  1L9C A;  4EMJ A;  1Q9I A;  4BUR A;  3URH A;  1ZP0 A;  3SZW A;  4H4S A;  3ICS A;  3RED A;  5EB5 A;  1F8W A;  1K0I A;  1YKJ A;  1Z6L A;  3NRN A;  3CNP A;  2XVH A;  2JKC A;  1JRX A;  4APN A;  3AD9 B;  4U8M A;  4JNQ A;  4HA6 A;  3S5W A;  5C2T A;  2CFY A;  2WES A;  2VQB A;  1PHH A;  3V3O A;  4AP3 A;  2CVJ A;  1TYT A;  1DOD A;  4B66 A;  4KPR A;  1NHS A;  3AE9 A;  4O5Q A;  1PBE A;  1Y56 B;  2IVD A;  2BS4 A;  2GV8 A;  4YKG A;  3QJ4 A;  2EQ9 A;  3COX A;  3NN0 X;  3NT6 A;  5KOX A;  4OPI A;  1QLB A;  1D7L A;  3AE4 A;  3GWD A;  4AT2 A;  5CQF A;  4EMW A;  4EM3 A;  5C3J A;  3ADA B;  2OLN A;  2FJD A;  3KA7 A;  4REK A;  4H4V A;  5FMH A;  1DNC A;  3ABV A;  2YR4 A;  2R9Z A;  4H4T A;  2ZZB A;  5KXJ A;  3NTD A;  1B8S A;  3SY4 A;  2WOW A;  4LII A;  1FL2 A;  4X9N A;  4GDP A;  3HYX A;  2BK3 A;  2C72 A;  1NPX A;  4K7Z A;  3NYF A;  4II3 A;  1PXB A;  1ZKQ A;  1H7X A;  4N9X A;  3C96 A;  1S3B A;  1LQT A;  2OAL A;  2ZZ0 A;  1PBB A;  4B68 A;  2AQJ A;  3GRT A;  1GRB A;  4M52 A;  2QAE A;  1IUT A;  1LQU A;  2XVF A;  3UTF A;  1FEB A;  3CTY A;  4G9K A;  2PYX A;  2C76 A;  2YLT A;  3KD9 A;  1HYU A;  3OZ2 A;  3AXB A;  1TDO A;  5BUL A;  1OJD A;  3R9U A;  2E1M A;  4J36 A;  5U25 A;  3NIX A;  1D5T A;  4LA1 A;  3AD8 B;  4AP1 A;  3QSM A;  4OPL A;  2VVL A;  4NZH A;  4NWZ A;  1BGN A;  4A6N A;  4I59 A;  2PHH A;  4NTC A;  5HYM A;  4K8D A;  1GTE A;  1H83 A;  1M64 A;  1P2E A;  1NHP A;  1MXT A;  1YY5 A;  2YQU A;  2OAM A;  3CNJ A;  4UP3 A;  2I0Z A;  2V5Z A;  2OLO A;  3DK8 A;  3EF6 A;  1W4X A;  4EQR A;  4BJZ A;  2EQ7 A;  1TDN A;  2GR3 A;  3G5Q A;  4ECH A;  3IHM A;  5U1O A;  1JRY A;  1EL9 A;  4TM0 A;  4H2R A;  4OPG A;  3LB8 A;  3K7Q X;  4EIQ A;  2WQY A;  4G74 A;  2X8H A;  2Q0L A;  1CHU A;  3F8P A;  4USQ A;  1VG0 A;  5EOW A;  2QCU A;  2VQ7 A;  3I3L A;  3AEC A;  4CRT A;  2QA2 A;  4H4U A;  3AE5 A;  1L0V A;  4GDE A;  1TDK A;  2YAU A;  5JCL A;  3AD7 B;  1EL5 A;  4LU6 A;  4YSZ A;  4JN9 A;  4U8J A;  2GR1 A;  3H8L A;  2ARD A;  1TRB A;  4YSH A;  3P4S A;  3CPH G;  3UOZ A;  3UKA A;  2YLR A;  3P9U A;  5KRQ A;  2WP5 A;  1B4V A;  1ZX9 A;  1PJ5 A;  2BK4 A;  3AED A;  3NG7 X;  4K22 A;  4NTE A;  4Z44 A;  3UP5 A;  1DXL A;  3UTE A;  3BI5 A;  3DJJ A;  3ATR A;  2XVI A;  2DKH A;  4X9M A;  4U2T A;  3NTA A;  2WP6 A;  2C7G A;  1JEH A;  4H4X A;  2B7S A;  4IVM B;  4OPU A;  5IPY A;  2EQ6 A;  1LV0 A;  2RGH A;  2YVF A;  4IA6 A;  2H89 A;  2AR8 A;  3VRB A;  2QA1 A;  1KN0 A;  4MJW A;  1GRA A;  3Q6J A;  2BC0 A;  3BHF A;  3CGB A;  3P4R A;  3D8X A;  1H7W A;  1DOE A;  2Q6U A;  2C4C A;  1O95 A;  2YVJ A;  1D4E A;  3D1C A;  2FJA A;  1OJT A;  3GD3 A;  4YXD A;  2C70 A;  2C73 A;  4Z24 A;  2BRY A;  4J34 A;  5FS7 A;  2R0G A;  3UOV A;  4YKF A;  2WDR A;  4TM1 A;  2GH5 A;  3G5R A;  1IUS A;  3V3N A;  3SFD A;  1F3P A;  3UOY A;  1KFY A;  3UKK A;  2W0H A;  4ZCD A;  3ISH A;  4ZN0 A;  1BF3 A;  1H84 A;  2TPR A;  2X99 A;  2X3N A;  2XCG A;  4TLZ A;  5GRT A;  2BAB A;  1GT8 A;  3UKL A;  2JB1 A;  4XXG A;  4CY8 A;  3T2Z A;  1CL0 A;  2X50 A;  3P1W A;  3SZC A;  2GF3 A;  1IJH A;  1ZMC A;  1PXA A;  1EL7 A;  1GPE A;  3AEF A;  2B9Y A;  2DKI A;  2Y6R A;  3AYJ A;  3QFB A;  2ZZC A;  3CMM A;  2GEW A;  2CUL A;  2AAQ A;  1IUX A;  3DJD A;  3GYJ A;  3M13 A;  3LZW A;  3PVC A;  3SGL A;  4U8I A;  4USR A;  3UKH A;  2GRT A;  3UTG A;  1PDH A;  2WPF A;  1CJ3 A;  5FS6 A;  2YG3 A;  3FG2 P;  3K30 A;  3DA1 A;  4G6G A;  3DGH A;  4II2 A;  1F8S A;  4JY3 A;  3IF9 A;  1JU2 A;  3EAN A;  4JY2 A;  4EQX A;  5DBJ A;  1GRG A;  1XHC A;  5KVH A;  1MO9 A;  1B37 A;  4O5U A;  3T14 A;  2V3A A;  3PG6 A;  5GSN A;  2R46 A;  3ALJ A;  2VVM A;  2FJE A;  2WEU A;  2WU5 A;  4H4Q A;  4NTD A;  1YQ3 A;  3NN6 X;  4C77 A;  1GSN A;  4CNK A;  3L5O A;  1IUU A;  3B6D A;  1N4V A;  4H4W A;  3RP6 A;  2B9W A;  3SM8 A;  2WOV A;  4B65 A;  2GAH B;  4J57 A;  3CPJ G;  2RGO A;  3PS9 A;  2WS3 A;  1GAL A;  4DGK A;  4H4R A;  3M0O A;  3BI2 A;  4E0V A;  2E4G A;  3AE6 A;  3ZDN A;  1XPQ A;  3NKS A;  1MOK A;  3ALL A;  3BNU A;  4X4J A;  2A89 A;  4YT0 A;  2A87 A;  5HXI A;  5J7X A;  1H81 A;  2VVL G;  1F8R A;  4AT0 A;  4C3Y A;  3CIR A;  4BK2 A;  3CNS A;  4GF7 A;  2VOU A;  3AE7 A;  1D4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...