1M6IA

Crystal structure of apoptosis inducing factor (aif)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
481
structure length
459
Chain Sequence
APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 8
publication title DNA binding is required for the apoptogenic action of apoptosis inducing factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 144
structure length 459
sequence length 481
ec nomenclature
pdb deposition date 2002-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1m6iA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1m6iA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1m6iA01
4HB9A 5M0ZA 2X8CA 2XFOA 3FIMB 1DOBA 4OPIA 3UTEA 3G5QA 1L9CA 3H8LA 5KRQA 2YG7A 4RSLA 5KVIA 2QAEA 1TDOA 3PS9A 1FECA 1GRAA 4J2WA 4H2QA 3DH9A 5KXJA 5GRTA 1GRHA 5GSNA 2GR0A 2WOWA 1LTXR 4JY3A 4TM1A 4E0VA 3KD9A 2A89A 1O95A 1PJ5A 3F8RA 1Q1WA 2C65A 3CGDA 4YSHA 3S5WA 4JY2A 3UKPA 2VRMA 4Z26A 1KNPA 2YR5A 4Z44A 4GCMA 4U8JA 4EQSA 4Y4NA 3RP8A 2EQ6A 1GRGA 2XYOA 1REOA 3DA1A 5M10A 2GR3A 3K7TA 1BZLA 1KDGA 1H84A 3OZ2A 3M0OA 1W4XA 3ICRA 4ZN0A 1HYUA 3DJJA 1COYA 3GRTA 1DJNA 3AE4A 1LJ1A 3PO7A 5HHFA 4U2TA 2WPCA 2YM1A 1N4UA 2OLOA 1S2YA 2BXRA 4CRTA 1GTEA 5JCIA 2BK4A 2AAQA 1M6IA 4U2SA 1D4DA 1NEKA 2YVFA 4JN9A 2O9ZA 2YAUA 1PBBA 4EM3A 4RG3A 1NPXA 4USQA 2YG4A 4B63A 1H81A 2WESA 3NN6X 5JCNA 3UKAA 2V5ZA 2WHDA 2NPXA 5U25A 4YTPA 3COXA 1TYTA 2OALA 1ZX9A 2CDUA 2JAEA 4GRTA 4B68A 3G5RA 1GXFA 3RHAA 5HXIA 4J31A 1H86A 1YQ3A 2YWLA 4WX1A 2VRLA 2JKCA 1TRBA 3CIRA 5JCKA 4APNA 1IUXA 3RP7A 4A6NB 4YTNA 3LB8A 2B76A 2A87A 4YKFA 3QSEA 1DNCA 2B7RA 5U1OA 1EL8A 5HYMA 2VOUA 4X9NA 1GOSA 1H82A 4H4UA 1YKJA 3CGEA 1PN0A 1LPFA 4K5SA 3KVEA 1D7YA 1PDHA 3ZYXA 4LA1A 4J34A 4BK3A 2BACA 4Z2UA 4EIPA 3UTHA 4C3YA 2XLUA 4PABA 1BF3A 4JNQA 2V3BA 5FMHA 2B7SA 4FK1C 2RGJA 1K0LA 4Z2RA 1GV4A 1TYPA 2XVIA 4USRA 2ACZA 5FS9A 2BXSA 3UTFA 4JQ9A 4ADWA 1H6VA 4H4VA 4C5OA 4FX9A 4N9XA 1VG0A 3KA7A 2XVEA 3AYIA 1S3EA 5CQFA 1PXBA 2FJDA 3NHOX 4YSXA 5U63A 3S61A 3LOVA 1O94A 3B6DA 2YLWA 4FK1A 3AE1A 4WCTA 4EQRA 2XFNA 1BGNA 5KOWA 1XANA 2C75A 3GMBA 1F6MA 2GEWA 3II4A 2Q0LA 1GRBA 4BURA 3KU9A 4AT2A 1JOAA 3FMWA 3UP4A 1JEHA 3K30A 4YT0A 4U8MA 2R0CA 1YQZA 3ALMA 4J33A 2XCGA 3REDA 4CNJA 1Y56A 2WDVA 4AT0A 4JNAA 4U8KA 1Z6LA 3ABVA 3P4PA 1H83A 4AOXA 3KPFA 1MO9A 1N4VA 3CNPA 4OPDA 3FG2P 2RGHA 1IUWA 2VZ2A 3BNUA 3D8XA 3IF9A 3EAOA 2GMJA 3QFBA 2CVJA 3QSMA 2YLZA 5EB4A 2R9ZA 3Q6JA 2BK5A 2E1MA 1MXTA 2B9YA 3GYIA 4K7ZA 3SFDA 4YXDA 3CGBA 3AE6A 4U2LA 1ZOVA 4YTMA 3CPHG 1JNRA 2BA9A 2XLSA 2TPRA 4AOSA 1ZMDA 2C7GA 2TMDA 4H2PA 2GR2A 4YWOA 1F8SA 1Q9IA 3NYFA 4YSYA 5BRTA 3P9UA 2WPEA 2WDRA 4XXGA 1YQ4A 2YVJA 1ZDLA 4DSHA 3H4KA 2XFPA 2BCGG 4CCRA 3P1WA 3VR8A 4X9MA 4H2RA 2YLXA 5KVHA 1QJDA 3G5SA 1GALA 3K7MX 5EOWA 2J3NA 3ISHA 3GMCA 3ZDNA 3SQPA 3AD9B 1ZKQA 4O5UA 4OPCA 4C3XA 3VRBA 2C70A 3NT6A 1FCDA 4U8LA 2IVEA 3AE5A 3IWAA 5IPYA 4NZHA 3UP5A 1N4WA 4REKA 1OJAA 2GQFA 2Y6RA 2XVJA 1LQTA 1F3PA 1BGJA 1F8RA 3LADA 1H7XA 3F8DA 3URHA 2WOVA 2B9WA 4Z43A 1K0JA 1NG3A 4H4ZA 3P4RA 4TM4A 1L9EA 1K4QA 2C3CA 3AXBA 3IHGA 1LVLA 1LV0A 2C64A 3GDNA 3H8IA 4GDPA 4CNKA 5EBKA 4CY6A 2YLSA 4XWRA 2WP9A 3ATRA 1DODA 2VVMA 1E1NA 4K8DA 4BV6A 3PVCA 2YLRA 5J60A 2GAHB 4EQWA 3NYCA 2E4GA 5IQ1A 2XDOA 2X50A 1NHPA 1DXLA 1NDAA 1E6EA 1Y0PA 2WETA 2BC0A 4H4PA 2XVHA 2OA1A 3DK9A 1CHUA 1MOKA 2GB0A 3C96A 3NN0X 2JB1A 3UCLA 1NHRA 2YG3A 2YR6A 3C4NA 3AECA 3GSIA 1CJCA 3UOZA 2VVLA 4KX6A 1D7LA 3EPTA 3LZXA 3NYEA 1JU2A 3NRNA 3I6DA 4J36A 3O0HA 2YLTA 3NTDA 4J56A 1NG4A 5J7XA 2YQUA 2R46A 4K5RA 1CF3A 1PJ6A 4HA6A 1IUSA 1PJ7A 2QA1A 2YVGA 1JNZA 4TLZA 4C77A 1B8SA 2YG6A 2GR1A 3AEDA 3GD4A 2OAMA 4K2XA 3CN8A 1XPQA 3ADAB 3ITJA 4IV9A 1RSGA 2VQ7A 3EANA 4B64A 1GRTA 1E1LA 2H89A 1D5TA 4UDQA 1PXCA 3KLJA 2V3AA 3UKHA 3CGCA 2JBVA 5KWFA 2EQ7A 4DSGA 4O5QA 1ZOYA 5JCLA 2YG5A 3BI5A 3LJPA 3CPIG 2DKIA 5C2TA 3VR9A 3DK4A 1N1PA 5FS7A 3GWFA 4K22A 3BHFA 2EQ8A 1TDNA 2FJAA 1IUUA 1Q1RA 1RP0A 4Y4LA 3AEGA 2GQWA 1S2QA 1GRFA 1VQWA 4TM0A 1O5WA 3NLCA 1IJHA 1ZP0A 4CY8A 3L8KA 1YY5A 4JDRA 2HQMA 5HY5A 4BJYA 2RABA 2FJEA 3NTAA 2IVDA 2WP5A 1CL0A 1LQUA 4OPLA 4D04A 1CJ2A 1E39A 1OJCA 2BCPA 2V61A 3UKLA 2NVKX 3FPZA 2CFYA 2Q0KA 3KKJA 4IVMB 1GSNA 2BYBA 4OVIA 4GF7A 3NIXA 3F8PA 2WOIA 1IUVA 1VDCA 4B66A 2X8HA 2JB2A 1L0VA 4H4TA 4UDPA 2X8GA 2C73A 2IIDA 4A6NA 3DJEA 4YKGA 1PXAA 5JCMA 4EMIA 2GH5A 2GMHA 1KSUA 3VRDB 3E1TA 4BK2A 4BK1A 1TDEA 2R4JA 3AEAA 1PHHA 2PYXA 3DJDA 2X3NA 3T37A 5L46A 2WDQA 1KSSA 2V60A 4OPGA 1GTHA 1VG9A 1BKWA 3GDPA 3M13A 4KPRA 3ICSA 5BUKA 4A7AA 2JB3A 3UKQA 2Z5YA 3OC4A 1UKVG 2PHHA 4D03A 3L1RA 3GYJA 4EMJA 1TDFA 4U8PA 3NG7X 2XVFA 3QSSA 1KFYA 1JRZA 2YR4A 3M12A 3AE3A 1EL5A 4ZCDA 1GETA 1FL2A 5ER0A 4H4SA 4FDCB 2C67A 3LXDA 4NTEA 3GD3A 2RGOA 4B69A 3AEBA 4AP3A 2F5ZA 4H4RA 1DJQA 1OJDA 5DBJA 4OPUA 1PS9A 2W0HA 2Y6QA 3DMEA 1GREA 3NK1X 4DNAA 2GVCA 1OJ9A 2DKHA 3AB1A 4IA5A 3BI2A 3NNEA 5IQ4A 2WPFA 5KOXA 3LZWA 3NKSA 3DK8A 1B37A 1GESA 1ZK7A 3AEEA 2XLRA 1GEUA 3ATQA 2WEUA 5LV9A 3JSKA 3P4QA 3CNSA 2ZZCA 4Z25A 2WU2A 1CC6A 2C66A 4IA6A 1TDKA 1CBOA 1CC2A 2CULA 3NK0X 2C3DA 1QO8A 4PAAA 1GNDA 1FOHA 2I0ZA 1ZMCA 5FS8A 3UKFA 4CBQA 3B3RA 1PBDA 3CPJG 2C76A 2OLNA 2Q6UA 2XFQA 4UP3A 4X4JA 2WP6A 4MJWA 3RP6A 4H50A 4A79A 3CNJA 3ALJA 4GR1A 1B5QA 4Z24A 4H4WA 2GV8A 1ONFA 2B9XA 3UOVA 3DGZA 1ELIA 4H4QA 4U8OA 4Y4MA 3Q9TA 3FBSA 1NHSA 3I3LA 1DOEA 2R0PA 4LIIA 2APGA 3AYJA 1EL9A 1S3BA 3AE9A 5CKUA 4GUVA 3AE2A 1FEBA 3SGLA 2UZZA 3CNDA 1K0IA 4NTDA 1AOGA 1NHQA 1CJ3A 3RNMA 2XFUA 3CTYA 3SM8A 1F8WA 4NTCA 2BS3A 4H4YA 2FJBA 3CNTA 2R0GA 2VQBA 5BULA 1GERA 4EMWA 2GRTA 1H7WA 2VVLG 3AD7B 2YM2A 3V76A 4A9WA 4BJZA 4LU6A 4IVOB 1Y56B 4P9SA 4OPTA 4TLXA 1P2EA 4DGKA 1XDIA 2ZZBA 1OJTA 1E1KA 2FBWA 2BABA 5BVAA 2Z5XA 2JK6A 2QCUA 1NAAA 2ZBWA 2EQ9A 2R4EA 3AE7A 3UKKA 4AP1A 1D4EA 1E1MA 3V3NA 2V6OA 1CC4A 4A65A 4M52A 3DJGX 2GAGB 4TM3A 3AD8B 2WBAA 2ZZ0A 3QFAA 3BHKA 1L9DA 4U8IA 5FS6A 2Q7VA 2WQYA 4B67A 1NENA 2XLPA 1KNRA 3HZLA 1QLBA 1DOCA 2H88A 4ZCCA 2BS4A 4XWZA 1PBFA 3QVPA 2X99A 2QA2A 1V59A 1SEZA 4Z2TA 3ICTA 1JRXA 2R45A 3V3OA 3ALLA 1X31B 4H4XA 1B4VA 4EQXA 3K7QX 3NH3X 3NGCX 1P2HA 3IC9A 1EBDA 1GT8A 3BI4A 4U8NA 2C72A 4NEWA 3C4AA 2E5VA 1BWCA 3SFEA 2ARDA 1CJ4A 1M64A 2AR8A 1GPEA 2BS2A 3AWIA 4A5LA 4A99A 3NK2X 4GDEA 3DGHA 3EF6A 4RG4A 4ICYA 4J57A 5EB5A 4ECHA 1IUTA 1XHCA 3GRSA 1VRQB 4I58A 2WU5A 1JRYA 5TR3A 3QVRA 4CCQA 2AQJA 3D1CA 3AYLA 3BNMA 1EL7A 3GWDA 3UOXA 3R9UA 5C3JA 4H2NA 3VQRA 4OCGA 1RYIA 1KF6A 1E7PA 2WS3A 4UDRA 1D4CA 3UTGA 3VRAA 1PBEA 4C74A 2A8XA 3UOYA 3IHMA 3WE0A 1FEAA 4NEVA 3QJ4A 4H7UA 2BC1A 2BK3A 4I59A 2XLTA 4B1BA 2GF3A 4YSZA 1PBCA 3P4SA 4EIQA 4EM4A 1ZY8A 4B65A 3AE8A 3AEFA
chains in the Genus database with same CATH superfamily
5M0ZA 3FIMB 1DOBA 3UTEA 1FECA 5GRTA 1N5WC 2GGEA 2GR0A 2WOWA 2QJMA 4E6MA 4TM1A 3KD9A 2VRMA 1KNPA 4U8JA 3RP8A 2EQ6A 3CT2A 3ES7A 3DA1A 5FJUA 1KDGA 1W4XA 4ZN0A 1HYUA 3AE4A 3MSYA 2AL2B 3VA8A 4KEMA 4IP4A 1FO4A 3OZYA 1NEKA 2GGGA 4Z1YA 4B63A 2WESA 5JCNA 2WHDA 3R11A 3VCCA 6ENLA 1H86A 2YWLA 2JKCA 4A6NB 3SN1A 3DEQA 1GOSA 1MUCA 4K5SA 3ZYXA 4J34A 3GY1A 4Z2UA 2XLUA 4PABA 4JNQA 2QJNA 2V3BA 4FP1A 4FK1C 2RGJA 1K0LA 1GV4A 4USRA 2ACZA 3MQTA 4ADWA 4C5OA 4N9XA 5U63A 3B6DA 1BGNA 1XANA 3GMBA 4BURA 1JEHA 3K30A 3PK7A 4U8MA 2W55A 4YT0A 1YQZA 4AT0A 4JNAA 4AOXA 1EC9A 3D8XA 1P48A 3T6CA 3SFDA 2MNRA 3D47A 3AE6A 4YTMA 3CPHG 1JNRA 1JROA 3NYFA 1Q9IA 5KMSA 3P9UA 1STZA 2WDRA 3SR6B 2YVJA 2BCGG 3P1WA 3K7MX 2NQLA 3AD9B 4C3XA 3DDMA 2C70A 1FCDA 2OVLA 3P3BA 2GQFA 2XVJA 2W3SA 3OP2A 3ZLGA 1ONEA 3IHGA 1LV0A 4HNCA 2YLSA 2WP9A 3ATRA 1DODA 3UXKA 1PDYA 3PVCA 4K8DA 2GAHB 2XDOA 1NHPA 1NDAA 1Y0PA 2BC0A 2OA1A 3UCLA 4IZGA 3NN0X 1NHRA 2YG3A 3GSIA 3UOZA 2VVLA 4KX6A 3JZUA 2ZC8A 4IHCA 4H2HA 3R10A 3SXIA 3AEDA 3CN8A 1GRTA 2H89A 2V3AA 4GIRA 2EQ7A 2PTZA 1ZOYA 3LJPA 3TJ4A 2DKIA 4K22A 5FS7A 3GWFA 3TWAA 1EC7A 3HYXA 2GGIA 4JN8A 5HY5A 4BJYA 2WP5A 1CL0A 2BCPA 2V61A 2BYBA 4GF7A 2WOIA 1IUVA 1VDCA 2IIDA 3DJEA 3FVDA 3E1TA 3DJDA 2X3NA 3T37A 5L46A 1BKWA 2GGJA 3GDPA 2QJJA 2FKPA 4HCLA 3SBFA 2PHHA 3DERA 4EMJA 4U8PA 3T14A 1KFYA 3M12A 5ER0A 4FDCB 2W3RA 2RGOA 1SB3B 4GAVA 3P93A 2W0HA 3SJNA 2DKHA 3AB1A 3BSMA 5IQ4A 2HNEA 5KOXA 3LZWA 2I5QA 4HPNA 4E5TA 1EBGA 3CXBA 3UGVA 4IA6A 1CC2A 3TW9A 2CULA 2OFJA 1GNDA 3UKFA 4UP3A 2WP6A 2OX4A 2QQ6A 4Z24A 1N60C 4H4WA 2B9XA 4K1WA 1DOEA 3AYJA 4LIIA 3SGLA 3AE2A 1FEBA 3T4WA 3CNDA 1AOGA 1NHQA 2BS3A 2R0GA 2YM2A 4LU6A 3SX6A 3H12A 4GYPA 1XDIA 1OJTA 1E1KA 2FBWA 4AP1A 1D4EA 1E1MA 1CC4A 5FS6A 1P43A 2H88A 4Z17A 2BS4A 2X99A 3ICTA 1JRXA 3V3OA 3SSZA 3STPA 4M6UA 3K7QX 1P2HA 1GT8A 3B9JB 3H70A 1CJ4A 3AWIA 4A5LA 2CHRA 4RG4A 5G5GB 3IJLA 5EB5A 4ECHA 1XHCA 3GRSA 1VRQB 4I58A 1JRYA 5TR3A 3BNMA 3VRAA 1E7PA 2WS3A 3UTGA 1MRAA 3UOYA 2DW6A 4B1BA 2GF3A 3TCSA 3P4SA 4YSZA 2OQHA 4B65A 3AEFA 3AM9A 3ENLA 2PS2A 5KRQA 4H83A 2GGHA 3PS9A 4J2WA 3DH9A 5IDZA 4JY3A 1Q1WA 1V97A 3CGDA 3S5WA 4JY2A 3UKPA 4Z26A 4Z44A 2P8BA 5FJTA 4EQSA 4Y4NA 1GRGA 1H84A 3M0OA 1COYA 3GRTA 1DJNA 3PO7A 4A35A 4CRTA 4GAPA 3AMZA 2GDQA 2O9ZA 1PBBA 3UKAA 2P88A 3NVZB 5U25A 4YTPA 3COXA 2PU0A 4GRTA 3G5RA 3CXOA 3H8AA 2VRLA 3CIRA 3RP7A 4APNA 3DG3A 3LB8A 2BRYA 4IL2A 2B76A 3TJIA 4YKFA 1DNCA 2ZADA 2B7RA 5U1OA 1EL8A 5HYMA 3CGEA 1PN0A 3KVEA 1D7YA 1N5XA 4BK3A 2BACA 4EIPA 3D46A 4Z2RA 3UTFA 7ENLA 1H6VA 4H4VA 1VG0A 3AYIA 1S3EA 4ZCWA 3S5SA 3ZVIA 3DESA 2YLWA 3AE1A 4EQRA 5KOWA 1F6MA 2Q0LA 1NELA 2GSHA 1GRBA 1JOAA 3FMWA 1Z6LA 1H83A 1MO9A 3CNPA 2RGHA 3BNUA 3EAOA 2GMJA 2YLZA 5EB4A 3Q6JA 2C4CA 2E1MA 3GYIA 4K8GA 4K7ZA 3OW1A 2XLSA 2C7GA 4H2PA 4YSYA 2GR2A 4XXGA 1TE6A 2XFPA 3VR8A 4X9MA 2YLXA 5KVHA 1GALA 3H7VA 3SQPA 4O5UA 1ZKQA 2OZ8A 4OPCA 3DIPA 3IJQA 3AE5A 3T2ZA 4ZA0A 4NZHA 1N4WA 3UP5A 2Y6RA 3HPFA 1LQTA 4G9KA 1F3PA 1BGJA 3LADA 3N4EA 3URHA 2WOVA 4Z43A 1K0JA 1W6TA 1NG3A 3P4RA 1L9EA 1K4QA 3AXBA 4CNKA 3H8IA 2MUCA 5EBKA 4XWRA 4K2SA 2AL1A 3RCYA 3Q45A 2VVMA 4BV6A 5J60A 3NYCA 2AKMA 1E6EA 4MMWA 2PODA 4E8GA 1MOKA 3JW7A 2YR6A 3AECA 1CJCA 1D7LA 3HYVA 3N6HA 3NTDA 2YQUA 2QA1A 2YVGA 1JNZA 3VFCA 4C77A 1E9IA 2YG6A 2OAMA 1XPQA 4IV9A 1RSGA 2VQ7A 3V4BA 4UDQA 1D5TA 3UKHA 3CGCA 5KWFA 1N63C 1SJBA 3CK5A 3CPIG 3DK4A 3BHFA 2EQ8A 2FJAA 2GQWA 3FJ4A 1VQWA 1GRFA 4HCHA 4HYRA 3NLCA 4JDRA 1PDZA 2PP0A 4OPLA 1E39A 3UKLA 3FPZA 2CFYA 2Q0KA 3BJSA 3NIXA 4HNLA 1L0VA 2O56A 4H4TA 4UDPA 5JCMA 4EMIA 2XSXA 4BK1A 3AEAA 1PHHA 1WUEA 3IJIA 1H2IA 1GTHA 3ICSA 3QKEA 2OQYA 4A7AA 2JB3A 4A3RA 1UKVG 3GYJA 3GYXA 3NG7X 3SZWA 3A7UA 1EBHA 1GETA 5DBJA 4H4RA 1DJQA 5G5HB 1DTNA 3DMEA 1GREA 3BOXA 4DNAA 1OJ9A 1RVKA 4IA5A 3NNEA 3UJSA 4TVWA 5KMPA 3DFYA 3NKSA 1B37A 3AEEA 3EEZA 5LV9A 3JSKA 3P4QA 4NWZA 3CNSA 4Z25A 2PCEA 2OO6A 3NZGA 4PAAA 1JDFA 2I0ZA 1ZMCA 5FS8A 1VQZA 1PBDA 3B3RA 3CPJG 2OLNA 4A6GA 3RP6A 3RR1A 4A79A 1B5QA 4E4UA 4GYPC 5BOFA 1ELIA 2HXUA 3FBSA 3NO1A 1EL9A 3AE9A 3FV9A 3SZCA 1K0IA 2FYMA 3VC6A 3NVVB 3I6TA 4H4YA 3CNTA 2PGWA 2VQBA 1GERA 4EMWA 3V76A 3VCNA 2P3ZA 4IVOB 4TLXA 1P2EA 3SY4A 2Z5XA 3CYJA 2QCUA 4X2PA 1BQGA 4M52A 4TM3A 3AD8B 2WBAA 4U8IA 2Q7VA 4ZCCA 1PBFA 3QVPA 2QA2A 1V59A 3T2YA 4G74A 1B4VA 4EQXA 3NH3X 3NVYB 3IC9A 1EBDA 3BI4A 4U8NA 4NEWA 3SFEA 2ARDA 2BS2A 4A99A 2OPJA 3DGHA 3EF6A 4ICYA 4J57A 3JVAA 5EU9A 1IUTA 1JCTA 4CCQA 3EUB3 1EL7A 3GWDA 3T9PA 1RYIA 1ECQA 5J04A 1D4CA 3D9XA 3RITA 2PSNA 2OG9A 3QJ4A 4H7UA 2BK3A 2XLTA 4ROPA 4TM4A 3AE8A 3SZ0A 3N4FA 2XFOA 3HRDC 4RSLA 5KVIA 1TDOA 1FIQB 1GRAA 4H2QA 5GSNA 1EC8A 4E0VA 2A89A 1O95A 1PJ5A 3F8RA 2C65A 1L8PA 3NXLA 2BRAA 1REOA 2GR3A 2PTXA 5HHFA 4U2TA 2YM1A 3ES8A 2PPGA 2BXRA 4U2SA 4JN9A 2YAUA 4EM3A 4USQA 1SJAA 3NN6X 2V5ZA 2PTWA 3Q4DA 2PP1A 1TYTA 1ZX9A 1GXFA 3RHAA 5HXIA 4J31A 4IT1A 3ZVHA 1IUXA 4YTNA 2OKTA 4JN7A 2XGZA 3OZMA 4X9NA 1MDLA 1RM6B 4H4UA 1PDHA 1R6WA 4J1OA 3GO2A 1SJCA 4EWJA 3ETRB 1IYXA 3UTHA 3CB3A 5FMHA 2B7SA 2PU1A 3NVWB 3KA7A 4GISA 5CQFA 3QTPA 2FJDA 3LOVA 1O94A 5FJPA 3KU9A 4AT2A 3UP4A 1KCZA 3ALMA 2XCGA 3REDA 5KNLA 1TKKA 2E5AA 4U8KA 3KPFA 1N4VA 4OPDA 2QGYA 3IF9A 2QDEA 2CVJA 4HCDA 1ZOVA 3K1GA 2BA9A 2TPRA 4AOSA 1ZMDA 3DFHA 4GGHA 2OZTA 4YWOA 1F8SA 2W54A 5BRTA 3I4KA 1YQ4A 1ZDLA 4DSHA 4H2RA 1QJDA 5EOWA 3ZDNA 3VRBA 4MGGA 4U8LA 2IVEA 5IPYA 1OJAA 4G8TA 1H7XA 4GGBA 3UJEA 3GDNA 2C64A 4CY6A 1E1NA 2YLRA 2E4GA 2X50A 3S47A 4DHGA 4H4PA 2GB0A 2PA6A 4HN8A 2OLAA 1BKHA 3EPTA 3LZXA 3NYEA 3O0HA 3PWIA 2YLTA 4HA6A 3R0UA 1B8SA 3GD4A 4K2XA 3MUCA 1JPMA 3EANA 4B64A 1PXCA 2JBVA 4DSGA 2YG5A 3BI5A 5C2TA 2XH4A 1N1PA 2PGEA 1IUUA 1Q1RA 4Y4LA 4ZOHB 1S2QA 4TM0A 1O5WA 1IJHA 3L8KA 2HZGA 2HQMA 2FJEA 3NTAA 2IVDA 1CJ2A 2NVKX 4IVMB 4ENLA 4B66A 2X8HA 1X2HA 1R0MA 2X8GA 2C73A 4YKGA 1MDRA 1PXAA 3FYYA 3R07C 1KSUA 3VRDB 1TDEA 2PYXA 2WDQA 1KSSA 2V60A 4OPGA 1VG9A 3M13A 2Z5YA 3OC4A 3THUA 3L1RA 4G73A 2XVFA 3NRZB 4ZCDA 1FL2A 2C67A 4NTEA 3LXDA 3GD3A 4AP3A 2F5ZA 4OPUA 3ZVHB 1PS9A 3NK1X 2GVCA 3BI2A 4G7FA 3DK8A 1GESA 1ZK7A 1GEUA 3ATQA 2QDDA 2ZZCA 3TQPA 2WU2A 1CC6A 1TDKA 3NK0X 1QO8A 1NU5A 4X4JA 3V5FA 3CNJA 3A7AA 4H19A 2GV8A 3U4FA 4U8OA 4Y4MA 3I3LA 2R0PA 2APGA 1S3BA 5CKUA 2UZZA 2XFUA 2XH2A 1F8WA 4NTCA 2FJBA 3AD7B 3MZNA 4A9WA 4BJZA 1KKOA 4P9SA 4OPTA 3I6EA 2E3TA 2ZZBA 2BABA 1NAAA 3L5OA 2R4EA 3PWGA 3AE7A 3UKKA 3V3NA 5FJRA 5BOEA 2GAGB 4M0XA 3NS1B 2ZZ0A 3QFAA 1L9DA 3SZFA 4B67A 2XLPA 1KNRA 1QLBA 3AN1A 1DOCA 1T3QC 1N61C 1FHVA 1SEZA 4Z2TA 1S7MA 2R45A 3P0WA 1F9CA 4II3A 1X31B 4H4XA 1FHUA 1X2GA 2C72A 3C4AA 2AR8A 1GPEA 4GDEA 2DW7A 2WU5A 3QVRA 3UOXA 4DXKA 3VQRA 4KWSA 4OCGA 4UDRA 4C74A 5KMRA 1WUFA 3WE0A 2BC1A 4I59A 4EIQA 4HB9A 2X8CA 4OPIA 3G5QA 1L9CA 3H8LA 2YG7A 2QAEA 5KXJA 3HYWA 1GRHA 1LTXR 3IK4A 4IL0A 1JPDX 3RRAA 1XS2A 1OEPA 4YSHA 2YR5A 4GCMA 2XYOA 4KPLA 5M10A 3K7TA 1BZLA 3OZ2A 3ICRA 3DJJA 1LJ1A 5ENLA 1MNSA 2WPCA 1N4UA 2OLOA 3NFUA 1S2YA 1GTEA 5JCIA 2BK4A 2AAQA 1M6IA 1D4DA 3RGTA 2YVFA 1ELSA 4RG3A 1NPXA 2QVHA 2YG4A 1H81A 3KUMA 2NPXA 3UXLA 2OALA 2CDUA 2JAEA 3GC2A 4B68A 3CAWA 3A7RA 3UJRA 1YQ3A 4WX1A 1TRBA 5JCKA 1XPYA 2AKZA 2A87A 3QSEA 3R1ZA 2VOUA 1H82A 1YKJA 1LPFA 3T8QA 4LA1A 3VC5A 4JHMA 4C3YA 2HXTA 1BF3A 3SN4A 3UJ2A 1JRPA 1TYPA 2XVIA 5FS9A 2BXSA 4JQ9A 3GD6A 3SN0A 3DG7A 4FX9A 2XVEA 3MY9A 1PXBA 3NHOX 4YSXA 3S61A 4FK1A 4WCTA 2XFNA 2C75A 2PP3A 2GEWA 3II4A 3KPKA 3ZLFA 2R0CA 4J33A 3OPSA 4CNJA 1Y56A 2WDVA 4G6GA 3RO6A 3ABVA 4DYEA 3P4PA 3FG2P 2VZ2A 1IUWA 3QFBA 3QSMA 2R9ZA 2BK5A 1MXTA 2B9YA 3DG6A 4YXDA 3CGBA 4U2LA 4GMEA 3SQSA 2TMDA 1FFUC 2WPEA 3CMMA 4KT2A 3H4KA 4CCRA 2PTYA 3G5SA 1TZZA 2J3NA 3ISHA 3GMCA 3NT6A 3IWAA 4REKA 1KN0A 3OTRA 1F8RA 3F8DA 2B9WA 3QPEA 3TWBA 4H4ZA 2C3CA 3FXGA 1LVLA 4GDPA 3DGBA 3V3WA 4EQWA 5IQ1A 1DXLA 4DWDA 2WETA 2XVHA 3DK9A 1CHUA 3C96A 2JB1A 3C4NA 1KKRA 1JU2A 3NRNA 3I6DA 4J36A 4G6HA 3B97A 3R0KA 4J56A 1NG4A 5J7XA 2R46A 4K5RA 1CF3A 1PJ6A 1IUSA 1PJ7A 4TLZA 3MWCA 4H1ZA 3UCDA 2GR1A 3ADAB 3ITJA 1E1LA 3KLJA 2AL2A 4O5QA 5JCLA 3VR9A 4F4RA 2ONEA 1TDNA 1RP0A 3AEGA 5FJOA 1YEYA 1ZP0A 4CY8A 1YY5A 2RABA 1LQUA 4D04A 3ZLHA 3FCPA 1OJCA 3T2KA 3KKJA 4OVIA 1GSNA 3F8PA 2JB2A 4A6NA 2GH5A 2GMHA 5KMQA 2PMQA 1SJDA 4BK2A 2R4JA 5JRBA 4KPRA 2POZA 5BUKA 2RDXA 3UKQA 4D03A 1TDFA 4DN1A 3QSSA 1JRZA 3UJFA 2YR4A 3AE3A 1EL5A 4J3ZA 3TTEA 4H4SA 4B69A 3AEBA 1N62C 1OJDA 2Y6QA 3MKCA 2WPFA 1KD0A 4II2A 1FFVC 2XLRA 3V5CA 1VDVA 2WEUA 4FI4A 3TOYA 4GFIA 3HW2A 2P8CA 2C66A 2OZ3A 1CBOA 2C3DA 1FOHA 4CBQA 3PFRA 2C76A 2Q6UA 2XFQA 2XH7A 4MJWA 4H50A 3ALJA 4GR1A 1ONFA 3UOVA 3DGZA 4YWSA 4H4QA 3Q9TA 1NHSA 3T31A 4GUVA 4NTDA 4TVYA 1CJ3A 3RNMA 3CTYA 3SM8A 1WYGA 3SYIA 5BULA 2GRTA 1H7WA 2VVLG 1Y56B 4DGKA 5BVAA 2JK6A 4DX3A 2ZBWA 2EQ9A 3U9IA 3QN3A 3T0KA 4NNJA 2V6OA 4A65A 3N6JA 3DJGX 4IP5A 3BHKA 2WQYA 4MKSA 3HZLA 1NENA 3VDGA 4XWZA 2GL5A 3ALLA 3QLDA 3NGCX 2P0IA 2E5VA 1BWCA 3UCCA 1M64A 2XH0A 3NK2X 3R25A 3EKGA 2AQJA 3D1CA 3AYLA 3R9UA 5C3JA 4H2NA 1KF6A 1PBEA 2A8XA 4E4FA 3IHMA 1FEAA 4NEVA 3PG6A 1PBCA 1ZXIC 4EM4A 1ZY8A
chains in the Genus database with same CATH topology
4HB9A 5M0ZA 2X8CA 2XFOA 3FIMB 1DOBA 4OPIA 3UTEA 3G5QA 1L9CA 3H8LA 5KRQA 2YG7A 4RSLA 5KVIA 2QAEA 1TDOA 3PS9A 1FECA 1GRAA 4J2WA 4H2QA 3DH9A 3HYWA 5GRTA 5KXJA 1GRHA 5GSNA 2GR0A 2WOWA 1LTXR 4JY3A 4TM1A 4E0VA 3KD9A 2A89A 1O95A 1PJ5A 3F8RA 1Q1WA 2C65A 3CGDA 4YSHA 3S5WA 4JY2A 3UKPA 2VRMA 4Z26A 1KNPA 2YR5A 4Z44A 4GCMA 4U8JA 4EQSA 4Y4NA 3RP8A 2EQ6A 1GRGA 2BRAA 2XYOA 1REOA 3DA1A 5M10A 2GR3A 3K7TA 1BZLA 1KDGA 1H84A 3OZ2A 3M0OA 1W4XA 3ICRA 4ZN0A 1HYUA 3DJJA 1COYA 3GRTA 1DJNA 3AE4A 1LJ1A 3PO7A 5HHFA 4U2TA 2WPCA 2YM1A 1N4UA 2OLOA 1S2YA 2BXRA 4CRTA 1GTEA 5JCIA 2BK4A 2AAQA 1M6IA 4U2SA 4GAPA 1D4DA 1NEKA 2YVFA 4JN9A 2O9ZA 2YAUA 1PBBA 4EM3A 4RG3A 1NPXA 4USQA 2YG4A 4B63A 1H81A 2WESA 3NN6X 5JCNA 3UKAA 2V5ZA 2WHDA 2NPXA 5U25A 4YTPA 3COXA 1TYTA 2OALA 1ZX9A 2CDUA 2JAEA 4GRTA 4B68A 3G5RA 1GXFA 3RHAA 5HXIA 4J31A 1H86A 1YQ3A 2YWLA 4WX1A 2VRLA 2JKCA 1TRBA 3CIRA 5JCKA 4APNA 1IUXA 3RP7A 4A6NB 4YTNA 3LB8A 2BRYA 2B76A 2A87A 4YKFA 3QSEA 1DNCA 2B7RA 5U1OA 1EL8A 5HYMA 2VOUA 4X9NA 1GOSA 1H82A 4H4UA 1YKJA 3CGEA 1PN0A 1LPFA 4K5SA 3KVEA 1D7YA 1PDHA 3ZYXA 4LA1A 4J34A 4BK3A 2BACA 4Z2UA 4EIPA 3UTHA 4C3YA 2XLUA 4PABA 1BF3A 4JNQA 2V3BA 5FMHA 2B7SA 4FK1C 2RGJA 1K0LA 4Z2RA 1GV4A 1TYPA 2XVIA 4USRA 2ACZA 5FS9A 2BXSA 3UTFA 4JQ9A 4ADWA 1H6VA 4H4VA 4C5OA 4FX9A 4N9XA 1VG0A 3KA7A 2XVEA 3AYIA 1S3EA 5CQFA 1PXBA 2FJDA 3NHOX 4YSXA 5U63A 3S61A 3LOVA 1O94A 3B6DA 2YLWA 4FK1A 3AE1A 4WCTA 4EQRA 2XFNA 1BGNA 5KOWA 1XANA 2C75A 3GMBA 1F6MA 2GEWA 3II4A 2Q0LA 1GRBA 4BURA 3KPKA 3KU9A 4AT2A 1JOAA 3FMWA 3UP4A 1JEHA 3K30A 4YT0A 4U8MA 2R0CA 1YQZA 3ALMA 4J33A 2XCGA 3REDA 5KNLA 4CNJA 1Y56A 2WDVA 4AT0A 4JNAA 4G6GA 4U8KA 1Z6LA 3SZ0A 3ABVA 3P4PA 1H83A 4AOXA 3KPFA 1MO9A 1N4VA 3CNPA 4OPDA 3FG2P 2RGHA 1IUWA 2VZ2A 3BNUA 3D8XA 3IF9A 3EAOA 2GMJA 3QFBA 2CVJA 3QSMA 2YLZA 5EB4A 2R9ZA 3Q6JA 2BK5A 2C4CA 2E1MA 1MXTA 2B9YA 3GYIA 4K7ZA 3SFDA 4YXDA 3CGBA 3AE6A 4U2LA 1ZOVA 4YTMA 3CPHG 1JNRA 2BA9A 2XLSA 2TPRA 4AOSA 1ZMDA 2C7GA 2TMDA 4H2PA 2GR2A 4YWOA 1F8SA 1Q9IA 3NYFA 4YSYA 5BRTA 5KMSA 3P9UA 2WPEA 2WDRA 3CMMA 4XXGA 1YQ4A 2YVJA 1ZDLA 4DSHA 3H4KA 2XFPA 2BCGG 4CCRA 3P1WA 3VR8A 4X9MA 4H2RA 2YLXA 5KVHA 1QJDA 3G5SA 1GALA 3K7MX 5EOWA 2J3NA 3ISHA 3GMCA 3ZDNA 3SQPA 3AD9B 1ZKQA 4O5UA 4OPCA 4C3XA 3VRBA 2C70A 3NT6A 1FCDA 4U8LA 2IVEA 3AE5A 3T2ZA 3IWAA 5IPYA 4NZHA 3UP5A 1N4WA 4REKA 1OJAA 2GQFA 2Y6RA 2XVJA 1LQTA 4G9KA 1F3PA 1KN0A 1BGJA 1F8RA 3LADA 1H7XA 3F8DA 3URHA 2WOVA 2B9WA 4Z43A 1K0JA 1NG3A 4H4ZA 3P4RA 4TM4A 1L9EA 1K4QA 2C3CA 3AXBA 3IHGA 1LVLA 1LV0A 2C64A 3GDNA 3H8IA 4GDPA 4CNKA 5EBKA 4CY6A 2YLSA 4XWRA 2WP9A 3ATRA 1DODA 2VVMA 1E1NA 4K8DA 4BV6A 3PVCA 2YLRA 5J60A 2GAHB 4EQWA 3NYCA 2E4GA 5IQ1A 2XDOA 2X50A 1NHPA 1DXLA 1NDAA 1E6EA 1Y0PA 2WETA 2BC0A 4H4PA 2XVHA 2OA1A 3DK9A 1CHUA 1MOKA 2GB0A 3C96A 3NN0X 2JB1A 3UCLA 1NHRA 2YG3A 2YR6A 3C4NA 3AECA 3GSIA 1CJCA 3UOZA 2VVLA 4KX6A 1D7LA 3EPTA 3LZXA 3HYVA 3NYEA 1JU2A 3NRNA 3I6DA 4J36A 4G6HA 3O0HA 2YLTA 3NTDA 4J56A 1NG4A 5J7XA 2YQUA 2R46A 4K5RA 1CF3A 1PJ6A 4HA6A 1IUSA 1PJ7A 2QA1A 2YVGA 1JNZA 4TLZA 4C77A 1B8SA 3SXIA 2YG6A 2GR1A 3AEDA 3GD4A 2OAMA 4K2XA 3CN8A 1XPQA 3ADAB 3ITJA 4IV9A 1RSGA 2VQ7A 3EANA 4B64A 1GRTA 1E1LA 2H89A 1D5TA 4UDQA 2V3AA 3KLJA 1PXCA 3UKHA 3CGCA 2JBVA 5KWFA 2EQ7A 4DSGA 4O5QA 1ZOYA 5JCLA 2YG5A 3BI5A 3LJPA 3CPIG 2DKIA 5C2TA 3VR9A 3DK4A 1N1PA 5FS7A 3GWFA 4K22A 3BHFA 2EQ8A 1TDNA 2FJAA 1IUUA 1Q1RA 1RP0A 4Y4LA 3AEGA 2GQWA 3HYXA 1S2QA 1GRFA 1VQWA 4TM0A 1O5WA 3NLCA 1IJHA 1ZP0A 4CY8A 3L8KA 1YY5A 4JDRA 2HQMA 5HY5A 4BJYA 2RABA 2FJEA 3NTAA 2IVDA 2WP5A 1CL0A 1LQUA 4OPLA 4D04A 1CJ2A 1E39A 1OJCA 3T2KA 2BCPA 2V61A 3UKLA 2NVKX 3FPZA 2CFYA 2Q0KA 3KKJA 4IVMB 1GSNA 2BYBA 4OVIA 4GF7A 3NIXA 3F8PA 2WOIA 1IUVA 1VDCA 4B66A 2X8HA 2JB2A 1L0VA 4H4TA 4UDPA 2X8GA 2C73A 2IIDA 4A6NA 3DJEA 4YKGA 1PXAA 5JCMA 4EMIA 2GH5A 2GMHA 5KMQA 1KSUA 3VRDB 3E1TA 4BK2A 4BK1A 1TDEA 2R4JA 3AEAA 1PHHA 2PYXA 3DJDA 2X3NA 3T37A 5JRBA 2WDQA 1KSSA 2V60A 5L46A 4OPGA 1H2IA 1GTHA 1VG9A 1BKWA 3GDPA 3M13A 4KPRA 3ICSA 5BUKA 4A7AA 2JB3A 3UKQA 2Z5YA 3OC4A 1UKVG 2PHHA 4D03A 3L1RA 3GYJA 4G73A 4EMJA 1TDFA 3GYXA 4U8PA 3NG7X 3T14A 2XVFA 3QSSA 1KFYA 1JRZA 2YR4A 3M12A 3SZWA 3AE3A 1EL5A 4ZCDA 1GETA 1FL2A 5ER0A 4H4SA 4FDCB 2C67A 3LXDA 4NTEA 3GD3A 2RGOA 4B69A 3AEBA 4AP3A 2F5ZA 4H4RA 1DJQA 1OJDA 5DBJA 4GAVA 4OPUA 1PS9A 2W0HA 2Y6QA 3DMEA 1GREA 3NK1X 4DNAA 2GVCA 1OJ9A 2DKHA 3AB1A 4IA5A 3BI2A 3NNEA 5IQ4A 2WPFA 5KMPA 4II2A 3LZWA 5KOXA 3NKSA 3DK8A 1B37A 1GESA 1ZK7A 3AEEA 2XLRA 1GEUA 3ATQA 2WEUA 5LV9A 3JSKA 3P4QA 4NWZA 3CNSA 2ZZCA 4Z25A 2WU2A 1CC6A 2C66A 4IA6A 1TDKA 1CBOA 1CC2A 2CULA 3NK0X 2C3DA 1QO8A 4PAAA 1GNDA 1FOHA 2I0ZA 1ZMCA 5FS8A 3UKFA 4CBQA 3B3RA 1PBDA 3CPJG 2C76A 2OLNA 2Q6UA 2XFQA 4UP3A 4X4JA 2WP6A 4MJWA 3RP6A 4H50A 4A79A 3CNJA 3ALJA 4GR1A 1B5QA 4Z24A 4H4WA 2GV8A 1ONFA 2B9XA 3UOVA 3DGZA 1ELIA 4H4QA 4U8OA 4Y4MA 3Q9TA 3FBSA 1NHSA 3I3LA 3T31A 1DOEA 2R0PA 4LIIA 2APGA 3AYJA 1EL9A 1S3BA 3AE9A 5CKUA 4GUVA 3AE2A 1FEBA 3SGLA 2UZZA 3CNDA 1K0IA 4NTDA 1AOGA 3SZCA 1NHQA 1CJ3A 3RNMA 2XFUA 3CTYA 3SM8A 1F8WA 4NTCA 3SYIA 2BS3A 4H4YA 2FJBA 3CNTA 2R0GA 2VQBA 5BULA 1GERA 4EMWA 2GRTA 1H7WA 2VVLG 3AD7B 2YM2A 3V76A 4A9WA 4BJZA 4LU6A 3SX6A 4IVOB 1Y56B 4P9SA 4OPTA 4TLXA 1P2EA 4DGKA 1XDIA 2ZZBA 1OJTA 1E1KA 2FBWA 3SY4A 2BABA 5BVAA 2Z5XA 2JK6A 2QCUA 1NAAA 2ZBWA 3L5OA 2EQ9A 2R4EA 3AE7A 3UKKA 4AP1A 1D4EA 1E1MA 3V3NA 3T0KA 4NNJA 2V6OA 1CC4A 4A65A 4M52A 3DJGX 2GAGB 4TM3A 3AD8B 2WBAA 2ZZ0A 3QFAA 3BHKA 1L9DA 4U8IA 5FS6A 2Q7VA 2WQYA 3SZFA 4B67A 1NENA 2XLPA 1KNRA 3HZLA 1QLBA 1DOCA 2H88A 4ZCCA 2BS4A 4XWZA 1PBFA 3QVPA 2X99A 2QA2A 1V59A 1SEZA 4Z2TA 3ICTA 1JRXA 1S7MA 2R45A 3V3OA 3T2YA 3ALLA 1X31B 4II3A 4G74A 4H4XA 1B4VA 4EQXA 3K7QX 3NH3X 3NGCX 1P2HA 3IC9A 1EBDA 1GT8A 3BI4A 4U8NA 2C72A 4NEWA 3C4AA 2E5VA 1BWCA 3SFEA 2ARDA 1CJ4A 1M64A 2AR8A 1GPEA 2BS2A 3AWIA 4A5LA 4A99A 3NK2X 4GDEA 3DGHA 3EF6A 4RG4A 4ICYA 4J57A 5EB5A 4ECHA 1IUTA 1XHCA 3GRSA 1VRQB 4I58A 2WU5A 1JRYA 5TR3A 3QVRA 4CCQA 2AQJA 3D1CA 3AYLA 3BNMA 1EL7A 3GWDA 3UOXA 3R9UA 5C3JA 4H2NA 3VQRA 4OCGA 1RYIA 1KF6A 1E7PA 2WS3A 4UDRA 1D4CA 3UTGA 3VRAA 1PBEA 4C74A 5KMRA 2A8XA 3D9XA 3UOYA 3IHMA 3WE0A 1FEAA 4NEVA 3QJ4A 4H7UA 2BC1A 3PG6A 2BK3A 2XLTA 4I59A 2GF3A 4B1BA 1PBCA 3P4SA 4EIQA 4EM4A 4YSZA 1ZY8A 4B65A 3AE8A 3AEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HB9 A;  5M0Z A;  2X8C A;  2XFO A;  3FIM B;  1DOB A;  4OPI A;  3UTE A;  3G5Q A;  1L9C A;  3H8L A;  5KRQ A;  2YG7 A;  4RSL A;  5KVI A;  2QAE A;  1TDO A;  3PS9 A;  1FEC A;  1GRA A;  4J2W A;  4H2Q A;  3DH9 A;  5KXJ A;  5GRT A;  1GRH A;  5GSN A;  2GR0 A;  2WOW A;  1LTX R;  4JY3 A;  4TM1 A;  4E0V A;  3KD9 A;  2A89 A;  1O95 A;  1PJ5 A;  3F8R A;  1Q1W A;  2C65 A;  3CGD A;  4YSH A;  3S5W A;  4JY2 A;  3UKP A;  2VRM A;  4Z26 A;  1KNP A;  2YR5 A;  4Z44 A;  4GCM A;  4U8J A;  4EQS A;  4Y4N A;  3RP8 A;  2EQ6 A;  1GRG A;  2XYO A;  1REO A;  3DA1 A;  5M10 A;  2GR3 A;  3K7T A;  1BZL A;  1KDG A;  1H84 A;  3OZ2 A;  3M0O A;  1W4X A;  3ICR A;  4ZN0 A;  1HYU A;  3DJJ A;  1COY A;  3GRT A;  1DJN A;  3AE4 A;  1LJ1 A;  3PO7 A;  5HHF A;  4U2T A;  2WPC A;  2YM1 A;  1N4U A;  2OLO A;  1S2Y A;  2BXR A;  4CRT A;  1GTE A;  5JCI A;  2BK4 A;  2AAQ A;  1M6I A;  4U2S A;  1D4D A;  1NEK A;  2YVF A;  4JN9 A;  2O9Z A;  2YAU A;  1PBB A;  4EM3 A;  4RG3 A;  1NPX A;  4USQ A;  2YG4 A;  4B63 A;  1H81 A;  2WES A;  3NN6 X;  5JCN A;  3UKA A;  2V5Z A;  2WHD A;  2NPX A;  5U25 A;  4YTP A;  3COX A;  1TYT A;  2OAL A;  1ZX9 A;  2CDU A;  2JAE A;  4GRT A;  4B68 A;  3G5R A;  1GXF A;  3RHA A;  5HXI A;  4J31 A;  1H86 A;  1YQ3 A;  2YWL A;  4WX1 A;  2VRL A;  2JKC A;  1TRB A;  3CIR A;  5JCK A;  4APN A;  1IUX A;  3RP7 A;  4A6N B;  4YTN A;  3LB8 A;  2B76 A;  2A87 A;  4YKF A;  3QSE A;  1DNC A;  2B7R A;  5U1O A;  1EL8 A;  5HYM A;  2VOU A;  4X9N A;  1GOS A;  1H82 A;  4H4U A;  1YKJ A;  3CGE A;  1PN0 A;  1LPF A;  4K5S A;  3KVE A;  1D7Y A;  1PDH A;  3ZYX A;  4LA1 A;  4J34 A;  4BK3 A;  2BAC A;  4Z2U A;  4EIP A;  3UTH A;  4C3Y A;  2XLU A;  4PAB A;  1BF3 A;  4JNQ A;  2V3B A;  5FMH A;  2B7S A;  4FK1 C;  2RGJ A;  1K0L A;  4Z2R A;  1GV4 A;  1TYP A;  2XVI A;  4USR A;  2ACZ A;  5FS9 A;  2BXS A;  3UTF A;  4JQ9 A;  4ADW A;  1H6V A;  4H4V A;  4C5O A;  4FX9 A;  4N9X A;  1VG0 A;  3KA7 A;  2XVE A;  3AYI A;  1S3E A;  5CQF A;  1PXB A;  2FJD A;  3NHO X;  4YSX A;  5U63 A;  3S61 A;  3LOV A;  1O94 A;  3B6D A;  2YLW A;  4FK1 A;  3AE1 A;  4WCT A;  4EQR A;  2XFN A;  1BGN A;  5KOW A;  1XAN A;  2C75 A;  3GMB A;  1F6M A;  2GEW A;  3II4 A;  2Q0L A;  1GRB A;  4BUR A;  3KU9 A;  4AT2 A;  1JOA A;  3FMW A;  3UP4 A;  1JEH A;  3K30 A;  4YT0 A;  4U8M A;  2R0C A;  1YQZ A;  3ALM A;  4J33 A;  2XCG A;  3RED A;  4CNJ A;  1Y56 A;  2WDV A;  4AT0 A;  4JNA A;  4U8K A;  1Z6L A;  3ABV A;  3P4P A;  1H83 A;  4AOX A;  3KPF A;  1MO9 A;  1N4V A;  3CNP A;  4OPD A;  3FG2 P;  2RGH A;  1IUW A;  2VZ2 A;  3BNU A;  3D8X A;  3IF9 A;  3EAO A;  2GMJ A;  3QFB A;  2CVJ A;  3QSM A;  2YLZ A;  5EB4 A;  2R9Z A;  3Q6J A;  2BK5 A;  2E1M A;  1MXT A;  2B9Y A;  3GYI A;  4K7Z A;  3SFD A;  4YXD A;  3CGB A;  3AE6 A;  4U2L A;  1ZOV A;  4YTM A;  3CPH G;  1JNR A;  2BA9 A;  2XLS A;  2TPR A;  4AOS A;  1ZMD A;  2C7G A;  2TMD A;  4H2P A;  2GR2 A;  4YWO A;  1F8S A;  1Q9I A;  3NYF A;  4YSY A;  5BRT A;  3P9U A;  2WPE A;  2WDR A;  4XXG A;  1YQ4 A;  2YVJ A;  1ZDL A;  4DSH A;  3H4K A;  2XFP A;  2BCG G;  4CCR A;  3P1W A;  3VR8 A;  4X9M A;  4H2R A;  2YLX A;  5KVH A;  1QJD A;  3G5S A;  1GAL A;  3K7M X;  5EOW A;  2J3N A;  3ISH A;  3GMC A;  3ZDN A;  3SQP A;  3AD9 B;  1ZKQ A;  4O5U A;  4OPC A;  4C3X A;  3VRB A;  2C70 A;  3NT6 A;  1FCD A;  4U8L A;  2IVE A;  3AE5 A;  3IWA A;  5IPY A;  4NZH A;  3UP5 A;  1N4W A;  4REK A;  1OJA A;  2GQF A;  2Y6R A;  2XVJ A;  1LQT A;  1F3P A;  1BGJ A;  1F8R A;  3LAD A;  1H7X A;  3F8D A;  3URH A;  2WOV A;  2B9W A;  4Z43 A;  1K0J A;  1NG3 A;  4H4Z A;  3P4R A;  4TM4 A;  1L9E A;  1K4Q A;  2C3C A;  3AXB A;  3IHG A;  1LVL A;  1LV0 A;  2C64 A;  3GDN A;  3H8I A;  4GDP A;  4CNK A;  5EBK A;  4CY6 A;  2YLS A;  4XWR A;  2WP9 A;  3ATR A;  1DOD A;  2VVM A;  1E1N A;  4K8D A;  4BV6 A;  3PVC A;  2YLR A;  5J60 A;  2GAH B;  4EQW A;  3NYC A;  2E4G A;  5IQ1 A;  2XDO A;  2X50 A;  1NHP A;  1DXL A;  1NDA A;  1E6E A;  1Y0P A;  2WET A;  2BC0 A;  4H4P A;  2XVH A;  2OA1 A;  3DK9 A;  1CHU A;  1MOK A;  2GB0 A;  3C96 A;  3NN0 X;  2JB1 A;  3UCL A;  1NHR A;  2YG3 A;  2YR6 A;  3C4N A;  3AEC A;  3GSI A;  1CJC A;  3UOZ A;  2VVL A;  4KX6 A;  1D7L A;  3EPT A;  3LZX A;  3NYE A;  1JU2 A;  3NRN A;  3I6D A;  4J36 A;  3O0H A;  2YLT A;  3NTD A;  4J56 A;  1NG4 A;  5J7X A;  2YQU A;  2R46 A;  4K5R A;  1CF3 A;  1PJ6 A;  4HA6 A;  1IUS A;  1PJ7 A;  2QA1 A;  2YVG A;  1JNZ A;  4TLZ A;  4C77 A;  1B8S A;  2YG6 A;  2GR1 A;  3AED A;  3GD4 A;  2OAM A;  4K2X A;  3CN8 A;  1XPQ A;  3ADA B;  3ITJ A;  4IV9 A;  1RSG A;  2VQ7 A;  3EAN A;  4B64 A;  1GRT A;  1E1L A;  2H89 A;  1D5T A;  4UDQ A;  1PXC A;  3KLJ A;  2V3A A;  3UKH A;  3CGC A;  2JBV A;  5KWF A;  2EQ7 A;  4DSG A;  4O5Q A;  1ZOY A;  5JCL A;  2YG5 A;  3BI5 A;  3LJP A;  3CPI G;  2DKI A;  5C2T A;  3VR9 A;  3DK4 A;  1N1P A;  5FS7 A;  3GWF A;  4K22 A;  3BHF A;  2EQ8 A;  1TDN A;  2FJA A;  1IUU A;  1Q1R A;  1RP0 A;  4Y4L A;  3AEG A;  2GQW A;  1S2Q A;  1GRF A;  1VQW A;  4TM0 A;  1O5W A;  3NLC A;  1IJH A;  1ZP0 A;  4CY8 A;  3L8K A;  1YY5 A;  4JDR A;  2HQM A;  5HY5 A;  4BJY A;  2RAB A;  2FJE A;  3NTA A;  2IVD A;  2WP5 A;  1CL0 A;  1LQU A;  4OPL A;  4D04 A;  1CJ2 A;  1E39 A;  1OJC A;  2BCP A;  2V61 A;  3UKL A;  2NVK X;  3FPZ A;  2CFY A;  2Q0K A;  3KKJ A;  4IVM B;  1GSN A;  2BYB A;  4OVI A;  4GF7 A;  3NIX A;  3F8P A;  2WOI A;  1IUV A;  1VDC A;  4B66 A;  2X8H A;  2JB2 A;  1L0V A;  4H4T A;  4UDP A;  2X8G A;  2C73 A;  2IID A;  4A6N A;  3DJE A;  4YKG A;  1PXA A;  5JCM A;  4EMI A;  2GH5 A;  2GMH A;  1KSU A;  3VRD B;  3E1T A;  4BK2 A;  4BK1 A;  1TDE A;  2R4J A;  3AEA A;  1PHH A;  2PYX A;  3DJD A;  2X3N A;  3T37 A;  5L46 A;  2WDQ A;  1KSS A;  2V60 A;  4OPG A;  1GTH A;  1VG9 A;  1BKW A;  3GDP A;  3M13 A;  4KPR A;  3ICS A;  5BUK A;  4A7A A;  2JB3 A;  3UKQ A;  2Z5Y A;  3OC4 A;  1UKV G;  2PHH A;  4D03 A;  3L1R A;  3GYJ A;  4EMJ A;  1TDF A;  4U8P A;  3NG7 X;  2XVF A;  3QSS A;  1KFY A;  1JRZ A;  2YR4 A;  3M12 A;  3AE3 A;  1EL5 A;  4ZCD A;  1GET A;  1FL2 A;  5ER0 A;  4H4S A;  4FDC B;  2C67 A;  3LXD A;  4NTE A;  3GD3 A;  2RGO A;  4B69 A;  3AEB A;  4AP3 A;  2F5Z A;  4H4R A;  1DJQ A;  1OJD A;  5DBJ A;  4OPU A;  1PS9 A;  2W0H A;  2Y6Q A;  3DME A;  1GRE A;  3NK1 X;  4DNA A;  2GVC A;  1OJ9 A;  2DKH A;  3AB1 A;  4IA5 A;  3BI2 A;  3NNE A;  5IQ4 A;  2WPF A;  5KOX A;  3LZW A;  3NKS A;  3DK8 A;  1B37 A;  1GES A;  1ZK7 A;  3AEE A;  2XLR A;  1GEU A;  3ATQ A;  2WEU A;  5LV9 A;  3JSK A;  3P4Q A;  3CNS A;  2ZZC A;  4Z25 A;  2WU2 A;  1CC6 A;  2C66 A;  4IA6 A;  1TDK A;  1CBO A;  1CC2 A;  2CUL A;  3NK0 X;  2C3D A;  1QO8 A;  4PAA A;  1GND A;  1FOH A;  2I0Z A;  1ZMC A;  5FS8 A;  3UKF A;  4CBQ A;  3B3R A;  1PBD A;  3CPJ G;  2C76 A;  2OLN A;  2Q6U A;  2XFQ A;  4UP3 A;  4X4J A;  2WP6 A;  4MJW A;  3RP6 A;  4H50 A;  4A79 A;  3CNJ A;  3ALJ A;  4GR1 A;  1B5Q A;  4Z24 A;  4H4W A;  2GV8 A;  1ONF A;  2B9X A;  3UOV A;  3DGZ A;  1ELI A;  4H4Q A;  4U8O A;  4Y4M A;  3Q9T A;  3FBS A;  1NHS A;  3I3L A;  1DOE A;  2R0P A;  4LII A;  2APG A;  3AYJ A;  1EL9 A;  1S3B A;  3AE9 A;  5CKU A;  4GUV A;  3AE2 A;  1FEB A;  3SGL A;  2UZZ A;  3CND A;  1K0I A;  4NTD A;  1AOG A;  1NHQ A;  1CJ3 A;  3RNM A;  2XFU A;  3CTY A;  3SM8 A;  1F8W A;  4NTC A;  2BS3 A;  4H4Y A;  2FJB A;  3CNT A;  2R0G A;  2VQB A;  5BUL A;  1GER A;  4EMW A;  2GRT A;  1H7W A;  2VVL G;  3AD7 B;  2YM2 A;  3V76 A;  4A9W A;  4BJZ A;  4LU6 A;  4IVO B;  1Y56 B;  4P9S A;  4OPT A;  4TLX A;  1P2E A;  4DGK A;  1XDI A;  2ZZB A;  1OJT A;  1E1K A;  2FBW A;  2BAB A;  5BVA A;  2Z5X A;  2JK6 A;  2QCU A;  1NAA A;  2ZBW A;  2EQ9 A;  2R4E A;  3AE7 A;  3UKK A;  4AP1 A;  1D4E A;  1E1M A;  3V3N A;  2V6O A;  1CC4 A;  4A65 A;  4M52 A;  3DJG X;  2GAG B;  4TM3 A;  3AD8 B;  2WBA A;  2ZZ0 A;  3QFA A;  3BHK A;  1L9D A;  4U8I A;  5FS6 A;  2Q7V A;  2WQY A;  4B67 A;  1NEN A;  2XLP A;  1KNR A;  3HZL A;  1QLB A;  1DOC A;  2H88 A;  4ZCC A;  2BS4 A;  4XWZ A;  1PBF A;  3QVP A;  2X99 A;  2QA2 A;  1V59 A;  1SEZ A;  4Z2T A;  3ICT A;  1JRX A;  2R45 A;  3V3O A;  3ALL A;  1X31 B;  4H4X A;  1B4V A;  4EQX A;  3K7Q X;  3NH3 X;  3NGC X;  1P2H A;  3IC9 A;  1EBD A;  1GT8 A;  3BI4 A;  4U8N A;  2C72 A;  4NEW A;  3C4A A;  2E5V A;  1BWC A;  3SFE A;  2ARD A;  1CJ4 A;  1M64 A;  2AR8 A;  1GPE A;  2BS2 A;  3AWI A;  4A5L A;  4A99 A;  3NK2 X;  4GDE A;  3DGH A;  3EF6 A;  4RG4 A;  4ICY A;  4J57 A;  5EB5 A;  4ECH A;  1IUT A;  1XHC A;  3GRS A;  1VRQ B;  4I58 A;  2WU5 A;  1JRY A;  5TR3 A;  3QVR A;  4CCQ A;  2AQJ A;  3D1C A;  3AYL A;  3BNM A;  1EL7 A;  3GWD A;  3UOX A;  3R9U A;  5C3J A;  4H2N A;  3VQR A;  4OCG A;  1RYI A;  1KF6 A;  1E7P A;  2WS3 A;  4UDR A;  1D4C A;  3UTG A;  3VRA A;  1PBE A;  4C74 A;  2A8X A;  3UOY A;  3IHM A;  3WE0 A;  1FEA A;  4NEV A;  3QJ4 A;  4H7U A;  2BC1 A;  2BK3 A;  4I59 A;  2XLT A;  4B1B A;  2GF3 A;  4YSZ A;  1PBC A;  3P4S A;  4EIQ A;  4EM4 A;  1ZY8 A;  4B65 A;  3AE8 A;  3AEF A; 
#chains in the Genus database with same CATH topology
 5M0Z A;  3FIM B;  1DOB A;  3UTE A;  1FEC A;  5GRT A;  1N5W C;  2GGE A;  2GR0 A;  2WOW A;  2QJM A;  4E6M A;  4TM1 A;  3KD9 A;  2VRM A;  1KNP A;  4U8J A;  3RP8 A;  2EQ6 A;  3CT2 A;  3ES7 A;  3DA1 A;  5FJU A;  1KDG A;  1W4X A;  4ZN0 A;  1HYU A;  3AE4 A;  3MSY A;  2AL2 B;  3VA8 A;  4KEM A;  4IP4 A;  1FO4 A;  3OZY A;  1NEK A;  2GGG A;  4Z1Y A;  4B63 A;  2WES A;  5JCN A;  2WHD A;  3R11 A;  3VCC A;  6ENL A;  1H86 A;  2YWL A;  2JKC A;  4A6N B;  3SN1 A;  3DEQ A;  1GOS A;  1MUC A;  4K5S A;  3ZYX A;  4J34 A;  3GY1 A;  4Z2U A;  2XLU A;  4PAB A;  4JNQ A;  2QJN A;  2V3B A;  4FP1 A;  4FK1 C;  2RGJ A;  1K0L A;  1GV4 A;  4USR A;  2ACZ A;  3MQT A;  4ADW A;  4C5O A;  4N9X A;  5U63 A;  3B6D A;  1BGN A;  1XAN A;  3GMB A;  4BUR A;  1JEH A;  3K30 A;  3PK7 A;  4U8M A;  2W55 A;  4YT0 A;  1YQZ A;  4AT0 A;  4JNA A;  4AOX A;  1EC9 A;  3D8X A;  1P48 A;  3T6C A;  3SFD A;  2MNR A;  3D47 A;  3AE6 A;  4YTM A;  3CPH G;  1JNR A;  1JRO A;  3NYF A;  1Q9I A;  5KMS A;  3P9U A;  1STZ A;  2WDR A;  3SR6 B;  2YVJ A;  2BCG G;  3P1W A;  3K7M X;  2NQL A;  3AD9 B;  4C3X A;  3DDM A;  2C70 A;  1FCD A;  2OVL A;  3P3B A;  2GQF A;  2XVJ A;  2W3S A;  3OP2 A;  3ZLG A;  1ONE A;  3IHG A;  1LV0 A;  4HNC A;  2YLS A;  2WP9 A;  3ATR A;  1DOD A;  3UXK A;  1PDY A;  3PVC A;  4K8D A;  2GAH B;  2XDO A;  1NHP A;  1NDA A;  1Y0P A;  2BC0 A;  2OA1 A;  3UCL A;  4IZG A;  3NN0 X;  1NHR A;  2YG3 A;  3GSI A;  3UOZ A;  2VVL A;  4KX6 A;  3JZU A;  2ZC8 A;  4IHC A;  4H2H A;  3R10 A;  3SXI A;  3AED A;  3CN8 A;  1GRT A;  2H89 A;  2V3A A;  4GIR A;  2EQ7 A;  2PTZ A;  1ZOY A;  3LJP A;  3TJ4 A;  2DKI A;  4K22 A;  5FS7 A;  3GWF A;  3TWA A;  1EC7 A;  3HYX A;  2GGI A;  4JN8 A;  5HY5 A;  4BJY A;  2WP5 A;  1CL0 A;  2BCP A;  2V61 A;  2BYB A;  4GF7 A;  2WOI A;  1IUV A;  1VDC A;  2IID A;  3DJE A;  3FVD A;  3E1T A;  3DJD A;  2X3N A;  3T37 A;  5L46 A;  1BKW A;  2GGJ A;  3GDP A;  2QJJ A;  2FKP A;  4HCL A;  3SBF A;  2PHH A;  3DER A;  4EMJ A;  4U8P A;  3T14 A;  1KFY A;  3M12 A;  5ER0 A;  4FDC B;  2W3R A;  2RGO A;  1SB3 B;  4GAV A;  3P93 A;  2W0H A;  3SJN A;  2DKH A;  3AB1 A;  3BSM A;  5IQ4 A;  2HNE A;  5KOX A;  3LZW A;  2I5Q A;  4HPN A;  4E5T A;  1EBG A;  3CXB A;  3UGV A;  4IA6 A;  1CC2 A;  3TW9 A;  2CUL A;  2OFJ A;  1GND A;  3UKF A;  4UP3 A;  2WP6 A;  2OX4 A;  2QQ6 A;  4Z24 A;  1N60 C;  4H4W A;  2B9X A;  4K1W A;  1DOE A;  3AYJ A;  4LII A;  3SGL A;  3AE2 A;  1FEB A;  3T4W A;  3CND A;  1AOG A;  1NHQ A;  2BS3 A;  2R0G A;  2YM2 A;  4LU6 A;  3SX6 A;  3H12 A;  4GYP A;  1XDI A;  1OJT A;  1E1K A;  2FBW A;  4AP1 A;  1D4E A;  1E1M A;  1CC4 A;  5FS6 A;  1P43 A;  2H88 A;  4Z17 A;  2BS4 A;  2X99 A;  3ICT A;  1JRX A;  3V3O A;  3SSZ A;  3STP A;  4M6U A;  3K7Q X;  1P2H A;  1GT8 A;  3B9J B;  3H70 A;  1CJ4 A;  3AWI A;  4A5L A;  2CHR A;  4RG4 A;  5G5G B;  3IJL A;  5EB5 A;  4ECH A;  1XHC A;  3GRS A;  1VRQ B;  4I58 A;  1JRY A;  5TR3 A;  3BNM A;  3VRA A;  1E7P A;  2WS3 A;  3UTG A;  1MRA A;  3UOY A;  2DW6 A;  4B1B A;  2GF3 A;  3TCS A;  3P4S A;  4YSZ A;  2OQH A;  4B65 A;  3AEF A;  3AM9 A;  3ENL A;  2PS2 A;  5KRQ A;  4H83 A;  2GGH A;  3PS9 A;  4J2W A;  3DH9 A;  5IDZ A;  4JY3 A;  1Q1W A;  1V97 A;  3CGD A;  3S5W A;  4JY2 A;  3UKP A;  4Z26 A;  4Z44 A;  2P8B A;  5FJT A;  4EQS A;  4Y4N A;  1GRG A;  1H84 A;  3M0O A;  1COY A;  3GRT A;  1DJN A;  3PO7 A;  4A35 A;  4CRT A;  4GAP A;  3AMZ A;  2GDQ A;  2O9Z A;  1PBB A;  3UKA A;  2P88 A;  3NVZ B;  5U25 A;  4YTP A;  3COX A;  2PU0 A;  4GRT A;  3G5R A;  3CXO A;  3H8A A;  2VRL A;  3CIR A;  3RP7 A;  4APN A;  3DG3 A;  3LB8 A;  2BRY A;  4IL2 A;  2B76 A;  3TJI A;  4YKF A;  1DNC A;  2ZAD A;  2B7R A;  5U1O A;  1EL8 A;  5HYM A;  3CGE A;  1PN0 A;  3KVE A;  1D7Y A;  1N5X A;  4BK3 A;  2BAC A;  4EIP A;  3D46 A;  4Z2R A;  3UTF A;  7ENL A;  1H6V A;  4H4V A;  1VG0 A;  3AYI A;  1S3E A;  4ZCW A;  3S5S A;  3ZVI A;  3DES A;  2YLW A;  3AE1 A;  4EQR A;  5KOW A;  1F6M A;  2Q0L A;  1NEL A;  2GSH A;  1GRB A;  1JOA A;  3FMW A;  1Z6L A;  1H83 A;  1MO9 A;  3CNP A;  2RGH A;  3BNU A;  3EAO A;  2GMJ A;  2YLZ A;  5EB4 A;  3Q6J A;  2C4C A;  2E1M A;  3GYI A;  4K8G A;  4K7Z A;  3OW1 A;  2XLS A;  2C7G A;  4H2P A;  4YSY A;  2GR2 A;  4XXG A;  1TE6 A;  2XFP A;  3VR8 A;  4X9M A;  2YLX A;  5KVH A;  1GAL A;  3H7V A;  3SQP A;  4O5U A;  1ZKQ A;  2OZ8 A;  4OPC A;  3DIP A;  3IJQ A;  3AE5 A;  3T2Z A;  4ZA0 A;  4NZH A;  1N4W A;  3UP5 A;  2Y6R A;  3HPF A;  1LQT A;  4G9K A;  1F3P A;  1BGJ A;  3LAD A;  3N4E A;  3URH A;  2WOV A;  4Z43 A;  1K0J A;  1W6T A;  1NG3 A;  3P4R A;  1L9E A;  1K4Q A;  3AXB A;  4CNK A;  3H8I A;  2MUC A;  5EBK A;  4XWR A;  4K2S A;  2AL1 A;  3RCY A;  3Q45 A;  2VVM A;  4BV6 A;  5J60 A;  3NYC A;  2AKM A;  1E6E A;  4MMW A;  2POD A;  4E8G A;  1MOK A;  3JW7 A;  2YR6 A;  3AEC A;  1CJC A;  1D7L A;  3HYV A;  3N6H A;  3NTD A;  2YQU A;  2QA1 A;  2YVG A;  1JNZ A;  3VFC A;  4C77 A;  1E9I A;  2YG6 A;  2OAM A;  1XPQ A;  4IV9 A;  1RSG A;  2VQ7 A;  3V4B A;  4UDQ A;  1D5T A;  3UKH A;  3CGC A;  5KWF A;  1N63 C;  1SJB A;  3CK5 A;  3CPI G;  3DK4 A;  3BHF A;  2EQ8 A;  2FJA A;  2GQW A;  3FJ4 A;  1VQW A;  1GRF A;  4HCH A;  4HYR A;  3NLC A;  4JDR A;  1PDZ A;  2PP0 A;  4OPL A;  1E39 A;  3UKL A;  3FPZ A;  2CFY A;  2Q0K A;  3BJS A;  3NIX A;  4HNL A;  1L0V A;  2O56 A;  4H4T A;  4UDP A;  5JCM A;  4EMI A;  2XSX A;  4BK1 A;  3AEA A;  1PHH A;  1WUE A;  3IJI A;  1H2I A;  1GTH A;  3ICS A;  3QKE A;  2OQY A;  4A7A A;  2JB3 A;  4A3R A;  1UKV G;  3GYJ A;  3GYX A;  3NG7 X;  3SZW A;  3A7U A;  1EBH A;  1GET A;  5DBJ A;  4H4R A;  1DJQ A;  5G5H B;  1DTN A;  3DME A;  1GRE A;  3BOX A;  4DNA A;  1OJ9 A;  1RVK A;  4IA5 A;  3NNE A;  3UJS A;  4TVW A;  5KMP A;  3DFY A;  3NKS A;  1B37 A;  3AEE A;  3EEZ A;  5LV9 A;  3JSK A;  3P4Q A;  4NWZ A;  3CNS A;  4Z25 A;  2PCE A;  2OO6 A;  3NZG A;  4PAA A;  1JDF A;  2I0Z A;  1ZMC A;  5FS8 A;  1VQZ A;  1PBD A;  3B3R A;  3CPJ G;  2OLN A;  4A6G A;  3RP6 A;  3RR1 A;  4A79 A;  1B5Q A;  4E4U A;  4GYP C;  5BOF A;  1ELI A;  2HXU A;  3FBS A;  3NO1 A;  1EL9 A;  3AE9 A;  3FV9 A;  3SZC A;  1K0I A;  2FYM A;  3VC6 A;  3NVV B;  3I6T A;  4H4Y A;  3CNT A;  2PGW A;  2VQB A;  1GER A;  4EMW A;  3V76 A;  3VCN A;  2P3Z A;  4IVO B;  4TLX A;  1P2E A;  3SY4 A;  2Z5X A;  3CYJ A;  2QCU A;  4X2P A;  1BQG A;  4M52 A;  4TM3 A;  3AD8 B;  2WBA A;  4U8I A;  2Q7V A;  4ZCC A;  1PBF A;  3QVP A;  2QA2 A;  1V59 A;  3T2Y A;  4G74 A;  1B4V A;  4EQX A;  3NH3 X;  3NVY B;  3IC9 A;  1EBD A;  3BI4 A;  4U8N A;  4NEW A;  3SFE A;  2ARD A;  2BS2 A;  4A99 A;  2OPJ A;  3DGH A;  3EF6 A;  4ICY A;  4J57 A;  3JVA A;  5EU9 A;  1IUT A;  1JCT A;  4CCQ A;  3EUB 3;  1EL7 A;  3GWD A;  3T9P A;  1RYI A;  1ECQ A;  5J04 A;  1D4C A;  3D9X A;  3RIT A;  2PSN A;  2OG9 A;  3QJ4 A;  4H7U A;  2BK3 A;  2XLT A;  4ROP A;  4TM4 A;  3AE8 A;  3SZ0 A;  3N4F A;  2XFO A;  3HRD C;  4RSL A;  5KVI A;  1TDO A;  1FIQ B;  1GRA A;  4H2Q A;  5GSN A;  1EC8 A;  4E0V A;  2A89 A;  1O95 A;  1PJ5 A;  3F8R A;  2C65 A;  1L8P A;  3NXL A;  2BRA A;  1REO A;  2GR3 A;  2PTX A;  5HHF A;  4U2T A;  2YM1 A;  3ES8 A;  2PPG A;  2BXR A;  4U2S A;  4JN9 A;  2YAU A;  4EM3 A;  4USQ A;  1SJA A;  3NN6 X;  2V5Z A;  2PTW A;  3Q4D A;  2PP1 A;  1TYT A;  1ZX9 A;  1GXF A;  3RHA A;  5HXI A;  4J31 A;  4IT1 A;  3ZVH A;  1IUX A;  4YTN A;  2OKT A;  4JN7 A;  2XGZ A;  3OZM A;  4X9N A;  1MDL A;  1RM6 B;  4H4U A;  1PDH A;  1R6W A;  4J1O A;  3GO2 A;  1SJC A;  4EWJ A;  3ETR B;  1IYX A;  3UTH A;  3CB3 A;  5FMH A;  2B7S A;  2PU1 A;  3NVW B;  3KA7 A;  4GIS A;  5CQF A;  3QTP A;  2FJD A;  3LOV A;  1O94 A;  5FJP A;  3KU9 A;  4AT2 A;  3UP4 A;  1KCZ A;  3ALM A;  2XCG A;  3RED A;  5KNL A;  1TKK A;  2E5A A;  4U8K A;  3KPF A;  1N4V A;  4OPD A;  2QGY A;  3IF9 A;  2QDE A;  2CVJ A;  4HCD A;  1ZOV A;  3K1G A;  2BA9 A;  2TPR A;  4AOS A;  1ZMD A;  3DFH A;  4GGH A;  2OZT A;  4YWO A;  1F8S A;  2W54 A;  5BRT A;  3I4K A;  1YQ4 A;  1ZDL A;  4DSH A;  4H2R A;  1QJD A;  5EOW A;  3ZDN A;  3VRB A;  4MGG A;  4U8L A;  2IVE A;  5IPY A;  1OJA A;  4G8T A;  1H7X A;  4GGB A;  3UJE A;  3GDN A;  2C64 A;  4CY6 A;  1E1N A;  2YLR A;  2E4G A;  2X50 A;  3S47 A;  4DHG A;  4H4P A;  2GB0 A;  2PA6 A;  4HN8 A;  2OLA A;  1BKH A;  3EPT A;  3LZX A;  3NYE A;  3O0H A;  3PWI A;  2YLT A;  4HA6 A;  3R0U A;  1B8S A;  3GD4 A;  4K2X A;  3MUC A;  1JPM A;  3EAN A;  4B64 A;  1PXC A;  2JBV A;  4DSG A;  2YG5 A;  3BI5 A;  5C2T A;  2XH4 A;  1N1P A;  2PGE A;  1IUU A;  1Q1R A;  4Y4L A;  4ZOH B;  1S2Q A;  4TM0 A;  1O5W A;  1IJH A;  3L8K A;  2HZG A;  2HQM A;  2FJE A;  3NTA A;  2IVD A;  1CJ2 A;  2NVK X;  4IVM B;  4ENL A;  4B66 A;  2X8H A;  1X2H A;  1R0M A;  2X8G A;  2C73 A;  4YKG A;  1MDR A;  1PXA A;  3FYY A;  3R07 C;  1KSU A;  3VRD B;  1TDE A;  2PYX A;  2WDQ A;  1KSS A;  2V60 A;  4OPG A;  1VG9 A;  3M13 A;  2Z5Y A;  3OC4 A;  3THU A;  3L1R A;  4G73 A;  2XVF A;  3NRZ B;  4ZCD A;  1FL2 A;  2C67 A;  4NTE A;  3LXD A;  3GD3 A;  4AP3 A;  2F5Z A;  4OPU A;  3ZVH B;  1PS9 A;  3NK1 X;  2GVC A;  3BI2 A;  4G7F A;  3DK8 A;  1GES A;  1ZK7 A;  1GEU A;  3ATQ A;  2QDD A;  2ZZC A;  3TQP A;  2WU2 A;  1CC6 A;  1TDK A;  3NK0 X;  1QO8 A;  1NU5 A;  4X4J A;  3V5F A;  3CNJ A;  3A7A A;  4H19 A;  2GV8 A;  3U4F A;  4U8O A;  4Y4M A;  3I3L A;  2R0P A;  2APG A;  1S3B A;  5CKU A;  2UZZ A;  2XFU A;  2XH2 A;  1F8W A;  4NTC A;  2FJB A;  3AD7 B;  3MZN A;  4A9W A;  4BJZ A;  1KKO A;  4P9S A;  4OPT A;  3I6E A;  2E3T A;  2ZZB A;  2BAB A;  1NAA A;  3L5O A;  2R4E A;  3PWG A;  3AE7 A;  3UKK A;  3V3N A;  5FJR A;  5BOE A;  2GAG B;  4M0X A;  3NS1 B;  2ZZ0 A;  3QFA A;  1L9D A;  3SZF A;  4B67 A;  2XLP A;  1KNR A;  1QLB A;  3AN1 A;  1DOC A;  1T3Q C;  1N61 C;  1FHV A;  1SEZ A;  4Z2T A;  1S7M A;  2R45 A;  3P0W A;  1F9C A;  4II3 A;  1X31 B;  4H4X A;  1FHU A;  1X2G A;  2C72 A;  3C4A A;  2AR8 A;  1GPE A;  4GDE A;  2DW7 A;  2WU5 A;  3QVR A;  3UOX A;  4DXK A;  3VQR A;  4KWS A;  4OCG A;  4UDR A;  4C74 A;  5KMR A;  1WUF A;  3WE0 A;  2BC1 A;  4I59 A;  4EIQ A;  4HB9 A;  2X8C A;  4OPI A;  3G5Q A;  1L9C A;  3H8L A;  2YG7 A;  2QAE A;  5KXJ A;  3HYW A;  1GRH A;  1LTX R;  3IK4 A;  4IL0 A;  1JPD X;  3RRA A;  1XS2 A;  1OEP A;  4YSH A;  2YR5 A;  4GCM A;  2XYO A;  4KPL A;  5M10 A;  3K7T A;  1BZL A;  3OZ2 A;  3ICR A;  3DJJ A;  1LJ1 A;  5ENL A;  1MNS A;  2WPC A;  1N4U A;  2OLO A;  3NFU A;  1S2Y A;  1GTE A;  5JCI A;  2BK4 A;  2AAQ A;  1M6I A;  1D4D A;  3RGT A;  2YVF A;  1ELS A;  4RG3 A;  1NPX A;  2QVH A;  2YG4 A;  1H81 A;  3KUM A;  2NPX A;  3UXL A;  2OAL A;  2CDU A;  2JAE A;  3GC2 A;  4B68 A;  3CAW A;  3A7R A;  3UJR A;  1YQ3 A;  4WX1 A;  1TRB A;  5JCK A;  1XPY A;  2AKZ A;  2A87 A;  3QSE A;  3R1Z A;  2VOU A;  1H82 A;  1YKJ A;  1LPF A;  3T8Q A;  4LA1 A;  3VC5 A;  4JHM A;  4C3Y A;  2HXT A;  1BF3 A;  3SN4 A;  3UJ2 A;  1JRP A;  1TYP A;  2XVI A;  5FS9 A;  2BXS A;  4JQ9 A;  3GD6 A;  3SN0 A;  3DG7 A;  4FX9 A;  2XVE A;  3MY9 A;  1PXB A;  3NHO X;  4YSX A;  3S61 A;  4FK1 A;  4WCT A;  2XFN A;  2C75 A;  2PP3 A;  2GEW A;  3II4 A;  3KPK A;  3ZLF A;  2R0C A;  4J33 A;  3OPS A;  4CNJ A;  1Y56 A;  2WDV A;  4G6G A;  3RO6 A;  3ABV A;  4DYE A;  3P4P A;  3FG2 P;  2VZ2 A;  1IUW A;  3QFB A;  3QSM A;  2R9Z A;  2BK5 A;  1MXT A;  2B9Y A;  3DG6 A;  4YXD A;  3CGB A;  4U2L A;  4GME A;  3SQS A;  2TMD A;  1FFU C;  2WPE A;  3CMM A;  4KT2 A;  3H4K A;  4CCR A;  2PTY A;  3G5S A;  1TZZ A;  2J3N A;  3ISH A;  3GMC A;  3NT6 A;  3IWA A;  4REK A;  1KN0 A;  3OTR A;  1F8R A;  3F8D A;  2B9W A;  3QPE A;  3TWB A;  4H4Z A;  2C3C A;  3FXG A;  1LVL A;  4GDP A;  3DGB A;  3V3W A;  4EQW A;  5IQ1 A;  1DXL A;  4DWD A;  2WET A;  2XVH A;  3DK9 A;  1CHU A;  3C96 A;  2JB1 A;  3C4N A;  1KKR A;  1JU2 A;  3NRN A;  3I6D A;  4J36 A;  4G6H A;  3B97 A;  3R0K A;  4J56 A;  1NG4 A;  5J7X A;  2R46 A;  4K5R A;  1CF3 A;  1PJ6 A;  1IUS A;  1PJ7 A;  4TLZ A;  3MWC A;  4H1Z A;  3UCD A;  2GR1 A;  3ADA B;  3ITJ A;  1E1L A;  3KLJ A;  2AL2 A;  4O5Q A;  5JCL A;  3VR9 A;  4F4R A;  2ONE A;  1TDN A;  1RP0 A;  3AEG A;  5FJO A;  1YEY A;  1ZP0 A;  4CY8 A;  1YY5 A;  2RAB A;  1LQU A;  4D04 A;  3ZLH A;  3FCP A;  1OJC A;  3T2K A;  3KKJ A;  4OVI A;  1GSN A;  3F8P A;  2JB2 A;  4A6N A;  2GH5 A;  2GMH A;  5KMQ A;  2PMQ A;  1SJD A;  4BK2 A;  2R4J A;  5JRB A;  4KPR A;  2POZ A;  5BUK A;  2RDX A;  3UKQ A;  4D03 A;  1TDF A;  4DN1 A;  3QSS A;  1JRZ A;  3UJF A;  2YR4 A;  3AE3 A;  1EL5 A;  4J3Z A;  3TTE A;  4H4S A;  4B69 A;  3AEB A;  1N62 C;  1OJD A;  2Y6Q A;  3MKC A;  2WPF A;  1KD0 A;  4II2 A;  1FFV C;  2XLR A;  3V5C A;  1VDV A;  2WEU A;  4FI4 A;  3TOY A;  4GFI A;  3HW2 A;  2P8C A;  2C66 A;  2OZ3 A;  1CBO A;  2C3D A;  1FOH A;  4CBQ A;  3PFR A;  2C76 A;  2Q6U A;  2XFQ A;  2XH7 A;  4MJW A;  4H50 A;  3ALJ A;  4GR1 A;  1ONF A;  3UOV A;  3DGZ A;  4YWS A;  4H4Q A;  3Q9T A;  1NHS A;  3T31 A;  4GUV A;  4NTD A;  4TVY A;  1CJ3 A;  3RNM A;  3CTY A;  3SM8 A;  1WYG A;  3SYI A;  5BUL A;  2GRT A;  1H7W A;  2VVL G;  1Y56 B;  4DGK A;  5BVA A;  2JK6 A;  4DX3 A;  2ZBW A;  2EQ9 A;  3U9I A;  3QN3 A;  3T0K A;  4NNJ A;  2V6O A;  4A65 A;  3N6J A;  3DJG X;  4IP5 A;  3BHK A;  2WQY A;  4MKS A;  3HZL A;  1NEN A;  3VDG A;  4XWZ A;  2GL5 A;  3ALL A;  3QLD A;  3NGC X;  2P0I A;  2E5V A;  1BWC A;  3UCC A;  1M64 A;  2XH0 A;  3NK2 X;  3R25 A;  3EKG A;  2AQJ A;  3D1C A;  3AYL A;  3R9U A;  5C3J A;  4H2N A;  1KF6 A;  1PBE A;  2A8X A;  4E4F A;  3IHM A;  1FEA A;  4NEV A;  3PG6 A;  1PBC A;  1ZXI C;  4EM4 A;  1ZY8 A; 
#chains in the Genus database with same CATH homology
 4HB9 A;  5M0Z A;  2X8C A;  2XFO A;  3FIM B;  1DOB A;  4OPI A;  3UTE A;  3G5Q A;  1L9C A;  3H8L A;  5KRQ A;  2YG7 A;  4RSL A;  5KVI A;  2QAE A;  1TDO A;  3PS9 A;  1FEC A;  1GRA A;  4J2W A;  4H2Q A;  3DH9 A;  3HYW A;  5GRT A;  5KXJ A;  1GRH A;  5GSN A;  2GR0 A;  2WOW A;  1LTX R;  4JY3 A;  4TM1 A;  4E0V A;  3KD9 A;  2A89 A;  1O95 A;  1PJ5 A;  3F8R A;  1Q1W A;  2C65 A;  3CGD A;  4YSH A;  3S5W A;  4JY2 A;  3UKP A;  2VRM A;  4Z26 A;  1KNP A;  2YR5 A;  4Z44 A;  4GCM A;  4U8J A;  4EQS A;  4Y4N A;  3RP8 A;  2EQ6 A;  1GRG A;  2BRA A;  2XYO A;  1REO A;  3DA1 A;  5M10 A;  2GR3 A;  3K7T A;  1BZL A;  1KDG A;  1H84 A;  3OZ2 A;  3M0O A;  1W4X A;  3ICR A;  4ZN0 A;  1HYU A;  3DJJ A;  1COY A;  3GRT A;  1DJN A;  3AE4 A;  1LJ1 A;  3PO7 A;  5HHF A;  4U2T A;  2WPC A;  2YM1 A;  1N4U A;  2OLO A;  1S2Y A;  2BXR A;  4CRT A;  1GTE A;  5JCI A;  2BK4 A;  2AAQ A;  1M6I A;  4U2S A;  4GAP A;  1D4D A;  1NEK A;  2YVF A;  4JN9 A;  2O9Z A;  2YAU A;  1PBB A;  4EM3 A;  4RG3 A;  1NPX A;  4USQ A;  2YG4 A;  4B63 A;  1H81 A;  2WES A;  3NN6 X;  5JCN A;  3UKA A;  2V5Z A;  2WHD A;  2NPX A;  5U25 A;  4YTP A;  3COX A;  1TYT A;  2OAL A;  1ZX9 A;  2CDU A;  2JAE A;  4GRT A;  4B68 A;  3G5R A;  1GXF A;  3RHA A;  5HXI A;  4J31 A;  1H86 A;  1YQ3 A;  2YWL A;  4WX1 A;  2VRL A;  2JKC A;  1TRB A;  3CIR A;  5JCK A;  4APN A;  1IUX A;  3RP7 A;  4A6N B;  4YTN A;  3LB8 A;  2BRY A;  2B76 A;  2A87 A;  4YKF A;  3QSE A;  1DNC A;  2B7R A;  5U1O A;  1EL8 A;  5HYM A;  2VOU A;  4X9N A;  1GOS A;  1H82 A;  4H4U A;  1YKJ A;  3CGE A;  1PN0 A;  1LPF A;  4K5S A;  3KVE A;  1D7Y A;  1PDH A;  3ZYX A;  4LA1 A;  4J34 A;  4BK3 A;  2BAC A;  4Z2U A;  4EIP A;  3UTH A;  4C3Y A;  2XLU A;  4PAB A;  1BF3 A;  4JNQ A;  2V3B A;  5FMH A;  2B7S A;  4FK1 C;  2RGJ A;  1K0L A;  4Z2R A;  1GV4 A;  1TYP A;  2XVI A;  4USR A;  2ACZ A;  5FS9 A;  2BXS A;  3UTF A;  4JQ9 A;  4ADW A;  1H6V A;  4H4V A;  4C5O A;  4FX9 A;  4N9X A;  1VG0 A;  3KA7 A;  2XVE A;  3AYI A;  1S3E A;  5CQF A;  1PXB A;  2FJD A;  3NHO X;  4YSX A;  5U63 A;  3S61 A;  3LOV A;  1O94 A;  3B6D A;  2YLW A;  4FK1 A;  3AE1 A;  4WCT A;  4EQR A;  2XFN A;  1BGN A;  5KOW A;  1XAN A;  2C75 A;  3GMB A;  1F6M A;  2GEW A;  3II4 A;  2Q0L A;  1GRB A;  4BUR A;  3KPK A;  3KU9 A;  4AT2 A;  1JOA A;  3FMW A;  3UP4 A;  1JEH A;  3K30 A;  4YT0 A;  4U8M A;  2R0C A;  1YQZ A;  3ALM A;  4J33 A;  2XCG A;  3RED A;  5KNL A;  4CNJ A;  1Y56 A;  2WDV A;  4AT0 A;  4JNA A;  4G6G A;  4U8K A;  1Z6L A;  3SZ0 A;  3ABV A;  3P4P A;  1H83 A;  4AOX A;  3KPF A;  1MO9 A;  1N4V A;  3CNP A;  4OPD A;  3FG2 P;  2RGH A;  1IUW A;  2VZ2 A;  3BNU A;  3D8X A;  3IF9 A;  3EAO A;  2GMJ A;  3QFB A;  2CVJ A;  3QSM A;  2YLZ A;  5EB4 A;  2R9Z A;  3Q6J A;  2BK5 A;  2C4C A;  2E1M A;  1MXT A;  2B9Y A;  3GYI A;  4K7Z A;  3SFD A;  4YXD A;  3CGB A;  3AE6 A;  4U2L A;  1ZOV A;  4YTM A;  3CPH G;  1JNR A;  2BA9 A;  2XLS A;  2TPR A;  4AOS A;  1ZMD A;  2C7G A;  2TMD A;  4H2P A;  2GR2 A;  4YWO A;  1F8S A;  1Q9I A;  3NYF A;  4YSY A;  5BRT A;  5KMS A;  3P9U A;  2WPE A;  2WDR A;  3CMM A;  4XXG A;  1YQ4 A;  2YVJ A;  1ZDL A;  4DSH A;  3H4K A;  2XFP A;  2BCG G;  4CCR A;  3P1W A;  3VR8 A;  4X9M A;  4H2R A;  2YLX A;  5KVH A;  1QJD A;  3G5S A;  1GAL A;  3K7M X;  5EOW A;  2J3N A;  3ISH A;  3GMC A;  3ZDN A;  3SQP A;  3AD9 B;  1ZKQ A;  4O5U A;  4OPC A;  4C3X A;  3VRB A;  2C70 A;  3NT6 A;  1FCD A;  4U8L A;  2IVE A;  3AE5 A;  3T2Z A;  3IWA A;  5IPY A;  4NZH A;  3UP5 A;  1N4W A;  4REK A;  1OJA A;  2GQF A;  2Y6R A;  2XVJ A;  1LQT A;  4G9K A;  1F3P A;  1KN0 A;  1BGJ A;  1F8R A;  3LAD A;  1H7X A;  3F8D A;  3URH A;  2WOV A;  2B9W A;  4Z43 A;  1K0J A;  1NG3 A;  4H4Z A;  3P4R A;  4TM4 A;  1L9E A;  1K4Q A;  2C3C A;  3AXB A;  3IHG A;  1LVL A;  1LV0 A;  2C64 A;  3GDN A;  3H8I A;  4GDP A;  4CNK A;  5EBK A;  4CY6 A;  2YLS A;  4XWR A;  2WP9 A;  3ATR A;  1DOD A;  2VVM A;  1E1N A;  4K8D A;  4BV6 A;  3PVC A;  2YLR A;  5J60 A;  2GAH B;  4EQW A;  3NYC A;  2E4G A;  5IQ1 A;  2XDO A;  2X50 A;  1NHP A;  1DXL A;  1NDA A;  1E6E A;  1Y0P A;  2WET A;  2BC0 A;  4H4P A;  2XVH A;  2OA1 A;  3DK9 A;  1CHU A;  1MOK A;  2GB0 A;  3C96 A;  3NN0 X;  2JB1 A;  3UCL A;  1NHR A;  2YG3 A;  2YR6 A;  3C4N A;  3AEC A;  3GSI A;  1CJC A;  3UOZ A;  2VVL A;  4KX6 A;  1D7L A;  3EPT A;  3LZX A;  3HYV A;  3NYE A;  1JU2 A;  3NRN A;  3I6D A;  4J36 A;  4G6H A;  3O0H A;  2YLT A;  3NTD A;  4J56 A;  1NG4 A;  5J7X A;  2YQU A;  2R46 A;  4K5R A;  1CF3 A;  1PJ6 A;  4HA6 A;  1IUS A;  1PJ7 A;  2QA1 A;  2YVG A;  1JNZ A;  4TLZ A;  4C77 A;  1B8S A;  3SXI A;  2YG6 A;  2GR1 A;  3AED A;  3GD4 A;  2OAM A;  4K2X A;  3CN8 A;  1XPQ A;  3ADA B;  3ITJ A;  4IV9 A;  1RSG A;  2VQ7 A;  3EAN A;  4B64 A;  1GRT A;  1E1L A;  2H89 A;  1D5T A;  4UDQ A;  2V3A A;  3KLJ A;  1PXC A;  3UKH A;  3CGC A;  2JBV A;  5KWF A;  2EQ7 A;  4DSG A;  4O5Q A;  1ZOY A;  5JCL A;  2YG5 A;  3BI5 A;  3LJP A;  3CPI G;  2DKI A;  5C2T A;  3VR9 A;  3DK4 A;  1N1P A;  5FS7 A;  3GWF A;  4K22 A;  3BHF A;  2EQ8 A;  1TDN A;  2FJA A;  1IUU A;  1Q1R A;  1RP0 A;  4Y4L A;  3AEG A;  2GQW A;  3HYX A;  1S2Q A;  1GRF A;  1VQW A;  4TM0 A;  1O5W A;  3NLC A;  1IJH A;  1ZP0 A;  4CY8 A;  3L8K A;  1YY5 A;  4JDR A;  2HQM A;  5HY5 A;  4BJY A;  2RAB A;  2FJE A;  3NTA A;  2IVD A;  2WP5 A;  1CL0 A;  1LQU A;  4OPL A;  4D04 A;  1CJ2 A;  1E39 A;  1OJC A;  3T2K A;  2BCP A;  2V61 A;  3UKL A;  2NVK X;  3FPZ A;  2CFY A;  2Q0K A;  3KKJ A;  4IVM B;  1GSN A;  2BYB A;  4OVI A;  4GF7 A;  3NIX A;  3F8P A;  2WOI A;  1IUV A;  1VDC A;  4B66 A;  2X8H A;  2JB2 A;  1L0V A;  4H4T A;  4UDP A;  2X8G A;  2C73 A;  2IID A;  4A6N A;  3DJE A;  4YKG A;  1PXA A;  5JCM A;  4EMI A;  2GH5 A;  2GMH A;  5KMQ A;  1KSU A;  3VRD B;  3E1T A;  4BK2 A;  4BK1 A;  1TDE A;  2R4J A;  3AEA A;  1PHH A;  2PYX A;  3DJD A;  2X3N A;  3T37 A;  5JRB A;  2WDQ A;  1KSS A;  2V60 A;  5L46 A;  4OPG A;  1H2I A;  1GTH A;  1VG9 A;  1BKW A;  3GDP A;  3M13 A;  4KPR A;  3ICS A;  5BUK A;  4A7A A;  2JB3 A;  3UKQ A;  2Z5Y A;  3OC4 A;  1UKV G;  2PHH A;  4D03 A;  3L1R A;  3GYJ A;  4G73 A;  4EMJ A;  1TDF A;  3GYX A;  4U8P A;  3NG7 X;  3T14 A;  2XVF A;  3QSS A;  1KFY A;  1JRZ A;  2YR4 A;  3M12 A;  3SZW A;  3AE3 A;  1EL5 A;  4ZCD A;  1GET A;  1FL2 A;  5ER0 A;  4H4S A;  4FDC B;  2C67 A;  3LXD A;  4NTE A;  3GD3 A;  2RGO A;  4B69 A;  3AEB A;  4AP3 A;  2F5Z A;  4H4R A;  1DJQ A;  1OJD A;  5DBJ A;  4GAV A;  4OPU A;  1PS9 A;  2W0H A;  2Y6Q A;  3DME A;  1GRE A;  3NK1 X;  4DNA A;  2GVC A;  1OJ9 A;  2DKH A;  3AB1 A;  4IA5 A;  3BI2 A;  3NNE A;  5IQ4 A;  2WPF A;  5KMP A;  4II2 A;  3LZW A;  5KOX A;  3NKS A;  3DK8 A;  1B37 A;  1GES A;  1ZK7 A;  3AEE A;  2XLR A;  1GEU A;  3ATQ A;  2WEU A;  5LV9 A;  3JSK A;  3P4Q A;  4NWZ A;  3CNS A;  2ZZC A;  4Z25 A;  2WU2 A;  1CC6 A;  2C66 A;  4IA6 A;  1TDK A;  1CBO A;  1CC2 A;  2CUL A;  3NK0 X;  2C3D A;  1QO8 A;  4PAA A;  1GND A;  1FOH A;  2I0Z A;  1ZMC A;  5FS8 A;  3UKF A;  4CBQ A;  3B3R A;  1PBD A;  3CPJ G;  2C76 A;  2OLN A;  2Q6U A;  2XFQ A;  4UP3 A;  4X4J A;  2WP6 A;  4MJW A;  3RP6 A;  4H50 A;  4A79 A;  3CNJ A;  3ALJ A;  4GR1 A;  1B5Q A;  4Z24 A;  4H4W A;  2GV8 A;  1ONF A;  2B9X A;  3UOV A;  3DGZ A;  1ELI A;  4H4Q A;  4U8O A;  4Y4M A;  3Q9T A;  3FBS A;  1NHS A;  3I3L A;  3T31 A;  1DOE A;  2R0P A;  4LII A;  2APG A;  3AYJ A;  1EL9 A;  1S3B A;  3AE9 A;  5CKU A;  4GUV A;  3AE2 A;  1FEB A;  3SGL A;  2UZZ A;  3CND A;  1K0I A;  4NTD A;  1AOG A;  3SZC A;  1NHQ A;  1CJ3 A;  3RNM A;  2XFU A;  3CTY A;  3SM8 A;  1F8W A;  4NTC A;  3SYI A;  2BS3 A;  4H4Y A;  2FJB A;  3CNT A;  2R0G A;  2VQB A;  5BUL A;  1GER A;  4EMW A;  2GRT A;  1H7W A;  2VVL G;  3AD7 B;  2YM2 A;  3V76 A;  4A9W A;  4BJZ A;  4LU6 A;  3SX6 A;  4IVO B;  1Y56 B;  4P9S A;  4OPT A;  4TLX A;  1P2E A;  4DGK A;  1XDI A;  2ZZB A;  1OJT A;  1E1K A;  2FBW A;  3SY4 A;  2BAB A;  5BVA A;  2Z5X A;  2JK6 A;  2QCU A;  1NAA A;  2ZBW A;  3L5O A;  2EQ9 A;  2R4E A;  3AE7 A;  3UKK A;  4AP1 A;  1D4E A;  1E1M A;  3V3N A;  3T0K A;  4NNJ A;  2V6O A;  1CC4 A;  4A65 A;  4M52 A;  3DJG X;  2GAG B;  4TM3 A;  3AD8 B;  2WBA A;  2ZZ0 A;  3QFA A;  3BHK A;  1L9D A;  4U8I A;  5FS6 A;  2Q7V A;  2WQY A;  3SZF A;  4B67 A;  1NEN A;  2XLP A;  1KNR A;  3HZL A;  1QLB A;  1DOC A;  2H88 A;  4ZCC A;  2BS4 A;  4XWZ A;  1PBF A;  3QVP A;  2X99 A;  2QA2 A;  1V59 A;  1SEZ A;  4Z2T A;  3ICT A;  1JRX A;  1S7M A;  2R45 A;  3V3O A;  3T2Y A;  3ALL A;  1X31 B;  4II3 A;  4G74 A;  4H4X A;  1B4V A;  4EQX A;  3K7Q X;  3NH3 X;  3NGC X;  1P2H A;  3IC9 A;  1EBD A;  1GT8 A;  3BI4 A;  4U8N A;  2C72 A;  4NEW A;  3C4A A;  2E5V A;  1BWC A;  3SFE A;  2ARD A;  1CJ4 A;  1M64 A;  2AR8 A;  1GPE A;  2BS2 A;  3AWI A;  4A5L A;  4A99 A;  3NK2 X;  4GDE A;  3DGH A;  3EF6 A;  4RG4 A;  4ICY A;  4J57 A;  5EB5 A;  4ECH A;  1IUT A;  1XHC A;  3GRS A;  1VRQ B;  4I58 A;  2WU5 A;  1JRY A;  5TR3 A;  3QVR A;  4CCQ A;  2AQJ A;  3D1C A;  3AYL A;  3BNM A;  1EL7 A;  3GWD A;  3UOX A;  3R9U A;  5C3J A;  4H2N A;  3VQR A;  4OCG A;  1RYI A;  1KF6 A;  1E7P A;  2WS3 A;  4UDR A;  1D4C A;  3UTG A;  3VRA A;  1PBE A;  4C74 A;  5KMR A;  2A8X A;  3D9X A;  3UOY A;  3IHM A;  3WE0 A;  1FEA A;  4NEV A;  3QJ4 A;  4H7U A;  2BC1 A;  3PG6 A;  2BK3 A;  2XLT A;  4I59 A;  2GF3 A;  4B1B A;  1PBC A;  3P4S A;  4EIQ A;  4EM4 A;  4YSZ A;  1ZY8 A;  4B65 A;  3AE8 A;  3AEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...