3OZYA

Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg and m-xylarate
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
386
structure length
386
Chain Sequence
SLKITEVKAHALSTPIPERMRVESGAGLKLNRQMILVEVRTDEGVTGVGSPSGPYDLAVLKRAIEDVIGPQLIGEDPANINYLWHKVFHGEVSRNLGHRSVGIAAMSGVDIALWDLKGRAMNQPIYQLLGGKFHTRGVRAYASSIYWDLTPDQAADELAGWVEQGFTAAKLKVGRAPRKDAANLRAMRQRVGADVEILVDANQSLGRHDALAMLRILDEAGCYWFEEPLSIDDIEGHRILRAQGTPVRIATGENLYTRNAFNDYIRNDAIDVLQADASRAGGITEALAISASAASAHLAWNPHTFNDIITVAANLHLVAASPHPAMFEWDITHNDLMTRLASYDLKLENGLVQPPQGPGLGFEIDWDFVAAHAWKGEPAIGAGHGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative mandelate racemase
publication title Crystal structure of enolase superfamily member from Bordetella bronchiseptica complexed with Mg and m-Xylarate
rcsb
source organism Bordetella bronchiseptica
molecule tags Unknown function
total genus 134
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ozyA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ozyA01
1JPMA 4IL0A 5FJRA 3DG3A 3TQPA 1YEYA 2XH2A 3VC5A 3SN1A 3U4FA 3KUMA 1EBGA 1KCZA 3NO1A 3T6CA 3B97A 4HCDA 2OPJA 3IJLA 2AL2A 1ECQA 4HYRA 3SBFA 3VA8A 1OEPA 4JN7A 2P88A 4F4RA 2AKMA 3VC6A 2GGIA 3DDMA 3DG6A 3JVAA 1EBHA 3PFRA 4IL2A 1F9CA 4KEMA 1RVKA 3RR1A 3DFYA 1IYXA 4KT2A 4K2SA 1MUCA 4J1OA 2MUCA 3SQSA 3TOYA 4H1ZA 1W6TA 3UJRA 4K1WA 3QLDA 5FJUA 1JDFA 1TE6A 3QKEA 2OZTA 3OTRA 3UCCA 3MKCA 3DESA 4DWDA 3MSYA 4JHMA 1KD0A 2PTYA 3T9PA 2QJJA 3SN0A 3RRAA 3V5CA 3JZUA 3IJQA 3RCYA 2OZ8A 1JPDX 2O56A 3R0KA 3ZLFA 4M0XA 1PDZA 3TTEA 4Z1YA 3ES7A 1EC8A 3IJIA 2PP1A 1R0MA 3OZYA 3MZNA 3D47A 3TWBA 2PCEA 3DG7A 4A6GA 5IDZA 2OG9A 3R1ZA 4DXKA 2XGZA 3CAWA 1ONEA 2HNEA 3OZMA 1MDLA 2AL1A 2P3ZA 3QN3A 4HN8A 3QTPA 2OFJA 2GGEA 3DGBA 2PU0A 2PP0A 1XS2A 2HXUA 3H7VA 3UXKA 2FKPA 1NELA 2QGYA 4J3ZA 4GIRA 3SJNA 1PDYA 1MRAA 3UCDA 2PP3A 3EEZA 4E4UA 3MWCA 4YWSA 3V4BA 5J04A 3CT2A 4ZCWA 2AKZA 6ENLA 3VDGA 2NQLA 2OLAA 1DTNA 4DX3A 2PGWA 4MMWA 3STPA 2RDXA 1FHVA 2PU1A 3N6JA 3DEQA 5ENLA 4DHGA 1MDRA 4ZA0A 4GGHA 2XSXA 3ZVHB 1EC9A 3PWGA 1P48A 2ONEA 4E4FA 4GYPA 2GGJA 4JN8A 2XH7A 3ZLHA 3R11A 2GGGA 2I5QA 3K1GA 3CXOA 2OO6A 2HZGA 4KWSA 1R6WA 3I6TA 3Q45A 2P8BA 1JCTA 2PS2A 3TJIA 5BOEA 4X2PA 4MGGA 3I6EA 2XH0A 5FJPA 2PTZA 3V3WA 4HNLA 1EC7A 1WUEA 4M6UA 1NU5A 3OP2A 2MNRA 3ENLA 3GO2A 4MKSA 4HNCA 3TCSA 3VFCA 1BKHA 5BOFA 3R0UA 1SJAA 4G7FA 3OW1A 3CB3A 3RGTA 4ROPA 3SSZA 1E9IA 2OQYA 4G8TA 2XH4A 3NXLA 2FYMA 3ZVHA 3P0WA 3QPEA 3HPFA 2GGHA 7ENLA 4H83A 4IT1A 2PTXA 4HPNA 1MNSA 4E8GA 3BOXA 3UJSA 3P3BA 3TJ4A 2PSNA 2P8CA 4A35A 3FVDA 1SJBA 2P0IA 3GD6A 3BJSA 3V5FA 3R10A 1SJCA 3VCCA 2DW7A 3CYJA 3T4WA 4IZGA 3UJ2A 4H19A 3FV9A 3DFHA 1XPYA 3MUCA 2PODA 2PA6A 3CK5A 1FHUA 2QJNA 3NFUA 3U9IA 3S5SA 3DERA 4GMEA 4EWJA 3MQTA 1L8PA 3N6HA 4H2HA 4DN1A 4GGBA 3T8QA 3UJEA 1KKRA 3UJFA 1TKKA 2QDEA 3FYYA 3H12A 2QDDA 3SN4A 2POZA 2OZ3A 2ZC8A 3S47A 4FI4A 3FJ4A 2OQHA 4ENLA 3PWIA 2PPGA 2OX4A 4HCLA 3I4KA 3VCNA 3N4EA 1BQGA 4IP4A 3BSMA 3Q4DA 2QVHA 5EU9A 4E5TA 5FJTA 4GYPC 4DYEA 3OPSA 3D46A 3FCPA 2ZADA 3ZLGA 2OVLA 3H8AA 3ZVIA 3R25A 3MY9A 4IHCA 3THUA 4A3RA 2CHRA 4Z17A 4FP1A 2GSHA 3GY1A 2QQ6A 3PK7A 1KKOA 3TWAA 2AL2B 1P43A 3IK4A 4E6MA 3UGVA 3H70A 4GISA 3JW7A 4KPLA 3RITA 3DIPA 3FXGA 2PTWA 4GFIA 4IP5A 5FJOA 1TZZA 3N4FA 2DW6A 2HXTA 3RO6A 3P93A 2GL5A 1SJDA 3GC2A 3ES8A 3NZGA 2OKTA 1WUFA 4K8GA 4HCHA 2PGEA 2PMQA 1ELSA 2GDQA 2QJMA 3TW9A 3UXLA 3EKGA
chains in the Genus database with same CATH superfamily
1DWJM 5IHSA 4Z2JA 1W3IA 1DVJA 2HDJA 2EF9A 1KCZA 2BZNA 4AC7C 1OF6A 1UR4A 4KRUA 4UQAA 3WH6A 3N18A 1ZTVA 1K4GA 3M46A 5FAJA 1KBIA 4YHEA 2OPJA 3WX7A 5CG0A 1EXPA 2C1HA 3H7UA 3WBWA 1E9ZB 1K9DA 3BV4A 4GI6A 2DP3A 3SBFA 2I17A 2J7DA 4P8WA 3VC6A 1LM1A 1UWIA 3SCRA 1DL3A 2BS9A 1JAEA 3QMTA 5I3GA 4JKLA 2VEFA 4BEUA 3VNJA 3RR1A 1N8IA 1IYXA 4QS6A 4AY7A 1S5VA 1O68A 5GNXA 3BGJA 2XM2A 5K4XA 3O0HA 4LVDA 1A5AA 3CPGA 1L6WA 4K1WA 2NZLA 4EMIA 4R53A 2CHOA 3UW6A 1QOQA 3OTRA 4HD5A 4I9AA 4XBSA 4H4RA 1UR0A 2VGIA 1TPEA 3L12A 5FF7A 5ECVA 3M5ZA 4JHMA 1QI3A 2PDLA 2VQTA 2PTYA 3F4NA 3QSTA 3BE7A 2O56A 2Y62A 3V7PA 5FJJA 4UTTA 5TAOA 1KTCA 2PP1A 2PDXA 3DHUA 1I8JA 5HMEA 1D3HA 3TN5A 3TXZA 3TH6A 3AS0A 5I5RA 3W7MA 1XRFA 1X97A 2VDGA 3K13A 3CWNA 1K7FA 4NJJA 1REQB 2AAQA 1XYCA 4PUEA 1EDTA 2NLYA 4TV5A 4EM3A 4GQ0A 1Q4WA 1MZHA 1R3VA 2FHFA 3VFLA 1LLZA 3M6DA 3H6OA 4NJGA 4ORIA 4HPHA 4IF2A 3M0XA 4BCEA 3UR5A 1WKYA 3LPPA 1E3ZA 1KM3A 3OVRA 1J10A 1PCWA 5J04A 3WEOA 1RH9A 4LYRA 1PCKA 2VFEA 3ITGA 1D3GA 1I2NA 1TJ0A 1XQLA 3PB2A 2EEXA 3EGJA 2QUMA 4UCFA 3MMUA 5DT5A 2CLKA 5FOOA 1TV3A 4DXVA 1KCLA 1RBLA 3ARRA 2V8ZA 4UTIA 4O19A 3MZ2A 1IE7C 4CNNA 2FLIA 5C9RA 4S3CA 3ORWA 1W5OA 5ER0A 4G6CA 4L9XA 2XZ7A 3NEVA 3WMCA 4RZ6A 2E3TA 4A8RA 4KKXA 1NFBA 6TAAA 3E0VA 4EPEC 4AXNA 3LGDA 4H6QA 4U3AA 4HNOA 2J13A 4N4QA 3I7RA 1NWUA 3I6EA 3EANA 1YX1A 4DF1A 2GJNA 4ZB0A 1VZWA 2Y7DA 4QLJA 1EIXA 2PE4A 4F0MA 3NTYA 1OFQA 1XDJA 3RMJA 3LB0A 5EL1A 4W4QA 3WH9A 3VGEA 4HU0A 4ROPA 4HPXA 3SSZA 3QZAA 4LIIA 5AYYA 5A8GA 3OVPA 3CLMA 2X2GA 4EF8A 2ACSA 2FYMA 1AG1O 4OWGA 4FX6M 5FI8A 4JHOA 1V4YA 1OT2A 4QAWA 2VP8A 1HL2A 1R30A 4IJCA 5A94A 4IIEA 5I06A 3TTOA 1STZA 2P0OA 1XIDA 5HMFA 2B31A 4O1DA 2P8CA 1OFRA 4PMUA 1QVBA 1CXHA 2E4TA 4XD3A 3TLQA 4GC4A 2J25A 3L5OA 1BVWA 2JIWA 5KETA 2NV1A 1IF2A 2EQ9A 2E40A 4J3WA 2WVSA 1J5SA 3KRSA 1GQJA 1M5WA 3ITCA 4PMYA 3W7NA 3IC9A 1NFGA 3A4AA 3DFHA 5JVLA 2R9RA 3HN3A 1IZKA 3EWUA 4DN1A 2GRTA 4AFYA 2J78A 1NOUA 4DO5A 3RCNA 4HU3A 3TFXA 2I1OA 1H7XA 1I9CB 2POZA 4JTIA 5GQBA 4Y9AA 3PY2A 2F2HA 1O7AA 2OQHA 3UPWA 4CD4A 2E7FA 4IMCA 3PWIA 4A3QA 4JTCA 3I4KA 4MTVA 2XIIA 3NVWB 1FFQA 2J88A 4TMCA 2PDYA 4LVFA 5JBEA 1DXFA 4GQGA 1H51A 3P0XA 2JEPA 3VXGA 3AHVA 1J96A 1VGAA 3WY1A 3S1XA 4CNUA 1D3CA 4MWAA 4UNLA 4FB7A 4Z2LA 1E6NA 1RK5A 3W7DA 3W7QA 4HMEA 1EH9A 3FFSA 4IGMA 1UUMA 4NT0A 4DO7A 1KFWA 3R25A 2ZA2A 2OWCA 4N02A 2X8RA 4EPBC 2V38A 2Y7EA 2VJXA 3A7RA 2CLMA 4S3EA 4XAGA 2PBGA 5D4YA 2C15A 5D2VA 4NASA 1B9ZA 2OGJA 1UP2A 3MSGA 2GZXA 1ZAIA 2IQ0A 1JR1A 4ZO9A 1IZCA 5CJMA 4PB3A 5DQPA 5CAKA 1W31A 3VMOA 4CCEA 1FIQB 5DBTA 2YX0A 4PZVA 2WVTA 2X09A 3M0KA 4YNGA 2G3FA 1LL4A 3RO6A 4IIHA 2CHNA 1X39A 3I6RA 4LCQA 2WVUA 3EWDA 3FKRA 1YW1A 1XW8A 1CECA 2YA0A 3WLSA 1UH3A 1XDLA 4C60A 4FSAA 2EPHA 3HG5A 3CZJA 3RXZA 2F9RA 2JK2A 1UJQA 4ZSUA 1MEIA 1GTEA 4AF0A 2Y85A 2DZTA 3MMTA 2C3DA 2VKZG 1MW3A 1O60A 4L80A 2CFFA 3OZOA 1MFUA 3EX3A 1Q6RA 2VFIA 3NO1A 6PTDA 4LH8A 5A6LA 1EA9C 1G69A 3N34A 4JKKA 1RAKA 1NFPA 1EPVA 5M5DA 1RCXB 3KBJA 1X1NA 4O0ZA 3W2KA 2GQ3A 1ECQA 1K6WA 4K7ZA 1QW7A 3JS3A 4HZMA 4UB9A 2P88A 1CB2A 4HHMA 2F38A 4BQ2A 1DOSA 1XF0A 1GT8A 5IOBA 3B06A 4FA3A 4MB3A 1N8WA 4KT2A 1XYLA 4M19A 1E4IA 3SUUA 2FDSA 2WOIA 3HJEA 4F2BA 1A80A 3N25A 3WFLA 4PE8A 4W89A 2BV9A 1Q6FA 2WPCA 4JIEA 4DO6A 4Q4QA 1FX6A 1KGWA 2YXXA 2Z1XA 3XINA 1L9WA 3O05A 4UFMA 3CU2A 1PEZA 2JEQA 1YNQA 2OZ8A 3ABZA 2WMHA 3GC5A 3ZFHA 1PZ2A 3QW4B 3EF6A 1ISVA 4JFSA 3LTYA 4M29A 3D47A 4LRTA 2VEMA 3BUVA 5I7GA 3DFNA 5BYWA 2V0TA 3GVQA 5FAGA 3CAWA 3H2CA 3NZRA 2JKEA 3D3FA 4MB1A 3HGOA 1MDLA 4KIEA 1DE5A 2GR3A 3KCJA 3WD3A 4H4ZA 4I7WA 5I09A 3ARXA 4NF7A 3V0TA 5CKSA 5M03A 3TV8A 3UXKA 4DJDD 4J3ZA 3E0WA 3SJNA 1JNEA 2QCNA 1HJVA 3NO5A 4E4UA 3KHDA 3NQBA 5FEZA 1O6IA 3MYPA 2X99A 2FVLA 3VIMA 2XM1A 4UQDA 2DJXA 2DPEA 1ITCA 5DT7A 1AUSL 2DZAA 3OLDA 3VKJA 4BS0A 3W7HA 2YKKA 4FLOA 4PUDA 3O0KA 5CSYA 5ENLA 2OEKA 2DZPA 3W82A 4G1KA 2VX5A 2UY5A 4XAFA 3G0XA 3EOUA 3W7EA 1E73M 1QO5A 5D2WA 4E4FA 3F5LA 5FS7A 2Z29A 5MHBA 3QQ1A 1XL9A 1GVOA 4GE8A 5LZLA 2BY3A 1K8CA 3K4AA 2WZTA 1E1EA 5EMUA 2CBVA 1DJIA 4ERAA 2NXIA 3UPBA 3OYXA 3T2QA 4CN6A 5D04C 1W8SA 2P8BA 2Q3RA 3IIXA 2ANUA 3FGCB 2V5CA 3MHFA 4JY9A 3EWWA 2J8GA 2Y8KA 4TVDA 2HISA 2EJ1A 4BY3A 4EX4A 3LM7A 3SQLA 3QTGA 2OT1A 1PX4A 3I4EA 2YIHA 3W3OA 1ZL1A 4WRHA 3W84A 2VFFA 4UQCA 5KZ6A 2BBFA 4C6CA 3WJWA 1C8YA 1SFSA 2FZNA 2WSQA 4PN2A 4CCCA 4L64A 3DC0A 1R47A 2AAAA 3HPFA 4HPGA 1Q2RA 2GGHA 4UTUA 2ZX7A 1XCFA 1EJWC 1VFUA 1MXGA 2Z4GA 2QPUA 3WENA 1CBGA 4CQ8A 3Q58A 2CLHA 1V59A 1XQKA 2QPSA 5KVHA 2ZE3A 3LV5A 2P0IA 3KCLA 5CZ0A 3R10A 3FY1A 4TVCA 1IEXA 1NP2A 3W7JA 4FR6A 3MI2A 4D1JA 1SSDA 1WZMA 4URIA 2PEVA 1XSKA 3NGFA 4IZGA 4C7DA 3TROA 1PWLA 1KBBA 3I3BA 3CK5A 1FHUA 1XGDA 4JCLA 3PF3A 1QATA 4CU8A 1R9ZA 3E2QA 2WWCA 1TKKA 4LS0A 4YPJA 4TU1A 1Q1WA 4JTLA 4IFKB 2ZOXA 3ARWA 4HNNA 4W7VA 1UD4A 3OA5A 1W1VA 1HVXA 2VUNA 1M9HA 4ENLA 3C86A 3WQVA 5E9XA 1ZS2A 4GRSA 1RVGA 2ZYFA 2E1WA 3WLLA 3HRDC 1HN1A 1PPIA 4W8AA 1SW7A 4N4PA 4H9VA 3I3EA 2DGAA 4IPLA 3O3RA 2HVNA 1XLGA 4CKQA 1D2KA 1PS9A 4AG0A 2PTDA 2ZUUA 4M80A 1JFXA 1UR3M 4PMDA 2A21A 3WLPA 2Y63A 3B8WA 3B0YA 3U8GA 1YXDA 1BXBA 2IS7A 3U3HA 4DJEA 4F2TA 3BLEA 1BEUA 3WMSA 3K5XA 4C6DA 1VPYA 3VZYA 1E0WA 3UGVA 3TTSA 1WP6A 3DH7A 4OTKA 1A49A 1KW1A 5BCAA 1L8NA 5HAOA 4BV6A 3NYDA 2WP5A 4WGXA 3TONA 3N1AA 2EPKX 4IG2B 3WDJA 2JFEX 1WDQA 1XIIA 3CWOX 5LA0A 1C93A 3NVYB 3DENA 4KF1A 2E9MA 4EAYA 3NZGA 3WQPA 1OHLA 4DO4A 4QNWA 2VHLA 4Q22A 4H4TA 4J7RA 4BFAA 4HZ6A 3UXIA 4GLEA 2YAUA 4PODA 4HK5A 3TW9A 4FK9A 5AECA 4S3GA 2KAUC 3XISA 4FNSA 4CLMA 2XSAA 4EF9A 1KR0A 2JALA 2Y89A 3S2CA 3TQKA 3UR2A 3UWYA 1ZSXA 4CD5A 1H1YA 3FNDA 1VRXA 2SFPA 3QYQA 1IV8A 1Z8AA 3PZTA 4RNHA 5KSWA 4WX2A 1UWRA 1EPXA 2RAGA 1NDWA 3B0UX 4NJKA 1ICPA 2DUZA 2V81A 1A5CA 1QNPA 1XG4A 1VEMA 3WK1A 5A8QA 3VA8A 4AMCA 1OEPA 4F0RA 1HTIA 1W1TA 3H54A 3W22A 2XIQA 2XU2A 1K9TA 4RZ5A 2FTYA 4LANA 2J24A 4QGCA 3SJ3A 5AC4A 3GR4A 3KOWA 1TR9A 4NY2A 3BURA 3AM9A 2DVXA 3WFZA 1UHVA 4RDYA 4IFOA 4AY8A 1DIOA 1P7TB 2V63A 5I3HA 3G22A 2DUAA 1JRCA 1QNVA 5HA7A 1DXLA 2BHZA 3OZYA 4TX6A 4GUJA 3H26A 2VO5A 1W54A 3DG7A 4C6LA 3WDIA 3AIQA 2CLLA 1GOKA 1AH4A 3AWOA 4XO6A 3WBYA 1L2QA 2PGFA 1H1ZA 1LF1A 2R1KA 3OQ8A 2PC4A 1FWSA 4QE4A 1YTDA 4Q4MA 1F6KA 2YW3A 1VFHA 1OYBA 4Y8FA 1OB0A 3VMPA 4UTHA 1OD8A 3THAA 1BRLB 3RIKA 4AZCA 2VD9A 4ZQOA 4HP5A 1NOFA 4L4PA 5C55A 3NQEA 1NWRA 4ZCWA 1WBHA 6A3HA 3GTHA 2OKOA 4H4VA 3ID7A 3EWCA 3GIQA 4ADWA 3EDJA 2E5DA 4O11A 1XRVA 1FFUC 3OBAA 3WQCA 4NVTA 1OFPA 1XANA 4KFNA 5AOUA 3VNLA 2NWRA 3B3DA 3L0NA 2PRLA 4JOMA 3IACA 4GYPA 3VZZA 4QLKA 2Y70A 4YN5A 3L4WA 1J93A 1YE6A 3LERA 4UMCA 2PWVA 4JEQA 2GFTA 4TO8A 5LNVA 2PDFA 3MS8A 4HYWA 1EJUC 4JN6A 2HZGA 2C3CA 3QXBA 1Z9AA 3PPFA 1RHCA 4WQ6A 2ATMA 5I6SA 1XIGA 1JCNA 3GVGA 1A53A 3G6MA 3IJ8A 3WL1A 3MB9A 3PJWA 1GZ1A 1LBFA 2VRQA 1WUEA 1T5AA 2Y8VA 4W7UA 1CLXA 1L2UA 4M6UA 1NDAA 4PB4A 1T99A 3M7SA 3PN8A 4JIHA 1S5TA 1BTCA 1VCFA 4ACZB 1B3VA 4G7FA 4O18A 4NAFA 2BNJA 4ICCX 2V3BA 5FD0A 4Y8EA 3VKDA 3RLUA 5K9CA 3WNOA 2QPXA 3P0WA 4G7EB 2WMIA 1Q13A 3DHFA 5FCZA 1A5OC 3OLGA 1T96A 1SGJA 4CVWA 3USZA 4JQ9A 1OC7A 2W6RA 3SO7A 1RP9A 2WZMA 1BYAA 1TPDA 3W07A 3TR9A 3TJ4A 3COTA 3NQFA 1V02E 2NX9A 1EZ2A 4B4FA 3PAJA 1GJWA 3FVDA 5K9XA 4AWTA 4ZFMA 2D20A 4R85A 1TVNA 4GA8A 3NYZA 3CGTA 4DPQA 1ME7A 1M01A 4UFKA 3NA8A 4LA1A 2WBKA 3M43A 1WOBA 4UOQA 1R5YA 4RZBA 3B8IA 4FNRA 1DHKA 2AQOA 3O16A 2PODA 3APYA 1Q85A 3CL7A 3M5VA 2VZUA 4A3YA 1H7OA 2JKAA 2X0YA 3KRUA 4EWJA 4FR1A 3LN3A 3CWHA 4GGBA 5A6BD 3ZM8A 3LRMA 1F3EA 3W01A 3WG6A 3TEVA 4W93A 2G3JA 3S47A 3FJ4A 4FI4A 3UZJA 3B4YA 1XBYA 1O5XA 1SZRA 5TD4A 2RKXA 3B8UA 4HPJA 5EFFA 3AXKA 5BRPA 3VCNA 4TMBA 3IPWA 4U4MA 3CZGA 3UWVA 2CETA 4YL2A 5GJMA 1Q6DA 3SGUA 1F6YA 3GNOA 2PDKA 1F3WA 3B05A 3DECA 4JX5A 4HB7A 4HHLA 3WF3A 2OSXA 3M0YA 2QAEA 4J57A 2O4QA 1GYLA 4DF0A 4CN4A 2CBIA 2ZUTA 4K8EA 1Y8BA 2VEIA 3MCNA 3TSDA 3CUIA 3HURA 1BXCA 1R86A 3WQDA 1D8CA 2RABA 3AIUA 3HJZA 3Q67A 3WK2A 2INFA 1UCWA 4MF4A 1VFFA 4H4WA 3TWAA 1QWKA 3EMQA 4H8VA 3N12A 4Y9MA 3SCSA 1SO4A 4DUXA 3ETRB 2GJPA 2WNQA 2PDIA 4C7FA 4H9MA 2ATSA 4DBWA 1JGIA 2X41A 2X30A 4N9BA 3EB3A 4V28A 2Q01A 1HJUA 4LNCA 3GG1A 3W9ZA 1TV8A 4IUGA 1V6TA 1MNZA 3H24A 4L65A 5LGZA 3UESA 2QJMA 4UTKA 4LUTB 4DZIA 3VD3A 4UXDA 4MY9A 3QSRA 4KRTA 5G4WA 4R5EA 3DG3A 1CENA 3VC5A 4LUJA 3GVVA 2EBNA 1RQHA 5DLCA 1IWPA 2BVWA 3T6CA 5PTDA 3KRBA 3RU6A 2WMFA 2VWSA 5D2TA 3L21A 3FSUA 3SCNA 4MZ1A 2BB0A 4NJIA 3QJAA 4JN7A 3PFMA 5H2ZA 1TIWA 4F4RA 2DSWA 4Q4RA 5CC5A 4LAUA 3GS6A 4Q8UA 4K37A 2XHYA 3MSDA 2I7GA 3EX2A 2AGTA 3L4YA 1HUVA 5A6SA 2CIPA 2ODOA 3TN4A 4H1ZA 4OOZA 1DPMA 4WY0A 1UD6A 1LUCA 3VGGA 1OSEA 3BK0A 3GBEA 3G1SA 3IJ9A 5HINA 1ZZMA 4H7ZA 1POJA 1KD0A 4KCVA 1OABA 2W91A 2WPBA 3IJQA 2HNHA 3TZFA 1VCGA 3ZLFA 4BR1A 4M0XA 2YBTA 1B3OA 2BLEA 3GDMA 4HOZA 4BEQA 4G1NA 2VX4A 2PWFA 2GPTA 2XGZA 1FCBA 4F0LA 1TYPA 2GOUA 3JUGA 3MWAA 2WKLA 4X2RA 3CUFA 2GJRA 3CYVA 5DEZA 3MCMA 2HJPA 4ERIA 4QDPA 2F8QA 4AU0A 4NX0A 1VLWA 2FKPA 4IGHA 3RPMA 3SIMA 1N5WC 3PTKA 3E2RA 3VE9A 4B5SA 3DJJA 2OB3A 1XLMA 1CI1A 5AYXA 3A47A 2QGHA 5M3WA 5T26A 3RCMA 5DFAA 4IWWA 2OLAA 4O1FA 4DNHA 3PG6A 2RDXA 1SQ7A 4FZIA 4DLMA 3QVQA 5CPSA 4JS3A 1OX5A 1BSIA 3WMLA 2GUBA 1AJZA 1A3XA 3RILA 1XGEA 1GKRA 3SDOA 2PDBA 1G4PA 5BMWA 2NW0A 1VH7A 3BAXA 1CWYA 2QUVA 4UR7A 4IGNA 1KRMA 3RN6A 1E6RA 3SCWA 4W85A 4WDWA 1W5NA 2WC3A 1ZJHA 2TMDA 3P60A 4M56A 2PDMA 2VCCA 2C71A 1DXEA 1PYMA 3EOOA 2OO6A 4UZSA 2GR2A 3SIZA 4JZ5A 5BU6A 5JCMA 4IMFA 2PS2A 1JCTA 2PRMA 2ADAA 3NDZA 2DH3A 1K03A 3ZOAA 1J9YA 1OY0A 4ZBCA 2X8HA 1EEPA 5FJPA 4TQTA 3BG3A 4D8ZA 2P53A 1JRBA 1G94A 1FQ0A 3W88A 3BW4A 1W8GA 3R94A 5H8PA 1B54A 3OP2A 1S2WA 3THDA 4IUOA 5EGRA 2ZRXA 4P8XA 2D0GA 1RSCA 3TVAA 1ZDLA 4WOZA 3L7RA 3WJZA 1R3QA 1RA0A 8A3HA 4MIMA 2ON3A 1AD4A 3CV1A 3N3TA 3OB8A 4ZQCA 1FWBC 4AZ6A 2C79A 2FFCA 2ZWYA 3OLEA 3QPEA 4KCWA 2DSVA 3DXIA 1DJQA 3EDFA 1LT8A 4H83A 1UIPA 3N73A 4H9YA 2E3ZA 3LI1A 2DSZA 3WF2A 1QOPA 3R2GA 2H9AA 4MNLA 5FF4A 3HGSA 2BOGX 1O94A 1J6PA 3AZSA 1LPFA 4U33A 3WCZA 1V77A 5FEPA 4UFLA 1UKOA 4CQBA 2NVKX 3DFTA 3FIGA 3URQA 1YADA 4C6OA 3IEBA 1NPXA 4PR4A 4B2DA 2DZWA 5JIPA 4IMGA 1UKSA 4V1YA 4Q4PA 3LSBA 2ICSA 2VOTA 4ZXLA 4UTFA 1YBQB 2C16A 4FX8A 2QJNA 1YRRA 5EKYA 3CL8A 1PX3A 5EMYA 3DHDA 1EX1A 1F76A 1L8PA 4IP7A 5CGQA 2QEZA 1WCGA 3V0SA 3ZT7A 5AY7A 4IFRA 3EWZA 1L6GA 3RPTA 2IUZA 3H53A 4N6EA 1PO9A 4J3SA 1DJYA 1X6UA 3GLCA 1TFVA 2OX4A 5EBKA 1V5XA 3RX3A 3ZSSA 2W67A 1P0NA 2OYKA 4P7OA 1DIDA 4IIFA 4N2YA 3HG4A 4RE4A 2DSUA 2QV4A 4JHZA 2IKIA 3NNTA 1J12A 1FO4A 1PKYA 3VIFA 3R8HA 1DQXA 1NOWA 1Q4NX 3PBWA 5HNRA 3QHMA 1AD1A 3RRXA 3L5LA 4AW7A 3DK8A 4U2ZA 4UCGA 2HSAA 4M24A 2I16A 4AD5A 1M68A 3GY1A 4US5D 1ISWA 3M0MA 1MEHA 1OCBA 1XHGA 2QQ6A 3EA2A 4FXRA 4IQEA 1ZJIA 2YOCA 4GISA 4AIUA 2PTWA 4IP5A 2QUUA 4MWAE 1QPQA 5DN1A 4B9ZA 1LQ0A 2QIWA 3WLHA 4MM1A 3TW6A 3TU9A 1OX4A 3HMCA 4LUSA 1RPKA 4NZ5A 3UGRA 1ISZA 4AQLA 3AMZA 2FJUB 3U57A 1CCWB 3LV6A 3HQOA 3T05A 4HCHA 1VEOA 1UPPA 3XIMA 1XHCA 3NQDA 3S9YA 2YYTA 4E2DA 3QRHA 1JG9A 4XTIA 2TAAA 3OODA 8TIMA 3V1PA 1V79A 3W6LA 2GR1A 3N9KA 2QCGA 1Q6LA 4B5WA 1EQCA 4TTUA 4FPSA 1WXJA 3FJ6A 3NAVA 1SR0A 4PTWA 1OJXA 2ZZ2A 2PD5A 1QR7A 1IEWA 1MI3A 5DY3A 1FWFC 1GRGA 4ZSTA 1TMHA 2J4GA 2WO5A 4F48A 2ZZ5A 4C65A 2DT1A 1QNSA 1J4EA 1BHGA 2ACUA 3KXQA 4JY8A 3M5YA 1UA3A 3KOXA 2VOMA 3C0JA 1ZP3A 3W71A 1F07A 1ZY9A 4LC6A 5BRBA 3APTA 2OLHA 2DV0A 3M9YA 4MOZA 3IK2A 1V0LA 4F0KA 5CJNA 3QF0A 4V2XA 4AEEA 5AC7A 4J1OA 3CUJA 3CUZA 3SQSA 4YTSA 1QI4A 2YL8A 3HQPA 2O9TA 2CNCA 2WOVA 3UCCA 4WSKA 1GW9A 2BWGA 3SEPA 3VKKA 4DRSA 1SZFA 4IQDA 3IVSA 4GOAA 3RM4A 5EA9A 4Z1YA 3AIEA 1RK6A 1JCXA 1I1WA 3DN5A 3VAVA 4RDZA 1DWFM 2Z24A 4QE5A 4GC3A 4GD0A 2W79A 4U10A 2X05A 3RMEA 4D6GA 3W1PA 1OVDA 1YTEA 3AI0A 1SPQA 1FWRA 2PZNA 5A8NA 4UIOA 2OMAA 3L4XA 3IIZA 3S2LA 3G1AA 1WXZA 2W5FA 1TVLA 2EPMX 2CERA 2HS6A 1RUSA 1GG1A 4W86A 1FUYA 1LL6A 4JICA 1NH6A 3O06A 3NQ8A 2JBMA 3VM7A 3CQHA 2OELA 4WKFA 2NQLA 1HP4A 3BAYA 4DX3A 3FSTA 3BMVA 3O2LA 1WXYA 3N6JA 2A0NA 4G2DA 1O66A 2HV5A 7TAAA 3BQ5A 4JQ1A 2YLAA 4OU1A 3KRZA 3WKZA 1ZHAA 3W74A 1W5QA 3G2GA 4MDPA 3B03A 1TRIA 2ISVA 5CPMA 2VR4A 1ZU8A 1AA1B 2FZMA 3E0FA 3SW6A 3R12A 3WL0A 3O07A 1VQZA 5HANA 1JI1A 4GO8A 2R82A 3P2VA 3RR4A 4ZTYA 4D72A 4KWOA 1BVNP 5BOEA 3QM3A 1H62A 1EGVA 1CTNA 3WNPA 1E9YB 3V36A 4AWSA 2PTZA 3V3WA 1W2PA 2J7GA 9XIMA 3IAPA 1VJZA 1E1CA 3AYSA 2GLKA 3IGUA 2MNRA 1WNOA 3VTRA 3FYOA 2FVKA 5BOFA 1AZ2A 3L4UA 1SJAA 4PEEA 3FYPA 4AWUA 1QW8A 5K3VA 2OCZA 1NHSA 3EPMA 4IXHA 1E9IA 2AOSA 2VR2A 1DV7A 4KFOA 3SCUA 4EXQA 4FS9A 1O1HA 1WKFA 2A3CA 4NZFA 1XX1A 2O9RA 4XD5A 4S3DA 1G7UA 2E6AA 2DZXA 2E0PA 4DELA 4DQWA 1G9HA 4LJ3A 1PTAA 4IPNB 4UBPC 1ADDA 5H1WA 1J18A 2WZIA 4GCAA 1PTDA 2G97A 2R14A 4UQ9A 3TOPA 4ZO7A 2QR6A 4G56A 1UWUA 2WB5A 4UTTC 1XLJA 4OECA 1GQLA 2XJ7A 4IISA 4MWAB 3LLFA 4W84A 3CL6A 3SB0A 5D05A 2QNEA 1OGSA 1PYFA 3BSHA 4JQ4A 2WCAA 1XG3A 3O6CA 1JGMA 5HQMA 1XYBA 5AHNA 2Z0IA 1MZRA 2B7PA 2PI6A 3RAOA 1CGUA 3WJSA 2QT3A 1OT1A 4GMEA 2XDFA 4GNKB 4HQVA 5E1QA 5A95A 1K8YA 1P6CA 3W1AA 2GVLA 3LXCA 3KP1A 2OZ3A 1N55A 3P80A 3PANA 3M7WA 2PPGA 4U2YA 2ZIDA 4ZZ9A 2A8XA 2NLIA 2PLMA 3O6YX 3DFQA 3R43A 1A5UA 3ARZA 4RK8A 3STEA 3T81A 1ONFA 3HG2A 5FS6A 3OYZA 4PYSA 1H6VA 4KQNA 4LBRA 3PUEA 2FTPA 4AF0B 3G1DA 3VIJA 3OPSA 2BGSA 1SU5A 1LRNA 3UWWA 3MKKA 3W70A 2ZADA 3FA4A 1XPGA 3TJXA 2WXDM 4DAFA 1UR1A 5IDIA 3VOGA 1P43A 3K8KA 4D6DA 2EQDA 1Z48A 1EWEA 1UD3A 1UWQA 4KPRA 2Z2AA 5IFTA 1UMYA 4PRRA 1THFD 2XPKA 1GOOA 3DAQA 4OBSA 3F7JA 2UZ9A 1ODZA 4WXYA 4C1NB 3P93A 3QZ6A 4FIQA 2J6VA 1U5VA 5BOOA 3GHTA 1SJDA 1MW2A 2ZRUA 4PCSA 4UWMA 1UG6A 2OOFA 3IGXA 3GKAA 1J2WA 4NNAA 1X98A 2PMQA 2FZBA 1EGMA 1KRAC 4CQAA 3TDFA 3W27A 3MDUA 4AHQA 5C71A 2YBUA 3WF4A 2DY3A 1LWJA 5HNUA 3G3DA 1JCMP 1GQNA 1R2TA 4MVAA 3MMWA 3NQ2A 4D8AA 5D8ZA 4WK9A 2V2HA 4DJFD 5FS9A 3HFTA 4X60A 1PZ0A 3H2AA 1R3RA 3W7GA 3F03K 3CGCA 1B0IA 1HW6A 4YWIA 3ATYA 3WQOA 4MFEA 4S23A 2DDXA 1KXTA 4HYRA 3MBFA 1L6FA 3AS2A 3HV8A 2GGIA 5LNSA 4R34A 1HXJA 1M7OA 2X1RA 1PJ9A 4W9TA 4IL2A 3BMXA 3OGVA 4ZENA 4MZ8A 2HE8A 1B4KA 4Y9OA 4MY8A 3UNTA 5C6MA 1JF5A 3IUHA 4DBUA 1TR1A 1F8IA 2VC9A 3W87A 2C7FA 2J27A 4Y7EA 3SCOA 4JDBA 2B7OA 3L65A 2OSYA 2WWDA 1HF6A 2BY1A 1B31A 1FWCC 4JFTA 2ISSA 4DWDA 3ZR5A 1NM9A 1V03A 3O1NA 5KITA 5GRTA 2XFYA 5CC6A 3WBEA 2DT3A 1E15A 1N5XA 4DUWA 1V97A 2B0MA 2VZTA 4CN1A 3ARVA 2VC5A 1Z3NA 4GY1A 1KLYA 1R0MA 4UTJA 5HWMA 2D3NA 3MMDA 3A12A 4PSPA 4BF9A 4KFPA 4MSSA 3F2DA 3CEUA 2DT2A 3R79A 3KVJA 5A2CA 4IH3A 2QV5A 3AIWA 1P6WA 3VVGA 4HK7A 2P3ZA 3SY1A 3TMLA 5D8WA 2BOFX 5LIUX 3S3GA 3W7RA 2I14A 2OFJA 1KBKA 2QS8A 4H6RA 2WPGA 4A8LA 1EJVC 4FALA 1BGGA 4MJ4A 2HXUA 4L6DA 3AHZA 3ARPA 5DF0A 4O16A 5DRIA 2LLEA 1PDYA 3UCDA 5U4NA 3CHEA 1F4AA 4XSLA 3GXIA 2WHLA 3S5YA 5DCDA 3BL3A 2CLEA 1PXGA 3HO8A 4AD3A 3UZ5A 5F1UA 3PAOA 1FHVA 3WMBA 2G5WA 1B9BA 4C6BA 1MDRA 3VO0A 4LT9A 1SZGA 4L4MA 2IPWA 3EB2A 1PB0A 1UP3A 2C3ZA 3KOYA 1NDYA 1JL8A 2J3NA 3RLVA 1IXOA 4N6FA 4BI6A 5BMXA 2O9PA 2A7RA 5G5HB 2TODA 3FOKA 4EIVA 2QUNA 2QVNA 2J7BA 1XP3A 4DXXA 4HYVA 5I0DA 2BXVA 4NZ3A 2FGBA 2A4AA 3CASA 3USBA 3TCEA 2WCSA 3FHQA 2YVFA 5A3HA 4J3UA 4JXCA 1E71M 4AZ5A 4MJ2A 2O55A 3ME3A 1EC7A 1S2VA 1QBBA 3GFYA 4S3BA 2DZUA 2Q71A 2AQWA 4NIRA 1XBZA 4DLFA 4LF2A 4ERGA 4Q4OA 3KL3A 4HNCA 1BKHA 3L4TA 1VFMA 4B91A 1JUKA 2H6RA 1FDYA 3SECA 1FWIC 4HVXA 3HB9A 2VCAA 1HIZA 1TCMA 3LS9A 5H91A 4M6PA 1ZNNA 2WZHA 5E0FA 4AWEA 3OGSA 3PS7A 3H2NA 1GPWA 4XG1A 3KCOA 3MC5A 3PBYA 4AEOA 3TSBA 3URHA 1E0XA 3L9CA 1TSIA 3S8HA 2NXHA 3GXMA 4JYEA 4GUGA 4N0RA 1E6PA 1ZK7A 3U2OA 1CGYA 4NEVA 4MPKA 3LUTA 5C54A 1FVPA 1ODUA 1XKYA 2Q6ZA 1FKXA 1RQBA 1EDGA 1JYNA 3VOIA 3VCCA 2QF7A 4PH6A 2ZXDA 3OO2A 4Q8TA 2PCQA 3T4WA 3CZ8A 2ALDA 3C52A 2ALRA 1T0OA 3FJLA 3PBVA 3T0CA 1JYVA 2V67A 4ICNA 3N6HA 1C9WA 3MUZ1 4ALDA 1KQZA 3LK6A 3T8QA 5HNTA 4W87A 3U2EA 3FAXA 1US3A 3N2BA 2WMJA 3LBCA 3TE9A 1AK5A 3SN4A 5CZSA 2ZC8A 1O5RA 3T78A 3VPLA 3A7UA 3QR0A 1R3SA 1C29A 2PWDA 1C91A 1IZJA 1Z42A 2DORA 2XIOA 2AAMA 1WX0A 3CO8A 3EB4A 1TPWA 4QIUA 1HL8A 3O9NA 1QAPA 3BXWA 2VURA 1EHAA 3F4CA 4BQ5A 1UUQA 4CNOA 4Q7NA 4BQ4A 3OG2A 4PUUA 3RNDA 3LX9A 3N04A 1UKQA 4GY0A 4PBGA 4DYEA 1JXKA 3IWPA 2E09A 4X3ZA 1O5QA 3PZIA 4Q4KA 4NHVA 2VR5A 2GQWA 3NVDA 2FZDA 1Q7QA 2VD8A 4JD4A 3THQA 2OXNA 2C1GA 2VENA 4NXKA 4Z42C 3NXFA 2YL6A 4LYPA 4LB4A 4XZIA 4GI8A 1J6OA 5J8LA 4DUOA 3PK7A 2QAPA 3MUY1 5L9FA 3UU0A 4DEFA 2UY4A 1KM0A 4PMZA 1UC4A 5JMUA 5FEXA 8CGTA 4Q3MA 2CLOA 2F5ZA 3SQMA 3IAQA 1PX8A 3A5VA 3LHUA 4WHBA 3VDCA 2J9XA 4KGJA 3FJNA 1FBAA 4GI9A 3O63A 2A3AA 1MW0A 4E3VA 5HQLA 2ISDA 2WBGA 2WMGA 1XWYA 4AZ7A 2J7EA 1ZMCA 5HNNA 1UR2A 1CT5A 1TV2A 4GH1A 2PDJA 4HOWA 2ZRZA 1V8EA 4LS1A 3GM8A 2Q8ZA 3PBUA 4IJRA 3VNYA 6REQA 3W0KA 3AMLA 4RJEA 4UR8A 4PUJA 1BFNA 4Z1DA 2BVDA 2Z6JA 3NVTA 2RGMA 3VD5A 3G5EA 5EY5A 4YCOA 1ADSA 3WD0A 1EOKA 3KVLA 3C0LA 3K2GA 4EQWA 4FLSA 3QC3A 2DIEA 4GH3A 4D6FA 1DJXA 4I6KA 5JUVA 3EWBX 2V30A 4AZCB 4RNFA 2XFFA 2YDSA 4PCFA 5EMMA 4UTLA 4AB4A 2XFRA 3W1RA 3CIVA 4UZUA 2QUTA 1G4SA 3M0LA 5F2MA 1RLDA 1QNRA 2IPGA 3A4XA 4F79A 3FVMA 2PWHA 2WC7A 4GXWA 3F4VA 4YXGA 2VX6A 2V6OA 3RPDA 1JDAA 4PTNA 3A24A 1PL9A 3PZQA 1U5JA 1VYRA 3PZMA 5TIMA 2OG9A 5I07A 4QG6A 3WEZA 3ZSTA 1UC5A 1XYFA 1CLVA 4A22A 3UPMA 2QMJA 3OZMA 3LM3A 2YW4A 5CZTA 4QNEA 4PMRA 3S1WA 3ARTA 5CPQA 2YA2A 1GWJA 2NQHA 3BGAA 2PU0A 1G4EA 2CESA 4Y6GA 4EQSA 4O4WA 1V3MA 4Q8MA 5JCNA 1MRAA 4ZXOA 1M7JA 3GVWA 1JZ3A 3A3XA 4S3JA 4M3PA 3KVMA 3WQ4A 4FNPA 3G8EA 4N9DA 4X0VA 3FN9A 2ZC1A 4AD2A 4NAFB 1X6NA 1HZYA 3KWSA 1NP0A 2D0FA 4JTQA 1JD7A 3B0XA 2WAGA 4D9PA 2R1NA 1HJQA 1MEWA 5A69A 1GHSA 2V5LA 2XSXA 1TJ1A 2WMIB 1KGUA 1K1DA 1P48A 3GNRA 1NHRA 3H2MA 3F1QA 5AC5A 3LCHA 1KM2A 1TO3A 3UXAA 4X63A 4H4UA 2GGGA 3SGZA 5EMJA 1RD6A 3CXOA 2VI0A 1NDVA 4GHRA 3VIGA 2XYLA 1UA7A 4MKVA 4V33A 1MVYA 4MJZA 4DUVA 5D2XA 3MU7A 3EPNA 4JCMA 1C9DA 2XH0A 3URAA 1EQPA 1UZHA 5HQEA 2VC7A 4ZO8A 5ECUA 4HNLA 3GG8A 4GK8A 4KWVA 2GJLA 1F6PA 1V6YA 1OC6A 4GNVA 4UUIA 5AB3A 3L8KA 3BARA 1KFJA 1H5VA 4MKSA 2BFGA 2R9ZA 3UFYA 1JJKA 4EXAA 3ZJKA 4LY4A 4O57A 3MP5A 1ICQA 1Z44A 3WK0A 4OBRA 4HNVA 2FFIA 4PCPA 4I9MA 4QR6A 3W2MA 2DIJA 1DKWA 3ZO9A 4QE1A 1U1HA 2ESCA 5I03A 4V1XA 3NPVA 4W8BA 2AGKA 4AIBA 1ZBCA 2V3GA 2QDHA 3L2IA 3HU7A 2DT0A 2CLFA 1NHQA 2XWDA 4B4HA 4WJ8A 1E1FA 2QCLA 3W53A 2X16A 1SZNA 2ZXQA 2YDRA 1Q5MA 1E5JA 5BROA 3P6LA 4NYYA 3GU9A 3V35A 3ZJ8A 1OG6A 3V5FA 1JZ8A 3UWEA 3ITTA 1E6SM 3FHAA 1O5KA 1AQHA 1R8LA 3LPFA 1V0KA 2EQ7A 2Z28A 1T3QC 3E96A 2X1IA 4CQDA 4RUBA 3DHPA 3IVUA 1KM1A 4I5UA 5A8OA 3FX4A 3FV9A 3GXPA 4PMOA 3PJTA 5I78A 1ZBWA 2CXGA 4H9XA 4KBXA 1KXHA 3S5SA 3LNPA 4LX4A 3STCA 1JCJA 5AC8A 1X8FA 2J62A 5TBOA 1GSNA 4IOTA 4ADSA 1SFLA 1X1ZA 1ESWA 4RNIA 5FJIA 4RL3A 2Z2UA 3IARA 3WDHA 1JDCA 1T7LA 3BAWA 3H12A 3TLLA 4BF5A 2Z00A 3EWYA 2Y88A 1W1PA 4GKLA 1J5TA 1BAGA 1QPKA 3P62A 5G1MA 4OJYA 4DYJA 3A3HA 4B16A 2TYSA 4LS2A 4JKMA 4FEZA 1PHQA 5T9CE 5F4XA 5FIPA 1BF2A 1H2IA 4E5TA 2ZWZA 3DCPA 4GYPC 3FKKA 3VOFA 3VIIA 1H1NA 2QCDA 4KWWA 1LOQA 2ZZ6A 1ISYA 1EDQA 3FK4A 4K38A 1GJUA 4O28A 3AYVA 3GNPA 3AISA 4FAMA 3REQA 4K39A 2HS8A 2C13A 4H4XA 3IK4A 2X1SA 2D24A 3U2CA 3EBVA 4LV4A 4XD6A 3ONCA 3DFSA 1UR9A 3VDAA 2Z26A 3PNZA 4GPNA 4XIMA 2R6OA 3GAKA 2VZVA 3AC0A 2HPMA 2BGQA 3K30A 3BLOA 3C2RA 3KBSA 3PHAA 2Y6ZA 2OKTA 3OGRA 2Z25A 3W81A 3E5PA 3W00A 1H4PA 2ZZCA 1A47A 4WY0B 2ASHA 5LNWA 1AFSA 1LUCB 5D2YA 3R0DA 5TNVA 1KM6A 4CQ9A 2VRKA 3UEQA 1NQ6A 4P8VA 1JYXA 3ZS4A 4P7RA 2PLCA 1JDDA 1JPMA 3ITVA 1JIBA 4LC8A 1M41A 3E74A 1CGXA 1GJPA 5FMHA 4WOQA 3GRIA 5FSDC 2WHKA 1CIUA 1AQ0A 3BSGA 3IRSA 3UF9A 1WZLA 4JTKA 3NSMA 4F0SA 3T0BA 5K9DA 4GABA 3MUXA 3E6EA 4QJ5B 3O15A 4HN4A 2HVOA 1FH7A 4AXKA 4A21A 1QO2A 2X0SA 3D9XA 4JTAA 5KZDA 1L0PA 4L6OA 4W7WA 3GW3A 4ZR8A 1XC6A 2PDHA 4AYGA 4W8LA 4OHQA 4KGLA 5A2AA 2XUCA 3NZ1A 4GX9A 3PUOA 1LVLA 7ODCA 3DFYA 2ACQA 1YPFA 5U7SA 5HPOA 1IEQA 2OZ0A 4PBEA 3GTXA 3W26A 4EWND 3LTPA 3TSMA 2J8TA 1UR8A 5L6UA 3KZSA 3B4UA 3LCWA 5CGTA 1S7MA 5I3KA 3UBPC 4UFJA 2OZTA 4XUGA 1VIZA 3A6OA 1M04A 4TVYA 1TUFA 1XRSA 1RPXA 1R46A 4D6IA 4XWUA 3T9PA 4KETA 3SN0A 3V5CA 1A50A 4LVBA 4EVZA 3TTEA 2A3HA 1ZQ5A 9CGTA 1P1XA 3L23A 3CPRA 2DUXA 3ZT6A 1SYTA 5H6HA 3R1ZA 1JNDA 1IR2A 4MDOA 4B3KA 4DM1A 3A3WA 1S39A 3BJTA 4W5UA 4B3ZA 5CBBA 3KLJA 1Q8AA 2PAJA 1LLOA 2TSYA 3VUPA 2PP0A 1XS2A 2XN1A 1XLIA 3H7VA 3U5UA 1IR1A 4B5TA 3ITOA 2BHYA 4HGXA 2E68A 4L1GA 3V4BA 4EKJA 3CT2A 3PTDA 1H50A 3HGJA 1UYQA 3IJ6A 3TR2A 3VIHA 1IGSA 3GDRA 3KBVA 3IVTA 4P5UA 2WW5A 1U33A 1US0A 4CCDA 4F9DA 2E77A 4Q7BA 4MWAD 3S9IA 4LEQA 5K2ZA 4RDWA 3QV7A 4BK9A 4A8IA 4AHPA 3H2FA 3N14A 1FA2A 2W92A 1DIEA 1Y5XA 3SM0A 3SGGA 1FEAA 4LYKA 1RBAA 1UB3A 3QFBA 1OZMA 1KTBA 4KH2A 1VB9A 1A3WA 1CEOA 1XDMA 1DBTA 2H9AB 3W1NA 5LKYA 1KA9F 2ZICA 3LCLA 4K8DA 3TX9A 1WPCA 4MY1A 1MYRA 2ZUSA 4DZ5A 1R2SA 1DTUA 1LBMA 1OZQA 1QWGA 3A4JA 1K7XA 4BA0A 1Y65A 1FWEC 3UZZA 4EMWA 2BSLA 2VDHA 1DWGM 4QSHA 3BPWA 2G8ZA 1VR6A 1XFCA 4LRSA 2Q8LA 4YTQA 3LU2A 4WXZA 3UY7A 3MKVA 3WQ8A 5HMDA 2W3ZA 1YYAA 2X8CA 1W1YA 4GINA 3B9AA 2BXYA 3AXXA 4QXIA 4O54A 1GQIA 3ARSA 1MQRA 3AS1A 3K8LA 1RY8A 4R27A 3CMFA 3RJYA 1AJ0A 1BWKA 4TTGA 1VQTA 2YYUA 2W9MA 3AXHA 2DVTA 1GVFA 3WLKX 2F6UA 1MNSA 3BQ6A 4MNJA 3S9ZA 1JPKA 1OGBA 2ZZBA 4AY1A 1VKFA 1WZAA 4JNYA 5J5RA 4WR3A 4HTBA 1ONXA 1W3KA 4FXFA 2PSNA 4PA8A 1EHNA 1TVPA 1YMYA 4OZOA 3WD4A 1WKDA 1B30A 1XM3A 5DO8A 3I65A 2OX1A 2OWXA 3CQJA 4CD6A 2QMKA 5ABFA 3AJXA 1JROA 3S6OA 3DJGX 4O1AA 4CD7A 1TQJA 7XIMA 2TPSA 3TNBA 3N2MA 2UV8G 4GKTA 1LLWA 1XPYA 4R9OA 3OVQA 3WNKA 2ZTKA 4O0KA 5CC3A 4DZAA 1XIBA 3G0UA 3PPHA 4O50A 3SR7A 1GETA 3QBUA 1PWMA 1S38A 4NI3A 3C3NA 4LWWA 3UJEA 4H7VA 3GXTA 3WQGA 3LHZA 4O1EA 1IXPA 1W0MA 3AHYA 4NNCA 2EJAA 4Q33A 1OX4B 1NF0A 4RW5A 4LUSB 1P1MA 4OKDA 4HU4A 3BC9A 2ZVIA 5JH2A 4ICMA 5D9PA 1QHZA 2X7WA 2H3BA 2QYGA 4WZHA 3GTIA 3PR2A 3R89A 3KBMA 1W1IE 2O4MA 1E3XA 2YXGA 2XN2A 2RDTA 3QKZA 1NTHA 3P61A 5CLWA 1GXFA 1F74A 5I3FA 4XISA 5KMYA 3P74A 3KS6A 3E2SA 3Q2DA 1GONA 1UKTA 3L0GA 1ISXA 1A4LA 1MQQA 4IIBA 3TYCA 4GIAA 3GZ3A 4A2SA 1QTWA 3VINA 2FPTA 3CM4A 1DEDA 1VFSA 1F2JA 5FJOA 1V3IA 2YCLA 4R7OA 3GDBA 3ANVA 1AH3A 3HZ3A 2WOQA 2P50A 1FWHC 5EBAA 1GRFA 1V3LA 4O15A 3LADA 3ERPA 3T55A 1F05A 3B9EA 3IUDA 4NRRA 1WUFA 3A4WA 4CU7A 3G1VA 3U5YA 3DK4A 3Q37A 1CX9A 4XZ9A 1OFOA 1ELSA 2VFGA 3R07C 4LF1A 4M6VA 4XIAA 3HF3A 2J8FA 3EKGA 4HNTA 2O9OA 1EF2A 4PUWA 2VEGA 2ZZ3A 1EWDA 3R13A 4A3UA 3UVAA 4FOJA 4YTUA 1IT8A 3U4FA 1K3UA 5F4SA 3NQVA 4J35A 4TX8A 2PBOA 1AW2A 2CKRA 2NQ5A 3QR1A 4GVGA 1BXNA 1TPH1 4JQ3A 1ZENA 1X96A 4CNPA 1XINA 4G7EA 2P76A 3W2NA 3CH0A 1ZJBA 1VJIA 3LRKA 2C6QA 1F61A 2AKMA 2DZSA 1IWBA 2D22A 4QQ3A 2QCCA 5KEZA 2HE5A 2XFWA 4K36A 3ABXA 2CFYA 2D73A 1PE1A 2ZQ0A 1M53A 3GFZA 3SURA 1JQXA 3DGZA 1CYGA 3HTWA 3UJRA 2RFGA 1CW2A 1LORA 5IFPA 1JDFA 5JCKA 2EPNA 2EKCA 2VMFA 2YPIA 2VFDA 3W1MA 3CXBA 1V93A 2R91A 4J3TA 2F6KA 2BTMA 4ACYA 2A79A 3RX4A 3UWZA 3MZNA 3E9AA 1D9EA 1TX2A 1XUUA 5IDZA 3HM7A 1TPC1 1ONEA 1KBLA 3CNYA 1JF6A 3TP4A 1MO9A 4MYAA 4H9UA 1SW0A 5XINA 4HTYA 3GXNA 1HNYA 4GZEA 3BW2A 2J7FA 3LRLA 3M16A 1X6LA 4E2OA 2F61A 2ZA1A 3HFYA 3NURA 1YPIA 3NO3A 4XV0A 4RE3A 2QGYA 1AMKA 3EKZA 1E1CB 2D2GA 4Z0JA 1BD0A 5I3IA 3AYRA 5AYBA 3G3MA 1FFVC 1IWAA 3RLHA 1DTNA 2HCVA 4LU0A 4ZQPA 2PU1A 1QNQA 2X7VA 3P5ZA 4LNYA 4QISA 1Y0EA 3E38A 4G9PA 5M17A 4GGHA 4ZE5A 2VM8A 3VDBA 4DJED 3B9NA 3OU8A 1I6NA 3R58A 5TF0A 4G5DA 3VKCA 4CUCA 2J66A 3B9OA 4JN8A 2XIJA 4B5NA 4D6HA 1JZ7A 1FP8A 2RDUA 1Y5VA 3ZJ7A 1WA3A 1A0CA 3RM9A 3TUUA 1Q63A 1UBSA 2UBPC 3QFWA 4HU8A 3L2LA 4YTTA 4KWSA 4Z2KA 3GNXA 5AFDA 1YXCA 3DBPA 4I8YA 3PPCA 3YPIA 3U7BA 5AYIA 5A6KA 2PURA 2Y7FA 4IX0A 4QAIA 3UG5A 5AVNA 5D09A 4NAEA 4BHYA 4AD1A 3FAWA 1KCKA 4XBKA 2RJGA 2EG6A 5HJYA 1ZB5A 1B3XA 1LDCA 5LA1A 3KBNA 4C6KA 1UOZA 4X9YA 3B0VC 3MUIA 2OQYA 1DNCA 1B1YA 5ABTA 1KBJA 3V18A 4KWUA 4POCA 2YSWA 5F2IA 7ENLA 2GWGA 2PTXA 1LYXA 2J79A 3A7AA 1VF8A 4AH7A 1X38A 5HDRA 4H6EA 3T0TA 1HGWA 1I45A 2ZUMA 1SO5A 3SRHA 4B5XA 1FCQA 3JR2A 5G1YA 1P0DA 5KINA 1OIMA 1K9FA 4D71A 3LXDA 1ZJAA 3MI6A 3KS5A 1LWHA 1Y7VA 3GDLA 1V0NA 1RR2A 1EKOA 3MPGA 2NVDA 1JULA 3BOLA 3UG4A 1TREA 2WMKA 2Y61A 3QFEA 2CZDA 4EM4A 3U48A 3M0VA 4C6FA 5HXMA 4L4LA 2YFOA 3F2CA 3EZ4A 2HQMA 3BG5A 4DYKA 2CKSA 1HJXA 3EA1A 4ZE4A 3CGEA 3NCOA 2GUUA 3BLKA 3ANYA 4BURA 2QLYA 3CHFA 4QTGA 2BDQA 1C8VA 3GW0A 2FGLA 2ZKMX 4OBTA 4HCLA 1RZMA 4WSJA 2WNNA 2JQXA 5F7UA 1GRBA 1J0HA 4DI8A 4RKAA 3UWUA 3VCRA 2BY2A 2D1ZA 2NV2A 3MP4A 2P10A 1A3HA 4AIOA 1H2JA 3CZLA 4Q8VA 1PVNA 3JZEA 1W1B1 3ZLGA 1KV5A 4BI5A 1EF3A 3NSXA 3UXDA 3Q6JA 1T6MA 3W6MA 4JFWA 4A3RA 3GSMA 2NV9A 2JGYA 4TVWA 2YCKX 1ME9A 2PDQA 1JDEA 3VE7A 3SRDA 4KCUA 1QHOA 1W3LA 3JW7A 3HA1A 4YVXA 1PKNA 2BODX 3FXGA 3E5BA 4RXFA 1F4HA 1TZZA 4H00A 2OLSA 4GYFA 3B8VA 2DW6A 5CSSA 2ZZ0A 3C2FA 2BY0A 1LP6A 4D2JA 3FDGA 4PTDA 4PMJA 4XUYA 5LIKX 3MANA 1O1ZA 3PBGA 1XLDA 1AQFA 4U5IA 4B92A 4JFUA 4WY0F 1DORA 2E9BA 3QY7A 3GHSA 4MKNA 2F7FA 4AISA 3LEPA 5XIAA 3IS4A 1EO5A 3H4KA 1UKPA 3L2MA 3POCA 4XSMA 3CTLA 4TVUA 4LVAA 1UPMB 1IEVA 3MSRA 3LB8A 3IIPA 2YDQA 3QV9A 4EAMA 3L0KA 4S3AA 4WF7A 4MUZA 3ZIZA 3T7VA 1YTKA 3BDKA 3KTSA 3LTSA 4PL2A 4GXPA 2G0WA 1UASA 4UQEA 1T8QA 3PUDA 3UWQA 2QKFA 4HCDA 3V0UA 2NT1A 4J5NA 4JIIX 4IMAA 3DYOA 2MANA 3OHMB 4HSHA 4HIBA 2ZZ7A 1KO0A 2ZRWA 3RG6A 4EXBA 2F84A 1PV8A 4M82A 3BLLA 3S46A 1LOSA 1P6BA 2RDWA 3GUWA 4AZGA 1QBAA 1YPXA 3LQGA 3VU2A 4W5ZA 4Q4SA 4L5ZA 3TMQA 1C90A 1S2AA 1VFTA 2ZA3A 3MKCA 3O8AA 1E4NA 2OGYA 4A2RA 1HKWA 1VS1A 1EBDA 3RCYA 4QJ1A 1XLKA 5U25A 5GNYA 1CZ1A 4UNKA 2QCFA 4LPCA 2WNWA 5DCBA 4WUIA 3IJIA 4OVXA 3SFKA 3EX6A 1GZJA 2ISWA 4D8LA 1S3HA 1XIJA 2Y4SA 2DU2A 3TAOA 4TUFA 1EFZA 4ZOBA 1UJPA 2YDAA 2EQ8A 4YLWA 3GTNA 4Z1BA 1OCNA 3QN3A 4YMZA 3QTPA 1KXQA 4NZJA 1TMLA 3QOKA 2TRSA 4QFUA 1KB3A 3IGSA 3GQYA 4GIRA 4H4IA 3WK3A 2PP3A 5D33A 1ZXIC 4HBKA 2YVGA 1Q2SA 3WD1A 3ZYZA 2AKZA 1Q7MA 5BWAA 4TIMA 2XTKA 4DWSA 1S3TC 3RYSA 2HROA 1GG0A 1I2RA 3LENA 1EZWA 1TWIA 2JKPA 1SR9A 4AEFA 3CJPA 3VNZA 4DHGA 1BKSA 1VLIA 3FW6A 1SMDA 3KHJA 2VNCA 1FY6A 2XINA 2EAWA 1GERA 4H9ZA 4C6EA 3GNNA 3NWRA 4GQQA 5EFDA 1GEQA 3R8RA 3BVJA 3KL5A 1GW1A 4MB4A 3OA3A 3DZ1A 2R1PA 4XTDA 3AQUA 4UTWC 3K1GA 1FEBA 3OIHA 3QMRA 4DVOA 1E70M 3GU2A 1FWGC 2IKHA 1IT0A 1RV8A 3Q45A 3SUTA 4U28A 5I3JA 4JDRA 2VYOA 4QS5A 1TG7A 5E9AA 4EPKA 2V3DA 5C7VA 1G1YA 1XLEA 3W28A 3NPUA 3UG8A 2CWNA 2XG9A 2YB4A 1H7RA 2ZX8A 4MLRA 4MADA 3VGHA 4JTHA 4QG8A 1W9VA 1XYMA 1ICSA 3ECQA 4WJXA 4CQCA 3GU1A 3KP0A 2QF8A 4RW3A 5D32A 5DRCA 3VKBA 1R9XA 3RGTA 1I1XA 1DE6A 4WDUA 3F5KA 3T0AA 2OEMA 5C2XA 4WGHA 1KC7A 3K1DA 3UA3A 2OQLA 1HFBA 3S6TA 4WDTA 4QROA 1YDNA 2OYMA 3WUFA 1YKWA 1HJWA 1MXSA 2WVVA 2XGIA 4HPNA 4DJFC 3EKLA 3OC4A 3LGGA 3B9DA 4MJMA 2UY3A 1GPFA 2PC8A 5BXTA 1W3TA 2X42A 1AVAA 1ADOA 2J6XA 3GYCA 1GOMA 3EYPA 1Q6GA 3GRSA 4K8HA 5EPDA 4KS0A 1J0YA 1ZFJA 2G3NA 3BJSA 3GH7A 1GREA 3A5FA 2B81A 4BKNA 3NS1B 3NVVB 1M1BA 1L6SA 4H4YA 4M52A 3NL3A 4QITA 1OFAA 3BGGA 4WVXA 4JDYA 3DFPA 5E5CA 4JBRA 2FH8A 3U9IA 2D2JA 3E02A 1OD0A 2VTFA 1K8XA 4N9EA 4RPQA 1AW5A 1MRQA 1S2TA 1JQVA 3SZ8A 2FPVA 3FYYA 3PZ9A 4ZOCA 2OU4A 3E12A 3LPGA 4R33A 3BZGA 3HPAA 4LUYA 4M5PA 2J47A 1OBAA 4XVEA 3QQ0A 3GRTA 5H8UA 1FXQA 1UH2A 3SRFA 2NPXA 1E6ZA 3T2OA 3Q4DA 3DGHA 3AIVA 1H09A 2CW6A 5ABEA 4QX4A 1AMYA 5GVJA 3C0SA 1JXJA 3UA4A 3HMJG 3FCPA 1FHDA 1Q8JA 1KFEA 4F2UA 2PUZA 1RALA 4C6NA 3V75A 2NWSA 4DBEA 2OVLA 3CHVA 1OG0A 3MY9A 6REQB 1FECA 3WDPP 1Q1RA 4IPIA 4GACA 3LHVA 4GVIA 1W9BM 1F3XA 4UNIA 2I5IA 3V5OA 4HA1A 2RUSA 3QY8A 4MHBA 2YL5A 3NQCA 2WLYA 3DK9A 2REQA 4QRNA 2W63A 4REQA 3H2EA 2JIEA 2FB2A 3DUGA 3PP7A 1G7VA 1XIHA 3JRKA 4O13A 4O12A 4PGLA 1XSIA 2EG8A 2OODA 3WF0A 4PULA 4YTRA 1VENA 1XISA 4Q6XA 4ADTA 2G4FA 2WJDA 2GDVA 2Z1WA 4Q8PA 1IIGA 1J0JA 2DQWA 1I4NA 2NVCA 3K46A 4BWLC 2ZX9A 3W1LA 1MWOA 3AJ7A 1FHLA 3AAMA 1QRQA 1XI3A 3TTQA 3VD4A 3BLFA 1OFEA 4J56A 2OOGA 3AZRA 4M1RA 5REQA 3CS2A 3RX2A 2YGYA 3M64A 1ME8A 1S5WA 2X1UA 1VFLA 2XISA 3HBLA 3TQPA 9XIAA 4PMVA 1CXFA 1YEYA 2RH9A 1H7NA 1WYIA 2YR1A 2GYIA 1WAUA 3NSNA 4MAVA 3SCPA 3BW3A 4FF7A 4YVPA 1TWSA 3ZMRA 5IRPA 4KEVA 3KX6A 1KFCA 5G2WA 4K3ZA 4ZQMA 1OX6A 4JYFA 4CNSA 1PKLA 1G6CA 4TOQA 2G41A 3JVAA 3K4DA 5CSUA 4FHAA 3TJLA 3CQ0A 2NX1A 3H21A 4KEMA 4ML4A 2VEKA 3SSJA 2RJHA 5C70A 1U5HA 2PDUA 4L9ZA 1FCVA 1PIFA 1GQKA 3LD5A 5HATA 1OM0A 1BGAA 2INEA 2MUCA 4YYFA 3ZJ6A 2D23A 1S1RA 3PZUA 3U7VA 3QLDA 5FJUA 4DF2A 1VYPX 2HVMA 1BPLB 4UFIA 1F3PA 3JZUA 3CC1A 4B2DD 1FXPA 2A7PA 1JAKA 1JPDX 2V3AA 2PLKA 3EXSA 3ES7A 3INPA 4IXXA 4GQRA 3N9RA 4AMAA 2GH5A 4RX0A 4XKMA 1H7PA 5D02A 2FPYA 4LAKA 3OZPA 3CUHA 5CZKA 5A6JA 2CCRA 2HMCA 1M6JA 1OCJA 4I5RA 5XIMA 5BNKA 2KX9A 4IIDA 4HN8A 1VIWA 3UZYA 2GGEA 5CQ1A 2WKGA 3G1RA 4PEKA 3W02A 1R3TA 5BXSA 3GDKA 2OTDA 3G8RA 3UR8A 1NELA 3GIPA 2YZRA 2FMOA 1BYBA 1J0KA 8RUCA 1DQWA 1K4QA 3GYEA 1GRAA 3GR8A 5IBXC 2GJXA 2NUXA 4HKPA 3VDGA 1ZX9A 1JZ2A 2ZZ1A 3NG3A 4HZ8A 3IJ7A 4H2CA 4AX7A 3SFWA 1GEHA 4L4OA 3GNDA 4ZA0A 4Y9PA 3EOEA 1GUVA 7A3HA 2WKJA 2G95A 3WQEA 5HOSA 2GGJA 3MBDA 1IXQA 3ZLHA 3R11A 3WH7A 1LZOA 4XZNX 4PTXA 4C1NA 2G50A 4IMEA 1RJQA 2D3LA 1XIEA 1HKIA 3LMYA 4FOKA 1OK4A 1PUDA 5RUBA 1G0CA 3W25A 3POHA 1XCXA 3CUGA 3RF9A 2Q09A 4IIGA 1DQUA 1HT6A 4C5YA 5D9MA 3QEZA 1YNPA 1NWTA 3HGRA 6CGTA 5JCIA 1A5KC 5K4ZA 4I90A 3WLTA 5LHFA 2H8ZA 1TA3A 1XRTA 5B80A 3VGBA 3ENLA 3GO2A 2CLPA 1HO4A 3AU6A 3B9JB 3S6DA 3ISIX 1YLVA 3H7RA 1T8XA 2GK1A 3N2XA 5EMKA 4MAZA 3VX0A 4UTMA 2XH4A 1AODA 5E0CA 1HKKA 1OGGA 5ABGA 2NQJA 3CEPA 4JTEA 2EPLX 3HOJA 4E8GA 1RCOB 3BOXA 5DELA 5CC7A 3SR6B 2QCHA 3CV2A 3OJGA 3TNOA 3CZEA 3WUGA 1S5MA 5GPRA 1ZKQA 2WLZA 3VGFA 1SJBA 2CC0A 1YHTA 2IKJA 1PHWA 1G5AA 2QCDB 1RJRA 4N42A 3AMCA 4EPDC 5A1AA 5CZJA 1SJCA 2ZFAA 4CVUA 2DW7A 1WZKA 4H3DA 3WIJA 4US6A 1Q3NA 4GWEA 3TW7A 3I68A 1KXVA 4ZL1A 3QHNA 4HT3A 1S1PA 1DP0A 1TYGA 3NFUA 4QCFA 3VI2A 8XIMA 3REQB 2JGQA 5I02A 1OWQA 3MQTA 5A6AA 3VIKA 2POTA 1HP5A 3AO0A 3W76A 1Q6EA 2ZX6A 2NSXA 1GYNA 3M41A 4B5UA 4S38A 2QDDA 3EX1A 2E8ZA 1LQAA 1EP2A 4C6PA 2V2DA 2CITA 1QUMA 2W27A 2X2YA 5H8MA 4GZJA 4DJDA 3QZEA 4Q32A 2PF8A 2X0HA 4O8RA 4XKYA 5G2IA 2HRWA 2NVAA 1ML1A 1SMAA 3NQ6A 5I24A 1IXNA 1VBGA 1GEUA 5K7JA 1WDRA 3KWXA 3OHIA 4NZCA 5EU9A 1MW1A 3E2VA 5FF0A 1FDZA 2INZA 2QJHA 1FCUA 1GVQA 2ACRA 4OGZA 1PTGA 3EAOA 4J3XA 4Q8WA 3WNLA 1CGTA 1DYSA 5A8MA 4EQRA 3H8AA 3U4AA 3SADA 4GFSA 3ABRA 4JTJA 1C8QA 4Z17A 4D6JA 3S5NA 4NNBA 4QLLA 3LCGA 2XVPA 3R5EA 3T4CA 3NL2A 1TX0A 2D69A 3S1GA 3CAVA 4E6MA 3I7QA 1N82A 2HK1A 3ONBA 3ABQA 5GJNA 1ZCCA 3P7YA 1P4CA 3TYZA 2C18A 1R9YA 1FP9A 3N15A 3P8JA 5KVIA 1N61C 4WDXA 2GL5A 3GD4A 4JNZA 3W7IA 1KWKA 3UZXA 3DKJA 4LSBA 4DZHA 2Z7KA 2YXOA 3LLXA 3NDYA 1W9DM 1UIOA 2OT0A 2Q8XA 1N62C 4AVNA 9RUBA 2VUYA 3O7UA 4ECLA 5CJ5A 5FJRA 1SFJA 3WBXA 4M8UA 3LHWA 2QCMA 3GR7A 3CGBA 3W1QA 3KUMA 3QLLA 4UMBA 1V7YA 1H5YA 1US2A 3TK7A 3MVTA 1TTQA 1HX0A 4FX7A 4HSNA 3BO9A 2CZFA 2G37A 2AL2A 5EBUA 4GYKA 4H4PA 1MXDA 7REQA 3CGDA 3CHDA 4WIWA 5SWUA 5JCLA 2IQDA 3GE7A 3ZQ9A 3HQ1A 4AHOA 1R3WA 3C61A 3U6WA 5JQ9A 3DDMA 3C3UA 1NVMA 1WYGA 4KEZA 4WSHA 3S42A 5JU6A 1XD1A 3MJYA 1F9CA 3BMWA 4KMQA 5DBUA 2J9ZA 3URNA 4UMAA 4MPQA 3PUGA 3MHUA 3ICJA 2XSBA 2FIQA 2AMXA 1DJHA 1DJGA 1UD5A 3A22A 4K2SA 1XFBA 3MP3A 3NM1A 5D38A 2FMNA 4OOUA 1BQCA 3EEGA 4RR4A 4JFVA 4C6JA 5AHMA 2BMBA 3LG3A 3BCDA 4WEVX 5HUOA 5T91A 4AC1X 1JPIA 2UY2A 3NPXA 1ZAJA 2JE8A 2BCPA 1GESA 1HKMA 3GC4A 4R7WA 4GUHA 2W62A 4FNQA 5CPOA 4I7UA 1ZUAX 5E09A 4K68A 1LROA 3BICA 1JD9A 1GVSA 1EC8A 1I75A 1MO0A 3L68A 3BAKA 5EYWA 1DJNA 4A6GA 4XBJA 1H63A 4DXKA 1ZBVA 2HNEA 1OYAA 1S5NA 5HJXA 3UETA 2A6LA 1J01A 2ZRYA 1SO6A 5DXYA 4LV9A 3BLPX 3QPZA 3AWNA 4O14A 4EMJA 5IXEA 4ZQNA 1GVEA 1PZ1A 4RV3A 5I2UA 2E1DA 1FOBA 2C91A 3MWCA 1JUBA 2EKGA 2DFAA 4YWSA 3MT1A 5KTLA 1JZ5A 4JR5A 4PRWA 4CU6A 1LT7A 4XK2A 2PWUA 5BWFA 1J2BA 3FXYA 2ZCGA 1YNYA 5I79A 3EXTA 3KBWA 3S0CA 3FS2A 1TPVA 4AD0A 3WLOA 2H8XA 4PUMA 2X40A 1EUAA 1D7YA 5KZMA 2WCGA 4FDCB 1NARA 4F8XA 2XH7A 1K70A 1H60A 4R7JA 3VNIA 2FHBA 2NT0A 3VYLA 2FTWA 5DMMA 2WSPA 1DJWA 1XYAA 4IICA 2WQPA 1U1JA 1C3FA 1F5ZA 2V5JA 3A23A 3N19B 4PUNA 1JVNA 5ABFB 1I0DA 1A5BA 4IX2A 1EGZA 1TV7A 3WLMA 2JK6A 1CPUA 1FH9A 3UR7A 1AH0A 3LLDA 1SZEA 3EXRA 5AVHA 1Q66A 1IHIA 4NZ1A 2E8YA 1QW9A 3W4RA 2BASA 3VFCA 1K7EA 4XQ6A 4V27A 3T09A 4DNMA 3PZVA 1VPQA 1N60C 4LXFA 3PWAA 5MKGA 1SO3A 1SVDA 4AD4A 3ZVHA 1XGZA 5C5YA 5A6TC 3VMNA 1TV5A 4GG9A 3QV8A 4LGXA 3B40A 5E6YA 4IT1A 4NSBA 1M3UA 1GOXA 1E40A 2O7QA 3GXDA 4Y96A 1A4MA 3KTCA 2DVUA 1EUNA 1KRBC 2P3EA 1VBRA 3ARYA 2WJEA 1LBLA 4FXJA 4CEUC 5G4EA 1TPB1 3BJFA 4E3TA 3W37A 1VJSA 3VILA 5C7HA 5T8GA 3RU8X 3BV7A 1LTDA 2ZZ4A 4PUKA 4O10A 3LCIA 3F4DA 3W24A 3BG9A 3KOFA 1GKQA 1GKPA 3ZT5A 1R38A 3M07A 2OR2A 3UERA 4QEHA 1WV2A 4JX6A 4XZWA 3MJMA 4D6EA 2ZTJA 2VZSA 3AMGA 3RDKA 1Z32X 4ZOHB 3VX1A 2Y0FA 2Z7GA 4PBFA 2YCLB 1Q45A 4S2BA 4ILSA 3W85A 4PL1A 2AMGA 2XIMA 4HHHA 4I6VA 2E6YA 2CPUA 1YQ2A 3D5HA 5HUPA 1NF7A 1UZDA 1SUXA 4OV9A 5GNZA 1TTPA 1BG9A 3BANA 4O4VA 1TZ7A 4P7LA 5JRBA 2PF0A 3RUBL 3GX9A 1PAMA 1R2RA 1NQKA 1V51A 4LAZA 4LB3A 3S83A 1D7FA 4KW2A 2R1LA 3T07A 3HW2A 2FQIA 3QY6A 3LQLA 3PG9A 4GR1A 1KKOA 1HQTA 3EWXA 4RCXA 5DXXA 4L7ZA 1KV8A 3UZWA 4KPLA 2YLLA 1V0MA 2EPOA 3RITA 4PB5A 3V1HA 3PPGA 4X61A 5E6ZA 1K4HA 3AROA 4RPPA 3P81A 1NDZA 2I57A 5CXPA 2VQUA 4MWAC 2EQ6A 4HJWA 2V3FA 2HXTA 2BG5A 4AYSA 2QW5A 3T40A 4RZ4A 3HQNA 1HJSA 1KFKA 3VOHA 3FEQA 4ASTA 3O6AA 3LMZA 4H04A 1XC4A 3LSCA 2ZX5A 4H6KA 1ECEA 3S1VA 5F1VA 4ZOEA 2J9YA 2VGBA 4N9CA 1M7PA 3C2VA 4B9YA 3TAKA 3UXLA 4PRTA 3HG3A 5IM51 1V6UA 1DWHM 4JTGA 1V3HA 3ZXWA 3K8MA 4NX5A 3WFAA 4DPPA 1GHRA 5CG7A 3CV6A 1VHNA 3SN1A 2YZ5A 1EBGA 3WH5A 4IJBA 5ABHA 1V6XA 4IGSA 1M65A 2PWGA 2VX7A 1XXXA 5G4HC 3N9SA 2CYGA 4C90A 5CPTA 3SRKA 4QEEA 2R24A 1K77A 3LZ5A 3WZ0E 1UWAA 1A5NC 2VCBA 3LCFA 1K8ZA 4DIAA 5J5DA 1LG1A 4AUBA 4FX9A 1XH1A 3PFRA 2CZVA 1JEZA 3TZNA 1PSCA 2Z1KA 5F4WA 1EB3A 1IEIA 4F66A 2XVKA 4RLIA 2IW0A 4KCTA 1XSJA 1CXIA 3FA5A 3CLWA 1UBPC 1V6VA 4Z08A 2PLJA 2AQVA 4AIEA 1XH2A 1EX5A 5E70A 3E3HA 1EA0A 1TELA 4GBDA 3DESA 4C6IA 1MFVA 1AZ1A 4C6MA 5A6BA 2QJJA 4FXSA 4MZYA 2QHAA 1TWDA 1E55A 4LYQA 1QMLA 4RV8A 5DX7A 4E8CA 3QPYA 4JNMA 1FRBA 1CGWA 4C91A 5C9WA 2ZE0A 1IIHA 3H55A 1H7WA 2QZRA 1Q6OA 1FWDC 1JZ4A 5FSEC 4K7VA 3AN1A 3C2OA 3W23A 4FNTA 3NOEA 4FNUA 3G24A 3ZWSA 5CGMA 5HPCA 4PTMA 5A6MA 1QU4A 1RBOB 3NR0A 5B7ZA 2NSOA 2P1FA 3OQEA 1V7AA 4P2VA 3DGBA 5CBIA 5CAHA 4ZEPA 1T40A 1G67A 3RO8A 1XIFA 1YDVA 2NUWA 1ZALA 3GXFA 4ROQA 5FA5A 3WNNA 4JQ2A 2XN0A 1BF6A 1EOMA 3HPZA 4NAEB 4NI8A 3TQ0A 4F3HA 3CB8A 2A3BA 6ENLA 3L5AA 1UMLA 4NU7A 4IQLA 1QJWA 1BTMA 2PGWA 2Q02A 1QPNA 3UT0A 3WF1A 1TMQA 2CZEA 1W1A1 2J75A 5HWNA 3W2JA 1VEPA 3DI0A 1F8WA 1POKA 1OCQA 3AUJA 4QM1A 4XZHA 1VAHA 5DANA 4ZVJA 2V9DA 1BZLA 1R6WA 3NOYA 5LHEA 1REQA 5CPLA 1GVYA 2FVMA 1UZ4A 4V15A 5AHIA 4Z1CA 3PTQA 3RLGA 2H3DA 3H4GA 4GRTA 1K02A 3M0IA 4OV4A 4Z1AA 1WQ5A 2NQ9A 1WDPA 2Y5JA 4L61A 2E5BA 4MFDA 1XLCA 2Y2WA 1RJPA 3N2TA 4S3KA 1WBJA 2GVJA 3OW1A 3QOMA 3S2NA 3UG3A 3TYDA 1Q6QA 3RK8A 2YCIX 1OFDA 2PDWA 1DWAM 2HWGA 3HV9A 4Z2HA 5D9NA 1QT1A 3I3DA 3FA3A 3SQPA 4E4PA 1AL7A 1NJJA 2C14A 3GUGA 5LSMA 1C92A 3QV6A 4M7SA 1JI2A 4JX4A 3SCQA 2WHMA 2B7QA 2YCJA 4GIEA 5C9XA 4NILA 2HPIA 1KN0A 3M6YA 4O0QA 1QI2A 5AN7A 4LBSA 4A35A 1KLZA 3TYAA 3PJUA 3WLQA 3NQAA 1EEXA 1GYMA 3N2CA 4EOUA 3GD6A 3WELA 4GO9A 5BXPA 4U3CA 7PTDA 4Q6JA 1XD0A 3S4TA 1UWTA 1BWVA 4MNKA 4C6QA 1JRPA 3BAJA 1W37A 4WJEA 3UJ2A 2EO7A 1H61A 3NDOA 3W83A 3NRZB 1TJRA 4AAJA 2W54A 1M6IA 3KDOA 2WYSA 2ZDSA 3D3AA 4U5KA 1W5MA 3QYSA 4PFMA 5FACA 1XLHA 3RNMA 5HJLA 1KKRA 3UJFA 4GUIA 4J2PA 4M7TA 3M0JA 3E0LA 2QDEA 2BGNE 2WK2A 3B8DA 1E4LA 5TR3A 3HIJA 2VEPA 1U30A 1AOGA 3H4WA 3KOZA 2YA1A 2CDUA 4JPGA 3KW3A 1DHPA 2X50A 1GVRA 3VNDA 4IP4A 4EE9A 1BWLA 1XR2A 1GRHA 2ZVRA 5FJTA 3WQWA 2QCEA 4LCSA 2J7CA 5EMLA 1UUOA 2DH2A 3U0HA 3I7SA 1C7TA 1UH4A 3TYBA 1N2VA 5C2GA 3OEXA 3WBAA 3W1TA 3OIXA 3PSVA 2E5CA 4S39A 4H4QA 3GH4A 4FP1A 3PSWA 1ZGDA 3CUXA 2A1YA 1WDWA 4HMCA 3ABOA 3R4IA 3MW7A 4EANA 1GVIA 3P8IA 4I3GA 4EP8C 3H70A 3JU2A 5LXXA 1OF8A 3A13A 3DIPA 3W7KA 3ARQA 3WDQA 2W0HA 3TA9A 4WKAA 4RDVA 3N4FA 1H49A 3TC3A 3P14A 1QDSA 4ZOAA 1Q6CA 1I0BA 2WJZA 3MI3A 3VIOA 3W75A 2FZ8A 4MG4A 2CZ5A 3L4VA 3TC6A 2V82A 1RY0A 1MMFA 5CPNA 3OVGA 1JUEA 5HWJA 3L5MA 3VNMA 1VPXA 4JTDA 5I3DA 3LDVA 1PIGA 1QXLA 4DJEC 1UQZA 2ZXBA 4K8GA 2QAFA 2PB1A 2PGEA 4UQBA 4ZB5A 1JCLA 1LCOA 1MSSA 1V3KA 1XCWA 4AX6A 4HMNA 4K1GA 4XX6A 3LHYA 2OYLA 3C0QA 2HQAA 2V5KA 1FWAC 3AALA 4IL0A 4QG9A 2PD9A 5IHRA 2R8WA 4YU1A 1I2OA 2EGZA 3OOQA 3LYEA 2F6XA 3CTTA 1Y5WA 4APNA 3D6NA 3RM8A 2TPRA 2PDNA 2WM1A 3GB6A 3PZOA 3STFA 4Y2WA 3WNMA 3AXIA 3G1FA 5DY2A 3NL5A 1ITXA 4H50A 1CGVA 5JBFA 1NHPA 4BI7A 1LWIA 1X2HA 1E56A 4ZQRA 4B90A 4O53A 3DU0A 4JIPA 1B57A 2YBVA 3NM3A 1OFBA 4CCZA 4C1KA 3DG6A 4Q8OA 1EJ7L 1F73A 3THCA 3LNMA 5JBDA 1FKWA 1RVKA 1E72M 3CAQA 1ITQA 2PWEA 2BC1A 1WO2A 1BLIA 1NEYA 1XYZA 1FWTA 4ATWA 3ZWTA 4QQUA 2WM0A 4M51A 3BAIA 3PC0A 1YXYA 3TOYA 3GKFA 1W6TA 1GCYA 4DWSB 3W7CA 4UOJA 3C2YA 3GDTA 1RQEA 3GHRA 2W4XA 3GZAA 3O0FA 4Z2IA 5D03A 4J4KA 4FF5A 4L6HA 1XV8A 2VVSA 1NY1A 1TRDA 4S1FA 1XLLA 6XIAA 3VUSA 3F5JA 1PDZA 3D0CA 4JYDA 3AYTA 4J27A 2DSKA 3OLIA 1X1OA 2HEJA 2A3LA 1KGXA 2PCEA 4PMNA 1FWNA 1NWSA 1TB3A 4J3VA 1TYTA 1KCXA 1W3HA 1B90A 5HR7A 5D9OA 3CT7A 3ELFA 5I23A 4CGTA 2X8GA 3LCXA 3WQ5A 3S1UA 5CLTA 1SFTA 4DB7A 3H4XA 1E5NA 4GCXA 1S2CA 4JTFA 3I10A 1LJYA 2C1IA 5DMYA 1HG3A 3VABA 4LY8A 3TYEA 3W6YA 3NQMA 3TYUA 5LIWX 1XDIA 1B4EA 3SUWA 4FMVA 3EEZA 1GV4A 3EMCA 3N4AA 1J79A 4S3FA 4A8NA 1J0IA 1J0ZA 1GZGA 2D2OA 4US5A 2PDPA 1OJTA 3GG0A 3AXMA 4GZ7A 1E4MM 3VOJA 1IT7A 4Z2GA 1SW3A 4JTSA 1OIFA 1LL7A 4ZGYA 3R7MA 1O4UA 3M5XA 4GJ1A 2OSWA 3S5ZA 3UY8A 2V68A 4DAIA 1EJTC 1A5LC 1JCYA 3NPWA 2WSRA 4C1LA 4GX8A 1ZRQA 4QBXA 5LNRA 3PWGA 4HK6A 4OUEA 4GZIA 2ONEA 2EHHA 5KZEA 1TQXA 1L6YA 2WVVB 2DZVA 1W9UA 5M2FX 3MV11 3BH4A 3DBNA 5GJPA 2C0HA 2I5QA 1RM6B 3UYIA 4A29A 4B3LA 3P84A 2ZDRA 2CEQA 5HK4A 3U2ZA 3B0PA 4YYCA 2IKGA 4ZO6A 3TJIA 2J74A 4XO7A 2IPFA 4L1XA 3WO8A 4NZ4A 7CGTA 1BG4A 3LPOA 3E1F1 4XZLX 1W32A 4HSOA 6XIMA 3VD7A 2WPFA 2FH6A 5I00A 1R3YA 3GK0A 1B3YA 5AHFA 3G0SA 4LVGA 4F9JA 3G6LA 1TPUA 3CB3A 2WSKA 3CQIA 2DEPA 4I9TA 3PM6A 1KM5A 2VELA 5U1OA 1OADA 3N29A 1EJXC 5CBJA 4NEWA 4O1BA 1VYSX 3NL6A 4YS1A 4KERA 2IPJA 4ZMGA