5FS8A

Crystal structure of the g308e mutant of human apoptosis inducing factor
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
487
structure length
473
Chain Sequence
QDKAPSHVPFLLIGGGTAAFAAASIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGEGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESRASEITIPPDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure/Function Relations in Aifm1 Variants Associated with Neurodegenerative Disorders
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
total genus 161
structure length 473
sequence length 487
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fs8A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs8A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs8A01
5JCLA 1KDGA 1TDOA 4Z25A 5BRTA 2BACA 2BK5A 4U8LA 4YSHA 1ZY8A 2XVIA 1BF3A 1M6IA 4EQWA 2VVMA 3GMCA 5HHFA 2Q6UA 2YLRA 4B68A 2FJDA 3M12A 3GDNA 5GSNA 5CKUA 3UP5A 2DKHA 3M13A 1PBDA 2EQ9A 1B5QA 3SGLA 3FBSA 4LU6A 4CCQA 2GEWA 3II4A 1GRAA 2EQ8A 1JRXA 3VRAA 1E39A 2ACZA 2Y6QA 1ZKQA 1XPQA 5U25A 3V3OA 4H2RA 4XXGA 2Z5XA 3SFEA 4BK1A 4NEVA 3GRSA 1D4DA 4PAAA 5KVHA 4U2TA 3H8IA 4ZCDA 1KNRA 4H2PA 4Z26A 2ZZ0A 2YG7A 4C77A 5BUKA 3BHKA 3NKSA 3NTAA 3DH9A 2XLSA 4OPTA 2EQ6A 4NZHA 3KVEA 1H82A 2F5ZA 3ZYXA 2R45A 5JCNA 2WQYA 3P4SA 1CJ2A 3G5SA 1GETA 1CC2A 3WE0A 2XFNA 1FCDA 3O0HA 3BNUA 3C4NA 3NHOX 2BABA 4CY6A 1E1NA 2WP6A 1GV4A 2I0ZA 2VQ7A 5FMHA 1Y0PA 4I58A 4TM3A 5M0ZA 1ZDLA 2APGA 2UZZA 4A65A 3CGCA 3NTDA 3PS9A 4TLXA 1FEBA 5KOWA 1L0VA 1NDAA 2H88A 2XCGA 2R4JA 3NG7X 1LQTA 3PO7A 3T37A 2WESA 2CFYA 4MJWA 1GRTA 2Y6RA 4EQXA 3UTFA 1DOEA 1CJCA 2JBVA 5BVAA 1PBBA 2VVLA 3UTGA 4OPUA 4C74A 2XLUA 3NGCX 4Z24A 1F8RA 2JB1A 4EQRA 3UTHA 1N4UA 4H4YA 1ZOVA 1NHSA 1JEHA 1PJ6A 3ALLA 3NK2X 2WOWA 2VQBA 1D4CA 3VR8A 3NH3X 5DBJA 2B9WA 3DGHA 1L9DA 2B9XA 2YR6A 3GYIA 4GDPA 3M0OA 2WDRA 1OJDA 1CBOA 1JOAA 5C2TA 3H4KA 1H81A 1ZP0A 1LTXR 4JY3A 1F3PA 1BWCA 3BHFA 1OJ9A 3CNPA 2YM1A 3GD3A 1Q1RA 3NLCA 3F8RA 4FK1A 1MO9A 3ADAB 3NRNA 1D7YA 3AECA 3UKKA 3DGZA 1RP0A 2VZ2A 2OALA 4H4RA 1PS9A 4IA6A 4GDEA 1BZLA 3ATQA 3NIXA 1FOHA 2WP9A 3AWIA 3COXA 2XDOA 2C70A 3QVPA 4A7AA 4YTNA 3LJPA 3JSKA 3IHMA 1LQUA 3S61A 4FK1C 2BK4A 4EMIA 4DSGA 2QAEA 1PJ7A 4Y4MA 3ATRA 2YLZA 2BYBA 2GQFA 2QA1A 3AEFA 4M52A 3ICRA 2R46A 3UOYA 1VDCA 4U8OA 4EQSA 3C96A 2GR1A 2BC0A 3AE9A 1KFYA 3URHA 1N4VA 4U8KA 1GPEA 1K0IA 3AD7B 2O9ZA 2YG5A 1F8SA 3UKHA 4AP1A 2RGOA 3AE3A 5EBKA 3G5RA 1GTHA 4REKA 4B67A 4BJYA 4DSHA 1Q9IA 4BURA 2W0HA 5FS6A 4GRTA 3AB1A 4DNAA 2OA1A 2GAHB 3BI5A 4JNQA 3CGDA 2X8GA 3DMEA 1CL0A 3UP4A 2YLWA 1EL8A 2GAGB 3IHGA 4HA6A 4YT0A 2YR5A 3CGEA 1IUWA 4GUVA 3Q6JA 5ER0A 1H86A 2NVKX 2CVJA 4WX1A 3SQPA 3UTEA 5U1OA 2RGJA 3DJJA 3IWAA 2IVEA 1DOCA 3AE2A 2XVJA 3AEGA 2AR8A 4IVOB 2BA9A 2C64A 4UDQA 4ECHA 5HY5A 1D5TA 1P2EA 2WHDA 4UP3A 3P4QA 2BC1A 1LPFA 1EBDA 2YR4A 3AD8B 4LIIA 3GRTA 2GV8A 4H4XA 3EF6A 1PHHA 1E6EA 3CIRA 3CNDA 3DJEA 3NT6A 4EIQA 1GERA 3CGBA 1REOA 3OC4A 2GMJA 2GF3A 2J3NA 3B3RA 3S5WA 2FJAA 3AE1A 4H4SA 3GWDA 3EANA 1SEZA 4OPGA 4J57A 4OPIA 3UOVA 1CF3A 1EL9A 1LVLA 1PBEA 5J60A 4EM3A 3P4PA 3DJGX 2OLOA 3ALMA 1FL2A 3UOXA 1EL5A 3LADA 2BCGG 4Z2UA 4YWOA 4FX9A 2WU5A 2XVFA 4USQA 2IVDA 4JDRA 2GR0A 3E1TA 3LZWA 4Z43A 4YSYA 2BS2A 4B1BA 1GT8A 4YKGA 2FJEA 1PN0A 1CHUA 4P9SA 1BGNA 1DODA 2Q0KA 2C3CA 3QFBA 2R0GA 3AE8A 4OCGA 3I6DA 2CDUA 4E0VA 4AP3A 2AQJA 4BK2A 2C73A 2E5VA 5HXIA 3F8DA 2XFQA 2R0PA 3ZDNA 1GRBA 3ITJA 2XFUA 4YKFA 4BK3A 2PHHA 1PDHA 4K22A 4AOXA 3AEEA 3AEBA 3K30A 2YLSA 3RHAA 1NHRA 4CNJA 4TLZA 1DNCA 1H7WA 4JNAA 2TPRA 1B4VA 2HQMA 4B69A 2B7RA 4OPCA 2BXRA 3C4AA 1E1MA 2C72A 3NYCA 1CJ3A 3UKPA 4A6NA 2FJBA 4YSXA 5FS8A 2BK3A 1F6MA 4TM0A 3UKQA 2XFPA 4EMJA 3DK4A 3CNJA 4J36A 1YQZA 2WPEA 1XANA 1IUSA 4H4PA 3NN0X 4Y4NA 3UKFA 3UKAA 3K7TA 4X9MA 3LXDA 1PXBA 1DJQA 2WPCA 2VOUA 3KA7A 2Q7VA 3F8PA 4OPDA 4N9XA 1ONFA 4USRA 1ZX9A 3V76A 1YQ3A 3AYLA 4X9NA 4Y4LA 4KX6A 2C67A 3CTYA 4CCRA 1CC6A 2R0CA 1KNPA 1H7XA 2C75A 2WEUA 3KPFA 3QJ4A 4K5RA 3NYFA 4O5QA 4U8NA 2V5ZA 1IUXA 4CNKA 2WPFA 4B65A 2GR2A 2OAMA 4XWZA 1S2QA 3FIMB 1LV0A 2JK6A 2V6OA 4XWRA 1PXAA 2BS4A 1FEAA 3DJDA 1K0LA 3KKJA 4NTDA 3GWFA 1W4XA 3OZ2A 4J33A 5BULA 2WS3A 3KU9A 3ALJA 1RSGA 4H4QA 2YLXA 3ICSA 2C3DA 2YAUA 1Y56A 1NPXA 4IA5A 1O5WA 3HZLA 3K7QX 3GSIA 5LV9A 1TDKA 1S3EA 4Z2RA 1ZMDA 2B7SA 3SM8A 2WBAA 1ZOYA 3BNMA 3V3NA 3EAOA 1X31B 2C76A 2JB2A 1P2HA 3QVRA 1DJNA 4Z2TA 1MOKA 1GEUA 1BGJA 1GNDA 1JRYA 1TDNA 1Z6LA 3GMBA 4A5LA 4U8IA 4YSZA 1JRZA 2GB0A 1QJDA 2OLNA 4H4VA 1YQ4A 3NK0X 4EMWA 2PYXA 2YG6A 2WOVA 4B64A 2C7GA 4H7UA 3FMWA 1O94A 5TR3A 4B63A 3QSMA 1UKVG 5GRTA 3KD9A 2BS3A 2A8XA 4CBQA 1V59A 4EIPA 5EB5A 3VQRA 4ADWA 4C3XA 1Y56B 3AE4A 5IQ1A 3CNSA 4CY8A 3NYEA 3K7MX 2NPXA 3VRDB 5JCMA 1GESA 3CPHG 4YTPA 1NG4A 4RSLA 2B76A 4YTMA 4BV6A 1GRHA 5FS7A 3BI4A 4BJZA 3IC9A 4I59A 1K4QA 1DOBA 3FG2P 1PXCA 1ZMCA 4GCMA 4U8JA 4K7ZA 4DGKA 1KF6A 4GF7A 5HYMA 3RP7A 4K2XA 3GD4A 4OVIA 2ARDA 3AD9B 2YM2A 1QLBA 4KPRA 4H4ZA 2GH5A 3DK9A 2X8CA 3GDPA 1EL7A 2GMHA 1JU2A 4EM4A 3VRBA 1D7LA 4TM4A 1F8WA 1OJAA 1YKJA 4U8MA 3RP8A 1DXLA 2YG3A 3AE6A 4J31A 3KLJA 2JKCA 3AEAA 1CJ4A 1Q1WA 2YG4A 2C66A 3BI2A 3G5QA 4K8DA 3I3LA 2QA2A 2RGHA 5J7XA 4ZN0A 1NAAA 2YVFA 4NTCA 4AT0A 4C3YA 1QO8A 3SFDA 3QFAA 1GOSA 1N1PA 3CNTA 4YXDA 1NEKA 2JB3A 3EPTA 5M10A 3D1CA 4NEWA 4K5SA 2DKIA 2XYOA 3GYJA 2XLRA 3AEDA 1NHQA 2QCUA 2XVEA 1YY5A 3CPJG 4TM1A 4H4UA 2C65A 3UOZA 4Z44A 4J34A 1FECA 1L9CA 1TYPA 1GRGA 2WU2A 3D8XA 1D4EA 3UKLA 1TDEA 2GQWA 1GXFA 3CPIG 3RP6A 3P4RA 5KRQA 1AOGA 3P1WA 4LA1A 4O5UA 4ZCCA 1VG0A 3RNMA 4AT2A 2VVLG 3ICTA 4H2NA 3P9UA 2X50A 2CULA 2GVCA 2BXSA 1IJHA 4AOSA 2WDVA 3DA1A 1IUTA 2TMDA 1E1LA 2GRTA 3NN6X 3LOVA 2VRMA 1H6VA 1XDIA 1ELIA 2AAQA 5U63A 4B66A 2WETA 2R9ZA 2X8HA 2YWLA 1VG9A 2XLTA 1ZK7A 1VQWA 2Q0LA 2WOIA 1O95A 1BKWA 4HB9A 1E1KA 4UDPA 4WCTA 1N4WA 4A99A 4H50A 2FBWA 3VR9A 1GRFA 2YLTA 3ABVA 1GALA 4U2LA 1TRBA 3AE7A 3B6DA 5IQ4A 1VRQB 1GSNA 4OPLA 4JQ9A 3ISHA 3UCLA 2X3NA 2IIDA 4JN9A 3Q9TA 2GR3A 2V3BA 4A79A 2V60A 4IVMB 4U8PA 3CN8A 1NENA 2YVGA 4C5OA 3L8KA 2E4GA 4H2QA 5L46A 2ZZBA 4RG4A 4H4WA 4D04A 4APNA 1JNRA 5KWFA 3LB8A 1IUVA 1GTEA 5CQFA 4U2SA 4GR1A 1L9EA 3AE5A 1S3BA 2Z5YA 3LZXA 5C3JA 2BCPA 1KSSA 1IUUA 2RABA 1CC4A 3REDA 2XLPA 4FDCB 2WP5A 3H8LA 1MXTA 3FPZA 3QSEA 1HYUA 1B8SA 1NHPA 2EQ7A 3IF9A 4ICYA 4J2WA 2ZBWA 1H84A 3NK1X 4JY2A 1OJCA 2V3AA 4CRTA 1PBFA 1PJ5A 5KOXA 3L1RA 3NNEA 2XVHA 1S2YA 1XHCA 5JCKA 4X4JA 4J56A 1COYA 2A87A 4H4TA 2V61A 1OJTA 3PVCA 4A9WA 1NG3A 2WDQA 4RG3A 1GREA 2XFOA 1JNZA 1KSUA 5JCIA 1RYIA 2B9YA 3QSSA 2JAEA 1E7PA 4IV9A 1PBCA 2ZZCA 3DK8A 2A89A 2E1MA 5EOWA 3AYJA 1TYTA 2X99A 2R4EA 2VRLA 5KXJA 1LJ1A 5KVIA 1B37A 1H83A 5EB4A 2YQUA 2YVJA 2H89A 1TDFA 3R9UA 4NTEA 4A6NB 5FS9A 4D03A 4PABA 5IPYA 1M64A 3AXBA 4UDRA 3AYIA 1K0JA
chains in the Genus database with same CATH superfamily
2OVLA 4Z25A 5BRTA 2BRAA 1ZY8A 1M6IA 4EQWA 3DG3A 2Q6UA 3OW1A 3GDNA 5FJPA 5CKUA 1ECQA 3NFUA 3RCYA 4LU6A 4CCQA 1JRXA 1XPQA 2Z5XA 5KVHA 1X2HA 3H8IA 3UJRA 4DX3A 3PFRA 3BHKA 3NTAA 2XLSA 3KVEA 1H82A 3R0KA 5FJUA 3G5SA 3NO1A 3FV9A 3SYIA 2PTWA 2WP6A 2I0ZA 2VQ7A 5FMHA 5M0ZA 2UZZA 3TOYA 3FJ4A 3FVDA 5KOWA 1L0VA 3PO7A 2XCGA 5G5GB 2CFYA 4MJWA 1GRTA 4M6UA 2JBVA 5BVAA 4OPUA 2XLUA 4Z24A 4EQRA 4H4YA 2XH0A 3DIPA 3MQTA 2B9XA 3GYIA 3M0OA 3HW2A 5C2TA 1H81A 1LTXR 4IT1A 3BHFA 4FK1A 2ZC8A 1MO9A 2PU0A 3NRZB 4H4RA 4IA6A 1BZLA 2WP9A 2C70A 3R10A 1LQUA 4Y4MA 3ATRA 3AEFA 4M52A 4U8OA 3C96A 4G9KA 2GR1A 2BC0A 3AE9A 1K0IA 2O9ZA 3AE3A 4BJYA 1GTHA 4B67A 4X2PA 3JZUA 5FS6A 4G8TA 4DNAA 2GAHB 3BI5A 3VC6A 3UJEA 4KT2A 1IUWA 4GUVA 3UTEA 3SQPA 2RGJA 2XGZA 3NXLA 3RO6A 2IVEA 3AEGA 4TVYA 4IVOB 2BA9A 1D5TA 1P2EA 1EBDA 3AD8B 3GO2A 5EB4A 4H4XA 1PHHA 3UXLA 1E6EA 2CHRA 2OFJA 4EIQA 1GERA 2GMJA 1REOA 3S5WA 3MKCA 2GF3A 1IYXA 2J3NA 3B3RA 2FJAA 3P93A 1PBEA 2OQHA 1FL2A 3ALMA 3LADA 4J1OA 2WU5A 3LZWA 3IJIA 2FJEA 1PN0A 4YSYA 2C3CA 5FJOA 2R0GA 4BK2A 2C73A 5HXIA 1V97A 3ZDNA 2FKPA 2XFUA 4DXKA 3VA8A 2YLSA 3QKEA 4B69A 4DN1A 2BXRA 3C4AA 1E1MA 4A6NA 1FFVC 5KNLA 2BK3A 3UKQA 3CNJA 1YQZA 1XANA 3UKFA 3K7TA 1PXBA 2VOUA 3SY4A 1WUEA 4OPDA 5G5HB 3CTYA 2PGWA 4K5RA 2WPFA 2GR2A 3NVZB 2OAMA 4XWZA 1LV0A 2JK6A 2BS4A 2QJMA 1K0LA 1W4XA 1MNSA 4J33A 4JHMA 2WS3A 4H4QA 2YLXA 2C3DA 1OEPA 2YAUA 1Y56A 4IA5A 1MDRA 4Z17A 5LV9A 1JROA 1S3EA 1ZMDA 3IK4A 2WBAA 1ZOYA 3EAOA 1X31B 2C76A 4A5LA 1Z6LA 3GMBA 4U8IA 4YSZA 4TVWA 1YEYA 4HCLA 4H4VA 3NK0X 4EMWA 2PYXA 4H7UA 1O94A 5GRTA 3KD9A 4HCDA 3VRDB 4YTPA 4RSLA 3PG6A 4A35A 4ZOHB 4U8JA 4Z1YA 4K7ZA 4GF7A 1QLBA 2DW7A 4JN7A 1D7LA 2GGHA 1CJ4A 5J7XA 1NAAA 4IL0A 4C3YA 3CNTA 1N1PA 3SN0A 1PDZA 3EPTA 3H7VA 3D1CA 2XYOA 3H8AA 1NHQA 2QCUA 3DG6A 3EEZA 1L9CA 1TYPA 1GRGA 3D8XA 3UKLA 2GQWA 3CPIG 3MUCA 3UCDA 3P4RA 4LA1A 3P3BA 4ZCCA 3ICTA 2X50A 1E1LA 2GRTA 1H6VA 2AAQA 2R9ZA 4G6HA 1BKWA 2NQLA 1E1KA 4A99A 4WCTA 4II3A 3VR9A 4U2LA 5IQ4A 3ISHA 1JCTA 3UGVA 3P0WA 3L8KA 3SN1A 2DW6A 2MNRA 2ZZBA 4H4WA 4APNA 5KWFA 1IUVA 5C3JA 5IDZA 3MZNA 1KSSA 3REDA 4FDCB 1MXTA 3FPZA 3VCNA 1PBFA 5KOXA 1XHCA 4X4JA 2QJNA 4J56A 4H4TA 1OJTA 1N63C 3NS1B 2XH4A 2W55A 1KSUA 5JRBA 5JCIA 3OP2A 3QLDA 5EOWA 3AYJA 1TYTA 1R6WA 1ELSA 1JDFA 4MKSA 2YVJA 4NTEA 4GAVA 3CB3A 2HNEA 2BACA 3H70A 3GMCA 2FJDA 3H12A 3M13A 1PBDA 1R0MA 1B5QA 3EUB3 2GEWA 3VRAA 3VFCA 2GGJA 3GRSA 4G73A 4ROPA 4PAAA 1KNRA 4H2PA 2AKMA 1W6TA 3PWIA 2P8CA 3T9PA 1RM6B 2WQYA 3T2ZA 3BNUA 2E3TA 4CY6A 1BQGA 4II2A 4I58A 3PS9A 2XH2A 1NDAA 2R4JA 3NG7X 3A7RA 4JN8A 1PBBA 1N4UA 2E5AA 1NHSA 1P43A 1PJ6A 3VR8A 2B9WA 4GDPA 2WDRA 1OJDA 1CBOA 5BOEA 2PA6A 2P0IA 1OJ9A 3CNPA 1Q1RA 4HNLA 3ZVHB 3SN4A 1FHVA 3AECA 3UKKA 3S47A 4GDEA 1FOHA 1ONEA 2XDOA 4A7AA 3HPFA 3I6EA 3SZWA 2YLZA 4HCHA 2BYBA 2GQFA 2QA1A 3ICRA 4EQSA 3ES7A 3URHA 1GPEA 3AD7B 2YG5A 2RDXA 3R0UA 2RGOA 2I5QA 3MY9A 4BURA 4GRTA 3BSMA 3CGDA 2X8GA 3DERA 3IHGA 4HA6A 4YT0A 2OKTA 3CGEA 5ER0A 3DJJA 3R1ZA 5HY5A 4UP3A 2YR4A 1LPFA 2GV8A 2OZ8A 3CNDA 3CIRA 2AKZA 3TW9A 1EC7A 3AE1A 3GWDA 1CF3A 3ZLGA 4EM3A 1EL5A 4Z2UA 4YWOA 4FX9A 2XVFA 4USQA 2IVDA 2QQ6A 4Z43A 4YKGA 2PTZA 4P9SA 1CHUA 1BGNA 3QFBA 3AE8A 2PTYA 4AP3A 3F8DA 1E9IA 2R0PA 3T4WA 4YKFA 4BK3A 2PHHA 1PDHA 4K22A 7ENLA 4CNJA 3RHAA 2TPRA 4B68A 3UKPA 4OPCA 2C72A 2FJBA 1F6MA 4TM0A 3ES8A 4EMJA 2FYMA 3Q4DA 4J36A 3EKGA 3UKAA 1SJCA 1DJQA 1FIQB 4N9XA 1ZX9A 1YQ3A 4Y4LA 4KX6A 4CCRA 1KNPA 1H7XA 3KPFA 2WEUA 1S2QA 4A3RA 2V6OA 1FEAA 3DJDA 4NTDA 3GWFA 1PDYA 3RRAA 2PPGA 1WUFA 3K7QX 3DDMA 4Z2RA 2B7SA 3SM8A 4E5TA 3BNMA 3V3NA 1SB3B 1DJNA 3RR1A 1GEUA 4DWDA 2GGGA 3SZ0A 4B64A 4GGBA 1MDLA 1H2IA 5TR3A 4B63A 2BS3A 2A8XA 1VDVA 5EB5A 4C3XA 5IQ1A 1GESA 3CPHG 3NVVB 4YTMA 3DFHA 3ZVIA 1GRHA 4BJZA 1DOBA 1PXCA 4GCMA 1KF6A 1NU5A 2W54A 3RP7A 3N6HA 3GD4A 1WYGA 3DK9A 2X8CA 3GDPA 1EL7A 3VRBA 1YKJA 4ENLA 1DXLA 3KLJA 2HZGA 2C66A 3G5QA 1KCZA 4K8DA 3I3LA 2RGHA 4ZN0A 2GGIA 1QO8A 3TTEA 3QFAA 1NEKA 4K5SA 3AEDA 3B9JB 4MMWA 1YY5A 3CPJG 3MWCA 4H4UA 3UOZA 4J34A 3BJSA 2GL5A 2WU2A 3RGTA 1TDEA 3RP6A 2PP1A 1AOGA 4O5UA 4AT2A 1FHUA 3P9UA 4AOSA 2TMDA 4K8GA 2VRMA 1ELIA 2X8HA 2XLTA 4HB9A 2P3ZA 1O95A 1TKKA 4H50A 3ABVA 3S5SA 3R07C 1VRQB 4HN8A 4IVMB 3DGBA 4U8PA 4H19A 3CN8A 5L46A 4D04A 3U9IA 3LB8A 3R25A 2QDEA 5CQFA 3IJLA 5J04A 1CC4A 2XLPA 2WP5A 3T2KA 3Q45A 1HYUA 4ICYA 1NHPA 3IF9A 4J2WA 3K1GA 4CRTA 3AMZA 2QGYA 3NNEA 4E4UA 2A87A 3PVCA 1NG3A 1GREA 1JNZA 1E7PA 4IV9A 3SZCA 2ZZCA 3V5CA 3DK8A 3KUMA 1H83A 1B37A 1EBGA 4UDRA 3AYIA 1TZZA 5JCLA 1KDGA 3QN3A 1TDOA 2BK5A 4YSHA 1BF3A 2VVMA 3M12A 5GSNA 2HXTA 3UP5A 2EQ9A 3TWBA 3FBSA 3II4A 2ACZA 1ZKQA 3PK7A 5U25A 1TE6A 3V3OA 2XSXA 4H2RA 4XXGA 3HYXA 4BK1A 4NEVA 4U2TA 4ZCDA 4Z26A 2YG7A 4C77A 3D9XA 3NKSA 4H83A 2EQ6A 4NZHA 2F5ZA 6ENLA 5JCNA 1CJ2A 1BKHA 1F9CA 3T2YA 3WE0A 2XFNA 3O0HA 4TM3A 1Y0PA 3FYYA 3GY1A 2APGA 2PGEA 3CGCA 4KWSA 1KN0A 2OG9A 1FEBA 3T37A 1LQTA 2Y6RA 3UTFA 3CXOA 1DOEA 1CJCA 4C74A 3NGCX 1F8RA 2JB1A 3UTHA 1ZOVA 1JEHA 4GIRA 2PODA 2WOWA 2VQBA 1D4CA 3NH3X 2OPJA 3SSZA 3H4KA 1STZA 1ZP0A 1F3PA 1BWCA 1N62C 3NLCA 3GD3A 3ADAB 3NRNA 3DGZA 4H1ZA 3ATQA 3AWIA 4YTNA 2W3RA 3LJPA 3JSKA 3UJSA 2BK4A 4EMIA 2QAEA 2R46A 3ZLHA 3UOYA 3TWAA 1KFYA 4U8KA 3IJQA 4HPNA 1F8SA 4AP1A 4DSHA 1Q9IA 5FJTA 4JNQA 3DMEA 1CL0A 3UP4A 4EWJA 2YLWA 2GAGB 3Q6JA 2NVKX 2CVJA 5U1OA 1KKRA 3IWAA 3AM9A 2XVJA 4UDQA 4ECHA 2BC1A 4LIIA 3GRTA 3DJEA 4DYEA 3JW7A 3OC4A 2AL1A 1NELA 4OPIA 1LVLA 5J60A 3DJGX 2OLOA 3DFYA 3CT2A 2GR0A 3E1TA 2OZ3A 2BS2A 3VC5A 2Q0KA 3I6DA 2CDUA 1GRBA 3T0KA 4GMEA 3AEEA 3SBFA 1DNCA 1H7WA 4JNAA 3NYCA 1CJ3A 1EC8A 5FS8A 5BOFA 2XFPA 3DK4A 2WPEA 4X9MA 4G6GA 3KA7A 1ONFA 3BOXA 3V76A 3AYLA 2C67A 1CC6A 2R0CA 3V4BA 3NYFA 4CNKA 4B65A 3KKJA 5BULA 3N4EA 3ALJA 1NPXA 3GSIA 2JB2A 1P2HA 1BGJA 4M0XA 2OQYA 2GGEA 1JRZA 2GB0A 2OLNA 2QDDA 2C7GA 1KKOA 4FP1A 3FMWA 3QSMA 1UKVG 3MSYA 4EIPA 4CBQA 4ADWA 3CNSA 3K7MX 2NPXA 4F4RA 2OLAA 2B76A 1N5XA 4I59A 3I4KA 1K4QA 3FG2P 4DGKA 5FJRA 2OZTA 4K2XA 1N5WC 2ARDA 3AD9B 4KPRA 2GH5A 2GMHA 1JU2A 4TM4A 1F8WA 1OJAA 1S7MA 4U8MA 3RP8A 1MRAA 1Q1WA 3BI2A 1SJAA 2QA2A 2YVFA 3U4FA 4NTCA 3SFDA 1GOSA 3AN1A 3QTPA 5M10A 2DKIA 3GYJA 2XLRA 4TM1A 2ZADA 2C65A 3V3WA 1FECA 3N6JA 1D4EA 3N4FA 1GXFA 2P8BA 5KRQA 3TJ4A 3NVYB 1VG0A 3OTRA 3RNMA 4H2NA 3JVAA 1MUCA 2CULA 2GVCA 1IJHA 2WDVA 3DA1A 4YWSA 3NN6X 4H2HA 1XDIA 5U63A 4B66A 2WETA 2YWLA 1VQWA 2Q0LA 1X2GA 1N4WA 1JPDX 2YLTA 4IL2A 1GALA 1TRBA 3B6DA 4GAPA 2IIDA 4JN9A 3Q9TA 3B97A 4A79A 2V60A 2C4CA 4IP4A 2YVGA 2E4GA 4J3ZA 4RG4A 4FI4A 4U2SA 1L9EA 3AE5A 3SZFA 4KEMA 2BCPA 2RABA 3H8LA 1JRPA 3D47A 3QSEA 1B8SA 1H84A 3NK1X 4JY2A 3OPSA 2AL2B 2V3AA 2OX4A 3L1RA 5KMSA 2XVHA 1S2YA 1COYA 4GFIA 4A9WA 1VQZA 2XFOA 1RYIA 3HYWA 3QSSA 1PBCA 2E1MA 2X99A 2R4EA 5KXJA 1RVKA 5KVIA 2H89A 3R9UA 4A6NB 2PP0A 3DESA 4D03A 3CYJA 1M64A 3AXBA 2YM1A 4IHCA 3NZGA 4U8LA 2P88A 2XVIA 1FFUC 4DHGA 1KD0A 2YLRA 5HHFA 2DKHA 3SGLA 1GRAA 2EQ8A 1E39A 2Y6QA 4GISA 3SXIA 3SFEA 1D4DA 2ZZ0A 3THUA 5BUKA 3DH9A 2PSNA 4OPTA 3TQPA 3CK5A 3ZYXA 2R45A 3P4SA 2PTXA 3DG7A 3UJ2A 1GETA 1CC2A 2PMQA 1FCDA 3C4NA 3NHOX 2BABA 3CMMA 1E1NA 1GV4A 5KMQA 3FCPA 1ZDLA 4A65A 3NTDA 3CXBA 4TLXA 3KPKA 2H88A 3RITA 2WESA 2AL2A 4EQXA 2OO6A 2VVLA 3UTGA 3HYVA 3I6TA 3FXGA 4HYRA 2ONEA 3ALLA 3NK2X 5DBJA 2XH7A 3DGHA 1L9DA 2YR6A 1JOAA 4JY3A 3TJIA 3F8RA 3R11A 1XS2A 1D7YA 1RP0A 2VZ2A 2OALA 1PS9A 3NIXA 3COXA 3QVPA 3IHMA 3S61A 4FK1C 4DSGA 1PJ7A 2PU1A 1ZXIC 1VDCA 1N4VA 3UKHA 4REKA 5EBKA 3G5RA 2QVHA 3V5FA 1N60C 2W0HA 4HNCA 3AB1A 2OA1A 1EL8A 2YR5A 1H86A 4WX1A 1DOCA 3AE2A 2PP3A 1JPMA 2AR8A 3T14A 2C64A 3VCCA 2WHDA 3P4QA 2PS2A 4YSXA 3EF6A 2PCEA 3NT6A 2QJJA 3CGBA 3GC2A 4KPLA 3D46A 4H4SA 4OPGA 3EANA 1SEZA 3UOVA 4J57A 1EL9A 3P4PA 3UOXA 2BCGG 4JDRA 4K2SA 4B1BA 1GT8A 3T8QA 1DODA 4E0VA 4OCGA 2AQJA 2E5VA 2XFQA 3ITJA 4AOXA 3AEBA 3K30A 3VDGA 1NHRA 3STPA 3ZLFA 4TLZA 1B4VA 2HQMA 2B7RA 5KMPA 1P48A 4GYPA 1IUSA 4H4PA 3NN0X 4Y4NA 3LXDA 2WPCA 3A7UA 2Q7VA 3F8PA 3ETRB 4USRA 4X9NA 4ZCWA 2C75A 4U8NA 4O5QA 2HXUA 3QJ4A 1EC9A 2V5ZA 1IUXA 3FIMB 2MUCA 4XWRA 1T3QC 1PXAA 1EBHA 3OZ2A 2POZA 3KU9A 1RSGA 3ICSA 1O5WA 3HZLA 1TDKA 3QVRA 1SJBA 2O56A 1MOKA 4Z2TA 1TDNA 1GNDA 1JRYA 1QJDA 1YQ4A 1XPYA 2YG6A 2WOVA 4G7FA 3OZYA 4GGHA 4A6GA 1V59A 3VQRA 1Y56B 3AE4A 2GDQA 4CY8A 3NYEA 4E8GA 3GYXA 3PWGA 5JCMA 2GSHA 1NG4A 4BV6A 5FS7A 4NWZA 3BI4A 3IC9A 1ZMCA 4E4FA 5HYMA 3CAWA 4OVIA 4GYPC 2YM2A 4H4ZA 1DTNA 4EM4A 3SR6B 3OZMA 3UCCA 2YG3A 3AE6A 4J31A 2JKCA 3AEAA 2YG4A 5EU9A 4AT0A 4YXDA 2JB3A 3UXKA 4NEWA 3NVWB 2XVEA 4Z44A 4G74A 3DEQA 3ENLA 3P1WA 3TCSA 2VVLG 3UJFA 3T6CA 3A7AA 2BXSA 1IUTA 3LOVA 1VG9A 1ZK7A 3ZVHA 2WOIA 2W3SA 4UDPA 2FBWA 1GRFA 3SJNA 3AE7A 4K1WA 1GSNA 4OPLA 4JQ9A 3UCLA 2X3NA 2GR3A 2V3BA 4MGGA 4E6MA 1NENA 4C5OA 4H2QA 1L8PA 1JNRA 4ZA0A 4IP5A 1GTEA 4GR1A 1S3BA 2Z5YA 3LZXA 3GD6A 1IUUA 3L5OA 3QPEA 3SQSA 2EQ7A 2ZBWA 1OJCA 1PJ5A 2BRYA 5JCKA 2V61A 3SX6A 4IZGA 2WDQA 4RG3A 2B9YA 1SJDA 2JAEA 1N61C 1FO4A 2A89A 2VRLA 1LJ1A 4NNJA 2YQUA 3T31A 1TDFA 5FS9A 5KMRA 3HRDC 4PABA 5IPYA 5ENLA 1K0JA
chains in the Genus database with same CATH topology
5JCLA 1KDGA 1TDOA 4Z25A 5BRTA 2BACA 2BK5A 2BRAA 4U8LA 4YSHA 1ZY8A 2XVIA 1BF3A 1M6IA 4EQWA 2VVMA 3GMCA 5HHFA 2Q6UA 2YLRA 4B68A 2FJDA 3M12A 3GDNA 5GSNA 5CKUA 3UP5A 2DKHA 3M13A 1PBDA 2EQ9A 1B5QA 3SGLA 3FBSA 4LU6A 4CCQA 2GEWA 3II4A 1GRAA 2EQ8A 1JRXA 3VRAA 1E39A 2ACZA 2Y6QA 1ZKQA 1XPQA 5U25A 3SXIA 3V3OA 4H2RA 4XXGA 2Z5XA 3HYXA 3SFEA 4BK1A 4NEVA 3GRSA 4G73A 1D4DA 4PAAA 5KVHA 4U2TA 3H8IA 4ZCDA 1KNRA 4H2PA 4Z26A 2ZZ0A 2YG7A 4C77A 5BUKA 3D9XA 3BHKA 3NKSA 3NTAA 3DH9A 2XLSA 4OPTA 2EQ6A 4NZHA 3KVEA 1H82A 2F5ZA 3ZYXA 2R45A 5JCNA 2WQYA 3P4SA 1CJ2A 3T2ZA 3G5SA 1GETA 1CC2A 3T2YA 3WE0A 2XFNA 3SYIA 1FCDA 3O0HA 3BNUA 3C4NA 3NHOX 2BABA 3CMMA 4CY6A 1E1NA 2WP6A 1GV4A 2I0ZA 4II2A 2VQ7A 5FMHA 1Y0PA 4I58A 4TM3A 5KMQA 5M0ZA 1ZDLA 2APGA 2UZZA 4A65A 3CGCA 3NTDA 3PS9A 1KN0A 4TLXA 1FEBA 5KOWA 3KPKA 1L0VA 1NDAA 2H88A 2XCGA 2R4JA 3NG7X 1LQTA 3PO7A 3T37A 2WESA 2CFYA 4MJWA 1GRTA 2Y6RA 4EQXA 3UTFA 1DOEA 1CJCA 2JBVA 5BVAA 1PBBA 2VVLA 3UTGA 4OPUA 3HYVA 4C74A 2XLUA 3NGCX 4Z24A 1F8RA 2JB1A 4EQRA 3UTHA 1N4UA 4H4YA 1ZOVA 1NHSA 1JEHA 1PJ6A 3ALLA 3NK2X 2WOWA 2VQBA 1D4CA 3VR8A 3NH3X 5DBJA 2B9WA 3DGHA 1L9DA 2B9XA 2YR6A 3GYIA 4GDPA 3M0OA 2WDRA 1OJDA 1CBOA 1JOAA 5C2TA 3H4KA 1H81A 1ZP0A 1LTXR 4JY3A 1F3PA 1BWCA 3BHFA 1OJ9A 3CNPA 2YM1A 3GD3A 1Q1RA 3NLCA 3F8RA 4FK1A 1MO9A 3ADAB 3NRNA 1D7YA 3AECA 3UKKA 3DGZA 1RP0A 2VZ2A 2OALA 4H4RA 1PS9A 4IA6A 4GDEA 1BZLA 3ATQA 3NIXA 1FOHA 2WP9A 3AWIA 3COXA 2XDOA 2C70A 3QVPA 4A7AA 4YTNA 3LJPA 3JSKA 3IHMA 1LQUA 3S61A 4FK1C 2BK4A 4EMIA 4DSGA 2QAEA 1PJ7A 3SZWA 4Y4MA 3ATRA 2YLZA 2BYBA 2GQFA 2QA1A 3AEFA 4M52A 3ICRA 2R46A 3UOYA 1VDCA 4U8OA 4EQSA 3C96A 4G9KA 2GR1A 2BC0A 3AE9A 1KFYA 3URHA 1N4VA 4U8KA 1GPEA 1K0IA 3AD7B 2O9ZA 2YG5A 1F8SA 3UKHA 4AP1A 2RGOA 3AE3A 5EBKA 3G5RA 1GTHA 4REKA 4B67A 4BJYA 4DSHA 1Q9IA 4BURA 2W0HA 5FS6A 4GRTA 3AB1A 4DNAA 2OA1A 2GAHB 3BI5A 4JNQA 3CGDA 2X8GA 3DMEA 1CL0A 3UP4A 2YLWA 1EL8A 2GAGB 3IHGA 4HA6A 4YT0A 2YR5A 3CGEA 1IUWA 4GUVA 3Q6JA 5ER0A 1H86A 2NVKX 2CVJA 4WX1A 3SQPA 3UTEA 5U1OA 2RGJA 3DJJA 3IWAA 2IVEA 1DOCA 3AE2A 2XVJA 3AEGA 2AR8A 4IVOB 2BA9A 3T14A 2C64A 4UDQA 4ECHA 5HY5A 1D5TA 1P2EA 2WHDA 4UP3A 3P4QA 2BC1A 1LPFA 1EBDA 2YR4A 3AD8B 4LIIA 3GRTA 2GV8A 4H4XA 3EF6A 1PHHA 1E6EA 3CIRA 3CNDA 3DJEA 3NT6A 4EIQA 1GERA 3CGBA 1REOA 3OC4A 2GMJA 2GF3A 2J3NA 3B3RA 3S5WA 2FJAA 3AE1A 4H4SA 3GWDA 3EANA 1SEZA 4OPGA 4J57A 4OPIA 3UOVA 1CF3A 1EL9A 1LVLA 1PBEA 5J60A 4EM3A 3P4PA 3DJGX 2OLOA 3ALMA 1FL2A 3UOXA 1EL5A 3LADA 2BCGG 4Z2UA 4YWOA 4FX9A 2WU5A 2XVFA 4USQA 2IVDA 4JDRA 2GR0A 3E1TA 3LZWA 4Z43A 4YSYA 2BS2A 4B1BA 1GT8A 4YKGA 2FJEA 1PN0A 1CHUA 4P9SA 1BGNA 1DODA 2Q0KA 2C3CA 3QFBA 2R0GA 3AE8A 4OCGA 3I6DA 2CDUA 4E0VA 4AP3A 2AQJA 4BK2A 2C73A 2E5VA 5HXIA 3F8DA 2XFQA 2R0PA 3ZDNA 1GRBA 3ITJA 3T0KA 2XFUA 4YKFA 4BK3A 2PHHA 1PDHA 4K22A 4AOXA 3AEEA 3AEBA 3K30A 2YLSA 3RHAA 1NHRA 4CNJA 4TLZA 1DNCA 1H7WA 4JNAA 2TPRA 1B4VA 2HQMA 4B69A 2B7RA 4OPCA 2BXRA 3C4AA 1E1MA 2C72A 3NYCA 1CJ3A 3UKPA 4A6NA 2FJBA 4YSXA 5KMPA 5KNLA 5FS8A 2BK3A 1F6MA 4TM0A 3UKQA 2XFPA 4EMJA 3DK4A 3CNJA 4J36A 1YQZA 2WPEA 1XANA 1IUSA 4H4PA 3NN0X 4Y4NA 3UKFA 3UKAA 3K7TA 4X9MA 3LXDA 1PXBA 1DJQA 2WPCA 2VOUA 4G6GA 3SY4A 3KA7A 2Q7VA 3F8PA 4OPDA 4N9XA 1ONFA 4USRA 1ZX9A 3V76A 1YQ3A 3AYLA 4X9NA 4Y4LA 4KX6A 2C67A 3CTYA 4CCRA 1CC6A 2R0CA 1KNPA 1H7XA 2C75A 2WEUA 3KPFA 3QJ4A 4K5RA 3NYFA 4O5QA 4U8NA 2V5ZA 1IUXA 4CNKA 2WPFA 4B65A 2GR2A 2OAMA 4XWZA 1S2QA 3FIMB 1LV0A 2JK6A 2V6OA 4XWRA 1PXAA 2BS4A 1FEAA 3DJDA 1K0LA 3KKJA 4NTDA 3GWFA 1W4XA 3OZ2A 4J33A 5BULA 2WS3A 3KU9A 3ALJA 1RSGA 4H4QA 2YLXA 3ICSA 2C3DA 2YAUA 1Y56A 1NPXA 4IA5A 1O5WA 3HZLA 3K7QX 3GSIA 5LV9A 1TDKA 1S3EA 4Z2RA 1ZMDA 2B7SA 3SM8A 2WBAA 1ZOYA 3BNMA 3V3NA 3EAOA 1X31B 2C76A 2JB2A 1P2HA 3QVRA 1DJNA 4Z2TA 1MOKA 1GEUA 1BGJA 1GNDA 1JRYA 1TDNA 1Z6LA 3GMBA 4A5LA 3SZ0A 4U8IA 4YSZA 1JRZA 2GB0A 1QJDA 2OLNA 4H4VA 1YQ4A 3NK0X 4EMWA 2PYXA 2YG6A 2WOVA 4B64A 2C7GA 4H7UA 3FMWA 1H2IA 1O94A 5TR3A 4B63A 3QSMA 1UKVG 5GRTA 3KD9A 2BS3A 2A8XA 4CBQA 1V59A 4EIPA 5EB5A 3VQRA 4ADWA 4C3XA 1Y56B 3AE4A 5IQ1A 3CNSA 4CY8A 3NYEA 3K7MX 2NPXA 3GYXA 3VRDB 5JCMA 1GESA 3CPHG 4YTPA 1NG4A 4RSLA 2B76A 3PG6A 4YTMA 4BV6A 1GRHA 5FS7A 4NWZA 3BI4A 4BJZA 3IC9A 4I59A 1K4QA 1DOBA 3FG2P 1PXCA 1ZMCA 4GCMA 4U8JA 4K7ZA 4DGKA 1KF6A 4GF7A 5HYMA 3RP7A 4K2XA 3GD4A 4OVIA 2ARDA 3AD9B 2YM2A 1QLBA 4KPRA 4H4ZA 2GH5A 3DK9A 2X8CA 3GDPA 1EL7A 2GMHA 1JU2A 4EM4A 3VRBA 1D7LA 4TM4A 1F8WA 1OJAA 1S7MA 1YKJA 4U8MA 3RP8A 1DXLA 2YG3A 3AE6A 4J31A 3KLJA 2JKCA 3AEAA 1CJ4A 1Q1WA 2YG4A 2C66A 3BI2A 3G5QA 4K8DA 3I3LA 2QA2A 2RGHA 5J7XA 4ZN0A 1NAAA 2YVFA 4NTCA 4AT0A 4C3YA 1QO8A 3SFDA 3QFAA 1GOSA 1N1PA 3CNTA 4YXDA 1NEKA 2JB3A 3EPTA 5M10A 3D1CA 4NEWA 4K5SA 2DKIA 2XYOA 3GYJA 2XLRA 3AEDA 1NHQA 2QCUA 2XVEA 1YY5A 3CPJG 4TM1A 4H4UA 2C65A 3UOZA 4Z44A 4J34A 1FECA 1L9CA 1TYPA 1GRGA 2WU2A 3D8XA 1D4EA 3UKLA 1TDEA 2GQWA 1GXFA 3CPIG 4G74A 3RP6A 3P4RA 5KRQA 1AOGA 3P1WA 4LA1A 4O5UA 4ZCCA 1VG0A 3RNMA 4AT2A 2VVLG 3ICTA 4H2NA 3P9UA 2X50A 2CULA 2GVCA 2BXSA 1IJHA 4AOSA 2WDVA 3DA1A 1IUTA 2TMDA 1E1LA 2GRTA 3NN6X 3LOVA 2VRMA 1H6VA 1XDIA 1ELIA 2AAQA 5U63A 4B66A 2WETA 2R9ZA 2X8HA 2YWLA 1VG9A 2XLTA 4G6HA 1ZK7A 1VQWA 2Q0LA 2WOIA 1O95A 1BKWA 4HB9A 1E1KA 4UDPA 4WCTA 1N4WA 4A99A 4II3A 4H50A 2FBWA 3VR9A 1GRFA 2YLTA 3ABVA 1GALA 4U2LA 1TRBA 3AE7A 3B6DA 5IQ4A 1VRQB 1GSNA 4OPLA 4JQ9A 3ISHA 4GAPA 3UCLA 2X3NA 2IIDA 4JN9A 3Q9TA 2GR3A 2V3BA 4A79A 2V60A 4IVMB 4U8PA 2C4CA 3CN8A 1NENA 2YVGA 4C5OA 3L8KA 2E4GA 4H2QA 5L46A 2ZZBA 4RG4A 4H4WA 4D04A 4APNA 1JNRA 5KWFA 3LB8A 1IUVA 1GTEA 5CQFA 4U2SA 4GR1A 1L9EA 3AE5A 1S3BA 2Z5YA 3LZXA 3SZFA 2BCPA 5C3JA 1KSSA 1IUUA 3L5OA 2RABA 1CC4A 3REDA 2XLPA 4FDCB 2WP5A 3H8LA 1MXTA 3T2KA 3FPZA 3QSEA 1HYUA 1B8SA 1NHPA 2EQ7A 3IF9A 4ICYA 4J2WA 2ZBWA 1H84A 3NK1X 4JY2A 1OJCA 2V3AA 4CRTA 1PBFA 1PJ5A 5KOXA 3L1RA 3NNEA 5KMSA 2XVHA 1S2YA 2BRYA 1XHCA 5JCKA 4X4JA 4J56A 1COYA 2A87A 4H4TA 2V61A 1OJTA 3PVCA 3SX6A 4A9WA 1NG3A 2WDQA 4RG3A 1GREA 2XFOA 1JNZA 5JRBA 1KSUA 5JCIA 1RYIA 2B9YA 3HYWA 3QSSA 2JAEA 1E7PA 4IV9A 3SZCA 1PBCA 2ZZCA 3DK8A 2A89A 2E1MA 5EOWA 3AYJA 1TYTA 2X99A 2R4EA 2VRLA 5KXJA 1LJ1A 5KVIA 1B37A 1H83A 4NNJA 2YQUA 5EB4A 2YVJA 2H89A 3T31A 1TDFA 3R9UA 4NTEA 4A6NB 5FS9A 4GAVA 5KMRA 4D03A 4PABA 5IPYA 1M64A 3AXBA 4UDRA 3AYIA 1K0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JCL A;  1KDG A;  1TDO A;  4Z25 A;  5BRT A;  2BAC A;  2BK5 A;  4U8L A;  4YSH A;  1ZY8 A;  2XVI A;  1BF3 A;  1M6I A;  4EQW A;  2VVM A;  3GMC A;  5HHF A;  2Q6U A;  2YLR A;  4B68 A;  2FJD A;  3M12 A;  3GDN A;  5GSN A;  5CKU A;  3UP5 A;  2DKH A;  3M13 A;  1PBD A;  2EQ9 A;  1B5Q A;  3SGL A;  3FBS A;  4LU6 A;  4CCQ A;  2GEW A;  3II4 A;  1GRA A;  2EQ8 A;  1JRX A;  3VRA A;  1E39 A;  2ACZ A;  2Y6Q A;  1ZKQ A;  1XPQ A;  5U25 A;  3V3O A;  4H2R A;  4XXG A;  2Z5X A;  3SFE A;  4BK1 A;  4NEV A;  3GRS A;  1D4D A;  4PAA A;  5KVH A;  4U2T A;  3H8I A;  4ZCD A;  1KNR A;  4H2P A;  4Z26 A;  2ZZ0 A;  2YG7 A;  4C77 A;  5BUK A;  3BHK A;  3NKS A;  3NTA A;  3DH9 A;  2XLS A;  4OPT A;  2EQ6 A;  4NZH A;  3KVE A;  1H82 A;  2F5Z A;  3ZYX A;  2R45 A;  5JCN A;  2WQY A;  3P4S A;  1CJ2 A;  3G5S A;  1GET A;  1CC2 A;  3WE0 A;  2XFN A;  1FCD A;  3O0H A;  3BNU A;  3C4N A;  3NHO X;  2BAB A;  4CY6 A;  1E1N A;  2WP6 A;  1GV4 A;  2I0Z A;  2VQ7 A;  5FMH A;  1Y0P A;  4I58 A;  4TM3 A;  5M0Z A;  1ZDL A;  2APG A;  2UZZ A;  4A65 A;  3CGC A;  3NTD A;  3PS9 A;  4TLX A;  1FEB A;  5KOW A;  1L0V A;  1NDA A;  2H88 A;  2XCG A;  2R4J A;  3NG7 X;  1LQT A;  3PO7 A;  3T37 A;  2WES A;  2CFY A;  4MJW A;  1GRT A;  2Y6R A;  4EQX A;  3UTF A;  1DOE A;  1CJC A;  2JBV A;  5BVA A;  1PBB A;  2VVL A;  3UTG A;  4OPU A;  4C74 A;  2XLU A;  3NGC X;  4Z24 A;  1F8R A;  2JB1 A;  4EQR A;  3UTH A;  1N4U A;  4H4Y A;  1ZOV A;  1NHS A;  1JEH A;  1PJ6 A;  3ALL A;  3NK2 X;  2WOW A;  2VQB A;  1D4C A;  3VR8 A;  3NH3 X;  5DBJ A;  2B9W A;  3DGH A;  1L9D A;  2B9X A;  2YR6 A;  3GYI A;  4GDP A;  3M0O A;  2WDR A;  1OJD A;  1CBO A;  1JOA A;  5C2T A;  3H4K A;  1H81 A;  1ZP0 A;  1LTX R;  4JY3 A;  1F3P A;  1BWC A;  3BHF A;  1OJ9 A;  3CNP A;  2YM1 A;  3GD3 A;  1Q1R A;  3NLC A;  3F8R A;  4FK1 A;  1MO9 A;  3ADA B;  3NRN A;  1D7Y A;  3AEC A;  3UKK A;  3DGZ A;  1RP0 A;  2VZ2 A;  2OAL A;  4H4R A;  1PS9 A;  4IA6 A;  4GDE A;  1BZL A;  3ATQ A;  3NIX A;  1FOH A;  2WP9 A;  3AWI A;  3COX A;  2XDO A;  2C70 A;  3QVP A;  4A7A A;  4YTN A;  3LJP A;  3JSK A;  3IHM A;  1LQU A;  3S61 A;  4FK1 C;  2BK4 A;  4EMI A;  4DSG A;  2QAE A;  1PJ7 A;  4Y4M A;  3ATR A;  2YLZ A;  2BYB A;  2GQF A;  2QA1 A;  3AEF A;  4M52 A;  3ICR A;  2R46 A;  3UOY A;  1VDC A;  4U8O A;  4EQS A;  3C96 A;  2GR1 A;  2BC0 A;  3AE9 A;  1KFY A;  3URH A;  1N4V A;  4U8K A;  1GPE A;  1K0I A;  3AD7 B;  2O9Z A;  2YG5 A;  1F8S A;  3UKH A;  4AP1 A;  2RGO A;  3AE3 A;  5EBK A;  3G5R A;  1GTH A;  4REK A;  4B67 A;  4BJY A;  4DSH A;  1Q9I A;  4BUR A;  2W0H A;  5FS6 A;  4GRT A;  3AB1 A;  4DNA A;  2OA1 A;  2GAH B;  3BI5 A;  4JNQ A;  3CGD A;  2X8G A;  3DME A;  1CL0 A;  3UP4 A;  2YLW A;  1EL8 A;  2GAG B;  3IHG A;  4HA6 A;  4YT0 A;  2YR5 A;  3CGE A;  1IUW A;  4GUV A;  3Q6J A;  5ER0 A;  1H86 A;  2NVK X;  2CVJ A;  4WX1 A;  3SQP A;  3UTE A;  5U1O A;  2RGJ A;  3DJJ A;  3IWA A;  2IVE A;  1DOC A;  3AE2 A;  2XVJ A;  3AEG A;  2AR8 A;  4IVO B;  2BA9 A;  2C64 A;  4UDQ A;  4ECH A;  5HY5 A;  1D5T A;  1P2E A;  2WHD A;  4UP3 A;  3P4Q A;  2BC1 A;  1LPF A;  1EBD A;  2YR4 A;  3AD8 B;  4LII A;  3GRT A;  2GV8 A;  4H4X A;  3EF6 A;  1PHH A;  1E6E A;  3CIR A;  3CND A;  3DJE A;  3NT6 A;  4EIQ A;  1GER A;  3CGB A;  1REO A;  3OC4 A;  2GMJ A;  2GF3 A;  2J3N A;  3B3R A;  3S5W A;  2FJA A;  3AE1 A;  4H4S A;  3GWD A;  3EAN A;  1SEZ A;  4OPG A;  4J57 A;  4OPI A;  3UOV A;  1CF3 A;  1EL9 A;  1LVL A;  1PBE A;  5J60 A;  4EM3 A;  3P4P A;  3DJG X;  2OLO A;  3ALM A;  1FL2 A;  3UOX A;  1EL5 A;  3LAD A;  2BCG G;  4Z2U A;  4YWO A;  4FX9 A;  2WU5 A;  2XVF A;  4USQ A;  2IVD A;  4JDR A;  2GR0 A;  3E1T A;  3LZW A;  4Z43 A;  4YSY A;  2BS2 A;  4B1B A;  1GT8 A;  4YKG A;  2FJE A;  1PN0 A;  1CHU A;  4P9S A;  1BGN A;  1DOD A;  2Q0K A;  2C3C A;  3QFB A;  2R0G A;  3AE8 A;  4OCG A;  3I6D A;  2CDU A;  4E0V A;  4AP3 A;  2AQJ A;  4BK2 A;  2C73 A;  2E5V A;  5HXI A;  3F8D A;  2XFQ A;  2R0P A;  3ZDN A;  1GRB A;  3ITJ A;  2XFU A;  4YKF A;  4BK3 A;  2PHH A;  1PDH A;  4K22 A;  4AOX A;  3AEE A;  3AEB A;  3K30 A;  2YLS A;  3RHA A;  1NHR A;  4CNJ A;  4TLZ A;  1DNC A;  1H7W A;  4JNA A;  2TPR A;  1B4V A;  2HQM A;  4B69 A;  2B7R A;  4OPC A;  2BXR A;  3C4A A;  1E1M A;  2C72 A;  3NYC A;  1CJ3 A;  3UKP A;  4A6N A;  2FJB A;  4YSX A;  5FS8 A;  2BK3 A;  1F6M A;  4TM0 A;  3UKQ A;  2XFP A;  4EMJ A;  3DK4 A;  3CNJ A;  4J36 A;  1YQZ A;  2WPE A;  1XAN A;  1IUS A;  4H4P A;  3NN0 X;  4Y4N A;  3UKF A;  3UKA A;  3K7T A;  4X9M A;  3LXD A;  1PXB A;  1DJQ A;  2WPC A;  2VOU A;  3KA7 A;  2Q7V A;  3F8P A;  4OPD A;  4N9X A;  1ONF A;  4USR A;  1ZX9 A;  3V76 A;  1YQ3 A;  3AYL A;  4X9N A;  4Y4L A;  4KX6 A;  2C67 A;  3CTY A;  4CCR A;  1CC6 A;  2R0C A;  1KNP A;  1H7X A;  2C75 A;  2WEU A;  3KPF A;  3QJ4 A;  4K5R A;  3NYF A;  4O5Q A;  4U8N A;  2V5Z A;  1IUX A;  4CNK A;  2WPF A;  4B65 A;  2GR2 A;  2OAM A;  4XWZ A;  1S2Q A;  3FIM B;  1LV0 A;  2JK6 A;  2V6O A;  4XWR A;  1PXA A;  2BS4 A;  1FEA A;  3DJD A;  1K0L A;  3KKJ A;  4NTD A;  3GWF A;  1W4X A;  3OZ2 A;  4J33 A;  5BUL A;  2WS3 A;  3KU9 A;  3ALJ A;  1RSG A;  4H4Q A;  2YLX A;  3ICS A;  2C3D A;  2YAU A;  1Y56 A;  1NPX A;  4IA5 A;  1O5W A;  3HZL A;  3K7Q X;  3GSI A;  5LV9 A;  1TDK A;  1S3E A;  4Z2R A;  1ZMD A;  2B7S A;  3SM8 A;  2WBA A;  1ZOY A;  3BNM A;  3V3N A;  3EAO A;  1X31 B;  2C76 A;  2JB2 A;  1P2H A;  3QVR A;  1DJN A;  4Z2T A;  1MOK A;  1GEU A;  1BGJ A;  1GND A;  1JRY A;  1TDN A;  1Z6L A;  3GMB A;  4A5L A;  4U8I A;  4YSZ A;  1JRZ A;  2GB0 A;  1QJD A;  2OLN A;  4H4V A;  1YQ4 A;  3NK0 X;  4EMW A;  2PYX A;  2YG6 A;  2WOV A;  4B64 A;  2C7G A;  4H7U A;  3FMW A;  1O94 A;  5TR3 A;  4B63 A;  3QSM A;  1UKV G;  5GRT A;  3KD9 A;  2BS3 A;  2A8X A;  4CBQ A;  1V59 A;  4EIP A;  5EB5 A;  3VQR A;  4ADW A;  4C3X A;  1Y56 B;  3AE4 A;  5IQ1 A;  3CNS A;  4CY8 A;  3NYE A;  3K7M X;  2NPX A;  3VRD B;  5JCM A;  1GES A;  3CPH G;  4YTP A;  1NG4 A;  4RSL A;  2B76 A;  4YTM A;  4BV6 A;  1GRH A;  5FS7 A;  3BI4 A;  4BJZ A;  3IC9 A;  4I59 A;  1K4Q A;  1DOB A;  3FG2 P;  1PXC A;  1ZMC A;  4GCM A;  4U8J A;  4K7Z A;  4DGK A;  1KF6 A;  4GF7 A;  5HYM A;  3RP7 A;  4K2X A;  3GD4 A;  4OVI A;  2ARD A;  3AD9 B;  2YM2 A;  1QLB A;  4KPR A;  4H4Z A;  2GH5 A;  3DK9 A;  2X8C A;  3GDP A;  1EL7 A;  2GMH A;  1JU2 A;  4EM4 A;  3VRB A;  1D7L A;  4TM4 A;  1F8W A;  1OJA A;  1YKJ A;  4U8M A;  3RP8 A;  1DXL A;  2YG3 A;  3AE6 A;  4J31 A;  3KLJ A;  2JKC A;  3AEA A;  1CJ4 A;  1Q1W A;  2YG4 A;  2C66 A;  3BI2 A;  3G5Q A;  4K8D A;  3I3L A;  2QA2 A;  2RGH A;  5J7X A;  4ZN0 A;  1NAA A;  2YVF A;  4NTC A;  4AT0 A;  4C3Y A;  1QO8 A;  3SFD A;  3QFA A;  1GOS A;  1N1P A;  3CNT A;  4YXD A;  1NEK A;  2JB3 A;  3EPT A;  5M10 A;  3D1C A;  4NEW A;  4K5S A;  2DKI A;  2XYO A;  3GYJ A;  2XLR A;  3AED A;  1NHQ A;  2QCU A;  2XVE A;  1YY5 A;  3CPJ G;  4TM1 A;  4H4U A;  2C65 A;  3UOZ A;  4Z44 A;  4J34 A;  1FEC A;  1L9C A;  1TYP A;  1GRG A;  2WU2 A;  3D8X A;  1D4E A;  3UKL A;  1TDE A;  2GQW A;  1GXF A;  3CPI G;  3RP6 A;  3P4R A;  5KRQ A;  1AOG A;  3P1W A;  4LA1 A;  4O5U A;  4ZCC A;  1VG0 A;  3RNM A;  4AT2 A;  2VVL G;  3ICT A;  4H2N A;  3P9U A;  2X50 A;  2CUL A;  2GVC A;  2BXS A;  1IJH A;  4AOS A;  2WDV A;  3DA1 A;  1IUT A;  2TMD A;  1E1L A;  2GRT A;  3NN6 X;  3LOV A;  2VRM A;  1H6V A;  1XDI A;  1ELI A;  2AAQ A;  5U63 A;  4B66 A;  2WET A;  2R9Z A;  2X8H A;  2YWL A;  1VG9 A;  2XLT A;  1ZK7 A;  1VQW A;  2Q0L A;  2WOI A;  1O95 A;  1BKW A;  4HB9 A;  1E1K A;  4UDP A;  4WCT A;  1N4W A;  4A99 A;  4H50 A;  2FBW A;  3VR9 A;  1GRF A;  2YLT A;  3ABV A;  1GAL A;  4U2L A;  1TRB A;  3AE7 A;  3B6D A;  5IQ4 A;  1VRQ B;  1GSN A;  4OPL A;  4JQ9 A;  3ISH A;  3UCL A;  2X3N A;  2IID A;  4JN9 A;  3Q9T A;  2GR3 A;  2V3B A;  4A79 A;  2V60 A;  4IVM B;  4U8P A;  3CN8 A;  1NEN A;  2YVG A;  4C5O A;  3L8K A;  2E4G A;  4H2Q A;  5L46 A;  2ZZB A;  4RG4 A;  4H4W A;  4D04 A;  4APN A;  1JNR A;  5KWF A;  3LB8 A;  1IUV A;  1GTE A;  5CQF A;  4U2S A;  4GR1 A;  1L9E A;  3AE5 A;  1S3B A;  2Z5Y A;  3LZX A;  5C3J A;  2BCP A;  1KSS A;  1IUU A;  2RAB A;  1CC4 A;  3RED A;  2XLP A;  4FDC B;  2WP5 A;  3H8L A;  1MXT A;  3FPZ A;  3QSE A;  1HYU A;  1B8S A;  1NHP A;  2EQ7 A;  3IF9 A;  4ICY A;  4J2W A;  2ZBW A;  1H84 A;  3NK1 X;  4JY2 A;  1OJC A;  2V3A A;  4CRT A;  1PBF A;  1PJ5 A;  5KOX A;  3L1R A;  3NNE A;  2XVH A;  1S2Y A;  1XHC A;  5JCK A;  4X4J A;  4J56 A;  1COY A;  2A87 A;  4H4T A;  2V61 A;  1OJT A;  3PVC A;  4A9W A;  1NG3 A;  2WDQ A;  4RG3 A;  1GRE A;  2XFO A;  1JNZ A;  1KSU A;  5JCI A;  1RYI A;  2B9Y A;  3QSS A;  2JAE A;  1E7P A;  4IV9 A;  1PBC A;  2ZZC A;  3DK8 A;  2A89 A;  2E1M A;  5EOW A;  3AYJ A;  1TYT A;  2X99 A;  2R4E A;  2VRL A;  5KXJ A;  1LJ1 A;  5KVI A;  1B37 A;  1H83 A;  5EB4 A;  2YQU A;  2YVJ A;  2H89 A;  1TDF A;  3R9U A;  4NTE A;  4A6N B;  5FS9 A;  4D03 A;  4PAB A;  5IPY A;  1M64 A;  3AXB A;  4UDR A;  3AYI A;  1K0J A; 
#chains in the Genus database with same CATH topology
 2OVL A;  4Z25 A;  5BRT A;  2BRA A;  1ZY8 A;  1M6I A;  4EQW A;  3DG3 A;  2Q6U A;  3OW1 A;  3GDN A;  5FJP A;  5CKU A;  1ECQ A;  3NFU A;  3RCY A;  4LU6 A;  4CCQ A;  1JRX A;  1XPQ A;  2Z5X A;  5KVH A;  1X2H A;  3H8I A;  3UJR A;  4DX3 A;  3PFR A;  3BHK A;  3NTA A;  2XLS A;  3KVE A;  1H82 A;  3R0K A;  5FJU A;  3G5S A;  3NO1 A;  3FV9 A;  3SYI A;  2PTW A;  2WP6 A;  2I0Z A;  2VQ7 A;  5FMH A;  5M0Z A;  2UZZ A;  3TOY A;  3FJ4 A;  3FVD A;  5KOW A;  1L0V A;  3PO7 A;  2XCG A;  5G5G B;  2CFY A;  4MJW A;  1GRT A;  4M6U A;  2JBV A;  5BVA A;  4OPU A;  2XLU A;  4Z24 A;  4EQR A;  4H4Y A;  2XH0 A;  3DIP A;  3MQT A;  2B9X A;  3GYI A;  3M0O A;  3HW2 A;  5C2T A;  1H81 A;  1LTX R;  4IT1 A;  3BHF A;  4FK1 A;  2ZC8 A;  1MO9 A;  2PU0 A;  3NRZ B;  4H4R A;  4IA6 A;  1BZL A;  2WP9 A;  2C70 A;  3R10 A;  1LQU A;  4Y4M A;  3ATR A;  3AEF A;  4M52 A;  4U8O A;  3C96 A;  4G9K A;  2GR1 A;  2BC0 A;  3AE9 A;  1K0I A;  2O9Z A;  3AE3 A;  4BJY A;  1GTH A;  4B67 A;  4X2P A;  3JZU A;  5FS6 A;  4G8T A;  4DNA A;  2GAH B;  3BI5 A;  3VC6 A;  3UJE A;  4KT2 A;  1IUW A;  4GUV A;  3UTE A;  3SQP A;  2RGJ A;  2XGZ A;  3NXL A;  3RO6 A;  2IVE A;  3AEG A;  4TVY A;  4IVO B;  2BA9 A;  1D5T A;  1P2E A;  1EBD A;  3AD8 B;  3GO2 A;  5EB4 A;  4H4X A;  1PHH A;  3UXL A;  1E6E A;  2CHR A;  2OFJ A;  4EIQ A;  1GER A;  2GMJ A;  1REO A;  3S5W A;  3MKC A;  2GF3 A;  1IYX A;  2J3N A;  3B3R A;  2FJA A;  3P93 A;  1PBE A;  2OQH A;  1FL2 A;  3ALM A;  3LAD A;  4J1O A;  2WU5 A;  3LZW A;  3IJI A;  2FJE A;  1PN0 A;  4YSY A;  2C3C A;  5FJO A;  2R0G A;  4BK2 A;  2C73 A;  5HXI A;  1V97 A;  3ZDN A;  2FKP A;  2XFU A;  4DXK A;  3VA8 A;  2YLS A;  3QKE A;  4B69 A;  4DN1 A;  2BXR A;  3C4A A;  1E1M A;  4A6N A;  1FFV C;  5KNL A;  2BK3 A;  3UKQ A;  3CNJ A;  1YQZ A;  1XAN A;  3UKF A;  3K7T A;  1PXB A;  2VOU A;  3SY4 A;  1WUE A;  4OPD A;  5G5H B;  3CTY A;  2PGW A;  4K5R A;  2WPF A;  2GR2 A;  3NVZ B;  2OAM A;  4XWZ A;  1LV0 A;  2JK6 A;  2BS4 A;  2QJM A;  1K0L A;  1W4X A;  1MNS A;  4J33 A;  4JHM A;  2WS3 A;  4H4Q A;  2YLX A;  2C3D A;  1OEP A;  2YAU A;  1Y56 A;  4IA5 A;  1MDR A;  4Z17 A;  5LV9 A;  1JRO A;  1S3E A;  1ZMD A;  3IK4 A;  2WBA A;  1ZOY A;  3EAO A;  1X31 B;  2C76 A;  4A5L A;  1Z6L A;  3GMB A;  4U8I A;  4YSZ A;  4TVW A;  1YEY A;  4HCL A;  4H4V A;  3NK0 X;  4EMW A;  2PYX A;  4H7U A;  1O94 A;  5GRT A;  3KD9 A;  4HCD A;  3VRD B;  4YTP A;  4RSL A;  3PG6 A;  4A35 A;  4ZOH B;  4U8J A;  4Z1Y A;  4K7Z A;  4GF7 A;  1QLB A;  2DW7 A;  4JN7 A;  1D7L A;  2GGH A;  1CJ4 A;  5J7X A;  1NAA A;  4IL0 A;  4C3Y A;  3CNT A;  1N1P A;  3SN0 A;  1PDZ A;  3EPT A;  3H7V A;  3D1C A;  2XYO A;  3H8A A;  1NHQ A;  2QCU A;  3DG6 A;  3EEZ A;  1L9C A;  1TYP A;  1GRG A;  3D8X A;  3UKL A;  2GQW A;  3CPI G;  3MUC A;  3UCD A;  3P4R A;  4LA1 A;  3P3B A;  4ZCC A;  3ICT A;  2X50 A;  1E1L A;  2GRT A;  1H6V A;  2AAQ A;  2R9Z A;  4G6H A;  1BKW A;  2NQL A;  1E1K A;  4A99 A;  4WCT A;  4II3 A;  3VR9 A;  4U2L A;  5IQ4 A;  3ISH A;  1JCT A;  3UGV A;  3P0W A;  3L8K A;  3SN1 A;  2DW6 A;  2MNR A;  2ZZB A;  4H4W A;  4APN A;  5KWF A;  1IUV A;  5C3J A;  5IDZ A;  3MZN A;  1KSS A;  3RED A;  4FDC B;  1MXT A;  3FPZ A;  3VCN A;  1PBF A;  5KOX A;  1XHC A;  4X4J A;  2QJN A;  4J56 A;  4H4T A;  1OJT A;  1N63 C;  3NS1 B;  2XH4 A;  2W55 A;  1KSU A;  5JRB A;  5JCI A;  3OP2 A;  3QLD A;  5EOW A;  3AYJ A;  1TYT A;  1R6W A;  1ELS A;  1JDF A;  4MKS A;  2YVJ A;  4NTE A;  4GAV A;  3CB3 A;  2HNE A;  2BAC A;  3H70 A;  3GMC A;  2FJD A;  3H12 A;  3M13 A;  1PBD A;  1R0M A;  1B5Q A;  3EUB 3;  2GEW A;  3VRA A;  3VFC A;  2GGJ A;  3GRS A;  4G73 A;  4ROP A;  4PAA A;  1KNR A;  4H2P A;  2AKM A;  1W6T A;  3PWI A;  2P8C A;  3T9P A;  1RM6 B;  2WQY A;  3T2Z A;  3BNU A;  2E3T A;  4CY6 A;  1BQG A;  4II2 A;  4I58 A;  3PS9 A;  2XH2 A;  1NDA A;  2R4J A;  3NG7 X;  3A7R A;  4JN8 A;  1PBB A;  1N4U A;  2E5A A;  1NHS A;  1P43 A;  1PJ6 A;  3VR8 A;  2B9W A;  4GDP A;  2WDR A;  1OJD A;  1CBO A;  5BOE A;  2PA6 A;  2P0I A;  1OJ9 A;  3CNP A;  1Q1R A;  4HNL A;  3ZVH B;  3SN4 A;  1FHV A;  3AEC A;  3UKK A;  3S47 A;  4GDE A;  1FOH A;  1ONE A;  2XDO A;  4A7A A;  3HPF A;  3I6E A;  3SZW A;  2YLZ A;  4HCH A;  2BYB A;  2GQF A;  2QA1 A;  3ICR A;  4EQS A;  3ES7 A;  3URH A;  1GPE A;  3AD7 B;  2YG5 A;  2RDX A;  3R0U A;  2RGO A;  2I5Q A;  3MY9 A;  4BUR A;  4GRT A;  3BSM A;  3CGD A;  2X8G A;  3DER A;  3IHG A;  4HA6 A;  4YT0 A;  2OKT A;  3CGE A;  5ER0 A;  3DJJ A;  3R1Z A;  5HY5 A;  4UP3 A;  2YR4 A;  1LPF A;  2GV8 A;  2OZ8 A;  3CND A;  3CIR A;  2AKZ A;  3TW9 A;  1EC7 A;  3AE1 A;  3GWD A;  1CF3 A;  3ZLG A;  4EM3 A;  1EL5 A;  4Z2U A;  4YWO A;  4FX9 A;  2XVF A;  4USQ A;  2IVD A;  2QQ6 A;  4Z43 A;  4YKG A;  2PTZ A;  4P9S A;  1CHU A;  1BGN A;  3QFB A;  3AE8 A;  2PTY A;  4AP3 A;  3F8D A;  1E9I A;  2R0P A;  3T4W A;  4YKF A;  4BK3 A;  2PHH A;  1PDH A;  4K22 A;  7ENL A;  4CNJ A;  3RHA A;  2TPR A;  4B68 A;  3UKP A;  4OPC A;  2C72 A;  2FJB A;  1F6M A;  4TM0 A;  3ES8 A;  4EMJ A;  2FYM A;  3Q4D A;  4J36 A;  3EKG A;  3UKA A;  1SJC A;  1DJQ A;  1FIQ B;  4N9X A;  1ZX9 A;  1YQ3 A;  4Y4L A;  4KX6 A;  4CCR A;  1KNP A;  1H7X A;  3KPF A;  2WEU A;  1S2Q A;  4A3R A;  2V6O A;  1FEA A;  3DJD A;  4NTD A;  3GWF A;  1PDY A;  3RRA A;  2PPG A;  1WUF A;  3K7Q X;  3DDM A;  4Z2R A;  2B7S A;  3SM8 A;  4E5T A;  3BNM A;  3V3N A;  1SB3 B;  1DJN A;  3RR1 A;  1GEU A;  4DWD A;  2GGG A;  3SZ0 A;  4B64 A;  4GGB A;  1MDL A;  1H2I A;  5TR3 A;  4B63 A;  2BS3 A;  2A8X A;  1VDV A;  5EB5 A;  4C3X A;  5IQ1 A;  1GES A;  3CPH G;  3NVV B;  4YTM A;  3DFH A;  3ZVI A;  1GRH A;  4BJZ A;  1DOB A;  1PXC A;  4GCM A;  1KF6 A;  1NU5 A;  2W54 A;  3RP7 A;  3N6H A;  3GD4 A;  1WYG A;  3DK9 A;  2X8C A;  3GDP A;  1EL7 A;  3VRB A;  1YKJ A;  4ENL A;  1DXL A;  3KLJ A;  2HZG A;  2C66 A;  3G5Q A;  1KCZ A;  4K8D A;  3I3L A;  2RGH A;  4ZN0 A;  2GGI A;  1QO8 A;  3TTE A;  3QFA A;  1NEK A;  4K5S A;  3AED A;  3B9J B;  4MMW A;  1YY5 A;  3CPJ G;  3MWC A;  4H4U A;  3UOZ A;  4J34 A;  3BJS A;  2GL5 A;  2WU2 A;  3RGT A;  1TDE A;  3RP6 A;  2PP1 A;  1AOG A;  4O5U A;  4AT2 A;  1FHU A;  3P9U A;  4AOS A;  2TMD A;  4K8G A;  2VRM A;  1ELI A;  2X8H A;  2XLT A;  4HB9 A;  2P3Z A;  1O95 A;  1TKK A;  4H50 A;  3ABV A;  3S5S A;  3R07 C;  1VRQ B;  4HN8 A;  4IVM B;  3DGB A;  4U8P A;  4H19 A;  3CN8 A;  5L46 A;  4D04 A;  3U9I A;  3LB8 A;  3R25 A;  2QDE A;  5CQF A;  3IJL A;  5J04 A;  1CC4 A;  2XLP A;  2WP5 A;  3T2K A;  3Q45 A;  1HYU A;  4ICY A;  1NHP A;  3IF9 A;  4J2W A;  3K1G A;  4CRT A;  3AMZ A;  2QGY A;  3NNE A;  4E4U A;  2A87 A;  3PVC A;  1NG3 A;  1GRE A;  1JNZ A;  1E7P A;  4IV9 A;  3SZC A;  2ZZC A;  3V5C A;  3DK8 A;  3KUM A;  1H83 A;  1B37 A;  1EBG A;  4UDR A;  3AYI A;  1TZZ A;  5JCL A;  1KDG A;  3QN3 A;  1TDO A;  2BK5 A;  4YSH A;  1BF3 A;  2VVM A;  3M12 A;  5GSN A;  2HXT A;  3UP5 A;  2EQ9 A;  3TWB A;  3FBS A;  3II4 A;  2ACZ A;  1ZKQ A;  3PK7 A;  5U25 A;  1TE6 A;  3V3O A;  2XSX A;  4H2R A;  4XXG A;  3HYX A;  4BK1 A;  4NEV A;  4U2T A;  4ZCD A;  4Z26 A;  2YG7 A;  4C77 A;  3D9X A;  3NKS A;  4H83 A;  2EQ6 A;  4NZH A;  2F5Z A;  6ENL A;  5JCN A;  1CJ2 A;  1BKH A;  1F9C A;  3T2Y A;  3WE0 A;  2XFN A;  3O0H A;  4TM3 A;  1Y0P A;  3FYY A;  3GY1 A;  2APG A;  2PGE A;  3CGC A;  4KWS A;  1KN0 A;  2OG9 A;  1FEB A;  3T37 A;  1LQT A;  2Y6R A;  3UTF A;  3CXO A;  1DOE A;  1CJC A;  4C74 A;  3NGC X;  1F8R A;  2JB1 A;  3UTH A;  1ZOV A;  1JEH A;  4GIR A;  2POD A;  2WOW A;  2VQB A;  1D4C A;  3NH3 X;  2OPJ A;  3SSZ A;  3H4K A;  1STZ A;  1ZP0 A;  1F3P A;  1BWC A;  1N62 C;  3NLC A;  3GD3 A;  3ADA B;  3NRN A;  3DGZ A;  4H1Z A;  3ATQ A;  3AWI A;  4YTN A;  2W3R A;  3LJP A;  3JSK A;  3UJS A;  2BK4 A;  4EMI A;  2QAE A;  2R46 A;  3ZLH A;  3UOY A;  3TWA A;  1KFY A;  4U8K A;  3IJQ A;  4HPN A;  1F8S A;  4AP1 A;  4DSH A;  1Q9I A;  5FJT A;  4JNQ A;  3DME A;  1CL0 A;  3UP4 A;  4EWJ A;  2YLW A;  2GAG B;  3Q6J A;  2NVK X;  2CVJ A;  5U1O A;  1KKR A;  3IWA A;  3AM9 A;  2XVJ A;  4UDQ A;  4ECH A;  2BC1 A;  4LII A;  3GRT A;  3DJE A;  4DYE A;  3JW7 A;  3OC4 A;  2AL1 A;  1NEL A;  4OPI A;  1LVL A;  5J60 A;  3DJG X;  2OLO A;  3DFY A;  3CT2 A;  2GR0 A;  3E1T A;  2OZ3 A;  2BS2 A;  3VC5 A;  2Q0K A;  3I6D A;  2CDU A;  1GRB A;  3T0K A;  4GME A;  3AEE A;  3SBF A;  1DNC A;  1H7W A;  4JNA A;  3NYC A;  1CJ3 A;  1EC8 A;  5FS8 A;  5BOF A;  2XFP A;  3DK4 A;  2WPE A;  4X9M A;  4G6G A;  3KA7 A;  1ONF A;  3BOX A;  3V76 A;  3AYL A;  2C67 A;  1CC6 A;  2R0C A;  3V4B A;  3NYF A;  4CNK A;  4B65 A;  3KKJ A;  5BUL A;  3N4E A;  3ALJ A;  1NPX A;  3GSI A;  2JB2 A;  1P2H A;  1BGJ A;  4M0X A;  2OQY A;  2GGE A;  1JRZ A;  2GB0 A;  2OLN A;  2QDD A;  2C7G A;  1KKO A;  4FP1 A;  3FMW A;  3QSM A;  1UKV G;  3MSY A;  4EIP A;  4CBQ A;  4ADW A;  3CNS A;  3K7M X;  2NPX A;  4F4R A;  2OLA A;  2B76 A;  1N5X A;  4I59 A;  3I4K A;  1K4Q A;  3FG2 P;  4DGK A;  5FJR A;  2OZT A;  4K2X A;  1N5W C;  2ARD A;  3AD9 B;  4KPR A;  2GH5 A;  2GMH A;  1JU2 A;  4TM4 A;  1F8W A;  1OJA A;  1S7M A;  4U8M A;  3RP8 A;  1MRA A;  1Q1W A;  3BI2 A;  1SJA A;  2QA2 A;  2YVF A;  3U4F A;  4NTC A;  3SFD A;  1GOS A;  3AN1 A;  3QTP A;  5M10 A;  2DKI A;  3GYJ A;  2XLR A;  4TM1 A;  2ZAD A;  2C65 A;  3V3W A;  1FEC A;  3N6J A;  1D4E A;  3N4F A;  1GXF A;  2P8B A;  5KRQ A;  3TJ4 A;  3NVY B;  1VG0 A;  3OTR A;  3RNM A;  4H2N A;  3JVA A;  1MUC A;  2CUL A;  2GVC A;  1IJH A;  2WDV A;  3DA1 A;  4YWS A;  3NN6 X;  4H2H A;  1XDI A;  5U63 A;  4B66 A;  2WET A;  2YWL A;  1VQW A;  2Q0L A;  1X2G A;  1N4W A;  1JPD X;  2YLT A;  4IL2 A;  1GAL A;  1TRB A;  3B6D A;  4GAP A;  2IID A;  4JN9 A;  3Q9T A;  3B97 A;  4A79 A;  2V60 A;  2C4C A;  4IP4 A;  2YVG A;  2E4G A;  4J3Z A;  4RG4 A;  4FI4 A;  4U2S A;  1L9E A;  3AE5 A;  3SZF A;  4KEM A;  2BCP A;  2RAB A;  3H8L A;  1JRP A;  3D47 A;  3QSE A;  1B8S A;  1H84 A;  3NK1 X;  4JY2 A;  3OPS A;  2AL2 B;  2V3A A;  2OX4 A;  3L1R A;  5KMS A;  2XVH A;  1S2Y A;  1COY A;  4GFI A;  4A9W A;  1VQZ A;  2XFO A;  1RYI A;  3HYW A;  3QSS A;  1PBC A;  2E1M A;  2X99 A;  2R4E A;  5KXJ A;  1RVK A;  5KVI A;  2H89 A;  3R9U A;  4A6N B;  2PP0 A;  3DES A;  4D03 A;  3CYJ A;  1M64 A;  3AXB A;  2YM1 A;  4IHC A;  3NZG A;  4U8L A;  2P88 A;  2XVI A;  1FFU C;  4DHG A;  1KD0 A;  2YLR A;  5HHF A;  2DKH A;  3SGL A;  1GRA A;  2EQ8 A;  1E39 A;  2Y6Q A;  4GIS A;  3SXI A;  3SFE A;  1D4D A;  2ZZ0 A;  3THU A;  5BUK A;  3DH9 A;  2PSN A;  4OPT A;  3TQP A;  3CK5 A;  3ZYX A;  2R45 A;  3P4S A;  2PTX A;  3DG7 A;  3UJ2 A;  1GET A;  1CC2 A;  2PMQ A;  1FCD A;  3C4N A;  3NHO X;  2BAB A;  3CMM A;  1E1N A;  1GV4 A;  5KMQ A;  3FCP A;  1ZDL A;  4A65 A;  3NTD A;  3CXB A;  4TLX A;  3KPK A;  2H88 A;  3RIT A;  2WES A;  2AL2 A;  4EQX A;  2OO6 A;  2VVL A;  3UTG A;  3HYV A;  3I6T A;  3FXG A;  4HYR A;  2ONE A;  3ALL A;  3NK2 X;  5DBJ A;  2XH7 A;  3DGH A;  1L9D A;  2YR6 A;  1JOA A;  4JY3 A;  3TJI A;  3F8R A;  3R11 A;  1XS2 A;  1D7Y A;  1RP0 A;  2VZ2 A;  2OAL A;  1PS9 A;  3NIX A;  3COX A;  3QVP A;  3IHM A;  3S61 A;  4FK1 C;  4DSG A;  1PJ7 A;  2PU1 A;  1ZXI C;  1VDC A;  1N4V A;  3UKH A;  4REK A;  5EBK A;  3G5R A;  2QVH A;  3V5F A;  1N60 C;  2W0H A;  4HNC A;  3AB1 A;  2OA1 A;  1EL8 A;  2YR5 A;  1H86 A;  4WX1 A;  1DOC A;  3AE2 A;  2PP3 A;  1JPM A;  2AR8 A;  3T14 A;  2C64 A;  3VCC A;  2WHD A;  3P4Q A;  2PS2 A;  4YSX A;  3EF6 A;  2PCE A;  3NT6 A;  2QJJ A;  3CGB A;  3GC2 A;  4KPL A;  3D46 A;  4H4S A;  4OPG A;  3EAN A;  1SEZ A;  3UOV A;  4J57 A;  1EL9 A;  3P4P A;  3UOX A;  2BCG G;  4JDR A;  4K2S A;  4B1B A;  1GT8 A;  3T8Q A;  1DOD A;  4E0V A;  4OCG A;  2AQJ A;  2E5V A;  2XFQ A;  3ITJ A;  4AOX A;  3AEB A;  3K30 A;  3VDG A;  1NHR A;  3STP A;  3ZLF A;  4TLZ A;  1B4V A;  2HQM A;  2B7R A;  5KMP A;  1P48 A;  4GYP A;  1IUS A;  4H4P A;  3NN0 X;  4Y4N A;  3LXD A;  2WPC A;  3A7U A;  2Q7V A;  3F8P A;  3ETR B;  4USR A;  4X9N A;  4ZCW A;  2C75 A;  4U8N A;  4O5Q A;  2HXU A;  3QJ4 A;  1EC9 A;  2V5Z A;  1IUX A;  3FIM B;  2MUC A;  4XWR A;  1T3Q C;  1PXA A;  1EBH A;  3OZ2 A;  2POZ A;  3KU9 A;  1RSG A;  3ICS A;  1O5W A;  3HZL A;  1TDK A;  3QVR A;  1SJB A;  2O56 A;  1MOK A;  4Z2T A;  1TDN A;  1GND A;  1JRY A;  1QJD A;  1YQ4 A;  1XPY A;  2YG6 A;  2WOV A;  4G7F A;  3OZY A;  4GGH A;  4A6G A;  1V59 A;  3VQR A;  1Y56 B;  3AE4 A;  2GDQ A;  4CY8 A;  3NYE A;  4E8G A;  3GYX A;  3PWG A;  5JCM A;  2GSH A;  1NG4 A;  4BV6 A;  5FS7 A;  4NWZ A;  3BI4 A;  3IC9 A;  1ZMC A;  4E4F A;  5HYM A;  3CAW A;  4OVI A;  4GYP C;  2YM2 A;  4H4Z A;  1DTN A;  4EM4 A;  3SR6 B;  3OZM A;  3UCC A;  2YG3 A;  3AE6 A;  4J31 A;  2JKC A;  3AEA A;  2YG4 A;  5EU9 A;  4AT0 A;  4YXD A;  2JB3 A;  3UXK A;  4NEW A;  3NVW B;  2XVE A;  4Z44 A;  4G74 A;  3DEQ A;  3ENL A;  3P1W A;  3TCS A;  2VVL G;  3UJF A;  3T6C A;  3A7A A;  2BXS A;  1IUT A;  3LOV A;  1VG9 A;  1ZK7 A;  3ZVH A;  2WOI A;  2W3S A;  4UDP A;  2FBW A;  1GRF A;  3SJN A;  3AE7 A;  4K1W A;  1GSN A;  4OPL A;  4JQ9 A;  3UCL A;  2X3N A;  2GR3 A;  2V3B A;  4MGG A;  4E6M A;  1NEN A;  4C5O A;  4H2Q A;  1L8P A;  1JNR A;  4ZA0 A;  4IP5 A;  1GTE A;  4GR1 A;  1S3B A;  2Z5Y A;  3LZX A;  3GD6 A;  1IUU A;  3L5O A;  3QPE A;  3SQS A;  2EQ7 A;  2ZBW A;  1OJC A;  1PJ5 A;  2BRY A;  5JCK A;  2V61 A;  3SX6 A;  4IZG A;  2WDQ A;  4RG3 A;  2B9Y A;  1SJD A;  2JAE A;  1N61 C;  1FO4 A;  2A89 A;  2VRL A;  1LJ1 A;  4NNJ A;  2YQU A;  3T31 A;  1TDF A;  5FS9 A;  5KMR A;  3HRD C;  4PAB A;  5IPY A;  5ENL A;  1K0J A; 
#chains in the Genus database with same CATH homology
 5JCL A;  1KDG A;  1TDO A;  4Z25 A;  5BRT A;  2BAC A;  2BK5 A;  2BRA A;  4U8L A;  4YSH A;  1ZY8 A;  2XVI A;  1BF3 A;  1M6I A;  4EQW A;  2VVM A;  3GMC A;  5HHF A;  2Q6U A;  2YLR A;  4B68 A;  2FJD A;  3M12 A;  3GDN A;  5GSN A;  5CKU A;  3UP5 A;  2DKH A;  3M13 A;  1PBD A;  2EQ9 A;  1B5Q A;  3SGL A;  3FBS A;  4LU6 A;  4CCQ A;  2GEW A;  3II4 A;  1GRA A;  2EQ8 A;  1JRX A;  3VRA A;  1E39 A;  2ACZ A;  2Y6Q A;  1ZKQ A;  1XPQ A;  5U25 A;  3SXI A;  3V3O A;  4H2R A;  4XXG A;  2Z5X A;  3HYX A;  3SFE A;  4BK1 A;  4NEV A;  3GRS A;  4G73 A;  1D4D A;  4PAA A;  5KVH A;  4U2T A;  3H8I A;  4ZCD A;  1KNR A;  4H2P A;  4Z26 A;  2ZZ0 A;  2YG7 A;  4C77 A;  5BUK A;  3D9X A;  3BHK A;  3NKS A;  3NTA A;  3DH9 A;  2XLS A;  4OPT A;  2EQ6 A;  4NZH A;  3KVE A;  1H82 A;  2F5Z A;  3ZYX A;  2R45 A;  5JCN A;  2WQY A;  3P4S A;  1CJ2 A;  3T2Z A;  3G5S A;  1GET A;  1CC2 A;  3T2Y A;  3WE0 A;  2XFN A;  3SYI A;  1FCD A;  3O0H A;  3BNU A;  3C4N A;  3NHO X;  2BAB A;  3CMM A;  4CY6 A;  1E1N A;  2WP6 A;  1GV4 A;  2I0Z A;  4II2 A;  2VQ7 A;  5FMH A;  1Y0P A;  4I58 A;  4TM3 A;  5KMQ A;  5M0Z A;  1ZDL A;  2APG A;  2UZZ A;  4A65 A;  3CGC A;  3NTD A;  3PS9 A;  1KN0 A;  4TLX A;  1FEB A;  5KOW A;  3KPK A;  1L0V A;  1NDA A;  2H88 A;  2XCG A;  2R4J A;  3NG7 X;  1LQT A;  3PO7 A;  3T37 A;  2WES A;  2CFY A;  4MJW A;  1GRT A;  2Y6R A;  4EQX A;  3UTF A;  1DOE A;  1CJC A;  2JBV A;  5BVA A;  1PBB A;  2VVL A;  3UTG A;  4OPU A;  3HYV A;  4C74 A;  2XLU A;  3NGC X;  4Z24 A;  1F8R A;  2JB1 A;  4EQR A;  3UTH A;  1N4U A;  4H4Y A;  1ZOV A;  1NHS A;  1JEH A;  1PJ6 A;  3ALL A;  3NK2 X;  2WOW A;  2VQB A;  1D4C A;  3VR8 A;  3NH3 X;  5DBJ A;  2B9W A;  3DGH A;  1L9D A;  2B9X A;  2YR6 A;  3GYI A;  4GDP A;  3M0O A;  2WDR A;  1OJD A;  1CBO A;  1JOA A;  5C2T A;  3H4K A;  1H81 A;  1ZP0 A;  1LTX R;  4JY3 A;  1F3P A;  1BWC A;  3BHF A;  1OJ9 A;  3CNP A;  2YM1 A;  3GD3 A;  1Q1R A;  3NLC A;  3F8R A;  4FK1 A;  1MO9 A;  3ADA B;  3NRN A;  1D7Y A;  3AEC A;  3UKK A;  3DGZ A;  1RP0 A;  2VZ2 A;  2OAL A;  4H4R A;  1PS9 A;  4IA6 A;  4GDE A;  1BZL A;  3ATQ A;  3NIX A;  1FOH A;  2WP9 A;  3AWI A;  3COX A;  2XDO A;  2C70 A;  3QVP A;  4A7A A;  4YTN A;  3LJP A;  3JSK A;  3IHM A;  1LQU A;  3S61 A;  4FK1 C;  2BK4 A;  4EMI A;  4DSG A;  2QAE A;  1PJ7 A;  3SZW A;  4Y4M A;  3ATR A;  2YLZ A;  2BYB A;  2GQF A;  2QA1 A;  3AEF A;  4M52 A;  3ICR A;  2R46 A;  3UOY A;  1VDC A;  4U8O A;  4EQS A;  3C96 A;  4G9K A;  2GR1 A;  2BC0 A;  3AE9 A;  1KFY A;  3URH A;  1N4V A;  4U8K A;  1GPE A;  1K0I A;  3AD7 B;  2O9Z A;  2YG5 A;  1F8S A;  3UKH A;  4AP1 A;  2RGO A;  3AE3 A;  5EBK A;  3G5R A;  1GTH A;  4REK A;  4B67 A;  4BJY A;  4DSH A;  1Q9I A;  4BUR A;  2W0H A;  5FS6 A;  4GRT A;  3AB1 A;  4DNA A;  2OA1 A;  2GAH B;  3BI5 A;  4JNQ A;  3CGD A;  2X8G A;  3DME A;  1CL0 A;  3UP4 A;  2YLW A;  1EL8 A;  2GAG B;  3IHG A;  4HA6 A;  4YT0 A;  2YR5 A;  3CGE A;  1IUW A;  4GUV A;  3Q6J A;  5ER0 A;  1H86 A;  2NVK X;  2CVJ A;  4WX1 A;  3SQP A;  3UTE A;  5U1O A;  2RGJ A;  3DJJ A;  3IWA A;  2IVE A;  1DOC A;  3AE2 A;  2XVJ A;  3AEG A;  2AR8 A;  4IVO B;  2BA9 A;  3T14 A;  2C64 A;  4UDQ A;  4ECH A;  5HY5 A;  1D5T A;  1P2E A;  2WHD A;  4UP3 A;  3P4Q A;  2BC1 A;  1LPF A;  1EBD A;  2YR4 A;  3AD8 B;  4LII A;  3GRT A;  2GV8 A;  4H4X A;  3EF6 A;  1PHH A;  1E6E A;  3CIR A;  3CND A;  3DJE A;  3NT6 A;  4EIQ A;  1GER A;  3CGB A;  1REO A;  3OC4 A;  2GMJ A;  2GF3 A;  2J3N A;  3B3R A;  3S5W A;  2FJA A;  3AE1 A;  4H4S A;  3GWD A;  3EAN A;  1SEZ A;  4OPG A;  4J57 A;  4OPI A;  3UOV A;  1CF3 A;  1EL9 A;  1LVL A;  1PBE A;  5J60 A;  4EM3 A;  3P4P A;  3DJG X;  2OLO A;  3ALM A;  1FL2 A;  3UOX A;  1EL5 A;  3LAD A;  2BCG G;  4Z2U A;  4YWO A;  4FX9 A;  2WU5 A;  2XVF A;  4USQ A;  2IVD A;  4JDR A;  2GR0 A;  3E1T A;  3LZW A;  4Z43 A;  4YSY A;  2BS2 A;  4B1B A;  1GT8 A;  4YKG A;  2FJE A;  1PN0 A;  1CHU A;  4P9S A;  1BGN A;  1DOD A;  2Q0K A;  2C3C A;  3QFB A;  2R0G A;  3AE8 A;  4OCG A;  3I6D A;  2CDU A;  4E0V A;  4AP3 A;  2AQJ A;  4BK2 A;  2C73 A;  2E5V A;  5HXI A;  3F8D A;  2XFQ A;  2R0P A;  3ZDN A;  1GRB A;  3ITJ A;  3T0K A;  2XFU A;  4YKF A;  4BK3 A;  2PHH A;  1PDH A;  4K22 A;  4AOX A;  3AEE A;  3AEB A;  3K30 A;  2YLS A;  3RHA A;  1NHR A;  4CNJ A;  4TLZ A;  1DNC A;  1H7W A;  4JNA A;  2TPR A;  1B4V A;  2HQM A;  4B69 A;  2B7R A;  4OPC A;  2BXR A;  3C4A A;  1E1M A;  2C72 A;  3NYC A;  1CJ3 A;  3UKP A;  4A6N A;  2FJB A;  4YSX A;  5KMP A;  5KNL A;  5FS8 A;  2BK3 A;  1F6M A;  4TM0 A;  3UKQ A;  2XFP A;  4EMJ A;  3DK4 A;  3CNJ A;  4J36 A;  1YQZ A;  2WPE A;  1XAN A;  1IUS A;  4H4P A;  3NN0 X;  4Y4N A;  3UKF A;  3UKA A;  3K7T A;  4X9M A;  3LXD A;  1PXB A;  1DJQ A;  2WPC A;  2VOU A;  4G6G A;  3SY4 A;  3KA7 A;  2Q7V A;  3F8P A;  4OPD A;  4N9X A;  1ONF A;  4USR A;  1ZX9 A;  3V76 A;  1YQ3 A;  3AYL A;  4X9N A;  4Y4L A;  4KX6 A;  2C67 A;  3CTY A;  4CCR A;  1CC6 A;  2R0C A;  1KNP A;  1H7X A;  2C75 A;  2WEU A;  3KPF A;  3QJ4 A;  4K5R A;  3NYF A;  4O5Q A;  4U8N A;  2V5Z A;  1IUX A;  4CNK A;  2WPF A;  4B65 A;  2GR2 A;  2OAM A;  4XWZ A;  1S2Q A;  3FIM B;  1LV0 A;  2JK6 A;  2V6O A;  4XWR A;  1PXA A;  2BS4 A;  1FEA A;  3DJD A;  1K0L A;  3KKJ A;  4NTD A;  3GWF A;  1W4X A;  3OZ2 A;  4J33 A;  5BUL A;  2WS3 A;  3KU9 A;  3ALJ A;  1RSG A;  4H4Q A;  2YLX A;  3ICS A;  2C3D A;  2YAU A;  1Y56 A;  1NPX A;  4IA5 A;  1O5W A;  3HZL A;  3K7Q X;  3GSI A;  5LV9 A;  1TDK A;  1S3E A;  4Z2R A;  1ZMD A;  2B7S A;  3SM8 A;  2WBA A;  1ZOY A;  3BNM A;  3V3N A;  3EAO A;  1X31 B;  2C76 A;  2JB2 A;  1P2H A;  3QVR A;  1DJN A;  4Z2T A;  1MOK A;  1GEU A;  1BGJ A;  1GND A;  1JRY A;  1TDN A;  1Z6L A;  3GMB A;  4A5L A;  3SZ0 A;  4U8I A;  4YSZ A;  1JRZ A;  2GB0 A;  1QJD A;  2OLN A;  4H4V A;  1YQ4 A;  3NK0 X;  4EMW A;  2PYX A;  2YG6 A;  2WOV A;  4B64 A;  2C7G A;  4H7U A;  3FMW A;  1H2I A;  1O94 A;  5TR3 A;  4B63 A;  3QSM A;  1UKV G;  5GRT A;  3KD9 A;  2BS3 A;  2A8X A;  4CBQ A;  1V59 A;  4EIP A;  5EB5 A;  3VQR A;  4ADW A;  4C3X A;  1Y56 B;  3AE4 A;  5IQ1 A;  3CNS A;  4CY8 A;  3NYE A;  3K7M X;  2NPX A;  3GYX A;  3VRD B;  5JCM A;  1GES A;  3CPH G;  4YTP A;  1NG4 A;  4RSL A;  2B76 A;  3PG6 A;  4YTM A;  4BV6 A;  1GRH A;  5FS7 A;  4NWZ A;  3BI4 A;  4BJZ A;  3IC9 A;  4I59 A;  1K4Q A;  1DOB A;  3FG2 P;  1PXC A;  1ZMC A;  4GCM A;  4U8J A;  4K7Z A;  4DGK A;  1KF6 A;  4GF7 A;  5HYM A;  3RP7 A;  4K2X A;  3GD4 A;  4OVI A;  2ARD A;  3AD9 B;  2YM2 A;  1QLB A;  4KPR A;  4H4Z A;  2GH5 A;  3DK9 A;  2X8C A;  3GDP A;  1EL7 A;  2GMH A;  1JU2 A;  4EM4 A;  3VRB A;  1D7L A;  4TM4 A;  1F8W A;  1OJA A;  1S7M A;  1YKJ A;  4U8M A;  3RP8 A;  1DXL A;  2YG3 A;  3AE6 A;  4J31 A;  3KLJ A;  2JKC A;  3AEA A;  1CJ4 A;  1Q1W A;  2YG4 A;  2C66 A;  3BI2 A;  3G5Q A;  4K8D A;  3I3L A;  2QA2 A;  2RGH A;  5J7X A;  4ZN0 A;  1NAA A;  2YVF A;  4NTC A;  4AT0 A;  4C3Y A;  1QO8 A;  3SFD A;  3QFA A;  1GOS A;  1N1P A;  3CNT A;  4YXD A;  1NEK A;  2JB3 A;  3EPT A;  5M10 A;  3D1C A;  4NEW A;  4K5S A;  2DKI A;  2XYO A;  3GYJ A;  2XLR A;  3AED A;  1NHQ A;  2QCU A;  2XVE A;  1YY5 A;  3CPJ G;  4TM1 A;  4H4U A;  2C65 A;  3UOZ A;  4Z44 A;  4J34 A;  1FEC A;  1L9C A;  1TYP A;  1GRG A;  2WU2 A;  3D8X A;  1D4E A;  3UKL A;  1TDE A;  2GQW A;  1GXF A;  3CPI G;  4G74 A;  3RP6 A;  3P4R A;  5KRQ A;  1AOG A;  3P1W A;  4LA1 A;  4O5U A;  4ZCC A;  1VG0 A;  3RNM A;  4AT2 A;  2VVL G;  3ICT A;  4H2N A;  3P9U A;  2X50 A;  2CUL A;  2GVC A;  2BXS A;  1IJH A;  4AOS A;  2WDV A;  3DA1 A;  1IUT A;  2TMD A;  1E1L A;  2GRT A;  3NN6 X;  3LOV A;  2VRM A;  1H6V A;  1XDI A;  1ELI A;  2AAQ A;  5U63 A;  4B66 A;  2WET A;  2R9Z A;  2X8H A;  2YWL A;  1VG9 A;  2XLT A;  4G6H A;  1ZK7 A;  1VQW A;  2Q0L A;  2WOI A;  1O95 A;  1BKW A;  4HB9 A;  1E1K A;  4UDP A;  4WCT A;  1N4W A;  4A99 A;  4II3 A;  4H50 A;  2FBW A;  3VR9 A;  1GRF A;  2YLT A;  3ABV A;  1GAL A;  4U2L A;  1TRB A;  3AE7 A;  3B6D A;  5IQ4 A;  1VRQ B;  1GSN A;  4OPL A;  4JQ9 A;  3ISH A;  4GAP A;  3UCL A;  2X3N A;  2IID A;  4JN9 A;  3Q9T A;  2GR3 A;  2V3B A;  4A79 A;  2V60 A;  4IVM B;  4U8P A;  2C4C A;  3CN8 A;  1NEN A;  2YVG A;  4C5O A;  3L8K A;  2E4G A;  4H2Q A;  5L46 A;  2ZZB A;  4RG4 A;  4H4W A;  4D04 A;  4APN A;  1JNR A;  5KWF A;  3LB8 A;  1IUV A;  1GTE A;  5CQF A;  4U2S A;  4GR1 A;  1L9E A;  3AE5 A;  1S3B A;  2Z5Y A;  3LZX A;  3SZF A;  2BCP A;  5C3J A;  1KSS A;  1IUU A;  3L5O A;  2RAB A;  1CC4 A;  3RED A;  2XLP A;  4FDC B;  2WP5 A;  3H8L A;  1MXT A;  3T2K A;  3FPZ A;  3QSE A;  1HYU A;  1B8S A;  1NHP A;  2EQ7 A;  3IF9 A;  4ICY A;  4J2W A;  2ZBW A;  1H84 A;  3NK1 X;  4JY2 A;  1OJC A;  2V3A A;  4CRT A;  1PBF A;  1PJ5 A;  5KOX A;  3L1R A;  3NNE A;  5KMS A;  2XVH A;  1S2Y A;  2BRY A;  1XHC A;  5JCK A;  4X4J A;  4J56 A;  1COY A;  2A87 A;  4H4T A;  2V61 A;  1OJT A;  3PVC A;  3SX6 A;  4A9W A;  1NG3 A;  2WDQ A;  4RG3 A;  1GRE A;  2XFO A;  1JNZ A;  5JRB A;  1KSU A;  5JCI A;  1RYI A;  2B9Y A;  3HYW A;  3QSS A;  2JAE A;  1E7P A;  4IV9 A;  3SZC A;  1PBC A;  2ZZC A;  3DK8 A;  2A89 A;  2E1M A;  5EOW A;  3AYJ A;  1TYT A;  2X99 A;  2R4E A;  2VRL A;  5KXJ A;  1LJ1 A;  5KVI A;  1B37 A;  1H83 A;  4NNJ A;  2YQU A;  5EB4 A;  2YVJ A;  2H89 A;  3T31 A;  1TDF A;  3R9U A;  4NTE A;  4A6N B;  5FS9 A;  4GAV A;  5KMR A;  4D03 A;  4PAB A;  5IPY A;  1M64 A;  3AXB A;  4UDR A;  3AYI A;  1K0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...