3CGBA

Pyridine nucleotide complexes with bacillus anthracis coenzyme a-disulfide reductase: a structural analysis of dual nad(p)h specificity
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
444
structure length
444
Chain Sequence
MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRDKYGIDAKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGAIGLEMAETFVELGKKVRMIERNDHIGTIYDGDMAEYIYKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLVSVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Pyridine nucleotide-disulfide oxidoreductase, class I
publication title Pyridine Nucleotide Complexes with Bacillus anthracis Coenzyme A-Disulfide Reductase: A Structural Analysis of Dual NAD(P)H Specificity.
pubmed doi rcsb
source organism Bacillus anthracis str.
total genus 137
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3cgbA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgbA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgbA02
2UZZA 4GR1A 3UTEA 1ZY8A 2WOIA 2VRMA 3DA1A 4PAAA 5U63A 4D04A 5LV9A 2EQ6A 2R9ZA 2C70A 3K7MX 4H4WA 4YTMA 3CGDA 4EMJA 2VOUA 3QFBA 2E4GA 2R4EA 1GRFA 3NTDA 4HA6A 3UTFA 3BHKA 4X4JA 3UKKA 4APNA 4JY3A 5KRQA 3SM8A 5KVHA 1REOA 3AE2A 1DXLA 2GR0A 2OALA 2ZZ0A 3VQRA 2I0ZA 3AEDA 4U8IA 3GYIA 3DGZA 2IIDA 2BS3A 4U8JA 1B37A 3ALMA 2YG7A 2WBAA 2FBWA 1GREA 4H4UA 1PBCA 1D7LA 4AP1A 1JNZA 2WP9A 1O95A 1PS9A 4OPGA 4H2NA 4K8DA 2Q0KA 5M10A 4EQRA 3EPTA 3KKJA 5EOWA 3IC9A 1D7YA 4X9MA 3NGCX 1IUUA 1ZP0A 3V3OA 4FDCB 2C67A 3AE7A 3GD4A 4EM4A 5BVAA 3P4SA 5KVIA 4K5SA 2YLSA 3P9UA 4D03A 1ZOYA 2YAUA 2BA9A 2XYOA 2V61A 2VQ7A 1GESA 3KLJA 3CTYA 2XLUA 1AOGA 3AYIA 4NTDA 4JNAA 2X8HA 4EIPA 5JCMA 4RG3A 3NNEA 2BK4A 2ARDA 3NG7X 4RG4A 4USQA 1DNCA 1FCDA 4K2XA 2XFPA 1P2HA 3GWDA 4AT0A 2WP5A 1CL0A 3UOZA 1LVLA 2RGJA 1DOEA 4U8OA 2FJAA 3CNPA 2GVCA 1KNPA 3CNTA 1PJ5A 4KPRA 2XVHA 1TDNA 4J31A 4OPDA 3VR9A 1GSNA 4EQXA 3UOXA 3DJJA 4YKFA 4K5RA 4Z24A 4OPCA 2WQYA 3QJ4A 2ACZA 2XFOA 3AECA 4K22A 1GOSA 1TDEA 1L0VA 2NPXA 1TYPA 2B9WA 1DJQA 3D1CA 5IPYA 3AB1A 3UKHA 1ZOVA 4CNJA 1YY5A 1JRZA 2Q6UA 3M12A 4OVIA 3RP7A 3ICTA 2C3DA 1Y0PA 3GMBA 3ICRA 2XVIA 4NTEA 3VRAA 2Q0LA 4BURA 1LPFA 3QVRA 5CQFA 4CY8A 4LU6A 4C3XA 4BJYA 1GV4A 2YM1A 1YQZA 3G5RA 2RGOA 4M52A 3AE6A 4B65A 4B68A 3LZXA 5KOWA 1LJ1A 1K0JA 2GAGB 4BV6A 2CDUA 2R0GA 4TM0A 1Q1RA 1FOHA 1F8RA 2GEWA 3P4PA 4C5OA 1PBEA 3B6DA 3AE4A 3FBSA 1EL5A 5FMHA 4A5LA 1RP0A 2BXRA 3NRNA 3C4NA 1BF3A 4HB9A 4B63A 3E1TA 2YQUA 1F8SA 3QSEA 2DKIA 1XANA 2GR1A 4Z25A 1MXTA 1K0IA 2JAEA 2Z5XA 1VG0A 3L1RA 3ICSA 5IQ4A 3DJDA 3OC4A 5EBKA 3AE5A 3V3NA 4A7AA 3WE0A 1GEUA 2R46A 3VR8A 3K7TA 1NG3A 1F3PA 1CHUA 4LIIA 5C2TA 4J36A 1Y56A 1S3EA 2YVGA 2C76A 1XPQA 1N1PA 4XWRA 2BABA 5C3JA 2GR3A 1O94A 2R0PA 3NHOX 4IA6A 4PABA 4UDQA 2A89A 4OPUA 1H81A 3AEGA 5HHFA 4J57A 3UOVA 1E39A 3R9UA 2BK5A 2WETA 2WOWA 2DKHA 2WOVA 3CPJG 2B76A 1E1MA 1KNRA 1B8SA 1N4UA 1ZDLA 1NAAA 2V3AA 1GXFA 4JQ9A 4I58A 3IHMA 4NEVA 2RGHA 1IUXA 1JNRA 1W4XA 4K7ZA 4CY6A 1K4QA 1S2QA 3FPZA 2WPCA 1LTXR 4OCGA 4A6NB 3RP8A 2GV8A 2QA1A 3DJEA 4TM4A 2BYBA 4NTCA 2W0HA 2YG5A 4B64A 5BRTA 2WDVA 3AD8B 1GERA 5GRTA 1F6MA 2PHHA 3C96A 3AE1A 5BULA 1E6EA 4EIQA 1KSSA 2WESA 3LADA 4A6NA 3AYLA 2XFUA 1ELIA 4TLXA 4DSHA 4USRA 4YXDA 1COYA 4H50A 1E7PA 1VG9A 2C72A 3CGCA 2FJDA 2YWLA 3NK2X 4O5QA 3I3LA 2AAQA 2JB2A 4B69A 1OJCA 1NPXA 5EB4A 1ZX9A 3NH3X 3SGLA 4H4YA 2Z5YA 4CCQA 2BS4A 1GALA 2CULA 3ATRA 4B66A 2X8GA 1IUSA 1E1KA 3ZDNA 4UDPA 3ABVA 4P9SA 2WPEA 2JBVA 4GDPA 4YSZA 3PVCA 3AYJA 1EL7A 3H8IA 1CC2A 1TDKA 1IUTA 1GRBA 2YLZA 3ADAB 2RABA 1UKVG 4UDRA 4GUVA 3EAOA 4BJZA 3EANA 2YLWA 1NG4A 3GDNA 1QLBA 4CCRA 2BXSA 3RP6A 1FEAA 1FL2A 1H86A 4H4VA 2YVFA 5L46A 4Y4NA 2GF3A 3QVPA 2BC1A 3AXBA 1XHCA 1K0LA 1VRQB 2OLNA 3CGEA 1OJ9A 4EM3A 3AEFA 4WX1A 4AP3A 4IVMB 1PJ7A 4EQSA 4TM3A 1BZLA 1VDCA 2E5VA 2C65A 2WU2A 2EQ7A 3M0OA 2EQ8A 4YWOA 1IUWA 4Z2TA 4NEWA 4EMIA 3OZ2A 4A65A 1GRTA 2R4JA 4OPIA 1H84A 1SEZA 5M0ZA 3KPFA 4DSGA 2NVKX 5JCLA 3GRSA 1NHSA 1NENA 1Z6LA 2C75A 2VVLA 4EQWA 1LV0A 4NZHA 5CKUA 5GSNA 4N9XA 1PXAA 4RSLA 1GETA 3NYCA 1D4DA 4H4QA 2OAMA 2O9ZA 3GSIA 3UCLA 2BS2A 3T37A 3V76A 1JU2A 1ZKQA 2YR6A 2F5ZA 3RHAA 3ITJA 3GDPA 4H4RA 3JSKA 2YG3A 2R0CA 4I59A 3NTAA 5J60A 1ZMCA 4U8KA 2FJEA 2B9YA 3GMCA 2XFQA 3DK8A 1PHHA 4H7UA 3S5WA 3F8PA 2XDOA 4MJWA 4ZCCA 2XVFA 4LA1A 4EMWA 5FS6A 2XCGA 4BK2A 1MO9A 3FG2P 1OJDA 1O5WA 2Y6RA 4ZN0A 4AOSA 2Y6QA 4ADWA 1ONFA 1XDIA 3NYFA 4YSHA 3P1WA 3NK0X 5KOXA 1JOAA 1KDGA 1H82A 3NIXA 1BGNA 1E1NA 1RYIA 1LQUA 2GMJA 1DOBA 2WDRA 4FK1C 2GRTA 3SQPA 1RSGA 2FJBA 2WEUA 3K30A 2BCPA 3IF9A 3LB8A 3AEEA 2BC0A 3QSSA 4IA5A 1QO8A 5HYMA 1EL9A 1VQWA 3AE8A 3P4QA 4YTPA 3DK4A 1CJ3A 2C7GA 2VVLG 3M13A 5U25A 5JCIA 4A99A 3CNJA 2A8XA 1CBOA 4KX6A 4J2WA 5JCKA 3BI2A 2YLTA 3LXDA 1X31B 3CPHG 1CC6A 2IVDA 3UP4A 1GT8A 3H8LA 3QFAA 1KSUA 4H4TA 3RNMA 2WP6A 1FECA 1TDFA 3VRBA 1DODA 2GR2A 2GQFA 4U8MA 4JNQA 4C77A 1DJNA 1GRGA 1GTHA 2EQ9A 2YVJA 4H4PA 2WU5A 2GAHB 3PS9A 4IVOB 2QAEA 4U8LA 2XLTA 4OPTA 2JB3A 4Z44A 2C66A 3CNSA 1S3BA 4B1BA 2AR8A 2XFNA 1H7XA 1L9EA 2YG4A 1PJ6A 3REDA 4H2PA 3CIRA 3LJPA 3GWFA 4U8PA 4OPLA 4CRTA 4CNKA 3NK1X 4Z26A 3NN6X 1EL8A 3AWIA 3DMEA 3F8RA 1TRBA 2BK3A 3KD9A 3EF6A 3KU9A 1PDHA 3S61A 5EB5A 1Q9IA 1IUVA 2ZZBA 4O5UA 4YSXA 1B4VA 1PBFA 3ALJA 2V5ZA 3NLCA 3ZYXA 3DK9A 3IHGA 2BCGG 4E0VA 2ZZCA 1V59A 1PXCA 4GCMA 5ER0A 5JCNA 3SFEA 5FS9A 1PXBA 3BI5A 3KVEA 3O0HA 5BUKA 4Z43A 1NDAA 4FX9A 2X3NA 2JK6A 3NN0X 3QSMA 1M64A 2WS3A 4ECHA 2WDQA 4GRTA 2B9XA 1H6VA 3CNDA 1KF6A 4Z2UA 3ALLA 2A87A 2B7RA 1OJAA 2VRLA 2H88A 1BKWA 2QA2A 1N4WA 3ISHA 4J33A 1JEHA 2C73A 2B7SA 2GMHA 4ZCDA 3P4RA 2GH5A 3GRTA 1BGJA 2YLXA 2X8CA 3GYJA 3NYEA 2OLOA 5DBJA 2J3NA 3DGHA 1JRYA 2VQBA 1LQTA 1NHQA 2C64A 2XLSA 4ICYA 5KXJA 3UKFA 3UKPA 3DJGX 4AT2A 3LZWA 2X99A 2H89A 4UP3A 3PO7A 1B5QA 2IVEA 1DOCA 3AD9B 2E1MA 3AE9A 1QJDA 2HQMA 3KA7A 4TLZA 3CPIG 3G5SA 4XWZA 4J56A 1CJ2A 4BK3A 2OA1A 4H2QA 4H4SA 4H4XA 2CFYA 2YM2A 3Q9TA 4Y4MA 2YR5A 1GNDA 2YR4A 4FK1A 3UKQA 4B67A 1HYUA 4Z2RA 3G5QA 4H2RA 5J7XA 3IWAA 4A9WA 4CBQA 1PN0A 2GB0A 4REKA 4AOXA 4WCTA 4JDRA 1EBDA 4DNAA 3UOYA 2WPFA 1D5TA 4U2TA 1ZK7A 3I6DA 2YG6A 3UTGA 1NEKA 1D4EA 3COXA 1FEBA 1ZMDA 3AE3A 4Y4LA 4C74A 3FMWA 5TR3A 3URHA 3C4AA 4IV9A 4X9NA 2XVEA 5IQ1A 1CJCA 2PYXA 2BACA 1CF3A 4BK1A 3FIMB 1S2YA 5U1OA 3BI4A 2XLPA 3HZLA 3UTHA 1GRHA 2V6OA 1P2EA 4GF7A 4YSYA 1IJHA 4XXGA 2GQWA 2C3CA 2TPRA 2XVJA 2Q7VA 1PBBA 1GPEA 1KFYA 1M6IA 2R45A 5FS8A 2WHDA 2YLRA 4GDEA 1MOKA 2XLRA 3AEBA 3UKAA 3NT6A 1BWCA 3CGBA 3CN8A 1YQ4A 1GRAA 3BNMA 2JB1A 4DGKA 3B3RA 3BNUA 5HXIA 2V3BA 1Q1WA 3Q6JA 1H83A 3L8KA 3GD3A 3K7QX 4U2SA 3SFDA 1NHPA 1CJ4A 5HY5A 3D8XA 5KWFA 3DH9A 2QCUA 1PBDA 3BHFA 2V60A 4YKGA 1YKJA 1F8WA 1N4VA 1JRXA 1Y56B 3ATQA 3LOVA 2APGA 2X50A 1H7WA 1L9CA 4U2LA 3UP5A 1L9DA 3VRDB 2AQJA 3AEAA 5FS7A 3II4A 2VVMA 2CVJA 1GTEA 4J34A 1E1LA 4U8NA 4H4ZA 1NHRA 3H4KA 4YT0A 1CC4A 2TMDA 2VZ2A 3F8DA 4TM1A 1TYTA 4C3YA 3AD7B 1TDOA 2JKCA 2ZBWA 1OJTA 4A79A 1YQ3A 3UKLA 4JN9A 3NKSA 1D4CA 4YTNA 4JY2A
chains in the Genus database with same CATH superfamily
2OQHA 3CAWA 2UZZA 4GR1A 2VRMA 4PAAA 3SJNA 5LV9A 2R9ZA 4H4WA 4YTMA 2VOUA 4TVWA 2R4EA 3UTFA 3MY9A 4X4JA 4JY3A 3SM8A 5KVHA 2OALA 3H8AA 2YG7A 2P8CA 2FBWA 1GREA 4H4UA 1D7LA 1PS9A 4GFIA 2Q0KA 4GAVA 3BJSA 4FP1A 5EOWA 1ZP0A 4EM4A 3EEZA 2W54A 3P4SA 5BVAA 1TE6A 1L8PA 2XYOA 2V61A 2VQ7A 1GESA 3AYIA 3T4WA 2BK4A 4RG4A 1DNCA 3NXLA 2FJAA 3CNPA 2O56A 2GVCA 1R0MA 4KPRA 2XVHA 1TDNA 4J31A 3VCNA 4A3RA 3NVZB 3STPA 3QJ4A 1GOSA 2NPXA 1TYPA 2AL1A 1DJQA 3D1CA 2AKMA 3NVWB 3M12A 3RP7A 1Y0PA 3ICRA 4LU6A 2P0IA 3NZGA 3AE6A 4B65A 3UJRA 3GC2A 3MZNA 3VC6A 3P4PA 4G73A 3HRDC 5FMHA 3R1ZA 1OEPA 3D46A 4B63A 3QSEA 2YQUA 2DKIA 1K0IA 3V5FA 3ICSA 2QDEA 3DERA 3V3NA 4A7AA 1X2GA 3WE0A 1GEUA 3VR8A 3OZYA 3K7TA 1F3PA 4J36A 1S3EA 2YVGA 3UCCA 4XWRA 2BABA 4H83A 2PTYA 1MUCA 3S47A 4G8TA 2WOWA 5FJPA 2WOVA 1NAAA 4I58A 4ZOHB 2RGHA 3A7UA 4YWSA 1K4QA 2PODA 4OCGA 4A6NB 2GV8A 4NTCA 2YG5A 3VFCA 5BRTA 1GERA 1F6MA 5FJRA 1KSSA 4ZCWA 4TLXA 3IJIA 4O5QA 2JB2A 4B69A 5EB4A 7ENLA 2CULA 4UDPA 2OVLA 3ABVA 2WPEA 4GDPA 4YSZA 3N6JA 1TDKA 3ADAB 2RABA 4K1WA 1NG4A 3GDNA 3RP6A 1FEAA 4H4VA 2YVFA 4Y4NA 3QVPA 1XHCA 1K0LA 1SJCA 3CGEA 2XH0A 4IVMB 1PJ7A 4EQSA 1BZLA 2C65A 2EQ8A 4NEWA 1X2HA 3RCYA 1H84A 3GRSA 2GL5A 5GSNA 1WYGA 2OFJA 4RSLA 2E5AA 3DG7A 4H4QA 2PTXA 3NFUA 1ZKQA 5EU9A 3GDPA 4H4RA 4U8KA 3GMCA 3ZVHA 4ZCCA 4LA1A 1MO9A 4Z1YA 1O5WA 2Y6RA 1ONFA 5KOXA 1JOAA 3DG3A 1RYIA 2GMJA 1RSGA 2XSXA 5KMRA 2BCPA 3IF9A 3PFRA 1ELSA 2PGWA 4IP4A 1E9IA 3T31A 1QO8A 1VQWA 3AE8A 3U4FA 2VVLG 3M13A 5U25A 5JCIA 3OPSA 2YLTA 1GT8A 3QFAA 4H4TA 5IDZA 2GQFA 2AKZA 2EQ9A 5KMPA 3PS9A 4IVOB 4U8LA 4OPTA 4B1BA 2AR8A 3REDA 4H2PA 4U8PA 4GYPC 3NK1X 2ONEA 3R25A 3DMEA 3EKGA 2MUCA 2W3SA 1PDHA 2OZTA 1ECQA 5EB5A 1KKOA 1Q9IA 3NLCA 3ZYXA 4GCMA 3BI5A 2JK6A 2OKTA 1M64A 2WS3A 4GRTA 3PWIA 2H88A 1KD0A 1BKWA 2C73A 2GMHA 2GH5A 3GRTA 2J3NA 3HPFA 1LQTA 5KMSA 3DJGX 3PO7A 1DOCA 2HQMA 3G5SA 4H4SA 4H4XA 3T9PA 3Q9TA 3N4EA 1GNDA 4FK1A 3UKQA 2QJJA 4H2RA 4A9WA 4REKA 4WCTA 3KUMA 3CYJA 2XH2A 3FXGA 3AE3A 5TR3A 2PPGA 4GMEA 4JN7A 3SR6B 3BI4A 3UTHA 1P2EA 2XVJA 3QTPA 3N4FA 3BNMA 3FCPA 3SY4A 3Q6JA 3S5SA 3DH9A 2QCUA 4YKGA 1F8WA 2APGA 2HXTA 2AQJA 3AEAA 5FS7A 4F4RA 3II4A 3V3WA 1GTEA 3QLDA 1E1LA 1CC4A 3HYWA 1WUEA 3F8DA 4A79A 3OW1A 1YQ3A 4JN9A 1D4CA 1JDFA 1ZY8A 4EMJA 4HA6A 5KRQA 1DXLA 4IP5A 4MKSA 3AEDA 3DGZA 1B37A 2PMQA 1MNSA 3TJ4A 4AP1A 1JNZA 3NGCX 1IUUA 3V3OA 4FDCB 3AE7A 1IYXA 5KVIA 4K5SA 2CHRA 4D03A 1ZOYA 3KLJA 2XLUA 4NTDA 4JNAA 4HNLA 3SN1A 2ARDA 3NG7X 2QGYA 3GWDA 4ROPA 1DOEA 2GSHA 4U8OA 1FFVC 4OPDA 1XS2A 4MMWA 3DJJA 1MRAA 2PP3A 2B9WA 1KCZA 5IPYA 3AB1A 3UKHA 3D47A 1ZOVA 4CNJA 1R6WA 1JRZA 3ICTA 2C3DA 4BURA 1LPFA 3QVRA 5CQFA 1GV4A 5FJOA 1EC9A 2GAGB 3JW7A 2GEWA 3FBSA 4A5LA 2DW7A 1RP0A 3C4NA 1BF3A 1F8SA 2GR1A 4Z25A 5IQ4A 4ZA0A 2JAEA 3L1RA 3AE5A 1DTNA 1CHUA 5C2TA 3TWBA 2C76A 4H2HA 1XPQA 5C3JA 1O94A 3NHOX 3FV9A 5HHFA 1H81A 3SXIA 2BK5A 2WETA 3CPJG 2B76A 1KNRA 1N4UA 2PP1A 2RDXA 1GXFA 3TW9A 2GDQA 4NEVA 3T6CA 4Z17A 1IUXA 1S2QA 3FPZA 3DJEA 4TM4A 3BSMA 2W0HA 3C96A 5BULA 3AE1A 2WESA 3LADA 5JRBA 1ELIA 4YXDA 4USRA 1JPMA 1COYA 4H50A 2YWLA 3NK2X 4EWJA 3THUA 1NPXA 3SGLA 2BS4A 3ATRA 3VC5A 3ZDNA 3R10A 3MQTA 2JBVA 3AYJA 3H8IA 1CC2A 2YLZA 1GRBA 3UXKA 1UKVG 3TJIA 4HN8A 3DESA 2GF3A 1EC8A 2OLNA 4AP3A 4TM3A 1PDYA 2WU2A 2EQ7A 1IUWA 2W55A 3T14A 4EMIA 3OZ2A 4A65A 1GRTA 1SEZA 5M0ZA 2NVKX 5JCLA 1Z6LA 3RITA 1NENA 2VVLA 5CKUA 1PXAA 3NYCA 1D4DA 2BS2A 1JU2A 2YR6A 3ITJA 2YG3A 3ZVHB 4G6GA 4K2SA 2XDOA 4M0XA 2XVFA 4E4UA 5FS6A 4BK2A 3FG2P 1OJDA 2Y6QA 1XDIA 3NK0X 3PK7A 4KWSA 1JPDX 2WEUA 3P3BA 3IJLA 3LB8A 3QSSA 4KPLA 5HYMA 1EL9A 3P4QA 4HYRA 2C7GA 1VQZA 3N6HA 2A8XA 1CBOA 5JCKA 3BI2A 1NELA 4DX3A 3CPHG 3RNMA 1TDFA 3CT2A 1DODA 4U8MA 4C77A 4JNQA 1GTHA 4H4PA 2GAHB 1JCTA 2QAEA 3DIPA 1S3BA 3H12A 2BRAA 3LJPA 3VCCA 4CRTA 2OG9A 3AWIA 4J3ZA 3OZMA 3NO1A 4JN8A 2ZZBA 3P93A 4YSXA 1B4VA 3UJSA 1PXCA 3PWGA 5JCNA 3ZVIA 5FS9A 1PXBA 4Z43A 1NDAA 3B97A 1N62C 4FI4A 2WDQA 1H6VA 4J1OA 2A87A 3TTEA 2GGJA 3P4RA 3GYJA 3NYEA 5DBJA 3L5OA 1JRYA 1EBHA 2XLSA 3JVAA 2PU0A 4AT2A 4UP3A 3KA7A 4TLZA 1XPYA 4BK3A 2CFYA 4Y4MA 2YR5A 2YR4A 3G5QA 5J7XA 3IWAA 2GB0A 3R0KA 2OQYA 2WPFA 1D5TA 1ZK7A 3UTGA 1FEBA 1ZMDA 4Y4LA 3FMWA 3UCDA 3URHA 4IV9A 4X9NA 2E3TA 2NQLA 5IQ1A 1CF3A 1TZZA 2PS2A 3HZLA 1GRHA 4GF7A 4YSYA 2GQWA 2TPRA 2Q7VA 1M6IA 2R45A 3Q4DA 5FS8A 2YLRA 3UKAA 3CN8A 2JB1A 3B3RA 3K7QX 3JZUA 3SFDA 1CJ4A 3PG6A 5KWFA 2XH7A 1ZXIC 1PBDA 2V60A 1H2IA 1N5XA 2HXUA 1H7WA 4U2LA 3UP5A 1L9DA 2VVMA 2CVJA 4J34A 4H4ZA 2TMDA 4H1ZA 3AD7B 2JKCA 1YEYA 4JHMA 5U63A 1FO4A 2C70A 4IL2A 3CGDA 3NTDA 3A7RA 1REOA 3AE2A 2ZZ0A 3VQRA 2I0ZA 4U8IA 3ALMA 2WBAA 4DYEA 2BRYA 4EQRA 3EPTA 2QDDA 3KKJA 4X9MA 4IZGA 2YLSA 4HCLA 2BA9A 2YAUA 1AOGA 3QKEA 3SZFA 5JCMA 3NNEA 1N5WC 4G74A 1FCDA 3K1GA 2XFPA 1P2HA 3U9IA 2WP5A 3UOZA 2OX4A 2MNRA 1KNPA 4E4FA 1PJ5A 3VR9A 1GSNA 3UOXA 4K5RA 2WQYA 2ACZA 4K22A 3FJ4A 1L0VA 3T2KA 1YY5A 2Q6UA 3SQSA 4NTEA 1SB3B 3VRAA 3CK5A 4BJYA 1YQZA 3G5RA 4B68A 4E6MA 3LZXA 5KOWA 1LJ1A 1K0JA 2P3ZA 2R0GA 4C5OA 3AE4A 2PTWA 2ZC8A 4HB9A 2PCEA 1XANA 2C4CA 3FYYA 3VDGA 1MXTA 2Z5XA 1VG0A 3DJDA 3OC4A 3UJFA 1NG3A 3GYXA 2R0PA 4PABA 4UDQA 2A89A 4OPUA 4J57A 3R9UA 1B8SA 3IHMA 4E5TA 4CY6A 2WPCA 1LTXR 3RP8A 1SJDA 2QA1A 4B64A 4II3A 5GRTA 2PHHA 1E6EA 4EIQA 3CXOA 3I6EA 3AYLA 2XFUA 3HW2A 2C72A 3ZLFA 3CGCA 1WUFA 1EC7A 2AAQA 1OJCA 1ZX9A 3NH3X 2XH4A 4H4YA 2Z5YA 1IUSA 4P9SA 3PVCA 1IUTA 3EAOA 2PU1A 3EANA 2YLWA 4CCRA 1FL2A 1SJAA 2BC1A 3SN0A 3AXBA 4KT2A 1VRQB 1OJ9A 3AEFA 4WX1A 1ONEA 1VDCA 3M0OA 2R4JA 3SYIA 2PP0A 4DSGA 3KPFA 3IK4A 1NHSA 2C75A 4GAPA 2OAMA 2O9ZA 3NVYB 2OLAA 3UCLA 3V76A 1ZMCA 2FJEA 3RRAA 3TWAA 2B9YA 3T2YA 4IL0A 1PHHA 3HYXA 3S5WA 1NU5A 4G7FA 2XCGA 3R11A 4AOSA 3P0WA 4ADWA 4YSHA 3NYFA 3P1WA 3NVVB 1KDGA 3NIXA 3DDMA 1E1NA 4FK1C 2GRTA 3SQPA 3TCSA 3DGBA 2FJBA 3AEEA 2BC0A 3KPKA 4IA5A 2XGZA 4YTPA 3DK4A 1CJ3A 3GD6A 4DXKA 3CNJA 4KX6A 1JRPA 3UP4A 3H8LA 1KSUA 2OZ8A 3ZLGA 1DJNA 1GRGA 2YVJA 2XLTA 3CNSA 2YG4A 1S7MA 4CNKA 3I4KA 3F8RA 1TRBA 2BK3A 3UXLA 3KU9A 1TKKA 1IUVA 4O5UA 3ALJA 3IHGA 3RR1A 2ZZCA 3SFEA 3O0HA 5BUKA 4FX9A 3NN0X 4ECHA 1KF6A 3ALLA 2POZA 1OJAA 2VRLA 2GGGA 2QA2A 1N4WA 4J33A 1STZA 4ZCDA 1BGJA 2X8CA 2OLOA 1N60C 3DGHA 2VQBA 1FIQB 2ZADA 3UKPA 2X99A 1B5QA 3AD9B 3DG6A 3AE9A 3CPIG 3I6TA 1CJ2A 2OA1A 4H2QA 3SZCA 2YM2A 4IHCA 1HYUA 4Z2RA 3SBFA 4AOXA 1F9CA 4JDRA 3UOYA 4U2TA 3AM9A 2YG6A 3FVDA 1D4EA 3CB3A 3COXA 4C74A 5BOEA 4IT1A 2FKPA 1CJCA 4DWDA 2BACA 4BK1A 3FIMB 1S2YA 5U1OA 1P43A 2XLPA 4M6UA 1IJHA 1PBBA 1GPEA 1KFYA 2WHDA 3NT6A 1BWCA 4DGKA 1YQ4A 3ES7A 2GGHA 2V3BA 4GIRA 5HXIA 4DN1A 4GYPA 4U2SA 1NHPA 2FYMA 2QVHA 3VA8A 3BHFA 1YKJA 3ATQA 1Y56B 3LOVA 2W3RA 5J04A 3HYVA 3RGTA 1NHRA 3H4KA 2VZ2A 1TYTA 1KN0A 2AL2A 4JY2A 5G5GB 3UTEA 2WOIA 3DA1A 4D04A 5G5HB 2EQ6A 3K7MX 2P8BA 3QFBA 2E4GA 1GRFA 3BHKA 3UKKA 4APNA 4HCDA 2GR0A 3TOYA 3GYIA 2IIDA 2BS3A 4U8JA 4HCHA 3QN3A 1PBCA 2OZ3A 3MKCA 2WP9A 1O95A 4OPGA 3NRZB 4H2NA 4K8DA 4A6GA 5M10A 3IC9A 1D7YA 4HPNA 4KEMA 2QJMA 2C67A 3GD4A 3AMZA 2PGEA 1MDRA 3P9UA 4X2PA 3CTYA 2X8HA 3TQPA 4EIPA 4RG3A 3MSYA 2GGEA 4USQA 4K2XA 1FHUA 4AT0A 1CL0A 1LVLA 2RGJA 1FFUC 3CNTA 5FJTA 4EQXA 4YKFA 4Z24A 4OPCA 2XFOA 4A35A 3AECA 1N61C 1TDEA 1FHVA 1V97A 4OVIA 3CXBA 3SX6A 3UGVA 3GMBA 2XVIA 2Q0LA 4CY8A 4C3XA 3V4BA 3T0KA 2YM1A 2RGOA 4M52A 4BV6A 2CDUA 4TM0A 1Q1RA 1FOHA 1F8RA 1PBEA 3B6DA 1BQGA 4H19A 1EL5A 3T2ZA 2BXRA 3NRNA 4G6HA 6ENLA 3E1TA 3H7VA 3H70A 3SSZA 5EBKA 3GO2A 2R46A 4LIIA 3R07C 1Y56A 2PTZA 3CMMA 1P48A 1N1PA 2GR3A 4IA6A 2P88A 3AEGA 3UOVA 1E39A 2DKHA 1E1MA 4HNCA 1ZDLA 2V3AA 4JQ9A 1JNRA 1W4XA 4K7ZA 3IJQA 2BYBA 2WDVA 3AD8B 3UJEA 4ENLA 4A6NA 4DSHA 3DFHA 1E7PA 1VG9A 2FJDA 4GGBA 3I3LA 1SJBA 3V5CA 4CCQA 4B66A 1GALA 1BKHA 2X8GA 1E1KA 1EL7A 4NNJA 4UDRA 4GUVA 4BJZA 2PA6A 5KNLA 1QLBA 2BXSA 1VDVA 1H86A 3ZLHA 5L46A 2QJNA 2DW6A 3OTRA 4EM3A 2E5VA 4YWOA 4Z2TA 4OPIA 4NZHA 4EQWA 1LV0A 3BOXA 4N9XA 1N63C 1GETA 3GSIA 3GY1A 3T37A 2F5ZA 3RHAA 3D9XA 2I5QA 3JSKA 2R0CA 4I59A 3NTAA 5J60A 3MWCA 5ENLA 2XFQA 3DK8A 4H7UA 3F8PA 4MJWA 3EUB3 3R0UA 4EMWA 3B9JB 4ZN0A 4DHGA 1EBGA 1H82A 3DEQA 1BGNA 1LQUA 2WDRA 1DOBA 1W6TA 3K30A 2QQ6A 5KMQA 3NS1B 5FJUA 4A99A 4J2WA 4GGHA 3LXDA 1X31B 2IVDA 1CC6A 3UJ2A 2WP6A 1FECA 3VRBA 2GR2A 2OO6A 2WU5A 3ENLA 2JB3A 4Z44A 2C66A 2XFNA 1H7XA 1L9EA 1PJ6A 3CIRA 3ETRB 3GWFA 4OPLA 4Z26A 3NN6X 1EL8A 3KD9A 3EF6A 3A7AA 3S61A 3AN1A 1PBFA 3DFYA 2HZGA 2V5ZA 3DK9A 4E0VA 2BCGG 1V59A 5ER0A 4GISA 3KVEA 1T3QC 2X3NA 4NWZA 3QSMA 2B9XA 3CNDA 3MUCA 4Z2UA 2B7RA 1JROA 3ISHA 1JEHA 2B7SA 2YLXA 1NHQA 2C64A 4MGGA 4ICYA 5KXJA 3UKFA 3LZWA 2H89A 1MDLA 2IVEA 2E1MA 1QJDA 2GGIA 4XWZA 4J56A 4TVYA 4B67A 3SN4A 4CBQA 1PN0A 2HNEA 1EBDA 4DNAA 3I6DA 1NEKA 4K8GA 3SZWA 3C4AA 2XVEA 2PYXA 1RM6B 5BOFA 4G9KA 4E8GA 2V6OA 4XXGA 2C3CA 3T8QA 3RO6A 3OP2A 3Q45A 4GDEA 1MOKA 2XLRA 3AEBA 3QPEA 3ES8A 3CGBA 1GRAA 3BNUA 1Q1WA 2PSNA 1H83A 3L8KA 2OPJA 3SZ0A 3GD3A 5HY5A 3D8XA 1N4VA 1JRXA 2X50A 1L9CA 3VRDB 1RVKA 2AL2B 4II2A 4U8NA 4YT0A 4TM1A 4C3YA 1TDOA 2ZBWA 1OJTA 3UKLA 3NKSA 1PDZA 4YTNA 1KKRA
chains in the Genus database with same CATH topology
2UZZA 4GR1A 3UTEA 1ZY8A 2WOIA 2VRMA 3DA1A 4PAAA 5U63A 4D04A 5LV9A 2EQ6A 2R9ZA 2C70A 3K7MX 4H4WA 4YTMA 3CGDA 4EMJA 2VOUA 3QFBA 2E4GA 2R4EA 1GRFA 3NTDA 4HA6A 3UTFA 3BHKA 4X4JA 3UKKA 4APNA 4JY3A 5KRQA 3SM8A 5KVHA 1REOA 3AE2A 1DXLA 2GR0A 2OALA 2ZZ0A 3VQRA 2I0ZA 3AEDA 4U8IA 3GYIA 3DGZA 2IIDA 2BS3A 4U8JA 1B37A 3ALMA 2YG7A 2WBAA 2FBWA 1GREA 4H4UA 1PBCA 1D7LA 4AP1A 1JNZA 2WP9A 1O95A 1PS9A 4OPGA 2BRYA 4H2NA 4K8DA 2Q0KA 4GAVA 5M10A 4EQRA 3EPTA 3KKJA 5EOWA 3IC9A 1D7YA 4X9MA 3NGCX 1IUUA 1ZP0A 3V3OA 4FDCB 2C67A 3AE7A 3GD4A 4EM4A 5BVAA 3P4SA 5KVIA 4K5SA 2YLSA 3P9UA 4D03A 1ZOYA 2YAUA 2BA9A 2XYOA 2V61A 2VQ7A 1GESA 3KLJA 3CTYA 2XLUA 1AOGA 3AYIA 4NTDA 4JNAA 3SZFA 2X8HA 4EIPA 5JCMA 4RG3A 3NNEA 2BK4A 2ARDA 3NG7X 4G74A 4RG4A 4USQA 1DNCA 1FCDA 4K2XA 2XFPA 1P2HA 3GWDA 4AT0A 2WP5A 1CL0A 3UOZA 1LVLA 2RGJA 1DOEA 4U8OA 2FJAA 3CNPA 2GVCA 1KNPA 3CNTA 1PJ5A 4KPRA 2XVHA 1TDNA 4J31A 4OPDA 3VR9A 1GSNA 4EQXA 3UOXA 3DJJA 4YKFA 4K5RA 4Z24A 4OPCA 2WQYA 3QJ4A 2ACZA 2XFOA 3AECA 4K22A 1GOSA 1TDEA 1L0VA 2NPXA 1TYPA 2B9WA 1DJQA 3D1CA 3T2KA 3AB1A 3UKHA 5IPYA 1ZOVA 4CNJA 1YY5A 1JRZA 2Q6UA 3M12A 4OVIA 3SX6A 3RP7A 3ICTA 2C3DA 1Y0PA 3GMBA 3ICRA 2XVIA 4NTEA 3VRAA 2Q0LA 4BURA 1LPFA 3QVRA 5CQFA 4CY8A 4LU6A 4C3XA 4BJYA 1GV4A 3T0KA 2YM1A 1YQZA 3G5RA 2RGOA 4M52A 3AE6A 4B65A 4B68A 3LZXA 5KOWA 1LJ1A 1K0JA 2GAGB 4BV6A 2CDUA 2R0GA 4TM0A 1Q1RA 1FOHA 1F8RA 2GEWA 3P4PA 4C5OA 1PBEA 3B6DA 3AE4A 4G73A 3FBSA 1EL5A 5FMHA 3T2ZA 4A5LA 1RP0A 2BXRA 3NRNA 4G6HA 3C4NA 1BF3A 4HB9A 4B63A 3E1TA 2YQUA 1F8SA 3QSEA 2DKIA 1XANA 2GR1A 2C4CA 4Z25A 1MXTA 1K0IA 2JAEA 2Z5XA 1VG0A 3L1RA 3ICSA 5IQ4A 3DJDA 3OC4A 5EBKA 3AE5A 3V3NA 4A7AA 3WE0A 1GEUA 2R46A 3VR8A 3K7TA 1NG3A 1F3PA 1CHUA 4LIIA 5C2TA 4J36A 1Y56A 1S3EA 2YVGA 3CMMA 2C76A 1XPQA 1N1PA 4XWRA 2BABA 3GYXA 5C3JA 2GR3A 1O94A 2R0PA 3NHOX 4IA6A 4PABA 4UDQA 2A89A 4OPUA 1H81A 3AEGA 5HHFA 4J57A 3SXIA 3UOVA 1E39A 3R9UA 2BK5A 2WETA 2WOWA 2DKHA 2WOVA 3CPJG 2B76A 1E1MA 1KNRA 1B8SA 1N4UA 1ZDLA 1NAAA 2V3AA 1GXFA 4JQ9A 4I58A 3IHMA 4NEVA 2RGHA 1IUXA 1JNRA 1W4XA 4K7ZA 4CY6A 1K4QA 1S2QA 3FPZA 2WPCA 1LTXR 4OCGA 4A6NB 3RP8A 2GV8A 2QA1A 3DJEA 4TM4A 2BYBA 4NTCA 2W0HA 2YG5A 4B64A 5BRTA 4II3A 2WDVA 3AD8B 1GERA 5GRTA 1F6MA 2PHHA 3C96A 3AE1A 5BULA 1E6EA 4EIQA 1KSSA 2WESA 3LADA 4A6NA 5JRBA 3AYLA 2XFUA 1ELIA 4TLXA 4DSHA 4USRA 4YXDA 1COYA 4H50A 1E7PA 1VG9A 2C72A 3CGCA 2FJDA 2YWLA 3NK2X 4O5QA 3I3LA 2AAQA 2JB2A 4B69A 1OJCA 1NPXA 5EB4A 1ZX9A 3NH3X 3SGLA 4H4YA 2Z5YA 4CCQA 2BS4A 1GALA 2CULA 3ATRA 4B66A 2X8GA 1IUSA 1E1KA 3ZDNA 4UDPA 3ABVA 4P9SA 2WPEA 2JBVA 4GDPA 4YSZA 3PVCA 3AYJA 1EL7A 3H8IA 1CC2A 1TDKA 1IUTA 1GRBA 2YLZA 3ADAB 2RABA 4NNJA 1UKVG 4UDRA 4GUVA 3EAOA 4BJZA 3EANA 2YLWA 5KNLA 1NG4A 3GDNA 1QLBA 4CCRA 2BXSA 3RP6A 1FEAA 1FL2A 1H86A 4H4VA 2YVFA 5L46A 4Y4NA 2GF3A 3QVPA 2BC1A 3AXBA 1XHCA 1K0LA 1VRQB 2OLNA 3CGEA 1OJ9A 4EM3A 3AEFA 4WX1A 4AP3A 4IVMB 1PJ7A 4EQSA 4TM3A 1BZLA 1VDCA 2E5VA 2C65A 2WU2A 2EQ7A 3M0OA 2EQ8A 4YWOA 1IUWA 4Z2TA 3T14A 4NEWA 4EMIA 3OZ2A 4A65A 1GRTA 2R4JA 4OPIA 3SYIA 1H84A 1SEZA 5M0ZA 3KPFA 4DSGA 2NVKX 5JCLA 3GRSA 1NHSA 1NENA 1Z6LA 2C75A 2VVLA 4EQWA 1LV0A 4NZHA 5CKUA 5GSNA 4N9XA 1PXAA 4RSLA 1GETA 4GAPA 3NYCA 1D4DA 4H4QA 2OAMA 2O9ZA 3GSIA 3UCLA 2BS2A 3T37A 3V76A 1JU2A 1ZKQA 2YR6A 2F5ZA 3RHAA 3ITJA 3D9XA 3GDPA 4H4RA 3JSKA 2YG3A 2R0CA 4I59A 3NTAA 5J60A 1ZMCA 4U8KA 2FJEA 2B9YA 3GMCA 3T2YA 4G6GA 2XFQA 3DK8A 1PHHA 3HYXA 4H7UA 3S5WA 3F8PA 2XDOA 4MJWA 4ZCCA 2XVFA 4LA1A 4EMWA 5FS6A 2XCGA 4BK2A 1MO9A 3FG2P 1OJDA 1O5WA 2Y6RA 4ZN0A 4AOSA 2Y6QA 4ADWA 1ONFA 1XDIA 3NYFA 4YSHA 3P1WA 3NK0X 5KOXA 1JOAA 1KDGA 1H82A 3NIXA 1BGNA 1E1NA 1RYIA 1LQUA 2GMJA 1DOBA 2WDRA 4FK1C 2GRTA 3SQPA 1RSGA 2FJBA 2WEUA 5KMRA 3K30A 2BCPA 3IF9A 3LB8A 3AEEA 2BC0A 3QSSA 3KPKA 4IA5A 5KMQA 3T31A 1QO8A 5HYMA 1EL9A 1VQWA 3AE8A 3P4QA 4YTPA 3DK4A 1CJ3A 2C7GA 2VVLG 3M13A 5U25A 5JCIA 4A99A 3CNJA 2A8XA 1CBOA 4KX6A 4J2WA 5JCKA 3BI2A 2YLTA 3LXDA 1X31B 3CPHG 1CC6A 2IVDA 3UP4A 1GT8A 3H8LA 3QFAA 1KSUA 4H4TA 3RNMA 2WP6A 1FECA 1TDFA 3VRBA 1DODA 2GR2A 2GQFA 4U8MA 4JNQA 4C77A 1DJNA 1GRGA 1GTHA 2EQ9A 2YVJA 5KMPA 4H4PA 2WU5A 2GAHB 3PS9A 4IVOB 2QAEA 4U8LA 2XLTA 4OPTA 2JB3A 4Z44A 2C66A 3CNSA 1S3BA 4B1BA 2AR8A 2XFNA 1H7XA 1L9EA 2YG4A 1PJ6A 3REDA 4H2PA 2BRAA 3CIRA 3LJPA 1S7MA 3GWFA 4U8PA 4OPLA 4CRTA 4CNKA 3NK1X 4Z26A 3NN6X 1EL8A 3AWIA 3DMEA 3F8RA 1TRBA 2BK3A 3KD9A 3EF6A 3KU9A 1PDHA 3S61A 5EB5A 1Q9IA 1IUVA 2ZZBA 4O5UA 4YSXA 1B4VA 1PBFA 3ALJA 2V5ZA 3NLCA 3ZYXA 3DK9A 3IHGA 2BCGG 4E0VA 2ZZCA 1V59A 1PXCA 4GCMA 5ER0A 5JCNA 3SFEA 5FS9A 1PXBA 3BI5A 3KVEA 3O0HA 5BUKA 4Z43A 1NDAA 4FX9A 2X3NA 2JK6A 3NN0X 3QSMA 4NWZA 1M64A 2WS3A 4ECHA 2WDQA 4GRTA 2B9XA 1H6VA 3CNDA 1KF6A 4Z2UA 3ALLA 2A87A 2B7RA 1OJAA 2VRLA 2H88A 1BKWA 2QA2A 1N4WA 3ISHA 4J33A 1JEHA 2C73A 2B7SA 2GMHA 4ZCDA 3P4RA 2GH5A 3GRTA 1BGJA 2YLXA 2X8CA 3GYJA 3NYEA 2OLOA 5DBJA 2J3NA 3L5OA 3DGHA 1JRYA 2VQBA 1LQTA 1NHQA 2C64A 2XLSA 4ICYA 5KXJA 3UKFA 3UKPA 5KMSA 3DJGX 4AT2A 3LZWA 2X99A 2H89A 4UP3A 3PO7A 1B5QA 2IVEA 1DOCA 3AD9B 2E1MA 3AE9A 1QJDA 2HQMA 3KA7A 4TLZA 3CPIG 3G5SA 4XWZA 4J56A 1CJ2A 4BK3A 2OA1A 4H2QA 4H4SA 4H4XA 2CFYA 3SZCA 2YM2A 3Q9TA 4Y4MA 2YR5A 1GNDA 2YR4A 4FK1A 3UKQA 4B67A 1HYUA 4Z2RA 3G5QA 4H2RA 5J7XA 3IWAA 4A9WA 4CBQA 1PN0A 2GB0A 4REKA 4AOXA 4WCTA 4JDRA 1EBDA 4DNAA 3UOYA 2WPFA 1D5TA 4U2TA 1ZK7A 3I6DA 2YG6A 3UTGA 1NEKA 1D4EA 3COXA 1FEBA 1ZMDA 3AE3A 4Y4LA 4C74A 3FMWA 3SZWA 5TR3A 3URHA 3C4AA 4IV9A 4X9NA 2XVEA 5IQ1A 1CJCA 2PYXA 2BACA 1CF3A 4BK1A 3FIMB 1S2YA 4G9KA 5U1OA 3BI4A 2XLPA 3HZLA 3UTHA 1GRHA 2V6OA 1P2EA 4GF7A 4YSYA 1IJHA 4XXGA 2GQWA 2C3CA 2TPRA 2XVJA 2Q7VA 1PBBA 1GPEA 1KFYA 1M6IA 2R45A 5FS8A 2WHDA 2YLRA 4GDEA 1MOKA 2XLRA 3AEBA 3UKAA 3NT6A 1BWCA 3CGBA 3CN8A 1YQ4A 1GRAA 3BNMA 2JB1A 4DGKA 3SY4A 3B3RA 3BNUA 5HXIA 2V3BA 1Q1WA 3Q6JA 1H83A 3L8KA 3SZ0A 3GD3A 3K7QX 4U2SA 3SFDA 1NHPA 1CJ4A 5HY5A 3D8XA 3PG6A 5KWFA 3DH9A 2QCUA 1PBDA 3BHFA 2V60A 4YKGA 1H2IA 1F8WA 1YKJA 1N4VA 1JRXA 1Y56B 3ATQA 3LOVA 2APGA 2X50A 1H7WA 1L9CA 4U2LA 3UP5A 1L9DA 3VRDB 2AQJA 3AEAA 5FS7A 3HYVA 3II4A 2VVMA 2CVJA 1GTEA 4II2A 4J34A 1E1LA 4U8NA 4H4ZA 1NHRA 3H4KA 4YT0A 1CC4A 2TMDA 2VZ2A 3HYWA 3F8DA 4TM1A 1TYTA 4C3YA 3AD7B 1TDOA 2JKCA 1KN0A 2ZBWA 1OJTA 4A79A 1YQ3A 3UKLA 4JN9A 3NKSA 1D4CA 4YTNA 4JY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZZ A;  4GR1 A;  3UTE A;  1ZY8 A;  2WOI A;  2VRM A;  3DA1 A;  4PAA A;  5U63 A;  4D04 A;  5LV9 A;  2EQ6 A;  2R9Z A;  2C70 A;  3K7M X;  4H4W A;  4YTM A;  3CGD A;  4EMJ A;  2VOU A;  3QFB A;  2E4G A;  2R4E A;  1GRF A;  3NTD A;  4HA6 A;  3UTF A;  3BHK A;  4X4J A;  3UKK A;  4APN A;  4JY3 A;  5KRQ A;  3SM8 A;  5KVH A;  1REO A;  3AE2 A;  1DXL A;  2GR0 A;  2OAL A;  2ZZ0 A;  3VQR A;  2I0Z A;  3AED A;  4U8I A;  3GYI A;  3DGZ A;  2IID A;  2BS3 A;  4U8J A;  1B37 A;  3ALM A;  2YG7 A;  2WBA A;  2FBW A;  1GRE A;  4H4U A;  1PBC A;  1D7L A;  4AP1 A;  1JNZ A;  2WP9 A;  1O95 A;  1PS9 A;  4OPG A;  4H2N A;  4K8D A;  2Q0K A;  5M10 A;  4EQR A;  3EPT A;  3KKJ A;  5EOW A;  3IC9 A;  1D7Y A;  4X9M A;  3NGC X;  1IUU A;  1ZP0 A;  3V3O A;  4FDC B;  2C67 A;  3AE7 A;  3GD4 A;  4EM4 A;  5BVA A;  3P4S A;  5KVI A;  4K5S A;  2YLS A;  3P9U A;  4D03 A;  1ZOY A;  2YAU A;  2BA9 A;  2XYO A;  2V61 A;  2VQ7 A;  1GES A;  3KLJ A;  3CTY A;  2XLU A;  1AOG A;  3AYI A;  4NTD A;  4JNA A;  2X8H A;  4EIP A;  5JCM A;  4RG3 A;  3NNE A;  2BK4 A;  2ARD A;  3NG7 X;  4RG4 A;  4USQ A;  1DNC A;  1FCD A;  4K2X A;  2XFP A;  1P2H A;  3GWD A;  4AT0 A;  2WP5 A;  1CL0 A;  3UOZ A;  1LVL A;  2RGJ A;  1DOE A;  4U8O A;  2FJA A;  3CNP A;  2GVC A;  1KNP A;  3CNT A;  1PJ5 A;  4KPR A;  2XVH A;  1TDN A;  4J31 A;  4OPD A;  3VR9 A;  1GSN A;  4EQX A;  3UOX A;  3DJJ A;  4YKF A;  4K5R A;  4Z24 A;  4OPC A;  2WQY A;  3QJ4 A;  2ACZ A;  2XFO A;  3AEC A;  4K22 A;  1GOS A;  1TDE A;  1L0V A;  2NPX A;  1TYP A;  2B9W A;  1DJQ A;  3D1C A;  5IPY A;  3AB1 A;  3UKH A;  1ZOV A;  4CNJ A;  1YY5 A;  1JRZ A;  2Q6U A;  3M12 A;  4OVI A;  3RP7 A;  3ICT A;  2C3D A;  1Y0P A;  3GMB A;  3ICR A;  2XVI A;  4NTE A;  3VRA A;  2Q0L A;  4BUR A;  1LPF A;  3QVR A;  5CQF A;  4CY8 A;  4LU6 A;  4C3X A;  4BJY A;  1GV4 A;  2YM1 A;  1YQZ A;  3G5R A;  2RGO A;  4M52 A;  3AE6 A;  4B65 A;  4B68 A;  3LZX A;  5KOW A;  1LJ1 A;  1K0J A;  2GAG B;  4BV6 A;  2CDU A;  2R0G A;  4TM0 A;  1Q1R A;  1FOH A;  1F8R A;  2GEW A;  3P4P A;  4C5O A;  1PBE A;  3B6D A;  3AE4 A;  3FBS A;  1EL5 A;  5FMH A;  4A5L A;  1RP0 A;  2BXR A;  3NRN A;  3C4N A;  1BF3 A;  4HB9 A;  4B63 A;  3E1T A;  2YQU A;  1F8S A;  3QSE A;  2DKI A;  1XAN A;  2GR1 A;  4Z25 A;  1MXT A;  1K0I A;  2JAE A;  2Z5X A;  1VG0 A;  3L1R A;  3ICS A;  5IQ4 A;  3DJD A;  3OC4 A;  5EBK A;  3AE5 A;  3V3N A;  4A7A A;  3WE0 A;  1GEU A;  2R46 A;  3VR8 A;  3K7T A;  1NG3 A;  1F3P A;  1CHU A;  4LII A;  5C2T A;  4J36 A;  1Y56 A;  1S3E A;  2YVG A;  2C76 A;  1XPQ A;  1N1P A;  4XWR A;  2BAB A;  5C3J A;  2GR3 A;  1O94 A;  2R0P A;  3NHO X;  4IA6 A;  4PAB A;  4UDQ A;  2A89 A;  4OPU A;  1H81 A;  3AEG A;  5HHF A;  4J57 A;  3UOV A;  1E39 A;  3R9U A;  2BK5 A;  2WET A;  2WOW A;  2DKH A;  2WOV A;  3CPJ G;  2B76 A;  1E1M A;  1KNR A;  1B8S A;  1N4U A;  1ZDL A;  1NAA A;  2V3A A;  1GXF A;  4JQ9 A;  4I58 A;  3IHM A;  4NEV A;  2RGH A;  1IUX A;  1JNR A;  1W4X A;  4K7Z A;  4CY6 A;  1K4Q A;  1S2Q A;  3FPZ A;  2WPC A;  1LTX R;  4OCG A;  4A6N B;  3RP8 A;  2GV8 A;  2QA1 A;  3DJE A;  4TM4 A;  2BYB A;  4NTC A;  2W0H A;  2YG5 A;  4B64 A;  5BRT A;  2WDV A;  3AD8 B;  1GER A;  5GRT A;  1F6M A;  2PHH A;  3C96 A;  3AE1 A;  5BUL A;  1E6E A;  4EIQ A;  1KSS A;  2WES A;  3LAD A;  4A6N A;  3AYL A;  2XFU A;  1ELI A;  4TLX A;  4DSH A;  4USR A;  4YXD A;  1COY A;  4H50 A;  1E7P A;  1VG9 A;  2C72 A;  3CGC A;  2FJD A;  2YWL A;  3NK2 X;  4O5Q A;  3I3L A;  2AAQ A;  2JB2 A;  4B69 A;  1OJC A;  1NPX A;  5EB4 A;  1ZX9 A;  3NH3 X;  3SGL A;  4H4Y A;  2Z5Y A;  4CCQ A;  2BS4 A;  1GAL A;  2CUL A;  3ATR A;  4B66 A;  2X8G A;  1IUS A;  1E1K A;  3ZDN A;  4UDP A;  3ABV A;  4P9S A;  2WPE A;  2JBV A;  4GDP A;  4YSZ A;  3PVC A;  3AYJ A;  1EL7 A;  3H8I A;  1CC2 A;  1TDK A;  1IUT A;  1GRB A;  2YLZ A;  3ADA B;  2RAB A;  1UKV G;  4UDR A;  4GUV A;  3EAO A;  4BJZ A;  3EAN A;  2YLW A;  1NG4 A;  3GDN A;  1QLB A;  4CCR A;  2BXS A;  3RP6 A;  1FEA A;  1FL2 A;  1H86 A;  4H4V A;  2YVF A;  5L46 A;  4Y4N A;  2GF3 A;  3QVP A;  2BC1 A;  3AXB A;  1XHC A;  1K0L A;  1VRQ B;  2OLN A;  3CGE A;  1OJ9 A;  4EM3 A;  3AEF A;  4WX1 A;  4AP3 A;  4IVM B;  1PJ7 A;  4EQS A;  4TM3 A;  1BZL A;  1VDC A;  2E5V A;  2C65 A;  2WU2 A;  2EQ7 A;  3M0O A;  2EQ8 A;  4YWO A;  1IUW A;  4Z2T A;  4NEW A;  4EMI A;  3OZ2 A;  4A65 A;  1GRT A;  2R4J A;  4OPI A;  1H84 A;  1SEZ A;  5M0Z A;  3KPF A;  4DSG A;  2NVK X;  5JCL A;  3GRS A;  1NHS A;  1NEN A;  1Z6L A;  2C75 A;  2VVL A;  4EQW A;  1LV0 A;  4NZH A;  5CKU A;  5GSN A;  4N9X A;  1PXA A;  4RSL A;  1GET A;  3NYC A;  1D4D A;  4H4Q A;  2OAM A;  2O9Z A;  3GSI A;  3UCL A;  2BS2 A;  3T37 A;  3V76 A;  1JU2 A;  1ZKQ A;  2YR6 A;  2F5Z A;  3RHA A;  3ITJ A;  3GDP A;  4H4R A;  3JSK A;  2YG3 A;  2R0C A;  4I59 A;  3NTA A;  5J60 A;  1ZMC A;  4U8K A;  2FJE A;  2B9Y A;  3GMC A;  2XFQ A;  3DK8 A;  1PHH A;  4H7U A;  3S5W A;  3F8P A;  2XDO A;  4MJW A;  4ZCC A;  2XVF A;  4LA1 A;  4EMW A;  5FS6 A;  2XCG A;  4BK2 A;  1MO9 A;  3FG2 P;  1OJD A;  1O5W A;  2Y6R A;  4ZN0 A;  4AOS A;  2Y6Q A;  4ADW A;  1ONF A;  1XDI A;  3NYF A;  4YSH A;  3P1W A;  3NK0 X;  5KOX A;  1JOA A;  1KDG A;  1H82 A;  3NIX A;  1BGN A;  1E1N A;  1RYI A;  1LQU A;  2GMJ A;  1DOB A;  2WDR A;  4FK1 C;  2GRT A;  3SQP A;  1RSG A;  2FJB A;  2WEU A;  3K30 A;  2BCP A;  3IF9 A;  3LB8 A;  3AEE A;  2BC0 A;  3QSS A;  4IA5 A;  1QO8 A;  5HYM A;  1EL9 A;  1VQW A;  3AE8 A;  3P4Q A;  4YTP A;  3DK4 A;  1CJ3 A;  2C7G A;  2VVL G;  3M13 A;  5U25 A;  5JCI A;  4A99 A;  3CNJ A;  2A8X A;  1CBO A;  4KX6 A;  4J2W A;  5JCK A;  3BI2 A;  2YLT A;  3LXD A;  1X31 B;  3CPH G;  1CC6 A;  2IVD A;  3UP4 A;  1GT8 A;  3H8L A;  3QFA A;  1KSU A;  4H4T A;  3RNM A;  2WP6 A;  1FEC A;  1TDF A;  3VRB A;  1DOD A;  2GR2 A;  2GQF A;  4U8M A;  4JNQ A;  4C77 A;  1DJN A;  1GRG A;  1GTH A;  2EQ9 A;  2YVJ A;  4H4P A;  2WU5 A;  2GAH B;  3PS9 A;  4IVO B;  2QAE A;  4U8L A;  2XLT A;  4OPT A;  2JB3 A;  4Z44 A;  2C66 A;  3CNS A;  1S3B A;  4B1B A;  2AR8 A;  2XFN A;  1H7X A;  1L9E A;  2YG4 A;  1PJ6 A;  3RED A;  4H2P A;  3CIR A;  3LJP A;  3GWF A;  4U8P A;  4OPL A;  4CRT A;  4CNK A;  3NK1 X;  4Z26 A;  3NN6 X;  1EL8 A;  3AWI A;  3DME A;  3F8R A;  1TRB A;  2BK3 A;  3KD9 A;  3EF6 A;  3KU9 A;  1PDH A;  3S61 A;  5EB5 A;  1Q9I A;  1IUV A;  2ZZB A;  4O5U A;  4YSX A;  1B4V A;  1PBF A;  3ALJ A;  2V5Z A;  3NLC A;  3ZYX A;  3DK9 A;  3IHG A;  2BCG G;  4E0V A;  2ZZC A;  1V59 A;  1PXC A;  4GCM A;  5ER0 A;  5JCN A;  3SFE A;  5FS9 A;  1PXB A;  3BI5 A;  3KVE A;  3O0H A;  5BUK A;  4Z43 A;  1NDA A;  4FX9 A;  2X3N A;  2JK6 A;  3NN0 X;  3QSM A;  1M64 A;  2WS3 A;  4ECH A;  2WDQ A;  4GRT A;  2B9X A;  1H6V A;  3CND A;  1KF6 A;  4Z2U A;  3ALL A;  2A87 A;  2B7R A;  1OJA A;  2VRL A;  2H88 A;  1BKW A;  2QA2 A;  1N4W A;  3ISH A;  4J33 A;  1JEH A;  2C73 A;  2B7S A;  2GMH A;  4ZCD A;  3P4R A;  2GH5 A;  3GRT A;  1BGJ A;  2YLX A;  2X8C A;  3GYJ A;  3NYE A;  2OLO A;  5DBJ A;  2J3N A;  3DGH A;  1JRY A;  2VQB A;  1LQT A;  1NHQ A;  2C64 A;  2XLS A;  4ICY A;  5KXJ A;  3UKF A;  3UKP A;  3DJG X;  4AT2 A;  3LZW A;  2X99 A;  2H89 A;  4UP3 A;  3PO7 A;  1B5Q A;  2IVE A;  1DOC A;  3AD9 B;  2E1M A;  3AE9 A;  1QJD A;  2HQM A;  3KA7 A;  4TLZ A;  3CPI G;  3G5S A;  4XWZ A;  4J56 A;  1CJ2 A;  4BK3 A;  2OA1 A;  4H2Q A;  4H4S A;  4H4X A;  2CFY A;  2YM2 A;  3Q9T A;  4Y4M A;  2YR5 A;  1GND A;  2YR4 A;  4FK1 A;  3UKQ A;  4B67 A;  1HYU A;  4Z2R A;  3G5Q A;  4H2R A;  5J7X A;  3IWA A;  4A9W A;  4CBQ A;  1PN0 A;  2GB0 A;  4REK A;  4AOX A;  4WCT A;  4JDR A;  1EBD A;  4DNA A;  3UOY A;  2WPF A;  1D5T A;  4U2T A;  1ZK7 A;  3I6D A;  2YG6 A;  3UTG A;  1NEK A;  1D4E A;  3COX A;  1FEB A;  1ZMD A;  3AE3 A;  4Y4L A;  4C74 A;  3FMW A;  5TR3 A;  3URH A;  3C4A A;  4IV9 A;  4X9N A;  2XVE A;  5IQ1 A;  1CJC A;  2PYX A;  2BAC A;  1CF3 A;  4BK1 A;  3FIM B;  1S2Y A;  5U1O A;  3BI4 A;  2XLP A;  3HZL A;  3UTH A;  1GRH A;  2V6O A;  1P2E A;  4GF7 A;  4YSY A;  1IJH A;  4XXG A;  2GQW A;  2C3C A;  2TPR A;  2XVJ A;  2Q7V A;  1PBB A;  1GPE A;  1KFY A;  1M6I A;  2R45 A;  5FS8 A;  2WHD A;  2YLR A;  4GDE A;  1MOK A;  2XLR A;  3AEB A;  3UKA A;  3NT6 A;  1BWC A;  3CGB A;  3CN8 A;  1YQ4 A;  1GRA A;  3BNM A;  2JB1 A;  4DGK A;  3B3R A;  3BNU A;  5HXI A;  2V3B A;  1Q1W A;  3Q6J A;  1H83 A;  3L8K A;  3GD3 A;  3K7Q X;  4U2S A;  3SFD A;  1NHP A;  1CJ4 A;  5HY5 A;  3D8X A;  5KWF A;  3DH9 A;  2QCU A;  1PBD A;  3BHF A;  2V60 A;  4YKG A;  1YKJ A;  1F8W A;  1N4V A;  1JRX A;  1Y56 B;  3ATQ A;  3LOV A;  2APG A;  2X50 A;  1H7W A;  1L9C A;  4U2L A;  3UP5 A;  1L9D A;  3VRD B;  2AQJ A;  3AEA A;  5FS7 A;  3II4 A;  2VVM A;  2CVJ A;  1GTE A;  4J34 A;  1E1L A;  4U8N A;  4H4Z A;  1NHR A;  3H4K A;  4YT0 A;  1CC4 A;  2TMD A;  2VZ2 A;  3F8D A;  4TM1 A;  1TYT A;  4C3Y A;  3AD7 B;  1TDO A;  2JKC A;  2ZBW A;  1OJT A;  4A79 A;  1YQ3 A;  3UKL A;  4JN9 A;  3NKS A;  1D4C A;  4YTN A;  4JY2 A; 
#chains in the Genus database with same CATH topology
 2OQH A;  3CAW A;  2UZZ A;  4GR1 A;  2VRM A;  4PAA A;  3SJN A;  5LV9 A;  2R9Z A;  4H4W A;  4YTM A;  2VOU A;  4TVW A;  2R4E A;  3UTF A;  3MY9 A;  4X4J A;  4JY3 A;  3SM8 A;  5KVH A;  2OAL A;  3H8A A;  2YG7 A;  2P8C A;  2FBW A;  1GRE A;  4H4U A;  1D7L A;  1PS9 A;  4GFI A;  2Q0K A;  4GAV A;  3BJS A;  4FP1 A;  5EOW A;  1ZP0 A;  4EM4 A;  3EEZ A;  2W54 A;  3P4S A;  5BVA A;  1TE6 A;  1L8P A;  2XYO A;  2V61 A;  2VQ7 A;  1GES A;  3AYI A;  3T4W A;  2BK4 A;  4RG4 A;  1DNC A;  3NXL A;  2FJA A;  3CNP A;  2O56 A;  2GVC A;  1R0M A;  4KPR A;  2XVH A;  1TDN A;  4J31 A;  3VCN A;  4A3R A;  3NVZ B;  3STP A;  3QJ4 A;  1GOS A;  2NPX A;  1TYP A;  2AL1 A;  1DJQ A;  3D1C A;  2AKM A;  3NVW B;  3M12 A;  3RP7 A;  1Y0P A;  3ICR A;  4LU6 A;  2P0I A;  3NZG A;  3AE6 A;  4B65 A;  3UJR A;  3GC2 A;  3MZN A;  3VC6 A;  3P4P A;  4G73 A;  3HRD C;  5FMH A;  3R1Z A;  1OEP A;  3D46 A;  4B63 A;  3QSE A;  2YQU A;  2DKI A;  1K0I A;  3V5F A;  3ICS A;  2QDE A;  3DER A;  3V3N A;  4A7A A;  1X2G A;  3WE0 A;  1GEU A;  3VR8 A;  3OZY A;  3K7T A;  1F3P A;  4J36 A;  1S3E A;  2YVG A;  3UCC A;  4XWR A;  2BAB A;  4H83 A;  2PTY A;  1MUC A;  3S47 A;  4G8T A;  2WOW A;  5FJP A;  2WOV A;  1NAA A;  4I58 A;  4ZOH B;  2RGH A;  3A7U A;  4YWS A;  1K4Q A;  2POD A;  4OCG A;  4A6N B;  2GV8 A;  4NTC A;  2YG5 A;  3VFC A;  5BRT A;  1GER A;  1F6M A;  5FJR A;  1KSS A;  4ZCW A;  4TLX A;  3IJI A;  4O5Q A;  2JB2 A;  4B69 A;  5EB4 A;  7ENL A;  2CUL A;  4UDP A;  2OVL A;  3ABV A;  2WPE A;  4GDP A;  4YSZ A;  3N6J A;  1TDK A;  3ADA B;  2RAB A;  4K1W A;  1NG4 A;  3GDN A;  3RP6 A;  1FEA A;  4H4V A;  2YVF A;  4Y4N A;  3QVP A;  1XHC A;  1K0L A;  1SJC A;  3CGE A;  2XH0 A;  4IVM B;  1PJ7 A;  4EQS A;  1BZL A;  2C65 A;  2EQ8 A;  4NEW A;  1X2H A;  3RCY A;  1H84 A;  3GRS A;  2GL5 A;  5GSN A;  1WYG A;  2OFJ A;  4RSL A;  2E5A A;  3DG7 A;  4H4Q A;  2PTX A;  3NFU A;  1ZKQ A;  5EU9 A;  3GDP A;  4H4R A;  4U8K A;  3GMC A;  3ZVH A;  4ZCC A;  4LA1 A;  1MO9 A;  4Z1Y A;  1O5W A;  2Y6R A;  1ONF A;  5KOX A;  1JOA A;  3DG3 A;  1RYI A;  2GMJ A;  1RSG A;  2XSX A;  5KMR A;  2BCP A;  3IF9 A;  3PFR A;  1ELS A;  2PGW A;  4IP4 A;  1E9I A;  3T31 A;  1QO8 A;  1VQW A;  3AE8 A;  3U4F A;  2VVL G;  3M13 A;  5U25 A;  5JCI A;  3OPS A;  2YLT A;  1GT8 A;  3QFA A;  4H4T A;  5IDZ A;  2GQF A;  2AKZ A;  2EQ9 A;  5KMP A;  3PS9 A;  4IVO B;  4U8L A;  4OPT A;  4B1B A;  2AR8 A;  3RED A;  4H2P A;  4U8P A;  4GYP C;  3NK1 X;  2ONE A;  3R25 A;  3DME A;  3EKG A;  2MUC A;  2W3S A;  1PDH A;  2OZT A;  1ECQ A;  5EB5 A;  1KKO A;  1Q9I A;  3NLC A;  3ZYX A;  4GCM A;  3BI5 A;  2JK6 A;  2OKT A;  1M64 A;  2WS3 A;  4GRT A;  3PWI A;  2H88 A;  1KD0 A;  1BKW A;  2C73 A;  2GMH A;  2GH5 A;  3GRT A;  2J3N A;  3HPF A;  1LQT A;  5KMS A;  3DJG X;  3PO7 A;  1DOC A;  2HQM A;  3G5S A;  4H4S A;  4H4X A;  3T9P A;  3Q9T A;  3N4E A;  1GND A;  4FK1 A;  3UKQ A;  2QJJ A;  4H2R A;  4A9W A;  4REK A;  4WCT A;  3KUM A;  3CYJ A;  2XH2 A;  3FXG A;  3AE3 A;  5TR3 A;  2PPG A;  4GME A;  4JN7 A;  3SR6 B;  3BI4 A;  3UTH A;  1P2E A;  2XVJ A;  3QTP A;  3N4F A;  3BNM A;  3FCP A;  3SY4 A;  3Q6J A;  3S5S A;  3DH9 A;  2QCU A;  4YKG A;  1F8W A;  2APG A;  2HXT A;  2AQJ A;  3AEA A;  5FS7 A;  4F4R A;  3II4 A;  3V3W A;  1GTE A;  3QLD A;  1E1L A;  1CC4 A;  3HYW A;  1WUE A;  3F8D A;  4A79 A;  3OW1 A;  1YQ3 A;  4JN9 A;  1D4C A;  1JDF A;  1ZY8 A;  4EMJ A;  4HA6 A;  5KRQ A;  1DXL A;  4IP5 A;  4MKS A;  3AED A;  3DGZ A;  1B37 A;  2PMQ A;  1MNS A;  3TJ4 A;  4AP1 A;  1JNZ A;  3NGC X;  1IUU A;  3V3O A;  4FDC B;  3AE7 A;  1IYX A;  5KVI A;  4K5S A;  2CHR A;  4D03 A;  1ZOY A;  3KLJ A;  2XLU A;  4NTD A;  4JNA A;  4HNL A;  3SN1 A;  2ARD A;  3NG7 X;  2QGY A;  3GWD A;  4ROP A;  1DOE A;  2GSH A;  4U8O A;  1FFV C;  4OPD A;  1XS2 A;  4MMW A;  3DJJ A;  1MRA A;  2PP3 A;  2B9W A;  1KCZ A;  5IPY A;  3AB1 A;  3UKH A;  3D47 A;  1ZOV A;  4CNJ A;  1R6W A;  1JRZ A;  3ICT A;  2C3D A;  4BUR A;  1LPF A;  3QVR A;  5CQF A;  1GV4 A;  5FJO A;  1EC9 A;  2GAG B;  3JW7 A;  2GEW A;  3FBS A;  4A5L A;  2DW7 A;  1RP0 A;  3C4N A;  1BF3 A;  1F8S A;  2GR1 A;  4Z25 A;  5IQ4 A;  4ZA0 A;  2JAE A;  3L1R A;  3AE5 A;  1DTN A;  1CHU A;  5C2T A;  3TWB A;  2C76 A;  4H2H A;  1XPQ A;  5C3J A;  1O94 A;  3NHO X;  3FV9 A;  5HHF A;  1H81 A;  3SXI A;  2BK5 A;  2WET A;  3CPJ G;  2B76 A;  1KNR A;  1N4U A;  2PP1 A;  2RDX A;  1GXF A;  3TW9 A;  2GDQ A;  4NEV A;  3T6C A;  4Z17 A;  1IUX A;  1S2Q A;  3FPZ A;  3DJE A;  4TM4 A;  3BSM A;  2W0H A;  3C96 A;  5BUL A;  3AE1 A;  2WES A;  3LAD A;  5JRB A;  1ELI A;  4YXD A;  4USR A;  1JPM A;  1COY A;  4H50 A;  2YWL A;  3NK2 X;  4EWJ A;  3THU A;  1NPX A;  3SGL A;  2BS4 A;  3ATR A;  3VC5 A;  3ZDN A;  3R10 A;  3MQT A;  2JBV A;  3AYJ A;  3H8I A;  1CC2 A;  2YLZ A;  1GRB A;  3UXK A;  1UKV G;  3TJI A;  4HN8 A;  3DES A;  2GF3 A;  1EC8 A;  2OLN A;  4AP3 A;  4TM3 A;  1PDY A;  2WU2 A;  2EQ7 A;  1IUW A;  2W55 A;  3T14 A;  4EMI A;  3OZ2 A;  4A65 A;  1GRT A;  1SEZ A;  5M0Z A;  2NVK X;  5JCL A;  1Z6L A;  3RIT A;  1NEN A;  2VVL A;  5CKU A;  1PXA A;  3NYC A;  1D4D A;  2BS2 A;  1JU2 A;  2YR6 A;  3ITJ A;  2YG3 A;  3ZVH B;  4G6G A;  4K2S A;  2XDO A;  4M0X A;  2XVF A;  4E4U A;  5FS6 A;  4BK2 A;  3FG2 P;  1OJD A;  2Y6Q A;  1XDI A;  3NK0 X;  3PK7 A;  4KWS A;  1JPD X;  2WEU A;  3P3B A;  3IJL A;  3LB8 A;  3QSS A;  4KPL A;  5HYM A;  1EL9 A;  3P4Q A;  4HYR A;  2C7G A;  1VQZ A;  3N6H A;  2A8X A;  1CBO A;  5JCK A;  3BI2 A;  1NEL A;  4DX3 A;  3CPH G;  3RNM A;  1TDF A;  3CT2 A;  1DOD A;  4U8M A;  4C77 A;  4JNQ A;  1GTH A;  4H4P A;  2GAH B;  1JCT A;  2QAE A;  3DIP A;  1S3B A;  3H12 A;  2BRA A;  3LJP A;  3VCC A;  4CRT A;  2OG9 A;  3AWI A;  4J3Z A;  3OZM A;  3NO1 A;  4JN8 A;  2ZZB A;  3P93 A;  4YSX A;  1B4V A;  3UJS A;  1PXC A;  3PWG A;  5JCN A;  3ZVI A;  5FS9 A;  1PXB A;  4Z43 A;  1NDA A;  3B97 A;  1N62 C;  4FI4 A;  2WDQ A;  1H6V A;  4J1O A;  2A87 A;  3TTE A;  2GGJ A;  3P4R A;  3GYJ A;  3NYE A;  5DBJ A;  3L5O A;  1JRY A;  1EBH A;  2XLS A;  3JVA A;  2PU0 A;  4AT2 A;  4UP3 A;  3KA7 A;  4TLZ A;  1XPY A;  4BK3 A;  2CFY A;  4Y4M A;  2YR5 A;  2YR4 A;  3G5Q A;  5J7X A;  3IWA A;  2GB0 A;  3R0K A;  2OQY A;  2WPF A;  1D5T A;  1ZK7 A;  3UTG A;  1FEB A;  1ZMD A;  4Y4L A;  3FMW A;  3UCD A;  3URH A;  4IV9 A;  4X9N A;  2E3T A;  2NQL A;  5IQ1 A;  1CF3 A;  1TZZ A;  2PS2 A;  3HZL A;  1GRH A;  4GF7 A;  4YSY A;  2GQW A;  2TPR A;  2Q7V A;  1M6I A;  2R45 A;  3Q4D A;  5FS8 A;  2YLR A;  3UKA A;  3CN8 A;  2JB1 A;  3B3R A;  3K7Q X;  3JZU A;  3SFD A;  1CJ4 A;  3PG6 A;  5KWF A;  2XH7 A;  1ZXI C;  1PBD A;  2V60 A;  1H2I A;  1N5X A;  2HXU A;  1H7W A;  4U2L A;  3UP5 A;  1L9D A;  2VVM A;  2CVJ A;  4J34 A;  4H4Z A;  2TMD A;  4H1Z A;  3AD7 B;  2JKC A;  1YEY A;  4JHM A;  5U63 A;  1FO4 A;  2C70 A;  4IL2 A;  3CGD A;  3NTD A;  3A7R A;  1REO A;  3AE2 A;  2ZZ0 A;  3VQR A;  2I0Z A;  4U8I A;  3ALM A;  2WBA A;  4DYE A;  2BRY A;  4EQR A;  3EPT A;  2QDD A;  3KKJ A;  4X9M A;  4IZG A;  2YLS A;  4HCL A;  2BA9 A;  2YAU A;  1AOG A;  3QKE A;  3SZF A;  5JCM A;  3NNE A;  1N5W C;  4G74 A;  1FCD A;  3K1G A;  2XFP A;  1P2H A;  3U9I A;  2WP5 A;  3UOZ A;  2OX4 A;  2MNR A;  1KNP A;  4E4F A;  1PJ5 A;  3VR9 A;  1GSN A;  3UOX A;  4K5R A;  2WQY A;  2ACZ A;  4K22 A;  3FJ4 A;  1L0V A;  3T2K A;  1YY5 A;  2Q6U A;  3SQS A;  4NTE A;  1SB3 B;  3VRA A;  3CK5 A;  4BJY A;  1YQZ A;  3G5R A;  4B68 A;  4E6M A;  3LZX A;  5KOW A;  1LJ1 A;  1K0J A;  2P3Z A;  2R0G A;  4C5O A;  3AE4 A;  2PTW A;  2ZC8 A;  4HB9 A;  2PCE A;  1XAN A;  2C4C A;  3FYY A;  3VDG A;  1MXT A;  2Z5X A;  1VG0 A;  3DJD A;  3OC4 A;  3UJF A;  1NG3 A;  3GYX A;  2R0P A;  4PAB A;  4UDQ A;  2A89 A;  4OPU A;  4J57 A;  3R9U A;  1B8S A;  3IHM A;  4E5T A;  4CY6 A;  2WPC A;  1LTX R;  3RP8 A;  1SJD A;  2QA1 A;  4B64 A;  4II3 A;  5GRT A;  2PHH A;  1E6E A;  4EIQ A;  3CXO A;  3I6E A;  3AYL A;  2XFU A;  3HW2 A;  2C72 A;  3ZLF A;  3CGC A;  1WUF A;  1EC7 A;  2AAQ A;  1OJC A;  1ZX9 A;  3NH3 X;  2XH4 A;  4H4Y A;  2Z5Y A;  1IUS A;  4P9S A;  3PVC A;  1IUT A;  3EAO A;  2PU1 A;  3EAN A;  2YLW A;  4CCR A;  1FL2 A;  1SJA A;  2BC1 A;  3SN0 A;  3AXB A;  4KT2 A;  1VRQ B;  1OJ9 A;  3AEF A;  4WX1 A;  1ONE A;  1VDC A;  3M0O A;  2R4J A;  3SYI A;  2PP0 A;  4DSG A;  3KPF A;  3IK4 A;  1NHS A;  2C75 A;  4GAP A;  2OAM A;  2O9Z A;  3NVY B;  2OLA A;  3UCL A;  3V76 A;  1ZMC A;  2FJE A;  3RRA A;  3TWA A;  2B9Y A;  3T2Y A;  4IL0 A;  1PHH A;  3HYX A;  3S5W A;  1NU5 A;  4G7F A;  2XCG A;  3R11 A;  4AOS A;  3P0W A;  4ADW A;  4YSH A;  3NYF A;  3P1W A;  3NVV B;  1KDG A;  3NIX A;  3DDM A;  1E1N A;  4FK1 C;  2GRT A;  3SQP A;  3TCS A;  3DGB A;  2FJB A;  3AEE A;  2BC0 A;  3KPK A;  4IA5 A;  2XGZ A;  4YTP A;  3DK4 A;  1CJ3 A;  3GD6 A;  4DXK A;  3CNJ A;  4KX6 A;  1JRP A;  3UP4 A;  3H8L A;  1KSU A;  2OZ8 A;  3ZLG A;  1DJN A;  1GRG A;  2YVJ A;  2XLT A;  3CNS A;  2YG4 A;  1S7M A;  4CNK A;  3I4K A;  3F8R A;  1TRB A;  2BK3 A;  3UXL A;  3KU9 A;  1TKK A;  1IUV A;  4O5U A;  3ALJ A;  3IHG A;  3RR1 A;  2ZZC A;  3SFE A;  3O0H A;  5BUK A;  4FX9 A;  3NN0 X;  4ECH A;  1KF6 A;  3ALL A;  2POZ A;  1OJA A;  2VRL A;  2GGG A;  2QA2 A;  1N4W A;  4J33 A;  1STZ A;  4ZCD A;  1BGJ A;  2X8C A;  2OLO A;  1N60 C;  3DGH A;  2VQB A;  1FIQ B;  2ZAD A;  3UKP A;  2X99 A;  1B5Q A;  3AD9 B;  3DG6 A;  3AE9 A;  3CPI G;  3I6T A;  1CJ2 A;  2OA1 A;  4H2Q A;  3SZC A;  2YM2 A;  4IHC A;  1HYU A;  4Z2R A;  3SBF A;  4AOX A;  1F9C A;  4JDR A;  3UOY A;  4U2T A;  3AM9 A;  2YG6 A;  3FVD A;  1D4E A;  3CB3 A;  3COX A;  4C74 A;  5BOE A;  4IT1 A;  2FKP A;  1CJC A;  4DWD A;  2BAC A;  4BK1 A;  3FIM B;  1S2Y A;  5U1O A;  1P43 A;  2XLP A;  4M6U A;  1IJH A;  1PBB A;  1GPE A;  1KFY A;  2WHD A;  3NT6 A;  1BWC A;  4DGK A;  1YQ4 A;  3ES7 A;  2GGH A;  2V3B A;  4GIR A;  5HXI A;  4DN1 A;  4GYP A;  4U2S A;  1NHP A;  2FYM A;  2QVH A;  3VA8 A;  3BHF A;  1YKJ A;  3ATQ A;  1Y56 B;  3LOV A;  2W3R A;  5J04 A;  3HYV A;  3RGT A;  1NHR A;  3H4K A;  2VZ2 A;  1TYT A;  1KN0 A;  2AL2 A;  4JY2 A;  5G5G B;  3UTE A;  2WOI A;  3DA1 A;  4D04 A;  5G5H B;  2EQ6 A;  3K7M X;  2P8B A;  3QFB A;  2E4G A;  1GRF A;  3BHK A;  3UKK A;  4APN A;  4HCD A;  2GR0 A;  3TOY A;  3GYI A;  2IID A;  2BS3 A;  4U8J A;  4HCH A;  3QN3 A;  1PBC A;  2OZ3 A;  3MKC A;  2WP9 A;  1O95 A;  4OPG A;  3NRZ B;  4H2N A;  4K8D A;  4A6G A;  5M10 A;  3IC9 A;  1D7Y A;  4HPN A;  4KEM A;  2QJM A;  2C67 A;  3GD4 A;  3AMZ A;  2PGE A;  1MDR A;  3P9U A;  4X2P A;  3CTY A;  2X8H A;  3TQP A;  4EIP A;  4RG3 A;  3MSY A;  2GGE A;  4USQ A;  4K2X A;  1FHU A;  4AT0 A;  1CL0 A;  1LVL A;  2RGJ A;  1FFU C;  3CNT A;  5FJT A;  4EQX A;  4YKF A;  4Z24 A;  4OPC A;  2XFO A;  4A35 A;  3AEC A;  1N61 C;  1TDE A;  1FHV A;  1V97 A;  4OVI A;  3CXB A;  3SX6 A;  3UGV A;  3GMB A;  2XVI A;  2Q0L A;  4CY8 A;  4C3X A;  3V4B A;  3T0K A;  2YM1 A;  2RGO A;  4M52 A;  4BV6 A;  2CDU A;  4TM0 A;  1Q1R A;  1FOH A;  1F8R A;  1PBE A;  3B6D A;  1BQG A;  4H19 A;  1EL5 A;  3T2Z A;  2BXR A;  3NRN A;  4G6H A;  6ENL A;  3E1T A;  3H7V A;  3H70 A;  3SSZ A;  5EBK A;  3GO2 A;  2R46 A;  4LII A;  3R07 C;  1Y56 A;  2PTZ A;  3CMM A;  1P48 A;  1N1P A;  2GR3 A;  4IA6 A;  2P88 A;  3AEG A;  3UOV A;  1E39 A;  2DKH A;  1E1M A;  4HNC A;  1ZDL A;  2V3A A;  4JQ9 A;  1JNR A;  1W4X A;  4K7Z A;  3IJQ A;  2BYB A;  2WDV A;  3AD8 B;  3UJE A;  4ENL A;  4A6N A;  4DSH A;  3DFH A;  1E7P A;  1VG9 A;  2FJD A;  4GGB A;  3I3L A;  1SJB A;  3V5C A;  4CCQ A;  4B66 A;  1GAL A;  1BKH A;  2X8G A;  1E1K A;  1EL7 A;  4NNJ A;  4UDR A;  4GUV A;  4BJZ A;  2PA6 A;  5KNL A;  1QLB A;  2BXS A;  1VDV A;  1H86 A;  3ZLH A;  5L46 A;  2QJN A;  2DW6 A;  3OTR A;  4EM3 A;  2E5V A;  4YWO A;  4Z2T A;  4OPI A;  4NZH A;  4EQW A;  1LV0 A;  3BOX A;  4N9X A;  1N63 C;  1GET A;  3GSI A;  3GY1 A;  3T37 A;  2F5Z A;  3RHA A;  3D9X A;  2I5Q A;  3JSK A;  2R0C A;  4I59 A;  3NTA A;  5J60 A;  3MWC A;  5ENL A;  2XFQ A;  3DK8 A;  4H7U A;  3F8P A;  4MJW A;  3EUB 3;  3R0U A;  4EMW A;  3B9J B;  4ZN0 A;  4DHG A;  1EBG A;  1H82 A;  3DEQ A;  1BGN A;  1LQU A;  2WDR A;  1DOB A;  1W6T A;  3K30 A;  2QQ6 A;  5KMQ A;  3NS1 B;  5FJU A;  4A99 A;  4J2W A;  4GGH A;  3LXD A;  1X31 B;  2IVD A;  1CC6 A;  3UJ2 A;  2WP6 A;  1FEC A;  3VRB A;  2GR2 A;  2OO6 A;  2WU5 A;  3ENL A;  2JB3 A;  4Z44 A;  2C66 A;  2XFN A;  1H7X A;  1L9E A;  1PJ6 A;  3CIR A;  3ETR B;  3GWF A;  4OPL A;  4Z26 A;  3NN6 X;  1EL8 A;  3KD9 A;  3EF6 A;  3A7A A;  3S61 A;  3AN1 A;  1PBF A;  3DFY A;  2HZG A;  2V5Z A;  3DK9 A;  4E0V A;  2BCG G;  1V59 A;  5ER0 A;  4GIS A;  3KVE A;  1T3Q C;  2X3N A;  4NWZ A;  3QSM A;  2B9X A;  3CND A;  3MUC A;  4Z2U A;  2B7R A;  1JRO A;  3ISH A;  1JEH A;  2B7S A;  2YLX A;  1NHQ A;  2C64 A;  4MGG A;  4ICY A;  5KXJ A;  3UKF A;  3LZW A;  2H89 A;  1MDL A;  2IVE A;  2E1M A;  1QJD A;  2GGI A;  4XWZ A;  4J56 A;  4TVY A;  4B67 A;  3SN4 A;  4CBQ A;  1PN0 A;  2HNE A;  1EBD A;  4DNA A;  3I6D A;  1NEK A;  4K8G A;  3SZW A;  3C4A A;  2XVE A;  2PYX A;  1RM6 B;  5BOF A;  4G9K A;  4E8G A;  2V6O A;  4XXG A;  2C3C A;  3T8Q A;  3RO6 A;  3OP2 A;  3Q45 A;  4GDE A;  1MOK A;  2XLR A;  3AEB A;  3QPE A;  3ES8 A;  3CGB A;  1GRA A;  3BNU A;  1Q1W A;  2PSN A;  1H83 A;  3L8K A;  2OPJ A;  3SZ0 A;  3GD3 A;  5HY5 A;  3D8X A;  1N4V A;  1JRX A;  2X50 A;  1L9C A;  3VRD B;  1RVK A;  2AL2 B;  4II2 A;  4U8N A;  4YT0 A;  4TM1 A;  4C3Y A;  1TDO A;  2ZBW A;  1OJT A;  3UKL A;  3NKS A;  1PDZ A;  4YTN A;  1KKR A; 
#chains in the Genus database with same CATH homology
 2UZZ A;  4GR1 A;  3UTE A;  1ZY8 A;  2WOI A;  2VRM A;  3DA1 A;  4PAA A;  5U63 A;  4D04 A;  5LV9 A;  2EQ6 A;  2R9Z A;  2C70 A;  3K7M X;  4H4W A;  4YTM A;  3CGD A;  4EMJ A;  2VOU A;  3QFB A;  2E4G A;  2R4E A;  1GRF A;  3NTD A;  4HA6 A;  3UTF A;  3BHK A;  4X4J A;  3UKK A;  4APN A;  4JY3 A;  5KRQ A;  3SM8 A;  5KVH A;  1REO A;  3AE2 A;  1DXL A;  2GR0 A;  2OAL A;  2ZZ0 A;  3VQR A;  2I0Z A;  3AED A;  4U8I A;  3GYI A;  3DGZ A;  2IID A;  2BS3 A;  4U8J A;  1B37 A;  3ALM A;  2YG7 A;  2WBA A;  2FBW A;  1GRE A;  4H4U A;  1PBC A;  1D7L A;  4AP1 A;  1JNZ A;  2WP9 A;  1O95 A;  1PS9 A;  4OPG A;  2BRY A;  4H2N A;  4K8D A;  2Q0K A;  4GAV A;  5M10 A;  4EQR A;  3EPT A;  3KKJ A;  5EOW A;  3IC9 A;  1D7Y A;  4X9M A;  3NGC X;  1IUU A;  1ZP0 A;  3V3O A;  4FDC B;  2C67 A;  3AE7 A;  3GD4 A;  4EM4 A;  5BVA A;  3P4S A;  5KVI A;  4K5S A;  2YLS A;  3P9U A;  4D03 A;  1ZOY A;  2YAU A;  2BA9 A;  2XYO A;  2V61 A;  2VQ7 A;  1GES A;  3KLJ A;  3CTY A;  2XLU A;  1AOG A;  3AYI A;  4NTD A;  4JNA A;  3SZF A;  2X8H A;  4EIP A;  5JCM A;  4RG3 A;  3NNE A;  2BK4 A;  2ARD A;  3NG7 X;  4G74 A;  4RG4 A;  4USQ A;  1DNC A;  1FCD A;  4K2X A;  2XFP A;  1P2H A;  3GWD A;  4AT0 A;  2WP5 A;  1CL0 A;  3UOZ A;  1LVL A;  2RGJ A;  1DOE A;  4U8O A;  2FJA A;  3CNP A;  2GVC A;  1KNP A;  3CNT A;  1PJ5 A;  4KPR A;  2XVH A;  1TDN A;  4J31 A;  4OPD A;  3VR9 A;  1GSN A;  4EQX A;  3UOX A;  3DJJ A;  4YKF A;  4K5R A;  4Z24 A;  4OPC A;  2WQY A;  3QJ4 A;  2ACZ A;  2XFO A;  3AEC A;  4K22 A;  1GOS A;  1TDE A;  1L0V A;  2NPX A;  1TYP A;  2B9W A;  1DJQ A;  3D1C A;  3T2K A;  3AB1 A;  3UKH A;  5IPY A;  1ZOV A;  4CNJ A;  1YY5 A;  1JRZ A;  2Q6U A;  3M12 A;  4OVI A;  3SX6 A;  3RP7 A;  3ICT A;  2C3D A;  1Y0P A;  3GMB A;  3ICR A;  2XVI A;  4NTE A;  3VRA A;  2Q0L A;  4BUR A;  1LPF A;  3QVR A;  5CQF A;  4CY8 A;  4LU6 A;  4C3X A;  4BJY A;  1GV4 A;  3T0K A;  2YM1 A;  1YQZ A;  3G5R A;  2RGO A;  4M52 A;  3AE6 A;  4B65 A;  4B68 A;  3LZX A;  5KOW A;  1LJ1 A;  1K0J A;  2GAG B;  4BV6 A;  2CDU A;  2R0G A;  4TM0 A;  1Q1R A;  1FOH A;  1F8R A;  2GEW A;  3P4P A;  4C5O A;  1PBE A;  3B6D A;  3AE4 A;  4G73 A;  3FBS A;  1EL5 A;  5FMH A;  3T2Z A;  4A5L A;  1RP0 A;  2BXR A;  3NRN A;  4G6H A;  3C4N A;  1BF3 A;  4HB9 A;  4B63 A;  3E1T A;  2YQU A;  1F8S A;  3QSE A;  2DKI A;  1XAN A;  2GR1 A;  2C4C A;  4Z25 A;  1MXT A;  1K0I A;  2JAE A;  2Z5X A;  1VG0 A;  3L1R A;  3ICS A;  5IQ4 A;  3DJD A;  3OC4 A;  5EBK A;  3AE5 A;  3V3N A;  4A7A A;  3WE0 A;  1GEU A;  2R46 A;  3VR8 A;  3K7T A;  1NG3 A;  1F3P A;  1CHU A;  4LII A;  5C2T A;  4J36 A;  1Y56 A;  1S3E A;  2YVG A;  3CMM A;  2C76 A;  1XPQ A;  1N1P A;  4XWR A;  2BAB A;  3GYX A;  5C3J A;  2GR3 A;  1O94 A;  2R0P A;  3NHO X;  4IA6 A;  4PAB A;  4UDQ A;  2A89 A;  4OPU A;  1H81 A;  3AEG A;  5HHF A;  4J57 A;  3SXI A;  3UOV A;  1E39 A;  3R9U A;  2BK5 A;  2WET A;  2WOW A;  2DKH A;  2WOV A;  3CPJ G;  2B76 A;  1E1M A;  1KNR A;  1B8S A;  1N4U A;  1ZDL A;  1NAA A;  2V3A A;  1GXF A;  4JQ9 A;  4I58 A;  3IHM A;  4NEV A;  2RGH A;  1IUX A;  1JNR A;  1W4X A;  4K7Z A;  4CY6 A;  1K4Q A;  1S2Q A;  3FPZ A;  2WPC A;  1LTX R;  4OCG A;  4A6N B;  3RP8 A;  2GV8 A;  2QA1 A;  3DJE A;  4TM4 A;  2BYB A;  4NTC A;  2W0H A;  2YG5 A;  4B64 A;  5BRT A;  4II3 A;  2WDV A;  3AD8 B;  1GER A;  5GRT A;  1F6M A;  2PHH A;  3C96 A;  3AE1 A;  5BUL A;  1E6E A;  4EIQ A;  1KSS A;  2WES A;  3LAD A;  4A6N A;  5JRB A;  3AYL A;  2XFU A;  1ELI A;  4TLX A;  4DSH A;  4USR A;  4YXD A;  1COY A;  4H50 A;  1E7P A;  1VG9 A;  2C72 A;  3CGC A;  2FJD A;  2YWL A;  3NK2 X;  4O5Q A;  3I3L A;  2AAQ A;  2JB2 A;  4B69 A;  1OJC A;  1NPX A;  5EB4 A;  1ZX9 A;  3NH3 X;  3SGL A;  4H4Y A;  2Z5Y A;  4CCQ A;  2BS4 A;  1GAL A;  2CUL A;  3ATR A;  4B66 A;  2X8G A;  1IUS A;  1E1K A;  3ZDN A;  4UDP A;  3ABV A;  4P9S A;  2WPE A;  2JBV A;  4GDP A;  4YSZ A;  3PVC A;  3AYJ A;  1EL7 A;  3H8I A;  1CC2 A;  1TDK A;  1IUT A;  1GRB A;  2YLZ A;  3ADA B;  2RAB A;  4NNJ A;  1UKV G;  4UDR A;  4GUV A;  3EAO A;  4BJZ A;  3EAN A;  2YLW A;  5KNL A;  1NG4 A;  3GDN A;  1QLB A;  4CCR A;  2BXS A;  3RP6 A;  1FEA A;  1FL2 A;  1H86 A;  4H4V A;  2YVF A;  5L46 A;  4Y4N A;  2GF3 A;  3QVP A;  2BC1 A;  3AXB A;  1XHC A;  1K0L A;  1VRQ B;  2OLN A;  3CGE A;  1OJ9 A;  4EM3 A;  3AEF A;  4WX1 A;  4AP3 A;  4IVM B;  1PJ7 A;  4EQS A;  4TM3 A;  1BZL A;  1VDC A;  2E5V A;  2C65 A;  2WU2 A;  2EQ7 A;  3M0O A;  2EQ8 A;  4YWO A;  1IUW A;  4Z2T A;  3T14 A;  4NEW A;  4EMI A;  3OZ2 A;  4A65 A;  1GRT A;  2R4J A;  4OPI A;  3SYI A;  1H84 A;  1SEZ A;  5M0Z A;  3KPF A;  4DSG A;  2NVK X;  5JCL A;  3GRS A;  1NHS A;  1NEN A;  1Z6L A;  2C75 A;  2VVL A;  4EQW A;  1LV0 A;  4NZH A;  5CKU A;  5GSN A;  4N9X A;  1PXA A;  4RSL A;  1GET A;  4GAP A;  3NYC A;  1D4D A;  4H4Q A;  2OAM A;  2O9Z A;  3GSI A;  3UCL A;  2BS2 A;  3T37 A;  3V76 A;  1JU2 A;  1ZKQ A;  2YR6 A;  2F5Z A;  3RHA A;  3ITJ A;  3D9X A;  3GDP A;  4H4R A;  3JSK A;  2YG3 A;  2R0C A;  4I59 A;  3NTA A;  5J60 A;  1ZMC A;  4U8K A;  2FJE A;  2B9Y A;  3GMC A;  3T2Y A;  4G6G A;  2XFQ A;  3DK8 A;  1PHH A;  3HYX A;  4H7U A;  3S5W A;  3F8P A;  2XDO A;  4MJW A;  4ZCC A;  2XVF A;  4LA1 A;  4EMW A;  5FS6 A;  2XCG A;  4BK2 A;  1MO9 A;  3FG2 P;  1OJD A;  1O5W A;  2Y6R A;  4ZN0 A;  4AOS A;  2Y6Q A;  4ADW A;  1ONF A;  1XDI A;  3NYF A;  4YSH A;  3P1W A;  3NK0 X;  5KOX A;  1JOA A;  1KDG A;  1H82 A;  3NIX A;  1BGN A;  1E1N A;  1RYI A;  1LQU A;  2GMJ A;  1DOB A;  2WDR A;  4FK1 C;  2GRT A;  3SQP A;  1RSG A;  2FJB A;  2WEU A;  5KMR A;  3K30 A;  2BCP A;  3IF9 A;  3LB8 A;  3AEE A;  2BC0 A;  3QSS A;  3KPK A;  4IA5 A;  5KMQ A;  3T31 A;  1QO8 A;  5HYM A;  1EL9 A;  1VQW A;  3AE8 A;  3P4Q A;  4YTP A;  3DK4 A;  1CJ3 A;  2C7G A;  2VVL G;  3M13 A;  5U25 A;  5JCI A;  4A99 A;  3CNJ A;  2A8X A;  1CBO A;  4KX6 A;  4J2W A;  5JCK A;  3BI2 A;  2YLT A;  3LXD A;  1X31 B;  3CPH G;  1CC6 A;  2IVD A;  3UP4 A;  1GT8 A;  3H8L A;  3QFA A;  1KSU A;  4H4T A;  3RNM A;  2WP6 A;  1FEC A;  1TDF A;  3VRB A;  1DOD A;  2GR2 A;  2GQF A;  4U8M A;  4JNQ A;  4C77 A;  1DJN A;  1GRG A;  1GTH A;  2EQ9 A;  2YVJ A;  5KMP A;  4H4P A;  2WU5 A;  2GAH B;  3PS9 A;  4IVO B;  2QAE A;  4U8L A;  2XLT A;  4OPT A;  2JB3 A;  4Z44 A;  2C66 A;  3CNS A;  1S3B A;  4B1B A;  2AR8 A;  2XFN A;  1H7X A;  1L9E A;  2YG4 A;  1PJ6 A;  3RED A;  4H2P A;  2BRA A;  3CIR A;  3LJP A;  1S7M A;  3GWF A;  4U8P A;  4OPL A;  4CRT A;  4CNK A;  3NK1 X;  4Z26 A;  3NN6 X;  1EL8 A;  3AWI A;  3DME A;  3F8R A;  1TRB A;  2BK3 A;  3KD9 A;  3EF6 A;  3KU9 A;  1PDH A;  3S61 A;  5EB5 A;  1Q9I A;  1IUV A;  2ZZB A;  4O5U A;  4YSX A;  1B4V A;  1PBF A;  3ALJ A;  2V5Z A;  3NLC A;  3ZYX A;  3DK9 A;  3IHG A;  2BCG G;  4E0V A;  2ZZC A;  1V59 A;  1PXC A;  4GCM A;  5ER0 A;  5JCN A;  3SFE A;  5FS9 A;  1PXB A;  3BI5 A;  3KVE A;  3O0H A;  5BUK A;  4Z43 A;  1NDA A;  4FX9 A;  2X3N A;  2JK6 A;  3NN0 X;  3QSM A;  4NWZ A;  1M64 A;  2WS3 A;  4ECH A;  2WDQ A;  4GRT A;  2B9X A;  1H6V A;  3CND A;  1KF6 A;  4Z2U A;  3ALL A;  2A87 A;  2B7R A;  1OJA A;  2VRL A;  2H88 A;  1BKW A;  2QA2 A;  1N4W A;  3ISH A;  4J33 A;  1JEH A;  2C73 A;  2B7S A;  2GMH A;  4ZCD A;  3P4R A;  2GH5 A;  3GRT A;  1BGJ A;  2YLX A;  2X8C A;  3GYJ A;  3NYE A;  2OLO A;  5DBJ A;  2J3N A;  3L5O A;  3DGH A;  1JRY A;  2VQB A;  1LQT A;  1NHQ A;  2C64 A;  2XLS A;  4ICY A;  5KXJ A;  3UKF A;  3UKP A;  5KMS A;  3DJG X;  4AT2 A;  3LZW A;  2X99 A;  2H89 A;  4UP3 A;  3PO7 A;  1B5Q A;  2IVE A;  1DOC A;  3AD9 B;  2E1M A;  3AE9 A;  1QJD A;  2HQM A;  3KA7 A;  4TLZ A;  3CPI G;  3G5S A;  4XWZ A;  4J56 A;  1CJ2 A;  4BK3 A;  2OA1 A;  4H2Q A;  4H4S A;  4H4X A;  2CFY A;  3SZC A;  2YM2 A;  3Q9T A;  4Y4M A;  2YR5 A;  1GND A;  2YR4 A;  4FK1 A;  3UKQ A;  4B67 A;  1HYU A;  4Z2R A;  3G5Q A;  4H2R A;  5J7X A;  3IWA A;  4A9W A;  4CBQ A;  1PN0 A;  2GB0 A;  4REK A;  4AOX A;  4WCT A;  4JDR A;  1EBD A;  4DNA A;  3UOY A;  2WPF A;  1D5T A;  4U2T A;  1ZK7 A;  3I6D A;  2YG6 A;  3UTG A;  1NEK A;  1D4E A;  3COX A;  1FEB A;  1ZMD A;  3AE3 A;  4Y4L A;  4C74 A;  3FMW A;  3SZW A;  5TR3 A;  3URH A;  3C4A A;  4IV9 A;  4X9N A;  2XVE A;  5IQ1 A;  1CJC A;  2PYX A;  2BAC A;  1CF3 A;  4BK1 A;  3FIM B;  1S2Y A;  4G9K A;  5U1O A;  3BI4 A;  2XLP A;  3HZL A;  3UTH A;  1GRH A;  2V6O A;  1P2E A;  4GF7 A;  4YSY A;  1IJH A;  4XXG A;  2GQW A;  2C3C A;  2TPR A;  2XVJ A;  2Q7V A;  1PBB A;  1GPE A;  1KFY A;  1M6I A;  2R45 A;  5FS8 A;  2WHD A;  2YLR A;  4GDE A;  1MOK A;  2XLR A;  3AEB A;  3UKA A;  3NT6 A;  1BWC A;  3CGB A;  3CN8 A;  1YQ4 A;  1GRA A;  3BNM A;  2JB1 A;  4DGK A;  3SY4 A;  3B3R A;  3BNU A;  5HXI A;  2V3B A;  1Q1W A;  3Q6J A;  1H83 A;  3L8K A;  3SZ0 A;  3GD3 A;  3K7Q X;  4U2S A;  3SFD A;  1NHP A;  1CJ4 A;  5HY5 A;  3D8X A;  3PG6 A;  5KWF A;  3DH9 A;  2QCU A;  1PBD A;  3BHF A;  2V60 A;  4YKG A;  1H2I A;  1F8W A;  1YKJ A;  1N4V A;  1JRX A;  1Y56 B;  3ATQ A;  3LOV A;  2APG A;  2X50 A;  1H7W A;  1L9C A;  4U2L A;  3UP5 A;  1L9D A;  3VRD B;  2AQJ A;  3AEA A;  5FS7 A;  3HYV A;  3II4 A;  2VVM A;  2CVJ A;  1GTE A;  4II2 A;  4J34 A;  1E1L A;  4U8N A;  4H4Z A;  1NHR A;  3H4K A;  4YT0 A;  1CC4 A;  2TMD A;  2VZ2 A;  3HYW A;  3F8D A;  4TM1 A;  1TYT A;  4C3Y A;  3AD7 B;  1TDO A;  2JKC A;  1KN0 A;  2ZBW A;  1OJT A;  4A79 A;  1YQ3 A;  3UKL A;  4JN9 A;  3NKS A;  1D4C A;  4YTN A;  4JY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...