3R11A

Crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : mg and fumarate complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
362
structure length
362
Chain Sequence
VSKIIDIKTSIIKIPLKRTFITAVRSTNHIDSLAVELTLDNGVKGYGVAPATTAITGDTLQGMQYIIREIFAPVILGSDLSDYKQTLELAFKKVMFNSAAKMAIDLAYHDLLAKEQDISVAKLLGAKANSIVTDVSISCGNVAETIQNIQNGVEANFTAIKVKTGADFNRDIQLLKALDNEFSKNIKFRFDANQGWNLAQTKQFIEEINKYSLNVEIIEQPVKYYDIKAMAEITKFSNIPVVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMESPAGILATASFALAEDITVADLDPLDWVAKDLYSDYITFNEPNIILKDNLKGFGFNLAENLYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enzyme of enolase superfamily
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Francisella philomiragia subsp. philomiragia
molecule tags Isomerase
total genus 119
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3r11A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3r11A01
2PP1A 3V5CA 4KEMA 3THUA 3KUMA 3CK5A 1EC9A 1SJCA 4HPNA 2PA6A 3DFHA 2AKMA 3MWCA 2MNRA 3EEZA 3QKEA 5FJUA 3CXOA 4F4RA 1MUCA 3OTRA 3ZLFA 1ONEA 2PSNA 2P88A 3IJIA 3SJNA 4E6MA 3UCCA 2DW6A 2QVHA 3PWIA 1MDLA 4E8GA 2GL5A 2GGHA 1FHVA 2XH4A 3N4EA 2ZC8A 3CT2A 3NXLA 2PP0A 2PP3A 2QQ6A 1SJDA 2AL2B 4MGGA 3QLDA 3DG6A 3SSZA 4DWDA 3TW9A 3N6HA 2HZGA 2FYMA 2OFJA 2HNEA 3R0KA 4IHCA 2OLAA 3GC2A 2PGWA 2RDXA 1ECQA 2NQLA 3VDGA 2PS2A 2FKPA 4M6UA 1WUFA 2XH0A 3VC5A 2OZ3A 3N4FA 2QGYA 3PK7A 3R11A 1KKOA 2PMQA 4JN8A 3TWAA 4GMEA 3K1GA 2P8BA 3UJEA 3VA8A 1XS2A 5EU9A 4HCDA 3FJ4A 3TCSA 1OEPA 1ELSA 4ZCWA 3S47A 2OX4A 4GGBA 3U9IA 3SN1A 2PODA 3HPFA 3FCPA 2ONEA 3ZLGA 3GY1A 4ZA0A 3B97A 3RITA 6ENLA 3DFYA 3FV9A 3UJSA 2OG9A 1FHUA 3DG7A 1R0MA 2XH7A 1F9CA 1JCTA 3MY9A 3TJ4A 3DEQA 3VC6A 3R0UA 3SQSA 3P0WA 3P3BA 2HXUA 3R25A 4DXKA 4KT2A 1TE6A 3I6EA 1MRAA 2PPGA 3MKCA 3TJIA 2QJJA 4HCLA 1SJAA 3MZNA 4E4UA 4ROPA 2QDDA 1MDRA 2MUCA 3SN0A 2OZTA 4MMWA 3U4FA 2AL2A 4G8TA 5IDZA 2OKTA 3STPA 1E9IA 4KPLA 4GIRA 3H8AA 4KWSA 3RRAA 3H70A 5BOEA 3V5FA 3FVDA 3OP2A 2XGZA 3VFCA 2OQYA 3ZVIA 3OW1A 3TTEA 3UJFA 3UJ2A 3RCYA 3SN4A 2POZA 3T9PA 3IK4A 3UGVA 3H12A 1WUEA 2I5QA 1XPYA 3DGBA 3QTPA 2DW7A 3JVAA 3CB3A 4GYPC 3OZYA 1P43A 3JZUA 3H7VA 4DX3A 1TKKA 1SJBA 2XSXA 3RO6A 3DERA 1BKHA 2P8CA 4HYRA 4H2HA 3ZVHB 4DHGA 1W6TA 4J1OA 3NZGA 4IP5A 1JPDX 4J3ZA 3S5SA 3T6CA 4JHMA 2CHRA 4IL0A 7ENLA 4DYEA 1JDFA 2P3ZA 2ZADA 1EBGA 1RVKA 3D47A 5J04A 3NFUA 3DIPA 3T4WA 4K8GA 3V3WA 4GYPA 1IYXA 4FP1A 1DTNA 2GGJA 4ENLA 2P0IA 3BOXA 2PU0A 3RR1A 2GGIA 4X2PA 3MQTA 3DG3A 3GD6A 3VCCA 2PTWA 3PWGA 2GGEA 3EKGA 4DN1A 3SBFA 3DDMA 4EWJA 5ENLA 5FJPA 3DESA 2PU1A 4IZGA 2PCEA 3UCDA 4K1WA 3FXGA 3QPEA 4M0XA 4G7FA 4YWSA 4MKSA 3BJSA 3I6TA 2QJMA 2OPJA 3TWBA 2GSHA 3OPSA 3MUCA 1JPMA 4A35A 4GFIA 1KKRA 1NELA 3BSMA 2PGEA 2QDEA 3ENLA 3ZLHA 2HXTA 3R10A 1NU5A 5FJOA 5BOFA 2O56A 1PDYA 2AKZA 3MSYA 1R6WA 4E4FA 2GDQA 1KCZA 4GGHA 3FYYA 3P93A 3VCNA 2OO6A 3TOYA 3NO1A 3PFRA 4IP4A 3CAWA 3N6JA 4HN8A 4IL2A 2GGGA 4A3RA 1BQGA 3GO2A 1TZZA 3T8QA 4H83A 3CYJA 2OZ8A 4HCHA 1EC7A 1YEYA 3R1ZA 3RGTA 4IT1A 3ZVHA 2AL1A 5FJRA 4A6GA 4GISA 3V4BA 3OZMA 3TQPA 3JW7A 4Z1YA 4HNLA 5FJTA 3Q45A 1EC8A 1L8PA 4H1ZA 4HNCA 2OQHA 4JN7A 4H19A 2OVLA 2PTZA 3UXLA 4FI4A 3IJLA 1PDZA 2QJNA 3IJQA 2PTXA 3Q4DA 3QN3A 3I4KA 4E5TA 3ES7A 1MNSA 2PTYA 3ES8A 1P48A 1KD0A 4Z17A 3D46A 4K2SA 1EBHA 3UXKA 2XH2A 3UJRA
chains in the Genus database with same CATH superfamily
4TO8A 4N9CA 1EP3A 1BAGA 2UY2A 2NVKX 4QBXA 3MV11 3BW4A 3ZJ6A 4N42A 1RP8A 2PDWA 1G4SA 1Y7VA 3EEZA 1SGJA 4ZENA 3MKKA 2PDNA 1LQ0A 3TN6A 4J5NA 4J56A 3IJIA 4B5NA 1XRTA 3FSUA 1XISA 2IXVA 3TMLA 4DQWA 3W37A 1TUXA 1XHGA 3BC9A 3S2LA 4EXQA 2I9UA 3OIHA 2CZDA 1XC6A 3EX4A 1ICPA 5I78A 3TTQA 3VOIA 3PBWA 1Q85A 5LXXA 3VM5A 1W31A 4HK7A 1UKTA 3KE0A 4K8HA 3P62A 5F1UA 1HKKA 3PG8A 1VDVA 3CWOX 1MW3A 4JZ5A 1HJUA 1QW9A 4KPRA 4IJRA 4QS6A 1XIIA 4LFYA 5REQA 2PDCA 3K4WA 3C56A 1NDWA 1TPFA 1JZ5A 4M6UA 3LLDA 3GDKA 4O57A 5DXYA 4AZ5A 1TB3A 4B5VA 2XZ7A 1QT1A 2BVTA 3EWUA 3BANA 2GQ8A 3OLGA 4DJFA 2W3ZA 1VENA 3UYCA 1JJKA 4JTFA 4W5UA 3KL5A 3IIXA 3WUFA 1VBUA 3UWUA 4HCDA 3FJ4A 1ZAJA 4DUVA 1YDYA 1TE1A 2I5IA 2WKJA 2QCLA 1LL6A 1KA9F 3W53A 3NQAA 1W91A 3L12A 3AYVA 4BWLA 2VC5A 3C5QA 1ZCOA 2NPXA 3LEPA 1XLAA 4BJHA 2VRQA 3N73A 2HJPA 3PZUA 3DAQA 4KETA 3WQPA 3VKBA 3ZWTA 4US6A 2YIHA 4S38A 2QR6A 3NZQA 2D3NA 2O55A 4FNPA 1R0MA 1V3IA 2XH7A 1V03A 3TJ4A 3QMTA 1A5OC 1UP2A 3O0KA 2F7FA 2PLMA 2A3BA 5G2HA 3W76A 1TE6A 2RJGA 2BOFX 4ZXOA 1MWOA 3GW3A 1KXQA 1JCLA 1SMDA 3BMVA 2JGYA 2QDDA 4NVTA 3WNMA 3P8IA 3LHTA 2R14A 4UQ9A 1JRPA 3U4FA 3A13A 4WEVX 4CD7A 3DX5A 4DWSB 1OJTA 3STPA 3VIFA 2NSOA 5LHFA 2YZRA 2ZZ4A 1YKWA 3LK6A 3GD3A 2VGGA 3O16A 2J25A 1MQRA 4UWMA 2PDXA 4NNAA 3SM0A 3UEQA 2HNHA 2GVYA 2XVKA 1C8QA 4YJ5A 3M6YA 2D22A 3UGRA 2VELA 4H6EA 2W54A 1XYFA 3K30A 3UZYA 1VZWA 3WELA 3E74A 3SRHA 3H24A 3QLLA 2OU4A 1XPYA 3B0YA 2VO5A 3O6DA 1XF0A 4PL2A 3LUTA 1TG7A 3JVAA 3HBLA 4AW7A 4HYWA 1GEUA 1FWTA 4GIEA 5F7UA 3GXFA 3FS2A 1BKHA 1ISZA 4FOKA 1G4EA 1XLIA 4DI9A 1UC4A 5AHLA 4AZCB 4HZMA 1AJZA 1TV2A 1JUKA 2X09A 4URIA 1US3A 2P10A 3L4UA 3NYZA 3TZNA 1EEXA 4K7YA 2OLSA 3OQ8A 1KCXA 1HL8A 3BCFA 3UXDA 1N7KA 2QUMA 2KX9A 3MS8A 3NURA 3NFUA 1R46A 2DY3A 4U3CA 4X63A 2CIPA 2DZXA 1KXTA 2OEJA 1G0CA 6REQA 3I7SA 1X96A 4WDTA 1EFZA 5HQLA 1SW0A 3WFLA 2ZUUA 2NUYA 2FZ9A 4DN1A 2XIQA 3S8HA 4EWJA 4GQ0A 1OGSA 3DYPA 1EZWA 3AMLA 5IXEA 1ZBWA 3BQ6A 1IZKA 1D8CA 4UZUA 3B8DA 2A8XA 4YTUA 1VCVA 4ACZB 4G56A 3LENA 1B3VA 3VZYA 2WNZA 3TWBA 4ZEPA 4LV4A 2O0TA 2DZSA 2OLHA 2PDHA 1M7PA 2PC8A 1YE6A 4RZ4A 1EOKA 4W9TA 3V0TA 3D3FA 4M82A 3U2ZA 1A5UA 1T7LA 1PDYA 1LUCA 2AKZA 4K8EA 1KFWA 2LLEA 1M9HA 3VKDA 5DCBA 3CTTA 4YVVA 4GX9A 2BOGX 2HCVA 3BARA 2Z6IA 2I17A 3LQGA 3GH7A 4MNMA 1E1CA 1FCVA 3ZSTA 1C3FA 1QRQA 3GTFA 2QCEA 3UF9A 4GA8A 3T8QA 2NZLA 3UPMA 2OZ8A 4KH2A 4JEQA 2Z29A 1Q5MA 2F84A 2EG6A 1FWWA 3V4BA 3EKLA 3HU7A 1ESWA 5FL0A 3WLLA 1FH7A 4AVNA 9RUBA 4F0KA 3LHZA 4HHMA 4H19A 1PYMA 2JFEX 3IEBA 3L5LA 1K4HA 4FI4A 1XLJA 2DP3A 2G4JA 1WA3A 4LUTB 3WQ4A 4RNFA 2Q8XA 3KDNA 3EA2A 4M7SA 2CCRA 2WOWA 1KD0A 3B03A 5CPOA 3EUB3 3VPLA 3BTNA 4KEMA 1LOSA 1A0CA 1DIDA 3W1QA 4M8UA 2PA6A 1DXEA 2J7EA 5F2LA 2AKMA 3H2CA 1ONRA 3EX1A 1NHQA 4CNTA 1OC6A 1JFHA 3GK0A 3OTRA 1HKJA 2R6OA 2HVOA 1TWZA 5E6YA 4O1EA 1J11A 4R53A 4FZIA 3IK2A 2QVHA 1EP2A 3UR8A 1F2JA 3APGA 3HPXA 1CGYA 1KXVA 3EXSA 1I2NA 5CPQA 4C5ZA 2WWDA 1BQCA 4J27A 1TX0A 2F5ZA 3QV9A 4AXNA 3AXMA 1IZJA 3EPNA 3GTIA 2CLEA 3E9AA 4REQB 2DSKA 3B8IA 4XO6A 3WL1A 5DEZA 2R94A 5FS8A 4PMDA 1W3IA 1CZ1A 1P0KA 3FDGA 4Q4RA 4L80A 4CD4A 1DXIA 4I9JA 4FK9A 1NF0A 1QNQA 2ZX8A 3L4TA 1GRFA 1JULA 1ZMCA 1DKWA 2PZ0A 3DK4A 2ZRXA 5FD0A 3ARXA 4WCJA 5DT7A 3SRKA 2ZFAA 2X50A 3SCTA 2D20A 5CXPA 3LHVA 2F2HA 4NIRA 3TN5A 3S1XA 1WXJA 3QPYA 1IIGA 3R7MA 3AROA 3USBA 3EYPA 1RM6B 3VA8A 5CSUA 4TVCA 2ZDRA 3QC0A 1H62A 1AQMA 1YBQA 5M3WA 4BCEA 3GX9A 2X05A 4LH8A 4UTJA 3POCA 3U9IA 2QYGA 3ZSSA 3BSGA 4FX7A 1JQVA 4LCSA 4KFPA 1V51A 5IDIA 3PPCA 4PUWA 1VJSA 3FAWA 3NL3A 4AYGA 3GDTA 1DWGM 1UD5A 3BLPX 1H49A 1ZUAX 5C0QA 2D1ZA 2FH6A 3KL0A 4H9VA 1H1YA 3WQFA 2A1YA 3T81A 1OJXA 1Z41A 3M0MA 3WX7A 3HURA 4DO6A 4ATDA 1AQHA 3GXDA 2XUCA 5EL1A 2Z6JA 3L67A 3UXAA 3COTA 3EF6A 4Y9OA 4GABA 5ABFB 4H01A 3W2LA 3B0PA 4O12A 3N13A 3TJIA 1VEOA 3BJTA 5HATA 4HCLA 1VEPA 3R6IA 4F2BA 3RJXA 1HIZA 4C1KA 1MMFA 1K8XA 4JQ3A 2FGZA 3S2CA 3W1TA 1F3WA 6PTDA 3CZLA 4YMZA 4EPKA 1UD2A 1OGBA 1PIFA 2FH8A 4EF9A 2V3GA 1H5YA 2YKKA 2E67A 1G4TA 1LRTA 1JL8A 1C90A 3C8FA 2R91A 2VWTA 2WZHA 4HA0A 5E6ZA 2WPCA 3W7NA 3VOGA 4Z2KA 5MKGB 1AW1A 2WVUA 3UJ2A 1WPCA 1U5JA 2Z7KA 3QZAA 4H7VA 4MNJA 3N19B 2NT1A 4JYFA 1S2CA 3NVWB 1EA0A 1K7FA 1W8GA 3QTPA 3M0KA 4ORIA 3IJDA 4HIBA 1HO1A 5IFPA 2TPRA 4HKPA 4PYSA 4AZIA 1XDIA 1V02A 3CJPA 3MSGA 1W6TA 4U28A 2Q01A 4TOQA 3UZJA 1QCWA 4R3UA 1CECA 4PMRA 2WHJA 2XFRA 4IL0A 5AHEA 1JDFA 3SSJA 1LWIA 3WK0A 1PZ0A 1QPNA 1X8CA 1GOIA 4K1GA 1ITXA 3DIPA 3PY2A 3VD7A 1PKMA 4GE8A 2XSAA 2VZOA 3KZSA 1BXCA 3FK4A 4X2PA 4IIEA 2XVNA 2XHYA 3BLEA 3SCQA 1WOAA 2G3NA 4NI3A 1I2PA 3RM8A 2WSKA 2GGEA 1VPYA 3DDMA 3LADA 2PDMA 4V33A 1AFSA 6A3HA 4IIDA 3P0XA 2W79A 2QCHA 4EM4A 4AWSA 1V08A 6XIMA 5TR3A 3ORWA 5LIYX 4LV9A 2GVEA 4AHPA 4C6EA 1OYBA 4MWAC 1GETA 3HN3A 2DV0A 1JEHA 2OR2A 1Q7ZA 3AYSA 3S42A 2QHAA 3LXCA 5FL1A 4H8NA 3EOEA 2PWUA 4KCUA 4Z2HA 4WLCA 4Y8EA 3W2MA 3ZFHA 4UNIA 2VX4A 2VUYA 4NXSA 1XIMA 3BSMA 2Z1VA 4R88A 3M47A 3UR2A 2DFAA 5FJOA 3TVAA 5RUBA 4C5YA 4E4FA 4FXSA 1UKSA 4LVFA 2GSEA 5FJJA 1XSJA 5LIXX 3LV5A 2BGSA 4H4VA 3F5LA 3P93A 3CUHA 3MW7A 3ITGA 4DI8A 5CPNA 1LL7A 5F1VA 3I68A 3N6JA 4PUDA 4FNSA 3AAMA 5A8MA 3LHWA 4C90A 4JTLA 1VFLA 2O7QA 1ICQA 4DJEA 5T9BG 3H2OA 3R07C 4L1GA 3ARWA 1Y0EA 3EWWA 4RDVA 1EC8A 3H22A 5FA5A 5EY5A 4H6KA 1LRQA 1CNVA 2RDWA 2WSQA 5HJLA 3S5YA 5BXTA 1KCKA 1XH1A 4IXHA 2X1SA 4UR8A 4EXAA 4RDZA 1XLBA 1U1JA 3U48A 4W85A 1VFTA 5H8MA 3G0XA 1FDJA 4XZLX 3FHQA 3SCUA 3HO8A 3N12A 1LG1A 1CGTA 4ATWA 2UZ9A 2I7GA 1R3YA 2PBGA 1PUDA 1W9VA 3N34A 3RM4A 3G2GA 5BWFA 1JAEA 1A3HA 2BFGA 3OHMB 4RLIA 2CLFA 4IGMA 4Z1CA 3LBMA 4D8LA 3NQFA 3BICA 3QKEA 3W25A 5E0KA 4OIFA 4Z2JA 2ISVA 3CS2A 3VGDA 3WG6A 3SJNA 1JF5A 3CT7A 1UCWA 2ZVRA 5AHNA 5D2TA 1XLMA 2Y24A 2J62A 3GNNA 1GVFA 4AZ7A 3APTA 1E0UA 2W6RA 2O9TA 2VZSA 3NQCA 4I5UA 1UJPA 3PZMA 3WBYA 3NPUA 4JTQA 4QSHA 3KLKA 2ZX6A 1OIFA 4WIWA 2TODA 4Y9NA 2FJKA 1UZHA 2VNCA 1QI2A 5JIPA 4N4PA 4CUCA 4KRZA 3WL0A 3OJGA 2JALA 2YBUA 3OVPA 3UVAA 3TW9A 2YFNA 3TSBA 3AIQA 3G1SA 2DZBA 3AS1A 1J0ZA 3SAZA 3W74A 3W7OA 5HOSA 3R58A 2XH0A 4I9MA 1E55A 2DVTA 3BLFA 2WM1A 4C6IA 3H6OA 4AY8A 3GR8A 4MWAB 3S5NA 4A3UA 1TIWA 1DYSA 1JNEA 1I1XA 3UETA 3SI9A 3JRKA 2C1IA 5LA1A 2P8BA 3MBDA 4WKHA 1EJ7L 5AYBA 2OWWA 2IUZA 4NZCA 1PZ2A 3J7HA 4AXKA 3CTLA 4ONVA 2H9AA 4AEEA 2E40A 3ANYA 4B3LA 3M0VA 2JBMA 4AD0A 1IR2A 5BMWA 4IPIA 2V82A 4O14A 4PODA 1H61A 1QPOA 4LY4A 4D1JA 2QF8A 3W29A 1TO3A 4CEUC 3W23A 3AOFA 2PB1A 3CMGA 2ZUSA 4O10A 3ECQA 3VVGA 3DUGA 4PMXA 1O4UA 2BV9A 2INFA 1PTGA 3VOJA 4QJ4B 3MWAA 3MMUA 2CBVA 3P5ZA 5DY3A 1CT5A 2CESA 2FVMA 3SUUA 2E6FA 2HXUA 5JH2A 4KT2A 2F8QA 1MRAA 4KGLA 2XVPA 3KBNA 1S5VA 1SJAA 3LCFA 4TX9A 2YAUA 4IX0A 4ROPA 4F0MA 5JH1A 4LF1A 2XG9A 3EWDA 4QS5A 3S2NA 5KITA 3ZWSA 2P3EA 4FX9A 4FPSA 1KQYA 1EUNA 4S2CA 1BFNA 3DZ1A 3OBEA 4H9ZA 4PUKA 4NHVA 2BC1A 4QG9A 3KCOA 2WKGA 5E70A 2W3RA 4ZODA 1P7TB 1TVLA 1M7OA 1YW1A 5FMHA 2D2OA 2DZWA 3H8AA 3HPSA 4P2VA 5M1TA 2RUSA 4NL1A 1N55A 4PULA 4WRHA 3UFYA 3QY7A 4M24A 2PWVA 1UPPA 5G5GB 1MXSA 4HMNA 4EPBC 3UWWA 3B05A 3GE7A 3UJFA 4JTSA 4AH7A 3HG3A 2CITA 3WCZA 1NY1A 5D32A 4PCTA 5A6BD 2DJXA 1YYAA 1QHPA 3W7KA 3W73A 1K8ZA 2WQDA 3O15A 2PF8A 3VMOA 1RY0A 3GH5A 1CLKA 5A3HA 4ZOEA 4NXKA 3IAQA 1VQTA 2OO0A 2EXOA 4Y90A 1J5TA 1OZMA 3CZ8A 1XIGA 5LXEA 4ZQPA 1L0PA 5DANA 1YIXA 3TN4A 1KRAC 4IFRA 1QDSA 1W9XA 4J9JA 4JHMA 2WCSA 4UTLA 1E6NA 5DQPA 5DO8A 1EHAA 3GC5A 3T2QA 3VE7A 2FB3A 1GUVA 3L9CA 5HINA 2WCGA 1TCMA 2DH2A 5EBUA 3BXWA 3CV6A 4GUGA 1XH2A 4U2YA 3BGGA 3EPOA 4CD6A 1FWIC 2XN1A 3W7LA 3LPFA 1R3SA 2QDGA 2HE8A 4GRTA 3QOKA 4AY7A 1AL7A 3QGVA 3FKKA 5XIAA 2C1HA 5FJPA 1KGXA 3NQMA 1RHCA 3A9IA 3PSWA 4HK5A 4H4TA 1BSLA 1OK6A 1RBLA 1PIIA 1YADA 1VP5A 5AFDA 1E6QM 1U2YA 3ABQA 1PBGA 3QV6A 3AMCA 4K38A 2OODA 2QAPA 3WDQA 1KR1A 4UOQA 1AG1O 3VKCA 4DWSA 1PB0A 3W81A 1QFEA 1RPXA 5JQ9A 1GNXA 4FLOA 2FPTA 1KBKA 1KLYA 2JIWA 2QDEA 4OJYA 4DJDD 3M0YA 3PNZA 3E0VA 1HFBA 4M52A 4X60A 1YLVA 2YQUA 5HMDA 1FOBA 3NXFA 2CXGA 1VBRA 2Z26A 1M7JA 1KCZA 3ZQ9A 2DUXA 4U5KA 4EXBA 4X0NA 1XLFA 1ZAIA 3A4AA 2GGGA 5GRTA 2ISSA 3GO2A 3K5XA 1S2TA 5JCNA 3STGA 1O5KA 2BGQA 4EMIA 2RGMA 4ZGYA 1FDYA 4B91A 4AZCA 5C9RA 4H1ZA 5A8QA 2X41A 2WK2A 3MV01 4F40A 1EJSC 4HPHA 1HZYA 3GU2A 5EMYA 1AJ0A 4Q4KA 1BVWA 1REQB 3UESA 3QN3A 1L8NA 1XG4A 3EMCA 1XSKA 3H26A 1MNSA 3CC1A 1IEIA 4OUEA 4LALA 1CDGA 5BRBA 2BMBA 4K2SA 2IKIA 1XBXA 4NZFA 4XZ9A 2WLZA 3L0NA 3PZVA 4HPNA 4WDWA 1MW2A 5HXMA 2GDVA 2YCLB 4E3VA 3B8UA 4LT9A 3MWCA 2VEKA 2WANA 2QIWA 4XZHA 2X7VA 3DYOA 4GVHA 2ISFA 5CG7A 5D05A 2JF6A 2ON3A 3B8TA 2Z1XA 3AIEA 1QOPA 4TMBA 1HKIA 1RZMA 5D9MA 4AHQA 3PWIA 5GNZA 5HPCA 1GOQA 4ACZA 2X0HA 2YZ5A 2OT1A 2JKEA 1X1OA 1ZJHA 3OLDA 1ALDA 3CT2A 2NX3A 2E7FA 1GKPA 1R38A 1FFVC 4HNOA 1LF1A 4RJEA 2PP3A 5XINA 3CBWA 2ZDSA 3QLDA 5DBUA 1VD6A 1C8VA 1TA3B 1D2KA 1Q13A 4JIRA 1NSJA 2FQIA 5I23A 4YS1A 3THAA 3W1XA 3OC4A 2OLAA 4XQ6A 1PKLA 1UR3M 3TW6A 3W6MA 2NQ5A 1ZDLA 4JTKA 1KFLA 2NQLA 1HJXA 4RE2A 5M2FX 1EZ2A 4O8RA 4NUWA 3T0DA 1D7YA 4HYVA 1DQXA 1LROA 4BI5A 4ZVJA 4XD4A 5D9PA 5JUVA 2GJXB 1A4MA 2PDFA 1GOOA 1IV8A 5FF7A 4ZBCA 3IACA 1AH3A 1I9CB 2ZUNA 1W3JA 1JVNA 3JUGA 2GVLA 1O94A 4PCSA 1XP3A 3BOLA 4JY9A 3BWWA 1UH3A 1GV4A 2ZWYA 2V6OA 5HUOA 4H50A 4FHAA 1OFQA 3S47A 4LUTA 4BR1A 2HS8A 4S23A 3SCPA 3WLOA 5EBKA 5A6BA 2GFTA 2WOVA 4C6NA 3IIPA 1AD1A 3FCPA 1XYBA 4L64A 1IE7C 4DO5A 4GX8A 1HP4A 1RJPA 1J93A 4OT7A 3NIYA 3B97A 3NSNA 3KZPA 3MP5A 5C9UA 1GZJA 4JTAA 1GRTA 4OUIA 3P82A 1H3GA 2FJUB 4LY8A 4DM2A 3V1HA 2FDMA 3N18A 5CC5A 4PTWA 3V18A 3EZ4A 3WJSA 3CYVA 4H7CA 3HJZA 3S1UA 2YBVA 2QPXA 4P8UA 1VCGA 4AD5A 3IC9A 3EWZA 4QHRA 1VRXA 2VDHA 1LWJA 3P14A 4LYPA 1EIXA 4XV0A 2FB2A 3PZ9A 3FN9A 3LGDA 1UUQA 1KFKA 1IF2A 1OVDA 1MDRA 3IAPA 1TJRA 1M3UA 4MIMA 2A3CA 2XIIA 2C3ZA 4WDXA 2QS8A 4REQA 2QZRA 4LRSA 4H6RA 3NEVA 2B7PA 2CLMA 1VQZA 1TRIA 1S39A 4G7EB 3MYPA 1ZX9A 2GOUA 5BOEA 4PMOA 3VDAA 2BY2A 1GW9A 1CCWB 3AU2A 5DFAA 3RCNA 1GERA 2QUTA 2CWNA 3WO8A 3MO4A 2D0FA 3AIVA 1BD0A 3H12A 5B7YA 1O68A 2QPUA 2DJLA 3C52A 3G1HA 5HJYA 4R27A 4PEKA 5MHBA 3O63A 3W83A 4C6JA 2J9YA 1XV8A 4C7DA 3AHZA 3GVRA 1F8IA 3CQIA 3HQNA 2ZRYA 4HYRA 1PTAA 3GS6A 3ZVHB 1O6IA 1LLWA 2BP1A 4RUBA 4I6VA 3I3BA 4MY1A 1Q6CA 3B9JB 3RPMA 3S1GA 1OINA 1OHLA 2CZFA 3RU8X 3WDPP 1LYXA 5I3DA 3WH7A 1B3XA 1Y8BA 2EBNA 1A50A 3BJFA 2P3ZA 3S1WA 2F9RA 5CSSA 3FX4A 2ZUWA 5A95A 3GZ3A 1XJBA 1XLHA 1LDCA 4YWIA 4NNCA 2ZXQA 1FP9A 2Q3RA 1H1ZA 3BOXA 2X99A 3VNMA 3PUGA 3GD6A 3AHXA 3LD5A 3AWNA 4F0SA 1NWSA 1ZL1A 2J6VA 2WKLA 3GFXA 2HK1A 4UTWA 4HN4A 3CIXA 5C55A 2W67A 4FXJA 2UY4A 4LUSB 3S5ZA 3Q37A 4W7UA 3BMXA 4I5RA 5ABFA 2PU1A 2BHUA 1W0MA 5E0CA 3NCOA 3R94A 4WX2A 1J01A 4XD6A 5F2IA 3DGRA 1GQJA 3KVJA 4P7LA 2BY1A 3ITTA 4JNZA 1V7YA 1WDDA 3AMZA 3APYA 2QJMA 2I14A 4ZMGA 1NFPA 2DH3A 3OPSA 3O6YX 1PKNA 2FPYA 1FKXA 3VDHA 2Z25A 1J8VA 2HE5A 2X0SA 1IGWA 2BBFA 3URQA 2I57A 2WZTA 3EA3A 1XBZA 2E5CA 2GYIA 4LYQA 1XUUA 3TSDA 5MKGA 4J4KA 4GGHA 3WBAA 4EF8A 2OO6A 1UR1A 3PSVA 1UH2A 3TOYA 1D3GA 1A0EA 5GPRA 5ECVA 2XFWA 3CAWA 4UTTC 3WN6A 4ORMA 1Q6DA 5KZEA 1GEHA 4GZ7A 2V2HA 2DT1A 4NJIA 4O0QA 2YFOA 4N6FA 1SFJA 1AQFA 2XIMA 4RL3A 2G96A 4IIFA 2VFDA 3GTXA 3GDLA 3BAJA 3BCJA 1JNDA 3PJWA 1KM0A 3TEVA 4GXPA 3CO4A 2NQJA 4G5DA 1BGGA 4GJ1A 4O19A 3CUIA 2PTZA 1F3TA 1MO9A 1R47A 2CBUA 4B5TA 3QV8A 4I6KA 3HGRA 3IJQA 1BEUA 3PN8A 2J77A 2Q3OA 3I4KA 1MOKA 4EQRA 4BZYA 4KBXA 3N2MA 3T09A 3B0XA 1FUYA 1W5OA 2Y7DA 3D46A 4DBWA 4HNVA 3BGAA 5ECUA 2G3IA 1VPXA 4Q8WA 5DRCA 2A85A 2XDFA 4J3XA 3B0UX 4DAFA 1V0MA 3HOJA 1FVPA 1H1NA 4Q4OA 4TQTA 2FVKA 4GI9A 1I2RA 3G77A 3G1YA 3BLLA 3KTXA 3AIBA 1KGWA 3FEMA 4P5UA 4MSSA 5XIMA 1ZP4A 5G4EA 3W1MA 3N4EA 3CPUA 3GIPA 4OWGA 3PTQA 3PUEA 1MW1A 4LVDA 5FSDC 4MPKA 1XIFA 4DJFC 4AIUA 5E09A 1DWHM 3C3UA 4GCXA 1A3WA 4MYAA 1AODA 1MRQA 4DBUA 1T5AA 1QI4A 1HW6A 3F4DA 1E40A 3NVYB 1QNPA 4GWEA 4YYFA 3KLJA 1X2GA 1N60C 5LA0A 3N6HA 2HZGA 2IS7A 3NVTA 1MQQA 2W62A 4KCTA 1UPMB 1BG4A 1YE4A 4UR7A 1H7RA 4DRSA 3V0SA 5E9AA 1ECQA 3QGKC 3NGJA 4BWLC 2PFHA 2ZA3A 1WUFA 3QR1A 4M1BA 4BK9A 1TYGA 4B5XA 4HP5A 2BZNA 4FMVA 4WF7A 1GOXA 1WE5A 3SCWA 1OC7A 3PK7A 3R11A 4AMAA 1BVNP 2V67A 3EMQA 3OA3A 1U1HA 3S1VA 3CMJA 2GVJA 3GG1A 3Q6JA 4AMCA 3OU8A 2WBKA 1HJWA 1Q6GA 5I09A 3KBSA 3IWPA 1BG9A 3D3AA 2RHGA 1QPKA 1Z32X 2BLEA 1VJZA 2NXHA 3HQOA 1JRBA 2J13A 4M1RA 1ZBKA 2AAAA 4ML4A 5FCZA 4K6AA 4ZQCA 4JS3A 1UA7A 5D03A 6ENLA 1W1ZA 1TZ9A 4IMGA 2NWSA 4WJXA 2PDUA 2QV5A 3UWEA 4JTEA 3NQEA 4FNQA 1FHUA 2J7BA 5F2GA 1CXIA 3L4YA 3BW2A 4KW2A 1ZSXA 2XJ7A 4N0RA 1R3RA 4LVAA 3TJLA 1ZFJA 1W5MA 2PTDA 1TJ2A 2ESCA 3QH2A 2EPNA 1NDVA 3I6EA 5I07A 3WH8A 1YRRA 3TAOA 4XBJA 4X61A 1H7WA 4QE4A 3TK7A 2ZRWA 3MP4A 4GBUA 4QXIA 1EGZA 2FMNA 1EH9A 1OFPA 3EDEA 4NZ5A 1Y5WA 1F6YA 1CBGA 2VZUA 1SO6A 4H9XA 2ZRVA 1XFBA 5FAJA 5HWJA 3WJWA 3I3DA 1N8FA 3U2OA 2GQWA 2ZXBA 3CPGA 1TREA 2HEJA 1UWSA 2BGNE 4C65A 3AZRA 1T99A 4PRWA 4V27A 2NXGA 3TA9A 4EQSA 4R85A 4YLWA 2POTA 1VAHA 5HA7A 3QKZA 1B3YA 4UTIA 4XBKA 2PD5A 5HNRA 5LKYA 1LPFA 3HMJG 1U22A 3CH9A 5K4ZA 3ISIX 3VTRA 3UR7A 2OZ0A 2Q6ZA 1GVEA 4L4LA 1K9EA 4GBDA 3N11A 3ZJ8A 2E3ZA 2CFYA 2J6XA 1U1UA 3WH5A 2PD9A 1S38A 4IMFA 4A3YA 4UTUA 1UR0A 1SZFA 3SZ8A 1WXYA 4I8YA 2ZZ3A 5F2MA 3V75A 3K46A 3EEGA 4IP5A 2J74A 4LAUA 3T0TA 1TPUA 3GNPA 2E4TA 2VEFA 1E9YB 4IUGA 5AKQA 3WQ6A 4V2XA 3W2NA 3QJAA 3W26A 4UC5A 4S3KA 5I02A 1EYEA 4D2JA 2DSZA 4XD5A 2VJXA 4JY8A 1Y5VA 4TX6A 4GYPA 5CGTA 3WQDA 4Q4QA 2Y5SA 1D3HA 2QUNA 1DVJA 4IJCA 1B3ZA 1TJPA 4IM4A 4LNYA 3C0JA 3H23A 2CU0A 2WJFA 1ZRQA 5I5RA 2QW5A 1I6NA 4GQRA 5BU9A 1ZQ5A 3S9IA 2FZNA 1MYRA 3EOLA 1D3CA 3C2EA 2A3AA 3NM3A 3VABA 2WC7A 3ITXA 3OOQA 4K39A 5A2BA 1PHQA 3KDOA 1W56A 5A6AA 3TYDA 1NDAA 3I6TA 4PUMA 4C7FA 3ZT6A 4PFMA 1H0GA 4GYJA 3FIGA 2YA1A 3E0IA 1Z3NA 2FLIA 2GSHA 2I9EA 3CUZA 4UIOA 1XGDA 2ABAA 3DHPA 3NDZA 4N6EA 1P7TA 2EF9A 4PBEA 3CZGA 3KBJA 2YCKX 1A49A 4JX5A 3G24A 2YL9A 3R12A 4IXXA 3R10A 1O7AA 1NU5A 2BX7A 3EDDA 5KTLA 2E5AA 2DU2A 1L6WA 3LCGA 3V36A 3ONCA 4XBSA 3IGHX 4HSHA 2WHMA 2O4MA 1FECA 1TV8A 4D1IA 2DUAA 1DJWA 4XK2A 2WBGA 3WQOA 1QOXA 1W1TA 3B8WA 2PLJA 1GG1A 4NZJA 3CAQA 3LHYA 1J2BA 4A3RA 5BXPA 1XLEA 1UP0A 1U33A 1UC5A 5CBJA 2V69A 2GJNA 3CYJA 4UMBA 3SADA 2Y6ZA 1FWRA 3SY1A 2F2KA 4KWUA 4A3HA 4GD0A 3K13A 2WZMA 4JN7A 4ERAA 3OYXA 4GI8A 2C19A 4HOXA 4V15A 3C0LA 1PHWA 2VVSA 3ARSA 3BZJA 3IJLA 2QJNA 3RK8A 3TXVA 1E4LA 4H8VA 1XC4A 3AMDA 4MWAE 3W7RA 3MMTA 3ES7A 3MUZ1 5KSWA 3KHJA 2FTWA 4MUPA 2O7SA 5AC8A 3OVRA 3V5CA 2HWGA 2DSUA 2VC7A 4JIHA 3CK5A 3VOFA 1TMLA 3O3RA 4Q7NA 5A8NA 2UWFA 4KEVA 1R9XA 3NOYA 1FDZA 4V1YA 3P61A 1JI1A 1W1A1 4RW3A 4ECLA 5BRPA 1XYLA 4P7QA 1K8YA 2Y7EA 5CPSA 3L2IA 1RAKA 3M4HA 2CBIA 4BI6A 1MDLA 1OQFA 3QY8A 3NVDA 1SO3A 3AM9A 4H8UA 4CN6A 4MADA 2E3TA 3P2VA 1V3LA 4GVIA 1SW7A 1OCQA 1GRBA 4GKTA 5PTDA 3NL6A 2BVWA 1K9FA 1FHDA 1BSIA 3AFBA 3PULA 2F6UA 2FYMA 4HSNA 4I90A 2HNEA 4FLRA 2D24A 2R1LA 1GVQA 4JTDA 2YVGA 4AC7C 4PUJA 2DEPA 3NZPA 2X8GA 1ZJBA 3WK1A 4M29A 2E9MA 1US2A 2W92A 5CZ0A 1EDQA 3G1VA 1XM3A 2R1PA 1IEVA 4Y8FA 3U0HA 4A3QA 1PWMA 4ZFMA 3F4WA 3SCNA 3FKRA 5U7SA 2B7QA 3MA8A 3WH6A 3NM1A 3TCSA 4QJ5B 5HAOA 3T7VA 1REQA 2VGBA 3IIVA 1M5WA 3CEUA 2YB1A 3GB6A 1S46A 2B7NA 2J78A 1LLOA 4XIAA 2OGJA 4IP7A 3MBFA 3W7MA 3POHA 3CXBA 2QAFA 5HJXA 3VKKA 2V3FA 3N4AA 1LBLA 4D6JA 3M1ZA 4PMUA 1J0YA 1E0WA 1RUSA 2AMXA 1KBBA 2YCLA 1ME8A 4Q4SA 1L6YA 4FNTA 2UV8G 3NQ8A 2BS9A 3PZGA 3OIXA 1EQCA 3SR6B 3OG3A 3IJ7A 4R7JA 3AYRA 2Y88A 4BHYA 3TJXA 3DFSA 2P53A 1BKSA 5AZ0A 1FRBA 4Q8TA 3CAKA 4XTDA 3R8HA 4ALDA 4OGZA 2Z24A 3HJEA 3OEXA 2G8ZA 5DELA 1FXPA 4WGHA 4IWWA 4OQVA 1VFMA 2H90A 4PR4A 1AH0A 4EKJA 1TA3A 2Y89A 4KPLA 3LCWA 3G3DA 1QJWA 2CXEA 5I3JA 1GWJA 4A22A 4P61A 2EPMX 1CXKA 3W71A 1M7XA 3IRSA 3GG8A 1J10A 3LERA 5LYRA 3UVIA 3KRUA 1RK6A 3RLHA 3RCYA 4A05A 1UWIA 2VZTA 1WUEA 3E5PA 1OB0A 1LJYA 5AHIA 3CM4A 3WQWA 2GJXA 1JZ2A 3H7VA 3WEOA 2ZZ1A 2J8GA 1UWQA 7PTDA 1EDGA 3NUKA 1GKQA 1WB0A 1FEAA 1GVRA 1P6CA 3UXIA 4C1LA 4J1OA 4YCPA 4XKYB 3CASA 1MI3A 3VZXA 3W4RA 1QU4A 4OTKA 4J3ZA 1TJ1A 3ZJ7A 3P81A 1OWQA 3AI0A 2FGLA 1K7EA 3BAIA 2P5NA 2HDJA 3VAVA 3RF9A 4QDWA 3WLSA 3T4WA 2H8XA 4AX7A 4LWWA 5AHFA 1DQUA 4LXFA 3LOTA 4RPPA 1EX5A 3F4VA 3LS9A 1KV8A 1JDCA 2J27A 2J7HA 2OELA 3CUXA 3TLLA 2GGIA 2YYUA 4Q4PA 4A21A 2J7FA 1A5NC 3AQUA 4NNBA 2Y85A 1J96A 1W3LA 2WVTA 1M01A 1RCXB 2L5HA 3WFZA 1F8WA 2OB3A 2REQB 2QT3A 4GJIA 2WLYA 3T0BA 3WENA 3H21A 5TBOA 1JCXA 4H9MA 5C2XA 4BFAA 1O1ZA 3M07A 5ER0A 1CI1A 5LNVA 3RMEA 5A69A 1PV8A 3S0CA 4MM1A 4LSBA 2CETA 3G0UA 1WX0A 3L68A 1DWFM 1C9DA 1XX1A 4QRNA 3PG6A 4DNMA 3UCQA 4G7EA 3NZ1A 3LRKA 2PGEA 3WLHA 2C91A 3WMLA 4UXDA 1FY6A 2HXTA 3STEA 5LHEA 1EWEA 2KZHA 2FFCA 4YVPA 3TX9A 4QAIA 1RQHA 4F9JA 3BAYA 3F1QA 7REQB 1XYZA 1CYGA 2O9OA 2TPSA 3S9ZA 4XSLA 4OOUA 1HL9A 1XD1A 2DPEA 2VM8A 2WWCA 3PFRA 3WF2A 4AG0A 2Z1KA 3UPWA 4S3CA 4GPNA 1GOKA 4MNLA 4WD0A 1BQGA 1TV4A 3M0HA 1FWHC 3HPZA 4LYKA 2PDKA 4JNMA 1J12A 5EBAA 3TKFA 3BG5A 4YHEA 3RGTA 4MDPA 1ZY8A 3ZVHA 5FJRA 4GUHA 4MB4A 1Q6OA 4JIPA 4YCOA 3Q45A 5H6HA 3O8AA 1Q3NA 2CPUA 3O07A 3QHNA 4FNRA 3MUIA 1EPVA 4H4SA 2R9RA 4QROA 3VDBA 3OGVA 5DBTA 4GH1A 1PDZA 3CHFA 2E1WA 1Q2RA 1NTHA 2E8YA 5D4YA 1XW8A 1OK4A 3R8GA 1HTIA 2B4GA 3AUJA 4LW7A 5EMKA 2EQ6A 4EMWA 4WXYA 5EKYA 1TSIA 1WCGA 3LXBA 4HU8A 1XICA 5BMXA 1EBHA 2CYGA 4Y9MA 2PP1A 3CL6A 3V16A 3MB9A 1EO7A 1C9WA 3HG2A 2HVNA 4S3JA 1C8YA 3H2AA 3GU9A 1H11A 1U83A 1VYPX 1R5YA 5CPLA 3MI2A 1RV8A 4CD8A 3DFTA 4LUSA 3M43A 1JPKA 1UG6A 3GXMA 5FEPA 3HG4A 1RK5A 3R8RA 2R1NA 5I00A 1T6MA 3A7UA 1E6SM 2QMJA 2WB5A 3F03K 3W86A 2CFFA 4F9DA 4H9UA 4H4UA 4OOZA 4W8AA 3GXIA 5FS9A 5K7JA 5C5YA 1DJQA 8CGTA 4BF9A 1W9BM 2OOFA 3WNLA 3NQBA 1SPQA 2NX9A 3C2FA 4N7QA 5MF5A 4E2OA 3U5YA 5G1TA 4DWDA 4G9PA 3WLJA 3A64A 4IHCA 3JU2A 3KXQA 5D2WA 1DTUA 4N4QA 1AMYA 4C6LA 2EKGA 3MCNA 3PTKA 4WOQA 5LSMA 5BYWA 1B30A 3HA1A 4RZBA 2PEVA 3VOCA 2WPEA 3LCXA 3T07A 4JN8A 3Q67A 1O95A 3ITCA 1XS2A 4XVEA 3UR5A 3B9AA 4HGXA 2XPKA 1SQ7A 1ZBVA 1SO5A 4Y7EA 1V79A 1DE5A 3B0VC 2WOIA 1A5CA 4J2MA 5EFFA 3CHEA 4ADUA 3LSBA 3GYEA 4BF7A 4YTTA 5CAKA 1OX5A 1UMLA 4TV6A 4LCRA 1DWAM 1C93A 3BLOA 1HQTA 4GYFA 4RDYA 1YX1A 2CHOA 2RH9A 3FJ6A 3QTGA 4PTXA 4A8IA 3A23A 3G1AA 1WZAA 1JIBA 1ZJIA 4WK9A 1YQ2A 1E6PA 1G94A 1V3JA 3CQJA 1P5BA 1Q6QA 4L4OA 1TVNA 4V1XA 2PE4A 1P0DA 3W1UA 2HQMA 5D9NA 3H4XA 3PTMA 3B4YA 3SRFA 2EHHA 1NHRA 2WVSA 4WHBA 4A8RA 4E4UA 4FLSA 1GSNA 2O9PA 3D6NA 3SQPA 1NAL1 4WY0B 4O13A 2IPJA 5E9XA 5D33A 1CGUA 4JKKA 3QGAC 4DLMA 4G8TA 1W5NA 2D23A 3G8RA 1R30A 2IKJA 4DLFA 1JF6A 2EJ1A 5HANA 3N2BA 2XFFA 4GIRA 2PAJA 1Z44A 4Q7IA 3QFEA 1GPFA 3H70A 3TYAA 3MUXA 2OWXA 1BPLB 4PRTA 3VGBA 4L6OA 4P7RA 2POZA 4EPDC 3IK4A 3UGVA 4DZHA 1Q6FA 3LN3A 3WYZA 2Z0IA 4LC8A 3OYZA 2YCEA 4QCFA 1NF7A 2WCAA 3OZYA 4A2RA 4M19A 5HNNA 1SJBA 2XSXA 1ONWA 1KLZA 2YL5A 3UP8A 3SGUA 3GIYA 1FXQA 3LCLA 4EMJA 1AJ2A 4W7VA 3VD5A 3NQDA 1SFSA 2J47A 3FA4A 3LB8A 2XM1A 1OG6A 2XIBA 1GREA 1PZ3A 2GJLA 1SZGA 1GQKA 5IFTA 2Z2AA 7ENLA 4GVGA 4JL2A 5EYWA 2ALDA 2X16A 1KGUA 4ROQA 4PFHA 2ZQ0A 4MF4A 3MJMA 3IUDA 2WSRA 4K8GA 2VR4A 4UTTA 3G1RA 2GUUA 2H8ZA 4IISA 3ZR6A 4IOTA 3BG9A 2QXWA 4WJEA 4DF1A 1J79A 3FJLA 4L9YA 1BYBA 4UCFA 4HMCA 4ZQRA 1DORA 3NPWA 2RKXA 5CGQA 1HN1A 4JBRA 2Y0FA 3RHGA 3M64A 5ENLA 1PPIA 4B5WA 1DXFA 3VGEA 1XL9A 4S1FA 3ZT7A 1IIHA 3FXGA 4KGJA 3CZEA 2FIQA 4M0XA 1UB3A 5B7ZA 4PMYA 1DPMA 4XZIA 3UYIA 1FWJC 2V2DA 4CLMA 4B9ZA 4TXEA 4H2CA 2X7WA 1H2JA 3S46A 5A6MA 4Z2LA 3OQEA 1MFVA 1KKRA 1QVBA 1G5AA 4IJBA 4ZTXA 1WQ5A 3DKLA 4NEWA 1B9BA 1QI0A 3L5AA 1EGMA 5I06A 4MYXA 1B5TA 2V3DA 1R6WA 1WZMA 1BRLB 1YNPA 3KL3A 4NYYA 3HQPA 1R3TA 3VINA 3NZRA 3FGCB 3W2JA 1OFAA 1PEZA 2EG8A 7A3HA 2VYOA 3IIZA 1RSCA 4HPJA 1O60A 2HRWA 3LHUA 4H83A 4AD3A 1YEYA 2AQVA 4US5D 2O92A 1EWDA 3R4IA 1UIPA 2VC9A 2G0WA 4N2YA 3B9OA 3LXDA 3TC3A 3GC4A 4LPCA 2VGIA 1GHSA 2ZX9A 1M6IA 3VYLA 3VIIA 5JBEA 3PBVA 2C1GA 1UASA 1BYCA 4C6FA 3S3GA 1O5XA 3BO9A 3B8SA 3O0HA 3MJYA 4E5TA 4KCVA 1YNQA 3ZOAA 3PF3A 1PXGA 2DVUA 4IQLA 1G67A 4QAWA 2PDIA 2WPGA 4Z17A 1WXZA 3GW0A 3GTNA 4D6HA 3THQA 3VIJA 2XVGA 2VVNA 5U1OA 3PPFA 1XBVA 3G22A 2GOKA 4M6VA 1S2AA 1US0A 4AD1A 2E5BA 4GXWA 3AO0A 4B9YA 3Q2DA 4GNVA 5CSRA 4QG6A 1QAPA 3GZAA 2V2CA 3QR0A 4FS9A 4NZ1A 1UJQA 1OBAA 2GGHA 3DYMA 2ZC8A 2PLCA 3HGSA 4CEXC 2I16A 3T42A 1VYRA 1ZKQA 2PP0A 1UIOA 1CWYA 2AL2B 3TH6A 4GO8A 1QASA 4WDUA 2DSWA 3K4AA 1UZDA 1E71M 4E2VA 4NY2A 3HFYA 1EA9C 4LUYA 3CGCA 4TU1A 8RUCA 2G4FA 4N02A 3NAVA 2J4GA 3VX1A 1CXEA 2OOGA 4B15A 3ARRA 3R0DA 5BNKA 5E5CA 3VNYA 3W7JA 4I9TA 1I2QA 2VX6A 2PBOA 3SJ3A 1TQJA 3NS1B 5A8OA 5EMJA 2QPSA 3K1GA 4HU4A 1E6RA 1SMAA 3W72A 1EBDA 1MXDA 1DJZA 1E4IA 4PE8A 1S5MA 4JIIX 4NILA 3N1AA 3V35A 1RR2A 1LQAA 3PUDA 2J7CA 1TWIA 2V5LA 2FFIA 3FA3A 4JQ1A 5FS7A 1ZTVA 2W5FA 1EO5A 5A6TC 3QY6A 3GNRA 2ZZBA 1Q6EA 1QXLA 4J3UA 3W6LA 4J2PA 2J8FA 5DN1A 1GYLA 3RITA 1H0IA 1TJ0A 4QLKA 4PCNA 4QLLA 4JXCA 1Q2SA 3BLDA 2QMKA 3XINA 2QCCA 3ELFA 2YDRA 3H4GA 1VLIA 1AH4A 2OGYA 4EX4A 4PTMA 3VC6A 1GOWA 2QV4A 4H00A 4P8VA 2R9ZA 3LTSA 4A29A 3WD0A 3G1XA 2WMHA 3O6AA 2QJHA 4XZNX 1E0TA 1WKDA 3KOZA 4FA3A 1RY8A 5HQMA 3TTOA 3FEQA 3EWXA 4LYRA 4H3DA 1GTHA 1WKEA 4MMWA 2PF0A 3SCVA 3M0ZA 3ZZ1A 1UZ1A 5CAHA 4LC6A 2YLLA 1R87A 4AEFA 1JROA 2E6YA 1EXBA 4JN6A 3NGFA 4JQ9A 5L9FA 3U5UA 4JCMA 4DJDC 2BCPA 3ETRB 1T8XA 2VI0A 2QDHA 4EIVA 2G95A 1H51A 3K4DA 1UZ4A 5LA2A 1IXOA 2C3DA 1JXKA 3H2NA 3A47A 3OW1A 5I79A 3SIZA 3GHTA 3SN4A 5I3GA 4JDYA 3P5YA 2WV8A 3O2LA 3GG0A 3CGEA 4W86A 3C6CA 3ABZA 3NO3A 2XSBA 2DW7A 4DYJA 4FXFA 3RLGA 3AJ7A 2PWDA 2A0NA 2DQWA 4MG4A 2Z00A 2I5GA 1VB9A 1ZS2A 3LQLA 1E9LA 2A3HA 5BU6A 3AALA 3ZM8A 1IEQA 3II4A 3LPGA 2TAAA 1OYCA 4X3ZA 4UTWC 1GJUA 5LGZA 1JPDX 5GVJA 4RNHA 7TAAA 1SFLA 5A8GA 1RALA 2VKZG 1ISWA 1TYPA 2WSPA 4AZ6A 2XISA 3T6CA 5GNXA 3ICJA 4H4RA 3PG9A 2NQHA 3PTDA 4IIGA 1TR1A 1F07A 4JL1A 1LG2A 2BY0A 2YDSA 2GH5A 3QW3A 2EGZA 3II1A 3W27A 4ENLA 4K7ZA 2PU0A 1U5HA 3VGGA 1LRNA 4H4QA 3IUHA 1GT8A 4O52A 2WYSA 1Y65A 4KWWA 1GYNA 1EKOA 3PWGA 2Q8LA 4WJ8A 1OZQA 1X7IA 2BWGA 3VK5A 5AVNA 3DESA 1M53A 3TAKA 1WBHA 1KRCC 1GESA 3GVWA 2BXZA 3MCOA 1B3OA 1R2TA 1OT2A 1W32A 2WMGA 1CLVA 2YBTA 1SM9A 2H3BA 3DC8A 3WLTA 5AECA 2YB4A 2A7PA 4K3ZA 3MU7A 4RNJA 4JFVA 2D2JA 2DZAA 1ZLPA 2ADAA 2O9RA 3B40A 5AC6A 3W2UA 1EJWC 4AEOA 4DZAA 3VI2A 2WHLA 3STFA 1NELA 5AB3A 4IG2B 4UFIA 2ABBA 1VFFA 4XISA 4NYUA 1JPHA 3NPXA 4QTGA 1BZLA 3A7RA 5I3FA 3MSYA 4X9YA 4GC3A 5CH9A 2FVLA 3L5MA 3M5XA 4ILSA 3QOMA 1K70A 3BCDA 3CNYA 3NO1A 2ZXAA 1VYSX 2AAMA 4NP7A 1R7AA 2NVCA 6XIAA 3V7PA 1WO2A 4PC8A 3QFAA 1JD9A 2OXNA 4JYDA 3SRDA 1WP6A 4AVOA 5A6JA 3RO8A 1ML1A 3KWXA 1POJA 4HHLA 2Y7FA 2JF7A 4OV4A 4HJWA 3BUVA 1XPGA 3FDKA 3GFZA 3IJ8A 3L0GA 1GG0A 4XG1A 4Z1YA 4HNLA 8XIAA 3IJ6A 3ARTA 1A3XA 4XKYA 1GW1A 4GY0A 4W5ZA 2VOMA 2Y8VA 4FOUA 4MUZA 2OCZA 4Z0JA 1A5SA 4FAMA 2ICSA 4DF0A 4O17A 2A2IA 4R5EA 1M6JA 1UROA 2D3LA 3U7BA 5D8ZA 3ABRA 5FAGA 4EQWA 4C6BA 4R7WA 4ES4A 4UQBA 3HIJA 3AC0A 4GUFA 1QNOA 2Z4GA 2D2GA 3L2MA 3VUPA 1SZNA 1SJCA 2VZVA 3O9NA 3TQ0A 4CQ8A 5I3IA 3KOWA 8XIMA 2V5JA 3NQ6A 3VO0A 3LLXA 2REQA 4GYKA 2X2GA 1Q63A 3EOUA 1VIZA 4NJJA 4J7RA 4D6GA 1M68A 2ZYFA 4UBPC 4L9ZA 5DRIA 1A5KC 3PHAA 3ANUA 1JDEA 5I77A 4F2TA 4GHRA 1O5QA 3SB0A 4CNSA 4YWOA 4JTRA 4P8XA 4YHGA 1X2HA 3DH9A 4GZEA 1XYAA 2QJGA 2QEZA 3WLPA 1LT8A 1A5LC 2VEPA 4CCCA 3GKAA 3DG6A 4HA3A 4G1NA 4IGHA 1AW5A 3XISA 5CZTA 2OFJA 7REQA 3ZS4A 4WQ6A 3O05A 3N04A 5G2WA 4ZE4A 1O66A 4NAEB 1IT8A 3G0SA 1NWTA 5A94A 1PIGA 1KCLA 5H2ZA 1VS1A 3UW6A 4MZ8A 4NI8A 3QHOA 2E25A 4GKLA 3W7IA 2WNNA 4BKNA 4E8CA 2PMQA 4J3WA 3MKVA 3PANA 5TAOA 5ABHA 1TWSA 4M80A 4DBSA 4WKAA 1RPKA 1XDJA 1LOLA 4HTYA 5A6LA 3G5EA 5CC7A 2PGFA 2WZEA 4LIIA 1L9WA 1U30A 1Q6RA 1YQZA 4BURA 2J3NA 1JCJA 4HNUA 4FXRA 2FHBA 4WOZA 4B5SA 4NAFB 4JTCA 1VEMA 1NOUA 1O1HA 1PCKA 1HKVA 4GIAA 3SCSA 1J18A 3H7UA 2PODA 3N2CA 1OIMA 4CVUA 3HW2A 1LOQA 2BDQA 2QLYA 4JTIA 2YCIX 4DELA 3SEPA 2PDPA 2A21A 5KINA 3HRDC 4NZ4A 3N15A 5CJ5A 2WPBA 4L1WA 1CENA 3FV9A 1T3QC 2A3LA 4O1CA 1QNRA 4MDOA 1VKFA 3GAKA 2IW0A 4XUGA 1P0NA 2GR2A 1G7VA 1B2YA 1XFCA 1XIEA 4QNWA 4GO9A 5G5HB 3VUSA 4S3DA 3OZPA 1ONXA 1IWPA 2D2HA 3L8KA 4MNKA 3GIQA 1GKRA 3URBA 3KS5A 1EYWA 3KVMA 3WUGA 3C61A 3RNMA 3KP1A 1OSEA 2W63A 2VQTA 2WMIB 3G1DA 1WAUA 3HGJA 5LNWA 2YXGA 3PZOA 2PURA 4H9YA 1KC7A 3NQVA 2GR0A 2V6AA 4GLEA 2V5DA 4AZBA 3PBYA 2B0MA 4O0KA 4PGLA 4BEQA 1B31A 4KWSA 2YA2A 4Q33A 4AIBA 3V5FA 3VD9A 3FVDA 3ABSA 3SCOA 3WD4A 1IEXA 5HWMA 5JVLA 3FHAA 2X8CA 3ZVIA 3OG2A 3GBEA 5HK4A 1Q1RA 3AICA 4ZZ9A 4NRRA 3TYUA 3E6EA 2CBJA 4LS0A 5H1WA 3UG4A 3SCRA 4GI4A 5FI8A 4GYPC 1F4AA 1XCWA 4AIOA 2QVNA 4DIAA 4NKCA 3SURA 3WQ8A 4MKNA 3BLKA 5FS6A 4DO4A 1XWYA 1E6ZA 4B4FA 3VOHA 4B5UA 3AHYA 2DT2A 3KWSA 3NWRA 1NQ6A 4DBDA 4QDPA 1OT1A 2XN2A 4AAJA 3K8LA 3DFPA 2ZUMA 1OF8A 3M5ZA 4MPQA 1GJWA 2VFGA 3D47A 3M16A 4UMCA 2IQ0A 2J66A 1ITUA 3OVQA 1ZALA 1IYXA 4GNKB 5JRBA 1ITQA 1LQ2A 1W3NA 2ANUA 3JR2A 4B92A 4GZIA 1MEWA 1V02E 4EPEC 2DT3A 2FZ8A 5AVHA 4S3BA 4O1DA 1Z8AA 2GZXA 5TQLA 1KO0A 3SECA 5FEXA 3CEPA 4XO7A 2V81A 3IGXA 3W1RA 4GUIA 4ERIA 5HNTA 3TP4A 4LB4A 2HK0A 4K1WA 2A79A 3CWHA 1GPWA 4AFYA 3ARYA 4PZVA 5FIPA 4K7VA 4M51A 3S83A 3QQWA 5JBFA 2IKHA 4WY0A 2VC6A 4O28A 1JPMA 3OODA 3T44A 4DM1A 3R79A 3W3OA 1RP9A 1THFD 2AQWA 4GFIA 1EHNA 3FFSA 3AHVA 3YPIA 3AS2A 3S6OA 2HSAA 2V30A 4S3EA 3W9ZA 1JEZA 1QWGA 3UWYA 1UR2A 1NFBA 1E51A 4OZOA 2X8RA 3CPRA 3CU2A 3WLIA 3VFLA 2HISA 5DT5A 3OB8A 3R5EA 4DVOA 3WNNA 3OBAA 4GJJA 2PDJA 5G4HC 2XGBA 3TC7A 3ITLA 4YNGA 4IL2A 4HVXA 4RR4A 1P6BA 4GG9A 4FX8A 3E2QA 2HMCA 4R7OA 2F6XA 1KFCA 4J3SA 3THDA 2AL1A 2GSJA 4AWTA 4LOCA 3TQPA 2E77A 1HJQA 5FJTA 4I7WA 3VMPA 1LZOA 4ZO6A 1W2VA 1JYXA 3ARZA 1V6WA 5ABEA 4R34A 2X1UA 1XRVA 4UR9A 5CBBA 1UQYA 4Z2GA 3LPPA 3VNZA 3M7SA 3QMSA 4L7ZA 1JG9A 1S7MA 3A24A 5T91A 3WQ5A 1O5RA 3L4WA 3M5YA 3CV7A 5LGXA 3WZ0E 1P48A 3EX6A 1VF8A 5I2UA 1W5PA 3NOEA 2BHYA 3MUY1 3KHDA 4UNLA 1EC9A 3CZKA 6CGTA 4NRSA 2DGAA 4E0CA 1KBJA 5IHSA 4I5XA 1XYMA 4C6PA 1VBHA 3KOXA 3CXOA 4CVWA 1R86A 4W87A 2WNWA 4DBEA 2P88A 2NUWA 1MSSA 3B9DA 3GDRA 4FNUA 3HPAA 4E6MA 4WSKA 2GQ9A 2ACUA 5IHRA 4MB5A 5LIUX 1FHVA 2XH4A 2NT0A 2WSYA 4W8LA 3NQ7A 4RV3A 3VU2A 2V3BA 4KWVA 1WKYA 3WD1A 1YPFA 5C9XA 5C2CA 1E4MM 4LRTA 4F3HA 1SZRA 1E3XA 3AWOA 1TMHA 2Z2BA 2W27A 3WMBA 3DENA 1RCOB 3W7GA 1EJRC 3SSZA 1FFQA 1I60A 1J5SA 3E1F1 1HO4A 2G97A 4XAYA 1BRLA 1FBAA 3MDUA 3WNPA 1KM5A 5GQBA 1QO5A 2GR1A 2WW5A 3WLRA 1PVNA 4JOMA 3FGCA 2QUVA 3W7EA 2NUXA 2V3EA 4IGNA 2P50A 2Y62A 1K6WA 1UD4A 1LP6A 3ZR4A 2EO7A 4KQNA 2YL8A 1M65A 1V5XA 4DXVA 2ZA2A 2YGYA 3WLMA 4GY7A 2R1MA 9XIAA 3BURA 1HF6A 3MHFA 3W28A 2E28A 3PJTA 4FR1A 3QZEA 4N9BA 4WGXA 3AMGA 4HK6A 4KMQA 4ZOCA 4ADTA 4PTVA 3VGHA 2W61A 1QWKA 5AYYA 3W1NA 1QNVA 1YXYA 3DK8A 3VD4A 4GGBA 3LXAA 5CSYA 3O6CA 3TCEA 2JKAA 3QQ0A 2E1DA 9CGTA 5DLCA 2J75A 1GYMA 3ZR5A 1KFEA 3DJJA 2ZZ7A 3FLUA 2IXUA 1LM1A 3W82A 1IZCA 3TXZA 3UZWA 4PH6A 1N8WA 4UUIA 4RV8A 1R2RA 4LAOA 1NWRA 4IMCA 3HMCA 1OABA 4BV6A 2PRHA 1GVSA 2Y5EA 4MB3A 3UY7A 4JHZA 1CEOA 3U57A 3RX2A 1W17A 2PPGA 1OX4A 3AXXA 1X98A 3T78A 1JZ6A 3VGFA 2VDIA 4KIEA 4GC4A 3MUAA 2PUZA 4L5ZA 1YTKA 1X6NA 2AL2A 5L6UA 3EDFA 2P76A 2QKFA 1TTQA 1MZRA 5EA9A 1X39A 2WPFA 4I7UA 1W1PA 6TAAA 4XSMA 3CLWA 3CO8A 1Q4WA 1QW7A 2PWEA 2W4XA 2ZX7A 3QSTA 3W01A 1XYCA 4ZO9A 1T0OA 1PX8A 3FSTA 1LT7A 1J2WA 2OYKA 3CB3A 5M03A 3QVQA 1TKKA 2PZNA 1FQ0A 4LBSA 1ZZMA 3GXTA 4W84A 1CIUA 5KVHA 2NSXA 3HG5A 4CQAA 4DHGA 5DY2A 1TV3A 3K8MA 2NVAA 2YYTA 3ABXA 4RE3A 1FWCC 3UPBA 1G4PA 3IUIA 4HMDA 4ZOHB 2RJHA 4JAWA 2ZADA 4O4WA 5J04A 5I03A 1KFBA 4F2UA 1CGVA 4CNUA 3TLQA 3BZGA 1N5XA 2CEQA 4FP1A 1E1FA 4HU0A 1FH8A 1SW3A 3MVTA 2OTDA 3IVTA 2OT0A 2P0IA 1TV7A 3ONBA 3AN1A 3TE9A 5HDRA 4AHOA 2EEXA 3BH4A 3RMJA 4MJMA 3VCCA 3VIPA 1DP0A 1YXCA 2ZICA 3UWQA 5FJIA 3FYPA 4S3GA 3LZ3A 4OBTA 4PEEA 2ZZ0A 3PC0A 1GK8A 3P8JA 1KRMA 4TUFA 3UCDA 1IEWA 4ACYA 2CLHA 2IQDA 3G6LA 1ZHAA 4Z1DA 4G7FA 2VD9A 2VMFA 3TC6A 3AIUA 4K36A 2Q09A 3S9YA 3ANVA 3QHMA 1X1NA 3LI1A 3EAOA 3NA8A 5TD4A 1QI5A 1C91A 3D0CA 5EFDA 1XH0A 3VIHA 5I6SA 4PRRA 4ZQMA 4JTUA 3ENLA 2Y61A 5DF0A 3ZLHA 5J5DA 5T26A 2YXOA 1LWHA 4LUIA 1WV2A 2F61A 1RBOB 5FEWA 1H7OA 1RLCL 1RCQA 3BAKA 1XCXA 3BLIA 1QBBA 4RK8A 1X6LA 1CW2A 3ARVA 5TF0A 3C86A 2HPIA 4PN2A 3A3XA 4JKLA 4CNPA 3WJXA 3OHIA 1S5WA 4ZO8A 3JW7A 3LGEA 3MHUA 4I7VA 4Y9PA 2C3CA 3KEHA 4Q8PA 2OSWA 4HNCA 4X0VA 5C54A 1KN0A 2WMKA 3M44A 1FCBA 1OFBA 3ERPA 5BROA 3WFAA 3RPTA 1JDAA 2FMOA 1ZK7A 3F7JA 4NQ1A 2RABA 2VTFA 3CQHA 3I7RA 3Q65A 5G5IA 3LCHA 4LA1A 3LV6A 3RDKA 3VNJA 3I6RA 3QM3A 3UJRA 3BL3A 5D38A 1KQZA 3THUA 3KUMA 3IVUA 4F66A 1EXPA 1AD4A 1LL4A 3IARA 3E49A 1AVAA 1KM3A 3GRIA 3MP3A 1RJRA 1UWRA 2EQ9A 2PDYA 3O7UA 1VR6A 1P0EA 3ARQA 4IFOA 1XXXA 3LRMA 1EJXC 4OV9A 3VNKA 3ITOA 4GR1A 1QI3A 3WMSA 2JQXA 2VP8A 1ADDA 4DYKA 3KAOA 4FO4A 3SR7A 1VFUA 4KF1A 2V9DA 2WXDM 3F2DA 2QCDB 1NARA 3SQLA 3PPGA 1E73M 4F0RA 1FFUC 3NXLA 1K8CA 3A4JA 5D30A 2J24A 1OY0A 4FR6A 1SJDA 3DH7A 3B8VA 3GVVA 3T55A 3QEZA 4TX8A 2ISWA 4N9EA 5T9CE 4IG2A 3WDIA 2PC4A 3OGRA 2A3EA 3V1PA 3WQGA 2BTMA 1STZA 1IQ8A 4KFOA 2GDUA 1OFEA 2VUNA 1N82A 2CZVA 2ACRA 4P7OA 3AUOA 1A4LA 2I56A 3REQB 1KBLA 1GONA 2BOEX 1C7TA 2FKPA 1E6XM 3QC3A 1GTEA 1FWSA 3N17A 2X2YA 3PJUA 1YNYA 4U3AA 4ICMA 2BSLA 3H2MA 2A6LA 2Z1WA 4LAMA 3H53A 3FA5A 4NJGA 4LU0A 4GUJA 1JOAA 3UJEA 4JDRA 1N5WC 3DECA 1VGAA 3W7HA 5ABTA 4GNJA 1NEYA 1OEPA 1KFJA 1U5VA 3W07A 4DJDA 1EL3A 3GXNA 1R3WA 1GJPA 4NZ3A 3S5OA 4B2DD 2WHKA 4E38A 2YDQA 3WD3A 1V6XA 2CLOA 1VBJA 1Q45A 4YIWA 3B04A 1V97A 5FKYA 2Y5JA 2JKPA 4CCZA 1V0LA 2SFPA 3RRXA 3SGZA 3CQ0A 3RX4A 4JTTA 1VFOA 5I3KA 2OG9A 1IWBA 1W9UA 3QW4B 2XWEA 4LS1A 1F61A 3E0LA 1ZPTA 1XRSA 3GKFA 5AY7A 4BQ3A 3HFTA 3N3MA 1P6WA 4CQDA 3P3BA 4QR6A 4DXKA 3WQCA 3E2RA 3RPDA 3O1NA 1Z7AA 4H7ZA 1T96A 3MZNA 1R3QA 2GLKA 2W3SA 4DJED 3PVFA 4M81A 2X8HA 3EX2A 4AZHA 4HPGA 1HG3A 3VNDA 2ZCGA 4ZQOA 3DJGX 1KW1A 2NLIA 3T0CA 2VXNA 1OFRA 2EPKX 1E72M 3N2TA 1EJVC 4TV5A 2YL6A 3W75A 3ALFA 3H2FA 3RNDA 3TOPA 1KRBC 1TPVA 2D0GA 3SW6A 2ZOXA 1G9HA 4JFSA 4ZB0A 3DKJA 2VRJA 3HZ3A 1LVLA 3OP2A 4H9TA 1KM1A 2ATMA 5ABGA 3VFCA 2EQ8A 4NAEA 3I4EA 1DIEA 1B9ZA 4HHHA 3QXBA 3KM8A 4O1FA 2BY3A 1V59A 3GU1A 2DSVA 7XIMA 2EG7A 1I75A 4GFSA 2TRSA 3V5OA 3VX0A 1TPB1 2VEGA 4DX3A 7CGTA 1AZ1A 4H2HA 3KLLA 2J9XA 4C91A 1F3XA 4WVXA 4L4PA 3NZGA 1DWIM 1FIQB 1TPC1 1R3VA 4NAFA 3M0LA 3S5SA 4GZJA 1QPQA 5LIKX 2X0YA 3QSRA 4HOWA 3URHA 1VHNA 4HNTA 2ALRA 1VRDA 3RJYA 5K3VA 2XIOA 1JZ4A 1E0VA 3WJZA 1VJIA 4HHPA 1HKMA 1XBYA 1JR1A 2BHZA 3W70A 1E0XA 4KEUA 4MY8A 4H4PA 2IPWA 4W7WA 2E8ZA 4C6QA 4H4ZA 1V3HA 5FSEC 1V6TA 4Q22A 1W3KA 3L2LA 4WSHA 4AISA 1F74A 3RAOA 2PTWA 4DNAA 4G1KA 2HROA 3EKGA 1KTBA 4C1NB 1UBPC 1H7PA 1I2OA 3KBMA 3VNIA 1JUBA 4QLJA 1XKJA 1MFUA 2VDGA 2DIKA 4O53A 5CKSA 1Z42A 3C0SA 2E0PA 3PJXA 1E9ZB 3SO7A 4IX2A 3DXIA 3M41A 1NP0A 4KESA 4KWOA 4CNOA 4XWUA 1E43A 2WMIA 1W8SA 1V3KA 1GVYA 4HMEA 1UWUA 4PB5A 4MJZA 2BNJA 5H91A 5KZDA 5AHMA 5DCDA 1QK2A 5FF2A 2GVGA 1KTNA 1UR8A 1ZY9A 1KR0A 4PUEA 2C6QA 1SZEA 3HB9A 1DJIA 4JR5A 1P1XA 3IVSA 5K9DA 4AYSA 1VLWA 2PRMA 3QPZA 4EAMA 1NOFA 3K1DA 3LYEA 4MHBA 2J7GA 1IHIA 1V0KA 4QIUA 3RILA 2AGTA 2PLKA 3R43A 5CBIA 3N3TA 4HN8A 3BDKA 3G6MA 1TZZA 3T08A 1HXJA 3C4UA 1TYTA 3BGJA 4HQVA 4ASTA 3SUWA 4GISA 4A8NA 5B80A 3OZMA 2VD8A 5CJNA 4L6HA 4UFJA 2V0TA 1C29A 2OVLA 1B4EA 3CB8A 3A9BA 3UXLA 3PM6A 2PTXA 4YN5A 4QJ1A 1YHTA 5HBFA 1ZENA 4YPJA 3EOOA 4JKMA 2E09A 3E02A 3TNOA 2PWGA 3GD4A 1XIBA 2QNEA 2XH2A 1WDPA 2DZVA 1WDSA 4EWND 4PCPA 1UWTA 3WIJA 2AAQA 2G3JA 1FWAC 4UZSA 6ALDA 1P0BA 3RYSA 3DFNA 4TIMA 5G4WA 3DN5A 1GZ1A 2PSNA 3VMNA 2V5CA 2IPFA 4Q6XA 1DHKA 5FACA 1KNWA 3C2YA 3A12A 5IBXC 1JYNA 3PBGA 2ZE3A 1DJHA 1QHOA 1XLGA 3CUJA 3UCCA 4B2DA 4DNHA 3TU9A 4BQ4A 4X22A 4IMAA 3CAVA 4AUBA 4GI6A 3KBVA 5IM51 2C18A 4HPXA 4JFUA 3RM9A 4Q8VA 4HB7A 1YXDA 2WBAA 1X97A 3RN6A 4C60A 3XIMA 2WMFA 4LTSA 4HBKA 1HX0A 3PB2A 1BLIA 2YA0A 2WP6A 3GC2A 2PGWA 3UG5A 2RDXA 4LAZA 1SSGA 2YPIA 3T2OA 2PS2A 4B3KA 3WF3A 5D2VA 3WUEA 4PMJA 3N4FA 4GY1A 4ZB2A 4JICA 1QPRA 4CCEA 2OEMA 3VNLA 3NNTA 1BYAA 4IH3A 3AXIA 3EPMA 4D6DA 1GQIA 2WJEA 3BVJA 4IQEA 1UW9A 1WOBA 2YJQA 2W9MA 4RX0A 4EP8C 1PS9A 3S6TA 1UR4A 4HD5A 1ELSA 4ZCWA 3SQMA 1MQPA 3M0IA 1OG0A 3TR2A 1ICSA 4GOAA 1AA1B 1TQXA 1C8XA 3A5FA 1CPUA 3DI1A 1GZGA 3ZLGA 5GJPA 3ARUA 3IJ9A 3WF0A 4D9PA 1DV7A 1BF2A 2ZTKA 3PB0A 1EF3A 4DWSD 3PZIA 1IXPA 1XLKA 2R82A 4GXMA 1V4YA 1RH9A 1HJVA 5J5RA 2A5HA 3DGZA 1JCTA 4LGXA 3ATZA 1HKWA 4OU1A 3WJYA 1E3ZA 4V28A 1E4NA 1J0HA 1QOQA 4YL2A 4CGTA 1V6UA 2V38A 4PSRA 1JCNA 1EJUC 3TMQA 4RE0A 3UZ5A 3MSRA 3F5JA 4ZOAA 4ZFCA 4JQ2A 3A3HA 5G2IA 4O1BA 1M04A 3A7AA 3MZ2A 1OADA 1ZGDA 1DWJM 1WZKA 1ZU8A 2V8ZA 1TWWA 1WDRA 4R33A 4NX5A 4APNA 2QF7A 3WMCA 3MMWA 2ISDA 3EWCA 4GRSA 2WJZA 5T8GA 4Q8MA 4CU6A 2R24A 1QNSA 2VEIA 1ZJAA 1UKOA 3VCRA 1FA2A 4MB1A 1SO4A 3HF3A 2PWHA 1DJXA 5HPOA 1DJYA 3NG3A 3EXRA 2R8WA 1ONFA 5D2XA 3T9PA 2ZZ2A 5CPTA 3T8LA 1FWNA 3EBVA 4PBFA 2IMRA 3E2VA 3RUBL 3W38A 4IUOA 1KBIA 3DGBA 4HT3A 3WNKA 1XQKA 1A5AA 4PMVA 1K1DA 3JZUA 3C0QA 2ZTJA 3DERA 4HZ8A 1HL2A 3MSDA 2P8CA 4AY1A 3LM7A 1ZAHA 4WUIA 3EB4A 3WUBA 1JI2A 1QK0A 5AOUA 3M46A 5H8UA 4J3TA 3WK2A 2BXVA 4LS2A 4MAZA 1A5BA 1DNCA 3PPHA 3I65A 4PMNA 4R9XA 3ZT5A 3BQ5A 4DUOA 4LX4A 1BWLA 2GQAA 4JNYA 3URAA 1AL8A 1OM0A 2C0AA 1EJTC 5HMEA 1I4NA 5DMYA 1YTEA 3GUGA 2H6RA 1V7AA 2W55A 2PGRA 4DZIA 2TYSA 2WVVB 3BW3A 4IIBA 4QP0A 4Z08A 4B3ZA 1K7XA 3ME3A 3RIKA 5AYXA 4Q6JA 1F5ZA 3B3DA 5I0DA 3NVVB 2CKSA 1G01A 3TIMA 3DG3A 5HQEA 3SIMA 3NPVA 4BQ5A 4FF5A 2GWNA 1PWLA 1JD7A 1JZ3A 3BG3A 2RDTA 4RXGA 1FCUA 2ZRUA 3UNDA 2C79A 1K02A 3UU0A 4IZGA 2C13A 2PCEA 4U31A 1N62C 1V93A 4K37A 5I7GA 4YWSA 3EWYA 3K8KA 1EF2A 2DIEA 4MFEA 3MUCA 3UD6A 1UH4A 4Q4MA 4O18A 4WSJA 4ZXLA 4H04A 4NG3A 2VURA 3GLCA 3TNBA 4A35A 3VILA 1CGWA 3MPGA 2Z28A 1JUEA 1VC4A 5JU6A 1UKPA 3IGSA 4FEZA 5GJMA 3GXPA 2QJIA 4U4MA 2G37A 1FWDC 5M5DA 2P1FA 3WQVA 1F3PA 3VE9A 3MHGA 2FTYA 1SFTA 2QCMA 2PDQA 3UQNA 3FYYA 2NQ9A 3FAXA 3WEZA 4F8XA 1ODUA 2FHFA 4EM3A 3CZJA 3EB2A 3O06A 3KTSA 3T4CA 1L6FA 2VT0A 3A6OA 3PFMA 4QE1A 1WNOA 2WAGA 1WYIA 4JPGA 1YTDA 2NQZA 2CW6A 3KOFA 4IMDA 1EC7A 3AIWA 4L61A 3R1ZA 4DPQA 1OCBA 4IT1A 3E12A 1PYFA 3W0KA 1KWGA 1NIUA 3E5BA 1K4QA 1WZLA 3W6YA 4ZB5A 2OSYA 2ZRZA 4LBUA 2PDLA 5TNVA 3AS0A 2ZVIA 4GACA 4A4AA 3DI0A 4H41A 3Q4DA 2WJDA 1ME7A 1QATA 1EDTA 4IIHA 4UFKA 2E9BA 1Z89A 3ARPA 4QCEA 1TMQA 3G1FA 5BRQA 4IICA 3PZNA 3NDYA 3TYBA 4TVDA 1BTCA 1QMLA 1NWUA 1Z6KA 1XDLA 3IV3A 2ATSA 3T0AA 1H63A 1PO9A 4KRUA 5BOOA 4F4RA 4Y2WA 4HA4A 3TV8A 3KRZA 3K2GA 1RXOB 1LBFA 1UR9A 3LLFA 1T8QA 1GCYA 3N14A 3NYDA 4XZBA 1S2UA 3C2RA 2GL5A 5BZAA 1VFHA 2E5DA 1GRGA 1SVDA 5I3HA 3CGDA 2GK1B 5LNRA 4LQ1A 1FO4A 4D6FA 4FB7A 4CQCA 2YW3A 3LNMA 4IPLA 4RXFA 5JCKA 3U2CA 1E5NA 3BOFA 4O0ZA 1DBTA 3WDRA 4YTQA 3TYEA 1HJSA 3W7QA 1ENUA 1Q8JA 3E0FA 4JX6A 3DK9A 1RJQA 4UFLA 4KERA 3LY0A 1BTMA 1R8LA 1BYDA 1SUXA 1TPWA 3NSXA 3EOSA 3WDJA 3I10A 1ADSA 3ZYZA 4AVFA 1WYGA 3LRLA 5TIMA 3AS3A 4MY9A 5DMMA 1TPH1 2OZ3A 4UMAA 3M7WA 2AMGA 3E96A 1TTJA 2CLIA 3LNPA 3ZXWA 1HP5A 1R9ZA 2TMDA 2EPLX 1VIWA 4DPPA 4BS0A 2FZMA 3W84A 4AD2A 2VEMA 3A5VA 4S39A 3PR2A 3IANA 1GVIA 1PSCA 2EPHA 5CC6A 2X1RA 2CC0A 2XU2A 4AB4A 4UTMA 4HTBA 3B06A 3GWQA 2OX4A 1IWAA 3SN1A 2YX0A 4ATLA 1FWEC 3VZZA 1JGMA 3HPFA 5K4XA 3PZQA 3DFOA 3S2MA 3GY1A 4MAVA 3DFQA 5C6MA 4F48A 4ZOBA 2A6NA 3GRSA 5BXRA 1KTCA 5IOBA 4J28A 1W9DM 3NL2A 3DG7A 1MNZA 2C8NA 1XG3A 4O11A 4C6DA 1LTDA 3SQSA 4QISA 4M6PA 1S2VA 1UYQA 2FGBA 2IPGA 3BAWA 1J4EA 2OYMA 1YDVA 3R25A 1M1BA 4KEZA 2V63A 5F4WA 2J79A 2F6KA 2XINA 2CZEA 3MKCA 2QJJA 1A80A 2C0HA 2QCDA 2VFFA 2VR5A 4DO7A 3TSMA 3DCPA 2JGQA 4NT0A 4ZSUA 5G1YA 3GFYA 3H7RA 4C6OA 4AF0B 5GNYA 3OA5A 2C14A 1UOZA 4GCAA 1H5VA 4QX4A 4O1AA 1FH9A 1LORA 1NPXA 3M0XA 3HQ1A 1V8EA 3MYOA 4FALA 2FPVA 2D0HA 3RRAA 2ZX5A 1VBGA 2YCJA 1QW8A 3INPA 3EMZA 5CLWA 3UNTA 3EA1A 3REQA 1E5JA 5DX7A 3SY5A 3U6WA 4OBRA 3VM7A 1KXHA 4FIRA 1AK5A 2I5QA 3A4XA 2CERA 1GRHA 4K68A 4UNKA 3QBUA 1MUWA 5D04C 1BWCA 1H6VA 3QMRA 2UY5A 1W9PA 2G50A 4I9AA 4H8HA 4MLRA 4LB3A 4YVXA 1JAKA 3VIKA 3QZ6A 4XUYA 1J9YA 2EQ7A 1TTPA 1R9YA 4FIQA 4YTSA 3NO5A 1SR0A 4QEEA 4X2RA 4S2BA 1DJGA 1GHRA 2DQXA 5EB8A 2ZA1A 5A6KA 1Q65A 1E56A 2J9ZA 2VFIA 3PP7A 3VXGA 1RVKA 3Q58A 1J6OA 4EOUA 4IFKB 5KZMA 4WY0F 4S3FA 1UWAA 4A2SA 2JEQA 3N2XA 3UA3A 1QO2A 3ZIZA 3CGTA 2DDXA 3JS3A 5BCAA 3HGOA 1XIDA 2J7DA 1C7SA 3EKZA 3A4WA 5C70A 2WC3A 3KP0A 4HA1A 3WLNA 4KFNA 3BMWA 3WNOA 1RVGA 4O16A 4M5PA 1PX4A 5FESA 3HM7A 3N9SA 1FWFC 3UZZA 3OVGA 3QPEA 1BHGA 1I8JA 3PNUA 1YMYA 3DU0A 1OD0A 4XIMA 1TFVA 1X7FA 3C8NA 3P74A 1FHLA 5AC5A 4JFTA 3TFCA 4GINA 5LZLA 2Y2WA 3RR4A 1YPXA 3P80A 4MLJA 3ATYA 5BWAA 2VCAA 5HUPA 4KS0A 1UHVA 3KRBA 4LEFA 1C92A 4UTKA 4O54A 1X38A 2C71A 3LA4A 3AISA 4G2DA 3VCNA 1Z48A 2Z1SA 4H6QA 4LUJA 5CJMA 4IP4A 1EX1A 7ODCA 4DXXA 3T2PA 5D37A 1TPDA 1A53A 4LAKA 3GDMA 4XX6A 4RCXA 3E0WA 3PBUA 2Y70A 4JIEA 3UBPC 3WF4A 4DB7A 3QV7A 3JZEA 4LVBA 1L8PA 4QSFA 4IMEA 5HMSA 4G6CA 2PDGA 3ITYA 5LNSA 3EB3A 5DMNA 2DIJA 4XZMX 1JYVA 3CUFA 5AC7A 1WDWA 1O12A 4HSOA 3FJNA 1JPIA 3LCIA 3TYZA 2XGIA 4YYCA 2A7NA 5CG0A 1JQXA 2X1TA 5H8PA 1K4GA 3ES8A 1LLZA 1X1ZA 2CKRA 4H4XA 2XIJA 4M3PA 1HUVA 4HZ7A 2HQAA 2CLPA 2JEPA 3A3WA 1W54A 1S5TA 1QUMA 3AIRA 2VR2A 1D7FA 4QJ3B 2YOCA 1UKQA 3F5KA 1OCNA 4C1NA 1TELA 3E38A 2NV2A 3WBEA 2ZUVA 4MTVA 2E6DA 4Z42C 1ONEA 3THCA 1AUSL 1QBAA 4LVGA 1XIJA 1P4CA 8A3HA 1S3TC 4CCDA 1H2IA 5AZ1A 4JTJA 3SFWA 4XAGA 2VRKA 4Z0SA 4MWAD 4D71A 4S3AA 1IT7A 4J57A 2BVDA 4TVYA 2QQ6A 2ZZ5A 4ML9A 4D72A 4MGGA 1SSDA 2R1KA 2CZ5A 1N61C 1NHPA 2GQ3A 5BXSA 2MANA 4POCA 2E9LA 1V77A 1N8IA 2DZTA 2X30A 2HTMA 3DC0A 1CB2A 3R0KA 3F2BA 1FWGC 4QG8A 3L4VA 4H4YA 3GVQA 3TTYA 3KW3A 1JYWA 1AZ2A 3WSUA 1BXNA 3WK3A 1TWDA 4AU0A 4TTGA 1I0BA 3VC5A 4Q3MA 2FDSA 1XGEA 3LTPA 1NP2A 1ISYA 4UOJA 3ABOA 4E4PA 5KMYA 3KVKA 3NDOA 3RLUA 1ODZA 1MZHA 5EMLA 3RG6A 1K6AA 1DJNA 2VENA 3FVMA 4Y9AA 3VKJA 1HVXA 3TROA 2VQUA 3SDOA 4I8DA 1XR2A 3STCA 1F4HA 1ME9A 3LSCA 1I1WA 5D2YA 1OCJA 4ZTYA 5E1QA 1GVOA 1TCDA 4JCLA 3LBCA 3EDJA 4UB9A 1CTNA 1W1IE 4FOJA 4H4IA 1UA3A 4ZA0A 4D6IA 3CHDA 1S1PA 4MFDA 2VOTA 3GRTA 1EIBA 3NSMA 5AYIA 5FF3A 5D02A 3VD3A 2ZZCA 1V6VA 3UJSA 4Q32A 4F0LA 4JHOA 3QYQA 3HV9A 3OLEA 3TUUA 3DBNA 1IXNA 3N9KA 3DEQA 5JXQA 1RD6A 1E1EA 4M7TA 2NWRA 4JDBA 1JFXA 1R2SA 4O4VA 1ZXIC 1NHSA 4OVXA 3KVLA 4IPJA 3C3NA