5FS8A

Crystal structure of the g308e mutant of human apoptosis inducing factor
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
487
structure length
473
Chain Sequence
QDKAPSHVPFLLIGGGTAAFAAASIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGEGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESRASEITIPPDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
publication title Structure/Function Relations in Aifm1 Variants Associated with Neurodegenerative Disorders
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 161
structure length 473
sequence length 487
ec nomenclature ec 1.1.1.-:
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF14721 AIF_C Apoptosis-inducing factor, mitochondrion-associated, C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5fs8A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs8A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5fs8A01
1PN0A 2B9YA 4REKA 5C3JA 2V60A 1N4UA 2BABA 3ALLA 3HZLA 3DJDA 4BJZA 1KF6A 3CNDA 3CPJG 1GTHA 2R46A 3AE8A 1ZOYA 2R0PA 5HY5A 4FK1C 2XVIA 1JNZA 4UDRA 1KNRA 1GRGA 2GAHB 1L9DA 3M13A 1GRFA 2GQWA 3CNTA 1L9EA 3P4PA 1GREA 3PVCA 3BI5A 3OC4A 4CY6A 3FPZA 4J56A 1RYIA 3QSMA 3KKJA 1PHHA 1B8SA 1P2EA 4Z2UA 3UOXA 2YAUA 1RSGA 4X4JA 1ZP0A 2BYBA 4H4XA 2C3DA 1KFYA 2Z5XA 5FS7A 3VRBA 1XDIA 3GMBA 5BRTA 1ZDLA 1Q1RA 3EANA 4WCTA 3UTGA 5KVHA 1GESA 4EM3A 2BK4A 5IQ1A 3CTYA 2Q7VA 2XDOA 4K7ZA 4TM3A 1D4EA 2B9WA 1IUVA 2R0CA 1SEZA 3GYIA 3H4KA 3NG7X 4U8KA 4O5QA 3NTAA 2VVMA 2XVFA 3BHKA 5HHFA 1NHQA 1E1KA 4FX9A 5CQFA 1K0JA 2APGA 1PDHA 2F5ZA 1LV0A 4YTNA 3DJEA 1NG4A 3QJ4A 1NHRA 3R9UA 2V3BA 2WP9A 4TLXA 1JNRA 1EL8A 5KOWA 1DOBA 5JCIA 3F8RA 4B64A 2R9ZA 1CHUA 4H4SA 1BGJA 2YWLA 1GETA 1ZX9A 2AR8A 4K5RA 1ZY8A 3GD3A 2PHHA 2RGHA 1JRYA 2XLSA 3DA1A 5JCLA 2WU2A 3BI2A 2YVJA 3KPFA 3UP5A 4EM4A 1E1MA 3NNEA 5GSNA 1S2QA 1Q9IA 3SFEA 1EL7A 1L9CA 2A8XA 2GV8A 4ZCDA 4OPLA 3LJPA 3FG2P 3CIRA 4Z43A 4DNAA 3ALJA 1ELIA 1YQ4A 1NHPA 5HYMA 3BHFA 4JQ9A 2NVKX 3KU9A 4H50A 2X8CA 2WESA 4X9NA 3AWIA 4EQRA 4J33A 3UP4A 3COXA 3UOZA 1O5WA 1IJHA 2XVJA 3I3LA 3NN0X 3GSIA 3KLJA 5ER0A 3P4RA 4A5LA 3CPHG 4BK1A 4NEWA 1CC6A 3ZYXA 2VOUA 1GERA 2X50A 3SQPA 4U8LA 2BK3A 3AEDA 1CBOA 2YLSA 4J36A 3AB1A 3RP8A 1JOAA 4YTPA 2X99A 2QA2A 4Y4MA 3C4AA 1TDEA 3GRSA 5IQ4A 2JB2A 2BS2A 3LADA 2C66A 4YKGA 1TRBA 1CJ2A 1CF3A 3JSKA 2DKHA 4FK1A 1JRXA 5CKUA 4CRTA 4YSHA 4HA6A 2YVFA 4TM1A 3F8DA 2YM1A 4C3YA 5TR3A 1TDNA 3C4NA 2FJAA 2XFQA 3AYJA 3V3OA 4AP3A 2ARDA 2YG7A 4I58A 4U8PA 1GEUA 4YSZA 3ZDNA 2YR5A 2WOIA 2XVEA 4K22A 3RHAA 1YQ3A 1NPXA 2OALA 3RP7A 3DK8A 5KWFA 1H84A 3URHA 4KPRA 1IUWA 1LTXR 1LPFA 2YG5A 4RG4A 1E6EA 3H8LA 2V61A 4KX6A 2YVGA 3M12A 1F8RA 3NH3X 1PJ5A 1GRAA 3AEFA 4AT0A 3CGBA 2WETA 2V5ZA 2C65A 4YT0A 1PJ7A 4AOSA 4U8NA 3NN6X 1FL2A 3G5SA 1GRBA 3AE5A 3NYEA 1FEAA 4OVIA 3WE0A 4LIIA 2BS3A 2GVCA 3K7TA 1RP0A 4GUVA 3DK4A 1H6VA 5JCKA 1CC4A 2WHDA 3UTFA 3VQRA 4AOXA 3UOYA 1F6MA 1PS9A 4H4QA 1OJAA 4A99A 3FIMB 1EL5A 3PO7A 3V3NA 1XPQA 4EQSA 3DH9A 1H86A 2OLOA 2QCUA 4M52A 4H2PA 4H4YA 1NEKA 4BURA 4APNA 4Z25A 1YKJA 2EQ8A 3O0HA 2AAQA 3GDPA 5EB5A 2CFYA 2YQUA 3P4SA 1FEBA 2V6OA 3NTDA 2X8GA 3C96A 2GR0A 1XANA 1NAAA 2Y6QA 3LZXA 3AYLA 1VDCA 4NTEA 1BF3A 2Q6UA 5KOXA 2BA9A 4GDPA 4H7UA 1IUSA 2C73A 2GB0A 2ZZCA 3ICTA 2YR6A 4A65A 4GCMA 1GT8A 3Q9TA 4D03A 3D8XA 4CBQA 1EBDA 1MOKA 1VG9A 2C75A 3E1TA 4B67A 1E1LA 4LU6A 1TYTA 2BC1A 4U2SA 2IVEA 3II4A 4U8IA 1GXFA 3S5WA 2H88A 3CNSA 2AQJA 2RABA 2ZBWA 2BCPA 2YLWA 4B63A 2YG3A 2XLRA 3AE6A 1COYA 3IWAA 2A87A 3REDA 2JB1A 1QJDA 1IUTA 3NK0X 2EQ7A 2UZZA 2ZZ0A 1ZKQA 3QSEA 4ECHA 2XVHA 3EPTA 3RP6A 4GR1A 4RG3A 3UOVA 1OJCA 1ZMDA 2I0ZA 2JAEA 3NK2X 5JCNA 4B65A 4NZHA 4U8MA 1BKWA 1S2YA 5U1OA 5BULA 3B6DA 1FOHA 3IHGA 4K5SA 4CCRA 3VR9A 2IVDA 2J3NA 3GRTA 3UKAA 4GRTA 1PXBA 2O9ZA 1K0IA 1L0VA 3ATQA 2YLRA 3CNJA 2CVJA 2E5VA 4YWOA 4H2NA 2DKIA 4JDRA 4GF7A 4IA5A 2VVLG 1ZK7A 3DK9A 1D4CA 4A6NA 4LA1A 1TDFA 1FECA 2OA1A 1S3EA 2RGOA 4EIQA 2A89A 4NTCA 4O5UA 3Q6JA 1REOA 3H8IA 1BZLA 3NKSA 2IIDA 4BK2A 2Q0KA 5KRQA 3GDNA 3ICRA 4WX1A 3CN8A 2XLPA 4Y4NA 3UKPA 2YG4A 1OJ9A 2EQ9A 1H83A 3AEAA 2GQFA 3GD4A 4H4UA 4ZCCA 4U8JA 4XWRA 3UKHA 2OLNA 4C3XA 4XWZA 4H4VA 4OPDA 5FS9A 1CJ3A 1PBCA 2Q0LA 1W4XA 4NEVA 4UDQA 3UKFA 3ITJA 3QFAA 4ADWA 1E1NA 3FBSA 3AEEA 3UTEA 1NHSA 2BC0A 5L46A 2R4EA 3ATRA 3LZWA 4YTMA 4A6NB 2C70A 1TYPA 2WS3A 4Y4LA 1GSNA 2E4GA 2ZZBA 4J57A 4A79A 1DODA 2ACZA 4OPUA 3QSSA 2WDVA 1M6IA 4B1BA 2VRMA 4IVOB 2HQMA 2GRTA 3CGCA 2YLTA 4A9WA 3CGDA 1PXAA 1LQUA 5FS6A 2B7RA 1H7XA 1DXLA 1X31B 2XLTA 4HB9A 4IVMB 1K0LA 3AD7B 4U2LA 4U8OA 4Z26A 2E1MA 3SGLA 2GR2A 1AOGA 2QAEA 5BVAA 2JBVA 2WU5A 4TM4A 4H4TA 2VZ2A 3NRNA 5HXIA 2R0GA 4TLZA 5U63A 2W0HA 5FS8A 1O94A 3M0OA 3GMCA 4GDEA 1GRHA 5JCMA 5KXJA 2WPCA 3CNPA 3DJGX 3NYFA 4I59A 2B9XA 3UKKA 4K8DA 4UP3A 1CJ4A 2XFPA 1E39A 3EF6A 3G5RA 2BS4A 2WDQA 1ONFA 1D4DA 3AE9A 1QLBA 4OPIA 1K4QA 5FMHA 3OZ2A 2R45A 2C3CA 3CGEA 2VVLA 3NK1X 2V3AA 4YKFA 1H7WA 4MJWA 4Z2TA 4Z2RA 4OCGA 1F8SA 2C64A 3AXBA 4USQA 2JB3A 3PS9A 4H2RA 4EIPA 1GNDA 3K7QX 4H4RA 3AD8B 4J2WA 4FDCB 1ZMCA 2WPEA 4BV6A 3L1RA 3NYCA 2GF3A 1B4VA 1GALA 1PXCA 3AYIA 4OPTA 1M64A 1GRTA 2NPXA 3SM8A 1TDKA 2YLZA 3L8KA 3UCLA 1NENA 4EQXA 1CJCA 2RGJA 2EQ6A 1EL9A 4E0VA 4D04A 2R4JA 4DSHA 2WDRA 2FJBA 4USRA 1Y0PA 2VQBA 3AE3A 3KD9A 3CPIG 3S61A 1NG3A 1YY5A 4XXGA 1IUUA 1DJQA 2XFUA 5M0ZA 1E7PA 2VRLA 2FBWA 2GR1A 1GV4A 5EOWA 1OJDA 5J7XA 4C5OA 1D5TA 1LQTA 5LV9A 2YLXA 4CY8A 2WEUA 1DNCA 1CL0A 3AD9B 4DGKA 1ZOVA 1PBBA 3AE1A 3IF9A 3KA7A 3RNMA 1D7LA 2XYOA 1DOCA 1KSUA 3ADAB 1B5QA 1CC2A 1N4WA 3AECA 4J31A 4NTDA 4OPGA 2TMDA 1YQZA 3KVEA 3NGCX 2XCGA 1QO8A 4K2XA 4ZN0A 1H81A 4X9MA 3EAOA 4JN9A 1Y56A 3AEBA 3QVPA 5GRTA 1GTEA 1KNPA 1GPEA 2XFNA 1VQWA 1PBFA 2JK6A 2XFOA 1P2HA 1VG0A 4DSGA 4TM0A 1JEHA 3GWDA 4RSLA 4C77A 2CDUA 3DJJA 1TDOA 1PJ6A 1B37A 3B3RA 1PBDA 1N4VA 1MO9A 2GH5A 2C72A 2TPRA 2BXRA 2Y6RA 3FMWA 4IV9A 3V76A 1V59A 2GR3A 2YR4A 2JKCA 3GWFA 1LVLA 2BACA 4PABA 4BJYA 1H82A 2GAGB 2VQ7A 3K7MX 4B68A 2QA1A 1KSSA 3ISHA 3K30A 4JY3A 1XHCA 5U25A 3IC9A 3IHMA 3UTHA 4UDPA 5C2TA 2FJDA 4C74A 2BCGG 4A7AA 3GYJA 1S3BA 2YG6A 3P9UA 3VR8A 4EMJA 2XLUA 2B76A 4YXDA 3T37A 1LJ1A 4YSXA 1BGNA 1Y56B 3ABVA 4Z24A 2WOWA 3G5QA 2BXSA 5IPYA 4AP1A 3LB8A 2H89A 4P9SA 4ICYA 4CCQA 4IA6A 3VRAA 4H2QA 1MXTA 3AEGA 4YSYA 2WOVA 3P4QA 4CNJA 1IUXA 1GOSA 2GMHA 4EQWA 4Z44A 4N9XA 3NT6A 3DGHA 4PAAA 3NLCA 4JNQA 2BK5A 1O95A 3P1WA 2GEWA 5DBJA 4B69A 4JY2A 3NIXA 2X8HA 1D7YA 1VRQB 4JNAA 5J60A 1UKVG 3SFDA 3ICSA 4H4ZA 2C67A 3ALMA 3DGZA 1JU2A 3BNMA 4B66A 1BWCA 2OAMA 3NHOX 3UKLA 1KDGA 2FJEA 4U2TA 2CULA 2WQYA 3BNUA 2Z5YA 5KVIA 1DOEA 4H4WA 1OJTA 2WBAA 1F3PA 2YM2A 4OPCA 4EMIA 1Z6LA 3AE2A 1HYUA 4AT2A 2X3NA 3F8PA 2WP6A 1FCDA 2C76A 1Q1WA 3QFBA 2C7GA 3D1CA 3LOVA 4J34A 3DMEA 5BUKA 1F8WA 3BI4A 3UKQA 3I6DA 2GMJA 5M10A 2WPFA 4BK3A 3AE7A 4CNKA 1NDAA 4EMWA 2WP5A 3LXDA 1DJNA 3QVRA 4H4PA 3VRDB 1PBEA 5EB4A 1N1PA 3AE4A 5EBKA 2PYXA 2B7SA 1JRZA
chains in the Genus database with same CATH superfamily
1PN0A 2B9YA 2BABA 3ALLA 3CNDA 3DGBA 1ZOYA 4FK1C 1GRGA 2PS2A 1GRFA 2GQWA 3BI5A 3OC4A 4J56A 1RYIA 1P48A 3KKJA 1JDFA 2YAUA 3THUA 1RSGA 2BYBA 1KFYA 2Z5XA 5FS7A 1XDIA 3GMBA 3EANA 4WCTA 4EM3A 2Q7VA 4IL2A 1D4EA 3BHKA 1E1KA 4ROPA 2F5ZA 1PDHA 3QJ4A 3R9UA 4TLXA 1DOBA 1CHUA 1GETA 1ZX9A 1ZY8A 4YWSA 3DA1A 3AMZA 5JCLA 2WU2A 3BI2A 3UP5A 4EWJA 1S2QA 1Q9IA 2A8XA 3D46A 4DNAA 1ELIA 3KU9A 2X8CA 3EEZA 4X9NA 3SZ0A 4J33A 3COXA 3UOZA 3GSIA 5ER0A 3CPHG 3V3WA 1GERA 2X50A 3AEDA 4J36A 3D47A 3GO2A 2QVHA 4GYPC 3SXIA 5IQ4A 2JB2A 4YKGA 1TRBA 2AL2A 1ECQA 3JSKA 4FK1A 4YSHA 2YM1A 4G6HA 3OW1A 3C4NA 3SZFA 2XFQA 2QDEA 4I58A 1GEUA 2WOIA 4K22A 3RHAA 1NPXA 2OALA 4E4UA 2OQHA 4KPRA 2OKTA 2HNEA 1LTXR 4RG4A 1E6EA 1F8RA 1KCZA 2RDXA 1XPYA 4U8NA 1V97A 1TZZA 1FEAA 2BS3A 2GSHA 3T2KA 3DH9A 4M52A 4MGGA 3SR6B 4Z25A 2AAQA 2CFYA 3TWBA 1XANA 1NAAA 2Y6QA 3SYIA 4GDPA 3T9PA 1IUSA 2GB0A 4M0XA 3BOXA 4A65A 1GT8A 3Q9TA 4CBQA 1EBDA 3E1TA 4B67A 4G8TA 4U2SA 2IVEA 3FJ4A 4U8IA 2H88A 3UXLA 4B63A 2XH0A 3AE6A 4GYPA 3SBFA 4G73A 2UZZA 4ECHA 3RP6A 4RG3A 1ZMDA 4K5SA 4CCRA 5KNLA 3VR9A 4GRTA 1PXBA 3H70A 4JDRA 3VC5A 2OLAA 4O5UA 3Q6JA 1REOA 3H8IA 3ES7A 4BK2A 2XH7A 2OG9A 2P3ZA 3CN8A 2XLPA 2EQ9A 1JCTA 1CJ3A 4Z17A 4NEVA 3OP2A 3HPFA 3FBSA 3UTEA 5L46A 2R4EA 3TQPA 1TYPA 4Y4LA 3BJSA 1DODA 2ACZA 4OPUA 1JROA 4B1BA 3CGCA 2YLTA 4A9WA 3FXGA 5FS6A 1DXLA 1K0LA 4U8OA 4Z26A 3CXBA 1AOGA 2QAEA 4H4TA 2VZ2A 3ZVHA 3R1ZA 3M0OA 3DJGX 4I59A 3D9XA 4K8DA 5FJOA 1CJ4A 3S47A 3QPEA 2ZC8A 4DHGA 2BS4A 2WDQA 4E8GA 4OPIA 3SZCA 3KUMA 2R45A 2C3CA 3CGEA 2ZADA 2VVLA 3NK1X 3GY1A 4HPNA 4H2RA 3K7QX 2PP0A 4H4RA 1W6TA 4J2WA 4FDCB 4BV6A 2NQLA 4K1WA 3AYIA 3T2ZA 4OPTA 3R0UA 3NZGA 2NPXA 3SM8A 3L8KA 1NENA 4GISA 4GFIA 4D04A 4DSHA 3AE3A 1NG3A 1IUUA 5ENLA 2GR1A 5EOWA 1RVKA 4DGKA 1ZOVA 3IF9A 3T4WA 1D7LA 1N60C 2XH2A 1DOCA 3T6CA 4OPGA 3KVEA 2QJMA 1QO8A 4DN1A 4ZN0A 2XGZA 4X9MA 3QVPA 3OPSA 2XFNA 1VQWA 1PBFA 2FYMA 4TM0A 1PJ6A 3B3RA 1PBDA 3T8QA 2C72A 2TPRA 4PABA 4BJYA 3VCCA 3MSYA 4M6UA 4B68A 4GMEA 3ISHA 4JY3A 3UTHA 2BCGG 1WUFA 4KPLA 3G5QA 5IPYA 4AP1A 3ZVIA 4IA6A 3VRAA 4HCHA 1N61C 3AEGA 4Z44A 4H19A 3NT6A 3UXKA 4JY2A 1VRQB 1UKVG 1KKOA 3DGZA 1SJDA 1KDGA 2QGYA 3BNUA 5KVIA 4EMIA 3L5OA 3F8PA 3UKQA 2GMJA 2WPFA 4NNJA 4CNKA 4EMWA 4IT1A 4H4PA 2PODA 1N1PA 3AE4A 2PYXA 4REKA 3DJDA 4BJZA 4KWSA 3CPJG 5HY5A 2XVIA 3PK7A 1L9DA 3CNTA 3PVCA 4CY6A 3FPZA 4JHMA 1YEYA 1P2EA 4H4XA 3VRBA 4K8GA 3VFCA 5EU9A 5KVHA 1GESA 2XDOA 4IP4A 2R0CA 4U8KA 4O5QA 2VVMA 2PCEA 5HHFA 3EUB3 4FX9A 1LV0A 4YTNA 3TTEA 2V3BA 2WP9A 4HCLA 1FFVC 4B64A 2YWLA 1BGJA 4K5RA 2PHHA 2RGHA 2XLSA 3KPFA 5GSNA 3SFEA 1L9CA 4ZCDA 4OPLA 2ONEA 2XH4A 3ALJA 1YQ4A 1NHPA 3BHFA 2NVKX 3AWIA 1SJCA 2XVJA 2PP3A 4A5LA 4BK1A 1CC6A 2YLSA 2X99A 3HYWA 4ZCWA 1TDEA 3GRSA 2BS2A 3LADA 2E3TA 5CKUA 2W3RA 3FCPA 4C3YA 5TR3A 1TDNA 3GYXA 3V3OA 2ARDA 4U8PA 4YSZA 3MY9A 2XVEA 4G7FA 3RP7A 1DTNA 1IUWA 1LPFA 3H8LA 2YVGA 4X2PA 1PJ5A 1GRAA 2WETA 2C65A 4YT0A 2AL2B 3FVDA 3NN6X 1FL2A 3DG3A 3NYEA 4OVIA 3WE0A 1CC4A 3VQRA 4AOXA 3UOYA 4EQSA 4HN8A 4H2PA 4H4YA 2EQ8A 3R0KA 3GDPA 3DEQA 5EB5A 3P4SA 6ENLA 2V6OA 1N5XA 2GR0A 3LZXA 1VDCA 4NTEA 1BF3A 5KOXA 2O56A 3ICTA 4GCMA 4II3A 1VG9A 3SX6A 1TYTA 2BC1A 2OFJA 3II4A 4IL0A 3S5WA 3CNSA 2RABA 2BCPA 2YLWA 2YG3A 2XLRA 3P93A 3CAWA 2A87A 1QJDA 3TW9A 2EQ7A 4GIRA 2ZZ0A 1ZKQA 3EPTA 3UOVA 5JCNA 1S2YA 2OO6A 2IVDA 1N63C 2O9ZA 2YLRA 2MNRA 2CVJA 4GF7A 3DK9A 1D4CA 3IK4A 5FJTA 1S3EA 4EIQA 2A89A 2PGEA 3DFHA 2IIDA 3A7AA 3UCCA 2Q0KA 3NRZB 2OZTA 4Y4NA 3SZWA 2YG4A 3AEAA 4ZCCA 4U8JA 4XWRA 3PWIA 3GC2A 1W4XA 3DFYA 2BC0A 4YTMA 2C70A 1GSNA 4J57A 3QSSA 4MKSA 2VRMA 3AM9A 2GRTA 1EC9A 3CGDA 2B7RA 4KT2A 1H7XA 4U2LA 2E1MA 2OZ3A 3NRNA 3SY4A 5FS8A 1O94A 3TOYA 1WUEA 1FIQB 3CNPA 2B9XA 1STZA 2XFPA 1E39A 3G5RA 1JPMA 1D4DA 5BOFA 1JRPA 4OCGA 2JB3A 4EIPA 4F4RA 3STPA 1ZMCA 2WPEA 3L1RA 1GALA 3IJLA 1Y0PA 2GL5A 3T31A 3CPIG 4GGBA 2XFUA 3NO1A 2P8BA 4HNLA 1OJDA 4C5OA 1D5TA 1LQTA 4CY8A 2WEUA 1CL0A 1PBBA 3RNMA 2XYOA 3VA8A 1B5QA 1N4WA 4NTDA 4HCDA 4TVWA 1H81A 3AEBA 5GRTA 1GTEA 5FJRA 4DSGA 1P2HA 3GWDA 4RSLA 4C77A 3DJJA 2OZ8A 3QTPA 5KMPA 4IV9A 1MDRA 1V59A 3EKGA 2YR4A 1LVLA 3DESA 2VQ7A 5KMSA 2QA1A 1KSSA 3K30A 3IHMA 4UDPA 2FJDA 3UJRA 4FI4A 2GGHA 1LJ1A 2PTYA 4IHCA 1BGNA 1MDLA 2E5AA 3T14A 3U9IA 1EC7A 3LB8A 2PU0A 3N4FA 2H89A 4ICYA 4CCQA 4YSYA 2WOVA 2GMHA 4N9XA 2PTXA 3P0WA 4PAAA 3NLCA 3N6JA 3NIXA 5J60A 1EBHA 3SFDA 3ENLA 1JU2A 3BNMA 3RGTA 3NHOX 3VCNA 4GAVA 4U2TA 4GAPA 1DOEA 1OJTA 3DG6A 3ZLGA 1F3PA 1Z6LA 4ZA0A 1HYUA 4A6GA 3LOVA 4A3RA 4JN7A 3DMEA 2WP5A 3QVRA 3AN1A 1DJNA 4DX3A 5EB4A 2B7SA 1JRZA 5C3JA 2V60A 1N4UA 3HZLA 1KF6A 1GTHA 2R46A 2R0PA 1JNZA 1SB3B 1KNRA 2GAHB 1L8PA 2PSNA 3M13A 3P4PA 1L9EA 1NELA 1PHHA 3UOXA 3TCSA 1EBGA 3HYVA 1ZDLA 3UTGA 1R0MA 4HNCA 1SEZA 3H4KA 2OQYA 3NTAA 2XVFA 4II2A 1NHQA 5CQFA 1K0JA 2OX4A 2DW6A 1NHRA 4JN8A 1JNRA 1EL8A 5KOWA 5JCIA 3RO6A 4KEMA 2R9ZA 4H4SA 2HXUA 3GD3A 3ES8A 2YVJA 4EM4A 3LJPA 2W54A 3FG2P 4Z43A 5HYMA 2WESA 3UP4A 2P88A 4G6GA 3QLDA 3I3LA 1IJHA 1VDVA 3P4RA 3ZYXA 2VOUA 4G74A 3SQPA 4U8LA 2BK3A 1CBOA 3AB1A 3RP8A 4YTPA 2QA2A 2BRYA 1E9IA 1CJ2A 1CF3A 1JRXA 3ETRB 4CRTA 4HA6A 4E6MA 4TM1A 3KPKA 3AYJA 2YG7A 1EC8A 3ZDNA 4E5TA 3QKEA 3JW7A 3TWAA 1FO4A 5KWFA 1H84A 1SJBA 3ZLFA 4MMWA 2AL1A 4KX6A 3NH3X 3AEFA 2V5ZA 1PJ7A 3CK5A 3RR1A 4AOSA 3ZLHA 3G5SA 1OEPA 3AE5A 3K7TA 4GUVA 3DK4A 1H6VA 3A7RA 5JCKA 2WHDA 2I5QA 4A99A 4H1ZA 1F6MA 4H4QA 1PS9A 1EL5A 3PO7A 2OLOA 2QCUA 7ENLA 5G5HB 1ELSA 4BURA 4APNA 3O0HA 3MKCA 3MUCA 1FEBA 4E4FA 3NTDA 2X8GA 2GDQA 3SN4A 3AYLA 3B9JB 1FHUA 3H7VA 2ZZCA 3OZMA 2YR6A 4D03A 3PFRA 3R25A 1E1LA 2P0IA 1GXFA 2ZBWA 3IWAA 2JB1A 3CB3A 4Z1YA 2PA6A 3SSZA 4GR1A 1OJCA 2I0ZA 2JAEA 4B65A 4NZHA 4U8MA 1BKWA 3B6DA 3IHGA 3GRTA 3UKAA 1L0VA 2E5VA 1IYXA 4YWOA 4H2NA 2DKIA 1P43A 2AKMA 2VVLG 5BOEA 4A6NA 1FECA 2RGOA 2PMQA 5G5GB 5KRQA 3GDNA 4TVYA 1H83A 2GQFA 3UKHA 2OLNA 4C3XA 2FKPA 4OPDA 5FS9A 4UDQA 3IJIA 4IZGA 3ITJA 3QFAA 1E1NA 3Q45A 3LZWA 2WS3A 3P3BA 2E4GA 2ZZBA 3NVYB 2WDVA 2W55A 4IVOB 3I6TA 2QQ6A 1LQUA 2XLTA 1X31B 3AD7B 3T2YA 4GGHA 2GR2A 3SQSA 2WU5A 1BQGA 5HXIA 2R0GA 5U63A 3N4EA 4GDEA 1GRHA 5KXJA 2WPCA 3UKKA 4UP3A 4HYRA 1ONFA 2V3AA 4YKFA 1PDYA 1F8SA 2C64A 3AXBA 3CT2A 3PS9A 2XSXA 3NS1B 3AD8B 2MUCA 1B4VA 1PXCA 4DXKA 1GRTA 1M64A 2PU1A 4EQXA 1CJCA 2EQ6A 2WDRA 2FJBA 3CYJA 2VQBA 3S61A 1YY5A 4XXGA 1DJQA 5FJUA 1E7PA 5M0ZA 2VRLA 2FBWA 1GV4A 3RRAA 3AE1A 3KA7A 3PG6A 3AECA 1CC2A 2XCGA 1MUCA 3EAOA 3DIPA 4JN9A 1Y56A 3CXOA 4G9KA 1KNPA 1GPEA 2JK6A 1VG0A 1JEHA 2GGJA 2CDUA 1B37A 3VDGA 3V76A 2JKCA 4ENLA 1H82A 1TE6A 2GAGB 2PGWA 5FJPA 1N62C 1XHCA 5C2TA 3IC9A 4H2HA 3GD6A 4A7AA 3GYJA 3VR8A 2XLUA 3ABVA 2WOWA 2OPJA 1MXTA 3HW2A 3P4QA 3K1GA 4CNJA 1IUXA 3DGHA 4JNQA 4B69A 2X8HA 1RM6B 4B66A 1BWCA 2OAMA 3UKLA 4DWDA 4IP5A 2FJEA 2WQYA 1NU5A 4H4WA 2WBAA 1KN0A 2YM2A 4AT2A 3UJSA 2WP6A 1FCDA 2C76A 3D1CA 3QFBA 5BUKA 1F8WA 3BI4A 2PTZA 3R10A 5M10A 1NDAA 5EBKA 3ZVHB 3NVZB 3AE8A 1FFUC 1KKRA 4UDRA 3Q4DA 2QJJA 1X2HA 1GREA 2QJNA 4H83A 3QSMA 2P8CA 1B8SA 1MRAA 4Z2UA 4X4JA 1ZP0A 2C3DA 5BRTA 1Q1RA 5IQ1A 2BK4A 3CTYA 3VC6A 4K7ZA 4TM3A 2B9WA 3GYIA 1IUVA 3NG7X 4K2SA 2APGA 3DJEA 1NG4A 3DERA 3F8RA 3SN1A 2AR8A 3IJQA 1JRYA 2GGEA 3QN3A 3V5CA 1E1MA 3NNEA 3V5FA 1EL7A 2GV8A 2C4CA 1H2IA 3CIRA 1VQZA 4JQ9A 4H50A 4EQRA 1O5WA 3NN0X 3KLJA 3SN0A 4NEWA 3R07C 1JOAA 4Y4MA 3C4AA 3MZNA 2C66A 3RITA 2DKHA 2YVFA 3F8DA 2FJAA 2AKZA 4AP3A 2YR5A 2PP1A 3N6HA 1YQ3A 3DK8A 3URHA 1JPDX 5KMRA 3TJIA 2YG5A 3OZYA 2V61A 2PTWA 3M12A 4A35A 4AT0A 3CGBA 2OVLA 3UJ2A 3R11A 1GRBA 4LIIA 2GVCA 1RP0A 3UTFA 3BSMA 3NVWB 1OJAA 3FIMB 3V3NA 1XPQA 1H86A 3JVAA 1ZXIC 1NEKA 1YKJA 2YQUA 3C96A 2Q6UA 2BA9A 4H7UA 2C73A 3D8XA 4ZOHB 1MOKA 5IDZA 1ONEA 2C75A 4LU6A 4DYEA 2AQJA 1TKKA 1COYA 3NFUA 3REDA 2W3SA 3H8AA 1IUTA 3NK0X 3I4KA 3RCYA 3QSEA 2XVHA 3NK2X 5U1OA 5BULA 1T3QC 1FOHA 3UGVA 2J3NA 1WYGA 1K0IA 1X2GA 3MQTA 3ATQA 3CNJA 3MWCA 4IA5A 1ZK7A 5KMQA 4LA1A 1TDFA 2OA1A 4NTCA 1FHVA 2GGGA 3NKSA 1BZLA 3DG7A 3TJ4A 3ICRA 4WX1A 3UKPA 1OJ9A 3GD4A 4H4UA 4XWZA 4H4VA 1PBCA 2Q0LA 3UKFA 4ADWA 3AEEA 1NHSA 3ATRA 4A6NB 4A79A 3UJEA 1M6IA 2HQMA 3DDMA 2BRAA 5J04A 1PXAA 4HB9A 4IVMB 1R6WA 3I6EA 3SGLA 5BVAA 1N5WC 2JBVA 4TM4A 4NWZA 4TLZA 2W0HA 3UCDA 3GMCA 4J3ZA 5JCMA 1SJAA 3NYFA 3S5SA 3NVVB 2QDDA 5JRBA 3EF6A 3CMMA 3JZUA 3NXLA 3AE9A 3PWGA 1QLBA 3SJNA 3V4BA 1K4QA 5FMHA 3OZ2A 1H7WA 2HXTA 4MJWA 4Z2TA 4Z2RA 4USQA 1GNDA 3NYCA 2GF3A 2DW7A 1TDKA 2YLZA 3UCLA 2RGJA 1EL9A 4E0VA 2R4JA 4USRA 3KD9A 3FYYA 1BKHA 1KD0A 3HRDC 5J7XA 2PPGA 1PDZA 5LV9A 2YLXA 1DNCA 3AD9B 1KSUA 3ADAB 4J31A 3OTRA 2TMDA 1YQZA 3NGCX 4K2XA 3FV9A 1S7MA 2GGIA 2XFOA 1XS2A 1TDOA 1N4VA 1MO9A 2GH5A 3FMWA 2Y6RA 2BXRA 2GR3A 3GWFA 2BACA 1F9CA 3K7MX 5U25A 3T0KA 4C74A 1S3BA 2YG6A 3P9UA 2B76A 3HYXA 2CHRA 4YXDA 3T37A 4YSXA 1Y56B 4Z24A 4J1OA 2BXSA 4P9SA 4FP1A 4H2QA 2POZA 1GOSA 4EQWA 2HZGA 2BK5A 1O95A 3P1WA 2GEWA 5DBJA 1D7YA 4JNAA 3H12A 3ICSA 4H4ZA 2C67A 3ALMA 1MNSA 2CULA 2Z5YA 3UJFA 3B97A 4OPCA 3AE2A 2X3NA 3U4FA 1Q1WA 2C7GA 4J34A 3A7UA 3I6DA 4BK3A 3AE7A 3LXDA 3VRDB 1PBEA 4EMJA
chains in the Genus database with same CATH topology
1PN0A 2B9YA 4REKA 5C3JA 2V60A 1N4UA 2BABA 3ALLA 3HZLA 3DJDA 4BJZA 1KF6A 3CNDA 3CPJG 1GTHA 2R46A 3AE8A 1ZOYA 2R0PA 5HY5A 4FK1C 2XVIA 1JNZA 4UDRA 1KNRA 1GRGA 2GAHB 1L9DA 3M13A 1GRFA 2GQWA 3CNTA 1L9EA 3P4PA 1GREA 3PVCA 3BI5A 3OC4A 4CY6A 3FPZA 4J56A 1RYIA 3QSMA 3KKJA 1PHHA 1B8SA 1P2EA 4Z2UA 3UOXA 2YAUA 1RSGA 4X4JA 1ZP0A 2BYBA 4H4XA 2C3DA 1KFYA 2Z5XA 5FS7A 3VRBA 1XDIA 3GMBA 3HYVA 1ZDLA 1Q1RA 3EANA 4WCTA 3UTGA 5BRTA 5KVHA 1GESA 4EM3A 2BK4A 5IQ1A 3CTYA 2Q7VA 2XDOA 4K7ZA 4TM3A 1D4EA 2B9WA 1IUVA 2R0CA 1SEZA 3GYIA 3H4KA 3NG7X 4U8KA 4O5QA 3NTAA 2VVMA 2XVFA 3BHKA 4II2A 5HHFA 1NHQA 1E1KA 4FX9A 5CQFA 1K0JA 2APGA 1PDHA 2F5ZA 1LV0A 4YTNA 5KMPA 3DJEA 1NG4A 3QJ4A 1NHRA 3R9UA 2V3BA 2WP9A 4TLXA 1JNRA 1EL8A 5KOWA 1DOBA 5JCIA 3F8RA 4B64A 2R9ZA 1CHUA 4H4SA 1BGJA 2YWLA 1GETA 1ZX9A 2AR8A 4K5RA 1ZY8A 3GD3A 2PHHA 2RGHA 1JRYA 2XLSA 3DA1A 5JCLA 2WU2A 3BI2A 2YVJA 3KPFA 3UP5A 4EM4A 1E1MA 3NNEA 5GSNA 1S2QA 1Q9IA 3SFEA 1EL7A 1L9CA 2A8XA 2GV8A 4ZCDA 4OPLA 3LJPA 2C4CA 1H2IA 3FG2P 3CIRA 4Z43A 4DNAA 3ALJA 1ELIA 1YQ4A 1NHPA 5HYMA 3BHFA 4JQ9A 2NVKX 3KU9A 4H50A 2X8CA 2WESA 4X9NA 3AWIA 4EQRA 3SZ0A 4J33A 3UP4A 3COXA 3UOZA 4G6GA 1O5WA 1IJHA 2XVJA 3I3LA 3NN0X 3GSIA 3KLJA 5ER0A 3P4RA 4A5LA 3CPHG 4BK1A 4NEWA 1CC6A 3ZYXA 2VOUA 1GERA 2X50A 3SQPA 4G74A 4U8LA 2BK3A 3AEDA 1CBOA 2YLSA 4J36A 3AB1A 3RP8A 1JOAA 4YTPA 2X99A 2QA2A 3HYWA 2BRYA 3C4AA 4Y4MA 3SXIA 1TDEA 3GRSA 5IQ4A 2JB2A 2BS2A 3LADA 2C66A 4YKGA 1TRBA 1CJ2A 1CF3A 3JSKA 2DKHA 4FK1A 1JRXA 5CKUA 4CRTA 4YSHA 4HA6A 2YVFA 4TM1A 3F8DA 2YM1A 4G6HA 4C3YA 5TR3A 1TDNA 3C4NA 2FJAA 2XFQA 3GYXA 3KPKA 3AYJA 3SZFA 3V3OA 4AP3A 2ARDA 2YG7A 4I58A 4U8PA 1GEUA 4YSZA 3ZDNA 2YR5A 2WOIA 2XVEA 4K22A 3RHAA 1YQ3A 1NPXA 2OALA 3RP7A 3DK8A 5KWFA 1H84A 3URHA 5KMRA 4KPRA 1IUWA 1LTXR 1LPFA 2YG5A 4RG4A 1E6EA 3H8LA 2V61A 4KX6A 2YVGA 3M12A 1F8RA 3NH3X 1PJ5A 1GRAA 3AEFA 4AT0A 3CGBA 2WETA 2V5ZA 2C65A 4YT0A 1PJ7A 4AOSA 4U8NA 3NN6X 1FL2A 3G5SA 1GRBA 3AE5A 3NYEA 1FEAA 4OVIA 3WE0A 4LIIA 2BS3A 2GVCA 3K7TA 1RP0A 4GUVA 3DK4A 1H6VA 5JCKA 1CC4A 2WHDA 3UTFA 3VQRA 4AOXA 3UOYA 1F6MA 1PS9A 4H4QA 1OJAA 4A99A 3FIMB 1EL5A 3PO7A 3V3NA 1XPQA 4EQSA 3T2KA 3DH9A 1H86A 2OLOA 2QCUA 4M52A 4H2PA 4H4YA 1NEKA 4BURA 4APNA 4Z25A 1YKJA 2EQ8A 3O0HA 2AAQA 3GDPA 5EB5A 2CFYA 2YQUA 3P4SA 1FEBA 2V6OA 3NTDA 2X8GA 3C96A 2GR0A 1XANA 1NAAA 2Y6QA 3SYIA 3LZXA 3AYLA 1VDCA 4NTEA 1BF3A 2Q6UA 5KOXA 2BA9A 4GDPA 4H7UA 1IUSA 2C73A 2GB0A 2ZZCA 3ICTA 2YR6A 4A65A 4GCMA 1GT8A 3Q9TA 4D03A 3D8XA 4CBQA 1EBDA 4II3A 1MOKA 1VG9A 2C75A 3E1TA 4B67A 1E1LA 4LU6A 3SX6A 1TYTA 2BC1A 4U2SA 2IVEA 3II4A 4U8IA 1GXFA 3S5WA 2H88A 3CNSA 2AQJA 2RABA 2ZBWA 2BCPA 2YLWA 4B63A 2YG3A 2XLRA 3AE6A 1COYA 3IWAA 2A87A 3REDA 2JB1A 1QJDA 1IUTA 3NK0X 4G73A 2EQ7A 2UZZA 2ZZ0A 1ZKQA 3QSEA 4ECHA 2XVHA 3EPTA 3RP6A 4GR1A 4RG3A 3UOVA 1OJCA 1ZMDA 2I0ZA 2JAEA 3NK2X 5JCNA 4B65A 4NZHA 4U8MA 1BKWA 1S2YA 5U1OA 5BULA 3B6DA 1FOHA 3IHGA 4K5SA 4CCRA 3VR9A 5KNLA 2IVDA 2J3NA 3GRTA 3UKAA 4GRTA 1PXBA 2O9ZA 1K0IA 1L0VA 3ATQA 2YLRA 3CNJA 2CVJA 2E5VA 4YWOA 4H2NA 2DKIA 4JDRA 4GF7A 4IA5A 2VVLG 1ZK7A 3DK9A 1D4CA 5KMQA 4A6NA 4LA1A 1TDFA 1FECA 2OA1A 1S3EA 2RGOA 4EIQA 2A89A 4NTCA 4O5UA 3Q6JA 1REOA 3H8IA 1BZLA 3NKSA 2IIDA 4BK2A 2Q0KA 5KRQA 3GDNA 3ICRA 4WX1A 3CN8A 2XLPA 4Y4NA 3SZWA 3UKPA 2YG4A 1OJ9A 2EQ9A 1H83A 3AEAA 2GQFA 3GD4A 4H4UA 4ZCCA 4U8JA 4XWRA 3UKHA 2OLNA 4C3XA 4XWZA 4H4VA 4OPDA 5FS9A 1CJ3A 1PBCA 2Q0LA 1W4XA 4NEVA 4UDQA 3UKFA 3ITJA 3QFAA 4ADWA 1E1NA 3FBSA 3AEEA 3UTEA 1NHSA 2BC0A 5L46A 2R4EA 3ATRA 3LZWA 4YTMA 4A6NB 2C70A 1TYPA 2WS3A 4Y4LA 1GSNA 2E4GA 2ZZBA 4J57A 4A79A 1DODA 2ACZA 4OPUA 3QSSA 2WDVA 1M6IA 4B1BA 2VRMA 4IVOB 2HQMA 2BRAA 2GRTA 3CGCA 2YLTA 4A9WA 3CGDA 1PXAA 1LQUA 5FS6A 2B7RA 1H7XA 1DXLA 1X31B 2XLTA 4HB9A 4IVMB 1K0LA 3AD7B 4U2LA 4U8OA 3T2YA 4Z26A 2E1MA 3SGLA 2GR2A 1AOGA 2QAEA 5BVAA 2JBVA 2WU5A 4TM4A 4H4TA 2VZ2A 3NRNA 5HXIA 3SY4A 4NWZA 2R0GA 4TLZA 5U63A 2W0HA 5FS8A 1O94A 3M0OA 3GMCA 4GDEA 1GRHA 5JCMA 5KXJA 2WPCA 3CNPA 3DJGX 3NYFA 4I59A 2B9XA 3D9XA 3UKKA 4K8DA 4UP3A 1CJ4A 2XFPA 1E39A 5JRBA 3EF6A 3G5RA 3CMMA 2BS4A 2WDQA 1ONFA 1D4DA 3AE9A 1QLBA 4OPIA 3SZCA 1K4QA 5FMHA 3OZ2A 2R45A 2C3CA 3CGEA 2VVLA 3NK1X 2V3AA 4YKFA 1H7WA 4MJWA 4Z2TA 4Z2RA 4OCGA 1F8SA 2C64A 3AXBA 4USQA 2JB3A 3PS9A 4H2RA 4EIPA 1GNDA 3K7QX 4H4RA 3AD8B 4J2WA 4FDCB 1ZMCA 2WPEA 4BV6A 3L1RA 3NYCA 2GF3A 1B4VA 1GALA 1PXCA 3AYIA 3T2ZA 4OPTA 1M64A 1GRTA 2NPXA 3SM8A 1TDKA 2YLZA 3L8KA 3UCLA 1NENA 4EQXA 1CJCA 2RGJA 2EQ6A 1EL9A 4E0VA 4D04A 2R4JA 4DSHA 2WDRA 2FJBA 4USRA 1Y0PA 2VQBA 3AE3A 3KD9A 3T31A 3CPIG 3S61A 1NG3A 1YY5A 4XXGA 1IUUA 1DJQA 2XFUA 5M0ZA 1E7PA 2VRLA 2FBWA 2GR1A 1GV4A 5EOWA 1OJDA 5J7XA 4C5OA 1D5TA 1LQTA 5LV9A 2YLXA 4CY8A 2WEUA 1DNCA 1CL0A 3AD9B 4DGKA 1ZOVA 1PBBA 3AE1A 3IF9A 3KA7A 3RNMA 1D7LA 3PG6A 2XYOA 1DOCA 1KSUA 3ADAB 1B5QA 1CC2A 1N4WA 3AECA 4J31A 4NTDA 4OPGA 2TMDA 1YQZA 3KVEA 3NGCX 2XCGA 1QO8A 4K2XA 4ZN0A 1H81A 4X9MA 3EAOA 4JN9A 1Y56A 3AEBA 3QVPA 5GRTA 1GTEA 4G9KA 1S7MA 1KNPA 1GPEA 2XFNA 1VQWA 1PBFA 2JK6A 2XFOA 1P2HA 1VG0A 4DSGA 4TM0A 1JEHA 3GWDA 4RSLA 4C77A 2CDUA 3DJJA 1TDOA 1PJ6A 1B37A 3B3RA 1PBDA 1N4VA 1MO9A 2GH5A 2C72A 2TPRA 2BXRA 2Y6RA 3FMWA 4IV9A 3V76A 1V59A 2GR3A 2YR4A 2JKCA 3GWFA 1LVLA 2BACA 4PABA 4BJYA 1H82A 2GAGB 2VQ7A 3K7MX 4B68A 5KMSA 2QA1A 1KSSA 3ISHA 3K30A 4JY3A 1XHCA 5U25A 3IC9A 3IHMA 3UTHA 4UDPA 5C2TA 2FJDA 3T0KA 2BCGG 4C74A 4A7AA 3GYJA 1S3BA 2YG6A 3P9UA 3VR8A 4EMJA 2XLUA 2B76A 3HYXA 4YXDA 3T37A 1LJ1A 4YSXA 1BGNA 1Y56B 3ABVA 4Z24A 2WOWA 3G5QA 2BXSA 3T14A 5IPYA 4AP1A 3LB8A 2H89A 4P9SA 4ICYA 4CCQA 4IA6A 3VRAA 4H2QA 1MXTA 3AEGA 4YSYA 2WOVA 3P4QA 4CNJA 1IUXA 1GOSA 2GMHA 4EQWA 4Z44A 4N9XA 3NT6A 3DGHA 4PAAA 3NLCA 4JNQA 2BK5A 1O95A 3P1WA 2GEWA 5DBJA 4B69A 4JY2A 3NIXA 2X8HA 1D7YA 1VRQB 4JNAA 5J60A 1UKVG 3SFDA 3ICSA 4H4ZA 2C67A 3ALMA 3DGZA 1JU2A 3BNMA 4B66A 1BWCA 2OAMA 3NHOX 3UKLA 1KDGA 2FJEA 4GAVA 4U2TA 2CULA 2WQYA 3BNUA 4GAPA 2Z5YA 5KVIA 1DOEA 4H4WA 1OJTA 2WBAA 1KN0A 1F3PA 2YM2A 4OPCA 4EMIA 1Z6LA 3AE2A 1HYUA 3L5OA 4AT2A 2X3NA 3F8PA 2WP6A 1FCDA 2C76A 1Q1WA 3QFBA 2C7GA 3D1CA 3LOVA 4J34A 3DMEA 5BUKA 1F8WA 3BI4A 3UKQA 3I6DA 2GMJA 5M10A 2WPFA 4NNJA 4BK3A 3AE7A 4CNKA 1NDAA 4EMWA 2WP5A 3LXDA 1DJNA 3QVRA 4H4PA 3VRDB 1PBEA 5EB4A 1N1PA 3AE4A 5EBKA 2PYXA 2B7SA 1JRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PN0 A;  2B9Y A;  4REK A;  5C3J A;  2V60 A;  1N4U A;  2BAB A;  3ALL A;  3HZL A;  3DJD A;  4BJZ A;  1KF6 A;  3CND A;  3CPJ G;  1GTH A;  2R46 A;  3AE8 A;  1ZOY A;  2R0P A;  5HY5 A;  4FK1 C;  2XVI A;  1JNZ A;  4UDR A;  1KNR A;  1GRG A;  2GAH B;  1L9D A;  3M13 A;  1GRF A;  2GQW A;  3CNT A;  1L9E A;  3P4P A;  1GRE A;  3PVC A;  3BI5 A;  3OC4 A;  4CY6 A;  3FPZ A;  4J56 A;  1RYI A;  3QSM A;  3KKJ A;  1PHH A;  1B8S A;  1P2E A;  4Z2U A;  3UOX A;  2YAU A;  1RSG A;  4X4J A;  1ZP0 A;  2BYB A;  4H4X A;  2C3D A;  1KFY A;  2Z5X A;  5FS7 A;  3VRB A;  1XDI A;  3GMB A;  5BRT A;  1ZDL A;  1Q1R A;  3EAN A;  4WCT A;  3UTG A;  5KVH A;  1GES A;  4EM3 A;  2BK4 A;  5IQ1 A;  3CTY A;  2Q7V A;  2XDO A;  4K7Z A;  4TM3 A;  1D4E A;  2B9W A;  1IUV A;  2R0C A;  1SEZ A;  3GYI A;  3H4K A;  3NG7 X;  4U8K A;  4O5Q A;  3NTA A;  2VVM A;  2XVF A;  3BHK A;  5HHF A;  1NHQ A;  1E1K A;  4FX9 A;  5CQF A;  1K0J A;  2APG A;  1PDH A;  2F5Z A;  1LV0 A;  4YTN A;  3DJE A;  1NG4 A;  3QJ4 A;  1NHR A;  3R9U A;  2V3B A;  2WP9 A;  4TLX A;  1JNR A;  1EL8 A;  5KOW A;  1DOB A;  5JCI A;  3F8R A;  4B64 A;  2R9Z A;  1CHU A;  4H4S A;  1BGJ A;  2YWL A;  1GET A;  1ZX9 A;  2AR8 A;  4K5R A;  1ZY8 A;  3GD3 A;  2PHH A;  2RGH A;  1JRY A;  2XLS A;  3DA1 A;  5JCL A;  2WU2 A;  3BI2 A;  2YVJ A;  3KPF A;  3UP5 A;  4EM4 A;  1E1M A;  3NNE A;  5GSN A;  1S2Q A;  1Q9I A;  3SFE A;  1EL7 A;  1L9C A;  2A8X A;  2GV8 A;  4ZCD A;  4OPL A;  3LJP A;  3FG2 P;  3CIR A;  4Z43 A;  4DNA A;  3ALJ A;  1ELI A;  1YQ4 A;  1NHP A;  5HYM A;  3BHF A;  4JQ9 A;  2NVK X;  3KU9 A;  4H50 A;  2X8C A;  2WES A;  4X9N A;  3AWI A;  4EQR A;  4J33 A;  3UP4 A;  3COX A;  3UOZ A;  1O5W A;  1IJH A;  2XVJ A;  3I3L A;  3NN0 X;  3GSI A;  3KLJ A;  5ER0 A;  3P4R A;  4A5L A;  3CPH G;  4BK1 A;  4NEW A;  1CC6 A;  3ZYX A;  2VOU A;  1GER A;  2X50 A;  3SQP A;  4U8L A;  2BK3 A;  3AED A;  1CBO A;  2YLS A;  4J36 A;  3AB1 A;  3RP8 A;  1JOA A;  4YTP A;  2X99 A;  2QA2 A;  4Y4M A;  3C4A A;  1TDE A;  3GRS A;  5IQ4 A;  2JB2 A;  2BS2 A;  3LAD A;  2C66 A;  4YKG A;  1TRB A;  1CJ2 A;  1CF3 A;  3JSK A;  2DKH A;  4FK1 A;  1JRX A;  5CKU A;  4CRT A;  4YSH A;  4HA6 A;  2YVF A;  4TM1 A;  3F8D A;  2YM1 A;  4C3Y A;  5TR3 A;  1TDN A;  3C4N A;  2FJA A;  2XFQ A;  3AYJ A;  3V3O A;  4AP3 A;  2ARD A;  2YG7 A;  4I58 A;  4U8P A;  1GEU A;  4YSZ A;  3ZDN A;  2YR5 A;  2WOI A;  2XVE A;  4K22 A;  3RHA A;  1YQ3 A;  1NPX A;  2OAL A;  3RP7 A;  3DK8 A;  5KWF A;  1H84 A;  3URH A;  4KPR A;  1IUW A;  1LTX R;  1LPF A;  2YG5 A;  4RG4 A;  1E6E A;  3H8L A;  2V61 A;  4KX6 A;  2YVG A;  3M12 A;  1F8R A;  3NH3 X;  1PJ5 A;  1GRA A;  3AEF A;  4AT0 A;  3CGB A;  2WET A;  2V5Z A;  2C65 A;  4YT0 A;  1PJ7 A;  4AOS A;  4U8N A;  3NN6 X;  1FL2 A;  3G5S A;  1GRB A;  3AE5 A;  3NYE A;  1FEA A;  4OVI A;  3WE0 A;  4LII A;  2BS3 A;  2GVC A;  3K7T A;  1RP0 A;  4GUV A;  3DK4 A;  1H6V A;  5JCK A;  1CC4 A;  2WHD A;  3UTF A;  3VQR A;  4AOX A;  3UOY A;  1F6M A;  1PS9 A;  4H4Q A;  1OJA A;  4A99 A;  3FIM B;  1EL5 A;  3PO7 A;  3V3N A;  1XPQ A;  4EQS A;  3DH9 A;  1H86 A;  2OLO A;  2QCU A;  4M52 A;  4H2P A;  4H4Y A;  1NEK A;  4BUR A;  4APN A;  4Z25 A;  1YKJ A;  2EQ8 A;  3O0H A;  2AAQ A;  3GDP A;  5EB5 A;  2CFY A;  2YQU A;  3P4S A;  1FEB A;  2V6O A;  3NTD A;  2X8G A;  3C96 A;  2GR0 A;  1XAN A;  1NAA A;  2Y6Q A;  3LZX A;  3AYL A;  1VDC A;  4NTE A;  1BF3 A;  2Q6U A;  5KOX A;  2BA9 A;  4GDP A;  4H7U A;  1IUS A;  2C73 A;  2GB0 A;  2ZZC A;  3ICT A;  2YR6 A;  4A65 A;  4GCM A;  1GT8 A;  3Q9T A;  4D03 A;  3D8X A;  4CBQ A;  1EBD A;  1MOK A;  1VG9 A;  2C75 A;  3E1T A;  4B67 A;  1E1L A;  4LU6 A;  1TYT A;  2BC1 A;  4U2S A;  2IVE A;  3II4 A;  4U8I A;  1GXF A;  3S5W A;  2H88 A;  3CNS A;  2AQJ A;  2RAB A;  2ZBW A;  2BCP A;  2YLW A;  4B63 A;  2YG3 A;  2XLR A;  3AE6 A;  1COY A;  3IWA A;  2A87 A;  3RED A;  2JB1 A;  1QJD A;  1IUT A;  3NK0 X;  2EQ7 A;  2UZZ A;  2ZZ0 A;  1ZKQ A;  3QSE A;  4ECH A;  2XVH A;  3EPT A;  3RP6 A;  4GR1 A;  4RG3 A;  3UOV A;  1OJC A;  1ZMD A;  2I0Z A;  2JAE A;  3NK2 X;  5JCN A;  4B65 A;  4NZH A;  4U8M A;  1BKW A;  1S2Y A;  5U1O A;  5BUL A;  3B6D A;  1FOH A;  3IHG A;  4K5S A;  4CCR A;  3VR9 A;  2IVD A;  2J3N A;  3GRT A;  3UKA A;  4GRT A;  1PXB A;  2O9Z A;  1K0I A;  1L0V A;  3ATQ A;  2YLR A;  3CNJ A;  2CVJ A;  2E5V A;  4YWO A;  4H2N A;  2DKI A;  4JDR A;  4GF7 A;  4IA5 A;  2VVL G;  1ZK7 A;  3DK9 A;  1D4C A;  4A6N A;  4LA1 A;  1TDF A;  1FEC A;  2OA1 A;  1S3E A;  2RGO A;  4EIQ A;  2A89 A;  4NTC A;  4O5U A;  3Q6J A;  1REO A;  3H8I A;  1BZL A;  3NKS A;  2IID A;  4BK2 A;  2Q0K A;  5KRQ A;  3GDN A;  3ICR A;  4WX1 A;  3CN8 A;  2XLP A;  4Y4N A;  3UKP A;  2YG4 A;  1OJ9 A;  2EQ9 A;  1H83 A;  3AEA A;  2GQF A;  3GD4 A;  4H4U A;  4ZCC A;  4U8J A;  4XWR A;  3UKH A;  2OLN A;  4C3X A;  4XWZ A;  4H4V A;  4OPD A;  5FS9 A;  1CJ3 A;  1PBC A;  2Q0L A;  1W4X A;  4NEV A;  4UDQ A;  3UKF A;  3ITJ A;  3QFA A;  4ADW A;  1E1N A;  3FBS A;  3AEE A;  3UTE A;  1NHS A;  2BC0 A;  5L46 A;  2R4E A;  3ATR A;  3LZW A;  4YTM A;  4A6N B;  2C70 A;  1TYP A;  2WS3 A;  4Y4L A;  1GSN A;  2E4G A;  2ZZB A;  4J57 A;  4A79 A;  1DOD A;  2ACZ A;  4OPU A;  3QSS A;  2WDV A;  1M6I A;  4B1B A;  2VRM A;  4IVO B;  2HQM A;  2GRT A;  3CGC A;  2YLT A;  4A9W A;  3CGD A;  1PXA A;  1LQU A;  5FS6 A;  2B7R A;  1H7X A;  1DXL A;  1X31 B;  2XLT A;  4HB9 A;  4IVM B;  1K0L A;  3AD7 B;  4U2L A;  4U8O A;  4Z26 A;  2E1M A;  3SGL A;  2GR2 A;  1AOG A;  2QAE A;  5BVA A;  2JBV A;  2WU5 A;  4TM4 A;  4H4T A;  2VZ2 A;  3NRN A;  5HXI A;  2R0G A;  4TLZ A;  5U63 A;  2W0H A;  5FS8 A;  1O94 A;  3M0O A;  3GMC A;  4GDE A;  1GRH A;  5JCM A;  5KXJ A;  2WPC A;  3CNP A;  3DJG X;  3NYF A;  4I59 A;  2B9X A;  3UKK A;  4K8D A;  4UP3 A;  1CJ4 A;  2XFP A;  1E39 A;  3EF6 A;  3G5R A;  2BS4 A;  2WDQ A;  1ONF A;  1D4D A;  3AE9 A;  1QLB A;  4OPI A;  1K4Q A;  5FMH A;  3OZ2 A;  2R45 A;  2C3C A;  3CGE A;  2VVL A;  3NK1 X;  2V3A A;  4YKF A;  1H7W A;  4MJW A;  4Z2T A;  4Z2R A;  4OCG A;  1F8S A;  2C64 A;  3AXB A;  4USQ A;  2JB3 A;  3PS9 A;  4H2R A;  4EIP A;  1GND A;  3K7Q X;  4H4R A;  3AD8 B;  4J2W A;  4FDC B;  1ZMC A;  2WPE A;  4BV6 A;  3L1R A;  3NYC A;  2GF3 A;  1B4V A;  1GAL A;  1PXC A;  3AYI A;  4OPT A;  1M64 A;  1GRT A;  2NPX A;  3SM8 A;  1TDK A;  2YLZ A;  3L8K A;  3UCL A;  1NEN A;  4EQX A;  1CJC A;  2RGJ A;  2EQ6 A;  1EL9 A;  4E0V A;  4D04 A;  2R4J A;  4DSH A;  2WDR A;  2FJB A;  4USR A;  1Y0P A;  2VQB A;  3AE3 A;  3KD9 A;  3CPI G;  3S61 A;  1NG3 A;  1YY5 A;  4XXG A;  1IUU A;  1DJQ A;  2XFU A;  5M0Z A;  1E7P A;  2VRL A;  2FBW A;  2GR1 A;  1GV4 A;  5EOW A;  1OJD A;  5J7X A;  4C5O A;  1D5T A;  1LQT A;  5LV9 A;  2YLX A;  4CY8 A;  2WEU A;  1DNC A;  1CL0 A;  3AD9 B;  4DGK A;  1ZOV A;  1PBB A;  3AE1 A;  3IF9 A;  3KA7 A;  3RNM A;  1D7L A;  2XYO A;  1DOC A;  1KSU A;  3ADA B;  1B5Q A;  1CC2 A;  1N4W A;  3AEC A;  4J31 A;  4NTD A;  4OPG A;  2TMD A;  1YQZ A;  3KVE A;  3NGC X;  2XCG A;  1QO8 A;  4K2X A;  4ZN0 A;  1H81 A;  4X9M A;  3EAO A;  4JN9 A;  1Y56 A;  3AEB A;  3QVP A;  5GRT A;  1GTE A;  1KNP A;  1GPE A;  2XFN A;  1VQW A;  1PBF A;  2JK6 A;  2XFO A;  1P2H A;  1VG0 A;  4DSG A;  4TM0 A;  1JEH A;  3GWD A;  4RSL A;  4C77 A;  2CDU A;  3DJJ A;  1TDO A;  1PJ6 A;  1B37 A;  3B3R A;  1PBD A;  1N4V A;  1MO9 A;  2GH5 A;  2C72 A;  2TPR A;  2BXR A;  2Y6R A;  3FMW A;  4IV9 A;  3V76 A;  1V59 A;  2GR3 A;  2YR4 A;  2JKC A;  3GWF A;  1LVL A;  2BAC A;  4PAB A;  4BJY A;  1H82 A;  2GAG B;  2VQ7 A;  3K7M X;  4B68 A;  2QA1 A;  1KSS A;  3ISH A;  3K30 A;  4JY3 A;  1XHC A;  5U25 A;  3IC9 A;  3IHM A;  3UTH A;  4UDP A;  5C2T A;  2FJD A;  4C74 A;  2BCG G;  4A7A A;  3GYJ A;  1S3B A;  2YG6 A;  3P9U A;  3VR8 A;  4EMJ A;  2XLU A;  2B76 A;  4YXD A;  3T37 A;  1LJ1 A;  4YSX A;  1BGN A;  1Y56 B;  3ABV A;  4Z24 A;  2WOW A;  3G5Q A;  2BXS A;  5IPY A;  4AP1 A;  3LB8 A;  2H89 A;  4P9S A;  4ICY A;  4CCQ A;  4IA6 A;  3VRA A;  4H2Q A;  1MXT A;  3AEG A;  4YSY A;  2WOV A;  3P4Q A;  4CNJ A;  1IUX A;  1GOS A;  2GMH A;  4EQW A;  4Z44 A;  4N9X A;  3NT6 A;  3DGH A;  4PAA A;  3NLC A;  4JNQ A;  2BK5 A;  1O95 A;  3P1W A;  2GEW A;  5DBJ A;  4B69 A;  4JY2 A;  3NIX A;  2X8H A;  1D7Y A;  1VRQ B;  4JNA A;  5J60 A;  1UKV G;  3SFD A;  3ICS A;  4H4Z A;  2C67 A;  3ALM A;  3DGZ A;  1JU2 A;  3BNM A;  4B66 A;  1BWC A;  2OAM A;  3NHO X;  3UKL A;  1KDG A;  2FJE A;  4U2T A;  2CUL A;  2WQY A;  3BNU A;  2Z5Y A;  5KVI A;  1DOE A;  4H4W A;  1OJT A;  2WBA A;  1F3P A;  2YM2 A;  4OPC A;  4EMI A;  1Z6L A;  3AE2 A;  1HYU A;  4AT2 A;  2X3N A;  3F8P A;  2WP6 A;  1FCD A;  2C76 A;  1Q1W A;  3QFB A;  2C7G A;  3D1C A;  3LOV A;  4J34 A;  3DME A;  5BUK A;  1F8W A;  3BI4 A;  3UKQ A;  3I6D A;  2GMJ A;  5M10 A;  2WPF A;  4BK3 A;  3AE7 A;  4CNK A;  1NDA A;  4EMW A;  2WP5 A;  3LXD A;  1DJN A;  3QVR A;  4H4P A;  3VRD B;  1PBE A;  5EB4 A;  1N1P A;  3AE4 A;  5EBK A;  2PYX A;  2B7S A;  1JRZ A; 
#chains in the Genus database with same CATH topology
 1PN0 A;  2B9Y A;  2BAB A;  3ALL A;  3CND A;  3DGB A;  1ZOY A;  4FK1 C;  1GRG A;  2PS2 A;  1GRF A;  2GQW A;  3BI5 A;  3OC4 A;  4J56 A;  1RYI A;  1P48 A;  3KKJ A;  1JDF A;  2YAU A;  3THU A;  1RSG A;  2BYB A;  1KFY A;  2Z5X A;  5FS7 A;  1XDI A;  3GMB A;  3EAN A;  4WCT A;  4EM3 A;  2Q7V A;  4IL2 A;  1D4E A;  3BHK A;  1E1K A;  4ROP A;  2F5Z A;  1PDH A;  3QJ4 A;  3R9U A;  4TLX A;  1DOB A;  1CHU A;  1GET A;  1ZX9 A;  1ZY8 A;  4YWS A;  3DA1 A;  3AMZ A;  5JCL A;  2WU2 A;  3BI2 A;  3UP5 A;  4EWJ A;  1S2Q A;  1Q9I A;  2A8X A;  3D46 A;  4DNA A;  1ELI A;  3KU9 A;  2X8C A;  3EEZ A;  4X9N A;  3SZ0 A;  4J33 A;  3COX A;  3UOZ A;  3GSI A;  5ER0 A;  3CPH G;  3V3W A;  1GER A;  2X50 A;  3AED A;  4J36 A;  3D47 A;  3GO2 A;  2QVH A;  4GYP C;  3SXI A;  5IQ4 A;  2JB2 A;  4YKG A;  1TRB A;  2AL2 A;  1ECQ A;  3JSK A;  4FK1 A;  4YSH A;  2YM1 A;  4G6H A;  3OW1 A;  3C4N A;  3SZF A;  2XFQ A;  2QDE A;  4I58 A;  1GEU A;  2WOI A;  4K22 A;  3RHA A;  1NPX A;  2OAL A;  4E4U A;  2OQH A;  4KPR A;  2OKT A;  2HNE A;  1LTX R;  4RG4 A;  1E6E A;  1F8R A;  1KCZ A;  2RDX A;  1XPY A;  4U8N A;  1V97 A;  1TZZ A;  1FEA A;  2BS3 A;  2GSH A;  3T2K A;  3DH9 A;  4M52 A;  4MGG A;  3SR6 B;  4Z25 A;  2AAQ A;  2CFY A;  3TWB A;  1XAN A;  1NAA A;  2Y6Q A;  3SYI A;  4GDP A;  3T9P A;  1IUS A;  2GB0 A;  4M0X A;  3BOX A;  4A65 A;  1GT8 A;  3Q9T A;  4CBQ A;  1EBD A;  3E1T A;  4B67 A;  4G8T A;  4U2S A;  2IVE A;  3FJ4 A;  4U8I A;  2H88 A;  3UXL A;  4B63 A;  2XH0 A;  3AE6 A;  4GYP A;  3SBF A;  4G73 A;  2UZZ A;  4ECH A;  3RP6 A;  4RG3 A;  1ZMD A;  4K5S A;  4CCR A;  5KNL A;  3VR9 A;  4GRT A;  1PXB A;  3H70 A;  4JDR A;  3VC5 A;  2OLA A;  4O5U A;  3Q6J A;  1REO A;  3H8I A;  3ES7 A;  4BK2 A;  2XH7 A;  2OG9 A;  2P3Z A;  3CN8 A;  2XLP A;  2EQ9 A;  1JCT A;  1CJ3 A;  4Z17 A;  4NEV A;  3OP2 A;  3HPF A;  3FBS A;  3UTE A;  5L46 A;  2R4E A;  3TQP A;  1TYP A;  4Y4L A;  3BJS A;  1DOD A;  2ACZ A;  4OPU A;  1JRO A;  4B1B A;  3CGC A;  2YLT A;  4A9W A;  3FXG A;  5FS6 A;  1DXL A;  1K0L A;  4U8O A;  4Z26 A;  3CXB A;  1AOG A;  2QAE A;  4H4T A;  2VZ2 A;  3ZVH A;  3R1Z A;  3M0O A;  3DJG X;  4I59 A;  3D9X A;  4K8D A;  5FJO A;  1CJ4 A;  3S47 A;  3QPE A;  2ZC8 A;  4DHG A;  2BS4 A;  2WDQ A;  4E8G A;  4OPI A;  3SZC A;  3KUM A;  2R45 A;  2C3C A;  3CGE A;  2ZAD A;  2VVL A;  3NK1 X;  3GY1 A;  4HPN A;  4H2R A;  3K7Q X;  2PP0 A;  4H4R A;  1W6T A;  4J2W A;  4FDC B;  4BV6 A;  2NQL A;  4K1W A;  3AYI A;  3T2Z A;  4OPT A;  3R0U A;  3NZG A;  2NPX A;  3SM8 A;  3L8K A;  1NEN A;  4GIS A;  4GFI A;  4D04 A;  4DSH A;  3AE3 A;  1NG3 A;  1IUU A;  5ENL A;  2GR1 A;  5EOW A;  1RVK A;  4DGK A;  1ZOV A;  3IF9 A;  3T4W A;  1D7L A;  1N60 C;  2XH2 A;  1DOC A;  3T6C A;  4OPG A;  3KVE A;  2QJM A;  1QO8 A;  4DN1 A;  4ZN0 A;  2XGZ A;  4X9M A;  3QVP A;  3OPS A;  2XFN A;  1VQW A;  1PBF A;  2FYM A;  4TM0 A;  1PJ6 A;  3B3R A;  1PBD A;  3T8Q A;  2C72 A;  2TPR A;  4PAB A;  4BJY A;  3VCC A;  3MSY A;  4M6U A;  4B68 A;  4GME A;  3ISH A;  4JY3 A;  3UTH A;  2BCG G;  1WUF A;  4KPL A;  3G5Q A;  5IPY A;  4AP1 A;  3ZVI A;  4IA6 A;  3VRA A;  4HCH A;  1N61 C;  3AEG A;  4Z44 A;  4H19 A;  3NT6 A;  3UXK A;  4JY2 A;  1VRQ B;  1UKV G;  1KKO A;  3DGZ A;  1SJD A;  1KDG A;  2QGY A;  3BNU A;  5KVI A;  4EMI A;  3L5O A;  3F8P A;  3UKQ A;  2GMJ A;  2WPF A;  4NNJ A;  4CNK A;  4EMW A;  4IT1 A;  4H4P A;  2POD A;  1N1P A;  3AE4 A;  2PYX A;  4REK A;  3DJD A;  4BJZ A;  4KWS A;  3CPJ G;  5HY5 A;  2XVI A;  3PK7 A;  1L9D A;  3CNT A;  3PVC A;  4CY6 A;  3FPZ A;  4JHM A;  1YEY A;  1P2E A;  4H4X A;  3VRB A;  4K8G A;  3VFC A;  5EU9 A;  5KVH A;  1GES A;  2XDO A;  4IP4 A;  2R0C A;  4U8K A;  4O5Q A;  2VVM A;  2PCE A;  5HHF A;  3EUB 3;  4FX9 A;  1LV0 A;  4YTN A;  3TTE A;  2V3B A;  2WP9 A;  4HCL A;  1FFV C;  4B64 A;  2YWL A;  1BGJ A;  4K5R A;  2PHH A;  2RGH A;  2XLS A;  3KPF A;  5GSN A;  3SFE A;  1L9C A;  4ZCD A;  4OPL A;  2ONE A;  2XH4 A;  3ALJ A;  1YQ4 A;  1NHP A;  3BHF A;  2NVK X;  3AWI A;  1SJC A;  2XVJ A;  2PP3 A;  4A5L A;  4BK1 A;  1CC6 A;  2YLS A;  2X99 A;  3HYW A;  4ZCW A;  1TDE A;  3GRS A;  2BS2 A;  3LAD A;  2E3T A;  5CKU A;  2W3R A;  3FCP A;  4C3Y A;  5TR3 A;  1TDN A;  3GYX A;  3V3O A;  2ARD A;  4U8P A;  4YSZ A;  3MY9 A;  2XVE A;  4G7F A;  3RP7 A;  1DTN A;  1IUW A;  1LPF A;  3H8L A;  2YVG A;  4X2P A;  1PJ5 A;  1GRA A;  2WET A;  2C65 A;  4YT0 A;  2AL2 B;  3FVD A;  3NN6 X;  1FL2 A;  3DG3 A;  3NYE A;  4OVI A;  3WE0 A;  1CC4 A;  3VQR A;  4AOX A;  3UOY A;  4EQS A;  4HN8 A;  4H2P A;  4H4Y A;  2EQ8 A;  3R0K A;  3GDP A;  3DEQ A;  5EB5 A;  3P4S A;  6ENL A;  2V6O A;  1N5X A;  2GR0 A;  3LZX A;  1VDC A;  4NTE A;  1BF3 A;  5KOX A;  2O56 A;  3ICT A;  4GCM A;  4II3 A;  1VG9 A;  3SX6 A;  1TYT A;  2BC1 A;  2OFJ A;  3II4 A;  4IL0 A;  3S5W A;  3CNS A;  2RAB A;  2BCP A;  2YLW A;  2YG3 A;  2XLR A;  3P93 A;  3CAW A;  2A87 A;  1QJD A;  3TW9 A;  2EQ7 A;  4GIR A;  2ZZ0 A;  1ZKQ A;  3EPT A;  3UOV A;  5JCN A;  1S2Y A;  2OO6 A;  2IVD A;  1N63 C;  2O9Z A;  2YLR A;  2MNR A;  2CVJ A;  4GF7 A;  3DK9 A;  1D4C A;  3IK4 A;  5FJT A;  1S3E A;  4EIQ A;  2A89 A;  2PGE A;  3DFH A;  2IID A;  3A7A A;  3UCC A;  2Q0K A;  3NRZ B;  2OZT A;  4Y4N A;  3SZW A;  2YG4 A;  3AEA A;  4ZCC A;  4U8J A;  4XWR A;  3PWI A;  3GC2 A;  1W4X A;  3DFY A;  2BC0 A;  4YTM A;  2C70 A;  1GSN A;  4J57 A;  3QSS A;  4MKS A;  2VRM A;  3AM9 A;  2GRT A;  1EC9 A;  3CGD A;  2B7R A;  4KT2 A;  1H7X A;  4U2L A;  2E1M A;  2OZ3 A;  3NRN A;  3SY4 A;  5FS8 A;  1O94 A;  3TOY A;  1WUE A;  1FIQ B;  3CNP A;  2B9X A;  1STZ A;  2XFP A;  1E39 A;  3G5R A;  1JPM A;  1D4D A;  5BOF A;  1JRP A;  4OCG A;  2JB3 A;  4EIP A;  4F4R A;  3STP A;  1ZMC A;  2WPE A;  3L1R A;  1GAL A;  3IJL A;  1Y0P A;  2GL5 A;  3T31 A;  3CPI G;  4GGB A;  2XFU A;  3NO1 A;  2P8B A;  4HNL A;  1OJD A;  4C5O A;  1D5T A;  1LQT A;  4CY8 A;  2WEU A;  1CL0 A;  1PBB A;  3RNM A;  2XYO A;  3VA8 A;  1B5Q A;  1N4W A;  4NTD A;  4HCD A;  4TVW A;  1H81 A;  3AEB A;  5GRT A;  1GTE A;  5FJR A;  4DSG A;  1P2H A;  3GWD A;  4RSL A;  4C77 A;  3DJJ A;  2OZ8 A;  3QTP A;  5KMP A;  4IV9 A;  1MDR A;  1V59 A;  3EKG A;  2YR4 A;  1LVL A;  3DES A;  2VQ7 A;  5KMS A;  2QA1 A;  1KSS A;  3K30 A;  3IHM A;  4UDP A;  2FJD A;  3UJR A;  4FI4 A;  2GGH A;  1LJ1 A;  2PTY A;  4IHC A;  1BGN A;  1MDL A;  2E5A A;  3T14 A;  3U9I A;  1EC7 A;  3LB8 A;  2PU0 A;  3N4F A;  2H89 A;  4ICY A;  4CCQ A;  4YSY A;  2WOV A;  2GMH A;  4N9X A;  2PTX A;  3P0W A;  4PAA A;  3NLC A;  3N6J A;  3NIX A;  5J60 A;  1EBH A;  3SFD A;  3ENL A;  1JU2 A;  3BNM A;  3RGT A;  3NHO X;  3VCN A;  4GAV A;  4U2T A;  4GAP A;  1DOE A;  1OJT A;  3DG6 A;  3ZLG A;  1F3P A;  1Z6L A;  4ZA0 A;  1HYU A;  4A6G A;  3LOV A;  4A3R A;  4JN7 A;  3DME A;  2WP5 A;  3QVR A;  3AN1 A;  1DJN A;  4DX3 A;  5EB4 A;  2B7S A;  1JRZ A;  5C3J A;  2V60 A;  1N4U A;  3HZL A;  1KF6 A;  1GTH A;  2R46 A;  2R0P A;  1JNZ A;  1SB3 B;  1KNR A;  2GAH B;  1L8P A;  2PSN A;  3M13 A;  3P4P A;  1L9E A;  1NEL A;  1PHH A;  3UOX A;  3TCS A;  1EBG A;  3HYV A;  1ZDL A;  3UTG A;  1R0M A;  4HNC A;  1SEZ A;  3H4K A;  2OQY A;  3NTA A;  2XVF A;  4II2 A;  1NHQ A;  5CQF A;  1K0J A;  2OX4 A;  2DW6 A;  1NHR A;  4JN8 A;  1JNR A;  1EL8 A;  5KOW A;  5JCI A;  3RO6 A;  4KEM A;  2R9Z A;  4H4S A;  2HXU A;  3GD3 A;  3ES8 A;  2YVJ A;  4EM4 A;  3LJP A;  2W54 A;  3FG2 P;  4Z43 A;  5HYM A;  2WES A;  3UP4 A;  2P88 A;  4G6G A;  3QLD A;  3I3L A;  1IJH A;  1VDV A;  3P4R A;  3ZYX A;  2VOU A;  4G74 A;  3SQP A;  4U8L A;  2BK3 A;  1CBO A;  3AB1 A;  3RP8 A;  4YTP A;  2QA2 A;  2BRY A;  1E9I A;  1CJ2 A;  1CF3 A;  1JRX A;  3ETR B;  4CRT A;  4HA6 A;  4E6M A;  4TM1 A;  3KPK A;  3AYJ A;  2YG7 A;  1EC8 A;  3ZDN A;  4E5T A;  3QKE A;  3JW7 A;  3TWA A;  1FO4 A;  5KWF A;  1H84 A;  1SJB A;  3ZLF A;  4MMW A;  2AL1 A;  4KX6 A;  3NH3 X;  3AEF A;  2V5Z A;  1PJ7 A;  3CK5 A;  3RR1 A;  4AOS A;  3ZLH A;  3G5S A;  1OEP A;  3AE5 A;  3K7T A;  4GUV A;  3DK4 A;  1H6V A;  3A7R A;  5JCK A;  2WHD A;  2I5Q A;  4A99 A;  4H1Z A;  1F6M A;  4H4Q A;  1PS9 A;  1EL5 A;  3PO7 A;  2OLO A;  2QCU A;  7ENL A;  5G5H B;  1ELS A;  4BUR A;  4APN A;  3O0H A;  3MKC A;  3MUC A;  1FEB A;  4E4F A;  3NTD A;  2X8G A;  2GDQ A;  3SN4 A;  3AYL A;  3B9J B;  1FHU A;  3H7V A;  2ZZC A;  3OZM A;  2YR6 A;  4D03 A;  3PFR A;  3R25 A;  1E1L A;  2P0I A;  1GXF A;  2ZBW A;  3IWA A;  2JB1 A;  3CB3 A;  4Z1Y A;  2PA6 A;  3SSZ A;  4GR1 A;  1OJC A;  2I0Z A;  2JAE A;  4B65 A;  4NZH A;  4U8M A;  1BKW A;  3B6D A;  3IHG A;  3GRT A;  3UKA A;  1L0V A;  2E5V A;  1IYX A;  4YWO A;  4H2N A;  2DKI A;  1P43 A;  2AKM A;  2VVL G;  5BOE A;  4A6N A;  1FEC A;  2RGO A;  2PMQ A;  5G5G B;  5KRQ A;  3GDN A;  4TVY A;  1H83 A;  2GQF A;  3UKH A;  2OLN A;  4C3X A;  2FKP A;  4OPD A;  5FS9 A;  4UDQ A;  3IJI A;  4IZG A;  3ITJ A;  3QFA A;  1E1N A;  3Q45 A;  3LZW A;  2WS3 A;  3P3B A;  2E4G A;  2ZZB A;  3NVY B;  2WDV A;  2W55 A;  4IVO B;  3I6T A;  2QQ6 A;  1LQU A;  2XLT A;  1X31 B;  3AD7 B;  3T2Y A;  4GGH A;  2GR2 A;  3SQS A;  2WU5 A;  1BQG A;  5HXI A;  2R0G A;  5U63 A;  3N4E A;  4GDE A;  1GRH A;  5KXJ A;  2WPC A;  3UKK A;  4UP3 A;  4HYR A;  1ONF A;  2V3A A;  4YKF A;  1PDY A;  1F8S A;  2C64 A;  3AXB A;  3CT2 A;  3PS9 A;  2XSX A;  3NS1 B;  3AD8 B;  2MUC A;  1B4V A;  1PXC A;  4DXK A;  1GRT A;  1M64 A;  2PU1 A;  4EQX A;  1CJC A;  2EQ6 A;  2WDR A;  2FJB A;  3CYJ A;  2VQB A;  3S61 A;  1YY5 A;  4XXG A;  1DJQ A;  5FJU A;  1E7P A;  5M0Z A;  2VRL A;  2FBW A;  1GV4 A;  3RRA A;  3AE1 A;  3KA7 A;  3PG6 A;  3AEC A;  1CC2 A;  2XCG A;  1MUC A;  3EAO A;  3DIP A;  4JN9 A;  1Y56 A;  3CXO A;  4G9K A;  1KNP A;  1GPE A;  2JK6 A;  1VG0 A;  1JEH A;  2GGJ A;  2CDU A;  1B37 A;  3VDG A;  3V76 A;  2JKC A;  4ENL A;  1H82 A;  1TE6 A;  2GAG B;  2PGW A;  5FJP A;  1N62 C;  1XHC A;  5C2T A;  3IC9 A;  4H2H A;  3GD6 A;  4A7A A;  3GYJ A;  3VR8 A;  2XLU A;  3ABV A;  2WOW A;  2OPJ A;  1MXT A;  3HW2 A;  3P4Q A;  3K1G A;  4CNJ A;  1IUX A;  3DGH A;  4JNQ A;  4B69 A;  2X8H A;  1RM6 B;  4B66 A;  1BWC A;  2OAM A;  3UKL A;  4DWD A;  4IP5 A;  2FJE A;  2WQY A;  1NU5 A;  4H4W A;  2WBA A;  1KN0 A;  2YM2 A;  4AT2 A;  3UJS A;  2WP6 A;  1FCD A;  2C76 A;  3D1C A;  3QFB A;  5BUK A;  1F8W A;  3BI4 A;  2PTZ A;  3R10 A;  5M10 A;  1NDA A;  5EBK A;  3ZVH B;  3NVZ B;  3AE8 A;  1FFU C;  1KKR A;  4UDR A;  3Q4D A;  2QJJ A;  1X2H A;  1GRE A;  2QJN A;  4H83 A;  3QSM A;  2P8C A;  1B8S A;  1MRA A;  4Z2U A;  4X4J A;  1ZP0 A;  2C3D A;  5BRT A;  1Q1R A;  5IQ1 A;  2BK4 A;  3CTY A;  3VC6 A;  4K7Z A;  4TM3 A;  2B9W A;  3GYI A;  1IUV A;  3NG7 X;  4K2S A;  2APG A;  3DJE A;  1NG4 A;  3DER A;  3F8R A;  3SN1 A;  2AR8 A;  3IJQ A;  1JRY A;  2GGE A;  3QN3 A;  3V5C A;  1E1M A;  3NNE A;  3V5F A;  1EL7 A;  2GV8 A;  2C4C A;  1H2I A;  3CIR A;  1VQZ A;  4JQ9 A;  4H50 A;  4EQR A;  1O5W A;  3NN0 X;  3KLJ A;  3SN0 A;  4NEW A;  3R07 C;  1JOA A;  4Y4M A;  3C4A A;  3MZN A;  2C66 A;  3RIT A;  2DKH A;  2YVF A;  3F8D A;  2FJA A;  2AKZ A;  4AP3 A;  2YR5 A;  2PP1 A;  3N6H A;  1YQ3 A;  3DK8 A;  3URH A;  1JPD X;  5KMR A;  3TJI A;  2YG5 A;  3OZY A;  2V61 A;  2PTW A;  3M12 A;  4A35 A;  4AT0 A;  3CGB A;  2OVL A;  3UJ2 A;  3R11 A;  1GRB A;  4LII A;  2GVC A;  1RP0 A;  3UTF A;  3BSM A;  3NVW B;  1OJA A;  3FIM B;  3V3N A;  1XPQ A;  1H86 A;  3JVA A;  1ZXI C;  1NEK A;  1YKJ A;  2YQU A;  3C96 A;  2Q6U A;  2BA9 A;  4H7U A;  2C73 A;  3D8X A;  4ZOH B;  1MOK A;  5IDZ A;  1ONE A;  2C75 A;  4LU6 A;  4DYE A;  2AQJ A;  1TKK A;  1COY A;  3NFU A;  3RED A;  2W3S A;  3H8A A;  1IUT A;  3NK0 X;  3I4K A;  3RCY A;  3QSE A;  2XVH A;  3NK2 X;  5U1O A;  5BUL A;  1T3Q C;  1FOH A;  3UGV A;  2J3N A;  1WYG A;  1K0I A;  1X2G A;  3MQT A;  3ATQ A;  3CNJ A;  3MWC A;  4IA5 A;  1ZK7 A;  5KMQ A;  4LA1 A;  1TDF A;  2OA1 A;  4NTC A;  1FHV A;  2GGG A;  3NKS A;  1BZL A;  3DG7 A;  3TJ4 A;  3ICR A;  4WX1 A;  3UKP A;  1OJ9 A;  3GD4 A;  4H4U A;  4XWZ A;  4H4V A;  1PBC A;  2Q0L A;  3UKF A;  4ADW A;  3AEE A;  1NHS A;  3ATR A;  4A6N B;  4A79 A;  3UJE A;  1M6I A;  2HQM A;  3DDM A;  2BRA A;  5J04 A;  1PXA A;  4HB9 A;  4IVM B;  1R6W A;  3I6E A;  3SGL A;  5BVA A;  1N5W C;  2JBV A;  4TM4 A;  4NWZ A;  4TLZ A;  2W0H A;  3UCD A;  3GMC A;  4J3Z A;  5JCM A;  1SJA A;  3NYF A;  3S5S A;  3NVV B;  2QDD A;  5JRB A;  3EF6 A;  3CMM A;  3JZU A;  3NXL A;  3AE9 A;  3PWG A;  1QLB A;  3SJN A;  3V4B A;  1K4Q A;  5FMH A;  3OZ2 A;  1H7W A;  2HXT A;  4MJW A;  4Z2T A;  4Z2R A;  4USQ A;  1GND A;  3NYC A;  2GF3 A;  2DW7 A;  1TDK A;  2YLZ A;  3UCL A;  2RGJ A;  1EL9 A;  4E0V A;  2R4J A;  4USR A;  3KD9 A;  3FYY A;  1BKH A;  1KD0 A;  3HRD C;  5J7X A;  2PPG A;  1PDZ A;  5LV9 A;  2YLX A;  1DNC A;  3AD9 B;  1KSU A;  3ADA B;  4J31 A;  3OTR A;  2TMD A;  1YQZ A;  3NGC X;  4K2X A;  3FV9 A;  1S7M A;  2GGI A;  2XFO A;  1XS2 A;  1TDO A;  1N4V A;  1MO9 A;  2GH5 A;  3FMW A;  2Y6R A;  2BXR A;  2GR3 A;  3GWF A;  2BAC A;  1F9C A;  3K7M X;  5U25 A;  3T0K A;  4C74 A;  1S3B A;  2YG6 A;  3P9U A;  2B76 A;  3HYX A;  2CHR A;  4YXD A;  3T37 A;  4YSX A;  1Y56 B;  4Z24 A;  4J1O A;  2BXS A;  4P9S A;  4FP1 A;  4H2Q A;  2POZ A;  1GOS A;  4EQW A;  2HZG A;  2BK5 A;  1O95 A;  3P1W A;  2GEW A;  5DBJ A;  1D7Y A;  4JNA A;  3H12 A;  3ICS A;  4H4Z A;  2C67 A;  3ALM A;  1MNS A;  2CUL A;  2Z5Y A;  3UJF A;  3B97 A;  4OPC A;  3AE2 A;  2X3N A;  3U4F A;  1Q1W A;  2C7G A;  4J34 A;  3A7U A;  3I6D A;  4BK3 A;  3AE7 A;  3LXD A;  3VRD B;  1PBE A;  4EMJ A; 
#chains in the Genus database with same CATH homology
 1PN0 A;  2B9Y A;  4REK A;  5C3J A;  2V60 A;  1N4U A;  2BAB A;  3ALL A;  3HZL A;  3DJD A;  4BJZ A;  1KF6 A;  3CND A;  3CPJ G;  1GTH A;  2R46 A;  3AE8 A;  1ZOY A;  2R0P A;  5HY5 A;  4FK1 C;  2XVI A;  1JNZ A;  4UDR A;  1KNR A;  1GRG A;  2GAH B;  1L9D A;  3M13 A;  1GRF A;  2GQW A;  3CNT A;  1L9E A;  3P4P A;  1GRE A;  3PVC A;  3BI5 A;  3OC4 A;  4CY6 A;  3FPZ A;  4J56 A;  1RYI A;  3QSM A;  3KKJ A;  1PHH A;  1B8S A;  1P2E A;  4Z2U A;  3UOX A;  2YAU A;  1RSG A;  4X4J A;  1ZP0 A;  2BYB A;  4H4X A;  2C3D A;  1KFY A;  2Z5X A;  5FS7 A;  3VRB A;  1XDI A;  3GMB A;  3HYV A;  1ZDL A;  1Q1R A;  3EAN A;  4WCT A;  3UTG A;  5BRT A;  5KVH A;  1GES A;  4EM3 A;  2BK4 A;  5IQ1 A;  3CTY A;  2Q7V A;  2XDO A;  4K7Z A;  4TM3 A;  1D4E A;  2B9W A;  1IUV A;  2R0C A;  1SEZ A;  3GYI A;  3H4K A;  3NG7 X;  4U8K A;  4O5Q A;  3NTA A;  2VVM A;  2XVF A;  3BHK A;  4II2 A;  5HHF A;  1NHQ A;  1E1K A;  4FX9 A;  5CQF A;  1K0J A;  2APG A;  1PDH A;  2F5Z A;  1LV0 A;  4YTN A;  5KMP A;  3DJE A;  1NG4 A;  3QJ4 A;  1NHR A;  3R9U A;  2V3B A;  2WP9 A;  4TLX A;  1JNR A;  1EL8 A;  5KOW A;  1DOB A;  5JCI A;  3F8R A;  4B64 A;  2R9Z A;  1CHU A;  4H4S A;  1BGJ A;  2YWL A;  1GET A;  1ZX9 A;  2AR8 A;  4K5R A;  1ZY8 A;  3GD3 A;  2PHH A;  2RGH A;  1JRY A;  2XLS A;  3DA1 A;  5JCL A;  2WU2 A;  3BI2 A;  2YVJ A;  3KPF A;  3UP5 A;  4EM4 A;  1E1M A;  3NNE A;  5GSN A;  1S2Q A;  1Q9I A;  3SFE A;  1EL7 A;  1L9C A;  2A8X A;  2GV8 A;  4ZCD A;  4OPL A;  3LJP A;  2C4C A;  1H2I A;  3FG2 P;  3CIR A;  4Z43 A;  4DNA A;  3ALJ A;  1ELI A;  1YQ4 A;  1NHP A;  5HYM A;  3BHF A;  4JQ9 A;  2NVK X;  3KU9 A;  4H50 A;  2X8C A;  2WES A;  4X9N A;  3AWI A;  4EQR A;  3SZ0 A;  4J33 A;  3UP4 A;  3COX A;  3UOZ A;  4G6G A;  1O5W A;  1IJH A;  2XVJ A;  3I3L A;  3NN0 X;  3GSI A;  3KLJ A;  5ER0 A;  3P4R A;  4A5L A;  3CPH G;  4BK1 A;  4NEW A;  1CC6 A;  3ZYX A;  2VOU A;  1GER A;  2X50 A;  3SQP A;  4G74 A;  4U8L A;  2BK3 A;  3AED A;  1CBO A;  2YLS A;  4J36 A;  3AB1 A;  3RP8 A;  1JOA A;  4YTP A;  2X99 A;  2QA2 A;  3HYW A;  2BRY A;  3C4A A;  4Y4M A;  3SXI A;  1TDE A;  3GRS A;  5IQ4 A;  2JB2 A;  2BS2 A;  3LAD A;  2C66 A;  4YKG A;  1TRB A;  1CJ2 A;  1CF3 A;  3JSK A;  2DKH A;  4FK1 A;  1JRX A;  5CKU A;  4CRT A;  4YSH A;  4HA6 A;  2YVF A;  4TM1 A;  3F8D A;  2YM1 A;  4G6H A;  4C3Y A;  5TR3 A;  1TDN A;  3C4N A;  2FJA A;  2XFQ A;  3GYX A;  3KPK A;  3AYJ A;  3SZF A;  3V3O A;  4AP3 A;  2ARD A;  2YG7 A;  4I58 A;  4U8P A;  1GEU A;  4YSZ A;  3ZDN A;  2YR5 A;  2WOI A;  2XVE A;  4K22 A;  3RHA A;  1YQ3 A;  1NPX A;  2OAL A;  3RP7 A;  3DK8 A;  5KWF A;  1H84 A;  3URH A;  5KMR A;  4KPR A;  1IUW A;  1LTX R;  1LPF A;  2YG5 A;  4RG4 A;  1E6E A;  3H8L A;  2V61 A;  4KX6 A;  2YVG A;  3M12 A;  1F8R A;  3NH3 X;  1PJ5 A;  1GRA A;  3AEF A;  4AT0 A;  3CGB A;  2WET A;  2V5Z A;  2C65 A;  4YT0 A;  1PJ7 A;  4AOS A;  4U8N A;  3NN6 X;  1FL2 A;  3G5S A;  1GRB A;  3AE5 A;  3NYE A;  1FEA A;  4OVI A;  3WE0 A;  4LII A;  2BS3 A;  2GVC A;  3K7T A;  1RP0 A;  4GUV A;  3DK4 A;  1H6V A;  5JCK A;  1CC4 A;  2WHD A;  3UTF A;  3VQR A;  4AOX A;  3UOY A;  1F6M A;  1PS9 A;  4H4Q A;  1OJA A;  4A99 A;  3FIM B;  1EL5 A;  3PO7 A;  3V3N A;  1XPQ A;  4EQS A;  3T2K A;  3DH9 A;  1H86 A;  2OLO A;  2QCU A;  4M52 A;  4H2P A;  4H4Y A;  1NEK A;  4BUR A;  4APN A;  4Z25 A;  1YKJ A;  2EQ8 A;  3O0H A;  2AAQ A;  3GDP A;  5EB5 A;  2CFY A;  2YQU A;  3P4S A;  1FEB A;  2V6O A;  3NTD A;  2X8G A;  3C96 A;  2GR0 A;  1XAN A;  1NAA A;  2Y6Q A;  3SYI A;  3LZX A;  3AYL A;  1VDC A;  4NTE A;  1BF3 A;  2Q6U A;  5KOX A;  2BA9 A;  4GDP A;  4H7U A;  1IUS A;  2C73 A;  2GB0 A;  2ZZC A;  3ICT A;  2YR6 A;  4A65 A;  4GCM A;  1GT8 A;  3Q9T A;  4D03 A;  3D8X A;  4CBQ A;  1EBD A;  4II3 A;  1MOK A;  1VG9 A;  2C75 A;  3E1T A;  4B67 A;  1E1L A;  4LU6 A;  3SX6 A;  1TYT A;  2BC1 A;  4U2S A;  2IVE A;  3II4 A;  4U8I A;  1GXF A;  3S5W A;  2H88 A;  3CNS A;  2AQJ A;  2RAB A;  2ZBW A;  2BCP A;  2YLW A;  4B63 A;  2YG3 A;  2XLR A;  3AE6 A;  1COY A;  3IWA A;  2A87 A;  3RED A;  2JB1 A;  1QJD A;  1IUT A;  3NK0 X;  4G73 A;  2EQ7 A;  2UZZ A;  2ZZ0 A;  1ZKQ A;  3QSE A;  4ECH A;  2XVH A;  3EPT A;  3RP6 A;  4GR1 A;  4RG3 A;  3UOV A;  1OJC A;  1ZMD A;  2I0Z A;  2JAE A;  3NK2 X;  5JCN A;  4B65 A;  4NZH A;  4U8M A;  1BKW A;  1S2Y A;  5U1O A;  5BUL A;  3B6D A;  1FOH A;  3IHG A;  4K5S A;  4CCR A;  3VR9 A;  5KNL A;  2IVD A;  2J3N A;  3GRT A;  3UKA A;  4GRT A;  1PXB A;  2O9Z A;  1K0I A;  1L0V A;  3ATQ A;  2YLR A;  3CNJ A;  2CVJ A;  2E5V A;  4YWO A;  4H2N A;  2DKI A;  4JDR A;  4GF7 A;  4IA5 A;  2VVL G;  1ZK7 A;  3DK9 A;  1D4C A;  5KMQ A;  4A6N A;  4LA1 A;  1TDF A;  1FEC A;  2OA1 A;  1S3E A;  2RGO A;  4EIQ A;  2A89 A;  4NTC A;  4O5U A;  3Q6J A;  1REO A;  3H8I A;  1BZL A;  3NKS A;  2IID A;  4BK2 A;  2Q0K A;  5KRQ A;  3GDN A;  3ICR A;  4WX1 A;  3CN8 A;  2XLP A;  4Y4N A;  3SZW A;  3UKP A;  2YG4 A;  1OJ9 A;  2EQ9 A;  1H83 A;  3AEA A;  2GQF A;  3GD4 A;  4H4U A;  4ZCC A;  4U8J A;  4XWR A;  3UKH A;  2OLN A;  4C3X A;  4XWZ A;  4H4V A;  4OPD A;  5FS9 A;  1CJ3 A;  1PBC A;  2Q0L A;  1W4X A;  4NEV A;  4UDQ A;  3UKF A;  3ITJ A;  3QFA A;  4ADW A;  1E1N A;  3FBS A;  3AEE A;  3UTE A;  1NHS A;  2BC0 A;  5L46 A;  2R4E A;  3ATR A;  3LZW A;  4YTM A;  4A6N B;  2C70 A;  1TYP A;  2WS3 A;  4Y4L A;  1GSN A;  2E4G A;  2ZZB A;  4J57 A;  4A79 A;  1DOD A;  2ACZ A;  4OPU A;  3QSS A;  2WDV A;  1M6I A;  4B1B A;  2VRM A;  4IVO B;  2HQM A;  2BRA A;  2GRT A;  3CGC A;  2YLT A;  4A9W A;  3CGD A;  1PXA A;  1LQU A;  5FS6 A;  2B7R A;  1H7X A;  1DXL A;  1X31 B;  2XLT A;  4HB9 A;  4IVM B;  1K0L A;  3AD7 B;  4U2L A;  4U8O A;  3T2Y A;  4Z26 A;  2E1M A;  3SGL A;  2GR2 A;  1AOG A;  2QAE A;  5BVA A;  2JBV A;  2WU5 A;  4TM4 A;  4H4T A;  2VZ2 A;  3NRN A;  5HXI A;  3SY4 A;  4NWZ A;  2R0G A;  4TLZ A;  5U63 A;  2W0H A;  5FS8 A;  1O94 A;  3M0O A;  3GMC A;  4GDE A;  1GRH A;  5JCM A;  5KXJ A;  2WPC A;  3CNP A;  3DJG X;  3NYF A;  4I59 A;  2B9X A;  3D9X A;  3UKK A;  4K8D A;  4UP3 A;  1CJ4 A;  2XFP A;  1E39 A;  5JRB A;  3EF6 A;  3G5R A;  3CMM A;  2BS4 A;  2WDQ A;  1ONF A;  1D4D A;  3AE9 A;  1QLB A;  4OPI A;  3SZC A;  1K4Q A;  5FMH A;  3OZ2 A;  2R45 A;  2C3C A;  3CGE A;  2VVL A;  3NK1 X;  2V3A A;  4YKF A;  1H7W A;  4MJW A;  4Z2T A;  4Z2R A;  4OCG A;  1F8S A;  2C64 A;  3AXB A;  4USQ A;  2JB3 A;  3PS9 A;  4H2R A;  4EIP A;  1GND A;  3K7Q X;  4H4R A;  3AD8 B;  4J2W A;  4FDC B;  1ZMC A;  2WPE A;  4BV6 A;  3L1R A;  3NYC A;  2GF3 A;  1B4V A;  1GAL A;  1PXC A;  3AYI A;  3T2Z A;  4OPT A;  1M64 A;  1GRT A;  2NPX A;  3SM8 A;  1TDK A;  2YLZ A;  3L8K A;  3UCL A;  1NEN A;  4EQX A;  1CJC A;  2RGJ A;  2EQ6 A;  1EL9 A;  4E0V A;  4D04 A;  2R4J A;  4DSH A;  2WDR A;  2FJB A;  4USR A;  1Y0P A;  2VQB A;  3AE3 A;  3KD9 A;  3T31 A;  3CPI G;  3S61 A;  1NG3 A;  1YY5 A;  4XXG A;  1IUU A;  1DJQ A;  2XFU A;  5M0Z A;  1E7P A;  2VRL A;  2FBW A;  2GR1 A;  1GV4 A;  5EOW A;  1OJD A;  5J7X A;  4C5O A;  1D5T A;  1LQT A;  5LV9 A;  2YLX A;  4CY8 A;  2WEU A;  1DNC A;  1CL0 A;  3AD9 B;  4DGK A;  1ZOV A;  1PBB A;  3AE1 A;  3IF9 A;  3KA7 A;  3RNM A;  1D7L A;  3PG6 A;  2XYO A;  1DOC A;  1KSU A;  3ADA B;  1B5Q A;  1CC2 A;  1N4W A;  3AEC A;  4J31 A;  4NTD A;  4OPG A;  2TMD A;  1YQZ A;  3KVE A;  3NGC X;  2XCG A;  1QO8 A;  4K2X A;  4ZN0 A;  1H81 A;  4X9M A;  3EAO A;  4JN9 A;  1Y56 A;  3AEB A;  3QVP A;  5GRT A;  1GTE A;  4G9K A;  1S7M A;  1KNP A;  1GPE A;  2XFN A;  1VQW A;  1PBF A;  2JK6 A;  2XFO A;  1P2H A;  1VG0 A;  4DSG A;  4TM0 A;  1JEH A;  3GWD A;  4RSL A;  4C77 A;  2CDU A;  3DJJ A;  1TDO A;  1PJ6 A;  1B37 A;  3B3R A;  1PBD A;  1N4V A;  1MO9 A;  2GH5 A;  2C72 A;  2TPR A;  2BXR A;  2Y6R A;  3FMW A;  4IV9 A;  3V76 A;  1V59 A;  2GR3 A;  2YR4 A;  2JKC A;  3GWF A;  1LVL A;  2BAC A;  4PAB A;  4BJY A;  1H82 A;  2GAG B;  2VQ7 A;  3K7M X;  4B68 A;  5KMS A;  2QA1 A;  1KSS A;  3ISH A;  3K30 A;  4JY3 A;  1XHC A;  5U25 A;  3IC9 A;  3IHM A;  3UTH A;  4UDP A;  5C2T A;  2FJD A;  3T0K A;  2BCG G;  4C74 A;  4A7A A;  3GYJ A;  1S3B A;  2YG6 A;  3P9U A;  3VR8 A;  4EMJ A;  2XLU A;  2B76 A;  3HYX A;  4YXD A;  3T37 A;  1LJ1 A;  4YSX A;  1BGN A;  1Y56 B;  3ABV A;  4Z24 A;  2WOW A;  3G5Q A;  2BXS A;  3T14 A;  5IPY A;  4AP1 A;  3LB8 A;  2H89 A;  4P9S A;  4ICY A;  4CCQ A;  4IA6 A;  3VRA A;  4H2Q A;  1MXT A;  3AEG A;  4YSY A;  2WOV A;  3P4Q A;  4CNJ A;  1IUX A;  1GOS A;  2GMH A;  4EQW A;  4Z44 A;  4N9X A;  3NT6 A;  3DGH A;  4PAA A;  3NLC A;  4JNQ A;  2BK5 A;  1O95 A;  3P1W A;  2GEW A;  5DBJ A;  4B69 A;  4JY2 A;  3NIX A;  2X8H A;  1D7Y A;  1VRQ B;  4JNA A;  5J60 A;  1UKV G;  3SFD A;  3ICS A;  4H4Z A;  2C67 A;  3ALM A;  3DGZ A;  1JU2 A;  3BNM A;  4B66 A;  1BWC A;  2OAM A;  3NHO X;  3UKL A;  1KDG A;  2FJE A;  4GAV A;  4U2T A;  2CUL A;  2WQY A;  3BNU A;  4GAP A;  2Z5Y A;  5KVI A;  1DOE A;  4H4W A;  1OJT A;  2WBA A;  1KN0 A;  1F3P A;  2YM2 A;  4OPC A;  4EMI A;  1Z6L A;  3AE2 A;  1HYU A;  3L5O A;  4AT2 A;  2X3N A;  3F8P A;  2WP6 A;  1FCD A;  2C76 A;  1Q1W A;  3QFB A;  2C7G A;  3D1C A;  3LOV A;  4J34 A;  3DME A;  5BUK A;  1F8W A;  3BI4 A;  3UKQ A;  3I6D A;  2GMJ A;  5M10 A;  2WPF A;  4NNJ A;  4BK3 A;  3AE7 A;  4CNK A;  1NDA A;  4EMW A;  2WP5 A;  3LXD A;  1DJN A;  3QVR A;  4H4P A;  3VRD B;  1PBE A;  5EB4 A;  1N1P A;  3AE4 A;  5EBK A;  2PYX A;  2B7S A;  1JRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...