5FS8A

Crystal structure of the g308e mutant of human apoptosis inducing factor
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
487
structure length
473
Chain Sequence
QDKAPSHVPFLLIGGGTAAFAAASIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGEGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESRASEITIPPDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Structure/Function Relations in Aifm1 Variants Associated with Neurodegenerative Disorders
pubmed doi rcsb
source organism Homo sapiens
total genus 161
structure length 473
sequence length 487
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fs8A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs8A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs8A01
2FJAA 4H7UA 3GWFA 2ZZBA 3GMCA 4LU6A 5KVHA 5EBKA 3ALMA 3K7QX 2OA1A 2QA2A 1GERA 2C3DA 1EL9A 2CULA 2Y6QA 3H8LA 4P9SA 4TM0A 1KSSA 1PXAA 3H8IA 4B1BA 2WETA 1GTEA 3PVCA 2X99A 4IV9A 3VR8A 3AYJA 4TLZA 4X9MA 3DJGX 1GRGA 2Z5XA 3T37A 3KKJA 5BVAA 2BC0A 3AEBA 4IA6A 1MXTA 3WE0A 4CNKA 4GUVA 4CBQA 2C67A 3DA1A 5HXIA 3CPHG 2V6OA 1B5QA 1TDNA 3O0HA 3P4RA 3L1RA 3KLJA 3S61A 3KVEA 3B3RA 3EF6A 5CQFA 1DOEA 1TDEA 2A87A 4J2WA 4EIQA 5FS8A 2F5ZA 4DNAA 5J7XA 2YG3A 3OC4A 4BV6A 1VDCA 2CVJA 4HB9A 4AP3A 1EL8A 2WDQA 1LTXR 4CY6A 2TMDA 1D4DA 1ZK7A 3DJEA 4ICYA 2GR3A 3KA7A 2APGA 2WU5A 5C3JA 4OPDA 4MJWA 3UOZA 4OPIA 1QLBA 4X9NA 3UKKA 4AT0A 4D03A 3QSMA 1E1LA 4USQA 3M13A 1AOGA 3SFDA 1PHHA 1ZY8A 4YKFA 5EB5A 1UKVG 5J60A 4K7ZA 1ZKQA 3BNMA 2WPFA 1RSGA 3GRTA 5L46A 4U2LA 3G5SA 4DSHA 1GETA 5JCKA 3DK9A 1E1MA 3QVRA 1O95A 1X31B 1TYTA 5BULA 2JB2A 1EL5A 1KNRA 4J34A 1CF3A 3EANA 3HZLA 3QVPA 4JN9A 1D7YA 3CGBA 4Z2RA 1GRBA 3CNDA 2R4JA 1ZOYA 2ZBWA 1Q9IA 3GWDA 4EIPA 2UZZA 2YVGA 3DGZA 1YQ3A 3OZ2A 1CBOA 3D1CA 2E5VA 3NKSA 4RG3A 2FBWA 1VRQB 1DOCA 4C74A 4Z2TA 1FL2A 2YLXA 4JNAA 3SGLA 2BYBA 3NIXA 1H7WA 4IVMB 1JRYA 1DXLA 4BK1A 2YLWA 5FS6A 4EMIA 3LOVA 3VRBA 3ICSA 2XLSA 2H89A 4LIIA 2R4EA 2NVKX 1Z6LA 3AD7B 1JU2A 2E1MA 3CTYA 3UKFA 4U8IA 1XANA 3CNSA 2QAEA 1YY5A 3P4SA 2WBAA 2WOVA 1GREA 1GEUA 1DJQA 1F3PA 3AE6A 3L8KA 1BGNA 2GAHB 4Z2UA 3M12A 4OVIA 2X8HA 2I0ZA 2XYOA 1L9DA 2R0PA 4XWRA 3UP5A 3CPJG 2O9ZA 4Z26A 4YSYA 3AD8B 4NTDA 1NHPA 1N1PA 4YSHA 1PBFA 1FOHA 3FPZA 3NYEA 2XVFA 1H82A 3QJ4A 3PS9A 4XXGA 2EQ8A 1K4QA 4C3XA 3Q6JA 2YR6A 3NRNA 2YLTA 2AAQA 2RABA 1K0IA 2A89A 3AD9B 3FIMB 3AEAA 4H4WA 3P9UA 4OPCA 4WX1A 2RGJA 3C4AA 2WPEA 5EB4A 3RHAA 4APNA 2GEWA 2R0GA 2GR1A 3DMEA 1O94A 1VG0A 3NG7X 3ATRA 4UDQA 1FEBA 3AEGA 4GRTA 2YM2A 3V3OA 4AOSA 2XFPA 2JB3A 4U8KA 3RP6A 2EQ6A 2B9YA 4O5QA 3COXA 2Y6RA 1IUWA 2H88A 3RNMA 1YQZA 3VRAA 2JAEA 3LXDA 1L9EA 1D5TA 5GRTA 3QSEA 4H50A 1E6EA 2ZZ0A 2CFYA 3IWAA 4K8DA 3AE5A 1PBEA 3UCLA 1LQUA 1ZDLA 2W0HA 3ISHA 4FK1A 2C75A 4YTNA 5JCLA 1GPEA 1TDOA 5GSNA 2BS4A 4U8LA 1BKWA 3UKAA 2XVJA 2GAGB 4U2SA 3NK0X 3AWIA 3UTFA 3C4NA 1OJCA 1Q1RA 2AQJA 3ICRA 2GB0A 1M64A 2HQMA 2J3NA 2WESA 4YTPA 4H4TA 2A8XA 3AE9A 4BK3A 4Z43A 1NDAA 4ZCDA 2JKCA 3NNEA 3AE2A 4K5SA 4IA5A 2B9WA 3GDNA 1Y56B 2DKIA 1QJDA 2GF3A 1LQTA 2IVEA 4ADWA 1GOSA 3NHOX 3UTGA 1IUTA 4U2TA 3DJJA 2BK5A 3GD3A 3NTAA 3IF9A 2VVMA 3ZDNA 2FJBA 1JNZA 5FMHA 1TDFA 2XLUA 2V60A 2V3AA 1TRBA 1H7XA 1VQWA 4DSGA 1NHSA 3K30A 4JNQA 2C3CA 1E7PA 1GESA 2B7RA 5IQ1A 4FX9A 3P4QA 1D7LA 3BNUA 3AE1A 1BF3A 4GDEA 4O5UA 3UOYA 4AT2A 4YSZA 5JCNA 4A9WA 3CGDA 3ICTA 1MO9A 5U1OA 1DOBA 1YKJA 1GV4A 2OLOA 2BXSA 4BURA 2WHDA 3ATQA 2BABA 3C96A 3CIRA 3P4PA 1PDHA 4H2PA 5IQ4A 2YLZA 4B67A 2TPRA 3GD4A 3IHGA 4NTCA 1O5WA 1NG4A 2C72A 1BGJA 2C76A 3R9UA 1LVLA 2YR4A 3IHMA 4H2RA 4LA1A 2YLSA 4YTMA 1ONFA 1IUVA 4JY3A 1TYPA 3UKHA 4J56A 3GSIA 3QFAA 2C73A 2WP5A 1JOAA 4GR1A 2VRMA 3VRDB 1JEHA 2XVIA 1Q1WA 4TM1A 2Q0LA 2V5ZA 4U8OA 1H86A 1REOA 3DH9A 4A7AA 4PAAA 1Y56A 1BWCA 1PXCA 5C2TA 5U63A 3UTEA 4RSLA 1BZLA 2X8GA 4JY2A 2WOIA 3KU9A 2ACZA 4A99A 3QSSA 1NAAA 1S2YA 3DK8A 3ITJA 1QO8A 5HY5A 2GQWA 3FBSA 1XDIA 1CC6A 2R45A 3G5RA 5LV9A 1DJNA 1OJAA 3BHKA 3ZYXA 3UKPA 1RP0A 4K5RA 3AXBA 1L0VA 1IUXA 4C5OA 5TR3A 1D4EA 3AB1A 2C66A 5M0ZA 2PYXA 2VQBA 1B4VA 3LADA 1IUUA 2WOWA 1PS9A 1YQ4A 2ZZCA 3CGEA 1E1KA 2ARDA 2JB1A 2IVDA 2BXRA 4E0VA 1V59A 1GSNA 4Y4NA 1OJ9A 2OAMA 4OCGA 1PN0A 3CPIG 2YM1A 4I58A 4UDPA 4U8NA 2BACA 2YAUA 1SEZA 4H4SA 2XFUA 2WDRA 4NZHA 4Y4LA 4C77A 4K22A 4OPUA 5KOWA 4GDPA 4EMJA 1LV0A 2E4GA 2OALA 2XDOA 4YWOA 2C70A 2GV8A 4H2QA 4X4JA 2XLTA 3SM8A 2BK3A 3EPTA 1N4VA 3NK2X 2WDVA 3UTHA 3NK1X 3RP8A 3GYJA 2WQYA 3F8DA 3NH3X 2NPXA 2BK4A 3AECA 2Z5YA 4A65A 4RG4A 1KSUA 3VQRA 4H4RA 1EL7A 3AE7A 2XFOA 5M10A 1H83A 2BCGG 1W4XA 3NYFA 2GH5A 2R0CA 3KPFA 1DNCA 1JRZA 3AE3A 1JNRA 1CJ3A 2BC1A 4XWZA 5HYMA 4H2NA 1VG9A 1F8RA 1K0JA 2RGHA 2WP9A 2WEUA 1RYIA 1GTHA 2C65A 4REKA 1S3BA 3REDA 2X50A 3CN8A 3D8XA 4A79A 4CY8A 4YSXA 2WU2A 2R46A 4JDRA 3NYCA 5KRQA 4GF7A 1IJHA 1F8SA 3GMBA 1KDGA 2GR2A 2V3BA 4U8PA 4Y4MA 1NENA 2BA9A 3ABVA 2B9XA 2X3NA 2EQ7A 2WPCA 4DGKA 3PO7A 1H6VA 3H4KA 4AP1A 3URHA 2VZ2A 4ZCCA 4H4UA 4H4VA 4CCRA 1ELIA 1H84A 1CJ4A 3CNPA 1F6MA 2DKHA 3G5QA 2X8CA 3VR9A 4EMWA 4B63A 2YQUA 2YG4A 3BI5A 2YG6A 4TM4A 4U8MA 1EBDA 4KPRA 4GCMA 1S2QA 1M6IA 1CC4A 1PJ6A 4TM3A 4M52A 1PJ5A 2OLNA 3BI4A 2RGOA 5KXJA 4UDRA 1XHCA 4D04A 1NEKA 5EOWA 1FECA 5FS9A 4Z44A 5DBJA 4JQ9A 1FCDA 4B68A 3E1TA 2BS2A 4CRTA 1K0LA 5CKUA 3GRSA 4A6NB 2GVCA 1ZMDA 2B7SA 2GMJA 3CNJA 1ZMCA 4EQRA 4BJYA 1NPXA 2Q6UA 2YG5A 2YVJA 1F8WA 2QA1A 3I6DA 4B65A 2VOUA 1GRTA 4I59A 1PBCA 2VRLA 5FS7A 1N4UA 4TLXA 3AE8A 1GALA 4BJZA 2XLPA 4ZN0A 4FDCB 3S5WA 2JK6A 1KNPA 3CGCA 1E1NA 4YKGA 1DODA 4A5LA 1HYUA 3ALLA 1OJTA 1P2EA 1NHRA 1P2HA 2QCUA 3AE4A 1S3EA 1CJ2A 1H81A 4EQWA 3NN6X 2IIDA 3M0OA 2BS3A 1CHUA 3GYIA 3V76A 1KF6A 2FJDA 1GRHA 3NLCA 4K2XA 1NG3A 3B6DA 4OPTA 3ADAB 2XFQA 5HHFA 2YVFA 4HA6A 1CC2A 1ZX9A 2XCGA 5ER0A 1CL0A 3BI2A 3FG2P 3SQPA 2JBVA 2FJEA 3BHFA 2Q7VA 3LB8A 1B8SA 3P1WA 4WCTA 4EQXA 4YXDA 4A6NA 5KWFA 1E39A 2R9ZA 1FEAA 3AEFA 1XPQA 2XLRA 3DK4A 4CNJA 1B37A 4PABA 5JCMA 1PBDA 3EAOA 2C7GA 3UP4A 1KFYA 3AYLA 1IUSA 2GQFA 3DJDA 4EQSA 1MOKA 4NTEA 3UOVA 1JRXA 2VQ7A 3UKLA 2YWLA 4U8JA 4YT0A 3I3LA 4J57A 1ZP0A 2VVLG 3CNTA 3F8RA 4ECHA 4EM3A 4AOXA 1LJ1A 1GNDA 2Q0KA 1ZOVA 4J36A 3F8PA 4J33A 4KX6A 4BK2A 2VVLA 3ALJA 1N4WA 2WS3A 2XVHA 1CJCA 1PXBA 3QFBA 3JSKA 3LJPA 4EM4A 5BUKA 4H4QA 1PBBA 4CCQA 5IPYA 4J31A 2XVEA 3IC9A 5KOXA 3V3NA 3RP7A 2PHHA 3AEDA 2XFNA 3GDPA 2CDUA 3FMWA 4H4PA 1D4CA 1Y0PA 1L9CA 3NTDA 5KVIA 4NEWA 3UOXA 1PJ7A 1LPFA 3SFEA 3II4A 5BRTA 2GRTA 2WP6A 3AYIA 4FK1C 4Z25A 4USRA 2C64A 4H4ZA 3K7TA 2V61A 3NT6A 3LZXA 3NGCX 2GMHA 4C3YA 1GRFA 2EQ9A 4B69A 4NEVA 2GR0A 4H4XA 1GT8A 4Z24A 4H4YA 1COYA 2BCPA 1GRAA 1TDKA 1OJDA 4UP3A 4N9XA 1GXFA 4OPGA 3UKQA 1NHQA 3K7MX 3DGHA 5U25A 5JCIA 2YG7A 3KD9A 3LZWA 3Q9TA 4OPLA 2AR8A 4IVOB 4B66A 2YLRA 4B64A 2YR5A 3AEEA 3NN0X 2B76A
chains in the Genus database with same CATH superfamily
4H7UA 3GWFA 3SZ0A 3ALMA 3K7QX 2OA1A 4H1ZA 2X99A 3AYJA 4X9MA 3UJ2A 3DJGX 2Z5XA 3HYXA 3T37A 2GGJA 1TDNA 3A7RA 3B3RA 3EF6A 1DOEA 3VA8A 2P0IA 2F5ZA 5J7XA 2WDQA 3T0KA 2APGA 1VDVA 4OPIA 1EC7A 3UKKA 4AT0A 1ELSA 1ONEA 4USQA 3M13A 1ZY8A 4YKFA 5J60A 3MQTA 3BNMA 3IJQA 1RSGA 4U2LA 3G5SA 1GETA 2OVLA 1ECQA 1TYTA 1N62C 2R4JA 4EIPA 2UZZA 2YVGA 1YQ3A 3NKSA 3GY1A 1DOCA 4Z2TA 2PTWA 4ZA0A 3SGLA 1H7WA 1JRYA 2YLWA 5FS6A 3ICSA 3T4WA 1N61C 1Z6LA 3AD7B 2BRYA 1JU2A 3VC5A 3PFRA 2ZADA 3A7UA 2QAEA 2WBAA 2WOVA 1GREA 1GEUA 3RGTA 4Z2UA 3FYYA 4XWRA 3CXBA 1NELA 4YSHA 1FOHA 3R10A 2EQ8A 4JN8A 3Q6JA 3ES7A 2YLTA 2AAQA 4E8GA 3FIMB 2RGJA 3C4AA 1PDZA 1X2HA 3S47A 3N4EA 1VG0A 4MGGA 4UDQA 3V3OA 3SZWA 2HNEA 3RP6A 2H88A 3RNMA 2JAEA 4K8GA 5GRTA 3QSEA 1LQUA 2W0HA 6ENLA 4YTNA 1TDOA 5GSNA 2BS4A 2XVJA 4KEMA 4U2SA 5FJRA 2AKMA 2WESA 4YTPA 4H4TA 1MRAA 2JKCA 2DKIA 1FHVA 1LQTA 4ADWA 1IUTA 1FO4A 3CB3A 3R0UA 1WUEA 3K30A 4JNQA 1S7MA 4FX9A 3IJLA 4FP1A 4O5UA 5EU9A 1MO9A 2OLOA 1YKJA 2BXSA 1JRPA 5IQ4A 4J3ZA 2YLZA 4B67A 3GD4A 3RITA 3DG3A 2FKPA 3SQSA 2OZ3A 2C72A 3IHMA 4H2RA 2YLSA 2B76A 4JY3A 3QFAA 1JOAA 4GR1A 4DX3A 2V5ZA 4U8OA 3VDGA 4PAAA 1BWCA 1PDYA 5C2TA 5U63A 4DWDA 4RSLA 3EUB3 3EKGA 1F9CA 3DK8A 3FBSA 1XDIA 3G5RA 2OFJA 3NXLA 3AXBA 3SN0A 1L0VA 1D4EA 2C66A 1IUUA 3VR9A 2WOWA 1YQ4A 2PU0A 2ARDA 3JW7A 1PN0A 4UDPA 2GGHA 1SEZA 4H4SA 2XFUA 5J04A 4NZHA 4OPUA 5KOWA 3UJRA 2E4GA 3RRAA 2XLTA 2OZTA 2BK3A 1SJDA 3TWBA 1N4VA 2WDVA 4GIRA 3NH3X 3T2YA 4H4RA 3DG6A 2R0CA 1DNCA 1JRZA 4XWZA 5HYMA 1VG9A 2WEUA 2C65A 3REDA 2R46A 3NYCA 5KRQA 4GF7A 2GR2A 4U8PA 2B9XA 2GL5A 3PWIA 1H6VA 3URHA 4ZCCA 4H4UA 4H4VA 4CCRA 1CJ4A 3CNPA 2DKHA 4KPRA 1CC4A 4TM3A 1PJ5A 1JPDX 4Z44A 3E1TA 2BS2A 1MDRA 5CKUA 2QGYA 3RO6A 4KT2A 2QA1A 1GRTA 4TLXA 4BJZA 3GC2A 3AN1A 4YKGA 4M0XA 4E5TA 3ALLA 2QCUA 1CHUA 2FJDA 1GRHA 2PPGA 1NG3A 3B6DA 4OPTA 2AL1A 5HHFA 4II3A 1CC2A 2XCGA 3QLDA 2ONEA 2OPJA 1B8SA 3VC6A 1E39A 3ZVHB 4ENLA 1B37A 3QKEA 4JHMA 2O56A 3EAOA 1N5WC 2GQFA 4M6UA 1MOKA 3UOVA 1KD0A 1JRXA 5FJOA 2VQ7A 4U8JA 4J57A 1ZP0A 3F8RA 4ECHA 1LJ1A 2QDEA 4J36A 3F8PA 4G6HA 2WS3A 3FVDA 2XVHA 1PXBA 3JSKA 4EM4A 4CCQA 4J31A 1R6WA 2PHHA 3AEDA 3TW9A 3UXLA 5KVIA 5BRTA 2GRTA 2OG9A 2GMHA 1GRFA 4H4XA 3ZVHA 4H4YA 4UP3A 3T9PA 3CXOA 2AR8A 2YR5A 1MDLA 1ZXIC 2FJAA 3GMCA 4LU6A 4TM0A 3H8IA 3PVCA 3R0KA 5KNLA 3UGVA 5BVAA 3WE0A 2C67A 3DA1A 2V6OA 3P4RA 4H83A 3KVEA 2A87A 1EBGA 4DNAA 2YG3A 4BV6A 1VDCA 2CVJA 1LTXR 2TMDA 1ZK7A 3DJEA 2P88A 3KA7A 5C3JA 3UOZA 3QSMA 1AOGA 3SFDA 5EB5A 1UKVG 4K7ZA 3GRTA 5L46A 5G5GB 3R1ZA 2DW7A 4DSHA 1E1MA 3Q4DA 1O95A 1X31B 3P93A 1IYXA 5BULA 4J1OA 3UCCA 1CF3A 3HZLA 3QVPA 4Z2RA 3CGBA 4GGBA 3CNDA 1ZOYA 4DXKA 3OZ2A 1CBOA 2GGIA 3TJ4A 2P8BA 3HYVA 1FL2A 2BYBA 4IVMB 1DXLA 3FJ4A 3LOVA 2XLSA 4IL0A 2H89A 4LIIA 2R4EA 2NVKX 4U8IA 3CNSA 3P4SA 1F3PA 2GAHB 4OVIA 1L9DA 3CPJG 3AD8B 3T8QA 3IK4A 3NYEA 4E4UA 1H82A 3QJ4A 2PCEA 4C3XA 3NRNA 2A89A 3KUMA 4H4WA 4OPCA 4WX1A 5EB4A 4APNA 2R0GA 4GRTA 4G9KA 2JB3A 4O5QA 3COXA 1IUWA 4TVYA 3LXDA 4H50A 1FFUC 2CFYA 3MKCA 3AE5A 1PBEA 1ZDLA 4FK1A 1GPEA 5KMSA 4U8LA 1KKRA 3UKAA 2W54A 1JDFA 1Q1RA 2AQJA 2GB0A 2J3NA 2A8XA 4ZCDA 3TOYA 3NNEA 3UJEA 1Y56B 1QJDA 1GOSA 3NHOX 3UTGA 3DJJA 3STPA 2VVMA 4HPNA 1H7XA 4DSGA 1NHSA 3SSZA 1E7PA 3CYJA 2B7RA 3P4QA 3AE1A 4A9WA 3CGDA 3HW2A 1DOBA 3ATQA 2HXUA 2TPRA 4TVWA 3TQPA 1BGJA 1LVLA 2QVHA 4H19A 3UKHA 4J56A 2C73A 2WP5A 2XVIA 4TM1A 3U9IA 4A7AA 3QN3A 1Y56A 3UTEA 4HNCA 2XH4A 5HY5A 1QO8A 5LV9A 3BHKA 3OZMA 3AM9A 4C5OA 1B4VA 3ETRB 1PS9A 3DFYA 2IVDA 1P43A 4E0VA 1GSNA 1OJ9A 2OAMA 4U8NA 2XH7A 4IP5A 1N63C 4IT1A 4C77A 4HCHA 4K22A 1LV0A 2C70A 3L5OA 3SY4A 3GYJA 3F8DA 2NPXA 1KSUA 3KPKA 2XFOA 5M10A 1W4XA 3NYFA 3TJIA 2PP0A 3KPFA 3DESA 5G5HB 1F8RA 2RGHA 1GTHA 2PTZA 4IP4A 3SN1A 2WU2A 1XS2A 1F8SA 1KDGA 4Y4MA 2P3ZA 2XSXA 3ABVA 3Q45A 2EQ7A 2WPCA 4DGKA 3DIPA 3H4KA 4AP1A 2VZ2A 2PSNA 5FJUA 3G5QA 2X8CA 3D47A 2YG6A 4U8MA 3MSYA 4GCMA 4GFIA 4M52A 2FYMA 3BI4A 3T31A 3GO2A 4D04A 2PMQA 1FECA 1FCDA 4B68A 4CRTA 2B7SA 1SJAA 1ZMCA 4EQRA 2Q6UA 3BJSA 3ZLHA 4B65A 2VOUA 4I59A 5FS7A 1N4UA 3H70A 1KNPA 2RDXA 1DODA 4A5LA 1HYUA 2GGGA 2QJNA 1P2EA 1NHRA 4EQWA 4HN8A 2BS3A 3GYIA 3ENLA 2C4CA 1TZZA 2OQHA 2XFQA 1ZX9A 1CL0A 3SQPA 3BHFA 2Q7VA 3P1WA 3AEFA 3DK4A 5JCMA 3RR1A 3AYLA 5JRBA 1IUSA 3DJDA 1RVKA 4YT0A 3I3LA 2VVLG 4AOXA 1ZOVA 4J33A 4KX6A 1N4WA 3QFBA 3CAWA 3THUA 2XFNA 3GDPA 4H4PA 1D4CA 4NEWA 3UOXA 1LPFA 3B97A 3II4A 2WP6A 4FK1C 2V61A 3NT6A 3NGCX 4C3YA 2EQ9A 2QQ6A 2CHRA 1KKOA 2OQYA 1GXFA 1NHQA 3K7MX 3Q9TA 3AEEA 3NN0X 3CK5A 5ENLA 2ZZBA 5EBKA 3SBFA 2QA2A 1GERA 2C3DA 1EL9A 2CULA 1KSSA 4B1BA 3UJFA 4IV9A 3IJIA 3H12A 4TLZA 3H7VA 1GRGA 3KKJA 4YWSA 2BC0A 4IA6A 2P8CA 4CNKA 4CBQA 5HXIA 2W55A 1B5QA 3O0HA 2E5AA 4II2A 3L1RA 1TDEA 4GYPC 4EIQA 4HCDA 3U4FA 3OC4A 4HB9A 4AP3A 3OTRA 3ES8A 4OPDA 4MJWA 4IL2A 1QLBA 4GISA 4X9NA 3DDMA 1E1LA 1PHHA 3CT2A 2WPFA 5JCKA 3MWCA 3T2ZA 2JB2A 1KNRA 4JN9A 1D7YA 1GRBA 4X2PA 3S5SA 2ZBWA 3DGZA 2E5VA 1VRQB 4GAPA 3NVZB 4BK1A 4EMIA 1L8PA 3R11A 1E9IA 1P48A 2AL2B 2POZA 3CTYA 4Z1YA 1XANA 1DJQA 4Z17A 3ZLFA 3L8KA 2X8HA 3V5CA 2R0PA 2O9ZA 4Z26A 1KN0A 4E6MA 3SN4A 2YR6A 4D03A 1K0IA 3AEAA 3N4FA 3JZUA 2MNRA 1O94A 3NG7X 3ATRA 3MUCA 4AOSA 2B9YA 1W6TA 2AL2A 1YQZA 3TCSA 1L9EA 1D5TA 3FV9A 1E6EA 2ZZ0A 4K8DA 3UCLA 4DYEA 5JCLA 3D46A 3AWIA 3UTFA 1V97A 3ICRA 2HQMA 4MMWA 2PGWA 3AE9A 4BK3A 4Z43A 3AE2A 2IVEA 2PGEA 2GGEA 4U2TA 3NTAA 2XLUA 2V60A 2V3AA 2MUCA 1D7LA 4GDEA 1BF3A 4YSZA 3ICTA 5U1OA 4EWJA 4BURA 4DHGA 2PA6A 1PDHA 3P4PA 3IHGA 1NG4A 3R9UA 2YR4A 4LA1A 4GGHA 1ONFA 3V5FA 3VRDB 1JEHA 2Q0LA 1H86A 4G8TA 1MNSA 2OO6A 1PXCA 1BZLA 2WOIA 4G74A 3QSSA 3DG7A 1NAAA 1T3QC 1CC6A 3OP2A 1OJAA 1EBHA 3ZYXA 4K5RA 1IUXA 2VQBA 3SM8A 2ZZCA 3CGEA 1E1KA 2BXRA 1V59A 1VQZA 4OCGA 2YM1A 2GDQA 2OALA 2GV8A 4H2QA 4FI4A 3EPTA 3GYXA 3UTHA 3NK1X 2OKTA 3RP8A 2WQYA 2BK4A 3AECA 2AKZA 1EC9A 3N6JA 1EL7A 3VQRA 2BC1A 4H2NA 1K0JA 1S3BA 3CN8A 3D8XA 4A79A 4CY8A 4ZOHB 3SYIA 4JDRA 3V3WA 3GMBA 2V3BA 3AMZA 5FJPA 2DW6A 2X3NA 3PO7A 3UXKA 4H2HA 3I6EA 1ELIA 1F6MA 4B63A 4EMWA 3OZYA 2YQUA 2YG4A 4A35A 1XPYA 2OLAA 2NQLA 3UCDA 2RGOA 1XHCA 1NEKA 5EOWA 5FS9A 5DBJA 3DFHA 3T6CA 4A6NB 1NPXA 2HXTA 2YG5A 2YVJA 1F8WA 3T2KA 2VRLA 3AE8A 1FFVC 1GALA 4GYPA 4HNLA 2JK6A 2XH0A 3CGCA 3N6HA 4A3RA 1P2HA 3AE4A 4JN7A 2IIDA 3V76A 1KF6A 1NU5A 3NLCA 2PTXA 3ZVIA 4K2XA 4HA6A 3BI2A 2PP1A 3FG2P 1R0MA 2FJEA 4IZGA 4WCTA 4EQXA 4YXDA 4A6NA 2XLRA 3A7AA 4CNJA 1OEPA 1PBDA 7ENLA 4A6GA 1KFYA 2PODA 4EQSA 3CNTA 3DERA 4K1WA 1WYGA 1SJCA 2VVLA 3LJPA 5BUKA 5IPYA 3V3NA 3RP7A 3SZFA 2CDUA 3FMWA 1Y0PA 3NTDA 1BQGA 1PJ7A 3SFEA 3AYIA 4Z25A 2I5QA 2C64A 3K7TA 3LZXA 3K1GA 5FJTA 3QPEA 4B69A 4NEVA 4Z24A 2BCPA 1TDKA 1OJDA 4G73A 3FXGA 3KD9A 2YG7A 3LZWA 3VCNA 4B64A 4IVOB 4B66A 2YLRA 1TKKA 4KPLA 5KVHA 4G7FA 2Y6QA 3H8LA 4P9SA 3PK7A 1PXAA 2WETA 1GTEA 1N5XA 3VR8A 3OPSA 3AEBA 4F4RA 1MXTA 4GUVA 3CPHG 3NRZB 3S61A 3KLJA 2GSHA 5CQFA 4J2WA 2QDDA 5FS8A 4CY6A 1EL8A 1D4DA 4ICYA 2GR3A 2WU5A 1ZKQA 1RM6B 3DK9A 3QVRA 1EL5A 4J34A 3DGBA 3EANA 2OX4A 1SB3B 1Q9IA 3GWDA 2W3RA 3D1CA 4RG3A 2FBWA 4C74A 2BRAA 2YLXA 4JNAA 3NIXA 3SJNA 3VRBA 3NO1A 3BSMA 4HYRA 3H8AA 2E1MA 3UKFA 1YY5A 1FHUA 3SZCA 3AE6A 3CMMA 1BGNA 4NWZA 3M12A 5IDZA 3MY9A 2I0ZA 2XYOA 3VFCA 3UP5A 4YSYA 2PU1A 4NTDA 1NHPA 1N1PA 1PBFA 3FPZA 2XVFA 3PS9A 4XXGA 1K4QA 2W3SA 2RABA 3AD9B 3P9UA 3EEZA 2WPEA 3NFUA 5BOEA 1DTNA 3RHAA 2GEWA 2GR1A 3DMEA 3DEQA 1FEBA 3AEGA 2YM2A 2XFPA 4U8KA 1JPMA 2EQ6A 3V4BA 2Y6RA 2E3TA 3PG6A 3VRAA 4IHCA 3P3BA 3IWAA 3ISHA 2C75A 1BKWA 2GAGB 3NK0X 3C4NA 1OJCA 1H2IA 3NS1B 1M64A 1NDAA 4K5SA 4IA5A 2B9WA 3T14A 3GDNA 2GF3A 2BK5A 3GD3A 3IF9A 3ZDNA 4NNJA 2FJBA 1JNZA 5FMHA 1TDFA 3NVWB 1TRBA 3NZGA 1VQWA 3GD6A 2C3CA 1GESA 5IQ1A 5BOFA 1JCTA 3BNUA 1N60C 3UOYA 4AT2A 5JCNA 4GAVA 3D9XA 3I6TA 1GV4A 2WHDA 3C96A 2BABA 3CIRA 4H2PA 1STZA 4NTCA 1O5WA 1FIQB 2C76A 4YTMA 1IUVA 1TYPA 3GSIA 2VRMA 1Q1WA 1REOA 3DH9A 4MKSA 3R25A 2X8GA 4JY2A 3KU9A 4A99A 2ACZA 1S2YA 3ITJA 2GQWA 3I4KA 3VCCA 2R45A 1DJNA 3NVYB 3UKPA 1RP0A 3QTPA 5TR3A 3AB1A 5M0ZA 2PYXA 3HPFA 3LADA 2JB1A 3UJSA 1SJBA 4Y4NA 3SX6A 3CPIG 4I58A 1KCZA 4HCLA 2BACA 2YAUA 3FCPA 2WDRA 4Y4LA 4GDPA 4EMJA 2XDOA 4YWOA 4X4JA 3HRDC 2PP3A 3NK2X 3ZLGA 4G6GA 4ROPA 2Z5YA 4A65A 4KWSA 4RG4A 3AE7A 1H83A 2BCGG 2GH5A 3AE3A 1JNRA 1CJ3A 2WP9A 3NVVB 1RYIA 4REKA 2X50A 4YSXA 1MUCA 1IJHA 1NENA 2BA9A 1YEYA 4DN1A 4ZCWA 1H84A 2QJMA 2QJJA 4E4FA 3B9JB 4K2SA 3BI5A 4TM4A 1WUFA 1EBDA 1S2QA 1M6IA 1PJ6A 2OLNA 3SR6B 5KXJA 4UDRA 3TTEA 4JQ9A 3TWAA 5KMRA 1K0LA 3GRSA 2GVCA 4GMEA 1ZMDA 2GMJA 3CNJA 3R07C 3HYWA 4BJYA 3I6DA 1PBCA 2ZC8A 2XLPA 2XH2A 4ZN0A 3P0WA 4FDCB 3S5WA 1E1NA 1OJTA 1S3EA 1CJ2A 3MZNA 1H81A 2OZ8A 3NN6X 3M0OA 3OW1A 1TE6A 1EC8A 3ADAB 2PS2A 2YVFA 3PWGA 5ER0A 2JBVA 2XGZA 3LB8A 5KWFA 1X2GA 2R9ZA 1FEAA 1XPQA 4PABA 5KMQA 2PTYA 2C7GA 3UP4A 4NTEA 3UKLA 2YWLA 2HZGA 4EM3A 1GNDA 2Q0KA 4BK2A 3ALJA 1CJCA 4H4QA 1PBBA 2XVEA 3IC9A 5KOXA 5KMPA 1L9CA 3JVAA 3SXIA 1BKHA 4USRA 4H4ZA 2GR0A 1GT8A 1COYA 1GRAA 3BOXA 4N9XA 4OPGA 3UKQA 3RCYA 3DGHA 5U25A 5JCIA 4OPLA 1JROA
chains in the Genus database with same CATH topology
2FJAA 4H7UA 3GWFA 2ZZBA 3GMCA 4LU6A 3SZ0A 5KVHA 5EBKA 3ALMA 3K7QX 2OA1A 2QA2A 1GERA 2C3DA 1EL9A 2CULA 2Y6QA 3H8LA 4P9SA 4TM0A 1KSSA 1PXAA 3H8IA 4B1BA 2WETA 1GTEA 3PVCA 2X99A 4IV9A 3VR8A 3AYJA 4TLZA 5KNLA 4X9MA 3DJGX 1GRGA 2Z5XA 3HYXA 3KKJA 3T37A 5BVAA 2BC0A 3AEBA 4IA6A 1MXTA 3WE0A 4CNKA 4GUVA 4CBQA 2C67A 3DA1A 5HXIA 3CPHG 2V6OA 1B5QA 1TDNA 3O0HA 4II2A 3P4RA 3L1RA 3KLJA 3S61A 3KVEA 3B3RA 3EF6A 5CQFA 1DOEA 1TDEA 2A87A 4J2WA 4EIQA 5FS8A 2F5ZA 4DNAA 5J7XA 2YG3A 3OC4A 4BV6A 1VDCA 2CVJA 4HB9A 4AP3A 1EL8A 2WDQA 1LTXR 4CY6A 2TMDA 1D4DA 1ZK7A 3DJEA 4ICYA 2GR3A 3T0KA 3KA7A 2APGA 2WU5A 5C3JA 4OPDA 4MJWA 3UOZA 4OPIA 1QLBA 4X9NA 3UKKA 4AT0A 4D03A 3QSMA 1E1LA 4USQA 3M13A 1AOGA 3SFDA 1PHHA 1ZY8A 4YKFA 5EB5A 1UKVG 5J60A 4K7ZA 1ZKQA 3BNMA 2WPFA 1RSGA 3GRTA 5L46A 4U2LA 3G5SA 4DSHA 1GETA 5JCKA 3DK9A 1E1MA 3QVRA 1O95A 1X31B 3T2ZA 1TYTA 5BULA 2JB2A 1EL5A 1KNRA 4J34A 1CF3A 3EANA 3HZLA 3QVPA 4JN9A 1D7YA 3CGBA 4Z2RA 1GRBA 3CNDA 2R4JA 1ZOYA 2ZBWA 1Q9IA 3GWDA 4EIPA 2UZZA 2YVGA 3DGZA 1YQ3A 3OZ2A 1CBOA 3D1CA 2E5VA 3NKSA 4RG3A 2FBWA 1VRQB 1DOCA 3HYVA 4C74A 4Z2TA 1FL2A 2BRAA 2YLXA 4JNAA 3SGLA 2BYBA 3NIXA 1H7WA 4GAPA 4IVMB 1JRYA 1DXLA 4BK1A 2YLWA 5FS6A 4EMIA 3LOVA 3VRBA 3ICSA 2XLSA 2H89A 4LIIA 2R4EA 2NVKX 1Z6LA 3AD7B 2BRYA 1JU2A 2E1MA 3CTYA 3UKFA 4U8IA 1XANA 3CNSA 2QAEA 1YY5A 3P4SA 2WBAA 2WOVA 1GREA 1GEUA 1DJQA 1F3PA 3SZCA 3AE6A 3L8KA 1BGNA 2GAHB 3CMMA 4NWZA 4Z2UA 3M12A 4OVIA 2X8HA 2I0ZA 2XYOA 1L9DA 2R0PA 4XWRA 3UP5A 3CPJG 2O9ZA 4Z26A 1KN0A 4YSYA 3AD8B 4NTDA 1NHPA 1N1PA 4YSHA 1PBFA 1FOHA 3FPZA 3NYEA 2XVFA 1H82A 3QJ4A 3PS9A 4XXGA 2EQ8A 1K4QA 4C3XA 3Q6JA 2YR6A 3NRNA 2YLTA 2AAQA 2RABA 1K0IA 2A89A 3AD9B 3FIMB 3AEAA 4H4WA 3P9UA 4OPCA 4WX1A 2RGJA 3C4AA 2WPEA 5EB4A 3RHAA 4APNA 2GEWA 2R0GA 2GR1A 3DMEA 1O94A 1VG0A 3NG7X 3ATRA 4UDQA 1FEBA 3AEGA 4GRTA 2YM2A 3SZWA 3V3OA 4G9KA 4AOSA 2XFPA 2JB3A 4U8KA 3RP6A 2EQ6A 2B9YA 4O5QA 3COXA 2Y6RA 1IUWA 2H88A 3RNMA 1YQZA 3PG6A 3VRAA 2JAEA 3LXDA 1L9EA 1D5TA 5GRTA 3QSEA 4H50A 1E6EA 2ZZ0A 2CFYA 3IWAA 4K8DA 3AE5A 1PBEA 3UCLA 1LQUA 1ZDLA 2W0HA 3ISHA 4FK1A 2C75A 4YTNA 5JCLA 1GPEA 1TDOA 5GSNA 2BS4A 5KMSA 4U8LA 1BKWA 3UKAA 2XVJA 2GAGB 4U2SA 3NK0X 3AWIA 3UTFA 3C4NA 1OJCA 1Q1RA 2AQJA 3ICRA 2GB0A 1H2IA 1M64A 2HQMA 2J3NA 2WESA 4YTPA 4H4TA 2A8XA 3AE9A 4BK3A 4Z43A 1NDAA 4ZCDA 2JKCA 3NNEA 3AE2A 4K5SA 4IA5A 2B9WA 3T14A 3GDNA 1Y56B 2DKIA 1QJDA 2GF3A 1LQTA 2IVEA 4ADWA 1GOSA 3NHOX 3UTGA 1IUTA 4U2TA 3DJJA 2BK5A 3GD3A 3NTAA 3IF9A 2VVMA 3ZDNA 4NNJA 2FJBA 1JNZA 5FMHA 1TDFA 2XLUA 2V60A 2V3AA 1TRBA 1H7XA 1VQWA 4DSGA 1NHSA 3K30A 4JNQA 2C3CA 1E7PA 1GESA 1S7MA 2B7RA 5IQ1A 4FX9A 3P4QA 1D7LA 3BNUA 3AE1A 1BF3A 4GDEA 4O5UA 3UOYA 4AT2A 4YSZA 5JCNA 4A9WA 4GAVA 3CGDA 3D9XA 3ICTA 1MO9A 5U1OA 1DOBA 1YKJA 1GV4A 2OLOA 2BXSA 4BURA 2WHDA 3ATQA 2BABA 3C96A 3CIRA 3P4PA 1PDHA 4H2PA 5IQ4A 2YLZA 4B67A 2TPRA 3GD4A 3IHGA 4NTCA 1O5WA 1NG4A 2C72A 1BGJA 2C76A 3R9UA 1LVLA 2YR4A 3IHMA 4H2RA 4LA1A 2YLSA 4YTMA 1ONFA 1IUVA 4JY3A 1TYPA 3UKHA 4J56A 3GSIA 3QFAA 2C73A 2WP5A 1JOAA 4GR1A 2VRMA 3VRDB 1JEHA 2XVIA 1Q1WA 4TM1A 2Q0LA 2V5ZA 4U8OA 1H86A 1REOA 3DH9A 4A7AA 4PAAA 1Y56A 1BWCA 1PXCA 5C2TA 5U63A 3UTEA 4RSLA 1BZLA 2X8GA 4JY2A 2WOIA 3KU9A 2ACZA 4G74A 4A99A 3QSSA 1NAAA 1S2YA 3DK8A 3ITJA 1QO8A 5HY5A 2GQWA 3FBSA 1XDIA 1CC6A 2R45A 3G5RA 5LV9A 1DJNA 1OJAA 3BHKA 3ZYXA 3UKPA 1RP0A 4K5RA 3AXBA 1L0VA 1IUXA 4C5OA 5TR3A 1D4EA 3AB1A 2C66A 5M0ZA 2PYXA 2VQBA 1B4VA 3LADA 1IUUA 2WOWA 1PS9A 1YQ4A 2ZZCA 3CGEA 1E1KA 2ARDA 2JB1A 2IVDA 2BXRA 4E0VA 1V59A 1GSNA 4Y4NA 1OJ9A 2OAMA 4OCGA 3SX6A 1PN0A 3CPIG 2YM1A 4I58A 4UDPA 4U8NA 2BACA 2YAUA 1SEZA 4H4SA 2XFUA 2WDRA 4NZHA 4Y4LA 4C77A 4K22A 4OPUA 5KOWA 4GDPA 4EMJA 1LV0A 2E4GA 2OALA 2XDOA 4YWOA 2C70A 2GV8A 4H2QA 4X4JA 2XLTA 3L5OA 3SM8A 2BK3A 3EPTA 1N4VA 3GYXA 3NK2X 2WDVA 3SY4A 3UTHA 3NK1X 4G6GA 3RP8A 3GYJA 2WQYA 3F8DA 3NH3X 2NPXA 2BK4A 3AECA 2Z5YA 4A65A 4RG4A 1KSUA 3T2YA 4H4RA 1EL7A 3VQRA 3KPKA 3AE7A 2XFOA 5M10A 1H83A 2BCGG 1W4XA 3NYFA 2GH5A 2R0CA 3KPFA 1DNCA 1JRZA 3AE3A 1JNRA 1CJ3A 2BC1A 4XWZA 5HYMA 4H2NA 1VG9A 1F8RA 1K0JA 2RGHA 2WP9A 2WEUA 1RYIA 1GTHA 2C65A 4REKA 1S3BA 3REDA 2X50A 3CN8A 3D8XA 4A79A 4CY8A 4YSXA 3SYIA 2WU2A 2R46A 4JDRA 3NYCA 5KRQA 4GF7A 1IJHA 1F8SA 3GMBA 1KDGA 2GR2A 2V3BA 4U8PA 4Y4MA 1NENA 2BA9A 3ABVA 2B9XA 2X3NA 2EQ7A 2WPCA 4DGKA 3PO7A 1H6VA 3H4KA 4AP1A 3URHA 2VZ2A 4ZCCA 4H4UA 4H4VA 4CCRA 1ELIA 1H84A 1CJ4A 3CNPA 1F6MA 2DKHA 3G5QA 2X8CA 3VR9A 4EMWA 4B63A 2YQUA 2YG4A 3BI5A 2YG6A 4TM4A 4U8MA 1EBDA 4KPRA 4GCMA 1S2QA 1M6IA 1CC4A 1PJ6A 4TM3A 4M52A 1PJ5A 2OLNA 3BI4A 2RGOA 3T31A 5KXJA 4UDRA 1XHCA 4D04A 1NEKA 5EOWA 1FECA 5FS9A 4Z44A 5DBJA 4JQ9A 1FCDA 4B68A 5KMRA 3E1TA 2BS2A 4CRTA 1K0LA 5CKUA 3GRSA 4A6NB 2GVCA 1ZMDA 2B7SA 2GMJA 3CNJA 1ZMCA 4EQRA 3HYWA 4BJYA 1NPXA 2Q6UA 2YG5A 2YVJA 1F8WA 2QA1A 3I6DA 4B65A 2VOUA 1GRTA 4I59A 1PBCA 3T2KA 2VRLA 5FS7A 1N4UA 4TLXA 3AE8A 1GALA 4BJZA 2XLPA 4ZN0A 4FDCB 3S5WA 2JK6A 1KNPA 3CGCA 1E1NA 4YKGA 1DODA 4A5LA 1HYUA 3ALLA 1OJTA 1P2EA 1NHRA 1P2HA 2QCUA 3AE4A 1S3EA 1CJ2A 1H81A 4EQWA 3NN6X 2IIDA 3M0OA 2BS3A 1CHUA 3GYIA 3V76A 1KF6A 2C4CA 2FJDA 1GRHA 3NLCA 4K2XA 1NG3A 3B6DA 4OPTA 3ADAB 2XFQA 5HHFA 4II3A 2YVFA 4HA6A 1CC2A 1ZX9A 2XCGA 5ER0A 1CL0A 3BI2A 3FG2P 3SQPA 2JBVA 2FJEA 3BHFA 2Q7VA 3LB8A 1B8SA 3P1WA 4WCTA 4EQXA 4YXDA 4A6NA 5KWFA 1E39A 2R9ZA 1FEAA 3AEFA 1XPQA 2XLRA 3DK4A 4CNJA 1B37A 4PABA 5JCMA 5KMQA 1PBDA 3EAOA 2C7GA 3UP4A 1KFYA 5JRBA 3AYLA 1IUSA 2GQFA 3DJDA 4EQSA 1MOKA 4NTEA 3UOVA 1JRXA 2VQ7A 3UKLA 2YWLA 4U8JA 4YT0A 3I3LA 4J57A 1ZP0A 2VVLG 3CNTA 3F8RA 4ECHA 4EM3A 4AOXA 1LJ1A 1GNDA 2Q0KA 1ZOVA 4J36A 3F8PA 4G6HA 4J33A 4KX6A 4BK2A 2VVLA 3ALJA 1N4WA 2WS3A 2XVHA 1CJCA 1PXBA 3QFBA 3JSKA 3LJPA 4EM4A 5BUKA 4H4QA 1PBBA 4CCQA 5IPYA 4J31A 2XVEA 3IC9A 5KOXA 3V3NA 3RP7A 2PHHA 3AEDA 2XFNA 3GDPA 3SZFA 2CDUA 5KMPA 3FMWA 4H4PA 1D4CA 1Y0PA 1L9CA 3NTDA 5KVIA 4NEWA 3UOXA 1PJ7A 1LPFA 3SFEA 3II4A 5BRTA 2GRTA 2WP6A 3AYIA 4FK1C 3SXIA 4USRA 4Z25A 2C64A 4H4ZA 3K7TA 2V61A 3NT6A 3LZXA 3NGCX 2GMHA 4C3YA 1GRFA 2EQ9A 4B69A 4NEVA 2GR0A 4H4XA 1GT8A 4Z24A 4H4YA 1COYA 2BCPA 1GRAA 1TDKA 1OJDA 4UP3A 4G73A 4N9XA 1GXFA 4OPGA 3UKQA 1NHQA 3K7MX 3DGHA 5U25A 5JCIA 2YG7A 3KD9A 3LZWA 3Q9TA 4OPLA 2AR8A 4IVOB 4B66A 2YLRA 4B64A 2YR5A 3AEEA 3NN0X 2B76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJA A;  4H7U A;  3GWF A;  2ZZB A;  3GMC A;  4LU6 A;  5KVH A;  5EBK A;  3ALM A;  3K7Q X;  2OA1 A;  2QA2 A;  1GER A;  2C3D A;  1EL9 A;  2CUL A;  2Y6Q A;  3H8L A;  4P9S A;  4TM0 A;  1KSS A;  1PXA A;  3H8I A;  4B1B A;  2WET A;  1GTE A;  3PVC A;  2X99 A;  4IV9 A;  3VR8 A;  3AYJ A;  4TLZ A;  4X9M A;  3DJG X;  1GRG A;  2Z5X A;  3T37 A;  3KKJ A;  5BVA A;  2BC0 A;  3AEB A;  4IA6 A;  1MXT A;  3WE0 A;  4CNK A;  4GUV A;  4CBQ A;  2C67 A;  3DA1 A;  5HXI A;  3CPH G;  2V6O A;  1B5Q A;  1TDN A;  3O0H A;  3P4R A;  3L1R A;  3KLJ A;  3S61 A;  3KVE A;  3B3R A;  3EF6 A;  5CQF A;  1DOE A;  1TDE A;  2A87 A;  4J2W A;  4EIQ A;  5FS8 A;  2F5Z A;  4DNA A;  5J7X A;  2YG3 A;  3OC4 A;  4BV6 A;  1VDC A;  2CVJ A;  4HB9 A;  4AP3 A;  1EL8 A;  2WDQ A;  1LTX R;  4CY6 A;  2TMD A;  1D4D A;  1ZK7 A;  3DJE A;  4ICY A;  2GR3 A;  3KA7 A;  2APG A;  2WU5 A;  5C3J A;  4OPD A;  4MJW A;  3UOZ A;  4OPI A;  1QLB A;  4X9N A;  3UKK A;  4AT0 A;  4D03 A;  3QSM A;  1E1L A;  4USQ A;  3M13 A;  1AOG A;  3SFD A;  1PHH A;  1ZY8 A;  4YKF A;  5EB5 A;  1UKV G;  5J60 A;  4K7Z A;  1ZKQ A;  3BNM A;  2WPF A;  1RSG A;  3GRT A;  5L46 A;  4U2L A;  3G5S A;  4DSH A;  1GET A;  5JCK A;  3DK9 A;  1E1M A;  3QVR A;  1O95 A;  1X31 B;  1TYT A;  5BUL A;  2JB2 A;  1EL5 A;  1KNR A;  4J34 A;  1CF3 A;  3EAN A;  3HZL A;  3QVP A;  4JN9 A;  1D7Y A;  3CGB A;  4Z2R A;  1GRB A;  3CND A;  2R4J A;  1ZOY A;  2ZBW A;  1Q9I A;  3GWD A;  4EIP A;  2UZZ A;  2YVG A;  3DGZ A;  1YQ3 A;  3OZ2 A;  1CBO A;  3D1C A;  2E5V A;  3NKS A;  4RG3 A;  2FBW A;  1VRQ B;  1DOC A;  4C74 A;  4Z2T A;  1FL2 A;  2YLX A;  4JNA A;  3SGL A;  2BYB A;  3NIX A;  1H7W A;  4IVM B;  1JRY A;  1DXL A;  4BK1 A;  2YLW A;  5FS6 A;  4EMI A;  3LOV A;  3VRB A;  3ICS A;  2XLS A;  2H89 A;  4LII A;  2R4E A;  2NVK X;  1Z6L A;  3AD7 B;  1JU2 A;  2E1M A;  3CTY A;  3UKF A;  4U8I A;  1XAN A;  3CNS A;  2QAE A;  1YY5 A;  3P4S A;  2WBA A;  2WOV A;  1GRE A;  1GEU A;  1DJQ A;  1F3P A;  3AE6 A;  3L8K A;  1BGN A;  2GAH B;  4Z2U A;  3M12 A;  4OVI A;  2X8H A;  2I0Z A;  2XYO A;  1L9D A;  2R0P A;  4XWR A;  3UP5 A;  3CPJ G;  2O9Z A;  4Z26 A;  4YSY A;  3AD8 B;  4NTD A;  1NHP A;  1N1P A;  4YSH A;  1PBF A;  1FOH A;  3FPZ A;  3NYE A;  2XVF A;  1H82 A;  3QJ4 A;  3PS9 A;  4XXG A;  2EQ8 A;  1K4Q A;  4C3X A;  3Q6J A;  2YR6 A;  3NRN A;  2YLT A;  2AAQ A;  2RAB A;  1K0I A;  2A89 A;  3AD9 B;  3FIM B;  3AEA A;  4H4W A;  3P9U A;  4OPC A;  4WX1 A;  2RGJ A;  3C4A A;  2WPE A;  5EB4 A;  3RHA A;  4APN A;  2GEW A;  2R0G A;  2GR1 A;  3DME A;  1O94 A;  1VG0 A;  3NG7 X;  3ATR A;  4UDQ A;  1FEB A;  3AEG A;  4GRT A;  2YM2 A;  3V3O A;  4AOS A;  2XFP A;  2JB3 A;  4U8K A;  3RP6 A;  2EQ6 A;  2B9Y A;  4O5Q A;  3COX A;  2Y6R A;  1IUW A;  2H88 A;  3RNM A;  1YQZ A;  3VRA A;  2JAE A;  3LXD A;  1L9E A;  1D5T A;  5GRT A;  3QSE A;  4H50 A;  1E6E A;  2ZZ0 A;  2CFY A;  3IWA A;  4K8D A;  3AE5 A;  1PBE A;  3UCL A;  1LQU A;  1ZDL A;  2W0H A;  3ISH A;  4FK1 A;  2C75 A;  4YTN A;  5JCL A;  1GPE A;  1TDO A;  5GSN A;  2BS4 A;  4U8L A;  1BKW A;  3UKA A;  2XVJ A;  2GAG B;  4U2S A;  3NK0 X;  3AWI A;  3UTF A;  3C4N A;  1OJC A;  1Q1R A;  2AQJ A;  3ICR A;  2GB0 A;  1M64 A;  2HQM A;  2J3N A;  2WES A;  4YTP A;  4H4T A;  2A8X A;  3AE9 A;  4BK3 A;  4Z43 A;  1NDA A;  4ZCD A;  2JKC A;  3NNE A;  3AE2 A;  4K5S A;  4IA5 A;  2B9W A;  3GDN A;  1Y56 B;  2DKI A;  1QJD A;  2GF3 A;  1LQT A;  2IVE A;  4ADW A;  1GOS A;  3NHO X;  3UTG A;  1IUT A;  4U2T A;  3DJJ A;  2BK5 A;  3GD3 A;  3NTA A;  3IF9 A;  2VVM A;  3ZDN A;  2FJB A;  1JNZ A;  5FMH A;  1TDF A;  2XLU A;  2V60 A;  2V3A A;  1TRB A;  1H7X A;  1VQW A;  4DSG A;  1NHS A;  3K30 A;  4JNQ A;  2C3C A;  1E7P A;  1GES A;  2B7R A;  5IQ1 A;  4FX9 A;  3P4Q A;  1D7L A;  3BNU A;  3AE1 A;  1BF3 A;  4GDE A;  4O5U A;  3UOY A;  4AT2 A;  4YSZ A;  5JCN A;  4A9W A;  3CGD A;  3ICT A;  1MO9 A;  5U1O A;  1DOB A;  1YKJ A;  1GV4 A;  2OLO A;  2BXS A;  4BUR A;  2WHD A;  3ATQ A;  2BAB A;  3C96 A;  3CIR A;  3P4P A;  1PDH A;  4H2P A;  5IQ4 A;  2YLZ A;  4B67 A;  2TPR A;  3GD4 A;  3IHG A;  4NTC A;  1O5W A;  1NG4 A;  2C72 A;  1BGJ A;  2C76 A;  3R9U A;  1LVL A;  2YR4 A;  3IHM A;  4H2R A;  4LA1 A;  2YLS A;  4YTM A;  1ONF A;  1IUV A;  4JY3 A;  1TYP A;  3UKH A;  4J56 A;  3GSI A;  3QFA A;  2C73 A;  2WP5 A;  1JOA A;  4GR1 A;  2VRM A;  3VRD B;  1JEH A;  2XVI A;  1Q1W A;  4TM1 A;  2Q0L A;  2V5Z A;  4U8O A;  1H86 A;  1REO A;  3DH9 A;  4A7A A;  4PAA A;  1Y56 A;  1BWC A;  1PXC A;  5C2T A;  5U63 A;  3UTE A;  4RSL A;  1BZL A;  2X8G A;  4JY2 A;  2WOI A;  3KU9 A;  2ACZ A;  4A99 A;  3QSS A;  1NAA A;  1S2Y A;  3DK8 A;  3ITJ A;  1QO8 A;  5HY5 A;  2GQW A;  3FBS A;  1XDI A;  1CC6 A;  2R45 A;  3G5R A;  5LV9 A;  1DJN A;  1OJA A;  3BHK A;  3ZYX A;  3UKP A;  1RP0 A;  4K5R A;  3AXB A;  1L0V A;  1IUX A;  4C5O A;  5TR3 A;  1D4E A;  3AB1 A;  2C66 A;  5M0Z A;  2PYX A;  2VQB A;  1B4V A;  3LAD A;  1IUU A;  2WOW A;  1PS9 A;  1YQ4 A;  2ZZC A;  3CGE A;  1E1K A;  2ARD A;  2JB1 A;  2IVD A;  2BXR A;  4E0V A;  1V59 A;  1GSN A;  4Y4N A;  1OJ9 A;  2OAM A;  4OCG A;  1PN0 A;  3CPI G;  2YM1 A;  4I58 A;  4UDP A;  4U8N A;  2BAC A;  2YAU A;  1SEZ A;  4H4S A;  2XFU A;  2WDR A;  4NZH A;  4Y4L A;  4C77 A;  4K22 A;  4OPU A;  5KOW A;  4GDP A;  4EMJ A;  1LV0 A;  2E4G A;  2OAL A;  2XDO A;  4YWO A;  2C70 A;  2GV8 A;  4H2Q A;  4X4J A;  2XLT A;  3SM8 A;  2BK3 A;  3EPT A;  1N4V A;  3NK2 X;  2WDV A;  3UTH A;  3NK1 X;  3RP8 A;  3GYJ A;  2WQY A;  3F8D A;  3NH3 X;  2NPX A;  2BK4 A;  3AEC A;  2Z5Y A;  4A65 A;  4RG4 A;  1KSU A;  3VQR A;  4H4R A;  1EL7 A;  3AE7 A;  2XFO A;  5M10 A;  1H83 A;  2BCG G;  1W4X A;  3NYF A;  2GH5 A;  2R0C A;  3KPF A;  1DNC A;  1JRZ A;  3AE3 A;  1JNR A;  1CJ3 A;  2BC1 A;  4XWZ A;  5HYM A;  4H2N A;  1VG9 A;  1F8R A;  1K0J A;  2RGH A;  2WP9 A;  2WEU A;  1RYI A;  1GTH A;  2C65 A;  4REK A;  1S3B A;  3RED A;  2X50 A;  3CN8 A;  3D8X A;  4A79 A;  4CY8 A;  4YSX A;  2WU2 A;  2R46 A;  4JDR A;  3NYC A;  5KRQ A;  4GF7 A;  1IJH A;  1F8S A;  3GMB A;  1KDG A;  2GR2 A;  2V3B A;  4U8P A;  4Y4M A;  1NEN A;  2BA9 A;  3ABV A;  2B9X A;  2X3N A;  2EQ7 A;  2WPC A;  4DGK A;  3PO7 A;  1H6V A;  3H4K A;  4AP1 A;  3URH A;  2VZ2 A;  4ZCC A;  4H4U A;  4H4V A;  4CCR A;  1ELI A;  1H84 A;  1CJ4 A;  3CNP A;  1F6M A;  2DKH A;  3G5Q A;  2X8C A;  3VR9 A;  4EMW A;  4B63 A;  2YQU A;  2YG4 A;  3BI5 A;  2YG6 A;  4TM4 A;  4U8M A;  1EBD A;  4KPR A;  4GCM A;  1S2Q A;  1M6I A;  1CC4 A;  1PJ6 A;  4TM3 A;  4M52 A;  1PJ5 A;  2OLN A;  3BI4 A;  2RGO A;  5KXJ A;  4UDR A;  1XHC A;  4D04 A;  1NEK A;  5EOW A;  1FEC A;  5FS9 A;  4Z44 A;  5DBJ A;  4JQ9 A;  1FCD A;  4B68 A;  3E1T A;  2BS2 A;  4CRT A;  1K0L A;  5CKU A;  3GRS A;  4A6N B;  2GVC A;  1ZMD A;  2B7S A;  2GMJ A;  3CNJ A;  1ZMC A;  4EQR A;  4BJY A;  1NPX A;  2Q6U A;  2YG5 A;  2YVJ A;  1F8W A;  2QA1 A;  3I6D A;  4B65 A;  2VOU A;  1GRT A;  4I59 A;  1PBC A;  2VRL A;  5FS7 A;  1N4U A;  4TLX A;  3AE8 A;  1GAL A;  4BJZ A;  2XLP A;  4ZN0 A;  4FDC B;  3S5W A;  2JK6 A;  1KNP A;  3CGC A;  1E1N A;  4YKG A;  1DOD A;  4A5L A;  1HYU A;  3ALL A;  1OJT A;  1P2E A;  1NHR A;  1P2H A;  2QCU A;  3AE4 A;  1S3E A;  1CJ2 A;  1H81 A;  4EQW A;  3NN6 X;  2IID A;  3M0O A;  2BS3 A;  1CHU A;  3GYI A;  3V76 A;  1KF6 A;  2FJD A;  1GRH A;  3NLC A;  4K2X A;  1NG3 A;  3B6D A;  4OPT A;  3ADA B;  2XFQ A;  5HHF A;  2YVF A;  4HA6 A;  1CC2 A;  1ZX9 A;  2XCG A;  5ER0 A;  1CL0 A;  3BI2 A;  3FG2 P;  3SQP A;  2JBV A;  2FJE A;  3BHF A;  2Q7V A;  3LB8 A;  1B8S A;  3P1W A;  4WCT A;  4EQX A;  4YXD A;  4A6N A;  5KWF A;  1E39 A;  2R9Z A;  1FEA A;  3AEF A;  1XPQ A;  2XLR A;  3DK4 A;  4CNJ A;  1B37 A;  4PAB A;  5JCM A;  1PBD A;  3EAO A;  2C7G A;  3UP4 A;  1KFY A;  3AYL A;  1IUS A;  2GQF A;  3DJD A;  4EQS A;  1MOK A;  4NTE A;  3UOV A;  1JRX A;  2VQ7 A;  3UKL A;  2YWL A;  4U8J A;  4YT0 A;  3I3L A;  4J57 A;  1ZP0 A;  2VVL G;  3CNT A;  3F8R A;  4ECH A;  4EM3 A;  4AOX A;  1LJ1 A;  1GND A;  2Q0K A;  1ZOV A;  4J36 A;  3F8P A;  4J33 A;  4KX6 A;  4BK2 A;  2VVL A;  3ALJ A;  1N4W A;  2WS3 A;  2XVH A;  1CJC A;  1PXB A;  3QFB A;  3JSK A;  3LJP A;  4EM4 A;  5BUK A;  4H4Q A;  1PBB A;  4CCQ A;  5IPY A;  4J31 A;  2XVE A;  3IC9 A;  5KOX A;  3V3N A;  3RP7 A;  2PHH A;  3AED A;  2XFN A;  3GDP A;  2CDU A;  3FMW A;  4H4P A;  1D4C A;  1Y0P A;  1L9C A;  3NTD A;  5KVI A;  4NEW A;  3UOX A;  1PJ7 A;  1LPF A;  3SFE A;  3II4 A;  5BRT A;  2GRT A;  2WP6 A;  3AYI A;  4FK1 C;  4Z25 A;  4USR A;  2C64 A;  4H4Z A;  3K7T A;  2V61 A;  3NT6 A;  3LZX A;  3NGC X;  2GMH A;  4C3Y A;  1GRF A;  2EQ9 A;  4B69 A;  4NEV A;  2GR0 A;  4H4X A;  1GT8 A;  4Z24 A;  4H4Y A;  1COY A;  2BCP A;  1GRA A;  1TDK A;  1OJD A;  4UP3 A;  4N9X A;  1GXF A;  4OPG A;  3UKQ A;  1NHQ A;  3K7M X;  3DGH A;  5U25 A;  5JCI A;  2YG7 A;  3KD9 A;  3LZW A;  3Q9T A;  4OPL A;  2AR8 A;  4IVO B;  4B66 A;  2YLR A;  4B64 A;  2YR5 A;  3AEE A;  3NN0 X;  2B76 A; 
#chains in the Genus database with same CATH topology
 4H7U A;  3GWF A;  3SZ0 A;  3ALM A;  3K7Q X;  2OA1 A;  4H1Z A;  2X99 A;  3AYJ A;  4X9M A;  3UJ2 A;  3DJG X;  2Z5X A;  3HYX A;  3T37 A;  2GGJ A;  1TDN A;  3A7R A;  3B3R A;  3EF6 A;  1DOE A;  3VA8 A;  2P0I A;  2F5Z A;  5J7X A;  2WDQ A;  3T0K A;  2APG A;  1VDV A;  4OPI A;  1EC7 A;  3UKK A;  4AT0 A;  1ELS A;  1ONE A;  4USQ A;  3M13 A;  1ZY8 A;  4YKF A;  5J60 A;  3MQT A;  3BNM A;  3IJQ A;  1RSG A;  4U2L A;  3G5S A;  1GET A;  2OVL A;  1ECQ A;  1TYT A;  1N62 C;  2R4J A;  4EIP A;  2UZZ A;  2YVG A;  1YQ3 A;  3NKS A;  3GY1 A;  1DOC A;  4Z2T A;  2PTW A;  4ZA0 A;  3SGL A;  1H7W A;  1JRY A;  2YLW A;  5FS6 A;  3ICS A;  3T4W A;  1N61 C;  1Z6L A;  3AD7 B;  2BRY A;  1JU2 A;  3VC5 A;  3PFR A;  2ZAD A;  3A7U A;  2QAE A;  2WBA A;  2WOV A;  1GRE A;  1GEU A;  3RGT A;  4Z2U A;  3FYY A;  4XWR A;  3CXB A;  1NEL A;  4YSH A;  1FOH A;  3R10 A;  2EQ8 A;  4JN8 A;  3Q6J A;  3ES7 A;  2YLT A;  2AAQ A;  4E8G A;  3FIM B;  2RGJ A;  3C4A A;  1PDZ A;  1X2H A;  3S47 A;  3N4E A;  1VG0 A;  4MGG A;  4UDQ A;  3V3O A;  3SZW A;  2HNE A;  3RP6 A;  2H88 A;  3RNM A;  2JAE A;  4K8G A;  5GRT A;  3QSE A;  1LQU A;  2W0H A;  6ENL A;  4YTN A;  1TDO A;  5GSN A;  2BS4 A;  2XVJ A;  4KEM A;  4U2S A;  5FJR A;  2AKM A;  2WES A;  4YTP A;  4H4T A;  1MRA A;  2JKC A;  2DKI A;  1FHV A;  1LQT A;  4ADW A;  1IUT A;  1FO4 A;  3CB3 A;  3R0U A;  1WUE A;  3K30 A;  4JNQ A;  1S7M A;  4FX9 A;  3IJL A;  4FP1 A;  4O5U A;  5EU9 A;  1MO9 A;  2OLO A;  1YKJ A;  2BXS A;  1JRP A;  5IQ4 A;  4J3Z A;  2YLZ A;  4B67 A;  3GD4 A;  3RIT A;  3DG3 A;  2FKP A;  3SQS A;  2OZ3 A;  2C72 A;  3IHM A;  4H2R A;  2YLS A;  2B76 A;  4JY3 A;  3QFA A;  1JOA A;  4GR1 A;  4DX3 A;  2V5Z A;  4U8O A;  3VDG A;  4PAA A;  1BWC A;  1PDY A;  5C2T A;  5U63 A;  4DWD A;  4RSL A;  3EUB 3;  3EKG A;  1F9C A;  3DK8 A;  3FBS A;  1XDI A;  3G5R A;  2OFJ A;  3NXL A;  3AXB A;  3SN0 A;  1L0V A;  1D4E A;  2C66 A;  1IUU A;  3VR9 A;  2WOW A;  1YQ4 A;  2PU0 A;  2ARD A;  3JW7 A;  1PN0 A;  4UDP A;  2GGH A;  1SEZ A;  4H4S A;  2XFU A;  5J04 A;  4NZH A;  4OPU A;  5KOW A;  3UJR A;  2E4G A;  3RRA A;  2XLT A;  2OZT A;  2BK3 A;  1SJD A;  3TWB A;  1N4V A;  2WDV A;  4GIR A;  3NH3 X;  3T2Y A;  4H4R A;  3DG6 A;  2R0C A;  1DNC A;  1JRZ A;  4XWZ A;  5HYM A;  1VG9 A;  2WEU A;  2C65 A;  3RED A;  2R46 A;  3NYC A;  5KRQ A;  4GF7 A;  2GR2 A;  4U8P A;  2B9X A;  2GL5 A;  3PWI A;  1H6V A;  3URH A;  4ZCC A;  4H4U A;  4H4V A;  4CCR A;  1CJ4 A;  3CNP A;  2DKH A;  4KPR A;  1CC4 A;  4TM3 A;  1PJ5 A;  1JPD X;  4Z44 A;  3E1T A;  2BS2 A;  1MDR A;  5CKU A;  2QGY A;  3RO6 A;  4KT2 A;  2QA1 A;  1GRT A;  4TLX A;  4BJZ A;  3GC2 A;  3AN1 A;  4YKG A;  4M0X A;  4E5T A;  3ALL A;  2QCU A;  1CHU A;  2FJD A;  1GRH A;  2PPG A;  1NG3 A;  3B6D A;  4OPT A;  2AL1 A;  5HHF A;  4II3 A;  1CC2 A;  2XCG A;  3QLD A;  2ONE A;  2OPJ A;  1B8S A;  3VC6 A;  1E39 A;  3ZVH B;  4ENL A;  1B37 A;  3QKE A;  4JHM A;  2O56 A;  3EAO A;  1N5W C;  2GQF A;  4M6U A;  1MOK A;  3UOV A;  1KD0 A;  1JRX A;  5FJO A;  2VQ7 A;  4U8J A;  4J57 A;  1ZP0 A;  3F8R A;  4ECH A;  1LJ1 A;  2QDE A;  4J36 A;  3F8P A;  4G6H A;  2WS3 A;  3FVD A;  2XVH A;  1PXB A;  3JSK A;  4EM4 A;  4CCQ A;  4J31 A;  1R6W A;  2PHH A;  3AED A;  3TW9 A;  3UXL A;  5KVI A;  5BRT A;  2GRT A;  2OG9 A;  2GMH A;  1GRF A;  4H4X A;  3ZVH A;  4H4Y A;  4UP3 A;  3T9P A;  3CXO A;  2AR8 A;  2YR5 A;  1MDL A;  1ZXI C;  2FJA A;  3GMC A;  4LU6 A;  4TM0 A;  3H8I A;  3PVC A;  3R0K A;  5KNL A;  3UGV A;  5BVA A;  3WE0 A;  2C67 A;  3DA1 A;  2V6O A;  3P4R A;  4H83 A;  3KVE A;  2A87 A;  1EBG A;  4DNA A;  2YG3 A;  4BV6 A;  1VDC A;  2CVJ A;  1LTX R;  2TMD A;  1ZK7 A;  3DJE A;  2P88 A;  3KA7 A;  5C3J A;  3UOZ A;  3QSM A;  1AOG A;  3SFD A;  5EB5 A;  1UKV G;  4K7Z A;  3GRT A;  5L46 A;  5G5G B;  3R1Z A;  2DW7 A;  4DSH A;  1E1M A;  3Q4D A;  1O95 A;  1X31 B;  3P93 A;  1IYX A;  5BUL A;  4J1O A;  3UCC A;  1CF3 A;  3HZL A;  3QVP A;  4Z2R A;  3CGB A;  4GGB A;  3CND A;  1ZOY A;  4DXK A;  3OZ2 A;  1CBO A;  2GGI A;  3TJ4 A;  2P8B A;  3HYV A;  1FL2 A;  2BYB A;  4IVM B;  1DXL A;  3FJ4 A;  3LOV A;  2XLS A;  4IL0 A;  2H89 A;  4LII A;  2R4E A;  2NVK X;  4U8I A;  3CNS A;  3P4S A;  1F3P A;  2GAH B;  4OVI A;  1L9D A;  3CPJ G;  3AD8 B;  3T8Q A;  3IK4 A;  3NYE A;  4E4U A;  1H82 A;  3QJ4 A;  2PCE A;  4C3X A;  3NRN A;  2A89 A;  3KUM A;  4H4W A;  4OPC A;  4WX1 A;  5EB4 A;  4APN A;  2R0G A;  4GRT A;  4G9K A;  2JB3 A;  4O5Q A;  3COX A;  1IUW A;  4TVY A;  3LXD A;  4H50 A;  1FFU C;  2CFY A;  3MKC A;  3AE5 A;  1PBE A;  1ZDL A;  4FK1 A;  1GPE A;  5KMS A;  4U8L A;  1KKR A;  3UKA A;  2W54 A;  1JDF A;  1Q1R A;  2AQJ A;  2GB0 A;  2J3N A;  2A8X A;  4ZCD A;  3TOY A;  3NNE A;  3UJE A;  1Y56 B;  1QJD A;  1GOS A;  3NHO X;  3UTG A;  3DJJ A;  3STP A;  2VVM A;  4HPN A;  1H7X A;  4DSG A;  1NHS A;  3SSZ A;  1E7P A;  3CYJ A;  2B7R A;  3P4Q A;  3AE1 A;  4A9W A;  3CGD A;  3HW2 A;  1DOB A;  3ATQ A;  2HXU A;  2TPR A;  4TVW A;  3TQP A;  1BGJ A;  1LVL A;  2QVH A;  4H19 A;  3UKH A;  4J56 A;  2C73 A;  2WP5 A;  2XVI A;  4TM1 A;  3U9I A;  4A7A A;  3QN3 A;  1Y56 A;  3UTE A;  4HNC A;  2XH4 A;  5HY5 A;  1QO8 A;  5LV9 A;  3BHK A;  3OZM A;  3AM9 A;  4C5O A;  1B4V A;  3ETR B;  1PS9 A;  3DFY A;  2IVD A;  1P43 A;  4E0V A;  1GSN A;  1OJ9 A;  2OAM A;  4U8N A;  2XH7 A;  4IP5 A;  1N63 C;  4IT1 A;  4C77 A;  4HCH A;  4K22 A;  1LV0 A;  2C70 A;  3L5O A;  3SY4 A;  3GYJ A;  3F8D A;  2NPX A;  1KSU A;  3KPK A;  2XFO A;  5M10 A;  1W4X A;  3NYF A;  3TJI A;  2PP0 A;  3KPF A;  3DES A;  5G5H B;  1F8R A;  2RGH A;  1GTH A;  2PTZ A;  4IP4 A;  3SN1 A;  2WU2 A;  1XS2 A;  1F8S A;  1KDG A;  4Y4M A;  2P3Z A;  2XSX A;  3ABV A;  3Q45 A;  2EQ7 A;  2WPC A;  4DGK A;  3DIP A;  3H4K A;  4AP1 A;  2VZ2 A;  2PSN A;  5FJU A;  3G5Q A;  2X8C A;  3D47 A;  2YG6 A;  4U8M A;  3MSY A;  4GCM A;  4GFI A;  4M52 A;  2FYM A;  3BI4 A;  3T31 A;  3GO2 A;  4D04 A;  2PMQ A;  1FEC A;  1FCD A;  4B68 A;  4CRT A;  2B7S A;  1SJA A;  1ZMC A;  4EQR A;  2Q6U A;  3BJS A;  3ZLH A;  4B65 A;  2VOU A;  4I59 A;  5FS7 A;  1N4U A;  3H70 A;  1KNP A;  2RDX A;  1DOD A;  4A5L A;  1HYU A;  2GGG A;  2QJN A;  1P2E A;  1NHR A;  4EQW A;  4HN8 A;  2BS3 A;  3GYI A;  3ENL A;  2C4C A;  1TZZ A;  2OQH A;  2XFQ A;  1ZX9 A;  1CL0 A;  3SQP A;  3BHF A;  2Q7V A;  3P1W A;  3AEF A;  3DK4 A;  5JCM A;  3RR1 A;  3AYL A;  5JRB A;  1IUS A;  3DJD A;  1RVK A;  4YT0 A;  3I3L A;  2VVL G;  4AOX A;  1ZOV A;  4J33 A;  4KX6 A;  1N4W A;  3QFB A;  3CAW A;  3THU A;  2XFN A;  3GDP A;  4H4P A;  1D4C A;  4NEW A;  3UOX A;  1LPF A;  3B97 A;  3II4 A;  2WP6 A;  4FK1 C;  2V61 A;  3NT6 A;  3NGC X;  4C3Y A;  2EQ9 A;  2QQ6 A;  2CHR A;  1KKO A;  2OQY A;  1GXF A;  1NHQ A;  3K7M X;  3Q9T A;  3AEE A;  3NN0 X;  3CK5 A;  5ENL A;  2ZZB A;  5EBK A;  3SBF A;  2QA2 A;  1GER A;  2C3D A;  1EL9 A;  2CUL A;  1KSS A;  4B1B A;  3UJF A;  4IV9 A;  3IJI A;  3H12 A;  4TLZ A;  3H7V A;  1GRG A;  3KKJ A;  4YWS A;  2BC0 A;  4IA6 A;  2P8C A;  4CNK A;  4CBQ A;  5HXI A;  2W55 A;  1B5Q A;  3O0H A;  2E5A A;  4II2 A;  3L1R A;  1TDE A;  4GYP C;  4EIQ A;  4HCD A;  3U4F A;  3OC4 A;  4HB9 A;  4AP3 A;  3OTR A;  3ES8 A;  4OPD A;  4MJW A;  4IL2 A;  1QLB A;  4GIS A;  4X9N A;  3DDM A;  1E1L A;  1PHH A;  3CT2 A;  2WPF A;  5JCK A;  3MWC A;  3T2Z A;  2JB2 A;  1KNR A;  4JN9 A;  1D7Y A;  1GRB A;  4X2P A;  3S5S A;  2ZBW A;  3DGZ A;  2E5V A;  1VRQ B;  4GAP A;  3NVZ B;  4BK1 A;  4EMI A;  1L8P A;  3R11 A;  1E9I A;  1P48 A;  2AL2 B;  2POZ A;  3CTY A;  4Z1Y A;  1XAN A;  1DJQ A;  4Z17 A;  3ZLF A;  3L8K A;  2X8H A;  3V5C A;  2R0P A;  2O9Z A;  4Z26 A;  1KN0 A;  4E6M A;  3SN4 A;  2YR6 A;  4D03 A;  1K0I A;  3AEA A;  3N4F A;  3JZU A;  2MNR A;  1O94 A;  3NG7 X;  3ATR A;  3MUC A;  4AOS A;  2B9Y A;  1W6T A;  2AL2 A;  1YQZ A;  3TCS A;  1L9E A;  1D5T A;  3FV9 A;  1E6E A;  2ZZ0 A;  4K8D A;  3UCL A;  4DYE A;  5JCL A;  3D46 A;  3AWI A;  3UTF A;  1V97 A;  3ICR A;  2HQM A;  4MMW A;  2PGW A;  3AE9 A;  4BK3 A;  4Z43 A;  3AE2 A;  2IVE A;  2PGE A;  2GGE A;  4U2T A;  3NTA A;  2XLU A;  2V60 A;  2V3A A;  2MUC A;  1D7L A;  4GDE A;  1BF3 A;  4YSZ A;  3ICT A;  5U1O A;  4EWJ A;  4BUR A;  4DHG A;  2PA6 A;  1PDH A;  3P4P A;  3IHG A;  1NG4 A;  3R9U A;  2YR4 A;  4LA1 A;  4GGH A;  1ONF A;  3V5F A;  3VRD B;  1JEH A;  2Q0L A;  1H86 A;  4G8T A;  1MNS A;  2OO6 A;  1PXC A;  1BZL A;  2WOI A;  4G74 A;  3QSS A;  3DG7 A;  1NAA A;  1T3Q C;  1CC6 A;  3OP2 A;  1OJA A;  1EBH A;  3ZYX A;  4K5R A;  1IUX A;  2VQB A;  3SM8 A;  2ZZC A;  3CGE A;  1E1K A;  2BXR A;  1V59 A;  1VQZ A;  4OCG A;  2YM1 A;  2GDQ A;  2OAL A;  2GV8 A;  4H2Q A;  4FI4 A;  3EPT A;  3GYX A;  3UTH A;  3NK1 X;  2OKT A;  3RP8 A;  2WQY A;  2BK4 A;  3AEC A;  2AKZ A;  1EC9 A;  3N6J A;  1EL7 A;  3VQR A;  2BC1 A;  4H2N A;  1K0J A;  1S3B A;  3CN8 A;  3D8X A;  4A79 A;  4CY8 A;  4ZOH B;  3SYI A;  4JDR A;  3V3W A;  3GMB A;  2V3B A;  3AMZ A;  5FJP A;  2DW6 A;  2X3N A;  3PO7 A;  3UXK A;  4H2H A;  3I6E A;  1ELI A;  1F6M A;  4B63 A;  4EMW A;  3OZY A;  2YQU A;  2YG4 A;  4A35 A;  1XPY A;  2OLA A;  2NQL A;  3UCD A;  2RGO A;  1XHC A;  1NEK A;  5EOW A;  5FS9 A;  5DBJ A;  3DFH A;  3T6C A;  4A6N B;  1NPX A;  2HXT A;  2YG5 A;  2YVJ A;  1F8W A;  3T2K A;  2VRL A;  3AE8 A;  1FFV C;  1GAL A;  4GYP A;  4HNL A;  2JK6 A;  2XH0 A;  3CGC A;  3N6H A;  4A3R A;  1P2H A;  3AE4 A;  4JN7 A;  2IID A;  3V76 A;  1KF6 A;  1NU5 A;  3NLC A;  2PTX A;  3ZVI A;  4K2X A;  4HA6 A;  3BI2 A;  2PP1 A;  3FG2 P;  1R0M A;  2FJE A;  4IZG A;  4WCT A;  4EQX A;  4YXD A;  4A6N A;  2XLR A;  3A7A A;  4CNJ A;  1OEP A;  1PBD A;  7ENL A;  4A6G A;  1KFY A;  2POD A;  4EQS A;  3CNT A;  3DER A;  4K1W A;  1WYG A;  1SJC A;  2VVL A;  3LJP A;  5BUK A;  5IPY A;  3V3N A;  3RP7 A;  3SZF A;  2CDU A;  3FMW A;  1Y0P A;  3NTD A;  1BQG A;  1PJ7 A;  3SFE A;  3AYI A;  4Z25 A;  2I5Q A;  2C64 A;  3K7T A;  3LZX A;  3K1G A;  5FJT A;  3QPE A;  4B69 A;  4NEV A;  4Z24 A;  2BCP A;  1TDK A;  1OJD A;  4G73 A;  3FXG A;  3KD9 A;  2YG7 A;  3LZW A;  3VCN A;  4B64 A;  4IVO B;  4B66 A;  2YLR A;  1TKK A;  4KPL A;  5KVH A;  4G7F A;  2Y6Q A;  3H8L A;  4P9S A;  3PK7 A;  1PXA A;  2WET A;  1GTE A;  1N5X A;  3VR8 A;  3OPS A;  3AEB A;  4F4R A;  1MXT A;  4GUV A;  3CPH G;  3NRZ B;  3S61 A;  3KLJ A;  2GSH A;  5CQF A;  4J2W A;  2QDD A;  5FS8 A;  4CY6 A;  1EL8 A;  1D4D A;  4ICY A;  2GR3 A;  2WU5 A;  1ZKQ A;  1RM6 B;  3DK9 A;  3QVR A;  1EL5 A;  4J34 A;  3DGB A;  3EAN A;  2OX4 A;  1SB3 B;  1Q9I A;  3GWD A;  2W3R A;  3D1C A;  4RG3 A;  2FBW A;  4C74 A;  2BRA A;  2YLX A;  4JNA A;  3NIX A;  3SJN A;  3VRB A;  3NO1 A;  3BSM A;  4HYR A;  3H8A A;  2E1M A;  3UKF A;  1YY5 A;  1FHU A;  3SZC A;  3AE6 A;  3CMM A;  1BGN A;  4NWZ A;  3M12 A;  5IDZ A;  3MY9 A;  2I0Z A;  2XYO A;  3VFC A;  3UP5 A;  4YSY A;  2PU1 A;  4NTD A;  1NHP A;  1N1P A;  1PBF A;  3FPZ A;  2XVF A;  3PS9 A;  4XXG A;  1K4Q A;  2W3S A;  2RAB A;  3AD9 B;  3P9U A;  3EEZ A;  2WPE A;  3NFU A;  5BOE A;  1DTN A;  3RHA A;  2GEW A;  2GR1 A;  3DME A;  3DEQ A;  1FEB A;  3AEG A;  2YM2 A;  2XFP A;  4U8K A;  1JPM A;  2EQ6 A;  3V4B A;  2Y6R A;  2E3T A;  3PG6 A;  3VRA A;  4IHC A;  3P3B A;  3IWA A;  3ISH A;  2C75 A;  1BKW A;  2GAG B;  3NK0 X;  3C4N A;  1OJC A;  1H2I A;  3NS1 B;  1M64 A;  1NDA A;  4K5S A;  4IA5 A;  2B9W A;  3T14 A;  3GDN A;  2GF3 A;  2BK5 A;  3GD3 A;  3IF9 A;  3ZDN A;  4NNJ A;  2FJB A;  1JNZ A;  5FMH A;  1TDF A;  3NVW B;  1TRB A;  3NZG A;  1VQW A;  3GD6 A;  2C3C A;  1GES A;  5IQ1 A;  5BOF A;  1JCT A;  3BNU A;  1N60 C;  3UOY A;  4AT2 A;  5JCN A;  4GAV A;  3D9X A;  3I6T A;  1GV4 A;  2WHD A;  3C96 A;  2BAB A;  3CIR A;  4H2P A;  1STZ A;  4NTC A;  1O5W A;  1FIQ B;  2C76 A;  4YTM A;  1IUV A;  1TYP A;  3GSI A;  2VRM A;  1Q1W A;  1REO A;  3DH9 A;  4MKS A;  3R25 A;  2X8G A;  4JY2 A;  3KU9 A;  4A99 A;  2ACZ A;  1S2Y A;  3ITJ A;  2GQW A;  3I4K A;  3VCC A;  2R45 A;  1DJN A;  3NVY B;  3UKP A;  1RP0 A;  3QTP A;  5TR3 A;  3AB1 A;  5M0Z A;  2PYX A;  3HPF A;  3LAD A;  2JB1 A;  3UJS A;  1SJB A;  4Y4N A;  3SX6 A;  3CPI G;  4I58 A;  1KCZ A;  4HCL A;  2BAC A;  2YAU A;  3FCP A;  2WDR A;  4Y4L A;  4GDP A;  4EMJ A;  2XDO A;  4YWO A;  4X4J A;  3HRD C;  2PP3 A;  3NK2 X;  3ZLG A;  4G6G A;  4ROP A;  2Z5Y A;  4A65 A;  4KWS A;  4RG4 A;  3AE7 A;  1H83 A;  2BCG G;  2GH5 A;  3AE3 A;  1JNR A;  1CJ3 A;  2WP9 A;  3NVV B;  1RYI A;  4REK A;  2X50 A;  4YSX A;  1MUC A;  1IJH A;  1NEN A;  2BA9 A;  1YEY A;  4DN1 A;  4ZCW A;  1H84 A;  2QJM A;  2QJJ A;  4E4F A;  3B9J B;  4K2S A;  3BI5 A;  4TM4 A;  1WUF A;  1EBD A;  1S2Q A;  1M6I A;  1PJ6 A;  2OLN A;  3SR6 B;  5KXJ A;  4UDR A;  3TTE A;  4JQ9 A;  3TWA A;  5KMR A;  1K0L A;  3GRS A;  2GVC A;  4GME A;  1ZMD A;  2GMJ A;  3CNJ A;  3R07 C;  3HYW A;  4BJY A;  3I6D A;  1PBC A;  2ZC8 A;  2XLP A;  2XH2 A;  4ZN0 A;  3P0W A;  4FDC B;  3S5W A;  1E1N A;  1OJT A;  1S3E A;  1CJ2 A;  3MZN A;  1H81 A;  2OZ8 A;  3NN6 X;  3M0O A;  3OW1 A;  1TE6 A;  1EC8 A;  3ADA B;  2PS2 A;  2YVF A;  3PWG A;  5ER0 A;  2JBV A;  2XGZ A;  3LB8 A;  5KWF A;  1X2G A;  2R9Z A;  1FEA A;  1XPQ A;  4PAB A;  5KMQ A;  2PTY A;  2C7G A;  3UP4 A;  4NTE A;  3UKL A;  2YWL A;  2HZG A;  4EM3 A;  1GND A;  2Q0K A;  4BK2 A;  3ALJ A;  1CJC A;  4H4Q A;  1PBB A;  2XVE A;  3IC9 A;  5KOX A;  5KMP A;  1L9C A;  3JVA A;  3SXI A;  1BKH A;  4USR A;  4H4Z A;  2GR0 A;  1GT8 A;  1COY A;  1GRA A;  3BOX A;  4N9X A;  4OPG A;  3UKQ A;  3RCY A;  3DGH A;  5U25 A;  5JCI A;  4OPL A;  1JRO A; 
#chains in the Genus database with same CATH homology
 2FJA A;  4H7U A;  3GWF A;  2ZZB A;  3GMC A;  4LU6 A;  3SZ0 A;  5KVH A;  5EBK A;  3ALM A;  3K7Q X;  2OA1 A;  2QA2 A;  1GER A;  2C3D A;  1EL9 A;  2CUL A;  2Y6Q A;  3H8L A;  4P9S A;  4TM0 A;  1KSS A;  1PXA A;  3H8I A;  4B1B A;  2WET A;  1GTE A;  3PVC A;  2X99 A;  4IV9 A;  3VR8 A;  3AYJ A;  4TLZ A;  5KNL A;  4X9M A;  3DJG X;  1GRG A;  2Z5X A;  3HYX A;  3KKJ A;  3T37 A;  5BVA A;  2BC0 A;  3AEB A;  4IA6 A;  1MXT A;  3WE0 A;  4CNK A;  4GUV A;  4CBQ A;  2C67 A;  3DA1 A;  5HXI A;  3CPH G;  2V6O A;  1B5Q A;  1TDN A;  3O0H A;  4II2 A;  3P4R A;  3L1R A;  3KLJ A;  3S61 A;  3KVE A;  3B3R A;  3EF6 A;  5CQF A;  1DOE A;  1TDE A;  2A87 A;  4J2W A;  4EIQ A;  5FS8 A;  2F5Z A;  4DNA A;  5J7X A;  2YG3 A;  3OC4 A;  4BV6 A;  1VDC A;  2CVJ A;  4HB9 A;  4AP3 A;  1EL8 A;  2WDQ A;  1LTX R;  4CY6 A;  2TMD A;  1D4D A;  1ZK7 A;  3DJE A;  4ICY A;  2GR3 A;  3T0K A;  3KA7 A;  2APG A;  2WU5 A;  5C3J A;  4OPD A;  4MJW A;  3UOZ A;  4OPI A;  1QLB A;  4X9N A;  3UKK A;  4AT0 A;  4D03 A;  3QSM A;  1E1L A;  4USQ A;  3M13 A;  1AOG A;  3SFD A;  1PHH A;  1ZY8 A;  4YKF A;  5EB5 A;  1UKV G;  5J60 A;  4K7Z A;  1ZKQ A;  3BNM A;  2WPF A;  1RSG A;  3GRT A;  5L46 A;  4U2L A;  3G5S A;  4DSH A;  1GET A;  5JCK A;  3DK9 A;  1E1M A;  3QVR A;  1O95 A;  1X31 B;  3T2Z A;  1TYT A;  5BUL A;  2JB2 A;  1EL5 A;  1KNR A;  4J34 A;  1CF3 A;  3EAN A;  3HZL A;  3QVP A;  4JN9 A;  1D7Y A;  3CGB A;  4Z2R A;  1GRB A;  3CND A;  2R4J A;  1ZOY A;  2ZBW A;  1Q9I A;  3GWD A;  4EIP A;  2UZZ A;  2YVG A;  3DGZ A;  1YQ3 A;  3OZ2 A;  1CBO A;  3D1C A;  2E5V A;  3NKS A;  4RG3 A;  2FBW A;  1VRQ B;  1DOC A;  3HYV A;  4C74 A;  4Z2T A;  1FL2 A;  2BRA A;  2YLX A;  4JNA A;  3SGL A;  2BYB A;  3NIX A;  1H7W A;  4GAP A;  4IVM B;  1JRY A;  1DXL A;  4BK1 A;  2YLW A;  5FS6 A;  4EMI A;  3LOV A;  3VRB A;  3ICS A;  2XLS A;  2H89 A;  4LII A;  2R4E A;  2NVK X;  1Z6L A;  3AD7 B;  2BRY A;  1JU2 A;  2E1M A;  3CTY A;  3UKF A;  4U8I A;  1XAN A;  3CNS A;  2QAE A;  1YY5 A;  3P4S A;  2WBA A;  2WOV A;  1GRE A;  1GEU A;  1DJQ A;  1F3P A;  3SZC A;  3AE6 A;  3L8K A;  1BGN A;  2GAH B;  3CMM A;  4NWZ A;  4Z2U A;  3M12 A;  4OVI A;  2X8H A;  2I0Z A;  2XYO A;  1L9D A;  2R0P A;  4XWR A;  3UP5 A;  3CPJ G;  2O9Z A;  4Z26 A;  1KN0 A;  4YSY A;  3AD8 B;  4NTD A;  1NHP A;  1N1P A;  4YSH A;  1PBF A;  1FOH A;  3FPZ A;  3NYE A;  2XVF A;  1H82 A;  3QJ4 A;  3PS9 A;  4XXG A;  2EQ8 A;  1K4Q A;  4C3X A;  3Q6J A;  2YR6 A;  3NRN A;  2YLT A;  2AAQ A;  2RAB A;  1K0I A;  2A89 A;  3AD9 B;  3FIM B;  3AEA A;  4H4W A;  3P9U A;  4OPC A;  4WX1 A;  2RGJ A;  3C4A A;  2WPE A;  5EB4 A;  3RHA A;  4APN A;  2GEW A;  2R0G A;  2GR1 A;  3DME A;  1O94 A;  1VG0 A;  3NG7 X;  3ATR A;  4UDQ A;  1FEB A;  3AEG A;  4GRT A;  2YM2 A;  3SZW A;  3V3O A;  4G9K A;  4AOS A;  2XFP A;  2JB3 A;  4U8K A;  3RP6 A;  2EQ6 A;  2B9Y A;  4O5Q A;  3COX A;  2Y6R A;  1IUW A;  2H88 A;  3RNM A;  1YQZ A;  3PG6 A;  3VRA A;  2JAE A;  3LXD A;  1L9E A;  1D5T A;  5GRT A;  3QSE A;  4H50 A;  1E6E A;  2ZZ0 A;  2CFY A;  3IWA A;  4K8D A;  3AE5 A;  1PBE A;  3UCL A;  1LQU A;  1ZDL A;  2W0H A;  3ISH A;  4FK1 A;  2C75 A;  4YTN A;  5JCL A;  1GPE A;  1TDO A;  5GSN A;  2BS4 A;  5KMS A;  4U8L A;  1BKW A;  3UKA A;  2XVJ A;  2GAG B;  4U2S A;  3NK0 X;  3AWI A;  3UTF A;  3C4N A;  1OJC A;  1Q1R A;  2AQJ A;  3ICR A;  2GB0 A;  1H2I A;  1M64 A;  2HQM A;  2J3N A;  2WES A;  4YTP A;  4H4T A;  2A8X A;  3AE9 A;  4BK3 A;  4Z43 A;  1NDA A;  4ZCD A;  2JKC A;  3NNE A;  3AE2 A;  4K5S A;  4IA5 A;  2B9W A;  3T14 A;  3GDN A;  1Y56 B;  2DKI A;  1QJD A;  2GF3 A;  1LQT A;  2IVE A;  4ADW A;  1GOS A;  3NHO X;  3UTG A;  1IUT A;  4U2T A;  3DJJ A;  2BK5 A;  3GD3 A;  3NTA A;  3IF9 A;  2VVM A;  3ZDN A;  4NNJ A;  2FJB A;  1JNZ A;  5FMH A;  1TDF A;  2XLU A;  2V60 A;  2V3A A;  1TRB A;  1H7X A;  1VQW A;  4DSG A;  1NHS A;  3K30 A;  4JNQ A;  2C3C A;  1E7P A;  1GES A;  1S7M A;  2B7R A;  5IQ1 A;  4FX9 A;  3P4Q A;  1D7L A;  3BNU A;  3AE1 A;  1BF3 A;  4GDE A;  4O5U A;  3UOY A;  4AT2 A;  4YSZ A;  5JCN A;  4A9W A;  4GAV A;  3CGD A;  3D9X A;  3ICT A;  1MO9 A;  5U1O A;  1DOB A;  1YKJ A;  1GV4 A;  2OLO A;  2BXS A;  4BUR A;  2WHD A;  3ATQ A;  2BAB A;  3C96 A;  3CIR A;  3P4P A;  1PDH A;  4H2P A;  5IQ4 A;  2YLZ A;  4B67 A;  2TPR A;  3GD4 A;  3IHG A;  4NTC A;  1O5W A;  1NG4 A;  2C72 A;  1BGJ A;  2C76 A;  3R9U A;  1LVL A;  2YR4 A;  3IHM A;  4H2R A;  4LA1 A;  2YLS A;  4YTM A;  1ONF A;  1IUV A;  4JY3 A;  1TYP A;  3UKH A;  4J56 A;  3GSI A;  3QFA A;  2C73 A;  2WP5 A;  1JOA A;  4GR1 A;  2VRM A;  3VRD B;  1JEH A;  2XVI A;  1Q1W A;  4TM1 A;  2Q0L A;  2V5Z A;  4U8O A;  1H86 A;  1REO A;  3DH9 A;  4A7A A;  4PAA A;  1Y56 A;  1BWC A;  1PXC A;  5C2T A;  5U63 A;  3UTE A;  4RSL A;  1BZL A;  2X8G A;  4JY2 A;  2WOI A;  3KU9 A;  2ACZ A;  4G74 A;  4A99 A;  3QSS A;  1NAA A;  1S2Y A;  3DK8 A;  3ITJ A;  1QO8 A;  5HY5 A;  2GQW A;  3FBS A;  1XDI A;  1CC6 A;  2R45 A;  3G5R A;  5LV9 A;  1DJN A;  1OJA A;  3BHK A;  3ZYX A;  3UKP A;  1RP0 A;  4K5R A;  3AXB A;  1L0V A;  1IUX A;  4C5O A;  5TR3 A;  1D4E A;  3AB1 A;  2C66 A;  5M0Z A;  2PYX A;  2VQB A;  1B4V A;  3LAD A;  1IUU A;  2WOW A;  1PS9 A;  1YQ4 A;  2ZZC A;  3CGE A;  1E1K A;  2ARD A;  2JB1 A;  2IVD A;  2BXR A;  4E0V A;  1V59 A;  1GSN A;  4Y4N A;  1OJ9 A;  2OAM A;  4OCG A;  3SX6 A;  1PN0 A;  3CPI G;  2YM1 A;  4I58 A;  4UDP A;  4U8N A;  2BAC A;  2YAU A;  1SEZ A;  4H4S A;  2XFU A;  2WDR A;  4NZH A;  4Y4L A;  4C77 A;  4K22 A;  4OPU A;  5KOW A;  4GDP A;  4EMJ A;  1LV0 A;  2E4G A;  2OAL A;  2XDO A;  4YWO A;  2C70 A;  2GV8 A;  4H2Q A;  4X4J A;  2XLT A;  3L5O A;  3SM8 A;  2BK3 A;  3EPT A;  1N4V A;  3GYX A;  3NK2 X;  2WDV A;  3SY4 A;  3UTH A;  3NK1 X;  4G6G A;  3RP8 A;  3GYJ A;  2WQY A;  3F8D A;  3NH3 X;  2NPX A;  2BK4 A;  3AEC A;  2Z5Y A;  4A65 A;  4RG4 A;  1KSU A;  3T2Y A;  4H4R A;  1EL7 A;  3VQR A;  3KPK A;  3AE7 A;  2XFO A;  5M10 A;  1H83 A;  2BCG G;  1W4X A;  3NYF A;  2GH5 A;  2R0C A;  3KPF A;  1DNC A;  1JRZ A;  3AE3 A;  1JNR A;  1CJ3 A;  2BC1 A;  4XWZ A;  5HYM A;  4H2N A;  1VG9 A;  1F8R A;  1K0J A;  2RGH A;  2WP9 A;  2WEU A;  1RYI A;  1GTH A;  2C65 A;  4REK A;  1S3B A;  3RED A;  2X50 A;  3CN8 A;  3D8X A;  4A79 A;  4CY8 A;  4YSX A;  3SYI A;  2WU2 A;  2R46 A;  4JDR A;  3NYC A;  5KRQ A;  4GF7 A;  1IJH A;  1F8S A;  3GMB A;  1KDG A;  2GR2 A;  2V3B A;  4U8P A;  4Y4M A;  1NEN A;  2BA9 A;  3ABV A;  2B9X A;  2X3N A;  2EQ7 A;  2WPC A;  4DGK A;  3PO7 A;  1H6V A;  3H4K A;  4AP1 A;  3URH A;  2VZ2 A;  4ZCC A;  4H4U A;  4H4V A;  4CCR A;  1ELI A;  1H84 A;  1CJ4 A;  3CNP A;  1F6M A;  2DKH A;  3G5Q A;  2X8C A;  3VR9 A;  4EMW A;  4B63 A;  2YQU A;  2YG4 A;  3BI5 A;  2YG6 A;  4TM4 A;  4U8M A;  1EBD A;  4KPR A;  4GCM A;  1S2Q A;  1M6I A;  1CC4 A;  1PJ6 A;  4TM3 A;  4M52 A;  1PJ5 A;  2OLN A;  3BI4 A;  2RGO A;  3T31 A;  5KXJ A;  4UDR A;  1XHC A;  4D04 A;  1NEK A;  5EOW A;  1FEC A;  5FS9 A;  4Z44 A;  5DBJ A;  4JQ9 A;  1FCD A;  4B68 A;  5KMR A;  3E1T A;  2BS2 A;  4CRT A;  1K0L A;  5CKU A;  3GRS A;  4A6N B;  2GVC A;  1ZMD A;  2B7S A;  2GMJ A;  3CNJ A;  1ZMC A;  4EQR A;  3HYW A;  4BJY A;  1NPX A;  2Q6U A;  2YG5 A;  2YVJ A;  1F8W A;  2QA1 A;  3I6D A;  4B65 A;  2VOU A;  1GRT A;  4I59 A;  1PBC A;  3T2K A;  2VRL A;  5FS7 A;  1N4U A;  4TLX A;  3AE8 A;  1GAL A;  4BJZ A;  2XLP A;  4ZN0 A;  4FDC B;  3S5W A;  2JK6 A;  1KNP A;  3CGC A;  1E1N A;  4YKG A;  1DOD A;  4A5L A;  1HYU A;  3ALL A;  1OJT A;  1P2E A;  1NHR A;  1P2H A;  2QCU A;  3AE4 A;  1S3E A;  1CJ2 A;  1H81 A;  4EQW A;  3NN6 X;  2IID A;  3M0O A;  2BS3 A;  1CHU A;  3GYI A;  3V76 A;  1KF6 A;  2C4C A;  2FJD A;  1GRH A;  3NLC A;  4K2X A;  1NG3 A;  3B6D A;  4OPT A;  3ADA B;  2XFQ A;  5HHF A;  4II3 A;  2YVF A;  4HA6 A;  1CC2 A;  1ZX9 A;  2XCG A;  5ER0 A;  1CL0 A;  3BI2 A;  3FG2 P;  3SQP A;  2JBV A;  2FJE A;  3BHF A;  2Q7V A;  3LB8 A;  1B8S A;  3P1W A;  4WCT A;  4EQX A;  4YXD A;  4A6N A;  5KWF A;  1E39 A;  2R9Z A;  1FEA A;  3AEF A;  1XPQ A;  2XLR A;  3DK4 A;  4CNJ A;  1B37 A;  4PAB A;  5JCM A;  5KMQ A;  1PBD A;  3EAO A;  2C7G A;  3UP4 A;  1KFY A;  5JRB A;  3AYL A;  1IUS A;  2GQF A;  3DJD A;  4EQS A;  1MOK A;  4NTE A;  3UOV A;  1JRX A;  2VQ7 A;  3UKL A;  2YWL A;  4U8J A;  4YT0 A;  3I3L A;  4J57 A;  1ZP0 A;  2VVL G;  3CNT A;  3F8R A;  4ECH A;  4EM3 A;  4AOX A;  1LJ1 A;  1GND A;  2Q0K A;  1ZOV A;  4J36 A;  3F8P A;  4G6H A;  4J33 A;  4KX6 A;  4BK2 A;  2VVL A;  3ALJ A;  1N4W A;  2WS3 A;  2XVH A;  1CJC A;  1PXB A;  3QFB A;  3JSK A;  3LJP A;  4EM4 A;  5BUK A;  4H4Q A;  1PBB A;  4CCQ A;  5IPY A;  4J31 A;  2XVE A;  3IC9 A;  5KOX A;  3V3N A;  3RP7 A;  2PHH A;  3AED A;  2XFN A;  3GDP A;  3SZF A;  2CDU A;  5KMP A;  3FMW A;  4H4P A;  1D4C A;  1Y0P A;  1L9C A;  3NTD A;  5KVI A;  4NEW A;  3UOX A;  1PJ7 A;  1LPF A;  3SFE A;  3II4 A;  5BRT A;  2GRT A;  2WP6 A;  3AYI A;  4FK1 C;  3SXI A;  4USR A;  4Z25 A;  2C64 A;  4H4Z A;  3K7T A;  2V61 A;  3NT6 A;  3LZX A;  3NGC X;  2GMH A;  4C3Y A;  1GRF A;  2EQ9 A;  4B69 A;  4NEV A;  2GR0 A;  4H4X A;  1GT8 A;  4Z24 A;  4H4Y A;  1COY A;  2BCP A;  1GRA A;  1TDK A;  1OJD A;  4UP3 A;  4G73 A;  4N9X A;  1GXF A;  4OPG A;  3UKQ A;  1NHQ A;  3K7M X;  3DGH A;  5U25 A;  5JCI A;  2YG7 A;  3KD9 A;  3LZW A;  3Q9T A;  4OPL A;  2AR8 A;  4IVO B;  4B66 A;  2YLR A;  4B64 A;  2YR5 A;  3AEE A;  3NN0 X;  2B76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...