3CGBA

Pyridine nucleotide complexes with bacillus anthracis coenzyme a-disulfide reductase: a structural analysis of dual nad(p)h specificity
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
444
structure length
444
Chain Sequence
b'MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRDKYGIDAKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGAIGLEMAETFVELGKKVRMIERNDHIGTIYDGDMAEYIYKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLVSVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyridine nucleotide-disulfide oxidoreductase, class I
publication title Pyridine Nucleotide Complexes with Bacillus anthracis Coenzyme A-Disulfide Reductase: A Structural Analysis of Dual NAD(P)H Specificity.
pubmed doi rcsb
source organism Bacillus anthracis str.
molecule tags Oxidoreductase
total genus 137
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3cgbA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgbA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgbA02
4H4QA 3GYJA 4DGKA 4CNJA 1N4VA 4NEVA 1PDHA 3QSMA 2QA2A 3OZ2A 2WU2A 2XLPA 4Z43A 2YLWA 3LOVA 2E5VA 2YG5A 3CPHG 3ZDNA 2XVIA 2AQJA 4DSGA 1VDCA 2VOUA 4Y4MA 2WP5A 4UDRA 3BHFA 1NPXA 3CGDA 4OVIA 3LXDA 1L0VA 4C74A 1ZX9A 4B67A 3GMBA 2ZZBA 3EAOA 4YSYA 2YLRA 2WPCA 2C66A 4DSHA 5EB5A 1CHUA 3QFAA 4JNAA 1N1PA 3RP8A 3AE7A 4B1BA 1GNDA 4GDEA 3KU9A 1LJ1A 2WS3A 4K5SA 3NRNA 4J36A 2RGHA 2WOIA 4PAAA 1BGJA 1Y0PA 4C5OA 3PO7A 2BYBA 3RNMA 4H4RA 1ZOVA 4H4ZA 1EL5A 2GRTA 2BS3A 2YLTA 2X8CA 1AOGA 1GRGA 3GYIA 1F3PA 2B9WA 1L9DA 5BUKA 1IUTA 4H4YA 4U8IA 1TDOA 4YWOA 4EMWA 1DJQA 3QSSA 4Z44A 3M12A 3ALJA 4N9XA 2YVJA 1YQ4A 3LJPA 2C73A 3IC9A 2YM2A 2OLOA 2A87A 1CJ2A 1KSUA 3DGHA 2WBAA 1KF6A 1E7PA 2BACA 2WU5A 2YG4A 4U8NA 2Y6QA 3RP6A 3P4RA 4NTCA 1MXTA 2BCPA 3Q9TA 2QCUA 3VR8A 3AEAA 3P4PA 3O0HA 2YVFA 5J7XA 3FBSA 4WX1A 1ZY8A 3G5RA 1JU2A 3FPZA 4Z26A 2PYXA 3NGCX 2YG7A 3NN0X 1GRAA 4PABA 2Y6RA 5KOWA 4B64A 4EIPA 3GWDA 5BULA 1P2EA 2UZZA 1IUVA 3CPIG 3NTDA 5U63A 2PHHA 1QO8A 5ER0A 3DMEA 4J33A 4JN9A 2R45A 1H7WA 5U1OA 3KVEA 4JNQA 1NHQA 2WQYA 1NG3A 3OC4A 4YXDA 2C72A 4APNA 4EQRA 2V61A 3QFBA 2J3NA 2JK6A 4U8OA 1BF3A 5CQFA 4EMJA 3H8IA 3GWFA 3NIXA 2R0GA 2FJEA 2GR1A 3LADA 1OJ9A 3BHKA 3I3LA 3AEGA 1JNZA 3UTEA 1GRHA 3II4A 2GR0A 2BS4A 4OPIA 1NG4A 1BZLA 1H84A 1PN0A 5HY5A 3DH9A 3AEDA 3S5WA 1PBBA 2R9ZA 1RYIA 1MOKA 2WDVA 3UKPA 1IJHA 2RGOA 1JRYA 1D4CA 3AE4A 3AE3A 4LU6A 2WPEA 1NHPA 2JB3A 3DJDA 1IUUA 2IIDA 2VQ7A 1W4XA 3NYCA 4USQA 1JOAA 3QVRA 3G5SA 3UKAA 1TRBA 4A79A 4EQSA 3NNEA 3VQRA 2TPRA 2XVEA 3CNTA 3DK8A 1GALA 1LV0A 2VVLA 1K0LA 2R0CA 2XFUA 4K5RA 1DOCA 3AD8B 1DOEA 3SGLA 4Z2RA 2R4EA 2BC1A 4RG4A 2GEWA 3GD4A 2XFOA 2ZBWA 3CN8A 4HB9A 3UOZA 1EL9A 4YSXA 2AR8A 2GF3A 4EM4A 2YR5A 1TDEA 3AECA 3F8DA 5C3JA 3IHMA 2YLSA 4NZHA 4ADWA 2BC0A 1YQ3A 2WETA 3JSKA 1REOA 1GEUA 2W0HA 4H4WA 1VG0A 4ICYA 1DOBA 1V59A 1KNRA 1FCDA 2GMHA 1CJCA 4OPTA 1NEKA 4CRTA 1ZDLA 1CC6A 4OPLA 3ADAB 1NAAA 2XLRA 3SQPA 5KOXA 4U2LA 1D4EA 2OALA 1ZMDA 1E1MA 4K8DA 5EB4A 4B66A 1MO9A 3KLJA 2JB2A 1GTEA 2Z5XA 3NYEA 3AD9B 1QJDA 4JQ9A 1LVLA 2VVMA 4EMIA 1GRTA 1GRBA 5L46A 1S3EA 2Q0LA 2FBWA 4FK1A 2GQFA 2X8HA 2JKCA 4YSZA 3VRDB 1L9EA 1BGNA 2OLNA 4IVOB 4K22A 3F8RA 2GB0A 3KPFA 2YG3A 3AE5A 1H86A 4GR1A 1HYUA 3D1CA 4A9WA 1OJTA 2BS2A 1XDIA 4DNAA 2YQUA 4H2RA 1CBOA 2ZZ0A 3CGEA 1YQZA 2NPXA 3GD3A 5EBKA 4K7ZA 1IUXA 1LTXR 4XWZA 3VRAA 1COYA 1PS9A 3LZXA 2WEUA 3UKQA 2XLSA 3M0OA 4XWRA 1OJCA 1M64A 4UP3A 4D03A 1NENA 1O95A 1S3BA 2C65A 2DKIA 3BNMA 4GCMA 2X8GA 1F6MA 1XPQA 3DJEA 4H4XA 1TDNA 2XFNA 4Z2UA 5C2TA 2BK4A 1GETA 2AAQA 3CPJG 4TM0A 5KXJA 4J56A 4CNKA 4AT0A 2WDQA 4TM3A 2B9YA 2I0ZA 5GRTA 3EPTA 1NDAA 2YR4A 2HQMA 4MJWA 1B8SA 4USRA 2VZ2A 3KA7A 5EOWA 2C3CA 1B4VA 3C4AA 5BVAA 2GAGB 4A65A 4ZCDA 4OPUA 1RP0A 4WCTA 4BJZA 2BXSA 2X3NA 2BK5A 1K4QA 3BI2A 3AE2A 3HZLA 5J60A 2VRMA 1TYPA 4GUVA 4A7AA 1OJDA 1UKVG 2GH5A 3AWIA 4LIIA 1N4UA 2QAEA 1GESA 1D4DA 1PXAA 4BK2A 3AXBA 4YSHA 1GREA 2O9ZA 3UOXA 5KVHA 5TR3A 4YKGA 3UKLA 5IPYA 1B37A 3REDA 4IV9A 3RHAA 1EL7A 3I6DA 3COXA 4Z25A 1GSNA 3GDNA 3AEFA 4I58A 3LZWA 3EANA 1EL8A 1CL0A 1PBCA 3CNJA 2EQ6A 3NYFA 2YLXA 3ALMA 4OCGA 1N4WA 4TM4A 4BK3A 3NH3X 4C77A 4J34A 4H4PA 4B63A 3QSEA 2OAMA 2GVCA 1E39A 2YWLA 4BK1A 3DA1A 2V3BA 2WP9A 2VVLG 1FEAA 4B69A 2R0PA 1PBFA 1ONFA 3UOYA 2ACZA 2Z5YA 1DODA 1P2HA 1NHRA 4J31A 1ZMCA 1FL2A 5HHFA 2X99A 3L1RA 1GXFA 1H7XA 2GR3A 3DGZA 4EQWA 1YY5A 3G5QA 4B68A 5IQ4A 1D5TA 2V6OA 1ZP0A 2BK3A 2FJAA 3KKJA 4U2SA 3NG7X 1PHHA 1ZKQA 3CGCA 3P4SA 1XANA 1TDFA 3P4QA 1FECA 4TLZA 4KX6A 4Y4NA 4BURA 2Q6UA 2WOWA 2V60A 3NHOX 3VRBA 4FX9A 1GOSA 2IVDA 3RP7A 3PVCA 5U25A 2VRLA 3K30A 1D7YA 3QJ4A 1PJ5A 2BA9A 4A6NB 4AT2A 4D04A 4CBQA 3NK0X 3BNUA 4AP3A 3AYLA 3NK2X 3CTYA 1Y56B 4REKA 3B6DA 4U8KA 2GQWA 2XFPA 2B7SA 4NTEA 4Z24A 2H89A 4AOSA 3ITJA 3NN6X 3C96A 4FK1C 1PBDA 5JCKA 3Q6JA 4JDRA 4H4TA 4C3YA 2GV8A 2ARDA 3BI5A 4U2TA 4I59A 4OPCA 3SFDA 3V3NA 1H6VA 3AE8A 5M10A 3M13A 4U8MA 2C70A 2B9XA 4O5QA 4CCRA 2X50A 2CVJA 3L8KA 1SEZA 2GMJA 5JCMA 1QLBA 1ZOYA 2FJBA 3K7MX 4GDPA 3UCLA 3CNDA 2YG6A 1EBDA 3IF9A 1TYTA 1GRFA 3ALLA 3CIRA 2CULA 1BKWA 2JBVA 5M0ZA 2YR6A 2R46A 3AE6A 4C3XA 1FOHA 4NTDA 1B5QA 4BV6A 4IA5A 4YKFA 3ZYXA 3DK9A 4YTMA 2YVGA 1F8RA 1Q9IA 3IHGA 4FDCB 3ATQA 5KRQA 2H88A 2B7RA 4X4JA 3VR9A 5GSNA 3DK4A 2EQ8A 1Q1RA 4U8PA 3NTAA 4ZCCA 4XXGA 3V76A 3WE0A 2JAEA 4LA1A 5FS9A 3S61A 5JCNA 1X31B 1KSSA 3ABVA 3NT6A 5KVIA 2WP6A 2OA1A 3GRSA 1PJ7A 1JEHA 3SM8A 3FIMB 1PXCA 3ICRA 3UTGA 4U8LA 3V3OA 3CNSA 1JRXA 3UP5A 1PBEA 1H83A 4TLXA 4A99A 4EQXA 3URHA 1E1LA 3AEBA 2Q0KA 2RABA 2XVHA 3K7TA 4X9NA 3NKSA 3ATRA 3UKFA 2XYOA 1CC2A 4X9MA 3ICSA 2EQ7A 4H4VA 2XVJA 3AEEA 3GMCA 5FMHA 3AB1A 1KFYA 2VQBA 3UKKA 5HXIA 2WPFA 4CY8A 1DJNA 2V3AA 2WDRA 3UTHA 2V5ZA 4CY6A 1VRQB 5FS8A 2C7GA 4IVMB 4UDPA 5BRTA 3UTFA 1H82A 2C3DA 4H4UA 4U8JA 2QA1A 2B76A 2BXRA 3ICTA 3T37A 3C4NA 1E1KA 1KDGA 2E4GA 3UKHA 1KNPA 1F8SA 1O5WA 4AOXA 1DNCA 2A8XA 3GDPA 4M52A 4E0VA 2BABA 2R4JA 3CNPA 1Q1WA 2CFYA 4O5UA 4J57A 3SFEA 2YAUA 4P9SA 4H50A 4H4SA 1RSGA 1LQUA 2EQ9A 2FJDA 1VG9A 4OPDA 4RG3A 3KD9A 2C75A 1LQTA 1S2QA 3AE1A 4H2QA 4J2WA 2XFQA 2C67A 2WHDA 2GAHB 2NVKX 3QVPA 1IUWA 3R9UA 1DXLA 5FS6A 2E1MA 3GRTA 2A89A 4HA6A 5JCIA 2XCGA 2XLTA 1BWCA 1K0IA 3B3RA 4ZN0A 1TDKA 2XVFA 1CJ3A 4H2NA 4BJYA 2YM1A 2WESA 4ECHA 3P9UA 1ELIA 1YKJA 2JB1A 3H8LA 5LV9A 1PJ6A 2APGA 4H7UA 2IVEA 4B65A 4KPRA 4GRTA 4JY2A 4EIQA 4YTPA 3EF6A 4YTNA 3LB8A 3ISHA 3IWAA 1LPFA 1O94A 1H81A 1GPEA 3UOVA 1S2YA 3K7QX 2GR2A 2Q7VA 2XDOA 5DBJA 1PXBA 3AD7B 1E1NA 3F8PA 3DJJA 1CF3A 1D7LA 5FS7A 2DKHA 4H2PA 4JY3A 2WOVA 2C64A 2YLZA 5IQ1A 5HYMA 3CGBA 2XLUA 3UP4A 1M6IA 4K2XA 3H4KA 2F5ZA 1JNRA 3DJGX 4IA6A 4CCQA 3P1WA 3AE9A 1NHSA 3BI4A 3GSIA 2CDUA 3D8XA 5CKUA 3E1TA 3FMWA 4YT0A 2RGJA 1CJ4A 3NLCA 4AP1A 5JCLA 3PS9A 5KWFA 2BCGG 4Y4LA 3AYIA 4UDQA 1IUSA 4Z2TA 1GT8A 1OJAA 4EM3A 4A6NA 2C76A 4GF7A 1JRZA 1K0JA 3NK1X 1CC4A 4A5LA 1FEBA 1L9CA 1XHCA 3AYJA 1ZK7A 1Z6LA 4NEWA 1GERA 1E6EA 1GV4A 2TMDA 2ZZCA 1GTHA 1VQWA 4OPGA 1F8WA 4TM1A 3FG2P 4RSLA 1Y56A
chains in the Genus database with same CATH superfamily
4GGHA 2WU2A 3CPHG 3ZDNA 2XVIA 2WP5A 3BHFA 3CGDA 3LXDA 3VCNA 4GIRA 2YLRA 1JDFA 1N1PA 1ONEA 3AE7A 4J36A 3PO7A 2HZGA 1ZOVA 1EL5A 2GRTA 2X8CA 4MGGA 3ES7A 1FFUC 4H4YA 4G6HA 3GD6A 4YWOA 1DJQA 2YVJA 3LJPA 1CJ2A 2YG4A 3DGHA 3BJSA 3PK7A 3RP6A 4NTCA 2P3ZA 2QCUA 3AEAA 3VFCA 3G5RA 3FPZA 4K1WA 2YG7A 3GWDA 3NVYB 4NNJA 2UZZA 3CPIG 3UXLA 4J33A 1H7WA 4GISA 1NG3A 4H19A 4APNA 3IJIA 3QFBA 2JK6A 4U8OA 3JZUA 2FJEA 2GR1A 3LADA 1YEYA 3AEGA 1JNZA 1BZLA 2PCEA 3AEDA 3S5WA 2PU0A 1RYIA 3UKPA 1IJHA 5G5HB 1JRYA 3UJRA 3AE4A 1IUUA 4USQA 3NYCA 1JOAA 3G5SA 4A79A 3CNTA 3DK8A 3OPSA 3MUCA 1DOEA 3SGLA 1ZXIC 2GEWA 2ZBWA 4G74A 4EM4A 1JRPA 2YR5A 3F8DA 1XPYA 1VG0A 1DOBA 2GMHA 1MNSA 3ADAB 5KOXA 4U2LA 1SJAA 3R25A 1MO9A 1SJDA 2Z5XA 1V97A 1LVLA 4A6GA 4EMIA 3UXKA 3T2KA 4KT2A 2Q0LA 4FK1A 2FBWA 2PP0A 3VRDB 3A7RA 4K22A 3NRZB 3DEQA 2YG3A 4A9WA 2BS2A 4DNAA 2YQUA 2QJNA 2ZZ0A 3CGEA 3ETRB 4ZA0A 5EBKA 1LTXR 1KCZA 4XWZA 1PS9A 3SSZA 3DGBA 4XWRA 1OJCA 1M64A 4D03A 4HPNA 5KMQA 2DKIA 3BNMA 4KWSA 3B97A 1F6MA 1XPQA 1TDNA 4J56A 5BOFA 3SR6B 1B8SA 3KA7A 2C3CA 2GAGB 4A65A 4OPUA 4BJZA 2X3NA 5J60A 1TYPA 4A7AA 3AWIA 4LIIA 1N4UA 4BK2A 3I6TA 3AXBA 4YSHA 1GREA 5TR3A 3UKLA 3SN4A 3V4BA 2ONEA 1B37A 3NVVB 1GSNA 3EANA 3ZLHA 1CL0A 1PBCA 3CNJA 2EQ6A 3NYFA 3SY4A 1N4WA 4C77A 3NH3X 1EC8A 2WP9A 4GGBA 1FEAA 3KUMA 2R0PA 3EEZA 2ACZA 2Z5YA 1NHRA 2QJJA 4J31A 5HHFA 1GXFA 3QKEA 2V6OA 1ZP0A 2BK3A 4U2SA 2P8BA 3NG7X 1PHHA 1VQZA 3PWGA 1JROA 3K30A 4D04A 4DWDA 4AP3A 3B6DA 4AOSA 3NN6X 3C96A 5JCKA 4H4TA 3S47A 3FJ4A 4I59A 3SFDA 1H6VA 3TWBA 3AE8A 2C70A 1RM6B 2CVJA 3L8KA 3GC2A 1QLBA 1ZOYA 3K7MX 2P0IA 3HW2A 2YG6A 4G9KA 4G73A 3ALLA 3CIRA 5M0ZA 3AE6A 1KD0A 3QTPA 3DG3A 2YVGA 1SJCA 3ATQA 2B7RA 5GSNA 2EQ8A 3P0WA 1Q1RA 3V76A 3NTAA 5JCNA 4X2PA 5KVIA 2WP6A 2C4CA 3GRSA 1KKRA 4U8LA 1JRXA 3OZYA 1E1LA 3ATRA 2XYOA 4X9MA 3ICSA 3AEEA 2XVJA 2VQBA 5HXIA 2V3AA 1FFVC 2V5ZA 1VRQB 4IVMB 4UDPA 3UTFA 1H82A 4U8JA 3NS1B 4MKSA 2B76A 2BXRA 3C4NA 1KDGA 4AOXA 1F8SA 2A8XA 2BABA 1Q1WA 2CFYA 3BOXA 2YAUA 4H4SA 4OPDA 4RG3A 3KD9A 3UJ2A 4J2WA 2C67A 3KPKA 3GRTA 4HA6A 2XCGA 2W3SA 4ZN0A 2GGIA 2OQHA 3EUB3 4BJYA 1ELIA 2JB1A 3H8LA 2OPJA 2APGA 2IVEA 4KPRA 3L5OA 3NVZB 4EIQA 4YTPA 3EF6A 5FJUA 3IWAA 1LPFA 1GPEA 3I4KA 2XDOA 1MUCA 3F8PA 5FS7A 4H2PA 1FIQB 4K2XA 3H8AA 2F5ZA 3NVWB 5CKUA 3PS9A 4GAVA 5KWFA 4Y4LA 3CYJA 3AYIA 4EM3A 4A6NA 4GF7A 1JRZA 3PG6A 1FEBA 3SZ0A 1Z6LA 4ECHA 2XH0A 2OZ3A 1N4VA 4NEVA 2QA2A 3OZ2A 4Z43A 2YLWA 2E5VA 2PA6A 2YG5A 2AQJA 3T6CA 4Y4MA 1NPXA 4C74A 3EAOA 3NO1A 3STPA 4B1BA 2WS3A 4K5SA 4PAAA 3RNMA 4H4RA 2PU1A 1WUEA 1F3PA 2AL2A 1L9DA 2OO6A 1TDOA 4Z17A 4EMWA 3QSSA 1H2IA 1YQ4A 6ENLA 2A87A 5KNLA 5BOEA 1KF6A 3Q9TA 3Q45A 3P4PA 3O0HA 2YVFA 4H83A 3MKCA 2BRYA 4WX1A 1JU2A 2PYXA 3NGCX 3NN0X 4NWZA 7ENLA 2P8CA 3V5CA 5KOWA 4B64A 3UCCA 1IUVA 5ER0A 4JN9A 1JPDX 2R45A 5U1OA 5J04A 4JNQA 3OC4A 4YXDA 3QN3A 3TQPA 2XH7A 2R0GA 1OJ9A 1GRHA 4IT1A 3NZGA 2QDDA 3R11A 2R9ZA 3V3WA 1D4CA 1NHPA 2JB3A 3MY9A 3CB3A 1W4XA 4HCDA 2QDEA 4EQSA 3NNEA 2ZADA 2XVEA 2XFUA 2PODA 4K5RA 1DOCA 1N5WC 3OW1A 3D9XA 3GY1A 1P43A 4Z2RA 4HB9A 3CN8A 3UOZA 4YSXA 3ENLA 3AECA 4ADWA 2WETA 3RRAA 4E5TA 3SX6A 2QGYA 1V59A 2AKZA 1CJCA 3CAWA 1NEKA 1NAAA 3SQPA 3VC5A 2GDQA 1E1MA 3N6JA 2XGZA 3NYEA 3AD9B 1KN0A 1QJDA 1PDZA 1T3QC 2VVMA 5L46A 1IYXA 2GQFA 1BGNA 2PP3A 3EKGA 2GB0A 3KPFA 1EBHA 4GR1A 1HYUA 1OJTA 3I6EA 1XDIA 3SJNA 2OQYA 4K7ZA 1IUXA 1COYA 2WEUA 3M0OA 1JPMA 1S3BA 3N4EA 3TJ4A 3OZMA 4GCMA 2X8GA 4Z2UA 5G5GB 4TM0A 4CNKA 4AT0A 2HQMA 2VZ2A 3C4AA 1B4VA 1RP0A 4WCTA 2BK5A 5KMSA 1OJDA 3RR1A 4YKGA 2PGEA 5IPYA 3GDNA 3TOYA 3AEFA 3LZWA 1EL8A 2OZ8A 3ALMA 4BK3A 3QPEA 4H4PA 4J34A 4EWJA 1E39A 3B9JB 3DA1A 2VVLG 4B69A 1PBFA 1ONFA 3UOYA 3N6HA 3AM9A 1FL2A 4EQWA 3G5QA 4HYRA 3T2ZA 3P4SA 1ZKQA 1VDVA 1XANA 1TDFA 3P4QA 4TLZA 4Y4NA 4BURA 2WOWA 3VRBA 1S7MA 1GOSA 4AT2A 4A6NB 2BA9A 3NK0X 4ZOHB 5EU9A 3NK2X 2GGEA 4REKA 2XFPA 3ITJA 4FK1C 3A7UA 4KPLA 1MDLA 3DG6A 2ARDA 3BI5A 4U2TA 4OPCA 4U8MA 4O5QA 2X50A 2GGHA 4IP5A 1EC9A 1OEPA 3UCLA 1GRFA 4H2HA 2HXUA 2CULA 1TE6A 3P3BA 4C3XA 4NTDA 4BV6A 4IA5A 1Q9IA 1F8RA 3IHGA 2PS2A 2PTXA 3H7VA 3VR9A 2AL2B 4ZCCA 2JAEA 1X31B 3SM8A 3FIMB 2AL1A 3V3OA 3UP5A 1PBEA 2I5QA 3AEBA 2Q0KA 4IHCA 2EQ7A 3GMCA 4J3ZA 3UKKA 3HYVA 5IDZA 3ICTA 2HXTA 1KNPA 1O5WA 4E0VA 2R4JA 4O5UA 4H50A 4KEMA 3SYIA 2EQ9A 3SQSA 1EC7A 2C75A 1LQTA 1S2QA 4H2QA 2PTWA 4TVWA 2WHDA 3R9UA 2NVKX 5FS6A 5JCIA 3B3RA 2XVFA 4H2NA 4DHGA 3P9UA 5FJPA 1YKJA 5LV9A 1TKKA 4ZCWA 4YTNA 3ISHA 1H81A 3K7QX 2Q7VA 3AD7B 1E1NA 3DJJA 1CF3A 2DW7A 4JY3A 5HYMA 2XLUA 3TW9A 3H4KA 3DJGX 4CCQA 2XH4A 3AE9A 1NHSA 3GSIA 2E3TA 2CDUA 3D8XA 1SJBA 3E1TA 3NLCA 1CJ4A 4ROPA 1GT8A 1CC4A 5KMRA 4NEWA 2TMDA 1GERA 2PGWA 1E6EA 3RGTA 1VQWA 3MSYA 1F8WA 5M10A 4RSLA 3GYJA 4DGKA 4CNJA 3QSMA 4DSGA 1VDCA 4F4RA 1F9CA 1FHVA 1L0VA 3R0KA 2ZZBA 1R6WA 2WPCA 1BKHA 2C66A 3T2YA 3IJLA 4JNAA 2POZA 1GNDA 4GDEA 1LJ1A 2RGHA 1BGJA 1Y0PA 1N5XA 2BS3A 2YLTA 1GRGA 2B9WA 5BUKA 1MRAA 3ALJA 4N9XA 3IC9A 2OLAA 2OLOA 1E7PA 3DG7A 2BACA 4U8NA 2Y6QA 1MXTA 3ZLFA 1EBGA 3VR8A 5J7XA 1ZY8A 4IL0A 4Z26A 1KKOA 1GRAA 2Y6RA 4G6GA 4EIPA 5BULA 1P2EA 3NTDA 5U63A 2PHHA 3DMEA 3DERA 3IK4A 1TZZA 3KVEA 1NHQA 2WQYA 4ENLA 2C72A 4EQRA 2J3NA 1BF3A 4EMJA 3H8IA 3GWFA 3NIXA 3BHKA 3I3LA 1NELA 4IL2A 2OKTA 3II4A 2GR0A 3SBFA 2BS4A 4YWSA 1NG4A 1H84A 1PN0A 5HY5A 1MOKA 2WPEA 2IIDA 2VQ7A 1TRBA 2OG9A 1W6TA 2R4EA 4RG4A 3GD4A 2XFOA 3PWIA 2AR8A 2GF3A 5C3JA 3IHMA 3GYXA 3FV9A 1YQ3A 3JSKA 1GEUA 2QQ6A 2W55A 1KNRA 4OPTA 1ZDLA 3MWCA 2XLRA 5EB4A 4HN8A 3KLJA 2JB2A 1GTEA 3VC6A 1SB3B 4JQ9A 1STZA 1GRBA 4A3RA 3RO6A 1H86A 4IZGA 4MMWA 3DESA 4H2RA 1CBOA 5ENLA 3GD3A 3VA8A 1N60C 3UJEA 4UP3A 1O95A 2C65A 1FHUA 4H4XA 2CHRA 5C2TA 2BK4A 2AAQA 3CPJG 5KXJA 2B9YA 4GMEA 1ECQA 5GRTA 3EPTA 2YR4A 4USRA 1WUFA 1X2GA 3QLDA 3ZVIA 2BXSA 2MNRA 1K4QA 3R1ZA 3BI2A 3AE2A 3DFHA 4GYPC 1E9IA 4DYEA 3MZNA 4JN7A 2FKPA 3UOXA 5KVHA 4II3A 3R10A 3VDGA 4Z25A 3HPFA 4I58A 4GYPA 2PTZA 4B63A 3QSEA 3H70A 2V3BA 2DW6A 2GL5A 1DODA 1P2HA 2HNEA 3L1RA 2GR3A 1YY5A 1D5TA 1MDRA 3CGCA 1FECA 2Q6UA 2V60A 3NHOX 3RP7A 3PVCA 5U25A 2VRLA 1D7YA 3QJ4A 1PJ5A 2PP1A 4CBQA 2GSHA 4E8GA 2OFJA 3CTYA 2B7SA 1PBDA 3Q6JA 4JDRA 3FXGA 4C3YA 2GV8A 2ZC8A 3M13A 4CCRA 3OP2A 1SEZA 2FJBA 1TYTA 3RCYA 2JBVA 3THUA 2R46A 1B5QA 4YKFA 4G8TA 3T9PA 4FDCB 2H88A 3DK4A 4U8PA 4XXGA 5FS9A 3NT6A 1PJ7A 1JEHA 4Z1YA 1PXCA 3ICRA 3CNSA 1H83A 4A99A 3URHA 2XVHA 4X9NA 2XSXA 3AB1A 1KFYA 2PTYA 2WPFA 1DJNA 3CMMA 3ZVHA 2C3DA 3SZFA 2QA1A 3HRDC 3T37A 1PDYA 3JW7A 4HCHA 3GDPA 4DXKA 3UJFA 3CNPA 1LQUA 1VG9A 4JN8A 2XFQA 1IUWA 1DXLA 3OTRA 2XLTA 1BWCA 3NFUA 3AN1A 1CJ3A 2YM1A 3TWAA 2WESA 3CXBA 3V5FA 1O94A 1S2YA 1L8PA 1D7LA 1ELSA 4E4UA 2C64A 2YLZA 5IQ1A 3CGBA 3UP4A 1M6IA 4IA6A 3P1WA 3ZLGA 3TTEA 5JCLA 3CT2A 2BCGG 4UDQA 4Z2TA 2C76A 4A5LA 3AYJA 2W54A 3VCCA 3H12A 1GTHA 4TM1A 1Y56A 3A7AA 4H4QA 4IP4A 3UCDA 1PDHA 2PSNA 2XLPA 3LOVA 1P48A 4HNCA 3BSMA 2VOUA 4UDRA 4OVIA 1XS2A 1ZX9A 4B67A 3GMBA 4YSYA 4DSHA 5EB5A 1CHUA 3QFAA 3FVDA 3RP8A 3KU9A 3NRNA 2WOIA 4K2SA 4C5OA 2BYBA 3FYYA 4M0XA 4H4ZA 1AOGA 3GYIA 1IUTA 4U8IA 3S5SA 4Z44A 3M12A 2C73A 2YM2A 3R07C 1KSUA 2WBAA 2WU5A 3P4RA 2BCPA 3TJIA 4E6MA 4DN1A 3FBSA 4JHMA 3JVAA 3PFRA 4PABA 2OZTA 1BQGA 2OVLA 2GGJA 2MUCA 1QO8A 3T14A 2W3RA 1WYGA 2V61A 5CQFA 3UTEA 4OPIA 4M6UA 3DH9A 3FCPA 1PBBA 2WDVA 2NQLA 2RGOA 3AE3A 4LU6A 3DJDA 3QVRA 3UKAA 3VQRA 3R0UA 2TPRA 3T0KA 1GALA 1LV0A 2VVLA 1K0LA 2R0CA 1N62C 3AD8B 3CXOA 2BC1A 1EL9A 4DX3A 1TDEA 4K8GA 3NXLA 2YLSA 4NZHA 2BC0A 3D46A 1REOA 2W0HA 4H4WA 4ICYA 3IJQA 1FCDA 4CRTA 1CC6A 3D47A 4OPLA 1D4EA 3SZCA 2OALA 1ZMDA 4K8DA 4B66A 3Q4DA 3HYWA 3RITA 2QVHA 1GRTA 3DIPA 5FJRA 1S3EA 2X8HA 2JKCA 4YSZA 1L9EA 2OLNA 4IVOB 3F8RA 1N63C 3CK5A 4TVYA 3AE5A 3D1CA 4J1OA 1YQZA 2NPXA 4FP1A 3VRAA 3LZXA 3UKQA 2XLSA 1RVKA 1NENA 3DJEA 3ZVHB 2XFNA 2O56A 4A35A 1GETA 2PMQA 2WDQA 4TM3A 2RDXA 2I0ZA 3HYXA 1NDAA 4MJWA 1JCTA 5EOWA 5BVAA 4ZCDA 3HZLA 2VRMA 5FJOA 2PPGA 1UKVG 2GH5A 3SN0A 2QAEA 1GESA 1D4DA 1PXAA 2O9ZA 3K1GA 3REDA 4IV9A 3RHAA 3U4FA 1EL7A 3I6DA 3COXA 2YLXA 4OCGA 4TM4A 3UGVA 2OAMA 2GVCA 2YWLA 4BK1A 1ZMCA 2X99A 4II2A 4H1ZA 1H7XA 3DGZA 4B68A 3SZWA 5IQ4A 2FJAA 3KKJA 1N61C 5JRBA 4KX6A 2E5AA 1DTNA 4FX9A 2IVDA 3MQTA 3BNUA 3AYLA 3AMZA 1Y56B 4U8KA 2GQWA 4NTEA 3UJSA 2H89A 4Z24A 3U9IA 3V3NA 4GAPA 3N4FA 2B9XA 3DDMA 3ES8A 2GMJA 5JCMA 4GDPA 3TCSA 3CNDA 1EBDA 3IF9A 1BKWA 3T8QA 2YR6A 3SXIA 1FOHA 3ZYXA 3DK9A 4YTMA 5KRQA 4X4JA 4E4FA 3WE0A 3S61A 4LA1A 1KSSA 2AKMA 3ABVA 2GGGA 2OA1A 1X2HA 4HCLA 3UTGA 4TLXA 4EQXA 3T31A 2RABA 3K7TA 3NKSA 3UKFA 1CC2A 2OX4A 1R0MA 4H4VA 5FMHA 4CY8A 2WDRA 3UTHA 4CY6A 5FS8A 2C7GA 5BRTA 4H4UA 5KMPA 1E1KA 2E4GA 3UKHA 1DNCA 2XH2A 4M52A 1FO4A 4J57A 3SFEA 4P9SA 1RSGA 2FJDA 2P88A 3AE1A 2GAHB 3QVPA 4GFIA 2E1MA 2A89A 4FI4A 1K0IA 4G7FA 1TDKA 3SN1A 1PJ6A 3GO2A 4H7UA 4B65A 4GRTA 4JY2A 3LB8A 3UOVA 5FJTA 2GR2A 5DBJA 1PXBA 3DFYA 2QJMA 3P93A 2BRAA 2DKHA 2WOVA 2FYMA 1JNRA 3BI4A 1NU5A 4HNLA 3FMWA 4YT0A 2RGJA 4AP1A 1IUSA 1OJAA 3NK1X 1K0JA 1L9CA 1XHCA 1ZK7A 1GV4A 2ZZCA 4OPGA 3T4WA 3FG2P 4GUVA
chains in the Genus database with same CATH topology
4H4QA 3GYJA 4DGKA 4CNJA 1N4VA 4NEVA 1PDHA 3QSMA 2QA2A 3OZ2A 2WU2A 2XLPA 4Z43A 2YLWA 3LOVA 2E5VA 2YG5A 3CPHG 3ZDNA 2XVIA 2AQJA 4DSGA 1VDCA 2VOUA 4Y4MA 2WP5A 4UDRA 3BHFA 1NPXA 3CGDA 4OVIA 3LXDA 1L0VA 4C74A 1ZX9A 4B67A 3GMBA 2ZZBA 3EAOA 4YSYA 2YLRA 2WPCA 2C66A 4DSHA 5EB5A 3T2YA 1CHUA 3QFAA 4JNAA 1N1PA 3RP8A 3AE7A 4B1BA 1GNDA 4GDEA 3KU9A 1LJ1A 2WS3A 4K5SA 3NRNA 4J36A 2RGHA 2WOIA 4PAAA 1BGJA 1Y0PA 4C5OA 3PO7A 2BYBA 3RNMA 4H4RA 1ZOVA 4H4ZA 1EL5A 2GRTA 2BS3A 2YLTA 2X8CA 1AOGA 1GRGA 3GYIA 1F3PA 2B9WA 1L9DA 5BUKA 1IUTA 4H4YA 4G6HA 4U8IA 1TDOA 4YWOA 4EMWA 1DJQA 3QSSA 4Z44A 3M12A 3ALJA 4N9XA 1H2IA 2YVJA 1YQ4A 3LJPA 2C73A 3IC9A 2YM2A 2OLOA 2A87A 1KSUA 1CJ2A 3DGHA 2WBAA 1KF6A 1E7PA 2BACA 2WU5A 2YG4A 4U8NA 2Y6QA 3RP6A 3P4RA 4NTCA 1MXTA 2BCPA 3Q9TA 2QCUA 3VR8A 3AEAA 3P4PA 3O0HA 2YVFA 5J7XA 3FBSA 2BRYA 4WX1A 1ZY8A 3G5RA 1JU2A 3FPZA 4Z26A 2PYXA 3NGCX 2YG7A 3NN0X 1GRAA 4PABA 4NWZA 2Y6RA 4G6GA 5KOWA 4B64A 4EIPA 3GWDA 5BULA 1P2EA 4NNJA 2UZZA 1IUVA 3CPIG 3NTDA 5U63A 2PHHA 1QO8A 3T14A 5ER0A 3DMEA 4J33A 4JN9A 2R45A 1H7WA 5U1OA 3KVEA 4JNQA 1NHQA 2WQYA 1NG3A 3OC4A 4YXDA 2C72A 4APNA 4EQRA 2V61A 3QFBA 2J3NA 2JK6A 4U8OA 1BF3A 5CQFA 4EMJA 3H8IA 3GWFA 3NIXA 2R0GA 2FJEA 2GR1A 3LADA 1OJ9A 3BHKA 3I3LA 3AEGA 1JNZA 3UTEA 1GRHA 3II4A 2GR0A 2BS4A 4OPIA 1NG4A 1BZLA 1H84A 1PN0A 5HY5A 3DH9A 3AEDA 3S5WA 1PBBA 2R9ZA 1RYIA 1MOKA 2WDVA 3UKPA 1IJHA 2RGOA 1JRYA 1D4CA 3AE4A 3AE3A 4LU6A 2WPEA 1NHPA 2JB3A 3DJDA 1IUUA 2IIDA 2VQ7A 1W4XA 3NYCA 4USQA 1JOAA 3QVRA 3G5SA 3UKAA 1TRBA 4A79A 4EQSA 3NNEA 3VQRA 2TPRA 2XVEA 3CNTA 3DK8A 1GALA 1LV0A 2VVLA 1K0LA 3T0KA 2R0CA 2XFUA 4K5RA 1DOCA 3D9XA 3AD8B 1DOEA 3SGLA 4Z2RA 2R4EA 2BC1A 4RG4A 2GEWA 3GD4A 2XFOA 2ZBWA 3CN8A 4HB9A 3UOZA 1EL9A 4YSXA 4G74A 2AR8A 2GF3A 4EM4A 2YR5A 1TDEA 3AECA 3F8DA 5C3JA 3IHMA 2YLSA 3GYXA 4NZHA 4ADWA 2BC0A 1YQ3A 2WETA 3JSKA 1REOA 1GEUA 2W0HA 4H4WA 3SX6A 1VG0A 4ICYA 1DOBA 1V59A 1KNRA 1FCDA 2GMHA 1CJCA 4OPTA 1NEKA 4CRTA 1ZDLA 1CC6A 4OPLA 3ADAB 1NAAA 2XLRA 3SQPA 5KOXA 4U2LA 1D4EA 3SZCA 2OALA 1ZMDA 1E1MA 4K8DA 5EB4A 4B66A 1MO9A 3KLJA 2JB2A 1GTEA 2Z5XA 3HYWA 3NYEA 3AD9B 1KN0A 1QJDA 4JQ9A 1LVLA 2VVMA 4EMIA 1GRTA 1GRBA 3T2KA 5KNLA 5L46A 1S3EA 2Q0LA 2FBWA 4FK1A 2GQFA 2X8HA 2JKCA 4YSZA 3VRDB 1L9EA 1BGNA 2OLNA 4IVOB 4K22A 3F8RA 2GB0A 3KPFA 2YG3A 3AE5A 1H86A 4GR1A 1HYUA 3D1CA 4A9WA 1OJTA 2BS2A 1XDIA 4DNAA 2YQUA 4H2RA 1CBOA 2ZZ0A 3CGEA 1YQZA 2NPXA 3GD3A 5EBKA 4K7ZA 1IUXA 1LTXR 4XWZA 3VRAA 1COYA 1PS9A 3LZXA 2WEUA 3UKQA 2XLSA 3M0OA 4XWRA 1OJCA 1M64A 4UP3A 4D03A 1NENA 1O95A 1S3BA 2C65A 5KMQA 2DKIA 3BNMA 4GCMA 2X8GA 1F6MA 1XPQA 3DJEA 4H4XA 1TDNA 2XFNA 4Z2UA 5C2TA 2BK4A 1GETA 2AAQA 3CPJG 4TM0A 5KXJA 4J56A 4CNKA 4AT0A 2WDQA 4TM3A 3HYXA 2B9YA 2I0ZA 5GRTA 3EPTA 1NDAA 2YR4A 2HQMA 4MJWA 1B8SA 4USRA 2VZ2A 3KA7A 5EOWA 2C3CA 1B4VA 3C4AA 5BVAA 2GAGB 4A65A 4ZCDA 4OPUA 1RP0A 4WCTA 4BJZA 2BXSA 2X3NA 2BK5A 1K4QA 3BI2A 3AE2A 3HZLA 5J60A 2VRMA 1TYPA 4GUVA 5KMSA 4A7AA 1OJDA 1UKVG 2GH5A 3AWIA 4LIIA 1N4UA 2QAEA 1GESA 1D4DA 1PXAA 4BK2A 3AXBA 4YSHA 1GREA 2O9ZA 3UOXA 5KVHA 5TR3A 4YKGA 3UKLA 5IPYA 1B37A 3REDA 4II3A 4IV9A 3RHAA 1EL7A 3I6DA 3COXA 4Z25A 1GSNA 3GDNA 3AEFA 4I58A 3LZWA 3EANA 1EL8A 1CL0A 1PBCA 3CNJA 2EQ6A 3NYFA 2YLXA 3SY4A 3ALMA 4OCGA 1N4WA 4TM4A 4BK3A 3NH3X 4C77A 4J34A 4H4PA 4B63A 3QSEA 2OAMA 2GVCA 1E39A 2YWLA 4BK1A 3DA1A 2V3BA 2WP9A 2VVLG 1FEAA 4B69A 2R0PA 1PBFA 1ONFA 3UOYA 2ACZA 2Z5YA 1DODA 1P2HA 1NHRA 4J31A 1ZMCA 1FL2A 5HHFA 2X99A 3L1RA 1GXFA 4II2A 1H7XA 2GR3A 3DGZA 4EQWA 1YY5A 3G5QA 4B68A 3SZWA 5IQ4A 1D5TA 2V6OA 1ZP0A 2BK3A 2FJAA 3KKJA 3T2ZA 4U2SA 3NG7X 1PHHA 1ZKQA 3CGCA 3P4SA 1XANA 1TDFA 3P4QA 1FECA 5JRBA 4TLZA 4KX6A 4Y4NA 4BURA 2Q6UA 2WOWA 2V60A 3NHOX 3VRBA 1S7MA 4FX9A 1GOSA 2IVDA 3RP7A 3PVCA 5U25A 2VRLA 3K30A 1D7YA 3QJ4A 1PJ5A 2BA9A 4A6NB 4AT2A 4D04A 4CBQA 3NK0X 3BNUA 4AP3A 3AYLA 3NK2X 3CTYA 1Y56B 4REKA 3B6DA 4U8KA 2GQWA 2XFPA 2B7SA 4NTEA 4Z24A 2H89A 4AOSA 3ITJA 3NN6X 3C96A 4FK1C 1PBDA 5JCKA 3Q6JA 4JDRA 4H4TA 4C3YA 2GV8A 2ARDA 3BI5A 4U2TA 4I59A 4OPCA 3SFDA 4GAPA 1H6VA 3AE8A 3V3NA 5M10A 3M13A 4U8MA 2C70A 2B9XA 4O5QA 4CCRA 2X50A 2CVJA 3L8KA 1SEZA 2GMJA 5JCMA 1QLBA 1ZOYA 2FJBA 3K7MX 4GDPA 3UCLA 3CNDA 2YG6A 1EBDA 3IF9A 1TYTA 1GRFA 4G9KA 4G73A 3ALLA 3CIRA 2CULA 1BKWA 2JBVA 5M0ZA 2YR6A 3SXIA 2R46A 3AE6A 4C3XA 1FOHA 4NTDA 1B5QA 4BV6A 4IA5A 4YKFA 3ZYXA 3DK9A 4YTMA 2YVGA 1F8RA 1Q9IA 3IHGA 4FDCB 3ATQA 5KRQA 2H88A 2B7RA 4X4JA 3VR9A 5GSNA 3DK4A 2EQ8A 1Q1RA 4U8PA 3NTAA 4ZCCA 4XXGA 3V76A 3WE0A 2JAEA 4LA1A 5FS9A 3S61A 5JCNA 1X31B 1KSSA 3ABVA 3NT6A 5KVIA 2WP6A 2OA1A 2C4CA 3GRSA 1PJ7A 1JEHA 3SM8A 3FIMB 1PXCA 3ICRA 3UTGA 4U8LA 3V3OA 3CNSA 1JRXA 3UP5A 1PBEA 1H83A 4TLXA 4A99A 4EQXA 3URHA 3T31A 1E1LA 3AEBA 2Q0KA 2RABA 2XVHA 3K7TA 4X9NA 3NKSA 3ATRA 3UKFA 2XYOA 1CC2A 4X9MA 3ICSA 2EQ7A 4H4VA 2XVJA 3AEEA 3GMCA 5FMHA 3AB1A 1KFYA 2VQBA 3UKKA 5HXIA 2WPFA 4CY8A 2V3AA 1DJNA 2WDRA 3UTHA 2V5ZA 4CY6A 1VRQB 3CMMA 5FS8A 2C7GA 4IVMB 4UDPA 5BRTA 3UTFA 1H82A 2C3DA 4H4UA 4U8JA 3HYVA 3SZFA 5KMPA 2QA1A 2B76A 2BXRA 3ICTA 3T37A 3C4NA 1E1KA 1KDGA 2E4GA 3UKHA 1KNPA 1F8SA 1O5WA 4AOXA 1DNCA 2A8XA 3GDPA 4M52A 4E0VA 2BABA 2R4JA 3CNPA 1Q1WA 2CFYA 4O5UA 4J57A 3SFEA 2YAUA 4P9SA 4H50A 4H4SA 1RSGA 1LQUA 3SYIA 2EQ9A 2FJDA 1VG9A 4OPDA 4RG3A 3KD9A 2C75A 1LQTA 1S2QA 3AE1A 4H2QA 4J2WA 2XFQA 2C67A 2WHDA 2GAHB 2NVKX 3QVPA 1IUWA 3KPKA 3R9UA 1DXLA 5FS6A 2E1MA 3GRTA 2A89A 4HA6A 5JCIA 2XCGA 2XLTA 1BWCA 1K0IA 3B3RA 4ZN0A 1TDKA 2XVFA 1CJ3A 4H2NA 4BJYA 2YM1A 2WESA 4ECHA 3P9UA 1ELIA 1YKJA 2JB1A 3H8LA 5LV9A 1PJ6A 2APGA 4H7UA 2IVEA 4B65A 4KPRA 4GRTA 4JY2A 3L5OA 4EIQA 4YTPA 3EF6A 4YTNA 3LB8A 3ISHA 3IWAA 1LPFA 1O94A 1H81A 1GPEA 3UOVA 1S2YA 3K7QX 2GR2A 2Q7VA 2XDOA 5DBJA 1PXBA 3AD7B 2BRAA 1E1NA 3F8PA 3DJJA 1CF3A 1D7LA 5FS7A 2DKHA 4H2PA 4JY3A 2WOVA 2C64A 2YLZA 5IQ1A 5HYMA 3CGBA 2XLUA 3UP4A 1M6IA 4K2XA 3H4KA 2F5ZA 1JNRA 3DJGX 4IA6A 4CCQA 3P1WA 3AE9A 1NHSA 3BI4A 3GSIA 2CDUA 3D8XA 5CKUA 3E1TA 3FMWA 4YT0A 2RGJA 1CJ4A 3NLCA 4AP1A 5JCLA 3PS9A 4GAVA 5KWFA 2BCGG 4Y4LA 3AYIA 4UDQA 1IUSA 4Z2TA 1GT8A 1OJAA 4EM3A 4A6NA 2C76A 4GF7A 1JRZA 1K0JA 3NK1X 1CC4A 3PG6A 1FEBA 1L9CA 4A5LA 3SZ0A 5KMRA 1XHCA 3AYJA 1ZK7A 1Z6LA 4NEWA 1GERA 1E6EA 1GV4A 2TMDA 2ZZCA 1GTHA 1VQWA 4OPGA 1F8WA 4TM1A 3FG2P 4RSLA 1Y56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H4Q A;  3GYJ A;  4DGK A;  4CNJ A;  1N4V A;  4NEV A;  1PDH A;  3QSM A;  2QA2 A;  3OZ2 A;  2WU2 A;  2XLP A;  4Z43 A;  2YLW A;  3LOV A;  2E5V A;  2YG5 A;  3CPH G;  3ZDN A;  2XVI A;  2AQJ A;  4DSG A;  1VDC A;  2VOU A;  4Y4M A;  2WP5 A;  4UDR A;  3BHF A;  1NPX A;  3CGD A;  4OVI A;  3LXD A;  1L0V A;  4C74 A;  1ZX9 A;  4B67 A;  3GMB A;  2ZZB A;  3EAO A;  4YSY A;  2YLR A;  2WPC A;  2C66 A;  4DSH A;  5EB5 A;  1CHU A;  3QFA A;  4JNA A;  1N1P A;  3RP8 A;  3AE7 A;  4B1B A;  1GND A;  4GDE A;  3KU9 A;  1LJ1 A;  2WS3 A;  4K5S A;  3NRN A;  4J36 A;  2RGH A;  2WOI A;  4PAA A;  1BGJ A;  1Y0P A;  4C5O A;  3PO7 A;  2BYB A;  3RNM A;  4H4R A;  1ZOV A;  4H4Z A;  1EL5 A;  2GRT A;  2BS3 A;  2YLT A;  2X8C A;  1AOG A;  1GRG A;  3GYI A;  1F3P A;  2B9W A;  1L9D A;  5BUK A;  1IUT A;  4H4Y A;  4U8I A;  1TDO A;  4YWO A;  4EMW A;  1DJQ A;  3QSS A;  4Z44 A;  3M12 A;  3ALJ A;  4N9X A;  2YVJ A;  1YQ4 A;  3LJP A;  2C73 A;  3IC9 A;  2YM2 A;  2OLO A;  2A87 A;  1CJ2 A;  1KSU A;  3DGH A;  2WBA A;  1KF6 A;  1E7P A;  2BAC A;  2WU5 A;  2YG4 A;  4U8N A;  2Y6Q A;  3RP6 A;  3P4R A;  4NTC A;  1MXT A;  2BCP A;  3Q9T A;  2QCU A;  3VR8 A;  3AEA A;  3P4P A;  3O0H A;  2YVF A;  5J7X A;  3FBS A;  4WX1 A;  1ZY8 A;  3G5R A;  1JU2 A;  3FPZ A;  4Z26 A;  2PYX A;  3NGC X;  2YG7 A;  3NN0 X;  1GRA A;  4PAB A;  2Y6R A;  5KOW A;  4B64 A;  4EIP A;  3GWD A;  5BUL A;  1P2E A;  2UZZ A;  1IUV A;  3CPI G;  3NTD A;  5U63 A;  2PHH A;  1QO8 A;  5ER0 A;  3DME A;  4J33 A;  4JN9 A;  2R45 A;  1H7W A;  5U1O A;  3KVE A;  4JNQ A;  1NHQ A;  2WQY A;  1NG3 A;  3OC4 A;  4YXD A;  2C72 A;  4APN A;  4EQR A;  2V61 A;  3QFB A;  2J3N A;  2JK6 A;  4U8O A;  1BF3 A;  5CQF A;  4EMJ A;  3H8I A;  3GWF A;  3NIX A;  2R0G A;  2FJE A;  2GR1 A;  3LAD A;  1OJ9 A;  3BHK A;  3I3L A;  3AEG A;  1JNZ A;  3UTE A;  1GRH A;  3II4 A;  2GR0 A;  2BS4 A;  4OPI A;  1NG4 A;  1BZL A;  1H84 A;  1PN0 A;  5HY5 A;  3DH9 A;  3AED A;  3S5W A;  1PBB A;  2R9Z A;  1RYI A;  1MOK A;  2WDV A;  3UKP A;  1IJH A;  2RGO A;  1JRY A;  1D4C A;  3AE4 A;  3AE3 A;  4LU6 A;  2WPE A;  1NHP A;  2JB3 A;  3DJD A;  1IUU A;  2IID A;  2VQ7 A;  1W4X A;  3NYC A;  4USQ A;  1JOA A;  3QVR A;  3G5S A;  3UKA A;  1TRB A;  4A79 A;  4EQS A;  3NNE A;  3VQR A;  2TPR A;  2XVE A;  3CNT A;  3DK8 A;  1GAL A;  1LV0 A;  2VVL A;  1K0L A;  2R0C A;  2XFU A;  4K5R A;  1DOC A;  3AD8 B;  1DOE A;  3SGL A;  4Z2R A;  2R4E A;  2BC1 A;  4RG4 A;  2GEW A;  3GD4 A;  2XFO A;  2ZBW A;  3CN8 A;  4HB9 A;  3UOZ A;  1EL9 A;  4YSX A;  2AR8 A;  2GF3 A;  4EM4 A;  2YR5 A;  1TDE A;  3AEC A;  3F8D A;  5C3J A;  3IHM A;  2YLS A;  4NZH A;  4ADW A;  2BC0 A;  1YQ3 A;  2WET A;  3JSK A;  1REO A;  1GEU A;  2W0H A;  4H4W A;  1VG0 A;  4ICY A;  1DOB A;  1V59 A;  1KNR A;  1FCD A;  2GMH A;  1CJC A;  4OPT A;  1NEK A;  4CRT A;  1ZDL A;  1CC6 A;  4OPL A;  3ADA B;  1NAA A;  2XLR A;  3SQP A;  5KOX A;  4U2L A;  1D4E A;  2OAL A;  1ZMD A;  1E1M A;  4K8D A;  5EB4 A;  4B66 A;  1MO9 A;  3KLJ A;  2JB2 A;  1GTE A;  2Z5X A;  3NYE A;  3AD9 B;  1QJD A;  4JQ9 A;  1LVL A;  2VVM A;  4EMI A;  1GRT A;  1GRB A;  5L46 A;  1S3E A;  2Q0L A;  2FBW A;  4FK1 A;  2GQF A;  2X8H A;  2JKC A;  4YSZ A;  3VRD B;  1L9E A;  1BGN A;  2OLN A;  4IVO B;  4K22 A;  3F8R A;  2GB0 A;  3KPF A;  2YG3 A;  3AE5 A;  1H86 A;  4GR1 A;  1HYU A;  3D1C A;  4A9W A;  1OJT A;  2BS2 A;  1XDI A;  4DNA A;  2YQU A;  4H2R A;  1CBO A;  2ZZ0 A;  3CGE A;  1YQZ A;  2NPX A;  3GD3 A;  5EBK A;  4K7Z A;  1IUX A;  1LTX R;  4XWZ A;  3VRA A;  1COY A;  1PS9 A;  3LZX A;  2WEU A;  3UKQ A;  2XLS A;  3M0O A;  4XWR A;  1OJC A;  1M64 A;  4UP3 A;  4D03 A;  1NEN A;  1O95 A;  1S3B A;  2C65 A;  2DKI A;  3BNM A;  4GCM A;  2X8G A;  1F6M A;  1XPQ A;  3DJE A;  4H4X A;  1TDN A;  2XFN A;  4Z2U A;  5C2T A;  2BK4 A;  1GET A;  2AAQ A;  3CPJ G;  4TM0 A;  5KXJ A;  4J56 A;  4CNK A;  4AT0 A;  2WDQ A;  4TM3 A;  2B9Y A;  2I0Z A;  5GRT A;  3EPT A;  1NDA A;  2YR4 A;  2HQM A;  4MJW A;  1B8S A;  4USR A;  2VZ2 A;  3KA7 A;  5EOW A;  2C3C A;  1B4V A;  3C4A A;  5BVA A;  2GAG B;  4A65 A;  4ZCD A;  4OPU A;  1RP0 A;  4WCT A;  4BJZ A;  2BXS A;  2X3N A;  2BK5 A;  1K4Q A;  3BI2 A;  3AE2 A;  3HZL A;  5J60 A;  2VRM A;  1TYP A;  4GUV A;  4A7A A;  1OJD A;  1UKV G;  2GH5 A;  3AWI A;  4LII A;  1N4U A;  2QAE A;  1GES A;  1D4D A;  1PXA A;  4BK2 A;  3AXB A;  4YSH A;  1GRE A;  2O9Z A;  3UOX A;  5KVH A;  5TR3 A;  4YKG A;  3UKL A;  5IPY A;  1B37 A;  3RED A;  4IV9 A;  3RHA A;  1EL7 A;  3I6D A;  3COX A;  4Z25 A;  1GSN A;  3GDN A;  3AEF A;  4I58 A;  3LZW A;  3EAN A;  1EL8 A;  1CL0 A;  1PBC A;  3CNJ A;  2EQ6 A;  3NYF A;  2YLX A;  3ALM A;  4OCG A;  1N4W A;  4TM4 A;  4BK3 A;  3NH3 X;  4C77 A;  4J34 A;  4H4P A;  4B63 A;  3QSE A;  2OAM A;  2GVC A;  1E39 A;  2YWL A;  4BK1 A;  3DA1 A;  2V3B A;  2WP9 A;  2VVL G;  1FEA A;  4B69 A;  2R0P A;  1PBF A;  1ONF A;  3UOY A;  2ACZ A;  2Z5Y A;  1DOD A;  1P2H A;  1NHR A;  4J31 A;  1ZMC A;  1FL2 A;  5HHF A;  2X99 A;  3L1R A;  1GXF A;  1H7X A;  2GR3 A;  3DGZ A;  4EQW A;  1YY5 A;  3G5Q A;  4B68 A;  5IQ4 A;  1D5T A;  2V6O A;  1ZP0 A;  2BK3 A;  2FJA A;  3KKJ A;  4U2S A;  3NG7 X;  1PHH A;  1ZKQ A;  3CGC A;  3P4S A;  1XAN A;  1TDF A;  3P4Q A;  1FEC A;  4TLZ A;  4KX6 A;  4Y4N A;  4BUR A;  2Q6U A;  2WOW A;  2V60 A;  3NHO X;  3VRB A;  4FX9 A;  1GOS A;  2IVD A;  3RP7 A;  3PVC A;  5U25 A;  2VRL A;  3K30 A;  1D7Y A;  3QJ4 A;  1PJ5 A;  2BA9 A;  4A6N B;  4AT2 A;  4D04 A;  4CBQ A;  3NK0 X;  3BNU A;  4AP3 A;  3AYL A;  3NK2 X;  3CTY A;  1Y56 B;  4REK A;  3B6D A;  4U8K A;  2GQW A;  2XFP A;  2B7S A;  4NTE A;  4Z24 A;  2H89 A;  4AOS A;  3ITJ A;  3NN6 X;  3C96 A;  4FK1 C;  1PBD A;  5JCK A;  3Q6J A;  4JDR A;  4H4T A;  4C3Y A;  2GV8 A;  2ARD A;  3BI5 A;  4U2T A;  4I59 A;  4OPC A;  3SFD A;  3V3N A;  1H6V A;  3AE8 A;  5M10 A;  3M13 A;  4U8M A;  2C70 A;  2B9X A;  4O5Q A;  4CCR A;  2X50 A;  2CVJ A;  3L8K A;  1SEZ A;  2GMJ A;  5JCM A;  1QLB A;  1ZOY A;  2FJB A;  3K7M X;  4GDP A;  3UCL A;  3CND A;  2YG6 A;  1EBD A;  3IF9 A;  1TYT A;  1GRF A;  3ALL A;  3CIR A;  2CUL A;  1BKW A;  2JBV A;  5M0Z A;  2YR6 A;  2R46 A;  3AE6 A;  4C3X A;  1FOH A;  4NTD A;  1B5Q A;  4BV6 A;  4IA5 A;  4YKF A;  3ZYX A;  3DK9 A;  4YTM A;  2YVG A;  1F8R A;  1Q9I A;  3IHG A;  4FDC B;  3ATQ A;  5KRQ A;  2H88 A;  2B7R A;  4X4J A;  3VR9 A;  5GSN A;  3DK4 A;  2EQ8 A;  1Q1R A;  4U8P A;  3NTA A;  4ZCC A;  4XXG A;  3V76 A;  3WE0 A;  2JAE A;  4LA1 A;  5FS9 A;  3S61 A;  5JCN A;  1X31 B;  1KSS A;  3ABV A;  3NT6 A;  5KVI A;  2WP6 A;  2OA1 A;  3GRS A;  1PJ7 A;  1JEH A;  3SM8 A;  3FIM B;  1PXC A;  3ICR A;  3UTG A;  4U8L A;  3V3O A;  3CNS A;  1JRX A;  3UP5 A;  1PBE A;  1H83 A;  4TLX A;  4A99 A;  4EQX A;  3URH A;  1E1L A;  3AEB A;  2Q0K A;  2RAB A;  2XVH A;  3K7T A;  4X9N A;  3NKS A;  3ATR A;  3UKF A;  2XYO A;  1CC2 A;  4X9M A;  3ICS A;  2EQ7 A;  4H4V A;  2XVJ A;  3AEE A;  3GMC A;  5FMH A;  3AB1 A;  1KFY A;  2VQB A;  3UKK A;  5HXI A;  2WPF A;  4CY8 A;  1DJN A;  2V3A A;  2WDR A;  3UTH A;  2V5Z A;  4CY6 A;  1VRQ B;  5FS8 A;  2C7G A;  4IVM B;  4UDP A;  5BRT A;  3UTF A;  1H82 A;  2C3D A;  4H4U A;  4U8J A;  2QA1 A;  2B76 A;  2BXR A;  3ICT A;  3T37 A;  3C4N A;  1E1K A;  1KDG A;  2E4G A;  3UKH A;  1KNP A;  1F8S A;  1O5W A;  4AOX A;  1DNC A;  2A8X A;  3GDP A;  4M52 A;  4E0V A;  2BAB A;  2R4J A;  3CNP A;  1Q1W A;  2CFY A;  4O5U A;  4J57 A;  3SFE A;  2YAU A;  4P9S A;  4H50 A;  4H4S A;  1RSG A;  1LQU A;  2EQ9 A;  2FJD A;  1VG9 A;  4OPD A;  4RG3 A;  3KD9 A;  2C75 A;  1LQT A;  1S2Q A;  3AE1 A;  4H2Q A;  4J2W A;  2XFQ A;  2C67 A;  2WHD A;  2GAH B;  2NVK X;  3QVP A;  1IUW A;  3R9U A;  1DXL A;  5FS6 A;  2E1M A;  3GRT A;  2A89 A;  4HA6 A;  5JCI A;  2XCG A;  2XLT A;  1BWC A;  1K0I A;  3B3R A;  4ZN0 A;  1TDK A;  2XVF A;  1CJ3 A;  4H2N A;  4BJY A;  2YM1 A;  2WES A;  4ECH A;  3P9U A;  1ELI A;  1YKJ A;  2JB1 A;  3H8L A;  5LV9 A;  1PJ6 A;  2APG A;  4H7U A;  2IVE A;  4B65 A;  4KPR A;  4GRT A;  4JY2 A;  4EIQ A;  4YTP A;  3EF6 A;  4YTN A;  3LB8 A;  3ISH A;  3IWA A;  1LPF A;  1O94 A;  1H81 A;  1GPE A;  3UOV A;  1S2Y A;  3K7Q X;  2GR2 A;  2Q7V A;  2XDO A;  5DBJ A;  1PXB A;  3AD7 B;  1E1N A;  3F8P A;  3DJJ A;  1CF3 A;  1D7L A;  5FS7 A;  2DKH A;  4H2P A;  4JY3 A;  2WOV A;  2C64 A;  2YLZ A;  5IQ1 A;  5HYM A;  3CGB A;  2XLU A;  3UP4 A;  1M6I A;  4K2X A;  3H4K A;  2F5Z A;  1JNR A;  3DJG X;  4IA6 A;  4CCQ A;  3P1W A;  3AE9 A;  1NHS A;  3BI4 A;  3GSI A;  2CDU A;  3D8X A;  5CKU A;  3E1T A;  3FMW A;  4YT0 A;  2RGJ A;  1CJ4 A;  3NLC A;  4AP1 A;  5JCL A;  3PS9 A;  5KWF A;  2BCG G;  4Y4L A;  3AYI A;  4UDQ A;  1IUS A;  4Z2T A;  1GT8 A;  1OJA A;  4EM3 A;  4A6N A;  2C76 A;  4GF7 A;  1JRZ A;  1K0J A;  3NK1 X;  1CC4 A;  4A5L A;  1FEB A;  1L9C A;  1XHC A;  3AYJ A;  1ZK7 A;  1Z6L A;  4NEW A;  1GER A;  1E6E A;  1GV4 A;  2TMD A;  2ZZC A;  1GTH A;  1VQW A;  4OPG A;  1F8W A;  4TM1 A;  3FG2 P;  4RSL A;  1Y56 A; 
#chains in the Genus database with same CATH topology
 4GGH A;  2WU2 A;  3CPH G;  3ZDN A;  2XVI A;  2WP5 A;  3BHF A;  3CGD A;  3LXD A;  3VCN A;  4GIR A;  2YLR A;  1JDF A;  1N1P A;  1ONE A;  3AE7 A;  4J36 A;  3PO7 A;  2HZG A;  1ZOV A;  1EL5 A;  2GRT A;  2X8C A;  4MGG A;  3ES7 A;  1FFU C;  4H4Y A;  4G6H A;  3GD6 A;  4YWO A;  1DJQ A;  2YVJ A;  3LJP A;  1CJ2 A;  2YG4 A;  3DGH A;  3BJS A;  3PK7 A;  3RP6 A;  4NTC A;  2P3Z A;  2QCU A;  3AEA A;  3VFC A;  3G5R A;  3FPZ A;  4K1W A;  2YG7 A;  3GWD A;  3NVY B;  4NNJ A;  2UZZ A;  3CPI G;  3UXL A;  4J33 A;  1H7W A;  4GIS A;  1NG3 A;  4H19 A;  4APN A;  3IJI A;  3QFB A;  2JK6 A;  4U8O A;  3JZU A;  2FJE A;  2GR1 A;  3LAD A;  1YEY A;  3AEG A;  1JNZ A;  1BZL A;  2PCE A;  3AED A;  3S5W A;  2PU0 A;  1RYI A;  3UKP A;  1IJH A;  5G5H B;  1JRY A;  3UJR A;  3AE4 A;  1IUU A;  4USQ A;  3NYC A;  1JOA A;  3G5S A;  4A79 A;  3CNT A;  3DK8 A;  3OPS A;  3MUC A;  1DOE A;  3SGL A;  1ZXI C;  2GEW A;  2ZBW A;  4G74 A;  4EM4 A;  1JRP A;  2YR5 A;  3F8D A;  1XPY A;  1VG0 A;  1DOB A;  2GMH A;  1MNS A;  3ADA B;  5KOX A;  4U2L A;  1SJA A;  3R25 A;  1MO9 A;  1SJD A;  2Z5X A;  1V97 A;  1LVL A;  4A6G A;  4EMI A;  3UXK A;  3T2K A;  4KT2 A;  2Q0L A;  4FK1 A;  2FBW A;  2PP0 A;  3VRD B;  3A7R A;  4K22 A;  3NRZ B;  3DEQ A;  2YG3 A;  4A9W A;  2BS2 A;  4DNA A;  2YQU A;  2QJN A;  2ZZ0 A;  3CGE A;  3ETR B;  4ZA0 A;  5EBK A;  1LTX R;  1KCZ A;  4XWZ A;  1PS9 A;  3SSZ A;  3DGB A;  4XWR A;  1OJC A;  1M64 A;  4D03 A;  4HPN A;  5KMQ A;  2DKI A;  3BNM A;  4KWS A;  3B97 A;  1F6M A;  1XPQ A;  1TDN A;  4J56 A;  5BOF A;  3SR6 B;  1B8S A;  3KA7 A;  2C3C A;  2GAG B;  4A65 A;  4OPU A;  4BJZ A;  2X3N A;  5J60 A;  1TYP A;  4A7A A;  3AWI A;  4LII A;  1N4U A;  4BK2 A;  3I6T A;  3AXB A;  4YSH A;  1GRE A;  5TR3 A;  3UKL A;  3SN4 A;  3V4B A;  2ONE A;  1B37 A;  3NVV B;  1GSN A;  3EAN A;  3ZLH A;  1CL0 A;  1PBC A;  3CNJ A;  2EQ6 A;  3NYF A;  3SY4 A;  1N4W A;  4C77 A;  3NH3 X;  1EC8 A;  2WP9 A;  4GGB A;  1FEA A;  3KUM A;  2R0P A;  3EEZ A;  2ACZ A;  2Z5Y A;  1NHR A;  2QJJ A;  4J31 A;  5HHF A;  1GXF A;  3QKE A;  2V6O A;  1ZP0 A;  2BK3 A;  4U2S A;  2P8B A;  3NG7 X;  1PHH A;  1VQZ A;  3PWG A;  1JRO A;  3K30 A;  4D04 A;  4DWD A;  4AP3 A;  3B6D A;  4AOS A;  3NN6 X;  3C96 A;  5JCK A;  4H4T A;  3S47 A;  3FJ4 A;  4I59 A;  3SFD A;  1H6V A;  3TWB A;  3AE8 A;  2C70 A;  1RM6 B;  2CVJ A;  3L8K A;  3GC2 A;  1QLB A;  1ZOY A;  3K7M X;  2P0I A;  3HW2 A;  2YG6 A;  4G9K A;  4G73 A;  3ALL A;  3CIR A;  5M0Z A;  3AE6 A;  1KD0 A;  3QTP A;  3DG3 A;  2YVG A;  1SJC A;  3ATQ A;  2B7R A;  5GSN A;  2EQ8 A;  3P0W A;  1Q1R A;  3V76 A;  3NTA A;  5JCN A;  4X2P A;  5KVI A;  2WP6 A;  2C4C A;  3GRS A;  1KKR A;  4U8L A;  1JRX A;  3OZY A;  1E1L A;  3ATR A;  2XYO A;  4X9M A;  3ICS A;  3AEE A;  2XVJ A;  2VQB A;  5HXI A;  2V3A A;  1FFV C;  2V5Z A;  1VRQ B;  4IVM B;  4UDP A;  3UTF A;  1H82 A;  4U8J A;  3NS1 B;  4MKS A;  2B76 A;  2BXR A;  3C4N A;  1KDG A;  4AOX A;  1F8S A;  2A8X A;  2BAB A;  1Q1W A;  2CFY A;  3BOX A;  2YAU A;  4H4S A;  4OPD A;  4RG3 A;  3KD9 A;  3UJ2 A;  4J2W A;  2C67 A;  3KPK A;  3GRT A;  4HA6 A;  2XCG A;  2W3S A;  4ZN0 A;  2GGI A;  2OQH A;  3EUB 3;  4BJY A;  1ELI A;  2JB1 A;  3H8L A;  2OPJ A;  2APG A;  2IVE A;  4KPR A;  3L5O A;  3NVZ B;  4EIQ A;  4YTP A;  3EF6 A;  5FJU A;  3IWA A;  1LPF A;  1GPE A;  3I4K A;  2XDO A;  1MUC A;  3F8P A;  5FS7 A;  4H2P A;  1FIQ B;  4K2X A;  3H8A A;  2F5Z A;  3NVW B;  5CKU A;  3PS9 A;  4GAV A;  5KWF A;  4Y4L A;  3CYJ A;  3AYI A;  4EM3 A;  4A6N A;  4GF7 A;  1JRZ A;  3PG6 A;  1FEB A;  3SZ0 A;  1Z6L A;  4ECH A;  2XH0 A;  2OZ3 A;  1N4V A;  4NEV A;  2QA2 A;  3OZ2 A;  4Z43 A;  2YLW A;  2E5V A;  2PA6 A;  2YG5 A;  2AQJ A;  3T6C A;  4Y4M A;  1NPX A;  4C74 A;  3EAO A;  3NO1 A;  3STP A;  4B1B A;  2WS3 A;  4K5S A;  4PAA A;  3RNM A;  4H4R A;  2PU1 A;  1WUE A;  1F3P A;  2AL2 A;  1L9D A;  2OO6 A;  1TDO A;  4Z17 A;  4EMW A;  3QSS A;  1H2I A;  1YQ4 A;  6ENL A;  2A87 A;  5KNL A;  5BOE A;  1KF6 A;  3Q9T A;  3Q45 A;  3P4P A;  3O0H A;  2YVF A;  4H83 A;  3MKC A;  2BRY A;  4WX1 A;  1JU2 A;  2PYX A;  3NGC X;  3NN0 X;  4NWZ A;  7ENL A;  2P8C A;  3V5C A;  5KOW A;  4B64 A;  3UCC A;  1IUV A;  5ER0 A;  4JN9 A;  1JPD X;  2R45 A;  5U1O A;  5J04 A;  4JNQ A;  3OC4 A;  4YXD A;  3QN3 A;  3TQP A;  2XH7 A;  2R0G A;  1OJ9 A;  1GRH A;  4IT1 A;  3NZG A;  2QDD A;  3R11 A;  2R9Z A;  3V3W A;  1D4C A;  1NHP A;  2JB3 A;  3MY9 A;  3CB3 A;  1W4X A;  4HCD A;  2QDE A;  4EQS A;  3NNE A;  2ZAD A;  2XVE A;  2XFU A;  2POD A;  4K5R A;  1DOC A;  1N5W C;  3OW1 A;  3D9X A;  3GY1 A;  1P43 A;  4Z2R A;  4HB9 A;  3CN8 A;  3UOZ A;  4YSX A;  3ENL A;  3AEC A;  4ADW A;  2WET A;  3RRA A;  4E5T A;  3SX6 A;  2QGY A;  1V59 A;  2AKZ A;  1CJC A;  3CAW A;  1NEK A;  1NAA A;  3SQP A;  3VC5 A;  2GDQ A;  1E1M A;  3N6J A;  2XGZ A;  3NYE A;  3AD9 B;  1KN0 A;  1QJD A;  1PDZ A;  1T3Q C;  2VVM A;  5L46 A;  1IYX A;  2GQF A;  1BGN A;  2PP3 A;  3EKG A;  2GB0 A;  3KPF A;  1EBH A;  4GR1 A;  1HYU A;  1OJT A;  3I6E A;  1XDI A;  3SJN A;  2OQY A;  4K7Z A;  1IUX A;  1COY A;  2WEU A;  3M0O A;  1JPM A;  1S3B A;  3N4E A;  3TJ4 A;  3OZM A;  4GCM A;  2X8G A;  4Z2U A;  5G5G B;  4TM0 A;  4CNK A;  4AT0 A;  2HQM A;  2VZ2 A;  3C4A A;  1B4V A;  1RP0 A;  4WCT A;  2BK5 A;  5KMS A;  1OJD A;  3RR1 A;  4YKG A;  2PGE A;  5IPY A;  3GDN A;  3TOY A;  3AEF A;  3LZW A;  1EL8 A;  2OZ8 A;  3ALM A;  4BK3 A;  3QPE A;  4H4P A;  4J34 A;  4EWJ A;  1E39 A;  3B9J B;  3DA1 A;  2VVL G;  4B69 A;  1PBF A;  1ONF A;  3UOY A;  3N6H A;  3AM9 A;  1FL2 A;  4EQW A;  3G5Q A;  4HYR A;  3T2Z A;  3P4S A;  1ZKQ A;  1VDV A;  1XAN A;  1TDF A;  3P4Q A;  4TLZ A;  4Y4N A;  4BUR A;  2WOW A;  3VRB A;  1S7M A;  1GOS A;  4AT2 A;  4A6N B;  2BA9 A;  3NK0 X;  4ZOH B;  5EU9 A;  3NK2 X;  2GGE A;  4REK A;  2XFP A;  3ITJ A;  4FK1 C;  3A7U A;  4KPL A;  1MDL A;  3DG6 A;  2ARD A;  3BI5 A;  4U2T A;  4OPC A;  4U8M A;  4O5Q A;  2X50 A;  2GGH A;  4IP5 A;  1EC9 A;  1OEP A;  3UCL A;  1GRF A;  4H2H A;  2HXU A;  2CUL A;  1TE6 A;  3P3B A;  4C3X A;  4NTD A;  4BV6 A;  4IA5 A;  1Q9I A;  1F8R A;  3IHG A;  2PS2 A;  2PTX A;  3H7V A;  3VR9 A;  2AL2 B;  4ZCC A;  2JAE A;  1X31 B;  3SM8 A;  3FIM B;  2AL1 A;  3V3O A;  3UP5 A;  1PBE A;  2I5Q A;  3AEB A;  2Q0K A;  4IHC A;  2EQ7 A;  3GMC A;  4J3Z A;  3UKK A;  3HYV A;  5IDZ A;  3ICT A;  2HXT A;  1KNP A;  1O5W A;  4E0V A;  2R4J A;  4O5U A;  4H50 A;  4KEM A;  3SYI A;  2EQ9 A;  3SQS A;  1EC7 A;  2C75 A;  1LQT A;  1S2Q A;  4H2Q A;  2PTW A;  4TVW A;  2WHD A;  3R9U A;  2NVK X;  5FS6 A;  5JCI A;  3B3R A;  2XVF A;  4H2N A;  4DHG A;  3P9U A;  5FJP A;  1YKJ A;  5LV9 A;  1TKK A;  4ZCW A;  4YTN A;  3ISH A;  1H81 A;  3K7Q X;  2Q7V A;  3AD7 B;  1E1N A;  3DJJ A;  1CF3 A;  2DW7 A;  4JY3 A;  5HYM A;  2XLU A;  3TW9 A;  3H4K A;  3DJG X;  4CCQ A;  2XH4 A;  3AE9 A;  1NHS A;  3GSI A;  2E3T A;  2CDU A;  3D8X A;  1SJB A;  3E1T A;  3NLC A;  1CJ4 A;  4ROP A;  1GT8 A;  1CC4 A;  5KMR A;  4NEW A;  2TMD A;  1GER A;  2PGW A;  1E6E A;  3RGT A;  1VQW A;  3MSY A;  1F8W A;  5M10 A;  4RSL A;  3GYJ A;  4DGK A;  4CNJ A;  3QSM A;  4DSG A;  1VDC A;  4F4R A;  1F9C A;  1FHV A;  1L0V A;  3R0K A;  2ZZB A;  1R6W A;  2WPC A;  1BKH A;  2C66 A;  3T2Y A;  3IJL A;  4JNA A;  2POZ A;  1GND A;  4GDE A;  1LJ1 A;  2RGH A;  1BGJ A;  1Y0P A;  1N5X A;  2BS3 A;  2YLT A;  1GRG A;  2B9W A;  5BUK A;  1MRA A;  3ALJ A;  4N9X A;  3IC9 A;  2OLA A;  2OLO A;  1E7P A;  3DG7 A;  2BAC A;  4U8N A;  2Y6Q A;  1MXT A;  3ZLF A;  1EBG A;  3VR8 A;  5J7X A;  1ZY8 A;  4IL0 A;  4Z26 A;  1KKO A;  1GRA A;  2Y6R A;  4G6G A;  4EIP A;  5BUL A;  1P2E A;  3NTD A;  5U63 A;  2PHH A;  3DME A;  3DER A;  3IK4 A;  1TZZ A;  3KVE A;  1NHQ A;  2WQY A;  4ENL A;  2C72 A;  4EQR A;  2J3N A;  1BF3 A;  4EMJ A;  3H8I A;  3GWF A;  3NIX A;  3BHK A;  3I3L A;  1NEL A;  4IL2 A;  2OKT A;  3II4 A;  2GR0 A;  3SBF A;  2BS4 A;  4YWS A;  1NG4 A;  1H84 A;  1PN0 A;  5HY5 A;  1MOK A;  2WPE A;  2IID A;  2VQ7 A;  1TRB A;  2OG9 A;  1W6T A;  2R4E A;  4RG4 A;  3GD4 A;  2XFO A;  3PWI A;  2AR8 A;  2GF3 A;  5C3J A;  3IHM A;  3GYX A;  3FV9 A;  1YQ3 A;  3JSK A;  1GEU A;  2QQ6 A;  2W55 A;  1KNR A;  4OPT A;  1ZDL A;  3MWC A;  2XLR A;  5EB4 A;  4HN8 A;  3KLJ A;  2JB2 A;  1GTE A;  3VC6 A;  1SB3 B;  4JQ9 A;  1STZ A;  1GRB A;  4A3R A;  3RO6 A;  1H86 A;  4IZG A;  4MMW A;  3DES A;  4H2R A;  1CBO A;  5ENL A;  3GD3 A;  3VA8 A;  1N60 C;  3UJE A;  4UP3 A;  1O95 A;  2C65 A;  1FHU A;  4H4X A;  2CHR A;  5C2T A;  2BK4 A;  2AAQ A;  3CPJ G;  5KXJ A;  2B9Y A;  4GME A;  1ECQ A;  5GRT A;  3EPT A;  2YR4 A;  4USR A;  1WUF A;  1X2G A;  3QLD A;  3ZVI A;  2BXS A;  2MNR A;  1K4Q A;  3R1Z A;  3BI2 A;  3AE2 A;  3DFH A;  4GYP C;  1E9I A;  4DYE A;  3MZN A;  4JN7 A;  2FKP A;  3UOX A;  5KVH A;  4II3 A;  3R10 A;  3VDG A;  4Z25 A;  3HPF A;  4I58 A;  4GYP A;  2PTZ A;  4B63 A;  3QSE A;  3H70 A;  2V3B A;  2DW6 A;  2GL5 A;  1DOD A;  1P2H A;  2HNE A;  3L1R A;  2GR3 A;  1YY5 A;  1D5T A;  1MDR A;  3CGC A;  1FEC A;  2Q6U A;  2V60 A;  3NHO X;  3RP7 A;  3PVC A;  5U25 A;  2VRL A;  1D7Y A;  3QJ4 A;  1PJ5 A;  2PP1 A;  4CBQ A;  2GSH A;  4E8G A;  2OFJ A;  3CTY A;  2B7S A;  1PBD A;  3Q6J A;  4JDR A;  3FXG A;  4C3Y A;  2GV8 A;  2ZC8 A;  3M13 A;  4CCR A;  3OP2 A;  1SEZ A;  2FJB A;  1TYT A;  3RCY A;  2JBV A;  3THU A;  2R46 A;  1B5Q A;  4YKF A;  4G8T A;  3T9P A;  4FDC B;  2H88 A;  3DK4 A;  4U8P A;  4XXG A;  5FS9 A;  3NT6 A;  1PJ7 A;  1JEH A;  4Z1Y A;  1PXC A;  3ICR A;  3CNS A;  1H83 A;  4A99 A;  3URH A;  2XVH A;  4X9N A;  2XSX A;  3AB1 A;  1KFY A;  2PTY A;  2WPF A;  1DJN A;  3CMM A;  3ZVH A;  2C3D A;  3SZF A;  2QA1 A;  3HRD C;  3T37 A;  1PDY A;  3JW7 A;  4HCH A;  3GDP A;  4DXK A;  3UJF A;  3CNP A;  1LQU A;  1VG9 A;  4JN8 A;  2XFQ A;  1IUW A;  1DXL A;  3OTR A;  2XLT A;  1BWC A;  3NFU A;  3AN1 A;  1CJ3 A;  2YM1 A;  3TWA A;  2WES A;  3CXB A;  3V5F A;  1O94 A;  1S2Y A;  1L8P A;  1D7L A;  1ELS A;  4E4U A;  2C64 A;  2YLZ A;  5IQ1 A;  3CGB A;  3UP4 A;  1M6I A;  4IA6 A;  3P1W A;  3ZLG A;  3TTE A;  5JCL A;  3CT2 A;  2BCG G;  4UDQ A;  4Z2T A;  2C76 A;  4A5L A;  3AYJ A;  2W54 A;  3VCC A;  3H12 A;  1GTH A;  4TM1 A;  1Y56 A;  3A7A A;  4H4Q A;  4IP4 A;  3UCD A;  1PDH A;  2PSN A;  2XLP A;  3LOV A;  1P48 A;  4HNC A;  3BSM A;  2VOU A;  4UDR A;  4OVI A;  1XS2 A;  1ZX9 A;  4B67 A;  3GMB A;  4YSY A;  4DSH A;  5EB5 A;  1CHU A;  3QFA A;  3FVD A;  3RP8 A;  3KU9 A;  3NRN A;  2WOI A;  4K2S A;  4C5O A;  2BYB A;  3FYY A;  4M0X A;  4H4Z A;  1AOG A;  3GYI A;  1IUT A;  4U8I A;  3S5S A;  4Z44 A;  3M12 A;  2C73 A;  2YM2 A;  3R07 C;  1KSU A;  2WBA A;  2WU5 A;  3P4R A;  2BCP A;  3TJI A;  4E6M A;  4DN1 A;  3FBS A;  4JHM A;  3JVA A;  3PFR A;  4PAB A;  2OZT A;  1BQG A;  2OVL A;  2GGJ A;  2MUC A;  1QO8 A;  3T14 A;  2W3R A;  1WYG A;  2V61 A;  5CQF A;  3UTE A;  4OPI A;  4M6U A;  3DH9 A;  3FCP A;  1PBB A;  2WDV A;  2NQL A;  2RGO A;  3AE3 A;  4LU6 A;  3DJD A;  3QVR A;  3UKA A;  3VQR A;  3R0U A;  2TPR A;  3T0K A;  1GAL A;  1LV0 A;  2VVL A;  1K0L A;  2R0C A;  1N62 C;  3AD8 B;  3CXO A;  2BC1 A;  1EL9 A;  4DX3 A;  1TDE A;  4K8G A;  3NXL A;  2YLS A;  4NZH A;  2BC0 A;  3D46 A;  1REO A;  2W0H A;  4H4W A;  4ICY A;  3IJQ A;  1FCD A;  4CRT A;  1CC6 A;  3D47 A;  4OPL A;  1D4E A;  3SZC A;  2OAL A;  1ZMD A;  4K8D A;  4B66 A;  3Q4D A;  3HYW A;  3RIT A;  2QVH A;  1GRT A;  3DIP A;  5FJR A;  1S3E A;  2X8H A;  2JKC A;  4YSZ A;  1L9E A;  2OLN A;  4IVO B;  3F8R A;  1N63 C;  3CK5 A;  4TVY A;  3AE5 A;  3D1C A;  4J1O A;  1YQZ A;  2NPX A;  4FP1 A;  3VRA A;  3LZX A;  3UKQ A;  2XLS A;  1RVK A;  1NEN A;  3DJE A;  3ZVH B;  2XFN A;  2O56 A;  4A35 A;  1GET A;  2PMQ A;  2WDQ A;  4TM3 A;  2RDX A;  2I0Z A;  3HYX A;  1NDA A;  4MJW A;  1JCT A;  5EOW A;  5BVA A;  4ZCD A;  3HZL A;  2VRM A;  5FJO A;  2PPG A;  1UKV G;  2GH5 A;  3SN0 A;  2QAE A;  1GES A;  1D4D A;  1PXA A;  2O9Z A;  3K1G A;  3RED A;  4IV9 A;  3RHA A;  3U4F A;  1EL7 A;  3I6D A;  3COX A;  2YLX A;  4OCG A;  4TM4 A;  3UGV A;  2OAM A;  2GVC A;  2YWL A;  4BK1 A;  1ZMC A;  2X99 A;  4II2 A;  4H1Z A;  1H7X A;  3DGZ A;  4B68 A;  3SZW A;  5IQ4 A;  2FJA A;  3KKJ A;  1N61 C;  5JRB A;  4KX6 A;  2E5A A;  1DTN A;  4FX9 A;  2IVD A;  3MQT A;  3BNU A;  3AYL A;  3AMZ A;  1Y56 B;  4U8K A;  2GQW A;  4NTE A;  3UJS A;  2H89 A;  4Z24 A;  3U9I A;  3V3N A;  4GAP A;  3N4F A;  2B9X A;  3DDM A;  3ES8 A;  2GMJ A;  5JCM A;  4GDP A;  3TCS A;  3CND A;  1EBD A;  3IF9 A;  1BKW A;  3T8Q A;  2YR6 A;  3SXI A;  1FOH A;  3ZYX A;  3DK9 A;  4YTM A;  5KRQ A;  4X4J A;  4E4F A;  3WE0 A;  3S61 A;  4LA1 A;  1KSS A;  2AKM A;  3ABV A;  2GGG A;  2OA1 A;  1X2H A;  4HCL A;  3UTG A;  4TLX A;  4EQX A;  3T31 A;  2RAB A;  3K7T A;  3NKS A;  3UKF A;  1CC2 A;  2OX4 A;  1R0M A;  4H4V A;  5FMH A;  4CY8 A;  2WDR A;  3UTH A;  4CY6 A;  5FS8 A;  2C7G A;  5BRT A;  4H4U A;  5KMP A;  1E1K A;  2E4G A;  3UKH A;  1DNC A;  2XH2 A;  4M52 A;  1FO4 A;  4J57 A;  3SFE A;  4P9S A;  1RSG A;  2FJD A;  2P88 A;  3AE1 A;  2GAH B;  3QVP A;  4GFI A;  2E1M A;  2A89 A;  4FI4 A;  1K0I A;  4G7F A;  1TDK A;  3SN1 A;  1PJ6 A;  3GO2 A;  4H7U A;  4B65 A;  4GRT A;  4JY2 A;  3LB8 A;  3UOV A;  5FJT A;  2GR2 A;  5DBJ A;  1PXB A;  3DFY A;  2QJM A;  3P93 A;  2BRA A;  2DKH A;  2WOV A;  2FYM A;  1JNR A;  3BI4 A;  1NU5 A;  4HNL A;  3FMW A;  4YT0 A;  2RGJ A;  4AP1 A;  1IUS A;  1OJA A;  3NK1 X;  1K0J A;  1L9C A;  1XHC A;  1ZK7 A;  1GV4 A;  2ZZC A;  4OPG A;  3T4W A;  3FG2 P;  4GUV A; 
#chains in the Genus database with same CATH homology
 4H4Q A;  3GYJ A;  4DGK A;  4CNJ A;  1N4V A;  4NEV A;  1PDH A;  3QSM A;  2QA2 A;  3OZ2 A;  2WU2 A;  2XLP A;  4Z43 A;  2YLW A;  3LOV A;  2E5V A;  2YG5 A;  3CPH G;  3ZDN A;  2XVI A;  2AQJ A;  4DSG A;  1VDC A;  2VOU A;  4Y4M A;  2WP5 A;  4UDR A;  3BHF A;  1NPX A;  3CGD A;  4OVI A;  3LXD A;  1L0V A;  4C74 A;  1ZX9 A;  4B67 A;  3GMB A;  2ZZB A;  3EAO A;  4YSY A;  2YLR A;  2WPC A;  2C66 A;  4DSH A;  5EB5 A;  3T2Y A;  1CHU A;  3QFA A;  4JNA A;  1N1P A;  3RP8 A;  3AE7 A;  4B1B A;  1GND A;  4GDE A;  3KU9 A;  1LJ1 A;  2WS3 A;  4K5S A;  3NRN A;  4J36 A;  2RGH A;  2WOI A;  4PAA A;  1BGJ A;  1Y0P A;  4C5O A;  3PO7 A;  2BYB A;  3RNM A;  4H4R A;  1ZOV A;  4H4Z A;  1EL5 A;  2GRT A;  2BS3 A;  2YLT A;  2X8C A;  1AOG A;  1GRG A;  3GYI A;  1F3P A;  2B9W A;  1L9D A;  5BUK A;  1IUT A;  4H4Y A;  4G6H A;  4U8I A;  1TDO A;  4YWO A;  4EMW A;  1DJQ A;  3QSS A;  4Z44 A;  3M12 A;  3ALJ A;  4N9X A;  1H2I A;  2YVJ A;  1YQ4 A;  3LJP A;  2C73 A;  3IC9 A;  2YM2 A;  2OLO A;  2A87 A;  1KSU A;  1CJ2 A;  3DGH A;  2WBA A;  1KF6 A;  1E7P A;  2BAC A;  2WU5 A;  2YG4 A;  4U8N A;  2Y6Q A;  3RP6 A;  3P4R A;  4NTC A;  1MXT A;  2BCP A;  3Q9T A;  2QCU A;  3VR8 A;  3AEA A;  3P4P A;  3O0H A;  2YVF A;  5J7X A;  3FBS A;  2BRY A;  4WX1 A;  1ZY8 A;  3G5R A;  1JU2 A;  3FPZ A;  4Z26 A;  2PYX A;  3NGC X;  2YG7 A;  3NN0 X;  1GRA A;  4PAB A;  4NWZ A;  2Y6R A;  4G6G A;  5KOW A;  4B64 A;  4EIP A;  3GWD A;  5BUL A;  1P2E A;  4NNJ A;  2UZZ A;  1IUV A;  3CPI G;  3NTD A;  5U63 A;  2PHH A;  1QO8 A;  3T14 A;  5ER0 A;  3DME A;  4J33 A;  4JN9 A;  2R45 A;  1H7W A;  5U1O A;  3KVE A;  4JNQ A;  1NHQ A;  2WQY A;  1NG3 A;  3OC4 A;  4YXD A;  2C72 A;  4APN A;  4EQR A;  2V61 A;  3QFB A;  2J3N A;  2JK6 A;  4U8O A;  1BF3 A;  5CQF A;  4EMJ A;  3H8I A;  3GWF A;  3NIX A;  2R0G A;  2FJE A;  2GR1 A;  3LAD A;  1OJ9 A;  3BHK A;  3I3L A;  3AEG A;  1JNZ A;  3UTE A;  1GRH A;  3II4 A;  2GR0 A;  2BS4 A;  4OPI A;  1NG4 A;  1BZL A;  1H84 A;  1PN0 A;  5HY5 A;  3DH9 A;  3AED A;  3S5W A;  1PBB A;  2R9Z A;  1RYI A;  1MOK A;  2WDV A;  3UKP A;  1IJH A;  2RGO A;  1JRY A;  1D4C A;  3AE4 A;  3AE3 A;  4LU6 A;  2WPE A;  1NHP A;  2JB3 A;  3DJD A;  1IUU A;  2IID A;  2VQ7 A;  1W4X A;  3NYC A;  4USQ A;  1JOA A;  3QVR A;  3G5S A;  3UKA A;  1TRB A;  4A79 A;  4EQS A;  3NNE A;  3VQR A;  2TPR A;  2XVE A;  3CNT A;  3DK8 A;  1GAL A;  1LV0 A;  2VVL A;  1K0L A;  3T0K A;  2R0C A;  2XFU A;  4K5R A;  1DOC A;  3D9X A;  3AD8 B;  1DOE A;  3SGL A;  4Z2R A;  2R4E A;  2BC1 A;  4RG4 A;  2GEW A;  3GD4 A;  2XFO A;  2ZBW A;  3CN8 A;  4HB9 A;  3UOZ A;  1EL9 A;  4YSX A;  4G74 A;  2AR8 A;  2GF3 A;  4EM4 A;  2YR5 A;  1TDE A;  3AEC A;  3F8D A;  5C3J A;  3IHM A;  2YLS A;  3GYX A;  4NZH A;  4ADW A;  2BC0 A;  1YQ3 A;  2WET A;  3JSK A;  1REO A;  1GEU A;  2W0H A;  4H4W A;  3SX6 A;  1VG0 A;  4ICY A;  1DOB A;  1V59 A;  1KNR A;  1FCD A;  2GMH A;  1CJC A;  4OPT A;  1NEK A;  4CRT A;  1ZDL A;  1CC6 A;  4OPL A;  3ADA B;  1NAA A;  2XLR A;  3SQP A;  5KOX A;  4U2L A;  1D4E A;  3SZC A;  2OAL A;  1ZMD A;  1E1M A;  4K8D A;  5EB4 A;  4B66 A;  1MO9 A;  3KLJ A;  2JB2 A;  1GTE A;  2Z5X A;  3HYW A;  3NYE A;  3AD9 B;  1KN0 A;  1QJD A;  4JQ9 A;  1LVL A;  2VVM A;  4EMI A;  1GRT A;  1GRB A;  3T2K A;  5KNL A;  5L46 A;  1S3E A;  2Q0L A;  2FBW A;  4FK1 A;  2GQF A;  2X8H A;  2JKC A;  4YSZ A;  3VRD B;  1L9E A;  1BGN A;  2OLN A;  4IVO B;  4K22 A;  3F8R A;  2GB0 A;  3KPF A;  2YG3 A;  3AE5 A;  1H86 A;  4GR1 A;  1HYU A;  3D1C A;  4A9W A;  1OJT A;  2BS2 A;  1XDI A;  4DNA A;  2YQU A;  4H2R A;  1CBO A;  2ZZ0 A;  3CGE A;  1YQZ A;  2NPX A;  3GD3 A;  5EBK A;  4K7Z A;  1IUX A;  1LTX R;  4XWZ A;  3VRA A;  1COY A;  1PS9 A;  3LZX A;  2WEU A;  3UKQ A;  2XLS A;  3M0O A;  4XWR A;  1OJC A;  1M64 A;  4UP3 A;  4D03 A;  1NEN A;  1O95 A;  1S3B A;  2C65 A;  5KMQ A;  2DKI A;  3BNM A;  4GCM A;  2X8G A;  1F6M A;  1XPQ A;  3DJE A;  4H4X A;  1TDN A;  2XFN A;  4Z2U A;  5C2T A;  2BK4 A;  1GET A;  2AAQ A;  3CPJ G;  4TM0 A;  5KXJ A;  4J56 A;  4CNK A;  4AT0 A;  2WDQ A;  4TM3 A;  3HYX A;  2B9Y A;  2I0Z A;  5GRT A;  3EPT A;  1NDA A;  2YR4 A;  2HQM A;  4MJW A;  1B8S A;  4USR A;  2VZ2 A;  3KA7 A;  5EOW A;  2C3C A;  1B4V A;  3C4A A;  5BVA A;  2GAG B;  4A65 A;  4ZCD A;  4OPU A;  1RP0 A;  4WCT A;  4BJZ A;  2BXS A;  2X3N A;  2BK5 A;  1K4Q A;  3BI2 A;  3AE2 A;  3HZL A;  5J60 A;  2VRM A;  1TYP A;  4GUV A;  5KMS A;  4A7A A;  1OJD A;  1UKV G;  2GH5 A;  3AWI A;  4LII A;  1N4U A;  2QAE A;  1GES A;  1D4D A;  1PXA A;  4BK2 A;  3AXB A;  4YSH A;  1GRE A;  2O9Z A;  3UOX A;  5KVH A;  5TR3 A;  4YKG A;  3UKL A;  5IPY A;  1B37 A;  3RED A;  4II3 A;  4IV9 A;  3RHA A;  1EL7 A;  3I6D A;  3COX A;  4Z25 A;  1GSN A;  3GDN A;  3AEF A;  4I58 A;  3LZW A;  3EAN A;  1EL8 A;  1CL0 A;  1PBC A;  3CNJ A;  2EQ6 A;  3NYF A;  2YLX A;  3SY4 A;  3ALM A;  4OCG A;  1N4W A;  4TM4 A;  4BK3 A;  3NH3 X;  4C77 A;  4J34 A;  4H4P A;  4B63 A;  3QSE A;  2OAM A;  2GVC A;  1E39 A;  2YWL A;  4BK1 A;  3DA1 A;  2V3B A;  2WP9 A;  2VVL G;  1FEA A;  4B69 A;  2R0P A;  1PBF A;  1ONF A;  3UOY A;  2ACZ A;  2Z5Y A;  1DOD A;  1P2H A;  1NHR A;  4J31 A;  1ZMC A;  1FL2 A;  5HHF A;  2X99 A;  3L1R A;  1GXF A;  4II2 A;  1H7X A;  2GR3 A;  3DGZ A;  4EQW A;  1YY5 A;  3G5Q A;  4B68 A;  3SZW A;  5IQ4 A;  1D5T A;  2V6O A;  1ZP0 A;  2BK3 A;  2FJA A;  3KKJ A;  3T2Z A;  4U2S A;  3NG7 X;  1PHH A;  1ZKQ A;  3CGC A;  3P4S A;  1XAN A;  1TDF A;  3P4Q A;  1FEC A;  5JRB A;  4TLZ A;  4KX6 A;  4Y4N A;  4BUR A;  2Q6U A;  2WOW A;  2V60 A;  3NHO X;  3VRB A;  1S7M A;  4FX9 A;  1GOS A;  2IVD A;  3RP7 A;  3PVC A;  5U25 A;  2VRL A;  3K30 A;  1D7Y A;  3QJ4 A;  1PJ5 A;  2BA9 A;  4A6N B;  4AT2 A;  4D04 A;  4CBQ A;  3NK0 X;  3BNU A;  4AP3 A;  3AYL A;  3NK2 X;  3CTY A;  1Y56 B;  4REK A;  3B6D A;  4U8K A;  2GQW A;  2XFP A;  2B7S A;  4NTE A;  4Z24 A;  2H89 A;  4AOS A;  3ITJ A;  3NN6 X;  3C96 A;  4FK1 C;  1PBD A;  5JCK A;  3Q6J A;  4JDR A;  4H4T A;  4C3Y A;  2GV8 A;  2ARD A;  3BI5 A;  4U2T A;  4I59 A;  4OPC A;  3SFD A;  4GAP A;  1H6V A;  3AE8 A;  3V3N A;  5M10 A;  3M13 A;  4U8M A;  2C70 A;  2B9X A;  4O5Q A;  4CCR A;  2X50 A;  2CVJ A;  3L8K A;  1SEZ A;  2GMJ A;  5JCM A;  1QLB A;  1ZOY A;  2FJB A;  3K7M X;  4GDP A;  3UCL A;  3CND A;  2YG6 A;  1EBD A;  3IF9 A;  1TYT A;  1GRF A;  4G9K A;  4G73 A;  3ALL A;  3CIR A;  2CUL A;  1BKW A;  2JBV A;  5M0Z A;  2YR6 A;  3SXI A;  2R46 A;  3AE6 A;  4C3X A;  1FOH A;  4NTD A;  1B5Q A;  4BV6 A;  4IA5 A;  4YKF A;  3ZYX A;  3DK9 A;  4YTM A;  2YVG A;  1F8R A;  1Q9I A;  3IHG A;  4FDC B;  3ATQ A;  5KRQ A;  2H88 A;  2B7R A;  4X4J A;  3VR9 A;  5GSN A;  3DK4 A;  2EQ8 A;  1Q1R A;  4U8P A;  3NTA A;  4ZCC A;  4XXG A;  3V76 A;  3WE0 A;  2JAE A;  4LA1 A;  5FS9 A;  3S61 A;  5JCN A;  1X31 B;  1KSS A;  3ABV A;  3NT6 A;  5KVI A;  2WP6 A;  2OA1 A;  2C4C A;  3GRS A;  1PJ7 A;  1JEH A;  3SM8 A;  3FIM B;  1PXC A;  3ICR A;  3UTG A;  4U8L A;  3V3O A;  3CNS A;  1JRX A;  3UP5 A;  1PBE A;  1H83 A;  4TLX A;  4A99 A;  4EQX A;  3URH A;  3T31 A;  1E1L A;  3AEB A;  2Q0K A;  2RAB A;  2XVH A;  3K7T A;  4X9N A;  3NKS A;  3ATR A;  3UKF A;  2XYO A;  1CC2 A;  4X9M A;  3ICS A;  2EQ7 A;  4H4V A;  2XVJ A;  3AEE A;  3GMC A;  5FMH A;  3AB1 A;  1KFY A;  2VQB A;  3UKK A;  5HXI A;  2WPF A;  4CY8 A;  2V3A A;  1DJN A;  2WDR A;  3UTH A;  2V5Z A;  4CY6 A;  1VRQ B;  3CMM A;  5FS8 A;  2C7G A;  4IVM B;  4UDP A;  5BRT A;  3UTF A;  1H82 A;  2C3D A;  4H4U A;  4U8J A;  3HYV A;  3SZF A;  5KMP A;  2QA1 A;  2B76 A;  2BXR A;  3ICT A;  3T37 A;  3C4N A;  1E1K A;  1KDG A;  2E4G A;  3UKH A;  1KNP A;  1F8S A;  1O5W A;  4AOX A;  1DNC A;  2A8X A;  3GDP A;  4M52 A;  4E0V A;  2BAB A;  2R4J A;  3CNP A;  1Q1W A;  2CFY A;  4O5U A;  4J57 A;  3SFE A;  2YAU A;  4P9S A;  4H50 A;  4H4S A;  1RSG A;  1LQU A;  3SYI A;  2EQ9 A;  2FJD A;  1VG9 A;  4OPD A;  4RG3 A;  3KD9 A;  2C75 A;  1LQT A;  1S2Q A;  3AE1 A;  4H2Q A;  4J2W A;  2XFQ A;  2C67 A;  2WHD A;  2GAH B;  2NVK X;  3QVP A;  1IUW A;  3KPK A;  3R9U A;  1DXL A;  5FS6 A;  2E1M A;  3GRT A;  2A89 A;  4HA6 A;  5JCI A;  2XCG A;  2XLT A;  1BWC A;  1K0I A;  3B3R A;  4ZN0 A;  1TDK A;  2XVF A;  1CJ3 A;  4H2N A;  4BJY A;  2YM1 A;  2WES A;  4ECH A;  3P9U A;  1ELI A;  1YKJ A;  2JB1 A;  3H8L A;  5LV9 A;  1PJ6 A;  2APG A;  4H7U A;  2IVE A;  4B65 A;  4KPR A;  4GRT A;  4JY2 A;  3L5O A;  4EIQ A;  4YTP A;  3EF6 A;  4YTN A;  3LB8 A;  3ISH A;  3IWA A;  1LPF A;  1O94 A;  1H81 A;  1GPE A;  3UOV A;  1S2Y A;  3K7Q X;  2GR2 A;  2Q7V A;  2XDO A;  5DBJ A;  1PXB A;  3AD7 B;  2BRA A;  1E1N A;  3F8P A;  3DJJ A;  1CF3 A;  1D7L A;  5FS7 A;  2DKH A;  4H2P A;  4JY3 A;  2WOV A;  2C64 A;  2YLZ A;  5IQ1 A;  5HYM A;  3CGB A;  2XLU A;  3UP4 A;  1M6I A;  4K2X A;  3H4K A;  2F5Z A;  1JNR A;  3DJG X;  4IA6 A;  4CCQ A;  3P1W A;  3AE9 A;  1NHS A;  3BI4 A;  3GSI A;  2CDU A;  3D8X A;  5CKU A;  3E1T A;  3FMW A;  4YT0 A;  2RGJ A;  1CJ4 A;  3NLC A;  4AP1 A;  5JCL A;  3PS9 A;  4GAV A;  5KWF A;  2BCG G;  4Y4L A;  3AYI A;  4UDQ A;  1IUS A;  4Z2T A;  1GT8 A;  1OJA A;  4EM3 A;  4A6N A;  2C76 A;  4GF7 A;  1JRZ A;  1K0J A;  3NK1 X;  1CC4 A;  3PG6 A;  1FEB A;  1L9C A;  4A5L A;  3SZ0 A;  5KMR A;  1XHC A;  3AYJ A;  1ZK7 A;  1Z6L A;  4NEW A;  1GER A;  1E6E A;  1GV4 A;  2TMD A;  2ZZC A;  1GTH A;  1VQW A;  4OPG A;  1F8W A;  4TM1 A;  3FG2 P;  4RSL A;  1Y56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...