3OZYA

Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg and m-xylarate
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
386
structure length
386
Chain Sequence
SLKITEVKAHALSTPIPERMRVESGAGLKLNRQMILVEVRTDEGVTGVGSPSGPYDLAVLKRAIEDVIGPQLIGEDPANINYLWHKVFHGEVSRNLGHRSVGIAAMSGVDIALWDLKGRAMNQPIYQLLGGKFHTRGVRAYASSIYWDLTPDQAADELAGWVEQGFTAAKLKVGRAPRKDAANLRAMRQRVGADVEILVDANQSLGRHDALAMLRILDEAGCYWFEEPLSIDDIEGHRILRAQGTPVRIATGENLYTRNAFNDYIRNDAIDVLQADASRAGGITEALAISASAASAHLAWNPHTFNDIITVAANLHLVAASPHPAMFEWDITHNDLMTRLASYDLKLENGLVQPPQGPGLGFEIDWDFVAAHAWKGEPAIGAGHGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative mandelate racemase
publication title Crystal structure of enolase superfamily member from Bordetella bronchiseptica complexed with Mg and m-Xylarate
rcsb
source organism Bordetella bronchiseptica
molecule tags Unknown function
total genus 134
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ozyA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ozyA01
3N4EA 3UCCA 3VDGA 3MZNA 3H7VA 3CT2A 3RITA 3QPEA 4F4RA 3IJQA 1SJCA 2QJMA 3N4FA 2GDQA 4H1ZA 1R6WA 3RO6A 2PA6A 4ZA0A 2P8CA 2OVLA 3UJRA 2PSNA 4A35A 1WUFA 2HXUA 3JZUA 2XSXA 4IHCA 4GMEA 4ENLA 3U9IA 1FHUA 2QDEA 4K2SA 4GYPC 2GGIA 3V3WA 3FVDA 3OTRA 3OZYA 2AL2B 4A3RA 3R0KA 2P3ZA 3I4KA 3Q4DA 3R11A 3DFYA 1WUEA 3UJSA 1PDYA 1YEYA 2AKMA 3DG6A 1ECQA 3QTPA 3SN4A 3HPFA 3SJNA 4FP1A 4J1OA 2RDXA 4K8GA 3B97A 3EEZA 3DDMA 4M6UA 3RR1A 3IJIA 1JPDX 4E4FA 5FJTA 2XH4A 3TW9A 3V5FA 4DHGA 3U4FA 1EC9A 3ZLFA 3BSMA 3SBFA 4HNCA 2XGZA 2PTZA 2OZ3A 2GSHA 3P0WA 4HN8A 2PCEA 2OKTA 3BJSA 1L8PA 2MNRA 3ZLHA 3ES8A 3ZVHB 3MUCA 3UCDA 3T6CA 5ENLA 2OPJA 4MGGA 5FJUA 1BQGA 1EC8A 2GGGA 3VA8A 5FJOA 3ZVIA 2DW6A 3FCPA 1F9CA 3FYYA 2CHRA 3QLDA 3T4WA 4M0XA 3I6EA 2QVHA 3P3BA 2PGEA 3ES7A 2OFJA 5FJRA 3MSYA 3I6TA 3TJ4A 3V5CA 3CXOA 3SN1A 1MDRA 4DXKA 2OX4A 3Q45A 3H70A 2PGWA 2PTWA 4E6MA 4DYEA 4GIRA 3R25A 3QN3A 1XPYA 4JHMA 1P43A 2OLAA 3UXLA 2P0IA 1R0MA 3CYJA 2PP0A 3UXKA 3N6HA 3SN0A 2XH7A 3RCYA 4DX3A 4X2PA 3OP2A 2I5QA 3OZMA 2OZTA 2ZC8A 1NELA 4JN7A 2GGJA 4GISA 5EU9A 2FYMA 2AL1A 3FJ4A 4MKSA 2O56A 2ZADA 4G8TA 1BKHA 2HNEA 3H12A 4IP4A 2NQLA 4EWJA 1PDZA 1JCTA 1TKKA 3DG7A 3SSZA 3JVAA 1KD0A 2XH0A 2QDDA 4IL0A 3D46A 3K1GA 1NU5A 3FV9A 1MUCA 3KUMA 3DGBA 2P8BA 3DG3A 3PK7A 2QJNA 3DESA 3UJEA 3UJFA 3BOXA 3IK4A 3UJ2A 3CB3A 1XS2A 2PP3A 3PWGA 3OPSA 3ZLGA 3DEQA 2OO6A 3RRAA 1MNSA 2HXTA 5FJPA 3GC2A 3FXGA 2PS2A 3D47A 6ENLA 1TE6A 3NXLA 1FHVA 5IDZA 3NO1A 2PTYA 1IYXA 3TJIA 1E9IA 2OQYA 4KWSA 4E5TA 1SJBA 2MUCA 2XH2A 3N6JA 2PU0A 4Z1YA 7ENLA 3VFCA 4IZGA 2OZ8A 1JPMA 1MDLA 3MKCA 3ENLA 1RVKA 3SQSA 4K1WA 3VC6A 1EBGA 4ROPA 4G7FA 4A6GA 4J3ZA 3THUA 1ONEA 3GO2A 3V4BA 4ZCWA 1EBHA 3TQPA 3DIPA 5BOEA 3T9PA 4HPNA 4KT2A 3STPA 4FI4A 3DERA 3CK5A 3PFRA 4GGHA 2OQHA 2DW7A 1KKOA 3TTEA 3NZGA 2ONEA 2QQ6A 3RGTA 4JN8A 2QGYA 2GGEA 3VC5A 2PPGA 4KEMA 4E8GA 3CAWA 2PMQA 1ELSA 3OW1A 4Z17A 3IJLA 3T8QA 2P88A 3JW7A 3NFUA 4H2HA 3PWIA 2PTXA 4HCDA 4IP5A 1P48A 2AL2A 3EKGA 3R10A 2AKZA 3S5SA 3TWAA 3MWCA 4DWDA 5J04A 2POZA 4H19A 3TCSA 4HYRA 2QJJA 1MRAA 2PU1A 3GD6A 3MY9A 3TWBA 3R1ZA 1JDFA 3VCCA 2OG9A 4H83A 4IT1A 3S47A 1EC7A 4KPLA 4IL2A 4YWSA 5BOFA 1DTNA 4E4UA 3VCNA 3ZVHA 3R0UA 2PODA 1SJDA 1W6TA 4MMWA 3QKEA 4HCLA 4HCHA 4GFIA 4GYPA 3MQTA 1TZZA 3P93A 1KCZA 3TOYA 2HZGA 1SJAA 3UGVA 3H8AA 3DFHA 4GGBA 3GY1A 4HNLA 2GGHA 4DN1A 2GL5A 2FKPA 2PP1A 1OEPA 1KKRA
chains in the Genus database with same CATH superfamily
3KS6A 3QPEA 1VB9A 1VP5A 3ORWA 1R6WA 2BLEA 1W2VA 1RD6A 3VM7A 3LUTA 2PSNA 3N12A 1N5WC 1T96A 1EJXC 4CNPA 2FVMA 4Q4SA 1I4NA 1PS9A 3ARRA 3V3WA 5DT7A 1XXXA 2VVNA 4O50A 2PB1A 2A8XA 3VNZA 1C90A 3S6TA 1WUEA 4IISA 1SGJA 3OBEA 4PUMA 4AY8A 4LGXA 4FK9A 1QK0A 3QC0A 1K4GA 4JIIX 3CL8A 1UD8A 4AHPA 1ITXA 3IJIA 3NPWA 4OV4A 4EF8A 1Z69A 1RJQA 4DHGA 1WZMA 2FMNA 2AQVA 3H26A 4JIPA 4MYXA 2YL5A 1E4LA 3N34A 5D9NA 1XI3A 2OWWA 1FH8A 4EP8C 4PUUA 3LM7A 3FG2P 3PPHA 4ZOHB 2J3NA 4APNA 1X8CA 2A3LA 3GBEA 1BGGA 3UCDA 3T6CA 1TX0A 3WFLA 2YBTA 4L6DA 2I7GA 3CEUA 4AD3A 4MOZA 1H51A 4XKMA 3VAVA 3EDKA 5I3JA 4C7DA 3P3BA 1R8LA 3C8FA 2VHLA 2OFJA 1EP1A 2OSWA 4AYSA 3VD7A 3GD3A 1L6SA 2Z26A 2WK2A 1EZ2A 2QDGA 3H70A 2NV9A 1XIEA 2PTWA 2G3JA 4ADUA 1JZ6A 4F0HA 3LB8A 1K7FA 1GOMA 1XR2A 3AU6A 4M82A 3WY1A 4GY7A 2OLAA 5G4HC 1QUMA 2CCRA 3GNXA 2P0IA 4D6HA 3R4IA 3AIQA 3WLIA 1YYAA 4FF5A 1TJ0A 4OVXA 3E6EA 3HPSA 1VPYA 1OC7A 2ZC8A 4O57A 1ZJBA 2D1ZA 1CXHA 1N60C 3AHXA 3W38A 1AD1A 4AXKA 1OBAA 2CHNA 5C7VA 4XAPA 3AROA 3TKFA 4UTTA 3LBMA 4G56A 3S5OA 2Z1WA 1XIHA 4J9JA 4X61A 4BQ3A 1EX1A 3KFTA 5JH1A 4EWJA 1DIDA 1KM2A 2NQJA 4EWND 3GKAA 3KLJA 4GQQA 1JFXA 4GXMA 3KXQA 2R6OA 3URNA 2WJFA 1NF0A 1MUCA 3NQBA 4QQ3A 2YJQA 1QPNA 1NVMA 2PDFA 4DJEA 4CD4A 2HEJA 3A3XA 1EJVC 2QIIA 3RRXA 3TC3A 3QGKC 2WM1A 4GO9A 2EJ1A 3NSXA 3DEQA 3GC5A 3IACA 5FF3A 2ZZ2A 3FVMA 2WB5A 3GC2A 3S42A 2H8XA 1ICSA 5KZEA 4JTIA 3V18A 3B9OA 5DXYA 4GRSA 3O3RA 5D2XA 1KCXA 4YVVA 1YQ2A 3N1AA 1GOWA 4W8AA 8RUCA 5KZMA 3FGCB 4DJEC 3UXDA 1YADA 5CPMA 3MC5A 4DYJA 3GR7A 4OUEA 4G7FA 4J40A 3THUA 3VNIA 5LSMA 1PIFA 1UP0A 3WUEA 3H4XA 1S46A 2XN2A 2NV1A 3CIWA 4LVGA 2YA2A 3MCOA 4KT2A 4C91A 4FI4A 2CLHA 4GZEA 3CK5A 4J3WA 5G1MA 4TV5A 4KRUA 4GQBA 4MWAE 1FKWA 1C7TA 1CXKA 1Q7MA 3AMDA 1GERA 1MXDA 2QQ6A 3ITTA 3ABZA 1W9UA 4FOUA 2BY1A 3CO8A 3NGFA 2J27A 3BSGA 1LP6A 4O1CA 4BF7A 5AN7A 3V0SA 2RDTA 3PC0A 4UQEA 3MMDA 2GSEA 3GW0A 1DJYA 1QATA 1IEQA 2EQ7A 3M5VA 1AQFA 1UR3M 2VELA 3SRFA 3CHCA 1ESWA 1JZ4A 4FMVA 4ZE4A 2JEPA 4RLIA 4B5XA 1JUEA 1I9CB 2OSXA 1UR9A 1FCQA 4GCAA 1LT7A 1EA0A 3L5LA 4IGMA 4MF4A 1H7RA 3KBNA 1LG2A 1HGYA 4M81A 1BKSA 1EF2A 2QPUA 4X60A 3PTDA 3DYOA 4UNKA 5TBOA 4JKKA 1RD5A 1JUBA 3SDOA 1V6UA 2V69A 2TODA 1ZP4A 3IANA 2XFWA 3KTCA 2ZVRA 3AXKA 4Z2LA 4AZ7A 1QNVA 2NXIA 4ZENA 3LMYA 1FH7A 1ZTVA 2GUYA 2QAEA 2BWGA 4XSLA 3GHRA 2BOGX 4KPLA 1WZAA 1JCXA 3GYCA 1DYSA 4XKYA 3PNUA 3O6DA 3GDBA 5F2IA 1JZ2A 2YL6A 1VBHA 2FPTA 3O2LA 4O0ZA 3RXZA 3M0ZA 2GUUA 2WHMA 2I5GA 4QTGA 3WELA 3VE7A 3WJSA 3QV6A 4EPBC 3G1YA 1GVOA 3LA4A 3NQ7A 3QV8A 3H55A 4DI8A 3H2NA 2DJLA 3AHTA 1XG4A 1BTMA 4Y7EA 2VCAA 4J27A 2JGYA 1W8SA 5T9BG 2CZEA 4DN1A 3OLDA 2Q71A 4GRTA 4Q8UA 1T41A 4GJIA 1X97A 2VOMA 1G5AA 1V08A 3CT2A 4JHZA 3SO7A 4M7TA 4JD4A 1SJCA 2WOVA 4XZWA 5JBFA 1CXFA 1ICQA 4GACA 3NCOA 4LBUA 3CUFA 4QG9A 4RE3A 2XSXA 4PA8A 3V7PA 3L12A 5I3HA 3E49A 2O7SA 3LU2A 1ITCA 1T8QA 4GR1A 1UP3A 1M5WA 2Y63A 4RNFA 4ZO7A 4TUFA 3V35A 1HJUA 3W88A 1UMLA 1E71M 4MPKA 1EZWA 1GORA 1FHLA 1KW1A 4GVIA 4OBTA 4F0MA 3UWQA 5JIWA 1PHWA 3M9YA 1NF7A 3GXFA 4KGLA 5EKYA 5JMUA 3WDJA 2VCCA 4GLEA 1HTIA 1UWQA 1P1MA 3GXTA 1REQB 1J79A 3G22A 3FJ6A 1ISXA 4MKVA 2YB4A 3HBLA 3DECA 1FQ0A 1FEAA 3EWCA 2ZZ7A 4UCFA 2HBXA 1SFLA 3SCNA 4B4FA 4CU7A 3GC4A 2CPUA 1B5TA 2X1IA 2VI0A 3MDUA 4RZ5A 3OBAA 4Y9PA 1J5SA 1EJRC 2CEQA 3O6CA 1IWAA 2TSYA 3ES8A 2E9BA 1HZYA 3VABA 4M6VA 2YL8A 3PBVA 4A21A 2ZIDA 1BQGA 3ZVIA 2PDGA 1POJA 3EA1A 4I9AA 4AQLA 1RJPA 3P81A 4YHGA 3WK2A 3T4WA 4JTKA 2X40A 4XZLX 2OMAA 2BY3A 2CXGA 1IGWA 1LQAA 4FS9A 4AZCA 3FOKA 2GJRA 1H50A 2YAUA 1VPXA 4P61A 3GVQA 1B54A 5CGTA 3FFSA 5BCAA 1XQLA 3A6OA 2EQDA 4PB4A 3W1MA 3EEGA 4Z08A 4P8WA 2JF6A 1VHCA 4HU8A 1XRVA 2D2GA 1LL6A 3UU0A 2HPIA 4XZMX 4XVEA 4JHMA 3ARUA 3UR5A 5I78A 1CGVA 3SN0A 4EMIA 2CWXA 5HA7A 1Q45A 2EPHA 5LXXA 4FLQA 3GXIA 1UOKA 4KCVA 4GISA 3M0KA 1I2OA 3QHMA 2FLIA 3MTWA 1GYMA 2F38A 1K3UA 3Q67A 5U4NA 2VFIA 1ZBWA 2C1HA 2VVSA 3G0SA 2ZADA 4GABA 4TMBA 2J77A 4Q6XA 1TPWA 4ZVJA 3H2FA 3QBUA 1GEHA 1T7LA 1Q6FA 2OWXA 4BFAA 4PTNA 1RP8A 4Q6JA 3OG2A 3RDKA 2A85A 4W93A 2ZTKA 4GO8A 1EEPA 2QCDA 1GVSA 2P8BA 2X1RA 3WO8A 1RCQA 1OFPA 1CXLA 1L8NA 3CB3A 1A4LA 3QHNA 1IQ8A 3H2EA 4LV4A 2VGBA 3L5MA 3W28A 1OCBA 3L65A 1ODUA 3LHTA 3NVWB 3PBYA 3BANA 3QMTA 3G6LA 2A7PA 4H6QA 4DO6A 1WXJA 1UUMA 1XRFA 2E8YA 3SGGA 4KESA 4RW5A 5HNUA 1M6JA 2WV8A 1GNXA 4UMAA 5G1YA 4URIA 3KEHA 1IWPA 5CPTA 1LOLA 2YCJA 3RILA 4LVAA 4QAWA 2W54A 1A5OC 1DE5A 2ACSA 3R94A 1FO4A 2VWTA 1XSJA 1ZAIA 3T09A 1W5QA 3BGJA 3BW4A 5EMLA 1QWGA 1DQWA 2DT3A 4DWSA 5BW6A 1QCWA 1QWKA 1XBXA 3S9YA 2WCAA 2QCHA 1MRQA 1AW1A 1WDRA 3T9PA 4CEUC 5G5IA 4HA4A 3STPA 1CYGA 3RX3A 4GX9A 3WK3A 3W73A 4NUWA 1QO5A 2YQUA 4R88A 4PMNA 3S2CA 3E12A 3W6LA 2RGLA 2IKJA 3WUBA 1MQQA 1M03A 4OBRA 2C71A 8XIAA 4P8VA 4F40A 1ITQA 3ERPA 3OU8A 9RUBA 4JICA 4I5UA 1ZRQA 2PDCA 5EMKA 3MMUA 3INPA 4DBUA 3GM8A 3W72A 2EPNA 2NV2A 4HCDA 1WKFA 4R9OA 4YCPA 1J11A 3TJXA 1UKSA 2QS8A 2YXGA 2VFHA 3E1F1 4EX4A 1EYWA 3K4WA 2KX9A 2NUWA 1JAEA 4EAYA 1KRMA 1P1XA 2G41A 4DELA 1XYFA 3PAJA 1JROA 2Y8UA 1VLIA 1TRDA 4AZ6A 4BK9A 4QDWA 1V93A 4IPLA 3ZQ9A 3ALGA 4JYDA 3BMVA 3QHOA 1OJXA 4PTXA 1JPIA 4K8DA 4P2VA 2RH9A 2O55A 3EMQA 3KTXA 1LLOA 2TRSA 5HPCA 1NFBA 3S1UA 4QX4A 5I09A 1NDWA 3RIKA 3TR2A 1P6CA 1M41A 2P3EA 3QVQA 4JNYA 3CZEA 4HYVA 3WLOA 4V27A 4A29A 3U7VA 3AISA 4WRHA 4OJYA 4NAFA 3VIFA 2PDIA 3PJUA 4JN6A 4LAMA 5A2CA 3G1HA 1MI3A 1XYMA 2FZDA 1R9ZA 4HJFA 1GRAA 4C90A 3E2QA 1TPC1 1V02A 2VRQA 3FIGA 5CC3A 1KCZA 3B8DA 1VZWA 4PTMA 4C5YA 2E25A 5E6YA 4CLMA 4QIUA 3IIPA 4Q4RA 1TV5A 1GKRA 3N13A 3ANYA 1FWBC 3O6YX 2XGIA 1CXIA 1JDCA 1S5MA 2D3LA 3ARXA 3LX9A 1H0GA 4F2UA 1GV4A 3ABXA 3CJPA 3THCA 4LTSA 1GVYA 3LBOA 3VZZA 4HKPA 1F8WA 3EOOA 3UCCA 3M0YA 3SRDA 4Q8VA 2YZRA 4F4RA 2BXVA 4NZ1A 4WDWA 3WH9A 3GVVA 3BPWA 1ZXIC 4H00A 2PA6A 4Q4MA 1G6CA 1LWIA 2CLOA 5LIWX 3PUEA 4H2CA 1GHSA 3W6YA 4KS0A 3BAXA 2ZC1A 5I77A 4P8XA 4CCDA 1GTEA 4ENLA 1JZ8A 4H6EA 3SGUA 2QDEA 5CSUA 1PTGA 1H7XA 4GJJA 3W27A 2OEMA 4NHVA 2Z25A 3BC9A 3A4XA 2INEA 3MP3A 1RV8A 1Q3NA 1BSIA 1NQKA 2NQ5A 1W9PA 4HHMA 2CZDA 4UTMA 4P8UA 3CUJA 3EEZA 5D2TA 1GXFA 3F5LA 4DJDA 1LOQA 4AC7C 2BGNE 3SQLA 3AHZA 2YCIX 4D1JA 1JPKA 5FSEC 3PSWA 1I1XA 4EVZA 4HN4A 3P5YA 5AHFA 1TYTA 2VX5A 3O15A 4OFCA 1EOMA 1GQJA 4XKYB 4CNUA 1O12A 1JYNA 4GD0A 1FWNA 3W76A 1PO9A 2YXOA 5H8UA 1CWYA 3WQ8A 4C7FA 3GXMA 1F9CA 1U1HA 1I45A 3LN3A 3SEPA 3SR6B 3S2JA 3VM5A 2PBOA 2YDRA 1O60A 1GG1A 3HOJA 2Z2AA 2F2KA 2VFDA 3SCSA 1ONRA 2D2JA 4HZ6A 1Q6QA 4PL1A 4GI9A 1IE7C 5CGQA 3ME3A 4MUPA 3A5FA 1EO5A 1BXBA 2C19A 4JHOA 4WJXA 1ZFJA 2G0WA 3IAQA 1RY8A 1AH4A 1A3WA 2HCVA 1JI2A 2W55A 3O16A 3EWYA 2E6YA 1WDDA 1S5WA 5FS9A 4OQVA 3UXKA 3W75A 1HO1A 1MFVA 4GVGA 1G4SA 4JTFA 5LNVA 4O8AA 2X7WA 5E70A 2F6UA 4DXXA 4YNGA 1HW6A 1BVNP 2W0UA 3DK9A 4P5UA 4HSNA 5D33A 3TFCA 1YQZA 4E2DA 5I02A 2B7NA 1W0MA 3FJ4A 4MKSA 2BTMA 3CV7A 1VCFA 1E0XA 4X2RA 1FUYA 1X6LA 3QZ6A 3ZZ1A 1UBPC 2DORA 1JZ7A 1UWAA 3MWAA 1EQPA 3L9CA 5AECA 3GDTA 1CDGA 3UXAA 3M0XA 3NO5A 2PUZA 4HA1A 1VBRA 4ES4A 2Y4SA 3WD2A 4M24A 2ZRWA 4FIRA 1NU5A 3W07A 5IRPA 4FA3A 2XSAA 3W7LA 1DJZA 1F5ZA 4BJHA 1E6SM 3GHSA 4XAGA 5C2GA 1PZ1A 4JTGA 3H2MA 1TFVA 1MEWA 1XW8A 2W91A 1UD5A 5I23A 3BZGA 2PP3A 3W7OA 2HJPA 2R1MA 4UTFA 1N62C 4L4LA 2X50A 5CZJA 5FJPA 4BR1A 3W2UA 4ERAA 5H2ZA 3N04A 1S5VA 3H4GA 1XIFA 2P10A 3VVGA 4UOZA 1F73A 4AZCB 2C1IA 3EDFA 5IDZA 2GJNA 5E1QA 4PMRA 5BWFA 3V75A 4OOZA 1G94A 1N2VA 2ZTJA 1JNEA 2KAUC 2A7RA 4ML4A 3SAZA 1ZSXA 1UIOA 2Z27A 4IZGA 2NLYA 1MDLA 4PE8A 4HU4A 4RK8A 3PUOA 1TZ9A 4M80A 5LYRA 3TX9A 4W86A 4LCSA 4C6CA 1EJ7L 4O11A 5I5RA 3K4AA 1K1DA 4V33A 1ISZA 1A47A 3UZYA 3MUXA 4PZVA 4LALA 2OQHA 1DL3A 1BEUA 2VR2A 4QRNA 5CPNA 5CPLA 4C6PA 2Y1HA 1LL4A 4PC8A 5HMFA 1MEHA 3L66A 5F2MA 1D9EA 4OUIA 3KW3A 3KL3A 1OCJA 4JFWA 4HSHA 2E5AA 2FB3A 4L7ZA 3DKLA 3KOYA 3MSGA 4UTLA 4N6FA 3WZ0E 3IJLA 3NZPA 2QUTA 1O5XA 2DZWA 3HFTA 2NX9A 1DXIA 5A8NA 3JW7A 4U10A 4FZIA 4O4WA 3K1DA 4S2BA 3G0XA 1R3VA 6TAAA 1GVRA 3VUSA 1PPIA 2B31A 1FA2A 2QCDB 3AO0A 2QAFA 3DJGX 1TO3A 2CBUA 4V15A 4L64A 2G3FA 4J3TA 2CLKA 4WXYA 3UPMA 5H6HA 4BS0A 1WA3A 1EF3A 4BWLA 5ABHA 2CLPA 4F0LA 5GNZA 1WOAA 4RNJA 1PXGA 3LDVA 5HQLA 2IKHA 1JCYA 2WJEA 3R1ZA 3UP8A 4B15A 3L2MA 1JDFA 3V1PA 1E70M 4ASTA 2XJ7A 4JCMA 4S3AA 3HZ3A 1AQMA 4KKXA 3VDBA 3WQDA 2JKEA 2DP3A 1DJHA 3LXDA 4DAIA 1QI0A 2ATSA 4WD0A 3MVTA 1DTNA 4MDPA 1NWSA 3AXMA 1NJJA 3S5ZA 2WXDM 3IK2A 1ZJIA 4RDZA 3BZJA 1Q1WA 1EP2A 2KZHA 3GVRA 5I03A 2XFYA 1OABA 2V5JA 4AEFA 1THFD 4H4PA 4DWSB 5FCZA 2PFHA 3WNOA 2NX1A 3NEVA 2E5CA 3VKCA 2OB3A 4HTBA 5LXEA 4KGJA 3LNMA 1RLCL 2ACQA 4JXCA 3O8AA 1C9DA 4H9VA 2J9ZA 3IUIA 2GJPA 3AICA 3K5XA 2JBMA 3QJAA 4FNUA 3PAOA 3B4UA 2OVLA 4D71A 1G4PA 2WVUA 3CIVA 3QYQA 4JX5A 3B4YA 4GBDA 1DEDA 4JTUA 2V9DA 1JYWA 1ZQ5A 3WG6A 2VX7A 1K9EA 2X42A 5GQBA 5HQEA 3MV11 1M7PA 4XAFA 1R38A 3F5KA 4LF1A 4JEJA 1IXQA 1YHTA 1IT7A 4GZ7A 1WAUA 2I14A 2VC6A 4HU3A 4EKJA 4LVFA 3KS5A 3E38A 4C6JA 3TYEA 2FPVA 1D7YA 4PCFA 2B4GA 3JRKA 2CWNA 3SJNA 2INFA 1KCKA 3AUOA 3NL6A 3B97A 1J96A 2J8TA 2TPRA 1ME9A 4M8UA 3N9SA 5AC6A 3LXBA 3BAJA 1DWJM 4EPEC 4F8XA 1R3WA 3BSMA 3W4RA 2AGTA 4G7EA 1B3WA 2D24A 3LZ5A 5EMYA 3J7HA 2QJGA 2Z24A 1M68A 1XBYA 4NAFB 2E8ZA 2GVEA 2Y6ZA 2E7FA 4L61A 4WKHA 1SPQA 1Z6KA 4PUDA 4W87A 2DW6A 3FYYA 3I68A 4BI5A 4DM2A 3ATYA 1PX8A 1HJSA 4QCFA 2CDUA 5D9PA 3ES7A 4MAZA 2Z1SA 3CMGA 5EPDA 3II1A 4NZ4A 5AB3A 5DXXA 4TV6A 3G1XA 4XISA 1O4UA 1QASA 4PCSA 3F5JA 2QPXA 4ACZA 4H7VA 4DO4A 4EACA 4RDVA 4H4ZA 4U3AA 3ONCA 3BOLA 3R12A 4CUCA 2FTPA 2H9AA 2VKZG 3VX0A 1JYXA 3WJYA 3GIYA 3S2MA 1GVQA 4ATDA 3R25A 2BVYA 4O28A 3CL7A 1I1WA 1W1ZA 3M5XA 3KBWA 3R13A 2OOFA 1OY0A 2F9RA 4KH2A 2G8ZA 3RU6A 4ZB5A 1UPMB 2NZLA 3BO9A 3O07A 4ZB0A 5HR7A 2J47A 2I5QA 4XTDA 1KLZA 1PCKA 4W5ZA 2WMHA 2B7QA 4GQGA 3TYDA 3MSDA 5EU9A 4PR4A 2Y8KA 1ONXA 2HTMA 4JOMA 3SUSA 4UFMA 1B2YA 1BG9A 3G3MA 1A5CA 5BRPA 2W62A 4I5XA 1O5QA 4KW2A 2W63A 1F07A 3RU8X 3H12A 3HMCA 4UMBA 5HINA 3SSZA 2AGKA 1W54A 3WLQA 4PSRA 5HUOA 3QSTA 1FDZA 1Q8JA 4XZNX 2R1PA 2DUXA 2WHJA 5T9CE 4I9MA 1W5MA 4V2XA 2WBGA 2IKGA 2WZMA 1XD0A 3TZFA 1XM3A 1PJ9A 3HGRA 3IK4A 4QJ5B 3DBNA 2BS9A 5B80A 3K46A 1XLJA 4D1IA 5CAKA 1SW0A 2QUNA 2OJPA 1NWTA 1N82A 3I65A 4NSBA 5I3GA 3SR7A 1ZB5A 1FY6A 3BCJA 2FTYA 5AY7A 3GVWA 2J7BA 5CGMA 3ARTA 1GRHA 2GWNA 4U31A 5CSSA 3IIZA 3MS8A 2CKSA 2OTDA 3GAYA 5CAHA 4QSHA 1TRIA 3GFXA 5HOSA 2VRJA 4U3CA 2MUCA 4TVCA 4ZOAA 1N8FA 1RPXA 3CC1A 3W3OA 4XD4A 3M4HA 1GEUA 3WLMA 4LW7A 1KQYA 2OLSA 2G95A 1NHQA 3C56A 3HPXA 2PDBA 2X1SA 1GRFA 1V6TA 2D2HA 2JIEA 2OYLA 2ZZ6A 1UB3A 5A6BA 3CGBA 4J35A 2ZCGA 1FWHC 4ZQCA 5D9MA 3G5EA 1W3LA 2XPKA 1W17A 1Q85A 2AQWA 1MFUA 3W22A 4PCTA 1N8WA 2XVLA 2JALA 3F4WA 4BI7A 2ONEA 3LG3A 2BDQA 1E15A 4IPNB 1R3TA 3KOXA 2QGYA 4QG8A 3K13A 4JIQA 4NT0A 4U2YA 1YBQA 3VKKA 1XLCA 4GA8A 3OGVA 4LH8A 5HANA 4GVHA 2OX1A 4DAFA 1GQLA 1CLVA 3LGGA 4UMCA 4B9ZA 3NDYA 5KVIA 3ABQA 3GNDA 3ZSSA 4BF9A 1VFLA 1DXFA 4LS0A 4W85A 1Y7VA 4QJ1A 4Y9OA 5I3DA 4KRTA 4Y96A 2GUBA 1E55A 1I0BA 4A2RA 3QGVA 2EQ8A 3VMOA 3MW7A 1Q6EA 1TG7A 1LT8A 4PFHA 3UT0A 1VFSA 3SY1A 2ISFA 4D6CA 1XINA 2YVJA 4HHHA 3TYBA 3LK6A 3WLSA 3WH8A 1KGWA 1V6VA 1DWGM 2J66A 4IIBA 2RDWA 4AXNA 4F79A 1X96A 4IWWA 3S47A 1W3TA 4HBKA 1ZU8A 3PZNA 4W8LA 1Q4NX 4LY4A 4EPKA 3P7YA 1OHLA 3MYPA 3WUGA 4V1XA 3LRMA 4AUBA 3LPPA 2PC8A 4WKAA 1U1UA 2XUCA 4NNBA 3UQNA 1ADSA 2C3ZA 3GBDA 3TYCA 3HO8A 2IXUA 2YYUA 3MQTA 3M0JA 5J5RA 3NQ2A 1QO2A 4WOZA 5LIUX 2DY3A 2W9MA 1HKWA 2G96A 1FECA 1OGGA 2HZGA 2D73A 4MJMA 2AQOA 2VDIA 3T55A 1UG6A 4FNRA 3WX7A 4LAZA 5CC7A 4DNAA 3RLGA 1LUCA 3LY0A 2J4GA 3POCA 3DYMA 2DZPA 4S39A 2FVKA 1GT8A 3FYPA 2GDQA 1L0PA 1LORA 4IIEA 3OVRA 3NO3A 1WP6A 1DQXA 4NJJA 3LHUA 1Q8AA 2I57A 3JZUA 3R79A 1YMYA 1VLWA 2YFOA 4M51A 2DZSA 2WO5A 3U9IA 1FHUA 3FJNA 5A1AA 4Q8TA 4ML9A 1XF0A 3W71A 2Z29A 2OXNA 4YWIA 5HQMA 3SCWA 1MQPA 2DZAA 4ZTYA 1W31A 1KTCA 1OGBA 2E28A 2FDSA 4JKMA 3T0CA 3A4AA 5CJMA 3W7MA 4ADWA 4PUWA 4LBSA 5C5YA 4CQDA 1YEYA 4UTWC 1D3GA 4WDXA 4H4RA 1G69A 2J7DA 1UQYA 4K8GA 3UNDA 4DWSD 3CH0A 4MY8A 2Q3RA 2YXXA 2X16A 1TA3B 2F6XA 3F1QA 4MJZA 1XH0A 3ZLFA 1TSIA 3UPBA 3SBFA 2X8HA 3PFMA 2XGZA 3MJYA 1O94A 1E1CA 5F4XA 3BMXA 4OZOA 3IGXA 3UWEA 5HMEA 1JEZA 1H3GA 1J9YA 1FWIC 1E6QM 3SFWA 5LZLA 3W53A 3MUCA 3DN5A 3FYOA 5ENLA 1IWBA 2I5IA 3VA8A 1VC4A 3CYVA 2VC9A 4Z1AA 4MWAC 3HA1A 1TTPA 1RSCA 1X6NA 1C91A 2YIHA 2ISVA 4LEFA 4JY8A 5KZDA 3MSYA 3I6TA 3B0XA 3R58A 1UC5A 4PTDA 3VU2A 3QTGA 1XH2A 1HF6A 3DHDA 2H3BA 2NVKX 4HQVA 3TAOA 4AWTA 1N61C 3R43A 4P7LA 3W1PA 2H90A 1TV3A 2Z0IA 1P43A 1V0LA 3CTTA 3EWUA 2W79A 3LQGA 1BRLA 4HMDA 4H7ZA 3PB0A 3GNRA 2CBIA 4KCWA 3W7GA 3L68A 2YW3A 1P6WA 2R9ZA 3KLLA 3C86A 3VMPA 1XLMA 3VGEA 3CQHA 1A3XA 5K7JA 4A3UA 5DCDA 5GJNA 3O0HA 1F74A 3MANA 3I3EA 2XYLA 2PDNA 5GPRA 1J10A 3LHZA 1QI3A 4PBFA 4QSFA 3AC0A 3DBPA 3ITCA 2VZOA 4C5ZA 1CNVA 2CBVA 3KOZA 2OODA 3W29A 2CESA 4HGXA 2VFFA 1AOGA 4G7EB 2R1KA 4M1RA 4EQXA 3GU1A 1JAKA 3DESA 3GVGA 4F2BA 3HG4A 4EXQA 1OC6A 3THDA 2DJXA 1MOKA 1VHNA 3B0PA 3KCLA 1RVGA 4O1FA 4Y2WA 2XZ9A 4ZMGA 3EF6A 5HMDA 2VJXA 3IGSA 1V7YA 1SZGA 4O8RA 1TCDA 3M0VA 2XGBA 4DUOA 2ZRUA 4RDWA 2D0HA 1H62A 1OFDA 2PS2A 1EJSC 4DUXA 1PE1A 3QEZA 5IFPA 2V68A 4AY1A 4AMCA 3H2AA 4ACZB 2VC7A 3MPGA 2ABBA 4LUIA 2WM0A 2OQYA 1XSKA 3BGAA 3LSCA 2C91A 3BLLA 3ZT5A 2H9AB 3HF3A 4B5SA 3AYSA 1S2AA 3CHFA 1J93A 2VO5A 2Y61A 3MKCA 3CZGA 3VOHA 4MM1A 1IXOA 4O1DA 3STEA 3V36A 4DJDD 4ROPA 3RM8A 4Z2IA 2EHHA 3CQIA 1K9TA 1VIZA 3QPYA 1EGVA 3BLPX 5BOEA 2ZZ1A 1I2RA 3TEVA 3S8HA 4JNZA 4GBUA 4JNMA 3QR0A 1XYCA 3CB8A 1RBLA 4J7RA 1KKOA 1YNQA 3H4WA 2A3BA 3CPUA 2YCKX 2E9LA 5HULA 2Y7DA 1NOUA 4Z2KA 4HOXA 5RUBA 4FPSA 1A5UA 3QFAA 2HK0A 4UB9A 3CAWA 1YTEA 1C8YA 1U1JA 1XGEA 3IVTA 4I9JA 1FRBA 2Z1VA 4RR4A 3LENA 2A79A 2UV8G 1M01A 3L4VA 5DELA 4CD5A 3NFUA 3S6DA 3T07A 3L4UA 1L6YA 1EA9C 4YVPA 3H2OA 4NZJA 4LFYA 1SO4A 1E1FA 3EPMA 2WQDA 3N2OA 3N11A 1KRCC 4DWDA 3BAIA 2O9OA 4IFRA 3JZEA 4KETA 3M64A 9XIMA 5AYIA 1OM0A 4HOWA 2ZVIA 4H7CA 2IPJA 1D3HA 3TSBA 4ICCX 2BOEX 4DJFA 4L4MA 4JYEA 4FLSA 1ZNNA 3UWYA 1V0MA 4X0NA 2GVJA 3F4DA 3KP0A 1KB3A 4Z42C 1NDVA 1LL7A 1NP0A 1F8MA 2QMJA 1EC7A 4IL2A 1TMLA 4S3EA 1PIIA 1R2SA 1XHGA 2F7FA 5JBEA 1VRXA 3PPFA 1KBIA 3KHDA 4M1BA 4NRSA 3R0UA 3TMLA 3QFWA 2IW0A 2OGYA 5HBFA 3C0JA 1Q6CA 4HCLA 2I17A 6CGTA 4D6EA 4GYPA 3KRUA 4WSJA 2VR4A 4R3UA 2PWGA 2PURA 1OJTA 4IJRA 4X9SA 1K02A 2UY3A 1WNOA 2OO0A 4TO8A 4TVUA 1S2UA 2FGBA 5I07A 2QUMA 3ZR6A 2GGHA 4DJFC 1P6BA 4OKDA 1SW3A 3PM6A 1VYRA 4CQBA 6TIMA 3M41A 3APYA 1Q65A 4G6CA 5AYYA 3PN8A 3UZWA 4GNVA 3B8UA 3UETA 4OBSA 3MMWA 1H0IA 3G1FA 4I7WA 1YBQB 1TVNA 2V3EA 2PDQA 1DE6A 1F05A 1MW2A 3B8VA 1UIPA 4JIHA 4GYPC 2UY2A 4DB7A 2QGHA 4MVAA 5DRIA 4QISA 2QCCA 3IVSA 3R0KA 3QF0A 4HK6A 1A5LC 3EDDA 4FEZA 3MSRA 4WY0F 2ZX5A 2PWHA 1PKNA 1E73M 4FLOA 2UBPC 5B7YA 5DO8A 1VEPA 4IMGA 4F0SA 3VI2A 3FA4A 3GKFA 3GTFA 7CGTA 3QQWA 2G97A 4TVYA 2V38A 5H8MA 1OFOA 1MQRA 1CGUA 5D32A 2XH4A 2Y5EA 1FWGC 3G24A 2Q6ZA 1WZKA 2VGGA 5E0KA 1G1YA 2GSHA 4K8EA 4M6QA 2ZYFA 3UG8A 4J2MA 3THQA 2H3DA 3ZJKA 4JTLA 4W84A 3ZMRA 5D2YA 1TJRA 2ZQ0A 4JTAA 1DKWA 4F3HA 1YE4A 3UWUA 1X2GA 1SO3A 1VFFA 4H4SA 1GONA 3OZPA 3BW3A 4TTUA 1CX9A 3IJ7A 4M0XA 3I6EA 5G5GB 3LXAA 2W3ZA 3VO0A 5CBIA 5C2XA 1OCQA 4MIMA 2DUZA 3DYPA 3W02A 3E2VA 4REQA 3ARPA 3BMWA 4FF7A 3SJ3A 4QBXA 3G77A 3AIVA 3NZ1A 3SFKA 3TJLA 5C9RA 1V3LA 2WMFA 3Q65A 4HZ8A 1M7OA 1GZ1A 1K8ZA 3SCTA 3EX2A 1AW2A 1DORA 2OEKA 1IEWA 1J0HA 2PD9A 2GR0A 3S3GA 1WDWA 3ECQA 3WL1A 2DGAA 3PBUA 1HX0A 4R9XA 3JS3A 2ZX9A 3C0QA 3WMCA 2GQ8A 2QYGA 1CBGA 3B9AA 3OOQA 1R7OA 5AYZA 1X38A 4C6IA 3UPWA 3NVZB 3GRIA 1ML1A 1UPPA 2PGRA 7A3HA 4B3ZA 5CBBA 1BF2A 4G8TA 3NA8A 3KOFA 3GK0A 1KQZA 2WMJA 3EDEA 4DYKA 1TIWA 3CT7A 1OVDA 2UY5A 4KWWA 2XH0A 3KOWA 1V8EA 2ZXBA 3TXVA 2CW6A 2G3MA 3CIXA 3GWQA 1E1CB 3TZNA 4JTDA 2ODOA 2DZXA 4JYFA 3EAUA 3U57A 1YDYA 1UWIA 4UQBA 1Z48A 2FHBA 2GQAA 3E0WA 2O4QA 2X0SA 4ERIA 1PZ3A 4JQ4A 1UD2A 1WKEA 5I06A 2X8CA 3BGGA 3RRAA 3ZLGA 4DNHA 3GXPA 2V5DA 4EOUA 1WOBA 4UC5A 3OVPA 2C79A 2W92A 2VEPA 4KFOA 1Y65A 4GQRA 2I1OA 1J2WA 4XIMA 1PCWA 1EJUC 3C0LA 5FACA 5A95A 2V3GA 5FS7A 4U5KA 1FX6A 3KM8A 1ISVA 4Z0JA 1V79A 4Z1YA 1KGUA 2D3NA 3S6OA 3VFCA 3CWNA 3CTLA 3RO8A 2GVYA 1Q2SA 5E5CA 4GCXA 2PWFA 1GYLA 3OYZA 4YYCA 1N63C 1JOAA 1BRLB 4BHYA 1ONEA 4IFKA 3EXSA 4JGDA 4ADSA 3NYDA 1ITUA 1JYVA 2FJKA 4JY9A 4HNUA 1J4EA 4HPNA 2Y8VA 3KRSA 4IM4A 3QFBA 1E5JA 1FWTA 1H11A 2DIKA 4F48A 1PBGA 1WKDA 2WMKA 3MI6A 7XIMA 4AWEA 1EUNA 1YDOA 4NG3A 5IFTA 4GUIA 2BXZA 2HDJA 1KV8A 3I3BA 2VGFA 4IJBA 4ZQPA 3GUWA 3A47A 5G4EA 4TVWA 3TTSA 3DFNA 4QE5A 3PWIA 3QSRA 2XWEA 1TV7A 1M7JA 1Q6OA 4LJ3A 4LRSA 3S5SA 3LLXA 3APGA 2G3NA 4MLJA 1RXOB 4MPQA 4HZ7A 5KITA 2D0FA 3DCPA 4QS5A 3TROA 2ZA3A 2V6AA 5K9DA 4A05A 3CGEA 1N5XA 1E0WA 2CLMA 3M0IA 1K8YA 3WF1A 1P7TA 2YZ5A 4WQ6A 4D6GA 2E3TA 4IG2A 2D2OA 3UR8A 4JFVA 4NU7A 1W1B1 4DI9A 2XIJA 5DY2A 4YWSA 3WJXA 1OZMA 2GJXA 3SQMA 5FKYA 4BEUA 1JI1A 4CCZA 4X0VA 4TU1A 1CXEA 2BHUA 1HT6A 3WH5A 1Q2RA 3IRSA 1S39A 4RZ6A 3IS4A 1Z42A 3AMGA 3POHA 4J4KA 4NI8A 2Q8LA 1TR1A 3AFBA 3HQ1A 3OLGA 1O1HA 1OF8A 4B5VA 1DP0A 3UVAA 1WDSA 4BI6A 3UGVA 4C6NA 3LLDA 1QW9A 2OOGA 1YPIA 1ZCOA 3DFHA 1GZJA 3S9ZA 4ZXLA 1YTDA 2IQ0A 4UQDA 3GY1A 5XINA 1E9YB 4HNLA 3IEBA 3N2XA 3WSUA 4DQWA 4DVOA 4MYAA 1BYAA 4JTQA 2ZRZA 4PB3A 1TYPA 4YHEA 5JBDA 1M6IA 1UMYA 3TNOA 3ZFHA 1DJNA 1C8XA 1SZFA 2QCGA 1WUFA 1LBLA 3H7UA 3WJZA 2PDLA 3RNDA 2Z6IA 3LM3A 3VKJA 4LOCA 1H7NA 4S3KA 1LG1A 4R85A 4NYYA 1HKJA 1NSJA 1XV8A 3A64A 3FSUA 3MUAA 2J13A 1LPFA 1RK6A 2VEFA 1WQ5A 2E0PA 3PANA 5HMSA 5EFFA 1TX2A 3M44A 4ZL1A 1XC6A 3GDRA 4PB5A 1LQ0A 3DFPA 5CG0A 4NVTA 3DAQA 2RDXA 4B16A 3DDMA 5T26A 2IQTA 2R8WA 4AAJA 3BUVA 5A6BD 2W66A 4EXBA 1NHPA 2PLCA 4A2SA 3DU0A 3BV4A 3W37A 3GYEA 3HQPA 1J6PA 2HBVA 1ZY9A 2PF8A 1PKLA 2HMCA 5K9XA 1MMFA 1F3XA 2XVNA 5FJIA 3RG6A 4FX6M 5LA0A 2X99A 1J01A 1H7PA 2VP8A 3WQEA 2R1NA 4NKCA 4DXVA 2GGGA 3W7IA 4DZIA 3AIBA 3N29A 4XK2A 3UR7A 2HQMA 3MZ2A 1VH7A 2OELA 4DBEA 3KTSA 5CZTA 1E1EA 2OCZA 2Y5SA 3ICJA 3MU7A 4HNNA 1G9HA 3NSNA 2FIQA 4GUGA 4HIBA 2YA0A 2F2HA 3KVLA 1UWSA 2PGEA 4FXFA 1SZRA 1W3NA 3FW6A 4J5NA 1XYAA 3AXXA 3V5CA 3LQLA 4GINA 1B9BA 2WSPA 1XDLA 4DNMA 1QI4A 2RUSA 5DEZA 4DZAA 1I60A 1JDEA 1KBLA 3ABSA 3CU2A 4KEVA 4MNLA 1ZBVA 1CZ1A 1JPHA 1NDZA 1AG1O 1MWOA 1X39A 5G4WA 3O6AA 4S38A 3UXLA 3UWVA 4O15A 1A49A 3TUUA 2CLIA 1DQUA 3UZXA 1KR1A 4IIDA 1N55A 4EMJA 3ARWA 3OZMA 1K6WA 2BX7A 2NPXA 4HOZA 1K7XA 1BAGA 1ECEA 2YDSA 4TR9A 3KBVA 3SQPA 5EB8A 4HNOA 2WANA 2GR1A 1R3SA 5AZ1A 3F7JA 3G6MA 4X63A 3UG4A 2GVLA 1OYBA 2V3BA 5JQ9A 2E5BA 1XFBA 2R24A 1YXCA 1TR9A 2HE8A 1OD8A 3TA9A 1HL8A 3DXIA 3B8TA 5DMNA 3AQUA 3T2QA 4A8RA 1S1RA 1NH6A 3O63A 3TVAA 2ZRXA 3W2KA 2DSVA 3MI3A 5A8GA 3VNDA 3GIQA 4MB3A 2UWFA 5EMJA 3P80A 3I7QA 1A5NC 2XN0A 3E96A 3FAWA 3UJEA 4NNAA 5HUPA 2O0TA 1XGZA 3AXIA 4B4HA 3IVUA 3BAYA 2ZWYA 3RF9A 1YDVA 5H91A 1TUXA 1FCVA 3T2OA 1EDTA 1W56A 3USBA 1CTNA 2JKPA 2W4XA 1SR9A 5DLCA 4TVDA 2FH8A 2FZ9A 3L4TA 4XD3A 3W1TA 3FDKA 1XANA 1H6VA 1XYZA 6ENLA 3FHAA 4REQB 2PDJA 1PAMA 4Q4KA 3KBJA 1EUAA 1E4IA 1IYXA 3LBCA 3MO4A 1PKMA 4MB4A 1E9IA 1TVPA 4IMAA 2A7NA 4HD5A 2PU0A 1YX1A 3CUZA 4NJKA 3RMJA 4D9PA 4CQCA 3NAVA 1YDNA 4NX5A 1VGAA 3WBXA 3OB8A 3EZ4A 3SQSA 4LCQA 2BXYA 1X2HA 4RE0A 2ALRA 3LHYA 1R9XA 5D38A 1V7AA 4A8LA 3LTYA 1EPXA 2FZMA 5LA1A 1PZ0A 4J28A 1NY1A 3E3HA 2HSAA 1KV5A 2QT3A 3BK0A 4PMUA 3SIMA 3NL5A 3DERA 3U48A 1P0EA 2Y88A 3XIMA 2V6OA 4AYGA 2CERA 5EMMA 3IGUA 3VZYA 4B3LA 1U5HA 2WVVA 2NLIA 2DSZA 3GDKA 4NY2A 3GDLA 4JN8A 3WQOA 3R07C 1GKQA 4MJ4A 1D8WA 4K8HA 3EAOA 3A7AA 2P88A 4H4XA 1R47A 2PTXA 1TPUA 2VMFA 2AL2A 1F3TA 3R10A 1XIIA 3GU2A 2VWSA 3GQYA 3UEQA 4LAUA 3SY8A 5GNXA 1H2JA 1OD0A 3T1GA 1BXCA 4MNMA 1T6MA 3W1RA 2JF7A 1EFZA 3PG8A 3BWWA 1PYMA 4Q22A 3N2MA 3SCRA 1UUQA 3V0TA 1MYRA 1MRAA 3LPGA 4AVNA 1ZL1A 1M65A 4D6IA 3QMRA 1FFQA 3AS3A 2PZ0A 5EMUA 2D23A 1GESA 1W5OA 2ZZ5A 1KLYA 4N6EA 4XD5A 3A13A 4EIVA 2FGZA 1UP2A 3HMJG 1HXJA 1Y5XA 5BRQA 4XTIA 4WGXA 1WXYA 3P60A 4DPQA 1GPWA 3N18A 3TN3A 4FX7A 1M53A 1OSEA 7TIMA 4Q32A 3WMBA 3G1DA 2J9YA 3BG5A 1IIHA 3A5VA 1OGSA 4Q4PA 4QEEA 3W23A 1PTAA 3N2TA 3L2LA 5MHBA 1UR1A 2VT0A 3EMZA 4LC6A 1OIMA 1E9ZB 3ONBA 3E5PA 5C7HA 3TOYA 2VR5A 3VIOA 5BNKA 4JTJA 2WPGA 4IFKB 1DJGA 3OYXA 2OKOA 1XBZA 1NWRA 3P2VA 5TNVA 1I6NA 1NTHA 3NM3A 4XSMA 1LYXA 4GE8A 3TP4A 3MZNA 1IEIA 3H7VA 4GHRA 4IIFA 1Q1RA 2QJMA 2EBNA 3F4CA 4AEOA 3PWAA 1Q7QA 1UBSA 2E6FA 3HN3A 4DBSA 4EMWA 2GDVA 4Y8FA 5D05A 1S5TA 3AJ7A 3WK1A 1KBKA 3CUIA 3VDAA 1VYSX 3OZYA 2NSXA 3VGDA 1VKFA 3H22A 1FFUC 1MEIA 2PDWA 3CZ8A 3M0HA 3A4JA 4R53A 1WO2A 2Z1BA 1TPFA 1CGXA 4ZO6A 3SM0A 1KFLA 3BQ5A 4CCEA 4ZZ9A 4L9XA 1VF8A 3QTPA 3IV3A 1LRQA 4HK7A 4OGZA 2EKCA 3H23A 3DGHA 3EX4A 1P7TB 4Y90A 4C6BA 4IG2B 1Q7ZA 3EX6A 2ICSA 1Q5MA 3FXYA 3UXIA 4ICNA 3ZOAA 3PZ9A 2WOQA 3C8NA 4HB7A 4YL2A 4IGHA 3H7RA 2GJXB 1OIFA 3FX4A 1GHRA 3ZLHA 1SQ7A 3TOPA 2OWCA 1CGWA 6PTDA 4R34A 3UZJA 2L5HA 4UQCA 1FWSA 4L4PA 3WQPA 3EOSA 1J6OA 4EF9A 4MZ8A 3BAWA 3G0UA 2XVPA 2ZZCA 4ZQRA 1O95A 3WNKA 4H50A 1PX4A 1K77A 1MZRA 4LU0A 4AZHA 4PEKA 3SB0A 3R8GA 5G1TA 2VGIA 4HHLA 1S7MA 4IQLA 1EWDA 2OX4A 3AXHA 2ISDA 4O53A 1IF2A 3N9RA 1EIXA 1KRAC 3VOJA 3VNYA 2E1WA 3DFOA 1DXEA 3OA3A 1SO5A 3U2CA 4DJFD 4H6KA 4O17A 1RALA 3SECA 3NR0A 3LCLA 1R2TA 3E2SA 4YTUA 4DX3A 4D6JA 3PTMA 1IEVA 3UWWA 2EKGA 1VAHA 4H8NA 3T7VA 1B3OA 2OZTA 3AWNA 4C1LA 2A3AA 3RCMA 1Q6RA 5LIXX 3AIWA 3LSBA 1BSLA 2CFFA 3OQEA 4AIEA 1IT8A 3GTNA 1H4PA 4INFA 3T4CA 1RY0A 3EX3A 1E6PA 4I6KA 1AK5A 2GH5A 2DSWA 2X2GA 4KWUA 4KWVA 3W01A 2DZUA 1OX6A 3PBWA 3P0XA 2EPOA 1ZLPA 1KN0A 3OIHA 3B06A 5EBUA 3USZA 4XV0A 1VBUA 1PB0A 4I8DA 3D46A 1C93A 2HE5A 3EXRA 4IP7A 3QZAA 5EBKA 5J5DA 1E72M 3HG2A 1AL7A 3MCNA 2J7HA 1YTKA 1A5KC 3UJFA 3LHWA 4IMCA 4DEFA 3UJ2A 4P7OA 1Q6GA 4IFOA 4LUJA 4JAWA 4QAIA 1XS2A 2ZXAA 4OU1A 3WLJA 2VD8A 2PTDA 1PYFA 1RJRA 3CLMA 3CO4A 2ZUTA 3AZSA 1X1OA 2IPWA 1MW3A 3WQGA 3NQ8A 4BURA 1AVAA 3TQVA 4WCJA 2YYTA 2WJZA 8A3HA 4UBPC 1S2CA 3NPVA 2RHGA 4AD0A 1Z41A 2WNZA 4UUIA 4GH3A 4PL2A 3N15A 1FOBA 3F2BA 1X1NA 1QRQA 1KXTA 4WHBA 4N9EA 2ZZ3A 2QKFA 4MSSA 3COTA 3N2BA 5I00A 3WD3A 2Y7FA 1Z89A 1JD9A 1V6WA 3ABRA 4M3PA 1GG0A 4O19A 4GC4A 2WYSA 1IXPA 3TH6A 1W1PA 2TPSA 1US2A 1XIDA 2J7GA 3QZEA 2AAAA 4GOAA 3QXBA 2WNNA 4HYWA 2W0HA 3HB9A 5CJ5A 2ZA1A 1E6ZA 1UJQA 3CXBA 4B5UA 3QH2A 3L0GA 3OW1A 3MO7A 4QLJA 2LLEA 4M52A 3WN6A 4WVXA 2PDYA 3NVVB 4JIEA 1XDMA 1EHNA 2A5HA 4PRTA 1MUWA 3BLDA 1E0UA 3CZLA 1VBJA 5AYBA 4LWWA 2VQTA 3O9NA 1S1PA 2GVGA 3MWCA 4LUYA 1VCVA 3UY8A 3NM1A 2POZA 2W5FA 3BARA 1L6WA 1OINA 4LT9A 4N4PA 3VGHA 4K68A 3EPNA 1ZALA 3TCEA 4P7QA 3MI2A 4F0RA 3WEMA 2CITA 3P62A 1KR0A 4PULA 1FBAA 3P61A 3R6IA 3N17A 3C52A 4PODA 1HKMA 5DT5A 3L23A 1V02E 1V3MA 2HWGA 2O9PA 4MFDA 4QQUA 1TVLA 4H83A 4OWGA 2V5BA 3RLUA 3HG5A 3T08A 1XLLA 1ZJHA 4AB4A 4PEEA 1CPUA 1ONFA 2VDGA 3CPGA 1B4KA 5LKYA 1G7VA 2EPLX 3NQVA 2C7FA 3TDFA 2JQXA 4MMWA 5HNRA 3AYVA 1KBJA 4KMQA 5DRCA 3WQ5A 3UVIA 3DC0A 4G9PA 3KL5A 5JCNA 4GIAA 5IHRA 2YLAA 1IHIA 4HP5A 1IIGA 3OLIA 5HATA 1SMDA 3FKRA 1Z32X 5JIPA 4GWEA 4K3ZA 4HU0A 2I9EA 3CBWA 1Q63A 3CH9A 2EQ9A 1CLKA 2WPCA 2QZRA 1R46A 1GJUA 5XIAA 1LRNA 2WVVB 5EBAA 3RITA 4PRRA 3URAA 1SO6A 5LGXA 2ALDA 4H1ZA 4C1NA 4M7SA 1XDJA 1XLGA 3ARQA 4RDYA 3ARVA 3W7QA 2HNHA 3MP5A 1XQKA 2VZVA 2ZFAA 3FEMA 4UIOA 2WSQA 2WAGA 4TOQA 3OEXA 1KM5A 4S3BA 2TMDA 1R86A 1WB0A 5E9XA 5HPOA 1RH9A 4A22A 2AL2B 5K2ZA 3M6DA 5HJLA 5ABEA 2ANUA 4H4YA 3M47A 1PDYA 1TJ1A 3VIGA 3QY6A 4W8BA 3WEOA 4LNYA 1F76A 4TX6A 4CNOA 2W61A 3PS7A 4JL1A 5D4YA 4IF2A 1SFSA 2FFIA 5I24A 1D7FA 3HQOA 4KEUA 2QUUA 4HNCA 1QPKA 3PZIA 3QQ1A 4A3YA 4FHAA 1AMKA 3DK4A 1FCBA 1MW0A 4ROQA 2W6RA 2P0OA 1O6IA 3NQFA 2A6NA 3O1NA 1IZCA 2VEMA 1F8IA 1BYCA 2GWGA 5AOUA 3NQGA 3SUUA 4N9BA 2OQLA 3TXZA 3U5YA 3GNOA 2J75A 2CHRA 2BOFX 4MTVA 3G8EA 3BLEA 2YCLA 3K4DA 1HL2A 2J7CA 5FJRA 1JG9A 4UCGA 2NXGA 1MDRA 1Y5VA 3S1XA 2BC0A 1W3IA 1E9LA 3VOIA 2PGWA 3EWXA 1FWRA 1RAKA 3T2PA 4GIRA 3W1LA 4FOKA 3TW7A 4E2BA 3CPRA 4AZ5A 1U83A 2ZRYA 5AC8A 3MHUA 1KRBC 2R91A 3OJGA 4NZFA 5D02A 3PJWA 4N9CA 1TWSA 3WQWA 4HNTA 1X1ZA 3AN1A 2XH7A 4J3SA 2JK2A 4F66A 5GJPA 5FL0A 4UNIA 4X2PA 4FNTA 2BP1A 3LPOA 2Y7GA 1XRTA 4HJWA 3VPLA 2Q3OA 4IOTA 4NJGA 5D30A 3MVIA 4O13A 3UYCA 1S2VA 1I75A 4XUGA 3MCMA 3PZGA 4TTGA 3BJTA 3WL0A 4EQSA 4RXFA 3MUIA 3IWPA 5FEWA 2F61A 4XO6A 2AMGA 3WQFA 5ECUA 2ZE0A 1PDZA 5AHIA 4JFTA 2E1DA 1TKKA 4DRSA 1X7IA 3VZXA 4ZQOA 3BOFA 3BL3A 3V5OA 4IL0A 4IGSA 4EM4A 3GG0A 8XIMA 2P76A 2E5DA 4AW7A 4DF2A 2IS7A 3PK7A 2Z2UA 3BOXA 2XIOA 4AZGA 3DUGA 5C70A 3WBYA 1MXSA 3H2CA 4LS2A 3U0HA 3MBDA 4PMVA 1MNSA 3A7RA 4H4UA 2XWDA 4BZYA 1GQKA 2DEPA 3UYIA 3FXGA 1ZUAX 1DOSA 1HG3A 3RM9A 2REQA 3JR2A 3RX4A 2PTYA 1UZDA 2GRTA 5DFAA 1DIKA 1QBAA 1F6YA 4KWSA 4E5TA 2XH2A 1JNDA 1BWLA 4DBDA 2J25A 1FWAC 1VEOA 1UJPA 2V8ZA 2E3ZA 4WDTA 4D6FA 1ZPTA 3WF0A 4BQ5A 3NOYA 4AWUA 1TWDA 1HL9A 5I0DA 1CB7B 2ZA2A 1GVEA 4J3ZA 1OFAA 3D3FA 3V4BA 2RKXA 1C7SA 1NWUA 1EOKA 1LROA 3DIPA 1GVIA 2J79A 1HJXA 2BY0A 4AVOA 1WAWA 1O5RA 5HAOA 5F1VA 3AOFA 5DANA 1Z9AA 4K39A 1K9DA 4XD6A 4R33A 1ADDA 2GLKA 3O0FA 4ICMA 3AMLA 4Q8NA 2WKLA 1I2PA 1P0KA 3JUGA 1B1YA 4O54A 5KTLA 1AFSA 3F2CA 4JS3A 3ZT7A 3B8WA 1XCWA 2YOCA 3D6NA 4NZCA 1C29A 1DJQA 1GW1A 3S1WA 3WK0A 1J0KA 1H1NA 2TYSA 3NVTA 1KA9F 1JR1A 1AZ1A 5I2UA 1T0OA 4I3GA 2BODX 5LGZA 4K7VA 1RCXB 1BWVA 4C6KA 3IUHA 2RDUA 1XH1A 2YVGA 2DSKA 1FXPA 4A8NA 1POKA 4LB3A 1V97A 2EXOA 3QGAC 4IT1A 5ER0A 1X7FA 4V1YA 1XCFA 2OT0A 3PZQA 4EQWA 3NZQA 2NWSA 5ABFA 4PMOA 5M3WA 2HS8A 2EG8A 2QCEA 3TMQA 3ZVHA 3NDZA 1DNCA 4IUOA 4AEEA 4I7UA 5AC5A 4GXWA 3GH5A 3O06A 3DI0A 4TX9A 3WF3A 1M9HA 3XINA 4L1GA 4B5NA 3TLLA 3ID7A 3TYUA 1WX0A 1HJVA 1TZZA 4E3VA 4HT3A 4PUJA 1PKYA 4XAZA 1F3EA 1PWMA 3CUGA 4NXSA 1F7BA 2BCPA 3UZ5A 4E8DA 1UOZA 5JU6A 2WC3A 3L67A 3LEPA 2AAQA 1Q6DA 2YDAA 3EKZA 2OGJA 3B9DA 2Z1KA 4JFUA 3N4EA 5DMYA 3D9XA 3IJQA 1KC7A 4D2JA 4N4QA 3SW6A 3IGHX 2I16A 4GMEA 1XBVA 4K2SA 3B8SA 3LI0A 1ZY8A 1A0DA 4LYQA 4O0KA 1HVQA 4N2YA 2J6XA 5C6MA 2P3ZA 3Q4DA 4WDUA 4E2OA 1R30A 3UJSA 3LXCA 3LGEA 4IX0A 4QGCA 3W0KA 1CGYA 4CN4A 4NL1A 1B3YA 5FF2A 5A6MA 1JQVA 3CUXA 4QLKA 4XZIA 4FR6A 2IUZA 5D09A 3R89A 1C92A 1QHPA 5BMXA 1ZDLA 1W5PA 2W67A 3N3TA 5FS8A 3KWSA 4ZSTA 2WKGA 2A2IA 1MUMA 4RE4A 3CMFA 1FWWA 3AM9A 3WF2A 5DN1A 3P0WA 1UKQA 3SUTA 2EJAA 3S83A 2IMRA 1W1YA 4JL2A 1M04A 5KZ6A 2WZHA 1FTXA 3E74A 5HNNA 4CQ8A 1FWDC 5C9WA 1GREA 1YPXA 4YPJA 1A3HA 3WLKX 3QLDA 1HP5A 4W7VA 1ISWA 1EP3A 4LYRA 3WKZA 3T05A 1P0DA 1H5VA 2JK6A 2FFCA 2D0GA 3HJEA 5F7UA 5EFDA 4B5WA 4IMEA 3W84A 1LOSA 4F9DA 4K37A 3BCFA 3L4YA 2O9TA 3PPGA 4CQ9A 4AZBA 4C1NB 1AD4A 3LTSA 2WVTA 4HPHA 5G2HA 1SMAA 2YL9A 4NEVA 3T40A 3C3UA 3KCOA 1R3QA 3BG3A 3NQEA 3C2FA 4GK8A 1A0CA 1UASA 4B2DA 2J62A 4F0KA 3SADA 4OIFA 1HKVA 2BB0A 2PDMA 4DUVA 4O18A 3UG5A 2P50A 1UH3A 2E09A 5LHEA 1LM1A 3VNMA 1SUXA 1FEBA 4FSAA 1GRTA 3W83A 4YLWA 2GQWA 1SM9A 4HPXA 5CPOA 4XBJA 1QNQA 1RA0A 1JCJA 1WYGA 1ALDA 4Q7IA 2HNEA 4NAEA 4JDRA 2I56A 1AZ2A 2OSYA 1UKTA 2QCMA 3L2IA 3CMJA 3NPUA 2VEKA 2X05A 2EAWA 4O4VA 2EEXA 4CD8A 4GYJA 5TAOA 1LWHA 1PTDA 5HWJA 4JZ5A 2WPEA 3AI0A 3L7RA 5HWNA 1U30A 3GG8A 4DY1A 4S3JA 3DFSA 4JTHA 4DF0A 4NIRA 3K8LA 3W7CA 1TZ7A 1TA3A 4XZHA 1DXLA 1D7KA 3CEPA 4B9YA 2CIPA 1J2BA 2DV0A 1EDQA 4LEQA 5K3VA 2VYOA 5FAGA 2YCLB 2WSKA 1CW2A 3KWXA 2C6QA 2PF0A 4QR6A 3NXLA 1FHVA 4JDYA 4PGLA 1L9WA 2ZUNA 3PSVA 4Z0SA 3TN6A 3PZTA 1K03A 3OO2A 3MJMA 1ZHAA 1GTHA 4MY1A 3GG1A 5C54A 2ASHA 2DIJA 3VILA 4Q8WA 3VC6A 3GNNA 1BVZA 3LTPA 1E0VA 4DJED 1NDAA 3GFZA 1JCMP 1W3HA 4BQ2A 4YCOA 3L0NA 4UFLA 1NFPA 1DJXA 3P67A 2DW7A 2WWCA 2JGQA 1PL9A 1LDCA 2GSJA 3WMLA 4CGTA 3Q6JA 4ALDA 1IXNA 1RBOB 1UC4A 2QPSA 2J7EA 4ECLA 1XDIA 2C14A 4OE7A 1HJQA 3THAA 1VD6A 4PBGA 4CD7A 4RJEA 1ZJAA 1XUZA 3W7NA 2Y2WA 2DH3A 3SCOA 2MANA 3TYZA 3P5ZA 3VK5A 1S2TA 2OR2A 3ZR4A 2PDXA 1XLEA 2ZUWA 4QFUA 4RNIA 1AL8A 5CEWA 2PRLA 5IOBA 2E40A 5J04A 1UR2A 3AALA 3TCSA 4FNQA 3FLUA 4IICA 1GQNA 3P14A 4L80A 3M7WA 2DT2A 4C6MA 1QNRA 3CV2A 2QHAA 3IIOA 3VIKA 2V3AA 4FO4A 3S4TA 2VCBA 3C6CA 4LV9A 1I2NA 3PPCA 3VCCA 4FNPA 1KTBA 4UTTC 3PBGA 4A8IA 3NQMA 3TONA 3O0KA 4LY8A 1JQXA 4O12A 4C6LA 2REQB 1E56A 3MT1A 4KBXA 1QW8A 4EK7A 1G4EA 4O1EA 3BH4A 1Z3NA 1AODA 1W6TA 1P0BA 1RR2A 5C0QA 3ZSTA 5JCLA 2QAPA 3WMSA 4L1WA 3TC6A 1IV8A 3ZJ6A 5CLTA 3LD5A 1VBGA 1S2WA 1EPVA 3DI1A 4BEQA 3ITXA 4PN2A 1XCXA 3RJXA 3RK8A 3W6MA 3LADA 2PRMA 5CXPA 4IUGA 4JR5A 3LRLA 1FKXA 3I7RA 1F4HA 2A3EA 1JUKA 4FDCB 4WLCA 2FKPA 4GPNA 4DXKA 1H49A 4WIWA 2ZDSA 1YRRA 5XIMA 3LERA 3UA3A 3CWHA 1TTJA 4UFKA 1Z44A 1OCNA 2RJGA 2J7FA 3W1QA 3VIMA 3LCHA 9CGTA 4NF7A 4AIOA 4PMQA 2OZ0A 1FWEC 4FXRA 1NHSA 3F4VA 2PDUA 2BHYA 5CZKA 3PJTA 1J0JA 5HDRA 3MUY1 1JZ3A 4PMXA 2XIMA 2VUYA 3R11A 4WEVX 3LB0A 4OT7A 3S5NA 2NT0A 2CFYA 1WXZA 5BWAA 4TIMA 5EA9A 3IC9A 4I9TA 2X0YA 1UD6A 2FZBA 5DBUA 3ZJ8A 2QCNA 3SN4A 4FP1A 2VZUA 4AC1X 1FHDA 1DJWA 4Q7NA 5FJTA 4IQJA 1PX3A 4N7QA 1RK5A 4UTIA 4JTRA 3TW9A 6A3HA 3U4FA 5CPSA 1OFRA 1JRCA 3QW3A 1MNZA 1X98A 4M29A 1HGWA 1HQTA 4H9ZA 1E3XA 3AIRA 3C2VA 4JTTA 2FVLA 4NI3A 2PCEA 5ABFB 2VURA 3II4A 2FJUB 3TYAA 3ZVHB 1UH4A 2ACRA 4UTHA 4C6EA 4JFSA 3OIXA 1XKJA 4MGGA 2E77A 4AHOA 4D8LA 4LAOA 2PCQA 2BFGA 1DTUA 4JBRA 4E8CA 3UCQA 5KETA 2XTKA 3M1ZA 3N73A 2OT1A 3DX5A 3N25A 4I8YA 3TJ4A 1W91A 4KRZA 3QY8A 1J8VA 3P8JA 3MKKA 3VKBA 5JCMA 1E5NA 4N02A 1B3VA 2XU2A 3HQNA 1VEMA 4M6PA 2WCSA 3N9KA 2QMKA 1YXDA 2O9RA 3CZJA 1WDQA 1FFVC 3B9JB 3UERA 2X8RA 3NS1B 4RZ4A 1LCOA 1LLZA 3QN3A 3W2NA 3GFYA 3KE0A 5KSWA 3T78A 1TTQA 2TAAA 5L9FA 1IT0A 1HKKA 1H5YA 5CH9A 2YFNA 1F61A 3LCGA 3VIJA 3EB2A 5FESA 1NP2A 1TJ2A 1NELA 1NOFA 4WJ8A 1JDAA 3UFYA 1LJYA 1WE5A 1XP3A 1E3ZA 2C13A 2FYMA 3IPWA 4LIIA 3CS2A 3LS9A 3O7UA 1EEXA 4PFMA 3TW6A 1AMYA 4QXIA 1CCWB 3QYSA 4G2DA 4Q8MA 1EH9A 4J57A 4CQAA 3G1SA 4Q8OA 2HVMA 4FAMA 3OLEA 1LQ2A 2E6DA 1QAPA 1YKWA 4H9MA 5KMYA 4NXKA 4MUZA 3JVAA 4GQ0A 4LYKA 1ENUA 4H9UA 1GETA 2VM8A 1EWEA 5REQA 3WEZA 3UGRA 2QEZA 4KEZA 2Y70A 3HGOA 5CBJA 2A1YA 1DV7A 3M5ZA 3DFTA 2A3CA 2WW5A 2CHOA 1PHQA 1NOWA 1B30A 2XINA 4YWOA 5KINA 2J8GA 3U5UA 2H8ZA 1UUOA 3ZWTA 3LV5A 3A21A 2HXTA 1I2QA 3DH7A 3L5OA 3WLPA 4LF2A 3EA3A 1OX5A 4HNVA 2DT0A 4QDPA 1VENA 4U28A 1OK4A 3NO1A 2BV9A 4NP7A 1LRTA 5D8WA 4MKNA 2VZSA 1ZK7A 2J6VA 3OZOA 2BSLA 4U5IA 1OF6A 3E9AA 4KCTA 3PTQA 5BRBA 4C7GA 2QJHA 4IGNA 2DZVA 3ENLA 1V51A 4HHPA 3WFAA 2YSWA 4KF1A 4UTWA 1K6AA 3BG9A 5MKGA 4UR9A 3TQPA 2X7VA 2Y24A 4ZTXA 3OQ8A 4GIEA 7REQA 1XISA 1JL8A 5G5HB 4LC8A 4NX0A 4V28A 1H60A 3T81A 1QNPA 5H1WA 1U2YA 1IEXA 3NZGA 4EAMA 4H4WA 4H8UA 1I8JA 1ZKQA 3OODA 3S1VA 3E02A 1WCGA 2AOSA 2DUAA 4NAEB 1W1TA 4U4MA 1KCLA 2ZZ4A 3KZSA 3R0DA 3K8KA 1MVYA 1QPRA 1G67A 1GOXA 4ACYA 5GRTA 3BCDA 1P48A 3QOKA 2DZTA 1QBBA 1ZAHA 4WR3A 4MWAA 3TWAA 1R3YA 4PYSA 3E2RA 1SVDA 1TQXA 1FWFC 4IQDA 3PZVA 4Q4OA 1L6FA 2WP5A 4O16A 1BYDA 5AHLA 4C6OA 3MY9A 5M17A 5DX7A 1QPOA 2DH2A 1ZS2A 3H53A 5TIMA 4DIAA 2JEQA 3TWBA 1TUFA 4QS6A 3QR3A 4WF7A 2OG9A 2PWDA 2PLKA 1WYIA 3H6OA 1UYQA 2FZ8A 3VDHA 3N2CA 1NHRA 4WJEA 1GVFA 3WD4A 4BY3A 2WCGA 2WMGA 4AF0A 4WGHA 5F4SA 5T8GA 3Q2DA 5ECVA 3EOEA 1WPCA 4BA0A 4PRWA 3E0VA 1GOQA 2WZIA 4C65A 3GXDA 1UWUA 3P93A 1QI5A 3WH6A 1J18A 3EOUA 3NEHA 4YTSA 5E9AA 5CPQA 3WLNA 3Q58A 1SJAA 2Z00A 1JRBA 2BY2A 3VE9A 5HJYA 2ZX8A 4H8VA 4Y9NA 3AWOA 4EQRA 1CIUA 3T8LA 4D8AA 4L6HA 2BMBA 4IH3A 2BGQA 3W2JA 3NQ6A 4J3VA 1XIMA 3CAQA 3M0MA 3FKKA 4M56A 5TD4A 1WKYA 2ZUUA 3CAKA 5DBTA 4YU1A 2VFEA 4XBKA 3VIHA 1B4EA 2ZRVA 3OTRA 4HA3A 1C8VA 4W7UA 4A3RA 1ZCCA 3MA8A 4CEXC 3BW2A 3M16A 1V0NA 4AISA 2YW4A 3AIEA 1K7EA 4DWSC 1ZX9A 5JCKA 4J56A 1ISYA 3G18A 5FAJA 4W88A 2CC0A 4HMCA 3VIPA 1NIUA 4LQ1A 5EY5A 3HPFA 5EYWA 5M2FX 1G0CA 3GIPA 2I9UA 3TSMA 4M6UA 1BWKA 3TA6A 3OHIA 3WQVA 1EC9A 3EWWA 1UR0A 4Q8QA 5AKQA 2WLYA 4AX6A 3QV7A 1QFEA 3ZR5A 2CYGA 3TU9A 1PUDA 1W2PA 4GG9A 1B3XA 2CNCA 4UFIA 1QW7A 1L8PA 5CSYA 3KZPA 4ZEPA 3KRBA 5EGRA 4GXPA 2D22A 4RXGA 4QEHA 3SZ8A 1WDPA 1M3UA 2E67A 3W7DA 3IV8A 5E0FA 2ZOXA 3WQ6A 1W8GA 3G1VA 4ZQMA 2X1TA 1QDSA 1XSIA 2QLYA 3BE7A 2QF7A 4XO7A 6XIMA 4AWSA 4RL3A 4N0RA 4TQTA 4ILSA 3FJLA 5AZ0A 3Q45A 1M7XA 5H8PA 3W2LA 1H1ZA 2HV5A 4DYEA 1JCLA 1C8QA 1PIGA 5C9XA 3SCQA 3RHGA 1KO0A 3S2LA 1XPYA 3E0IA 3UA4A 3U6WA 4R27A 3TFXA 4JDBA 2XG9A 2XFRA 4POCA 1UA7A 1B9ZA 7TAAA 3A22A 3HV8A 4DZHA 1W3KA 1CEOA 2GJLA 5A5WA 2ZX7A 1XGDA 3S2NA 3R5EA 4JCLA 2HROA 3WDIA 3EGJA 5JXQA 4Y8EA 5F1UA 5F2LA 3ZM8A 2QIWA 3SUVA 1QK2A 3A9IA 3DZ1A 5BU6A 2HPMA 1BKHA 2G5WA 3S1GA 2YPIA 5BYWA 1OWQA 3BV7A 4DM1A 1JCTA 3A23A 2VFGA 3WNPA 1FCUA 1KD0A 1LVLA 1ZBCA 4NZ5A 2J78A 1XLDA 2WLZA 1JZ5A 5CQ1A 3RMEA 3GU9A 2YA1A 1GKPA 3PG6A 4KIRA 1BPLB 1TWWA 4MZ1A 3W70A 3F4NA 3NTYA 2WNQA 2V30A 3EWBX 3ARSA 2ZBTA 4WXZA 2NX3A 3RN6A 1CB2A 4QNWA 2Q8ZA 4IX2A 2A3HA 2BNJA 3STFA 3A24A 1TPVA 2C3CA 1N8IA 3G8RA 3TTYA 1UROA 2B0MA 4ZO9A 3GB6A 4MB1A 3M46A 2V5LA 5A8MA 5FOOA 3NL2A 1UZHA 2PLMA 3KX6A 3W87A 1BGAA 3BSHA 4ZXOA 1PZ2A 3PR2A 4FOJA 3WF4A 3O05A 4AD1A 3TQ0A 4HSOA 4S1FA 7ENLA 4DJDC 3GE7A 3CL6A 4MJ2A 2OZ8A 1P4CA 1JPMA 3ITLA 4QROA 1OG6A 4MG4A 4GVFA 4MZYA 4K36A 1JGMA 2HVNA 3ANVA 3TQKA 2CLEA 4K1WA 3B0VC 4JX6A 2NVCA 2VEIA 3GO2A 2E68A 1JRPA 4RV8A 4H4TA 3LCWA 2C16A 1A80A 1SYTA 1UKOA 2NVAA 2FHCA 2G4JA 3REQA 5C2CA 4GGHA 3GG7A 1YE6A 1UH2A 3FS2A 2VUNA 2ZZ0A 1C9WA 1OZQA 4IXXA 2A0NA 5BXPA 5JVLA 3VC5A 4LSBA 3HURA 2PPGA 5BXSA 1WBJA 2R82A 3BVJA 1KFBA 2C15A 2VQUA 1Z8AA 3HPZA 5DQPA 3VGGA 5C8BB 3KBMA 4UQAA 3RUBL 4QE1A 4L9YA 1UWRA 4IP5A 5B7ZA 1MXGA 3URBA 1UWTA 5FMHA 4OHQA 5REQB 1XLAA 2CETA 3WH7A 1YLVA 1UKPA 2CZFA 3NSMA 5U25A 4FB7A 1ODZA 2RGMA 1W5NA 1VPQA 2F5ZA 4EANA 1X6UA 2YLLA 5AC7A 4MNJA 5A6LA 3DFQA 1AW5A 2QR6A 2Z28A 3NIYA 1XLBA 4D72A 1VJZA 2R94A 2CKRA 3PZOA 1GUVA 4B2DD 3AMZA 3TV8A 2ACUA 4AMAA 3AMCA 3CM4A 1BYBA 1DWFM 1NDYA 4GI8A 1GPFA 4FXJA 1CI1A 3EMCA 3HJZA 2BHZA 3VGBA 3FNDA 1SJDA 3B03A 1KM1A 3IIXA 2VX4A 3QLLA 2NW0A 5HXMA 1UD4A 1OFEA 2GPTA 5G2IA 1V6XA 1US3A 1OT2A 4S3GA 1IGSA 2YGYA 5DMLA 4JEQA 5K9CA 2PD5A 2V2HA 2HRWA 2OU4A 5MKGB 1ONWA 4JIRA 7REQB 3SY5A 3CUHA 1H7OA 3W00A 1XL9A 5FIPA 3ZWSA 4NYUA 2PP1A 1KKRA 1LTDA 1O5KA 1WZLA 3M6YA 4O52A 5CLWA 1HVXA 3P8IA 1I0DA 3U2EA 4L9ZA 2XIQA 1DWIM 5CCZA 1Y8BA 4Z1BA 4Z2JA 2GOUA 1EX5A 1SU5A 1XLHA 2JKAA 5KVHA 3FVDA 5SWUA 1F6KA 3RPDA 1VCGA 2DSUA 5I6SA 2BVTA 4WOQA 1OFBA 4QITA 4MWAB 4K7ZA 3KDNA 8TIMA 1O68A 1VFUA 1Z7AA 2F8QA 4GKLA 1LLWA 1ECQA 3NQCA 3RAOA 1GYNA 4UNLA 2PI6A 1JD7A 2YCEA 1RQHA 2YBVA 1LBMA 1JPDX 4RPQA 1EXPA 1MO9A 1OC5A 4L4OA 4ZBCA 3VUPA 3TR9A 2DPEA 4GYKA 1QOPA 3W82A 3QKZA 2OKTA 2VC5A 4US5A 4AF0B 3U7BA 2MNRA 4LBRA 5D04C 1JFHA 3KLKA 5GJMA 2FTWA 5FJOA 4KPRA 1V59A 2X41A 2X1UA 4O10A 3VXGA 4PBEA 3T42A 3PBMA 4ZOCA 5TQLA 2AMXA 5LNWA 2QVHA 3L21A 4RNHA 3NURA 1QXLA 1NPXA 1XWYA 3DENA 4BWLC 4QG6A 1NM9A 3SN1A 4FLRA 4X22A 1TIMA 2BC1A 2BVDA 4ADTA 4H9TA 1AJ2A 3R8RA 3GDMA 1FWJC 1LF1A 3WLRA 3VINA 3TTOA 3NL3A 3LCXA 1BLIA 1R0MA 3CYJA 3W7JA 2XDFA 3NNTA 1XIJA 4O0QA 1FDJA 1TWZA 4WSKA 3RPTA 3EOLA 5A8PA 1ME7A 1T8XA 4PCPA 1V3HA 5F4WA 2B81A 3MYOA 5BOOA 1ZENA 4KFNA 4E0CA 1QMLA 4H04A 3ATZA 3LPFA 4L65A 2O56A 4MADA 4LS1A 4HVXA 3AUJA 2J24A 4IP4A 4B92A 1CECA 2QCLA 3DG7A 1SFJA 2UY4A 1XUUA 1TPEA 1JGIA 1D2KA 1BF6A 2HS6A 4XVDA 3W74A 4HA0A 1HFBA 4UR7A 1J0YA 1BXNA 3FV9A 1SW7A 3DGRA 4GY0A 4RKAA 4PMYA 3DG3A 3IJ8A 3ZO9A 1YNYA 1FVPA 4PTVA 3SRHA 3DGZA 1XICA 3SSJA 3WYZA 3QFEA 1W3JA 3PWGA 4DLMA 2OO6A 2NSOA 1XLFA 3CQKA 1MSSA 1R3RA 2PDKA 4KQNA 2QUVA 4CD6A 3C2EA 4PSPA 2ZWZA 3ZT6A 3WJWA 4MY9A 1QVBA 7ODCA 1AH3A 2INZA 1B90A 1KBBA 2QJIA 2V5KA 4HMNA 5K4XA 1U33A 1VYPX 2WPFA 3PVFA 2WHKA 4DBWA 2OYKA 5LNUA 5PTDA 3AS2A 3N6JA 3DHFA 3LV6A 3W1UA 5BU9A 1XLIA 4DZ5A 4R7OA 2WHLA 2V67A 1T99A 5JUVA 2ZX6A 3RLHA 4GYFA 4AHQA 3L4ZA 4BCEA 1J5TA 4NASA 2WKJA 5BROA 1TJPA 2VX6A 1KFJA 1GWJA 1OADA 4YN5A 2OYMA 1ZP3A 5L6UA 3NRZB 4D8ZA 4E2VA 1OB0A 3S0CA 2GDUA 3TTQA 3B05A 1QOQA 1S3HA 1H2IA 4CN1A 4ZR8A 1R85A 1ZMDA 3RGTA 1F3WA 1O66A 1XKYA 2GGEA 3WENA 3YPIA 3OHMB 4E8GA 1ELSA 3T0AA 1V3JA 5FA5A 3BJFA 4PMZA 3H24A 2EF9A 3WBAA 4WKFA 1G01A 3EPOA 1OYAA 1PWLA 1CT5A 1U5JA 5F2GA 3GW3A 1EJWC 5D2WA 1UW9A 5HNTA 1E6NA 2PGFA 1HIZA 2NUXA 4JTSA 1A5BA 4HZMA 5D03A 4YTTA 1RA5A 4LANA 4ZO8A 3AYTA 3MB9A 5AHNA 1H7WA 4S3FA 2NXHA 3FEQA 4CCCA 1E4NA 1XIBA 4LAKA 3VNKA 1H61A 5A6AA 1XHCA 3BLIA 3HM7A 1LWJA 1KNWA 4UOJA 4J3UA 4FXSA 3GHTA 1JXJA 4KWOA 3ZXWA 3VNJA 1TMQA 3TN5A 1GOOA 3KDOA 1TTIA 1DHKA 3CQJA 5C55A 5AHMA 3SUWA 1GQIA 1W1A1 3B04A 2Y62A 3RJYA 1OYCA 2X0HA 4KIEA 2RABA 3P74A 2ZDRA 4W4QA 2QW5A 4NILA 3ITOA 2FGLA 3H8AA 4NZ3A 3L4WA 2WSYA 1GJWA 4HPGA 1EIBA 4KFPA 3IJ6A 2ZUMA 3REQB 4DO5A 4L5ZA 2ZUVA 3S46A 2QXWA 2CZ5A 3RO6A 1AQ0A 1GSNA 2P8CA 1ZGDA 4XB3A 2HXUA 2WMIA 3AZTA 2P1FA 1TMHA 3NUKA 2DVUA 1K8XA 1VJIA 1RM6B 3K2GA 5CC5A 2DQXA 4MAVA 2FDMA 1TYGA 1LZOA 3WFZA 4YMZA 4Q3MA 1E0TA 6REQA 1AH0A 1F6PA 1O7AA 3M7SA 2XVKA 5IBXA 4BQ4A 1GRBA 3B9EA 3PZMA 1A5MC 3DFYA 1AUSL 3TN4A 1TE1A 1A5AA 1QHZA 3W81A 4C6DA 1GRGA 1EYEA 4H4IA 2PBGA 5BMWA 5HK4A 4K1GA 3P82A 1P0NA 4QJ4B 2ON3A 4J1OA 1KXHA 4ORMA 4K6AA 4E4FA 5LHFA 4XZBA 1EB3A 3T0TA 4JQ1A 3PULA 4EXAA 3PB2A 2V3FA 2PTZA 5CG7A 1JF5A 5BZAA 5M5DA 1WBHA 4UWMA 4WZHA 3SGZA 3DKJA 4GJ1A 4MNKA 3PY2A 4ATWA 1V6YA 2QF8A 3A3HA 5FF4A 3STGA 4G1NA 2WZEA 1F2JA 1EC8A 5IBXC 3URQA 5CC6A 2HQAA 3W86A 2JFEX 2PAJA 4Q33A 2W3RA 3A12A 3B8IA 4YVXA 2V82A 1FP8A 5A6SA 1ME8A 4PMDA 4UXDA 4O1BA 5U7SA 3WDRA 3V16A 4MWAD 4CVUA 2QULA 5I3IA 1S38A 5D2VA 1TQJA 4H4VA 3LRKA 3HG3A 2GK1A 4IIHA 1KM3A 3DJJA 3QMSA 1E4MM 2ISWA 6ALDA 3KVJA 4UOQA 1KWGA 1AQHA 3GNPA 3WUFA 3AZRA 1F3PA 4IJCA 5IM51 4W89A 3CHDA 3CGCA 5HJXA 2PWEA 2O4MA 4PUEA 4XBSA 2CU0A 3PTKA 1JXKA 4X9YA 3CASA 1VJSA 3M07A 1V3KA 4AG0A 2G37A 1G4TA 2Z6JA 4S3DA 1CGTA 4QLLA 4EPDC 2WSRA 2ZZBA 2GGJA 1BZLA 3ABOA 3LGDA 1JIBA 1FP9A 2Z2BA 2WZTA 4WY0A 3CNYA 4E38A 1QHOA 3NJ3A 2XZ7A 4S2CA 1H41A 4FALA 3GSMA 1Y0EA 3UNTA 3SCVA 4YTQA 1TELA 4HK5A 3FA3A 3WDQA 4B91A 4D6DA 2YR1A 3TSDA 3UZZA 2NQLA 2FQIA 4PH6A 3V1HA 3VD9A 4JQ9A 3DK8A 5A6KA 1A5SA 1JEHA 2IPFA 1VQTA 5D9OA 3PUGA 4GNKB 2XHYA 1V5XA 4AU0A 1A50A 2QDDA 2BVWA 3IJDA 1A0EA 3K1GA 5A2BA 1KTNA 1MZHA 4IMDA 4O14A 1RZMA 1UHVA 2PWVA 2BZNA 4QP0A 2IQDA 3CGTA 1T5AA 1RQEA 4W9TA 2R14A 5IHSA 3CV1A 3WDHA 4PUKA 3GR4A 3EYPA 1EL3A 5FJJA 3OPSA 4LRTA 2J8FA 1AA1B 3UY7A 3T0DA 3VD3A 3VOGA 1BFNA 2Q01A 3HGSA 4YXGA