2QDDA

Crystal structure of a member of enolase superfamily from roseovarius nubinhibens ism
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
370
structure length
368
Chain Sequence
SLRITRLTVFHLDLPLAKPYWLSGLKFDRLDSTYLRIDTDEGVTGWGEGCPWGHSYLPAHGPGLRAGIATLAPHLLGLDPRSLDHVNRVMDLQLPGHSYVKSPIDMACWDILGQVAGLPLWQLLGGEAATPVPINSSISTGTPDQMLGLIAEAAAQGYRTHSAKIGGSDPAQDIARIEAISAGLPDGHRVTFDVNRAWTPAIAVEVLNSVRARDWIEQPCQTLDQCAHVARRVANPIMLDECLHEFSDHLAAWSRGACEGVKIKPNRVGGLTRARQIRDFGVSVGWQMHIEDVGGTALADTAALHLAASTPEANRLASWLGHAHLADDPIPGQGARNRDGLATPPSAPGLGVIPDPEALGRPVASYDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a member of enolase superfamily from Roseovarius nubinhibens ISM.
rcsb
source organism Roseovarius nubinhibens
molecule tags Structural genomics, unknown function
molecule keywords Mandelate racemase/muconate lactonizing enzyme
total genus 120
structure length 368
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2qddA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2qddA01
3SN1A 1PDYA 2HNEA 4M6UA 4FP1A 3GD6A 3TTEA 1WUEA 1SJDA 3BSMA 3N6HA 1NELA 5FJRA 2OPJA 3DFYA 1ECQA 3RITA 4K2SA 3FYYA 1R6WA 1TE6A 3NFUA 3TCSA 3H8AA 3RCYA 2QQ6A 3DESA 3TWAA 2XH4A 3T6CA 3T8QA 3SBFA 1EC8A 2OVLA 4IZGA 4GYPA 1DTNA 2HZGA 2AL1A 1TZZA 3H70A 3CT2A 3N6JA 2I5QA 2PTXA 3I6EA 4A3RA 1SJCA 1IYXA 3OP2A 3IJQA 3V3WA 2AKMA 4J1OA 4DN1A 3D46A 3FCPA 3PWIA 4J3ZA 4ZA0A 3UCDA 2MUCA 4GIRA 2AL2A 3RGTA 3ES8A 4HCDA 1MNSA 3N4FA 1ELSA 3GO2A 4H19A 4FI4A 1MUCA 3UJSA 3OTRA 2OLAA 2CHRA 3SJNA 4ROPA 1XPYA 4JN8A 3R1ZA 4HCLA 3UCCA 3EKGA 4IP4A 4GFIA 3DEQA 4MKSA 3TOYA 2P0IA 5ENLA 5FJOA 1FHVA 4GGHA 4MGGA 3ENLA 3ZVIA 2AKZA 2QGYA 3RR1A 2PSNA 3ZVHA 1E9IA 3MZNA 1JPMA 2OKTA 3MWCA 3VCCA 2GSHA 3R25A 3Q45A 3SN0A 5FJTA 1SJBA 2OO6A 3IJIA 3THUA 2PTZA 3U4FA 3T4WA 3CYJA 3QTPA 4K1WA 3P93A 3TQPA 3I4KA 1EBGA 2ZC8A 2OZ3A 3CB3A 5FJUA 4GGBA 3P0WA 4GMEA 2GGIA 2PGWA 3IJLA 1MRAA 3S47A 3FXGA 4KEMA 3FJ4A 2XH0A 3R10A 1W6TA 4ENLA 1P48A 2PODA 1JPDX 3VA8A 4F4RA 2XSXA 3JVAA 1BKHA 4E4UA 3R0KA 1KKRA 2PA6A 3UXLA 1XS2A 3QN3A 3VC6A 1SJAA 2DW6A 2PU0A 3UJFA 3D47A 2GL5A 4KT2A 4M0XA 2PTYA 1OEPA 1JCTA 2P88A 4JN7A 3MUCA 3PWGA 4H1ZA 4GISA 1KCZA 4MMWA 3UGVA 2PMQA 3KUMA 1P43A 1YEYA 3NO1A 2PP1A 7ENLA 1JDFA 3BOXA 3VDGA 3V5FA 3TJ4A 1TKKA 3TWBA 5J04A 3ES7A 3STPA 2GGGA 3CXOA 3OZYA 3ZLGA 5BOFA 2PGEA 2PTWA 2HXUA 3R11A 4ZCWA 3H12A 3T9PA 2QDEA 5EU9A 1EBHA 3DG6A 3S5SA 4E8GA 3UJRA 3FV9A 2OQHA 3JZUA 3TJIA 4Z1YA 2POZA 2OFJA 3GY1A 3TW9A 4E6MA 2AL2B 2ONEA 4IL2A 4DX3A 1F9CA 2OX4A 3SQSA 1L8PA 1R0MA 3PFRA 2QJNA 2PCEA 3R0UA 3RO6A 3P3BA 4GYPC 1PDZA 1BQGA 2FKPA 3V4BA 2GDQA 3DIPA 3MQTA 3MSYA 3V5CA 3SSZA 3OW1A 2OG9A 3DG7A 4DWDA 3CAWA 4JHMA 4HN8A 2PP0A 1EC9A 3ZLHA 3DERA 4HNLA 4KWSA 2HXTA 4G8TA 3VC5A 2MNRA 2QJJA 4IP5A 3ZVHB 3ZLFA 3UJEA 1MDLA 3H7VA 3QLDA 2FYMA 5FJPA 3QPEA 5BOEA 3Q4DA 4DXKA 3PK7A 3I6TA 4YWSA 4HPNA 2QJMA 4X2PA 3OZMA 3OPSA 2P8CA 4A6GA 2PP3A 2QVHA 2GGHA 2QDDA 3EEZA 3RRAA 2OQYA 3CK5A 2XH2A 4Z17A 4DYEA 2P3ZA 4A35A 2XGZA 3GC2A 4EWJA 2NQLA 3NZGA 3NXLA 4KPLA 3VFCA 3K1GA 4K8GA 3MY9A 3N4EA 4HYRA 2RDXA 4IT1A 4IL0A 2DW7A 1WUFA 4H2HA 3DDMA 1EC7A 4IHCA 2P8BA 1RVKA 4HCHA 2GGEA 4E4FA 3UJ2A 2O56A 3U9IA 3JW7A 6ENLA 4H83A 4G7FA 3HPFA 3DG3A 1KD0A 3DFHA 1KKOA 2PS2A 2PU1A 3DGBA 2PPGA 5IDZA 1MDRA 2ZADA 3B97A 2GGJA 3IK4A 4HNCA 1FHUA 3QKEA 2OZ8A 3VCNA 1ONEA 3FVDA 4DHGA 1NU5A 2OZTA 3BJSA 3SN4A 3UXKA 4E5TA 2XH7A 3MKCA
chains in the Genus database with same CATH superfamily
4M6UA 1IEXA 4HNUA 3M5YA 5DT5A 1SJDA 1FVPA 1B30A 4NSBA 1DOSA 5FS9A 1AH3A 2YXGA 1ENUA 1DIEA 1K7XA 1SZNA 3FYYA 3VKDA 5HNTA 1R6WA 1JPIA 3OG2A 5F4XA 3TCSA 1C29A 4MPQA 2FPVA 4G7EB 5DEZA 3WQ5A 2VEGA 3Q67A 3GG0A 1EC8A 2H8XA 4AEOA 1D3GA 1PWMA 4E8CA 2A8XA 3IGUA 3MCOA 3WQPA 2G37A 1QT1A 3LBCA 1DTNA 1EZ2A 3ITLA 3LTPA 2V3FA 4CD6A 4AD0A 4I3GA 4K7VA 2WBKA 4C91A 3W6YA 2BMBA 2GVLA 5HA7A 2YB1A 1X1OA 3VNIA 4KWUA 2V68A 3WK2A 1C90A 1I6NA 5CPMA 1XW8A 1QWKA 3OGRA 3W4RA 1MEHA 2ZA1A 3F5LA 2JK6A 4Z1AA 3IV8A 4B3KA 4XUYA 1F4HA 3AO0A 3S42A 1ELSA 2EO7A 4NJKA 2ZUTA 4E8DA 1Q6DA 4TO8A 4EF8A 3CUGA 4XTDA 3T2QA 3SJNA 4H4ZA 5DXYA 4OKDA 1LRNA 1UH2A 1VFFA 4MKSA 4L61A 3QV8A 4RNJA 3EEGA 1W3TA 4AHPA 2EG6A 2EJAA 4J3TA 5TQLA 3ENLA 3L68A 1E6SM 4P8VA 3GW0A 4WVXA 3VINA 3S5ZA 1DQUA 3GH7A 2WMHA 3R5EA 1MEWA 1PBGA 1XF0A 4DYKA 4S3KA 4RL3A 1YTEA 4AXNA 3CUIA 3GDTA 3T4WA 3VGGA 3W1MA 3PVFA 1XBVA 4QRNA 4M56A 2ZWZA 1R9XA 3GR7A 3C2RA 4RCXA 3UFYA 4WX2A 1EP3A 1H3GA 3KHJA 3VD3A 3CUXA 4PTNA 2VWSA 1GYNA 4JTRA 1S7MA 2NWSA 3IJLA 3BQ6A 1XR2A 3R79A 3R10A 4QIUA 2BVTA 4LH8A 4GVGA 4AD1A 2ZUMA 3S4TA 3G3MA 4AW7A 1EJUC 1YDNA 3GXDA 1GVRA 1NAL1 2Y4SA 3I4EA 1OF8A 1XS2A 2W4XA 2OEMA 3N17A 4PUDA 3NUKA 2PDLA 2UWFA 4IGSA 2DIJA 1MW0A 3W29A 2GWNA 3TTQA 1L0PA 1E40A 1FWNA 1XLDA 4JQAA 1GKQA 3W84A 3D47A 2HK0A 3KL5A 3NOYA 1X1ZA 1UD5A 2CBJA 1ZJIA 3WMSA 4C60A 1UZ4A 5BU9A 5I02A 5FF0A 3UGVA 1KBIA 3E12A 3CPGA 4S3AA 4HJWA 3UU0A 1PHQA 4RV3A 2IW0A 4UMAA 1IXQA 3Q65A 4C1KA 1UR0A 2DQXA 1RQHA 4MB3A 2E3ZA 1ITCA 2WAGA 4JIHA 1AW5A 1TKKA 3MC5A 4MUZA 4FLOA 2WVUA 1GUVA 4C6KA 4EMWA 3CXOA 3OZYA 4W86A 3P8JA 5CZSA 3QY6A 4ZCWA 4OU1A 2Y63A 3G6MA 2J13A 1J18A 4PB5A 5HNNA 3FGCA 1F8IA 3A22A 3PM6A 1IIGA 1KM0A 2J3NA 3TJIA 1CGVA 2GQWA 4D1IA 4IXXA 3PUGA 4D6EA 1RPXA 2VGIA 3HO8A 1OIMA 3DUGA 5DMNA 3GDLA 2QCLA 1RK6A 1UZ1A 2ACUA 5E6ZA 4JKLA 2NUWA 3PUOA 2FHFA 5A69A 3VCRA 1WDSA 3NDOA 2A3BA 5ABEA 5AFDA 2OT1A 4DWDA 3GXTA 2CIPA 4N7QA 3S5OA 4GLEA 2WVSA 3TN6A 1BQCA 3DERA 2FTYA 2HXTA 3CHCA 4G8TA 1GG0A 1D2KA 3PZUA 2D73A 2OX1A 3GG1A 5F2IA 2GR1A 2KZHA 1OZMA 4L9ZA 4ZQNA 4HYVA 4G9PA 1QPKA 3GIQA 2FFIA 4C5YA 4N9CA 4FEZA 3E0LA 2HRWA 3EEZA 3RRAA 1ZUAX 3NEHA 4Y9PA 4E4PA 1I4NA 2BDQA 3GD4A 3U2CA 2J8GA 3R0DA 1Y5WA 2J7DA 2WP5A 4GFSA 5LIWX 5GJPA 3NEVA 4CNPA 2V6OA 2NQLA 4DNMA 2RH9A 1YIXA 5J5DA 3LV6A 3KLKA 5HMEA 3VFCA 3P80A 1KRBC 1K7FA 4A22A 1CLKA 1I2PA 4Q8OA 3AXKA 3VNJA 1G9HA 5SWUA 4IL0A 3VIKA 1AQHA 3RK8A 3BARA 3DK9A 5CAKA 3LNMA 1KFWA 5TAOA 3SRDA 1Z6KA 4GBDA 4NHVA 4IG2B 1B3WA 1E0VA 4O53A 4HOZA 2XIIA 4PTVA 4XX6A 2BXVA 4ALDA 3MYPA 2ZTKA 3B9NA 3IRSA 1L6FA 4KS0A 4MF4A 1EF2A 5FI8A 2VGGA 1T8XA 4P7OA 3AHXA 3AJXA 1UQYA 1RV8A 3B97A 2CWXA 3LBOA 1VS1A 3TA6A 1ONEA 1F6PA 1V3HA 4PMRA 1P0NA 3GW3A 2Y61A 4ZFCA 2PDIA 4JDBA 3SN4A 1ODUA 3EDFA 2RABA 3DU0A 5CGQA 5M03A 3TA9A 4MNMA 5FF4A 4AF0A 1NDVA 1PYMA 3K1DA 1UR8A 4JHOA 4H4TA 1TRDA 3BQ5A 2DZUA 3NYZA 4JTGA 3SRKA 3P81A 1V6YA 1TE6A 4PMYA 4O18A 1PX8A 3T44A 2PDHA 3F1QA 5JUVA 2ZIDA 2AOSA 3S3GA 3OVGA 1C7TA 4GVFA 1M53A 2WK2A 2Y5JA 1JZ8A 3WNMA 2OYKA 3ZO9A 5J8LA 3S5NA 1S2WA 3ITOA 5FEZA 2VRKA 1WDPA 3EX1A 1HG3A 4E2BA 1EJ7L 1IYXA 2HJPA 5D9OA 5CG0A 2ATMA 3GZAA 1DNCA 1VR6A 2QMJA 2J8FA 1SZGA 2CESA 4PR4A 3TR9A 4MVAA 4EANA 5I00A 3GU1A 5T9BG 1GW9A 1LUCB 3DFSA 2E25A 3WBXA 1EEXA 5JQ9A 5TD4A 3R89A 1KBKA 4LUSB 4OGZA 3T05A 3CQ0A 2DUXA 1UA7A 3I10A 3C2EA 4KCTA 1E73M 2XZ9A 3U8GA 4AY1A 4H41A 3B8VA 2BOEX 5FEXA 1RCQA 4YCOA 1LQ2A 2E1WA 3H26A 1ZAIA 4O1AA 3UZXA 4Q4MA 5C6MA 1FP8A 1XSJA 1N55A 3OG3A 4RZ4A 2BGSA 4TMBA 4GVHA 2ZOXA 4X2RA 5IHRA 1VFTA 5CJMA 3ZMRA 3MB9A 2PTDA 4JCMA 3SUUA 1X8CA 4R3UA 1OFPA 2AKZA 5B7YA 4WK9A 4NJHA 3UWWA 3RU6A 5L6UA 1WKDA 3LXAA 2XFYA 4GBUA 3GBEA 2DH3A 3QPYA 4KH2A 4O57A 1RALA 1NDWA 3NPVA 3M64A 4Q33A 4GI4A 2GSHA 4NF7A 4U2YA 1EUAA 4KGJA 4GUGA 4FNUA 1XISA 3EWDA 2QW5A 2QR6A 3LHUA 1Q65A 2ZKMX 4NJIA 1XYFA 3W2UA 2C0AA 4IPNB 3VGHA 2RJGA 1S1PA 1VCGA 4FK9A 2QNEA 4DZIA 1PTGA 3WLNA 2WC7A 4V1YA 2DZXA 4LS2A 4DLMA 3EOOA 4H4WA 4OUIA 1T96A 2Z24A 4LUTB 3KTCA 1S5NA 1QNVA 3U5UA 1AQ0A 3NM3A 1JFHA 1W1PA 3VKBA 5I09A 3UZJA 3MHGA 4A3QA 3KBVA 3L4ZA 1X6LA 2YIHA 1BG9A 3UPWA 2GVGA 4RE3A 3AM9A 4ZB0A 4NRRA 3PP7A 2FVMA 3M0YA 3AN1A 1VPXA 3RXZA 5HPOA 1PVNA 2XINA 3N2TA 4NAFB 1QI5A 5A6LA 2XFWA 3BLPX 1E1CA 3OIHA 3WBYA 1E6QM 3GG7A 3VE9A 1JQVA 4GHRA 1V0MA 2J7GA 4U5IA 1I2OA 3NPXA 3K8LA 4GKTA 3WQ6A 1HKIA 1LBFA 3I68A 3ZFHA 1DBTA 3OIXA 2UY3A 3VDGA 2GLKA 1W3JA 2J24A 5DN1A 1GRHA 2DSWA 4O4WA 2OB3A 2VZOA 1FWHC 2G3MA 2ZCGA 2NVDA 3PBGA 3T0CA 1R9ZA 4IQEA 2OQLA 5D32A 1E3ZA 3GQYA 3HA1A 3A4WA 3PB2A 2YCLA 4S38A 2OLSA 3DG6A 4OUEA 4ZB2A 4ZL1A 4CQCA 3AYRA 3V5OA 1NF7A 2AQWA 2D0FA 5DY2A 4LBRA 3SCVA 4JIRA 4R33A 1BWLA 3MI2A 3GY1A 1Y7VA 3DGRA 4ICMA 1XYZA 1CXLA 2G5WA 3QHOA 3BPWA 3NPWA 4B5TA 3N25A 2P1FA 3EUB3 2PCEA 2C3ZA 3RO6A 1JYNA 4D8LA 4JTKA 1B3VA 4KESA 1JROA 3GTHA 3MQTA 4KQNA 1FFVC 2WBGA 1EJWC 1H09A 1MUMA 4A29A 1E4NA 3GHTA 1VFMA 5B80A 3ARRA 3V36A 2D2OA 3TEVA 3AU2A 4H4SA 1F3EA 2QZRA 1E6RA 3H7VA 4H8HA 3A47A 2VC5A 1Q6LA 3WF1A 3UPMA 3CGCA 2YFNA 1SZEA 3HMJG 5G5IA 3E0FA 4OV9A 1YXCA 1IZKA 3E2RA 4WY0B 4JPGA 2XH2A 3LG3A 4J5NA 1GOMA 2V38A 3LOTA 4A35A 3ID7A 4FOJA 1VP5A 4IGHA 3MU7A 3LK6A 5IFPA 1E1FA 1OK6A 1T6MA 4PTXA 2PD9A 1Q6FA 1QCWA 3AXIA 1OCQA 3WCZA 4IT1A 1IE7C 2GVEA 2DW7A 3ARUA 1TTJA 1GETA 3WEMA 2DU2A 4H2HA 3VE7A 4S3JA 4M1BA 1RVKA 5IM51 4J3WA 3WO8A 4GQGA 4URIA 1X1NA 2HV5A 3L4VA 1FECA 1FQ0A 3SIZA 4OJYA 3M6YA 3ANUA 1W5MA 4PUEA 2OKOA 1QOXA 3KLJA 2ODOA 3I7RA 4WKFA 3OVQA 1RBOB 1TZ9A 5D9NA 3GDRA 2A4AA 2EXOA 5HMDA 1QI2A 2J27A 1EEPA 1MXSA 3TCEA 3REQA 1GONA 1NTHA 2TSYA 1UPPA 4I90A 1XXXA 3VZYA 1GYMA 3T8LA 1W32A 3G24A 1LOSA 1MZHA 1XIJA 5IBXA 3RITA 4J2MA 4B91A 5BZAA 2POTA 4EXBA 2HROA 3F2BA 3CGDA 5EY5A 5BXSA 2X8HA 2I14A 3B8UA 4FAMA 3MPGA 3S2MA 3VM5A 2HMCA 1LBMA 4B5SA 2YA2A 2VOMA 4DZAA 3FNDA 1ZB5A 3NO3A 4DZHA 3M46A 4O1FA 1EB3A 1LRTA 1RCOB 4A2RA 5FSDC 2D3LA 1XGEA 4N0RA 3NVYB 3H6OA 3PUDA 2VEPA 3W7PA 4EACA 3GZ3A 1PO9A 1Z8AA 3IAPA 1CNVA 3RLHA 5ABHA 3OEXA 1UB3A 1IEWA 4FXJA 4KMQA 1QATA 3SQMA 5LYRA 1CXKA 4Y9AA 2ISDA 4A05A 3RO8A 2VX5A 2J74A 5CPTA 4BS0A 3M0ZA 1XCFA 3EZ4A 1H2JA 2E3TA 1U5VA 1E4IA 1HN1A 4AIUA 1GCYA 4UR9A 1A3HA 1TWDA 1ZU8A 3IK2A 2GJNA 1FXPA 3NZRA 2R1MA 2HCVA 3TDFA 4HCLA 5H8MA 2ZBTA 1G5AA 4IP4A 1QOPA 2NQ5A 1W1YA 4ZTYA 1FWJC 1R9YA 3N1AA 3MJMA 3Q2DA 1P7TA 3W73A 2FMOA 2WWCA 4CCCA 4AFYA 3LPPA 3FDGA 3DH9A 5BNKA 4LJ3A 1GHRA 1H63A 1SFLA 2Y24A 4YU1A 4YIWA 4JEJA 3EKLA 4M24A 3GFYA 5FCZA 1Q5MA 3NDZA 4HZ7A 1J2WA 4MLJA 3SRHA 3KZPA 2HQAA 4FXFA 2P0OA 4RZ5A 4B9ZA 1SFTA 1S39A 1J79A 1AVAA 1UYQA 1TFVA 3PY2A 3VZZA 1H4PA 1SFJA 3NL5A 3URHA 3M43A 2CLMA 4Y8EA 4RPQA 2QF8A 3RPTA 1PIGA 1US0A 1W9BM 1FWTA 3T0BA 3UG5A 3NXFA 1GEUA 2AQOA 2Y5SA 4Z1CA 4QROA 1EO5A 1P48A 1R38A 3W2LA 2I7GA 3CMJA 2QUNA 1DL3A 1YNPA 3QBUA 4U28A 3NNTA 1CB7B 2JKEA 2DT3A 4GX8A 1XGDA 4GQQA 2PUZA 1ZENA 4HNNA 2QIWA 3LTSA 1FP9A 1TPC1 1JZ3A 3M7SA 3LPFA 3WUEA 1GRTA 4CUCA 1LZOA 3HFTA 4CQ9A 3PN8A 1A50A 1Q6EA 3MHFA 1OY0A 5EBUA 1ECEA 2CLEA 3LZ5A 4D6IA 4ZQCA 2NV9A 1FWCC 1DWIM 3HM7A 5GJMA 2E67A 3BAKA 4LU0A 4W7UA 1VB9A 1UC4A 5HJYA 1XLCA 1CIUA 3M5VA 3S83A 4IIEA 2X42A 3M0LA 4W7VA 4IM4A 2DSZA 3PG9A 4EE9A 1SW3A 4DO4A 3RG6A 2QPXA 4PB3A 4XZ9A 3L66A 2IXUA 3BLDA 4B16A 3KCLA 1OD0A 3ES7A 3GKFA 2YDRA 3W81A 4AYSA 4ACYA 2Z4GA 5BOFA 3WJZA 1N2VA 4A4AA 4FALA 4OVXA 5I2UA 1MOKA 3JS3A 1BSLA 1E5NA 1XLHA 5A8PA 3MP5A 3H4WA 1KM5A 3BWWA 3F7JA 2QJIA 4S2BA 3BV7A 4JEQA 2O4QA 3JZUA 1QHOA 2X7VA 3W28A 2OMAA 2OGYA 3W38A 3ZJ7A 1T40A 1GOXA 3PSVA 3STEA 1E70M 2JF7A 4PMJA 1Z89A 4I6VA 1S5MA 3E2QA 2DT0A 2NVCA 1PDZA 1TG7A 2FKPA 2FTWA 4DBEA 4JD4A 5CPNA 4BF9A 3WDQA 5A6BD 3EX4A 3OW1A 4LX4A 2BTMA 3ITGA 2B81A 5EFDA 4QG8A 4AC1X 5TF0A 4NJJA 3EX2A 4B5NA 3MSDA 3ZT5A 2UZ9A 3B0UX 3P5YA 4ACZB 1AD1A 3WFZA 4D71A 1VEMA 2FYMA 1PYFA 4DXKA 3PK7A 1ZZMA 4ICNA 4HPNA 2I16A 2GGHA 4J3UA 1DIKA 4K7YA 4IPIA 3HPSA 5M1TA 3TQVA 1KBBA 2V2DA 2ZRVA 3EOLA 3SCQA 3EAOA 5GNXA 5REQB 1VIZA 4WZHA 2WPGA 3LCGA 1FDZA 1N8FA 2XISA 3RUBL 1K9EA 4LUTA 1MQQA 2EQ9A 4W4QA 4O1CA 2OO0A 4WGHA 4NAEB 3LCLA 1RVGA 3R8GA 4LGXA 4Q8NA 2D2GA 4G6CA 1UD6A 4JTAA 4B5XA 4L9YA 1QXLA 3W2JA 4NJGA 3RHGA 1EC7A 1DE6A 3CIVA 4G1NA 3SR6B 2GGEA 5G4EA 3E0IA 3W2NA 2VFFA 1RD6A 3FOKA 1KD0A 3IANA 3WLKX 4ML4A 4NAFA 1WZAA 2R1KA 1R3SA 2ZVIA 4JQ9A 2CZEA 3W75A 3WDJA 1E6ZA 3MKKA 3LA4A 5MHBA 4JS3A 3KM8A 4MTVA 4ZQMA 2IKJA 1AL7A 3NPUA 4NXKA 1AD4A 3MANA 3D5HA 3VABA 1K9FA 1HVXA 1XRTA 3UYIA 3NWRA 3ZSTA 4ZGYA 4WDWA 4O1DA 4MHBA 4XVEA 4MWAD 1ODZA 3BSMA 1B54A 2WCGA 2E6DA 3T7VA 3BLIA 1DJXA 3HIJA 1ECQA 2WJFA 3COTA 2R9ZA 3G1SA 1M5WA 1CB2A 4C90A 3RCYA 2NXGA 3KS6A 4NZ3A 2YCLB 1WZKA 2B7QA 1RAKA 2DVTA 5I24A 3LTYA 3RYSA 3TMLA 2V8ZA 4ZOAA 4WOQA 3WX7A 1TZZA 4XV0A 5I03A 2Z1WA 2I5QA 2V9DA 4A3RA 4IMGA 5FKYA 4M6QA 2Z0IA 1H6VA 2GJXB 5F1UA 1DJYA 3TW6A 1KM3A 2WCSA 3D46A 4IF2A 1VPQA 3CHVA 5AHIA 5DLCA 3S2NA 1LL6A 2E9LA 4ZA0A 4BF5A 4KRZA 4UR7A 2ZXAA 5FS8A 4EIVA 1Q7QA 3LHVA 4LAOA 5I3FA 4HCDA 3N2MA 2OYLA 2BSLA 4HZ6A 1MNSA 2BS9A 4H19A 4HBKA 2NLYA 4B3ZA 1XLIA 4DB7A 4H50A 3BXWA 4JOMA 1BEUA 1XKJA 3RJXA 1XYCA 3APGA 3UCCA 2EHHA 4IGMA 4RXGA 2DIEA 4OBTA 5TBOA 2P0IA 2GSEA 1VFSA 3DFOA 1V79A 3WLTA 1GOKA 4QR6A 5FJOA 2TPRA 1ADDA 4YWOA 4U3AA 4LIIA 3H4KA 3IC9A 1C9DA 2FJKA 4JTCA 3USZA 3O15A 4U33A 4LANA 3RPDA 1D7FA 2ACQA 4IQLA 3NTYA 4OFCA 3MWCA 1EX1A 1TSIA 1XG3A 1TJRA 1WP6A 4DXXA 2KAUC 4P8WA 2OO6A 3MT1A 1C92A 3SW6A 3WBEA 3W72A 1UWQA 2Y85A 4UNKA 4XIMA 2QCDA 1HP5A 1N62C 2YBTA 1PHWA 1MO0A 3GNXA 3W00A 2E5AA 4L6OA 2J7HA 1MRAA 5AYIA 5KVIA 3ARSA 3FXGA 3KX6A 3WH8A 2BWGA 3UY8A 4AZBA 1HL8A 3AU6A 1R3WA 2CW6A 3PWAA 1YDVA 4GZIA 2FGLA 1XL9A 1UD4A 3GBDA 4FR1A 1UBSA 3SECA 1Q6CA 1ZBCA 2HVOA 3KP1A 3FJLA 1FFUC 3ONBA 4BQ5A 3M07A 5XIMA 2NT0A 2CKRA 4TVUA 3N12A 4L65A 1VBJA 3QW3A 4M5PA 3VM7A 4C6JA 2D0GA 2DW6A 1SR9A 3MJYA 2BXZA 2GH5A 4I5XA 4FB7A 3UNDA 2XU2A 1V3KA 2GQAA 8XIMA 4BI5A 3DFQA 4JIPA 4IMDA 3PWGA 4LS1A 4UTTA 4HN4A 3QR1A 3JZEA 4L1GA 4LSBA 1YEYA 1A5KC 4LVAA 1KFJA 1JDFA 2QCGA 1NVMA 2VR5A 3FX4A 4ZVJA 3TWBA 2V3DA 2VUNA 3NDYA 1YXDA 1NDZA 4IP7A 3NL6A 2X8GA 4KKXA 4QDMA 4Z1DA 3GG8A 4GQRA 1KN0A 4X9SA 4H4PA 3TK7A 1Z9AA 1X38A 1I2NA 1SO3A 4Q8VA 2PEVA 1HJUA 4Z08A 2XSAA 3NS1B 2OQHA 1FH8A 5A6BA 2GK1A 3FY1A 3TW9A 1EZWA 3A6OA 2FPTA 1TWWA 1W9UA 1EQCA 3FXYA 3OBAA 1FXQA 4XAYA 3AS3A 3SQSA 3OA5A 1PL9A 3R7MA 3NQ2A 1X8FA 4KETA 1WZMA 3EPNA 3ETRB 3P3BA 1GEHA 5DMLA 1UH4A 1VEOA 2D0HA 2WKJA 2W92A 2GJLA 3C0JA 5D2VA 1XLKA 2BXYA 3V5CA 2UBPC 4P7QA 1J0JA 4DELA 5HWJA 2WO5A 3T4CA 3TN4A 3M16A 1AJZA 5JRBA 3NRZB 3OQ8A 1LG1A 4LRTA 1I0BA 3DH7A 3O6YX 4KFOA 1V3JA 1SM9A 3CWHA 1KO0A 3HG2A 2G41A 5E0FA 1CTNA 4O28A 3SZ8A 1TPUA 3IWPA 4NX0A 3WFLA 4HIBA 5JIPA 1FEAA 1TR1A 3MV11 5DBUA 4A6GA 2YXXA 1CLXA 1EH9A 4H3DA 3G6LA 1Z7AA 2ISWA 2ZZ7A 3UNTA 2FMNA 3NM1A 4DYEA 1CBGA 1K7EA 4W7WA 2B31A 3VGBA 4EWJA 5E93A 1UZHA 1TV7A 3AXHA 3FA5A 1WA3A 5E9XA 4QLJA 4BHYA 3MCNA 3PPGA 4KPLA 1N5XA 4XKYA 3BG9A 2QCHA 5F7UA 1B3YA 2R9RA 4HU0A 3VU2A 1EBDA 4L4OA 2E8YA 4QCEA 3DJGX 1OYAA 1EHNA 1JXJA 4ZB5A 3DDMA 1RPKA 4QQ3A 3EAUA 2IPWA 1RR2A 4QAIA 5HWNA 4Q8QA 1XH1A 2PRLA 1BGGA 1KKOA 3ITYA 2EGZA 2FZNA 4PEKA 2FVLA 3A3WA 1K8CA 1MDRA 1V02E 3SY5A 1EL3A 2G0WA 4ERIA 4MJ2A 2A7PA 2VCAA 5D04C 5LIKX 1XD0A 2A3AA 2XUCA 4MG4A 4X9YA 1CYGA 2E6FA 1E9YB 9XIAA 4Q8WA 2TRSA 2IMRA 4EPDC 5CZ0A 4MNLA 4E5TA 4LEFA 1W1IE 4LAKA 3WLJA 4W8AA 5LNWA 1S2VA 3W53A 5K9XA 3PAJA 3ZJ8A 1A47A 1OFBA 1EJTC 1HKMA 2NUXA 1C8XA 3ERPA 3N6HA 1ZP3A 1JRPA 4ZO6A 5HR7A 4K2SA 5LA0A 1BWCA 1K6AA 4A8IA 1DJQA 3A4XA 3TWAA 1DWHM 1BSIA 3FJNA 4AQLA 1DQWA 1XYMA 3OVRA 4JTDA 1KM1A 2AL1A 4HHLA 3MO7A 5E09A 3N6JA 3AS0A 3I6EA 3OGVA 1KRAC 4RPPA 4IH3A 4DI8A 1GGOA 1JR1A 1ZALA 4N6EA 1EYWA 4ZQPA 3KZSA 3C56A 1VZWA 1EOKA 4QJ3B 4DI9A 4J1OA 2FFCA 1GVIA 3RM8A 1B3ZA 1U30A 4LS0A 5EGRA 7REQA 1PPIA 3FCPA 3PWIA 4UTLA 4PMZA 5E5CA 1E56A 7TIMA 3BURA 1F3PA 3W1UA 3ABXA 3N4FA 2ZXBA 2GZXA 1OGBA 2X1TA 1MUCA 2PDYA 1A4LA 3H53A 3MW7A 3JUGA 3NG3A 3HGSA 5K7JA 4JN8A 3R1ZA 3CT7A 3CWOX 3G0SA 4LC6A 2WXDM 3CMFA 3T78A 1S5VA 4INFA 3O07A 5CGTA 2V81A 1MFUA 4EQRA 3B9DA 1TYPA 4ZR8A 1V5XA 2PSNA 3WL0A 2OU4A 1J9YA 4H4QA 2WANA 2VURA 1UUMA 1A80A 1V02A 1I60A 2OCZA 3PS7A 3IIPA 4QAWA 4YNGA 5EMLA 4DF0A 2BNJA 4O0KA 4NT0A 4UZUA 1EA0A 2Y62A 1STZA 3R25A 4CD4A 4AAJA 2VRJA 1EQPA 5HWMA 3LRMA 3E1F1 4PULA 2ZA3A 4HMEA 3LD5A 3BZGA 2A1YA 2OZ3A 3CB3A 8RUCA 1QAPA 4YTUA 1T41A 2PDGA 4QE5A 1FCBA 1OG0A 4ZQOA 3HRDC 5HANA 4GQBA 3T81A 1XIIA 5HDRA 3MBFA 4F8XA 4D9PA 1F3XA 3CV7A 3R07C 1TWIA 4DBUA 4HT3A 4JBRA 2W67A 2DEPA 3S1XA 2WMIB 3RNMA 3R0KA 1KA9F 1XSIA 3CJPA 1AUSL 4N42A 2XN0A 5CXPA 4W5UA 4WUIA 1D8CA 4B2DA 5HOSA 2ZICA 5EA9A 1E0WA 4CD8A 1Q13A 4IIHA 3DAQA 5FL1A 2QV4A 1OYBA 1U1UA 1Z48A 4KT2A 2X99A 1FWSA 4M0XA 4LVBA 4LF1A 3W22A 3RFAA 1OX5A 2VFHA 1NFPA 4HHPA 1KCZA 3W85A 3UCQA 4R27A 5JH2A 4UFLA 5D9MA 1GREA 2GR0A 4XAPA 1FA2A 3GC4A 4H9VA 4AEEA 5A6TC 3WIJA 5A6JA 4ZZ9A 2YKKA 2GR2A 5GVJA 3WF4A 4PODA 5M5DA 3W74A 3C2YA 1W0MA 3KOXA 3EB3A 3LHZA 2F2KA 1HO4A 1V77A 3VPLA 2GGGA 1KQYA 1XD1A 1LLOA 4UXDA 2VEMA 3VNKA 1HJVA 1WE5A 1Y65A 2W61A 2XN1A 1LVLA 2EQ7A 1UP2A 3IIOA 1AQFA 4PUNA 3ITTA 3QTGA 2Z28A 1NOFA 1J0YA 4FF5A 1PTDA 3T55A 1BF2A 4LWWA 2Y0FA 2I9EA 1J6OA 5EMKA 2ZRYA 3OQEA 1ZTVA 3CH9A 2JE8A 4KEUA 2HBXA 4FNQA 3HU7A 1X96A 5XIAA 5D33A 5AVNA 5GJNA 4DM1A 1HJXA 2OG9A 5I3HA 2V2HA 4HPJA 3MI6A 4N9EA 3WEOA 1LQAA 4B5UA 1P0DA 4HU4A 1UJQA 2PWEA 3A9IA 4JHMA 3CHDA 1TZ7A 3SCRA 2VEFA 5BYWA 2OJPA 3TKFA 2HPMA 3I3DA 4IP5A 1DWJM 4IMAA 2HK1A 5CC6A 1M9HA 4GCXA 1N8WA 1XWYA 3C0LA 3QQWA 2RJHA 3V75A 2QXWA 2HQMA 3R6IA 4TR9A 2XWEA 2DSKA 1NM9A 3W1TA 2QCNA 2OSXA 3HTWA 4LUJA 4FX9A 4EM3A 2I5IA 3FDKA 3GU9A 4IG2A 3AYSA 4DWSA 1C8QA 1NWUA 2YZ5A 4EF9A 2DORA 1Z42A 1HX0A 2YZRA 3U4AA 3S46A 4UBPC 4P61A 1H51A 3DHUA 2FVKA 3MY9A 3L4UA 1PCWA 1U33A 3CV6A 2OSYA 5CJNA 2W3ZA 1WXJA 5JBDA 2H3BA 1VJSA 3BLEA 3B3DA 1W5NA 3TU9A 3W1XA 4E3TA 1ONWA 3VGDA 3OHIA 1QI0A 2AAMA 3DJJA 4L4MA 4E4FA 2Y89A 1YKWA 4ZE4A 4UTJA 2J47A 1EXBA 4PCFA 5K2ZA 3TJLA 3N15A 3O0HA 1NEYA 3S1VA 4CNTA 9XIMA 4YYFA 5LHEA 3DGBA 1CXHA 3NVZB 4PCNA 1GWJA 3QZAA 4A3HA 4ZBCA 3PJUA 1V51A 4J57A 2CEQA 3TC6A 2QYGA 3FVDA 1BRLA 4JHZA 1TVNA 4W8BA 4CLMA 1R3RA 3I3BA 4YL2A 4RNHA 3PBYA 4ERGA 2OSWA 3OHMB 3TROA 1YNQA 2ZE3A 4EPKA 1RLDA 5CSSA 4J28A 3TH6A 3SGZA 3MUIA 3H7RA 1MWOA 5CC3A 1OHLA 3DFYA 1H49A 3AIBA 4UWMA 1D3HA 4M52A 1JCNA 4NZ1A 1GOQA 1DIOA 4MDOA 2QQ6A 3W88A 1KGUA 3XISA 4DBDA 3WJSA 4YJ5A 3RIKA 2ZRWA 4UB9A 3ARYA 4MY9A 1GQLA 2WJZA 3LSCA 1CXEA 1WOAA 2WJEA 3W07A 1OCJA 1IEVA 3ARZA 1VFLA 2CZ5A 2XVGA 3H23A 1CGYA 3CZEA 2ZWYA 2NUYA 4EQWA 3BANA 2A3CA 3PZGA 4HJFA 4ADSA 3WLSA 3BGJA 4JL1A 5A8QA 3UXAA 2OEKA 2PDMA 3AISA 1Q4WA 2ZXQA 1BHGA 4DZ5A 1P1XA 4J3ZA 4HB7A 3RGTA 1Q6RA 1QI4A 3ZWSA 3PZVA 2DZAA 1ADOA 3ITCA 3G0XA 4H9UA 5DRCA 4US6A 5A6KA 1XPYA 4W8LA 2ZQ0A 1JGIA 4U10A 2IUZA 4UTFA 2R24A 3GHUA 7ODCA 2XN2A 4A3YA 3ABSA 3LLXA 1OJTA 2WPCA 4JTSA 3FK4A 3QC3A 4F0KA 3ZT7A 4XIAA 1QNOA 5AC6A 3IVTA 1U1HA 3CV1A 3FYPA 3MZNA 4OZOA 4DUWA 1LRQA 3G1RA 3L2MA 3B8IA 3N34A 2OKTA 3AAMA 3T08A 3VIFA 1NQKA 3VCCA 3WK3A 1LWHA 4RNIA 3W0KA 1D3CA 1V0LA 3QZ6A 3WDRA 4FF7A 5A6AA 3CQIA 2PTZA 1ZNNA 4F2BA 3FSUA 4HMNA 4H6RA 5MKGB 3NL3A 1W1ZA 1Q85A 4A21A 1PEZA 1GOIA 4JQ2A 1OFQA 1IF2A 4H4UA 4X61A 3NYDA 3P0WA 5CPOA 1F3WA 4Z2KA 1HIZA 4GI8A 3UG8A 2ZX9A 2J75A 3S47A 3W3OA 1DE5A 3KRSA 4IWWA 4QNWA 1RA0A 3WD3A 1T0OA 3SCSA 2YAUA 3MMTA 2JEQA 3TR2A 5CC5A 2IPFA 4C6IA 5C9RA 4C5ZA 3THAA 3LI0A 5K4XA 3CASA 4DJDA 3M47A 1FH7A 3BW3A 1REQB 3YPIA 2V5LA 2E5BA 3GE7A 2PU0A 5FS6A 4PL2A 3HGOA 4GC3A 4DUOA 1WPCA 4CGTA 3A23A 3WH7A 3F4WA 4GISA 4Q4PA 1N8IA 2ZUUA 3JU2A 1JUEA 1KC7A 4CQAA 2EKCA 1FCUA 1JCLA 1G7VA 3BW2A 1DV7A 2BCPA 3GSMA 1X7IA 2WC4A 3RRXA 2EPHA 1UJPA 2CITA 4EXQA 3VIGA 3M0MA 3E9AA 4JGDA 4GZ7A 1H0GA 1JNEA 5J04A 3EWWA 4HA3A 2PTWA 1XP3A 3RN6A 1FFRA 5D2WA 1X2GA 2VELA 3DHFA 2EKGA 1OX4A 1KR1A 4JQ4A 4FX6M 2R1LA 3P8IA 3QFEA 1VCFA 4OT7A 5HPCA 4Z1YA 2B7PA 4WJXA 4IICA 1K9DA 2YW3A 5LNUA 1O94A 3G0UA 3K8MA 2ZZ2A 2ZZ6A 4E6MA 2FB3A 4V15A 4JFVA 5JCNA 5JCLA 1F9CA 2OX4A 3GR8A 2Z1BA 3BDKA 1V03A 3QZEA 5CSRA 3E74A 2X09A 1POJA 3EXTA 1ZMCA 3OU8A 4JR5A 4MB4A 3MMUA 1BYAA 3GNNA 3L8KA 4U4MA 3PPFA 3TYCA 3KVMA 1QHPA 4DEFA 3OC4A 1AZ1A 1CZ1A 1TIMA 4A8LA 1Q8JA 3GLCA 3V1HA 2YR1A 3TYUA 3KEHA 4HSHA 3E96A 1A0DA 1A53A 2PP0A 1RP9A 3VDAA 1EJVC 3QY7A 5LGXA 3C5QA 2GOKA 3H2AA 4Y9MA 2WQPA 4JTJA 2HDJA 2EJ1A 1GZGA 3GXFA 1W9XA 4TXEA 2W91A 2PF0A 3APYA 4TVWA 1Q2SA 4WY0F 2DZSA 2P3EA 4NNBA 2Z26A 3L0NA 2WKLA 4GR1A 2OXNA 4YMZA 4US5D 3ELFA 3S5YA 2WJDA 2XIJA 3TAOA 4F0LA 3TX9A 3H22A 1H0IA 2C7FA 3KW3A 3WLHA 2VFEA 3W7KA 5LA1A 4C6PA 1J0ZA 2E6YA 4H8NA 3L0GA 3H2NA 3W7LA 3FS2A 1ITUA 4UFIA 1M65A 3UWVA 5EBKA 1XYLA 3O3RA 1M7PA 2WMIA 2WW5A 3N3TA 1VJIA 4F48A 2BVDA 1TO3A 5DCDA 4DJFD 1S1RA 2FZDA 5BXPA 5A2BA 4UNLA 3L65A 1FWEC 3LLDA 3AMGA 3IJ7A 1DXEA 4GJ1A 5F2MA 2W3SA 7TAAA 3WQEA 1JEZA 1RUSA 4AHOA 5KEZA 2HNHA 2PDPA 2W0UA 3H2EA 1TB3A 1X98A 4M80A 4KWVA 4I5RA 1RH9A 4CNUA 2RGLA 2ZADA 4PCSA 2YSWA 3GB6A 4GPNA 4HNCA 1FHUA 2E0PA 5RUBA 3CNYA 4AH7A 3CH0A 4F40A 1GVOA 1JYVA 1VFHA 3A5VA 1QJWA 2XH7A 1XC6A 1K9TA 3FHAA 4LB3A 2WMKA 5D03A 3PBVA 3W82A 2WV8A 2WSYA 4NIRA 2V5BA 1C91A 4TOQA 1O60A 1I8JA 2DT1A 3CMGA 3WZ0E 4PE8A 5I79A 3KL3A 3BC9A 3H55A 1V3IA 2VCBA 4O10A 3T2OA 3B06A 3DC0A 4EM4A 4IIGA 1KV8A 1LM1A 3O05A 1JCMP 3A5FA 4Q8UA 3SQPA 4Q8MA 3UXIA 1ZCCA 3LPOA 5FF7A 4Z0SA 1XC4A 4P5UA 4C7GA 4UTHA 4QTGA 4TVYA 3AUOA 1SJCA 3LLFA 2DY3A 4HA0A 1Q4NX 4BR1A 5KTLA 4ZOEA 1KFKA 1YBQA 3MUAA 1IGWA 2HPIA 4C7DA 3B8WA 2ZZ4A 5AHFA 1F76A 4XZLX 3QOKA 4NNAA 2J78A 2MUCA 2AL2A 4CQDA 1F6YA 1FCVA 1M6JA 2BP1A 1BPLB 3R4IA 3UJSA 1NOWA 4L4PA 5F4SA 4KGLA 1EHAA 4AD3A 2A5HA 4LPCA 1QDSA 4OE7A 5GNYA 4XKMA 1C3FA 1IR2A 4FNSA 6PTDA 3EYPA 5ER0A 5BCAA 3QFAA 3P67A 4LYKA 3UESA 1DIDA 3N2XA 4BA0A 1KGWA 2A7NA 1FY6A 1XIMA 3D3AA 3PBMA 1A5MC 3TSMA 1BXBA 3SCTA 3UR5A 5B7ZA 2ZDSA 2E9MA 3B9OA 3CQKA 3O8AA 1XM3A 1R8LA 2EPOA 1O1ZA 3EWCA 3UYCA 3VOFA 2V6AA 4H8VA 2YX0A 4V2XA 1BAGA 1QK0A 3QTPA 4K1WA 1O1HA 4H6QA 2WYSA 3PPCA 3NAVA 3P82A 3BLKA 3SGGA 4K8HA 3GC5A 4J9JA 4DPQA 1WZLA 1UKQA 2CLOA 3GD3A 3OGSA 4FDCB 3UZWA 2D24A 2YL9A 3S2CA 4A8RA 1JUKA 2YCIX 4KEMA 1UMYA 3RMEA 4R9XA 4ENLA 4LC8A 3WD1A 1J2BA 5D4YA 3UWZA 1ZJHA 2ALDA 3IJ6A 1RQEA 2CU0A 4FA3A 1L6YA 4MOZA 3AIWA 2QHAA 1OFOA 2Q6ZA 3W83A 3W27A 3UPBA 3ZOAA 1IWPA 4LUIA 2E09A 4DF2A 4H04A 1K03A 3O6CA 4IFKB 1UD8A 5GRTA 1JCTA 1DKWA 1ZSXA 2P88A 3P7YA 4JN7A 5K9CA 3MUCA 1HT6A 3GM8A 3L5MA 5ECUA 2PMQA 3PHAA 2BB0A 2WZMA 1O5XA 1W8GA 3W7EA 1OFDA 4JY8A 3W86A 2VQTA 3V5FA 1V97A 2NQ9A 2A6LA 3VUPA 3W01A 2D2JA 4LNCA 4JXCA 4YTQA 4UQAA 4YS1A 5JBFA 1T99A 3NVWB 1G4SA 3PTDA 1LPFA 3SDOA 2YL5A 1JZ6A 3VDBA 4OQVA 5T9CE 4WHBA 2RDWA 1KTCA 1GQIA 3NSMA 1XRVA 2E28A 2NV1A 1QNPA 1ZXIC 1NPXA 1LCOA 1FWFC 3HMCA 4JFSA 1ZHAA 4FNRA 4HA1A 2OFJA 4MNKA 3SAZA 5JCMA 3TAKA 1GJUA 5DT7A 2ONEA 4JX5A 3A3HA 3V0SA 2INEA 3SEPA 3R8HA 1ISWA 3LXDA 2YVGA 3LUTA 1IT0A 1Q66A 2VC7A 2YL8A 1W3KA 4PMXA 3VNZA 4QJ5B 3N9SA 1YADA 5HJXA 2X1SA 4RE4A 3E5BA 1ISZA 4LT9A 2DFAA 4K36A 5FF3A 3VC5A 2ZZ3A 2YYTA 3MVTA 1GJPA 3VD9A 4AIEA 3UJEA 5A8MA 3QLDA 1VIWA 4RE0A 4H01A 3DBPA 1A5OC 2QJMA 2VDGA 3W1NA 1EFZA 3RAOA 2Y7GA 2REQB 3L7RA 5A3HA 2PD5A 1SW0A 1H11A 1H7OA 4B9YA 3WEZA 4ECLA 4G2DA 2CETA 4UC5A 1UOKA 3UP8A 5CAHA 6REQB 1E6XM 4CVUA 5HQEA 3ZIZA 4AG0A 3S9IA 3VIIA 2VZTA 2CBUA 4ZSTA 3IV3A 3VD4A 3VD5A 2Q3RA 4XBJA 3AMZA 1GKRA 3WNPA 2VO5A 4AEFA 3EA1A 3MP4A 4ZXOA 4RNFA 1TWZA 3L4TA 5EFFA 3ZR6A 4US5A 4IHCA 2J4GA 5I7GA 3GS6A 1KM4A 3HW2A 1ESWA 2ALRA 5E1QA 2A6NA 3HPFA 4JYDA 1QO5A 4BF7A 1JZ2A 3WSUA 1ZFJA 3ZT6A 4XUGA 5C9UA 4LEQA 5HNRA 4GIEA 3D0CA 2C18A 4LVGA 2PRHA 4XO7A 3KTXA 1ZK7A 2FJUB 3LMZA 1KFEA 1E43A 3RJYA 2G3IA 3J7HA 1NU5A 3OBKA 2X2GA 2WB5A 4M1RA 2YXOA 3O9NA 1ICQA 2YPIA 1W54A 3VNDA 2VC9A 3KOFA 3WMLA 1S2TA 1EKOA 1CXIA 4RZBA 4ZODA 2GJXA 3P14A 1QI3A 3GTNA 3H8AA 1ZJBA 1OX4B 4M6VA 1CGXA 2F7FA 2HZGA 4IPJA 3FFSA 4ES4A 1I1WA 2UV8G 3HQPA 2C14A 5CZTA 3TXZA 2YGYA 3IJQA 1WDDA 1DWFM 4S3CA 2ZA2A 4AYGA 1JRBA 3WNLA 4DN1A 1XDMA 2WPEA 3N3MA 1GRBA 4REQB 4DBSA 1MQRA 1E9LA 1MQPA 5FAJA 3VD7A 3KCOA 4GQ0A 1BVWA 3HQOA 2DJLA 4O54A 1GKPA 2X1IA 3LGEA 2Z2AA 1GV4A 3AMLA 3M5ZA 2WLYA 3IGHX 2BOFX 3G77A 1LYXA 4IJBA 4PSRA 1MNZA 4D6GA 1F6KA 5CLTA 4L6DA 4X22A 3URAA 4F9JA 1LUCA 3TC7A 4NEVA 3QGAC 3W6MA 4X0VA 1KFLA 2J8TA 1U1JA 4LUSA 6ALDA 1XI3A 3GTFA 5JVLA 2XZ7A 3EOSA 3ONCA 2ZE0A 3TNBA 3VKKA 2R82A 2QGYA 2GFTA 8CGTA 3PG6A 4NNCA 1TVPA 2BLEA 2ZVRA 5TNVA 2Q01A 2WM1A 4RV8A 3OJGA 2YDSA 1V7YA 4PRTA 1A5AA 5JIWA 1DWGM 4H00A 2E5DA 3UR8A 3K30A 2YB4A 3D6NA 5HINA 2BC1A 4QG9A 3NIYA 2VENA 4DBWA 3CYJA 2DIKA 4XVDA 4L80A 4FLRA 4K3ZA 1JULA 3FVMA 3NQFA 1B1YA 4GMEA 1X6NA 1LOLA 3BH4A 2D22A 1YQ2A 4Y6GA 3NQ7A 2VJXA 3TOPA 2YFOA 3WJXA 3QR0A 4ZTXA 2ZUSA 4AIBA 4HU8A 3W7NA 4MKNA 2OWCA 1H60A 3QGKC 2VDHA 4YXGA 1NHRA 4TQTA 1I75A 2CLPA 2VZUA 4CD5A 1W31A 1EIXA 1OM0A 3ABQA 1KKRA 5HQLA 4OTKA 1JCXA 1JZ5A 1JF5A 2Y70A 4ONVA 2CERA 3UXLA 3V18A 2F38A 4RKAA 4LCQA 3CTTA 4F0MA 1M7OA 4NY2A 4IMEA 4A2SA 3L4WA 2WSRA 2QDHA 4O52A 3AIEA 3U7BA 3IUIA 2PZ0A 4Q32A 3WL1A 2ZX8A 1P6BA 4KWWA 3M1ZA 5ECVA 1PIFA 2PAJA 5BRBA 3G3DA 2CFYA 1R7AA 2ATSA 3N9KA 4HGXA 3EOUA 4EMJA 3WLOA 2WOIA 3B8DA 1UA3A 2E1DA 4CU6A 2C6QA 4BFAA 2GJRA 3IGSA 3FG2P 2YCKX 2DGAA 3L2LA 3P84A 5DMMA 2Q8XA 3LQLA 4N4PA 4DWSC 2CLKA 1JQXA 5IFTA 1TPB1 1A5CA 4Y96A 1R2SA 2EAWA 4E3VA 4FS9A 5BMWA 1YBQB 4Z42C 3HPZA 3KL0A 3KBWA 5CQ1A 3GNRA 2BVWA 4MFEA 4DF1A 4BV6A 5FS7A 1JJKA 3MTWA 3EDDA 3MSGA 2H9AA 4FLSA 3LY0A 2AL2B 4F66A 5FIPA 4C6QA 1XH2A 4OECA 4IL2A 4BWLC 4PMDA 3LM3A 3S6OA 2WBAA 4BKNA 2OZ0A 4OWGA 3O0FA 5AC7A 3DGHA 4PTDA 4Q8TA 1BQGA 3E0WA 4O1EA 1AOGA 3EXRA 5KETA 2V3EA 1M3UA 4QP0A 3UY7A 3UGRA 1S5WA 2VFGA 3L0KA 4O8RA 4IIDA 5AHLA 2JK2A 3TZFA 2C0HA 4DPPA 2W6RA 3SCNA 4F0HA 3NQDA 5DCEA 3SJ3A 4ADWA 1PWLA 1FWBC 3SURA 3NO5A 4EX4A 4Q4RA 1VH7A 3I7QA 4C6DA 3BMXA 2VQUA 5BOEA 2P5NA 1Q6OA 2V0TA 4K6AA 1RA5A 4L7ZA 2VHLA 4BQ3A 4RZ6A 1KBLA 2PLKA 1UR3M 4UCGA 2GQ9A 3KXQA 4PCTA 4ROQA 3W7IA 1F2JA 3LS9A 5C8BB 1VC4A 3V1PA 1E4MM 3WLQA 4CCEA 1S46A 2NWRA 1JNDA 4AZCB 4B2DD 3WNNA 5G4WA 2EPLX 2X7WA 4DQWA 3NXLA 4AIOA 1SO4A 2VGFA 3W1RA 4XISA 2BGQA 2Q8ZA 3GIYA 1DYSA 3F5JA 3HG4A 1TQJA 3HJEA 5M17A 3TV8A 1WV2A 2XVLA 2EG7A 4Z2JA 4MWAB 3HV8A 3MUXA 1V6VA 4JX6A 3W2MA 1WUFA 3B4UA 4F0SA 4H7CA 1LJYA 2PDWA 4TX9A 3QXBA 2YLAA 1OF6A 2CBIA 2YQUA 3TXVA 2I17A 1B57A 1ONRA 4D6FA 4P7LA 1M7XA 4LF2A 3TSDA 3CZ8A 1QW7A 1A4MA 3LPGA 1OC6A 4GNKB 3L12A 4P7RA 3A7UA 3N6QA 3GNDA 3RCMA 1S5TA 1SGJA 5E9AA 1XLLA 4G5DA 2V5KA 4DHGA 4AD2A 2NXHA 5EBAA 1WKEA 2X8RA 1PDYA 3LHWA 4FP1A 2JIEA 3TTEA 4IMFA 3HQNA 5FF2A 5FJRA 3SCOA 2PWHA 2YA0A 3GUGA 5CEWA 4AXKA 5C2XA 3B0PA 3OLGA 2HTMA 4W84A 4EK7A 3SUVA 1UASA 3N2BA 3BTNA 4U5KA 3SBFA 3G1VA 3FGCB 4IZGA 3L67A 1V3MA 3MP3A 4H4XA 4NX5A 3EWBX 1PAMA 2NZLA 1SSGA 3EXSA 1V6WA 2C1HA 3A24A 5A94A 1BXCA 1H61A 4UZSA 2A7RA 2ZZ5A 3P5ZA 2AKMA 5C9XA 4IQJA 3CC1A 1J01A 4R9OA 2BY2A 1L2UA 3P6LA 4I7VA 4UIOA 1UWIA 2B0MA 4GIRA 4IIFA 4H9MA 1OB0A 5C2GA 4OIFA 2XFRA 4EXAA 1DEDA 4LQ1A 1YTDA 3S2LA 3OTRA 3M4HA 1KV5A 2OLAA 1TMLA 2CHRA 4B4FA 3AQUA 3PTMA 2IPJA 4B3LA 3EKGA 2FDSA 3O7UA 2AQVA 4H7VA 1B4KA 3TQKA 4PRWA 3V16A 4Q3MA 2UY5A 3QQ1A 2QEZA 2VCCA 5CKSA 2IKIA 3EA2A 3K46A 1FTXA 1W5PA 4P2VA 2RKXA 4HK7A 2ZZCA 3WUFA 1CPUA 2VMFA 3NURA 5TR3A 3WLLA 4PUWA 3ZVHA 4JICA 1YE4A 3II1A 3ZR5A 1C8YA 4AWSA 4ADTA 1AW1A 2IPGA 5FEWA 4N2YA 2BV9A 4EKJA 1SJBA 4O8AA 5K4ZA 3N18A 1NSJA 4NU7A 4QQUA 1PE1A 3THUA 3A64A 2WMJA 3KBSA 3RX2A 3NQMA 1GVYA 5C54A 2WZEA 1WYGA 3CBWA 5FSEC 3DXIA 5KITA 3CU2A 3WH9A 5MF5A 5CBBA 4GY1A 1HVQA 3ZWTA 1D7KA 3NQ8A 3W7OA 3WUBA 1SSDA 2XSXA 3KAOA 1OJXA 3FEMA 3IAQA 4Q22A 1UKPA 3CPUA 4QSFA 4GH1A 1EYEA 4MADA 5U1OA 2ZX6A 1H7RA 5BOOA 3N19B 1JCJA 2RHGA 1MXGA 3SSJA 3DZ1A 1XBYA 1V3LA 2NVKX 5CZKA 3URBA 1Q1RA 1NFBA 4TIMA 4FXRA 4JNMA 1XANA 2OODA 1ONFA 3F4DA 2O7QA 2PDUA 3SCWA 1VDVA 4CN4A 4EWND 3RU8X 4EQSA 3AHZA 4PMUA 2INFA 3NZQA 3GXMA 2VVNA 3ZJKA 2X0SA 3NO1A 5D37A 2NX3A 2V3AA 1CGWA 4Q4SA 4LYRA 1B5TA 2F84A 1OYCA 1W9PA 1KM6A 1RM6B 1UQZA 2NSXA 2E6AA 3P61A 1TJ0A 1G94A 4XZIA 1N60C 2EF9A 5AHNA 1NP0A 5CLWA 5LIUX 4WEVX 3QYSA 2PFHA 3H12A 3C52A 3T9PA 4E8GA 1TTIA 2Z29A 2JQXA 4KW2A 4OHQA 1UW9A 3CAVA 4REQA 1UR4A 3MHUA 1VLWA 2POZA 2QV5A 2QJHA 3EPMA 3OYZA 1GOWA 2WOQA 1E72M 3U5YA 2D1ZA 1MYRA 2P50A 1FOBA 2PI6A 1BVNP 1HFBA 4HSNA 4GYPC 1TV2A 3BCDA 1ZPTA 4V27A 5AZ0A 1CENA 3LM7A 1HJSA 1PCKA 4S1FA 4TV6A 5KZDA 4WSKA 3HF3A 1B0IA 3DG7A 2X0YA 2QIIA 1Q7ZA 1Y5VA 5D2YA 3C8NA 3EOEA 2G3NA 4Q7IA 1IHIA 1W1VA 3VNMA 4DWSB 2X2YA 2SFPA 4NYYA 3DFTA 1NDYA 3U2EA 5A8NA 3KHDA 3S0CA 4O4VA 3AYTA 2IKGA 4LY8A 1H50A 3GVWA 2PDXA 1VQTA 3P60A 2X05A 3OZMA 3C61A 2PP3A 1TJPA 1AH0A 1BF6A 2QUMA 5KSWA 1VBRA 1GK8A 2J9ZA 4NUWA 2OGJA 1NF0A 3WK1A 4AUBA 4C1LA 1KRMA 3RILA 3GNPA 1DXLA 1YMYA 3SGUA 5EKYA 3AALA 3CUHA 3PTKA 4DJDD 3LDVA 4XBKA 1JZ4A 3TTYA 1UHVA 2DVUA 3V0UA 1R3VA 3H24A 3GAYA 1LTDA 3K1GA 4PA8A 3EPOA 3ARWA 4W87A 3VDHA 1E9ZB 3LMYA 1OADA 4J3VA 1EDTA 5FL0A 2PRMA 3VIMA 2Y5EA 1THFD 4JQ3A 2WOWA 1J96A 3E3HA 2FPYA 1XCWA 2CLIA 5I3JA 3MA8A 4GYKA 4JN6A 4Y9OA 1XDLA 3TYZA 4FXSA 3KBJA 1W1TA 2EQ6A 1YPIA 3KBNA 2C3DA 2P76A 4H83A 1UUQA 1RLCL 4XBSA 4NAEA 1OGSA 2CZDA 1GVSA 2PWFA 2FZ9A 4O11A 2A3HA 1AA1B 4POCA 5F4WA 3ITXA 1OFRA 3N9RA 3MMDA 1JZ7A 2X40A 4QBXA 2DZVA 2OZ8A 1UWAA 3BE7A 4A3UA 3RM9A 4KWOA 3T1GA 1VGAA 2AMGA 3KRUA 3L23A 4DNAA 1KCLA 3BUVA 3URNA 3C0QA 3DENA 3SN1A 1BTMA 1JCYA 2HNEA 3EMCA 1VQZA 5G4HC 3VILA 3VDCA 2YCJA 4UQDA 1XFCA 4AMCA 2ZZ0A 3GRTA 3NFUA 3GK0A 1KM2A 3LU2A 2R1PA 5KZEA 1O68A 1K6WA 1NARA 2DP3A 5I5RA 1MW3A 1J0IA 4PL1A 4HHMA 3TVAA 4CCDA 1BWKA 2Z7KA 4KIRA 3GRIA 3K4DA 4FIRA 2FB2A 2YOCA 2PTXA 3MS8A 4C6LA 1KQZA 4IUGA 3WY1A 4AX7A 3V3WA 1RXOB 5AN7A 5AC8A 4RK8A 4HNOA 1BD0A 4MJ4A 3V7PA 4GUIA 2HISA 1JI1A 1XIBA 4ATLA 3OO2A 3GVVA 1KXHA 4HZ8A 3IIVA 3SUWA 4DRSA 4FNPA 2O9OA 2WNZA 3P62A 3GO2A 3QVQA 4JYFA 3CQJA 2QAFA 4XAFA 3LV5A 3LXCA 4GUJA 4NZCA 4BK9A 2ABAA 2HSAA 3IVSA 2BASA 5CBIA 3I6RA 3DEQA 4LTSA 1E4LA 3I65A 4C1NB 2FZ8A 1AODA 2D23A 2J7CA 4MIMA 3LCHA 2O9PA 3QSTA 3ARXA 2P53A 4C6MA 3KRBA 3XIMA 3TTOA 3VIJA 5LZLA 4QDWA 4S3BA 3BGAA 4MYAA 1KWGA 5C0QA 2V82A 4OBSA 2O55A 3CM4A 3FYOA 1A5SA 4XSMA 5HR6A 3NGJA 4YYCA 3LHTA 3Q45A 3SN0A 3L9CA 4PFMA 2PC4A 5FAGA 3UZZA 1VBHA 3NQGA 4V1XA 6TAAA 4KEVA 3HG5A 3TQPA 4MWAA 4BWLA 3P0XA 5FESA 2V67A 4AZIA 3BV4A 4Z2HA 1JEHA 1HW6A 3ARVA 5FJUA 1PX4A 5A2CA 3M0JA 3LRLA 4IQDA 3F5KA 1CXFA 1EWEA 3S8HA 3U2OA 1REQA 2VTFA 4MZ1A 3QV7A 3FJ4A 4WJ8A 3LADA 1B3OA 2CHNA 2GOUA 1TJ2A 2QS8A 3WDIA 1BKHA 4CQBA 3BJTA 4V33A 2C79A 1BXNA 2DZTA 2C13A 3BLFA 1RP8A 1YW1A 4FX7A 3B4YA 1DVJA 4L56A 3S6TA 3GH4A 3QH2A 1JFXA 1SJAA 2FGBA 3VX1A 5F2LA 3T42A 3LGGA 3REQB 1UKOA 3UWEA 5D2XA 2FHCA 3E2SA 3KLLA 4QXIA 3DI1A 4AZ7A 1B9ZA 1V7AA 3WH5A 3WENA 3KWSA 1XYBA 4MMWA 2IQDA 4D6DA 1DJWA 4RUBA 1R3YA 1XCXA 1V59A 3IUDA 3UD6A 1YHTA 1W37A 3BOXA 1JIBA 2AGTA 3II4A 1A3XA 4QSHA 4RR4A 1F8WA 1XUZA 3DFNA 1CT5A 3G1HA 3C3NA 2VKZG 1EPXA 1M03A 3NQBA 2H8ZA 4LVDA 3W02A 3E6EA 1LQ0A 2G50A 2TODA 4BY3A 1CEOA 3NCOA 2QDEA 4WF7A 3WJYA 3S5SA 3GDBA 1VLIA 4DO6A 5HUOA 3VMPA 1N5WC 1XLAA 4QISA 5HJLA 1JYXA 4IMCA 1WAUA 1KXQA 2ACSA 1FKXA 3PAOA 2GSJA 3F4CA 1VFOA 3BW4A 1V6UA 3BL3A 3RM4A 4D6HA 1Z32X 3AZTA 3R0UA 3GHSA 1DQXA 1IZJA 3CYVA 2Z27A 4LXFA 1E55A 2CCRA 5D30A 3MV01 1XLFA 2XJ7A 2PURA 2F6XA 3ISIX 2OT0A 2JIWA 4J3SA 5AY7A 2WOVA 3AIQA 4LCSA 2AMXA 2QJJA 4WCJA 3ZVHB 3STFA 2BBFA 2VX6A 3DKLA 1GRFA 1UZDA 1QFEA 3H4GA 3Q4DA 1MRQA 1CLVA 1WAWA 3OPSA 4PBFA 4W89A 1LLZA 1DORA 3A4AA 4QEHA 1IT7A 1TPVA 1EUNA 2ADAA 1LL7A 4LAZA 2XGZA 3UW6A 4R7WA 4E0CA 1VENA 2WWDA 5BXRA 3W7HA 2XYLA 1J5TA 1RQBA 4WSHA 1SW7A 4XZBA 1TV3A 1QMLA 1M01A 1UD3A 1FCQA 3VVGA 3HZ3A 1S2CA 4FX8A 2E40A 3BJFA 1ZS2A 2PDBA 4WD0A 3CTLA 4F79A 2OR2A 3NVTA 1JXKA 6ENLA 1FEBA 2XM1A 4AWUA 3DG3A 3BAYA 5FD0A 1EDGA 2OELA 3FA4A 2CDUA 3VZXA 1RJPA 1V0NA 2PPGA 3L5LA 3G1XA 3POHA 1LT8A 4HMDA 3TYAA 4UQ9A 2CXEA 3FSTA 3LCIA 2WHLA 4CQ8A 4FLQA 3C2FA 3LENA 5I6SA 2R91A 4G7EA 2O4MA 2C19A 3SUTA 2QAPA 2FTPA 3WF0A 4OV4A 5HAOA 4RLIA 5HATA 3W7JA 3MCMA 4DJFC 1MO9A 3G22A 5DQPA 2GQ8A 1JAKA 2QCEA 4WDUA 3UA3A 3ME3A 3R94A 2G95A 3WQDA 3ECQA 4JQ1A 4XQ6A 4O0ZA 2XPKA 3QPZA 4GUFA 4BI6A 1H7PA 4QFUA 4PFHA 4L1WA 1O4UA 1HJWA 5CC7A 1FHLA 5CPLA 1WO2A 1HL2A 1KCKA 1XLEA 4BCEA 1OFEA 2Q09A 3ORWA 4Z1BA 1MXDA 1JGMA 2ZRXA 5G5HB 2DZPA 3TW7A 5DANA 4O19A 4YWIA 1GRGA 1XDIA 2PDKA 1RD5A 2VZSA 5DXXA 5H8PA 3SCUA 4YTTA 2VFDA 2L5HA 2BFGA 2Z6IA 3VKJA 2RAGA 3WD4A 1XHCA 4IFRA 3CPRA 1F73A 4HK6A 1IWAA 3GXIA 1UBPC 4JKMA 1YX1A 7REQB 2XTKA 2WPBA 3N11A 4EQXA 4GX9A 1W2VA 1UP0A 1W5QA 2PBGA 1TWSA 4UTMA 3CL7A 1R7OA 4PGLA 2LLEA 3GFZA 4UFMA 3TNOA 3PULA 3EA3A 2Z00A 3VOHA 4U31A 3GXPA 4GA8A 4UQCA 1TUXA 2ZXDA 2VM8A 1J93A 2Y8KA 1K4HA 1MVYA 5AZ1A 2XVPA 4UTKA 1OD8A 3VNLA 3E02A 4HOXA 2E8ZA 3H7UA 3I4KA 4PB4A 1EBGA 1JG9A 1FFQA 1NOUA 2A3LA 4TU1A 3DKJA 4I9TA 3B0XA 2C1IA 4JTTA 3OLDA 3SADA 5E0CA 3HURA 2G3JA 4IIBA 4C6EA 5IRPA 2XH0A 3L2IA 3VA8A 2VYOA 4LCRA 1K8ZA 2R8WA 5D09A 4IFKA 3UWYA 4F4RA 1UR9A 4K68A 4UOZA 1MMFA 2A3EA 3WG6A 1EP2A 1TCMA 1ML1A 4UTWC 1QK2A 4Q4OA 1G01A 4AZ6A 1EDQA 1DPMA 5D8ZA 1R2RA 2A85A 2CNCA 3OODA 3AMKA 3AOFA 2VNCA 1UMLA 3RPMA 5BWFA 2BY1A 2TPSA 1E0TA 4V28A 1J11A 2PTYA 1P0KA 1ZLPA 1A5NC 4YVVA 2ZFAA 1G6CA 1XH0A 2ZC1A 4S39A 1ISVA 4LRSA 5HXMA 4ZO8A 4HU3A 1J12A 1TMQA 3U48A 3IIZA 2R94A 3NL2A 1TVLA 1UWSA 7ENLA 3M5XA 3VXGA 1B3XA 4H4IA 3FAWA 5G2HA 5EYWA 5EPDA 5M3WA 4S2CA 4LV4A 9RUBA 4Q6XA 3B05A 4I5UA 1TMHA 1CWYA 3ZLGA 3CAKA 1BYCA 2PGEA 4HOWA 2C1GA 2QAEA 2HXUA 4Z2LA 3EDKA 1U22A 4MZYA 3LBMA 3PZ9A 1N82A 5EU9A 1YNYA 3IVUA 1OFAA 3BK0A 3BCJA 3ZZ1A 2JGYA 2YLLA 2ABBA 3E5PA 1U83A 1EJRC 2MANA 1QBBA 4FOKA 1E6PA 3UEQA 4QLKA 1SZFA 3C0SA 3CZJA 3TFXA 1L8PA 4GE8A 3SY1A 3GTIA 2XGIA 1E1EA 3LGDA 3HFYA 3SR7A 1K8XA 3A12A 2REQA 1P6CA 1Z41A 2PDCA 3PNZA 3WBWA 1Q3NA 1EGVA 1SMAA 3WLMA 4FNTA 5AB3A 1HTIA 4R34A 4C7FA 1EC9A 4BQ4A 3QEZA 1DJIA 1G0CA 2XIOA 5JU6A 1VAHA 4Q7NA 4DUXA 4AWTA 4Q7BA 1MDLA 4UFHA 2ZRUA 3HBLA 4PMQA 3MUY1 2QDGA 3GDMA 1AG1O 5CG7A 1L8NA 3GNOA 4YWSA 1ZY8A 1OGGA 1FIQB 4X2PA 3NQVA 2ZUNA 2F61A 2P8CA 2PDNA 4E38A 3WF3A 4WQ6A 1W3NA 3EB4A 4G56A 1NQ6A 5LNVA 1FWRA 2E9BA 2D2HA 4WDTA 2OLHA 4B90A 1P1MA 1TTQA 1JDCA 1SPQA 4UR8A 2GRTA 1W2PA 2UY4A 4PUJA 1EOMA 4NQ1A 3UR7A 4H6KA 4JNZA 5AYZA 1XIDA 5T8GA 2Y8UA 3TYDA 4PTMA 3C2VA 4YPJA 1AW2A 4X3ZA 4L64A 1A49A 2CWNA 1NH6A 2UY2A 4H4VA 4TX6A 2HBVA 5ABFB 3VKCA 3H54A 4GO8A 3VAVA 1KBJA 4ZXLA 4ZENA 3O6DA 2ZDRA 1IIHA 4FZIA 4E2DA 5M2FX 2VEKA 1WX0A 1ME9A 4ATWA 5D9PA 1V08A 2Y1HA 4I6KA 2GJPA 2VI0A 3VO0A 4AF0B 1HNYA 2PU1A 3TN3A 2NLIA 4JFUA 3HV9A 3WQWA 3W1QA 3QC0A 2F5ZA 3QKZA 2RDUA 5H91A 1YDOA 3EX3A 3W7GA 3AIUA 1Q2RA 2EG8A 4L9XA 4NYUA 1BTCA 3FHQA 3QKEA 1POKA 3RDKA 1TPEA 2QKFA 3A3XA 1TRIA 1JRCA 4HP5A 3LB8A 4GI6A 3PG8A 3T0TA 1XIEA 2FH8A 5KMYA 3AMDA 3EMQA 3H2CA 4QJ1A 3PPHA 3CUZA 4LBUA 1VPYA 1WXYA 1F7BA 2GUUA 2X0HA 3AZSA 1FWIC 1XLJA 1OVDA 1KFCA 3RX4A 2B7OA 1JI2A 2WSQA 3GU2A 3GRSA 3A7AA 3OZPA 1UPMB 1QBAA 1ZAJA 1RZMA 2PGRA 3E2VA 1ZRQA 1AH4A 3DC8A 4JIEA 3WQGA 2PF8A 3H70A 3F4NA 5U4NA 4PRRA 4G1KA 4XTIA 3WLPA 4MPKA 1V93A 1VJZA 4UTIA 1Q1WA 4ORIA 1SU5A 1J6PA 4GG9A 4DYJA 1GTEA 4UUIA 1G7UA 1FHDA 3VX0A 2WCAA 4WR3A 5I07A 4FIQA 1R3QA 1VYSX 3CL6A 5AYBA 4PUMA 2XIQA 1HQTA 2A0NA 1ZP4A 3ES8A 3UVAA 1PKNA 1L9WA 5H1WA 3CGEA 3H2OA 1L6WA 1OQFA 2QCMA 1ISXA 1WBJA 1ZBWA 4FO4A 2WHKA 3EF6A 1LF1A 3PZTA 4MJMA 2G8ZA 1C7SA 1YDYA 3LCWA 3KP0A 4NZFA 4K8DA 3QY8A 2G97A 3UA4A 4XZNX 2QF7A 3POCA 4IGNA 3IJ9A 1BKSA 3PZQA 1XINA 5E6YA 4IPPA 1UIOA 4O50A 3WNKA 1CECA 1SR0A 1XHGA 3C3UA 4RXFA 3O1NA 3QGVA 4QDPA 1E9IA 2BHUA 4ACZA 5JCIA 5F2GA 1VYPX 2VOTA 4EMIA 1EGMA 1ME8A 4MDPA 1TX0A 4HTBA 4LV9A 4LYQA 4E2OA 1C93A 2NX1A 2ZRZA 1LOQA 4AHQA 3LHYA 4AB4A 5LXEA 2OWXA 2QULA 1YXYA 2WNNA 3U4FA 4C6OA 4GD0A 1A0CA 2PE4A 5GNZA 1GQNA 4QLLA 2ZC8A 2PDJA 5FJIA 4GGBA 2R6OA 3F2CA 4K38A 3TMQA 1XRSA 1S2AA 3LSBA 2YL6A 1TPDA 1V4YA 2QUTA 4QJ4B 3NSXA 4JTEA 4FSAA 3S1WA 3AHVA 3AMCA 1NP2A 3TN5A 1UWUA 3HN3A 4ICCX 4WXYA 3NZPA 1TYTA 1E1CB 5I77A 4JAWA 2PA6A 2V5JA 4TX8A 4XO6A 2HEJA 3T40A 2PLJA 1KW1A 5FOOA 4QHRA 3U3HA 1AMKA 5BXTA 5I3DA 1F07A 1U5HA 2ASHA 3RLUA 4O12A 1B9BA 3QR3A 4MWAE 2J9XA 1O5QA 1R30A 1BFNA 1IGSA 2GL5A 3WLRA 1ZBKA 4AVFA 2DZWA 1PSCA 1W3LA 3PJXA 3R58A 5HQMA 2RFGA 1MZRA 3VGFA 3AYVA 2WKGA 4BEUA 1QU4A 4MAVA 1P43A 3OYXA 2PDQA 2ZX5A 3AROA 2Q8LA 4GCAA 3INPA 4CNOA 2YJQA 1US2A 1M7JA 3R12A 3VMNA 4D6JA 3U7VA 1SZRA 3WF2A 1VCVA 1PZ0A 1FWDC 3CO4A 3KWXA 1PX3A 3W9ZA 2QUVA 4J4KA 3DOPA 2I1OA 4AY7A 1FDJA 3R11A 4DJFA 1E3XA 4GO9A 3CEPA 2TMDA 4DJEC 3N2CA 1QRQA 1MW1A 1GJWA 3NOEA 2QGHA 4MNJA 3CV2A 1TV8A 3KS5A 3FLUA 4XZWA 2WNQA 3QFBA 2J77A 1ZDLA 1L2QA 1L6GA 2RGMA 3MDUA 2Y88A 4QX4A 3UXDA 4AX6A 1UR2A 4Y9NA 4NILA 3E38A 4M51A 3URQA 3P74A 3LX9A 2E4TA 2WHJA 4LW7A 1NHQA 1R0MA 4GK8A 4MFDA 1V6TA 3RX3A 5A8GA 3HJZA 1W9VA 4PMOA 1EPVA 3BSHA 3SSZA 3C86A 5A1AA 5LA2A 4QITA 1ZBVA 2ZYFA 5DO8A 2WMFA 4UTWA 2E77A 1S38A 1UP3A 3BO9A 2WPFA 1E51A 4M8UA 3ZXWA 1A5UA 1OG6A 1OIFA 4AZCA 5BU6A 3ALGA 6CGTA 5I3KA 5FJPA 3MVIA 4H9ZA 4K7ZA 2I56A 5IOBA 1ZKQA 4AU0A 4X60A 3CGBA 7XIMA 1C8VA 2QJGA 3ZM8A 2QVHA 3WLIA 3VOCA 3B8TA 3AWNA 1NHSA 3U0HA 2OQYA 5H8UA 3GFXA 4PUKA 1DJHA 3W1LA 1DJNA 8XIAA 4Z2IA 4F9DA 2PWDA 3IACA 3KOZA 2G96A 5LGZA 1LDCA 1RK5A 2Z1SA 4CEUC 1ZMDA 2XDFA 1ITQA 1K8YA 4MY8A 2XIMA 1H7NA 3HOJA 4R7JA 2CYGA 3N4EA 4AC7C 3R43A 1ICSA 4NZ4A 1PXGA 3WDHA 2DSVA 2ZX7A 4ILSA 4XZHA 2VXNA 4HD5A 4FHAA 3QYQA 4AISA 2ESCA 1ZL1A 5CCZA 1DJGA 2E5CA 4JIIX 4RDVA 1G4TA 3CB8A 3SFKA 5JBEA 4I8DA 5JH1A 3PZOA 2X50A 2Y7FA 3FKKA 3BMVA 3N04A 3THCA 5J5RA 3NGFA 3QHNA 3LXBA 5HNUA 1LLWA 3EKZA 4HPHA 5G5GB 2X41A 1N61C 3UZYA 4HKPA 1IXNA 3VOGA 4FOUA 3Q6JA 3CS2A 3GKAA 2IXVA 3WMCA 2QMKA 2Z1VA 2B4GA 4X63A 2EPMX 3T09A 2W62A 3MKCA 4X0NA 3CO8A 3LN3A 4R53A 4NZ5A 3VMOA 4ERAA 3DFPA 1K3UA 4BJHA 6XIMA 3H2FA 4L6HA 3QFWA 3WQVA 3NA8A 4JDYA 3QV9A 4MAZA 1Q8AA 3DESA 7CGTA 1GZJA 4NG3A 1US3A 2INZA 3LZ3A 2TAAA 1Q7MA 1UOZA 4M7TA 2QLYA 3N73A 1H7WA 2ISSA 4XZMX 3TP4A 2YVFA 1GTHA 1PV8A 3THQA 4O0QA 1RHCA 3BGGA 1KLZA 4O16A 1XKYA 3HPXA 2J66A 1NFGA 3VUSA 1ME7A 3WELA 3VNYA 4GJJA 3N13A 3B40A 1IEIA 2FQIA 2DT2A 3T0AA 1RBAA 3RNDA 2PB1A 4H8UA 4CN1A 2CKSA 3KFTA 3S9YA 4XB3A 4I8YA 1P7TB 4Q6JA 3BAXA 5BRQA 4RDYA 4M7SA 1GXFA 4GXMA 4QGCA 1OWQA 3B03A 4FI4A 2PDFA 1GESA 1MW2A 1TE1A 5DX7A 1GOOA 3WQOA 4F2UA 4W85A 1F8MA 4GXWA 2WSPA 3TOYA 1EGZA 1OC7A 3TONA 3W2KA 3TZNA 3Q37A 1EP1A 1GEQA 3GVQA 1F74A 3BSGA 3CUJA 3QMRA 1J4EA 4QE4A 3SQLA 3HPAA 3PR2A 2GUYA 4IX2A 4K1GA 4ZOCA 3M6DA 4JTHA 2WVVB 1Q6GA 3SM0A 1NHPA 4XD5A 4AY8A 1GRAA 2PGFA 4KRTA 5C9WA 2I5GA 3W1AA 1A5LC 3BAJA 3CLWA 1XBXA 4AVOA 4EP8C 1G69A 5HMSA 1D7YA 2NSOA 1FKWA 1DWAM 3SUSA 3IJIA 4EAMA 2F8QA 5AHMA 2YYUA 2VX7A 3S9ZA 1PZ1A 1SMDA 3W71A 4H4YA 1OZQA 4PMVA 2DJXA 4CD7A 5ABFA 3IPWA 3SRFA 2GGIA 4DNHA 3GWQA 4W93A 3UQNA 1CDGA 2AAQA 1XICA 2IQTA 3R2GA 4XKYB 2PGWA 4D1JA 3L5OA 2Y6ZA 5KZMA 1AJ0A 2VRQA 3HGRA 1GQJA 4ZFMA 1XG4A 3S1UA 3WQCA 3XINA 2Y7DA 4LBSA 1JPDX 4WIWA 1TPWA 2EQDA 1ZCOA 2WNWA 1KFBA 4XAZA 5C70A 7A3HA 3CZLA 3HGJA 5PTDA 3WKZA 2B7NA 1BYBA 5D38A 1DP0A 4RDWA 5ABGA 2V5DA 5KZ6A 2OYMA 1PB0A 2J9YA 4H9XA 5DRIA 4ATDA 3ICJA 4HA4A 3WUGA 1KWKA 2BZNA 3W24A 1A0EA 3A4JA 1OEPA 2O9TA 2W0HA 5DFAA 2ICSA 1RSCA 4J56A 5T26A 1N63C 3N29A 2ISVA 4AZHA 3F4VA 3G1YA 1RY0A 1WQ5A 4MSSA 1I2RA 3CUFA 2PP1A 4XWUA 1X6UA 4L4LA 3TJ4A 1G1YA 1LORA 3FAXA 3EWXA 4XD4A 2O0TA 3UR2A 5CPSA 1UG6A 1Q6QA 1M41A 1JDDA 3M0IA 1TX2A 5FJJA 3QSRA 1HKVA 5KVHA 4LFYA 4H7ZA 3UF9A 1BGAA 5IXEA 2IQ0A 2C8NA 2C16A 2C71A 4RE2A 4GH3A 3W23A 3MO4A 3G2GA 4XSLA 1XLBA 1LP6A 1EBHA 2PWGA 4H9TA 3GXNA 3FV9A 4JFTA 3SI9A 3B8SA 3L4XA 4GRSA 3BLOA 1S3HA 2V30A 2WM0A 1X7FA 3KTSA 5E0KA 1QNQA 5FMHA 2VFIA 3KDOA 2QT3A 5G1YA 2ZTJA 4IPLA 2XVKA 3K2GA 2CZVA 3UETA 3PFRA 3UWUA 3TJXA 4HTYA 1AQMA 3CXBA 5A2AA 1YPFA 1M1BA 3ZJ6A 1GVEA 1QPOA 4RX0A 5EMYA 2YBVA 1U2YA 2JEPA 1A5BA 3CAWA 5LNRA 4C6BA 4DJDC 4GINA 2CXGA 4HN8A 2JGQA 5I06A 3ZLHA 4HNLA 4KWSA 2MNRA 3NQAA 3ZS4A 2RUSA 2J6XA 1AJ2A 1KR0A 4PUUA 4ZOBA 4D72A 4QE1A 2W66A 3N14A 3WQ8A 3GVRA 1I45A 2OEJA 2O92A 5I3IA 4JTFA 5BW6A 4JDRA 3PUEA 2BOGX 1HKJA 3DGZA 3WMBA 1DXFA 4PN2A 2P3ZA 4N4QA 5A6SA 2D20A 4NI8A 4LA1A 5AC5A 5C5YA 1XQKA 4MYXA 2VC6A 4KFNA 2NPXA 3JR2A 2NX9A 5XINA 1RCXB 3BG5A 3UG3A 1R46A 4K8GA 3OLIA 2A2IA 3C6CA 4Q8PA 4Q4QA 3GYCA 2Q71A 3WN6A 1QW9A 3LI1A 5CSUA 6REQA 2NQJA 1JVNA 3JRKA 4Q4KA 3ZYZA 1R2TA 2O56A 2CLHA 3W7RA 4IX0A 1WYIA 4G7FA 4S3EA 1VBUA 1AFSA 4YN5A 1W1B1 4WXZA 1M04A 2XIBA 3T07A 1IXPA 4B5WA 4ZO7A 5C7HA 4HVXA 4MZ8A 1XFBA 1YYAA 1W56A 3GUWA 3EWYA 2ISFA 4U3CA 1FWWA 3VCNA 4Y7EA 2BVYA 4NXSA 5LXXA 3BJSA 5JMUA 3OZOA 4WJEA 4PC8A 1JAEA 4JY9A 2W63A 3EGJA 4GNJA 4LOCA 5C7VA 3GD6A 1GG1A 1E71M 4PEEA 1QNSA 2O7SA 2OPJA 2JF6A 2J6VA 1J8VA 3CQHA 3G5EA 1MEIA 3RR4A 2DSUA 1ZQ5A 3L21A 3WQ4A 3DCPA 3W87A 5AOUA 1QTWA 3T8QA 3T6CA 2W3RA 5LIXX 2O9RA 2Z6JA 3BG3A 5C55A 3CIWA 3WQFA 1QNRA 4KBXA 4PTWA 4WOZA 1YTKA 6XIAA 2WLZA 4F2TA 2JKPA 3ARTA 3W76A 4XD6A 2PWVA 3G8RA 4I7WA 2JFEX 2Z1XA 3W7DA 2Y2WA 2FZBA 4I7UA 1LG2A 4GWEA 1O95A 3NVVB 1W91A 1IR1A 1UR1A 3LYEA 1M6IA 4HNTA 5JXQA 1GPWA 3MSRA 4C1NA 2ON3A 4DAFA 3UCDA 3DHDA 4YHGA 3DYMA 3NZ1A 2VD9A 2Z1KA 1X97A 3TIMA 5AECA 3O16A 5G2WA 3LEPA 1XJBA 3PZMA 1W5OA 1B2YA 3D3FA 2P10A 2A21A 4CVWA 1W3IA 3WYZA 2W27A 3CEUA 4L1XA 1YLVA 3VYLA 4D8AA 1TTPA 1MI3A 4JIQA 4CU7A 2PBOA 5ENLA 1GVQA 3FKRA 5BRPA 3S1GA 4NZJA 5G1MA 3S2JA 4MGGA 1YRRA 3RR1A 3B0YA 4KEZA 5FEPA 3AC0A 3KE0A 3ITVA 1O66A 3O2LA 3MZ2A 3QW4B 1IQ8A 1YE6A 3KVLA 5FJTA 4R5EA 4MB1A 2QVNA 3PF3A 3AXMA 1TQXA 4JZ5A 3D9XA 3VTRA 1LBLA 4C65A 4JTIA 1Z3NA 2D3NA 2VL4A 1OT2A 2VWTA 1I2QA 1P0EA 2VX4A 1JD9A 3PJWA 3ZSSA 1HP4A 3IJ8A 3BICA 4EPEC 3PJTA 4MY1A 2WC3A 2DVXA 5BROA 1EO7A 4KERA 4CCZA 4AD4A 4ZE5A 3M0KA 4TUFA 1JD7A 4I9AA 3FEQA 4KIEA 2PCQA 3JVAA 1DHKA 4JTQA 4OOUA 2JBMA 3QQ0A 4JKKA 3VGEA 2WZIA 1AMYA 3ABOA 1HO1A 1WDRA 1K4QA 2YA1A 4B4HA 4ZEPA 4WSJA 2AGKA 4KPRA 4XAGA 1XIGA 4J3XA 4H6EA 1K4GA 2DUAA 4J7RA 2DQWA 4K39A 1QPQA 1BVZA 1O6IA 1R5YA