1M6IA

Crystal structure of apoptosis inducing factor (aif)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
481
structure length
459
Chain Sequence
APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 8
publication title DNA binding is required for the apoptogenic action of apoptosis inducing factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 144
structure length 459
sequence length 481
ec nomenclature
pdb deposition date 2002-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1m6iA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1m6iA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1m6iA01
2WPFA 2IVDA 1IUVA 1GPEA 1KNRA 2C72A 3AYIA 3NK1X 2C64A 5TR3A 1JOAA 3DK4A 3VR9A 3C4AA 2VVLG 4LA1A 4JDRA 2GEWA 2WPEA 3CGEA 5U25A 4DSHA 1H7XA 3CNPA 1H86A 1F8WA 4YSXA 5KOWA 3UKAA 4USRA 4B1BA 3F8DA 4BURA 2YVJA 2R0CA 2ZZBA 1D4DA 1P2EA 1QO8A 1RYIA 2XVIA 3GRTA 4A7AA 2FJAA 2GH5A 1E1KA 1DJQA 1XPQA 3RP6A 2BCGG 3BI5A 1PXCA 2C67A 3NT6A 2BC1A 1KSSA 1OJCA 3UOYA 2APGA 5FMHA 2HQMA 2BK5A 2YR4A 1TDNA 1P2HA 2GR0A 4YTMA 5BRTA 4IVMB 4CRTA 1D4CA 1DJNA 1GRBA 1NHQA 1NEKA 2C7GA 2WU2A 4FK1A 3SM8A 2C3CA 4C74A 3CNTA 2YG4A 4U2TA 1RP0A 5JCKA 3DJDA 4HB9A 2VRLA 4DGKA 3AEEA 2GAHB 2YM2A 1DNCA 4U8MA 2EQ6A 2ZZCA 2WHDA 2BACA 4OPIA 1E6EA 1N1PA 3CIRA 3P4QA 3VRDB 4B63A 2BXSA 1CC4A 1PBCA 2VVMA 4OCGA 3KD9A 1H7WA 4CNKA 4FX9A 4U8JA 5HHFA 5HXIA 4ZCCA 2WP6A 3UP4A 3CGDA 4TM3A 4LIIA 3BHKA 3UKFA 4D04A 3ALJA 2YWLA 3NNEA 3LXDA 4AP1A 1Z6LA 1CJCA 3WE0A 4H4UA 1JU2A 5L46A 2WOVA 4J36A 1ZP0A 1B4VA 5JCLA 3AD8B 3K30A 4C5OA 4XXGA 2GVCA 4AT2A 3NN6X 5EB5A 4YWOA 1NG3A 1BZLA 1GRAA 3UCLA 2BS3A 3SFEA 5C3JA 2Z5XA 1JNZA 4EQWA 2I0ZA 2JB2A 4BK3A 4YSHA 5JCNA 1GETA 1E1NA 1KNPA 4J31A 4TLZA 1EL7A 2YLSA 2Q0KA 2W0HA 3CN8A 3ATRA 3UP5A 2XLUA 4UDQA 1FOHA 1TDFA 3ISHA 2B9XA 2C65A 3AEGA 1GREA 1IUSA 3SQPA 4I58A 2YG6A 2R4EA 5DBJA 4X4JA 1XANA 1JNRA 2V5ZA 3AWIA 4A65A 3GYIA 1NHPA 3ICTA 4OPGA 4U8PA 3T37A 2C76A 1E1MA 2ZBWA 2A8XA 3P1WA 4OPDA 3AEFA 4Z44A 1GERA 2XFNA 5GRTA 4H7UA 1ZDLA 1MXTA 3PO7A 3CPHG 2GAGB 3CPIG 1FEAA 1PHHA 4APNA 1F6MA 5JCMA 2WOIA 1CJ4A 4O5QA 1FL2A 3DK9A 2FBWA 4YT0A 4FDCB 3FBSA 4EMIA 3AE5A 2X3NA 1DOEA 3AE6A 3VRBA 4NTEA 3H4KA 2WBAA 3P9UA 1TDKA 1ZOVA 2WEUA 1W4XA 2GR1A 1VRQB 1IUWA 4JY3A 3UKHA 1NDAA 1YKJA 2OAMA 5GSNA 1D5TA 1Y56A 2FJEA 3AEBA 1EBDA 3AE2A 3L8KA 4H2QA 3NYEA 1Q1WA 5FS6A 3I3LA 3R9UA 3V3NA 3VQRA 4MJWA 4J33A 4CY6A 3URHA 4H2NA 4E0VA 1OJAA 3EPTA 1PN0A 4B65A 4H4WA 4C77A 2XFPA 1ZMCA 1H81A 4U2SA 1B8SA 2OALA 3AE9A 1N4VA 3CNDA 1L9CA 3NTDA 4Z24A 3UKPA 2R0GA 3G5SA 4OPCA 1CC6A 1EL8A 3GMBA 4H2PA 4KX6A 3AEDA 2F5ZA 1GTHA 4USQA 1CHUA 2E1MA 1ZOYA 1VG0A 3DA1A 3NH3X 1IUXA 5FS7A 4H4ZA 5ER0A 1GRGA 4IA6A 3QSSA 2DKIA 1DXLA 4Y4LA 1GNDA 2B7SA 2H88A 2H89A 2ZZ0A 3BHFA 1GTEA 4TLXA 3IWAA 2WDRA 5HY5A 3GYJA 3NRNA 2XLPA 4IA5A 3GD3A 2QA2A 3KPFA 2GB0A 2GMHA 1D4EA 1OJ9A 4WCTA 3M13A 1SEZA 2OLOA 4OVIA 1NPXA 3AE1A 3BI4A 2VQ7A 2WDQA 4TM0A 3KU9A 1YQZA 1VDCA 1B5QA 2B9WA 4K5RA 5CQFA 3PVCA 2E4GA 4NTCA 3OC4A 5JCIA 1CBOA 1YQ4A 3OZ2A 4U8OA 2Y6RA 4H4RA 4NEVA 4RG3A 5U1OA 1ZX9A 4ZN0A 4ADWA 3ABVA 2NVKX 1Y0PA 2WP5A 3AE4A 3L1RA 3ITJA 3G5QA 4CCRA 3CNSA 5LV9A 4EIPA 2XVFA 3P4RA 1GV4A 3F8RA 2EQ8A 2JKCA 2YVFA 3H8IA 3VR8A 1Q9IA 3E1TA 2B9YA 4EQSA 3P4PA 4GUVA 5BVAA 4K22A 3D8XA 1PBDA 2XFOA 2WPCA 4U8LA 1NAAA 3UTEA 4YTPA 2JB3A 4RG4A 4EMWA 1XHCA 1PJ6A 2ARDA 5BULA 4PAAA 2XVHA 2XVJA 1NENA 2V6OA 3BI2A 3NYFA 2BS2A 4AT0A 4GDPA 3QVPA 4CBQA 1DOCA 1PBFA 1OJTA 1F8SA 3AYJA 4J34A 3DGHA 3FG2P 4IV9A 2JBVA 2R0PA 1ZK7A 2XCGA 4A99A 2OLNA 2XLTA 1VG9A 3QVRA 4EQRA 2C70A 3IF9A 1K0JA 4NEWA 1KF6A 3LZWA 3UOVA 2YLRA 4DSGA 1MOKA 2A87A 3AB1A 1BGJA 3LOVA 3II4A 1KSUA 2VVLA 3M12A 1LJ1A 1TDOA 3IHGA 3JSKA 3Q9TA 2WOWA 2WS3A 2BC0A 1PXAA 3C4NA 3AEAA 4K7ZA 2JAEA 4B67A 3FIMB 1L9DA 4BV6A 2R46A 1L0VA 4D03A 4JY2A 4GDEA 1JRYA 4C3XA 2VRMA 1NG4A 3DH9A 4A6NA 2GQWA 1NHSA 2V3BA 1QJDA 3KA7A 1GOSA 3S61A 3HZLA 5FS9A 3H8LA 4H4VA 1OJDA 1ZKQA 3RHAA 2YLXA 4K8DA 4P9SA 4U8KA 1HYUA 1COYA 2WETA 2C3DA 3IC9A 3B3RA 3NIXA 2YQUA 4DNAA 4JNQA 4TM4A 4JNAA 2GRTA 4OPLA 4M52A 4NZHA 4X9NA 5C2TA 1ONFA 3DJEA 3AE7A 2X8CA 3NHOX 3REDA 3NYCA 1JEHA 4Z2RA 3KKJA 2BXRA 2C66A 2GQFA 4YSZA 3CTYA 4HA6A 4AP3A 1REOA 1H6VA 4BJYA 4H2RA 3GMCA 1Y56B 1GESA 3D1CA 4YSYA 5IPYA 1BWCA 5J7XA 1TDEA 4H4SA 1PJ5A 1LVLA 3GWFA 3SGLA 3UTHA 1ZY8A 2Z5YA 4REKA 3UTGA 5HYMA 3LADA 1GEUA 2B7RA 4A79A 1AOGA 2TMDA 1H83A 3CNJA 2GR3A 2RABA 1FEBA 1O94A 2FJDA 2V61A 3NKSA 2IVEA 3RP8A 2YR5A 2QAEA 4B68A 2XVEA 3KVEA 4AOSA 1BKWA 1PDHA 1N4UA 4BK2A 3NLCA 4JQ9A 4BJZA 3BNMA 1PS9A 3K7TA 1CJ2A 4OPTA 3AYLA 4Z26A 3GDNA 3ALLA 1TYPA 1Q1RA 3GDPA 1NHRA 2GV8A 4I59A 2R9ZA 2E5VA 4U2LA 5EBKA 2WP9A 3UKLA 1MO9A 2BK4A 3NN0X 4J57A 2BCPA 4BK1A 3ICSA 4PABA 2XDOA 3CGBA 3DGZA 2C73A 4KPRA 3RNMA 1ELIA 4Z2TA 4RSLA 2Y6QA 1EL5A 1DODA 2VQBA 2QA1A 1V59A 2X8HA 2YR6A 2GR2A 3AE8A 4K2XA 1L9EA 2WDVA 1QLBA 3F8PA 4H4XA 3K7QX 5KVHA 2V60A 3UTFA 3O0HA 2BS4A 2JK6A 2IIDA 4YXDA 1KFYA 3LJPA 2WESA 3AD7B 3SFDA 1CJ3A 3NGCX 1IUUA 3VRAA 3DMEA 3G5RA 3AD9B 2B76A 3NK2X 3UKKA 2XYOA 4EM3A 1S3EA 4CCQA 4YKFA 3UOXA 2AAQA 3BNUA 1TRBA 2YG3A 4Z2UA 1LQUA 5KXJA 2YG7A 2QCUA 3ATQA 4Z43A 3GWDA 5FS8A 5M0ZA 2Q6UA 3PS9A 3ZYXA 5CKUA 4JN9A 1XDIA 1M6IA 3LZXA 1GRTA 4NTDA 4UDPA 3K7MX 4FK1C 2C75A 3GD4A 2CULA 2J3NA 3ALMA 3COXA 1BF3A 4A9WA 4H4QA 1CL0A 2XLRA 3C96A 3QFBA 1D7LA 1GRHA 2EQ9A 3ICRA 2YVGA 4TM1A 3NTAA 2JB1A 2XFUA 4U8NA 5KVIA 1VQWA 4EM4A 2CDUA 3Q6JA 1E1LA 2BK3A 3LB8A 4IVOB 4K5SA 5U63A 1FECA 4LU6A 1GT8A 1LQTA 1YY5A 2FJBA 1PJ7A 2YG5A 3FMWA 1KDGA 2R45A 4B66A 2UZZA 3I6DA 1H84A 2A89A 4UDRA 2AQJA 3QFAA 3B6DA 3CPJG 2BA9A 4Z25A 4B64A 1DOBA 4GRTA 2NPXA 5IQ1A 4A6NB 3QJ4A 5M10A 4YKGA 1O5WA 1K0IA 5EOWA 4A5LA 2RGJA 2CVJA 4EQXA 3ADAB 2PYXA 4N9XA 4EIQA 3EANA 4XWRA 5J60A 4J2WA 3AECA 1ZMDA 4ECHA 1E39A 3AXBA 4H4TA 2BABA 4J56A 1JRZA 2WU5A 1LPFA 3NG7X 4GF7A 4U8IA 3RP7A 1IJHA 2X8GA 1CC2A 1FCDA 3FPZA 2XFQA 3UKQA 2OA1A 4ICYA 3V3OA 1EL9A 1K0LA 4C3YA 1PBEA 2GMJA 1PBBA 4AOXA 2DKHA 1GALA 1D7YA 2VZ2A 2YM1A 3M0OA 4OPUA 4ZCDA 1F3PA 2ACZA 1N4WA 5BUKA 3QSMA 2RGHA 4Y4NA 2YLTA 1H82A 1CF3A 3NK0X 3S5WA 1M64A 2R4JA 3ZDNA 4CNJA 1B37A 2X99A 1S2YA 4WX1A 1LTXR 5KRQA 2WQYA 1LV0A 3V76A 1RSGA 4B69A 3KLJA 4YTNA 3EAOA 5IQ4A 1IUTA 2V3AA 4H50A 3GSIA 2YLWA 2EQ7A 2CFYA 2YAUA 2BYBA 1O95A 2YLZA 4X9MA 2O9ZA 1E7PA 3CGCA 3QSEA 3UOZA 5KOXA 5KWFA 2TPRA 3DJGX 3DJJA 2GF3A 4XWZA 1YQ3A 1BGNA 4H4PA 1S3BA 4GCMA 5EB4A 3IHMA 3DK8A 1JRXA 1GRFA 1F8RA 1UKVG 4Y4MA 4O5UA 2X50A 1GSNA 1PXBA 3GRSA 4H4YA 1GXFA 2PHHA 2Q7VA 2RGOA 4EMJA 2VOUA 3AE3A 2Q0LA 4CY8A 2XLSA 3P4SA 1TYTA 4GR1A 1X31B 2AR8A 1S2QA 1K4QA 4UP3A 3EF6A
chains in the Genus database with same CATH superfamily
1IUVA 3NK1X 4KT2A 2C64A 3IJQA 1R6WA 3CXBA 2GGIA 4USRA 2ZZBA 3GRTA 3AMZA 1DJQA 4ZCWA 1KSSA 2APGA 4ZA0A 2PPGA 2HQMA 2BK5A 1SJBA 2E3TA 1D4CA 4FK1A 3GD6A 3A7UA 4HN8A 2YG4A 5JCKA 3B9JB 2EQ6A 2RDXA 2BACA 4OPIA 1E6EA 3VRDB 1PBCA 3KD9A 4CNKA 4DYEA 4U8JA 5HHFA 5HXIA 4ZCCA 4E4UA 3QLDA 3UP4A 4EWJA 4TM3A 4LIIA 3UKFA 3ALJA 2OO6A 4GGBA 3NNEA 3LXDA 4AP1A 1SJDA 2WOVA 1ZP0A 3AD8B 3K30A 3MZNA 3QKEA 3ZLGA 4YWOA 1GRAA 3TQPA 5C3JA 2Z5XA 1JNZA 4GIRA 4EQWA 2I0ZA 4BK3A 4J31A 4TLZA 4HCDA 2Q0KA 2W0HA 3CN8A 2PS2A 3UP5A 4UDQA 2QVHA 3BJSA 2GGEA 3ISHA 4I58A 3D9XA 1RVKA 4ROPA 5DBJA 1JNRA 4A65A 3ETRB 1NHPA 3ICTA 4HNLA 1E1MA 3MY9A 2PGEA 2ZBWA 4JHMA 3AEFA 4Z44A 5GRTA 3NO1A 3PO7A 3CPHG 2GAGB 4A3RA 1EC9A 1F6MA 2WOIA 2PSNA 3FBSA 2AL1A 3IK4A 1DOEA 4NTEA 2WEUA 4GGHA 3VCCA 1VRQB 3ZVHA 3RRAA 1YEYA 2ZADA 1NDAA 2XH2A 5FS6A 3FXGA 4H2NA 4E0VA 4H4WA 1B8SA 4Z24A 3SR6B 1CC6A 3T2ZA 4USQA 3QPEA 1IUXA 5ER0A 3U9IA 1FHVA 1GNDA 2H88A 2H89A 2HXTA 3S5SA 1GTEA 4TLXA 4IA5A 3GD3A 2QA2A 2GB0A 2OLOA 4IL2A 3BI4A 3MUCA 3FCPA 1YQZA 1B5QA 3KPKA 4K5RA 3PVCA 3DG7A 3OC4A 4NWZA 2OFJA 2Y6RA 2NVKX 4HNCA 4G73A 5BOFA 3UXKA 3SJNA 3VR8A 3H8IA 3D8XA 1PBDA 1NAAA 2JB3A 4RG4A 1XHCA 3UCCA 5BULA 4PAAA 2XVJA 1NENA 4AT0A 5FJPA 2GGHA 3QVPA 4CBQA 4IP5A 3AYJA 1E9IA 2OLNA 2C70A 2A87A 1KSUA 3PFRA 3R25A 3FIMB 1KKOA 2PU1A 3DIPA 3SX6A 1FHUA 3D46A 1N60C 2QDDA 1NHSA 4E5TA 1QJDA 1IYXA 3H8LA 1OEPA 4U8KA 3P93A 1COYA 2OZTA 3B3RA 2YQUA 3ZLHA 4JNQA 4TM4A 4JNAA 2GRTA 4M52A 4GYPC 1ONFA 4Z2RA 4YWSA 2ZC8A 2C66A 4YSZA 4HA6A 4KEMA 3ZVHB 1H6VA 4H2RA 2PTXA 3DEQA 3T0KA 4H4SA 1PJ5A 3SGLA 3R10A 3UTGA 3PWIA 1AOGA 2GR3A 2RABA 2V61A 2YR5A 2XVEA 3KVEA 4AOSA 1BKWA 4MKSA 1PDHA 1N4UA 4BK2A 2XH7A 1S7MA 4H2HA 3BNMA 3K7TA 4Z26A 3STPA 3ES8A 4U2LA 4J57A 2XDOA 2C73A 3DGZA 2GGGA 1JROA 2Y6QA 3H8AA 1EL5A 1DODA 1L9EA 2PTZA 2WDVA 3F8PA 2V60A 3O0HA 1KFYA 3AD7B 1CJ3A 3U4FA 3AD9B 3VC6A 3OTRA 3UOXA 1EBHA 4K1WA 5FJOA 2YG3A 5KXJA 5FS8A 3ZYXA 2P8CA 4JN9A 1XDIA 1M6IA 3LZXA 4H1ZA 4FK1C 2C75A 3GD4A 3ALMA 2J3NA 4H4QA 1CL0A 2XLRA 3C96A 2XFUA 3PWGA 5KVIA 2CDUA 3Q6JA 1GT8A 1LQTA 1YY5A 2R45A 5IDZA 2UZZA 4UDRA 3SY4A 3B6DA 2CVJA 2PYXA 1ONEA 4N9XA 3OZMA 4EIQA 3R0UA 2BABA 1T3QC 3NG7X 5KNLA 3FPZA 1EL9A 1PBBA 2YM1A 1F3PA 3QSMA 2PTYA 4Y4NA 1M64A 2R4JA 3ZDNA 4CNJA 3T9PA 4B69A 3ZLFA 4YTNA 2V3AA 2YLZA 1E7PA 3VCNA 2GF3A 4GFIA 1BGNA 4H4PA 5EB4A 3IHMA 3DK8A 1PXBA 3SZ0A 1R0MA 4H4YA 4EMJA 4CY8A 3RO6A 3P4SA 1TYTA 4GR1A 2MNRA 2AR8A 1S2QA 2IVDA 1KNRA 2C72A 3VR9A 5TR3A 4II3A 2VVLG 4LA1A 4JDRA 3RCYA 2GEWA 4YSXA 3UKAA 3R11A 2HXUA 4BURA 3F8DA 1D4DA 1P2EA 3SXIA 4A7AA 2FJAA 1OJCA 3THUA 1P2HA 2GR0A 4YTMA 4IVMB 4NNJA 3DGBA 1DJNA 1NHQA 1NEKA 3SM8A 2C3CA 2P0IA 3DJDA 2GAHB 4B63A 3P4QA 4GISA 1EBGA 3V5FA 1WUFA 3N6JA 3RR1A 4E8GA 3FVDA 3I4KA 2YWLA 1Z6LA 3WE0A 2XSXA 5L46A 3SQSA 4XXGA 4GMEA 2GVCA 1NG3A 3UCLA 2JB2A 1E1NA 1BKHA 3MKCA 5G5GB 3V5CA 3S47A 4ZOHB 2C65A 5KMSA 3DESA 1GREA 1IUSA 3SQPA 2R4EA 4U8PA 3P1WA 1FEAA 4APNA 3DG6A 1FL2A 4FDCB 2W54A 2X3NA 3AE6A 2WBAA 3P9UA 1JCTA 1W4XA 2HZGA 1IUWA 4JY3A 3UKHA 2OAMA 3SSZA 1D5TA 2FJEA 4H2QA 3NYEA 1Q1WA 3R9UA 4FP1A 4M6UA 1OJAA 4B65A 4C77A 2PTWA 2OALA 3AE9A 1N4VA 4HPNA 1EL8A 2OVLA 3GMBA 2F5ZA 1GTHA 1F9CA 1VG0A 3NH3X 5FS7A 2DKIA 2B7SA 3EKGA 3BHFA 5HY5A 3GYJA 2XLPA 3KPFA 3M13A 2VQ7A 4TM0A 2B9WA 3NZGA 1STZA 4NTCA 1CBOA 4H4RA 4NEVA 5ENLA 5U1OA 4ADWA 1X2HA 3T8QA 4CCRA 5LV9A 4EIPA 2XVFA 5KMRA 2EQ8A 2JKCA 2YVFA 1Q9IA 3E1TA 2B9YA 3P4PA 4TVYA 4K22A 2WPCA 3NS1B 4YTPA 4EMWA 2XVHA 3NYFA 1F8SA 4J34A 2JBVA 2R0PA 2XCGA 4K2SA 2OPJA 3QVRA 1K0JA 4NEWA 1KF6A 4E4FA 1LJ1A 3JSKA 3Q9TA 2WOWA 2BC0A 1PXAA 4K7ZA 4JY2A 1XPYA 2VRMA 4A6NA 2GQWA 3TTEA 5FS9A 1OJDA 1ZKQA 1ZXIC 3UJSA 4G7FA 2C3DA 4DNAA 3BOXA 4X9NA 2BRAA 4NZHA 3AE7A 2X8CA 3NHOX 3REDA 3HYVA 3NYCA 3EUB3 4GAPA 3CTYA 1REOA 4BJYA 3GMCA 1W6TA 3D1CA 4YSYA 1LVLA 3UTHA 1DTNA 5HYMA 4A79A 3CYJA 2IVEA 2DW6A 2PP0A 1CJ2A 4OPTA 3GDNA 5EBKA 2WP9A 1MO9A 3NN0X 2BCPA 4KPRA 3RNMA 4RSLA 2QA1A 2YR6A 2GR2A 3K7QX 3UTFA 4YXDA 4DX3A 3SFDA 3VRAA 3G5RA 3NK2X 3IJIA 2XYOA 4EM3A 4CCQA 4IL0A 1EC8A 3ATQA 4Z43A 2Q6UA 3PS9A 3TWAA 4NTDA 4UDPA 3K7MX 3COXA 3QFBA 1D7LA 3DDMA 2EQ9A 2YVGA 4TM1A 3PG6A 1E1LA 1FECA 4LU6A 2QJNA 1WYGA 1PJ7A 4HYRA 1H84A 2A89A 2NPXA 3NVYB 4A6NB 3QJ4A 1O5WA 4A5LA 4EQXA 1WUEA 3HYXA 4ECHA 4H4TA 4J56A 1NU5A 3N4FA 1JRZA 2WU5A 4GF7A 3RP7A 3VA8A 2X8GA 3TOYA 2OA1A 4C3YA 3VFCA 2GMJA 4AOXA 2DKHA 3HRDC 1N4WA 5BUKA 3DFHA 5KRQA 2WQYA 1LV0A 3V76A 3KLJA 1KCZA 1IUTA 2AL2A 4FI4A 3GSIA 2CFYA 3FV9A 2YAUA 3T14A 3QSEA 5J04A 5KOXA 2OG9A 3DJGX 4XWZA 1S3BA 1GRFA 2NQLA 1F8RA 2XLSA 1X31B 3IJLA 2WPFA 3AYIA 1GPEA 1JOAA 3C4AA 2QJJA 4DSHA 3CGEA 3CNPA 1H86A 5KOWA 4B1BA 2YVJA 2XH0A 2GH5A 3RP6A 2BCGG 3EEZA 3NT6A 1TDNA 1KD0A 2WU2A 3N4EA 3UJFA 3V4BA 3SN1A 1RP0A 4DGKA 3AEEA 3CT2A 4U8MA 3GC2A 1N1PA 3CIRA 1VDVA 3ES7A 2BXSA 1CC4A 2VVMA 4OCGA 5FJTA 4FX9A 4MMWA 2GL5A 3OW1A 1ECQA 2WP6A 3TWBA 4D04A 3RGTA 1CJCA 4H4UA 1JU2A 4GAVA 3I6TA 3N6HA 4AT2A 3NN6X 5EB5A 1BZLA 2PA6A 5JCNA 1KNPA 2YLSA 3AM9A 3UGVA 3ATRA 2XLUA 2B9XA 4MGGA 3AEGA 4K8GA 1XANA 2V5ZA 3AWIA 3T37A 2C76A 2A8XA 4OPDA 1KN0A 1GERA 2XFNA 4H7UA 1ZDLA 3CPIG 5JCMA 2AL2B 1MRAA 4EMIA 3AE5A 3H4KA 2GR1A 1YKJA 4M0XA 1EBDA 3T31A 3L8KA 3VQRA 3I3LA 4MJWA 4J33A 4CY6A 3URHA 5JRBA 4IHCA 2XFPA 1ZMCA 1H81A 4U2SA 3CNDA 1L9CA 3GYXA 3UKPA 4TVWA 4KX6A 3AEDA 1CHUA 1ZOYA 3DA1A 3UXLA 1GRGA 1DXLA 4Y4LA 2MUCA 2ZZ0A 3NRNA 4JN7A 4WCTA 1SEZA 3TJ4A 2W55A 3AE1A 2WDQA 1PDZA 2E4GA 4U8OA 1YQ4A 2OLAA 3VDGA 4RG3A 3ABVA 2WP5A 3L1RA 3G5QA 3CNSA 3SZCA 3B97A 2QJMA 4G6GA 2PODA 2PMQA 1N62C 3SN4A 5EU9A 4GUVA 3A7AA 5BVAA 1SB3B 3TW9A 2XFOA 4G74A 4U8LA 3UTEA 3UCDA 1PJ6A 1RM6B 2ARDA 3BI2A 2V6OA 3H7VA 4GDPA 1VQZA 3DGHA 4A99A 3H12A 2XLTA 1VG9A 3IF9A 3AB1A 3II4A 1N5XA 3IHGA 3C4NA 1EC7A 4B67A 1L9DA 2R46A 4GDEA 1NG4A 3DH9A 2V3BA 4G9KA 1GOSA 1JPDX 3HZLA 1MDLA 4H4VA 4K8DA 3UJEA 1HYUA 4HCLA 2WETA 4HCHA 3IC9A 4GYPA 1FFVC 4OPLA 3JZUA 2AKMA 2GDQA 3VC5A 1JEHA 2GQFA 3HPFA 2PGWA 1GESA 1BWCA 5G5HB 5J7XA 1ZY8A 2Z5YA 2TMDA 1H83A 1FEBA 1O94A 3NKSA 2XH4A 5BOEA 4B68A 3NLCA 4JQ9A 3DFYA 2OQYA 1PS9A 3ALLA 2O56A 1Q1RA 1NHRA 4I59A 2R9ZA 2E5VA 3UKLA 4BK1A 3ICSA 4PABA 4Z2TA 3SZFA 2VQBA 1V59A 3I6EA 1QLBA 5KVHA 3SBFA 2JK6A 2QDEA 2IIDA 3NFUA 3NGCX 1IUUA 2B76A 3UKKA 4A35A 1LQUA 2QCUA 3GWDA 5M0ZA 1N5WC 5CKUA 1GRTA 3MQTA 1BF3A 3RITA 3NVZB 1GRHA 3P3BA 2JB1A 1VQWA 4EM4A 3LB8A 2YG5A 3FMWA 4B66A 3QFAA 3CPJG 4Z25A 4B64A 1DOBA 4GRTA 5M10A 4YKGA 1K0IA 1SJCA 2RGJA 3ADAB 2FKPA 3EANA 4XWRA 4J2WA 3AECA 1ZMDA 1E39A 3MWCA 3GO2A 3R1ZA 1CC2A 1FCDA 3GY1A 2XFQA 3UKQA 2P8BA 1PBEA 1D7YA 2VZ2A 4ZCDA 2ACZA 2YLTA 3NK0X 1PDYA 4X2PA 4F4RA 1TKKA 2X99A 1S2YA 1XS2A 1RSGA 1FFUC 7ENLA 1V97A 3EAOA 5IQ4A 4H50A 4DWDA 3CGCA 2GSHA 3JW7A 5KWFA 2TPRA 2W3RA 4GCMA 4Y4MA 2AKZA 4O5UA 1GSNA 4DHGA 1GXFA 2VOUA 2PU0A 3V3WA 4DXKA 1K4QA 3EF6A 4IT1A 3DK4A 3TJIA 2WPEA 5U25A 1H7XA 1F8WA 2R0CA 4ENLA 1RYIA 2XVIA 1QO8A 2PP1A 1E1KA 1XPQA 3BI5A 1PXCA 2C67A 3HYWA 2BC1A 3UOYA 5FMHA 2YR4A 5BRTA 4CRTA 1GRBA 2C7GA 6ENLA 4C74A 3CNTA 3NRZB 4U2TA 2P88A 2VRLA 4HB9A 2YM2A 1DNCA 2ZZCA 4A6GA 2WHDA 4G6HA 3OP2A 3CAWA 1H7WA 4H19A 3OZYA 3MSYA 3CGDA 3BHKA 3BSMA 4J1OA 4J36A 1B4VA 5JCLA 4C5OA 3T4WA 1FO4A 2BS3A 3SFEA 4YSHA 1GETA 1EL7A 1FOHA 1TDFA 2YG6A 4JN8A 4X4JA 3SYIA 3QTPA 3GYIA 4OPGA 3A7RA 2W3SA 1MXTA 1PHHA 3H70A 2OQHA 4O5QA 1CJ4A 3T2YA 3DK9A 2FBWA 4YT0A 3TCSA 1TE6A 3VRBA 3R0KA 1TDKA 1ZOVA 1BQGA 2DW7A 5GSNA 1Y56A 3CB3A 3AEBA 3AE2A 3Q4DA 1JDFA 3SN0A 3V3NA 2FYMA 3EPTA 1PN0A 4Z1YA 3NTDA 3NVWB 2R0GA 3G5SA 4OPCA 3CXOA 4H2PA 2E1MA 4H4ZA 5KMQA 4IA6A 3QSSA 3HW2A 2GGJA 3IWAA 2WDRA 4J3ZA 1NELA 2GMHA 1D4EA 1OJ9A 4OVIA 1NPXA 3KU9A 1VDCA 3Q45A 5CQFA 3OZ2A 5JCIA 1MDRA 1ZX9A 4ZN0A 1P43A 1Y0PA 3AE4A 5KMPA 3ITJA 2XGZA 1L8PA 1GV4A 3P4RA 4IP4A 3F8RA 4EQSA 3T6CA 1X2GA 2BS2A 1DOCA 1PBFA 4E6MA 1OJTA 3FG2P 4IV9A 1ZK7A 2HNEA 4EQRA 2P3ZA 3LZWA 3UOVA 2YLRA 4DSGA 1MOKA 3M12A 1BGJA 3LOVA 2VVLA 1TDOA 2PCEA 2WS3A 3AN1A 1H2IA 4H83A 2JAEA 3AEAA 3R07C 4D03A 4BV6A 1L0VA 4KWSA 1JRYA 4C3XA 3CK5A 3KA7A 3S61A 5FJRA 3RHAA 2YLXA 4IZGA 4P9SA 2CHRA 3NIXA 5C2TA 3DJEA 2QGYA 2C4CA 3KKJA 2BXRA 3UJ2A 4AP3A 1Y56B 4II2A 5IPYA 1TDEA 3GWFA 4REKA 3LADA 1GEUA 2B7RA 3CNJA 2FJDA 2QQ6A 3RP8A 1JPMA 2QAEA 1FIQB 4Z17A 4BJZA 3AYLA 1TYPA 2POZA 3ZVIA 3GDPA 2GV8A 2OZ3A 2BK4A 3CGBA 1ELIA 1SJAA 4KPLA 2X8HA 3AE8A 4K2XA 4H4XA 1TZZA 2BS4A 3LJPA 2WESA 3DMEA 5FJUA 1S3EA 1MUCA 4YKFA 2AAQA 3BNUA 1TRBA 3SZWA 2BRYA 4Z2UA 2YG7A 2ONEA 3PK7A 2OZ8A 2CULA 4A9WA 1N63C 3ICRA 3NTAA 3UJRA 4U8NA 3P0WA 2OX4A 2BK3A 1ELSA 4K5SA 4IVOB 5U63A 2FJBA 1KDGA 3JVAA 3QN3A 3I6DA 3KUMA 2AQJA 2BA9A 5IQ1A 3OPSA 3FJ4A 5EOWA 5J60A 3AXBA 4G8TA 2I5QA 1LPFA 3D47A 4U8IA 3DG3A 1IJHA 3NVVB 4ICYA 3FYYA 3V3OA 3NXLA 1K0LA 1P48A 2OKTA 3DERA 4DN1A 1GALA 3L5OA 3M0OA 4OPUA 3ENLA 2RGHA 1H82A 1CF3A 3S5WA 1B37A 3CMMA 4WX1A 1LTXR 1KKRA 2PP3A 2YLWA 2EQ7A 2BYBA 1O95A 4X9MA 1JRPA 2O9ZA 3UOZA 2E5AA 1N61C 3DJJA 1YQ3A 3K1GA 1JRXA 1UKVG 2X50A 3GRSA 2PHHA 2Q7VA 2RGOA 3AE3A 2Q0LA 3T2KA 1MNSA 4UP3A
chains in the Genus database with same CATH topology
2WPFA 2IVDA 1IUVA 1GPEA 1KNRA 2C72A 3AYIA 3NK1X 2C64A 5TR3A 1JOAA 3DK4A 4II3A 3C4AA 2VVLG 4LA1A 4JDRA 2GEWA 2WPEA 3CGEA 5U25A 4DSHA 1H7XA 3CNPA 1H86A 1F8WA 4YSXA 5KOWA 3UKAA 4USRA 4B1BA 3F8DA 4BURA 2YVJA 2R0CA 2ZZBA 1D4DA 1P2EA 1QO8A 1RYIA 2XVIA 3SXIA 3GRTA 4A7AA 2FJAA 2GH5A 1E1KA 1DJQA 1XPQA 3RP6A 2BCGG 3BI5A 1PXCA 2C67A 3NT6A 3HYWA 2BC1A 1KSSA 1OJCA 3UOYA 2APGA 5FMHA 2HQMA 2BK5A 2YR4A 1TDNA 1P2HA 2GR0A 4YTMA 5BRTA 4IVMB 4NNJA 4CRTA 1D4CA 1DJNA 1GRBA 1NHQA 1NEKA 2C7GA 2WU2A 4FK1A 3SM8A 2C3CA 4C74A 3CNTA 2YG4A 4U2TA 1RP0A 5JCKA 3DJDA 4HB9A 2VRLA 4DGKA 3AEEA 2GAHB 2YM2A 1DNCA 4U8MA 2EQ6A 2ZZCA 2WHDA 2BACA 4OPIA 1E6EA 1N1PA 3CIRA 3P4QA 3VRDB 4B63A 4G6HA 2BXSA 1CC4A 1PBCA 2VVMA 4OCGA 3KD9A 1H7WA 4CNKA 4FX9A 4U8JA 5HHFA 5HXIA 4ZCCA 2WP6A 3UP4A 3CGDA 4TM3A 4LIIA 3BHKA 3UKFA 4D04A 3ALJA 2YWLA 3NNEA 3LXDA 4AP1A 1Z6LA 1CJCA 3WE0A 4H4UA 1JU2A 4GAVA 5L46A 2WOVA 4J36A 1ZP0A 1B4VA 5JCLA 3AD8B 3K30A 4C5OA 4XXGA 2GVCA 4AT2A 3NN6X 5EB5A 4YWOA 1NG3A 1BZLA 1GRAA 3UCLA 2BS3A 3SFEA 5C3JA 2Z5XA 1JNZA 4EQWA 2I0ZA 2JB2A 4BK3A 4YSHA 5JCNA 1GETA 1E1NA 1KNPA 4J31A 4TLZA 3VR9A 1EL7A 2YLSA 2Q0KA 2W0HA 3CN8A 3ATRA 3UP5A 2XLUA 4UDQA 1FOHA 1TDFA 3ISHA 2B9XA 2C65A 5KMSA 3AEGA 1GREA 1IUSA 3SQPA 3D9XA 4I58A 2YG6A 2R4EA 5DBJA 4X4JA 3SYIA 1XANA 1JNRA 2V5ZA 3AWIA 4A65A 3GYIA 1NHPA 3ICTA 4OPGA 4U8PA 3T37A 2C76A 1E1MA 2ZBWA 2A8XA 3P1WA 4OPDA 1KN0A 3AEFA 4Z44A 1GERA 2XFNA 5GRTA 4H7UA 1ZDLA 1MXTA 3PO7A 3CPHG 2GAGB 3CPIG 1FEAA 1PHHA 4APNA 1F6MA 5JCMA 2WOIA 1CJ4A 4O5QA 3T2YA 1FL2A 3DK9A 2FBWA 4YT0A 4FDCB 3FBSA 4EMIA 3AE5A 2X3NA 1DOEA 3AE6A 3VRBA 4NTEA 3H4KA 2WBAA 3P9UA 1TDKA 1ZOVA 2WEUA 1W4XA 2GR1A 1VRQB 1IUWA 4JY3A 3UKHA 1NDAA 1YKJA 2OAMA 5GSNA 1D5TA 1Y56A 2FJEA 3AEBA 1EBDA 3AE2A 3T31A 3L8KA 4H2QA 3NYEA 1Q1WA 5FS6A 3I3LA 3R9UA 3V3NA 3VQRA 4MJWA 4J33A 4CY6A 3URHA 4H2NA 4E0VA 1OJAA 3EPTA 1PN0A 5JRBA 4B65A 4H4WA 4C77A 2XFPA 1ZMCA 1H81A 4U2SA 1B8SA 2OALA 3AE9A 1N4VA 3CNDA 1L9CA 3NTDA 3GYXA 4Z24A 2R0GA 3UKPA 3G5SA 4OPCA 1CC6A 1EL8A 3GMBA 3T2ZA 4H2PA 4KX6A 3AEDA 2F5ZA 1GTHA 4USQA 1CHUA 2E1MA 1ZOYA 1VG0A 3DA1A 3NH3X 1IUXA 5FS7A 4H4ZA 5ER0A 5KMQA 1GRGA 4IA6A 3QSSA 2DKIA 1DXLA 4Y4LA 1GNDA 2B7SA 2H88A 2H89A 2ZZ0A 3BHFA 1GTEA 4TLXA 3IWAA 2WDRA 5HY5A 3GYJA 3NRNA 2XLPA 4IA5A 3GD3A 2QA2A 3KPFA 2GB0A 2GMHA 1D4EA 1OJ9A 4WCTA 3M13A 1SEZA 2OLOA 4OVIA 1NPXA 3AE1A 3BI4A 2VQ7A 2WDQA 4TM0A 3KU9A 1YQZA 1VDCA 1B5QA 3KPKA 2B9WA 4K5RA 5CQFA 3PVCA 2E4GA 4NTCA 3OC4A 5JCIA 1CBOA 1YQ4A 3OZ2A 4NWZA 4U8OA 2Y6RA 4H4RA 4NEVA 4RG3A 5U1OA 1ZX9A 4ZN0A 4ADWA 3ABVA 2NVKX 1Y0PA 2WP5A 3AE4A 3L1RA 5KMPA 3ITJA 3G5QA 4CCRA 3CNSA 4G73A 5LV9A 3SZCA 4EIPA 2XVFA 4G6GA 5KMRA 3P4RA 1GV4A 3F8RA 2EQ8A 2JKCA 2YVFA 3H8IA 3VR8A 1Q9IA 3E1TA 2B9YA 4EQSA 3P4PA 4GUVA 5BVAA 4K22A 3D8XA 1PBDA 2XFOA 2WPCA 4G74A 1NAAA 4U8LA 3UTEA 4YTPA 2JB3A 4RG4A 4EMWA 1XHCA 1PJ6A 2ARDA 5BULA 4PAAA 2XVHA 2XVJA 1NENA 2V6OA 3BI2A 3NYFA 2BS2A 4AT0A 4GDPA 3QVPA 4CBQA 1DOCA 1PBFA 1OJTA 1F8SA 3AYJA 4J34A 3DGHA 3FG2P 4IV9A 2JBVA 2R0PA 1ZK7A 2XCGA 4A99A 2OLNA 2XLTA 1VG9A 3QVRA 4EQRA 2C70A 3IF9A 1K0JA 4NEWA 1KF6A 3LZWA 3UOVA 2YLRA 4DSGA 1MOKA 2A87A 3AB1A 1BGJA 3LOVA 3II4A 1KSUA 2VVLA 3M12A 1LJ1A 1TDOA 3IHGA 3JSKA 3Q9TA 2WOWA 2WS3A 2BC0A 1PXAA 3C4NA 1H2IA 3AEAA 4K7ZA 2JAEA 4B67A 3FIMB 1L9DA 4BV6A 2R46A 1L0VA 4D03A 4JY2A 4GDEA 1JRYA 3SX6A 4C3XA 2VRMA 1NG4A 3DH9A 4A6NA 2GQWA 1NHSA 2V3BA 1QJDA 3KA7A 1GOSA 4G9KA 3S61A 3HZLA 5FS9A 3H8LA 4H4VA 1OJDA 1ZKQA 3RHAA 2YLXA 4K8DA 4P9SA 4U8KA 1HYUA 1COYA 2WETA 2C3DA 3IC9A 3B3RA 3NIXA 2YQUA 4DNAA 4JNQA 4TM4A 4JNAA 2GRTA 4OPLA 4M52A 2BRAA 4NZHA 4X9NA 5C2TA 1ONFA 3DJEA 3AE7A 2X8CA 3NHOX 3REDA 3HYVA 3NYCA 1JEHA 4Z2RA 2C4CA 3KKJA 2BXRA 2C66A 2GQFA 4GAPA 4YSZA 3CTYA 4HA6A 4AP3A 1REOA 1H6VA 4BJYA 4H2RA 3GMCA 1Y56B 1GESA 3D1CA 4II2A 4YSYA 5IPYA 1BWCA 5J7XA 1TDEA 3T0KA 4H4SA 1PJ5A 1LVLA 3GWFA 3SGLA 3UTHA 1ZY8A 2Z5YA 4REKA 3UTGA 5HYMA 3LADA 1GEUA 2B7RA 4A79A 1AOGA 2TMDA 1H83A 3CNJA 2GR3A 2RABA 1FEBA 1O94A 2FJDA 2V61A 3NKSA 2IVEA 3RP8A 2YR5A 2QAEA 4B68A 2XVEA 3KVEA 4AOSA 1BKWA 1PDHA 1N4UA 4BK2A 3NLCA 1S7MA 4JQ9A 4BJZA 3BNMA 1PS9A 3K7TA 1CJ2A 4OPTA 3AYLA 4Z26A 3GDNA 3ALLA 1TYPA 1Q1RA 3GDPA 1NHRA 2GV8A 4I59A 2R9ZA 2E5VA 4U2LA 5EBKA 2WP9A 3UKLA 1MO9A 2BK4A 3NN0X 4J57A 2BCPA 4BK1A 3ICSA 4PABA 2XDOA 3CGBA 3DGZA 2C73A 4KPRA 3RNMA 1ELIA 4Z2TA 4RSLA 2Y6QA 1EL5A 3SZFA 1DODA 2VQBA 2QA1A 1V59A 2X8HA 2YR6A 2GR2A 3AE8A 4K2XA 1L9EA 2WDVA 1QLBA 3F8PA 4H4XA 3K7QX 5KVHA 2V60A 3UTFA 3O0HA 2BS4A 2JK6A 2IIDA 4YXDA 1KFYA 3LJPA 2WESA 3AD7B 3SFDA 1CJ3A 3NGCX 1IUUA 3VRAA 3DMEA 3G5RA 3AD9B 2B76A 3NK2X 3UKKA 2XYOA 4EM3A 1S3EA 4CCQA 4YKFA 3UOXA 2AAQA 3BNUA 1TRBA 3SZWA 2BRYA 2YG3A 4Z2UA 1LQUA 5KXJA 2YG7A 2QCUA 3ATQA 4Z43A 3GWDA 5FS8A 5M0ZA 2Q6UA 3PS9A 3ZYXA 5CKUA 4JN9A 1XDIA 1M6IA 3LZXA 1GRTA 4NTDA 4UDPA 3K7MX 4FK1C 2C75A 3GD4A 2CULA 2J3NA 3ALMA 3COXA 1BF3A 4A9WA 4H4QA 1CL0A 2XLRA 3C96A 3QFBA 1D7LA 1GRHA 2EQ9A 3ICRA 2YVGA 4TM1A 3NTAA 2JB1A 2XFUA 4U8NA 5KVIA 1VQWA 4EM4A 2CDUA 3Q6JA 3PG6A 1E1LA 2BK3A 3LB8A 4IVOB 4K5SA 5U63A 1FECA 4LU6A 1GT8A 1LQTA 1YY5A 2FJBA 1PJ7A 2YG5A 3FMWA 1KDGA 2R45A 4B66A 2UZZA 3I6DA 1H84A 2A89A 4UDRA 3SY4A 2AQJA 3QFAA 3B6DA 3CPJG 2BA9A 4Z25A 4B64A 1DOBA 4GRTA 2NPXA 5IQ1A 4A6NB 3QJ4A 5M10A 4YKGA 1O5WA 1K0IA 5EOWA 4A5LA 2RGJA 2CVJA 4EQXA 3ADAB 2PYXA 4N9XA 4EIQA 3EANA 4XWRA 5J60A 4J2WA 3AECA 1ZMDA 3HYXA 4ECHA 1E39A 3AXBA 4H4TA 2BABA 4J56A 1JRZA 2WU5A 1LPFA 3NG7X 4GF7A 4U8IA 3RP7A 1IJHA 2X8GA 1CC2A 5KNLA 1FCDA 3FPZA 2XFQA 3UKQA 2OA1A 4ICYA 3V3OA 1EL9A 1K0LA 4C3YA 1PBEA 2GMJA 1PBBA 4AOXA 2DKHA 1GALA 1D7YA 3L5OA 2VZ2A 2YM1A 3M0OA 4OPUA 4ZCDA 1F3PA 2ACZA 1N4WA 5BUKA 3QSMA 2RGHA 4Y4NA 2YLTA 1H82A 1CF3A 3NK0X 3S5WA 1M64A 2R4JA 3ZDNA 4CNJA 1B37A 2X99A 1S2YA 3CMMA 4WX1A 1LTXR 5KRQA 2WQYA 1LV0A 3V76A 1RSGA 4B69A 3KLJA 4YTNA 3EAOA 5IQ4A 2V3AA 1IUTA 4H50A 3GSIA 2YLWA 2EQ7A 2CFYA 2YAUA 2BYBA 1O95A 2YLZA 4X9MA 3T14A 2O9ZA 1E7PA 3CGCA 3QSEA 3UOZA 5KOXA 5KWFA 2TPRA 3DJGX 3DJJA 2GF3A 4XWZA 1YQ3A 1BGNA 4H4PA 1S3BA 4GCMA 5EB4A 3IHMA 3DK8A 1JRXA 1GRFA 1F8RA 1UKVG 4Y4MA 4O5UA 2X50A 1GSNA 1PXBA 3GRSA 3SZ0A 4H4YA 1GXFA 2PHHA 2Q7VA 2RGOA 4EMJA 2VOUA 3AE3A 2Q0LA 4CY8A 3T2KA 2XLSA 3P4SA 1TYTA 4GR1A 1X31B 2AR8A 1S2QA 1K4QA 4UP3A 3EF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPF A;  2IVD A;  1IUV A;  1GPE A;  1KNR A;  2C72 A;  3AYI A;  3NK1 X;  2C64 A;  5TR3 A;  1JOA A;  3DK4 A;  3VR9 A;  3C4A A;  2VVL G;  4LA1 A;  4JDR A;  2GEW A;  2WPE A;  3CGE A;  5U25 A;  4DSH A;  1H7X A;  3CNP A;  1H86 A;  1F8W A;  4YSX A;  5KOW A;  3UKA A;  4USR A;  4B1B A;  3F8D A;  4BUR A;  2YVJ A;  2R0C A;  2ZZB A;  1D4D A;  1P2E A;  1QO8 A;  1RYI A;  2XVI A;  3GRT A;  4A7A A;  2FJA A;  2GH5 A;  1E1K A;  1DJQ A;  1XPQ A;  3RP6 A;  2BCG G;  3BI5 A;  1PXC A;  2C67 A;  3NT6 A;  2BC1 A;  1KSS A;  1OJC A;  3UOY A;  2APG A;  5FMH A;  2HQM A;  2BK5 A;  2YR4 A;  1TDN A;  1P2H A;  2GR0 A;  4YTM A;  5BRT A;  4IVM B;  4CRT A;  1D4C A;  1DJN A;  1GRB A;  1NHQ A;  1NEK A;  2C7G A;  2WU2 A;  4FK1 A;  3SM8 A;  2C3C A;  4C74 A;  3CNT A;  2YG4 A;  4U2T A;  1RP0 A;  5JCK A;  3DJD A;  4HB9 A;  2VRL A;  4DGK A;  3AEE A;  2GAH B;  2YM2 A;  1DNC A;  4U8M A;  2EQ6 A;  2ZZC A;  2WHD A;  2BAC A;  4OPI A;  1E6E A;  1N1P A;  3CIR A;  3P4Q A;  3VRD B;  4B63 A;  2BXS A;  1CC4 A;  1PBC A;  2VVM A;  4OCG A;  3KD9 A;  1H7W A;  4CNK A;  4FX9 A;  4U8J A;  5HHF A;  5HXI A;  4ZCC A;  2WP6 A;  3UP4 A;  3CGD A;  4TM3 A;  4LII A;  3BHK A;  3UKF A;  4D04 A;  3ALJ A;  2YWL A;  3NNE A;  3LXD A;  4AP1 A;  1Z6L A;  1CJC A;  3WE0 A;  4H4U A;  1JU2 A;  5L46 A;  2WOV A;  4J36 A;  1ZP0 A;  1B4V A;  5JCL A;  3AD8 B;  3K30 A;  4C5O A;  4XXG A;  2GVC A;  4AT2 A;  3NN6 X;  5EB5 A;  4YWO A;  1NG3 A;  1BZL A;  1GRA A;  3UCL A;  2BS3 A;  3SFE A;  5C3J A;  2Z5X A;  1JNZ A;  4EQW A;  2I0Z A;  2JB2 A;  4BK3 A;  4YSH A;  5JCN A;  1GET A;  1E1N A;  1KNP A;  4J31 A;  4TLZ A;  1EL7 A;  2YLS A;  2Q0K A;  2W0H A;  3CN8 A;  3ATR A;  3UP5 A;  2XLU A;  4UDQ A;  1FOH A;  1TDF A;  3ISH A;  2B9X A;  2C65 A;  3AEG A;  1GRE A;  1IUS A;  3SQP A;  4I58 A;  2YG6 A;  2R4E A;  5DBJ A;  4X4J A;  1XAN A;  1JNR A;  2V5Z A;  3AWI A;  4A65 A;  3GYI A;  1NHP A;  3ICT A;  4OPG A;  4U8P A;  3T37 A;  2C76 A;  1E1M A;  2ZBW A;  2A8X A;  3P1W A;  4OPD A;  3AEF A;  4Z44 A;  1GER A;  2XFN A;  5GRT A;  4H7U A;  1ZDL A;  1MXT A;  3PO7 A;  3CPH G;  2GAG B;  3CPI G;  1FEA A;  1PHH A;  4APN A;  1F6M A;  5JCM A;  2WOI A;  1CJ4 A;  4O5Q A;  1FL2 A;  3DK9 A;  2FBW A;  4YT0 A;  4FDC B;  3FBS A;  4EMI A;  3AE5 A;  2X3N A;  1DOE A;  3AE6 A;  3VRB A;  4NTE A;  3H4K A;  2WBA A;  3P9U A;  1TDK A;  1ZOV A;  2WEU A;  1W4X A;  2GR1 A;  1VRQ B;  1IUW A;  4JY3 A;  3UKH A;  1NDA A;  1YKJ A;  2OAM A;  5GSN A;  1D5T A;  1Y56 A;  2FJE A;  3AEB A;  1EBD A;  3AE2 A;  3L8K A;  4H2Q A;  3NYE A;  1Q1W A;  5FS6 A;  3I3L A;  3R9U A;  3V3N A;  3VQR A;  4MJW A;  4J33 A;  4CY6 A;  3URH A;  4H2N A;  4E0V A;  1OJA A;  3EPT A;  1PN0 A;  4B65 A;  4H4W A;  4C77 A;  2XFP A;  1ZMC A;  1H81 A;  4U2S A;  1B8S A;  2OAL A;  3AE9 A;  1N4V A;  3CND A;  1L9C A;  3NTD A;  4Z24 A;  3UKP A;  2R0G A;  3G5S A;  4OPC A;  1CC6 A;  1EL8 A;  3GMB A;  4H2P A;  4KX6 A;  3AED A;  2F5Z A;  1GTH A;  4USQ A;  1CHU A;  2E1M A;  1ZOY A;  1VG0 A;  3DA1 A;  3NH3 X;  1IUX A;  5FS7 A;  4H4Z A;  5ER0 A;  1GRG A;  4IA6 A;  3QSS A;  2DKI A;  1DXL A;  4Y4L A;  1GND A;  2B7S A;  2H88 A;  2H89 A;  2ZZ0 A;  3BHF A;  1GTE A;  4TLX A;  3IWA A;  2WDR A;  5HY5 A;  3GYJ A;  3NRN A;  2XLP A;  4IA5 A;  3GD3 A;  2QA2 A;  3KPF A;  2GB0 A;  2GMH A;  1D4E A;  1OJ9 A;  4WCT A;  3M13 A;  1SEZ A;  2OLO A;  4OVI A;  1NPX A;  3AE1 A;  3BI4 A;  2VQ7 A;  2WDQ A;  4TM0 A;  3KU9 A;  1YQZ A;  1VDC A;  1B5Q A;  2B9W A;  4K5R A;  5CQF A;  3PVC A;  2E4G A;  4NTC A;  3OC4 A;  5JCI A;  1CBO A;  1YQ4 A;  3OZ2 A;  4U8O A;  2Y6R A;  4H4R A;  4NEV A;  4RG3 A;  5U1O A;  1ZX9 A;  4ZN0 A;  4ADW A;  3ABV A;  2NVK X;  1Y0P A;  2WP5 A;  3AE4 A;  3L1R A;  3ITJ A;  3G5Q A;  4CCR A;  3CNS A;  5LV9 A;  4EIP A;  2XVF A;  3P4R A;  1GV4 A;  3F8R A;  2EQ8 A;  2JKC A;  2YVF A;  3H8I A;  3VR8 A;  1Q9I A;  3E1T A;  2B9Y A;  4EQS A;  3P4P A;  4GUV A;  5BVA A;  4K22 A;  3D8X A;  1PBD A;  2XFO A;  2WPC A;  4U8L A;  1NAA A;  3UTE A;  4YTP A;  2JB3 A;  4RG4 A;  4EMW A;  1XHC A;  1PJ6 A;  2ARD A;  5BUL A;  4PAA A;  2XVH A;  2XVJ A;  1NEN A;  2V6O A;  3BI2 A;  3NYF A;  2BS2 A;  4AT0 A;  4GDP A;  3QVP A;  4CBQ A;  1DOC A;  1PBF A;  1OJT A;  1F8S A;  3AYJ A;  4J34 A;  3DGH A;  3FG2 P;  4IV9 A;  2JBV A;  2R0P A;  1ZK7 A;  2XCG A;  4A99 A;  2OLN A;  2XLT A;  1VG9 A;  3QVR A;  4EQR A;  2C70 A;  3IF9 A;  1K0J A;  4NEW A;  1KF6 A;  3LZW A;  3UOV A;  2YLR A;  4DSG A;  1MOK A;  2A87 A;  3AB1 A;  1BGJ A;  3LOV A;  3II4 A;  1KSU A;  2VVL A;  3M12 A;  1LJ1 A;  1TDO A;  3IHG A;  3JSK A;  3Q9T A;  2WOW A;  2WS3 A;  2BC0 A;  1PXA A;  3C4N A;  3AEA A;  4K7Z A;  2JAE A;  4B67 A;  3FIM B;  1L9D A;  4BV6 A;  2R46 A;  1L0V A;  4D03 A;  4JY2 A;  4GDE A;  1JRY A;  4C3X A;  2VRM A;  1NG4 A;  3DH9 A;  4A6N A;  2GQW A;  1NHS A;  2V3B A;  1QJD A;  3KA7 A;  1GOS A;  3S61 A;  3HZL A;  5FS9 A;  3H8L A;  4H4V A;  1OJD A;  1ZKQ A;  3RHA A;  2YLX A;  4K8D A;  4P9S A;  4U8K A;  1HYU A;  1COY A;  2WET A;  2C3D A;  3IC9 A;  3B3R A;  3NIX A;  2YQU A;  4DNA A;  4JNQ A;  4TM4 A;  4JNA A;  2GRT A;  4OPL A;  4M52 A;  4NZH A;  4X9N A;  5C2T A;  1ONF A;  3DJE A;  3AE7 A;  2X8C A;  3NHO X;  3RED A;  3NYC A;  1JEH A;  4Z2R A;  3KKJ A;  2BXR A;  2C66 A;  2GQF A;  4YSZ A;  3CTY A;  4HA6 A;  4AP3 A;  1REO A;  1H6V A;  4BJY A;  4H2R A;  3GMC A;  1Y56 B;  1GES A;  3D1C A;  4YSY A;  5IPY A;  1BWC A;  5J7X A;  1TDE A;  4H4S A;  1PJ5 A;  1LVL A;  3GWF A;  3SGL A;  3UTH A;  1ZY8 A;  2Z5Y A;  4REK A;  3UTG A;  5HYM A;  3LAD A;  1GEU A;  2B7R A;  4A79 A;  1AOG A;  2TMD A;  1H83 A;  3CNJ A;  2GR3 A;  2RAB A;  1FEB A;  1O94 A;  2FJD A;  2V61 A;  3NKS A;  2IVE A;  3RP8 A;  2YR5 A;  2QAE A;  4B68 A;  2XVE A;  3KVE A;  4AOS A;  1BKW A;  1PDH A;  1N4U A;  4BK2 A;  3NLC A;  4JQ9 A;  4BJZ A;  3BNM A;  1PS9 A;  3K7T A;  1CJ2 A;  4OPT A;  3AYL A;  4Z26 A;  3GDN A;  3ALL A;  1TYP A;  1Q1R A;  3GDP A;  1NHR A;  2GV8 A;  4I59 A;  2R9Z A;  2E5V A;  4U2L A;  5EBK A;  2WP9 A;  3UKL A;  1MO9 A;  2BK4 A;  3NN0 X;  4J57 A;  2BCP A;  4BK1 A;  3ICS A;  4PAB A;  2XDO A;  3CGB A;  3DGZ A;  2C73 A;  4KPR A;  3RNM A;  1ELI A;  4Z2T A;  4RSL A;  2Y6Q A;  1EL5 A;  1DOD A;  2VQB A;  2QA1 A;  1V59 A;  2X8H A;  2YR6 A;  2GR2 A;  3AE8 A;  4K2X A;  1L9E A;  2WDV A;  1QLB A;  3F8P A;  4H4X A;  3K7Q X;  5KVH A;  2V60 A;  3UTF A;  3O0H A;  2BS4 A;  2JK6 A;  2IID A;  4YXD A;  1KFY A;  3LJP A;  2WES A;  3AD7 B;  3SFD A;  1CJ3 A;  3NGC X;  1IUU A;  3VRA A;  3DME A;  3G5R A;  3AD9 B;  2B76 A;  3NK2 X;  3UKK A;  2XYO A;  4EM3 A;  1S3E A;  4CCQ A;  4YKF A;  3UOX A;  2AAQ A;  3BNU A;  1TRB A;  2YG3 A;  4Z2U A;  1LQU A;  5KXJ A;  2YG7 A;  2QCU A;  3ATQ A;  4Z43 A;  3GWD A;  5FS8 A;  5M0Z A;  2Q6U A;  3PS9 A;  3ZYX A;  5CKU A;  4JN9 A;  1XDI A;  1M6I A;  3LZX A;  1GRT A;  4NTD A;  4UDP A;  3K7M X;  4FK1 C;  2C75 A;  3GD4 A;  2CUL A;  2J3N A;  3ALM A;  3COX A;  1BF3 A;  4A9W A;  4H4Q A;  1CL0 A;  2XLR A;  3C96 A;  3QFB A;  1D7L A;  1GRH A;  2EQ9 A;  3ICR A;  2YVG A;  4TM1 A;  3NTA A;  2JB1 A;  2XFU A;  4U8N A;  5KVI A;  1VQW A;  4EM4 A;  2CDU A;  3Q6J A;  1E1L A;  2BK3 A;  3LB8 A;  4IVO B;  4K5S A;  5U63 A;  1FEC A;  4LU6 A;  1GT8 A;  1LQT A;  1YY5 A;  2FJB A;  1PJ7 A;  2YG5 A;  3FMW A;  1KDG A;  2R45 A;  4B66 A;  2UZZ A;  3I6D A;  1H84 A;  2A89 A;  4UDR A;  2AQJ A;  3QFA A;  3B6D A;  3CPJ G;  2BA9 A;  4Z25 A;  4B64 A;  1DOB A;  4GRT A;  2NPX A;  5IQ1 A;  4A6N B;  3QJ4 A;  5M10 A;  4YKG A;  1O5W A;  1K0I A;  5EOW A;  4A5L A;  2RGJ A;  2CVJ A;  4EQX A;  3ADA B;  2PYX A;  4N9X A;  4EIQ A;  3EAN A;  4XWR A;  5J60 A;  4J2W A;  3AEC A;  1ZMD A;  4ECH A;  1E39 A;  3AXB A;  4H4T A;  2BAB A;  4J56 A;  1JRZ A;  2WU5 A;  1LPF A;  3NG7 X;  4GF7 A;  4U8I A;  3RP7 A;  1IJH A;  2X8G A;  1CC2 A;  1FCD A;  3FPZ A;  2XFQ A;  3UKQ A;  2OA1 A;  4ICY A;  3V3O A;  1EL9 A;  1K0L A;  4C3Y A;  1PBE A;  2GMJ A;  1PBB A;  4AOX A;  2DKH A;  1GAL A;  1D7Y A;  2VZ2 A;  2YM1 A;  3M0O A;  4OPU A;  4ZCD A;  1F3P A;  2ACZ A;  1N4W A;  5BUK A;  3QSM A;  2RGH A;  4Y4N A;  2YLT A;  1H82 A;  1CF3 A;  3NK0 X;  3S5W A;  1M64 A;  2R4J A;  3ZDN A;  4CNJ A;  1B37 A;  2X99 A;  1S2Y A;  4WX1 A;  1LTX R;  5KRQ A;  2WQY A;  1LV0 A;  3V76 A;  1RSG A;  4B69 A;  3KLJ A;  4YTN A;  3EAO A;  5IQ4 A;  1IUT A;  2V3A A;  4H50 A;  3GSI A;  2YLW A;  2EQ7 A;  2CFY A;  2YAU A;  2BYB A;  1O95 A;  2YLZ A;  4X9M A;  2O9Z A;  1E7P A;  3CGC A;  3QSE A;  3UOZ A;  5KOX A;  5KWF A;  2TPR A;  3DJG X;  3DJJ A;  2GF3 A;  4XWZ A;  1YQ3 A;  1BGN A;  4H4P A;  1S3B A;  4GCM A;  5EB4 A;  3IHM A;  3DK8 A;  1JRX A;  1GRF A;  1F8R A;  1UKV G;  4Y4M A;  4O5U A;  2X50 A;  1GSN A;  1PXB A;  3GRS A;  4H4Y A;  1GXF A;  2PHH A;  2Q7V A;  2RGO A;  4EMJ A;  2VOU A;  3AE3 A;  2Q0L A;  4CY8 A;  2XLS A;  3P4S A;  1TYT A;  4GR1 A;  1X31 B;  2AR8 A;  1S2Q A;  1K4Q A;  4UP3 A;  3EF6 A; 
#chains in the Genus database with same CATH topology
 1IUV A;  3NK1 X;  4KT2 A;  2C64 A;  3IJQ A;  1R6W A;  3CXB A;  2GGI A;  4USR A;  2ZZB A;  3GRT A;  3AMZ A;  1DJQ A;  4ZCW A;  1KSS A;  2APG A;  4ZA0 A;  2PPG A;  2HQM A;  2BK5 A;  1SJB A;  2E3T A;  1D4C A;  4FK1 A;  3GD6 A;  3A7U A;  4HN8 A;  2YG4 A;  5JCK A;  3B9J B;  2EQ6 A;  2RDX A;  2BAC A;  4OPI A;  1E6E A;  3VRD B;  1PBC A;  3KD9 A;  4CNK A;  4DYE A;  4U8J A;  5HHF A;  5HXI A;  4ZCC A;  4E4U A;  3QLD A;  3UP4 A;  4EWJ A;  4TM3 A;  4LII A;  3UKF A;  3ALJ A;  2OO6 A;  4GGB A;  3NNE A;  3LXD A;  4AP1 A;  1SJD A;  2WOV A;  1ZP0 A;  3AD8 B;  3K30 A;  3MZN A;  3QKE A;  3ZLG A;  4YWO A;  1GRA A;  3TQP A;  5C3J A;  2Z5X A;  1JNZ A;  4GIR A;  4EQW A;  2I0Z A;  4BK3 A;  4J31 A;  4TLZ A;  4HCD A;  2Q0K A;  2W0H A;  3CN8 A;  2PS2 A;  3UP5 A;  4UDQ A;  2QVH A;  3BJS A;  2GGE A;  3ISH A;  4I58 A;  3D9X A;  1RVK A;  4ROP A;  5DBJ A;  1JNR A;  4A65 A;  3ETR B;  1NHP A;  3ICT A;  4HNL A;  1E1M A;  3MY9 A;  2PGE A;  2ZBW A;  4JHM A;  3AEF A;  4Z44 A;  5GRT A;  3NO1 A;  3PO7 A;  3CPH G;  2GAG B;  4A3R A;  1EC9 A;  1F6M A;  2WOI A;  2PSN A;  3FBS A;  2AL1 A;  3IK4 A;  1DOE A;  4NTE A;  2WEU A;  4GGH A;  3VCC A;  1VRQ B;  3ZVH A;  3RRA A;  1YEY A;  2ZAD A;  1NDA A;  2XH2 A;  5FS6 A;  3FXG A;  4H2N A;  4E0V A;  4H4W A;  1B8S A;  4Z24 A;  3SR6 B;  1CC6 A;  3T2Z A;  4USQ A;  3QPE A;  1IUX A;  5ER0 A;  3U9I A;  1FHV A;  1GND A;  2H88 A;  2H89 A;  2HXT A;  3S5S A;  1GTE A;  4TLX A;  4IA5 A;  3GD3 A;  2QA2 A;  2GB0 A;  2OLO A;  4IL2 A;  3BI4 A;  3MUC A;  3FCP A;  1YQZ A;  1B5Q A;  3KPK A;  4K5R A;  3PVC A;  3DG7 A;  3OC4 A;  4NWZ A;  2OFJ A;  2Y6R A;  2NVK X;  4HNC A;  4G73 A;  5BOF A;  3UXK A;  3SJN A;  3VR8 A;  3H8I A;  3D8X A;  1PBD A;  1NAA A;  2JB3 A;  4RG4 A;  1XHC A;  3UCC A;  5BUL A;  4PAA A;  2XVJ A;  1NEN A;  4AT0 A;  5FJP A;  2GGH A;  3QVP A;  4CBQ A;  4IP5 A;  3AYJ A;  1E9I A;  2OLN A;  2C70 A;  2A87 A;  1KSU A;  3PFR A;  3R25 A;  3FIM B;  1KKO A;  2PU1 A;  3DIP A;  3SX6 A;  1FHU A;  3D46 A;  1N60 C;  2QDD A;  1NHS A;  4E5T A;  1QJD A;  1IYX A;  3H8L A;  1OEP A;  4U8K A;  3P93 A;  1COY A;  2OZT A;  3B3R A;  2YQU A;  3ZLH A;  4JNQ A;  4TM4 A;  4JNA A;  2GRT A;  4M52 A;  4GYP C;  1ONF A;  4Z2R A;  4YWS A;  2ZC8 A;  2C66 A;  4YSZ A;  4HA6 A;  4KEM A;  3ZVH B;  1H6V A;  4H2R A;  2PTX A;  3DEQ A;  3T0K A;  4H4S A;  1PJ5 A;  3SGL A;  3R10 A;  3UTG A;  3PWI A;  1AOG A;  2GR3 A;  2RAB A;  2V61 A;  2YR5 A;  2XVE A;  3KVE A;  4AOS A;  1BKW A;  4MKS A;  1PDH A;  1N4U A;  4BK2 A;  2XH7 A;  1S7M A;  4H2H A;  3BNM A;  3K7T A;  4Z26 A;  3STP A;  3ES8 A;  4U2L A;  4J57 A;  2XDO A;  2C73 A;  3DGZ A;  2GGG A;  1JRO A;  2Y6Q A;  3H8A A;  1EL5 A;  1DOD A;  1L9E A;  2PTZ A;  2WDV A;  3F8P A;  2V60 A;  3O0H A;  1KFY A;  3AD7 B;  1CJ3 A;  3U4F A;  3AD9 B;  3VC6 A;  3OTR A;  3UOX A;  1EBH A;  4K1W A;  5FJO A;  2YG3 A;  5KXJ A;  5FS8 A;  3ZYX A;  2P8C A;  4JN9 A;  1XDI A;  1M6I A;  3LZX A;  4H1Z A;  4FK1 C;  2C75 A;  3GD4 A;  3ALM A;  2J3N A;  4H4Q A;  1CL0 A;  2XLR A;  3C96 A;  2XFU A;  3PWG A;  5KVI A;  2CDU A;  3Q6J A;  1GT8 A;  1LQT A;  1YY5 A;  2R45 A;  5IDZ A;  2UZZ A;  4UDR A;  3SY4 A;  3B6D A;  2CVJ A;  2PYX A;  1ONE A;  4N9X A;  3OZM A;  4EIQ A;  3R0U A;  2BAB A;  1T3Q C;  3NG7 X;  5KNL A;  3FPZ A;  1EL9 A;  1PBB A;  2YM1 A;  1F3P A;  3QSM A;  2PTY A;  4Y4N A;  1M64 A;  2R4J A;  3ZDN A;  4CNJ A;  3T9P A;  4B69 A;  3ZLF A;  4YTN A;  2V3A A;  2YLZ A;  1E7P A;  3VCN A;  2GF3 A;  4GFI A;  1BGN A;  4H4P A;  5EB4 A;  3IHM A;  3DK8 A;  1PXB A;  3SZ0 A;  1R0M A;  4H4Y A;  4EMJ A;  4CY8 A;  3RO6 A;  3P4S A;  1TYT A;  4GR1 A;  2MNR A;  2AR8 A;  1S2Q A;  2IVD A;  1KNR A;  2C72 A;  3VR9 A;  5TR3 A;  4II3 A;  2VVL G;  4LA1 A;  4JDR A;  3RCY A;  2GEW A;  4YSX A;  3UKA A;  3R11 A;  2HXU A;  4BUR A;  3F8D A;  1D4D A;  1P2E A;  3SXI A;  4A7A A;  2FJA A;  1OJC A;  3THU A;  1P2H A;  2GR0 A;  4YTM A;  4IVM B;  4NNJ A;  3DGB A;  1DJN A;  1NHQ A;  1NEK A;  3SM8 A;  2C3C A;  2P0I A;  3DJD A;  2GAH B;  4B63 A;  3P4Q A;  4GIS A;  1EBG A;  3V5F A;  1WUF A;  3N6J A;  3RR1 A;  4E8G A;  3FVD A;  3I4K A;  2YWL A;  1Z6L A;  3WE0 A;  2XSX A;  5L46 A;  3SQS A;  4XXG A;  4GME A;  2GVC A;  1NG3 A;  3UCL A;  2JB2 A;  1E1N A;  1BKH A;  3MKC A;  5G5G B;  3V5C A;  3S47 A;  4ZOH B;  2C65 A;  5KMS A;  3DES A;  1GRE A;  1IUS A;  3SQP A;  2R4E A;  4U8P A;  3P1W A;  1FEA A;  4APN A;  3DG6 A;  1FL2 A;  4FDC B;  2W54 A;  2X3N A;  3AE6 A;  2WBA A;  3P9U A;  1JCT A;  1W4X A;  2HZG A;  1IUW A;  4JY3 A;  3UKH A;  2OAM A;  3SSZ A;  1D5T A;  2FJE A;  4H2Q A;  3NYE A;  1Q1W A;  3R9U A;  4FP1 A;  4M6U A;  1OJA A;  4B65 A;  4C77 A;  2PTW A;  2OAL A;  3AE9 A;  1N4V A;  4HPN A;  1EL8 A;  2OVL A;  3GMB A;  2F5Z A;  1GTH A;  1F9C A;  1VG0 A;  3NH3 X;  5FS7 A;  2DKI A;  2B7S A;  3EKG A;  3BHF A;  5HY5 A;  3GYJ A;  2XLP A;  3KPF A;  3M13 A;  2VQ7 A;  4TM0 A;  2B9W A;  3NZG A;  1STZ A;  4NTC A;  1CBO A;  4H4R A;  4NEV A;  5ENL A;  5U1O A;  4ADW A;  1X2H A;  3T8Q A;  4CCR A;  5LV9 A;  4EIP A;  2XVF A;  5KMR A;  2EQ8 A;  2JKC A;  2YVF A;  1Q9I A;  3E1T A;  2B9Y A;  3P4P A;  4TVY A;  4K22 A;  2WPC A;  3NS1 B;  4YTP A;  4EMW A;  2XVH A;  3NYF A;  1F8S A;  4J34 A;  2JBV A;  2R0P A;  2XCG A;  4K2S A;  2OPJ A;  3QVR A;  1K0J A;  4NEW A;  1KF6 A;  4E4F A;  1LJ1 A;  3JSK A;  3Q9T A;  2WOW A;  2BC0 A;  1PXA A;  4K7Z A;  4JY2 A;  1XPY A;  2VRM A;  4A6N A;  2GQW A;  3TTE A;  5FS9 A;  1OJD A;  1ZKQ A;  1ZXI C;  3UJS A;  4G7F A;  2C3D A;  4DNA A;  3BOX A;  4X9N A;  2BRA A;  4NZH A;  3AE7 A;  2X8C A;  3NHO X;  3RED A;  3HYV A;  3NYC A;  3EUB 3;  4GAP A;  3CTY A;  1REO A;  4BJY A;  3GMC A;  1W6T A;  3D1C A;  4YSY A;  1LVL A;  3UTH A;  1DTN A;  5HYM A;  4A79 A;  3CYJ A;  2IVE A;  2DW6 A;  2PP0 A;  1CJ2 A;  4OPT A;  3GDN A;  5EBK A;  2WP9 A;  1MO9 A;  3NN0 X;  2BCP A;  4KPR A;  3RNM A;  4RSL A;  2QA1 A;  2YR6 A;  2GR2 A;  3K7Q X;  3UTF A;  4YXD A;  4DX3 A;  3SFD A;  3VRA A;  3G5R A;  3NK2 X;  3IJI A;  2XYO A;  4EM3 A;  4CCQ A;  4IL0 A;  1EC8 A;  3ATQ A;  4Z43 A;  2Q6U A;  3PS9 A;  3TWA A;  4NTD A;  4UDP A;  3K7M X;  3COX A;  3QFB A;  1D7L A;  3DDM A;  2EQ9 A;  2YVG A;  4TM1 A;  3PG6 A;  1E1L A;  1FEC A;  4LU6 A;  2QJN A;  1WYG A;  1PJ7 A;  4HYR A;  1H84 A;  2A89 A;  2NPX A;  3NVY B;  4A6N B;  3QJ4 A;  1O5W A;  4A5L A;  4EQX A;  1WUE A;  3HYX A;  4ECH A;  4H4T A;  4J56 A;  1NU5 A;  3N4F A;  1JRZ A;  2WU5 A;  4GF7 A;  3RP7 A;  3VA8 A;  2X8G A;  3TOY A;  2OA1 A;  4C3Y A;  3VFC A;  2GMJ A;  4AOX A;  2DKH A;  3HRD C;  1N4W A;  5BUK A;  3DFH A;  5KRQ A;  2WQY A;  1LV0 A;  3V76 A;  3KLJ A;  1KCZ A;  1IUT A;  2AL2 A;  4FI4 A;  3GSI A;  2CFY A;  3FV9 A;  2YAU A;  3T14 A;  3QSE A;  5J04 A;  5KOX A;  2OG9 A;  3DJG X;  4XWZ A;  1S3B A;  1GRF A;  2NQL A;  1F8R A;  2XLS A;  1X31 B;  3IJL A;  2WPF A;  3AYI A;  1GPE A;  1JOA A;  3C4A A;  2QJJ A;  4DSH A;  3CGE A;  3CNP A;  1H86 A;  5KOW A;  4B1B A;  2YVJ A;  2XH0 A;  2GH5 A;  3RP6 A;  2BCG G;  3EEZ A;  3NT6 A;  1TDN A;  1KD0 A;  2WU2 A;  3N4E A;  3UJF A;  3V4B A;  3SN1 A;  1RP0 A;  4DGK A;  3AEE A;  3CT2 A;  4U8M A;  3GC2 A;  1N1P A;  3CIR A;  1VDV A;  3ES7 A;  2BXS A;  1CC4 A;  2VVM A;  4OCG A;  5FJT A;  4FX9 A;  4MMW A;  2GL5 A;  3OW1 A;  1ECQ A;  2WP6 A;  3TWB A;  4D04 A;  3RGT A;  1CJC A;  4H4U A;  1JU2 A;  4GAV A;  3I6T A;  3N6H A;  4AT2 A;  3NN6 X;  5EB5 A;  1BZL A;  2PA6 A;  5JCN A;  1KNP A;  2YLS A;  3AM9 A;  3UGV A;  3ATR A;  2XLU A;  2B9X A;  4MGG A;  3AEG A;  4K8G A;  1XAN A;  2V5Z A;  3AWI A;  3T37 A;  2C76 A;  2A8X A;  4OPD A;  1KN0 A;  1GER A;  2XFN A;  4H7U A;  1ZDL A;  3CPI G;  5JCM A;  2AL2 B;  1MRA A;  4EMI A;  3AE5 A;  3H4K A;  2GR1 A;  1YKJ A;  4M0X A;  1EBD A;  3T31 A;  3L8K A;  3VQR A;  3I3L A;  4MJW A;  4J33 A;  4CY6 A;  3URH A;  5JRB A;  4IHC A;  2XFP A;  1ZMC A;  1H81 A;  4U2S A;  3CND A;  1L9C A;  3GYX A;  3UKP A;  4TVW A;  4KX6 A;  3AED A;  1CHU A;  1ZOY A;  3DA1 A;  3UXL A;  1GRG A;  1DXL A;  4Y4L A;  2MUC A;  2ZZ0 A;  3NRN A;  4JN7 A;  4WCT A;  1SEZ A;  3TJ4 A;  2W55 A;  3AE1 A;  2WDQ A;  1PDZ A;  2E4G A;  4U8O A;  1YQ4 A;  2OLA A;  3VDG A;  4RG3 A;  3ABV A;  2WP5 A;  3L1R A;  3G5Q A;  3CNS A;  3SZC A;  3B97 A;  2QJM A;  4G6G A;  2POD A;  2PMQ A;  1N62 C;  3SN4 A;  5EU9 A;  4GUV A;  3A7A A;  5BVA A;  1SB3 B;  3TW9 A;  2XFO A;  4G74 A;  4U8L A;  3UTE A;  3UCD A;  1PJ6 A;  1RM6 B;  2ARD A;  3BI2 A;  2V6O A;  3H7V A;  4GDP A;  1VQZ A;  3DGH A;  4A99 A;  3H12 A;  2XLT A;  1VG9 A;  3IF9 A;  3AB1 A;  3II4 A;  1N5X A;  3IHG A;  3C4N A;  1EC7 A;  4B67 A;  1L9D A;  2R46 A;  4GDE A;  1NG4 A;  3DH9 A;  2V3B A;  4G9K A;  1GOS A;  1JPD X;  3HZL A;  1MDL A;  4H4V A;  4K8D A;  3UJE A;  1HYU A;  4HCL A;  2WET A;  4HCH A;  3IC9 A;  4GYP A;  1FFV C;  4OPL A;  3JZU A;  2AKM A;  2GDQ A;  3VC5 A;  1JEH A;  2GQF A;  3HPF A;  2PGW A;  1GES A;  1BWC A;  5G5H B;  5J7X A;  1ZY8 A;  2Z5Y A;  2TMD A;  1H83 A;  1FEB A;  1O94 A;  3NKS A;  2XH4 A;  5BOE A;  4B68 A;  3NLC A;  4JQ9 A;  3DFY A;  2OQY A;  1PS9 A;  3ALL A;  2O56 A;  1Q1R A;  1NHR A;  4I59 A;  2R9Z A;  2E5V A;  3UKL A;  4BK1 A;  3ICS A;  4PAB A;  4Z2T A;  3SZF A;  2VQB A;  1V59 A;  3I6E A;  1QLB A;  5KVH A;  3SBF A;  2JK6 A;  2QDE A;  2IID A;  3NFU A;  3NGC X;  1IUU A;  2B76 A;  3UKK A;  4A35 A;  1LQU A;  2QCU A;  3GWD A;  5M0Z A;  1N5W C;  5CKU A;  1GRT A;  3MQT A;  1BF3 A;  3RIT A;  3NVZ B;  1GRH A;  3P3B A;  2JB1 A;  1VQW A;  4EM4 A;  3LB8 A;  2YG5 A;  3FMW A;  4B66 A;  3QFA A;  3CPJ G;  4Z25 A;  4B64 A;  1DOB A;  4GRT A;  5M10 A;  4YKG A;  1K0I A;  1SJC A;  2RGJ A;  3ADA B;  2FKP A;  3EAN A;  4XWR A;  4J2W A;  3AEC A;  1ZMD A;  1E39 A;  3MWC A;  3GO2 A;  3R1Z A;  1CC2 A;  1FCD A;  3GY1 A;  2XFQ A;  3UKQ A;  2P8B A;  1PBE A;  1D7Y A;  2VZ2 A;  4ZCD A;  2ACZ A;  2YLT A;  3NK0 X;  1PDY A;  4X2P A;  4F4R A;  1TKK A;  2X99 A;  1S2Y A;  1XS2 A;  1RSG A;  1FFU C;  7ENL A;  1V97 A;  3EAO A;  5IQ4 A;  4H50 A;  4DWD A;  3CGC A;  2GSH A;  3JW7 A;  5KWF A;  2TPR A;  2W3R A;  4GCM A;  4Y4M A;  2AKZ A;  4O5U A;  1GSN A;  4DHG A;  1GXF A;  2VOU A;  2PU0 A;  3V3W A;  4DXK A;  1K4Q A;  3EF6 A;  4IT1 A;  3DK4 A;  3TJI A;  2WPE A;  5U25 A;  1H7X A;  1F8W A;  2R0C A;  4ENL A;  1RYI A;  2XVI A;  1QO8 A;  2PP1 A;  1E1K A;  1XPQ A;  3BI5 A;  1PXC A;  2C67 A;  3HYW A;  2BC1 A;  3UOY A;  5FMH A;  2YR4 A;  5BRT A;  4CRT A;  1GRB A;  2C7G A;  6ENL A;  4C74 A;  3CNT A;  3NRZ B;  4U2T A;  2P88 A;  2VRL A;  4HB9 A;  2YM2 A;  1DNC A;  2ZZC A;  4A6G A;  2WHD A;  4G6H A;  3OP2 A;  3CAW A;  1H7W A;  4H19 A;  3OZY A;  3MSY A;  3CGD A;  3BHK A;  3BSM A;  4J1O A;  4J36 A;  1B4V A;  5JCL A;  4C5O A;  3T4W A;  1FO4 A;  2BS3 A;  3SFE A;  4YSH A;  1GET A;  1EL7 A;  1FOH A;  1TDF A;  2YG6 A;  4JN8 A;  4X4J A;  3SYI A;  3QTP A;  3GYI A;  4OPG A;  3A7R A;  2W3S A;  1MXT A;  1PHH A;  3H70 A;  2OQH A;  4O5Q A;  1CJ4 A;  3T2Y A;  3DK9 A;  2FBW A;  4YT0 A;  3TCS A;  1TE6 A;  3VRB A;  3R0K A;  1TDK A;  1ZOV A;  1BQG A;  2DW7 A;  5GSN A;  1Y56 A;  3CB3 A;  3AEB A;  3AE2 A;  3Q4D A;  1JDF A;  3SN0 A;  3V3N A;  2FYM A;  3EPT A;  1PN0 A;  4Z1Y A;  3NTD A;  3NVW B;  2R0G A;  3G5S A;  4OPC A;  3CXO A;  4H2P A;  2E1M A;  4H4Z A;  5KMQ A;  4IA6 A;  3QSS A;  3HW2 A;  2GGJ A;  3IWA A;  2WDR A;  4J3Z A;  1NEL A;  2GMH A;  1D4E A;  1OJ9 A;  4OVI A;  1NPX A;  3KU9 A;  1VDC A;  3Q45 A;  5CQF A;  3OZ2 A;  5JCI A;  1MDR A;  1ZX9 A;  4ZN0 A;  1P43 A;  1Y0P A;  3AE4 A;  5KMP A;  3ITJ A;  2XGZ A;  1L8P A;  1GV4 A;  3P4R A;  4IP4 A;  3F8R A;  4EQS A;  3T6C A;  1X2G A;  2BS2 A;  1DOC A;  1PBF A;  4E6M A;  1OJT A;  3FG2 P;  4IV9 A;  1ZK7 A;  2HNE A;  4EQR A;  2P3Z A;  3LZW A;  3UOV A;  2YLR A;  4DSG A;  1MOK A;  3M12 A;  1BGJ A;  3LOV A;  2VVL A;  1TDO A;  2PCE A;  2WS3 A;  3AN1 A;  1H2I A;  4H83 A;  2JAE A;  3AEA A;  3R07 C;  4D03 A;  4BV6 A;  1L0V A;  4KWS A;  1JRY A;  4C3X A;  3CK5 A;  3KA7 A;  3S61 A;  5FJR A;  3RHA A;  2YLX A;  4IZG A;  4P9S A;  2CHR A;  3NIX A;  5C2T A;  3DJE A;  2QGY A;  2C4C A;  3KKJ A;  2BXR A;  3UJ2 A;  4AP3 A;  1Y56 B;  4II2 A;  5IPY A;  1TDE A;  3GWF A;  4REK A;  3LAD A;  1GEU A;  2B7R A;  3CNJ A;  2FJD A;  2QQ6 A;  3RP8 A;  1JPM A;  2QAE A;  1FIQ B;  4Z17 A;  4BJZ A;  3AYL A;  1TYP A;  2POZ A;  3ZVI A;  3GDP A;  2GV8 A;  2OZ3 A;  2BK4 A;  3CGB A;  1ELI A;  1SJA A;  4KPL A;  2X8H A;  3AE8 A;  4K2X A;  4H4X A;  1TZZ A;  2BS4 A;  3LJP A;  2WES A;  3DME A;  5FJU A;  1S3E A;  1MUC A;  4YKF A;  2AAQ A;  3BNU A;  1TRB A;  3SZW A;  2BRY A;  4Z2U A;  2YG7 A;  2ONE A;  3PK7 A;  2OZ8 A;  2CUL A;  4A9W A;  1N63 C;  3ICR A;  3NTA A;  3UJR A;  4U8N A;  3P0W A;  2OX4 A;  2BK3 A;  1ELS A;  4K5S A;  4IVO B;  5U63 A;  2FJB A;  1KDG A;  3JVA A;  3QN3 A;  3I6D A;  3KUM A;  2AQJ A;  2BA9 A;  5IQ1 A;  3OPS A;  3FJ4 A;  5EOW A;  5J60 A;  3AXB A;  4G8T A;  2I5Q A;  1LPF A;  3D47 A;  4U8I A;  3DG3 A;  1IJH A;  3NVV B;  4ICY A;  3FYY A;  3V3O A;  3NXL A;  1K0L A;  1P48 A;  2OKT A;  3DER A;  4DN1 A;  1GAL A;  3L5O A;  3M0O A;  4OPU A;  3ENL A;  2RGH A;  1H82 A;  1CF3 A;  3S5W A;  1B37 A;  3CMM A;  4WX1 A;  1LTX R;  1KKR A;  2PP3 A;  2YLW A;  2EQ7 A;  2BYB A;  1O95 A;  4X9M A;  1JRP A;  2O9Z A;  3UOZ A;  2E5A A;  1N61 C;  3DJJ A;  1YQ3 A;  3K1G A;  1JRX A;  1UKV G;  2X50 A;  3GRS A;  2PHH A;  2Q7V A;  2RGO A;  3AE3 A;  2Q0L A;  3T2K A;  1MNS A;  4UP3 A; 
#chains in the Genus database with same CATH homology
 2WPF A;  2IVD A;  1IUV A;  1GPE A;  1KNR A;  2C72 A;  3AYI A;  3NK1 X;  2C64 A;  5TR3 A;  1JOA A;  3DK4 A;  4II3 A;  3C4A A;  2VVL G;  4LA1 A;  4JDR A;  2GEW A;  2WPE A;  3CGE A;  5U25 A;  4DSH A;  1H7X A;  3CNP A;  1H86 A;  1F8W A;  4YSX A;  5KOW A;  3UKA A;  4USR A;  4B1B A;  3F8D A;  4BUR A;  2YVJ A;  2R0C A;  2ZZB A;  1D4D A;  1P2E A;  1QO8 A;  1RYI A;  2XVI A;  3SXI A;  3GRT A;  4A7A A;  2FJA A;  2GH5 A;  1E1K A;  1DJQ A;  1XPQ A;  3RP6 A;  2BCG G;  3BI5 A;  1PXC A;  2C67 A;  3NT6 A;  3HYW A;  2BC1 A;  1KSS A;  1OJC A;  3UOY A;  2APG A;  5FMH A;  2HQM A;  2BK5 A;  2YR4 A;  1TDN A;  1P2H A;  2GR0 A;  4YTM A;  5BRT A;  4IVM B;  4NNJ A;  4CRT A;  1D4C A;  1DJN A;  1GRB A;  1NHQ A;  1NEK A;  2C7G A;  2WU2 A;  4FK1 A;  3SM8 A;  2C3C A;  4C74 A;  3CNT A;  2YG4 A;  4U2T A;  1RP0 A;  5JCK A;  3DJD A;  4HB9 A;  2VRL A;  4DGK A;  3AEE A;  2GAH B;  2YM2 A;  1DNC A;  4U8M A;  2EQ6 A;  2ZZC A;  2WHD A;  2BAC A;  4OPI A;  1E6E A;  1N1P A;  3CIR A;  3P4Q A;  3VRD B;  4B63 A;  4G6H A;  2BXS A;  1CC4 A;  1PBC A;  2VVM A;  4OCG A;  3KD9 A;  1H7W A;  4CNK A;  4FX9 A;  4U8J A;  5HHF A;  5HXI A;  4ZCC A;  2WP6 A;  3UP4 A;  3CGD A;  4TM3 A;  4LII A;  3BHK A;  3UKF A;  4D04 A;  3ALJ A;  2YWL A;  3NNE A;  3LXD A;  4AP1 A;  1Z6L A;  1CJC A;  3WE0 A;  4H4U A;  1JU2 A;  4GAV A;  5L46 A;  2WOV A;  4J36 A;  1ZP0 A;  1B4V A;  5JCL A;  3AD8 B;  3K30 A;  4C5O A;  4XXG A;  2GVC A;  4AT2 A;  3NN6 X;  5EB5 A;  4YWO A;  1NG3 A;  1BZL A;  1GRA A;  3UCL A;  2BS3 A;  3SFE A;  5C3J A;  2Z5X A;  1JNZ A;  4EQW A;  2I0Z A;  2JB2 A;  4BK3 A;  4YSH A;  5JCN A;  1GET A;  1E1N A;  1KNP A;  4J31 A;  4TLZ A;  3VR9 A;  1EL7 A;  2YLS A;  2Q0K A;  2W0H A;  3CN8 A;  3ATR A;  3UP5 A;  2XLU A;  4UDQ A;  1FOH A;  1TDF A;  3ISH A;  2B9X A;  2C65 A;  5KMS A;  3AEG A;  1GRE A;  1IUS A;  3SQP A;  3D9X A;  4I58 A;  2YG6 A;  2R4E A;  5DBJ A;  4X4J A;  3SYI A;  1XAN A;  1JNR A;  2V5Z A;  3AWI A;  4A65 A;  3GYI A;  1NHP A;  3ICT A;  4OPG A;  4U8P A;  3T37 A;  2C76 A;  1E1M A;  2ZBW A;  2A8X A;  3P1W A;  4OPD A;  1KN0 A;  3AEF A;  4Z44 A;  1GER A;  2XFN A;  5GRT A;  4H7U A;  1ZDL A;  1MXT A;  3PO7 A;  3CPH G;  2GAG B;  3CPI G;  1FEA A;  1PHH A;  4APN A;  1F6M A;  5JCM A;  2WOI A;  1CJ4 A;  4O5Q A;  3T2Y A;  1FL2 A;  3DK9 A;  2FBW A;  4YT0 A;  4FDC B;  3FBS A;  4EMI A;  3AE5 A;  2X3N A;  1DOE A;  3AE6 A;  3VRB A;  4NTE A;  3H4K A;  2WBA A;  3P9U A;  1TDK A;  1ZOV A;  2WEU A;  1W4X A;  2GR1 A;  1VRQ B;  1IUW A;  4JY3 A;  3UKH A;  1NDA A;  1YKJ A;  2OAM A;  5GSN A;  1D5T A;  1Y56 A;  2FJE A;  3AEB A;  1EBD A;  3AE2 A;  3T31 A;  3L8K A;  4H2Q A;  3NYE A;  1Q1W A;  5FS6 A;  3I3L A;  3R9U A;  3V3N A;  3VQR A;  4MJW A;  4J33 A;  4CY6 A;  3URH A;  4H2N A;  4E0V A;  1OJA A;  3EPT A;  1PN0 A;  5JRB A;  4B65 A;  4H4W A;  4C77 A;  2XFP A;  1ZMC A;  1H81 A;  4U2S A;  1B8S A;  2OAL A;  3AE9 A;  1N4V A;  3CND A;  1L9C A;  3NTD A;  3GYX A;  4Z24 A;  2R0G A;  3UKP A;  3G5S A;  4OPC A;  1CC6 A;  1EL8 A;  3GMB A;  3T2Z A;  4H2P A;  4KX6 A;  3AED A;  2F5Z A;  1GTH A;  4USQ A;  1CHU A;  2E1M A;  1ZOY A;  1VG0 A;  3DA1 A;  3NH3 X;  1IUX A;  5FS7 A;  4H4Z A;  5ER0 A;  5KMQ A;  1GRG A;  4IA6 A;  3QSS A;  2DKI A;  1DXL A;  4Y4L A;  1GND A;  2B7S A;  2H88 A;  2H89 A;  2ZZ0 A;  3BHF A;  1GTE A;  4TLX A;  3IWA A;  2WDR A;  5HY5 A;  3GYJ A;  3NRN A;  2XLP A;  4IA5 A;  3GD3 A;  2QA2 A;  3KPF A;  2GB0 A;  2GMH A;  1D4E A;  1OJ9 A;  4WCT A;  3M13 A;  1SEZ A;  2OLO A;  4OVI A;  1NPX A;  3AE1 A;  3BI4 A;  2VQ7 A;  2WDQ A;  4TM0 A;  3KU9 A;  1YQZ A;  1VDC A;  1B5Q A;  3KPK A;  2B9W A;  4K5R A;  5CQF A;  3PVC A;  2E4G A;  4NTC A;  3OC4 A;  5JCI A;  1CBO A;  1YQ4 A;  3OZ2 A;  4NWZ A;  4U8O A;  2Y6R A;  4H4R A;  4NEV A;  4RG3 A;  5U1O A;  1ZX9 A;  4ZN0 A;  4ADW A;  3ABV A;  2NVK X;  1Y0P A;  2WP5 A;  3AE4 A;  3L1R A;  5KMP A;  3ITJ A;  3G5Q A;  4CCR A;  3CNS A;  4G73 A;  5LV9 A;  3SZC A;  4EIP A;  2XVF A;  4G6G A;  5KMR A;  3P4R A;  1GV4 A;  3F8R A;  2EQ8 A;  2JKC A;  2YVF A;  3H8I A;  3VR8 A;  1Q9I A;  3E1T A;  2B9Y A;  4EQS A;  3P4P A;  4GUV A;  5BVA A;  4K22 A;  3D8X A;  1PBD A;  2XFO A;  2WPC A;  4G74 A;  1NAA A;  4U8L A;  3UTE A;  4YTP A;  2JB3 A;  4RG4 A;  4EMW A;  1XHC A;  1PJ6 A;  2ARD A;  5BUL A;  4PAA A;  2XVH A;  2XVJ A;  1NEN A;  2V6O A;  3BI2 A;  3NYF A;  2BS2 A;  4AT0 A;  4GDP A;  3QVP A;  4CBQ A;  1DOC A;  1PBF A;  1OJT A;  1F8S A;  3AYJ A;  4J34 A;  3DGH A;  3FG2 P;  4IV9 A;  2JBV A;  2R0P A;  1ZK7 A;  2XCG A;  4A99 A;  2OLN A;  2XLT A;  1VG9 A;  3QVR A;  4EQR A;  2C70 A;  3IF9 A;  1K0J A;  4NEW A;  1KF6 A;  3LZW A;  3UOV A;  2YLR A;  4DSG A;  1MOK A;  2A87 A;  3AB1 A;  1BGJ A;  3LOV A;  3II4 A;  1KSU A;  2VVL A;  3M12 A;  1LJ1 A;  1TDO A;  3IHG A;  3JSK A;  3Q9T A;  2WOW A;  2WS3 A;  2BC0 A;  1PXA A;  3C4N A;  1H2I A;  3AEA A;  4K7Z A;  2JAE A;  4B67 A;  3FIM B;  1L9D A;  4BV6 A;  2R46 A;  1L0V A;  4D03 A;  4JY2 A;  4GDE A;  1JRY A;  3SX6 A;  4C3X A;  2VRM A;  1NG4 A;  3DH9 A;  4A6N A;  2GQW A;  1NHS A;  2V3B A;  1QJD A;  3KA7 A;  1GOS A;  4G9K A;  3S61 A;  3HZL A;  5FS9 A;  3H8L A;  4H4V A;  1OJD A;  1ZKQ A;  3RHA A;  2YLX A;  4K8D A;  4P9S A;  4U8K A;  1HYU A;  1COY A;  2WET A;  2C3D A;  3IC9 A;  3B3R A;  3NIX A;  2YQU A;  4DNA A;  4JNQ A;  4TM4 A;  4JNA A;  2GRT A;  4OPL A;  4M52 A;  2BRA A;  4NZH A;  4X9N A;  5C2T A;  1ONF A;  3DJE A;  3AE7 A;  2X8C A;  3NHO X;  3RED A;  3HYV A;  3NYC A;  1JEH A;  4Z2R A;  2C4C A;  3KKJ A;  2BXR A;  2C66 A;  2GQF A;  4GAP A;  4YSZ A;  3CTY A;  4HA6 A;  4AP3 A;  1REO A;  1H6V A;  4BJY A;  4H2R A;  3GMC A;  1Y56 B;  1GES A;  3D1C A;  4II2 A;  4YSY A;  5IPY A;  1BWC A;  5J7X A;  1TDE A;  3T0K A;  4H4S A;  1PJ5 A;  1LVL A;  3GWF A;  3SGL A;  3UTH A;  1ZY8 A;  2Z5Y A;  4REK A;  3UTG A;  5HYM A;  3LAD A;  1GEU A;  2B7R A;  4A79 A;  1AOG A;  2TMD A;  1H83 A;  3CNJ A;  2GR3 A;  2RAB A;  1FEB A;  1O94 A;  2FJD A;  2V61 A;  3NKS A;  2IVE A;  3RP8 A;  2YR5 A;  2QAE A;  4B68 A;  2XVE A;  3KVE A;  4AOS A;  1BKW A;  1PDH A;  1N4U A;  4BK2 A;  3NLC A;  1S7M A;  4JQ9 A;  4BJZ A;  3BNM A;  1PS9 A;  3K7T A;  1CJ2 A;  4OPT A;  3AYL A;  4Z26 A;  3GDN A;  3ALL A;  1TYP A;  1Q1R A;  3GDP A;  1NHR A;  2GV8 A;  4I59 A;  2R9Z A;  2E5V A;  4U2L A;  5EBK A;  2WP9 A;  3UKL A;  1MO9 A;  2BK4 A;  3NN0 X;  4J57 A;  2BCP A;  4BK1 A;  3ICS A;  4PAB A;  2XDO A;  3CGB A;  3DGZ A;  2C73 A;  4KPR A;  3RNM A;  1ELI A;  4Z2T A;  4RSL A;  2Y6Q A;  1EL5 A;  3SZF A;  1DOD A;  2VQB A;  2QA1 A;  1V59 A;  2X8H A;  2YR6 A;  2GR2 A;  3AE8 A;  4K2X A;  1L9E A;  2WDV A;  1QLB A;  3F8P A;  4H4X A;  3K7Q X;  5KVH A;  2V60 A;  3UTF A;  3O0H A;  2BS4 A;  2JK6 A;  2IID A;  4YXD A;  1KFY A;  3LJP A;  2WES A;  3AD7 B;  3SFD A;  1CJ3 A;  3NGC X;  1IUU A;  3VRA A;  3DME A;  3G5R A;  3AD9 B;  2B76 A;  3NK2 X;  3UKK A;  2XYO A;  4EM3 A;  1S3E A;  4CCQ A;  4YKF A;  3UOX A;  2AAQ A;  3BNU A;  1TRB A;  3SZW A;  2BRY A;  2YG3 A;  4Z2U A;  1LQU A;  5KXJ A;  2YG7 A;  2QCU A;  3ATQ A;  4Z43 A;  3GWD A;  5FS8 A;  5M0Z A;  2Q6U A;  3PS9 A;  3ZYX A;  5CKU A;  4JN9 A;  1XDI A;  1M6I A;  3LZX A;  1GRT A;  4NTD A;  4UDP A;  3K7M X;  4FK1 C;  2C75 A;  3GD4 A;  2CUL A;  2J3N A;  3ALM A;  3COX A;  1BF3 A;  4A9W A;  4H4Q A;  1CL0 A;  2XLR A;  3C96 A;  3QFB A;  1D7L A;  1GRH A;  2EQ9 A;  3ICR A;  2YVG A;  4TM1 A;  3NTA A;  2JB1 A;  2XFU A;  4U8N A;  5KVI A;  1VQW A;  4EM4 A;  2CDU A;  3Q6J A;  3PG6 A;  1E1L A;  2BK3 A;  3LB8 A;  4IVO B;  4K5S A;  5U63 A;  1FEC A;  4LU6 A;  1GT8 A;  1LQT A;  1YY5 A;  2FJB A;  1PJ7 A;  2YG5 A;  3FMW A;  1KDG A;  2R45 A;  4B66 A;  2UZZ A;  3I6D A;  1H84 A;  2A89 A;  4UDR A;  3SY4 A;  2AQJ A;  3QFA A;  3B6D A;  3CPJ G;  2BA9 A;  4Z25 A;  4B64 A;  1DOB A;  4GRT A;  2NPX A;  5IQ1 A;  4A6N B;  3QJ4 A;  5M10 A;  4YKG A;  1O5W A;  1K0I A;  5EOW A;  4A5L A;  2RGJ A;  2CVJ A;  4EQX A;  3ADA B;  2PYX A;  4N9X A;  4EIQ A;  3EAN A;  4XWR A;  5J60 A;  4J2W A;  3AEC A;  1ZMD A;  3HYX A;  4ECH A;  1E39 A;  3AXB A;  4H4T A;  2BAB A;  4J56 A;  1JRZ A;  2WU5 A;  1LPF A;  3NG7 X;  4GF7 A;  4U8I A;  3RP7 A;  1IJH A;  2X8G A;  1CC2 A;  5KNL A;  1FCD A;  3FPZ A;  2XFQ A;  3UKQ A;  2OA1 A;  4ICY A;  3V3O A;  1EL9 A;  1K0L A;  4C3Y A;  1PBE A;  2GMJ A;  1PBB A;  4AOX A;  2DKH A;  1GAL A;  1D7Y A;  3L5O A;  2VZ2 A;  2YM1 A;  3M0O A;  4OPU A;  4ZCD A;  1F3P A;  2ACZ A;  1N4W A;  5BUK A;  3QSM A;  2RGH A;  4Y4N A;  2YLT A;  1H82 A;  1CF3 A;  3NK0 X;  3S5W A;  1M64 A;  2R4J A;  3ZDN A;  4CNJ A;  1B37 A;  2X99 A;  1S2Y A;  3CMM A;  4WX1 A;  1LTX R;  5KRQ A;  2WQY A;  1LV0 A;  3V76 A;  1RSG A;  4B69 A;  3KLJ A;  4YTN A;  3EAO A;  5IQ4 A;  2V3A A;  1IUT A;  4H50 A;  3GSI A;  2YLW A;  2EQ7 A;  2CFY A;  2YAU A;  2BYB A;  1O95 A;  2YLZ A;  4X9M A;  3T14 A;  2O9Z A;  1E7P A;  3CGC A;  3QSE A;  3UOZ A;  5KOX A;  5KWF A;  2TPR A;  3DJG X;  3DJJ A;  2GF3 A;  4XWZ A;  1YQ3 A;  1BGN A;  4H4P A;  1S3B A;  4GCM A;  5EB4 A;  3IHM A;  3DK8 A;  1JRX A;  1GRF A;  1F8R A;  1UKV G;  4Y4M A;  4O5U A;  2X50 A;  1GSN A;  1PXB A;  3GRS A;  3SZ0 A;  4H4Y A;  1GXF A;  2PHH A;  2Q7V A;  2RGO A;  4EMJ A;  2VOU A;  3AE3 A;  2Q0L A;  4CY8 A;  3T2K A;  2XLS A;  3P4S A;  1TYT A;  4GR1 A;  1X31 B;  2AR8 A;  1S2Q A;  1K4Q A;  4UP3 A;  3EF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...