1M6IA

Crystal structure of apoptosis inducing factor (aif)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
481
structure length
459
Chain Sequence
APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA binding is required for the apoptogenic action of apoptosis inducing factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Programmed cell death protein 8
total genus 144
structure length 459
sequence length 481
ec nomenclature
pdb deposition date 2002-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1m6iA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1m6iA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1m6iA01
3UOVA 3DH9A 3AYIA 1CJ4A 4YT0A 4B64A 5EBKA 4USRA 4LIIA 2YLRA 4YSZA 2B76A 2XVEA 3AXBA 5TR3A 3NGCX 4U8NA 3OZ2A 3AEEA 1HYUA 1CC2A 2X8CA 1H81A 1Z6LA 4X9NA 3P4RA 3UCLA 3UTHA 1Y0PA 3LADA 2WS3A 1NPXA 2FJAA 1VG0A 2OLNA 4U8MA 4DSHA 1Q1WA 3VR9A 3R9UA 2GEWA 2AQJA 1VQWA 4DSGA 1BWCA 3VQRA 4XWZA 2CDUA 3AEDA 2GF3A 2W0HA 2R4JA 2JKCA 2WDRA 3GWFA 4OCGA 3NG7X 1CBOA 5KVIA 3AEBA 4FDCB 1LQTA 1LTXR 3DK9A 4RG3A 4IA5A 4CY8A 2FJEA 4EM3A 4EIQA 2BCPA 1BZLA 4GR1A 1ZOYA 5BVAA 3B6DA 2C7GA 2YVGA 2GQFA 4N9XA 2YVFA 2R0GA 3UOXA 3AEFA 2RABA 1PS9A 4U8OA 4C77A 4CY6A 2NVKX 2V6OA 1GETA 3GDNA 1D4CA 5IQ4A 1D7LA 3UKQA 4D04A 5KOWA 2XLSA 2Q7VA 2BK4A 2VQ7A 5U63A 2XLRA 4H4VA 3RHAA 4J36A 3AE4A 3ATRA 4A65A 2WPFA 5L46A 2PYXA 4DGKA 4E0VA 3NLCA 4NEVA 1F6MA 3L8KA 2YQUA 3CIRA 2BABA 4J57A 3KU9A 4EQXA 2RGJA 3AWIA 3ALJA 5KOXA 1XDIA 3RP8A 4CCQA 2WOIA 5FS9A 2YR6A 4Z24A 1XPQA 3RP7A 4CNKA 5EB5A 1IUSA 3REDA 4X4JA 1PDHA 1SEZA 1L9EA 1S2QA 3ZYXA 5HYMA 3P1WA 2WPCA 3GD3A 1H7XA 4U8LA 1N1PA 1ZDLA 4YTPA 1IUUA 3LZWA 3G5SA 4JY3A 1CHUA 3BI2A 2XFUA 1JRZA 2BXSA 3F8PA 1N4VA 1KF6A 1DXLA 1DJQA 3P9UA 4REKA 2GAHB 3IHMA 1FL2A 4LA1A 4CCRA 1YKJA 4H4TA 4U2LA 1E6EA 4AP1A 3GRSA 5JCLA 1N4UA 2QA1A 3LOVA 3H8IA 2YG6A 1GEUA 5KXJA 2WHDA 4NEWA 4H4WA 1EL5A 4IVMB 4Z2TA 3M12A 1IJHA 2RGOA 5HHFA 3V3NA 3KD9A 4K5RA 2R0PA 1MO9A 2E4GA 3M13A 4PAAA 4Z2UA 1Y56B 4K22A 1K0JA 3AD8B 3WE0A 1JNZA 4B63A 1FOHA 4B68A 1TYPA 1CJCA 3QSSA 2BACA 3KA7A 1GTEA 2DKHA 2XFNA 4TM0A 3UKLA 2BK3A 2Q6UA 3AB1A 1FECA 2WDQA 4J56A 4YWOA 4YSXA 2GV8A 3K7MX 4GF7A 1GOSA 5BRTA 1O5WA 4JDRA 3DJJA 1BF3A 1E1LA 4U8KA 4A99A 4GCMA 3D1CA 2FJDA 2YWLA 4WCTA 2V3BA 2ZZ0A 4HA6A 2B7RA 3DA1A 3GYIA 5J7XA 2PHHA 2VZ2A 1KFYA 1GALA 4BJZA 5GSNA 4ECHA 3FPZA 2C3CA 2YG4A 1H84A 2GAGB 3Q9TA 2WETA 4XXGA 1NHPA 2QA2A 2C3DA 4BK1A 4Z43A 3BHFA 4C3XA 3UKFA 1B5QA 1S2YA 3C4NA 1JRYA 3H4KA 3O0HA 1PJ5A 2C73A 2V60A 1KNPA 3B3RA 2JB1A 2UZZA 2BXRA 3BNUA 2R4EA 4A79A 5FS8A 2C65A 2R9ZA 1LVLA 3FMWA 3AE9A 3SQPA 4Z25A 1VG9A 2RGHA 1E1NA 4O5QA 4B1BA 3OC4A 4EMJA 4YTMA 1PBCA 2YR5A 3KKJA 1ELIA 2VRLA 3KVEA 4H4RA 4XWRA 3IC9A 2XYOA 2BA9A 2R0CA 1YQ4A 2YG7A 4U8PA 4Z26A 1GREA 4Y4MA 4BJYA 3LB8A 3UOZA 2X99A 4OPDA 3FG2P 2ACZA 2GMJA 2C76A 2Q0LA 1ONFA 1M64A 1F3PA 4O5UA 4BK3A 4GDEA 3CNTA 2OLOA 2YVJA 1LPFA 1TDOA 2CULA 3CN8A 5JCIA 3AE3A 4H2RA 4A5LA 2TMDA 5C3JA 3UTFA 4I58A 2WPEA 4ICYA 4TM3A 2C70A 1OJCA 3IWAA 2QCUA 3ICRA 3NNEA 2AAQA 4NTCA 1L0VA 4PABA 1Q9IA 1E7PA 2CFYA 1NG3A 2B7SA 3FBSA 4K2XA 5JCMA 4OPTA 2YG3A 2WESA 1F8WA 3BI5A 1M6IA 1PXCA 5CQFA 1CJ2A 1BGNA 2Z5XA 3NYFA 3DGZA 1YQZA 4Y4NA 1OJDA 2HQMA 4C3YA 2Z5YA 3PVCA 2FJBA 3K7QX 1S3BA 4OPIA 2B9WA 1OJTA 5U1OA 1DOEA 2YLWA 2BCGG 5IQ1A 2YAUA 3CPHG 3NK0X 1OJ9A 1X31B 2FBWA 3AD7B 4UDQA 4A9WA 4C5OA 2YLSA 1DODA 3CPJG 1GRFA 1H7WA 3UKPA 4K7ZA 2XDOA 4EIPA 3VRBA 3AE1A 2F5ZA 3ICTA 1GSNA 2ZBWA 2X50A 1BGJA 3M0OA 3I6DA 4A7AA 1D4EA 2BS2A 4AT2A 3QSEA 3NHOX 3ABVA 3NRNA 4NZHA 3V76A 4YSHA 2BS3A 2Q0KA 3AD9B 4AOXA 3EAOA 5J60A 4TLZA 1TDNA 2R46A 2ARDA 2YLXA 1TDFA 2XVHA 2CVJA 4TM1A 4X9MA 3DJEA 4EM4A 2VVMA 1RSGA 1FEAA 3EPTA 1QO8A 1K0IA 5JCKA 3AE6A 1GRAA 4KPRA 5FS6A 2I0ZA 2JK6A 1XHCA 4H7UA 1IUTA 3QSMA 1P2HA 2EQ6A 3EF6A 4IA6A 1YY5A 2GR1A 4CBQA 1GRTA 2YR4A 1O95A 2XVIA 3LXDA 2WP6A 1K4QA 1QLBA 4RSLA 3VRAA 4C74A 2BYBA 1GRGA 2WP5A 3SFDA 1EBDA 2B9XA 1GERA 4YTNA 4D03A 3UOYA 2BC0A 4KX6A 1L9DA 1PN0A 4ZCCA 2GVCA 3DJGX 1ZKQA 1L9CA 3IF9A 4A6NB 3PS9A 1B4VA 1GNDA 1NEKA 1GRBA 2ZZCA 2XFQA 3GMCA 3IHGA 1D4DA 4UDRA 3QFAA 2Y6RA 2XFPA 2WP9A 2IVDA 3C4AA 2DKIA 1TRBA 5IPYA 1KNRA 1VDCA 1PBDA 1LQUA 5FS7A 4OPGA 4IV9A 4YXDA 1GV4A 1IUXA 3F8RA 4EMWA 1GT8A 1ZP0A 2YLZA 3K30A 3PO7A 2C66A 2C72A 2YM1A 3EANA 4H4ZA 3L1RA 1CC6A 1PBFA 3VR8A 2A8XA 2WEUA 1OJAA 2XVJA 2XFOA 3AEAA 5DBJA 3AE2A 3HZLA 1FEBA 3ALLA 3SFEA 5HXIA 1F8SA 5KWFA 4H4UA 3SM8A 1ZOVA 3BI4A 3NKSA 2E1MA 3I3LA 2X3NA 3S5WA 4H4SA 2GMHA 3P4QA 5C2TA 5KRQA 1PXBA 2XVFA 5EB4A 3DK4A 3F8DA 2WOWA 1CC4A 2WBAA 1TDEA 4FK1A 2GR2A 1B37A 1UKVG 3LJPA 4NTEA 3CNSA 1COYA 3AE8A 1O94A 4EQWA 3NN0X 1VRQB 2C64A 3RP6A 4H4YA 2JAEA 2YM2A 1ZMDA 4H4PA 1DNCA 1D5TA 2JB3A 1REOA 1CJ3A 1PHHA 2B9YA 2WU5A 1H86A 1YQ3A 4FK1C 4ADWA 2WQYA 3ISHA 5KVHA 1RYIA 2V5ZA 3COXA 1JEHA 4EQSA 4GRTA 1JOAA 3NN6X 4RG4A 3CNJA 2XLPA 5HY5A 1E1KA 1RP0A 1IUWA 4AT0A 4UP3A 2VRMA 3ADAB 5M10A 2A87A 3C96A 4YKFA 4B69A 3CNDA 3NTAA 2H88A 3DMEA 3ZDNA 1CF3A 2GR0A 1QJDA 3LZXA 1NENA 3CGCA 3FIMB 5EOWA 1E39A 1EL7A 3ATQA 5ER0A 4B66A 1AOGA 2GB0A 1K0LA 3UKKA 4WX1A 5BULA 1D7YA 2IVEA 3G5QA 3H8LA 4JNAA 2GRTA 4U2SA 1MOKA 4USQA 4YKGA 2Y6QA 1NHRA 1NAAA 4TM4A 3GRTA 3AE7A 2OAMA 3AYJA 1PJ6A 2YG5A 3QFBA 4H4QA 2C67A 3ICSA 2V61A 4GDPA 4EMIA 1EL9A 1TYTA 1EL8A 3CTYA 4OPLA 4AP3A 4H2PA 3GSIA 4CRTA 1P2EA 2AR8A 3UKAA 4J31A 2C75A 4M52A 4J33A 1PJ7A 3DGHA 4IVOB 2EQ8A 2X8HA 4Z2RA 3AE5A 4A6NA 3CGBA 1KSSA 2A89A 4I59A 3GWDA 3NK2X 2VVLA 3CGDA 1GXFA 4H2QA 4YSYA 4FX9A 2QAEA 3CGEA 2VQBA 3DJDA 1PBEA 4JN9A 4OVIA 3NYEA 4U2TA 3NT6A 1H6VA 1NHSA 1ZK7A 4H4XA 1N4WA 2BK5A 4P9SA 3KLJA 2NPXA 3CNPA 3D8XA 1JU2A 1MXTA 1DOCA 1PXAA 3V3OA 2WDVA 4LU6A 3AYLA 4DNAA 2WOVA 5FMHA 3P4PA 1ZY8A 3UKHA 2GQWA 1B8SA 4ZCDA 3AEGA 3K7TA 4OPUA 2O9ZA 4K8DA 1KDGA 4BK2A 5JCNA 3NTDA 4BURA 4APNA 4UDPA 5M0ZA 5CKUA 5GRTA 2GR3A 2BC1A 2R45A 3NK1X 3SGLA 2ZZBA 4MJWA 3UP4A 2OALA 3G5RA 1XANA 2J3NA 1DOBA 2IIDA 3NH3X 1S3EA 2XLTA 1F8RA 4HB9A 1H82A 3UTGA 3GD4A 2VVLG 4JNQA 3DK8A 1E1MA 2APGA 1IUVA 1GTHA 2WU2A 2JBVA 3KPFA 4CNJA 3ALMA 1LV0A 5U25A 4B65A 3II4A 1JRXA 3T37A 4Y4LA 1JNRA 5BUKA 3E1TA 1W4XA 3GMBA 1Q1RA 2GH5A 1ZX9A 3CPIG 3S61A 4GUVA 2TPRA 3UTEA 5LV9A 4JQ9A 1DJNA 1NG4A 4JY2A 1LJ1A 2VOUA 3BHKA 3ITJA 3JSKA 3NYCA 3QVPA 4J34A 1PBBA 1FCDA 2E5VA 1GRHA 3URHA 2H89A 1NDAA 3P4SA 4H2NA 4U8IA 3QJ4A 4ZN0A 3UP5A 3BNMA 2EQ9A 1KSUA 1ZMCA 3VRDB 1GESA 4J2WA 1V59A 2BS4A 4Z44A 3QVRA 2JB2A 4EQRA 3AECA 4H50A 3GDPA 4BV6A 1BKWA 2X8GA 4OPCA 4AOSA 4U8JA 3Q6JA 2EQ7A 1TDKA 4TLXA 2OA1A 3NIXA 1Y56A 1CL0A 4K5SA 1GPEA 4NTDA 1NHQA 2YLTA 2V3AA 2XLUA 4B67A 1H83A 3RNMA 2XCGA 3GYJA
chains in the Genus database with same CATH superfamily
3STPA 4YT0A 5EBKA 4LIIA 2B76A 2XVEA 2ZADA 3I4KA 1HYUA 1CC2A 2X8CA 1OEPA 1Z6LA 3MKCA 3P4RA 3UCLA 3UTHA 1Y0PA 3DG7A 3LADA 2FJAA 1VG0A 2OQYA 1Q1WA 3VR9A 3V3WA 2AQJA 4E8GA 4DSGA 1BWCA 4XWZA 2CDUA 4OCGA 1CBOA 1LQTA 3DK9A 1ZOYA 3NRZB 2C7GA 4N9XA 1N60C 2YVFA 3UOXA 4C77A 3NO1A 5IQ4A 3UKQA 2XLSA 2BK4A 1JRPA 5FJRA 3RHAA 3NVYB 4J36A 3AE4A 4A65A 4DGKA 3R0UA 5BOEA 1F6MA 3TOYA 2RGJA 3RP8A 2WOIA 3RP7A 3REDA 1PDHA 1RVKA 1EBHA 4U8LA 4YTPA 2MUCA 3VCNA 3BI2A 3N4FA 1FFVC 4LA1A 3GRSA 4E6MA 5KMSA 2QA1A 3LOVA 5KXJA 2WHDA 3M12A 2PODA 3KD9A 1L8PA 3M13A 4PAAA 4K22A 1JNZA 4B63A 1FOHA 1TYPA 3MQTA 2BACA 3QKEA 3AB1A 2MNRA 1H2IA 4GF7A 4JDRA 3L5OA 2FJDA 4WCTA 2O56A 2ZZ0A 3QPEA 3DA1A 1JROA 3GYIA 3OZYA 2PHHA 1GALA 3VDGA 4BJZA 4II3A 3UKFA 1PJ5A 2UZZA 2R9ZA 3H8AA 3AE9A 1R6WA 2P3ZA 1VG9A 1E1NA 3OC4A 2YR5A 4XWRA 2BA9A 2PU1A 1GREA 3FCPA 3UOZA 3SX6A 3FG2P 2ACZA 1FFUC 2Q0LA 4BK3A 4O5UA 2RDXA 3GD6A 4IL0A 2CULA 2TMDA 3UTFA 4ICYA 3IWAA 3NNEA 1L0VA 2B7SA 4ZCWA 2DW6A 2QDEA 2YG3A 3BI5A 3VFCA 3NYFA 3P3BA 1YQZA 3TQPA 3SSZA 3K7QX 4OPIA 1EC7A 1OJTA 2BCGG 3CT2A 1X31B 2FBWA 2GL5A 3OW1A 1H7WA 3AE1A 3NZGA 3M0OA 4AT2A 3QSEA 4NZHA 3V76A 3DFYA 2XVHA 4TM1A 3SN0A 3DJEA 2OQHA 1FEAA 3GC2A 3R07C 1GRAA 3FXGA 2HZGA 1XHCA 3GY1A 1P2HA 2P0IA 4HPNA 4CBQA 2YR4A 3LXDA 2WP6A 1K4QA 1N5WC 2WP5A 3JZUA 1GERA 4MGGA 2BC0A 4KX6A 1TZZA 1GRBA 3GMCA 1D4DA 3QFAA 2Y6RA 2XFPA 4E5TA 2DKIA 2GGIA 5IPYA 1KNRA 4OPGA 1GV4A 1BQGA 3OPSA 1GT8A 2AKZA 4H19A 3H12A 2C72A 2PPGA 1EC9A 2XVJA 5DBJA 3BOXA 1DTNA 3S5WA 4H4SA 2GMHA 3UXKA 5EB4A 3DK4A 4MMWA 2WOWA 1TDEA 3LJPA 1O94A 3FV9A 4H4YA 1ZMDA 4H4PA 2WU5A 1ONEA 2WQYA 3NN6X 3AM9A 3CNJA 3R25A 3U9IA 3ADAB 5M10A 4YKFA 4B69A 3NTAA 3ZDNA 2E5AA 2GR0A 1QJDA 2PCEA 3FYYA 3FIMB 5ER0A 1EC8A 2GB0A 5BULA 4DYEA 3G5QA 1NELA 1NHRA 1NAAA 4TM4A 3GRTA 3AYJA 4K1WA 1VQZA 2YG5A 3QFBA 4OPLA 4AP3A 3TWBA 4H2PA 2C75A 4J33A 1PJ7A 1WUFA 1FO4A 4I59A 3HPFA 4H2QA 2VVLA 4YSYA 2QAEA 4DN1A 2VQBA 3DJDA 1PBEA 4U2TA 3NT6A 1N4WA 1ZK7A 4P9SA 1JU2A 5G5GB 3P4PA 3NVWB 3K7TA 2O9ZA 3FVDA 4BK2A 2PP0A 3V4BA 5JCNA 4BURA 5GRTA 3NK1X 2R45A 3SBFA 1P43A 3G5RA 1N62C 1XANA 3NH3X 2IIDA 1S3EA 4IP5A 1FHUA 4H2HA 3MSYA 4B65A 2HXTA 1JRXA 3QTPA 1JNRA 3GMBA 2GH5A 5LV9A 4JQ9A 4FI4A 3ITJA 4J34A 1FCDA 3URHA 2H89A 4U8IA 4ZN0A 2EQ9A 1ZMCA 3VRDB 1GESA 3OTRA 2JB2A 4H50A 4IT1A 1S7MA 3Q6JA 4TLXA 3OZMA 1GPEA 1NHQA 2YLTA 2XCGA 4USRA 4YSZA 3SJNA 1XPYA 2OZ3A 5IDZA 4U8MA 2GEWA 1VQWA 3VQRA 2GF3A 2W0HA 3GWFA 2WDRA 3NG7X 5KVIA 4RG3A 4IA5A 4CY8A 3VCCA 2GQFA 3R1ZA 2R0GA 4U8OA 2NVKX 2V6OA 3GDNA 3UJSA 4II2A 2Q7VA 5U63A 2AL1A 3HRDC 2WPFA 2PTZA 4E0VA 3MWCA 2YQUA 3THUA 2QJJA 4M6UA 4GAVA 5EB5A 4X4JA 1SEZA 2PU0A 3ZYXA 3GD3A 1H7XA 2PTXA 4HYRA 4JY3A 2BXSA 1KF6A 1DJQA 4REKA 3IHMA 1FL2A 1YKJA 3OP2A 1STZA 3H8IA 4IL2A 4NEWA 1EL5A 4IVMB 1IJHA 2RGOA 5HHFA 3V3NA 3SYIA 2R0PA 3SQSA 1K0JA 3AD8B 4B68A 1CJCA 1GTEA 2DKHA 2XFNA 4TM0A 2BK3A 4J56A 4YWOA 2GV8A 1O5WA 1BF3A 4IHCA 3AN1A 3SN4A 1E1LA 4GGHA 4A3RA 2XGZA 2VZ2A 1WUEA 3TJIA 4XXGA 1NHPA 3CXOA 4BK1A 3BHFA 1S2YA 1JRYA 3I3LA 2C73A 2BXRA 4A79A 3FMWA 3DERA 4B1BA 3KKJA 1ELIA 4HCLA 4DX3A 3IC9A 2R0CA 3LB8A 4OPDA 2C76A 1JPDX 1M64A 4G9KA 3VC5A 3B97A 3CN8A 4H2RA 4ROPA 4I58A 3V5FA 2QCUA 3A7UA 4PABA 1Q9IA 2CFYA 1F8WA 2Z5XA 1W6TA 3DGZA 4Y4NA 2Z5YA 3MZNA 3MY9A 2FJBA 3PVCA 1S3BA 5U1OA 1DOEA 2YAUA 1OJ9A 3CPJG 4K7ZA 1N61C 2W54A 2F5ZA 3HYWA 2X50A 3I6DA 1D4EA 3NHOX 3ABVA 1WYGA 2BS3A 3AD9B 4AOXA 1P48A 2R46A 1TDFA 1RSGA 1ZXIC 4GFIA 5JCKA 5FS6A 2I0ZA 2JK6A 4H7UA 3ZLHA 1IUTA 2EQ6A 3EF6A 2GR1A 3I6EA 2OPJA 1O95A 2BYBA 1JPMA 4YTNA 3UOYA 4KPLA 1L9DA 4ZCCA 2GVCA 1ZKQA 4A6NB 1GNDA 1NEKA 2XFQA 3IHGA 3T31A 3C4AA 1LQUA 4YXDA 3PWGA 2FYMA 3EANA 1PBFA 4H83A 2XFOA 3AEAA 3ALLA 5KWFA 1F8SA 4A6GA 1ZOVA 3BI4A 2QQ6A 4G73A 3P4QA 5KMPA 2XVFA 3F8DA 4FK1A 1B37A 3TTEA 3CNSA 4HN8A 4EQWA 2JAEA 1D5TA 2QJMA 1REOA 1CJ3A 1PHHA 1KD0A 1RM6B 3PWIA 3S47A 5KVHA 2V5ZA 1JEHA 3ENLA 1FHVA 1JOAA 2XLPA 5HY5A 6ENLA 1IUWA 4AT0A 4IP4A 3CNDA 2QGYA 3UXLA 1CF3A 3LZXA 3UCCA 5EOWA 1E39A 1K0LA 3D47A 3QLDA 3H8LA 4JNAA 4USQA 1PJ6A 3ICSA 2C67A 4K2SA 1TYTA 3CTYA 3CMMA 3GSIA 3VA8A 4DXKA 1PDYA 4IZGA 3UKAA 2EQ8A 3Q45A 3CGBA 1KSSA 2A89A 3PK7A 3GWDA 4FX9A 3CGEA 3NYEA 4NNJA 1H6VA 2BK5A 3JW7A 3T6CA 4G6HA 4LU6A 3AYLA 3UKHA 2GQWA 4ZCDA 3ETRB 3AEGA 2CHRA 4Z17A 4APNA 3SGLA 3T2KA 2ZZBA 2J3NA 2PP3A 1DOBA 2XLTA 1F8RA 4G74A 1H82A 4HNLA 3VC6A 3GD4A 1N63C 3A7RA 1IUVA 2WU2A 3KPFA 2C4CA 5ENLA 3H7VA 4J1OA 5BUKA 2QDDA 2OFJA 3CPIG 4GUVA 4JY2A 2QJNA 3BHKA 2E5VA 1GRHA 4TVYA 3T2ZA 4EQRA 3GDPA 4OPCA 4AOSA 3NIXA 3UJRA 1CL0A 1H83A 3KUMA 3GYJA 4KEMA 3AYIA 1CJ4A 4B64A 1X2GA 4U8NA 3AEEA 2WS3A 4DSHA 4DWDA 3T14A 2BRAA 3AEDA 3AEBA 4FDCB 1LTXR 2FJEA 3PFRA 3T4WA 1BZLA 5BVAA 3B6DA 1D4CA 2PS2A 2XH2A 4D04A 5KOWA 4DHGA 2VQ7A 2XLRA 1X2HA 3I6TA 3ATRA 5L46A 2PYXA 3L8KA 3CIRA 4H1ZA 4EQXA 3AWIA 5KOXA 1JDFA 1XDIA 4CCQA 3R0KA 2YR6A 1XPQA 3UJFA 1IUSA 1S2QA 1IUUA 1CHUA 1JRZA 1N5XA 1E9IA 2GGJA 1DXLA 3P9UA 5FJUA 4U2LA 3RCYA 4MKSA 3Q4DA 2YG6A 4H4WA 3DIPA 2PGEA 4ENLA 1MO9A 2E4GA 4Z2UA 1Y56B 3WE0A 3KA7A 2Q6UA 3DJJA 4U8KA 4GCMA 3D1CA 2YWLA 2OKTA 2V3BA 2B7RA 5J7XA 3SR6B 2E3TA 5GSNA 2GAGB 3Q9TA 2QA2A 7ENLA 4C3XA 1B5QA 1MNSA 3R9UA 3T2YA 2V60A 3TWAA 3BNUA 3N6HA 5FS8A 2C65A 3GO2A 2BRYA 3SQPA 4Z25A 2RGHA 2PTYA 2ONEA 4EMJA 4NWZA 3KVEA 4A35A 2XYOA 2YG7A 1YQ4A 4BJYA 3P93A 2OX4A 3NVVB 2GMJA 4GDEA 3CNTA 1KKOA 2YVJA 1LPFA 3P0WA 4TM3A 3NVZB 1OJCA 3ICRA 2AAQA 3EEZA 1NG3A 3ZVHB 1M6IA 1PXCA 3U4FA 5CQFA 1CJ2A 1BGNA 2XH0A 3R10A 1OJDA 4C3YA 3RITA 3D9XA 3CPHG 3AD7B 3HYVA 1DODA 1GRFA 3UKPA 2XDOA 4EIPA 3VRBA 1GSNA 1BGJA 4A7AA 2W55A 2BS2A 3DESA 2Q0KA 5J60A 4TLZA 3V5CA 2CVJA 3ZLGA 4EM4A 1MRAA 3EPTA 1QO8A 3QSMA 1YY5A 1GRTA 3SZ0A 2XVIA 4E4FA 1QLBA 4RSLA 1GRGA 2B9XA 3T9PA 3SZFA 4D03A 3RRAA 3DJGX 3PS9A 4UDRA 3SXIA 2PSNA 3BSMA 1PBDA 3F8RA 4EMWA 3K30A 3PO7A 2YLZA 4FP1A 2C66A 2YM1A 3L1RA 1CC6A 3ES8A 1OJAA 3AE2A 1FEBA 5HXIA 3SM8A 5KMQA 2X3NA 3T8QA 2PGWA 2GR2A 1UKVG 1COYA 2AKMA 3NN0X 1VRQB 3RP6A 1DNCA 2JB3A 4FK1C 4ADWA 4KT2A 2VRMA 3SN1A 3ZLFA 2A87A 3C96A 3S5SA 3DMEA 3TCSA 3CGCA 1KCZA 1EL7A 3ATQA 3B9JB 1BKHA 4WX1A 2IVEA 4U2SA 1MOKA 4YKGA 2OAMA 2V61A 4GDPA 1MUCA 4EMIA 1EL9A 3DEQA 1P2EA 4M52A 4GISA 2AL2B 3UGVA 4IVOB 3AE5A 4GIRA 3CGDA 1GXFA 4OVIA 1NHSA 4H4XA 2POZA 3CXBA 3KLJA 2NPXA 3CNPA 3D8XA 1MXTA 3V3OA 2WDVA 1ZY8A 5EU9A 4G8TA 1B8SA 4HCHA 3IJIA 2ZC8A 4GGBA 1KDGA 3EUB3 5M0ZA 1SJAA 3UP4A 4MJWA 4HB9A 3RO6A 4JNQA 3DK8A 1E1MA 1GTHA 2JBVA 2NQLA 4CNJA 1EBGA 2GGGA 5U25A 4GMEA 4Y4LA 2HNEA 2OO6A 5JRBA 1Q1RA 1ZX9A 3S61A 2TPRA 1LJ1A 3JSKA 1PBBA 3P4SA 4H2NA 1NDAA 3BNMA 4J2WA 1V59A 2OG9A 2BS4A 4Z44A 3QVRA 2EQ7A 1TDKA 2OA1A 1Y56A 3A7AA 3IK4A 4B67A 4G6GA 2GGHA 3UOVA 3DH9A 1VDVA 3RGTA 2YLRA 3AXBA 5TR3A 3NGCX 3OZ2A 1R0MA 1H81A 4X9NA 1NPXA 2OLNA 2GSHA 1V97A 3KPKA 2R4JA 2JKCA 1NU5A 4EIQA 4EM3A 2BCPA 3T0KA 2OZ8A 4GR1A 2W3SA 2PTWA 3DDMA 2YVGA 3AEFA 2RABA 1PS9A 4CY6A 1GETA 1D7LA 3SZWA 4H4VA 1SJCA 5KMRA 3NLCA 4NEVA 3UJ2A 2BABA 4J57A 3KU9A 4JN7A 3ALJA 5FS9A 4Z24A 2HXUA 4CNKA 3RR1A 3ZVHA 1L9EA 5HYMA 3P1WA 2WPCA 1N1PA 1ZDLA 3LZWA 3G5SA 1ECQA 2XFUA 3F8PA 1N4VA 2GAHB 4CCRA 3IJLA 3DFHA 4H4TA 1E6EA 3NFUA 4KWSA 4AP1A 5JCLA 1JCTA 1N4UA 1XS2A 1GEUA 4TVWA 4Z2TA 4K5RA 3IJQA 3QSSA 3UKLA 2P88A 1FECA 2WDQA 4YSXA 4HCDA 3K7MX 1GOSA 5BRTA 4A99A 4HA6A 5FJPA 1KFYA 4ECHA 3FPZA 2C3CA 2YG4A 1H84A 5J04A 2WETA 2C3DA 4Z43A 1T3QC 4Z1YA 3C4NA 3H4KA 3O0HA 3UTEA 2PMQA 1KNPA 2JB1A 3B3RA 2R4EA 3K1GA 1LVLA 4F4RA 4O5QA 2XH4A 4YTMA 1PBCA 2VRLA 4ZOHB 4H4RA 3CAWA 4U8PA 4Z26A 4K8GA 4Y4MA 2X99A 3CYJA 1ONFA 1F3PA 2OLOA 5G5HB 1TDOA 5JCIA 3CB3A 5FJOA 3EKGA 3AE3A 4A5LA 5C3JA 2WPEA 2C70A 3SZCA 4NTCA 1E7PA 3FBSA 4K2XA 4OPTA 5JCMA 2WESA 3SY4A 2HQMA 3D46A 2B9WA 2YLWA 5IQ1A 3NK0X 4C5OA 4UDQA 3HYXA 4A9WA 2YLSA 1MDRA 2PA6A 3UJEA 3ICTA 2ZBWA 2W3RA 3NRNA 4YSHA 3NS1B 3EAOA 3FJ4A 1TDNA 2ARDA 2YLXA 1MDLA 3ZVIA 4X9MA 2VVMA 1TKKA 4YWSA 4JN8A 1K0IA 3AE6A 2GDQA 4EWJA 1KN0A 4KPRA 1ELSA 4IA6A 3VRAA 4C74A 3SFDA 2FKPA 3ES7A 1EBDA 2XSXA 2AL2A 1PN0A 3DG3A 3IF9A 1L9CA 3PG6A 1B4VA 2ZZCA 2IVDA 2WP9A 1TRBA 1VDCA 5FS7A 4IV9A 4M0XA 1IUXA 1ZP0A 4HNCA 3GYXA 4H4ZA 3VR8A 2A8XA 2WEUA 3HZLA 3SFEA 4H4UA 3NKSA 2E1MA 5C2TA 2QVHA 4X2PA 5KRQA 1PXBA 1CC4A 2WBAA 4NTEA 5KNLA 3AE8A 3TW9A 1SJDA 1YEYA 4E4UA 3DGBA 2C64A 2YM2A 2B9YA 1H86A 1YQ3A 5FJTA 3ISHA 1RYIA 3COXA 4EQSA 2P8CA 4GRTA 4RG4A 1E1KA 1RP0A 4UP3A 3N4EA 2H88A 3JVAA 1NENA 4B66A 1AOGA 3UKKA 1D7YA 3QN3A 2GRTA 2XH7A 4GAPA 2Y6QA 3AMZA 3AE7A 1KKRA 3H70A 4G7FA 4JHMA 4H4QA 1EL8A 4ZA0A 3N6JA 3BJSA 4CRTA 2AR8A 4J31A 3DGHA 3TJ4A 2X8HA 4Z2RA 4A6NA 1IYXA 3NXLA 3NK2X 4GYPA 4JN9A 4J3ZA 2OLAA 2PP1A 1DOCA 1PXAA 4DNAA 2WOVA 5FMHA 4GYPC 4OPUA 3CK5A 4K8DA 3NTDA 4UDPA 5CKUA 2GR3A 2BC1A 2DW7A 2OALA 2GGEA 3HW2A 3UTGA 1F9CA 2VVLG 2APGA 1FIQB 3ALMA 1LV0A 3II4A 3MUCA 3T37A 2I5QA 2OVLA 3E1TA 1W4XA 1SB3B 3UCDA 1DJNA 1NG4A 1SJBA 1TE6A 2VOUA 3NYCA 3QVPA 2OZTA 3QJ4A 3UP5A 1KSUA 2P8BA 1PDZA 3R11A 3AECA 4BV6A 1BKWA 2X8GA 3DG6A 4U8JA 4K5SA 4NTDA 2V3AA 2XLUA 5BOFA 3RNMA
chains in the Genus database with same CATH topology
3UOVA 3DH9A 3AYIA 1CJ4A 4YT0A 4B64A 5EBKA 4USRA 4LIIA 2YLRA 4YSZA 2B76A 2XVEA 3AXBA 5TR3A 3NGCX 4U8NA 3OZ2A 3AEEA 1HYUA 1CC2A 2X8CA 1H81A 1Z6LA 4X9NA 3SXIA 3P4RA 3UCLA 3UTHA 1Y0PA 3LADA 2WS3A 1NPXA 2FJAA 1VG0A 2OLNA 4U8MA 4DSHA 1Q1WA 3VR9A 3R9UA 2GEWA 2AQJA 3T14A 1VQWA 4DSGA 1BWCA 3VQRA 2BRAA 4XWZA 3KPKA 2CDUA 3AEDA 2GF3A 2W0HA 2R4JA 2JKCA 2WDRA 3GWFA 4OCGA 3NG7X 1CBOA 5KVIA 3AEBA 4FDCB 1LQTA 1LTXR 3DK9A 4RG3A 4IA5A 4CY8A 2FJEA 4EM3A 4EIQA 4G6GA 2BCPA 3T0KA 1BZLA 4GR1A 1ZOYA 5BVAA 3B6DA 2C7GA 2YVGA 2GQFA 4N9XA 2YVFA 2R0GA 3UOXA 3AEFA 2RABA 1PS9A 4U8OA 4C77A 4CY6A 2NVKX 2V6OA 1GETA 3GDNA 1D4CA 5IQ4A 1D7LA 3UKQA 4D04A 4II2A 5KOWA 2XLSA 2Q7VA 2BK4A 2VQ7A 5U63A 2XLRA 3SZWA 4H4VA 3RHAA 4J36A 3AE4A 3ATRA 4A65A 2WPFA 5L46A 2PYXA 4DGKA 4E0VA 5KMRA 3NLCA 4NEVA 1F6MA 3L8KA 2YQUA 3CIRA 2BABA 4J57A 3KU9A 4EQXA 2RGJA 3AWIA 3ALJA 5KOXA 1XDIA 3RP8A 4CCQA 2WOIA 5FS9A 2YR6A 4Z24A 1XPQA 3RP7A 4CNKA 4GAVA 5EB5A 1IUSA 3REDA 4X4JA 1PDHA 1SEZA 1L9EA 1S2QA 3ZYXA 5HYMA 3P1WA 2WPCA 3GD3A 1H7XA 4U8LA 1N1PA 1ZDLA 4YTPA 1IUUA 3LZWA 3G5SA 4JY3A 1CHUA 3BI2A 2XFUA 4C5OA 1JRZA 2BXSA 3F8PA 1N4VA 1KF6A 1DXLA 1DJQA 3P9UA 4REKA 2GAHB 3IHMA 1FL2A 4LA1A 4CCRA 1YKJA 4H4TA 4U2LA 1E6EA 4AP1A 3GRSA 5JCLA 5KMSA 1N4UA 2QA1A 3LOVA 3H8IA 2YG6A 1GEUA 5KXJA 2WHDA 4NEWA 4H4WA 1EL5A 4IVMB 4Z2TA 3M12A 1IJHA 2RGOA 5HHFA 3V3NA 3KD9A 4K5RA 3SYIA 2R0PA 1MO9A 2E4GA 3M13A 4PAAA 4Z2UA 1Y56B 4K22A 1K0JA 3AD8B 3WE0A 1JNZA 4B63A 1FOHA 4B68A 1TYPA 1CJCA 3QSSA 2BACA 3KA7A 1GTEA 2DKHA 2XFNA 4TM0A 3UKLA 2BK3A 2Q6UA 3AB1A 1FECA 1H2IA 2WDQA 4J56A 4YWOA 4YSXA 2GV8A 3K7MX 4GF7A 1GOSA 5BRTA 1O5WA 4JDRA 3DJJA 1BF3A 3L5OA 1E1LA 4U8KA 4A99A 4GCMA 3D1CA 2FJDA 2YWLA 4WCTA 2V3BA 2ZZ0A 4HA6A 2B7RA 3DA1A 3GYIA 5J7XA 2PHHA 2VZ2A 1KFYA 1GALA 4BJZA 5GSNA 4ECHA 3FPZA 2C3CA 2YG4A 1H84A 2GAGB 3Q9TA 2WETA 4XXGA 1NHPA 2QA2A 2C3DA 4BK1A 4Z43A 4II3A 3BHFA 4C3XA 3UKFA 1B5QA 1S2YA 3C4NA 1JRYA 3H4KA 3O0HA 1PJ5A 2C73A 2V60A 1KNPA 3B3RA 2JB1A 2UZZA 2BXRA 3BNUA 2R4EA 4A79A 5FS8A 2C65A 2R9ZA 1LVLA 2BRYA 3FMWA 3AE9A 3SQPA 4Z25A 1VG9A 2RGHA 1E1NA 4O5QA 4B1BA 3OC4A 4EMJA 4YTMA 1PBCA 2YR5A 3KKJA 4NWZA 1ELIA 2VRLA 3KVEA 4H4RA 4XWRA 3IC9A 2XYOA 2BA9A 2R0CA 1YQ4A 2YG7A 4U8PA 4Z26A 1GREA 4Y4MA 4BJYA 3LB8A 3UOZA 2X99A 4OPDA 3SX6A 3FG2P 2ACZA 2GMJA 2C76A 2Q0LA 1ONFA 1M64A 4G9KA 1F3PA 4O5UA 4BK3A 4GDEA 3CNTA 2OLOA 2YVJA 1LPFA 1TDOA 2CULA 3CN8A 5JCIA 3AE3A 4H2RA 4A5LA 2TMDA 5C3JA 3UTFA 4I58A 2WPEA 4ICYA 4TM3A 2C70A 1OJCA 3IWAA 3SZCA 2QCUA 3ICRA 3NNEA 2AAQA 4NTCA 1L0VA 4PABA 1Q9IA 1E7PA 2CFYA 1NG3A 2B7SA 3FBSA 4K2XA 5JCMA 4OPTA 2YG3A 2WESA 1F8WA 3BI5A 1M6IA 1PXCA 3SY4A 5CQFA 1CJ2A 1BGNA 2Z5XA 3NYFA 3DGZA 1YQZA 4Y4NA 1OJDA 2HQMA 4C3YA 2Z5YA 3PVCA 2FJBA 3K7QX 1S3BA 4OPIA 2B9WA 1OJTA 5U1OA 1DOEA 2YLWA 2BCGG 5IQ1A 2YAUA 3D9XA 3CPHG 1OJ9A 1X31B 2FBWA 3AD7B 3HYXA 3NK0X 4UDQA 4A9WA 2YLSA 3HYVA 1DODA 3CPJG 1GRFA 1H7WA 3UKPA 4K7ZA 2XDOA 4EIPA 3VRBA 3AE1A 2F5ZA 3HYWA 3ICTA 1GSNA 2ZBWA 2X50A 1BGJA 3M0OA 3I6DA 4A7AA 1D4EA 2BS2A 4AT2A 3QSEA 3NHOX 3ABVA 3NRNA 4NZHA 3V76A 4YSHA 2BS3A 2Q0KA 3AD9B 4AOXA 3EAOA 5J60A 4TLZA 1TDNA 2R46A 2ARDA 2YLXA 1TDFA 2XVHA 2CVJA 4TM1A 4X9MA 3DJEA 4EM4A 2VVMA 1RSGA 1FEAA 3EPTA 1QO8A 1K0IA 5JCKA 3AE6A 1GRAA 1KN0A 4KPRA 5FS6A 2I0ZA 2JK6A 1XHCA 4H7UA 1IUTA 3QSMA 1P2HA 2EQ6A 3EF6A 4IA6A 1YY5A 2GR1A 4CBQA 1GRTA 2YR4A 3SZ0A 1O95A 2XVIA 3LXDA 2WP6A 1K4QA 1QLBA 4RSLA 3VRAA 4C74A 2BYBA 1GRGA 2WP5A 3SFDA 1EBDA 2B9XA 1GERA 4YTNA 3SZFA 4D03A 3UOYA 2BC0A 4KX6A 1L9DA 1PN0A 4ZCCA 2GVCA 3DJGX 1ZKQA 1L9CA 3PG6A 3IF9A 4A6NB 3PS9A 1B4VA 1GNDA 1NEKA 1GRBA 2ZZCA 2XFQA 3GMCA 3IHGA 1D4DA 4UDRA 3QFAA 2Y6RA 2XFPA 2WP9A 2IVDA 3C4AA 3T31A 2DKIA 1TRBA 5IPYA 1KNRA 1VDCA 1PBDA 1LQUA 5FS7A 4OPGA 4IV9A 4YXDA 1GV4A 1IUXA 3F8RA 4EMWA 1GT8A 1ZP0A 2YLZA 3K30A 3PO7A 2C66A 2C72A 2YM1A 3EANA 3GYXA 4H4ZA 3L1RA 1CC6A 1PBFA 3VR8A 2A8XA 2WEUA 1OJAA 2XVJA 2XFOA 3AEAA 5DBJA 3AE2A 3HZLA 1FEBA 3ALLA 3SFEA 5HXIA 1F8SA 5KWFA 4H4UA 3SM8A 1ZOVA 5KMQA 3BI4A 3NKSA 2E1MA 3I3LA 2X3NA 4G73A 3S5WA 4H4SA 2GMHA 3P4QA 5C2TA 5KMPA 5KRQA 1PXBA 2XVFA 5EB4A 3DK4A 3F8DA 2WOWA 1CC4A 2WBAA 1TDEA 4FK1A 2GR2A 1B37A 1UKVG 3LJPA 4NTEA 3CNSA 5KNLA 1COYA 3AE8A 1O94A 4EQWA 3NN0X 1VRQB 2C64A 3RP6A 4H4YA 2JAEA 2YM2A 1ZMDA 4H4PA 1DNCA 1D5TA 2JB3A 1REOA 1CJ3A 1PHHA 2B9YA 2WU5A 1H86A 1YQ3A 4FK1C 4ADWA 2WQYA 3ISHA 5KVHA 1RYIA 2V5ZA 3COXA 1JEHA 4EQSA 4GRTA 1JOAA 3NN6X 4RG4A 3CNJA 2XLPA 5HY5A 1E1KA 1RP0A 1IUWA 4AT0A 4UP3A 2VRMA 3ADAB 5M10A 2A87A 3C96A 4YKFA 4B69A 3CNDA 3NTAA 2H88A 3DMEA 3ZDNA 1CF3A 2GR0A 1QJDA 3LZXA 1NENA 3CGCA 3FIMB 5EOWA 1E39A 1EL7A 3ATQA 5ER0A 4B66A 1AOGA 2GB0A 1K0LA 3UKKA 4WX1A 5BULA 1D7YA 2IVEA 3G5QA 3H8LA 4JNAA 2GRTA 4U2SA 1MOKA 4GAPA 4USQA 4YKGA 2Y6QA 1NHRA 1NAAA 4TM4A 3GRTA 3AE7A 2OAMA 3AYJA 1PJ6A 2YG5A 3QFBA 4H4QA 2C67A 3ICSA 2V61A 4GDPA 4EMIA 1EL9A 1TYTA 1EL8A 3CTYA 4OPLA 4AP3A 3CMMA 4H2PA 3GSIA 4CRTA 1P2EA 2AR8A 3UKAA 4J31A 2C75A 4M52A 4J33A 1PJ7A 3DGHA 4IVOB 2EQ8A 2X8HA 4Z2RA 3AE5A 4A6NA 3CGBA 1KSSA 2A89A 4I59A 3GWDA 3NK2X 2VVLA 3CGDA 1GXFA 4H2QA 4YSYA 4FX9A 2QAEA 3CGEA 2VQBA 3DJDA 1PBEA 4JN9A 4OVIA 3NYEA 4U2TA 3NT6A 4NNJA 1H6VA 1NHSA 1ZK7A 4H4XA 1N4WA 2BK5A 4P9SA 3KLJA 2NPXA 3CNPA 3D8XA 1JU2A 1MXTA 1DOCA 1PXAA 4G6HA 3V3OA 2WDVA 4LU6A 3AYLA 4DNAA 2WOVA 5FMHA 3P4PA 1ZY8A 3UKHA 2GQWA 1B8SA 4ZCDA 3AEGA 3K7TA 4OPUA 2O9ZA 4K8DA 1KDGA 4BK2A 5JCNA 3NTDA 4BURA 4APNA 4UDPA 5M0ZA 5CKUA 5GRTA 2GR3A 2BC1A 2R45A 3NK1X 3SGLA 3T2KA 2ZZBA 4MJWA 3UP4A 2OALA 3G5RA 1XANA 2J3NA 1DOBA 2IIDA 3NH3X 1S3EA 2XLTA 1F8RA 4HB9A 4G74A 1H82A 3UTGA 3GD4A 2VVLG 4JNQA 3DK8A 1E1MA 2APGA 1IUVA 1GTHA 2WU2A 2JBVA 3KPFA 4CNJA 3T2YA 3ALMA 1LV0A 5U25A 2C4CA 4B65A 3II4A 1JRXA 3T37A 4Y4LA 1JNRA 5BUKA 3E1TA 1W4XA 5JRBA 3GMBA 1Q1RA 2GH5A 1ZX9A 3CPIG 3S61A 4GUVA 2TPRA 3UTEA 5LV9A 4JQ9A 1DJNA 1NG4A 4JY2A 1LJ1A 2VOUA 3BHKA 3ITJA 3JSKA 3NYCA 3QVPA 4J34A 1PBBA 1FCDA 2E5VA 1GRHA 3URHA 2H89A 1NDAA 3P4SA 4H2NA 4U8IA 3QJ4A 4ZN0A 3UP5A 3BNMA 2EQ9A 1KSUA 1ZMCA 3VRDB 1GESA 4J2WA 3T2ZA 1V59A 2BS4A 4Z44A 3QVRA 2JB2A 4EQRA 3AECA 4H50A 3GDPA 4BV6A 1BKWA 2X8GA 4OPCA 4AOSA 4U8JA 1S7MA 3Q6JA 2EQ7A 1TDKA 4TLXA 2OA1A 3NIXA 1Y56A 1CL0A 4K5SA 1GPEA 4NTDA 1NHQA 2YLTA 2V3AA 2XLUA 4B67A 1H83A 3RNMA 2XCGA 3GYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UOV A;  3DH9 A;  3AYI A;  1CJ4 A;  4YT0 A;  4B64 A;  5EBK A;  4USR A;  4LII A;  2YLR A;  4YSZ A;  2B76 A;  2XVE A;  3AXB A;  5TR3 A;  3NGC X;  4U8N A;  3OZ2 A;  3AEE A;  1HYU A;  1CC2 A;  2X8C A;  1H81 A;  1Z6L A;  4X9N A;  3P4R A;  3UCL A;  3UTH A;  1Y0P A;  3LAD A;  2WS3 A;  1NPX A;  2FJA A;  1VG0 A;  2OLN A;  4U8M A;  4DSH A;  1Q1W A;  3VR9 A;  3R9U A;  2GEW A;  2AQJ A;  1VQW A;  4DSG A;  1BWC A;  3VQR A;  4XWZ A;  2CDU A;  3AED A;  2GF3 A;  2W0H A;  2R4J A;  2JKC A;  2WDR A;  3GWF A;  4OCG A;  3NG7 X;  1CBO A;  5KVI A;  3AEB A;  4FDC B;  1LQT A;  1LTX R;  3DK9 A;  4RG3 A;  4IA5 A;  4CY8 A;  2FJE A;  4EM3 A;  4EIQ A;  2BCP A;  1BZL A;  4GR1 A;  1ZOY A;  5BVA A;  3B6D A;  2C7G A;  2YVG A;  2GQF A;  4N9X A;  2YVF A;  2R0G A;  3UOX A;  3AEF A;  2RAB A;  1PS9 A;  4U8O A;  4C77 A;  4CY6 A;  2NVK X;  2V6O A;  1GET A;  3GDN A;  1D4C A;  5IQ4 A;  1D7L A;  3UKQ A;  4D04 A;  5KOW A;  2XLS A;  2Q7V A;  2BK4 A;  2VQ7 A;  5U63 A;  2XLR A;  4H4V A;  3RHA A;  4J36 A;  3AE4 A;  3ATR A;  4A65 A;  2WPF A;  5L46 A;  2PYX A;  4DGK A;  4E0V A;  3NLC A;  4NEV A;  1F6M A;  3L8K A;  2YQU A;  3CIR A;  2BAB A;  4J57 A;  3KU9 A;  4EQX A;  2RGJ A;  3AWI A;  3ALJ A;  5KOX A;  1XDI A;  3RP8 A;  4CCQ A;  2WOI A;  5FS9 A;  2YR6 A;  4Z24 A;  1XPQ A;  3RP7 A;  4CNK A;  5EB5 A;  1IUS A;  3RED A;  4X4J A;  1PDH A;  1SEZ A;  1L9E A;  1S2Q A;  3ZYX A;  5HYM A;  3P1W A;  2WPC A;  3GD3 A;  1H7X A;  4U8L A;  1N1P A;  1ZDL A;  4YTP A;  1IUU A;  3LZW A;  3G5S A;  4JY3 A;  1CHU A;  3BI2 A;  2XFU A;  1JRZ A;  2BXS A;  3F8P A;  1N4V A;  1KF6 A;  1DXL A;  1DJQ A;  3P9U A;  4REK A;  2GAH B;  3IHM A;  1FL2 A;  4LA1 A;  4CCR A;  1YKJ A;  4H4T A;  4U2L A;  1E6E A;  4AP1 A;  3GRS A;  5JCL A;  1N4U A;  2QA1 A;  3LOV A;  3H8I A;  2YG6 A;  1GEU A;  5KXJ A;  2WHD A;  4NEW A;  4H4W A;  1EL5 A;  4IVM B;  4Z2T A;  3M12 A;  1IJH A;  2RGO A;  5HHF A;  3V3N A;  3KD9 A;  4K5R A;  2R0P A;  1MO9 A;  2E4G A;  3M13 A;  4PAA A;  4Z2U A;  1Y56 B;  4K22 A;  1K0J A;  3AD8 B;  3WE0 A;  1JNZ A;  4B63 A;  1FOH A;  4B68 A;  1TYP A;  1CJC A;  3QSS A;  2BAC A;  3KA7 A;  1GTE A;  2DKH A;  2XFN A;  4TM0 A;  3UKL A;  2BK3 A;  2Q6U A;  3AB1 A;  1FEC A;  2WDQ A;  4J56 A;  4YWO A;  4YSX A;  2GV8 A;  3K7M X;  4GF7 A;  1GOS A;  5BRT A;  1O5W A;  4JDR A;  3DJJ A;  1BF3 A;  1E1L A;  4U8K A;  4A99 A;  4GCM A;  3D1C A;  2FJD A;  2YWL A;  4WCT A;  2V3B A;  2ZZ0 A;  4HA6 A;  2B7R A;  3DA1 A;  3GYI A;  5J7X A;  2PHH A;  2VZ2 A;  1KFY A;  1GAL A;  4BJZ A;  5GSN A;  4ECH A;  3FPZ A;  2C3C A;  2YG4 A;  1H84 A;  2GAG B;  3Q9T A;  2WET A;  4XXG A;  1NHP A;  2QA2 A;  2C3D A;  4BK1 A;  4Z43 A;  3BHF A;  4C3X A;  3UKF A;  1B5Q A;  1S2Y A;  3C4N A;  1JRY A;  3H4K A;  3O0H A;  1PJ5 A;  2C73 A;  2V60 A;  1KNP A;  3B3R A;  2JB1 A;  2UZZ A;  2BXR A;  3BNU A;  2R4E A;  4A79 A;  5FS8 A;  2C65 A;  2R9Z A;  1LVL A;  3FMW A;  3AE9 A;  3SQP A;  4Z25 A;  1VG9 A;  2RGH A;  1E1N A;  4O5Q A;  4B1B A;  3OC4 A;  4EMJ A;  4YTM A;  1PBC A;  2YR5 A;  3KKJ A;  1ELI A;  2VRL A;  3KVE A;  4H4R A;  4XWR A;  3IC9 A;  2XYO A;  2BA9 A;  2R0C A;  1YQ4 A;  2YG7 A;  4U8P A;  4Z26 A;  1GRE A;  4Y4M A;  4BJY A;  3LB8 A;  3UOZ A;  2X99 A;  4OPD A;  3FG2 P;  2ACZ A;  2GMJ A;  2C76 A;  2Q0L A;  1ONF A;  1M64 A;  1F3P A;  4O5U A;  4BK3 A;  4GDE A;  3CNT A;  2OLO A;  2YVJ A;  1LPF A;  1TDO A;  2CUL A;  3CN8 A;  5JCI A;  3AE3 A;  4H2R A;  4A5L A;  2TMD A;  5C3J A;  3UTF A;  4I58 A;  2WPE A;  4ICY A;  4TM3 A;  2C70 A;  1OJC A;  3IWA A;  2QCU A;  3ICR A;  3NNE A;  2AAQ A;  4NTC A;  1L0V A;  4PAB A;  1Q9I A;  1E7P A;  2CFY A;  1NG3 A;  2B7S A;  3FBS A;  4K2X A;  5JCM A;  4OPT A;  2YG3 A;  2WES A;  1F8W A;  3BI5 A;  1M6I A;  1PXC A;  5CQF A;  1CJ2 A;  1BGN A;  2Z5X A;  3NYF A;  3DGZ A;  1YQZ A;  4Y4N A;  1OJD A;  2HQM A;  4C3Y A;  2Z5Y A;  3PVC A;  2FJB A;  3K7Q X;  1S3B A;  4OPI A;  2B9W A;  1OJT A;  5U1O A;  1DOE A;  2YLW A;  2BCG G;  5IQ1 A;  2YAU A;  3CPH G;  3NK0 X;  1OJ9 A;  1X31 B;  2FBW A;  3AD7 B;  4UDQ A;  4A9W A;  4C5O A;  2YLS A;  1DOD A;  3CPJ G;  1GRF A;  1H7W A;  3UKP A;  4K7Z A;  2XDO A;  4EIP A;  3VRB A;  3AE1 A;  2F5Z A;  3ICT A;  1GSN A;  2ZBW A;  2X50 A;  1BGJ A;  3M0O A;  3I6D A;  4A7A A;  1D4E A;  2BS2 A;  4AT2 A;  3QSE A;  3NHO X;  3ABV A;  3NRN A;  4NZH A;  3V76 A;  4YSH A;  2BS3 A;  2Q0K A;  3AD9 B;  4AOX A;  3EAO A;  5J60 A;  4TLZ A;  1TDN A;  2R46 A;  2ARD A;  2YLX A;  1TDF A;  2XVH A;  2CVJ A;  4TM1 A;  4X9M A;  3DJE A;  4EM4 A;  2VVM A;  1RSG A;  1FEA A;  3EPT A;  1QO8 A;  1K0I A;  5JCK A;  3AE6 A;  1GRA A;  4KPR A;  5FS6 A;  2I0Z A;  2JK6 A;  1XHC A;  4H7U A;  1IUT A;  3QSM A;  1P2H A;  2EQ6 A;  3EF6 A;  4IA6 A;  1YY5 A;  2GR1 A;  4CBQ A;  1GRT A;  2YR4 A;  1O95 A;  2XVI A;  3LXD A;  2WP6 A;  1K4Q A;  1QLB A;  4RSL A;  3VRA A;  4C74 A;  2BYB A;  1GRG A;  2WP5 A;  3SFD A;  1EBD A;  2B9X A;  1GER A;  4YTN A;  4D03 A;  3UOY A;  2BC0 A;  4KX6 A;  1L9D A;  1PN0 A;  4ZCC A;  2GVC A;  3DJG X;  1ZKQ A;  1L9C A;  3IF9 A;  4A6N B;  3PS9 A;  1B4V A;  1GND A;  1NEK A;  1GRB A;  2ZZC A;  2XFQ A;  3GMC A;  3IHG A;  1D4D A;  4UDR A;  3QFA A;  2Y6R A;  2XFP A;  2WP9 A;  2IVD A;  3C4A A;  2DKI A;  1TRB A;  5IPY A;  1KNR A;  1VDC A;  1PBD A;  1LQU A;  5FS7 A;  4OPG A;  4IV9 A;  4YXD A;  1GV4 A;  1IUX A;  3F8R A;  4EMW A;  1GT8 A;  1ZP0 A;  2YLZ A;  3K30 A;  3PO7 A;  2C66 A;  2C72 A;  2YM1 A;  3EAN A;  4H4Z A;  3L1R A;  1CC6 A;  1PBF A;  3VR8 A;  2A8X A;  2WEU A;  1OJA A;  2XVJ A;  2XFO A;  3AEA A;  5DBJ A;  3AE2 A;  3HZL A;  1FEB A;  3ALL A;  3SFE A;  5HXI A;  1F8S A;  5KWF A;  4H4U A;  3SM8 A;  1ZOV A;  3BI4 A;  3NKS A;  2E1M A;  3I3L A;  2X3N A;  3S5W A;  4H4S A;  2GMH A;  3P4Q A;  5C2T A;  5KRQ A;  1PXB A;  2XVF A;  5EB4 A;  3DK4 A;  3F8D A;  2WOW A;  1CC4 A;  2WBA A;  1TDE A;  4FK1 A;  2GR2 A;  1B37 A;  1UKV G;  3LJP A;  4NTE A;  3CNS A;  1COY A;  3AE8 A;  1O94 A;  4EQW A;  3NN0 X;  1VRQ B;  2C64 A;  3RP6 A;  4H4Y A;  2JAE A;  2YM2 A;  1ZMD A;  4H4P A;  1DNC A;  1D5T A;  2JB3 A;  1REO A;  1CJ3 A;  1PHH A;  2B9Y A;  2WU5 A;  1H86 A;  1YQ3 A;  4FK1 C;  4ADW A;  2WQY A;  3ISH A;  5KVH A;  1RYI A;  2V5Z A;  3COX A;  1JEH A;  4EQS A;  4GRT A;  1JOA A;  3NN6 X;  4RG4 A;  3CNJ A;  2XLP A;  5HY5 A;  1E1K A;  1RP0 A;  1IUW A;  4AT0 A;  4UP3 A;  2VRM A;  3ADA B;  5M10 A;  2A87 A;  3C96 A;  4YKF A;  4B69 A;  3CND A;  3NTA A;  2H88 A;  3DME A;  3ZDN A;  1CF3 A;  2GR0 A;  1QJD A;  3LZX A;  1NEN A;  3CGC A;  3FIM B;  5EOW A;  1E39 A;  1EL7 A;  3ATQ A;  5ER0 A;  4B66 A;  1AOG A;  2GB0 A;  1K0L A;  3UKK A;  4WX1 A;  5BUL A;  1D7Y A;  2IVE A;  3G5Q A;  3H8L A;  4JNA A;  2GRT A;  4U2S A;  1MOK A;  4USQ A;  4YKG A;  2Y6Q A;  1NHR A;  1NAA A;  4TM4 A;  3GRT A;  3AE7 A;  2OAM A;  3AYJ A;  1PJ6 A;  2YG5 A;  3QFB A;  4H4Q A;  2C67 A;  3ICS A;  2V61 A;  4GDP A;  4EMI A;  1EL9 A;  1TYT A;  1EL8 A;  3CTY A;  4OPL A;  4AP3 A;  4H2P A;  3GSI A;  4CRT A;  1P2E A;  2AR8 A;  3UKA A;  4J31 A;  2C75 A;  4M52 A;  4J33 A;  1PJ7 A;  3DGH A;  4IVO B;  2EQ8 A;  2X8H A;  4Z2R A;  3AE5 A;  4A6N A;  3CGB A;  1KSS A;  2A89 A;  4I59 A;  3GWD A;  3NK2 X;  2VVL A;  3CGD A;  1GXF A;  4H2Q A;  4YSY A;  4FX9 A;  2QAE A;  3CGE A;  2VQB A;  3DJD A;  1PBE A;  4JN9 A;  4OVI A;  3NYE A;  4U2T A;  3NT6 A;  1H6V A;  1NHS A;  1ZK7 A;  4H4X A;  1N4W A;  2BK5 A;  4P9S A;  3KLJ A;  2NPX A;  3CNP A;  3D8X A;  1JU2 A;  1MXT A;  1DOC A;  1PXA A;  3V3O A;  2WDV A;  4LU6 A;  3AYL A;  4DNA A;  2WOV A;  5FMH A;  3P4P A;  1ZY8 A;  3UKH A;  2GQW A;  1B8S A;  4ZCD A;  3AEG A;  3K7T A;  4OPU A;  2O9Z A;  4K8D A;  1KDG A;  4BK2 A;  5JCN A;  3NTD A;  4BUR A;  4APN A;  4UDP A;  5M0Z A;  5CKU A;  5GRT A;  2GR3 A;  2BC1 A;  2R45 A;  3NK1 X;  3SGL A;  2ZZB A;  4MJW A;  3UP4 A;  2OAL A;  3G5R A;  1XAN A;  2J3N A;  1DOB A;  2IID A;  3NH3 X;  1S3E A;  2XLT A;  1F8R A;  4HB9 A;  1H82 A;  3UTG A;  3GD4 A;  2VVL G;  4JNQ A;  3DK8 A;  1E1M A;  2APG A;  1IUV A;  1GTH A;  2WU2 A;  2JBV A;  3KPF A;  4CNJ A;  3ALM A;  1LV0 A;  5U25 A;  4B65 A;  3II4 A;  1JRX A;  3T37 A;  4Y4L A;  1JNR A;  5BUK A;  3E1T A;  1W4X A;  3GMB A;  1Q1R A;  2GH5 A;  1ZX9 A;  3CPI G;  3S61 A;  4GUV A;  2TPR A;  3UTE A;  5LV9 A;  4JQ9 A;  1DJN A;  1NG4 A;  4JY2 A;  1LJ1 A;  2VOU A;  3BHK A;  3ITJ A;  3JSK A;  3NYC A;  3QVP A;  4J34 A;  1PBB A;  1FCD A;  2E5V A;  1GRH A;  3URH A;  2H89 A;  1NDA A;  3P4S A;  4H2N A;  4U8I A;  3QJ4 A;  4ZN0 A;  3UP5 A;  3BNM A;  2EQ9 A;  1KSU A;  1ZMC A;  3VRD B;  1GES A;  4J2W A;  1V59 A;  2BS4 A;  4Z44 A;  3QVR A;  2JB2 A;  4EQR A;  3AEC A;  4H50 A;  3GDP A;  4BV6 A;  1BKW A;  2X8G A;  4OPC A;  4AOS A;  4U8J A;  3Q6J A;  2EQ7 A;  1TDK A;  4TLX A;  2OA1 A;  3NIX A;  1Y56 A;  1CL0 A;  4K5S A;  1GPE A;  4NTD A;  1NHQ A;  2YLT A;  2V3A A;  2XLU A;  4B67 A;  1H83 A;  3RNM A;  2XCG A;  3GYJ A; 
#chains in the Genus database with same CATH topology
 3STP A;  4YT0 A;  5EBK A;  4LII A;  2B76 A;  2XVE A;  2ZAD A;  3I4K A;  1HYU A;  1CC2 A;  2X8C A;  1OEP A;  1Z6L A;  3MKC A;  3P4R A;  3UCL A;  3UTH A;  1Y0P A;  3DG7 A;  3LAD A;  2FJA A;  1VG0 A;  2OQY A;  1Q1W A;  3VR9 A;  3V3W A;  2AQJ A;  4E8G A;  4DSG A;  1BWC A;  4XWZ A;  2CDU A;  4OCG A;  1CBO A;  1LQT A;  3DK9 A;  1ZOY A;  3NRZ B;  2C7G A;  4N9X A;  1N60 C;  2YVF A;  3UOX A;  4C77 A;  3NO1 A;  5IQ4 A;  3UKQ A;  2XLS A;  2BK4 A;  1JRP A;  5FJR A;  3RHA A;  3NVY B;  4J36 A;  3AE4 A;  4A65 A;  4DGK A;  3R0U A;  5BOE A;  1F6M A;  3TOY A;  2RGJ A;  3RP8 A;  2WOI A;  3RP7 A;  3RED A;  1PDH A;  1RVK A;  1EBH A;  4U8L A;  4YTP A;  2MUC A;  3VCN A;  3BI2 A;  3N4F A;  1FFV C;  4LA1 A;  3GRS A;  4E6M A;  5KMS A;  2QA1 A;  3LOV A;  5KXJ A;  2WHD A;  3M12 A;  2POD A;  3KD9 A;  1L8P A;  3M13 A;  4PAA A;  4K22 A;  1JNZ A;  4B63 A;  1FOH A;  1TYP A;  3MQT A;  2BAC A;  3QKE A;  3AB1 A;  2MNR A;  1H2I A;  4GF7 A;  4JDR A;  3L5O A;  2FJD A;  4WCT A;  2O56 A;  2ZZ0 A;  3QPE A;  3DA1 A;  1JRO A;  3GYI A;  3OZY A;  2PHH A;  1GAL A;  3VDG A;  4BJZ A;  4II3 A;  3UKF A;  1PJ5 A;  2UZZ A;  2R9Z A;  3H8A A;  3AE9 A;  1R6W A;  2P3Z A;  1VG9 A;  1E1N A;  3OC4 A;  2YR5 A;  4XWR A;  2BA9 A;  2PU1 A;  1GRE A;  3FCP A;  3UOZ A;  3SX6 A;  3FG2 P;  2ACZ A;  1FFU C;  2Q0L A;  4BK3 A;  4O5U A;  2RDX A;  3GD6 A;  4IL0 A;  2CUL A;  2TMD A;  3UTF A;  4ICY A;  3IWA A;  3NNE A;  1L0V A;  2B7S A;  4ZCW A;  2DW6 A;  2QDE A;  2YG3 A;  3BI5 A;  3VFC A;  3NYF A;  3P3B A;  1YQZ A;  3TQP A;  3SSZ A;  3K7Q X;  4OPI A;  1EC7 A;  1OJT A;  2BCG G;  3CT2 A;  1X31 B;  2FBW A;  2GL5 A;  3OW1 A;  1H7W A;  3AE1 A;  3NZG A;  3M0O A;  4AT2 A;  3QSE A;  4NZH A;  3V76 A;  3DFY A;  2XVH A;  4TM1 A;  3SN0 A;  3DJE A;  2OQH A;  1FEA A;  3GC2 A;  3R07 C;  1GRA A;  3FXG A;  2HZG A;  1XHC A;  3GY1 A;  1P2H A;  2P0I A;  4HPN A;  4CBQ A;  2YR4 A;  3LXD A;  2WP6 A;  1K4Q A;  1N5W C;  2WP5 A;  3JZU A;  1GER A;  4MGG A;  2BC0 A;  4KX6 A;  1TZZ A;  1GRB A;  3GMC A;  1D4D A;  3QFA A;  2Y6R A;  2XFP A;  4E5T A;  2DKI A;  2GGI A;  5IPY A;  1KNR A;  4OPG A;  1GV4 A;  1BQG A;  3OPS A;  1GT8 A;  2AKZ A;  4H19 A;  3H12 A;  2C72 A;  2PPG A;  1EC9 A;  2XVJ A;  5DBJ A;  3BOX A;  1DTN A;  3S5W A;  4H4S A;  2GMH A;  3UXK A;  5EB4 A;  3DK4 A;  4MMW A;  2WOW A;  1TDE A;  3LJP A;  1O94 A;  3FV9 A;  4H4Y A;  1ZMD A;  4H4P A;  2WU5 A;  1ONE A;  2WQY A;  3NN6 X;  3AM9 A;  3CNJ A;  3R25 A;  3U9I A;  3ADA B;  5M10 A;  4YKF A;  4B69 A;  3NTA A;  3ZDN A;  2E5A A;  2GR0 A;  1QJD A;  2PCE A;  3FYY A;  3FIM B;  5ER0 A;  1EC8 A;  2GB0 A;  5BUL A;  4DYE A;  3G5Q A;  1NEL A;  1NHR A;  1NAA A;  4TM4 A;  3GRT A;  3AYJ A;  4K1W A;  1VQZ A;  2YG5 A;  3QFB A;  4OPL A;  4AP3 A;  3TWB A;  4H2P A;  2C75 A;  4J33 A;  1PJ7 A;  1WUF A;  1FO4 A;  4I59 A;  3HPF A;  4H2Q A;  2VVL A;  4YSY A;  2QAE A;  4DN1 A;  2VQB A;  3DJD A;  1PBE A;  4U2T A;  3NT6 A;  1N4W A;  1ZK7 A;  4P9S A;  1JU2 A;  5G5G B;  3P4P A;  3NVW B;  3K7T A;  2O9Z A;  3FVD A;  4BK2 A;  2PP0 A;  3V4B A;  5JCN A;  4BUR A;  5GRT A;  3NK1 X;  2R45 A;  3SBF A;  1P43 A;  3G5R A;  1N62 C;  1XAN A;  3NH3 X;  2IID A;  1S3E A;  4IP5 A;  1FHU A;  4H2H A;  3MSY A;  4B65 A;  2HXT A;  1JRX A;  3QTP A;  1JNR A;  3GMB A;  2GH5 A;  5LV9 A;  4JQ9 A;  4FI4 A;  3ITJ A;  4J34 A;  1FCD A;  3URH A;  2H89 A;  4U8I A;  4ZN0 A;  2EQ9 A;  1ZMC A;  3VRD B;  1GES A;  3OTR A;  2JB2 A;  4H50 A;  4IT1 A;  1S7M A;  3Q6J A;  4TLX A;  3OZM A;  1GPE A;  1NHQ A;  2YLT A;  2XCG A;  4USR A;  4YSZ A;  3SJN A;  1XPY A;  2OZ3 A;  5IDZ A;  4U8M A;  2GEW A;  1VQW A;  3VQR A;  2GF3 A;  2W0H A;  3GWF A;  2WDR A;  3NG7 X;  5KVI A;  4RG3 A;  4IA5 A;  4CY8 A;  3VCC A;  2GQF A;  3R1Z A;  2R0G A;  4U8O A;  2NVK X;  2V6O A;  3GDN A;  3UJS A;  4II2 A;  2Q7V A;  5U63 A;  2AL1 A;  3HRD C;  2WPF A;  2PTZ A;  4E0V A;  3MWC A;  2YQU A;  3THU A;  2QJJ A;  4M6U A;  4GAV A;  5EB5 A;  4X4J A;  1SEZ A;  2PU0 A;  3ZYX A;  3GD3 A;  1H7X A;  2PTX A;  4HYR A;  4JY3 A;  2BXS A;  1KF6 A;  1DJQ A;  4REK A;  3IHM A;  1FL2 A;  1YKJ A;  3OP2 A;  1STZ A;  3H8I A;  4IL2 A;  4NEW A;  1EL5 A;  4IVM B;  1IJH A;  2RGO A;  5HHF A;  3V3N A;  3SYI A;  2R0P A;  3SQS A;  1K0J A;  3AD8 B;  4B68 A;  1CJC A;  1GTE A;  2DKH A;  2XFN A;  4TM0 A;  2BK3 A;  4J56 A;  4YWO A;  2GV8 A;  1O5W A;  1BF3 A;  4IHC A;  3AN1 A;  3SN4 A;  1E1L A;  4GGH A;  4A3R A;  2XGZ A;  2VZ2 A;  1WUE A;  3TJI A;  4XXG A;  1NHP A;  3CXO A;  4BK1 A;  3BHF A;  1S2Y A;  1JRY A;  3I3L A;  2C73 A;  2BXR A;  4A79 A;  3FMW A;  3DER A;  4B1B A;  3KKJ A;  1ELI A;  4HCL A;  4DX3 A;  3IC9 A;  2R0C A;  3LB8 A;  4OPD A;  2C76 A;  1JPD X;  1M64 A;  4G9K A;  3VC5 A;  3B97 A;  3CN8 A;  4H2R A;  4ROP A;  4I58 A;  3V5F A;  2QCU A;  3A7U A;  4PAB A;  1Q9I A;  2CFY A;  1F8W A;  2Z5X A;  1W6T A;  3DGZ A;  4Y4N A;  2Z5Y A;  3MZN A;  3MY9 A;  2FJB A;  3PVC A;  1S3B A;  5U1O A;  1DOE A;  2YAU A;  1OJ9 A;  3CPJ G;  4K7Z A;  1N61 C;  2W54 A;  2F5Z A;  3HYW A;  2X50 A;  3I6D A;  1D4E A;  3NHO X;  3ABV A;  1WYG A;  2BS3 A;  3AD9 B;  4AOX A;  1P48 A;  2R46 A;  1TDF A;  1RSG A;  1ZXI C;  4GFI A;  5JCK A;  5FS6 A;  2I0Z A;  2JK6 A;  4H7U A;  3ZLH A;  1IUT A;  2EQ6 A;  3EF6 A;  2GR1 A;  3I6E A;  2OPJ A;  1O95 A;  2BYB A;  1JPM A;  4YTN A;  3UOY A;  4KPL A;  1L9D A;  4ZCC A;  2GVC A;  1ZKQ A;  4A6N B;  1GND A;  1NEK A;  2XFQ A;  3IHG A;  3T31 A;  3C4A A;  1LQU A;  4YXD A;  3PWG A;  2FYM A;  3EAN A;  1PBF A;  4H83 A;  2XFO A;  3AEA A;  3ALL A;  5KWF A;  1F8S A;  4A6G A;  1ZOV A;  3BI4 A;  2QQ6 A;  4G73 A;  3P4Q A;  5KMP A;  2XVF A;  3F8D A;  4FK1 A;  1B37 A;  3TTE A;  3CNS A;  4HN8 A;  4EQW A;  2JAE A;  1D5T A;  2QJM A;  1REO A;  1CJ3 A;  1PHH A;  1KD0 A;  1RM6 B;  3PWI A;  3S47 A;  5KVH A;  2V5Z A;  1JEH A;  3ENL A;  1FHV A;  1JOA A;  2XLP A;  5HY5 A;  6ENL A;  1IUW A;  4AT0 A;  4IP4 A;  3CND A;  2QGY A;  3UXL A;  1CF3 A;  3LZX A;  3UCC A;  5EOW A;  1E39 A;  1K0L A;  3D47 A;  3QLD A;  3H8L A;  4JNA A;  4USQ A;  1PJ6 A;  3ICS A;  2C67 A;  4K2S A;  1TYT A;  3CTY A;  3CMM A;  3GSI A;  3VA8 A;  4DXK A;  1PDY A;  4IZG A;  3UKA A;  2EQ8 A;  3Q45 A;  3CGB A;  1KSS A;  2A89 A;  3PK7 A;  3GWD A;  4FX9 A;  3CGE A;  3NYE A;  4NNJ A;  1H6V A;  2BK5 A;  3JW7 A;  3T6C A;  4G6H A;  4LU6 A;  3AYL A;  3UKH A;  2GQW A;  4ZCD A;  3ETR B;  3AEG A;  2CHR A;  4Z17 A;  4APN A;  3SGL A;  3T2K A;  2ZZB A;  2J3N A;  2PP3 A;  1DOB A;  2XLT A;  1F8R A;  4G74 A;  1H82 A;  4HNL A;  3VC6 A;  3GD4 A;  1N63 C;  3A7R A;  1IUV A;  2WU2 A;  3KPF A;  2C4C A;  5ENL A;  3H7V A;  4J1O A;  5BUK A;  2QDD A;  2OFJ A;  3CPI G;  4GUV A;  4JY2 A;  2QJN A;  3BHK A;  2E5V A;  1GRH A;  4TVY A;  3T2Z A;  4EQR A;  3GDP A;  4OPC A;  4AOS A;  3NIX A;  3UJR A;  1CL0 A;  1H83 A;  3KUM A;  3GYJ A;  4KEM A;  3AYI A;  1CJ4 A;  4B64 A;  1X2G A;  4U8N A;  3AEE A;  2WS3 A;  4DSH A;  4DWD A;  3T14 A;  2BRA A;  3AED A;  3AEB A;  4FDC B;  1LTX R;  2FJE A;  3PFR A;  3T4W A;  1BZL A;  5BVA A;  3B6D A;  1D4C A;  2PS2 A;  2XH2 A;  4D04 A;  5KOW A;  4DHG A;  2VQ7 A;  2XLR A;  1X2H A;  3I6T A;  3ATR A;  5L46 A;  2PYX A;  3L8K A;  3CIR A;  4H1Z A;  4EQX A;  3AWI A;  5KOX A;  1JDF A;  1XDI A;  4CCQ A;  3R0K A;  2YR6 A;  1XPQ A;  3UJF A;  1IUS A;  1S2Q A;  1IUU A;  1CHU A;  1JRZ A;  1N5X A;  1E9I A;  2GGJ A;  1DXL A;  3P9U A;  5FJU A;  4U2L A;  3RCY A;  4MKS A;  3Q4D A;  2YG6 A;  4H4W A;  3DIP A;  2PGE A;  4ENL A;  1MO9 A;  2E4G A;  4Z2U A;  1Y56 B;  3WE0 A;  3KA7 A;  2Q6U A;  3DJJ A;  4U8K A;  4GCM A;  3D1C A;  2YWL A;  2OKT A;  2V3B A;  2B7R A;  5J7X A;  3SR6 B;  2E3T A;  5GSN A;  2GAG B;  3Q9T A;  2QA2 A;  7ENL A;  4C3X A;  1B5Q A;  1MNS A;  3R9U A;  3T2Y A;  2V60 A;  3TWA A;  3BNU A;  3N6H A;  5FS8 A;  2C65 A;  3GO2 A;  2BRY A;  3SQP A;  4Z25 A;  2RGH A;  2PTY A;  2ONE A;  4EMJ A;  4NWZ A;  3KVE A;  4A35 A;  2XYO A;  2YG7 A;  1YQ4 A;  4BJY A;  3P93 A;  2OX4 A;  3NVV B;  2GMJ A;  4GDE A;  3CNT A;  1KKO A;  2YVJ A;  1LPF A;  3P0W A;  4TM3 A;  3NVZ B;  1OJC A;  3ICR A;  2AAQ A;  3EEZ A;  1NG3 A;  3ZVH B;  1M6I A;  1PXC A;  3U4F A;  5CQF A;  1CJ2 A;  1BGN A;  2XH0 A;  3R10 A;  1OJD A;  4C3Y A;  3RIT A;  3D9X A;  3CPH G;  3AD7 B;  3HYV A;  1DOD A;  1GRF A;  3UKP A;  2XDO A;  4EIP A;  3VRB A;  1GSN A;  1BGJ A;  4A7A A;  2W55 A;  2BS2 A;  3DES A;  2Q0K A;  5J60 A;  4TLZ A;  3V5C A;  2CVJ A;  3ZLG A;  4EM4 A;  1MRA A;  3EPT A;  1QO8 A;  3QSM A;  1YY5 A;  1GRT A;  3SZ0 A;  2XVI A;  4E4F A;  1QLB A;  4RSL A;  1GRG A;  2B9X A;  3T9P A;  3SZF A;  4D03 A;  3RRA A;  3DJG X;  3PS9 A;  4UDR A;  3SXI A;  2PSN A;  3BSM A;  1PBD A;  3F8R A;  4EMW A;  3K30 A;  3PO7 A;  2YLZ A;  4FP1 A;  2C66 A;  2YM1 A;  3L1R A;  1CC6 A;  3ES8 A;  1OJA A;  3AE2 A;  1FEB A;  5HXI A;  3SM8 A;  5KMQ A;  2X3N A;  3T8Q A;  2PGW A;  2GR2 A;  1UKV G;  1COY A;  2AKM A;  3NN0 X;  1VRQ B;  3RP6 A;  1DNC A;  2JB3 A;  4FK1 C;  4ADW A;  4KT2 A;  2VRM A;  3SN1 A;  3ZLF A;  2A87 A;  3C96 A;  3S5S A;  3DME A;  3TCS A;  3CGC A;  1KCZ A;  1EL7 A;  3ATQ A;  3B9J B;  1BKH A;  4WX1 A;  2IVE A;  4U2S A;  1MOK A;  4YKG A;  2OAM A;  2V61 A;  4GDP A;  1MUC A;  4EMI A;  1EL9 A;  3DEQ A;  1P2E A;  4M52 A;  4GIS A;  2AL2 B;  3UGV A;  4IVO B;  3AE5 A;  4GIR A;  3CGD A;  1GXF A;  4OVI A;  1NHS A;  4H4X A;  2POZ A;  3CXB A;  3KLJ A;  2NPX A;  3CNP A;  3D8X A;  1MXT A;  3V3O A;  2WDV A;  1ZY8 A;  5EU9 A;  4G8T A;  1B8S A;  4HCH A;  3IJI A;  2ZC8 A;  4GGB A;  1KDG A;  3EUB 3;  5M0Z A;  1SJA A;  3UP4 A;  4MJW A;  4HB9 A;  3RO6 A;  4JNQ A;  3DK8 A;  1E1M A;  1GTH A;  2JBV A;  2NQL A;  4CNJ A;  1EBG A;  2GGG A;  5U25 A;  4GME A;  4Y4L A;  2HNE A;  2OO6 A;  5JRB A;  1Q1R A;  1ZX9 A;  3S61 A;  2TPR A;  1LJ1 A;  3JSK A;  1PBB A;  3P4S A;  4H2N A;  1NDA A;  3BNM A;  4J2W A;  1V59 A;  2OG9 A;  2BS4 A;  4Z44 A;  3QVR A;  2EQ7 A;  1TDK A;  2OA1 A;  1Y56 A;  3A7A A;  3IK4 A;  4B67 A;  4G6G A;  2GGH A;  3UOV A;  3DH9 A;  1VDV A;  3RGT A;  2YLR A;  3AXB A;  5TR3 A;  3NGC X;  3OZ2 A;  1R0M A;  1H81 A;  4X9N A;  1NPX A;  2OLN A;  2GSH A;  1V97 A;  3KPK A;  2R4J A;  2JKC A;  1NU5 A;  4EIQ A;  4EM3 A;  2BCP A;  3T0K A;  2OZ8 A;  4GR1 A;  2W3S A;  2PTW A;  3DDM A;  2YVG A;  3AEF A;  2RAB A;  1PS9 A;  4CY6 A;  1GET A;  1D7L A;  3SZW A;  4H4V A;  1SJC A;  5KMR A;  3NLC A;  4NEV A;  3UJ2 A;  2BAB A;  4J57 A;  3KU9 A;  4JN7 A;  3ALJ A;  5FS9 A;  4Z24 A;  2HXU A;  4CNK A;  3RR1 A;  3ZVH A;  1L9E A;  5HYM A;  3P1W A;  2WPC A;  1N1P A;  1ZDL A;  3LZW A;  3G5S A;  1ECQ A;  2XFU A;  3F8P A;  1N4V A;  2GAH B;  4CCR A;  3IJL A;  3DFH A;  4H4T A;  1E6E A;  3NFU A;  4KWS A;  4AP1 A;  5JCL A;  1JCT A;  1N4U A;  1XS2 A;  1GEU A;  4TVW A;  4Z2T A;  4K5R A;  3IJQ A;  3QSS A;  3UKL A;  2P88 A;  1FEC A;  2WDQ A;  4YSX A;  4HCD A;  3K7M X;  1GOS A;  5BRT A;  4A99 A;  4HA6 A;  5FJP A;  1KFY A;  4ECH A;  3FPZ A;  2C3C A;  2YG4 A;  1H84 A;  5J04 A;  2WET A;  2C3D A;  4Z43 A;  1T3Q C;  4Z1Y A;  3C4N A;  3H4K A;  3O0H A;  3UTE A;  2PMQ A;  1KNP A;  2JB1 A;  3B3R A;  2R4E A;  3K1G A;  1LVL A;  4F4R A;  4O5Q A;  2XH4 A;  4YTM A;  1PBC A;  2VRL A;  4ZOH B;  4H4R A;  3CAW A;  4U8P A;  4Z26 A;  4K8G A;  4Y4M A;  2X99 A;  3CYJ A;  1ONF A;  1F3P A;  2OLO A;  5G5H B;  1TDO A;  5JCI A;  3CB3 A;  5FJO A;  3EKG A;  3AE3 A;  4A5L A;  5C3J A;  2WPE A;  2C70 A;  3SZC A;  4NTC A;  1E7P A;  3FBS A;  4K2X A;  4OPT A;  5JCM A;  2WES A;  3SY4 A;  2HQM A;  3D46 A;  2B9W A;  2YLW A;  5IQ1 A;  3NK0 X;  4C5O A;  4UDQ A;  3HYX A;  4A9W A;  2YLS A;  1MDR A;  2PA6 A;  3UJE A;  3ICT A;  2ZBW A;  2W3R A;  3NRN A;  4YSH A;  3NS1 B;  3EAO A;  3FJ4 A;  1TDN A;  2ARD A;  2YLX A;  1MDL A;  3ZVI A;  4X9M A;  2VVM A;  1TKK A;  4YWS A;  4JN8 A;  1K0I A;  3AE6 A;  2GDQ A;  4EWJ A;  1KN0 A;  4KPR A;  1ELS A;  4IA6 A;  3VRA A;  4C74 A;  3SFD A;  2FKP A;  3ES7 A;  1EBD A;  2XSX A;  2AL2 A;  1PN0 A;  3DG3 A;  3IF9 A;  1L9C A;  3PG6 A;  1B4V A;  2ZZC A;  2IVD A;  2WP9 A;  1TRB A;  1VDC A;  5FS7 A;  4IV9 A;  4M0X A;  1IUX A;  1ZP0 A;  4HNC A;  3GYX A;  4H4Z A;  3VR8 A;  2A8X A;  2WEU A;  3HZL A;  3SFE A;  4H4U A;  3NKS A;  2E1M A;  5C2T A;  2QVH A;  4X2P A;  5KRQ A;  1PXB A;  1CC4 A;  2WBA A;  4NTE A;  5KNL A;  3AE8 A;  3TW9 A;  1SJD A;  1YEY A;  4E4U A;  3DGB A;  2C64 A;  2YM2 A;  2B9Y A;  1H86 A;  1YQ3 A;  5FJT A;  3ISH A;  1RYI A;  3COX A;  4EQS A;  2P8C A;  4GRT A;  4RG4 A;  1E1K A;  1RP0 A;  4UP3 A;  3N4E A;  2H88 A;  3JVA A;  1NEN A;  4B66 A;  1AOG A;  3UKK A;  1D7Y A;  3QN3 A;  2GRT A;  2XH7 A;  4GAP A;  2Y6Q A;  3AMZ A;  3AE7 A;  1KKR A;  3H70 A;  4G7F A;  4JHM A;  4H4Q A;  1EL8 A;  4ZA0 A;  3N6J A;  3BJS A;  4CRT A;  2AR8 A;  4J31 A;  3DGH A;  3TJ4 A;  2X8H A;  4Z2R A;  4A6N A;  1IYX A;  3NXL A;  3NK2 X;  4GYP A;  4JN9 A;  4J3Z A;  2OLA A;  2PP1 A;  1DOC A;  1PXA A;  4DNA A;  2WOV A;  5FMH A;  4GYP C;  4OPU A;  3CK5 A;  4K8D A;  3NTD A;  4UDP A;  5CKU A;  2GR3 A;  2BC1 A;  2DW7 A;  2OAL A;  2GGE A;  3HW2 A;  3UTG A;  1F9C A;  2VVL G;  2APG A;  1FIQ B;  3ALM A;  1LV0 A;  3II4 A;  3MUC A;  3T37 A;  2I5Q A;  2OVL A;  3E1T A;  1W4X A;  1SB3 B;  3UCD A;  1DJN A;  1NG4 A;  1SJB A;  1TE6 A;  2VOU A;  3NYC A;  3QVP A;  2OZT A;  3QJ4 A;  3UP5 A;  1KSU A;  2P8B A;  1PDZ A;  3R11 A;  3AEC A;  4BV6 A;  1BKW A;  2X8G A;  3DG6 A;  4U8J A;  4K5S A;  4NTD A;  2V3A A;  2XLU A;  5BOF A;  3RNM A; 
#chains in the Genus database with same CATH homology
 3UOV A;  3DH9 A;  3AYI A;  1CJ4 A;  4YT0 A;  4B64 A;  5EBK A;  4USR A;  4LII A;  2YLR A;  4YSZ A;  2B76 A;  2XVE A;  3AXB A;  5TR3 A;  3NGC X;  4U8N A;  3OZ2 A;  3AEE A;  1HYU A;  1CC2 A;  2X8C A;  1H81 A;  1Z6L A;  4X9N A;  3SXI A;  3P4R A;  3UCL A;  3UTH A;  1Y0P A;  3LAD A;  2WS3 A;  1NPX A;  2FJA A;  1VG0 A;  2OLN A;  4U8M A;  4DSH A;  1Q1W A;  3VR9 A;  3R9U A;  2GEW A;  2AQJ A;  3T14 A;  1VQW A;  4DSG A;  1BWC A;  3VQR A;  2BRA A;  4XWZ A;  3KPK A;  2CDU A;  3AED A;  2GF3 A;  2W0H A;  2R4J A;  2JKC A;  2WDR A;  3GWF A;  4OCG A;  3NG7 X;  1CBO A;  5KVI A;  3AEB A;  4FDC B;  1LQT A;  1LTX R;  3DK9 A;  4RG3 A;  4IA5 A;  4CY8 A;  2FJE A;  4EM3 A;  4EIQ A;  4G6G A;  2BCP A;  3T0K A;  1BZL A;  4GR1 A;  1ZOY A;  5BVA A;  3B6D A;  2C7G A;  2YVG A;  2GQF A;  4N9X A;  2YVF A;  2R0G A;  3UOX A;  3AEF A;  2RAB A;  1PS9 A;  4U8O A;  4C77 A;  4CY6 A;  2NVK X;  2V6O A;  1GET A;  3GDN A;  1D4C A;  5IQ4 A;  1D7L A;  3UKQ A;  4D04 A;  4II2 A;  5KOW A;  2XLS A;  2Q7V A;  2BK4 A;  2VQ7 A;  5U63 A;  2XLR A;  3SZW A;  4H4V A;  3RHA A;  4J36 A;  3AE4 A;  3ATR A;  4A65 A;  2WPF A;  5L46 A;  2PYX A;  4DGK A;  4E0V A;  5KMR A;  3NLC A;  4NEV A;  1F6M A;  3L8K A;  2YQU A;  3CIR A;  2BAB A;  4J57 A;  3KU9 A;  4EQX A;  2RGJ A;  3AWI A;  3ALJ A;  5KOX A;  1XDI A;  3RP8 A;  4CCQ A;  2WOI A;  5FS9 A;  2YR6 A;  4Z24 A;  1XPQ A;  3RP7 A;  4CNK A;  4GAV A;  5EB5 A;  1IUS A;  3RED A;  4X4J A;  1PDH A;  1SEZ A;  1L9E A;  1S2Q A;  3ZYX A;  5HYM A;  3P1W A;  2WPC A;  3GD3 A;  1H7X A;  4U8L A;  1N1P A;  1ZDL A;  4YTP A;  1IUU A;  3LZW A;  3G5S A;  4JY3 A;  1CHU A;  3BI2 A;  2XFU A;  4C5O A;  1JRZ A;  2BXS A;  3F8P A;  1N4V A;  1KF6 A;  1DXL A;  1DJQ A;  3P9U A;  4REK A;  2GAH B;  3IHM A;  1FL2 A;  4LA1 A;  4CCR A;  1YKJ A;  4H4T A;  4U2L A;  1E6E A;  4AP1 A;  3GRS A;  5JCL A;  5KMS A;  1N4U A;  2QA1 A;  3LOV A;  3H8I A;  2YG6 A;  1GEU A;  5KXJ A;  2WHD A;  4NEW A;  4H4W A;  1EL5 A;  4IVM B;  4Z2T A;  3M12 A;  1IJH A;  2RGO A;  5HHF A;  3V3N A;  3KD9 A;  4K5R A;  3SYI A;  2R0P A;  1MO9 A;  2E4G A;  3M13 A;  4PAA A;  4Z2U A;  1Y56 B;  4K22 A;  1K0J A;  3AD8 B;  3WE0 A;  1JNZ A;  4B63 A;  1FOH A;  4B68 A;  1TYP A;  1CJC A;  3QSS A;  2BAC A;  3KA7 A;  1GTE A;  2DKH A;  2XFN A;  4TM0 A;  3UKL A;  2BK3 A;  2Q6U A;  3AB1 A;  1FEC A;  1H2I A;  2WDQ A;  4J56 A;  4YWO A;  4YSX A;  2GV8 A;  3K7M X;  4GF7 A;  1GOS A;  5BRT A;  1O5W A;  4JDR A;  3DJJ A;  1BF3 A;  3L5O A;  1E1L A;  4U8K A;  4A99 A;  4GCM A;  3D1C A;  2FJD A;  2YWL A;  4WCT A;  2V3B A;  2ZZ0 A;  4HA6 A;  2B7R A;  3DA1 A;  3GYI A;  5J7X A;  2PHH A;  2VZ2 A;  1KFY A;  1GAL A;  4BJZ A;  5GSN A;  4ECH A;  3FPZ A;  2C3C A;  2YG4 A;  1H84 A;  2GAG B;  3Q9T A;  2WET A;  4XXG A;  1NHP A;  2QA2 A;  2C3D A;  4BK1 A;  4Z43 A;  4II3 A;  3BHF A;  4C3X A;  3UKF A;  1B5Q A;  1S2Y A;  3C4N A;  1JRY A;  3H4K A;  3O0H A;  1PJ5 A;  2C73 A;  2V60 A;  1KNP A;  3B3R A;  2JB1 A;  2UZZ A;  2BXR A;  3BNU A;  2R4E A;  4A79 A;  5FS8 A;  2C65 A;  2R9Z A;  1LVL A;  2BRY A;  3FMW A;  3AE9 A;  3SQP A;  4Z25 A;  1VG9 A;  2RGH A;  1E1N A;  4O5Q A;  4B1B A;  3OC4 A;  4EMJ A;  4YTM A;  1PBC A;  2YR5 A;  3KKJ A;  4NWZ A;  1ELI A;  2VRL A;  3KVE A;  4H4R A;  4XWR A;  3IC9 A;  2XYO A;  2BA9 A;  2R0C A;  1YQ4 A;  2YG7 A;  4U8P A;  4Z26 A;  1GRE A;  4Y4M A;  4BJY A;  3LB8 A;  3UOZ A;  2X99 A;  4OPD A;  3SX6 A;  3FG2 P;  2ACZ A;  2GMJ A;  2C76 A;  2Q0L A;  1ONF A;  1M64 A;  4G9K A;  1F3P A;  4O5U A;  4BK3 A;  4GDE A;  3CNT A;  2OLO A;  2YVJ A;  1LPF A;  1TDO A;  2CUL A;  3CN8 A;  5JCI A;  3AE3 A;  4H2R A;  4A5L A;  2TMD A;  5C3J A;  3UTF A;  4I58 A;  2WPE A;  4ICY A;  4TM3 A;  2C70 A;  1OJC A;  3IWA A;  3SZC A;  2QCU A;  3ICR A;  3NNE A;  2AAQ A;  4NTC A;  1L0V A;  4PAB A;  1Q9I A;  1E7P A;  2CFY A;  1NG3 A;  2B7S A;  3FBS A;  4K2X A;  5JCM A;  4OPT A;  2YG3 A;  2WES A;  1F8W A;  3BI5 A;  1M6I A;  1PXC A;  3SY4 A;  5CQF A;  1CJ2 A;  1BGN A;  2Z5X A;  3NYF A;  3DGZ A;  1YQZ A;  4Y4N A;  1OJD A;  2HQM A;  4C3Y A;  2Z5Y A;  3PVC A;  2FJB A;  3K7Q X;  1S3B A;  4OPI A;  2B9W A;  1OJT A;  5U1O A;  1DOE A;  2YLW A;  2BCG G;  5IQ1 A;  2YAU A;  3D9X A;  3CPH G;  1OJ9 A;  1X31 B;  2FBW A;  3AD7 B;  3HYX A;  3NK0 X;  4UDQ A;  4A9W A;  2YLS A;  3HYV A;  1DOD A;  3CPJ G;  1GRF A;  1H7W A;  3UKP A;  4K7Z A;  2XDO A;  4EIP A;  3VRB A;  3AE1 A;  2F5Z A;  3HYW A;  3ICT A;  1GSN A;  2ZBW A;  2X50 A;  1BGJ A;  3M0O A;  3I6D A;  4A7A A;  1D4E A;  2BS2 A;  4AT2 A;  3QSE A;  3NHO X;  3ABV A;  3NRN A;  4NZH A;  3V76 A;  4YSH A;  2BS3 A;  2Q0K A;  3AD9 B;  4AOX A;  3EAO A;  5J60 A;  4TLZ A;  1TDN A;  2R46 A;  2ARD A;  2YLX A;  1TDF A;  2XVH A;  2CVJ A;  4TM1 A;  4X9M A;  3DJE A;  4EM4 A;  2VVM A;  1RSG A;  1FEA A;  3EPT A;  1QO8 A;  1K0I A;  5JCK A;  3AE6 A;  1GRA A;  1KN0 A;  4KPR A;  5FS6 A;  2I0Z A;  2JK6 A;  1XHC A;  4H7U A;  1IUT A;  3QSM A;  1P2H A;  2EQ6 A;  3EF6 A;  4IA6 A;  1YY5 A;  2GR1 A;  4CBQ A;  1GRT A;  2YR4 A;  3SZ0 A;  1O95 A;  2XVI A;  3LXD A;  2WP6 A;  1K4Q A;  1QLB A;  4RSL A;  3VRA A;  4C74 A;  2BYB A;  1GRG A;  2WP5 A;  3SFD A;  1EBD A;  2B9X A;  1GER A;  4YTN A;  3SZF A;  4D03 A;  3UOY A;  2BC0 A;  4KX6 A;  1L9D A;  1PN0 A;  4ZCC A;  2GVC A;  3DJG X;  1ZKQ A;  1L9C A;  3PG6 A;  3IF9 A;  4A6N B;  3PS9 A;  1B4V A;  1GND A;  1NEK A;  1GRB A;  2ZZC A;  2XFQ A;  3GMC A;  3IHG A;  1D4D A;  4UDR A;  3QFA A;  2Y6R A;  2XFP A;  2WP9 A;  2IVD A;  3C4A A;  3T31 A;  2DKI A;  1TRB A;  5IPY A;  1KNR A;  1VDC A;  1PBD A;  1LQU A;  5FS7 A;  4OPG A;  4IV9 A;  4YXD A;  1GV4 A;  1IUX A;  3F8R A;  4EMW A;  1GT8 A;  1ZP0 A;  2YLZ A;  3K30 A;  3PO7 A;  2C66 A;  2C72 A;  2YM1 A;  3EAN A;  3GYX A;  4H4Z A;  3L1R A;  1CC6 A;  1PBF A;  3VR8 A;  2A8X A;  2WEU A;  1OJA A;  2XVJ A;  2XFO A;  3AEA A;  5DBJ A;  3AE2 A;  3HZL A;  1FEB A;  3ALL A;  3SFE A;  5HXI A;  1F8S A;  5KWF A;  4H4U A;  3SM8 A;  1ZOV A;  5KMQ A;  3BI4 A;  3NKS A;  2E1M A;  3I3L A;  2X3N A;  4G73 A;  3S5W A;  4H4S A;  2GMH A;  3P4Q A;  5C2T A;  5KMP A;  5KRQ A;  1PXB A;  2XVF A;  5EB4 A;  3DK4 A;  3F8D A;  2WOW A;  1CC4 A;  2WBA A;  1TDE A;  4FK1 A;  2GR2 A;  1B37 A;  1UKV G;  3LJP A;  4NTE A;  3CNS A;  5KNL A;  1COY A;  3AE8 A;  1O94 A;  4EQW A;  3NN0 X;  1VRQ B;  2C64 A;  3RP6 A;  4H4Y A;  2JAE A;  2YM2 A;  1ZMD A;  4H4P A;  1DNC A;  1D5T A;  2JB3 A;  1REO A;  1CJ3 A;  1PHH A;  2B9Y A;  2WU5 A;  1H86 A;  1YQ3 A;  4FK1 C;  4ADW A;  2WQY A;  3ISH A;  5KVH A;  1RYI A;  2V5Z A;  3COX A;  1JEH A;  4EQS A;  4GRT A;  1JOA A;  3NN6 X;  4RG4 A;  3CNJ A;  2XLP A;  5HY5 A;  1E1K A;  1RP0 A;  1IUW A;  4AT0 A;  4UP3 A;  2VRM A;  3ADA B;  5M10 A;  2A87 A;  3C96 A;  4YKF A;  4B69 A;  3CND A;  3NTA A;  2H88 A;  3DME A;  3ZDN A;  1CF3 A;  2GR0 A;  1QJD A;  3LZX A;  1NEN A;  3CGC A;  3FIM B;  5EOW A;  1E39 A;  1EL7 A;  3ATQ A;  5ER0 A;  4B66 A;  1AOG A;  2GB0 A;  1K0L A;  3UKK A;  4WX1 A;  5BUL A;  1D7Y A;  2IVE A;  3G5Q A;  3H8L A;  4JNA A;  2GRT A;  4U2S A;  1MOK A;  4GAP A;  4USQ A;  4YKG A;  2Y6Q A;  1NHR A;  1NAA A;  4TM4 A;  3GRT A;  3AE7 A;  2OAM A;  3AYJ A;  1PJ6 A;  2YG5 A;  3QFB A;  4H4Q A;  2C67 A;  3ICS A;  2V61 A;  4GDP A;  4EMI A;  1EL9 A;  1TYT A;  1EL8 A;  3CTY A;  4OPL A;  4AP3 A;  3CMM A;  4H2P A;  3GSI A;  4CRT A;  1P2E A;  2AR8 A;  3UKA A;  4J31 A;  2C75 A;  4M52 A;  4J33 A;  1PJ7 A;  3DGH A;  4IVO B;  2EQ8 A;  2X8H A;  4Z2R A;  3AE5 A;  4A6N A;  3CGB A;  1KSS A;  2A89 A;  4I59 A;  3GWD A;  3NK2 X;  2VVL A;  3CGD A;  1GXF A;  4H2Q A;  4YSY A;  4FX9 A;  2QAE A;  3CGE A;  2VQB A;  3DJD A;  1PBE A;  4JN9 A;  4OVI A;  3NYE A;  4U2T A;  3NT6 A;  4NNJ A;  1H6V A;  1NHS A;  1ZK7 A;  4H4X A;  1N4W A;  2BK5 A;  4P9S A;  3KLJ A;  2NPX A;  3CNP A;  3D8X A;  1JU2 A;  1MXT A;  1DOC A;  1PXA A;  4G6H A;  3V3O A;  2WDV A;  4LU6 A;  3AYL A;  4DNA A;  2WOV A;  5FMH A;  3P4P A;  1ZY8 A;  3UKH A;  2GQW A;  1B8S A;  4ZCD A;  3AEG A;  3K7T A;  4OPU A;  2O9Z A;  4K8D A;  1KDG A;  4BK2 A;  5JCN A;  3NTD A;  4BUR A;  4APN A;  4UDP A;  5M0Z A;  5CKU A;  5GRT A;  2GR3 A;  2BC1 A;  2R45 A;  3NK1 X;  3SGL A;  3T2K A;  2ZZB A;  4MJW A;  3UP4 A;  2OAL A;  3G5R A;  1XAN A;  2J3N A;  1DOB A;  2IID A;  3NH3 X;  1S3E A;  2XLT A;  1F8R A;  4HB9 A;  4G74 A;  1H82 A;  3UTG A;  3GD4 A;  2VVL G;  4JNQ A;  3DK8 A;  1E1M A;  2APG A;  1IUV A;  1GTH A;  2WU2 A;  2JBV A;  3KPF A;  4CNJ A;  3T2Y A;  3ALM A;  1LV0 A;  5U25 A;  2C4C A;  4B65 A;  3II4 A;  1JRX A;  3T37 A;  4Y4L A;  1JNR A;  5BUK A;  3E1T A;  1W4X A;  5JRB A;  3GMB A;  1Q1R A;  2GH5 A;  1ZX9 A;  3CPI G;  3S61 A;  4GUV A;  2TPR A;  3UTE A;  5LV9 A;  4JQ9 A;  1DJN A;  1NG4 A;  4JY2 A;  1LJ1 A;  2VOU A;  3BHK A;  3ITJ A;  3JSK A;  3NYC A;  3QVP A;  4J34 A;  1PBB A;  1FCD A;  2E5V A;  1GRH A;  3URH A;  2H89 A;  1NDA A;  3P4S A;  4H2N A;  4U8I A;  3QJ4 A;  4ZN0 A;  3UP5 A;  3BNM A;  2EQ9 A;  1KSU A;  1ZMC A;  3VRD B;  1GES A;  4J2W A;  3T2Z A;  1V59 A;  2BS4 A;  4Z44 A;  3QVR A;  2JB2 A;  4EQR A;  3AEC A;  4H50 A;  3GDP A;  4BV6 A;  1BKW A;  2X8G A;  4OPC A;  4AOS A;  4U8J A;  1S7M A;  3Q6J A;  2EQ7 A;  1TDK A;  4TLX A;  2OA1 A;  3NIX A;  1Y56 A;  1CL0 A;  4K5S A;  1GPE A;  4NTD A;  1NHQ A;  2YLT A;  2V3A A;  2XLU A;  4B67 A;  1H83 A;  3RNM A;  2XCG A;  3GYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...