3CGBA

Pyridine nucleotide complexes with bacillus anthracis coenzyme a-disulfide reductase: a structural analysis of dual nad(p)h specificity
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
444
structure length
444
Chain Sequence
MNYVIIGGDAAGMSAAMQIVRNDENANVVTLEKGEIYSYAQCGLPYVISGAIASTEKLIARNVKTFRDKYGIDAKVRHEVTKVDTEKKIVYAEHTKTKDVFEFSYDRLLIATGVRPVMPEWEGRDLQGVHLLKTIPDAERILKTLETNKVEDVTIIGGGAIGLEMAETFVELGKKVRMIERNDHIGTIYDGDMAEYIYKEADKHHIEILTNENVKAFKGNERVEAVETDKGTYKADLVLVSVGVKPNTDFLEGTNIRTNHKGAIEVNAYMQTNVQDVYAAGDCATHYHVIKEIHDHIPIGTTANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNLTLARTGLNEKEAKGLHIPYKTVKVDSTNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDVIAMALFNKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pyridine Nucleotide Complexes with Bacillus anthracis Coenzyme A-Disulfide Reductase: A Structural Analysis of Dual NAD(P)H Specificity.
pubmed doi rcsb
source organism Bacillus anthracis str.
molecule tags Oxidoreductase
molecule keywords Pyridine nucleotide-disulfide oxidoreductase, class I
total genus 137
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3cgbA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgbA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3cgbA02
2YLTA 3UTGA 3CPJG 3CN8A 4WX1A 3UKHA 1PDHA 3GDNA 3I3LA 3IHGA 4UP3A 4USQA 4X4JA 3D1CA 1OJ9A 2W0HA 4EQWA 5U25A 1M6IA 2GMJA 1KF6A 1H82A 3GYIA 3GSIA 3NH3X 4YKGA 2XVHA 1XPQA 5EBKA 2WBAA 5TR3A 3UTHA 4H2QA 4H2PA 2Y6QA 3ISHA 1B5QA 3D8XA 3L1RA 4B66A 2V3AA 4LA1A 1LQUA 5JCIA 2X50A 1XDIA 3CNPA 4HA6A 1K4QA 1H83A 2FJEA 5KXJA 2E5VA 1RP0A 1X31B 1PHHA 4RG3A 4AOSA 1GRHA 1NHSA 3RP7A 2Q7VA 2R9ZA 1GPEA 1FECA 4OCGA 3B6DA 2Q0KA 4A6NB 3AD9B 4OPIA 1GTEA 1K0IA 2R45A 1KFYA 3ATRA 4HB9A 3O0HA 3T37A 1REOA 5LV9A 3E1TA 3P1WA 4KX6A 3LADA 4U8OA 5BUKA 4K22A 5JCKA 4TM3A 1E39A 2C3CA 4GR1A 4CNJA 1VDCA 3CNSA 3NN0X 2WPFA 1H84A 1PXCA 1O94A 2I0ZA 2JAEA 3ICSA 1D4CA 1JRXA 1NENA 2VVLG 3AE5A 2YG5A 3ALLA 2GV8A 2CDUA 2X99A 1BKWA 1L0VA 3H4KA 1LJ1A 4H2NA 2WHDA 5L46A 1GRAA 1CHUA 1KNPA 3AEBA 3CGEA 2XVEA 3GD3A 1JNRA 2JKCA 2YLZA 2AAQA 3KPFA 3QJ4A 4C74A 4YTNA 3LZXA 2YM1A 5U63A 3CPHG 1Y56A 4CBQA 1LV0A 1TRBA 4DNAA 1GESA 1S2QA 1KNRA 4OPDA 2C7GA 5EB5A 2BC1A 3VRBA 3LB8A 3AD7B 4RSLA 3GD4A 4GUVA 4GCMA 3ZYXA 3CGBA 2WDVA 4Z25A 2GMHA 2V5ZA 1D4DA 5BVAA 1Q9IA 2YVJA 2GR2A 1TDEA 2RGOA 5CQFA 1SEZA 4B1BA 2OAMA 2GAGB 1H6VA 4H50A 2XLTA 2J3NA 1CJ4A 1CJCA 2V6OA 4EQXA 1ELIA 4EM4A 2OALA 3NTDA 3KLJA 1OJCA 4FK1A 3SM8A 2GR1A 2E4GA 3H8LA 1N4UA 2XYOA 4BK2A 1NPXA 1PXBA 5HYMA 3EANA 3UP5A 3M13A 4J56A 4NZHA 2NPXA 2ZZBA 1FEAA 3UKFA 4OPGA 1LTXR 2EQ8A 4NEWA 3P4QA 2VQ7A 2TPRA 2X8GA 3OC4A 1NG4A 2E1MA 4PAAA 4U8JA 4YXDA 2WS3A 4UDPA 2DKIA 4JDRA 5FMHA 1DXLA 4Y4NA 4Z2UA 1NAAA 4TM0A 3NG7X 3DJEA 4Z44A 2ZZ0A 4AP3A 1GTHA 3FBSA 1N4WA 2XFNA 1M64A 2C66A 2C65A 3AEEA 3AE2A 4A99A 4U8NA 3NK0X 2GH5A 3UOXA 2APGA 3NTAA 3BHKA 4ZCDA 4BV6A 2XFUA 1ONFA 4DSHA 3ITJA 2Z5YA 3S61A 3ZDNA 4EQRA 3K7MX 1EL5A 4CCRA 3NYEA 2QA1A 3DK8A 3IWAA 1Y56B 4IA5A 4XWZA 2VRMA 4ZN0A 1CC4A 1FEBA 4N9XA 2BS4A 1PJ5A 3KA7A 4H4SA 1ZDLA 3BI2A 1NHRA 3EAOA 1F8RA 1KSUA 2C70A 2IVDA 5CKUA 1F6MA 3GMCA 3LXDA 5GSNA 4YTPA 3AE6A 1E6EA 1GRTA 5GRTA 4CRTA 2DKHA 2GEWA 1Q1WA 3NHOX 3AYLA 2XVIA 2IVEA 2XVJA 5FS7A 1Z6LA 2YLXA 2YLSA 2YR6A 4U8LA 3CPIG 1HYUA 3R9UA 4OPLA 4YSHA 4TM1A 4C77A 4CNKA 1BGJA 3CNDA 2BC0A 2GRTA 3NYFA 4EMIA 2ZZCA 4D04A 2YQUA 3GRSA 1DJQA 1BWCA 3B3RA 4IV9A 4H4TA 1GSNA 4ICYA 2Y6RA 5ER0A 2PHHA 2XLSA 3AEDA 3RP6A 2A89A 4B64A 3FPZA 3NRNA 5C3JA 3Q9TA 3AE8A 3SFEA 4YSXA 4JQ9A 3AD8B 4GRTA 1N1PA 3H8IA 3AEAA 3WE0A 3DA1A 1PN0A 1TDOA 2YG7A 4Z43A 3QFBA 4APNA 1H86A 1QO8A 1Y0PA 2R4EA 4U2LA 4C3XA 2FJBA 2YVFA 1AOGA 3LOVA 2WDQA 3DGHA 1GETA 1QJDA 3LJPA 1GRFA 4I58A 3DJDA 4U2SA 2XCGA 3UOYA 4H7UA 2GQWA 2WU5A 2NVKX 2WU2A 2X3NA 3VRAA 3ICRA 4CY6A 1GXFA 4J36A 3VR9A 4Z26A 2A8XA 1CJ3A 1OJAA 1O95A 1DNCA 1IUXA 3C4AA 2YAUA 3S5WA 4C3YA 3ABVA 4XWRA 3PO7A 5KOXA 2GR0A 3EF6A 3AWIA 3ICTA 1RYIA 4EIPA 2WP6A 1ZMDA 1FL2A 1ZP0A 1VG0A 5U1OA 3NT6A 3GRTA 2VOUA 3KKJA 3UTFA 3VR8A 1XANA 4M52A 1CC2A 1JRYA 3UKKA 1D4EA 1V59A 3V3OA 2GB0A 1CJ2A 1BF3A 2XFQA 2JB2A 1E1NA 3BNUA 3QSSA 1PXAA 1TYPA 4YT0A 2QAEA 4LU6A 3IHMA 4BJZA 4FX9A 5J60A 2H89A 2V3BA 3AE7A 4O5UA 2WOWA 4GF7A 2X8CA 5BRTA 5FS6A 2YR4A 2R46A 2YG6A 4B68A 1D7YA 2WP9A 5FS8A 3JSKA 3NYCA 3UOZA 1FCDA 4RG4A 4BJYA 2Z5XA 1COYA 1ZY8A 3BI4A 4AT0A 5M10A 2GVCA 3LZWA 2R4JA 2WPEA 2VQBA 4U8MA 3DJJA 2YM2A 3DK4A 2EQ7A 2WOIA 2XVFA 2B7RA 4KPRA 1GT8A 1D7LA 3QSEA 4U2TA 5KWFA 4MJWA 4YTMA 3P4SA 1PS9A 3GWFA 4B69A 4P9SA 1L9CA 1NHQA 3IC9A 1PBCA 1DOEA 5EB4A 2VVLA 3C4NA 5KOWA 2R0GA 1JEHA 4AOXA 5KVIA 1IUTA 4NEVA 4JN9A 2XFPA 4JNAA 1KSSA 2FJDA 1PBDA 1EL9A 2CULA 1BGNA 4AT2A 4EQSA 3EPTA 1F3PA 2EQ9A 3NIXA 1GALA 2H88A 1K0LA 4C5OA 1EBDA 2B7SA 3BNMA 3QVRA 4IA6A 1GREA 3QSMA 3V3NA 4NTEA 4K7ZA 4U8KA 2C75A 2R0PA 4CCQA 4ADWA 2C72A 2BCPA 1YY5A 3NN6X 2TMDA 4YWOA 1GV4A 3CGDA 1YQ4A 4LIIA 1Q1RA 3II4A 2ARDA 4H4RA 2C3DA 1B4VA 4J2WA 1IUUA 4BK3A 1MXTA 2WESA 4Z24A 1GRGA 2ACZA 3FMWA 1E7PA 3RHAA 3AE1A 5IQ1A 4ECHA 3ATQA 3CNTA 3CNJA 4TM4A 4EM3A 1KDGA 2XLUA 1VRQB 2YLRA 4OVIA 2YG4A 4Y4MA 2WEUA 3UTEA 5DBJA 1K0JA 2IIDA 4Z2TA 4H4YA 3GYJA 2XLRA 3FG2P 2JB1A 1L9EA 2BYBA 1ZKQA 4EMJA 1OJTA 5C2TA 1YQ3A 1YKJA 3KU9A 3KVEA 4AP1A 4Y4LA 2C76A 1DOCA 5JCMA 3K7QX 3UCLA 5IPYA 1CBOA 2V60A 1S2YA 1JOAA 3V76A 2CVJA 4UDQA 2B9XA 2QCUA 5JCNA 4YSZA 5KVHA 1BZLA 3PS9A 4U8PA 4UDRA 5M0ZA 2JK6A 4BURA 3G5SA 5FS9A 3AECA 3NK1X 3SGLA 2V61A 2BS3A 3UP4A 4Z2RA 3FIMB 1CL0A 4H4ZA 3ALJA 4K5RA 1TDNA 2FJAA 5HXIA 4E0VA 1LPFA 3PVCA 4A65A 2YLWA 2JBVA 4BK1A 1P2HA 3CTYA 2BK3A 2GQFA 1IUSA 1TDKA 3QFAA 1L9DA 1N4VA 4FDCB 4IVMB 4B65A 3NKSA 3F8DA 1VG9A 1DODA 4DSGA 1GNDA 1JNZA 4DGKA 3K30A 1IUVA 3SFDA 2YVGA 3RNMA 5HY5A 4J34A 4U8IA 3NLCA 3AEFA 1D5TA 3UKQA 4NTCA 4GDPA 2GAHB 4H4PA 4IVOB 2RGJA 3BHFA 2FBWA 1CC6A 1GEUA 3AXBA 3AE9A 3NK2X 3UKPA 1DJNA 2XFOA 5IQ4A 3UKLA 2BCGG 4A5LA 4PABA 1ZMCA 2BABA 2VZ2A 1P2EA 2CFYA 1PBEA 2Q0LA 2WQYA 3NNEA 4H4UA 2A87A 3AB1A 3G5QA 4H2RA 4TLZA 3BI5A 4TLXA 4YKFA 5EOWA 1LQTA 3L8KA 4B63A 2GR3A 1B37A 4K8DA 2B9YA 3G5RA 4CY8A 2BK5A 1LVLA 1GRBA 4J33A 2WETA 3AYIA 5BULA 2R0CA 3KD9A 1ZOVA 1GERA 1IJHA 3DH9A 1F8WA 3SQPA 2BK4A 2HQMA 4J31A 1MO9A 1VQWA 3AE3A 5JCLA 1XHCA 3UKAA 2JB3A 3REDA 4D03A 4H4QA 2BS2A 2O9ZA 1JU2A 3DMEA 4OPCA 3I6DA 1YQZA 1PJ7A 4USRA 3M12A 3HZLA 4JY3A 3AYJA 1TDFA 3RP8A 2B76A 2Q6UA 1NHPA 4K5SA 3DGZA 2C67A 4REKA 5HHFA 3CGCA 1TYTA 1ZOYA 3F8PA 3OZ2A 4H4VA 1JRZA 2YR5A 2B9WA 1UKVG 1O5WA 4I59A 3Q6JA 4X9NA 4J57A 5KRQA 1NDAA 3GMBA 2VRLA 3ALMA 2YWLA 4A9WA 2X8HA 4X9MA 2EQ6A 4OPUA 1H81A 3AEGA 3NGCX 1MOKA 3P4PA 2VVMA 1PBBA 1H7WA 2QA2A 3COXA 1PJ6A 1RSGA 4K2XA 3DJGX 1CF3A 4WCTA 2XLPA 1OJDA 2WDRA 2WOVA 2OLOA 2AQJA 2BA9A 1NEKA 2UZZA 3K7TA 4A7AA 1W4XA 3GDPA 1GOSA 1ZK7A 2WPCA 2BXRA 4XXGA 4EMWA 5J7XA 3VRDB 3ADAB 2C73A 1B8SA 1EL8A 2F5ZA 4A6NA 2GF3A 4GDEA 2AR8A 2WP5A 2RABA 1E1LA 1NG3A 3F8RA 3UOVA 4A79A 4H4XA 4FK1C 4B67A 3M0OA 1DOBA 1EL7A 2YG3A 3DK9A 3GWDA 1S3BA 2C64A 3IF9A 4YSYA 4H4WA 4NTDA 3URHA 3P9UA 3QVPA 2ZBWA 4OPTA 2OA1A 4JNQA 4EIQA 2BACA 3C96A 1F8SA 4JY2A 1E1KA 1ZX9A 3VQRA 1PBFA 3P4RA 4O5QA 3AE4A 2RGHA 4ZCCA 2XDOA 3CIRA 1QLBA 1IUWA 1S3EA 2PYXA 2BXSA 1H7XA 1E1MA 2OLNA 1FOHA
chains in the Genus database with same CATH superfamily
2YLTA 3DG3A 3CN8A 4WX1A 3FJ4A 4USQA 3D1CA 5U25A 1IYXA 3SSZA 3P3BA 4YKGA 2Y6QA 2I5QA 2V3AA 1FFUC 1X31B 4RG3A 1NHSA 3DESA 2GGHA 3UCDA 4OPIA 3ZVIA 5LV9A 3E1TA 3P1WA 4U8OA 4K22A 1SJBA 4J3ZA 1JDFA 1E39A 2C3CA 4JHMA 3NN0X 2WPFA 1O94A 1FO4A 3ICSA 2JAEA 3VA8A 2YG5A 2GV8A 2CDUA 2WHDA 1GRAA 1CHUA 2XVEA 3GD3A 2JKCA 2AAQA 2NQLA 4H19A 3LZXA 1Y56A 4CBQA 1GESA 1KNRA 5EB5A 3VRBA 3LB8A 2PPGA 3ZYXA 3CGBA 2WDVA 5FJUA 2GMHA 4II2A 1D4DA 5BVAA 2YVJA 3V5FA 3ZVHA 5CQFA 2GAGB 4H50A 1ZXIC 1CJCA 4FK1A 3UGVA 3SM8A 1PXBA 3M13A 1VQZA 2NPXA 3GY1A 1FEAA 1BKHA 2X8GA 4GAVA 4U8JA 4YXDA 3V3WA 2WS3A 4G73A 1DXLA 4Y4NA 4G74A 3SN4A 4TM0A 4A6GA 3DJEA 2ZZ0A 2OO6A 1N4WA 2XFNA 1KN0A 2C65A 3AEEA 4E6MA 3BHKA 4GMEA 3MY9A 3GC2A 3ITJA 3S61A 1JRPA 3ZDNA 4CCRA 3TQPA 2VRMA 3I6EA 2BS4A 1ZDLA 3JVAA 1KSUA 2IVDA 5GSNA 1Q1WA 3NHOX 2XVJA 5FS7A 1Z6LA 3MWCA 4OPLA 4YSHA 4CNKA 3CNDA 3NYFA 2YQUA 4H4TA 3AEDA 4B64A 5C3JA 3Q9TA 3SFEA 3H8IA 3DA1A 4Z43A 4APNA 1H86A 1Y0PA 3ES7A 1E9IA 2YVFA 3CYJA 1GRFA 2OPJA 2P0IA 2WU5A 2NVKX 4IP4A 3VRAA 1GXFA 4J36A 3VR9A 4EWJA 1CJ3A 1OJAA 1IUXA 4C3YA 3ABVA 4XWRA 3ICTA 1R6WA 2FYMA 1RYIA 4EIPA 1FL2A 1ZP0A 1VG0A 3UTFA 1XANA 2PSNA 4M52A 3UKKA 5KMPA 1E1NA 4YT0A 2QAEA 2H89A 3CXOA 2HNEA 3R0KA 3AE7A 5BRTA 5FS6A 4B68A 3NRZB 1KD0A 1ZY8A 2EQ7A 1ONEA 1STZA 4KPRA 3QSEA 3P4SA 1PS9A 3GWFA 1L9CA 4MMWA 3SZFA 5KOWA 4DWDA 2MNRA 2FJDA 1PBDA 2CULA 2EQ9A 2P8CA 3QVRA 3BOXA 3QSMA 4NTEA 4K7ZA 2C72A 4F4RA 2TMDA 3T2YA 4YWOA 2ARDA 4J2WA 1MXTA 4Z24A 1WUEA 2ACZA 1E7PA 3AE1A 3ATQA 3H12A 4Y4MA 4H4YA 2XLRA 2JB1A 3KVEA 3EKGA 3K7QX 3UCLA 4U8PA 2RDXA 2JK6A 3AECA 2OZTA 3UP4A 4Z2RA 4H4ZA 2JBVA 3CTYA 2BK3A 1TDKA 1L9DA 1DODA 4DSGA 1GNDA 3QTPA 3K30A 2PTXA 4H2HA 3BHFA 2FBWA 1GEUA 1EBHA 3NK2X 4A5LA 2BABA 1PBEA 2WQYA 1LQTA 4K8DA 3R1ZA 2B9YA 3G5RA 1LVLA 3P0WA 3A7RA 1ZOVA 1F8WA 1XPYA 3AE3A 6ENLA 2OFJA 5G5GB 3HZLA 4JY3A 2Q6UA 3SJNA 5HHFA 3PFRA 1TYTA 3OZ2A 4I59A 1EBGA 4JN7A 4X9MA 4OPUA 3P4PA 3CB3A 4E4FA 3COXA 3DJGX 4WCTA 2XLPA 1OJDA 1NEKA 2UZZA 3K7TA 1GOSA 2E5AA 4EMWA 5J7XA 3VRDB 4HCDA 3ADAB 3AM9A 2F5ZA 1S7MA 4GDEA 2AR8A 3H8AA 3FV9A 2RABA 2E3TA 2GSHA 1N60C 2C64A 2FKPA 3TW9A 4EIQA 4J1OA 3V5CA 3P4RA 4O5QA 2HXTA 1S3EA 3CPJG 1PDHA 3I3LA 4UP3A 3RO6A 1M6IA 3DGBA 2OQYA 4FI4A 1KF6A 3GYIA 3GSIA 2XVHA 5TR3A 3IK4A 4H2PA 3ISHA 2OKTA 4LA1A 3D9XA 2X50A 4HA6A 2FJEA 3T4WA 4AOSA 1PDZA 3RP7A 1FECA 4OCGA 1X2GA 1XS2A 3SZ0A 4G7FA 1FHUA 3DIPA 4TVWA 1REOA 3PG6A 5EU9A 3R10A 5JCKA 4TM3A 4GR1A 4CNJA 3CNSA 1H84A 1PXCA 1F9CA 4X2PA 2X99A 3H4KA 4Z17A 3JW7A 5L46A 1KNPA 3KPFA 1MDLA 4YTNA 3I6TA 4HCHA 4KT2A 1LV0A 1TRBA 1S2QA 4OPDA 2C7GA 2BC1A 3AD7B 3QPEA 4GUVA 4GCMA 4DXKA 1N5XA 4Z25A 1Q9IA 3NVYB 4HPNA 2OAMA 2XLTA 4EM4A 3NTDA 2GR1A 2E4GA 4BK2A 5HYMA 3NFUA 3UP5A 4NZHA 3I4KA 1LTXR 2EQ8A 1NG4A 4PAAA 2E1MA 3T8QA 2P88A 4JDRA 1NAAA 1TE6A 1OEPA 3AE2A 4U8NA 3TWAA 2GH5A 2ONEA 2CHRA 3NTAA 4BV6A 3N6HA 3K7MX 3R07C 3SQSA 1Y56B 3RGTA 1CC4A 1FEBA 4N9XA 1PJ5A 3KA7A 3EAOA 2C70A 3LXDA 4YTPA 3AE6A 1GRTA 2XVIA 2GDQA 2YR6A 1BGJA 1H2IA 2BC0A 2GRTA 3H70A 4EMIA 2ZZCA 4D04A 3P93A 1BWCA 3B3RA 4IV9A 2PHHA 3RP6A 2A89A 3MKCA 3NRNA 3RITA 3AE8A 4JQ9A 3AD8B 2BRYA 3CMMA 1PN0A 1TDOA 3QFBA 4M0XA 4U2LA 2FJBA 2POZA 4KEMA 1GETA 3DJDA 2GGJA 2GQWA 2WU2A 4Z26A 5FJPA 1DNCA 3S5WA 3C4AA 2YAUA 4A3RA 4GYPA 3PO7A 3EF6A 5U1OA 2VOUA 3KKJA 3ETRB 1CC2A 1D4EA 4NNJA 2GB0A 5ENLA 1CJ2A 2JB2A 3PK7A 4BJZA 5J60A 4O5UA 2X8CA 3CT2A 3NYCA 3NO1A 2P8BA 3BSMA 1COYA 3BI4A 5M10A 2R4JA 4U8MA 3DJJA 3DK4A 3SXIA 1GT8A 3K1GA 4MJWA 4YTMA 4GIRA 1PBCA 2VVLA 3C4NA 5KVIA 1IUTA 2QDEA 4JN9A 2XFPA 4EQSA 1K0LA 4C5OA 1EBDA 3BNMA 4IA6A 1GREA 4U8KA 2R0PA 1KKOA 3NN6X 1GV4A 4LIIA 1Q1RA 3II4A 2C3DA 1B4VA 5IQ1A 4ECHA 4TM4A 4EM3A 1KDGA 2WEUA 3UTEA 4Z2TA 3SZWA 1ZKQA 1OJTA 3KU9A 3RRAA 1YKJA 4AP1A 2C76A 5IPYA 2CVJA 2QCUA 1BZLA 4UDRA 1JPDX 3EEZA 3S47A 5FS9A 1TDNA 2FJAA 3T2ZA 4E0VA 1LPFA 3PVCA 2AKMA 1IUSA 4IVMB 1JNZA 2YVGA 5HY5A 4J34A 3NLCA 3AEFA 3ZLGA 2ZC8A 1D5TA 4NTCA 4H4PA 4IVOB 3UJFA 4GFIA 3MQTA 1DJNA 2XFOA 4PABA 1P2EA 4A35A 3AB1A 2A87A 4B63A 1B37A 3NZGA 2W3SA 1GERA 1EC9A 3SQPA 2HQMA 4J31A 1MO9A 1VQWA 2JB3A 4H4QA 3OTRA 1JU2A 1YQZA 3N4EA 3DGZA 3AN1A 3CGCA 1JROA 3F8PA 2B9WA 4IT1A 3ALMA 1DTNA 2DW7A 4A9WA 1P48A 4HNCA 3AEGA 3NGCX 1MOKA 2VVMA 1H7WA 2QA2A 2PMQA 2WDRA 1RVKA 2BA9A 2C4CA 4NWZA 3GDPA 5BOFA 1EL8A 4A6NA 4KPLA 7ENLA 2AL1A 1NG3A 3F8RA 3UOVA 4FK1C 5KMRA 3VDGA 4NTDA 3QVPA 2BACA 2DW6A 4JY2A 1E1KA 1H7XA 2OLNA 4JN8A 1FOHA 3L5OA 3UTGA 3UKHA 3IHGA 3R11A 1OJ9A 3QLDA 1XPQA 2WBAA 3UTHA 4H2QA 1B5QA 3D8XA 3L1RA 4B66A 5JCIA 1XDIA 3CNPA 2OX4A 5KXJA 1RP0A 1PHHA 2Q0KA 4A6NB 1SJDA 1GTEA 1K0IA 2GGIA 3ATRA 1MDRA 4HB9A 4KX6A 5BUKA 3T9PA 1VDCA 2I0ZA 3AE5A 3ALLA 1LJ1A 4H2NA 4G6HA 3OW1A 3CGEA 1JNRA 2YLZA 2YM1A 1KCZA 4DNAA 4HCLA 4RSLA 2QGYA 3HRDC 2V5ZA 2GR2A 1SEZA 1H6VA 3MZNA 4DGKA 3KLJA 1OJCA 1NPXA 2ZZBA 3FCPA 4OPGA 4NEWA 3DG6A 1ELSA 3P4QA 2TPRA 3OC4A 3OZMA 4IL0A 4UDPA 1P43A 2PU0A 4Z2UA 1MNSA 3GD6A 1NU5A 4AP3A 3NG7X 3FBSA 2QDDA 2C66A 4A99A 3UOXA 4DSHA 2XFUA 1ONFA 2Z5YA 2HXUA 2PP3A 4EQRA 1EL5A 2PP0A 3ZVHB 3TJIA 3SX6A 3IWAA 4IA5A 4XWZA 2PCEA 3SR6B 3S5SA 5KMSA 3CXBA 4H4SA 2OG9A 1F6MA 3GMCA 1E6EA 4IHCA 1SJCA 2W54A 2DKHA 2OZ8A 2YLXA 4MGGA 4GYPC 2OZ3A 1DJQA 1GSNA 3HYXA 3SN0A 4E5TA 1NELA 3B9JB 1N1PA 3WE0A 1QO8A 2R4EA 4C3XA 3LOVA 2WDQA 2XSXA 1QJDA 4I58A 4U2SA 3ICRA 2A8XA 4IZGA 3U9IA 3HPFA 3VCCA 4G8TA 2WP6A 3NT6A 3TWBA 3GRTA 3T31A 3V3OA 4TVYA 3UXLA 1BF3A 2XFQA 3BNUA 1PXAA 3IHMA 4FX9A 3UJRA 2GL5A 2R46A 3JSKA 2Z5XA 2PA6A 2WPEA 2PS2A 2B7RA 4U2TA 5KWFA 4P9SA 3MSYA 3DEQA 1NHQA 3IC9A 1DOEA 2R0GA 4JNAA 3DFYA 3A7AA 1KSSA 3VFCA 2W3RA 4AT2A 4YWSA 1F3PA 2H88A 4K2SA 2C75A 4H4RA 4GGHA 1IUUA 3ENLA 2WESA 2GGGA 2AKZA 3FMWA 3RHAA 3CNTA 4OVIA 2YG4A 5DBJA 5BOEA 3FG2P 1L9EA 1BQGA 2BYBA 4Y4LA 1DOCA 5JCMA 1CBOA 1S2YA 3V76A 4UDQA 5JCNA 4YSZA 5KVHA 3PS9A 1V97A 5M0ZA 4BURA 2PTWA 3G5SA 3VCNA 3SGLA 3NVZB 3FIMB 5HXIA 1JPMA 4A65A 4DYEA 4BK1A 5J04A 4KWSA 2GQFA 3NKSA 1VG9A 4ROPA 3SFDA 1SJAA 4U8IA 3KPKA 3UKQA 2GAHB 3B97A 1CC6A 3AXBA 1YEYA 4FP1A 3UKPA 4ZA0A 3AMZA 2OQHA 3OPSA 4H4UA 4TLZA 4TLXA 4YKFA 5EOWA 3L8KA 4J33A 3KD9A 1N62C 1IJHA 3DH9A 1XHCA 3UKAA 1KKRA 3REDA 4D03A 3TTEA 2ZADA 2HZGA 4OPCA 3I6DA 4GAPA 3DERA 3M12A 3AYJA 4REKA 4H4VA 1JRZA 2YR5A 1O5WA 3Q6JA 4J57A 1NDAA 2VRLA 2XH0A 2YWLA 2BRAA 3SYIA 1PJ6A 1CF3A 4ENLA 2OLOA 2AQJA 3SBFA 4A7AA 3DDMA 1W4XA 1ZK7A 2BXRA 4XXGA 1R0MA 4E8GA 3HW2A 2WP5A 1E1LA 4A79A 4B67A 1TZZA 3M0OA 1DOBA 3QN3A 2YG3A 1VDVA 2AL2B 3CK5A 3DK9A 2PGWA 4H4WA 3A7UA 3P9UA 2OA1A 3D46A 2QJJA 1F8SA 3VQRA 3AE4A 4ZCCA 1QLBA 3TJ4A 2BXSA 1E1MA 2PTZA 4IL2A 3GDNA 3EUB3 4X4JA 3HYVA 2W0HA 4EQWA 3U4FA 2GMJA 1H82A 3T14A 3TOYA 3NH3X 5EBKA 2PODA 3T0KA 1LQUA 1W6TA 1K4QA 1H83A 2E5VA 1GRHA 2Q7VA 2R9ZA 1GPEA 3VC6A 3THUA 2PTYA 1MRAA 3B6DA 5G5HB 3AD9B 2QVHA 2R45A 3V4BA 1EC7A 1KFYA 3T37A 3O0HA 3LADA 3NS1B 4HNLA 5FJTA 4IP5A 3ZLHA 2XH7A 3FYYA 3T2KA 1D4CA 1JRXA 1NENA 2VVLG 1BKWA 1L0VA 3AEBA 4K1WA 3IJQA 3SY4A 3QJ4A 4C74A 3SN1A 2QJMA 5U63A 3CPHG 2PU1A 3GYXA 3GO2A 3GD4A 2XH2A 1TKKA 1TDEA 3DFHA 2RGOA 4B1BA 2J3NA 1CJ4A 2V6OA 4EQXA 1ELIA 2OALA 3H8LA 1N4UA 2XYOA 3BJSA 3UXKA 1JCTA 3EANA 4J56A 1FHVA 3UKFA 2VQ7A 4GGBA 4II3A 2DKIA 5FMHA 4M6UA 4Z44A 1GTHA 4G9KA 1M64A 3H7VA 3NK0X 1SB3B 2APGA 4ZCDA 2O56A 3NYEA 2QA1A 3D47A 3DK8A 4ZN0A 5KMQA 1WYGA 4ZOHB 3BI2A 1NHRA 1F8RA 5CKUA 1PDYA 3UCCA 5GRTA 3OP2A 4CRTA 2GEWA 3AYLA 2IVEA 2YLSA 2W55A 3T6CA 4U8LA 3STPA 2AL2A 3CPIG 1HYUA 3R9UA 1L8PA 4TM1A 4C77A 1FFVC 3GRSA 4ICYA 2Y6RA 5ER0A 2XLSA 3FPZA 4HN8A 4YSXA 4DX3A 4GRTA 3AEAA 2YG7A 4DHGA 1AOGA 3KUMA 3DGHA 3LJPA 3UOYA 2XCGA 4H7UA 4MKSA 2X3NA 4CY6A 2MUCA 3IJIA 1O95A 5KOXA 2GR0A 3AWIA 1ZMDA 4E4UA 3VR8A 1JRYA 1V59A 3QSSA 1TYPA 4LU6A 2V3BA 3ZLFA 2WOWA 4GF7A 3RR1A 2YR4A 2YG6A 4H83A 1D7YA 2WP9A 5FS8A 4BJYA 3UOZA 1FCDA 4RG4A 2PP1A 3Q4DA 4AT0A 5IDZA 2GVCA 3LZWA 2VQBA 3CAWA 2YM2A 2WOIA 2XVFA 1D7LA 3MUCA 4B69A 3OZYA 5FJRA 1ECQA 4DN1A 5EB4A 3UJSA 2QQ6A 1JEHA 4AOXA 1MUCA 4NEVA 1WUFA 3HYWA 1EL9A 5FJOA 1BGNA 3EPTA 3NIXA 1GALA 1X2HA 2B7SA 3V3NA 4CCQA 4ADWA 2BCPA 1YY5A 3CGDA 3NVVB 1YQ4A 2OVLA 4H1ZA 2OLAA 4BK3A 1GRGA 3CNJA 2XLUA 1VRQB 3NVWB 2YLRA 3DG7A 1K0JA 2IIDA 3IJLA 3GYJA 4EMJA 5C2TA 1YQ3A 4Z1YA 2QJNA 2V60A 1JOAA 2GGEA 2B9XA 3R25A 3TCSA 3NK1X 2V61A 2BS3A 1FIQB 1CL0A 3ALJA 4K5RA 2YLWA 1P2HA 3QFAA 1N4VA 4FDCB 4B65A 3F8DA 1IUVA 3RNMA 3VC5A 4GDPA 1N61C 3UJEA 2RGJA 1N63C 3AE9A 2XH4A 5KNLA 5IQ4A 1EC8A 2BCGG 3UKLA 1ZMCA 2VZ2A 2CFYA 2Q0LA 3NNEA 3UJ2A 3G5QA 4H2RA 3BI5A 3JZUA 2GR3A 4CY8A 2BK5A 1GRBA 2WETA 3AYIA 5BULA 2R0CA 1T3QC 2BK4A 5JCLA 2BS2A 2O9ZA 3DMEA 1PJ7A 4USRA 3NXLA 3FVDA 4HYRA 1TDFA 3RP8A 2B76A 1NHPA 4K5SA 4G6GA 2C67A 1ZOYA 3N6JA 1UKVG 4X9NA 1N5WC 5KRQA 2PGEA 3GMBA 2X8HA 2EQ6A 2P3ZA 1H81A 1PBBA 4K8GA 3PWGA 5JRBA 1RSGA 4K2XA 4GISA 4ZCWA 2WOVA 3ES8A 3RCYA 3R0UA 2WPCA 2C73A 1RM6B 1B8SA 2GF3A 2XGZA 3N4FA 4H4XA 3PWIA 3SZCA 1EL7A 3GWDA 1S3BA 3IF9A 4YSYA 3URHA 4OPTA 2ZBWA 4JNQA 3C96A 3FXGA 1ZX9A 1PBFA 2RGHA 2XDOA 3CIRA 1IUWA 3Q45A 2PYXA 3QKEA
chains in the Genus database with same CATH topology
2YLTA 3L5OA 3UTGA 3CPJG 3CN8A 4WX1A 3UKHA 1PDHA 3GDNA 3I3LA 3IHGA 4UP3A 4USQA 4X4JA 3D1CA 1OJ9A 3HYVA 2W0HA 4EQWA 5U25A 1M6IA 2GMJA 1KF6A 1H82A 3GYIA 3T14A 3GSIA 3NH3X 4YKGA 2XVHA 1XPQA 5EBKA 2WBAA 5TR3A 3UTHA 4H2QA 4H2PA 2Y6QA 3ISHA 1B5QA 3D8XA 3L1RA 3T0KA 4B66A 2V3AA 4LA1A 1LQUA 3D9XA 5JCIA 2X50A 1XDIA 3CNPA 4HA6A 1K4QA 1H83A 2FJEA 5KXJA 2E5VA 1RP0A 1X31B 1PHHA 4RG3A 4AOSA 1GRHA 1NHSA 3RP7A 2Q7VA 2R9ZA 1GPEA 1FECA 4OCGA 3SZ0A 3B6DA 2Q0KA 4A6NB 3AD9B 4OPIA 1GTEA 1K0IA 2R45A 1KFYA 3ATRA 4HB9A 3O0HA 3T37A 1REOA 5LV9A 3E1TA 3P1WA 4KX6A 3LADA 3PG6A 4U8OA 5BUKA 4K22A 5JCKA 4TM3A 1E39A 2C3CA 4GR1A 4CNJA 1VDCA 3CNSA 3NN0X 2WPFA 1H84A 1O94A 1PXCA 2I0ZA 2JAEA 3ICSA 3T2KA 1D4CA 1JRXA 1NENA 2VVLG 3AE5A 2YG5A 3ALLA 2GV8A 2CDUA 2X99A 1BKWA 1L0VA 3H4KA 1LJ1A 4H2NA 4G6HA 2WHDA 5L46A 1GRAA 1CHUA 1KNPA 3AEBA 3CGEA 2XVEA 3GD3A 1JNRA 2JKCA 2YLZA 2AAQA 3KPFA 3QJ4A 3SY4A 4C74A 4YTNA 3LZXA 2YM1A 5U63A 3CPHG 1Y56A 4CBQA 1LV0A 1TRBA 4DNAA 1GESA 1S2QA 1KNRA 4OPDA 2C7GA 5EB5A 3GYXA 2BC1A 3VRBA 3LB8A 3AD7B 4RSLA 3GD4A 4GUVA 4GCMA 3ZYXA 3CGBA 2WDVA 4Z25A 2GMHA 4II2A 2V5ZA 1D4DA 5BVAA 1Q9IA 2YVJA 2GR2A 1TDEA 2RGOA 5CQFA 1SEZA 4B1BA 2OAMA 2GAGB 1H6VA 4H50A 2XLTA 2J3NA 1CJ4A 1CJCA 2V6OA 4EQXA 1ELIA 4EM4A 2OALA 3NTDA 3KLJA 1OJCA 4FK1A 3SM8A 2GR1A 2E4GA 3H8LA 1N4UA 2XYOA 4BK2A 1NPXA 1PXBA 5HYMA 3EANA 3UP5A 3M13A 4J56A 4NZHA 2NPXA 2ZZBA 1FEAA 3UKFA 4OPGA 1LTXR 2EQ8A 4NEWA 3P4QA 2VQ7A 2TPRA 2X8GA 3OC4A 1NG4A 2E1MA 4GAVA 4PAAA 4U8JA 4II3A 4YXDA 2WS3A 4UDPA 2DKIA 4G73A 4JDRA 5FMHA 1DXLA 4Y4NA 4Z2UA 4G74A 1NAAA 4TM0A 3NG7X 3DJEA 4Z44A 2ZZ0A 4AP3A 1GTHA 3FBSA 1N4WA 2XFNA 4G9KA 1KN0A 1M64A 2C66A 2C65A 3AEEA 3AE2A 4A99A 4U8NA 3NK0X 2GH5A 3UOXA 2APGA 3NTAA 3BHKA 4ZCDA 4BV6A 2XFUA 1ONFA 4DSHA 3ITJA 2Z5YA 3S61A 3ZDNA 4EQRA 3K7MX 1EL5A 4CCRA 3NYEA 2QA1A 3SX6A 3DK8A 3IWAA 1Y56B 4IA5A 4XWZA 2VRMA 4ZN0A 1CC4A 1FEBA 4N9XA 5KMQA 2BS4A 1PJ5A 5KMSA 3KA7A 4H4SA 1ZDLA 3BI2A 1NHRA 3EAOA 1F8RA 1KSUA 2C70A 2IVDA 5CKUA 1F6MA 3GMCA 3LXDA 5GSNA 4YTPA 3AE6A 1E6EA 1GRTA 5GRTA 4CRTA 2DKHA 2GEWA 1Q1WA 3NHOX 3AYLA 2XVIA 2IVEA 2XVJA 5FS7A 1Z6LA 2YLXA 2YLSA 2YR6A 4U8LA 3CPIG 1HYUA 3R9UA 4OPLA 4YSHA 4TM1A 4C77A 4CNKA 1BGJA 3CNDA 1H2IA 2BC0A 2GRTA 3NYFA 4EMIA 2ZZCA 4D04A 2YQUA 3GRSA 1DJQA 1BWCA 3B3RA 4IV9A 4H4TA 1GSNA 4ICYA 2Y6RA 5ER0A 2PHHA 2XLSA 3AEDA 3RP6A 2A89A 4B64A 3HYXA 3FPZA 3NRNA 5C3JA 3Q9TA 3AE8A 3SFEA 4YSXA 4JQ9A 3AD8B 4GRTA 1N1PA 2BRYA 3H8IA 3AEAA 3CMMA 3DA1A 1PN0A 1TDOA 2YG7A 3WE0A 3QFBA 4APNA 1H86A 1QO8A 1Y0PA 2R4EA 4U2LA 4C3XA 2FJBA 2YVFA 1AOGA 3LOVA 2WDQA 3DGHA 1GETA 1QJDA 3LJPA 1GRFA 4I58A 3DJDA 4U2SA 2XCGA 3UOYA 4H7UA 2GQWA 2WU5A 2NVKX 2WU2A 2X3NA 3VRAA 3ICRA 4CY6A 1GXFA 4J36A 3VR9A 4Z26A 2A8XA 1CJ3A 1OJAA 1O95A 1DNCA 1IUXA 3C4AA 2YAUA 3S5WA 4C3YA 3ABVA 4XWRA 3PO7A 5KOXA 2GR0A 3EF6A 3AWIA 3ICTA 1RYIA 4EIPA 2WP6A 1ZMDA 1FL2A 1ZP0A 1VG0A 5U1OA 3NT6A 3GRTA 2VOUA 3KKJA 3UTFA 3T31A 3VR8A 1XANA 4M52A 1CC2A 1JRYA 3UKKA 1D4EA 4NNJA 1V59A 3V3OA 5KMPA 2GB0A 1CJ2A 1BF3A 2XFQA 2JB2A 1E1NA 3BNUA 3QSSA 1PXAA 1TYPA 4YT0A 2QAEA 4LU6A 3IHMA 4BJZA 4FX9A 5J60A 2H89A 2V3BA 3AE7A 4O5UA 2WOWA 4GF7A 2X8CA 5BRTA 5FS6A 2YR4A 2R46A 2YG6A 4B68A 1D7YA 2WP9A 5FS8A 3JSKA 3NYCA 3UOZA 1FCDA 4RG4A 4BJYA 2Z5XA 1COYA 1ZY8A 3BI4A 4AT0A 5M10A 2GVCA 3LZWA 2R4JA 2WPEA 2VQBA 4U8MA 3DJJA 2YM2A 3DK4A 2EQ7A 3SXIA 2WOIA 2XVFA 2B7RA 4KPRA 1GT8A 1D7LA 3QSEA 4U2TA 5KWFA 4MJWA 4YTMA 3P4SA 1PS9A 3GWFA 4B69A 4P9SA 1L9CA 3SZFA 1NHQA 3IC9A 1PBCA 1DOEA 5EB4A 2VVLA 3C4NA 5KOWA 2R0GA 1JEHA 4AOXA 5KVIA 1IUTA 4NEVA 4JN9A 2XFPA 4JNAA 1KSSA 2FJDA 3HYWA 1PBDA 1EL9A 2CULA 1BGNA 4AT2A 4EQSA 3EPTA 1F3PA 2EQ9A 3NIXA 1GALA 2H88A 1K0LA 4C5OA 1EBDA 2B7SA 3BNMA 3QVRA 4IA6A 1GREA 3QSMA 3V3NA 4NTEA 4K7ZA 4U8KA 2C75A 2R0PA 4CCQA 4ADWA 2C72A 2BCPA 1YY5A 3NN6X 2TMDA 3T2YA 4YWOA 1GV4A 3CGDA 1YQ4A 4LIIA 1Q1RA 3II4A 2ARDA 4H4RA 2C3DA 1B4VA 4J2WA 1IUUA 4BK3A 1MXTA 2WESA 4Z24A 1GRGA 2ACZA 3FMWA 1E7PA 3RHAA 3AE1A 5IQ1A 4ECHA 3ATQA 3CNTA 3CNJA 4TM4A 4EM3A 1KDGA 2XLUA 1VRQB 2YLRA 4OVIA 2YG4A 4Y4MA 2WEUA 3UTEA 5DBJA 1K0JA 2IIDA 4Z2TA 4H4YA 3GYJA 3SZWA 2XLRA 3FG2P 2JB1A 1L9EA 2BYBA 1ZKQA 4EMJA 1OJTA 5C2TA 1YQ3A 1YKJA 3KU9A 3KVEA 4AP1A 4Y4LA 2C76A 1DOCA 5JCMA 4Z43A 3K7QX 3UCLA 5IPYA 1CBOA 2V60A 1S2YA 1JOAA 3V76A 2CVJA 4UDQA 2B9XA 2QCUA 5JCNA 4YSZA 5KVHA 1BZLA 3PS9A 4U8PA 4UDRA 5M0ZA 2JK6A 4BURA 3G5SA 5FS9A 3AECA 3NK1X 3SGLA 2V61A 2BS3A 3UP4A 4Z2RA 3FIMB 1CL0A 4H4ZA 3ALJA 4K5RA 1TDNA 2FJAA 5HXIA 3T2ZA 4E0VA 1LPFA 3PVCA 4A65A 2YLWA 2JBVA 4BK1A 1P2HA 3CTYA 2BK3A 2GQFA 1IUSA 1TDKA 3QFAA 1L9DA 1N4VA 4FDCB 4IVMB 4B65A 3NKSA 3F8DA 1VG9A 1DODA 4DSGA 1GNDA 1JNZA 4DGKA 3K30A 1IUVA 3SFDA 2YVGA 3RNMA 5HY5A 4J34A 4U8IA 3NLCA 3AEFA 3KPKA 1D5TA 3UKQA 4NTCA 4GDPA 2GAHB 4H4PA 4IVOB 2RGJA 3BHFA 2FBWA 1CC6A 1GEUA 3AXBA 3AE9A 3NK2X 3UKPA 1DJNA 5KNLA 2XFOA 5IQ4A 3UKLA 2BCGG 4A5LA 4PABA 1ZMCA 2BABA 2VZ2A 1P2EA 2CFYA 1PBEA 2Q0LA 2WQYA 3NNEA 4H4UA 2A87A 3AB1A 3G5QA 4H2RA 4TLZA 3BI5A 4TLXA 4YKFA 5EOWA 1LQTA 3L8KA 4B63A 2GR3A 1B37A 4K8DA 2B9YA 3G5RA 4CY8A 2BK5A 1LVLA 1GRBA 4J33A 2WETA 3AYIA 5BULA 2R0CA 3KD9A 1ZOVA 1GERA 1IJHA 3DH9A 1F8WA 3SQPA 2BK4A 2HQMA 4J31A 1MO9A 1VQWA 3AE3A 5JCLA 1XHCA 3UKAA 2JB3A 3REDA 4D03A 4H4QA 2BS2A 2O9ZA 1JU2A 3DMEA 4OPCA 3I6DA 1YQZA 1PJ7A 4GAPA 4USRA 3M12A 3HZLA 4JY3A 3AYJA 1TDFA 3RP8A 2B76A 2Q6UA 1NHPA 4K5SA 3DGZA 4G6GA 2C67A 4REKA 5HHFA 3CGCA 1TYTA 1ZOYA 3F8PA 3OZ2A 4H4VA 1JRZA 2YR5A 2B9WA 1UKVG 1O5WA 4I59A 3Q6JA 4X9NA 4J57A 5KRQA 1NDAA 3GMBA 2VRLA 3ALMA 2YWLA 4A9WA 2X8HA 4X9MA 2EQ6A 4OPUA 1H81A 2BRAA 3AEGA 3NGCX 1MOKA 3SYIA 3P4PA 2VVMA 1PBBA 1H7WA 2QA2A 5JRBA 1PJ6A 3COXA 1RSGA 4K2XA 3DJGX 1CF3A 4WCTA 2XLPA 1OJDA 2WDRA 2WOVA 2OLOA 2AQJA 2BA9A 1NEKA 2C4CA 2UZZA 4NWZA 3K7TA 4A7AA 1W4XA 3GDPA 1GOSA 1ZK7A 2WPCA 2BXRA 4XXGA 4EMWA 5J7XA 3VRDB 3ADAB 2C73A 1B8SA 1EL8A 2F5ZA 4A6NA 2GF3A 1S7MA 4GDEA 2AR8A 2WP5A 2RABA 1E1LA 1NG3A 3F8RA 3UOVA 4A79A 4H4XA 4FK1C 4B67A 3SZCA 3M0OA 1DOBA 1EL7A 2YG3A 5KMRA 3DK9A 3GWDA 1S3BA 2C64A 3IF9A 4YSYA 4H4WA 4NTDA 3URHA 3P9UA 3QVPA 2ZBWA 4OPTA 2OA1A 4JNQA 4EIQA 2BACA 3C96A 1F8SA 4JY2A 1E1KA 1ZX9A 3VQRA 1PBFA 3P4RA 4O5QA 3AE4A 2RGHA 4ZCCA 2XDOA 3CIRA 1QLBA 1IUWA 1S3EA 2PYXA 2BXSA 1H7XA 1E1MA 2OLNA 1FOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YLT A;  3UTG A;  3CPJ G;  3CN8 A;  4WX1 A;  3UKH A;  1PDH A;  3GDN A;  3I3L A;  3IHG A;  4UP3 A;  4USQ A;  4X4J A;  3D1C A;  1OJ9 A;  2W0H A;  4EQW A;  5U25 A;  1M6I A;  2GMJ A;  1KF6 A;  1H82 A;  3GYI A;  3GSI A;  3NH3 X;  4YKG A;  2XVH A;  1XPQ A;  5EBK A;  2WBA A;  5TR3 A;  3UTH A;  4H2Q A;  4H2P A;  2Y6Q A;  3ISH A;  1B5Q A;  3D8X A;  3L1R A;  4B66 A;  2V3A A;  4LA1 A;  1LQU A;  5JCI A;  2X50 A;  1XDI A;  3CNP A;  4HA6 A;  1K4Q A;  1H83 A;  2FJE A;  5KXJ A;  2E5V A;  1RP0 A;  1X31 B;  1PHH A;  4RG3 A;  4AOS A;  1GRH A;  1NHS A;  3RP7 A;  2Q7V A;  2R9Z A;  1GPE A;  1FEC A;  4OCG A;  3B6D A;  2Q0K A;  4A6N B;  3AD9 B;  4OPI A;  1GTE A;  1K0I A;  2R45 A;  1KFY A;  3ATR A;  4HB9 A;  3O0H A;  3T37 A;  1REO A;  5LV9 A;  3E1T A;  3P1W A;  4KX6 A;  3LAD A;  4U8O A;  5BUK A;  4K22 A;  5JCK A;  4TM3 A;  1E39 A;  2C3C A;  4GR1 A;  4CNJ A;  1VDC A;  3CNS A;  3NN0 X;  2WPF A;  1H84 A;  1PXC A;  1O94 A;  2I0Z A;  2JAE A;  3ICS A;  1D4C A;  1JRX A;  1NEN A;  2VVL G;  3AE5 A;  2YG5 A;  3ALL A;  2GV8 A;  2CDU A;  2X99 A;  1BKW A;  1L0V A;  3H4K A;  1LJ1 A;  4H2N A;  2WHD A;  5L46 A;  1GRA A;  1CHU A;  1KNP A;  3AEB A;  3CGE A;  2XVE A;  3GD3 A;  1JNR A;  2JKC A;  2YLZ A;  2AAQ A;  3KPF A;  3QJ4 A;  4C74 A;  4YTN A;  3LZX A;  2YM1 A;  5U63 A;  3CPH G;  1Y56 A;  4CBQ A;  1LV0 A;  1TRB A;  4DNA A;  1GES A;  1S2Q A;  1KNR A;  4OPD A;  2C7G A;  5EB5 A;  2BC1 A;  3VRB A;  3LB8 A;  3AD7 B;  4RSL A;  3GD4 A;  4GUV A;  4GCM A;  3ZYX A;  3CGB A;  2WDV A;  4Z25 A;  2GMH A;  2V5Z A;  1D4D A;  5BVA A;  1Q9I A;  2YVJ A;  2GR2 A;  1TDE A;  2RGO A;  5CQF A;  1SEZ A;  4B1B A;  2OAM A;  2GAG B;  1H6V A;  4H50 A;  2XLT A;  2J3N A;  1CJ4 A;  1CJC A;  2V6O A;  4EQX A;  1ELI A;  4EM4 A;  2OAL A;  3NTD A;  3KLJ A;  1OJC A;  4FK1 A;  3SM8 A;  2GR1 A;  2E4G A;  3H8L A;  1N4U A;  2XYO A;  4BK2 A;  1NPX A;  1PXB A;  5HYM A;  3EAN A;  3UP5 A;  3M13 A;  4J56 A;  4NZH A;  2NPX A;  2ZZB A;  1FEA A;  3UKF A;  4OPG A;  1LTX R;  2EQ8 A;  4NEW A;  3P4Q A;  2VQ7 A;  2TPR A;  2X8G A;  3OC4 A;  1NG4 A;  2E1M A;  4PAA A;  4U8J A;  4YXD A;  2WS3 A;  4UDP A;  2DKI A;  4JDR A;  5FMH A;  1DXL A;  4Y4N A;  4Z2U A;  1NAA A;  4TM0 A;  3NG7 X;  3DJE A;  4Z44 A;  2ZZ0 A;  4AP3 A;  1GTH A;  3FBS A;  1N4W A;  2XFN A;  1M64 A;  2C66 A;  2C65 A;  3AEE A;  3AE2 A;  4A99 A;  4U8N A;  3NK0 X;  2GH5 A;  3UOX A;  2APG A;  3NTA A;  3BHK A;  4ZCD A;  4BV6 A;  2XFU A;  1ONF A;  4DSH A;  3ITJ A;  2Z5Y A;  3S61 A;  3ZDN A;  4EQR A;  3K7M X;  1EL5 A;  4CCR A;  3NYE A;  2QA1 A;  3DK8 A;  3IWA A;  1Y56 B;  4IA5 A;  4XWZ A;  2VRM A;  4ZN0 A;  1CC4 A;  1FEB A;  4N9X A;  2BS4 A;  1PJ5 A;  3KA7 A;  4H4S A;  1ZDL A;  3BI2 A;  1NHR A;  3EAO A;  1F8R A;  1KSU A;  2C70 A;  2IVD A;  5CKU A;  1F6M A;  3GMC A;  3LXD A;  5GSN A;  4YTP A;  3AE6 A;  1E6E A;  1GRT A;  5GRT A;  4CRT A;  2DKH A;  2GEW A;  1Q1W A;  3NHO X;  3AYL A;  2XVI A;  2IVE A;  2XVJ A;  5FS7 A;  1Z6L A;  2YLX A;  2YLS A;  2YR6 A;  4U8L A;  3CPI G;  1HYU A;  3R9U A;  4OPL A;  4YSH A;  4TM1 A;  4C77 A;  4CNK A;  1BGJ A;  3CND A;  2BC0 A;  2GRT A;  3NYF A;  4EMI A;  2ZZC A;  4D04 A;  2YQU A;  3GRS A;  1DJQ A;  1BWC A;  3B3R A;  4IV9 A;  4H4T A;  1GSN A;  4ICY A;  2Y6R A;  5ER0 A;  2PHH A;  2XLS A;  3AED A;  3RP6 A;  2A89 A;  4B64 A;  3FPZ A;  3NRN A;  5C3J A;  3Q9T A;  3AE8 A;  3SFE A;  4YSX A;  4JQ9 A;  3AD8 B;  4GRT A;  1N1P A;  3H8I A;  3AEA A;  3WE0 A;  3DA1 A;  1PN0 A;  1TDO A;  2YG7 A;  4Z43 A;  3QFB A;  4APN A;  1H86 A;  1QO8 A;  1Y0P A;  2R4E A;  4U2L A;  4C3X A;  2FJB A;  2YVF A;  1AOG A;  3LOV A;  2WDQ A;  3DGH A;  1GET A;  1QJD A;  3LJP A;  1GRF A;  4I58 A;  3DJD A;  4U2S A;  2XCG A;  3UOY A;  4H7U A;  2GQW A;  2WU5 A;  2NVK X;  2WU2 A;  2X3N A;  3VRA A;  3ICR A;  4CY6 A;  1GXF A;  4J36 A;  3VR9 A;  4Z26 A;  2A8X A;  1CJ3 A;  1OJA A;  1O95 A;  1DNC A;  1IUX A;  3C4A A;  2YAU A;  3S5W A;  4C3Y A;  3ABV A;  4XWR A;  3PO7 A;  5KOX A;  2GR0 A;  3EF6 A;  3AWI A;  3ICT A;  1RYI A;  4EIP A;  2WP6 A;  1ZMD A;  1FL2 A;  1ZP0 A;  1VG0 A;  5U1O A;  3NT6 A;  3GRT A;  2VOU A;  3KKJ A;  3UTF A;  3VR8 A;  1XAN A;  4M52 A;  1CC2 A;  1JRY A;  3UKK A;  1D4E A;  1V59 A;  3V3O A;  2GB0 A;  1CJ2 A;  1BF3 A;  2XFQ A;  2JB2 A;  1E1N A;  3BNU A;  3QSS A;  1PXA A;  1TYP A;  4YT0 A;  2QAE A;  4LU6 A;  3IHM A;  4BJZ A;  4FX9 A;  5J60 A;  2H89 A;  2V3B A;  3AE7 A;  4O5U A;  2WOW A;  4GF7 A;  2X8C A;  5BRT A;  5FS6 A;  2YR4 A;  2R46 A;  2YG6 A;  4B68 A;  1D7Y A;  2WP9 A;  5FS8 A;  3JSK A;  3NYC A;  3UOZ A;  1FCD A;  4RG4 A;  4BJY A;  2Z5X A;  1COY A;  1ZY8 A;  3BI4 A;  4AT0 A;  5M10 A;  2GVC A;  3LZW A;  2R4J A;  2WPE A;  2VQB A;  4U8M A;  3DJJ A;  2YM2 A;  3DK4 A;  2EQ7 A;  2WOI A;  2XVF A;  2B7R A;  4KPR A;  1GT8 A;  1D7L A;  3QSE A;  4U2T A;  5KWF A;  4MJW A;  4YTM A;  3P4S A;  1PS9 A;  3GWF A;  4B69 A;  4P9S A;  1L9C A;  1NHQ A;  3IC9 A;  1PBC A;  1DOE A;  5EB4 A;  2VVL A;  3C4N A;  5KOW A;  2R0G A;  1JEH A;  4AOX A;  5KVI A;  1IUT A;  4NEV A;  4JN9 A;  2XFP A;  4JNA A;  1KSS A;  2FJD A;  1PBD A;  1EL9 A;  2CUL A;  1BGN A;  4AT2 A;  4EQS A;  3EPT A;  1F3P A;  2EQ9 A;  3NIX A;  1GAL A;  2H88 A;  1K0L A;  4C5O A;  1EBD A;  2B7S A;  3BNM A;  3QVR A;  4IA6 A;  1GRE A;  3QSM A;  3V3N A;  4NTE A;  4K7Z A;  4U8K A;  2C75 A;  2R0P A;  4CCQ A;  4ADW A;  2C72 A;  2BCP A;  1YY5 A;  3NN6 X;  2TMD A;  4YWO A;  1GV4 A;  3CGD A;  1YQ4 A;  4LII A;  1Q1R A;  3II4 A;  2ARD A;  4H4R A;  2C3D A;  1B4V A;  4J2W A;  1IUU A;  4BK3 A;  1MXT A;  2WES A;  4Z24 A;  1GRG A;  2ACZ A;  3FMW A;  1E7P A;  3RHA A;  3AE1 A;  5IQ1 A;  4ECH A;  3ATQ A;  3CNT A;  3CNJ A;  4TM4 A;  4EM3 A;  1KDG A;  2XLU A;  1VRQ B;  2YLR A;  4OVI A;  2YG4 A;  4Y4M A;  2WEU A;  3UTE A;  5DBJ A;  1K0J A;  2IID A;  4Z2T A;  4H4Y A;  3GYJ A;  2XLR A;  3FG2 P;  2JB1 A;  1L9E A;  2BYB A;  1ZKQ A;  4EMJ A;  1OJT A;  5C2T A;  1YQ3 A;  1YKJ A;  3KU9 A;  3KVE A;  4AP1 A;  4Y4L A;  2C76 A;  1DOC A;  5JCM A;  3K7Q X;  3UCL A;  5IPY A;  1CBO A;  2V60 A;  1S2Y A;  1JOA A;  3V76 A;  2CVJ A;  4UDQ A;  2B9X A;  2QCU A;  5JCN A;  4YSZ A;  5KVH A;  1BZL A;  3PS9 A;  4U8P A;  4UDR A;  5M0Z A;  2JK6 A;  4BUR A;  3G5S A;  5FS9 A;  3AEC A;  3NK1 X;  3SGL A;  2V61 A;  2BS3 A;  3UP4 A;  4Z2R A;  3FIM B;  1CL0 A;  4H4Z A;  3ALJ A;  4K5R A;  1TDN A;  2FJA A;  5HXI A;  4E0V A;  1LPF A;  3PVC A;  4A65 A;  2YLW A;  2JBV A;  4BK1 A;  1P2H A;  3CTY A;  2BK3 A;  2GQF A;  1IUS A;  1TDK A;  3QFA A;  1L9D A;  1N4V A;  4FDC B;  4IVM B;  4B65 A;  3NKS A;  3F8D A;  1VG9 A;  1DOD A;  4DSG A;  1GND A;  1JNZ A;  4DGK A;  3K30 A;  1IUV A;  3SFD A;  2YVG A;  3RNM A;  5HY5 A;  4J34 A;  4U8I A;  3NLC A;  3AEF A;  1D5T A;  3UKQ A;  4NTC A;  4GDP A;  2GAH B;  4H4P A;  4IVO B;  2RGJ A;  3BHF A;  2FBW A;  1CC6 A;  1GEU A;  3AXB A;  3AE9 A;  3NK2 X;  3UKP A;  1DJN A;  2XFO A;  5IQ4 A;  3UKL A;  2BCG G;  4A5L A;  4PAB A;  1ZMC A;  2BAB A;  2VZ2 A;  1P2E A;  2CFY A;  1PBE A;  2Q0L A;  2WQY A;  3NNE A;  4H4U A;  2A87 A;  3AB1 A;  3G5Q A;  4H2R A;  4TLZ A;  3BI5 A;  4TLX A;  4YKF A;  5EOW A;  1LQT A;  3L8K A;  4B63 A;  2GR3 A;  1B37 A;  4K8D A;  2B9Y A;  3G5R A;  4CY8 A;  2BK5 A;  1LVL A;  1GRB A;  4J33 A;  2WET A;  3AYI A;  5BUL A;  2R0C A;  3KD9 A;  1ZOV A;  1GER A;  1IJH A;  3DH9 A;  1F8W A;  3SQP A;  2BK4 A;  2HQM A;  4J31 A;  1MO9 A;  1VQW A;  3AE3 A;  5JCL A;  1XHC A;  3UKA A;  2JB3 A;  3RED A;  4D03 A;  4H4Q A;  2BS2 A;  2O9Z A;  1JU2 A;  3DME A;  4OPC A;  3I6D A;  1YQZ A;  1PJ7 A;  4USR A;  3M12 A;  3HZL A;  4JY3 A;  3AYJ A;  1TDF A;  3RP8 A;  2B76 A;  2Q6U A;  1NHP A;  4K5S A;  3DGZ A;  2C67 A;  4REK A;  5HHF A;  3CGC A;  1TYT A;  1ZOY A;  3F8P A;  3OZ2 A;  4H4V A;  1JRZ A;  2YR5 A;  2B9W A;  1UKV G;  1O5W A;  4I59 A;  3Q6J A;  4X9N A;  4J57 A;  5KRQ A;  1NDA A;  3GMB A;  2VRL A;  3ALM A;  2YWL A;  4A9W A;  2X8H A;  4X9M A;  2EQ6 A;  4OPU A;  1H81 A;  3AEG A;  3NGC X;  1MOK A;  3P4P A;  2VVM A;  1PBB A;  1H7W A;  2QA2 A;  3COX A;  1PJ6 A;  1RSG A;  4K2X A;  3DJG X;  1CF3 A;  4WCT A;  2XLP A;  1OJD A;  2WDR A;  2WOV A;  2OLO A;  2AQJ A;  2BA9 A;  1NEK A;  2UZZ A;  3K7T A;  4A7A A;  1W4X A;  3GDP A;  1GOS A;  1ZK7 A;  2WPC A;  2BXR A;  4XXG A;  4EMW A;  5J7X A;  3VRD B;  3ADA B;  2C73 A;  1B8S A;  1EL8 A;  2F5Z A;  4A6N A;  2GF3 A;  4GDE A;  2AR8 A;  2WP5 A;  2RAB A;  1E1L A;  1NG3 A;  3F8R A;  3UOV A;  4A79 A;  4H4X A;  4FK1 C;  4B67 A;  3M0O A;  1DOB A;  1EL7 A;  2YG3 A;  3DK9 A;  3GWD A;  1S3B A;  2C64 A;  3IF9 A;  4YSY A;  4H4W A;  4NTD A;  3URH A;  3P9U A;  3QVP A;  2ZBW A;  4OPT A;  2OA1 A;  4JNQ A;  4EIQ A;  2BAC A;  3C96 A;  1F8S A;  4JY2 A;  1E1K A;  1ZX9 A;  3VQR A;  1PBF A;  3P4R A;  4O5Q A;  3AE4 A;  2RGH A;  4ZCC A;  2XDO A;  3CIR A;  1QLB A;  1IUW A;  1S3E A;  2PYX A;  2BXS A;  1H7X A;  1E1M A;  2OLN A;  1FOH A; 
#chains in the Genus database with same CATH topology
 2YLT A;  3DG3 A;  3CN8 A;  4WX1 A;  3FJ4 A;  4USQ A;  3D1C A;  5U25 A;  1IYX A;  3SSZ A;  3P3B A;  4YKG A;  2Y6Q A;  2I5Q A;  2V3A A;  1FFU C;  1X31 B;  4RG3 A;  1NHS A;  3DES A;  2GGH A;  3UCD A;  4OPI A;  3ZVI A;  5LV9 A;  3E1T A;  3P1W A;  4U8O A;  4K22 A;  1SJB A;  4J3Z A;  1JDF A;  1E39 A;  2C3C A;  4JHM A;  3NN0 X;  2WPF A;  1O94 A;  1FO4 A;  3ICS A;  2JAE A;  3VA8 A;  2YG5 A;  2GV8 A;  2CDU A;  2WHD A;  1GRA A;  1CHU A;  2XVE A;  3GD3 A;  2JKC A;  2AAQ A;  2NQL A;  4H19 A;  3LZX A;  1Y56 A;  4CBQ A;  1GES A;  1KNR A;  5EB5 A;  3VRB A;  3LB8 A;  2PPG A;  3ZYX A;  3CGB A;  2WDV A;  5FJU A;  2GMH A;  4II2 A;  1D4D A;  5BVA A;  2YVJ A;  3V5F A;  3ZVH A;  5CQF A;  2GAG B;  4H50 A;  1ZXI C;  1CJC A;  4FK1 A;  3UGV A;  3SM8 A;  1PXB A;  3M13 A;  1VQZ A;  2NPX A;  3GY1 A;  1FEA A;  1BKH A;  2X8G A;  4GAV A;  4U8J A;  4YXD A;  3V3W A;  2WS3 A;  4G73 A;  1DXL A;  4Y4N A;  4G74 A;  3SN4 A;  4TM0 A;  4A6G A;  3DJE A;  2ZZ0 A;  2OO6 A;  1N4W A;  2XFN A;  1KN0 A;  2C65 A;  3AEE A;  4E6M A;  3BHK A;  4GME A;  3MY9 A;  3GC2 A;  3ITJ A;  3S61 A;  1JRP A;  3ZDN A;  4CCR A;  3TQP A;  2VRM A;  3I6E A;  2BS4 A;  1ZDL A;  3JVA A;  1KSU A;  2IVD A;  5GSN A;  1Q1W A;  3NHO X;  2XVJ A;  5FS7 A;  1Z6L A;  3MWC A;  4OPL A;  4YSH A;  4CNK A;  3CND A;  3NYF A;  2YQU A;  4H4T A;  3AED A;  4B64 A;  5C3J A;  3Q9T A;  3SFE A;  3H8I A;  3DA1 A;  4Z43 A;  4APN A;  1H86 A;  1Y0P A;  3ES7 A;  1E9I A;  2YVF A;  3CYJ A;  1GRF A;  2OPJ A;  2P0I A;  2WU5 A;  2NVK X;  4IP4 A;  3VRA A;  1GXF A;  4J36 A;  3VR9 A;  4EWJ A;  1CJ3 A;  1OJA A;  1IUX A;  4C3Y A;  3ABV A;  4XWR A;  3ICT A;  1R6W A;  2FYM A;  1RYI A;  4EIP A;  1FL2 A;  1ZP0 A;  1VG0 A;  3UTF A;  1XAN A;  2PSN A;  4M52 A;  3UKK A;  5KMP A;  1E1N A;  4YT0 A;  2QAE A;  2H89 A;  3CXO A;  2HNE A;  3R0K A;  3AE7 A;  5BRT A;  5FS6 A;  4B68 A;  3NRZ B;  1KD0 A;  1ZY8 A;  2EQ7 A;  1ONE A;  1STZ A;  4KPR A;  3QSE A;  3P4S A;  1PS9 A;  3GWF A;  1L9C A;  4MMW A;  3SZF A;  5KOW A;  4DWD A;  2MNR A;  2FJD A;  1PBD A;  2CUL A;  2EQ9 A;  2P8C A;  3QVR A;  3BOX A;  3QSM A;  4NTE A;  4K7Z A;  2C72 A;  4F4R A;  2TMD A;  3T2Y A;  4YWO A;  2ARD A;  4J2W A;  1MXT A;  4Z24 A;  1WUE A;  2ACZ A;  1E7P A;  3AE1 A;  3ATQ A;  3H12 A;  4Y4M A;  4H4Y A;  2XLR A;  2JB1 A;  3KVE A;  3EKG A;  3K7Q X;  3UCL A;  4U8P A;  2RDX A;  2JK6 A;  3AEC A;  2OZT A;  3UP4 A;  4Z2R A;  4H4Z A;  2JBV A;  3CTY A;  2BK3 A;  1TDK A;  1L9D A;  1DOD A;  4DSG A;  1GND A;  3QTP A;  3K30 A;  2PTX A;  4H2H A;  3BHF A;  2FBW A;  1GEU A;  1EBH A;  3NK2 X;  4A5L A;  2BAB A;  1PBE A;  2WQY A;  1LQT A;  4K8D A;  3R1Z A;  2B9Y A;  3G5R A;  1LVL A;  3P0W A;  3A7R A;  1ZOV A;  1F8W A;  1XPY A;  3AE3 A;  6ENL A;  2OFJ A;  5G5G B;  3HZL A;  4JY3 A;  2Q6U A;  3SJN A;  5HHF A;  3PFR A;  1TYT A;  3OZ2 A;  4I59 A;  1EBG A;  4JN7 A;  4X9M A;  4OPU A;  3P4P A;  3CB3 A;  4E4F A;  3COX A;  3DJG X;  4WCT A;  2XLP A;  1OJD A;  1NEK A;  2UZZ A;  3K7T A;  1GOS A;  2E5A A;  4EMW A;  5J7X A;  3VRD B;  4HCD A;  3ADA B;  3AM9 A;  2F5Z A;  1S7M A;  4GDE A;  2AR8 A;  3H8A A;  3FV9 A;  2RAB A;  2E3T A;  2GSH A;  1N60 C;  2C64 A;  2FKP A;  3TW9 A;  4EIQ A;  4J1O A;  3V5C A;  3P4R A;  4O5Q A;  2HXT A;  1S3E A;  3CPJ G;  1PDH A;  3I3L A;  4UP3 A;  3RO6 A;  1M6I A;  3DGB A;  2OQY A;  4FI4 A;  1KF6 A;  3GYI A;  3GSI A;  2XVH A;  5TR3 A;  3IK4 A;  4H2P A;  3ISH A;  2OKT A;  4LA1 A;  3D9X A;  2X50 A;  4HA6 A;  2FJE A;  3T4W A;  4AOS A;  1PDZ A;  3RP7 A;  1FEC A;  4OCG A;  1X2G A;  1XS2 A;  3SZ0 A;  4G7F A;  1FHU A;  3DIP A;  4TVW A;  1REO A;  3PG6 A;  5EU9 A;  3R10 A;  5JCK A;  4TM3 A;  4GR1 A;  4CNJ A;  3CNS A;  1H84 A;  1PXC A;  1F9C A;  4X2P A;  2X99 A;  3H4K A;  4Z17 A;  3JW7 A;  5L46 A;  1KNP A;  3KPF A;  1MDL A;  4YTN A;  3I6T A;  4HCH A;  4KT2 A;  1LV0 A;  1TRB A;  1S2Q A;  4OPD A;  2C7G A;  2BC1 A;  3AD7 B;  3QPE A;  4GUV A;  4GCM A;  4DXK A;  1N5X A;  4Z25 A;  1Q9I A;  3NVY B;  4HPN A;  2OAM A;  2XLT A;  4EM4 A;  3NTD A;  2GR1 A;  2E4G A;  4BK2 A;  5HYM A;  3NFU A;  3UP5 A;  4NZH A;  3I4K A;  1LTX R;  2EQ8 A;  1NG4 A;  4PAA A;  2E1M A;  3T8Q A;  2P88 A;  4JDR A;  1NAA A;  1TE6 A;  1OEP A;  3AE2 A;  4U8N A;  3TWA A;  2GH5 A;  2ONE A;  2CHR A;  3NTA A;  4BV6 A;  3N6H A;  3K7M X;  3R07 C;  3SQS A;  1Y56 B;  3RGT A;  1CC4 A;  1FEB A;  4N9X A;  1PJ5 A;  3KA7 A;  3EAO A;  2C70 A;  3LXD A;  4YTP A;  3AE6 A;  1GRT A;  2XVI A;  2GDQ A;  2YR6 A;  1BGJ A;  1H2I A;  2BC0 A;  2GRT A;  3H70 A;  4EMI A;  2ZZC A;  4D04 A;  3P93 A;  1BWC A;  3B3R A;  4IV9 A;  2PHH A;  3RP6 A;  2A89 A;  3MKC A;  3NRN A;  3RIT A;  3AE8 A;  4JQ9 A;  3AD8 B;  2BRY A;  3CMM A;  1PN0 A;  1TDO A;  3QFB A;  4M0X A;  4U2L A;  2FJB A;  2POZ A;  4KEM A;  1GET A;  3DJD A;  2GGJ A;  2GQW A;  2WU2 A;  4Z26 A;  5FJP A;  1DNC A;  3S5W A;  3C4A A;  2YAU A;  4A3R A;  4GYP A;  3PO7 A;  3EF6 A;  5U1O A;  2VOU A;  3KKJ A;  3ETR B;  1CC2 A;  1D4E A;  4NNJ A;  2GB0 A;  5ENL A;  1CJ2 A;  2JB2 A;  3PK7 A;  4BJZ A;  5J60 A;  4O5U A;  2X8C A;  3CT2 A;  3NYC A;  3NO1 A;  2P8B A;  3BSM A;  1COY A;  3BI4 A;  5M10 A;  2R4J A;  4U8M A;  3DJJ A;  3DK4 A;  3SXI A;  1GT8 A;  3K1G A;  4MJW A;  4YTM A;  4GIR A;  1PBC A;  2VVL A;  3C4N A;  5KVI A;  1IUT A;  2QDE A;  4JN9 A;  2XFP A;  4EQS A;  1K0L A;  4C5O A;  1EBD A;  3BNM A;  4IA6 A;  1GRE A;  4U8K A;  2R0P A;  1KKO A;  3NN6 X;  1GV4 A;  4LII A;  1Q1R A;  3II4 A;  2C3D A;  1B4V A;  5IQ1 A;  4ECH A;  4TM4 A;  4EM3 A;  1KDG A;  2WEU A;  3UTE A;  4Z2T A;  3SZW A;  1ZKQ A;  1OJT A;  3KU9 A;  3RRA A;  1YKJ A;  4AP1 A;  2C76 A;  5IPY A;  2CVJ A;  2QCU A;  1BZL A;  4UDR A;  1JPD X;  3EEZ A;  3S47 A;  5FS9 A;  1TDN A;  2FJA A;  3T2Z A;  4E0V A;  1LPF A;  3PVC A;  2AKM A;  1IUS A;  4IVM B;  1JNZ A;  2YVG A;  5HY5 A;  4J34 A;  3NLC A;  3AEF A;  3ZLG A;  2ZC8 A;  1D5T A;  4NTC A;  4H4P A;  4IVO B;  3UJF A;  4GFI A;  3MQT A;  1DJN A;  2XFO A;  4PAB A;  1P2E A;  4A35 A;  3AB1 A;  2A87 A;  4B63 A;  1B37 A;  3NZG A;  2W3S A;  1GER A;  1EC9 A;  3SQP A;  2HQM A;  4J31 A;  1MO9 A;  1VQW A;  2JB3 A;  4H4Q A;  3OTR A;  1JU2 A;  1YQZ A;  3N4E A;  3DGZ A;  3AN1 A;  3CGC A;  1JRO A;  3F8P A;  2B9W A;  4IT1 A;  3ALM A;  1DTN A;  2DW7 A;  4A9W A;  1P48 A;  4HNC A;  3AEG A;  3NGC X;  1MOK A;  2VVM A;  1H7W A;  2QA2 A;  2PMQ A;  2WDR A;  1RVK A;  2BA9 A;  2C4C A;  4NWZ A;  3GDP A;  5BOF A;  1EL8 A;  4A6N A;  4KPL A;  7ENL A;  2AL1 A;  1NG3 A;  3F8R A;  3UOV A;  4FK1 C;  5KMR A;  3VDG A;  4NTD A;  3QVP A;  2BAC A;  2DW6 A;  4JY2 A;  1E1K A;  1H7X A;  2OLN A;  4JN8 A;  1FOH A;  3L5O A;  3UTG A;  3UKH A;  3IHG A;  3R11 A;  1OJ9 A;  3QLD A;  1XPQ A;  2WBA A;  3UTH A;  4H2Q A;  1B5Q A;  3D8X A;  3L1R A;  4B66 A;  5JCI A;  1XDI A;  3CNP A;  2OX4 A;  5KXJ A;  1RP0 A;  1PHH A;  2Q0K A;  4A6N B;  1SJD A;  1GTE A;  1K0I A;  2GGI A;  3ATR A;  1MDR A;  4HB9 A;  4KX6 A;  5BUK A;  3T9P A;  1VDC A;  2I0Z A;  3AE5 A;  3ALL A;  1LJ1 A;  4H2N A;  4G6H A;  3OW1 A;  3CGE A;  1JNR A;  2YLZ A;  2YM1 A;  1KCZ A;  4DNA A;  4HCL A;  4RSL A;  2QGY A;  3HRD C;  2V5Z A;  2GR2 A;  1SEZ A;  1H6V A;  3MZN A;  4DGK A;  3KLJ A;  1OJC A;  1NPX A;  2ZZB A;  3FCP A;  4OPG A;  4NEW A;  3DG6 A;  1ELS A;  3P4Q A;  2TPR A;  3OC4 A;  3OZM A;  4IL0 A;  4UDP A;  1P43 A;  2PU0 A;  4Z2U A;  1MNS A;  3GD6 A;  1NU5 A;  4AP3 A;  3NG7 X;  3FBS A;  2QDD A;  2C66 A;  4A99 A;  3UOX A;  4DSH A;  2XFU A;  1ONF A;  2Z5Y A;  2HXU A;  2PP3 A;  4EQR A;  1EL5 A;  2PP0 A;  3ZVH B;  3TJI A;  3SX6 A;  3IWA A;  4IA5 A;  4XWZ A;  2PCE A;  3SR6 B;  3S5S A;  5KMS A;  3CXB A;  4H4S A;  2OG9 A;  1F6M A;  3GMC A;  1E6E A;  4IHC A;  1SJC A;  2W54 A;  2DKH A;  2OZ8 A;  2YLX A;  4MGG A;  4GYP C;  2OZ3 A;  1DJQ A;  1GSN A;  3HYX A;  3SN0 A;  4E5T A;  1NEL A;  3B9J B;  1N1P A;  3WE0 A;  1QO8 A;  2R4E A;  4C3X A;  3LOV A;  2WDQ A;  2XSX A;  1QJD A;  4I58 A;  4U2S A;  3ICR A;  2A8X A;  4IZG A;  3U9I A;  3HPF A;  3VCC A;  4G8T A;  2WP6 A;  3NT6 A;  3TWB A;  3GRT A;  3T31 A;  3V3O A;  4TVY A;  3UXL A;  1BF3 A;  2XFQ A;  3BNU A;  1PXA A;  3IHM A;  4FX9 A;  3UJR A;  2GL5 A;  2R46 A;  3JSK A;  2Z5X A;  2PA6 A;  2WPE A;  2PS2 A;  2B7R A;  4U2T A;  5KWF A;  4P9S A;  3MSY A;  3DEQ A;  1NHQ A;  3IC9 A;  1DOE A;  2R0G A;  4JNA A;  3DFY A;  3A7A A;  1KSS A;  3VFC A;  2W3R A;  4AT2 A;  4YWS A;  1F3P A;  2H88 A;  4K2S A;  2C75 A;  4H4R A;  4GGH A;  1IUU A;  3ENL A;  2WES A;  2GGG A;  2AKZ A;  3FMW A;  3RHA A;  3CNT A;  4OVI A;  2YG4 A;  5DBJ A;  5BOE A;  3FG2 P;  1L9E A;  1BQG A;  2BYB A;  4Y4L A;  1DOC A;  5JCM A;  1CBO A;  1S2Y A;  3V76 A;  4UDQ A;  5JCN A;  4YSZ A;  5KVH A;  3PS9 A;  1V97 A;  5M0Z A;  4BUR A;  2PTW A;  3G5S A;  3VCN A;  3SGL A;  3NVZ B;  3FIM B;  5HXI A;  1JPM A;  4A65 A;  4DYE A;  4BK1 A;  5J04 A;  4KWS A;  2GQF A;  3NKS A;  1VG9 A;  4ROP A;  3SFD A;  1SJA A;  4U8I A;  3KPK A;  3UKQ A;  2GAH B;  3B97 A;  1CC6 A;  3AXB A;  1YEY A;  4FP1 A;  3UKP A;  4ZA0 A;  3AMZ A;  2OQH A;  3OPS A;  4H4U A;  4TLZ A;  4TLX A;  4YKF A;  5EOW A;  3L8K A;  4J33 A;  3KD9 A;  1N62 C;  1IJH A;  3DH9 A;  1XHC A;  3UKA A;  1KKR A;  3RED A;  4D03 A;  3TTE A;  2ZAD A;  2HZG A;  4OPC A;  3I6D A;  4GAP A;  3DER A;  3M12 A;  3AYJ A;  4REK A;  4H4V A;  1JRZ A;  2YR5 A;  1O5W A;  3Q6J A;  4J57 A;  1NDA A;  2VRL A;  2XH0 A;  2YWL A;  2BRA A;  3SYI A;  1PJ6 A;  1CF3 A;  4ENL A;  2OLO A;  2AQJ A;  3SBF A;  4A7A A;  3DDM A;  1W4X A;  1ZK7 A;  2BXR A;  4XXG A;  1R0M A;  4E8G A;  3HW2 A;  2WP5 A;  1E1L A;  4A79 A;  4B67 A;  1TZZ A;  3M0O A;  1DOB A;  3QN3 A;  2YG3 A;  1VDV A;  2AL2 B;  3CK5 A;  3DK9 A;  2PGW A;  4H4W A;  3A7U A;  3P9U A;  2OA1 A;  3D46 A;  2QJJ A;  1F8S A;  3VQR A;  3AE4 A;  4ZCC A;  1QLB A;  3TJ4 A;  2BXS A;  1E1M A;  2PTZ A;  4IL2 A;  3GDN A;  3EUB 3;  4X4J A;  3HYV A;  2W0H A;  4EQW A;  3U4F A;  2GMJ A;  1H82 A;  3T14 A;  3TOY A;  3NH3 X;  5EBK A;  2POD A;  3T0K A;  1LQU A;  1W6T A;  1K4Q A;  1H83 A;  2E5V A;  1GRH A;  2Q7V A;  2R9Z A;  1GPE A;  3VC6 A;  3THU A;  2PTY A;  1MRA A;  3B6D A;  5G5H B;  3AD9 B;  2QVH A;  2R45 A;  3V4B A;  1EC7 A;  1KFY A;  3T37 A;  3O0H A;  3LAD A;  3NS1 B;  4HNL A;  5FJT A;  4IP5 A;  3ZLH A;  2XH7 A;  3FYY A;  3T2K A;  1D4C A;  1JRX A;  1NEN A;  2VVL G;  1BKW A;  1L0V A;  3AEB A;  4K1W A;  3IJQ A;  3SY4 A;  3QJ4 A;  4C74 A;  3SN1 A;  2QJM A;  5U63 A;  3CPH G;  2PU1 A;  3GYX A;  3GO2 A;  3GD4 A;  2XH2 A;  1TKK A;  1TDE A;  3DFH A;  2RGO A;  4B1B A;  2J3N A;  1CJ4 A;  2V6O A;  4EQX A;  1ELI A;  2OAL A;  3H8L A;  1N4U A;  2XYO A;  3BJS A;  3UXK A;  1JCT A;  3EAN A;  4J56 A;  1FHV A;  3UKF A;  2VQ7 A;  4GGB A;  4II3 A;  2DKI A;  5FMH A;  4M6U A;  4Z44 A;  1GTH A;  4G9K A;  1M64 A;  3H7V A;  3NK0 X;  1SB3 B;  2APG A;  4ZCD A;  2O56 A;  3NYE A;  2QA1 A;  3D47 A;  3DK8 A;  4ZN0 A;  5KMQ A;  1WYG A;  4ZOH B;  3BI2 A;  1NHR A;  1F8R A;  5CKU A;  1PDY A;  3UCC A;  5GRT A;  3OP2 A;  4CRT A;  2GEW A;  3AYL A;  2IVE A;  2YLS A;  2W55 A;  3T6C A;  4U8L A;  3STP A;  2AL2 A;  3CPI G;  1HYU A;  3R9U A;  1L8P A;  4TM1 A;  4C77 A;  1FFV C;  3GRS A;  4ICY A;  2Y6R A;  5ER0 A;  2XLS A;  3FPZ A;  4HN8 A;  4YSX A;  4DX3 A;  4GRT A;  3AEA A;  2YG7 A;  4DHG A;  1AOG A;  3KUM A;  3DGH A;  3LJP A;  3UOY A;  2XCG A;  4H7U A;  4MKS A;  2X3N A;  4CY6 A;  2MUC A;  3IJI A;  1O95 A;  5KOX A;  2GR0 A;  3AWI A;  1ZMD A;  4E4U A;  3VR8 A;  1JRY A;  1V59 A;  3QSS A;  1TYP A;  4LU6 A;  2V3B A;  3ZLF A;  2WOW A;  4GF7 A;  3RR1 A;  2YR4 A;  2YG6 A;  4H83 A;  1D7Y A;  2WP9 A;  5FS8 A;  4BJY A;  3UOZ A;  1FCD A;  4RG4 A;  2PP1 A;  3Q4D A;  4AT0 A;  5IDZ A;  2GVC A;  3LZW A;  2VQB A;  3CAW A;  2YM2 A;  2WOI A;  2XVF A;  1D7L A;  3MUC A;  4B69 A;  3OZY A;  5FJR A;  1ECQ A;  4DN1 A;  5EB4 A;  3UJS A;  2QQ6 A;  1JEH A;  4AOX A;  1MUC A;  4NEV A;  1WUF A;  3HYW A;  1EL9 A;  5FJO A;  1BGN A;  3EPT A;  3NIX A;  1GAL A;  1X2H A;  2B7S A;  3V3N A;  4CCQ A;  4ADW A;  2BCP A;  1YY5 A;  3CGD A;  3NVV B;  1YQ4 A;  2OVL A;  4H1Z A;  2OLA A;  4BK3 A;  1GRG A;  3CNJ A;  2XLU A;  1VRQ B;  3NVW B;  2YLR A;  3DG7 A;  1K0J A;  2IID A;  3IJL A;  3GYJ A;  4EMJ A;  5C2T A;  1YQ3 A;  4Z1Y A;  2QJN A;  2V60 A;  1JOA A;  2GGE A;  2B9X A;  3R25 A;  3TCS A;  3NK1 X;  2V61 A;  2BS3 A;  1FIQ B;  1CL0 A;  3ALJ A;  4K5R A;  2YLW A;  1P2H A;  3QFA A;  1N4V A;  4FDC B;  4B65 A;  3F8D A;  1IUV A;  3RNM A;  3VC5 A;  4GDP A;  1N61 C;  3UJE A;  2RGJ A;  1N63 C;  3AE9 A;  2XH4 A;  5KNL A;  5IQ4 A;  1EC8 A;  2BCG G;  3UKL A;  1ZMC A;  2VZ2 A;  2CFY A;  2Q0L A;  3NNE A;  3UJ2 A;  3G5Q A;  4H2R A;  3BI5 A;  3JZU A;  2GR3 A;  4CY8 A;  2BK5 A;  1GRB A;  2WET A;  3AYI A;  5BUL A;  2R0C A;  1T3Q C;  2BK4 A;  5JCL A;  2BS2 A;  2O9Z A;  3DME A;  1PJ7 A;  4USR A;  3NXL A;  3FVD A;  4HYR A;  1TDF A;  3RP8 A;  2B76 A;  1NHP A;  4K5S A;  4G6G A;  2C67 A;  1ZOY A;  3N6J A;  1UKV G;  4X9N A;  1N5W C;  5KRQ A;  2PGE A;  3GMB A;  2X8H A;  2EQ6 A;  2P3Z A;  1H81 A;  1PBB A;  4K8G A;  3PWG A;  5JRB A;  1RSG A;  4K2X A;  4GIS A;  4ZCW A;  2WOV A;  3ES8 A;  3RCY A;  3R0U A;  2WPC A;  2C73 A;  1RM6 B;  1B8S A;  2GF3 A;  2XGZ A;  3N4F A;  4H4X A;  3PWI A;  3SZC A;  1EL7 A;  3GWD A;  1S3B A;  3IF9 A;  4YSY A;  3URH A;  4OPT A;  2ZBW A;  4JNQ A;  3C96 A;  3FXG A;  1ZX9 A;  1PBF A;  2RGH A;  2XDO A;  3CIR A;  1IUW A;  3Q45 A;  2PYX A;  3QKE A; 
#chains in the Genus database with same CATH homology
 2YLT A;  3L5O A;  3UTG A;  3CPJ G;  3CN8 A;  4WX1 A;  3UKH A;  1PDH A;  3GDN A;  3I3L A;  3IHG A;  4UP3 A;  4USQ A;  4X4J A;  3D1C A;  1OJ9 A;  3HYV A;  2W0H A;  4EQW A;  5U25 A;  1M6I A;  2GMJ A;  1KF6 A;  1H82 A;  3GYI A;  3T14 A;  3GSI A;  3NH3 X;  4YKG A;  2XVH A;  1XPQ A;  5EBK A;  2WBA A;  5TR3 A;  3UTH A;  4H2Q A;  4H2P A;  2Y6Q A;  3ISH A;  1B5Q A;  3D8X A;  3L1R A;  3T0K A;  4B66 A;  2V3A A;  4LA1 A;  1LQU A;  3D9X A;  5JCI A;  2X50 A;  1XDI A;  3CNP A;  4HA6 A;  1K4Q A;  1H83 A;  2FJE A;  5KXJ A;  2E5V A;  1RP0 A;  1X31 B;  1PHH A;  4RG3 A;  4AOS A;  1GRH A;  1NHS A;  3RP7 A;  2Q7V A;  2R9Z A;  1GPE A;  1FEC A;  4OCG A;  3SZ0 A;  3B6D A;  2Q0K A;  4A6N B;  3AD9 B;  4OPI A;  1GTE A;  1K0I A;  2R45 A;  1KFY A;  3ATR A;  4HB9 A;  3O0H A;  3T37 A;  1REO A;  5LV9 A;  3E1T A;  3P1W A;  4KX6 A;  3LAD A;  3PG6 A;  4U8O A;  5BUK A;  4K22 A;  5JCK A;  4TM3 A;  1E39 A;  2C3C A;  4GR1 A;  4CNJ A;  1VDC A;  3CNS A;  3NN0 X;  2WPF A;  1H84 A;  1O94 A;  1PXC A;  2I0Z A;  2JAE A;  3ICS A;  3T2K A;  1D4C A;  1JRX A;  1NEN A;  2VVL G;  3AE5 A;  2YG5 A;  3ALL A;  2GV8 A;  2CDU A;  2X99 A;  1BKW A;  1L0V A;  3H4K A;  1LJ1 A;  4H2N A;  4G6H A;  2WHD A;  5L46 A;  1GRA A;  1CHU A;  1KNP A;  3AEB A;  3CGE A;  2XVE A;  3GD3 A;  1JNR A;  2JKC A;  2YLZ A;  2AAQ A;  3KPF A;  3QJ4 A;  3SY4 A;  4C74 A;  4YTN A;  3LZX A;  2YM1 A;  5U63 A;  3CPH G;  1Y56 A;  4CBQ A;  1LV0 A;  1TRB A;  4DNA A;  1GES A;  1S2Q A;  1KNR A;  4OPD A;  2C7G A;  5EB5 A;  3GYX A;  2BC1 A;  3VRB A;  3LB8 A;  3AD7 B;  4RSL A;  3GD4 A;  4GUV A;  4GCM A;  3ZYX A;  3CGB A;  2WDV A;  4Z25 A;  2GMH A;  4II2 A;  2V5Z A;  1D4D A;  5BVA A;  1Q9I A;  2YVJ A;  2GR2 A;  1TDE A;  2RGO A;  5CQF A;  1SEZ A;  4B1B A;  2OAM A;  2GAG B;  1H6V A;  4H50 A;  2XLT A;  2J3N A;  1CJ4 A;  1CJC A;  2V6O A;  4EQX A;  1ELI A;  4EM4 A;  2OAL A;  3NTD A;  3KLJ A;  1OJC A;  4FK1 A;  3SM8 A;  2GR1 A;  2E4G A;  3H8L A;  1N4U A;  2XYO A;  4BK2 A;  1NPX A;  1PXB A;  5HYM A;  3EAN A;  3UP5 A;  3M13 A;  4J56 A;  4NZH A;  2NPX A;  2ZZB A;  1FEA A;  3UKF A;  4OPG A;  1LTX R;  2EQ8 A;  4NEW A;  3P4Q A;  2VQ7 A;  2TPR A;  2X8G A;  3OC4 A;  1NG4 A;  2E1M A;  4GAV A;  4PAA A;  4U8J A;  4II3 A;  4YXD A;  2WS3 A;  4UDP A;  2DKI A;  4G73 A;  4JDR A;  5FMH A;  1DXL A;  4Y4N A;  4Z2U A;  4G74 A;  1NAA A;  4TM0 A;  3NG7 X;  3DJE A;  4Z44 A;  2ZZ0 A;  4AP3 A;  1GTH A;  3FBS A;  1N4W A;  2XFN A;  4G9K A;  1KN0 A;  1M64 A;  2C66 A;  2C65 A;  3AEE A;  3AE2 A;  4A99 A;  4U8N A;  3NK0 X;  2GH5 A;  3UOX A;  2APG A;  3NTA A;  3BHK A;  4ZCD A;  4BV6 A;  2XFU A;  1ONF A;  4DSH A;  3ITJ A;  2Z5Y A;  3S61 A;  3ZDN A;  4EQR A;  3K7M X;  1EL5 A;  4CCR A;  3NYE A;  2QA1 A;  3SX6 A;  3DK8 A;  3IWA A;  1Y56 B;  4IA5 A;  4XWZ A;  2VRM A;  4ZN0 A;  1CC4 A;  1FEB A;  4N9X A;  5KMQ A;  2BS4 A;  1PJ5 A;  5KMS A;  3KA7 A;  4H4S A;  1ZDL A;  3BI2 A;  1NHR A;  3EAO A;  1F8R A;  1KSU A;  2C70 A;  2IVD A;  5CKU A;  1F6M A;  3GMC A;  3LXD A;  5GSN A;  4YTP A;  3AE6 A;  1E6E A;  1GRT A;  5GRT A;  4CRT A;  2DKH A;  2GEW A;  1Q1W A;  3NHO X;  3AYL A;  2XVI A;  2IVE A;  2XVJ A;  5FS7 A;  1Z6L A;  2YLX A;  2YLS A;  2YR6 A;  4U8L A;  3CPI G;  1HYU A;  3R9U A;  4OPL A;  4YSH A;  4TM1 A;  4C77 A;  4CNK A;  1BGJ A;  3CND A;  1H2I A;  2BC0 A;  2GRT A;  3NYF A;  4EMI A;  2ZZC A;  4D04 A;  2YQU A;  3GRS A;  1DJQ A;  1BWC A;  3B3R A;  4IV9 A;  4H4T A;  1GSN A;  4ICY A;  2Y6R A;  5ER0 A;  2PHH A;  2XLS A;  3AED A;  3RP6 A;  2A89 A;  4B64 A;  3HYX A;  3FPZ A;  3NRN A;  5C3J A;  3Q9T A;  3AE8 A;  3SFE A;  4YSX A;  4JQ9 A;  3AD8 B;  4GRT A;  1N1P A;  2BRY A;  3H8I A;  3AEA A;  3CMM A;  3DA1 A;  1PN0 A;  1TDO A;  2YG7 A;  3WE0 A;  3QFB A;  4APN A;  1H86 A;  1QO8 A;  1Y0P A;  2R4E A;  4U2L A;  4C3X A;  2FJB A;  2YVF A;  1AOG A;  3LOV A;  2WDQ A;  3DGH A;  1GET A;  1QJD A;  3LJP A;  1GRF A;  4I58 A;  3DJD A;  4U2S A;  2XCG A;  3UOY A;  4H7U A;  2GQW A;  2WU5 A;  2NVK X;  2WU2 A;  2X3N A;  3VRA A;  3ICR A;  4CY6 A;  1GXF A;  4J36 A;  3VR9 A;  4Z26 A;  2A8X A;  1CJ3 A;  1OJA A;  1O95 A;  1DNC A;  1IUX A;  3C4A A;  2YAU A;  3S5W A;  4C3Y A;  3ABV A;  4XWR A;  3PO7 A;  5KOX A;  2GR0 A;  3EF6 A;  3AWI A;  3ICT A;  1RYI A;  4EIP A;  2WP6 A;  1ZMD A;  1FL2 A;  1ZP0 A;  1VG0 A;  5U1O A;  3NT6 A;  3GRT A;  2VOU A;  3KKJ A;  3UTF A;  3T31 A;  3VR8 A;  1XAN A;  4M52 A;  1CC2 A;  1JRY A;  3UKK A;  1D4E A;  4NNJ A;  1V59 A;  3V3O A;  5KMP A;  2GB0 A;  1CJ2 A;  1BF3 A;  2XFQ A;  2JB2 A;  1E1N A;  3BNU A;  3QSS A;  1PXA A;  1TYP A;  4YT0 A;  2QAE A;  4LU6 A;  3IHM A;  4BJZ A;  4FX9 A;  5J60 A;  2H89 A;  2V3B A;  3AE7 A;  4O5U A;  2WOW A;  4GF7 A;  2X8C A;  5BRT A;  5FS6 A;  2YR4 A;  2R46 A;  2YG6 A;  4B68 A;  1D7Y A;  2WP9 A;  5FS8 A;  3JSK A;  3NYC A;  3UOZ A;  1FCD A;  4RG4 A;  4BJY A;  2Z5X A;  1COY A;  1ZY8 A;  3BI4 A;  4AT0 A;  5M10 A;  2GVC A;  3LZW A;  2R4J A;  2WPE A;  2VQB A;  4U8M A;  3DJJ A;  2YM2 A;  3DK4 A;  2EQ7 A;  3SXI A;  2WOI A;  2XVF A;  2B7R A;  4KPR A;  1GT8 A;  1D7L A;  3QSE A;  4U2T A;  5KWF A;  4MJW A;  4YTM A;  3P4S A;  1PS9 A;  3GWF A;  4B69 A;  4P9S A;  1L9C A;  3SZF A;  1NHQ A;  3IC9 A;  1PBC A;  1DOE A;  5EB4 A;  2VVL A;  3C4N A;  5KOW A;  2R0G A;  1JEH A;  4AOX A;  5KVI A;  1IUT A;  4NEV A;  4JN9 A;  2XFP A;  4JNA A;  1KSS A;  2FJD A;  3HYW A;  1PBD A;  1EL9 A;  2CUL A;  1BGN A;  4AT2 A;  4EQS A;  3EPT A;  1F3P A;  2EQ9 A;  3NIX A;  1GAL A;  2H88 A;  1K0L A;  4C5O A;  1EBD A;  2B7S A;  3BNM A;  3QVR A;  4IA6 A;  1GRE A;  3QSM A;  3V3N A;  4NTE A;  4K7Z A;  4U8K A;  2C75 A;  2R0P A;  4CCQ A;  4ADW A;  2C72 A;  2BCP A;  1YY5 A;  3NN6 X;  2TMD A;  3T2Y A;  4YWO A;  1GV4 A;  3CGD A;  1YQ4 A;  4LII A;  1Q1R A;  3II4 A;  2ARD A;  4H4R A;  2C3D A;  1B4V A;  4J2W A;  1IUU A;  4BK3 A;  1MXT A;  2WES A;  4Z24 A;  1GRG A;  2ACZ A;  3FMW A;  1E7P A;  3RHA A;  3AE1 A;  5IQ1 A;  4ECH A;  3ATQ A;  3CNT A;  3CNJ A;  4TM4 A;  4EM3 A;  1KDG A;  2XLU A;  1VRQ B;  2YLR A;  4OVI A;  2YG4 A;  4Y4M A;  2WEU A;  3UTE A;  5DBJ A;  1K0J A;  2IID A;  4Z2T A;  4H4Y A;  3GYJ A;  3SZW A;  2XLR A;  3FG2 P;  2JB1 A;  1L9E A;  2BYB A;  1ZKQ A;  4EMJ A;  1OJT A;  5C2T A;  1YQ3 A;  1YKJ A;  3KU9 A;  3KVE A;  4AP1 A;  4Y4L A;  2C76 A;  1DOC A;  5JCM A;  4Z43 A;  3K7Q X;  3UCL A;  5IPY A;  1CBO A;  2V60 A;  1S2Y A;  1JOA A;  3V76 A;  2CVJ A;  4UDQ A;  2B9X A;  2QCU A;  5JCN A;  4YSZ A;  5KVH A;  1BZL A;  3PS9 A;  4U8P A;  4UDR A;  5M0Z A;  2JK6 A;  4BUR A;  3G5S A;  5FS9 A;  3AEC A;  3NK1 X;  3SGL A;  2V61 A;  2BS3 A;  3UP4 A;  4Z2R A;  3FIM B;  1CL0 A;  4H4Z A;  3ALJ A;  4K5R A;  1TDN A;  2FJA A;  5HXI A;  3T2Z A;  4E0V A;  1LPF A;  3PVC A;  4A65 A;  2YLW A;  2JBV A;  4BK1 A;  1P2H A;  3CTY A;  2BK3 A;  2GQF A;  1IUS A;  1TDK A;  3QFA A;  1L9D A;  1N4V A;  4FDC B;  4IVM B;  4B65 A;  3NKS A;  3F8D A;  1VG9 A;  1DOD A;  4DSG A;  1GND A;  1JNZ A;  4DGK A;  3K30 A;  1IUV A;  3SFD A;  2YVG A;  3RNM A;  5HY5 A;  4J34 A;  4U8I A;  3NLC A;  3AEF A;  3KPK A;  1D5T A;  3UKQ A;  4NTC A;  4GDP A;  2GAH B;  4H4P A;  4IVO B;  2RGJ A;  3BHF A;  2FBW A;  1CC6 A;  1GEU A;  3AXB A;  3AE9 A;  3NK2 X;  3UKP A;  1DJN A;  5KNL A;  2XFO A;  5IQ4 A;  3UKL A;  2BCG G;  4A5L A;  4PAB A;  1ZMC A;  2BAB A;  2VZ2 A;  1P2E A;  2CFY A;  1PBE A;  2Q0L A;  2WQY A;  3NNE A;  4H4U A;  2A87 A;  3AB1 A;  3G5Q A;  4H2R A;  4TLZ A;  3BI5 A;  4TLX A;  4YKF A;  5EOW A;  1LQT A;  3L8K A;  4B63 A;  2GR3 A;  1B37 A;  4K8D A;  2B9Y A;  3G5R A;  4CY8 A;  2BK5 A;  1LVL A;  1GRB A;  4J33 A;  2WET A;  3AYI A;  5BUL A;  2R0C A;  3KD9 A;  1ZOV A;  1GER A;  1IJH A;  3DH9 A;  1F8W A;  3SQP A;  2BK4 A;  2HQM A;  4J31 A;  1MO9 A;  1VQW A;  3AE3 A;  5JCL A;  1XHC A;  3UKA A;  2JB3 A;  3RED A;  4D03 A;  4H4Q A;  2BS2 A;  2O9Z A;  1JU2 A;  3DME A;  4OPC A;  3I6D A;  1YQZ A;  1PJ7 A;  4GAP A;  4USR A;  3M12 A;  3HZL A;  4JY3 A;  3AYJ A;  1TDF A;  3RP8 A;  2B76 A;  2Q6U A;  1NHP A;  4K5S A;  3DGZ A;  4G6G A;  2C67 A;  4REK A;  5HHF A;  3CGC A;  1TYT A;  1ZOY A;  3F8P A;  3OZ2 A;  4H4V A;  1JRZ A;  2YR5 A;  2B9W A;  1UKV G;  1O5W A;  4I59 A;  3Q6J A;  4X9N A;  4J57 A;  5KRQ A;  1NDA A;  3GMB A;  2VRL A;  3ALM A;  2YWL A;  4A9W A;  2X8H A;  4X9M A;  2EQ6 A;  4OPU A;  1H81 A;  2BRA A;  3AEG A;  3NGC X;  1MOK A;  3SYI A;  3P4P A;  2VVM A;  1PBB A;  1H7W A;  2QA2 A;  5JRB A;  1PJ6 A;  3COX A;  1RSG A;  4K2X A;  3DJG X;  1CF3 A;  4WCT A;  2XLP A;  1OJD A;  2WDR A;  2WOV A;  2OLO A;  2AQJ A;  2BA9 A;  1NEK A;  2C4C A;  2UZZ A;  4NWZ A;  3K7T A;  4A7A A;  1W4X A;  3GDP A;  1GOS A;  1ZK7 A;  2WPC A;  2BXR A;  4XXG A;  4EMW A;  5J7X A;  3VRD B;  3ADA B;  2C73 A;  1B8S A;  1EL8 A;  2F5Z A;  4A6N A;  2GF3 A;  1S7M A;  4GDE A;  2AR8 A;  2WP5 A;  2RAB A;  1E1L A;  1NG3 A;  3F8R A;  3UOV A;  4A79 A;  4H4X A;  4FK1 C;  4B67 A;  3SZC A;  3M0O A;  1DOB A;  1EL7 A;  2YG3 A;  5KMR A;  3DK9 A;  3GWD A;  1S3B A;  2C64 A;  3IF9 A;  4YSY A;  4H4W A;  4NTD A;  3URH A;  3P9U A;  3QVP A;  2ZBW A;  4OPT A;  2OA1 A;  4JNQ A;  4EIQ A;  2BAC A;  3C96 A;  1F8S A;  4JY2 A;  1E1K A;  1ZX9 A;  3VQR A;  1PBF A;  3P4R A;  4O5Q A;  3AE4 A;  2RGH A;  4ZCC A;  2XDO A;  3CIR A;  1QLB A;  1IUW A;  1S3E A;  2PYX A;  2BXS A;  1H7X A;  1E1M A;  2OLN A;  1FOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...