5FS9A

Crystal structure of the g338e mutant of human apoptosis inducing factor
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
487
structure length
459
Chain Sequence
DKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKENMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Structure/Function Relations in Aifm1 Variants Associated with Neurodegenerative Disorders.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 152
structure length 459
sequence length 487
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fs9A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs9A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs9A01
2YQUA 5FMHA 4CY8A 3E1TA 2VRLA 4H2NA 4NEVA 3COXA 2YM1A 3C96A 3RP6A 2XVEA 1IJHA 2WDVA 4USRA 3VRAA 4AT0A 2O9ZA 4Z26A 1CJ4A 3Q9TA 5KOWA 3B6DA 1PDHA 2B76A 1GETA 5FS9A 3F8RA 3G5RA 2V3BA 4D03A 3CGDA 1CL0A 1F8SA 5U1OA 3FIMB 1ZP0A 1ELIA 4B68A 4X4JA 1P2HA 2GR3A 1CJCA 4B64A 1FEBA 3DK4A 5C2TA 2AQJA 3VR8A 4H4TA 1L0VA 2WEUA 2ZZ0A 3UKHA 1OJDA 3CPHG 2VRMA 3GYIA 3IF9A 2YLXA 5HYMA 3IHGA 3QSMA 2EQ6A 1GESA 1NDAA 2C70A 1ZX9A 2GR1A 3KU9A 4U8IA 4XWZA 3AE5A 3CPJG 4WCTA 1FL2A 3UKAA 4C3YA 5KOXA 1D4EA 2TMDA 1REOA 3UKLA 5KWFA 4B63A 2R46A 2Q7VA 2GMJA 2YAUA 2BCPA 4JQ9A 1PXCA 4ICYA 1L9CA 4U2SA 2YLSA 1Y0PA 1H82A 4H4QA 1EBDA 2F5ZA 3P4RA 3P4SA 1Y56B 4APNA 3AB1A 4H50A 1VQWA 4YT0A 1E1LA 3SGLA 4YKFA 4CCQA 2V6OA 4H4RA 3VQRA 3ALLA 3RNMA 1IUWA 3VRDB 3CIRA 3UCLA 4H7UA 1OJCA 3DGHA 4B67A 2B7RA 5M10A 3DMEA 3DK8A 5JCMA 1K0JA 1PBCA 2FBWA 2XFOA 1D4DA 4FK1C 1KDGA 4LU6A 3NGCX 1QLBA 3WE0A 2C3CA 1GTHA 2JB2A 1N4WA 4H4WA 3NN0X 3UKPA 3DJDA 4NTEA 2R9ZA 1JRXA 2XLTA 1KF6A 2C73A 3AE9A 1O94A 3UP5A 4AT2A 3BI5A 4XXGA 4A99A 1RSGA 4OPCA 1B8SA 2BXRA 3H4KA 3UOYA 4KPRA 5GRTA 2IVEA 2BS2A 1M6IA 2E5VA 3UOZA 3S5WA 2JKCA 3LXDA 2FJEA 1GREA 2OA1A 3UTGA 2YR5A 4Z2TA 1M64A 2XVHA 4GDPA 4CY6A 3AE8A 3DH9A 1NHRA 1IUTA 2YLZA 2IVDA 1GSNA 5J60A 4IVOB 4OVIA 1JRZA 4JN9A 3SFDA 4A79A 3AD7B 3GDNA 1GEUA 1TDFA 2VVLA 3AE7A 4REKA 5GSNA 3KA7A 1IUSA 2WS3A 4EM3A 3P1WA 1K0LA 1B4VA 3M0OA 1IUVA 3NK1X 5FS8A 2R0CA 4O5QA 5LV9A 3VR9A 1ZY8A 1BKWA 4J34A 4UDRA 3KD9A 4E0VA 1Q1WA 3NN6X 1E1NA 3EF6A 1CBOA 4H4PA 3DA1A 1CJ2A 1Z6LA 3O0HA 3KVEA 2AR8A 3FPZA 1VG0A 4RG3A 5EOWA 2Y6RA 5EB5A 2X3NA 2E4GA 2C7GA 4Z2UA 3NKSA 1GALA 1JEHA 3DGZA 2XFPA 2YG3A 3AEEA 3DJGX 2JB3A 1F3PA 3LADA 2YWLA 1PBDA 4LIIA 2XFNA 4TLXA 1PBEA 1PN0A 1E7PA 1DOBA 1P2EA 1ZOYA 3GWDA 4AOXA 3C4NA 2WETA 2GF3A 1H7XA 5M0ZA 5BULA 1D5TA 1LPFA 1BGJA 4AP3A 4U8MA 1NENA 2JBVA 2XLSA 2C72A 1H83A 2Q0KA 1H86A 2WESA 3IHMA 3IWAA 2VOUA 5HHFA 3NTAA 1CJ3A 1LVLA 3FBSA 3JSKA 4OCGA 3F8PA 1K0IA 3FG2P 1GRBA 1GRFA 3BI2A 4GCMA 3QSSA 4X9NA 4C74A 4U2TA 3M13A 4OPIA 4YSZA 3CPIG 1GOSA 1VDCA 3AE1A 3QJ4A 3G5SA 1PXAA 1W4XA 1KSSA 4ECHA 2TPRA 2C66A 3GD4A 3URHA 4K7ZA 1GRAA 2X8CA 3L8KA 4KX6A 4TM0A 3EAOA 3ZYXA 1EL9A 1NG4A 5JCNA 4CCRA 2CDUA 4BJZA 1VG9A 1S2YA 2FJBA 3ITJA 3L1RA 4UDQA 4K5SA 3V3OA 4YKGA 4H4YA 2WP5A 3AE6A 2EQ7A 3GRTA 2YG5A 4H2RA 4K5RA 2XFQA 3SQPA 2X50A 5FS6A 3PO7A 4AOSA 2V60A 1Q9IA 3S61A 1ZK7A 1ZMDA 3KLJA 1X31B 4Z44A 2R0PA 1RYIA 4GF7A 3LZWA 4A7AA 2Q6UA 2YR4A 3H8IA 1MO9A 4J56A 3CGCA 1PS9A 2Z5XA 3RP8A 1FOHA 2W0HA 2R45A 2YLWA 4AP1A 2JK6A 1H81A 1COYA 2R4EA 4FK1A 4CRTA 2GAGB 3NYCA 4YXDA 2WU2A 4OPUA 4YTMA 1Y56A 1Q1RA 4Y4NA 4U8OA 4C3XA 1H7WA 4BURA 1GRHA 3ADAB 4EMIA 1JU2A 4OPGA 1E39A 1KFYA 2XFUA 1GXFA 3UOVA 2WDRA 1PHHA 4EQXA 2PYXA 3QSEA 5U25A 4CBQA 3GRSA 1GERA 4EQWA 4BK3A 2ARDA 1PJ6A 1DJQA 2JAEA 2YR6A 3NNEA 3I3LA 2V61A 2VVLG 4ZCDA 3DJJA 2WDQA 2BS3A 1TDNA 4H4SA 2GVCA 1AOGA 4JNQA 5KXJA 1NHQA 1XANA 2EQ8A 2YM2A 3I6DA 4HB9A 3VRBA 2BS4A 2QCUA 1PBFA 3AD8B 1NPXA 1OJTA 2I0ZA 3NRNA 1S3EA 1KNRA 1O95A 4GUVA 3GD3A 3AEBA 1E1KA 1MOKA 2WOIA 4N9XA 3ZDNA 1YQZA 4YTPA 4DSHA 2C65A 4Z43A 3AECA 2QA2A 4UP3A 3SFEA 3Q6JA 3NH3X 1IUXA 4YTNA 4J31A 4Y4LA 3UTEA 3ISHA 3LZXA 5L46A 2Z5YA 2NPXA 4PABA 1YQ3A 2WPCA 3FMWA 3GWFA 1NHPA 3V3NA 5J7XA 3UTFA 1JOAA 5IQ1A 5TR3A 2V3AA 1ONFA 4BJYA 2BABA 1F6MA 2C75A 4BK2A 2Y6QA 2RGOA 2GR2A 1PBBA 2WHDA 2WU5A 1F8RA 3LOVA 4XWRA 2X8GA 3NK2X 4HA6A 2GEWA 1TDKA 1YKJA 3QVRA 1O5WA 2A87A 2XVIA 2C3DA 3UKKA 3UKQA 1CC2A 1BF3A 4YWOA 3BHFA 2VVMA 3QFAA 3D8XA 3AE4A 4H4ZA 2WPEA 1N4UA 3K7MX 3CNTA 4IA6A 4J57A 4DSGA 3NHOX 2ACZA 2YLRA 3CGEA 3D1CA 4J2WA 2WPFA 2BC1A 4WX1A 1EL8A 3BNMA 4Z24A 2C67A 3QFBA 1JNRA 4NZHA 1VRQB 1PXBA 2UZZA 3EPTA 4NEWA 2XCGA 1GV4A 2GMHA 3ABVA 1QO8A 2BK5A 1XPQA 2XVFA 4TM1A 2VQBA 2B7SA 1FECA 5KVIA 1S2QA 3UTHA 4USQA 4A9WA 3ICRA 3PVCA 4YSYA 2GR0A 2BXSA 4EIPA 3AYLA 3P9UA 3KKJA 4JY2A 4NTDA 5U63A 5ER0A 1EL7A 4H4XA 5CKUA 2B9WA 1PJ7A 2E1MA 3B3RA 3T37A 1L9EA 1CHUA 4NTCA 1LJ1A 3UP4A 4U8LA 3AEGA 3GYJA 5FS7A 1DOCA 2C76A 2DKHA 4CNJA 5JCIA 5IQ4A 1RP0A 2QAEA 2GAHB 5EBKA 4IA5A 4OPTA 2YVGA 2IIDA 5HY5A 2Q0LA 3AXBA 1GPEA 3PS9A 4H4VA 2CFYA 3NT6A 4FX9A 3DK9A 4I58A 3F8DA 4DGKA 4H4UA 3K30A 4LA1A 4A6NA 2OLOA 2WOVA 4B69A 3CNJA 2GB0A 5BVAA 1LV0A 4BV6A 3OZ2A 4YSXA 4P9SA 2J3NA 2YVFA 4EMWA 2XYOA 1DODA 2ZZBA 1F8WA 4U8PA 1ZDLA 4JY3A 1FCDA 1BWCA 4TM3A 2R4JA 4IVMB 4B1BA 2ZZCA 2PHHA 2WBAA 3HZLA 3AYJA 1HYUA 5KVHA 2C64A 4A6NB 1DXLA 2RABA 4Z25A 4A65A 1H6VA 1UKVG 5CQFA 1TYPA 1D7LA 4ZCCA 3SM8A 3NG7X 3ICTA 4EQSA 2BA9A 2GQFA 2WOWA 3CTYA 3DJEA 3BNUA 2X8HA 3II4A 4J36A 4GRTA 2BK3A 1LQTA 3EANA 1GNDA 2B9YA 2VQ7A 4B65A 2H88A 1OJ9A 3K7TA 2GH5A 1CC4A 4JNAA 2B9XA 2WQYA 1MXTA 1NAAA 1TDEA 3AE3A 2XLRA 4YSHA 3K7QX 3QVPA 1GT8A 1CF3A 1JNZA 1QJDA 3ALJA 5EB4A 1L9DA 4GR1A 3GSIA 5BRTA 2NVKX 1XHCA 2OAMA 3C4AA 4C77A 4EIQA 5HXIA 4A5LA 1NHSA 1V59A 4GDEA 5DBJA 4FDCB 3RHAA 2BYBA 1BGNA 2GV8A 2AAQA 4K8DA 5JCKA 2BACA 1NEKA 2BCGG 2WP6A 3REDA 4EMJA 1S3BA 3LJPA 4D04A 3G5QA 5JCLA 3GDPA 3P4QA 3AWIA 3NYEA 2ZBWA 3ICSA 1GRTA 4H2PA 4J33A 3AYIA 2APGA 2FJDA 4DNAA 1N4VA 1FEAA 4K22A 5C3JA 2OALA 3BHKA 2R0GA 4B66A 1ZKQA 4U8NA 5KRQA 2V5ZA 4JDRA 4Y4MA 2YLTA 1PJ5A 2RGJA 1NG3A 3V76A 3CNSA 5IPYA 3NIXA 3H8LA 2FJAA 2YG7A 1ZMCA 4C5OA 3NYFA 3CN8A 1D4CA 3NLCA 3BI4A 1D7YA 3ALMA 2YG4A 3UOXA 2XLPA 1TYTA 1B37A 2CULA 1BZLA 4MJWA 3AEAA 1N1PA 3OC4A 2WP9A 4U8JA 2YG6A 1KSUA 1TDOA 2XLUA 4ADWA 1DJNA 2RGHA 4IV9A 3UKFA 1KNPA 4TLZA 1XDIA 2BC0A 1DOEA 4BK1A 4ZN0A 2CVJA 3KPFA 3RP7A 4CNKA 4OPLA 4O5UA 2JB1A 3AE2A 1SEZA 4U8KA 2QA1A 1E1MA 4OPDA 3R9UA 4TM4A 4K2XA 3NTDA 3IC9A 3ATQA 1EL5A 4U2LA 2A8XA 2DKIA 2A89A 3GMBA 4EQRA 1YQ4A 2H89A 3ATRA 1LTXR 3AEDA 3M12A 3LB8A 1OJAA 2OLNA 2VZ2A 4I59A 2HQMA 4EM4A 1LQUA 4PAAA 2EQ9A 1JRYA 2XVJA 1CC6A 3CNPA 4H2QA 2BK4A 2YVJA 1ZOVA 2XDOA 3AD9B 2GRTA 3CNDA 3GMCA 3CGBA 1GTEA 1GRGA 2X99A 3NK0X 5BUKA 4Z2RA 1H84A 4M52A 1TRBA 1YY5A 3P4PA 4RG4A 1IUUA 1K4QA 1DNCA 2GQWA 4RSLA 4UDPA 4X9MA 1B5QA 3AEFA 1E6EA
chains in the Genus database with same CATH superfamily
2QQ6A 3COXA 3C96A 4AT0A 1IJHA 5KOWA 3Q9TA 3B6DA 2PTXA 4D03A 4GISA 1CL0A 4HCDA 1VDVA 3FIMB 1ELIA 2GR3A 4IT1A 3T2KA 2ZZ0A 3UKHA 3CPHG 4GGBA 3D46A 3MQTA 5HYMA 2EQ6A 1ZX9A 4Z17A 4U8IA 4XWZA 3CPJG 3DESA 4WCTA 1W6TA 1REOA 5KWFA 2Q7VA 2W55A 1N5WC 2YLSA 2F5ZA 4H50A 4YT0A 4YKFA 4CCQA 2V6OA 5KMPA 3UCLA 2OKTA 3DK8A 1K0JA 2FBWA 2XGZA 2ZADA 4LU6A 2JB2A 3OTRA 1N4WA 3VFCA 4H4WA 3DJDA 1BKHA 2R9ZA 1JRXA 4AT2A 1KF6A 1O94A 4IP4A 2BXRA 5GRTA 3UOZA 3QLDA 2BS2A 3N4FA 3S5WA 2JKCA 4Z2TA 2XVHA 2YLZA 2IVDA 1GSNA 1ECQA 4E6MA 1JRZA 3SFDA 3AD7B 4REKA 2VVLA 3AE7A 3KA7A 1K0LA 1KKOA 1XS2A 4E0VA 1BKWA 4UDRA 3O0HA 3KVEA 4G6HA 5EB5A 2XFPA 5BOFA 3AEEA 4LIIA 1PBEA 1DOBA 1P2EA 2WETA 3AMZA 4TVWA 1FFUC 1LPFA 4AP3A 4U8MA 1NENA 4TVYA 2JBVA 2Q0KA 3IWAA 2P0IA 1LVLA 3R07C 3FBSA 1GRFA 4GCMA 4U2TA 4MKSA 3CPIG 1VDCA 1KSSA 5KMSA 4KX6A 4TM0A 3ZYXA 1EL9A 1NG4A 1VG9A 3L1RA 4YKGA 2EQ7A 3GRTA 4K5RA 3PO7A 4AOSA 2V60A 1Q9IA 1ZK7A 1ZMDA 2R0PA 4GF7A 3IJLA 4A7AA 3ZVHB 4J56A 2Z5XA 2RDXA 4J3ZA 1FOHA 2R45A 2R4EA 3HW2A 2AL2A 3UCDA 2ZC8A 3NRZB 5KNLA 1GXFA 2PYXA 2ARDA 3NNEA 3V3WA 3H8AA 2BS3A 5KXJA 2QJMA 3I6DA 2BS4A 3VDGA 3AD8B 1NPXA 3EUB3 4F4RA 1KNRA 2WOIA 3T0KA 3CT2A 2C65A 3AECA 4UP3A 5KMQA 1IUXA 5FJOA 4G73A 3STPA 3LZXA 5L46A 3V3NA 3GWFA 2O56A 3UTFA 5TR3A 3MWCA 4BJYA 1F6MA 2Y6QA 2RGOA 2WU5A 3LOVA 1F8RA 2GEWA 3H70A 3NVVB 3AE4A 1N4UA 3CNTA 2ACZA 2PS2A 3D1CA 3TTEA 4M6UA 3S5SA 2WPFA 1EC8A 4Z24A 3T31A 2XVFA 3ZLHA 2VQBA 1FECA 1SJDA 1MDLA 5KVIA 3UTHA 3AYLA 4NTDA 3P0WA 3CXBA 5ER0A 4H4XA 3B9JB 2B9WA 6ENLA 3JVAA 4U8LA 4CNJA 3I6EA 1V97A 2OG9A 2Q0LA 1GPEA 3DK9A 4I58A 3K30A 4B69A 4BV6A 4YSXA 3FYYA 3SX6A 4JY3A 3GY1A 4B1BA 3AYJA 1HYUA 4IHCA 5KVHA 4Z25A 2RABA 3DFHA 5CQFA 1TYPA 3NG7X 3ICTA 4EQSA 3DJEA 2WOWA 3CTYA 3BNUA 4J36A 1GNDA 1SJCA 1CC4A 3KPKA 2WQYA 1NAAA 4ROPA 1TDEA 4YSHA 1L9DA 3K1GA 2PGWA 3R0KA 4C77A 5HXIA 5DBJA 4FDCB 3V5CA 3T6CA 1BGNA 1PDZA 4K8DA 5JCKA 3L5OA 1NEKA 3REDA 3PK7A 3Q45A 3GDPA 1H2IA 3VCNA 3ICSA 3VA8A 2OQYA 2R0GA 4B66A 3TCSA 3QTPA 5IDZA 4DHGA 3CYJA 2PTWA 2XLPA 1B37A 2CULA 3AEAA 3OC4A 3R0UA 3SY4A 4HN8A 2XLUA 2GL5A 1FO4A 4ADWA 2GGIA 2PTYA 1DOEA 2JB1A 3V4BA 4U8KA 3IK4A 1MRAA 3ATQA 3GMBA 3AEDA 3R1ZA 3CNPA 2YVJA 1ZOVA 3AD9B 2GRTA 3GMCA 3CGBA 3NK0X 1GRGA 4Z2RA 1YY5A 5BOEA 1K4QA 4RSLA 1EC9A 3E1TA 4NEVA 2XVEA 4DXKA 2WDVA 4Z26A 2MUCA 3F8RA 2GGEA 1F8SA 2GGGA 4B68A 4X4JA 3DDMA 4B64A 2AQJA 3VR8A 4H4TA 1L0VA 2WEUA 1OJDA 3RGTA 3GYIA 1P43A 1GESA 4K2SA 2HXUA 2C70A 3AE5A 4C3YA 1D4EA 2TMDA 3CXOA 3UKLA 3SQSA 2R46A 1PXCA 4U2SA 3SN0A 1Y0PA 1Y56B 5FJTA 3AB1A 3P93A 1VQWA 4H4RA 1N62C 3MY9A 1OJCA 4B67A 4DWDA 5JCMA 3H12A 1KDGA 3NGCX 1QLBA 3UKPA 2C73A 4A99A 1RSGA 4OPCA 2OO6A 1KCZA 3UOYA 2E5VA 1M6IA 2FJEA 1GREA 3UTGA 2P88A 4CY6A 2NQLA 4K1WA 4A79A 1TDFA 4JN8A 3MKCA 2WS3A 3P1WA 1MNSA 4DYEA 3M0OA 1IUVA 4O5QA 3VR9A 1Q1WA 3NN6X 1CJ2A 3FPZA 1VG0A 4RG3A 2Y6RA 2C7GA 3DGZA 1F3PA 1FFVC 4TLXA 3OZMA 1PN0A 1H7XA 5BULA 3SZ0A 1D5TA 1BGJA 3T2ZA 3AN1A 2C72A 3IHMA 5HHFA 2VOUA 1CJ3A 4HCLA 3UJRA 3JSKA 4OCGA 3FG2P 2AKZA 3BI2A 2FKPA 4X9NA 4YSZA 1PXAA 1W4XA 4ECHA 1GRAA 2PTZA 1X2HA 5JCNA 4BJZA 1S2YA 2FJBA 3UJSA 3ITJA 3V3OA 2C4CA 5JRBA 2WP5A 1KN0A 2XFQA 2X50A 4G6GA 3FCPA 3S61A 7ENLA 3KLJA 3BSMA 3DEQA 1FHVA 2Q6UA 1MO9A 3RP8A 4CRTA 2GAGB 1N60C 3ZLFA 4BURA 4EMIA 4OPGA 1E39A 2XFUA 2E3TA 2WDRA 3QSEA 4A3RA 3EEZA 4CBQA 4ZCDA 3I3LA 2BRYA 1OEPA 3SJNA 2XH4A 2WDQA 4H4SA 3VCCA 2GVCA 1NHQA 1XANA 2EQ8A 2OQHA 1JCTA 3VRBA 3GD6A 1PBFA 2QCUA 1S3EA 4GUVA 3SYIA 3AEBA 4G7FA 4YTPA 3SFEA 3Q6JA 4YTNA 4J31A 3UTEA 3ISHA 3FMWA 2WPCA 1JOAA 3MUCA 1PBBA 2X8GA 4H1ZA 3RO6A 1YKJA 3QVRA 1BF3A 1JDFA 2VVMA 3S47A 1EBGA 3FV9A 4J57A 2YLRA 3FXGA 3HRDC 4WX1A 1JPMA 1VRQB 1PXBA 2UZZA 3ABVA 1XPQA 4A9WA 1FHUA 3PVCA 2BXSA 3P9UA 1EL7A 3NXLA 1PJ7A 2E1MA 3UXKA 4NTCA 3AEGA 5IQ4A 5JCIA 4IA5A 4NNJA 5HY5A 2OLAA 3PS9A 3ZVHA 3NT6A 4FX9A 3F8DA 4A6NA 2OLOA 2PP0A 3CNJA 5BVAA 4P9SA 2J3NA 2YVFA 1F8WA 2W3RA 4U8PA 2XSXA 1ZDLA 3T8QA 3SN4A 2ZZCA 2PHHA 3HZLA 4A6NB 4GIRA 1H6VA 2BRAA 3TJIA 2GQFA 4ENLA 2X8HA 1LQTA 3EANA 2B9YA 1SB3B 1F9CA 1OJ9A 2GH5A 2AKMA 1VQZA 3PFRA 4GR1A 3IJQA 5BRTA 2OPJA 3ENLA 3BOXA 2NVKX 2OAMA 4EIQA 1V59A 3THUA 2OFJA 1JPDX 4G74A 3G5QA 2PODA 5JCLA 3NYEA 3NVZB 4H2PA 1GRTA 4Z1YA 3AYIA 2APGA 2FJDA 1STZA 1N4VA 4K22A 3BHKA 3RRAA 5KRQA 3TQPA 4Y4MA 2YLTA 3EKGA 2RGJA 3VC6A 5IPYA 3MZNA 3UXLA 3NIXA 4ZA0A 2FJAA 3R10A 2YG7A 4NWZA 1BZLA 4MJWA 2WP9A 4U8JA 1XDIA 3RP7A 4O5UA 3AE2A 1SEZA 2QA1A 3R9UA 3NTDA 4A35A 4U2LA 1EL5A 2A8XA 4EQRA 1LTXR 2OLNA 3SR6B 4PAAA 2EQ9A 1JRYA 1L8PA 1GTEA 5BUKA 2X99A 4J1OA 4M52A 3P4PA 4JHMA 1B5QA 2VRLA 2YM1A 3RP6A 3VRAA 1MUCA 2B76A 1PDYA 3G5RA 2OX4A 2QJNA 5U1OA 3SSZA 3TWAA 1P2HA 4GAPA 1FEBA 3DK4A 2VRMA 3IHGA 5G5GB 1NDAA 3KU9A 4II3A 2XH2A 3UKAA 5KOXA 3OW1A 3QKEA 2GMJA 4JQ9A 3SN1A 4H4QA 3P4RA 4APNA 3SGLA 3VQRA 3U9IA 4GGHA 3N4EA 3CIRA 4H7UA 5M10A 3DMEA 1D4DA 4FK1C 3JZUA 2HZGA 3WE0A 1GTHA 3NN0X 4NTEA 2XLTA 1EC7A 1ELSA 3UP5A 3BI5A 3H7VA 4XXGA 1B8SA 2GSHA 2IVEA 2PGEA 3LXDA 1M64A 3TOYA 1IUTA 4IVOB 5GSNA 2ONEA 1B4VA 4GAVA 5FS8A 2R0CA 3I4KA 5LV9A 2OVLA 2QVHA 1ZY8A 3KD9A 1CBOA 3CB3A 5EOWA 2X3NA 2E4GA 4Z2UA 1GALA 4G9KA 2JB3A 1SJAA 2YWLA 1PBDA 2XFNA 3SBFA 4AOXA 3GWDA 3C4NA 2PP3A 2GF3A 3BJSA 1N5XA 3U4FA 1WYGA 2HXTA 3A7AA 2I5QA 2XLSA 1H83A 2WESA 1H86A 3NTAA 3F8PA 1K0IA 1GRBA 2XH0A 3QSSA 3M13A 4OPIA 1GOSA 3AE1A 3G5SA 2TPRA 1XPYA 3URHA 3EAOA 3R11A 3VC5A 4CCRA 2CDUA 4FI4A 3QPEA 3AE6A 2YG5A 3HYXA 4H2RA 3ZVIA 2OZ3A 4X2PA 4ZOHB 1WUEA 1RYIA 3N6HA 4GFIA 2POZA 2YR4A 3H8IA 4H83A 3CGCA 2YLWA 4AP1A 3I6TA 2JK6A 1H81A 4YXDA 3N6JA 2WU2A 4OPUA 1Y56A 1Q1RA 4U8OA 1H7WA 3ADAB 3HYVA 1TZZA 1KFYA 4IP5A 1PHHA 1GERA 4EQWA 1PJ6A 1BQGA 3NVYB 2YR6A 2V61A 2VVLG 1WUFA 2PP1A 1TDNA 5ENLA 4JNQA 4GYPA 2I0ZA 4HCHA 5FJUA 1E1KA 4N9XA 1YQZA 4DSHA 3NH3X 2Z5YA 2NPXA 3RCYA 4PABA 1YQ3A 4DX3A 5J7XA 5IQ1A 3CAWA 4BK2A 4GYPC 2GR2A 2WHDA 1TDKA 2PMQA 3UKQA 3UKKA 1CC2A 2E5AA 3BHFA 1IYXA 3SZFA 3A7RA 2WPEA 3K7MX 4HYRA 3NHOX 3CGEA 3AM9A 4DN1A 3BNMA 2C67A 3QFBA 4E4UA 1JNRA 4NZHA 2XCGA 2GMHA 3P3BA 2BK5A 4TM1A 3PWGA 1E9IA 4USQA 3ICRA 3NO1A 4ZCWA 2DW7A 1S7MA 4KT2A 1NU5A 2PU0A 3IJIA 4KEMA 1L9EA 1LJ1A 2C76A 1DOCA 2DKHA 2IIDA 4YWSA 4H4VA 2PU1A 4DGKA 4H4UA 3SXIA 3NS1B 2GB0A 4EMWA 2XYOA 2ZZBA 4KWSA 2W3SA 1FCDA 4TM3A 3DG3A 1DXLA 4ZCCA 1D7LA 3SM8A 5G5HB 3RITA 4GRTA 2BK3A 2VQ7A 2H88A 3K7TA 4JNAA 2XLRA 3K7QX 1GT8A 1N63C 1QJDA 5EB4A 3GSIA 3UCCA 1XHCA 3C4AA 4A5LA 3RHAA 2AAQA 3T9PA 2BACA 2BCGG 3LJPA 4D04A 3P4QA 3AWIA 4J33A 2PSNA 3FVDA 1FEAA 2OALA 1KKRA 3OPSA 1ZKQA 4JDRA 1PJ5A 1NG3A 3DIPA 1KD0A 1ZMCA 4C5OA 3NYFA 1FIQB 2W54A 1D4CA 3Q4DA 3DG6A 4A6GA 3ES8A 4HNLA 1D7YA 3ALMA 1TYTA 4H19A 5J04A 1RVKA 1DJNA 4IV9A 3UKFA 2CVJA 3KPFA 4CNKA 3DERA 4TM4A 4K2XA 2DKIA 1YQ4A 2H89A 3HPFA 3LB8A 3PG6A 1OJAA 4I59A 3T2YA 2HQMA 4EM4A 1LQUA 2XVJA 2XDOA 3D47A 3GC2A 3CNDA 4GMEA 3TW9A 4RG4A 1IUUA 4UDPA 3UGVA 3AEFA 1P48A 1E6EA 2YQUA 5FMHA 1ZXIC 4CY8A 4H2NA 4USRA 2O9ZA 1CJ4A 2PCEA 4MGGA 1PDHA 1GETA 1DTNA 5FS9A 2V3BA 3CGDA 1ZP0A 1R6WA 1CJCA 3CMMA 2MNRA 5C2TA 2DW6A 3IF9A 2YLXA 2GGHA 3QSMA 2PPGA 1YEYA 2GR1A 4HNCA 1FL2A 1TE6A 1JRPA 4H2HA 4B63A 2YAUA 2BCPA 4ICYA 1L9CA 2AL2B 1H82A 1EBDA 3P4SA 1E1LA 3ALLA 3KUMA 3RNMA 1IUWA 3VRDB 3DGHA 3T4WA 2B7RA 1RM6B 3R25A 1PBCA 3MSYA 2XFOA 3QN3A 2P8CA 4G8TA 2C3CA 3AE9A 1EBHA 3H4KA 4KPRA 2OA1A 2YR5A 2QDDA 4GDPA 3AE8A 3DH9A 1MDRA 1NHRA 5J60A 4OVIA 4JN9A 3GDNA 1GEUA 3OP2A 1ONEA 1IUSA 4EM3A 2OZTA 5FJPA 3NK1X 4J34A 1E1NA 3EF6A 4H4PA 3DA1A 1Z6LA 2AR8A 2P3ZA 4IL0A 3NKSA 1JEHA 2YG3A 2QDEA 3DJGX 3LADA 2PA6A 4E8GA 3NZGA 1E7PA 2GDQA 1ZOYA 5M0ZA 4C74A 3DG7A 3HYWA 3QJ4A 3DGBA 2C66A 3GD4A 1N61C 3L8KA 2X8CA 4K7ZA 3FJ4A 3SZCA 4UDQA 4K5SA 4H4YA 3ES7A 3SQPA 5FS6A 2FYMA 3ZLGA 1X31B 4Z44A 3LZWA 1PS9A 2W0HA 1COYA 4FK1A 3NYCA 4YTMA 3JW7A 3GO2A 4Y4NA 4C3XA 1GRHA 1JU2A 3UOVA 4EQXA 5U25A 3GRSA 5EU9A 4BK3A 1DJQA 2JAEA 3DJJA 1AOGA 2YM2A 4HB9A 1OJTA 3NRNA 1O95A 3GD3A 4E4FA 1MOKA 3ZDNA 4Z43A 4EWJA 2QA2A 4MMWA 2P8BA 4Y4LA 3ETRB 1NHPA 2V3AA 3GYXA 1ONFA 1JROA 2BABA 2C75A 3UJFA 4XWRA 3DFYA 3NK2X 4HA6A 1O5WA 2A87A 2XVIA 2C3DA 4YWOA 3QFAA 3D8XA 4H4ZA 4DSGA 4IA6A 4J2WA 2BC1A 1EL8A 3EPTA 4NEWA 1GV4A 2HNEA 3SZWA 1QO8A 3CK5A 1R0MA 2B7SA 1S2QA 4YSYA 2GR0A 4EIPA 3D9XA 4M0XA 2GGJA 3KKJA 4JY2A 5U63A 5CKUA 3B3RA 3T37A 1CHUA 3UP4A 3TWBA 3GYJA 5FS7A 1RP0A 2QAEA 2GAHB 5EBKA 4OPTA 1T3QC 2YVGA 2OZ8A 3AXBA 2QGYA 2CFYA 3B97A 4LA1A 4KPLA 2XH7A 2WOVA 1LV0A 3OZ2A 1DODA 1BWCA 2R4JA 4IVMB 2WBAA 2C64A 3UJEA 1SJBA 4A65A 1UKVG 3RR1A 2BA9A 1X2GA 3PWIA 3II4A 4B65A 2B9XA 1MXTA 3AE3A 1NELA 3QVPA 3A7UA 1CF3A 1JNZA 3ALJA 3TJ4A 4JN7A 1NHSA 4GDEA 2QJJA 3OZYA 2BYBA 2GV8A 4II2A 2WP6A 4EMJA 1S3BA 3V5FA 2ZBWA 5FJRA 4DNAA 4IZGA 5C3JA 4U8NA 2V5ZA 3V76A 3CNSA 3NVWB 3H8LA 1TKKA 2CHRA 4IL2A 3CN8A 3T14A 3NLCA 3BI4A 4HPNA 2YG4A 3UOXA 1N1PA 4E5TA 2YG6A 1KSUA 1TDOA 2RGHA 1KNPA 4TLZA 2BC0A 4BK1A 4ZN0A 3NFUA 4OPLA 1E1MA 4OPDA 3UJ2A 3IC9A 2A89A 3ATRA 3M12A 2VZ2A 2AL1A 1CC6A 4H2QA 4FP1A 2BK4A 4K8GA 5KMRA 1H84A 1TRBA 1DNCA 2GQWA 4X9MA
chains in the Genus database with same CATH topology
2YQUA 5FMHA 4CY8A 3E1TA 2VRLA 4H2NA 4NEVA 3COXA 2YM1A 3C96A 3RP6A 2XVEA 1IJHA 2WDVA 4USRA 3VRAA 4AT0A 2O9ZA 4Z26A 1CJ4A 3Q9TA 5KOWA 3B6DA 1PDHA 2B76A 1GETA 5FS9A 3F8RA 3G5RA 2V3BA 4D03A 3CGDA 1CL0A 1F8SA 5U1OA 3FIMB 1ZP0A 1ELIA 4B68A 4X4JA 1P2HA 2GR3A 1CJCA 4GAPA 3CMMA 4B64A 1FEBA 3DK4A 5C2TA 2AQJA 3T2KA 3VR8A 4H4TA 1L0VA 2WEUA 2ZZ0A 3UKHA 1OJDA 3CPHG 2VRMA 3GYIA 3IF9A 2YLXA 5HYMA 3IHGA 3QSMA 2EQ6A 1GESA 1NDAA 2C70A 1ZX9A 2GR1A 3KU9A 4U8IA 4II3A 3AE5A 3CPJG 4XWZA 4WCTA 1FL2A 3UKAA 4C3YA 5KOXA 1D4EA 2TMDA 1REOA 3UKLA 5KWFA 4B63A 2R46A 2Q7VA 2GMJA 2YAUA 2BCPA 4JQ9A 1PXCA 4ICYA 1L9CA 4U2SA 2YLSA 1Y0PA 1H82A 4H4QA 1EBDA 2F5ZA 3P4RA 3P4SA 1Y56B 4APNA 3AB1A 4H50A 1VQWA 4YT0A 1E1LA 3SGLA 4YKFA 4CCQA 2V6OA 4H4RA 3VQRA 3ALLA 3RNMA 1IUWA 5KMPA 3VRDB 3CIRA 3UCLA 4H7UA 1OJCA 3DGHA 4B67A 2B7RA 5M10A 3DMEA 3DK8A 5JCMA 1K0JA 1PBCA 2FBWA 2XFOA 1D4DA 4FK1C 1KDGA 4LU6A 3NGCX 1QLBA 3WE0A 2C3CA 1GTHA 2JB2A 1N4WA 4H4WA 3NN0X 3UKPA 3DJDA 4NTEA 2R9ZA 1JRXA 2XLTA 1KF6A 2C73A 3AE9A 1O94A 3UP5A 4AT2A 3BI5A 4XXGA 4A99A 1RSGA 4OPCA 1B8SA 2BXRA 3H4KA 3UOYA 4KPRA 5GRTA 2IVEA 2BS2A 1M6IA 2E5VA 3UOZA 3S5WA 2JKCA 3LXDA 2FJEA 1GREA 2OA1A 3UTGA 2YR5A 4Z2TA 1M64A 2XVHA 4GDPA 4CY6A 3AE8A 3DH9A 1NHRA 1IUTA 2YLZA 2IVDA 1GSNA 5J60A 4IVOB 4OVIA 1JRZA 4JN9A 3SFDA 4A79A 3AD7B 3GDNA 1GEUA 1TDFA 2VVLA 3AE7A 4REKA 5GSNA 3KA7A 1IUSA 2WS3A 4EM3A 3P1WA 1K0LA 1B4VA 3M0OA 1IUVA 3NK1X 5FS8A 2R0CA 4GAVA 4O5QA 5LV9A 3VR9A 1ZY8A 1BKWA 4J34A 4UDRA 3KD9A 4E0VA 1Q1WA 3NN6X 1E1NA 3EF6A 1CBOA 4H4PA 3DA1A 1CJ2A 1Z6LA 3O0HA 3KVEA 2AR8A 3FPZA 1VG0A 4G6HA 4RG3A 5EOWA 2Y6RA 5EB5A 2X3NA 2E4GA 2C7GA 4Z2UA 3NKSA 1GALA 1JEHA 3DGZA 2XFPA 4G9KA 2YG3A 3AEEA 3DJGX 2JB3A 1F3PA 3LADA 2YWLA 1PBDA 4LIIA 2XFNA 4TLXA 1PBEA 1PN0A 1E7PA 1DOBA 1P2EA 1ZOYA 3GWDA 4AOXA 3C4NA 2WETA 2GF3A 1H7XA 5M0ZA 5BULA 3SZ0A 1D5TA 1LPFA 1BGJA 4AP3A 3T2ZA 4U8MA 1NENA 2JBVA 2XLSA 2C72A 1H83A 2Q0KA 1H86A 2WESA 3IHMA 3IWAA 2VOUA 5HHFA 3NTAA 1CJ3A 1LVLA 3FBSA 3JSKA 4OCGA 3F8PA 1K0IA 3FG2P 1GRBA 1GRFA 3BI2A 4GCMA 3QSSA 4X9NA 4C74A 4U2TA 3M13A 4OPIA 4YSZA 3CPIG 1GOSA 1VDCA 3AE1A 3HYWA 3QJ4A 3G5SA 1PXAA 1W4XA 1KSSA 4ECHA 2TPRA 2C66A 3GD4A 5KMSA 3URHA 4K7ZA 1GRAA 2X8CA 3L8KA 4KX6A 4TM0A 3EAOA 3ZYXA 1EL9A 1NG4A 5JCNA 3SZCA 2CDUA 4CCRA 4BJZA 1VG9A 1S2YA 2FJBA 3ITJA 3L1RA 4UDQA 4K5SA 3V3OA 4YKGA 2C4CA 4H4YA 5JRBA 2WP5A 3AE6A 2EQ7A 3GRTA 2YG5A 3HYXA 4H2RA 1KN0A 4K5RA 2XFQA 3SQPA 2X50A 5FS6A 4G6GA 3PO7A 4AOSA 2V60A 1Q9IA 3S61A 1ZK7A 1ZMDA 3KLJA 1X31B 4Z44A 2R0PA 1RYIA 4GF7A 3LZWA 4A7AA 2Q6UA 2YR4A 3H8IA 1MO9A 4J56A 3CGCA 1PS9A 2Z5XA 3RP8A 1FOHA 2W0HA 2R45A 2YLWA 4AP1A 2JK6A 1H81A 1COYA 2R4EA 4FK1A 4CRTA 2GAGB 3NYCA 4YXDA 2WU2A 4OPUA 4YTMA 1Y56A 1Q1RA 4Y4NA 4U8OA 4C3XA 1H7WA 4BURA 1GRHA 3ADAB 4EMIA 1JU2A 3HYVA 4OPGA 5KNLA 1E39A 1KFYA 2XFUA 1GXFA 3UOVA 2WDRA 1PHHA 4EQXA 2PYXA 3QSEA 5U25A 4CBQA 3GRSA 1GERA 4EQWA 4BK3A 2ARDA 1PJ6A 1DJQA 2JAEA 2YR6A 3NNEA 3I3LA 2BRYA 2V61A 2VVLG 4ZCDA 3DJJA 2WDQA 2BS3A 1TDNA 4H4SA 2GVCA 1AOGA 4JNQA 5KXJA 1NHQA 1XANA 2EQ8A 2YM2A 3I6DA 4HB9A 3VRBA 2BS4A 2QCUA 1PBFA 3AD8B 1NPXA 1OJTA 2I0ZA 3NRNA 1S3EA 1KNRA 1O95A 4GUVA 3SYIA 3GD3A 3AEBA 1E1KA 1MOKA 2WOIA 4N9XA 3ZDNA 1YQZA 4YTPA 3T0KA 4DSHA 2C65A 4Z43A 3AECA 2QA2A 4UP3A 3SFEA 3Q6JA 3NH3X 5KMQA 1IUXA 4G73A 4YTNA 4J31A 4Y4LA 3UTEA 3ISHA 3LZXA 5L46A 2Z5YA 2NPXA 4PABA 1YQ3A 2WPCA 3FMWA 3GWFA 1NHPA 3V3NA 5J7XA 3UTFA 1JOAA 5IQ1A 2V3AA 5TR3A 3GYXA 1ONFA 4BJYA 2BABA 1F6MA 2C75A 4BK2A 2Y6QA 2RGOA 2GR2A 1PBBA 2WHDA 2WU5A 1F8RA 3LOVA 4XWRA 2X8GA 3NK2X 4HA6A 2GEWA 1TDKA 1YKJA 3QVRA 1O5WA 2A87A 2XVIA 2C3DA 3UKKA 3UKQA 1CC2A 1BF3A 4YWOA 3BHFA 2VVMA 3QFAA 3D8XA 3AE4A 4H4ZA 3SZFA 2WPEA 1N4UA 3K7MX 3CNTA 4IA6A 4J57A 4DSGA 3NHOX 2ACZA 2YLRA 3CGEA 3D1CA 4J2WA 2WPFA 2BC1A 4WX1A 1EL8A 3BNMA 4Z24A 2C67A 3QFBA 1JNRA 4NZHA 1VRQB 1PXBA 2UZZA 3T31A 3EPTA 4NEWA 2XCGA 1GV4A 2GMHA 3ABVA 3SZWA 1QO8A 2BK5A 1XPQA 2XVFA 4TM1A 2VQBA 2B7SA 1FECA 5KVIA 1S2QA 3UTHA 4USQA 4A9WA 3ICRA 3PVCA 4YSYA 2GR0A 2BXSA 4EIPA 3AYLA 3D9XA 3P9UA 3KKJA 4JY2A 4NTDA 5U63A 5ER0A 1EL7A 1S7MA 4H4XA 5CKUA 2B9WA 1PJ7A 2E1MA 3B3RA 3T37A 1L9EA 1CHUA 4NTCA 1LJ1A 3UP4A 4U8LA 3AEGA 3GYJA 5FS7A 1DOCA 2C76A 2DKHA 4CNJA 5JCIA 5IQ4A 1RP0A 2QAEA 2GAHB 5EBKA 4IA5A 4OPTA 4NNJA 2YVGA 2IIDA 5HY5A 2Q0LA 3AXBA 1GPEA 3PS9A 4H4VA 2CFYA 3NT6A 4FX9A 3DK9A 4I58A 3F8DA 4DGKA 4H4UA 3K30A 4LA1A 3SXIA 4A6NA 2OLOA 2WOVA 4B69A 3CNJA 2GB0A 5BVAA 1LV0A 4BV6A 3OZ2A 4YSXA 4P9SA 2J3NA 2YVFA 4EMWA 2XYOA 1DODA 2ZZBA 1F8WA 3SX6A 4U8PA 1ZDLA 4JY3A 1FCDA 1BWCA 4TM3A 2R4JA 4IVMB 4B1BA 2ZZCA 2PHHA 2WBAA 3HZLA 3AYJA 1HYUA 5KVHA 2C64A 4A6NB 1DXLA 2RABA 4Z25A 4A65A 1H6VA 1UKVG 5CQFA 1TYPA 1D7LA 2BRAA 4ZCCA 3NG7X 3SM8A 3ICTA 4EQSA 2BA9A 2GQFA 2WOWA 3CTYA 3DJEA 3BNUA 2X8HA 3II4A 4J36A 4GRTA 2BK3A 1LQTA 3EANA 1GNDA 2B9YA 2VQ7A 4B65A 2H88A 1OJ9A 3K7TA 2GH5A 1CC4A 4JNAA 2B9XA 2WQYA 1MXTA 3KPKA 1NAAA 1TDEA 3AE3A 2XLRA 4YSHA 3K7QX 3QVPA 1GT8A 1CF3A 1JNZA 1QJDA 3ALJA 5EB4A 1L9DA 4GR1A 3GSIA 5BRTA 2NVKX 1XHCA 2OAMA 3C4AA 4C77A 4EIQA 5HXIA 4A5LA 1NHSA 1V59A 4GDEA 5DBJA 4FDCB 3RHAA 2BYBA 1BGNA 2GV8A 2AAQA 4II2A 4K8DA 5JCKA 2BACA 3L5OA 1NEKA 2BCGG 2WP6A 4G74A 4EMJA 3REDA 1S3BA 3LJPA 4D04A 3G5QA 5JCLA 3GDPA 3P4QA 3AWIA 1H2IA 3NYEA 2ZBWA 3ICSA 1GRTA 4H2PA 4J33A 3AYIA 2APGA 2FJDA 4DNAA 1N4VA 1FEAA 4K22A 5C3JA 2OALA 3BHKA 2R0GA 4B66A 1ZKQA 4U8NA 5KRQA 2V5ZA 4JDRA 4Y4MA 2YLTA 1PJ5A 2RGJA 1NG3A 3V76A 3CNSA 5IPYA 3NIXA 3H8LA 2FJAA 2YG7A 1ZMCA 4C5OA 3NYFA 3CN8A 1D4CA 3T14A 3NLCA 3BI4A 1D7YA 3ALMA 2YG4A 3UOXA 2XLPA 1TYTA 1B37A 2CULA 1BZLA 4MJWA 4NWZA 3AEAA 1N1PA 3OC4A 2WP9A 3SY4A 4U8JA 2YG6A 1KSUA 1TDOA 2XLUA 4ADWA 1DJNA 2RGHA 4IV9A 3UKFA 1KNPA 4TLZA 1XDIA 2BC0A 1DOEA 4BK1A 4ZN0A 2CVJA 3KPFA 3RP7A 4CNKA 4OPLA 4O5UA 2JB1A 3AE2A 1SEZA 4U8KA 2QA1A 1E1MA 4OPDA 3R9UA 4TM4A 4K2XA 3NTDA 3IC9A 3ATQA 1EL5A 4U2LA 2A8XA 2DKIA 2A89A 3GMBA 4EQRA 1YQ4A 2H89A 3ATRA 1LTXR 3AEDA 3M12A 3LB8A 3PG6A 1OJAA 2OLNA 2VZ2A 4I59A 3T2YA 2HQMA 4EM4A 1LQUA 4PAAA 2EQ9A 1JRYA 2XVJA 1CC6A 3CNPA 4H2QA 2BK4A 2YVJA 1ZOVA 2XDOA 3AD9B 2GRTA 3CNDA 3GMCA 3CGBA 1GTEA 1GRGA 2X99A 3NK0X 5BUKA 4Z2RA 5KMRA 1H84A 4M52A 1TRBA 1YY5A 3P4PA 4RG4A 1IUUA 1K4QA 1DNCA 2GQWA 4RSLA 4UDPA 4X9MA 1B5QA 3AEFA 1E6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQU A;  5FMH A;  4CY8 A;  3E1T A;  2VRL A;  4H2N A;  4NEV A;  3COX A;  2YM1 A;  3C96 A;  3RP6 A;  2XVE A;  1IJH A;  2WDV A;  4USR A;  3VRA A;  4AT0 A;  2O9Z A;  4Z26 A;  1CJ4 A;  3Q9T A;  5KOW A;  3B6D A;  1PDH A;  2B76 A;  1GET A;  5FS9 A;  3F8R A;  3G5R A;  2V3B A;  4D03 A;  3CGD A;  1CL0 A;  1F8S A;  5U1O A;  3FIM B;  1ZP0 A;  1ELI A;  4B68 A;  4X4J A;  1P2H A;  2GR3 A;  1CJC A;  4B64 A;  1FEB A;  3DK4 A;  5C2T A;  2AQJ A;  3VR8 A;  4H4T A;  1L0V A;  2WEU A;  2ZZ0 A;  3UKH A;  1OJD A;  3CPH G;  2VRM A;  3GYI A;  3IF9 A;  2YLX A;  5HYM A;  3IHG A;  3QSM A;  2EQ6 A;  1GES A;  1NDA A;  2C70 A;  1ZX9 A;  2GR1 A;  3KU9 A;  4U8I A;  4XWZ A;  3AE5 A;  3CPJ G;  4WCT A;  1FL2 A;  3UKA A;  4C3Y A;  5KOX A;  1D4E A;  2TMD A;  1REO A;  3UKL A;  5KWF A;  4B63 A;  2R46 A;  2Q7V A;  2GMJ A;  2YAU A;  2BCP A;  4JQ9 A;  1PXC A;  4ICY A;  1L9C A;  4U2S A;  2YLS A;  1Y0P A;  1H82 A;  4H4Q A;  1EBD A;  2F5Z A;  3P4R A;  3P4S A;  1Y56 B;  4APN A;  3AB1 A;  4H50 A;  1VQW A;  4YT0 A;  1E1L A;  3SGL A;  4YKF A;  4CCQ A;  2V6O A;  4H4R A;  3VQR A;  3ALL A;  3RNM A;  1IUW A;  3VRD B;  3CIR A;  3UCL A;  4H7U A;  1OJC A;  3DGH A;  4B67 A;  2B7R A;  5M10 A;  3DME A;  3DK8 A;  5JCM A;  1K0J A;  1PBC A;  2FBW A;  2XFO A;  1D4D A;  4FK1 C;  1KDG A;  4LU6 A;  3NGC X;  1QLB A;  3WE0 A;  2C3C A;  1GTH A;  2JB2 A;  1N4W A;  4H4W A;  3NN0 X;  3UKP A;  3DJD A;  4NTE A;  2R9Z A;  1JRX A;  2XLT A;  1KF6 A;  2C73 A;  3AE9 A;  1O94 A;  3UP5 A;  4AT2 A;  3BI5 A;  4XXG A;  4A99 A;  1RSG A;  4OPC A;  1B8S A;  2BXR A;  3H4K A;  3UOY A;  4KPR A;  5GRT A;  2IVE A;  2BS2 A;  1M6I A;  2E5V A;  3UOZ A;  3S5W A;  2JKC A;  3LXD A;  2FJE A;  1GRE A;  2OA1 A;  3UTG A;  2YR5 A;  4Z2T A;  1M64 A;  2XVH A;  4GDP A;  4CY6 A;  3AE8 A;  3DH9 A;  1NHR A;  1IUT A;  2YLZ A;  2IVD A;  1GSN A;  5J60 A;  4IVO B;  4OVI A;  1JRZ A;  4JN9 A;  3SFD A;  4A79 A;  3AD7 B;  3GDN A;  1GEU A;  1TDF A;  2VVL A;  3AE7 A;  4REK A;  5GSN A;  3KA7 A;  1IUS A;  2WS3 A;  4EM3 A;  3P1W A;  1K0L A;  1B4V A;  3M0O A;  1IUV A;  3NK1 X;  5FS8 A;  2R0C A;  4O5Q A;  5LV9 A;  3VR9 A;  1ZY8 A;  1BKW A;  4J34 A;  4UDR A;  3KD9 A;  4E0V A;  1Q1W A;  3NN6 X;  1E1N A;  3EF6 A;  1CBO A;  4H4P A;  3DA1 A;  1CJ2 A;  1Z6L A;  3O0H A;  3KVE A;  2AR8 A;  3FPZ A;  1VG0 A;  4RG3 A;  5EOW A;  2Y6R A;  5EB5 A;  2X3N A;  2E4G A;  2C7G A;  4Z2U A;  3NKS A;  1GAL A;  1JEH A;  3DGZ A;  2XFP A;  2YG3 A;  3AEE A;  3DJG X;  2JB3 A;  1F3P A;  3LAD A;  2YWL A;  1PBD A;  4LII A;  2XFN A;  4TLX A;  1PBE A;  1PN0 A;  1E7P A;  1DOB A;  1P2E A;  1ZOY A;  3GWD A;  4AOX A;  3C4N A;  2WET A;  2GF3 A;  1H7X A;  5M0Z A;  5BUL A;  1D5T A;  1LPF A;  1BGJ A;  4AP3 A;  4U8M A;  1NEN A;  2JBV A;  2XLS A;  2C72 A;  1H83 A;  2Q0K A;  1H86 A;  2WES A;  3IHM A;  3IWA A;  2VOU A;  5HHF A;  3NTA A;  1CJ3 A;  1LVL A;  3FBS A;  3JSK A;  4OCG A;  3F8P A;  1K0I A;  3FG2 P;  1GRB A;  1GRF A;  3BI2 A;  4GCM A;  3QSS A;  4X9N A;  4C74 A;  4U2T A;  3M13 A;  4OPI A;  4YSZ A;  3CPI G;  1GOS A;  1VDC A;  3AE1 A;  3QJ4 A;  3G5S A;  1PXA A;  1W4X A;  1KSS A;  4ECH A;  2TPR A;  2C66 A;  3GD4 A;  3URH A;  4K7Z A;  1GRA A;  2X8C A;  3L8K A;  4KX6 A;  4TM0 A;  3EAO A;  3ZYX A;  1EL9 A;  1NG4 A;  5JCN A;  4CCR A;  2CDU A;  4BJZ A;  1VG9 A;  1S2Y A;  2FJB A;  3ITJ A;  3L1R A;  4UDQ A;  4K5S A;  3V3O A;  4YKG A;  4H4Y A;  2WP5 A;  3AE6 A;  2EQ7 A;  3GRT A;  2YG5 A;  4H2R A;  4K5R A;  2XFQ A;  3SQP A;  2X50 A;  5FS6 A;  3PO7 A;  4AOS A;  2V60 A;  1Q9I A;  3S61 A;  1ZK7 A;  1ZMD A;  3KLJ A;  1X31 B;  4Z44 A;  2R0P A;  1RYI A;  4GF7 A;  3LZW A;  4A7A A;  2Q6U A;  2YR4 A;  3H8I A;  1MO9 A;  4J56 A;  3CGC A;  1PS9 A;  2Z5X A;  3RP8 A;  1FOH A;  2W0H A;  2R45 A;  2YLW A;  4AP1 A;  2JK6 A;  1H81 A;  1COY A;  2R4E A;  4FK1 A;  4CRT A;  2GAG B;  3NYC A;  4YXD A;  2WU2 A;  4OPU A;  4YTM A;  1Y56 A;  1Q1R A;  4Y4N A;  4U8O A;  4C3X A;  1H7W A;  4BUR A;  1GRH A;  3ADA B;  4EMI A;  1JU2 A;  4OPG A;  1E39 A;  1KFY A;  2XFU A;  1GXF A;  3UOV A;  2WDR A;  1PHH A;  4EQX A;  2PYX A;  3QSE A;  5U25 A;  4CBQ A;  3GRS A;  1GER A;  4EQW A;  4BK3 A;  2ARD A;  1PJ6 A;  1DJQ A;  2JAE A;  2YR6 A;  3NNE A;  3I3L A;  2V61 A;  2VVL G;  4ZCD A;  3DJJ A;  2WDQ A;  2BS3 A;  1TDN A;  4H4S A;  2GVC A;  1AOG A;  4JNQ A;  5KXJ A;  1NHQ A;  1XAN A;  2EQ8 A;  2YM2 A;  3I6D A;  4HB9 A;  3VRB A;  2BS4 A;  2QCU A;  1PBF A;  3AD8 B;  1NPX A;  1OJT A;  2I0Z A;  3NRN A;  1S3E A;  1KNR A;  1O95 A;  4GUV A;  3GD3 A;  3AEB A;  1E1K A;  1MOK A;  2WOI A;  4N9X A;  3ZDN A;  1YQZ A;  4YTP A;  4DSH A;  2C65 A;  4Z43 A;  3AEC A;  2QA2 A;  4UP3 A;  3SFE A;  3Q6J A;  3NH3 X;  1IUX A;  4YTN A;  4J31 A;  4Y4L A;  3UTE A;  3ISH A;  3LZX A;  5L46 A;  2Z5Y A;  2NPX A;  4PAB A;  1YQ3 A;  2WPC A;  3FMW A;  3GWF A;  1NHP A;  3V3N A;  5J7X A;  3UTF A;  1JOA A;  5IQ1 A;  5TR3 A;  2V3A A;  1ONF A;  4BJY A;  2BAB A;  1F6M A;  2C75 A;  4BK2 A;  2Y6Q A;  2RGO A;  2GR2 A;  1PBB A;  2WHD A;  2WU5 A;  1F8R A;  3LOV A;  4XWR A;  2X8G A;  3NK2 X;  4HA6 A;  2GEW A;  1TDK A;  1YKJ A;  3QVR A;  1O5W A;  2A87 A;  2XVI A;  2C3D A;  3UKK A;  3UKQ A;  1CC2 A;  1BF3 A;  4YWO A;  3BHF A;  2VVM A;  3QFA A;  3D8X A;  3AE4 A;  4H4Z A;  2WPE A;  1N4U A;  3K7M X;  3CNT A;  4IA6 A;  4J57 A;  4DSG A;  3NHO X;  2ACZ A;  2YLR A;  3CGE A;  3D1C A;  4J2W A;  2WPF A;  2BC1 A;  4WX1 A;  1EL8 A;  3BNM A;  4Z24 A;  2C67 A;  3QFB A;  1JNR A;  4NZH A;  1VRQ B;  1PXB A;  2UZZ A;  3EPT A;  4NEW A;  2XCG A;  1GV4 A;  2GMH A;  3ABV A;  1QO8 A;  2BK5 A;  1XPQ A;  2XVF A;  4TM1 A;  2VQB A;  2B7S A;  1FEC A;  5KVI A;  1S2Q A;  3UTH A;  4USQ A;  4A9W A;  3ICR A;  3PVC A;  4YSY A;  2GR0 A;  2BXS A;  4EIP A;  3AYL A;  3P9U A;  3KKJ A;  4JY2 A;  4NTD A;  5U63 A;  5ER0 A;  1EL7 A;  4H4X A;  5CKU A;  2B9W A;  1PJ7 A;  2E1M A;  3B3R A;  3T37 A;  1L9E A;  1CHU A;  4NTC A;  1LJ1 A;  3UP4 A;  4U8L A;  3AEG A;  3GYJ A;  5FS7 A;  1DOC A;  2C76 A;  2DKH A;  4CNJ A;  5JCI A;  5IQ4 A;  1RP0 A;  2QAE A;  2GAH B;  5EBK A;  4IA5 A;  4OPT A;  2YVG A;  2IID A;  5HY5 A;  2Q0L A;  3AXB A;  1GPE A;  3PS9 A;  4H4V A;  2CFY A;  3NT6 A;  4FX9 A;  3DK9 A;  4I58 A;  3F8D A;  4DGK A;  4H4U A;  3K30 A;  4LA1 A;  4A6N A;  2OLO A;  2WOV A;  4B69 A;  3CNJ A;  2GB0 A;  5BVA A;  1LV0 A;  4BV6 A;  3OZ2 A;  4YSX A;  4P9S A;  2J3N A;  2YVF A;  4EMW A;  2XYO A;  1DOD A;  2ZZB A;  1F8W A;  4U8P A;  1ZDL A;  4JY3 A;  1FCD A;  1BWC A;  4TM3 A;  2R4J A;  4IVM B;  4B1B A;  2ZZC A;  2PHH A;  2WBA A;  3HZL A;  3AYJ A;  1HYU A;  5KVH A;  2C64 A;  4A6N B;  1DXL A;  2RAB A;  4Z25 A;  4A65 A;  1H6V A;  1UKV G;  5CQF A;  1TYP A;  1D7L A;  4ZCC A;  3SM8 A;  3NG7 X;  3ICT A;  4EQS A;  2BA9 A;  2GQF A;  2WOW A;  3CTY A;  3DJE A;  3BNU A;  2X8H A;  3II4 A;  4J36 A;  4GRT A;  2BK3 A;  1LQT A;  3EAN A;  1GND A;  2B9Y A;  2VQ7 A;  4B65 A;  2H88 A;  1OJ9 A;  3K7T A;  2GH5 A;  1CC4 A;  4JNA A;  2B9X A;  2WQY A;  1MXT A;  1NAA A;  1TDE A;  3AE3 A;  2XLR A;  4YSH A;  3K7Q X;  3QVP A;  1GT8 A;  1CF3 A;  1JNZ A;  1QJD A;  3ALJ A;  5EB4 A;  1L9D A;  4GR1 A;  3GSI A;  5BRT A;  2NVK X;  1XHC A;  2OAM A;  3C4A A;  4C77 A;  4EIQ A;  5HXI A;  4A5L A;  1NHS A;  1V59 A;  4GDE A;  5DBJ A;  4FDC B;  3RHA A;  2BYB A;  1BGN A;  2GV8 A;  2AAQ A;  4K8D A;  5JCK A;  2BAC A;  1NEK A;  2BCG G;  2WP6 A;  3RED A;  4EMJ A;  1S3B A;  3LJP A;  4D04 A;  3G5Q A;  5JCL A;  3GDP A;  3P4Q A;  3AWI A;  3NYE A;  2ZBW A;  3ICS A;  1GRT A;  4H2P A;  4J33 A;  3AYI A;  2APG A;  2FJD A;  4DNA A;  1N4V A;  1FEA A;  4K22 A;  5C3J A;  2OAL A;  3BHK A;  2R0G A;  4B66 A;  1ZKQ A;  4U8N A;  5KRQ A;  2V5Z A;  4JDR A;  4Y4M A;  2YLT A;  1PJ5 A;  2RGJ A;  1NG3 A;  3V76 A;  3CNS A;  5IPY A;  3NIX A;  3H8L A;  2FJA A;  2YG7 A;  1ZMC A;  4C5O A;  3NYF A;  3CN8 A;  1D4C A;  3NLC A;  3BI4 A;  1D7Y A;  3ALM A;  2YG4 A;  3UOX A;  2XLP A;  1TYT A;  1B37 A;  2CUL A;  1BZL A;  4MJW A;  3AEA A;  1N1P A;  3OC4 A;  2WP9 A;  4U8J A;  2YG6 A;  1KSU A;  1TDO A;  2XLU A;  4ADW A;  1DJN A;  2RGH A;  4IV9 A;  3UKF A;  1KNP A;  4TLZ A;  1XDI A;  2BC0 A;  1DOE A;  4BK1 A;  4ZN0 A;  2CVJ A;  3KPF A;  3RP7 A;  4CNK A;  4OPL A;  4O5U A;  2JB1 A;  3AE2 A;  1SEZ A;  4U8K A;  2QA1 A;  1E1M A;  4OPD A;  3R9U A;  4TM4 A;  4K2X A;  3NTD A;  3IC9 A;  3ATQ A;  1EL5 A;  4U2L A;  2A8X A;  2DKI A;  2A89 A;  3GMB A;  4EQR A;  1YQ4 A;  2H89 A;  3ATR A;  1LTX R;  3AED A;  3M12 A;  3LB8 A;  1OJA A;  2OLN A;  2VZ2 A;  4I59 A;  2HQM A;  4EM4 A;  1LQU A;  4PAA A;  2EQ9 A;  1JRY A;  2XVJ A;  1CC6 A;  3CNP A;  4H2Q A;  2BK4 A;  2YVJ A;  1ZOV A;  2XDO A;  3AD9 B;  2GRT A;  3CND A;  3GMC A;  3CGB A;  1GTE A;  1GRG A;  2X99 A;  3NK0 X;  5BUK A;  4Z2R A;  1H84 A;  4M52 A;  1TRB A;  1YY5 A;  3P4P A;  4RG4 A;  1IUU A;  1K4Q A;  1DNC A;  2GQW A;  4RSL A;  4UDP A;  4X9M A;  1B5Q A;  3AEF A;  1E6E A; 
#chains in the Genus database with same CATH topology
 2QQ6 A;  3COX A;  3C96 A;  4AT0 A;  1IJH A;  5KOW A;  3Q9T A;  3B6D A;  2PTX A;  4D03 A;  4GIS A;  1CL0 A;  4HCD A;  1VDV A;  3FIM B;  1ELI A;  2GR3 A;  4IT1 A;  3T2K A;  2ZZ0 A;  3UKH A;  3CPH G;  4GGB A;  3D46 A;  3MQT A;  5HYM A;  2EQ6 A;  1ZX9 A;  4Z17 A;  4U8I A;  4XWZ A;  3CPJ G;  3DES A;  4WCT A;  1W6T A;  1REO A;  5KWF A;  2Q7V A;  2W55 A;  1N5W C;  2YLS A;  2F5Z A;  4H50 A;  4YT0 A;  4YKF A;  4CCQ A;  2V6O A;  5KMP A;  3UCL A;  2OKT A;  3DK8 A;  1K0J A;  2FBW A;  2XGZ A;  2ZAD A;  4LU6 A;  2JB2 A;  3OTR A;  1N4W A;  3VFC A;  4H4W A;  3DJD A;  1BKH A;  2R9Z A;  1JRX A;  4AT2 A;  1KF6 A;  1O94 A;  4IP4 A;  2BXR A;  5GRT A;  3UOZ A;  3QLD A;  2BS2 A;  3N4F A;  3S5W A;  2JKC A;  4Z2T A;  2XVH A;  2YLZ A;  2IVD A;  1GSN A;  1ECQ A;  4E6M A;  1JRZ A;  3SFD A;  3AD7 B;  4REK A;  2VVL A;  3AE7 A;  3KA7 A;  1K0L A;  1KKO A;  1XS2 A;  4E0V A;  1BKW A;  4UDR A;  3O0H A;  3KVE A;  4G6H A;  5EB5 A;  2XFP A;  5BOF A;  3AEE A;  4LII A;  1PBE A;  1DOB A;  1P2E A;  2WET A;  3AMZ A;  4TVW A;  1FFU C;  1LPF A;  4AP3 A;  4U8M A;  1NEN A;  4TVY A;  2JBV A;  2Q0K A;  3IWA A;  2P0I A;  1LVL A;  3R07 C;  3FBS A;  1GRF A;  4GCM A;  4U2T A;  4MKS A;  3CPI G;  1VDC A;  1KSS A;  5KMS A;  4KX6 A;  4TM0 A;  3ZYX A;  1EL9 A;  1NG4 A;  1VG9 A;  3L1R A;  4YKG A;  2EQ7 A;  3GRT A;  4K5R A;  3PO7 A;  4AOS A;  2V60 A;  1Q9I A;  1ZK7 A;  1ZMD A;  2R0P A;  4GF7 A;  3IJL A;  4A7A A;  3ZVH B;  4J56 A;  2Z5X A;  2RDX A;  4J3Z A;  1FOH A;  2R45 A;  2R4E A;  3HW2 A;  2AL2 A;  3UCD A;  2ZC8 A;  3NRZ B;  5KNL A;  1GXF A;  2PYX A;  2ARD A;  3NNE A;  3V3W A;  3H8A A;  2BS3 A;  5KXJ A;  2QJM A;  3I6D A;  2BS4 A;  3VDG A;  3AD8 B;  1NPX A;  3EUB 3;  4F4R A;  1KNR A;  2WOI A;  3T0K A;  3CT2 A;  2C65 A;  3AEC A;  4UP3 A;  5KMQ A;  1IUX A;  5FJO A;  4G73 A;  3STP A;  3LZX A;  5L46 A;  3V3N A;  3GWF A;  2O56 A;  3UTF A;  5TR3 A;  3MWC A;  4BJY A;  1F6M A;  2Y6Q A;  2RGO A;  2WU5 A;  3LOV A;  1F8R A;  2GEW A;  3H70 A;  3NVV B;  3AE4 A;  1N4U A;  3CNT A;  2ACZ A;  2PS2 A;  3D1C A;  3TTE A;  4M6U A;  3S5S A;  2WPF A;  1EC8 A;  4Z24 A;  3T31 A;  2XVF A;  3ZLH A;  2VQB A;  1FEC A;  1SJD A;  1MDL A;  5KVI A;  3UTH A;  3AYL A;  4NTD A;  3P0W A;  3CXB A;  5ER0 A;  4H4X A;  3B9J B;  2B9W A;  6ENL A;  3JVA A;  4U8L A;  4CNJ A;  3I6E A;  1V97 A;  2OG9 A;  2Q0L A;  1GPE A;  3DK9 A;  4I58 A;  3K30 A;  4B69 A;  4BV6 A;  4YSX A;  3FYY A;  3SX6 A;  4JY3 A;  3GY1 A;  4B1B A;  3AYJ A;  1HYU A;  4IHC A;  5KVH A;  4Z25 A;  2RAB A;  3DFH A;  5CQF A;  1TYP A;  3NG7 X;  3ICT A;  4EQS A;  3DJE A;  2WOW A;  3CTY A;  3BNU A;  4J36 A;  1GND A;  1SJC A;  1CC4 A;  3KPK A;  2WQY A;  1NAA A;  4ROP A;  1TDE A;  4YSH A;  1L9D A;  3K1G A;  2PGW A;  3R0K A;  4C77 A;  5HXI A;  5DBJ A;  4FDC B;  3V5C A;  3T6C A;  1BGN A;  1PDZ A;  4K8D A;  5JCK A;  3L5O A;  1NEK A;  3RED A;  3PK7 A;  3Q45 A;  3GDP A;  1H2I A;  3VCN A;  3ICS A;  3VA8 A;  2OQY A;  2R0G A;  4B66 A;  3TCS A;  3QTP A;  5IDZ A;  4DHG A;  3CYJ A;  2PTW A;  2XLP A;  1B37 A;  2CUL A;  3AEA A;  3OC4 A;  3R0U A;  3SY4 A;  4HN8 A;  2XLU A;  2GL5 A;  1FO4 A;  4ADW A;  2GGI A;  2PTY A;  1DOE A;  2JB1 A;  3V4B A;  4U8K A;  3IK4 A;  1MRA A;  3ATQ A;  3GMB A;  3AED A;  3R1Z A;  3CNP A;  2YVJ A;  1ZOV A;  3AD9 B;  2GRT A;  3GMC A;  3CGB A;  3NK0 X;  1GRG A;  4Z2R A;  1YY5 A;  5BOE A;  1K4Q A;  4RSL A;  1EC9 A;  3E1T A;  4NEV A;  2XVE A;  4DXK A;  2WDV A;  4Z26 A;  2MUC A;  3F8R A;  2GGE A;  1F8S A;  2GGG A;  4B68 A;  4X4J A;  3DDM A;  4B64 A;  2AQJ A;  3VR8 A;  4H4T A;  1L0V A;  2WEU A;  1OJD A;  3RGT A;  3GYI A;  1P43 A;  1GES A;  4K2S A;  2HXU A;  2C70 A;  3AE5 A;  4C3Y A;  1D4E A;  2TMD A;  3CXO A;  3UKL A;  3SQS A;  2R46 A;  1PXC A;  4U2S A;  3SN0 A;  1Y0P A;  1Y56 B;  5FJT A;  3AB1 A;  3P93 A;  1VQW A;  4H4R A;  1N62 C;  3MY9 A;  1OJC A;  4B67 A;  4DWD A;  5JCM A;  3H12 A;  1KDG A;  3NGC X;  1QLB A;  3UKP A;  2C73 A;  4A99 A;  1RSG A;  4OPC A;  2OO6 A;  1KCZ A;  3UOY A;  2E5V A;  1M6I A;  2FJE A;  1GRE A;  3UTG A;  2P88 A;  4CY6 A;  2NQL A;  4K1W A;  4A79 A;  1TDF A;  4JN8 A;  3MKC A;  2WS3 A;  3P1W A;  1MNS A;  4DYE A;  3M0O A;  1IUV A;  4O5Q A;  3VR9 A;  1Q1W A;  3NN6 X;  1CJ2 A;  3FPZ A;  1VG0 A;  4RG3 A;  2Y6R A;  2C7G A;  3DGZ A;  1F3P A;  1FFV C;  4TLX A;  3OZM A;  1PN0 A;  1H7X A;  5BUL A;  3SZ0 A;  1D5T A;  1BGJ A;  3T2Z A;  3AN1 A;  2C72 A;  3IHM A;  5HHF A;  2VOU A;  1CJ3 A;  4HCL A;  3UJR A;  3JSK A;  4OCG A;  3FG2 P;  2AKZ A;  3BI2 A;  2FKP A;  4X9N A;  4YSZ A;  1PXA A;  1W4X A;  4ECH A;  1GRA A;  2PTZ A;  1X2H A;  5JCN A;  4BJZ A;  1S2Y A;  2FJB A;  3UJS A;  3ITJ A;  3V3O A;  2C4C A;  5JRB A;  2WP5 A;  1KN0 A;  2XFQ A;  2X50 A;  4G6G A;  3FCP A;  3S61 A;  7ENL A;  3KLJ A;  3BSM A;  3DEQ A;  1FHV A;  2Q6U A;  1MO9 A;  3RP8 A;  4CRT A;  2GAG B;  1N60 C;  3ZLF A;  4BUR A;  4EMI A;  4OPG A;  1E39 A;  2XFU A;  2E3T A;  2WDR A;  3QSE A;  4A3R A;  3EEZ A;  4CBQ A;  4ZCD A;  3I3L A;  2BRY A;  1OEP A;  3SJN A;  2XH4 A;  2WDQ A;  4H4S A;  3VCC A;  2GVC A;  1NHQ A;  1XAN A;  2EQ8 A;  2OQH A;  1JCT A;  3VRB A;  3GD6 A;  1PBF A;  2QCU A;  1S3E A;  4GUV A;  3SYI A;  3AEB A;  4G7F A;  4YTP A;  3SFE A;  3Q6J A;  4YTN A;  4J31 A;  3UTE A;  3ISH A;  3FMW A;  2WPC A;  1JOA A;  3MUC A;  1PBB A;  2X8G A;  4H1Z A;  3RO6 A;  1YKJ A;  3QVR A;  1BF3 A;  1JDF A;  2VVM A;  3S47 A;  1EBG A;  3FV9 A;  4J57 A;  2YLR A;  3FXG A;  3HRD C;  4WX1 A;  1JPM A;  1VRQ B;  1PXB A;  2UZZ A;  3ABV A;  1XPQ A;  4A9W A;  1FHU A;  3PVC A;  2BXS A;  3P9U A;  1EL7 A;  3NXL A;  1PJ7 A;  2E1M A;  3UXK A;  4NTC A;  3AEG A;  5IQ4 A;  5JCI A;  4IA5 A;  4NNJ A;  5HY5 A;  2OLA A;  3PS9 A;  3ZVH A;  3NT6 A;  4FX9 A;  3F8D A;  4A6N A;  2OLO A;  2PP0 A;  3CNJ A;  5BVA A;  4P9S A;  2J3N A;  2YVF A;  1F8W A;  2W3R A;  4U8P A;  2XSX A;  1ZDL A;  3T8Q A;  3SN4 A;  2ZZC A;  2PHH A;  3HZL A;  4A6N B;  4GIR A;  1H6V A;  2BRA A;  3TJI A;  2GQF A;  4ENL A;  2X8H A;  1LQT A;  3EAN A;  2B9Y A;  1SB3 B;  1F9C A;  1OJ9 A;  2GH5 A;  2AKM A;  1VQZ A;  3PFR A;  4GR1 A;  3IJQ A;  5BRT A;  2OPJ A;  3ENL A;  3BOX A;  2NVK X;  2OAM A;  4EIQ A;  1V59 A;  3THU A;  2OFJ A;  1JPD X;  4G74 A;  3G5Q A;  2POD A;  5JCL A;  3NYE A;  3NVZ B;  4H2P A;  1GRT A;  4Z1Y A;  3AYI A;  2APG A;  2FJD A;  1STZ A;  1N4V A;  4K22 A;  3BHK A;  3RRA A;  5KRQ A;  3TQP A;  4Y4M A;  2YLT A;  3EKG A;  2RGJ A;  3VC6 A;  5IPY A;  3MZN A;  3UXL A;  3NIX A;  4ZA0 A;  2FJA A;  3R10 A;  2YG7 A;  4NWZ A;  1BZL A;  4MJW A;  2WP9 A;  4U8J A;  1XDI A;  3RP7 A;  4O5U A;  3AE2 A;  1SEZ A;  2QA1 A;  3R9U A;  3NTD A;  4A35 A;  4U2L A;  1EL5 A;  2A8X A;  4EQR A;  1LTX R;  2OLN A;  3SR6 B;  4PAA A;  2EQ9 A;  1JRY A;  1L8P A;  1GTE A;  5BUK A;  2X99 A;  4J1O A;  4M52 A;  3P4P A;  4JHM A;  1B5Q A;  2VRL A;  2YM1 A;  3RP6 A;  3VRA A;  1MUC A;  2B76 A;  1PDY A;  3G5R A;  2OX4 A;  2QJN A;  5U1O A;  3SSZ A;  3TWA A;  1P2H A;  4GAP A;  1FEB A;  3DK4 A;  2VRM A;  3IHG A;  5G5G B;  1NDA A;  3KU9 A;  4II3 A;  2XH2 A;  3UKA A;  5KOX A;  3OW1 A;  3QKE A;  2GMJ A;  4JQ9 A;  3SN1 A;  4H4Q A;  3P4R A;  4APN A;  3SGL A;  3VQR A;  3U9I A;  4GGH A;  3N4E A;  3CIR A;  4H7U A;  5M10 A;  3DME A;  1D4D A;  4FK1 C;  3JZU A;  2HZG A;  3WE0 A;  1GTH A;  3NN0 X;  4NTE A;  2XLT A;  1EC7 A;  1ELS A;  3UP5 A;  3BI5 A;  3H7V A;  4XXG A;  1B8S A;  2GSH A;  2IVE A;  2PGE A;  3LXD A;  1M64 A;  3TOY A;  1IUT A;  4IVO B;  5GSN A;  2ONE A;  1B4V A;  4GAV A;  5FS8 A;  2R0C A;  3I4K A;  5LV9 A;  2OVL A;  2QVH A;  1ZY8 A;  3KD9 A;  1CBO A;  3CB3 A;  5EOW A;  2X3N A;  2E4G A;  4Z2U A;  1GAL A;  4G9K A;  2JB3 A;  1SJA A;  2YWL A;  1PBD A;  2XFN A;  3SBF A;  4AOX A;  3GWD A;  3C4N A;  2PP3 A;  2GF3 A;  3BJS A;  1N5X A;  3U4F A;  1WYG A;  2HXT A;  3A7A A;  2I5Q A;  2XLS A;  1H83 A;  2WES A;  1H86 A;  3NTA A;  3F8P A;  1K0I A;  1GRB A;  2XH0 A;  3QSS A;  3M13 A;  4OPI A;  1GOS A;  3AE1 A;  3G5S A;  2TPR A;  1XPY A;  3URH A;  3EAO A;  3R11 A;  3VC5 A;  4CCR A;  2CDU A;  4FI4 A;  3QPE A;  3AE6 A;  2YG5 A;  3HYX A;  4H2R A;  3ZVI A;  2OZ3 A;  4X2P A;  4ZOH B;  1WUE A;  1RYI A;  3N6H A;  4GFI A;  2POZ A;  2YR4 A;  3H8I A;  4H83 A;  3CGC A;  2YLW A;  4AP1 A;  3I6T A;  2JK6 A;  1H81 A;  4YXD A;  3N6J A;  2WU2 A;  4OPU A;  1Y56 A;  1Q1R A;  4U8O A;  1H7W A;  3ADA B;  3HYV A;  1TZZ A;  1KFY A;  4IP5 A;  1PHH A;  1GER A;  4EQW A;  1PJ6 A;  1BQG A;  3NVY B;  2YR6 A;  2V61 A;  2VVL G;  1WUF A;  2PP1 A;  1TDN A;  5ENL A;  4JNQ A;  4GYP A;  2I0Z A;  4HCH A;  5FJU A;  1E1K A;  4N9X A;  1YQZ A;  4DSH A;  3NH3 X;  2Z5Y A;  2NPX A;  3RCY A;  4PAB A;  1YQ3 A;  4DX3 A;  5J7X A;  5IQ1 A;  3CAW A;  4BK2 A;  4GYP C;  2GR2 A;  2WHD A;  1TDK A;  2PMQ A;  3UKQ A;  3UKK A;  1CC2 A;  2E5A A;  3BHF A;  1IYX A;  3SZF A;  3A7R A;  2WPE A;  3K7M X;  4HYR A;  3NHO X;  3CGE A;  3AM9 A;  4DN1 A;  3BNM A;  2C67 A;  3QFB A;  4E4U A;  1JNR A;  4NZH A;  2XCG A;  2GMH A;  3P3B A;  2BK5 A;  4TM1 A;  3PWG A;  1E9I A;  4USQ A;  3ICR A;  3NO1 A;  4ZCW A;  2DW7 A;  1S7M A;  4KT2 A;  1NU5 A;  2PU0 A;  3IJI A;  4KEM A;  1L9E A;  1LJ1 A;  2C76 A;  1DOC A;  2DKH A;  2IID A;  4YWS A;  4H4V A;  2PU1 A;  4DGK A;  4H4U A;  3SXI A;  3NS1 B;  2GB0 A;  4EMW A;  2XYO A;  2ZZB A;  4KWS A;  2W3S A;  1FCD A;  4TM3 A;  3DG3 A;  1DXL A;  4ZCC A;  1D7L A;  3SM8 A;  5G5H B;  3RIT A;  4GRT A;  2BK3 A;  2VQ7 A;  2H88 A;  3K7T A;  4JNA A;  2XLR A;  3K7Q X;  1GT8 A;  1N63 C;  1QJD A;  5EB4 A;  3GSI A;  3UCC A;  1XHC A;  3C4A A;  4A5L A;  3RHA A;  2AAQ A;  3T9P A;  2BAC A;  2BCG G;  3LJP A;  4D04 A;  3P4Q A;  3AWI A;  4J33 A;  2PSN A;  3FVD A;  1FEA A;  2OAL A;  1KKR A;  3OPS A;  1ZKQ A;  4JDR A;  1PJ5 A;  1NG3 A;  3DIP A;  1KD0 A;  1ZMC A;  4C5O A;  3NYF A;  1FIQ B;  2W54 A;  1D4C A;  3Q4D A;  3DG6 A;  4A6G A;  3ES8 A;  4HNL A;  1D7Y A;  3ALM A;  1TYT A;  4H19 A;  5J04 A;  1RVK A;  1DJN A;  4IV9 A;  3UKF A;  2CVJ A;  3KPF A;  4CNK A;  3DER A;  4TM4 A;  4K2X A;  2DKI A;  1YQ4 A;  2H89 A;  3HPF A;  3LB8 A;  3PG6 A;  1OJA A;  4I59 A;  3T2Y A;  2HQM A;  4EM4 A;  1LQU A;  2XVJ A;  2XDO A;  3D47 A;  3GC2 A;  3CND A;  4GME A;  3TW9 A;  4RG4 A;  1IUU A;  4UDP A;  3UGV A;  3AEF A;  1P48 A;  1E6E A;  2YQU A;  5FMH A;  1ZXI C;  4CY8 A;  4H2N A;  4USR A;  2O9Z A;  1CJ4 A;  2PCE A;  4MGG A;  1PDH A;  1GET A;  1DTN A;  5FS9 A;  2V3B A;  3CGD A;  1ZP0 A;  1R6W A;  1CJC A;  3CMM A;  2MNR A;  5C2T A;  2DW6 A;  3IF9 A;  2YLX A;  2GGH A;  3QSM A;  2PPG A;  1YEY A;  2GR1 A;  4HNC A;  1FL2 A;  1TE6 A;  1JRP A;  4H2H A;  4B63 A;  2YAU A;  2BCP A;  4ICY A;  1L9C A;  2AL2 B;  1H82 A;  1EBD A;  3P4S A;  1E1L A;  3ALL A;  3KUM A;  3RNM A;  1IUW A;  3VRD B;  3DGH A;  3T4W A;  2B7R A;  1RM6 B;  3R25 A;  1PBC A;  3MSY A;  2XFO A;  3QN3 A;  2P8C A;  4G8T A;  2C3C A;  3AE9 A;  1EBH A;  3H4K A;  4KPR A;  2OA1 A;  2YR5 A;  2QDD A;  4GDP A;  3AE8 A;  3DH9 A;  1MDR A;  1NHR A;  5J60 A;  4OVI A;  4JN9 A;  3GDN A;  1GEU A;  3OP2 A;  1ONE A;  1IUS A;  4EM3 A;  2OZT A;  5FJP A;  3NK1 X;  4J34 A;  1E1N A;  3EF6 A;  4H4P A;  3DA1 A;  1Z6L A;  2AR8 A;  2P3Z A;  4IL0 A;  3NKS A;  1JEH A;  2YG3 A;  2QDE A;  3DJG X;  3LAD A;  2PA6 A;  4E8G A;  3NZG A;  1E7P A;  2GDQ A;  1ZOY A;  5M0Z A;  4C74 A;  3DG7 A;  3HYW A;  3QJ4 A;  3DGB A;  2C66 A;  3GD4 A;  1N61 C;  3L8K A;  2X8C A;  4K7Z A;  3FJ4 A;  3SZC A;  4UDQ A;  4K5S A;  4H4Y A;  3ES7 A;  3SQP A;  5FS6 A;  2FYM A;  3ZLG A;  1X31 B;  4Z44 A;  3LZW A;  1PS9 A;  2W0H A;  1COY A;  4FK1 A;  3NYC A;  4YTM A;  3JW7 A;  3GO2 A;  4Y4N A;  4C3X A;  1GRH A;  1JU2 A;  3UOV A;  4EQX A;  5U25 A;  3GRS A;  5EU9 A;  4BK3 A;  1DJQ A;  2JAE A;  3DJJ A;  1AOG A;  2YM2 A;  4HB9 A;  1OJT A;  3NRN A;  1O95 A;  3GD3 A;  4E4F A;  1MOK A;  3ZDN A;  4Z43 A;  4EWJ A;  2QA2 A;  4MMW A;  2P8B A;  4Y4L A;  3ETR B;  1NHP A;  2V3A A;  3GYX A;  1ONF A;  1JRO A;  2BAB A;  2C75 A;  3UJF A;  4XWR A;  3DFY A;  3NK2 X;  4HA6 A;  1O5W A;  2A87 A;  2XVI A;  2C3D A;  4YWO A;  3QFA A;  3D8X A;  4H4Z A;  4DSG A;  4IA6 A;  4J2W A;  2BC1 A;  1EL8 A;  3EPT A;  4NEW A;  1GV4 A;  2HNE A;  3SZW A;  1QO8 A;  3CK5 A;  1R0M A;  2B7S A;  1S2Q A;  4YSY A;  2GR0 A;  4EIP A;  3D9X A;  4M0X A;  2GGJ A;  3KKJ A;  4JY2 A;  5U63 A;  5CKU A;  3B3R A;  3T37 A;  1CHU A;  3UP4 A;  3TWB A;  3GYJ A;  5FS7 A;  1RP0 A;  2QAE A;  2GAH B;  5EBK A;  4OPT A;  1T3Q C;  2YVG A;  2OZ8 A;  3AXB A;  2QGY A;  2CFY A;  3B97 A;  4LA1 A;  4KPL A;  2XH7 A;  2WOV A;  1LV0 A;  3OZ2 A;  1DOD A;  1BWC A;  2R4J A;  4IVM B;  2WBA A;  2C64 A;  3UJE A;  1SJB A;  4A65 A;  1UKV G;  3RR1 A;  2BA9 A;  1X2G A;  3PWI A;  3II4 A;  4B65 A;  2B9X A;  1MXT A;  3AE3 A;  1NEL A;  3QVP A;  3A7U A;  1CF3 A;  1JNZ A;  3ALJ A;  3TJ4 A;  4JN7 A;  1NHS A;  4GDE A;  2QJJ A;  3OZY A;  2BYB A;  2GV8 A;  4II2 A;  2WP6 A;  4EMJ A;  1S3B A;  3V5F A;  2ZBW A;  5FJR A;  4DNA A;  4IZG A;  5C3J A;  4U8N A;  2V5Z A;  3V76 A;  3CNS A;  3NVW B;  3H8L A;  1TKK A;  2CHR A;  4IL2 A;  3CN8 A;  3T14 A;  3NLC A;  3BI4 A;  4HPN A;  2YG4 A;  3UOX A;  1N1P A;  4E5T A;  2YG6 A;  1KSU A;  1TDO A;  2RGH A;  1KNP A;  4TLZ A;  2BC0 A;  4BK1 A;  4ZN0 A;  3NFU A;  4OPL A;  1E1M A;  4OPD A;  3UJ2 A;  3IC9 A;  2A89 A;  3ATR A;  3M12 A;  2VZ2 A;  2AL1 A;  1CC6 A;  4H2Q A;  4FP1 A;  2BK4 A;  4K8G A;  5KMR A;  1H84 A;  1TRB A;  1DNC A;  2GQW A;  4X9M A; 
#chains in the Genus database with same CATH homology
 2YQU A;  5FMH A;  4CY8 A;  3E1T A;  2VRL A;  4H2N A;  4NEV A;  3COX A;  2YM1 A;  3C96 A;  3RP6 A;  2XVE A;  1IJH A;  2WDV A;  4USR A;  3VRA A;  4AT0 A;  2O9Z A;  4Z26 A;  1CJ4 A;  3Q9T A;  5KOW A;  3B6D A;  1PDH A;  2B76 A;  1GET A;  5FS9 A;  3F8R A;  3G5R A;  2V3B A;  4D03 A;  3CGD A;  1CL0 A;  1F8S A;  5U1O A;  3FIM B;  1ZP0 A;  1ELI A;  4B68 A;  4X4J A;  1P2H A;  2GR3 A;  1CJC A;  4GAP A;  3CMM A;  4B64 A;  1FEB A;  3DK4 A;  5C2T A;  2AQJ A;  3T2K A;  3VR8 A;  4H4T A;  1L0V A;  2WEU A;  2ZZ0 A;  3UKH A;  1OJD A;  3CPH G;  2VRM A;  3GYI A;  3IF9 A;  2YLX A;  5HYM A;  3IHG A;  3QSM A;  2EQ6 A;  1GES A;  1NDA A;  2C70 A;  1ZX9 A;  2GR1 A;  3KU9 A;  4U8I A;  4II3 A;  3AE5 A;  3CPJ G;  4XWZ A;  4WCT A;  1FL2 A;  3UKA A;  4C3Y A;  5KOX A;  1D4E A;  2TMD A;  1REO A;  3UKL A;  5KWF A;  4B63 A;  2R46 A;  2Q7V A;  2GMJ A;  2YAU A;  2BCP A;  4JQ9 A;  1PXC A;  4ICY A;  1L9C A;  4U2S A;  2YLS A;  1Y0P A;  1H82 A;  4H4Q A;  1EBD A;  2F5Z A;  3P4R A;  3P4S A;  1Y56 B;  4APN A;  3AB1 A;  4H50 A;  1VQW A;  4YT0 A;  1E1L A;  3SGL A;  4YKF A;  4CCQ A;  2V6O A;  4H4R A;  3VQR A;  3ALL A;  3RNM A;  1IUW A;  5KMP A;  3VRD B;  3CIR A;  3UCL A;  4H7U A;  1OJC A;  3DGH A;  4B67 A;  2B7R A;  5M10 A;  3DME A;  3DK8 A;  5JCM A;  1K0J A;  1PBC A;  2FBW A;  2XFO A;  1D4D A;  4FK1 C;  1KDG A;  4LU6 A;  3NGC X;  1QLB A;  3WE0 A;  2C3C A;  1GTH A;  2JB2 A;  1N4W A;  4H4W A;  3NN0 X;  3UKP A;  3DJD A;  4NTE A;  2R9Z A;  1JRX A;  2XLT A;  1KF6 A;  2C73 A;  3AE9 A;  1O94 A;  3UP5 A;  4AT2 A;  3BI5 A;  4XXG A;  4A99 A;  1RSG A;  4OPC A;  1B8S A;  2BXR A;  3H4K A;  3UOY A;  4KPR A;  5GRT A;  2IVE A;  2BS2 A;  1M6I A;  2E5V A;  3UOZ A;  3S5W A;  2JKC A;  3LXD A;  2FJE A;  1GRE A;  2OA1 A;  3UTG A;  2YR5 A;  4Z2T A;  1M64 A;  2XVH A;  4GDP A;  4CY6 A;  3AE8 A;  3DH9 A;  1NHR A;  1IUT A;  2YLZ A;  2IVD A;  1GSN A;  5J60 A;  4IVO B;  4OVI A;  1JRZ A;  4JN9 A;  3SFD A;  4A79 A;  3AD7 B;  3GDN A;  1GEU A;  1TDF A;  2VVL A;  3AE7 A;  4REK A;  5GSN A;  3KA7 A;  1IUS A;  2WS3 A;  4EM3 A;  3P1W A;  1K0L A;  1B4V A;  3M0O A;  1IUV A;  3NK1 X;  5FS8 A;  2R0C A;  4GAV A;  4O5Q A;  5LV9 A;  3VR9 A;  1ZY8 A;  1BKW A;  4J34 A;  4UDR A;  3KD9 A;  4E0V A;  1Q1W A;  3NN6 X;  1E1N A;  3EF6 A;  1CBO A;  4H4P A;  3DA1 A;  1CJ2 A;  1Z6L A;  3O0H A;  3KVE A;  2AR8 A;  3FPZ A;  1VG0 A;  4G6H A;  4RG3 A;  5EOW A;  2Y6R A;  5EB5 A;  2X3N A;  2E4G A;  2C7G A;  4Z2U A;  3NKS A;  1GAL A;  1JEH A;  3DGZ A;  2XFP A;  4G9K A;  2YG3 A;  3AEE A;  3DJG X;  2JB3 A;  1F3P A;  3LAD A;  2YWL A;  1PBD A;  4LII A;  2XFN A;  4TLX A;  1PBE A;  1PN0 A;  1E7P A;  1DOB A;  1P2E A;  1ZOY A;  3GWD A;  4AOX A;  3C4N A;  2WET A;  2GF3 A;  1H7X A;  5M0Z A;  5BUL A;  3SZ0 A;  1D5T A;  1LPF A;  1BGJ A;  4AP3 A;  3T2Z A;  4U8M A;  1NEN A;  2JBV A;  2XLS A;  2C72 A;  1H83 A;  2Q0K A;  1H86 A;  2WES A;  3IHM A;  3IWA A;  2VOU A;  5HHF A;  3NTA A;  1CJ3 A;  1LVL A;  3FBS A;  3JSK A;  4OCG A;  3F8P A;  1K0I A;  3FG2 P;  1GRB A;  1GRF A;  3BI2 A;  4GCM A;  3QSS A;  4X9N A;  4C74 A;  4U2T A;  3M13 A;  4OPI A;  4YSZ A;  3CPI G;  1GOS A;  1VDC A;  3AE1 A;  3HYW A;  3QJ4 A;  3G5S A;  1PXA A;  1W4X A;  1KSS A;  4ECH A;  2TPR A;  2C66 A;  3GD4 A;  5KMS A;  3URH A;  4K7Z A;  1GRA A;  2X8C A;  3L8K A;  4KX6 A;  4TM0 A;  3EAO A;  3ZYX A;  1EL9 A;  1NG4 A;  5JCN A;  3SZC A;  2CDU A;  4CCR A;  4BJZ A;  1VG9 A;  1S2Y A;  2FJB A;  3ITJ A;  3L1R A;  4UDQ A;  4K5S A;  3V3O A;  4YKG A;  2C4C A;  4H4Y A;  5JRB A;  2WP5 A;  3AE6 A;  2EQ7 A;  3GRT A;  2YG5 A;  3HYX A;  4H2R A;  1KN0 A;  4K5R A;  2XFQ A;  3SQP A;  2X50 A;  5FS6 A;  4G6G A;  3PO7 A;  4AOS A;  2V60 A;  1Q9I A;  3S61 A;  1ZK7 A;  1ZMD A;  3KLJ A;  1X31 B;  4Z44 A;  2R0P A;  1RYI A;  4GF7 A;  3LZW A;  4A7A A;  2Q6U A;  2YR4 A;  3H8I A;  1MO9 A;  4J56 A;  3CGC A;  1PS9 A;  2Z5X A;  3RP8 A;  1FOH A;  2W0H A;  2R45 A;  2YLW A;  4AP1 A;  2JK6 A;  1H81 A;  1COY A;  2R4E A;  4FK1 A;  4CRT A;  2GAG B;  3NYC A;  4YXD A;  2WU2 A;  4OPU A;  4YTM A;  1Y56 A;  1Q1R A;  4Y4N A;  4U8O A;  4C3X A;  1H7W A;  4BUR A;  1GRH A;  3ADA B;  4EMI A;  1JU2 A;  3HYV A;  4OPG A;  5KNL A;  1E39 A;  1KFY A;  2XFU A;  1GXF A;  3UOV A;  2WDR A;  1PHH A;  4EQX A;  2PYX A;  3QSE A;  5U25 A;  4CBQ A;  3GRS A;  1GER A;  4EQW A;  4BK3 A;  2ARD A;  1PJ6 A;  1DJQ A;  2JAE A;  2YR6 A;  3NNE A;  3I3L A;  2BRY A;  2V61 A;  2VVL G;  4ZCD A;  3DJJ A;  2WDQ A;  2BS3 A;  1TDN A;  4H4S A;  2GVC A;  1AOG A;  4JNQ A;  5KXJ A;  1NHQ A;  1XAN A;  2EQ8 A;  2YM2 A;  3I6D A;  4HB9 A;  3VRB A;  2BS4 A;  2QCU A;  1PBF A;  3AD8 B;  1NPX A;  1OJT A;  2I0Z A;  3NRN A;  1S3E A;  1KNR A;  1O95 A;  4GUV A;  3SYI A;  3GD3 A;  3AEB A;  1E1K A;  1MOK A;  2WOI A;  4N9X A;  3ZDN A;  1YQZ A;  4YTP A;  3T0K A;  4DSH A;  2C65 A;  4Z43 A;  3AEC A;  2QA2 A;  4UP3 A;  3SFE A;  3Q6J A;  3NH3 X;  5KMQ A;  1IUX A;  4G73 A;  4YTN A;  4J31 A;  4Y4L A;  3UTE A;  3ISH A;  3LZX A;  5L46 A;  2Z5Y A;  2NPX A;  4PAB A;  1YQ3 A;  2WPC A;  3FMW A;  3GWF A;  1NHP A;  3V3N A;  5J7X A;  3UTF A;  1JOA A;  5IQ1 A;  2V3A A;  5TR3 A;  3GYX A;  1ONF A;  4BJY A;  2BAB A;  1F6M A;  2C75 A;  4BK2 A;  2Y6Q A;  2RGO A;  2GR2 A;  1PBB A;  2WHD A;  2WU5 A;  1F8R A;  3LOV A;  4XWR A;  2X8G A;  3NK2 X;  4HA6 A;  2GEW A;  1TDK A;  1YKJ A;  3QVR A;  1O5W A;  2A87 A;  2XVI A;  2C3D A;  3UKK A;  3UKQ A;  1CC2 A;  1BF3 A;  4YWO A;  3BHF A;  2VVM A;  3QFA A;  3D8X A;  3AE4 A;  4H4Z A;  3SZF A;  2WPE A;  1N4U A;  3K7M X;  3CNT A;  4IA6 A;  4J57 A;  4DSG A;  3NHO X;  2ACZ A;  2YLR A;  3CGE A;  3D1C A;  4J2W A;  2WPF A;  2BC1 A;  4WX1 A;  1EL8 A;  3BNM A;  4Z24 A;  2C67 A;  3QFB A;  1JNR A;  4NZH A;  1VRQ B;  1PXB A;  2UZZ A;  3T31 A;  3EPT A;  4NEW A;  2XCG A;  1GV4 A;  2GMH A;  3ABV A;  3SZW A;  1QO8 A;  2BK5 A;  1XPQ A;  2XVF A;  4TM1 A;  2VQB A;  2B7S A;  1FEC A;  5KVI A;  1S2Q A;  3UTH A;  4USQ A;  4A9W A;  3ICR A;  3PVC A;  4YSY A;  2GR0 A;  2BXS A;  4EIP A;  3AYL A;  3D9X A;  3P9U A;  3KKJ A;  4JY2 A;  4NTD A;  5U63 A;  5ER0 A;  1EL7 A;  1S7M A;  4H4X A;  5CKU A;  2B9W A;  1PJ7 A;  2E1M A;  3B3R A;  3T37 A;  1L9E A;  1CHU A;  4NTC A;  1LJ1 A;  3UP4 A;  4U8L A;  3AEG A;  3GYJ A;  5FS7 A;  1DOC A;  2C76 A;  2DKH A;  4CNJ A;  5JCI A;  5IQ4 A;  1RP0 A;  2QAE A;  2GAH B;  5EBK A;  4IA5 A;  4OPT A;  4NNJ A;  2YVG A;  2IID A;  5HY5 A;  2Q0L A;  3AXB A;  1GPE A;  3PS9 A;  4H4V A;  2CFY A;  3NT6 A;  4FX9 A;  3DK9 A;  4I58 A;  3F8D A;  4DGK A;  4H4U A;  3K30 A;  4LA1 A;  3SXI A;  4A6N A;  2OLO A;  2WOV A;  4B69 A;  3CNJ A;  2GB0 A;  5BVA A;  1LV0 A;  4BV6 A;  3OZ2 A;  4YSX A;  4P9S A;  2J3N A;  2YVF A;  4EMW A;  2XYO A;  1DOD A;  2ZZB A;  1F8W A;  3SX6 A;  4U8P A;  1ZDL A;  4JY3 A;  1FCD A;  1BWC A;  4TM3 A;  2R4J A;  4IVM B;  4B1B A;  2ZZC A;  2PHH A;  2WBA A;  3HZL A;  3AYJ A;  1HYU A;  5KVH A;  2C64 A;  4A6N B;  1DXL A;  2RAB A;  4Z25 A;  4A65 A;  1H6V A;  1UKV G;  5CQF A;  1TYP A;  1D7L A;  2BRA A;  4ZCC A;  3NG7 X;  3SM8 A;  3ICT A;  4EQS A;  2BA9 A;  2GQF A;  2WOW A;  3CTY A;  3DJE A;  3BNU A;  2X8H A;  3II4 A;  4J36 A;  4GRT A;  2BK3 A;  1LQT A;  3EAN A;  1GND A;  2B9Y A;  2VQ7 A;  4B65 A;  2H88 A;  1OJ9 A;  3K7T A;  2GH5 A;  1CC4 A;  4JNA A;  2B9X A;  2WQY A;  1MXT A;  3KPK A;  1NAA A;  1TDE A;  3AE3 A;  2XLR A;  4YSH A;  3K7Q X;  3QVP A;  1GT8 A;  1CF3 A;  1JNZ A;  1QJD A;  3ALJ A;  5EB4 A;  1L9D A;  4GR1 A;  3GSI A;  5BRT A;  2NVK X;  1XHC A;  2OAM A;  3C4A A;  4C77 A;  4EIQ A;  5HXI A;  4A5L A;  1NHS A;  1V59 A;  4GDE A;  5DBJ A;  4FDC B;  3RHA A;  2BYB A;  1BGN A;  2GV8 A;  2AAQ A;  4II2 A;  4K8D A;  5JCK A;  2BAC A;  3L5O A;  1NEK A;  2BCG G;  2WP6 A;  4G74 A;  4EMJ A;  3RED A;  1S3B A;  3LJP A;  4D04 A;  3G5Q A;  5JCL A;  3GDP A;  3P4Q A;  3AWI A;  1H2I A;  3NYE A;  2ZBW A;  3ICS A;  1GRT A;  4H2P A;  4J33 A;  3AYI A;  2APG A;  2FJD A;  4DNA A;  1N4V A;  1FEA A;  4K22 A;  5C3J A;  2OAL A;  3BHK A;  2R0G A;  4B66 A;  1ZKQ A;  4U8N A;  5KRQ A;  2V5Z A;  4JDR A;  4Y4M A;  2YLT A;  1PJ5 A;  2RGJ A;  1NG3 A;  3V76 A;  3CNS A;  5IPY A;  3NIX A;  3H8L A;  2FJA A;  2YG7 A;  1ZMC A;  4C5O A;  3NYF A;  3CN8 A;  1D4C A;  3T14 A;  3NLC A;  3BI4 A;  1D7Y A;  3ALM A;  2YG4 A;  3UOX A;  2XLP A;  1TYT A;  1B37 A;  2CUL A;  1BZL A;  4MJW A;  4NWZ A;  3AEA A;  1N1P A;  3OC4 A;  2WP9 A;  3SY4 A;  4U8J A;  2YG6 A;  1KSU A;  1TDO A;  2XLU A;  4ADW A;  1DJN A;  2RGH A;  4IV9 A;  3UKF A;  1KNP A;  4TLZ A;  1XDI A;  2BC0 A;  1DOE A;  4BK1 A;  4ZN0 A;  2CVJ A;  3KPF A;  3RP7 A;  4CNK A;  4OPL A;  4O5U A;  2JB1 A;  3AE2 A;  1SEZ A;  4U8K A;  2QA1 A;  1E1M A;  4OPD A;  3R9U A;  4TM4 A;  4K2X A;  3NTD A;  3IC9 A;  3ATQ A;  1EL5 A;  4U2L A;  2A8X A;  2DKI A;  2A89 A;  3GMB A;  4EQR A;  1YQ4 A;  2H89 A;  3ATR A;  1LTX R;  3AED A;  3M12 A;  3LB8 A;  3PG6 A;  1OJA A;  2OLN A;  2VZ2 A;  4I59 A;  3T2Y A;  2HQM A;  4EM4 A;  1LQU A;  4PAA A;  2EQ9 A;  1JRY A;  2XVJ A;  1CC6 A;  3CNP A;  4H2Q A;  2BK4 A;  2YVJ A;  1ZOV A;  2XDO A;  3AD9 B;  2GRT A;  3CND A;  3GMC A;  3CGB A;  1GTE A;  1GRG A;  2X99 A;  3NK0 X;  5BUK A;  4Z2R A;  5KMR A;  1H84 A;  4M52 A;  1TRB A;  1YY5 A;  3P4P A;  4RG4 A;  1IUU A;  1K4Q A;  1DNC A;  2GQW A;  4RSL A;  4UDP A;  4X9M A;  1B5Q A;  3AEF A;  1E6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...