4J57A

Structure of plasmodium falciparum thioredoxin reductase-thioredoxin complex
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
499
structure length
483
Chain Sequence
b'HTYDYDYVVIGGGPGGMASAKEAAAHGARVLLFDYVKPSSQGTKWGIGGTCVNVGCVPKKLMHYAGHMGSIFKLDSKAYGWKFDNLKHDWKKLVTTVQSHIRSLNFSYMTGLRSSKVKYINGLAKLKDKNTVSYYLKGDLSKEETVTGKYILIATGCRPHIPDDVEGAKELSITSDDIFSLKKDPGKTLVVGASYVALECSGFLNSLGYDVTVAVRSIVLRGFDQQCAVKVKLYMEEQGVMFKNGILPKKLTKMDDKILVEFSDKTSELYDTVLYAIGRKGDIDGLNLESLNMNVNKSNNKIIADHLSCTNIPSIFAVGDVAENVPELAPVAIKAGEILARRLFKDSDEIMDYSYIPTSIYTPIEYGACGYSEEKAYELYGKSNVEVFLQEFNNLEISAVHRSTCLAKLVCLKNEDNRVIGFHYVGPNAGEVTQGMALALRLKVKKKDFDNCIGIHPTDAESFMNLFVTISSGLSYAAKGGCG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase 2
publication title Crystal Structure of the Plasmodium falciparum Thioredoxin Reductase-Thioredoxin Complex.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 155
structure length 483
sequence length 499
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF00890 FAD_binding_2 FAD binding domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4j57A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4j57A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4j57A02
4B1BA 5EBKA 3G5QA 3P4QA 4K5RA 5C3JA 1EL7A 1X31B 4C3YA 1KDGA 4JDRA 3KVEA 4JN9A 1VDCA 3LOVA 4A6NB 2YVGA 3RNMA 4B69A 1PHHA 3BHFA 1GERA 4BURA 1NENA 2ZBWA 4U8MA 4AP1A 1DJQA 3GWDA 4CCQA 4DNAA 2VQ7A 2W0HA 2GAHB 1ZDLA 3P4SA 4K5SA 3P9UA 2WOWA 1PJ7A 2DKIA 4CY6A 3O0HA 1JRXA 2C67A 4J34A 1JU2A 1NEKA 3CN8A 5FS8A 1LPFA 1CHUA 4BK2A 2B7RA 1NHPA 3GYJA 2R0CA 4EQSA 4H4WA 3QSEA 3I3LA 3G5RA 5FS7A 2X3NA 3QSSA 4A79A 4K7ZA 4Y4MA 3LB8A 1L9EA 3LZWA 1UKVG 2GMJA 1F8RA 2EQ8A 4YSZA 1S2YA 4AP3A 3DJEA 3I6DA 2BABA 1DOCA 2JKCA 3K7MX 3P4RA 2V60A 2C3DA 2WESA 2YG4A 1OJDA 1XPQA 2YG6A 3CGCA 2V3AA 2GR1A 2WDVA 2XCGA 4BK1A 1E1NA 3BHKA 4OCGA 2YLZA 3BNMA 3DJDA 1VG9A 3UTGA 3M12A 1SEZA 2GR3A 1PBDA 2YLTA 4H2PA 2GAGB 1Q1RA 2Z5YA 3RP8A 2JBVA 3AEFA 1JNRA 4KX6A 2OLNA 2XYOA 4B66A 2XLTA 2YLXA 2C3CA 2IVDA 4CBQA 3UTEA 1E6EA 3CPIG 2AAQA 2CULA 1Y56B 4D03A 3NHOX 1CL0A 4WCTA 3AD8B 1PBBA 2BK3A 1BZLA 2BA9A 4CNKA 2V5ZA 1GRGA 2WP9A 3URHA 2YQUA 4E0VA 2WPFA 4UP3A 2E4GA 4ZN0A 3AD7B 2E5VA 3UKHA 1ZOYA 3CNDA 1H7WA 3UOZA 3GRTA 3CPHG 2B9YA 3M0OA 4GF7A 5J7XA 1NHSA 3AE4A 4B67A 2FJDA 2R9ZA 3COXA 4O5UA 2WETA 4XXGA 2YG5A 5KVIA 1KF6A 2QAEA 2XLUA 4IVMB 3CIRA 4GR1A 1DOEA 3UOYA 3II4A 5TR3A 4APNA 1TRBA 2XVJA 3NYEA 4N9XA 2C72A 3VQRA 4FK1C 3HZLA 5JCKA 3KA7A 5HY5A 4U2TA 4OPUA 1TDEA 1NHQA 3GMBA 2A8XA 3NG7X 5L46A 1B37A 3ICTA 2NPXA 3K30A 4GCMA 2R4EA 5BULA 2RGHA 5GSNA 4NTDA 1LQTA 1KSUA 1F6MA 1GEUA 3FG2P 1CC6A 3DGZA 2GEWA 2JAEA 1GRTA 3QVRA 5JCLA 3DK4A 2BXSA 4J36A 4DSHA 1MOKA 2WU5A 3H8LA 2YR4A 1FEBA 1GNDA 1OJTA 3KLJA 3ATRA 5BRTA 3NYCA 1NG3A 1IUXA 1E1KA 1B4VA 2V3BA 2FJBA 1N4UA 4U8LA 3AEBA 3BI2A 3SFEA 4YTPA 4TM1A 1Y0PA 4PABA 2R0GA 4Z2UA 1TDKA 1QO8A 1ZOVA 3NTAA 4OPGA 5JCMA 2C7GA 4CRTA 1D7YA 2RABA 2FJEA 2GB0A 5IQ4A 3L8KA 3ZYXA 4HA6A 1EL5A 1OJ9A 1DXLA 4EQWA 2XLPA 3CGDA 1LV0A 3F8DA 1D4DA 1K0IA 3BI4A 2HQMA 4EQRA 1CJ2A 1ZX9A 2GF3A 4U2SA 1L0VA 3RP6A 1OJCA 4H4PA 1MO9A 5U1OA 2JB1A 3NRNA 2PHHA 1NPXA 2EQ7A 2XVIA 4TLXA 2XFNA 1B8SA 1N4VA 4NZHA 2XFQA 3UP5A 2OAMA 2WU2A 3AYJA 4B64A 3NT6A 3PS9A 3SQPA 3NTDA 5U25A 4USRA 4RSLA 2WBAA 3NK0X 3UKKA 2GR0A 2R4JA 2TMDA 4GDPA 1IUUA 2ZZBA 2Z5XA 3CNJA 1L9DA 3ITJA 3DH9A 1PBFA 2H89A 4JNAA 3NIXA 3T37A 1NDAA 4IA6A 1LVLA 3EPTA 4X9NA 4OPTA 3V3OA 3P1WA 4J2WA 1GTHA 2C66A 3ALLA 4U8IA 4H4UA 3BI5A 2ACZA 1BKWA 3GD4A 2NVKX 1MXTA 2FJAA 1GOSA 1QJDA 5CQFA 1H82A 4H50A 2VQBA 1CJ3A 3IF9A 1PBCA 5JCIA 1V59A 2XFPA 1E39A 2CVJA 1JEHA 4Z2TA 4UDRA 3UTHA 3S5WA 3AXBA 1W4XA 4B63A 2R45A 1FECA 1P2HA 1FEAA 5BVAA 1TDOA 1K4QA 1H7XA 3KPFA 3GD3A 2JB2A 1CJ4A 1KFYA 4X4JA 1L9CA 3AE9A 1GRBA 2B76A 1REOA 3AE6A 5FS9A 4OPLA 3R9UA 1TDFA 1VG0A 3S61A 2YVFA 1XDIA 3EANA 3CGEA 1YKJA 3ICSA 4GRTA 1ZMCA 1VQWA 3NN0X 1PXCA 2BC1A 3GYIA 1EL9A 2VRLA 4A99A 1ZY8A 3LZXA 4YKGA 4U2LA 2GVCA 2JK6A 1HYUA 1GPEA 1RYIA 4C77A 1LQUA 1LTXR 2GMHA 4O5QA 3KKJA 3OZ2A 4H4XA 3UKPA 1BGJA 3NGCX 1O94A 4Z24A 4LIIA 1E1LA 2X8GA 1PXBA 4K22A 3UTFA 3AYIA 1CBOA 1N4WA 3FBSA 4BJYA 2FBWA 4AOXA 1M64A 2X8CA 2E1MA 2WHDA 1FOHA 3WE0A 1OJAA 2RGJA 4P9SA 2AQJA 2PYXA 3NNEA 2GQFA 3UKLA 1Q9IA 2BXRA 2VOUA 5IQ1A 2A89A 2B7SA 4C5OA 4EMWA 5KOXA 3AYLA 2Y6QA 2VVMA 2XVFA 2J3NA 1TDNA 1Z6LA 2V61A 3AE2A 5M10A 4YSHA 2WQYA 3ICRA 2WS3A 5FMHA 4C74A 1E1MA 3FPZA 1ELIA 3G5SA 4YT0A 1PXAA 2C75A 3AE3A 4J31A 1S3BA 2DKHA 3AB1A 1N1PA 2JB3A 1D4EA 4Z44A 4OPDA 2C65A 1D5TA 3SGLA 4Y4NA 1DODA 4H7UA 1GRFA 2UZZA 4H4QA 4Z2RA 2QA1A 2RGOA 3B6DA 5JCNA 4XWZA 4I58A 2WEUA 4U8OA 4OVIA 3AD9B 4IVOB 4YSYA 2Q0KA 3H8IA 2IIDA 3K7TA 2YM2A 4RG3A 5DBJA 4LU6A 4JQ9A 2BC0A 4RG4A 4WX1A 3B3RA 1KNPA 1H86A 2O9ZA 2BCPA 4JNQA 3AE5A 2Y6RA 4EM4A 1GV4A 1GTEA 5IPYA 2ZZCA 5KXJA 2XDOA 4YTNA 3AE1A 4LA1A 1GT8A 3AEAA 1JRZA 2OALA 3D1CA 1H83A 1K0LA 1NHRA 4H2NA 2CFYA 3ZDNA 4EIQA 1F3PA 3EAOA 2BS4A 1M6IA 1CC4A 1PS9A 2QCUA 5BUKA 3AEDA 4A9WA 3UP4A 5FS6A 4UDPA 1LJ1A 4ECHA 3M13A 1PN0A 3GDPA 2WDRA 2YM1A 3DJGX 1ZK7A 4H4ZA 1RP0A 3ALJA 4BJZA 1GSNA 3CNSA 3F8PA 2WP5A 1CC2A 3JSKA 4TM0A 2YLSA 2XLRA 5EB4A 4YWOA 3CNTA 3VR9A 3NK1X 5EB5A 4X9MA 3E1TA 3IWAA 1H81A 3VRAA 5EOWA 1K0JA 2WPCA 1H6VA 1JOAA 2WP6A 4H4VA 2X50A 2Q7VA 1KSSA 4J56A 2YR5A 1DJNA 3NLCA 4U8JA 4EIPA 1IUVA 1ONFA 3KU9A 3QVPA 4BK3A 1S3EA 2C70A 3C4AA 2VZ2A 3UKQA 4REKA 2GR2A 1VRQB 1YY5A 3AEEA 1EBDA 3DJJA 3RP7A 2BS2A 3LXDA 2GV8A 2R46A 4AOSA 1FL2A 4K8DA 1Q1WA 3CGBA 3AE7A 3REDA 2BK5A 3LJPA 4YTMA 4OPCA 3VRDB 3RHAA 5HYMA 3FIMB 5KWFA 2GH5A 4YKFA 1BGNA 3QFAA 4ZCDA 1FCDA 4TM4A 2R0PA 1PJ6A 4U8PA 1COYA 2VVLG 3PVCA 3ADAB 1JRYA 4ICYA 2C73A 3Q6JA 3DA1A 2B9WA 4EQXA 3C4NA 1NG4A 2H88A 3IC9A 4IA5A 4A6NA 1GXFA 4FX9A 1AOGA 5CKUA 1GALA 2YG3A 3AE8A 3SFDA 2WPEA 3ABVA 4U8KA 2X8HA 2Q6UA 4FK1A 4A65A 4M52A 4B65A 2BCGG 4USQA 3ATQA 2XVEA 3NN6X 1TYTA 4YXDA 1GRHA 2BS3A 4D04A 1ZKQA 2WDQA 4H4TA 2VVLA 1IUWA 1F8SA 4A7AA 1E7PA 3AWIA 4I59A 1JNZA 3OC4A 2TPRA 3H4KA 3SM8A 5ER0A 2YR6A 2ARDA 3DGHA 3AECA 4TLZA 4ZCCA 1DNCA 4ADWA 1CJCA 3DK8A 4J33A 1GETA 5LV9A 2C64A 3F8RA 4NEVA 1RSGA 3QSMA 2GQWA 2YVJA 4H2RA 4MJWA 2VRMA 1YQZA 2A87A 3UCLA 1O5WA 4XWRA 3EF6A 4NEWA 4KPRA 1H84A 3IHMA 3KD9A 4HB9A 2I0ZA 1XHCA 2XFOA 1IJHA 3NH3X 4Z43A 3UOVA 4NTEA 1PJ5A 4J57A 3NK2X 2GRTA 3QJ4A 2AR8A 4IV9A 3K7QX 2OA1A 1ZP0A 1P2EA 4BV6A 3DK9A 1PBEA 4AT2A 2QA2A 2YWLA 4DGKA 5KRQA 4GDEA 1NAAA 1ZMDA 2ZZ0A 3BNUA 1D4CA 5C2TA 3VRBA 2WOIA 1IUSA 1O95A 2CDUA 1QLBA 4CNJA 1GESA 1B5QA 2XLSA 1D7LA 2YAUA 5U63A 2APGA 2OLOA 4TM3A 1XANA 3FMWA 3UOXA 4C3XA 1EL8A 1GRAA 1Y56A 3GWFA 3CPJG 5HHFA 4Z26A 4OPIA 1DOBA 4EMJA 1YQ3A 3D8XA 2BK4A 3C96A 4DSGA 3DMEA 2F5ZA 4PAAA 4UDQA 5J60A 1IUTA 3AEGA 4Z25A 4H4YA 1BF3A 3GSIA 3IHGA 3ALMA 2YG7A 4EMIA 4U8NA 3ISHA 4A5LA 4K2XA 4YSXA 3Q9TA 1TYPA 4H2QA 5HXIA 4Y4LA 3UKAA 4FDCB 2YLWA 3QFBA 2B9XA 3UKFA 4JY3A 1S2QA 2V6OA 1CF3A 5M0ZA 2IVEA 2C76A 1F8WA 4CCRA 3V3NA 4H4RA 4JY2A 2EQ6A 3NYFA 4AT0A 2EQ9A 2WOVA 3PO7A 4EM3A 1YQ4A 2X99A 3L1RA 4NTCA 2Q0LA 3LADA 2YLRA 1PDHA 3V76A 3NKSA 3GMCA 5GRTA 4B68A 2BACA 3CTYA 4H4SA 3VR8A 4CY8A 3GDNA 1BWCA 3CNPA 1KNRA 3P4PA 2XVHA 2BYBA 1GREA 4GUVA 3GRSA 5KVHA 2XFUA 5KOWA
chains in the Genus database with same CATH superfamily
4B1BA 5EBKA 3P4QA 5C3JA 1KDGA 3H70A 3EEZA 2YVGA 4K8GA 1MNSA 4BURA 2ZBWA 3STPA 4DYEA 1DJQA 2VQ7A 4K5SA 3P9UA 2WOWA 2DKIA 1PDZA 2PTWA 3FCPA 3NXLA 3SN1A 4J34A 1NEKA 5FS8A 3SY4A 1CHUA 4G9KA 4BK2A 4H4WA 2PP3A 2GL5A 2ZADA 4Y4MA 1L9EA 2GMJA 2EQ8A 1S2YA 3DIPA 3K7MX 3SX6A 2V60A 2C3DA 2WESA 1OJDA 2V3AA 2GR1A 2XCGA 4BK1A 3ZLFA 2GR3A 2YLTA 3RP8A 4KX6A 1E6EA 3CPIG 1Y56B 3AD8B 2BK3A 2V5ZA 1GRGA 4ZN0A 4A6GA 2PP0A 2E5VA 3UKHA 1FFVC 1H7WA 3UOZA 4II2A 3GRTA 2B9YA 4B67A 2AL2A 2OFJA 3CIRA 4GR1A 4JN8A 4G8TA 3VQRA 4U2TA 4E8GA 2OX4A 2AL1A 5J04A 3SZWA 4DSHA 4J36A 3DK4A 2WU5A 3H8LA 3NYCA 4F4RA 1NG3A 1IUXA 5EU9A 4Z1YA 2BRAA 3AEBA 3SFEA 4Z2UA 3JVAA 3NTAA 1D7YA 5ENLA 3L8KA 3A7AA 3NVZB 1OJ9A 1DXLA 3UGVA 3MZNA 1CJ2A 4GYPC 4H2HA 2XGZA 4FP1A 4H4PA 1MO9A 2XVIA 1NPXA 1B8SA 2P3ZA 3CT2A 2WU2A 3AYJA 3PS9A 3NTDA 3VFCA 1S7MA 2GR0A 4G6GA 4E5TA 3CNJA 1L9DA 1PBFA 2H89A 2NQLA 4JNAA 3VCCA 3RCYA 3ZVHB 3ETRB 3P1WA 5KNLA 3ALLA 2ACZA 2NVKX 1MXTA 1EBHA 3MY9A 4Z2TA 4UDRA 1IYXA 2P8CA 3GYXA 4II3A 2QJNA 1FECA 1VDVA 3KPFA 2JB2A 1KFYA 4X4JA 1L9CA 1GRBA 2B76A 2OQHA 1ZMCA 3NN0X 1EL9A 1FO4A 1BKHA 5FJTA 4U2LA 2GVCA 1HYUA 4C77A 1LTXR 2GMHA 3KKJA 4H4XA 3UKPA 3NGCX 4Z24A 4LIIA 2X8GA 3UTFA 3AYIA 1N4WA 4AOXA 1OJAA 2PYXA 2A89A 3MWCA 4JHMA 2WS3A 6ENLA 4J31A 2DKHA 2JB3A 4YWSA 4Y4NA 1DODA 1WYGA 2QA1A 4U8OA 2QQ6A 4IVOB 1XS2A 4RG3A 2IIDA 5DBJA 2YM2A 1ELSA 1TKKA 4RG4A 1GV4A 2ZZCA 3I6EA 2XDOA 4YTNA 3FVDA 1JRZA 1F3PA 3EAOA 2QCUA 5BUKA 1CC4A 4A9WA 2E3TA 3GDPA 2BRYA 2WDRA 2XSXA 3L5OA 4H4ZA 4HCHA 4BJZA 3CNSA 4YXDA 2WP5A 3JSKA 1N5WC 2YLSA 3VR9A 4IL0A 3VRAA 2W3SA 2X50A 1KSSA 3PFRA 2YR5A 3UKQA 2GR2A 1VRQB 1YY5A 1EBDA 3RP7A 1EBGA 1R0MA 2PU1A 3RHAA 3FIMB 4HYRA 2GGIA 3QFAA 3DESA 3R11A 4TM4A 2R0PA 4U8PA 1KCZA 5G5GB 3R1ZA 2B9WA 4EQXA 7ENLA 1WUFA 2OG9A 2H88A 1AOGA 2YG3A 3UJRA 3VDGA 4U8KA 2X8HA 4FK1A 4GAPA 4USQA 4GFIA 1TYTA 3SSZA 1IUWA 3OC4A 3AECA 2ARDA 3DGHA 1CJCA 1GETA 2GQWA 2YVJA 2XH2A 2A87A 3DDMA 3PK7A 4HB9A 4J3ZA 4DHGA 1XHCA 3NH3X 4Z43A 3OTRA 3NK2X 4J57A 3QJ4A 3CYJA 3NS1B 1PBEA 4AT2A 1NAAA 2ZZ0A 3Q45A 3VRBA 2POZA 3TQPA 4GGBA 1XANA 4C3XA 1Y56A 4KT2A 4ZOHB 4H4YA 1BF3A 3GSIA 3IHGA 2GGHA 1TYPA 2YLWA 2B9XA 3CXBA 2V6OA 3TWBA 2EQ6A 2EQ9A 3PO7A 3L1RA 1PDHA 5FJRA 5G5HB 4CY8A 3CXOA 2AKZA 3KPKA 3GRSA 3NZGA 1NU5A 1EL7A 4C3YA 4A6NB 1SJDA 2PTXA 1PHHA 3BHFA 1NENA 4AP1A 3GWDA 4CCQA 4DNAA 1ZDLA 3P4SA 3UCCA 3T8QA 1JU2A 1LPFA 3PWIA 4X2PA 3GYJA 5FS7A 3QSSA 4A79A 4DX3A 3R25A 1UKVG 4E4UA 3SZCA 4E4FA 2YG4A 2YG6A 3FV9A 2WDVA 3N6HA 2YLZA 3M12A 1SEZA 4GMEA 1NELA 3MKCA 4H2PA 2JBVA 3ZVHA 1JNRA 3TOYA 2OLNA 4B66A 2YLXA 2IVDA 4CBQA 3UTEA 2AAQA 3GD6A 4CNKA 1BZLA 1SJCA 2YQUA 4HPNA 4UP3A 4E0VA 3HPFA 3AD7B 4TVYA 1NHSA 3VCNA 3COXA 3DGBA 2YG5A 3V3WA 2QAEA 1FHVA 4IVMB 3UOYA 3DEQA 3II4A 5TR3A 1TRBA 2XVJA 3CB3A 3HZLA 5JCKA 3UJSA 1NHQA 2NPXA 4GCMA 4NNJA 2R4EA 5BULA 5GSNA 4NTDA 1LQTA 2GEWA 5KOXA 1GRTA 5JCLA 2BXSA 1T3QC 1EC8A 1TE6A 1FEBA 3ATRA 4M6UA 5BRTA 1E1KA 1B4VA 3DG3A 2FJBA 1N4UA 3BOXA 5JRBA 4PABA 2GGEA 4G73A 4CRTA 3TCSA 2FJEA 2GB0A 5IQ4A 2P0IA 4EQWA 1K0IA 3RO6A 2HQMA 2GF3A 2I5QA 3UJEA 3RP6A 2PU0A 2PHHA 2XFNA 1EC7A 2XFQA 3UP5A 2OAMA 5U25A 2WBAA 3NK0X 3HYXA 2W3RA 2ZZBA 3NIXA 3THUA 4IA6A 1LVLA 3EPTA 4X9NA 3V3OA 3RR1A 1GTHA 2PPGA 4JN7A 2GDQA 4H4UA 3H7VA 1GOSA 5CQFA 1PBCA 2XFPA 3S5SA 4IP4A 2CVJA 3UTHA 1W4XA 1FEAA 5BVAA 1FIQB 1H7XA 3GD3A 3AE6A 1TDFA 1VG0A 2YVFA 3EANA 4IHCA 3GYIA 2VRLA 4TVWA 1GPEA 3OZ2A 1BGJA 2FBWA 3AM9A 1M64A 3OPSA 2RGJA 4P9SA 2AQJA 2B7SA 4EMWA 3AYLA 2Y6QA 3MSYA 2XVFA 2J3NA 1Z6LA 1FFUC 1E1MA 3FPZA 3G5SA 1TZZA 1S3BA 4OPDA 4GISA 4GIRA 2UZZA 3IK4A 4XWZA 3NFUA 4OVIA 1SB3B 3S47A 3H8IA 4JQ9A 1KNPA 3FXGA 2O9ZA 3AE5A 3T2YA 2Y6RA 4EM4A 3GY1A 4NWZA 2XH7A 3QN3A 1H83A 3MUCA 2OQYA 2PGEA 4EIQA 1N60C 1PS9A 3I6TA 3AEDA 1LJ1A 4ECHA 3M13A 2XH4A 2C4CA 3DJGX 3DFHA 3F8PA 1CC2A 5EB5A 4X9MA 1H6VA 2W54A 2WP6A 4H4VA 1DJNA 2P8BA 2C70A 3C4AA 2VZ2A 4REKA 4ROPA 2R46A 4K8DA 1F9CA 3AE7A 2BK5A 4YTMA 3VRDB 5HYMA 3JW7A 5BOEA 2OPJA 2GH5A 4YKFA 4ZCDA 2W55A 3PVCA 4ICYA 3Q6JA 1X2HA 4A6NA 3SFDA 2WPEA 3T0KA 2XVEA 2BS3A 1ZKQA 1F8SA 3AWIA 4I59A 1JNZA 2TPRA 3H4KA 3NVVB 1DNCA 4J33A 2C64A 3P93A 4NEVA 1RSGA 4MJWA 4XWRA 4KPRA 1H84A 2I0ZA 1YEYA 2HNEA 1ZP0A 2MUCA 4BV6A 2QA2A 3BNUA 5C2TA 1O95A 2CDUA 1GESA 3ES7A 2APGA 2OLOA 3UOXA 3FMWA 1EL8A 3GWFA 4Z26A 1YQ3A 3D8XA 4DSGA 4PAAA 4UDQA 4IP5A 3AEGA 4YSXA 4A5LA 4K2XA 3UKAA 4FDCB 3UKFA 1S2QA 2C76A 4H4RA 4AT0A 4EM3A 2X99A 4NTCA 3LADA 3ES8A 3NKSA 5GRTA 3VR8A 4K2SA 1BWCA 3P4PA 2XVHA 1GREA 4GUVA 2XFUA 4K5RA 1X31B 3KVEA 4JN9A 1VDCA 3T9PA 3RNMA 4B69A 1GERA 2PS2A 4U8MA 3OZYA 2C67A 3GO2A 1N61C 1NHPA 2R0CA 4EQSA 3QSEA 3I3LA 1XPYA 1N5XA 2X3NA 4K7ZA 3LB8A 3LZWA 4YSZA 4AP3A 3P4RA 2BABA 2JKCA 1XPQA 3VC6A 3CGCA 1X2GA 2P88A 1VG9A 4DXKA 4IT1A 2GAGB 1Q1RA 2Z5YA 2PSNA 2XLTA 2E5AA 4A35A 2C3CA 3SN4A 3IJLA 2CULA 4D03A 3NHOX 3T2KA 1CL0A 3N4FA 4WCTA 2BA9A 2WP9A 3URHA 3V5CA 1KD0A 2E4GA 3AMZA 3M0OA 2QDDA 3TJIA 2R9ZA 4O5UA 4XXGA 1MRAA 3QTPA 3HYWA 2XLUA 4FI4A 4APNA 4N9XA 3R07C 2C72A 4FK1C 3K1GA 2PTZA 3GMBA 1B37A 3K30A 2RGHA 4KWSA 1KSUA 1F6MA 1GEUA 3T14A 3QVRA 1MOKA 3AN1A 1OEPA 1GNDA 2DW6A 4G74A 2V3BA 3UXLA 1Y0PA 3N4EA 3ZVIA 2R0GA 1TDKA 1QO8A 4OPGA 3CAWA 2C7GA 5IDZA 1JROA 4HCLA 1EL5A 3CGDA 1LV0A 3F8DA 1D4DA 2XH0A 4EQRA 1ZX9A 3B97A 4TLXA 4NZHA 1P43A 4B64A 3NT6A 4H1ZA 3IJIA 2OZTA 2TMDA 4GDPA 2Z5XA 3B9JB 3DH9A 1ONEA 3T37A 4E6MA 3TW9A 3SBFA 4OPTA 5KMRA 3DG6A 3H8AA 2C66A 1DTNA 1N63C 3GD4A 2FJAA 1H82A 1JPDX 4IZGA 3IF9A 1V59A 1E39A 2QGYA 1JRPA 3RGTA 3AXBA 4B63A 4G7FA 2R45A 4GAVA 1TDOA 4ZCWA 1K4QA 1KN0A 3OW1A 5KMQA 1REOA 5FS9A 3R9UA 3EKGA 2PP1A 1YKJA 4GRTA 1VQWA 3LZXA 2RDXA 3VC5A 1LQUA 4O5QA 1O94A 1MDLA 1E1LA 4BJYA 4K22A 1CBOA 4HN8A 2E1MA 2WHDA 2GQFA 3UKLA 3T31A 5IQ1A 4C5OA 3PWGA 2VVMA 1TDNA 2V61A 5M10A 2WQYA 3ICRA 5FMHA 4C74A 2QJJA 1ELIA 4YT0A 1FHUA 3AB1A 1N1PA 1D4EA 3T4WA 3SGLA 4H7UA 4H4QA 3B6DA 5JCNA 4I58A 2WEUA 1H2IA 4YSYA 4LU6A 2BC0A 3BJSA 4WX1A 3B3RA 1H86A 2BCPA 1STZA 4JNQA 5IPYA 2GSHA 3UXKA 3AE1A 3AEAA 2CFYA 3ZDNA 3D9XA 1M6IA 1PN0A 2PMQA 2YM1A 1RP0A 1N62C 2XLRA 4YWOA 3CNTA 3U4FA 3NK1X 3HRDC 1H81A 2WPCA 2GGGA 1JOAA 4J56A 2HXTA 1IUVA 1ONFA 4HNLA 3QVPA 3AEEA 3DJJA 3IJQA 2BS2A 3LXDA 1E9IA 2GV8A 1FL2A 1Q1WA 3CGBA 3REDA 1KKRA 2OLAA 4G6HA 5FJUA 1COYA 1JRYA 2C73A 3DA1A 3SYIA 3JZUA 1GXFA 3AE8A 3ABVA 4A65A 4M52A 4B65A 4DWDA 3NN6X 1JDFA 4GGHA 4D04A 3MQTA 4H4TA 3SJNA 3SN0A 1E7PA 3T2ZA 3ENLA 3TWAA 5ER0A 2YR6A 4ZCCA 2PODA 5LV9A 3F8RA 3QSMA 1YQZA 4NEWA 3KD9A 5FJPA 4IV9A 2GRTA 2AR8A 1SJBA 2YWLA 5KRQA 4CNJA 1IUSA 4KEMA 1ZXIC 3ZLHA 1B5QA 4GYPA 1D7LA 2YAUA 5U63A 3CPJG 5HHFA 1DOBA 4H19A 2BK4A 3C96A 4MMWA 2F5ZA 4Z25A 4EMIA 1ECQA 3ISHA 4H2QA 3QFBA 1CF3A 5M0ZA 2IVEA 1F8WA 4CCRA 4JY2A 3CMMA 2Q0LA 3V76A 3GMCA 4B68A 3CTYA 4H4SA 4DN1A 3GDNA 1KNRA 4J1OA 3P0WA 5KOWA 1KKOA 3G5QA 4JDRA 1L8PA 3LOVA 2GGJA 3DG7A 2W0HA 2GAHB 2PCEA 4CY6A 1PJ7A 3O0HA 5FJOA 1JRXA 1SJAA 3CN8A 2OZ8A 2B7RA 3SZFA 3G5RA 1F8RA 3DJEA 3I6DA 1DOCA 3UCDA 2OO6A 1E1NA 3BHKA 4OCGA 3BNMA 3SZ0A 3DJDA 3UTGA 1PBDA 3AEFA 2QJMA 3H12A 3D47A 3QPEA 2XYOA 2OZ3A 1PBBA 2WPFA 3SQSA 3OP2A 1ZOYA 3CNDA 3CPHG 4GF7A 5J7XA 3AE4A 2FJDA 2WETA 3DFYA 5KVIA 4H83A 1KF6A 4HCDA 1DOEA 1PDYA 3I4KA 3NYEA 3SXIA 3KA7A 5HY5A 4OPUA 1TDEA 1RVKA 2A8XA 3NG7X 5L46A 4A3RA 3HYVA 3ICTA 3FG2P 1CC6A 3DGZA 2JAEA 1MUCA 2YR4A 2QDEA 1OJTA 3KLJA 4U8LA 3BI2A 4YTPA 4TM1A 1ZOVA 3NRZB 3RITA 5JCMA 2RABA 3DERA 3ZYXA 4HA6A 2XLPA 3D46A 3BI4A 4U2SA 1L0VA 1OJCA 3NRNA 5U1OA 2JB1A 2EQ7A 1N4VA 2QVHA 2OVLA 3UJFA 3SQPA 3A7RA 4USRA 3UKKA 4RSLA 2R4JA 1IUUA 3TJ4A 3ITJA 3UJ2A 1NDAA 4MKSA 5KMSA 3QKEA 3R0UA 4J2WA 4U8IA 3BI5A 1BKWA 1QJDA 4H50A 5BOFA 2VQBA 1CJ3A 5JCIA 1JEHA 1W6TA 1V97A 3S5WA 2AL2B 4M0XA 1P2HA 1CJ4A 3AE9A 4OPLA 3V5FA 3S61A 1XDIA 1MDRA 3CGEA 3ICSA 1PXCA 2BC1A 4A99A 1ZY8A 3CK5A 4YKGA 3GC2A 2JK6A 2PGWA 1RYIA 3U9IA 2HZGA 1PXBA 3FBSA 2X8CA 1FOHA 3WE0A 3NNEA 1Q9IA 2BXRA 3V4BA 2VOUA 1P48A 2FYMA 3AE2A 4YSHA 1PXAA 3FJ4A 2C75A 3AE3A 4ZA0A 4Z44A 2C65A 1D5TA 1GRFA 3EUB3 4Z2RA 2RGOA 4HNCA 3NVYB 3AD9B 2Q0KA 3K7TA 3Q4DA 3FYYA 1GTEA 5KXJA 4LA1A 1GT8A 2OALA 3D1CA 1K0LA 1NHRA 4H2NA 4K1WA 2OKTA 4IL2A 2BS4A 3VA8A 3TTEA 3UP4A 5FS6A 4UDPA 2FKPA 4MGGA 1RM6B 2O56A 2DW7A 1ZK7A 3ALJA 3N6JA 1GSNA 4TM0A 5EB4A 3E1TA 3IWAA 5EOWA 1K0JA 2Q7VA 3RRAA 3NLCA 4U8JA 4EIPA 3KU9A 4BK3A 1S3EA 4AOSA 3R0KA 3LJPA 4OPCA 5KMPA 5KWFA 1BGNA 4EWJA 3ZLGA 1FCDA 1PJ6A 2VVLG 1EC9A 3ADAB 3HW2A 3NVWB 3OZMA 3C4NA 1NG4A 4Z17A 3IC9A 4IA5A 2ONEA 4FX9A 5CKUA 1GALA 3QLDA 2Q6UA 3BSMA 2BCGG 3ATQA 1GRHA 2WDQA 4ENLA 2VVLA 4A7AA 2PTYA 1WUEA 2HXUA 3SM8A 4TLZA 1BQGA 4ADWA 3DK8A 1JCTA 4H2RA 3UCLA 2VRMA 1O5WA 3EF6A 3SR6B 3IHMA 2XFOA 1IJHA 3UOVA 4NTEA 1PJ5A 4KPLA 3K7QX 2OA1A 1R6WA 1P2EA 3DK9A 4DGKA 4GDEA 1ZMDA 1D4CA 2WOIA 1QLBA 3R10A 2XLSA 2AKMA 4TM3A 1GRAA 3A7UA 4OPIA 4EMJA 3DMEA 5J60A 1IUTA 3ALMA 2YG7A 4U8NA 5HXIA 3Q9TA 4Y4LA 2MNRA 1VQZA 4JY3A 3T6CA 3V3NA 3NYFA 2WOVA 2ZC8A 1YQ4A 2CHRA 2YLRA 3NO1A 3PG6A 2BACA 2PA6A 3CNPA 3KUMA 2BYBA 1JPMA 5KVHA 3P3BA
chains in the Genus database with same CATH topology
4B1BA 5EBKA 3G5QA 3P4QA 4K5RA 5C3JA 1EL7A 1X31B 4C3YA 1KDGA 4JDRA 3KVEA 4JN9A 1VDCA 3LOVA 4A6NB 2YVGA 3RNMA 4B69A 1PHHA 3BHFA 1GERA 4BURA 1NENA 2ZBWA 4U8MA 4AP1A 1DJQA 3GWDA 4CCQA 4DNAA 2VQ7A 2W0HA 2GAHB 1ZDLA 3P4SA 4K5SA 3P9UA 2WOWA 1PJ7A 2DKIA 4CY6A 3O0HA 1JRXA 2C67A 4J34A 1JU2A 1NEKA 3CN8A 5FS8A 3SY4A 1LPFA 1CHUA 4G9KA 4BK2A 2B7RA 1NHPA 3GYJA 2R0CA 4EQSA 3SZFA 4H4WA 3QSEA 3I3LA 3G5RA 5FS7A 2X3NA 3QSSA 4A79A 4K7ZA 4Y4MA 3LB8A 1L9EA 3LZWA 1UKVG 2GMJA 1F8RA 2EQ8A 4YSZA 1S2YA 4AP3A 3DJEA 3SZCA 3I6DA 2BABA 1DOCA 2JKCA 3K7MX 3P4RA 3SX6A 2V60A 2C3DA 2WESA 2YG4A 1OJDA 1XPQA 2YG6A 3CGCA 2V3AA 2GR1A 2WDVA 2XCGA 4BK1A 1E1NA 3BHKA 4OCGA 2YLZA 3BNMA 3SZ0A 3DJDA 1VG9A 3UTGA 3M12A 1SEZA 2GR3A 1PBDA 2YLTA 4H2PA 2GAGB 1Q1RA 2Z5YA 3RP8A 2JBVA 3AEFA 1JNRA 4KX6A 2OLNA 2XYOA 4B66A 2XLTA 2YLXA 2C3CA 2IVDA 4CBQA 3UTEA 1E6EA 3CPIG 2AAQA 2CULA 1Y56B 4D03A 3NHOX 3T2KA 1CL0A 4WCTA 3AD8B 1PBBA 2BK3A 1BZLA 2BA9A 4CNKA 2V5ZA 1GRGA 2WP9A 3URHA 2YQUA 4E0VA 2WPFA 4UP3A 2E4GA 4ZN0A 3AD7B 2E5VA 3UKHA 1ZOYA 3CNDA 1H7WA 3UOZA 4II2A 3GRTA 3CPHG 2B9YA 3M0OA 4GF7A 5J7XA 1NHSA 3AE4A 4B67A 2FJDA 2R9ZA 3COXA 4O5UA 2WETA 4XXGA 2YG5A 5KVIA 1KF6A 2QAEA 3HYWA 2XLUA 4IVMB 3CIRA 4GR1A 1DOEA 3UOYA 3II4A 5TR3A 4APNA 1TRBA 2XVJA 3NYEA 4N9XA 2C72A 3SXIA 4FK1C 3VQRA 3HZLA 5JCKA 3KA7A 5HY5A 4U2TA 4OPUA 1TDEA 1NHQA 3GMBA 2A8XA 3NG7X 5L46A 1B37A 3HYVA 2NPXA 3ICTA 3K30A 4GCMA 4NNJA 2R4EA 5BULA 2RGHA 5GSNA 4NTDA 1LQTA 1KSUA 1F6MA 1GEUA 3FG2P 1CC6A 3DGZA 2GEWA 2JAEA 1GRTA 3QVRA 5JCLA 3DK4A 2BXSA 4J36A 3T14A 4DSHA 1MOKA 2WU5A 3H8LA 2YR4A 1FEBA 1GNDA 1OJTA 3KLJA 3ATRA 5BRTA 3NYCA 4G74A 1NG3A 1IUXA 1E1KA 2V3BA 1B4VA 2FJBA 1N4UA 2BRAA 4U8LA 3AEBA 3BI2A 5JRBA 3SFEA 4YTPA 4TM1A 1Y0PA 4PABA 2R0GA 4G73A 4Z2UA 1TDKA 1QO8A 1ZOVA 3NTAA 4OPGA 5JCMA 2C7GA 4CRTA 1D7YA 2RABA 2FJEA 2GB0A 5IQ4A 3L8KA 3ZYXA 4HA6A 1EL5A 1OJ9A 1DXLA 4EQWA 2XLPA 3CGDA 1LV0A 3F8DA 1D4DA 1K0IA 3BI4A 2HQMA 4EQRA 1CJ2A 1ZX9A 2GF3A 4U2SA 1L0VA 3RP6A 1OJCA 4H4PA 1MO9A 5U1OA 2JB1A 3NRNA 2PHHA 1NPXA 2EQ7A 2XVIA 4TLXA 2XFNA 1B8SA 1N4VA 4NZHA 2XFQA 3UP5A 2OAMA 2WU2A 3AYJA 4B64A 3NT6A 3PS9A 3SQPA 3NTDA 1S7MA 5U25A 4USRA 4RSLA 2WBAA 3NK0X 3UKKA 2GR0A 2R4JA 2TMDA 3HYXA 4G6GA 4GDPA 1IUUA 2ZZBA 2Z5XA 3CNJA 1L9DA 3ITJA 3DH9A 1PBFA 2H89A 4JNAA 3NIXA 3T37A 1NDAA 4IA6A 1LVLA 3EPTA 4X9NA 5KMSA 4OPTA 3V3OA 5KMRA 3P1WA 5KNLA 4J2WA 1GTHA 2C66A 3ALLA 4U8IA 4H4UA 3BI5A 2ACZA 1BKWA 3GD4A 2NVKX 1MXTA 2FJAA 1GOSA 1QJDA 5CQFA 1H82A 4H50A 2VQBA 1CJ3A 3IF9A 1PBCA 5JCIA 1V59A 2XFPA 1E39A 2CVJA 1JEHA 4Z2TA 4UDRA 3UTHA 3S5WA 3AXBA 1W4XA 4B63A 3GYXA 2R45A 4II3A 1FECA 1P2HA 1FEAA 4GAVA 5BVAA 1TDOA 1K4QA 1H7XA 3KPFA 1KN0A 3GD3A 2JB2A 1CJ4A 1KFYA 4X4JA 1L9CA 3AE9A 1GRBA 2B76A 5KMQA 1REOA 3AE6A 5FS9A 4OPLA 3R9UA 1TDFA 1VG0A 3S61A 2YVFA 1XDIA 3EANA 3CGEA 1YKJA 3ICSA 4GRTA 1ZMCA 1VQWA 3NN0X 1PXCA 2BC1A 3GYIA 1EL9A 2VRLA 4A99A 1ZY8A 3LZXA 4YKGA 4U2LA 2GVCA 2JK6A 1HYUA 1GPEA 1RYIA 3SZWA 1LQUA 4C77A 1LTXR 2GMHA 4O5QA 3KKJA 3OZ2A 4H4XA 3UKPA 1BGJA 3NGCX 1O94A 4Z24A 4LIIA 1E1LA 2X8GA 1PXBA 4K22A 3UTFA 3AYIA 1CBOA 1N4WA 3FBSA 4BJYA 2FBWA 4AOXA 1M64A 2X8CA 2E1MA 2WHDA 1FOHA 3WE0A 1OJAA 2RGJA 4P9SA 2AQJA 2PYXA 3NNEA 2GQFA 3UKLA 1Q9IA 2BXRA 2VOUA 5IQ1A 3T31A 2A89A 2B7SA 4C5OA 4EMWA 5KOXA 3AYLA 2Y6QA 2VVMA 2XVFA 2J3NA 1TDNA 1Z6LA 2V61A 3AE2A 5M10A 4YSHA 2WQYA 3ICRA 2WS3A 5FMHA 4C74A 1E1MA 3FPZA 1ELIA 3G5SA 4YT0A 1PXAA 2C75A 3AE3A 4J31A 1S3BA 2DKHA 3AB1A 1N1PA 2JB3A 1D4EA 4Z44A 4OPDA 2C65A 1D5TA 3SGLA 4Y4NA 1DODA 4H7UA 1GRFA 2UZZA 4H4QA 4Z2RA 2QA1A 2RGOA 3B6DA 5JCNA 4XWZA 4I58A 2WEUA 1H2IA 4U8OA 4OVIA 3AD9B 4IVOB 4YSYA 2Q0KA 3H8IA 2IIDA 3K7TA 2YM2A 4RG3A 5DBJA 4LU6A 4JQ9A 2BC0A 4RG4A 4WX1A 3B3RA 1KNPA 1H86A 2O9ZA 2BCPA 4JNQA 3AE5A 3T2YA 2Y6RA 4EM4A 1GV4A 1GTEA 5IPYA 2ZZCA 5KXJA 2XDOA 4NWZA 4YTNA 3AE1A 4LA1A 1GT8A 3AEAA 1JRZA 2OALA 3D1CA 1H83A 1K0LA 1NHRA 4H2NA 2CFYA 3ZDNA 4EIQA 1F3PA 3D9XA 3EAOA 2BS4A 1M6IA 1CC4A 1PS9A 2QCUA 5BUKA 3AEDA 4A9WA 3UP4A 5FS6A 4UDPA 1LJ1A 4ECHA 3M13A 1PN0A 3GDPA 2BRYA 2C4CA 2WDRA 2YM1A 3L5OA 3DJGX 1ZK7A 4H4ZA 1RP0A 3ALJA 4BJZA 1GSNA 3CNSA 3F8PA 2WP5A 1CC2A 3JSKA 4TM0A 2YLSA 2XLRA 5EB4A 4YWOA 3CNTA 3VR9A 3NK1X 5EB5A 4X9MA 3E1TA 3IWAA 1H81A 3VRAA 5EOWA 1K0JA 2WPCA 1H6VA 1JOAA 2WP6A 4H4VA 2X50A 2Q7VA 1KSSA 4J56A 2YR5A 1DJNA 3NLCA 4U8JA 4EIPA 1IUVA 1ONFA 3KU9A 3QVPA 4BK3A 1S3EA 2C70A 3C4AA 2VZ2A 3UKQA 4REKA 2GR2A 1VRQB 1YY5A 3AEEA 1EBDA 3DJJA 3RP7A 2BS2A 3LXDA 2GV8A 2R46A 4AOSA 1FL2A 4K8DA 1Q1WA 3CGBA 3AE7A 3REDA 2BK5A 3LJPA 4YTMA 4OPCA 3VRDB 3RHAA 5HYMA 5KMPA 3FIMB 5KWFA 2GH5A 4G6HA 1BGNA 4YKFA 3QFAA 4ZCDA 1FCDA 4TM4A 2R0PA 1PJ6A 4U8PA 1COYA 2VVLG 3PVCA 3ADAB 1JRYA 4ICYA 2C73A 3Q6JA 3DA1A 3SYIA 2B9WA 4EQXA 3C4NA 1NG4A 2H88A 3IC9A 4IA5A 4A6NA 1GXFA 4FX9A 1AOGA 5CKUA 1GALA 2YG3A 3AE8A 3SFDA 2WPEA 3ABVA 4U8KA 2X8HA 2Q6UA 3T0KA 4FK1A 4A65A 4M52A 4B65A 2BCGG 4GAPA 4USQA 3ATQA 2XVEA 3NN6X 1TYTA 4YXDA 1GRHA 2BS3A 4D04A 1ZKQA 2WDQA 4H4TA 2VVLA 1IUWA 1F8SA 4A7AA 1E7PA 3AWIA 3T2ZA 4I59A 1JNZA 3OC4A 2TPRA 3H4KA 3SM8A 5ER0A 2YR6A 2ARDA 3DGHA 3AECA 4TLZA 4ZCCA 1DNCA 4ADWA 1CJCA 3DK8A 4J33A 1GETA 5LV9A 2C64A 3F8RA 4NEVA 1RSGA 3QSMA 2GQWA 2YVJA 4H2RA 4MJWA 2VRMA 1YQZA 2A87A 3UCLA 1O5WA 4XWRA 3EF6A 4NEWA 4KPRA 1H84A 3IHMA 3KD9A 4HB9A 2I0ZA 1XHCA 2XFOA 1IJHA 3NH3X 4Z43A 3UOVA 4NTEA 1PJ5A 4J57A 3NK2X 2GRTA 3QJ4A 2AR8A 4IV9A 3K7QX 2OA1A 1ZP0A 1P2EA 4BV6A 3DK9A 1PBEA 4AT2A 2QA2A 2YWLA 4DGKA 5KRQA 4GDEA 1NAAA 1ZMDA 2ZZ0A 3BNUA 1D4CA 5C2TA 3VRBA 2WOIA 1IUSA 1O95A 2CDUA 1QLBA 4CNJA 1GESA 1B5QA 2XLSA 1D7LA 2YAUA 5U63A 2APGA 2OLOA 4TM3A 1XANA 3FMWA 3UOXA 4C3XA 1EL8A 1GRAA 1Y56A 3GWFA 3CPJG 5HHFA 4Z26A 4OPIA 1DOBA 4EMJA 1YQ3A 3D8XA 2BK4A 3C96A 4DSGA 3DMEA 2F5ZA 4PAAA 4UDQA 5J60A 1IUTA 3AEGA 4Z25A 4H4YA 1BF3A 3GSIA 3IHGA 3ALMA 2YG7A 4EMIA 4U8NA 3ISHA 4A5LA 4K2XA 4YSXA 3Q9TA 1TYPA 4H2QA 5HXIA 4Y4LA 3UKAA 4FDCB 2YLWA 3QFBA 2B9XA 3UKFA 4JY3A 1S2QA 2V6OA 1CF3A 5M0ZA 2IVEA 2C76A 1F8WA 4CCRA 3V3NA 4H4RA 4JY2A 3CMMA 2EQ6A 3NYFA 4AT0A 2EQ9A 2WOVA 3PO7A 4EM3A 1YQ4A 2X99A 3L1RA 4NTCA 2Q0LA 3LADA 2YLRA 1PDHA 3V76A 3NKSA 3GMCA 5GRTA 4B68A 3PG6A 2BACA 3CTYA 4H4SA 3VR8A 4CY8A 3GDNA 1BWCA 3CNPA 1KNRA 3P4PA 2XVHA 2BYBA 1GREA 3KPKA 4GUVA 3GRSA 5KVHA 2XFUA 5KOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B1B A;  5EBK A;  3G5Q A;  3P4Q A;  4K5R A;  5C3J A;  1EL7 A;  1X31 B;  4C3Y A;  1KDG A;  4JDR A;  3KVE A;  4JN9 A;  1VDC A;  3LOV A;  4A6N B;  2YVG A;  3RNM A;  4B69 A;  1PHH A;  3BHF A;  1GER A;  4BUR A;  1NEN A;  2ZBW A;  4U8M A;  4AP1 A;  1DJQ A;  3GWD A;  4CCQ A;  4DNA A;  2VQ7 A;  2W0H A;  2GAH B;  1ZDL A;  3P4S A;  4K5S A;  3P9U A;  2WOW A;  1PJ7 A;  2DKI A;  4CY6 A;  3O0H A;  1JRX A;  2C67 A;  4J34 A;  1JU2 A;  1NEK A;  3CN8 A;  5FS8 A;  1LPF A;  1CHU A;  4BK2 A;  2B7R A;  1NHP A;  3GYJ A;  2R0C A;  4EQS A;  4H4W A;  3QSE A;  3I3L A;  3G5R A;  5FS7 A;  2X3N A;  3QSS A;  4A79 A;  4K7Z A;  4Y4M A;  3LB8 A;  1L9E A;  3LZW A;  1UKV G;  2GMJ A;  1F8R A;  2EQ8 A;  4YSZ A;  1S2Y A;  4AP3 A;  3DJE A;  3I6D A;  2BAB A;  1DOC A;  2JKC A;  3K7M X;  3P4R A;  2V60 A;  2C3D A;  2WES A;  2YG4 A;  1OJD A;  1XPQ A;  2YG6 A;  3CGC A;  2V3A A;  2GR1 A;  2WDV A;  2XCG A;  4BK1 A;  1E1N A;  3BHK A;  4OCG A;  2YLZ A;  3BNM A;  3DJD A;  1VG9 A;  3UTG A;  3M12 A;  1SEZ A;  2GR3 A;  1PBD A;  2YLT A;  4H2P A;  2GAG B;  1Q1R A;  2Z5Y A;  3RP8 A;  2JBV A;  3AEF A;  1JNR A;  4KX6 A;  2OLN A;  2XYO A;  4B66 A;  2XLT A;  2YLX A;  2C3C A;  2IVD A;  4CBQ A;  3UTE A;  1E6E A;  3CPI G;  2AAQ A;  2CUL A;  1Y56 B;  4D03 A;  3NHO X;  1CL0 A;  4WCT A;  3AD8 B;  1PBB A;  2BK3 A;  1BZL A;  2BA9 A;  4CNK A;  2V5Z A;  1GRG A;  2WP9 A;  3URH A;  2YQU A;  4E0V A;  2WPF A;  4UP3 A;  2E4G A;  4ZN0 A;  3AD7 B;  2E5V A;  3UKH A;  1ZOY A;  3CND A;  1H7W A;  3UOZ A;  3GRT A;  3CPH G;  2B9Y A;  3M0O A;  4GF7 A;  5J7X A;  1NHS A;  3AE4 A;  4B67 A;  2FJD A;  2R9Z A;  3COX A;  4O5U A;  2WET A;  4XXG A;  2YG5 A;  5KVI A;  1KF6 A;  2QAE A;  2XLU A;  4IVM B;  3CIR A;  4GR1 A;  1DOE A;  3UOY A;  3II4 A;  5TR3 A;  4APN A;  1TRB A;  2XVJ A;  3NYE A;  4N9X A;  2C72 A;  3VQR A;  4FK1 C;  3HZL A;  5JCK A;  3KA7 A;  5HY5 A;  4U2T A;  4OPU A;  1TDE A;  1NHQ A;  3GMB A;  2A8X A;  3NG7 X;  5L46 A;  1B37 A;  3ICT A;  2NPX A;  3K30 A;  4GCM A;  2R4E A;  5BUL A;  2RGH A;  5GSN A;  4NTD A;  1LQT A;  1KSU A;  1F6M A;  1GEU A;  3FG2 P;  1CC6 A;  3DGZ A;  2GEW A;  2JAE A;  1GRT A;  3QVR A;  5JCL A;  3DK4 A;  2BXS A;  4J36 A;  4DSH A;  1MOK A;  2WU5 A;  3H8L A;  2YR4 A;  1FEB A;  1GND A;  1OJT A;  3KLJ A;  3ATR A;  5BRT A;  3NYC A;  1NG3 A;  1IUX A;  1E1K A;  1B4V A;  2V3B A;  2FJB A;  1N4U A;  4U8L A;  3AEB A;  3BI2 A;  3SFE A;  4YTP A;  4TM1 A;  1Y0P A;  4PAB A;  2R0G A;  4Z2U A;  1TDK A;  1QO8 A;  1ZOV A;  3NTA A;  4OPG A;  5JCM A;  2C7G A;  4CRT A;  1D7Y A;  2RAB A;  2FJE A;  2GB0 A;  5IQ4 A;  3L8K A;  3ZYX A;  4HA6 A;  1EL5 A;  1OJ9 A;  1DXL A;  4EQW A;  2XLP A;  3CGD A;  1LV0 A;  3F8D A;  1D4D A;  1K0I A;  3BI4 A;  2HQM A;  4EQR A;  1CJ2 A;  1ZX9 A;  2GF3 A;  4U2S A;  1L0V A;  3RP6 A;  1OJC A;  4H4P A;  1MO9 A;  5U1O A;  2JB1 A;  3NRN A;  2PHH A;  1NPX A;  2EQ7 A;  2XVI A;  4TLX A;  2XFN A;  1B8S A;  1N4V A;  4NZH A;  2XFQ A;  3UP5 A;  2OAM A;  2WU2 A;  3AYJ A;  4B64 A;  3NT6 A;  3PS9 A;  3SQP A;  3NTD A;  5U25 A;  4USR A;  4RSL A;  2WBA A;  3NK0 X;  3UKK A;  2GR0 A;  2R4J A;  2TMD A;  4GDP A;  1IUU A;  2ZZB A;  2Z5X A;  3CNJ A;  1L9D A;  3ITJ A;  3DH9 A;  1PBF A;  2H89 A;  4JNA A;  3NIX A;  3T37 A;  1NDA A;  4IA6 A;  1LVL A;  3EPT A;  4X9N A;  4OPT A;  3V3O A;  3P1W A;  4J2W A;  1GTH A;  2C66 A;  3ALL A;  4U8I A;  4H4U A;  3BI5 A;  2ACZ A;  1BKW A;  3GD4 A;  2NVK X;  1MXT A;  2FJA A;  1GOS A;  1QJD A;  5CQF A;  1H82 A;  4H50 A;  2VQB A;  1CJ3 A;  3IF9 A;  1PBC A;  5JCI A;  1V59 A;  2XFP A;  1E39 A;  2CVJ A;  1JEH A;  4Z2T A;  4UDR A;  3UTH A;  3S5W A;  3AXB A;  1W4X A;  4B63 A;  2R45 A;  1FEC A;  1P2H A;  1FEA A;  5BVA A;  1TDO A;  1K4Q A;  1H7X A;  3KPF A;  3GD3 A;  2JB2 A;  1CJ4 A;  1KFY A;  4X4J A;  1L9C A;  3AE9 A;  1GRB A;  2B76 A;  1REO A;  3AE6 A;  5FS9 A;  4OPL A;  3R9U A;  1TDF A;  1VG0 A;  3S61 A;  2YVF A;  1XDI A;  3EAN A;  3CGE A;  1YKJ A;  3ICS A;  4GRT A;  1ZMC A;  1VQW A;  3NN0 X;  1PXC A;  2BC1 A;  3GYI A;  1EL9 A;  2VRL A;  4A99 A;  1ZY8 A;  3LZX A;  4YKG A;  4U2L A;  2GVC A;  2JK6 A;  1HYU A;  1GPE A;  1RYI A;  4C77 A;  1LQU A;  1LTX R;  2GMH A;  4O5Q A;  3KKJ A;  3OZ2 A;  4H4X A;  3UKP A;  1BGJ A;  3NGC X;  1O94 A;  4Z24 A;  4LII A;  1E1L A;  2X8G A;  1PXB A;  4K22 A;  3UTF A;  3AYI A;  1CBO A;  1N4W A;  3FBS A;  4BJY A;  2FBW A;  4AOX A;  1M64 A;  2X8C A;  2E1M A;  2WHD A;  1FOH A;  3WE0 A;  1OJA A;  2RGJ A;  4P9S A;  2AQJ A;  2PYX A;  3NNE A;  2GQF A;  3UKL A;  1Q9I A;  2BXR A;  2VOU A;  5IQ1 A;  2A89 A;  2B7S A;  4C5O A;  4EMW A;  5KOX A;  3AYL A;  2Y6Q A;  2VVM A;  2XVF A;  2J3N A;  1TDN A;  1Z6L A;  2V61 A;  3AE2 A;  5M10 A;  4YSH A;  2WQY A;  3ICR A;  2WS3 A;  5FMH A;  4C74 A;  1E1M A;  3FPZ A;  1ELI A;  3G5S A;  4YT0 A;  1PXA A;  2C75 A;  3AE3 A;  4J31 A;  1S3B A;  2DKH A;  3AB1 A;  1N1P A;  2JB3 A;  1D4E A;  4Z44 A;  4OPD A;  2C65 A;  1D5T A;  3SGL A;  4Y4N A;  1DOD A;  4H7U A;  1GRF A;  2UZZ A;  4H4Q A;  4Z2R A;  2QA1 A;  2RGO A;  3B6D A;  5JCN A;  4XWZ A;  4I58 A;  2WEU A;  4U8O A;  4OVI A;  3AD9 B;  4IVO B;  4YSY A;  2Q0K A;  3H8I A;  2IID A;  3K7T A;  2YM2 A;  4RG3 A;  5DBJ A;  4LU6 A;  4JQ9 A;  2BC0 A;  4RG4 A;  4WX1 A;  3B3R A;  1KNP A;  1H86 A;  2O9Z A;  2BCP A;  4JNQ A;  3AE5 A;  2Y6R A;  4EM4 A;  1GV4 A;  1GTE A;  5IPY A;  2ZZC A;  5KXJ A;  2XDO A;  4YTN A;  3AE1 A;  4LA1 A;  1GT8 A;  3AEA A;  1JRZ A;  2OAL A;  3D1C A;  1H83 A;  1K0L A;  1NHR A;  4H2N A;  2CFY A;  3ZDN A;  4EIQ A;  1F3P A;  3EAO A;  2BS4 A;  1M6I A;  1CC4 A;  1PS9 A;  2QCU A;  5BUK A;  3AED A;  4A9W A;  3UP4 A;  5FS6 A;  4UDP A;  1LJ1 A;  4ECH A;  3M13 A;  1PN0 A;  3GDP A;  2WDR A;  2YM1 A;  3DJG X;  1ZK7 A;  4H4Z A;  1RP0 A;  3ALJ A;  4BJZ A;  1GSN A;  3CNS A;  3F8P A;  2WP5 A;  1CC2 A;  3JSK A;  4TM0 A;  2YLS A;  2XLR A;  5EB4 A;  4YWO A;  3CNT A;  3VR9 A;  3NK1 X;  5EB5 A;  4X9M A;  3E1T A;  3IWA A;  1H81 A;  3VRA A;  5EOW A;  1K0J A;  2WPC A;  1H6V A;  1JOA A;  2WP6 A;  4H4V A;  2X50 A;  2Q7V A;  1KSS A;  4J56 A;  2YR5 A;  1DJN A;  3NLC A;  4U8J A;  4EIP A;  1IUV A;  1ONF A;  3KU9 A;  3QVP A;  4BK3 A;  1S3E A;  2C70 A;  3C4A A;  2VZ2 A;  3UKQ A;  4REK A;  2GR2 A;  1VRQ B;  1YY5 A;  3AEE A;  1EBD A;  3DJJ A;  3RP7 A;  2BS2 A;  3LXD A;  2GV8 A;  2R46 A;  4AOS A;  1FL2 A;  4K8D A;  1Q1W A;  3CGB A;  3AE7 A;  3RED A;  2BK5 A;  3LJP A;  4YTM A;  4OPC A;  3VRD B;  3RHA A;  5HYM A;  3FIM B;  5KWF A;  2GH5 A;  4YKF A;  1BGN A;  3QFA A;  4ZCD A;  1FCD A;  4TM4 A;  2R0P A;  1PJ6 A;  4U8P A;  1COY A;  2VVL G;  3PVC A;  3ADA B;  1JRY A;  4ICY A;  2C73 A;  3Q6J A;  3DA1 A;  2B9W A;  4EQX A;  3C4N A;  1NG4 A;  2H88 A;  3IC9 A;  4IA5 A;  4A6N A;  1GXF A;  4FX9 A;  1AOG A;  5CKU A;  1GAL A;  2YG3 A;  3AE8 A;  3SFD A;  2WPE A;  3ABV A;  4U8K A;  2X8H A;  2Q6U A;  4FK1 A;  4A65 A;  4M52 A;  4B65 A;  2BCG G;  4USQ A;  3ATQ A;  2XVE A;  3NN6 X;  1TYT A;  4YXD A;  1GRH A;  2BS3 A;  4D04 A;  1ZKQ A;  2WDQ A;  4H4T A;  2VVL A;  1IUW A;  1F8S A;  4A7A A;  1E7P A;  3AWI A;  4I59 A;  1JNZ A;  3OC4 A;  2TPR A;  3H4K A;  3SM8 A;  5ER0 A;  2YR6 A;  2ARD A;  3DGH A;  3AEC A;  4TLZ A;  4ZCC A;  1DNC A;  4ADW A;  1CJC A;  3DK8 A;  4J33 A;  1GET A;  5LV9 A;  2C64 A;  3F8R A;  4NEV A;  1RSG A;  3QSM A;  2GQW A;  2YVJ A;  4H2R A;  4MJW A;  2VRM A;  1YQZ A;  2A87 A;  3UCL A;  1O5W A;  4XWR A;  3EF6 A;  4NEW A;  4KPR A;  1H84 A;  3IHM A;  3KD9 A;  4HB9 A;  2I0Z A;  1XHC A;  2XFO A;  1IJH A;  3NH3 X;  4Z43 A;  3UOV A;  4NTE A;  1PJ5 A;  4J57 A;  3NK2 X;  2GRT A;  3QJ4 A;  2AR8 A;  4IV9 A;  3K7Q X;  2OA1 A;  1ZP0 A;  1P2E A;  4BV6 A;  3DK9 A;  1PBE A;  4AT2 A;  2QA2 A;  2YWL A;  4DGK A;  5KRQ A;  4GDE A;  1NAA A;  1ZMD A;  2ZZ0 A;  3BNU A;  1D4C A;  5C2T A;  3VRB A;  2WOI A;  1IUS A;  1O95 A;  2CDU A;  1QLB A;  4CNJ A;  1GES A;  1B5Q A;  2XLS A;  1D7L A;  2YAU A;  5U63 A;  2APG A;  2OLO A;  4TM3 A;  1XAN A;  3FMW A;  3UOX A;  4C3X A;  1EL8 A;  1GRA A;  1Y56 A;  3GWF A;  3CPJ G;  5HHF A;  4Z26 A;  4OPI A;  1DOB A;  4EMJ A;  1YQ3 A;  3D8X A;  2BK4 A;  3C96 A;  4DSG A;  3DME A;  2F5Z A;  4PAA A;  4UDQ A;  5J60 A;  1IUT A;  3AEG A;  4Z25 A;  4H4Y A;  1BF3 A;  3GSI A;  3IHG A;  3ALM A;  2YG7 A;  4EMI A;  4U8N A;  3ISH A;  4A5L A;  4K2X A;  4YSX A;  3Q9T A;  1TYP A;  4H2Q A;  5HXI A;  4Y4L A;  3UKA A;  4FDC B;  2YLW A;  3QFB A;  2B9X A;  3UKF A;  4JY3 A;  1S2Q A;  2V6O A;  1CF3 A;  5M0Z A;  2IVE A;  2C76 A;  1F8W A;  4CCR A;  3V3N A;  4H4R A;  4JY2 A;  2EQ6 A;  3NYF A;  4AT0 A;  2EQ9 A;  2WOV A;  3PO7 A;  4EM3 A;  1YQ4 A;  2X99 A;  3L1R A;  4NTC A;  2Q0L A;  3LAD A;  2YLR A;  1PDH A;  3V76 A;  3NKS A;  3GMC A;  5GRT A;  4B68 A;  2BAC A;  3CTY A;  4H4S A;  3VR8 A;  4CY8 A;  3GDN A;  1BWC A;  3CNP A;  1KNR A;  3P4P A;  2XVH A;  2BYB A;  1GRE A;  4GUV A;  3GRS A;  5KVH A;  2XFU A;  5KOW A; 
#chains in the Genus database with same CATH topology
 4B1B A;  5EBK A;  3P4Q A;  5C3J A;  1KDG A;  3H70 A;  3EEZ A;  2YVG A;  4K8G A;  1MNS A;  4BUR A;  2ZBW A;  3STP A;  4DYE A;  1DJQ A;  2VQ7 A;  4K5S A;  3P9U A;  2WOW A;  2DKI A;  1PDZ A;  2PTW A;  3FCP A;  3NXL A;  3SN1 A;  4J34 A;  1NEK A;  5FS8 A;  3SY4 A;  1CHU A;  4G9K A;  4BK2 A;  4H4W A;  2PP3 A;  2GL5 A;  2ZAD A;  4Y4M A;  1L9E A;  2GMJ A;  2EQ8 A;  1S2Y A;  3DIP A;  3K7M X;  3SX6 A;  2V60 A;  2C3D A;  2WES A;  1OJD A;  2V3A A;  2GR1 A;  2XCG A;  4BK1 A;  3ZLF A;  2GR3 A;  2YLT A;  3RP8 A;  4KX6 A;  1E6E A;  3CPI G;  1Y56 B;  3AD8 B;  2BK3 A;  2V5Z A;  1GRG A;  4ZN0 A;  4A6G A;  2PP0 A;  2E5V A;  3UKH A;  1FFV C;  1H7W A;  3UOZ A;  4II2 A;  3GRT A;  2B9Y A;  4B67 A;  2AL2 A;  2OFJ A;  3CIR A;  4GR1 A;  4JN8 A;  4G8T A;  3VQR A;  4U2T A;  4E8G A;  2OX4 A;  2AL1 A;  5J04 A;  3SZW A;  4DSH A;  4J36 A;  3DK4 A;  2WU5 A;  3H8L A;  3NYC A;  4F4R A;  1NG3 A;  1IUX A;  5EU9 A;  4Z1Y A;  2BRA A;  3AEB A;  3SFE A;  4Z2U A;  3JVA A;  3NTA A;  1D7Y A;  5ENL A;  3L8K A;  3A7A A;  3NVZ B;  1OJ9 A;  1DXL A;  3UGV A;  3MZN A;  1CJ2 A;  4GYP C;  4H2H A;  2XGZ A;  4FP1 A;  4H4P A;  1MO9 A;  2XVI A;  1NPX A;  1B8S A;  2P3Z A;  3CT2 A;  2WU2 A;  3AYJ A;  3PS9 A;  3NTD A;  3VFC A;  1S7M A;  2GR0 A;  4G6G A;  4E5T A;  3CNJ A;  1L9D A;  1PBF A;  2H89 A;  2NQL A;  4JNA A;  3VCC A;  3RCY A;  3ZVH B;  3ETR B;  3P1W A;  5KNL A;  3ALL A;  2ACZ A;  2NVK X;  1MXT A;  1EBH A;  3MY9 A;  4Z2T A;  4UDR A;  1IYX A;  2P8C A;  3GYX A;  4II3 A;  2QJN A;  1FEC A;  1VDV A;  3KPF A;  2JB2 A;  1KFY A;  4X4J A;  1L9C A;  1GRB A;  2B76 A;  2OQH A;  1ZMC A;  3NN0 X;  1EL9 A;  1FO4 A;  1BKH A;  5FJT A;  4U2L A;  2GVC A;  1HYU A;  4C77 A;  1LTX R;  2GMH A;  3KKJ A;  4H4X A;  3UKP A;  3NGC X;  4Z24 A;  4LII A;  2X8G A;  3UTF A;  3AYI A;  1N4W A;  4AOX A;  1OJA A;  2PYX A;  2A89 A;  3MWC A;  4JHM A;  2WS3 A;  6ENL A;  4J31 A;  2DKH A;  2JB3 A;  4YWS A;  4Y4N A;  1DOD A;  1WYG A;  2QA1 A;  4U8O A;  2QQ6 A;  4IVO B;  1XS2 A;  4RG3 A;  2IID A;  5DBJ A;  2YM2 A;  1ELS A;  1TKK A;  4RG4 A;  1GV4 A;  2ZZC A;  3I6E A;  2XDO A;  4YTN A;  3FVD A;  1JRZ A;  1F3P A;  3EAO A;  2QCU A;  5BUK A;  1CC4 A;  4A9W A;  2E3T A;  3GDP A;  2BRY A;  2WDR A;  2XSX A;  3L5O A;  4H4Z A;  4HCH A;  4BJZ A;  3CNS A;  4YXD A;  2WP5 A;  3JSK A;  1N5W C;  2YLS A;  3VR9 A;  4IL0 A;  3VRA A;  2W3S A;  2X50 A;  1KSS A;  3PFR A;  2YR5 A;  3UKQ A;  2GR2 A;  1VRQ B;  1YY5 A;  1EBD A;  3RP7 A;  1EBG A;  1R0M A;  2PU1 A;  3RHA A;  3FIM B;  4HYR A;  2GGI A;  3QFA A;  3DES A;  3R11 A;  4TM4 A;  2R0P A;  4U8P A;  1KCZ A;  5G5G B;  3R1Z A;  2B9W A;  4EQX A;  7ENL A;  1WUF A;  2OG9 A;  2H88 A;  1AOG A;  2YG3 A;  3UJR A;  3VDG A;  4U8K A;  2X8H A;  4FK1 A;  4GAP A;  4USQ A;  4GFI A;  1TYT A;  3SSZ A;  1IUW A;  3OC4 A;  3AEC A;  2ARD A;  3DGH A;  1CJC A;  1GET A;  2GQW A;  2YVJ A;  2XH2 A;  2A87 A;  3DDM A;  3PK7 A;  4HB9 A;  4J3Z A;  4DHG A;  1XHC A;  3NH3 X;  4Z43 A;  3OTR A;  3NK2 X;  4J57 A;  3QJ4 A;  3CYJ A;  3NS1 B;  1PBE A;  4AT2 A;  1NAA A;  2ZZ0 A;  3Q45 A;  3VRB A;  2POZ A;  3TQP A;  4GGB A;  1XAN A;  4C3X A;  1Y56 A;  4KT2 A;  4ZOH B;  4H4Y A;  1BF3 A;  3GSI A;  3IHG A;  2GGH A;  1TYP A;  2YLW A;  2B9X A;  3CXB A;  2V6O A;  3TWB A;  2EQ6 A;  2EQ9 A;  3PO7 A;  3L1R A;  1PDH A;  5FJR A;  5G5H B;  4CY8 A;  3CXO A;  2AKZ A;  3KPK A;  3GRS A;  3NZG A;  1NU5 A;  1EL7 A;  4C3Y A;  4A6N B;  1SJD A;  2PTX A;  1PHH A;  3BHF A;  1NEN A;  4AP1 A;  3GWD A;  4CCQ A;  4DNA A;  1ZDL A;  3P4S A;  3UCC A;  3T8Q A;  1JU2 A;  1LPF A;  3PWI A;  4X2P A;  3GYJ A;  5FS7 A;  3QSS A;  4A79 A;  4DX3 A;  3R25 A;  1UKV G;  4E4U A;  3SZC A;  4E4F A;  2YG4 A;  2YG6 A;  3FV9 A;  2WDV A;  3N6H A;  2YLZ A;  3M12 A;  1SEZ A;  4GME A;  1NEL A;  3MKC A;  4H2P A;  2JBV A;  3ZVH A;  1JNR A;  3TOY A;  2OLN A;  4B66 A;  2YLX A;  2IVD A;  4CBQ A;  3UTE A;  2AAQ A;  3GD6 A;  4CNK A;  1BZL A;  1SJC A;  2YQU A;  4HPN A;  4UP3 A;  4E0V A;  3HPF A;  3AD7 B;  4TVY A;  1NHS A;  3VCN A;  3COX A;  3DGB A;  2YG5 A;  3V3W A;  2QAE A;  1FHV A;  4IVM B;  3UOY A;  3DEQ A;  3II4 A;  5TR3 A;  1TRB A;  2XVJ A;  3CB3 A;  3HZL A;  5JCK A;  3UJS A;  1NHQ A;  2NPX A;  4GCM A;  4NNJ A;  2R4E A;  5BUL A;  5GSN A;  4NTD A;  1LQT A;  2GEW A;  5KOX A;  1GRT A;  5JCL A;  2BXS A;  1T3Q C;  1EC8 A;  1TE6 A;  1FEB A;  3ATR A;  4M6U A;  5BRT A;  1E1K A;  1B4V A;  3DG3 A;  2FJB A;  1N4U A;  3BOX A;  5JRB A;  4PAB A;  2GGE A;  4G73 A;  4CRT A;  3TCS A;  2FJE A;  2GB0 A;  5IQ4 A;  2P0I A;  4EQW A;  1K0I A;  3RO6 A;  2HQM A;  2GF3 A;  2I5Q A;  3UJE A;  3RP6 A;  2PU0 A;  2PHH A;  2XFN A;  1EC7 A;  2XFQ A;  3UP5 A;  2OAM A;  5U25 A;  2WBA A;  3NK0 X;  3HYX A;  2W3R A;  2ZZB A;  3NIX A;  3THU A;  4IA6 A;  1LVL A;  3EPT A;  4X9N A;  3V3O A;  3RR1 A;  1GTH A;  2PPG A;  4JN7 A;  2GDQ A;  4H4U A;  3H7V A;  1GOS A;  5CQF A;  1PBC A;  2XFP A;  3S5S A;  4IP4 A;  2CVJ A;  3UTH A;  1W4X A;  1FEA A;  5BVA A;  1FIQ B;  1H7X A;  3GD3 A;  3AE6 A;  1TDF A;  1VG0 A;  2YVF A;  3EAN A;  4IHC A;  3GYI A;  2VRL A;  4TVW A;  1GPE A;  3OZ2 A;  1BGJ A;  2FBW A;  3AM9 A;  1M64 A;  3OPS A;  2RGJ A;  4P9S A;  2AQJ A;  2B7S A;  4EMW A;  3AYL A;  2Y6Q A;  3MSY A;  2XVF A;  2J3N A;  1Z6L A;  1FFU C;  1E1M A;  3FPZ A;  3G5S A;  1TZZ A;  1S3B A;  4OPD A;  4GIS A;  4GIR A;  2UZZ A;  3IK4 A;  4XWZ A;  3NFU A;  4OVI A;  1SB3 B;  3S47 A;  3H8I A;  4JQ9 A;  1KNP A;  3FXG A;  2O9Z A;  3AE5 A;  3T2Y A;  2Y6R A;  4EM4 A;  3GY1 A;  4NWZ A;  2XH7 A;  3QN3 A;  1H83 A;  3MUC A;  2OQY A;  2PGE A;  4EIQ A;  1N60 C;  1PS9 A;  3I6T A;  3AED A;  1LJ1 A;  4ECH A;  3M13 A;  2XH4 A;  2C4C A;  3DJG X;  3DFH A;  3F8P A;  1CC2 A;  5EB5 A;  4X9M A;  1H6V A;  2W54 A;  2WP6 A;  4H4V A;  1DJN A;  2P8B A;  2C70 A;  3C4A A;  2VZ2 A;  4REK A;  4ROP A;  2R46 A;  4K8D A;  1F9C A;  3AE7 A;  2BK5 A;  4YTM A;  3VRD B;  5HYM A;  3JW7 A;  5BOE A;  2OPJ A;  2GH5 A;  4YKF A;  4ZCD A;  2W55 A;  3PVC A;  4ICY A;  3Q6J A;  1X2H A;  4A6N A;  3SFD A;  2WPE A;  3T0K A;  2XVE A;  2BS3 A;  1ZKQ A;  1F8S A;  3AWI A;  4I59 A;  1JNZ A;  2TPR A;  3H4K A;  3NVV B;  1DNC A;  4J33 A;  2C64 A;  3P93 A;  4NEV A;  1RSG A;  4MJW A;  4XWR A;  4KPR A;  1H84 A;  2I0Z A;  1YEY A;  2HNE A;  1ZP0 A;  2MUC A;  4BV6 A;  2QA2 A;  3BNU A;  5C2T A;  1O95 A;  2CDU A;  1GES A;  3ES7 A;  2APG A;  2OLO A;  3UOX A;  3FMW A;  1EL8 A;  3GWF A;  4Z26 A;  1YQ3 A;  3D8X A;  4DSG A;  4PAA A;  4UDQ A;  4IP5 A;  3AEG A;  4YSX A;  4A5L A;  4K2X A;  3UKA A;  4FDC B;  3UKF A;  1S2Q A;  2C76 A;  4H4R A;  4AT0 A;  4EM3 A;  2X99 A;  4NTC A;  3LAD A;  3ES8 A;  3NKS A;  5GRT A;  3VR8 A;  4K2S A;  1BWC A;  3P4P A;  2XVH A;  1GRE A;  4GUV A;  2XFU A;  4K5R A;  1X31 B;  3KVE A;  4JN9 A;  1VDC A;  3T9P A;  3RNM A;  4B69 A;  1GER A;  2PS2 A;  4U8M A;  3OZY A;  2C67 A;  3GO2 A;  1N61 C;  1NHP A;  2R0C A;  4EQS A;  3QSE A;  3I3L A;  1XPY A;  1N5X A;  2X3N A;  4K7Z A;  3LB8 A;  3LZW A;  4YSZ A;  4AP3 A;  3P4R A;  2BAB A;  2JKC A;  1XPQ A;  3VC6 A;  3CGC A;  1X2G A;  2P88 A;  1VG9 A;  4DXK A;  4IT1 A;  2GAG B;  1Q1R A;  2Z5Y A;  2PSN A;  2XLT A;  2E5A A;  4A35 A;  2C3C A;  3SN4 A;  3IJL A;  2CUL A;  4D03 A;  3NHO X;  3T2K A;  1CL0 A;  3N4F A;  4WCT A;  2BA9 A;  2WP9 A;  3URH A;  3V5C A;  1KD0 A;  2E4G A;  3AMZ A;  3M0O A;  2QDD A;  3TJI A;  2R9Z A;  4O5U A;  4XXG A;  1MRA A;  3QTP A;  3HYW A;  2XLU A;  4FI4 A;  4APN A;  4N9X A;  3R07 C;  2C72 A;  4FK1 C;  3K1G A;  2PTZ A;  3GMB A;  1B37 A;  3K30 A;  2RGH A;  4KWS A;  1KSU A;  1F6M A;  1GEU A;  3T14 A;  3QVR A;  1MOK A;  3AN1 A;  1OEP A;  1GND A;  2DW6 A;  4G74 A;  2V3B A;  3UXL A;  1Y0P A;  3N4E A;  3ZVI A;  2R0G A;  1TDK A;  1QO8 A;  4OPG A;  3CAW A;  2C7G A;  5IDZ A;  1JRO A;  4HCL A;  1EL5 A;  3CGD A;  1LV0 A;  3F8D A;  1D4D A;  2XH0 A;  4EQR A;  1ZX9 A;  3B97 A;  4TLX A;  4NZH A;  1P43 A;  4B64 A;  3NT6 A;  4H1Z A;  3IJI A;  2OZT A;  2TMD A;  4GDP A;  2Z5X A;  3B9J B;  3DH9 A;  1ONE A;  3T37 A;  4E6M A;  3TW9 A;  3SBF A;  4OPT A;  5KMR A;  3DG6 A;  3H8A A;  2C66 A;  1DTN A;  1N63 C;  3GD4 A;  2FJA A;  1H82 A;  1JPD X;  4IZG A;  3IF9 A;  1V59 A;  1E39 A;  2QGY A;  1JRP A;  3RGT A;  3AXB A;  4B63 A;  4G7F A;  2R45 A;  4GAV A;  1TDO A;  4ZCW A;  1K4Q A;  1KN0 A;  3OW1 A;  5KMQ A;  1REO A;  5FS9 A;  3R9U A;  3EKG A;  2PP1 A;  1YKJ A;  4GRT A;  1VQW A;  3LZX A;  2RDX A;  3VC5 A;  1LQU A;  4O5Q A;  1O94 A;  1MDL A;  1E1L A;  4BJY A;  4K22 A;  1CBO A;  4HN8 A;  2E1M A;  2WHD A;  2GQF A;  3UKL A;  3T31 A;  5IQ1 A;  4C5O A;  3PWG A;  2VVM A;  1TDN A;  2V61 A;  5M10 A;  2WQY A;  3ICR A;  5FMH A;  4C74 A;  2QJJ A;  1ELI A;  4YT0 A;  1FHU A;  3AB1 A;  1N1P A;  1D4E A;  3T4W A;  3SGL A;  4H7U A;  4H4Q A;  3B6D A;  5JCN A;  4I58 A;  2WEU A;  1H2I A;  4YSY A;  4LU6 A;  2BC0 A;  3BJS A;  4WX1 A;  3B3R A;  1H86 A;  2BCP A;  1STZ A;  4JNQ A;  5IPY A;  2GSH A;  3UXK A;  3AE1 A;  3AEA A;  2CFY A;  3ZDN A;  3D9X A;  1M6I A;  1PN0 A;  2PMQ A;  2YM1 A;  1RP0 A;  1N62 C;  2XLR A;  4YWO A;  3CNT A;  3U4F A;  3NK1 X;  3HRD C;  1H81 A;  2WPC A;  2GGG A;  1JOA A;  4J56 A;  2HXT A;  1IUV A;  1ONF A;  4HNL A;  3QVP A;  3AEE A;  3DJJ A;  3IJQ A;  2BS2 A;  3LXD A;  1E9I A;  2GV8 A;  1FL2 A;  1Q1W A;  3CGB A;  3RED A;  1KKR A;  2OLA A;  4G6H A;  5FJU A;  1COY A;  1JRY A;  2C73 A;  3DA1 A;  3SYI A;  3JZU A;  1GXF A;  3AE8 A;  3ABV A;  4A65 A;  4M52 A;  4B65 A;  4DWD A;  3NN6 X;  1JDF A;  4GGH A;  4D04 A;  3MQT A;  4H4T A;  3SJN A;  3SN0 A;  1E7P A;  3T2Z A;  3ENL A;  3TWA A;  5ER0 A;  2YR6 A;  4ZCC A;  2POD A;  5LV9 A;  3F8R A;  3QSM A;  1YQZ A;  4NEW A;  3KD9 A;  5FJP A;  4IV9 A;  2GRT A;  2AR8 A;  1SJB A;  2YWL A;  5KRQ A;  4CNJ A;  1IUS A;  4KEM A;  1ZXI C;  3ZLH A;  1B5Q A;  4GYP A;  1D7L A;  2YAU A;  5U63 A;  3CPJ G;  5HHF A;  1DOB A;  4H19 A;  2BK4 A;  3C96 A;  4MMW A;  2F5Z A;  4Z25 A;  4EMI A;  1ECQ A;  3ISH A;  4H2Q A;  3QFB A;  1CF3 A;  5M0Z A;  2IVE A;  1F8W A;  4CCR A;  4JY2 A;  3CMM A;  2Q0L A;  3V76 A;  3GMC A;  4B68 A;  3CTY A;  4H4S A;  4DN1 A;  3GDN A;  1KNR A;  4J1O A;  3P0W A;  5KOW A;  1KKO A;  3G5Q A;  4JDR A;  1L8P A;  3LOV A;  2GGJ A;  3DG7 A;  2W0H A;  2GAH B;  2PCE A;  4CY6 A;  1PJ7 A;  3O0H A;  5FJO A;  1JRX A;  1SJA A;  3CN8 A;  2OZ8 A;  2B7R A;  3SZF A;  3G5R A;  1F8R A;  3DJE A;  3I6D A;  1DOC A;  3UCD A;  2OO6 A;  1E1N A;  3BHK A;  4OCG A;  3BNM A;  3SZ0 A;  3DJD A;  3UTG A;  1PBD A;  3AEF A;  2QJM A;  3H12 A;  3D47 A;  3QPE A;  2XYO A;  2OZ3 A;  1PBB A;  2WPF A;  3SQS A;  3OP2 A;  1ZOY A;  3CND A;  3CPH G;  4GF7 A;  5J7X A;  3AE4 A;  2FJD A;  2WET A;  3DFY A;  5KVI A;  4H83 A;  1KF6 A;  4HCD A;  1DOE A;  1PDY A;  3I4K A;  3NYE A;  3SXI A;  3KA7 A;  5HY5 A;  4OPU A;  1TDE A;  1RVK A;  2A8X A;  3NG7 X;  5L46 A;  4A3R A;  3HYV A;  3ICT A;  3FG2 P;  1CC6 A;  3DGZ A;  2JAE A;  1MUC A;  2YR4 A;  2QDE A;  1OJT A;  3KLJ A;  4U8L A;  3BI2 A;  4YTP A;  4TM1 A;  1ZOV A;  3NRZ B;  3RIT A;  5JCM A;  2RAB A;  3DER A;  3ZYX A;  4HA6 A;  2XLP A;  3D46 A;  3BI4 A;  4U2S A;  1L0V A;  1OJC A;  3NRN A;  5U1O A;  2JB1 A;  2EQ7 A;  1N4V A;  2QVH A;  2OVL A;  3UJF A;  3SQP A;  3A7R A;  4USR A;  3UKK A;  4RSL A;  2R4J A;  1IUU A;  3TJ4 A;  3ITJ A;  3UJ2 A;  1NDA A;  4MKS A;  5KMS A;  3QKE A;  3R0U A;  4J2W A;  4U8I A;  3BI5 A;  1BKW A;  1QJD A;  4H50 A;  5BOF A;  2VQB A;  1CJ3 A;  5JCI A;  1JEH A;  1W6T A;  1V97 A;  3S5W A;  2AL2 B;  4M0X A;  1P2H A;  1CJ4 A;  3AE9 A;  4OPL A;  3V5F A;  3S61 A;  1XDI A;  1MDR A;  3CGE A;  3ICS A;  1PXC A;  2BC1 A;  4A99 A;  1ZY8 A;  3CK5 A;  4YKG A;  3GC2 A;  2JK6 A;  2PGW A;  1RYI A;  3U9I A;  2HZG A;  1PXB A;  3FBS A;  2X8C A;  1FOH A;  3WE0 A;  3NNE A;  1Q9I A;  2BXR A;  3V4B A;  2VOU A;  1P48 A;  2FYM A;  3AE2 A;  4YSH A;  1PXA A;  3FJ4 A;  2C75 A;  3AE3 A;  4ZA0 A;  4Z44 A;  2C65 A;  1D5T A;  1GRF A;  3EUB 3;  4Z2R A;  2RGO A;  4HNC A;  3NVY B;  3AD9 B;  2Q0K A;  3K7T A;  3Q4D A;  3FYY A;  1GTE A;  5KXJ A;  4LA1 A;  1GT8 A;  2OAL A;  3D1C A;  1K0L A;  1NHR A;  4H2N A;  4K1W A;  2OKT A;  4IL2 A;  2BS4 A;  3VA8 A;  3TTE A;  3UP4 A;  5FS6 A;  4UDP A;  2FKP A;  4MGG A;  1RM6 B;  2O56 A;  2DW7 A;  1ZK7 A;  3ALJ A;  3N6J A;  1GSN A;  4TM0 A;  5EB4 A;  3E1T A;  3IWA A;  5EOW A;  1K0J A;  2Q7V A;  3RRA A;  3NLC A;  4U8J A;  4EIP A;  3KU9 A;  4BK3 A;  1S3E A;  4AOS A;  3R0K A;  3LJP A;  4OPC A;  5KMP A;  5KWF A;  1BGN A;  4EWJ A;  3ZLG A;  1FCD A;  1PJ6 A;  2VVL G;  1EC9 A;  3ADA B;  3HW2 A;  3NVW B;  3OZM A;  3C4N A;  1NG4 A;  4Z17 A;  3IC9 A;  4IA5 A;  2ONE A;  4FX9 A;  5CKU A;  1GAL A;  3QLD A;  2Q6U A;  3BSM A;  2BCG G;  3ATQ A;  1GRH A;  2WDQ A;  4ENL A;  2VVL A;  4A7A A;  2PTY A;  1WUE A;  2HXU A;  3SM8 A;  4TLZ A;  1BQG A;  4ADW A;  3DK8 A;  1JCT A;  4H2R A;  3UCL A;  2VRM A;  1O5W A;  3EF6 A;  3SR6 B;  3IHM A;  2XFO A;  1IJH A;  3UOV A;  4NTE A;  1PJ5 A;  4KPL A;  3K7Q X;  2OA1 A;  1R6W A;  1P2E A;  3DK9 A;  4DGK A;  4GDE A;  1ZMD A;  1D4C A;  2WOI A;  1QLB A;  3R10 A;  2XLS A;  2AKM A;  4TM3 A;  1GRA A;  3A7U A;  4OPI A;  4EMJ A;  3DME A;  5J60 A;  1IUT A;  3ALM A;  2YG7 A;  4U8N A;  5HXI A;  3Q9T A;  4Y4L A;  2MNR A;  1VQZ A;  4JY3 A;  3T6C A;  3V3N A;  3NYF A;  2WOV A;  2ZC8 A;  1YQ4 A;  2CHR A;  2YLR A;  3NO1 A;  3PG6 A;  2BAC A;  2PA6 A;  3CNP A;  3KUM A;  2BYB A;  1JPM A;  5KVH A;  3P3B A; 
#chains in the Genus database with same CATH homology
 4B1B A;  5EBK A;  3G5Q A;  3P4Q A;  4K5R A;  5C3J A;  1EL7 A;  1X31 B;  4C3Y A;  1KDG A;  4JDR A;  3KVE A;  4JN9 A;  1VDC A;  3LOV A;  4A6N B;  2YVG A;  3RNM A;  4B69 A;  1PHH A;  3BHF A;  1GER A;  4BUR A;  1NEN A;  2ZBW A;  4U8M A;  4AP1 A;  1DJQ A;  3GWD A;  4CCQ A;  4DNA A;  2VQ7 A;  2W0H A;  2GAH B;  1ZDL A;  3P4S A;  4K5S A;  3P9U A;  2WOW A;  1PJ7 A;  2DKI A;  4CY6 A;  3O0H A;  1JRX A;  2C67 A;  4J34 A;  1JU2 A;  1NEK A;  3CN8 A;  5FS8 A;  3SY4 A;  1LPF A;  1CHU A;  4G9K A;  4BK2 A;  2B7R A;  1NHP A;  3GYJ A;  2R0C A;  4EQS A;  3SZF A;  4H4W A;  3QSE A;  3I3L A;  3G5R A;  5FS7 A;  2X3N A;  3QSS A;  4A79 A;  4K7Z A;  4Y4M A;  3LB8 A;  1L9E A;  3LZW A;  1UKV G;  2GMJ A;  1F8R A;  2EQ8 A;  4YSZ A;  1S2Y A;  4AP3 A;  3DJE A;  3SZC A;  3I6D A;  2BAB A;  1DOC A;  2JKC A;  3K7M X;  3P4R A;  3SX6 A;  2V60 A;  2C3D A;  2WES A;  2YG4 A;  1OJD A;  1XPQ A;  2YG6 A;  3CGC A;  2V3A A;  2GR1 A;  2WDV A;  2XCG A;  4BK1 A;  1E1N A;  3BHK A;  4OCG A;  2YLZ A;  3BNM A;  3SZ0 A;  3DJD A;  1VG9 A;  3UTG A;  3M12 A;  1SEZ A;  2GR3 A;  1PBD A;  2YLT A;  4H2P A;  2GAG B;  1Q1R A;  2Z5Y A;  3RP8 A;  2JBV A;  3AEF A;  1JNR A;  4KX6 A;  2OLN A;  2XYO A;  4B66 A;  2XLT A;  2YLX A;  2C3C A;  2IVD A;  4CBQ A;  3UTE A;  1E6E A;  3CPI G;  2AAQ A;  2CUL A;  1Y56 B;  4D03 A;  3NHO X;  3T2K A;  1CL0 A;  4WCT A;  3AD8 B;  1PBB A;  2BK3 A;  1BZL A;  2BA9 A;  4CNK A;  2V5Z A;  1GRG A;  2WP9 A;  3URH A;  2YQU A;  4E0V A;  2WPF A;  4UP3 A;  2E4G A;  4ZN0 A;  3AD7 B;  2E5V A;  3UKH A;  1ZOY A;  3CND A;  1H7W A;  3UOZ A;  4II2 A;  3GRT A;  3CPH G;  2B9Y A;  3M0O A;  4GF7 A;  5J7X A;  1NHS A;  3AE4 A;  4B67 A;  2FJD A;  2R9Z A;  3COX A;  4O5U A;  2WET A;  4XXG A;  2YG5 A;  5KVI A;  1KF6 A;  2QAE A;  3HYW A;  2XLU A;  4IVM B;  3CIR A;  4GR1 A;  1DOE A;  3UOY A;  3II4 A;  5TR3 A;  4APN A;  1TRB A;  2XVJ A;  3NYE A;  4N9X A;  2C72 A;  3SXI A;  4FK1 C;  3VQR A;  3HZL A;  5JCK A;  3KA7 A;  5HY5 A;  4U2T A;  4OPU A;  1TDE A;  1NHQ A;  3GMB A;  2A8X A;  3NG7 X;  5L46 A;  1B37 A;  3HYV A;  2NPX A;  3ICT A;  3K30 A;  4GCM A;  4NNJ A;  2R4E A;  5BUL A;  2RGH A;  5GSN A;  4NTD A;  1LQT A;  1KSU A;  1F6M A;  1GEU A;  3FG2 P;  1CC6 A;  3DGZ A;  2GEW A;  2JAE A;  1GRT A;  3QVR A;  5JCL A;  3DK4 A;  2BXS A;  4J36 A;  3T14 A;  4DSH A;  1MOK A;  2WU5 A;  3H8L A;  2YR4 A;  1FEB A;  1GND A;  1OJT A;  3KLJ A;  3ATR A;  5BRT A;  3NYC A;  4G74 A;  1NG3 A;  1IUX A;  1E1K A;  2V3B A;  1B4V A;  2FJB A;  1N4U A;  2BRA A;  4U8L A;  3AEB A;  3BI2 A;  5JRB A;  3SFE A;  4YTP A;  4TM1 A;  1Y0P A;  4PAB A;  2R0G A;  4G73 A;  4Z2U A;  1TDK A;  1QO8 A;  1ZOV A;  3NTA A;  4OPG A;  5JCM A;  2C7G A;  4CRT A;  1D7Y A;  2RAB A;  2FJE A;  2GB0 A;  5IQ4 A;  3L8K A;  3ZYX A;  4HA6 A;  1EL5 A;  1OJ9 A;  1DXL A;  4EQW A;  2XLP A;  3CGD A;  1LV0 A;  3F8D A;  1D4D A;  1K0I A;  3BI4 A;  2HQM A;  4EQR A;  1CJ2 A;  1ZX9 A;  2GF3 A;  4U2S A;  1L0V A;  3RP6 A;  1OJC A;  4H4P A;  1MO9 A;  5U1O A;  2JB1 A;  3NRN A;  2PHH A;  1NPX A;  2EQ7 A;  2XVI A;  4TLX A;  2XFN A;  1B8S A;  1N4V A;  4NZH A;  2XFQ A;  3UP5 A;  2OAM A;  2WU2 A;  3AYJ A;  4B64 A;  3NT6 A;  3PS9 A;  3SQP A;  3NTD A;  1S7M A;  5U25 A;  4USR A;  4RSL A;  2WBA A;  3NK0 X;  3UKK A;  2GR0 A;  2R4J A;  2TMD A;  3HYX A;  4G6G A;  4GDP A;  1IUU A;  2ZZB A;  2Z5X A;  3CNJ A;  1L9D A;  3ITJ A;  3DH9 A;  1PBF A;  2H89 A;  4JNA A;  3NIX A;  3T37 A;  1NDA A;  4IA6 A;  1LVL A;  3EPT A;  4X9N A;  5KMS A;  4OPT A;  3V3O A;  5KMR A;  3P1W A;  5KNL A;  4J2W A;  1GTH A;  2C66 A;  3ALL A;  4U8I A;  4H4U A;  3BI5 A;  2ACZ A;  1BKW A;  3GD4 A;  2NVK X;  1MXT A;  2FJA A;  1GOS A;  1QJD A;  5CQF A;  1H82 A;  4H50 A;  2VQB A;  1CJ3 A;  3IF9 A;  1PBC A;  5JCI A;  1V59 A;  2XFP A;  1E39 A;  2CVJ A;  1JEH A;  4Z2T A;  4UDR A;  3UTH A;  3S5W A;  3AXB A;  1W4X A;  4B63 A;  3GYX A;  2R45 A;  4II3 A;  1FEC A;  1P2H A;  1FEA A;  4GAV A;  5BVA A;  1TDO A;  1K4Q A;  1H7X A;  3KPF A;  1KN0 A;  3GD3 A;  2JB2 A;  1CJ4 A;  1KFY A;  4X4J A;  1L9C A;  3AE9 A;  1GRB A;  2B76 A;  5KMQ A;  1REO A;  3AE6 A;  5FS9 A;  4OPL A;  3R9U A;  1TDF A;  1VG0 A;  3S61 A;  2YVF A;  1XDI A;  3EAN A;  3CGE A;  1YKJ A;  3ICS A;  4GRT A;  1ZMC A;  1VQW A;  3NN0 X;  1PXC A;  2BC1 A;  3GYI A;  1EL9 A;  2VRL A;  4A99 A;  1ZY8 A;  3LZX A;  4YKG A;  4U2L A;  2GVC A;  2JK6 A;  1HYU A;  1GPE A;  1RYI A;  3SZW A;  1LQU A;  4C77 A;  1LTX R;  2GMH A;  4O5Q A;  3KKJ A;  3OZ2 A;  4H4X A;  3UKP A;  1BGJ A;  3NGC X;  1O94 A;  4Z24 A;  4LII A;  1E1L A;  2X8G A;  1PXB A;  4K22 A;  3UTF A;  3AYI A;  1CBO A;  1N4W A;  3FBS A;  4BJY A;  2FBW A;  4AOX A;  1M64 A;  2X8C A;  2E1M A;  2WHD A;  1FOH A;  3WE0 A;  1OJA A;  2RGJ A;  4P9S A;  2AQJ A;  2PYX A;  3NNE A;  2GQF A;  3UKL A;  1Q9I A;  2BXR A;  2VOU A;  5IQ1 A;  3T31 A;  2A89 A;  2B7S A;  4C5O A;  4EMW A;  5KOX A;  3AYL A;  2Y6Q A;  2VVM A;  2XVF A;  2J3N A;  1TDN A;  1Z6L A;  2V61 A;  3AE2 A;  5M10 A;  4YSH A;  2WQY A;  3ICR A;  2WS3 A;  5FMH A;  4C74 A;  1E1M A;  3FPZ A;  1ELI A;  3G5S A;  4YT0 A;  1PXA A;  2C75 A;  3AE3 A;  4J31 A;  1S3B A;  2DKH A;  3AB1 A;  1N1P A;  2JB3 A;  1D4E A;  4Z44 A;  4OPD A;  2C65 A;  1D5T A;  3SGL A;  4Y4N A;  1DOD A;  4H7U A;  1GRF A;  2UZZ A;  4H4Q A;  4Z2R A;  2QA1 A;  2RGO A;  3B6D A;  5JCN A;  4XWZ A;  4I58 A;  2WEU A;  1H2I A;  4U8O A;  4OVI A;  3AD9 B;  4IVO B;  4YSY A;  2Q0K A;  3H8I A;  2IID A;  3K7T A;  2YM2 A;  4RG3 A;  5DBJ A;  4LU6 A;  4JQ9 A;  2BC0 A;  4RG4 A;  4WX1 A;  3B3R A;  1KNP A;  1H86 A;  2O9Z A;  2BCP A;  4JNQ A;  3AE5 A;  3T2Y A;  2Y6R A;  4EM4 A;  1GV4 A;  1GTE A;  5IPY A;  2ZZC A;  5KXJ A;  2XDO A;  4NWZ A;  4YTN A;  3AE1 A;  4LA1 A;  1GT8 A;  3AEA A;  1JRZ A;  2OAL A;  3D1C A;  1H83 A;  1K0L A;  1NHR A;  4H2N A;  2CFY A;  3ZDN A;  4EIQ A;  1F3P A;  3D9X A;  3EAO A;  2BS4 A;  1M6I A;  1CC4 A;  1PS9 A;  2QCU A;  5BUK A;  3AED A;  4A9W A;  3UP4 A;  5FS6 A;  4UDP A;  1LJ1 A;  4ECH A;  3M13 A;  1PN0 A;  3GDP A;  2BRY A;  2C4C A;  2WDR A;  2YM1 A;  3L5O A;  3DJG X;  1ZK7 A;  4H4Z A;  1RP0 A;  3ALJ A;  4BJZ A;  1GSN A;  3CNS A;  3F8P A;  2WP5 A;  1CC2 A;  3JSK A;  4TM0 A;  2YLS A;  2XLR A;  5EB4 A;  4YWO A;  3CNT A;  3VR9 A;  3NK1 X;  5EB5 A;  4X9M A;  3E1T A;  3IWA A;  1H81 A;  3VRA A;  5EOW A;  1K0J A;  2WPC A;  1H6V A;  1JOA A;  2WP6 A;  4H4V A;  2X50 A;  2Q7V A;  1KSS A;  4J56 A;  2YR5 A;  1DJN A;  3NLC A;  4U8J A;  4EIP A;  1IUV A;  1ONF A;  3KU9 A;  3QVP A;  4BK3 A;  1S3E A;  2C70 A;  3C4A A;  2VZ2 A;  3UKQ A;  4REK A;  2GR2 A;  1VRQ B;  1YY5 A;  3AEE A;  1EBD A;  3DJJ A;  3RP7 A;  2BS2 A;  3LXD A;  2GV8 A;  2R46 A;  4AOS A;  1FL2 A;  4K8D A;  1Q1W A;  3CGB A;  3AE7 A;  3RED A;  2BK5 A;  3LJP A;  4YTM A;  4OPC A;  3VRD B;  3RHA A;  5HYM A;  5KMP A;  3FIM B;  5KWF A;  2GH5 A;  4G6H A;  1BGN A;  4YKF A;  3QFA A;  4ZCD A;  1FCD A;  4TM4 A;  2R0P A;  1PJ6 A;  4U8P A;  1COY A;  2VVL G;  3PVC A;  3ADA B;  1JRY A;  4ICY A;  2C73 A;  3Q6J A;  3DA1 A;  3SYI A;  2B9W A;  4EQX A;  3C4N A;  1NG4 A;  2H88 A;  3IC9 A;  4IA5 A;  4A6N A;  1GXF A;  4FX9 A;  1AOG A;  5CKU A;  1GAL A;  2YG3 A;  3AE8 A;  3SFD A;  2WPE A;  3ABV A;  4U8K A;  2X8H A;  2Q6U A;  3T0K A;  4FK1 A;  4A65 A;  4M52 A;  4B65 A;  2BCG G;  4GAP A;  4USQ A;  3ATQ A;  2XVE A;  3NN6 X;  1TYT A;  4YXD A;  1GRH A;  2BS3 A;  4D04 A;  1ZKQ A;  2WDQ A;  4H4T A;  2VVL A;  1IUW A;  1F8S A;  4A7A A;  1E7P A;  3AWI A;  3T2Z A;  4I59 A;  1JNZ A;  3OC4 A;  2TPR A;  3H4K A;  3SM8 A;  5ER0 A;  2YR6 A;  2ARD A;  3DGH A;  3AEC A;  4TLZ A;  4ZCC A;  1DNC A;  4ADW A;  1CJC A;  3DK8 A;  4J33 A;  1GET A;  5LV9 A;  2C64 A;  3F8R A;  4NEV A;  1RSG A;  3QSM A;  2GQW A;  2YVJ A;  4H2R A;  4MJW A;  2VRM A;  1YQZ A;  2A87 A;  3UCL A;  1O5W A;  4XWR A;  3EF6 A;  4NEW A;  4KPR A;  1H84 A;  3IHM A;  3KD9 A;  4HB9 A;  2I0Z A;  1XHC A;  2XFO A;  1IJH A;  3NH3 X;  4Z43 A;  3UOV A;  4NTE A;  1PJ5 A;  4J57 A;  3NK2 X;  2GRT A;  3QJ4 A;  2AR8 A;  4IV9 A;  3K7Q X;  2OA1 A;  1ZP0 A;  1P2E A;  4BV6 A;  3DK9 A;  1PBE A;  4AT2 A;  2QA2 A;  2YWL A;  4DGK A;  5KRQ A;  4GDE A;  1NAA A;  1ZMD A;  2ZZ0 A;  3BNU A;  1D4C A;  5C2T A;  3VRB A;  2WOI A;  1IUS A;  1O95 A;  2CDU A;  1QLB A;  4CNJ A;  1GES A;  1B5Q A;  2XLS A;  1D7L A;  2YAU A;  5U63 A;  2APG A;  2OLO A;  4TM3 A;  1XAN A;  3FMW A;  3UOX A;  4C3X A;  1EL8 A;  1GRA A;  1Y56 A;  3GWF A;  3CPJ G;  5HHF A;  4Z26 A;  4OPI A;  1DOB A;  4EMJ A;  1YQ3 A;  3D8X A;  2BK4 A;  3C96 A;  4DSG A;  3DME A;  2F5Z A;  4PAA A;  4UDQ A;  5J60 A;  1IUT A;  3AEG A;  4Z25 A;  4H4Y A;  1BF3 A;  3GSI A;  3IHG A;  3ALM A;  2YG7 A;  4EMI A;  4U8N A;  3ISH A;  4A5L A;  4K2X A;  4YSX A;  3Q9T A;  1TYP A;  4H2Q A;  5HXI A;  4Y4L A;  3UKA A;  4FDC B;  2YLW A;  3QFB A;  2B9X A;  3UKF A;  4JY3 A;  1S2Q A;  2V6O A;  1CF3 A;  5M0Z A;  2IVE A;  2C76 A;  1F8W A;  4CCR A;  3V3N A;  4H4R A;  4JY2 A;  3CMM A;  2EQ6 A;  3NYF A;  4AT0 A;  2EQ9 A;  2WOV A;  3PO7 A;  4EM3 A;  1YQ4 A;  2X99 A;  3L1R A;  4NTC A;  2Q0L A;  3LAD A;  2YLR A;  1PDH A;  3V76 A;  3NKS A;  3GMC A;  5GRT A;  4B68 A;  3PG6 A;  2BAC A;  3CTY A;  4H4S A;  3VR8 A;  4CY8 A;  3GDN A;  1BWC A;  3CNP A;  1KNR A;  3P4P A;  2XVH A;  2BYB A;  1GRE A;  3KPK A;  4GUV A;  3GRS A;  5KVH A;  2XFU A;  5KOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...