3PG6A

The carboxyl terminal domain of human deltex 3-like
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
QKGNQPEGSMVFTVSRDSLPGYESFGTIVITYSMKAGIQTEEHPNPGKRYPGIQRTAYLPDNKEGRKVLKLLYRAFDQKLIFTVGYSRVLGVSDVITWNDIHHKTSRFGGPEMYGYPDPSYLKRVKEELKAKGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase DTX3L
publication title Fold of the conserved DTC domain in Deltex proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 37
structure length 135
sequence length 135
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18102 DTC Deltex C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.130 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3pg6A00
3PG6A
chains in the Genus database with same CATH superfamily
4H4ZA 2CHRA 2GR1A 4ZCWA 3UXLA 4TVWA 2XH0A 1GRHA 2PTWA 2PU1A 3UCCA 3RGTA 1DXLA 1FHUA 1M6IA 3FJ4A 3DIPA 5FMHA 2QDDA 3IJQA 1KD0A 3GRTA 1JPDX 1WUEA 2CFYA 5EBKA 2MNRA 1EC9A 3T9PA 2NVKX 3TWAA 4A3RA 5FS8A 1JRPA 3B9JB 2PS2A 3L8KA 4HCLA 3DERA 4IT1A 2E5AA 3NVZB 4IP4A 2RDXA 5JCLA 4H1ZA 4H4VA 5GRTA 1GREA 4X2PA 2OX4A 2ZADA 3MY9A 1GRBA 5FS7A 3DJGX 2C3DA 1KN0A 2OZTA 1XS2A 1SJBA 5U1OA 1F9CA 3NVVB 2R9ZA 1JOAA 4IP5A 2GQWA 1BWCA 3VC5A 1DNCA 3R1ZA 4GIRA 2GR3A 3Q4DA 4EQXA 1PDZA 3DK4A 3GRSA 2WPEA 1NPXA 4KPLA 4FP1A 3QLDA 3KUMA 1GRGA 4JDRA 2ONEA 1MOKA 2XH7A 4BURA 1FECA 1WUFA 2FYMA 4E4FA 1XPYA 2V3AA 2JK6A 2BC0A 4A35A 2YVJA 2NQLA 4M0XA 1MRAA 3UJFA 4J3ZA 3SN0A 7ENLA 1K4QA 2GSHA 3DG6A 2OLAA 3NO1A 1E9IA 1VQZA 2OFJA 3AN1A 5J04A 4HNLA 4DX3A 1F3PA 4Z17A 3BOXA 1FEAA 5EU9A 3PK7A 3L5OA 3RR1A 1R0MA 3K1GA 4JHMA 5G5HB 4E4UA 4DXKA 5ENLA 3OZYA 4GR1A 3H70A 1FO4A 2W3RA 4LIIA 3CK5A 3JVAA 4GYPC 4E6MA 3T4WA 3LADA 4ZOHB 3NRZB 3ZLGA 1GRAA 4GYPA 1GRTA 3OW1A 1FEBA 5G5GB 3Q6JA 2PGWA 1OJTA 3ES8A 2X8GA 3ES7A 3THUA 1NHRA 2QAEA 4EMWA 2QGYA 3ENLA 3OTRA 5TR3A 1NHPA 3VCCA 3TJIA 1N60C 5KVIA 1ZXIC 3OPSA 3ETRB 2PU0A 3FV9A 3DGZA 4LA1A 3PFRA 1L8PA 1ZY8A 2OQYA 2PP1A 3KLJA 4EQWA 4J57A 2W3SA 3R0UA 4H83A 4MGGA 1NHQA 4KPRA 3TCSA 6ENLA 5JRBA 4YWOA 2OO6A 2YQUA 3GD3A 1JPMA 3II4A 3Q45A 3TW9A 3CB3A 2PA6A 3DFHA 2EQ7A 4HN8A 3R11A 4JQ9A 2XSXA 4M6UA 3DGHA 1GRFA 4H50A 2W0HA 2AL1A 2DW6A 1YEYA 4EQSA 3ZVIA 1F8WA 3EEZA 2PTYA 3FXGA 1XDIA 1X2GA 1NELA 3I6EA 2EQ9A 1ONEA 5IDZA 4HCHA 1XHCA 4Z1YA 4KT2A 1KCZA 1NU5A 2OQHA 2PTZA 4EWJA 1R6WA 1EC7A 3GY1A 3VC6A 4K1WA 2HZGA 1X2HA 2PTXA 3HW2A 2MUCA 4H4XA 3EKGA 3SJNA 3TJ4A 3VCNA 4H4YA 3DK9A 3SN4A 5FJPA 3A7UA 2GH5A 4IL0A 3MSYA 3S5SA 4YWSA 1RM6B 1GESA 1ECQA 2QDEA 2WP6A 1FFVC 3UGVA 3EUB3 3I6TA 3BSMA 4BV6A 5JCIA 4HNCA 3PWGA 2WOVA 2ZZBA 5FJUA 2WOIA 3NVWB 3TWBA 3V5CA 1TE6A 3TQPA 1EBGA 2XGZA 5FS6A 2F5ZA 3CT2A 5JCNA 5FJRA 4H4SA 1SJDA 2WPCA 2YAUA 3U4FA 4APNA 4H2HA 4K7ZA 1JEHA 4DYEA 4H4UA 3DESA 1PDYA 3BJSA 3OZMA 2PODA 3SR6B 3I4KA 4HYRA 4MMWA 4G8TA 5FJTA 1N5XA 1ZK7A 4JN7A 3QTPA 3ZLFA 2PP3A 3FYYA 3VDGA 4FX9A 4MKSA 1V59A 2X50A 4HCDA 2WPFA 3R10A 2AAQA 3AM9A 4JN8A 4EMJA 4H4TA 3EAOA 3CXOA 3MQTA 3MUCA 3SSZA 5JCKA 1N63C 3IC9A 1N5WC 2OKTA 4H19A 2PPGA 4DNAA 3A7RA 4GGHA 2P8BA 1MUCA 4GFIA 2EQ6A 2PP0A 2FKPA 2RABA 3DK8A 1GEUA 3FVDA 4DHGA 1DTNA 3UJ2A 2PMQA 3OC4A 1Q1WA 2CDUA 2PSNA 1GSNA 3CYJA 3T6CA 3UJRA 1ZDLA 3P0WA 4GGBA 4EQRA 1T3QC 3EF6A 3H8AA 2X8CA 3DG3A 3N6HA 3CGCA 1MO9A 3RRAA 1JCTA 4F4RA 2WOWA 2ZC8A 3P3BA 5U25A 3SBFA 3DGBA 3DEQA 3H7VA 3QFAA 4K8DA 3R07C 3TTEA 2P0IA 3RO6A 3NFUA 4E8GA 2P88A 1FHVA 1GERA 4DN1A 1NHSA 1N61C 2OVLA 2POZA 1JROA 3CAWA 3CGEA 2HXTA 3T8QA 4H4PA 5JCMA 4NEWA 2OG9A 3SQSA 3IK4A 3RITA 2OZ8A 2GR0A 3D47A 3P93A 3FG2P 1KKOA 3DH9A 3B97A 2GRTA 3GD4A 1V97A 4HPNA 3LXDA 3UJEA 3V4BA 1N62C 2P8CA 3LB8A 5FS9A 3RCYA 1MDLA 3MZNA 3VFCA 4E5TA 2GGEA 5BOFA 3V5FA 4J1OA 2QJJA 3N6JA 4GMEA 3NZGA 3NXLA 2DW7A 4J56A 4EM4A 4A6GA 3JW7A 3O0HA 2EQ8A 1D7YA 1FIQB 2W55A 1EBDA 4TVYA 2GR2A 4H4WA 1ZX9A 2HXUA 1GXFA 3QKEA 2GGHA 3TOYA 2V6OA 2P3ZA 2QJMA 3OP2A 2PGEA 3N4FA 1ZKQA 2QQ6A 2J3NA 2E3TA 1BKHA 1VDVA 4KEMA 4G7FA 2ZZCA 4GISA 3IJLA 3S47A 2GGIA 1H2IA 2YVGA 1TYPA 3H12A 1TZZA 4ROPA 3CGBA 3D46A 2X99A 4ZA0A 2PCEA 2BC1A 3PWIA 3N4EA 1MDRA 1ZMCA 2W54A 3NVYB 3JZUA 2YVFA 1S7MA 3STPA 1W6TA 3MKCA 1BZLA 2AL2A 2OPJA 3A7AA 3UJSA 2AKMA 4IHCA 2A8XA 2XH2A 3EANA 3DFYA 3ZVHA 3MWCA 3R0KA 1GETA 4IL2A 2HNEA 2GDQA 2GL5A 3U9IA 2AL2B 1BQGA 2OZ3A 4ADWA 4ENLA 1ONFA 2XH4A 3V3WA 3UXKA 5BOEA 3ZVHB 3D9XA 4EM3A 1MNSA 1IYXA 4H4RA 4DWDA 1XANA 1NDAA 1OEPA 3SQPA 5KVHA 1EC8A 1TKKA 3GC2A 3GD6A 2I5QA 4FI4A 3CXBA 2TPRA 1YQZA 4KWSA 1FFUC 3SN1A 1STZA 3PG6A 3VA8A 1WYGA 2GGJA 3QPEA 4K8GA 3QFBA 3DG7A 2ZZ0A 1EBHA 2V3BA 2HQMA 5FJOA 3HPFA 1KKRA 4K2SA 1RVKA 1Q1RA 4GRTA 2BCPA 1SB3B 2O56A 4IZGA 3ZLHA 3R25A 1GV4A 3NS1B 3GO2A 1ZMDA 2QJNA 3H4KA 1LPFA 1SJCA 1H6VA 4H4QA 3IJIA 4M52A 3QN3A 1SJAA 3FCPA 3UCDA 3DJJA 4EMIA 2AKZA 5ER0A 2C3CA 3AMZA 1JDFA 3HRDC 2X8HA 3URHA 1P43A 1TYTA 3DDMA 1LVLA 2WBAA 3RNMA 3CGDA 2WP5A 2NPXA 4FDCB 2GGGA 2QVHA 1P48A 4NEVA 1AOGA 1ELSA
chains in the Genus database with same CATH topology
4H4ZA 5KVIA 4FX9A 2GR1A 1V59A 2X50A 1GRHA 1ZKQA 3DGZA 2WPFA 4LA1A 2J3NA 1DXLA 1ZY8A 1M6IA 2AAQA 2ZZCA 4EMJA 4H4TA 3EAOA 1H2IA 5FMHA 2YVGA 3GRTA 3KLJA 4J57A 4EQWA 5JCKA 1TYPA 2CFYA 5EBKA 3IC9A 5JRBA 1NHQA 4KPRA 4YWOA 2NVKX 3CGBA 4DNAA 5FS8A 2X99A 2EQ6A 2BC1A 2YQUA 3GD3A 3L8KA 3II4A 1ZMCA 2RABA 2YVFA 1S7MA 2EQ7A 3DK8A 4JQ9A 5JCLA 4H4VA 1BZLA 1GEUA 3DGHA 1GRFA 4H50A 5GRTA 1GREA 2W0HA 2A8XA 1GRBA 5FS7A 4EQSA 3DJGX 1Q1WA 3OC4A 2C3DA 1KN0A 3EANA 1F8WA 2CDUA 1GETA 1XDIA 1GSNA 5U1OA 2R9ZA 1JOAA 1ZDLA 2EQ9A 4EQRA 2GQWA 3EF6A 1BWCA 4ADWA 2X8CA 1ONFA 1XHCA 1DNCA 3CGCA 1MO9A 2GR3A 4EQXA 3D9XA 2WOWA 3DK4A 3GRSA 2WPEA 4EM3A 4H4RA 1NPXA 1XANA 5U25A 1GRGA 1NDAA 4JDRA 3SQPA 1MOKA 4BURA 3QFAA 1FECA 4K8DA 5KVHA 2V3AA 2JK6A 2BC0A 1GERA 4H4XA 1NHSA 2TPRA 1YQZA 4H4YA 2YVJA 3DK9A 3PG6A 3CGEA 5JCMA 4H4PA 2GH5A 4NEWA 1K4QA 3QFBA 2GR0A 1GESA 2ZZ0A 2V3BA 2WP6A 1F3PA 2HQMA 3DH9A 3FG2P 2GRTA 3GD4A 4BV6A 1FEAA 5JCIA 3L5OA 2WOVA 1Q1RA 4GRTA 2BCPA 2ZZBA 3LXDA 1GV4A 3H4KA 1ZMDA 2WOIA 4GR1A 1LPFA 3LB8A 5FS9A 1H6VA 4LIIA 4H4QA 5FS6A 4M52A 2F5ZA 5JCNA 3LADA 3DJJA 4H4SA 1GRAA 4EMIA 2WPCA 5ER0A 2C3CA 1GRTA 2YAUA 2X8HA 1FEBA 4J56A 3URHA 3Q6JA 4APNA 4EM4A 4K7ZA 3O0HA 1OJTA 1JEHA 1TYTA 2EQ8A 4H4UA 2X8GA 1D7YA 1EBDA 1NHRA 2QAEA 1LVLA 2GR2A 2WBAA 4H4WA 3RNMA 4EMWA 1ZX9A 3CGDA 1GXFA 2WP5A 2NPXA 4FDCB 5TR3A 1ZK7A 1NHPA 4NEVA 1AOGA 2V6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PG6 A; 
#chains in the Genus database with same CATH topology
 4H4Z A;  2CHR A;  2GR1 A;  4ZCW A;  3UXL A;  4TVW A;  2XH0 A;  1GRH A;  2PTW A;  2PU1 A;  3UCC A;  3RGT A;  1DXL A;  1FHU A;  1M6I A;  3FJ4 A;  3DIP A;  5FMH A;  2QDD A;  3IJQ A;  1KD0 A;  3GRT A;  1JPD X;  1WUE A;  2CFY A;  5EBK A;  2MNR A;  1EC9 A;  3T9P A;  2NVK X;  3TWA A;  4A3R A;  5FS8 A;  1JRP A;  3B9J B;  2PS2 A;  3L8K A;  4HCL A;  3DER A;  4IT1 A;  2E5A A;  3NVZ B;  4IP4 A;  2RDX A;  5JCL A;  4H1Z A;  4H4V A;  5GRT A;  1GRE A;  4X2P A;  2OX4 A;  2ZAD A;  3MY9 A;  1GRB A;  5FS7 A;  3DJG X;  2C3D A;  1KN0 A;  2OZT A;  1XS2 A;  1SJB A;  5U1O A;  1F9C A;  3NVV B;  2R9Z A;  1JOA A;  4IP5 A;  2GQW A;  1BWC A;  3VC5 A;  1DNC A;  3R1Z A;  4GIR A;  2GR3 A;  3Q4D A;  4EQX A;  1PDZ A;  3DK4 A;  3GRS A;  2WPE A;  1NPX A;  4KPL A;  4FP1 A;  3QLD A;  3KUM A;  1GRG A;  4JDR A;  2ONE A;  1MOK A;  2XH7 A;  4BUR A;  1FEC A;  1WUF A;  2FYM A;  4E4F A;  1XPY A;  2V3A A;  2JK6 A;  2BC0 A;  4A35 A;  2YVJ A;  2NQL A;  4M0X A;  1MRA A;  3UJF A;  4J3Z A;  3SN0 A;  7ENL A;  1K4Q A;  2GSH A;  3DG6 A;  2OLA A;  3NO1 A;  1E9I A;  1VQZ A;  2OFJ A;  3AN1 A;  5J04 A;  4HNL A;  4DX3 A;  1F3P A;  4Z17 A;  3BOX A;  1FEA A;  5EU9 A;  3PK7 A;  3L5O A;  3RR1 A;  1R0M A;  3K1G A;  4JHM A;  5G5H B;  4E4U A;  4DXK A;  5ENL A;  3OZY A;  4GR1 A;  3H70 A;  1FO4 A;  2W3R A;  4LII A;  3CK5 A;  3JVA A;  4GYP C;  4E6M A;  3T4W A;  3LAD A;  4ZOH B;  3NRZ B;  3ZLG A;  1GRA A;  4GYP A;  1GRT A;  3OW1 A;  1FEB A;  5G5G B;  3Q6J A;  2PGW A;  1OJT A;  3ES8 A;  2X8G A;  3ES7 A;  3THU A;  1NHR A;  2QAE A;  4EMW A;  2QGY A;  3ENL A;  3OTR A;  5TR3 A;  1NHP A;  3VCC A;  3TJI A;  1N60 C;  5KVI A;  1ZXI C;  3OPS A;  3ETR B;  2PU0 A;  3FV9 A;  3DGZ A;  4LA1 A;  3PFR A;  1L8P A;  1ZY8 A;  2OQY A;  2PP1 A;  3KLJ A;  4EQW A;  4J57 A;  2W3S A;  3R0U A;  4H83 A;  4MGG A;  1NHQ A;  4KPR A;  3TCS A;  6ENL A;  5JRB A;  4YWO A;  2OO6 A;  2YQU A;  3GD3 A;  1JPM A;  3II4 A;  3Q45 A;  3TW9 A;  3CB3 A;  2PA6 A;  3DFH A;  2EQ7 A;  4HN8 A;  3R11 A;  4JQ9 A;  2XSX A;  4M6U A;  3DGH A;  1GRF A;  4H50 A;  2W0H A;  2AL1 A;  2DW6 A;  1YEY A;  4EQS A;  3ZVI A;  1F8W A;  3EEZ A;  2PTY A;  3FXG A;  1XDI A;  1X2G A;  1NEL A;  3I6E A;  2EQ9 A;  1ONE A;  5IDZ A;  4HCH A;  1XHC A;  4Z1Y A;  4KT2 A;  1KCZ A;  1NU5 A;  2OQH A;  2PTZ A;  4EWJ A;  1R6W A;  1EC7 A;  3GY1 A;  3VC6 A;  4K1W A;  2HZG A;  1X2H A;  2PTX A;  3HW2 A;  2MUC A;  4H4X A;  3EKG A;  3SJN A;  3TJ4 A;  3VCN A;  4H4Y A;  3DK9 A;  3SN4 A;  5FJP A;  3A7U A;  2GH5 A;  4IL0 A;  3MSY A;  3S5S A;  4YWS A;  1RM6 B;  1GES A;  1ECQ A;  2QDE A;  2WP6 A;  1FFV C;  3UGV A;  3EUB 3;  3I6T A;  3BSM A;  4BV6 A;  5JCI A;  4HNC A;  3PWG A;  2WOV A;  2ZZB A;  5FJU A;  2WOI A;  3NVW B;  3TWB A;  3V5C A;  1TE6 A;  3TQP A;  1EBG A;  2XGZ A;  5FS6 A;  2F5Z A;  3CT2 A;  5JCN A;  5FJR A;  4H4S A;  1SJD A;  2WPC A;  2YAU A;  3U4F A;  4APN A;  4H2H A;  4K7Z A;  1JEH A;  4DYE A;  4H4U A;  3DES A;  1PDY A;  3BJS A;  3OZM A;  2POD A;  3SR6 B;  3I4K A;  4HYR A;  4MMW A;  4G8T A;  5FJT A;  1N5X A;  1ZK7 A;  4JN7 A;  3QTP A;  3ZLF A;  2PP3 A;  3FYY A;  3VDG A;  4FX9 A;  4MKS A;  1V59 A;  2X50 A;  4HCD A;  2WPF A;  3R10 A;  2AAQ A;  3AM9 A;  4JN8 A;  4EMJ A;  4H4T A;  3EAO A;  3CXO A;  3MQT A;  3MUC A;  3SSZ A;  5JCK A;  1N63 C;  3IC9 A;  1N5W C;  2OKT A;  4H19 A;  2PPG A;  4DNA A;  3A7R A;  4GGH A;  2P8B A;  1MUC A;  4GFI A;  2EQ6 A;  2PP0 A;  2FKP A;  2RAB A;  3DK8 A;  1GEU A;  3FVD A;  4DHG A;  1DTN A;  3UJ2 A;  2PMQ A;  3OC4 A;  1Q1W A;  2CDU A;  2PSN A;  1GSN A;  3CYJ A;  3T6C A;  3UJR A;  1ZDL A;  3P0W A;  4GGB A;  4EQR A;  1T3Q C;  3EF6 A;  3H8A A;  2X8C A;  3DG3 A;  3N6H A;  3CGC A;  1MO9 A;  3RRA A;  1JCT A;  4F4R A;  2WOW A;  2ZC8 A;  3P3B A;  5U25 A;  3SBF A;  3DGB A;  3DEQ A;  3H7V A;  3QFA A;  4K8D A;  3R07 C;  3TTE A;  2P0I A;  3RO6 A;  3NFU A;  4E8G A;  2P88 A;  1FHV A;  1GER A;  4DN1 A;  1NHS A;  1N61 C;  2OVL A;  2POZ A;  1JRO A;  3CAW A;  3CGE A;  2HXT A;  3T8Q A;  4H4P A;  5JCM A;  4NEW A;  2OG9 A;  3SQS A;  3IK4 A;  3RIT A;  2OZ8 A;  2GR0 A;  3D47 A;  3P93 A;  3FG2 P;  1KKO A;  3DH9 A;  3B97 A;  2GRT A;  3GD4 A;  1V97 A;  4HPN A;  3LXD A;  3UJE A;  3V4B A;  1N62 C;  2P8C A;  3LB8 A;  5FS9 A;  3RCY A;  1MDL A;  3MZN A;  3VFC A;  4E5T A;  2GGE A;  5BOF A;  3V5F A;  4J1O A;  2QJJ A;  3N6J A;  4GME A;  3NZG A;  3NXL A;  2DW7 A;  4J56 A;  4EM4 A;  4A6G A;  3JW7 A;  3O0H A;  2EQ8 A;  1D7Y A;  1FIQ B;  2W55 A;  1EBD A;  4TVY A;  2GR2 A;  4H4W A;  1ZX9 A;  2HXU A;  1GXF A;  3QKE A;  2GGH A;  3TOY A;  2V6O A;  2P3Z A;  2QJM A;  3OP2 A;  2PGE A;  3N4F A;  1ZKQ A;  2QQ6 A;  2J3N A;  2E3T A;  1BKH A;  1VDV A;  4KEM A;  4G7F A;  2ZZC A;  4GIS A;  3IJL A;  3S47 A;  2GGI A;  1H2I A;  2YVG A;  1TYP A;  3H12 A;  1TZZ A;  4ROP A;  3CGB A;  3D46 A;  2X99 A;  4ZA0 A;  2PCE A;  2BC1 A;  3PWI A;  3N4E A;  1MDR A;  1ZMC A;  2W54 A;  3NVY B;  3JZU A;  2YVF A;  1S7M A;  3STP A;  1W6T A;  3MKC A;  1BZL A;  2AL2 A;  2OPJ A;  3A7A A;  3UJS A;  2AKM A;  4IHC A;  2A8X A;  2XH2 A;  3EAN A;  3DFY A;  3ZVH A;  3MWC A;  3R0K A;  1GET A;  4IL2 A;  2HNE A;  2GDQ A;  2GL5 A;  3U9I A;  2AL2 B;  1BQG A;  2OZ3 A;  4ADW A;  4ENL A;  1ONF A;  2XH4 A;  3V3W A;  3UXK A;  5BOE A;  3ZVH B;  3D9X A;  4EM3 A;  1MNS A;  1IYX A;  4H4R A;  4DWD A;  1XAN A;  1NDA A;  1OEP A;  3SQP A;  5KVH A;  1EC8 A;  1TKK A;  3GC2 A;  3GD6 A;  2I5Q A;  4FI4 A;  3CXB A;  2TPR A;  1YQZ A;  4KWS A;  1FFU C;  3SN1 A;  1STZ A;  3PG6 A;  3VA8 A;  1WYG A;  2GGJ A;  3QPE A;  4K8G A;  3QFB A;  3DG7 A;  2ZZ0 A;  1EBH A;  2V3B A;  2HQM A;  5FJO A;  3HPF A;  1KKR A;  4K2S A;  1RVK A;  1Q1R A;  4GRT A;  2BCP A;  1SB3 B;  2O56 A;  4IZG A;  3ZLH A;  3R25 A;  1GV4 A;  3NS1 B;  3GO2 A;  1ZMD A;  2QJN A;  3H4K A;  1LPF A;  1SJC A;  1H6V A;  4H4Q A;  3IJI A;  4M52 A;  3QN3 A;  1SJA A;  3FCP A;  3UCD A;  3DJJ A;  4EMI A;  2AKZ A;  5ER0 A;  2C3C A;  3AMZ A;  1JDF A;  3HRD C;  2X8H A;  3URH A;  1P43 A;  1TYT A;  3DDM A;  1LVL A;  2WBA A;  3RNM A;  3CGD A;  2WP5 A;  2NPX A;  4FDC B;  2GGG A;  2QVH A;  1P48 A;  4NEV A;  1AOG A;  1ELS A; 
#chains in the Genus database with same CATH homology
 4H4Z A;  5KVI A;  4FX9 A;  2GR1 A;  1V59 A;  2X50 A;  1GRH A;  1ZKQ A;  3DGZ A;  2WPF A;  4LA1 A;  2J3N A;  1DXL A;  1ZY8 A;  1M6I A;  2AAQ A;  2ZZC A;  4EMJ A;  4H4T A;  3EAO A;  1H2I A;  5FMH A;  2YVG A;  3GRT A;  3KLJ A;  4J57 A;  4EQW A;  5JCK A;  1TYP A;  2CFY A;  5EBK A;  3IC9 A;  5JRB A;  1NHQ A;  4KPR A;  4YWO A;  2NVK X;  3CGB A;  4DNA A;  5FS8 A;  2X99 A;  2EQ6 A;  2BC1 A;  2YQU A;  3GD3 A;  3L8K A;  3II4 A;  1ZMC A;  2RAB A;  2YVF A;  1S7M A;  2EQ7 A;  3DK8 A;  4JQ9 A;  5JCL A;  4H4V A;  1BZL A;  1GEU A;  3DGH A;  1GRF A;  4H50 A;  5GRT A;  1GRE A;  2W0H A;  2A8X A;  1GRB A;  5FS7 A;  4EQS A;  3DJG X;  1Q1W A;  3OC4 A;  2C3D A;  1KN0 A;  3EAN A;  1F8W A;  2CDU A;  1GET A;  1XDI A;  1GSN A;  5U1O A;  2R9Z A;  1JOA A;  1ZDL A;  2EQ9 A;  4EQR A;  2GQW A;  3EF6 A;  1BWC A;  4ADW A;  2X8C A;  1ONF A;  1XHC A;  1DNC A;  3CGC A;  1MO9 A;  2GR3 A;  4EQX A;  3D9X A;  2WOW A;  3DK4 A;  3GRS A;  2WPE A;  4EM3 A;  4H4R A;  1NPX A;  1XAN A;  5U25 A;  1GRG A;  1NDA A;  4JDR A;  3SQP A;  1MOK A;  4BUR A;  3QFA A;  1FEC A;  4K8D A;  5KVH A;  2V3A A;  2JK6 A;  2BC0 A;  1GER A;  4H4X A;  1NHS A;  2TPR A;  1YQZ A;  4H4Y A;  2YVJ A;  3DK9 A;  3PG6 A;  3CGE A;  5JCM A;  4H4P A;  2GH5 A;  4NEW A;  1K4Q A;  3QFB A;  2GR0 A;  1GES A;  2ZZ0 A;  2V3B A;  2WP6 A;  1F3P A;  2HQM A;  3DH9 A;  3FG2 P;  2GRT A;  3GD4 A;  4BV6 A;  1FEA A;  5JCI A;  3L5O A;  2WOV A;  1Q1R A;  4GRT A;  2BCP A;  2ZZB A;  3LXD A;  1GV4 A;  3H4K A;  1ZMD A;  2WOI A;  4GR1 A;  1LPF A;  3LB8 A;  5FS9 A;  1H6V A;  4LII A;  4H4Q A;  5FS6 A;  4M52 A;  2F5Z A;  5JCN A;  3LAD A;  3DJJ A;  4H4S A;  1GRA A;  4EMI A;  2WPC A;  5ER0 A;  2C3C A;  1GRT A;  2YAU A;  2X8H A;  1FEB A;  4J56 A;  3URH A;  3Q6J A;  4APN A;  4EM4 A;  4K7Z A;  3O0H A;  1OJT A;  1JEH A;  1TYT A;  2EQ8 A;  4H4U A;  2X8G A;  1D7Y A;  1EBD A;  1NHR A;  2QAE A;  1LVL A;  2GR2 A;  2WBA A;  4H4W A;  3RNM A;  4EMW A;  1ZX9 A;  3CGD A;  1GXF A;  2WP5 A;  2NPX A;  4FDC B;  5TR3 A;  1ZK7 A;  1NHP A;  4NEV A;  1AOG A;  2V6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...