5FS8A

Crystal structure of the g308e mutant of human apoptosis inducing factor
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
487
structure length
473
Chain Sequence
QDKAPSHVPFLLIGGGTAAFAAASIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGEGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESRASEITIPPDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure/Function Relations in Aifm1 Variants Associated with Neurodegenerative Disorders
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
total genus 161
structure length 473
sequence length 487
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fs8A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs8A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs8A01
3VRBA 1JNZA 3UTHA 1PXAA 3CNJA 4RG3A 3H8LA 4YWOA 4A99A 2YM1A 1BGNA 5M0ZA 1Y0PA 1LJ1A 1FEAA 4H4RA 5HYMA 1YKJA 3CTYA 4E0VA 4GF7A 2W0HA 1LPFA 1H83A 2DKIA 2BCPA 4X9MA 3RHAA 2QA1A 2VRLA 1GRBA 2Y6QA 2YR4A 2YVJA 3DGZA 1CJ4A 1YQ3A 4TM3A 2NVKX 1OJAA 1P2HA 2RGHA 3AB1A 3EPTA 3P4QA 1ZOYA 4LA1A 4B68A 1VDCA 2IVEA 1GOSA 3M13A 3UP5A 1YY5A 3AE3A 1SEZA 1D4CA 4MJWA 4CCRA 5FMHA 2WS3A 3PO7A 3QSSA 3GRTA 2DKHA 1N4WA 4UDPA 3GMCA 2YAUA 1P2EA 1W4XA 3D1CA 1O94A 2JB3A 2QAEA 2Z5YA 4EQRA 2AR8A 4H4XA 2VQBA 2YLXA 1GESA 4AP1A 1ZY8A 2X50A 3L8KA 2R45A 4OPCA 3NIXA 3AYIA 4UDQA 4U8IA 2FJEA 1OJDA 2GMJA 1DJQA 4D03A 4NEWA 1DOBA 1LTXR 1PBBA 5BRTA 3UKFA 2WPEA 2YLTA 1AOGA 2B9WA 1H6VA 3AEAA 2ZBWA 2XCGA 2GQWA 2XLPA 3NT6A 2CFYA 3V3OA 1CF3A 4YT0A 2V61A 2YR5A 3BNMA 3G5QA 1S3EA 3LZXA 4K5SA 2WOVA 4BK1A 2V6OA 1PBFA 4B67A 4GRTA 2WOWA 5KWFA 3PS9A 5KOWA 1S3BA 2GRTA 2WPFA 3GSIA 1K0LA 4FK1C 2XVFA 3DMEA 4JN9A 1MOKA 5GSNA 2BK4A 2YLSA 2OAMA 1PBDA 4NTEA 1S2YA 2VQ7A 3T37A 2C64A 2QCUA 3ALMA 3IHGA 4Y4MA 1JRXA 4U2LA 2VVLA 2C3DA 1GREA 1TYPA 2E1MA 2YG4A 4Z2TA 1QO8A 4OPIA 4Z24A 1PN0A 3RP6A 2ACZA 2GV8A 2H89A 3GWDA 3DJGX 1CC2A 3S5WA 1GRHA 3Q6JA 1XDIA 3P1WA 1H81A 2R0PA 1KNPA 1IUVA 4OPTA 1JU2A 1CJ3A 3FIMB 1DJNA 1PDHA 1ZOVA 3UKLA 4X9NA 3AE4A 3KD9A 2YQUA 4TLZA 3EAOA 3C4NA 3AEDA 1F3PA 1KNRA 2ARDA 2CULA 4WCTA 3AE5A 3AE8A 3QSEA 5ER0A 1GTEA 1GETA 2EQ6A 1LV0A 1OJCA 1LQTA 1BGJA 1KF6A 2WDRA 3NK1X 4B65A 2BK5A 2GMHA 1JOAA 3CIRA 4OPLA 5HY5A 1F8WA 2QA2A 4Z2RA 5J60A 3BI2A 5TR3A 1E1MA 1K0JA 4RG4A 2BS4A 2YWLA 4Z44A 2R4EA 1L0VA 4EIQA 1E1NA 4AOXA 3CPHG 1VRQB 3G5RA 2GAHB 1F8SA 3PVCA 3H8IA 2XFOA 1H84A 2TPRA 3K7TA 4EIPA 2WHDA 2JB2A 2R9ZA 3VRDB 3ICTA 2IIDA 3M0OA 3D8XA 4U8KA 1DODA 2B9YA 2GH5A 3AWIA 3CGEA 3SQPA 4J34A 1BF3A 1LVLA 2BXSA 1IUTA 1GTHA 3NYEA 4B66A 1K4QA 5EOWA 3Q9TA 5M10A 3UOXA 2Z5XA 4PAAA 1XHCA 3CN8A 2Q6UA 3REDA 2GQFA 1H7WA 3KPFA 1KSSA 3WE0A 3CNPA 3GDPA 1NHPA 3CGCA 1CHUA 1ZKQA 2JAEA 4IV9A 4DNAA 3SM8A 3UKAA 2A8XA 4CNKA 5FS9A 5FS6A 3DJEA 4J2WA 4CY8A 4CY6A 1DNCA 4U2TA 5KXJA 4U8MA 1GRTA 1L9EA 1ONFA 2RGJA 1Q1RA 3ICRA 4OCGA 4U8NA 4NTDA 1PXCA 4USRA 1B5QA 4K8DA 4JDRA 4CCQA 3E1TA 1Y56B 1D5TA 2OLOA 3M12A 3AE7A 4UP3A 2X3NA 3I3LA 1PJ7A 1NDAA 3P4RA 4DSGA 4YSYA 3DH9A 3F8PA 2YG5A 2XLTA 2R0GA 3NH3X 1YQ4A 5LV9A 2JKCA 1OJ9A 5BVAA 1CBOA 2GB0A 4JNQA 2BC0A 3C96A 3QJ4A 2JK6A 3SFDA 2HQMA 2WDVA 5JCNA 1ZDLA 2WETA 5HHFA 2IVDA 1DXLA 3DA1A 1X31B 1JRZA 4OPDA 4O5QA 2VOUA 1FEBA 3NK2X 4GR1A 2E5VA 1B4VA 2XFQA 5FS7A 1NG3A 3G5SA 4EMWA 1CC4A 3OZ2A 2WP9A 1L9DA 1E6EA 3AEBA 5EB5A 4B64A 3FMWA 4HA6A 4C77A 2C3CA 1IUXA 3AE9A 3AE6A 4Z43A 2V5ZA 3NGCX 3EF6A 3IF9A 4N9XA 1GPEA 3ZYXA 4APNA 1TDKA 2GF3A 2VZ2A 4EQWA 2C72A 4Y4NA 1DOEA 3AD9B 1O5WA 4I58A 1GV4A 2YG3A 5HXIA 4H4SA 2R4JA 5JCIA 2PYXA 2V3AA 1L9CA 1CJ2A 4IVOB 4OPUA 2GR2A 3DK4A 1PJ6A 2B7SA 1EL9A 4X4JA 1GERA 3AEGA 1GT8A 1QJDA 3QVPA 2RABA 4NEVA 3UKKA 4A79A 3K7MX 4ICYA 4B1BA 2WOIA 3NN0X 4U8LA 2GR3A 2X8CA 4KX6A 3VR8A 3H4KA 3GYIA 4GUVA 3NTDA 4GDPA 3LB8A 2XVIA 5JCMA 4AT2A 1VQWA 1EL8A 2WPCA 4H2QA 4B69A 1PS9A 4YSXA 3FPZA 4J57A 4U8JA 3CPIG 4TLXA 3NK0X 4H7UA 2Y6RA 4RSLA 1BKWA 2EQ9A 2C66A 3AD7B 3NN6X 3P4SA 3DJJA 2C73A 3VQRA 2C67A 1NPXA 3UP4A 2X8HA 4I59A 3FG2P 1GRFA 3II4A 4XWRA 4JQ9A 2JBVA 4ZN0A 1S2QA 1N4UA 4IA6A 5IQ1A 3UKPA 3FBSA 2O9ZA 3VRAA 4P9SA 1HYUA 4Z2UA 2X99A 3SGLA 1IJHA 4H4QA 3UOVA 3CPJG 4EM3A 4USQA 3JSKA 3UTEA 2R46A 1CJCA 4YTNA 4YXDA 3GDNA 3URHA 4BK3A 1ZK7A 5JCKA 1FOHA 2OLNA 2A89A 2WEUA 4XXGA 3NHOX 4D04A 2WP5A 2H88A 2ZZ0A 1TDNA 3K7QX 1EL5A 1NEKA 2X8GA 2UZZA 2AAQA 2FBWA 1Y56A 1GNDA 2Q0LA 1PXBA 2C76A 3AXBA 5KRQA 2F5ZA 4H2NA 4XWZA 5GRTA 3UKHA 4K2XA 1CL0A 2WESA 2XLUA 2VVMA 4TM0A 3ALJA 4C74A 3AYJA 4PABA 1E1KA 4B63A 3DK9A 2WBAA 3IWAA 3UCLA 2OALA 3LZWA 4NTCA 3V3NA 4Z26A 1TDOA 4A7AA 1XANA 4LU6A 4A6NA 4AP3A 4C5OA 4OVIA 4CBQA 3B3RA 2VRMA 1MXTA 1NAAA 3NYFA 2YG7A 2GVCA 2PHHA 3AECA 3P9UA 4GDEA 3R9UA 4EQXA 3GD3A 2GAGB 2YM2A 3UTGA 4AOSA 2FJBA 1EL7A 3BI5A 1N4VA 4JNAA 2CVJA 5FS8A 2XVEA 2BCGG 4A6NB 2RGOA 3ZDNA 4OPGA 4TM4A 4BJYA 4C3YA 3UKQA 1F8RA 4LIIA 3UOZA 1H86A 2AQJA 2BYBA 4J36A 3NG7X 5J7XA 4YSHA 2CDUA 1QLBA 3KA7A 1N1PA 2XDOA 4H2RA 1TRBA 2XYOA 3QFBA 1IUUA 3F8RA 3DGHA 3BI4A 4J33A 3NKSA 4FK1A 3NYCA 2BABA 1D7YA 2I0ZA 3ATRA 3CGDA 5KVHA 1OJTA 2BS2A 2XLSA 1ZX9A 5EB4A 5EBKA 4U8PA 4JY2A 1GEUA 2Q0KA 4CRTA 4JY3A 1D4DA 4DGKA 1H82A 2V60A 3KVEA 4O5UA 1M64A 1F6MA 4UDRA 3GWFA 5L46A 2XFPA 3NLCA 1GALA 2YG6A 1NHSA 1ELIA 2E4GA 1PBEA 4A5LA 3BNUA 2OA1A 3QVRA 3B6DA 1FECA 2YLWA 2C65A 3IHMA 1Q1WA 3VR9A 2FJAA 1EBDA 3BHFA 2A87A 3C4AA 2VVLG 2BACA 1IUWA 4IVMB 2BK3A 4ZCDA 3SFEA 1GRGA 2B76A 5KOXA 4HB9A 5BULA 2GR0A 4YKGA 3GMBA 4FDCB 1RP0A 3IC9A 2TMDA 3RP7A 1BZLA 1D7LA 3UOYA 4H4PA 1PHHA 2FJDA 2EQ7A 4YSZA 4TM1A 1TYTA 1ZMCA 2WP6A 2EQ8A 2C75A 3AE1A 5C3JA 3CNDA 5IQ4A 1KFYA 2ZZCA 4GCMA 1E7PA 2WU2A 3KU9A 1V59A 4J31A 1IUSA 3EANA 3CNTA 3LADA 3OC4A 1K0IA 4AT0A 3GD4A 2XFUA 4NZHA 1TDEA 1GRAA 3DJDA 4EMIA 3QSMA 1B8SA 1FL2A 2R0CA 2YVFA 4KPRA 1ZP0A 1VG0A 2WU5A 1UKVG 1XPQA 2BXRA 4BJZA 4H4VA 1KDGA 2GEWA 3CNSA 4K22A 5KVIA 5JCLA 1MO9A 3RP8A 5IPYA 2GR1A 3ITJA 5U63A 1FCDA 4FX9A 3NNEA 1RYIA 4BK2A 4WX1A 3LXDA 4YTMA 2XFNA 2YR6A 3LOVA 3F8DA 5BUKA 3QFAA 2NPXA 2YLRA 3RNMA 4EQSA 1PJ5A 4U8OA 3K30A 4BURA 1YQZA 4K7ZA 2B7RA 3BHKA 2XVHA 4H4WA 4J56A 4ADWA 2BS3A 1NG4A 4H4YA 4H4UA 2JB1A 2WDQA 3AE2A 1CC6A 3ATQA 4M52A 1KSUA 4CNJA 4K5RA 2YVGA 2XVJA 5CQFA 4DSHA 1GSNA 4H4TA 1E1LA 1BWCA 1VG9A 5DBJA 4Z25A 5C2TA 3AYLA 4REKA 1RSGA 3ADAB 2C70A 2XLRA 3AEEA 2V3BA 3ISHA 1COYA 1JNRA 4C3XA 4EM4A 1M6IA 4H50A 3O0HA 4BV6A 1TDFA 3ABVA 4EMJA 3ICSA 3I6DA 4H4ZA 2B9XA 4YTPA 4A65A 1ZMDA 5U25A 1NHRA 3CGBA 5CKUA 2J3NA 3KLJA 2BC1A 1REOA 1PBCA 3S61A 2ZZBA 4ECHA 2WQYA 1JEHA 1NHQA 1LQUA 3GYJA 3ALLA 3NTAA 2YLZA 1GXFA 4U2SA 2APGA 3COXA 4Y4LA 4YKFA 3AD8B 4H2PA 3HZLA 2BA9A 3LJPA 1D4EA 3NRNA 4ZCCA 1NENA 5U1OA 1DOCA 1E39A 1O95A 3GRSA 3KKJA 4IA5A 3UTFA 3V76A 1Z6LA 3AEFA 4A9WA 1Q9IA 1B37A 3P4PA 2Q7VA 2C7GA 3L1RA 3DK8A 1JRYA 1H7XA
chains in the Genus database with same CATH superfamily
4E5TA 4RG3A 5M0ZA 1LJ1A 1EBGA 4E0VA 4GF7A 2BCPA 1NU5A 4X9MA 2YR4A 2Y6QA 3RHAA 2OO6A 2NVKX 1W6TA 1VDCA 1YY5A 1SEZA 4MJWA 4CCRA 2WS3A 2DKHA 2YAUA 1P2EA 1O94A 1ZY8A 5KMPA 2ZC8A 4OPCA 3PWIA 2FJEA 2GMJA 1DJQA 2OZ8A 4NEWA 3DEQA 1H6VA 3AEAA 2GQWA 3NT6A 4K8GA 3V3OA 2PTYA 2YR5A 3BNMA 3LZXA 1PBFA 4H1ZA 5KOWA 1S3BA 3GSIA 4FK1C 1MOKA 1PBDA 1S2YA 2VQ7A 3T37A 1RVKA 2OKTA 1TYPA 2E1MA 4Z2TA 1CC2A 2RDXA 3P1WA 1N60C 4OPTA 1CJ3A 2GSHA 1ZOVA 3AE4A 2YQUA 3EAOA 3C4NA 1FFUC 4WCTA 1FHVA 5ER0A 3CXBA 1LV0A 4C3YA 2BK5A 3CIRA 5HY5A 4Z2RA 3R0KA 5KMQA 4AOXA 2XFOA 1H84A 3T6CA 2WHDA 2JB2A 3UCDA 3M0OA 1KCZA 3Q9TA 2Z5XA 3CN8A 2Q6UA 3KPFA 3UJEA 3T2YA 3CGCA 2JAEA 3NO1A 2A8XA 4CNKA 3DJEA 3MSYA 4U2TA 1L9EA 4OCGA 3TW9A 4U8NA 4JDRA 3M12A 4UP3A 2XLTA 3NH3X 5LV9A 1OJ9A 2GB0A 3SY4A 5JRBA 4JNQA 4M6UA 2WDVA 5HHFA 4O5QA 4GMEA 1WUFA 2E5VA 1B4VA 2XFQA 1NG3A 3GD6A 4EMWA 3N4FA 1CC4A 5EB5A 2OQYA 3S47A 3MZNA 1SJAA 3ZYXA 4APNA 2C4CA 2P8CA 2GGJA 1O5WA 1GV4A 2V3AA 2P3ZA 1STZA 3DK4A 2B7SA 3BOXA 1GERA 4ICYA 4B1BA 3MQTA 2X8CA 3DESA 4KX6A 3NTDA 4H2QA 4GFIA 1PS9A 2XH2A 3DJJA 2C73A 2C67A 3UP4A 2X8HA 3FXGA 1MDLA 4IA6A 2O9ZA 3VRAA 3AMZA 4Z2UA 4EM3A 4USQA 3R11A 2R46A 3MUCA 5JCKA 1FOHA 2A89A 2WEUA 4KWSA 3NHOX 1MDRA 1TDNA 1MNSA 2AAQA 2FBWA 1GNDA 3SX6A 5GRTA 4PABA 1E1KA 2AL2B 4Z26A 4A7AA 1XANA 1NAAA 3FCPA 2YG7A 1ZXIC 3AECA 3UTGA 4EQXA 2GAGB 2YM2A 2W3RA 2XVEA 4BJYA 4LIIA 2AQJA 4H2RA 1TRBA 3QFBA 3DGHA 2BABA 2XLSA 4YWSA 4JY2A 4ZOHB 4JY3A 1D4DA 4DGKA 3KVEA 4O5UA 1N63C 4H83A 1GALA 3GC2A 4A5LA 3B6DA 1FECA 2FJAA 2A87A 2BACA 2ONEA 2BK3A 1GRGA 2B76A 4HB9A 4YKGA 3GMBA 4FDCB 2TMDA 2QJMA 4GIRA 4YSZA 4TM1A 1TYTA 5C3JA 3JW7A 4K2SA 4DHGA 3OW1A 1IUSA 3DERA 3LADA 2OX4A 1FL2A 5KMRA 4HNLA 1N61C 3TOYA 3IJLA 1N62C 4H4VA 2GEWA 4GAPA 3CNSA 5KVIA 5BOEA 3EEZA 5IPYA 1FCDA 3ETRB 2PP0A 4BK2A 4WX1A 2PTWA 3LXDA 1XPYA 3F8DA 3D46A 4K7ZA 2XVHA 3AE2A 2YVGA 5CQFA 1F9CA 1VG9A 5DBJA 3SN4A 3FYYA 3ISHA 1COYA 4C3XA 4F4RA 3V3WA 3H12A 1ZMDA 2PODA 5U25A 1EC7A 5CKUA 3NZGA 1REOA 4G74A 2WQYA 2GGEA 3QPEA 2CHRA 1JEHA 3ALLA 2YLZA 3AM9A 3COXA 4M0XA 4YKFA 3AD8B 5G5GB 1BKHA 4H2PA 2BA9A 3LJPA 3NRNA 3VA8A 3CB3A 1NENA 1DOCA 1E39A 4IA5A 1B37A 3T4WA 3DK8A 1H7XA 1JNZA 4G9KA 1PDZA 1JCTA 3CTYA 2W0HA 1EC8A 2QA1A 1GRBA 3U9IA 1YQ3A 3UJSA 3ZLFA 3EPTA 2IVEA 1GOSA 3UP5A 3AE3A 1D4CA 4MKSA 4GGHA 1SJDA 5FMHA 3PO7A 3QSSA 3GRTA 2JB3A 2YLXA 1GESA 3TTEA 2OZ3A 1IYXA 2PCEA 3AYIA 1H2IA 4U8IA 1OJDA 4D03A 1DOBA 3RR1A 3UKFA 2ZBWA 2XCGA 3A7RA 4K5SA 2WOVA 4BK1A 4B67A 2WOWA 5KWFA 2WPFA 2PGEA 3NFUA 2XVFA 4JN9A 3FJ4A 4NTEA 3HRDC 3DG6A 2QCUA 3ALMA 3IHGA 4Y4MA 4OPIA 4KT2A 1XS2A 2PSNA 3GY1A 1JU2A 2PGWA 3FIMB 1PDHA 4J1OA 4EWJA 3AEDA 2ARDA 1KNRA 2CULA 2HXTA 1T3QC 3QSEA 1GETA 2EQ6A 2GMHA 4OPLA 1F8WA 5TR3A 1L0VA 4RG4A 2BS4A 1E1NA 3G5RA 3PVCA 1F8SA 3K7TA 2R9ZA 4A35A 2GH5A 3SQPA 4J34A 1BF3A 1LVLA 2BXSA 1IUTA 1GTHA 5EOWA 3Q4DA 3REDA 3UXLA 1KSSA 3WE0A 3OZMA 4KPLA 4DNAA 1ONFA 1MRAA 3ICRA 1PXCA 4USRA 4K8DA 3JVAA 2OLOA 3AE7A 3N6JA 4Z1YA 3GYXA 2PP3A 4GISA 3IJQA 2BC0A 3SFDA 2JK6A 1ZDLA 1X31B 1FEBA 1MUCA 3NK2X 2PMQA 4GR1A 3H70A 5FS7A 3UJRA 4MMWA 3H7VA 3AEBA 3CMMA 4C77A 3AE9A 1IUXA 3AE6A 2V5ZA 3NGCX 4H19A 3TJ4A 1TDKA 2C72A 3SYIA 3TWBA 2R4JA 6ENLA 1CJ2A 2GR2A 1FHUA 2PA6A 2XSXA 2QDEA 3AEGA 2AL2A 1QJDA 1R6WA 4H2HA 4NEVA 1PDYA 2WOIA 3NN0X 4U8LA 2GR3A 3VR8A 4GUVA 2XVIA 4AT2A 1VQWA 4B69A 4YSXA 4U8JA 4TLXA 2Y6RA 4RSLA 4II2A 2C66A 3VQRA 4I59A 3QKEA 3II4A 2JBVA 1S2QA 3UKPA 4FI4A 1HYUA 4X2PA 2X99A 1IJHA 4H4QA 3SZFA 1X2HA 2HZGA 3UTEA 3SN1A 1CJCA 4YXDA 3N4EA 4BK3A 1ZK7A 3UJ2A 1FFVC 2OLNA 4D04A 5FJOA 2H88A 5FJUA 1Y56A 4MGGA 3AXBA 2F5ZA 4XWZA 1CL0A 2WESA 4C74A 3ALJA 3VDGA 3AYJA 1TDOA 4AP3A 3DFHA 4LU6A 4A6NA 3NYFA 2PHHA 3P9UA 3PK7A 4GDEA 3R9UA 3GD3A 2BCGG 4A6NB 2RGOA 4OPGA 4TM4A 3OTRA 1SB3B 2OVLA 3CT2A 5J7XA 3KA7A 1N1PA 2XYOA 1IUUA 1YEYA 2POZA 2OLAA 3ATRA 4ROPA 3CGDA 1OJTA 3IK4A 3CAWA 3S5SA 1SJCA 2NQLA 3NLCA 3CYJA 1PBEA 3BNUA 2OA1A 1FIQB 2BRYA 2C65A 3IHMA 1Q1WA 3C4AA 1EBDA 3BHFA 4IVMB 1DTNA 4HNCA 5BULA 2QGYA 1RP0A 1BZLA 1D7LA 3UOYA 4H4PA 2FJDA 2I5QA 1ZMCA 3AE1A 3CNDA 7ENLA 1RM6B 5BOFA 4J31A 3GO2A 3HW2A 1VQZA 3OPSA 3OC4A 1K0IA 3GD4A 4JHMA 2AL1A 1B8SA 3V4BA 2YVFA 4G73A 4II3A 1UKVG 4BJZA 4ZA0A 3RCYA 1MO9A 3NNEA 4FX9A 3H8AA 4YTMA 2XFNA 3ZVHB 3QFAA 3I6TA 4U8OA 4DXKA 3BHKA 1E9IA 3NVWB 2BS3A 1NG4A 4H4YA 2WDQA 1CC6A 3T31A 2QDDA 4M52A 1BWCA 2PTXA 4REKA 2QJNA 4NNJA 2C70A 3AEEA 1JNRA 4EM4A 4H50A 1TDFA 3SZ0A 1JROA 4GYPA 2B9XA 4A65A 3R25A 4HN8A 1PBCA 4IZGA 3HZLA 1D4EA 1JPMA 5U1OA 3UTFA 3VFCA 4A9WA 3P4PA 2E3TA 3IF9A 1TZZA 3VRBA 3UTHA 1PXAA 1NELA 3JZUA 4A99A 2YM1A 1BGNA 3KUMA 1VDVA 1LPFA 2DKIA 2AKMA 2VRLA 3UJFA 4IHCA 2RGHA 3AB1A 1ZOYA 4B68A 1R0MA 5J04A 3HYXA 4G7FA 5EU9A 2W54A 3D47A 2QAEA 4EQRA 2AR8A 4IP4A 2X50A 4DYEA 3NIXA 4TVYA 3QN3A 3SN0A 4E4FA 1LTXR 5BRTA 2YLTA 1AOGA 2B9WA 1CF3A 4YT0A 2V61A 1S3EA 3AN1A 4IP5A 4GRTA 1P43A 3PS9A 2GRTA 1P48A 2XH0A 2C64A 1JRXA 4U2LA 2PP1A 2VVLA 2C3DA 3NVZB 2YG4A 4Z24A 3RP6A 2ACZA 2H89A 3GWDA 1H81A 2R0PA 1IUVA 2O56A 1DJNA 3UKLA 4TLZA 2BRAA 3AE8A 3NK1X 3QTPA 1BGJA 1KF6A 1OJCA 3RRAA 2QA2A 1K0JA 3T9PA 2YWLA 4EIQA 2R4EA 3DG7A 2GAHB 3H8IA 3B9JB 2TPRA 3Q45A 3VRDB 2GDQA 3D8XA 1DODA 3OP2A 3CGEA 3NYEA 4B66A 3UOXA 4PAAA 1XHCA 2GQFA 1X2GA 3PG6A 3TJIA 2PTZA 3GDPA 1NHPA 1CHUA 1ZKQA 4IV9A 4CY6A 1DNCA 3VC6A 1GRTA 2RGJA 4NTDA 1B5QA 3E1TA 3I3LA 3P4RA 4DSGA 3F8PA 3CXOA 2R0GA 5BVAA 1CBOA 3C96A 3QJ4A 2HQMA 5JCNA 2WETA 2IVDA 1DXLA 3DA1A 3NVYB 1JRZA 2VOUA 2PU1A 3HPFA 1L9DA 1E6EA 2W55A 4B64A 4ENLA 2C3CA 3SXIA 3U4FA 4N9XA 4Y4NA 4EQWA 1DOEA 3AD9B 4I58A 4H4SA 2PYXA 4HYRA 4OPUA 1PJ6A 1GT8A 2RABA 3UKKA 3R0UA 2P88A 5KNLA 5FJTA 3H4KA 3ZLGA 3GYIA 4Z17A 4GDPA 2HXUA 3LB8A 5JCMA 3SZCA 3NXLA 3STPA 2GGGA 3P4SA 3UCCA 1NPXA 1GRFA 2DW6A 4XWRA 4JQ9A 3P93A 1N4UA 5IQ1A 3FBSA 4P9SA 5G5HB 3SGLA 3UOVA 3JSKA 4YTNA 3URHA 2GGIA 2WP5A 3K7QX 2ZZ0A 1EBHA 4KEMA 1EL5A 1NEKA 3SQSA 5KRQA 4H2NA 3UGVA 4TM0A 2XLUA 4B63A 2OG9A 3IWAA 3UCLA 3LZWA 2OFJA 4NTCA 3V3NA 4E4UA 4IT1A 1JPDX 1MXTA 2XH4A 2GVCA 1EL7A 3BI5A 5FS8A 4JN8A 3TQPA 3UOZA 1H86A 1JDFA 4J36A 3NG7X 2PS2A 3PWGA 4HCLA 3R1ZA 3F8RA 4J33A 3NKSA 3VCCA 4FK1A 1D7YA 2I0ZA 5KVHA 2BS2A 3EKGA 2XGZA 1N5XA 4CRTA 2MNRA 1H82A 1M64A 1F6MA 4UDRA 5L46A 3D9XA 1L8PA 3RO6A 3T2KA 3T14A 2PPGA 2YLWA 4G6GA 3VR9A 2VVLG 1IUWA 4ZCDA 3SFEA 5KOXA 3A7AA 2GR0A 3IC9A 3RP7A 1PHHA 3ES7A 2EQ7A 3DG3A 5IQ4A 2C75A 2EQ8A 3ES8A 1KFYA 3DGBA 1E7PA 3DIPA 3A7UA 3KU9A 1V59A 3CNTA 4AT0A 4NZHA 2R0CA 4KPRA 1VG0A 2DW7A 3KPKA 2WU5A 3ZVHA 1KDGA 4K22A 5JCLA 3RP8A 2GGHA 2GR1A 3ITJA 5U63A 3R10A 5BUKA 2NPXA 3K30A 2B7RA 4H4WA 4J56A 4ADWA 2JB1A 4K5RA 3V5FA 1E1LA 5C2TA 4Z25A 3AYLA 3ADAB 5IDZA 2P8BA 3NS1B 1KKRA 3ABVA 3BJSA 4EMJA 3ICSA 4GGBA 3MKCA 3I6DA 4HPNA 5ENLA 4YTPA 1ECQA 3EUB3 1NHRA 2OQHA 3CGBA 2BC1A 2OPJA 2ZZBA 4ECHA 1NHQA 3NTAA 1GXFA 4U2SA 2APGA 4ZCCA 1O95A 3KKJA 1Z6LA 3AEFA 2C7GA 3PFRA 3L1RA 3CNJA 3H8LA 1SJBA 4YWOA 4FP1A 2W3SA 3OZYA 1Y0PA 3B97A 1FEAA 4H4RA 5HYMA 1YKJA 1H83A 2YVJA 3DGZA 1CJ4A 4TM3A 1OJAA 1P2HA 3P4QA 4LA1A 3M13A 1N4WA 4UDPA 3GMCA 3RGTA 2FYMA 1W4XA 3D1CA 1KKOA 2Z5YA 4AP1A 4H4XA 2VQBA 1FO4A 3L8KA 2R45A 4UDQA 3N6HA 1PBBA 2WPEA 3SBFA 2XLPA 2CFYA 2QVHA 3G5QA 4ZCWA 2V6OA 1K0LA 3DMEA 5GSNA 4IL0A 2BK4A 2OAMA 2YLSA 3P0WA 3FV9A 1JRPA 3TWAA 3ZLHA 1GREA 1QO8A 1PN0A 4HCHA 2GV8A 3DJGX 3S5WA 1GRHA 3Q6JA 1XDIA 4E6MA 1KNPA 3K1GA 3ZVIA 4X9NA 1ELSA 3KD9A 2XH7A 1F3PA 3L5OA 3AE5A 4DX3A 1GTEA 1LQTA 4B65A 1WUEA 2WDRA 4IL2A 1JOAA 5J60A 3BI2A 4JN7A 1E1MA 4GAVA 4Z44A 3NVVB 3CPHG 1VRQB 1OEPA 4EIPA 4GYPC 3ICTA 2IIDA 1ONEA 4U8KA 2B9YA 3AWIA 3I6EA 1K4QA 5M10A 5KMSA 1V97A 1H7WA 3CNPA 2MUCA 3UKAA 3MWCA 3SM8A 4CY8A 5FS9A 5FS6A 4J2WA 5KXJA 4U8MA 1Q1RA 3T0KA 4CCQA 1Y56B 1D5TA 4G6HA 2X3NA 1PJ7A 1NDAA 4YSYA 3DH9A 2ZADA 3V5CA 2YG5A 1YQ4A 2E5AA 2JKCA 2QJJA 4E8GA 4OPDA 3SJNA 3G5SA 3OZ2A 2WP9A 3MY9A 3FMWA 4HA6A 4Z43A 3EF6A 1GPEA 3HYWA 2GF3A 2VZ2A 1KN0A 3IJIA 2YG3A 5HXIA 5JCIA 3HYVA 1L9CA 1S7MA 4IVOB 1EL9A 4X4JA 3UXKA 3QVPA 4A79A 3K7MX 2HNEA 3I4KA 3ENLA 1EC9A 1N5WC 1EL8A 2WPCA 3FPZA 4J57A 3CPIG 4A6GA 3NK0X 4H7UA 4J3ZA 1TKKA 1BKWA 1TE6A 2EQ9A 3SZWA 3AD7B 3NN6X 3FG2P 4ZN0A 3VCNA 3FVDA 2AKZA 3CPJG 4G8TA 3GDNA 2QQ6A 4XXGA 2X8GA 3NRZB 2UZZA 2Q0LA 1PXBA 2C76A 3UKHA 4K2XA 2VVMA 3DK9A 2WBAA 2OALA 4C5OA 2GL5A 4OVIA 4CBQA 3B3RA 2VRMA 3SSZA 4AOSA 2FJBA 1N4VA 4JNAA 2CVJA 2PU0A 3ZDNA 3UKQA 1F8RA 2BYBA 4YSHA 2CDUA 1QLBA 2XDOA 3BI4A 3NYCA 3P3BA 3QLDA 3CK5A 1ZX9A 5EB4A 5EBKA 4U8PA 3RITA 1GEUA 2Q0KA 2V60A 4HCDA 3GWFA 2XFPA 3T8QA 2YG6A 1NHSA 2FKPA 1ELIA 2E4GA 3QVRA 4DWDA 4DN1A 2OZTA 3R07C 5FJRA 3VC5A 2WP6A 2ZZCA 4GCMA 2WU2A 3EANA 1WYGA 2XFUA 1TDEA 1GRAA 3THUA 3DJDA 4EMIA 3QSMA 2P0IA 1ZP0A 1XPQA 2BXRA 4K1WA 3DFYA 1RYIA 2YR6A 3LOVA 5FJPA 2YLRA 3RNMA 4EQSA 1PJ5A 4BURA 1YQZA 4H4UA 3ATQA 1KSUA 4CNJA 2XVJA 4DSHA 4TVWA 1GSNA 4H4TA 3TCSA 1RSGA 2XLRA 2V3BA 4A3RA 1M6IA 4NWZA 3O0HA 4BV6A 4H4ZA 2J3NA 1BQGA 3KLJA 3S61A 1LQUA 3GYJA 4Y4LA 3BSMA 1KD0A 3V76A 3DDMA 3GRSA 3SR6B 3T2ZA 1Q9IA 2Q7VA 1JRYA
chains in the Genus database with same CATH topology
3VRBA 1JNZA 4G9KA 1PXAA 3UTHA 3CNJA 4RG3A 3H8LA 4YWOA 4A99A 2YM1A 1BGNA 5M0ZA 1Y0PA 1LJ1A 1FEAA 4H4RA 5HYMA 1YKJA 3CTYA 4E0VA 4GF7A 2W0HA 1LPFA 1H83A 2DKIA 2BCPA 4X9MA 3RHAA 2QA1A 2VRLA 1GRBA 2Y6QA 2YR4A 2YVJA 3DGZA 1CJ4A 1YQ3A 4TM3A 2NVKX 1OJAA 1P2HA 2RGHA 3AB1A 3EPTA 3P4QA 1ZOYA 4LA1A 4B68A 1VDCA 2IVEA 1GOSA 3M13A 3UP5A 1YY5A 3AE3A 1SEZA 1D4CA 4MJWA 4CCRA 3HYXA 5FMHA 2WS3A 3PO7A 3QSSA 3GRTA 2DKHA 1N4WA 4UDPA 3GMCA 2YAUA 1P2EA 1W4XA 3D1CA 1O94A 2JB3A 2QAEA 2Z5YA 4EQRA 2AR8A 4H4XA 2VQBA 2YLXA 1GESA 4AP1A 1ZY8A 5KMPA 2X50A 3L8KA 2R45A 4OPCA 3NIXA 3AYIA 4UDQA 1H2IA 4U8IA 2FJEA 1OJDA 2GMJA 1DJQA 4D03A 4NEWA 1DOBA 1LTXR 1PBBA 5BRTA 3UKFA 2WPEA 2YLTA 1AOGA 2B9WA 1H6VA 3AEAA 2ZBWA 2XCGA 2GQWA 2XLPA 3NT6A 2CFYA 3V3OA 1CF3A 4YT0A 2V61A 2YR5A 3BNMA 3G5QA 1S3EA 3LZXA 4K5SA 2WOVA 4BK1A 2V6OA 1PBFA 4B67A 4GRTA 2WOWA 5KWFA 3PS9A 5KOWA 1S3BA 2GRTA 2WPFA 3GSIA 1K0LA 4FK1C 2XVFA 3DMEA 4JN9A 1MOKA 5GSNA 2BK4A 2YLSA 2OAMA 1PBDA 4NTEA 1S2YA 2VQ7A 3T37A 2C64A 2QCUA 3ALMA 3IHGA 4Y4MA 1JRXA 4U2LA 2VVLA 2C3DA 1GREA 1TYPA 2E1MA 2YG4A 4Z2TA 1QO8A 4OPIA 4Z24A 1PN0A 3RP6A 2ACZA 2GV8A 2H89A 3GWDA 3DJGX 1CC2A 3S5WA 1GRHA 3Q6JA 1XDIA 3P1WA 1H81A 2R0PA 1KNPA 1IUVA 4OPTA 1JU2A 1CJ3A 3FIMB 1DJNA 1PDHA 1ZOVA 3UKLA 4X9NA 3AE4A 3KD9A 2YQUA 4TLZA 3EAOA 3C4NA 3AEDA 1F3PA 1KNRA 2ARDA 2CULA 4WCTA 3L5OA 3AE5A 2BRAA 3AE8A 3QSEA 5ER0A 1GTEA 1GETA 2EQ6A 1LV0A 1OJCA 1LQTA 1BGJA 1KF6A 2WDRA 3NK1X 4B65A 2BK5A 2GMHA 1JOAA 3CIRA 4OPLA 5HY5A 1F8WA 2QA2A 4Z2RA 5J60A 3BI2A 5TR3A 1E1MA 1K0JA 4GAVA 2BS4A 2YWLA 4RG4A 2R4EA 4Z44A 5KMQA 4EIQA 1E1NA 4AOXA 3CPHG 1VRQB 3G5RA 2GAHB 1F8SA 3PVCA 3H8IA 2XFOA 1H84A 2TPRA 3K7TA 4EIPA 2WHDA 2JB2A 2R9ZA 3VRDB 3ICTA 2IIDA 3M0OA 3D8XA 4U8KA 1DODA 2B9YA 2GH5A 3AWIA 3CGEA 3SQPA 4J34A 1BF3A 1LVLA 2BXSA 1IUTA 1GTHA 3NYEA 4B66A 1K4QA 5EOWA 3Q9TA 5M10A 3UOXA 2Z5XA 4PAAA 1XHCA 3CN8A 2Q6UA 3REDA 5KMSA 2GQFA 1H7WA 3PG6A 3KPFA 1KSSA 3T2YA 3WE0A 3CNPA 3GDPA 1NHPA 3CGCA 1CHUA 1ZKQA 2JAEA 4IV9A 4DNAA 3SM8A 3UKAA 2A8XA 4CNKA 5FS9A 5FS6A 3DJEA 4J2WA 4CY8A 4CY6A 1DNCA 4U2TA 5KXJA 4U8MA 1GRTA 1L9EA 1ONFA 2RGJA 1Q1RA 3ICRA 4OCGA 4U8NA 4NTDA 1PXCA 4USRA 1B5QA 3T0KA 4K8DA 4JDRA 4CCQA 3E1TA 1Y56B 1D5TA 2OLOA 3M12A 3AE7A 4UP3A 4G6HA 2X3NA 3I3LA 1PJ7A 1NDAA 3P4RA 4DSGA 3GYXA 4YSYA 3DH9A 3F8PA 2YG5A 2XLTA 2R0GA 3NH3X 1YQ4A 5LV9A 2JKCA 1OJ9A 5BVAA 1CBOA 2GB0A 3SY4A 5JRBA 4JNQA 2BC0A 3C96A 3QJ4A 2JK6A 3SFDA 2HQMA 2WDVA 5JCNA 1ZDLA 2WETA 5HHFA 2IVDA 1DXLA 3DA1A 1X31B 1JRZA 4OPDA 4O5QA 2VOUA 1FEBA 3NK2X 4GR1A 2E5VA 1B4VA 2XFQA 5FS7A 1NG3A 3G5SA 4EMWA 1CC4A 3OZ2A 2WP9A 1L9DA 1E6EA 3AEBA 3CMMA 5EB5A 4B64A 3FMWA 4HA6A 4C77A 2C3CA 1IUXA 3AE9A 3AE6A 3SXIA 4Z43A 2V5ZA 3NGCX 3EF6A 3IF9A 4N9XA 1GPEA 3ZYXA 3HYWA 4APNA 1TDKA 2C4CA 2GF3A 2VZ2A 1KN0A 4EQWA 2C72A 1DOEA 3AD9B 1O5WA 4I58A 4Y4NA 1GV4A 2YG3A 5HXIA 3SYIA 4H4SA 2R4JA 5JCIA 2V3AA 2PYXA 3HYVA 1L9CA 1S7MA 1CJ2A 4IVOB 4OPUA 2GR2A 3DK4A 1PJ6A 2B7SA 1EL9A 4X4JA 1GERA 3AEGA 1GT8A 1QJDA 3QVPA 2RABA 4NEVA 3UKKA 4A79A 3K7MX 4ICYA 4B1BA 2WOIA 3NN0X 4U8LA 2GR3A 2X8CA 4KX6A 5KNLA 3VR8A 3H4KA 3GYIA 4GUVA 3NTDA 4GDPA 3LB8A 2XVIA 5JCMA 4AT2A 1VQWA 1EL8A 2WPCA 4H2QA 4B69A 1PS9A 4YSXA 3FPZA 4J57A 4U8JA 3CPIG 4TLXA 3NK0X 4H7UA 2Y6RA 4RSLA 1BKWA 3SZCA 4II2A 1L0VA 2EQ9A 3SZWA 2C66A 3AD7B 3NN6X 3P4SA 3DJJA 2C73A 3VQRA 2C67A 1NPXA 3UP4A 2X8HA 4I59A 3FG2P 1GRFA 3II4A 4XWRA 4JQ9A 2JBVA 4ZN0A 1S2QA 1N4UA 4IA6A 5IQ1A 3UKPA 3FBSA 2O9ZA 3VRAA 4P9SA 1HYUA 4Z2UA 2X99A 3SGLA 1IJHA 4H4QA 3UOVA 3CPJG 4EM3A 4USQA 3SZFA 3JSKA 3UTEA 2R46A 1CJCA 4YTNA 4YXDA 3GDNA 3URHA 4BK3A 1ZK7A 5JCKA 1FOHA 2OLNA 2A89A 2WEUA 4XXGA 3NHOX 4D04A 2WP5A 2H88A 2ZZ0A 1TDNA 3K7QX 1EL5A 1NEKA 2X8GA 2UZZA 2AAQA 2FBWA 1Y56A 1GNDA 2Q0LA 1PXBA 3SX6A 2C76A 3AXBA 5KRQA 2F5ZA 4H2NA 4XWZA 5GRTA 3UKHA 4K2XA 1CL0A 2WESA 2XLUA 2VVMA 4TM0A 3ALJA 4C74A 3AYJA 4PABA 1E1KA 4B63A 3DK9A 2WBAA 3IWAA 3UCLA 2OALA 3LZWA 4NTCA 3V3NA 4Z26A 1TDOA 4A7AA 1XANA 4LU6A 4A6NA 4AP3A 4C5OA 4OVIA 4CBQA 3B3RA 2VRMA 1MXTA 1NAAA 3NYFA 2YG7A 2GVCA 2PHHA 3AECA 3P9UA 4GDEA 3R9UA 4EQXA 3GD3A 2GAGB 2YM2A 3UTGA 4AOSA 2FJBA 1EL7A 3BI5A 1N4VA 4JNAA 2CVJA 5FS8A 2XVEA 2BCGG 4A6NB 2RGOA 3ZDNA 4OPGA 4TM4A 4BJYA 4C3YA 3UKQA 1F8RA 4LIIA 3UOZA 1H86A 2AQJA 2BYBA 4J36A 3NG7X 5J7XA 4YSHA 2CDUA 1QLBA 3KA7A 1N1PA 2XDOA 4H2RA 1TRBA 2XYOA 3QFBA 1IUUA 3F8RA 3DGHA 3BI4A 4J33A 3NKSA 4FK1A 3NYCA 2BABA 1D7YA 2I0ZA 3ATRA 3CGDA 5KVHA 1OJTA 2BS2A 2XLSA 1ZX9A 5EB4A 5EBKA 4U8PA 4JY2A 1GEUA 2Q0KA 4CRTA 4JY3A 1D4DA 4DGKA 1H82A 2V60A 3KVEA 4O5UA 1M64A 1F6MA 4UDRA 3GWFA 5L46A 3D9XA 2XFPA 3NLCA 1GALA 2YG6A 1NHSA 1ELIA 2E4GA 3T2KA 1PBEA 4A5LA 3BNUA 3T14A 2OA1A 3QVRA 3B6DA 1FECA 2YLWA 2BRYA 2C65A 3IHMA 1Q1WA 4G6GA 2FJAA 1EBDA 3BHFA 2A87A 3C4AA 3VR9A 2VVLG 2BACA 1IUWA 4IVMB 2BK3A 4ZCDA 3SFEA 1GRGA 2B76A 5KOXA 4HB9A 5BULA 2GR0A 4YKGA 3GMBA 4FDCB 1RP0A 3IC9A 2TMDA 3RP7A 1BZLA 1D7LA 3UOYA 4H4PA 1PHHA 2FJDA 2EQ7A 4YSZA 4TM1A 1TYTA 1ZMCA 2WP6A 2EQ8A 2C75A 3AE1A 5C3JA 3CNDA 5IQ4A 1KFYA 2ZZCA 4GCMA 1E7PA 2WU2A 3KU9A 1V59A 4J31A 1IUSA 3EANA 3CNTA 3LADA 3OC4A 1K0IA 4AT0A 3GD4A 2XFUA 4NZHA 1TDEA 1GRAA 3DJDA 4EMIA 3QSMA 1B8SA 1FL2A 2R0CA 5KMRA 2YVFA 4KPRA 1ZP0A 1VG0A 4G73A 3KPKA 2WU5A 4II3A 1UKVG 1XPQA 2BXRA 4BJZA 4H4VA 1KDGA 2GEWA 4GAPA 3CNSA 4K22A 5KVIA 5JCLA 1MO9A 3RP8A 5IPYA 2GR1A 3ITJA 5U63A 1FCDA 4FX9A 3NNEA 1RYIA 4BK2A 4WX1A 3LXDA 4YTMA 2XFNA 2YR6A 3LOVA 3F8DA 5BUKA 3QFAA 2NPXA 2YLRA 3RNMA 4EQSA 1PJ5A 4U8OA 3K30A 4BURA 1YQZA 4K7ZA 2B7RA 3BHKA 2XVHA 4H4WA 4J56A 4ADWA 2BS3A 1NG4A 4H4YA 4H4UA 2JB1A 2WDQA 3AE2A 1CC6A 3ATQA 3T31A 4M52A 1KSUA 4CNJA 4K5RA 2YVGA 2XVJA 5CQFA 4DSHA 1GSNA 4H4TA 1E1LA 1BWCA 1VG9A 5DBJA 4Z25A 5C2TA 3AYLA 4REKA 1RSGA 4NNJA 3ADAB 2C70A 2XLRA 3AEEA 2V3BA 3ISHA 1COYA 1JNRA 4C3XA 4EM4A 1M6IA 4H50A 4NWZA 3O0HA 4BV6A 1TDFA 3ABVA 3SZ0A 4EMJA 3ICSA 3I6DA 4H4ZA 2B9XA 4YTPA 4A65A 1ZMDA 5U25A 1NHRA 3CGBA 5CKUA 2J3NA 3KLJA 2BC1A 1REOA 1PBCA 4G74A 2ZZBA 3S61A 2WQYA 4ECHA 1JEHA 1NHQA 1LQUA 3GYJA 3ALLA 3NTAA 2YLZA 1GXFA 4U2SA 2APGA 3COXA 4Y4LA 4YKFA 3AD8B 4H2PA 3HZLA 2BA9A 3LJPA 1D4EA 3NRNA 4ZCCA 1NENA 5U1OA 1DOCA 1E39A 1O95A 3GRSA 3KKJA 4IA5A 3T2ZA 3UTFA 1Z6LA 3AEFA 3V76A 4A9WA 1Q9IA 1B37A 3P4PA 2Q7VA 2C7GA 3L1RA 3DK8A 1JRYA 1H7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRB A;  1JNZ A;  3UTH A;  1PXA A;  3CNJ A;  4RG3 A;  3H8L A;  4YWO A;  4A99 A;  2YM1 A;  1BGN A;  5M0Z A;  1Y0P A;  1LJ1 A;  1FEA A;  4H4R A;  5HYM A;  1YKJ A;  3CTY A;  4E0V A;  4GF7 A;  2W0H A;  1LPF A;  1H83 A;  2DKI A;  2BCP A;  4X9M A;  3RHA A;  2QA1 A;  2VRL A;  1GRB A;  2Y6Q A;  2YR4 A;  2YVJ A;  3DGZ A;  1CJ4 A;  1YQ3 A;  4TM3 A;  2NVK X;  1OJA A;  1P2H A;  2RGH A;  3AB1 A;  3EPT A;  3P4Q A;  1ZOY A;  4LA1 A;  4B68 A;  1VDC A;  2IVE A;  1GOS A;  3M13 A;  3UP5 A;  1YY5 A;  3AE3 A;  1SEZ A;  1D4C A;  4MJW A;  4CCR A;  5FMH A;  2WS3 A;  3PO7 A;  3QSS A;  3GRT A;  2DKH A;  1N4W A;  4UDP A;  3GMC A;  2YAU A;  1P2E A;  1W4X A;  3D1C A;  1O94 A;  2JB3 A;  2QAE A;  2Z5Y A;  4EQR A;  2AR8 A;  4H4X A;  2VQB A;  2YLX A;  1GES A;  4AP1 A;  1ZY8 A;  2X50 A;  3L8K A;  2R45 A;  4OPC A;  3NIX A;  3AYI A;  4UDQ A;  4U8I A;  2FJE A;  1OJD A;  2GMJ A;  1DJQ A;  4D03 A;  4NEW A;  1DOB A;  1LTX R;  1PBB A;  5BRT A;  3UKF A;  2WPE A;  2YLT A;  1AOG A;  2B9W A;  1H6V A;  3AEA A;  2ZBW A;  2XCG A;  2GQW A;  2XLP A;  3NT6 A;  2CFY A;  3V3O A;  1CF3 A;  4YT0 A;  2V61 A;  2YR5 A;  3BNM A;  3G5Q A;  1S3E A;  3LZX A;  4K5S A;  2WOV A;  4BK1 A;  2V6O A;  1PBF A;  4B67 A;  4GRT A;  2WOW A;  5KWF A;  3PS9 A;  5KOW A;  1S3B A;  2GRT A;  2WPF A;  3GSI A;  1K0L A;  4FK1 C;  2XVF A;  3DME A;  4JN9 A;  1MOK A;  5GSN A;  2BK4 A;  2YLS A;  2OAM A;  1PBD A;  4NTE A;  1S2Y A;  2VQ7 A;  3T37 A;  2C64 A;  2QCU A;  3ALM A;  3IHG A;  4Y4M A;  1JRX A;  4U2L A;  2VVL A;  2C3D A;  1GRE A;  1TYP A;  2E1M A;  2YG4 A;  4Z2T A;  1QO8 A;  4OPI A;  4Z24 A;  1PN0 A;  3RP6 A;  2ACZ A;  2GV8 A;  2H89 A;  3GWD A;  3DJG X;  1CC2 A;  3S5W A;  1GRH A;  3Q6J A;  1XDI A;  3P1W A;  1H81 A;  2R0P A;  1KNP A;  1IUV A;  4OPT A;  1JU2 A;  1CJ3 A;  3FIM B;  1DJN A;  1PDH A;  1ZOV A;  3UKL A;  4X9N A;  3AE4 A;  3KD9 A;  2YQU A;  4TLZ A;  3EAO A;  3C4N A;  3AED A;  1F3P A;  1KNR A;  2ARD A;  2CUL A;  4WCT A;  3AE5 A;  3AE8 A;  3QSE A;  5ER0 A;  1GTE A;  1GET A;  2EQ6 A;  1LV0 A;  1OJC A;  1LQT A;  1BGJ A;  1KF6 A;  2WDR A;  3NK1 X;  4B65 A;  2BK5 A;  2GMH A;  1JOA A;  3CIR A;  4OPL A;  5HY5 A;  1F8W A;  2QA2 A;  4Z2R A;  5J60 A;  3BI2 A;  5TR3 A;  1E1M A;  1K0J A;  4RG4 A;  2BS4 A;  2YWL A;  4Z44 A;  2R4E A;  1L0V A;  4EIQ A;  1E1N A;  4AOX A;  3CPH G;  1VRQ B;  3G5R A;  2GAH B;  1F8S A;  3PVC A;  3H8I A;  2XFO A;  1H84 A;  2TPR A;  3K7T A;  4EIP A;  2WHD A;  2JB2 A;  2R9Z A;  3VRD B;  3ICT A;  2IID A;  3M0O A;  3D8X A;  4U8K A;  1DOD A;  2B9Y A;  2GH5 A;  3AWI A;  3CGE A;  3SQP A;  4J34 A;  1BF3 A;  1LVL A;  2BXS A;  1IUT A;  1GTH A;  3NYE A;  4B66 A;  1K4Q A;  5EOW A;  3Q9T A;  5M10 A;  3UOX A;  2Z5X A;  4PAA A;  1XHC A;  3CN8 A;  2Q6U A;  3RED A;  2GQF A;  1H7W A;  3KPF A;  1KSS A;  3WE0 A;  3CNP A;  3GDP A;  1NHP A;  3CGC A;  1CHU A;  1ZKQ A;  2JAE A;  4IV9 A;  4DNA A;  3SM8 A;  3UKA A;  2A8X A;  4CNK A;  5FS9 A;  5FS6 A;  3DJE A;  4J2W A;  4CY8 A;  4CY6 A;  1DNC A;  4U2T A;  5KXJ A;  4U8M A;  1GRT A;  1L9E A;  1ONF A;  2RGJ A;  1Q1R A;  3ICR A;  4OCG A;  4U8N A;  4NTD A;  1PXC A;  4USR A;  1B5Q A;  4K8D A;  4JDR A;  4CCQ A;  3E1T A;  1Y56 B;  1D5T A;  2OLO A;  3M12 A;  3AE7 A;  4UP3 A;  2X3N A;  3I3L A;  1PJ7 A;  1NDA A;  3P4R A;  4DSG A;  4YSY A;  3DH9 A;  3F8P A;  2YG5 A;  2XLT A;  2R0G A;  3NH3 X;  1YQ4 A;  5LV9 A;  2JKC A;  1OJ9 A;  5BVA A;  1CBO A;  2GB0 A;  4JNQ A;  2BC0 A;  3C96 A;  3QJ4 A;  2JK6 A;  3SFD A;  2HQM A;  2WDV A;  5JCN A;  1ZDL A;  2WET A;  5HHF A;  2IVD A;  1DXL A;  3DA1 A;  1X31 B;  1JRZ A;  4OPD A;  4O5Q A;  2VOU A;  1FEB A;  3NK2 X;  4GR1 A;  2E5V A;  1B4V A;  2XFQ A;  5FS7 A;  1NG3 A;  3G5S A;  4EMW A;  1CC4 A;  3OZ2 A;  2WP9 A;  1L9D A;  1E6E A;  3AEB A;  5EB5 A;  4B64 A;  3FMW A;  4HA6 A;  4C77 A;  2C3C A;  1IUX A;  3AE9 A;  3AE6 A;  4Z43 A;  2V5Z A;  3NGC X;  3EF6 A;  3IF9 A;  4N9X A;  1GPE A;  3ZYX A;  4APN A;  1TDK A;  2GF3 A;  2VZ2 A;  4EQW A;  2C72 A;  4Y4N A;  1DOE A;  3AD9 B;  1O5W A;  4I58 A;  1GV4 A;  2YG3 A;  5HXI A;  4H4S A;  2R4J A;  5JCI A;  2PYX A;  2V3A A;  1L9C A;  1CJ2 A;  4IVO B;  4OPU A;  2GR2 A;  3DK4 A;  1PJ6 A;  2B7S A;  1EL9 A;  4X4J A;  1GER A;  3AEG A;  1GT8 A;  1QJD A;  3QVP A;  2RAB A;  4NEV A;  3UKK A;  4A79 A;  3K7M X;  4ICY A;  4B1B A;  2WOI A;  3NN0 X;  4U8L A;  2GR3 A;  2X8C A;  4KX6 A;  3VR8 A;  3H4K A;  3GYI A;  4GUV A;  3NTD A;  4GDP A;  3LB8 A;  2XVI A;  5JCM A;  4AT2 A;  1VQW A;  1EL8 A;  2WPC A;  4H2Q A;  4B69 A;  1PS9 A;  4YSX A;  3FPZ A;  4J57 A;  4U8J A;  3CPI G;  4TLX A;  3NK0 X;  4H7U A;  2Y6R A;  4RSL A;  1BKW A;  2EQ9 A;  2C66 A;  3AD7 B;  3NN6 X;  3P4S A;  3DJJ A;  2C73 A;  3VQR A;  2C67 A;  1NPX A;  3UP4 A;  2X8H A;  4I59 A;  3FG2 P;  1GRF A;  3II4 A;  4XWR A;  4JQ9 A;  2JBV A;  4ZN0 A;  1S2Q A;  1N4U A;  4IA6 A;  5IQ1 A;  3UKP A;  3FBS A;  2O9Z A;  3VRA A;  4P9S A;  1HYU A;  4Z2U A;  2X99 A;  3SGL A;  1IJH A;  4H4Q A;  3UOV A;  3CPJ G;  4EM3 A;  4USQ A;  3JSK A;  3UTE A;  2R46 A;  1CJC A;  4YTN A;  4YXD A;  3GDN A;  3URH A;  4BK3 A;  1ZK7 A;  5JCK A;  1FOH A;  2OLN A;  2A89 A;  2WEU A;  4XXG A;  3NHO X;  4D04 A;  2WP5 A;  2H88 A;  2ZZ0 A;  1TDN A;  3K7Q X;  1EL5 A;  1NEK A;  2X8G A;  2UZZ A;  2AAQ A;  2FBW A;  1Y56 A;  1GND A;  2Q0L A;  1PXB A;  2C76 A;  3AXB A;  5KRQ A;  2F5Z A;  4H2N A;  4XWZ A;  5GRT A;  3UKH A;  4K2X A;  1CL0 A;  2WES A;  2XLU A;  2VVM A;  4TM0 A;  3ALJ A;  4C74 A;  3AYJ A;  4PAB A;  1E1K A;  4B63 A;  3DK9 A;  2WBA A;  3IWA A;  3UCL A;  2OAL A;  3LZW A;  4NTC A;  3V3N A;  4Z26 A;  1TDO A;  4A7A A;  1XAN A;  4LU6 A;  4A6N A;  4AP3 A;  4C5O A;  4OVI A;  4CBQ A;  3B3R A;  2VRM A;  1MXT A;  1NAA A;  3NYF A;  2YG7 A;  2GVC A;  2PHH A;  3AEC A;  3P9U A;  4GDE A;  3R9U A;  4EQX A;  3GD3 A;  2GAG B;  2YM2 A;  3UTG A;  4AOS A;  2FJB A;  1EL7 A;  3BI5 A;  1N4V A;  4JNA A;  2CVJ A;  5FS8 A;  2XVE A;  2BCG G;  4A6N B;  2RGO A;  3ZDN A;  4OPG A;  4TM4 A;  4BJY A;  4C3Y A;  3UKQ A;  1F8R A;  4LII A;  3UOZ A;  1H86 A;  2AQJ A;  2BYB A;  4J36 A;  3NG7 X;  5J7X A;  4YSH A;  2CDU A;  1QLB A;  3KA7 A;  1N1P A;  2XDO A;  4H2R A;  1TRB A;  2XYO A;  3QFB A;  1IUU A;  3F8R A;  3DGH A;  3BI4 A;  4J33 A;  3NKS A;  4FK1 A;  3NYC A;  2BAB A;  1D7Y A;  2I0Z A;  3ATR A;  3CGD A;  5KVH A;  1OJT A;  2BS2 A;  2XLS A;  1ZX9 A;  5EB4 A;  5EBK A;  4U8P A;  4JY2 A;  1GEU A;  2Q0K A;  4CRT A;  4JY3 A;  1D4D A;  4DGK A;  1H82 A;  2V60 A;  3KVE A;  4O5U A;  1M64 A;  1F6M A;  4UDR A;  3GWF A;  5L46 A;  2XFP A;  3NLC A;  1GAL A;  2YG6 A;  1NHS A;  1ELI A;  2E4G A;  1PBE A;  4A5L A;  3BNU A;  2OA1 A;  3QVR A;  3B6D A;  1FEC A;  2YLW A;  2C65 A;  3IHM A;  1Q1W A;  3VR9 A;  2FJA A;  1EBD A;  3BHF A;  2A87 A;  3C4A A;  2VVL G;  2BAC A;  1IUW A;  4IVM B;  2BK3 A;  4ZCD A;  3SFE A;  1GRG A;  2B76 A;  5KOX A;  4HB9 A;  5BUL A;  2GR0 A;  4YKG A;  3GMB A;  4FDC B;  1RP0 A;  3IC9 A;  2TMD A;  3RP7 A;  1BZL A;  1D7L A;  3UOY A;  4H4P A;  1PHH A;  2FJD A;  2EQ7 A;  4YSZ A;  4TM1 A;  1TYT A;  1ZMC A;  2WP6 A;  2EQ8 A;  2C75 A;  3AE1 A;  5C3J A;  3CND A;  5IQ4 A;  1KFY A;  2ZZC A;  4GCM A;  1E7P A;  2WU2 A;  3KU9 A;  1V59 A;  4J31 A;  1IUS A;  3EAN A;  3CNT A;  3LAD A;  3OC4 A;  1K0I A;  4AT0 A;  3GD4 A;  2XFU A;  4NZH A;  1TDE A;  1GRA A;  3DJD A;  4EMI A;  3QSM A;  1B8S A;  1FL2 A;  2R0C A;  2YVF A;  4KPR A;  1ZP0 A;  1VG0 A;  2WU5 A;  1UKV G;  1XPQ A;  2BXR A;  4BJZ A;  4H4V A;  1KDG A;  2GEW A;  3CNS A;  4K22 A;  5KVI A;  5JCL A;  1MO9 A;  3RP8 A;  5IPY A;  2GR1 A;  3ITJ A;  5U63 A;  1FCD A;  4FX9 A;  3NNE A;  1RYI A;  4BK2 A;  4WX1 A;  3LXD A;  4YTM A;  2XFN A;  2YR6 A;  3LOV A;  3F8D A;  5BUK A;  3QFA A;  2NPX A;  2YLR A;  3RNM A;  4EQS A;  1PJ5 A;  4U8O A;  3K30 A;  4BUR A;  1YQZ A;  4K7Z A;  2B7R A;  3BHK A;  2XVH A;  4H4W A;  4J56 A;  4ADW A;  2BS3 A;  1NG4 A;  4H4Y A;  4H4U A;  2JB1 A;  2WDQ A;  3AE2 A;  1CC6 A;  3ATQ A;  4M52 A;  1KSU A;  4CNJ A;  4K5R A;  2YVG A;  2XVJ A;  5CQF A;  4DSH A;  1GSN A;  4H4T A;  1E1L A;  1BWC A;  1VG9 A;  5DBJ A;  4Z25 A;  5C2T A;  3AYL A;  4REK A;  1RSG A;  3ADA B;  2C70 A;  2XLR A;  3AEE A;  2V3B A;  3ISH A;  1COY A;  1JNR A;  4C3X A;  4EM4 A;  1M6I A;  4H50 A;  3O0H A;  4BV6 A;  1TDF A;  3ABV A;  4EMJ A;  3ICS A;  3I6D A;  4H4Z A;  2B9X A;  4YTP A;  4A65 A;  1ZMD A;  5U25 A;  1NHR A;  3CGB A;  5CKU A;  2J3N A;  3KLJ A;  2BC1 A;  1REO A;  1PBC A;  3S61 A;  2ZZB A;  4ECH A;  2WQY A;  1JEH A;  1NHQ A;  1LQU A;  3GYJ A;  3ALL A;  3NTA A;  2YLZ A;  1GXF A;  4U2S A;  2APG A;  3COX A;  4Y4L A;  4YKF A;  3AD8 B;  4H2P A;  3HZL A;  2BA9 A;  3LJP A;  1D4E A;  3NRN A;  4ZCC A;  1NEN A;  5U1O A;  1DOC A;  1E39 A;  1O95 A;  3GRS A;  3KKJ A;  4IA5 A;  3UTF A;  3V76 A;  1Z6L A;  3AEF A;  4A9W A;  1Q9I A;  1B37 A;  3P4P A;  2Q7V A;  2C7G A;  3L1R A;  3DK8 A;  1JRY A;  1H7X A; 
#chains in the Genus database with same CATH topology
 4E5T A;  4RG3 A;  5M0Z A;  1LJ1 A;  1EBG A;  4E0V A;  4GF7 A;  2BCP A;  1NU5 A;  4X9M A;  2YR4 A;  2Y6Q A;  3RHA A;  2OO6 A;  2NVK X;  1W6T A;  1VDC A;  1YY5 A;  1SEZ A;  4MJW A;  4CCR A;  2WS3 A;  2DKH A;  2YAU A;  1P2E A;  1O94 A;  1ZY8 A;  5KMP A;  2ZC8 A;  4OPC A;  3PWI A;  2FJE A;  2GMJ A;  1DJQ A;  2OZ8 A;  4NEW A;  3DEQ A;  1H6V A;  3AEA A;  2GQW A;  3NT6 A;  4K8G A;  3V3O A;  2PTY A;  2YR5 A;  3BNM A;  3LZX A;  1PBF A;  4H1Z A;  5KOW A;  1S3B A;  3GSI A;  4FK1 C;  1MOK A;  1PBD A;  1S2Y A;  2VQ7 A;  3T37 A;  1RVK A;  2OKT A;  1TYP A;  2E1M A;  4Z2T A;  1CC2 A;  2RDX A;  3P1W A;  1N60 C;  4OPT A;  1CJ3 A;  2GSH A;  1ZOV A;  3AE4 A;  2YQU A;  3EAO A;  3C4N A;  1FFU C;  4WCT A;  1FHV A;  5ER0 A;  3CXB A;  1LV0 A;  4C3Y A;  2BK5 A;  3CIR A;  5HY5 A;  4Z2R A;  3R0K A;  5KMQ A;  4AOX A;  2XFO A;  1H84 A;  3T6C A;  2WHD A;  2JB2 A;  3UCD A;  3M0O A;  1KCZ A;  3Q9T A;  2Z5X A;  3CN8 A;  2Q6U A;  3KPF A;  3UJE A;  3T2Y A;  3CGC A;  2JAE A;  3NO1 A;  2A8X A;  4CNK A;  3DJE A;  3MSY A;  4U2T A;  1L9E A;  4OCG A;  3TW9 A;  4U8N A;  4JDR A;  3M12 A;  4UP3 A;  2XLT A;  3NH3 X;  5LV9 A;  1OJ9 A;  2GB0 A;  3SY4 A;  5JRB A;  4JNQ A;  4M6U A;  2WDV A;  5HHF A;  4O5Q A;  4GME A;  1WUF A;  2E5V A;  1B4V A;  2XFQ A;  1NG3 A;  3GD6 A;  4EMW A;  3N4F A;  1CC4 A;  5EB5 A;  2OQY A;  3S47 A;  3MZN A;  1SJA A;  3ZYX A;  4APN A;  2C4C A;  2P8C A;  2GGJ A;  1O5W A;  1GV4 A;  2V3A A;  2P3Z A;  1STZ A;  3DK4 A;  2B7S A;  3BOX A;  1GER A;  4ICY A;  4B1B A;  3MQT A;  2X8C A;  3DES A;  4KX6 A;  3NTD A;  4H2Q A;  4GFI A;  1PS9 A;  2XH2 A;  3DJJ A;  2C73 A;  2C67 A;  3UP4 A;  2X8H A;  3FXG A;  1MDL A;  4IA6 A;  2O9Z A;  3VRA A;  3AMZ A;  4Z2U A;  4EM3 A;  4USQ A;  3R11 A;  2R46 A;  3MUC A;  5JCK A;  1FOH A;  2A89 A;  2WEU A;  4KWS A;  3NHO X;  1MDR A;  1TDN A;  1MNS A;  2AAQ A;  2FBW A;  1GND A;  3SX6 A;  5GRT A;  4PAB A;  1E1K A;  2AL2 B;  4Z26 A;  4A7A A;  1XAN A;  1NAA A;  3FCP A;  2YG7 A;  1ZXI C;  3AEC A;  3UTG A;  4EQX A;  2GAG B;  2YM2 A;  2W3R A;  2XVE A;  4BJY A;  4LII A;  2AQJ A;  4H2R A;  1TRB A;  3QFB A;  3DGH A;  2BAB A;  2XLS A;  4YWS A;  4JY2 A;  4ZOH B;  4JY3 A;  1D4D A;  4DGK A;  3KVE A;  4O5U A;  1N63 C;  4H83 A;  1GAL A;  3GC2 A;  4A5L A;  3B6D A;  1FEC A;  2FJA A;  2A87 A;  2BAC A;  2ONE A;  2BK3 A;  1GRG A;  2B76 A;  4HB9 A;  4YKG A;  3GMB A;  4FDC B;  2TMD A;  2QJM A;  4GIR A;  4YSZ A;  4TM1 A;  1TYT A;  5C3J A;  3JW7 A;  4K2S A;  4DHG A;  3OW1 A;  1IUS A;  3DER A;  3LAD A;  2OX4 A;  1FL2 A;  5KMR A;  4HNL A;  1N61 C;  3TOY A;  3IJL A;  1N62 C;  4H4V A;  2GEW A;  4GAP A;  3CNS A;  5KVI A;  5BOE A;  3EEZ A;  5IPY A;  1FCD A;  3ETR B;  2PP0 A;  4BK2 A;  4WX1 A;  2PTW A;  3LXD A;  1XPY A;  3F8D A;  3D46 A;  4K7Z A;  2XVH A;  3AE2 A;  2YVG A;  5CQF A;  1F9C A;  1VG9 A;  5DBJ A;  3SN4 A;  3FYY A;  3ISH A;  1COY A;  4C3X A;  4F4R A;  3V3W A;  3H12 A;  1ZMD A;  2POD A;  5U25 A;  1EC7 A;  5CKU A;  3NZG A;  1REO A;  4G74 A;  2WQY A;  2GGE A;  3QPE A;  2CHR A;  1JEH A;  3ALL A;  2YLZ A;  3AM9 A;  3COX A;  4M0X A;  4YKF A;  3AD8 B;  5G5G B;  1BKH A;  4H2P A;  2BA9 A;  3LJP A;  3NRN A;  3VA8 A;  3CB3 A;  1NEN A;  1DOC A;  1E39 A;  4IA5 A;  1B37 A;  3T4W A;  3DK8 A;  1H7X A;  1JNZ A;  4G9K A;  1PDZ A;  1JCT A;  3CTY A;  2W0H A;  1EC8 A;  2QA1 A;  1GRB A;  3U9I A;  1YQ3 A;  3UJS A;  3ZLF A;  3EPT A;  2IVE A;  1GOS A;  3UP5 A;  3AE3 A;  1D4C A;  4MKS A;  4GGH A;  1SJD A;  5FMH A;  3PO7 A;  3QSS A;  3GRT A;  2JB3 A;  2YLX A;  1GES A;  3TTE A;  2OZ3 A;  1IYX A;  2PCE A;  3AYI A;  1H2I A;  4U8I A;  1OJD A;  4D03 A;  1DOB A;  3RR1 A;  3UKF A;  2ZBW A;  2XCG A;  3A7R A;  4K5S A;  2WOV A;  4BK1 A;  4B67 A;  2WOW A;  5KWF A;  2WPF A;  2PGE A;  3NFU A;  2XVF A;  4JN9 A;  3FJ4 A;  4NTE A;  3HRD C;  3DG6 A;  2QCU A;  3ALM A;  3IHG A;  4Y4M A;  4OPI A;  4KT2 A;  1XS2 A;  2PSN A;  3GY1 A;  1JU2 A;  2PGW A;  3FIM B;  1PDH A;  4J1O A;  4EWJ A;  3AED A;  2ARD A;  1KNR A;  2CUL A;  2HXT A;  1T3Q C;  3QSE A;  1GET A;  2EQ6 A;  2GMH A;  4OPL A;  1F8W A;  5TR3 A;  1L0V A;  4RG4 A;  2BS4 A;  1E1N A;  3G5R A;  3PVC A;  1F8S A;  3K7T A;  2R9Z A;  4A35 A;  2GH5 A;  3SQP A;  4J34 A;  1BF3 A;  1LVL A;  2BXS A;  1IUT A;  1GTH A;  5EOW A;  3Q4D A;  3RED A;  3UXL A;  1KSS A;  3WE0 A;  3OZM A;  4KPL A;  4DNA A;  1ONF A;  1MRA A;  3ICR A;  1PXC A;  4USR A;  4K8D A;  3JVA A;  2OLO A;  3AE7 A;  3N6J A;  4Z1Y A;  3GYX A;  2PP3 A;  4GIS A;  3IJQ A;  2BC0 A;  3SFD A;  2JK6 A;  1ZDL A;  1X31 B;  1FEB A;  1MUC A;  3NK2 X;  2PMQ A;  4GR1 A;  3H70 A;  5FS7 A;  3UJR A;  4MMW A;  3H7V A;  3AEB A;  3CMM A;  4C77 A;  3AE9 A;  1IUX A;  3AE6 A;  2V5Z A;  3NGC X;  4H19 A;  3TJ4 A;  1TDK A;  2C72 A;  3SYI A;  3TWB A;  2R4J A;  6ENL A;  1CJ2 A;  2GR2 A;  1FHU A;  2PA6 A;  2XSX A;  2QDE A;  3AEG A;  2AL2 A;  1QJD A;  1R6W A;  4H2H A;  4NEV A;  1PDY A;  2WOI A;  3NN0 X;  4U8L A;  2GR3 A;  3VR8 A;  4GUV A;  2XVI A;  4AT2 A;  1VQW A;  4B69 A;  4YSX A;  4U8J A;  4TLX A;  2Y6R A;  4RSL A;  4II2 A;  2C66 A;  3VQR A;  4I59 A;  3QKE A;  3II4 A;  2JBV A;  1S2Q A;  3UKP A;  4FI4 A;  1HYU A;  4X2P A;  2X99 A;  1IJH A;  4H4Q A;  3SZF A;  1X2H A;  2HZG A;  3UTE A;  3SN1 A;  1CJC A;  4YXD A;  3N4E A;  4BK3 A;  1ZK7 A;  3UJ2 A;  1FFV C;  2OLN A;  4D04 A;  5FJO A;  2H88 A;  5FJU A;  1Y56 A;  4MGG A;  3AXB A;  2F5Z A;  4XWZ A;  1CL0 A;  2WES A;  4C74 A;  3ALJ A;  3VDG A;  3AYJ A;  1TDO A;  4AP3 A;  3DFH A;  4LU6 A;  4A6N A;  3NYF A;  2PHH A;  3P9U A;  3PK7 A;  4GDE A;  3R9U A;  3GD3 A;  2BCG G;  4A6N B;  2RGO A;  4OPG A;  4TM4 A;  3OTR A;  1SB3 B;  2OVL A;  3CT2 A;  5J7X A;  3KA7 A;  1N1P A;  2XYO A;  1IUU A;  1YEY A;  2POZ A;  2OLA A;  3ATR A;  4ROP A;  3CGD A;  1OJT A;  3IK4 A;  3CAW A;  3S5S A;  1SJC A;  2NQL A;  3NLC A;  3CYJ A;  1PBE A;  3BNU A;  2OA1 A;  1FIQ B;  2BRY A;  2C65 A;  3IHM A;  1Q1W A;  3C4A A;  1EBD A;  3BHF A;  4IVM B;  1DTN A;  4HNC A;  5BUL A;  2QGY A;  1RP0 A;  1BZL A;  1D7L A;  3UOY A;  4H4P A;  2FJD A;  2I5Q A;  1ZMC A;  3AE1 A;  3CND A;  7ENL A;  1RM6 B;  5BOF A;  4J31 A;  3GO2 A;  3HW2 A;  1VQZ A;  3OPS A;  3OC4 A;  1K0I A;  3GD4 A;  4JHM A;  2AL1 A;  1B8S A;  3V4B A;  2YVF A;  4G73 A;  4II3 A;  1UKV G;  4BJZ A;  4ZA0 A;  3RCY A;  1MO9 A;  3NNE A;  4FX9 A;  3H8A A;  4YTM A;  2XFN A;  3ZVH B;  3QFA A;  3I6T A;  4U8O A;  4DXK A;  3BHK A;  1E9I A;  3NVW B;  2BS3 A;  1NG4 A;  4H4Y A;  2WDQ A;  1CC6 A;  3T31 A;  2QDD A;  4M52 A;  1BWC A;  2PTX A;  4REK A;  2QJN A;  4NNJ A;  2C70 A;  3AEE A;  1JNR A;  4EM4 A;  4H50 A;  1TDF A;  3SZ0 A;  1JRO A;  4GYP A;  2B9X A;  4A65 A;  3R25 A;  4HN8 A;  1PBC A;  4IZG A;  3HZL A;  1D4E A;  1JPM A;  5U1O A;  3UTF A;  3VFC A;  4A9W A;  3P4P A;  2E3T A;  3IF9 A;  1TZZ A;  3VRB A;  3UTH A;  1PXA A;  1NEL A;  3JZU A;  4A99 A;  2YM1 A;  1BGN A;  3KUM A;  1VDV A;  1LPF A;  2DKI A;  2AKM A;  2VRL A;  3UJF A;  4IHC A;  2RGH A;  3AB1 A;  1ZOY A;  4B68 A;  1R0M A;  5J04 A;  3HYX A;  4G7F A;  5EU9 A;  2W54 A;  3D47 A;  2QAE A;  4EQR A;  2AR8 A;  4IP4 A;  2X50 A;  4DYE A;  3NIX A;  4TVY A;  3QN3 A;  3SN0 A;  4E4F A;  1LTX R;  5BRT A;  2YLT A;  1AOG A;  2B9W A;  1CF3 A;  4YT0 A;  2V61 A;  1S3E A;  3AN1 A;  4IP5 A;  4GRT A;  1P43 A;  3PS9 A;  2GRT A;  1P48 A;  2XH0 A;  2C64 A;  1JRX A;  4U2L A;  2PP1 A;  2VVL A;  2C3D A;  3NVZ B;  2YG4 A;  4Z24 A;  3RP6 A;  2ACZ A;  2H89 A;  3GWD A;  1H81 A;  2R0P A;  1IUV A;  2O56 A;  1DJN A;  3UKL A;  4TLZ A;  2BRA A;  3AE8 A;  3NK1 X;  3QTP A;  1BGJ A;  1KF6 A;  1OJC A;  3RRA A;  2QA2 A;  1K0J A;  3T9P A;  2YWL A;  4EIQ A;  2R4E A;  3DG7 A;  2GAH B;  3H8I A;  3B9J B;  2TPR A;  3Q45 A;  3VRD B;  2GDQ A;  3D8X A;  1DOD A;  3OP2 A;  3CGE A;  3NYE A;  4B66 A;  3UOX A;  4PAA A;  1XHC A;  2GQF A;  1X2G A;  3PG6 A;  3TJI A;  2PTZ A;  3GDP A;  1NHP A;  1CHU A;  1ZKQ A;  4IV9 A;  4CY6 A;  1DNC A;  3VC6 A;  1GRT A;  2RGJ A;  4NTD A;  1B5Q A;  3E1T A;  3I3L A;  3P4R A;  4DSG A;  3F8P A;  3CXO A;  2R0G A;  5BVA A;  1CBO A;  3C96 A;  3QJ4 A;  2HQM A;  5JCN A;  2WET A;  2IVD A;  1DXL A;  3DA1 A;  3NVY B;  1JRZ A;  2VOU A;  2PU1 A;  3HPF A;  1L9D A;  1E6E A;  2W55 A;  4B64 A;  4ENL A;  2C3C A;  3SXI A;  3U4F A;  4N9X A;  4Y4N A;  4EQW A;  1DOE A;  3AD9 B;  4I58 A;  4H4S A;  2PYX A;  4HYR A;  4OPU A;  1PJ6 A;  1GT8 A;  2RAB A;  3UKK A;  3R0U A;  2P88 A;  5KNL A;  5FJT A;  3H4K A;  3ZLG A;  3GYI A;  4Z17 A;  4GDP A;  2HXU A;  3LB8 A;  5JCM A;  3SZC A;  3NXL A;  3STP A;  2GGG A;  3P4S A;  3UCC A;  1NPX A;  1GRF A;  2DW6 A;  4XWR A;  4JQ9 A;  3P93 A;  1N4U A;  5IQ1 A;  3FBS A;  4P9S A;  5G5H B;  3SGL A;  3UOV A;  3JSK A;  4YTN A;  3URH A;  2GGI A;  2WP5 A;  3K7Q X;  2ZZ0 A;  1EBH A;  4KEM A;  1EL5 A;  1NEK A;  3SQS A;  5KRQ A;  4H2N A;  3UGV A;  4TM0 A;  2XLU A;  4B63 A;  2OG9 A;  3IWA A;  3UCL A;  3LZW A;  2OFJ A;  4NTC A;  3V3N A;  4E4U A;  4IT1 A;  1JPD X;  1MXT A;  2XH4 A;  2GVC A;  1EL7 A;  3BI5 A;  5FS8 A;  4JN8 A;  3TQP A;  3UOZ A;  1H86 A;  1JDF A;  4J36 A;  3NG7 X;  2PS2 A;  3PWG A;  4HCL A;  3R1Z A;  3F8R A;  4J33 A;  3NKS A;  3VCC A;  4FK1 A;  1D7Y A;  2I0Z A;  5KVH A;  2BS2 A;  3EKG A;  2XGZ A;  1N5X A;  4CRT A;  2MNR A;  1H82 A;  1M64 A;  1F6M A;  4UDR A;  5L46 A;  3D9X A;  1L8P A;  3RO6 A;  3T2K A;  3T14 A;  2PPG A;  2YLW A;  4G6G A;  3VR9 A;  2VVL G;  1IUW A;  4ZCD A;  3SFE A;  5KOX A;  3A7A A;  2GR0 A;  3IC9 A;  3RP7 A;  1PHH A;  3ES7 A;  2EQ7 A;  3DG3 A;  5IQ4 A;  2C75 A;  2EQ8 A;  3ES8 A;  1KFY A;  3DGB A;  1E7P A;  3DIP A;  3A7U A;  3KU9 A;  1V59 A;  3CNT A;  4AT0 A;  4NZH A;  2R0C A;  4KPR A;  1VG0 A;  2DW7 A;  3KPK A;  2WU5 A;  3ZVH A;  1KDG A;  4K22 A;  5JCL A;  3RP8 A;  2GGH A;  2GR1 A;  3ITJ A;  5U63 A;  3R10 A;  5BUK A;  2NPX A;  3K30 A;  2B7R A;  4H4W A;  4J56 A;  4ADW A;  2JB1 A;  4K5R A;  3V5F A;  1E1L A;  5C2T A;  4Z25 A;  3AYL A;  3ADA B;  5IDZ A;  2P8B A;  3NS1 B;  1KKR A;  3ABV A;  3BJS A;  4EMJ A;  3ICS A;  4GGB A;  3MKC A;  3I6D A;  4HPN A;  5ENL A;  4YTP A;  1ECQ A;  3EUB 3;  1NHR A;  2OQH A;  3CGB A;  2BC1 A;  2OPJ A;  2ZZB A;  4ECH A;  1NHQ A;  3NTA A;  1GXF A;  4U2S A;  2APG A;  4ZCC A;  1O95 A;  3KKJ A;  1Z6L A;  3AEF A;  2C7G A;  3PFR A;  3L1R A;  3CNJ A;  3H8L A;  1SJB A;  4YWO A;  4FP1 A;  2W3S A;  3OZY A;  1Y0P A;  3B97 A;  1FEA A;  4H4R A;  5HYM A;  1YKJ A;  1H83 A;  2YVJ A;  3DGZ A;  1CJ4 A;  4TM3 A;  1OJA A;  1P2H A;  3P4Q A;  4LA1 A;  3M13 A;  1N4W A;  4UDP A;  3GMC A;  3RGT A;  2FYM A;  1W4X A;  3D1C A;  1KKO A;  2Z5Y A;  4AP1 A;  4H4X A;  2VQB A;  1FO4 A;  3L8K A;  2R45 A;  4UDQ A;  3N6H A;  1PBB A;  2WPE A;  3SBF A;  2XLP A;  2CFY A;  2QVH A;  3G5Q A;  4ZCW A;  2V6O A;  1K0L A;  3DME A;  5GSN A;  4IL0 A;  2BK4 A;  2OAM A;  2YLS A;  3P0W A;  3FV9 A;  1JRP A;  3TWA A;  3ZLH A;  1GRE A;  1QO8 A;  1PN0 A;  4HCH A;  2GV8 A;  3DJG X;  3S5W A;  1GRH A;  3Q6J A;  1XDI A;  4E6M A;  1KNP A;  3K1G A;  3ZVI A;  4X9N A;  1ELS A;  3KD9 A;  2XH7 A;  1F3P A;  3L5O A;  3AE5 A;  4DX3 A;  1GTE A;  1LQT A;  4B65 A;  1WUE A;  2WDR A;  4IL2 A;  1JOA A;  5J60 A;  3BI2 A;  4JN7 A;  1E1M A;  4GAV A;  4Z44 A;  3NVV B;  3CPH G;  1VRQ B;  1OEP A;  4EIP A;  4GYP C;  3ICT A;  2IID A;  1ONE A;  4U8K A;  2B9Y A;  3AWI A;  3I6E A;  1K4Q A;  5M10 A;  5KMS A;  1V97 A;  1H7W A;  3CNP A;  2MUC A;  3UKA A;  3MWC A;  3SM8 A;  4CY8 A;  5FS9 A;  5FS6 A;  4J2W A;  5KXJ A;  4U8M A;  1Q1R A;  3T0K A;  4CCQ A;  1Y56 B;  1D5T A;  4G6H A;  2X3N A;  1PJ7 A;  1NDA A;  4YSY A;  3DH9 A;  2ZAD A;  3V5C A;  2YG5 A;  1YQ4 A;  2E5A A;  2JKC A;  2QJJ A;  4E8G A;  4OPD A;  3SJN A;  3G5S A;  3OZ2 A;  2WP9 A;  3MY9 A;  3FMW A;  4HA6 A;  4Z43 A;  3EF6 A;  1GPE A;  3HYW A;  2GF3 A;  2VZ2 A;  1KN0 A;  3IJI A;  2YG3 A;  5HXI A;  5JCI A;  3HYV A;  1L9C A;  1S7M A;  4IVO B;  1EL9 A;  4X4J A;  3UXK A;  3QVP A;  4A79 A;  3K7M X;  2HNE A;  3I4K A;  3ENL A;  1EC9 A;  1N5W C;  1EL8 A;  2WPC A;  3FPZ A;  4J57 A;  3CPI G;  4A6G A;  3NK0 X;  4H7U A;  4J3Z A;  1TKK A;  1BKW A;  1TE6 A;  2EQ9 A;  3SZW A;  3AD7 B;  3NN6 X;  3FG2 P;  4ZN0 A;  3VCN A;  3FVD A;  2AKZ A;  3CPJ G;  4G8T A;  3GDN A;  2QQ6 A;  4XXG A;  2X8G A;  3NRZ B;  2UZZ A;  2Q0L A;  1PXB A;  2C76 A;  3UKH A;  4K2X A;  2VVM A;  3DK9 A;  2WBA A;  2OAL A;  4C5O A;  2GL5 A;  4OVI A;  4CBQ A;  3B3R A;  2VRM A;  3SSZ A;  4AOS A;  2FJB A;  1N4V A;  4JNA A;  2CVJ A;  2PU0 A;  3ZDN A;  3UKQ A;  1F8R A;  2BYB A;  4YSH A;  2CDU A;  1QLB A;  2XDO A;  3BI4 A;  3NYC A;  3P3B A;  3QLD A;  3CK5 A;  1ZX9 A;  5EB4 A;  5EBK A;  4U8P A;  3RIT A;  1GEU A;  2Q0K A;  2V60 A;  4HCD A;  3GWF A;  2XFP A;  3T8Q A;  2YG6 A;  1NHS A;  2FKP A;  1ELI A;  2E4G A;  3QVR A;  4DWD A;  4DN1 A;  2OZT A;  3R07 C;  5FJR A;  3VC5 A;  2WP6 A;  2ZZC A;  4GCM A;  2WU2 A;  3EAN A;  1WYG A;  2XFU A;  1TDE A;  1GRA A;  3THU A;  3DJD A;  4EMI A;  3QSM A;  2P0I A;  1ZP0 A;  1XPQ A;  2BXR A;  4K1W A;  3DFY A;  1RYI A;  2YR6 A;  3LOV A;  5FJP A;  2YLR A;  3RNM A;  4EQS A;  1PJ5 A;  4BUR A;  1YQZ A;  4H4U A;  3ATQ A;  1KSU A;  4CNJ A;  2XVJ A;  4DSH A;  4TVW A;  1GSN A;  4H4T A;  3TCS A;  1RSG A;  2XLR A;  2V3B A;  4A3R A;  1M6I A;  4NWZ A;  3O0H A;  4BV6 A;  4H4Z A;  2J3N A;  1BQG A;  3KLJ A;  3S61 A;  1LQU A;  3GYJ A;  4Y4L A;  3BSM A;  1KD0 A;  3V76 A;  3DDM A;  3GRS A;  3SR6 B;  3T2Z A;  1Q9I A;  2Q7V A;  1JRY A; 
#chains in the Genus database with same CATH homology
 3VRB A;  1JNZ A;  4G9K A;  1PXA A;  3UTH A;  3CNJ A;  4RG3 A;  3H8L A;  4YWO A;  4A99 A;  2YM1 A;  1BGN A;  5M0Z A;  1Y0P A;  1LJ1 A;  1FEA A;  4H4R A;  5HYM A;  1YKJ A;  3CTY A;  4E0V A;  4GF7 A;  2W0H A;  1LPF A;  1H83 A;  2DKI A;  2BCP A;  4X9M A;  3RHA A;  2QA1 A;  2VRL A;  1GRB A;  2Y6Q A;  2YR4 A;  2YVJ A;  3DGZ A;  1CJ4 A;  1YQ3 A;  4TM3 A;  2NVK X;  1OJA A;  1P2H A;  2RGH A;  3AB1 A;  3EPT A;  3P4Q A;  1ZOY A;  4LA1 A;  4B68 A;  1VDC A;  2IVE A;  1GOS A;  3M13 A;  3UP5 A;  1YY5 A;  3AE3 A;  1SEZ A;  1D4C A;  4MJW A;  4CCR A;  3HYX A;  5FMH A;  2WS3 A;  3PO7 A;  3QSS A;  3GRT A;  2DKH A;  1N4W A;  4UDP A;  3GMC A;  2YAU A;  1P2E A;  1W4X A;  3D1C A;  1O94 A;  2JB3 A;  2QAE A;  2Z5Y A;  4EQR A;  2AR8 A;  4H4X A;  2VQB A;  2YLX A;  1GES A;  4AP1 A;  1ZY8 A;  5KMP A;  2X50 A;  3L8K A;  2R45 A;  4OPC A;  3NIX A;  3AYI A;  4UDQ A;  1H2I A;  4U8I A;  2FJE A;  1OJD A;  2GMJ A;  1DJQ A;  4D03 A;  4NEW A;  1DOB A;  1LTX R;  1PBB A;  5BRT A;  3UKF A;  2WPE A;  2YLT A;  1AOG A;  2B9W A;  1H6V A;  3AEA A;  2ZBW A;  2XCG A;  2GQW A;  2XLP A;  3NT6 A;  2CFY A;  3V3O A;  1CF3 A;  4YT0 A;  2V61 A;  2YR5 A;  3BNM A;  3G5Q A;  1S3E A;  3LZX A;  4K5S A;  2WOV A;  4BK1 A;  2V6O A;  1PBF A;  4B67 A;  4GRT A;  2WOW A;  5KWF A;  3PS9 A;  5KOW A;  1S3B A;  2GRT A;  2WPF A;  3GSI A;  1K0L A;  4FK1 C;  2XVF A;  3DME A;  4JN9 A;  1MOK A;  5GSN A;  2BK4 A;  2YLS A;  2OAM A;  1PBD A;  4NTE A;  1S2Y A;  2VQ7 A;  3T37 A;  2C64 A;  2QCU A;  3ALM A;  3IHG A;  4Y4M A;  1JRX A;  4U2L A;  2VVL A;  2C3D A;  1GRE A;  1TYP A;  2E1M A;  2YG4 A;  4Z2T A;  1QO8 A;  4OPI A;  4Z24 A;  1PN0 A;  3RP6 A;  2ACZ A;  2GV8 A;  2H89 A;  3GWD A;  3DJG X;  1CC2 A;  3S5W A;  1GRH A;  3Q6J A;  1XDI A;  3P1W A;  1H81 A;  2R0P A;  1KNP A;  1IUV A;  4OPT A;  1JU2 A;  1CJ3 A;  3FIM B;  1DJN A;  1PDH A;  1ZOV A;  3UKL A;  4X9N A;  3AE4 A;  3KD9 A;  2YQU A;  4TLZ A;  3EAO A;  3C4N A;  3AED A;  1F3P A;  1KNR A;  2ARD A;  2CUL A;  4WCT A;  3L5O A;  3AE5 A;  2BRA A;  3AE8 A;  3QSE A;  5ER0 A;  1GTE A;  1GET A;  2EQ6 A;  1LV0 A;  1OJC A;  1LQT A;  1BGJ A;  1KF6 A;  2WDR A;  3NK1 X;  4B65 A;  2BK5 A;  2GMH A;  1JOA A;  3CIR A;  4OPL A;  5HY5 A;  1F8W A;  2QA2 A;  4Z2R A;  5J60 A;  3BI2 A;  5TR3 A;  1E1M A;  1K0J A;  4GAV A;  2BS4 A;  2YWL A;  4RG4 A;  2R4E A;  4Z44 A;  5KMQ A;  4EIQ A;  1E1N A;  4AOX A;  3CPH G;  1VRQ B;  3G5R A;  2GAH B;  1F8S A;  3PVC A;  3H8I A;  2XFO A;  1H84 A;  2TPR A;  3K7T A;  4EIP A;  2WHD A;  2JB2 A;  2R9Z A;  3VRD B;  3ICT A;  2IID A;  3M0O A;  3D8X A;  4U8K A;  1DOD A;  2B9Y A;  2GH5 A;  3AWI A;  3CGE A;  3SQP A;  4J34 A;  1BF3 A;  1LVL A;  2BXS A;  1IUT A;  1GTH A;  3NYE A;  4B66 A;  1K4Q A;  5EOW A;  3Q9T A;  5M10 A;  3UOX A;  2Z5X A;  4PAA A;  1XHC A;  3CN8 A;  2Q6U A;  3RED A;  5KMS A;  2GQF A;  1H7W A;  3PG6 A;  3KPF A;  1KSS A;  3T2Y A;  3WE0 A;  3CNP A;  3GDP A;  1NHP A;  3CGC A;  1CHU A;  1ZKQ A;  2JAE A;  4IV9 A;  4DNA A;  3SM8 A;  3UKA A;  2A8X A;  4CNK A;  5FS9 A;  5FS6 A;  3DJE A;  4J2W A;  4CY8 A;  4CY6 A;  1DNC A;  4U2T A;  5KXJ A;  4U8M A;  1GRT A;  1L9E A;  1ONF A;  2RGJ A;  1Q1R A;  3ICR A;  4OCG A;  4U8N A;  4NTD A;  1PXC A;  4USR A;  1B5Q A;  3T0K A;  4K8D A;  4JDR A;  4CCQ A;  3E1T A;  1Y56 B;  1D5T A;  2OLO A;  3M12 A;  3AE7 A;  4UP3 A;  4G6H A;  2X3N A;  3I3L A;  1PJ7 A;  1NDA A;  3P4R A;  4DSG A;  3GYX A;  4YSY A;  3DH9 A;  3F8P A;  2YG5 A;  2XLT A;  2R0G A;  3NH3 X;  1YQ4 A;  5LV9 A;  2JKC A;  1OJ9 A;  5BVA A;  1CBO A;  2GB0 A;  3SY4 A;  5JRB A;  4JNQ A;  2BC0 A;  3C96 A;  3QJ4 A;  2JK6 A;  3SFD A;  2HQM A;  2WDV A;  5JCN A;  1ZDL A;  2WET A;  5HHF A;  2IVD A;  1DXL A;  3DA1 A;  1X31 B;  1JRZ A;  4OPD A;  4O5Q A;  2VOU A;  1FEB A;  3NK2 X;  4GR1 A;  2E5V A;  1B4V A;  2XFQ A;  5FS7 A;  1NG3 A;  3G5S A;  4EMW A;  1CC4 A;  3OZ2 A;  2WP9 A;  1L9D A;  1E6E A;  3AEB A;  3CMM A;  5EB5 A;  4B64 A;  3FMW A;  4HA6 A;  4C77 A;  2C3C A;  1IUX A;  3AE9 A;  3AE6 A;  3SXI A;  4Z43 A;  2V5Z A;  3NGC X;  3EF6 A;  3IF9 A;  4N9X A;  1GPE A;  3ZYX A;  3HYW A;  4APN A;  1TDK A;  2C4C A;  2GF3 A;  2VZ2 A;  1KN0 A;  4EQW A;  2C72 A;  1DOE A;  3AD9 B;  1O5W A;  4I58 A;  4Y4N A;  1GV4 A;  2YG3 A;  5HXI A;  3SYI A;  4H4S A;  2R4J A;  5JCI A;  2V3A A;  2PYX A;  3HYV A;  1L9C A;  1S7M A;  1CJ2 A;  4IVO B;  4OPU A;  2GR2 A;  3DK4 A;  1PJ6 A;  2B7S A;  1EL9 A;  4X4J A;  1GER A;  3AEG A;  1GT8 A;  1QJD A;  3QVP A;  2RAB A;  4NEV A;  3UKK A;  4A79 A;  3K7M X;  4ICY A;  4B1B A;  2WOI A;  3NN0 X;  4U8L A;  2GR3 A;  2X8C A;  4KX6 A;  5KNL A;  3VR8 A;  3H4K A;  3GYI A;  4GUV A;  3NTD A;  4GDP A;  3LB8 A;  2XVI A;  5JCM A;  4AT2 A;  1VQW A;  1EL8 A;  2WPC A;  4H2Q A;  4B69 A;  1PS9 A;  4YSX A;  3FPZ A;  4J57 A;  4U8J A;  3CPI G;  4TLX A;  3NK0 X;  4H7U A;  2Y6R A;  4RSL A;  1BKW A;  3SZC A;  4II2 A;  1L0V A;  2EQ9 A;  3SZW A;  2C66 A;  3AD7 B;  3NN6 X;  3P4S A;  3DJJ A;  2C73 A;  3VQR A;  2C67 A;  1NPX A;  3UP4 A;  2X8H A;  4I59 A;  3FG2 P;  1GRF A;  3II4 A;  4XWR A;  4JQ9 A;  2JBV A;  4ZN0 A;  1S2Q A;  1N4U A;  4IA6 A;  5IQ1 A;  3UKP A;  3FBS A;  2O9Z A;  3VRA A;  4P9S A;  1HYU A;  4Z2U A;  2X99 A;  3SGL A;  1IJH A;  4H4Q A;  3UOV A;  3CPJ G;  4EM3 A;  4USQ A;  3SZF A;  3JSK A;  3UTE A;  2R46 A;  1CJC A;  4YTN A;  4YXD A;  3GDN A;  3URH A;  4BK3 A;  1ZK7 A;  5JCK A;  1FOH A;  2OLN A;  2A89 A;  2WEU A;  4XXG A;  3NHO X;  4D04 A;  2WP5 A;  2H88 A;  2ZZ0 A;  1TDN A;  3K7Q X;  1EL5 A;  1NEK A;  2X8G A;  2UZZ A;  2AAQ A;  2FBW A;  1Y56 A;  1GND A;  2Q0L A;  1PXB A;  3SX6 A;  2C76 A;  3AXB A;  5KRQ A;  2F5Z A;  4H2N A;  4XWZ A;  5GRT A;  3UKH A;  4K2X A;  1CL0 A;  2WES A;  2XLU A;  2VVM A;  4TM0 A;  3ALJ A;  4C74 A;  3AYJ A;  4PAB A;  1E1K A;  4B63 A;  3DK9 A;  2WBA A;  3IWA A;  3UCL A;  2OAL A;  3LZW A;  4NTC A;  3V3N A;  4Z26 A;  1TDO A;  4A7A A;  1XAN A;  4LU6 A;  4A6N A;  4AP3 A;  4C5O A;  4OVI A;  4CBQ A;  3B3R A;  2VRM A;  1MXT A;  1NAA A;  3NYF A;  2YG7 A;  2GVC A;  2PHH A;  3AEC A;  3P9U A;  4GDE A;  3R9U A;  4EQX A;  3GD3 A;  2GAG B;  2YM2 A;  3UTG A;  4AOS A;  2FJB A;  1EL7 A;  3BI5 A;  1N4V A;  4JNA A;  2CVJ A;  5FS8 A;  2XVE A;  2BCG G;  4A6N B;  2RGO A;  3ZDN A;  4OPG A;  4TM4 A;  4BJY A;  4C3Y A;  3UKQ A;  1F8R A;  4LII A;  3UOZ A;  1H86 A;  2AQJ A;  2BYB A;  4J36 A;  3NG7 X;  5J7X A;  4YSH A;  2CDU A;  1QLB A;  3KA7 A;  1N1P A;  2XDO A;  4H2R A;  1TRB A;  2XYO A;  3QFB A;  1IUU A;  3F8R A;  3DGH A;  3BI4 A;  4J33 A;  3NKS A;  4FK1 A;  3NYC A;  2BAB A;  1D7Y A;  2I0Z A;  3ATR A;  3CGD A;  5KVH A;  1OJT A;  2BS2 A;  2XLS A;  1ZX9 A;  5EB4 A;  5EBK A;  4U8P A;  4JY2 A;  1GEU A;  2Q0K A;  4CRT A;  4JY3 A;  1D4D A;  4DGK A;  1H82 A;  2V60 A;  3KVE A;  4O5U A;  1M64 A;  1F6M A;  4UDR A;  3GWF A;  5L46 A;  3D9X A;  2XFP A;  3NLC A;  1GAL A;  2YG6 A;  1NHS A;  1ELI A;  2E4G A;  3T2K A;  1PBE A;  4A5L A;  3BNU A;  3T14 A;  2OA1 A;  3QVR A;  3B6D A;  1FEC A;  2YLW A;  2BRY A;  2C65 A;  3IHM A;  1Q1W A;  4G6G A;  2FJA A;  1EBD A;  3BHF A;  2A87 A;  3C4A A;  3VR9 A;  2VVL G;  2BAC A;  1IUW A;  4IVM B;  2BK3 A;  4ZCD A;  3SFE A;  1GRG A;  2B76 A;  5KOX A;  4HB9 A;  5BUL A;  2GR0 A;  4YKG A;  3GMB A;  4FDC B;  1RP0 A;  3IC9 A;  2TMD A;  3RP7 A;  1BZL A;  1D7L A;  3UOY A;  4H4P A;  1PHH A;  2FJD A;  2EQ7 A;  4YSZ A;  4TM1 A;  1TYT A;  1ZMC A;  2WP6 A;  2EQ8 A;  2C75 A;  3AE1 A;  5C3J A;  3CND A;  5IQ4 A;  1KFY A;  2ZZC A;  4GCM A;  1E7P A;  2WU2 A;  3KU9 A;  1V59 A;  4J31 A;  1IUS A;  3EAN A;  3CNT A;  3LAD A;  3OC4 A;  1K0I A;  4AT0 A;  3GD4 A;  2XFU A;  4NZH A;  1TDE A;  1GRA A;  3DJD A;  4EMI A;  3QSM A;  1B8S A;  1FL2 A;  2R0C A;  5KMR A;  2YVF A;  4KPR A;  1ZP0 A;  1VG0 A;  4G73 A;  3KPK A;  2WU5 A;  4II3 A;  1UKV G;  1XPQ A;  2BXR A;  4BJZ A;  4H4V A;  1KDG A;  2GEW A;  4GAP A;  3CNS A;  4K22 A;  5KVI A;  5JCL A;  1MO9 A;  3RP8 A;  5IPY A;  2GR1 A;  3ITJ A;  5U63 A;  1FCD A;  4FX9 A;  3NNE A;  1RYI A;  4BK2 A;  4WX1 A;  3LXD A;  4YTM A;  2XFN A;  2YR6 A;  3LOV A;  3F8D A;  5BUK A;  3QFA A;  2NPX A;  2YLR A;  3RNM A;  4EQS A;  1PJ5 A;  4U8O A;  3K30 A;  4BUR A;  1YQZ A;  4K7Z A;  2B7R A;  3BHK A;  2XVH A;  4H4W A;  4J56 A;  4ADW A;  2BS3 A;  1NG4 A;  4H4Y A;  4H4U A;  2JB1 A;  2WDQ A;  3AE2 A;  1CC6 A;  3ATQ A;  3T31 A;  4M52 A;  1KSU A;  4CNJ A;  4K5R A;  2YVG A;  2XVJ A;  5CQF A;  4DSH A;  1GSN A;  4H4T A;  1E1L A;  1BWC A;  1VG9 A;  5DBJ A;  4Z25 A;  5C2T A;  3AYL A;  4REK A;  1RSG A;  4NNJ A;  3ADA B;  2C70 A;  2XLR A;  3AEE A;  2V3B A;  3ISH A;  1COY A;  1JNR A;  4C3X A;  4EM4 A;  1M6I A;  4H50 A;  4NWZ A;  3O0H A;  4BV6 A;  1TDF A;  3ABV A;  3SZ0 A;  4EMJ A;  3ICS A;  3I6D A;  4H4Z A;  2B9X A;  4YTP A;  4A65 A;  1ZMD A;  5U25 A;  1NHR A;  3CGB A;  5CKU A;  2J3N A;  3KLJ A;  2BC1 A;  1REO A;  1PBC A;  4G74 A;  2ZZB A;  3S61 A;  2WQY A;  4ECH A;  1JEH A;  1NHQ A;  1LQU A;  3GYJ A;  3ALL A;  3NTA A;  2YLZ A;  1GXF A;  4U2S A;  2APG A;  3COX A;  4Y4L A;  4YKF A;  3AD8 B;  4H2P A;  3HZL A;  2BA9 A;  3LJP A;  1D4E A;  3NRN A;  4ZCC A;  1NEN A;  5U1O A;  1DOC A;  1E39 A;  1O95 A;  3GRS A;  3KKJ A;  4IA5 A;  3T2Z A;  3UTF A;  1Z6L A;  3AEF A;  3V76 A;  4A9W A;  1Q9I A;  1B37 A;  3P4P A;  2Q7V A;  2C7G A;  3L1R A;  3DK8 A;  1JRY A;  1H7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...