5FS9A

Crystal structure of the g338e mutant of human apoptosis inducing factor
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
487
structure length
459
Chain Sequence
DKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKENMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure/Function Relations in Aifm1 Variants Associated with Neurodegenerative Disorders.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
total genus 152
structure length 459
sequence length 487
chains with identical sequence B
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fs9A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs9A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs9A01
3BI2A 2YLRA 5EB4A 2R45A 1Q9IA 4U8OA 4Y4NA 3ZYXA 2VQ7A 4IV9A 4JNAA 2TPRA 3CGDA 1VG0A 4A9WA 3NG7X 3AD9B 1NDAA 1K0IA 1O95A 2GQFA 2V3AA 4J33A 2C76A 1NG4A 1PDHA 3C4AA 3FMWA 3OZ2A 4P9SA 3G5RA 1TYTA 3KD9A 3K7TA 2JK6A 2B9YA 3ALLA 3DK8A 4AP1A 1RP0A 3BI4A 3NGCX 2GEWA 1GRGA 1GOSA 2GR0A 4BK1A 4CNJA 4ECHA 2YG6A 1E1MA 1N4WA 2BXSA 2YLTA 2RABA 1JRYA 1M6IA 1NHPA 5C2TA 5TR3A 1PS9A 3K7MX 3S5WA 1FEBA 1GRTA 3CNDA 4IA5A 1NHSA 4PAAA 2OLNA 3F8RA 2GR3A 1S3BA 2FJAA 2WDRA 5KOWA 5IQ4A 3NTAA 2O9ZA 3ATQA 1DOEA 2VRMA 3GD3A 3QFAA 1CHUA 2VRLA 2XCGA 3P4PA 5KOXA 2YVJA 1QLBA 3NN6X 5KXJA 4GUVA 2C72A 1CBOA 3AE2A 1E1KA 1CL0A 2V60A 2XFQA 1KF6A 1PBCA 3NHOX 2BK3A 2XLSA 4HB9A 2GR1A 2WQYA 3ADAB 4EQXA 3H8LA 3ITJA 1CJ2A 1BGNA 2QA2A 1ZY8A 5L46A 2WS3A 3P9UA 3P1WA 3L1RA 3UP4A 1CJCA 3IC9A 2FJDA 3GYJA 3IHGA 1S3EA 2WOIA 1N4UA 2XLPA 3S61A 4B68A 5JCLA 1NG3A 4Z24A 3AB1A 2FJEA 2YQUA 2A8XA 3D8XA 2C75A 4XWRA 4ZN0A 2AQJA 4NTEA 3LJPA 1PXAA 3VR8A 1KFYA 3P4QA 1Y56B 3SFDA 1B4VA 4K2XA 2IVEA 4Z2UA 1YY5A 4U8PA 5CKUA 4A7AA 1JOAA 1H84A 3PO7A 1MO9A 1B5QA 2BK4A 2Q7VA 3NH3X 4YT0A 2AR8A 3UTHA 1EL9A 2GF3A 2VOUA 1FOHA 3CGCA 1JRXA 5FMHA 3CIRA 3UKFA 4GDEA 2GMJA 4J36A 2EQ8A 4AT2A 3DK4A 1FEAA 2WP5A 3Q6JA 2RGOA 4GR1A 2R0CA 3LZXA 2YG3A 4OCGA 4YSXA 2BXRA 2XFNA 1H83A 2DKHA 3P4SA 3AE3A 4ZCDA 4RG3A 3LXDA 1SEZA 2R46A 3AEEA 5CQFA 3BNUA 4GCMA 1GTHA 4MJWA 3WE0A 4J2WA 4AP3A 1K0LA 2WHDA 3NIXA 3DJGX 2AAQA 1XPQA 4UDRA 4EM4A 4H4TA 2OA1A 4FK1A 4OPDA 1VDCA 2H89A 5DBJA 1S2YA 4BK3A 3AE8A 2XVEA 2YAUA 1EL7A 5KRQA 5EBKA 3SQPA 1ZMDA 1P2HA 2VVMA 4H4QA 4EIPA 1VQWA 1OJTA 1AOGA 4Z2RA 1PBEA 2F5ZA 5JCIA 1IUSA 1IUTA 2WP9A 2GQWA 2CFYA 5JCMA 2WPFA 3M0OA 1YKJA 1GNDA 4YTMA 3UOXA 3VRDB 1F3PA 2R9ZA 1K0JA 1EBDA 3AWIA 3BHFA 3AE5A 2FJBA 3RNMA 3DJJA 2YG4A 3QJ4A 4OPUA 2JAEA 3B3RA 3C96A 3GD4A 4I58A 5IPYA 2BCGG 5FS8A 3RHAA 3AD8B 4EQWA 1GV4A 3NTDA 4J57A 1LV0A 1OJAA 3L8KA 1TRBA 5M0ZA 2XDOA 3CNSA 4A5LA 4LU6A 2XVJA 4K7ZA 4U8MA 5EOWA 3DMEA 4D03A 2WPEA 3UKAA 3ISHA 4PABA 2FBWA 3ALMA 3AEFA 4Z25A 2TMDA 1PJ7A 2GAGB 1W4XA 3AYLA 4YTPA 2BC1A 1PBFA 3CTYA 1FL2A 4NEVA 3FIMB 2ZZCA 3CNPA 3FPZA 4J34A 2NPXA 1JRZA 3NN0X 3URHA 3NK2X 3GDPA 1BKWA 3I6DA 2WU2A 1KSUA 5LV9A 3AE6A 4H2NA 1JNRA 4XWZA 1CC6A 5BULA 2Q0KA 3CNTA 2XFPA 2BS3A 4AOXA 2C3DA 4YKGA 2V6OA 5KVIA 2IVDA 5M10A 1FCDA 1KSSA 3M12A 3UTFA 4OPGA 4AT0A 4B65A 2R4EA 2V3BA 1GSNA 2UZZA 2YVFA 4EIQA 1H6VA 2R4JA 3JSKA 1E7PA 3NK1X 4B63A 3QFBA 4U2TA 3AEAA 1Q1WA 4I59A 5J60A 3ABVA 4ZCCA 1OJDA 5JCKA 2R0PA 3H4KA 4EM3A 1CJ4A 4HA6A 1CC4A 4KPRA 4U8NA 3AEDA 4AOSA 3NYCA 4C5OA 1LJ1A 2Y6RA 3KVEA 3QSEA 5U63A 2IIDA 3G5SA 3KPFA 1D4DA 4A6NA 4O5QA 3DK9A 1QO8A 1IUUA 2B76A 3GWFA 5KWFA 1GT8A 3P4RA 4USRA 4DSGA 3VRAA 3FBSA 4YSZA 4DGKA 1NHQA 4E0VA 4USQA 2WU5A 2YM1A 4JN9A 4YKFA 1NAAA 3BHKA 3GYIA 2QA1A 1JEHA 5U25A 2E1MA 1DOBA 2Q0LA 2YWLA 3AD7B 4A6NB 2GR2A 1PJ6A 1PXCA 2C7GA 3AE9A 1PHHA 4GDPA 4RG4A 1KDGA 3VQRA 3F8PA 4B66A 1IJHA 1CJ3A 1LQTA 2EQ9A 4Y4MA 3PS9A 2YR4A 3AEGA 2B7SA 1H82A 1GTEA 4Z2TA 1M64A 4Y4LA 3AE7A 1BZLA 4K5RA 4EQSA 4U8LA 4YXDA 1TYPA 3R9UA 4ADWA 1DOCA 1D7LA 4H50A 2JBVA 2X3NA 4NZHA 1E1NA 1OJCA 4TLZA 4Z44A 3CN8A 4X9MA 3UP5A 1GERA 2E5VA 4B67A 4J56A 2YG5A 1D5TA 1H86A 5FS7A 1F8RA 4H4SA 1PXBA 4CCQA 2ARDA 3OC4A 1YQ3A 3CPJG 3KU9A 3EF6A 5HY5A 3QSSA 1GEUA 2NVKX 2Q6UA 4JY2A 1DJQA 2JB1A 5BUKA 3II4A 3VRBA 2BYBA 3DJEA 2XFUA 3NNEA 1PBBA 3DJDA 1ZMCA 2XVHA 3ICTA 3QSMA 1BF3A 3HZLA 2H88A 3NYFA 1LTXR 4C3XA 1X31B 2XYOA 3UOZA 1F8SA 5GRTA 2JKCA 5U1OA 3ATRA 1PJ5A 3CPHG 3UKHA 2DKIA 2YR5A 4A99A 4B69A 3RP8A 2BS4A 3GMBA 3QVPA 1NEKA 2CULA 5C3JA 4U8KA 4APNA 1DXLA 2Y6QA 1Y56A 3E1TA 4FK1C 1D4EA 4H2QA 4JDRA 4N9XA 1TDFA 3DGHA 2WETA 4JY3A 1ZP0A 4DNAA 5IQ1A 1K4QA 3ALJA 1F8WA 1LPFA 1E6EA 2BK5A 2YLZA 2YR6A 4CRTA 3V3NA 2V61A 4H2RA 4H7UA 3REDA 3GMCA 4WCTA 4TM4A 4RSLA 4TLXA 1D7YA 3KLJA 4H2PA 3EAOA 1EL8A 3LB8A 3LOVA 1CF3A 4IVOB 2OLOA 2A87A 4OPCA 2YVGA 3EPTA 2WDQA 3BNMA 2XVIA 4Z43A 3PVCA 3GSIA 1O94A 4CNKA 1ZKQA 3NKSA 4UP3A 3UOYA 1H7WA 1LVLA 3M13A 4BURA 5EB5A 4U8JA 3GRSA 2C73A 1ZOVA 1Z6LA 4H4XA 1YQ4A 4D04A 3QVRA 2PHHA 4FX9A 1GXFA 1EL5A 1UKVG 3SM8A 4CY6A 2X99A 2C66A 4U2LA 5HXIA 3DGZA 4BJZA 3GDNA 1D4CA 5FS6A 3G5QA 1RYIA 4OPIA 4X4JA 3UKKA 1O5WA 1ZX9A 1DODA 2YLSA 4X9NA 2J3NA 1GREA 1ONFA 1ZDLA 2GMHA 2C64A 3CNJA 1B8SA 2WOWA 1GRAA 2WOVA 1P2EA 3UKQA 1S2QA 3NRNA 3DH9A 1XHCA 4GRTA 4J31A 2BC0A 4OPLA 1JU2A 4BJYA 4K5SA 2X50A 1CC2A 1NHRA 2VVLA 2YM2A 4Z26A 5JCNA 1F6MA 1LQUA 1MXTA 2E4GA 1PBDA 4YSHA 2OALA 3LADA 3ICSA 2C67A 3IHMA 4NTCA 1L0VA 4IA6A 4FDCB 3BI5A 3F8DA 3VR9A 2GH5A 3IF9A 3LZWA 5GSNA 2ZZBA 3UCLA 3FG2P 3O0HA 4H4YA 2Z5XA 3ICRA 4JQ9A 3Q9TA 1TDKA 4REKA 1XDIA 2WEUA 4U2SA 5BRTA 4B64A 4A65A 2XLTA 1BGJA 1KNRA 4WX1A 1ELIA 4BK2A 2EQ6A 2R0GA 4TM0A 3UKPA 3UKLA 3CGBA 2BCPA 3NK0X 1L9CA 3NLCA 1TDNA 4H4ZA 4U8IA 2XFOA 2VQBA 1ZK7A 4EMJA 4CCRA 4H4PA 3D1CA 3AYJA 1QJDA 4M52A 2V5ZA 3NYEA 3K7QX 1VG9A 2I0ZA 2WESA 3IWAA 3AECA 1JNZA 4LIIA 2VZ2A 1COYA 4B1BA 4JNQA 1GRHA 4H4WA 3CPIG 2B7RA 4KX6A 4UDQA 1H81A 2ZBWA 4YWOA 4GF7A 2QAEA 4C74A 4H4RA 1NENA 4CBQA 3I3LA 1L9EA 3UTGA 4K8DA 2X8CA 1V59A 4O5UA 2W0HA 2QCUA 1Y0PA 4C77A 2GRTA 2A89A 2X8GA 4TM3A 3UTEA 4NEWA 2VVLG 1MOKA 3SFEA 1GPEA 2YG7A 3AE4A 4XXGA 1NPXA 1TDEA 1Q1RA 3K30A 2ZZ0A 2CDUA 1BWCA 4BV6A 3B6DA 4LA1A 4EMWA 1E1LA 1N4VA 2C65A 4H4UA 1XANA 3COXA 1E39A 2Z5YA 4OVIA 4DSHA 3DA1A 2BS2A 3NT6A 1ZOYA 3H8IA 1YQZA 2GB0A 3CGEA 5KVHA 1IUVA 1H7XA 1RSGA 1IUWA 5HYMA 1DJNA 1REOA 1L9DA 2XVFA 5BVAA 4UDPA 1KNPA 4C3YA 2X8HA 3T37A 3RP7A 2GVCA 1GETA 2RGJA 2XLUA 4A79A 3AE1A 4EMIA 2C70A 1PN0A 5J7XA 2EQ7A 2BA9A 2ACZA 3ZDNA 2BABA 3AYIA 2JB2A 1IUXA 4CY8A 2GV8A 2C3CA 5FS9A 1N1PA 2B9WA 2BACA 3KA7A 5HHFA 4YSYA 4TM1A 2OAMA 1TDOA 2JB3A 4NTDA 2YLWA 2RGHA 3RP6A 4H4VA 2PYXA 3V3OA 3EANA 2WPCA 4YTNA 2YLXA 1GRBA 4IVMB 1GALA 2HQMA 1VRQB 1FECA 2B9XA 1GESA 3KKJA 5ER0A 1HYUA 4OPTA 4ICYA 4EQRA 3GWDA 2CVJA 3SGLA 2WP6A 3AEBA 3AXBA 2APGA 1B37A 1GRFA 1DNCA 2WDVA 3GRTA 3V76A 2XLRA 2GAHB 4K22A 1OJ9A 3C4NA 2WBAA 3UOVA
chains in the Genus database with same CATH superfamily
5EB4A 2R45A 1Q9IA 4Y4NA 2VQ7A 4JNAA 1NDAA 4JN8A 1O95A 2ZC8A 1NG4A 1PDHA 3C4AA 3FMWA 3AMZA 3K7TA 3UJRA 3ALLA 3DIPA 1E1MA 1N4WA 1M6IA 4IHCA 4PAAA 1S3BA 2FJAA 2WDRA 3ATQA 2VRMA 3GD3A 1FFVC 5KXJA 1E1KA 3I6TA 2MUCA 2P3ZA 2XFQA 1KF6A 3ZVHA 3TTEA 4EQXA 3L1RA 1CJCA 3T9PA 2AKMA 4B68A 5JCLA 2YQUA 3D8XA 2BRAA 3DERA 4K2XA 2AKZA 5J04A 5FJOA 1MO9A 1B5QA 1ZXIC 1EL9A 2OX4A 2FKPA 4GDEA 2GMJA 2EQ8A 2XH0A 2R0CA 4OCGA 4ZCDA 3I4KA 3NVWB 3AEEA 5CQFA 1GTHA 1OEPA 3WE0A 4J2WA 3RCYA 2OA1A 4OPDA 1S2YA 4G7FA 2OKTA 3FYYA 3N4EA 1VQWA 1KD0A 1OJTA 1PBEA 2F5ZA 1IUSA 1IUTA 2GQWA 3M0OA 1GNDA 3UOXA 3AWIA 4I58A 3C96A 3GD4A 5FS8A 3AD8B 4J57A 1LV0A 1OJAA 1E9IA 4LU6A 3DMEA 2WPEA 2TMDA 4K8GA 3FIMB 4NEVA 2ZZCA 3CNPA 3ZVIA 3NN0X 2QVHA 3URHA 1MNSA 2WU2A 1P48A 3AE6A 1JNRA 1CC6A 2Q0KA 1NELA 2IVDA 5M10A 3UTFA 4OPGA 3AM9A 4EIQA 2R4JA 3HPFA 3QFBA 1Q1WA 3D46A 3MQTA 4IP4A 5J60A 4ZCCA 5G5GB 1CC4A 3NYCA 1LJ1A 4KWSA 3MY9A 3G5SA 4A6NA 1D4DA 4O5QA 3GWFA 5KWFA 4USRA 3P4RA 2XH2A 4E0VA 2WU5A 2YM1A 5U25A 3ZLGA 2Q0LA 2GR2A 1PJ6A 1PXCA 2C7GA 1PHHA 1KDGA 1IJHA 2EQ9A 4Y4MA 3D9XA 4DXKA 1BZLA 4K5RA 1DOCA 4H50A 1E1NA 1OJCA 4TLZA 3CN8A 2E5VA 1H86A 3K1GA 3EF6A 3V4BA 3VCCA 5KMSA 1KKOA 1DJQA 4E6MA 5BUKA 1PBBA 2OZ3A 1LTXR 2XYOA 5GRTA 2JKCA 1SJCA 4B69A 1NEKA 2PTZA 4U8KA 3PWIA 4APNA 1Y56A 1D4EA 3N6HA 1ZP0A 2MNRA 1K4QA 4II2A 3ALJA 4CRTA 3V3NA 3KPKA 3ES8A 1D7YA 4H2PA 3EAOA 4GYPA 3LOVA 2DW6A 3A7UA 4OPCA 3BNMA 3FCPA 4BURA 4ENLA 4H4XA 2PHHA 4FX9A 5HXIA 3DGZA 4OPIA 4X4JA 2GGEA 2YLSA 4X9NA 1ZDLA 3CNJA 1ELSA 1B8SA 2WOWA 4DX3A 1XHCA 4J31A 1JU2A 3T8QA 4G6GA 2E4GA 2OALA 4IA6A 3BI5A 3CAWA 3UCLA 3FG2P 4JQ9A 4GGHA 4REKA 1BGJA 4WX1A 3SXIA 1ELIA 4BK2A 3UKLA 3CGBA 1L9CA 4H4ZA 2OFJA 3AYJA 1QJDA 3NYEA 3K7QX 1VG9A 2WESA 1JNZA 4HNLA 4JNQA 3DEQA 4UDQA 1JCTA 2ZBWA 2P0IA 4C74A 2HZGA 1H2IA 4GFIA 2A89A 2VVLG 3SFEA 2PS2A 3AE4A 4G8TA 1TDEA 1Q1RA 3HRDC 2ZZ0A 1N4VA 2OVLA 1E39A 1KCZA 1DTNA 1ZOYA 5HYMA 1RSGA 1IUWA 1L9DA 4C3YA 2GVCA 3AE1A 3SX6A 1X2GA 1PN0A 2EQ7A 2BA9A 2BABA 3AYIA 5FS9A 2B9WA 4H1ZA 3IJIA 2OAMA 1TDOA 2JB3A 3UXKA 4GGBA 4NTDA 2YLWA 3RP6A 1JPDX 2PYXA 4YTNA 2HQMA 1VRQB 1FECA 2PP1A 4OPTA 2CVJA 3GYXA 4GMEA 1B37A 1GRFA 3BJSA 4YWSA 4K22A 3IJQA 2YLRA 4IV9A 2P8CA 3CGDA 4IL2A 4A9WA 3AD9B 3VCNA 2C76A 2HNEA 3OZ2A 3MZNA 3DK8A 1RP0A 3BI4A 2OO6A 2GR0A 4BK1A 4CNJA 3VA8A 2YG6A 3U4FA 2RABA 1JRYA 1PDZA 2PTYA 1PS9A 3PK7A 3S5WA 2GR3A 5KOWA 1STZA 1CHUA 2VRLA 2XCGA 5KOXA 3NN6X 2C72A 3AE2A 2V60A 3TOYA 2W3RA 2PTXA 4HB9A 5L46A 2WS3A 3P9UA 3P1WA 2E3TA 3CMMA 2XLPA 3R25A 3FJ4A 4ZA0A 2PMQA 3Q4DA 4XWRA 3LJPA 1Y56B 1B4VA 4U8PA 1JOAA 1H84A 2BK4A 4YT0A 3UTHA 3FXGA 3UKFA 5FMHA 4AT2A 2GL5A 2WP5A 3Q6JA 2DKHA 3P4SA 1SEZA 3SY4A 3R10A 3JZUA 4AP3A 4EM4A 4FK1A 2P88A 3AE8A 1N5XA 3SQPA 4HN8A 3T2ZA 2CFYA 5JCMA 2AL2A 3VRDB 2R9ZA 1EBDA 4A6GA 2FJBA 4OPUA 3QJ4A 3B3RA 4EQWA 1TRBA 3L8KA 4A5LA 1X2HA 3HYVA 4U8MA 5EOWA 3TCSA 4Z25A 3HYXA 3NS1B 1PJ7A 2GAGB 1W4XA 3AYLA 3A7AA 3PG6A 3SJNA 3CTYA 3FPZA 4J34A 3MWCA 1TKKA 3GDPA 1BKWA 1KSUA 3T4WA 4XWZA 3NFUA 2W55A 4KT2A 2C3DA 5KVIA 1FCDA 1KSSA 3M12A 4B65A 2V3BA 2UZZA 1TZZA 2AL2B 4TVYA 3JSKA 3BSMA 4U2TA 2PU1A 3ABVA 1JPMA 5JCKA 3H4KA 4EM3A 4U8NA 4C5OA 3VFCA 2IIDA 3KPFA 4USQA 3UJSA 4YKFA 1NAAA 3GYIA 2QA1A 1JEHA 3GD6A 2YWLA 3AE9A 4GDPA 4RG4A 1ONEA 4B66A 3TWBA 1LQTA 3PS9A 3MSYA 3AEGA 1N60C 3EEZA 2B7SA 1M64A 4YXDA 1TYPA 3V5FA 3NVZB 4Z17A 4ADWA 4GAPA 1BKHA 2JBVA 3MKCA 4Z44A 3UP5A 1GERA 2YG5A 1D5TA 1F8RA 1PXBA 4CCQA 1MDLA 1YQ3A 3B9JB 5HY5A 3SN4A 5BOEA 1N5WC 2JB1A 3II4A 3VRBA 3NNEA 4G6HA 3DJDA 3ICTA 3QSMA 1BF3A 3HZLA 3H7VA 4C3XA 1X31B 3GO2A 3CPHG 4A99A 3GMBA 2QDDA 3DFHA 1TE6A 2CULA 5C3JA 1FHVA 1DXLA 3OPSA 3QTPA 4JDRA 4N9XA 3UCDA 3DGHA 2WETA 4H2HA 1F8WA 1RVKA 2YLZA 4H7UA 4GYPC 4WCTA 4TM4A 4RSLA 4TLXA 3KLJA 3LB8A 4IL0A 1KN0A 2WDQA 3PVCA 4UP3A 3UOYA 3M13A 4U8JA 1Z6LA 4EWJA 4FP1A 4CY6A 3SM8A 4U2LA 4BJZA 3GC2A 3R11A 5FS6A 3UKKA 3SYIA 2AL1A 3DG3A 5FJRA 3UKQA 3NRNA 4GRTA 4OPLA 4BJYA 4K5SA 2X50A 2VVLA 2YM2A 4Z26A 2GGIA 1MXTA 3T14A 1L0VA 3F8DA 1P43A 2GH5A 4E4UA 4H4YA 5BOFA 1XDIA 5BRTA 4A65A 3NK0X 2VQBA 2POZA 4H4PA 4M52A 3OP2A 1FO4A 3JW7A 4B1BA 3CPIG 2B7RA 1H81A 4YWOA 3TW9A 1MDRA 2PSNA 3I3LA 1L9EA 2W0HA 4DN1A 2X8GA 3UTEA 2YG7A 4XXGA 4LA1A 1KKRA 4EMWA 2C65A 3DA1A 3SN1A 3CGEA 2CHRA 2OQHA 3I6EA 1ECQA 5BVAA 4UDPA 2X8HA 3RP7A 1SB3B 4H83A 2XLUA 2C70A 5J7XA 2ACZA 3ZDNA 3P0WA 1IUXA 2GV8A 3KA7A 1S7MA 2RGHA 3L5OA 1GRBA 3R07C 1R6WA 4ICYA 3R0KA 3SGLA 3EKGA 3T6CA 5FJTA 5KMQA 3C4NA 2WBAA 3BI2A 2NQLA 2TPRA 3MUCA 3NG7X 3VC5A 1K0IA 2GGHA 4J33A 3ENLA 4P9SA 3KD9A 3BOXA 1EC7A 4J3ZA 3V5CA 2B9YA 4AP1A 3NGCX 4NNJA 1GRGA 1GOSA 3DFYA 5TR3A 1FEBA 4IA5A 1NHSA 2OLNA 3R1ZA 3NTAA 2PU0A 3P4PA 4DWDA 3NVVB 2YVJA 5G5HB 1QLBA 4GUVA 1CL0A 1EC9A 2XSXA 3NXLA 1PBCA 3NHOX 2BK3A 2XLSA 4TVWA 1N63C 3H8LA 1BGNA 2QA2A 3UP4A 3IC9A 3GYJA 1S3EA 1N4UA 3QPEA 1NG3A 3AB1A 2C75A 4NTEA 1PXAA 3VR8A 3P4QA 3FVDA 3HYWA 1YY5A 5CKUA 2QJNA 3CYJA 2AR8A 3DG6A 1FOHA 5KMRA 3CIRA 4ZCWA 2GSHA 2PPGA 4J36A 3DK4A 2O56A 2ONEA 3LZXA 2XH7A 4YSXA 2XFNA 1H83A 3AE3A 3KUMA 1SJDA 3BNUA 3AN1A 4GCMA 1K0LA 2WHDA 2AAQA 1XPQA 3N6JA 5DBJA 4BK3A 5KRQA 4HCHA 1ZMDA 3CK5A 1P2HA 2VVMA 4H4QA 4EIPA 3RO6A 4Z2RA 1AOGA 1SJAA 5JCIA 3HW2A 4HPNA 2WP9A 2E5AA 2WPFA 4YTMA 3H8AA 3BHFA 2W3SA 3RNMA 3DJJA 3UGVA 4K2SA 2JAEA 2BCGG 3RHAA 3NTDA 1GV4A 2PGWA 5M0ZA 2XDOA 3CNSA 2C4CA 4K7ZA 3ISHA 4PABA 2FBWA 3AEFA 3N4FA 2BC1A 1PBFA 1FL2A 1JRZA 3I6DA 5LV9A 3CNTA 4AOXA 2BS3A 4A3RA 3UXLA 4F4RA 4AT0A 3Q45A 1GSNA 2YVFA 1H6VA 1E7PA 4B63A 3NK1X 3AEAA 1OJDA 1CJ4A 4KPRA 3AEDA 3KVEA 2Y6RA 3NZGA 2B76A 1GT8A 2RDXA 3FBSA 4YSZA 1R0MA 3A7RA 2E1MA 3RR1A 3F8PA 4Z1YA 3VDGA 3SZFA 3RITA 2YR4A 1H82A 1GTEA 4Z2TA 3AE7A 4U8LA 3R9UA 1D7LA 2X3NA 2I5QA 4X9MA 4B67A 2ARDA 3OC4A 2PGEA 1L8PA 3UCCA 2NVKX 2P8BA 4HNCA 4JY2A 2BYBA 3DJEA 1ZMCA 2XVHA 2H88A 3NYFA 3FV9A 3UOZA 3ATRA 5U1OA 2DKIA 3CXBA 3RP8A 2BS4A 2BRYA 7ENLA 3QLDA 4E5TA 2OPJA 4DNAA 2BK5A 1E6EA 2V61A 3REDA 1BQGA 4X2PA 1EL8A 1CF3A 4IVOB 2OLOA 2A87A 4Z43A 2YVGA 2GGGA 3PFRA 1VQZA 1O94A 4CNKA 2QJJA 3NKSA 3DDMA 1H7WA 1LVLA 3GRSA 3QVRA 3SBFA 1EL5A 2X99A 2C66A 3GDNA 1D4CA 1RYIA 3NRZB 1XS2A 1ONFA 4MMWA 3DH9A 2BC0A 1CC2A 3TQPA 1F6MA 2W54A 1LQUA 1PBDA 3ICSA 2C67A 3IHMA 4NTCA 3VR9A 2PTWA 3LZWA 4M6UA 3ICRA 1TDKA 1WUFA 2WEUA 4U2SA 4B64A 4GIRA 3UKPA 2BCPA 3NLCA 1TDNA 4U8IA 4EMJA 3ZVHB 3D1CA 2GDQA 2I0ZA 3AECA 4LIIA 2VZ2A 1COYA 4KX6A 3OTRA 3RRAA 1NENA 2OZ8A 1V59A 3UJ2A 4O5UA 1Y0PA 3NVYB 4NWZA 4NEWA 3DG7A 1NPXA 2CDUA 1BWCA 2XGZA 1E1LA 2DW7A 4DSHA 2BS2A 5KVHA 1IUVA 2OG9A 1H7XA 1REOA 3T37A 3SQSA 1JDFA 1GETA 2JB2A 4CY8A 1N1PA 2BACA 4YSYA 5EU9A 4GISA 3DESA 3STPA 4H4VA 3V3OA 2WPCA 2YLXA 1GALA 3TWAA 3KKJA 3S47A 5ER0A 4EQRA 3GWDA 3PWGA 2APGA 1DNCA 2WDVA 1SJBA 3V76A 1F9CA 1OJ9A 3UOVA 4U8OA 4MGGA 3ZYXA 1VG0A 1JROA 5FJUA 3UJFA 2GQFA 2V3AA 3T2KA 3G5RA 1TYTA 2JK6A 4E4FA 2PODA 3IJLA 2GEWA 4ECHA 2BXSA 2YLTA 1NHPA 3K7MX 1GRTA 3CNDA 2OQYA 3F8RA 3SZCA 5IQ4A 2O9ZA 2FYMA 1DOEA 3QFAA 1CBOA 1EBGA 2GR1A 2WQYA 3ADAB 3ITJA 1CJ2A 1ZY8A 3RGTA 3T0KA 2FJDA 3IHGA 3B97A 2WOIA 3S61A 4HYRA 3S5SA 4Z24A 2FJEA 2A8XA 4ZN0A 2AQJA 3D47A 1KFYA 3SFDA 2IVEA 4Z2UA 4A7AA 3PO7A 2Q7VA 3NH3X 2GF3A 2VOUA 3THUA 3CGCA 1JRXA 4H19A 1FEAA 2RGOA 4GR1A 2YG3A 2BXRA 2PP3A 4RG3A 3LXDA 2R46A 4MJWA 3NIXA 3DJGX 4UDRA 4H4TA 1VDCA 2H89A 2XVEA 2YAUA 1EL7A 5EBKA 4IP5A 3ZLFA 3EUB3 3ETRB 3DGBA 1YKJA 1F3PA 1K0JA 3AE5A 3V3WA 5KNLA 2YG4A 5IPYA 5C2TA 4DHGA 2XVJA 3UKAA 3OZMA 3ZLHA 3ALMA 3CXOA 4YTPA 4KEMA 2NPXA 2ZADA 4HCDA 3NK2X 2HXUA 4H2NA 3QKEA 2PP0A 5BULA 2XFPA 4YKGA 1WYGA 2V6OA 3JVAA 2R4EA 1EC8A 3CT2A 1RM6B 4I59A 2R0PA 3OW1A 4HA6A 4GAVA 4AOSA 6ENLA 3QSEA 5U63A 3DK9A 1QO8A 1IUUA 1T3QC 4DSGA 3VRAA 1WUEA 4DGKA 1NHQA 4J1OA 4JN9A 5IDZA 3BHKA 4M0XA 3U9IA 1W6TA 4D03A 1DOBA 4A6NB 3AD7B 3VQRA 5JRBA 1CJ3A 2XH4A 2HXTA 4Y4LA 4EQSA 3SZ0A 4ROPA 4NZHA 2QJMA 3IK4A 4J56A 5FS7A 4H4SA 3TJIA 3CPJG 3KU9A 3QSSA 3SZWA 1GEUA 4MKSA 2Q6UA 4ZOHB 2XFUA 3P3BA 1F8SA 3UKHA 1PJ5A 2YR5A 4G9KA 4G73A 4FI4A 3QVPA 2Y6QA 3E1TA 4FK1C 4H2QA 1TDFA 4JY3A 1XPYA 5IQ1A 2QGYA 1LPFA 2YR6A 4H2RA 3GMCA 4HCLA 1EBHA 3EPTA 2XVIA 3GSIA 1ZKQA 5EB5A 1N62C 2C73A 1ZOVA 3T2YA 1MUCA 1YQ4A 4D04A 1FFUC 1GXFA 1UKVG 4A35A 5FJPA 4IZGA 3G5QA 3T31A 1PDYA 1O5WA 1ZX9A 1DODA 1FIQB 3ES7A 2J3NA 1GREA 2GMHA 2C64A 2PCEA 1GRAA 2WOVA 1P2EA 1S2QA 1NHRA 3UJEA 3SSZA 5JCNA 4YSHA 3LADA 1MRAA 4FDCB 1N61C 3IF9A 5GSNA 2ZZBA 3O0HA 2Z5XA 3Q9TA 3OZYA 1NU5A 2XLTA 1KNRA 2EQ6A 2R0GA 4TM0A 3SR6B 1FHUA 2OZTA 4DYEA 2XFOA 1ZK7A 4CCRA 2V5ZA 4IT1A 3NO1A 3H70A 3IWAA 1GRHA 4H4WA 1VDVA 4GF7A 2QAEA 4KPLA 3VC6A 4H4RA 4CBQA 3UTGA 4K8DA 2X8CA 2QCUA 4C77A 2GRTA 2OLAA 4TM3A 1MOKA 1GPEA 3GY1A 3K30A 4BV6A 3B6DA 3SN0A 4H4UA 1XANA 4II3A 3R0UA 3COXA 2Z5YA 4OVIA 3NT6A 4E8GA 3H8IA 1IYXA 1YQZA 2GB0A 2QDEA 1DJNA 3TJ4A 4JN7A 2XVFA 1KNPA 2RGJA 4A79A 3H12A 3P93A 4EMIA 1JRPA 2C3CA 5HHFA 4TM1A 4K1WA 1V97A 2QQ6A 3QN3A 3EANA 2PA6A 4IVMB 1YEYA 4JHMA 2B9XA 1GESA 5ENLA 1HYUA 3CB3A 2WP6A 3AEBA 2GGJA 3AXBA 5KMPA 4G74A 3GRTA 2XLRA 2GAHB
chains in the Genus database with same CATH topology
3BI2A 2YLRA 5EB4A 2R45A 1Q9IA 4U8OA 4Y4NA 3ZYXA 2VQ7A 4IV9A 4JNAA 2TPRA 3CGDA 1VG0A 4A9WA 3NG7X 3AD9B 1NDAA 1K0IA 1O95A 2GQFA 2V3AA 4J33A 2C76A 1NG4A 1PDHA 3C4AA 3T2KA 3FMWA 3OZ2A 4P9SA 3G5RA 1TYTA 3KD9A 3K7TA 2JK6A 2B9YA 3ALLA 3DK8A 4AP1A 1RP0A 3BI4A 3NGCX 4NNJA 2GEWA 1GRGA 1GOSA 2GR0A 4BK1A 4CNJA 4ECHA 2YG6A 1E1MA 1N4WA 2BXSA 2YLTA 2RABA 1JRYA 1M6IA 1NHPA 5C2TA 5TR3A 1PS9A 3K7MX 3S5WA 1FEBA 1GRTA 3CNDA 4IA5A 1NHSA 4PAAA 2OLNA 3F8RA 2GR3A 1S3BA 2FJAA 2WDRA 3SZCA 5IQ4A 5KOWA 3NTAA 2O9ZA 3ATQA 1DOEA 2VRMA 3GD3A 3QFAA 1CHUA 2VRLA 2XCGA 3P4PA 5KOXA 2YVJA 1QLBA 3NN6X 5KXJA 4GUVA 2C72A 1CBOA 3AE2A 1E1KA 1CL0A 2V60A 2XFQA 1KF6A 1PBCA 3NHOX 2BK3A 2XLSA 4HB9A 2GR1A 2WQYA 3ADAB 4EQXA 3H8LA 3ITJA 1CJ2A 1BGNA 2QA2A 1ZY8A 5L46A 2WS3A 3P9UA 3P1WA 3L1RA 3UP4A 1CJCA 3IC9A 3T0KA 2FJDA 3GYJA 3IHGA 1S3EA 2WOIA 1N4UA 2XLPA 3CMMA 3S61A 4B68A 5JCLA 1NG3A 4Z24A 3AB1A 2FJEA 2YQUA 2A8XA 3D8XA 2C75A 4XWRA 4ZN0A 2AQJA 4NTEA 4Z43A 3LJPA 1PXAA 3VR8A 1KFYA 2BRAA 3P4QA 1Y56B 3SFDA 1B4VA 4K2XA 2IVEA 3HYWA 4Z2UA 1YY5A 4U8PA 5CKUA 4A7AA 1JOAA 1H84A 3PO7A 1MO9A 1B5QA 2BK4A 2Q7VA 3NH3X 4YT0A 2AR8A 3UTHA 1EL9A 2GF3A 2VOUA 1FOHA 5KMRA 3CGCA 1JRXA 5FMHA 3CIRA 3UKFA 4GDEA 2GMJA 4J36A 2EQ8A 4AT2A 3DK4A 1FEAA 2WP5A 3Q6JA 2RGOA 4GR1A 2R0CA 3LZXA 2YG3A 4OCGA 4YSXA 2BXRA 2XFNA 1H83A 2DKHA 3P4SA 3AE3A 4ZCDA 4RG3A 3LXDA 1SEZA 2R46A 3AEEA 3SY4A 5CQFA 3BNUA 4GCMA 1GTHA 4MJWA 3WE0A 4J2WA 4AP3A 1K0LA 2WHDA 3NIXA 3DJGX 2AAQA 1XPQA 4UDRA 4EM4A 4H4TA 2OA1A 4FK1A 4OPDA 1VDCA 2H89A 5DBJA 1S2YA 4BK3A 3AE8A 2XVEA 2YAUA 1EL7A 5KRQA 5EBKA 3SQPA 1ZMDA 1P2HA 2VVMA 4H4QA 4EIPA 1VQWA 1OJTA 1AOGA 4Z2RA 1PBEA 2F5ZA 5JCIA 1IUSA 1IUTA 3T2ZA 2WP9A 2GQWA 2CFYA 5JCMA 2WPFA 3M0OA 1YKJA 1GNDA 4YTMA 3UOXA 3VRDB 1F3PA 2R9ZA 1K0JA 1EBDA 3AWIA 3BHFA 3AE5A 2FJBA 3RNMA 3DJJA 5KNLA 2YG4A 3QJ4A 4OPUA 2JAEA 3B3RA 3C96A 3GD4A 4I58A 5IPYA 2BCGG 5FS8A 3RHAA 3AD8B 4EQWA 1GV4A 3NTDA 4J57A 1LV0A 1OJAA 3L8KA 1TRBA 5M0ZA 2XDOA 3CNSA 4A5LA 4LU6A 2C4CA 4K7ZA 2XVJA 3HYVA 4U8MA 5EOWA 3DMEA 4D03A 2WPEA 3UKAA 3ISHA 4PABA 2FBWA 3ALMA 3AEFA 4Z25A 3HYXA 2TMDA 1PJ7A 2GAGB 1W4XA 3AYLA 3PG6A 4YTPA 2BC1A 1PBFA 3CTYA 1FL2A 4NEVA 3FIMB 2ZZCA 3CNPA 3FPZA 4J34A 2NPXA 1JRZA 3NN0X 3URHA 3NK2X 3GDPA 1BKWA 3I6DA 2WU2A 1KSUA 5LV9A 3AE6A 4H2NA 1JNRA 4XWZA 1CC6A 5BULA 2Q0KA 3CNTA 2XFPA 2BS3A 4AOXA 2C3DA 4YKGA 2V6OA 5KVIA 2IVDA 5M10A 1FCDA 1KSSA 3M12A 3UTFA 4OPGA 4AT0A 4B65A 2R4EA 2V3BA 1GSNA 2UZZA 2YVFA 4EIQA 1H6VA 2R4JA 3JSKA 1E7PA 3NK1X 4B63A 3QFBA 4U2TA 3AEAA 1Q1WA 4I59A 5J60A 3ABVA 4ZCCA 1OJDA 5JCKA 2R0PA 3H4KA 4EM3A 1CJ4A 4HA6A 1CC4A 4KPRA 4GAVA 3AEDA 4U8NA 4AOSA 3NYCA 4C5OA 1LJ1A 2Y6RA 3KVEA 3QSEA 5U63A 2IIDA 3G5SA 3KPFA 1D4DA 4A6NA 4O5QA 3DK9A 1QO8A 1IUUA 2B76A 3GWFA 5KWFA 1GT8A 3P4RA 4USRA 4DSGA 3VRAA 3FBSA 4YSZA 4DGKA 1NHQA 4E0VA 4USQA 2WU5A 2YM1A 4JN9A 4YKFA 1NAAA 3BHKA 3GYIA 2QA1A 1JEHA 5U25A 2E1MA 1DOBA 2Q0LA 2YWLA 3AD7B 4A6NB 2GR2A 1PJ6A 1PXCA 2C7GA 3AE9A 1PHHA 4GDPA 4RG4A 1KDGA 3VQRA 3F8PA 4B66A 5JRBA 1IJHA 1CJ3A 1LQTA 2EQ9A 4Y4MA 3PS9A 3SZFA 3D9XA 2YR4A 3AEGA 2B7SA 1H82A 1GTEA 4Z2TA 1M64A 4Y4LA 3AE7A 1BZLA 4K5RA 4EQSA 4U8LA 4YXDA 1TYPA 3SZ0A 3R9UA 4ADWA 1DOCA 1D7LA 4H50A 2JBVA 2X3NA 4GAPA 4NZHA 1E1NA 1OJCA 4TLZA 4Z44A 3CN8A 4X9MA 3UP5A 1GERA 2E5VA 4B67A 4J56A 2YG5A 1D5TA 1H86A 5FS7A 1F8RA 4H4SA 1PXBA 4CCQA 2ARDA 3OC4A 1YQ3A 3CPJG 3KU9A 3EF6A 5HY5A 3QSSA 3SZWA 1GEUA 2NVKX 5KMSA 2Q6UA 4JY2A 1DJQA 2JB1A 5BUKA 3II4A 3VRBA 2BYBA 3DJEA 2XFUA 3NNEA 4G6HA 1PBBA 3DJDA 1ZMCA 2XVHA 3ICTA 3QSMA 1BF3A 3HZLA 2H88A 3NYFA 1LTXR 4C3XA 1X31B 2XYOA 3UOZA 1F8SA 5GRTA 2JKCA 5U1OA 3ATRA 1PJ5A 3CPHG 3UKHA 2DKIA 2YR5A 4A99A 4B69A 3RP8A 4G9KA 4G73A 2BS4A 3GMBA 3QVPA 2BRYA 1NEKA 2CULA 5C3JA 4U8KA 4APNA 1DXLA 2Y6QA 1Y56A 3E1TA 4FK1C 1D4EA 4H2QA 4JDRA 4N9XA 1TDFA 3DGHA 2WETA 4JY3A 1ZP0A 4DNAA 5IQ1A 1K4QA 4II2A 3ALJA 1F8WA 1LPFA 1E6EA 2BK5A 2YLZA 2YR6A 4CRTA 3V3NA 2V61A 4H2RA 4H7UA 3KPKA 3REDA 3GMCA 4WCTA 4TM4A 4RSLA 4TLXA 1D7YA 3KLJA 4H2PA 3EAOA 1EL8A 3LB8A 3LOVA 1CF3A 4IVOB 2OLOA 2A87A 4OPCA 2YVGA 3EPTA 1KN0A 2WDQA 2XVIA 3BNMA 3PVCA 3GSIA 1O94A 4CNKA 1ZKQA 3NKSA 4UP3A 3UOYA 1H7WA 1LVLA 3M13A 4BURA 5EB5A 4U8JA 3GRSA 2C73A 1ZOVA 3T2YA 1Z6LA 4H4XA 1YQ4A 4D04A 3QVRA 2PHHA 4FX9A 1GXFA 1EL5A 1UKVG 3SM8A 4CY6A 2X99A 2C66A 4U2LA 5HXIA 3DGZA 4BJZA 3GDNA 1D4CA 5FS6A 3G5QA 1RYIA 4OPIA 4X4JA 3T31A 3UKKA 3SYIA 1O5WA 1ZX9A 1DODA 2YLSA 4X9NA 2J3NA 1GREA 1ONFA 1ZDLA 2GMHA 2C64A 3CNJA 1B8SA 2WOWA 1GRAA 2WOVA 1P2EA 3UKQA 1S2QA 3NRNA 3DH9A 1XHCA 4GRTA 4J31A 2BC0A 4OPLA 1JU2A 4BJYA 4K5SA 2X50A 1CC2A 1NHRA 2VVLA 2YM2A 4Z26A 5JCNA 4G6GA 1F6MA 1LQUA 1MXTA 2E4GA 1PBDA 3T14A 4YSHA 2OALA 3LADA 3ICSA 2C67A 3IHMA 4NTCA 1L0VA 4IA6A 4FDCB 3BI5A 3F8DA 3VR9A 2GH5A 3IF9A 3LZWA 5GSNA 2ZZBA 3UCLA 3FG2P 3O0HA 4H4YA 2Z5XA 3ICRA 4JQ9A 3Q9TA 1TDKA 4REKA 1XDIA 2WEUA 4U2SA 5BRTA 4B64A 4A65A 2XLTA 1BGJA 1KNRA 4WX1A 3SXIA 1ELIA 4BK2A 2EQ6A 2R0GA 4TM0A 3UKPA 3UKLA 3CGBA 2BCPA 3NK0X 1L9CA 3NLCA 1TDNA 4H4ZA 4U8IA 2XFOA 2VQBA 1ZK7A 4EMJA 4CCRA 4H4PA 3D1CA 3AYJA 1QJDA 4M52A 2V5ZA 3NYEA 3K7QX 1VG9A 2I0ZA 2WESA 3IWAA 3AECA 1JNZA 4LIIA 2VZ2A 1COYA 4B1BA 4JNQA 1GRHA 4H4WA 3CPIG 2B7RA 4KX6A 4UDQA 1H81A 2ZBWA 4YWOA 4GF7A 2QAEA 4C74A 4H4RA 1NENA 4CBQA 3I3LA 1L9EA 3UTGA 4K8DA 1H2IA 2X8CA 1V59A 4O5UA 2W0HA 2QCUA 1Y0PA 4C77A 2GRTA 2A89A 2X8GA 4NWZA 4TM3A 3UTEA 4NEWA 2VVLG 1MOKA 3SFEA 1GPEA 2YG7A 3AE4A 4XXGA 1NPXA 1TDEA 1Q1RA 3K30A 2ZZ0A 2CDUA 1BWCA 4BV6A 3B6DA 4LA1A 4EMWA 1E1LA 1N4VA 2C65A 4H4UA 1XANA 4II3A 3COXA 1E39A 2Z5YA 4OVIA 4DSHA 3DA1A 2BS2A 3NT6A 1ZOYA 3H8IA 1YQZA 2GB0A 3CGEA 5KVHA 1IUVA 1H7XA 1RSGA 1IUWA 5HYMA 1DJNA 1REOA 1L9DA 2XVFA 5BVAA 4UDPA 1KNPA 4C3YA 2X8HA 3T37A 3RP7A 2GVCA 1GETA 2RGJA 2XLUA 4A79A 3AE1A 3SX6A 4EMIA 2C70A 1PN0A 5J7XA 2EQ7A 2BA9A 2ACZA 3ZDNA 2BABA 3AYIA 2JB2A 1IUXA 4CY8A 2GV8A 2C3CA 5FS9A 1N1PA 2B9WA 2BACA 3KA7A 5HHFA 4YSYA 4TM1A 2OAMA 1S7MA 1TDOA 2JB3A 4NTDA 2YLWA 2RGHA 3RP6A 4H4VA 2PYXA 3V3OA 3L5OA 3EANA 2WPCA 4YTNA 2YLXA 1GRBA 4IVMB 1GALA 2HQMA 1VRQB 1FECA 2B9XA 1GESA 3KKJA 5ER0A 1HYUA 4OPTA 4ICYA 4EQRA 3GWDA 2CVJA 3SGLA 3GYXA 2WP6A 3AEBA 3AXBA 2APGA 5KMPA 1B37A 1GRFA 1DNCA 4G74A 2WDVA 3GRTA 3V76A 2XLRA 2GAHB 4K22A 5KMQA 1OJ9A 3C4NA 2WBAA 3UOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BI2 A;  2YLR A;  5EB4 A;  2R45 A;  1Q9I A;  4U8O A;  4Y4N A;  3ZYX A;  2VQ7 A;  4IV9 A;  4JNA A;  2TPR A;  3CGD A;  1VG0 A;  4A9W A;  3NG7 X;  3AD9 B;  1NDA A;  1K0I A;  1O95 A;  2GQF A;  2V3A A;  4J33 A;  2C76 A;  1NG4 A;  1PDH A;  3C4A A;  3FMW A;  3OZ2 A;  4P9S A;  3G5R A;  1TYT A;  3KD9 A;  3K7T A;  2JK6 A;  2B9Y A;  3ALL A;  3DK8 A;  4AP1 A;  1RP0 A;  3BI4 A;  3NGC X;  2GEW A;  1GRG A;  1GOS A;  2GR0 A;  4BK1 A;  4CNJ A;  4ECH A;  2YG6 A;  1E1M A;  1N4W A;  2BXS A;  2YLT A;  2RAB A;  1JRY A;  1M6I A;  1NHP A;  5C2T A;  5TR3 A;  1PS9 A;  3K7M X;  3S5W A;  1FEB A;  1GRT A;  3CND A;  4IA5 A;  1NHS A;  4PAA A;  2OLN A;  3F8R A;  2GR3 A;  1S3B A;  2FJA A;  2WDR A;  5KOW A;  5IQ4 A;  3NTA A;  2O9Z A;  3ATQ A;  1DOE A;  2VRM A;  3GD3 A;  3QFA A;  1CHU A;  2VRL A;  2XCG A;  3P4P A;  5KOX A;  2YVJ A;  1QLB A;  3NN6 X;  5KXJ A;  4GUV A;  2C72 A;  1CBO A;  3AE2 A;  1E1K A;  1CL0 A;  2V60 A;  2XFQ A;  1KF6 A;  1PBC A;  3NHO X;  2BK3 A;  2XLS A;  4HB9 A;  2GR1 A;  2WQY A;  3ADA B;  4EQX A;  3H8L A;  3ITJ A;  1CJ2 A;  1BGN A;  2QA2 A;  1ZY8 A;  5L46 A;  2WS3 A;  3P9U A;  3P1W A;  3L1R A;  3UP4 A;  1CJC A;  3IC9 A;  2FJD A;  3GYJ A;  3IHG A;  1S3E A;  2WOI A;  1N4U A;  2XLP A;  3S61 A;  4B68 A;  5JCL A;  1NG3 A;  4Z24 A;  3AB1 A;  2FJE A;  2YQU A;  2A8X A;  3D8X A;  2C75 A;  4XWR A;  4ZN0 A;  2AQJ A;  4NTE A;  3LJP A;  1PXA A;  3VR8 A;  1KFY A;  3P4Q A;  1Y56 B;  3SFD A;  1B4V A;  4K2X A;  2IVE A;  4Z2U A;  1YY5 A;  4U8P A;  5CKU A;  4A7A A;  1JOA A;  1H84 A;  3PO7 A;  1MO9 A;  1B5Q A;  2BK4 A;  2Q7V A;  3NH3 X;  4YT0 A;  2AR8 A;  3UTH A;  1EL9 A;  2GF3 A;  2VOU A;  1FOH A;  3CGC A;  1JRX A;  5FMH A;  3CIR A;  3UKF A;  4GDE A;  2GMJ A;  4J36 A;  2EQ8 A;  4AT2 A;  3DK4 A;  1FEA A;  2WP5 A;  3Q6J A;  2RGO A;  4GR1 A;  2R0C A;  3LZX A;  2YG3 A;  4OCG A;  4YSX A;  2BXR A;  2XFN A;  1H83 A;  2DKH A;  3P4S A;  3AE3 A;  4ZCD A;  4RG3 A;  3LXD A;  1SEZ A;  2R46 A;  3AEE A;  5CQF A;  3BNU A;  4GCM A;  1GTH A;  4MJW A;  3WE0 A;  4J2W A;  4AP3 A;  1K0L A;  2WHD A;  3NIX A;  3DJG X;  2AAQ A;  1XPQ A;  4UDR A;  4EM4 A;  4H4T A;  2OA1 A;  4FK1 A;  4OPD A;  1VDC A;  2H89 A;  5DBJ A;  1S2Y A;  4BK3 A;  3AE8 A;  2XVE A;  2YAU A;  1EL7 A;  5KRQ A;  5EBK A;  3SQP A;  1ZMD A;  1P2H A;  2VVM A;  4H4Q A;  4EIP A;  1VQW A;  1OJT A;  1AOG A;  4Z2R A;  1PBE A;  2F5Z A;  5JCI A;  1IUS A;  1IUT A;  2WP9 A;  2GQW A;  2CFY A;  5JCM A;  2WPF A;  3M0O A;  1YKJ A;  1GND A;  4YTM A;  3UOX A;  3VRD B;  1F3P A;  2R9Z A;  1K0J A;  1EBD A;  3AWI A;  3BHF A;  3AE5 A;  2FJB A;  3RNM A;  3DJJ A;  2YG4 A;  3QJ4 A;  4OPU A;  2JAE A;  3B3R A;  3C96 A;  3GD4 A;  4I58 A;  5IPY A;  2BCG G;  5FS8 A;  3RHA A;  3AD8 B;  4EQW A;  1GV4 A;  3NTD A;  4J57 A;  1LV0 A;  1OJA A;  3L8K A;  1TRB A;  5M0Z A;  2XDO A;  3CNS A;  4A5L A;  4LU6 A;  2XVJ A;  4K7Z A;  4U8M A;  5EOW A;  3DME A;  4D03 A;  2WPE A;  3UKA A;  3ISH A;  4PAB A;  2FBW A;  3ALM A;  3AEF A;  4Z25 A;  2TMD A;  1PJ7 A;  2GAG B;  1W4X A;  3AYL A;  4YTP A;  2BC1 A;  1PBF A;  3CTY A;  1FL2 A;  4NEV A;  3FIM B;  2ZZC A;  3CNP A;  3FPZ A;  4J34 A;  2NPX A;  1JRZ A;  3NN0 X;  3URH A;  3NK2 X;  3GDP A;  1BKW A;  3I6D A;  2WU2 A;  1KSU A;  5LV9 A;  3AE6 A;  4H2N A;  1JNR A;  4XWZ A;  1CC6 A;  5BUL A;  2Q0K A;  3CNT A;  2XFP A;  2BS3 A;  4AOX A;  2C3D A;  4YKG A;  2V6O A;  5KVI A;  2IVD A;  5M10 A;  1FCD A;  1KSS A;  3M12 A;  3UTF A;  4OPG A;  4AT0 A;  4B65 A;  2R4E A;  2V3B A;  1GSN A;  2UZZ A;  2YVF A;  4EIQ A;  1H6V A;  2R4J A;  3JSK A;  1E7P A;  3NK1 X;  4B63 A;  3QFB A;  4U2T A;  3AEA A;  1Q1W A;  4I59 A;  5J60 A;  3ABV A;  4ZCC A;  1OJD A;  5JCK A;  2R0P A;  3H4K A;  4EM3 A;  1CJ4 A;  4HA6 A;  1CC4 A;  4KPR A;  4U8N A;  3AED A;  4AOS A;  3NYC A;  4C5O A;  1LJ1 A;  2Y6R A;  3KVE A;  3QSE A;  5U63 A;  2IID A;  3G5S A;  3KPF A;  1D4D A;  4A6N A;  4O5Q A;  3DK9 A;  1QO8 A;  1IUU A;  2B76 A;  3GWF A;  5KWF A;  1GT8 A;  3P4R A;  4USR A;  4DSG A;  3VRA A;  3FBS A;  4YSZ A;  4DGK A;  1NHQ A;  4E0V A;  4USQ A;  2WU5 A;  2YM1 A;  4JN9 A;  4YKF A;  1NAA A;  3BHK A;  3GYI A;  2QA1 A;  1JEH A;  5U25 A;  2E1M A;  1DOB A;  2Q0L A;  2YWL A;  3AD7 B;  4A6N B;  2GR2 A;  1PJ6 A;  1PXC A;  2C7G A;  3AE9 A;  1PHH A;  4GDP A;  4RG4 A;  1KDG A;  3VQR A;  3F8P A;  4B66 A;  1IJH A;  1CJ3 A;  1LQT A;  2EQ9 A;  4Y4M A;  3PS9 A;  2YR4 A;  3AEG A;  2B7S A;  1H82 A;  1GTE A;  4Z2T A;  1M64 A;  4Y4L A;  3AE7 A;  1BZL A;  4K5R A;  4EQS A;  4U8L A;  4YXD A;  1TYP A;  3R9U A;  4ADW A;  1DOC A;  1D7L A;  4H50 A;  2JBV A;  2X3N A;  4NZH A;  1E1N A;  1OJC A;  4TLZ A;  4Z44 A;  3CN8 A;  4X9M A;  3UP5 A;  1GER A;  2E5V A;  4B67 A;  4J56 A;  2YG5 A;  1D5T A;  1H86 A;  5FS7 A;  1F8R A;  4H4S A;  1PXB A;  4CCQ A;  2ARD A;  3OC4 A;  1YQ3 A;  3CPJ G;  3KU9 A;  3EF6 A;  5HY5 A;  3QSS A;  1GEU A;  2NVK X;  2Q6U A;  4JY2 A;  1DJQ A;  2JB1 A;  5BUK A;  3II4 A;  3VRB A;  2BYB A;  3DJE A;  2XFU A;  3NNE A;  1PBB A;  3DJD A;  1ZMC A;  2XVH A;  3ICT A;  3QSM A;  1BF3 A;  3HZL A;  2H88 A;  3NYF A;  1LTX R;  4C3X A;  1X31 B;  2XYO A;  3UOZ A;  1F8S A;  5GRT A;  2JKC A;  5U1O A;  3ATR A;  1PJ5 A;  3CPH G;  3UKH A;  2DKI A;  2YR5 A;  4A99 A;  4B69 A;  3RP8 A;  2BS4 A;  3GMB A;  3QVP A;  1NEK A;  2CUL A;  5C3J A;  4U8K A;  4APN A;  1DXL A;  2Y6Q A;  1Y56 A;  3E1T A;  4FK1 C;  1D4E A;  4H2Q A;  4JDR A;  4N9X A;  1TDF A;  3DGH A;  2WET A;  4JY3 A;  1ZP0 A;  4DNA A;  5IQ1 A;  1K4Q A;  3ALJ A;  1F8W A;  1LPF A;  1E6E A;  2BK5 A;  2YLZ A;  2YR6 A;  4CRT A;  3V3N A;  2V61 A;  4H2R A;  4H7U A;  3RED A;  3GMC A;  4WCT A;  4TM4 A;  4RSL A;  4TLX A;  1D7Y A;  3KLJ A;  4H2P A;  3EAO A;  1EL8 A;  3LB8 A;  3LOV A;  1CF3 A;  4IVO B;  2OLO A;  2A87 A;  4OPC A;  2YVG A;  3EPT A;  2WDQ A;  3BNM A;  2XVI A;  4Z43 A;  3PVC A;  3GSI A;  1O94 A;  4CNK A;  1ZKQ A;  3NKS A;  4UP3 A;  3UOY A;  1H7W A;  1LVL A;  3M13 A;  4BUR A;  5EB5 A;  4U8J A;  3GRS A;  2C73 A;  1ZOV A;  1Z6L A;  4H4X A;  1YQ4 A;  4D04 A;  3QVR A;  2PHH A;  4FX9 A;  1GXF A;  1EL5 A;  1UKV G;  3SM8 A;  4CY6 A;  2X99 A;  2C66 A;  4U2L A;  5HXI A;  3DGZ A;  4BJZ A;  3GDN A;  1D4C A;  5FS6 A;  3G5Q A;  1RYI A;  4OPI A;  4X4J A;  3UKK A;  1O5W A;  1ZX9 A;  1DOD A;  2YLS A;  4X9N A;  2J3N A;  1GRE A;  1ONF A;  1ZDL A;  2GMH A;  2C64 A;  3CNJ A;  1B8S A;  2WOW A;  1GRA A;  2WOV A;  1P2E A;  3UKQ A;  1S2Q A;  3NRN A;  3DH9 A;  1XHC A;  4GRT A;  4J31 A;  2BC0 A;  4OPL A;  1JU2 A;  4BJY A;  4K5S A;  2X50 A;  1CC2 A;  1NHR A;  2VVL A;  2YM2 A;  4Z26 A;  5JCN A;  1F6M A;  1LQU A;  1MXT A;  2E4G A;  1PBD A;  4YSH A;  2OAL A;  3LAD A;  3ICS A;  2C67 A;  3IHM A;  4NTC A;  1L0V A;  4IA6 A;  4FDC B;  3BI5 A;  3F8D A;  3VR9 A;  2GH5 A;  3IF9 A;  3LZW A;  5GSN A;  2ZZB A;  3UCL A;  3FG2 P;  3O0H A;  4H4Y A;  2Z5X A;  3ICR A;  4JQ9 A;  3Q9T A;  1TDK A;  4REK A;  1XDI A;  2WEU A;  4U2S A;  5BRT A;  4B64 A;  4A65 A;  2XLT A;  1BGJ A;  1KNR A;  4WX1 A;  1ELI A;  4BK2 A;  2EQ6 A;  2R0G A;  4TM0 A;  3UKP A;  3UKL A;  3CGB A;  2BCP A;  3NK0 X;  1L9C A;  3NLC A;  1TDN A;  4H4Z A;  4U8I A;  2XFO A;  2VQB A;  1ZK7 A;  4EMJ A;  4CCR A;  4H4P A;  3D1C A;  3AYJ A;  1QJD A;  4M52 A;  2V5Z A;  3NYE A;  3K7Q X;  1VG9 A;  2I0Z A;  2WES A;  3IWA A;  3AEC A;  1JNZ A;  4LII A;  2VZ2 A;  1COY A;  4B1B A;  4JNQ A;  1GRH A;  4H4W A;  3CPI G;  2B7R A;  4KX6 A;  4UDQ A;  1H81 A;  2ZBW A;  4YWO A;  4GF7 A;  2QAE A;  4C74 A;  4H4R A;  1NEN A;  4CBQ A;  3I3L A;  1L9E A;  3UTG A;  4K8D A;  2X8C A;  1V59 A;  4O5U A;  2W0H A;  2QCU A;  1Y0P A;  4C77 A;  2GRT A;  2A89 A;  2X8G A;  4TM3 A;  3UTE A;  4NEW A;  2VVL G;  1MOK A;  3SFE A;  1GPE A;  2YG7 A;  3AE4 A;  4XXG A;  1NPX A;  1TDE A;  1Q1R A;  3K30 A;  2ZZ0 A;  2CDU A;  1BWC A;  4BV6 A;  3B6D A;  4LA1 A;  4EMW A;  1E1L A;  1N4V A;  2C65 A;  4H4U A;  1XAN A;  3COX A;  1E39 A;  2Z5Y A;  4OVI A;  4DSH A;  3DA1 A;  2BS2 A;  3NT6 A;  1ZOY A;  3H8I A;  1YQZ A;  2GB0 A;  3CGE A;  5KVH A;  1IUV A;  1H7X A;  1RSG A;  1IUW A;  5HYM A;  1DJN A;  1REO A;  1L9D A;  2XVF A;  5BVA A;  4UDP A;  1KNP A;  4C3Y A;  2X8H A;  3T37 A;  3RP7 A;  2GVC A;  1GET A;  2RGJ A;  2XLU A;  4A79 A;  3AE1 A;  4EMI A;  2C70 A;  1PN0 A;  5J7X A;  2EQ7 A;  2BA9 A;  2ACZ A;  3ZDN A;  2BAB A;  3AYI A;  2JB2 A;  1IUX A;  4CY8 A;  2GV8 A;  2C3C A;  5FS9 A;  1N1P A;  2B9W A;  2BAC A;  3KA7 A;  5HHF A;  4YSY A;  4TM1 A;  2OAM A;  1TDO A;  2JB3 A;  4NTD A;  2YLW A;  2RGH A;  3RP6 A;  4H4V A;  2PYX A;  3V3O A;  3EAN A;  2WPC A;  4YTN A;  2YLX A;  1GRB A;  4IVM B;  1GAL A;  2HQM A;  1VRQ B;  1FEC A;  2B9X A;  1GES A;  3KKJ A;  5ER0 A;  1HYU A;  4OPT A;  4ICY A;  4EQR A;  3GWD A;  2CVJ A;  3SGL A;  2WP6 A;  3AEB A;  3AXB A;  2APG A;  1B37 A;  1GRF A;  1DNC A;  2WDV A;  3GRT A;  3V76 A;  2XLR A;  2GAH B;  4K22 A;  1OJ9 A;  3C4N A;  2WBA A;  3UOV A; 
#chains in the Genus database with same CATH topology
 5EB4 A;  2R45 A;  1Q9I A;  4Y4N A;  2VQ7 A;  4JNA A;  1NDA A;  4JN8 A;  1O95 A;  2ZC8 A;  1NG4 A;  1PDH A;  3C4A A;  3FMW A;  3AMZ A;  3K7T A;  3UJR A;  3ALL A;  3DIP A;  1E1M A;  1N4W A;  1M6I A;  4IHC A;  4PAA A;  1S3B A;  2FJA A;  2WDR A;  3ATQ A;  2VRM A;  3GD3 A;  1FFV C;  5KXJ A;  1E1K A;  3I6T A;  2MUC A;  2P3Z A;  2XFQ A;  1KF6 A;  3ZVH A;  3TTE A;  4EQX A;  3L1R A;  1CJC A;  3T9P A;  2AKM A;  4B68 A;  5JCL A;  2YQU A;  3D8X A;  2BRA A;  3DER A;  4K2X A;  2AKZ A;  5J04 A;  5FJO A;  1MO9 A;  1B5Q A;  1ZXI C;  1EL9 A;  2OX4 A;  2FKP A;  4GDE A;  2GMJ A;  2EQ8 A;  2XH0 A;  2R0C A;  4OCG A;  4ZCD A;  3I4K A;  3NVW B;  3AEE A;  5CQF A;  1GTH A;  1OEP A;  3WE0 A;  4J2W A;  3RCY A;  2OA1 A;  4OPD A;  1S2Y A;  4G7F A;  2OKT A;  3FYY A;  3N4E A;  1VQW A;  1KD0 A;  1OJT A;  1PBE A;  2F5Z A;  1IUS A;  1IUT A;  2GQW A;  3M0O A;  1GND A;  3UOX A;  3AWI A;  4I58 A;  3C96 A;  3GD4 A;  5FS8 A;  3AD8 B;  4J57 A;  1LV0 A;  1OJA A;  1E9I A;  4LU6 A;  3DME A;  2WPE A;  2TMD A;  4K8G A;  3FIM B;  4NEV A;  2ZZC A;  3CNP A;  3ZVI A;  3NN0 X;  2QVH A;  3URH A;  1MNS A;  2WU2 A;  1P48 A;  3AE6 A;  1JNR A;  1CC6 A;  2Q0K A;  1NEL A;  2IVD A;  5M10 A;  3UTF A;  4OPG A;  3AM9 A;  4EIQ A;  2R4J A;  3HPF A;  3QFB A;  1Q1W A;  3D46 A;  3MQT A;  4IP4 A;  5J60 A;  4ZCC A;  5G5G B;  1CC4 A;  3NYC A;  1LJ1 A;  4KWS A;  3MY9 A;  3G5S A;  4A6N A;  1D4D A;  4O5Q A;  3GWF A;  5KWF A;  4USR A;  3P4R A;  2XH2 A;  4E0V A;  2WU5 A;  2YM1 A;  5U25 A;  3ZLG A;  2Q0L A;  2GR2 A;  1PJ6 A;  1PXC A;  2C7G A;  1PHH A;  1KDG A;  1IJH A;  2EQ9 A;  4Y4M A;  3D9X A;  4DXK A;  1BZL A;  4K5R A;  1DOC A;  4H50 A;  1E1N A;  1OJC A;  4TLZ A;  3CN8 A;  2E5V A;  1H86 A;  3K1G A;  3EF6 A;  3V4B A;  3VCC A;  5KMS A;  1KKO A;  1DJQ A;  4E6M A;  5BUK A;  1PBB A;  2OZ3 A;  1LTX R;  2XYO A;  5GRT A;  2JKC A;  1SJC A;  4B69 A;  1NEK A;  2PTZ A;  4U8K A;  3PWI A;  4APN A;  1Y56 A;  1D4E A;  3N6H A;  1ZP0 A;  2MNR A;  1K4Q A;  4II2 A;  3ALJ A;  4CRT A;  3V3N A;  3KPK A;  3ES8 A;  1D7Y A;  4H2P A;  3EAO A;  4GYP A;  3LOV A;  2DW6 A;  3A7U A;  4OPC A;  3BNM A;  3FCP A;  4BUR A;  4ENL A;  4H4X A;  2PHH A;  4FX9 A;  5HXI A;  3DGZ A;  4OPI A;  4X4J A;  2GGE A;  2YLS A;  4X9N A;  1ZDL A;  3CNJ A;  1ELS A;  1B8S A;  2WOW A;  4DX3 A;  1XHC A;  4J31 A;  1JU2 A;  3T8Q A;  4G6G A;  2E4G A;  2OAL A;  4IA6 A;  3BI5 A;  3CAW A;  3UCL A;  3FG2 P;  4JQ9 A;  4GGH A;  4REK A;  1BGJ A;  4WX1 A;  3SXI A;  1ELI A;  4BK2 A;  3UKL A;  3CGB A;  1L9C A;  4H4Z A;  2OFJ A;  3AYJ A;  1QJD A;  3NYE A;  3K7Q X;  1VG9 A;  2WES A;  1JNZ A;  4HNL A;  4JNQ A;  3DEQ A;  4UDQ A;  1JCT A;  2ZBW A;  2P0I A;  4C74 A;  2HZG A;  1H2I A;  4GFI A;  2A89 A;  2VVL G;  3SFE A;  2PS2 A;  3AE4 A;  4G8T A;  1TDE A;  1Q1R A;  3HRD C;  2ZZ0 A;  1N4V A;  2OVL A;  1E39 A;  1KCZ A;  1DTN A;  1ZOY A;  5HYM A;  1RSG A;  1IUW A;  1L9D A;  4C3Y A;  2GVC A;  3AE1 A;  3SX6 A;  1X2G A;  1PN0 A;  2EQ7 A;  2BA9 A;  2BAB A;  3AYI A;  5FS9 A;  2B9W A;  4H1Z A;  3IJI A;  2OAM A;  1TDO A;  2JB3 A;  3UXK A;  4GGB A;  4NTD A;  2YLW A;  3RP6 A;  1JPD X;  2PYX A;  4YTN A;  2HQM A;  1VRQ B;  1FEC A;  2PP1 A;  4OPT A;  2CVJ A;  3GYX A;  4GME A;  1B37 A;  1GRF A;  3BJS A;  4YWS A;  4K22 A;  3IJQ A;  2YLR A;  4IV9 A;  2P8C A;  3CGD A;  4IL2 A;  4A9W A;  3AD9 B;  3VCN A;  2C76 A;  2HNE A;  3OZ2 A;  3MZN A;  3DK8 A;  1RP0 A;  3BI4 A;  2OO6 A;  2GR0 A;  4BK1 A;  4CNJ A;  3VA8 A;  2YG6 A;  3U4F A;  2RAB A;  1JRY A;  1PDZ A;  2PTY A;  1PS9 A;  3PK7 A;  3S5W A;  2GR3 A;  5KOW A;  1STZ A;  1CHU A;  2VRL A;  2XCG A;  5KOX A;  3NN6 X;  2C72 A;  3AE2 A;  2V60 A;  3TOY A;  2W3R A;  2PTX A;  4HB9 A;  5L46 A;  2WS3 A;  3P9U A;  3P1W A;  2E3T A;  3CMM A;  2XLP A;  3R25 A;  3FJ4 A;  4ZA0 A;  2PMQ A;  3Q4D A;  4XWR A;  3LJP A;  1Y56 B;  1B4V A;  4U8P A;  1JOA A;  1H84 A;  2BK4 A;  4YT0 A;  3UTH A;  3FXG A;  3UKF A;  5FMH A;  4AT2 A;  2GL5 A;  2WP5 A;  3Q6J A;  2DKH A;  3P4S A;  1SEZ A;  3SY4 A;  3R10 A;  3JZU A;  4AP3 A;  4EM4 A;  4FK1 A;  2P88 A;  3AE8 A;  1N5X A;  3SQP A;  4HN8 A;  3T2Z A;  2CFY A;  5JCM A;  2AL2 A;  3VRD B;  2R9Z A;  1EBD A;  4A6G A;  2FJB A;  4OPU A;  3QJ4 A;  3B3R A;  4EQW A;  1TRB A;  3L8K A;  4A5L A;  1X2H A;  3HYV A;  4U8M A;  5EOW A;  3TCS A;  4Z25 A;  3HYX A;  3NS1 B;  1PJ7 A;  2GAG B;  1W4X A;  3AYL A;  3A7A A;  3PG6 A;  3SJN A;  3CTY A;  3FPZ A;  4J34 A;  3MWC A;  1TKK A;  3GDP A;  1BKW A;  1KSU A;  3T4W A;  4XWZ A;  3NFU A;  2W55 A;  4KT2 A;  2C3D A;  5KVI A;  1FCD A;  1KSS A;  3M12 A;  4B65 A;  2V3B A;  2UZZ A;  1TZZ A;  2AL2 B;  4TVY A;  3JSK A;  3BSM A;  4U2T A;  2PU1 A;  3ABV A;  1JPM A;  5JCK A;  3H4K A;  4EM3 A;  4U8N A;  4C5O A;  3VFC A;  2IID A;  3KPF A;  4USQ A;  3UJS A;  4YKF A;  1NAA A;  3GYI A;  2QA1 A;  1JEH A;  3GD6 A;  2YWL A;  3AE9 A;  4GDP A;  4RG4 A;  1ONE A;  4B66 A;  3TWB A;  1LQT A;  3PS9 A;  3MSY A;  3AEG A;  1N60 C;  3EEZ A;  2B7S A;  1M64 A;  4YXD A;  1TYP A;  3V5F A;  3NVZ B;  4Z17 A;  4ADW A;  4GAP A;  1BKH A;  2JBV A;  3MKC A;  4Z44 A;  3UP5 A;  1GER A;  2YG5 A;  1D5T A;  1F8R A;  1PXB A;  4CCQ A;  1MDL A;  1YQ3 A;  3B9J B;  5HY5 A;  3SN4 A;  5BOE A;  1N5W C;  2JB1 A;  3II4 A;  3VRB A;  3NNE A;  4G6H A;  3DJD A;  3ICT A;  3QSM A;  1BF3 A;  3HZL A;  3H7V A;  4C3X A;  1X31 B;  3GO2 A;  3CPH G;  4A99 A;  3GMB A;  2QDD A;  3DFH A;  1TE6 A;  2CUL A;  5C3J A;  1FHV A;  1DXL A;  3OPS A;  3QTP A;  4JDR A;  4N9X A;  3UCD A;  3DGH A;  2WET A;  4H2H A;  1F8W A;  1RVK A;  2YLZ A;  4H7U A;  4GYP C;  4WCT A;  4TM4 A;  4RSL A;  4TLX A;  3KLJ A;  3LB8 A;  4IL0 A;  1KN0 A;  2WDQ A;  3PVC A;  4UP3 A;  3UOY A;  3M13 A;  4U8J A;  1Z6L A;  4EWJ A;  4FP1 A;  4CY6 A;  3SM8 A;  4U2L A;  4BJZ A;  3GC2 A;  3R11 A;  5FS6 A;  3UKK A;  3SYI A;  2AL1 A;  3DG3 A;  5FJR A;  3UKQ A;  3NRN A;  4GRT A;  4OPL A;  4BJY A;  4K5S A;  2X50 A;  2VVL A;  2YM2 A;  4Z26 A;  2GGI A;  1MXT A;  3T14 A;  1L0V A;  3F8D A;  1P43 A;  2GH5 A;  4E4U A;  4H4Y A;  5BOF A;  1XDI A;  5BRT A;  4A65 A;  3NK0 X;  2VQB A;  2POZ A;  4H4P A;  4M52 A;  3OP2 A;  1FO4 A;  3JW7 A;  4B1B A;  3CPI G;  2B7R A;  1H81 A;  4YWO A;  3TW9 A;  1MDR A;  2PSN A;  3I3L A;  1L9E A;  2W0H A;  4DN1 A;  2X8G A;  3UTE A;  2YG7 A;  4XXG A;  4LA1 A;  1KKR A;  4EMW A;  2C65 A;  3DA1 A;  3SN1 A;  3CGE A;  2CHR A;  2OQH A;  3I6E A;  1ECQ A;  5BVA A;  4UDP A;  2X8H A;  3RP7 A;  1SB3 B;  4H83 A;  2XLU A;  2C70 A;  5J7X A;  2ACZ A;  3ZDN A;  3P0W A;  1IUX A;  2GV8 A;  3KA7 A;  1S7M A;  2RGH A;  3L5O A;  1GRB A;  3R07 C;  1R6W A;  4ICY A;  3R0K A;  3SGL A;  3EKG A;  3T6C A;  5FJT A;  5KMQ A;  3C4N A;  2WBA A;  3BI2 A;  2NQL A;  2TPR A;  3MUC A;  3NG7 X;  3VC5 A;  1K0I A;  2GGH A;  4J33 A;  3ENL A;  4P9S A;  3KD9 A;  3BOX A;  1EC7 A;  4J3Z A;  3V5C A;  2B9Y A;  4AP1 A;  3NGC X;  4NNJ A;  1GRG A;  1GOS A;  3DFY A;  5TR3 A;  1FEB A;  4IA5 A;  1NHS A;  2OLN A;  3R1Z A;  3NTA A;  2PU0 A;  3P4P A;  4DWD A;  3NVV B;  2YVJ A;  5G5H B;  1QLB A;  4GUV A;  1CL0 A;  1EC9 A;  2XSX A;  3NXL A;  1PBC A;  3NHO X;  2BK3 A;  2XLS A;  4TVW A;  1N63 C;  3H8L A;  1BGN A;  2QA2 A;  3UP4 A;  3IC9 A;  3GYJ A;  1S3E A;  1N4U A;  3QPE A;  1NG3 A;  3AB1 A;  2C75 A;  4NTE A;  1PXA A;  3VR8 A;  3P4Q A;  3FVD A;  3HYW A;  1YY5 A;  5CKU A;  2QJN A;  3CYJ A;  2AR8 A;  3DG6 A;  1FOH A;  5KMR A;  3CIR A;  4ZCW A;  2GSH A;  2PPG A;  4J36 A;  3DK4 A;  2O56 A;  2ONE A;  3LZX A;  2XH7 A;  4YSX A;  2XFN A;  1H83 A;  3AE3 A;  3KUM A;  1SJD A;  3BNU A;  3AN1 A;  4GCM A;  1K0L A;  2WHD A;  2AAQ A;  1XPQ A;  3N6J A;  5DBJ A;  4BK3 A;  5KRQ A;  4HCH A;  1ZMD A;  3CK5 A;  1P2H A;  2VVM A;  4H4Q A;  4EIP A;  3RO6 A;  4Z2R A;  1AOG A;  1SJA A;  5JCI A;  3HW2 A;  4HPN A;  2WP9 A;  2E5A A;  2WPF A;  4YTM A;  3H8A A;  3BHF A;  2W3S A;  3RNM A;  3DJJ A;  3UGV A;  4K2S A;  2JAE A;  2BCG G;  3RHA A;  3NTD A;  1GV4 A;  2PGW A;  5M0Z A;  2XDO A;  3CNS A;  2C4C A;  4K7Z A;  3ISH A;  4PAB A;  2FBW A;  3AEF A;  3N4F A;  2BC1 A;  1PBF A;  1FL2 A;  1JRZ A;  3I6D A;  5LV9 A;  3CNT A;  4AOX A;  2BS3 A;  4A3R A;  3UXL A;  4F4R A;  4AT0 A;  3Q45 A;  1GSN A;  2YVF A;  1H6V A;  1E7P A;  4B63 A;  3NK1 X;  3AEA A;  1OJD A;  1CJ4 A;  4KPR A;  3AED A;  3KVE A;  2Y6R A;  3NZG A;  2B76 A;  1GT8 A;  2RDX A;  3FBS A;  4YSZ A;  1R0M A;  3A7R A;  2E1M A;  3RR1 A;  3F8P A;  4Z1Y A;  3VDG A;  3SZF A;  3RIT A;  2YR4 A;  1H82 A;  1GTE A;  4Z2T A;  3AE7 A;  4U8L A;  3R9U A;  1D7L A;  2X3N A;  2I5Q A;  4X9M A;  4B67 A;  2ARD A;  3OC4 A;  2PGE A;  1L8P A;  3UCC A;  2NVK X;  2P8B A;  4HNC A;  4JY2 A;  2BYB A;  3DJE A;  1ZMC A;  2XVH A;  2H88 A;  3NYF A;  3FV9 A;  3UOZ A;  3ATR A;  5U1O A;  2DKI A;  3CXB A;  3RP8 A;  2BS4 A;  2BRY A;  7ENL A;  3QLD A;  4E5T A;  2OPJ A;  4DNA A;  2BK5 A;  1E6E A;  2V61 A;  3RED A;  1BQG A;  4X2P A;  1EL8 A;  1CF3 A;  4IVO B;  2OLO A;  2A87 A;  4Z43 A;  2YVG A;  2GGG A;  3PFR A;  1VQZ A;  1O94 A;  4CNK A;  2QJJ A;  3NKS A;  3DDM A;  1H7W A;  1LVL A;  3GRS A;  3QVR A;  3SBF A;  1EL5 A;  2X99 A;  2C66 A;  3GDN A;  1D4C A;  1RYI A;  3NRZ B;  1XS2 A;  1ONF A;  4MMW A;  3DH9 A;  2BC0 A;  1CC2 A;  3TQP A;  1F6M A;  2W54 A;  1LQU A;  1PBD A;  3ICS A;  2C67 A;  3IHM A;  4NTC A;  3VR9 A;  2PTW A;  3LZW A;  4M6U A;  3ICR A;  1TDK A;  1WUF A;  2WEU A;  4U2S A;  4B64 A;  4GIR A;  3UKP A;  2BCP A;  3NLC A;  1TDN A;  4U8I A;  4EMJ A;  3ZVH B;  3D1C A;  2GDQ A;  2I0Z A;  3AEC A;  4LII A;  2VZ2 A;  1COY A;  4KX6 A;  3OTR A;  3RRA A;  1NEN A;  2OZ8 A;  1V59 A;  3UJ2 A;  4O5U A;  1Y0P A;  3NVY B;  4NWZ A;  4NEW A;  3DG7 A;  1NPX A;  2CDU A;  1BWC A;  2XGZ A;  1E1L A;  2DW7 A;  4DSH A;  2BS2 A;  5KVH A;  1IUV A;  2OG9 A;  1H7X A;  1REO A;  3T37 A;  3SQS A;  1JDF A;  1GET A;  2JB2 A;  4CY8 A;  1N1P A;  2BAC A;  4YSY A;  5EU9 A;  4GIS A;  3DES A;  3STP A;  4H4V A;  3V3O A;  2WPC A;  2YLX A;  1GAL A;  3TWA A;  3KKJ A;  3S47 A;  5ER0 A;  4EQR A;  3GWD A;  3PWG A;  2APG A;  1DNC A;  2WDV A;  1SJB A;  3V76 A;  1F9C A;  1OJ9 A;  3UOV A;  4U8O A;  4MGG A;  3ZYX A;  1VG0 A;  1JRO A;  5FJU A;  3UJF A;  2GQF A;  2V3A A;  3T2K A;  3G5R A;  1TYT A;  2JK6 A;  4E4F A;  2POD A;  3IJL A;  2GEW A;  4ECH A;  2BXS A;  2YLT A;  1NHP A;  3K7M X;  1GRT A;  3CND A;  2OQY A;  3F8R A;  3SZC A;  5IQ4 A;  2O9Z A;  2FYM A;  1DOE A;  3QFA A;  1CBO A;  1EBG A;  2GR1 A;  2WQY A;  3ADA B;  3ITJ A;  1CJ2 A;  1ZY8 A;  3RGT A;  3T0K A;  2FJD A;  3IHG A;  3B97 A;  2WOI A;  3S61 A;  4HYR A;  3S5S A;  4Z24 A;  2FJE A;  2A8X A;  4ZN0 A;  2AQJ A;  3D47 A;  1KFY A;  3SFD A;  2IVE A;  4Z2U A;  4A7A A;  3PO7 A;  2Q7V A;  3NH3 X;  2GF3 A;  2VOU A;  3THU A;  3CGC A;  1JRX A;  4H19 A;  1FEA A;  2RGO A;  4GR1 A;  2YG3 A;  2BXR A;  2PP3 A;  4RG3 A;  3LXD A;  2R46 A;  4MJW A;  3NIX A;  3DJG X;  4UDR A;  4H4T A;  1VDC A;  2H89 A;  2XVE A;  2YAU A;  1EL7 A;  5EBK A;  4IP5 A;  3ZLF A;  3EUB 3;  3ETR B;  3DGB A;  1YKJ A;  1F3P A;  1K0J A;  3AE5 A;  3V3W A;  5KNL A;  2YG4 A;  5IPY A;  5C2T A;  4DHG A;  2XVJ A;  3UKA A;  3OZM A;  3ZLH A;  3ALM A;  3CXO A;  4YTP A;  4KEM A;  2NPX A;  2ZAD A;  4HCD A;  3NK2 X;  2HXU A;  4H2N A;  3QKE A;  2PP0 A;  5BUL A;  2XFP A;  4YKG A;  1WYG A;  2V6O A;  3JVA A;  2R4E A;  1EC8 A;  3CT2 A;  1RM6 B;  4I59 A;  2R0P A;  3OW1 A;  4HA6 A;  4GAV A;  4AOS A;  6ENL A;  3QSE A;  5U63 A;  3DK9 A;  1QO8 A;  1IUU A;  1T3Q C;  4DSG A;  3VRA A;  1WUE A;  4DGK A;  1NHQ A;  4J1O A;  4JN9 A;  5IDZ A;  3BHK A;  4M0X A;  3U9I A;  1W6T A;  4D03 A;  1DOB A;  4A6N B;  3AD7 B;  3VQR A;  5JRB A;  1CJ3 A;  2XH4 A;  2HXT A;  4Y4L A;  4EQS A;  3SZ0 A;  4ROP A;  4NZH A;  2QJM A;  3IK4 A;  4J56 A;  5FS7 A;  4H4S A;  3TJI A;  3CPJ G;  3KU9 A;  3QSS A;  3SZW A;  1GEU A;  4MKS A;  2Q6U A;  4ZOH B;  2XFU A;  3P3B A;  1F8S A;  3UKH A;  1PJ5 A;  2YR5 A;  4G9K A;  4G73 A;  4FI4 A;  3QVP A;  2Y6Q A;  3E1T A;  4FK1 C;  4H2Q A;  1TDF A;  4JY3 A;  1XPY A;  5IQ1 A;  2QGY A;  1LPF A;  2YR6 A;  4H2R A;  3GMC A;  4HCL A;  1EBH A;  3EPT A;  2XVI A;  3GSI A;  1ZKQ A;  5EB5 A;  1N62 C;  2C73 A;  1ZOV A;  3T2Y A;  1MUC A;  1YQ4 A;  4D04 A;  1FFU C;  1GXF A;  1UKV G;  4A35 A;  5FJP A;  4IZG A;  3G5Q A;  3T31 A;  1PDY A;  1O5W A;  1ZX9 A;  1DOD A;  1FIQ B;  3ES7 A;  2J3N A;  1GRE A;  2GMH A;  2C64 A;  2PCE A;  1GRA A;  2WOV A;  1P2E A;  1S2Q A;  1NHR A;  3UJE A;  3SSZ A;  5JCN A;  4YSH A;  3LAD A;  1MRA A;  4FDC B;  1N61 C;  3IF9 A;  5GSN A;  2ZZB A;  3O0H A;  2Z5X A;  3Q9T A;  3OZY A;  1NU5 A;  2XLT A;  1KNR A;  2EQ6 A;  2R0G A;  4TM0 A;  3SR6 B;  1FHU A;  2OZT A;  4DYE A;  2XFO A;  1ZK7 A;  4CCR A;  2V5Z A;  4IT1 A;  3NO1 A;  3H70 A;  3IWA A;  1GRH A;  4H4W A;  1VDV A;  4GF7 A;  2QAE A;  4KPL A;  3VC6 A;  4H4R A;  4CBQ A;  3UTG A;  4K8D A;  2X8C A;  2QCU A;  4C77 A;  2GRT A;  2OLA A;  4TM3 A;  1MOK A;  1GPE A;  3GY1 A;  3K30 A;  4BV6 A;  3B6D A;  3SN0 A;  4H4U A;  1XAN A;  4II3 A;  3R0U A;  3COX A;  2Z5Y A;  4OVI A;  3NT6 A;  4E8G A;  3H8I A;  1IYX A;  1YQZ A;  2GB0 A;  2QDE A;  1DJN A;  3TJ4 A;  4JN7 A;  2XVF A;  1KNP A;  2RGJ A;  4A79 A;  3H12 A;  3P93 A;  4EMI A;  1JRP A;  2C3C A;  5HHF A;  4TM1 A;  4K1W A;  1V97 A;  2QQ6 A;  3QN3 A;  3EAN A;  2PA6 A;  4IVM B;  1YEY A;  4JHM A;  2B9X A;  1GES A;  5ENL A;  1HYU A;  3CB3 A;  2WP6 A;  3AEB A;  2GGJ A;  3AXB A;  5KMP A;  4G74 A;  3GRT A;  2XLR A;  2GAH B; 
#chains in the Genus database with same CATH homology
 3BI2 A;  2YLR A;  5EB4 A;  2R45 A;  1Q9I A;  4U8O A;  4Y4N A;  3ZYX A;  2VQ7 A;  4IV9 A;  4JNA A;  2TPR A;  3CGD A;  1VG0 A;  4A9W A;  3NG7 X;  3AD9 B;  1NDA A;  1K0I A;  1O95 A;  2GQF A;  2V3A A;  4J33 A;  2C76 A;  1NG4 A;  1PDH A;  3C4A A;  3T2K A;  3FMW A;  3OZ2 A;  4P9S A;  3G5R A;  1TYT A;  3KD9 A;  3K7T A;  2JK6 A;  2B9Y A;  3ALL A;  3DK8 A;  4AP1 A;  1RP0 A;  3BI4 A;  3NGC X;  4NNJ A;  2GEW A;  1GRG A;  1GOS A;  2GR0 A;  4BK1 A;  4CNJ A;  4ECH A;  2YG6 A;  1E1M A;  1N4W A;  2BXS A;  2YLT A;  2RAB A;  1JRY A;  1M6I A;  1NHP A;  5C2T A;  5TR3 A;  1PS9 A;  3K7M X;  3S5W A;  1FEB A;  1GRT A;  3CND A;  4IA5 A;  1NHS A;  4PAA A;  2OLN A;  3F8R A;  2GR3 A;  1S3B A;  2FJA A;  2WDR A;  3SZC A;  5IQ4 A;  5KOW A;  3NTA A;  2O9Z A;  3ATQ A;  1DOE A;  2VRM A;  3GD3 A;  3QFA A;  1CHU A;  2VRL A;  2XCG A;  3P4P A;  5KOX A;  2YVJ A;  1QLB A;  3NN6 X;  5KXJ A;  4GUV A;  2C72 A;  1CBO A;  3AE2 A;  1E1K A;  1CL0 A;  2V60 A;  2XFQ A;  1KF6 A;  1PBC A;  3NHO X;  2BK3 A;  2XLS A;  4HB9 A;  2GR1 A;  2WQY A;  3ADA B;  4EQX A;  3H8L A;  3ITJ A;  1CJ2 A;  1BGN A;  2QA2 A;  1ZY8 A;  5L46 A;  2WS3 A;  3P9U A;  3P1W A;  3L1R A;  3UP4 A;  1CJC A;  3IC9 A;  3T0K A;  2FJD A;  3GYJ A;  3IHG A;  1S3E A;  2WOI A;  1N4U A;  2XLP A;  3CMM A;  3S61 A;  4B68 A;  5JCL A;  1NG3 A;  4Z24 A;  3AB1 A;  2FJE A;  2YQU A;  2A8X A;  3D8X A;  2C75 A;  4XWR A;  4ZN0 A;  2AQJ A;  4NTE A;  4Z43 A;  3LJP A;  1PXA A;  3VR8 A;  1KFY A;  2BRA A;  3P4Q A;  1Y56 B;  3SFD A;  1B4V A;  4K2X A;  2IVE A;  3HYW A;  4Z2U A;  1YY5 A;  4U8P A;  5CKU A;  4A7A A;  1JOA A;  1H84 A;  3PO7 A;  1MO9 A;  1B5Q A;  2BK4 A;  2Q7V A;  3NH3 X;  4YT0 A;  2AR8 A;  3UTH A;  1EL9 A;  2GF3 A;  2VOU A;  1FOH A;  5KMR A;  3CGC A;  1JRX A;  5FMH A;  3CIR A;  3UKF A;  4GDE A;  2GMJ A;  4J36 A;  2EQ8 A;  4AT2 A;  3DK4 A;  1FEA A;  2WP5 A;  3Q6J A;  2RGO A;  4GR1 A;  2R0C A;  3LZX A;  2YG3 A;  4OCG A;  4YSX A;  2BXR A;  2XFN A;  1H83 A;  2DKH A;  3P4S A;  3AE3 A;  4ZCD A;  4RG3 A;  3LXD A;  1SEZ A;  2R46 A;  3AEE A;  3SY4 A;  5CQF A;  3BNU A;  4GCM A;  1GTH A;  4MJW A;  3WE0 A;  4J2W A;  4AP3 A;  1K0L A;  2WHD A;  3NIX A;  3DJG X;  2AAQ A;  1XPQ A;  4UDR A;  4EM4 A;  4H4T A;  2OA1 A;  4FK1 A;  4OPD A;  1VDC A;  2H89 A;  5DBJ A;  1S2Y A;  4BK3 A;  3AE8 A;  2XVE A;  2YAU A;  1EL7 A;  5KRQ A;  5EBK A;  3SQP A;  1ZMD A;  1P2H A;  2VVM A;  4H4Q A;  4EIP A;  1VQW A;  1OJT A;  1AOG A;  4Z2R A;  1PBE A;  2F5Z A;  5JCI A;  1IUS A;  1IUT A;  3T2Z A;  2WP9 A;  2GQW A;  2CFY A;  5JCM A;  2WPF A;  3M0O A;  1YKJ A;  1GND A;  4YTM A;  3UOX A;  3VRD B;  1F3P A;  2R9Z A;  1K0J A;  1EBD A;  3AWI A;  3BHF A;  3AE5 A;  2FJB A;  3RNM A;  3DJJ A;  5KNL A;  2YG4 A;  3QJ4 A;  4OPU A;  2JAE A;  3B3R A;  3C96 A;  3GD4 A;  4I58 A;  5IPY A;  2BCG G;  5FS8 A;  3RHA A;  3AD8 B;  4EQW A;  1GV4 A;  3NTD A;  4J57 A;  1LV0 A;  1OJA A;  3L8K A;  1TRB A;  5M0Z A;  2XDO A;  3CNS A;  4A5L A;  4LU6 A;  2C4C A;  4K7Z A;  2XVJ A;  3HYV A;  4U8M A;  5EOW A;  3DME A;  4D03 A;  2WPE A;  3UKA A;  3ISH A;  4PAB A;  2FBW A;  3ALM A;  3AEF A;  4Z25 A;  3HYX A;  2TMD A;  1PJ7 A;  2GAG B;  1W4X A;  3AYL A;  3PG6 A;  4YTP A;  2BC1 A;  1PBF A;  3CTY A;  1FL2 A;  4NEV A;  3FIM B;  2ZZC A;  3CNP A;  3FPZ A;  4J34 A;  2NPX A;  1JRZ A;  3NN0 X;  3URH A;  3NK2 X;  3GDP A;  1BKW A;  3I6D A;  2WU2 A;  1KSU A;  5LV9 A;  3AE6 A;  4H2N A;  1JNR A;  4XWZ A;  1CC6 A;  5BUL A;  2Q0K A;  3CNT A;  2XFP A;  2BS3 A;  4AOX A;  2C3D A;  4YKG A;  2V6O A;  5KVI A;  2IVD A;  5M10 A;  1FCD A;  1KSS A;  3M12 A;  3UTF A;  4OPG A;  4AT0 A;  4B65 A;  2R4E A;  2V3B A;  1GSN A;  2UZZ A;  2YVF A;  4EIQ A;  1H6V A;  2R4J A;  3JSK A;  1E7P A;  3NK1 X;  4B63 A;  3QFB A;  4U2T A;  3AEA A;  1Q1W A;  4I59 A;  5J60 A;  3ABV A;  4ZCC A;  1OJD A;  5JCK A;  2R0P A;  3H4K A;  4EM3 A;  1CJ4 A;  4HA6 A;  1CC4 A;  4KPR A;  4GAV A;  3AED A;  4U8N A;  4AOS A;  3NYC A;  4C5O A;  1LJ1 A;  2Y6R A;  3KVE A;  3QSE A;  5U63 A;  2IID A;  3G5S A;  3KPF A;  1D4D A;  4A6N A;  4O5Q A;  3DK9 A;  1QO8 A;  1IUU A;  2B76 A;  3GWF A;  5KWF A;  1GT8 A;  3P4R A;  4USR A;  4DSG A;  3VRA A;  3FBS A;  4YSZ A;  4DGK A;  1NHQ A;  4E0V A;  4USQ A;  2WU5 A;  2YM1 A;  4JN9 A;  4YKF A;  1NAA A;  3BHK A;  3GYI A;  2QA1 A;  1JEH A;  5U25 A;  2E1M A;  1DOB A;  2Q0L A;  2YWL A;  3AD7 B;  4A6N B;  2GR2 A;  1PJ6 A;  1PXC A;  2C7G A;  3AE9 A;  1PHH A;  4GDP A;  4RG4 A;  1KDG A;  3VQR A;  3F8P A;  4B66 A;  5JRB A;  1IJH A;  1CJ3 A;  1LQT A;  2EQ9 A;  4Y4M A;  3PS9 A;  3SZF A;  3D9X A;  2YR4 A;  3AEG A;  2B7S A;  1H82 A;  1GTE A;  4Z2T A;  1M64 A;  4Y4L A;  3AE7 A;  1BZL A;  4K5R A;  4EQS A;  4U8L A;  4YXD A;  1TYP A;  3SZ0 A;  3R9U A;  4ADW A;  1DOC A;  1D7L A;  4H50 A;  2JBV A;  2X3N A;  4GAP A;  4NZH A;  1E1N A;  1OJC A;  4TLZ A;  4Z44 A;  3CN8 A;  4X9M A;  3UP5 A;  1GER A;  2E5V A;  4B67 A;  4J56 A;  2YG5 A;  1D5T A;  1H86 A;  5FS7 A;  1F8R A;  4H4S A;  1PXB A;  4CCQ A;  2ARD A;  3OC4 A;  1YQ3 A;  3CPJ G;  3KU9 A;  3EF6 A;  5HY5 A;  3QSS A;  3SZW A;  1GEU A;  2NVK X;  5KMS A;  2Q6U A;  4JY2 A;  1DJQ A;  2JB1 A;  5BUK A;  3II4 A;  3VRB A;  2BYB A;  3DJE A;  2XFU A;  3NNE A;  4G6H A;  1PBB A;  3DJD A;  1ZMC A;  2XVH A;  3ICT A;  3QSM A;  1BF3 A;  3HZL A;  2H88 A;  3NYF A;  1LTX R;  4C3X A;  1X31 B;  2XYO A;  3UOZ A;  1F8S A;  5GRT A;  2JKC A;  5U1O A;  3ATR A;  1PJ5 A;  3CPH G;  3UKH A;  2DKI A;  2YR5 A;  4A99 A;  4B69 A;  3RP8 A;  4G9K A;  4G73 A;  2BS4 A;  3GMB A;  3QVP A;  2BRY A;  1NEK A;  2CUL A;  5C3J A;  4U8K A;  4APN A;  1DXL A;  2Y6Q A;  1Y56 A;  3E1T A;  4FK1 C;  1D4E A;  4H2Q A;  4JDR A;  4N9X A;  1TDF A;  3DGH A;  2WET A;  4JY3 A;  1ZP0 A;  4DNA A;  5IQ1 A;  1K4Q A;  4II2 A;  3ALJ A;  1F8W A;  1LPF A;  1E6E A;  2BK5 A;  2YLZ A;  2YR6 A;  4CRT A;  3V3N A;  2V61 A;  4H2R A;  4H7U A;  3KPK A;  3RED A;  3GMC A;  4WCT A;  4TM4 A;  4RSL A;  4TLX A;  1D7Y A;  3KLJ A;  4H2P A;  3EAO A;  1EL8 A;  3LB8 A;  3LOV A;  1CF3 A;  4IVO B;  2OLO A;  2A87 A;  4OPC A;  2YVG A;  3EPT A;  1KN0 A;  2WDQ A;  2XVI A;  3BNM A;  3PVC A;  3GSI A;  1O94 A;  4CNK A;  1ZKQ A;  3NKS A;  4UP3 A;  3UOY A;  1H7W A;  1LVL A;  3M13 A;  4BUR A;  5EB5 A;  4U8J A;  3GRS A;  2C73 A;  1ZOV A;  3T2Y A;  1Z6L A;  4H4X A;  1YQ4 A;  4D04 A;  3QVR A;  2PHH A;  4FX9 A;  1GXF A;  1EL5 A;  1UKV G;  3SM8 A;  4CY6 A;  2X99 A;  2C66 A;  4U2L A;  5HXI A;  3DGZ A;  4BJZ A;  3GDN A;  1D4C A;  5FS6 A;  3G5Q A;  1RYI A;  4OPI A;  4X4J A;  3T31 A;  3UKK A;  3SYI A;  1O5W A;  1ZX9 A;  1DOD A;  2YLS A;  4X9N A;  2J3N A;  1GRE A;  1ONF A;  1ZDL A;  2GMH A;  2C64 A;  3CNJ A;  1B8S A;  2WOW A;  1GRA A;  2WOV A;  1P2E A;  3UKQ A;  1S2Q A;  3NRN A;  3DH9 A;  1XHC A;  4GRT A;  4J31 A;  2BC0 A;  4OPL A;  1JU2 A;  4BJY A;  4K5S A;  2X50 A;  1CC2 A;  1NHR A;  2VVL A;  2YM2 A;  4Z26 A;  5JCN A;  4G6G A;  1F6M A;  1LQU A;  1MXT A;  2E4G A;  1PBD A;  3T14 A;  4YSH A;  2OAL A;  3LAD A;  3ICS A;  2C67 A;  3IHM A;  4NTC A;  1L0V A;  4IA6 A;  4FDC B;  3BI5 A;  3F8D A;  3VR9 A;  2GH5 A;  3IF9 A;  3LZW A;  5GSN A;  2ZZB A;  3UCL A;  3FG2 P;  3O0H A;  4H4Y A;  2Z5X A;  3ICR A;  4JQ9 A;  3Q9T A;  1TDK A;  4REK A;  1XDI A;  2WEU A;  4U2S A;  5BRT A;  4B64 A;  4A65 A;  2XLT A;  1BGJ A;  1KNR A;  4WX1 A;  3SXI A;  1ELI A;  4BK2 A;  2EQ6 A;  2R0G A;  4TM0 A;  3UKP A;  3UKL A;  3CGB A;  2BCP A;  3NK0 X;  1L9C A;  3NLC A;  1TDN A;  4H4Z A;  4U8I A;  2XFO A;  2VQB A;  1ZK7 A;  4EMJ A;  4CCR A;  4H4P A;  3D1C A;  3AYJ A;  1QJD A;  4M52 A;  2V5Z A;  3NYE A;  3K7Q X;  1VG9 A;  2I0Z A;  2WES A;  3IWA A;  3AEC A;  1JNZ A;  4LII A;  2VZ2 A;  1COY A;  4B1B A;  4JNQ A;  1GRH A;  4H4W A;  3CPI G;  2B7R A;  4KX6 A;  4UDQ A;  1H81 A;  2ZBW A;  4YWO A;  4GF7 A;  2QAE A;  4C74 A;  4H4R A;  1NEN A;  4CBQ A;  3I3L A;  1L9E A;  3UTG A;  4K8D A;  1H2I A;  2X8C A;  1V59 A;  4O5U A;  2W0H A;  2QCU A;  1Y0P A;  4C77 A;  2GRT A;  2A89 A;  2X8G A;  4NWZ A;  4TM3 A;  3UTE A;  4NEW A;  2VVL G;  1MOK A;  3SFE A;  1GPE A;  2YG7 A;  3AE4 A;  4XXG A;  1NPX A;  1TDE A;  1Q1R A;  3K30 A;  2ZZ0 A;  2CDU A;  1BWC A;  4BV6 A;  3B6D A;  4LA1 A;  4EMW A;  1E1L A;  1N4V A;  2C65 A;  4H4U A;  1XAN A;  4II3 A;  3COX A;  1E39 A;  2Z5Y A;  4OVI A;  4DSH A;  3DA1 A;  2BS2 A;  3NT6 A;  1ZOY A;  3H8I A;  1YQZ A;  2GB0 A;  3CGE A;  5KVH A;  1IUV A;  1H7X A;  1RSG A;  1IUW A;  5HYM A;  1DJN A;  1REO A;  1L9D A;  2XVF A;  5BVA A;  4UDP A;  1KNP A;  4C3Y A;  2X8H A;  3T37 A;  3RP7 A;  2GVC A;  1GET A;  2RGJ A;  2XLU A;  4A79 A;  3AE1 A;  3SX6 A;  4EMI A;  2C70 A;  1PN0 A;  5J7X A;  2EQ7 A;  2BA9 A;  2ACZ A;  3ZDN A;  2BAB A;  3AYI A;  2JB2 A;  1IUX A;  4CY8 A;  2GV8 A;  2C3C A;  5FS9 A;  1N1P A;  2B9W A;  2BAC A;  3KA7 A;  5HHF A;  4YSY A;  4TM1 A;  2OAM A;  1S7M A;  1TDO A;  2JB3 A;  4NTD A;  2YLW A;  2RGH A;  3RP6 A;  4H4V A;  2PYX A;  3V3O A;  3L5O A;  3EAN A;  2WPC A;  4YTN A;  2YLX A;  1GRB A;  4IVM B;  1GAL A;  2HQM A;  1VRQ B;  1FEC A;  2B9X A;  1GES A;  3KKJ A;  5ER0 A;  1HYU A;  4OPT A;  4ICY A;  4EQR A;  3GWD A;  2CVJ A;  3SGL A;  3GYX A;  2WP6 A;  3AEB A;  3AXB A;  2APG A;  5KMP A;  1B37 A;  1GRF A;  1DNC A;  4G74 A;  2WDV A;  3GRT A;  3V76 A;  2XLR A;  2GAH B;  4K22 A;  5KMQ A;  1OJ9 A;  3C4N A;  2WBA A;  3UOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...