2QDDA

Crystal structure of a member of enolase superfamily from roseovarius nubinhibens ism
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
370
structure length
368
Chain Sequence
b'SLRITRLTVFHLDLPLAKPYWLSGLKFDRLDSTYLRIDTDEGVTGWGEGCPWGHSYLPAHGPGLRAGIATLAPHLLGLDPRSLDHVNRVMDLQLPGHSYVKSPIDMACWDILGQVAGLPLWQLLGGEAATPVPINSSISTGTPDQMLGLIAEAAAQGYRTHSAKIGGSDPAQDIARIEAISAGLPDGHRVTFDVNRAWTPAIAVEVLNSVRARDWIEQPCQTLDQCAHVARRVANPIMLDECLHEFSDHLAAWSRGACEGVKIKPNRVGGLTRARQIRDFGVSVGWQMHIEDVGGTALADTAALHLAASTPEANRLASWLGHAHLADDPIPGQGARNRDGLATPPSAPGLGVIPDPEALGRPVASYDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of a member of enolase superfamily from Roseovarius nubinhibens ISM.
rcsb
source organism Roseovarius nubinhibens
molecule tags Structural genomics, unknown function
total genus 120
structure length 368
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2qddA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2qddA01
4J1OA 3IK4A 4IL2A 3VCCA 2GGEA 3Q45A 1PDYA 4A3RA 2GSHA 3DG3A 3NFUA 4MMWA 3TJ4A 1JDFA 3FYYA 4MKSA 2XH0A 1SJAA 1XS2A 3VC6A 5FJTA 2PTYA 3ENLA 1IYXA 4H83A 3NZGA 3TQPA 3DERA 1MDLA 5EU9A 4FI4A 3SN0A 3HPFA 4HCLA 2HNEA 3ES7A 2O56A 2OZ8A 2PPGA 2XH4A 1R0MA 2PU1A 3EEZA 2MNRA 2PMQA 3TWAA 4DWDA 3R1ZA 4KEMA 1R6WA 4X2PA 3VCNA 3DFHA 3IJLA 4E8GA 2NQLA 2OX4A 1FHUA 3ZVHA 2HXTA 5J04A 3ZVHB 4Z1YA 4JN8A 2HXUA 4A35A 4DX3A 4HYRA 4ENLA 4ZCWA 1FHVA 3QPEA 2PS2A 3TWBA 3I4KA 3UJFA 1JCTA 4A6GA 2XH2A 1TZZA 3GD6A 4MGGA 3UXKA 3OZYA 2P88A 3RRAA 2QVHA 3K1GA 2QJJA 2P8CA 4H19A 2QJNA 4H1ZA 4GIRA 3KUMA 2OG9A 4K8GA 2OLAA 4M0XA 2MUCA 4K1WA 3UJRA 3VFCA 4K2SA 3R25A 2OQYA 3R0UA 4GYPA 4J3ZA 2P8BA 4IP4A 5BOFA 3CXOA 1EBGA 4HNLA 2POZA 3D47A 6ENLA 3OP2A 3S5SA 4IL0A 4GGBA 1KCZA 3JW7A 3H12A 4G8TA 3RGTA 3NO1A 3DG6A 2XSXA 2QDEA 2PP3A 3DG7A 2ONEA 1KKRA 2PP0A 3H7VA 3P0WA 3R0KA 1NELA 5BOEA 2XH7A 2ZC8A 3FV9A 2RDXA 3RCYA 3FVDA 3CB3A 3R11A 3TW9A 3QTPA 4DYEA 3CAWA 4E5TA 2PTZA 3QKEA 3UJSA 3MWCA 2PODA 3T9PA 4HCDA 2QJMA 3MKCA 4GYPC 3FJ4A 2I5QA 3PK7A 2FKPA 3H70A 3BSMA 4GGHA 2PGEA 1F9CA 2OFJA 3DGBA 4GMEA 4KWSA 1E9IA 2DW7A 2AKZA 2AL2A 4E6MA 3VC5A 1KD0A 2AL2B 2PA6A 3CK5A 3IJQA 1SJBA 3GY1A 3UJ2A 2XGZA 4JN7A 2P3ZA 3TCSA 2PP1A 5FJRA 3V5CA 3UJEA 1TKKA 3SN4A 4DN1A 1TE6A 1NU5A 3UGVA 2DW6A 3FXGA 3BOXA 2FYMA 3STPA 4HN8A 3V4BA 3V5FA 3OW1A 4YWSA 3TJIA 4E4FA 3ZVIA 3DEQA 3SN1A 4ROPA 2OPJA 4ZA0A 2QQ6A 2GGJA 3MQTA 2QGYA 3TOYA 2OZ3A 3TTEA 2GDQA 3CT2A 2OVLA 4EWJA 3THUA 3SJNA 4IP5A 4HPNA 4M6UA 3PWGA 3DESA 4E4UA 3MUCA 3S47A 4DXKA 7ENLA 3PFRA 2QDDA 3DDMA 3BJSA 1YEYA 1MUCA 3SSZA 3P93A 3RR1A 3VDGA 3B97A 3ES8A 3T8QA 2GGIA 2PCEA 1MNSA 5ENLA 4HNCA 3SQSA 2HZGA 1BQGA 3N4EA 1SJCA 3V3WA 2OKTA 3GO2A 1OEPA 4FP1A 3UCDA 4GFIA 5FJPA 1JPDX 4HCHA 3P3BA 3U9IA 3ZLGA 2PTWA 2PSNA 3N4FA 3QLDA 3T6CA 3GC2A 4KT2A 3OPSA 3MY9A 1ECQA 3U4FA 3IJIA 4Z17A 3N6JA 1L8PA 3FCPA 3RO6A 1MRAA 5FJUA 2P0IA 1EC7A 3SBFA 3DFYA 1EC8A 1ONEA 4F4RA 1EBHA 3QN3A 4GISA 1BKHA 4G7FA 2OZTA 3OZMA 3PWIA 1RVKA 2OQHA 3EKGA 3CYJA 2PTXA 4IT1A 1JPMA 3UCCA 3NXLA 3JZUA 2OO6A 3OTRA 2ZADA 3I6TA 1P48A 3UXLA 1XPYA 2GGGA 1SJDA 3D46A 1PDZA 4IHCA 3T4WA 3MZNA 1W6TA 1ELSA 4H2HA 2GGHA 1DTNA 1WUFA 3VA8A 3H8AA 3I6EA 1P43A 5FJOA 1WUEA 2PGWA 2GL5A 5IDZA 1MDRA 2AL1A 3N6HA 1KKOA 4KPLA 3ZLHA 3MSYA 3DIPA 3R10A 2PU0A 4JHMA 2CHRA 3Q4DA 3ZLFA 3RITA 4DHGA 2AKMA 3JVAA 1EC9A 4IZGA
chains in the Genus database with same CATH superfamily
2E77A 1EDGA 4Q4RA 4Z42C 4C6MA 2WSYA 4UCFA 4I7VA 1H1NA 4NZ1A 2WNWA 5EMLA 3TAOA 1SMAA 8XIMA 3I3BA 3QPZA 1I1WA 2GWGA 3A3WA 4ICMA 4I9MA 4ES4A 1I4NA 2AAQA 4MG4A 3MSGA 3PBUA 1TMLA 1IQ8A 4PMRA 4ZQRA 3P8IA 1BWKA 2VNCA 2PDBA 4MWAD 2J7EA 2ZRYA 2C1HA 4QG9A 3E02A 2HNEA 4AXKA 1CGTA 2OZ8A 4GVFA 3N4AA 3G0SA 2PBOA 5XIMA 1R3VA 2PDUA 4WKFA 5KITA 3EA2A 4XQ6A 1RD6A 2EAWA 3W7HA 3UWZA 2NUYA 3WH6A 3VD3A 1NFBA 3B9NA 1CGVA 1FH8A 3ZT6A 3BMVA 1UQYA 4WEVX 1XCFA 4ACZB 1FFUC 3S5OA 3PUGA 1NDYA 3DKLA 1GSNA 1PUDA 1S1RA 2RJGA 4NKCA 1GVIA 1UW9A 1F07A 1FY6A 1Q3NA 5E1QA 1YBQB 1SB3B 3KZSA 4IIHA 3LENA 1FCUA 4I8DA 5A3HA 1DORA 3EXSA 3OA3A 4GI6A 4MWAC 3MHUA 4TUFA 5EBKA 1QHZA 1VPYA 1H0IA 4A6GA 1TZZA 5KZDA 1DE6A 4Q8OA 5KMYA 1WBJA 2BC1A 3AICA 2P8CA 2CLMA 3PHAA 1IEWA 2CU0A 3M0YA 4L61A 1W31A 4H8VA 1M7JA 4HU3A 4MFEA 4DZIA 2BVWA 4OKDA 4K2SA 1N8IA 4HNOA 2Z24A 1N60C 2P8BA 5F2IA 2VR5A 2BCPA 1V0KA 2B7OA 2YXOA 4AD3A 1JI2A 2R6OA 1N7KA 4XB3A 2IUZA 3B0VC 3GXMA 3FKKA 5C2GA 4W5ZA 1V51A 1IGSA 3LGEA 1UD2A 1UWUA 2YCEA 2WC3A 1WA3A 2GVEA 1TRIA 2YA0A 2H8XA 1P4CA 2WLZA 2XJ7A 3A7UA 1E43A 3GKFA 3M5YA 1J18A 3ONBA 3HB9A 2A85A 3T0BA 3VIKA 5DQPA 2XH7A 4ORIA 3STEA 3P80A 1UH2A 5C9RA 3SADA 1QK2A 3RK8A 5CSRA 1BTMA 1ZJIA 3CB3A 4ZENA 3HMCA 3APTA 1OGSA 1YTDA 4JTKA 3XIMA 2PDMA 4OWGA 3MTWA 3GHSA 3W4RA 1JRPA 2ZRZA 1GPWA 1GTHA 3N9KA 1YDYA 1W56A 2EKGA 3BH4A 4OJYA 1MW0A 2YYUA 2PWUA 3E9AA 2PGFA 5ER0A 4BURA 1VLIA 4YVXA 5I09A 1K9DA 4ICNA 4CVWA 4B5NA 4AY1A 3R94A 1E40A 2ZBTA 4M6VA 5G4EA 2NW0A 3CV6A 3SECA 4N9BA 5PTDA 3P67A 4L4PA 2E8YA 4ILSA 5L6UA 1OJTA 1JD9A 2B4GA 3POHA 1C91A 4IXHA 3GDBA 3QR1A 2J7DA 1IHIA 4E8DA 1TE6A 1KQZA 3LPGA 3N9SA 5AOUA 2FYMA 4R3UA 1FWRA 3V5FA 4L65A 4AWEA 1OF8A 5C9XA 4MNJA 4E4FA 2CZFA 1LZOA 1F3WA 1U1JA 2D3LA 4JTDA 5A8NA 3STGA 5CPSA 1WPCA 2PLCA 2P0OA 3ARVA 3NO5A 2G3JA 1XI3A 4G2DA 1C90A 2G3IA 3OGVA 4PL1A 1EQPA 3AS0A 1DJWA 1MUMA 3S47A 3P7YA 5DT5A 1MW2A 1N8FA 3GC4A 3S5ZA 4M81A 3SCSA 5HQEA 5IHRA 3SCWA 1LT7A 1CB2A 3F7JA 2OQLA 3W24A 4AY8A 1V7YA 1U5VA 3GYEA 4JTUA 3STFA 2VX6A 3ECQA 3OGSA 3GRIA 1H5YA 3C8NA 3SUWA 2VEIA 3E0FA 4IG2B 1S2UA 5GRTA 4AZCB 3BG3A 1DP0A 3BLKA 4U3CA 2A79A 1VIZA 1WOBA 4MWAE 4PMNA 2VURA 1W1TA 1X7FA 3MUZ1 1KBKA 3EXRA 3GM8A 3TZFA 4MSSA 1B90A 3GC2A 3LHWA 4KT2A 4GBUA 2ALDA 4QDPA 3IJIA 2HV5A 2NUXA 4XWUA 2QCCA 4LC6A 3FCPA 4NEWA 2QAEA 3UWYA 1W3TA 1EOKA 3CQ0A 4RW3A 1G5AA 4F4RA 4CQAA 2O0TA 4WY0B 2QVNA 3U2ZA 2WSPA 2RHGA 2D69A 1DXIA 1JNEA 2OQHA 4TIMA 3EKGA 7CGTA 2PTXA 4U3AA 2WHJA 3PANA 2YQUA 4B3LA 3NQDA 1F8WA 3WG6A 4DNMA 2I56A 3UQNA 3IK2A 5CGTA 2YCIX 4C6JA 1A49A 3C56A 2WPEA 1HZYA 3N17A 4LNYA 4Q7IA 2QV5A 1EFZA 4EPEC 3BOFA 2Z0IA 3I6EA 2FZMA 4Z1CA 4KCUA 2Y62A 1SR0A 4KETA 2P3EA 5EY5A 3T2PA 1WUEA 1CENA 5HPOA 1ITCA 4JTSA 1CX9A 3Q37A 1GORA 1EIXA 3RG6A 1UKPA 1AFSA 4MB1A 4N7QA 3UZ5A 2XYLA 1LL7A 1BYBA 1IXNA 1XR2A 4YTQA 4UR7A 2GQ3A 4PTWA 4XZNX 4MWAA 4ZOEA 2ISSA 2NSOA 1JEZA 3E0IA 4LVGA 3FHAA 4H41A 1EX1A 3LNPA 5DELA 1VR6A 4BJHA 1VFUA 3EZ4A 4UNKA 1VBHA 3RLGA 1WB0A 1VCFA 3W70A 3L21A 2FVLA 3MANA 5JCKA 2I14A 3MUAA 3DJGX 1SFLA 3UPWA 3B9EA 3UA4A 1W1A1 4IOTA 2GK1A 4IQJA 2KZHA 5G2WA 3AU2A 4KH2A 1OINA 1KXQA 4U5KA 2QUNA 3R1ZA 3C5QA 3VOGA 1CGUA 4WSHA 3G1XA 4JEQA 4JQ9A 1WV2A 4ADSA 3QM3A 1VGAA 3C0SA 4PSPA 4Q8WA 4RV8A 3G1HA 2NQLA 4UTJA 1PWMA 4OVXA 4QXIA 4GC4A 3VNLA 1A0EA 5GJMA 1OZQA 3Q65A 2YX0A 4FXJA 3VIPA 1DNCA 3LHUA 1NP2A 1W3IA 2Q02A 3LD5A 2OWCA 1STZA 1R30A 3GR7A 4PFHA 4AW7A 1J12A 1H4PA 2ZXBA 3FFSA 5E9XA 2W0UA 4XD4A 3VOJA 3PFMA 3W7KA 4IFOA 4HSOA 4MOZA 4C6KA 2WM0A 1ZX9A 4HYWA 4PFMA 5LHFA 3M5ZA 4UMCA 1B9ZA 2ZICA 1LL4A 1QXLA 3WMBA 3UPMA 3W6MA 3CUHA 5I2UA 1PZ3A 3APGA 4RLIA 3B9DA 3LZ5A 3CM4A 1AJZA 3L9CA 4JTEA 2ZUNA 4L4LA 1WBHA 3VD5A 3AYTA 3P0XA 1C92A 3UWWA 1AA1B 4D6IA 1Z6KA 3SRKA 1FWSA 1U33A 4J3ZA 5ABEA 1E4IA 3S0CA 1FDZA 2EF9A 3OZPA 1HO4A 3SM0A 5F2MA 2W4XA 3CGBA 1IXOA 1FWGC 1HKWA 3F5KA 4FIRA 3HZ3A 5EBAA 4CD7A 4FOUA 4HHPA 4X9SA 4H50A 4GGBA 4PL2A 4KERA 4J27A 3VVGA 3GTNA 1UBPC 1TUXA 1Q6LA 2BDQA 4QX4A 1EUNA 2WP5A 4PGLA 4F8XA 4M52A 2QCDB 4AD5A 5BOEA 1KRBC 2EBNA 1FDYA 4ZEPA 3VFLA 2PRHA 2D0HA 3AJXA 1KTBA 1W5NA 5A2AA 3EWDA 2PWEA 2OJPA 4GX9A 3E49A 1TV7A 3E2SA 4DWSC 4UFIA 3LYEA 3W0KA 1QWGA 3DZ1A 4RDWA 4CQCA 4X22A 5FJIA 5HJXA 2UY4A 2VP8A 1BAGA 1YDNA 4X2RA 3UY7A 2PFHA 2VFIA 1QR7A 4XSMA 1WO2A 1JUEA 2EJAA 3QMSA 1IT8A 3AUJA 1J11A 3MSRA 3L5AA 1O1ZA 4D8AA 1EEPA 2L5HA 4D6HA 3CK5A 2WKJA 2X99A 5CBBA 3UXAA 5D2XA 4MJZA 1G0CA 9XIMA 3WBXA 5LA0A 1JXKA 1NWUA 4NZFA 3SGGA 3QMTA 3SN4A 2HVNA 1JI1A 1UKOA 2CNCA 3SCPA 5FF2A 3EWBX 4DN1A 4ZFMA 2QEZA 3AI0A 4XD3A 3R12A 5DEZA 4L9ZA 4K37A 3HGOA 5A6LA 3GXDA 3TEVA 8CGTA 2YA2A 3GWQA 2QQ6A 3MQTA 1FA2A 5GVJA 3TTEA 3WK0A 3NAVA 1XLJA 1W54A 4ZTYA 3NDYA 3F5LA 4HZMA 4AHQA 2CLIA 3RJXA 2X8GA 5A8QA 4TX6A 3M0XA 3E6EA 2FPYA 1NQ6A 4PTXA 3WMLA 5E9AA 1MUCA 2J13A 4AZBA 2Q71A 3L4WA 1FECA 3I3EA 2Z27A 1DWIM 4IGSA 1R3TA 1TWSA 1JGIA 4HNCA 4REQA 4AEFA 2CLHA 2HZGA 5JRBA 2B7PA 4R27A 1BWCA 1K7FA 3NSXA 5I6SA 3WFLA 2UY5A 1LCOA 3U3HA 2EQ9A 2VC5A 3GUGA 1IEQA 3LN3A 2O9PA 1OIFA 1E73M 3QTGA 1NDAA 1S46A 2GYIA 5H8UA 3WBWA 3QFBA 3P3BA 3WLRA 3GTXA 3FVMA 3N4FA 1HT6A 2OGJA 3FAXA 2X16A 1WE5A 2HCVA 3SUTA 2E1DA 3RFAA 1EPXA 3NQBA 4UTIA 4N9CA 2G37A 3BE7A 1L8PA 1XDLA 3TYUA 2RJHA 5A94A 5D30A 1KM1A 4FNRA 1JAEA 1EC8A 3W88A 4NZCA 1H7RA 1NY1A 3KBNA 1SPQA 1ZGDA 2BY2A 1SFSA 2YLAA 3KOXA 1CPUA 1QPQA 4UC5A 3N29A 4AC7C 1AQ0A 1R85A 3K8LA 4ZOAA 4K3ZA 2VEMA 3UT0A 3TXVA 1KM5A 3KX6A 1AW5A 1OYBA 3W2UA 2J77A 2PZNA 1ONXA 2VZUA 3THDA 4ATLA 5D2YA 2ZRXA 2QF7A 2W55A 2BHZA 1GKQA 2QAFA 1RQBA 4I8YA 1KC7A 2XGIA 3FA4A 2JEQA 1K4GA 3CO8A 2Z26A 4CNUA 2PGWA 1KFEA 1H60A 1XSJA 4UTMA 3LRKA 3FSUA 3ZLHA 5I0DA 4PB3A 2OEJA 1XBVA 3EUB3 3W83A 5D9MA 2A1YA 3KBMA 4LF1A 2GUYA 4TU1A 3GR8A 3DG3A 1EOMA 2IMRA 4NI3A 2PDLA 4BI5A 5JCNA 3PBGA 2OYKA 1TPB1 2XH0A 4QGCA 3LQLA 4TVCA 3UYCA 5MF5A 3BZGA 3SCUA 1UH4A 1Y0EA 3CQJA 3BAWA 3LZ3A 4QQUA 2ZZ7A 3KVJA 2AAAA 4KEUA 3UD6A 3HQOA 2VELA 4ACYA 3IIVA 1M7PA 4QJ4B 1GOKA 1HGWA 1LVLA 3FYOA 1T5AA 3NPVA 3NTYA 4GUJA 3B8DA 2DQWA 4NJHA 1P0BA 1W9DM 3FN9A 4MJ2A 3IJLA 1US3A 3OIXA 3NNTA 3S8HA 3Q67A 2A7NA 4DF2A 4LRSA 1UASA 2V5DA 3GNPA 2VT0A 2BOEX 1NF0A 1XM3A 2Z1KA 3NL6A 4X9YA 4WDTA 3NOYA 1VCVA 1DJYA 3E2QA 4QR6A 3HV9A 1W0MA 2VC7A 4YNGA 3OC4A 1YYAA 3H4XA 4I9AA 2GJXA 3UJFA 1FX6A 2O4QA 1YNPA 3GHRA 4TTGA 1FVPA 1AMYA 3TJLA 3UXKA 1AH0A 4HPXA 5K9XA 1GVEA 3F2DA 4BF9A 4FA3A 3VD4A 1F2JA 1XWYA 3EKLA 2ISFA 4PYSA 4BCEA 1RY8A 4DWSA 1VD6A 3TE9A 1N63C 4AZ5A 4XVDA 1UWIA 3AMKA 4EF8A 4KWOA 1S3HA 2XISA 2YCKX 3AWNA 2ZDRA 2WVTA 3RM9A 3R25A 1CI1A 1KRCC 1QVBA 2INEA 5BOFA 1SVDA 4O11A 3QLLA 4S1FA 5JBFA 1E6ZA 1TB3A 1IEXA 3TCEA 1BVZA 2Y70A 1C8VA 5E70A 3EB3A 3SZ8A 1REQA 4LVAA 3WBYA 1TJPA 3AS2A 1LL6A 3MBDA 2BXZA 3BJFA 2DH3A 1SZRA 1E70M 4CCEA 4HA4A 3LSCA 4Q7BA 1NDVA 1JCXA 4IGHA 3QHOA 1FWCC 2PLKA 5TD4A 2XSXA 4E2VA 3PBWA 2J74A 2NSXA 2D0FA 3R0KA 4JBRA 1OC7A 1PS9A 2XPKA 2PE4A 3WQPA 4WXYA 4A29A 1V6WA 4WOQA 3W85A 4KRTA 2WSQA 2DZAA 1GETA 3DFOA 5M17A 1TWIA 4ZOBA 2FVKA 3BV4A 1J0KA 3KHDA 4O8AA 3RLHA 4A3QA 4DVOA 4X60A 2QJGA 1YADA 2GOKA 2TAAA 3PSVA 3MKCA 2Q8LA 2XU2A 3STCA 3NQ8A 3HFYA 2NV9A 1R2TA 2PDQA 2NQ9A 4GG9A 1JQVA 4CVUA 1T96A 3S1VA 1J93A 2R91A 4EAMA 2PGEA 4YTUA 5CJMA 4DJDD 5C54A 4A3HA 4GVHA 1C7TA 4UNLA 2J3NA 3SRHA 5JCLA 1EJWC 2Y7GA 4XUGA 4PBGA 3GH4A 4BQ3A 3CGDA 2O7QA 3GVWA 3E0WA 1Q6RA 3WLHA 5BWFA 3DGRA 2CLOA 4NAEA 4S2CA 4QAIA 3UVIA 4DYKA 3EX1A 3P14A 4KRUA 5FJRA 3N04A 1PTDA 5HINA 3AN1A 2E25A 1M53A 5CZKA 2DGAA 2FGLA 4OE7A 3UGVA 1V6TA 3CH9A 1OFQA 3BO9A 3W2KA 1H7XA 3S9YA 4HP5A 4WHBA 3PAOA 4FNPA 2DT2A 3NQ7A 5AECA 3IJ6A 5I03A 4DJDC 1E6NA 1V5XA 3M0JA 1VFTA 1OC6A 2X30A 4KEVA 1FIQB 1B3WA 1RJRA 2WJFA 1Q8JA 5M1TA 2BTMA 2HVMA 4HPNA 3BLDA 3GSMA 3R79A 4PBEA 3CUXA 1P1MA 2F9RA 1JOAA 3GHTA 4HU4A 2C18A 4OV9A 3A13A 4JTJA 3T2OA 3HG4A 3USZA 3CL7A 3ZZ1A 4H4YA 2J27A 3RU6A 1E71M 3OODA 4FX7A 1XIIA 1ZBKA 1BGGA 3WYZA 3GG7A 2EO7A 3NS1B 3QW3A 1GKPA 2NVAA 4EF9A 3G24A 4PCSA 3TJXA 4QHRA 3EBVA 4FLSA 3WQOA 3HW2A 2HBVA 2E09A 3IACA 5I3DA 2ZX7A 1F3EA 1A80A 3G1AA 5HATA 3BLIA 4GJ1A 5IBXC 1Q5MA 4LOCA 3GW0A 3KP0A 1CXHA 3G22A 1QI0A 1JPKA 3KCOA 1E6QM 2J9ZA 1H50A 3RPDA 4ZMGA 4LS0A 3RPTA 3GFXA 3J7HA 3ARXA 3LPFA 4KS0A 3V16A 3UR8A 2J79A 3GIYA 5HWMA 4BF5A 1KM2A 3TC6A 4A4AA 3OTRA 3A21A 1LDCA 2Y5JA 1E9LA 3I6TA 1MFUA 2WPGA 2XVLA 6XIAA 3ZIZA 2VTFA 3KBWA 4GJJA 4Y2WA 2WBGA 1B31A 2A7RA 3IUDA 4BI6A 4RDVA 1PX3A 1QHOA 4S3FA 3QH2A 5D03A 1TRDA 4G1NA 4DRSA 2TRSA 2ZDSA 1WYGA 1FFQA 1TVNA 1BG9A 3ARTA 3P74A 2H8ZA 4F0RA 1EGVA 4JDBA 1WZLA 3WDIA 3LEPA 1DWFM 4FNQA 4RCXA 4IL2A 3P62A 1PDYA 4FK9A 3B9OA 4AXNA 2GSHA 1GT8A 1GUVA 4N4PA 1JZ8A 7REQA 2QR6A 2QCMA 4H9TA 4YHEA 3PF3A 3MC5A 3W7MA 2ZRWA 5CEWA 2HNHA 3NZGA 3GFZA 2VJXA 5CJNA 1BRLA 3DHPA 1PB0A 2PDNA 3PB2A 1TO3A 4Z2KA 2XFWA 1W1PA 2BC0A 4I9JA 1R0MA 2PU1A 1DBTA 3ORWA 1K9EA 1RP9A 2HK1A 2DVXA 2BFGA 1ITQA 1KLYA 2P5NA 1EH9A 3CH0A 2D22A 4GCAA 2DT3A 4AC1X 4APNA 4U2ZA 4P5UA 1M6JA 5DCEA 1XIHA 1UWTA 5KZEA 3D5HA 4LUJA 5D9PA 3AZTA 1XDMA 3TTQA 2ZUVA 3BK0A 3IIZA 4DB7A 3ZVHB 2PTDA 4JTRA 3G1VA 3UW6A 3HM7A 2DZSA 2VL4A 2CBVA 1W9BM 1TPDA 1H7WA 3PUEA 2WSRA 2CXGA 1NEYA 1XRFA 4OV4A 1U2YA 5DXXA 4GQ0A 3DH7A 4O14A 4ADWA 3TR9A 3H2NA 3GXTA 3QW4B 3L4UA 2XINA 1NTHA 4Q4PA 2CZVA 4H4IA 4XTDA 9RUBA 5C2CA 3WLNA 2YL6A 3WDHA 1BXNA 3GAKA 2XFRA 2WPCA 1V6XA 1LYXA 2VFEA 4FF7A 4FXRA 5U7SA 2GVGA 5ABFB 5EMKA 1F05A 5D33A 1Q65A 3SFKA 5B7YA 2RGLA 4PC8A 3NWRA 1LBLA 1F3TA 1HNYA 4GCXA 3Q58A 1TPC1 5A69A 4DELA 3QHMA 3AZSA 5D05A 3I65A 5E6YA 4HSNA 1VJZA 3KDOA 1XXXA 3GZ3A 2PRLA 4MY8A 1I2QA 3PJWA 3WJZA 5D37A 3H4WA 1Q4WA 2HTMA 2PP3A 1W3LA 4C60A 4WX2A 3RAOA 2J47A 3AIVA 4LX4A 4A8IA 4ZO6A 3R6IA 1SO6A 1K70A 1GRAA 1J79A 2VX7A 5C0QA 1NH6A 3C8FA 3CV7A 3RILA 2VEGA 3S9ZA 1H1ZA 4LWWA 4E2OA 4R88A 3RX4A 4DJDA 3S1XA 3A4JA 4S3JA 1PJ9A 1XLFA 3N2XA 4CQ9A 1F3PA 4U10A 1Q6DA 5DF0A 2CBUA 2I17A 2I5QA 3MCMA 5XINA 1GHSA 3FA5A 3TA6A 6A3HA 3E74A 1WZMA 1HKVA 2ZUSA 3RYSA 4UMAA 3W7PA 3PN8A 3URNA 5HNNA 1XBZA 4JYDA 3AO0A 4L64A 5A6KA 3ARWA 2FFIA 2ACSA 1FWBC 4C7DA 3KLKA 4FX6M 4AX7A 3MYOA 2OELA 3WH9A 4CN4A 1QBBA 3AHZA 4CQBA 4GINA 4L6OA 3WSUA 3V5CA 4FX9A 1Q63A 1FXPA 3LCXA 3R8HA 2WO5A 4UTWC 2OX1A 2BODX 1SGJA 1O94A 1ODUA 4H7CA 2WP6A 4LCQA 1FWIC 1Z69A 1XLMA 1FP8A 1HGYA 4QEHA 3QYSA 3TN5A 4QCEA 5IBXA 1BXBA 3S2MA 1D3HA 3C52A 3FHQA 3S9IA 4IF2A 4UFMA 3ZWTA 4GJIA 3VM5A 1V3JA 4MJMA 2XIMA 3TLLA 1UD8A 4LUSB 4I7UA 2DVTA 4EM3A 2F6XA 5DBTA 2R1PA 1B0IA 4LBUA 1NAL1 4GI9A 3S4TA 3SSJA 3PTDA 1JYWA 2YVFA 4AZGA 3CWNA 3WDQA 4AH7A 2EG7A 2H9AB 3G2GA 4G7EA 3ETRB 5I02A 1HG3A 2V38A 3TK7A 3D6NA 1UMLA 3CO4A 1CXEA 1L9WA 1JCYA 3WQ6A 4QITA 3TN4A 3KVLA 2OYMA 4HTBA 4AYGA 1EGMA 3HG2A 2REQA 3MP4A 1TVLA 1XH1A 1XGEA 3TV8A 1TCDA 2WNQA 5BROA 5BXPA 4JYFA 2EXOA 5BW6A 1R3QA 1EC7A 3CGEA 4ZODA 3D3AA 2IXUA 3QN3A 3F1QA 2A3BA 3OEXA 4KIRA 3P5ZA 5JCMA 4RKAA 1OYAA 4HZ7A 1LBFA 2YIHA 3VAVA 1E1EA 2CZ5A 1P7TA 2WZMA 4Y9MA 1R86A 1BEUA 4IT1A 1OCBA 1QU4A 4GE8A 1GOOA 2BXVA 3JZUA 3SUVA 2O4MA 2ZADA 1CT5A 3WQDA 1IEVA 2WOVA 2H3DA 1DJIA 1TIMA 3W1TA 1J2WA 2YGYA 5LIXX 4HK7A 4HA1A 1WZAA 1GEQA 4AEEA 4H2HA 3U7BA 1E4MM 1WUFA 4PCNA 1XHGA 5CPMA 5CBJA 1RQHA 4JTIA 3S2LA 5T91A 4B2DD 3ZR4A 1J6PA 3GAYA 1OQFA 1EL3A 1T3QC 4PMZA 2PBGA 2BY0A 1XPGA 4XIAA 4GHRA 1NWSA 1DJHA 2FZBA 1LBMA 3QZEA 5I5RA 4O52A 3RITA 2OWWA 2PAJA 2UV8G 1VPXA 3QGVA 4HBKA 3VCCA 1YTKA 3HQNA 2DP3A 2XVGA 2Z25A 4Q3MA 1L2QA 2X1IA 2R24A 1UR2A 4HHHA 4C6IA 5G1MA 1AQHA 3L4VA 1ZRQA 3T4CA 2EPLX 4IFKB 1GERA 2HPIA 4OT7A 4AFYA 4NZ5A 3H23A 3KHJA 4LU0A 3VC6A 2IQ0A 2IPWA 3WH5A 2PDPA 4YXGA 1XKYA 4V33A 3CUZA 1E3ZA 3CZ8A 1VFSA 1XYCA 1X38A 1X6LA 2A5HA 1DWAM 2ANUA 4IISA 1SZEA 1P0DA 1ZAHA 1H49A 3PM6A 5CXPA 2V82A 3DAQA 2WYSA 4EPKA 4US5D 2RGMA 5LZLA 4H4XA 2CFFA 1UWAA 3NVYB 4GLEA 4ACZA 3WF3A 1MO9A 2C13A 3NZQA 5J8LA 2QJIA 4L7ZA 2EPOA 1YBQA 1GNXA 2R14A 4OOZA 2DIJA 1MQPA 3BAYA 4W8LA 5I78A 1HJSA 3PPFA 3U2OA 2WMHA 4GUIA 1M01A 3QPEA 3E0LA 3TWBA 1OG0A 3RCMA 2HPMA 2Y0FA 4Q4KA 4F0KA 3S46A 2VCBA 3IIXA 1J6OA 4BK9A 4TX8A 3CTLA 3RRAA 4PUWA 3GLCA 1RLCL 3SCOA 5G4HC 1E4NA 1FDJA 4IWWA 1A5LC 5F1UA 3UZWA 4HD5A 3OQEA 4H1ZA 4GY0A 2OG9A 2Y8VA 3OO2A 4IIGA 3VFCA 1XV8A 3W87A 1OFOA 4PCTA 4WCJA 1K6WA 3VM7A 2G95A 3LCFA 1W1YA 3LDVA 3WNOA 4BF7A 3RN6A 1RK6A 1J0JA 3GKAA 3LB8A 1XYBA 3A12A 2YZ5A 1JJKA 1WXJA 3W22A 3L66A 4X0NA 3NO1A 3H2EA 3IGXA 3NZPA 5H91A 3RLVA 3EPMA 2Z4GA 5BU6A 3AXMA 2A3LA 1OJXA 3W2LA 4RDYA 5HA7A 1Q6GA 2TYSA 1DTUA 2RDXA 4IX0A 4UTWA 3EA1A 1WDDA 3UG4A 3WJSA 1PHQA 1JDDA 4S3DA 1K8CA 2IW0A 3USBA 1TREA 3WLMA 4JICA 2ZE0A 4AIOA 3WF4A 1GZ1A 1XYMA 2EQ7A 2JIEA 5GNYA 4S39A 1XDJA 4HCDA 4IPNB 1KV5A 4DUXA 4F0MA 3N1AA 3LGGA 5EA9A 1D8CA 1JL8A 3VC5A 2CKRA 4WJEA 4NJIA 3LI0A 3TQ0A 3H2OA 2LLEA 3SDOA 1K02A 3PY2A 3PZMA 3CTTA 3TYDA 2R8WA 2Y63A 2OCZA 4IJRA 1EXBA 4IUGA 4JFUA 2JFEX 2V5LA 1JFHA 1Z44A 1NU5A 1B54A 5HDRA 1NWRA 2X8RA 4Z0SA 3K5XA 3UWUA 2PLJA 1YQZA 3UCQA 2BVYA 1MOKA 3ATZA 3MJYA 1U83A 3V0SA 4H7VA 4KQNA 4KRZA 2V8ZA 2Y8KA 1ZB5A 2NV1A 3A5FA 2D24A 1WP6A 4B90A 1AH4A 4NXSA 4B9YA 4QE4A 4YWOA 1TA3B 3ZSSA 1ALDA 2VVSA 3K30A 3RM4A 1B4KA 1RM6B 5XIAA 4JAWA 8TIMA 4IMAA 5LA2A 5BOOA 2QDDA 2RFGA 3G1YA 4JKMA 1OADA 3L67A 1K03A 2D20A 1HJQA 3WZ0E 3EANA 2O55A 4IG2A 4GRSA 4ZFCA 1UZHA 4ZO8A 4O1DA 3CYVA 1W8GA 1ZUAX 2V3EA 4UFLA 2P50A 4GFIA 4HZ6A 1A0CA 1B4EA 3TTSA 3JS3A 4PUKA 1ZMCA 2VC6A 4ZOCA 1DJXA 1Z42A 3E0VA 1A3HA 4WGHA 4E3VA 4QDWA 1KFJA 3MKKA 3CASA 4W89A 2CITA 1HF6A 1ZY8A 1HL8A 4QROA 2XIIA 3OLGA 1A5MC 4YVPA 4F0HA 2VENA 4O10A 2YA1A 4IIBA 4AF0B 2VC9A 4JFWA 4PSRA 4HJWA 1DPMA 4Y96A 3DFYA 5AZ0A 4WY0A 3RNMA 3LLDA 1VAHA 3QY7A 3V0UA 1DEDA 3BGGA 1DIDA 3HBLA 4LAOA 3KL5A 2IS7A 4G5DA 3WDJA 5U1OA 3LY0A 2CERA 3UFYA 3VMOA 1MFVA 4B5WA 3UCCA 3W7GA 4B2DA 3KBSA 4ZB2A 1GRBA 4PMDA 4MYXA 3OJGA 4F9DA 4PB4A 3WH7A 4ZTXA 2YFNA 1IIHA 1N8WA 4JQ1A 3O8AA 1X39A 4ROQA 4U2YA 4KCVA 5EFDA 2VZVA 2J24A 3NO3A 5HUOA 2J7CA 2F84A 1ME8A 5F4SA 1QW7A 3WFZA 1QI4A 1UB3A 3EYPA 1VRXA 2X8HA 2WJZA 1IV8A 1V7AA 1A5OC 1JNDA 1KFCA 4HMEA 2FB2A 1I1XA 2CZDA 2V9DA 5HULA 3WD0A 1QATA 4DZHA 4KW2A 4JL1A 3MCOA 3PZ9A 2SFPA 1XIGA 5DRCA 4WDUA 3W81A 4RX0A 2Z1SA 1XLHA 5LIYX 2QLYA 3M5VA 2EPKX 1DJGA 1TMQA 1W32A 2WMGA 4H04A 2YCJA 4MMWA 2VVNA 4UWMA 3TQVA 1ZENA 1FXQA 1LRQA 2VM8A 1OG6A 4PCPA 1QOPA 4US5A 4L56A 3URBA 4H83A 1MDLA 3HJEA 1XIMA 3BCJA 4S3CA 2XIBA 1UG6A 2IPFA 4FI4A 4S23A 2OSYA 4CLMA 3IUIA 3VYLA 1RPXA 2J9XA 3W75A 4U28A 1UD6A 3HF3A 5FD0A 3R7MA 4JXCA 2O9TA 5JCIA 2ON3A 3WD4A 3CQHA 3OBKA 3UA3A 4HQVA 3UZXA 2Y89A 5AHIA 5C5YA 4KFPA 1AW1A 1FHUA 3QKZA 1ESWA 4PRWA 1E0XA 1EJSC 3HTWA 1OFRA 4JN8A 4H6QA 1XRSA 4QSFA 1BF6A 3LV5A 3IVUA 2C16A 2X42A 2DY3A 4GZ7A 1KCKA 4HIBA 3T05A 1QCWA 2RDTA 4M29A 1PIIA 2Z7GA 4PMUA 4NYUA 3GD6A 3PBVA 1Z41A 4YTRA 3BQ5A 2AQWA 1FCVA 2XWEA 2FGZA 3AHVA 2I57A 1J9YA 1I0BA 1TWZA 2Z1BA 4CQDA 2YYTA 4WJ8A 1J2BA 5A8PA 3NVWB 4Y9PA 2F6UA 5LNRA 1WZKA 3WENA 2A3CA 5KVHA 2ZQ0A 1UZ4A 4DNAA 4J57A 5LXXA 2V68A 3SRFA 1YE6A 4JZ5A 3V35A 1GQLA 5DO8A 3W1QA 2VUYA 4UQAA 4ZBCA 2XSAA 2NWRA 1F6KA 2WAGA 3CU2A 3VMPA 4KFOA 2CKSA 4IJBA 3GXFA 5BU9A 2QZRA 2NQHA 1R9ZA 2G5WA 4X63A 3QZAA 3AALA 4HOXA 4UXDA 3O3RA 3TTYA 2WOWA 1X1OA 3AC0A 4D6FA 1M41A 2C71A 3OIHA 2CLFA 2IKHA 2QCDA 2FH8A 4UFJA 4NF7A 4P7LA 2PDYA 2ZVIA 4XD6A 1QJWA 1OT2A 6TIMA 1EF3A 3ZJ8A 1UPPA 2W3SA 4ZQMA 2WHMA 4OIFA 4M82A 4V2XA 2EG8A 1BSIA 1TX2A 3TW9A 1ONWA 4UB9A 3A47A 1GVOA 1V6YA 4KWVA 5GNXA 4LCSA 4RXFA 4DEFA 3KDNA 1QAPA 2E5BA 3MWCA 4GBDA 1Q7ZA 2VFGA 2W62A 4U31A 2R94A 1XC4A 4CU6A 1XUZA 1X2HA 3P2VA 1Q2RA 1LTDA 2HS6A 1ITXA 2AKZA 2OSWA 4E6MA 1OFEA 3W1MA 1OK6A 2V5CA 3L8KA 1VS1A 5KVIA 1GREA 3ANYA 3H24A 3VIJA 1JF6A 4M5PA 1ITUA 3UJ2A 4JCMA 2UZ9A 3DBNA 1YXDA 2XGZA 3PZNA 4MB5A 1X96A 2NXIA 1D3CA 2H3BA 5K9CA 1XW8A 2PP1A 1AK5A 3QOMA 3W26A 1TKKA 4I3GA 4B15A 4AAJA 4UBPC 3GDMA 2GVJA 3VOIA 5AC5A 1EXPA 3W7LA 3H54A 4XVEA 2CYGA 3K8MA 4UIOA 1XLKA 4H9ZA 5C9WA 2Y7DA 1VDVA 3NPUA 4BWLC 3VOFA 4CNSA 1H62A 4D8LA 5CZSA 1YE4A 3AU6A 1HVQA 4P8XA 3DHFA 2Z00A 3VD9A 3CT7A 3H26A 1GW9A 2GJRA 4M3PA 4H01A 4LB4A 4P8UA 4KBXA 3U0HA 3H2AA 1JFXA 3QPYA 1YEYA 3SSZA 4ZL1A 3LBCA 5BMXA 2YB1A 2OT0A 5IM51 4RE2A 1RZMA 1NDWA 5HBFA 2GR0A 2YKKA 3QBUA 1TWWA 1ZP4A 1BQGA 3NJ3A 4GNJA 4HK6A 1UC5A 2OKTA 4DBWA 4GA8A 3ABOA 1PKYA 3BOLA 1G1YA 3S42A 1KRAC 1JEHA 3MI3A 1ZSXA 2BMBA 3S3GA 4AY7A 3UGRA 2BB0A 3L68A 2NXHA 2PD5A 3O06A 1WKDA 4GI4A 3AXIA 4QRNA 4LYQA 4NRSA 2Y2WA 3BARA 4L1XA 5LXEA 3DN5A 3O6CA 3TC7A 4I5RA 3FJNA 2CC0A 3NXFA 1MO0A 3IJ8A 4LALA 3ZMRA 3A24A 3IGSA 5RUBA 1JD7A 3F4DA 2I9EA 4NXKA 3PJTA 1ELSA 5DT7A 3I7QA 4D8ZA 3H8AA 3GVQA 4O50A 1MQQA 2BG5A 3DI1A 1WKYA 3MV01 1US2A 2V3DA 2YXGA 3U4AA 1VBUA 1FEAA 1SM9A 1HX0A 5A6AA 3GU9A 3T78A 5IDZA 3N6HA 2PEVA 4MVAA 3DIPA 1QPRA 1JVNA 1LQ2A 4ZSTA 1KO0A 2YPIA 1HN1A 1JROA 1BKSA 3VOCA 2AKMA 1ZBCA 2ZUUA 3S6OA 1C93A 3GRTA 3R5EA 3T8LA 5M03A 5CGQA 1L6GA 6TAAA 2JF7A 3FYYA 1E0WA 4FOKA 3PZTA 5TAOA 2VR2A 1V93A 1TPWA 3KE0A 2OZ0A 1IT0A 1DVJA 3DERA 2QHAA 1E6RA 3CHEA 3WD2A 5C7VA 4CGTA 3VUSA 3UNDA 2OLSA 2XUCA 2PPGA 3AIBA 4RR4A 4W7VA 2D73A 4ASTA 4YTTA 3C4UA 4WLCA 2ISWA 1HP5A 4RZ5A 1RY0A 4DWDA 1FRBA 3DFHA 2E6FA 1BG4A 1Z7AA 4OZOA 5D9NA 1RA5A 4E8GA 5FL1A 2XZ9A 1B3XA 1XRTA 1CIUA 2ZZ0A 5J04A 3E2RA 5K2ZA 3A23A 1VP5A 4LS1A 4DX3A 1JZ4A 3GH5A 4EPDC 4YHGA 2XWDA 2E1WA 2IKIA 2ZRUA 2W6RA 2ZKMX 3W37A 3GD3A 1JZ6A 5AZ1A 2Z29A 4MGGA 1MWOA 1TPEA 4IQDA 1VJIA 1T41A 3CIXA 4AWSA 2R82A 3EMCA 4RPPA 3TSDA 4G9PA 5JU6A 1EX5A 2QJNA 4QJ5B 3LHZA 2QUMA 1KXVA 5C7HA 1O95A 1L6SA 3RHGA 4A8LA 3G8EA 4OQVA 1W5MA 2WHLA 4WVXA 3UJRA 1TTIA 4JOMA 1ZDLA 3UR2A 4FNUA 3CLWA 3IV3A 2ZX9A 1L8NA 3ONCA 1DJZA 3VKCA 2FDSA 3U2EA 2YBVA 2JKEA 1VQTA 4CD6A 4K7VA 1FWFC 1X2GA 3MMWA 4DM2A 1K8YA 3DC0A 1IR1A 2PDHA 4TO8A 3H6OA 4GKTA 3CHDA 2C0AA 3R8RA 4TQTA 4LF2A 2ZA2A 4DPQA 2CW6A 3RGTA 1B3VA 3W29A 3EF6A 3TOPA 2XFFA 2WWDA 3PG6A 1UZ1A 1KKRA 2PP0A 5AC4A 3H7VA 4RE4A 2RKXA 3R89A 1A5AA 2QDHA 2Q6ZA 1EHAA 3IRDA 4M51A 5EGRA 2GK1B 4D71A 4ML4A 2YVJA 1XL9A 3LUTA 3KBVA 4HJFA 4GUFA 2Z6JA 4YN5A 5AHLA 4BWLA 3CAWA 3G1FA 2G3FA 4JX5A 1EYWA 3CHFA 4R34A 4EE9A 3R0DA 4EWND 2ZZBA 4FPSA 3KM8A 4DXXA 1UA3A 1GKRA 2PDGA 3EA3A 5IRPA 3KP1A 2HMCA 2OFJA 3DGBA 3W7EA 2Q3RA 4AWUA 4CCDA 2FGBA 4GY1A 4XAYA 1D7YA 1OZMA 5FI8A 1Y8BA 2FZDA 3NVZB 1XYAA 3IJQA 4HNTA 4O17A 3ITLA 2ICSA 5F2LA 4XZLX 1OX4A 4I6VA 1QPNA 2ATSA 3E5BA 3GE7A 4C91A 2WANA 2DW6A 3W7NA 2C14A 3L0GA 4GUGA 4AVFA 1HJUA 2I1OA 5BYWA 4Z08A 4RE0A 1SSDA 4V15A 3W1LA 4G56A 1MEHA 3DI0A 3M43A 1EPVA 1Z3NA 4IM4A 5FAJA 3N3TA 3WLPA 6ALDA 1LWHA 1KM6A 3PS7A 1DV7A 3LV6A 4ZXOA 4V1XA 1GOXA 1VIWA 2GQAA 4GO9A 2OVLA 4EWJA 4Q8PA 3WLTA 4LTSA 3A9IA 1UZDA 4IP5A 2ZZ3A 3W7IA 3ID7A 1R2RA 3ARPA 4W8AA 3DESA 1G7UA 3HA1A 2B7NA 3D0CA 3NURA 5FF0A 5H8MA 5LNSA 1FBAA 4XBJA 2G4JA 3VDBA 1GK8A 3P61A 1PKNA 7ENLA 1B3YA 5MKGB 1MUWA 4WY0F 2BY1A 2WZTA 5E93A 3B97A 3ES8A 1FUYA 3K1DA 4EQWA 2MANA 2Y8UA 1F7BA 4PTVA 4MF4A 3WMCA 4K8HA 4IMGA 4S3KA 3UNTA 3UPBA 1S7MA 4FAMA 2HSAA 4C1NB 3W2JA 5AY7A 4OBRA 3PG9A 4C5YA 3EPNA 3VKAA 4ZOHB 4CNPA 3KCJA 3M5XA 3GO2A 2YAUA 5DN1A 4JTCA 4CU7A 4LUTB 1WAUA 3REQA 2JK6A 4HCHA 2DT1A 3SIMA 1S2AA 3CZJA 1G4TA 3QLDA 3VCRA 1L2UA 1S5NA 2VGIA 2VZSA 3AS3A 4GXWA 5D8WA 4RDZA 1YPIA 3MY9A 3T0AA 3HPSA 2X2GA 4NP7A 1PZ0A 3SY1A 3BW2A 4BS0A 1TJ2A 3AYVA 3N6JA 4HN4A 3VNKA 4N2YA 3AROA 1OABA 3HJZA 4H4ZA 1CLKA 3GG8A 3GU2A 4I9TA 3NQVA 4W9TA 4WSKA 5HOSA 3SAZA 1X97A 3A7RA 3L23A 1S5VA 3H53A 4JIRA 1RVKA 4M19A 3AS1A 1O6IA 4JTQA 3TKFA 2J88A 3IIOA 4FF5A 5A8GA 1DJNA 4NYYA 1BVNP 2DZUA 3COTA 1LG2A 1XPYA 1AW2A 2GGGA 1W2VA 3PULA 2YW3A 1NDZA 4I7WA 4MZYA 3LADA 3B9AA 5BRQA 1FCBA 3BW4A 3AMCA 5FJOA 1XKJA 5A6BD 3PJUA 3VIOA 1ZZMA 3XISA 5LNWA 1ML1A 4MYAA 1W5OA 1LF1A 4LPCA 2E8ZA 4MLRA 1GJWA 4N4QA 5BWAA 1ISWA 4KPLA 3OYZA 1Q45A 2TODA 2AQVA 4NY2A 5BCAA 3CC1A 3QSRA 4DO7A 2D0GA 3O0FA 2QPSA 4AD4A 4FOJA 7A3HA 3A7AA 1ZAJA 4PUUA 3GH7A 4PTMA 4MB4A 3IAQA 3Q45A 5DY2A 5JXQA 3EOEA 3K4WA 4A3RA 1XF0A 1E0VA 4XBSA 3UU0A 2ZZ1A 4REQB 3B8UA 3M7SA 4MKSA 1FTXA 3S2JA 5ABHA 4FS9A 1EBDA 1SJAA 2V3GA 1YPXA 4MDPA 4O19A 2YLLA 1QBAA 5FJTA 3ENLA 1EDQA 4A2RA 3W1PA 3SN0A 1TSIA 1FEBA 3URQA 3IVSA 1H61A 2VEPA 1V97A 1WQ5A 3PZOA 4LAUA 1PWLA 3TYEA 5HQMA 3SCRA 1LOLA 5CG0A 5HWNA 4O8RA 1PE1A 3FS2A 3IJ7A 3EOLA 1R6WA 3ZT5A 3FW6A 4NZ3A 4FSAA 1PIFA 4ZQCA 4JX4A 2VWSA 3VKJA 4RZ6A 2D2OA 3RU8X 3ZVHA 3NEVA 3CMFA 3NQ6A 4AIBA 4N42A 3V0TA 1Z32X 4PZVA 5A6TC 3A3HA 3W7JA 3Q2DA 1Z8AA 2WPBA 3DHDA 3FJ6A 2V3FA 2HISA 3DU0A 3GC5A 1XJBA 2Q8ZA 3MVIA 1PO9A 5DLCA 3MHGA 1F4AA 1ZS2A 3K1GA 2Y61A 5D2TA 3CPUA 3MO4A 2W5FA 3VKBA 1UROA 5H2ZA 1FP9A 4PEEA 3ABXA 2JE8A 1KNWA 3WLLA 3EWXA 3LXCA 3VILA 5ABFA 1PZ2A 1TR9A 4NAFB 3EB2A 5EMUA 3TONA 4JS3A 4CN6A 3S6TA 5CSYA 3RIKA 3QFWA 4E3TA 3WQEA 1GGOA 1OT1A 3QOKA 1HKMA 2PWGA 4ZB0A 4LVBA 3WD1A 3L2IA 3WDPP 5D2VA 4DAFA 5K9DA 3LPOA 3P60A 4AG0A 2XVKA 4JKKA 2TPSA 3WK1A 1E51A 1NQKA 2PC8A 1XLEA 3DG7A 1KXHA 1ZQ5A 4Q8VA 1NELA 3UY8A 4HU8A 3DFPA 5K3VA 2GPTA 1OSEA 3OBAA 1FFRA 4HTYA 5I7GA 3BJTA 1QHPA 3WQ4A 2J7GA 1QW9A 2BVDA 3JRKA 4FIQA 4F40A 3T7VA 1IF2A 4DI8A 3R11A 4P8WA 3B4UA 1IT7A 2HROA 5CPOA 4RZ4A 3IGUA 2F5ZA 5I3HA 5IDIA 4RW5A 2ISDA 1E5JA 1EA0A 2DSVA 4IMDA 1JDAA 3V18A 1MZHA 1RBLA 1CBGA 4O1FA 4PBFA 1E4LA 1FKXA 4DO4A 2WZIA 3FJ4A 4LXFA 2FTPA 4LV4A 3H70A 1F9CA 1IWPA 1HJWA 2WQPA 1W1ZA 3ZR6A 1VFOA 1N5WC 5JBEA 2V5KA 4MZ1A 3AXKA 1KD0A 4BQ2A 1S3TC 3VZXA 4GWEA 4K68A 1OYCA 4MKVA 2CXEA 1JCNA 3T1GA 3DECA 4LEQA 1K7XA 1GWJA 4MLJA 2ZWYA 4DWSB 4GC3A 1VF8A 2ZTKA 2Q3OA 3LBMA 3GNDA 3IIPA 4UFKA 3HPZA 3AIEA 3U5YA 4EXBA 2OODA 5JVLA 1G4SA 4Q8NA 4C6LA 2G41A 1UUMA 2GGJA 4HMCA 4M7TA 3M7WA 1GQIA 3PTMA 3ZWSA 2OZ3A 3KRUA 2FTYA 3B0XA 4E2BA 1J5TA 5LNVA 1JG9A 2XIQA 1PV8A 3W07A 1ZCOA 2V63A 2E3TA 1MNZA 1A5CA 4JIIX 5GJNA 1GCYA 1BYCA 3YPIA 1A53A 2VO5A 3WUEA 5DRIA 3GHUA 1JR1A 4XZBA 3LMZA 1K9TA 1SQ7A 2VRQA 3FAWA 3MPGA 1XLIA 3OLIA 4EOUA 5I00A 2Z28A 4AZ6A 4OUEA 2YBUA 1CWYA 2H9AA 2IPJA 5GQBA 5I3JA 3BVJA 3OYXA 1IIGA 3QRHA 4A8NA 3VOHA 2Y1HA 1Q1WA 3HGSA 3M44A 3LS9A 4M8UA 1BPLB 1GTEA 2DUZA 3UVAA 1OEPA 1E0TA 3NQFA 2DSUA 1B2YA 3W27A 5C71A 1TZ9A 2CBJA 1BSLA 2WB5A 3IJ9A 2PSNA 2BLEA 3WQ8A 1GRTA 2NUWA 3GVRA 2YVGA 2OXNA 1XCXA 3NOEA 2CIPA 4JHOA 4LV9A 3JU2A 1LG1A 5FESA 1VFLA 1XC6A 3CLMA 5FJUA 1BYAA 1Q6CA 3B3DA 4GKLA 1EB3A 2VQTA 1UIOA 1F6PA 3MUIA 3KS6A 1H41A 3W2NA 4LY8A 4EXQA 1DIEA 1KFWA 3GS6A 2YW4A 3FGCB 2QXWA 1X8CA 2V2DA 5FMHA 1CW2A 3D46A 5M5DA 3W25A 1A5NC 3VIGA 3M0HA 3GYCA 5BZAA 3W38A 1IEIA 4K8DA 1VBGA 2Z1XA 3KOFA 3F5JA 3U7VA 1P43A 2CHOA 1Q66A 2RAGA 1KB3A 5EFFA 4PMVA 2W79A 3B0UX 4EIVA 1AQMA 1PEZA 4AVNA 3CL6A 2I5IA 1EZ2A 4C7GA 3VTRA 2B81A 2CWNA 1H2IA 2G50A 5IFPA 4NRRA 1KTNA 3CEPA 4Q8QA 1TPFA 3UWEA 1TYGA 2OKOA 2X0SA 2QAPA 1V8EA 1O7AA 4IFKA 4GABA 4XKMA 1XYZA 2VFFA 1RLDA 1A5KC 4FHAA 4GQBA 3KBJA 3VMNA 3WLOA 2Z2UA 1UKSA 1MW1A 3CQIA 4C6PA 3HPFA 4DAIA 3ES7A 4ZSUA 3PTKA 4MY1A 3HFTA 2XH4A 3UG5A 1OBAA 1VQZA 3W2MA 3WD3A 3KL0A 1KV8A 4IQEA 1R3YA 2P10A 2TPRA 4W85A 1V02E 2EPHA 2C79A 1UA7A 3TROA 3VCNA 1UQZA 4OGZA 2QYGA 1SR9A 1V6UA 4WOZA 3UR7A 3B0YA 4I90A 4IPJA 3MCNA 3LSBA 3CXBA 2DDXA 4XG1A 1W3HA 4CD8A 7ODCA 2WQDA 1CECA 1W9XA 1EJ7L 2PDKA 5FEXA 1H1YA 4O18A 5AVNA 4UR9A 3JR2A 3C0LA 5HJLA 2W9MA 4QCFA 5C9UA 3EDJA 2DZVA 5DY3A 4WKAA 3T44A 4BEUA 2XN1A 3OZYA 3W53A 2QVHA 4O54A 4PMYA 1V0MA 3P6LA 4DF1A 4QP0A 1ZBVA 4YLWA 4YIWA 5CAHA 4XZ9A 3UXIA 1NARA 4K1WA 4MKNA 3B06A 2CPUA 2D2GA 5CBIA 4JNYA 3AYRA 3N2MA 3W73A 3OGRA 2EEXA 1PYFA 4AZHA 3CQKA 1UBSA 4UMBA 1WX0A 6ENLA 3XINA 9CGTA 3BZJA 3TTOA 5EB8A 4A3UA 5SWUA 1XRVA 2PDFA 1VPQA 1XLCA 3ITOA 2QF8A 4WUIA 4IMEA 2DPEA 3A9BA 4J3SA 4G8TA 2JBMA 3QJAA 5LSMA 2Z1WA 3T09A 3SQLA 3QF0A 2VHLA 1Q6FA 2OGYA 4JTLA 3WN6A 1GZGA 1G7VA 1W91A 4JDYA 3EB4A 1KCXA 4B16A 4IMFA 3N18A 4MB3A 4F3HA 1MYRA 1QI5A 4B92A 1CYGA 3LHTA 4DXVA 4B5VA 4UTKA 3IANA 3W23A 1O66A 2RDWA 3QZ6A 2QW5A 4GD0A 4M80A 1BYDA 4EX4A 2WXDM 2EQDA 5LYRA 4GYPC 1EJRC 1Q7QA 3V1PA 5CZ0A 3WK2A 1HXJA 3GDLA 2QMJA 2ZXAA 4HA3A 4Q33A 3IJDA 1VH7A 2NX1A 2YXXA 1TMHA 2VX5A 3VINA 2R9RA 4IFRA 1I75A 1UOKA 4C65A 4URIA 4IP7A 3NQAA 2GDVA 3VNYA 1VHNA 1XG4A 4JFVA 1V77A 1H7OA 3DCPA 1R3RA 1TJRA 2F2KA 3GVGA 3LOTA 3AMLA 3HQPA 2ABBA 4PRRA 4D6DA 4R33A 3LQGA 2EPMX 4K6AA 1FWHC 4KFNA 3DGHA 3V4BA 1HQTA 2OEKA 5T8GA 4HPGA 3DBPA 4XKYB 3GW3A 3AYSA 2OMAA 3SN1A 3W74A 4PMOA 3T42A 4JL2A 2ZOXA 1KCLA 3I10A 1B3ZA 2QGYA 1BHGA 3O07A 2X1TA 4CUCA 3GX9A 3HMJG 5A6JA 4H9XA 1V3HA 5F7UA 5M2FX 2WC7A 3PZGA 3CUGA 3PR2A 4DPPA 3AIQA 1I60A 1JDCA 1GONA 4US6A 1AL7A 3L0NA 1S2VA 3OLEA 1K77A 2G3NA 4PB5A 3LHYA 1O1HA 3N4EA 4WDWA 3N9RA 4ZE4A 1S5TA 2R9ZA 1CXIA 4DI9A 4QNWA 1PPIA 3BQ6A 1MZRA 1FWJC 2GQ8A 3IARA 5A2CA 3ZLGA 2VX4A 1TV3A 3SO7A 4M56A 1QOQA 4WQ6A 1XISA 1OCJA 1GJUA 2W3RA 1TR1A 3OBEA 3T6CA 4TR9A 2NQJA 3E96A 3WKZA 3CV1A 3BG5A 3LXAA 2XN2A 2CZEA 1ZALA 4PN2A 2AMXA 1O4UA 4H7ZA 6REQB 2W63A 1FWTA 4AF0A 3MV11 3SR7A 4BR1A 3CZLA 2YL9A 5E0KA 2ASHA 1G69A 1ONEA 4B5XA 5F4XA 4R7JA 1F76A 3OVQA 4LH8A 3PUOA 3EDEA 1GYMA 3E1F1 3EAUA 4MZ8A 1MSSA 3UXLA 2B31A 3EOSA 5D8ZA 3UG3A 4NVTA 3UF9A 2E9MA 5J5RA 1BFNA 2XIJA 1EJTC 2VZTA 2PDWA 3ARUA 4MY9A 1CCWB 2J8FA 3ZT7A 1J96A 1VRDA 3WUBA 1R9XA 3GDRA 1F73A 3T81A 3PVFA 1W9VA 1BWVA 4F0LA 4UTHA 3TW6A 3ZLFA 5FOOA 4FNSA 5ECVA 3NEHA 5D09A 3G0XA 3OVRA 2GGEA 1RQEA 5B80A 5FS8A 4FLRA 3WLQA 1R38A 3R2GA 3KRSA 3WEMA 3TJ4A 3T40A 1DE5A 2Q09A 3F4VA 3LM7A 5AN7A 2PTYA 4LJ3A 4GR1A 3RF9A 4NI8A 2FIQA 3BTNA 2G97A 4JGDA 4LANA 3DFQA 4RNIA 2BSLA 1TX0A 5D38A 1EJVC 4XAZA 4JHZA 2ZWZA 4UZUA 8RUCA 2QGHA 2DJXA 4EK7A 2F61A 1MVYA 1XCWA 1H7NA 4YCOA 2MNRA 2XZ7A 4GQGA 3B0PA 1V79A 3TAKA 3C2YA 2H90A 3MS8A 3PSWA 4CD5A 5JIWA 2E7FA 3VDAA 7PTDA 3W76A 3IUHA 4Z1YA 3QQWA 2JALA 3RCNA 4UUIA 1P7TB 2W61A 4HZ8A 4XK2A 4CNNA 1S2TA 3GNXA 1UR1A 5CH9A 3W6LA 1VHCA 4J3WA 1XFCA 5LGZA 3NYZA 1TYTA 5FEZA 1RCOB 2R1MA 3BG9A 4DO5A 2GOUA 1BZLA 2I9UA 1OVDA 3WNNA 4OECA 4NU7A 4JPGA 3TH6A 4HNNA 4Q8UA 1FQ0A 4QAWA 4LVDA 3N13A 3ALGA 3AXXA 4LNCA 2XN0A 4HPHA 4XZMX 2MUCA 1E9YB 1PYMA 5REQB 1P0NA 3MZ2A 5I77A 3AZRA 5AC8A 2X0HA 4WDXA 1AG1O 4GYPA 3ATYA 1ZXIC 4O16A 2F7FA 1Y5XA 1D9EA 2POZA 1IWBA 1SW7A 2C3DA 1DWJM 4TOQA 5AHEA 1EJUC 3BAIA 3NDZA 3CBWA 1Y5VA 2CWXA 1KBJA 3LCGA 4DY1A 5I07A 3W1NA 3FNDA 1UH3A 2E9LA 4O57A 1XINA 5J5DA 3WBEA 1E9ZB 4W5UA 3EOOA 3CPRA 3WQWA 3CWOX 2PURA 3DXIA 1SFTA 2X41A 4UQCA 4C7FA 1CGXA 3S2CA 2DZWA 1ONRA 4DO6A 1ZBWA 2X8CA 1DQUA 3INPA 4HMDA 1TFVA 2C1IA 5LIWX 4KWWA 1GZJA 4Y7EA 1OX6A 5BXRA 2YFOA 2JGQA 5DX7A 3FVDA 4KEZA 2RABA 1A47A 1S5WA 1QFEA 5HJYA 4E5TA 2FJKA 3HQ1A 3MI2A 3NCOA 4GYFA 2C91A 3UJSA 4FXSA 1V3LA 1YTEA 3S83A 4AYSA 1J0YA 5A8MA 1V0LA 3BGJA 1JZ5A 3CUJA 5HMSA 3TYBA 1W1VA 1BVWA 3C6CA 4O1AA 4PUEA 2DW7A 3HO8A 1CNVA 3NA8A 4IUOA 1KN0A 1JZ3A 1T40A 2FTWA 3CHCA 1ICPA 1OGBA 2VCAA 4WF7A 1H2JA 2DQXA 1I6NA 3GY1A 2Q8XA 1O68A 4KCTA 4QG8A 4FR6A 1OCNA 5GPRA 1WDRA 4WIWA 3MWAA 3IS4A 2YCLB 2P53A 1UIPA 1W3NA 3W6YA 5E0FA 1M03A 2HE5A 3K8KA 2FDMA 1D2KA 1EHNA 1VEMA 5ECUA 1T99A 4RUBA 4DLFA 4XX6A 4WKHA 2WMIB 4YYFA 2TMDA 1XD0A 2OPJA 3T08A 4Y8EA 5CSSA 3MP5A 2E5CA 4KGLA 4O12A 3N12A 1XFBA 3WEOA 2AGKA 2V5BA 4H2CA 1Q8AA 1MQRA 3WK3A 4NNBA 2QCFA 1OC5A 4JX6A 4NEVA 3UP8A 4NT0A 3WFAA 1ADOA 3SQMA 4TV5A 4DXKA 1UP3A 4H8HA 3RUBL 4B91A 2FHFA 3EMQA 4A2SA 2O92A 2FZ9A 2O7SA 4GXMA 3WBAA 5KSWA 4CQ8A 4LCRA 1J4EA 3ISIX 5F2GA 1SMDA 3RO8A 1RCXB 1TIWA 4W84A 3AM9A 3G3MA 2YDSA 1EP2A 3VDHA 4W4QA 2QJHA 2A21A 2ZFAA 5AYIA 4F79A 2GRTA 3O9NA 1BGAA 5FJPA 1KFLA 4R7OA 2OYLA 3MVTA 1JPDX 4CU8A 2IKGA 3VUPA 3P84A 1IXPA 4UOQA 4J3TA 1DXEA 1N55A 5AFDA 2W54A 1O5RA 2BV9A 2WZHA 1Q2SA 4W7WA 3F4NA 1ECQA 2OOFA 1EJXC 4Y90A 4B5UA 3ZR5A 2QCGA 2DH2A 2HQMA 2Q01A 1PIGA 1FWAC 3G8RA 2QCHA 3ALFA 4IX2A 1KRMA 1ZMDA 3CYJA 1OF6A 3CNYA 5HR6A 2OO6A 5FIPA 2ACRA 1FO4A 5AB3A 4QDMA 1U22A 4ADUA 4Y9AA 1DTNA 2UY3A 1VYPX 1C9DA 2BS9A 5C6MA 2GQ9A 1HFBA 1EA9C 1H63A 3IC9A 1CLVA 4ZE5A 3A5VA 3BW3A 3LGDA 5DCBA 2FZ8A 4QLLA 4Z1BA 1N62C 1ISXA 4MHBA 2FPVA 1PZ1A 3QGKC 4DZAA 2WVVB 5I3GA 3BL3A 4MUPA 3VZZA 3VGBA 2YZRA 3KL3A 1P5BA 1K1DA 2Z1VA 5TIMA 1RA0A 3HG3A 1XS2A 7TAAA 2GUBA 4GO8A 5TBOA 4NNCA 2X0YA 3B8SA 3N14A 1UD5A 2Z7KA 3BMWA 2QIWA 3VGEA 1BXCA 5KZ6A 3O0HA 3W72A 1DHPA 2J78A 3MDWA 3LB0A 2YDQA 3EEZA 2VQUA 3TWAA 2YR1A 4RNJA 1PX4A 5MHBA 1I8JA 4PMQA 1U1UA 4KEMA 3L4YA 1A4MA 3LI1A 4IXXA 2WMFA 4E8CA 2DZTA 2JK2A 5E0CA 4AIEA 2F8QA 4MTVA 2Y5EA 1XYLA 4KF1A 3OA5A 2DT0A 3HN3A 3NM1A 4KIEA 2HXUA 2HVOA 3A4AA 4MNMA 2FPTA 3DC8A 5CPLA 4YMZA 3W7DA 4EANA 5CJ5A 3I4KA 1A50A 2CLPA 5HMFA 2Y85A 1QTWA 3H2FA 1UWQA 3EWUA 3UR5A 1HL9A 1LRNA 1JCTA 2PWDA 2QV4A 2Y88A 2VZOA 2WNNA 1C29A 5CPNA 3G18A 3QR3A 3GVVA 2OWXA 1FH9A 5AHNA 2QUVA 3URHA 1WDPA 2QJJA 1F8MA 3NVTA 3L0KA 1OD0A 5FL0A 1QPOA 3HV8A 3W1XA 4NNAA 5LA1A 3WELA 1XD1A 1Q4NX 3PPHA 3ITCA 4F66A 5L9FA 1GVQA 2FMOA 3VK5A 4JIPA 1H09A 1C7SA 1HKKA 4GZEA 1GESA 1WXZA 5CLWA 3FDGA 4LUYA 4ZQNA 3G6MA 2VOMA 5I3FA 3THCA 3M0IA 4KPRA 2IXVA 3KW3A 4IL0A 4HSHA 3DENA 4KESA 1KCZA 1AL8A 3WEZA 2XTKA 4H3DA 4H6KA 1ZL1A 3G3DA 2JQXA 2ONEA 3FSTA 3F2BA 1T8QA 4ERGA 1I2NA 3URAA 1FWEC 2BASA 1US0A 3U6WA 1EZWA 1HUVA 2FH6A 1TTQA 4H9YA 3S1GA 4QEEA 5JBDA 3R43A 2XM2A 3M47A 2W67A 3EDFA 2J75A 1YXCA 1UWRA 3BCFA 1JCJA 4Q4SA 1UR4A 4W86A 4N6FA 2DIKA 2YSWA 3II4A 3UWQA 1IWAA 3V36A 2QJMA 1ZJBA 5BMWA 2X1SA 3MYPA 5AC7A 3WLIA 5GJPA 4LAMA 4O15A 3BSMA 4PE8A 3K46A 1XGDA 4KWSA 5FAGA 3SRDA 2DVUA 3BURA 3QYQA 1UMYA 4H6EA 2BBFA 3CUIA 4WD0A 3WX7A 1SSGA 1KGXA 3GTIA 2X2YA 1T8XA 3LTSA 2CBIA 4AEOA 4AZ7A 1FFVC 1GQJA 3RXZA 5U25A 1W37A 3C2VA 1Z89A 3L12A 3OVGA 2W3ZA 4LYKA 3M9YA 4XO6A 3RLUA 3W01A 4C6BA 3WF1A 4DBSA 3C3NA 5EPDA 3IRSA 1Q7MA 4LBSA 2PF8A 4J5NA 4YWSA 3TX9A 3MI6A 2EG6A 4NILA 1HJXA 5A8OA 1VENA 4DWSD 1GYNA 1X1ZA 1S5MA 5LNUA 2E40A 2INZA 1E6XM 4GNVA 4AIUA 1WOAA 3CZKA 3L4XA 5AYBA 4JQ3A 1JQXA 4K39A 1GV4A 4HB7A 4UFHA 4XV0A 1WAWA 5CCZA 3O05A 3WJXA 3DKJA 5MKGA 3POCA 1P6CA 3RPMA 3L7RA 2YDRA 3VDGA 3O63A 2GGIA 3OG3A 4YL2A 4JTAA 4JNMA 1GW1A 3SQSA 5D4YA 4C1NA 3NGJA 1VYRA 3IEBA 1J8VA 3NPXA 1QI3A 3BSGA 4GACA 5FS7A 4QISA 4DJED 1R46A 4H6RA 4LUTA 1EKOA 3FOKA 3H7UA 1UHVA 1F6YA 3AHYA 3U9IA 3OOQA 1H0GA 1QOXA 4L1GA 5CPTA 4PRTA 4M1RA 1QNQA 3OPSA 1NHQA 1MXSA 2VYOA 3TLQA 3H2MA 3O0KA 3HPXA 3W7QA 5AHFA 3VU2A 2HEJA 2AAMA 3PBMA 1VEPA 3CB8A 2BY3A 4HU0A 1R7AA 4UQBA 5GNZA 1J0HA 5BNKA 1KM0A 1EIBA 3AOFA 4ZO7A 3B05A 4H00A 3ELFA 3KOYA 4DJEC 3Q94A 1ZJHA 1M68A 1RR2A 1SO4A 1A5SA 2H6RA 4DUWA 1SZNA 3CHVA 1CDGA 1ME9A 1M7OA 2NXGA 1ZJAA 1SJDA 3L4TA 3NL2A 4ATDA 3PBYA 1KM3A 3C2OA 3G77A 3TYZA 4JY8A 2OLHA 3M6YA 1GEHA 1X6UA 3I3DA 4UTFA 4UQDA 1ICSA 2FB3A 3N3MA 3NQMA 1JGMA 1PHWA 2R1NA 3NM3A 1KKOA 2CLLA 1VYSX 2PLMA 3AUOA 5D02A 1D3GA 3L2MA 3CMGA 4FLQA 4K7YA 3DHUA 1CXFA 4J1OA 3A22A 2JIWA 3IK4A 4CEUC 1RPKA 3TZNA 4JQ4A 1M7XA 4BQ5A 4D6GA 1P0EA 2WOIA 3O7UA 1NJJA 1V08A 1HKIA 3KLJA 1GVRA 1W9PA 3DX5A 4L80A 4DJFD 1TVPA 3NZ1A 5IHSA 4HT3A 1VBRA 3GIPA 4AVOA 3WJWA 4KGJA 2VDHA 5C70A 1J0IA 1CTNA 3TUUA 5EU9A 2ALRA 3WNPA 1LT8A 1DKWA 4HMNA 1F8IA 2G3MA 3BLFA 4I5XA 5G5IA 3B8IA 1H3GA 3WJYA 4WK9A 3BUVA 3TN3A 2DZPA 1JIBA 1XG3A 4EPBC 4WZHA 4X2PA 3WL1A 1KR0A 4JY9A 3I68A 3V75A 3O1NA 2QPXA 1V59A 4EAYA 4I5UA 3VGGA 2OX4A 2HXTA 2YOCA 3BPWA 2QKFA 3LG3A 5KINA 4DJFC 3AISA 5CG7A 1DYSA 1W8SA 2WLYA 4ZCWA 1FHVA 1W9UA 4MPQA 2VOTA 3TNBA 4WRHA 1R47A 2XH2A 1QRQA 2WBKA 3KOWA 4F2UA 3ARQA 2OTDA 2C3ZA 1A5UA 3VD7A 2DSWA 4IPIA 4LC8A 1WDQA 4XTIA 4H4RA 3LLXA 1IZCA 3OHIA 3FY1A 3H4GA 3NYDA 3T0CA 4KCWA 1R8LA 1HP4A 4NAFA 1OD8A 1DOSA 1G6CA 3HOJA 1LUCB 3AFBA 1L6FA 4HKPA 3M0ZA 3CEUA 5G1YA 1NFGA 3O6AA 3CXOA 3TYCA 3EMZA 4GK8A 1ZFJA 5FJJA 1GJPA 4X0VA 1KBBA 1EBGA 1G4PA 1XIBA 4B5TA 1ONFA 1UR9A 3P5YA 5CC6A 4NL1A 4OOUA 3ZYZA 2E6DA 1XANA 4LAKA 3A6OA 2X05A 1N5XA 4RL3A 4GY7A 2DV0A 2WC4A 3CPGA 2FHCA 5JH2A 3SY5A 4B5SA 4JKLA 7TIMA 1GRFA 3QY8A 2QDEA 1GVYA 2GZXA 2WVUA 3O6YX 3FLUA 4C6OA 1P1XA 4J4KA 3SGUA 2ZXDA 3II1A 2DIEA 3L5LA 1YPFA 3R4IA 2JF6A 5IXEA 5K4ZA 1D7KA 4AZCA 4TMBA 5HUPA 4UOJA 4M6QA 3OZOA 2A6LA 3RDKA 4P7NA 1PX8A 1E6PA 4FX8A 2DZBA 3SI9A 2YDAA 3W86A 1TYPA 2QPUA 3DUGA 4HGXA 5HAOA 3BMXA 2WCSA 2E3ZA 1PL9A 2ZVRA 4IPLA 2DZXA 4MIMA 3LX9A 5HANA 5M3WA 3WF0A 2NVDA 4GQRA 4GMEA 1RALA 2XIOA 3W1AA 1EWDA 1UR8A 1THFD 2BGNE 2AL2B 2GH5A 1XQKA 4GPNA 3GNRA 4AISA 1SJBA 1UUOA 3G6LA 2GUUA 1SW0A 2VGBA 2F2HA 3WNKA 3C2EA 2VD8A 5ABTA 1E0UA 1B1YA 2VUNA 1IXQA 2WM1A 4LVFA 2J8TA 5HR7A 4QLKA 2QUUA 4G6CA 2GWNA 3LERA 4W7UA 2C7FA 2BVTA 1AD1A 2HE8A 1SZGA 3AAMA 4J2PA 1VC4A 3QQ1A 4AMCA 4BKNA 4H4SA 4CEXC 4PCFA 1ZK7A 1TPUA 4C5ZA 4ROPA 1ENUA 1XICA 4FLOA 3EXTA 1I0DA 3DYPA 3IWPA 2WW5A 5E6ZA 1TV4A 3SFWA 3NRZB 2E6YA 2IKJA 3NL3A 4GYKA 4XO7A 2J6VA 3THUA 2ACQA 3FEQA 4YU1A 2A0NA 4D2JA 1ODZA 4E4UA 1AOGA 2WNZA 2HK0A 1YHTA 3W82A 2PWHA 3VNIA 1AD4A 2VXNA 1I45A 3DDMA 2GLKA 3NUKA 4GIAA 4DJEA 3RR1A 1ZAIA 3T8QA 4WXZA 2PCEA 3F2CA 4HA0A 1GQKA 4UR8A 2ZUWA 3VNZA 5FCZA 5FF3A 3FIGA 3V3WA 4XUYA 1S39A 4IPPA 3N34A 3ERPA 5CPQA 1YDVA 4LRTA 2P76A 2X7WA 4JFTA 1OY0A 3C3UA 3B8WA 1A3WA 4ZZ9A 4CNOA 5DCDA 3W9ZA 4NASA 2A2IA 3UCDA 4F9JA 2V3AA 3NVDA 2D23A 2BOGX 4XD5A 3PUDA 4L6DA 5AYYA 3NG3A 4UQEA 2XDFA 3KWXA 1OIMA 1X98A 4JQAA 1ZKQA 1PKLA 5HNRA 4A21A 2EQ8A 4ZQPA 1KA9F 2ZCGA 4P7QA 1G9HA 3GUWA 4BFAA 4IQLA 4Q22A 3AMZA 1AODA 4JTTA 4YPJA 3WY1A 2IQDA 3WQVA 4ICCX 5KETA 2ZA3A 4JTHA 3RO6A 1RK5A 4LIIA 3PG8A 2P0IA 1PCWA 3PPCA 2OR2A 1DXLA 1M04A 3LCIA 4H4PA 3DFSA 5LIKX 4WJXA 3RRXA 3WLKX 4MDOA 3WQGA 1EF2A 3CAVA 3GZAA 3IPWA 1UOZA 5TQLA 3SCQA 2ZZCA 4QTGA 1IZKA 5HNUA 3FGCA 1MMFA 1OX4B 1HIZA 1VEOA 1XUUA 1NSJA 4WGXA 4ONVA 1JCMP 4PUNA 1L6WA 3M0KA 3ABRA 1UR3M 3M64A 1PDZA 4QS5A 3SR6B 3KWSA 4Q32A 1S2WA 1YDOA 2ISVA 2GDUA 5EL1A 5EMYA 2X09A 1JF5A 3C2RA 1E1CB 1XLGA 1GRHA 3V7PA 4D6CA 2GVYA 1FKWA 2C15A 1NOUA 5TNVA 5I79A 4YCPA 1K6AA 4U33A 2AL1A 2J66A 2PD9A 2DEPA 3R10A 4Y6GA 5EBUA 4JHMA 3WNMA 3ANVA 4NSBA 5JIPA 4EM4A 4DJFA 3FJLA 5JUVA 1LLZA 1EC9A 4O53A 4QQ3A 4IZGA 2FVMA 4CKQA 1JYXA 4AD0A 4V27A 2DU2A 2BGSA 3CS2A 5CQ1A 2PWVA 2R1KA 3VIMA 3GR4A 5AHMA 1GOWA 4GH3A 3IVTA 1OCQA 3QQ0A 2BOFX 1ZHAA 4W87A 3OLDA 2V3BA 3G1DA 4R9OA 3TQPA 3VGDA 4QM1A 5CZTA 1ISZA 1UD4A 4D6EA 2VI0A 3REQB 3QV9A 5HPCA 3UESA 3W1UA 3BDKA 3BSHA 2WMKA 1KGUA 1K4HA 1TWDA 4LEFA 2V6OA 4N02A 1TTPA 3G1SA 4O28A 1NIUA 3H4KA 4HHMA 4ZR8A 4RNFA 4OBSA 1VBJA 4GXPA 1VZWA 3AJ7A 3S6DA 2HQAA 3VGFA 2VRJA 4TTUA 4MAVA 3M07A 3R8GA 1RXOB 3MB9A 2EPNA 1UYQA 4P61A 4OTKA 2TSYA 4DUOA 1EUAA 2PS2A 4N9EA 1R5YA 1OM0A 3KEHA 3VE7A 2E5AA 4UTLA 4N9DA 5FSDC 4LA1A 4L9YA 3TMQA 1GOIA 3VXGA 4FZIA 3TXZA 4KWUA 4J2MA 3TN6A 2W66A 1XIDA 1ZCCA 1PXGA 4K7ZA 2CCRA 2VDIA 5B7ZA 2V67A 2W91A 3AHXA 3TVAA 2OLAA 3L5MA 2V81A 1AJ0A 1TE1A 1H11A 1ZTVA 2YJQA 3ME3A 2D2HA 3PNZA 4PUMA 4IIDA 3R0UA 1A3XA 1QDSA 4A3YA 4IP4A 1N61C 2FMNA 3CUFA 3ICJA 3WUGA 5FA5A 2CDUA 3MUXA 3FXYA 2PGRA 3AIRA 3UERA 1E72M 4LT9A 3WIJA 2Z2AA 4A8RA 1NHRA 3KLLA 3B8VA 1JZ7A 1VJSA 3ZXWA 1F3XA 1QNSA 3JW7A 2PRMA 1UUQA 5FSEC 5BXSA 3U57A 4BZYA 1DIOA 3S1UA 3I6RA 2A3AA 3FV9A 3SJ3A 3TNOA 4ZXLA 4LYPA 2ACUA 3WQ5A 1G94A 3UZYA 3T0DA 1A0DA 1W17A 4LUIA 5DMYA 2O9OA 4RE3A 4NJKA 4AHPA 3SY8A 1EDTA 1YXYA 2O9RA 4J7RA 2PODA 1PTGA 3E38A 3T9PA 4E38A 3W7RA 1GOMA 4KMQA 3MU7A 3ANUA 3EAOA 3TYAA 1KGWA 2FKPA 3VNJA 3LBOA 3PC0A 1RJQA 3WDRA 3PPGA 3WNLA 1E9IA 2GJNA 2ZRVA 4P2VA 1H51A 1M5WA 2EHHA 5CGMA 2X1RA 3RNDA 4AUBA 1ZNNA 3BICA 3OB8A 2PDIA 1VFMA 4UQ9A 3BLPX 3ITGA 4C6NA 4JEJA 1RUSA 3EDKA 2P3ZA 3CZGA 4L5ZA 3LCLA 3TCSA 1M65A 4DBDA 1LJYA 3UJEA 4MPKA 2HJPA 3SUUA 1EP1A 4M6PA 1SW3A 4RXGA 1JRCA 4E2DA 2J6XA 1EWEA 1JXJA 1HKJA 4WR3A 1TV5A 1QT1A 4WSJA 1P0KA 8A3HA 4XKYA 3N2CA 3H55A 3BC9A 2HS8A 3GG1A 1PSCA 4QE1A 4MUZA 3WF2A 1JDEA 4BV6A 3TOYA 3B03A 1GXFA 1B57A 4B3KA 5EYWA 1V4YA 3W7CA 5T9CE 3THQA 3ARZA 4UOZA 4Q7NA 4TXEA 3QHNA 3N2TA 3TU9A 4JNZA 2XGBA 3BGAA 3PWGA 3NPWA 2NWSA 4UZSA 1ZPTA 4A05A 1TTJA 3THAA 2BHYA 4LYRA 3LCWA 3PFRA 3W3OA 2GVLA 3BLOA 3KAOA 3P93A 1ISYA 2OT1A 3G5EA 4C1KA 4GRTA 4J9JA 3CAKA 1Q13A 5LHEA 4PR4A 3BLEA 4HYVA 4R9XA 2E5DA 5CC5A 3CV2A 3M41A 4XIMA 2GR2A 4LY4A 2WMJA 2J8GA 3AQUA 1XHCA 3CZEA 6XIMA 4FXFA 3RX3A 4J3XA 1D8WA 4GZJA 4PMXA 2WV8A 1SU5A 5DMNA 2PB1A 5BXTA 2B0MA 3E5PA 3NR0A 4YYCA 5BRPA 3MMUA 3UZZA 1MW3A 6REQA 1ZU8A 4ERIA 3TDFA 2DFAA 4BEQA 1YIXA 5AYXA 2WJDA 3LNMA 3SBFA 1WYIA 1DXFA 2J4GA 1E56A 1EBHA 4GISA 1GYLA 4G7FA 4H4UA 1HW6A 2OZTA 2EJ1A 3FK4A 5EKYA 3LK6A 3V5OA 4X3ZA 1TJ1A 5DXYA 1M6IA 2C8NA 4QBXA 2PDCA 3TR2A 2ZC1A 3UBPC 3LU2A 3NIYA 3SUSA 1PTAA 3GNOA 1JUKA 1XIJA 2QUTA 3T4WA 1RH9A 4L9XA 4JCLA 4O4WA 2WJEA 3RMEA 1CGYA 1FWWA 1I2RA 3C0JA 3KFTA 2JKPA 3NQCA 3U5UA 5AYZA 4BQ4A 1WXYA 4QG6A 4DM1A 1DIKA 3H2CA 4A22A 2PCQA 5H8PA 4IH3A 1YKWA 3AXHA 2D1ZA 1EO7A 2GFTA 5KTLA 3B4YA 3N6QA 1XDIA 3KTXA 1UPMB 1T0OA 2HWGA 1ADSA 4QSHA 3QC3A 3VPLA 5CSUA 4MWAB 4H4QA 3MMDA 3N15A 1PAMA 1WKFA 2VKZG 2KAUC 2VGFA 3VIFA 3ABQA 4JD4A 3N2OA 1RV8A 1O5QA 3WQFA 4Z2LA 4ZGYA 3S1WA 2AMGA 4Z2IA 4IIFA 4HCLA 4MAZA 2V30A 2YBTA 2O56A 1XIFA 4OU1A 3BV7A 3QFEA 2G0WA 1MEWA 3MKVA 1XQLA 3NSNA 3WCZA 1XLAA 2VMFA 2ZX8A 2NVKX 2ADAA 4ML9A 2PMQA 5K7JA 5FF7A 1FOBA 1X1NA 5JH1A 1IR2A 4F48A 1NPXA 6CGTA 1RD5A 2I5GA 3O15A 3S5NA 1OB0A 3M0VA 3VIIA 3MSDA 3F03K 1DJQA 3D3FA 4H4TA 3QEZA 2EGZA 1QMLA 3EKZA 4ENLA 3H22A 2WK2A 3T55A 4EVZA 5I3IA 4LBRA 1QNOA 2YL5A 4V28A 4LB3A 3KOZA 1CXLA 3AMDA 2BHUA 2PDXA 1OFBA 1QNVA 1P6BA 2WKGA 3MP3A 2P88A 3ZM8A 4LSBA 3UXDA 4U4MA 4GZIA 5T26A 1W3JA 1OFDA 1DWGM 3L4ZA 1YLVA 1EYEA 4E0CA 3QC0A 4K8GA 1UJPA 5REQA 4FNTA 1U5JA 2QS8A 1GG1A 1NHPA 1UP0A 4TX9A 1XLLA 3R07C 1ADDA 2QMKA 3EOUA 3QY6A 4J56A 1W2PA 2PC4A 4HNLA 5F1VA 3D47A 5I24A 3OP2A 3RJYA 1TV8A 1DQXA 1X6NA 3F4WA 1J01A 2XVPA 1G67A 3B8TA 2BGQA 1KWKA 5EMJA 2F6KA 1CB7B 1CZ1A 5DANA 2ESCA 3E2VA 3SQPA 5JMUA 1BD0A 4FDCB 2INFA 5FS6A 3W28A 4YTSA 1LOQA 4JN6A 3W00A 1XYFA 1QO2A 1YX1A 4Q8TA 4C90A 1Q85A 4QE5A 3GRSA 4CCZA 2ZC8A 1AVAA 1YNYA 4LGXA 3CMJA 1B5TA 3TW7A 5FF4A 3WO8A 4GYJA 5TF0A 4INFA 2ZZ2A 3QV7A 1XLBA 3QTPA 4AQLA 3MW7A 3ZJKA 2PTZA 4W93A 3PB0A 2NQ5A 2RH9A 1V3IA 4LQ1A 1YNQA 4DF0A 2ZUTA 4IIEA 3RX2A 5G4WA 1E1FA 4I6KA 3ZQ9A 2GR3A 1N82A 4CN1A 1S1PA 4EACA 4F2TA 2JKAA 1K4QA 1AZ2A 1A5BA 4GNKB 2PA6A 5G2IA 5DMMA 3SB0A 3CGCA 1OFAA 1S2CA 4MFDA 2E68A 2FFCA 4JN7A