3OZYA

Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg and m-xylarate
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
386
structure length
386
Chain Sequence
SLKITEVKAHALSTPIPERMRVESGAGLKLNRQMILVEVRTDEGVTGVGSPSGPYDLAVLKRAIEDVIGPQLIGEDPANINYLWHKVFHGEVSRNLGHRSVGIAAMSGVDIALWDLKGRAMNQPIYQLLGGKFHTRGVRAYASSIYWDLTPDQAADELAGWVEQGFTAAKLKVGRAPRKDAANLRAMRQRVGADVEILVDANQSLGRHDALAMLRILDEAGCYWFEEPLSIDDIEGHRILRAQGTPVRIATGENLYTRNAFNDYIRNDAIDVLQADASRAGGITEALAISASAASAHLAWNPHTFNDIITVAANLHLVAASPHPAMFEWDITHNDLMTRLASYDLKLENGLVQPPQGPGLGFEIDWDFVAAHAWKGEPAIGAGHGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative mandelate racemase
publication title Crystal structure of enolase superfamily member from Bordetella bronchiseptica complexed with Mg and m-Xylarate
rcsb
source organism Bordetella bronchiseptica
total genus 134
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ozyA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ozyA01
2QJMA 1KKOA 2PTZA 3CK5A 3SN1A 4G7FA 2OLAA 2ZADA 2QDDA 5EU9A 2HZGA 3S5SA 3JW7A 3SSZA 2QVHA 3JVAA 1P48A 3H70A 5IDZA 4H83A 2OO6A 2PTXA 4IT1A 3CXOA 3PK7A 4KEMA 4ROPA 3Q4DA 3TW9A 1KD0A 4FI4A 1P43A 3R0KA 4GYPA 3H12A 4MMWA 5FJUA 3TWBA 3I6EA 4E6MA 2FKPA 3N6HA 4E4FA 5FJTA 3K1GA 2P88A 3P93A 3CYJA 3ENLA 3FYYA 4DXKA 4IL0A 2GGHA 3BOXA 3QPEA 2MUCA 1TKKA 3UJFA 2PCEA 3NFUA 3R10A 4KT2A 3ZVHA 4HCLA 2AL2A 1XS2A 4GGBA 1SJCA 1R6WA 3T4WA 3MKCA 1TE6A 4JHMA 3SN4A 4K2SA 3THUA 4EWJA 3V5FA 1MUCA 1EBHA 2XH4A 1WUFA 3UXKA 2RDXA 4ZCWA 3MY9A 4E4UA 3N4EA 5BOEA 1ELSA 1JPMA 3OZMA 3MWCA 4GYPC 2GSHA 1MNSA 3DG3A 3DFYA 2QJJA 3DG6A 3T8QA 1ONEA 3FV9A 2NQLA 2P8CA 3SN0A 3RGTA 3SQSA 3SBFA 3TCSA 2QJNA 1JPDX 2OVLA 4DX3A 3BJSA 4E8GA 2PP3A 1FHVA 3QLDA 2PTYA 3BSMA 2PP1A 3V3WA 3TTEA 2POZA 3FJ4A 4J3ZA 1ECQA 5FJOA 4K8GA 3DGBA 4M6UA 2FYMA 2PGEA 1BQGA 1KKRA 4M0XA 3U4FA 3ZVIA 5FJPA 3VFCA 4H1ZA 2XSXA 3UJSA 4DYEA 3ZVHB 2XH7A 2AL2B 3V5CA 3P3BA 3UJRA 2GDQA 1IYXA 4MGGA 3DESA 1TZZA 1DTNA 2OZTA 3NO1A 2OZ8A 3UCDA 2QGYA 3VCNA 2GGEA 1YEYA 1EC7A 1RVKA 1NELA 4HPNA 3FXGA 3ZLHA 2OZ3A 3I6TA 3D46A 4KPLA 2QDEA 3DDMA 2AKZA 3VC6A 3VDGA 4G8TA 3RO6A 4IP5A 4IL2A 1R0MA 3QTPA 2AKMA 4DN1A 1BKHA 3ES8A 3UXLA 2P8BA 3D47A 4HN8A 2DW6A 3QN3A 3ZLFA 2PPGA 1W6TA 4HYRA 2P3ZA 3FVDA 4YWSA 1SJBA 1XPYA 2PMQA 3V4BA 3NZGA 3CT2A 2ZC8A 3TWAA 4H19A 3U9IA 3PWGA 3N6JA 4GIRA 4GISA 4FP1A 2PA6A 4GMEA 3EEZA 2QQ6A 3UGVA 2PS2A 3CB3A 3OP2A 1SJDA 1EC8A 4HNLA 4A35A 2OKTA 3VA8A 3GY1A 4IHCA 4F4RA 2HXTA 5J04A 3OZYA 1PDZA 4GGHA 2I5QA 2GGJA 1MDRA 2XH0A 2OQHA 2OPJA 3PFRA 3T9PA 1MRAA 4Z17A 3JZUA 1SJAA 3KUMA 3DERA 3MSYA 1NU5A 3S47A 2CHRA 3GC2A 2GL5A 2PODA 3DEQA 3OTRA 3UCCA 4DHGA 4DWDA 3PWIA 1E9IA 4MKSA 3DIPA 3OPSA 3SJNA 3STPA 4HCHA 3RR1A 1KCZA 2HXUA 3IJQA 4Z1YA 1JDFA 3I4KA 5BOFA 4A3RA 4IP4A 3ES7A 1MDLA 2OG9A 3GD6A 4A6GA 3RRAA 4ENLA 3RITA 4K1WA 2OQYA 3MZNA 1FHUA 2P0IA 2PTWA 3IJIA 2GGIA 4HCDA 3N4FA 2PU1A 3R1ZA 4X2PA 3DG7A 3OW1A 3UJEA 3TQPA 3VCCA 3VC5A 3ZLGA 1EBGA 3HPFA 4JN7A 6ENLA 1EC9A 2PSNA 3FCPA 3Q45A 3NXLA 1L8PA 4J1OA 3TOYA 3R11A 4E5TA 2O56A 2ONEA 3TJIA 3P0WA 2DW7A 2PU0A 3RCYA 3B97A 3TJ4A 4ZA0A 3H8AA 2MNRA 2PGWA 1PDYA 3H7VA 5FJRA 3GO2A 1OEPA 2XH2A 1F9CA 5ENLA 4IZGA 1WUEA 3MQTA 2OFJA 3MUCA 2PP0A 3R25A 4KWSA 2OX4A 3DFHA 3UJ2A 3IJLA 3IK4A 7ENLA 4H2HA 1JCTA 3EKGA 3QKEA 3T6CA 4JN8A 4GFIA 2XGZA 2HNEA 4HNCA 2AL1A 2GGGA 3CAWA 3R0UA
chains in the Genus database with same CATH superfamily
1FWEC 2D2JA 5FS9A 1AQMA 3ZIZA 2E67A 2Y5SA 4WSKA 4BHYA 4R27A 3TSMA 3JW7A 1VBGA 3JVAA 2Z6IA 4RE2A 4Z2LA 1V7AA 3WH7A 5A8QA 2OSWA 3CXOA 3FYOA 3PK7A 4XZIA 3GLCA 4OU1A 3TYAA 4HMDA 3NWRA 1JVNA 4JXCA 4DUWA 3KM8A 5ABFB 3RFAA 3GAKA 2W55A 4ICNA 2V3EA 4PC8A 4C6BA 5AB3A 3W1RA 3WQFA 5A94A 1Q4NX 3PTMA 1ME8A 3CNYA 3WFLA 1FWDC 2ZRWA 2A7RA 1N2VA 3THCA 3PN8A 4EANA 2PCEA 5HJLA 2A8XA 1HO4A 2FHFA 1TV4A 4HHLA 2AL2A 1F05A 1LUCB 2JF6A 1SO3A 1U2YA 2QDGA 3DFQA 1BTMA 1SSGA 2XIOA 3VIHA 3A13A 1QNSA 3VIPA 2J6XA 4UZUA 4ZQOA 3MMUA 4JQAA 1US3A 4QFUA 2BGSA 4Z1AA 1CI1A 4ZOEA 4BI7A 2YQUA 2C0AA 1DJGA 4FX9A 3S2NA 1PO9A 1XANA 2ISFA 5E93A 2X2YA 3HTWA 1GOIA 4EQWA 1QHPA 1NOWA 1W1ZA 3W7EA 4OGZA 3BAKA 1KRAC 4OBTA 2P8CA 4N4QA 5MKGA 5CBJA 1N63C 3ARVA 1XH2A 5CPNA 2E6AA 1N55A 3FHAA 5JCLA 2QZRA 2ZKMX 2WMHA 1YNPA 4LVFA 1G6CA 5BOOA 3FJ4A 4AZBA 5EMLA 6XIMA 5HUPA 3OVRA 5FJOA 4EMJA 3JUGA 1M1BA 1X8FA 3M07A 3AFBA 3F7JA 2PGEA 4AIUA 1Q5MA 4Q8PA 2DSWA 2AQOA 1GRAA 5F4XA 2XSXA 1RAKA 3L5MA 5AZ1A 3OLIA 1FY6A 1OD8A 4DM2A 3WQPA 1FXQA 1M6JA 1EIBA 1A5AA 3WUGA 2CLOA 5HWNA 3G1AA 3GH5A 1G5AA 1EC7A 2R1KA 1F3PA 5IXEA 4H9YA 4PODA 1HXJA 3VD7A 3I6TA 3CGTA 3CH0A 4M5PA 2E5CA 4PB3A 1Z9AA 3ARQA 3RO6A 5DMMA 3GR4A 2PDNA 1CDGA 2V3GA 3KOXA 3N14A 3N17A 3G1XA 1JUBA 3O6CA 2R82A 4YVXA 1OD0A 3UYIA 2XUCA 1DXEA 2Y85A 4YU1A 2XIJA 3TEVA 1T96A 3FSTA 2DZXA 1SJBA 2F2KA 2V5DA 4AEFA 2WOVA 4DXXA 2VDHA 2V3BA 2QMKA 5I7GA 3WDRA 1BYCA 2VENA 3SY5A 1A49A 1Z8AA 3MUAA 1V0NA 4EAMA 2QQ6A 4AD3A 1R3YA 3CB3A 1BQCA 1S7MA 2QPSA 5FEWA 4QCFA 4HNLA 4FX8A 3BW3A 2VX6A 5CCZA 4Y9AA 1XLEA 5M3WA 3BSGA 2XHYA 3AXXA 3MYPA 1LWHA 1UROA 4LRSA 2ZVRA 2PURA 1MW0A 2WMFA 1KFCA 3L0GA 4DO5A 3L8KA 5LNUA 2DQXA 3RX3A 3N13A 3EA1A 1LOQA 4PEEA 2X05A 3T2QA 5ECVA 2INZA 4FEZA 3TAKA 5BRPA 1XIJA 4IIHA 2E4TA 2WB5A 1NU5A 2PZ0A 3MW7A 4AU0A 1SZGA 1WZMA 3UNTA 1LRNA 4O13A 2JEQA 1SZRA 4ZZ9A 3RR1A 4Q4KA 7PTDA 1XRVA 2OR2A 1KWGA 3HV8A 1CGTA 1MDLA 3ARUA 4MADA 4CU7A 2XFFA 4FXFA 1DJNA 2OQYA 4GVHA 3PBWA 3BQ6A 2H8ZA 1QXLA 4X0VA 2WHJA 1OCNA 1TELA 2GR3A 3TXZA 1E0VA 1W1B1 4UTTA 2YYUA 4XO7A 1JQVA 4Q4RA 1VFMA 3UJEA 4BF5A 4H9TA 1OFEA 3P14A 2XN1A 3PUEA 1XF0A 4LVDA 1J9YA 3IJ6A 4F79A 3WEMA 4E0CA 1I0DA 1DWHM 2HEJA 1I9CB 3QV9A 1LROA 1XYLA 4H4QA 3O63A 2EO7A 4R34A 1UZDA 2Q8LA 3WF4A 4GXMA 3B8WA 2ONEA 4C6QA 4FO4A 3NPUA 4CCDA 1IF2A 2ZDRA 3WUBA 2FZ9A 1S1PA 1RCXB 3TJ4A 2G8ZA 1HGWA 1Y7VA 3FAXA 2PGWA 2VCAA 2GVEA 3MMTA 2WLZA 1NF0A 3UERA 3S4TA 4GZEA 4QDMA 2QW5A 2VRQA 2OOGA 1O7AA 4A3UA 3R13A 1WZLA 4U4MA 4TX9A 2VFGA 1JCLA 1BLIA 2QCEA 4LIIA 4HYWA 4CD4A 3VZXA 3NDOA 4UTTC 4B91A 2F6KA 3R79A 1XCFA 1RP9A 1NY1A 3GTIA 3P61A 2QCDA 5GJNA 5RUBA 3O0HA 4JX5A 1KV8A 2JEPA 3W1TA 3LRKA 2JGQA 1WZAA 4C6KA 4P8UA 4RZBA 4C6CA 3KL0A 4AIEA 3NQMA 4YIWA 1ZJHA 4ECLA 2GQ3A 3NVWB 3TJLA 1OFPA 1VKFA 2NSXA 1KRCC 3HPZA 2FZMA 1V3JA 3TTOA 1LBFA 2FGZA 1KQZA 2R9ZA 1RUSA 2OZ0A 1NEYA 2VRKA 2WC7A 3WUFA 4ML9A 4J40A 2GJLA 2NVDA 2ZTKA 1NM9A 1KFWA 3N6HA 4Q8QA 4WQ6A 1NVMA 1ZAJA 4MZ1A 1QK2A 2BXZA 1KM6A 3SCQA 3G18A 1EBDA 2D22A 2D1ZA 4QE4A 3U7BA 5MHBA 1JCXA 1TWDA 1T3QC 4FNPA 3FVMA 3R10A 3C2RA 5U4NA 2W3ZA 4LSBA 4BS0A 2VZOA 1H7NA 1DVJA 3AMLA 2Z1SA 3JU2A 4XD5A 4WDXA 2Y70A 4DWSB 3W01A 4GQQA 3L2MA 3VNJA 1QNRA 1DXFA 4IGMA 3GG7A 1WZKA 3TSDA 1XLCA 1FCBA 3VABA 2BXVA 4LBSA 1WUFA 3W00A 1D8CA 1Z3NA 3AAMA 1ZY8A 4JY8A 4E4UA 4C6JA 4IG2A 2TPSA 1GW1A 1TB3A 3LX9A 4IJRA 1M53A 4OJYA 1ODUA 3AZTA 3V35A 2RDUA 1E1FA 1MQQA 4Q7IA 2A3CA 3SIZA 3QLLA 2E8ZA 1KV5A 2VFIA 3N19B 3VKAA 4HNOA 2VR5A 4S2BA 4UZSA 1GG1A 2NV9A 3RGTA 1W1A1 1JULA 2CERA 2OVLA 4DX3A 1TUFA 4DF0A 1UR9A 4NY2A 3UY7A 1R7OA 2Y24A 1JXJA 2FPTA 2RKXA 4PL2A 3TTEA 1I2RA 1JCYA 4O0QA 3BL3A 2YLAA 4O50A 2HBVA 3AI0A 1EEPA 2ZZ1A 4GNJA 3MU7A 2PD9A 2V81A 3IJDA 4W89A 3ZVHB 5HMDA 4G5DA 4MGGA 1IZCA 3WMBA 2Z29A 1DTNA 3U57A 3R8GA 1Q6CA 3B0UX 3NVDA 5AY7A 1V4YA 4WR3A 2GJXA 5A2AA 5BRQA 2OELA 3LI1A 4EF9A 1NELA 4HPNA 4RDVA 3WH8A 3MKKA 2OZ3A 2FLIA 3O3RA 3N6QA 1WV2A 3G2GA 3VC6A 3HGOA 2V0TA 4QG6A 3RLVA 4XX6A 2REQA 2W9MA 3CPUA 1FECA 2XFRA 3ES8A 1XSIA 2J75A 5CXPA 4X9YA 2GR0A 2VZVA 3ARPA 1ZALA 3DFTA 2O4MA 2FVLA 5C2CA 2PPGA 1E0TA 4V1XA 4CQAA 2V9DA 4XZWA 1JDEA 4JIQA 4J3XA 1CXFA 3PJUA 4J4KA 4ZR8A 3WLHA 1AK5A 1A53A 1XLKA 3D6NA 4HZ8A 5AHLA 1HJWA 1TCMA 4LCRA 1G1YA 5DT7A 1I2OA 2J74A 1EHAA 3EX3A 1LPFA 1GQIA 2YCJA 4RDZA 3DI0A 3EYPA 4D2JA 5FEZA 3SCRA 4WKAA 1P0DA 1I1WA 3W1QA 2X1SA 2XINA 4I7WA 4ZFCA 4TTGA 8CGTA 3T9PA 4UMCA 4HIBA 1V5XA 5AKQA 4JQ2A 5EB8A 5M03A 2GOKA 4IPIA 1EJUC 1O5RA 4AEEA 4PTXA 1R3QA 4INFA 2D2OA 4PTVA 1BGAA 2D3NA 4QJ5B 2HSAA 1KFLA 1KM3A 2KAUC 3NM1A 4IQEA 3GBEA 3VE9A 4IP4A 1IQ8A 4RNIA 4MB3A 1DBTA 1YMYA 4F8XA 1JZ4A 1CENA 2DY3A 5BU6A 3W1NA 4CGTA 1KTBA 3B0PA 1EDQA 4L4PA 3QTGA 1VYPX 2I16A 1GRGA 1GZ1A 1ME7A 4JHOA 2Z25A 2Y63A 3VIIA 4JX6A 1EJXC 2DGAA 3NJ3A 3OGVA 2J3NA 1W1VA 2XFWA 2YYTA 1M3UA 1TQXA 4LF1A 1W1YA 3OBKA 4AVNA 3QSRA 3ZLGA 1DWAM 3HQ1A 5A6SA 2VDIA 4GG9A 1UH3A 1VP5A 1UUMA 1UB3A 3LLDA 5K2ZA 4JIRA 1EKOA 4D1JA 1E0WA 1DJQA 5GNZA 3PP7A 1P4CA 4XD6A 2ISVA 1TTPA 4JFWA 3W76A 3SADA 2PU0A 2V3DA 4A8LA 1J2BA 4MDOA 1ZU8A 1DHPA 4ORMA 2UY3A 4MYAA 4I9MA 1VLWA 4FXSA 2VFFA 2VFHA 4Y9NA 1VH7A 3MBFA 4BQ4A 3O0KA 5C9WA 5FJRA 4OBSA 1OEPA 2XH2A 4L1GA 4CU8A 3CEPA 2QPXA 3GTFA 3UVAA 4PCPA 2X1TA 3QZ6A 4Q4PA 1KGXA 3U7VA 4KWSA 1E3XA 3M0IA 4XWUA 1UOZA 1K70A 1TZ7A 3LLFA 1W8SA 1XBXA 3CASA 3JS3A 1AA1B 5DEZA 4Y9PA 4TR9A 3AO0A 7ODCA 3UZ5A 2PAJA 2WAGA 3O07A 3RPTA 3V5OA 5K9CA 3MDWA 4PUJA 4MFEA 4XBKA 4GR1A 2CYGA 5E0KA 6TAAA 1J6OA 3BLEA 4QAWA 4RK8A 3DFPA 1K4QA 4ASTA 2OCZA 1PX3A 4DNAA 3NVVB 4U28A 1XFCA 1JPKA 3RJXA 1DP0A 3WH9A 4H8NA 4GXWA 1M7PA 4N9CA 2YB1A 3MCNA 2XGBA 4DXKA 1P7TA 1K8ZA 4O19A 2BVDA 4LCQA 2E7FA 3L4YA 4BI6A 4AD2A 1J8VA 4PR4A 3OZOA 2IXUA 3UFYA 1GG0A 2EPNA 2AAQA 2X1UA 4M29A 4R5EA 2VZUA 4H6RA 1P0NA 2PUZA 4RE4A 3B8VA 3GG1A 1K1DA 2RGMA 1RPXA 5LYRA 4UOJA 4KERA 3N4EA 1HJSA 2A2IA 1UKPA 1V77A 1PYFA 1QJWA 3G22A 3CPRA 3APTA 3VCRA 1AH3A 2WM1A 3CT7A 1J11A 4GVGA 2J66A 1S1RA 5A5WA 1SSDA 4ZQMA 3JRKA 3P2VA 4FLSA 4EPDC 1NWUA 4ALDA 1UPPA 1A5NC 3BOFA 3GH7A 4YXGA 3O1NA 1IT7A 2X0YA 2QT3A 5I2UA 3WQCA 2ZZ2A 1P6BA 2GDUA 1HKMA 4JN6A 4IIBA 3VGFA 2F6XA 4XO6A 3TTQA 1Q7ZA 5DCDA 1GVFA 5CJNA 1E56A 4H3DA 2CHOA 5ABEA 3H6OA 2O9TA 4MJMA 1I75A 5REQA 4A3QA 1E0XA 1BQGA 1E73M 2H90A 3DUGA 1LTDA 5AHFA 2ACRA 3RAOA 2PDUA 2DDXA 3L4WA 1UJPA 1V97A 4QS6A 3L2IA 3DKJA 5AC8A 1YEYA 3ABXA 3BAXA 2VC9A 3ARSA 1QO2A 3GVVA 3MMWA 3QFAA 2D73A 1QCWA 1QMLA 5T9CE 2J7CA 2G3JA 3VGGA 1RBOB 7CGTA 4H2CA 3QTPA 4DN1A 1AW5A 1K8XA 3GNDA 2P8BA 2GUUA 5FA5A 3NNTA 1AJZA 2UY4A 3S9ZA 1KCKA 1EFZA 2QVNA 2F6UA 2PDCA 3NL3A 5BXPA 1TYPA 3AHZA 3LS9A 1XPYA 4ZL1A 5BNKA 1PIIA 4N9BA 4Q6JA 3UD6A 1XLMA 2ZC8A 2WZEA 2OYMA 1VPQA 3OLEA 3PWGA 1HL2A 5G4HC 3AHXA 1YBQB 4DRSA 3QV6A 3NPVA 3I3DA 3SY8A 2A3AA 4S3DA 3LGGA 3MI6A 3WK1A 3WNMA 2ZYFA 4ZEPA 4JFTA 4JTGA 5I00A 5I3JA 4N9DA 1BSLA 1FH7A 3MBDA 1WO2A 2VWTA 1JXKA 2YDRA 3IK2A 4TMBA 1XYCA 3HO8A 3N2MA 5HR6A 3EXSA 1IEQA 4UFHA 5HWMA 1QO5A 1ZNNA 3A23A 3CTTA 3ZJKA 2WKJA 3INPA 1S2WA 4K7ZA 4NU7A 3E96A 2V3AA 1RLDA 1CXEA 3A64A 1H7XA 4F2BA 5EMKA 3VIKA 3RNMA 3NTYA 2ZTJA 1DIDA 3UCCA 4YYCA 1MUMA 2G37A 3S2JA 4LYPA 3SRKA 4NRRA 4FNUA 2AMXA 3LTSA 5BOFA 1AQHA 5LA2A 3ES7A 2ZX8A 1F5ZA 2DZPA 1OBAA 1IT0A 3VU2A 4K1WA 2WPEA 4H50A 1GNXA 3W70A 3QQ0A 3GX9A 2DZSA 2XSBA 3W28A 5FSEC 4RZ6A 4LAKA 2WNNA 1JZ5A 5MF5A 4JIHA 2YDAA 4NUWA 1DL3A 3WELA 1L6SA 4JN7A 1EC9A 4I9AA 3B05A 3N9KA 3SQPA 3WBAA 3NXLA 3W88A 5ABFA 1AJ0A 2DSUA 2DZVA 1RJPA 4XVEA 4LUIA 2JBMA 1J0YA 2O9OA 1F3TA 3FGCB 2JKEA 4C5ZA 2V5BA 1XHGA 2GOUA 2JK2A 1THFD 2D0FA 1TWWA 1IR1A 1JCJA 1EX1A 4O52A 5H91A 3WLKX 3IUHA 3P5ZA 3NQEA 3P6LA 2X8CA 3UGRA 3ABQA 1YW1A 4UNKA 2YL6A 3QFEA 3NO3A 4I7VA 4LFYA 3C2VA 3MO4A 1J2WA 2OFJA 4AC1X 2VEIA 4K39A 2PBOA 3F4VA 4BFAA 3DFHA 4GJJA 2DIKA 1LUCA 3E74A 4LU0A 2EBNA 4WOZA 3QVQA 3PZ9A 1E0UA 1Q2SA 3QKEA 1D7FA 4GFIA 2FQIA 4PA8A 2Y7GA 1XIFA 1KKOA 1D3GA 4FNRA 3VVGA 2GWNA 3L9CA 4JTDA 4GVFA 2IW0A 1BWLA 3NZRA 1OYAA 1GOQA 2QHAA 3C8NA 3CO4A 1JYXA 1GHRA 3LG3A 1OADA 1F74A 4NX0A 4D8LA 1HKJA 4P8WA 1Q85A 4D1IA 3O6YX 4H00A 1PX8A 5A8NA 3CBWA 3Q4DA 1FP8A 3VNIA 3DXIA 2PWGA 3C2OA 3E1F1 3VI2A 1S2CA 2C13A 1LM1A 3TDFA 2YBTA 2BY1A 3G1VA 1B3YA 4D8AA 1RHCA 3ITYA 3UF9A 3WNKA 3A7RA 3L4TA 2VVNA 4JX4A 5FD0A 1QU4A 1CXHA 3FYYA 4WY0F 1TJPA 2C8NA 3L66A 3WD0A 3UXIA 2ZE0A 4GNVA 1F61A 3W1AA 3VIFA 1SMAA 3SGGA 2YGYA 1OM0A 5D8ZA 2ZA1A 3PFMA 1XJBA 3ARRA 1VD6A 1R3RA 2CZDA 5C0QA 5AOUA 4JICA 1Q66A 3W29A 4P8VA 1Z6KA 4KW2A 1XW8A 3G8RA 2G96A 4TVYA 4GQBA 1XS2A 2WSYA 4O1AA 1XLHA 2CBIA 3SN4A 3V5FA 2QAFA 5G5IA 4UBPC 2VGFA 3W7KA 3IGHX 5JBDA 2BOFX 1GEUA 2W0HA 1QPQA 2Q3OA 4HKPA 4LC6A 3H7RA 1GERA 1F8MA 3IRDA 5D05A 4YTTA 3ABRA 2Y5EA 3PY2A 4J2MA 3Q6JA 3SM0A 1TIMA 1W91A 2BHZA 3GZAA 7XIMA 4W7WA 1PIFA 3OIXA 3O16A 2Z1WA 4N4PA 4ZOCA 4UFIA 4XKYB 2QJNA 4BY3A 3AS2A 1RM6B 1TPB1 4Z2IA 4LAMA 5E1QA 3KLJA 1C3FA 3S5ZA 2IKGA 1ZLPA 4JTHA 1L8NA 3OG3A 1B3ZA 1XXXA 4A05A 1C8XA 3T4CA 3WY1A 1JD7A 4QNWA 3W7CA 3VIOA 5CPOA 5DY2A 4CKQA 2YDSA 3CWOX 3AALA 4GE8A 1MI3A 2C1IA 2W27A 5FCZA 1DWGM 3LN3A 3W07A 1ITCA 1IR2A 3R07C 4DYEA 3A22A 3SQMA 2CBUA 4K37A 2P3EA 4WEVX 3AOFA 5EA9A 2PRHA 4M7SA 1VRXA 1TZZA 2NWSA 3QW4B 3CU2A 3UCDA 1IGWA 3KL5A 4V28A 3DC8A 3GFYA 4YWOA 3OBAA 1VZWA 2J27A 1RVKA 3BGGA 1EGVA 3K8KA 3PTDA 3S0CA 2YPIA 1Q6EA 1PZ1A 3OEXA 1VJSA 4B3ZA 3D46A 2WZMA 2BXYA 3DDMA 1J18A 4NI3A 4FB7A 3EX1A 2G3MA 3EPMA 4QLLA 5CZSA 4UOQA 4EWND 5EKYA 2GRTA 3UXLA 4LVBA 3W02A 1YIXA 1UMYA 2WC3A 3D47A 3SGZA 4DBWA 2FTPA 2JKPA 5D8WA 3FKKA 3IIXA 3QN3A 1TPWA 5JH1A 3I7QA 4OBRA 2V6AA 1JI2A 4O8AA 3W1MA 4J3VA 1BYDA 1QOQA 5CPLA 2OTDA 3KRUA 5C7VA 3MCOA 4W7VA 4GISA 2Y8KA 1JZ6A 1E6NA 5HXMA 2PA6A 4JYEA 4GXPA 1X2HA 3Q94A 2X8GA 1TMLA 2F5ZA 4DPQA 2CESA 4EPEC 2W63A 2G50A 2VEGA 1A5OC 1I45A 1R3WA 4DNMA 3GY1A 4AD5A 4AZIA 4H9UA 3W2JA 3LRLA 1KFKA 3W3OA 4HB7A 2YVFA 3W7NA 4F0KA 2Y62A 3HFYA 1QPRA 3VFLA 2IUZA 4G7EB 3JZUA 2XSAA 4W88A 3R6IA 3W86A 2ZRVA 1EB3A 5KSWA 1TPDA 2JALA 1EO5A 3DEQA 1KW1A 3ZWSA 3URNA 3FN9A 2XVPA 5F1VA 1KWKA 3SJNA 4REQB 4FS9A 4MVAA 3SRHA 2WWCA 1ZJIA 4OHQA 5JCKA 2BHYA 1Q3NA 3EDDA 3A4JA 3BGJA 1OB0A 1OG0A 2HS8A 3I65A 1PX4A 3GD6A 3QPZA 4J3TA 1Q6QA 3E49A 1UR2A 3WJXA 1Q65A 4OIFA 3WJZA 2RJGA 4GKLA 4NVTA 1V93A 3NQ6A 3KBNA 4LRTA 3FKRA 1TWZA 4GPNA 4RV3A 3A9IA 7A3HA 3SW6A 3QYQA 3UG8A 2WZIA 4K6AA 1DV7A 1HO1A 4QSFA 3CHCA 3DYPA 2WZTA 1LT8A 3W38A 2CIPA 3VC5A 4ZGYA 3QHNA 4EQXA 1GEQA 3O06A 1IEXA 5F4SA 1VYSX 5H8UA 3CV6A 4WRHA 4JHZA 1B9BA 4TMCA 3LCLA 1TX2A 1LYXA 2WJEA 1ZKQA 1DJIA 3TV8A 1Q4WA 4KGJA 4J3WA 4JNMA 1DXLA 3AHYA 1GK8A 2NUYA 4J1OA 5DN1A 4P7OA 3OU8A 1EX5A 4RNJA 2QAEA 4HT3A 3HG3A 3N2OA 1MRQA 1UHVA 3NVTA 1GW9A 4HSHA 2RUSA 9CGTA 4JFUA 4LJ3A 2MNRA 3VXGA 3VTRA 3GXNA 1UG6A 4Q4OA 1BVZA 1NIUA 3LEPA 2X8RA 3TA6A 1Q8JA 3EUB3 4CNPA 2CNCA 5CLTA 1WUEA 4JCMA 2JIEA 3UJ2A 2BBFA 4JOMA 4DWSA 3PZTA 3KDNA 1M41A 1UA3A 3PR2A 3NGFA 4C6FA 4JIPA 2AL1A 2DZTA 5CSYA 3S2MA 4JBRA 3ANYA 2VOTA 1DQWA 4PMZA 4A3HA 2FTWA 1XSKA 1OK6A 4LVGA 3UWZA 1TPEA 2WYSA 4EQRA 2HZGA 3SSZA 3NEVA 5IDZA 3PUDA 3C2EA 4O15A 2BY3A 4S3CA 3IVUA 3E9AA 4PH6A 1M65A 1UJQA 3L4VA 4ROPA 3TROA 2EAWA 1VFFA 1QNVA 4PUDA 2E3TA 5LHEA 1G4EA 5DBUA 1Y0EA 4YTUA 1W0MA 2PDMA 4PCFA 2D3LA 4MB4A 4QQ3A 5FJUA 2VNCA 4BQ3A 2J47A 4MB1A 2QAPA 3P82A 1NWRA 4IPJA 2OO0A 2G4FA 3P93A 4ZOHB 1ME9A 3PPGA 3OB8A 2J79A 3REQB 4D6IA 2XVLA 3V16A 4B5UA 2VMFA 1P0BA 4AHOA 1E6ZA 2IPGA 2MUCA 3MV01 5A8PA 1TKKA 3T0DA 1TRDA 1UP3A 2J13A 1RLCL 3HMJG 3FYPA 3ZVHA 3WF1A 3LHWA 1JAEA 3F4NA 1MNZA 1K7XA 3ALFA 3T4WA 3ARWA 2UBPC 4GYJA 3THDA 2R1LA 3KS5A 3THUA 1M01A 4IWWA 2BOEX 4X61A 1ZMCA 2TSYA 3HB9A 1YYAA 3MY9A 5TF0A 3VGEA 3G1DA 5DLCA 4KEZA 3RX4A 3BLDA 5FESA 1DWIM 1B3VA 2ACQA 3CGBA 4P5UA 4ZSUA 4AWSA 5HMSA 4C7DA 1CLKA 3WDPP 2NLIA 1S5MA 3M5YA 5DO8A 4L4MA 4YN5A 2YXGA 4WKHA 3GDKA 2W3SA 4NEVA 4ZB2A 1CXLA 1SR9A 5K9XA 3LOTA 3QY8A 1TV7A 3SBFA 1XFBA 3S8HA 2FJKA 3EPNA 4JDYA 4GI9A 2QULA 1EP3A 3M64A 2YA1A 3BOLA 3E2SA 2WMGA 2E1WA 4H4PA 2ZZ6A 2DSVA 3GU9A 1ECQA 3BMWA 4E2VA 3U3HA 4WZHA 1EOMA 1KKRA 1ISVA 3U4FA 4ADWA 1GXFA 3HU7A 3CPGA 3FA4A 1IEWA 3D3FA 3HOJA 4O0ZA 4AYGA 5GPRA 1GEHA 1T41A 2GDQA 4UCGA 3CJPA 3FW6A 5J5RA 4LUYA 5A2CA 3LCHA 2V67A 4IM4A 4W87A 1TPFA 1XBVA 2DPEA 2GGEA 5IDIA 5FEPA 2W5FA 4PBEA 4ZMGA 2VGBA 3AWNA 1RR2A 3G0SA 2WLYA 3HG2A 1TJ0A 2Z28A 5E9AA 4G1KA 3CWNA 2GUBA 4MF4A 4GD0A 3NQAA 4NXKA 1BVWA 1YQZA 5SWUA 3GD4A 4UMBA 3GRTA 2ICSA 3M4HA 1TIWA 4IP5A 3PZVA 3OHMB 4C1NB 3LBMA 4KGLA 4ZODA 5D2YA 3ZR4A 4L6DA 4K8DA 1MW2A 3VD9A 5I23A 3OYZA 4LS0A 2A1YA 1YADA 4F2TA 3DECA 1BYBA 5JH2A 1S2TA 5DRIA 4B2DA 2Q8ZA 1MVYA 3GYEA 3WENA 1WX0A 6XIAA 5LXXA 2P3ZA 5GVJA 2VEFA 2A6LA 2PI6A 2ZQ0A 3C6CA 5HDRA 4DB7A 2UZ9A 3CEUA 4WD0A 1O1ZA 1V3HA 1A47A 4JFSA 5DT5A 4NT0A 3RJYA 3DHFA 1VC4A 3SUWA 3WF3A 2YW3A 4IFKB 1HT6A 4UTWA 1KGUA 5A69A 3KL3A 3SB0A 1AW2A 1ONWA 3V36A 2NQ5A 1FWFC 3UXDA 1YE4A 4QDWA 2CLHA 3GSMA 4BQ2A 4CD5A 3C52A 3CL7A 2W54A 3AYRA 1H5YA 1XIBA 3MSYA 4IQLA 4MSSA 3S47A 2GL5A 3OTRA 3W1PA 1QW7A 1QW9A 3LCXA 4RJEA 4GQGA 4M1RA 3DIPA 1SO6A 3TE9A 5DRCA 1OG6A 3ANVA 1C7TA 3CL6A 1H63A 1S2AA 4LAOA 1JDAA 3UPBA 4IH3A 3KS6A 3U5UA 3UA4A 4B3KA 2XIQA 3P5YA 5BYWA 1T8XA 5CC5A 4A6GA 4ENLA 1C29A 5KVHA 2CFYA 4O0KA 3LHTA 1E6RA 1TMQA 4UTWC 3I3EA 4LOCA 4GIAA 4FLQA 4XIMA 1KLYA 4B16A 3PZMA 4WK9A 1XH0A 1C90A 1LZOA 1OT1A 2GQ8A 1K7EA 1P0EA 3R58A 3MHFA 2H6RA 1S38A 4XZLX 2ZZ0A 1TX0A 3BC9A 1R3TA 3PWAA 4GKTA 1V7YA 1JD9A 3MSDA 1OSEA 2E0PA 1UPMB 3BLIA 4MPKA 1GREA 4LGXA 4ZB0A 2V2DA 3B0VC 1YPFA 1GJWA 2Y1HA 4S3EA 3WN6A 3ARYA 2NT0A 1ONXA 1TR9A 3CWHA 3UWUA 4GOAA 3QC3A 3EDEA 1QI2A 3B8DA 4PEKA 4ILSA 1RV8A 2FDSA 5HQLA 2RH9A 3AUJA 4MWAB 2PDJA 5HINA 5TBOA 1YXCA 1A0CA 2DH3A 2DZAA 2WSRA 1X6UA 1RBAA 3IK4A 1GWJA 1SB3B 4X22A 4LWWA 3W1UA 5JBEA 1Q13A 1RK6A 3PBMA 3QOKA 2ZRYA 4GY7A 3WK3A 3CAWA 1MW1A 3GE7A 5EPDA 2X40A 2TAAA 3ZQ9A 5ABGA 2Z7GA 3VKDA 4GINA 2A4AA 4BR1A 4ZOAA 1OT2A 1WE5A 4XKMA 1TG7A 2NXIA 5G1MA 5JVLA 3NYZA 2PDLA 1EXBA 3LHUA 3NSNA 2C91A 1IXOA 3B03A 3KLKA 4K8EA 4L7ZA 1TTQA 2UWFA 3ITXA 4FI4A 3WSUA 1DWFM 3WEZA 2Z1BA 1RK5A 4H4ZA 2D69A 1W3KA 3I6EA 2FKPA 1J6PA 3UR5A 2OSXA 1JZ3A 2P88A 4ZTYA 4H4XA 3FK4A 3QC0A 4XD3A 1LG2A 1Q1RA 3ZWTA 3BOXA 2O9PA 1FDJA 1X97A 4JTTA 4B5XA 2ZZ4A 3LPGA 1A0DA 3IARA 1IV8A 1DE5A 4NL1A 1VFHA 4Z1CA 3BJTA 3W81A 4KT2A 3O8AA 3IRSA 3B4UA 4Q8MA 3VOJA 3JR2A 1OJTA 2YCEA 3GDBA 1GZJA 1DJYA 1R6WA 3G6LA 4JHMA 4M81A 3B06A 1PWLA 1PYMA 3R7MA 3TXVA 4F40A 5AC7A 3CZGA 2ZOXA 5C55A 4H9ZA 3PSVA 1OFOA 2IKIA 3VOFA 2Y2WA 3WUEA 1WDSA 3QBUA 1LLWA 4MUZA 4AVOA 4ZQPA 4C6OA 4QJ4B 3UZZA 3ETRB 1UC4A 3VD5A 4HNVA 3WH5A 4XQ6A 3MP5A 1GRBA 2IPWA 1RJQA 2INEA 3N9RA 1BAGA 2PLCA 3UPMA 4O28A 1UKSA 4HQVA 2PDKA 2DU2A 2ATSA 4KETA 3WZ0E 4PCTA 3A5FA 1UIOA 2POZA 3KVJA 3RO8A 1H60A 1YBQA 2FH8A 5TAOA 2NUXA 4Q4QA 4ACYA 1V6XA 4B5TA 3PF3A 2XFYA 3VFCA 1M6IA 4IICA 1MSSA 3H4KA 1XR2A 2ZXAA 4ADSA 1XKYA 1G7UA 2HPMA 5CC3A 3EKZA 8RUCA 4U2ZA 1B2YA 3HPXA 3MSRA 4H8HA 1MZHA 2QGYA 4LV9A 2Y0FA 1C9DA 3DX5A 5AYXA 3WQWA 4WDWA 1HW6A 1H5VA 1KM2A 3NL5A 4CQ9A 4GYKA 4RCXA 4MY1A 4MZ8A 3FJ6A 2QCHA 2R1NA 2VEKA 2DUAA 4IPNB 3L21A 3A12A 3WLMA 4DZ5A 4HU4A 5BXTA 3OHIA 1GESA 3L0KA 2AKMA 1AL7A 1NHPA 3N25A 5I24A 1V0LA 4MUPA 1MQPA 4F2UA 1P6WA 1M7JA 3SUTA 1CIUA 1OX4B 1VENA 4YHGA 4YTRA 1E1EA 5FS8A 4TIMA 3TN5A 3V0TA 3WO8A 4IIFA 4DJDD 2PC4A 4AC7C 1W6TA 8A3HA 1R9XA 2XN2A 5LIXX 2HQAA 3MMDA 5AHNA 2YJQA 3FG2P 3PC0A 2WV8A 1N7KA 4PMVA 3E0WA 4JKLA 2G4JA 1K9DA 4UQDA 3QGVA 4QITA 1NARA 3UP8A 3KTSA 3H7UA 4FA3A 2OQLA 3CZLA 4R33A 2LLEA 4MTVA 1HNYA 1H7WA 2PS2A 2HNHA 2EKGA 4LPCA 3TQVA 3WF2A 1CEOA 3UR8A 1I4NA 1BHGA 5DY3A 5CC7A 1FUYA 3O7UA 1DWJM 4EE9A 3FNDA 4U5IA 3BLLA 3NOEA 2VVSA 3R43A 2OQHA 4RDYA 3NQ7A 2F7FA 3FGCA 3HG5A 5C2XA 4AWTA 3PG9A 4GIEA 3ZSTA 5TR3A 3I10A 2ZRZA 3PJXA 3GDRA 5D9OA 4MNKA 3DYMA 3AYSA 3H4GA 5M17A 5IBXA 4HU8A 1E5JA 4DI8A 3T0CA 3K30A 4HCHA 1XIIA 3P8IA 2VUYA 1UUOA 4U31A 2ZUWA 3LUTA 4KCWA 4ZQCA 2Z00A 3Q2DA 4PTWA 2RHGA 4LVAA 3GNXA 1GPFA 3T0TA 2NLYA 4XIAA 2Z1KA 3FXYA 1JIBA 3PPCA 4KBXA 5HNRA 2NV2A 5CPSA 3C2YA 1H09A 5BXSA 1KBIA 2YZRA 4XD4A 4JCLA 2E6DA 4GC3A 2WVVB 1DIOA 1DHKA 3VKCA 1PTAA 3GU2A 3RRXA 3MA8A 3W72A 4L61A 1K7FA 3E0FA 1GHSA 1Y5VA 1GPWA 3Q45A 3V1PA 1OYCA 3IJ9A 3NS1B 2TPRA 5F4WA 1V02A 3ITCA 3LXAA 3BPWA 4XUGA 2OB3A 2B4GA 5IBXC 5GRTA 4H9MA 1J93A 3H2EA 3LQGA 3TIMA 1XIDA 4WSJA 2X42A 3B97A 1KO0A 1FP9A 4ZA0A 1Q63A 1TFVA 5EFFA 4UCFA 4X0NA 4DJDA 1H1ZA 4E8DA 3GNOA 3OLGA 2J7EA 1PIGA 4JTJA 2Z4GA 5I3HA 4TO8A 3AIWA 2DT0A 1MYRA 2V6OA 1GQNA 1TV8A 1WA3A 4KKXA 1BWCA 2YAUA 1TQJA 3ME3A 4BQ5A 1PKMA 4UR7A 2ZWZA 2OGJA 1V3MA 2QCCA 2CXGA 3KCJA 4G6CA 3RPDA 2QKFA 5FF2A 3OQ8A 4JTQA 4ONVA 2YXOA 1MO0A 3H70A 4IMEA 3EX6A 4HA4A 1G7VA 1W1PA 1YDYA 1J10A 4E2DA 1XLFA 4JQ4A 2EPLX 2QCGA 3G77A 4HN4A 4EK7A 4NZ5A 2ABAA 4CN4A 1GORA 4AZ7A 3C56A 1KNWA 3ITLA 2O7SA 4ORIA 4K68A 1EIXA 1Q6RA 2EG6A 4XKYA 4GYPA 3PUGA 4HPGA 2FPVA 3U48A 4DJDC 5ECUA 1SU5A 4S3BA 2CZ5A 4O1DA 2EQ8A 2ZCGA 3H55A 3WBEA 2BVYA 1GRHA 3S9YA 5BCAA 4H4VA 3ISIX 3EB4A 2NXHA 4XZMX 2ZRUA 2E9LA 1H11A 2ISDA 2ASHA 1JEZA 3XISA 1UR8A 4DUXA 1ZHAA 1GJPA 2PGRA 1HJQA 1ML1A 1PTGA 2ZA3A 4WIWA 1MOKA 3F5KA 4DBSA 4MJ4A 5I06A 4AY8A 4PMJA 3P60A 3DFSA 2XZ9A 5AC4A 3EWWA 2V69A 4HGXA 1GVOA 1XWYA 4MYXA 7TAAA 4GYPC 1JF5A 1FDYA 3TOPA 1BEUA 3RHGA 1IGSA 1S5TA 5CSRA 4W85A 3WQEA 3CV1A 1DJZA 2WKLA 4FX7A 3TC6A 2HQMA 1POKA 1TV2A 3HMCA 3N3TA 3BJSA 3NOYA 4E8GA 1FHVA 5T8GA 3MC5A 1R47A 3AXMA 3B9OA 2WVTA 1V51A 3BDKA 1F3WA 1AG1O 4A3YA 2V5LA 1UWSA 3SCVA 2YFOA 2DVTA 2FYMA 4O1FA 4S38A 5A8MA 4MIMA 5EFDA 2HS6A 2E25A 2JK6A 3MB9A 4O8RA 4UUIA 2B81A 3P3BA 3CO8A 1WOBA 1NHQA 1IYXA 4I6KA 4XZHA 4AWEA 2RGLA 4B5VA 3LHYA 2VOMA 4LY4A 4QQUA 1FH8A 3AYTA 4F66A 1ZS2A 3CZKA 4PCNA 3T44A 1J79A 1HN1A 4UQCA 3IJ8A 5D2XA 1RALA 2YX0A 4G7EA 1EF2A 1MFUA 3GC5A 3L12A 4JNYA 1BKSA 1H6VA 3RUBL 2YVJA 3WL1A 3DK8A 1FHLA 1PHWA 4G8TA 3TW6A 4ERIA 4RZ5A 1O6IA 4PMUA 3GNNA 4REQA 4PMRA 1XI3A 3TQ0A 1RA5A 3QY6A 3HPAA 3WDQA 1JRBA 3M5XA 3LCGA 2XTKA 2Q09A 3EXRA 1XL9A 2PEVA 3ELFA 3FX4A 3EA3A 3WD3A 2FB3A 2VL4A 5CQ1A 2GVYA 5AHIA 2J4GA 1ZB5A 4Y8FA 1O94A 5D32A 5CEWA 1AH0A 1AODA 1UWAA 3U9IA 1A5CA 1HQTA 1SO5A 3G3DA 1ZTVA 1HL9A 1G9HA 1H1YA 1AFSA 4K7VA 5ABHA 5A8OA 3UGVA 2PDFA 4H9XA 1ZZMA 1MXDA 4Z1DA 4W8AA 3ZT5A 3ARXA 3H53A 3LTPA 3AROA 1XD0A 4J7RA 1V03A 6ALDA 4LUTB 2NVKX 2C0HA 2C79A 2ZRXA 1BRLB 1YDOA 1W56A 4IIDA 1SW0A 3BLFA 5FKYA 2RDWA 2XVGA 5EMUA 2OPJA 4GH3A 1YHTA 4RW5A 3QPYA 6REQB 1YTEA 7TIMA 1EOKA 3QV8A 4AIBA 5DANA 3H4WA 2OWWA 2XVKA 3NCOA 4O53A 4HHPA 4US5D 3VGDA 2CHRA 3T7VA 5D9PA 4DWDA 4YMZA 4A2SA 1H7PA 3GKAA 3RM8A 4Y9MA 1CGVA 5LSMA 4K3ZA 5A6JA 3WLSA 1SW7A 3IJQA 1JDFA 1EYWA 2R24A 5F2MA 3M44A 3OG2A 4UTJA 3DFNA 3WLJA 2D2HA 2Z2AA 4B3LA 1E6SM 5HK4A 1FHUA 2FMNA 1I2PA 1O5XA 1ZMDA 2PTWA 1OHLA 4QGCA 4HK6A 1W31A 2GGIA 1E40A 2DIJA 3S5YA 1WAWA 3LBOA 4DYJA 4Z42C 1NFGA 2MANA 3LGDA 1JPIA 3B9NA 1IWBA 2J6VA 2WVUA 1U1HA 5BRBA 3RLHA 4O16A 1UC5A 1EBGA 4QCEA 3S5NA 3GHTA 4TVCA 3BCFA 4FIRA 4DO7A 3STFA 2A0NA 3E0IA 2RABA 3FCPA 4S2CA 2ZUTA 1CWYA 1UD6A 4WOQA 4GH1A 4I9TA 1FX6A 5JCNA 1X6LA 3W1LA 2OX1A 1L8PA 2ZZBA 1S5VA 4GA8A 2ZFAA 3C5QA 5JUVA 3GZ3A 2O56A 1REQB 3M0HA 5A95A 1R9ZA 4DF1A 3KX6A 4QISA 1Q7QA 3RK8A 2E28A 3TZFA 3WD2A 3TJXA 4NNAA 4KRUA 3VDAA 1U5VA 4IUOA 3REQA 4UQEA 2A85A 1WXYA 1E6QM 4WGHA 1GVEA 4XBJA 1FEBA 3NVZB 3LQLA 3SRDA 3PNUA 1CB7B 1JUEA 3BJFA 1WDQA 2OX4A 1GT8A 2WHMA 3T55A 5U25A 3HG4A 4ML4A 2C1HA 1DJHA 4FX6M 1Q6LA 1RY8A 3F5LA 2XGZA 4JN8A 3M5ZA 2GGGA 3LXBA 2WWDA 2QJMA 4QXIA 4DZIA 5CJ5A 1UUQA 1YXDA 4JQ3A 1GETA 5G5HB 4G7FA 2V68A 4GY0A 2DSZA 1J0KA 3CHVA 4L6HA 2ABBA 1QHZA 3DGHA 5C5YA 2HMCA 3W74A 2YBVA 1TYTA 3L5LA 2C3DA 1QNOA 4K8HA 4PMOA 4JTCA 3IANA 3IEBA 4KEMA 4IISA 5LKYA 3A7AA 4NJGA 3POHA 4UTLA 5JCIA 2CU0A 3BQ5A 4US5A 1JI1A 2FHBA 1KD0A 1H7OA 5G2WA 3QJAA 2NUWA 4JKKA 2GUYA 4ACZB 4AAJA 1GOWA 3OODA 3TWBA 4E4FA 3M0JA 3EOOA 1KBKA 3DH7A 3AMZA 1BXNA 2DUZA 3H24A 4GVIA 3WLNA 5FL0A 1O5QA 1BF2A 5B7YA 2SFPA 4EPBC 1QFEA 1PSCA 4C7GA 1ZY9A 1EP1A 4R9OA 4IMFA 3KOZA 4C6DA 5HJYA 2DSKA 3IIOA 4HJFA 4AISA 4AZGA 4L4LA 2GJRA 4C1KA 1PS9A 3SUSA 3W1XA 3D9XA 4F0SA 3NSXA 3ICJA 3AS1A 1HZYA 2DIEA 1FKXA 4PMDA 2NX3A 4O57A 1TWIA 1JPMA 3OBEA 4ZENA 2F84A 1FOBA 1LRQA 1ECEA 4M56A 4C1NA 3CUFA 1FQ0A 1WKDA 1MNSA 2EJAA 5I07A 1UWQA 2W92A 4J27A 3DCPA 4AH7A 3DC0A 1E1CB 1JEHA 4PB4A 1VFLA 1C7SA 1FEAA 2NQLA 1VQZA 2P5NA 1BZLA 1E9YB 4AF0B 2BY2A 3DHUA 1MXSA 1W3TA 4MWAD 4H41A 3UEQA 3A4XA 3BSMA 4XZBA 4YVVA 3GDLA 4JEQA 4OKDA 3GB6A 1F2JA 1RD6A 3U6WA 1ZCOA 2PF0A 3UW6A 4GI8A 1H0IA 4QROA 1XLGA 1RQEA 1JYWA 4IFKA 1LQ0A 1B4EA 4O17A 2E77A 1XLBA 3LYEA 4GK8A 1KBBA 4PL1A 1CECA 3UETA 1JGMA 3V5CA 4QJ3B 3ZXWA 4FXJA 3N3MA 1EDGA 4D6GA 1UBSA 3ABSA 1BG4A 4Y96A 1QWGA 5D2TA 2BOGX 4HU3A 5G2IA 5TIMA 3NQDA 1B4KA 5BMWA 3CMGA 2Q02A 1NOFA 3HURA 3N18A 2D20A 4MNMA 2W79A 1TZ9A 3PZOA 3O6DA 1UD2A 1GUVA 4GUHA 2PC8A 3GNPA 5LIYX 1W2VA 3BSHA 2AGTA 1CBGA 4NXSA 1L9WA 3UWYA 3UZJA 4U3CA 1M7XA 3F4CA 1E5NA 5EMJA 2G3IA 1J96A 1U30A 3VX0A 5LNWA 3C0JA 3W6LA 3W7LA 2VEPA 5M2FX 3EWYA 2PLMA 4R9XA 2WO5A 4C7FA 4GIRA 2EF9A 5IHSA 4XG1A 4DAIA 1VBJA 5HPOA 3LMZA 2WPBA 3Q65A 2D24A 4NJIA 4E2OA 1R30A 5IHRA 1XLLA 1SJDA 1XDLA 2EQDA 2PLKA 4FHAA 4PSRA 4PTMA 4L65A 3IIVA 3PBVA 1QI4A 3VM5A 1EA0A 4CD7A 1W5QA 4WY0B 4GX8A 1Z69A 3VAVA 2NQJA 2BS9A 4KEUA 1QK0A 1DIKA 3LB0A 2XH0A 3UNDA 4V27A 2NPXA 5GJMA 4B90A 4AVFA 2BVTA 3B04A 5EBAA 1OK4A 4FSAA 4Z17A 2EXOA 3KTXA 3EWXA 3OLDA 2E6FA 2OEKA 4DBEA 3EWCA 1VJIA 4QS5A 1MW3A 3WH6A 3DGZA 4KEVA 4WXYA 2NXGA 1A5MC 1WKYA 3PWIA 3OPSA 4WDUA 4MWAA 1M68A 3KEHA 3B8IA 4PUKA 3N1AA 4C6MA 1N8IA 4A3RA 3U0HA 2YKKA 3AZSA 3D0CA 2ZWYA 2J9YA 1C93A 2V82A 4Y90A 4QBXA 4OV9A 1QHOA 3MV11 6TIMA 4RW3A 3RCMA 4Z08A 5DBTA 3HV9A 3N15A 4ICMA 4NZCA 2XIIA 1Q8AA 2RFGA 4KWWA 1EEXA 1UA7A 3PS7A 5L9FA 2NT1A 1JYVA 1SUXA 1EQCA 3SDOA 5JBFA 5I77A 2AOSA 1FHDA 3HPFA 3TVAA 3K4WA 4EXAA 1CGXA 4B15A 3LU2A 5D4YA 1BG9A 1SFSA 4QR6A 4PZVA 1QVBA 4AY1A 2OKOA 1JAKA 3AXIA 3W0KA 1R85A 5BMXA 2W67A 2V2CA 5CAKA 4AZCB 4N9EA 2YOCA 4MWAC 3TJIA 2J25A 4FAMA 3H2MA 1KXHA 3KAOA 3IAPA 1PL9A 1UWRA 3NIYA 5E09A 2YR1A 5FAJA 1NTHA 4U5KA 5ER0A 1F9CA 2ISWA 1SR0A 2J7HA 2GYIA 3TK7A 3E5PA 2NWRA 2PP0A 3VUSA 5TNVA 4NI8A 4M52A 4H6QA 2H3BA 1V6UA 1W5PA 1NHRA 4P7NA 2GFTA 3BV7A 4BF7A 4MNLA 4DAFA 4MKVA 1EGMA 1QOXA 1RCOB 1J01A 2QF7A 3CK5A 3TW7A 1YNYA 1UR1A 1TWSA 3CM4A 3IACA 3LD5A 3TYBA 5FACA 3GHUA 1A5SA 1EJVC 4GX9A 1P48A 2WNZA 4HA1A 3VMPA 2GZXA 4GHRA 1PKYA 4V33A 2JIWA 3TNOA 1J5SA 3NQBA 1RP8A 5HMFA 3B0XA 4M6PA 4O18A 1MEHA 5HQMA 3E2RA 1OY0A 3DI1A 3TLQA 1EL3A 4B9ZA 4AB4A 3T0AA 2PFHA 2ZZ3A 4KRZA 5D2VA 2CLKA 4RZ4A 4FNQA 5J8LA 4DJED 3CUJA 1XD1A 3A3HA 3BUVA 3PANA 3E5BA 3ENLA 2OODA 4ZOBA 2WP6A 3WLRA 4A22A 1G0CA 3EOSA 4MY9A 2ADAA 1OGGA 1Z7AA 2YSWA 4YJ5A 3CHEA 2JKAA 5B80A 1POJA 1S46A 1Y8BA 2YVGA 4EMIA 2DQWA 3THQA 3RXZA 4NZ3A 4RE0A 2FFCA 4KFOA 4JPGA 3K8LA 4U2YA 4MAZA 2UY5A 1JDCA 1OFDA 3ARTA 3ITVA 3VGBA 2ZZ7A 4KFPA 3XIMA 4A21A 3C4UA 3RF9A 4Q7BA 4HHHA 2HVMA 2ZA2A 3H21A 5BOEA 1R46A 2QF8A 1VFSA 3AC0A 8TIMA 2I1OA 5CZKA 1SW3A 1EJ7L 1I2QA 4JTIA 4HYVA 4WSHA 2GSHA 4AYSA 1W9XA 3KBMA 3QZAA 3WJYA 1LP6A 3QR3A 1MMFA 3T0BA 2QUMA 1OX4A 3T8QA 2VI0A 1GRTA 4AX7A 4PMYA 5DFAA 3SN0A 3DAQA 2OLHA 1LBMA 5I09A 3EA2A 4MHBA 4J3UA 5FF0A 2X16A 3F4DA 2J7DA 3KP1A 1JNEA 3N9SA 2PP1A 2PZNA 5XIMA 5T26A 4QNEA 1NFBA 5HNNA 1JCNA 3W7MA 3S3GA 2IKHA 1PE1A 2VGIA 1CXIA 2FGBA 1F6PA 3TH6A 4D6FA 3HZ3A 4N7QA 3CAKA 4OV4A 2GDVA 3I68A 2IKJA 4J5NA 2Z2BA 1GOKA 3BCJA 4B5WA 3RM4A 4F9JA 5JIPA 1CT5A 1KBLA 4HHMA 3VOHA 3KVMA 3N11A 2BGNE 4IQJA 3NO1A 3L0NA 4L80A 1A5KC 4JTRA 2Q6ZA 3W7HA 1ICQA 4X2RA 4PUUA 3NPXA 4B4FA 4UTHA 2F9RA 3SY1A 1E15A 4M80A 1XRTA 4QDPA 3OVGA 4J35A 3VDGA 4ZE5A 4L64A 2EPOA 2P53A 4ADTA 3M41A 3BW2A 1HKVA 4HMCA 1F6KA 1FWCC 4DJEA 1TA3B 2QJIA 4OWGA 7REQB 1OFQA 3APGA 4HA3A 3N29A 3C2FA 4MG4A 2R91A 4C65A 1KN0A 4YWSA 3G5EA 3NZGA 3AXKA 4K38A 1A5LC 1ZBCA 2VD9A 4NJHA 4JTUA 1VCGA 4Y7EA 4Z2HA 3G8EA 1FH9A 2CXEA 3KZPA 1YTKA 4FMVA 4FP1A 1HX0A 2CWXA 4GQ0A 1UH2A 3EEZA 4NKCA 3QYSA 1FRBA 2WVVA 5D9MA 2XIBA 3DZ1A 1XICA 1XC6A 3AIRA 3N34A 4P7RA 1R86A 4IHCA 3M0VA 2WNQA 4ATDA 1KRMA 3DH9A 2IXVA 4W86A 1NWSA 2EQ6A 3LV5A 4ERAA 4X60A 1CX9A 1F6YA 1UBPC 5M5DA 2GJPA 1XYMA 4DXVA 1X6NA 2OGYA 3L5OA 1LBLA 3MCMA 3DERA 4AY7A 4E3VA 1QI5A 1VS1A 4DJEC 1UQZA 3S6OA 3MPGA 3T05A 3R4IA 1SPQA 1NHSA 3A3WA 3L67A 3N2BA 3VIMA 2HWGA 4BEQA 2I9EA 4LW7A 2JFEX 1XCWA 1KCZA 2J88A 4JS3A 1UCWA 3LGEA 5LNSA 1FIQB 1QASA 4WDTA 4KIRA 3E2QA 1XP3A 2QCNA 5LGXA 3KOWA 1G4SA 5G2HA 2X2GA 1I1XA 4NYYA 3N12A 3OA5A 4CNSA 3LDVA 1H2JA 1VCVA 4KWOA 3NO5A 3TYCA 2HRWA 3S5OA 1QATA 2W66A 3R89A 4TVUA 1W9PA 4IIGA 4IMGA 4M1BA 3BZGA 3IVTA 3N4FA 4NYUA 1T5AA 3ZR6A 2I57A 2PU1A 4K1GA 1XRFA 4X2PA 3TR2A 1RBLA 2VJXA 4FNSA 3W7RA 4P2VA 2VFEA 2EQ7A 5CGTA 4AD0A 1OCJA 1V79A 3PBGA 1KFJA 2X50A 1F3XA 4N42A 4DQWA 1KR1A 4JTAA 2X99A 3K46A 1V6VA 3CUHA 3KRSA 3LENA 2Z27A 3B8UA 4GCXA 1XYAA 4BI5A 2L5HA 2C1GA 4Q7NA 2OMAA 2Z6JA 2VWSA 3AXHA 5HWJA 4HOZA 3D5HA 2ZZ5A 3T07A 3A3XA 1UKTA 4M6VA 4JTLA 5BU9A 1F8WA 3BH4A 4JTKA 5FMHA 3TN3A 1JZ7A 2VXNA 3RCNA 4IZGA 2DEPA 5KVIA 3FIGA 5LZLA 2YCLA 1IXPA 4LQ1A 3CQHA 3PZGA 2PGFA 5LHFA 3M0YA 4H4SA 1TUXA 3E0VA 4NAEB 4O12A 1UYQA 4UTKA 3OO2A 1B9ZA 3VNKA 1E9LA 2NQ9A 4JQ1A 3LERA 4XAYA 4FXRA 3GHRA 1PZ2A 1R7AA 4Q4MA 5A6BA 2QUVA 3KWXA 3GVRA 4LV4A 1GKQA 1NWTA 2ZUNA 2FJUB 1BWVA 2PTXA 4AZ6A 3VNLA 2ALRA 2DUXA 4RX0A 3QRHA 1BPLB 1G67A 2XIMA 2Z26A 2J8TA 2QCFA 1T6MA 3O15A 5H8MA 3QQWA 3CV7A 3PG6A 4KMQA 3CUGA 1ZK7A 2PF8A 2XDFA 3AYVA 4PRTA 5DCBA 5FJTA 3E02A 3EPOA 1R9YA 2UY2A 1VPYA 4LF2A 2ZUMA 2P1FA 4FOJA 4GZJA 2C14A 3YPIA 1TPH1 5AHEA 4H4UA 1ESWA 3MSGA 3QPEA 2HVNA 2CC0A 1DKWA 1B3WA 3AWOA 4IIEA 3APYA 1E43A 4W7UA 1FCVA 5C71A 2W6RA 4FOKA 2WW5A 2WZHA 2XN0A 4GGBA 2VX5A 2VUNA 3MKCA 3LPPA 2HBXA 3WDHA 1KBJA 1SFLA 2PBGA 4FIQA 3A6OA 2OEJA 4AMAA 2ZE3A 3UXKA 3HQNA 4ZCWA 3GYCA 4H4WA 5IRPA 2I17A 3XINA 1WP6A 1ELSA 3T42A 2ATMA 1HL8A 1GOMA 1WXJA 4J57A 3B9JB 3HQPA 2YCIX 1FWBC 3MJMA 1QNPA 1H4PA 3IGUA 5JXQA 4AQLA 1Z44A 1AD4A 2FGLA 2WBGA 4QE5A 2BP1A 1W1TA 5I3KA 2QCLA 1EXPA 4HZ7A 3BE7A 1W3NA 4G56A 2DJLA 4BZYA 2X1RA 1LWJA 4O54A 4UFJA 4HPHA 1WBHA 1KM0A 3KXQA 4XB3A 3SFKA 3STGA 1PCWA 3WNLA 3M0XA 3IWPA 3IAQA 1V59A 2BCPA 2X7VA 4E4PA 4GUFA 4O1EA 1WQ5A 1L0PA 3W2MA 4IPPA 1FWTA 1LLZA 1E9ZB 1E4NA 2HJPA 2PDPA 2XZ7A 4GI4A 3BTNA 3UJSA 3FSUA 4C91A 1QPOA 4NHVA 1FCQA 5E6YA 3LTYA 4LUTA 1H1NA 4Z2KA 1N61C 4KCVA 2WBAA 5T9BG 1BRLA 2BDQA 3S1GA 4BCEA 3VNYA 5HANA 4XSMA 5HOSA 3IPWA 4HNNA 1ZAIA 5E9XA 2Y61A 6REQA 3FXGA 3HM7A 1VHCA 4X3ZA 4IGNA 3U5YA 2DZWA 1H61A 5DCEA 2B0MA 3VKJA 4RKAA 4UR9A 1J0JA 3WQ6A 3WQ5A 4S3GA 1IEIA 3S1VA 1N82A 1Z48A 2CFFA 3T8LA 1KCLA 5AYZA 1WAUA 4JDBA 1VDVA 5DELA 3I7RA 2ISSA 1V3IA 3QMSA 3ZM8A 3CUZA 2E5AA 1NPXA 4CQCA 2YL5A 2OT0A 3FDKA 4R3UA 3W2UA 5C8BB 4UQBA 5LIUX 2ZUVA 4US6A 2Y8VA 2YXXA 4RPPA 4IJCA 3TWAA 4H19A 4S3FA 4EXBA 4QSHA 2DZUA 3JZEA 2BC0A 3SCWA 3MJYA 5CKSA 3GC4A 5B7ZA 2ZXDA 3F1QA 5CZ0A 3OP2A 4XZNX 2G97A 5A3HA 4AXKA 5D04C 3NGJA 2E09A 1XBYA 2HXTA 3S2CA 5KINA 5T91A 2QJHA 4B5NA 3THAA 1HJVA 1RY0A 3MP4A 5HA7A 5CZJA 4I8DA 4MJ2A 5LNRA 1FFVC 1JNDA 3UR2A 1MRAA 1UZHA 1REQA 1XLAA 1WCGA 4DI9A 3WFZA 5H8PA 2WNWA 1SZFA 1KQYA 2R14A 1V0KA 2BFGA 2B7NA 1TVLA 1S2VA 1X98A 1A5BA 3VOGA 3PBYA 5CSUA 2OWXA 3OC4A 3OA3A 3N2TA 3UG5A 5H2ZA 3QMTA 3C3NA 4FK9A 4HTBA 4UNLA 1L6WA 1ISXA 4WF7A 4KWUA 4E8CA 4DLMA 3ZJ8A 3B8SA 3RITA 4BV6A 2PDYA 3CXBA 2QDHA 5AC5A 5C9ZA 2W3RA 3AU2A 2CWNA 2Y89A 1VQTA 3CLWA 2UV8G 4P7LA 1X7FA 1VF8A 3SO7A 4PN2A 1NOUA 3OQEA 4YYFA 1WYIA 4G9PA 2BASA 5CG0A 4AZHA 9RUBA 4TV5A 3IVSA 1XBZA 3B9AA 4UWMA 3C61A 5A8GA 1ISZA 1DPMA 1LORA 3NQVA 4XSLA 4K7YA 4CQBA 2X0SA 4ACZA 4L4OA 3W53A 1XINA 1VYRA 3OVPA 3PHAA 3W85A 1OABA 3GXMA 2YL8A 4FF7A 1OIMA 5F2IA 3S1WA 1LOLA 3TTSA 5AYBA 3U2OA 3V7PA 3QHMA 3L23A 1EPVA 1PAMA 1EWEA 2XM1A 2DZBA 2ZX6A 1YE6A 3IJLA 5F7UA 2X8HA 3WQGA 1EJTC 3RIKA 1KFEA 2WVSA 3BGAA 2FHCA 4U10A 3T6CA 2HTMA 4XBSA 2DV0A 3F2CA 2W62A 2PTZA 4W4QA 3AIVA 3KBVA 4ZBCA 1SVDA 4YTQA 2GLKA 2ZADA 3G1FA 4UOZA 2DVXA 4BF9A 2QR6A 5A6MA 2XG9A 4FOUA 1Y65A 4GWEA 6PTDA 3F03K 3M5VA 3UR7A 1R2TA 2E9BA 2YLLA 3MT1A 1E3ZA 3U2EA 1CXKA 4IMAA 1QPKA 1PKNA 3GXPA 1E1CA 5JIWA 4LYQA 3BARA 3WNNA 3LCFA 4AF0A 2WJFA 1ZFJA 3H12A 1EO7A 2NQZA 4MMWA 3GR8A 3BZJA 1UD3A 3ZJ6A 1NQKA 2TODA 3BANA 1VRDA 3CYJA 1B0IA 2A5HA 1TYGA 5I6SA 3KWSA 4GRSA 4WKFA 3EOUA 3S83A 5GJPA 1SM9A 3ALGA 2CLMA 3GBDA 3UJFA 4FLOA 4DEFA 2BZNA 1UWIA 4UFLA 1GV4A 3PJWA 1H7RA 1B1YA 2AQWA 3P0XA 4CNOA 4PTNA 1W1IE 9XIMA 1N8FA 3AS0A 3LNMA 1DIEA 4EWJA 3CGDA 3HJEA 4ZQRA 3A5VA 3PVFA 5FEXA 1KM1A 1QAPA 3LV6A 4H4IA 5FF3A 3W24A 3DN5A 5AHMA 2WC4A 1PCKA 1W9VA 2TRSA 5A6LA 2EPMX 1RVGA 1XHCA 1FWNA 3OZMA 3FA3A 4DWSD 4Q8WA 1ONFA 5C2GA 3R2GA 4XK2A 1Y5XA 3R5EA 2X1IA 4LH8A 3URBA 4I9JA 3BMXA 1K6AA 1SFJA 3LPOA 3G1HA 4PGLA 3MO7A 4BEUA 2BG5A 2WSPA 3FHQA 3K13A 4ICCX 4A8RA 3RU8X 2PRMA 3R12A 2I7GA 4H6EA 1XV8A 1AMKA 4QTGA 1QBBA 2YDQA 4HD5A 3SECA 1MFVA 5TD4A 4NASA 4RDWA 1GVRA 4K8GA 5I78A 4TX6A 1NP0A 1A0EA 4MPQA 5AVHA 4NSBA 2WOQA 1YXYA 3RX2A 2V5CA 2QUUA 3STEA 1GVYA 4L1XA 3TONA 4H04A 2QEZA 4WY0A 5C7HA 1HVXA 2OZTA 5I79A 4NZ1A 3L65A 1F4AA 4I3GA 2WQDA 5DQPA 4EP8C 3L4UA 1JQXA 1XDIA 1Z42A 4GC4A 3BK0A 4C1LA 4BURA 1TJRA 3ZLHA 4RR4A 5JRBA 4M19A 5AC6A 2IS7A 2J77A 3V18A 3ZR5A 3W2KA 1R3VA 2CLLA 4GZIA 5I02A 4CVWA 1XUZA 1V02E 3W87A 1MQRA 4P61A 3K2GA 2VX7A 1ZBVA 4AW7A 2CBVA 5U7SA 4NZJA 3TZNA 4CU6A 2VURA 3EGJA 1K9FA 2PWEA 2WSKA 2BWGA 2Z0IA 1A3HA 3T08A 3V4BA 4GO9A 5HATA 4UTUA 1Q2RA 4DVOA 1T40A 2VR2A 4GI6A 1AMYA 3WBYA 3GXTA 1FWSA 3S6DA 3W83A 2B7QA 1HKIA 2Y8UA 3A7UA 4P7QA 4HPJA 2GR1A 4G2DA 4JQ9A 3MWAA 3WDJA 5J04A 1U5JA 1XSJA 4OZOA 2A21A 3KZSA 3MVTA 3SI9A 1KFBA 1MDRA 2DH2A 1H62A 1XG3A 5DXXA 1ZXIC 4M24A 2BV9A 2KZHA 5BWAA 3WCZA 4AZCA 4HA0A 3MUZ1 1AZ1A 4C6LA 3MKVA 1J0ZA 4UIOA 5AFDA 2WOWA 2GR2A 1DQUA 3QOMA 5KETA 1O95A 3NQGA 2VEMA 4R7WA 2D23A 2HXUA 3TKFA 4Z1YA 5DMYA 5JCMA 1GTHA 3M43A 1T7LA 2J24A 2G3FA 3G0UA 4LBRA 2VQUA 1TPVA 3W75A 2GVGA 4KFNA 4FZIA 3WF0A 3W6MA 3LCIA 3MZNA 3ANUA 1YQ2A 1NQ6A 4JD4A 2A3HA 2HV5A 3QF0A 3W82A 2GK1B 3SCPA 5CBBA 1A80A 5HULA 4GCAA 1LQ2A 4B2DD 5KTLA 3RYSA 3EB3A 4LANA 4IGHA 3GW3A 3HRDC 2QXWA 4DWSC 5DXYA 2WPCA 4FR1A 4PFHA 6ENLA 3H2AA 3U8GA 4ZO6A 3AIUA 3C3UA 2GVLA 4LC8A 3LADA 3I4EA 4QJ1A 1ENUA 1JR1A 2WJDA 3T1GA 3H2CA 1H0GA 2HDJA 3UYCA 1VEMA 4IXHA 3P0WA 2OYKA 3OGSA 1B30A 2VTFA 1EQPA 2IQ0A 4QG8A 4UFMA 3RNDA 3KRZA 4LAUA 2NVAA 3QQ1A 3GK0A 4Z2JA 3LBCA 1WBJA 1R87A 2WCGA 3HPSA 1Q45A 2E5DA 3DU0A 3H7VA 3ZMRA 4AWUA 4Y2WA 3AJXA 1GVQA 3RPMA 3GM8A 3GD3A 2IPJA 3FLUA 4Y6GA 2WANA 2QUNA 2YA2A 1EF3A 1CZ1A 3QV7A 3WLQA 4ZQNA 1JCTA 5HJXA 5ABTA 3EKGA 2PDQA 4PUWA 4JTFA 5FS6A 3SRFA 3ATZA 4BKNA 2QLYA 3H22A 3HFTA 1IWAA 3AMKA 1PWMA 3M46A 1Q6DA 3PJTA 3UT0A 4QRNA 2CZEA 4M3PA 3A4AA 4PBGA 3TLLA 1OINA 2A7NA 1EUNA 3UXAA 3ID7A 5E6ZA 4J9JA 1OZMA 3MI2A 3G1YA 4O1CA 3UWWA 3P84A 1LLOA 1HKKA 1K02A 2HISA 5CPQA 2E68A 1PTDA 4TVDA 1QPNA 4AHPA 1WPCA 4PE8A 4C60A 3GKFA 1UMLA 1UP0A 3E3HA 5BZAA 1QTWA 3TN4A 4JL2A 1S5WA 1VR6A 3J7HA 3SUVA 1RD5A 3ZYZA 4AFYA 4GACA 3VNMA 1FTXA 2GGHA 3UWQA 3S6TA 3QSTA 1OIFA 1ITXA 1W8GA 3EWDA 1T8QA 1U33A 3NG3A 3L5AA 3NFUA 3QH2A 4Q6XA 1FWHC 4HCLA 3W7IA 4L9ZA 1MWOA 2NVCA 3POCA 4KRTA 3EKLA 5XINA 3VUPA 1WDWA 3SURA 2C16A 4Q8OA 2H3DA 3WK0A 4ZE4A 4ATWA 4HOXA 4O14A 1JG9A 1VBHA 3DJGX 3GW0A 1VFOA 3NL2A 4POCA 1UD5A 3TP4A 3GXFA 1W32A 2OEMA 1ICPA 1BFNA 2YCKX 2W91A 1N60C 2WBKA 1DTUA 3SCOA 6CGTA 3EX2A 2AAMA 2Y6ZA 5CPMA 1UWUA 2CW6A 3TSBA 5D37A 5KZ6A 1I6NA 3FDGA 1AQ0A 1EWDA 1YPXA 4AXNA 3P80A 3EBVA 4QE1A 3G3MA 4MY8A 3DG6A 4EM3A 2GWGA 3W4RA 2BTMA 1TA3A 2CHNA 7REQA 3HJZA 3SQSA 4DUVA 1JPHA 3EMZA 3AMGA 4L56A 5KEZA 2WJZA 2O92A 3ECQA 3URAA 2PP3A 1HKWA 2GJNA 2CCRA 4RXFA 2WMKA 2AAAA 2I5IA 3V3WA 4ERGA 2W0UA 3A4WA 4EIVA 5EBUA 2VCBA 4M6UA 1AD1A 1KGWA 3AHTA 4TV6A 4M7TA 3W71A 2FIQA 1WDRA 4H1ZA 5LA1A 5LXEA 4TVWA 4BA0A 1US0A 4H4RA 4NJJA 3DESA 4RL3A 1EPXA 4IJBA 1UKOA 1P1MA 1BVNP 2ZICA 4H7CA 4GBUA 1JROA 3LB8A 4ZO8A 1QNQA 3TFXA 3CS2A 2NV1A 3VCNA 4H9VA 4R85A 1LJYA 4UFKA 2XWDA 3VOIA 4MZYA 1AVAA 4I5XA 1U1JA 1E51A 3E2VA 4HJWA 3URQA 4Q8VA 1IXNA 2FB2A 4KPLA 3W7JA 4WVXA 1V6TA 3A9BA 1Q6OA 3CGCA 1J5TA 1EH9A 1R2SA 5A6KA 2QIWA 1FO4A 2HROA 2Z1XA 2QMJA 1W3HA 2W61A 2DW6A 3CQKA 1ITUA 3M9YA 4U33A 4IMCA 1C8VA 3G1RA 4NP7A 4HSOA 4MNJA 4C6NA 3R94A 2TMDA 2DORA 1TCDA 5K4XA 3LCWA 2Q01A 1O68A 4OOZA 2VZTA 1BF6A 1X1NA 4F0MA 3F2BA 1EA9C 3AIBA 2JQXA 1PZ0A 2KX9A 5G1TA 3W22A 4WLCA 5J5DA 5C9UA 1AQFA 1NDZA 2OKTA 4M51A 1I8JA 3L4ZA 1U22A 4DLFA 1LF1A 3DFOA 4NNBA 4QEEA 1VCFA 3DGRA 1MZRA 2ACUA 3BVJA 1V8EA 4MKNA 1S3TC 1PUDA 5AVNA 4O4WA 5D38A 1RXOB 4HK5A 1IT8A 1ZL1A 3TC7A 1MUWA 4I5UA 3BV4A 1F07A 3EMQA 1E9IA 2OLSA 3WMLA 4FF5A 3QMRA 2F61A 2BY0A 3GUGA 5C9XA 1FBAA 2PRLA 1BYAA 1XDJA 4JR5A 4ZXLA 3ZT6A 3PSWA 3LSBA 3GXIA 1FWRA 2FMOA 2Z2UA 2BX7A 3RRAA 4OT7A 1RQHA 4NAEA 3U2ZA 2X0HA 2X09A 4DELA 2P0IA 4HZMA 3KBWA 1OC5A 2VX4A 1ZDLA 4CUCA 1E6XM 3DYOA 3O0FA 4OQVA 4YNGA 4LNCA 4EVZA 2V38A 2I5GA 1XLIA 3M16A 5JQ9A 1YNQA 3OW1A 1JCMP 3DKLA 3VCCA 3HGJA 4XAZA 4XISA 1BSIA 4JZ5A 1CB2A 2E9MA 2X7WA 1X1ZA 2WKGA 1TV5A 1H3GA 4CQ8A 1PXGA 5D30A 2R6OA 3NQ2A 4XTIA 4UC5A 5HQEA 1QBAA 1XYBA 3TR9A 3GTNA 3WNPA 2J9ZA 2VGGA 2X30A 4BWLA 3LMYA 4DF2A 3GR7A 2A3BA 4JYFA 1TSIA 2IQDA 3W7DA 2ZC1A 1XIEA 4OOUA 4AD4A 3P81A 2VC6A 1GGOA 2A79A 1FWWA 3FOKA 1L2QA 1M04A 3LM3A 4HTYA 4CVUA 3I7SA 1GQLA 4UQ9A 4DPPA 1PDYA 4EACA 1HJXA 3IIZA 5K3VA 3GS6A 1G01A 1HTIA 3WMSA 3GO2A 3NQFA 3KCLA 2R94A 5ENLA 2J8FA 4LUSB 1LQAA 3SCSA 3V0SA 3MUCA 5FS7A 5KZDA 3M6YA 3I3BA 3R25A 8XIAA 3K8MA 1HFBA 3BLKA 3O9NA 4I90A 4KQNA 1ZJBA 1V3KA 5FAGA 1W3IA 1W54A 1K9EA 4XAPA 3T09A 2TYSA 1Y5WA 2ZIDA 1NAL1 4HPXA 3OGRA 1YX1A 1CLVA 3AIQA 4W93A 3KDOA 1TPC1 1ZP3A 5GNXA 3QXBA 1H49A 3IIPA 3GTXA 3AJ7A 2WHLA 3TMQA 3MHGA 4GLEA 1SZNA 1K6WA 1TV3A 3LHVA 5FJJA 2WMIB 3UA3A 4C6EA 3VDBA 4BWLC 1XCXA 2V8ZA 2CKSA 3K4AA 2EJ1A 1P1XA 2FTYA 3ZJ7A 3QY7A 2CLIA 3CHDA 4HMNA 1TJ2A 1XUUA 4GJIA 4HZ6A 4MDPA 1F8IA 5EBKA 1S2UA 1O12A 1I60A 2ZX9A 3LY0A 3W84A 2INFA 3KOFA 4D6EA 4NIRA 5A6TC 1VEOA 3P7YA 1IWPA 4EF8A 4RPQA 5PTDA 3CZ8A 3NQ8A 3QEZA 3PB2A 4DNHA 4PRRA 2EPHA 1VGAA 1E70M 1VEPA 4IOTA 5H6HA 1JL8A 4NF7A 2BSLA 3B8TA 3EOEA 4EOUA 3USBA 4LYKA 3WQOA 4GJ1A 3C0SA 1B3XA 4URIA 2PDHA 3H23A 4ZO9A 4CCCA 4MFDA 1F4HA 4KCUA 1VB9A 5FI8A 3WD1A 4CD8A 4GRTA 1US2A 2V5KA 1ADSA 1X7IA 3ZFHA 3O05A 3B40A 2ESCA 5HBFA 5F2GA 2E8YA 4FNTA 1LL7A 2ZDSA 5BXRA 4V2XA 4WCJA 3WJWA 3W25A 3DBPA 2P0OA 3VD3A 2PDGA 4TTUA 1L6FA 5I3IA 1IE7C 3WKZA 3URHA 3TX9A 4JKMA 3H2NA 3ABOA 2QJJA 4PB5A 4OE7A 3KVKA 3EAUA 3FV9A 1JUKA 3KFTA 4NJKA 5EMYA 1K3UA 4F48A 3CQIA 1HGYA 1UZ4A 1JPDX 1KLZA 1NSJA 1BXCA 1JF6A 3NPWA 3QLDA 3MP3A 2PTYA 4GO8A 4EAYA 4OVXA 3L7RA 3VOCA 2E40A 1E72M 4MWAE 3VNZA 5K4ZA 1TR1A 1O1HA 2QJGA 3BAWA 3E6EA 5M1TA 1MXGA 3SEPA 4ROQA 4EMWA 1N62C 1U5HA 4BK9A 3L2LA 4M0XA 3ZVIA 4JYDA 4DBUA 2PDIA 1XGZA 2PE4A 3BO9A 2DJXA 3KHDA 3OIHA 4LAZA 4ZSTA 2NX9A 3M7SA 1OGBA 1AH4A 1UASA 2H8XA 1PKLA 3EF6A 1CGUA 4W9TA 1ZP4A 2XWEA 5D9NA 4B9YA 3S9IA 3PZQA 2G3NA 1VJZA 3VIJA 3S42A 1EJRC 2NZLA 4HOWA 5D33A 3UWEA 4RXGA 1C9WA 4D6DA 2AQVA 3U2CA 2FZ8A 2HE8A 4LALA 5I03A 2E1DA 1F3EA 3PTQA 5XIAA 1MO9A 1XC4A 1J12A 3GVWA 5CC6A 1K8YA 3VYLA 3WFAA 4C90A 3LXCA 5A6AA 1BKHA 4CN1A 2CITA 5FL1A 1CCWB 2Y7DA 2ZXQA 1CGYA 1PV8A 3QFWA 1ALDA 2VZSA 1ISWA 2FVMA 1Q1WA 4PUNA 1ZGDA 6A3HA 4IF2A 4QHRA 3TAOA 3U4AA 4AEOA 3HW2A 3CT2A 4EM4A 2QCMA 4A4AA 1SMDA 2FZDA 3QR0A 2XPKA 3TFCA 3N6JA 2BHUA 1TPUA 2ON3A 4NILA 2Z1VA 4WHBA 2QS8A 1GKRA 1ZBWA 1XLDA 1EGZA 3W7OA 1K4GA 2GH5A 1W9UA 1LDCA 3KBSA 3NM3A 4YPJA 4F4RA 4F9DA 3L68A 4XTDA 1P0KA 4GABA 1DJWA 1FDZA 4CEXC 5DF0A 1PDZA 4O4VA 1TRIA 4KF1A 4C5YA 3NA8A 4TX8A 3KE0A 1JRCA 2Q3RA 3W23A 3W7PA 5AYYA 3AS3A 1BXBA 3SCNA 5HNUA 3PAOA 4GFSA 5K7JA 3ZZ1A 1D3HA 2PWDA 4QM1A 4ZB5A 4CN6A 3RG6A 3P8JA 1D7YA 2PD5A 3O6AA 4AX6A 1H51A 1JRPA 3NDYA 4EKJA 5I5RA 1K4HA 1Z32X 3I4KA 1EYEA 3EB2A 3GHSA 4JL1A 5AN7A 3UWVA 3QZEA 5HR7A 1W5NA 4NAFB 3BAIA 2X41A 3EDJA 2F38A 2I14A 3VM7A 1PPIA 2J8GA 2YB4A 4HSNA 2H9AB 1LT7A 4YL2A 4HCDA 2FDMA 1ZSXA 4YHEA 3TQKA 3PAJA 2PWUA 1JFHA 5DX7A 1UD8A 3CLMA 3TQPA 3WNOA 1W9DM 1XG4A 3G6MA 1LG1A 5D02A 2GQWA 2BC1A 3AN1A 3KCOA 4H6KA 4Q22A 3W26A 3CH9A 5LNVA 3KRBA 2C18A 3C0QA 4ATLA 1STZA 3RU6A 2XVNA 4L1WA 3NR0A 3UCQA 1Q6FA 3EDFA 5A1AA 1H2IA 3BXWA 3IUIA 3M0KA 3SCUA 3NRZB 2ZUSA 3WLIA 2QV4A 3PPFA 3WLPA 3BG3A 1L6GA 4A8IA 1LWIA 1LL6A 3CV2A 2IMRA 2NQHA 4NZFA 5KZEA 2G0WA 3TYUA 3NQCA 4NEWA 4FALA 1OYBA 4N6EA 1F7BA 5CG7A 4QIUA 1ONRA 1FWJC 1TREA 4RLIA 1P5BA 4H2HA 1PVNA 3UVIA 1G4PA 2YFNA 1HJUA 1OJXA 3WD4A 4DBDA 2FPYA 3CMJA 4RUBA 3VMOA 4FR6A 2J7FA 3BAYA 1M03A 2VR4A 4JIEA 2OLAA 2YL9A 3PZUA 4A2RA 5EU9A 3R8HA 3KTCA 4CD6A 4B4HA 3LK6A 2V5JA 3TA9A 3II4A 4HU0A 4AD1A 2VO5A 3PZNA 1RJRA 3ONBA 3CC1A 4LNYA 2HCVA 1KTNA 3LA4A 5D09A 3W7GA 4PMXA 3VK5A 1FFUC 4NQ1A 3WL0A 1RH9A 4WX2A 3PPHA 3IS4A 4WXZA 2RJHA 3B9DA 1PZ3A 4UTMA 3FFSA 4KS0A 3LLXA 4KIEA 3KBJA 1QI3A 5FIPA 4Z1BA 1N8WA 1YPIA 4IL0A 1RZMA 3CZEA 1EJSC 3IUDA 1ZBKA 2PLJA 2HVOA 3CAVA 5U1OA 2PB1A 4R7OA 1NDVA 2IQTA 5IM51 3KW3A 3WBXA 3VDHA 3DBNA 3TU9A 4WUIA 3T81A 1ZRQA 2ZUUA 2B7PA 1UR4A 1MUCA 3KLLA 4WJEA 4CEUC 3T40A 4YVPA 4A8NA 2RDXA 1BTCA 8XIMA 1IIHA 2EQ9A 2XISA 1OCBA 3GG0A 1B31A 1LL4A 1NH6A 1B3OA 4WJXA 2FZBA 3KVLA 2OXNA 3UBPC 4D6HA 3K4DA 2C19A 1EZWA 3NZ1A 4TOQA 2OYLA 3S2LA 1FFQA 2GSEA 4XVDA 3DFYA 4IPLA 1K77A 3HBLA 1ONEA 3GDTA 3SQLA 3UU0A 1W9BM 1E4IA 5CZTA 1ZPTA 5E5CA 4Q8UA 3M7WA 4ADUA 1DQXA 4GZ7A 1DJXA 4QX4A 2OU4A 4D72A 3O2LA 4AIOA 4MLJA 2JF7A 3AMCA 1O60A 4Y8EA 4J3ZA 4S3AA 4D71A 3G24A 2CETA 3ERPA 2PCQA 1A4LA 3V75A 2A6NA 4Q32A 4IX0A 3VIGA 2NW0A 1CNVA 4AUBA 1XH1A 4D8ZA 2R1MA 3RN6A 2AL2B 3WK2A 3LXDA 3UJRA 2BGQA 4D6JA 3EZ4A 1PEZA 3WBWA 3GH4A 5JMUA 4EPKA 2DT1A 4GY1A 4QLKA 3IV8A 3LI0A 3F2DA 3EXTA 4ZXOA 5EGRA 3MUXA 3GVGA 5KITA 4QAIA 4PCSA 2Y5JA 3WIJA 3QR1A 5AYIA 1RQBA 5HMEA 3VPLA 3LZ3A 5DMNA 4LXFA 4P8XA 4Q8TA 1LVLA 3ZSSA 3SUUA 3CL8A 3P74A 1ADDA 3ZT7A 1BD0A 2F8QA 4WGXA 1OZQA 1N5XA 2XJ7A 5MKGB