5FS9A

Crystal structure of the g338e mutant of human apoptosis inducing factor
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
487
structure length
459
Chain Sequence
DKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKENMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Structure/Function Relations in Aifm1 Variants Associated with Neurodegenerative Disorders.
pubmed doi rcsb
source organism Homo sapiens
total genus 152
structure length 459
sequence length 487
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fs9A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs9A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs9A01
1FOHA 2C76A 3F8RA 2Z5XA 2WHDA 4U8LA 3DK4A 2XLUA 1ONFA 3KD9A 3UTGA 5BULA 2RGJA 5EBKA 1Z6LA 2A87A 4Y4MA 5FS9A 4IVMB 2TPRA 1Y0PA 1H7WA 3UOZA 4H2NA 2BC0A 2V61A 1L9EA 4U8JA 4H4QA 1OJ9A 1PBBA 1XPQA 3URHA 3G5QA 2EQ6A 1F8RA 3V3NA 3VRAA 3V76A 4IVOB 2XDOA 3BHFA 4EIPA 4ZCDA 1N4UA 5J7XA 3UKHA 4CCQA 4B64A 3COXA 3P4QA 4A99A 1FL2A 4HB9A 1Q1WA 2IVDA 1GRGA 1PS9A 4GDEA 3GDNA 3NT6A 2V3AA 3C4AA 4C3XA 3GWDA 4OPDA 5M10A 4K2XA 1DOCA 1H84A 4CRTA 1EL9A 5DBJA 2C73A 3BNUA 4OPLA 3M13A 3AEBA 3M0OA 2EQ7A 5EOWA 2ARDA 4EQWA 2OALA 4NTDA 3CIRA 4Z2RA 3IHGA 2VQ7A 1BGJA 2B9YA 2GAHB 3AECA 3IF9A 3LB8A 2NVKX 1X31B 2WU5A 2R0CA 2YR6A 4CNKA 3UOXA 4CNJA 4K5SA 3RHAA 2A89A 1M6IA 2GQWA 4YSXA 3DJDA 4U8OA 2H88A 3H8LA 3O0HA 5U63A 4GF7A 1GNDA 3ALLA 4J36A 2FJDA 5KVHA 1IUTA 4IA6A 1CBOA 4NEVA 2WEUA 4ZN0A 3BI4A 2BS4A 3JSKA 2XCGA 3NG7X 1QO8A 3LZWA 4BJYA 2WP6A 4AP1A 4FDCB 5JCMA 2GEWA 2Y6QA 4BV6A 2WOVA 4UDQA 3DJGX 1IJHA 1PBDA 2WP5A 2FJEA 3LXDA 3CNPA 4K7ZA 1EL5A 5KXJA 1ZKQA 2YVGA 1N1PA 4YSHA 1B37A 2Y6RA 2BCPA 1PXCA 2XLRA 3AD8B 1UKVG 3EANA 4H4SA 3PVCA 4YTMA 3REDA 4TM0A 4CY6A 1NG3A 4YXDA 5BUKA 1GREA 3GMCA 4LA1A 3GD3A 3VR9A 1TDEA 1S2YA 1MXTA 1F8WA 1JNRA 1B8SA 3UKAA 1EBDA 4A9WA 5FS6A 1E7PA 5KVIA 2E1MA 2HQMA 2GVCA 2WESA 3QVRA 1S3BA 4C74A 3LJPA 2BXSA 1IUWA 2QA1A 1S3EA 1OJTA 1GXFA 1KSUA 2BK4A 2V5ZA 3ISHA 3UTEA 1GRHA 4YKFA 3S61A 1KFYA 1QJDA 4H2PA 4O5QA 2QAEA 2YAUA 3AEFA 3DGHA 1GEUA 2AAQA 3AB1A 2VQBA 3CN8A 3NTAA 2YM2A 3AYJA 3OZ2A 1JEHA 3EAOA 4UDPA 3UOVA 1GESA 1MO9A 5JCKA 4NEWA 3DH9A 3AD9B 4OCGA 4H4VA 4J2WA 1PHHA 3AE4A 1TDOA 4ECHA 1CL0A 1JNZA 3GRSA 4H4UA 1Q9IA 3DA1A 4XWRA 3CGEA 3UKKA 3F8PA 4C3YA 4OPGA 2XVHA 4O5UA 3NGCX 4B68A 4H4WA 3BHKA 1V59A 1GTEA 4J33A 4YT0A 1OJDA 3Q6JA 3QFAA 1NEKA 4WCTA 3NYCA 1GALA 4LU6A 1DNCA 4Z25A 2ZBWA 2BC1A 3AWIA 4X4JA 1BF3A 2XFNA 2R0PA 1EL8A 1NHQA 3ATQA 1L9CA 4EQSA 1GRBA 1PDHA 5BVAA 3SM8A 1IUUA 1PBCA 5LV9A 4JNQA 3UKFA 3I3LA 4UP3A 4K8DA 1K4QA 2GR1A 4DGKA 5KOXA 1YQ4A 1FEAA 3NLCA 1ELIA 3NH3X 3WE0A 3AEAA 2BYBA 3DK9A 4Y4LA 3UTHA 2GMJA 3CTYA 1YQ3A 4B66A 4H7UA 5HHFA 4B63A 3IC9A 1JRZA 4J34A 4RG3A 4GRTA 1REOA 4A6NA 3NK2X 4BK1A 3QSSA 2VOUA 4AOSA 4I59A 2FBWA 3K30A 4FX9A 2WPFA 1PJ6A 5IQ1A 2JKCA 3H4KA 1KDGA 2PHHA 4RSLA 4EMIA 2BS2A 3K7MX 5BRTA 4U8NA 4H2RA 2VRMA 4DNAA 4RG4A 5FS7A 2CULA 3NIXA 3NK1X 1GETA 1HYUA 1LQTA 2X8HA 1TDFA 2GR3A 3DMEA 4GUVA 1PBFA 2OLNA 2Q0LA 2XFPA 4YKGA 2RGHA 2B9XA 4FK1A 1B4VA 1N4WA 4TM3A 2OA1A 3L8KA 2VVMA 2GMHA 3KA7A 4PABA 3AE9A 1NPXA 1H81A 2BK3A 4OPIA 1GRAA 1E39A 2YG6A 4I58A 2JK6A 2GB0A 3T37A 2XLSA 2WS3A 3VRBA 2XVFA 2OAMA 1D4CA 1VDCA 1GERA 3AE2A 2R46A 2WETA 5GRTA 1JOAA 1DJNA 5M0ZA 4U2SA 3QFBA 1XANA 3AXBA 1NHPA 1VQWA 2WBAA 3GMBA 4U2TA 5KRQA 1O5WA 2A8XA 3RP6A 3CGBA 2YLTA 4LIIA 3NK0X 1E1LA 1YQZA 1K0LA 2DKIA 4IA5A 4OPUA 4Z24A 1GTHA 1KNPA 1XHCA 4K5RA 2YLSA 3AYLA 3P9UA 2R45A 2WP9A 1ZOVA 3B3RA 3LZXA 4A5LA 1LJ1A 4YSZA 4CBQA 2IVEA 2R9ZA 3RP7A 1H82A 3GSIA 3G5RA 2YM1A 5FS8A 5TR3A 1O95A 3ATRA 4H4XA 3PO7A 3DJJA 2BABA 2NPXA 3NYFA 4J57A 4U2LA 3UKQA 4A65A 2XYOA 3AE6A 1ZOYA 2XVIA 1CJ3A 4IV9A 4J56A 1IUXA 2JB1A 1VG0A 3QJ4A 3SFEA 3ICSA 3H8IA 1XDIA 4EM4A 1TYPA 2X8GA 4YWOA 1TYTA 2BXRA 2V6OA 3UKLA 3BNMA 3GD4A 4H2QA 1K0IA 1GPEA 2V3BA 4H4TA 3E1TA 2BACA 3UP4A 3I6DA 1PXBA 2AR8A 4C5OA 1NAAA 4OVIA 3F8DA 3AD7B 1ZY8A 3RP8A 5C2TA 4EMJA 4U8IA 4B67A 4GCMA 3M12A 1COYA 4D03A 1JRXA 1ZDLA 4Z26A 3R9UA 1F8SA 2C67A 4XWZA 4DSGA 1N4VA 4GR1A 4N9XA 4TM4A 1RSGA 1D4EA 2QA2A 4JDRA 2XFUA 1E1KA 3UTFA 3NKSA 1DODA 2IIDA 1CC6A 1P2EA 3FPZA 3GDPA 2CDUA 2F5ZA 4PAAA 3DGZA 2YVJA 3KKJA 3IHMA 4WX1A 2XVJA 3LADA 4FK1C 4AT0A 1Q1RA 1TRBA 1F3PA 4AOXA 3KPFA 1EL7A 1Y56B 4H4PA 4BURA 2JAEA 3CNJA 4A79A 2FJBA 3NTDA 1E1MA 3DK8A 3NYEA 2R4EA 1KSSA 4Y4NA 3LOVA 3UOYA 2WOWA 2C75A 4X9NA 2X50A 3HZLA 4U8PA 5ER0A 2APGA 1W4XA 1KNRA 1DXLA 2H89A 1BWCA 2QCUA 2YG5A 3BI5A 3BI2A 4TLZA 1ZMCA 2C3DA 2C70A 4TLXA 5U1OA 2E5VA 2EQ9A 3Q9TA 4TM1A 1PJ5A 3GWFA 4EMWA 1FCDA 1LV0A 3ADAB 3FG2P 3AE8A 2B76A 3PS9A 3QVPA 2GAGB 4JNAA 2Q6UA 2GQFA 2VVLA 2ZZ0A 1BZLA 4EQXA 2I0ZA 2YVFA 1JU2A 3GYIA 4BK2A 2WPEA 2J3NA 1ZMDA 2WQYA 3AEDA 4U8KA 4E0VA 2XVEA 3P4SA 4EM3A 2OLOA 3AE5A 2X99A 3ICTA 2BA9A 3VQRA 2CVJA 2JB3A 2E4GA 4Z2TA 1DOBA 2YQUA 1YKJA 2B7RA 2C64A 5JCIA 1RP0A 2YLZA 4JY2A 2BS3A 2WU2A 3SGLA 5L46A 3VR8A 1H86A 2Z5YA 1FEBA 1B5QA 1CHUA 1E1NA 4JQ9A 4H4YA 3QSMA 3ITJA 3QSEA 3CNTA 5CKUA 2YR4A 4P9SA 3P1WA 1LVLA 3K7TA 4XXGA 4USRA 4NTEA 2UZZA 1VRQB 5HY5A 1D5TA 4OPCA 4YSYA 4UDRA 5IQ4A 4YTPA 5FMHA 1KF6A 4DSHA 2B9WA 2X3NA 3NN0X 2VVLG 1P2HA 2BK5A 4NZHA 5U25A 1YY5A 1RYIA 3FIMB 4JN9A 3NN6X 1DJQA 2YG4A 3FBSA 4A6NB 1H83A 3S5WA 4REKA 2R4JA 2GR0A 3NRNA 1TDNA 4ADWA 3ALJA 3D1CA 3IWAA 4ICYA 2X8CA 1CC2A 1MOKA 2C3CA 4Z44A 3KLJA 2GR2A 3GRTA 5JCNA 3RNMA 4C77A 5KOWA 1ZX9A 4M52A 1IUVA 1PJ7A 3KU9A 1PN0A 5KWFA 1CJ2A 4ZCCA 4AT2A 3AE1A 1GV4A 2GF3A 4MJWA 3V3OA 1GSNA 1BKWA 1H6VA 1NENA 2O9ZA 2WDQA 4AP3A 1H7XA 3NHOX 3EF6A 2C7GA 1NDAA 4H50A 4CY8A 4K22A 3AYIA 4YTNA 3UP5A 1TDKA 2WPCA 3D8XA 4X9MA 2JB2A 5HXIA 2C72A 4JY3A 5CQFA 2CFYA 4J31A 4B1BA 3ZYXA 1D7LA 2VZ2A 2GV8A 1D7YA 1PXAA 4B69A 1D4DA 4OPTA 2XFQA 2AQJA 3AEEA 2XFOA 4KX6A 1NHSA 1E6EA 3P4PA 2WDVA 3CPHG 2XLPA 2EQ8A 3FMWA 2B7SA 3C4NA 1JRYA 2JBVA 2GRTA 2V60A 2VRLA 2FJAA 2YLWA 3AE7A 3ALMA 1CJ4A 1S2QA 3NNEA 4USQA 1Y56A 3CPIG 1GRTA 3ICRA 1FECA 1LPFA 5J60A 1LTXR 1F6MA 5EB5A 4U8MA 4APNA 2RGOA 3UKPA 3OC4A 5JCLA 1M64A 1O94A 2YLXA 1GOSA 3DJEA 4Z43A 1AOGA 1LQUA 3CGCA 3SFDA 4H4ZA 1VG9A 2YLRA 3P4RA 4D04A 2ZZCA 2RABA 3EPTA 4KPRA 3AEGA 1BGNA 4B65A 3K7QX 3VRDB 2TMDA 3SQPA 2PYXA 1CJCA 1PBEA 3C96A 3GYJA 1CF3A 2Q0KA 4Z2UA 2YR5A 3KVEA 5HYMA 2W0HA 2GH5A 4GDPA 2XLTA 1ZP0A 4BJZA 2WDRA 1IUSA 1GT8A 2BCGG 3CNSA 4NTCA 1DOEA 4BK3A 1CC4A 1OJCA 5EB4A 3ZDNA 2C66A 1GRFA 1K0JA 4EIQA 5C3JA 4CCRA 2YG3A 3CPJG 1ZK7A 2DKHA 3L1RA 2Q7VA 3AE3A 1L9DA 3CGDA 3G5SA 2ZZBA 2YWLA 2C65A 1QLBA 3B6DA 4EQRA 2WOIA 2ACZA 3ABVA 3UCLA 1NG4A 3CNDA 5GSNA 4H4RA 1OJAA 1L0VA 5IPYA 2YG7A 1NHRA 4HA6A 4A7AA 2R0GA 1SEZA 3II4A
chains in the Genus database with same CATH superfamily
2C76A 3P93A 1FIQB 4HCHA 2A87A 3UJFA 3UOZA 1KN0A 2XH0A 2V61A 1L9EA 4U8JA 3T2KA 3G5QA 1RM6B 3V76A 5BOEA 2XDOA 1N4UA 5J7XA 4CCQA 4G74A 3P4QA 2QDEA 1Q1WA 3C4AA 5M10A 3GWDA 4HN8A 4OPLA 3R0UA 4DWDA 2ARDA 4EQWA 2OALA 3IHGA 2VQ7A 1BGJA 3AECA 3IF9A 3LB8A 2GGJA 3RHAA 2W54A 3DJDA 4GF7A 3ALLA 1EC8A 1IUTA 4IA6A 4ZN0A 2QJMA 1STZA 3FV9A 2XCGA 5KMPA 5JCMA 5FJPA 2WP5A 5FJOA 3DIPA 1ZKQA 4MGGA 1N1PA 1NELA 3AD8B 1UKVG 3PVCA 4YXDA 5BUKA 4H83A 1S2YA 2XH7A 1B8SA 5FS6A 2AL2A 4A3RA 3CXOA 3LJPA 3CXBA 4E4UA 2QA1A 1OJTA 1KFYA 1QJDA 2YAUA 3AB1A 3NTAA 3AYJA 3NXLA 3OP2A 3AD9B 4H4VA 4J2WA 1JDFA 1V97A 3NZGA 4ECHA 3U9IA 3NVWB 3R0KA 1Q9IA 3UKKA 2W55A 2XVHA 3SN1A 1RVKA 3BHKA 1N62C 2PODA 2QDDA 1OJDA 3QFAA 4YT0A 4WCTA 3NYCA 3NO1A 3TQPA 1DNCA 4Z25A 2BC1A 1BF3A 2XFNA 1GRBA 4KEMA 1PBCA 5LV9A 3UKFA 4IL2A 4K8DA 2PPGA 3TCSA 3NLCA 3UTHA 2GMJA 5HHFA 4J34A 2OO6A 3UJEA 3GYXA 4BK1A 3QSSA 2W3SA 1EC9A 4I59A 2FBWA 4FX9A 4ZCWA 2WPFA 2JKCA 4EMIA 4U8NA 4H19A 2VRMA 5FS7A 2CULA 2OLNA 2XFPA 4YKGA 2ZC8A 1JRPA 3DDMA 3QKEA 1NPXA 1H81A 3PK7A 1E39A 1KKOA 3T37A 2WS3A 1NU5A 2XVFA 1D4CA 2R46A 5M0ZA 2WBAA 3OZMA 1E1LA 2DKIA 4IA5A 4OPUA 4Z24A 1KNPA 1XHCA 3BSMA 2YLSA 4K8GA 3AYLA 2R45A 3P9UA 1KKRA 2IVEA 2R9ZA 3MY9A 4EWJA 3DJJA 3UKQA 4U2LA 4A65A 4J57A 3STPA 1CJ3A 3UGVA 3QJ4A 4EM4A 2BXRA 3UKLA 3BNMA 1GPEA 2BACA 3ES7A 1PXBA 1XS2A 4U8IA 4DSGA 1WUEA 1F8SA 2C67A 3N6HA 2AL1A 4N9XA 4TM4A 1E1KA 3GDPA 3V3WA 2CDUA 3DERA 1Q1RA 4A79A 3DK8A 1KSSA 2WOWA 5ER0A 2APGA 2H89A 1DXLA 3VCNA 2QCUA 3BI5A 2C3DA 4HCLA 5U1OA 2B76A 4JNAA 2I0ZA 3N4EA 1N5WC 1ELSA 4U8KA 3P4SA 4EM3A 2GL5A 3ICTA 1YKJA 4JY2A 1B5QA 1E1NA 3H7VA 5JRBA 4H4YA 3ITJA 5CKUA 3K7TA 1D5TA 4YSYA 5IQ4A 4YTPA 3NN0X 2VVLG 2BK5A 4NZHA 3T14A 3SR6B 1DJQA 3ALJA 4ICYA 2BRAA 3NRZB 2C3CA 4DXKA 4MMWA 3NVZB 5JCNA 4M52A 1CJ2A 1GV4A 2GF3A 3V3OA 1H6VA 3ETRB 2C7GA 2PTWA 3GY1A 3AYIA 5HXIA 2CFYA 1PXAA 1D4DA 2XFQA 2XFOA 1IYXA 4DN1A 3MQTA 1SJCA 3MKCA 3Q4DA 3CPHG 2EQ8A 3FMWA 2P0IA 2FJAA 3AN1A 3ALMA 4IP4A 4USQA 4FI4A 3CPIG 1FECA 5J60A 4DHGA 3UKPA 1M64A 2YLXA 1GOSA 4Z43A 2YLRA 3P4RA 3EPTA 3CYJA 1BGNA 3K7QX 3D9XA 2TMDA 4ENLA 3C96A 4ROPA 4M6UA 5HYMA 2W0HA 3A7AA 4GDPA 4E5TA 2WDRA 3CNSA 1ONEA 4BK3A 1OJCA 5EB4A 1K0JA 4EIQA 1VDVA 5IDZA 1L9DA 2C65A 3DFYA 2ACZA 3UCLA 3I6TA 4HA6A 3F8RA 3T6CA 3OZYA 2Z5XA 2XLUA 1ONFA 2QQ6A 3DFHA 5ENLA 4KT2A 4Y4MA 5FS9A 2TPRA 1H7WA 4E8GA 1OJ9A 1XPQA 1F8RA 3V3NA 4A6GA 1BKHA 3NFUA 3COXA 1FL2A 4HB9A 2IVDA 1GRGA 3NT6A 2V3AA 4K2XA 1H84A 3UCDA 3M13A 5EOWA 3P3BA 3VFCA 4KPLA 2GAHB 1X31B 2NVKX 2R0CA 3UOXA 4YSXA 4IZGA 4JN7A 3H8LA 3I6EA 3RGTA 2FJDA 5KVHA 3T2ZA 2QGYA 4H2HA 2Y6QA 3KPKA 4UDQA 3DJGX 2FJEA 3RCYA 3ZVHB 3DEQA 3REDA 1JCTA 4CY6A 3TWAA 3DGBA 3N6JA 3GMCA 4LA1A 3VR9A 1TDEA 1MXTA 1F8WA 1KD0A 1EBDA 3VDGA 2E1MA 1IUWA 1S3EA 2BK4A 1GRHA 3B97A 2VQBA 2PA6A 2YM2A 3EAOA 4UDPA 3UOVA 1GESA 1MO9A 3ZLGA 4GFIA 1X2GA 4OCGA 1JNZA 3QPEA 4XWRA 3F8PA 4OPGA 4O5UA 1FHVA 1TZZA 4H4WA 5FJUA 1NEKA 4X4JA 2R0PA 1EL8A 3ATQA 4EQSA 5BVAA 3T8QA 2PCEA 2GGGA 3I3LA 4UP3A 1K4QA 2GR1A 3WE0A 1ELIA 3NH3X 3DK9A 3U4FA 4B63A 1JRZA 4GRTA 4A6NA 2VOUA 3K30A 1ECQA 1PJ6A 3OTRA 2PGEA 4RSLA 1H2IA 3D46A 3NK1X 1EC7A 3DMEA 3Q45A 4GUVA 3T31A 2Q0LA 3DG3A 3QN3A 2B9XA 1N4WA 4TM3A 2OA1A 3L8KA 3AE9A 2BK3A 2XLSA 2OAMA 1N5XA 5GRTA 1JOAA 3QFBA 1XANA 3AXBA 1NHPA 1VQWA 3GMBA 4U2TA 2A8XA 3NK0X 1YQZA 2PTXA 2AKZA 1ZOVA 3GSIA 5FS8A 5TR3A 1O95A 3B9JB 4H4XA 2BABA 2NPXA 1EBGA 3ZVIA 2GDQA 3DG7A 2XYOA 3AE6A 1N61C 4J56A 1VG0A 1XDIA 1TYPA 4YWOA 3CAWA 4H2QA 1K0IA 2RDXA 2BRYA 1WUFA 3EKGA 2AR8A 2AKMA 3AD7B 1ZY8A 3RP8A 5C2TA 4GCMA 1COYA 1JRXA 2FKPA 1N4VA 4GR1A 1RSGA 1D4EA 2QA2A 4JDRA 2XFUA 1CC6A 2F5ZA 4WX1A 4FK1C 1TRBA 4BURA 2JAEA 2R4EA 3UOYA 4Y4NA 2C75A 4IT1A 3K1GA 3HZLA 4NNJA 1W4XA 3BJSA 1N63C 2YG5A 4TLZA 1ZMCA 3CK5A 2EQ9A 4TM1A 2GGEA 1LV0A 3ADAB 3FG2P 2VVLA 1BZLA 1JU2A 3GYIA 2WPEA 2WQYA 2BA9A 3VQRA 1MUCA 2YQUA 5JCIA 1RP0A 2BS3A 2OZTA 2P3ZA 4G6HA 3QSMA 3ENLA 3HYWA 3SN0A 1S7MA 4NTEA 4II3A 4GAPA 3FJ4A 5FMHA 2B9WA 1DTNA 1P2HA 3R10A 5U25A 1YY5A 1RYIA 4JN9A 3NN6X 3MSYA 2YG4A 2OX4A 3S5WA 3VA8A 2GR0A 4ADWA 2X8CA 1T3QC 3T4WA 2GSHA 1L8PA 3HW2A 4YWSA 4C77A 5KOWA 1ZX9A 3AE1A 4MJWA 2QVHA 4AP3A 3NHOX 4YTNA 1TDKA 3D8XA 4JY3A 5CQFA 1D7LA 2VZ2A 4B69A 3AEEA 3CMMA 1NHSA 3HRDC 2PU0A 2WDVA 3TWBA 2JBVA 3SZWA 2V60A 5G5GB 1LPFA 3DG6A 1F6MA 5EB5A 2RGOA 3SSZA 1LQUA 2W3RA 3CGCA 3SFDA 1VG9A 5FJTA 3JW7A 4B65A 3VRDB 2P88A 2PYXA 1CF3A 2Q0KA 2YR5A 2GH5A 3NVYB 4BJZA 1GT8A 4NTCA 1DOEA 1CC4A 2C66A 5C3JA 2PGWA 2Q7VA 3CGDA 3G5SA 1QLBA 2OZ8A 3B6DA 3CNDA 1OJAA 3II4A 2PP0A 2WHDA 4U8LA 3DK4A 3KD9A 3UTGA 2RGJA 1Z6LA 4FP1A 4H2NA 2BC0A 4H4QA 3URHA 2EQ6A 3T9PA 3VRAA 4IVOB 3UKHA 4GISA 4GDEA 4C3XA 4OPDA 4CRTA 1EL9A 3S47A 2C73A 3BNUA 2EQ7A 3AM9A 3CIRA 2B9YA 2HZGA 2WU5A 4CNKA 4K5SA 2A89A 1M6IA 3TTEA 2H88A 2E3TA 5U63A 1GNDA 2PP3A 2WEUA 3MZNA 3NG7X 4HNLA 1QO8A 3LZWA 2WP6A 4BV6A 3T2YA 1PBDA 4K7ZA 1EL5A 3L5OA 2YVGA 3SN4A 1B37A 2Y6RA 2BCPA 2PP1A 3EANA 4H4SA 4TM0A 3EUB3 5BOFA 1E9IA 3IJLA 3DESA 4G9KA 2HQMA 2GVCA 4C74A 4TVWA 2V5ZA 3ISHA 3S61A 4H2PA 3D47A 3AEFA 2AAQA 5JCKA 4NEWA 3DH9A 3IJIA 3AE4A 3FYYA 3IK4A 4H4UA 4GYPA 3CGEA 3GO2A 4C3YA 3NGCX 4HYRA 2C4CA 1GALA 1X2HA 1NHQA 1FHUA 3HYVA 3SM8A 1IUUA 3FVDA 3H70A 3AEAA 2BYBA 2XH2A 1YQ3A 4H7UA 2HXUA 3SJNA 2CHRA 3IJQA 3NK2X 2PS2A 3H4KA 4DNAA 4RG4A 3NIXA 1HYUA 1LQTA 2X8HA 3VCCA 1PBFA 2PTYA 2RGHA 4FK1A 1B4VA 4DX3A 3KA7A 2VVMA 2GMHA 4PABA 4OPIA 1GRAA 4G7FA 2YG6A 2GB0A 1BQGA 1VDCA 3AE2A 3SZFA 5KRQA 3A7RA 1O5WA 3RP6A 2YLTA 2PMQA 3SBFA 1GTHA 1LJ1A 1H82A 3PO7A 3NYFA 4ZA0A 1ZOYA 2I5QA 4IV9A 1IUXA 3SFEA 3UJRA 3H8IA 4E4FA 4JN8A 4KWSA 2V6OA 4HCDA 2ZADA 2V3BA 3FCPA 3E1TA 3RO6A 3F8DA 4IHCA 3UJSA 3M12A 4Z26A 1ZDLA 2DW7A 1DODA 3TOYA 2IIDA 1P2EA 3FPZA 4PAAA 3DGZA 2YVJA 3KKJA 3LADA 2AL2B 3KPFA 1EL7A 4H1ZA 2FJBA 3NTDA 3LOVA 4X9NA 4U8PA 4K2SA 1KNRA 1BWCA 4TLXA 2HXTA 3Q9TA 3GWFA 4EMWA 3GD6A 1FCDA 4G8TA 3AE8A 3QVPA 2GAGB 2Q6UA 2GQFA 1TE6A 2J3NA 3R11A 3ES8A 3AEDA 3AE5A 2CVJA 3QTPA 4Z17A 4Z2TA 3RITA 1DOBA 3H12A 2YLZA 4II2A 2WU2A 3VR8A 1CHUA 4JQ9A 3UXLA 3HYXA 3QSEA 3CNTA 1R6WA 4P9SA 3P1WA 3PWGA 2DW6A 2UZZA 5HY5A 4MKSA 4OPCA 3ZVHA 5KMRA 3FXGA 1KF6A 2X3NA 4A35A 3FIMB 5J04A 4GYPC 2R4JA 3IWAA 4J3ZA 1CC2A 1JROA 1MOKA 1FFVC 4Z44A 2OPJA 3UCCA 1IUVA 3KU9A 1PN0A 5KWFA 4ZCCA 3A7UA 4AT2A 4TVYA 1GSNA 1BKWA 3QLDA 1NENA 4K1WA 3TW9A 1H7XA 2HNEA 4CY8A 4K22A 3UP5A 4J31A 3P0WA 1D7YA 3S5SA 4OPTA 3ZLFA 1E6EA 3P4PA 2XLPA 1N60C 2B7SA 3C4NA 1TKKA 3V5CA 1CJ4A 1S2QA 1LTXR 4APNA 3PWIA 3DJEA 1O94A 1AOGA 4ZOHB 3MWCA 1MDRA 2ZZCA 2P8CA 4GMEA 3AEGA 3GYJA 2OKTA 3UJ2A 1KCZA 2XLTA 2BCGG 3ZDNA 4CCRA 3CPJG 3SQSA 3TJ4A 2YWLA 4E6MA 4EQRA 1NG4A 5GSNA 4H4RA 2OQHA 1L0VA 1FO4A 2YG7A 3SY4A 1FOHA 3BOXA 4Z1YA 5BULA 3AMZA 4IL0A 5EBKA 4IVMB 1Y0PA 1PBBA 3SZCA 4HPNA 3BHFA 4EIPA 4ZCDA 1R0MA 4B64A 2POZA 4A99A 5KNLA 1PS9A 3GDNA 1DOCA 5DBJA 3AEBA 3M0OA 5G5HB 3T0KA 4NTDA 4Z2RA 2YR6A 4CNJA 2GQWA 4U8OA 4HNCA 3O0HA 2OQYA 4J36A 1MDLA 6ENLA 1CBOA 4NEVA 3BI4A 2BS4A 3V5FA 3JSKA 4BJYA 1SJBA 4AP1A 4FDCB 2GEWA 3HPFA 2WOVA 1IJHA 3CNPA 3LXDA 5KXJA 4YSHA 1PXCA 4IP5A 2XLRA 4YTMA 1NG3A 1GREA 3GD3A 1PDYA 1JNRA 3UKAA 3N4FA 4A9WA 1E7PA 5KVIA 3QVRA 2WESA 1ZXIC 2OFJA 1S3BA 2BXSA 3OPSA 1GXFA 2XGZA 1KSUA 3UTEA 4YKFA 2PU1A 3ZLHA 4O5QA 2QAEA 2GGIA 3DGHA 1GEUA 3CN8A 3OZ2A 1JEHA 1P43A 1PHHA 1TDOA 2NQLA 1CL0A 3GRSA 4F4RA 3DA1A 2MNRA 3JVAA 4B68A 5KMSA 1XPYA 1W6TA 1V59A 1GTEA 4J33A 4GGHA 3Q6JA 3VC5A 4LU6A 2ZBWA 3AWIA 2ONEA 1L9CA 1PDHA 4JNQA 2QJJA 5KOXA 4DGKA 1YQ4A 1FEAA 1EBHA 4Y4LA 3CTYA 5FJRA 2FYMA 4B66A 3IC9A 4RG3A 2OVLA 1REOA 3UXKA 4AOSA 3EEZA 5IQ1A 1KDGA 2PHHA 2BS2A 3K7MX 5BRTA 4H2RA 1GETA 1TDFA 2GR3A 2OLAA 4DYEA 3CT2A 3SZ0A 2MUCA 1JPMA 4G73A 2PSNA 4I58A 2JK6A 3VRBA 1VQZA 1GERA 1OEPA 2WETA 1DJNA 4U2SA 1SJDA 3CGBA 4LIIA 1K0LA 2OZ3A 4K5RA 4A5LA 2WP9A 3LZXA 3B3RA 3SX6A 4YSZA 4CBQA 3RP7A 3G5RA 2YM1A 4G6GA 1SJAA 3ATRA 4X2PA 1MNSA 2XVIA 2JB1A 3ICSA 4NWZA 2X8GA 1TYTA 3GD4A 4H4TA 3NS1B 3UP4A 3I6DA 4C5OA 1NAAA 4OVIA 2P8BA 3MUCA 1SB3B 4EMJA 3SYIA 4B67A 3KUMA 4D03A 3R9UA 3VC6A 4XWZA 2PTZA 3UTFA 3NKSA 4GIRA 1JPDX 7ENLA 5KMQA 3RRAA 3IHMA 3NVVB 2XVJA 3R1ZA 4AT0A 1F3PA 4AOXA 1Y56B 4H4PA 3CNJA 1E1MA 3NYEA 2X50A 3H8AA 3PG6A 3PFRA 3V4BA 3BI2A 2C70A 2E5VA 1PJ5A 3PS9A 2ZZ0A 4EQXA 2YVFA 4BK2A 1F9CA 1ZMDA 4E0VA 2XVEA 2O56A 2OLOA 2X99A 2JB3A 2E4GA 2XH4A 2B7RA 2C64A 5EU9A 5L46A 3SGLA 1H86A 4JHMA 2Z5YA 1FEBA 2YR4A 1LVLA 4XXGA 4USRA 3JZUA 1VRQB 4UDRA 4DSHA 4GGBA 2E5AA 3FBSA 4A6NB 1H83A 4REKA 3NRNA 1TDNA 3D1CA 3TJIA 3R25A 2QJNA 3KLJA 2GR2A 1MRAA 3CB3A 3GRTA 3RNMA 2XSXA 1PJ7A 2O9ZA 2WDQA 3EF6A 1NDAA 4H50A 1FFUC 3OW1A 2WPCA 4X9MA 2JB2A 2C72A 4B1BA 3ZYXA 2GV8A 2AQJA 4KX6A 1WYGA 3RR1A 1JRYA 2GRTA 2VRLA 1YEYA 2YLWA 2GGHA 3R07C 3AE7A 3NNEA 1Y56A 1GRTA 3ICRA 4U8MA 3OC4A 5JCLA 4H4ZA 4M0XA 4D04A 3SXIA 2RABA 4KPRA 4GAVA 3I4KA 3SQPA 1CJCA 1PBEA 4Z2UA 3KVEA 3GC2A 3THUA 1ZP0A 4J1OA 1P48A 1IUSA 1GRFA 1PDZA 2OG9A 2YG3A 1ZK7A 2DKHA 3L1RA 3AE3A 2ZZBA 2WOIA 3ABVA 5IPYA 1NHRA 4A7AA 2R0GA 1SEZA
chains in the Genus database with same CATH topology
1FOHA 2C76A 3F8RA 2Z5XA 2WHDA 4U8LA 3DK4A 2XLUA 1ONFA 3KD9A 3UTGA 5BULA 2RGJA 5EBKA 1Z6LA 2A87A 4Y4MA 5FS9A 4IVMB 2TPRA 1Y0PA 1KN0A 1H7WA 3UOZA 4H2NA 2BC0A 2V61A 1L9EA 4U8JA 4H4QA 1OJ9A 3T2KA 1PBBA 1XPQA 3URHA 3G5QA 2EQ6A 3SZCA 1F8RA 3V3NA 3VRAA 3V76A 4IVOB 2XDOA 3BHFA 4EIPA 4ZCDA 1N4UA 5J7XA 3UKHA 4CCQA 4G74A 3COXA 3P4QA 4B64A 4A99A 1FL2A 4HB9A 1Q1WA 2IVDA 1GRGA 1PS9A 4GDEA 5KNLA 3GDNA 3NT6A 2V3AA 3C4AA 4C3XA 3GWDA 4OPDA 5M10A 4K2XA 1DOCA 1H84A 4CRTA 1EL9A 5DBJA 2C73A 3BNUA 4OPLA 3M13A 3AEBA 3M0OA 2EQ7A 5EOWA 2ARDA 3T0KA 4EQWA 2OALA 4NTDA 3CIRA 4Z2RA 3IHGA 2VQ7A 1BGJA 2B9YA 2GAHB 3AECA 3IF9A 3LB8A 2NVKX 1X31B 2WU5A 2R0CA 2YR6A 4CNKA 3UOXA 4CNJA 4K5SA 3RHAA 2A89A 1M6IA 2GQWA 4YSXA 3DJDA 4U8OA 2H88A 3H8LA 3O0HA 5U63A 4GF7A 1GNDA 3ALLA 4J36A 2FJDA 5KVHA 1IUTA 3T2ZA 4IA6A 1CBOA 4NEVA 2WEUA 4ZN0A 3BI4A 2BS4A 3JSKA 2XCGA 3NG7X 1QO8A 3LZWA 4BJYA 2WP6A 5KMPA 4AP1A 4FDCB 5JCMA 2GEWA 2Y6QA 3KPKA 4BV6A 2WOVA 4UDQA 3T2YA 3DJGX 1IJHA 1PBDA 2WP5A 2FJEA 3LXDA 3CNPA 4K7ZA 1EL5A 5KXJA 1ZKQA 2YVGA 3L5OA 1N1PA 4YSHA 1B37A 2Y6RA 2BCPA 1PXCA 2XLRA 3AD8B 1UKVG 3EANA 4H4SA 3PVCA 4YTMA 3REDA 4TM0A 4CY6A 1NG3A 4YXDA 5BUKA 1GREA 3GMCA 4LA1A 3GD3A 3VR9A 1TDEA 1S2YA 1MXTA 1F8WA 1JNRA 1B8SA 3UKAA 4G9KA 1EBDA 4A9WA 5FS6A 1E7PA 5KVIA 2E1MA 2HQMA 2GVCA 2WESA 3QVRA 1S3BA 4C74A 3LJPA 2BXSA 1IUWA 2QA1A 1S3EA 1OJTA 1GXFA 1KSUA 2BK4A 2V5ZA 3ISHA 3UTEA 1GRHA 4YKFA 3S61A 1KFYA 1QJDA 4H2PA 4O5QA 2QAEA 2YAUA 3AEFA 3DGHA 1GEUA 2AAQA 3AB1A 2VQBA 3CN8A 3NTAA 2YM2A 3AYJA 3OZ2A 1JEHA 3EAOA 4UDPA 3UOVA 1GESA 1MO9A 5JCKA 4NEWA 3DH9A 3AD9B 4OCGA 4H4VA 4J2WA 1PHHA 3AE4A 1TDOA 4ECHA 1CL0A 1JNZA 3GRSA 4H4UA 1Q9IA 3DA1A 4XWRA 3CGEA 3UKKA 3F8PA 4C3YA 4OPGA 2XVHA 4O5UA 3NGCX 4B68A 4H4WA 5KMSA 3BHKA 1V59A 1GTEA 4J33A 4YT0A 1OJDA 3Q6JA 3QFAA 1NEKA 4WCTA 2C4CA 3NYCA 1GALA 4LU6A 1DNCA 4Z25A 2ZBWA 2BC1A 3AWIA 4X4JA 1BF3A 2XFNA 2R0PA 1EL8A 1NHQA 3ATQA 3HYVA 1L9CA 4EQSA 1GRBA 1PDHA 5BVAA 3SM8A 1IUUA 1PBCA 5LV9A 4JNQA 3UKFA 3I3LA 4UP3A 4K8DA 1K4QA 2GR1A 4DGKA 5KOXA 1YQ4A 1FEAA 3NLCA 1ELIA 3NH3X 3WE0A 3AEAA 2BYBA 3DK9A 4Y4LA 3UTHA 2GMJA 3CTYA 1YQ3A 4B66A 4H7UA 5HHFA 4B63A 3IC9A 1JRZA 4J34A 4RG3A 4GRTA 1REOA 3GYXA 4A6NA 3NK2X 4BK1A 3QSSA 2VOUA 4AOSA 4I59A 2FBWA 3K30A 4FX9A 2WPFA 1PJ6A 5IQ1A 2JKCA 3H4KA 1KDGA 2PHHA 4RSLA 1H2IA 4EMIA 2BS2A 3K7MX 5BRTA 4U8NA 4H2RA 2VRMA 4DNAA 4RG4A 5FS7A 2CULA 3NIXA 3NK1X 1GETA 1HYUA 1LQTA 2X8HA 1TDFA 2GR3A 3DMEA 4GUVA 1PBFA 2OLNA 2Q0LA 2XFPA 3T31A 4YKGA 2RGHA 2B9XA 4FK1A 3SZ0A 1B4VA 1N4WA 4TM3A 2OA1A 3L8KA 2VVMA 2GMHA 3KA7A 4G73A 3AE9A 4PABA 1NPXA 1H81A 2BK3A 4OPIA 1GRAA 1E39A 2YG6A 4I58A 2JK6A 2GB0A 3T37A 2XLSA 2WS3A 3VRBA 2XVFA 2OAMA 1D4CA 1VDCA 1GERA 3AE2A 3SZFA 2R46A 2WETA 5GRTA 1JOAA 1DJNA 5M0ZA 4U2SA 3QFBA 1XANA 3AXBA 1NHPA 1VQWA 2WBAA 3GMBA 4U2TA 5KRQA 1O5WA 2A8XA 3RP6A 3CGBA 2YLTA 4LIIA 3NK0X 1E1LA 1YQZA 1K0LA 2DKIA 4IA5A 4OPUA 4Z24A 1GTHA 1KNPA 1XHCA 4K5RA 2YLSA 3AYLA 3P9UA 2R45A 2WP9A 1ZOVA 3B3RA 3LZXA 4A5LA 1LJ1A 3SX6A 4YSZA 4CBQA 2IVEA 2R9ZA 3RP7A 1H82A 3GSIA 3G5RA 2YM1A 5FS8A 5TR3A 1O95A 4G6GA 3ATRA 4H4XA 3PO7A 3DJJA 2BABA 2NPXA 3NYFA 4J57A 4U2LA 3UKQA 4A65A 2XYOA 3AE6A 1ZOYA 2XVIA 1CJ3A 4IV9A 4J56A 1IUXA 2JB1A 1VG0A 3QJ4A 3SFEA 3ICSA 3H8IA 1XDIA 4EM4A 1TYPA 2X8GA 4YWOA 1TYTA 2BXRA 4NWZA 2V6OA 3UKLA 3BNMA 3GD4A 4H2QA 1K0IA 1GPEA 2V3BA 4H4TA 2BRYA 3E1TA 2BACA 3UP4A 3I6DA 1PXBA 2AR8A 4C5OA 1NAAA 4OVIA 3F8DA 3AD7B 1ZY8A 3RP8A 5C2TA 4EMJA 4U8IA 3SYIA 4B67A 4GCMA 3M12A 1COYA 4D03A 1JRXA 1ZDLA 4Z26A 3R9UA 1F8SA 2C67A 4XWZA 4DSGA 1N4VA 4GR1A 4N9XA 4TM4A 1RSGA 1D4EA 2QA2A 4JDRA 2XFUA 1E1KA 3UTFA 3NKSA 1DODA 2IIDA 1CC6A 1P2EA 3FPZA 3GDPA 2CDUA 2F5ZA 4PAAA 3DGZA 2YVJA 3KKJA 5KMQA 3IHMA 4WX1A 2XVJA 3LADA 4FK1C 4AT0A 1Q1RA 1TRBA 1F3PA 4AOXA 3KPFA 1EL7A 1Y56B 4H4PA 4BURA 2JAEA 3CNJA 4A79A 2FJBA 3NTDA 1E1MA 3DK8A 3NYEA 2R4EA 1KSSA 4Y4NA 3LOVA 3UOYA 2WOWA 2C75A 4X9NA 2X50A 3HZLA 4NNJA 4U8PA 5ER0A 2APGA 1W4XA 1KNRA 1DXLA 3PG6A 2H89A 1BWCA 2QCUA 2YG5A 3BI5A 3BI2A 4TLZA 1ZMCA 2C3DA 2C70A 4TLXA 5U1OA 2E5VA 2EQ9A 3Q9TA 4TM1A 1PJ5A 3GWFA 4EMWA 1FCDA 1LV0A 3ADAB 3FG2P 3AE8A 2B76A 3PS9A 3QVPA 2GAGB 4JNAA 2Q6UA 2GQFA 2VVLA 2ZZ0A 1BZLA 4EQXA 2I0ZA 2YVFA 1JU2A 3GYIA 4BK2A 2WPEA 2J3NA 1ZMDA 2WQYA 3AEDA 4U8KA 4E0VA 2XVEA 3P4SA 4EM3A 2OLOA 3AE5A 2X99A 3ICTA 2BA9A 3VQRA 2CVJA 2JB3A 2E4GA 4Z2TA 1DOBA 2YQUA 1YKJA 2B7RA 2C64A 5JCIA 1RP0A 2YLZA 4JY2A 2BS3A 2WU2A 4II2A 3SGLA 3VR8A 5L46A 1H86A 2Z5YA 1FEBA 1B5QA 1CHUA 1E1NA 4G6HA 5JRBA 4JQ9A 4H4YA 3HYXA 3QSMA 3HYWA 3ITJA 3QSEA 1S7MA 3CNTA 5CKUA 2YR4A 4P9SA 3P1WA 1LVLA 3K7TA 4XXGA 4USRA 4NTEA 2UZZA 1VRQB 4II3A 1D5TA 5HY5A 4GAPA 4OPCA 5KMRA 4YSYA 4UDRA 5IQ4A 4YTPA 5FMHA 1KF6A 4DSHA 2B9WA 2X3NA 3NN0X 2VVLG 1P2HA 2BK5A 4NZHA 3T14A 5U25A 1YY5A 1RYIA 3FIMB 4JN9A 3NN6X 1DJQA 2YG4A 3FBSA 4A6NB 1H83A 3S5WA 4REKA 2R4JA 2GR0A 3NRNA 1TDNA 4ADWA 3ALJA 3D1CA 3IWAA 4ICYA 2X8CA 1CC2A 2BRAA 1MOKA 2C3CA 4Z44A 3KLJA 2GR2A 3GRTA 5JCNA 3RNMA 4C77A 5KOWA 1ZX9A 4M52A 1IUVA 1PJ7A 3KU9A 1PN0A 5KWFA 1CJ2A 4ZCCA 4AT2A 3AE1A 1GV4A 2GF3A 4MJWA 3V3OA 1GSNA 1BKWA 1H6VA 1NENA 2O9ZA 2WDQA 4AP3A 1H7XA 3NHOX 3EF6A 2C7GA 1NDAA 4H50A 4CY8A 4K22A 3AYIA 4YTNA 3UP5A 1TDKA 2WPCA 3D8XA 4X9MA 2JB2A 5HXIA 2C72A 4JY3A 5CQFA 2CFYA 4J31A 4B1BA 3ZYXA 1D7LA 2VZ2A 2GV8A 1D7YA 1PXAA 4B69A 1D4DA 4OPTA 2XFQA 2AQJA 3AEEA 2XFOA 3CMMA 4KX6A 1NHSA 1E6EA 3P4PA 2WDVA 3CPHG 2XLPA 2EQ8A 3FMWA 2B7SA 3C4NA 1JRYA 2JBVA 2GRTA 3SZWA 2V60A 2VRLA 2FJAA 2YLWA 3AE7A 3ALMA 1CJ4A 1S2QA 3NNEA 4USQA 1Y56A 3CPIG 1GRTA 3ICRA 1FECA 1LPFA 5J60A 1LTXR 1F6MA 5EB5A 4U8MA 4APNA 2RGOA 3UKPA 3OC4A 5JCLA 1M64A 1O94A 2YLXA 1GOSA 3DJEA 4Z43A 1AOGA 1LQUA 3CGCA 3SFDA 4H4ZA 1VG9A 2YLRA 3P4RA 3SXIA 4D04A 2ZZCA 2RABA 3EPTA 4KPRA 3AEGA 1BGNA 4B65A 3K7QX 4GAVA 3VRDB 3D9XA 2TMDA 3SQPA 2PYXA 1CJCA 1PBEA 3C96A 3GYJA 1CF3A 2Q0KA 4Z2UA 2YR5A 3KVEA 5HYMA 2W0HA 2GH5A 4GDPA 2XLTA 1ZP0A 4BJZA 2WDRA 1IUSA 1GT8A 2BCGG 3CNSA 4NTCA 1DOEA 4BK3A 1CC4A 1OJCA 5EB4A 3ZDNA 2C66A 1GRFA 1K0JA 4EIQA 5C3JA 4CCRA 2YG3A 3CPJG 1ZK7A 2DKHA 3L1RA 2Q7VA 3AE3A 1L9DA 3CGDA 3G5SA 2ZZBA 2YWLA 2C65A 1QLBA 3B6DA 4EQRA 2WOIA 2ACZA 3ABVA 3UCLA 1NG4A 3CNDA 5GSNA 4H4RA 1OJAA 1L0VA 5IPYA 2YG7A 1NHRA 4HA6A 3SY4A 4A7AA 2R0GA 1SEZA 3II4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FOH A;  2C76 A;  3F8R A;  2Z5X A;  2WHD A;  4U8L A;  3DK4 A;  2XLU A;  1ONF A;  3KD9 A;  3UTG A;  5BUL A;  2RGJ A;  5EBK A;  1Z6L A;  2A87 A;  4Y4M A;  5FS9 A;  4IVM B;  2TPR A;  1Y0P A;  1H7W A;  3UOZ A;  4H2N A;  2BC0 A;  2V61 A;  1L9E A;  4U8J A;  4H4Q A;  1OJ9 A;  1PBB A;  1XPQ A;  3URH A;  3G5Q A;  2EQ6 A;  1F8R A;  3V3N A;  3VRA A;  3V76 A;  4IVO B;  2XDO A;  3BHF A;  4EIP A;  4ZCD A;  1N4U A;  5J7X A;  3UKH A;  4CCQ A;  4B64 A;  3COX A;  3P4Q A;  4A99 A;  1FL2 A;  4HB9 A;  1Q1W A;  2IVD A;  1GRG A;  1PS9 A;  4GDE A;  3GDN A;  3NT6 A;  2V3A A;  3C4A A;  4C3X A;  3GWD A;  4OPD A;  5M10 A;  4K2X A;  1DOC A;  1H84 A;  4CRT A;  1EL9 A;  5DBJ A;  2C73 A;  3BNU A;  4OPL A;  3M13 A;  3AEB A;  3M0O A;  2EQ7 A;  5EOW A;  2ARD A;  4EQW A;  2OAL A;  4NTD A;  3CIR A;  4Z2R A;  3IHG A;  2VQ7 A;  1BGJ A;  2B9Y A;  2GAH B;  3AEC A;  3IF9 A;  3LB8 A;  2NVK X;  1X31 B;  2WU5 A;  2R0C A;  2YR6 A;  4CNK A;  3UOX A;  4CNJ A;  4K5S A;  3RHA A;  2A89 A;  1M6I A;  2GQW A;  4YSX A;  3DJD A;  4U8O A;  2H88 A;  3H8L A;  3O0H A;  5U63 A;  4GF7 A;  1GND A;  3ALL A;  4J36 A;  2FJD A;  5KVH A;  1IUT A;  4IA6 A;  1CBO A;  4NEV A;  2WEU A;  4ZN0 A;  3BI4 A;  2BS4 A;  3JSK A;  2XCG A;  3NG7 X;  1QO8 A;  3LZW A;  4BJY A;  2WP6 A;  4AP1 A;  4FDC B;  5JCM A;  2GEW A;  2Y6Q A;  4BV6 A;  2WOV A;  4UDQ A;  3DJG X;  1IJH A;  1PBD A;  2WP5 A;  2FJE A;  3LXD A;  3CNP A;  4K7Z A;  1EL5 A;  5KXJ A;  1ZKQ A;  2YVG A;  1N1P A;  4YSH A;  1B37 A;  2Y6R A;  2BCP A;  1PXC A;  2XLR A;  3AD8 B;  1UKV G;  3EAN A;  4H4S A;  3PVC A;  4YTM A;  3RED A;  4TM0 A;  4CY6 A;  1NG3 A;  4YXD A;  5BUK A;  1GRE A;  3GMC A;  4LA1 A;  3GD3 A;  3VR9 A;  1TDE A;  1S2Y A;  1MXT A;  1F8W A;  1JNR A;  1B8S A;  3UKA A;  1EBD A;  4A9W A;  5FS6 A;  1E7P A;  5KVI A;  2E1M A;  2HQM A;  2GVC A;  2WES A;  3QVR A;  1S3B A;  4C74 A;  3LJP A;  2BXS A;  1IUW A;  2QA1 A;  1S3E A;  1OJT A;  1GXF A;  1KSU A;  2BK4 A;  2V5Z A;  3ISH A;  3UTE A;  1GRH A;  4YKF A;  3S61 A;  1KFY A;  1QJD A;  4H2P A;  4O5Q A;  2QAE A;  2YAU A;  3AEF A;  3DGH A;  1GEU A;  2AAQ A;  3AB1 A;  2VQB A;  3CN8 A;  3NTA A;  2YM2 A;  3AYJ A;  3OZ2 A;  1JEH A;  3EAO A;  4UDP A;  3UOV A;  1GES A;  1MO9 A;  5JCK A;  4NEW A;  3DH9 A;  3AD9 B;  4OCG A;  4H4V A;  4J2W A;  1PHH A;  3AE4 A;  1TDO A;  4ECH A;  1CL0 A;  1JNZ A;  3GRS A;  4H4U A;  1Q9I A;  3DA1 A;  4XWR A;  3CGE A;  3UKK A;  3F8P A;  4C3Y A;  4OPG A;  2XVH A;  4O5U A;  3NGC X;  4B68 A;  4H4W A;  3BHK A;  1V59 A;  1GTE A;  4J33 A;  4YT0 A;  1OJD A;  3Q6J A;  3QFA A;  1NEK A;  4WCT A;  3NYC A;  1GAL A;  4LU6 A;  1DNC A;  4Z25 A;  2ZBW A;  2BC1 A;  3AWI A;  4X4J A;  1BF3 A;  2XFN A;  2R0P A;  1EL8 A;  1NHQ A;  3ATQ A;  1L9C A;  4EQS A;  1GRB A;  1PDH A;  5BVA A;  3SM8 A;  1IUU A;  1PBC A;  5LV9 A;  4JNQ A;  3UKF A;  3I3L A;  4UP3 A;  4K8D A;  1K4Q A;  2GR1 A;  4DGK A;  5KOX A;  1YQ4 A;  1FEA A;  3NLC A;  1ELI A;  3NH3 X;  3WE0 A;  3AEA A;  2BYB A;  3DK9 A;  4Y4L A;  3UTH A;  2GMJ A;  3CTY A;  1YQ3 A;  4B66 A;  4H7U A;  5HHF A;  4B63 A;  3IC9 A;  1JRZ A;  4J34 A;  4RG3 A;  4GRT A;  1REO A;  4A6N A;  3NK2 X;  4BK1 A;  3QSS A;  2VOU A;  4AOS A;  4I59 A;  2FBW A;  3K30 A;  4FX9 A;  2WPF A;  1PJ6 A;  5IQ1 A;  2JKC A;  3H4K A;  1KDG A;  2PHH A;  4RSL A;  4EMI A;  2BS2 A;  3K7M X;  5BRT A;  4U8N A;  4H2R A;  2VRM A;  4DNA A;  4RG4 A;  5FS7 A;  2CUL A;  3NIX A;  3NK1 X;  1GET A;  1HYU A;  1LQT A;  2X8H A;  1TDF A;  2GR3 A;  3DME A;  4GUV A;  1PBF A;  2OLN A;  2Q0L A;  2XFP A;  4YKG A;  2RGH A;  2B9X A;  4FK1 A;  1B4V A;  1N4W A;  4TM3 A;  2OA1 A;  3L8K A;  2VVM A;  2GMH A;  3KA7 A;  4PAB A;  3AE9 A;  1NPX A;  1H81 A;  2BK3 A;  4OPI A;  1GRA A;  1E39 A;  2YG6 A;  4I58 A;  2JK6 A;  2GB0 A;  3T37 A;  2XLS A;  2WS3 A;  3VRB A;  2XVF A;  2OAM A;  1D4C A;  1VDC A;  1GER A;  3AE2 A;  2R46 A;  2WET A;  5GRT A;  1JOA A;  1DJN A;  5M0Z A;  4U2S A;  3QFB A;  1XAN A;  3AXB A;  1NHP A;  1VQW A;  2WBA A;  3GMB A;  4U2T A;  5KRQ A;  1O5W A;  2A8X A;  3RP6 A;  3CGB A;  2YLT A;  4LII A;  3NK0 X;  1E1L A;  1YQZ A;  1K0L A;  2DKI A;  4IA5 A;  4OPU A;  4Z24 A;  1GTH A;  1KNP A;  1XHC A;  4K5R A;  2YLS A;  3AYL A;  3P9U A;  2R45 A;  2WP9 A;  1ZOV A;  3B3R A;  3LZX A;  4A5L A;  1LJ1 A;  4YSZ A;  4CBQ A;  2IVE A;  2R9Z A;  3RP7 A;  1H82 A;  3GSI A;  3G5R A;  2YM1 A;  5FS8 A;  5TR3 A;  1O95 A;  3ATR A;  4H4X A;  3PO7 A;  3DJJ A;  2BAB A;  2NPX A;  3NYF A;  4J57 A;  4U2L A;  3UKQ A;  4A65 A;  2XYO A;  3AE6 A;  1ZOY A;  2XVI A;  1CJ3 A;  4IV9 A;  4J56 A;  1IUX A;  2JB1 A;  1VG0 A;  3QJ4 A;  3SFE A;  3ICS A;  3H8I A;  1XDI A;  4EM4 A;  1TYP A;  2X8G A;  4YWO A;  1TYT A;  2BXR A;  2V6O A;  3UKL A;  3BNM A;  3GD4 A;  4H2Q A;  1K0I A;  1GPE A;  2V3B A;  4H4T A;  3E1T A;  2BAC A;  3UP4 A;  3I6D A;  1PXB A;  2AR8 A;  4C5O A;  1NAA A;  4OVI A;  3F8D A;  3AD7 B;  1ZY8 A;  3RP8 A;  5C2T A;  4EMJ A;  4U8I A;  4B67 A;  4GCM A;  3M12 A;  1COY A;  4D03 A;  1JRX A;  1ZDL A;  4Z26 A;  3R9U A;  1F8S A;  2C67 A;  4XWZ A;  4DSG A;  1N4V A;  4GR1 A;  4N9X A;  4TM4 A;  1RSG A;  1D4E A;  2QA2 A;  4JDR A;  2XFU A;  1E1K A;  3UTF A;  3NKS A;  1DOD A;  2IID A;  1CC6 A;  1P2E A;  3FPZ A;  3GDP A;  2CDU A;  2F5Z A;  4PAA A;  3DGZ A;  2YVJ A;  3KKJ A;  3IHM A;  4WX1 A;  2XVJ A;  3LAD A;  4FK1 C;  4AT0 A;  1Q1R A;  1TRB A;  1F3P A;  4AOX A;  3KPF A;  1EL7 A;  1Y56 B;  4H4P A;  4BUR A;  2JAE A;  3CNJ A;  4A79 A;  2FJB A;  3NTD A;  1E1M A;  3DK8 A;  3NYE A;  2R4E A;  1KSS A;  4Y4N A;  3LOV A;  3UOY A;  2WOW A;  2C75 A;  4X9N A;  2X50 A;  3HZL A;  4U8P A;  5ER0 A;  2APG A;  1W4X A;  1KNR A;  1DXL A;  2H89 A;  1BWC A;  2QCU A;  2YG5 A;  3BI5 A;  3BI2 A;  4TLZ A;  1ZMC A;  2C3D A;  2C70 A;  4TLX A;  5U1O A;  2E5V A;  2EQ9 A;  3Q9T A;  4TM1 A;  1PJ5 A;  3GWF A;  4EMW A;  1FCD A;  1LV0 A;  3ADA B;  3FG2 P;  3AE8 A;  2B76 A;  3PS9 A;  3QVP A;  2GAG B;  4JNA A;  2Q6U A;  2GQF A;  2VVL A;  2ZZ0 A;  1BZL A;  4EQX A;  2I0Z A;  2YVF A;  1JU2 A;  3GYI A;  4BK2 A;  2WPE A;  2J3N A;  1ZMD A;  2WQY A;  3AED A;  4U8K A;  4E0V A;  2XVE A;  3P4S A;  4EM3 A;  2OLO A;  3AE5 A;  2X99 A;  3ICT A;  2BA9 A;  3VQR A;  2CVJ A;  2JB3 A;  2E4G A;  4Z2T A;  1DOB A;  2YQU A;  1YKJ A;  2B7R A;  2C64 A;  5JCI A;  1RP0 A;  2YLZ A;  4JY2 A;  2BS3 A;  2WU2 A;  3SGL A;  5L46 A;  3VR8 A;  1H86 A;  2Z5Y A;  1FEB A;  1B5Q A;  1CHU A;  1E1N A;  4JQ9 A;  4H4Y A;  3QSM A;  3ITJ A;  3QSE A;  3CNT A;  5CKU A;  2YR4 A;  4P9S A;  3P1W A;  1LVL A;  3K7T A;  4XXG A;  4USR A;  4NTE A;  2UZZ A;  1VRQ B;  5HY5 A;  1D5T A;  4OPC A;  4YSY A;  4UDR A;  5IQ4 A;  4YTP A;  5FMH A;  1KF6 A;  4DSH A;  2B9W A;  2X3N A;  3NN0 X;  2VVL G;  1P2H A;  2BK5 A;  4NZH A;  5U25 A;  1YY5 A;  1RYI A;  3FIM B;  4JN9 A;  3NN6 X;  1DJQ A;  2YG4 A;  3FBS A;  4A6N B;  1H83 A;  3S5W A;  4REK A;  2R4J A;  2GR0 A;  3NRN A;  1TDN A;  4ADW A;  3ALJ A;  3D1C A;  3IWA A;  4ICY A;  2X8C A;  1CC2 A;  1MOK A;  2C3C A;  4Z44 A;  3KLJ A;  2GR2 A;  3GRT A;  5JCN A;  3RNM A;  4C77 A;  5KOW A;  1ZX9 A;  4M52 A;  1IUV A;  1PJ7 A;  3KU9 A;  1PN0 A;  5KWF A;  1CJ2 A;  4ZCC A;  4AT2 A;  3AE1 A;  1GV4 A;  2GF3 A;  4MJW A;  3V3O A;  1GSN A;  1BKW A;  1H6V A;  1NEN A;  2O9Z A;  2WDQ A;  4AP3 A;  1H7X A;  3NHO X;  3EF6 A;  2C7G A;  1NDA A;  4H50 A;  4CY8 A;  4K22 A;  3AYI A;  4YTN A;  3UP5 A;  1TDK A;  2WPC A;  3D8X A;  4X9M A;  2JB2 A;  5HXI A;  2C72 A;  4JY3 A;  5CQF A;  2CFY A;  4J31 A;  4B1B A;  3ZYX A;  1D7L A;  2VZ2 A;  2GV8 A;  1D7Y A;  1PXA A;  4B69 A;  1D4D A;  4OPT A;  2XFQ A;  2AQJ A;  3AEE A;  2XFO A;  4KX6 A;  1NHS A;  1E6E A;  3P4P A;  2WDV A;  3CPH G;  2XLP A;  2EQ8 A;  3FMW A;  2B7S A;  3C4N A;  1JRY A;  2JBV A;  2GRT A;  2V60 A;  2VRL A;  2FJA A;  2YLW A;  3AE7 A;  3ALM A;  1CJ4 A;  1S2Q A;  3NNE A;  4USQ A;  1Y56 A;  3CPI G;  1GRT A;  3ICR A;  1FEC A;  1LPF A;  5J60 A;  1LTX R;  1F6M A;  5EB5 A;  4U8M A;  4APN A;  2RGO A;  3UKP A;  3OC4 A;  5JCL A;  1M64 A;  1O94 A;  2YLX A;  1GOS A;  3DJE A;  4Z43 A;  1AOG A;  1LQU A;  3CGC A;  3SFD A;  4H4Z A;  1VG9 A;  2YLR A;  3P4R A;  4D04 A;  2ZZC A;  2RAB A;  3EPT A;  4KPR A;  3AEG A;  1BGN A;  4B65 A;  3K7Q X;  3VRD B;  2TMD A;  3SQP A;  2PYX A;  1CJC A;  1PBE A;  3C96 A;  3GYJ A;  1CF3 A;  2Q0K A;  4Z2U A;  2YR5 A;  3KVE A;  5HYM A;  2W0H A;  2GH5 A;  4GDP A;  2XLT A;  1ZP0 A;  4BJZ A;  2WDR A;  1IUS A;  1GT8 A;  2BCG G;  3CNS A;  4NTC A;  1DOE A;  4BK3 A;  1CC4 A;  1OJC A;  5EB4 A;  3ZDN A;  2C66 A;  1GRF A;  1K0J A;  4EIQ A;  5C3J A;  4CCR A;  2YG3 A;  3CPJ G;  1ZK7 A;  2DKH A;  3L1R A;  2Q7V A;  3AE3 A;  1L9D A;  3CGD A;  3G5S A;  2ZZB A;  2YWL A;  2C65 A;  1QLB A;  3B6D A;  4EQR A;  2WOI A;  2ACZ A;  3ABV A;  3UCL A;  1NG4 A;  3CND A;  5GSN A;  4H4R A;  1OJA A;  1L0V A;  5IPY A;  2YG7 A;  1NHR A;  4HA6 A;  4A7A A;  2R0G A;  1SEZ A;  3II4 A; 
#chains in the Genus database with same CATH topology
 2C76 A;  3P93 A;  1FIQ B;  4HCH A;  2A87 A;  3UJF A;  3UOZ A;  1KN0 A;  2XH0 A;  2V61 A;  1L9E A;  4U8J A;  3T2K A;  3G5Q A;  1RM6 B;  3V76 A;  5BOE A;  2XDO A;  1N4U A;  5J7X A;  4CCQ A;  4G74 A;  3P4Q A;  2QDE A;  1Q1W A;  3C4A A;  5M10 A;  3GWD A;  4HN8 A;  4OPL A;  3R0U A;  4DWD A;  2ARD A;  4EQW A;  2OAL A;  3IHG A;  2VQ7 A;  1BGJ A;  3AEC A;  3IF9 A;  3LB8 A;  2GGJ A;  3RHA A;  2W54 A;  3DJD A;  4GF7 A;  3ALL A;  1EC8 A;  1IUT A;  4IA6 A;  4ZN0 A;  2QJM A;  1STZ A;  3FV9 A;  2XCG A;  5KMP A;  5JCM A;  5FJP A;  2WP5 A;  5FJO A;  3DIP A;  1ZKQ A;  4MGG A;  1N1P A;  1NEL A;  3AD8 B;  1UKV G;  3PVC A;  4YXD A;  5BUK A;  4H83 A;  1S2Y A;  2XH7 A;  1B8S A;  5FS6 A;  2AL2 A;  4A3R A;  3CXO A;  3LJP A;  3CXB A;  4E4U A;  2QA1 A;  1OJT A;  1KFY A;  1QJD A;  2YAU A;  3AB1 A;  3NTA A;  3AYJ A;  3NXL A;  3OP2 A;  3AD9 B;  4H4V A;  4J2W A;  1JDF A;  1V97 A;  3NZG A;  4ECH A;  3U9I A;  3NVW B;  3R0K A;  1Q9I A;  3UKK A;  2W55 A;  2XVH A;  3SN1 A;  1RVK A;  3BHK A;  1N62 C;  2POD A;  2QDD A;  1OJD A;  3QFA A;  4YT0 A;  4WCT A;  3NYC A;  3NO1 A;  3TQP A;  1DNC A;  4Z25 A;  2BC1 A;  1BF3 A;  2XFN A;  1GRB A;  4KEM A;  1PBC A;  5LV9 A;  3UKF A;  4IL2 A;  4K8D A;  2PPG A;  3TCS A;  3NLC A;  3UTH A;  2GMJ A;  5HHF A;  4J34 A;  2OO6 A;  3UJE A;  3GYX A;  4BK1 A;  3QSS A;  2W3S A;  1EC9 A;  4I59 A;  2FBW A;  4FX9 A;  4ZCW A;  2WPF A;  2JKC A;  4EMI A;  4U8N A;  4H19 A;  2VRM A;  5FS7 A;  2CUL A;  2OLN A;  2XFP A;  4YKG A;  2ZC8 A;  1JRP A;  3DDM A;  3QKE A;  1NPX A;  1H81 A;  3PK7 A;  1E39 A;  1KKO A;  3T37 A;  2WS3 A;  1NU5 A;  2XVF A;  1D4C A;  2R46 A;  5M0Z A;  2WBA A;  3OZM A;  1E1L A;  2DKI A;  4IA5 A;  4OPU A;  4Z24 A;  1KNP A;  1XHC A;  3BSM A;  2YLS A;  4K8G A;  3AYL A;  2R45 A;  3P9U A;  1KKR A;  2IVE A;  2R9Z A;  3MY9 A;  4EWJ A;  3DJJ A;  3UKQ A;  4U2L A;  4A65 A;  4J57 A;  3STP A;  1CJ3 A;  3UGV A;  3QJ4 A;  4EM4 A;  2BXR A;  3UKL A;  3BNM A;  1GPE A;  2BAC A;  3ES7 A;  1PXB A;  1XS2 A;  4U8I A;  4DSG A;  1WUE A;  1F8S A;  2C67 A;  3N6H A;  2AL1 A;  4N9X A;  4TM4 A;  1E1K A;  3GDP A;  3V3W A;  2CDU A;  3DER A;  1Q1R A;  4A79 A;  3DK8 A;  1KSS A;  2WOW A;  5ER0 A;  2APG A;  2H89 A;  1DXL A;  3VCN A;  2QCU A;  3BI5 A;  2C3D A;  4HCL A;  5U1O A;  2B76 A;  4JNA A;  2I0Z A;  3N4E A;  1N5W C;  1ELS A;  4U8K A;  3P4S A;  4EM3 A;  2GL5 A;  3ICT A;  1YKJ A;  4JY2 A;  1B5Q A;  1E1N A;  3H7V A;  5JRB A;  4H4Y A;  3ITJ A;  5CKU A;  3K7T A;  1D5T A;  4YSY A;  5IQ4 A;  4YTP A;  3NN0 X;  2VVL G;  2BK5 A;  4NZH A;  3T14 A;  3SR6 B;  1DJQ A;  3ALJ A;  4ICY A;  2BRA A;  3NRZ B;  2C3C A;  4DXK A;  4MMW A;  3NVZ B;  5JCN A;  4M52 A;  1CJ2 A;  1GV4 A;  2GF3 A;  3V3O A;  1H6V A;  3ETR B;  2C7G A;  2PTW A;  3GY1 A;  3AYI A;  5HXI A;  2CFY A;  1PXA A;  1D4D A;  2XFQ A;  2XFO A;  1IYX A;  4DN1 A;  3MQT A;  1SJC A;  3MKC A;  3Q4D A;  3CPH G;  2EQ8 A;  3FMW A;  2P0I A;  2FJA A;  3AN1 A;  3ALM A;  4IP4 A;  4USQ A;  4FI4 A;  3CPI G;  1FEC A;  5J60 A;  4DHG A;  3UKP A;  1M64 A;  2YLX A;  1GOS A;  4Z43 A;  2YLR A;  3P4R A;  3EPT A;  3CYJ A;  1BGN A;  3K7Q X;  3D9X A;  2TMD A;  4ENL A;  3C96 A;  4ROP A;  4M6U A;  5HYM A;  2W0H A;  3A7A A;  4GDP A;  4E5T A;  2WDR A;  3CNS A;  1ONE A;  4BK3 A;  1OJC A;  5EB4 A;  1K0J A;  4EIQ A;  1VDV A;  5IDZ A;  1L9D A;  2C65 A;  3DFY A;  2ACZ A;  3UCL A;  3I6T A;  4HA6 A;  3F8R A;  3T6C A;  3OZY A;  2Z5X A;  2XLU A;  1ONF A;  2QQ6 A;  3DFH A;  5ENL A;  4KT2 A;  4Y4M A;  5FS9 A;  2TPR A;  1H7W A;  4E8G A;  1OJ9 A;  1XPQ A;  1F8R A;  3V3N A;  4A6G A;  1BKH A;  3NFU A;  3COX A;  1FL2 A;  4HB9 A;  2IVD A;  1GRG A;  3NT6 A;  2V3A A;  4K2X A;  1H84 A;  3UCD A;  3M13 A;  5EOW A;  3P3B A;  3VFC A;  4KPL A;  2GAH B;  1X31 B;  2NVK X;  2R0C A;  3UOX A;  4YSX A;  4IZG A;  4JN7 A;  3H8L A;  3I6E A;  3RGT A;  2FJD A;  5KVH A;  3T2Z A;  2QGY A;  4H2H A;  2Y6Q A;  3KPK A;  4UDQ A;  3DJG X;  2FJE A;  3RCY A;  3ZVH B;  3DEQ A;  3RED A;  1JCT A;  4CY6 A;  3TWA A;  3DGB A;  3N6J A;  3GMC A;  4LA1 A;  3VR9 A;  1TDE A;  1MXT A;  1F8W A;  1KD0 A;  1EBD A;  3VDG A;  2E1M A;  1IUW A;  1S3E A;  2BK4 A;  1GRH A;  3B97 A;  2VQB A;  2PA6 A;  2YM2 A;  3EAO A;  4UDP A;  3UOV A;  1GES A;  1MO9 A;  3ZLG A;  4GFI A;  1X2G A;  4OCG A;  1JNZ A;  3QPE A;  4XWR A;  3F8P A;  4OPG A;  4O5U A;  1FHV A;  1TZZ A;  4H4W A;  5FJU A;  1NEK A;  4X4J A;  2R0P A;  1EL8 A;  3ATQ A;  4EQS A;  5BVA A;  3T8Q A;  2PCE A;  2GGG A;  3I3L A;  4UP3 A;  1K4Q A;  2GR1 A;  3WE0 A;  1ELI A;  3NH3 X;  3DK9 A;  3U4F A;  4B63 A;  1JRZ A;  4GRT A;  4A6N A;  2VOU A;  3K30 A;  1ECQ A;  1PJ6 A;  3OTR A;  2PGE A;  4RSL A;  1H2I A;  3D46 A;  3NK1 X;  1EC7 A;  3DME A;  3Q45 A;  4GUV A;  3T31 A;  2Q0L A;  3DG3 A;  3QN3 A;  2B9X A;  1N4W A;  4TM3 A;  2OA1 A;  3L8K A;  3AE9 A;  2BK3 A;  2XLS A;  2OAM A;  1N5X A;  5GRT A;  1JOA A;  3QFB A;  1XAN A;  3AXB A;  1NHP A;  1VQW A;  3GMB A;  4U2T A;  2A8X A;  3NK0 X;  1YQZ A;  2PTX A;  2AKZ A;  1ZOV A;  3GSI A;  5FS8 A;  5TR3 A;  1O95 A;  3B9J B;  4H4X A;  2BAB A;  2NPX A;  1EBG A;  3ZVI A;  2GDQ A;  3DG7 A;  2XYO A;  3AE6 A;  1N61 C;  4J56 A;  1VG0 A;  1XDI A;  1TYP A;  4YWO A;  3CAW A;  4H2Q A;  1K0I A;  2RDX A;  2BRY A;  1WUF A;  3EKG A;  2AR8 A;  2AKM A;  3AD7 B;  1ZY8 A;  3RP8 A;  5C2T A;  4GCM A;  1COY A;  1JRX A;  2FKP A;  1N4V A;  4GR1 A;  1RSG A;  1D4E A;  2QA2 A;  4JDR A;  2XFU A;  1CC6 A;  2F5Z A;  4WX1 A;  4FK1 C;  1TRB A;  4BUR A;  2JAE A;  2R4E A;  3UOY A;  4Y4N A;  2C75 A;  4IT1 A;  3K1G A;  3HZL A;  4NNJ A;  1W4X A;  3BJS A;  1N63 C;  2YG5 A;  4TLZ A;  1ZMC A;  3CK5 A;  2EQ9 A;  4TM1 A;  2GGE A;  1LV0 A;  3ADA B;  3FG2 P;  2VVL A;  1BZL A;  1JU2 A;  3GYI A;  2WPE A;  2WQY A;  2BA9 A;  3VQR A;  1MUC A;  2YQU A;  5JCI A;  1RP0 A;  2BS3 A;  2OZT A;  2P3Z A;  4G6H A;  3QSM A;  3ENL A;  3HYW A;  3SN0 A;  1S7M A;  4NTE A;  4II3 A;  4GAP A;  3FJ4 A;  5FMH A;  2B9W A;  1DTN A;  1P2H A;  3R10 A;  5U25 A;  1YY5 A;  1RYI A;  4JN9 A;  3NN6 X;  3MSY A;  2YG4 A;  2OX4 A;  3S5W A;  3VA8 A;  2GR0 A;  4ADW A;  2X8C A;  1T3Q C;  3T4W A;  2GSH A;  1L8P A;  3HW2 A;  4YWS A;  4C77 A;  5KOW A;  1ZX9 A;  3AE1 A;  4MJW A;  2QVH A;  4AP3 A;  3NHO X;  4YTN A;  1TDK A;  3D8X A;  4JY3 A;  5CQF A;  1D7L A;  2VZ2 A;  4B69 A;  3AEE A;  3CMM A;  1NHS A;  3HRD C;  2PU0 A;  2WDV A;  3TWB A;  2JBV A;  3SZW A;  2V60 A;  5G5G B;  1LPF A;  3DG6 A;  1F6M A;  5EB5 A;  2RGO A;  3SSZ A;  1LQU A;  2W3R A;  3CGC A;  3SFD A;  1VG9 A;  5FJT A;  3JW7 A;  4B65 A;  3VRD B;  2P88 A;  2PYX A;  1CF3 A;  2Q0K A;  2YR5 A;  2GH5 A;  3NVY B;  4BJZ A;  1GT8 A;  4NTC A;  1DOE A;  1CC4 A;  2C66 A;  5C3J A;  2PGW A;  2Q7V A;  3CGD A;  3G5S A;  1QLB A;  2OZ8 A;  3B6D A;  3CND A;  1OJA A;  3II4 A;  2PP0 A;  2WHD A;  4U8L A;  3DK4 A;  3KD9 A;  3UTG A;  2RGJ A;  1Z6L A;  4FP1 A;  4H2N A;  2BC0 A;  4H4Q A;  3URH A;  2EQ6 A;  3T9P A;  3VRA A;  4IVO B;  3UKH A;  4GIS A;  4GDE A;  4C3X A;  4OPD A;  4CRT A;  1EL9 A;  3S47 A;  2C73 A;  3BNU A;  2EQ7 A;  3AM9 A;  3CIR A;  2B9Y A;  2HZG A;  2WU5 A;  4CNK A;  4K5S A;  2A89 A;  1M6I A;  3TTE A;  2H88 A;  2E3T A;  5U63 A;  1GND A;  2PP3 A;  2WEU A;  3MZN A;  3NG7 X;  4HNL A;  1QO8 A;  3LZW A;  2WP6 A;  4BV6 A;  3T2Y A;  1PBD A;  4K7Z A;  1EL5 A;  3L5O A;  2YVG A;  3SN4 A;  1B37 A;  2Y6R A;  2BCP A;  2PP1 A;  3EAN A;  4H4S A;  4TM0 A;  3EUB 3;  5BOF A;  1E9I A;  3IJL A;  3DES A;  4G9K A;  2HQM A;  2GVC A;  4C74 A;  4TVW A;  2V5Z A;  3ISH A;  3S61 A;  4H2P A;  3D47 A;  3AEF A;  2AAQ A;  5JCK A;  4NEW A;  3DH9 A;  3IJI A;  3AE4 A;  3FYY A;  3IK4 A;  4H4U A;  4GYP A;  3CGE A;  3GO2 A;  4C3Y A;  3NGC X;  4HYR A;  2C4C A;  1GAL A;  1X2H A;  1NHQ A;  1FHU A;  3HYV A;  3SM8 A;  1IUU A;  3FVD A;  3H70 A;  3AEA A;  2BYB A;  2XH2 A;  1YQ3 A;  4H7U A;  2HXU A;  3SJN A;  2CHR A;  3IJQ A;  3NK2 X;  2PS2 A;  3H4K A;  4DNA A;  4RG4 A;  3NIX A;  1HYU A;  1LQT A;  2X8H A;  3VCC A;  1PBF A;  2PTY A;  2RGH A;  4FK1 A;  1B4V A;  4DX3 A;  3KA7 A;  2VVM A;  2GMH A;  4PAB A;  4OPI A;  1GRA A;  4G7F A;  2YG6 A;  2GB0 A;  1BQG A;  1VDC A;  3AE2 A;  3SZF A;  5KRQ A;  3A7R A;  1O5W A;  3RP6 A;  2YLT A;  2PMQ A;  3SBF A;  1GTH A;  1LJ1 A;  1H82 A;  3PO7 A;  3NYF A;  4ZA0 A;  1ZOY A;  2I5Q A;  4IV9 A;  1IUX A;  3SFE A;  3UJR A;  3H8I A;  4E4F A;  4JN8 A;  4KWS A;  2V6O A;  4HCD A;  2ZAD A;  2V3B A;  3FCP A;  3E1T A;  3RO6 A;  3F8D A;  4IHC A;  3UJS A;  3M12 A;  4Z26 A;  1ZDL A;  2DW7 A;  1DOD A;  3TOY A;  2IID A;  1P2E A;  3FPZ A;  4PAA A;  3DGZ A;  2YVJ A;  3KKJ A;  3LAD A;  2AL2 B;  3KPF A;  1EL7 A;  4H1Z A;  2FJB A;  3NTD A;  3LOV A;  4X9N A;  4U8P A;  4K2S A;  1KNR A;  1BWC A;  4TLX A;  2HXT A;  3Q9T A;  3GWF A;  4EMW A;  3GD6 A;  1FCD A;  4G8T A;  3AE8 A;  3QVP A;  2GAG B;  2Q6U A;  2GQF A;  1TE6 A;  2J3N A;  3R11 A;  3ES8 A;  3AED A;  3AE5 A;  2CVJ A;  3QTP A;  4Z17 A;  4Z2T A;  3RIT A;  1DOB A;  3H12 A;  2YLZ A;  4II2 A;  2WU2 A;  3VR8 A;  1CHU A;  4JQ9 A;  3UXL A;  3HYX A;  3QSE A;  3CNT A;  1R6W A;  4P9S A;  3P1W A;  3PWG A;  2DW6 A;  2UZZ A;  5HY5 A;  4MKS A;  4OPC A;  3ZVH A;  5KMR A;  3FXG A;  1KF6 A;  2X3N A;  4A35 A;  3FIM B;  5J04 A;  4GYP C;  2R4J A;  3IWA A;  4J3Z A;  1CC2 A;  1JRO A;  1MOK A;  1FFV C;  4Z44 A;  2OPJ A;  3UCC A;  1IUV A;  3KU9 A;  1PN0 A;  5KWF A;  4ZCC A;  3A7U A;  4AT2 A;  4TVY A;  1GSN A;  1BKW A;  3QLD A;  1NEN A;  4K1W A;  3TW9 A;  1H7X A;  2HNE A;  4CY8 A;  4K22 A;  3UP5 A;  4J31 A;  3P0W A;  1D7Y A;  3S5S A;  4OPT A;  3ZLF A;  1E6E A;  3P4P A;  2XLP A;  1N60 C;  2B7S A;  3C4N A;  1TKK A;  3V5C A;  1CJ4 A;  1S2Q A;  1LTX R;  4APN A;  3PWI A;  3DJE A;  1O94 A;  1AOG A;  4ZOH B;  3MWC A;  1MDR A;  2ZZC A;  2P8C A;  4GME A;  3AEG A;  3GYJ A;  2OKT A;  3UJ2 A;  1KCZ A;  2XLT A;  2BCG G;  3ZDN A;  4CCR A;  3CPJ G;  3SQS A;  3TJ4 A;  2YWL A;  4E6M A;  4EQR A;  1NG4 A;  5GSN A;  4H4R A;  2OQH A;  1L0V A;  1FO4 A;  2YG7 A;  3SY4 A;  1FOH A;  3BOX A;  4Z1Y A;  5BUL A;  3AMZ A;  4IL0 A;  5EBK A;  4IVM B;  1Y0P A;  1PBB A;  3SZC A;  4HPN A;  3BHF A;  4EIP A;  4ZCD A;  1R0M A;  4B64 A;  2POZ A;  4A99 A;  5KNL A;  1PS9 A;  3GDN A;  1DOC A;  5DBJ A;  3AEB A;  3M0O A;  5G5H B;  3T0K A;  4NTD A;  4Z2R A;  2YR6 A;  4CNJ A;  2GQW A;  4U8O A;  4HNC A;  3O0H A;  2OQY A;  4J36 A;  1MDL A;  6ENL A;  1CBO A;  4NEV A;  3BI4 A;  2BS4 A;  3V5F A;  3JSK A;  4BJY A;  1SJB A;  4AP1 A;  4FDC B;  2GEW A;  3HPF A;  2WOV A;  1IJH A;  3CNP A;  3LXD A;  5KXJ A;  4YSH A;  1PXC A;  4IP5 A;  2XLR A;  4YTM A;  1NG3 A;  1GRE A;  3GD3 A;  1PDY A;  1JNR A;  3UKA A;  3N4F A;  4A9W A;  1E7P A;  5KVI A;  3QVR A;  2WES A;  1ZXI C;  2OFJ A;  1S3B A;  2BXS A;  3OPS A;  1GXF A;  2XGZ A;  1KSU A;  3UTE A;  4YKF A;  2PU1 A;  3ZLH A;  4O5Q A;  2QAE A;  2GGI A;  3DGH A;  1GEU A;  3CN8 A;  3OZ2 A;  1JEH A;  1P43 A;  1PHH A;  1TDO A;  2NQL A;  1CL0 A;  3GRS A;  4F4R A;  3DA1 A;  2MNR A;  3JVA A;  4B68 A;  5KMS A;  1XPY A;  1W6T A;  1V59 A;  1GTE A;  4J33 A;  4GGH A;  3Q6J A;  3VC5 A;  4LU6 A;  2ZBW A;  3AWI A;  2ONE A;  1L9C A;  1PDH A;  4JNQ A;  2QJJ A;  5KOX A;  4DGK A;  1YQ4 A;  1FEA A;  1EBH A;  4Y4L A;  3CTY A;  5FJR A;  2FYM A;  4B66 A;  3IC9 A;  4RG3 A;  2OVL A;  1REO A;  3UXK A;  4AOS A;  3EEZ A;  5IQ1 A;  1KDG A;  2PHH A;  2BS2 A;  3K7M X;  5BRT A;  4H2R A;  1GET A;  1TDF A;  2GR3 A;  2OLA A;  4DYE A;  3CT2 A;  3SZ0 A;  2MUC A;  1JPM A;  4G73 A;  2PSN A;  4I58 A;  2JK6 A;  3VRB A;  1VQZ A;  1GER A;  1OEP A;  2WET A;  1DJN A;  4U2S A;  1SJD A;  3CGB A;  4LII A;  1K0L A;  2OZ3 A;  4K5R A;  4A5L A;  2WP9 A;  3LZX A;  3B3R A;  3SX6 A;  4YSZ A;  4CBQ A;  3RP7 A;  3G5R A;  2YM1 A;  4G6G A;  1SJA A;  3ATR A;  4X2P A;  1MNS A;  2XVI A;  2JB1 A;  3ICS A;  4NWZ A;  2X8G A;  1TYT A;  3GD4 A;  4H4T A;  3NS1 B;  3UP4 A;  3I6D A;  4C5O A;  1NAA A;  4OVI A;  2P8B A;  3MUC A;  1SB3 B;  4EMJ A;  3SYI A;  4B67 A;  3KUM A;  4D03 A;  3R9U A;  3VC6 A;  4XWZ A;  2PTZ A;  3UTF A;  3NKS A;  4GIR A;  1JPD X;  7ENL A;  5KMQ A;  3RRA A;  3IHM A;  3NVV B;  2XVJ A;  3R1Z A;  4AT0 A;  1F3P A;  4AOX A;  1Y56 B;  4H4P A;  3CNJ A;  1E1M A;  3NYE A;  2X50 A;  3H8A A;  3PG6 A;  3PFR A;  3V4B A;  3BI2 A;  2C70 A;  2E5V A;  1PJ5 A;  3PS9 A;  2ZZ0 A;  4EQX A;  2YVF A;  4BK2 A;  1F9C A;  1ZMD A;  4E0V A;  2XVE A;  2O56 A;  2OLO A;  2X99 A;  2JB3 A;  2E4G A;  2XH4 A;  2B7R A;  2C64 A;  5EU9 A;  5L46 A;  3SGL A;  1H86 A;  4JHM A;  2Z5Y A;  1FEB A;  2YR4 A;  1LVL A;  4XXG A;  4USR A;  3JZU A;  1VRQ B;  4UDR A;  4DSH A;  4GGB A;  2E5A A;  3FBS A;  4A6N B;  1H83 A;  4REK A;  3NRN A;  1TDN A;  3D1C A;  3TJI A;  3R25 A;  2QJN A;  3KLJ A;  2GR2 A;  1MRA A;  3CB3 A;  3GRT A;  3RNM A;  2XSX A;  1PJ7 A;  2O9Z A;  2WDQ A;  3EF6 A;  1NDA A;  4H50 A;  1FFU C;  3OW1 A;  2WPC A;  4X9M A;  2JB2 A;  2C72 A;  4B1B A;  3ZYX A;  2GV8 A;  2AQJ A;  4KX6 A;  1WYG A;  3RR1 A;  1JRY A;  2GRT A;  2VRL A;  1YEY A;  2YLW A;  2GGH A;  3R07 C;  3AE7 A;  3NNE A;  1Y56 A;  1GRT A;  3ICR A;  4U8M A;  3OC4 A;  5JCL A;  4H4Z A;  4M0X A;  4D04 A;  3SXI A;  2RAB A;  4KPR A;  4GAV A;  3I4K A;  3SQP A;  1CJC A;  1PBE A;  4Z2U A;  3KVE A;  3GC2 A;  3THU A;  1ZP0 A;  4J1O A;  1P48 A;  1IUS A;  1GRF A;  1PDZ A;  2OG9 A;  2YG3 A;  1ZK7 A;  2DKH A;  3L1R A;  3AE3 A;  2ZZB A;  2WOI A;  3ABV A;  5IPY A;  1NHR A;  4A7A A;  2R0G A;  1SEZ A; 
#chains in the Genus database with same CATH homology
 1FOH A;  2C76 A;  3F8R A;  2Z5X A;  2WHD A;  4U8L A;  3DK4 A;  2XLU A;  1ONF A;  3KD9 A;  3UTG A;  5BUL A;  2RGJ A;  5EBK A;  1Z6L A;  2A87 A;  4Y4M A;  5FS9 A;  4IVM B;  2TPR A;  1Y0P A;  1KN0 A;  1H7W A;  3UOZ A;  4H2N A;  2BC0 A;  2V61 A;  1L9E A;  4U8J A;  4H4Q A;  1OJ9 A;  3T2K A;  1PBB A;  1XPQ A;  3URH A;  3G5Q A;  2EQ6 A;  3SZC A;  1F8R A;  3V3N A;  3VRA A;  3V76 A;  4IVO B;  2XDO A;  3BHF A;  4EIP A;  4ZCD A;  1N4U A;  5J7X A;  3UKH A;  4CCQ A;  4G74 A;  3COX A;  3P4Q A;  4B64 A;  4A99 A;  1FL2 A;  4HB9 A;  1Q1W A;  2IVD A;  1GRG A;  1PS9 A;  4GDE A;  5KNL A;  3GDN A;  3NT6 A;  2V3A A;  3C4A A;  4C3X A;  3GWD A;  4OPD A;  5M10 A;  4K2X A;  1DOC A;  1H84 A;  4CRT A;  1EL9 A;  5DBJ A;  2C73 A;  3BNU A;  4OPL A;  3M13 A;  3AEB A;  3M0O A;  2EQ7 A;  5EOW A;  2ARD A;  3T0K A;  4EQW A;  2OAL A;  4NTD A;  3CIR A;  4Z2R A;  3IHG A;  2VQ7 A;  1BGJ A;  2B9Y A;  2GAH B;  3AEC A;  3IF9 A;  3LB8 A;  2NVK X;  1X31 B;  2WU5 A;  2R0C A;  2YR6 A;  4CNK A;  3UOX A;  4CNJ A;  4K5S A;  3RHA A;  2A89 A;  1M6I A;  2GQW A;  4YSX A;  3DJD A;  4U8O A;  2H88 A;  3H8L A;  3O0H A;  5U63 A;  4GF7 A;  1GND A;  3ALL A;  4J36 A;  2FJD A;  5KVH A;  1IUT A;  3T2Z A;  4IA6 A;  1CBO A;  4NEV A;  2WEU A;  4ZN0 A;  3BI4 A;  2BS4 A;  3JSK A;  2XCG A;  3NG7 X;  1QO8 A;  3LZW A;  4BJY A;  2WP6 A;  5KMP A;  4AP1 A;  4FDC B;  5JCM A;  2GEW A;  2Y6Q A;  3KPK A;  4BV6 A;  2WOV A;  4UDQ A;  3T2Y A;  3DJG X;  1IJH A;  1PBD A;  2WP5 A;  2FJE A;  3LXD A;  3CNP A;  4K7Z A;  1EL5 A;  5KXJ A;  1ZKQ A;  2YVG A;  3L5O A;  1N1P A;  4YSH A;  1B37 A;  2Y6R A;  2BCP A;  1PXC A;  2XLR A;  3AD8 B;  1UKV G;  3EAN A;  4H4S A;  3PVC A;  4YTM A;  3RED A;  4TM0 A;  4CY6 A;  1NG3 A;  4YXD A;  5BUK A;  1GRE A;  3GMC A;  4LA1 A;  3GD3 A;  3VR9 A;  1TDE A;  1S2Y A;  1MXT A;  1F8W A;  1JNR A;  1B8S A;  3UKA A;  4G9K A;  1EBD A;  4A9W A;  5FS6 A;  1E7P A;  5KVI A;  2E1M A;  2HQM A;  2GVC A;  2WES A;  3QVR A;  1S3B A;  4C74 A;  3LJP A;  2BXS A;  1IUW A;  2QA1 A;  1S3E A;  1OJT A;  1GXF A;  1KSU A;  2BK4 A;  2V5Z A;  3ISH A;  3UTE A;  1GRH A;  4YKF A;  3S61 A;  1KFY A;  1QJD A;  4H2P A;  4O5Q A;  2QAE A;  2YAU A;  3AEF A;  3DGH A;  1GEU A;  2AAQ A;  3AB1 A;  2VQB A;  3CN8 A;  3NTA A;  2YM2 A;  3AYJ A;  3OZ2 A;  1JEH A;  3EAO A;  4UDP A;  3UOV A;  1GES A;  1MO9 A;  5JCK A;  4NEW A;  3DH9 A;  3AD9 B;  4OCG A;  4H4V A;  4J2W A;  1PHH A;  3AE4 A;  1TDO A;  4ECH A;  1CL0 A;  1JNZ A;  3GRS A;  4H4U A;  1Q9I A;  3DA1 A;  4XWR A;  3CGE A;  3UKK A;  3F8P A;  4C3Y A;  4OPG A;  2XVH A;  4O5U A;  3NGC X;  4B68 A;  4H4W A;  5KMS A;  3BHK A;  1V59 A;  1GTE A;  4J33 A;  4YT0 A;  1OJD A;  3Q6J A;  3QFA A;  1NEK A;  4WCT A;  2C4C A;  3NYC A;  1GAL A;  4LU6 A;  1DNC A;  4Z25 A;  2ZBW A;  2BC1 A;  3AWI A;  4X4J A;  1BF3 A;  2XFN A;  2R0P A;  1EL8 A;  1NHQ A;  3ATQ A;  3HYV A;  1L9C A;  4EQS A;  1GRB A;  1PDH A;  5BVA A;  3SM8 A;  1IUU A;  1PBC A;  5LV9 A;  4JNQ A;  3UKF A;  3I3L A;  4UP3 A;  4K8D A;  1K4Q A;  2GR1 A;  4DGK A;  5KOX A;  1YQ4 A;  1FEA A;  3NLC A;  1ELI A;  3NH3 X;  3WE0 A;  3AEA A;  2BYB A;  3DK9 A;  4Y4L A;  3UTH A;  2GMJ A;  3CTY A;  1YQ3 A;  4B66 A;  4H7U A;  5HHF A;  4B63 A;  3IC9 A;  1JRZ A;  4J34 A;  4RG3 A;  4GRT A;  1REO A;  3GYX A;  4A6N A;  3NK2 X;  4BK1 A;  3QSS A;  2VOU A;  4AOS A;  4I59 A;  2FBW A;  3K30 A;  4FX9 A;  2WPF A;  1PJ6 A;  5IQ1 A;  2JKC A;  3H4K A;  1KDG A;  2PHH A;  4RSL A;  1H2I A;  4EMI A;  2BS2 A;  3K7M X;  5BRT A;  4U8N A;  4H2R A;  2VRM A;  4DNA A;  4RG4 A;  5FS7 A;  2CUL A;  3NIX A;  3NK1 X;  1GET A;  1HYU A;  1LQT A;  2X8H A;  1TDF A;  2GR3 A;  3DME A;  4GUV A;  1PBF A;  2OLN A;  2Q0L A;  2XFP A;  3T31 A;  4YKG A;  2RGH A;  2B9X A;  4FK1 A;  3SZ0 A;  1B4V A;  1N4W A;  4TM3 A;  2OA1 A;  3L8K A;  2VVM A;  2GMH A;  3KA7 A;  4G73 A;  3AE9 A;  4PAB A;  1NPX A;  1H81 A;  2BK3 A;  4OPI A;  1GRA A;  1E39 A;  2YG6 A;  4I58 A;  2JK6 A;  2GB0 A;  3T37 A;  2XLS A;  2WS3 A;  3VRB A;  2XVF A;  2OAM A;  1D4C A;  1VDC A;  1GER A;  3AE2 A;  3SZF A;  2R46 A;  2WET A;  5GRT A;  1JOA A;  1DJN A;  5M0Z A;  4U2S A;  3QFB A;  1XAN A;  3AXB A;  1NHP A;  1VQW A;  2WBA A;  3GMB A;  4U2T A;  5KRQ A;  1O5W A;  2A8X A;  3RP6 A;  3CGB A;  2YLT A;  4LII A;  3NK0 X;  1E1L A;  1YQZ A;  1K0L A;  2DKI A;  4IA5 A;  4OPU A;  4Z24 A;  1GTH A;  1KNP A;  1XHC A;  4K5R A;  2YLS A;  3AYL A;  3P9U A;  2R45 A;  2WP9 A;  1ZOV A;  3B3R A;  3LZX A;  4A5L A;  1LJ1 A;  3SX6 A;  4YSZ A;  4CBQ A;  2IVE A;  2R9Z A;  3RP7 A;  1H82 A;  3GSI A;  3G5R A;  2YM1 A;  5FS8 A;  5TR3 A;  1O95 A;  4G6G A;  3ATR A;  4H4X A;  3PO7 A;  3DJJ A;  2BAB A;  2NPX A;  3NYF A;  4J57 A;  4U2L A;  3UKQ A;  4A65 A;  2XYO A;  3AE6 A;  1ZOY A;  2XVI A;  1CJ3 A;  4IV9 A;  4J56 A;  1IUX A;  2JB1 A;  1VG0 A;  3QJ4 A;  3SFE A;  3ICS A;  3H8I A;  1XDI A;  4EM4 A;  1TYP A;  2X8G A;  4YWO A;  1TYT A;  2BXR A;  4NWZ A;  2V6O A;  3UKL A;  3BNM A;  3GD4 A;  4H2Q A;  1K0I A;  1GPE A;  2V3B A;  4H4T A;  2BRY A;  3E1T A;  2BAC A;  3UP4 A;  3I6D A;  1PXB A;  2AR8 A;  4C5O A;  1NAA A;  4OVI A;  3F8D A;  3AD7 B;  1ZY8 A;  3RP8 A;  5C2T A;  4EMJ A;  4U8I A;  3SYI A;  4B67 A;  4GCM A;  3M12 A;  1COY A;  4D03 A;  1JRX A;  1ZDL A;  4Z26 A;  3R9U A;  1F8S A;  2C67 A;  4XWZ A;  4DSG A;  1N4V A;  4GR1 A;  4N9X A;  4TM4 A;  1RSG A;  1D4E A;  2QA2 A;  4JDR A;  2XFU A;  1E1K A;  3UTF A;  3NKS A;  1DOD A;  2IID A;  1CC6 A;  1P2E A;  3FPZ A;  3GDP A;  2CDU A;  2F5Z A;  4PAA A;  3DGZ A;  2YVJ A;  3KKJ A;  5KMQ A;  3IHM A;  4WX1 A;  2XVJ A;  3LAD A;  4FK1 C;  4AT0 A;  1Q1R A;  1TRB A;  1F3P A;  4AOX A;  3KPF A;  1EL7 A;  1Y56 B;  4H4P A;  4BUR A;  2JAE A;  3CNJ A;  4A79 A;  2FJB A;  3NTD A;  1E1M A;  3DK8 A;  3NYE A;  2R4E A;  1KSS A;  4Y4N A;  3LOV A;  3UOY A;  2WOW A;  2C75 A;  4X9N A;  2X50 A;  3HZL A;  4NNJ A;  4U8P A;  5ER0 A;  2APG A;  1W4X A;  1KNR A;  1DXL A;  3PG6 A;  2H89 A;  1BWC A;  2QCU A;  2YG5 A;  3BI5 A;  3BI2 A;  4TLZ A;  1ZMC A;  2C3D A;  2C70 A;  4TLX A;  5U1O A;  2E5V A;  2EQ9 A;  3Q9T A;  4TM1 A;  1PJ5 A;  3GWF A;  4EMW A;  1FCD A;  1LV0 A;  3ADA B;  3FG2 P;  3AE8 A;  2B76 A;  3PS9 A;  3QVP A;  2GAG B;  4JNA A;  2Q6U A;  2GQF A;  2VVL A;  2ZZ0 A;  1BZL A;  4EQX A;  2I0Z A;  2YVF A;  1JU2 A;  3GYI A;  4BK2 A;  2WPE A;  2J3N A;  1ZMD A;  2WQY A;  3AED A;  4U8K A;  4E0V A;  2XVE A;  3P4S A;  4EM3 A;  2OLO A;  3AE5 A;  2X99 A;  3ICT A;  2BA9 A;  3VQR A;  2CVJ A;  2JB3 A;  2E4G A;  4Z2T A;  1DOB A;  2YQU A;  1YKJ A;  2B7R A;  2C64 A;  5JCI A;  1RP0 A;  2YLZ A;  4JY2 A;  2BS3 A;  2WU2 A;  4II2 A;  3SGL A;  3VR8 A;  5L46 A;  1H86 A;  2Z5Y A;  1FEB A;  1B5Q A;  1CHU A;  1E1N A;  4G6H A;  5JRB A;  4JQ9 A;  4H4Y A;  3HYX A;  3QSM A;  3HYW A;  3ITJ A;  3QSE A;  1S7M A;  3CNT A;  5CKU A;  2YR4 A;  4P9S A;  3P1W A;  1LVL A;  3K7T A;  4XXG A;  4USR A;  4NTE A;  2UZZ A;  1VRQ B;  4II3 A;  1D5T A;  5HY5 A;  4GAP A;  4OPC A;  5KMR A;  4YSY A;  4UDR A;  5IQ4 A;  4YTP A;  5FMH A;  1KF6 A;  4DSH A;  2B9W A;  2X3N A;  3NN0 X;  2VVL G;  1P2H A;  2BK5 A;  4NZH A;  3T14 A;  5U25 A;  1YY5 A;  1RYI A;  3FIM B;  4JN9 A;  3NN6 X;  1DJQ A;  2YG4 A;  3FBS A;  4A6N B;  1H83 A;  3S5W A;  4REK A;  2R4J A;  2GR0 A;  3NRN A;  1TDN A;  4ADW A;  3ALJ A;  3D1C A;  3IWA A;  4ICY A;  2X8C A;  1CC2 A;  2BRA A;  1MOK A;  2C3C A;  4Z44 A;  3KLJ A;  2GR2 A;  3GRT A;  5JCN A;  3RNM A;  4C77 A;  5KOW A;  1ZX9 A;  4M52 A;  1IUV A;  1PJ7 A;  3KU9 A;  1PN0 A;  5KWF A;  1CJ2 A;  4ZCC A;  4AT2 A;  3AE1 A;  1GV4 A;  2GF3 A;  4MJW A;  3V3O A;  1GSN A;  1BKW A;  1H6V A;  1NEN A;  2O9Z A;  2WDQ A;  4AP3 A;  1H7X A;  3NHO X;  3EF6 A;  2C7G A;  1NDA A;  4H50 A;  4CY8 A;  4K22 A;  3AYI A;  4YTN A;  3UP5 A;  1TDK A;  2WPC A;  3D8X A;  4X9M A;  2JB2 A;  5HXI A;  2C72 A;  4JY3 A;  5CQF A;  2CFY A;  4J31 A;  4B1B A;  3ZYX A;  1D7L A;  2VZ2 A;  2GV8 A;  1D7Y A;  1PXA A;  4B69 A;  1D4D A;  4OPT A;  2XFQ A;  2AQJ A;  3AEE A;  2XFO A;  3CMM A;  4KX6 A;  1NHS A;  1E6E A;  3P4P A;  2WDV A;  3CPH G;  2XLP A;  2EQ8 A;  3FMW A;  2B7S A;  3C4N A;  1JRY A;  2JBV A;  2GRT A;  3SZW A;  2V60 A;  2VRL A;  2FJA A;  2YLW A;  3AE7 A;  3ALM A;  1CJ4 A;  1S2Q A;  3NNE A;  4USQ A;  1Y56 A;  3CPI G;  1GRT A;  3ICR A;  1FEC A;  1LPF A;  5J60 A;  1LTX R;  1F6M A;  5EB5 A;  4U8M A;  4APN A;  2RGO A;  3UKP A;  3OC4 A;  5JCL A;  1M64 A;  1O94 A;  2YLX A;  1GOS A;  3DJE A;  4Z43 A;  1AOG A;  1LQU A;  3CGC A;  3SFD A;  4H4Z A;  1VG9 A;  2YLR A;  3P4R A;  3SXI A;  4D04 A;  2ZZC A;  2RAB A;  3EPT A;  4KPR A;  3AEG A;  1BGN A;  4B65 A;  3K7Q X;  4GAV A;  3VRD B;  3D9X A;  2TMD A;  3SQP A;  2PYX A;  1CJC A;  1PBE A;  3C96 A;  3GYJ A;  1CF3 A;  2Q0K A;  4Z2U A;  2YR5 A;  3KVE A;  5HYM A;  2W0H A;  2GH5 A;  4GDP A;  2XLT A;  1ZP0 A;  4BJZ A;  2WDR A;  1IUS A;  1GT8 A;  2BCG G;  3CNS A;  4NTC A;  1DOE A;  4BK3 A;  1CC4 A;  1OJC A;  5EB4 A;  3ZDN A;  2C66 A;  1GRF A;  1K0J A;  4EIQ A;  5C3J A;  4CCR A;  2YG3 A;  3CPJ G;  1ZK7 A;  2DKH A;  3L1R A;  2Q7V A;  3AE3 A;  1L9D A;  3CGD A;  3G5S A;  2ZZB A;  2YWL A;  2C65 A;  1QLB A;  3B6D A;  4EQR A;  2WOI A;  2ACZ A;  3ABV A;  3UCL A;  1NG4 A;  3CND A;  5GSN A;  4H4R A;  1OJA A;  1L0V A;  5IPY A;  2YG7 A;  1NHR A;  4HA6 A;  3SY4 A;  4A7A A;  2R0G A;  1SEZ A;  3II4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...