3OZYA

Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg and m-xylarate
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
386
structure length
386
Chain Sequence
SLKITEVKAHALSTPIPERMRVESGAGLKLNRQMILVEVRTDEGVTGVGSPSGPYDLAVLKRAIEDVIGPQLIGEDPANINYLWHKVFHGEVSRNLGHRSVGIAAMSGVDIALWDLKGRAMNQPIYQLLGGKFHTRGVRAYASSIYWDLTPDQAADELAGWVEQGFTAAKLKVGRAPRKDAANLRAMRQRVGADVEILVDANQSLGRHDALAMLRILDEAGCYWFEEPLSIDDIEGHRILRAQGTPVRIATGENLYTRNAFNDYIRNDAIDVLQADASRAGGITEALAISASAASAHLAWNPHTFNDIITVAANLHLVAASPHPAMFEWDITHNDLMTRLASYDLKLENGLVQPPQGPGLGFEIDWDFVAAHAWKGEPAIGAGHGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of enolase superfamily member from Bordetella bronchiseptica complexed with Mg and m-Xylarate
rcsb
source organism Bordetella bronchiseptica
molecule tags Unknown function
molecule keywords Putative mandelate racemase
total genus 134
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ozyA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ozyA01
3R25A 3UXLA 4J3ZA 3TOYA 4M6UA 3B97A 3TJ4A 3R0KA 3ZLGA 1RVKA 1JPDX 3S47A 5ENLA 4ZA0A 3VFCA 2OLAA 4KEMA 3EKGA 3UCCA 3T9PA 1NELA 3RGTA 2NQLA 6ENLA 3DESA 1PDYA 2PA6A 4DHGA 5FJOA 3H7VA 4E8GA 3SSZA 3JVAA 2P8CA 2PSNA 4HN8A 3I6TA 3VC6A 3FYYA 3FVDA 2ZC8A 1EC8A 2XSXA 3ENLA 3V4BA 2XH4A 1TZZA 4GGHA 4E5TA 2XH2A 2ONEA 3PWGA 3SQSA 3BJSA 3DERA 2GGHA 3CB3A 2O56A 3P0WA 3D47A 2OZ3A 4FP1A 3FXGA 3JW7A 4MMWA 4IZGA 5J04A 3ES8A 3U4FA 4IT1A 3T8QA 4DX3A 1W6TA 3I6EA 4GYPC 3CT2A 3RRAA 4HCDA 1JPMA 4Z1YA 4F4RA 2P8BA 4KPLA 1ECQA 3MQTA 1BKHA 2PP3A 1R6WA 3UCDA 3R10A 1SJDA 1WUEA 3BSMA 3I4KA 1EBHA 3VC5A 1P43A 3S5SA 3N4FA 2FKPA 2HXUA 3TWAA 4E4FA 1NU5A 3DG6A 3MUCA 3MSYA 3UJ2A 2RDXA 1EBGA 2QQ6A 3T4WA 4GYPA 5FJPA 3TTEA 1ONEA 4HPNA 3SN4A 1JCTA 3IJLA 3GD6A 3QLDA 3T6CA 3FJ4A 3QN3A 3D46A 2PODA 4G7FA 3GO2A 2PPGA 1SJBA 2AKZA 4ROPA 2PTYA 2ZADA 2P0IA 2PTXA 4JHMA 1MRAA 4X2PA 2QDDA 3UXKA 2PS2A 3QKEA 4GISA 3N6HA 3UJRA 1MNSA 4DXKA 5FJUA 4A6GA 2OKTA 4IL0A 3SJNA 1MDLA 3QTPA 2PTWA 2OO6A 2I5QA 2GGEA 3RITA 4ENLA 3OTRA 4HNCA 2GDQA 1MDRA 2PGWA 3RO6A 2OQYA 3ZLHA 3TJIA 2P88A 4J1OA 1SJAA 1OEPA 3IJIA 3U9IA 4KWSA 2OZTA 4ZCWA 3V5CA 4JN7A 3NXLA 2DW7A 3VCCA 1TE6A 3HPFA 4KT2A 3OZMA 2HNEA 3CK5A 3THUA 3ES7A 2XH7A 3ZVHB 2QVHA 4A35A 3VCNA 4DYEA 1YEYA 3DGBA 3DFYA 3JZUA 5EU9A 3MWCA 3NO1A 4JN8A 3MY9A 1L8PA 4E6MA 3UJFA 3OZYA 2DW6A 3EEZA 2HXTA 3PWIA 2OFJA 4M0XA 3ZLFA 3PFRA 3DFHA 3GC2A 4IL2A 3V3WA 2QGYA 2OX4A 3V5FA 4H2HA 5IDZA 3N4EA 4HCHA 4GGBA 2XGZA 4HYRA 2QJJA 1TKKA 3UGVA 1FHVA 2FYMA 4YWSA 3H8AA 1P48A 2PMQA 3P93A 3UJSA 2AL2A 4Z17A 4H19A 5BOEA 3TWBA 3UJEA 2AL1A 3DEQA 3PK7A 3R11A 3N6JA 4HNLA 2QDEA 4MKSA 4A3RA 4DN1A 3R1ZA 3Q4DA 1SJCA 3MZNA 7ENLA 1E9IA 3IJQA 2MNRA 3RR1A 2HZGA 3KUMA 2AKMA 2CHRA 1KKOA 1XPYA 2OVLA 2GL5A 5FJRA 2POZA 3Q45A 3QPEA 2OPJA 3P3BA 1WUFA 2PU0A 3BOXA 3TW9A 3NZGA 2P3ZA 2GSHA 3TCSA 1DTNA 3ZVIA 3GY1A 4HCLA 1KKRA 4H83A 1EC7A 1F9CA 1IYXA 1MUCA 2PGEA 2QJNA 3DG7A 3FV9A 4G8TA 3SN0A 1XS2A 3CYJA 2XH0A 1PDZA 4H1ZA 3DG3A 3VA8A 4K1WA 4K2SA 2OZ8A 4DWDA 2PCEA 3OP2A 3IK4A 1R0MA 3VDGA 2PU1A 2MUCA 1KCZA 3ZVHA 3RCYA 1KD0A 2GGGA 3SN1A 2PP0A 3H70A 4EWJA 3SBFA 5BOFA 1FHUA 2PTZA 5FJTA 4IHCA 1JDFA 3FCPA 2GGIA 4GIRA 3R0UA 2OG9A 4MGGA 3OW1A 3OPSA 4K8GA 3DDMA 3H12A 4IP4A 3TQPA 3K1GA 3DIPA 2QJMA 3NFUA 2PP1A 2OQHA 4GMEA 3STPA 4IP5A 3CAWA 1EC9A 4GFIA 2GGJA 2AL2B 3MKCA 1ELSA 3CXOA 4FI4A 1BQGA 4E4UA
chains in the Genus database with same CATH superfamily
1H61A 4NZ5A 1WZKA 1GPWA 1VBJA 1XLFA 4DI8A 1H50A 3C2FA 2E9LA 1E6ZA 3O6CA 4QNWA 2Y5JA 2G4FA 1O5QA 3B9OA 3PZQA 3KWXA 2E09A 1E70M 1FWAC 4NUWA 1TRIA 2DZWA 1GZJA 3PY2A 2PBGA 4JIPA 4WKAA 1O1HA 4EANA 2WPCA 4LPCA 4U2YA 4AZ5A 1QW8A 1KBJA 4NJGA 3KLLA 3NDOA 4KWUA 3P67A 3ZS4A 3ZFHA 1ESWA 3RMEA 3BICA 3DBPA 2CXGA 3GU1A 1KM0A 3VM7A 5CZTA 1FTXA 3I10A 2E5AA 1DE6A 3AYTA 4FF5A 5GJMA 3VMNA 3W2JA 3A4JA 3LBOA 2B81A 2B7QA 2FH6A 3TC7A 3AICA 3G1SA 3T78A 3ITLA 1ZBVA 1G9HA 5A69A 2A3AA 2DZXA 2JIEA 2R91A 2QCNA 5G4WA 4AQLA 2IQDA 1H7NA 4MADA 2YCKX 1W37A 4IZGA 3LLDA 3CQIA 4CU7A 4EF9A 4DELA 3HO8A 2VWSA 2DSZA 4RXGA 4UCFA 2QCEA 1PS9A 1XR2A 5I00A 5LHFA 3S9ZA 3NEVA 1KM6A 4NRSA 2J7DA 2FZ9A 5HUOA 3B0UX 3R10A 4CCEA 1AA1B 1WUEA 2P3EA 2XFYA 4FSAA 1LL6A 3FFSA 5CJMA 2VUYA 4PYSA 1OZMA 4C7DA 1B54A 1W1B1 3IJ6A 1QNOA 2DT1A 4UMCA 3TWAA 1YE4A 1C3FA 1EHNA 3UG4A 4D8AA 4PRRA 3RJYA 1XBYA 4UWMA 2JFEX 6REQB 2NQHA 4JIQA 4GX9A 4O10A 3S4TA 3A4AA 3CEPA 3WFLA 1VZWA 3QN3A 1E6XM 1LLZA 3VDCA 2WZIA 2GLKA 3D6NA 4PSPA 2E28A 4QS5A 4L4PA 2QVNA 4AXKA 1AQHA 5U25A 4LU0A 3FN9A 4GLEA 4WJEA 1VBUA 4UQCA 3WD0A 3O0KA 4GX8A 3N2OA 4JHMA 3BG3A 1UOZA 4ZOHB 3BOFA 3UXKA 5D2WA 3E02A 4N6FA 3E0LA 1LCOA 1Z42A 5CC6A 2EKGA 4TX9A 3GKAA 1C29A 3DOPA 3PF3A 3W2NA 3T07A 4YU1A 3FG2P 3W7CA 1HFBA 4MWAC 3GTNA 2SFPA 2C1IA 2HNHA 3CTTA 3M0YA 3N13A 1ITQA 3CGBA 3W1NA 5CZJA 1YTDA 1TV8A 4UTMA 1BF2A 1W91A 2G5WA 4PB3A 1EYEA 2GOUA 4P7QA 7A3HA 3KW3A 4C91A 2TPSA 4R7JA 5EMUA 4IUOA 3MMUA 4FXSA 2BZNA 3NSXA 2HNEA 1LVLA 2VFIA 4F8XA 2BOEX 4MM1A 4MKNA 3UXDA 2BS9A 2WOWA 2JGQA 2NT0A 5I24A 3S0CA 3TYZA 3M0JA 1IEVA 2HVMA 2ZRVA 1FECA 3ISIX 2X8CA 4WLCA 5FF2A 5LXXA 5HDRA 1JG9A 4QJ5B 3OZYA 4XG1A 1GKRA 2OFJA 3PPFA 3U48A 3I7SA 3KS5A 3AUJA 2Y8UA 3N3MA 3W26A 3LXAA 5DXXA 3GHUA 1IEIA 3S5OA 4JFSA 1KTNA 5CGQA 4Q6XA 3W38A 1JFXA 4K7VA 5B7YA 4JTCA 2BV9A 4DNHA 4Q7IA 1ZK7A 4YWSA 4P61A 4IGHA 1GKPA 4AYSA 3RUBL 5C5YA 3SRDA 1CWYA 3M1ZA 4H19A 4BR1A 3GBEA 3UJEA 2R94A 2WLZA 3AZSA 3VDHA 1EH9A 4O0KA 5H6HA 4H7ZA 2QCDB 1CLKA 4L4MA 2JF6A 1O6IA 4A2RA 3EUB3 1KGUA 1YTEA 3MCOA 1NOFA 1KM1A 3UWQA 3POCA 1J2BA 3RPDA 2C15A 1VB9A 4QCEA 2JBMA 3VD7A 3W37A 1BXNA 1EP3A 3FYOA 1Q6DA 3UYIA 2J7FA 1JCYA 1EEPA 4AZHA 1TX0A 2XYLA 5RUBA 4Z2LA 5KTLA 2PLKA 1JRPA 3WO8A 3MHGA 3S2LA 4QJ1A 3W1XA 1XWYA 2QPSA 3MKKA 3GVGA 3VOCA 3C8NA 4DJFD 1XC4A 3AN1A 1NY1A 4INFA 1AJZA 4GE8A 1POJA 1MUMA 3L0KA 5KZMA 4UTWC 3VMOA 1X38A 3M0VA 3W02A 4CNUA 3KCLA 1LORA 3CL6A 4JTLA 4CKQA 1Y5WA 7REQA 1OM0A 1CLVA 4LYRA 4WOQA 3LM7A 1E73M 3W1AA 1IV8A 3SW6A 1XJBA 2EPHA 2VD9A 4W4QA 1TA3A 1K8XA 4EX4A 2W9MA 4OUEA 3MV11 3TK7A 4KCUA 5G5GB 4GUIA 4HHPA 2ACRA 4ZE5A 1NOUA 3AMKA 1K4QA 1RHCA 4PRWA 4X9SA 4B16A 2CYGA 4EM4A 5KZEA 4OT7A 4DXXA 4NI3A 4AWSA 4HA0A 4D6CA 1GJPA 1TV3A 3GD4A 4I6KA 3SECA 2GQ8A 1E6RA 4GVFA 1C8XA 4Q4RA 1SFSA 3MB9A 4Z2IA 2RGLA 3RK8A 1V6WA 1TV2A 1VBGA 2EBNA 4IG2B 4R88A 1ZBWA 2A7PA 4UFJA 2B7OA 1CXFA 1TR1A 3LADA 3KHJA 1K4HA 1RVKA 1KCXA 4XISA 3SGUA 1F73A 3M6DA 2BGSA 4KEMA 3JZEA 4URIA 4R9OA 4C1NB 3QR1A 2ZXAA 3THCA 1DXEA 3VNZA 2VJXA 3G0UA 1W2VA 2PC4A 4MKVA 4XWUA 3RLUA 4B5SA 4LT9A 3UXAA 3QGVA 1A5BA 4WXZA 3DZ1A 1CGTA 2PLMA 3H2OA 1ZTVA 4YNGA 2WSRA 3AM9A 3FVDA 2A2IA 8A3HA 2HQAA 1OFPA 2DORA 5L6UA 3CWNA 4DJED 3QVQA 4UOZA 1ZBKA 1OIFA 4ML9A 4JDYA 3BXWA 1G4TA 4W86A 1QHOA 5FSEC 4BJHA 1X8CA 2GUUA 1RY0A 1DWHM 4MMWA 5TF0A 5CG7A 4UTUA 4LH8A 5C2CA 5C55A 3A7AA 2W79A 2QCHA 1ITUA 3DFPA 2AGTA 4MB3A 2PP3A 3GNNA 2BDQA 4GI4A 3CGCA 2QMJA 1Q7ZA 1BYCA 3BG9A 4R9XA 1P43A 3IV8A 5E6YA 3C56A 2EG8A 3DCPA 1QNVA 3GVRA 4K3ZA 1FQ0A 1FY6A 4PUKA 5E70A 3DYPA 4HPGA 1UZ1A 2GK1A 4DB7A 3BE7A 1KN0A 2DQWA 1JZ5A 4OECA 3EGJA 4AX6A 2CW6A 1XLLA 1OY0A 3ONBA 4AZCA 3EMCA 1FO4A 3WQGA 5DMLA 1LF1A 1UASA 4DLMA 3WQOA 1VFSA 1V3JA 3H26A 2V3DA 4NIRA 3BSGA 3CQJA 1UQYA 3TN3A 1SB3B 3TQKA 2PBOA 4S3EA 1A3HA 4JX5A 3APTA 3MVTA 3QKEA 4UOJA 4KETA 5FF3A 2G95A 3NOYA 1E3ZA 3PZGA 4D1IA 2FPVA 1JZ7A 2I5QA 4JQ9A 5AFDA 1XQKA 2GGEA 1JD7A 1PV8A 3OHMB 3RITA 3WBXA 3WBYA 4ENLA 4LYPA 3WY1A 3WIJA 2ATMA 5FL1A 3DC8A 4HNCA 1K9TA 1LBFA 3WENA 4Q22A 4C5ZA 1XIFA 2GVJA 1DIDA 3SCUA 4HOZA 1VAHA 1VYSX 4JN7A 1CGWA 3NXLA 4F2TA 3WF2A 2NSXA 1TE6A 4NAFB 1QWGA 4K7ZA 1E4NA 2CLPA 3OZMA 1TJ2A 3M0HA 2HROA 4O50A 3WJYA 3ZVHB 3C0JA 3K13A 2QCCA 3WNKA 1A4LA 3I3BA 4NNAA 1BF6A 2TAAA 1KC7A 4W5ZA 3BAYA 1NOWA 5GJNA 5CPLA 1H0IA 2D0GA 1VJIA 2XU2A 3EEZA 1XHGA 3LI0A 1VPQA 2X30A 3TN6A 3BAWA 3GX9A 4Z2KA 1OD0A 4J3SA 4K36A 1YRRA 5C6MA 4IMFA 1GG0A 1VJSA 2KAUC 1LRQA 3WQCA 3KX6A 3G1XA 5ER0A 3L12A 4R85A 3UZJA 2PMQA 1Q4WA 1I2PA 1K9EA 5I3KA 3NNTA 4NJHA 1NFGA 3TWBA 3LHVA 3UA3A 2VX6A 3HJEA 4MFDA 4F79A 3AIQA 2NWSA 4A3RA 4PMZA 4Q8QA 1JPIA 1XI3A 1XFBA 3IACA 4J40A 3GH4A 2A5HA 2MANA 2CWXA 3VGDA 4S2BA 3AHYA 2HK0A 1SZNA 3VUPA 4TVCA 1UD6A 4N9CA 4YVVA 5T9CE 3Q6JA 4O19A 3GVVA 2V5JA 1KO0A 2O4MA 3UZYA 1ZJBA 2OVLA 3THAA 1QU4A 1WKFA 3NG3A 2NQ9A 4IFRA 1WUFA 3KVKA 4JOMA 1E4MM 4HQVA 3SUUA 1IT8A 3KP1A 3SCPA 4H83A 2O9TA 1V93A 2V3EA 5I23A 1I2QA 4FNPA 1GJUA 4WDWA 2Q3RA 5ECVA 3S2NA 4JTEA 1C8VA 1MQQA 1U83A 4YTRA 5BRQA 5I3GA 4H1ZA 4GUJA 4K1WA 4YL2A 3ARQA 4ILSA 1TWWA 3UESA 4U33A 3TZNA 1R0MA 3TDFA 2VELA 2JALA 3R12A 1R3WA 2ZUTA 1KCZA 4WJ8A 1OX4A 1J11A 3GRTA 2F8QA 3NO5A 3ZR6A 3DBNA 2VX7A 2GWGA 1X1NA 3P80A 4QS6A 2V63A 4LC6A 2ATSA 4GXWA 2NUWA 5I09A 3F2DA 3N34A 4UQEA 4B9ZA 3B9NA 3W7LA 1S2UA 3TYCA 1F07A 3W86A 2W27A 2AMXA 3BCDA 2UY2A 3WLLA 4HZ6A 2R8WA 4EPDC 5KETA 1QTWA 2ESCA 1S2WA 1XYBA 1HVXA 4CQDA 2VR4A 2YL5A 2YXGA 2Z1BA 1X6UA 2NUYA 4JTTA 3S5YA 4NEVA 1UZHA 2J9XA 4RLIA 3UR7A 2NLYA 1FHLA 1EC9A 2XIOA 4GFIA 2E1WA 5EY5A 4ZQRA 3C0QA 1J96A 3GR7A 3PUEA 3NZQA 3FGCB 3TE9A 1UKSA 3CXOA 4GQGA 5FMHA 3W88A 4HU3A 4AEOA 1BKSA 1DIEA 4NZ1A 2UY4A 3QOKA 5C2GA 4HHHA 1S5MA 3H21A 1T40A 5HMFA 3VD4A 1T7LA 1RV8A 1S2TA 1LLWA 1B4EA 4LS2A 4AC7C 2EPOA 1S5WA 2CZ5A 3BAIA 3MTWA 1KA9F 3UCCA 1K77A 3APGA 4D6HA 3CEUA 1EDGA 4DHGA 4M6PA 4K1GA 4ROQA 5CGMA 1TIWA 4CD5A 1J79A 1AOGA 3GXPA 4UR8A 3IVSA 3VC6A 3T7VA 3ARUA 4OHQA 5FA5A 3C5QA 4W84A 1K1DA 1S2VA 3S1UA 2YBUA 3LPOA 4PH6A 4C6KA 4ICNA 1OF6A 5D02A 3SGGA 1Q8AA 1JFHA 1UWSA 1Z69A 4HPJA 2CZDA 1HP5A 4A3HA 4ERGA 3U7BA 1BD0A 1B9BA 1RA5A 5HANA 2JKEA 3B06A 3UERA 4FX9A 4HBKA 1JQVA 1W9DM 3TR2A 3MDWA 2J24A 3UNTA 5HPOA 4H04A 3DYOA 4N9BA 2O4QA 4QEHA 1GQJA 2HSAA 4KPLA 4DPPA 2W67A 1RR2A 2DSUA 1YXYA 4JDRA 1QPRA 1JROA 2H8XA 3LNMA 3BO9A 3CB8A 3TVAA 1ISZA 4DYJA 1KLYA 3KWSA 1Q4NX 4HK7A 1QNPA 2RAGA 3EKZA 3GNDA 3ANVA 3T1GA 2X42A 3K4WA 2YVJA 4C7GA 3MW7A 3NQ8A 2WANA 2RHGA 1E6QM 4B92A 1IWPA 5K9DA 5D30A 2HJPA 2XIJA 3O1NA 4PUUA 4PZVA 1UWRA 4GYPA 1EFZA 1A0CA 1HJVA 2PWDA 1V5XA 3MYPA 1JR1A 3TSBA 1F7BA 4IM4A 5E09A 3R8HA 3GD6A 1LLOA 3TTSA 4C6JA 5D33A 3DHUA 1M7JA 1OCJA 3OZPA 5JH1A 3C2OA 3TYEA 5EBKA 3C3UA 3NYDA 2V6AA 3BGJA 3LCHA 3T42A 3E9AA 2J9ZA 3Q58A 4WCJA 4TU1A 2P0IA 4OKDA 2J13A 3WQWA 3W4RA 2W55A 3TU9A 1Q6GA 3INPA 2HDJA 4POCA 2PDMA 4UXDA 4NX0A 1SQ7A 2RGMA 4H00A 3VIHA 3W9ZA 2WHJA 2E0PA 3OTRA 4TO8A 1UA3A 4PTWA 5TR3A 2GDQA 4L65A 2WZEA 5AHMA 3U9IA 2BFGA 3HA1A 2H3BA 3GU2A 3DHFA 2WCAA 2D0FA 3NSMA 2WKLA 5BWFA 1Q6LA 1E1CB 1VYRA 1TPFA 3GUWA 5EFDA 1T8QA 2VDGA 4QDMA 1KRMA 1UHVA 2YLLA 1SO4A 4DUOA 1R30A 2I9EA 3PZTA 1PKYA 4LIIA 4HNTA 4H4UA 3KS6A 3CWOX 4XO7A 2VCBA 1KFCA 2BSLA 4LVAA 1W1YA 3UJFA 2VVNA 3AFBA 1GOXA 1NWUA 5BOOA 1T6MA 2CLEA 2OSWA 4JN6A 2NV2A 4HHLA 1ONXA 5D2YA 4JIHA 3SFWA 4DY1A 4L4LA 4QAWA 2YOCA 2OMAA 2EJ1A 4C90A 4RNJA 1D8WA 3BQ6A 3ITYA 1TWZA 2XGZA 4AUBA 3G1AA 3UT0A 2AMGA 4LUSA 5CAHA 2JE8A 3QC3A 1MEHA 4I8YA 4TV6A 3QOMA 4Z17A 1GRGA 3WLPA 1XRSA 1OZQA 5H8MA 1V6VA 3IANA 1KWKA 3EXRA 4A2SA 2PWUA 4JQ1A 1HT6A 4JCLA 4QG9A 1EDQA 4CD7A 2XVLA 1VIWA 4NP7A 2Q01A 3TFCA 4ZOAA 2BG5A 3WQDA 2FIQA 2WHMA 3HZ3A 3PS7A 3A24A 3QV6A 4ATWA 1H49A 2Q09A 3RDKA 2UV8G 1FWRA 1QCWA 2PU0A 1WDPA 3LI1A 4O1DA 2OODA 2Y5EA 3TCSA 2DUZA 3LBMA 3PSWA 4HCLA 4I5XA 1FH8A 2OEMA 1LBMA 3UFYA 1F8MA 2R1LA 3N29A 1J0IA 4PTNA 4D6FA 3TCEA 3L0GA 1P0EA 3HU7A 4A3YA 3M9YA 3P84A 1Q65A 4J9JA 3CLWA 5JU6A 2AQVA 3W81A 3LY0A 4XZNX 4GI9A 4K2SA 1O1ZA 1ONWA 3EANA 2YBTA 5D9PA 3T09A 4FK9A 4H4SA 4XV0A 5AHIA 4PMQA 5D2TA 4Y2WA 4BY3A 2VFHA 1ISWA 4IICA 1DKWA 1XLKA 2QJIA 3NQVA 1V6TA 1UUMA 3LX9A 3HBLA 2PWEA 1QI2A 3FCPA 4PUNA 1ICSA 2CLOA 3QZ6A 2GFTA 2OG9A 4C60A 3KBWA 4CU8A 1YXDA 1DWGM 1C91A 4WSKA 1WAWA 1FWTA 2Q6ZA 1VFHA 5FL0A 2PP1A 3DXIA 3M6YA 3WSUA 1T0OA 5EB8A 2QUMA 1X7FA 1TYTA 2G96A 3HIJA 3BW4A 2J7EA 4DM2A 1B3VA 5A6BD 8TIMA 1NHSA 3R79A 3PWAA 4FI4A 4Z2JA 5FEPA 3CAKA 1GVEA 3LV6A 2IXUA 2YGYA 1OFEA 1BXCA 2PDKA 1KTCA 1JZ6A 4M6UA 1OVDA 1TYGA 3L5MA 2X1UA 3CHEA 5AC7A 4LX4A 3MI2A 4PTMA 2YVGA 1YIXA 4S38A 1ZQ5A 5ENLA 2ASHA 4GH3A 2JGYA 1HKIA 5BYWA 1TB3A 2JK2A 3B8WA 1O68A 1XCFA 4A29A 4BCEA 3PZUA 3WLHA 2Q3OA 4B5TA 1LT7A 4QE1A 1ZKQA 3CZKA 1KV8A 2XN1A 1J01A 1CGUA 1DXIA 3FJ6A 3OZOA 3AMDA 4GPNA 4MAVA 2I57A 3KAOA 1D3HA 4J2MA 1H60A 4D6EA 2EQ6A 2YA1A 3CUHA 4XQ6A 4UZUA 5FS8A 3ZJKA 1TMQA 3OBAA 5BZAA 1W8GA 3TKFA 1TTPA 2YA2A 4M19A 3MMDA 5A95A 1CXIA 2O56A 1E71M 1UWTA 3KP0A 1BRLA 3M0KA 4LUIA 4LVDA 3A47A 1Q2RA 4PMXA 1H11A 1Q2SA 3II1A 4EQRA 2QCGA 3OVQA 3K2GA 4LV4A 3A4XA 1GVOA 4C6QA 1UD4A 5HQLA 4M7TA 4UFIA 4XUYA 1Y5XA 3RRAA 3BMXA 2VP8A 5E93A 1Q1RA 3PUOA 1OX5A 2VDHA 5F2LA 3RX4A 3S1WA 3CV1A 3F2CA 3M16A 4HU4A 5BRBA 3M7SA 2ISVA 4PEEA 2OEJA 1GNXA 3NJ3A 1RXOB 4DBDA 2ZUMA 4ZR8A 2NZLA 3R4IA 1SR0A 1DJQA 1XBVA 4M81A 5JBFA 2G37A 1EBGA 3B8IA 3KOWA 2J3NA 2W0UA 2VEPA 1AODA 3G8EA 3MJMA 2ZX5A 4FIQA 1Q6FA 1UMYA 2OGJA 1SUXA 1ZL1A 1TWIA 3EYPA 3FJ4A 1BYBA 2WXDM 3CH9A 1EOMA 2WWCA 3KOFA 2PPGA 2VGBA 3U5YA 3FJLA 4HA1A 2CU0A 2HCVA 3KFTA 3QYSA 3O0FA 2PTXA 2G0WA 3ZJ7A 3MUZ1 1JYWA 4LNYA 1MNSA 3KCOA 4HSNA 3TR9A 1V0MA 1B0IA 4KERA 1XINA 2TYSA 1U5JA 3GH5A 6TIMA 1EP1A 2OSYA 1DQWA 4AD2A 4XAFA 3EKLA 4QM1A 5CC7A 4ALDA 1B1YA 2Z2AA 3TEVA 2PGWA 3ZLHA 1R2TA 5JIWA 1UJPA 3TJIA 4PUJA 1ZXIC 2EEXA 3LN3A 2GJNA 5K7JA 4MPKA 1TTIA 2PDUA 1LOLA 4J56A 2ZZBA 4PULA 1ZU8A 3O6YX 5FKYA 3LLFA 3QFAA 1XIEA 3JS3A 3GNPA 1O94A 4BEUA 2A8XA 2RDWA 3EOEA 1CB7B 3DKLA 4FR1A 4B2DA 3DH9A 3LZ3A 3DFYA 3LSCA 3ZWTA 1W5QA 3BLOA 3AROA 8XIMA 2QIIA 3C2EA 1EJ7L 4U3CA 4E6MA 3IVUA 2D24A 1R47A 3RU6A 3UPBA 3M0XA 3SIMA 3PWIA 1GOOA 3EWYA 4JKKA 3OB8A 3TFXA 3W1PA 2YCJA 4B3KA 4XAZA 4B9YA 2E5DA 4UNLA 3LM3A 1NF0A 2BC0A 4C6FA 1RBOB 4DI9A 4HYRA 2CITA 4NJKA 2CDUA 2REQA 3ID7A 3IGSA 3W6YA 4HHMA 4Z0SA 2Z25A 2Z28A 2YL6A 1ZFJA 2QPUA 4MLJA 1XFCA 1XISA 1K6WA 2RJGA 2Y7DA 2XIQA 4QDPA 4AAJA 3MWAA 3UA4A 3TROA 5CPTA 3EA3A 1XKJA 1K3UA 2IQTA 2YCEA 6A3HA 3VX1A 4B2DD 3AYRA 3RM4A 3LK6A 3IJQA 1JVNA 2MNRA 3GHSA 5H1WA 2X1IA 4RPPA 1CXLA 1E4IA 1H1YA 1VFLA 1P0KA 3NO3A 1RK5A 4M8UA 3TIMA 3MUIA 3AMCA 4GXMA 2G8ZA 4AEEA 3WLMA 3NZGA 4FNUA 2A3CA 2WM1A 1EB3A 3GNOA 1KKRA 4FXJA 3RXZA 3SQMA 4E38A 1F3PA 1VD6A 4MNJA 1EQCA 2DT3A 1YMYA 2HVOA 1DVJA 4V1XA 4WJXA 4TV5A 3W7KA 2ZZ4A 4XZIA 3DG7A 1AH3A 3NM1A 2F6XA 3P5ZA 1NF7A 3PBGA 4N2YA 1Z8AA 3HURA 2ZE0A 2DY3A 1EJUC 5BW6A 3LRKA 1T41A 1HNYA 3VDGA 1I0DA 3WMBA 1US2A 5EA9A 1S1RA 2HS8A 1M7PA 1JZ8A 3D3FA 3WBEA 2HEJA 4EXBA 3VIMA 2DIKA 4GINA 5AC6A 1IHIA 4K8DA 2Q02A 4GNVA 1W3KA 3JR2A 1R2SA 1KXQA 3PBUA 2F2KA 3CLMA 1FHUA 3U2CA 3ATYA 5JUVA 1X1ZA 3S6DA 1N5WC 2YX0A 3SCRA 3A3WA 4O1BA 4MGGA 3OPSA 2Y70A 2V2HA 4IP4A 1I6NA 1VP5A 3SM0A 4LF1A 4M3PA 2ZXQA 2WC7A 4DZIA 1VFFA 2DT2A 4H4PA 3BMWA 1UQZA 3DECA 3M43A 3CC1A 4MWAE 1K8ZA 4B91A 5AC4A 3TLQA 4EE9A 4ZEPA 1WBHA 2EPLX 4JY8A 3VZYA 1FDZA 4JIRA 4N9DA 3UXLA 4D6DA 3I65A 1S38A 1GVQA 1RM6B 1OGGA 5U1OA 1XH2A 1A53A 5ABHA 2WK2A 1W3IA 2V38A 2DPEA 4ZA0A 1PBGA 4HT3A 1PYMA 3MSRA 3WBWA 2J74A 3SCSA 3T9PA 3C2YA 4GBUA 3R94A 2RFGA 1XSKA 3WQFA 2ZVRA 3VIOA 1YXCA 4E2BA 4DBUA 1W3LA 2NUXA 4XB3A 3CHCA 2A7RA 2PSNA 4P7OA 1ZJAA 3VIGA 5AZ0A 1X2HA 1LPFA 4PMDA 2OYMA 3OHIA 4LUJA 1OD8A 3Q67A 2J8FA 3UZWA 1D3GA 4P2VA 2PDJA 2IKHA 1TZZA 4GGHA 4E5TA 1SFTA 2OCZA 4WSJA 4ADTA 5TD4A 2OZ3A 4GY7A 2C1HA 4LF2A 1RSCA 1MW3A 4JGDA 2FGLA 3BGAA 4C6DA 4ACZB 3O05A 1PTGA 1BKHA 3L0NA 1TJ0A 4AXNA 4RV3A 3AYVA 1IQ8A 1SVDA 3FYPA 3GDMA 2W3RA 2PEVA 4P8VA 5JMUA 5LGXA 1P0DA 4O1FA 3L21A 3CAQA 3UGRA 3SB0A 5I3FA 1Z89A 3GYEA 4PMVA 1NP2A 2ZRYA 2FKPA 1XG4A 3U57A 2WQPA 1YDYA 2FDSA 4HGXA 1L0PA 3ZIZA 3IARA 3M07A 1G01A 4CCDA 5F4WA 3V7PA 1PWMA 1TCDA 4M5PA 2X1RA 2O55A 4DWSA 3PBMA 3WLOA 3ANUA 4JEJA 1JQXA 1POKA 5KINA 3W1MA 2BVTA 3EDJA 3FKKA 1W1ZA 3LNPA 1Q66A 4Z42C 4KWVA 1I60A 3B04A 2CLKA 2PLJA 1EXPA 2ZYFA 2XIMA 2C14A 1JNDA 4IGSA 2R82A 3L2LA 3TUUA 4ROPA 1DQUA 3UWUA 3WLRA 3S5ZA 4DZ5A 3VXGA 1X2GA 2YSWA 1GGOA 4AD5A 4GABA 4XIMA 2FTWA 3W27A 2ACUA 3UJRA 4GZEA 2GQ3A 4LSBA 4KPRA 3N12A 1E55A 4IQLA 5CEWA 1OB0A 2V5CA 3DHDA 1PIIA 3GDBA 1TELA 3AJ7A 3T40A 1O12A 1Z7AA 3AMLA 3BOLA 4UB9A 2ZX6A 1GYMA 4AH7A 3H22A 2BVYA 4YVPA 4FX8A 3QRHA 2GQ9A 4UR7A 2NSOA 5JCKA 5B80A 5H8UA 1R9YA 4EAYA 1BTMA 3LXBA 4ZCWA 4YPJA 4FOKA 1E0UA 5T8GA 2POTA 3ZOAA 3UEQA 3E5PA 5JBDA 4KT2A 5F2GA 2TODA 1WO2A 3HGJA 1H0GA 4DJFC 3VD9A 3H2MA 2A3HA 2VCCA 1VEOA 1H09A 1M03A 5C7VA 3FKRA 3VFLA 2Z2BA 3NO1A 5FACA 1X8FA 1B3ZA 4NJJA 4ZO7A 2WMIB 2DIJA 4WKHA 4UUIA 2X8HA 2WKGA 1UBSA 1XYFA 2QXWA 4GJ1A 3WH7A 1RZMA 3UNDA 4FO4A 1P5BA 3K30A 4Q4SA 5EFFA 1XLEA 4GYFA 3EWBX 3CUIA 3HG3A 4U10A 4J27A 1UH3A 1PCKA 4RZBA 2DUAA 3LGGA 1P48A 4UQDA 3YPIA 3TTQA 3RCMA 1AMKA 3QV7A 3NQGA 1QNQA 2J62A 1JUKA 5BXRA 2DH2A 3L4TA 2G41A 4AVNA 2I9UA 4QXIA 3P8JA 2QPXA 3V35A 3CZLA 2EJAA 4HK6A 1UIOA 4NAEA 7ENLA 5E9XA 1OFOA 4XD3A 3BLIA 4GQ0A 3BW2A 1B3OA 4HMNA 5LKYA 1ODZA 5E0KA 3AIBA 3L8KA 2I16A 4RR4A 2GJXA 5HK4A 2GL5A 3CUZA 4CNTA 1ZY9A 1XYZA 2YW3A 1GESA 4HB7A 4EQXA 3T44A 3P3BA 1IE7C 5FEXA 2LLEA 4PTDA 2VNCA 5DT5A 1OINA 2OYLA 4GKLA 1OT1A 4RV8A 2JIWA 1PHWA 2GSHA 3GY1A 2YYTA 3MU7A 5A1AA 1AW2A 4PL1A 4M82A 2QT3A 4MUPA 4KCWA 1REQB 1F5ZA 3CZJA 3VMPA 2PD9A 3C3NA 2XSBA 1R7AA 3SN0A 1FH9A 1QPQA 1E56A 2UZ9A 4DIAA 4FB7A 1R3VA 1THFD 4P5UA 2QUNA 3OVRA 2BASA 1K8YA 2WP5A 2VD8A 3LHZA 3AC0A 2C13A 2WNQA 5FF0A 1M1BA 1PTDA 3KZSA 4AF0B 1E1FA 4CNPA 5M03A 4Q7BA 1CX9A 2YB4A 2NW0A 5AHLA 4O15A 1CLXA 1WE5A 1G4PA 1LTDA 1I2NA 1N7KA 2VC6A 2F2HA 4BV6A 4NJIA 1EQPA 4JHZA 4RDWA 5KVIA 3EOLA 2GYIA 4K8GA 2FQIA 3TQPA 5DBTA 2OYKA 1WKYA 1P7TA 3RN6A 2GR1A 4ZQCA 5ABTA 9CGTA 3QHOA 2FHCA 4XD5A 2VZVA 3SCQA 2QDGA 2VEFA 1BG9A 3FEQA 4ZQMA 6ALDA 1ZAJA 1W1PA 2DH3A 1E72M 3TN5A 3O3RA 2WSKA 3EMQA 3VGHA 3L65A 3ITXA 4IPLA 3PZIA 1QXLA 3W6MA 5LNUA 3H4GA 5CSRA 1JPDX 4BHYA 1TZ9A 3VFCA 2PDCA 1FA2A 1JI2A 4KESA 2XFRA 3M4HA 3CMFA 3TMLA 2J7CA 1H7OA 2DZTA 1QI4A 3OYZA 2WNZA 2G3FA 1VFMA 1EHAA 2VUNA 3WLNA 3TA9A 4AIBA 1XD0A 2YAUA 3PZVA 1S5NA 4DLFA 4O8RA 3ABZA 2AOSA 5BMXA 4FLSA 4MG4A 1YTKA 2D2HA 1TWSA 2QUVA 3M5XA 1VS1A 1TO3A 1HF6A 3GR4A 3HGSA 1K7EA 3GU9A 4BK9A 2TRSA 4NG3A 2GDVA 3HOJA 3BLLA 2OU4A 4BWLA 4L1WA 1GEUA 2ZOXA 3MHUA 4XBJA 1YBQB 2WBAA 3FXGA 4RXFA 4X60A 2CKSA 3WQ5A 5CZSA 4IT1A 1B30A 3T8QA 4LC8A 4DEFA 5DN1A 3HB9A 5FJJA 1NVMA 3UETA 1XDIA 4HCDA 3W7QA 5ABFA 1FEAA 4EF8A 3CV7A 2BMBA 3CL7A 3MP3A 4YJ5A 3JUGA 3P61A 1AJ0A 2DEPA 4LRSA 5KITA 3VIKA 1EKOA 5MKGA 4GY1A 2X2GA 2V81A 1XD1A 1WOBA 2RABA 3NVTA 1V3LA 4K37A 4JTUA 2ABAA 4AZIA 1V51A 1V08A 3IC9A 1N82A 2WHKA 2VC7A 3WFAA 1FKWA 4CNOA 2RDUA 4QHRA 5D32A 4AWTA 4HN4A 4NILA 4H7VA 3SN4A 4M29A 4CQ9A 3WMLA 2GDUA 3NRZB 2QF8A 1KCKA 7PTDA 1XLMA 2A6NA 1JEZA 1UR1A 2AKZA 1IWAA 1SZEA 1UPMB 5D2VA 4FHAA 3HW2A 3WMCA 2Y89A 4XKYA 2ZX8A 1EX1A 4ORIA 4LYKA 4DF1A 4JFUA 4DXKA 2DSVA 2UBPC 2BXVA 4A6GA 4ZBCA 5LSMA 1QOPA 3UG5A 3LCIA 2P50A 4EMWA 3P74A 3BLFA 4HIBA 2R6OA 4JS3A 1VFUA 1DQXA 4Z2HA 4ZODA 1NWSA 1K02A 4S3GA 1W5PA 4IIDA 1QVBA 4HA3A 4J1OA 2OEKA 2WJFA 3ORWA 2OSXA 5I06A 4F66A 1JYXA 1LJYA 3EA1A 2E9MA 4JBRA 3E3HA 4F48A 4P7LA 2EPKX 4BQ2A 1EP2A 3A5VA 2A4AA 1U30A 1E6PA 1CIUA 1O5KA 1XLCA 2XH7A 4CEXC 1L6YA 3LBCA 3S6OA 3VCNA 2IKJA 2CLFA 3DGBA 3AOFA 3UPMA 3UWYA 4JCMA 3KDNA 2AQWA 4S3JA 1L8PA 5EMMA 3AIRA 3MKVA 1F6YA 3WCZA 4JNMA 3E96A 3RM9A 2VZTA 2PUZA 3ZLFA 1NWTA 3DFHA 2BCPA 1N61C 4IL2A 5BU6A 4ZTXA 4UNKA 4DO5A 2D2OA 4H2HA 1YPXA 3LMYA 5IDZA 1OABA 2W91A 1B3WA 2IW0A 4EAMA 4J3XA 4HU0A 2BX7A 2XN2A 5A2BA 2C91A 4YCPA 1W1IE 3H8AA 2VCAA 4N0RA 3ARWA 2AL2A 1H6VA 3BGGA 4DJDC 4DF2A 2CHNA 5BOEA 3NDZA 1PIFA 3TX9A 4W93A 1KBLA 3G1HA 4M80A 2VEKA 1PJ9A 4OVXA 1IIGA 3STCA 2Z4GA 4QCFA 4QLKA 4H9UA 1KFBA 3E38A 1XGZA 5ABEA 1QAPA 4M6VA 2OZ0A 2ACQA 1ZP3A 3LYEA 3U5UA 1GREA 1HQTA 1A5OC 2V68A 4QGCA 4Y9NA 3ABXA 1EJSC 3RU8X 2XWDA 8CGTA 2PDBA 3SCNA 5XIMA 2D20A 1HJUA 3KXQA 5CPOA 3VGGA 5D2XA 3KVJA 3M5YA 2X05A 1FWIC 1PEZA 4TVDA 4CCZA 5LYRA 1ZZMA 1GEQA 1J18A 1KTBA 4RPQA 3RLVA 4UBPC 4MFEA 3KRSA 1IYXA 1MUCA 4ERIA 5IFPA 2VQUA 3GH7A 4GI6A 1GW1A 2DT0A 2XH0A 3B9JB 3T55A 1HO4A 2YCLB 4X2RA 3VE7A 1JXJA 3PJXA 3MP5A 4DJFA 5M2FX 4E3TA 3H2NA 5CJNA 3SY1A 1LT8A 4JTAA 4KW2A 1XIHA 3WH8A 1B3XA 2PP0A 5CZKA 1TR9A 1XIBA 3P7YA 2GJRA 1RLCL 5HNUA 1N62C 1ZPTA 4LY4A 1XSJA 4XZ9A 3U6WA 1GQNA 3REQA 3RLGA 3I7QA 3QFBA 3R0UA 2F5ZA 1P6BA 2EG6A 4GVHA 2FJUB 1LYXA 2I1OA 3BW3A 1DHKA 2E68A 3K1GA 1IF2A 3NQ2A 3W24A 1QT1A 3RHGA 2WMHA 3ARZA 2OQHA 3STPA 3ARYA 4PGLA 4Q33A 3CUGA 5FEZA 5A3HA 2KZHA 5IBXA 1W9BM 2Y5SA 3QLLA 2ADAA 4CLMA 2Y61A 4R3UA 4KFPA 3CGTA 1GV4A 2INEA 3UYCA 3B40A 4CVWA 1XYAA 1I4NA 2BHZA 3TOYA 1HGWA 1QHPA 3N04A 4EKJA 4F9DA 3B97A 4DF0A 5JBEA 4AD0A 1HJXA 3S5NA 4XK2A 5C9ZA 3BARA 5E0FA 1OGBA 2J7HA 1JXKA 4P7RA 5HNTA 2Z29A 4Y6GA 3U8GA 4CNSA 1YNPA 2R14A 1NELA 2YA0A 1WV2A 1XBXA 1XLBA 6ENLA 2A21A 1FHDA 2PA6A 1C93A 3WLQA 4DUVA 1E5JA 2C8NA 2CXEA 1XX1A 3WLIA 1X96A 4LV9A 1S46A 1BPLB 5LZLA 2X0HA 4WRHA 3AS0A 3UZXA 1F61A 3ENLA 5AC8A 2E6FA 4ZFMA 1Q6EA 3L4VA 4AD3A 3PVFA 4D72A 2ONEA 1EYWA 1XDJA 2XGIA 3PR2A 4OBRA 1KFKA 1A5AA 4MZ8A 5D9NA 3EWDA 2CLHA 1JUBA 3WJZA 2E3TA 1M68A 2DZSA 1LQ0A 2WAGA 3HV8A 1CDGA 1NAL1 4HMDA 2X7WA 1XUUA 4I7UA 4LUYA 2J8GA 5HJXA 2PI6A 4DPQA 2ICSA 3M0MA 1JD9A 3TXVA 2ZZ7A 3VO0A 2CFYA 2VFFA 2VHLA 1TQJA 3OEXA 1SJDA 2PC8A 4O16A 2IKGA 4LAKA 5JCMA 1TA3B 1TPVA 2NVCA 1RLDA 3OODA 4QR6A 3WBAA 1IR2A 3GAKA 3TOPA 1A5MC 2FZBA 1U1UA 3KBNA 4HNOA 3DG6A 2ZZCA 2NXIA 4EPBC 4WDXA 4P8WA 3MSYA 3MV01 1BAGA 1Q7MA 2RDXA 1YE6A 4L1XA 2YFNA 4ZZ9A 3HQPA 3KBJA 2XVNA 1DWFM 4XZBA 2ISSA 4O18A 1DIOA 1ZMCA 3GB6A 2Z00A 3TMQA 2NQJA 1JCJA 3LHUA 3PZ9A 1CXHA 2FTYA 4E4PA 2OQLA 4A8RA 4YLWA 3AAMA 3LRMA 4PBFA 3VKJA 4X2PA 4GZJA 3ARVA 4US6A 4H4WA 3TP4A 4IJBA 3CHDA 1G94A 3H4KA 2V69A 2PTWA 1GOKA 2BWGA 4MY8A 3XIMA 1N5XA 2E3ZA 4GRTA 3IEBA 5C9RA 3CUFA 2NXGA 2XM2A 2WWDA 4O57A 1UR4A 4WX2A 1ADOA 2FHBA 5D37A 1EZWA 5KSWA 3WH5A 1VPYA 1ITCA 5FF4A 3L5OA 4TTGA 3IRDA 2WC4A 3VCCA 2CFFA 1B90A 1XLIA 5EPDA 4C6IA 1UC5A 3CQ0A 3HPFA 3THDA 2JEPA 4O0QA 4HPXA 3NPVA 2ISFA 2VR5A 1GHRA 3PG6A 1V8EA 1JRCA 2WO5A 3W7NA 5AOUA 5MF5A 3Q2DA 1B4KA 3NGFA 3H4XA 4LALA 3W73A 3DGZA 1KQZA 3GDLA 5IDIA 4JYEA 1GZGA 3EB4A 2GPTA 4Y9OA 1BWKA 5FF7A 1QOXA 4IF2A 1F3EA 1XYCA 4PMRA 2B7NA 4MLRA 2E7FA 3S46A 4H50A 5DY3A 4KFNA 1G1YA 1AH4A 4DUXA 3GDRA 3WNPA 2QGYA 1I9CB 4MNMA 3RAOA 3RPMA 2OX4A 2W92A 4DNMA 1AQ0A 3QFEA 4LB3A 3NVYB 2F38A 3E2VA 4H41A 4FXFA 2OLSA 3GXTA 1QBBA 1Q45A 2NWRA 4RDVA 1BFNA 1G7UA 1SFLA 1ISYA 1UBPC 3UJSA 3NL6A 3T0TA 3LLXA 1HP4A 3SR7A 1X6NA 5EYWA 2AL1A 1JULA 2I5IA 2VWTA 2ZZ0A 1DORA 1J0YA 1DHPA 3N6JA 2ALRA 3KTCA 3PNUA 4IPPA 1DJXA 1QBAA 2WCGA 3QSTA 4HZMA 3B8SA 3QC0A 4G1NA 1DOSA 2X0SA 3AU6A 5H8PA 3CPUA 1WZLA 4XD6A 5C2XA 3L4UA 3W1LA 3A3XA 3H2CA 3QZAA 3G3DA 3NQFA 5HMSA 1B3YA 4UTKA 1MEWA 3VKCA 3S3GA 2J88A 3UR2A 1NDYA 2PDHA 1NQ6A 1O95A 4DZAA 5BNKA 4GJIA 1MI3A 3O6AA 4KFOA 5AYXA 3CAVA 2XJ7A 3IGHX 2YZRA 3M64A 2HVNA 3E74A 4H4ZA 3TQVA 4L64A 3MANA 4Q4MA 2XZ7A 4KWOA 1PDZA 2VRKA 3R8GA 1EWEA 5I5RA 2PU1A 2MUCA 3ZVHA 2GOKA 5DCBA 1CNVA 3UWZA 5GPRA 3BJTA 1BVNP 4RCXA 1MOKA 2AAAA 1VEPA 2BOFX 3UR5A 1KFJA 4CQ8A 2Q8ZA 2OKOA 5HNRA 2WVVA 2ZCGA 1M5WA 3GHRA 5CAKA 5EMKA 1F8IA 3ABOA 3MUAA 4O14A 4XUGA 1EDTA 1UB3A 2GJLA 1LUCB 2BODX 4MWAB 4H4VA 1TUFA 1TPB1 3DIPA 3LPGA 3URAA 3DI1A 3IIPA 3GAYA 2UY3A 1JAEA 1RPXA 4HK5A 4WD0A 4YTUA 4A8LA 1Q1WA 2VFEA 4LW7A 1QOQA 1MFVA 4U31A 1UROA 5CC5A 2C3DA 2YL9A 1PKMA 1W1A1 4J3ZA 3PB0A 1UYQA 1UG6A 1MW0A 1JRBA 1Q8JA 3OJGA 4IX2A 2W6RA 1SW3A 5LA2A 4BI6A 1ZY8A 1FX6A 1TVLA 4X61A 3W7OA 5CQ1A 1CZ1A 3ANYA 4G7EA 3EKGA 1I2RA 2A1YA 1BLIA 3FHQA 3ZQ9A 3R13A 1YX1A 1ZX9A 3K5XA 2CLLA 4P8UA 1GG1A 5EBUA 1V6UA 3TC3A 3WF4A 3DFQA 2B4GA 2BVDA 3CIVA 4GH1A 2R1KA 3EBVA 3IJDA 4RW3A 1OYBA 1RJRA 1QDSA 3F4NA 5PTDA 3SURA 4WDUA 3WN6A 2D3LA 1FWWA 2O9PA 1A49A 3WEMA 1C8QA 1H1ZA 5EMYA 4XBKA 5JCNA 2VO5A 2P53A 4RKAA 3KBMA 3W72A 1OCQA 3DERA 5CKSA 2GH5A 1F3TA 5A6BA 3R0DA 1OYCA 3N25A 1UR3M 4A4AA 4YMZA 2CZVA 4XBSA 2PGFA 4EVZA 3HMCA 1FWEC 1OX4B 3U4FA 4IH3A 4DX3A 1W6TA 5AKQA 4IFKA 2I7GA 4PCTA 2HBVA 1P0NA 1TJ1A 1IZJA 3ITTA 3MQTA 1DJWA 1PTAA 5A6TC 4Z2GA 5G2IA 2CESA 1KFEA 3BSMA 3GXIA 3ZZ1A 4BF7A 1DE5A 3A21A 4AD4A 3GR8A 5E0CA 3FVMA 3AXMA 1SO3A 1M6JA 1GZ1A 1YNQA 4E4FA 3S2JA 2JEQA 4H8VA 2WSQA 4L9XA 1V59A 2EO7A 3TA6A 4ATDA 3N2TA 1V02E 1ISXA 2E6AA 3VUSA 3KTSA 3ZO9A 2HE8A 3GC4A 1QHZA 3CHVA 4K6AA 3ERPA 3V1HA 5E1QA 1Y5VA 3WK3A 3QV9A 5G4HC 1LG2A 1JCTA 3CGEA 1M41A 4W5UA 4YHGA 3PC0A 1IZKA 2PODA 4G7FA 2NV1A 1YPIA 2BY0A 2D0HA 4FAMA 5A6JA 1XGDA 3LB0A 1MEIA 1XYMA 2DZPA 5G1YA 1F4AA 3R58A 1K9DA 3WK2A 3S42A 5LA1A 3W3OA 5FS7A 4H4XA 1H7RA 3QM3A 3NQDA 2HE5A 1SR9A 2OO6A 4PUMA 4AVFA 5G5IA 4R33A 3M47A 2YDSA 1XRTA 4GACA 4M56A 1IR1A 2VEMA 2QW5A 3UWVA 3WJSA 3IIOA 1LG1A 4B5VA 1DJZA 2D73A 2EPNA 4FLQA 3LMZA 1GQLA 1NWRA 3GXDA 2ZA3A 4YXGA 4CD4A 4G9PA 3PJUA 4FOUA 2QVHA 2Y8VA 4LJ3A 3JZUA 1UH4A 3FHAA 3A7RA 3S1GA 5K2ZA 4F0MA 1DJGA 3NPWA 3SY5A 2E8YA 1EIBA 3L4WA 1KCLA 4JTDA 4L6HA 4PEKA 4C6PA 3B03A 4FXRA 1ZALA 3WD4A 5IM51 1CB2A 5F1VA 1GRTA 2DSWA 4FNTA 4M0XA 4LCRA 5K9CA 4PODA 1IIHA 2WBKA 3B9AA 1TMLA 2OWWA 1DP0A 3N4EA 7TAAA 4DM1A 1NSJA 2QZRA 1F76A 1EEXA 4MAZA 4IPIA 3NPUA 2H9AB 2P76A 1QW9A 4DXVA 3R6IA 1HJWA 3QF0A 1ADDA 1ZMDA 4IOTA 3UP8A 1J0ZA 2Z7GA 3CMJA 2GSJA 1LRNA 4YTQA 2PRHA 1SPQA 1XLGA 2XUCA 4QG8A 3I7RA 2XGBA 2G97A 1WOAA 1D7YA 3BUVA 3CNYA 2Y63A 2ZZ1A 3NL2A 4ZXOA 5HUPA 5AECA 1PYFA 4LQ1A 5HJLA 1IXNA 3NYZA 4GIAA 1IEQA 1W1TA 1UWAA 1JZ3A 1KB3A 1T96A 1OFDA 4HD5A 5K4XA 2VENA 1E9YB 3NDYA 1H5YA 3QPEA 4WVXA 3WJXA 4MJ4A 2XPKA 3H55A 1H3GA 3OQ8A 2J6XA 3SCOA 4H8HA 1M7OA 4HU8A 4JNZA 4PA8A 5TNVA 3ZMRA 4IJCA 1DYSA 3KL3A 2F9RA 1UZDA 4UTTC 1XS2A 3DFTA 1ZGDA 2V8ZA 2ZZ5A 1KNWA 1E1CA 4V2XA 1NDVA 1TCMA 3AALA 2PCEA 4DWDA 2R1MA 2ZUSA 3H7RA 4BF9A 4CN6A 5U4NA 4MY1A 5LNWA 4LANA 2NT1A 4CCCA 4DNAA 3N4AA 5A6KA 2D23A 4EXAA 3WQEA 1GHSA 1KFLA 2D22A 2Y8KA 1KR1A 5DMMA 3AHTA 2A3EA 3PM6A 4LXFA 1NARA 1W54A 2EF9A 3T8LA 5AB3A 3BCJA 2PAJA 2PWGA 4L5ZA 2X09A 4D9PA 1HKWA 4M52A 2V3AA 1RBLA 1W5NA 3W7EA 3K4DA 2W61A 1PCWA 4QNEA 2BXZA 1UOKA 4BS0A 1LWIA 3GE7A 3L67A 1VFOA 2X50A 1XGEA 4ZQPA 1OC6A 4X0VA 3QZEA 1NP0A 3S83A 5AYIA 3R25A 3GTIA 3V0SA 4WUIA 3QY8A 3TSMA 1GVSA 5HXMA 5ECUA 4WY0A 1MXDA 4W7VA 3N1AA 5HMEA 4HA4A 4H9YA 3FNDA 2WZMA 1XBZA 5REQB 5I3DA 3KOZA 5M1TA 4GA8A 3MUY1 4C5YA 3R43A 1DV7A 1MUWA 2EAWA 2NQLA 4H6KA 3IAQA 2FMOA 1R9ZA 1W9UA 1VBRA 4NZJA 2WW5A 1Q3NA 4NI8A 5DLCA 3A9BA 4HN8A 2WZTA 3HGOA 4DO7A 4R7WA 2IPGA 2VC5A 4ZB2A 1J6PA 3VNLA 1XHCA 4J3WA 2A85A 4LBUA 3SQSA 1MNZA 2WPFA 3VVGA 2ZDRA 3WG6A 1R85A 2DZVA 3GFXA 3TV8A 3PPCA 2Z1KA 1V79A 4EQSA 3HG4A 3C6CA 1OX6A 3V75A 3G0SA 4KKXA 1GTHA 3ABRA 2J9YA 1XC6A 1UD5A 2DUXA 1WZAA 4QP0A 4EQWA 3I6EA 4UFHA 1OG6A 1ECQA 3K8MA 3WEZA 1V3KA 1KXHA 1LBLA 4F2BA 3E1F1 4HJFA 4MVAA 3N4FA 1WP6A 1Q6RA 4AZ6A 1ZB5A 4LVBA 4IJRA 5A8NA 1QFEA 3EPNA 3USBA 3N9KA 3OG3A 3WMSA 5D9OA 3V1PA 3QQ0A 2PDYA 3EDKA 2ANUA 1WDDA 2HWGA 3C61A 3WYZA 3MJYA 1U1JA 5G2WA 3WH9A 1TPWA 4MIMA 4HSOA 1TRDA 3GVWA 3W7MA 5D38A 2VRQA 3PUGA 2QCDA 3CT7A 3DUGA 3NQAA 3UY7A 2BP1A 3N9SA 4K8HA 5D4YA 3U2OA 3W7RA 4KCVA 1HXJA 1SJBA 1L6GA 5I02A 5LNRA 4LAOA 1UKQA 1XL9A 4IPJA 2IMRA 1EF3A 3F5KA 2D2JA 1DIKA 3VTRA 1E6SM 4LCSA 4NZ4A 3MO7A 4KIRA 4LRTA 5AVHA 5FAJA 1UP3A 3G1DA 3WQ6A 4D6GA 1H4PA 4IL0A 3CPRA 2VC9A 1MMFA 3P81A 2X7VA 3GNXA 3UQNA 3KBSA 1QO5A 3F4CA 3VI2A 1CPUA 1HKKA 4DZHA 1AD4A 5HWJA 1QNSA 2OJPA 1SJAA 3EOOA 4UMAA 1F6PA 3P0XA 2ZIDA 3FAXA 1DJYA 1ZS2A 3WNLA 4LEQA 1J0KA 1QWKA 1GETA 1XPGA 1ME9A 4F9JA 3DHPA 2VX4A 3RCNA 1GCYA 4KGLA 1ALDA 1RCQA 2YXXA 3DENA 3I3EA 4WKFA 1JCMP 4GZIA 5KEZA 4HNNA 7REQB 3PBYA 1WXZA 4S2CA 1BRLB 2J7GA 4C6EA 1JAKA 3W1UA 3UF9A 2D3NA 4AG0A 2G4JA 2XSAA 4DBSA 3VOGA 3LHYA 4E8DA 2W3SA 4JN8A 2VZSA 1FWBC 2HXTA 3IK2A 1FFQA 4CD8A 3IJ7A 4ASTA 4K68A 3SY8A 4MOZA 3PFRA 4TVWA 3T2OA 3RYSA 2PF0A 3V5FA 4KGJA 4KMQA 3NUKA 3BV7A 2XIIA 2QIWA 5GVJA 2PZ0A 3W82A 2I17A 4GKTA 1ZBCA 1VBHA 2V30A 4JFTA 5LNVA 1UIPA 4ZQNA 3GWQA 2ZZ3A 1WZMA 1SU5A 4CN1A 1S3TC 4GIYA 1UR0A 2Z7KA 2PDFA 1GW9A 4AIUA 5FD0A 1R8LA 5T26A 3SIZA 5D8ZA 5SWUA 3F7JA 6REQA 4CUCA 3DEQA 2W4XA 3EPOA 3PFMA 2PURA 1RPKA 4AYGA 1EPVA 3QMTA 4YS1A 1GT8A 5AVNA 1C9WA 1XYLA 5U7SA 3W29A 4TVYA 1V97A 4C1NA 2QGHA 4O28A 2WJZA 3FA3A 1CW2A 3G22A 4O8AA 4UFLA 4BQ4A 3BMVA 1R7OA 3BPWA 1JGMA 2IPFA 3AXKA 5M17A 2OPJA 1Q5MA 5HMDA 3S1XA 3W70A 3VIPA 2WPGA 3BLEA 2DGAA 2DP3A 4ZXLA 1WQ5A 1Z48A 3WUBA 3EX1A 1GRBA 4HOXA 4MWAD 1H7XA 3U4AA 2QF7A 4ZO9A 3ATZA 3B0PA 3CS2A 1TG7A 1EUNA 2Y0FA 1DWAM 3PSVA 3C0SA 1ZCOA 1IGSA 4G8TA 2HTMA 1ZSXA 4TX8A 1QJWA 1M9HA 3MPGA 3QQWA 4Q3MA 4JX6A 3NIYA 3WDIA 2VXNA 1BVZA 3VOJA 4PMUA 1IXOA 1W31A 2R1NA 5ABGA 3LCLA 2G3JA 1EJRC 3SGZA 3M5ZA 4QLJA 5DO8A 1KRBC 2VOMA 4AW7A 2QKFA 4PMJA 3G5EA 1FCUA 3SFKA 4BI7A 4LNCA 3GK0A 3PJTA 3W23A 4G5DA 5G1MA 1XLJA 3OG2A 3QBUA 5BOFA 5H2ZA 2ZVIA 4IIFA 1I1XA 2WLYA 2Z2UA 1AK5A 2ZUNA 4GIRA 2C71A 5AYYA 2FVLA 1XF0A 4B15A 4H4RA 4A8IA 4B5XA 3LS9A 4E0CA 3VM5A 3OW1A 4U5IA 3IAPA 2GK1B 4DVOA 3ITGA 3QQ1A 1A5SA 1GOIA 3NQ6A 4IP7A 4D2JA 4GR1A 1FIQB 3KOXA 1CI1A 3RILA 3O06A 2REQB 3W84A 3H2EA 1OFAA 1A4MA 3CO4A 1FXPA 1A5LC 3I3DA 3P8IA 2C19A 4MNLA 4Q32A 1CT5A 4GQBA 3OIXA 3GNRA 1BQGA 2Y62A 2AGKA 2ZZ2A 3LZ5A 3W83A 1BYDA 2PDWA 2WMFA 3UU0A 1TVNA 4MDPA 1XP3A 1S5VA 3GG7A 3EXSA 1OGSA 1FWNA 4Q8NA 3M0IA 4JR5A 4F0HA 3K8KA 3S47A 1EO5A 4UTLA 1A0EA 1M7XA 1E51A 3LCFA 2QAPA 2X99A 2J8TA 2VTFA 2FB2A 2TPRA 3LQLA 1HJQA 3IPWA 2QV5A 2PCQA 4HYWA 3PBVA 2VGIA 4H9XA 5LGZA 2W5FA 3I68A 4JTRA 4OIFA 1EOKA 1VDVA 1DTUA 3L4XA 8XIAA 2OWXA 2OO0A 2WOVA 4GBDA 4MY9A 2DZAA 1RCOB 4JKMA 3W53A 2CZEA 4ICMA 3AIVA 4JTGA 1GORA 2XVPA 3V0UA 2VEIA 1J5SA 4CQCA 1GVRA 4BWLC 1SYTA 2KX9A 3N17A 3EWXA 5CCZA 1P1XA 4ML4A 1GYNA 4FP1A 2CEQA 2YB1A 1QNRA 1DJHA 3JU2A 4GO8A 4MSSA 5J04A 4XAYA 4V1YA 2V0TA 1ZAIA 5A6AA 3FXYA 3O15A 4U4MA 2IPWA 1QK0A 1WDSA 2A0NA 2P8BA 2V9DA 2VM8A 5GNYA 3HG2A 1FWHC 2P5NA 3GIPA 1IT0A 3KOYA 3MS8A 4V15A 3WELA 1KM2A 3RX2A 1GQKA 4S23A 1L6FA 1FWFC 3IUDA 3LDVA 3C52A 3S5SA 1JDDA 3E0FA 4UMBA 3SRFA 2ZUWA 3GQYA 3UVIA 1OCBA 5BWAA 3VZXA 1MYRA 3FX4A 1NU5A 2X16A 3P62A 2PWFA 3OBKA 3VOIA 4KWWA 3SQLA 3PPHA 1G4EA 4PUWA 2VZOA 4LA1A 3B8DA 2O9RA 4C6CA 2E4TA 4LUTA 2GVYA 4GVIA 3NTYA 4UFKA 3QW3A 3HF3A 4RNHA 1US3A 3AMGA 3RRXA 3H54A 1AL7A 1OWQA 4F0KA 1MWOA 2XM1A 4IG2A 3SZ8A 2EPMX 1HN1A 3SUWA 1MRAA 2Z24A 3DX5A 4NZFA 3EWZA 1SGJA 1UCWA 3AIEA 2PLCA 5KZDA 1VHNA 1PAMA 4PCPA 4Q8WA 3P2VA 3ZSTA 3QR3A 1AW1A 4I9AA 3AZTA 1J0HA 2J7BA 6XIAA 6PTDA 4IIEA 1BSLA 3HRDC 3PUDA 1EWDA 3EOUA 2OQYA 1YDOA 2HV5A 5KVHA 1E0XA 4KWSA 1M04A 4ZQOA 3E2SA 4AD1A 3F03K 3U0HA 3VIJA 4J3UA 1W2PA 2OR2A 3LERA 4OOZA 3WD1A 3VKBA 3VNJA 1NIUA 4RJEA 4OBSA 1SZGA 1N8IA 3T05A 3WDRA 4LS0A 2XFFA 4PFMA 4G2DA 4PB5A 1WPCA 1K6AA 3EWCA 2X40A 1C90A 1PX4A 1ADSA 1H63A 4RK8A 1AFSA 4KF1A 4H3DA 4U3AA 3PJWA 4HNUA 4OBTA 4U28A 1N60C 1YDVA 1AZ2A 1I75A 4W89A 5EBAA 1OBAA 3LB8A 3HQNA 3T0CA 2R24A 3UG8A 3N18A 2ZRWA 4NEWA 4HCHA 5CZ0A 4OOUA 4GC4A 1SO6A 5HWMA 1LOSA 2VL4A 4OE7A 1FHVA 3LV5A 3NQCA 1UWUA 4ZVJA 3TSDA 3WQVA 4MB1A 1YDNA 1ZNNA 4BURA 3MCMA 2J4GA 4YN5A 3A6OA 4DBEA 3ITVA 3S2CA 1DEDA 3T08A 4AZCB 4RX0A 2QDEA 1HO1A 5IXEA 5FOOA 2AAMA 1R9XA 2BHYA 4LEFA 4Q8PA 4IIHA 2ZWYA 3M5VA 1Z32X 1MQPA 1QPOA 2YVFA 4AY7A 1OQFA 1VC4A 4GG9A 5CSUA 2V3BA 3OLGA 1JGIA 1J10A 4JPGA 5FJIA 1F3XA 1FCQA 1UD8A 3AWOA 3CGDA 5C9WA 3PZMA 3FS2A 3ALGA 3ZJ8A 2VOTA 3CASA 2H90A 3PNZA 3MT1A 1ME7A 3NSNA 2ZTJA 1MSSA 2DQXA 2D69A 4YHEA 3WDPP 4RL3A 2P1FA 3CYJA 2H3DA 2BOGX 3VA8A 4EXQA 1N8FA 2WOQA 1KR0A 4NAFA 4N6EA 1HW6A 3NS1B 3F4DA 3CIXA 4MB4A 1L8NA 3WQ8A 1E9ZB 4NVTA 4W7WA 1XLHA 4HVXA 4AEFA 3AHXA 2WMJA 3SN1A 1WXJA 1LL4A 2E67A 4GQQA 1Y7VA 1UWIA 1SO5A 3AWNA 4F3HA 4PL2A 3SBFA 4GD0A 3AO0A 4PC8A 1ME8A 1HUVA 1XRFA 5M3WA 2E1DA 2GGIA 7ODCA 1ISVA 4DJEC 2B7PA 2PE4A 1JF6A 1KM3A 1UW9A 1VHCA 3DDMA 3H12A 2GQWA 6XIMA 5AHNA 2YJQA 3CUXA 4FEZA 4AY1A 1F05A 1Z44A 2A3LA 3Q94A 6CGTA 1UMLA 3MSGA 4TQTA 1TUXA 4JEQA 3O7UA 4O13A 1IZCA 3NVZB 4REQA 3T0AA 3N2XA 1AG1O 1RH9A 2A79A 1TV4A 1C7TA 3SCWA 1W9VA 3OGVA 3UBPC 4Q6JA 4IXHA 4Y7EA 4XZLX 3NR0A 1VFTA 1DJIA 3WK1A 1STZA 3TAOA 3STFA 2OLAA 1DBTA 1OG0A 2IPJA 2VT0A 3OC4A 3W6LA 4ORMA 3M7WA 4NKCA 2GUBA 3RGTA 4AFYA 3DAQA 2Y88A 1ZDLA 2H8ZA 3DJJA 1K9FA 1B2YA 2Z1VA 4E8GA 3SSZA 4GIEA 4E8CA 4EPEC 5FS6A 4HPHA 4BQ3A 1QI0A 3I6TA 3GG1A 3KEHA 3VNYA 4Q4PA 3WD3A 3V18A 1UR8A 1I0BA 1H62A 3ARXA 1VRXA 1RALA 3IVTA 4S3BA 1RD6A 3SRHA 3W71A 3GFYA 3BJSA 2C79A 2J6VA 3WDQA 4NY2A 5I79A 1RY8A 2OGYA 5CBBA 2INZA 2NX9A 3VKKA 5A8MA 4I9MA 2G3NA 1A0DA 3MMTA 3NZPA 4UC5A 3KTXA 3T0BA 1XLDA 4KCTA 3DKJA 5HOSA 2VR2A 4ZB0A 1R6WA 1V7YA 2UY5A 2XVKA 3GXNA 4AMCA 4QSFA 4HMCA 2A6LA 2E77A 5K3VA 4CD6A 2Y7FA 4KIEA 3HQ1A 4K8EA 3CQKA 4XSMA 3PTQA 2V82A 2HXUA 3W2LA 3MUCA 3BAXA 1YYAA 3B8TA 3QYQA 4JQ4A 4YVXA 3CH0A 1UD2A 4Q8TA 2GQAA 1GRFA 3H7UA 1BEUA 3SCVA 4QAIA 5I77A 4GOAA 3TTEA 2NXHA 1F8WA 2WV8A 1NEYA 3FGCA 3THQA 3VINA 3D46A 1G7VA 1W9PA 4XVEA 3STEA 2ZUVA 3GO2A 3QV8A 3EWWA 5AYZA 1OJTA 3VAVA 3BLPX 1VCFA 2GVLA 1R5YA 2YIHA 5F4SA 3LCGA 2E6YA 4IIBA 4EWND 4RDYA 2EQ9A 5T9BG 5DT7A 5I0DA 3G2GA 3T0DA 1XH0A 2NLIA 1M6IA 1TV5A 3SJNA 5I3JA 5D8WA 1WDQA 1YLVA 3PTDA 1R87A 5DRIA 3U2EA 3DFNA 1QATA 2XIBA 2ZRXA 1F3WA 1RQBA 2P88A 1YQ2A 4NSBA 2WP6A 2XVGA 4B90A 2QR6A 4N4PA 1MVYA 3P5YA 2VI0A 1P6CA 3QPYA 2CKRA 5I3HA 4RDZA 2O9OA 3BAJA 4P8XA 1X97A 4C1KA 1KXTA 2E5BA 1DL3A 4A35A 3DGHA 1NHQA 1ZUAX 3VABA 1YBQA 3ZT5A 3ZXWA 5IBXC 3LXCA 3OIHA 3MY9A 4MZYA 1TSIA 1GOMA 2Y85A 3KE0A 1FP9A 4IWWA 1RBAA 4MJZA 3G1YA 3GG8A 2QCLA 4F0SA 3GC2A 2Y1HA 2YKKA 2Z1XA 2DVXA 4YWOA 5A6LA 2YDAA 1NHRA 1FXQA 5BMWA 1W1VA 5MKGB 2C3ZA 5HBFA 1TKKA 1AJ2A 1FWGC 4GC3A 4AWUA 2FLIA 1XM3A 3NL5A 1OYAA 4S3AA 3TN4A 3VNMA 4NYYA 5I2UA 4QFUA 5LIWX 1W8SA 4KRTA 2RKXA 4EPKA 3MZNA 3M0ZA 4RE0A 4GVGA 2VX5A 4ES4A 1FDYA 5DMNA 3KUMA 2CHRA 5HA7A 1OC7A 1W56A 3W7JA 1CTNA 2POZA 1JJKA 1NDWA 3KL0A 3GZ3A 2WSPA 4ATLA 1H7PA 2DJXA 4XIAA 2ZTKA 3V5OA 2QLYA 2P3ZA 3BH4A 3U3HA 4D8LA 4ECLA 2WBGA 2QDHA 2VGGA 4Y8FA 1WYIA 3RG6A 1R86A 1CXKA 5C7HA 2IS7A 1QI3A 3LHTA 9XIAA 4UOQA 3QEZA 4OU1A 1OJXA 3RLHA 2E5CA 3N15A 4UNIA 3DG3A 3FOKA 3UG3A 1EXBA 1AD1A 4LAZA 3TQ0A 4Z1DA 2HK1A 4PTXA 4QLLA 1ML1A 3IK4A 3G0XA 2FVKA 3URNA 1UZ4A 5J5RA 3NVDA 1KD0A 2WCSA 4TXEA 1I8JA 2GGGA 3WUGA 1EGZA 1N55A 1U22A 4O1EA 3N73A 4DJDA 3B4UA 1B9ZA 1TREA 1V3MA 5HQEA 4FNRA 2JKPA 2IKIA 2GRTA 4NZCA 4Q8UA 5A5WA 1B57A 2DFAA 4RZ4A 1JDFA 3WL1A 1SW7A 1LL7A 4L80A 2I5GA 3QHMA 3CWHA 1H51A 3BCFA 2OTDA 1AQMA 1XH1A 4YYFA 1M3UA 1PUDA 4M24A 2IXVA 4APNA 1SMAA 3CAWA 2WPEA 4LUSB 1HG3A 1EIXA 3N14A 3NVVB 1UKOA 2NVDA 4CQBA 4H8UA 2AAQA 3EA2A 3WF1A 1O4UA 5EL1A 1G0CA 1FEBA 4C6NA 1S39A 4A21A 3G6LA 4F2UA 4S1FA 4NHVA 3AISA 1JI1A 3TJ4A 3II4A 4C1LA 3FAWA 1U1HA 2NX1A 1BWCA 3BLKA 3LCWA 1GK8A 4XSLA 4Y96A 3SJ3A 3E0IA 1PX8A 1J8VA 1HJSA 2WPBA 4IMDA 4W87A 2XTKA 2YCIX 3QY7A 3VOFA 3H7VA 1DWJM 5G5HB 2CWNA 2D1ZA 2FZMA 2P8CA 4Q4OA 1LZOA 2J78A 4OTKA 1ITXA 4J57A 2YDQA 3EAOA 1GOQA 3GDTA 3V4BA 1GVIA 5DCDA 4J35A 2J79A 4WSHA 4O4VA 1IEXA 3W25A 3GC5A 4OV9A 3EZ4A 2YCLA 3P0WA 4J3VA 1TIMA 4U2ZA 2ZA2A 1F74A 2GZXA 4JFVA 5IHRA 3J7HA 4GI8A 4GUHA 3W87A 5A8QA 1C7SA 3MYOA 4GQRA 4GYPC 1J4EA 2BLEA 2EHHA 4QDWA 3L2IA 4UTTA 4YCOA 4F4RA 4J5NA 1Z3NA 1VRDA 3FIGA 3G1FA 3GRIA 4I5RA 2NQ5A 4W88A 1ENUA 1BQCA 3REQB 3AJXA 4L6OA 3P82A 1TTQA 3WDJA 2EGZA 1WA3A 4FMVA 4EMIA 2YR1A 4DQWA 2W54A 4O0ZA 4Z1AA 1JL8A 4LFYA 1RP9A 1D9EA 3H4WA 3STGA 2XN0A 5GNZA 4H9ZA 5LIXX 3CJPA 4WZHA 3SUSA 1QPKA 1UUOA 3BSHA 1J6OA 3ICJA 3ZSSA 3M41A 4ADWA 2DVUA 2XDFA 1IWBA 3AXXA 3NZ1A 4AB4A 1P4CA 1U5VA 2PDGA 1BWLA 3FSUA 2QYGA 4UQBA 5CG0A 1BHGA 3GZAA 4WR3A 4JL1A 3HV9A 4PSRA 3VNIA 5I07A 5HWNA 3PN8A 3N6HA 3UCQA 3GD3A 1GUVA 1NHPA 3W74A 4FNQA 4YIWA 4RE4A 5A94A 3ELFA 1HVQA 4S3KA 2CBVA 2OOFA 4H7CA 1G69A 1C9DA 1PHQA 2HISA 5CPQA 5D03A 2YFOA 4CU6A 3RIKA 3EDFA 1XIJA 1XDLA 2CIPA 1BGGA 3AYSA 3VNDA 4EIVA 4TIMA 3V5CA 4L61A 5G1TA 1RQHA 4UTHA 4OZOA 1UC4A 2DDXA 1JDCA 3VGFA 5JCIA 3WF0A 3IGUA 2ZBTA 3NGJA 2XINA 4ACYA 2Y7EA 4Q8VA 4NQ1A 3TTOA 4JY9A 5FIPA 2ISWA 4DBWA 3KRUA 2W0HA 5A6MA 2HPIA 3AS1A 2YZ5A 5EU9A 4C6MA 3Q65A 4MZ1A 1A47A 3CZGA 2DW6A 3N3TA 3CZEA 3LTYA 4B4HA 5CJ5A 1XIDA 1AUSL 1NDZA 5CLWA 3CMGA 3V16A 2H6RA 1QI5A 2VFDA 1FKXA 4JICA 3H2AA 3CO8A 3T2PA 4JFWA 4PMOA 1TJRA 3EAUA 3G8RA 2ALDA 2F6UA 1SMDA 3BZGA 1WDRA 1UR2A 4B3LA 1YHTA 3RM8A 5DBUA 2EQDA 4WGXA 5IOBA 1WAUA 1KGXA 3MI6A 3O63A 1PKLA 1G4SA 4XZWA 4GRSA 5F7UA 1VLWA 1N2VA 3ONCA 1W3JA 4DRSA 1SM9A 4WOZA 5HQMA 1HTIA 4C6OA 4DN1A 3Q4DA 4JKLA 2VURA 3NQ7A 3AUOA 4GY0A 4B5UA 2HZGA 3WK0A 4OGZA 4TVUA 1OT2A 3E5BA 2QUTA 3BLDA 1OCNA 4I7VA 1XPYA 3KLKA 4IGNA 5EMJA 5GRTA 4FA3A 1WX0A 1FUYA 1W9XA 1MO0A 2X1TA 5BXTA 2PGRA 2QV4A 1S7MA 3GFZA 2CBJA 3EPMA 4C65A 4ZENA 4H9VA 3F4WA 3TAKA 1QMLA 3MA8A 4JD4A 3ZVIA 3VNKA 1NTHA 4RE3A 2FZNA 1EC7A 1V3IA 3UXIA 1LDCA 3TNBA 1A80A 4E3VA 1U33A 1KQYA 3L4ZA 4GUFA 4DO6A 2CCRA 3FV9A 4JYFA 4LBRA 1IT7A 1N8WA 3SDOA 1EO7A 4M51A 3URHA 3W0KA 4R5EA 4I6VA 2X1SA 4J7RA 5A8GA 4AZBA 3BG5A 3EB3A 4AY8A 3RCYA 4QQUA 4X9YA 4AMAA 1GRAA 2BY1A 4E2DA 3G6MA 4QIUA 4DYKA 5HJYA 5C54A 3VU2A 3K1DA 3BURA 4G6CA 3GUGA 2PTZA 2DZUA 4WEVX 4IHCA 1MZRA 5K9XA 1F2JA 3QY6A 3HFYA 3TW7A 4FPSA 3BV4A 6TAAA 1X39A 5AY7A 3K8LA 1U2YA 1YPFA 5IFTA 2Z1WA 3R2GA 1PZ0A 4RNIA 4B5WA 3KZPA 5LNSA 2OB3A 4IMAA 1HL2A 3A13A 3EXTA 3IIXA 3VIFA 1V4YA 3GKFA 4DWSB 4FS9A 2PF8A 4GK8A 4UTFA 4JTKA 3ME3A 3MKCA 1MQRA 1A5NC 4ZOEA 4W8BA 4AISA 4AX7A 1NFPA 5DXYA 4JTJA 3OGSA 3ETRB 3KHDA 2EG7A 4KEVA 4BI5A 3IJ9A 1R38A 2PD5A 4D6JA 2CZFA 3WDHA 4IMCA 3R0KA 3ZLGA 3IS4A 1JEHA 2ZDSA 5F2IA 4XVDA 4XZMX 1TVPA 1ZCCA 1IXQA 2JF7A 1FP8A 2ZZ6A 3C86A 1UWQA 3R5EA 1LQ2A 4FDCB 2PDNA 2PWHA 3GDKA 1PIGA 4U5KA 5CLTA 4DJEA 1MO9A 3P14A 2ZE3A 1Z9AA 1MW1A 5HULA 5C9XA 1V0KA 3G1VA 1UPPA 1GOWA 2PTDA 4H2CA 2GWNA 2QNEA 3COTA 2ZX7A 3PWGA 4RW5A 4Q7NA 1JPHA 2X8GA 2FGBA 4JIEA 3W1RA 1PSCA 3W28A 1XW8A 2YDRA 2GGHA 3W7IA 2EQ8A 4H9MA 4KRUA 3SQPA 1ZRQA 5DANA 3GTXA 2CBIA 1E1EA 3ABSA 2ZKMX 1W0MA 3KRBA 4XZHA 2PDLA 1OADA 2X0YA 1JPKA 4ZSUA 5EKYA 1JF5A 1JPMA 2I56A 3A9IA 4LB4A 3RR4A 1BVWA 4XO6A 4FR6A 2WVVB 5XINA 1KV5A 1EA0A 4Y9PA 4L9YA 2CPUA 3I4KA 1EBHA 2V5KA 1U5HA 1QASA 3I4EA 4NYUA 1TPDA 2EQ7A 4JTQA 1TV7A 5AHFA 3C4UA 4AWEA 1TPUA 4L9ZA 1QW7A 1LUCA 3VIIA 1Z41A 5G2HA 1Q6CA 3EX2A 2BY3A 4O4WA 3L2MA 2J25A 2VYOA 3S2MA 3T4WA 3FW6A 5JXQA 2W63A 1K70A 1Q85A 1ZP4A 1ONEA 3HJZA 1V6YA 3A4WA 2RUSA 4UZSA 3VZZA 9XIMA 1EGVA 1ZAHA 3B9DA 2FPYA 4JTFA 2PS2A 3WNNA 3TH6A 4HZ7A 5FAGA 1TFVA 1W3TA 3T81A 1RQEA 3KLJA 4W8AA 3KBVA 4KEZA 4GJJA 3CHFA 4G56A 3E6EA 1H2IA 3OLEA 3E2QA 3LQGA 3V0TA 7CGTA 1REQA 3TC6A 3CXBA 4QBXA 3G1RA 3IJIA 4LY8A 3RJXA 3B0YA 5IRPA 1UKTA 2DZBA 4S3CA 3CQHA 1P1MA 1OK4A 2BVWA 2GR3A 4Q4KA 3THUA 1KWGA 3W76A 2VMFA 1BTCA 1ICQA 3B0VC 2ZUUA 3VGEA 1OHLA 3GTFA 1VR6A 2BY2A 2P10A 1WBJA 3LHWA 1KFWA 3MWCA 1GERA 2PRMA 1OSEA 3HG5A 3WX7A 1WNOA 2JKAA 5LIYX 2WJEA 3MO4A 1FWJC 2C0AA 5CSYA 2V3FA 4GO9A 2E9BA 1Q13A 1W5MA 1DXFA 3S8HA 1OFRA 4TMBA 3L5LA 1PZ1A 3GIQA 2EXOA 2WVSA 3ARPA 4QSHA 3B05A 4GGBA 1CYGA 4F0LA 3UZ5A 4LAUA 1JDAA 1VPXA 4R34A 5LHEA 3QH2A 5FSDC 3MBFA 3NPXA 1XQLA 3AHVA 4LYQA 2PZNA 2VGFA 1VGAA 3L68A 7XIMA 4OJYA 4I3GA 3C2VA 5FCZA 3DJGX 4M6QA 1D7KA 3R11A 1JCLA 1Q6QA 5DMYA 1YKWA 3NZRA 5DRCA 4JDBA 1UH2A 1LWHA 3O2LA 5I7GA 2W66A 1SJCA 1XKYA 3RO8A 4K38A 4AHOA 3RF9A 1BYAA 3GBDA 1US0A 1KKOA 3OQEA 5CH9A 2XISA 1EJTC 4UR9A 2C7FA 2F84A 1EJVC 1EJXC 4AC1X 1SZFA 3G77A 3OYXA 3PB2A 4WHBA 1CCWB 4EK7A 5HNNA 1TZ7A 5C0QA 1W3HA 1B31A 1DTNA 3KVLA 3NWRA 4N42A 5IHSA 3TZFA 1O60A 2Q8LA 4QITA 3LTSA 2ZX9A 4PR4A 5DF0A 4OV4A 1KM4A 1Y8BA 3N2CA 5G4EA 2Z6IA 4WY0F 4FIRA 1X1OA 5H91A 4O1AA 4JTHA 4JQAA 2OOGA 3BL3A 1GQIA 5C9UA 1BZLA 2NVAA 3KM8A 4TMCA 3M44A 1UUQA 1AH0A 3N2MA 4I7WA 4HZ8A 5L9FA 4FZIA 1RJPA 1J93A 3G18A 3PTMA 2QS8A 4YTTA 3ITCA 1LWJA 4TOQA 2Y4SA 4FNSA 2I14A 5A2CA 3N2BA 4X3ZA 5D9MA 1EX5A 3XISA 4XAGA 4EWJA 4BQ5A 5E6ZA 3D5HA 3SEPA 3TLLA 3VILA 3NXFA 5GNXA 1FFRA 3HM7A 3DK9A 3SI9A 1TYPA 3A3HA 4ZMGA 1MXGA 3GS6A 3GXMA 3M0LA 4MPQA 1H2JA 2QHAA 1TMHA 3GYCA 4H4IA 2V3GA 2QJMA 4QISA 1YADA 3QR0A 2ZXBA 1N63C 2CLIA 2C0HA 3OA5A 3LUTA 4GMEA 3NQEA 1T3QC 4QG6A 3GVQA 3S9YA 3H23A 1V7AA 4PCNA 2BB0A 1ZENA 2H9AA 4KRZA 3WQ4A 3LSBA 3USZA 3ARRA 3PANA 4E4UA 4RZ6A 1FVPA 2NVKX 1Q63A 3ZWSA 2CHOA 3L66A 3VOHA 3OVPA 5GQBA 3BQ5A 4IXXA 1CGYA 3QTGA 4V27A 3D0CA 1X7IA 3IWPA 3GW0A 3OVGA 4CVUA 2V2CA 1K7XA 3NURA 2GJXB 1AQFA 3IIZA 4Y8EA 1E40A 3GLCA 3IJ8A 4GFSA 5CSSA 2D2GA 4AVOA 1MW2A 2J77A 3PZNA 4HMEA 4AHQA 3GXFA 3W7DA 4IMEA 2BGQA 3JVAA 1RP8A 3BDKA 5KMYA 1H5VA 3QKZA 2ZC8A 3BANA 2GVGA 1EC8A 5D05A 1XICA 4EACA 2BC1A 3O0HA 2XH4A 1V03A 2FZ8A 4MHBA 4UCGA 1M01A 4IUGA 4J4KA 2QAFA 1TJPA 3LCXA 4J28A 3CB3A 3NQMA 5LIUX 3D47A 1T8XA 3MI3A 1WDWA 3JW7A 1TTJA 4MF4A 1G67A 2ZFAA 3MVIA 1LROA 1ZJIA 1VH7A 3FEMA 5A6SA 4AF0A 2X2YA 4GYKA 3UY8A 1PXGA 1VLIA 2V5DA 3CT2A 3ZT7A 2F6KA 3SAZA 3L5AA 3VD5A 4IISA 4WIWA 4V33A 3GM8A 3KDOA 3IIVA 4B5NA 1Q6OA 1L6WA 2WMGA 3M46A 3VC5A 1MFUA 2NPXA 3G24A 3L23A 3BAKA 1MRQA 4JTSA 2YXOA 1CENA 3QW4B 5BROA 3EMZA 1K7FA 4NU7A 3FDKA 3NA8A 1XV8A 1D8CA 3MMWA 4V28A 4QE5A 3IGXA 2QJHA 4LOCA 3AU2A 4C7FA 5AHEA 1E9LA 3RPTA 3V36A 1FCBA 2QULA 1JOAA 1R46A 4PE8A 3AMZA 4XKMA 1FFVC 3QGAC 5LXEA 4LBSA 2FGZA 3HGRA 4IX0A 2OELA 2QJGA 2B31A 4WY0B 1PZ3A 2WSYA 1OFQA 4JNYA 3NL3A 3SSJA 4Y90A 4O12A 5REQA 1TWDA 4H6EA 1S2CA 5FJUA 1JZ4A 4GZ7A 2OKTA 4GWEA 3LENA 1A5KC 3QTPA 2G3MA 5B7ZA 2BXYA 3W2KA 3H2FA 4I8DA 3C8FA 4HP5A 2VEGA 5A2AA 3MSDA 2RDTA 4R7OA 3MZ2A 3ECQA 1W17A 2GR0A 3UD6A 3N6QA 4X22A 4ZFCA 3OLDA 3WL0A 4N02A