5FS8A

Crystal structure of the g308e mutant of human apoptosis inducing factor
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
487
structure length
473
Chain Sequence
b'QDKAPSHVPFLLIGGGTAAFAAASIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGEGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESRASEITIPPDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Structure/Function Relations in Aifm1 Variants Associated with Neurodegenerative Disorders
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 161
structure length 473
sequence length 487
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fs8A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs8A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs8A01
2BCPA 3FIMB 4EMWA 2EQ6A 4ZCDA 2ZZ0A 2VRLA 2VVLA 3AXBA 4U8LA 4H4QA 3BNMA 2X8HA 3P1WA 4U8NA 3KVEA 1L0VA 3LJPA 3K7QX 2JAEA 3QFBA 3ALJA 3AD8B 4K22A 4K5SA 1IUTA 4NTDA 3H4KA 3CN8A 3NYFA 4IVOB 4EM3A 3NIXA 2BS2A 4NTCA 2WPCA 3PS9A 1KF6A 1S3EA 3BI2A 4J34A 3S61A 3DH9A 1H7XA 3GWDA 3ZDNA 4B67A 4DSGA 2V6OA 2RGOA 3VRBA 4CCRA 2VVLG 1F8WA 3CGBA 2ZBWA 3AYJA 3O0HA 3DGZA 2C66A 4H2PA 4JY2A 1TYPA 1OJCA 4Z26A 2X3NA 2F5ZA 2YWLA 3NYCA 2BK3A 2YVFA 3ABVA 1D4DA 5JCIA 1DODA 2GV8A 4H4ZA 1VG0A 2WDRA 2WU2A 2YG5A 2FJDA 1NG3A 1VQWA 2IIDA 3COXA 3IWAA 4PAAA 4Y4LA 2XYOA 1FEBA 1TDEA 5M0ZA 4OPLA 2C76A 4GF7A 1NHPA 2VOUA 3ISHA 1SEZA 2UZZA 1IUVA 2XFNA 1PBBA 3G5RA 3C4AA 3I3LA 3P4RA 4NTEA 2WEUA 5L46A 4H4SA 4C74A 2Y6QA 1H81A 1Q1WA 3AB1A 2VRMA 1F8SA 2R45A 4USQA 2XDOA 1OJAA 5EB4A 5BVAA 2J3NA 3NN6X 1KSUA 4B63A 2YLXA 1GPEA 3KU9A 4DGKA 3KKJA 3ICRA 1NHQA 4YTNA 2EQ9A 2WOIA 1PJ5A 5CQFA 4B65A 3LADA 3SM8A 3URHA 2VQBA 1K0JA 4H2RA 3VRDB 3RNMA 5BULA 4CBQA 2APGA 4CNJA 5BUKA 2OAMA 3SGLA 5FS8A 1GRGA 3DGHA 4A79A 3LZWA 4AP3A 4OPCA 3P9UA 3SFEA 2JK6A 2PYXA 1GSNA 1YKJA 1DXLA 1B4VA 1LQUA 2CULA 2Q0LA 2CDUA 2R4JA 4YSZA 5GRTA 4U2LA 5HY5A 2QAEA 3FPZA 2XFQA 2O9ZA 2C67A 3AWIA 4Y4MA 2JKCA 2NVKX 3DMEA 4EMJA 2YG4A 4A7AA 1S2YA 3DJDA 2WBAA 2IVDA 5JCNA 3FMWA 1TDKA 3NRNA 4C5OA 4H4VA 2B9XA 3LZXA 1CC4A 1CHUA 4H4WA 1QLBA 2YLTA 1FL2A 1P2HA 5GSNA 2RGHA 3I6DA 4D03A 5HXIA 2YQUA 1JNZA 1ONFA 1OJTA 2V3AA 3LOVA 2GQFA 3AE3A 2TMDA 1MOKA 3PO7A 1IUUA 4NEWA 3P4QA 3R9UA 1PBEA 1DOCA 1VDCA 3UOYA 4LU6A 4Z2TA 3DJGX 2H89A 1B8SA 3ALMA 4GDPA 2DKHA 3KPFA 4TM3A 1XPQA 1NG4A 3DK9A 2BCGG 1XDIA 2Y6RA 3CNJA 4LIIA 2C70A 3G5QA 4U8JA 1H84A 4UP3A 2B9WA 3UOVA 1S2QA 4TLZA 1P2EA 1CC2A 4A99A 1DJQA 1ZMDA 3AECA 1H6VA 1ELIA 4OVIA 4Z43A 3AEFA 3NT6A 4KX6A 3UKQA 2WDQA 1D4EA 1N4VA 2ARDA 3GD3A 3BI5A 3PVCA 1PN0A 4YSXA 2XLUA 3VRAA 2BC1A 3T37A 3AE9A 4J2WA 1RP0A 2GRTA 5C2TA 4NEVA 4YTMA 1IUSA 1D7LA 2C65A 4CRTA 4X9NA 1ZY8A 4ADWA 4U8MA 1M6IA 5JCMA 2JB1A 1CJCA 2R46A 3M0OA 5CKUA 4CCQA 1IUXA 4YXDA 2GMHA 1K0IA 2XFPA 3AE8A 4CY8A 3BHKA 4TLXA 4EQWA 1ZK7A 3GMCA 1MO9A 3CPIG 3P4PA 1YY5A 5EBKA 1NHRA 1PHHA 5IPYA 2EQ8A 1KFYA 4YT0A 2C3CA 2EQ7A 3AEAA 2AR8A 1O94A 4USRA 3QSSA 4U2SA 4E0VA 1BF3A 4KPRA 2WQYA 3L8KA 4UDRA 3IF9A 1JEHA 1K0LA 5FS7A 1EL5A 2XVHA 2X50A 3LB8A 3RHAA 3UOZA 3UTEA 4EQXA 2XLPA 4Z25A 1D7YA 2GR1A 4H50A 3BI4A 1DJNA 1F6MA 3UP5A 3Q9TA 1Q9IA 4BV6A 3V3OA 3AE2A 1NPXA 3UKFA 5KOWA 2WOWA 2HQMA 5U1OA 4CY6A 3M13A 1N1PA 5HYMA 2ZZBA 3RP7A 4XXGA 1QJDA 2OALA 5C3JA 1N4UA 4B1BA 1CJ4A 3VR9A 3NLCA 4X9MA 3CGDA 1KNPA 3UTFA 3CNSA 3CNPA 1EL7A 4HB9A 2GR3A 2JB2A 1ZOVA 4H7UA 1DOEA 1E1KA 5KRQA 2VZ2A 4RG3A 2BYBA 4GCMA 3CTYA 3NK0X 3B3RA 2QA2A 3AE7A 1OJDA 3CGEA 3ATQA 1H83A 3GYJA 4GRTA 1H86A 3NK1X 1PBDA 1JRXA 2FJBA 2Z5YA 3UKKA 2E1MA 4H4TA 3CPJG 4EM4A 2GB0A 2A87A 5JCLA 2V60A 2WPFA 1OJ9A 2BK5A 3UTGA 3DA1A 2RGJA 5IQ1A 1GALA 4BURA 4OPUA 3ATRA 3WE0A 3GYIA 2WP9A 3AE5A 1CF3A 3NTAA 5U63A 1N4WA 1FECA 3QVPA 3RP6A 5HHFA 2C3DA 4WCTA 3IHGA 3AEGA 4EMIA 2YR4A 4J33A 1COYA 3FBSA 4XWRA 2XVJA 1GTEA 1TDOA 1L9DA 4O5UA 1O95A 3AYIA 3KA7A 4Y4NA 4C77A 3ICTA 3EANA 2WP6A 1L9EA 4A65A 2FJAA 4AT2A 2WOVA 1NDAA 2GR2A 5KVHA 4J56A 2C73A 2Q6UA 5EOWA 1GRAA 5FMHA 3OZ2A 3NG7X 3QSEA 2BXSA 1BGNA 2YLSA 3BNUA 4OPIA 4AP1A 3GRSA 2R9ZA 1GETA 3E1TA 1YQ3A 2OA1A 3AEBA 4RG4A 3GRTA 1TDNA 2XLRA 3C96A 2BXRA 3ALLA 3UOXA 2A8XA 1YQ4A 1Y56A 1LVLA 4IVMB 2BACA 2Q0KA 1EL8A 1X31B 4H4YA 3REDA 4H4PA 3UKAA 2X99A 4AOXA 1ZKQA 1IUWA 4NZHA 1GRTA 1JNRA 3UKHA 2YVGA 4ZCCA 3BHFA 4EQRA 3AEDA 4U8PA 4Z24A 5IQ4A 2BS4A 2BK4A 4J31A 2AQJA 2BABA 3F8DA 2NPXA 3NKSA 4WX1A 2YR6A 2XLTA 5JCKA 3NTDA 4Z2RA 2H88A 5KVIA 4J57A 4JQ9A 3AEEA 1VRQB 1REOA 1K4QA 1UKVG 3ADAB 2QA1A 2R0GA 4DSHA 2CVJA 3GSIA 2RABA 5FS9A 2C75A 4C3YA 3DJJA 4BJYA 2GEWA 2R0CA 1LQTA 1BZLA 3GD4A 4JDRA 3SQPA 1E1NA 1JRYA 2WP5A 2PHHA 4K2XA 4Z44A 3QFAA 3ICSA 4FK1A 1LTXR 3UKLA 2W0HA 1EL9A 4EIPA 1GTHA 1Y56B 2E4GA 4N9XA 3QSMA 1GREA 4I59A 2V61A 2XFUA 4P9SA 4M52A 3RP8A 2XVFA 2VVMA 5KXJA 4U8IA 3P4SA 1GOSA 4YKFA 1NHSA 1LV0A 3NK2X 1ZOYA 4OCGA 2YLWA 5M10A 1B5QA 4J36A 3IHMA 4GUVA 3K7TA 1M64A 4ECHA 3L1RA 3EPTA 2GQWA 4GDEA 3AYLA 3EF6A 4JN9A 1ZX9A 2GH5A 3M12A 2ZZCA 3EAOA 3NHOX 4HA6A 1KSSA 2YLRA 4K5RA 4YSHA 1Z6LA 3DK8A 1PJ6A 1PS9A 4PABA 2GF3A 4TM1A 2JB3A 2X8GA 5TR3A 4UDPA 3SFDA 1RSGA 5J7XA 2WU5A 3UTHA 2Z5XA 4BJZA 4APNA 2B76A 3DJEA 1L9CA 2GAHB 4U8OA 2BC0A 1CBOA 1GT8A 1ZMCA 5BRTA 2XFOA 1TYTA 1F3PA 2WHDA 3V3NA 2TPRA 1LJ1A 4DNAA 3AD7B 4RSLA 5EB5A 4K8DA 1BWCA 4LA1A 4JY3A 1E1MA 3AE4A 3DK4A 4H4UA 1PXBA 3NH3X 1H7WA 2Q7VA 3AE6A 1Y0PA 4TM4A 2ACZA 4BK2A 2I0ZA 1PBFA 4BK1A 4REKA 1VG9A 4D04A 2GMJA 4I58A 2C7GA 4Z2UA 1GXFA 1JRZA 4BK3A 1E1LA 4B69A 3UKPA 5KWFA 2WETA 1CL0A 1F8RA 4JNQA 4JNAA 3IC9A 3AE1A 3VQRA 4CNKA 1GRHA 1D5TA 2C64A 4OPTA 3CNDA 4U8KA 1CJ2A 3K30A 1B37A 2VQ7A 1GERA 3NGCX 1S3BA 1XANA 4OPGA 1FCDA 1KNRA 3CGCA 2CFYA 1GRFA 3B6DA 3NN0X 2XVIA 4B66A 4UDQA 4A6NA 5FS6A 2B9YA 3HZLA 2YVJA 1BKWA 1NENA 3CPHG 3D1CA 5ER0A 3KLJA 2YG7A 1AOGA 3II4A 4IA6A 2AAQA 4EQSA 3JSKA 1TRBA 4FDCB 5U25A 1FOHA 1H82A 4H4RA 3GWFA 1NEKA 3GDNA 1DOBA 2FJEA 3C4NA 1FEAA 3H8LA 2XVEA 2WESA 3H8IA 1O5WA 5J60A 4A9WA 2XCGA 3G5SA 4MJWA 3VR8A 2FBWA 4B68A 1ZDLA 3NNEA 1D4CA 4YTPA 3LXDA 3S5WA 2OLOA 1PXCA 2GAGB 2V5ZA 2V3BA 2BA9A 1BGJA 1RYIA 5KOXA 1GESA 1PXAA 2OLNA 1IJHA 2YG6A 2R4EA 3D8XA 3CIRA 1HYUA 3CNTA 4IA5A 3ITJA 1JOAA 2X8CA 2YM1A 2DKIA 2QCUA 1PDHA 4O5QA 4FX9A 1JU2A 4AOSA 2XLSA 4YWOA 4FK1C 4TM0A 4U2TA 2B7SA 2BS3A 2YG3A 1GEUA 3QVRA 1GNDA 4H2NA 5DBJA 4A6NB 4EIQA 3GMBA 4GR1A 4ICYA 2JBVA 4K7ZA 1TDFA 1XHCA 4B64A 2R0PA 4OPDA 3AD9B 1CC6A 2YR5A 4A5LA 1KDGA 4IV9A 3F8RA 1W4XA 3OC4A 2YLZA 1PBCA 1DNCA 2GR0A 2A89A 2WS3A 3FG2P 3UP4A 2WPEA 3KD9A 1E6EA 1LPFA 1NAAA 2E5VA 4H4XA 3K7MX 3QJ4A 1E39A 1CJ3A 3GDPA 3ZYXA 4YKGA 4AT0A 2B7RA 1YQZA 5LV9A 1MXTA 3UCLA 4C3XA 1E7PA 1V59A 4YSYA 2GVCA 2WDVA 1ZP0A 1GRBA 1EBDA 4XWZA 1PJ7A 2YM2A 2IVEA 3V76A 1GV4A 3NYEA 2C72A 2YAUA 4ZN0A 4H2QA 3F8PA 1Q1RA 4X4JA 3Q6JA 1QO8A
chains in the Genus database with same CATH superfamily
4U8LA 3BNMA 2X8HA 3R0UA 1L0VA 3DFHA 3K7QX 1IUTA 3OTRA 3H4KA 4IVOB 3NIXA 3JZUA 2HXTA 4GAVA 3H70A 3DG3A 3ZLGA 3ZDNA 3N6HA 2DW6A 3VRBA 3R0KA 2VVLG 1F8WA 3CGBA 3O0HA 1OJCA 2F5ZA 2BK3A 2PMQA 1VQWA 3SSZA 3CXOA 4E5TA 4H2HA 2RDXA 3B9JB 4IL2A 1IUVA 2XFNA 3C4AA 3I3LA 2Y6QA 5BVAA 2XDOA 1OJAA 1R0MA 2YLXA 1PJ5A 5CQFA 3A7RA 3CXBA 3URHA 3UCCA 2VQBA 4H2RA 3VRDB 5BULA 3SGLA 4A79A 4AP3A 3IJIA 2PYXA 1DXLA 1N61C 2CULA 3IJLA 4GYPA 5HY5A 3V5FA 4EMJA 4A7AA 3DJDA 3FMWA 3PK7A 3LZXA 4H4WA 1QLBA 2YLTA 3R1ZA 1FL2A 1X2GA 2RGHA 5BOFA 1JNZA 2V3AA 3R9UA 1PBEA 2H89A 1XPQA 3G5QA 2OPJA 3UOVA 1S2QA 2I5QA 4TLZA 1CC2A 3R25A 1ELIA 4OVIA 3NT6A 3BI5A 2XLUA 3Q4DA 2C65A 1CJCA 4CCQA 2QDDA 3AE8A 4IT1A 4KT2A 1YY5A 5IPYA 1NHRA 2EQ8A 2P8CA 2AL2A 4E0VA 1BF3A 2WQYA 3IF9A 3RHAA 2W3RA 2X50A 4II3A 3UTEA 1FFVC 3STPA 2XLPA 4Z25A 4H50A 3Q9TA 3V3OA 3AE2A 1NPXA 3UKFA 2WOWA 2HQMA 3N4FA 1TE6A 2GGHA 2ZZBA 2OVLA 2OALA 3TCSA 1EL7A 2GR3A 3FYYA 3B3RA 3AE7A 1OJDA 2AL2B 2W3SA 4G7FA 3N4EA 1JRXA 2E1MA 3ENLA 3DA1A 2RGJA 4HNLA 3FVDA 4BURA 4OPUA 5KNLA 4X2PA 3NXLA 2WP9A 1CF3A 3NTAA 1FECA 3QVPA 2C3DA 4XWRA 1L9DA 2OZ3A 2WP6A 4A65A 1NDAA 2GR2A 5KVHA 1S7MA 5FMHA 3QSEA 4OPIA 2OA1A 3C96A 3UOXA 2PCEA 1LVLA 2BACA 2Q0KA 3NRZB 4AOXA 3EUB3 1IUWA 5JRBA 3UKHA 2YVGA 4ZCCA 4J31A 2AQJA 1WUFA 3R10A 4Z2RA 2H88A 4J57A 4JQ9A 1IYXA 3ADAB 3VC6A 2QA1A 4DSHA 2AL1A 1N62C 3QLDA 2GEWA 2R0CA 1BZLA 4JDRA 2WP5A 3NVZB 4FK1A 1EL9A 1GTHA 2E4GA 3ZVIA 1GREA 4H19A 1NHSA 4OCGA 2PGEA 3IHMA 1W6TA 4YWSA 4ECHA 1SJAA 1ONEA 3AYLA 4K5RA 3EAOA 3DK8A 3QN3A 3OPSA 4UDPA 2P8BA 5J7XA 3UTHA 1L9CA 1GT8A 1ZMCA 2XFOA 2OG9A 2OLAA 4DNAA 5EB5A 1BWCA 4LA1A 4B67A 2PTZA 3AE4A 1KKRA 4Z17A 3OP2A 2ACZA 4TVYA 2I0ZA 2GMJA 4B69A 1CL0A 1F8RA 4JNAA 3AE1A 3I6EA 4CNKA 4U8KA 3NFUA 3K30A 2VQ7A 3A7UA 4OPGA 3UJEA 2CFYA 1GRFA 3B6DA 4GMEA 2XVIA 4MMWA 1NENA 3MY9A 3DERA 2PTWA 1STZA 1TRBA 4FDCB 1FOHA 6ENLA 3SZCA 2FYMA 1FEAA 2XVEA 3T2KA 3H8AA 3QTPA 5G5GB 4A9WA 2XCGA 4MJWA 3CAWA 4B68A 1ELSA 3UJSA 1D4CA 2BA9A 2YG6A 3ITJA 4O5QA 4AOSA 4FX9A 1JU2A 2XLSA 2BS3A 4EIQA 4GR1A 4ICYA 3Q45A 3U9IA 1F9CA 4A5LA 1KDGA 3OC4A 1DNCA 3SR6B 1X2HA 3UP4A 5KMRA 1E6EA 1VQZA 4GFIA 1NAAA 2E5VA 3QJ4A 2GGIA 1E39A 3ZYXA 1YQZA 4C3XA 1E7PA 2WDVA 4ZN0A 3F8PA 1FHUA 2BCPA 3FIMB 4EMWA 2VRLA 2PODA 4KPLA 4H4QA 1JPDX 3KVEA 4DX3A 3LJPA 3ALJA 4NTDA 4EM3A 3SZFA 3PS9A 4J1OA 2V6OA 4HCDA 5FJTA 2RGOA 2P0IA 4CCRA 3AYJA 1ECQA 4G9KA 3DGZA 2C66A 3SZWA 2X3NA 3NYCA 3DGBA 2YVFA 5JCIA 3BSMA 4DN1A 2WU2A 2YG5A 3COXA 3IWAA 3CYJA 4OPLA 3G5RA 4NTEA 1H81A 5EB4A 2VRMA 2R45A 2J3NA 1KSUA 4DGKA 1T3QC 2EQ9A 2WOIA 4B65A 3LADA 3SM8A 3PFRA 3RNMA 4CBQA 4CNJA 5BUKA 4K8GA 3LZWA 4G73A 4OPCA 3SFEA 5FJOA 1YKJA 3DG7A 2Q0LA 2CDUA 2R4JA 1EBGA 4U2LA 2XFQA 2O9ZA 3AWIA 2QVHA 2AKZA 1TZZA 4E4UA 1TDKA 4C5OA 4H4VA 4JHMA 1CC4A 5GSNA 1ONFA 3LOVA 3MSYA 2TMDA 3PO7A 1NU5A 4NEWA 3P4QA 2PGWA 2CHRA 4Z2TA 3ALMA 3DK9A 2BCGG 2C70A 1P2EA 1RVKA 3AECA 1H6VA 4Z43A 1N4VA 3VRAA 3T37A 2HXUA 1RP0A 1ZY8A 1SB3B 2NQLA 1M6IA 5JCMA 2R46A 4YXDA 1IUXA 2OZ8A 2XFPA 4CY8A 4TLXA 4EQWA 3TTEA 3CPIG 3P4PA 1PHHA 4YT0A 2C3CA 1DTNA 1ZXIC 1O94A 4UDRA 5FS7A 3LB8A 3EEZA 1D7YA 2GR1A 1F6MA 4ROPA 1Q9IA 4BV6A 5U1OA 2QJMA 5C3JA 1N4UA 4B1BA 3VR9A 3CGDA 1KNPA 3FJ4A 3CNPA 1ZOVA 4GCMA 3T8QA 3MWCA 4DWDA 3UKKA 4H4TA 4EM4A 1KN0A 1OJ9A 2BK5A 5EU9A 5IQ1A 4E6MA 2HZGA 3WE0A 3AE5A 3RP6A 4WCTA 4KEMA 1COYA 7ENLA 2XVJA 1GTEA 4Y4NA 3ICTA 1L9EA 4J56A 3NG7X 5G5HB 1BGNA 4K2SA 3GO2A 2GDQA 2R9ZA 1YQ3A 4RG4A 3AEBA 2BXRA 2ZC8A 3SBFA 4H4YA 1ZKQA 4NZHA 1GRTA 5KMPA 3HYXA 4GISA 3T6CA 2BS4A 2BK4A 3HYVA 4G74A 3NKSA 4GAPA 5IDZA 5FJUA 2YR6A 5JCKA 3NTDA 5KVIA 1REOA 1K4QA 1UKVG 3UJFA 4C3YA 3SYIA 3DJJA 1E1NA 1JRYA 3MQTA 2W0HA 3SN4A 1FHVA 4N9XA 3DEQA 4DXKA 2V61A 4P9SA 2VVMA 3TWBA 3TJ4A 5M10A 1B5QA 1M64A 1P43A 1PDYA 3TOYA 4JN9A 2ZZCA 4YSHA 1PS9A 1WYGA 2WU5A 2B76A 3DJEA 3SN1A 1LJ1A 4RSLA 4K8DA 2OKTA 4H4UA 1PXBA 3AE6A 3VCNA 1PBFA 1VG9A 3EKGA 4I58A 1GXFA 4BK3A 1E1LA 3UKPA 5FJPA 3VQRA 4OPTA 1CJ2A 3NGCX 1FCDA 4UDQA 5FS6A 1E9IA 3HZLA 3D1CA 3KLJA 4IA6A 3MUCA 3JSKA 3ZVHA 5U25A 1H82A 5J60A 1O5WA 3RO6A 3OW1A 3S5WA 3HW2A 2OLOA 1XS2A 3H12A 5BOEA 1GESA 2OLNA 3NVVB 1IJHA 3FCPA 4MGGA 2X8CA 1PDHA 3V4BA 4U2TA 1TDFA 4B64A 4OPDA 2PP0A 3NO1A 4IV9A 3F8RA 1EC7A 1W4XA 3ZVHB 3S47A 2A89A 2WPEA 4II2A 3UGVA 1LPFA 4H4XA 3GDPA 4YKGA 4AT0A 4IHCA 5LV9A 3VDGA 1V97A 2GVCA 1ZP0A 2YM2A 2IVEA 4G6HA 2YAUA 1QO8A 2EQ6A 4IZGA 4ZCDA 2ZZ0A 2VVLA 3GC2A 2MNRA 4U8NA 1JROA 1XPYA 2JAEA 3QFBA 3AD8B 4K22A 2OX4A 4K5SA 3TJIA 3NYFA 2WPCA 4J34A 1H7XA 4ZA0A 2ZBWA 4H2PA 3KPKA 3VC5A 1TYPA 4Z26A 2YWLA 3ABVA 1D4DA 2GV8A 1VG0A 4Z1YA 2FJDA 3IJQA 4Y4LA 2XYOA 1FEBA 4NWZA 3VA8A 2PTYA 2DW7A 2VOUA 4KWSA 4JN7A 5L46A 4HPNA 3AB1A 1Q1WA 1F8SA 3NN6X 1R6WA 4B63A 3KUMA 1GPEA 3KU9A 3ICRA 1NHQA 4YTNA 4GGBA 3V5CA 3DGHA 3P9UA 1GSNA 1FFUC 1LQUA 3OZYA 4YSZA 3T31A 4JN8A 4Y4MA 2WBAA 1N5WC 2IVDA 2OZTA 3NRNA 2AKMA 3R11A 4NNJA 1P2HA 5J04A 4GGHA 3AE3A 1MOKA 3THUA 1IUUA 4HN8A 4LU6A 4ENLA 2DKHA 4TM3A 1XDIA 3CNJA 4UP3A 1H84A 2B9WA 1N63C 4A99A 1DJQA 3SJNA 3BJSA 3AEFA 4KX6A 2WDQA 2ARDA 3GD3A 1PN0A 4J2WA 1D7LA 3DDMA 4ADWA 2JB1A 3M0OA 2C4CA 1K0IA 2O56A 2BRAA 1ZK7A 3D47A 3AEAA 3QSSA 4U2SA 1FO4A 4KPRA 3D46A 1EL5A 3MKCA 3V3WA 3BI4A 1DJNA 3UP5A 4CY6A 3M13A 3RP7A 4J3ZA 1QJDA 1CJ4A 3UJ2A 3CNSA 5KRQA 2VZ2A 4RG3A 2BYBA 3R07C 4GYPC 3CGEA 3ATQA 3GYJA 3RRAA 3RR1A 1PBDA 2Z5YA 3TW9A 3CPJG 2GB0A 2A87A 5JCLA 2V60A 3MZNA 1GALA 3T2YA 3UJRA 3RITA 3HRDC 1VDVA 3S5SA 3IHGA 4A35A 3P3BA 2YR4A 4J33A 3HPFA 3P93A 1TDOA 3AYIA 3NS1B 3FXGA 3KA7A 4C77A 3T14A 2FJAA 4AT2A 2WOVA 3QKEA 2C73A 2BXSA 3U4FA 1FIQB 3BNUA 1EC9A 4AP1A 3UXLA 1SJBA 1GETA 3E1TA 3ALLA 1Y56A 3BOXA 1EL8A 3REDA 3UKAA 1JNRA 4EQRA 3AEDA 4U8PA 5IQ4A 3F8DA 2NPXA 4WX1A 3A7AA 3JW7A 2XLTA 2PTXA 3CMMA 2RABA 5FS9A 2C75A 4G6GA 4IP4A 4BJYA 4Z44A 4K2XA 3SQPA 2PHHA 3ICSA 1LTXR 3UCDA 2PS2A 3JVAA 4A3RA 2W54A 3SN0A 1Y56B 4I59A 2GGEA 2XFUA 3RP8A 3CT2A 4HNCA 4U8IA 1GOSA 4YKFA 3D9XA 2OFJA 4J36A 3K7TA 3L1RA 2P88A 1ZX9A 2GH5A 3M12A 3GD6A 2YLRA 1Z6LA 1PJ6A 4PABA 2X8GA 5TR3A 1RSGA 3P0WA 3H7VA 2QJJA 5BRTA 2WHDA 3V3NA 2XH0A 2TPRA 1JRPA 1BKHA 1E1MA 3NH3X 3OZMA 1H7WA 2Q7VA 1Y0PA 4HCLA 2GSHA 4BK1A 4REKA 4D04A 1OEPA 1JRZA 2XH7A 2WETA 3VCCA 1GRHA 2C64A 4FP1A 1GERA 1XANA 3T9PA 3NN0X 4A6NA 2B9YA 1P48A 3II4A 4EQSA 4H4RA 3RGTA 3GWFA 4HCHA 1NEKA 3GDNA 1DOBA 2FJEA 3C4NA 3G5SA 3VR8A 2FBWA 3NNEA 4YTPA 3LXDA 1PXCA 2V3BA 3PWIA 1RYIA 5KOXA 1PXAA 3CIRA 1HYUA 3CNTA 4IA5A 1JOAA 2YM1A 2DKIA 3HYWA 3SXIA 4FK1C 4HYRA 4H2NA 4A6NB 1JCTA 3AN1A 2JBVA 1CC6A 2YR5A 3SY4A 2YLZA 1PBCA 3K1GA 4ZCWA 2E5AA 3KD9A 3K7MX 3NZGA 2P3ZA 2B7RA 1MXTA 3UCLA 4YSYA 3NYEA 2OQYA 2OO6A 3SQSA 4E8GA 2XH2A 3AXBA 3P1WA 2PP3A 3CN8A 2BS2A 3TQPA 4NTCA 1KF6A 1S3EA 3BI2A 3S61A 3DH9A 3GWDA 4DSGA 4JY2A 4M6UA 2GGJA 1DODA 4H4ZA 2WDRA 2IIDA 1NG3A 4PAAA 1TDEA 5M0ZA 1KD0A 2XH4A 2C76A 4GF7A 1NHPA 3ISHA 1SEZA 2UZZA 1PBBA 3P4RA 2WEUA 4H4SA 3VFCA 4C74A 4USQA 4GIRA 3KKJA 1K0JA 3N6JA 2APGA 2OAMA 5FS8A 1GRGA 1MDLA 2JK6A 2PPGA 1B4VA 3DIPA 5GRTA 2QAEA 3FPZA 4MKSA 3ZLFA 2C67A 2JKCA 2NVKX 3DMEA 2YG4A 1S2YA 5JCNA 1YEYA 1PDZA 2B9XA 1CHUA 3I4KA 3I6DA 4D03A 5HXIA 2YQUA 1OJTA 2GQFA 1H2IA 4DYEA 3ES8A 1DOCA 1VDCA 1BQGA 3UOYA 3DJGX 1B8SA 4GDPA 3KPFA 1NG4A 2Y6RA 4LIIA 4U8JA 1EC8A 1ZMDA 2POZA 2PU1A 3UKQA 2OQHA 1D4EA 3PVCA 4YSXA 3SX6A 2BC1A 4DHGA 3AE9A 3NVWB 2GRTA 5C2TA 4NEVA 4YTMA 1IUSA 4CRTA 4X9NA 4U8MA 5CKUA 1MDRA 4H83A 2GMHA 1SJDA 3BHKA 3CK5A 3GMCA 1MO9A 5EBKA 1KFYA 2EQ7A 2AR8A 4USRA 2ONEA 1MRAA 2FKPA 3L8KA 1JEHA 1K0LA 2XVHA 3UOZA 4EQXA 3ES7A 4M0XA 2W55A 1NELA 5KOWA 1N1PA 5HYMA 3L5OA 4XXGA 1RM6B 2PP1A 3NLCA 3AMZA 4X9MA 2GGGA 3UTFA 3DESA 4HB9A 2PSNA 2JB2A 4H7UA 1DOEA 1E1KA 4ZOHB 3DG6A 3CTYA 3NK0X 1JDFA 2QA2A 1H83A 4GRTA 1H86A 3NK1X 2FJBA 1MUCA 1SJCA 2BRYA 3GY1A 3SZ0A 2XGZA 2WPFA 2MUCA 3UTGA 3AM9A 1TKKA 3B97A 3ATRA 3GYIA 1L8PA 2PU0A 5U63A 1N4WA 5HHFA 3AEGA 4EMIA 4F4RA 4EWJA 3FBSA 3ZLHA 3RCYA 4O5UA 1O95A 3DFYA 3EANA 4A6GA 2Q6UA 5EOWA 1GRAA 3OZ2A 2YLSA 3GRSA 3GRTA 1TDNA 2XLRA 2A8XA 1YQ4A 4IVMB 4K1WA 1X31B 4H4PA 2X99A 2QJNA 3BHFA 5KMSA 4Z24A 2BABA 4TVWA 1EBHA 2QQ6A 3T2ZA 3AEEA 1VRQB 2R0GA 2CVJA 3GSIA 1LQTA 3GD4A 3UKLA 3QFAA 5KMQA 4EIPA 3QSMA 3T4WA 4M52A 2XVFA 5KXJA 3P4SA 3NK2X 1LV0A 1ZOYA 2YLWA 2PA6A 4G8TA 4GUVA 3EPTA 2GQWA 4GDEA 4E4FA 3EF6A 4HA6A 3NHOX 2GL5A 1KSSA 4H1ZA 3UXKA 2GF3A 4TM1A 2ZADA 2JB3A 3SFDA 3NVYB 2Z5XA 4BJZA 4APNA 1N5XA 3PG6A 2GAHB 4U8OA 2BC0A 1CBOA 1KCZA 2XSXA 1TYTA 1F3PA 3CB3A 3AD7B 3T0KA 4JY3A 3DK4A 4TM4A 4BK2A 2C7GA 4Z2UA 3GYXA 5KWFA 5ENLA 4JNQA 3IC9A 4FI4A 5FJRA 1D5TA 3CNDA 3IK4A 1B37A 1S3BA 1KNRA 3CGCA 3FV9A 1MNSA 3QPEA 2E3TA 4B66A 2YVJA 1BKWA 3CPHG 5ER0A 2YG7A 1AOGA 2AAQA 3H8LA 3TWAA 1JPMA 2WESA 3H8IA 1ZDLA 4IL0A 2GAGB 2V5ZA 1BGJA 2R4EA 3D8XA 2HNEA 2QCUA 4IP5A 4YWOA 1N60C 4TM0A 2QDEA 2B7SA 2YG3A 3QVRA 1GEUA 5DBJA 1GNDA 3GMBA 4K7ZA 1XHCA 1WUEA 2R0PA 3AD9B 3I6TA 1KKOA 2GR0A 2WS3A 3FG2P 1CJ3A 2QGYA 1V59A 1GRBA 1EBDA 4XWZA 3PWGA 1PJ7A 3V76A 1GV4A 2C72A 4H2QA 1Q1RA 4X4JA 3Q6JA 3ETRB
chains in the Genus database with same CATH topology
2BCPA 3FIMB 4EMWA 2EQ6A 4ZCDA 2ZZ0A 2VRLA 2VVLA 3AXBA 4U8LA 4H4QA 3BNMA 2X8HA 3P1WA 4U8NA 3KVEA 1L0VA 3LJPA 3K7QX 2JAEA 3QFBA 3ALJA 3AD8B 4K22A 4K5SA 1IUTA 4NTDA 3H4KA 3CN8A 3NYFA 4IVOB 4EM3A 3NIXA 2BS2A 4NTCA 3SZFA 2WPCA 3PS9A 1KF6A 1S3EA 3BI2A 4GAVA 4J34A 3S61A 3DH9A 1H7XA 3GWDA 3ZDNA 4B67A 4DSGA 2V6OA 2RGOA 3VRBA 4CCRA 2VVLG 1F8WA 3CGBA 2ZBWA 3AYJA 3O0HA 3DGZA 2C66A 3KPKA 4G9KA 4H2PA 4JY2A 1TYPA 1OJCA 3SZWA 4Z26A 2X3NA 2F5ZA 2YWLA 3NYCA 2BK3A 2YVFA 3ABVA 1D4DA 5JCIA 1DODA 2GV8A 4H4ZA 1VG0A 2WDRA 2WU2A 2YG5A 2FJDA 1NG3A 1VQWA 2IIDA 3COXA 3IWAA 4PAAA 4Y4LA 2XYOA 1FEBA 1TDEA 4NWZA 5M0ZA 4OPLA 2C76A 4GF7A 1NHPA 2VOUA 3ISHA 1SEZA 2UZZA 1IUVA 2XFNA 1PBBA 3G5RA 3C4AA 3I3LA 3P4RA 4NTEA 2WEUA 5L46A 4H4SA 4C74A 2Y6QA 1H81A 1Q1WA 3AB1A 2VRMA 1F8SA 2R45A 4USQA 2XDOA 1OJAA 5EB4A 5BVAA 2J3NA 3NN6X 1KSUA 4B63A 2YLXA 1GPEA 3KU9A 4DGKA 3KKJA 3ICRA 1NHQA 4YTNA 2EQ9A 2WOIA 1PJ5A 5CQFA 4B65A 3LADA 3SM8A 3URHA 2VQBA 1K0JA 4H2RA 3VRDB 3RNMA 5BULA 4CBQA 2APGA 4CNJA 5BUKA 2OAMA 3SGLA 5FS8A 1GRGA 3DGHA 4A79A 3LZWA 4AP3A 4G73A 4OPCA 3P9UA 3SFEA 2JK6A 2PYXA 1GSNA 1YKJA 1DXLA 1B4VA 1LQUA 2CULA 2Q0LA 2CDUA 2R4JA 4YSZA 5GRTA 4U2LA 5HY5A 2QAEA 3FPZA 2XFQA 3T31A 2O9ZA 2C67A 3AWIA 4Y4MA 2JKCA 2NVKX 3DMEA 4EMJA 2YG4A 4A7AA 1S2YA 3DJDA 2WBAA 2IVDA 5JCNA 3FMWA 1TDKA 3NRNA 4C5OA 4H4VA 2B9XA 3LZXA 1CC4A 1CHUA 4H4WA 1QLBA 2YLTA 4NNJA 1FL2A 1P2HA 5GSNA 2RGHA 3I6DA 4D03A 5HXIA 2YQUA 1JNZA 1ONFA 1OJTA 2V3AA 3LOVA 2GQFA 3AE3A 2TMDA 1MOKA 3PO7A 1IUUA 1H2IA 4NEWA 3P4QA 3R9UA 1PBEA 1DOCA 1VDCA 3UOYA 4LU6A 4Z2TA 3DJGX 2H89A 1B8SA 3ALMA 4GDPA 2DKHA 3KPFA 4TM3A 1XPQA 1NG4A 3DK9A 2BCGG 1XDIA 2Y6RA 3CNJA 4LIIA 2C70A 3G5QA 4U8JA 1H84A 4UP3A 2B9WA 3UOVA 1S2QA 4TLZA 1P2EA 1CC2A 4A99A 1DJQA 1ZMDA 3AECA 1H6VA 1ELIA 4OVIA 4Z43A 3AEFA 3NT6A 4KX6A 3UKQA 2WDQA 1D4EA 1N4VA 2ARDA 3GD3A 3BI5A 3PVCA 1PN0A 4YSXA 3SX6A 2XLUA 3VRAA 2BC1A 3T37A 3AE9A 4J2WA 1RP0A 2GRTA 5C2TA 4NEVA 4YTMA 1IUSA 1D7LA 2C65A 4CRTA 4X9NA 1ZY8A 4ADWA 4U8MA 1M6IA 5JCMA 2JB1A 1CJCA 2R46A 3M0OA 5CKUA 4CCQA 1IUXA 4YXDA 2C4CA 2GMHA 1K0IA 2XFPA 3AE8A 4CY8A 3BHKA 4TLXA 4EQWA 2BRAA 1ZK7A 3GMCA 1MO9A 3CPIG 3P4PA 1YY5A 5EBKA 1NHRA 1PHHA 5IPYA 2EQ8A 1KFYA 4YT0A 2C3CA 2EQ7A 3AEAA 2AR8A 1O94A 4USRA 3QSSA 4U2SA 4E0VA 1BF3A 4KPRA 2WQYA 3L8KA 4UDRA 3IF9A 1JEHA 1K0LA 5FS7A 1EL5A 2XVHA 2X50A 3LB8A 3RHAA 3UOZA 4II3A 3UTEA 4EQXA 2XLPA 4Z25A 1D7YA 2GR1A 4H50A 3BI4A 1DJNA 1F6MA 3UP5A 3Q9TA 1Q9IA 4BV6A 3V3OA 3AE2A 1NPXA 3UKFA 5KOWA 2WOWA 2HQMA 5U1OA 4CY6A 3M13A 1N1PA 5HYMA 2ZZBA 3L5OA 3RP7A 4XXGA 1QJDA 2OALA 5C3JA 1N4UA 4B1BA 1CJ4A 3VR9A 3NLCA 4X9MA 3CGDA 1KNPA 3UTFA 3CNSA 3CNPA 1EL7A 4HB9A 2GR3A 2JB2A 1ZOVA 4H7UA 1DOEA 1E1KA 5KRQA 2VZ2A 4RG3A 2BYBA 4GCMA 3CTYA 3NK0X 3B3RA 2QA2A 3AE7A 1OJDA 3CGEA 3ATQA 1H83A 3GYJA 4GRTA 1H86A 3NK1X 1PBDA 1JRXA 2FJBA 2Z5YA 3UKKA 2E1MA 4H4TA 3CPJG 4EM4A 2BRYA 1KN0A 2GB0A 2A87A 3SZ0A 5JCLA 2V60A 2WPFA 1OJ9A 2BK5A 3UTGA 3DA1A 2RGJA 5IQ1A 1GALA 4BURA 4OPUA 3ATRA 5KNLA 3WE0A 3T2YA 3GYIA 2WP9A 3AE5A 1CF3A 3NTAA 5U63A 1N4WA 1FECA 3QVPA 3RP6A 5HHFA 2C3DA 4WCTA 3IHGA 3AEGA 4EMIA 2YR4A 4J33A 1COYA 3FBSA 4XWRA 2XVJA 1GTEA 1TDOA 1L9DA 4O5UA 1O95A 3AYIA 3KA7A 4Y4NA 4C77A 3ICTA 3EANA 2WP6A 1L9EA 4A65A 3T14A 2FJAA 4AT2A 2WOVA 1NDAA 2GR2A 5KVHA 4J56A 2C73A 1S7MA 2Q6UA 5EOWA 1GRAA 5FMHA 3OZ2A 3NG7X 3QSEA 2BXSA 1BGNA 2YLSA 3BNUA 4OPIA 4AP1A 3GRSA 2R9ZA 1GETA 3E1TA 1YQ3A 2OA1A 3AEBA 4RG4A 3GRTA 1TDNA 2XLRA 3C96A 2BXRA 3ALLA 3UOXA 2A8XA 1YQ4A 1Y56A 1LVLA 4IVMB 2BACA 2Q0KA 1EL8A 1X31B 4H4YA 3REDA 4H4PA 3UKAA 2X99A 4AOXA 1ZKQA 1IUWA 5JRBA 4NZHA 1GRTA 1JNRA 3UKHA 2YVGA 3HYXA 3BHFA 4EQRA 4ZCCA 3AEDA 5KMPA 5KMSA 4U8PA 4Z24A 5IQ4A 2BS4A 2BK4A 4J31A 2AQJA 3HYVA 4G74A 2BABA 3F8DA 2NPXA 3NKSA 4GAPA 4WX1A 2YR6A 2XLTA 5JCKA 3NTDA 4Z2RA 2H88A 5KVIA 3T2ZA 4J57A 4JQ9A 3AEEA 3CMMA 1VRQB 1REOA 1K4QA 1UKVG 3ADAB 2QA1A 2R0GA 4DSHA 2CVJA 3GSIA 2RABA 5FS9A 2C75A 4C3YA 3SYIA 3DJJA 4G6GA 4BJYA 2GEWA 2R0CA 1LQTA 1BZLA 3GD4A 4JDRA 3SQPA 1E1NA 1JRYA 2WP5A 2PHHA 4K2XA 4Z44A 3QFAA 3ICSA 4FK1A 1LTXR 5KMQA 3UKLA 2W0HA 1EL9A 4EIPA 1GTHA 1Y56B 2E4GA 4N9XA 3QSMA 1GREA 4I59A 2V61A 2XFUA 4P9SA 4M52A 3RP8A 2XVFA 2VVMA 5KXJA 4U8IA 3P4SA 1GOSA 4YKFA 1NHSA 1LV0A 3NK2X 3D9XA 1ZOYA 4OCGA 2YLWA 5M10A 1B5QA 4J36A 3IHMA 4GUVA 3K7TA 1M64A 4ECHA 3L1RA 3EPTA 2GQWA 4GDEA 3AYLA 3EF6A 4JN9A 1ZX9A 2GH5A 3M12A 2ZZCA 3EAOA 3NHOX 4HA6A 1KSSA 2YLRA 4K5RA 4YSHA 1Z6LA 3DK8A 1PJ6A 1PS9A 4PABA 2GF3A 4TM1A 2JB3A 2X8GA 5TR3A 4UDPA 3SFDA 1RSGA 5J7XA 2WU5A 3UTHA 2Z5XA 4BJZA 4APNA 2B76A 3DJEA 1L9CA 3PG6A 2GAHB 4U8OA 2BC0A 1CBOA 1GT8A 1ZMCA 5BRTA 2XFOA 1TYTA 1F3PA 2WHDA 3V3NA 2TPRA 1LJ1A 4DNAA 3AD7B 4RSLA 5EB5A 4K8DA 1BWCA 4LA1A 3T0KA 4JY3A 1E1MA 3AE4A 3DK4A 4H4UA 1PXBA 3NH3X 1H7WA 2Q7VA 3AE6A 1Y0PA 4TM4A 2ACZA 4BK2A 2I0ZA 1PBFA 4BK1A 4REKA 1VG9A 4D04A 2GMJA 4I58A 2C7GA 4Z2UA 1GXFA 1JRZA 4BK3A 1E1LA 3GYXA 4B69A 3UKPA 5KWFA 2WETA 1CL0A 1F8RA 4JNQA 4JNAA 3IC9A 3AE1A 3VQRA 4CNKA 1GRHA 1D5TA 2C64A 4OPTA 3CNDA 4U8KA 1CJ2A 3K30A 1B37A 2VQ7A 1GERA 3NGCX 1S3BA 1XANA 4OPGA 1FCDA 1KNRA 3CGCA 2CFYA 1GRFA 3B6DA 3NN0X 2XVIA 4B66A 4UDQA 4A6NA 5FS6A 2B9YA 3HZLA 2YVJA 1BKWA 1NENA 3CPHG 3D1CA 5ER0A 3KLJA 2YG7A 1AOGA 3II4A 4IA6A 2AAQA 4EQSA 3JSKA 1TRBA 4FDCB 5U25A 1FOHA 1H82A 4H4RA 3GWFA 1NEKA 3SZCA 3GDNA 1DOBA 2FJEA 3C4NA 1FEAA 3H8LA 2XVEA 3T2KA 2WESA 3H8IA 1O5WA 5J60A 4A9WA 2XCGA 3G5SA 4MJWA 3VR8A 2FBWA 4B68A 1ZDLA 3NNEA 1D4CA 4YTPA 3LXDA 3S5WA 2OLOA 1PXCA 2GAGB 2V5ZA 2V3BA 2BA9A 1BGJA 1RYIA 5KOXA 1GESA 1PXAA 2OLNA 1IJHA 2YG6A 2R4EA 3D8XA 3CIRA 1HYUA 3CNTA 4IA5A 3ITJA 1JOAA 2X8CA 2YM1A 2DKIA 2QCUA 1PDHA 4O5QA 4FX9A 1JU2A 3HYWA 4AOSA 2XLSA 3SXIA 4YWOA 4FK1C 4TM0A 4U2TA 2B7SA 2BS3A 2YG3A 1GEUA 3QVRA 1GNDA 4H2NA 5DBJA 4A6NB 4EIQA 3GMBA 4GR1A 4ICYA 2JBVA 4K7ZA 1TDFA 1XHCA 4B64A 2R0PA 4OPDA 3AD9B 1CC6A 2YR5A 4A5LA 3SY4A 1KDGA 4IV9A 3F8RA 1W4XA 3OC4A 2YLZA 1PBCA 1DNCA 2GR0A 2A89A 2WS3A 3FG2P 3UP4A 2WPEA 5KMRA 3KD9A 4II2A 1E6EA 1LPFA 1NAAA 2E5VA 4H4XA 3K7MX 3QJ4A 1E39A 1CJ3A 3GDPA 3ZYXA 4YKGA 4AT0A 2B7RA 1YQZA 5LV9A 1MXTA 3UCLA 4C3XA 1E7PA 1V59A 4YSYA 2GVCA 2WDVA 1ZP0A 1GRBA 1EBDA 4XWZA 1PJ7A 2YM2A 2IVEA 3V76A 1GV4A 3NYEA 2C72A 4G6HA 2YAUA 4ZN0A 4H2QA 3F8PA 1Q1RA 4X4JA 3Q6JA 1QO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCP A;  3FIM B;  4EMW A;  2EQ6 A;  4ZCD A;  2ZZ0 A;  2VRL A;  2VVL A;  3AXB A;  4U8L A;  4H4Q A;  3BNM A;  2X8H A;  3P1W A;  4U8N A;  3KVE A;  1L0V A;  3LJP A;  3K7Q X;  2JAE A;  3QFB A;  3ALJ A;  3AD8 B;  4K22 A;  4K5S A;  1IUT A;  4NTD A;  3H4K A;  3CN8 A;  3NYF A;  4IVO B;  4EM3 A;  3NIX A;  2BS2 A;  4NTC A;  2WPC A;  3PS9 A;  1KF6 A;  1S3E A;  3BI2 A;  4J34 A;  3S61 A;  3DH9 A;  1H7X A;  3GWD A;  3ZDN A;  4B67 A;  4DSG A;  2V6O A;  2RGO A;  3VRB A;  4CCR A;  2VVL G;  1F8W A;  3CGB A;  2ZBW A;  3AYJ A;  3O0H A;  3DGZ A;  2C66 A;  4H2P A;  4JY2 A;  1TYP A;  1OJC A;  4Z26 A;  2X3N A;  2F5Z A;  2YWL A;  3NYC A;  2BK3 A;  2YVF A;  3ABV A;  1D4D A;  5JCI A;  1DOD A;  2GV8 A;  4H4Z A;  1VG0 A;  2WDR A;  2WU2 A;  2YG5 A;  2FJD A;  1NG3 A;  1VQW A;  2IID A;  3COX A;  3IWA A;  4PAA A;  4Y4L A;  2XYO A;  1FEB A;  1TDE A;  5M0Z A;  4OPL A;  2C76 A;  4GF7 A;  1NHP A;  2VOU A;  3ISH A;  1SEZ A;  2UZZ A;  1IUV A;  2XFN A;  1PBB A;  3G5R A;  3C4A A;  3I3L A;  3P4R A;  4NTE A;  2WEU A;  5L46 A;  4H4S A;  4C74 A;  2Y6Q A;  1H81 A;  1Q1W A;  3AB1 A;  2VRM A;  1F8S A;  2R45 A;  4USQ A;  2XDO A;  1OJA A;  5EB4 A;  5BVA A;  2J3N A;  3NN6 X;  1KSU A;  4B63 A;  2YLX A;  1GPE A;  3KU9 A;  4DGK A;  3KKJ A;  3ICR A;  1NHQ A;  4YTN A;  2EQ9 A;  2WOI A;  1PJ5 A;  5CQF A;  4B65 A;  3LAD A;  3SM8 A;  3URH A;  2VQB A;  1K0J A;  4H2R A;  3VRD B;  3RNM A;  5BUL A;  4CBQ A;  2APG A;  4CNJ A;  5BUK A;  2OAM A;  3SGL A;  5FS8 A;  1GRG A;  3DGH A;  4A79 A;  3LZW A;  4AP3 A;  4OPC A;  3P9U A;  3SFE A;  2JK6 A;  2PYX A;  1GSN A;  1YKJ A;  1DXL A;  1B4V A;  1LQU A;  2CUL A;  2Q0L A;  2CDU A;  2R4J A;  4YSZ A;  5GRT A;  4U2L A;  5HY5 A;  2QAE A;  3FPZ A;  2XFQ A;  2O9Z A;  2C67 A;  3AWI A;  4Y4M A;  2JKC A;  2NVK X;  3DME A;  4EMJ A;  2YG4 A;  4A7A A;  1S2Y A;  3DJD A;  2WBA A;  2IVD A;  5JCN A;  3FMW A;  1TDK A;  3NRN A;  4C5O A;  4H4V A;  2B9X A;  3LZX A;  1CC4 A;  1CHU A;  4H4W A;  1QLB A;  2YLT A;  1FL2 A;  1P2H A;  5GSN A;  2RGH A;  3I6D A;  4D03 A;  5HXI A;  2YQU A;  1JNZ A;  1ONF A;  1OJT A;  2V3A A;  3LOV A;  2GQF A;  3AE3 A;  2TMD A;  1MOK A;  3PO7 A;  1IUU A;  4NEW A;  3P4Q A;  3R9U A;  1PBE A;  1DOC A;  1VDC A;  3UOY A;  4LU6 A;  4Z2T A;  3DJG X;  2H89 A;  1B8S A;  3ALM A;  4GDP A;  2DKH A;  3KPF A;  4TM3 A;  1XPQ A;  1NG4 A;  3DK9 A;  2BCG G;  1XDI A;  2Y6R A;  3CNJ A;  4LII A;  2C70 A;  3G5Q A;  4U8J A;  1H84 A;  4UP3 A;  2B9W A;  3UOV A;  1S2Q A;  4TLZ A;  1P2E A;  1CC2 A;  4A99 A;  1DJQ A;  1ZMD A;  3AEC A;  1H6V A;  1ELI A;  4OVI A;  4Z43 A;  3AEF A;  3NT6 A;  4KX6 A;  3UKQ A;  2WDQ A;  1D4E A;  1N4V A;  2ARD A;  3GD3 A;  3BI5 A;  3PVC A;  1PN0 A;  4YSX A;  2XLU A;  3VRA A;  2BC1 A;  3T37 A;  3AE9 A;  4J2W A;  1RP0 A;  2GRT A;  5C2T A;  4NEV A;  4YTM A;  1IUS A;  1D7L A;  2C65 A;  4CRT A;  4X9N A;  1ZY8 A;  4ADW A;  4U8M A;  1M6I A;  5JCM A;  2JB1 A;  1CJC A;  2R46 A;  3M0O A;  5CKU A;  4CCQ A;  1IUX A;  4YXD A;  2GMH A;  1K0I A;  2XFP A;  3AE8 A;  4CY8 A;  3BHK A;  4TLX A;  4EQW A;  1ZK7 A;  3GMC A;  1MO9 A;  3CPI G;  3P4P A;  1YY5 A;  5EBK A;  1NHR A;  1PHH A;  5IPY A;  2EQ8 A;  1KFY A;  4YT0 A;  2C3C A;  2EQ7 A;  3AEA A;  2AR8 A;  1O94 A;  4USR A;  3QSS A;  4U2S A;  4E0V A;  1BF3 A;  4KPR A;  2WQY A;  3L8K A;  4UDR A;  3IF9 A;  1JEH A;  1K0L A;  5FS7 A;  1EL5 A;  2XVH A;  2X50 A;  3LB8 A;  3RHA A;  3UOZ A;  3UTE A;  4EQX A;  2XLP A;  4Z25 A;  1D7Y A;  2GR1 A;  4H50 A;  3BI4 A;  1DJN A;  1F6M A;  3UP5 A;  3Q9T A;  1Q9I A;  4BV6 A;  3V3O A;  3AE2 A;  1NPX A;  3UKF A;  5KOW A;  2WOW A;  2HQM A;  5U1O A;  4CY6 A;  3M13 A;  1N1P A;  5HYM A;  2ZZB A;  3RP7 A;  4XXG A;  1QJD A;  2OAL A;  5C3J A;  1N4U A;  4B1B A;  1CJ4 A;  3VR9 A;  3NLC A;  4X9M A;  3CGD A;  1KNP A;  3UTF A;  3CNS A;  3CNP A;  1EL7 A;  4HB9 A;  2GR3 A;  2JB2 A;  1ZOV A;  4H7U A;  1DOE A;  1E1K A;  5KRQ A;  2VZ2 A;  4RG3 A;  2BYB A;  4GCM A;  3CTY A;  3NK0 X;  3B3R A;  2QA2 A;  3AE7 A;  1OJD A;  3CGE A;  3ATQ A;  1H83 A;  3GYJ A;  4GRT A;  1H86 A;  3NK1 X;  1PBD A;  1JRX A;  2FJB A;  2Z5Y A;  3UKK A;  2E1M A;  4H4T A;  3CPJ G;  4EM4 A;  2GB0 A;  2A87 A;  5JCL A;  2V60 A;  2WPF A;  1OJ9 A;  2BK5 A;  3UTG A;  3DA1 A;  2RGJ A;  5IQ1 A;  1GAL A;  4BUR A;  4OPU A;  3ATR A;  3WE0 A;  3GYI A;  2WP9 A;  3AE5 A;  1CF3 A;  3NTA A;  5U63 A;  1N4W A;  1FEC A;  3QVP A;  3RP6 A;  5HHF A;  2C3D A;  4WCT A;  3IHG A;  3AEG A;  4EMI A;  2YR4 A;  4J33 A;  1COY A;  3FBS A;  4XWR A;  2XVJ A;  1GTE A;  1TDO A;  1L9D A;  4O5U A;  1O95 A;  3AYI A;  3KA7 A;  4Y4N A;  4C77 A;  3ICT A;  3EAN A;  2WP6 A;  1L9E A;  4A65 A;  2FJA A;  4AT2 A;  2WOV A;  1NDA A;  2GR2 A;  5KVH A;  4J56 A;  2C73 A;  2Q6U A;  5EOW A;  1GRA A;  5FMH A;  3OZ2 A;  3NG7 X;  3QSE A;  2BXS A;  1BGN A;  2YLS A;  3BNU A;  4OPI A;  4AP1 A;  3GRS A;  2R9Z A;  1GET A;  3E1T A;  1YQ3 A;  2OA1 A;  3AEB A;  4RG4 A;  3GRT A;  1TDN A;  2XLR A;  3C96 A;  2BXR A;  3ALL A;  3UOX A;  2A8X A;  1YQ4 A;  1Y56 A;  1LVL A;  4IVM B;  2BAC A;  2Q0K A;  1EL8 A;  1X31 B;  4H4Y A;  3RED A;  4H4P A;  3UKA A;  2X99 A;  4AOX A;  1ZKQ A;  1IUW A;  4NZH A;  1GRT A;  1JNR A;  3UKH A;  2YVG A;  4ZCC A;  3BHF A;  4EQR A;  3AED A;  4U8P A;  4Z24 A;  5IQ4 A;  2BS4 A;  2BK4 A;  4J31 A;  2AQJ A;  2BAB A;  3F8D A;  2NPX A;  3NKS A;  4WX1 A;  2YR6 A;  2XLT A;  5JCK A;  3NTD A;  4Z2R A;  2H88 A;  5KVI A;  4J57 A;  4JQ9 A;  3AEE A;  1VRQ B;  1REO A;  1K4Q A;  1UKV G;  3ADA B;  2QA1 A;  2R0G A;  4DSH A;  2CVJ A;  3GSI A;  2RAB A;  5FS9 A;  2C75 A;  4C3Y A;  3DJJ A;  4BJY A;  2GEW A;  2R0C A;  1LQT A;  1BZL A;  3GD4 A;  4JDR A;  3SQP A;  1E1N A;  1JRY A;  2WP5 A;  2PHH A;  4K2X A;  4Z44 A;  3QFA A;  3ICS A;  4FK1 A;  1LTX R;  3UKL A;  2W0H A;  1EL9 A;  4EIP A;  1GTH A;  1Y56 B;  2E4G A;  4N9X A;  3QSM A;  1GRE A;  4I59 A;  2V61 A;  2XFU A;  4P9S A;  4M52 A;  3RP8 A;  2XVF A;  2VVM A;  5KXJ A;  4U8I A;  3P4S A;  1GOS A;  4YKF A;  1NHS A;  1LV0 A;  3NK2 X;  1ZOY A;  4OCG A;  2YLW A;  5M10 A;  1B5Q A;  4J36 A;  3IHM A;  4GUV A;  3K7T A;  1M64 A;  4ECH A;  3L1R A;  3EPT A;  2GQW A;  4GDE A;  3AYL A;  3EF6 A;  4JN9 A;  1ZX9 A;  2GH5 A;  3M12 A;  2ZZC A;  3EAO A;  3NHO X;  4HA6 A;  1KSS A;  2YLR A;  4K5R A;  4YSH A;  1Z6L A;  3DK8 A;  1PJ6 A;  1PS9 A;  4PAB A;  2GF3 A;  4TM1 A;  2JB3 A;  2X8G A;  5TR3 A;  4UDP A;  3SFD A;  1RSG A;  5J7X A;  2WU5 A;  3UTH A;  2Z5X A;  4BJZ A;  4APN A;  2B76 A;  3DJE A;  1L9C A;  2GAH B;  4U8O A;  2BC0 A;  1CBO A;  1GT8 A;  1ZMC A;  5BRT A;  2XFO A;  1TYT A;  1F3P A;  2WHD A;  3V3N A;  2TPR A;  1LJ1 A;  4DNA A;  3AD7 B;  4RSL A;  5EB5 A;  4K8D A;  1BWC A;  4LA1 A;  4JY3 A;  1E1M A;  3AE4 A;  3DK4 A;  4H4U A;  1PXB A;  3NH3 X;  1H7W A;  2Q7V A;  3AE6 A;  1Y0P A;  4TM4 A;  2ACZ A;  4BK2 A;  2I0Z A;  1PBF A;  4BK1 A;  4REK A;  1VG9 A;  4D04 A;  2GMJ A;  4I58 A;  2C7G A;  4Z2U A;  1GXF A;  1JRZ A;  4BK3 A;  1E1L A;  4B69 A;  3UKP A;  5KWF A;  2WET A;  1CL0 A;  1F8R A;  4JNQ A;  4JNA A;  3IC9 A;  3AE1 A;  3VQR A;  4CNK A;  1GRH A;  1D5T A;  2C64 A;  4OPT A;  3CND A;  4U8K A;  1CJ2 A;  3K30 A;  1B37 A;  2VQ7 A;  1GER A;  3NGC X;  1S3B A;  1XAN A;  4OPG A;  1FCD A;  1KNR A;  3CGC A;  2CFY A;  1GRF A;  3B6D A;  3NN0 X;  2XVI A;  4B66 A;  4UDQ A;  4A6N A;  5FS6 A;  2B9Y A;  3HZL A;  2YVJ A;  1BKW A;  1NEN A;  3CPH G;  3D1C A;  5ER0 A;  3KLJ A;  2YG7 A;  1AOG A;  3II4 A;  4IA6 A;  2AAQ A;  4EQS A;  3JSK A;  1TRB A;  4FDC B;  5U25 A;  1FOH A;  1H82 A;  4H4R A;  3GWF A;  1NEK A;  3GDN A;  1DOB A;  2FJE A;  3C4N A;  1FEA A;  3H8L A;  2XVE A;  2WES A;  3H8I A;  1O5W A;  5J60 A;  4A9W A;  2XCG A;  3G5S A;  4MJW A;  3VR8 A;  2FBW A;  4B68 A;  1ZDL A;  3NNE A;  1D4C A;  4YTP A;  3LXD A;  3S5W A;  2OLO A;  1PXC A;  2GAG B;  2V5Z A;  2V3B A;  2BA9 A;  1BGJ A;  1RYI A;  5KOX A;  1GES A;  1PXA A;  2OLN A;  1IJH A;  2YG6 A;  2R4E A;  3D8X A;  3CIR A;  1HYU A;  3CNT A;  4IA5 A;  3ITJ A;  1JOA A;  2X8C A;  2YM1 A;  2DKI A;  2QCU A;  1PDH A;  4O5Q A;  4FX9 A;  1JU2 A;  4AOS A;  2XLS A;  4YWO A;  4FK1 C;  4TM0 A;  4U2T A;  2B7S A;  2BS3 A;  2YG3 A;  1GEU A;  3QVR A;  1GND A;  4H2N A;  5DBJ A;  4A6N B;  4EIQ A;  3GMB A;  4GR1 A;  4ICY A;  2JBV A;  4K7Z A;  1TDF A;  1XHC A;  4B64 A;  2R0P A;  4OPD A;  3AD9 B;  1CC6 A;  2YR5 A;  4A5L A;  1KDG A;  4IV9 A;  3F8R A;  1W4X A;  3OC4 A;  2YLZ A;  1PBC A;  1DNC A;  2GR0 A;  2A89 A;  2WS3 A;  3FG2 P;  3UP4 A;  2WPE A;  3KD9 A;  1E6E A;  1LPF A;  1NAA A;  2E5V A;  4H4X A;  3K7M X;  3QJ4 A;  1E39 A;  1CJ3 A;  3GDP A;  3ZYX A;  4YKG A;  4AT0 A;  2B7R A;  1YQZ A;  5LV9 A;  1MXT A;  3UCL A;  4C3X A;  1E7P A;  1V59 A;  4YSY A;  2GVC A;  2WDV A;  1ZP0 A;  1GRB A;  1EBD A;  4XWZ A;  1PJ7 A;  2YM2 A;  2IVE A;  3V76 A;  1GV4 A;  3NYE A;  2C72 A;  2YAU A;  4ZN0 A;  4H2Q A;  3F8P A;  1Q1R A;  4X4J A;  3Q6J A;  1QO8 A; 
#chains in the Genus database with same CATH topology
 4U8L A;  3BNM A;  2X8H A;  3R0U A;  1L0V A;  3DFH A;  3K7Q X;  1IUT A;  3OTR A;  3H4K A;  4IVO B;  3NIX A;  3JZU A;  2HXT A;  4GAV A;  3H70 A;  3DG3 A;  3ZLG A;  3ZDN A;  3N6H A;  2DW6 A;  3VRB A;  3R0K A;  2VVL G;  1F8W A;  3CGB A;  3O0H A;  1OJC A;  2F5Z A;  2BK3 A;  2PMQ A;  1VQW A;  3SSZ A;  3CXO A;  4E5T A;  4H2H A;  2RDX A;  3B9J B;  4IL2 A;  1IUV A;  2XFN A;  3C4A A;  3I3L A;  2Y6Q A;  5BVA A;  2XDO A;  1OJA A;  1R0M A;  2YLX A;  1PJ5 A;  5CQF A;  3A7R A;  3CXB A;  3URH A;  3UCC A;  2VQB A;  4H2R A;  3VRD B;  5BUL A;  3SGL A;  4A79 A;  4AP3 A;  3IJI A;  2PYX A;  1DXL A;  1N61 C;  2CUL A;  3IJL A;  4GYP A;  5HY5 A;  3V5F A;  4EMJ A;  4A7A A;  3DJD A;  3FMW A;  3PK7 A;  3LZX A;  4H4W A;  1QLB A;  2YLT A;  3R1Z A;  1FL2 A;  1X2G A;  2RGH A;  5BOF A;  1JNZ A;  2V3A A;  3R9U A;  1PBE A;  2H89 A;  1XPQ A;  3G5Q A;  2OPJ A;  3UOV A;  1S2Q A;  2I5Q A;  4TLZ A;  1CC2 A;  3R25 A;  1ELI A;  4OVI A;  3NT6 A;  3BI5 A;  2XLU A;  3Q4D A;  2C65 A;  1CJC A;  4CCQ A;  2QDD A;  3AE8 A;  4IT1 A;  4KT2 A;  1YY5 A;  5IPY A;  1NHR A;  2EQ8 A;  2P8C A;  2AL2 A;  4E0V A;  1BF3 A;  2WQY A;  3IF9 A;  3RHA A;  2W3R A;  2X50 A;  4II3 A;  3UTE A;  1FFV C;  3STP A;  2XLP A;  4Z25 A;  4H50 A;  3Q9T A;  3V3O A;  3AE2 A;  1NPX A;  3UKF A;  2WOW A;  2HQM A;  3N4F A;  1TE6 A;  2GGH A;  2ZZB A;  2OVL A;  2OAL A;  3TCS A;  1EL7 A;  2GR3 A;  3FYY A;  3B3R A;  3AE7 A;  1OJD A;  2AL2 B;  2W3S A;  4G7F A;  3N4E A;  1JRX A;  2E1M A;  3ENL A;  3DA1 A;  2RGJ A;  4HNL A;  3FVD A;  4BUR A;  4OPU A;  5KNL A;  4X2P A;  3NXL A;  2WP9 A;  1CF3 A;  3NTA A;  1FEC A;  3QVP A;  2C3D A;  4XWR A;  1L9D A;  2OZ3 A;  2WP6 A;  4A65 A;  1NDA A;  2GR2 A;  5KVH A;  1S7M A;  5FMH A;  3QSE A;  4OPI A;  2OA1 A;  3C96 A;  3UOX A;  2PCE A;  1LVL A;  2BAC A;  2Q0K A;  3NRZ B;  4AOX A;  3EUB 3;  1IUW A;  5JRB A;  3UKH A;  2YVG A;  4ZCC A;  4J31 A;  2AQJ A;  1WUF A;  3R10 A;  4Z2R A;  2H88 A;  4J57 A;  4JQ9 A;  1IYX A;  3ADA B;  3VC6 A;  2QA1 A;  4DSH A;  2AL1 A;  1N62 C;  3QLD A;  2GEW A;  2R0C A;  1BZL A;  4JDR A;  2WP5 A;  3NVZ B;  4FK1 A;  1EL9 A;  1GTH A;  2E4G A;  3ZVI A;  1GRE A;  4H19 A;  1NHS A;  4OCG A;  2PGE A;  3IHM A;  1W6T A;  4YWS A;  4ECH A;  1SJA A;  1ONE A;  3AYL A;  4K5R A;  3EAO A;  3DK8 A;  3QN3 A;  3OPS A;  4UDP A;  2P8B A;  5J7X A;  3UTH A;  1L9C A;  1GT8 A;  1ZMC A;  2XFO A;  2OG9 A;  2OLA A;  4DNA A;  5EB5 A;  1BWC A;  4LA1 A;  4B67 A;  2PTZ A;  3AE4 A;  1KKR A;  4Z17 A;  3OP2 A;  2ACZ A;  4TVY A;  2I0Z A;  2GMJ A;  4B69 A;  1CL0 A;  1F8R A;  4JNA A;  3AE1 A;  3I6E A;  4CNK A;  4U8K A;  3NFU A;  3K30 A;  2VQ7 A;  3A7U A;  4OPG A;  3UJE A;  2CFY A;  1GRF A;  3B6D A;  4GME A;  2XVI A;  4MMW A;  1NEN A;  3MY9 A;  3DER A;  2PTW A;  1STZ A;  1TRB A;  4FDC B;  1FOH A;  6ENL A;  3SZC A;  2FYM A;  1FEA A;  2XVE A;  3T2K A;  3H8A A;  3QTP A;  5G5G B;  4A9W A;  2XCG A;  4MJW A;  3CAW A;  4B68 A;  1ELS A;  3UJS A;  1D4C A;  2BA9 A;  2YG6 A;  3ITJ A;  4O5Q A;  4AOS A;  4FX9 A;  1JU2 A;  2XLS A;  2BS3 A;  4EIQ A;  4GR1 A;  4ICY A;  3Q45 A;  3U9I A;  1F9C A;  4A5L A;  1KDG A;  3OC4 A;  1DNC A;  3SR6 B;  1X2H A;  3UP4 A;  5KMR A;  1E6E A;  1VQZ A;  4GFI A;  1NAA A;  2E5V A;  3QJ4 A;  2GGI A;  1E39 A;  3ZYX A;  1YQZ A;  4C3X A;  1E7P A;  2WDV A;  4ZN0 A;  3F8P A;  1FHU A;  2BCP A;  3FIM B;  4EMW A;  2VRL A;  2POD A;  4KPL A;  4H4Q A;  1JPD X;  3KVE A;  4DX3 A;  3LJP A;  3ALJ A;  4NTD A;  4EM3 A;  3SZF A;  3PS9 A;  4J1O A;  2V6O A;  4HCD A;  5FJT A;  2RGO A;  2P0I A;  4CCR A;  3AYJ A;  1ECQ A;  4G9K A;  3DGZ A;  2C66 A;  3SZW A;  2X3N A;  3NYC A;  3DGB A;  2YVF A;  5JCI A;  3BSM A;  4DN1 A;  2WU2 A;  2YG5 A;  3COX A;  3IWA A;  3CYJ A;  4OPL A;  3G5R A;  4NTE A;  1H81 A;  5EB4 A;  2VRM A;  2R45 A;  2J3N A;  1KSU A;  4DGK A;  1T3Q C;  2EQ9 A;  2WOI A;  4B65 A;  3LAD A;  3SM8 A;  3PFR A;  3RNM A;  4CBQ A;  4CNJ A;  5BUK A;  4K8G A;  3LZW A;  4G73 A;  4OPC A;  3SFE A;  5FJO A;  1YKJ A;  3DG7 A;  2Q0L A;  2CDU A;  2R4J A;  1EBG A;  4U2L A;  2XFQ A;  2O9Z A;  3AWI A;  2QVH A;  2AKZ A;  1TZZ A;  4E4U A;  1TDK A;  4C5O A;  4H4V A;  4JHM A;  1CC4 A;  5GSN A;  1ONF A;  3LOV A;  3MSY A;  2TMD A;  3PO7 A;  1NU5 A;  4NEW A;  3P4Q A;  2PGW A;  2CHR A;  4Z2T A;  3ALM A;  3DK9 A;  2BCG G;  2C70 A;  1P2E A;  1RVK A;  3AEC A;  1H6V A;  4Z43 A;  1N4V A;  3VRA A;  3T37 A;  2HXU A;  1RP0 A;  1ZY8 A;  1SB3 B;  2NQL A;  1M6I A;  5JCM A;  2R46 A;  4YXD A;  1IUX A;  2OZ8 A;  2XFP A;  4CY8 A;  4TLX A;  4EQW A;  3TTE A;  3CPI G;  3P4P A;  1PHH A;  4YT0 A;  2C3C A;  1DTN A;  1ZXI C;  1O94 A;  4UDR A;  5FS7 A;  3LB8 A;  3EEZ A;  1D7Y A;  2GR1 A;  1F6M A;  4ROP A;  1Q9I A;  4BV6 A;  5U1O A;  2QJM A;  5C3J A;  1N4U A;  4B1B A;  3VR9 A;  3CGD A;  1KNP A;  3FJ4 A;  3CNP A;  1ZOV A;  4GCM A;  3T8Q A;  3MWC A;  4DWD A;  3UKK A;  4H4T A;  4EM4 A;  1KN0 A;  1OJ9 A;  2BK5 A;  5EU9 A;  5IQ1 A;  4E6M A;  2HZG A;  3WE0 A;  3AE5 A;  3RP6 A;  4WCT A;  4KEM A;  1COY A;  7ENL A;  2XVJ A;  1GTE A;  4Y4N A;  3ICT A;  1L9E A;  4J56 A;  3NG7 X;  5G5H B;  1BGN A;  4K2S A;  3GO2 A;  2GDQ A;  2R9Z A;  1YQ3 A;  4RG4 A;  3AEB A;  2BXR A;  2ZC8 A;  3SBF A;  4H4Y A;  1ZKQ A;  4NZH A;  1GRT A;  5KMP A;  3HYX A;  4GIS A;  3T6C A;  2BS4 A;  2BK4 A;  3HYV A;  4G74 A;  3NKS A;  4GAP A;  5IDZ A;  5FJU A;  2YR6 A;  5JCK A;  3NTD A;  5KVI A;  1REO A;  1K4Q A;  1UKV G;  3UJF A;  4C3Y A;  3SYI A;  3DJJ A;  1E1N A;  1JRY A;  3MQT A;  2W0H A;  3SN4 A;  1FHV A;  4N9X A;  3DEQ A;  4DXK A;  2V61 A;  4P9S A;  2VVM A;  3TWB A;  3TJ4 A;  5M10 A;  1B5Q A;  1M64 A;  1P43 A;  1PDY A;  3TOY A;  4JN9 A;  2ZZC A;  4YSH A;  1PS9 A;  1WYG A;  2WU5 A;  2B76 A;  3DJE A;  3SN1 A;  1LJ1 A;  4RSL A;  4K8D A;  2OKT A;  4H4U A;  1PXB A;  3AE6 A;  3VCN A;  1PBF A;  1VG9 A;  3EKG A;  4I58 A;  1GXF A;  4BK3 A;  1E1L A;  3UKP A;  5FJP A;  3VQR A;  4OPT A;  1CJ2 A;  3NGC X;  1FCD A;  4UDQ A;  5FS6 A;  1E9I A;  3HZL A;  3D1C A;  3KLJ A;  4IA6 A;  3MUC A;  3JSK A;  3ZVH A;  5U25 A;  1H82 A;  5J60 A;  1O5W A;  3RO6 A;  3OW1 A;  3S5W A;  3HW2 A;  2OLO A;  1XS2 A;  3H12 A;  5BOE A;  1GES A;  2OLN A;  3NVV B;  1IJH A;  3FCP A;  4MGG A;  2X8C A;  1PDH A;  3V4B A;  4U2T A;  1TDF A;  4B64 A;  4OPD A;  2PP0 A;  3NO1 A;  4IV9 A;  3F8R A;  1EC7 A;  1W4X A;  3ZVH B;  3S47 A;  2A89 A;  2WPE A;  4II2 A;  3UGV A;  1LPF A;  4H4X A;  3GDP A;  4YKG A;  4AT0 A;  4IHC A;  5LV9 A;  3VDG A;  1V97 A;  2GVC A;  1ZP0 A;  2YM2 A;  2IVE A;  4G6H A;  2YAU A;  1QO8 A;  2EQ6 A;  4IZG A;  4ZCD A;  2ZZ0 A;  2VVL A;  3GC2 A;  2MNR A;  4U8N A;  1JRO A;  1XPY A;  2JAE A;  3QFB A;  3AD8 B;  4K22 A;  2OX4 A;  4K5S A;  3TJI A;  3NYF A;  2WPC A;  4J34 A;  1H7X A;  4ZA0 A;  2ZBW A;  4H2P A;  3KPK A;  3VC5 A;  1TYP A;  4Z26 A;  2YWL A;  3ABV A;  1D4D A;  2GV8 A;  1VG0 A;  4Z1Y A;  2FJD A;  3IJQ A;  4Y4L A;  2XYO A;  1FEB A;  4NWZ A;  3VA8 A;  2PTY A;  2DW7 A;  2VOU A;  4KWS A;  4JN7 A;  5L46 A;  4HPN A;  3AB1 A;  1Q1W A;  1F8S A;  3NN6 X;  1R6W A;  4B63 A;  3KUM A;  1GPE A;  3KU9 A;  3ICR A;  1NHQ A;  4YTN A;  4GGB A;  3V5C A;  3DGH A;  3P9U A;  1GSN A;  1FFU C;  1LQU A;  3OZY A;  4YSZ A;  3T31 A;  4JN8 A;  4Y4M A;  2WBA A;  1N5W C;  2IVD A;  2OZT A;  3NRN A;  2AKM A;  3R11 A;  4NNJ A;  1P2H A;  5J04 A;  4GGH A;  3AE3 A;  1MOK A;  3THU A;  1IUU A;  4HN8 A;  4LU6 A;  4ENL A;  2DKH A;  4TM3 A;  1XDI A;  3CNJ A;  4UP3 A;  1H84 A;  2B9W A;  1N63 C;  4A99 A;  1DJQ A;  3SJN A;  3BJS A;  3AEF A;  4KX6 A;  2WDQ A;  2ARD A;  3GD3 A;  1PN0 A;  4J2W A;  1D7L A;  3DDM A;  4ADW A;  2JB1 A;  3M0O A;  2C4C A;  1K0I A;  2O56 A;  2BRA A;  1ZK7 A;  3D47 A;  3AEA A;  3QSS A;  4U2S A;  1FO4 A;  4KPR A;  3D46 A;  1EL5 A;  3MKC A;  3V3W A;  3BI4 A;  1DJN A;  3UP5 A;  4CY6 A;  3M13 A;  3RP7 A;  4J3Z A;  1QJD A;  1CJ4 A;  3UJ2 A;  3CNS A;  5KRQ A;  2VZ2 A;  4RG3 A;  2BYB A;  3R07 C;  4GYP C;  3CGE A;  3ATQ A;  3GYJ A;  3RRA A;  3RR1 A;  1PBD A;  2Z5Y A;  3TW9 A;  3CPJ G;  2GB0 A;  2A87 A;  5JCL A;  2V60 A;  3MZN A;  1GAL A;  3T2Y A;  3UJR A;  3RIT A;  3HRD C;  1VDV A;  3S5S A;  3IHG A;  4A35 A;  3P3B A;  2YR4 A;  4J33 A;  3HPF A;  3P93 A;  1TDO A;  3AYI A;  3NS1 B;  3FXG A;  3KA7 A;  4C77 A;  3T14 A;  2FJA A;  4AT2 A;  2WOV A;  3QKE A;  2C73 A;  2BXS A;  3U4F A;  1FIQ B;  3BNU A;  1EC9 A;  4AP1 A;  3UXL A;  1SJB A;  1GET A;  3E1T A;  3ALL A;  1Y56 A;  3BOX A;  1EL8 A;  3RED A;  3UKA A;  1JNR A;  4EQR A;  3AED A;  4U8P A;  5IQ4 A;  3F8D A;  2NPX A;  4WX1 A;  3A7A A;  3JW7 A;  2XLT A;  2PTX A;  3CMM A;  2RAB A;  5FS9 A;  2C75 A;  4G6G A;  4IP4 A;  4BJY A;  4Z44 A;  4K2X A;  3SQP A;  2PHH A;  3ICS A;  1LTX R;  3UCD A;  2PS2 A;  3JVA A;  4A3R A;  2W54 A;  3SN0 A;  1Y56 B;  4I59 A;  2GGE A;  2XFU A;  3RP8 A;  3CT2 A;  4HNC A;  4U8I A;  1GOS A;  4YKF A;  3D9X A;  2OFJ A;  4J36 A;  3K7T A;  3L1R A;  2P88 A;  1ZX9 A;  2GH5 A;  3M12 A;  3GD6 A;  2YLR A;  1Z6L A;  1PJ6 A;  4PAB A;  2X8G A;  5TR3 A;  1RSG A;  3P0W A;  3H7V A;  2QJJ A;  5BRT A;  2WHD A;  3V3N A;  2XH0 A;  2TPR A;  1JRP A;  1BKH A;  1E1M A;  3NH3 X;  3OZM A;  1H7W A;  2Q7V A;  1Y0P A;  4HCL A;  2GSH A;  4BK1 A;  4REK A;  4D04 A;  1OEP A;  1JRZ A;  2XH7 A;  2WET A;  3VCC A;  1GRH A;  2C64 A;  4FP1 A;  1GER A;  1XAN A;  3T9P A;  3NN0 X;  4A6N A;  2B9Y A;  1P48 A;  3II4 A;  4EQS A;  4H4R A;  3RGT A;  3GWF A;  4HCH A;  1NEK A;  3GDN A;  1DOB A;  2FJE A;  3C4N A;  3G5S A;  3VR8 A;  2FBW A;  3NNE A;  4YTP A;  3LXD A;  1PXC A;  2V3B A;  3PWI A;  1RYI A;  5KOX A;  1PXA A;  3CIR A;  1HYU A;  3CNT A;  4IA5 A;  1JOA A;  2YM1 A;  2DKI A;  3HYW A;  3SXI A;  4FK1 C;  4HYR A;  4H2N A;  4A6N B;  1JCT A;  3AN1 A;  2JBV A;  1CC6 A;  2YR5 A;  3SY4 A;  2YLZ A;  1PBC A;  3K1G A;  4ZCW A;  2E5A A;  3KD9 A;  3K7M X;  3NZG A;  2P3Z A;  2B7R A;  1MXT A;  3UCL A;  4YSY A;  3NYE A;  2OQY A;  2OO6 A;  3SQS A;  4E8G A;  2XH2 A;  3AXB A;  3P1W A;  2PP3 A;  3CN8 A;  2BS2 A;  3TQP A;  4NTC A;  1KF6 A;  1S3E A;  3BI2 A;  3S61 A;  3DH9 A;  3GWD A;  4DSG A;  4JY2 A;  4M6U A;  2GGJ A;  1DOD A;  4H4Z A;  2WDR A;  2IID A;  1NG3 A;  4PAA A;  1TDE A;  5M0Z A;  1KD0 A;  2XH4 A;  2C76 A;  4GF7 A;  1NHP A;  3ISH A;  1SEZ A;  2UZZ A;  1PBB A;  3P4R A;  2WEU A;  4H4S A;  3VFC A;  4C74 A;  4USQ A;  4GIR A;  3KKJ A;  1K0J A;  3N6J A;  2APG A;  2OAM A;  5FS8 A;  1GRG A;  1MDL A;  2JK6 A;  2PPG A;  1B4V A;  3DIP A;  5GRT A;  2QAE A;  3FPZ A;  4MKS A;  3ZLF A;  2C67 A;  2JKC A;  2NVK X;  3DME A;  2YG4 A;  1S2Y A;  5JCN A;  1YEY A;  1PDZ A;  2B9X A;  1CHU A;  3I4K A;  3I6D A;  4D03 A;  5HXI A;  2YQU A;  1OJT A;  2GQF A;  1H2I A;  4DYE A;  3ES8 A;  1DOC A;  1VDC A;  1BQG A;  3UOY A;  3DJG X;  1B8S A;  4GDP A;  3KPF A;  1NG4 A;  2Y6R A;  4LII A;  4U8J A;  1EC8 A;  1ZMD A;  2POZ A;  2PU1 A;  3UKQ A;  2OQH A;  1D4E A;  3PVC A;  4YSX A;  3SX6 A;  2BC1 A;  4DHG A;  3AE9 A;  3NVW B;  2GRT A;  5C2T A;  4NEV A;  4YTM A;  1IUS A;  4CRT A;  4X9N A;  4U8M A;  5CKU A;  1MDR A;  4H83 A;  2GMH A;  1SJD A;  3BHK A;  3CK5 A;  3GMC A;  1MO9 A;  5EBK A;  1KFY A;  2EQ7 A;  2AR8 A;  4USR A;  2ONE A;  1MRA A;  2FKP A;  3L8K A;  1JEH A;  1K0L A;  2XVH A;  3UOZ A;  4EQX A;  3ES7 A;  4M0X A;  2W55 A;  1NEL A;  5KOW A;  1N1P A;  5HYM A;  3L5O A;  4XXG A;  1RM6 B;  2PP1 A;  3NLC A;  3AMZ A;  4X9M A;  2GGG A;  3UTF A;  3DES A;  4HB9 A;  2PSN A;  2JB2 A;  4H7U A;  1DOE A;  1E1K A;  4ZOH B;  3DG6 A;  3CTY A;  3NK0 X;  1JDF A;  2QA2 A;  1H83 A;  4GRT A;  1H86 A;  3NK1 X;  2FJB A;  1MUC A;  1SJC A;  2BRY A;  3GY1 A;  3SZ0 A;  2XGZ A;  2WPF A;  2MUC A;  3UTG A;  3AM9 A;  1TKK A;  3B97 A;  3ATR A;  3GYI A;  1L8P A;  2PU0 A;  5U63 A;  1N4W A;  5HHF A;  3AEG A;  4EMI A;  4F4R A;  4EWJ A;  3FBS A;  3ZLH A;  3RCY A;  4O5U A;  1O95 A;  3DFY A;  3EAN A;  4A6G A;  2Q6U A;  5EOW A;  1GRA A;  3OZ2 A;  2YLS A;  3GRS A;  3GRT A;  1TDN A;  2XLR A;  2A8X A;  1YQ4 A;  4IVM B;  4K1W A;  1X31 B;  4H4P A;  2X99 A;  2QJN A;  3BHF A;  5KMS A;  4Z24 A;  2BAB A;  4TVW A;  1EBH A;  2QQ6 A;  3T2Z A;  3AEE A;  1VRQ B;  2R0G A;  2CVJ A;  3GSI A;  1LQT A;  3GD4 A;  3UKL A;  3QFA A;  5KMQ A;  4EIP A;  3QSM A;  3T4W A;  4M52 A;  2XVF A;  5KXJ A;  3P4S A;  3NK2 X;  1LV0 A;  1ZOY A;  2YLW A;  2PA6 A;  4G8T A;  4GUV A;  3EPT A;  2GQW A;  4GDE A;  4E4F A;  3EF6 A;  4HA6 A;  3NHO X;  2GL5 A;  1KSS A;  4H1Z A;  3UXK A;  2GF3 A;  4TM1 A;  2ZAD A;  2JB3 A;  3SFD A;  3NVY B;  2Z5X A;  4BJZ A;  4APN A;  1N5X A;  3PG6 A;  2GAH B;  4U8O A;  2BC0 A;  1CBO A;  1KCZ A;  2XSX A;  1TYT A;  1F3P A;  3CB3 A;  3AD7 B;  3T0K A;  4JY3 A;  3DK4 A;  4TM4 A;  4BK2 A;  2C7G A;  4Z2U A;  3GYX A;  5KWF A;  5ENL A;  4JNQ A;  3IC9 A;  4FI4 A;  5FJR A;  1D5T A;  3CND A;  3IK4 A;  1B37 A;  1S3B A;  1KNR A;  3CGC A;  3FV9 A;  1MNS A;  3QPE A;  2E3T A;  4B66 A;  2YVJ A;  1BKW A;  3CPH G;  5ER0 A;  2YG7 A;  1AOG A;  2AAQ A;  3H8L A;  3TWA A;  1JPM A;  2WES A;  3H8I A;  1ZDL A;  4IL0 A;  2GAG B;  2V5Z A;  1BGJ A;  2R4E A;  3D8X A;  2HNE A;  2QCU A;  4IP5 A;  4YWO A;  1N60 C;  4TM0 A;  2QDE A;  2B7S A;  2YG3 A;  3QVR A;  1GEU A;  5DBJ A;  1GND A;  3GMB A;  4K7Z A;  1XHC A;  1WUE A;  2R0P A;  3AD9 B;  3I6T A;  1KKO A;  2GR0 A;  2WS3 A;  3FG2 P;  1CJ3 A;  2QGY A;  1V59 A;  1GRB A;  1EBD A;  4XWZ A;  3PWG A;  1PJ7 A;  3V76 A;  1GV4 A;  2C72 A;  4H2Q A;  1Q1R A;  4X4J A;  3Q6J A;  3ETR B; 
#chains in the Genus database with same CATH homology
 2BCP A;  3FIM B;  4EMW A;  2EQ6 A;  4ZCD A;  2ZZ0 A;  2VRL A;  2VVL A;  3AXB A;  4U8L A;  4H4Q A;  3BNM A;  2X8H A;  3P1W A;  4U8N A;  3KVE A;  1L0V A;  3LJP A;  3K7Q X;  2JAE A;  3QFB A;  3ALJ A;  3AD8 B;  4K22 A;  4K5S A;  1IUT A;  4NTD A;  3H4K A;  3CN8 A;  3NYF A;  4IVO B;  4EM3 A;  3NIX A;  2BS2 A;  4NTC A;  3SZF A;  2WPC A;  3PS9 A;  1KF6 A;  1S3E A;  3BI2 A;  4GAV A;  4J34 A;  3S61 A;  3DH9 A;  1H7X A;  3GWD A;  3ZDN A;  4B67 A;  4DSG A;  2V6O A;  2RGO A;  3VRB A;  4CCR A;  2VVL G;  1F8W A;  3CGB A;  2ZBW A;  3AYJ A;  3O0H A;  3DGZ A;  2C66 A;  3KPK A;  4G9K A;  4H2P A;  4JY2 A;  1TYP A;  1OJC A;  3SZW A;  4Z26 A;  2X3N A;  2F5Z A;  2YWL A;  3NYC A;  2BK3 A;  2YVF A;  3ABV A;  1D4D A;  5JCI A;  1DOD A;  2GV8 A;  4H4Z A;  1VG0 A;  2WDR A;  2WU2 A;  2YG5 A;  2FJD A;  1NG3 A;  1VQW A;  2IID A;  3COX A;  3IWA A;  4PAA A;  4Y4L A;  2XYO A;  1FEB A;  1TDE A;  4NWZ A;  5M0Z A;  4OPL A;  2C76 A;  4GF7 A;  1NHP A;  2VOU A;  3ISH A;  1SEZ A;  2UZZ A;  1IUV A;  2XFN A;  1PBB A;  3G5R A;  3C4A A;  3I3L A;  3P4R A;  4NTE A;  2WEU A;  5L46 A;  4H4S A;  4C74 A;  2Y6Q A;  1H81 A;  1Q1W A;  3AB1 A;  2VRM A;  1F8S A;  2R45 A;  4USQ A;  2XDO A;  1OJA A;  5EB4 A;  5BVA A;  2J3N A;  3NN6 X;  1KSU A;  4B63 A;  2YLX A;  1GPE A;  3KU9 A;  4DGK A;  3KKJ A;  3ICR A;  1NHQ A;  4YTN A;  2EQ9 A;  2WOI A;  1PJ5 A;  5CQF A;  4B65 A;  3LAD A;  3SM8 A;  3URH A;  2VQB A;  1K0J A;  4H2R A;  3VRD B;  3RNM A;  5BUL A;  4CBQ A;  2APG A;  4CNJ A;  5BUK A;  2OAM A;  3SGL A;  5FS8 A;  1GRG A;  3DGH A;  4A79 A;  3LZW A;  4AP3 A;  4G73 A;  4OPC A;  3P9U A;  3SFE A;  2JK6 A;  2PYX A;  1GSN A;  1YKJ A;  1DXL A;  1B4V A;  1LQU A;  2CUL A;  2Q0L A;  2CDU A;  2R4J A;  4YSZ A;  5GRT A;  4U2L A;  5HY5 A;  2QAE A;  3FPZ A;  2XFQ A;  3T31 A;  2O9Z A;  2C67 A;  3AWI A;  4Y4M A;  2JKC A;  2NVK X;  3DME A;  4EMJ A;  2YG4 A;  4A7A A;  1S2Y A;  3DJD A;  2WBA A;  2IVD A;  5JCN A;  3FMW A;  1TDK A;  3NRN A;  4C5O A;  4H4V A;  2B9X A;  3LZX A;  1CC4 A;  1CHU A;  4H4W A;  1QLB A;  2YLT A;  4NNJ A;  1FL2 A;  1P2H A;  5GSN A;  2RGH A;  3I6D A;  4D03 A;  5HXI A;  2YQU A;  1JNZ A;  1ONF A;  1OJT A;  2V3A A;  3LOV A;  2GQF A;  3AE3 A;  2TMD A;  1MOK A;  3PO7 A;  1IUU A;  1H2I A;  4NEW A;  3P4Q A;  3R9U A;  1PBE A;  1DOC A;  1VDC A;  3UOY A;  4LU6 A;  4Z2T A;  3DJG X;  2H89 A;  1B8S A;  3ALM A;  4GDP A;  2DKH A;  3KPF A;  4TM3 A;  1XPQ A;  1NG4 A;  3DK9 A;  2BCG G;  1XDI A;  2Y6R A;  3CNJ A;  4LII A;  2C70 A;  3G5Q A;  4U8J A;  1H84 A;  4UP3 A;  2B9W A;  3UOV A;  1S2Q A;  4TLZ A;  1P2E A;  1CC2 A;  4A99 A;  1DJQ A;  1ZMD A;  3AEC A;  1H6V A;  1ELI A;  4OVI A;  4Z43 A;  3AEF A;  3NT6 A;  4KX6 A;  3UKQ A;  2WDQ A;  1D4E A;  1N4V A;  2ARD A;  3GD3 A;  3BI5 A;  3PVC A;  1PN0 A;  4YSX A;  3SX6 A;  2XLU A;  3VRA A;  2BC1 A;  3T37 A;  3AE9 A;  4J2W A;  1RP0 A;  2GRT A;  5C2T A;  4NEV A;  4YTM A;  1IUS A;  1D7L A;  2C65 A;  4CRT A;  4X9N A;  1ZY8 A;  4ADW A;  4U8M A;  1M6I A;  5JCM A;  2JB1 A;  1CJC A;  2R46 A;  3M0O A;  5CKU A;  4CCQ A;  1IUX A;  4YXD A;  2C4C A;  2GMH A;  1K0I A;  2XFP A;  3AE8 A;  4CY8 A;  3BHK A;  4TLX A;  4EQW A;  2BRA A;  1ZK7 A;  3GMC A;  1MO9 A;  3CPI G;  3P4P A;  1YY5 A;  5EBK A;  1NHR A;  1PHH A;  5IPY A;  2EQ8 A;  1KFY A;  4YT0 A;  2C3C A;  2EQ7 A;  3AEA A;  2AR8 A;  1O94 A;  4USR A;  3QSS A;  4U2S A;  4E0V A;  1BF3 A;  4KPR A;  2WQY A;  3L8K A;  4UDR A;  3IF9 A;  1JEH A;  1K0L A;  5FS7 A;  1EL5 A;  2XVH A;  2X50 A;  3LB8 A;  3RHA A;  3UOZ A;  4II3 A;  3UTE A;  4EQX A;  2XLP A;  4Z25 A;  1D7Y A;  2GR1 A;  4H50 A;  3BI4 A;  1DJN A;  1F6M A;  3UP5 A;  3Q9T A;  1Q9I A;  4BV6 A;  3V3O A;  3AE2 A;  1NPX A;  3UKF A;  5KOW A;  2WOW A;  2HQM A;  5U1O A;  4CY6 A;  3M13 A;  1N1P A;  5HYM A;  2ZZB A;  3L5O A;  3RP7 A;  4XXG A;  1QJD A;  2OAL A;  5C3J A;  1N4U A;  4B1B A;  1CJ4 A;  3VR9 A;  3NLC A;  4X9M A;  3CGD A;  1KNP A;  3UTF A;  3CNS A;  3CNP A;  1EL7 A;  4HB9 A;  2GR3 A;  2JB2 A;  1ZOV A;  4H7U A;  1DOE A;  1E1K A;  5KRQ A;  2VZ2 A;  4RG3 A;  2BYB A;  4GCM A;  3CTY A;  3NK0 X;  3B3R A;  2QA2 A;  3AE7 A;  1OJD A;  3CGE A;  3ATQ A;  1H83 A;  3GYJ A;  4GRT A;  1H86 A;  3NK1 X;  1PBD A;  1JRX A;  2FJB A;  2Z5Y A;  3UKK A;  2E1M A;  4H4T A;  3CPJ G;  4EM4 A;  2BRY A;  1KN0 A;  2GB0 A;  2A87 A;  3SZ0 A;  5JCL A;  2V60 A;  2WPF A;  1OJ9 A;  2BK5 A;  3UTG A;  3DA1 A;  2RGJ A;  5IQ1 A;  1GAL A;  4BUR A;  4OPU A;  3ATR A;  5KNL A;  3WE0 A;  3T2Y A;  3GYI A;  2WP9 A;  3AE5 A;  1CF3 A;  3NTA A;  5U63 A;  1N4W A;  1FEC A;  3QVP A;  3RP6 A;  5HHF A;  2C3D A;  4WCT A;  3IHG A;  3AEG A;  4EMI A;  2YR4 A;  4J33 A;  1COY A;  3FBS A;  4XWR A;  2XVJ A;  1GTE A;  1TDO A;  1L9D A;  4O5U A;  1O95 A;  3AYI A;  3KA7 A;  4Y4N A;  4C77 A;  3ICT A;  3EAN A;  2WP6 A;  1L9E A;  4A65 A;  3T14 A;  2FJA A;  4AT2 A;  2WOV A;  1NDA A;  2GR2 A;  5KVH A;  4J56 A;  2C73 A;  1S7M A;  2Q6U A;  5EOW A;  1GRA A;  5FMH A;  3OZ2 A;  3NG7 X;  3QSE A;  2BXS A;  1BGN A;  2YLS A;  3BNU A;  4OPI A;  4AP1 A;  3GRS A;  2R9Z A;  1GET A;  3E1T A;  1YQ3 A;  2OA1 A;  3AEB A;  4RG4 A;  3GRT A;  1TDN A;  2XLR A;  3C96 A;  2BXR A;  3ALL A;  3UOX A;  2A8X A;  1YQ4 A;  1Y56 A;  1LVL A;  4IVM B;  2BAC A;  2Q0K A;  1EL8 A;  1X31 B;  4H4Y A;  3RED A;  4H4P A;  3UKA A;  2X99 A;  4AOX A;  1ZKQ A;  1IUW A;  5JRB A;  4NZH A;  1GRT A;  1JNR A;  3UKH A;  2YVG A;  3HYX A;  3BHF A;  4EQR A;  4ZCC A;  3AED A;  5KMP A;  5KMS A;  4U8P A;  4Z24 A;  5IQ4 A;  2BS4 A;  2BK4 A;  4J31 A;  2AQJ A;  3HYV A;  4G74 A;  2BAB A;  3F8D A;  2NPX A;  3NKS A;  4GAP A;  4WX1 A;  2YR6 A;  2XLT A;  5JCK A;  3NTD A;  4Z2R A;  2H88 A;  5KVI A;  3T2Z A;  4J57 A;  4JQ9 A;  3AEE A;  3CMM A;  1VRQ B;  1REO A;  1K4Q A;  1UKV G;  3ADA B;  2QA1 A;  2R0G A;  4DSH A;  2CVJ A;  3GSI A;  2RAB A;  5FS9 A;  2C75 A;  4C3Y A;  3SYI A;  3DJJ A;  4G6G A;  4BJY A;  2GEW A;  2R0C A;  1LQT A;  1BZL A;  3GD4 A;  4JDR A;  3SQP A;  1E1N A;  1JRY A;  2WP5 A;  2PHH A;  4K2X A;  4Z44 A;  3QFA A;  3ICS A;  4FK1 A;  1LTX R;  5KMQ A;  3UKL A;  2W0H A;  1EL9 A;  4EIP A;  1GTH A;  1Y56 B;  2E4G A;  4N9X A;  3QSM A;  1GRE A;  4I59 A;  2V61 A;  2XFU A;  4P9S A;  4M52 A;  3RP8 A;  2XVF A;  2VVM A;  5KXJ A;  4U8I A;  3P4S A;  1GOS A;  4YKF A;  1NHS A;  1LV0 A;  3NK2 X;  3D9X A;  1ZOY A;  4OCG A;  2YLW A;  5M10 A;  1B5Q A;  4J36 A;  3IHM A;  4GUV A;  3K7T A;  1M64 A;  4ECH A;  3L1R A;  3EPT A;  2GQW A;  4GDE A;  3AYL A;  3EF6 A;  4JN9 A;  1ZX9 A;  2GH5 A;  3M12 A;  2ZZC A;  3EAO A;  3NHO X;  4HA6 A;  1KSS A;  2YLR A;  4K5R A;  4YSH A;  1Z6L A;  3DK8 A;  1PJ6 A;  1PS9 A;  4PAB A;  2GF3 A;  4TM1 A;  2JB3 A;  2X8G A;  5TR3 A;  4UDP A;  3SFD A;  1RSG A;  5J7X A;  2WU5 A;  3UTH A;  2Z5X A;  4BJZ A;  4APN A;  2B76 A;  3DJE A;  1L9C A;  3PG6 A;  2GAH B;  4U8O A;  2BC0 A;  1CBO A;  1GT8 A;  1ZMC A;  5BRT A;  2XFO A;  1TYT A;  1F3P A;  2WHD A;  3V3N A;  2TPR A;  1LJ1 A;  4DNA A;  3AD7 B;  4RSL A;  5EB5 A;  4K8D A;  1BWC A;  4LA1 A;  3T0K A;  4JY3 A;  1E1M A;  3AE4 A;  3DK4 A;  4H4U A;  1PXB A;  3NH3 X;  1H7W A;  2Q7V A;  3AE6 A;  1Y0P A;  4TM4 A;  2ACZ A;  4BK2 A;  2I0Z A;  1PBF A;  4BK1 A;  4REK A;  1VG9 A;  4D04 A;  2GMJ A;  4I58 A;  2C7G A;  4Z2U A;  1GXF A;  1JRZ A;  4BK3 A;  1E1L A;  3GYX A;  4B69 A;  3UKP A;  5KWF A;  2WET A;  1CL0 A;  1F8R A;  4JNQ A;  4JNA A;  3IC9 A;  3AE1 A;  3VQR A;  4CNK A;  1GRH A;  1D5T A;  2C64 A;  4OPT A;  3CND A;  4U8K A;  1CJ2 A;  3K30 A;  1B37 A;  2VQ7 A;  1GER A;  3NGC X;  1S3B A;  1XAN A;  4OPG A;  1FCD A;  1KNR A;  3CGC A;  2CFY A;  1GRF A;  3B6D A;  3NN0 X;  2XVI A;  4B66 A;  4UDQ A;  4A6N A;  5FS6 A;  2B9Y A;  3HZL A;  2YVJ A;  1BKW A;  1NEN A;  3CPH G;  3D1C A;  5ER0 A;  3KLJ A;  2YG7 A;  1AOG A;  3II4 A;  4IA6 A;  2AAQ A;  4EQS A;  3JSK A;  1TRB A;  4FDC B;  5U25 A;  1FOH A;  1H82 A;  4H4R A;  3GWF A;  1NEK A;  3SZC A;  3GDN A;  1DOB A;  2FJE A;  3C4N A;  1FEA A;  3H8L A;  2XVE A;  3T2K A;  2WES A;  3H8I A;  1O5W A;  5J60 A;  4A9W A;  2XCG A;  3G5S A;  4MJW A;  3VR8 A;  2FBW A;  4B68 A;  1ZDL A;  3NNE A;  1D4C A;  4YTP A;  3LXD A;  3S5W A;  2OLO A;  1PXC A;  2GAG B;  2V5Z A;  2V3B A;  2BA9 A;  1BGJ A;  1RYI A;  5KOX A;  1GES A;  1PXA A;  2OLN A;  1IJH A;  2YG6 A;  2R4E A;  3D8X A;  3CIR A;  1HYU A;  3CNT A;  4IA5 A;  3ITJ A;  1JOA A;  2X8C A;  2YM1 A;  2DKI A;  2QCU A;  1PDH A;  4O5Q A;  4FX9 A;  1JU2 A;  3HYW A;  4AOS A;  2XLS A;  3SXI A;  4YWO A;  4FK1 C;  4TM0 A;  4U2T A;  2B7S A;  2BS3 A;  2YG3 A;  1GEU A;  3QVR A;  1GND A;  4H2N A;  5DBJ A;  4A6N B;  4EIQ A;  3GMB A;  4GR1 A;  4ICY A;  2JBV A;  4K7Z A;  1TDF A;  1XHC A;  4B64 A;  2R0P A;  4OPD A;  3AD9 B;  1CC6 A;  2YR5 A;  4A5L A;  3SY4 A;  1KDG A;  4IV9 A;  3F8R A;  1W4X A;  3OC4 A;  2YLZ A;  1PBC A;  1DNC A;  2GR0 A;  2A89 A;  2WS3 A;  3FG2 P;  3UP4 A;  2WPE A;  5KMR A;  3KD9 A;  4II2 A;  1E6E A;  1LPF A;  1NAA A;  2E5V A;  4H4X A;  3K7M X;  3QJ4 A;  1E39 A;  1CJ3 A;  3GDP A;  3ZYX A;  4YKG A;  4AT0 A;  2B7R A;  1YQZ A;  5LV9 A;  1MXT A;  3UCL A;  4C3X A;  1E7P A;  1V59 A;  4YSY A;  2GVC A;  2WDV A;  1ZP0 A;  1GRB A;  1EBD A;  4XWZ A;  1PJ7 A;  2YM2 A;  2IVE A;  3V76 A;  1GV4 A;  3NYE A;  2C72 A;  4G6H A;  2YAU A;  4ZN0 A;  4H2Q A;  3F8P A;  1Q1R A;  4X4J A;  3Q6J A;  1QO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...