2QDDA

Crystal structure of a member of enolase superfamily from roseovarius nubinhibens ism
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
370
structure length
368
Chain Sequence
SLRITRLTVFHLDLPLAKPYWLSGLKFDRLDSTYLRIDTDEGVTGWGEGCPWGHSYLPAHGPGLRAGIATLAPHLLGLDPRSLDHVNRVMDLQLPGHSYVKSPIDMACWDILGQVAGLPLWQLLGGEAATPVPINSSISTGTPDQMLGLIAEAAAQGYRTHSAKIGGSDPAQDIARIEAISAGLPDGHRVTFDVNRAWTPAIAVEVLNSVRARDWIEQPCQTLDQCAHVARRVANPIMLDECLHEFSDHLAAWSRGACEGVKIKPNRVGGLTRARQIRDFGVSVGWQMHIEDVGGTALADTAALHLAASTPEANRLASWLGHAHLADDPIPGQGARNRDGLATPPSAPGLGVIPDPEALGRPVASYDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of a member of enolase superfamily from Roseovarius nubinhibens ISM.
rcsb
source organism Roseovarius nubinhibens
total genus 120
structure length 368
sequence length 370
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2qddA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2qddA01
1JPDX 4IHCA 2OZ3A 2GGEA 3FCPA 3PWGA 4ZA0A 4K8GA 3VCNA 3DG6A 3SBFA 5ENLA 2PCEA 3S47A 4HCDA 3I4KA 3QKEA 4JN8A 4E5TA 3H7VA 4FI4A 3FJ4A 4E4UA 3MZNA 3TWBA 1ECQA 4X2PA 3IJLA 3D46A 3NFUA 1ELSA 2PTYA 1PDYA 3MWCA 2GL5A 3PWIA 3VA8A 3VFCA 3N4EA 2P3ZA 1W6TA 4HCLA 3VDGA 2OKTA 4KT2A 3IK4A 1P48A 1BKHA 3FV9A 4GGHA 2PODA 4GMEA 5FJOA 1XS2A 3SN0A 2OPJA 3S5SA 3ZVIA 1R6WA 2OLAA 1BQGA 4K1WA 4A35A 1EC9A 1MUCA 1EBGA 3TCSA 3TW9A 2GGJA 3JZUA 3V4BA 3FVDA 3OW1A 2PA6A 3PFRA 3H70A 2XH4A 3H8AA 3P93A 2PSNA 4HN8A 3RGTA 2GGGA 3QN3A 5EU9A 4GIRA 3DESA 4IT1A 3NZGA 3IJQA 3VCCA 4HNCA 1WUFA 1EC8A 3UCCA 3RR1A 2QJMA 3BSMA 3U4FA 3V5FA 1FHVA 2QVHA 3R0UA 3CXOA 2QJNA 3V3WA 3DGBA 3SN4A 3UJEA 2QQ6A 2QDDA 3Q4DA 3DERA 1L8PA 2HXUA 3KUMA 2HXTA 3QPEA 2OG9A 1NU5A 2OQHA 3VC6A 1E9IA 2HNEA 3OPSA 3ENLA 3P0WA 1ONEA 5BOFA 3MKCA 3DIPA 2PTWA 3ZVHA 2HZGA 1NELA 2PPGA 2XH2A 2OZTA 4GGBA 3CT2A 3RITA 2QJJA 3DFYA 3GY1A 1R0MA 2CHRA 1JPMA 4JHMA 3D47A 4H2HA 4F4RA 3R0KA 2O56A 3BJSA 3T6CA 5BOEA 4ZCWA 4Z17A 3HPFA 2PP0A 1KCZA 1OEPA 3FXGA 3RCYA 3UJRA 2OX4A 3MQTA 3UJFA 4IP5A 3N6HA 2ONEA 3SQSA 1XPYA 4EWJA 3OZYA 1JCTA 2XGZA 3ES8A 3B97A 1TZZA 1EC7A 3CB3A 4M0XA 3QTPA 3N4FA 3UJSA 3K1GA 1SJAA 3H12A 1SJDA 4DHGA 1RVKA 1DTNA 2PGWA 2XH7A 3DG3A 3RRAA 5FJPA 5J04A 1P43A 3TJ4A 4H83A 4GFIA 3Q45A 3QLDA 4A6GA 4K2SA 3CK5A 1IYXA 2XH0A 4E6MA 4HYRA 3CAWA 2DW7A 4YWSA 2GDQA 4IZGA 3TTEA 4G7FA 4KWSA 3DDMA 2NQLA 2MUCA 2OVLA 2MNRA 3U9IA 3CYJA 4IL2A 3SJNA 2ZADA 3SSZA 4JN7A 3I6TA 2XSXA 5FJTA 3ZLHA 1FHUA 4ENLA 3ZVHB 4IL0A 2GSHA 4KEMA 3R25A 1KKOA 3JVAA 2P8CA 3TWAA 2OO6A 4IP4A 4DX3A 1KKRA 3TJIA 2PMQA 4ROPA 4E4FA 4J1OA 3OP2A 4Z1YA 2AKZA 2P88A 3DFHA 4DN1A 3OTRA 2AL2A 2QDEA 4MMWA 4G8TA 1KD0A 4HNLA 2PU1A 3R10A 4KPLA 3UJ2A 3EEZA 3MY9A 3ZLGA 5FJRA 3P3BA 2PTXA 4E8GA 4DYEA 4DWDA 3I6EA 4MKSA 4GYPC 2PTZA 2ZC8A 3THUA 3TQPA 3IJIA 2AKMA 3T4WA 4MGGA 4H1ZA 3GO2A 3EKGA 2POZA 3N6JA 3T8QA 1MRAA 1PDZA 2GGIA 3NO1A 3R1ZA 2OFJA 3T9PA 3STPA 2QGYA 3UXLA 3OZMA 4DXKA 1SJCA 2AL1A 3PK7A 5FJUA 3JW7A 3R11A 3BOXA 3UXKA 2P0IA 3GC2A 2I5QA 3TOYA 3UCDA 3ZLFA 3FYYA 2RDXA 2DW6A 3NXLA 3V5CA 3MUCA 2PS2A 3RO6A 2PU0A 3MSYA 4HPNA 3DEQA 2PP3A 1TE6A 3VC5A 1MDLA 2PP1A 4J3ZA 2OQYA 1MDRA 1F9CA 3GD6A 1MNSA 2OZ8A 6ENLA 2FKPA 5IDZA 3DG7A 1WUEA 2FYMA 2PGEA 4M6UA 1JDFA 1EBHA 7ENLA 4H19A 3ES7A 1SJBA 4FP1A 2GGHA 1TKKA 4A3RA 1YEYA 4HCHA 4GYPA 2P8BA 3SN1A 3UGVA 2AL2B 4GISA
chains in the Genus database with same CATH superfamily
1ADDA 2I7GA 3FLUA 3VIJA 3DU0A 2UV8G 3IV3A 1EOMA 2ZIDA 3IJ6A 3IIOA 3SADA 3LQGA 2XN0A 4FI4A 1QAPA 1J0YA 1E6PA 3KOWA 3MB9A 3FA4A 1NF7A 1N63C 1JFXA 3DYOA 1EP2A 5EB8A 1FEBA 3RMEA 3MWCA 5A2CA 2GFTA 3VA8A 1TPWA 1A5MC 4B5SA 5C2CA 3LTSA 1Y5VA 2JKPA 4MY9A 1M01A 2FH6A 1Q13A 1VRDA 1L6WA 1W5PA 5MF5A 3KL5A 3QV9A 3HB9A 3CO4A 1WDRA 2EG6A 5A3HA 1GQIA 1IT7A 3P2VA 3JS3A 4R53A 1I2NA 5JVLA 1N8IA 3KDNA 2NQZA 1ZDLA 3BAKA 2WBKA 3E0FA 1RM6B 2GVLA 3DFPA 2FIQA 3PZGA 2QCEA 4F66A 1QPOA 4GKLA 4EMIA 2H8XA 1E4MM 3KBSA 1FHLA 5JCIA 1EIBA 1VYPX 1AH0A 3N12A 3ZZ1A 3CUZA 3UZYA 1CTNA 1F07A 3MWAA 3QN3A 4RNFA 2G41A 3LSBA 3R2GA 1O5KA 2WJEA 4EXQA 4QXIA 3MBFA 5T9BG 3VCCA 1V79A 3A24A 2FZ8A 3RR1A 2CLHA 4S2CA 4RXFA 4B15A 3PVFA 2FTPA 4FX6M 3CAKA 2J75A 1VFSA 4AZCB 2ZE3A 3CXOA 1BTCA 3LOTA 2OLSA 1OJXA 4D2JA 4RE3A 3S1GA 3KFTA 1TE1A 4ZTYA 1AJZA 3AHYA 4FHAA 2C1HA 4IPNB 3TYBA 1CGUA 4KCVA 2C79A 3CC1A 2IMRA 2VEIA 4K36A 3PWAA 3W26A 2HMCA 4ZQPA 1K8XA 2AMXA 4PMDA 3W7PA 2F2KA 1DE6A 5BYWA 4PUUA 2PDLA 4GD0A 3H4WA 8A3HA 1UP2A 2XH2A 3BE7A 4I9AA 1K6WA 4FAMA 2V5JA 4MDOA 2WSPA 4Q33A 2X41A 4D6DA 2CHRA 2CFYA 2BGQA 2WPGA 4DAIA 5XIMA 1E6QM 1K6AA 1PIGA 2A6LA 3GBDA 4H2HA 1Z44A 2OWCA 1ZY9A 3BO9A 4Q8WA 5GVJA 3U4AA 5C9UA 2Q71A 4XSLA 2PWDA 3FHQA 3TEVA 2FHCA 2Y8UA 3WMBA 1Z41A 3CMGA 3W1RA 4JIRA 2A21A 1SZNA 3MMWA 4XZNX 3WDHA 3AUOA 1ZAHA 2AQVA 3QFAA 4MF4A 4EWJA 1P7TB 3MDUA 4TVCA 4HA4A 1D7KA 5EPDA 3QGKC 2NX9A 4Z42C 4M0XA 4K7VA 4TR9A 4QROA 3WQ8A 4J3XA 1OC5A 2RDUA 1JROA 3HA1A 4L5ZA 3ZFHA 4IICA 4D6FA 3OYXA 4C6LA 4FF5A 3GLCA 3KEHA 2XH0A 2HRWA 2OOGA 3W74A 2NWSA 3AI0A 3E3HA 1EKOA 3CQKA 1VR6A 1DBTA 1EJTC 1SQ7A 1BXNA 1JNEA 2WBGA 4XD3A 2OODA 1M7JA 2JF6A 1Y65A 3THQA 1R47A 1VAHA 1FA2A 1KTBA 1E1CB 3AMDA 3SSZA 4NRRA 5HNTA 5FJTA 3NG3A 5EBKA 1ZS2A 3IANA 3VUSA 2R1KA 4AY7A 2VZTA 3AMZA 1NDWA 3BLFA 4Q4KA 5AHMA 2XGIA 4R7WA 1NFPA 1TPH1 1O66A 4DJFA 1PZ3A 3BL3A 3VDBA 2QVNA 1BGAA 4UQCA 1H11A 4MWAE 4IOTA 5CQ1A 1JYXA 1UR4A 1GVYA 3CIVA 4CD8A 2V0TA 4IMGA 1KLYA 3FEQA 3WBXA 1KD0A 3GZ3A 1KXTA 1WQ5A 3QQWA 2W61A 3RCMA 5FJRA 3A6OA 3KVKA 4DYEA 3AS3A 2YDAA 1TR9A 1TRIA 1XM3A 3W7EA 1H2IA 2KZHA 2OX1A 4EPDC 1XP3A 3QY8A 3I3DA 1EXPA 4WEVX 3OQEA 3ZQ9A 2AKMA 2VFHA 2IKGA 4RNHA 4C7DA 3ITOA 4NZ1A 2QCFA 3MHGA 5CPMA 2QULA 1ALDA 4M56A 3PBVA 4NHVA 1F73A 4J7RA 3WIJA 3CV1A 4LUSB 2BC1A 4LA1A 1H7PA 4Y8FA 3T8LA 4DWSD 3AS2A 3KM8A 3KVLA 1RA0A 3WK3A 1BYCA 1ZX9A 4J9JA 2P3EA 4H4QA 4YXGA 2ZWYA 4JGDA 3ONBA 1ZMCA 4F2UA 1E0UA 1K3UA 1H50A 4DUVA 4QSFA 1OYCA 5JCLA 2UY4A 5HJLA 4MUZA 1K1DA 1H60A 2ZVIA 5BXRA 5ABFA 3HZ3A 3DHUA 3MYOA 1ICQA 2JGQA 2QT3A 1LL4A 3DEQA 3U7BA 3CH0A 4WGXA 5HBFA 3HGRA 2WBAA 1CW2A 1EUAA 4EE9A 1OCQA 4ORIA 1F3EA 3T42A 1DWIM 3GM8A 2DUAA 3GTXA 1JOAA 3GVRA 3QW4B 1MNSA 3GIQA 2OB3A 3GQYA 5AHFA 6ENLA 4Z2JA 5DCEA 3C3UA 1C3FA 1OINA 4HKPA 1B3YA 3NVDA 3PTDA 4OBSA 2Y7FA 2B81A 1QMLA 2WZHA 4UTJA 3UGVA 4H4WA 1QXLA 3U2OA 3SUUA 1N82A 1UMYA 4EVZA 1GK8A 2WKGA 2CXEA 1FWBC 4NNCA 1XBVA 1QNVA 1W3NA 1NF0A 2OGYA 2ZRVA 2ZA3A 3RNMA 4LAKA 1BEUA 4NX0A 1JCLA 3W84A 5D9MA 1MFUA 3NPUA 3SQMA 2ZX5A 2VC9A 1EH9A 4FXFA 3G24A 2V5LA 3MI3A 4UR7A 4HOZA 1Y0EA 1KCKA 1XIBA 3CT7A 4U31A 4GXMA 1RPKA 4Q4QA 1XIGA 3KOFA 4HCLA 4O8RA 3JRKA 1BVZA 3TN4A 1A5LC 4JTJA 2WQPA 4MWAC 4N9CA 3OLGA 3TYUA 1M65A 2VUYA 3E0LA 2HBXA 1BTMA 2OLHA 4GQRA 2XVKA 4FK9A 2WP6A 3GVWA 2QJGA 4G1NA 3SCQA 4PODA 3RCNA 1GZ1A 3R58A 1TPC1 1UZHA 1ECEA 3NDYA 2B7PA 4PZVA 1TV4A 3NDZA 3H2AA 1VPQA 3W70A 2VRQA 3L23A 3RPTA 5SWUA 1R2SA 1EF3A 3CZEA 3ZMRA 4CD7A 2A85A 1O5QA 3ERPA 4FZIA 3I65A 2YXOA 2CHOA 3S6TA 2J4GA 2YIHA 4M8UA 1ZRQA 3AIUA 3P84A 3VM7A 4NASA 2J7BA 4O1DA 1JRBA 4IMCA 1B4EA 3SAZA 2QR6A 3W24A 5EFFA 4LB4A 3WLTA 1E6RA 3K1DA 2ZRUA 4C6JA 3GXFA 3V0UA 3R4IA 3SDOA 4JYDA 4DUWA 1IWBA 3T55A 3LV5A 3FSTA 1HL9A 2QGHA 1KM3A 3QR3A 1YE4A 1ISWA 3AQUA 1G1YA 3MVIA 5A8PA 1M7XA 1EO5A 1R87A 3UP8A 3SB0A 5C2XA 3APGA 1PKNA 5LA2A 3SGGA 4PTVA 4WK9A 2QUMA 4RE2A 1WZAA 5D2VA 1YTDA 2INFA 1XYAA 4L80A 4RW3A 1GW1A 3VD9A 5LXEA 2FDMA 5XIAA 3DECA 4HMDA 4HPJA 4KERA 1NDVA 1VBJA 4IPLA 2EXOA 1XUZA 3A4AA 1ONEA 4IX2A 1HKKA 1J10A 4WOZA 3GKAA 2X1IA 4E38A 4AW7A 2NV1A 4JTUA 3PM6A 1NELA 1YQZA 3GNPA 3VNDA 1CBGA 1DIDA 4GK8A 4J40A 3ZO9A 2ISFA 3H54A 3K8MA 2Y0FA 5LHEA 5EYWA 2P76A 3ME3A 4IH3A 1UZ4A 4S3KA 3TKFA 1WDPA 5KETA 4FNRA 4IGHA 1I2PA 1BYAA 2VR5A 5FL1A 1XKYA 2ANUA 1BKSA 3GDRA 2AAQA 3W01A 4N2YA 3VIMA 3L65A 2GSJA 4BURA 5F4SA 3DJJA 1GYNA 1M68A 2FPTA 1GRAA 1J18A 1DXLA 5FF3A 1PL9A 3BMWA 1ZJHA 1FWCC 1K4HA 1I60A 2NLYA 1HGYA 3W0KA 4MSSA 2AQOA 1UWUA 5FS6A 2DP3A 2NXGA 2XGZA 3GRIA 4AFYA 3CV7A 5CJMA 2YXXA 1JR1A 1ITUA 1CXEA 3NA8A 4M5PA 1CLKA 1NHPA 1XICA 3N4FA 4PUNA 2BOGX 3NQCA 3A5FA 3VIKA 4JTRA 3GG7A 2X1TA 4IJBA 1UHVA 1HXJA 2PWFA 3ARXA 1YQ2A 3NQVA 5J04A 4H7CA 4IMEA 3CPRA 2R1NA 5AC8A 1J9YA 2Z1KA 4H8NA 3VKAA 1ZZMA 1K7FA 1MWOA 3AMCA 4N4QA 1F61A 2V38A 4XWUA 5D2YA 3PSVA 4W5ZA 1TYGA 3MZ2A 3CPGA 3EYPA 3PZOA 2NQ5A 5DT5A 1TQXA 4AF0A 5CSYA 3M0MA 1GVFA 4HN4A 3GVQA 4IFKA 3CUHA 1CLXA 4WZHA 3W1MA 1P0KA 4CNTA 1E72M 4GVGA 1BWLA 3NGFA 4I3GA 2DZTA 4E4PA 3AYRA 2H8ZA 3MUIA 4TOQA 4P7RA 4OGZA 3DC8A 4PRRA 4Z2HA 2FZBA 1F3XA 3PPCA 4ATLA 3B9DA 3G0UA 4WY0A 2VGGA 2ZZ3A 3DFNA 4BFAA 5LNUA 2PTXA 1TELA 4GVHA 1A4LA 3GHUA 4MKSA 3WUEA 4JX4A 3URHA 3M0ZA 3THUA 4IMFA 1HJUA 3NEHA 2A4AA 5BU6A 5I24A 4H8VA 4PUEA 5AECA 2WMGA 2ZRZA 3CZLA 1A0EA 1LOQA 5D30A 3L0GA 3S6DA 2D73A 3ZJKA 3C0SA 3TW7A 4GBDA 3WLRA 2EGZA 3W4RA 3LSCA 1LORA 1HKVA 3TQVA 6A3HA 4ADWA 2FB3A 3IUDA 4DQWA 4HGXA 1CB2A 3LN3A 3ARZA 3NL2A 4CVUA 3ZLFA 3CLMA 3NXLA 3WUBA 2O55A 3IEBA 2CKRA 5BXSA 4J3WA 3LB0A 4UC5A 2BHUA 4MB4A 2NT0A 3G2GA 4FNQA 2XDFA 4UQEA 3WLQA 1MO0A 5AYZA 2QZRA 1GVEA 4HTBA 4FA3A 1QDSA 4GRSA 4OKDA 3LXDA 3URBA 3KX6A 2BY1A 3YPIA 2Z2BA 1W8SA 1BYBA 2WMIA 1O60A 4QNEA 5BXPA 1PV8A 3H7RA 2YCKX 5CGTA 2CIPA 1QPRA 4M6QA 5B80A 1Q6GA 3ITGA 2Y24A 1CGWA 3PZ9A 1VBGA 4GISA 3UGRA 3ZJ8A 1MZHA 1EB3A 3ZT5A 1ZU8A 4PB4A 3R7MA 4GYKA 4RPQA 5CPTA 3GD3A 4W9TA 4W87A 4M81A 3VOJA 1RCXB 1RQEA 3H7VA 4WRHA 3S8HA 4L9XA 1Q4WA 4KWOA 1H09A 3D46A 4O0QA 1NARA 4R9XA 4JEQA 3WH5A 1W9UA 1Z69A 3PP7A 1ZXIC 4JTEA 4M19A 2WP5A 4HNUA 4WY0F 1OX4A 4UFLA 3R43A 2O4QA 3KBNA 2F61A 4UTKA 4B3KA 2GWGA 2J6XA 3KP1A 4GZJA 2YL6A 4H41A 4XX6A 3MV11 4P8XA 1Q6FA 3BWWA 5TF0A 4M52A 4I9JA 4IFOA 5XINA 3JZUA 3U57A 3T05A 3DYMA 1Z3NA 1R7AA 2A6NA 1DTUA 1E5JA 3SW6A 1TWIA 5I07A 1K8CA 3NJ3A 1EO7A 2G95A 1A5UA 4HN8A 4V28A 4YYCA 3TK7A 1NWUA 3IJDA 4LYPA 3OBKA 4IM4A 3IVTA 5C0QA 1UR0A 3DESA 3CHCA 1TPFA 1X96A 1N61C 1W0MA 3NM1A 1S2WA 3L5MA 1CPUA 3BSMA 3V5FA 8RUCA 5D9PA 2QVHA 1F3WA 1PX4A 1BVNP 1NM9A 7A3HA 3BVJA 1RXOB 3P67A 2A3LA 1KTNA 3IGXA 1OF8A 4TVDA 3IJ8A 3QBUA 2E8YA 3V16A 4NI8A 2ZUTA 3OZOA 3AN1A 1FUYA 1EWDA 2HXUA 1OIFA 4ES4A 2ATMA 2OG9A 4KWVA 3EOSA 2D2GA 3A4WA 2EQ8A 1AD4A 4QDMA 3W86A 3HFTA 3VKDA 4BF5A 3AS1A 3WK0A 3DXIA 1X2HA 3WNKA 5BOFA 2W79A 2IPWA 3AXHA 3UW6A 3WH8A 4NJGA 1YBQA 1ZCCA 2OWXA 4GG9A 1UH3A 5IXEA 1LVLA 1HW6A 3ABQA 1XC4A 2ZDRA 1R0MA 1RP8A 1NJJA 1DJXA 4NYYA 4MWAD 5HJXA 2Z1SA 1AQHA 4JIEA 1CGTA 2ZXQA 4GC4A 3U2CA 1JRPA 1KCZA 1G67A 4RNJA 1D7FA 1S5TA 3M07A 2W63A 1XRSA 4XIAA 3RG6A 2XFYA 3VGBA 4DJFC 3TDFA 4JOMA 1DP0A 3MQTA 3UJFA 1OFDA 2A0NA 3LDVA 3O6DA 4A05A 2TSYA 5G4HC 2BVTA 3AFBA 4LAMA 4BQ3A 3GTFA 1BYDA 3AMLA 2J6VA 2WVTA 1BZLA 1XGEA 5LKYA 3MC5A 3LZ5A 4NAEA 1CEOA 3UJSA 2GPTA 1TWDA 4M80A 1SJDA 3LCIA 2BFGA 1H7NA 4YNGA 3N3TA 3EDJA 4KEZA 3NL6A 3M5YA 1GHRA 3GHRA 3PULA 1BSLA 5BMXA 2EAWA 1V0NA 3WJSA 4B92A 3LK6A 2ZKMX 1ISZA 3L2MA 2WOIA 4Q4PA 2YVJA 1EJ7L 2ZRXA 1QJWA 4G7FA 1TWZA 2RGMA 1IQ8A 1SSGA 1G69A 2VEGA 3AROA 1NWRA 5E0FA 1Y8BA 5DRIA 2WK2A 2R94A 5MKGB 3SFWA 3BG3A 2PE4A 1X6NA 1XRFA 5CG0A 1ADOA 1FH7A 3R25A 2YR1A 4LBUA 2PZ0A 4ZODA 4E4FA 5DY2A 3UWZA 3GVGA 2CZFA 1GRBA 2ESCA 4Z1YA 2P88A 2WHJA 2WWDA 4S3FA 2PU1A 3V1PA 1QI2A 5E70A 1R85A 1HFBA 4O4WA 4ML4A 1K03A 2R24A 4MAZA 1W56A 4GVIA 3WF2A 4L6HA 3FSUA 4BWLA 3A4JA 1UD4A 4WKFA 2EQDA 1GCYA 1O1HA 5HPCA 1VBHA 3LNPA 4TX6A 2EPLX 3HMCA 3WEMA 1JI2A 5M3WA 3G1SA 4PCFA 5D9NA 1VQTA 4QCFA 3W71A 4RE0A 1ME9A 1Y7VA 4UNKA 1CT5A 1DQWA 1VHCA 2J47A 3FJLA 1UKSA 1QHOA 1H41A 2WM0A 2DDXA 5FSDC 3UWWA 2BVWA 3FYYA 1NOFA 2RDXA 1SO5A 4KMQA 3MUCA 4OJYA 1ZSXA 3QQ1A 5LGXA 1G9HA 3OGVA 4O13A 2VURA 2WZEA 3TQKA 4IIDA 1DQXA 4PUJA 3L4ZA 3GNRA 4DO5A 4L4PA 4C91A 3SECA 1MW0A 4U3AA 5ABTA 2ZZCA 2E0PA 5CXPA 4LJ3A 4LX4A 3ZWTA 5DN1A 4JN6A 3P5YA 3W76A 1XI3A 3UZXA 3TSDA 3EOLA 2Z26A 4HHHA 1JDFA 2PCQA 4Y9OA 1EGVA 4H2CA 3OIHA 3H4XA 4MJZA 2C0HA 3STFA 2Q8LA 4A3RA 4HCHA 3KZPA 5M1TA 3O05A 4C5YA 2IKJA 3UYIA 5H2ZA 4QM1A 1IXOA 1KRAC 3LRMA 3VCNA 4X3ZA 3BDKA 3WJWA 2O7SA 4M6VA 2FGBA 3R8GA 1HVQA 5E1QA 1JPHA 3GHTA 5FCZA 1JCNA 2OGJA 3EOUA 4DVOA 2JIWA 4DBDA 1XX1A 4UFMA 1OFEA 1PWMA 1FWRA 3WD3A 1A5KC 3NFUA 4AYGA 1U5VA 4HU0A 2IW0A 3HM7A 5HWNA 3KL0A 1DWAM 3FN9A 1OZMA 4RXGA 2XYLA 4EF9A 2GJLA 1G4EA 3FG2P 3PR2A 2WMJA 2XSBA 2A2IA 1FKXA 1QWGA 4UWMA 6PTDA 2YVFA 1NOUA 3ECQA 2B7OA 3CZGA 3UG4A 2PZNA 1GVQA 1LCOA 2YJQA 1W3KA 3A9BA 3W7CA 3S3GA 3NO3A 4AC7C 2XTKA 1CXFA 3WDJA 3PFRA 2W6RA 2XH4A 1UD5A 1WAUA 1BRLB 3SUVA 5I06A 1LJYA 2CERA 4L9ZA 3DH7A 2DZSA 2E68A 1JAEA 1TRDA 1R9YA 2EPOA 5KZ6A 4DPPA 4GIRA 2XIMA 3CBWA 4KBXA 2QLYA 3ABSA 1EJXC 1XDMA 3FXYA 2J74A 2DSKA 1OM0A 1XGZA 3T2OA 5IOBA 3ZT6A 3TR2A 1GPWA 4FOJA 3TV8A 3E96A 3R0UA 4XZWA 3QHOA 4S3DA 4QSHA 3B03A 4K8EA 3Q4DA 1LBFA 1VPXA 1BWVA 4MADA 2R6OA 2E25A 1XRTA 1GQLA 1LWHA 3S1UA 2F7FA 3QMSA 3EOOA 1PWLA 1JZ5A 3EF6A 1Q6EA 3DYPA 1BWCA 4B3LA 5CZSA 1KCXA 1EJUC 2F84A 3UPWA 1KQYA 4ZEPA 1X1NA 2YL9A 4NZFA 3DFSA 5D9OA 1Q7MA 1VFUA 1AL7A 1PUDA 4GGBA 3IS4A 1STZA 4GH1A 3FFSA 2DSZA 2QHAA 4PBFA 2R1MA 3WF3A 2VX7A 2AAMA 3BJSA 1BLIA 5ECUA 3FJ6A 5BOEA 3AZSA 9XIAA 3NO5A 3WL1A 5FOOA 4JHOA 3E6EA 1JXKA 1XLDA 4ZOAA 3NYZA 5G1TA 4PMRA 1FIQB 2MANA 2ON3A 2ZX9A 1SR0A 4CEXC 4TTUA 1A80A 2X50A 3B0UX 1XPYA 3WQCA 1MEWA 3NOYA 5IM51 4GNJA 1PX8A 5B7YA 2PDKA 4HK5A 1J5SA 2ZZ6A 1FTXA 5ABEA 1VCFA 2X42A 1EX1A 3CGBA 3RLUA 1GOKA 2RKXA 4HQVA 1PZ2A 3FDKA 6ALDA 2YA0A 1G7VA 5E6YA 4IG2A 1DJZA 4UTUA 3W83A 5B7ZA 3WLLA 3ZM8A 3OJGA 2DZAA 4XKMA 4YMZA 3O15A 3VK5A 4ZQRA 3BW3A 3CQ0A 5TAOA 2GDQA 4AX7A 3EDEA 4EF8A 1KFKA 1AMYA 4KWSA 3BXWA 2ZYFA 4Q32A 3IIXA 2GK1B 1Q6OA 5F2MA 4AHPA 1CXHA 4LFYA 4HSOA 3MT1A 1XWYA 2H9AA 4NU7A 1VFMA 1JGIA 4PN2A 3MYPA 2NV9A 3G6LA 3KS6A 1W32A 4Z1DA 2J66A 5F1UA 2XSXA 3QFBA 1TTPA 4I7WA 1PYFA 2EG7A 4IL0A 3JU2A 3NL3A 3R89A 3WLMA 3GIYA 4D6CA 2YOCA 1VC4A 3NR0A 3PHAA 1K9EA 4B9YA 1LROA 5EMLA 1KKRA 2A79A 4LANA 3ZIZA 4DUOA 3IARA 2QAPA 4QG9A 3ITCA 1TUXA 1F74A 5CAHA 1AZ1A 3B0YA 1U33A 1CX9A 1W37A 1R3QA 4FX8A 3WY1A 2IS7A 2JGYA 1E4NA 4KPLA 3H2OA 1H49A 4IIGA 1OBAA 3GR8A 3CGDA 3MY9A 3GUGA 2YA2A 2FTWA 2W9MA 1W1TA 4F9DA 2PB1A 1GKQA 4PRTA 2YA1A 1J0HA 4JYFA 1BD0A 4GC3A 2VX5A 1ZBWA 4DJFD 2NSXA 3AXIA 3TQPA 4LV4A 3T4WA 1H7XA 2BMBA 1C9WA 2ZA1A 2RDWA 3EWWA 4JQ4A 3RLHA 5I2UA 4YWIA 2Y88A 3OLDA 2GQ3A 3W1XA 2OT0A 1MRAA 2DIKA 3AXXA 2D0FA 2F6UA 4XVDA 1EJVC 2GR3A 1FH8A 2HCVA 2QGYA 3VGHA 1V08A 4EANA 3TC6A 3GYCA 3W7MA 1HL8A 9CGTA 3H2EA 1E9YB 3PK7A 1C8YA 3GK0A 4WDUA 1A0DA 2I5QA 4C6CA 4J57A 2IPFA 4GNVA 2NPXA 4A3HA 3NZQA 3LYEA 3FOKA 3IC9A 2PU0A 2HDJA 1XYMA 3MSYA 1UUMA 3NS1B 1TV5A 1B31A 1CDGA 1XIMA 3MSDA 2NQ9A 4MB3A 5E6ZA 1KLZA 1F9CA 1X97A 3GD6A 5A6BA 2X40A 1CI1A 2BGNE 1JZ4A 4ZB5A 5K4XA 3BCJA 4MVAA 3N73A 1THFD 4PH6A 4JFUA 3UESA 3WNNA 1WOBA 4WSKA 1ZENA 5E9XA 2WW5A 1Q1WA 3HPAA 2P1FA 3UZWA 3Q37A 4AZCA 4A29A 1RH9A 1XLCA 1FH9A 1FWGC 3GNDA 4P8WA 3QOMA 4K8GA 3HRDC 2YVGA 3D6NA 1EZ2A 4U2YA 3SUTA 1JDAA 4U4MA 1T7LA 5D8WA 4XVEA 2E9MA 5KZDA 4IQJA 3W7RA 4ZENA 3DK4A 1TMHA 1J6PA 2PGFA 1FECA 1RBAA 1CXKA 4JY9A 5I7GA 4DXVA 1RCOB 4FB7A 2WLZA 5AN7A 2XGBA 4AD1A 3WH6A 1WDWA 3SRHA 3WBWA 4J3VA 4UMAA 4B5NA 3FV9A 1XH0A 4GMEA 1HKJA 3A3HA 1WBJA 3WLSA 2GR0A 4AMCA 2JF7A 5DBUA 3ZVIA 3M0YA 1R6WA 3ISIX 3CYVA 4N9BA 1OFAA 1V3IA 4CQAA 3K4DA 4IMDA 4ZOBA 1Q3NA 3NQBA 4AB4A 2YCJA 5JU6A 4CQDA 3LPFA 4L6DA 7PTDA 4HU3A 1GONA 1VFHA 4MJ4A 3RILA 2DIJA 4NILA 5KSWA 4YVPA 3VZYA 3LXBA 1FWAC 1P7TA 3F5JA 4ML9A 5U1OA 4QE1A 1HVXA 3G0SA 1EA0A 1IIHA 3W7QA 4XG1A 4YYFA 4US5A 5CZJA 4IT1A 3URNA 3GBEA 4F0KA 4GA8A 5D02A 2XVPA 2OYMA 1OC7A 1TUFA 3I7RA 3A22A 2E9BA 4RZBA 3EMCA 3LGGA 1S5NA 5EMYA 1YTEA 3ZWSA 3IJ7A 1GETA 1OJTA 2X1RA 1ENUA 4F79A 2QDDA 2Z29A 4Q22A 4Q4RA 1GEUA 1A4MA 3PANA 4CN6A 3KBJA 3WDQA 2FFCA 1FWTA 1F4HA 2DUXA 1OT2A 4C6DA 3WJZA 1E1CA 1B30A 3O0KA 3P62A 4PC8A 4NEWA 1MRQA 1KWKA 3BAIA 5HMFA 4ZB0A 1OYAA 3LCHA 5A6SA 3EX3A 2WNQA 1TX2A 2OZTA 1XIHA 7TAAA 1LUCB 1N60C 1SZEA 3E74A 5DXXA 1UIOA 3M0HA 1OG0A 4QRNA 4XZHA 3F4DA 5BMWA 1LG2A 3HG5A 2AMGA 3SQLA 1TA3B 1LQ2A 3R94A 4LUYA 3AUJA 3OZPA 4Z17A 4BZYA 2NT1A 2X0SA 1V6UA 3T2QA 2CW6A 1N2VA 2V3GA 4UFKA 2P50A 3KTCA 1SW3A 2O0TA 1F4AA 4ZTXA 1JRCA 4YL2A 3N2CA 1XISA 1J0KA 1UMLA 4MHBA 1X7FA 5JCMA 3LTPA 8TIMA 3CV2A 1MO9A 3AHZA 3W1UA 2XIBA 1O5XA 1H5VA 8CGTA 5EKYA 3W7HA 2PAJA 2BBFA 4M24A 1LOSA 2QJHA 3G22A 3AJXA 3DFOA 4GXPA 1RD6A 3VNMA 2CCRA 1Q8JA 1XDJA 2PGRA 4NZ5A 3EWCA 4LUSA 5AYXA 5HULA 4Y9MA 2X1UA 1XF0A 4TU1A 3EWZA 4O50A 2TPSA 5CC6A 2Z1XA 4UFJA 5CAKA 1J0ZA 1W8GA 3N1AA 4D1IA 1X6LA 5PTDA 5IBXA 2V3FA 3NVZB 2GZXA 2HVMA 3CAWA 4YWSA 1FP8A 4AY1A 2OEKA 1ZMDA 3S9IA 2J8GA 4DELA 5D8ZA 2ADAA 2HVOA 4V15A 3O07A 1Z9AA 5K3VA 3ARRA 3GTNA 4UMCA 1I75A 2Q3RA 2ZADA 4GBUA 1UPMB 1B5TA 4INFA 2VT0A 3VXGA 3BV7A 4C5ZA 1NEYA 3PNUA 3VKJA 1TG7A 3M0LA 3MANA 2BP1A 1BGGA 3CWHA 4HZ6A 1GEQA 1DJYA 2QUTA 3QH2A 2NQHA 3LPGA 4UBPC 2YDRA 4JCLA 4ZFCA 4ZQCA 4LUTB 3E38A 1A5NC 3G77A 4DN1A 4QDWA 4PTDA 1MW2A 4X0NA 1UQZA 2VGFA 3GE7A 3KDOA 3USBA 3V75A 3W72A 3V1HA 5A95A 4U10A 2VP8A 1VQZA 1S2AA 3I4EA 2D0HA 1AOGA 3AOFA 3ZLGA 2OXNA 1OD8A 4GI4A 4UOQA 2V3EA 2LLEA 2G3NA 2VNCA 4JQ3A 4AHQA 1XG3A 1V0KA 2DORA 2ZZ1A 4BF7A 2ALDA 4FMVA 3NVVB 3H6OA 2V6OA 4IF2A 4KGJA 3NOEA 2OOFA 3R1ZA 4QGCA 2C13A 3V36A 4BI5A 3PBUA 4AZ7A 1PE1A 1ZJBA 2DSUA 3GDKA 4DXKA 1S39A 1JFHA 1IXQA 2DT0A 5JBEA 4IX0A 1L0PA 2D69A 3LXAA 1EXBA 3WDPP 1EDQA 1PEZA 3WNOA 2WKJA 2PS2A 3NM3A 2GVEA 2ZUNA 3EWDA 2PWGA 4CUCA 1H0GA 4W8AA 3F4CA 1UP0A 1V0MA 3KRZA 1C90A 3GTIA 3VC5A 4MWAB 4J3ZA 4YVXA 3A64A 4LS0A 5EL1A 1O1ZA 2W27A 4TV6A 2OZ8A 3UBPC 4R3UA 4ACYA 5IDZA 1WUEA 1AJ0A 1PJ9A 3A12A 1FCUA 4B5VA 5DT7A 2Y5SA 1R2TA 1QW7A 4LNYA 4NI3A 3VNIA 1W17A 4XUGA 4I9TA 1KRCC 4LC6A 1TYTA 3VD3A 5K4ZA 2QUUA 3L7RA 3CUIA 4IHCA 2NVDA 1R3RA 1VBUA 3E0IA 1KBLA 2ZX6A 2X30A 2OCZA 3DG6A 4OVXA 3DHPA 4B5TA 1SPQA 3FAWA 4S3EA 4K1GA 1X1ZA 4C1NA 5CZTA 4NKCA 3W2MA 4X2PA 1L6YA 3QYQA 3MUXA 4GABA 1JZ6A 3K4AA 3QEZA 4ADUA 4MIMA 2GL5A 3N4EA 1OCJA 1DWGM 5HR6A 3VDGA 1QK0A 1J93A 4YTUA 1N8WA 3KLKA 1CGYA 4UIOA 3N2BA 2XVNA 2PODA 3TVAA 4Q8NA 1GVRA 1W1YA 1XH2A 4XB3A 4F8XA 4J5NA 4LPCA 1GZGA 2OPJA 3WFZA 2VWSA 3R0DA 1CCWB 1M5WA 2OLAA 1M6JA 3JR2A 4YTQA 1KRMA 1JL8A 2UBPC 1KM0A 2Q02A 3P7YA 3GS6A 4J3UA 4YIWA 2YB4A 3SCTA 4PTNA 4AIBA 2DVXA 2A3HA 3AU6A 3QFEA 1BF6A 1DL3A 4D6JA 1Q5MA 3SR6B 3HV9A 1KRBC 3W75A 1U1HA 1Q2RA 5EBAA 1H1YA 2NWRA 4O1CA 2WSYA 2J7EA 3N17A 1UD2A 1LBLA 1WUFA 2AGTA 3B8WA 2X2GA 3UCCA 1EBDA 2J7HA 1TWSA 2ACUA 1E0VA 2Y5JA 1V6TA 4WKHA 2ZX8A 2Z28A 5CBIA 1V6VA 3VMNA 1TV2A 2BOEX 3S6OA 1UPPA 1YDOA 5JUVA 1TCDA 4GZ7A 3KBWA 2FZNA 3P60A 4AZ6A 1RJQA 4DZHA 1NU5A 2QJIA 2C1IA 2PDNA 1YLVA 3PG9A 4DF1A 1VF8A 3LTYA 1W91A 4H00A 4E2BA 4DJDC 2Z6IA 3DBNA 4XZLX 4PEEA 5HQMA 1XYZA 3CAQA 3CIXA 2VDGA 3G8EA 1LL6A 5H6HA 2CDUA 2NUYA 4AD3A 1AG1O 4JTKA 3G6MA 4BV6A 2VR4A 1QOPA 4UQ9A 1CGXA 5AC5A 1HKMA 3T6CA 1C9DA 1FBAA 3C5QA 4PRWA 4AZBA 4RLIA 2BNJA 2B4GA 2Y61A 1DJQA 5FEXA 4GUHA 3ZJ6A 3LMYA 3HN3A 1MQQA 3VNKA 1CENA 1KM5A 4G56A 4C7GA 4ICCX 1QI5A 1F3PA 1R46A 4GACA 1GREA 1TJPA 2RJHA 2VHLA 1XW8A 4IPPA 3WBAA 3W73A 3UVAA 1WV2A 2F8QA 4HHPA 3A4XA 3HG3A 4BQ4A 4RV3A 4Z2KA 3B0VC 4J2MA 4XD6A 1ZUAX 4JQ1A 1J0JA 3HG4A 3NL5A 2Q01A 1VJIA 3RRAA 1F8WA 1VDVA 3KCJA 4C65A 2BVYA 2RGLA 3UA4A 3KLJA 3T81A 3S1XA 4MJMA 1IYXA 1JGMA 3FYOA 1TB3A 2ATSA 2ZUVA 3SIMA 1P1MA 3TONA 1U22A 4HYRA 3ATYA 1YRRA 2YLAA 4IIBA 2QF7A 3C3NA 3SZ8A 2YCLB 1K77A 2MUCA 3GU9A 3RM8A 3A3WA 1UOZA 3GNXA 2V2DA 4PCSA 2W67A 1W5MA 2J9ZA 3RN6A 1BWKA 2VEPA 1BAGA 3RF9A 1WX0A 3ZVHB 4AD2A 5JBDA 3QPZA 1SU5A 1KQZA 2WC4A 4MNJA 3VDCA 3LADA 5LA1A 2C18A 4OWGA 2V5CA 4LAUA 1GV4A 1DJHA 4B9ZA 3WFLA 3L12A 5TIMA 3W88A 1PX3A 1HJVA 3PUGA 4J1OA 2VR2A 2Y85A 3PZNA 3PJTA 2X8RA 3DFHA 3EPMA 5EBUA 2DH3A 4L4OA 2J7CA 1G4TA 4LVBA 4KFOA 5T26A 4IIFA 1Q4NX 1XLKA 1D3GA 1YXDA 4MZ1A 4Q8PA 4FLSA 4N0RA 2PTZA 4AWTA 2R1LA 1DIKA 4C6OA 5LNRA 3IRSA 3RFAA 1EJSC 1TREA 3PN8A 4XBKA 2ZZ0A 3C2YA 4W88A 4EWND 4GJJA 5U4NA 1SO4A 4MG4A 3VIGA 2HTMA 3C4UA 4DO7A 4LSBA 2G0WA 5E09A 5RUBA 1E0XA 2REQB 1EEXA 2X7WA 4OQVA 2J9YA 1H7WA 1HKWA 1QO5A 3TFCA 3U2EA 1UWRA 3R79A 4XAPA 5FJUA 2P0IA 4B90A 3E1F1 2X09A 2YLLA 3TOYA 5HOSA 4IXHA 2E5DA 2PDJA 1POKA 1SSDA 3GH7A 4GY1A 5CBBA 1XQLA 1RY8A 3LGEA 2V6AA 3N2MA 1JVNA 1IEQA 2ZWZA 3S5YA 2PP1A 1NVMA 1PTGA 3CUFA 1MDRA 2BS9A 4QJ4B 4N9DA 3VDAA 2GOKA 3MVTA 4Q8QA 1JNDA 3ABXA 5JH2A 4IJRA 1ZBVA 4G5DA 2VCCA 4XD4A 1YEYA 3VNLA 4WDWA 1V4YA 2CLFA 1YYAA 2BODX 4L4LA 2XISA 4N4PA 4MYXA 4ZA0A 4HB7A 4ILSA 4F0RA 2WQDA 3EA3A 4WR3A 5A8NA 5FAJA 4NY2A 3N9RA 2GJPA 1NDZA 1FX6A 3TFXA 4YS1A 1NFGA 3HPXA 2X0HA 4RPPA 4FALA 4L56A 3TLQA 1T40A 2YBTA 3W1LA 3KL3A 4WDTA 3S2CA 3DZ1A 4LUJA 4GUGA 1QI0A 4O0KA 4M1RA 3VAVA 2PDIA 4YN5A 1LT7A 2W66A 5FMHA 3L4YA 1N62C 4QAIA 3IK4A 3M5ZA 2A1YA 4B4FA 5K9XA 4C60A 5FJOA 3W7LA 1E0TA 1TVLA 2CBUA 3VGFA 2DVUA 2ZE0A 2IXVA 1MOKA 1LDCA 1T8QA 1UH2A 3PPHA 4K3ZA 4UTLA 3S9YA 1ISXA 4UUIA 1A5OC 1RA5A 1KM6A 5G1MA 1R3SA 4IUGA 1NY1A 4HOXA 3TA6A 1FWWA 3PUOA 5C55A 3GFYA 1KFLA 4IPIA 4MKNA 3B9EA 2WC3A 3PTMA 3ALGA 3WEOA 2EJAA 4HOWA 1JI1A 3VIOA 2FMOA 3WNLA 3C0JA 4P61A 3P80A 2CPUA 1N8FA 3Q2DA 4OV4A 2HQMA 3AHXA 4XD5A 3EB2A 5KITA 1N5WC 4JDYA 4ZSUA 4W7VA 5E0CA 4D6GA 4U5KA 1H63A 2HPMA 2WZTA 3WO8A 1Z48A 4Q4MA 1OFBA 4Z1CA 3U4FA 1FHVA 2X8CA 1BF2A 1C91A 4EQRA 1TR1A 1QPNA 4YWOA 1WDSA 1LYXA 4Y90A 2QJNA 1OCNA 1QU4A 3WNMA 5HQEA 9XIMA 4GI8A 4B91A 4XQ6A 5I5RA 3WJYA 3QM3A 1AFSA 1GRGA 2A3EA 3TP4A 4J2PA 1XDIA 2HXTA 4B5UA 1F6YA 3W02A 1QK2A 1JDCA 3GU2A 2UWFA 4Y9NA 4DLMA 2GR2A 3EDDA 4LCSA 2NXIA 5MKGA 5IBXC 1OWQA 4IUOA 3PZUA 1W3IA 3MKCA 4JIPA 1X8FA 2HZGA 2J25A 3RPMA 1NTHA 4O0ZA 5CGQA 3MCMA 2Z27A 4UCGA 5H8MA 2WHLA 3MKVA 4DM2A 2Y70A 1DKWA 1TMLA 4KIRA 1EGZA 2ZICA 1KFWA 3GY1A 4TXEA 1RUSA 3W81A 3W27A 3T07A 3RK8A 1V77A 2J7FA 1DYSA 1QTWA 1K9TA 4O15A 2TMDA 4Z0JA 4MKVA 4JPGA 3RCYA 2Y2WA 1W3TA 5EMMA 1J96A 3WQPA 3UWEA 4JR5A 1YTKA 4C6MA 1ML1A 1E4LA 2ACQA 3IV8A 1UUQA 4CD4A 4DNAA 1GKPA 4JTHA 3AMKA 4Q7BA 3C2EA 1JCTA 3WUFA 3U5UA 3P61A 3H2NA 1FWHC 3MU7A 3U3HA 3CB3A 2ZRYA 2QDHA 1G4PA 2I56A 1KC7A 3II1A 3RRXA 3EMZA 3RMJA 2E4TA 2Z25A 5K2ZA 1WXJA 2BDQA 3QLDA 5FESA 4EMWA 4O18A 2QV4A 3VZXA 3CK5A 4QE4A 1K9DA 5GRTA 2XWEA 3WQ4A 3O1NA 5TD4A 4KW2A 2B0MA 3NQ8A 1OB0A 4MPQA 1DXFA 1US3A 4UTWA 2DT1A 2WJFA 2MNRA 1DNCA 7REQB 3B8IA 2P53A 3VGGA 2EPKX 3S0CA 4KFNA 2CZDA 5A8OA 2PDWA 1NPXA 4L1WA 3VKBA 5LSMA 1AUSL 2BXZA 4OFCA 5FA5A 4JAWA 1C29A 3PJXA 3AHVA 1B3XA 1OYBA 1QBAA 2OZ0A 1TIWA 3EGJA 1D3CA 3LB8A 1OFPA 5HPOA 4DJDD 1R86A 2RHGA 2GVYA 4CNPA 1DQUA 1JYNA 2YW3A 5MHBA 3LRLA 4XK2A 4GY7A 2UY3A 1I2OA 3ANYA 1GZJA 2YAUA 3O16A 1V5XA 3BJTA 4MMWA 2QCGA 1AZ2A 3WF0A 6REQB 2EKCA 5FIPA 3II4A 1FQ0A 3NURA 4UTMA 3AIBA 2J8TA 3IIZA 3S2JA 3OVGA 2ZC8A 3HPSA 3BLEA 3HOJA 2BXVA 4P8UA 1M41A 4A2RA 1S2UA 4O8AA 3GR4A 5HDRA 3LLXA 5A94A 4QS5A 3N6JA 4D9PA 3T2PA 4CCZA 3VU2A 2EO7A 4KRTA 1GOMA 4JBRA 1W5OA 3KOZA 1HJSA 5GJNA 1KBBA 4HPXA 1MFVA 4OU1A 3GC2A 1D7YA 4Q7IA 4PUMA 2W55A 1QW9A 3M7SA 1EEPA 5FF4A 1M9HA 2Y6ZA 1QNQA 3G0XA 1UD3A 3L5AA 3R8HA 3IJ9A 3TXVA 3OYZA 2FZMA 2VFGA 3NQ2A 2CLPA 3UF9A 3XIMA 5A5WA 1OD0A 3DGRA 1G0CA 5JIPA 4UTHA 2Z1VA 1BRLA 3FGCB 1NDAA 2WZIA 1U5JA 3EAUA 4RX0A 1H62A 1J79A 4W7UA 3KP0A 1E70M 2GQ8A 1ZPTA 4ZBCA 3O6YX 3TR9A 1LT8A 3B8UA 4GQ0A 4URIA 4M6UA 1SYTA 3QPYA 4PSRA 3MP4A 1E15A 2PLMA 1SUXA 4LVFA 1XYLA 2W3SA 2HQAA 4DIAA 3UD6A 1UR2A 4Z2IA 1FKWA 3VILA 5I0DA 1Z89A 3FCPA 3KOYA 3W7OA 1UWQA 1K70A 3UNTA 1E40A 2PCEA 3S47A 5A6BD 4F2BA 1GYMA 2WCGA 3GRTA 4R33A 5IDIA 1B90A 2IKHA 1AK5A 3F03K 2NUXA 4TVYA 4D6IA 3UU0A 5T9CE 4K39A 1FWSA 2P3ZA 5LIWX 1OX6A 1ESWA 3DBPA 5GNYA 1LLWA 3VFLA 3WQ5A 5FSEC 5FACA 3WQ6A 3QJAA 1XSKA 3CZJA 2XINA 3BUVA 4DZ5A 1KM2A 5AB3A 2FMNA 2BG5A 1EC9A 3PB0A 5GPRA 1RK5A 5CZ0A 1TZ7A 1UA3A 4NYUA 1VEMA 1ZHAA 4XIMA 4AIOA 2W3ZA 4GI6A 1E1FA 3C0LA 2DZPA 2Y89A 1WB0A 6CGTA 4M6PA 2XM1A 2OJPA 2AGKA 1PSCA 4D6HA 1Q6RA 2X8GA 1HF6A 3OGRA 2G5WA 4JICA 3MP3A 5D2WA 4XAGA 1BVWA 1XG4A 5D09A 5ABHA 3MSGA 2BHYA 2PDCA 4ICNA 5CZKA 4QQ3A 4IFKB 3QZEA 4NZ3A 1R5YA 1VPYA 5BZAA 1UH4A 5A2AA 3HURA 3PZTA 4E2OA 3W07A 4QP0A 1EUNA 2X16A 3BAXA 4U2ZA 1D8CA 4MY1A 5GJPA 1WDQA 4AIEA 2WOVA 1AODA 2J9XA 3V3WA 4FX7A 4F0MA 4OOZA 2YQUA 2C6QA 4JX6A 1B9BA 1B0IA 1OVDA 4G2DA 4W84A 4ZOEA 2GK1A 4US5D 1W1PA 3H4KA 3ABRA 2Y4SA 1RPXA 4UZUA 4NAFB 3BAJA 3H2CA 3WD4A 1T3QC 2BXYA 3G1VA 4PYSA 3SSJA 4RKAA 5C71A 2CKSA 4Q8UA 3CGEA 4HBKA 3TUUA 3THAA 5J5RA 1ZTVA 1ONRA 3TTQA 3BCFA 2EPMX 3GRSA 4I7UA 5A1AA 5GNZA 5I79A 4CN1A 3QV6A 4JX5A 4UTTA 3RM4A 3E2SA 2G4JA 1Q1RA 2WYSA 1TQJA 3M9YA 3UFYA 1PPIA 1E71M 2G4FA 1JCJA 1GKRA 4P5UA 1UKOA 1H5YA 4HU4A 3MDWA 1YX1A 1A5CA 1GG0A 5LIYX 4EKJA 3CASA 3TROA 3PBGA 2A7RA 2C8NA 1FFRA 1V93A 5M5DA 2WANA 2F2HA 2DGAA 3BK0A 4AX6A 3GWQA 1FRBA 2VX6A 4Q4OA 1QUMA 4GWEA 1WKDA 1ADSA 2D24A 3CTLA 3GXTA 3HGOA 5CKSA 4LU0A 2A3BA 4W93A 4LVGA 3H53A 4R7JA 3IUIA 2G37A 1PZ0A 1NOWA 4DHGA 5M2FX 3GYEA 1YHTA 1IV8A 3SRFA 3LBOA 1H3GA 3A7RA 3QMTA 1J2WA 3MUY1 4AXKA 4LALA 1TTIA 4E6MA 3T40A 4A2SA 1GOQA 2J27A 3RPDA 3O9NA 2FHFA 4GX9A 3DDMA 1JF5A 3BZGA 2ZUMA 1PCKA 2V30A 4QCEA 4O19A 4AWUA 4S23A 5CPOA 3USZA 4QLKA 4QQUA 1UQYA 4LQ1A 1XLGA 3C0QA 3CZ8A 1FXQA 3E5BA 1P0BA 2VKZG 3BGAA 2X1SA 1UASA 2OTDA 3ITYA 1Q66A 1P4CA 5A69A 1LOLA 3OVPA 2QPUA 1Q2SA 3OG3A 1DHKA 2OO6A 4PCNA 3TJIA 2PDHA 2I14A 4L1XA 4RCXA 2X05A 4KPRA 1R3WA 3B4UA 4FNPA 4GX8A 4JTSA 2VEKA 4LS2A 2I1OA 3N6QA 3V18A 2CLKA 4LYKA 3TZFA 2C0AA 4FR1A 4AUBA 1B1YA 4DWDA 4J27A 4QFUA 4AXNA 4L1GA 3MSRA 2V3DA 3WF1A 1SZGA 4EPEC 4EK7A 1OFRA 4MGGA 3D3FA 5FI8A 4DEFA 4H1ZA 4GNKB 2GQWA 3FA5A 1DE5A 3T8QA 4JDBA 3T9PA 4DM1A 1EQPA 1U1UA 3W7DA 3U8GA 5FD0A 2BC0A 3WQVA 2NVKX 4OE7A 3SY1A 3OOQA 1M7OA 2FDSA 1V6WA 3MI2A 5FEPA 3SRKA 3R11A 1P1XA 2V9DA 3EUB3 5LZLA 1XV8A 3L21A 2NUWA 3H7UA 3VX1A 1WA3A 5A6MA 3ARWA 3P6LA 3K4WA 4LT9A 5DCDA 4PFMA 4NL1A 5BROA 4GR1A 3RO6A 3CWOX 3LLFA 4UFHA 4EAMA 2PP3A 5I6SA 2DZVA 3S46A 5IHRA 3GC5A 2QMJA 1J6OA 1KA9F 1HUVA 1IIGA 1O6IA 1K8ZA 3P8JA 4NUWA 3LM3A 3SCOA 1EBHA 3S83A 3GW3A 4JTTA 2Q3OA 4DO4A 4FP1A 1UB3A 1NDYA 1EIXA 1NP0A 1FHDA 2AOSA 3P5ZA 5DF0A 5KMYA 2INZA 4FSAA 3DGHA 3S5OA 4BKNA 3MA8A 2ABAA 4BQ2A 2VUNA 3WLNA 4DBUA 3PUDA 3VNYA 2ZZ7A 5JCNA 3WQDA 4DI9A 4FXJA 2XIQA 1TJ0A 4KCWA 2W3RA 1QI4A 4HCDA 1DORA 4AEOA 5BRQA 4NXKA 4IISA 2ZOXA 2J62A 2XWDA 4H6RA 2FVLA 6XIAA 2GJXA 2RDTA 1XDLA 5F2IA 1O12A 5LHFA 3LBCA 4O53A 5I23A 5DMMA 4HA3A 1H4PA 4P7QA 1E6ZA 1XPGA 1FWDC 4K7YA 3VTRA 4DUXA 2DZXA 3OA3A 4YLWA 4KEUA 3BW2A 3PJWA 4R34A 1ZCOA 2Y62A 2I17A 3CL8A 3BAWA 4NZCA 1WZLA 3W2NA 1QASA 4PB5A 2R8WA 1TA3A 4K1WA 5JXQA 1S38A 3ITXA 2ZBTA 4O12A 1QOXA 4RUBA 3G1XA 4ZE4A 3NAVA 2CC0A 5LXXA 3G1DA 1GSNA 4JTQA 1HG3A 8XIAA 2I5GA 4CCCA 1J11A 2IKIA 2CBJA 1KBKA 1UROA 3KRBA 2QPSA 4YTSA 2PFHA 1GOXA 1PO9A 3C2FA 2E5BA 1JG9A 2R1PA 3G3DA 1SB3B 3IUHA 3RGTA 2GGGA 3GFZA 1C7TA 3DHDA 4H7ZA 2DZUA 1H6VA 1EX5A 7ODCA 2D23A 4AQLA 2ZCGA 1EA9C 1TJRA 1N55A 1KV5A 4LBSA 1Q7ZA 3AISA 2HS8A 2Y8VA 4A22A 3NQDA 1L2UA 5BW6A 3WJXA 4D8AA 1PKMA 5K7JA 3PC0A 2GOUA 4WOQA 1Z6KA 2P5NA 4TO8A 1K7XA 1OCBA 4PMUA 1H1NA 3W1NA 5HUOA 4J56A 3W1TA 1VZWA 2VZSA 3NQAA 1JQXA 3KUMA 2FLIA 3G1RA 5HINA 2CESA 4QEEA 2XHYA 2Z7GA 1C8XA 2V3AA 1PHQA 3OPSA 1KFBA 4K7ZA 1QNOA 2HPIA 3TE9A 1UBPC 3P0WA 1EOKA 2VO5A 2ZA2A 3V35A 3EXTA 3TYAA 2VX4A 3EWUA 2PDYA 2D0GA 2G8ZA 2CZ5A 4GIYA 2W92A 3FW6A 4UTWC 1A3HA 4KWWA 1XIIA 1E43A 4HYWA 4JNZA 1VH7A 2FTYA 3D47A 1KNWA 4GUJA 3B40A 4LUTA 4CQ9A 2Z6JA 2FFIA 3BLOA 3M0KA 3W28A 5FS9A 3FEMA 3HPFA 5BOOA 5IHSA 4H4RA 1TV7A 2ZVRA 4JTDA 3I10A 3VIFA 1NH6A 3ICJA 3C6CA 4ICMA 3M47A 3MTWA 2H3BA 2XPKA 4UB9A 4D72A 4P7OA 3TMLA 1FDJA 3BICA 3DX5A 2W0UA 2PUZA 1QNPA 1OK4A 4A8IA 3T7VA 2JALA 3WH7A 3AMGA 1FCVA 1AQ0A 5I3DA 1XIFA 4H50A 4HMEA 3AALA 4N6EA 3QXBA 2J7GA 4QBXA 1NWSA 3K1GA 3AAMA 3BG9A 4BF9A 3UZZA 5JRBA 1NQ6A 3O6AA 5JIWA 4TTGA 1UD6A 4CQCA 2GQAA 3K30A 3Q45A 2Q6ZA 4K2SA 3S1VA 2IXUA 4GJ1A 3IPWA 1A5BA 2ICSA 1H61A 5FJJA 1KW1A 3EB3A 3GHSA 4X22A 1B57A 3TNOA 1JD7A 2Y5EA 3V5OA 1TJ2A 2NQLA 2NX1A 3F4NA 4K8HA 3U9IA 4XO7A 3CMFA 4JCMA 3JZEA 2V2HA 2OYKA 3NEVA 2EPNA 5EMJA 3W2LA 3P8IA 2O92A 2VOMA 4MAVA 1C7SA 1FWNA 4CNSA 2O9RA 1GVSA 2E5CA 1CYGA 1YNYA 4Y6GA 2TRSA 2JBMA 3PBWA 3R12A 4IP4A 3UETA 1HL2A 5EA9A 2QUVA 4B16A 4JTIA 2V82A 3WQEA 3WBEA 3LQLA 1EQCA 5FF7A 2POTA 2YDQA 4YVVA 5DMLA 4MFDA 3T0DA 4QISA 3UJ2A 4DI8A 3WLJA 1YADA 5AKQA 1BQCA 3EEZA 5D38A 1TWWA 1CLVA 2QCDB 1US0A 2C91A 4LF1A 5GNXA 2NW0A 1K8YA 5EMUA 1LG1A 4EAYA 1TX0A 1RJRA 3QYSA 3DI1A 5L6UA 3HG2A 3PUEA 3R13A 2V81A 1H0IA 3WMSA 3W7NA 2YYTA 3LCWA 3C2OA 3VNJA 2C3CA 3H2MA 5M17A 2DJLA 1GRHA 3TYEA 5I78A 2PD5A 1TFVA 1E56A 1ONXA 3LLDA 3WG6A 1LRNA 2AL1A 4IQEA 1LBMA 4U5IA 1GQJA 3FY1A 3DFTA 1B3WA 1YDYA 3TTOA 4LYQA 4AMAA 3WQGA 1SFLA 3PNZA 4FLQA 3ZS4A 2NSOA 4IQDA 1O4UA 3CM4A 3REQB 3F4WA 2EQ6A 1A53A 3ITLA 5DBTA 1DHPA 2ZRWA 4FIRA 3WX7A 3KWSA 3POCA 3AICA 3OHMB 1RZMA 1WE5A 1GOWA 1RVGA 1B4KA 3G5EA 3GU1A 1B54A 1E4IA 2AQWA 3OIXA 1OGBA 5REQA 3BH4A 1MW3A 4GCXA 3KAOA 1WBHA 4AVOA 2YKKA 3L5LA 1XHGA 3OVRA 5LA0A 1UC5A 1XHCA 4ZSTA 4JKLA 4PMXA 4JHZA 3O63A 3QSTA 1GEHA 2VC5A 3FJ4A 3TWBA 2HSAA 2PLKA 1LP6A 3PF3A 5LIUX 3NVYB 2WOWA 2Z4GA 4RDZA 4CEUC 4CQ8A 1SMAA 5DCBA 1ICSA 3ARQA 1MNZA 2GDVA 4MLRA 3F2BA 1BKHA 3MUAA 2XIIA 2VCAA 1IE7C 4N7QA 1RLCL 2W62A 2VI0A 3M1ZA 4RE4A 1EYEA 3SFKA 3O0FA 3VGEA 3SN0A 1FVPA 2YPIA 4O54A 1VEOA 1FWIC 3KBVA 2J7DA 1R3TA 3QF0A 3PB2A 4A3UA 4A35A 2WCSA 3AWNA 1LRTA 1EYWA 4W8LA 5HXMA 3V4BA 3QHMA 4ZQOA 2YDSA 2C3DA 4XV0A 3BARA 4UR9A 3P93A 4WUIA 1YNPA 4UTTC 4DO6A 4Y8EA 2HNHA 4XISA 4TVUA 4NJJA 3T09A 4OUIA 3H26A 4Y7EA 2CEQA 3P81A 4XZ9A 1KN0A 2O4MA 4V2XA 3NRZB 1ISYA 4HNCA 4P7NA 3W6MA 4Y9PA 1UKQA 5I3GA 1V8EA 2E40A 2GUYA 3VX0A 3A3XA 3L67A 2DFAA 1ONFA 2QCLA 3KVMA 4OOUA 3RLVA 2ZZ5A 4JEJA 4JQAA 3UR7A 4FXSA 3CNYA 3FYPA 4UQAA 3RDKA 1GTEA 2YCLA 2XU2A 1S7MA 4H6QA 2E3TA 5HUPA 5I00A 1QHZA 3QPEA 1T99A 4G7EA 1REQA 4GFSA 4U3CA 3A7AA 1AVAA 1E9IA 2HWGA 3ENLA 3AIVA 5I3JA 4DF0A 5LIXX 2G3JA 2QIWA 4JY8A 3FDGA 5AHNA 1KR0A 5EFDA 3PZVA 1SW7A 3ZVHA 2E6AA 4HZ8A 4I5RA 1TSIA 1RY0A 3N4AA 3BLPX 4U28A 1N7KA 3E49A 4EPKA 1JZ8A 1DXIA 4JTCA 3RITA 4MZ8A 5LYRA 4WJ8A 3ZXWA 2J3NA 3VCRA 3B8TA 4C6IA 2UZ9A 3BURA 1KCLA 3A13A 4BHYA 3LHVA 1FFQA 4FR6A 1LF1A 5DEZA 1GTHA 4C6NA 1KR1A 5C6MA 1I0DA 2GSEA 2IPGA 3UJRA 3T0TA 4XAYA 4OTKA 1QNSA 2OX4A 5BU9A 4AZIA 1KWGA 4IP5A 3T78A 4ECLA 4H3DA 1GGOA 4C6BA 3CGCA 1W3LA 5KZEA 4ACZB 3EPNA 1TZZA 3EKLA 2PDBA 1GVIA 4HK6A 3EX6A 1UOKA 3H12A 4LV9A 1VHNA 1YXYA 4HPHA 1XLHA 1L6GA 3B8VA 3EWYA 3NWRA 5AYIA 4C6PA 4NZJA 4IJCA 2REQA 3TJ4A 1DIEA 3TOPA 3O0HA 2V68A 2E7FA 1JZ3A 3DC0A 3LY0A 4ZO7A 3ZOAA 3RJXA 4X9YA 2XG9A 2YBUA 4IZGA 4RNIA 3TTEA 2PWVA 4W85A 4B2DA 5D05A 1VYSX 2VENA 2V69A 4PB3A 1VFFA 4N9EA 1JDDA 1NHQA 4UXDA 3STEA 1GUVA 3GKFA 2PRMA 4ENLA 2XZ7A 1SO6A 5G2WA 1DEDA 1VLWA 1V3MA 4RZ6A 3BGJA 3SJ3A 1UKTA 3TJXA 4KEVA 1UR1A 2V8ZA 1J4EA 4OZOA 4ZOCA 4ROPA 5HATA 3D9XA 5HANA 1IEVA 4XAFA 2AKZA 3SEPA 1RLDA 3KCLA 3GDTA 1OSEA 4O52A 4K37A 3LHWA 4RW5A 2TYSA 4HIBA 1KM1A 1IT0A 3SCWA 3OEXA 1ZL1A 1X8CA 1V6XA 2ASHA 1ME7A 3CO8A 2CLMA 4GHRA 1V51A 1BG4A 2VDIA 4HT3A 1W1B1 2OYLA 1EJRC 1TVNA 2G3FA 3EMQA 3WK2A 2WNZA 2Z1WA 1Z7AA 4X2RA 3TZNA 1PZ1A 3N04A 3B06A 3EWXA 4G1KA 3HU7A 3K5XA 1FFUC 2WSRA 4PSPA 5A6KA 2GUUA 4M3PA 4O1EA 3HW2A 2XFRA 4N02A 1GPFA 2JKAA 1S2VA 5DELA 1VENA 2PF8A 3HQ1A 4Y9AA 3SCRA 1OGGA 3WMLA 3B8DA 2YCIX 4NJHA 3WK1A 3N2XA 1XKJA 3MI6A 3DGZA 3AYVA 4M82A 1Z8AA 5I3KA 1TE6A 3U6WA 1PKYA 1KGUA 5G2IA 3L2LA 3N9KA 3BZJA 1IEIA 3G8RA 1P6WA 2OO0A 1U2YA 3VI2A 1L8NA 3H4GA 3SCPA 3WLHA 4E8DA 4AIUA 2VTFA 4BI6A 3HIJA 3E5PA 3N14A 3UR5A 1UYQA 1DIOA 3SUSA 2AL2B 2Q8XA 5FEWA 1UJPA 5AC6A 2WSKA 3I3BA 2ZXBA 3AO0A 5C7VA 4UCFA 5H8UA 4BEUA 2BB0A 4DWSB 3EKZA 2GUBA 3COTA 4FPSA 4TQTA 1UZ1A 3BLDA 5KINA 3IJLA 1NAL1 4FO4A 5I09A 4KWUA 1PDYA 3L4VA 3PWIA 5BCAA 1WDDA 2VZOA 4IGSA 5HR7A 4X60A 1AQFA 1QOQA 4CCDA 1W9PA 3CS2A 2GVJA 4ZO6A 1UW9A 1UKPA 5C8BB 1JULA 4H4YA 4GY0A 4HMNA 3MHUA 1MMFA 2CZVA 2PD9A 2BVDA 4QX4A 3LBMA 4H4TA 4OHQA 2A7NA 3LA4A 4HZMA 5CC5A 2RAGA 2WHKA 1MUCA 4JQ9A 3VGDA 5D2XA 3ORWA 4DZIA 1OIMA 2YZRA 3L66A 3QRHA 5CLWA 3SURA 3EPOA 4MM1A 4YCOA 3UZ5A 5C5YA 4W4QA 3NVTA 1OT1A 1UP3A 1XCFA 2TPRA 3BLKA 1XLBA 1ZBCA 1J12A 3MHFA 2BY3A 4QR6A 2ZUUA 3MO4A 3L4WA 1Q65A 3WD2A 3L0NA 1Q7QA 3GDBA 3O06A 2ACSA 3E2VA 1ZB5A 3BMVA 3QTGA 2FZDA 5AC4A 3EBVA 3VD5A 2QJMA 4X9SA 5CLTA 4GZIA 1RK6A 3MUZ1 1F76A 4PUWA 2BWGA 3W37A 1W54A 4QNWA 4KIEA 3LRKA 3C8FA 1P0NA 2Z2AA 1XBYA 2WJZA 3DGBA 3W2UA 4DJEA 3W7GA 3HF3A 4E2DA 3TSMA 1MZRA 4D71A 3I3EA 3M64A 2Y63A 1M53A 2NVAA 3EOEA 7REQA 3NNTA 4ZO8A 2PDQA 2PBOA 2WAGA 2CHNA 2QCNA 2QCMA 2WV8A 4H4PA 3OBEA 1JF6A 2VD9A 3RXZA 1B3ZA 3GAKA 5CPSA 3FS2A 1TV3A 3CB8A 4TMBA 1I1WA 3NZ1A 2ZQ0A 4WHBA 2Z2UA 2VVNA 3L8KA 3WN6A 3EA1A 4H9TA 4JIQA 1QATA 3QSRA 3SM0A 3AJ7A 4JZ5A 3TTYA 3QV8A 2Q8ZA 4IGMA 4PMVA 4S38A 6REQA 2V3BA 5HA7A 2QKFA 4RZ5A 1ISVA 1B9ZA 4JYEA 2DU2A 1GVOA 1S5VA 3ONCA 2A8XA 1NFBA 4ZQMA 1QR7A 3N6HA 3KHJA 1SFJA 4GUIA 3OZYA 1GQKA 4DF2A 3URAA 1E0WA 3L0KA 3ES8A 3C2RA 4LNCA 4XTIA 1A0CA 1VCGA 3QTPA 3G1FA 3ELFA 4FF7A 2QYGA 4IIEA 2WVVB 5TQLA 1PCWA 4A21A 1ZFJA 2DIEA 2PGWA 2XH7A 1W9BM 3R5EA 3UY8A 3G3MA 2OWWA 4QEHA 1SM9A 4E3VA 1F7BA 1FDYA 3MPGA 2HK0A 2HROA 3RHGA 2VQUA 3ID7A 5AVNA 5E93A 1D8WA 3VPLA 2DPEA 2W4XA 1W1ZA 3NSMA 5FAGA 3GTHA 1KM4A 3BC9A 1TIMA 3NQFA 1T41A 4UFIA 3SJNA 4DZAA 2BGSA 1T6MA 2JQXA 3FGCA 2VOTA 3I6TA 4RZ4A 4C1NB 5K9DA 3NYDA 4QLJA 1K02A 1QFEA 4YHEA 5LGZA 2WC7A 4BQ5A 1OC6A 1JZ7A 1J2BA 4Z08A 2J78A 4JFTA 3W25A 4QE5A 2QUNA 1JDEA 3AIEA 4FEZA 5E5CA 4ZVJA 4KS0A 2FGZA 3GXDA 3CJPA 1M04A 3UR2A 4LGXA 4DPQA 3QW3A 4HNVA 3VOGA 4ZE5A 2J77A 3EAOA 4HNLA 1MXDA 3M46A 2VFFA 3VINA 1XIJA 3B9JB 4NJIA 1FP9A 5A6LA 4IGNA 1U30A 1UG6A 5AHLA 2IQDA 3AIWA 3NQMA 1XR2A 1HJXA 4HK7A 2WWCA 3PZMA 3T4CA 3W9ZA 4X61A 3VD7A 1GJUA 3M0XA 3GO2A 4CNOA 4ZR8A 4GIEA 4TX9A 1V3HA 1IZCA 3EKGA 4JFSA 4EQXA 5DY3A 2OT1A 2WMKA 3C52A 3UG3A 4MDPA 2H3DA 4O11A 4W89A 2V5BA 1K4GA 4WXYA 3CHVA 5T91A 5K9CA 5DLCA 3W2JA 4UTFA 3OODA 4AEEA 8XIMA 4LCRA 2WPCA 2D3LA 1UD8A 2ZFAA 1ZY8A 2DW6A 1SVDA 4O10A 1IEXA 1S2TA 3OLIA 2CETA 3S4TA 4FOUA 3OG2A 4WSHA 1XCXA 5AHEA 1YPXA 3QZ6A 4Q4SA 3A7UA 4HTYA 3GX9A 4F9JA 4H4IA 1CECA 3W85A 3W1PA 4ZXOA 3W22A 3L5OA 1TPUA 4WX2A 4ERIA 4I6KA 4OIFA 4L6OA 4GI9A 4YTRA 4AVFA 3CU2A 5BNKA 5ER0A 4NG3A 4CNUA 1HP4A 5FF0A 3P74A 2OEJA 3QKZA 1GQNA 3C61A 2O9OA 2FVMA 1EJWC 4GYPA 2RH9A 2E6FA 2OQLA 2OKOA 5HMSA 2VYOA 3IGUA 2GGEA 3PWGA 4KGLA 1HIZA 1ITQA 2ZTKA 5ENLA 3VIIA 1MUWA 4JS3A 3UXDA 4JN8A 3VOFA 1O94A 4AYSA 4FDCB 2X99A 3BCDA 1VIZA 3EXRA 5AY7A 2VQTA 4IIHA 4NAFA 4FX9A 5HJYA 1ELSA 5L9FA 4ZGYA 2DEPA 3EA2A 5A2BA 2WVUA 2D3NA 2OKTA 4MB5A 2ISVA 4A8LA 2W5FA 1CZ1A 1YMYA 4PMJA 4GGHA 2ALRA 2QAEA 4J35A 1XS2A 1Q6CA 3LHYA 4AD5A 2PLJA 1FEAA 3EX1A 4WSJA 2ZXDA 1U5HA 1OX5A 4HNOA 3KRSA 3LD5A 2Z1BA 1BQGA 1WZKA 3T1GA 3KS5A 1EBGA 2GRTA 3MJYA 3UG8A 3MP5A 3WDRA 2E28A 3E02A 4FOKA 5DMNA 4CCEA 2DZWA 4NX5A 5CPLA 2BSLA 3E2RA 3O3RA 4Y2WA 1WYIA 2Y7EA 4ADTA 2CXGA 5AZ0A 1KXHA 3AYSA 3BSHA 1CIUA 3QGVA 4F40A 4REQB 1CWYA 3QR1A 3N3MA 1YXCA 3M5VA 5HK4A 4PA8A 4XBSA 1RJPA 4ERAA 4BWLC 3PZIA 2FB2A 2J8FA 4UZSA 4MNKA 4LUIA 1K9FA 1UIPA 2NLIA 1C93A 3SCSA 1WKFA 3NQ6A 1F8MA 1X2GA 3GXMA 4AWSA 5FS7A 1KXVA 4EPBC 3SN4A 3UCQA 1E55A 5F4WA 3DERA 1HT6A 1P6CA 4RR4A 4JFWA 1EDGA 3W53A 3IRDA 2WZMA 3WEZA 4V1XA 2XZ9A 1XRVA 1MSSA 4H4ZA 1V03A 2TAAA 1YDVA 4G9PA 3TH6A 3P0XA 4NSBA 1GT8A 3M6DA 4I6VA 4FS9A 4TUFA 4FNUA 3ZR4A 4F0LA 1XSIA 4FIQA 2VD8A 3LS9A 1FWFC 5CC3A 3AXKA 2OEMA 5TR3A 1KBJA 1KB3A 2DSVA 4OBTA 1GW9A 4NQ1A 4W8BA 3K8LA 1JQVA 2VRJA 5FF2A 3R0KA 4O17A 1EF2A 1MVYA 3KLLA 2CNCA 1M1BA 3T44A 2PP0A 1WXYA 3BMXA 4CGTA 3PPGA 2EQ9A 2VGIA 2CLOA 1VFTA 4MJ2A 2HE8A 4POCA 2D2HA 5F2LA 2C19A 2E5AA 4JD4A 4CN4A 2DQWA 1PIFA 2ONEA 1HZYA 5E9AA 4EQWA 1YW1A 3VKCA 3N18A 4F0HA 3DH9A 3AZRA 5HNNA 1EC7A 1VD6A 4E8CA 3HV8A 3PG8A 3WYZA 4JTAA 4K38A 3M43A 4H6KA 4OECA 2PDXA 1IR2A 4LYRA 3D0CA 1BHGA 2E1DA 3B4YA 3M16A 1RQHA 1VFOA 2WMHA 3DG3A 2IUZA 5FJPA 3R07C 1SMDA 3W7JA 2VFEA 1SZRA 4H83A 1UC4A 5C9ZA 3ALFA 5CC7A 4CVWA 4A6GA 5F2GA 3W1QA 3PBMA 3SI9A 3QV7A 3OO2A 3EWBX 1YPIA 1OY0A 2X8HA 3UT0A 1EZWA 1YE6A 1TCMA 2JE8A 2OVLA 1LM1A 3TYZA 5F7UA 1TO3A 1R7OA 2OELA 1R2RA 1LQ0A 3S2LA 1B3VA 2JFEX 1XC6A 1I6NA 3DHFA 4P2VA 4RV8A 5C9XA 1SO3A 1XYCA 3ANUA 4H9YA 3V7PA 5CCZA 1RBLA 3CEPA 3ARPA 6TAAA 3UVIA 4WF7A 1QPQA 4WJEA 3JVAA 1HP5A 1E6SM 4Q8MA 3GUWA 3KE0A 1X7IA 1UCWA 2PMQA 4G6CA 4ZO9A 4M51A 3POHA 1MXSA 3J7HA 5T8GA 3OTRA 3B3DA 4S1FA 3O2LA 4I5UA 1NIUA 1X1OA 2ZTJA 3RLGA 1UUOA 4KRUA 1MYRA 3MW7A 2AAAA 3KRUA 1ZAIA 3E0VA 4ZXLA 4DRSA 4XKYB 2VJXA 2BY2A 1ODUA 3WUGA 3RUBL 2C7FA 3TMQA 2H6RA 3NCOA 2WOQA 4IFRA 1H7OA 1FCQA 1I4NA 1W2VA 5HMDA 3IJIA 3WBYA 1IXNA 1NHRA 4YTTA 3CGTA 1NWTA 4KQNA 4M1BA 2OR2A 2INEA 1GJPA 1XYFA 2BV9A 3M4HA 2O7QA 2OFJA 1DV7A 4EP8C 1TVPA 3F1QA 3E9AA 3T0CA 1R9XA 2F9RA 3HJZA 1M3UA 4QIUA 3BQ6A 2HVNA 3VUPA 4DYJA 3O8AA 3UCDA 4HNTA 4W86A 1ODZA 3S2MA 1JD9A 1M03A 5D33A 4HSHA 4KCTA 5CSRA 1WKEA 2PC4A 2OU4A 2A5HA 3BTNA 2ZZ4A 2BY0A 2RABA 1XLIA 3WELA 1P6BA 2WPEA 1Q63A 7TIMA 4D1JA 4HYVA 5C2GA 4QJ1A 3LU2A 3TYCA 1KFCA 3MS8A 1PTAA 1JUKA 4BA0A 1XLMA 1ZK7A 1AJ2A 3VDHA 2R14A 4H19A 4C6KA 3ES7A 3ARUA 3H21A 3S5NA 1UA7A 3NUKA 1DPMA 4YJ5A 1J0IA 3SN1A 1VJZA 4HA0A 2HV5A 1AMKA 1FWJC 2XM2A 3NXFA 3TN5A 1JPDX 3LHUA 1XCWA 2DH2A 3GNNA 3LX9A 3H55A 2VM8A 3HO8A 3GB6A 3S42A 3I4KA 1QW8A 1Q45A 3BW4A 3QFWA 4J28A 2VVSA 1JEHA 1DWHM 5G2HA 4KH2A 1P5BA 3UWYA 4LVDA 3SR7A 1OFOA 2TODA 3G1AA 4I9MA 3VFCA 4DLFA 3F5LA 2QEZA 4AC1X 4DJEC 4WGHA 4M29A 2EJ1A 4O16A 4JTFA 1EPXA 2EEXA 3SO7A 5EGRA 4AHOA 2OSYA 3SCNA 1LLOA 2GJNA 4S3CA 5TBOA 2Y1HA 1D9EA 1V0LA 3N2TA 3MBDA 1RQBA 2PRHA 2GGJA 4KF1A 3W7IA 3ITTA 3DN5A 3NSNA 4NT0A 3FVDA 4RDVA 1J8VA 3CL7A 2ZUSA 4LY8A 3SY5A 4ADSA 4PBEA 4LAZA 1XD0A 2QXWA 3B9NA 1JYVA 1PYMA 3VMPA 2PSNA 3GDMA 3G18A 3TAKA 3W23A 3KXQA 4UQDA 3UR8A 1V7AA 3RU6A 1RCQA 4LY4A 3AC0A 3STCA 1KFEA 3LGDA 5A6AA 4F48A 2UY2A 3IJQA 5LNVA 4X0VA 1O7AA 1EC8A 3NGJA 1F5ZA 2WNWA 1XLEA 6TIMA 1SFTA 4A3QA 4NZ4A 5G5IA 3RU8X 1DWJM 1KGXA 3RM9A 4KCUA 2QPXA 2QQ6A 1VJSA 1XBZA 3DKJA 2HJPA 2PDFA 1VLIA 2L5HA 1VS1A 3BGGA 4NXSA 1AH3A 1HO4A 5JH1A 1NP2A 5DX7A 4S39A 3TCEA 3CUJA 1JPIA 3TXZA 1NQKA 2VC7A 1XIDA 2ZXAA 4HJWA 4KETA 5D04C 1LZOA 3CXBA 4PCTA 1GJWA 4AISA 1XLFA 4PCPA 5DMYA 3GG1A 3WLKX 2PWEA 3P14A 4EM3A 2VRKA 1DVJA 3L2IA 1R3VA 3DFYA 1XINA 1XQKA 2FJKA 2DT3A 4ZB2A 4ALDA 4HPGA 3RX2A 4MYAA 3T08A 1MQRA 2ACRA 2YL8A 4QG6A 3O6CA 3W3OA 4GUFA 5AHIA 4MUPA 1Q8AA 4ZCWA 3BPWA 4GRTA 4GYFA 2E6DA 3FXGA 4V33A 1PBGA 3GG0A 2KAUC 2PWHA 3UA3A 1IT8A 2QCDA 4ZOHB 1XLJA 5KZMA 3N15A 4JIHA 5U7SA 5E0KA 4H01A 3TIMA 3VKKA 2CLLA 4I90A 1TPEA 3RR4A 3LZ3A 1UWTA 3TX9A 1P0DA 4QS6A 4US6A 1SGJA 3UYCA 4YHGA 3OLEA 1BPLB 1SJAA 2W54A 1RVKA 4PMYA 4NNAA 5AYYA 4GYJA 1YPFA 2VZUA 2R82A 3EXSA 3XINA 4ORMA 1WOAA 3H22A 1O5RA 2BOFX 4FLOA 3IAQA 3ITVA 5JQ9A 4LOCA 2YL5A 3LUTA 2YSWA 2Y7DA 4XZBA 1E3ZA 3FKRA 2BLEA 1AW1A 1AD1A 1LLZA 2VXNA 3HBLA 2ZZ2A 1L2QA 4PL2A 5J5DA 7XIMA 5KVHA 2WB5A 3QVQA 3REQA 2VCBA 3HQPA 3UWVA 3ZJ7A 4J3SA 2ISDA 4I7VA 4MB1A 2JIEA 3P82A 3DK9A 3TLLA 4ONVA 3GSMA 3W38A 3TWAA 4LWWA 3G1YA 1H7RA 4JL1A 4Q7NA 4B2DD 3CZKA 1QCWA 3R8RA 3LCFA 3L4UA 1UBSA 1RBOB 3TJLA 1TTQA 3RYSA 1TPDA 4BS0A 4RL3A 3G1HA 2PWUA 3M41A 3KTSA 3UWQA 1BXCA 2A3CA 4PMQA 3CTTA 3LCLA 1AA1B 5LNWA 1F2JA 3OA5A 5DFAA 2ZX7A 1PHWA 5HNRA 3NSXA 3QC3A 4GYPC 4UOZA 1T5AA 1POJA 3EEGA 3NVWB 1ZALA 3UPBA 3KTXA 3UY7A 4AWEA 3ARYA 3APYA 2Y7GA 1GYLA 1I2QA 1D3HA 4QHRA 4QLLA 4WXZA 2POZA 3CL6A 1L9WA 3LXCA 1V7YA 2E09A 4IQLA 1PDZA 2GGIA 5AVHA 3STPA 2ZDSA 3UXLA 3TNBA 2F6XA 4CD5A 4JTLA 1GERA 1LWIA 1EHAA 1QPKA 4XUYA 5G4WA 1F3TA 4QJ3B 1SJCA 4H9XA 1K4QA 3H24A 5FEZA 5JCKA 4KFPA 3FNDA 1H1ZA 2W91A 3U0HA 1EHNA 3V5CA 3PY2A 3CUXA 1RSCA 3PAJA 4JFVA 2XVLA 4DJDA 4HPNA 3UZJA 1MDLA 3WQFA 1DXEA 3HPZA 5CEWA 3VE9A 3DK8A 3FX4A 3A5VA 4Z2LA 2QW5A 1CNVA 4GZEA 1BFNA 3D5HA 5LIKX 3U7VA 5FKYA 2BASA 3QHNA 1NHSA 3BAYA 3MMUA 1LPFA 2EQ7A 2BCPA 4H9VA 3ARTA 4HA1A 1UZDA 4LRTA 4C6QA 1TTJA 5A8QA 3W6LA 4O4VA 1OABA 3SBFA 4EM4A 5LNSA 1UR3M 1TV8A 1XL9A 4IMAA 4D6EA 4P8VA 4E5TA 2GH5A 4LVAA 4E4UA 3LMZA 3QY6A 1A5SA 3NQGA 3UEQA 1VYRA 1C8VA 4H9ZA 2PTYA 1UWAA 3UWUA 4WDXA 4PTWA 1HQTA 3LCGA 3WL0A 4EXBA 2XJ7A 1KBIA 3OU8A 4GLEA 1W31A 2Y8KA 4GO8A 4PGLA 3GFXA 1P48A 2DJXA 4L65A 3HGSA 4O1FA 4O57A 1Q6QA 2I57A 3L4XA 3W82A 1FDZA 3APTA 1LQAA 4I8DA 5H8PA 2WCAA 3S5SA 5I77A 1RAKA 3L68A 3ATZA 4M7TA 4UR8A 7CGTA 1Q6DA 4WCJA 2B7QA 4XZMX 2V5DA 2J88A 2XIOA 4OUEA 5D4YA 5DANA 4Y96A 3OC4A 5ABFB 2I5IA 2PA6A 3NTYA 2F6KA 1QRQA 2J13A 5I3HA 1OGSA 5FJIA 4X63A 3WD0A 3S1WA 3CEUA 3EX2A 3VO0A 4WJXA 2VELA 1Q85A 4FNTA 1SR9A 4ACZA 1ZJIA 1L6SA 4Z1AA 3V0TA 3C2VA 3ARVA 2BX7A 4LW7A 3SY8A 2Z0IA 1HJQA 1E6NA 3FHAA 3M0VA 1G01A 3LPOA 2D2JA 2FQIA 3OBAA 5EMKA 5KVIA 4LTSA 5BRPA 2NXHA 5C9WA 1AW5A 1S1RA 4AZ5A 2CYGA 4H9MA 3TW6A 1OHLA 2QMKA 3UJEA 1GRTA 3IGHX 1AL8A 3N19B 3WNPA 4ZMGA 2A7PA 4A3YA 2OQHA 3NPWA 2VDHA 2NX3A 1HX0A 4H8HA 3K8KA 1VIWA 1E51A 1X6UA 3AWOA 4MY8A 1W5NA 2RUSA 4GPNA 1JYWA 3ANVA 4JQ2A 2XVGA 4RDYA 5KEZA 4AY8A 2DSWA 4DJED 4C1LA 1JPMA 2H90A 3E0WA 3MCOA 4UTIA 1V3KA 1O68A 3SUWA 1EGMA 1OADA 1T96A 1W1IE 1OEPA 5IFPA 4KESA 5G4EA 3HFYA 3DCPA 4GOAA 4HHLA 4E3TA 1GWJA 5AZ1A 1YKWA 1LL7A 2FPVA 3N29A 4S3AA 4GH3A 2FGLA 1GESA 3VYLA 2I9UA 3SQSA 2VFDA 1PB0A 3WFAA 3B97A 4Q6JA 3GXIA 3N25A 2VL4A 1VBRA 3TN3A 4Q8OA 2D2OA 4O14A 1ZP4A 2PRLA 3WLPA 3C56A 1V3LA 1P43A 3CMJA 3AZTA 1IR1A 3NDOA 1JIBA 2NQJA 4O28A 4HHMA 1UWIA