1M6IA

Crystal structure of apoptosis inducing factor (aif)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
481
structure length
459
Chain Sequence
APSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Programmed cell death protein 8
publication title DNA binding is required for the apoptogenic action of apoptosis inducing factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 144
structure length 459
sequence length 481
ec nomenclature
pdb deposition date 2002-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1m6iA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1m6iA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1m6iA01
5GRTA 1KNPA 4JNQA 4K8DA 4LU6A 3L8KA 2JKCA 1S3EA 1PDHA 4H4ZA 4A79A 2EQ7A 1MO9A 1Y56B 3AE5A 2V6OA 1ZP0A 1GRHA 1H86A 1NDAA 2FJDA 3P4PA 5FS8A 4TLZA 4U8NA 4UDQA 4A99A 3NLCA 4H4PA 1CL0A 5IPYA 1XANA 4H4SA 4GUVA 4GR1A 2BC0A 5J7XA 5JCKA 3ALJA 4PAAA 2IIDA 3AE8A 3M0OA 1Q1RA 3NRNA 1P2EA 4KPRA 4CY8A 1IJHA 2C73A 1PJ7A 4TM0A 1OJ9A 2YM2A 4HB9A 2YWLA 2BA9A 3VQRA 4J34A 3NN0X 2YLRA 1H7WA 3P1WA 3AD8B 3LADA 4B69A 2WOWA 3ALLA 2BABA 3C4NA 3NK1X 4B66A 2APGA 2XFPA 1OJDA 1N4WA 3NTDA 4OPUA 5HHFA 2WPEA 2QAEA 3AYLA 3JSKA 1BGJA 4ADWA 1L9EA 5KXJA 2AR8A 2VZ2A 4YTMA 1CJ4A 1VDCA 3CIRA 4J36A 2VVLA 3CPHG 1H7XA 2XLTA 3QSEA 4DSGA 4EMWA 4H2QA 3DJGX 3ZYXA 4FDCB 2OLNA 1HYUA 1MXTA 3BI5A 3E1TA 4EM3A 1REOA 3IF9A 4MJWA 3EF6A 2WESA 1NG4A 2XFOA 1TDOA 2XYOA 1ZDLA 3AYJA 4EMIA 4OPTA 4U8PA 2C70A 2WETA 3VRAA 2QA2A 1DJNA 3EPTA 4Z2RA 3LB8A 4HA6A 3QVPA 3QSSA 1PS9A 1ZMDA 1CF3A 3AEDA 1QO8A 3CPIG 3DMEA 2TPRA 1BKWA 2OLOA 2VQ7A 4J31A 2B9XA 2WPFA 1M64A 4H2PA 3QFAA 4O5UA 3RP6A 2BK3A 3B3RA 4IV9A 4U8KA 4EQXA 3ITJA 2GV8A 1ZK7A 4H4QA 3ALMA 4YXDA 1FCDA 2GF3A 4TLXA 5EBKA 1DOEA 4EQWA 2C67A 1B8SA 4A6NA 1NHSA 4K22A 5KOXA 3ZDNA 1FECA 4FK1C 4KX6A 3NNEA 1CJ3A 3UKLA 4TM4A 4UDPA 2BS4A 2WOVA 1YQ4A 2WDVA 3K7MX 1H6VA 4AT2A 5BULA 3FPZA 3NYCA 4XXGA 2YG7A 2VRMA 1EL5A 3H8IA 1S2YA 1YQZA 3O0HA 2GEWA 4U8IA 1ZKQA 1D4EA 3CNJA 3DGHA 3VRDB 4H7UA 1IUWA 3P4RA 3PVCA 4GRTA 2VOUA 2WOIA 3AE9A 2B7SA 3UTGA 3COXA 2C66A 3UTHA 4PABA 2YVJA 5EB4A 2B9YA 1GPEA 4NTDA 3KLJA 5IQ4A 3I3LA 3NHOX 4BK3A 2ZZBA 3D8XA 1EL8A 3KPFA 1GERA 4K5SA 4U8JA 3IC9A 3SQPA 4BURA 2GMJA 3L1RA 3P4SA 4RG4A 4B68A 2NPXA 3AE3A 3NTAA 4Z24A 4U2SA 4TM1A 1GNDA 3QSMA 4YKGA 1CC4A 4FX9A 1CC2A 2V3BA 2Y6RA 3AE4A 4CCRA 4EIPA 1UKVG 3OC4A 1AOGA 3CN8A 1F3PA 2CDUA 3DJEA 2FJEA 5ER0A 1OJAA 1N4UA 1CBOA 2WS3A 1COYA 1KSUA 3DK8A 1PBDA 2BK5A 3CNTA 4Z2TA 1GTEA 4J56A 3DGZA 4Z44A 3ADAB 3ICSA 5FMHA 3UTFA 1ZOYA 3GWDA 3IHGA 2DKIA 1D4DA 2FJBA 1IUSA 2GR1A 2BK4A 1TDKA 4Z2UA 2YR6A 1VQWA 2XFQA 4C3YA 3NGCX 3ISHA 4EM4A 1L0VA 1JU2A 3D1CA 2HQMA 2C3CA 1F8RA 1CHUA 1EL7A 1TDEA 4IA5A 3UP4A 2WBAA 4JQ9A 2BS3A 2YLZA 1PXBA 1VRQB 5KVHA 5KVIA 3NIXA 1H83A 1IUUA 4AT0A 1K0JA 1JRXA 3BHFA 4DGKA 3K30A 5TR3A 3KKJA 3SFDA 4J57A 1GTHA 4IVOB 1KDGA 4ECHA 4BV6A 4OVIA 2C76A 2XLPA 4RG3A 2XVJA 2B7RA 2JB2A 2V3AA 3AWIA 3V76A 2R0GA 2FBWA 3C4AA 4ZCCA 3OZ2A 2XVHA 1BWCA 3T37A 1MOKA 1L9CA 1VG0A 1CJ2A 2QA1A 1TDFA 2QCUA 1GV4A 3AD9B 4TM3A 4I59A 2JB3A 2GAGB 3M12A 5L46A 1IUTA 2GAHB 3LZXA 3AEBA 5IQ1A 3UKKA 3M13A 5BRTA 3DJJA 5J60A 2GH5A 3AEAA 3DH9A 3G5QA 1TYTA 1NENA 1PHHA 5U1OA 3CNDA 5JCNA 2RABA 3I6DA 3ICTA 4H2RA 4OPLA 4WCTA 5CQFA 2C3DA 1GEUA 5GSNA 2R0CA 3GD4A 2A87A 1FOHA 2I0ZA 3EANA 3KVEA 3URHA 2BCGG 2AAQA 1KNRA 3CGEA 1B4VA 4DNAA 2E5VA 4BK2A 4YSYA 3GYIA 1Z6LA 2X50A 1PBBA 2YLWA 4U2LA 4USRA 4EQSA 2X3NA 3G5RA 2BC1A 3B6DA 3K7QX 4X9NA 2R9ZA 1LTXR 2R4EA 3NT6A 3NK2X 3CNPA 5KRQA 1ONFA 4OPIA 2GMHA 1NHPA 1PJ5A 5JCIA 2V60A 4ZCDA 3HZLA 2VVLG 4UP3A 4CNKA 5C3JA 4WX1A 3CNSA 4B63A 5HYMA 3IWAA 4H4WA 4YSZA 3AEGA 4B67A 3V3OA 1YY5A 1N4VA 3GRTA 4H4VA 1SEZA 2YLXA 3H8LA 4X9MA 1XPQA 4CY6A 4C77A 3PS9A 4A6NB 3BHKA 1S2QA 3UKFA 3BNMA 1E7PA 1ELIA 4RSLA 4Z26A 1NHRA 3SM8A 4AP1A 2JBVA 4AOXA 3NYFA 4H4UA 4NEWA 2WP6A 1NPXA 3GSIA 4U8LA 3AE2A 2BACA 1DNCA 1N1PA 1K0LA 3ABVA 3WE0A 4H4TA 3QVRA 1XDIA 2Q0LA 5HXIA 5JCMA 1GESA 2C72A 2CULA 1VG9A 2B9WA 2WQYA 4H4XA 5FS7A 2C75A 4P9SA 1D7YA 2OALA 4J33A 1B5QA 4Y4NA 3II4A 3Q6JA 1W4XA 3NKSA 1DXLA 2XCGA 1K4QA 4H50A 1OJCA 4LA1A 4YKFA 2YVGA 4YSXA 1F8WA 1E39A 1JNRA 4E0VA 1LQUA 3SFEA 5M10A 1F6MA 4JNAA 2A8XA 1M6IA 4K5RA 3KU9A 3GYJA 3QJ4A 2X8HA 4NTCA 2GR3A 4YT0A 4GF7A 3VR9A 3AE6A 3LJPA 4Y4MA 3UP5A 1QLBA 2CVJA 5FS6A 3K7TA 1JNZA 2C65A 2V5ZA 5JCLA 2BCPA 3P4QA 1LPFA 4DSHA 2WU5A 1DOCA 3P9UA 1H81A 2UZZA 4A7AA 1ZY8A 3RP8A 1E1NA 1GRTA 3AE7A 3DJDA 3GWFA 3IHMA 1ZX9A 2IVDA 2CFYA 3GRSA 1GETA 3UKHA 2R46A 3DK4A 4NZHA 3GD3A 1PN0A 4JN9A 2E4GA 1FEAA 4OCGA 4LIIA 2GVCA 2YG6A 1EL9A 3C96A 4GDPA 4BJZA 1E6EA 2H88A 4REKA 4JY3A 3AEFA 1JEHA 4H2NA 3UOXA 1IUXA 1Y56A 2Q6UA 5CKUA 1D5TA 1E1MA 4FK1A 3RP7A 2F5ZA 2ARDA 4Z25A 2R0PA 3F8DA 3FIMB 2Q7VA 4AOSA 4BJYA 1Q9IA 5BVAA 2C64A 2GB0A 1YKJA 4J2WA 2Q0KA 4A9WA 2WDRA 4H4YA 2NVKX 1PBEA 3G5SA 2BXRA 5DBJA 4A5LA 4BK1A 2GR2A 3REDA 2JB1A 2ACZA 2VQBA 4X4JA 5LV9A 3DA1A 2XVFA 2C7GA 2YLTA 4GCMA 2O9ZA 4APNA 4YTPA 4ICYA 4B65A 3BI2A 1PXAA 1H82A 2A89A 3V3NA 3AB1A 5EOWA 2IVEA 1PXCA 4U2TA 4YTNA 1GRBA 1GRGA 1K0IA 3UKQA 2XDOA 2XLUA 1ZOVA 5EB5A 2ZZCA 3GMBA 4M52A 1IUVA 3F8RA 3BNUA 1PBFA 1GRFA 4C5OA 2WU2A 1D4CA 4IA6A 2WEUA 4USQA 3PO7A 2WP5A 2GR0A 3AE1A 4A65A 4ZN0A 1BF3A 4YSHA 2DKHA 2X99A 2OA1A 2VVMA 3UKAA 2E1MA 3RNMA 3RHAA 1BZLA 4YWOA 3GDNA 4GDEA 4N9XA 4CCQA 2XFNA 1NG3A 4D04A 2BYBA 1ZMCA 4IVMB 1D7LA 4NEVA 1QJDA 1FEBA 2YG4A 1EBDA 5KWFA 1KF6A 3FBSA 2YR4A 4U8OA 3NH3X 3VRBA 1F8SA 1JRZA 1NEKA 1LJ1A 2B76A 4C74A 2JAEA 3NG7X 1O5WA 3AEEA 2YLSA 1OJTA 3ATRA 1Q1WA 2X8CA 4JDRA 2WDQA 3S5WA 2YR5A 4Z43A 2GQWA 3GDPA 1LV0A 4H4RA 2Y6QA 3GMCA 3NYEA 3UTEA 1JOAA 2YQUA 4OPGA 4OPCA 2AQJA 3AECA 1L9DA 1DODA 3ICRA 1B37A 2TMDA 2XLSA 2ZZ0A 1GALA 2RGOA 4UDRA 1GSNA 3CGCA 5FS9A 4XWRA 4CNJA 1BGNA 3UOYA 3LXDA 1S3BA 2Z5XA 5HY5A 1P2HA 1YQ3A 4EMJA 2PHHA 2R4JA 2YM1A 4K2XA 3BI4A 1H84A 3UKPA 2XVEA 1GOSA 2XLRA 4U8MA 3NN6X 4XWZA 1XHCA 3ATQA 3F8PA 3LOVA 3VR8A 3Q9TA 1X31B 2Z5YA 1FL2A 2XFUA 4B64A 1GRAA 5KOWA 1Y0PA 3SGLA 1JRYA 2ZBWA 2BS2A 2XVIA 3CPJG 1GXFA 2YVFA 1PBCA 3FG2P 2OAMA 3CTYA 4C3XA 2EQ8A 2JK6A 1NHQA 3UCLA 2GQFA 1RSGA 5M0ZA 2WP9A 1O95A 4OPDA 5C2TA 1KSSA 2H89A 4CRTA 1TYPA 3AYIA 2WPCA 3UOZA 1O94A 4O5QA 3S61A 3CGBA 2R45A 1LVLA 2YAUA 1GREA 2EQ9A 2PYXA 1KFYA 4Y4LA 3AD7B 3FMWA 3UOVA 1CJCA 2W0HA 2X8GA 2RGHA 1GT8A 4NTEA 5BUKA 4CBQA 4EIQA 1RYIA 3R9UA 4D03A 1CC6A 1DJQA 1RP0A 2YG3A 4JY2A 2V61A 3AXBA 3EAOA 2EQ6A 3H4KA 4K7ZA 1TRBA 2VRLA 1LQTA 2WHDA 2RGJA 2GRTA 5U25A 1V59A 4EQRA 2J3NA 3KD9A 1E1KA 4I58A 4B1BA 5U63A 1E1LA 3DK9A 1DOBA 1NAAA 1TDNA 2FJAA 3NK0X 3KA7A 3LZWA 4AP3A 3QFBA 1PJ6A 2YG5A 2BXSA 3CGDA
chains in the Genus database with same CATH superfamily
3IK4A 4LU6A 3L8KA 2JKCA 3OTRA 3NVYB 4H4ZA 4A79A 3TTEA 3AE5A 1H86A 1NDAA 4TLZA 3CB3A 1XANA 4PAAA 4KPRA 3VQRA 3NN0X 1N61C 2YLRA 4B69A 2WOWA 4X2PA 1N4WA 3JSKA 1BGJA 2AR8A 1VDCA 3CIRA 2XLTA 3IJIA 1KN0A 4EMWA 3DJGX 1HYUA 2FYMA 3UXKA 3EF6A 3SN1A 2WESA 3PWIA 1TDOA 2XYOA 3D46A 2I5QA 3VRAA 2AL2A 2QDDA 4IHCA 4A6GA 1PS9A 1ZMDA 3AEDA 3CPIG 2VQ7A 2E3TA 1MUCA 2QJJA 4U8KA 4EQXA 3TJIA 2GV8A 1ZK7A 4H4QA 3RITA 1MDLA 1B8SA 2E5AA 1NHSA 1EC8A 3ZDNA 1PDYA 3FPZA 3H8IA 2GEWA 4U8IA 1ZKQA 1D4EA 3DFYA 3DGHA 4H7UA 1IUWA 3UTGA 3COXA 2C66A 2B9YA 5IQ4A 3I3LA 3HYWA 3D8XA 3IC9A 3L1RA 4B68A 2NPXA 3NTAA 3DGBA 4Z24A 2V3BA 1AOGA 1VDVA 1F3PA 3DJEA 1OJAA 3OW1A 3DK8A 2OKTA 4J56A 3ICSA 2XH0A 4ZA0A 3IHGA 1IUSA 4EM4A 2C3CA 1F8RA 1TDEA 2WBAA 5KVIA 3HRDC 3K30A 1OEPA 7ENLA 4J57A 4IVOB 4BV6A 3T9PA 1FIQB 3T37A 2PU1A 1L9CA 1TDFA 2QCUA 3AD9B 4I59A 2GAHB 3T6CA 5BOFA 5BRTA 3DH9A 2P3ZA 3ICTA 4WCTA 5GSNA 3ZLGA 2GGEA 1KD0A 1SJDA 1KNRA 2E5VA 2X50A 4FP1A 1FFVC 3G5RA 2BC1A 3B6DA 2R9ZA 3NT6A 5KRQA 1N5WC 2VVLG 4Z17A 4WX1A 5HYMA 4H4WA 3PFRA 3GRTA 2YLXA 3BHKA 3UKFA 4IP5A 2WP6A 4TVYA 1DNCA 4Z1YA 3QVRA 1XDIA 5HXIA 2CULA 3R0KA 3DESA 1B5QA 3NKSA 1DXLA 2XCGA 1OJCA 2YVGA 1JNRA 5M10A 4JNAA 3DERA 1M6IA 3GYJA 2ZC8A 3P4QA 1LPFA 1DOCA 1H81A 3RP8A 3GWFA 3SSZA 2CFYA 3DK4A 4NZHA 3SN4A 1N5XA 3ZLHA 1E6EA 4REKA 1JEHA 3GO2A 1Y56A 4Z25A 5CKUA 5KOWA 1E1MA 4FK1A 3FIMB 4BJYA 2C64A 2BXRA 5DBJA 3NFUA 2ACZA 3AN1A 2XVFA 2YLTA 3L5OA 4APNA 4YTPA 4ICYA 4MKSA 2A89A 5EOWA 1PXCA 4U2TA 1GRGA 3RR1A 4G74A 1K0IA 3UKQA 1XPYA 1ZOVA 5EB5A 3DG7A 2QJNA 1IUVA 3TOYA 3F8RA 3BNUA 4J3ZA 3RGTA 2VVMA 4YWOA 3GDNA 4IVMB 1FEBA 1ZXIC 2B76A 2JAEA 1MDRA 5BOEA 3AEEA 4H1ZA 1RVKA 1OJTA 3ATRA 2YR5A 4Z43A 3VCCA 2Y6QA 3UTEA 1JOAA 2YQUA 4E4FA 4OPGA 4OPCA 3MWCA 5FJUA 1B37A 2XLSA 4IL2A 4KT2A 2PTWA 1GALA 1YEYA 4UDRA 3PG6A 5FS9A 4XWRA 4CNJA 3LXDA 3DIPA 3UKPA 1H84A 2XLRA 1XHCA 3VC5A 3F8PA 2Z5YA 2XFUA 4DYEA 1ONEA 1GXFA 3UOZA 1O94A 2EQ9A 4G6HA 2PCEA 2W0HA 2RGHA 2OQHA 4EIQA 4JN7A 1RYIA 1CC6A 1DJQA 4JY2A 2V61A 3I6EA 3H4KA 2WHDA 3V4BA 4I58A 1TDNA 3ES8A 3K1GA 3KA7A 3LZWA 4KWSA 3CGDA 4JNQA 1S3EA 1XS2A 4G9KA 2V6OA 4K1WA 3NLCA 1V97A 4GISA 5IPYA 2BC0A 3M0OA 1Q1RA 3T8QA 4H83A 1IJHA 2C73A 4HB9A 3ZVIA 4J34A 3LADA 2BABA 3UJFA 5HHFA 1OJDA 3NTDA 2WPEA 3AYLA 2VZ2A 4YTMA 1CJ4A 3VC6A 3E1TA 3BI5A 4MJWA 1REOA 3TQPA 2C70A 1KCZA 2QA2A 3EKGA 3LB8A 3SQSA 3FCPA 4J31A 4O5UA 3RP6A 2BK3A 3B3RA 3ITJA 3ALMA 4YXDA 2DW6A 2GF3A 1TZZA 3CK5A 4FK1C 3R1ZA 4UDPA 2BS4A 1YQ4A 2WDVA 3K7MX 4AT2A 5BULA 4XXGA 4GFIA 2VRMA 2YG7A 4G6GA 4K2SA 3VRDB 3MUCA 2W3RA 3QPEA 4GRTA 3AE9A 2B7SA 1E9IA 1SJBA 1GPEA 3KLJA 3NHOX 3V3WA 1EL8A 4DHGA 4U8JA 2OQYA 4BURA 3AE3A 3UJSA 3UJRA 1GNDA 3QSMA 1CC4A 4FX9A 2PP3A 3BJSA 3S5SA 2Y6RA 3AE4A 4EIPA 3OC4A 2CDUA 2FJEA 4H19A 2WS3A 3ZVHA 4FI4A 4Z2TA 1SB3B 1GTEA 5FMHA 1D4DA 2XFQA 3ISHA 1CHUA 2YLZA 1VRQB 3NIXA 2XH2A 4II3A 4ECHA 2OLAA 4OVIA 2C76A 1F9CA 3MSYA 2XLPA 4RG3A 2V3AA 2B7RA 2JB2A 3NVVB 3AWIA 3V76A 3RCYA 2R0GA 3U9IA 3H7VA 3C4AA 3OZ2A 2XVHA 3THUA 1CJ2A 2P88A 3R0UA 2JB3A 3AEBA 4KPLA 3OPSA 2XH7A 1H2IA 5J60A 1TYTA 5JCNA 2RABA 3CT2A 5CQFA 2A87A 3KVEA 1B4VA 4YSYA 4G8TA 1Z6LA 1PBBA 3I4KA 1LTXR 2R4EA 2PA6A 2BRYA 3NK2X 1NHPA 3MQTA 2AL1A 1PJ5A 3DFHA 2V60A 3SZ0A 2AL2B 3HZLA 1SJAA 1S7MA 4UP3A 2GSHA 2C4CA 3V3OA 2CHRA 4H4VA 3H8LA 1XPQA 4C77A 3NRZB 1S2QA 2DW7A 2OZ3A 3DG6A 1ELIA 4RSLA 4Z26A 4AP1A 4NEWA 3GSIA 1N1PA 4H4TA 3NS1B 4GYPA 2GGHA 5JCMA 1GESA 2WQYA 2PMQA 4H4XA 2C75A 1D7YA 4J33A 3N6JA 1W4XA 3V5FA 4E0VA 2A8XA 3UJ2A 1ECQA 3OZMA 3KU9A 4NTCA 3QJ4A 2GR3A 2QQ6A 4DN1A 3AE6A 3KUMA 3B97A 5FS6A 2C65A 4IZGA 3NZGA 2WU5A 4A7AA 2UZZA 1E1NA 3IHMA 1ZX9A 2R46A 1PN0A 4OCGA 1VQZA 1EL9A 3SY4A 3GD6A 3AEFA 2Q6UA 2Q7VA 2GB0A 4J2WA 2Q0KA 4H4YA 4A5LA 1BQGA 2GR2A 3PK7A 4NWZA 4A35A 2PGEA 4GCMA 3V3NA 3SZCA 1N60C 2IVEA 5J04A 2XDOA 4HYRA 2ZZCA 3GYXA 2WEUA 3SZWA 2WP5A 2GR0A 1BF3A 3UKAA 2GDQA 1BZLA 4CCQA 3OP2A 3HYVA 2BYBA 5FJOA 1D7LA 4NEVA 1EBDA 4U8OA 3VRBA 1F8SA 1NEKA 4GGHA 1TE6A 3ETRB 4M0XA 2OO6A 2GQWA 3GDPA 2AQJA 1L9DA 1DODA 3ICRA 3CYJA 5G5HB 3UOYA 3R10A 1P2HA 4GIRA 2PHHA 4YWSA 2R4JA 2YM1A 3BI4A 5FJTA 3MZNA 4B64A 1GRAA 1Y0PA 2OFJA 2XVIA 3CPJG 2YVFA 3CTYA 2JK6A 2GQFA 2OZ8A 1O95A 2H89A 3AYIA 2GGIA 1LVLA 2YAUA 1KFYA 1W6TA 3FMWA 4NTEA 3T2YA 4CBQA 5KMRA 1MRAA 4D03A 5ENLA 1RP0A 4K7ZA 1TRBA 1V59A 4E5TA 3QKEA 2J3NA 2GL5A 4HN8A 3KD9A 3DK9A 1DOBA 2XH4A 2BXSA 4M6UA 5GRTA 4K8DA 3T0KA 1MO9A 2POZA 2PPGA 1Y56B 1GRHA 6ENLA 2FJDA 3P4PA 4U8NA 4UDQA 4H4PA 3N6HA 3STPA 4H4SA 3NRNA 1P2EA 4A3RA 1PJ7A 2YM2A 3FVDA 2YWLA 4DWDA 2BA9A 3CXBA 1KKRA 3R25A 4GYPC 3P1WA 3ALLA 3C4NA 2XFPA 3TCSA 4ADWA 2P8BA 2PU0A 4J36A 1H7XA 1RM6B 3ZYXA 4FDCB 3OZYA 3AMZA 4HNLA 1NG4A 2XFOA 1X2HA 4U8PA 1DJNA 3EPTA 4HA6A 3QVPA 4ZOHB 3MY9A 1CF3A 3DMEA 1QO8A 1BKWA 3DG3A 2B9XA 2WPFA 1M64A 3QFAA 4IV9A 5EBKA 1DOEA 4EQWA 4A6NA 3UCCA 4KX6A 3NNEA 1CJ3A 3UKLA 2WOVA 2P8CA 3O0HA 3CNJA 1DTNA 3P4RA 3PVCA 2VOUA 2WOIA 3UTHA 4PABA 5EB4A 4NTDA 2PTXA 2ZZBA 3KPFA 1GERA 4K5SA 3P4SA 4RG4A 4U2SA 2RDXA 2MUCA 4YKGA 1CC2A 4CCRA 3A7RA 1JPDX 1CBOA 1COYA 1KSUA 1PBDA 1WYGA 3DGZA 1ZOYA 3GWDA 2DKIA 3RRAA 2BK4A 2YR6A 4C3YA 3NGCX 1L0VA 2HQMA 3TWBA 4IA5A 3UP4A 3QTPA 4IP4A 5KVHA 1H83A 3BHFA 5TR3A 3SFDA 2XVJA 2PGWA 1EC9A 3SN0A 4ZCCA 1BWCA 3MKCA 1VG0A 3FV9A 3P93A 1IUTA 5IQ1A 3M13A 3G5QA 3AEAA 3CNDA 4H2RA 2HXTA 2R0CA 3GD4A 5KMQA 4ROPA 3URHA 2BCGG 3CGEA 4DNAA 4BK2A 3GYIA 3T2ZA 1EBHA 3H8AA 4USRA 4X9NA 2X3NA 3R07C 3FXGA 4OPIA 2GMHA 1JPMA 3FJ4A 5JCIA 4ZCDA 3NXLA 3N4FA 2AKZA 3ZLFA 3IWAA 4YSZA 2W3SA 1SEZA 4X9MA 2OX4A 3PS9A 4HCHA 2XGZA 3BNMA 1NHRA 2JBVA 3NYFA 4H4UA 1NPXA 4NNJA 2Q0LA 3HYXA 1VG9A 5FS7A 2OALA 3HW2A 4Y4NA 3II4A 1MNSA 1K4QA 4YKFA 3SFEA 1F6MA 4K5RA 2X8HA 3D47A 1N63C 4GF7A 3LJPA 4Y4MA 3UP5A 3T4WA 3VA8A 2BCPA 4DSHA 1WUFA 3ZVHB 1ZY8A 4E8GA 3AE7A 3GRSA 3UKHA 3AM9A 3GD3A 2E4GA 1FEAA 3GY1A 2GVCA 2YG6A 2P0IA 3UJEA 2H88A 2OZTA 2PTYA 1IUXA 1FHVA 5BUKA 1D5TA 2F5ZA 2W55A 5KNLA 1YKJA 3DEQA 2WDRA 3IJQA 4GGBA 2NVKX 3G5SA 4BK1A 4X4JA 3DA1A 2C7GA 3P0WA 4B65A 4HCDA 1PXAA 3AB1A 4YTNA 2OG9A 1GRBA 4JHMA 2W54A 2XLUA 3GMBA 1NU5A 1GRFA 4C5OA 2WU2A 3PO7A 4A65A 4ZN0A 5JRBA 2E1MA 3RNMA 3RHAA 4N9XA 3PWGA 3V5CA 2XFNA 4D04A 3TWAA 1ZMCA 5KWFA 4EWJA 1JRZA 3SZFA 1O5WA 2HNEA 2YLSA 2X8CA 4JDRA 3S5WA 2AKMA 3GMCA 4H4RA 3NYEA 3EEZA 3GC2A 4ENLA 1PDZA 3QLDA 2TMDA 2ZZ0A 2RGOA 1GSNA 4ZCWA 1BGNA 1S3BA 2Z5XA 1YQ3A 3CMMA 4U8MA 1N62C 3NN6X 4XWZA 3LOVA 3Q9TA 1X31B 1FL2A 3SGLA 1STZA 4TVWA 2PODA 2BS2A 1PBCA 3FG2P 2OAMA 1NHQA 3VFCA 3UCLA 1RSGA 1EC7A 2WP9A 5C2TA 1KSSA 4CRTA 1TYPA 2WPCA 3S61A 3CGBA 1GREA 2PYXA 4JN8A 3AD7B 2OVLA 1JROA 3NO1A 2YG3A 3EAOA 3BSMA 2EQ6A 2VRLA 2RGJA 4MGGA 5U63A 1E1LA 1NAAA 5FJPA 1SJCA 1PJ6A 2PS2A 2YG5A 1KNPA 1PDHA 2MNRA 2EQ7A 1ZP0A 5FS8A 4II2A 4A99A 1CL0A 3JZUA 4GUVA 4GR1A 5J7XA 5JCKA 3ALJA 2IIDA 3AE8A 4CY8A 2PTZA 3RO6A 1OJ9A 4TM0A 2HXUA 4F4RA 1H7WA 3AD8B 4B66A 3NK1X 1JRPA 2APGA 4OPUA 1WUEA 3T31A 2QAEA 4E6MA 1L9EA 5KXJA 2VVLA 3CPHG 3QSEA 4DSGA 4H2QA 2OLNA 4HCLA 1MXTA 3IF9A 4EM3A 2QGYA 1ZDLA 3AYJA 4EMIA 4OPTA 3BOXA 1IYXA 2WETA 3JVAA 3SR6B 2BRAA 4Z2RA 3QSSA 2TPRA 2OLOA 2NQLA 4H2PA 3H12A 3B9JB 5G5GB 1FCDA 4TLXA 2C67A 4K22A 5KMPA 3T14A 5KOXA 1FECA 4TM4A 1H6VA 3NYCA 1EL5A 1S2YA 1YQZA 3IJLA 1FO4A 2YVJA 3UCDA 2ZADA 4BK3A 3HPFA 3SXIA 1NELA 2QJMA 3SQPA 2GMJA 4TM1A 1X2GA 3EUB3 1UKVG 3CN8A 5ER0A 3SYIA 1N4UA 3ENLA 2BK5A 3CNTA 4DX3A 4HPNA 4Z44A 3ADAB 3UTFA 2GGGA 2FJBA 2GR1A 4Z2UA 1TDKA 1VQWA 1JU2A 3D1CA 3QN3A 1EL7A 4JQ9A 2BS3A 1PXBA 4G73A 1IUUA 4AT0A 1K0JA 1JRXA 1KKOA 4DGKA 2ONEA 3KKJA 1GTHA 1KDGA 4GAPA 4E4UA 2FBWA 4GAVA 3A7AA 1MOKA 2QA1A 1GV4A 1R6WA 4TM3A 3TJ4A 2GAGB 3M12A 5L46A 3LZXA 3NVZB 3UKKA 1TKKA 3DJJA 2GH5A 3I6DA 1NENA 1PHHA 5U1OA 4OPLA 3T2KA 4DXKA 2C3DA 1GEUA 4H2HA 1FOHA 2I0ZA 3EANA 2AAQA 2PP1A 3S47A 2YLWA 4U2LA 4K8GA 4EQSA 3UGVA 3K7QX 3NVWB 3CNPA 1ONFA 3I6TA 3JW7A 5EU9A 4CNKA 5C3JA 4KEMA 3CNSA 4B63A 3AEGA 4B67A 1YY5A 1N4VA 4CY6A 3DDMA 4A6NB 3ES7A 3A7UA 1E7PA 4HNCA 3SM8A 3D9XA 4AOXA 4U8LA 3AE2A 2BACA 1K0LA 3ABVA 3WE0A 1P48A 4J1OA 4IT1A 2C72A 2B9WA 4P9SA 3Q6JA 4H50A 4LA1A 4YSXA 1F8WA 1T3QC 1E39A 3P3BA 1LQUA 4YT0A 2PP0A 3VR9A 1QLBA 2CVJA 3K7TA 1JNZA 2PSNA 5KMSA 2V5ZA 5JCLA 3P9UA 4MMWA 1GRTA 3DJDA 3H70A 2IVDA 1JCTA 1GETA 2XSXA 4JN9A 4LIIA 3FYYA 3C96A 4BJZA 4GDPA 4JY3A 4H2NA 3UOXA 3RP7A 2ARDA 2R0PA 3F8DA 4AOSA 2QDEA 1Q9IA 5BVAA 4A9WA 2HZGA 1PBEA 3REDA 2JB1A 2VQBA 5LV9A 4IL0A 2O9ZA 1L8PA 3U4FA 1JDFA 1EBGA 2FKPA 3BI2A 1H82A 4GMEA 4M52A 1PBFA 3Q4DA 1D4CA 4IA6A 4USQA 3AE1A 3TW9A 4YSHA 2DKHA 2X99A 2OA1A 4GDEA 1NG3A 1QJDA 2YG4A 3VDGA 1KF6A 3FBSA 2YR4A 3NH3X 4C74A 1LJ1A 3NG7X 3SX6A 1FHUA 1Q1WA 2WDQA 1LV0A 3N4EA 3AECA 1FFUC 3CGCA 5HY5A 5FJRA 4EMJA 4K2XA 2XVEA 1GOSA 3R11A 3ATQA 3Q45A 1ELSA 2OPJA 3VR8A 1JRYA 2ZBWA 3CXOA 4C3XA 2EQ8A 4G7FA 5M0ZA 4OPDA 3SJNA 4O5QA 2R45A 4Y4LA 3UOVA 1CJCA 2X8GA 3KPKA 3SBFA 1GT8A 2GGJA 3R9UA 3UXLA 3AXBA 1R0MA 1LQTA 2GRTA 5U25A 4EQRA 1BKHA 5IDZA 1E1KA 4B1BA 2QVHA 2O56A 3NK0X 2FJAA 4AP3A 3QFBA 3VCNA 3CAWA 1P43A
chains in the Genus database with same CATH topology
5GRTA 1KNPA 4JNQA 4K8DA 4LU6A 3L8KA 2JKCA 1S3EA 3T0KA 1PDHA 4H4ZA 4A79A 4G9KA 2EQ7A 1MO9A 1Y56B 3AE5A 2V6OA 1ZP0A 1GRHA 1H86A 1NDAA 2FJDA 3P4PA 5FS8A 4TLZA 4II2A 4U8NA 4UDQA 4A99A 3NLCA 4H4PA 1CL0A 5IPYA 1XANA 4H4SA 4GUVA 4GR1A 2BC0A 5J7XA 5JCKA 3ALJA 4PAAA 2IIDA 3AE8A 3M0OA 1Q1RA 3NRNA 1P2EA 4KPRA 4CY8A 1IJHA 2C73A 1PJ7A 4TM0A 1OJ9A 2YM2A 4HB9A 2YWLA 2BA9A 3VQRA 4J34A 3NN0X 2YLRA 1H7WA 3P1WA 3AD8B 3LADA 4B69A 2WOWA 3ALLA 2BABA 3C4NA 3NK1X 4B66A 2APGA 2XFPA 1OJDA 1N4WA 3NTDA 4OPUA 5HHFA 3T31A 2WPEA 2QAEA 3AYLA 3JSKA 1BGJA 4ADWA 1L9EA 5KXJA 2AR8A 2VZ2A 4YTMA 1CJ4A 1VDCA 3CIRA 4J36A 2VVLA 3CPHG 1H7XA 2XLTA 1KN0A 3QSEA 4DSGA 4EMWA 4H2QA 3DJGX 3ZYXA 4FDCB 2OLNA 1HYUA 1MXTA 3BI5A 3E1TA 4EM3A 1REOA 3IF9A 4MJWA 3EF6A 2WESA 1NG4A 2XFOA 1TDOA 2XYOA 1ZDLA 3AYJA 4EMIA 4OPTA 4U8PA 2C70A 2WETA 3VRAA 2QA2A 2BRAA 1DJNA 3EPTA 4Z2RA 3LB8A 4HA6A 3QVPA 3QSSA 1PS9A 1ZMDA 1CF3A 3AEDA 1QO8A 3CPIG 3DMEA 2TPRA 1BKWA 2OLOA 2VQ7A 4J31A 2B9XA 2WPFA 1M64A 4H2PA 3QFAA 4O5UA 3RP6A 2BK3A 3B3RA 4IV9A 4U8KA 4EQXA 3ITJA 2GV8A 1ZK7A 4H4QA 3ALMA 4YXDA 1FCDA 2GF3A 4TLXA 5EBKA 1DOEA 4EQWA 2C67A 1B8SA 4A6NA 1NHSA 4K22A 5KMPA 3T14A 5KOXA 3ZDNA 1FECA 4FK1C 4KX6A 3NNEA 1CJ3A 3UKLA 4TM4A 4UDPA 2BS4A 2WOVA 1YQ4A 2WDVA 3K7MX 1H6VA 4AT2A 5BULA 3FPZA 3NYCA 4XXGA 2YG7A 2VRMA 1EL5A 3H8IA 1S2YA 1YQZA 3O0HA 2GEWA 4G6GA 4U8IA 1ZKQA 1D4EA 3CNJA 3DGHA 3VRDB 4H7UA 1IUWA 3P4RA 3PVCA 4GRTA 2VOUA 2WOIA 3AE9A 2B7SA 3UTGA 3COXA 2C66A 3UTHA 4PABA 2YVJA 5EB4A 2B9YA 1GPEA 4NTDA 3KLJA 5IQ4A 3I3LA 3NHOX 4BK3A 3HYWA 2ZZBA 3D8XA 1EL8A 3KPFA 3SXIA 1GERA 4K5SA 4U8JA 3IC9A 3SQPA 4BURA 2GMJA 3L1RA 3P4SA 4RG4A 4B68A 2NPXA 3AE3A 3NTAA 4Z24A 4U2SA 4TM1A 1GNDA 3QSMA 4YKGA 1CC4A 4FX9A 2V3BA 1CC2A 2Y6RA 3AE4A 4CCRA 4EIPA 1UKVG 3OC4A 1AOGA 3CN8A 1F3PA 2CDUA 3DJEA 2FJEA 5ER0A 1OJAA 3SYIA 1N4UA 1CBOA 2WS3A 1COYA 1KSUA 3DK8A 1PBDA 2BK5A 3CNTA 4Z2TA 1GTEA 4J56A 3DGZA 4Z44A 3ADAB 3ICSA 5FMHA 3UTFA 1ZOYA 3GWDA 3IHGA 2DKIA 1D4DA 2FJBA 1IUSA 2GR1A 2BK4A 1TDKA 4Z2UA 2YR6A 1VQWA 2XFQA 4C3YA 3NGCX 3ISHA 4EM4A 1L0VA 1JU2A 3D1CA 2HQMA 2C3CA 1F8RA 1CHUA 1EL7A 1TDEA 4IA5A 3UP4A 2WBAA 4JQ9A 2BS3A 2YLZA 1PXBA 1VRQB 5KVHA 5KVIA 4G73A 3NIXA 1H83A 1IUUA 4AT0A 1K0JA 1JRXA 3BHFA 4DGKA 3K30A 5TR3A 3KKJA 3SFDA 4J57A 1GTHA 4IVOB 1KDGA 4II3A 4BV6A 4ECHA 4OVIA 2C76A 2XLPA 4RG3A 4GAPA 2XVJA 2V3AA 2B7RA 2JB2A 3AWIA 3V76A 2R0GA 2FBWA 4GAVA 3C4AA 4ZCCA 3OZ2A 2XVHA 1BWCA 3T37A 1MOKA 1L9CA 1VG0A 1CJ2A 2QA1A 1TDFA 2QCUA 1GV4A 3AD9B 4TM3A 4I59A 2JB3A 2GAGB 3M12A 5L46A 1IUTA 2GAHB 3LZXA 3AEBA 5IQ1A 3UKKA 3M13A 5BRTA 3DJJA 1H2IA 5J60A 2GH5A 3AEAA 3DH9A 3G5QA 1TYTA 1NENA 1PHHA 5U1OA 3CNDA 5JCNA 2RABA 3I6DA 3ICTA 4H2RA 4OPLA 4WCTA 5CQFA 3T2KA 2C3DA 1GEUA 5GSNA 2R0CA 3GD4A 2A87A 1FOHA 2I0ZA 5KMQA 3EANA 3KVEA 3URHA 2BCGG 2AAQA 1KNRA 3CGEA 1B4VA 4DNAA 2E5VA 4BK2A 4YSYA 3GYIA 1Z6LA 2X50A 1PBBA 2YLWA 3T2ZA 4U2LA 4USRA 4EQSA 2X3NA 3G5RA 2BC1A 3B6DA 3K7QX 4X9NA 2R9ZA 1LTXR 2R4EA 3NT6A 3NK2X 2BRYA 3CNPA 5KRQA 1ONFA 4OPIA 2GMHA 1NHPA 1PJ5A 5JCIA 2V60A 4ZCDA 3SZ0A 3HZLA 2VVLG 4UP3A 1S7MA 4CNKA 5C3JA 4WX1A 3CNSA 2C4CA 4B63A 5HYMA 3IWAA 4H4WA 4YSZA 3AEGA 4B67A 3V3OA 1YY5A 1N4VA 3GRTA 4H4VA 1SEZA 2YLXA 3H8LA 4X9MA 1XPQA 4CY6A 4C77A 3PS9A 4A6NB 3BHKA 1S2QA 3UKFA 3BNMA 1E7PA 1ELIA 4RSLA 4Z26A 1NHRA 3SM8A 4AP1A 2JBVA 3D9XA 4AOXA 3NYFA 4H4UA 4NEWA 2WP6A 1NPXA 3GSIA 4U8LA 3AE2A 2BACA 1DNCA 1N1PA 1K0LA 3ABVA 3WE0A 4NNJA 4H4TA 3QVRA 1XDIA 2Q0LA 5HXIA 3HYXA 5JCMA 1GESA 2C72A 2CULA 1VG9A 2B9WA 2WQYA 4H4XA 5FS7A 2C75A 4P9SA 1D7YA 2OALA 4J33A 1B5QA 4Y4NA 3II4A 3Q6JA 1W4XA 3NKSA 1DXLA 2XCGA 1K4QA 4H50A 1OJCA 4LA1A 4YKFA 2YVGA 4YSXA 1F8WA 1E39A 1JNRA 4E0VA 1LQUA 3SFEA 5M10A 1F6MA 4JNAA 2A8XA 1M6IA 4K5RA 3KU9A 3GYJA 3QJ4A 2X8HA 4NTCA 2GR3A 4YT0A 4GF7A 3VR9A 3AE6A 3LJPA 4Y4MA 3UP5A 1QLBA 2CVJA 5FS6A 3K7TA 1JNZA 2C65A 5KMSA 2V5ZA 5JCLA 2BCPA 3P4QA 1LPFA 4DSHA 2WU5A 1DOCA 3P9UA 1H81A 2UZZA 4A7AA 1ZY8A 3RP8A 1E1NA 1GRTA 3AE7A 3DJDA 3GWFA 3IHMA 1ZX9A 2IVDA 2CFYA 3GRSA 1GETA 3UKHA 2R46A 3DK4A 4NZHA 3GD3A 1PN0A 4JN9A 2E4GA 1FEAA 4OCGA 4LIIA 2GVCA 2YG6A 1EL9A 3C96A 4GDPA 4BJZA 1E6EA 2H88A 3SY4A 4REKA 4JY3A 3AEFA 1JEHA 4H2NA 3UOXA 1IUXA 1Y56A 2Q6UA 5CKUA 1D5TA 1E1MA 4FK1A 3RP7A 2F5ZA 2ARDA 4Z25A 2R0PA 3F8DA 3FIMB 2Q7VA 4AOSA 4BJYA 1Q9IA 5BVAA 5KNLA 2C64A 2GB0A 1YKJA 4J2WA 2Q0KA 4A9WA 2WDRA 4H4YA 2NVKX 1PBEA 3G5SA 2BXRA 5DBJA 4A5LA 4BK1A 2GR2A 4NWZA 3REDA 2JB1A 2ACZA 2VQBA 4X4JA 5LV9A 3DA1A 2XVFA 2C7GA 2YLTA 4GCMA 2O9ZA 3L5OA 4APNA 4YTPA 4ICYA 4B65A 3BI2A 1PXAA 1H82A 2A89A 3V3NA 3SZCA 3AB1A 5EOWA 2IVEA 1PXCA 4U2TA 4YTNA 1GRBA 1GRGA 4G74A 1K0IA 3UKQA 2XDOA 2XLUA 1ZOVA 5EB5A 2ZZCA 3GMBA 4M52A 1IUVA 3F8RA 3BNUA 1PBFA 1GRFA 4C5OA 2WU2A 1D4CA 3GYXA 4IA6A 2WEUA 4USQA 3PO7A 3SZWA 2WP5A 2GR0A 3AE1A 4A65A 4ZN0A 5JRBA 1BF3A 4YSHA 2DKHA 2X99A 2OA1A 2VVMA 3UKAA 2E1MA 3RNMA 3RHAA 1BZLA 4YWOA 3GDNA 4GDEA 4N9XA 4CCQA 2XFNA 3HYVA 1NG3A 4D04A 2BYBA 1ZMCA 4IVMB 1D7LA 4NEVA 1QJDA 1FEBA 2YG4A 1EBDA 5KWFA 1KF6A 3FBSA 2YR4A 4U8OA 3NH3X 3VRBA 1F8SA 1JRZA 1NEKA 1LJ1A 2B76A 4C74A 2JAEA 3NG7X 3SZFA 1O5WA 3SX6A 3AEEA 2YLSA 1OJTA 3ATRA 1Q1WA 2X8CA 4JDRA 2WDQA 3S5WA 2YR5A 4Z43A 2GQWA 3GDPA 1LV0A 4H4RA 2Y6QA 3GMCA 3NYEA 3UTEA 1JOAA 2YQUA 4OPGA 4OPCA 2AQJA 3AECA 1L9DA 1DODA 3ICRA 1B37A 2TMDA 2XLSA 2ZZ0A 1GALA 2RGOA 4UDRA 1GSNA 3CGCA 3PG6A 5FS9A 4XWRA 4CNJA 1BGNA 3UOYA 3LXDA 1S3BA 2Z5XA 5HY5A 1P2HA 1YQ3A 4EMJA 2PHHA 2R4JA 2YM1A 4K2XA 3BI4A 1H84A 3UKPA 3CMMA 2XVEA 1GOSA 2XLRA 4U8MA 3NN6X 4XWZA 1XHCA 3ATQA 3F8PA 3LOVA 3VR8A 3Q9TA 1X31B 2Z5YA 1FL2A 2XFUA 4B64A 1GRAA 5KOWA 1Y0PA 3SGLA 1JRYA 2ZBWA 2BS2A 2XVIA 3CPJG 1GXFA 2YVFA 1PBCA 3FG2P 2OAMA 3CTYA 4C3XA 2EQ8A 2JK6A 1NHQA 3UCLA 2GQFA 1RSGA 5M0ZA 2WP9A 1O95A 4OPDA 5C2TA 1KSSA 2H89A 4CRTA 1TYPA 3AYIA 2WPCA 3UOZA 1O94A 4O5QA 3S61A 3CGBA 2R45A 1LVLA 2YAUA 1GREA 2EQ9A 2PYXA 1KFYA 4Y4LA 4G6HA 3AD7B 3FMWA 3UOVA 1CJCA 2W0HA 2X8GA 2RGHA 3KPKA 1GT8A 4NTEA 5BUKA 3T2YA 4CBQA 5KMRA 4EIQA 1RYIA 3R9UA 4D03A 1CC6A 1DJQA 1RP0A 2YG3A 4JY2A 2V61A 3AXBA 3EAOA 2EQ6A 3H4KA 4K7ZA 1TRBA 2VRLA 1LQTA 2WHDA 2RGJA 2GRTA 5U25A 1V59A 4EQRA 2J3NA 3KD9A 1E1KA 4I58A 4B1BA 5U63A 1E1LA 3DK9A 1DOBA 1NAAA 1TDNA 2FJAA 3NK0X 3KA7A 3LZWA 4AP3A 3QFBA 1PJ6A 2YG5A 2BXSA 3CGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GRT A;  1KNP A;  4JNQ A;  4K8D A;  4LU6 A;  3L8K A;  2JKC A;  1S3E A;  1PDH A;  4H4Z A;  4A79 A;  2EQ7 A;  1MO9 A;  1Y56 B;  3AE5 A;  2V6O A;  1ZP0 A;  1GRH A;  1H86 A;  1NDA A;  2FJD A;  3P4P A;  5FS8 A;  4TLZ A;  4U8N A;  4UDQ A;  4A99 A;  3NLC A;  4H4P A;  1CL0 A;  5IPY A;  1XAN A;  4H4S A;  4GUV A;  4GR1 A;  2BC0 A;  5J7X A;  5JCK A;  3ALJ A;  4PAA A;  2IID A;  3AE8 A;  3M0O A;  1Q1R A;  3NRN A;  1P2E A;  4KPR A;  4CY8 A;  1IJH A;  2C73 A;  1PJ7 A;  4TM0 A;  1OJ9 A;  2YM2 A;  4HB9 A;  2YWL A;  2BA9 A;  3VQR A;  4J34 A;  3NN0 X;  2YLR A;  1H7W A;  3P1W A;  3AD8 B;  3LAD A;  4B69 A;  2WOW A;  3ALL A;  2BAB A;  3C4N A;  3NK1 X;  4B66 A;  2APG A;  2XFP A;  1OJD A;  1N4W A;  3NTD A;  4OPU A;  5HHF A;  2WPE A;  2QAE A;  3AYL A;  3JSK A;  1BGJ A;  4ADW A;  1L9E A;  5KXJ A;  2AR8 A;  2VZ2 A;  4YTM A;  1CJ4 A;  1VDC A;  3CIR A;  4J36 A;  2VVL A;  3CPH G;  1H7X A;  2XLT A;  3QSE A;  4DSG A;  4EMW A;  4H2Q A;  3DJG X;  3ZYX A;  4FDC B;  2OLN A;  1HYU A;  1MXT A;  3BI5 A;  3E1T A;  4EM3 A;  1REO A;  3IF9 A;  4MJW A;  3EF6 A;  2WES A;  1NG4 A;  2XFO A;  1TDO A;  2XYO A;  1ZDL A;  3AYJ A;  4EMI A;  4OPT A;  4U8P A;  2C70 A;  2WET A;  3VRA A;  2QA2 A;  1DJN A;  3EPT A;  4Z2R A;  3LB8 A;  4HA6 A;  3QVP A;  3QSS A;  1PS9 A;  1ZMD A;  1CF3 A;  3AED A;  1QO8 A;  3CPI G;  3DME A;  2TPR A;  1BKW A;  2OLO A;  2VQ7 A;  4J31 A;  2B9X A;  2WPF A;  1M64 A;  4H2P A;  3QFA A;  4O5U A;  3RP6 A;  2BK3 A;  3B3R A;  4IV9 A;  4U8K A;  4EQX A;  3ITJ A;  2GV8 A;  1ZK7 A;  4H4Q A;  3ALM A;  4YXD A;  1FCD A;  2GF3 A;  4TLX A;  5EBK A;  1DOE A;  4EQW A;  2C67 A;  1B8S A;  4A6N A;  1NHS A;  4K22 A;  5KOX A;  3ZDN A;  1FEC A;  4FK1 C;  4KX6 A;  3NNE A;  1CJ3 A;  3UKL A;  4TM4 A;  4UDP A;  2BS4 A;  2WOV A;  1YQ4 A;  2WDV A;  3K7M X;  1H6V A;  4AT2 A;  5BUL A;  3FPZ A;  3NYC A;  4XXG A;  2YG7 A;  2VRM A;  1EL5 A;  3H8I A;  1S2Y A;  1YQZ A;  3O0H A;  2GEW A;  4U8I A;  1ZKQ A;  1D4E A;  3CNJ A;  3DGH A;  3VRD B;  4H7U A;  1IUW A;  3P4R A;  3PVC A;  4GRT A;  2VOU A;  2WOI A;  3AE9 A;  2B7S A;  3UTG A;  3COX A;  2C66 A;  3UTH A;  4PAB A;  2YVJ A;  5EB4 A;  2B9Y A;  1GPE A;  4NTD A;  3KLJ A;  5IQ4 A;  3I3L A;  3NHO X;  4BK3 A;  2ZZB A;  3D8X A;  1EL8 A;  3KPF A;  1GER A;  4K5S A;  4U8J A;  3IC9 A;  3SQP A;  4BUR A;  2GMJ A;  3L1R A;  3P4S A;  4RG4 A;  4B68 A;  2NPX A;  3AE3 A;  3NTA A;  4Z24 A;  4U2S A;  4TM1 A;  1GND A;  3QSM A;  4YKG A;  1CC4 A;  4FX9 A;  1CC2 A;  2V3B A;  2Y6R A;  3AE4 A;  4CCR A;  4EIP A;  1UKV G;  3OC4 A;  1AOG A;  3CN8 A;  1F3P A;  2CDU A;  3DJE A;  2FJE A;  5ER0 A;  1OJA A;  1N4U A;  1CBO A;  2WS3 A;  1COY A;  1KSU A;  3DK8 A;  1PBD A;  2BK5 A;  3CNT A;  4Z2T A;  1GTE A;  4J56 A;  3DGZ A;  4Z44 A;  3ADA B;  3ICS A;  5FMH A;  3UTF A;  1ZOY A;  3GWD A;  3IHG A;  2DKI A;  1D4D A;  2FJB A;  1IUS A;  2GR1 A;  2BK4 A;  1TDK A;  4Z2U A;  2YR6 A;  1VQW A;  2XFQ A;  4C3Y A;  3NGC X;  3ISH A;  4EM4 A;  1L0V A;  1JU2 A;  3D1C A;  2HQM A;  2C3C A;  1F8R A;  1CHU A;  1EL7 A;  1TDE A;  4IA5 A;  3UP4 A;  2WBA A;  4JQ9 A;  2BS3 A;  2YLZ A;  1PXB A;  1VRQ B;  5KVH A;  5KVI A;  3NIX A;  1H83 A;  1IUU A;  4AT0 A;  1K0J A;  1JRX A;  3BHF A;  4DGK A;  3K30 A;  5TR3 A;  3KKJ A;  3SFD A;  4J57 A;  1GTH A;  4IVO B;  1KDG A;  4ECH A;  4BV6 A;  4OVI A;  2C76 A;  2XLP A;  4RG3 A;  2XVJ A;  2B7R A;  2JB2 A;  2V3A A;  3AWI A;  3V76 A;  2R0G A;  2FBW A;  3C4A A;  4ZCC A;  3OZ2 A;  2XVH A;  1BWC A;  3T37 A;  1MOK A;  1L9C A;  1VG0 A;  1CJ2 A;  2QA1 A;  1TDF A;  2QCU A;  1GV4 A;  3AD9 B;  4TM3 A;  4I59 A;  2JB3 A;  2GAG B;  3M12 A;  5L46 A;  1IUT A;  2GAH B;  3LZX A;  3AEB A;  5IQ1 A;  3UKK A;  3M13 A;  5BRT A;  3DJJ A;  5J60 A;  2GH5 A;  3AEA A;  3DH9 A;  3G5Q A;  1TYT A;  1NEN A;  1PHH A;  5U1O A;  3CND A;  5JCN A;  2RAB A;  3I6D A;  3ICT A;  4H2R A;  4OPL A;  4WCT A;  5CQF A;  2C3D A;  1GEU A;  5GSN A;  2R0C A;  3GD4 A;  2A87 A;  1FOH A;  2I0Z A;  3EAN A;  3KVE A;  3URH A;  2BCG G;  2AAQ A;  1KNR A;  3CGE A;  1B4V A;  4DNA A;  2E5V A;  4BK2 A;  4YSY A;  3GYI A;  1Z6L A;  2X50 A;  1PBB A;  2YLW A;  4U2L A;  4USR A;  4EQS A;  2X3N A;  3G5R A;  2BC1 A;  3B6D A;  3K7Q X;  4X9N A;  2R9Z A;  1LTX R;  2R4E A;  3NT6 A;  3NK2 X;  3CNP A;  5KRQ A;  1ONF A;  4OPI A;  2GMH A;  1NHP A;  1PJ5 A;  5JCI A;  2V60 A;  4ZCD A;  3HZL A;  2VVL G;  4UP3 A;  4CNK A;  5C3J A;  4WX1 A;  3CNS A;  4B63 A;  5HYM A;  3IWA A;  4H4W A;  4YSZ A;  3AEG A;  4B67 A;  3V3O A;  1YY5 A;  1N4V A;  3GRT A;  4H4V A;  1SEZ A;  2YLX A;  3H8L A;  4X9M A;  1XPQ A;  4CY6 A;  4C77 A;  3PS9 A;  4A6N B;  3BHK A;  1S2Q A;  3UKF A;  3BNM A;  1E7P A;  1ELI A;  4RSL A;  4Z26 A;  1NHR A;  3SM8 A;  4AP1 A;  2JBV A;  4AOX A;  3NYF A;  4H4U A;  4NEW A;  2WP6 A;  1NPX A;  3GSI A;  4U8L A;  3AE2 A;  2BAC A;  1DNC A;  1N1P A;  1K0L A;  3ABV A;  3WE0 A;  4H4T A;  3QVR A;  1XDI A;  2Q0L A;  5HXI A;  5JCM A;  1GES A;  2C72 A;  2CUL A;  1VG9 A;  2B9W A;  2WQY A;  4H4X A;  5FS7 A;  2C75 A;  4P9S A;  1D7Y A;  2OAL A;  4J33 A;  1B5Q A;  4Y4N A;  3II4 A;  3Q6J A;  1W4X A;  3NKS A;  1DXL A;  2XCG A;  1K4Q A;  4H50 A;  1OJC A;  4LA1 A;  4YKF A;  2YVG A;  4YSX A;  1F8W A;  1E39 A;  1JNR A;  4E0V A;  1LQU A;  3SFE A;  5M10 A;  1F6M A;  4JNA A;  2A8X A;  1M6I A;  4K5R A;  3KU9 A;  3GYJ A;  3QJ4 A;  2X8H A;  4NTC A;  2GR3 A;  4YT0 A;  4GF7 A;  3VR9 A;  3AE6 A;  3LJP A;  4Y4M A;  3UP5 A;  1QLB A;  2CVJ A;  5FS6 A;  3K7T A;  1JNZ A;  2C65 A;  2V5Z A;  5JCL A;  2BCP A;  3P4Q A;  1LPF A;  4DSH A;  2WU5 A;  1DOC A;  3P9U A;  1H81 A;  2UZZ A;  4A7A A;  1ZY8 A;  3RP8 A;  1E1N A;  1GRT A;  3AE7 A;  3DJD A;  3GWF A;  3IHM A;  1ZX9 A;  2IVD A;  2CFY A;  3GRS A;  1GET A;  3UKH A;  2R46 A;  3DK4 A;  4NZH A;  3GD3 A;  1PN0 A;  4JN9 A;  2E4G A;  1FEA A;  4OCG A;  4LII A;  2GVC A;  2YG6 A;  1EL9 A;  3C96 A;  4GDP A;  4BJZ A;  1E6E A;  2H88 A;  4REK A;  4JY3 A;  3AEF A;  1JEH A;  4H2N A;  3UOX A;  1IUX A;  1Y56 A;  2Q6U A;  5CKU A;  1D5T A;  1E1M A;  4FK1 A;  3RP7 A;  2F5Z A;  2ARD A;  4Z25 A;  2R0P A;  3F8D A;  3FIM B;  2Q7V A;  4AOS A;  4BJY A;  1Q9I A;  5BVA A;  2C64 A;  2GB0 A;  1YKJ A;  4J2W A;  2Q0K A;  4A9W A;  2WDR A;  4H4Y A;  2NVK X;  1PBE A;  3G5S A;  2BXR A;  5DBJ A;  4A5L A;  4BK1 A;  2GR2 A;  3RED A;  2JB1 A;  2ACZ A;  2VQB A;  4X4J A;  5LV9 A;  3DA1 A;  2XVF A;  2C7G A;  2YLT A;  4GCM A;  2O9Z A;  4APN A;  4YTP A;  4ICY A;  4B65 A;  3BI2 A;  1PXA A;  1H82 A;  2A89 A;  3V3N A;  3AB1 A;  5EOW A;  2IVE A;  1PXC A;  4U2T A;  4YTN A;  1GRB A;  1GRG A;  1K0I A;  3UKQ A;  2XDO A;  2XLU A;  1ZOV A;  5EB5 A;  2ZZC A;  3GMB A;  4M52 A;  1IUV A;  3F8R A;  3BNU A;  1PBF A;  1GRF A;  4C5O A;  2WU2 A;  1D4C A;  4IA6 A;  2WEU A;  4USQ A;  3PO7 A;  2WP5 A;  2GR0 A;  3AE1 A;  4A65 A;  4ZN0 A;  1BF3 A;  4YSH A;  2DKH A;  2X99 A;  2OA1 A;  2VVM A;  3UKA A;  2E1M A;  3RNM A;  3RHA A;  1BZL A;  4YWO A;  3GDN A;  4GDE A;  4N9X A;  4CCQ A;  2XFN A;  1NG3 A;  4D04 A;  2BYB A;  1ZMC A;  4IVM B;  1D7L A;  4NEV A;  1QJD A;  1FEB A;  2YG4 A;  1EBD A;  5KWF A;  1KF6 A;  3FBS A;  2YR4 A;  4U8O A;  3NH3 X;  3VRB A;  1F8S A;  1JRZ A;  1NEK A;  1LJ1 A;  2B76 A;  4C74 A;  2JAE A;  3NG7 X;  1O5W A;  3AEE A;  2YLS A;  1OJT A;  3ATR A;  1Q1W A;  2X8C A;  4JDR A;  2WDQ A;  3S5W A;  2YR5 A;  4Z43 A;  2GQW A;  3GDP A;  1LV0 A;  4H4R A;  2Y6Q A;  3GMC A;  3NYE A;  3UTE A;  1JOA A;  2YQU A;  4OPG A;  4OPC A;  2AQJ A;  3AEC A;  1L9D A;  1DOD A;  3ICR A;  1B37 A;  2TMD A;  2XLS A;  2ZZ0 A;  1GAL A;  2RGO A;  4UDR A;  1GSN A;  3CGC A;  5FS9 A;  4XWR A;  4CNJ A;  1BGN A;  3UOY A;  3LXD A;  1S3B A;  2Z5X A;  5HY5 A;  1P2H A;  1YQ3 A;  4EMJ A;  2PHH A;  2R4J A;  2YM1 A;  4K2X A;  3BI4 A;  1H84 A;  3UKP A;  2XVE A;  1GOS A;  2XLR A;  4U8M A;  3NN6 X;  4XWZ A;  1XHC A;  3ATQ A;  3F8P A;  3LOV A;  3VR8 A;  3Q9T A;  1X31 B;  2Z5Y A;  1FL2 A;  2XFU A;  4B64 A;  1GRA A;  5KOW A;  1Y0P A;  3SGL A;  1JRY A;  2ZBW A;  2BS2 A;  2XVI A;  3CPJ G;  1GXF A;  2YVF A;  1PBC A;  3FG2 P;  2OAM A;  3CTY A;  4C3X A;  2EQ8 A;  2JK6 A;  1NHQ A;  3UCL A;  2GQF A;  1RSG A;  5M0Z A;  2WP9 A;  1O95 A;  4OPD A;  5C2T A;  1KSS A;  2H89 A;  4CRT A;  1TYP A;  3AYI A;  2WPC A;  3UOZ A;  1O94 A;  4O5Q A;  3S61 A;  3CGB A;  2R45 A;  1LVL A;  2YAU A;  1GRE A;  2EQ9 A;  2PYX A;  1KFY A;  4Y4L A;  3AD7 B;  3FMW A;  3UOV A;  1CJC A;  2W0H A;  2X8G A;  2RGH A;  1GT8 A;  4NTE A;  5BUK A;  4CBQ A;  4EIQ A;  1RYI A;  3R9U A;  4D03 A;  1CC6 A;  1DJQ A;  1RP0 A;  2YG3 A;  4JY2 A;  2V61 A;  3AXB A;  3EAO A;  2EQ6 A;  3H4K A;  4K7Z A;  1TRB A;  2VRL A;  1LQT A;  2WHD A;  2RGJ A;  2GRT A;  5U25 A;  1V59 A;  4EQR A;  2J3N A;  3KD9 A;  1E1K A;  4I58 A;  4B1B A;  5U63 A;  1E1L A;  3DK9 A;  1DOB A;  1NAA A;  1TDN A;  2FJA A;  3NK0 X;  3KA7 A;  3LZW A;  4AP3 A;  3QFB A;  1PJ6 A;  2YG5 A;  2BXS A;  3CGD A; 
#chains in the Genus database with same CATH topology
 3IK4 A;  4LU6 A;  3L8K A;  2JKC A;  3OTR A;  3NVY B;  4H4Z A;  4A79 A;  3TTE A;  3AE5 A;  1H86 A;  1NDA A;  4TLZ A;  3CB3 A;  1XAN A;  4PAA A;  4KPR A;  3VQR A;  3NN0 X;  1N61 C;  2YLR A;  4B69 A;  2WOW A;  4X2P A;  1N4W A;  3JSK A;  1BGJ A;  2AR8 A;  1VDC A;  3CIR A;  2XLT A;  3IJI A;  1KN0 A;  4EMW A;  3DJG X;  1HYU A;  2FYM A;  3UXK A;  3EF6 A;  3SN1 A;  2WES A;  3PWI A;  1TDO A;  2XYO A;  3D46 A;  2I5Q A;  3VRA A;  2AL2 A;  2QDD A;  4IHC A;  4A6G A;  1PS9 A;  1ZMD A;  3AED A;  3CPI G;  2VQ7 A;  2E3T A;  1MUC A;  2QJJ A;  4U8K A;  4EQX A;  3TJI A;  2GV8 A;  1ZK7 A;  4H4Q A;  3RIT A;  1MDL A;  1B8S A;  2E5A A;  1NHS A;  1EC8 A;  3ZDN A;  1PDY A;  3FPZ A;  3H8I A;  2GEW A;  4U8I A;  1ZKQ A;  1D4E A;  3DFY A;  3DGH A;  4H7U A;  1IUW A;  3UTG A;  3COX A;  2C66 A;  2B9Y A;  5IQ4 A;  3I3L A;  3HYW A;  3D8X A;  3IC9 A;  3L1R A;  4B68 A;  2NPX A;  3NTA A;  3DGB A;  4Z24 A;  2V3B A;  1AOG A;  1VDV A;  1F3P A;  3DJE A;  1OJA A;  3OW1 A;  3DK8 A;  2OKT A;  4J56 A;  3ICS A;  2XH0 A;  4ZA0 A;  3IHG A;  1IUS A;  4EM4 A;  2C3C A;  1F8R A;  1TDE A;  2WBA A;  5KVI A;  3HRD C;  3K30 A;  1OEP A;  7ENL A;  4J57 A;  4IVO B;  4BV6 A;  3T9P A;  1FIQ B;  3T37 A;  2PU1 A;  1L9C A;  1TDF A;  2QCU A;  3AD9 B;  4I59 A;  2GAH B;  3T6C A;  5BOF A;  5BRT A;  3DH9 A;  2P3Z A;  3ICT A;  4WCT A;  5GSN A;  3ZLG A;  2GGE A;  1KD0 A;  1SJD A;  1KNR A;  2E5V A;  2X50 A;  4FP1 A;  1FFV C;  3G5R A;  2BC1 A;  3B6D A;  2R9Z A;  3NT6 A;  5KRQ A;  1N5W C;  2VVL G;  4Z17 A;  4WX1 A;  5HYM A;  4H4W A;  3PFR A;  3GRT A;  2YLX A;  3BHK A;  3UKF A;  4IP5 A;  2WP6 A;  4TVY A;  1DNC A;  4Z1Y A;  3QVR A;  1XDI A;  5HXI A;  2CUL A;  3R0K A;  3DES A;  1B5Q A;  3NKS A;  1DXL A;  2XCG A;  1OJC A;  2YVG A;  1JNR A;  5M10 A;  4JNA A;  3DER A;  1M6I A;  3GYJ A;  2ZC8 A;  3P4Q A;  1LPF A;  1DOC A;  1H81 A;  3RP8 A;  3GWF A;  3SSZ A;  2CFY A;  3DK4 A;  4NZH A;  3SN4 A;  1N5X A;  3ZLH A;  1E6E A;  4REK A;  1JEH A;  3GO2 A;  1Y56 A;  4Z25 A;  5CKU A;  5KOW A;  1E1M A;  4FK1 A;  3FIM B;  4BJY A;  2C64 A;  2BXR A;  5DBJ A;  3NFU A;  2ACZ A;  3AN1 A;  2XVF A;  2YLT A;  3L5O A;  4APN A;  4YTP A;  4ICY A;  4MKS A;  2A89 A;  5EOW A;  1PXC A;  4U2T A;  1GRG A;  3RR1 A;  4G74 A;  1K0I A;  3UKQ A;  1XPY A;  1ZOV A;  5EB5 A;  3DG7 A;  2QJN A;  1IUV A;  3TOY A;  3F8R A;  3BNU A;  4J3Z A;  3RGT A;  2VVM A;  4YWO A;  3GDN A;  4IVM B;  1FEB A;  1ZXI C;  2B76 A;  2JAE A;  1MDR A;  5BOE A;  3AEE A;  4H1Z A;  1RVK A;  1OJT A;  3ATR A;  2YR5 A;  4Z43 A;  3VCC A;  2Y6Q A;  3UTE A;  1JOA A;  2YQU A;  4E4F A;  4OPG A;  4OPC A;  3MWC A;  5FJU A;  1B37 A;  2XLS A;  4IL2 A;  4KT2 A;  2PTW A;  1GAL A;  1YEY A;  4UDR A;  3PG6 A;  5FS9 A;  4XWR A;  4CNJ A;  3LXD A;  3DIP A;  3UKP A;  1H84 A;  2XLR A;  1XHC A;  3VC5 A;  3F8P A;  2Z5Y A;  2XFU A;  4DYE A;  1ONE A;  1GXF A;  3UOZ A;  1O94 A;  2EQ9 A;  4G6H A;  2PCE A;  2W0H A;  2RGH A;  2OQH A;  4EIQ A;  4JN7 A;  1RYI A;  1CC6 A;  1DJQ A;  4JY2 A;  2V61 A;  3I6E A;  3H4K A;  2WHD A;  3V4B A;  4I58 A;  1TDN A;  3ES8 A;  3K1G A;  3KA7 A;  3LZW A;  4KWS A;  3CGD A;  4JNQ A;  1S3E A;  1XS2 A;  4G9K A;  2V6O A;  4K1W A;  3NLC A;  1V97 A;  4GIS A;  5IPY A;  2BC0 A;  3M0O A;  1Q1R A;  3T8Q A;  4H83 A;  1IJH A;  2C73 A;  4HB9 A;  3ZVI A;  4J34 A;  3LAD A;  2BAB A;  3UJF A;  5HHF A;  1OJD A;  3NTD A;  2WPE A;  3AYL A;  2VZ2 A;  4YTM A;  1CJ4 A;  3VC6 A;  3E1T A;  3BI5 A;  4MJW A;  1REO A;  3TQP A;  2C70 A;  1KCZ A;  2QA2 A;  3EKG A;  3LB8 A;  3SQS A;  3FCP A;  4J31 A;  4O5U A;  3RP6 A;  2BK3 A;  3B3R A;  3ITJ A;  3ALM A;  4YXD A;  2DW6 A;  2GF3 A;  1TZZ A;  3CK5 A;  4FK1 C;  3R1Z A;  4UDP A;  2BS4 A;  1YQ4 A;  2WDV A;  3K7M X;  4AT2 A;  5BUL A;  4XXG A;  4GFI A;  2VRM A;  2YG7 A;  4G6G A;  4K2S A;  3VRD B;  3MUC A;  2W3R A;  3QPE A;  4GRT A;  3AE9 A;  2B7S A;  1E9I A;  1SJB A;  1GPE A;  3KLJ A;  3NHO X;  3V3W A;  1EL8 A;  4DHG A;  4U8J A;  2OQY A;  4BUR A;  3AE3 A;  3UJS A;  3UJR A;  1GND A;  3QSM A;  1CC4 A;  4FX9 A;  2PP3 A;  3BJS A;  3S5S A;  2Y6R A;  3AE4 A;  4EIP A;  3OC4 A;  2CDU A;  2FJE A;  4H19 A;  2WS3 A;  3ZVH A;  4FI4 A;  4Z2T A;  1SB3 B;  1GTE A;  5FMH A;  1D4D A;  2XFQ A;  3ISH A;  1CHU A;  2YLZ A;  1VRQ B;  3NIX A;  2XH2 A;  4II3 A;  4ECH A;  2OLA A;  4OVI A;  2C76 A;  1F9C A;  3MSY A;  2XLP A;  4RG3 A;  2V3A A;  2B7R A;  2JB2 A;  3NVV B;  3AWI A;  3V76 A;  3RCY A;  2R0G A;  3U9I A;  3H7V A;  3C4A A;  3OZ2 A;  2XVH A;  3THU A;  1CJ2 A;  2P88 A;  3R0U A;  2JB3 A;  3AEB A;  4KPL A;  3OPS A;  2XH7 A;  1H2I A;  5J60 A;  1TYT A;  5JCN A;  2RAB A;  3CT2 A;  5CQF A;  2A87 A;  3KVE A;  1B4V A;  4YSY A;  4G8T A;  1Z6L A;  1PBB A;  3I4K A;  1LTX R;  2R4E A;  2PA6 A;  2BRY A;  3NK2 X;  1NHP A;  3MQT A;  2AL1 A;  1PJ5 A;  3DFH A;  2V60 A;  3SZ0 A;  2AL2 B;  3HZL A;  1SJA A;  1S7M A;  4UP3 A;  2GSH A;  2C4C A;  3V3O A;  2CHR A;  4H4V A;  3H8L A;  1XPQ A;  4C77 A;  3NRZ B;  1S2Q A;  2DW7 A;  2OZ3 A;  3DG6 A;  1ELI A;  4RSL A;  4Z26 A;  4AP1 A;  4NEW A;  3GSI A;  1N1P A;  4H4T A;  3NS1 B;  4GYP A;  2GGH A;  5JCM A;  1GES A;  2WQY A;  2PMQ A;  4H4X A;  2C75 A;  1D7Y A;  4J33 A;  3N6J A;  1W4X A;  3V5F A;  4E0V A;  2A8X A;  3UJ2 A;  1ECQ A;  3OZM A;  3KU9 A;  4NTC A;  3QJ4 A;  2GR3 A;  2QQ6 A;  4DN1 A;  3AE6 A;  3KUM A;  3B97 A;  5FS6 A;  2C65 A;  4IZG A;  3NZG A;  2WU5 A;  4A7A A;  2UZZ A;  1E1N A;  3IHM A;  1ZX9 A;  2R46 A;  1PN0 A;  4OCG A;  1VQZ A;  1EL9 A;  3SY4 A;  3GD6 A;  3AEF A;  2Q6U A;  2Q7V A;  2GB0 A;  4J2W A;  2Q0K A;  4H4Y A;  4A5L A;  1BQG A;  2GR2 A;  3PK7 A;  4NWZ A;  4A35 A;  2PGE A;  4GCM A;  3V3N A;  3SZC A;  1N60 C;  2IVE A;  5J04 A;  2XDO A;  4HYR A;  2ZZC A;  3GYX A;  2WEU A;  3SZW A;  2WP5 A;  2GR0 A;  1BF3 A;  3UKA A;  2GDQ A;  1BZL A;  4CCQ A;  3OP2 A;  3HYV A;  2BYB A;  5FJO A;  1D7L A;  4NEV A;  1EBD A;  4U8O A;  3VRB A;  1F8S A;  1NEK A;  4GGH A;  1TE6 A;  3ETR B;  4M0X A;  2OO6 A;  2GQW A;  3GDP A;  2AQJ A;  1L9D A;  1DOD A;  3ICR A;  3CYJ A;  5G5H B;  3UOY A;  3R10 A;  1P2H A;  4GIR A;  2PHH A;  4YWS A;  2R4J A;  2YM1 A;  3BI4 A;  5FJT A;  3MZN A;  4B64 A;  1GRA A;  1Y0P A;  2OFJ A;  2XVI A;  3CPJ G;  2YVF A;  3CTY A;  2JK6 A;  2GQF A;  2OZ8 A;  1O95 A;  2H89 A;  3AYI A;  2GGI A;  1LVL A;  2YAU A;  1KFY A;  1W6T A;  3FMW A;  4NTE A;  3T2Y A;  4CBQ A;  5KMR A;  1MRA A;  4D03 A;  5ENL A;  1RP0 A;  4K7Z A;  1TRB A;  1V59 A;  4E5T A;  3QKE A;  2J3N A;  2GL5 A;  4HN8 A;  3KD9 A;  3DK9 A;  1DOB A;  2XH4 A;  2BXS A;  4M6U A;  5GRT A;  4K8D A;  3T0K A;  1MO9 A;  2POZ A;  2PPG A;  1Y56 B;  1GRH A;  6ENL A;  2FJD A;  3P4P A;  4U8N A;  4UDQ A;  4H4P A;  3N6H A;  3STP A;  4H4S A;  3NRN A;  1P2E A;  4A3R A;  1PJ7 A;  2YM2 A;  3FVD A;  2YWL A;  4DWD A;  2BA9 A;  3CXB A;  1KKR A;  3R25 A;  4GYP C;  3P1W A;  3ALL A;  3C4N A;  2XFP A;  3TCS A;  4ADW A;  2P8B A;  2PU0 A;  4J36 A;  1H7X A;  1RM6 B;  3ZYX A;  4FDC B;  3OZY A;  3AMZ A;  4HNL A;  1NG4 A;  2XFO A;  1X2H A;  4U8P A;  1DJN A;  3EPT A;  4HA6 A;  3QVP A;  4ZOH B;  3MY9 A;  1CF3 A;  3DME A;  1QO8 A;  1BKW A;  3DG3 A;  2B9X A;  2WPF A;  1M64 A;  3QFA A;  4IV9 A;  5EBK A;  1DOE A;  4EQW A;  4A6N A;  3UCC A;  4KX6 A;  3NNE A;  1CJ3 A;  3UKL A;  2WOV A;  2P8C A;  3O0H A;  3CNJ A;  1DTN A;  3P4R A;  3PVC A;  2VOU A;  2WOI A;  3UTH A;  4PAB A;  5EB4 A;  4NTD A;  2PTX A;  2ZZB A;  3KPF A;  1GER A;  4K5S A;  3P4S A;  4RG4 A;  4U2S A;  2RDX A;  2MUC A;  4YKG A;  1CC2 A;  4CCR A;  3A7R A;  1JPD X;  1CBO A;  1COY A;  1KSU A;  1PBD A;  1WYG A;  3DGZ A;  1ZOY A;  3GWD A;  2DKI A;  3RRA A;  2BK4 A;  2YR6 A;  4C3Y A;  3NGC X;  1L0V A;  2HQM A;  3TWB A;  4IA5 A;  3UP4 A;  3QTP A;  4IP4 A;  5KVH A;  1H83 A;  3BHF A;  5TR3 A;  3SFD A;  2XVJ A;  2PGW A;  1EC9 A;  3SN0 A;  4ZCC A;  1BWC A;  3MKC A;  1VG0 A;  3FV9 A;  3P93 A;  1IUT A;  5IQ1 A;  3M13 A;  3G5Q A;  3AEA A;  3CND A;  4H2R A;  2HXT A;  2R0C A;  3GD4 A;  5KMQ A;  4ROP A;  3URH A;  2BCG G;  3CGE A;  4DNA A;  4BK2 A;  3GYI A;  3T2Z A;  1EBH A;  3H8A A;  4USR A;  4X9N A;  2X3N A;  3R07 C;  3FXG A;  4OPI A;  2GMH A;  1JPM A;  3FJ4 A;  5JCI A;  4ZCD A;  3NXL A;  3N4F A;  2AKZ A;  3ZLF A;  3IWA A;  4YSZ A;  2W3S A;  1SEZ A;  4X9M A;  2OX4 A;  3PS9 A;  4HCH A;  2XGZ A;  3BNM A;  1NHR A;  2JBV A;  3NYF A;  4H4U A;  1NPX A;  4NNJ A;  2Q0L A;  3HYX A;  1VG9 A;  5FS7 A;  2OAL A;  3HW2 A;  4Y4N A;  3II4 A;  1MNS A;  1K4Q A;  4YKF A;  3SFE A;  1F6M A;  4K5R A;  2X8H A;  3D47 A;  1N63 C;  4GF7 A;  3LJP A;  4Y4M A;  3UP5 A;  3T4W A;  3VA8 A;  2BCP A;  4DSH A;  1WUF A;  3ZVH B;  1ZY8 A;  4E8G A;  3AE7 A;  3GRS A;  3UKH A;  3AM9 A;  3GD3 A;  2E4G A;  1FEA A;  3GY1 A;  2GVC A;  2YG6 A;  2P0I A;  3UJE A;  2H88 A;  2OZT A;  2PTY A;  1IUX A;  1FHV A;  5BUK A;  1D5T A;  2F5Z A;  2W55 A;  5KNL A;  1YKJ A;  3DEQ A;  2WDR A;  3IJQ A;  4GGB A;  2NVK X;  3G5S A;  4BK1 A;  4X4J A;  3DA1 A;  2C7G A;  3P0W A;  4B65 A;  4HCD A;  1PXA A;  3AB1 A;  4YTN A;  2OG9 A;  1GRB A;  4JHM A;  2W54 A;  2XLU A;  3GMB A;  1NU5 A;  1GRF A;  4C5O A;  2WU2 A;  3PO7 A;  4A65 A;  4ZN0 A;  5JRB A;  2E1M A;  3RNM A;  3RHA A;  4N9X A;  3PWG A;  3V5C A;  2XFN A;  4D04 A;  3TWA A;  1ZMC A;  5KWF A;  4EWJ A;  1JRZ A;  3SZF A;  1O5W A;  2HNE A;  2YLS A;  2X8C A;  4JDR A;  3S5W A;  2AKM A;  3GMC A;  4H4R A;  3NYE A;  3EEZ A;  3GC2 A;  4ENL A;  1PDZ A;  3QLD A;  2TMD A;  2ZZ0 A;  2RGO A;  1GSN A;  4ZCW A;  1BGN A;  1S3B A;  2Z5X A;  1YQ3 A;  3CMM A;  4U8M A;  1N62 C;  3NN6 X;  4XWZ A;  3LOV A;  3Q9T A;  1X31 B;  1FL2 A;  3SGL A;  1STZ A;  4TVW A;  2POD A;  2BS2 A;  1PBC A;  3FG2 P;  2OAM A;  1NHQ A;  3VFC A;  3UCL A;  1RSG A;  1EC7 A;  2WP9 A;  5C2T A;  1KSS A;  4CRT A;  1TYP A;  2WPC A;  3S61 A;  3CGB A;  1GRE A;  2PYX A;  4JN8 A;  3AD7 B;  2OVL A;  1JRO A;  3NO1 A;  2YG3 A;  3EAO A;  3BSM A;  2EQ6 A;  2VRL A;  2RGJ A;  4MGG A;  5U63 A;  1E1L A;  1NAA A;  5FJP A;  1SJC A;  1PJ6 A;  2PS2 A;  2YG5 A;  1KNP A;  1PDH A;  2MNR A;  2EQ7 A;  1ZP0 A;  5FS8 A;  4II2 A;  4A99 A;  1CL0 A;  3JZU A;  4GUV A;  4GR1 A;  5J7X A;  5JCK A;  3ALJ A;  2IID A;  3AE8 A;  4CY8 A;  2PTZ A;  3RO6 A;  1OJ9 A;  4TM0 A;  2HXU A;  4F4R A;  1H7W A;  3AD8 B;  4B66 A;  3NK1 X;  1JRP A;  2APG A;  4OPU A;  1WUE A;  3T31 A;  2QAE A;  4E6M A;  1L9E A;  5KXJ A;  2VVL A;  3CPH G;  3QSE A;  4DSG A;  4H2Q A;  2OLN A;  4HCL A;  1MXT A;  3IF9 A;  4EM3 A;  2QGY A;  1ZDL A;  3AYJ A;  4EMI A;  4OPT A;  3BOX A;  1IYX A;  2WET A;  3JVA A;  3SR6 B;  2BRA A;  4Z2R A;  3QSS A;  2TPR A;  2OLO A;  2NQL A;  4H2P A;  3H12 A;  3B9J B;  5G5G B;  1FCD A;  4TLX A;  2C67 A;  4K22 A;  5KMP A;  3T14 A;  5KOX A;  1FEC A;  4TM4 A;  1H6V A;  3NYC A;  1EL5 A;  1S2Y A;  1YQZ A;  3IJL A;  1FO4 A;  2YVJ A;  3UCD A;  2ZAD A;  4BK3 A;  3HPF A;  3SXI A;  1NEL A;  2QJM A;  3SQP A;  2GMJ A;  4TM1 A;  1X2G A;  3EUB 3;  1UKV G;  3CN8 A;  5ER0 A;  3SYI A;  1N4U A;  3ENL A;  2BK5 A;  3CNT A;  4DX3 A;  4HPN A;  4Z44 A;  3ADA B;  3UTF A;  2GGG A;  2FJB A;  2GR1 A;  4Z2U A;  1TDK A;  1VQW A;  1JU2 A;  3D1C A;  3QN3 A;  1EL7 A;  4JQ9 A;  2BS3 A;  1PXB A;  4G73 A;  1IUU A;  4AT0 A;  1K0J A;  1JRX A;  1KKO A;  4DGK A;  2ONE A;  3KKJ A;  1GTH A;  1KDG A;  4GAP A;  4E4U A;  2FBW A;  4GAV A;  3A7A A;  1MOK A;  2QA1 A;  1GV4 A;  1R6W A;  4TM3 A;  3TJ4 A;  2GAG B;  3M12 A;  5L46 A;  3LZX A;  3NVZ B;  3UKK A;  1TKK A;  3DJJ A;  2GH5 A;  3I6D A;  1NEN A;  1PHH A;  5U1O A;  4OPL A;  3T2K A;  4DXK A;  2C3D A;  1GEU A;  4H2H A;  1FOH A;  2I0Z A;  3EAN A;  2AAQ A;  2PP1 A;  3S47 A;  2YLW A;  4U2L A;  4K8G A;  4EQS A;  3UGV A;  3K7Q X;  3NVW B;  3CNP A;  1ONF A;  3I6T A;  3JW7 A;  5EU9 A;  4CNK A;  5C3J A;  4KEM A;  3CNS A;  4B63 A;  3AEG A;  4B67 A;  1YY5 A;  1N4V A;  4CY6 A;  3DDM A;  4A6N B;  3ES7 A;  3A7U A;  1E7P A;  4HNC A;  3SM8 A;  3D9X A;  4AOX A;  4U8L A;  3AE2 A;  2BAC A;  1K0L A;  3ABV A;  3WE0 A;  1P48 A;  4J1O A;  4IT1 A;  2C72 A;  2B9W A;  4P9S A;  3Q6J A;  4H50 A;  4LA1 A;  4YSX A;  1F8W A;  1T3Q C;  1E39 A;  3P3B A;  1LQU A;  4YT0 A;  2PP0 A;  3VR9 A;  1QLB A;  2CVJ A;  3K7T A;  1JNZ A;  2PSN A;  5KMS A;  2V5Z A;  5JCL A;  3P9U A;  4MMW A;  1GRT A;  3DJD A;  3H70 A;  2IVD A;  1JCT A;  1GET A;  2XSX A;  4JN9 A;  4LII A;  3FYY A;  3C96 A;  4BJZ A;  4GDP A;  4JY3 A;  4H2N A;  3UOX A;  3RP7 A;  2ARD A;  2R0P A;  3F8D A;  4AOS A;  2QDE A;  1Q9I A;  5BVA A;  4A9W A;  2HZG A;  1PBE A;  3RED A;  2JB1 A;  2VQB A;  5LV9 A;  4IL0 A;  2O9Z A;  1L8P A;  3U4F A;  1JDF A;  1EBG A;  2FKP A;  3BI2 A;  1H82 A;  4GME A;  4M52 A;  1PBF A;  3Q4D A;  1D4C A;  4IA6 A;  4USQ A;  3AE1 A;  3TW9 A;  4YSH A;  2DKH A;  2X99 A;  2OA1 A;  4GDE A;  1NG3 A;  1QJD A;  2YG4 A;  3VDG A;  1KF6 A;  3FBS A;  2YR4 A;  3NH3 X;  4C74 A;  1LJ1 A;  3NG7 X;  3SX6 A;  1FHU A;  1Q1W A;  2WDQ A;  1LV0 A;  3N4E A;  3AEC A;  1FFU C;  3CGC A;  5HY5 A;  5FJR A;  4EMJ A;  4K2X A;  2XVE A;  1GOS A;  3R11 A;  3ATQ A;  3Q45 A;  1ELS A;  2OPJ A;  3VR8 A;  1JRY A;  2ZBW A;  3CXO A;  4C3X A;  2EQ8 A;  4G7F A;  5M0Z A;  4OPD A;  3SJN A;  4O5Q A;  2R45 A;  4Y4L A;  3UOV A;  1CJC A;  2X8G A;  3KPK A;  3SBF A;  1GT8 A;  2GGJ A;  3R9U A;  3UXL A;  3AXB A;  1R0M A;  1LQT A;  2GRT A;  5U25 A;  4EQR A;  1BKH A;  5IDZ A;  1E1K A;  4B1B A;  2QVH A;  2O56 A;  3NK0 X;  2FJA A;  4AP3 A;  3QFB A;  3VCN A;  3CAW A;  1P43 A; 
#chains in the Genus database with same CATH homology
 5GRT A;  1KNP A;  4JNQ A;  4K8D A;  4LU6 A;  3L8K A;  2JKC A;  1S3E A;  3T0K A;  1PDH A;  4H4Z A;  4A79 A;  4G9K A;  2EQ7 A;  1MO9 A;  1Y56 B;  3AE5 A;  2V6O A;  1ZP0 A;  1GRH A;  1H86 A;  1NDA A;  2FJD A;  3P4P A;  5FS8 A;  4TLZ A;  4II2 A;  4U8N A;  4UDQ A;  4A99 A;  3NLC A;  4H4P A;  1CL0 A;  5IPY A;  1XAN A;  4H4S A;  4GUV A;  4GR1 A;  2BC0 A;  5J7X A;  5JCK A;  3ALJ A;  4PAA A;  2IID A;  3AE8 A;  3M0O A;  1Q1R A;  3NRN A;  1P2E A;  4KPR A;  4CY8 A;  1IJH A;  2C73 A;  1PJ7 A;  4TM0 A;  1OJ9 A;  2YM2 A;  4HB9 A;  2YWL A;  2BA9 A;  3VQR A;  4J34 A;  3NN0 X;  2YLR A;  1H7W A;  3P1W A;  3AD8 B;  3LAD A;  4B69 A;  2WOW A;  3ALL A;  2BAB A;  3C4N A;  3NK1 X;  4B66 A;  2APG A;  2XFP A;  1OJD A;  1N4W A;  3NTD A;  4OPU A;  5HHF A;  3T31 A;  2WPE A;  2QAE A;  3AYL A;  3JSK A;  1BGJ A;  4ADW A;  1L9E A;  5KXJ A;  2AR8 A;  2VZ2 A;  4YTM A;  1CJ4 A;  1VDC A;  3CIR A;  4J36 A;  2VVL A;  3CPH G;  1H7X A;  2XLT A;  1KN0 A;  3QSE A;  4DSG A;  4EMW A;  4H2Q A;  3DJG X;  3ZYX A;  4FDC B;  2OLN A;  1HYU A;  1MXT A;  3BI5 A;  3E1T A;  4EM3 A;  1REO A;  3IF9 A;  4MJW A;  3EF6 A;  2WES A;  1NG4 A;  2XFO A;  1TDO A;  2XYO A;  1ZDL A;  3AYJ A;  4EMI A;  4OPT A;  4U8P A;  2C70 A;  2WET A;  3VRA A;  2QA2 A;  2BRA A;  1DJN A;  3EPT A;  4Z2R A;  3LB8 A;  4HA6 A;  3QVP A;  3QSS A;  1PS9 A;  1ZMD A;  1CF3 A;  3AED A;  1QO8 A;  3CPI G;  3DME A;  2TPR A;  1BKW A;  2OLO A;  2VQ7 A;  4J31 A;  2B9X A;  2WPF A;  1M64 A;  4H2P A;  3QFA A;  4O5U A;  3RP6 A;  2BK3 A;  3B3R A;  4IV9 A;  4U8K A;  4EQX A;  3ITJ A;  2GV8 A;  1ZK7 A;  4H4Q A;  3ALM A;  4YXD A;  1FCD A;  2GF3 A;  4TLX A;  5EBK A;  1DOE A;  4EQW A;  2C67 A;  1B8S A;  4A6N A;  1NHS A;  4K22 A;  5KMP A;  3T14 A;  5KOX A;  3ZDN A;  1FEC A;  4FK1 C;  4KX6 A;  3NNE A;  1CJ3 A;  3UKL A;  4TM4 A;  4UDP A;  2BS4 A;  2WOV A;  1YQ4 A;  2WDV A;  3K7M X;  1H6V A;  4AT2 A;  5BUL A;  3FPZ A;  3NYC A;  4XXG A;  2YG7 A;  2VRM A;  1EL5 A;  3H8I A;  1S2Y A;  1YQZ A;  3O0H A;  2GEW A;  4G6G A;  4U8I A;  1ZKQ A;  1D4E A;  3CNJ A;  3DGH A;  3VRD B;  4H7U A;  1IUW A;  3P4R A;  3PVC A;  4GRT A;  2VOU A;  2WOI A;  3AE9 A;  2B7S A;  3UTG A;  3COX A;  2C66 A;  3UTH A;  4PAB A;  2YVJ A;  5EB4 A;  2B9Y A;  1GPE A;  4NTD A;  3KLJ A;  5IQ4 A;  3I3L A;  3NHO X;  4BK3 A;  3HYW A;  2ZZB A;  3D8X A;  1EL8 A;  3KPF A;  3SXI A;  1GER A;  4K5S A;  4U8J A;  3IC9 A;  3SQP A;  4BUR A;  2GMJ A;  3L1R A;  3P4S A;  4RG4 A;  4B68 A;  2NPX A;  3AE3 A;  3NTA A;  4Z24 A;  4U2S A;  4TM1 A;  1GND A;  3QSM A;  4YKG A;  1CC4 A;  4FX9 A;  2V3B A;  1CC2 A;  2Y6R A;  3AE4 A;  4CCR A;  4EIP A;  1UKV G;  3OC4 A;  1AOG A;  3CN8 A;  1F3P A;  2CDU A;  3DJE A;  2FJE A;  5ER0 A;  1OJA A;  3SYI A;  1N4U A;  1CBO A;  2WS3 A;  1COY A;  1KSU A;  3DK8 A;  1PBD A;  2BK5 A;  3CNT A;  4Z2T A;  1GTE A;  4J56 A;  3DGZ A;  4Z44 A;  3ADA B;  3ICS A;  5FMH A;  3UTF A;  1ZOY A;  3GWD A;  3IHG A;  2DKI A;  1D4D A;  2FJB A;  1IUS A;  2GR1 A;  2BK4 A;  1TDK A;  4Z2U A;  2YR6 A;  1VQW A;  2XFQ A;  4C3Y A;  3NGC X;  3ISH A;  4EM4 A;  1L0V A;  1JU2 A;  3D1C A;  2HQM A;  2C3C A;  1F8R A;  1CHU A;  1EL7 A;  1TDE A;  4IA5 A;  3UP4 A;  2WBA A;  4JQ9 A;  2BS3 A;  2YLZ A;  1PXB A;  1VRQ B;  5KVH A;  5KVI A;  4G73 A;  3NIX A;  1H83 A;  1IUU A;  4AT0 A;  1K0J A;  1JRX A;  3BHF A;  4DGK A;  3K30 A;  5TR3 A;  3KKJ A;  3SFD A;  4J57 A;  1GTH A;  4IVO B;  1KDG A;  4II3 A;  4BV6 A;  4ECH A;  4OVI A;  2C76 A;  2XLP A;  4RG3 A;  4GAP A;  2XVJ A;  2V3A A;  2B7R A;  2JB2 A;  3AWI A;  3V76 A;  2R0G A;  2FBW A;  4GAV A;  3C4A A;  4ZCC A;  3OZ2 A;  2XVH A;  1BWC A;  3T37 A;  1MOK A;  1L9C A;  1VG0 A;  1CJ2 A;  2QA1 A;  1TDF A;  2QCU A;  1GV4 A;  3AD9 B;  4TM3 A;  4I59 A;  2JB3 A;  2GAG B;  3M12 A;  5L46 A;  1IUT A;  2GAH B;  3LZX A;  3AEB A;  5IQ1 A;  3UKK A;  3M13 A;  5BRT A;  3DJJ A;  1H2I A;  5J60 A;  2GH5 A;  3AEA A;  3DH9 A;  3G5Q A;  1TYT A;  1NEN A;  1PHH A;  5U1O A;  3CND A;  5JCN A;  2RAB A;  3I6D A;  3ICT A;  4H2R A;  4OPL A;  4WCT A;  5CQF A;  3T2K A;  2C3D A;  1GEU A;  5GSN A;  2R0C A;  3GD4 A;  2A87 A;  1FOH A;  2I0Z A;  5KMQ A;  3EAN A;  3KVE A;  3URH A;  2BCG G;  2AAQ A;  1KNR A;  3CGE A;  1B4V A;  4DNA A;  2E5V A;  4BK2 A;  4YSY A;  3GYI A;  1Z6L A;  2X50 A;  1PBB A;  2YLW A;  3T2Z A;  4U2L A;  4USR A;  4EQS A;  2X3N A;  3G5R A;  2BC1 A;  3B6D A;  3K7Q X;  4X9N A;  2R9Z A;  1LTX R;  2R4E A;  3NT6 A;  3NK2 X;  2BRY A;  3CNP A;  5KRQ A;  1ONF A;  4OPI A;  2GMH A;  1NHP A;  1PJ5 A;  5JCI A;  2V60 A;  4ZCD A;  3SZ0 A;  3HZL A;  2VVL G;  4UP3 A;  1S7M A;  4CNK A;  5C3J A;  4WX1 A;  3CNS A;  2C4C A;  4B63 A;  5HYM A;  3IWA A;  4H4W A;  4YSZ A;  3AEG A;  4B67 A;  3V3O A;  1YY5 A;  1N4V A;  3GRT A;  4H4V A;  1SEZ A;  2YLX A;  3H8L A;  4X9M A;  1XPQ A;  4CY6 A;  4C77 A;  3PS9 A;  4A6N B;  3BHK A;  1S2Q A;  3UKF A;  3BNM A;  1E7P A;  1ELI A;  4RSL A;  4Z26 A;  1NHR A;  3SM8 A;  4AP1 A;  2JBV A;  3D9X A;  4AOX A;  3NYF A;  4H4U A;  4NEW A;  2WP6 A;  1NPX A;  3GSI A;  4U8L A;  3AE2 A;  2BAC A;  1DNC A;  1N1P A;  1K0L A;  3ABV A;  3WE0 A;  4NNJ A;  4H4T A;  3QVR A;  1XDI A;  2Q0L A;  5HXI A;  3HYX A;  5JCM A;  1GES A;  2C72 A;  2CUL A;  1VG9 A;  2B9W A;  2WQY A;  4H4X A;  5FS7 A;  2C75 A;  4P9S A;  1D7Y A;  2OAL A;  4J33 A;  1B5Q A;  4Y4N A;  3II4 A;  3Q6J A;  1W4X A;  3NKS A;  1DXL A;  2XCG A;  1K4Q A;  4H50 A;  1OJC A;  4LA1 A;  4YKF A;  2YVG A;  4YSX A;  1F8W A;  1E39 A;  1JNR A;  4E0V A;  1LQU A;  3SFE A;  5M10 A;  1F6M A;  4JNA A;  2A8X A;  1M6I A;  4K5R A;  3KU9 A;  3GYJ A;  3QJ4 A;  2X8H A;  4NTC A;  2GR3 A;  4YT0 A;  4GF7 A;  3VR9 A;  3AE6 A;  3LJP A;  4Y4M A;  3UP5 A;  1QLB A;  2CVJ A;  5FS6 A;  3K7T A;  1JNZ A;  2C65 A;  5KMS A;  2V5Z A;  5JCL A;  2BCP A;  3P4Q A;  1LPF A;  4DSH A;  2WU5 A;  1DOC A;  3P9U A;  1H81 A;  2UZZ A;  4A7A A;  1ZY8 A;  3RP8 A;  1E1N A;  1GRT A;  3AE7 A;  3DJD A;  3GWF A;  3IHM A;  1ZX9 A;  2IVD A;  2CFY A;  3GRS A;  1GET A;  3UKH A;  2R46 A;  3DK4 A;  4NZH A;  3GD3 A;  1PN0 A;  4JN9 A;  2E4G A;  1FEA A;  4OCG A;  4LII A;  2GVC A;  2YG6 A;  1EL9 A;  3C96 A;  4GDP A;  4BJZ A;  1E6E A;  2H88 A;  3SY4 A;  4REK A;  4JY3 A;  3AEF A;  1JEH A;  4H2N A;  3UOX A;  1IUX A;  1Y56 A;  2Q6U A;  5CKU A;  1D5T A;  1E1M A;  4FK1 A;  3RP7 A;  2F5Z A;  2ARD A;  4Z25 A;  2R0P A;  3F8D A;  3FIM B;  2Q7V A;  4AOS A;  4BJY A;  1Q9I A;  5BVA A;  5KNL A;  2C64 A;  2GB0 A;  1YKJ A;  4J2W A;  2Q0K A;  4A9W A;  2WDR A;  4H4Y A;  2NVK X;  1PBE A;  3G5S A;  2BXR A;  5DBJ A;  4A5L A;  4BK1 A;  2GR2 A;  4NWZ A;  3RED A;  2JB1 A;  2ACZ A;  2VQB A;  4X4J A;  5LV9 A;  3DA1 A;  2XVF A;  2C7G A;  2YLT A;  4GCM A;  2O9Z A;  3L5O A;  4APN A;  4YTP A;  4ICY A;  4B65 A;  3BI2 A;  1PXA A;  1H82 A;  2A89 A;  3V3N A;  3SZC A;  3AB1 A;  5EOW A;  2IVE A;  1PXC A;  4U2T A;  4YTN A;  1GRB A;  1GRG A;  4G74 A;  1K0I A;  3UKQ A;  2XDO A;  2XLU A;  1ZOV A;  5EB5 A;  2ZZC A;  3GMB A;  4M52 A;  1IUV A;  3F8R A;  3BNU A;  1PBF A;  1GRF A;  4C5O A;  2WU2 A;  1D4C A;  3GYX A;  4IA6 A;  2WEU A;  4USQ A;  3PO7 A;  3SZW A;  2WP5 A;  2GR0 A;  3AE1 A;  4A65 A;  4ZN0 A;  5JRB A;  1BF3 A;  4YSH A;  2DKH A;  2X99 A;  2OA1 A;  2VVM A;  3UKA A;  2E1M A;  3RNM A;  3RHA A;  1BZL A;  4YWO A;  3GDN A;  4GDE A;  4N9X A;  4CCQ A;  2XFN A;  3HYV A;  1NG3 A;  4D04 A;  2BYB A;  1ZMC A;  4IVM B;  1D7L A;  4NEV A;  1QJD A;  1FEB A;  2YG4 A;  1EBD A;  5KWF A;  1KF6 A;  3FBS A;  2YR4 A;  4U8O A;  3NH3 X;  3VRB A;  1F8S A;  1JRZ A;  1NEK A;  1LJ1 A;  2B76 A;  4C74 A;  2JAE A;  3NG7 X;  3SZF A;  1O5W A;  3SX6 A;  3AEE A;  2YLS A;  1OJT A;  3ATR A;  1Q1W A;  2X8C A;  4JDR A;  2WDQ A;  3S5W A;  2YR5 A;  4Z43 A;  2GQW A;  3GDP A;  1LV0 A;  4H4R A;  2Y6Q A;  3GMC A;  3NYE A;  3UTE A;  1JOA A;  2YQU A;  4OPG A;  4OPC A;  2AQJ A;  3AEC A;  1L9D A;  1DOD A;  3ICR A;  1B37 A;  2TMD A;  2XLS A;  2ZZ0 A;  1GAL A;  2RGO A;  4UDR A;  1GSN A;  3CGC A;  3PG6 A;  5FS9 A;  4XWR A;  4CNJ A;  1BGN A;  3UOY A;  3LXD A;  1S3B A;  2Z5X A;  5HY5 A;  1P2H A;  1YQ3 A;  4EMJ A;  2PHH A;  2R4J A;  2YM1 A;  4K2X A;  3BI4 A;  1H84 A;  3UKP A;  3CMM A;  2XVE A;  1GOS A;  2XLR A;  4U8M A;  3NN6 X;  4XWZ A;  1XHC A;  3ATQ A;  3F8P A;  3LOV A;  3VR8 A;  3Q9T A;  1X31 B;  2Z5Y A;  1FL2 A;  2XFU A;  4B64 A;  1GRA A;  5KOW A;  1Y0P A;  3SGL A;  1JRY A;  2ZBW A;  2BS2 A;  2XVI A;  3CPJ G;  1GXF A;  2YVF A;  1PBC A;  3FG2 P;  2OAM A;  3CTY A;  4C3X A;  2EQ8 A;  2JK6 A;  1NHQ A;  3UCL A;  2GQF A;  1RSG A;  5M0Z A;  2WP9 A;  1O95 A;  4OPD A;  5C2T A;  1KSS A;  2H89 A;  4CRT A;  1TYP A;  3AYI A;  2WPC A;  3UOZ A;  1O94 A;  4O5Q A;  3S61 A;  3CGB A;  2R45 A;  1LVL A;  2YAU A;  1GRE A;  2EQ9 A;  2PYX A;  1KFY A;  4Y4L A;  4G6H A;  3AD7 B;  3FMW A;  3UOV A;  1CJC A;  2W0H A;  2X8G A;  2RGH A;  3KPK A;  1GT8 A;  4NTE A;  5BUK A;  3T2Y A;  4CBQ A;  5KMR A;  4EIQ A;  1RYI A;  3R9U A;  4D03 A;  1CC6 A;  1DJQ A;  1RP0 A;  2YG3 A;  4JY2 A;  2V61 A;  3AXB A;  3EAO A;  2EQ6 A;  3H4K A;  4K7Z A;  1TRB A;  2VRL A;  1LQT A;  2WHD A;  2RGJ A;  2GRT A;  5U25 A;  1V59 A;  4EQR A;  2J3N A;  3KD9 A;  1E1K A;  4I58 A;  4B1B A;  5U63 A;  1E1L A;  3DK9 A;  1DOB A;  1NAA A;  1TDN A;  2FJA A;  3NK0 X;  3KA7 A;  3LZW A;  4AP3 A;  3QFB A;  1PJ6 A;  2YG5 A;  2BXS A;  3CGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...