2QDDA

Crystal structure of a member of enolase superfamily from roseovarius nubinhibens ism
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
370
structure length
368
Chain Sequence
SLRITRLTVFHLDLPLAKPYWLSGLKFDRLDSTYLRIDTDEGVTGWGEGCPWGHSYLPAHGPGLRAGIATLAPHLLGLDPRSLDHVNRVMDLQLPGHSYVKSPIDMACWDILGQVAGLPLWQLLGGEAATPVPINSSISTGTPDQMLGLIAEAAAQGYRTHSAKIGGSDPAQDIARIEAISAGLPDGHRVTFDVNRAWTPAIAVEVLNSVRARDWIEQPCQTLDQCAHVARRVANPIMLDECLHEFSDHLAAWSRGACEGVKIKPNRVGGLTRARQIRDFGVSVGWQMHIEDVGGTALADTAALHLAASTPEANRLASWLGHAHLADDPIPGQGARNRDGLATPPSAPGLGVIPDPEALGRPVASYDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of a member of enolase superfamily from Roseovarius nubinhibens ISM.
rcsb
source organism Roseovarius nubinhibens
molecule tags Structural genomics, unknown function
total genus 120
structure length 368
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2qddA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2qddA01
3MSYA 4DHGA 4IP5A 1L8PA 3R0UA 2AKMA 3CXOA 1F9CA 1XPYA 3ZLHA 2OZ3A 2HXUA 2GGJA 3QLDA 3ZLFA 3SJNA 2PP0A 4E4UA 3VC5A 1JDFA 3UJSA 2QGYA 5FJRA 2P0IA 3I6EA 3DG7A 3UJRA 3Q4DA 2OZ8A 1R6WA 2PTWA 3MQTA 3DERA 3DIPA 3P0WA 3VC6A 1MDLA 4H83A 4G8TA 3T4WA 2PP3A 2GGHA 4J1OA 3N4EA 3N4FA 1WUEA 4K2SA 3VA8A 2XH0A 3H8AA 2PSNA 3GO2A 3V5FA 3FV9A 3UJEA 2QDDA 2POZA 4E6MA 3OZMA 3K1GA 4HCHA 3UXKA 1ELSA 2OZTA 3OPSA 4HYRA 2PA6A 1SJCA 2O56A 2PODA 3CK5A 1EBGA 4M6UA 2GL5A 1KCZA 2DW6A 4JN7A 4E5TA 2QQ6A 3QTPA 2PS2A 2ZADA 2GGEA 3FJ4A 3R11A 2OO6A 3STPA 2QDEA 2PU0A 3VCNA 2OLAA 3R0KA 1TKKA 3PFRA 2PCEA 3TQPA 1SJBA 4DYEA 3U9IA 3D47A 3T8QA 1KKRA 4HNCA 3DFYA 4A35A 3T9PA 2MUCA 2PTZA 3NZGA 4IT1A 1DTNA 1JPMA 3DDMA 4GISA 3RGTA 2DW7A 4IL0A 4M0XA 7ENLA 4F4RA 3GY1A 3THUA 2OPJA 3P3BA 3BJSA 3HPFA 3UJ2A 3DESA 1NU5A 1NELA 2XGZA 4J3ZA 3CT2A 4H2HA 5FJPA 1PDZA 3ENLA 2OX4A 3SBFA 1XS2A 4KWSA 4GFIA 3D46A 4JHMA 3R25A 1W6TA 3H12A 2PP1A 2PPGA 3CB3A 3BOXA 3DG3A 2AKZA 4HCLA 1WUFA 4KPLA 2RDXA 2FYMA 4GMEA 3RITA 4FP1A 4K1WA 1MNSA 2XH7A 1KD0A 3OTRA 2PGEA 3JZUA 1MDRA 3MY9A 2P88A 1IYXA 3NFUA 3OP2A 3I4KA 2QJMA 4GGHA 4ENLA 4K8GA 3QPEA 3JW7A 2MNRA 3DG6A 3FCPA 1R0MA 2HZGA 3MZNA 3QN3A 5FJTA 3BSMA 4HNLA 3NXLA 4GYPC 3DGBA 3IJQA 2XH2A 4GIRA 4H19A 3PWGA 5ENLA 3B97A 1MRAA 4IL2A 4IHCA 1EC9A 4YWSA 3EEZA 3ES8A 5EU9A 4HN8A 3DEQA 4KT2A 1EBHA 3PK7A 2XH4A 3PWIA 2OQYA 4IP4A 3UCCA 3ZLGA 2PGWA 1BQGA 3SQSA 3R10A 3VCCA 4A6GA 4DXKA 3UJFA 1RVKA 3S5SA 4DX3A 2PTXA 2OKTA 3SN0A 3VFCA 2NQLA 3Q45A 3N6JA 4GYPA 2GGIA 4KEMA 2ONEA 2PTYA 3JVAA 2P3ZA 2QVHA 4HPNA 4E4FA 1FHVA 3TW9A 3V3WA 1TE6A 3NO1A 1MUCA 3ES7A 4ROPA 3TWAA 2GGGA 4HCDA 4GGBA 3UCDA 3SN4A 2GSHA 2HNEA 3TOYA 3UXLA 3IK4A 2CHRA 3TTEA 1FHUA 3SSZA 3OW1A 3TJ4A 5BOEA 2FKPA 3N6HA 3OZYA 4MKSA 3TCSA 5BOFA 1EC8A 1SJDA 4E8GA 3KUMA 1EC7A 1P43A 3S47A 3GC2A 3H70A 2QJJA 3RO6A 2ZC8A 4ZCWA 1ONEA 3RCYA 1P48A 3TJIA 3QKEA 5FJUA 1ECQA 3V4BA 1BKHA 5J04A 3ZVHA 3VDGA 3DFHA 4IZGA 2PU1A 3CYJA 1OEPA 4Z17A 3FYYA 2AL1A 2PMQA 1JPDX 3RR1A 1YEYA 3ZVHB 4A3RA 1JCTA 4JN8A 3MWCA 2P8BA 2P8CA 3EKGA 2AL2A 4DN1A 4EWJA 6ENLA 1SJAA 3V5CA 1KKOA 3MKCA 3T6CA 2OFJA 3U4FA 3I6TA 1TZZA 3UGVA 4G7FA 2AL2B 1E9IA 3H7VA 2QJNA 2GDQA 3MUCA 3IJIA 2XSXA 3FVDA 5FJOA 4DWDA 4Z1YA 1PDYA 2OVLA 3SN1A 2OG9A 3GD6A 4X2PA 4ZA0A 2HXTA 3TWBA 4MGGA 3CAWA 3ZVIA 2OQHA 2I5QA 5IDZA 3R1ZA 3P93A 3RRAA 4FI4A 3IJLA 4MMWA 4H1ZA 3FXGA
chains in the Genus database with same CATH superfamily
4GRTA 1S1PA 1MWOA 1QW8A 4U10A 4HKPA 2VD9A 2EPKX 4DPPA 1F9CA 5C7HA 2IKGA 3ZM8A 1BPLB 2RJHA 1VP5A 4JIRA 4PCPA 2A2IA 4EVZA 1AQFA 2ZXQA 4ZB2A 1B57A 3RK8A 4D71A 3NQBA 4UFHA 1RCOB 1Q85A 5DT7A 3WBWA 2X30A 3RPDA 3OHIA 3P8IA 5DBTA 4W93A 1WAUA 4IMFA 3K8MA 3R0DA 1RJPA 2CZ5A 2RJGA 4MSSA 5KVHA 2JBMA 3VI2A 2B7OA 4AVOA 1TTQA 1S5NA 1VFLA 5GNYA 1RBAA 3PZNA 3M4HA 4HCHA 4L1WA 2DZTA 4UTLA 4JIHA 2QCGA 3GAKA 3UWEA 4XZ9A 1J6OA 5XIAA 9XIMA 1IEXA 2PA6A 1Q6DA 2Z2UA 1GV4A 3OG2A 3WBAA 5E93A 2W3ZA 3V1PA 1ZRQA 1LLZA 3GNOA 3PTDA 3B06A 2EBNA 3NQFA 4Q7NA 3W7DA 5JBFA 3STPA 2EQ8A 2QDEA 1XLMA 1CLXA 1A3XA 3S9ZA 3KBSA 3STGA 5CZSA 4RZBA 3AYRA 1FTXA 4CN1A 4RE0A 3F03K 2V2HA 4WJXA 1R5YA 3BG3A 1A47A 1TELA 3SURA 3LGGA 5G2WA 1G1YA 5HNUA 2QAFA 3MMWA 4UQEA 3HPFA 1LBMA 3IJDA 3DESA 3O6AA 4Z1DA 2W3SA 3CV7A 4Q4PA 4LBSA 4K68A 4D6DA 1OX5A 5ABTA 2YOCA 4GFIA 3OLEA 4GY1A 1S2WA 3ARZA 3LXBA 3L2MA 2GUBA 3VKBA 1O4UA 2CLKA 4WIWA 3BMVA 2C18A 1TYTA 1SO6A 1U1HA 1W1YA 3CQ0A 4MB5A 5FF3A 3RLHA 4CNUA 3EWCA 1TFVA 3VKDA 3QSTA 5FMHA 2QS8A 3CV2A 5C2XA 1HFBA 4GWEA 1ONXA 3LCHA 2VELA 3RNMA 3NTYA 3WDIA 2WWCA 1UZHA 2X05A 4GVFA 1RK6A 3R13A 4KPLA 1JR1A 5F2GA 1UZDA 3W85A 4H04A 3HQPA 4FP1A 4I5RA 4K1WA 5BZAA 2WLYA 4LUYA 3B8TA 1HVXA 2FHBA 4N4PA 3KWXA 5I7GA 4L9ZA 3TH6A 2O9RA 3WDQA 4LVAA 3OP2A 3LLDA 4U33A 2CLFA 2QJMA 1KXHA 2O92A 3OQ8A 2OEKA 3P62A 2B81A 4QSFA 3AZSA 2RDTA 1H0GA 5BMXA 2ABAA 1V51A 4AWUA 1W3JA 4FS9A 5AC6A 1EGVA 4IPJA 4YWSA 4HVXA 4F40A 4PMDA 3DFOA 1WXJA 5DF0A 3SW6A 2FH8A 1V6XA 3N11A 4S3AA 4EAMA 1NWSA 4E2BA 3C0LA 4LRSA 1K8ZA 2PGWA 3VO0A 4OE7A 3TOPA 4KFPA 3GM8A 4UNKA 1VEMA 2AQVA 4AD4A 2QIIA 3DBNA 1KTCA 2YBVA 4LV9A 3UJFA 1VDVA 1IGWA 3VFCA 2NQLA 3GBEA 4QTGA 2ZZCA 3Q45A 1IXQA 3BLKA 2G3FA 5TD4A 4WR3A 2Y7FA 3GRTA 3VGHA 1EBDA 3WBEA 1RZMA 3GDTA 3PZVA 1ZP3A 1FHVA 4C6OA 1W8GA 5U1OA 1W3HA 2GQ9A 3IUDA 5CEWA 1LF1A 2C91A 1AOGA 1OC7A 4ES4A 5F4XA 3TN4A 1H09A 2ASHA 1JCXA 2VRQA 1GWJA 3IPWA 1D3GA 1XLHA 1WKFA 3SGUA 3AHTA 5H2ZA 1Z69A 2C1HA 4D6EA 3UU0A 2XSAA 1BHGA 1NPXA 1JQVA 1PUDA 2O0TA 3VD5A 1V59A 3TP4A 4GA8A 2FGLA 3COTA 1A5MC 1S1RA 4LVFA 3B0YA 1D8WA 4XUGA 1BFNA 1UOKA 3WQVA 3RJXA 3W82A 2W61A 2WMIA 4S3BA 4EAYA 2OMAA 5FJUA 1OZQA 4LUTA 3DFHA 5BWAA 2VFIA 1QATA 1FECA 2A3HA 3CYJA 3LK6A 2WMIB 1YDYA 4KGJA 2JK6A 1L0PA 1IIHA 5IFTA 1YEYA 2VC5A 4LUTB 2VHLA 2VGBA 3W73A 3AU6A 1RPKA 3B04A 5HR7A 2EO7A 3WFAA 1XRFA 4FNRA 1MW3A 1F7BA 2OFJA 1GERA 3V0UA 1SO5A 3NVVB 5J8LA 3W70A 1TZZA 4AH7A 3WLLA 3EBVA 3SIMA 3CZEA 3GHUA 3EXSA 3WQ8A 5KZ6A 3TTSA 4MDPA 5T26A 3EOEA 2QCMA 4GXPA 3P6LA 4C6BA 5A5WA 1P1MA 3N2MA 4GI6A 4ZQCA 1JNDA 1U5JA 3QW3A 3GIYA 3ZVIA 2C6QA 3SFWA 2INFA 2ATSA 1JJKA 3WDPP 5GNXA 2NLYA 3CC1A 4H2CA 1XP3A 3E2VA 4FI4A 5DCBA 1E40A 2BTMA 4JCMA 2XFRA 4GABA 2IKJA 4AC1X 1HIZA 3D6NA 4DJEA 2FTWA 4DHGA 4KS0A 3LTSA 2V5BA 3LRMA 1MMFA 4C6MA 1OX6A 3BE7A 3S2NA 2WC4A 5EFFA 3GRSA 1IXOA 3G1YA 2HXUA 4GZ7A 5M2FX 3E0IA 3A3WA 1UMLA 3EPNA 1FWCC 4FPSA 4N7QA 1BG9A 1K03A 2FZNA 4RJEA 1PVNA 2FVMA 4Q8UA 1W5PA 4H01A 4L7ZA 3BAXA 2DZUA 1GNXA 2XM2A 4C1NA 3OGRA 3WBYA 4IX2A 4AX7A 4QJ3B 2CLEA 2EJAA 2VCCA 4Y9OA 2DJLA 1F8MA 4GYKA 5A8OA 2XIMA 3DBPA 3WKZA 4C1NB 5EA9A 3IACA 3VOHA 4JQ4A 1GTHA 3GG0A 4GIEA 3ITXA 3GO2A 2ZWYA 2WPGA 2NVAA 3IUHA 3UJEA 5D2VA 5FJJA 1XDMA 1SFJA 4DJDC 2J8FA 4K8DA 1W91A 1BG4A 3B9AA 4M82A 4O13A 4R88A 4Z2KA 1VFHA 4TXEA 3CS2A 1BXBA 3CUZA 2C8NA 2PDGA 3AZRA 3Q65A 4IMCA 4RDZA 4L1XA 2CCRA 3PZUA 1GYLA 4H8HA 2GL5A 1WCGA 1PX4A 4PCTA 3R11A 3Q37A 3DU0A 4HT3A 1TJ1A 1DQWA 4UZSA 1LJYA 4ICCX 2BGQA 1ISVA 2RAGA 4HPGA 3QZAA 1OGGA 1V7AA 1QUMA 2YCJA 4F2BA 5DLCA 5I3FA 3II4A 3TXVA 1MW1A 4WY0F 1KTNA 4LSBA 2Y63A 3QV9A 4EPKA 2FTPA 3W88A 3BJSA 4QJ4B 1NM9A 3PG6A 1PTAA 4I3GA 1BD0A 4AF0B 3VIKA 1FCVA 3W53A 3N9RA 2YAUA 1CXLA 3U2CA 4B3KA 3SBFA 1QOQA 4FB7A 3LXDA 3ITYA 3L5OA 3MPGA 2GVJA 4JYDA 3BC9A 1S3TC 5B80A 3G1AA 1OK6A 3SCQA 2H3DA 3AC0A 3QSRA 4WOZA 3UWVA 3EYPA 1WB0A 2GWNA 1OFPA 4J2MA 4N9CA 3R4IA 2VOMA 2B0MA 3GB6A 3ZZ1A 1W1ZA 3GRIA 4YVXA 3S5YA 1SVDA 3THDA 4AW7A 4UTKA 5HPOA 5G4HC 3TLLA 4LAZA 2QF7A 2Y7EA 3S6TA 3TFCA 4TMCA 2YCLA 5HAOA 1LQ0A 2OEMA 3AWNA 2V2CA 2V0TA 3GW3A 4MNLA 2YFNA 3ZQ9A 4IQLA 3TNBA 5GRTA 2YCLB 5M5DA 2G3JA 2AQOA 3T0DA 3GDKA 1AD1A 4C6KA 2FTYA 1QOPA 3W0KA 3PZIA 1BVWA 4PMQA 3PK7A 2DVTA 3G3MA 3WD4A 1UZ1A 2OQYA 4PUKA 5GJNA 4CCDA 4F0KA 4L1GA 1ZENA 4FR6A 3R10A 4E2DA 4ZR8A 1QNPA 3SCNA 5KZMA 3HV9A 3M0KA 3SIZA 4JNZA 2VGGA 1QI3A 4C1LA 1YIXA 3QMRA 1RVGA 4GLEA 3CXBA 4BK9A 3G1RA 4QDPA 1H11A 4B5VA 3PUOA 2Z24A 4O11A 2EG8A 3CZLA 3KVLA 1YADA 2PDYA 4PTDA 1EFZA 4YS1A 1UR2A 3UT0A 3K5XA 3TW9A 3V3WA 3CGEA 1KCLA 3QQ1A 5K3VA 1NDWA 4AZHA 2J79A 2VFHA 2Y7DA 4KBXA 3DECA 3ES7A 2HQMA 5A2BA 1UMYA 1SPQA 4C6PA 4D6GA 3GTHA 1F8IA 4J2PA 4O1BA 2FKPA 1Q6OA 3F4NA 3OZYA 3E2RA 1AH4A 4GXWA 4I9TA 2J24A 1GHSA 1DQXA 1GQJA 1QK2A 2ZXAA 2WANA 2G41A 3NQEA 1JZ5A 2YB1A 2DZWA 1VIZA 1QI2A 2W54A 1XYLA 2QJGA 1FIQB 3ZVHA 3AI0A 4BI6A 2YR1A 5K9XA 2P1FA 3AHVA 4I8YA 2PUZA 2J78A 4IZGA 1R2TA 1FHLA 1PCKA 4HQVA 3NZQA 2IXUA 2X1IA 2HPMA 4PODA 1A4LA 1V08A 3ZVHB 4LEQA 1WOAA 4WX2A 3NPWA 4TV5A 4TVCA 1S2AA 6ENLA 4O12A 3UXIA 3EMQA 4R7WA 4AHQA 4PCSA 3MKCA 3T6CA 2A3LA 3QOKA 2XM1A 4C6JA 1K7XA 1C9DA 1UWQA 4J56A 4DZHA 3O9NA 4JTJA 1E9IA 3GNNA 1H0IA 2ACUA 6XIAA 4JHZA 5FJOA 5I77A 2DQXA 3G1XA 1JI1A 4BQ3A 4GO9A 2QCFA 4NEVA 3U8GA 1VEPA 3DX5A 4UFKA 2Z7KA 4WJ8A 5LIUX 4W7VA 4HSOA 3BAKA 1JEHA 5HA7A 1JI2A 4YCPA 4AB4A 3Q2DA 2HJPA 4JKKA 3C2VA 3WL0A 1F73A 1HKJA 3HU7A 2DT2A 2PRHA 3DJJA 1YNQA 5MF5A 1ZK7A 5JMUA 4PRWA 1RA5A 3CPGA 2UY4A 4NHVA 4HK6A 1RLCL 2UV8G 1TB3A 3E3HA 3W83A 2HSAA 1K8CA 4Q8WA 1XHGA 2HBXA 4JQ2A 1EX5A 3S6DA 1NOUA 3F1QA 2DT0A 1DWAM 4NJIA 3L4ZA 2W79A 3CZGA 2NXIA 1S5VA 1DNCA 1WX0A 3UJSA 3KS6A 1RP9A 3ARPA 3R89A 3WMSA 3BMWA 1J5TA 3PBVA 3E38A 1DYSA 1Z6KA 3ZR4A 3LS9A 5C9WA 3CL6A 3KE0A 3GG8A 3AXKA 4G8TA 1X7FA 1Z9AA 1UP3A 3N4EA 1YTDA 3LV6A 3HQOA 1ZAJA 3KBNA 5AB3A 4C6IA 3VYLA 1XLCA 5HANA 2BC1A 5I24A 4LFYA 1PL9A 3GXFA 4ZTXA 2BDQA 1B2YA 2FLIA 1EA9C 3AAMA 3C5QA 1XSJA 3BOLA 4K7YA 4EP8C 4R33A 1UD6A 5FCZA 1GKRA 3IGSA 3AIRA 2PLKA 1L6WA 1HG3A 3SCVA 3QGAC 4HTYA 3BWWA 4XD6A 2QQ6A 1DE6A 1AFSA 3NA8A 2GR2A 3B8VA 2E7FA 3VCNA 4ADUA 1G69A 3CGDA 3V18A 5H8PA 1HZYA 3T8QA 1M65A 4MDOA 3AS0A 2P5NA 5A8GA 5LNUA 4UTWC 1X39A 4DUVA 2VCAA 1HJSA 2L5HA 4GVHA 4CUCA 3IJ9A 1UD4A 2F84A 4Z2GA 2TYSA 4TV6A 4OHQA 4LV4A 3CIVA 3KOXA 1VYPX 3KBVA 5AC7A 3LBCA 1O5KA 5CLWA 3T2PA 3WQ5A 1S7MA 3LHZA 2CPUA 5CBIA 1E3XA 1OFOA 4M6PA 4YL2A 2V3GA 4REQA 3RXZA 3EWUA 1EDQA 3ANYA 1YKWA 2D2OA 3QR0A 4UNLA 4C6NA 1G4SA 2OLHA 1UWTA 1GCYA 5DQPA 3NYZA 3USZA 4OT7A 5AY7A 4UCFA 2J66A 3A6OA 1WUFA 5EKYA 1GPWA 1GKQA 1XICA 1HKWA 4BKNA 1MNSA 3GIPA 3SY5A 4ACZB 1GJPA 2FZ9A 4IX0A 4HIBA 4CNNA 4BCEA 3SSJA 1NP0A 4WGXA 1MDRA 3DK4A 2XINA 3OEXA 4NZ5A 3SCRA 3ETRB 4A2RA 1STZA 3I4KA 3N12A 1ZZMA 1NFBA 2Z26A 3QPEA 1K3UA 1ME9A 4ORMA 1KXTA 2FZ8A 2QULA 1BSIA 1HT6A 3BV7A 4I9MA 4CNSA 4UTMA 3TEVA 2VZUA 1NFPA 1C29A 2GJLA 2XIOA 3DCPA 3WFLA 3K4AA 1XLJA 4D1JA 2XPKA 2TRSA 3RU8X 3SFKA 3L4YA 3O0FA 3H26A 3V16A 3IC9A 2RABA 2MANA 3VVGA 3ZLGA 2JEPA 3FGCA 3VCRA 3DHFA 2NQJA 3CLMA 3KS5A 3MCMA 4Q4QA 4A21A 4QISA 4A6GA 4DXKA 4ATLA 1GVRA 3IVTA 4CD6A 3HO8A 4MWAC 3FGCB 2FJUB 2HS6A 2O9TA 3MA8A 5LYRA 5C71A 4BV6A 4TR9A 5H91A 1KBLA 3W7MA 1KC7A 1W9BM 3ZR6A 3ECQA 3MYPA 2FZBA 2Y8UA 2BOEX 4W84A 2OJPA 3LLXA 1K8YA 3G1VA 1DHPA 3PPHA 4G2DA 4HCDA 1FY6A 3G0UA 3W25A 3LHUA 3BMXA 3LU2A 3MUY1 3UXLA 1LL4A 3S5NA 4M6QA 3A3XA 4OV9A 4F9JA 3W2UA 1TTIA 3ARRA 3LCGA 3SSZA 2NZLA 1R46A 3QRHA 1JYNA 4O8RA 2GOKA 3GC2A 2QJJA 3MJYA 1VQZA 3AHZA 1E0TA 4FNUA 3TJIA 3AO0A 4W7WA 1L6SA 4LVGA 1BEUA 1BKHA 5M1TA 3KHJA 1DOSA 5G1MA 3GSMA 1OIFA 2OWWA 3FYYA 4AY7A 1C92A 2ALDA 4DNAA 4V27A 2P53A 3APGA 2J9XA 1B3XA 3R6IA 3F4VA 5I3HA 1YQZA 4JIEA 3EB2A 2PI6A 3V5CA 3BAJA 4KPRA 4J35A 1AK5A 2QUVA 3CUXA 2HK1A 2TPSA 2TAAA 3C8NA 4J3WA 4JL1A 3A22A 1CZ1A 3HBLA 5G1TA 3PG8A 2GDUA 3WH6A 4XKMA 4PTVA 1H62A 2O55A 4IF2A 4LUSA 1WOBA 1H7XA 3SRFA 1VGAA 5CKSA 3DXIA 3SUSA 4CQ9A 1OM0A 3CH9A 3W7PA 2ZYFA 4XIMA 2Z2AA 5FAGA 4MM1A 2DVUA 4LUSB 5I07A 4S2BA 1I60A 1K9FA 3G8RA 6TIMA 3N1AA 3RG6A 2VEPA 1J0ZA 2I9UA 5LSMA 3T05A 4IP5A 1SYTA 4PMRA 2I14A 3L5AA 1L8PA 5F7UA 2ZOXA 1XBXA 5I0DA 1J0KA 2CXGA 2FHFA 4YWOA 2VR2A 1E71M 3FA3A 1JCYA 2GGJA 4NNCA 1Y8BA 5A6SA 4LAKA 4LBRA 4DO4A 4HNVA 3TIMA 4I6KA 4OUIA 2WOVA 2C79A 3MHGA 3WNOA 1AH0A 1IEVA 4RW3A 4KGLA 5K2ZA 4PUEA 3OBAA 2OZ8A 3NUKA 1W1A1 3AZTA 4WKHA 5DXYA 2Z1KA 2C13A 2BY3A 5GJMA 1XCXA 2ISSA 3AIWA 1PZ3A 3E12A 1CLVA 4I9JA 2PP3A 3AICA 3S5OA 1EP1A 1S2CA 2NT0A 4A29A 1VHNA 3R94A 2PRMA 5FD0A 2JGYA 3MO7A 2AMGA 1FWEC 2QMKA 4Y9AA 4HU4A 4BURA 3W7CA 1EHAA 3A13A 3KFTA 2NQZA 1WO2A 4UFMA 2R6OA 3NO3A 4AIUA 1QO2A 3KDOA 3RIKA 2VGIA 4BA0A 4DYKA 5JCNA 2PE4A 3CK5A 3UWQA 3RCMA 1JZ4A 3U5YA 2V67A 1WYGA 2IXVA 1LOSA 1VAHA 5I00A 2VUYA 2X50A 2GQWA 2I5IA 1XGDA 3QTPA 1JUEA 2GGEA 2YQUA 4QS5A 1EYEA 1UPMB 4B5TA 4OBRA 5I23A 4MUZA 2UZ9A 1E6XM 1KRBC 3LYEA 2NWSA 1MZHA 3TQPA 1G0CA 1QWGA 4HNCA 4BWLC 1Q3NA 1GZ1A 5I3GA 1K77A 2HVNA 2I57A 3GX9A 4GISA 4UOQA 3B8DA 3URHA 4X0VA 3ATZA 3S3GA 4GI9A 2RGMA 3DFQA 3M5VA 1NU5A 3BJFA 3VKKA 1AQ0A 1YXCA 5EBUA 4FX7A 1FKXA 4E0CA 2WVSA 3VMPA 2X1UA 3VOJA 4AZ6A 2E28A 1RBLA 3ISIX 4EQRA 2IPFA 1HVQA 3T4CA 4J9JA 1HL2A 3II1A 4KCTA 1W54A 4N9DA 3EDKA 1KQZA 3VZXA 3A12A 1P1XA 2E8ZA 2D2JA 3M1ZA 4V28A 1J0HA 1RSCA 3FA4A 3QMSA 4PTWA 5IHSA 4P7RA 1EJSC 3VD9A 2QDHA 3M43A 4WRHA 4JTTA 1EP2A 3HURA 2P0OA 4W89A 4PCFA 1TPVA 1SMDA 4QE5A 1KGUA 4JOMA 1GVIA 1IYXA 1TV5A 1UUQA 4X61A 5JIPA 4RCXA 1EQCA 1UYQA 3T7VA 3MKKA 3PNUA 3QY8A 2YXXA 3L12A 1RQHA 2JQXA 3CWOX 3DGBA 3G2GA 2V8ZA 1E6RA 3T08A 3PWGA 3EDJA 1DJIA 2R14A 3UD6A 3SQPA 4IHCA 3CTTA 4B15A 3USBA 5FL0A 1KRCC 4B3LA 4F2UA 4DM2A 4JXCA 4W4QA 5EPDA 7A3HA 1B9ZA 4H50A 1V3MA 4HU3A 4EKJA 5C5YA 2JIWA 3VOCA 3SCOA 3V7PA 4GNKB 1G7UA 4DX3A 3TVAA 3EDDA 1F2JA 3IIVA 1XIHA 1MEIA 4KIRA 2J9ZA 2WW5A 4JQ3A 2GR0A 2IW0A 1K7FA 4AD2A 4LNCA 3VGGA 1V79A 1Z44A 4CD8A 2DUZA 4KCVA 3L23A 1VBJA 2Y1HA 5AZ1A 2J4GA 2E1WA 3AMCA 1EA0A 4MZYA 1JAEA 4HPJA 3HJEA 1JROA 5CXPA 4H4ZA 4J57A 5BNKA 1SSDA 1V0MA 3WQOA 1YXDA 3URNA 1WZKA 3NDOA 1EJXC 3FS2A 4H7ZA 4RZ6A 4HA3A 4MKSA 2FIQA 4C5YA 1SJDA 3WN6A 5U7SA 4ERAA 3KZSA 1ZMCA 1EC7A 3W7IA 1R47A 2DUAA 3OODA 4MLJA 3ITCA 5XIMA 3HMJG 3LLFA 3W6LA 4QBXA 3HRDC 2QMJA 2QUUA 4MJMA 4S3KA 1J2BA 1FWDC 2ZA3A 2WNNA 1CGXA 3N4AA 3PZ9A 2D24A 4M52A 4NY2A 2QR6A 3NJ3A 4PMVA 2J6VA 2CHNA 2AL1A 4Y96A 2YVJA 1J6PA 1V3LA 4LVBA 3BOFA 1ZY9A 2PLMA 3O6CA 1A5NC 1GOMA 2ZZ0A 1KFEA 3H2AA 4DN1A 4NKCA 3S0CA 1KLYA 1XLFA 4HA4A 2IQDA 1J18A 3UA3A 3AMKA 1DJNA 3PANA 5L9FA 4HPXA 5FS7A 5A3HA 4CQCA 4JQ1A 2QJNA 2DIKA 3M0HA 4Q7BA 2Y8VA 3TROA 1V4YA 4LAMA 2PDIA 1KRMA 2YA2A 2DH3A 1F3XA 4DWDA 3S4TA 3H21A 1MO9A 3UA4A 5FESA 1M7JA 1Q13A 3WF3A 4ZA0A 3IIOA 1ZALA 5FS8A 5AVNA 4XAZA 4F48A 3TWBA 3UWYA 3DHPA 3ZYZA 4QP0A 3PBYA 2J47A 1BTMA 3F2DA 4D8ZA 2OYMA 3WCZA 1I0DA 4EF8A 3HW2A 5F2LA 4PE8A 1JF6A 5C9RA 3BCDA 2H8XA 3LRKA 4GUIA 2QF8A 1MQRA 3HPZA 3FN9A 3GXNA 5BRPA 5D05A 1CB7B 4EXQA 5K4XA 3R0UA 2HMCA 3WLRA 1IGSA 3DHDA 4IGNA 1RCQA 3TAOA 4UZUA 1OFQA 1RQBA 2VQTA 3BQ5A 3WNMA 4JHOA 5DFAA 2WB5A 1TPFA 3SCTA 1ZHAA 3NQAA 5FEPA 1LDCA 4N2YA 5HNRA 4AAJA 5D30A 3UZZA 3KVKA 2X0SA 2XUCA 5FJRA 3MI6A 4UTIA 1TR1A 4OU1A 4ZB0A 1GVQA 3TN3A 1Y7VA 3UPBA 4NVTA 2Y89A 1SMAA 1JDCA 4H83A 4CCEA 3IGUA 2W27A 1GEHA 4O0KA 1J8VA 1GPFA 4KWUA 2CESA 4XX6A 4KERA 3GDLA 3BDKA 2XFWA 3WDRA 3PG9A 2ZRXA 3ABSA 2PSNA 3PF3A 5A6BD 5LIYX 4P2VA 5TNVA 4C6EA 1O12A 2E8YA 3KCLA 3L2IA 3QHOA 1QDSA 3TR9A 1M1BA 3P2VA 4R27A 1DQUA 3TYUA 3MUXA 3LCXA 1KNWA 1V0KA 4NG3A 3OLDA 2ZTKA 1G6CA 2GZXA 2FQIA 1OIMA 4MB3A 5F1VA 4CNTA 3A9BA 3TYEA 3MC5A 1VLIA 3HGSA 2YA0A 1D8CA 3WEZA 1JYVA 1E9LA 1IHIA 1KFJA 3ONCA 3N2OA 2V3FA 2OLAA 5E6YA 2HNHA 1UBPC 4HK5A 3O2LA 4LCRA 1SW7A 3IJ8A 1SFSA 1B3VA 5DXXA 3HF3A 2NUXA 1OJTA 4US5D 1RR2A 4EQXA 3W29A 4PH6A 2Q02A 2VDHA 2MUCA 4NP7A 1PKMA 2D2HA 2GVGA 4IT1A 3WZ0E 3Q67A 2YDSA 4M0XA 2PF0A 3M0MA 2PDKA 3TYDA 3TJXA 3BPWA 4GZEA 4IIFA 1G94A 1UKPA 1XFCA 4N42A 3QH2A 4Q8PA 3OVPA 4IH3A 3GIQA 5CZJA 2H9AA 2OX4A 1OYAA 2YVFA 3RO8A 3N04A 2WZMA 3F5JA 3ID7A 4WVXA 4W5ZA 1UH4A 1J0IA 4JY8A 5CCZA 4WK9A 2PZNA 3W2JA 3DZ1A 1I2QA 1OG6A 1SQ7A 3FOKA 5CPLA 3NOEA 2CBJA 2ESCA 2H9AB 3NZ1A 2ZRZA 4GVGA 3H12A 4O18A 1V6UA 3NL5A 3OO2A 5LA2A 2BGNE 3EX1A 4A4AA 4Q4RA 3M0LA 3WUGA 3MP3A 1AL8A 4NIRA 3SUTA 3G0XA 4LY4A 1H4PA 1W1TA 2XWDA 3TQ0A 4CU7A 1PTDA 2O7SA 8XIMA 8CGTA 1JDEA 3A47A 3S9YA 1W37A 2VR5A 3LNMA 1FWTA 3GDRA 1I1WA 2D22A 3FCPA 4ZXOA 3UZYA 1XIBA 2A8XA 3N29A 3MZNA 1B3YA 3BLIA 4L6OA 5D2YA 1G4EA 1Q8JA 4Q8NA 4LAUA 1XX1A 4CQBA 3T2QA 4EQWA 3FY1A 1XSIA 3WK1A 1F61A 4HN8A 1JRPA 1AA1B 3U6WA 4RDVA 2GPTA 3ITTA 1UASA 2XH4A 2G37A 1O7AA 4Z2LA 3ATYA 2Z4GA 4G1KA 1UOZA 4XZIA 3PTQA 3W1AA 1KFLA 1FWWA 4IISA 4A22A 1TWWA 1DEDA 4TQTA 3W23A 1TPUA 4WDUA 5G4WA 3KOFA 1JXKA 2P76A 3ZMRA 1CXHA 5REQA 1T96A 4O4WA 4RDWA 3RUBL 1BTCA 1YTKA 5FSDC 4C6CA 1ZAHA 1N2VA 5A95A 4RPQA 1PHQA 4YVVA 4CCCA 5REQB 1E6SM 3WK0A 2CFFA 2CLMA 3NSNA 2NXHA 4LCSA 1HO4A 4M8UA 2X40A 3HIJA 4IGSA 4J5NA 3V5OA 4GYJA 4AC7C 4XZMX 1JDDA 4GC4A 4PTNA 3EOUA 1XIEA 4LCQA 3B05A 4IM4A 3L21A 5CBBA 2ZFAA 3GFYA 1D7KA 1R8LA 1I4NA 5FEXA 4LBUA 1XYBA 5DELA 4JTSA 4CD5A 3O0KA 1IR1A 2I5GA 1VFSA 4P8UA 4L64A 2WXDM 5CSRA 3QC0A 3PZOA 4XAPA 2VJXA 2J62A 3MMDA 3SRKA 2EQ9A 2SFPA 1FDYA 3S46A 1UD5A 1LVLA 1UR9A 6CGTA 1PKNA 4M81A 1O5XA 1E4NA 3U4AA 1AJZA 3QR1A 1XC6A 1DJXA 1LWHA 4BJHA 1W2VA 1VBUA 4L61A 4Q8TA 3PUDA 1FH9A 3O07A 3TUUA 3RR1A 3M5YA 4O16A 4WSHA 1QW9A 3VKAA 2DPEA 3CM4A 3RLGA 3UG5A 3A7UA 1NARA 3BZJA 2X8CA 1TTJA 1JDAA 4N4QA 1TV7A 1GYMA 2J7HA 4PL1A 3U2ZA 5H8MA 1M53A 4PMOA 2E5CA 4V33A 4YYCA 4GKTA 1VR6A 2GYIA 2BC0A 3W7EA 1H60A 4QLJA 2WBGA 3C0SA 2JGQA 3M46A 5HMDA 3RLVA 3QFBA 4HGXA 1B4KA 1V3HA 1FUYA 1NIUA 4DBUA 4U2YA 5I5RA 5C0QA 5C9XA 2J25A 7XIMA 1YXYA 5IBXC 3M0XA 4H00A 3KCJA 2E6FA 4GR1A 3U57A 4DJFD 3PJWA 3TFXA 1QNSA 1YPFA 1OFAA 4HK7A 3RNDA 4IFOA 1WKDA 3B9DA 5JRBA 2XISA 2E5AA 3GW0A 4UB9A 4YHGA 3LGEA 3NGFA 1ZS2A 3A4JA 3GKAA 1GK8A 5K4ZA 4OV4A 3LHWA 3R5EA 4C7DA 5AKQA 4IIGA 4JZ5A 2A0NA 3LB8A 3WF1A 1CXEA 3EWXA 4NJGA 3W81A 4JAWA 3TYBA 4HSNA 5CPMA 3GHRA 1R6WA 4XB3A 4I8DA 3DH7A 3E74A 4ZO7A 5A6MA 4UOZA 2YDQA 3AHXA 1OINA 4JS3A 1PZ1A 1UPPA 3N18A 2EQDA 2X2GA 3M0ZA 2OSXA 4QAIA 1US3A 5A1AA 4WSJA 1K9DA 2BHUA 1GOIA 3VNIA 1MFUA 1VFFA 1FWRA 3T44A 4AD0A 4ZE4A 1CTNA 4OUEA 3UYCA 3AXIA 4BF9A 5E5CA 3GNPA 1XI3A 1EEPA 3EX2A 3KXQA 5ER0A 4AZBA 3PHAA 2IKHA 3PBWA 1TV3A 3M0IA 2AMXA 2QCEA 4OJYA 2XZ9A 2C71A 5CPSA 4LS1A 4NRSA 4M6UA 1R3SA 2Q8XA 3FJ4A 4AZGA 2WP5A 4XD4A 1FBAA 5ABGA 4X60A 5FS6A 4DI8A 2ZRUA 4DYJA 4PMXA 1EHNA 3FLUA 2DEPA 2A5HA 4NZFA 4KFOA 4QJ1A 4MG4A 1DWHM 3KOZA 1DJHA 2J7BA 3WD2A 1EX1A 5IDIA 4P7QA 1KWKA 3RGTA 1E6ZA 2DP3A 5HJYA 2XTKA 2DW7A 3OBKA 1A0CA 2PBOA 4GUJA 3VOIA 2D0HA 5HUPA 1JRBA 2HPIA 3EKZA 2NX9A 5FSEC 2WC3A 2Z6JA 1GTEA 4DWSD 1L9WA 4GHRA 1X6LA 3E96A 3ENLA 3MDWA 2KAUC 2XHYA 4DQWA 3WLSA 1N8WA 3M16A 1DWIM 1ZBCA 1TZ9A 4MY8A 2YCEA 1GVFA 1NF7A 3O05A 3M6YA 5ABFA 2J3NA 4UQAA 1UG6A 4HMCA 1TYPA 3E0WA 3DKLA 4XSMA 3UXDA 2F38A 3E0LA 1DWFM 3QTGA 3IV3A 3UPMA 3CO4A 2OOFA 5ABFB 1UW9A 3WFZA 2VFFA 3KL3A 1X1ZA 4GMEA 4GY0A 1EJTC 1Y0EA 2R8WA 4NQ1A 5KTLA 1GZJA 2BY1A 3AHYA 3GXIA 3I7SA 3JZUA 5K7JA 2NW0A 5I6SA 2DU2A 1GONA 5T8GA 5GNZA 4N6EA 4ENLA 2ZC1A 2QAPA 3NQ8A 4XBKA 1UWUA 3WNKA 2D20A 3BW2A 1GRBA 2DSUA 3F7JA 3M64A 5FEWA 3CQIA 3SRHA 1OF8A 2NXGA 4O50A 3T07A 4YHEA 1C9WA 1S2TA 1TMHA 2A3BA 3OZOA 1CPUA 2BVDA 1EBHA 2BHYA 1N62C 2J7DA 2W3RA 4N02A 4W5UA 1KCKA 1Z7AA 3TQKA 5FEZA 4GK8A 4HA1A 2YZ5A 1GJUA 1R38A 4XISA 1IZJA 3AMDA 4NAFA 2PTXA 3PAOA 3ZR5A 3G6MA 4F0HA 4JIIX 4H4WA 1DXLA 2VUNA 4GYPA 3B0XA 4NAFB 2IUZA 4WSKA 2WQPA 4KMQA 2DZPA 3HOJA 5FS9A 3UCQA 2QCNA 3M0JA 1VBHA 1RBOB 3OBEA 2NX1A 4E4FA 1XIDA 3W71A 1EO7A 1FWAC 4O52A 3QV8A 3R79A 3BLPX 2PCQA 1ITQA 5C2CA 3NO1A 5CG0A 1Q2RA 1FOBA 1RQEA 5LA0A 2YBUA 3INPA 1EZ2A 2WWDA 1ISYA 2ZZ5A 1VJIA 4JDBA 1JGMA 2GSHA 2VP8A 3GS6A 1YNPA 1CGWA 2NV2A 4GC3A 2CZFA 1JXJA 4AIOA 1QK0A 4C7GA 1YHTA 2G4JA 3GE7A 3TE9A 1FHUA 5DX7A 3UZJA 3NQMA 5BXRA 4M6VA 1XDIA 2DORA 3ZXWA 4BEUA 1IZKA 3L0NA 2X1SA 3KUMA 2QKFA 2R1NA 4PYSA 1Z42A 3S47A 3FYOA 4YJ5A 1TJRA 3HJZA 3B4UA 2E4TA 4NT0A 4CN4A 1XRVA 3VIGA 3MDUA 1FDJA 1FFUC 2PEVA 3S1UA 3CGTA 4C65A 3WNLA 4D6IA 3P8JA 2ON3A 3VIMA 4OWGA 1UIPA 4Z17A 1QU4A 5HATA 4XD5A 3PP7A 1R9ZA 4X2RA 1E43A 1P7TA 1TPH1 4JICA 4XZBA 1KBBA 3EKGA 1DTUA 1R85A 3LXCA 3GU2A 3PS7A 1RV8A 1NQ6A 1TRIA 2DT3A 1Q5MA 2ZZ4A 3RPMA 3UGVA 1P7TB 1GRFA 5A69A 2C14A 4G7FA 4HJWA 1LUCA 4JBRA 1UR1A 4JDYA 3IJIA 1JD9A 3UZ5A 3WF2A 3U0HA 3NG3A 5FA5A 1WKEA 2OR2A 1P5BA 4RNJA 3WLMA 4B2DD 3C61A 3VDHA 1MXGA 1HL9A 4TIMA 3NQDA 3SADA 5CQ1A 1LUCB 4WXYA 1IQ8A 1ZU8A 5AYZA 4FNPA 2WHMA 3W07A 4GY7A 2ATMA 3IJ7A 4PMNA 3WLPA 3KBMA 4QQUA 4GG9A 2WQDA 4LWWA 3UG4A 3WMLA 1W0MA 3W01A 5D9MA 5BROA 2YCIX 3FKRA 2OELA 2NQHA 4B5NA 1W17A 3H23A 1XWYA 3TSMA 1QPKA 2RH9A 1Q1RA 2VDIA 2PDFA 4MHBA 2WJZA 1TSIA 1L6GA 4FX8A 3B9NA 2V38A 1LCOA 4YMZA 4TTGA 4E4UA 2O4QA 4S1FA 4I6VA 4HMNA 2Y8KA 1RCXB 2ZE3A 1GORA 1F6KA 2J74A 5A8PA 4YIWA 4IPIA 2PTWA 3HB9A 3EWYA 3NDYA 2RUSA 3DH9A 4PCNA 1RJRA 4LNYA 2CC0A 3N3MA 4NF7A 5G2IA 4G6CA 1HP4A 3N4FA 1F74A 5H6HA 4RPPA 5HK4A 3FHAA 4EM4A 2VEMA 1I1XA 1FWIC 2PDLA 3WDJA 2RDWA 1T5AA 2TODA 3AYSA 3IAQA 2F5ZA 4QSHA 3DK9A 1DIEA 4FMVA 3BAWA 4E8DA 3AROA 4O0QA 2OZTA 2EJ1A 1CDGA 1UJQA 2HISA 1SJCA 2G96A 1ZY8A 3N9SA 5HMFA 4GCXA 2V5CA 2V63A 5A6AA 4XZHA 2W55A 4A8IA 2CERA 3FG2P 1FCBA 1WE5A 4ZTYA 2ZADA 4KQNA 3AMLA 4BS0A 3RM9A 2Z28A 1U5HA 2ZCGA 3MV01 1E1EA 4FXRA 3FSTA 4DYEA 4JEQA 1PEZA 3RM4A 1VFTA 1SGJA 2VO5A 4NYYA 2IS7A 5DMNA 1XYZA 3UNDA 1W9UA 3G8EA 1TPC1 3KP1A 4GH1A 3M7SA 1QASA 1B54A 1KW1A 3BL3A 4GJ1A 2QCHA 1HQTA 3LB0A 1W31A 3KLLA 4UQDA 4JYEA 1CWYA 3N19B 4Z2IA 4U31A 1CCWB 4O0ZA 3UPWA 1AMKA 2D0GA 1XS2A 3KW3A 4JTHA 2PDMA 1UUOA 3CH0A 4AEOA 4AISA 4QNEA 4WEVX 3CL7A 3QHMA 3GC5A 4Y8FA 3W37A 1TRDA 1ZUAX 3VKCA 2PP1A 4RXFA 3T42A 1XQKA 4JIPA 1DP0A 4PEEA 3NVWB 4JD4A 1F3EA 1PPIA 4Z2HA 1H1YA 5BRQA 4DEFA 3UWWA 5AECA 3V0TA 2YX0A 4JX4A 1O1ZA 5LZLA 2BOGX 4JKMA 3E02A 1GZGA 2PURA 3S5ZA 2E5DA 3IEBA 1E56A 1OY0A 2G8ZA 3QHNA 4P8XA 1ZGDA 2V81A 3VOGA 4QFUA 3AXHA 1DIKA 1EOKA 3DG6A 5DY2A 2HZGA 3QKZA 4F0SA 3L4UA 1AVAA 3NM1A 1BGAA 2UY2A 1K70A 2YBTA 3BVJA 3SB0A 2R82A 4AHPA 3B97A 1MRAA 4LS2A 4AQLA 2PDNA 3MUAA 4PL2A 1EDGA 3NGJA 4LS0A 1K6AA 4UR9A 3SCSA 4P8VA 1TIMA 1QBAA 2OGYA 3BGGA 3NQ6A 3PWIA 4IP4A 2XIIA 3UCCA 3DAQA 3LPFA 3IGHX 4LXFA 3QLLA 3MUIA 2V82A 1PZ0A 1NHSA 1T3QC 5C9ZA 2OWCA 3U48A 2EHHA 3AYTA 4HYVA 6PTDA 1MXSA 3H4XA 4C6DA 1EB3A 1KRAC 2QDGA 4NUWA 3E49A 4S2CA 4QEEA 3GTFA 3POCA 2FB3A 3MCOA 2VVNA 3BXWA 1UJPA 4D2JA 4AVNA 1PSCA 4MUPA 5CZTA 1MUCA 3W1UA 1TV2A 4QAWA 4DF0A 3CBWA 3TWAA 4UTTA 5J5RA 2PWHA 1KQYA 2CBVA 5D02A 3UWUA 4N0RA 5HWNA 1H5VA 2E1DA 4YXGA 3W7QA 3BCFA 1KFBA 4M80A 2V6AA 3SCUA 4DJDD 5D9OA 1ZBKA 5EMUA 2I7GA 4H9MA 1LWIA 4E38A 1JCJA 1SZRA 1O5RA 3IIZA 4AXNA 4K3ZA 3TJLA 3AXMA 2D3LA 3WK2A 2C7FA 1KXQA 2J75A 2BOFX 3G1SA 1FH8A 3VM5A 4QG6A 1W8SA 4LRTA 4ZZ9A 2RHGA 4B5UA 1WA3A 3AIBA 1E4MM 2A85A 1IEWA 1ECEA 3KRBA 3GTNA 3W22A 2HVOA 4NXKA 1SFLA 3VDAA 2PU1A 3B3DA 1VCVA 3AUOA 2W6RA 2DSZA 1WDRA 4QLKA 4US5A 4DUWA 1JCTA 1FWNA 2ZX6A 4EWJA 3P14A 3FW6A 2D3NA 3K30A 2NSXA 3EX6A 1M9HA 5KINA 3W1MA 1R9YA 1E0UA 3I6TA 1QFEA 1XG3A 4FOUA 1GQNA 1EIBA 5I3IA 1IT7A 2NLIA 5HDRA 5IFPA 2AAQA 3H4KA 3L68A 2CU0A 1HKVA 3TQVA 1GEUA 1ZSXA 1AODA 1PDYA 1HKIA 4OBTA 2ZRVA 1YMYA 3HQNA 3PBMA 3XINA 4L6HA 1MQPA 3WO8A 4YTQA 2CLPA 1TWIA 3A4WA 1FRBA 5IDZA 5F4WA 4U3CA 5E0KA 3MV11 4QGCA 2QGHA 1AQHA 5DT5A 1N63C 4N9EA 2DUXA 4NRRA 2AAAA 1WXYA 4S3EA 1B4EA 3ZOAA 3VIFA 1XR2A 4EK7A 3WMCA 4XAYA 5JH1A 4UTJA 3AJXA 3ARWA 1XD1A 4PFHA 2ZX9A 3DN5A 4RNIA 5H8UA 1XLIA 1EEXA 3GXDA 1L6FA 4YLWA 2Y2WA 1POKA 4OFCA 4GX9A 5KVIA 3UJRA 2EPOA 4PRRA 4PMYA 4OOZA 3GXPA 3OA3A 1NHPA 3H22A 1MDLA 2Y88A 4OIFA 4AYSA 1ZCOA 1R7OA 4LC8A 1AQMA 3CPUA 1VPYA 1WAWA 1UR4A 2VEFA 4CNOA 2POTA 4S3DA 4K36A 2Y24A 2CITA 4GUGA 4BQ4A 3V5FA 1ADSA 1XBZA 5CGTA 1C7TA 2BNJA 1OFDA 3T0CA 7TIMA 3PSVA 3P80A 3KVJA 3M5XA 3W38A 2G5WA 5BYWA 3P5YA 4IPNB 2ZIDA 2WZTA 4B91A 3UESA 4M5PA 3T0TA 4ZOAA 1RJQA 5C2GA 3VUSA 4PBGA 4E5TA 3K1DA 2OO6A 3CPRA 2OXNA 2PWEA 1A5AA 4GZIA 1WDSA 1DJZA 1W5QA 3DFYA 4LW7A 1UKTA 3M44A 4C6FA 1E9ZB 3B9EA 3O3RA 3W6YA 2X1TA 1H51A 1JAKA 3E2QA 4QG9A 1L2UA 4J3ZA 1A5SA 4IIBA 2ZXBA 1GQIA 3CASA 3EWWA 3W1RA 1MFVA 4G9PA 1HXJA 4AY8A 2JKEA 1LYXA 4GCAA 2XVKA 2WM0A 1ZX9A 2HVMA 1OQFA 2TSYA 3L4WA 4U2ZA 1KM5A 1AD4A 3E1F1 3WH8A 8TIMA 2V3DA 3VXGA 4X22A 2B4GA 3DG3A 1ODUA 2FYMA 4J3XA 2R1KA 4AG0A 1KB3A 4FO4A 1FCUA 3H4WA 3GDMA 1B30A 1AZ1A 3W26A 2PWFA 1A5LC 4BHYA 1G4PA 1M5WA 3R07C 3NIYA 4TX6A 4WDTA 3EOOA 2MNRA 3WLOA 5FF2A 4O17A 1A0DA 1J5SA 4AYGA 3WUBA 3OC4A 3OQEA 4OOUA 2CFYA 3VNYA 4L4MA 3VK5A 3U7BA 3QYQA 2Q3RA 3DEQA 4KETA 3EDEA 3TX9A 2VWSA 1AJ0A 3CHDA 4TU1A 3LTYA 3NM3A 1RD6A 1ZJHA 1H3GA 4ZQNA 4CU8A 3BV4A 2V68A 4NX0A 1C8XA 5F2IA 3GVVA 5HQMA 1M01A 4QXIA 4Y8EA 1DKWA 4XIAA 3FAXA 1UD3A 2PD5A 4W86A 1WZLA 4CU6A 5LIKX 5M17A 3ALGA 1QNOA 1D7YA 1TE6A 3EDFA 2AOSA 4IJCA 4MZ8A 2B7QA 4HSHA 1YPIA 3Q58A 5I2UA 1BWKA 4ILSA 1D3CA 3SN4A 4MF4A 2XGIA 2F7FA 1BWLA 4R7OA 5AYYA 1LBFA 1EP3A 3CUHA 1FH7A 3QFAA 1WDQA 1HF6A 3UBPC 1ICQA 3N6HA 1OB0A 4UMBA 2J7GA 4DBEA 1ZJBA 2YL6A 1F6YA 1SUXA 2DZXA 3LPOA 3GC4A 1E55A 1GT8A 4O15A 2X8HA 1IEIA 4ZCWA 1ONEA 3SY1A 5HQEA 2E25A 1YDOA 4LH8A 1NY1A 1P6WA 3EPMA 3LSCA 3S8HA 5E9XA 1A50A 1QPRA 4UFIA 3NQVA 1SZFA 4MNKA 3R43A 2J27A 3W24A 2VM8A 4ZSUA 1JZ6A 1PYFA 1SU5A 4JTGA 3MVTA 1YBQA 3TTQA 1T99A 3OZPA 3WJZA 3TNOA 4F0MA 1XDLA 5CLTA 3EPOA 1GGOA 1FHDA 3CTLA 1N82A 1YBQB 2X42A 3WBXA 4C6QA 3VM7A 1AW1A 1XUUA 5CC7A 3TCEA 2W62A 4UTFA 4RK8A 3W7LA 3NWRA 1SR9A 2ZUTA 1SR0A 3HG5A 1WKYA 2DT1A 3QXBA 5TBOA 3VIPA 3VFLA 3FSUA 2ACRA 3H24A 4GNJA 3S2MA 1NWTA 4H9ZA 1LWJA 3CAWA 2W5FA 1SO4A 1PKLA 1ZBVA 1W9DM 3P93A 4GIAA 3RN6A 3FXYA 3S1VA 3WLIA 4AF0A 4Q8QA 4L4OA 4Q33A 1OYCA 2WSPA 4MVAA 4HHLA 1Q4NX 2WHLA 4JTKA 1HJQA 4E4PA 2NV1A 3G3DA 2EF9A 1U1JA 5CPOA 1TA3A 3NEVA 4XKYA 2OSWA 3C2YA 3SR7A 2AAMA 1XIIA 5I06A 4AWEA 2JKAA 3DGZA 1U33A 5A6KA 1QW7A 2CIPA 2NSOA 1JDFA 2QXWA 2J13A 4H3DA 5D03A 1V93A 1TA3B 2QGYA 1L2QA 1H5YA 4XKYB 3OU8A 4ACYA 3I6EA 2FGZA 1EO5A 3DG7A 3DC8A 5CH9A 4LF2A 2OKOA 3W2KA 3WG6A 3P0WA 4BF7A 3DJGX 4DF2A 4MJZA 4NZCA 3WSUA 4PUJA 3TSBA 3EA2A 5I09A 4J1OA 1D3HA 4W8LA 2BX7A 3G5EA 1Q6RA 1NWUA 2WP6A 2I56A 4GOAA 5HBFA 4PMUA 4MWAD 3IARA 1QMLA 1V3IA 2WC7A 1QTWA 4EMJA 3CUFA 2YIHA 2OQLA 3CYVA 2WSQA 4HJFA 1A5UA 3HQ1A 3GUWA 4ORIA 3W7HA 3GTIA 4QIUA 3RMEA 3UY7A 4XV0A 3WELA 3WEOA 2CWXA 3LRLA 5FI8A 2CWNA 1LQ2A 1TUFA 1G9HA 2EQ6A 2PS2A 2NX3A 3QGKC 1I45A 2XSBA 3PR2A 4EF9A 5B7YA 5DBUA 1JRCA 1PAMA 3PY2A 1W1VA 4ZOHB 3S2JA 1U22A 1ICSA 3NCOA 3TAKA 4JCLA 4QM1A 1ML1A 4ROQA 4J27A 4Z2JA 2PTZA 3B8UA 1GW9A 5EB8A 5B7ZA 3GWQA 1LP6A 1VIWA 3AOFA 3KEHA 1WQ5A 5HULA 3PJUA 3QV7A 1V6YA 4HTBA 2J6XA 3G24A 2AGTA 1HTIA 3FDKA 3CQHA 3TC7A 3PZGA 1SM9A 5G1YA 3DFPA 1PDZA 2VX7A 2WMHA 4F2TA 1EQPA 3BLFA 1DWGM 1NAL1 4FOKA 1OABA 1OT2A 3DYPA 1MRQA 3DC0A 2VOTA 1J93A 1AZ2A 1WYIA 1LRNA 3RX3A 4WXZA 2A7NA 4H9XA 2UBPC 3SECA 1BYDA 3O0HA 3CB3A 4Q8MA 1TWZA 2QLYA 4HCLA 4Y2WA 3RCNA 3L4XA 4HHMA 1T41A 1XYMA 3C2RA 2NQ5A 1ZQ5A 3LERA 2E40A 4PUDA 1MO0A 4FLRA 4DNMA 3I68A 4UFLA 1GREA 2GK1A 4Y9MA 3LX9A 2OWXA 4ECLA 4LVDA 4NJJA 4AWSA 3CUGA 1JPIA 1O6IA 4GGHA 3SO7A 2GJRA 3IVSA 4OECA 2GK1B 1T40A 2R91A 2ZZ2A 1EWEA 2ALRA 3H2CA 2OOGA 2FPTA 4PEKA 2ZRWA 1N5WC 2WSRA 4D8LA 4FF7A 1TCMA 3FA5A 4RW5A 5BCAA 3THCA 2WLZA 3MSGA 2FHCA 3VKJA 3VUPA 5EU9A 1PIGA 1US0A 3A3HA 1L8NA 3V36A 3SJ3A 3R7MA 2OT0A 3DK8A 4QR6A 1Y65A 1F3WA 3S42A 5AC5A 4HD5A 5CPNA 3TDFA 4BR1A 3BLLA 3LNPA 1BZLA 2EG7A 3SN0A 3L2LA 1YE4A 3I3EA 2PC4A 3E0VA 1KGWA 3CUIA 3AIVA 4IQEA 4KEMA 2PTYA 5ABEA 2F6KA 1NJJA 2P3ZA 4MYXA 1S46A 1UKQA 2B31A 2X1RA 3C52A 2ZXDA 1N8FA 4GI8A 1OADA 2EXOA 1A0EA 1H7NA 4Q3MA 2ZVRA 1A4MA 3W1TA 1V02E 4ROPA 1ME8A 4UMCA 4DLMA 1NQKA 3O7UA 4JPGA 2WNZA 1R3TA 3LPPA 1F4HA 4GGBA 4H4VA 3UCDA 4LIIA 1VPQA 3TOYA 1QHZA 4LUIA 2A3AA 1VFUA 1QPOA 3HMCA 3IK2A 4O53A 3HPXA 4ZENA 3T81A 3RJYA 3N25A 3GK0A 2VEGA 1PX3A 4IJRA 2PZ0A 1FEAA 4E8GA 3OVGA 1P43A 4IXHA 3VMOA 1KFCA 1HW6A 1F07A 4XO7A 1VKFA 5RUBA 4DIAA 1M04A 1JIBA 2VWTA 4C7FA 1UCWA 2Y0FA 3SUWA 1K4QA 3V4BA 3N6QA 1MXDA 3IUIA 1MZRA 4MAVA 2DV0A 3BICA 4RUBA 4J7RA 3GVGA 2G3MA 4UCGA 1W1PA 3LZ3A 1JL8A 3W28A 1OEPA 2GJXA 1XRTA 1JPDX 3A9IA 4PC8A 3UNTA 4KWVA 3CGBA 1D9EA 1Q6QA 3OIXA 2A21A 3VNDA 2QZRA 1E4LA 2J77A 3GBDA 2Q8ZA 2WVUA 2ZBTA 2GJXB 4DJEC 3CIXA 4FSAA 3B0VC 3TK7A 3GD3A 1AG1O 2E9BA 5JCMA 4DXXA 3TR2A 1Q45A 1VJZA 3AM9A 1XV8A 1C91A 2FFCA 2VKZG 3TSDA 1C3FA 3VZZA 3DOPA 4XZWA 2GR3A 3KX6A 3LQLA 3FVDA 2QYGA 1XC4A 3MP5A 4BY3A 1JFHA 2OEJA 1KGXA 3LA4A 1OJXA 3AUJA 4JFSA 4GH3A 4IMEA 4QCFA 4XO6A 3VGEA 4R85A 3ARUA 2ISWA 3FNDA 2ZVIA 2D1ZA 4OKDA 3KTCA 1Q66A 2OZ0A 4I5UA 3L9CA 3NR0A 4D6HA 1ESWA 4IMDA 3IJLA 2VRJA 5D8ZA 5DCEA 3MWAA 4PFMA 5MHBA 4JIQA 2O9PA 5F2MA 3ALFA 2NUYA 4DBSA 5ECVA 1UBSA 1XLBA 4L9YA 1OSEA 1MNZA 2AKMA 2CNCA 3CXOA 5DCDA 4KEUA 1OD0A 1HJWA 2Z1SA 1V02A 5LGXA 4NJKA 4MIMA 4JY9A 1LTDA 3HGJA 1AUSL 1CXIA 1B3WA 1EOMA 4Q4KA 2QV4A 1I6NA 1VF8A 2PP0A 1A3WA 3DENA 4I5XA 4DLFA 3FJNA 1IXPA 4H4YA 4JDRA 3AIUA 2WAGA 4EIVA 5HR6A 2PF8A 1ZL1A 4I90A 4ACZA 2GJPA 2PGRA 3WH7A 4OTKA 3BUVA 5CG7A 4DXVA 1GRGA 1I2NA 4MB1A 2HDJA 3DIPA 2PLCA 3PVFA 2NVCA 3NQGA 2BG5A 3GD4A 2AQWA 5L6UA 2PDUA 3E0FA 1J0YA 2XJ7A 1E1CA 3CAVA 1EKOA 3VNKA 3VA8A 2VXNA 2XH0A 4GFSA 1N8IA 1W3LA 3G1FA 3W1LA 3VIIA 4MPQA 2POZA 3CU2A 4J3SA 1M6JA 3OB8A 4YYFA 4FA3A 3UXKA 1LZOA 1HJXA 1E1CB 2OSYA 2A1YA 3OPSA 4XTIA 1TV8A 4JX6A 2IKIA 2O56A 1CX9A 3H2FA 4O14A 1TUXA 1J2WA 1TE1A 5HUOA 4UIOA 5JQ9A 3A24A 1DIOA 1CEOA 4GACA 3SUVA 1KCZA 4E2VA 2PRLA 3THAA 4KF1A 3PTKA 1OHLA 1TPEA 1VPXA 3QGVA 1OFBA 4G5DA 3TZNA 4C1KA 2WCGA 3H6OA 4PZVA 3ZT5A 2E6YA 1K9TA 3WQGA 3P5ZA 4H7VA 3PBGA 1SJBA 2XIQA 4H4PA 2O9OA 3VNMA 4DJDA 2GH5A 2ZDRA 2ACQA 1KM2A 2CBUA 1OD8A 1AJ2A 2WZEA 2QJIA 1JPMA 2DVXA 5E0FA 3L65A 1EXPA 4LYPA 4Q32A 3U2EA 4F4RA 4YVPA 4WKFA 4WF7A 2OPJA 2OU4A 1OFEA 2YYTA 5D9NA 1VJSA 3I3DA 3EA3A 2XGZA 1I8JA 3P61A 4H2HA 3BURA 1YLVA 2YLAA 2R9ZA 1CNVA 3UERA 2J8GA 2X16A 3UP8A 2CKSA 4TOQA 1GOXA 3FYPA 3KL0A 4HMEA 7REQA 3AJ7A 1LORA 3ZT7A 3UQNA 1BXCA 4KEZA 3NQ2A 4IWWA 1TCDA 3E5PA 7REQB 1TWSA 5CPTA 4HZ7A 3U2OA 2IPWA 2DQWA 4DNHA 1GXFA 2XH7A 1BAGA 2PD9A 1V03A 3C86A 3OTRA 1DPMA 1ZP4A 4TVYA 4UR8A 5FIPA 1KV8A 1R7AA 3AS2A 5HQLA 2PDXA 3NFUA 4J3TA 2CLHA 2VQUA 2CZEA 2E6AA 3N2CA 3CEPA 5MKGA 1R0MA 3DFNA 2UWFA 3S2LA 3IANA 1MI3A 5G5HB 3S6OA 5FJTA 3BSMA 1ITCA 3CJPA 2Q71A 3C2FA 1XHCA 4GIRA 4DB7A 4UQCA 5MKGB 2W63A 3DHUA 3GQYA 1GHRA 2PWUA 3C4UA 1XH0A 4RNFA 1YNYA 4AU0A 1OGSA 4GNVA 3D3FA 4WKAA 5DY3A 5A94A 1X1OA 1I2OA 2DJXA 1IWPA 2XN1A 3C8FA 2ISVA 1GOKA 5BW6A 3QV6A 3RX4A 5BU6A 3GZAA 3QC3A 4MAZA 1MOKA 2YL9A 5I78A 2D73A 3N6JA 3BAYA 3LG3A 1DHKA 5JCLA 2WO5A 2F2KA 3IGXA 3MVIA 3MMUA 3K4WA 5A8QA 3EGJA 2NT1A 3J7HA 4OZOA 3LCIA 4W8BA 5T9BG 1ITXA 2ISFA 5LXEA 3KTXA 4Y90A 1WZMA 3NVTA 4D9PA 3HGOA 1OK4A 4H7CA 5AC4A 4S3CA 9RUBA 2GGGA 1QCWA 3TW7A 1E72M 1XF0A 4UQBA 3B8WA 2WMGA 3LMYA 1CLKA 5KETA 3JZEA 4QE1A 4FX9A 4RE3A 3MZ2A 1KTBA 2JALA 2FH6A 3IV8A 3RDKA 3H7UA 4CEUC 4FZIA 3CLWA 4HNTA 2GVEA 3SCWA 1YYAA 2HTMA 2QEZA 2JF7A 3F5LA 3N2TA 3TMQA 4IIEA 3RO6A 4U5KA 2ZC8A 2QPUA 3UZWA 4H8UA 2WOWA 4UNIA 2CLLA 3EMCA 5AHEA 1X6NA 1P48A 4DBWA 1QWKA 4KCWA 1FFQA 3W3OA 2KX9A 3H7RA 4CCZA 3WLKX 3K46A 5D32A 3RMJA 4HA0A 5G4EA 2WJDA 3MO4A 1DJQA 2FDMA 3QPYA 1XLAA 2RFGA 4NEWA 1CXKA 3VE9A 2GUUA 4CGTA 3QEZA 2P8CA 2BP1A 3ZFHA 3C56A 2ODOA 2VZOA 3ICJA 3VD7A 1GYNA 2F2HA 3PZQA 3K13A 3WH5A 1KM4A 1O95A 4KIEA 1VENA 5IM51 1EGMA 1DWJM 3F5KA 1ODZA 1TPDA 3N17A 3VMNA 2VGFA 1J12A 1QVBA 1OGBA 2HXTA 4QQ3A 4I7VA 1VBRA 3LENA 4HP5A 3WQDA 3P60A 3OA5A 2D69A 1PYMA 4PMZA 2WPFA 3ARYA 3BG9A 4YTTA 1XL9A 3AMZA 1CBGA 3REQA 1LG1A 1TO3A 4JTFA 4PA8A 3WLQA 3NS1B 4ZFCA 4L9XA 3A5VA 5LNWA 1XKJA 1SW3A 2X0HA 4Z08A 1B0IA 1J9YA 4DI9A 3WJWA 5G5IA 3LM7A 4F0LA 3REQB 3BW4A 5HMEA 3CWNA 3EWZA 2A7PA 3S1GA 3VGFA 1CGVA 4Y7EA 3SJNA 1QNRA 1LRQA 4HHHA 4LAOA 2B7NA 8A3HA 3VC5A 2XU2A 2PDQA 2A6NA 2DY3A 1H61A 3U3HA 1ZJIA 2WBAA 1SZNA 3ZS4A 5A6JA 1DV7A 1UKSA 2VENA 3P82A 3Q4DA 4XAGA 5G2HA 3VPLA 1K8XA 1NDAA 1UC5A 1VYRA 3IRDA 1SB3B 3NQ7A 3W7OA 3O6YX 2GGHA 4ICNA 4PMJA 4AMAA 3CNYA 3AFBA 4WQ6A 2O7QA 2P3EA 3T09A 1RHCA 3MBFA 1EIXA 1XANA 3I65A 2XZ7A 3SEPA 3F2CA 3H54A 5TQLA 4ZOCA 1GQKA 3EZ4A 1ALDA 2XFFA 1B1YA 3EX3A 3VIJA 1MYRA 1DXIA 1YX1A 5AC8A 1TV4A 1ZXIC 4NILA 2PODA 1WDWA 3DGHA 2XVGA 4HU0A 1F05A 3W86A 3LN3A 1F76A 4H6KA 3MTWA 1MEWA 1SSGA 2BVTA 3NEHA 4WY0A 2HQAA 1CIUA 1KV5A 4P7OA 4PB5A 4QDWA 3QY6A 1P6CA 3NZGA 1DTNA 4WY0B 4Z1BA 3FAWA 4PSRA 2JE8A 2BWGA 1I2RA 3F4WA 3EOSA 4FOJA 4GYFA 3GY1A 1A5OC 4YU1A 3QOMA 4O1AA 3C2EA 3STCA 3W84A 4GINA 4JYFA 5U4NA 5EMJA 5K9DA 1ZLPA 2AGKA 2IMRA 1LL7A 3GR8A 4F79A 1JYXA 2ZICA 1CGUA 1ITUA 3AS3A 1BRLA 3SGGA 2YA1A 4MWAE 2I17A 2H8ZA 2XDFA 1RH9A 5C55A 3QMTA 2X0YA 4HNNA 4B92A 1N61C 1EF2A 6TAAA 1XGZA 4EXBA 4GKLA 4UTWA 4BF5A 1BRLB 2CHOA 3F4CA 3NAVA 4ZOBA 2BHZA 1R3RA 1YPXA 1HX0A 4S38A 2RDXA 3B0UX 4YTRA 3ELFA 1B9BA 1NDZA 1UP0A 1W5NA 4K6AA 2GJNA 4A05A 5LNVA 1I2PA 2HK0A 4B90A 3MANA 4AIBA 2WCSA 1VZWA 4YWIA 1Y5VA 3TC3A 2GSJA 2BASA 3WQ4A 1V77A 1ZFJA 1HKKA 3MI3A 4XG1A 5T91A 4GQ0A 2D2GA 3BW3A 3RLUA 3GXMA 1HO1A 4LOCA 1TWDA 1RP8A 3NXLA 3AU2A 1RUSA 3ABZA 3LV5A 4H19A 3ABRA 2D23A 1W1IE 1OC6A 2CW6A 4J3VA 5HMSA 2ZX7A 1YE6A 5I3KA 1CYGA 3R12A 5D9PA 1N55A 4PBFA 1WBJA 1W56A 3VNLA 3I10A 2E9LA 1W9VA 1XDJA 4P8WA 4J3UA 1H2IA 1K4HA 2WNWA 5D37A 2VFGA 4FXFA 1TMQA 2I1OA 3WQ6A 2Y85A 4FIRA 1K1DA 3TTOA 1JNEA 3GAYA 3NO5A 4IFKA 2HBVA 1THFD 1O94A 2ZTJA 4H6QA 2FZDA 2GGIA 3RHGA 4IFKB 3ZO9A 5DO8A 1MW2A 5E6ZA 1XRSA 3LSBA 3TLQA 3RM8A 3WQCA 2YL8A 2VTFA 1TQJA 4ERIA 2PDWA 4YNGA 1KWGA 3WYZA 5LNSA 3ABXA 1KA9F 4JFWA 5TF0A 3KLJA 8RUCA 4O1DA 1E0WA 1TX0A 1EJWC 1JEZA 1P0KA 3WJSA 2YXOA 2WSKA 4D8AA 1NWRA 4LC6A 1XSKA 1XINA 2HV5A 1EGZA 4MWAA 3WL1A 7ODCA 3B40A 3KRUA 2PDPA 3LXAA 1GG1A 4PRTA 2IQ0A 2W9MA 4ZOEA 3H2EA 4QEHA 3XIMA 1FXQA 4MWAB 4J40A 4HNOA 1UD2A 3M07A 4Z1AA 4M56A 1RPXA 3GVWA 1LT8A 2ZUMA 3GVRA 5AHNA 3P81A 2PC8A 5HPCA 1X2GA 1HNYA 2F6XA 2V2DA 2EQ7A 5A2CA 3GH5A 3CMJA 4CQAA 1J01A 1QI5A 1XYAA 4CN6A 5JBDA 2DH2A 1TQXA 1PIIA 2ZE0A 3LTPA 3FDGA 4AD5A 2CEQA 2ZUUA 3GDBA 3ITLA 4PB4A 4B3ZA 4Q6JA 3AXXA 2VC9A 1QBBA 5I03A 3QQWA 2EKGA 3C6CA 4X9YA 5AN7A 3PWAA 3NSXA 2REQA 3VGBA 3PZMA 4DBDA 4MADA 1TVPA 1LM1A 1EF3A 4H6RA 5AHMA 4AIEA 2G50A 2INEA 4RE4A 4WJEA 2QIWA 5EMMA 3W1QA 1JPKA 2PWGA 1MEHA 3WK3A 2QUNA 2REQB 4KW2A 1ZMDA 2GDQA 2ICSA 3QJAA 2C19A 2C0HA 1LLOA 5KITA 1B31A 1V7YA 1JZ3A 1X2HA 3E6EA 3ARTA 2WMJA 4LYQA 4KFNA 1WV2A 1O60A 4FLQA 2ZA1A 3SI9A 1EL3A 2BY0A 3NYDA 5FKYA 1I75A 4HHPA 1O68A 3P67A 4HU8A 3OVQA 5FACA 1D2KA 2FMOA 4DZIA 4JNMA 3L5LA 1FP8A 3S1WA 3G22A 1XIFA 3BSGA 3VE7A 3G6LA 4IIDA 2VX5A 1X8FA 4L4LA 4H8VA 1S2VA 2CYGA 3H2MA 4PULA 4GZJA 2OB3A 4JFVA 4H8NA 2E3TA 1PJ9A 3BSHA 3I3BA 3WLJA 2GOUA 4LY8A 3MUZ1 4NU7A 1QHPA 3ZJ7A 4DPQA 2A6LA 3ARXA 3EWDA 1XUZA 4LT9A 4X9SA 4YTSA 3TONA 4XTDA 4ADTA 2CKRA 1EUNA 3NDZA 3WIJA 2OTDA 5AHFA 4MFDA 1CGTA 2JKPA 4MOZA 3THQA 1M6IA 1ONWA 1TMLA 3PPCA 3EAUA 2QDDA 3EB4A 1WZAA 4GQRA 1R2SA 4KH2A 1C90A 4E6MA 5FOOA 1E1FA 4UUIA 1GOWA 1IWAA 1FFVC 3DI0A 5LKYA 1OG0A 4W87A 1JUKA 2VC6A 4WCJA 3SCPA 1W32A 4FNTA 4XVDA 3B8SA 5E9AA 3VX0A 3BANA 3TU9A 3O6DA 4EWND 4JN7A 3BAIA 1SFTA 3MSDA 4IGHA 3AIEA 3HG4A 4C91A 9CGTA 2R24A 3R0KA 4DUXA 4ZO8A 3SAZA 3M7WA 2BZNA 3E5BA 1EJVC 1KO0A 3PZTA 1KKRA 1UQZA 3N2XA 2PWDA 4A35A 3UETA 1VS1A 1HJVA 1UKOA 2OYKA 1GQLA 4XAFA 1BF6A 1R86A 2PTDA 4V2XA 4UFJA 7ENLA 1QNVA 3KWSA 4EPBC 1C8QA 1FWFC 3P3BA 1XJBA 4AVFA 2RDUA 4NXSA 4JTRA 2WJFA 3BJTA 4MZ1A 2WPCA 3A64A 2WPEA 4W9TA 3LD5A 4NI8A 4JHMA 2NV9A 4QHRA 3AYVA 4IICA 1JVNA 1W6TA 5CSUA 1G67A 1BYBA 3H2OA 4NX5A 1AW5A 4O1FA 4N9BA 2EPMX 4Z0SA 1REQA 5CJNA 4BWLA 3UFYA 3OOQA 3OHMB 4QITA 3JRKA 5K9CA 3LDVA 4A2SA 4IGMA 1REQB 4TVWA 1XW8A 4ICMA 1E3ZA 1K4GA 1X8CA 1JCLA 3MY9A 2P88A 3W7KA 4PR4A 2JEQA 1V6WA 2J9YA 1H1NA 3NRZB 3ARVA 2E67A 2A3CA 1NFGA 2FFIA 3R8RA 3QBUA 2ANUA 1EPXA 5JBEA 1PX8A 4M29A 5JVLA 1CXFA 2XH2A 3VDBA 3HGRA 3L8KA 4FDCB 3CUJA 3PC0A 1FWHC 4AZCA 3B0PA 2X7VA 4XVEA 1IT0A 4X3ZA 1J0JA 2YW3A 3V35A 1ADDA 3EEZA 1XLKA 1GRHA 3GNXA 4UTUA 1AH3A 1Q1WA 2WYSA 4MLRA 3KVMA 5LHEA 3QF0A 2OYLA 4AZCB 1WBHA 3F2BA 1ZJAA 1BQGA 4Y6GA 4Q7IA 1A49A 2ZZ1A 3MP4A 5JU6A 2WZIA 5IOBA 1EPVA 1UWIA 3JU2A 3OIHA 1U5VA 3SRDA 5D09A 3WQPA 4R34A 4DAFA 3PAJA 3D0CA 3L0KA 4K7ZA 1UWAA 3JS3A 4JTQA 3IVUA 4B5SA 4GPNA 1KM0A 1A3HA 4JR5A 1XLEA 2BY2A 2V9DA 3O63A 1Q6GA 3TN6A 3JR2A 2VFEA 4IJBA 1ENUA 1UR0A 3I7QA 2VR4A 2RGLA 1BKSA 3VX1A 4HZMA 1E6QM 4YCOA 4NL1A 3UF9A 1V3JA 5GQBA 1VC4A 3HV8A 3W2NA 3BCJA 3BGAA 4EPEC 1SO3A 3QFWA 3EOLA 2HNEA 3BLEA 2CLOA 2CHRA 2XIBA 5H1WA 5D04C 4REQB 1S2UA 3MMTA 2GLKA 3LEPA 3TKFA 3TCSA 3LCLA 4FEZA 1EC8A 1VLWA 1HGWA 5DMMA 4PUNA 2DSVA 2EPLX 3CQKA 2ZDSA 4HOWA 2CZDA 4OVXA 1KLZA 4CLMA 2A4AA 3LM3A 1Z89A 3P7YA 1X98A 4H4XA 4XQ6A 3NOYA 2VCBA 3CMFA 1S38A 4LYRA 3GLCA 4ZVJA 4JN6A 4CD7A 1QXLA 4JTAA 4F66A 4GJJA 1ICPA 2HS8A 1KM3A 4EE9A 1Q7ZA 3SUUA 4RV8A 1UIOA 1UROA 3QR3A 3W02A 4ADWA 3MW7A 2QCLA 2WOIA 4AXKA 4W7UA 1HL8A 1GESA 4ERGA 2X41A 1QT1A 4MNMA 3WD1A 4MPKA 1WDDA 4GQQA 1OCNA 1V5XA 1R2RA 4B5XA 3GG1A 1Z3NA 3EKLA 5HXMA 3H7VA 3WEMA 3MKVA 2Y5SA 3PULA 3OG3A 4RKAA 4Q4SA 3L0GA 3AS1A 1LROA 4ADSA 6XIMA 3CZKA 4X2PA 4AHOA 4M24A 4INFA 8XIAA 2OQHA 2YXGA 2Y61A 2I5QA 4H4UA 3VNZA 4S23A 1M3UA 5CGQA 4H1ZA 2YDRA 3FFSA 1ZB5A 2VI0A 3LBOA 1M41A 3FK4A 5I79A 3STEA 3PB0A 3LI1A 4AUBA 3TZFA 3UWZA 2GVLA 3WENA 5JCIA 5I3JA 1ISWA 1PWLA 3PN8A 1JQXA 3WD0A 1K9EA 3FJ6A 4E8CA 1SZGA 2INZA 4O10A 3KL5A 5A8NA 1P6BA 4AMCA 4HZ6A 1IXNA 1X38A 4L6DA 4OQVA 4NZJA 2XN0A 2KZHA 1RY0A 3K8KA 3SY8A 2WK2A 1IR2A 4GUFA 4ZGYA 1ZDLA 3MQTA 1IV8A 4FLSA 1BVNP 1JF5A 1CECA 3VC6A 1R30A 3AIQA 1Y5XA 2R1PA 1LOQA 4EANA 3UR8A 3PJTA 3M6DA 3W7JA 3ONBA 4ONVA 1PZ2A 2C15A 1MSSA 3WX7A 1WUEA 4K2SA 1EUAA 5C9UA 1PHWA 4PTXA 5BU9A 1RAKA 4OGZA 3PSWA 4LU0A 4O4VA 3N73A 1GVYA 3QW4B 3W72A 1KM1A 5CBJA 3QVQA 4MKNA 3PPGA 1P4CA 3EXRA 1LRTA 1PS9A 2BCPA 3QPZA 3DFSA 1VFOA 2BS9A 4IP7A 4A3UA 4JNYA 1GOQA 2BV9A 5BRBA 2H90A 2DW6A 2V5KA 1E6PA 4FF5A 3UZXA 2FGBA 1XH1A 5CC3A 3RR4A 1NSJA 1FWJC 4K37A 1Q7QA 4OBSA 4K8HA 3GH7A 4EACA 4TX9A 4KCUA 4WDXA 2ZX5A 2HE5A 1XG4A 1IT8A 3OJGA 1XIMA 5AYXA 3OGSA 3U5UA 3DDMA 1BGGA 1J11A 1Q6CA 4QE4A 5XINA 1VB9A 4JTIA 4NNBA 3O15A 4I7UA 4ALDA 3THUA 2JF6A 1XLLA 5SWUA 2DZBA 3CMGA 4MTVA 5D2XA 4H41A 3MS8A 3TTYA 3CGCA 2QUTA 4UOJA 1S5TA 5FJPA 3WDHA 4P7LA 1Y5WA 4ZFMA 2EG6A 3T78A 2FJKA 4E3VA 3W6MA 1HN1A 1TJ0A 4EQSA 1GUVA 3G1DA 2Z00A 2A7RA 2Y7GA 1AW2A 5DRIA 1UH3A 2V5JA 2WHJA 3AALA 4H9VA 3ABQA 2A3EA 5BXSA 3OGVA 6REQA 4ZB5A 5JCKA 2PPGA 2ZUSA 4A8RA 1Q4WA 4S3JA 2V5DA 3A7AA 6REQB 2YB4A 3WF4A 3ITOA 5EL1A 1WNOA 4F0RA 4ZBCA 5E1QA 5A6LA 5TAOA 4YTUA 2TPRA 2Y6ZA 2WSYA 2X7WA 3PJXA 1UB3A 4DO7A 4HB7A 1F4AA 4PBEA 3WH9A 3M41A 3QQ0A 2OT1A 4JGDA 3AWOA 4GQBA 3QYSA 2E09A 1G7VA 4U28A 4S39A 3SGZA 1W3KA 1VQTA 1KR0A 4MKVA 1UQYA 1LG2A 4IQJA 4FHAA 4IL2A 1TTPA 5HOSA 3M0YA 2F6UA 1C8YA 3ERPA 2Z7GA 4IFRA 2HRWA 5GJPA 1DL3A 1T6MA 3CO8A 3NPUA 1EXBA 1XPGA 5IRPA 5AOUA 4K8EA 2E5BA 5I3DA 2NWRA 3RFAA 1FWGC 1GJWA 3FKKA 2QHAA 1FEBA 1R3YA 3PPFA 3SDOA 5KMYA 3VCCA 1VRXA 4X0NA 4ZE5A 4GQGA 2V3EA 4ZMGA 2B7PA 3A21A 1U30A 1JPHA 1GW1A 5JH2A 2C3DA 4LTSA 4P7NA 2E77A 2Q8LA 4L56A 1OYBA 3HZ3A 4CQ8A 2Y62A 3QFEA 1KN0A 1IF2A 3SQMA 1LT7A 3D5HA 3EWBX 4QRNA 3HA1A 1L6YA 2ACSA 3MHUA 3QY7A 4I7WA 2GQ3A 2P10A 4RV3A 4Q6XA 3GYEA 3LPGA 3L4TA 2QNEA 1PTGA 2YCKX 1VCFA 2BBFA 3WUEA 4XZNX 2HCVA 1E0VA 1TIWA 2ZUVA 3IK4A 4PUUA 2EGZA 3ABOA 4V15A 1Q6FA 4NASA 1S5WA 1Z48A 1PE1A 4LQ1A 3NL2A 3NPXA 4RLIA 2QW5A 3KRZA 4IPPA 1C93A 1AL7A 3TV8A 2G3NA 3OVRA 3VNJA 2DIEA 3RAOA 1UR8A 3G0SA 5KZEA 1DJGA 5TR3A 2Z1XA 2YPIA 3WQWA 4KWOA 1H49A 1ECQA 1ZTVA 4H9YA 3R58A 4UC5A 3VD3A 3W75A 4AD3A 3MSRA 1BWCA 1JCMP 1BF2A 4GO8A 4HZ8A 2PMQA 3WY1A 3WJYA 2C3CA 4JQ9A 4BI5A 1T8XA 1BQCA 4O54A 4FXJA 3MWCA 3ZSSA 1VHCA 2J7EA 4GXMA 1KCXA 2PAJA 4NJHA 1JZ8A 1HKMA 4HOXA 1RXOB 4TX8A 3NPVA 3HM7A 4R7JA 1KBKA 1ZAIA 4LB3A 3GFZA 1DXFA 3F4DA 3MUCA 2C3ZA 1X97A 2PBGA 1ISZA 3S9IA 3URAA 3WLNA 3APTA 2OVLA 3SN1A 3UGRA 2OG9A 2VYOA 5CGMA 2R1LA 1JYWA 1OFRA 5A6TC 4HNUA 1MW0A 2PDHA 2CBIA 4A8LA 1T7LA 3B03A 1LOLA 1JOAA 2Y70A 4M7SA 1U1UA 5ECUA 4E3TA 3FXGA 4H9UA 1DBTA 1GVSA 4DO5A 3GG7A 4ATDA 4UMAA 4JTUA 3GNDA 3T40A 1XKYA 2RKXA 1P0EA 5DEZA 4O19A 2WKGA 1NOWA 4B4FA 2NVKX 3H55A 7TAAA 5FF7A 3MJMA 3ZLFA 1YDNA 3L5MA 4L5ZA 1NOFA 1JGIA 3P0XA 2ZQ0A 1Q2SA 4G56A 2ZKMX 2J88A 2F8QA 4WUIA 4IG2A 4L80A 3ZJ8A 3SQLA 2WKJA 1ONFA 3L67A 1LL6A 4G7EA 1CI1A 4W8AA 3GUGA 1JUBA 3WQEA 5IBXA 3LQGA 3A4AA 4IG2B 3URQA 3HN3A 1O5QA 2Z2BA 5AYIA 4G7EB 1E70M 1XCFA 4DELA 2BXYA 2XG9A 3MI2A 4DZAA 3H8AA 2YVGA 2QPSA 4HPHA 2WM1A 1G5AA 4LPCA 1J4EA 2ZUNA 2YGYA 2E6DA 3CEUA 1SW0A 2WNQA 4FXSA 4CVWA 4Q8VA 3K1GA 3E2SA 1XIJA 3TYZA 4HMDA 1BXNA 4UWMA 4ZQMA 1TPWA 1O1HA 1XGEA 2H3BA 2IPGA 3HG3A 4TVUA 2YSWA 4Q22A 3PFMA 3OYZA 3M9YA 4UR7A 4EMIA 1A53A 1EBGA 3FX4A 4CQDA 2JFEX 1W3NA 1TJPA 2VZTA 4B16A 4H4IA 4U3AA 3LADA 4H4QA 4C60A 4RL3A 5BXPA 4WHBA 4LANA 4O8AA 1TKKA 3PFRA 2GRTA 4JEJA 2H6RA 4JX5A 2DGAA 4DF1A 3T9PA 1FDZA 4GUHA 1PB0A 4MFEA 4APNA 4TMBA 3LI0A 3VTRA 3CHEA 4IXXA 3R8HA 3WJXA 2ZZ6A 3WLTA 1UA3A 4ZQOA 3UJ2A 3QM3A 5D2TA 4NNAA 4PSPA 4JL2A 4DAIA 1V97A 4WGHA 5HNNA 2PLJA 4KWSA 2C0AA 2I16A 3JUGA 3DI1A 2BODX 3EXTA 3K2GA 3EMZA 5PTDA 2PDJA 4F8XA 2NPXA 4Q4OA 1HP5A 4XD3A 2HEJA 3GFXA 3NZRA 4GVIA 1YW1A 5DN1A 2WKLA 5A6BA 3MYOA 3CIWA 3L4VA 5CC5A 2VZSA 3BOXA 1ZNNA 3V1HA 4TO8A 3KCOA 4P61A 1DJWA 2GFTA 2Q3OA 2XGBA 1B3OA 3TYAA 1EZWA 3W87A 1QAPA 4M1BA 1KD0A 3IAPA 1JULA 2PGEA 4JFTA 2FPVA 2DZVA 4Q4MA 4LALA 4FNQA 1WXZA 1QRQA 1A5CA 3R8GA 4K8GA 4RZ4A 2V3AA 1CB2A 4GRSA 2FVKA 2CLIA 3UEQA 3RF9A 1SZEA 1ISXA 3IWPA 3QN3A 5JUVA 4GYPC 4IUGA 1KBJA 2CZVA 4QG8A 1H7OA 2FVLA 4IOTA 1LPFA 1F6PA 1PXGA 4XWUA 3ES8A 4UBPC