3PG6A

The carboxyl terminal domain of human deltex 3-like
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
b'QKGNQPEGSMVFTVSRDSLPGYESFGTIVITYSMKAGIQTEEHPNPGKRYPGIQRTAYLPDNKEGRKVLKLLYRAFDQKLIFTVGYSRVLGVSDVITWNDIHHKTSRFGGPEMYGYPDPSYLKRVKEELKAKGIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase DTX3L
publication title Fold of the conserved DTC domain in Deltex proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 37
structure length 135
sequence length 135
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18102 DTC Deltex C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.130 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3pg6A00
3PG6A
chains in the Genus database with same CATH superfamily
3L8KA 4ROPA 1JROA 2DW7A 3QFBA 3R11A 3Q6JA 5JCNA 1MRAA 2V6OA 4DYEA 1BKHA 1SJAA 2GH5A 2P3ZA 2ZZBA 4K7ZA 2WOIA 1ZK7A 3IJIA 2AL1A 3PG6A 2PTYA 3UJSA 1EC8A 2YVJA 5EU9A 1LVLA 1ZDLA 4MKSA 2PU0A 3ZVHB 3CAWA 2HZGA 4H4PA 5FS7A 1V97A 2XGZA 3PWIA 4K1WA 1GRFA 4G7FA 3JW7A 3DESA 1VDVA 4G8TA 1F8WA 3TCSA 3ZLGA 1Q1RA 2ZZCA 3FV9A 3UJEA 2R9ZA 3HRDC 1XDIA 3HPFA 3DERA 1EBDA 3URHA 3T4WA 4JN8A 4H4QA 3H70A 5G5HB 4IT1A 1NPXA 3SN0A 3SN4A 3S47A 3UXLA 1PDZA 3QKEA 3K1GA 1TKKA 3LXDA 3T8QA 1JEHA 1XANA 2I5QA 2OFJA 2ZZ0A 1GRBA 1GXFA 3DEQA 3B97A 1XPYA 2OO6A 3TW9A 2PGWA 2QGYA 3R07C 4ENLA 4H1ZA 1NHRA 3ZVIA 3VC5A 1DTNA 2AL2A 2GGGA 5FS6A 3UJRA 3R25A 3H12A 2P0IA 1EC9A 2OZ3A 3DJJA 2PP1A 3FVDA 3OZMA 4H4RA 3UCCA 3NVZB 1D7YA 4M6UA 3EUB3 3VCNA 4E5TA 1FIQB 1K4QA 2RDXA 2QQ6A 2W55A 3GC2A 3VFCA 5FJRA 1SJDA 2ZADA 4HYRA 3NS1B 1DXLA 2P88A 3QTPA 2WOWA 1AOGA 4X2PA 4DN1A 2NPXA 3NVWB 5BOEA 5FJUA 3CT2A 4A3RA 1E9IA 3SBFA 2XH7A 2E5AA 2OPJA 1KN0A 3TWBA 2XH4A 2JK6A 4KT2A 1XHCA 1DNCA 3RRAA 4EWJA 2PODA 4EQRA 4GYPA 3GRTA 1N63C 3A7AA 5GRTA 5EBKA 3SQSA 5ENLA 1GREA 2GDQA 2EQ9A 1BQGA 4DWDA 2WOVA 4BV6A 1NHPA 4H19A 4A6GA 3RO6A 3DG6A 1GRHA 3RNMA 1P48A 1RVKA 4IL0A 1GSNA 3CYJA 2HQMA 5FS8A 4H83A 4HPNA 3EEZA 2XSXA 4HNLA 4IL2A 2XH0A 5KVHA 3QN3A 1NHSA 4H2HA 1N60C 2AKMA 1ZMCA 4IP5A 3GD6A 4J3ZA 1GETA 3CGBA 4H4WA 4DXKA 2WBAA 3N6HA 3R0KA 5ER0A 1T3QC 2PTZA 2W54A 3GD4A 2GGEA 1ONFA 3FJ4A 1JPDX 2PCEA 3FCPA 4ZA0A 4A35A 3GRSA 4GGBA 2NVKX 4NEWA 2GR0A 2GGJA 1N62C 2C3CA 3NZGA 3RR1A 1ECQA 1MNSA 4LIIA 4FX9A 3I6EA 3A7RA 2P8BA 3AN1A 1S7MA 3U4FA 4EM3A 3VA8A 3H8AA 2HXTA 3DG7A 1FECA 3DK4A 3QLDA 2QJJA 3ZLHA 3FYYA 5JCMA 3VC6A 2PA6A 1NHQA 3BOXA 1ZY8A 3NVYB 4EMIA 2X8CA 2GR3A 2X50A 2PGEA 3DFYA 4DNAA 2OVLA 4HCLA 1MOKA 2QDDA 2OQHA 1YQZA 3R1ZA 2V3BA 3H7VA 2FKPA 1SJBA 1N5XA 3Q4DA 3MZNA 4KWSA 4H4YA 4GIRA 2PPGA 3STPA 3U9IA 3Q45A 3DH9A 2OG9A 1GERA 3VCCA 2PP3A 4GR1A 4E8GA 5JCLA 3TJIA 1JDFA 3PK7A 4FDCB 2P8CA 3D47A 2W3RA 3AM9A 2ZC8A 3UJFA 1JCTA 3QFAA 3RGTA 2WPEA 1F3PA 1JPMA 2YAUA 3GD3A 4GYPC 1X2HA 1EBHA 4KEMA 1W6TA 1LPFA 2GQWA 2HNEA 1MDLA 1JRPA 2GRTA 4GRTA 1F9CA 1X2GA 4H4XA 3EKGA 2PMQA 3II4A 3V5FA 1ZXIC 3DG3A 4JQ9A 3ES8A 2GR1A 2OX4A 4E6MA 1GV4A 3OW1A 2W0HA 3UCDA 5U1OA 4IHCA 1BZLA 2QJNA 2PTXA 2EQ7A 4JDRA 5JCKA 4H4VA 1L8PA 5JCIA 2F5ZA 1ONEA 2WP6A 2PS2A 1MO9A 2A8XA 1GRGA 1N5WC 3CGEA 4FP1A 3OPSA 4KPLA 1ZMDA 3OZYA 3DK9A 3EANA 3N4EA 3ZVHA 3L5OA 3B9JB 1Q1WA 3DGBA 3V5CA 1BWCA 4E4FA 2GR2A 3PWGA 4MMWA 3IK4A 3THUA 1STZA 4F4RA 5U25A 1YEYA 5IDZA 4LA1A 3ZLFA 4K8GA 1FFVC 2WP5A 3UXKA 1KKRA 3LB8A 2OKTA 3ENLA 2FYMA 2PSNA 1FEBA 1SB3B 2WPCA 3R10A 4IZGA 3MKCA 2NQLA 2QDEA 3CK5A 2BC1A 3T9PA 3MY9A 4FI4A 1GRAA 2AL2B 3OTRA 1V59A 3FXGA 1OJTA 5J04A 3CXOA 3R0UA 3SSZA 3TWAA 2V3AA 1GEUA 2AKZA 3V4BA 1WUFA 2RABA 3NRZB 4H4SA 7ENLA 3TJ4A 2YVFA 3SQPA 2GL5A 3JZUA 4ZCWA 4EMWA 1JOAA 1ELSA 2BC0A 3N6JA 1EBGA 4K2SA 2DW6A 4EQWA 2X8GA 1H2IA 1OEPA 1KD0A 3NO1A 1SJCA 2MUCA 3NVVB 1R6WA 3MUCA 2W3SA 5FS9A 3CXBA 3T6CA 4E4UA 2X99A 4MGGA 4TVWA 1NDAA 5KVIA 2YVGA 3S5SA 3N4FA 3P3BA 3UGVA 1RM6B 1TZZA 2EQ8A 1ZX9A 1P43A 3UJ2A 3MSYA 5FJTA 3OC4A 2E3TA 5FMHA 1GRTA 3QPEA 2ONEA 3MWCA 1FFUC 1KKOA 2GSHA 4JHMA 5JRBA 1NU5A 2PTWA 3TTEA 3IC9A 6ENLA 4H4TA 2QAEA 1M6IA 3SR6B 3DGZA 4GGHA 3V3WA 3O0HA 2J3NA 1WYGA 2X8HA 1FO4A 2CDUA 4H50A 4IP4A 2OQYA 4GISA 4EQSA 3MQTA 2CHRA 2XH2A 1XS2A 3A7UA 5BOFA 3HW2A 3SJNA 3P93A 2WPFA 3BSMA 4H4UA 4YWOA 2OZTA 3CGCA 3I6TA 2BCPA 2O56A 4JN7A 5G5GB 4ADWA 1FEAA 4EM4A 3RCYA 4Z1YA 3PFRA 1TYTA 4GMEA 5TR3A 3SN1A 3DIPA 5FJPA 4GFIA 4J56A 3IJLA 3LADA 2AAQA 4KPRA 1IYXA 3VDGA 4ZOHB 2OLAA 2MNRA 3TQPA 1H6VA 4TVYA 2POZA 1NELA 3DDMA 1ZKQA 3KLJA 3D9XA 1VQZA 2CFYA 3DGHA 3ETRB 3GO2A 3I4KA 2EQ6A 1TE6A 3AMZA 3D46A 2QVHA 2TPRA 4EQXA 1TYPA 3NXLA 1N61C 4APNA 2GGIA 2PP0A 1PDYA 3DJGX 1MDRA 3IJQA 3JVAA 4J57A 4K8DA 4Z17A 1EC7A 1GESA 2PU1A 2HXUA 3EAOA 3BJSA 3EF6A 3ES7A 4EMJA 3RITA 4HNCA 4HN8A 1KCZA 3P0WA 2OZ8A 4M52A 4DX3A 4NEVA 1WUEA 2C3DA 3CB3A 3TOYA 4DHGA 3FG2P 3NFUA 5FJOA 4YWSA 4HCHA 1R0MA 4M0XA 4HCDA 2QJMA 3KUMA 4J1OA 1MUCA 3OP2A 3H4KA 2GGHA 3DFHA 3GY1A 1FHUA 3DK8A 4H4ZA 4BURA 3CGDA 1FHVA 2YQUA
chains in the Genus database with same CATH topology
2GR1A 3DGZA 3GRTA 3O0HA 3L8KA 1GV4A 5GRTA 5EBKA 2W0HA 3QFBA 2J3NA 1GREA 2X8HA 5U1OA 3Q6JA 2CDUA 2EQ9A 4H50A 1BZLA 2WOVA 1NHPA 2V6OA 4BV6A 5JCNA 2EQ7A 4JDRA 4EQSA 5JCKA 4H4VA 2ZZBA 2GH5A 2F5ZA 1GRHA 2WP6A 4K7ZA 3RNMA 2WOIA 5JCIA 1MO9A 1ZK7A 2A8XA 3PG6A 1GRGA 1GSNA 3CGEA 2YVJA 4JQ9A 1ZMDA 2HQMA 1LVLA 1ZDLA 5FS8A 3DK9A 3EANA 4H4PA 5FS7A 2WPFA 3L5OA 1Q1WA 1GRFA 4H4UA 4YWOA 1BWCA 5KVHA 1F8WA 1Q1RA 1NHSA 2ZZCA 3CGCA 1ZMCA 2BCPA 2GR2A 1GETA 3CGBA 2R9ZA 4H4WA 5U25A 2WBAA 5ER0A 1XDIA 4LA1A 4ADWA 1FEAA 4EM4A 3GD4A 1EBDA 1ONFA 3URHA 1TYTA 5TR3A 3GRSA 2NVKX 4H4QA 4NEWA 4J56A 2GR0A 1NPXA 2WP5A 3LADA 2C3CA 2AAQA 3LB8A 4KPRA 3LXDA 4LIIA 4FX9A 1JEHA 1XANA 1FEBA 2ZZ0A 2WPCA 1S7MA 1GRBA 1GXFA 4EM3A 2BC1A 1H6VA 1FECA 3DK4A 1GRAA 1NHRA 1V59A 5JCMA 1ZKQA 1OJTA 3KLJA 3D9XA 2CFYA 5FS6A 3DGHA 1NHQA 4EMIA 1ZY8A 2V3AA 1GEUA 2X8CA 2EQ6A 2GR3A 2RABA 2X50A 3DJJA 2TPRA 4DNAA 4EQXA 4H4SA 1TYPA 4H4RA 4APNA 1MOKA 2YVFA 3SQPA 1D7YA 4EMWA 1YQZA 3DJGX 2V3BA 1JOAA 4J57A 4K8DA 2BC0A 1GESA 4H4YA 2X8GA 1H2IA 3EAOA 4EQWA 1K4QA 3EF6A 3DH9A 1GERA 5FS9A 2X99A 4EMJA 4GR1A 1NDAA 5JCLA 1DXLA 1AOGA 2WOWA 4FDCB 2YVGA 5KVIA 4M52A 2NPXA 4NEVA 2EQ8A 1ZX9A 2C3DA 3QFAA 3OC4A 2WPEA 5FMHA 1F3PA 1GRTA 2YAUA 3GD3A 3FG2P 1LPFA 2GQWA 2GRTA 4GRTA 5JRBA 1KN0A 4H4XA 3IC9A 2JK6A 3II4A 4H4TA 1XHCA 1DNCA 1M6IA 2QAEA 3H4KA 3DK8A 4H4ZA 4BURA 4EQRA 3CGDA 2YQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PG6 A; 
#chains in the Genus database with same CATH topology
 3L8K A;  4ROP A;  1JRO A;  2DW7 A;  3QFB A;  3R11 A;  3Q6J A;  5JCN A;  1MRA A;  2V6O A;  4DYE A;  1BKH A;  1SJA A;  2GH5 A;  2P3Z A;  2ZZB A;  4K7Z A;  2WOI A;  1ZK7 A;  3IJI A;  2AL1 A;  3PG6 A;  2PTY A;  3UJS A;  1EC8 A;  2YVJ A;  5EU9 A;  1LVL A;  1ZDL A;  4MKS A;  2PU0 A;  3ZVH B;  3CAW A;  2HZG A;  4H4P A;  5FS7 A;  1V97 A;  2XGZ A;  3PWI A;  4K1W A;  1GRF A;  4G7F A;  3JW7 A;  3DES A;  1VDV A;  4G8T A;  1F8W A;  3TCS A;  3ZLG A;  1Q1R A;  2ZZC A;  3FV9 A;  3UJE A;  2R9Z A;  3HRD C;  1XDI A;  3HPF A;  3DER A;  1EBD A;  3URH A;  3T4W A;  4JN8 A;  4H4Q A;  3H70 A;  5G5H B;  4IT1 A;  1NPX A;  3SN0 A;  3SN4 A;  3S47 A;  3UXL A;  1PDZ A;  3QKE A;  3K1G A;  1TKK A;  3LXD A;  3T8Q A;  1JEH A;  1XAN A;  2I5Q A;  2OFJ A;  2ZZ0 A;  1GRB A;  1GXF A;  3DEQ A;  3B97 A;  1XPY A;  2OO6 A;  3TW9 A;  2PGW A;  2QGY A;  3R07 C;  4ENL A;  4H1Z A;  1NHR A;  3ZVI A;  3VC5 A;  1DTN A;  2AL2 A;  2GGG A;  5FS6 A;  3UJR A;  3R25 A;  3H12 A;  2P0I A;  1EC9 A;  2OZ3 A;  3DJJ A;  2PP1 A;  3FVD A;  3OZM A;  4H4R A;  3UCC A;  3NVZ B;  1D7Y A;  4M6U A;  3EUB 3;  3VCN A;  4E5T A;  1FIQ B;  1K4Q A;  2RDX A;  2QQ6 A;  2W55 A;  3GC2 A;  3VFC A;  5FJR A;  1SJD A;  2ZAD A;  4HYR A;  3NS1 B;  1DXL A;  2P88 A;  3QTP A;  2WOW A;  1AOG A;  4X2P A;  4DN1 A;  2NPX A;  3NVW B;  5BOE A;  5FJU A;  3CT2 A;  4A3R A;  1E9I A;  3SBF A;  2XH7 A;  2E5A A;  2OPJ A;  1KN0 A;  3TWB A;  2XH4 A;  2JK6 A;  4KT2 A;  1XHC A;  1DNC A;  3RRA A;  4EWJ A;  2POD A;  4EQR A;  4GYP A;  3GRT A;  1N63 C;  3A7A A;  5GRT A;  5EBK A;  3SQS A;  5ENL A;  1GRE A;  2GDQ A;  2EQ9 A;  1BQG A;  4DWD A;  2WOV A;  4BV6 A;  1NHP A;  4H19 A;  4A6G A;  3RO6 A;  3DG6 A;  1GRH A;  3RNM A;  1P48 A;  1RVK A;  4IL0 A;  1GSN A;  3CYJ A;  2HQM A;  5FS8 A;  4H83 A;  4HPN A;  3EEZ A;  2XSX A;  4HNL A;  4IL2 A;  2XH0 A;  5KVH A;  3QN3 A;  1NHS A;  4H2H A;  1N60 C;  2AKM A;  1ZMC A;  4IP5 A;  3GD6 A;  4J3Z A;  1GET A;  3CGB A;  4H4W A;  4DXK A;  2WBA A;  3N6H A;  3R0K A;  5ER0 A;  1T3Q C;  2PTZ A;  2W54 A;  3GD4 A;  2GGE A;  1ONF A;  3FJ4 A;  1JPD X;  2PCE A;  3FCP A;  4ZA0 A;  4A35 A;  3GRS A;  4GGB A;  2NVK X;  4NEW A;  2GR0 A;  2GGJ A;  1N62 C;  2C3C A;  3NZG A;  3RR1 A;  1ECQ A;  1MNS A;  4LII A;  4FX9 A;  3I6E A;  3A7R A;  2P8B A;  3AN1 A;  1S7M A;  3U4F A;  4EM3 A;  3VA8 A;  3H8A A;  2HXT A;  3DG7 A;  1FEC A;  3DK4 A;  3QLD A;  2QJJ A;  3ZLH A;  3FYY A;  5JCM A;  3VC6 A;  2PA6 A;  1NHQ A;  3BOX A;  1ZY8 A;  3NVY B;  4EMI A;  2X8C A;  2GR3 A;  2X50 A;  2PGE A;  3DFY A;  4DNA A;  2OVL A;  4HCL A;  1MOK A;  2QDD A;  2OQH A;  1YQZ A;  3R1Z A;  2V3B A;  3H7V A;  2FKP A;  1SJB A;  1N5X A;  3Q4D A;  3MZN A;  4KWS A;  4H4Y A;  4GIR A;  2PPG A;  3STP A;  3U9I A;  3Q45 A;  3DH9 A;  2OG9 A;  1GER A;  3VCC A;  2PP3 A;  4GR1 A;  4E8G A;  5JCL A;  3TJI A;  1JDF A;  3PK7 A;  4FDC B;  2P8C A;  3D47 A;  2W3R A;  3AM9 A;  2ZC8 A;  3UJF A;  1JCT A;  3QFA A;  3RGT A;  2WPE A;  1F3P A;  1JPM A;  2YAU A;  3GD3 A;  4GYP C;  1X2H A;  1EBH A;  4KEM A;  1W6T A;  1LPF A;  2GQW A;  2HNE A;  1MDL A;  1JRP A;  2GRT A;  4GRT A;  1F9C A;  1X2G A;  4H4X A;  3EKG A;  2PMQ A;  3II4 A;  3V5F A;  1ZXI C;  3DG3 A;  4JQ9 A;  3ES8 A;  2GR1 A;  2OX4 A;  4E6M A;  1GV4 A;  3OW1 A;  2W0H A;  3UCD A;  5U1O A;  4IHC A;  1BZL A;  2QJN A;  2PTX A;  2EQ7 A;  4JDR A;  5JCK A;  4H4V A;  1L8P A;  5JCI A;  2F5Z A;  1ONE A;  2WP6 A;  2PS2 A;  1MO9 A;  2A8X A;  1GRG A;  1N5W C;  3CGE A;  4FP1 A;  3OPS A;  4KPL A;  1ZMD A;  3OZY A;  3DK9 A;  3EAN A;  3N4E A;  3ZVH A;  3L5O A;  3B9J B;  1Q1W A;  3DGB A;  3V5C A;  1BWC A;  4E4F A;  2GR2 A;  3PWG A;  4MMW A;  3IK4 A;  3THU A;  1STZ A;  4F4R A;  5U25 A;  1YEY A;  5IDZ A;  4LA1 A;  3ZLF A;  4K8G A;  1FFV C;  2WP5 A;  3UXK A;  1KKR A;  3LB8 A;  2OKT A;  3ENL A;  2FYM A;  2PSN A;  1FEB A;  1SB3 B;  2WPC A;  3R10 A;  4IZG A;  3MKC A;  2NQL A;  2QDE A;  3CK5 A;  2BC1 A;  3T9P A;  3MY9 A;  4FI4 A;  1GRA A;  2AL2 B;  3OTR A;  1V59 A;  3FXG A;  1OJT A;  5J04 A;  3CXO A;  3R0U A;  3SSZ A;  3TWA A;  2V3A A;  1GEU A;  2AKZ A;  3V4B A;  1WUF A;  2RAB A;  3NRZ B;  4H4S A;  7ENL A;  3TJ4 A;  2YVF A;  3SQP A;  2GL5 A;  3JZU A;  4ZCW A;  4EMW A;  1JOA A;  1ELS A;  2BC0 A;  3N6J A;  1EBG A;  4K2S A;  2DW6 A;  4EQW A;  2X8G A;  1H2I A;  1OEP A;  1KD0 A;  3NO1 A;  1SJC A;  2MUC A;  3NVV B;  1R6W A;  3MUC A;  2W3S A;  5FS9 A;  3CXB A;  3T6C A;  4E4U A;  2X99 A;  4MGG A;  4TVW A;  1NDA A;  5KVI A;  2YVG A;  3S5S A;  3N4F A;  3P3B A;  3UGV A;  1RM6 B;  1TZZ A;  2EQ8 A;  1ZX9 A;  1P43 A;  3UJ2 A;  3MSY A;  5FJT A;  3OC4 A;  2E3T A;  5FMH A;  1GRT A;  3QPE A;  2ONE A;  3MWC A;  1FFU C;  1KKO A;  2GSH A;  4JHM A;  5JRB A;  1NU5 A;  2PTW A;  3TTE A;  3IC9 A;  6ENL A;  4H4T A;  2QAE A;  1M6I A;  3SR6 B;  3DGZ A;  4GGH A;  3V3W A;  3O0H A;  2J3N A;  1WYG A;  2X8H A;  1FO4 A;  2CDU A;  4H50 A;  4IP4 A;  2OQY A;  4GIS A;  4EQS A;  3MQT A;  2CHR A;  2XH2 A;  1XS2 A;  3A7U A;  5BOF A;  3HW2 A;  3SJN A;  3P93 A;  2WPF A;  3BSM A;  4H4U A;  4YWO A;  2OZT A;  3CGC A;  3I6T A;  2BCP A;  2O56 A;  4JN7 A;  5G5G B;  4ADW A;  1FEA A;  4EM4 A;  3RCY A;  4Z1Y A;  3PFR A;  1TYT A;  4GME A;  5TR3 A;  3SN1 A;  3DIP A;  5FJP A;  4GFI A;  4J56 A;  3IJL A;  3LAD A;  2AAQ A;  4KPR A;  1IYX A;  3VDG A;  4ZOH B;  2OLA A;  2MNR A;  3TQP A;  1H6V A;  4TVY A;  2POZ A;  1NEL A;  3DDM A;  1ZKQ A;  3KLJ A;  3D9X A;  1VQZ A;  2CFY A;  3DGH A;  3ETR B;  3GO2 A;  3I4K A;  2EQ6 A;  1TE6 A;  3AMZ A;  3D46 A;  2QVH A;  2TPR A;  4EQX A;  1TYP A;  3NXL A;  1N61 C;  4APN A;  2GGI A;  2PP0 A;  1PDY A;  3DJG X;  1MDR A;  3IJQ A;  3JVA A;  4J57 A;  4K8D A;  4Z17 A;  1EC7 A;  1GES A;  2PU1 A;  2HXU A;  3EAO A;  3BJS A;  3EF6 A;  3ES7 A;  4EMJ A;  3RIT A;  4HNC A;  4HN8 A;  1KCZ A;  3P0W A;  2OZ8 A;  4M52 A;  4DX3 A;  4NEV A;  1WUE A;  2C3D A;  3CB3 A;  3TOY A;  4DHG A;  3FG2 P;  3NFU A;  5FJO A;  4YWS A;  4HCH A;  1R0M A;  4M0X A;  4HCD A;  2QJM A;  3KUM A;  4J1O A;  1MUC A;  3OP2 A;  3H4K A;  2GGH A;  3DFH A;  3GY1 A;  1FHU A;  3DK8 A;  4H4Z A;  4BUR A;  3CGD A;  1FHV A;  2YQU A; 
#chains in the Genus database with same CATH homology
 2GR1 A;  3DGZ A;  3GRT A;  3O0H A;  3L8K A;  1GV4 A;  5GRT A;  5EBK A;  2W0H A;  3QFB A;  2J3N A;  1GRE A;  2X8H A;  5U1O A;  3Q6J A;  2CDU A;  2EQ9 A;  4H50 A;  1BZL A;  2WOV A;  1NHP A;  2V6O A;  4BV6 A;  5JCN A;  2EQ7 A;  4JDR A;  4EQS A;  5JCK A;  4H4V A;  2ZZB A;  2GH5 A;  2F5Z A;  1GRH A;  2WP6 A;  4K7Z A;  3RNM A;  2WOI A;  5JCI A;  1MO9 A;  1ZK7 A;  2A8X A;  3PG6 A;  1GRG A;  1GSN A;  3CGE A;  2YVJ A;  4JQ9 A;  1ZMD A;  2HQM A;  1LVL A;  1ZDL A;  5FS8 A;  3DK9 A;  3EAN A;  4H4P A;  5FS7 A;  2WPF A;  3L5O A;  1Q1W A;  1GRF A;  4H4U A;  4YWO A;  1BWC A;  5KVH A;  1F8W A;  1Q1R A;  1NHS A;  2ZZC A;  3CGC A;  1ZMC A;  2BCP A;  2GR2 A;  1GET A;  3CGB A;  2R9Z A;  4H4W A;  5U25 A;  2WBA A;  5ER0 A;  1XDI A;  4LA1 A;  4ADW A;  1FEA A;  4EM4 A;  3GD4 A;  1EBD A;  1ONF A;  3URH A;  1TYT A;  5TR3 A;  3GRS A;  2NVK X;  4H4Q A;  4NEW A;  4J56 A;  2GR0 A;  1NPX A;  2WP5 A;  3LAD A;  2C3C A;  2AAQ A;  3LB8 A;  4KPR A;  3LXD A;  4LII A;  4FX9 A;  1JEH A;  1XAN A;  1FEB A;  2ZZ0 A;  2WPC A;  1S7M A;  1GRB A;  1GXF A;  4EM3 A;  2BC1 A;  1H6V A;  1FEC A;  3DK4 A;  1GRA A;  1NHR A;  1V59 A;  5JCM A;  1ZKQ A;  1OJT A;  3KLJ A;  3D9X A;  2CFY A;  5FS6 A;  3DGH A;  1NHQ A;  4EMI A;  1ZY8 A;  2V3A A;  1GEU A;  2X8C A;  2EQ6 A;  2GR3 A;  2RAB A;  2X50 A;  3DJJ A;  2TPR A;  4DNA A;  4EQX A;  4H4S A;  1TYP A;  4H4R A;  4APN A;  1MOK A;  2YVF A;  3SQP A;  1D7Y A;  4EMW A;  1YQZ A;  3DJG X;  2V3B A;  1JOA A;  4J57 A;  4K8D A;  2BC0 A;  1GES A;  4H4Y A;  2X8G A;  1H2I A;  3EAO A;  4EQW A;  1K4Q A;  3EF6 A;  3DH9 A;  1GER A;  5FS9 A;  2X99 A;  4EMJ A;  4GR1 A;  1NDA A;  5JCL A;  1DXL A;  1AOG A;  2WOW A;  4FDC B;  2YVG A;  5KVI A;  4M52 A;  2NPX A;  4NEV A;  2EQ8 A;  1ZX9 A;  2C3D A;  3QFA A;  3OC4 A;  2WPE A;  5FMH A;  1F3P A;  1GRT A;  2YAU A;  3GD3 A;  3FG2 P;  1LPF A;  2GQW A;  2GRT A;  4GRT A;  5JRB A;  1KN0 A;  4H4X A;  3IC9 A;  2JK6 A;  3II4 A;  4H4T A;  1XHC A;  1DNC A;  1M6I A;  2QAE A;  3H4K A;  3DK8 A;  4H4Z A;  4BUR A;  4EQR A;  3CGD A;  2YQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...