3PG6A

The carboxyl terminal domain of human deltex 3-like
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
QKGNQPEGSMVFTVSRDSLPGYESFGTIVITYSMKAGIQTEEHPNPGKRYPGIQRTAYLPDNKEGRKVLKLLYRAFDQKLIFTVGYSRVLGVSDVITWNDIHHKTSRFGGPEMYGYPDPSYLKRVKEELKAKGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Fold of the conserved DTC domain in Deltex proteins.
pubmed doi rcsb
molecule keywords E3 ubiquitin-protein ligase DTX3L
molecule tags Ligase
source organism Homo sapiens
total genus 37
structure length 135
sequence length 135
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18102 DTC Deltex C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.130 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3pg6A00
3PG6A
chains in the Genus database with same CATH superfamily
4LIIA 4GYPC 4ROPA 4F4RA 3V4BA 3R25A 4MGGA 4H4RA 1YQZA 3NO1A 1OJTA 1BWCA 1FHUA 2NVKX 4IZGA 3D46A 3NVZB 5U25A 4GYPA 4H2HA 2NQLA 2PSNA 3CGCA 2P8CA 2PP3A 3OPSA 1DNCA 4GGBA 1GV4A 4H1ZA 3RGTA 3DK4A 3A7UA 4YWOA 4MKSA 2XH2A 3DGHA 1H6VA 3DK9A 3CXBA 5FS7A 2ZZCA 3SN1A 3B9JB 3VA8A 1KD0A 4GRTA 1SJCA 3R0UA 4MMWA 4J57A 3N6JA 1MDLA 2GGHA 3S47A 3DGZA 5ER0A 3EAOA 4KEMA 3O0HA 1DTNA 2QAEA 3UJ2A 1YEYA 1Q1WA 2R9ZA 2ZADA 2GL5A 3AM9A 1KKRA 3DJJA 3MZNA 3IJLA 2GSHA 2XH0A 3R0KA 3GRTA 3CGEA 2RABA 3EUB3 1JOAA 2OX4A 1GERA 2OKTA 3GD6A 4ZCWA 3UCCA 2WP5A 3OZMA 1X2GA 2OVLA 5EU9A 1EC9A 1GRFA 3ZVIA 3GD4A 2TPRA 3V5FA 4H50A 2WOWA 2BCPA 3H4KA 3FVDA 1ECQA 1TE6A 1RM6B 2WPFA 3TJ4A 2PU1A 4J3ZA 2MUCA 3RNMA 4EQXA 2AL2B 4TVYA 3DFYA 2BC1A 3NVWB 1N5XA 2P88A 2YVGA 4KPLA 1WYGA 3DH9A 3ES8A 3SJNA 3HW2A 1D7YA 2MNRA 1VDVA 5IDZA 3GO2A 1GETA 5FJOA 2OPJA 4GMEA 1GRGA 3PFRA 2P3ZA 3IK4A 4H4WA 1WUFA 3UJRA 4E5TA 1KKOA 1TYTA 2GGJA 4H19A 2EQ6A 4HPNA 5FJRA 1JCTA 1SB3B 1FHVA 3PWGA 1NDAA 3ZLGA 3R10A 2GR2A 1MOKA 3ZVHB 2ZC8A 3P93A 4KPRA 1TZZA 3OP2A 2CHRA 4A35A 3ES7A 2AL1A 1P48A 2JK6A 2PGEA 2X8GA 3FJ4A 3D47A 3H8AA 4K8GA 5G5HB 1ZDLA 3Q45A 3TOYA 4JQ9A 1STZA 3QKEA 2GR0A 1SJDA 2RDXA 4H4PA 2FYMA 3CGBA 1ONFA 1NU5A 3DG6A 4FP1A 1XS2A 4M6UA 1JRPA 4IT1A 2OFJA 1VQZA 3UCDA 1JPMA 1ZKQA 3R07C 4EQSA 3RITA 1JROA 1GREA 2OZTA 3CB3A 3EF6A 3QLDA 3QN3A 3SN4A 3RCYA 1FO4A 4H4VA 3LADA 2F5ZA 3RR1A 3NFUA 4DHGA 5KVIA 3JVAA 3RRAA 4Z1YA 1FEAA 1NHPA 2OZ3A 4X2PA 3N6HA 5KVHA 4LA1A 3V3WA 1F3PA 4J1OA 1BKHA 2GH5A 1Q1RA 1E9IA 2J3NA 2WOIA 3AN1A 1L8PA 2XGZA 1N63C 2OG9A 2E5AA 1F8WA 4A6GA 1EBDA 2YAUA 3H7VA 5U1OA 3VC6A 5J04A 2YVFA 3DGBA 2NPXA 1N62C 3L5OA 1GEUA 2W0HA 2C3DA 1NELA 1V97A 3Q6JA 4HYRA 2HZGA 1FFVC 3DG7A 3II4A 1NHSA 4GFIA 3BSMA 3SQSA 3TCSA 4G8TA 3LB8A 4EQRA 1EC7A 1FFUC 4GIRA 2PA6A 1N61C 2WPCA 3UJEA 1R6WA 4H4XA 4GR1A 1XHCA 4YWSA 2WBAA 3UXLA 3UJFA 2GR1A 3FV9A 1T3QC 2P0IA 3P3BA 1ELSA 1XDIA 3AMZA 3VCCA 3FG2P 4DYEA 4DXKA 1R0MA 3N4EA 5GRTA 2PCEA 1IYXA 4GGHA 3T8QA 3TWBA 3MSYA 3I6EA 2QDEA 3QFBA 5JCMA 3R11A 7ENLA 3NZGA 3PG6A 3ENLA 1P43A 5BOFA 4K1WA 1LVLA 2QJNA 4EM3A 2PODA 1JDFA 2PTZA 3ETRB 4EM4A 1NPXA 2YVJA 2CDUA 2BC0A 4IL2A 4DX3A 3DG3A 1V59A 5EBKA 3STPA 4EMWA 3DFHA 2PS2A 3DIPA 3SN0A 4KT2A 3NXLA 4EMJA 2ONEA 2PU0A 3FYYA 1S7MA 1ZXIC 2GDQA 1PDZA 1M6IA 4KWSA 5JCLA 3MWCA 2C3CA 2OZ8A 3QPEA 3KLJA 2HXUA 2YQUA 1GXFA 2PTXA 3NVVB 3TWAA 2E3TA 2X50A 3CAWA 3CT2A 1ZMCA 2AL2A 3I4KA 1MUCA 4Z17A 3CYJA 2X8CA 3FXGA 2PTWA 4EMIA 1JPDX 3A7RA 3PWIA 3VFCA 2XSXA 1GSNA 5FS8A 1TKKA 3EEZA 3ZLHA 1XANA 2FKPA 3OC4A 4DN1A 1N5WC 1MNSA 2QJMA 3OW1A 1XPYA 2QJJA 4IHCA 3IJQA 3U4FA 2EQ7A 4IP4A 3VC5A 3L8KA 2OLAA 1LPFA 4NEVA 5FMHA 2V3BA 1DXLA 4H4UA 1WUEA 2P8BA 4ENLA 3DK8A 2CFYA 1OEPA 3T9PA 3FCPA 3EKGA 2WP6A 2GGGA 1F9CA 1RVKA 3DERA 2GRTA 3JZUA 4IP5A 3ZVHA 3SR6B 3HRDC 1SJAA 1MDRA 5FJUA 4HN8A 2HXTA 4HCLA 2A8XA 3IJIA 3DESA 2DW7A 3MKCA 4H4QA 2HQMA 4HNCA 2XH7A 5JCKA 3OZYA 2PTYA 2AAQA 3A7AA 3JW7A 3NRZB 1EBGA 1N60C 3TJIA 1ZY8A 1NHQA 3R1ZA 3TW9A 1W6TA 3IC9A 1KCZA 3UGVA 3GRSA 4HCHA 1GRBA 1ZK7A 3VCNA 3T6CA 2ZZBA 3V5CA 3TQPA 3DEQA 2DW6A 4EWJA 2QGYA 4ZA0A 3CK5A 2OQHA 3N4FA 4BV6A 2GGEA 3KUMA 3H70A 3CXOA 5FS9A 4K8DA 4DWDA 1MRAA 3UXKA 3CGDA 1GRAA 2W55A 3MUCA 2XH4A 4EQWA 3BOXA 5BOEA 3DJGX 1FIQB 4ADWA 4K7ZA 1MO9A 2GQWA 3PK7A 3B97A 3MQTA 1H2IA 3TTEA 5ENLA 4H83A 4E4FA 3QTPA 4J56A 2QDDA 2OO6A 3NS1B 4JHMA 6ENLA 1BZLA 4FI4A 4A3RA 3U9IA 2X99A 2QQ6A 1FECA 2HNEA 2PP0A 1EC8A 1K4QA 2PPGA 3GC2A 4JDRA 3LXDA 2EQ9A 3MY9A 4E4UA 4M0XA 3Q4DA 1GESA 2V3AA 1ZX9A 3OTRA 3GY1A 4TVWA 2ZZ0A 4NEWA 3I6TA 3BJSA 1BQGA 3ZLFA 2I5QA 2POZA 2PP1A 5JCIA 3S5SA 1TYPA 4E6MA 3GD3A 4K2SA 4DNAA 2WOVA 5G5GB 1ONEA 2QVHA 2O56A 3QFAA 3EANA 4APNA 2V6OA 3RO6A 2W3RA 2EQ8A 3SSZA 2OQYA 3P0WA 4H4ZA 4JN7A 4IL0A 2GR3A 4FDCB 2X8HA 3THUA 1AOGA 1ZMDA 4E8GA 2AKZA 2PGWA 3T4WA 1GRTA 4H4YA 4HCDA 1NHRA 2GGIA 3NVYB 4JN8A 5FJPA 1PDYA 1SJBA 2PMQA 1GRHA 1X2HA 3D9XA 2W3SA 3VDGA 2AKMA 4H4SA 5TR3A 5FS6A 1JEHA 4GISA 3HPFA 3K1GA 1FEBA 4FX9A 3DDMA 2WPEA 3URHA 3UJSA 4ZOHB 1KN0A 3SQPA 4M52A 4G7FA 3H12A 5JRBA 4H4TA 1EBHA 3SBFA 2W54A 4BURA 5FJTA 4HNLA 5JCNA
chains in the Genus database with same CATH topology
1V59A 4LIIA 5EBKA 4EMWA 1ZDLA 4JQ9A 5FS9A 2GR0A 4K8DA 4H4RA 1YQZA 1OJTA 3CGDA 1BWCA 1GRAA 4H4PA 2NVKX 4EMJA 4EQWA 5U25A 3CGBA 1ONFA 1S7MA 3DJGX 3CGCA 4ADWA 1M6IA 4K7ZA 1MO9A 1DNCA 2GQWA 5JCLA 1GV4A 2C3CA 3DK4A 1H2IA 3KLJA 4YWOA 2YQUA 1ZKQA 1GXFA 4EQSA 3DGHA 1H6VA 3DK9A 4J56A 5FS7A 2CDUA 2ZZCA 1GREA 2X50A 1BZLA 3EF6A 4GRTA 2X99A 4H4VA 3LADA 1FECA 1ZMCA 2F5ZA 4J57A 5KVIA 1K4QA 2X8CA 4JDRA 3LXDA 2EQ9A 1FEAA 1NHPA 3DGZA 4EMIA 5ER0A 5KVHA 3EAOA 3O0HA 4LA1A 1GESA 2QAEA 1F3PA 1GSNA 5FS8A 2GH5A 1Q1RA 2V3AA 1ZX9A 1Q1WA 2R9ZA 2J3NA 2WOIA 1XANA 2ZZ0A 3DJJA 3OC4A 4NEWA 3GRTA 2EQ7A 1F8WA 1EBDA 2YAUA 3L8KA 5U1OA 1LPFA 2YVFA 3CGEA 2RABA 4NEVA 2NPXA 1JOAA 1DXLA 1GERA 2V3BA 3L5OA 5FMHA 4H4UA 1GEUA 2WP5A 2W0HA 2C3DA 3Q6JA 1GRFA 3DK8A 2CFYA 2TPRA 3GD4A 5JCIA 1TYPA 2WP6A 3GD3A 3II4A 4H50A 1NHSA 2WOVA 4DNAA 2WOWA 2BCPA 2GRTA 3H4KA 2WPFA 3QFAA 3EANA 4APNA 3RNMA 3LB8A 4EQRA 2V6OA 4EQXA 2BC1A 2WPCA 4H4XA 4GR1A 1XHCA 2EQ8A 2WBAA 2A8XA 2YVGA 4H4QA 2GR1A 4H4ZA 3DH9A 2HQMA 2GR3A 4FDCB 2X8HA 1XDIA 1AOGA 1D7YA 1ZMDA 3FG2P 1GRTA 5JCKA 4H4YA 1NHRA 1GETA 5GRTA 2AAQA 1GRGA 4H4WA 1ZY8A 1NHQA 1GRHA 1TYTA 2EQ6A 3D9XA 4H4SA 5TR3A 3QFBA 5FS6A 1JEHA 5JCMA 3IC9A 1NDAA 1FEBA 2GR2A 4FX9A 3GRSA 1MOKA 3PG6A 2WPEA 3URHA 1GRBA 1ZK7A 1KN0A 3SQPA 2ZZBA 4M52A 1LVLA 4KPRA 4EM3A 5JRBA 4H4TA 4BURA 4EM4A 2X8GA 1NPXA 2JK6A 2YVJA 2BC0A 5JCNA 4BV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PG6 A; 
#chains in the Genus database with same CATH topology
 4LII A;  4GYP C;  4ROP A;  4F4R A;  3V4B A;  3R25 A;  4MGG A;  4H4R A;  1YQZ A;  3NO1 A;  1OJT A;  1BWC A;  1FHU A;  2NVK X;  4IZG A;  3D46 A;  3NVZ B;  5U25 A;  4GYP A;  4H2H A;  2NQL A;  2PSN A;  3CGC A;  2P8C A;  2PP3 A;  3OPS A;  1DNC A;  4GGB A;  1GV4 A;  4H1Z A;  3RGT A;  3DK4 A;  3A7U A;  4YWO A;  4MKS A;  2XH2 A;  3DGH A;  1H6V A;  3DK9 A;  3CXB A;  5FS7 A;  2ZZC A;  3SN1 A;  3B9J B;  3VA8 A;  1KD0 A;  4GRT A;  1SJC A;  3R0U A;  4MMW A;  4J57 A;  3N6J A;  1MDL A;  2GGH A;  3S47 A;  3DGZ A;  5ER0 A;  3EAO A;  4KEM A;  3O0H A;  1DTN A;  2QAE A;  3UJ2 A;  1YEY A;  1Q1W A;  2R9Z A;  2ZAD A;  2GL5 A;  3AM9 A;  1KKR A;  3DJJ A;  3MZN A;  3IJL A;  2GSH A;  2XH0 A;  3R0K A;  3GRT A;  3CGE A;  2RAB A;  3EUB 3;  1JOA A;  2OX4 A;  1GER A;  2OKT A;  3GD6 A;  4ZCW A;  3UCC A;  2WP5 A;  3OZM A;  1X2G A;  2OVL A;  5EU9 A;  1EC9 A;  1GRF A;  3ZVI A;  3GD4 A;  2TPR A;  3V5F A;  4H50 A;  2WOW A;  2BCP A;  3H4K A;  3FVD A;  1ECQ A;  1TE6 A;  1RM6 B;  2WPF A;  3TJ4 A;  2PU1 A;  4J3Z A;  2MUC A;  3RNM A;  4EQX A;  2AL2 B;  4TVY A;  3DFY A;  2BC1 A;  3NVW B;  1N5X A;  2P88 A;  2YVG A;  4KPL A;  1WYG A;  3DH9 A;  3ES8 A;  3SJN A;  3HW2 A;  1D7Y A;  2MNR A;  1VDV A;  5IDZ A;  3GO2 A;  1GET A;  5FJO A;  2OPJ A;  4GME A;  1GRG A;  3PFR A;  2P3Z A;  3IK4 A;  4H4W A;  1WUF A;  3UJR A;  4E5T A;  1KKO A;  1TYT A;  2GGJ A;  4H19 A;  2EQ6 A;  4HPN A;  5FJR A;  1JCT A;  1SB3 B;  1FHV A;  3PWG A;  1NDA A;  3ZLG A;  3R10 A;  2GR2 A;  1MOK A;  3ZVH B;  2ZC8 A;  3P93 A;  4KPR A;  1TZZ A;  3OP2 A;  2CHR A;  4A35 A;  3ES7 A;  2AL1 A;  1P48 A;  2JK6 A;  2PGE A;  2X8G A;  3FJ4 A;  3D47 A;  3H8A A;  4K8G A;  5G5H B;  1ZDL A;  3Q45 A;  3TOY A;  4JQ9 A;  1STZ A;  3QKE A;  2GR0 A;  1SJD A;  2RDX A;  4H4P A;  2FYM A;  3CGB A;  1ONF A;  1NU5 A;  3DG6 A;  4FP1 A;  1XS2 A;  4M6U A;  1JRP A;  4IT1 A;  2OFJ A;  1VQZ A;  3UCD A;  1JPM A;  1ZKQ A;  3R07 C;  4EQS A;  3RIT A;  1JRO A;  1GRE A;  2OZT A;  3CB3 A;  3EF6 A;  3QLD A;  3QN3 A;  3SN4 A;  3RCY A;  1FO4 A;  4H4V A;  3LAD A;  2F5Z A;  3RR1 A;  3NFU A;  4DHG A;  5KVI A;  3JVA A;  3RRA A;  4Z1Y A;  1FEA A;  1NHP A;  2OZ3 A;  4X2P A;  3N6H A;  5KVH A;  4LA1 A;  3V3W A;  1F3P A;  4J1O A;  1BKH A;  2GH5 A;  1Q1R A;  1E9I A;  2J3N A;  2WOI A;  3AN1 A;  1L8P A;  2XGZ A;  1N63 C;  2OG9 A;  2E5A A;  1F8W A;  4A6G A;  1EBD A;  2YAU A;  3H7V A;  5U1O A;  3VC6 A;  5J04 A;  2YVF A;  3DGB A;  2NPX A;  1N62 C;  3L5O A;  1GEU A;  2W0H A;  2C3D A;  1NEL A;  1V97 A;  3Q6J A;  4HYR A;  2HZG A;  1FFV C;  3DG7 A;  3II4 A;  1NHS A;  4GFI A;  3BSM A;  3SQS A;  3TCS A;  4G8T A;  3LB8 A;  4EQR A;  1EC7 A;  1FFU C;  4GIR A;  2PA6 A;  1N61 C;  2WPC A;  3UJE A;  1R6W A;  4H4X A;  4GR1 A;  1XHC A;  4YWS A;  2WBA A;  3UXL A;  3UJF A;  2GR1 A;  3FV9 A;  1T3Q C;  2P0I A;  3P3B A;  1ELS A;  1XDI A;  3AMZ A;  3VCC A;  3FG2 P;  4DYE A;  4DXK A;  1R0M A;  3N4E A;  5GRT A;  2PCE A;  1IYX A;  4GGH A;  3T8Q A;  3TWB A;  3MSY A;  3I6E A;  2QDE A;  3QFB A;  5JCM A;  3R11 A;  7ENL A;  3NZG A;  3PG6 A;  3ENL A;  1P43 A;  5BOF A;  4K1W A;  1LVL A;  2QJN A;  4EM3 A;  2POD A;  1JDF A;  2PTZ A;  3ETR B;  4EM4 A;  1NPX A;  2YVJ A;  2CDU A;  2BC0 A;  4IL2 A;  4DX3 A;  3DG3 A;  1V59 A;  5EBK A;  3STP A;  4EMW A;  3DFH A;  2PS2 A;  3DIP A;  3SN0 A;  4KT2 A;  3NXL A;  4EMJ A;  2ONE A;  2PU0 A;  3FYY A;  1S7M A;  1ZXI C;  2GDQ A;  1PDZ A;  1M6I A;  4KWS A;  5JCL A;  3MWC A;  2C3C A;  2OZ8 A;  3QPE A;  3KLJ A;  2HXU A;  2YQU A;  1GXF A;  2PTX A;  3NVV B;  3TWA A;  2E3T A;  2X50 A;  3CAW A;  3CT2 A;  1ZMC A;  2AL2 A;  3I4K A;  1MUC A;  4Z17 A;  3CYJ A;  2X8C A;  3FXG A;  2PTW A;  4EMI A;  1JPD X;  3A7R A;  3PWI A;  3VFC A;  2XSX A;  1GSN A;  5FS8 A;  1TKK A;  3EEZ A;  3ZLH A;  1XAN A;  2FKP A;  3OC4 A;  4DN1 A;  1N5W C;  1MNS A;  2QJM A;  3OW1 A;  1XPY A;  2QJJ A;  4IHC A;  3IJQ A;  3U4F A;  2EQ7 A;  4IP4 A;  3VC5 A;  3L8K A;  2OLA A;  1LPF A;  4NEV A;  5FMH A;  2V3B A;  1DXL A;  4H4U A;  1WUE A;  2P8B A;  4ENL A;  3DK8 A;  2CFY A;  1OEP A;  3T9P A;  3FCP A;  3EKG A;  2WP6 A;  2GGG A;  1F9C A;  1RVK A;  3DER A;  2GRT A;  3JZU A;  4IP5 A;  3ZVH A;  3SR6 B;  3HRD C;  1SJA A;  1MDR A;  5FJU A;  4HN8 A;  2HXT A;  4HCL A;  2A8X A;  3IJI A;  3DES A;  2DW7 A;  3MKC A;  4H4Q A;  2HQM A;  4HNC A;  2XH7 A;  5JCK A;  3OZY A;  2PTY A;  2AAQ A;  3A7A A;  3JW7 A;  3NRZ B;  1EBG A;  1N60 C;  3TJI A;  1ZY8 A;  1NHQ A;  3R1Z A;  3TW9 A;  1W6T A;  3IC9 A;  1KCZ A;  3UGV A;  3GRS A;  4HCH A;  1GRB A;  1ZK7 A;  3VCN A;  3T6C A;  2ZZB A;  3V5C A;  3TQP A;  3DEQ A;  2DW6 A;  4EWJ A;  2QGY A;  4ZA0 A;  3CK5 A;  2OQH A;  3N4F A;  4BV6 A;  2GGE A;  3KUM A;  3H70 A;  3CXO A;  5FS9 A;  4K8D A;  4DWD A;  1MRA A;  3UXK A;  3CGD A;  1GRA A;  2W55 A;  3MUC A;  2XH4 A;  4EQW A;  3BOX A;  5BOE A;  3DJG X;  1FIQ B;  4ADW A;  4K7Z A;  1MO9 A;  2GQW A;  3PK7 A;  3B97 A;  3MQT A;  1H2I A;  3TTE A;  5ENL A;  4H83 A;  4E4F A;  3QTP A;  4J56 A;  2QDD A;  2OO6 A;  3NS1 B;  4JHM A;  6ENL A;  1BZL A;  4FI4 A;  4A3R A;  3U9I A;  2X99 A;  2QQ6 A;  1FEC A;  2HNE A;  2PP0 A;  1EC8 A;  1K4Q A;  2PPG A;  3GC2 A;  4JDR A;  3LXD A;  2EQ9 A;  3MY9 A;  4E4U A;  4M0X A;  3Q4D A;  1GES A;  2V3A A;  1ZX9 A;  3OTR A;  3GY1 A;  4TVW A;  2ZZ0 A;  4NEW A;  3I6T A;  3BJS A;  1BQG A;  3ZLF A;  2I5Q A;  2POZ A;  2PP1 A;  5JCI A;  3S5S A;  1TYP A;  4E6M A;  3GD3 A;  4K2S A;  4DNA A;  2WOV A;  5G5G B;  1ONE A;  2QVH A;  2O56 A;  3QFA A;  3EAN A;  4APN A;  2V6O A;  3RO6 A;  2W3R A;  2EQ8 A;  3SSZ A;  2OQY A;  3P0W A;  4H4Z A;  4JN7 A;  4IL0 A;  2GR3 A;  4FDC B;  2X8H A;  3THU A;  1AOG A;  1ZMD A;  4E8G A;  2AKZ A;  2PGW A;  3T4W A;  1GRT A;  4H4Y A;  4HCD A;  1NHR A;  2GGI A;  3NVY B;  4JN8 A;  5FJP A;  1PDY A;  1SJB A;  2PMQ A;  1GRH A;  1X2H A;  3D9X A;  2W3S A;  3VDG A;  2AKM A;  4H4S A;  5TR3 A;  5FS6 A;  1JEH A;  4GIS A;  3HPF A;  3K1G A;  1FEB A;  4FX9 A;  3DDM A;  2WPE A;  3URH A;  3UJS A;  4ZOH B;  1KN0 A;  3SQP A;  4M52 A;  4G7F A;  3H12 A;  5JRB A;  4H4T A;  1EBH A;  3SBF A;  2W54 A;  4BUR A;  5FJT A;  4HNL A;  5JCN A; 
#chains in the Genus database with same CATH homology
 1V59 A;  4LII A;  5EBK A;  4EMW A;  1ZDL A;  4JQ9 A;  5FS9 A;  2GR0 A;  4K8D A;  4H4R A;  1YQZ A;  1OJT A;  3CGD A;  1BWC A;  1GRA A;  4H4P A;  2NVK X;  4EMJ A;  4EQW A;  5U25 A;  3CGB A;  1ONF A;  1S7M A;  3DJG X;  3CGC A;  4ADW A;  1M6I A;  4K7Z A;  1MO9 A;  1DNC A;  2GQW A;  5JCL A;  1GV4 A;  2C3C A;  3DK4 A;  1H2I A;  3KLJ A;  4YWO A;  2YQU A;  1ZKQ A;  1GXF A;  4EQS A;  3DGH A;  1H6V A;  3DK9 A;  4J56 A;  5FS7 A;  2CDU A;  2ZZC A;  1GRE A;  2X50 A;  1BZL A;  3EF6 A;  4GRT A;  2X99 A;  4H4V A;  3LAD A;  1FEC A;  1ZMC A;  2F5Z A;  4J57 A;  5KVI A;  1K4Q A;  2X8C A;  4JDR A;  3LXD A;  2EQ9 A;  1FEA A;  1NHP A;  3DGZ A;  4EMI A;  5ER0 A;  5KVH A;  3EAO A;  3O0H A;  4LA1 A;  1GES A;  2QAE A;  1F3P A;  1GSN A;  5FS8 A;  2GH5 A;  1Q1R A;  2V3A A;  1ZX9 A;  1Q1W A;  2R9Z A;  2J3N A;  2WOI A;  1XAN A;  2ZZ0 A;  3DJJ A;  3OC4 A;  4NEW A;  3GRT A;  2EQ7 A;  1F8W A;  1EBD A;  2YAU A;  3L8K A;  5U1O A;  1LPF A;  2YVF A;  3CGE A;  2RAB A;  4NEV A;  2NPX A;  1JOA A;  1DXL A;  1GER A;  2V3B A;  3L5O A;  5FMH A;  4H4U A;  1GEU A;  2WP5 A;  2W0H A;  2C3D A;  3Q6J A;  1GRF A;  3DK8 A;  2CFY A;  2TPR A;  3GD4 A;  5JCI A;  1TYP A;  2WP6 A;  3GD3 A;  3II4 A;  4H50 A;  1NHS A;  2WOV A;  4DNA A;  2WOW A;  2BCP A;  2GRT A;  3H4K A;  2WPF A;  3QFA A;  3EAN A;  4APN A;  3RNM A;  3LB8 A;  4EQR A;  2V6O A;  4EQX A;  2BC1 A;  2WPC A;  4H4X A;  4GR1 A;  1XHC A;  2EQ8 A;  2WBA A;  2A8X A;  2YVG A;  4H4Q A;  2GR1 A;  4H4Z A;  3DH9 A;  2HQM A;  2GR3 A;  4FDC B;  2X8H A;  1XDI A;  1AOG A;  1D7Y A;  1ZMD A;  3FG2 P;  1GRT A;  5JCK A;  4H4Y A;  1NHR A;  1GET A;  5GRT A;  2AAQ A;  1GRG A;  4H4W A;  1ZY8 A;  1NHQ A;  1GRH A;  1TYT A;  2EQ6 A;  3D9X A;  4H4S A;  5TR3 A;  3QFB A;  5FS6 A;  1JEH A;  5JCM A;  3IC9 A;  1NDA A;  1FEB A;  2GR2 A;  4FX9 A;  3GRS A;  1MOK A;  3PG6 A;  2WPE A;  3URH A;  1GRB A;  1ZK7 A;  1KN0 A;  3SQP A;  2ZZB A;  4M52 A;  1LVL A;  4KPR A;  4EM3 A;  5JRB A;  4H4T A;  4BUR A;  4EM4 A;  2X8G A;  1NPX A;  2JK6 A;  2YVJ A;  2BC0 A;  5JCN A;  4BV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...