1M6IA

Crystal structure of apoptosis inducing factor (aif)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
481
structure length
459
Chain Sequence
APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA binding is required for the apoptogenic action of apoptosis inducing factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Programmed cell death protein 8
total genus 144
structure length 459
sequence length 481
ec nomenclature
pdb deposition date 2002-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1m6iA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1m6iA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1m6iA01
3OC4A 4EMIA 3NNEA 4EM3A 2B9YA 1Y0PA 3VRBA 4A79A 3CIRA 4M52A 4NZHA 5EBKA 1KFYA 2FJEA 2XLUA 2YLWA 3DH9A 4I59A 4RG4A 4YTMA 5BVAA 4Y4MA 1ZY8A 3QFBA 1PXAA 1L9DA 4I58A 3NG7X 3GD3A 1Q1WA 2GMJA 2GVCA 3HZLA 4H4UA 1ZOVA 2C3CA 3DGZA 2XCGA 3WE0A 2B76A 5CQFA 4FX9A 1PBEA 3I3LA 3LB8A 3P1WA 2BXSA 4U8KA 4GDPA 2PYXA 4YSYA 5KWFA 2A8XA 1FOHA 1CJCA 1GT8A 2ZBWA 1IUTA 1VG9A 1DOCA 1K0IA 4JY3A 4O5QA 2BC0A 3RNMA 1O95A 2VVLG 1GRFA 3G5SA 3QVPA 1ZMDA 3DMEA 2CULA 2EQ8A 1F6MA 1VDCA 2R0GA 4UP3A 2UZZA 3AECA 4Z2TA 1REOA 1VG0A 1PBFA 3UTFA 1LVLA 1L9CA 5KXJA 2BS2A 4YSHA 3VRDB 1JRXA 2OA1A 5IPYA 1ZKQA 2BK4A 3IC9A 3Q6JA 4AP3A 3K30A 2QAEA 3AD8B 2YLZA 3CGCA 3B6DA 1CHUA 4OPCA 4LIIA 2Q6UA 3GDNA 2E4GA 4CY6A 3UKAA 1ZOYA 1NENA 3CNJA 1IUVA 3LZXA 4OPDA 2EQ7A 1PDHA 2BCPA 2XLPA 3GMCA 2GQWA 2VVMA 3G5QA 3GMBA 1ELIA 3L1RA 3EF6A 1GNDA 2GAGB 2WU2A 3K7TA 1DOEA 2C65A 3NTAA 4WX1A 3KD9A 2X8GA 4AP1A 3QSEA 3IF9A 4NTDA 3AD7B 2HQMA 2VRMA 4ZCCA 2IIDA 3CPJG 4EQSA 5GRTA 5C2TA 1PS9A 4JQ9A 2AAQA 2GEWA 4YKGA 2XLTA 4K8DA 2DKIA 3M13A 1TDFA 4J36A 3IWAA 3DJJA 4CNJA 4KPRA 1GEUA 1PXBA 3AE8A 2JAEA 2Z5XA 3DA1A 1KNRA 4BV6A 2AQJA 3NIXA 4WCTA 2VOUA 2R4EA 1PHHA 3NLCA 2GAHB 2GMHA 4YSXA 2FJAA 5KVHA 1N1PA 2YVFA 2RGOA 1EL9A 1E1LA 1E39A 4U8LA 1IUXA 1S3EA 3Q9TA 2FBWA 4K2XA 1TDOA 1VRQB 2JB1A 2WP9A 1YQ3A 5KRQA 4DNAA 3AWIA 3LOVA 1YQ4A 2YM1A 3AE4A 3BNMA 2JKCA 1EL5A 5U63A 2CDUA 2ZZBA 4H4SA 4U2TA 1DJNA 1D7YA 2GB0A 1OJCA 2V3BA 2BS3A 1GOSA 2FJBA 3ALJA 3H4KA 4GRTA 5JCMA 3UTHA 2ZZ0A 4H4TA 2IVDA 3NK1X 2C66A 2X8CA 3C4AA 3E1TA 2XVHA 1B8SA 5JCKA 2YLRA 2B9XA 2YR4A 3AXBA 4A6NB 3NYCA 1MOKA 5DBJA 1JRZA 4EQWA 2C72A 1PBDA 2ACZA 1MO9A 2WETA 1GRAA 3V3NA 3CPIG 3V3OA 3H8IA 1DNCA 3PVCA 2BC1A 4PABA 1COYA 4YKFA 4EIQA 1FEAA 1W4XA 3KPFA 3DK4A 4JDRA 4H4VA 2QA1A 3QVRA 4UDPA 2V60A 4BK2A 1KDGA 4J2WA 3ISHA 3REDA 1GRGA 3F8PA 4IA6A 4USRA 1GXFA 1GALA 4A6NA 2WOIA 2JB3A 4D03A 4H2PA 4C74A 2C70A 1LJ1A 3GWDA 3KKJA 2YQUA 2YG7A 2XFQA 4A99A 1X31B 1M64A 2GV8A 4J34A 4GDEA 2BK5A 4Z2RA 5HYMA 2WPCA 3II4A 4X9NA 3GRSA 3KLJA 2APGA 2RGJA 4JNQA 4XXGA 4A9WA 3S5WA 3O0HA 3JSKA 2YG6A 3FG2P 4OCGA 2C67A 3IHGA 2XVIA 1CC6A 2B7SA 4AOSA 1TYPA 5FS9A 4YTNA 3DGHA 1H81A 2OALA 1CC2A 4IVOB 3UKLA 4EQXA 2GR3A 1PJ6A 5L46A 1P2EA 1IJHA 4U2LA 3EANA 2EQ6A 4JY2A 3ZYXA 2YG4A 3BHFA 4A5LA 2GRTA 4A65A 3AYIA 3AB1A 1Q9IA 4H7UA 2R0PA 2C3DA 3SM8A 1GTEA 1RYIA 4HB9A 2GR1A 2BACA 2WOWA 1Y56B 3CNDA 1H82A 3CNPA 4B63A 1ZK7A 3QJ4A 1F8SA 3AYJA 1NHRA 2BABA 2XVEA 1D4EA 3P4RA 2V3AA 4EMJA 4K5RA 1BWCA 2JK6A 1K4QA 1EBDA 1F3PA 1CJ2A 1S3BA 1GRTA 2YAUA 1CL0A 2BA9A 2BK3A 3KU9A 4GCMA 2WPFA 5FS6A 2H89A 3ATQA 4H4RA 1UKVG 4FK1C 1N4VA 3BI5A 3LJPA 3P4PA 1OJTA 1QLBA 1DXLA 1D7LA 1IUWA 5J60A 1PXCA 1E1KA 1DOBA 2TMDA 5IQ1A 2A89A 3DJGX 3P9UA 4U8IA 4YXDA 2WS3A 1V59A 4E0VA 5BRTA 2X8HA 3GYJA 5GSNA 1RSGA 3AEBA 1VQWA 4OPTA 3C96A 5EB5A 4LA1A 1OJDA 4BK1A 1NHPA 1KSSA 1EL8A 2GF3A 4K22A 4CBQA 2XFOA 3M0OA 3AEGA 2CVJA 2GQFA 2Y6QA 4U8JA 5KOWA 3GWFA 3NH3X 4DSGA 3DK8A 1B4VA 2ARDA 1XPQA 1PJ7A 2YLXA 3D1CA 4TM0A 3UOXA 4C77A 2Y6RA 3AEDA 2YWLA 2YLSA 4B67A 4Z43A 4J57A 1N4WA 3AE5A 4BJZA 4TLXA 5KVIA 3BI2A 2H88A 2YLTA 1ZMCA 3LZWA 4CRTA 1FCDA 1HYUA 2O9ZA 4Y4LA 5JCLA 3K7MX 4CCQA 1CF3A 1NHQA 3DJEA 3UKPA 2VZ2A 1O5WA 3NTDA 1DODA 4JNAA 4AOXA 1YKJA 2VRLA 4GF7A 4B65A 3QSMA 2EQ9A 5BUKA 4U8NA 2AR8A 2IVEA 3UTEA 4J56A 4YTPA 5TR3A 2XVFA 2NPXA 1KF6A 3S61A 2C76A 3V76A 4CNKA 4O5UA 3SGLA 1XDIA 2WDQA 2XFPA 3FBSA 3P4SA 2F5ZA 4MJWA 4UDQA 5HXIA 1YQZA 1Z6LA 1Y56A 2QA2A 4XWRA 3DJDA 2WP5A 2PHHA 3CPHG 1JNRA 3QFAA 4RG3A 4Y4NA 4BK3A 5KOXA 4H4QA 2WDRA 4RSLA 4TM4A 3ICTA 4U8MA 3G5RA 4BURA 3GD4A 2C7GA 4K7ZA 1LQUA 3RP7A 5J7XA 3UOYA 3OZ2A 1S2QA 1LTXR 1KSUA 4NEVA 3FMWA 1JOAA 1CJ4A 1JNZA 1GTHA 2VQ7A 2WHDA 4FDCB 3IHMA 2WP6A 3UKHA 4DSHA 1O94A 4C3YA 5BULA 2V6OA 4NTEA 4N9XA 5CKUA 3NK0X 1E1NA 3UKQA 1FECA 1B37A 5C3JA 1K0JA 1TDEA 3UP4A 2XFNA 4P9SA 3NHOX 1BZLA 4CCRA 1ZX9A 3ZDNA 4ICYA 1NDAA 2R9ZA 5JCNA 1QJDA 1SEZA 1RP0A 3AE3A 3NYEA 2FJDA 2I0ZA 2NVKX 5FS8A 5U1OA 3AE7A 3T37A 1CJ3A 4TM3A 4H4YA 1GRHA 4JN9A 1ZDLA 4EM4A 1PBCA 3QSSA 2Q0LA 2XLRA 2XFUA 2YG5A 4ADWA 1NG4A 1NG3A 2BS4A 3LXDA 2DKHA 5HHFA 1H6VA 3UTGA 3VR8A 3CTYA 4B66A 4EIPA 3EAOA 2RGHA 4B64A 4KX6A 4GR1A 1JU2A 3VRAA 1NAAA 4X4JA 2J3NA 2X99A 1IUSA 2OAMA 2BXRA 4IV9A 4AT0A 3AEEA 2RABA 4H2NA 1GREA 3CN8A 1JRYA 3AEAA 5FMHA 3BNUA 4Z24A 3VQRA 1D4DA 3GYIA 4OPGA 3ABVA 3NT6A 2GR0A 1IUUA 2ZZCA 2E5VA 4ZN0A 4FK1A 1D4CA 4BJYA 4REKA 2JBVA 2XYOA 3F8DA 2OLNA 2Z5YA 4H4PA 4EQRA 4Z44A 3CNTA 3NRNA 2WESA 4LU6A 2XDOA 4ZCDA 3AE6A 1TRBA 4NEWA 1FL2A 2BCGG 2WDVA 1P2HA 4K5SA 4NTCA 2C64A 2CFYA 4Z26A 4OVIA 3BHKA 1YY5A 3AE1A 4H2QA 4H4ZA 2YVJA 2B9WA 2E1MA 1GERA 3GRTA 1H7XA 5EB4A 3CGDA 3ICSA 3CNSA 1EL7A 2WQYA 3UOVA 4DGKA 2OLOA 2YG3A 4APNA 1CBOA 2C75A 5HY5A 1L9EA 1N4UA 1XHCA 1MXTA 1CC4A 3NK2X 1TYTA 4TLZA 1TDNA 3EPTA 3ITJA 3NN0X 4H2RA 3URHA 4Z2UA 5LV9A 2YVGA 3NYFA 1TDKA 3C4NA 4GUVA 2V5ZA 1K0LA 3NGCX 1XANA 4H4XA 3AD9B 5ER0A 5M0ZA 4J33A 4AT2A 1LQTA 3RP6A 2TPRA 3RHAA 1E7PA 4HA6A 1PBBA 2WOVA 3L8KA 4OPIA 3AYLA 2B7RA 3GDPA 3RP8A 3KVEA 3SFDA 4C5OA 4PAAA 3CGEA 4UDRA 3P4QA 4U8PA 2R46A 2JB2A 3SQPA 2R4JA 4OPLA 2BYBA 2V61A 3PO7A 2X3NA 4IVMB 3AE9A 5FS7A 2YM2A 3AEFA 4B69A 2GR2A 4J31A 4EMWA 1H86A 3CGBA 4B68A 3I6DA 1KNPA 3NN6X 1DJQA 1NPXA 4B1BA 5M10A 1E1MA 2YR6A 2WPEA 2GH5A 1ZP0A 3ALMA 3K7QX 2A87A 3F8RA 3M12A 3UKFA 1FEBA 3B3RA 1B5QA 3R9UA 1F8WA 4OPUA 3UOZA 2R45A 3ALLA 1GPEA 1H7WA 1AOGA 1BF3A 2VQBA 3UCLA 1NEKA 4IA5A 2C73A 3FPZA 1GSNA 5U25A 3NKSA 1LV0A 4D04A 1L0VA 1GESA 2YR5A 1PN0A 3SFEA 4H4WA 1NHSA 2VVLA 3H8LA 1BGJA 2Q0KA 4CY8A 3ICRA 1GRBA 3ATRA 3VR9A 4XWZA 2W0HA 3BI4A 1D5TA 2QCUA 1S2YA 1M6IA 4USQA 3UP5A 2WBAA 3LADA 1Q1RA 3AE2A 1JEHA 5JCIA 3FIMB 2WEUA 5IQ4A 4C3XA 1BKWA 3DK9A 2XVJA 1GETA 1PJ5A 2WU5A 3PS9A 2R0CA 1ONFA 3GSIA 1OJAA 2XLSA 1GV4A 1H83A 1H84A 4ECHA 2X50A 4U8OA 4A7AA 4U2SA 4H50A 1LPFA 3KA7A 4TM1A 3UKKA 3ADAB 1BGNA 4YSZA 1F8RA 4Z25A 1E6EA 5EOWA 4YT0A 1OJ9A 1QO8A 3D8XA 4X9MA 3COXA 4YWOA 2Q7VA
chains in the Genus database with same CATH superfamily
3OC4A 4EMIA 3NNEA 2XGZA 1Y0PA 4A79A 4M52A 5EBKA 4H83A 3T8QA 2P3ZA 1L9DA 3GD3A 1N63C 3ES7A 3HZLA 1ZOVA 2C3CA 2XCGA 5CQFA 4FX9A 3I3LA 4YSYA 2FYMA 3GC2A 1DOCA 4O5QA 2HXTA 3RNMA 1GRFA 1ZMDA 2CULA 4Z2TA 3UCDA 1LVLA 3PWIA 2BS2A 5IPYA 3SN1A 4HNCA 3GDNA 2E4GA 1ZOYA 4OPDA 2EQ7A 2XLPA 2BCPA 3SY4A 3DFHA 2GQWA 2VVMA 3GMBA 2MNRA 1ELIA 2GAGB 3I4KA 1DOEA 2X8GA 4AP1A 4II2A 2IIDA 4HN8A 5GRTA 5C2TA 4YKGA 2AAQA 3UJSA 2XLTA 2AKMA 4CNJA 4WCTA 1KNRA 3NIXA 4IHCA 3NLCA 2GMHA 2FJAA 3ZVIA 3H12A 1N1PA 1IUXA 4A6GA 4K2XA 1VRQB 1YQ3A 2W55A 3AWIA 3AE4A 4U2TA 2GB0A 1OJCA 3ALJA 4GMEA 2XVHA 3SSZA 4EQWA 2C72A 1PBDA 2MUCA 3SZCA 2WETA 1RM6B 4DN1A 1FEAA 3DK4A 4G6GA 4H4VA 4TVWA 3QVRA 2V60A 4BK2A 2BRYA 1KDGA 4J2WA 3REDA 1GRGA 1JDFA 2DW7A 1GALA 4A6NA 2WOIA 4D03A 4H2PA 3OZMA 4C74A 2GV8A 4X9NA 3GRSA 3O0HA 3JSKA 1KN0A 2PMQA 4OCGA 2C67A 3IHGA 1TYPA 3I6TA 1EBHA 3DGHA 3UKLA 1P2EA 4EWJA 2YG4A 3AYIA 3UJRA 3AB1A 2R0PA 1KCZA 2WOWA 1Y56B 3QJ4A 2W3RA 1FFUC 3T9PA 3AYJA 3BOXA 1D4EA 2OZTA 2BK3A 4GCMA 1JPMA 5FS6A 1UKVG 4FK1C 3P4PA 1QLBA 1IUWA 1ONEA 5IQ1A 4U8IA 4YXDA 3UJ2A 3SZFA 4E0VA 3CAWA 4G6HA 3C96A 1EL8A 3AEGA 2GQFA 5KMPA 3GWFA 4DSGA 3A7AA 3OP2A 4TLXA 1P43A 1HYUA 3N4EA 3VCNA 3K7MX 3TTEA 3DJEA 3UKPA 1O5WA 4AOXA 1YKJA 3QSMA 5BUKA 4U8NA 4J56A 5TR3A 1KF6A 2C76A 4M6UA 2XFPA 1XS2A 3R0UA 1YQZA 1Z6LA 1Y56A 2FKPA 4RSLA 3ICTA 3G5RA 5J7XA 3UOYA 3QKEA 1KSUA 2VQ7A 4FDCB 3QN3A 3PK7A 5C3JA 1TDEA 4G7FA 3TJ4A 4P9SA 3NVZB 2R9ZA 1QJDA 1RP0A 5U1OA 4TM3A 4JN9A 1PBCA 3QSSA 2Q0LA 2XLRA 5KMSA 4ADWA 1NG4A 1NG3A 4B64A 2P88A 1WUFA 4H2NA 4OPGA 3ABVA 3NT6A 2GR0A 2E5VA 3KUMA 4FK1A 4E4UA 3NS1B 2Z5YA 2WESA 3T0KA 3AE6A 1TRBA 4Z26A 4DWDA 3ZLGA 4E6MA 2YVJA 2B9WA 2OG9A 4FI4A 3UOVA 4DGKA 4APNA 1CBOA 3NK2X 1TYTA 4TLZA 1FFVC 3NN0X 4H2RA 3FYYA 3URHA 5IDZA 2YVGA 3CYJA 4E5TA 3NYFA 2V5ZA 3N6HA 4J3ZA 4NNJA 1LQTA 1OEPA 3RP6A 3ETRB 4HA6A 1PBBA 1TKKA 3AYLA 2B7RA 4PAAA 3P4QA 1MDLA 3PO7A 3AE9A 5FS7A 2YM2A 4EMWA 4B68A 3I6DA 1KNPA 2PP3A 3VDGA 4B1BA 1E1MA 2PP0A 2GH5A 3ALMA 3SXIA 3R9UA 4OPUA 2R45A 1GPEA 1H7WA 1BF3A 4IA5A 3FPZA 1GSNA 2YR5A 1NHSA 4YWSA 2VVLA 4CY8A 3ICRA 1GRBA 3VCCA 3VR9A 4XWZA 3EUB3 1S2YA 5IQ4A 3DK9A 1PJ5A 2P8BA 2WU5A 3PS9A 4A3RA 1ONFA 4ECHA 1TE6A 4H50A 1LPFA 4TM1A 3T2KA 1F8RA 4YT0A 1OJ9A 4II3A 4DX3A 4F4RA 3FJ4A 3T2ZA 3VRBA 3CIRA 2YLWA 4Y4MA 1PXAA 4I58A 3NG7X 4GGHA 2GVCA 2B76A 1PBEA 3P1WA 2BXSA 2A8XA 3CMMA 3VA8A 1K0IA 1O95A 3S47A 3MQTA 1VDCA 2R0GA 3AECA 1VG0A 1L9CA 2PCEA 4HYRA 1ZKQA 3MWCA 2BK4A 4AP3A 3K30A 3AD8B 2PU1A 2GL5A 3UKAA 1NENA 3CNJA 3LZXA 2QJNA 3G5QA 3L1RA 4WX1A 4TVYA 3NTAA 3P0WA 3QSEA 3IF9A 4NTDA 3AD7B 2VRMA 3CPJG 5FJTA 2GEWA 1TDFA 3IWAA 4KPRA 1GEUA 1NELA 2PGWA 2C4CA 2JAEA 3DA1A 2BRAA 2PSNA 2RGOA 1KKRA 2XH2A 4U8LA 1S3EA 2JB1A 3Q4DA 3IJQA 3LOVA 1YQ4A 1STZA 1EC7A 3GD6A 4GFIA 4G8TA 2YLRA 3AXBA 1JRZA 2AKZA 3A7UA 2ACZA 1MO9A 3V3NA 1TZZA 2OKTA 1DNCA 3PVCA 4PABA 2PTZA 3D47A 3RR1A 3SZWA 3SZ0A 4USRA 2PTXA 2JB3A 1VDVA 2GGHA 3MZNA 3BSMA 2APGA 4A9WA 2B7SA 3T31A 5FS9A 4YTNA 4EQXA 1ZXIC 1MNSA 1N5WC 4A5LA 1L8PA 2C3DA 3SM8A 4ZCWA 1RYIA 4HB9A 3TQPA 2POZA 4B63A 1ZK7A 2QGYA 3QPEA 2BABA 3P4RA 4HNLA 1BWCA 1K4QA 2JK6A 7ENLA 1GRTA 2YAUA 3KU9A 3ZLFA 4Z17A 3ATQA 3BI5A 3Q45A 5J60A 4K2SA 1DTNA 1VQWA 4IZGA 1OJDA 5KMQA 2GF3A 1R6WA 5ENLA 2XFOA 5KOWA 3NH3X 2ARDA 2Y6RA 2ZADA 4Z43A 3BI2A 2H88A 1ZMCA 3SYIA 1V97A 3B9JB 4Y4LA 5JCLA 4CCQA 1NHQA 3THUA 4JNAA 3NTDA 1EBGA 2EQ9A 3VC6A 3RRAA 4YTPA 2XVFA 2NPXA 3V76A 2WDQA 1P48A 3NO1A 2XH0A 2QA2A 4ZOHB 4Y4NA 1FIQB 3HYVA 3QFAA 4RG3A 5J04A 2WDRA 2C7GA 4K7ZA 3GO2A 3OZ2A 3DEQA 2XH4A 1JOAA 1JNZA 3R10A 3H70A 2WHDA 3IHMA 1O94A 2V6OA 3UCCA 3T2YA 3NK0X 1B37A 3NHOX 1ZX9A 4ICYA 5JCNA 2HNEA 1EC8A 3T37A 2NVKX 5FS8A 3AE7A 2PU0A 1CJ3A 2XFUA 2OZ8A 3PWGA 2P8CA 3LXDA 1H6VA 3VR8A 3CTYA 4X2PA 4EIPA 1BQGA 4KX6A 4GR1A 1XPYA 1JU2A 4X4JA 1IUSA 2BXRA 4AT0A 2RABA 3AN1A 3IJLA 1JRYA 3HPFA 5FMHA 3GYIA 2I5QA 2ZZCA 2QDDA 4ZN0A 1SJAA 3RCYA 2OLNA 4H4PA 3CNTA 3NRNA 2XDOA 2BCGG 2WDVA 4NTCA 4K5SA 3N4FA 1GERA 3GRTA 1H7XA 3CGDA 3CNSA 1EL7A 3PG6A 2OLOA 2YG3A 2PODA 3UXLA 5HY5A 2GDQA 1XHCA 1MXTA 1F9CA 4HPNA 3ITJA 5LV9A 3D46A 5M0ZA 4H4XA 5ER0A 3PFRA 4J33A 3L8KA 3TOYA 3SFDA 4U8PA 2BYBA 4IVMB 2GR2A 4J31A 1H86A 4GYPC 4HCHA 2GSHA 1MUCA 3CXOA 4IP5A 5M10A 2WPEA 2NQLA 3M12A 3F8RA 3V3WA 1B5QA 3JW7A 2QQ6A 3ALLA 3V4BA 4IL0A 3NKSA 4D04A 1PN0A 1W6TA 4H4WA 2AL2B 3ATRA 1M6IA 4USQA 4ZA0A 3RGTA 1BKWA 1GETA 3HW2A 2R0CA 3GSIA 1OJAA 3DERA 4A7AA 3AMZA 3ADAB 1BGNA 1E6EA 5EOWA 3UJEA 1QO8A 3D8XA 4YWOA 2PTYA 2P0IA 4JHMA 1KFYA 2FJEA 2XLUA 4RG4A 3DH9A 1ZY8A 3ZVHB 2GMJA 4H4UA 3DGZA 5KWFA 5FJRA 4GDPA 1GT8A 1CJCA 1IUTA 3FVDA 4JY3A 2BC0A 2VVLG 3QVPA 4UP3A 1REOA 1PBFA 4A35A 3MKCA 2PGEA 4YSHA 3IC9A 3Q6JA 2QAEA 2YLZA 3CGCA 4LIIA 2Q6UA 4CY6A 3HYWA 2E5AA 3EF6A 1GNDA 3K7TA 3DG3A 3KD9A 2HQMA 1YEYA 4ZCCA 3STPA 4JQ9A 1PS9A 4K8DA 3GYXA 4J36A 3AE8A 4IL2A 2OQYA 2AQJA 2VOUA 2GAHB 5KVHA 3R25A 3TCSA 1E1LA 1E39A 3Q9TA 2FBWA 2WP9A 4GGBA 4DNAA 2YM1A 3UJFA 3BNMA 2JKCA 1EL5A 2ZZBA 3DFYA 3UGVA 1GOSA 2FJBA 3H4KA 3S5SA 3SN4A 5JCMA 3UTHA 1T3QC 2ZZ0A 4H4TA 3NK1X 3CXBA 3R0KA 1B8SA 2OQHA 5DBJA 1GRAA 3UXKA 3H8IA 4YKFA 4EIQA 4JDRA 2QA1A 2OX4A 3F8PA 4IA6A 3VC5A 2C70A 3KKJA 3GWDA 2YQUA 2YG7A 1X31B 1M64A 2BK5A 3NVVB 3KLJA 2RGJA 4JNQA 3ENLA 2YG6A 3FG2P 2XVIA 1H81A 4DXKA 1CC2A 2OALA 4IVOB 2GR3A 1PJ6A 5L46A 3EANA 3ZYXA 3BHFA 2W3SA 4H7UA 1WUEA 2GR1A 2BACA 3CNDA 2XVEA 1F3PA 2WPFA 4H4RA 1N4VA 1KKOA 1OJTA 1D7LA 1PXCA 3U9IA 3P9UA 2WS3A 1V59A 1BKHA 5BRTA 2X8HA 5GSNA 3R11A 1FO4A 4LA1A 4BK1A 4K22A 4CBQA 3M0OA 1B4VA 1XPQA 3D1CA 4TM0A 2QDEA 1SJDA 3AEDA 4B67A 4J57A 4M0XA 3AE5A 4BJZA 2YLTA 3LZWA 2AL1A 1FCDA 2O9ZA 1CF3A 3MSYA 1NU5A 1FHUA 5KMRA 2AR8A 2IVEA 3S61A 1FHVA 1XDIA 3FBSA 4UDQA 4MJWA 5FJPA 3DJDA 2WP5A 3D9XA 4H4QA 4TM4A 4U8MA 1S2QA 4NEVA 1CJ4A 3UKHA 4HCDA 3V5CA 4C3YA 4NTEA 3FXGA 3QTPA 4N9XA 3UKQA 3NRZB 1K0JA 3UP4A 2OO6A 3ZLHA 4FP1A 3ZDNA 2ONEA 1SEZA 2PP1A 3AE3A 3NYEA 2I0ZA 3DIPA 4H4YA 1GRHA 1ZDLA 3NVYB 2BS4A 2DKHA 3UTGA 4B66A 3TWAA 4ENLA 3VRAA 1NAAA 2X99A 4MKSA 1GREA 2XH7A 3CN8A 3ES8A 4IT1A 1D4CA 4BJYA 2JBVA 4EQRA 4LU6A 4ZCDA 1FL2A 1P2HA 4OVIA 3BHKA 4JN7A 4H4ZA 4MGGA 5EB4A 3K1GA 1PDZA 3L5OA 3ICSA 2C75A 1L9EA 1CC4A 1TDNA 3EPTA 1TDKA 3C4NA 3P93A 3HRDC 3NGCX 1JROA 4AT2A 2WOVA 4OPIA 3GDPA 3CGEA 2R46A 2R4JA 3N6JA 4OPLA 2X3NA 3SQSA 4J1OA 2OPJA 1S7MA 1DJQA 3DDMA 1ZP0A 2A87A 3UKFA 1FEBA 3B3RA 3UOZA 2VQBA 3HYXA 1NEKA 2C73A 5U25A 1LV0A 1GESA 3SFEA 1SB3B 4GYPA 2Q0KA 1N62C 2PS2A 2W0HA 3BI4A 1D5TA 2QCUA 3SN0A 2WBAA 1Q1RA 2GGEA 2RDXA 5KNLA 1JEHA 2AL2A 2XLSA 1GV4A 1H84A 2X50A 4U8OA 4U2SA 3UKKA 3KA7A 3A7RA 4Z25A 4X9MA 2Q7VA 3CT2A 4EM3A 2B9YA 3V5FA 3NXLA 4NZHA 4MMWA 4YTMA 4I59A 4IP4A 5BVAA 4E4FA 3QFBA 1Q1WA 4GISA 3WE0A 5KRQA 3LB8A 4U8KA 2PYXA 1FOHA 2ZBWA 1VG9A 4H2HA 3G5SA 4HCLA 1RVKA 2OLAA 3DMEA 2EQ8A 1F6MA 2UZZA 3UTFA 5KXJA 3VRDB 1JRXA 2OA1A 3B6DA 1CHUA 4OPCA 3U4FA 1IUVA 3EKGA 3MY9A 1PDHA 2OFJA 3GMCA 2WU2A 3DG7A 2C65A 3TJIA 3OPSA 3P3BA 3R07C 1MRAA 4EQSA 2DKIA 3M13A 3T6CA 3DJJA 1PXBA 2Z5XA 4BV6A 2R4EA 1PHHA 4YSXA 2YVFA 1EL9A 4DHGA 1TDOA 3DG6A 1N5XA 2W54A 3RITA 5U63A 2CDUA 4H4SA 1JCTA 3AM9A 1DJNA 1D7YA 2V3BA 2BS3A 2OVLA 4GRTA 2IVDA 2PA6A 2C66A 2X8CA 3C4AA 3E1TA 5JCKA 2B9XA 2YR4A 1H2IA 4A6NB 5BOFA 1MOKA 3OZYA 1MDRA 4K1WA 3NYCA 6ENLA 3CPIG 3SR6B 3V3OA 3NZGA 2QJJA 2BC1A 1COYA 1W4XA 3KPFA 1SJBA 4KWSA 4UDPA 4GAVA 3ISHA 1JPDX 1GXFA 2QJMA 2HZGA 1LJ1A 2XFQA 2OZ3A 4A99A 4G73A 4J34A 4Z2RA 4GDEA 5HYMA 2WPCA 3II4A 4XXGA 3S5WA 1CC6A 4AOSA 1ELSA 1IJHA 4U2LA 2EQ6A 4JY2A 4GIRA 2GRTA 4A65A 3I6EA 1Q9IA 3OTRA 1GTEA 1H82A 3CNPA 1F8SA 3R1ZA 1NHRA 2V3AA 4EMJA 4K5RA 1EBDA 1CJ2A 1S3BA 1CL0A 2BA9A 4NWZA 2H89A 4Z1YA 3LJPA 1DXLA 4DYEA 1E1KA 1DOBA 2TMDA 2A89A 3DJGX 1X2HA 3FCPA 3NFUA 5G5HB 3GYJA 1RSGA 3AEBA 3TW9A 4OPTA 4KT2A 5EB5A 3T14A 1NHPA 2PTWA 1KSSA 2CVJA 3OW1A 2Y6QA 4U8JA 3DK8A 1PJ7A 2YLXA 3UOXA 4C77A 2YWLA 2YLSA 3B97A 4K8GA 1N4WA 3ZVHA 5KVIA 3T4WA 4CRTA 3NVWB 3JVAA 2VZ2A 1DODA 2VRLA 4GF7A 4B65A 3QLDA 2E3TA 4G74A 3SJNA 3UTEA 4CNKA 4O5UA 3SGLA 4JN8A 3P4SA 2F5ZA 5HXIA 4XWRA 2PHHA 3CPHG 1JNRA 1R0MA 4BK3A 5KOXA 3SX6A 5JRBA 4BURA 5FJUA 3GD4A 1LQUA 3RP7A 3DGBA 1LTXR 3FMWA 1GTHA 2WP6A 4DSHA 1PDYA 2GGGA 3GY1A 2XSXA 5BULA 1VQZA 5CKUA 1E1NA 1FECA 2XFNA 3EEZA 2QVHA 1IYXA 1BZLA 1JRPA 4CCRA 1NDAA 2O56A 1N61C 2FJDA 3FV9A 4EM4A 3SBFA 2YG5A 5HHFA 5EU9A 3EAOA 2RGHA 3RO6A 2J3NA 3DESA 2OAMA 4IV9A 3AEEA 3AEAA 3BNUA 2HXUA 4Z24A 3VQRA 1D4DA 1IUUA 2GGJA 4REKA 1E9IA 4E8GA 2XYOA 3F8DA 1KD0A 4Z44A 4NEWA 1ECQA 2C64A 2CFYA 3H7VA 5FJOA 1YY5A 1X2GA 3AE1A 4H2QA 3MUCA 2E1MA 2WQYA 1N4UA 4Z2UA 1N60C 4GUVA 1K0LA 1XANA 3AD9B 2TPRA 2ZC8A 3RHAA 1E7PA 4C5OA 3RP8A 3KVEA 4UDRA 4H1ZA 2JB2A 3SQPA 2V61A 3TWBA 2GGIA 4B69A 3AEFA 4KEMA 3CGBA 3NN6X 3IJIA 1NPXA 2CHRA 2YR6A 4H19A 3K7QX 1F8WA 1WYGA 1AOGA 3IK4A 3UCLA 3CK5A 3KPKA 4G9KA 1L0VA 4KPLA 3H8LA 5BOEA 1BGJA 4GAPA 3CB3A 1EC9A 3H8AA 3UP5A 4ROPA 3LADA 3AE2A 3FIMB 5G5GB 5JCIA 2WEUA 4C3XA 2XVJA 2PPGA 1H83A 3VFCA 3JZUA 2DW6A 4YSZA 1SJCA 3BJSA 3COXA
chains in the Genus database with same CATH topology
3OC4A 4EMIA 3NNEA 3T2ZA 4EM3A 2B9YA 1Y0PA 3VRBA 4A79A 3CIRA 4M52A 4NZHA 5EBKA 1KFYA 2FJEA 2XLUA 2YLWA 3DH9A 4I59A 4RG4A 4YTMA 5BVAA 4Y4MA 1ZY8A 3QFBA 1PXAA 1L9DA 4I58A 3NG7X 3GD3A 1Q1WA 2GMJA 2GVCA 3HZLA 4H4UA 1ZOVA 2C3CA 3DGZA 2XCGA 3WE0A 2B76A 5CQFA 4FX9A 1PBEA 3I3LA 3LB8A 3P1WA 2BXSA 4U8KA 4GDPA 2PYXA 4YSYA 5KWFA 2A8XA 1FOHA 1CJCA 1GT8A 2ZBWA 1IUTA 3CMMA 1VG9A 1DOCA 1K0IA 4JY3A 4O5QA 2BC0A 3RNMA 1O95A 2VVLG 1GRFA 3G5SA 3QVPA 1ZMDA 3DMEA 2CULA 2EQ8A 1F6MA 1VDCA 2R0GA 4UP3A 2UZZA 3AECA 4Z2TA 1REOA 1VG0A 1PBFA 3UTFA 1LVLA 1L9CA 5KXJA 2BS2A 4YSHA 3VRDB 1JRXA 2OA1A 5IPYA 1ZKQA 2BK4A 3IC9A 3Q6JA 4AP3A 3K30A 2QAEA 3AD8B 2YLZA 3CGCA 3B6DA 1CHUA 4OPCA 4LIIA 2Q6UA 3GDNA 2E4GA 4CY6A 3UKAA 1ZOYA 1NENA 3CNJA 1IUVA 3LZXA 4OPDA 3HYWA 2EQ7A 1PDHA 2BCPA 2XLPA 3SY4A 3GMCA 2GQWA 2VVMA 3G5QA 3GMBA 1ELIA 3L1RA 3EF6A 1GNDA 2GAGB 2WU2A 3K7TA 1DOEA 2C65A 3NTAA 4WX1A 3KD9A 2X8GA 4AP1A 3QSEA 3IF9A 4NTDA 3AD7B 2HQMA 2VRMA 4II2A 4ZCCA 2IIDA 3CPJG 4EQSA 5GRTA 5C2TA 4JQ9A 2AAQA 1PS9A 2GEWA 4YKGA 2XLTA 4K8DA 2DKIA 3M13A 3GYXA 1TDFA 4J36A 3IWAA 3DJJA 4CNJA 4KPRA 1GEUA 1PXBA 2C4CA 2JAEA 3AE8A 2Z5XA 3DA1A 1KNRA 4BV6A 2AQJA 2BRAA 3NIXA 4WCTA 2VOUA 2R4EA 1PHHA 3NLCA 2GAHB 2GMHA 4YSXA 2FJAA 5KVHA 1N1PA 2YVFA 2RGOA 1EL9A 1E1LA 1E39A 4U8LA 1IUXA 1S3EA 3Q9TA 2FBWA 4K2XA 1TDOA 1VRQB 2JB1A 2WP9A 1YQ3A 5KRQA 4DNAA 3AWIA 3LOVA 1YQ4A 2YM1A 3AE4A 3BNMA 2JKCA 1EL5A 5U63A 2CDUA 2ZZBA 4H4SA 4U2TA 1DJNA 1D7YA 2GB0A 1OJCA 2V3BA 2BS3A 1GOSA 2FJBA 3ALJA 3H4KA 4GRTA 5JCMA 3UTHA 2ZZ0A 4H4TA 2IVDA 3NK1X 2C66A 2X8CA 3C4AA 3E1TA 2XVHA 1B8SA 5JCKA 2YLRA 2B9XA 2YR4A 1H2IA 3AXBA 4A6NB 3NYCA 1MOKA 5DBJA 1JRZA 4EQWA 2C72A 1PBDA 2ACZA 3SZCA 1MO9A 2WETA 1GRAA 3V3NA 3CPIG 3V3OA 3H8IA 1DNCA 3PVCA 2BC1A 4PABA 1COYA 4YKFA 4EIQA 1FEAA 1W4XA 3KPFA 3DK4A 4G6GA 4JDRA 4H4VA 2QA1A 3QVRA 4UDPA 2V60A 4BK2A 2BRYA 1KDGA 3SZWA 4J2WA 4GAVA 3ISHA 3REDA 1GRGA 3F8PA 4IA6A 3SZ0A 4USRA 1GXFA 1GALA 4A6NA 2WOIA 2JB3A 4D03A 4H2PA 4C74A 2C70A 1LJ1A 3GWDA 3KKJA 2YQUA 2YG7A 2XFQA 4A99A 1X31B 4G73A 1M64A 2GV8A 4J34A 4GDEA 2BK5A 4Z2RA 5HYMA 2WPCA 3II4A 4X9NA 3GRSA 3KLJA 2APGA 2RGJA 4JNQA 4XXGA 4A9WA 3S5WA 3O0HA 3JSKA 1KN0A 2YG6A 3FG2P 4OCGA 2C67A 3IHGA 2XVIA 1CC6A 2B7SA 4AOSA 1TYPA 5FS9A 3T31A 4YTNA 3DGHA 1H81A 2OALA 1CC2A 4IVOB 3UKLA 4EQXA 2GR3A 1PJ6A 5L46A 1P2EA 1IJHA 4U2LA 3EANA 2EQ6A 4JY2A 3ZYXA 2YG4A 3BHFA 4A5LA 2GRTA 4A65A 3AYIA 3AB1A 1Q9IA 4H7UA 2R0PA 2C3DA 3SM8A 1GTEA 1RYIA 4HB9A 2GR1A 2BACA 2WOWA 1Y56B 3CNDA 1H82A 3CNPA 4B63A 1ZK7A 3QJ4A 1F8SA 3AYJA 1NHRA 2BABA 2XVEA 1D4EA 3P4RA 2V3AA 4EMJA 4K5RA 1BWCA 2JK6A 1K4QA 1EBDA 1F3PA 1CJ2A 1S3BA 1GRTA 2YAUA 1CL0A 2BA9A 2BK3A 3KU9A 4GCMA 2WPFA 5FS6A 4NWZA 2H89A 3ATQA 4H4RA 1UKVG 4FK1C 1N4VA 3BI5A 3LJPA 3P4PA 1OJTA 1QLBA 1DXLA 1D7LA 1IUWA 5J60A 1PXCA 1E1KA 1DOBA 2TMDA 5IQ1A 2A89A 3DJGX 3P9UA 4U8IA 4YXDA 2WS3A 1V59A 3SZFA 4E0VA 5BRTA 2X8HA 3GYJA 5GSNA 1RSGA 3AEBA 1VQWA 4G6HA 4OPTA 3C96A 5EB5A 3T14A 4LA1A 1OJDA 5KMQA 4BK1A 1NHPA 1KSSA 1EL8A 2GF3A 4K22A 4CBQA 2XFOA 3M0OA 3AEGA 2CVJA 2GQFA 5KMPA 2Y6QA 4U8JA 5KOWA 3GWFA 3NH3X 4DSGA 3DK8A 1B4VA 2ARDA 1XPQA 1PJ7A 2YLXA 3D1CA 4TM0A 3UOXA 4C77A 2Y6RA 3AEDA 2YWLA 2YLSA 4B67A 4Z43A 4J57A 1N4WA 3AE5A 4BJZA 4TLXA 5KVIA 3BI2A 2H88A 2YLTA 1ZMCA 3LZWA 3SYIA 4CRTA 1FCDA 1HYUA 2O9ZA 4Y4LA 5JCLA 3K7MX 4CCQA 1CF3A 1NHQA 3DJEA 3UKPA 2VZ2A 1O5WA 3NTDA 1DODA 4JNAA 4AOXA 1YKJA 2VRLA 4GF7A 4B65A 3QSMA 2EQ9A 5BUKA 5KMRA 4G74A 4U8NA 2AR8A 2IVEA 3UTEA 4J56A 4YTPA 5TR3A 2XVFA 2NPXA 1KF6A 3S61A 2C76A 3V76A 4CNKA 4O5UA 3SGLA 1XDIA 2WDQA 2XFPA 3FBSA 3P4SA 2F5ZA 4MJWA 4UDQA 5HXIA 1YQZA 1Z6LA 1Y56A 2QA2A 4XWRA 3DJDA 2WP5A 2PHHA 3CPHG 1JNRA 3QFAA 3HYVA 4RG3A 3D9XA 4Y4NA 4BK3A 5KOXA 3SX6A 4H4QA 5JRBA 2WDRA 4RSLA 3ICTA 4TM4A 4U8MA 3G5RA 4BURA 3GD4A 2C7GA 4K7ZA 1LQUA 3RP7A 5J7XA 3UOYA 3OZ2A 1S2QA 1LTXR 1KSUA 4NEVA 3FMWA 1JOAA 1CJ4A 1JNZA 1GTHA 2VQ7A 2WHDA 4FDCB 3IHMA 2WP6A 3UKHA 4DSHA 1O94A 4C3YA 5BULA 2V6OA 4NTEA 4N9XA 5CKUA 3T2YA 3NK0X 1E1NA 3UKQA 1FECA 1B37A 5C3JA 1K0JA 1TDEA 3UP4A 2XFNA 4P9SA 3NHOX 1BZLA 4CCRA 1ZX9A 3ZDNA 4ICYA 1NDAA 2R9ZA 5JCNA 1QJDA 1SEZA 1RP0A 3AE3A 3NYEA 2FJDA 2I0ZA 2NVKX 5FS8A 5U1OA 3AE7A 3T37A 1CJ3A 4TM3A 4H4YA 1GRHA 4JN9A 1ZDLA 4EM4A 1PBCA 3QSSA 2Q0LA 2XLRA 2XFUA 2YG5A 5KMSA 4ADWA 1NG4A 1NG3A 2BS4A 3LXDA 2DKHA 5HHFA 1H6VA 3UTGA 3VR8A 3CTYA 4B66A 4EIPA 3EAOA 2RGHA 4B64A 4KX6A 4GR1A 1JU2A 3VRAA 1NAAA 4X4JA 2J3NA 2X99A 1IUSA 2OAMA 2BXRA 4IV9A 4AT0A 3AEEA 2RABA 4H2NA 1GREA 3CN8A 1JRYA 3AEAA 5FMHA 3BNUA 4Z24A 3VQRA 1D4DA 3GYIA 4OPGA 3ABVA 3NT6A 2GR0A 1IUUA 2ZZCA 2E5VA 4ZN0A 4FK1A 1D4CA 4BJYA 4REKA 2JBVA 2XYOA 3F8DA 2OLNA 2Z5YA 4H4PA 4EQRA 4Z44A 3CNTA 3NRNA 2WESA 4LU6A 2XDOA 3T0KA 4ZCDA 3AE6A 1TRBA 4NEWA 1FL2A 2BCGG 2WDVA 1P2HA 4K5SA 4NTCA 2C64A 2CFYA 4Z26A 4OVIA 3BHKA 1YY5A 3AE1A 4H2QA 4H4ZA 2YVJA 2B9WA 2E1MA 1GERA 3GRTA 1H7XA 5EB4A 3CGDA 3L5OA 3CNSA 3ICSA 1EL7A 2WQYA 3UOVA 3PG6A 4DGKA 2OLOA 2YG3A 4APNA 1CBOA 2C75A 5HY5A 1L9EA 1N4UA 1XHCA 1MXTA 1CC4A 3NK2X 1TYTA 4TLZA 1TDNA 3EPTA 3ITJA 3NN0X 4H2RA 3URHA 4Z2UA 5LV9A 2YVGA 3NYFA 1TDKA 3C4NA 4GUVA 2V5ZA 1K0LA 3NGCX 1XANA 4H4XA 3AD9B 5ER0A 4NNJA 5M0ZA 4J33A 4AT2A 1LQTA 3RP6A 2TPRA 3RHAA 1E7PA 4HA6A 1PBBA 2WOVA 3L8KA 4OPIA 3AYLA 2B7RA 3GDPA 3RP8A 3KVEA 3SFDA 4C5OA 4PAAA 3CGEA 4UDRA 3P4QA 4U8PA 2R46A 2JB2A 3SQPA 2R4JA 4OPLA 2BYBA 2V61A 3PO7A 2X3NA 4IVMB 3AE9A 5FS7A 2YM2A 3AEFA 4B69A 2GR2A 4J31A 4EMWA 1H86A 3CGBA 4B68A 3I6DA 1KNPA 3NN6X 1S7MA 1DJQA 1NPXA 4B1BA 5M10A 1E1MA 2YR6A 2WPEA 2GH5A 1ZP0A 3ALMA 3K7QX 2A87A 3F8RA 3M12A 3UKFA 1FEBA 3SXIA 3B3RA 1B5QA 3R9UA 1F8WA 4OPUA 3UOZA 2R45A 3ALLA 1GPEA 1H7WA 1AOGA 1BF3A 2VQBA 3UCLA 3KPKA 3HYXA 1NEKA 4IA5A 2C73A 3FPZA 4G9KA 1GSNA 5U25A 3NKSA 1LV0A 4D04A 1L0VA 1GESA 2YR5A 1PN0A 3SFEA 4H4WA 1NHSA 2VVLA 3H8LA 1BGJA 2Q0KA 4CY8A 4GAPA 3ICRA 1GRBA 3ATRA 3VR9A 4XWZA 2W0HA 3BI4A 1D5TA 2QCUA 1S2YA 1M6IA 4USQA 3UP5A 2WBAA 3LADA 1Q1RA 3AE2A 5KNLA 1JEHA 5JCIA 3FIMB 2WEUA 5IQ4A 4C3XA 1BKWA 3DK9A 2XVJA 1GETA 1PJ5A 2WU5A 3PS9A 2R0CA 1ONFA 3GSIA 1OJAA 2XLSA 1GV4A 1H83A 1H84A 4ECHA 2X50A 4U8OA 4A7AA 4U2SA 4H50A 1LPFA 3KA7A 4TM1A 3UKKA 3ADAB 3T2KA 1BGNA 4YSZA 1F8RA 4Z25A 1E6EA 5EOWA 4YT0A 1OJ9A 1QO8A 3D8XA 4II3A 4X9MA 3COXA 4YWOA 2Q7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OC4 A;  4EMI A;  3NNE A;  4EM3 A;  2B9Y A;  1Y0P A;  3VRB A;  4A79 A;  3CIR A;  4M52 A;  4NZH A;  5EBK A;  1KFY A;  2FJE A;  2XLU A;  2YLW A;  3DH9 A;  4I59 A;  4RG4 A;  4YTM A;  5BVA A;  4Y4M A;  1ZY8 A;  3QFB A;  1PXA A;  1L9D A;  4I58 A;  3NG7 X;  3GD3 A;  1Q1W A;  2GMJ A;  2GVC A;  3HZL A;  4H4U A;  1ZOV A;  2C3C A;  3DGZ A;  2XCG A;  3WE0 A;  2B76 A;  5CQF A;  4FX9 A;  1PBE A;  3I3L A;  3LB8 A;  3P1W A;  2BXS A;  4U8K A;  4GDP A;  2PYX A;  4YSY A;  5KWF A;  2A8X A;  1FOH A;  1CJC A;  1GT8 A;  2ZBW A;  1IUT A;  1VG9 A;  1DOC A;  1K0I A;  4JY3 A;  4O5Q A;  2BC0 A;  3RNM A;  1O95 A;  2VVL G;  1GRF A;  3G5S A;  3QVP A;  1ZMD A;  3DME A;  2CUL A;  2EQ8 A;  1F6M A;  1VDC A;  2R0G A;  4UP3 A;  2UZZ A;  3AEC A;  4Z2T A;  1REO A;  1VG0 A;  1PBF A;  3UTF A;  1LVL A;  1L9C A;  5KXJ A;  2BS2 A;  4YSH A;  3VRD B;  1JRX A;  2OA1 A;  5IPY A;  1ZKQ A;  2BK4 A;  3IC9 A;  3Q6J A;  4AP3 A;  3K30 A;  2QAE A;  3AD8 B;  2YLZ A;  3CGC A;  3B6D A;  1CHU A;  4OPC A;  4LII A;  2Q6U A;  3GDN A;  2E4G A;  4CY6 A;  3UKA A;  1ZOY A;  1NEN A;  3CNJ A;  1IUV A;  3LZX A;  4OPD A;  2EQ7 A;  1PDH A;  2BCP A;  2XLP A;  3GMC A;  2GQW A;  2VVM A;  3G5Q A;  3GMB A;  1ELI A;  3L1R A;  3EF6 A;  1GND A;  2GAG B;  2WU2 A;  3K7T A;  1DOE A;  2C65 A;  3NTA A;  4WX1 A;  3KD9 A;  2X8G A;  4AP1 A;  3QSE A;  3IF9 A;  4NTD A;  3AD7 B;  2HQM A;  2VRM A;  4ZCC A;  2IID A;  3CPJ G;  4EQS A;  5GRT A;  5C2T A;  1PS9 A;  4JQ9 A;  2AAQ A;  2GEW A;  4YKG A;  2XLT A;  4K8D A;  2DKI A;  3M13 A;  1TDF A;  4J36 A;  3IWA A;  3DJJ A;  4CNJ A;  4KPR A;  1GEU A;  1PXB A;  3AE8 A;  2JAE A;  2Z5X A;  3DA1 A;  1KNR A;  4BV6 A;  2AQJ A;  3NIX A;  4WCT A;  2VOU A;  2R4E A;  1PHH A;  3NLC A;  2GAH B;  2GMH A;  4YSX A;  2FJA A;  5KVH A;  1N1P A;  2YVF A;  2RGO A;  1EL9 A;  1E1L A;  1E39 A;  4U8L A;  1IUX A;  1S3E A;  3Q9T A;  2FBW A;  4K2X A;  1TDO A;  1VRQ B;  2JB1 A;  2WP9 A;  1YQ3 A;  5KRQ A;  4DNA A;  3AWI A;  3LOV A;  1YQ4 A;  2YM1 A;  3AE4 A;  3BNM A;  2JKC A;  1EL5 A;  5U63 A;  2CDU A;  2ZZB A;  4H4S A;  4U2T A;  1DJN A;  1D7Y A;  2GB0 A;  1OJC A;  2V3B A;  2BS3 A;  1GOS A;  2FJB A;  3ALJ A;  3H4K A;  4GRT A;  5JCM A;  3UTH A;  2ZZ0 A;  4H4T A;  2IVD A;  3NK1 X;  2C66 A;  2X8C A;  3C4A A;  3E1T A;  2XVH A;  1B8S A;  5JCK A;  2YLR A;  2B9X A;  2YR4 A;  3AXB A;  4A6N B;  3NYC A;  1MOK A;  5DBJ A;  1JRZ A;  4EQW A;  2C72 A;  1PBD A;  2ACZ A;  1MO9 A;  2WET A;  1GRA A;  3V3N A;  3CPI G;  3V3O A;  3H8I A;  1DNC A;  3PVC A;  2BC1 A;  4PAB A;  1COY A;  4YKF A;  4EIQ A;  1FEA A;  1W4X A;  3KPF A;  3DK4 A;  4JDR A;  4H4V A;  2QA1 A;  3QVR A;  4UDP A;  2V60 A;  4BK2 A;  1KDG A;  4J2W A;  3ISH A;  3RED A;  1GRG A;  3F8P A;  4IA6 A;  4USR A;  1GXF A;  1GAL A;  4A6N A;  2WOI A;  2JB3 A;  4D03 A;  4H2P A;  4C74 A;  2C70 A;  1LJ1 A;  3GWD A;  3KKJ A;  2YQU A;  2YG7 A;  2XFQ A;  4A99 A;  1X31 B;  1M64 A;  2GV8 A;  4J34 A;  4GDE A;  2BK5 A;  4Z2R A;  5HYM A;  2WPC A;  3II4 A;  4X9N A;  3GRS A;  3KLJ A;  2APG A;  2RGJ A;  4JNQ A;  4XXG A;  4A9W A;  3S5W A;  3O0H A;  3JSK A;  2YG6 A;  3FG2 P;  4OCG A;  2C67 A;  3IHG A;  2XVI A;  1CC6 A;  2B7S A;  4AOS A;  1TYP A;  5FS9 A;  4YTN A;  3DGH A;  1H81 A;  2OAL A;  1CC2 A;  4IVO B;  3UKL A;  4EQX A;  2GR3 A;  1PJ6 A;  5L46 A;  1P2E A;  1IJH A;  4U2L A;  3EAN A;  2EQ6 A;  4JY2 A;  3ZYX A;  2YG4 A;  3BHF A;  4A5L A;  2GRT A;  4A65 A;  3AYI A;  3AB1 A;  1Q9I A;  4H7U A;  2R0P A;  2C3D A;  3SM8 A;  1GTE A;  1RYI A;  4HB9 A;  2GR1 A;  2BAC A;  2WOW A;  1Y56 B;  3CND A;  1H82 A;  3CNP A;  4B63 A;  1ZK7 A;  3QJ4 A;  1F8S A;  3AYJ A;  1NHR A;  2BAB A;  2XVE A;  1D4E A;  3P4R A;  2V3A A;  4EMJ A;  4K5R A;  1BWC A;  2JK6 A;  1K4Q A;  1EBD A;  1F3P A;  1CJ2 A;  1S3B A;  1GRT A;  2YAU A;  1CL0 A;  2BA9 A;  2BK3 A;  3KU9 A;  4GCM A;  2WPF A;  5FS6 A;  2H89 A;  3ATQ A;  4H4R A;  1UKV G;  4FK1 C;  1N4V A;  3BI5 A;  3LJP A;  3P4P A;  1OJT A;  1QLB A;  1DXL A;  1D7L A;  1IUW A;  5J60 A;  1PXC A;  1E1K A;  1DOB A;  2TMD A;  5IQ1 A;  2A89 A;  3DJG X;  3P9U A;  4U8I A;  4YXD A;  2WS3 A;  1V59 A;  4E0V A;  5BRT A;  2X8H A;  3GYJ A;  5GSN A;  1RSG A;  3AEB A;  1VQW A;  4OPT A;  3C96 A;  5EB5 A;  4LA1 A;  1OJD A;  4BK1 A;  1NHP A;  1KSS A;  1EL8 A;  2GF3 A;  4K22 A;  4CBQ A;  2XFO A;  3M0O A;  3AEG A;  2CVJ A;  2GQF A;  2Y6Q A;  4U8J A;  5KOW A;  3GWF A;  3NH3 X;  4DSG A;  3DK8 A;  1B4V A;  2ARD A;  1XPQ A;  1PJ7 A;  2YLX A;  3D1C A;  4TM0 A;  3UOX A;  4C77 A;  2Y6R A;  3AED A;  2YWL A;  2YLS A;  4B67 A;  4Z43 A;  4J57 A;  1N4W A;  3AE5 A;  4BJZ A;  4TLX A;  5KVI A;  3BI2 A;  2H88 A;  2YLT A;  1ZMC A;  3LZW A;  4CRT A;  1FCD A;  1HYU A;  2O9Z A;  4Y4L A;  5JCL A;  3K7M X;  4CCQ A;  1CF3 A;  1NHQ A;  3DJE A;  3UKP A;  2VZ2 A;  1O5W A;  3NTD A;  1DOD A;  4JNA A;  4AOX A;  1YKJ A;  2VRL A;  4GF7 A;  4B65 A;  3QSM A;  2EQ9 A;  5BUK A;  4U8N A;  2AR8 A;  2IVE A;  3UTE A;  4J56 A;  4YTP A;  5TR3 A;  2XVF A;  2NPX A;  1KF6 A;  3S61 A;  2C76 A;  3V76 A;  4CNK A;  4O5U A;  3SGL A;  1XDI A;  2WDQ A;  2XFP A;  3FBS A;  3P4S A;  2F5Z A;  4MJW A;  4UDQ A;  5HXI A;  1YQZ A;  1Z6L A;  1Y56 A;  2QA2 A;  4XWR A;  3DJD A;  2WP5 A;  2PHH A;  3CPH G;  1JNR A;  3QFA A;  4RG3 A;  4Y4N A;  4BK3 A;  5KOX A;  4H4Q A;  2WDR A;  4RSL A;  4TM4 A;  3ICT A;  4U8M A;  3G5R A;  4BUR A;  3GD4 A;  2C7G A;  4K7Z A;  1LQU A;  3RP7 A;  5J7X A;  3UOY A;  3OZ2 A;  1S2Q A;  1LTX R;  1KSU A;  4NEV A;  3FMW A;  1JOA A;  1CJ4 A;  1JNZ A;  1GTH A;  2VQ7 A;  2WHD A;  4FDC B;  3IHM A;  2WP6 A;  3UKH A;  4DSH A;  1O94 A;  4C3Y A;  5BUL A;  2V6O A;  4NTE A;  4N9X A;  5CKU A;  3NK0 X;  1E1N A;  3UKQ A;  1FEC A;  1B37 A;  5C3J A;  1K0J A;  1TDE A;  3UP4 A;  2XFN A;  4P9S A;  3NHO X;  1BZL A;  4CCR A;  1ZX9 A;  3ZDN A;  4ICY A;  1NDA A;  2R9Z A;  5JCN A;  1QJD A;  1SEZ A;  1RP0 A;  3AE3 A;  3NYE A;  2FJD A;  2I0Z A;  2NVK X;  5FS8 A;  5U1O A;  3AE7 A;  3T37 A;  1CJ3 A;  4TM3 A;  4H4Y A;  1GRH A;  4JN9 A;  1ZDL A;  4EM4 A;  1PBC A;  3QSS A;  2Q0L A;  2XLR A;  2XFU A;  2YG5 A;  4ADW A;  1NG4 A;  1NG3 A;  2BS4 A;  3LXD A;  2DKH A;  5HHF A;  1H6V A;  3UTG A;  3VR8 A;  3CTY A;  4B66 A;  4EIP A;  3EAO A;  2RGH A;  4B64 A;  4KX6 A;  4GR1 A;  1JU2 A;  3VRA A;  1NAA A;  4X4J A;  2J3N A;  2X99 A;  1IUS A;  2OAM A;  2BXR A;  4IV9 A;  4AT0 A;  3AEE A;  2RAB A;  4H2N A;  1GRE A;  3CN8 A;  1JRY A;  3AEA A;  5FMH A;  3BNU A;  4Z24 A;  3VQR A;  1D4D A;  3GYI A;  4OPG A;  3ABV A;  3NT6 A;  2GR0 A;  1IUU A;  2ZZC A;  2E5V A;  4ZN0 A;  4FK1 A;  1D4C A;  4BJY A;  4REK A;  2JBV A;  2XYO A;  3F8D A;  2OLN A;  2Z5Y A;  4H4P A;  4EQR A;  4Z44 A;  3CNT A;  3NRN A;  2WES A;  4LU6 A;  2XDO A;  4ZCD A;  3AE6 A;  1TRB A;  4NEW A;  1FL2 A;  2BCG G;  2WDV A;  1P2H A;  4K5S A;  4NTC A;  2C64 A;  2CFY A;  4Z26 A;  4OVI A;  3BHK A;  1YY5 A;  3AE1 A;  4H2Q A;  4H4Z A;  2YVJ A;  2B9W A;  2E1M A;  1GER A;  3GRT A;  1H7X A;  5EB4 A;  3CGD A;  3ICS A;  3CNS A;  1EL7 A;  2WQY A;  3UOV A;  4DGK A;  2OLO A;  2YG3 A;  4APN A;  1CBO A;  2C75 A;  5HY5 A;  1L9E A;  1N4U A;  1XHC A;  1MXT A;  1CC4 A;  3NK2 X;  1TYT A;  4TLZ A;  1TDN A;  3EPT A;  3ITJ A;  3NN0 X;  4H2R A;  3URH A;  4Z2U A;  5LV9 A;  2YVG A;  3NYF A;  1TDK A;  3C4N A;  4GUV A;  2V5Z A;  1K0L A;  3NGC X;  1XAN A;  4H4X A;  3AD9 B;  5ER0 A;  5M0Z A;  4J33 A;  4AT2 A;  1LQT A;  3RP6 A;  2TPR A;  3RHA A;  1E7P A;  4HA6 A;  1PBB A;  2WOV A;  3L8K A;  4OPI A;  3AYL A;  2B7R A;  3GDP A;  3RP8 A;  3KVE A;  3SFD A;  4C5O A;  4PAA A;  3CGE A;  4UDR A;  3P4Q A;  4U8P A;  2R46 A;  2JB2 A;  3SQP A;  2R4J A;  4OPL A;  2BYB A;  2V61 A;  3PO7 A;  2X3N A;  4IVM B;  3AE9 A;  5FS7 A;  2YM2 A;  3AEF A;  4B69 A;  2GR2 A;  4J31 A;  4EMW A;  1H86 A;  3CGB A;  4B68 A;  3I6D A;  1KNP A;  3NN6 X;  1DJQ A;  1NPX A;  4B1B A;  5M10 A;  1E1M A;  2YR6 A;  2WPE A;  2GH5 A;  1ZP0 A;  3ALM A;  3K7Q X;  2A87 A;  3F8R A;  3M12 A;  3UKF A;  1FEB A;  3B3R A;  1B5Q A;  3R9U A;  1F8W A;  4OPU A;  3UOZ A;  2R45 A;  3ALL A;  1GPE A;  1H7W A;  1AOG A;  1BF3 A;  2VQB A;  3UCL A;  1NEK A;  4IA5 A;  2C73 A;  3FPZ A;  1GSN A;  5U25 A;  3NKS A;  1LV0 A;  4D04 A;  1L0V A;  1GES A;  2YR5 A;  1PN0 A;  3SFE A;  4H4W A;  1NHS A;  2VVL A;  3H8L A;  1BGJ A;  2Q0K A;  4CY8 A;  3ICR A;  1GRB A;  3ATR A;  3VR9 A;  4XWZ A;  2W0H A;  3BI4 A;  1D5T A;  2QCU A;  1S2Y A;  1M6I A;  4USQ A;  3UP5 A;  2WBA A;  3LAD A;  1Q1R A;  3AE2 A;  1JEH A;  5JCI A;  3FIM B;  2WEU A;  5IQ4 A;  4C3X A;  1BKW A;  3DK9 A;  2XVJ A;  1GET A;  1PJ5 A;  2WU5 A;  3PS9 A;  2R0C A;  1ONF A;  3GSI A;  1OJA A;  2XLS A;  1GV4 A;  1H83 A;  1H84 A;  4ECH A;  2X50 A;  4U8O A;  4A7A A;  4U2S A;  4H50 A;  1LPF A;  3KA7 A;  4TM1 A;  3UKK A;  3ADA B;  1BGN A;  4YSZ A;  1F8R A;  4Z25 A;  1E6E A;  5EOW A;  4YT0 A;  1OJ9 A;  1QO8 A;  3D8X A;  4X9M A;  3COX A;  4YWO A;  2Q7V A; 
#chains in the Genus database with same CATH topology
 3OC4 A;  4EMI A;  3NNE A;  2XGZ A;  1Y0P A;  4A79 A;  4M52 A;  5EBK A;  4H83 A;  3T8Q A;  2P3Z A;  1L9D A;  3GD3 A;  1N63 C;  3ES7 A;  3HZL A;  1ZOV A;  2C3C A;  2XCG A;  5CQF A;  4FX9 A;  3I3L A;  4YSY A;  2FYM A;  3GC2 A;  1DOC A;  4O5Q A;  2HXT A;  3RNM A;  1GRF A;  1ZMD A;  2CUL A;  4Z2T A;  3UCD A;  1LVL A;  3PWI A;  2BS2 A;  5IPY A;  3SN1 A;  4HNC A;  3GDN A;  2E4G A;  1ZOY A;  4OPD A;  2EQ7 A;  2XLP A;  2BCP A;  3SY4 A;  3DFH A;  2GQW A;  2VVM A;  3GMB A;  2MNR A;  1ELI A;  2GAG B;  3I4K A;  1DOE A;  2X8G A;  4AP1 A;  4II2 A;  2IID A;  4HN8 A;  5GRT A;  5C2T A;  4YKG A;  2AAQ A;  3UJS A;  2XLT A;  2AKM A;  4CNJ A;  4WCT A;  1KNR A;  3NIX A;  4IHC A;  3NLC A;  2GMH A;  2FJA A;  3ZVI A;  3H12 A;  1N1P A;  1IUX A;  4A6G A;  4K2X A;  1VRQ B;  1YQ3 A;  2W55 A;  3AWI A;  3AE4 A;  4U2T A;  2GB0 A;  1OJC A;  3ALJ A;  4GME A;  2XVH A;  3SSZ A;  4EQW A;  2C72 A;  1PBD A;  2MUC A;  3SZC A;  2WET A;  1RM6 B;  4DN1 A;  1FEA A;  3DK4 A;  4G6G A;  4H4V A;  4TVW A;  3QVR A;  2V60 A;  4BK2 A;  2BRY A;  1KDG A;  4J2W A;  3RED A;  1GRG A;  1JDF A;  2DW7 A;  1GAL A;  4A6N A;  2WOI A;  4D03 A;  4H2P A;  3OZM A;  4C74 A;  2GV8 A;  4X9N A;  3GRS A;  3O0H A;  3JSK A;  1KN0 A;  2PMQ A;  4OCG A;  2C67 A;  3IHG A;  1TYP A;  3I6T A;  1EBH A;  3DGH A;  3UKL A;  1P2E A;  4EWJ A;  2YG4 A;  3AYI A;  3UJR A;  3AB1 A;  2R0P A;  1KCZ A;  2WOW A;  1Y56 B;  3QJ4 A;  2W3R A;  1FFU C;  3T9P A;  3AYJ A;  3BOX A;  1D4E A;  2OZT A;  2BK3 A;  4GCM A;  1JPM A;  5FS6 A;  1UKV G;  4FK1 C;  3P4P A;  1QLB A;  1IUW A;  1ONE A;  5IQ1 A;  4U8I A;  4YXD A;  3UJ2 A;  3SZF A;  4E0V A;  3CAW A;  4G6H A;  3C96 A;  1EL8 A;  3AEG A;  2GQF A;  5KMP A;  3GWF A;  4DSG A;  3A7A A;  3OP2 A;  4TLX A;  1P43 A;  1HYU A;  3N4E A;  3VCN A;  3K7M X;  3TTE A;  3DJE A;  3UKP A;  1O5W A;  4AOX A;  1YKJ A;  3QSM A;  5BUK A;  4U8N A;  4J56 A;  5TR3 A;  1KF6 A;  2C76 A;  4M6U A;  2XFP A;  1XS2 A;  3R0U A;  1YQZ A;  1Z6L A;  1Y56 A;  2FKP A;  4RSL A;  3ICT A;  3G5R A;  5J7X A;  3UOY A;  3QKE A;  1KSU A;  2VQ7 A;  4FDC B;  3QN3 A;  3PK7 A;  5C3J A;  1TDE A;  4G7F A;  3TJ4 A;  4P9S A;  3NVZ B;  2R9Z A;  1QJD A;  1RP0 A;  5U1O A;  4TM3 A;  4JN9 A;  1PBC A;  3QSS A;  2Q0L A;  2XLR A;  5KMS A;  4ADW A;  1NG4 A;  1NG3 A;  4B64 A;  2P88 A;  1WUF A;  4H2N A;  4OPG A;  3ABV A;  3NT6 A;  2GR0 A;  2E5V A;  3KUM A;  4FK1 A;  4E4U A;  3NS1 B;  2Z5Y A;  2WES A;  3T0K A;  3AE6 A;  1TRB A;  4Z26 A;  4DWD A;  3ZLG A;  4E6M A;  2YVJ A;  2B9W A;  2OG9 A;  4FI4 A;  3UOV A;  4DGK A;  4APN A;  1CBO A;  3NK2 X;  1TYT A;  4TLZ A;  1FFV C;  3NN0 X;  4H2R A;  3FYY A;  3URH A;  5IDZ A;  2YVG A;  3CYJ A;  4E5T A;  3NYF A;  2V5Z A;  3N6H A;  4J3Z A;  4NNJ A;  1LQT A;  1OEP A;  3RP6 A;  3ETR B;  4HA6 A;  1PBB A;  1TKK A;  3AYL A;  2B7R A;  4PAA A;  3P4Q A;  1MDL A;  3PO7 A;  3AE9 A;  5FS7 A;  2YM2 A;  4EMW A;  4B68 A;  3I6D A;  1KNP A;  2PP3 A;  3VDG A;  4B1B A;  1E1M A;  2PP0 A;  2GH5 A;  3ALM A;  3SXI A;  3R9U A;  4OPU A;  2R45 A;  1GPE A;  1H7W A;  1BF3 A;  4IA5 A;  3FPZ A;  1GSN A;  2YR5 A;  1NHS A;  4YWS A;  2VVL A;  4CY8 A;  3ICR A;  1GRB A;  3VCC A;  3VR9 A;  4XWZ A;  3EUB 3;  1S2Y A;  5IQ4 A;  3DK9 A;  1PJ5 A;  2P8B A;  2WU5 A;  3PS9 A;  4A3R A;  1ONF A;  4ECH A;  1TE6 A;  4H50 A;  1LPF A;  4TM1 A;  3T2K A;  1F8R A;  4YT0 A;  1OJ9 A;  4II3 A;  4DX3 A;  4F4R A;  3FJ4 A;  3T2Z A;  3VRB A;  3CIR A;  2YLW A;  4Y4M A;  1PXA A;  4I58 A;  3NG7 X;  4GGH A;  2GVC A;  2B76 A;  1PBE A;  3P1W A;  2BXS A;  2A8X A;  3CMM A;  3VA8 A;  1K0I A;  1O95 A;  3S47 A;  3MQT A;  1VDC A;  2R0G A;  3AEC A;  1VG0 A;  1L9C A;  2PCE A;  4HYR A;  1ZKQ A;  3MWC A;  2BK4 A;  4AP3 A;  3K30 A;  3AD8 B;  2PU1 A;  2GL5 A;  3UKA A;  1NEN A;  3CNJ A;  3LZX A;  2QJN A;  3G5Q A;  3L1R A;  4WX1 A;  4TVY A;  3NTA A;  3P0W A;  3QSE A;  3IF9 A;  4NTD A;  3AD7 B;  2VRM A;  3CPJ G;  5FJT A;  2GEW A;  1TDF A;  3IWA A;  4KPR A;  1GEU A;  1NEL A;  2PGW A;  2C4C A;  2JAE A;  3DA1 A;  2BRA A;  2PSN A;  2RGO A;  1KKR A;  2XH2 A;  4U8L A;  1S3E A;  2JB1 A;  3Q4D A;  3IJQ A;  3LOV A;  1YQ4 A;  1STZ A;  1EC7 A;  3GD6 A;  4GFI A;  4G8T A;  2YLR A;  3AXB A;  1JRZ A;  2AKZ A;  3A7U A;  2ACZ A;  1MO9 A;  3V3N A;  1TZZ A;  2OKT A;  1DNC A;  3PVC A;  4PAB A;  2PTZ A;  3D47 A;  3RR1 A;  3SZW A;  3SZ0 A;  4USR A;  2PTX A;  2JB3 A;  1VDV A;  2GGH A;  3MZN A;  3BSM A;  2APG A;  4A9W A;  2B7S A;  3T31 A;  5FS9 A;  4YTN A;  4EQX A;  1ZXI C;  1MNS A;  1N5W C;  4A5L A;  1L8P A;  2C3D A;  3SM8 A;  4ZCW A;  1RYI A;  4HB9 A;  3TQP A;  2POZ A;  4B63 A;  1ZK7 A;  2QGY A;  3QPE A;  2BAB A;  3P4R A;  4HNL A;  1BWC A;  1K4Q A;  2JK6 A;  7ENL A;  1GRT A;  2YAU A;  3KU9 A;  3ZLF A;  4Z17 A;  3ATQ A;  3BI5 A;  3Q45 A;  5J60 A;  4K2S A;  1DTN A;  1VQW A;  4IZG A;  1OJD A;  5KMQ A;  2GF3 A;  1R6W A;  5ENL A;  2XFO A;  5KOW A;  3NH3 X;  2ARD A;  2Y6R A;  2ZAD A;  4Z43 A;  3BI2 A;  2H88 A;  1ZMC A;  3SYI A;  1V97 A;  3B9J B;  4Y4L A;  5JCL A;  4CCQ A;  1NHQ A;  3THU A;  4JNA A;  3NTD A;  1EBG A;  2EQ9 A;  3VC6 A;  3RRA A;  4YTP A;  2XVF A;  2NPX A;  3V76 A;  2WDQ A;  1P48 A;  3NO1 A;  2XH0 A;  2QA2 A;  4ZOH B;  4Y4N A;  1FIQ B;  3HYV A;  3QFA A;  4RG3 A;  5J04 A;  2WDR A;  2C7G A;  4K7Z A;  3GO2 A;  3OZ2 A;  3DEQ A;  2XH4 A;  1JOA A;  1JNZ A;  3R10 A;  3H70 A;  2WHD A;  3IHM A;  1O94 A;  2V6O A;  3UCC A;  3T2Y A;  3NK0 X;  1B37 A;  3NHO X;  1ZX9 A;  4ICY A;  5JCN A;  2HNE A;  1EC8 A;  3T37 A;  2NVK X;  5FS8 A;  3AE7 A;  2PU0 A;  1CJ3 A;  2XFU A;  2OZ8 A;  3PWG A;  2P8C A;  3LXD A;  1H6V A;  3VR8 A;  3CTY A;  4X2P A;  4EIP A;  1BQG A;  4KX6 A;  4GR1 A;  1XPY A;  1JU2 A;  4X4J A;  1IUS A;  2BXR A;  4AT0 A;  2RAB A;  3AN1 A;  3IJL A;  1JRY A;  3HPF A;  5FMH A;  3GYI A;  2I5Q A;  2ZZC A;  2QDD A;  4ZN0 A;  1SJA A;  3RCY A;  2OLN A;  4H4P A;  3CNT A;  3NRN A;  2XDO A;  2BCG G;  2WDV A;  4NTC A;  4K5S A;  3N4F A;  1GER A;  3GRT A;  1H7X A;  3CGD A;  3CNS A;  1EL7 A;  3PG6 A;  2OLO A;  2YG3 A;  2POD A;  3UXL A;  5HY5 A;  2GDQ A;  1XHC A;  1MXT A;  1F9C A;  4HPN A;  3ITJ A;  5LV9 A;  3D46 A;  5M0Z A;  4H4X A;  5ER0 A;  3PFR A;  4J33 A;  3L8K A;  3TOY A;  3SFD A;  4U8P A;  2BYB A;  4IVM B;  2GR2 A;  4J31 A;  1H86 A;  4GYP C;  4HCH A;  2GSH A;  1MUC A;  3CXO A;  4IP5 A;  5M10 A;  2WPE A;  2NQL A;  3M12 A;  3F8R A;  3V3W A;  1B5Q A;  3JW7 A;  2QQ6 A;  3ALL A;  3V4B A;  4IL0 A;  3NKS A;  4D04 A;  1PN0 A;  1W6T A;  4H4W A;  2AL2 B;  3ATR A;  1M6I A;  4USQ A;  4ZA0 A;  3RGT A;  1BKW A;  1GET A;  3HW2 A;  2R0C A;  3GSI A;  1OJA A;  3DER A;  4A7A A;  3AMZ A;  3ADA B;  1BGN A;  1E6E A;  5EOW A;  3UJE A;  1QO8 A;  3D8X A;  4YWO A;  2PTY A;  2P0I A;  4JHM A;  1KFY A;  2FJE A;  2XLU A;  4RG4 A;  3DH9 A;  1ZY8 A;  3ZVH B;  2GMJ A;  4H4U A;  3DGZ A;  5KWF A;  5FJR A;  4GDP A;  1GT8 A;  1CJC A;  1IUT A;  3FVD A;  4JY3 A;  2BC0 A;  2VVL G;  3QVP A;  4UP3 A;  1REO A;  1PBF A;  4A35 A;  3MKC A;  2PGE A;  4YSH A;  3IC9 A;  3Q6J A;  2QAE A;  2YLZ A;  3CGC A;  4LII A;  2Q6U A;  4CY6 A;  3HYW A;  2E5A A;  3EF6 A;  1GND A;  3K7T A;  3DG3 A;  3KD9 A;  2HQM A;  1YEY A;  4ZCC A;  3STP A;  4JQ9 A;  1PS9 A;  4K8D A;  3GYX A;  4J36 A;  3AE8 A;  4IL2 A;  2OQY A;  2AQJ A;  2VOU A;  2GAH B;  5KVH A;  3R25 A;  3TCS A;  1E1L A;  1E39 A;  3Q9T A;  2FBW A;  2WP9 A;  4GGB A;  4DNA A;  2YM1 A;  3UJF A;  3BNM A;  2JKC A;  1EL5 A;  2ZZB A;  3DFY A;  3UGV A;  1GOS A;  2FJB A;  3H4K A;  3S5S A;  3SN4 A;  5JCM A;  3UTH A;  1T3Q C;  2ZZ0 A;  4H4T A;  3NK1 X;  3CXB A;  3R0K A;  1B8S A;  2OQH A;  5DBJ A;  1GRA A;  3UXK A;  3H8I A;  4YKF A;  4EIQ A;  4JDR A;  2QA1 A;  2OX4 A;  3F8P A;  4IA6 A;  3VC5 A;  2C70 A;  3KKJ A;  3GWD A;  2YQU A;  2YG7 A;  1X31 B;  1M64 A;  2BK5 A;  3NVV B;  3KLJ A;  2RGJ A;  4JNQ A;  3ENL A;  2YG6 A;  3FG2 P;  2XVI A;  1H81 A;  4DXK A;  1CC2 A;  2OAL A;  4IVO B;  2GR3 A;  1PJ6 A;  5L46 A;  3EAN A;  3ZYX A;  3BHF A;  2W3S A;  4H7U A;  1WUE A;  2GR1 A;  2BAC A;  3CND A;  2XVE A;  1F3P A;  2WPF A;  4H4R A;  1N4V A;  1KKO A;  1OJT A;  1D7L A;  1PXC A;  3U9I A;  3P9U A;  2WS3 A;  1V59 A;  1BKH A;  5BRT A;  2X8H A;  5GSN A;  3R11 A;  1FO4 A;  4LA1 A;  4BK1 A;  4K22 A;  4CBQ A;  3M0O A;  1B4V A;  1XPQ A;  3D1C A;  4TM0 A;  2QDE A;  1SJD A;  3AED A;  4B67 A;  4J57 A;  4M0X A;  3AE5 A;  4BJZ A;  2YLT A;  3LZW A;  2AL1 A;  1FCD A;  2O9Z A;  1CF3 A;  3MSY A;  1NU5 A;  1FHU A;  5KMR A;  2AR8 A;  2IVE A;  3S61 A;  1FHV A;  1XDI A;  3FBS A;  4UDQ A;  4MJW A;  5FJP A;  3DJD A;  2WP5 A;  3D9X A;  4H4Q A;  4TM4 A;  4U8M A;  1S2Q A;  4NEV A;  1CJ4 A;  3UKH A;  4HCD A;  3V5C A;  4C3Y A;  4NTE A;  3FXG A;  3QTP A;  4N9X A;  3UKQ A;  3NRZ B;  1K0J A;  3UP4 A;  2OO6 A;  3ZLH A;  4FP1 A;  3ZDN A;  2ONE A;  1SEZ A;  2PP1 A;  3AE3 A;  3NYE A;  2I0Z A;  3DIP A;  4H4Y A;  1GRH A;  1ZDL A;  3NVY B;  2BS4 A;  2DKH A;  3UTG A;  4B66 A;  3TWA A;  4ENL A;  3VRA A;  1NAA A;  2X99 A;  4MKS A;  1GRE A;  2XH7 A;  3CN8 A;  3ES8 A;  4IT1 A;  1D4C A;  4BJY A;  2JBV A;  4EQR A;  4LU6 A;  4ZCD A;  1FL2 A;  1P2H A;  4OVI A;  3BHK A;  4JN7 A;  4H4Z A;  4MGG A;  5EB4 A;  3K1G A;  1PDZ A;  3L5O A;  3ICS A;  2C75 A;  1L9E A;  1CC4 A;  1TDN A;  3EPT A;  1TDK A;  3C4N A;  3P93 A;  3HRD C;  3NGC X;  1JRO A;  4AT2 A;  2WOV A;  4OPI A;  3GDP A;  3CGE A;  2R46 A;  2R4J A;  3N6J A;  4OPL A;  2X3N A;  3SQS A;  4J1O A;  2OPJ A;  1S7M A;  1DJQ A;  3DDM A;  1ZP0 A;  2A87 A;  3UKF A;  1FEB A;  3B3R A;  3UOZ A;  2VQB A;  3HYX A;  1NEK A;  2C73 A;  5U25 A;  1LV0 A;  1GES A;  3SFE A;  1SB3 B;  4GYP A;  2Q0K A;  1N62 C;  2PS2 A;  2W0H A;  3BI4 A;  1D5T A;  2QCU A;  3SN0 A;  2WBA A;  1Q1R A;  2GGE A;  2RDX A;  5KNL A;  1JEH A;  2AL2 A;  2XLS A;  1GV4 A;  1H84 A;  2X50 A;  4U8O A;  4U2S A;  3UKK A;  3KA7 A;  3A7R A;  4Z25 A;  4X9M A;  2Q7V A;  3CT2 A;  4EM3 A;  2B9Y A;  3V5F A;  3NXL A;  4NZH A;  4MMW A;  4YTM A;  4I59 A;  4IP4 A;  5BVA A;  4E4F A;  3QFB A;  1Q1W A;  4GIS A;  3WE0 A;  5KRQ A;  3LB8 A;  4U8K A;  2PYX A;  1FOH A;  2ZBW A;  1VG9 A;  4H2H A;  3G5S A;  4HCL A;  1RVK A;  2OLA A;  3DME A;  2EQ8 A;  1F6M A;  2UZZ A;  3UTF A;  5KXJ A;  3VRD B;  1JRX A;  2OA1 A;  3B6D A;  1CHU A;  4OPC A;  3U4F A;  1IUV A;  3EKG A;  3MY9 A;  1PDH A;  2OFJ A;  3GMC A;  2WU2 A;  3DG7 A;  2C65 A;  3TJI A;  3OPS A;  3P3B A;  3R07 C;  1MRA A;  4EQS A;  2DKI A;  3M13 A;  3T6C A;  3DJJ A;  1PXB A;  2Z5X A;  4BV6 A;  2R4E A;  1PHH A;  4YSX A;  2YVF A;  1EL9 A;  4DHG A;  1TDO A;  3DG6 A;  1N5X A;  2W54 A;  3RIT A;  5U63 A;  2CDU A;  4H4S A;  1JCT A;  3AM9 A;  1DJN A;  1D7Y A;  2V3B A;  2BS3 A;  2OVL A;  4GRT A;  2IVD A;  2PA6 A;  2C66 A;  2X8C A;  3C4A A;  3E1T A;  5JCK A;  2B9X A;  2YR4 A;  1H2I A;  4A6N B;  5BOF A;  1MOK A;  3OZY A;  1MDR A;  4K1W A;  3NYC A;  6ENL A;  3CPI G;  3SR6 B;  3V3O A;  3NZG A;  2QJJ A;  2BC1 A;  1COY A;  1W4X A;  3KPF A;  1SJB A;  4KWS A;  4UDP A;  4GAV A;  3ISH A;  1JPD X;  1GXF A;  2QJM A;  2HZG A;  1LJ1 A;  2XFQ A;  2OZ3 A;  4A99 A;  4G73 A;  4J34 A;  4Z2R A;  4GDE A;  5HYM A;  2WPC A;  3II4 A;  4XXG A;  3S5W A;  1CC6 A;  4AOS A;  1ELS A;  1IJH A;  4U2L A;  2EQ6 A;  4JY2 A;  4GIR A;  2GRT A;  4A65 A;  3I6E A;  1Q9I A;  3OTR A;  1GTE A;  1H82 A;  3CNP A;  1F8S A;  3R1Z A;  1NHR A;  2V3A A;  4EMJ A;  4K5R A;  1EBD A;  1CJ2 A;  1S3B A;  1CL0 A;  2BA9 A;  4NWZ A;  2H89 A;  4Z1Y A;  3LJP A;  1DXL A;  4DYE A;  1E1K A;  1DOB A;  2TMD A;  2A89 A;  3DJG X;  1X2H A;  3FCP A;  3NFU A;  5G5H B;  3GYJ A;  1RSG A;  3AEB A;  3TW9 A;  4OPT A;  4KT2 A;  5EB5 A;  3T14 A;  1NHP A;  2PTW A;  1KSS A;  2CVJ A;  3OW1 A;  2Y6Q A;  4U8J A;  3DK8 A;  1PJ7 A;  2YLX A;  3UOX A;  4C77 A;  2YWL A;  2YLS A;  3B97 A;  4K8G A;  1N4W A;  3ZVH A;  5KVI A;  3T4W A;  4CRT A;  3NVW B;  3JVA A;  2VZ2 A;  1DOD A;  2VRL A;  4GF7 A;  4B65 A;  3QLD A;  2E3T A;  4G74 A;  3SJN A;  3UTE A;  4CNK A;  4O5U A;  3SGL A;  4JN8 A;  3P4S A;  2F5Z A;  5HXI A;  4XWR A;  2PHH A;  3CPH G;  1JNR A;  1R0M A;  4BK3 A;  5KOX A;  3SX6 A;  5JRB A;  4BUR A;  5FJU A;  3GD4 A;  1LQU A;  3RP7 A;  3DGB A;  1LTX R;  3FMW A;  1GTH A;  2WP6 A;  4DSH A;  1PDY A;  2GGG A;  3GY1 A;  2XSX A;  5BUL A;  1VQZ A;  5CKU A;  1E1N A;  1FEC A;  2XFN A;  3EEZ A;  2QVH A;  1IYX A;  1BZL A;  1JRP A;  4CCR A;  1NDA A;  2O56 A;  1N61 C;  2FJD A;  3FV9 A;  4EM4 A;  3SBF A;  2YG5 A;  5HHF A;  5EU9 A;  3EAO A;  2RGH A;  3RO6 A;  2J3N A;  3DES A;  2OAM A;  4IV9 A;  3AEE A;  3AEA A;  3BNU A;  2HXU A;  4Z24 A;  3VQR A;  1D4D A;  1IUU A;  2GGJ A;  4REK A;  1E9I A;  4E8G A;  2XYO A;  3F8D A;  1KD0 A;  4Z44 A;  4NEW A;  1ECQ A;  2C64 A;  2CFY A;  3H7V A;  5FJO A;  1YY5 A;  1X2G A;  3AE1 A;  4H2Q A;  3MUC A;  2E1M A;  2WQY A;  1N4U A;  4Z2U A;  1N60 C;  4GUV A;  1K0L A;  1XAN A;  3AD9 B;  2TPR A;  2ZC8 A;  3RHA A;  1E7P A;  4C5O A;  3RP8 A;  3KVE A;  4UDR A;  4H1Z A;  2JB2 A;  3SQP A;  2V61 A;  3TWB A;  2GGI A;  4B69 A;  3AEF A;  4KEM A;  3CGB A;  3NN6 X;  3IJI A;  1NPX A;  2CHR A;  2YR6 A;  4H19 A;  3K7Q X;  1F8W A;  1WYG A;  1AOG A;  3IK4 A;  3UCL A;  3CK5 A;  3KPK A;  4G9K A;  1L0V A;  4KPL A;  3H8L A;  5BOE A;  1BGJ A;  4GAP A;  3CB3 A;  1EC9 A;  3H8A A;  3UP5 A;  4ROP A;  3LAD A;  3AE2 A;  3FIM B;  5G5G B;  5JCI A;  2WEU A;  4C3X A;  2XVJ A;  2PPG A;  1H83 A;  3VFC A;  3JZU A;  2DW6 A;  4YSZ A;  1SJC A;  3BJS A;  3COX A; 
#chains in the Genus database with same CATH homology
 3OC4 A;  4EMI A;  3NNE A;  3T2Z A;  4EM3 A;  2B9Y A;  1Y0P A;  3VRB A;  4A79 A;  3CIR A;  4M52 A;  4NZH A;  5EBK A;  1KFY A;  2FJE A;  2XLU A;  2YLW A;  3DH9 A;  4I59 A;  4RG4 A;  4YTM A;  5BVA A;  4Y4M A;  1ZY8 A;  3QFB A;  1PXA A;  1L9D A;  4I58 A;  3NG7 X;  3GD3 A;  1Q1W A;  2GMJ A;  2GVC A;  3HZL A;  4H4U A;  1ZOV A;  2C3C A;  3DGZ A;  2XCG A;  3WE0 A;  2B76 A;  5CQF A;  4FX9 A;  1PBE A;  3I3L A;  3LB8 A;  3P1W A;  2BXS A;  4U8K A;  4GDP A;  2PYX A;  4YSY A;  5KWF A;  2A8X A;  1FOH A;  1CJC A;  1GT8 A;  2ZBW A;  1IUT A;  3CMM A;  1VG9 A;  1DOC A;  1K0I A;  4JY3 A;  4O5Q A;  2BC0 A;  3RNM A;  1O95 A;  2VVL G;  1GRF A;  3G5S A;  3QVP A;  1ZMD A;  3DME A;  2CUL A;  2EQ8 A;  1F6M A;  1VDC A;  2R0G A;  4UP3 A;  2UZZ A;  3AEC A;  4Z2T A;  1REO A;  1VG0 A;  1PBF A;  3UTF A;  1LVL A;  1L9C A;  5KXJ A;  2BS2 A;  4YSH A;  3VRD B;  1JRX A;  2OA1 A;  5IPY A;  1ZKQ A;  2BK4 A;  3IC9 A;  3Q6J A;  4AP3 A;  3K30 A;  2QAE A;  3AD8 B;  2YLZ A;  3CGC A;  3B6D A;  1CHU A;  4OPC A;  4LII A;  2Q6U A;  3GDN A;  2E4G A;  4CY6 A;  3UKA A;  1ZOY A;  1NEN A;  3CNJ A;  1IUV A;  3LZX A;  4OPD A;  3HYW A;  2EQ7 A;  1PDH A;  2BCP A;  2XLP A;  3SY4 A;  3GMC A;  2GQW A;  2VVM A;  3G5Q A;  3GMB A;  1ELI A;  3L1R A;  3EF6 A;  1GND A;  2GAG B;  2WU2 A;  3K7T A;  1DOE A;  2C65 A;  3NTA A;  4WX1 A;  3KD9 A;  2X8G A;  4AP1 A;  3QSE A;  3IF9 A;  4NTD A;  3AD7 B;  2HQM A;  2VRM A;  4II2 A;  4ZCC A;  2IID A;  3CPJ G;  4EQS A;  5GRT A;  5C2T A;  4JQ9 A;  2AAQ A;  1PS9 A;  2GEW A;  4YKG A;  2XLT A;  4K8D A;  2DKI A;  3M13 A;  3GYX A;  1TDF A;  4J36 A;  3IWA A;  3DJJ A;  4CNJ A;  4KPR A;  1GEU A;  1PXB A;  2C4C A;  2JAE A;  3AE8 A;  2Z5X A;  3DA1 A;  1KNR A;  4BV6 A;  2AQJ A;  2BRA A;  3NIX A;  4WCT A;  2VOU A;  2R4E A;  1PHH A;  3NLC A;  2GAH B;  2GMH A;  4YSX A;  2FJA A;  5KVH A;  1N1P A;  2YVF A;  2RGO A;  1EL9 A;  1E1L A;  1E39 A;  4U8L A;  1IUX A;  1S3E A;  3Q9T A;  2FBW A;  4K2X A;  1TDO A;  1VRQ B;  2JB1 A;  2WP9 A;  1YQ3 A;  5KRQ A;  4DNA A;  3AWI A;  3LOV A;  1YQ4 A;  2YM1 A;  3AE4 A;  3BNM A;  2JKC A;  1EL5 A;  5U63 A;  2CDU A;  2ZZB A;  4H4S A;  4U2T A;  1DJN A;  1D7Y A;  2GB0 A;  1OJC A;  2V3B A;  2BS3 A;  1GOS A;  2FJB A;  3ALJ A;  3H4K A;  4GRT A;  5JCM A;  3UTH A;  2ZZ0 A;  4H4T A;  2IVD A;  3NK1 X;  2C66 A;  2X8C A;  3C4A A;  3E1T A;  2XVH A;  1B8S A;  5JCK A;  2YLR A;  2B9X A;  2YR4 A;  1H2I A;  3AXB A;  4A6N B;  3NYC A;  1MOK A;  5DBJ A;  1JRZ A;  4EQW A;  2C72 A;  1PBD A;  2ACZ A;  3SZC A;  1MO9 A;  2WET A;  1GRA A;  3V3N A;  3CPI G;  3V3O A;  3H8I A;  1DNC A;  3PVC A;  2BC1 A;  4PAB A;  1COY A;  4YKF A;  4EIQ A;  1FEA A;  1W4X A;  3KPF A;  3DK4 A;  4G6G A;  4JDR A;  4H4V A;  2QA1 A;  3QVR A;  4UDP A;  2V60 A;  4BK2 A;  2BRY A;  1KDG A;  3SZW A;  4J2W A;  4GAV A;  3ISH A;  3RED A;  1GRG A;  3F8P A;  4IA6 A;  3SZ0 A;  4USR A;  1GXF A;  1GAL A;  4A6N A;  2WOI A;  2JB3 A;  4D03 A;  4H2P A;  4C74 A;  2C70 A;  1LJ1 A;  3GWD A;  3KKJ A;  2YQU A;  2YG7 A;  2XFQ A;  4A99 A;  1X31 B;  4G73 A;  1M64 A;  2GV8 A;  4J34 A;  4GDE A;  2BK5 A;  4Z2R A;  5HYM A;  2WPC A;  3II4 A;  4X9N A;  3GRS A;  3KLJ A;  2APG A;  2RGJ A;  4JNQ A;  4XXG A;  4A9W A;  3S5W A;  3O0H A;  3JSK A;  1KN0 A;  2YG6 A;  3FG2 P;  4OCG A;  2C67 A;  3IHG A;  2XVI A;  1CC6 A;  2B7S A;  4AOS A;  1TYP A;  5FS9 A;  3T31 A;  4YTN A;  3DGH A;  1H81 A;  2OAL A;  1CC2 A;  4IVO B;  3UKL A;  4EQX A;  2GR3 A;  1PJ6 A;  5L46 A;  1P2E A;  1IJH A;  4U2L A;  3EAN A;  2EQ6 A;  4JY2 A;  3ZYX A;  2YG4 A;  3BHF A;  4A5L A;  2GRT A;  4A65 A;  3AYI A;  3AB1 A;  1Q9I A;  4H7U A;  2R0P A;  2C3D A;  3SM8 A;  1GTE A;  1RYI A;  4HB9 A;  2GR1 A;  2BAC A;  2WOW A;  1Y56 B;  3CND A;  1H82 A;  3CNP A;  4B63 A;  1ZK7 A;  3QJ4 A;  1F8S A;  3AYJ A;  1NHR A;  2BAB A;  2XVE A;  1D4E A;  3P4R A;  2V3A A;  4EMJ A;  4K5R A;  1BWC A;  2JK6 A;  1K4Q A;  1EBD A;  1F3P A;  1CJ2 A;  1S3B A;  1GRT A;  2YAU A;  1CL0 A;  2BA9 A;  2BK3 A;  3KU9 A;  4GCM A;  2WPF A;  5FS6 A;  4NWZ A;  2H89 A;  3ATQ A;  4H4R A;  1UKV G;  4FK1 C;  1N4V A;  3BI5 A;  3LJP A;  3P4P A;  1OJT A;  1QLB A;  1DXL A;  1D7L A;  1IUW A;  5J60 A;  1PXC A;  1E1K A;  1DOB A;  2TMD A;  5IQ1 A;  2A89 A;  3DJG X;  3P9U A;  4U8I A;  4YXD A;  2WS3 A;  1V59 A;  3SZF A;  4E0V A;  5BRT A;  2X8H A;  3GYJ A;  5GSN A;  1RSG A;  3AEB A;  1VQW A;  4G6H A;  4OPT A;  3C96 A;  5EB5 A;  3T14 A;  4LA1 A;  1OJD A;  5KMQ A;  4BK1 A;  1NHP A;  1KSS A;  1EL8 A;  2GF3 A;  4K22 A;  4CBQ A;  2XFO A;  3M0O A;  3AEG A;  2CVJ A;  2GQF A;  5KMP A;  2Y6Q A;  4U8J A;  5KOW A;  3GWF A;  3NH3 X;  4DSG A;  3DK8 A;  1B4V A;  2ARD A;  1XPQ A;  1PJ7 A;  2YLX A;  3D1C A;  4TM0 A;  3UOX A;  4C77 A;  2Y6R A;  3AED A;  2YWL A;  2YLS A;  4B67 A;  4Z43 A;  4J57 A;  1N4W A;  3AE5 A;  4BJZ A;  4TLX A;  5KVI A;  3BI2 A;  2H88 A;  2YLT A;  1ZMC A;  3LZW A;  3SYI A;  4CRT A;  1FCD A;  1HYU A;  2O9Z A;  4Y4L A;  5JCL A;  3K7M X;  4CCQ A;  1CF3 A;  1NHQ A;  3DJE A;  3UKP A;  2VZ2 A;  1O5W A;  3NTD A;  1DOD A;  4JNA A;  4AOX A;  1YKJ A;  2VRL A;  4GF7 A;  4B65 A;  3QSM A;  2EQ9 A;  5BUK A;  5KMR A;  4G74 A;  4U8N A;  2AR8 A;  2IVE A;  3UTE A;  4J56 A;  4YTP A;  5TR3 A;  2XVF A;  2NPX A;  1KF6 A;  3S61 A;  2C76 A;  3V76 A;  4CNK A;  4O5U A;  3SGL A;  1XDI A;  2WDQ A;  2XFP A;  3FBS A;  3P4S A;  2F5Z A;  4MJW A;  4UDQ A;  5HXI A;  1YQZ A;  1Z6L A;  1Y56 A;  2QA2 A;  4XWR A;  3DJD A;  2WP5 A;  2PHH A;  3CPH G;  1JNR A;  3QFA A;  3HYV A;  4RG3 A;  3D9X A;  4Y4N A;  4BK3 A;  5KOX A;  3SX6 A;  4H4Q A;  5JRB A;  2WDR A;  4RSL A;  3ICT A;  4TM4 A;  4U8M A;  3G5R A;  4BUR A;  3GD4 A;  2C7G A;  4K7Z A;  1LQU A;  3RP7 A;  5J7X A;  3UOY A;  3OZ2 A;  1S2Q A;  1LTX R;  1KSU A;  4NEV A;  3FMW A;  1JOA A;  1CJ4 A;  1JNZ A;  1GTH A;  2VQ7 A;  2WHD A;  4FDC B;  3IHM A;  2WP6 A;  3UKH A;  4DSH A;  1O94 A;  4C3Y A;  5BUL A;  2V6O A;  4NTE A;  4N9X A;  5CKU A;  3T2Y A;  3NK0 X;  1E1N A;  3UKQ A;  1FEC A;  1B37 A;  5C3J A;  1K0J A;  1TDE A;  3UP4 A;  2XFN A;  4P9S A;  3NHO X;  1BZL A;  4CCR A;  1ZX9 A;  3ZDN A;  4ICY A;  1NDA A;  2R9Z A;  5JCN A;  1QJD A;  1SEZ A;  1RP0 A;  3AE3 A;  3NYE A;  2FJD A;  2I0Z A;  2NVK X;  5FS8 A;  5U1O A;  3AE7 A;  3T37 A;  1CJ3 A;  4TM3 A;  4H4Y A;  1GRH A;  4JN9 A;  1ZDL A;  4EM4 A;  1PBC A;  3QSS A;  2Q0L A;  2XLR A;  2XFU A;  2YG5 A;  5KMS A;  4ADW A;  1NG4 A;  1NG3 A;  2BS4 A;  3LXD A;  2DKH A;  5HHF A;  1H6V A;  3UTG A;  3VR8 A;  3CTY A;  4B66 A;  4EIP A;  3EAO A;  2RGH A;  4B64 A;  4KX6 A;  4GR1 A;  1JU2 A;  3VRA A;  1NAA A;  4X4J A;  2J3N A;  2X99 A;  1IUS A;  2OAM A;  2BXR A;  4IV9 A;  4AT0 A;  3AEE A;  2RAB A;  4H2N A;  1GRE A;  3CN8 A;  1JRY A;  3AEA A;  5FMH A;  3BNU A;  4Z24 A;  3VQR A;  1D4D A;  3GYI A;  4OPG A;  3ABV A;  3NT6 A;  2GR0 A;  1IUU A;  2ZZC A;  2E5V A;  4ZN0 A;  4FK1 A;  1D4C A;  4BJY A;  4REK A;  2JBV A;  2XYO A;  3F8D A;  2OLN A;  2Z5Y A;  4H4P A;  4EQR A;  4Z44 A;  3CNT A;  3NRN A;  2WES A;  4LU6 A;  2XDO A;  3T0K A;  4ZCD A;  3AE6 A;  1TRB A;  4NEW A;  1FL2 A;  2BCG G;  2WDV A;  1P2H A;  4K5S A;  4NTC A;  2C64 A;  2CFY A;  4Z26 A;  4OVI A;  3BHK A;  1YY5 A;  3AE1 A;  4H2Q A;  4H4Z A;  2YVJ A;  2B9W A;  2E1M A;  1GER A;  3GRT A;  1H7X A;  5EB4 A;  3CGD A;  3L5O A;  3CNS A;  3ICS A;  1EL7 A;  2WQY A;  3UOV A;  3PG6 A;  4DGK A;  2OLO A;  2YG3 A;  4APN A;  1CBO A;  2C75 A;  5HY5 A;  1L9E A;  1N4U A;  1XHC A;  1MXT A;  1CC4 A;  3NK2 X;  1TYT A;  4TLZ A;  1TDN A;  3EPT A;  3ITJ A;  3NN0 X;  4H2R A;  3URH A;  4Z2U A;  5LV9 A;  2YVG A;  3NYF A;  1TDK A;  3C4N A;  4GUV A;  2V5Z A;  1K0L A;  3NGC X;  1XAN A;  4H4X A;  3AD9 B;  5ER0 A;  4NNJ A;  5M0Z A;  4J33 A;  4AT2 A;  1LQT A;  3RP6 A;  2TPR A;  3RHA A;  1E7P A;  4HA6 A;  1PBB A;  2WOV A;  3L8K A;  4OPI A;  3AYL A;  2B7R A;  3GDP A;  3RP8 A;  3KVE A;  3SFD A;  4C5O A;  4PAA A;  3CGE A;  4UDR A;  3P4Q A;  4U8P A;  2R46 A;  2JB2 A;  3SQP A;  2R4J A;  4OPL A;  2BYB A;  2V61 A;  3PO7 A;  2X3N A;  4IVM B;  3AE9 A;  5FS7 A;  2YM2 A;  3AEF A;  4B69 A;  2GR2 A;  4J31 A;  4EMW A;  1H86 A;  3CGB A;  4B68 A;  3I6D A;  1KNP A;  3NN6 X;  1S7M A;  1DJQ A;  1NPX A;  4B1B A;  5M10 A;  1E1M A;  2YR6 A;  2WPE A;  2GH5 A;  1ZP0 A;  3ALM A;  3K7Q X;  2A87 A;  3F8R A;  3M12 A;  3UKF A;  1FEB A;  3SXI A;  3B3R A;  1B5Q A;  3R9U A;  1F8W A;  4OPU A;  3UOZ A;  2R45 A;  3ALL A;  1GPE A;  1H7W A;  1AOG A;  1BF3 A;  2VQB A;  3UCL A;  3KPK A;  3HYX A;  1NEK A;  4IA5 A;  2C73 A;  3FPZ A;  4G9K A;  1GSN A;  5U25 A;  3NKS A;  1LV0 A;  4D04 A;  1L0V A;  1GES A;  2YR5 A;  1PN0 A;  3SFE A;  4H4W A;  1NHS A;  2VVL A;  3H8L A;  1BGJ A;  2Q0K A;  4CY8 A;  4GAP A;  3ICR A;  1GRB A;  3ATR A;  3VR9 A;  4XWZ A;  2W0H A;  3BI4 A;  1D5T A;  2QCU A;  1S2Y A;  1M6I A;  4USQ A;  3UP5 A;  2WBA A;  3LAD A;  1Q1R A;  3AE2 A;  5KNL A;  1JEH A;  5JCI A;  3FIM B;  2WEU A;  5IQ4 A;  4C3X A;  1BKW A;  3DK9 A;  2XVJ A;  1GET A;  1PJ5 A;  2WU5 A;  3PS9 A;  2R0C A;  1ONF A;  3GSI A;  1OJA A;  2XLS A;  1GV4 A;  1H83 A;  1H84 A;  4ECH A;  2X50 A;  4U8O A;  4A7A A;  4U2S A;  4H50 A;  1LPF A;  3KA7 A;  4TM1 A;  3UKK A;  3ADA B;  3T2K A;  1BGN A;  4YSZ A;  1F8R A;  4Z25 A;  1E6E A;  5EOW A;  4YT0 A;  1OJ9 A;  1QO8 A;  3D8X A;  4II3 A;  4X9M A;  3COX A;  4YWO A;  2Q7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...