3R11A

Crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : mg and fumarate complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
362
structure length
362
Chain Sequence
VSKIIDIKTSIIKIPLKRTFITAVRSTNHIDSLAVELTLDNGVKGYGVAPATTAITGDTLQGMQYIIREIFAPVILGSDLSDYKQTLELAFKKVMFNSAAKMAIDLAYHDLLAKEQDISVAKLLGAKANSIVTDVSISCGNVAETIQNIQNGVEANFTAIKVKTGADFNRDIQLLKALDNEFSKNIKFRFDANQGWNLAQTKQFIEEINKYSLNVEIIEQPVKYYDIKAMAEITKFSNIPVVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMESPAGILATASFALAEDITVADLDPLDWVAKDLYSDYITFNEPNIILKDNLKGFGFNLAENLYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Enzyme of enolase superfamily
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Francisella philomiragia subsp. philomiragia
total genus 119
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3r11A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3r11A01
2PA6A 1MNSA 3EKGA 3MSYA 5FJRA 3GY1A 2OLAA 1BKHA 2PODA 3DG6A 4GYPA 3TTEA 3DDMA 2OG9A 1MDRA 2OX4A 3ENLA 3STPA 1SJAA 2XH7A 2PTZA 1ONEA 2OPJA 1XS2A 2GDQA 3NO1A 2OZTA 1TZZA 3H70A 4HCDA 1NELA 4HN8A 3RR1A 1P43A 3TJIA 3N4EA 5J04A 4HCLA 3ZLGA 4A35A 4KWSA 4H2HA 3V5FA 3OP2A 4M6UA 4KEMA 2AL2B 4IZGA 1IYXA 3CYJA 3VA8A 3VCNA 3MWCA 4E6MA 3H8AA 3OZMA 4IHCA 2DW6A 4GIRA 3FJ4A 4HNLA 3GC2A 4IL0A 3GD6A 4MKSA 3EEZA 3ES7A 3UCDA 4DXKA 4Z1YA 4E4UA 3FYYA 3DFHA 2OVLA 3OW1A 5FJOA 3I6EA 2OZ8A 2GGIA 2QJMA 3UXLA 3SN0A 4KPLA 3DIPA 3ZLFA 3B97A 1EC9A 3UJ2A 3SSZA 3P3BA 3P93A 4FP1A 4GMEA 3TWAA 1ECQA 3SBFA 3S5SA 4YWSA 3QN3A 2MNRA 3Q4DA 2P88A 4MMWA 3IJQA 1EBHA 2HNEA 3R0UA 1MRAA 3CXOA 3N6JA 3SN4A 4Z17A 3NXLA 3ZVIA 1YEYA 1PDZA 3UGVA 2ZC8A 4IP5A 3T8QA 3GO2A 1EC7A 1L8PA 2P0IA 3UCCA 4DHGA 3UJFA 1JCTA 2PSNA 3TCSA 3U9IA 1JPDX 1MDLA 3IJIA 3D47A 3DESA 3UJSA 1P48A 3THUA 3JW7A 2QJJA 3VDGA 4M0XA 1WUEA 4J3ZA 2QDDA 2OQHA 3UJEA 2PCEA 3I4KA 4GFIA 1DTNA 3R11A 2AKZA 3QKEA 3OTRA 1EC8A 2PTXA 4E4FA 1KKOA 2OKTA 3DERA 2PTYA 4ENLA 2NQLA 3PFRA 3DEQA 3ZVHA 1JDFA 4J1OA 3VFCA 2PP1A 1SJCA 2XH4A 2O56A 2CHRA 2FYMA 3T9PA 3Q45A 4MGGA 3K1GA 3KUMA 4H83A 2HXUA 2QJNA 2GGHA 2P8CA 2AL1A 2PU0A 4H19A 1FHUA 2MUCA 5EU9A 3CT2A 4ROPA 3U4FA 4ZA0A 2RDXA 2P3ZA 1KCZA 1SJDA 4K1WA 3CAWA 3H7VA 1RVKA 3OPSA 1TKKA 3TOYA 1KD0A 4JHMA 2OZ3A 1E9IA 4KT2A 1PDYA 3BJSA 5FJPA 4JN7A 2QGYA 4FI4A 1FHVA 4DN1A 3R0KA 2PGWA 3D46A 3JZUA 3CB3A 4DX3A 2PTWA 3FVDA 3S47A 1SJBA 3SN1A 2XSXA 5FJUA 3V3WA 4HNCA 3RRAA 5FJTA 2PU1A 4E5TA 2OQYA 3T4WA 4DWDA 2P8BA 1R0MA 3BOXA 2QDEA 3MQTA 3RO6A 3DG3A 2XGZA 4H1ZA 4DYEA 2PMQA 4A6GA 4K2SA 2PPGA 3JVAA 3UXKA 3R1ZA 3MZNA 4GGHA 3V5CA 2OFJA 3DG7A 2PGEA 3V4BA 1F9CA 3CK5A 1W6TA 3SQSA 5BOEA 3OZYA 4A3RA 4GGBA 3H12A 3P0WA 3RCYA 2QVHA 3NFUA 2HXTA 3QLDA 4IP4A 3RITA 2AL2A 1OEPA 2QQ6A 4JN8A 3ES8A 1MUCA 3HPFA 3RGTA 5IDZA 3FXGA 3T6CA 4F4RA 4EWJA 3R10A 2PP0A 3BSMA 4IL2A 4IT1A 3PK7A 2ONEA 2GGJA 1ELSA 1R6WA 3N4FA 2PS2A 1BQGA 2GL5A 2GGGA 3TQPA 3TWBA 2PP3A 3MUCA 4G8TA 3R25A 3FV9A 3ZVHB 3VCCA 1KKRA 3N6HA 3DGBA 3UJRA 4E8GA 3NZGA 2OO6A 5BOFA 2I5QA 3PWIA 4G7FA 2GSHA 7ENLA 3VC6A 1WUFA 3DFYA 3MY9A 3TW9A 1EBGA 2GGEA 3I6TA 3QTPA 1XPYA 4K8GA 2XH2A 2XH0A 2AKMA 4GISA 3MKCA 4HCHA 3QPEA 2FKPA 5ENLA 3VC5A 4X2PA 3ZLHA 2HZGA 6ENLA 1JPMA 3SJNA 2DW7A 3IK4A 4ZCWA 4GYPC 4HPNA 1NU5A 3FCPA 1TE6A 2POZA 4HYRA 3PWGA 3IJLA 2ZADA 3TJ4A
chains in the Genus database with same CATH superfamily
2R91A 5DBTA 1JI1A 1CTNA 3K30A 1WZMA 1GKQA 1E3XA 1K9EA 2XYLA 4OVXA 2ZC1A 4MADA 3GXIA 1DHPA 1VZWA 1LROA 5HDRA 4M3PA 2WZTA 2P53A 4O57A 1XIHA 4NEVA 2DV0A 4D6DA 1IHIA 1GYNA 1A0EA 3RF9A 1NELA 3WH8A 1MW3A 1KM0A 3IVTA 4PRWA 5J04A 3ZLGA 2J6VA 3P5ZA 4L6OA 2OEJA 3RLVA 5FSDC 2HTMA 1MW0A 5J5RA 3L5OA 2VURA 4IZGA 3U4AA 1FKXA 1BFNA 4ORMA 3V75A 3CTLA 4IPNB 3BG3A 3A3HA 4EWND 1HVQA 1W1B1 3I3BA 5FA5A 1UH4A 5FJIA 5HOSA 4LQ1A 3B40A 3FJ4A 3B8UA 4C6BA 3S2LA 1Z48A 4ADTA 1G01A 3MKKA 4DJED 2Z29A 3HFTA 3EEZA 3GD4A 4HHHA 1YYAA 1CGUA 2WPEA 3T78A 1HJSA 1Z69A 1UZHA 1NTHA 1O5QA 5C71A 3DIPA 2G3NA 2Y24A 2VEIA 3GRSA 1NHSA 3UQNA 2QCDA 2Z7GA 1B31A 3T09A 4EAMA 1HJWA 1PIGA 5M1TA 2ISFA 1ECQA 3PUDA 2YKKA 2UY2A 4JTKA 3AMGA 3WD1A 3EB4A 1F76A 3LV5A 5HMSA 2V3FA 3II1A 3QXBA 1CEOA 2O7QA 1XLGA 3BAWA 1XCXA 2VO5A 4DXVA 1GZJA 4AZ5A 2A2IA 1RK5A 1EQCA 1XGZA 3PG9A 3G1AA 1F8MA 4LYPA 3QQ1A 4JXCA 1GWJA 3TDFA 1S2CA 3W70A 1U1HA 4PUNA 5C9UA 2E67A 4Q8VA 2Z2AA 3TCSA 1FVPA 4I9AA 3SUWA 3DKJA 4MSSA 4GUFA 2ZX6A 2CYGA 1MEHA 4O0QA 3FAXA 2UY3A 1DWGM 4M81A 4QDPA 4EM4A 1E3ZA 1J79A 4HTBA 3I4EA 4DXXA 5K2ZA 3P8IA 1K8YA 3VD9A 5CGQA 5FL0A 5CZJA 2HSAA 3MA8A 3WD2A 3W7DA 2YCJA 4TXEA 3B05A 3VD3A 3CXBA 1JRBA 4K8DA 3DK4A 4MAZA 1RJQA 2QUMA 3AALA 2IPGA 5BRBA 3DEQA 4LUJA 4KWUA 2Q8ZA 4K38A 4LY8A 5JBEA 3IV8A 4L4OA 3B9OA 4Y7EA 1BXBA 2WWDA 5AOUA 3SQLA 4MDPA 2QJNA 3L5MA 3VOHA 5IBXC 2P8CA 2VUNA 3IGHX 2QEZA 4ICMA 4QJ5B 3PZVA 3DK8A 4ROQA 5EMUA 5EU9A 1AMKA 4S3CA 1JZ5A 3WLMA 3MI2A 4GHRA 2ZA3A 3AS1A 5CGTA 3G0SA 1ZY8A 2P3ZA 3LX9A 4WKAA 1SJDA 1P4CA 3B3DA 2H3DA 1PIFA 2WPBA 3IGSA 2CNCA 3TOYA 3QYSA 4RPQA 4DPPA 1RD5A 4NNAA 3UERA 3PZOA 1SZEA 2Z25A 3W1PA 4QNWA 2VNCA 1H1NA 3UT0A 2J62A 3A9IA 3N1AA 3EPOA 2JKPA 4AZCA 3TMLA 1KA9F 3DENA 2F2HA 1B3VA 3N04A 1CZ1A 1BQCA 3XIMA 2D22A 1REQA 3SY5A 2ZXDA 3V3WA 1W9PA 3HPXA 1DJWA 1QK0A 4WCJA 4F0HA 4S3DA 1OD0A 3PZQA 2YFOA 1A5SA 3FJNA 4G56A 2ZOXA 2V5KA 4LEQA 5D32A 2Q09A 3AXMA 4UTKA 2XJ7A 1SO6A 5I6SA 1VBGA 2ZUNA 5G5HB 5T8GA 3NL2A 3REQB 1K3UA 3C52A 4S3GA 2J9ZA 3L65A 3RM9A 2QKFA 3MCNA 5BOEA 4F3HA 2WSKA 3KE0A 3GNDA 5HWJA 2BHYA 4V2XA 3THCA 4S38A 1FH8A 2HXTA 5I23A 4NUWA 4JTHA 1JGIA 1LBMA 4UQDA 1JRCA 1TUFA 2PDWA 4AF0B 3CM4A 2HJPA 1JIBA 5HQMA 5E9XA 4EPDC 3EAOA 4IF2A 3TXVA 2CITA 1G7UA 4ZTYA 4JOMA 4PRTA 2QAPA 4F66A 2ZZCA 1DJZA 2GGJA 3TJLA 3K4AA 3EMZA 1LRQA 4QS6A 4RE2A 4LVBA 2IW0A 2WMJA 8XIAA 1ZAJA 3TWBA 1HFBA 5CPNA 1TR1A 3P60A 1RALA 3UESA 3NEHA 5D2XA 1QDSA 3AZRA 4YVPA 5K9XA 3NPUA 1L8NA 3DGBA 1F4AA 4H4WA 1OFEA 4C1LA 5BOFA 3PWIA 1P1MA 3ZQ9A 1GOQA 2FGZA 3F4WA 5CPTA 3B04A 1TQJA 2F6UA 2FTPA 3Q2DA 1AJ0A 1WE5A 2YDRA 2E3TA 3ITGA 3QV9A 2E5AA 2PWVA 3CIVA 2V3EA 3CPGA 3URHA 2NT1A 3MKCA 2PDCA 2ZUSA 4C1NA 5ENLA 4MJ4A 3W1MA 6TAAA 4DYKA 4XISA 1K7XA 2YR1A 1EP3A 1P7TB 3P62A 1TE6A 5XIMA 1UQYA 1YBQA 4HMEA 1Q5MA 5IM51 3LADA 1JUKA 1KQZA 2ESCA 4N0RA 3N29A 1NF7A 2KX9A 2HS8A 4JX4A 4Q7NA 2Z1VA 1O66A 3EWUA 5EBAA 1NP0A 1TELA 3BTNA 2NSOA 4NAEB 4H4TA 2ZDSA 4OKDA 4PFHA 2YA2A 3S1GA 1RVGA 1GVEA 4YCOA 1IIHA 1D3HA 1DWJM 2ZZ3A 1PTDA 2GDQA 1Y8BA 4PTVA 4ZQRA 3AIBA 5A6MA 5LIYX 3P2VA 3VNMA 1XLAA 2Y7EA 2QCHA 5SWUA 1QHZA 4DYJA 3W23A 1P1XA 4A29A 2GR3A 4NAFA 1O5XA 2NUWA 1TPH1 4CUCA 4B92A 1LTDA 3CL6A 3D9XA 4GZEA 1LWHA 1PTGA 4PUJA 3POHA 1TPB1 3U2CA 2GJLA 4PUMA 4ZOEA 4H4QA 2R1LA 3UEQA 5KVIA 1HKJA 4HZ8A 1E6SM 1GRBA 3LOTA 2FPYA 5I06A 1W1VA 2VP8A 3S5YA 1XIBA 5HJYA 1R2RA 2QPSA 3NQ7A 2QPUA 1HVXA 4U5KA 4X2RA 2RH9A 3PPHA 2AAQA 5D38A 1DWAM 1S2WA 1TYTA 3OBAA 4JD4A 4BZYA 3SCRA 1LQAA 1CGWA 1OFAA 1YRRA 5CPMA 4JIHA 4P8VA 1P0DA 3SZ8A 4IIDA 4JQ1A 1IXOA 4TTGA 3GNPA 1SR9A 4QQUA 5HQEA 1PKMA 5G5GB 2P1FA 4XIAA 3P3BA 4FP1A 3HV9A 1AODA 1BRLA 4ZQOA 3Q4DA 2VCBA 3GNXA 3OEXA 3WEMA 3QVQA 1BYDA 4LS0A 1YTDA 3IJQA 4CQBA 2HNEA 2O0TA 6REQB 3W7IA 2A3CA 5D37A 2VR4A 1O5RA 3CQ0A 4GQBA 1EX1A 2Q01A 1GHSA 3S5NA 1TV7A 1X98A 2EKGA 4TV5A 3DHFA 4I8YA 2X16A 3B9JB 3W07A 3DC8A 1BZLA 4M7SA 4LUIA 3AOFA 3UJFA 3BH4A 3H26A 1XSJA 2UZ9A 3EX6A 2EQ8A 1YNYA 3AS0A 2ZQ0A 3EDEA 1YXCA 2A85A 4XWUA 4C91A 3FX4A 4B9ZA 4J3ZA 1A50A 5HNUA 2Y1HA 1T0OA 4H6QA 5M3WA 4GK8A 2HV5A 3E49A 4DJFA 4LAUA 3VINA 3TZFA 4H04A 4NVTA 3QKEA 3L4TA 1OD8A 3B8IA 3OTRA 4JTDA 2C16A 2JBMA 2CLKA 2YDSA 3EDKA 3UR7A 3W87A 4EX4A 1TPC1 4V33A 1F2JA 1RJPA 4XX6A 1FFRA 4Y2WA 1R87A 4M24A 5EYWA 3USZA 3KBVA 2INFA 4HTYA 2I9UA 4OECA 3LGDA 3JR2A 2AL1A 4H19A 4PZVA 2WOVA 1FHUA 4XVDA 3A23A 1OFQA 2Y2WA 1G1YA 4PTWA 3QTGA 4FA3A 1HO4A 4ORIA 1AZ1A 3S42A 1US2A 3MT1A 1I75A 3G1RA 3ARTA 1POKA 4F0LA 1TJ1A 5TD4A 4HNOA 4KT2A 5EBUA 1K7EA 4NI8A 2EAWA 3AMDA 3KCOA 4JYEA 5FF0A 4PCSA 1SB3B 2GYIA 3D46A 3M9YA 1DXLA 4AX6A 4O1AA 1EXPA 4XAPA 1ONXA 2DU2A 1E9ZB 4PGLA 4GE8A 3MO7A 3O07A 3G6LA 4KIRA 4QEEA 3UY8A 3O6CA 2XSXA 2BCPA 1V3JA 4IXHA 4BQ3A 2CLOA 2AQWA 2WHMA 2Z4GA 3MSRA 4NY2A 4JL2A 1PWLA 3PZMA 2NQZA 4HN4A 4XVEA 4GZIA 2F61A 2DUZA 3MQTA 4WXYA 3T4CA 1KFBA 1TZ7A 2PDHA 1AQ0A 3EOSA 2GR2A 2WSPA 4DJEC 1JXJA 4O17A 1PXGA 1LOQA 4I5UA 3LQGA 4J3UA 3QQ0A 4YLWA 1TX2A 2PDKA 3NURA 4QLJA 3WO8A 2Y7FA 3WBYA 2NV1A 5HMDA 4CVWA 5BMXA 3A24A 2DVTA 3KBNA 4DWSA 4PULA 3P0WA 4PE8A 2BBFA 5ABGA 4MUZA 3ITTA 4Q8PA 4PFMA 3EWDA 3NGFA 1QOXA 3ARVA 1R7AA 3UWYA 3UXIA 4AHOA 1OEPA 2QQ6A 2VXNA 1SSDA 3E12A 2BHUA 3NL6A 1RR2A 1Q6GA 3CUZA 3TYEA 5C70A 3VD5A 1TJRA 1FBAA 1C92A 1L6FA 3VIFA 3M6YA 4RDYA 1GOXA 3MP4A 1ELSA 1FWEC 1W9BM 2JF7A 3HIJA 3ZR5A 4AZIA 1I1WA 2WC7A 3T08A 1JCMP 3BZGA 3PNZA 1H1YA 2HBVA 4MB5A 5A94A 3VGFA 2OOFA 5M2FX 3SGUA 1HN1A 2R8WA 3EB3A 1LUCA 4S3EA 1J5TA 2GSHA 4O11A 1IWBA 5CJNA 3A7UA 2XIJA 4EQWA 1G94A 2FH8A 1TV3A 5CSSA 1JL8A 5JIWA 5I09A 4RJEA 4LCQA 1E1CB 1JYNA 1YLVA 5HATA 2PGRA 5CJMA 4DF0A 4CD7A 3LPPA 1Q7QA 1GQIA 2FKPA 4C5YA 1NY1A 1V7AA 4XAZA 4HMNA 4B4HA 5AC4A 2ZKMX 4KERA 4B9YA 3N14A 3I65A 1E71M 2VWSA 5LHEA 1SFJA 5I3FA 4H50A 5JCNA 2IPFA 5FSEC 4QGCA 4D6HA 2POZA 3N34A 3PWGA 3H2NA 1R3VA 4H00A 2ZADA 3RLUA 3LK6A 3EKGA 1B30A 2EQ9A 2DIKA 2OB3A 2OLAA 4H8HA 1UPMB 3CWNA 2Z2BA 4Q7BA 2OG9A 2A7PA 1BEUA 2A3EA 2WKGA 3GXTA 3HGSA 4NX0A 1JF5A 3OO2A 1J2WA 5JXQA 1EZ2A 1LJYA 2GSEA 1DP0A 3W76A 4O14A 1ZY9A 1ODZA 4MJMA 4J28A 1H7XA 4JNMA 1IR2A 1N61C 4BEQA 5J5DA 2XN0A 4GNKB 2B4GA 1S38A 3RR1A 4GZ7A 1XUUA 4WY0B 5B7ZA 1EHNA 3GXPA 1C7TA 4K3ZA 5LNUA 1H09A 2WCSA 3CUFA 1UD5A 3KS6A 4UMAA 4YTRA 4JICA 4KEMA 1MWOA 5E0KA 4ZSUA 2DDXA 2E7FA 2Z26A 1FWRA 1POJA 2CWXA 2X42A 2IKIA 5HR6A 4QR6A 5HMFA 5A8PA 1GVYA 4TX6A 4XO6A 1F6KA 1DJXA 3W86A 5A2CA 2PDPA 3A21A 5DRCA 1BWKA 1JYXA 4MKSA 2J88A 1RP9A 4FNRA 4AD3A 2QYGA 1SUXA 2OOGA 2CBJA 2YW4A 3O7UA 3ITVA 3TE9A 3A4AA 4G9PA 4BQ2A 2YL8A 4S2BA 3OHMB 3KOYA 3E0IA 2DZUA 3HGJA 4GQRA 3SSJA 4L7ZA 4G5DA 3S9IA 4KCUA 4AD2A 1TVPA 5AB3A 1AFSA 3BO9A 1UBSA 5C7HA 4RV8A 4ZB5A 3LXAA 3TAOA 1R38A 4ATLA 2OODA 1UR4A 3GFXA 3K13A 5AVNA 2XVNA 2DORA 5CPSA 2FFIA 2QNEA 3N73A 3NZQA 1FRBA 3WELA 1L8PA 3TXZA 2FMOA 1NFPA 1XANA 2WVTA 3V16A 2RGLA 1H7WA 1LL7A 3ZOAA 4Y90A 3COTA 4DZHA 3CTTA 4DNMA 3EWYA 1XIGA 1TO3A 1F73A 1W3LA 3ABQA 4I7UA 2WWCA 1Q6FA 4K7VA 3PZ9A 2EPOA 4EQRA 4F2TA 2HISA 2DZAA 3W4RA 1VBJA 4E4FA 1EGMA 1ITCA 4D1IA 7PTDA 1W1IE 5TR3A 2QCGA 4BF9A 4NZ4A 5KINA 3NEVA 5DQPA 2VI0A 4HNTA 4RE0A 3UWUA 4EQXA 1XM3A 1QJWA 4UTTC 3PUEA 2GUUA 3K8KA 3PS7A 1I8JA 1DQWA 1JPIA 1R5YA 2W63A 3DOPA 1E6XM 5T91A 4C65A 1ZK7A 3RLHA 5AHMA 5KZMA 2XIBA 4ROPA 1YMYA 2IXVA 4H6RA 3M1ZA 2PDBA 1ZBKA 6TIMA 3H7VA 4DZAA 3OPSA 3GH4A 1I4NA 3G1DA 3SCOA 3DUGA 3ZWTA 1KXQA 3AXIA 1LM1A 2GQ9A 2ZYFA 1B9BA 1TQXA 3S83A 4I3GA 1QNOA 3E1F1 4E8CA 3S47A 4W9TA 4WGXA 4YS1A 3QMTA 4RZ6A 5LIUX 3IV3A 1UBPC 3TFXA 3G3DA 4UOZA 3LS9A 5C0QA 2WAGA 4LC8A 1LYXA 2OQLA 2Y5SA 2PDYA 4H8NA 5EA9A 1XRTA 3TC3A 1V8EA 3WD0A 3WLLA 2D69A 3AFBA 3SQSA 2GRTA 4XD6A 3WQVA 1BWVA 1EDGA 4ZQCA 4IMDA 3M41A 2W3RA 4FXFA 1ODUA 4Q8WA 3CZEA 1LVLA 5BU9A 1X1ZA 3TV8A 2CLEA 1EKOA 2GJRA 3MMTA 4UFHA 1DIOA 3C2YA 2UV8G 4ONVA 3ES8A 2BC0A 3OG3A 3BUVA 1S2AA 4LXFA 3RLGA 4XB3A 4C7FA 2YW3A 5CXPA 3VOJA 4DELA 2ONEA 5F4SA 5GNYA 3OA5A 5T9CE 3HO8A 3PTDA 3KVMA 1B3OA 3W1QA 1J01A 1Y5VA 3PAOA 2EJAA 1ZJBA 3AWNA 4M82A 4CGTA 1OFRA 3ZVHB 1HX0A 5AYIA 5JH2A 1XRFA 3SFWA 1UD6A 4Y8FA 4E8GA 4WRHA 1MI3A 2QCCA 3RX4A 3PPCA 1VLIA 1M7JA 2NXGA 1JCYA 5MKGA 3QBUA 2IUZA 2QDGA 3LV6A 1MZRA 5DY3A 5D8ZA 3CC1A 4FXSA 3UR5A 1C90A 1TJPA 3IIOA 2HMCA 1H3GA 1Y5WA 4IXXA 2W6RA 2VFDA 3VDCA 1OJTA 3UZWA 4QE1A 5HA7A 3CUHA 3PZGA 1H51A 1GQJA 2BVWA 6ENLA 1VIZA 3KLJA 3HM7A 4PTNA 3L8KA 3O15A 3EEGA 3KS5A 3SFKA 1ZU8A 3PC0A 3MPGA 3TW7A 4PUKA 2QCEA 3TN4A 1HJXA 1GVFA 3TW6A 4LA1A 2BVDA 1RCXB 3NPWA 2J8FA 1G7VA 1KCXA 1BPLB 4XZMX 3M07A 1FFVC 1JOAA 2YGYA 1YXDA 1SSGA 4KWWA 4M56A 2PODA 1ISXA 3UG8A 1K7FA 3F2DA 5M03A 3B4YA 1BF2A 3C5QA 2WZHA 1K6AA 1ESWA 2X2YA 2VX4A 1VFOA 2ACUA 3NDYA 3GXFA 2OZTA 2WPGA 1B3XA 1WYIA 3WF1A 3W02A 1DE5A 4ZQPA 1GUVA 4Q4QA 1LRTA 2G5WA 3TZNA 3W1RA 3EMCA 3N4EA 4DBUA 3CAQA 4ZBCA 4PTMA 5DMMA 3GNRA 4Y96A 1KGUA 2FDMA 3F5LA 1R3RA 2A3BA 1DYSA 3W6YA 3ZYZA 4AISA 2TMDA 1ZX9A 2JF6A 1XG3A 2YCLB 3HQOA 3LCXA 2ISDA 2W9MA 5DT5A 4L9ZA 2D2GA 3P84A 3TAKA 2PDQA 5A2AA 3PNUA 5L6UA 3A12A 2BMBA 2BWGA 2V67A 2OXNA 1KTCA 2B7OA 2WZMA 4IL0A 4UR9A 3WEOA 2CESA 3VE7A 4MNLA 3G1HA 2OKOA 2VRQA 1TX0A 3WBXA 4AH7A 3WQDA 4B3KA 2PDUA 1CGTA 3S5OA 4DF2A 1QW9A 4DXKA 1FQ0A 2ON3A 3K4DA 1A5MC 1W37A 1KLYA 2CZ5A 4QITA 1GVIA 4I9JA 5F2GA 1E6QM 3H7UA 2CLIA 3KOWA 2O55A 2XFWA 3ZLFA 2YDAA 4KFPA 1O12A 4CKQA 3SSZA 1T6MA 1U5HA 2W61A 1EWDA 3SBFA 1Q13A 2CBVA 1M5WA 4W5UA 3TJXA 4LUYA 2NX3A 4S39A 3C2EA 5C9XA 4G6CA 3TYDA 5HINA 3AIWA 1K77A 1IZCA 1VQZA 1NPXA 3DI0A 4LUSB 2GWGA 1GJWA 2Y8KA 3S6TA 3RM4A 4MJ2A 4PUWA 4JGDA 4HPHA 4OOZA 5CPOA 1SO4A 2GUBA 3UBPC 3LHUA 4IMFA 1A0CA 3LBOA 1GK8A 3U9IA 4Q22A 5A3HA 2W91A 5AC5A 1HO1A 4RDZA 1P48A 4JQ4A 2V3AA 4S3KA 3AU6A 4AIEA 2QCMA 1C8VA 5I5RA 4DNHA 3QY6A 2FB2A 3G3MA 4O1BA 3D3AA 3VX1A 1OF8A 4MHBA 4O12A 2NPXA 3LA4A 5G1YA 3FHQA 1PZ1A 4ACZA 5DCDA 3AJ7A 5A6LA 2FGLA 2V5LA 5CLWA 3BICA 1TA3B 3MV01 4WJXA 5REQA 4ZXOA 3V1HA 2AQVA 2DSWA 3GFZA 3ETRB 3VFCA 4DUOA 2PP1A 4MYAA 3WL1A 2VZOA 4PH6A 1ADSA 2XGIA 1SZFA 3AO0A 4PA8A 3AWOA 4V28A 3Q45A 2HVMA 4FS9A 3L4VA 3OHIA 1M7OA 4YHEA 2J74A 4QAWA 3VIJA 4I7WA 3RIKA 4A8IA 4H4XA 4GH3A 2X1IA 1J0JA 3IGUA 3WX7A 3APTA 5FI8A 4TVWA 3WQPA 2X99A 4R85A 2YSWA 3TX9A 1RBOB 1K1DA 1CCWB 1I6NA 3IEBA 1V6TA 2XU2A 3GTHA 3FYPA 3CB3A 4WKHA 3M0HA 3CHFA 4ZTXA 3AMLA 5FJUA 3W75A 3B9DA 5EFDA 5I78A 1RV8A 1CX9A 2FZ9A 3C3NA 1UP2A 2BOGX 2XIOA 2VFEA 1JPKA 1VR6A 3L5LA 4GJ1A 1JZ8A 1DE6A 8RUCA 2RGMA 4J35A 3V0UA 2W62A 5EMLA 4DYEA 1PYMA 2PMQA 3JVAA 1XDIA 1E9YB 4K36A 4WK9A 4A8NA 1F9CA 5I3HA 1Q4WA 1B3ZA 4DY1A 4IQJA 3CNYA 1TPDA 3NO5A 4EF9A 4EE9A 2C3DA 4E2BA 2FFCA 3WQ6A 3H12A 4K1GA 5FF2A 4CCCA 2WMGA 1N60C 5A8NA 5D9PA 1YDNA 5JMUA 3TN5A 2V6AA 3EA2A 1FWHC 2OWCA 3LYEA 2PWDA 1XGDA 4WSJA 3B0XA 2X7VA 2ODOA 3CYVA 1TCMA 1VEMA 5AYBA 1M03A 2EG7A 5DBUA 1C9DA 2REQB 1E0TA 2GPTA 4PCNA 4GO8A 3KM8A 1M04A 1MW1A 2E5CA 5AY7A 3APGA 4B5TA 1MZHA 4HOZA 4REQA 3WNMA 2ZXBA 3CMJA 1H41A 5IOBA 3NZGA 2YVGA 3GIPA 4TR9A 4DVOA 1GYMA 3ZIZA 2W4XA 4DJFD 3G1SA 4GXPA 4UBPC 4ZFMA 1WUFA 4CD8A 1S2VA 2Y0FA 2RAGA 3W2JA 5C6MA 4FNPA 1CXIA 4N9BA 3H7RA 3AICA 3M0IA 1RH9A 3PTMA 3EMQA 3WUBA 1TWZA 4RCXA 3WLKX 2C14A 3M5ZA 3WNPA 2NVAA 3N13A 1NAL1 4P7OA 3ZO9A 1W3JA 2PDMA 1BHGA 1J5SA 1S3TC 3WH5A 3ZJ8A 5I03A 3NS1B 2NUXA 2E9MA 2GVYA 1IXPA 2BDQA 3ONCA 2X1UA 5BWAA 3WK0A 4BF7A 5A8OA 3VX0A 5CKSA 3TROA 3GB6A 2OR2A 2YA1A 3CQKA 2EPNA 1XWYA 4MWAC 3TR2A 1FHDA 4TVCA 2JEPA 3A4WA 4UOJA 5BOOA 1Z44A 1I2QA 3EXTA 3OVGA 4EOUA 4OIFA 1A47A 2ZA2A 3V36A 2VELA 5D9NA 1EJWC 3AHXA 1QVBA 2WLZA 3LCHA 1XG4A 1ME7A 4YWIA 5EMYA 1JNEA 2PDGA 4LAMA 1OF6A 2XVLA 1GV4A 2V81A 3THAA 3GTIA 1PVNA 5DO8A 1NWSA 4US5A 1BGGA 2E77A 2QCFA 1K02A 2DW6A 4DWSD 1DWIM 3SGZA 2E6YA 2Y61A 4OWGA 2C7FA 3L21A 1LT8A 4NL1A 3VNKA 4AYGA 3RCNA 3LHYA 5K3VA 3SIZA 4AY8A 3VABA 5JCIA 3PTKA 2X30A 3I6EA 1F5ZA 1H5YA 1V0NA 3GXDA 1AL8A 5LNWA 1XFBA 4NI3A 2J27A 2R9ZA 1F3EA 5KMYA 2G41A 4H3DA 1EJVC 1WZAA 2VUYA 1N8FA 3BCDA 1MEIA 1CECA 1GVQA 2A3LA 4M29A 1ICSA 1RM6B 3R79A 4YU1A 3AIRA 2OMAA 2QHAA 3MWAA 1X96A 5D02A 3H55A 2KAUC 4AWUA 5DXYA 1PO9A 3UVIA 3NXLA 3WDRA 4K37A 2J78A 4MB1A 3K46A 2G97A 3QHOA 2AOSA 1PZ3A 2ZZ4A 1RD6A 3F4CA 4OOUA 3ARUA 1VYPX 1JPDX 3E0VA 1H0IA 3SCPA 5EY5A 3QV8A 3KFTA 1WXYA 3AYVA 5F2LA 3RXZA 5FF4A 3PUGA 4CNPA 3KTCA 3I4KA 2PD9A 4H4IA 1XYZA 2DIEA 4FR1A 1Q6DA 4RXGA 2ZZBA 3NQVA 4GIYA 4QCFA 3IJ9A 1SU5A 3CT7A 4CQ9A 3DGRA 4RR4A 5GVJA 2RDWA 1OX6A 1UCWA 4E8DA 3LLXA 3E0FA 2DZVA 1PEZA 3BANA 2BY2A 2C15A 5CZKA 4UTUA 3C86A 4UZUA 3DYPA 2PTDA 4PTXA 2CCRA 2CPUA 2DSKA 2CKSA 4BKNA 4HNUA 1SR0A 1UWQA 4I9MA 1LLZA 2TODA 1ALDA 1XKJA 1K9DA 1YXYA 1DEDA 4L1XA 4BCEA 2RDXA 3IS4A 3DGZA 2YYTA 3NQMA 1CGYA 4MZYA 3C0QA 3L4UA 4HOWA 2G3MA 3QEZA 4GQGA 1XBXA 2E40A 2NSXA 3EUB3 2E9BA 4FI4A 4WHBA 4DN1A 1EXBA 3OVQA 1Z41A 2R1MA 3TNOA 1KM3A 1VJSA 2WHKA 3W0KA 4IX0A 2QMJA 1XYLA 1V59A 3M5YA 1TZ9A 4XZBA 3ARZA 4LFYA 4YYCA 2HPIA 3NQDA 5E0FA 9XIAA 4ZOBA 2PB1A 2BGQA 3RUBL 2F9RA 3REQA 3O0HA 1BG9A 3U2ZA 1IT0A 3T4WA 1VFSA 3O3RA 4QFUA 3AXKA 4A6GA 4UIOA 4K2SA 2W3SA 2PPGA 4DAFA 3GBEA 3R1ZA 5I7GA 4YMZA 1VKFA 3CK5A 3LM7A 2PE4A 3AMZA 3CWOX 5AKQA 3NQ6A 1FXQA 1V3MA 5M17A 3DJJA 2DZTA 1DORA 3RDKA 2C6QA 2GDUA 5CJ5A 5ABFA 4F0KA 2GFTA 3TA6A 1HGYA 4IGNA 3TYUA 2G37A 2J7BA 1MXDA 1Q2RA 3RITA 1R2TA 3OOQA 3D3FA 1NF0A 2QCNA 3QV7A 3W6MA 2XDFA 1MUCA 4NJHA 1GW1A 4J56A 1H6VA 4N6FA 1CDGA 3LGEA 1ZS2A 1CB2A 1IQ8A 1A5LC 3BSMA 3UVAA 4A05A 3GIYA 1OT1A 4LUTA 5LKYA 3SUTA 1VCGA 4ADUA 1U1UA 2GL5A 1TE1A 1JJKA 4WOQA 3TQPA 1H61A 2H9AB 1TREA 5FS6A 2PRLA 4EM3A 5AC8A 2ICSA 3ORWA 5FACA 3RPMA 3LXDA 1W1TA 5E0CA 3EKLA 1XC4A 1Q7ZA 1IF2A 2OYKA 2WSYA 2GQ8A 4RZBA 3MTWA 1EWEA 2GUYA 4EP8C 7ENLA 3URAA 2VCCA 1YX1A 4Z1CA 1WNOA 3CPRA 3I6TA 4K8GA 2CBUA 3GR7A 1FWCC 3ITXA 1ZHAA 5AZ1A 3VC5A 4CQAA 5HWMA 3GX9A 1NEYA 2CZVA 2YBTA 3SJNA 1OX4B 1EX5A 1MO9A 1ZSXA 4YTSA 1Z89A 3DC0A 3SCWA 2QMKA 5A95A 2WJEA 4R7OA 1RBLA 5C54A 4HYRA 5HUPA 1C7SA 1E1EA 3R43A 2Z7KA 3ZSTA 2RFGA 1S39A 1RBAA 2GQAA 2A3HA 3R6IA 4IG2A 3GG0A 2VZTA 4V27A 4D8ZA 1DJYA 1H49A 3AM9A 4UWMA 3HMJG 3ITYA 3QH2A 3LLDA 1FTXA 3AISA 1YTKA 3THDA 5I2UA 2A7RA 2HCVA 1E6ZA 2J13A 2Q3OA 2WM0A 3UWEA 1C29A 2VZSA 1AH4A 1XQKA 1K8XA 1UPPA 1X7FA 4JNYA 2XSBA 3GQYA 1WXJA 3HRDC 3TONA 4TMBA 3GSMA 1JCJA 2WKJA 3AJXA 3PBYA 3KLLA 3QV6A 3NPXA 5D4YA 2V8ZA 5CPQA 4KH2A 4MFDA 1AL7A 3LG3A 2VEMA 3BAYA 3N17A 4KRTA 3GAKA 4GIRA 1QOPA 3AIEA 3UGRA 4CN4A 4E4PA 3IUDA 3APYA 4W8AA 1ZXIC 3E74A 3DHUA 3AS2A 3E96A 5HBFA 2DPEA 3GU1A 3U48A 3EOEA 3WUEA 3UCDA 1YNPA 2ALRA 2Y5JA 4E4UA 4Z1YA 5CGMA 5HNRA 4J3WA 4M52A 4KWVA 3H21A 4PMOA 2X8HA 1QWKA 3UXLA 4AHQA 4KPLA 1STZA 7CGTA 5I3DA 4S2CA 1NFGA 1VFFA 3UJ2A 3UCQA 4BHYA 1N8WA 1NHRA 4GMEA 1QFEA 3CZGA 3KOXA 1KFWA 3QN3A 1SZRA 3IUHA 3TC7A 3GDRA 1PS9A 2V3DA 1M3UA 2HPMA 4U10A 4IFKB 4QDWA 4A3QA 4ZQNA 4U28A 1U5JA 3R0UA 3CZKA 4HBKA 2BLEA 3U0HA 1V0MA 3LENA 3INPA 5EPDA 3W2UA 3LPFA 2PZ0A 4HYWA 5H2ZA 2TAAA 4DJFC 2GDVA 1OFDA 2R1PA 4QTGA 5KZ6A 4CU8A 2Y89A 3IUIA 3GTXA 3U6WA 4L9XA 3QMRA 4C6LA 2X41A 3LDVA 4HHMA 4JTFA 3VDGA 3HB9A 1BTCA 1KO0A 3EB2A 3NZPA 1O4UA 3T1GA 5K4ZA 5LSMA 1Q6LA 4ALDA 3OZOA 2BZNA 3DCPA 1PZ0A 3QSRA 3NTYA 1Z42A 3G1YA 4S3AA 3MCMA 1XLCA 4JTJA 4IFRA 4UQBA 4PMVA 3AHZA 4UFMA 4EPEC 4GPNA 1FWJC 7REQA 2OKTA 3NR0A 5H8UA 2XINA 4GI6A 4L4PA 4HA1A 4QSHA 1DIEA 2GLKA 5AHEA 2WV8A 5LNVA 1FCUA 3NL5A 3UPMA 3T9PA 5T9BG 4YVXA 4MGGA 3E2RA 4WLCA 1NWTA 4LYKA 4HA0A 3VDBA 1ISZA 7XIMA 3OLEA 4HMCA 1HJVA 5JUVA 3CEPA 1RHCA 3KDOA 4Z2IA 1PX8A 1I2PA 1UR3M 1JG9A 2OWWA 1KM2A 1YW1A 2ZICA 4MZ8A 3A3WA 3KBSA 4LU0A 3PJUA 1TV2A 3C61A 3DZ1A 5U25A 3VU2A 4JR5A 2ISSA 1OT2A 2PGWA 3J7HA 2Y7GA 4OFCA 1W5QA 2G4JA 1SMAA 1UKOA 3VGGA 4XBJA 4N9EA 4AD5A 4PBGA 1SJBA 1FWGC 2DZWA 1KCKA 2ZXQA 2NVCA 3RYSA 4Y9MA 4BWLC 1BWCA 4GI4A 3OBEA 3AIQA 4XZNX 5FEWA 2QCDB 5FF7A 4HQVA 5JBFA 1VFHA 3RO6A 1TWSA 2V82A 2PDIA 4NJGA 1R3TA 4H9YA 4K8HA 1XUZA 4QE4A 3RJXA 5HNNA 3RMEA 1XSIA 3M64A 4GD0A 1UMYA 3D5HA 4CQDA 4N02A 1C8QA 1IEVA 4K8EA 3T07A 2V30A 1QOQA 2BNJA 2VOMA 4X0NA 1L0PA 2BODX 2OEKA 2P76A 3C2FA 1HIZA 4GVIA 1VYRA 3GHTA 1JCNA 2E6AA 3QLDA 8XIMA 1V51A 4C6DA 1NDYA 1KM4A 4U33A 2YBVA 2X1SA 5E6YA 2PDJA 4CCEA 4MKNA 4Q8OA 1RLDA 4LX4A 4CD4A 1LL4A 3R10A 4EXQA 4D6CA 3EA3A 5FIPA 3MI6A 4DUVA 1EO5A 4KCVA 3MKVA 2EPMX 2QW5A 4ASTA 1LF1A 1LQ0A 1CXFA 2BTMA 4U2YA 3NDZA 4QHRA 1E4MM 3W9ZA 1K4HA 1L2QA 4WVXA 4C6IA 3HGRA 4ZENA 3A3XA 5A6TC 3NVWB 5B7YA 3EXRA 1SFLA 1TPFA 3N6HA 4P61A 2FZ8A 4CU6A 5CSRA 4S3JA 4PMZA 3DXIA 4NU7A 5AC7A 1FCQA 3BK0A 3NQFA 3QTPA 2Y7DA 3EXSA 2R1NA 1XJBA 4GISA 2AKMA 2DVXA 4M5PA 2ZXAA 3L0GA 1FWSA 2FVLA 2JK2A 1OGSA 3RHGA 1F8IA 3B9NA 2PBGA 1JD7A 3K4WA 2FHBA 1E56A 4Q7IA 3TNBA 4F48A 1ZAIA 1QATA 1WQ5A 4H9XA 4O52A 2WK2A 4AWTA 5EGRA 2OYMA 5H1WA 3UPBA 2DJXA 5TAOA 2WMFA 3ECQA 3E02A 1LRNA 4FLQA 4XAFA 4EMWA 3ALFA 3EX2A 2PA6A 2BX7A 1REQB 2QDHA 2AGKA 5BYWA 1BD0A 4A2RA 2ZE0A 3L4XA 2YIHA 4H8VA 2IKGA 2X05A 3VILA 1FDZA 3GY1A 3N9RA 3DFNA 6ALDA 1NFBA 4N4QA 1BKHA 3L7RA 3IIVA 1U33A 3TTEA 3NQBA 1WO2A 1DJNA 4K68A 3O05A 2HK1A 1PSCA 2E3ZA 5KETA 1OYAA 4WQ6A 4E38A 3N2CA 2P5NA 3QZEA 1ZALA 1IXNA 3F7JA 3FN9A 3KZSA 3M0JA 4AIUA 3F2CA 3W7KA 1O1ZA 1FWFC 1KFEA 4UMBA 5F1UA 4HN8A 5A8MA 2A0NA 1EP1A 3OQ8A 3S1VA 4AX7A 4EACA 4A35A 3SM0A 1GOOA 3HG2A 1HUVA 4J9JA 1NQ6A 2G8ZA 3QZAA 5E6ZA 1IYXA 1UH2A 3R5EA 5A69A 2PI6A 4E6MA 5TQLA 4LYQA 4ZEPA 4Q8QA 2WLYA 5K7JA 3NJ3A 3PR2A 4IISA 2VQUA 4X22A 3ZT5A 1D7FA 5E1QA 1G0CA 3A6OA 3H23A 2G95A 3WK1A 2OLSA 4HSNA 3W73A 2Z24A 4GI9A 3HG5A 3CUXA 3S3GA 2W55A 5F4XA 4ZOAA 1QT1A 3NIYA 1SYTA 2ZZ7A 3MUXA 1ZUAX 2ZUVA 4QDMA 3GDLA 5EB8A 3LSCA 2GOUA 1OFBA 1U5VA 2NUYA 3O8AA 4IQDA 4M80A 4OQVA 2F2KA 2IXUA 3WQOA 3OG2A 1FO4A 4O1EA 2WZEA 3RPDA 4E2OA 1K4GA 4ACYA 3H2AA 2BGNE 3NVTA 4C1NB 4NRSA 1Y65A 2ZA1A 4V15A 1KXHA 2GVLA 3DBNA 2YZ5A 3WL0A 4GRTA 3IJ8A 3KLKA 3ZVIA 3NVZB 5GJMA 1NM9A 4JTSA 3HPSA 4R9OA 1GW9A 4JEJA 3SGGA 1AQMA 2INEA 3R89A 7A3HA 1YBQB 2P0IA 4FLRA 2ZRWA 4AIBA 1FH7A 4PCFA 3M0MA 4Q8MA 1RLCL 4TQTA 4JFWA 2OT0A 4H4PA 3WENA 2VJXA 3FY1A 1WUEA 3TQKA 2OQHA 1UKQA 2QJIA 1YDOA 1TWWA 5F1VA 3STFA 2GK1A 1YHTA 1Q1WA 2QGHA 4Y8EA 4B2DA 1UB3A 4Z1BA 2BVTA 3MO4A 5FF3A 1V6YA 5FEPA 4ENLA 4Z0JA 2CZDA 2ZZ2A 1OCJA 1L9WA 4FMVA 1LLOA 5AHIA 3TSDA 3VM5A 1I2RA 4B5SA 1RP8A 1WDQA 3PP7A 1R3WA 3OB8A 3BLOA 3CPUA 4DRSA 4NAFB 3S1WA 1WDRA 3O0KA 3ZM8A 2RJHA 3IWPA 4GXMA 3WQFA 3EDJA 1EOMA 4MIMA 1GEUA 1P5BA 1N2VA 1KD0A 3OZPA 2W67A 1T99A 1F3TA 1EOKA 3GWQA 1MUMA 3E2SA 3VKAA 1KFKA 2HRWA 2VZVA 3W1AA 1HL9A 3VD4A 3OODA 3SY1A 2POTA 4XUGA 3O6DA 3LQLA 3E3HA 1XHCA 3MDWA 3M0XA 4IJCA 3W2KA 3S1UA 4AWEA 3RK8A 1GKRA 1TYPA 4US5D 4AD1A 2CHNA 5EMJA 3CS2A 1UIPA 2B7PA 5A2BA 4H6EA 4M19A 4GQ0A 3I3DA 2HEJA 4HPGA 1VC4A 1VIWA 3TSMA 3VIPA 3LXBA 1OC6A 1JZ6A 3GNNA 4QAIA 1BRLB 3USBA 3ZR4A 1XPGA 4C6OA 2IKJA 3B03A 2ABBA 3VGHA 4RNHA 2PWGA 3FKKA 2OFJA 1OC5A 1MOKA 4C90A 3QKZA 1A3WA 1EYWA 4PN2A 1TJ0A 1HKVA 3PSWA 4GGBA 3BLIA 1WDSA 3WLSA 4IUOA 3EWBX 3DAQA 1IZJA 3GIQA 9XIMA 5KSWA 2I16A 5A8QA 2PGFA 2Z1BA 2ZZ6A 3SCSA 4R88A 3VFLA 4D6EA 3A7AA 4MB4A 4DI8A 4MTVA 3KP1A 4HZ7A 3BAIA 3FXGA 3LUTA 1KXTA 1QBBA 3RN6A 2X8GA 4ES4A 1P6CA 2CETA 3S0CA 4RNFA 4M1RA 3PG8A 4KRUA 4MWAA 2PURA 1FWTA 1UR1A 2WCGA 4PEKA 3G6MA 2XM1A 1ITUA 2Q6ZA 4YXGA 5LNRA 1XFCA 2HK0A 3CH0A 1AJ2A 5EMMA 1QNQA 2V0TA 1TV4A 1EJRC 5GNZA 1N7KA 1VHNA 1TPEA 2X0HA 2O7SA 2PF0A 3MHFA 4A3HA 2GZXA 2PWEA 2V38A 2V2CA 3TW9A 1J96A 4AC7C 4XKMA 1V97A 1AMYA 4TX9A 5FEXA 1GJPA 3T55A 2A8XA 5LA1A 1GZGA 4PR4A 4X9YA 1K8ZA 1F7BA 1U1JA 3R13A 1V6WA 5C8BB 1TB3A 3A9BA 1GONA 3L66A 4DBWA 4P2VA 4IICA 3CUIA 1CYGA 1GCYA 4WOZA 1B0IA 4PMDA 3OIHA 1FY6A 1GERA 1DHKA 1PWMA 3HBLA 4FEZA 1UHVA 4XUYA 1OINA 3MI3A 3DG6A 4KEUA 3FG2P 3V18A 4DZ5A 1MFVA 3ENLA 1R86A 4U3CA 1ONEA 4Z2KA 5C9WA 5GQBA 3DYOA 4H4RA 1A53A 4LS2A 2WPFA 4HJFA 1IE7C 1X1OA 1X6NA 3LRMA 1WOBA 1D8CA 5JCKA 3W82A 3UNDA 4DWSB 3OBKA 3HJZA 4GQQA 5LYRA 5JU6A 4TVYA 3VKCA 1ZCCA 4FHAA 1V3LA 2TPSA 2NT0A 4MDOA 4G1KA 2WNQA 1CGVA 3WSUA 3KW3A 2JE8A 4F2UA 3WNLA 3KBWA 2HQMA 3C2VA 3NQ2A 3SRHA 3WQWA 1J18A 2V5CA 3ID7A 3LSBA 1CIUA 3QQWA 2VX5A 3R7MA 5BXRA 4O1DA 3PUOA 3STEA 3G18A 3VOCA 3H8AA 4LB4A 4FZIA 1BYAA 3C2RA 3OZMA 3T0AA 2J7CA 2DSVA 2YL5A 2OSYA 1DV7A 2BY1A 5CQ1A 1ADOA 1AA1B 4YCPA 3FIGA 3RX3A 2ZRUA 5CEWA 2WVSA 3ES7A 3I3EA 4CVUA 1FWAC 4C7DA 4BV6A 5M5DA 3OW1A 5EKYA 5I07A 5HAOA 1TFVA 1W5OA 2WYSA 4NASA 4GYKA 3DYMA 4QISA 4W87A 1E51A 5F7UA 3DHPA 2ACRA 1B3WA 3PN8A 1J12A 1LUCB 1XH2A 3LERA 3P93A 3TWAA 3ZJ7A 1BYBA 4FX8A 2BASA 2ANUA 2RDTA 1Y7VA 3L4WA 1H50A 1SFSA 1IXQA 1ZRQA 4JTQA 1ZCOA 4KMQA 2DIJA 3CU2A 1VAHA 4ZZ9A 2ZUWA 2XUCA 4IP5A 1FWWA 3C6CA 4JTLA 3BSHA 1EEPA 4DHGA 4RNJA 4GIAA 1JDAA 1W3NA 1NP2A 3N2TA 3D47A 1LOSA 1HKMA 2O92A 3GDKA 3SURA 1VF8A 4PBFA 4O1CA 3OYXA 1H5VA 5H8PA 4US6A 3S9YA 4JTTA 1DTNA 3GXNA 4Y6GA 5A6SA 3LB8A 3R11A 4R53A 4JDBA 1MUWA 3NQ8A 1L6YA 3R8RA 2PTYA 1WAWA 2VZUA 3AXXA 1JDFA 4BFAA 1GG1A 3W24A 2J9YA 4BR1A 4PCPA 2DT3A 4GNJA 1AJZA 3C0LA 2XWEA 3KUMA 1YIXA 3VIMA 3SRFA 2VKZG 4FDCB 2FZNA 4M8UA 4QCEA 5G1TA 3O1NA 4YNGA 5LXXA 3M0KA 4B5WA 1RVKA 2ZRVA 1U83A 3KVLA 2R94A 1W1ZA 2A3AA 4EMJA 1RQHA 3NOYA 3FA4A 1Q66A 4LVFA 2XZ9A 3RMJA 1JGMA 4UQEA 3L4ZA 3R0KA 3TU9A 4C6MA 1TV5A 4Q6XA 1UA3A 2WANA 2XGBA 4O18A 5LNSA 1K70A 2QIIA 1RPXA 3BG5A 3W7GA 1U22A 3PZIA 3LB0A 3ARRA 1KGXA 4B15A 2FHFA 3VOIA 4AB4A 4CLMA 3RO8A 1ICPA 4IQLA 3DG3A 1IT7A 3HU7A 1IEQA 4AD0A 1FWDC 1BVNP 1I2OA 3W7CA 3V4BA 4RE4A 3CIWA 4N9DA 1E5JA 3QFEA 1UKPA 1O7AA 3T44A 5EMKA 3BGGA 1SVDA 4KIEA 3NA8A 3BJFA 4FX7A 3LGGA 2VWTA 3M5VA 1E40A 2JGYA 1KLZA 1GRFA 1Q8JA 3CBWA 2JEQA 3W83A 4HT3A 4WSKA 1OK6A 4EAYA 1R9YA 2FB3A 3GLCA 4RX0A 2DGAA 4UTFA 2AL2A 1ZLPA 3L4YA 4FALA 3WFZA 5HNTA 3VTRA 1IV8A 1XBVA 2JALA 4CQCA 2Z28A 2TPRA 4EWJA 5FMHA 3O16A 4JAWA 4CN6A 2IQDA 3KCLA 1NSJA 2CKRA 3PK7A 1M7PA 4LS1A 1R6WA 1XP3A 1EJUC 3M46A 4K39A 2W66A 1B5TA 3KTSA 1MO0A 3GHUA 1Q65A 3I10A 1FWIC 3WLNA 2J79A 3FA5A 4DJDC 3WDQA 4ATDA 1OIMA 5HULA 3W1LA 5K9CA 1L6SA 4URIA 1ZAHA 3UR8A 1C9WA 4Q4KA 3NNTA 1CXEA 5DEZA 4XTIA 1XYMA 1UD8A 4LH8A 4AEEA 1I0BA 4IQEA 3FSTA 4JCLA 1JCXA 3U7VA 1XIJA 2PDLA 2AAAA 2PBOA 1OGBA 2FPTA 3CGEA 2NXIA 1W8SA 3IJDA 4QXIA 3WQ5A 3AIVA 3THQA 1W2VA 4D8AA 1QXLA 4I5XA 4J5NA 5AHFA 3T2OA 2VGIA 1SQ7A 4O50A 1F74A 3A4XA 3H2EA 3FCPA 1PIIA 5DMLA 3QHNA 2YBUA 2CW6A 3GG8A 4ZFCA 1GGOA 4LVAA 1AK5A 4IJBA 2DFAA 5A5WA 2Z1WA 2EG6A 1Q6EA 4O8AA 5E93A 1M01A 1PKLA 3M16A 3QLLA 4BI5A 1PZ2A 1W32A 4J3TA 1TPWA 2IQ0A 1YNQA 4RL3A 1KBIA 4DO5A 3L2MA 2DJLA 3W38A 3IRSA 3VI2A 3TQVA 2OPJA 3EPNA 1E43A 3G24A 1VS1A 3LMYA 2CFYA 2YAUA 3QZ6A 2X0YA 4BI7A 3TN6A 4Y9OA 4PBEA 4DI9A 5LA2A 3G1XA 4XAYA 3W72A 3M6DA 1GQNA 5JRBA 3GUWA 5LIKX 4C6PA 1MXGA 1KRCC 2CXEA 1LP6A 2O9PA 1D3CA 1EP2A 3DHDA 1S1PA 4FR6A 3NVDA 2YLAA 4OV4A 1UKTA 3AYTA 2DT2A 3W2MA 2VHLA 4GIEA 1HF6A 4W88A 3V35A 1QHOA 1FWNA 1X38A 3BSGA 3NQAA 4TUFA 3FHAA 4RLIA 1J0ZA 3IVUA 4XO7A 3VA8A 3MWCA 1OZQA 1ZENA 4IHCA 2BSLA 3AZTA 5CC3A 1OIFA 2O9RA 1PBGA 3S46A 1MSSA 1H7OA 5TBOA 3VUPA 1H62A 4GY7A 1EH9A 1FDJA 1GZ1A 1IR1A 3CASA 1FHLA 3VNYA 3DFHA 4HA3A 4IGSA 3GR8A 5IXEA 2D2OA 1GTHA 3BLDA 1GREA 1W2PA 3MCOA 1V02A 3E0WA 3ZZ1A 3NZRA 3KHJA 1KBBA 2GJXA 5MKGB 1JEZA 3UZ5A 3N9KA 4GCAA 3EDDA 1A5UA 4YL2A 2PLCA 3RR4A 3ABXA 3STGA 3KHDA 3O6YX 4DQWA 2V2DA 4MMWA 1ZTVA 4Y9PA 2UWFA 4FIRA 4TVUA 2FVMA 1ZNNA 4BURA 3I7QA 3GVRA 3SN4A 3W1NA 3O2LA 1XV8A 3B0VC 3W81A 3QM3A 1YEYA 2BB0A 4RW3A 3PM6A 1GPFA 1K03A 2ADAA 2HE8A 3GO2A 4PMJA 4LSBA 1K9TA 1QCWA 5MHBA 1QO2A 4OV9A 1H1ZA 1PKYA 1MDLA 3QSTA 2NQJA 3MP5A 2FHCA 4JIRA 3ANVA 4AY1A 5A6JA 4BWLA 4KEVA 1F05A 1N55A 2GWNA 4JX5A 4AAJA 2OX1A 4DO7A 4UNKA 3TR9A 3GU2A 1LPFA 3R8HA 4A4AA 3QFBA 4NP7A 3GE7A 3BXWA 2JIEA 2V2HA 3K8MA 3RFAA 4IIEA 3FJ6A 4HU0A 4JQ9A 4FIQA 1VYSX 2WVVA 2ACQA 4JIQA 5LIXX 2QAFA 4Q4RA 4NILA 1Z9AA 2V69A 1GRGA 1M6JA 1K9FA 1RUSA 1SJCA 1EYEA 4FNUA 1AUSL 2CHRA 2C1HA 4A8RA 2X40A 4U3AA 3C56A 2X1RA 3BV7A 1V4YA 2ZWYA 1GEHA 2XPKA 1L6WA 5FESA 3QPYA 3ABZA 2Y5EA 4IFOA 4PTDA 3BURA 4TMCA 1OM0A 4HJWA 5A1AA 1EGZA 1WZKA 3NYDA 4JHMA 3LN3A 3BOLA 3LU2A 2OELA 3BJSA 3G8EA 1G4PA 3KX6A 1UUMA 1KWGA 1HT6A 2CLFA 4RDWA 5T26A 1X39A 2ZIDA 3GVGA 1UASA 3BAJA 1XIIA 4AZBA 2O9TA 3VNDA 3LI0A 3S6OA 4WY0F 3N2MA 1TYGA 4I9TA 1B1YA 3EKZA 3A22A 2QULA 2XVGA 3WJYA 2FDSA 1MQPA 3CV1A 4ZO7A 4X9SA 3HMCA 4W89A 3PJXA 1XYFA 4AZ6A 1CXKA 3GH7A 4FPSA 2VR2A 1ME9A 3BZJA 1B2YA 3VGEA 3TCEA 1QW7A 1DKWA 3GFYA 2A7NA 1R30A 5KITA 2Y63A 4Z2GA 3E5PA 4H9VA 4NEWA 1TUXA 3LXCA 4RE3A 2Y4SA 1SZGA 3NVYB 4RKAA 3AHVA 3WMCA 2IQTA 2HROA 1KWKA 3G77A 2ZX5A 4MOZA 5D2YA 5HJLA 3A64A 4X3ZA 2IPJA 3CHCA 5I79A 1W91A 4NJKA 1AW2A 3R2GA 3WMLA 1IEIA 2HS6A 3FA3A 1US3A 1TMLA 2F8QA 1ZP3A 3IK2A 4LF2A 5IDZA 1UZDA 5IRPA 2NX1A 1CLVA 4NZ5A 2H8XA 1JD9A 3CZ8A 5JQ9A 5FS8A 4WR3A 2QCLA 1A4LA 3WF0A 5CZSA 4J40A 4KCTA 1OJXA 3TTQA 5DMNA 4IIGA 1UW9A 4G8TA 1QHPA 5REQB 2QJHA 2W27A 2EGZA 4TU1A 3WDPP 3T8LA 1KKRA 1TSIA 1V3IA 5BRPA 4HYVA 4AZ7A 1OK4A 1SW0A 1TPUA 3QW3A 3RU6A 4B2DD 3TLQA 2GH5A 3UZXA 3CV7A 4O16A 3L67A 4HPJA 8TIMA 1H7PA 3R0DA 3QRHA 1F6YA 4GUJA 4ERAA 3WLRA 2WMKA 2XSAA 4XD3A 4IMAA 4JTAA 1Q8AA 3FSUA 1EB3A 4XKYB 3W29A 3URBA 3AYRA 3UWVA 5AC6A 4GC4A 2I56A 3OC4A 1S5MA 3AMCA 3IK4A 4ZCWA 3ZS4A 2C3ZA 4AQLA 2JGQA 1OWQA 1XLHA 5DFAA 4DBDA 3KEHA 3EWCA 3L5AA 1SMDA 3AXHA 3WEZA 4J57A 2QR6A 1IGSA 4XZWA 3CZLA 2ISVA 5I00A 4MNKA 1OZMA 2R24A 3MSYA 1EIBA 1H0GA 2QV5A 1E15A 3BMVA 4AXKA 3DDMA 1E0XA 1E4NA 1KRMA 2J8GA 1MDRA 1NOWA 2OX4A 2D24A 1FECA 3STPA 3JRKA 2I1OA 5BMWA 1GOIA 1X6UA 2BS9A 4QE5A 2DP3A 4D6JA 2AMGA 1W1YA 1YPFA 4TV6A 3VNIA 3KWXA 1OFOA 5DRIA 3OLIA 1T7LA 3VK5A 1E5NA 4JKMA 1B54A 1X97A 4FNQA 2PDFA 1VD6A 3TJIA 1EBDA 2EBNA 3M0ZA 2HBXA 3FLUA 3MYPA 1V93A 4XZLX 4L65A 3MHUA 3IJ6A 1A5BA 1YDYA 1HL2A 3L2IA 3ABOA 1QI3A 2PWUA 2L5HA 5D03A 3SAZA 1V03A 2ZTKA 3LCIA 1J6OA 4MY9A 3AQUA 3G0UA 1GVRA 3CLMA 4K7ZA 2NQHA 6XIMA 5BWFA 1VFUA 2FPVA 3E38A 4QLKA 4QLLA 2CLMA 3V1PA 3LHZA 2ABAA 2FJUB 2F7FA 3GD6A 4F0SA 3OGRA 1TMQA 4L61A 4QM1A 1XXXA 3FNDA 3PBVA 1EJXC 2WNNA 1ADDA 4JKLA 2WQPA 4KESA 4REQB 3TLLA 3FYYA 2D0FA 2YCEA 2OVLA 3Q65A 2BVYA 1V3KA 1TVLA 3M0VA 4WSHA 4LAOA 3HG3A 3VZZA 4IH3A 3ZR6A 4C6EA 4MWAD 1BTMA 5ABTA 3BW3A 3S5SA 1VRDA 3MVTA 3QMSA 3TKFA 3HG4A 4NJIA 2P88A 3ATZA 3EGJA 1A0DA 2C71A 2OYLA 1WP6A 3FDGA 3K8LA 2E09A 4QG6A 3QY7A 4JYDA 1ML1A 3VKJA 5ABEA 3W2NA 1JYWA 2XM2A 2VMFA 3ARSA 4OHQA 3KBJA 2VDIA 4ICCX 1ZDLA 2CU0A 1AH0A 2CERA 4O8RA 4I90A 4IOTA 5HWNA 5GPRA 3IJIA 5CPLA 4GWEA 3LZ5A 4ADWA 4CNNA 3DESA 4ZMGA 5D9MA 5AECA 3THUA 3JS3A 5CC6A 3SQMA 1ICQA 3PY2A 3NQCA 3O6AA 1RJRA 1CXLA 5RUBA 2X2GA 4UCGA 5BROA 3UJEA 3CMFA 3UA4A 4Z1AA 3PANA 2YB4A 2NVKX 3HGOA 2BXZA 1YQZA 4AWSA 3GAYA 2PTXA 4F0MA 3ICJA 1W5NA 2F38A 1JNDA 2YOCA 2TRSA 3LEPA 1T96A 1NH6A 3W53A 3GH5A 4YVVA 3P8JA 3G5EA 3DI1A 3BPWA 3VUSA 3MUZ1 1W56A 4L4MA 3H4XA 3V0SA 5KTLA 4Q6JA 3MVIA 3SECA 3WQ4A 2HXUA 3CHDA 4IPLA 5HK4A 1GNXA 2ZBTA 3EWZA 2QF8A 4KBXA 3IC9A 1S46A 3MDUA 2WSRA 4LRSA 1BG4A 1UA7A 1FUYA 4B5VA 4POCA 1PCWA 4Z2JA 3AS3A 2VDGA 1X8CA 3VAVA 2VGBA 3UW6A 1E9IA 1P0EA 1VLWA 4RZ5A 3VKKA 1XLKA 3I68A 3CQHA 3KBMA 1WBJA 3T0CA 1WDWA 1VQTA 2B7NA 1EEXA 4R34A 3HTWA 2XHYA 3RRAA 1KR1A 2E6FA 3C8FA 3FVMA 1RZMA 1XYAA 3G2GA 3PPGA 1QI2A 5CC5A 4UQAA 4J3XA 2QDEA 3P7YA 3WH7A 3FYOA 3E2QA 3FK4A 3WBAA 1KR0A 1XBZA 4LV4A 2IPWA 1A5OC 3DG7A 4HU4A 4IPIA 4Z0SA 1FKWA 3ARWA 5G2WA 3NG3A 2NV2A 1R9ZA 2X0SA 5ECVA 4CEUC 4DNAA 4OUIA 3E6EA 2RKXA 2QVHA 3NFUA 1AVAA 1UZ4A 4CNUA 2WOWA 3HPZA 2AAMA 1UG6A 4JN8A 3W7RA 2EQ7A 4M51A 3NGJA 4JTRA 4IPJA 4JQAA 5EBKA 4L9YA 1VBUA 4L5ZA 4W93A 4AVNA 5ABHA 4ZO8A 1TTPA 2RJGA 3G8RA 1G6CA 4O1FA 3NUKA 4PSPA 2OTDA 3H2FA 3GW0A 3EX3A 2FTYA 3AHTA 2EO7A 3URQA 4IGHA 3KOFA 1TCDA 5DELA 3V0TA 1NDWA 4LVDA 1UH3A 2DZBA 4XSMA 3VMPA 4GYJA 4N6EA 1VHCA 4N4PA 4HU3A 1JUBA 5D2VA 1Y5XA 2XVPA 2INZA 1C3FA 1LL6A 1LT7A 2H8ZA 2ZX8A 3H24A 1EGVA 3UD6A 4PL1A 1S5TA 3WY1A 4AVFA 2VX7A 1TTIA 4DEFA 3WQCA 1VJZA 1UR0A 2WNWA 3FGCB 3R12A 1W3KA 5AVHA 1W9UA 3VIGA 1QU4A 1F8WA 3N25A 1HKIA 4O13A 4JN6A 4KF1A 2HZGA 4MY8A 3W22A 1EPXA 2BC1A 1OBAA 4J27A 1FWBC 1W3TA 4ZO6A 1MYRA 1U30A 1X2GA 3UZZA 2BOFX 1XRVA 3OGVA 3KZPA 2J24A 3FW6A 3SQPA 1UZ1A 1GJUA 5FS9A 1MQRA 1QPOA 3MBFA 2UBPC 4D71A 3DX5A 4OBSA 3QGAC 4MPKA 4ZE4A 3IRDA 1MMFA 3NSXA 4JFTA 5AFDA 2PWFA 4F40A 4NT0A 3T81A 2QXWA 3GHRA 1FEAA 3P81A 1Z3NA 3WQ8A 4EANA 2XH7A 3MMUA 4PMRA 4M1BA 1IEXA 2XZ7A 1LWIA 3QW4B 2WMIA 1M41A 5FAJA 3N12A 3CB8A 2J7HA 3T42A 4YTUA 1XLBA 4FB7A 3M44A 3NPVA 5ABFB 3MZ2A 5A6KA 4K6AA 4GABA 3NDOA 4OGZA 5DLCA 3GC4A 3STCA 2GSJA 4M6UA 1EFZA 1YDVA 4GINA 2E25A 3HQPA 4R9XA 3VIIA 2ZRXA 1D8WA 1IT8A 3LTYA 1QPRA 3W1XA 4Z2LA 2Y8VA 1IWPA 5DCEA 4KFNA 2TSYA 4LUTB 4C6KA 4MJZA 5DX7A 2XWDA 3KXQA 1UC5A 4OUEA 3IACA 3CUJA 2DUAA 3QR0A 5CAKA 2ZDRA 1ZPTA 4CN1A 4JPGA 4L80A 5FJOA 1E4IA 4B90A 1KC7A 3FEMA 1ZFJA 3W7EA 2YPIA 1TJ2A 2FZDA 4G7EA 4JFVA 3HJEA 3WG6A 4WZHA 1G5AA 3G22A 2XFYA 1OFPA 3UXAA 4O4VA 3VKBA 2DQXA 4JY9A 2VGGA 2WOQA 5CLTA 2VVSA 1O94A 4AZHA 1FXPA 3FEQA 2NZLA 3B8DA 3N2XA 4MZ1A 2OWXA 3IIZA 2J7GA 3OQEA 5FS7A 1V3HA 1LLWA 3RG6A 1I60A 3CHEA 2HE5A 3GVVA 4D1JA 4MKVA 1DOSA 3T8QA 3PJTA 3LMZA 1JCTA 2E1DA 1W5PA 2FTWA 3H4GA 3MMWA 3W26A 2RUSA 2VFFA 5FAGA 1C93A 3CEUA 3JW7A 4C6NA 1IEWA 1M68A 1QI5A 3DKLA 5ER0A 3BLPX 1E1FA 2ALDA 1A4MA 1UOZA 1OYCA 3TH6A 1HG3A 4IG2B 4NKCA 3ARQA 1OABA 1EO7A 3HF3A 1AOGA 1D9EA 1S2UA 5G4HC 1KM1A 2Z6IA 3O0FA 3VIOA 1JZ7A 1MRQA 1WA3A 1EUNA 3K5XA 4IP7A 2C13A 1JDEA 1VENA 4XTDA 2XVKA 1D7KA 5I0DA 3CV6A 4J1OA 2WXDM 3IGXA 4BQ4A 2NQ9A 1N5WC 1SZNA 4MF4A 5A6BA 1QI4A 3PULA 1X6LA 2YXXA 2A4AA 3ISIX 4JIEA 4Q4MA 2PU0A 3WBWA 1WCGA 2MUCA 2HDJA 4NRRA 1GOKA 1RA5A 3RCMA 4LBSA 5FKYA 1KCZA 3DFTA 1XLLA 3CAWA 1UMLA 3ARPA 4GX9A 3GU9A 3SCNA 1JEHA 1GETA 3HW2A 3OLGA 2NLIA 2VDHA 5H91A 2C91A 1WX0A 1O95A 4N9CA 1Q6CA 1QWGA 3W71A 2QGYA 1M7XA 1GRTA 3M43A 5AN7A 3IIPA 2HQAA 2PTWA 3PBWA 2VEPA 4OT7A 4DJDA 4JHZA 3ATYA 1G4TA 4I6KA 3MC5A 3WNNA 1PKNA 4ECLA 1T8QA 2V68A 3WYZA 4FOUA 2QVNA 4MVAA 4YTTA 4AY7A 4E5TA 4F8XA 2WHLA 3M4HA 3VNJA 1XINA 2NVDA 3QYQA 4QJ1A 3AUJA 1XIDA 4D6IA 2CZEA 1NOFA 2AMXA 2CXGA 2PD5A 3SB0A 4PMQA 3MZNA 1MFUA 3ME3A 3Q67A 1UR2A 1W6TA 5AHNA 3Q6JA 2V5BA 3MB9A 2PC4A 4EXAA 2QUVA 2OGJA 1CXHA 3CGTA 3OZYA 2DH3A 3GRIA 4GR1A 3JUGA 5C2XA 2QS8A 2PDNA 4QIUA 3FFSA 4LNYA 2JKEA 2YXGA 1RSCA 4W7UA 1QI0A 3PPFA 2HWGA 3M47A 2X7WA 1OG0A 4CCZA 1TIMA 2EQDA 2H6RA 2E9LA 3W28A 1BVWA 3XINA 1KM5A 4L6HA 4WUIA 3W7NA 4GVGA 2HVNA 3EYPA 4ZE5A 4APNA 5LHFA 3GTFA 2VFGA 1GORA 2V6OA 7REQB 1S5NA 2Z6JA 3FV9A 5I77A 5G5IA 1HW6A 1J9YA 3MW7A 1QNVA 2Y85A 3CQIA 2CWNA 3AMKA 3CAVA 4H9UA 1JF6A 1VB9A 4D8LA 3EAUA 1Q6QA 4KW2A 2I5QA 4FX9A 4P8XA 2V3GA 4G7FA 3A7RA 5IFTA 3DFYA 5LA0A 1E70M 4N2YA 3P74A 1YKWA 2ZRYA 4E2DA 1PYFA 1BKSA 4WEVX 3VOFA 2V5DA 1THFD 4I6VA 1JVNA 4GLEA 3NL3A 4IM4A 4LIIA 4H7CA 4IIFA 4D9PA 1W0MA 3PZNA 1UUOA 3SCVA 3ZWSA 3WF3A 1JPMA 2Y6ZA 3O63A 3VYLA 4L1WA 4C6CA 1HP5A 1VPXA 1LQ2A 1WBHA 4NIRA 3GRTA 1IGWA 1V08A 2RHGA 5CBIA 4J3SA 3IJLA 5FCZA 1QO5A 1MNSA 3KL5A 3PB0A 9RUBA 3MUIA 3SRDA 3VPLA 3VDAA 4GYPA 4HP5A 4NXKA 3GDMA 1CNVA 4E3TA 4EPKA 4TOQA 1T40A 3N19B 4H41A 2PF8A 2OCZA 3BAKA 4UR7A 1XRSA 4S3BA 1JQXA 6PTDA 1AW1A 2C0HA 3BMXA 1VCFA 2B81A 4LCSA 5ECUA 1PHQA 3OP2A 4GI8A 1FEBA 3V7PA 2E5BA 1G69A 1KFCA 3DH9A 3W7QA 2OGYA 3VO0A 4ADSA 4R7WA 2BY0A 3EWWA 3TVAA 4EMIA 4K7YA 1XDMA 5FL1A 1SM9A 3DU0A 2JFEX 4F79A 1CWYA 2Z1SA 1VEOA 4NYUA 4M6QA 2FJKA 1O1HA 1J0YA 2AQOA 2C19A 2VT0A 4CNTA 4GBUA 2I5IA 5DANA 1KBKA 1US0A 2QJMA 4GY1A 2XFRA 3ARYA 1HGWA 3WLIA 1FDYA 2QIWA 3OA3A 4B5NA 1ISWA 1SO5A 2JK6A 2H3BA 1DPMA 3PBGA 3QR3A 2WPCA 4GACA 4JDYA 4XD5A 1YPXA 4UFKA 1Q6OA 1NOUA 2MNRA 4IMGA 5FOOA 2Q71A 5CCZA 3F2BA 2Z27A 4C5ZA 2GJPA 3VIHA 1XQLA 1DBTA 1QUMA 4Z08A 3P0XA 2XFFA 2UY5A 1ZZMA 3CIXA 1B57A 3F03K 3HN3A 3CGBA 3CQJA 1ONRA 5MF5A 2P0OA 1EC7A 1UWRA 2QV4A 1CI1A 1X7IA 1M65A 1W9XA 2CC0A 4NZ3A 3WMSA 4AF0A 4MM1A 3WD3A 3B8SA 4HB7A 3CL8A 3DFQA 4AU0A 5AZ0A 3UYCA 5HXMA 3R58A 5TIMA 4MWAE 3RM8A 1G4EA 1EF3A 3BGAA 1BSIA 2PCEA 3IAQA 3T05A 2EPLX 2G50A 1XHGA 4RZ4A 3WK2A 5BU6A 2FZMA 5DN1A 2OT1A 1ENUA 3B9EA 3UF9A 3BDKA 3WF2A 3AU2A 3S4TA 2Z0IA 3PFRA 2A6NA 4GYFA 3LPGA 4AYSA 2BGSA 2C8NA 1BWLA 3TA9A 3LCLA 1NARA 3GZAA 1UWSA 3LHVA 4QP0A 2D1ZA 2WKLA 4CD6A 1FIQB 1KB3A 3SUVA 1KRAC 4M7TA 1A5KC 4N42A 2VEFA 2VEKA 4R7JA 1W31A 1PAMA 4UTMA 2BV9A 4ZOCA 5HANA 2GR1A 2W0HA 1FP9A 2DUXA 2NQ5A 1E6NA 4JTGA 1XI3A 1EZWA 4EF8A 3WFAA 3NM3A 1LG2A 3P67A 3PVFA 4PMNA 2DT1A 4RPPA 5FJPA 1UP0A 3E9AA 5C7VA 3YPIA 3M7SA 1SO3A 4HSHA 5I02A 3IARA 1FHVA 2CLLA 4I7VA 1XH0A 2LLEA 1P7TA 1ZJHA 2YLLA 4ERGA 3FVDA 2PCQA 1DL3A 1TTQA 5A8GA 2CEQA 3UY7A 3F4DA 2Y88A 1UWAA 4LRTA 4LPCA 1TMHA 1W5MA 4DUWA 2J75A 1EPVA 1R46A 4HHLA 3VCRA 3V5OA 5FJTA 4IUGA 4NAEA 1P6WA 4GNVA 3SADA 1WB0A 1CT5A 4CEXC 1E73M 1UR9A 1OQFA 2DZSA 3LRKA 4JY8A 3B8TA 4KETA 4O54A 2FVKA 1QAPA 1OY0A 2DVUA 1N5XA 2DQWA 2KZHA 1F3XA 4MNMA 2Z00A 5BRQA 2E5DA 1UWIA 1NDVA 2GVEA 1TRDA 4OJYA 3S8HA 2FH6A 2WO5A 3POCA 3RNDA 3W7MA 1J10A 4GXWA 4NZCA 3EF6A 3C2OA 4P7NA 5A6AA 5HR7A 1T8XA 4HSOA 2E1WA 4Y9NA 3AUOA 3W7JA 2EPHA 2J25A 1W17A 2A6LA 3G0XA 5EL1A 2W54A 4H4VA 1YPIA 3WKZA 4OTKA 3QF0A 1ME8A 3BL3A 1FP8A 2I57A 3HPFA 4AEOA 1UD2A 1CBGA 3T6CA 4F4RA 4JFUA 1G4SA 4PUUA 3U3HA 2PP0A 3CGDA 2GK1B 2X1TA 4IL2A 4DB7A 5F4WA 1B3YA 1C91A 3H22A 4ZB0A 1KW1A 5JVLA 1XIMA 2GGGA 4LJ3A 1PHWA 1PB0A 3QOKA 3UFYA 2VM8A 5KEZA 3WJZA 4XZ9A 3BAXA 1ISYA 4W8BA 5U4NA 3ZXWA 3N4AA 3XISA 2DY3A 1WDPA 1DWHM 5IFPA 3NRZB 3F5JA 4P8WA 3KOZA 1EBGA 1XD0A 2GOKA 3CJPA 4O28A 1Z7AA 2CZFA 1X8FA 4NZFA 3M7WA 3M0YA 2J8TA 1ZKQA 4X2PA 2PDXA 4GKLA 6REQA 3SRKA 4PODA 4GOAA 1N8IA 2VEGA 3U2OA 2E68A 2FZBA 2R82A 3ONBA 1Q63A 2ATSA 1BSLA 3ZFHA 4JNZA 4EVZA 1GVOA 1V6UA 2WC3A 2WQDA 1VP5A 2G3IA 4Q8NA 3Q37A 3N3TA 3MBDA 3N2BA 5I3JA 1FCVA 5FJRA 4NHVA 1T41A 3W1UA 4JTUA 2X8RA 4KCWA 4GUGA 4QSFA 1E4LA 3L23A 2BXVA 2FIQA 5PTDA 1XBYA 2NW0A 1XD1A 2PTZA 2VRJA 2UY4A 3UZYA 4FSAA 5CZTA 4UNIA 1FCBA 1V0KA 2ZVIA 1HNYA 4IWWA 3R8GA 2PLKA 5B80A 3NQEA 5LXEA 3B06A 1W1A1 5CC7A 3LPOA 2R6OA 5C5YA 4GVHA 1UD4A 3S2JA 2C0AA 4JYFA 4JTEA 2OSXA 4KGJA 3PZUA 4KWSA 4AMCA 4H2HA 1WKEA 4TO8A 1S5WA 4FO4A 4M6PA 3UWQA 1TTJA 1F61A 1FFUC 1M1BA 2EXOA 2VD9A 2ZX9A 1R3YA 1PUDA 3E5BA 3VCNA 5AYXA 3WFLA 1XIEA 1CENA 4B3LA 3WK3A 3QOMA 3W7LA 1QNPA 1TRIA 4HNLA 3TQ0A 4MWAB 5JH1A 4UC5A 3WF4A 3NQGA 4LGXA 3LBMA 1PTAA 3WZ0E 4QBXA 3SI9A 3PF3A 3W1TA 1XLJA 4J4KA 1EIXA 4LCRA 3DFSA 1GQKA 2EKCA 1N63C 3B97A 4ZB2A 5AYZA 1EC9A 4NX5A 2IS7A 3TTOA 4RW5A 2VGFA 3UP8A 1MQQA 4O10A 3GG1A 2XN2A 4C6QA 1CB7B 2ZCGA 1MVYA 5D2WA 1XYBA 1XIFA 2QAEA 1EBHA 3C3UA 1Z32X 3GDBA 4MLJA 2WHJA 4H6KA 4UFLA 3MSDA 4J7RA 3UWWA 1XDJA 1UJQA 3KP0A 1R85A 4ILSA 1TWIA 3OIXA 2ZZ5A 1V0LA 2YFNA 1HL8A 4GJJA 3VM7A 4IPPA 1UWTA 3TYCA 1TIWA 3TUUA 3ERPA 3ITOA 4C60A 1HXJA 1RCOB 3BJTA 3SW6A 4R27A 2Z1XA 3RPTA 2D3LA 4IIHA 3BMWA 3VVGA 1DJGA 4QROA 4ZL1A 3EX1A 4D6FA 1QR7A 4QNEA 3KTXA 1GXFA 1H2IA 4PB5A 3ZJ6A 1L2UA 3AROA 1QMLA 1S5VA 4JL1A 2AKZA 3ELFA 1NIUA 2DT0A 2A5HA 1EC8A 4Z2HA 2QUNA 3VIKA 3HZ3A 1N82A 2PC8A 3VMNA 4BA0A 4Z42C 1JAKA 4E2VA 1BLIA 2FYMA 1A3HA 4WKFA 2Q3RA 3GUGA 1JCLA 3C8NA 2V9DA 3S9ZA 4MLRA 4CCDA 1K4QA 1VPQA 3GZ3A 5FJJA 2ISWA 4MYXA 1QTWA 3VKDA 5BCAA 1E1CA 4INFA 4BQ5A 5BXSA 4BI6A 2WMHA 3BLKA 1TWDA 4MB3A 1FFQA 4UCFA 4OZOA 4Z1DA 2FGBA 3HOJA 4IX2A 2VCAA 3LCFA 1I9CB 2P10A 3UYIA 1BVZA 4DM2A 3H4WA 5IBXA 4DO4A 3PBMA 3CMGA 3RILA 1KFJA 3JZUA 3WDJA 4Q33A 3R94A 2QUTA 4HZ6A 1BGAA 3OGSA 5CG7A 3WLQA 2BP1A 3GKAA 3CLWA 3DFPA 3KRUA 2CLPA 3HURA 3TEVA 1QRQA 1JFHA 5L9FA 2JQXA 4O15A 3U8GA 4JIIX 3BOXA 2R9RA 3Q58A 4Q4OA 4AZCB 1HJQA 1T3QC 5LZLA 4UMCA 2EQ6A 3FXYA 1CGXA 1I45A 1KM6A 4WXZA 4YJ5A 1ONWA 1UJPA 2VRKA 3UU0A 4N7QA 2D3NA 3EZ4A 5J8LA 3V5CA 4DLFA 2YCKX 2PGEA 3N3MA 1KCLA 4WIWA 3CZJA 1SW7A 1IIGA 3BLLA 5H6HA 3A13A 4W5ZA 4A3RA 4WY0A 3G1VA 1R47A 3GW3A 3RCYA 3S2NA 7TAAA 3VOGA 4MG4A 5EFFA 4UZSA 1ZQ5A 3WLJA 2RABA 4IP4A 2VYOA 4DAIA 1A5NC 1GRAA 3NSMA 1GYLA 5HPOA 2ZUTA 3HQNA 5DXXA 3RGTA 3WNKA 4S1FA 1VH7A 1NDAA 1XYCA 3B0UX 3NZ1A 4KGLA 3BWWA 4F2BA 1F07A 1JROA 3KRSA 3TYAA 4WJ8A 4CNSA 4UXDA 1I0DA 2A79A 4H7ZA 4YTQA 3UR2A 5LIWX 4Q32A 1JRPA 4XBSA 2Y70A 2PP3A 1V02E 1KQYA 4UTWC 4DBSA 4A3UA 5I3KA 5CSYA 3T0BA 1GHRA 4W85A 4CNOA 1DJIA 5JBDA 1GTEA 1C8YA 4WDTA 9CGTA 4XKYA 1R3QA 3VDHA 3VXGA 1PE1A 3KCJA 4WD0A 3EBVA 3T2PA 8A3HA 2E28A 1TPVA 4QX4A 2VC9A 5KZEA 2ZRZA 1J2BA 1QPQA 4NG3A 5JCLA 3OJGA 3MJYA 1DXFA 1FH9A 2DZPA 5A6BD 4MNJA 4Q8TA 1W9DM 4LF1A 3Q94A 3ZLHA 2Q8XA 2DEPA 4HPNA 3QC3A 4F9JA 2EF9A 1CW2A 1VFLA 3CL7A 1QNRA 2D23A 3UPWA 2P50A 2D2JA 3NAVA 4PMYA 3SJ3A 4E3VA 1VFMA 1X2HA 1R7OA 1M9HA 3GR4A 4ICNA 3TJ4A 1WOAA 1K8CA 1UIOA 1TG7A 3P14A 4C6FA 3BLFA 4O0KA 3TTYA 1HKWA 5KVHA 4G1NA 3PB2A 1B9ZA 4LV9A 2YZRA 1SJAA 3NM1A 3TOPA 5CBBA 4H4ZA 4NZJA 1H2JA 4DJDD 5IHRA 3HPAA 2WZIA 4W8LA 1FOBA 1OHLA 1W3HA 5HMEA 3BGJA 4HGXA 1WXZA 3LTPA 4MPQA 1EF2A 3BE7A 1N62C 1E72M 1QPNA 1XSKA 3BQ6A 1ECEA 3NYZA 3VNZA 3SDOA 4B5UA 3ITLA 1AZ2A 1E0WA 2PEVA 3V5FA 4JZ5A 3WIJA 2AL2B 2BOEX 4LAZA 4LY4A 1NHPA 3TC6A 4JHOA 1UP3A 3LBCA 2PWHA 5GNXA 1KXVA 3NCOA 1EDTA 1I2NA 4PB4A 1E0VA 3BW4A 3QY8A 1QNSA 3GC2A 2CLHA 4A2SA 4AFYA 1W8GA 3B0PA 1RPKA 2R1KA 2NWRA 2YX0A 2OZ8A 5G4WA 3IAPA 3S6DA 2J7FA 3L2LA 4HNVA 1H11A 1KN0A 3PTQA 1C8XA 3K1DA 4HKPA 1R8LA 1Q85A 1D2KA 3N18A 4V1YA 4QJ3B 1JQVA 4XQ6A 1MW2A 4QG8A 3WN6A 2YYUA 1ZB5A 4OBTA 4XK2A 1M53A 4FXRA 1J8VA 2YQUA 4PUEA 1R2SA 4HK5A 4KWOA 3BG9A 1MRAA 3N6JA 1J0KA 5G2HA 1DIKA 5FEZA 2D0GA 2QLYA 5E09A 3A5VA 2YXOA 3UGVA 5D9OA 4BS0A 1AQHA 1JR1A 4LC6A 1ZBWA 4JBRA 8CGTA 1J93A 3L0NA 4Y9AA 2H90A 3WH6A 3IANA 4UFJA 2QJJA 3GC5A 3T7VA 4W7VA 4AVOA 2VFIA 3I7SA 4PC8A 1WAUA 2O4MA 4WDXA 1OSEA 5IDIA 2ZVRA 2XN1A 4GFIA 1XX1A 3TYZA 4TVDA 1SW3A 3U57A 1OB0A 3WJSA 3W00A 4W86A 4RUBA 5HQLA 1B90A 1GOMA 2O9OA 3T0TA 1Q3NA 5BNKA 5HUOA 2CIPA 4EXBA 3I7RA 4GVFA 3II4A 2NQLA 3O06A 4IMEA 2G4FA 3ZVHA 2OU4A 3UG4A 2D0HA 4BY3A 4LT9A 1LG1A 3MYOA 3HA1A 2O56A 1W1PA 5IHSA 4B4FA 4IGMA 3VZYA 1B4EA 1XF0A 3W74A 1VGAA 2W5FA 2Y62A 2QJGA 4UNLA 2QUUA 5D8WA 3S2CA 3U4FA 3PFMA 4MFEA 7TIMA 4H9TA 4XAGA 4ZA0A 3SCTA 1DVJA 1F4HA 4PSRA 5DF0A 1OGGA 4K1WA 2Q02A 3WLOA 1S2TA 4LYRA 3W7HA