3PG6A

The carboxyl terminal domain of human deltex 3-like
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
QKGNQPEGSMVFTVSRDSLPGYESFGTIVITYSMKAGIQTEEHPNPGKRYPGIQRTAYLPDNKEGRKVLKLLYRAFDQKLIFTVGYSRVLGVSDVITWNDIHHKTSRFGGPEMYGYPDPSYLKRVKEELKAKGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Fold of the conserved DTC domain in Deltex proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase DTX3L
total genus 37
structure length 135
sequence length 135
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18102 DTC Deltex C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.130 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3pg6A00
3PG6A
chains in the Genus database with same CATH superfamily
3O0HA 4DWDA 1GRAA 2XH4A 3H8AA 1MDLA 1KKRA 4ZA0A 3CXBA 4IT1A 1WYGA 3DK9A 1GRHA 3TTEA 1MNSA 1JPMA 4IL2A 2NVKX 2X8CA 3TCSA 3DJJA 1BQGA 1KCZA 2OQYA 2POZA 4EQSA 3AMZA 3RNMA 1WUFA 2XH7A 3EF6A 4EQRA 4H1ZA 3BOXA 4H4WA 3DEQA 3PFRA 3R07C 4A6GA 3CXOA 4HNLA 3RRAA 2W3RA 3EANA 1NHQA 4HCDA 4H4UA 3CT2A 4LA1A 2OZ3A 1W6TA 3B9JB 3NZGA 1TYTA 4E4FA 4EMIA 1ECQA 2GGGA 3UJEA 1F8WA 1ZK7A 1DXLA 1P43A 1MRAA 2HNEA 1ZDLA 2GSHA 2ONEA 4HCLA 2BC0A 3BSMA 3VA8A 1SJDA 4LIIA 2CHRA 3Q6JA 1KKOA 2OG9A 2PS2A 4EWJA 3IC9A 4H4TA 5BOEA 4IP5A 1N61C 3HRDC 2WPCA 7ENLA 1V97A 2E3TA 1YEYA 4A3RA 1BWCA 1N5XA 4TVWA 3OW1A 4IP4A 3P0WA 4JN8A 3CB3A 4ADWA 3QKEA 2QVHA 1TE6A 1NU5A 3A7RA 3R0KA 2GGHA 5U1OA 2BC1A 3JW7A 4KEMA 1EBDA 3JVAA 1VDVA 3DGBA 5J04A 3NVWB 4IZGA 3T4WA 2XSXA 1MOKA 3A7AA 2YVFA 2WP6A 3TOYA 2FKPA 3A7UA 2W0HA 3MY9A 4H2HA 2C3CA 4JHMA 4G8TA 4JN7A 3FG2P 3U9IA 3V4BA 2X8GA 2OQHA 3UCCA 3NFUA 2BCPA 2WPEA 1XS2A 3R25A 2OLAA 1PDYA 1RVKA 1H6VA 3FYYA 4HPNA 3RCYA 1GRFA 3NVYB 3NXLA 1D7YA 1NHSA 2QJNA 4K7ZA 2XH0A 3NVZB 1VQZA 4GRTA 5FS8A 2CDUA 2QJJA 2GGEA 1EC7A 4MKSA 1KD0A 3QTPA 2OKTA 2XGZA 1F9CA 2WOWA 3IK4A 4J57A 3V5CA 2HXTA 1PDZA 3L5OA 4J3ZA 2YVGA 3VFCA 1JPDX 1F3PA 2HXUA 2P8BA 3SSZA 1E9IA 1T3QC 3ETRB 2OFJA 2RABA 3GRTA 1STZA 3UCDA 2O56A 4E5TA 3CAWA 3LADA 1YQZA 2X50A 3OZYA 3DESA 3QFAA 2PSNA 1XPYA 3ENLA 1FEAA 3UXKA 4FX9A 1MDRA 1S7MA 3Q45A 4EM4A 3SJNA 3VC5A 1GETA 2QDEA 2QJMA 1FEBA 4EQXA 3SN0A 2QAEA 4H4XA 3DFYA 4GYPC 1OJTA 2P8CA 3T9PA 2GL5A 3I6EA 4BURA 3DG6A 3DH9A 4ENLA 3NRZB 5ENLA 3HW2A 1XANA 4H4PA 3VCCA 2I5QA 2PMQA 3FJ4A 1FIQB 3OC4A 5G5HB 1BKHA 1ZXIC 3IJQA 4GIRA 4DHGA 2EQ7A 2GR1A 3DG3A 3GD4A 2W54A 1N5WC 1GRTA 5FJOA 1ELSA 1GRBA 3FXGA 3OTRA 2W3SA 1EC8A 3ES7A 3GD3A 4H19A 4NEWA 2V6OA 3OP2A 5KVHA 1TZZA 3QFBA 1JCTA 1L8PA 2WOIA 1N63C 3RO6A 1AOGA 3NO1A 3DFHA 3T8QA 4KWSA 3CGBA 4EQWA 2GR0A 2OVLA 3HPFA 4Z17A 3NVVB 4BV6A 3NS1B 2GRTA 1P48A 1NELA 1MO9A 1DNCA 3DDMA 3MSYA 2PP3A 1JROA 3QPEA 3P3BA 1GREA 4MGGA 2WPFA 3QN3A 4YWOA 3P93A 4G7FA 2ZZBA 4H50A 2PGEA 4YWSA 4M0XA 3CGCA 2OZ8A 1DTNA 3AN1A 1SJCA 5JCLA 2ZZ0A 2PTXA 3L8KA 2ZADA 3K1GA 3I4KA 2WOVA 3IJLA 4ZCWA 2GGIA 5EBKA 2AL1A 2GR2A 3ZLFA 4X2PA 1FECA 3DK4A 1R0MA 4K1WA 1XDIA 2F5ZA 2YQUA 3II4A 1Q1WA 5FS6A 3D9XA 3VDGA 5FJRA 1X2HA 4H4SA 3DK8A 2YAUA 3S47A 4H4QA 3T6CA 2OPJA 4ZOHB 4DYEA 2MNRA 2ZZCA 3PK7A 3D46A 3FV9A 3I6TA 4F4RA 5FJPA 3URHA 2AKZA 2PU0A 2J3NA 4H4RA 2R9ZA 5G5GB 4JDRA 3SQPA 3THUA 1ZKQA 2OX4A 3H7VA 2W55A 2PA6A 2X99A 3GY1A 3TWBA 4J56A 5FS7A 3V5FA 2CFYA 2PODA 3PG6A 3ZLHA 3TJIA 5JCNA 1GXFA 4DN1A 1K4QA 1V59A 4Z1YA 1BZLA 3JZUA 1FO4A 1JEHA 4KT2A 3TWAA 1GSNA 4A35A 5FJUA 3CGDA 4HCHA 1SJBA 1ZY8A 4TVYA 1TKKA 1NPXA 5FMHA 2GQWA 3SBFA 3PWIA 3R11A 3SN4A 3ZLGA 3DERA 3BJSA 2WP5A 3GRSA 4GMEA 2PTYA 1ZX9A 3Q4DA 2V3AA 2NPXA 3KLJA 4FI4A 3D47A 1ZMDA 3GO2A 2QQ6A 3N6JA 4GYPA 5GRTA 3TQPA 5EU9A 2A8XA 2PCEA 4K8GA 1IYXA 3IJIA 3VCNA 1OEPA 4M6UA 1N62C 2OO6A 3SR6B 5ER0A 3R0UA 3EAOA 2QDDA 3TW9A 4J1OA 1X2GA 4GISA 4GGHA 4H4ZA 4K8DA 3VC6A 3UJSA 1EC9A 1Q1RA 2AL2B 3UJFA 3AM9A 3DG7A 3ZVIA 1WUEA 5JCIA 3DGZA 2DW7A 3B97A 3GC2A 2PU1A 4IL0A 2DW6A 2PGWA 1H2IA 4E4UA 2EQ8A 2FYMA 3ES8A 2WBAA 3UJ2A 2NQLA 1GESA 3H12A 3N4EA 2P88A 5JCKA 4HNCA 1FHVA 3STPA 5BOFA 2ZC8A 3DIPA 3U4FA 4E6MA 3SN1A 3N6HA 3ZVHB 2HZGA 3LB8A 2PTZA 3KUMA 1JOAA 4EMJA 1FFUC 4GFIA 3MUCA 2GGJA 1M6IA 1MUCA 4GR1A 2AL2A 3MWCA 2RDXA 1LPFA 3UGVA 4APNA 5TR3A 3CK5A 4E8GA 1ONFA 2GDQA 2GH5A 2TPRA 6ENLA 3RITA 2V3BA 4K2SA 2PPGA 1JDFA 3TJ4A 4DXKA 4IHCA 4MMWA 3SQSA 1ONEA 3EKGA 2JK6A 3OPSA 3R1ZA 5JCMA 4GGBA 5U25A 2P0IA 3UJRA 4ROPA 1RM6B 2X8HA 1NDAA 2XH2A 3RR1A 3H70A 3LXDA 5IDZA 2PP1A 3QLDA 3V3WA 2QGYA 1LVLA 3RGTA 1GV4A 3DJGX 3MQTA 1NHPA 2E5AA 3MKCA 4H4YA 4EM3A 1EBGA 3S5SA 1GERA 4FDCB 5FS9A 4DNAA 4EMWA 1XHCA 3GD6A 3FVDA 2GR3A 2AKMA 2YVJA 1KN0A 2P3ZA 2PTWA 3FCPA 1EBHA 1JRPA 3EEZA 4JQ9A 3UXLA 3R10A 4HYRA 1TYPA 5JRBA 2MUCA 2OZTA 3ZVHA 4NEVA 1FFVC 2EQ6A 1R6WA 4DX3A 1ZMCA 4KPLA 3MZNA 1FHUA 3CYJA 5FJTA 3EUB3 5KVIA 2C3DA 4M52A 2AAQA 3H4KA 2HQMA 4KPRA 3CGEA 4FP1A 4HN8A 3PWGA 1SB3B 2PP0A 1GEUA 1GRGA 1N60C 1NHRA 3OZMA 4H4VA 2EQ9A 3N4FA 1SJAA 3DGHA 4H83A
chains in the Genus database with same CATH topology
3O0HA 2ZZ0A 1GRAA 2YVGA 3L8KA 1F3PA 2WOVA 1H2IA 3DK9A 5EBKA 1GRHA 2EQ8A 2GR2A 2WBAA 2NVKX 2X8CA 2RABA 3DJJA 3GRTA 4EQSA 1GESA 1FECA 3DK4A 3RNMA 5JCKA 1XDIA 2F5ZA 2YQUA 3EF6A 3II4A 4EQRA 1Q1WA 3LADA 4H4WA 1YQZA 5FS6A 3LB8A 3D9XA 2X50A 3QFAA 4H4SA 1JOAA 3EANA 3DK8A 1NHQA 2YAUA 4EMJA 4H4UA 4H4QA 1FEAA 4LA1A 4FX9A 1M6IA 1S7MA 4EM4A 4EMIA 4GR1A 1TYTA 2ZZCA 1GETA 1F8WA 1LPFA 1ZK7A 4APNA 1FEBA 4EQXA 1DXLA 5TR3A 3URHA 1ONFA 1ZDLA 2GH5A 2QAEA 2TPRA 2BC0A 2J3NA 2R9ZA 4H4RA 2V3BA 4H4XA 4JDRA 4LIIA 3SQPA 3Q6JA 1OJTA 1ZKQA 2X99A 3IC9A 4BURA 4H4TA 2WPCA 3DH9A 1BWCA 4J56A 5FS7A 2CFYA 2JK6A 3PG6A 1XANA 4H4PA 5JCNA 1GXFA 5JCMA 5U25A 1K4QA 1V59A 2X8HA 1NDAA 4ADWA 1BZLA 3LXDA 3OC4A 5U1OA 2BC1A 1JEHA 2EQ7A 2GR1A 1GSNA 3GD4A 3CGDA 1GRTA 1LVLA 1ZY8A 1GV4A 1GRBA 3DJGX 1EBDA 1NPXA 5FMHA 2GQWA 1NHPA 4H4YA 3GD3A 3GRSA 2WP5A 4EM3A 1MOKA 4NEWA 1GERA 2WP6A 2V6OA 2YVFA 4FDCB 5FS9A 5KVHA 4DNAA 4EMWA 1XHCA 3QFBA 2GR3A 2W0HA 2WOIA 2C3CA 1ZX9A 2YVJA 1KN0A 2V3AA 2NPXA 1AOGA 3KLJA 3FG2P 3CGBA 1ZMDA 2X8GA 4EQWA 2GR0A 4JQ9A 5GRTA 4BV6A 2A8XA 2GRTA 1TYPA 2BCPA 2WPEA 1MO9A 5JRBA 1DNCA 4NEVA 2EQ6A 1ZMCA 1H6VA 1GRFA 5ER0A 5KVIA 3EAOA 2C3DA 4M52A 2AAQA 3H4KA 1GREA 2HQMA 1D7YA 4KPRA 1NHSA 4K7ZA 3CGEA 4K8DA 4H4ZA 2WPFA 4GRTA 5FS8A 4YWOA 1GEUA 1Q1RA 2CDUA 1GRGA 2ZZBA 1NHRA 4H50A 4H4VA 2EQ9A 3CGCA 4J57A 2WOWA 5JCIA 3DGZA 3DGHA 3L5OA 5JCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PG6 A; 
#chains in the Genus database with same CATH topology
 3O0H A;  4DWD A;  1GRA A;  2XH4 A;  3H8A A;  1MDL A;  1KKR A;  4ZA0 A;  3CXB A;  4IT1 A;  1WYG A;  3DK9 A;  1GRH A;  3TTE A;  1MNS A;  1JPM A;  4IL2 A;  2NVK X;  2X8C A;  3TCS A;  3DJJ A;  1BQG A;  1KCZ A;  2OQY A;  2POZ A;  4EQS A;  3AMZ A;  3RNM A;  1WUF A;  2XH7 A;  3EF6 A;  4EQR A;  4H1Z A;  3BOX A;  4H4W A;  3DEQ A;  3PFR A;  3R07 C;  4A6G A;  3CXO A;  4HNL A;  3RRA A;  2W3R A;  3EAN A;  1NHQ A;  4HCD A;  4H4U A;  3CT2 A;  4LA1 A;  2OZ3 A;  1W6T A;  3B9J B;  3NZG A;  1TYT A;  4E4F A;  4EMI A;  1ECQ A;  2GGG A;  3UJE A;  1F8W A;  1ZK7 A;  1DXL A;  1P43 A;  1MRA A;  2HNE A;  1ZDL A;  2GSH A;  2ONE A;  4HCL A;  2BC0 A;  3BSM A;  3VA8 A;  1SJD A;  4LII A;  2CHR A;  3Q6J A;  1KKO A;  2OG9 A;  2PS2 A;  4EWJ A;  3IC9 A;  4H4T A;  5BOE A;  4IP5 A;  1N61 C;  3HRD C;  2WPC A;  7ENL A;  1V97 A;  2E3T A;  1YEY A;  4A3R A;  1BWC A;  1N5X A;  4TVW A;  3OW1 A;  4IP4 A;  3P0W A;  4JN8 A;  3CB3 A;  4ADW A;  3QKE A;  2QVH A;  1TE6 A;  1NU5 A;  3A7R A;  3R0K A;  2GGH A;  5U1O A;  2BC1 A;  3JW7 A;  4KEM A;  1EBD A;  3JVA A;  1VDV A;  3DGB A;  5J04 A;  3NVW B;  4IZG A;  3T4W A;  2XSX A;  1MOK A;  3A7A A;  2YVF A;  2WP6 A;  3TOY A;  2FKP A;  3A7U A;  2W0H A;  3MY9 A;  4H2H A;  2C3C A;  4JHM A;  4G8T A;  4JN7 A;  3FG2 P;  3U9I A;  3V4B A;  2X8G A;  2OQH A;  3UCC A;  3NFU A;  2BCP A;  2WPE A;  1XS2 A;  3R25 A;  2OLA A;  1PDY A;  1RVK A;  1H6V A;  3FYY A;  4HPN A;  3RCY A;  1GRF A;  3NVY B;  3NXL A;  1D7Y A;  1NHS A;  2QJN A;  4K7Z A;  2XH0 A;  3NVZ B;  1VQZ A;  4GRT A;  5FS8 A;  2CDU A;  2QJJ A;  2GGE A;  1EC7 A;  4MKS A;  1KD0 A;  3QTP A;  2OKT A;  2XGZ A;  1F9C A;  2WOW A;  3IK4 A;  4J57 A;  3V5C A;  2HXT A;  1PDZ A;  3L5O A;  4J3Z A;  2YVG A;  3VFC A;  1JPD X;  1F3P A;  2HXU A;  2P8B A;  3SSZ A;  1E9I A;  1T3Q C;  3ETR B;  2OFJ A;  2RAB A;  3GRT A;  1STZ A;  3UCD A;  2O56 A;  4E5T A;  3CAW A;  3LAD A;  1YQZ A;  2X50 A;  3OZY A;  3DES A;  3QFA A;  2PSN A;  1XPY A;  3ENL A;  1FEA A;  3UXK A;  4FX9 A;  1MDR A;  1S7M A;  3Q45 A;  4EM4 A;  3SJN A;  3VC5 A;  1GET A;  2QDE A;  2QJM A;  1FEB A;  4EQX A;  3SN0 A;  2QAE A;  4H4X A;  3DFY A;  4GYP C;  1OJT A;  2P8C A;  3T9P A;  2GL5 A;  3I6E A;  4BUR A;  3DG6 A;  3DH9 A;  4ENL A;  3NRZ B;  5ENL A;  3HW2 A;  1XAN A;  4H4P A;  3VCC A;  2I5Q A;  2PMQ A;  3FJ4 A;  1FIQ B;  3OC4 A;  5G5H B;  1BKH A;  1ZXI C;  3IJQ A;  4GIR A;  4DHG A;  2EQ7 A;  2GR1 A;  3DG3 A;  3GD4 A;  2W54 A;  1N5W C;  1GRT A;  5FJO A;  1ELS A;  1GRB A;  3FXG A;  3OTR A;  2W3S A;  1EC8 A;  3ES7 A;  3GD3 A;  4H19 A;  4NEW A;  2V6O A;  3OP2 A;  5KVH A;  1TZZ A;  3QFB A;  1JCT A;  1L8P A;  2WOI A;  1N63 C;  3RO6 A;  1AOG A;  3NO1 A;  3DFH A;  3T8Q A;  4KWS A;  3CGB A;  4EQW A;  2GR0 A;  2OVL A;  3HPF A;  4Z17 A;  3NVV B;  4BV6 A;  3NS1 B;  2GRT A;  1P48 A;  1NEL A;  1MO9 A;  1DNC A;  3DDM A;  3MSY A;  2PP3 A;  1JRO A;  3QPE A;  3P3B A;  1GRE A;  4MGG A;  2WPF A;  3QN3 A;  4YWO A;  3P93 A;  4G7F A;  2ZZB A;  4H50 A;  2PGE A;  4YWS A;  4M0X A;  3CGC A;  2OZ8 A;  1DTN A;  3AN1 A;  1SJC A;  5JCL A;  2ZZ0 A;  2PTX A;  3L8K A;  2ZAD A;  3K1G A;  3I4K A;  2WOV A;  3IJL A;  4ZCW A;  2GGI A;  5EBK A;  2AL1 A;  2GR2 A;  3ZLF A;  4X2P A;  1FEC A;  3DK4 A;  1R0M A;  4K1W A;  1XDI A;  2F5Z A;  2YQU A;  3II4 A;  1Q1W A;  5FS6 A;  3D9X A;  3VDG A;  5FJR A;  1X2H A;  4H4S A;  3DK8 A;  2YAU A;  3S47 A;  4H4Q A;  3T6C A;  2OPJ A;  4ZOH B;  4DYE A;  2MNR A;  2ZZC A;  3PK7 A;  3D46 A;  3FV9 A;  3I6T A;  4F4R A;  5FJP A;  3URH A;  2AKZ A;  2PU0 A;  2J3N A;  4H4R A;  2R9Z A;  5G5G B;  4JDR A;  3SQP A;  3THU A;  1ZKQ A;  2OX4 A;  3H7V A;  2W55 A;  2PA6 A;  2X99 A;  3GY1 A;  3TWB A;  4J56 A;  5FS7 A;  3V5F A;  2CFY A;  2POD A;  3PG6 A;  3ZLH A;  3TJI A;  5JCN A;  1GXF A;  4DN1 A;  1K4Q A;  1V59 A;  4Z1Y A;  1BZL A;  3JZU A;  1FO4 A;  1JEH A;  4KT2 A;  3TWA A;  1GSN A;  4A35 A;  5FJU A;  3CGD A;  4HCH A;  1SJB A;  1ZY8 A;  4TVY A;  1TKK A;  1NPX A;  5FMH A;  2GQW A;  3SBF A;  3PWI A;  3R11 A;  3SN4 A;  3ZLG A;  3DER A;  3BJS A;  2WP5 A;  3GRS A;  4GME A;  2PTY A;  1ZX9 A;  3Q4D A;  2V3A A;  2NPX A;  3KLJ A;  4FI4 A;  3D47 A;  1ZMD A;  3GO2 A;  2QQ6 A;  3N6J A;  4GYP A;  5GRT A;  3TQP A;  5EU9 A;  2A8X A;  2PCE A;  4K8G A;  1IYX A;  3IJI A;  3VCN A;  1OEP A;  4M6U A;  1N62 C;  2OO6 A;  3SR6 B;  5ER0 A;  3R0U A;  3EAO A;  2QDD A;  3TW9 A;  4J1O A;  1X2G A;  4GIS A;  4GGH A;  4H4Z A;  4K8D A;  3VC6 A;  3UJS A;  1EC9 A;  1Q1R A;  2AL2 B;  3UJF A;  3AM9 A;  3DG7 A;  3ZVI A;  1WUE A;  5JCI A;  3DGZ A;  2DW7 A;  3B97 A;  3GC2 A;  2PU1 A;  4IL0 A;  2DW6 A;  2PGW A;  1H2I A;  4E4U A;  2EQ8 A;  2FYM A;  3ES8 A;  2WBA A;  3UJ2 A;  2NQL A;  1GES A;  3H12 A;  3N4E A;  2P88 A;  5JCK A;  4HNC A;  1FHV A;  3STP A;  5BOF A;  2ZC8 A;  3DIP A;  3U4F A;  4E6M A;  3SN1 A;  3N6H A;  3ZVH B;  2HZG A;  3LB8 A;  2PTZ A;  3KUM A;  1JOA A;  4EMJ A;  1FFU C;  4GFI A;  3MUC A;  2GGJ A;  1M6I A;  1MUC A;  4GR1 A;  2AL2 A;  3MWC A;  2RDX A;  1LPF A;  3UGV A;  4APN A;  5TR3 A;  3CK5 A;  4E8G A;  1ONF A;  2GDQ A;  2GH5 A;  2TPR A;  6ENL A;  3RIT A;  2V3B A;  4K2S A;  2PPG A;  1JDF A;  3TJ4 A;  4DXK A;  4IHC A;  4MMW A;  3SQS A;  1ONE A;  3EKG A;  2JK6 A;  3OPS A;  3R1Z A;  5JCM A;  4GGB A;  5U25 A;  2P0I A;  3UJR A;  4ROP A;  1RM6 B;  2X8H A;  1NDA A;  2XH2 A;  3RR1 A;  3H70 A;  3LXD A;  5IDZ A;  2PP1 A;  3QLD A;  3V3W A;  2QGY A;  1LVL A;  3RGT A;  1GV4 A;  3DJG X;  3MQT A;  1NHP A;  2E5A A;  3MKC A;  4H4Y A;  4EM3 A;  1EBG A;  3S5S A;  1GER A;  4FDC B;  5FS9 A;  4DNA A;  4EMW A;  1XHC A;  3GD6 A;  3FVD A;  2GR3 A;  2AKM A;  2YVJ A;  1KN0 A;  2P3Z A;  2PTW A;  3FCP A;  1EBH A;  1JRP A;  3EEZ A;  4JQ9 A;  3UXL A;  3R10 A;  4HYR A;  1TYP A;  5JRB A;  2MUC A;  2OZT A;  3ZVH A;  4NEV A;  1FFV C;  2EQ6 A;  1R6W A;  4DX3 A;  1ZMC A;  4KPL A;  3MZN A;  1FHU A;  3CYJ A;  5FJT A;  3EUB 3;  5KVI A;  2C3D A;  4M52 A;  2AAQ A;  3H4K A;  2HQM A;  4KPR A;  3CGE A;  4FP1 A;  4HN8 A;  3PWG A;  1SB3 B;  2PP0 A;  1GEU A;  1GRG A;  1N60 C;  1NHR A;  3OZM A;  4H4V A;  2EQ9 A;  3N4F A;  1SJA A;  3DGH A;  4H83 A; 
#chains in the Genus database with same CATH homology
 3O0H A;  2ZZ0 A;  1GRA A;  2YVG A;  3L8K A;  1F3P A;  2WOV A;  1H2I A;  3DK9 A;  5EBK A;  1GRH A;  2EQ8 A;  2GR2 A;  2WBA A;  2NVK X;  2X8C A;  2RAB A;  3DJJ A;  3GRT A;  4EQS A;  1GES A;  1FEC A;  3DK4 A;  3RNM A;  5JCK A;  1XDI A;  2F5Z A;  2YQU A;  3EF6 A;  3II4 A;  4EQR A;  1Q1W A;  3LAD A;  4H4W A;  1YQZ A;  5FS6 A;  3LB8 A;  3D9X A;  2X50 A;  3QFA A;  4H4S A;  1JOA A;  3EAN A;  3DK8 A;  1NHQ A;  2YAU A;  4EMJ A;  4H4U A;  4H4Q A;  1FEA A;  4LA1 A;  4FX9 A;  1M6I A;  1S7M A;  4EM4 A;  4EMI A;  4GR1 A;  1TYT A;  2ZZC A;  1GET A;  1F8W A;  1LPF A;  1ZK7 A;  4APN A;  1FEB A;  4EQX A;  1DXL A;  5TR3 A;  3URH A;  1ONF A;  1ZDL A;  2GH5 A;  2QAE A;  2TPR A;  2BC0 A;  2J3N A;  2R9Z A;  4H4R A;  2V3B A;  4H4X A;  4JDR A;  4LII A;  3SQP A;  3Q6J A;  1OJT A;  1ZKQ A;  2X99 A;  3IC9 A;  4BUR A;  4H4T A;  2WPC A;  3DH9 A;  1BWC A;  4J56 A;  5FS7 A;  2CFY A;  2JK6 A;  3PG6 A;  1XAN A;  4H4P A;  5JCN A;  1GXF A;  5JCM A;  5U25 A;  1K4Q A;  1V59 A;  2X8H A;  1NDA A;  4ADW A;  1BZL A;  3LXD A;  3OC4 A;  5U1O A;  2BC1 A;  1JEH A;  2EQ7 A;  2GR1 A;  1GSN A;  3GD4 A;  3CGD A;  1GRT A;  1LVL A;  1ZY8 A;  1GV4 A;  1GRB A;  3DJG X;  1EBD A;  1NPX A;  5FMH A;  2GQW A;  1NHP A;  4H4Y A;  3GD3 A;  3GRS A;  2WP5 A;  4EM3 A;  1MOK A;  4NEW A;  1GER A;  2WP6 A;  2V6O A;  2YVF A;  4FDC B;  5FS9 A;  5KVH A;  4DNA A;  4EMW A;  1XHC A;  3QFB A;  2GR3 A;  2W0H A;  2WOI A;  2C3C A;  1ZX9 A;  2YVJ A;  1KN0 A;  2V3A A;  2NPX A;  1AOG A;  3KLJ A;  3FG2 P;  3CGB A;  1ZMD A;  2X8G A;  4EQW A;  2GR0 A;  4JQ9 A;  5GRT A;  4BV6 A;  2A8X A;  2GRT A;  1TYP A;  2BCP A;  2WPE A;  1MO9 A;  5JRB A;  1DNC A;  4NEV A;  2EQ6 A;  1ZMC A;  1H6V A;  1GRF A;  5ER0 A;  5KVI A;  3EAO A;  2C3D A;  4M52 A;  2AAQ A;  3H4K A;  1GRE A;  2HQM A;  1D7Y A;  4KPR A;  1NHS A;  4K7Z A;  3CGE A;  4K8D A;  4H4Z A;  2WPF A;  4GRT A;  5FS8 A;  4YWO A;  1GEU A;  1Q1R A;  2CDU A;  1GRG A;  2ZZB A;  1NHR A;  4H50 A;  4H4V A;  2EQ9 A;  3CGC A;  4J57 A;  2WOW A;  5JCI A;  3DGZ A;  3DGH A;  3L5O A;  5JCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...