4J57A

Structure of plasmodium falciparum thioredoxin reductase-thioredoxin complex
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
499
structure length
483
Chain Sequence
HTYDYDYVVIGGGPGGMASAKEAAAHGARVLLFDYVKPSSQGTKWGIGGTCVNVGCVPKKLMHYAGHMGSIFKLDSKAYGWKFDNLKHDWKKLVTTVQSHIRSLNFSYMTGLRSSKVKYINGLAKLKDKNTVSYYLKGDLSKEETVTGKYILIATGCRPHIPDDVEGAKELSITSDDIFSLKKDPGKTLVVGASYVALECSGFLNSLGYDVTVAVRSIVLRGFDQQCAVKVKLYMEEQGVMFKNGILPKKLTKMDDKILVEFSDKTSELYDTVLYAIGRKGDIDGLNLESLNMNVNKSNNKIIADHLSCTNIPSIFAVGDVAENVPELAPVAIKAGEILARRLFKDSDEIMDYSYIPTSIYTPIEYGACGYSEEKAYELYGKSNVEVFLQEFNNLEISAVHRSTCLAKLVCLKNEDNRVIGFHYVGPNAGEVTQGMALALRLKVKKKDFDNCIGIHPTDAESFMNLFVTISSGLSYAAKGGCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase 2
publication title Crystal Structure of the Plasmodium falciparum Thioredoxin Reductase-Thioredoxin Complex.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 155
structure length 483
sequence length 499
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF00890 FAD_binding_2 FAD binding domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4j57A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4j57A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4j57A02
4K5RA 4HA6A 4C5OA 3GYJA 4JQ9A 5BULA 3UTGA 1GT8A 1GPEA 3NYCA 2BACA 1CHUA 3AWIA 4CY6A 1O95A 3KKJA 4TM3A 2A89A 3ICTA 4IVOB 4DNAA 3UOZA 2YR5A 2XLRA 1CJ3A 2BC0A 3UKQA 2B9YA 4U8NA 1NHQA 1IUSA 2IVDA 2C70A 2ACZA 4NEVA 1YY5A 2C67A 2QA1A 1FECA 2AQJA 2FJAA 2VVLG 2YVJA 2OALA 3DJGX 3G5QA 2QAEA 1OJAA 2PYXA 3AE4A 4B64A 1Y56A 5FS7A 5HY5A 3EF6A 1YQ4A 4REKA 2FJDA 4YTMA 1CC6A 2WPFA 1FCDA 1RYIA 2GEWA 1GALA 4H4QA 2WHDA 2XLTA 1NHSA 1COYA 1O94A 3AEBA 3AE2A 3ITJA 2BK4A 2FJBA 3GRSA 1L9CA 2XVEA 1D7LA 2C3CA 1IUTA 1ONFA 3QVPA 3PVCA 2PHHA 2Q0KA 4IA6A 1FEBA 2EQ8A 4EMIA 4H4TA 2DKIA 2GAGB 4Z25A 4FDCB 1L9DA 5C3JA 2GF3A 3DK9A 4FX9A 2E4GA 4OPTA 2X8HA 4H4ZA 3SFEA 4A9WA 2YLWA 3IC9A 1GEUA 1AOGA 2B9XA 1QLBA 3AD8B 2GQWA 3D1CA 3G5SA 4OVIA 4B63A 4BK1A 5JCNA 2Q7VA 4U8OA 2C65A 2CDUA 4H2QA 1F6MA 2IIDA 4H4WA 4CNKA 5HYMA 1IUUA 1GRAA 2YQUA 1RP0A 1NHRA 2GH5A 1GERA 1CJ2A 1PJ6A 4K22A 1XHCA 3QSSA 3ATQA 4A7AA 2WPEA 4AP3A 3UTHA 4GRTA 1K0IA 3LZWA 1O5WA 1N1PA 3DJJA 1CJ4A 4H2PA 1CF3A 1M64A 1S3BA 1MO9A 3LB8A 1DOEA 2FJEA 1GNDA 3GWDA 2OLNA 1YKJA 1S2QA 1F8RA 1GRTA 4J56A 2R9ZA 4I58A 3NG7X 4TLXA 1NENA 4CCQA 2XDOA 3QVRA 4U8JA 1DOBA 1D5TA 4U2LA 3P4RA 3AD7B 3NNEA 4E0VA 1ZOYA 4EM4A 4YKGA 2B7SA 3UOXA 2OAMA 1GRBA 2V60A 4CCRA 4WX1A 1QO8A 1XPQA 2GMJA 3CGDA 1DJNA 1VDCA 3URHA 1E39A 3DMEA 4XXGA 3K7TA 1P2EA 1PXAA 3UKLA 3NRNA 4A65A 1E7PA 2VOUA 1PJ7A 2YG7A 5LV9A 2OLOA 2JBVA 1KF6A 2VVLA 3SGLA 2YLTA 2BK3A 3KVEA 4C77A 3DGZA 1JEHA 2XFQA 3CNPA 4JNQA 4NTDA 3UOYA 3H8IA 1CL0A 1Q1WA 1NG4A 2V61A 2YLSA 4J57A 1K0JA 2YAUA 1NG3A 3EAOA 2XCGA 2BS4A 2WPCA 3AE5A 4Y4LA 4OPCA 1NHPA 2YG5A 3PO7A 4APNA 1Y0PA 3GSIA 1FEAA 1Y56B 3AEAA 1H6VA 1F8SA 2C72A 3GMCA 3P4PA 4H4PA 1B8SA 3UP5A 3AECA 4NEWA 4GDEA 2WP5A 3VQRA 1ZX9A 5KVIA 4GUVA 1PS9A 4GR1A 3RNMA 1L9EA 4JN9A 1CBOA 2R46A 2WETA 4LA1A 1TDKA 4ZCCA 2WU5A 5BRTA 3AEEA 3ALLA 4B69A 1PBFA 1PBCA 3ALMA 2WBAA 3C4AA 2F5ZA 3VR9A 4J2WA 1NAAA 3SQPA 4EQXA 5IQ1A 3K7QX 4BK3A 3ICRA 1N4UA 3KU9A 4U8LA 3CNTA 1LPFA 4JDRA 1N4WA 4TM1A 4OPIA 1PHHA 2RABA 4H4YA 4U8PA 1H7XA 3OC4A 3IF9A 3IHGA 3V3NA 4Z43A 4FK1C 3ZYXA 1Q1RA 2UZZA 2YR4A 3AEGA 3PS9A 4KX6A 2CULA 5M10A 3UKFA 4UDQA 4D03A 4M52A 3UTFA 2XFUA 1K4QA 1DOCA 3UP4A 1E6EA 1NPXA 3QFAA 2EQ6A 3NYEA 2Z5YA 5GRTA 2ZBWA 2NVKX 1IUWA 3REDA 4IVMB 3DJEA 3NLCA 3G5RA 2VRMA 3P9UA 1DJQA 4B66A 2R4EA 3LADA 1PBEA 3B6DA 4BJYA 1LQUA 3P4SA 3ALJA 3QFBA 2R45A 4FK1A 2YM2A 4A79A 4DSGA 1ZMDA 1M6IA 2BA9A 5KVHA 4TM4A 1PBDA 1GOSA 2VVMA 2NPXA 2GAHB 3BHKA 2VQ7A 1GTHA 3COXA 1ZDLA 1X31B 2B7RA 3AYLA 4A5LA 4EM3A 4YWOA 2XVIA 1FOHA 4ICYA 2HQMA 4UDRA 1TYTA 4HB9A 3UTEA 3AYIA 4CNJA 1XANA 2RGHA 4J34A 1ZOVA 4K8DA 4X4JA 3GWFA 2R0CA 3DJDA 5EOWA 3RP7A 2WESA 1OJDA 3F8PA 4RG4A 4GF7A 1TYPA 1VG9A 4U8KA 4D04A 2FBWA 4EMJA 2WOWA 1CC2A 1SEZA 2BABA 3O0HA 3FPZA 4U2SA 1ZKQA 3NK1X 1DODA 1KFYA 1DXLA 2XFOA 4OPUA 5KOWA 1B4VA 2WDRA 3DA1A 4ZCDA 1YQZA 2BCPA 2H89A 3BI5A 4U8MA 2XYOA 3GDPA 2EQ9A 1P2HA 2C64A 2C66A 4EIQA 4Z2RA 4Y4NA 1H82A 1JOAA 4A6NB 2ARDA 2X8GA 1KSUA 1L0VA 3IHMA 5EB4A 1GESA 1S2YA 3C4NA 1BZLA 4YSYA 5HHFA 1JNZA 2GMHA 1TDFA 2XVHA 5J60A 1BGNA 1EL8A 2E5VA 1PBBA 2H88A 1XDIA 1KNPA 5M0ZA 3CNDA 4LIIA 4OPDA 4BV6A 4EQWA 4H2RA 4X9NA 4Z24A 1GXFA 3VRAA 2X99A 1GRGA 4NZHA 4OPGA 3UKHA 3CNJA 4B68A 4IA5A 2RGOA 2XLSA 4K2XA 4MJWA 4AP1A 3ISHA 2Q6UA 1F3PA 3DK4A 1QJDA 5EB5A 3RHAA 1REOA 4CRTA 4DSHA 4RSLA 1ZMCA 4ZN0A 3EANA 1H81A 2DKHA 4IV9A 1OJCA 2APGA 2C75A 2VZ2A 5FS9A 1TDNA 2GVCA 3CGEA 1E1KA 4PAAA 4ECHA 4UP3A 1PJ5A 3H8LA 4EMWA 4AT0A 1H7WA 3AE8A 2Q0LA 1NDAA 1N4VA 2J3NA 3Q9TA 3K7MX 5FS6A 1KNRA 3QJ4A 4GCMA 2ZZ0A 1D7YA 2WOVA 3NK0X 4O5QA 3KLJA 4JY2A 1TRBA 1ZK7A 1OJ9A 4YXDA 1GETA 2YVFA 3CIRA 5U1OA 1MOKA 5KRQA 2GR2A 3H4KA 3NGCX 2V3BA 1OJTA 5KWFA 3NHOX 3IWAA 2CFYA 1Q9IA 1PXBA 1VQWA 4KPRA 2X50A 4K7ZA 3AEFA 1S3EA 3AXBA 3CN8A 4K5SA 4NTEA 3QSMA 3BHFA 4OPLA 2ZZCA 4CBQA 4U8IA 4Y4MA 3DK8A 3ZDNA 3DH9A 1EL5A 2BXRA 1CC4A 3I3LA 3OZ2A 4H2NA 4X9MA 2C76A 5J7XA 4B65A 4C74A 2BK5A 2C3DA 3T37A 5JCLA 5U63A 2C7GA 2GV8A 2VQBA 3NIXA 2R0PA 3JSKA 3UKAA 4C3YA 2WP6A 4H4XA 4NTCA 1GTEA 3NN0X 4H50A 3ADAB 4Z44A 4GDPA 4PABA 2WOIA 1FL2A 4AOXA 5C2TA 4YTNA 2BCGG 4DGKA 1GRFA 3FBSA 3M0OA 3V3OA 1VRQB 4AT2A 3R9UA 2AR8A 3CPJG 4U2TA 3CGBA 2JB2A 2JAEA 4LU6A 1GRHA 5BUKA 3NN6X 3KD9A 1GREA 3UKKA 3P1WA 2ZZBA 2GB0A 3GD4A 3ABVA 3NTAA 1TDEA 2BS3A 1BGJA 5EBKA 5CQFA 3SFDA 3HZLA 4J31A 5FS8A 4B67A 4TLZA 4UDPA 1IJHA 4BJZA 3QSEA 2W0HA 1GSNA 4Z2TA 1BKWA 4I59A 2JB3A 4YKFA 1ELIA 1W4XA 4J36A 3GYIA 2TPRA 3FMWA 1LVLA 2CVJA 2XVFA 2YLXA 2WQYA 2WEUA 3F8DA 4EQRA 4CY8A 1VG0A 2GQFA 5BVAA 4Z2UA 3L1RA 4USQA 4A99A 3S5WA 2Y6RA 3C96A 2RGJA 1ZP0A 1JNRA 3VRBA 2X8CA 1B37A 4EIPA 2BS2A 5IQ4A 5TR3A 3V76A 2A87A 1D4DA 3LXDA 3AD9B 2GRTA 3GMBA 2GR1A 1NEKA 2R0GA 2R4JA 2B9WA 3AE1A 2BC1A 4JY3A 1DNCA 1BWCA 2YG6A 3S61A 4YT0A 2YG3A 3CGCA 3NT6A 4ADWA 1V59A 3NKSA 4WCTA 2WS3A 2WP9A 1EBDA 2VRLA 3RP6A 1H86A 3B3RA 3KA7A 3M13A 2X3NA 3NH3X 3BI4A 1K0LA 1D4CA 2I0ZA 3D8XA 4O5UA 4USRA 3E1TA 1MXTA 3AE7A 3UOVA 1IUXA 2V5ZA 5U25A 1PDHA 1HYUA 3AB1A 3GDNA 4P9SA 2TMDA 4XWZA 4AOSA 1LV0A 3AE6A 4Z26A 2EQ7A 5JCMA 2Z5XA 5DBJA 1UKVG 1KDGA 2E1MA 3BI2A 3NK2X 4H4RA 1KSSA 3P4QA 3BNUA 2YR6A 2GR3A 2JB1A 2V3AA 2JK6A 3BNMA 1H83A 5HXIA 1LQTA 3AEDA 1PXCA 1JRXA 1JRZA 3VRDB 1GV4A 4JNAA 3I6DA 3CNSA 2OA1A 5CKUA 1E1MA 4N9XA 3VR8A 1F8WA 2XVJA 5JCIA 3CPIG 2IVEA 4EQSA 1BF3A 3LJPA 3EPTA 3ICSA 5JCKA 1EL9A 4J33A 4YSHA 1RSGA 2JKCA 1Z6LA 3NYFA 2BXSA 4BURA 2YVGA 3SM8A 3WE0A 2YG4A 3K30A 2XLPA 4C3XA 2Y6QA 1IUVA 1CJCA 4TM0A 2A8XA 5ER0A 3FG2P 4RG3A 3LOVA 2C73A 5KXJA 3AYJA 4YSXA 3CPHG 2AAQA 1B5QA 3RP8A 3UCLA 2GR0A 4H4SA 3ATRA 4H7UA 3UKPA 4BK2A 2YM1A 2QA2A 2B76A 2YWLA 4OCGA 1ZY8A 3LZXA 1YQ3A 1EL7A 1E1NA 3L8KA 4H4UA 1H84A 2XLUA 2YLZA 3M12A 3DGHA 5IPYA 1TDOA 3KPFA 4YSZA 1D4EA 2V6OA 2QCUA 2XFPA 1LTXR 3II4A 4A6NA 5KOXA 1PN0A 3NTDA 2WDQA 5GSNA 3GRTA 2YLRA 1JRYA 2XFNA 4B1BA 5L46A 3F8RA 1JU2A 1LJ1A 3Q6JA 2WDVA 2O9ZA 3AE9A 3AE3A 4XWRA 3FIMB 3GD3A 4YTPA 1E1LA 4H4VA 2BYBA 3CTYA 5FMHA 2WU2A
chains in the Genus database with same CATH superfamily
2PU0A 4C5OA 5BULA 3QKEA 1GT8A 1PDYA 4DNAA 2YR5A 1CJ3A 2BC0A 3UKQA 2PSNA 2CHRA 2C67A 3ZLGA 2VVLG 1MRAA 1KKRA 4REKA 1CC6A 2WPFA 1RYIA 2WHDA 3ITJA 4KX6A 1NHSA 3VA8A 3SXIA 3NVZB 3PVCA 1FEBA 3TTEA 2DKIA 3DIPA 4HPNA 1L9DA 5C3JA 3CAWA 4A9WA 4A6GA 2B9XA 1QLBA 3AD8B 2GQWA 1ZXIC 4U8OA 4H2QA 3GO2A 3UXKA 1PDZA 5HYMA 2YQUA 4K22A 1GERA 1CJ2A 1XHCA 4AP3A 4GRTA 1K0IA 3DJJA 1CF3A 3TJIA 2OLNA 1YKJA 1IYXA 1GRTA 3NG7X 4TLXA 4DXKA 4GYPC 4U8JA 3NNEA 4E0VA 2OAMA 2OO6A 3V5CA 1DJNA 3OP2A 3URHA 1VQZA 1VDCA 3SN0A 3K7TA 3V3WA 3TWAA 3KUMA 4A65A 2JBVA 1KF6A 4GYPA 4C77A 3DGZA 3H8IA 4IP5A 2GGGA 3R0UA 1NG3A 2XCGA 2WPCA 3MZNA 4APNA 1FEAA 1Y56B 3P4PA 3GMCA 4NEWA 2WP5A 1ZX9A 4GUVA 3RNMA 1L9EA 4JN9A 4K1WA 1CBOA 3VC6A 4LA1A 3AEEA 1PBFA 1PBCA 2PP0A 3VR9A 1NAAA 4BK3A 3K7QX 4G73A 1LPFA 2DW6A 3DFYA 1PHHA 2RABA 3FV9A 2UZZA 3TQPA 3PS9A 2CULA 4G6GA 2MUCA 4UDQA 4D03A 2XFUA 1K4QA 1VDVA 1E6EA 4K8GA 3QFAA 3ZLHA 2NVKX 3REDA 3DJEA 3NLCA 3G5RA 1DJQA 3B6DA 4NNJA 1LQUA 3IK4A 3HW2A 3SQSA 1SJCA 5ENLA 3H70A 3BHKA 3EEZA 1X31B 3AYLA 4A5LA 3U4FA 4EM3A 3T8QA 1EC8A 3GWFA 5EOWA 2PTZA 1VG9A 4OPUA 1DXLA 1B4VA 4E6MA 3DA1A 4ZCDA 2OX4A 1P2HA 2C64A 1FIQB 2X8GA 3IHMA 2P3ZA 3C4NA 4H2HA 5J60A 2E5VA 2H88A 1XDIA 5M0ZA 3CNDA 4OPDA 4BV6A 4H2RA 1GXFA 1RM6B 3CNJA 4IA5A 2XLSA 4K2XA 4MJWA 3ISHA 3I6TA 2HXUA 1QJDA 1REOA 2C75A 5KNLA 3CT2A 3BJSA 2C4CA 4KEMA 3H8LA 1H7WA 1NDAA 3K7MX 4GCMA 2ZZ0A 4JY2A 3CIRA 2OPJA 2GR2A 5KWFA 3AEFA 4NTEA 3CN8A 4ENLA 3Q4DA 3SR6B 3HYXA 4CBQA 4U8IA 3DH9A 5J7XA 1CC4A 2C3DA 3EUB3 3T37A 2C7GA 2PU1A 3NIXA 4H4XA 3PWGA 4NTCA 4H50A 4GDPA 3UJ2A 4PABA 5C2TA 3NS1B 4AT2A 2XH7A 2AR8A 2JB2A 4LU6A 5BUKA 1GREA 3UKKA 5EBKA 3SFDA 3HZLA 5FS8A 4II3A 4ZOHB 3T9PA 4I59A 2JB3A 2O56A 3GYIA 2TPRA 3FMWA 1X2GA 2YLXA 3SN1A 3JW7A 2P0IA 3R11A 3L1RA 4A99A 2ONEA 3A7RA 4GGBA 2X8CA 3SYIA 3ES7A 3FJ4A 5G5HB 5KMPA 4IHCA 3A7AA 3DGBA 4H1ZA 5FJOA 2R0GA 4GAVA 3T6CA 3SBFA 4WCTA 3ZLFA 2PGWA 2VRLA 4IZGA 1D4CA 3E1TA 1IUXA 2EQ7A 3T0KA 2Z5XA 1UKVG 3OPSA 3BI2A 3EKGA 3P4QA 2YR6A 2V3AA 1H83A 3AEDA 1N5XA 1S7MA 3VR8A 4J33A 4IL2A 2BXSA 3SM8A 3WE0A 2YG4A 2XLPA 1CJCA 4TM0A 3SZCA 3LOVA 3T31A 3UCLA 2GR0A 3ATRA 4BK2A 1ZY8A 1YQ3A 1E1NA 4H4UA 5FJPA 3H8AA 4YSZA 2AL2A 4A6NA 5KOXA 1PN0A 3NTDA 1FFUC 2WDQA 3GRTA 1JRYA 3F8RA 1JU2A 1LJ1A 3AE3A 3DG6A 4IL0A 1E1LA 3IJIA 4HCHA 1W6TA 5JRBA 4HA6A 3GYJA 4GFIA 1CHUA 3FYYA 3ZVIA 2B9YA 2IVDA 4NEVA 1YY5A 4MMWA 2QA1A 2AQJA 3DJGX 4B64A 2QAEA 1OJAA 3AE4A 2BRYA 5G5GB 3EF6A 3AM9A 1FCDA 3AEBA 1COYA 1WUFA 1O94A 3PG6A 3CYJA 1X2HA 2FJBA 3GRSA 1D7LA 2C3CA 2EQ8A 3GY1A 2GAGB 4H4TA 4Z25A 4FDCB 3DK9A 4FX9A 5KMSA 3SFEA 1GEUA 4B63A 3R10A 3UCCA 2IIDA 3BOXA 3STPA 1RP0A 1NHRA 2GH5A 3UTHA 1O5WA 1N1PA 2QJNA 4GGHA 2FJEA 3RO6A 4CCQA 1DOBA 4U2LA 3P4RA 1ZOYA 4EM4A 1QO8A 2GMJA 4KWSA 1E39A 3DMEA 5KMQA 4XXGA 1PXAA 1KKOA 4ZCWA 2VOUA 4G6HA 1PJ7A 2OLOA 3SGLA 2VVLA 3KVEA 2PS2A 1JEHA 3CNPA 4JNQA 4NTDA 4A35A 3UOYA 1CL0A 4J57A 1K0JA 2YAUA 2PMQA 4Y4LA 1NHPA 3B9JB 3AEAA 1H6VA 1JDFA 1B8SA 4GDEA 3IJLA 2PTYA 2WETA 4ZCCA 2WU5A 3ALLA 2WBAA 5J04A 4J2WA 4U8LA 3CNTA 4OPIA 5IDZA 4U8PA 3IF9A 4Z43A 3PK7A 3ZYXA 5M10A 3UKFA 1DOCA 1NPXA 3NYEA 2Z5YA 2ZBWA 3UJRA 3PFRA 2VRMA 2R4EA 1PBEA 3RRAA 3JZUA 3K1GA 4EWJA 3ALJA 2R45A 3R1ZA 2YM2A 1ZMDA 4TM4A 2VVMA 3DERA 2W55A 2B7RA 3TWBA 3UJFA 2GGJA 4ICYA 1XS2A 1TYTA 1XANA 1YEYA 4X4JA 2FBWA 1CC2A 2BABA 3O0HA 4U2SA 4U8MA 2XYOA 2EQ9A 4EIQA 1JOAA 4G8TA 1L0VA 2POZA 1S2YA 1JNZA 2XVHA 1BGNA 3UJEA 3NRZB 1DTNA 2OQHA 1GRGA 3UXLA 4OPGA 1ECQA 3SX6A 2XH4A 1JPMA 1F3PA 5EB5A 1H81A 3CMMA 1TDNA 1L8PA 4TVWA 1PJ5A 2FKPA 3AE8A 2Q0LA 2J3NA 2W3RA 3QJ4A 3NK0X 2OQYA 1OJ9A 4YXDA 1GETA 2P88A 2YVFA 2GSHA 3NGCX 1PXBA 4KPRA 4K5SA 3QSMA 4OPLA 4Y4MA 3DK8A 2BXRA 3P0WA 4X9MA 2C76A 2BK5A 5JCLA 1E9IA 2WP6A 3T4WA 4Z44A 1N5WC 1FL2A 4AOXA 1GRFA 3FCPA 4U2TA 1GRHA 3KD9A 1TDEA 2BS3A 5CQFA 4TLZA 2W0HA 4Z2TA 2OLAA 2GL5A 2OKTA 1ELIA 1LVLA 2XVFA 3NVVB 3F8DA 1VG0A 5BVAA 2Y6RA 1JNRA 3SN4A 3VRBA 2GR1A 2OG9A 1NEKA 2BC1A 4JY3A 1EC9A 4HN8A 3SJNA 1BWCA 4ROPA 3S61A 2YG3A 3CGCA 1JCTA 3TJ4A 3TOYA 3RP6A 1H86A 3B3RA 1MDRA 2I0ZA 3BI4A 3D8XA 4O5UA 3AE7A 3UOVA 2V5ZA 4XWZA 5U25A 1HYUA 1LV0A 2GGIA 1SB3B 2GR3A 2JB1A 1LQTA 1JRXA 3CNSA 1E1MA 1F8WA 5JCIA 1BF3A 3LJPA 5JCKA 3MKCA 1RSGA 2JKCA 5FJUA 3NYFA 2I5QA 1IUVA 4JN8A 3VCNA 5ER0A 3FG2P 4YSXA 3CPHG 3RP8A 4H4SA 2YM1A 2QDDA 3T2ZA 2YWLA 5KMRA 3LZXA 3VFCA 3NZGA 2XLUA 2PPGA 5BOFA 2V6OA 2QCUA 2PP1A 3SZWA 2O9ZA 3AE9A 4XWRA 3FIMB 4YTPA 4H4VA 2BYBA 2WU2A 1SJDA 3HYWA 4JQ9A 3N6HA 3AWIA 3KKJA 3DG7A 3V4BA 3THUA 3RITA 1NHQA 1IUSA 4U8NA 3N4FA 2ACZA 1FECA 4YWSA 2OALA 3I4KA 5HY5A 1YQ4A 2FJDA 4YTMA 3UKAA 4H4QA 3AE2A 3DEQA 1ELSA 1L9CA 1IUTA 4GIRA 3QPEA 2E4GA 2GDQA 2X8HA 1AOGA 4Z2RA 3D1CA 2OFJA 5JCNA 2Q7VA 4X2PA 2C65A 3VDGA 1IUUA 1N60C 2WPEA 5BOEA 3LZWA 3ZVHB 3MSYA 1CJ4A 4H2PA 1M64A 1S3BA 1MO9A 1DOEA 1GNDA 2R9ZA 4I58A 1D5TA 3T2KA 4YKGA 2B7SA 4CCRA 4WX1A 1FHUA 3CGDA 3S47A 1MUCA 3R25A 3UKLA 3NRNA 1E7PA 2YG7A 5LV9A 2YLTA 2BK3A 2XFQA 3V5FA 1NELA 2V61A 2YLSA 3UJSA 3AE5A 2YG5A 3VC5A 3Q45A 3GC2A 3GSIA 3UP5A 2C72A 2AKZA 3VQRA 5KVIA 1PS9A 4GR1A 4JHMA 1TDKA 4FP1A 5BRTA 1P43A 4B69A 2PGEA 2F5ZA 3SQPA 1N4UA 3KU9A 3B97A 4H4YA 1H7XA 3V3NA 2PODA 3IHGA 4FK1C 2W54A 4KPLA 3AEGA 4MKSA 2XSXA 4M52A 3UP4A 1IUWA 6ENLA 4GISA 4IVMB 3P9UA 4B66A 3LADA 4BJYA 3P4SA 3QFBA 4FK1A 2OZ3A 4KT2A 4DSGA 3NXLA 2GAHB 1GTHA 2GGHA 4YWOA 4UDRA 4CNJA 2OZ8A 2RGHA 1ZOVA 2R0CA 3RP7A 2ZADA 3CK5A 3P3BA 4D04A 2WOWA 1SEZA 3AN1A 1DODA 3DDMA 2H89A 3BI5A 2E3TA 1H82A 2ARDA 1GESA 4YSYA 1TDFA 4J3ZA 1PBBA 1KNPA 4EQWA 1KCZA 4X9NA 4Z24A 4NZHA 3UKHA 2PA6A 2RGOA 5EU9A 2PCEA 4AP1A 2MNRA 5FJTA 2Q6UA 4DSHA 3DK4A 3RHAA 4CRTA 4RSLA 1ZMCA 3EANA 2DKHA 4IV9A 3QN3A 2VZ2A 1OJCA 5FS9A 2GVCA 3CGEA 1E1KA 4PAAA 4ECHA 4UP3A 3PWIA 4AT0A 1N4VA 3CB3A 4HNCA 1D7YA 1STZA 3HPFA 4F4RA 2GGEA 5U1OA 1MOKA 3T2YA 1SJAA 3NHOX 2CFYA 3MQTA 4K7ZA 1S3EA 3BHFA 1EL5A 4B65A 3I3LA 4C74A 4H19A 2GV8A 2VQBA 2R0PA 3JSKA 4C3YA 4Z1YA 2NQLA 1GTEA 3DESA 3ADAB 2FYMA 2WOIA 2BCGG 3JVAA 3V3OA 4K2SA 3M0OA 3R9UA 3UCDA 2JAEA 4DN1A 3P1WA 2GB0A 2OZTA 3ABVA 3NTAA 1BGJA 2PP3A 4ZA0A 1IJHA 2HXTA 2DW7A 2QQ6A 3FVDA 1GSNA 1V97A 2CVJA 2WQYA 4CY8A 4II2A 4EQRA 2GQFA 4USQA 1EBHA 4E5TA 3S5WA 1ZP0A 2P8CA 2E5AA 3V76A 2A87A 3D9XA 3LXDA 4IT1A 3AD9B 2GRTA 3GMBA 2R4JA 3AE1A 2YG6A 4DWDA 4ADWA 1V59A 2WS3A 2WP9A 1TE6A 3M13A 2X3NA 3NH3X 1K0LA 3SY4A 1R6WA 1PDHA 4P9SA 2TMDA 5JCMA 3VCCA 4JN7A 5DBJA 1KDGA 1KSSA 3BNUA 2JK6A 3BNMA 3OTRA 2QGYA 2BRAA 3D47A 1JRZA 3VRDB 1GV4A 4JNAA 3I6DA 4N9XA 3CPIG 3EPTA 3ICSA 2RDXA 1EL9A 4BURA 2YVGA 2A8XA 4RG3A 3OZMA 1H2IA 2QA2A 2B76A 1TDOA 3KPFA 1D4EA 1JROA 3II4A 2QVHA 2YLRA 3GD6A 1N62C 5L46A 4IP4A 3Q6JA 1FFVC 3GYXA 3GD3A 3CTYA 5FMHA 4HCDA 4K5RA 3ES8A 3MUCA 1R0MA 1WYGA 3UTGA 1GPEA 3NYCA 2BACA 4CY6A 1O95A 4TM3A 2A89A 3ICTA 4IVOB 3UOZA 2XLRA 7ENLA 2C70A 2FJAA 2YVJA 1N61C 3G5QA 2PYXA 1Y56A 5FS7A 1ONEA 2XLTA 2GEWA 1GALA 3NVYB 3R0KA 2BK4A 2XVEA 1ONFA 3QVPA 2PHHA 2Q0KA 4IA6A 4EMIA 4J1OA 2GF3A 4OPTA 4H4ZA 2YLWA 3IC9A 4OVIA 2QJJA 3G5SA 4Z17A 3MY9A 1T3QC 2CDUA 1FO4A 1F6MA 4H4WA 4CNKA 1GRAA 4G9KA 1PJ6A 3MWCA 3UGVA 3ATQA 3QSSA 4A7AA 1TZZA 3LB8A 2PTXA 4GAPA 2QDEA 3GWDA 1S2QA 1F8RA 4J56A 1NENA 2XDOA 3QVRA 3AMZA 3AD7B 3R07C 3UOXA 1GRBA 2V60A 1XPQA 3HYVA 1P2EA 1EBGA 3H7VA 4HCLA 1KN0A 1Q1WA 1NG4A 3OZYA 3EAOA 2BS4A 4OPCA 3PO7A 3I6EA 1Y0PA 3QTPA 1F8SA 4M0XA 4H4PA 3N6JA 3AECA 2QJMA 1RVKA 2R46A 4G74A 1FHVA 3ALMA 3SSZA 3C4AA 5IQ1A 1BQGA 2AKMA 4EQXA 4DX3A 3ICRA 1JPDX 4JDRA 1N4WA 4TM1A 3NFUA 3OC4A 4DYEA 4MGGA 1Q1RA 2YR4A 2PTWA 3UTFA 3U9IA 4NWZA 2EQ6A 5GRTA 3T14A 2XH2A 3CXBA 4A79A 2BA9A 1M6IA 5KVHA 1BKHA 1PBDA 3L5OA 1GOSA 2NPXA 2VQ7A 3COXA 1ZDLA 2ZC8A 2XVIA 1FOHA 2HQMA 4HB9A 3UTEA 3AYIA 4J34A 4K8DA 3DJDA 2WESA 1OJDA 3F8PA 4RG4A 3DG3A 4GF7A 1TYPA 4U8KA 3FXGA 4EMJA 3SZFA 4E8GA 3FPZA 1ZKQA 4A3RA 3NK1X 3H12A 1KFYA 2XFOA 5KOWA 2XH0A 2WDRA 1YQZA 2BCPA 3GDPA 2C66A 4GMEA 4Y4NA 2AL2B 4A6NB 3RGTA 1KSUA 1TKKA 4HYRA 3P93A 5EB4A 4TVYA 3ENLA 1BZLA 5HHFA 2GMHA 1EL8A 2P8BA 4LIIA 3VRAA 2X99A 4B68A 4H83A 4ZN0A 3RR1A 2APGA 1EC7A 4EMWA 3IJQA 3Q9TA 5FS6A 1KNRA 2WOVA 4O5QA 3KLJA 3N4EA 1TRBA 1ZK7A 2HZGA 3RCYA 5KRQA 3H4KA 2V3BA 1OJTA 3IWAA 1VQWA 2X50A 3QLDA 3AXBA 3ZVHA 2ZZCA 3ZDNA 3OZ2A 4H2NA 1F9CA 3BSMA 1KD0A 5U63A 1NU5A 3A7UA 3NN0X 1MNSA 4YTNA 4DGKA 4FI4A 3FBSA 3KPKA 1VRQB 3CPJG 3CGBA 3CXOA 3NN6X 2ZZBA 3GD4A 4J31A 4B67A 4UDPA 4BJZA 4E4FA 3QSEA 1BKWA 4YKFA 1W4XA 4J36A 1XPYA 4G7FA 2WEUA 4Z2UA 3C96A 4HNLA 2RGJA 3HRDC 2AL1A 1B37A 4EIPA 2BS2A 5IQ4A 5TR3A 3OW1A 1D4DA 2HNEA 2B9WA 3S5SA 1DNCA 4YT0A 3NT6A 4M6UA 3NKSA 1EBDA 3KA7A 4USRA 1N63C 5FJRA 3D46A 1MXTA 3AB1A 3GDNA 4BK1A 4AOSA 3AE6A 4Z26A 1JRPA 2E1MA 3NK2X 4H4RA 4DHGA 1OEPA 5HXIA 1PXCA 1WUEA 2OA1A 5CKUA 2XVJA 2IVEA 4EQSA 3SZ0A 4YSHA 1Z6LA 3NVWB 1MDLA 3K30A 4C3XA 2Y6QA 3TCSA 5KXJA 2C73A 2OVLA 3AYJA 2AAQA 1B5QA 4H7UA 3UKPA 4OCGA 1EL7A 2W3SA 3L8KA 1H84A 2YLZA 3M12A 3DGHA 5IPYA 4E4UA 3ETRB 2XFPA 1LTXR 1P48A 3DFHA 3TW9A 5GSNA 1SJBA 2XFNA 4B1BA 2WDVA 2XGZA 3NO1A 1Q9IA
chains in the Genus database with same CATH topology
4K5RA 5JRBA 4HA6A 4C5OA 3HYWA 3GYJA 4JQ9A 5BULA 3UTGA 1GT8A 1GPEA 3NYCA 2BACA 1CHUA 3AWIA 4CY6A 1O95A 3KKJA 4TM3A 2A89A 3ICTA 4IVOB 4DNAA 3UOZA 2YR5A 2XLRA 1CJ3A 2BC0A 3UKQA 2B9YA 4U8NA 1NHQA 1IUSA 2IVDA 2C70A 2ACZA 4NEVA 1YY5A 2C67A 2QA1A 1FECA 2AQJA 2FJAA 2VVLG 2YVJA 2OALA 3DJGX 3G5QA 2QAEA 1OJAA 2PYXA 3AE4A 4B64A 2BRYA 1Y56A 5FS7A 5HY5A 3EF6A 1YQ4A 4REKA 2FJDA 4YTMA 1CC6A 2WPFA 1FCDA 1RYIA 2GEWA 1GALA 4H4QA 2WHDA 2XLTA 1NHSA 1COYA 1O94A 3AEBA 3AE2A 3PG6A 3SXIA 2BK4A 2FJBA 3GRSA 1L9CA 2XVEA 1D7LA 2C3CA 1IUTA 1ONFA 3QVPA 3PVCA 2PHHA 2Q0KA 4IA6A 1FEBA 2EQ8A 4EMIA 4H4TA 2DKIA 2GAGB 4Z25A 4FDCB 1L9DA 5C3JA 2GF3A 3DK9A 4FX9A 2E4GA 5KMSA 4OPTA 2X8HA 4H4ZA 3SFEA 4A9WA 2YLWA 3IC9A 1GEUA 1AOGA 2B9XA 1QLBA 3AD8B 2GQWA 3D1CA 3G5SA 4OVIA 4B63A 4BK1A 5JCNA 2Q7VA 4U8OA 2C65A 2CDUA 4H2QA 1F6MA 2IIDA 4H4WA 4CNKA 5HYMA 1IUUA 1GRAA 2YQUA 1RP0A 1NHRA 2GH5A 1GERA 1CJ2A 1PJ6A 4G9KA 1XHCA 4K22A 3QSSA 3ATQA 4A7AA 2WPEA 4AP3A 3UTHA 4GRTA 1K0IA 3LZWA 1O5WA 1N1PA 3DJJA 1CJ4A 4H2PA 1CF3A 1M64A 1S3BA 1MO9A 3LB8A 1DOEA 4GAPA 2FJEA 1GNDA 3GWDA 2OLNA 1YKJA 1S2QA 1F8RA 1GRTA 4J56A 2R9ZA 4I58A 3NG7X 4TLXA 1NENA 4CCQA 2XDOA 3QVRA 4U8JA 1DOBA 1D5TA 4U2LA 3P4RA 3AD7B 3NNEA 4E0VA 1ZOYA 4EM4A 3T2KA 2B7SA 3UOXA 2OAMA 1GRBA 2V60A 4CCRA 4WX1A 1QO8A 1XPQA 2GMJA 3CGDA 1DJNA 1VDCA 3URHA 3HYVA 1E39A 3DMEA 5KMQA 4XXGA 3K7TA 1P2EA 1PXAA 3UKLA 3NRNA 4A65A 1E7PA 2VOUA 4G6HA 1PJ7A 2YG7A 5LV9A 2OLOA 2JBVA 1KF6A 2VVLA 3SGLA 2YLTA 2BK3A 3KVEA 4C77A 3DGZA 1JEHA 2XFQA 3CNPA 4JNQA 4NTDA 3UOYA 3H8IA 1KN0A 1CL0A 1Q1WA 1NG4A 2V61A 2YLSA 4J57A 1K0JA 2YAUA 1NG3A 3EAOA 2XCGA 2BS4A 2WPCA 3AE5A 4Y4LA 4OPCA 1NHPA 2YG5A 3PO7A 4APNA 1Y0PA 3GSIA 1FEAA 1Y56B 3AEAA 1H6VA 1F8SA 2C72A 3GMCA 3P4PA 4H4PA 1B8SA 3UP5A 3AECA 4NEWA 4GDEA 2WP5A 3VQRA 1ZX9A 5KVIA 4GUVA 1PS9A 4GR1A 3RNMA 1L9EA 4JN9A 1CBOA 2R46A 2WETA 4LA1A 1TDKA 4ZCCA 2WU5A 5BRTA 3AEEA 3ALLA 4G74A 4B69A 1PBFA 1PBCA 3ALMA 2WBAA 3C4AA 2F5ZA 3VR9A 4J2WA 1NAAA 3SQPA 4EQXA 5IQ1A 3K7QX 4BK3A 3ICRA 1N4UA 3KU9A 4G73A 4U8LA 3CNTA 1LPFA 4JDRA 1N4WA 4TM1A 4OPIA 1PHHA 2RABA 4H4YA 4U8PA 1H7XA 3OC4A 3IF9A 3IHGA 3V3NA 4Z43A 4FK1C 3ZYXA 1Q1RA 2UZZA 2YR4A 3AEGA 3PS9A 3ITJA 4KX6A 2CULA 5M10A 3UKFA 4G6GA 4UDQA 4D03A 4M52A 3UTFA 2XFUA 1K4QA 1DOCA 3UP4A 4NWZA 1E6EA 1NPXA 3QFAA 2EQ6A 3NYEA 2Z5YA 5GRTA 2ZBWA 2NVKX 1IUWA 4YKGA 3REDA 4IVMB 3DJEA 3NLCA 3G5RA 2VRMA 3P9UA 1DJQA 4B66A 2R4EA 3LADA 1PBEA 3T14A 3B6DA 4NNJA 4BJYA 1LQUA 3P4SA 3ALJA 3QFBA 2R45A 4FK1A 2YM2A 4A79A 4DSGA 1ZMDA 1M6IA 2BA9A 5KVHA 4TM4A 1PBDA 3L5OA 1GOSA 2VVMA 2NPXA 2GAHB 3BHKA 2VQ7A 1GTHA 3COXA 1ZDLA 1X31B 2B7RA 3AYLA 4A5LA 4EM3A 4YWOA 2XVIA 1FOHA 4ICYA 2HQMA 4UDRA 1TYTA 4HB9A 3UTEA 3AYIA 4CNJA 1XANA 2RGHA 4J34A 1ZOVA 4K8DA 4X4JA 3GWFA 2R0CA 3DJDA 5EOWA 3RP7A 2WESA 1OJDA 3F8PA 4RG4A 4GF7A 1TYPA 1VG9A 4U8KA 4D04A 2FBWA 4EMJA 2WOWA 1CC2A 1SEZA 2BABA 3SZFA 3O0HA 3FPZA 4U2SA 1ZKQA 3NK1X 1DODA 1KFYA 1DXLA 2XFOA 4OPUA 5KOWA 1B4VA 2WDRA 3DA1A 4ZCDA 1YQZA 2BCPA 2H89A 3BI5A 4U8MA 2XYOA 3GDPA 2EQ9A 1P2HA 2C64A 2C66A 4EIQA 4Z2RA 4Y4NA 1H82A 1JOAA 4A6NB 2ARDA 2X8GA 1KSUA 1L0VA 3IHMA 5EB4A 1GESA 1S2YA 3C4NA 1BZLA 4YSYA 5HHFA 1JNZA 2GMHA 1TDFA 2XVHA 5J60A 1BGNA 1EL8A 2E5VA 1PBBA 2H88A 1XDIA 1KNPA 5M0ZA 3CNDA 4LIIA 4OPDA 4BV6A 4EQWA 4H2RA 4X9NA 4Z24A 1GXFA 3VRAA 2X99A 1GRGA 4NZHA 4OPGA 3UKHA 3CNJA 4B68A 4IA5A 2RGOA 2XLSA 4K2XA 4MJWA 4AP1A 3ISHA 3SX6A 2Q6UA 1F3PA 3DK4A 1QJDA 5EB5A 3RHAA 1REOA 4CRTA 4DSHA 4RSLA 1ZMCA 4ZN0A 3EANA 1H81A 2DKHA 4IV9A 1OJCA 2APGA 2C75A 2VZ2A 5FS9A 3CMMA 5KNLA 1TDNA 2GVCA 3CGEA 1E1KA 4PAAA 4ECHA 4UP3A 1PJ5A 2C4CA 3H8LA 4EMWA 4AT0A 1H7WA 3AE8A 2Q0LA 1NDAA 1N4VA 2J3NA 3Q9TA 3K7MX 5FS6A 1KNRA 3QJ4A 4GCMA 2ZZ0A 1D7YA 2WOVA 3NK0X 4O5QA 3KLJA 4JY2A 1TRBA 1ZK7A 1OJ9A 4YXDA 1GETA 2YVFA 3CIRA 5U1OA 1MOKA 5KRQA 2GR2A 3H4KA 3NGCX 3T2YA 2V3BA 1OJTA 5KWFA 3NHOX 3IWAA 2CFYA 1Q9IA 1PXBA 1VQWA 4KPRA 2X50A 4K7ZA 3AEFA 1S3EA 3AXBA 3CN8A 4K5SA 4NTEA 3QSMA 3BHFA 3HYXA 4OPLA 2ZZCA 4CBQA 4U8IA 4Y4MA 3DK8A 3ZDNA 3DH9A 1EL5A 2BXRA 1CC4A 3I3LA 3OZ2A 4H2NA 4X9MA 2C76A 5J7XA 4B65A 4C74A 2BK5A 2C3DA 3T37A 5JCLA 5U63A 2C7GA 2GV8A 2VQBA 3NIXA 2R0PA 3JSKA 3UKAA 4C3YA 2WP6A 4H4XA 4NTCA 1GTEA 3NN0X 4H50A 3ADAB 4Z44A 4GDPA 4PABA 2WOIA 1FL2A 4AOXA 5C2TA 4YTNA 2BCGG 4DGKA 1GRFA 3FBSA 3M0OA 3KPKA 1VRQB 3V3OA 3R9UA 2AR8A 3CPJG 4AT2A 4U2TA 3CGBA 2JB2A 2JAEA 4LU6A 1GRHA 5BUKA 3NN6X 3KD9A 1GREA 3UKKA 3P1WA 2ZZBA 2GB0A 3GD4A 3ABVA 3NTAA 1TDEA 2BS3A 1BGJA 5EBKA 5CQFA 3SFDA 3HZLA 4J31A 5FS8A 4II3A 4B67A 4TLZA 4UDPA 1IJHA 4BJZA 3QSEA 2W0HA 1GSNA 4Z2TA 1BKWA 4I59A 2JB3A 4YKFA 1ELIA 1W4XA 4J36A 3GYIA 2TPRA 3FMWA 1LVLA 2CVJA 2XVFA 2YLXA 2WQYA 2WEUA 3F8DA 4EQRA 4II2A 1VG0A 2GQFA 4CY8A 5BVAA 4Z2UA 3L1RA 4USQA 4A99A 3S5WA 2Y6RA 3C96A 2RGJA 1ZP0A 1JNRA 3VRBA 2X8CA 1B37A 4EIPA 2BS2A 3SYIA 5IQ4A 5TR3A 5KMPA 3V76A 2A87A 3D9XA 1D4DA 3LXDA 3AD9B 2GRTA 3GMBA 2GR1A 1NEKA 2R0GA 4GAVA 2R4JA 2B9WA 3AE1A 2BC1A 4JY3A 1DNCA 1BWCA 2YG6A 3S61A 4YT0A 2YG3A 3CGCA 3NT6A 4ADWA 1V59A 3NKSA 4WCTA 2WS3A 2WP9A 1EBDA 2VRLA 3RP6A 1H86A 3B3RA 3KA7A 3M13A 2X3NA 3NH3X 3BI4A 1K0LA 1D4CA 2I0ZA 3D8XA 4O5UA 4USRA 3E1TA 1MXTA 3AE7A 3SY4A 3UOVA 1IUXA 2V5ZA 5U25A 1PDHA 1HYUA 3AB1A 3GDNA 4P9SA 2TMDA 4XWZA 4AOSA 1LV0A 3AE6A 4Z26A 2EQ7A 5JCMA 3T0KA 2Z5XA 5DBJA 1UKVG 1KDGA 2E1MA 3BI2A 3NK2X 4H4RA 1KSSA 3P4QA 3BNUA 2YR6A 2GR3A 2V3AA 2JB1A 2JK6A 3BNMA 1H83A 5HXIA 2BRAA 1LQTA 3AEDA 1PXCA 1JRXA 1JRZA 3VRDB 1GV4A 4JNAA 1S7MA 3CNSA 3I6DA 2OA1A 5CKUA 1E1MA 4N9XA 3VR8A 1F8WA 2XVJA 5JCIA 3CPIG 2IVEA 4EQSA 1BF3A 3SZ0A 3LJPA 3EPTA 3ICSA 5JCKA 1EL9A 4J33A 4YSHA 1RSGA 2JKCA 1Z6LA 3NYFA 2BXSA 4BURA 2YVGA 3SM8A 3WE0A 2YG4A 3K30A 2XLPA 4C3XA 2Y6QA 1IUVA 1CJCA 4TM0A 2A8XA 5ER0A 3SZCA 3FG2P 4RG3A 3LOVA 2C73A 3T31A 3AYJA 4YSXA 3CPHG 2AAQA 5KXJA 1H2IA 1B5QA 3RP8A 3UCLA 2GR0A 4H4SA 3ATRA 4H7UA 3UKPA 4BK2A 2YM1A 2QA2A 2B76A 3T2ZA 2YWLA 4OCGA 1ZY8A 5KMRA 3LZXA 1YQ3A 1EL7A 1E1NA 3L8KA 4H4UA 1H84A 2XLUA 2YLZA 3M12A 3DGHA 5IPYA 1TDOA 3KPFA 4YSZA 1D4EA 2V6OA 2QCUA 2XFPA 1LTXR 3II4A 4A6NA 5KOXA 1PN0A 3NTDA 2WDQA 5GSNA 3SZWA 3GRTA 2YLRA 1JRYA 2XFNA 4B1BA 5L46A 3F8RA 1JU2A 1LJ1A 3Q6JA 2WDVA 3GYXA 2O9ZA 3AE9A 3AE3A 4XWRA 3FIMB 3GD3A 4YTPA 1E1LA 4H4VA 2BYBA 3CTYA 5FMHA 2WU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K5R A;  4HA6 A;  4C5O A;  3GYJ A;  4JQ9 A;  5BUL A;  3UTG A;  1GT8 A;  1GPE A;  3NYC A;  2BAC A;  1CHU A;  3AWI A;  4CY6 A;  1O95 A;  3KKJ A;  4TM3 A;  2A89 A;  3ICT A;  4IVO B;  4DNA A;  3UOZ A;  2YR5 A;  2XLR A;  1CJ3 A;  2BC0 A;  3UKQ A;  2B9Y A;  4U8N A;  1NHQ A;  1IUS A;  2IVD A;  2C70 A;  2ACZ A;  4NEV A;  1YY5 A;  2C67 A;  2QA1 A;  1FEC A;  2AQJ A;  2FJA A;  2VVL G;  2YVJ A;  2OAL A;  3DJG X;  3G5Q A;  2QAE A;  1OJA A;  2PYX A;  3AE4 A;  4B64 A;  1Y56 A;  5FS7 A;  5HY5 A;  3EF6 A;  1YQ4 A;  4REK A;  2FJD A;  4YTM A;  1CC6 A;  2WPF A;  1FCD A;  1RYI A;  2GEW A;  1GAL A;  4H4Q A;  2WHD A;  2XLT A;  1NHS A;  1COY A;  1O94 A;  3AEB A;  3AE2 A;  3ITJ A;  2BK4 A;  2FJB A;  3GRS A;  1L9C A;  2XVE A;  1D7L A;  2C3C A;  1IUT A;  1ONF A;  3QVP A;  3PVC A;  2PHH A;  2Q0K A;  4IA6 A;  1FEB A;  2EQ8 A;  4EMI A;  4H4T A;  2DKI A;  2GAG B;  4Z25 A;  4FDC B;  1L9D A;  5C3J A;  2GF3 A;  3DK9 A;  4FX9 A;  2E4G A;  4OPT A;  2X8H A;  4H4Z A;  3SFE A;  4A9W A;  2YLW A;  3IC9 A;  1GEU A;  1AOG A;  2B9X A;  1QLB A;  3AD8 B;  2GQW A;  3D1C A;  3G5S A;  4OVI A;  4B63 A;  4BK1 A;  5JCN A;  2Q7V A;  4U8O A;  2C65 A;  2CDU A;  4H2Q A;  1F6M A;  2IID A;  4H4W A;  4CNK A;  5HYM A;  1IUU A;  1GRA A;  2YQU A;  1RP0 A;  1NHR A;  2GH5 A;  1GER A;  1CJ2 A;  1PJ6 A;  4K22 A;  1XHC A;  3QSS A;  3ATQ A;  4A7A A;  2WPE A;  4AP3 A;  3UTH A;  4GRT A;  1K0I A;  3LZW A;  1O5W A;  1N1P A;  3DJJ A;  1CJ4 A;  4H2P A;  1CF3 A;  1M64 A;  1S3B A;  1MO9 A;  3LB8 A;  1DOE A;  2FJE A;  1GND A;  3GWD A;  2OLN A;  1YKJ A;  1S2Q A;  1F8R A;  1GRT A;  4J56 A;  2R9Z A;  4I58 A;  3NG7 X;  4TLX A;  1NEN A;  4CCQ A;  2XDO A;  3QVR A;  4U8J A;  1DOB A;  1D5T A;  4U2L A;  3P4R A;  3AD7 B;  3NNE A;  4E0V A;  1ZOY A;  4EM4 A;  4YKG A;  2B7S A;  3UOX A;  2OAM A;  1GRB A;  2V60 A;  4CCR A;  4WX1 A;  1QO8 A;  1XPQ A;  2GMJ A;  3CGD A;  1DJN A;  1VDC A;  3URH A;  1E39 A;  3DME A;  4XXG A;  3K7T A;  1P2E A;  1PXA A;  3UKL A;  3NRN A;  4A65 A;  1E7P A;  2VOU A;  1PJ7 A;  2YG7 A;  5LV9 A;  2OLO A;  2JBV A;  1KF6 A;  2VVL A;  3SGL A;  2YLT A;  2BK3 A;  3KVE A;  4C77 A;  3DGZ A;  1JEH A;  2XFQ A;  3CNP A;  4JNQ A;  4NTD A;  3UOY A;  3H8I A;  1CL0 A;  1Q1W A;  1NG4 A;  2V61 A;  2YLS A;  4J57 A;  1K0J A;  2YAU A;  1NG3 A;  3EAO A;  2XCG A;  2BS4 A;  2WPC A;  3AE5 A;  4Y4L A;  4OPC A;  1NHP A;  2YG5 A;  3PO7 A;  4APN A;  1Y0P A;  3GSI A;  1FEA A;  1Y56 B;  3AEA A;  1H6V A;  1F8S A;  2C72 A;  3GMC A;  3P4P A;  4H4P A;  1B8S A;  3UP5 A;  3AEC A;  4NEW A;  4GDE A;  2WP5 A;  3VQR A;  1ZX9 A;  5KVI A;  4GUV A;  1PS9 A;  4GR1 A;  3RNM A;  1L9E A;  4JN9 A;  1CBO A;  2R46 A;  2WET A;  4LA1 A;  1TDK A;  4ZCC A;  2WU5 A;  5BRT A;  3AEE A;  3ALL A;  4B69 A;  1PBF A;  1PBC A;  3ALM A;  2WBA A;  3C4A A;  2F5Z A;  3VR9 A;  4J2W A;  1NAA A;  3SQP A;  4EQX A;  5IQ1 A;  3K7Q X;  4BK3 A;  3ICR A;  1N4U A;  3KU9 A;  4U8L A;  3CNT A;  1LPF A;  4JDR A;  1N4W A;  4TM1 A;  4OPI A;  1PHH A;  2RAB A;  4H4Y A;  4U8P A;  1H7X A;  3OC4 A;  3IF9 A;  3IHG A;  3V3N A;  4Z43 A;  4FK1 C;  3ZYX A;  1Q1R A;  2UZZ A;  2YR4 A;  3AEG A;  3PS9 A;  4KX6 A;  2CUL A;  5M10 A;  3UKF A;  4UDQ A;  4D03 A;  4M52 A;  3UTF A;  2XFU A;  1K4Q A;  1DOC A;  3UP4 A;  1E6E A;  1NPX A;  3QFA A;  2EQ6 A;  3NYE A;  2Z5Y A;  5GRT A;  2ZBW A;  2NVK X;  1IUW A;  3RED A;  4IVM B;  3DJE A;  3NLC A;  3G5R A;  2VRM A;  3P9U A;  1DJQ A;  4B66 A;  2R4E A;  3LAD A;  1PBE A;  3B6D A;  4BJY A;  1LQU A;  3P4S A;  3ALJ A;  3QFB A;  2R45 A;  4FK1 A;  2YM2 A;  4A79 A;  4DSG A;  1ZMD A;  1M6I A;  2BA9 A;  5KVH A;  4TM4 A;  1PBD A;  1GOS A;  2VVM A;  2NPX A;  2GAH B;  3BHK A;  2VQ7 A;  1GTH A;  3COX A;  1ZDL A;  1X31 B;  2B7R A;  3AYL A;  4A5L A;  4EM3 A;  4YWO A;  2XVI A;  1FOH A;  4ICY A;  2HQM A;  4UDR A;  1TYT A;  4HB9 A;  3UTE A;  3AYI A;  4CNJ A;  1XAN A;  2RGH A;  4J34 A;  1ZOV A;  4K8D A;  4X4J A;  3GWF A;  2R0C A;  3DJD A;  5EOW A;  3RP7 A;  2WES A;  1OJD A;  3F8P A;  4RG4 A;  4GF7 A;  1TYP A;  1VG9 A;  4U8K A;  4D04 A;  2FBW A;  4EMJ A;  2WOW A;  1CC2 A;  1SEZ A;  2BAB A;  3O0H A;  3FPZ A;  4U2S A;  1ZKQ A;  3NK1 X;  1DOD A;  1KFY A;  1DXL A;  2XFO A;  4OPU A;  5KOW A;  1B4V A;  2WDR A;  3DA1 A;  4ZCD A;  1YQZ A;  2BCP A;  2H89 A;  3BI5 A;  4U8M A;  2XYO A;  3GDP A;  2EQ9 A;  1P2H A;  2C64 A;  2C66 A;  4EIQ A;  4Z2R A;  4Y4N A;  1H82 A;  1JOA A;  4A6N B;  2ARD A;  2X8G A;  1KSU A;  1L0V A;  3IHM A;  5EB4 A;  1GES A;  1S2Y A;  3C4N A;  1BZL A;  4YSY A;  5HHF A;  1JNZ A;  2GMH A;  1TDF A;  2XVH A;  5J60 A;  1BGN A;  1EL8 A;  2E5V A;  1PBB A;  2H88 A;  1XDI A;  1KNP A;  5M0Z A;  3CND A;  4LII A;  4OPD A;  4BV6 A;  4EQW A;  4H2R A;  4X9N A;  4Z24 A;  1GXF A;  3VRA A;  2X99 A;  1GRG A;  4NZH A;  4OPG A;  3UKH A;  3CNJ A;  4B68 A;  4IA5 A;  2RGO A;  2XLS A;  4K2X A;  4MJW A;  4AP1 A;  3ISH A;  2Q6U A;  1F3P A;  3DK4 A;  1QJD A;  5EB5 A;  3RHA A;  1REO A;  4CRT A;  4DSH A;  4RSL A;  1ZMC A;  4ZN0 A;  3EAN A;  1H81 A;  2DKH A;  4IV9 A;  1OJC A;  2APG A;  2C75 A;  2VZ2 A;  5FS9 A;  1TDN A;  2GVC A;  3CGE A;  1E1K A;  4PAA A;  4ECH A;  4UP3 A;  1PJ5 A;  3H8L A;  4EMW A;  4AT0 A;  1H7W A;  3AE8 A;  2Q0L A;  1NDA A;  1N4V A;  2J3N A;  3Q9T A;  3K7M X;  5FS6 A;  1KNR A;  3QJ4 A;  4GCM A;  2ZZ0 A;  1D7Y A;  2WOV A;  3NK0 X;  4O5Q A;  3KLJ A;  4JY2 A;  1TRB A;  1ZK7 A;  1OJ9 A;  4YXD A;  1GET A;  2YVF A;  3CIR A;  5U1O A;  1MOK A;  5KRQ A;  2GR2 A;  3H4K A;  3NGC X;  2V3B A;  1OJT A;  5KWF A;  3NHO X;  3IWA A;  2CFY A;  1Q9I A;  1PXB A;  1VQW A;  4KPR A;  2X50 A;  4K7Z A;  3AEF A;  1S3E A;  3AXB A;  3CN8 A;  4K5S A;  4NTE A;  3QSM A;  3BHF A;  4OPL A;  2ZZC A;  4CBQ A;  4U8I A;  4Y4M A;  3DK8 A;  3ZDN A;  3DH9 A;  1EL5 A;  2BXR A;  1CC4 A;  3I3L A;  3OZ2 A;  4H2N A;  4X9M A;  2C76 A;  5J7X A;  4B65 A;  4C74 A;  2BK5 A;  2C3D A;  3T37 A;  5JCL A;  5U63 A;  2C7G A;  2GV8 A;  2VQB A;  3NIX A;  2R0P A;  3JSK A;  3UKA A;  4C3Y A;  2WP6 A;  4H4X A;  4NTC A;  1GTE A;  3NN0 X;  4H50 A;  3ADA B;  4Z44 A;  4GDP A;  4PAB A;  2WOI A;  1FL2 A;  4AOX A;  5C2T A;  4YTN A;  2BCG G;  4DGK A;  1GRF A;  3FBS A;  3M0O A;  3V3O A;  1VRQ B;  4AT2 A;  3R9U A;  2AR8 A;  3CPJ G;  4U2T A;  3CGB A;  2JB2 A;  2JAE A;  4LU6 A;  1GRH A;  5BUK A;  3NN6 X;  3KD9 A;  1GRE A;  3UKK A;  3P1W A;  2ZZB A;  2GB0 A;  3GD4 A;  3ABV A;  3NTA A;  1TDE A;  2BS3 A;  1BGJ A;  5EBK A;  5CQF A;  3SFD A;  3HZL A;  4J31 A;  5FS8 A;  4B67 A;  4TLZ A;  4UDP A;  1IJH A;  4BJZ A;  3QSE A;  2W0H A;  1GSN A;  4Z2T A;  1BKW A;  4I59 A;  2JB3 A;  4YKF A;  1ELI A;  1W4X A;  4J36 A;  3GYI A;  2TPR A;  3FMW A;  1LVL A;  2CVJ A;  2XVF A;  2YLX A;  2WQY A;  2WEU A;  3F8D A;  4EQR A;  4CY8 A;  1VG0 A;  2GQF A;  5BVA A;  4Z2U A;  3L1R A;  4USQ A;  4A99 A;  3S5W A;  2Y6R A;  3C96 A;  2RGJ A;  1ZP0 A;  1JNR A;  3VRB A;  2X8C A;  1B37 A;  4EIP A;  2BS2 A;  5IQ4 A;  5TR3 A;  3V76 A;  2A87 A;  1D4D A;  3LXD A;  3AD9 B;  2GRT A;  3GMB A;  2GR1 A;  1NEK A;  2R0G A;  2R4J A;  2B9W A;  3AE1 A;  2BC1 A;  4JY3 A;  1DNC A;  1BWC A;  2YG6 A;  3S61 A;  4YT0 A;  2YG3 A;  3CGC A;  3NT6 A;  4ADW A;  1V59 A;  3NKS A;  4WCT A;  2WS3 A;  2WP9 A;  1EBD A;  2VRL A;  3RP6 A;  1H86 A;  3B3R A;  3KA7 A;  3M13 A;  2X3N A;  3NH3 X;  3BI4 A;  1K0L A;  1D4C A;  2I0Z A;  3D8X A;  4O5U A;  4USR A;  3E1T A;  1MXT A;  3AE7 A;  3UOV A;  1IUX A;  2V5Z A;  5U25 A;  1PDH A;  1HYU A;  3AB1 A;  3GDN A;  4P9S A;  2TMD A;  4XWZ A;  4AOS A;  1LV0 A;  3AE6 A;  4Z26 A;  2EQ7 A;  5JCM A;  2Z5X A;  5DBJ A;  1UKV G;  1KDG A;  2E1M A;  3BI2 A;  3NK2 X;  4H4R A;  1KSS A;  3P4Q A;  3BNU A;  2YR6 A;  2GR3 A;  2JB1 A;  2V3A A;  2JK6 A;  3BNM A;  1H83 A;  5HXI A;  1LQT A;  3AED A;  1PXC A;  1JRX A;  1JRZ A;  3VRD B;  1GV4 A;  4JNA A;  3I6D A;  3CNS A;  2OA1 A;  5CKU A;  1E1M A;  4N9X A;  3VR8 A;  1F8W A;  2XVJ A;  5JCI A;  3CPI G;  2IVE A;  4EQS A;  1BF3 A;  3LJP A;  3EPT A;  3ICS A;  5JCK A;  1EL9 A;  4J33 A;  4YSH A;  1RSG A;  2JKC A;  1Z6L A;  3NYF A;  2BXS A;  4BUR A;  2YVG A;  3SM8 A;  3WE0 A;  2YG4 A;  3K30 A;  2XLP A;  4C3X A;  2Y6Q A;  1IUV A;  1CJC A;  4TM0 A;  2A8X A;  5ER0 A;  3FG2 P;  4RG3 A;  3LOV A;  2C73 A;  5KXJ A;  3AYJ A;  4YSX A;  3CPH G;  2AAQ A;  1B5Q A;  3RP8 A;  3UCL A;  2GR0 A;  4H4S A;  3ATR A;  4H7U A;  3UKP A;  4BK2 A;  2YM1 A;  2QA2 A;  2B76 A;  2YWL A;  4OCG A;  1ZY8 A;  3LZX A;  1YQ3 A;  1EL7 A;  1E1N A;  3L8K A;  4H4U A;  1H84 A;  2XLU A;  2YLZ A;  3M12 A;  3DGH A;  5IPY A;  1TDO A;  3KPF A;  4YSZ A;  1D4E A;  2V6O A;  2QCU A;  2XFP A;  1LTX R;  3II4 A;  4A6N A;  5KOX A;  1PN0 A;  3NTD A;  2WDQ A;  5GSN A;  3GRT A;  2YLR A;  1JRY A;  2XFN A;  4B1B A;  5L46 A;  3F8R A;  1JU2 A;  1LJ1 A;  3Q6J A;  2WDV A;  2O9Z A;  3AE9 A;  3AE3 A;  4XWR A;  3FIM B;  3GD3 A;  4YTP A;  1E1L A;  4H4V A;  2BYB A;  3CTY A;  5FMH A;  2WU2 A; 
#chains in the Genus database with same CATH topology
 2PU0 A;  4C5O A;  5BUL A;  3QKE A;  1GT8 A;  1PDY A;  4DNA A;  2YR5 A;  1CJ3 A;  2BC0 A;  3UKQ A;  2PSN A;  2CHR A;  2C67 A;  3ZLG A;  2VVL G;  1MRA A;  1KKR A;  4REK A;  1CC6 A;  2WPF A;  1RYI A;  2WHD A;  3ITJ A;  4KX6 A;  1NHS A;  3VA8 A;  3SXI A;  3NVZ B;  3PVC A;  1FEB A;  3TTE A;  2DKI A;  3DIP A;  4HPN A;  1L9D A;  5C3J A;  3CAW A;  4A9W A;  4A6G A;  2B9X A;  1QLB A;  3AD8 B;  2GQW A;  1ZXI C;  4U8O A;  4H2Q A;  3GO2 A;  3UXK A;  1PDZ A;  5HYM A;  2YQU A;  4K22 A;  1GER A;  1CJ2 A;  1XHC A;  4AP3 A;  4GRT A;  1K0I A;  3DJJ A;  1CF3 A;  3TJI A;  2OLN A;  1YKJ A;  1IYX A;  1GRT A;  3NG7 X;  4TLX A;  4DXK A;  4GYP C;  4U8J A;  3NNE A;  4E0V A;  2OAM A;  2OO6 A;  3V5C A;  1DJN A;  3OP2 A;  3URH A;  1VQZ A;  1VDC A;  3SN0 A;  3K7T A;  3V3W A;  3TWA A;  3KUM A;  4A65 A;  2JBV A;  1KF6 A;  4GYP A;  4C77 A;  3DGZ A;  3H8I A;  4IP5 A;  2GGG A;  3R0U A;  1NG3 A;  2XCG A;  2WPC A;  3MZN A;  4APN A;  1FEA A;  1Y56 B;  3P4P A;  3GMC A;  4NEW A;  2WP5 A;  1ZX9 A;  4GUV A;  3RNM A;  1L9E A;  4JN9 A;  4K1W A;  1CBO A;  3VC6 A;  4LA1 A;  3AEE A;  1PBF A;  1PBC A;  2PP0 A;  3VR9 A;  1NAA A;  4BK3 A;  3K7Q X;  4G73 A;  1LPF A;  2DW6 A;  3DFY A;  1PHH A;  2RAB A;  3FV9 A;  2UZZ A;  3TQP A;  3PS9 A;  2CUL A;  4G6G A;  2MUC A;  4UDQ A;  4D03 A;  2XFU A;  1K4Q A;  1VDV A;  1E6E A;  4K8G A;  3QFA A;  3ZLH A;  2NVK X;  3RED A;  3DJE A;  3NLC A;  3G5R A;  1DJQ A;  3B6D A;  4NNJ A;  1LQU A;  3IK4 A;  3HW2 A;  3SQS A;  1SJC A;  5ENL A;  3H70 A;  3BHK A;  3EEZ A;  1X31 B;  3AYL A;  4A5L A;  3U4F A;  4EM3 A;  3T8Q A;  1EC8 A;  3GWF A;  5EOW A;  2PTZ A;  1VG9 A;  4OPU A;  1DXL A;  1B4V A;  4E6M A;  3DA1 A;  4ZCD A;  2OX4 A;  1P2H A;  2C64 A;  1FIQ B;  2X8G A;  3IHM A;  2P3Z A;  3C4N A;  4H2H A;  5J60 A;  2E5V A;  2H88 A;  1XDI A;  5M0Z A;  3CND A;  4OPD A;  4BV6 A;  4H2R A;  1GXF A;  1RM6 B;  3CNJ A;  4IA5 A;  2XLS A;  4K2X A;  4MJW A;  3ISH A;  3I6T A;  2HXU A;  1QJD A;  1REO A;  2C75 A;  5KNL A;  3CT2 A;  3BJS A;  2C4C A;  4KEM A;  3H8L A;  1H7W A;  1NDA A;  3K7M X;  4GCM A;  2ZZ0 A;  4JY2 A;  3CIR A;  2OPJ A;  2GR2 A;  5KWF A;  3AEF A;  4NTE A;  3CN8 A;  4ENL A;  3Q4D A;  3SR6 B;  3HYX A;  4CBQ A;  4U8I A;  3DH9 A;  5J7X A;  1CC4 A;  2C3D A;  3EUB 3;  3T37 A;  2C7G A;  2PU1 A;  3NIX A;  4H4X A;  3PWG A;  4NTC A;  4H50 A;  4GDP A;  3UJ2 A;  4PAB A;  5C2T A;  3NS1 B;  4AT2 A;  2XH7 A;  2AR8 A;  2JB2 A;  4LU6 A;  5BUK A;  1GRE A;  3UKK A;  5EBK A;  3SFD A;  3HZL A;  5FS8 A;  4II3 A;  4ZOH B;  3T9P A;  4I59 A;  2JB3 A;  2O56 A;  3GYI A;  2TPR A;  3FMW A;  1X2G A;  2YLX A;  3SN1 A;  3JW7 A;  2P0I A;  3R11 A;  3L1R A;  4A99 A;  2ONE A;  3A7R A;  4GGB A;  2X8C A;  3SYI A;  3ES7 A;  3FJ4 A;  5G5H B;  5KMP A;  4IHC A;  3A7A A;  3DGB A;  4H1Z A;  5FJO A;  2R0G A;  4GAV A;  3T6C A;  3SBF A;  4WCT A;  3ZLF A;  2PGW A;  2VRL A;  4IZG A;  1D4C A;  3E1T A;  1IUX A;  2EQ7 A;  3T0K A;  2Z5X A;  1UKV G;  3OPS A;  3BI2 A;  3EKG A;  3P4Q A;  2YR6 A;  2V3A A;  1H83 A;  3AED A;  1N5X A;  1S7M A;  3VR8 A;  4J33 A;  4IL2 A;  2BXS A;  3SM8 A;  3WE0 A;  2YG4 A;  2XLP A;  1CJC A;  4TM0 A;  3SZC A;  3LOV A;  3T31 A;  3UCL A;  2GR0 A;  3ATR A;  4BK2 A;  1ZY8 A;  1YQ3 A;  1E1N A;  4H4U A;  5FJP A;  3H8A A;  4YSZ A;  2AL2 A;  4A6N A;  5KOX A;  1PN0 A;  3NTD A;  1FFU C;  2WDQ A;  3GRT A;  1JRY A;  3F8R A;  1JU2 A;  1LJ1 A;  3AE3 A;  3DG6 A;  4IL0 A;  1E1L A;  3IJI A;  4HCH A;  1W6T A;  5JRB A;  4HA6 A;  3GYJ A;  4GFI A;  1CHU A;  3FYY A;  3ZVI A;  2B9Y A;  2IVD A;  4NEV A;  1YY5 A;  4MMW A;  2QA1 A;  2AQJ A;  3DJG X;  4B64 A;  2QAE A;  1OJA A;  3AE4 A;  2BRY A;  5G5G B;  3EF6 A;  3AM9 A;  1FCD A;  3AEB A;  1COY A;  1WUF A;  1O94 A;  3PG6 A;  3CYJ A;  1X2H A;  2FJB A;  3GRS A;  1D7L A;  2C3C A;  2EQ8 A;  3GY1 A;  2GAG B;  4H4T A;  4Z25 A;  4FDC B;  3DK9 A;  4FX9 A;  5KMS A;  3SFE A;  1GEU A;  4B63 A;  3R10 A;  3UCC A;  2IID A;  3BOX A;  3STP A;  1RP0 A;  1NHR A;  2GH5 A;  3UTH A;  1O5W A;  1N1P A;  2QJN A;  4GGH A;  2FJE A;  3RO6 A;  4CCQ A;  1DOB A;  4U2L A;  3P4R A;  1ZOY A;  4EM4 A;  1QO8 A;  2GMJ A;  4KWS A;  1E39 A;  3DME A;  5KMQ A;  4XXG A;  1PXA A;  1KKO A;  4ZCW A;  2VOU A;  4G6H A;  1PJ7 A;  2OLO A;  3SGL A;  2VVL A;  3KVE A;  2PS2 A;  1JEH A;  3CNP A;  4JNQ A;  4NTD A;  4A35 A;  3UOY A;  1CL0 A;  4J57 A;  1K0J A;  2YAU A;  2PMQ A;  4Y4L A;  1NHP A;  3B9J B;  3AEA A;  1H6V A;  1JDF A;  1B8S A;  4GDE A;  3IJL A;  2PTY A;  2WET A;  4ZCC A;  2WU5 A;  3ALL A;  2WBA A;  5J04 A;  4J2W A;  4U8L A;  3CNT A;  4OPI A;  5IDZ A;  4U8P A;  3IF9 A;  4Z43 A;  3PK7 A;  3ZYX A;  5M10 A;  3UKF A;  1DOC A;  1NPX A;  3NYE A;  2Z5Y A;  2ZBW A;  3UJR A;  3PFR A;  2VRM A;  2R4E A;  1PBE A;  3RRA A;  3JZU A;  3K1G A;  4EWJ A;  3ALJ A;  2R45 A;  3R1Z A;  2YM2 A;  1ZMD A;  4TM4 A;  2VVM A;  3DER A;  2W55 A;  2B7R A;  3TWB A;  3UJF A;  2GGJ A;  4ICY A;  1XS2 A;  1TYT A;  1XAN A;  1YEY A;  4X4J A;  2FBW A;  1CC2 A;  2BAB A;  3O0H A;  4U2S A;  4U8M A;  2XYO A;  2EQ9 A;  4EIQ A;  1JOA A;  4G8T A;  1L0V A;  2POZ A;  1S2Y A;  1JNZ A;  2XVH A;  1BGN A;  3UJE A;  3NRZ B;  1DTN A;  2OQH A;  1GRG A;  3UXL A;  4OPG A;  1ECQ A;  3SX6 A;  2XH4 A;  1JPM A;  1F3P A;  5EB5 A;  1H81 A;  3CMM A;  1TDN A;  1L8P A;  4TVW A;  1PJ5 A;  2FKP A;  3AE8 A;  2Q0L A;  2J3N A;  2W3R A;  3QJ4 A;  3NK0 X;  2OQY A;  1OJ9 A;  4YXD A;  1GET A;  2P88 A;  2YVF A;  2GSH A;  3NGC X;  1PXB A;  4KPR A;  4K5S A;  3QSM A;  4OPL A;  4Y4M A;  3DK8 A;  2BXR A;  3P0W A;  4X9M A;  2C76 A;  2BK5 A;  5JCL A;  1E9I A;  2WP6 A;  3T4W A;  4Z44 A;  1N5W C;  1FL2 A;  4AOX A;  1GRF A;  3FCP A;  4U2T A;  1GRH A;  3KD9 A;  1TDE A;  2BS3 A;  5CQF A;  4TLZ A;  2W0H A;  4Z2T A;  2OLA A;  2GL5 A;  2OKT A;  1ELI A;  1LVL A;  2XVF A;  3NVV B;  3F8D A;  1VG0 A;  5BVA A;  2Y6R A;  1JNR A;  3SN4 A;  3VRB A;  2GR1 A;  2OG9 A;  1NEK A;  2BC1 A;  4JY3 A;  1EC9 A;  4HN8 A;  3SJN A;  1BWC A;  4ROP A;  3S61 A;  2YG3 A;  3CGC A;  1JCT A;  3TJ4 A;  3TOY A;  3RP6 A;  1H86 A;  3B3R A;  1MDR A;  2I0Z A;  3BI4 A;  3D8X A;  4O5U A;  3AE7 A;  3UOV A;  2V5Z A;  4XWZ A;  5U25 A;  1HYU A;  1LV0 A;  2GGI A;  1SB3 B;  2GR3 A;  2JB1 A;  1LQT A;  1JRX A;  3CNS A;  1E1M A;  1F8W A;  5JCI A;  1BF3 A;  3LJP A;  5JCK A;  3MKC A;  1RSG A;  2JKC A;  5FJU A;  3NYF A;  2I5Q A;  1IUV A;  4JN8 A;  3VCN A;  5ER0 A;  3FG2 P;  4YSX A;  3CPH G;  3RP8 A;  4H4S A;  2YM1 A;  2QDD A;  3T2Z A;  2YWL A;  5KMR A;  3LZX A;  3VFC A;  3NZG A;  2XLU A;  2PPG A;  5BOF A;  2V6O A;  2QCU A;  2PP1 A;  3SZW A;  2O9Z A;  3AE9 A;  4XWR A;  3FIM B;  4YTP A;  4H4V A;  2BYB A;  2WU2 A;  1SJD A;  3HYW A;  4JQ9 A;  3N6H A;  3AWI A;  3KKJ A;  3DG7 A;  3V4B A;  3THU A;  3RIT A;  1NHQ A;  1IUS A;  4U8N A;  3N4F A;  2ACZ A;  1FEC A;  4YWS A;  2OAL A;  3I4K A;  5HY5 A;  1YQ4 A;  2FJD A;  4YTM A;  3UKA A;  4H4Q A;  3AE2 A;  3DEQ A;  1ELS A;  1L9C A;  1IUT A;  4GIR A;  3QPE A;  2E4G A;  2GDQ A;  2X8H A;  1AOG A;  4Z2R A;  3D1C A;  2OFJ A;  5JCN A;  2Q7V A;  4X2P A;  2C65 A;  3VDG A;  1IUU A;  1N60 C;  2WPE A;  5BOE A;  3LZW A;  3ZVH B;  3MSY A;  1CJ4 A;  4H2P A;  1M64 A;  1S3B A;  1MO9 A;  1DOE A;  1GND A;  2R9Z A;  4I58 A;  1D5T A;  3T2K A;  4YKG A;  2B7S A;  4CCR A;  4WX1 A;  1FHU A;  3CGD A;  3S47 A;  1MUC A;  3R25 A;  3UKL A;  3NRN A;  1E7P A;  2YG7 A;  5LV9 A;  2YLT A;  2BK3 A;  2XFQ A;  3V5F A;  1NEL A;  2V61 A;  2YLS A;  3UJS A;  3AE5 A;  2YG5 A;  3VC5 A;  3Q45 A;  3GC2 A;  3GSI A;  3UP5 A;  2C72 A;  2AKZ A;  3VQR A;  5KVI A;  1PS9 A;  4GR1 A;  4JHM A;  1TDK A;  4FP1 A;  5BRT A;  1P43 A;  4B69 A;  2PGE A;  2F5Z A;  3SQP A;  1N4U A;  3KU9 A;  3B97 A;  4H4Y A;  1H7X A;  3V3N A;  2POD A;  3IHG A;  4FK1 C;  2W54 A;  4KPL A;  3AEG A;  4MKS A;  2XSX A;  4M52 A;  3UP4 A;  1IUW A;  6ENL A;  4GIS A;  4IVM B;  3P9U A;  4B66 A;  3LAD A;  4BJY A;  3P4S A;  3QFB A;  4FK1 A;  2OZ3 A;  4KT2 A;  4DSG A;  3NXL A;  2GAH B;  1GTH A;  2GGH A;  4YWO A;  4UDR A;  4CNJ A;  2OZ8 A;  2RGH A;  1ZOV A;  2R0C A;  3RP7 A;  2ZAD A;  3CK5 A;  3P3B A;  4D04 A;  2WOW A;  1SEZ A;  3AN1 A;  1DOD A;  3DDM A;  2H89 A;  3BI5 A;  2E3T A;  1H82 A;  2ARD A;  1GES A;  4YSY A;  1TDF A;  4J3Z A;  1PBB A;  1KNP A;  4EQW A;  1KCZ A;  4X9N A;  4Z24 A;  4NZH A;  3UKH A;  2PA6 A;  2RGO A;  5EU9 A;  2PCE A;  4AP1 A;  2MNR A;  5FJT A;  2Q6U A;  4DSH A;  3DK4 A;  3RHA A;  4CRT A;  4RSL A;  1ZMC A;  3EAN A;  2DKH A;  4IV9 A;  3QN3 A;  2VZ2 A;  1OJC A;  5FS9 A;  2GVC A;  3CGE A;  1E1K A;  4PAA A;  4ECH A;  4UP3 A;  3PWI A;  4AT0 A;  1N4V A;  3CB3 A;  4HNC A;  1D7Y A;  1STZ A;  3HPF A;  4F4R A;  2GGE A;  5U1O A;  1MOK A;  3T2Y A;  1SJA A;  3NHO X;  2CFY A;  3MQT A;  4K7Z A;  1S3E A;  3BHF A;  1EL5 A;  4B65 A;  3I3L A;  4C74 A;  4H19 A;  2GV8 A;  2VQB A;  2R0P A;  3JSK A;  4C3Y A;  4Z1Y A;  2NQL A;  1GTE A;  3DES A;  3ADA B;  2FYM A;  2WOI A;  2BCG G;  3JVA A;  3V3O A;  4K2S A;  3M0O A;  3R9U A;  3UCD A;  2JAE A;  4DN1 A;  3P1W A;  2GB0 A;  2OZT A;  3ABV A;  3NTA A;  1BGJ A;  2PP3 A;  4ZA0 A;  1IJH A;  2HXT A;  2DW7 A;  2QQ6 A;  3FVD A;  1GSN A;  1V97 A;  2CVJ A;  2WQY A;  4CY8 A;  4II2 A;  4EQR A;  2GQF A;  4USQ A;  1EBH A;  4E5T A;  3S5W A;  1ZP0 A;  2P8C A;  2E5A A;  3V76 A;  2A87 A;  3D9X A;  3LXD A;  4IT1 A;  3AD9 B;  2GRT A;  3GMB A;  2R4J A;  3AE1 A;  2YG6 A;  4DWD A;  4ADW A;  1V59 A;  2WS3 A;  2WP9 A;  1TE6 A;  3M13 A;  2X3N A;  3NH3 X;  1K0L A;  3SY4 A;  1R6W A;  1PDH A;  4P9S A;  2TMD A;  5JCM A;  3VCC A;  4JN7 A;  5DBJ A;  1KDG A;  1KSS A;  3BNU A;  2JK6 A;  3BNM A;  3OTR A;  2QGY A;  2BRA A;  3D47 A;  1JRZ A;  3VRD B;  1GV4 A;  4JNA A;  3I6D A;  4N9X A;  3CPI G;  3EPT A;  3ICS A;  2RDX A;  1EL9 A;  4BUR A;  2YVG A;  2A8X A;  4RG3 A;  3OZM A;  1H2I A;  2QA2 A;  2B76 A;  1TDO A;  3KPF A;  1D4E A;  1JRO A;  3II4 A;  2QVH A;  2YLR A;  3GD6 A;  1N62 C;  5L46 A;  4IP4 A;  3Q6J A;  1FFV C;  3GYX A;  3GD3 A;  3CTY A;  5FMH A;  4HCD A;  4K5R A;  3ES8 A;  3MUC A;  1R0M A;  1WYG A;  3UTG A;  1GPE A;  3NYC A;  2BAC A;  4CY6 A;  1O95 A;  4TM3 A;  2A89 A;  3ICT A;  4IVO B;  3UOZ A;  2XLR A;  7ENL A;  2C70 A;  2FJA A;  2YVJ A;  1N61 C;  3G5Q A;  2PYX A;  1Y56 A;  5FS7 A;  1ONE A;  2XLT A;  2GEW A;  1GAL A;  3NVY B;  3R0K A;  2BK4 A;  2XVE A;  1ONF A;  3QVP A;  2PHH A;  2Q0K A;  4IA6 A;  4EMI A;  4J1O A;  2GF3 A;  4OPT A;  4H4Z A;  2YLW A;  3IC9 A;  4OVI A;  2QJJ A;  3G5S A;  4Z17 A;  3MY9 A;  1T3Q C;  2CDU A;  1FO4 A;  1F6M A;  4H4W A;  4CNK A;  1GRA A;  4G9K A;  1PJ6 A;  3MWC A;  3UGV A;  3ATQ A;  3QSS A;  4A7A A;  1TZZ A;  3LB8 A;  2PTX A;  4GAP A;  2QDE A;  3GWD A;  1S2Q A;  1F8R A;  4J56 A;  1NEN A;  2XDO A;  3QVR A;  3AMZ A;  3AD7 B;  3R07 C;  3UOX A;  1GRB A;  2V60 A;  1XPQ A;  3HYV A;  1P2E A;  1EBG A;  3H7V A;  4HCL A;  1KN0 A;  1Q1W A;  1NG4 A;  3OZY A;  3EAO A;  2BS4 A;  4OPC A;  3PO7 A;  3I6E A;  1Y0P A;  3QTP A;  1F8S A;  4M0X A;  4H4P A;  3N6J A;  3AEC A;  2QJM A;  1RVK A;  2R46 A;  4G74 A;  1FHV A;  3ALM A;  3SSZ A;  3C4A A;  5IQ1 A;  1BQG A;  2AKM A;  4EQX A;  4DX3 A;  3ICR A;  1JPD X;  4JDR A;  1N4W A;  4TM1 A;  3NFU A;  3OC4 A;  4DYE A;  4MGG A;  1Q1R A;  2YR4 A;  2PTW A;  3UTF A;  3U9I A;  4NWZ A;  2EQ6 A;  5GRT A;  3T14 A;  2XH2 A;  3CXB A;  4A79 A;  2BA9 A;  1M6I A;  5KVH A;  1BKH A;  1PBD A;  3L5O A;  1GOS A;  2NPX A;  2VQ7 A;  3COX A;  1ZDL A;  2ZC8 A;  2XVI A;  1FOH A;  2HQM A;  4HB9 A;  3UTE A;  3AYI A;  4J34 A;  4K8D A;  3DJD A;  2WES A;  1OJD A;  3F8P A;  4RG4 A;  3DG3 A;  4GF7 A;  1TYP A;  4U8K A;  3FXG A;  4EMJ A;  3SZF A;  4E8G A;  3FPZ A;  1ZKQ A;  4A3R A;  3NK1 X;  3H12 A;  1KFY A;  2XFO A;  5KOW A;  2XH0 A;  2WDR A;  1YQZ A;  2BCP A;  3GDP A;  2C66 A;  4GME A;  4Y4N A;  2AL2 B;  4A6N B;  3RGT A;  1KSU A;  1TKK A;  4HYR A;  3P93 A;  5EB4 A;  4TVY A;  3ENL A;  1BZL A;  5HHF A;  2GMH A;  1EL8 A;  2P8B A;  4LII A;  3VRA A;  2X99 A;  4B68 A;  4H83 A;  4ZN0 A;  3RR1 A;  2APG A;  1EC7 A;  4EMW A;  3IJQ A;  3Q9T A;  5FS6 A;  1KNR A;  2WOV A;  4O5Q A;  3KLJ A;  3N4E A;  1TRB A;  1ZK7 A;  2HZG A;  3RCY A;  5KRQ A;  3H4K A;  2V3B A;  1OJT A;  3IWA A;  1VQW A;  2X50 A;  3QLD A;  3AXB A;  3ZVH A;  2ZZC A;  3ZDN A;  3OZ2 A;  4H2N A;  1F9C A;  3BSM A;  1KD0 A;  5U63 A;  1NU5 A;  3A7U A;  3NN0 X;  1MNS A;  4YTN A;  4DGK A;  4FI4 A;  3FBS A;  3KPK A;  1VRQ B;  3CPJ G;  3CGB A;  3CXO A;  3NN6 X;  2ZZB A;  3GD4 A;  4J31 A;  4B67 A;  4UDP A;  4BJZ A;  4E4F A;  3QSE A;  1BKW A;  4YKF A;  1W4X A;  4J36 A;  1XPY A;  4G7F A;  2WEU A;  4Z2U A;  3C96 A;  4HNL A;  2RGJ A;  3HRD C;  2AL1 A;  1B37 A;  4EIP A;  2BS2 A;  5IQ4 A;  5TR3 A;  3OW1 A;  1D4D A;  2HNE A;  2B9W A;  3S5S A;  1DNC A;  4YT0 A;  3NT6 A;  4M6U A;  3NKS A;  1EBD A;  3KA7 A;  4USR A;  1N63 C;  5FJR A;  3D46 A;  1MXT A;  3AB1 A;  3GDN A;  4BK1 A;  4AOS A;  3AE6 A;  4Z26 A;  1JRP A;  2E1M A;  3NK2 X;  4H4R A;  4DHG A;  1OEP A;  5HXI A;  1PXC A;  1WUE A;  2OA1 A;  5CKU A;  2XVJ A;  2IVE A;  4EQS A;  3SZ0 A;  4YSH A;  1Z6L A;  3NVW B;  1MDL A;  3K30 A;  4C3X A;  2Y6Q A;  3TCS A;  5KXJ A;  2C73 A;  2OVL A;  3AYJ A;  2AAQ A;  1B5Q A;  4H7U A;  3UKP A;  4OCG A;  1EL7 A;  2W3S A;  3L8K A;  1H84 A;  2YLZ A;  3M12 A;  3DGH A;  5IPY A;  4E4U A;  3ETR B;  2XFP A;  1LTX R;  1P48 A;  3DFH A;  3TW9 A;  5GSN A;  1SJB A;  2XFN A;  4B1B A;  2WDV A;  2XGZ A;  3NO1 A;  1Q9I A; 
#chains in the Genus database with same CATH homology
 4K5R A;  5JRB A;  4HA6 A;  4C5O A;  3HYW A;  3GYJ A;  4JQ9 A;  5BUL A;  3UTG A;  1GT8 A;  1GPE A;  3NYC A;  2BAC A;  1CHU A;  3AWI A;  4CY6 A;  1O95 A;  3KKJ A;  4TM3 A;  2A89 A;  3ICT A;  4IVO B;  4DNA A;  3UOZ A;  2YR5 A;  2XLR A;  1CJ3 A;  2BC0 A;  3UKQ A;  2B9Y A;  4U8N A;  1NHQ A;  1IUS A;  2IVD A;  2C70 A;  2ACZ A;  4NEV A;  1YY5 A;  2C67 A;  2QA1 A;  1FEC A;  2AQJ A;  2FJA A;  2VVL G;  2YVJ A;  2OAL A;  3DJG X;  3G5Q A;  2QAE A;  1OJA A;  2PYX A;  3AE4 A;  4B64 A;  2BRY A;  1Y56 A;  5FS7 A;  5HY5 A;  3EF6 A;  1YQ4 A;  4REK A;  2FJD A;  4YTM A;  1CC6 A;  2WPF A;  1FCD A;  1RYI A;  2GEW A;  1GAL A;  4H4Q A;  2WHD A;  2XLT A;  1NHS A;  1COY A;  1O94 A;  3AEB A;  3AE2 A;  3PG6 A;  3SXI A;  2BK4 A;  2FJB A;  3GRS A;  1L9C A;  2XVE A;  1D7L A;  2C3C A;  1IUT A;  1ONF A;  3QVP A;  3PVC A;  2PHH A;  2Q0K A;  4IA6 A;  1FEB A;  2EQ8 A;  4EMI A;  4H4T A;  2DKI A;  2GAG B;  4Z25 A;  4FDC B;  1L9D A;  5C3J A;  2GF3 A;  3DK9 A;  4FX9 A;  2E4G A;  5KMS A;  4OPT A;  2X8H A;  4H4Z A;  3SFE A;  4A9W A;  2YLW A;  3IC9 A;  1GEU A;  1AOG A;  2B9X A;  1QLB A;  3AD8 B;  2GQW A;  3D1C A;  3G5S A;  4OVI A;  4B63 A;  4BK1 A;  5JCN A;  2Q7V A;  4U8O A;  2C65 A;  2CDU A;  4H2Q A;  1F6M A;  2IID A;  4H4W A;  4CNK A;  5HYM A;  1IUU A;  1GRA A;  2YQU A;  1RP0 A;  1NHR A;  2GH5 A;  1GER A;  1CJ2 A;  1PJ6 A;  4G9K A;  1XHC A;  4K22 A;  3QSS A;  3ATQ A;  4A7A A;  2WPE A;  4AP3 A;  3UTH A;  4GRT A;  1K0I A;  3LZW A;  1O5W A;  1N1P A;  3DJJ A;  1CJ4 A;  4H2P A;  1CF3 A;  1M64 A;  1S3B A;  1MO9 A;  3LB8 A;  1DOE A;  4GAP A;  2FJE A;  1GND A;  3GWD A;  2OLN A;  1YKJ A;  1S2Q A;  1F8R A;  1GRT A;  4J56 A;  2R9Z A;  4I58 A;  3NG7 X;  4TLX A;  1NEN A;  4CCQ A;  2XDO A;  3QVR A;  4U8J A;  1DOB A;  1D5T A;  4U2L A;  3P4R A;  3AD7 B;  3NNE A;  4E0V A;  1ZOY A;  4EM4 A;  3T2K A;  2B7S A;  3UOX A;  2OAM A;  1GRB A;  2V60 A;  4CCR A;  4WX1 A;  1QO8 A;  1XPQ A;  2GMJ A;  3CGD A;  1DJN A;  1VDC A;  3URH A;  3HYV A;  1E39 A;  3DME A;  5KMQ A;  4XXG A;  3K7T A;  1P2E A;  1PXA A;  3UKL A;  3NRN A;  4A65 A;  1E7P A;  2VOU A;  4G6H A;  1PJ7 A;  2YG7 A;  5LV9 A;  2OLO A;  2JBV A;  1KF6 A;  2VVL A;  3SGL A;  2YLT A;  2BK3 A;  3KVE A;  4C77 A;  3DGZ A;  1JEH A;  2XFQ A;  3CNP A;  4JNQ A;  4NTD A;  3UOY A;  3H8I A;  1KN0 A;  1CL0 A;  1Q1W A;  1NG4 A;  2V61 A;  2YLS A;  4J57 A;  1K0J A;  2YAU A;  1NG3 A;  3EAO A;  2XCG A;  2BS4 A;  2WPC A;  3AE5 A;  4Y4L A;  4OPC A;  1NHP A;  2YG5 A;  3PO7 A;  4APN A;  1Y0P A;  3GSI A;  1FEA A;  1Y56 B;  3AEA A;  1H6V A;  1F8S A;  2C72 A;  3GMC A;  3P4P A;  4H4P A;  1B8S A;  3UP5 A;  3AEC A;  4NEW A;  4GDE A;  2WP5 A;  3VQR A;  1ZX9 A;  5KVI A;  4GUV A;  1PS9 A;  4GR1 A;  3RNM A;  1L9E A;  4JN9 A;  1CBO A;  2R46 A;  2WET A;  4LA1 A;  1TDK A;  4ZCC A;  2WU5 A;  5BRT A;  3AEE A;  3ALL A;  4G74 A;  4B69 A;  1PBF A;  1PBC A;  3ALM A;  2WBA A;  3C4A A;  2F5Z A;  3VR9 A;  4J2W A;  1NAA A;  3SQP A;  4EQX A;  5IQ1 A;  3K7Q X;  4BK3 A;  3ICR A;  1N4U A;  3KU9 A;  4G73 A;  4U8L A;  3CNT A;  1LPF A;  4JDR A;  1N4W A;  4TM1 A;  4OPI A;  1PHH A;  2RAB A;  4H4Y A;  4U8P A;  1H7X A;  3OC4 A;  3IF9 A;  3IHG A;  3V3N A;  4Z43 A;  4FK1 C;  3ZYX A;  1Q1R A;  2UZZ A;  2YR4 A;  3AEG A;  3PS9 A;  3ITJ A;  4KX6 A;  2CUL A;  5M10 A;  3UKF A;  4G6G A;  4UDQ A;  4D03 A;  4M52 A;  3UTF A;  2XFU A;  1K4Q A;  1DOC A;  3UP4 A;  4NWZ A;  1E6E A;  1NPX A;  3QFA A;  2EQ6 A;  3NYE A;  2Z5Y A;  5GRT A;  2ZBW A;  2NVK X;  1IUW A;  4YKG A;  3RED A;  4IVM B;  3DJE A;  3NLC A;  3G5R A;  2VRM A;  3P9U A;  1DJQ A;  4B66 A;  2R4E A;  3LAD A;  1PBE A;  3T14 A;  3B6D A;  4NNJ A;  4BJY A;  1LQU A;  3P4S A;  3ALJ A;  3QFB A;  2R45 A;  4FK1 A;  2YM2 A;  4A79 A;  4DSG A;  1ZMD A;  1M6I A;  2BA9 A;  5KVH A;  4TM4 A;  1PBD A;  3L5O A;  1GOS A;  2VVM A;  2NPX A;  2GAH B;  3BHK A;  2VQ7 A;  1GTH A;  3COX A;  1ZDL A;  1X31 B;  2B7R A;  3AYL A;  4A5L A;  4EM3 A;  4YWO A;  2XVI A;  1FOH A;  4ICY A;  2HQM A;  4UDR A;  1TYT A;  4HB9 A;  3UTE A;  3AYI A;  4CNJ A;  1XAN A;  2RGH A;  4J34 A;  1ZOV A;  4K8D A;  4X4J A;  3GWF A;  2R0C A;  3DJD A;  5EOW A;  3RP7 A;  2WES A;  1OJD A;  3F8P A;  4RG4 A;  4GF7 A;  1TYP A;  1VG9 A;  4U8K A;  4D04 A;  2FBW A;  4EMJ A;  2WOW A;  1CC2 A;  1SEZ A;  2BAB A;  3SZF A;  3O0H A;  3FPZ A;  4U2S A;  1ZKQ A;  3NK1 X;  1DOD A;  1KFY A;  1DXL A;  2XFO A;  4OPU A;  5KOW A;  1B4V A;  2WDR A;  3DA1 A;  4ZCD A;  1YQZ A;  2BCP A;  2H89 A;  3BI5 A;  4U8M A;  2XYO A;  3GDP A;  2EQ9 A;  1P2H A;  2C64 A;  2C66 A;  4EIQ A;  4Z2R A;  4Y4N A;  1H82 A;  1JOA A;  4A6N B;  2ARD A;  2X8G A;  1KSU A;  1L0V A;  3IHM A;  5EB4 A;  1GES A;  1S2Y A;  3C4N A;  1BZL A;  4YSY A;  5HHF A;  1JNZ A;  2GMH A;  1TDF A;  2XVH A;  5J60 A;  1BGN A;  1EL8 A;  2E5V A;  1PBB A;  2H88 A;  1XDI A;  1KNP A;  5M0Z A;  3CND A;  4LII A;  4OPD A;  4BV6 A;  4EQW A;  4H2R A;  4X9N A;  4Z24 A;  1GXF A;  3VRA A;  2X99 A;  1GRG A;  4NZH A;  4OPG A;  3UKH A;  3CNJ A;  4B68 A;  4IA5 A;  2RGO A;  2XLS A;  4K2X A;  4MJW A;  4AP1 A;  3ISH A;  3SX6 A;  2Q6U A;  1F3P A;  3DK4 A;  1QJD A;  5EB5 A;  3RHA A;  1REO A;  4CRT A;  4DSH A;  4RSL A;  1ZMC A;  4ZN0 A;  3EAN A;  1H81 A;  2DKH A;  4IV9 A;  1OJC A;  2APG A;  2C75 A;  2VZ2 A;  5FS9 A;  3CMM A;  5KNL A;  1TDN A;  2GVC A;  3CGE A;  1E1K A;  4PAA A;  4ECH A;  4UP3 A;  1PJ5 A;  2C4C A;  3H8L A;  4EMW A;  4AT0 A;  1H7W A;  3AE8 A;  2Q0L A;  1NDA A;  1N4V A;  2J3N A;  3Q9T A;  3K7M X;  5FS6 A;  1KNR A;  3QJ4 A;  4GCM A;  2ZZ0 A;  1D7Y A;  2WOV A;  3NK0 X;  4O5Q A;  3KLJ A;  4JY2 A;  1TRB A;  1ZK7 A;  1OJ9 A;  4YXD A;  1GET A;  2YVF A;  3CIR A;  5U1O A;  1MOK A;  5KRQ A;  2GR2 A;  3H4K A;  3NGC X;  3T2Y A;  2V3B A;  1OJT A;  5KWF A;  3NHO X;  3IWA A;  2CFY A;  1Q9I A;  1PXB A;  1VQW A;  4KPR A;  2X50 A;  4K7Z A;  3AEF A;  1S3E A;  3AXB A;  3CN8 A;  4K5S A;  4NTE A;  3QSM A;  3BHF A;  3HYX A;  4OPL A;  2ZZC A;  4CBQ A;  4U8I A;  4Y4M A;  3DK8 A;  3ZDN A;  3DH9 A;  1EL5 A;  2BXR A;  1CC4 A;  3I3L A;  3OZ2 A;  4H2N A;  4X9M A;  2C76 A;  5J7X A;  4B65 A;  4C74 A;  2BK5 A;  2C3D A;  3T37 A;  5JCL A;  5U63 A;  2C7G A;  2GV8 A;  2VQB A;  3NIX A;  2R0P A;  3JSK A;  3UKA A;  4C3Y A;  2WP6 A;  4H4X A;  4NTC A;  1GTE A;  3NN0 X;  4H50 A;  3ADA B;  4Z44 A;  4GDP A;  4PAB A;  2WOI A;  1FL2 A;  4AOX A;  5C2T A;  4YTN A;  2BCG G;  4DGK A;  1GRF A;  3FBS A;  3M0O A;  3KPK A;  1VRQ B;  3V3O A;  3R9U A;  2AR8 A;  3CPJ G;  4AT2 A;  4U2T A;  3CGB A;  2JB2 A;  2JAE A;  4LU6 A;  1GRH A;  5BUK A;  3NN6 X;  3KD9 A;  1GRE A;  3UKK A;  3P1W A;  2ZZB A;  2GB0 A;  3GD4 A;  3ABV A;  3NTA A;  1TDE A;  2BS3 A;  1BGJ A;  5EBK A;  5CQF A;  3SFD A;  3HZL A;  4J31 A;  5FS8 A;  4II3 A;  4B67 A;  4TLZ A;  4UDP A;  1IJH A;  4BJZ A;  3QSE A;  2W0H A;  1GSN A;  4Z2T A;  1BKW A;  4I59 A;  2JB3 A;  4YKF A;  1ELI A;  1W4X A;  4J36 A;  3GYI A;  2TPR A;  3FMW A;  1LVL A;  2CVJ A;  2XVF A;  2YLX A;  2WQY A;  2WEU A;  3F8D A;  4EQR A;  4II2 A;  1VG0 A;  2GQF A;  4CY8 A;  5BVA A;  4Z2U A;  3L1R A;  4USQ A;  4A99 A;  3S5W A;  2Y6R A;  3C96 A;  2RGJ A;  1ZP0 A;  1JNR A;  3VRB A;  2X8C A;  1B37 A;  4EIP A;  2BS2 A;  3SYI A;  5IQ4 A;  5TR3 A;  5KMP A;  3V76 A;  2A87 A;  3D9X A;  1D4D A;  3LXD A;  3AD9 B;  2GRT A;  3GMB A;  2GR1 A;  1NEK A;  2R0G A;  4GAV A;  2R4J A;  2B9W A;  3AE1 A;  2BC1 A;  4JY3 A;  1DNC A;  1BWC A;  2YG6 A;  3S61 A;  4YT0 A;  2YG3 A;  3CGC A;  3NT6 A;  4ADW A;  1V59 A;  3NKS A;  4WCT A;  2WS3 A;  2WP9 A;  1EBD A;  2VRL A;  3RP6 A;  1H86 A;  3B3R A;  3KA7 A;  3M13 A;  2X3N A;  3NH3 X;  3BI4 A;  1K0L A;  1D4C A;  2I0Z A;  3D8X A;  4O5U A;  4USR A;  3E1T A;  1MXT A;  3AE7 A;  3SY4 A;  3UOV A;  1IUX A;  2V5Z A;  5U25 A;  1PDH A;  1HYU A;  3AB1 A;  3GDN A;  4P9S A;  2TMD A;  4XWZ A;  4AOS A;  1LV0 A;  3AE6 A;  4Z26 A;  2EQ7 A;  5JCM A;  3T0K A;  2Z5X A;  5DBJ A;  1UKV G;  1KDG A;  2E1M A;  3BI2 A;  3NK2 X;  4H4R A;  1KSS A;  3P4Q A;  3BNU A;  2YR6 A;  2GR3 A;  2V3A A;  2JB1 A;  2JK6 A;  3BNM A;  1H83 A;  5HXI A;  2BRA A;  1LQT A;  3AED A;  1PXC A;  1JRX A;  1JRZ A;  3VRD B;  1GV4 A;  4JNA A;  1S7M A;  3CNS A;  3I6D A;  2OA1 A;  5CKU A;  1E1M A;  4N9X A;  3VR8 A;  1F8W A;  2XVJ A;  5JCI A;  3CPI G;  2IVE A;  4EQS A;  1BF3 A;  3SZ0 A;  3LJP A;  3EPT A;  3ICS A;  5JCK A;  1EL9 A;  4J33 A;  4YSH A;  1RSG A;  2JKC A;  1Z6L A;  3NYF A;  2BXS A;  4BUR A;  2YVG A;  3SM8 A;  3WE0 A;  2YG4 A;  3K30 A;  2XLP A;  4C3X A;  2Y6Q A;  1IUV A;  1CJC A;  4TM0 A;  2A8X A;  5ER0 A;  3SZC A;  3FG2 P;  4RG3 A;  3LOV A;  2C73 A;  3T31 A;  3AYJ A;  4YSX A;  3CPH G;  2AAQ A;  5KXJ A;  1H2I A;  1B5Q A;  3RP8 A;  3UCL A;  2GR0 A;  4H4S A;  3ATR A;  4H7U A;  3UKP A;  4BK2 A;  2YM1 A;  2QA2 A;  2B76 A;  3T2Z A;  2YWL A;  4OCG A;  1ZY8 A;  5KMR A;  3LZX A;  1YQ3 A;  1EL7 A;  1E1N A;  3L8K A;  4H4U A;  1H84 A;  2XLU A;  2YLZ A;  3M12 A;  3DGH A;  5IPY A;  1TDO A;  3KPF A;  4YSZ A;  1D4E A;  2V6O A;  2QCU A;  2XFP A;  1LTX R;  3II4 A;  4A6N A;  5KOX A;  1PN0 A;  3NTD A;  2WDQ A;  5GSN A;  3SZW A;  3GRT A;  2YLR A;  1JRY A;  2XFN A;  4B1B A;  5L46 A;  3F8R A;  1JU2 A;  1LJ1 A;  3Q6J A;  2WDV A;  3GYX A;  2O9Z A;  3AE9 A;  3AE3 A;  4XWR A;  3FIM B;  3GD3 A;  4YTP A;  1E1L A;  4H4V A;  2BYB A;  3CTY A;  5FMH A;  2WU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...