4J57A

Structure of plasmodium falciparum thioredoxin reductase-thioredoxin complex
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
499
structure length
483
Chain Sequence
HTYDYDYVVIGGGPGGMASAKEAAAHGARVLLFDYVKPSSQGTKWGIGGTCVNVGCVPKKLMHYAGHMGSIFKLDSKAYGWKFDNLKHDWKKLVTTVQSHIRSLNFSYMTGLRSSKVKYINGLAKLKDKNTVSYYLKGDLSKEETVTGKYILIATGCRPHIPDDVEGAKELSITSDDIFSLKKDPGKTLVVGASYVALECSGFLNSLGYDVTVAVRSIVLRGFDQQCAVKVKLYMEEQGVMFKNGILPKKLTKMDDKILVEFSDKTSELYDTVLYAIGRKGDIDGLNLESLNMNVNKSNNKIIADHLSCTNIPSIFAVGDVAENVPELAPVAIKAGEILARRLFKDSDEIMDYSYIPTSIYTPIEYGACGYSEEKAYELYGKSNVEVFLQEFNNLEISAVHRSTCLAKLVCLKNEDNRVIGFHYVGPNAGEVTQGMALALRLKVKKKDFDNCIGIHPTDAESFMNLFVTISSGLSYAAKGGCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Plasmodium falciparum Thioredoxin Reductase-Thioredoxin Complex.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase 2
total genus 155
structure length 483
sequence length 499
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF00890 FAD_binding_2 FAD binding domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4j57A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4j57A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4j57A02
2YM1A 1TDOA 2A8XA 2BABA 1PBDA 3NN0X 4BK1A 4EMJA 4JY3A 2YG5A 4CNJA 3UOZA 2IVEA 3D8XA 3E1TA 4P9SA 4U8NA 2X8HA 1CC4A 4H4PA 2DKIA 1B4VA 3NYEA 1M64A 1YQ4A 2R0CA 1NENA 1N4UA 4BJZA 4XWZA 1QO8A 4K8DA 1X31B 3AXBA 3G5SA 3P4SA 3UOVA 3LXDA 1GNDA 1K0JA 1GETA 2WDQA 1YKJA 2VZ2A 3NKSA 4YT0A 4C3YA 5KXJA 3CNPA 1ZMCA 3OC4A 3QSMA 5HXIA 3QVRA 1DOCA 3BI4A 1LTXR 4ZCCA 4TM0A 4B65A 3KU9A 2WP6A 3GD3A 2XVEA 3BI5A 1XPQA 4J56A 2B9XA 1L0VA 3SGLA 1K0LA 2FJAA 4K5SA 3S5WA 4B68A 1KDGA 4JY2A 1HYUA 4FX9A 1BKWA 2EQ8A 4GDPA 3Q6JA 1LQTA 5KVHA 1OJ9A 1LJ1A 4C5OA 4EMWA 3ISHA 4IA6A 1IUWA 4YSHA 3EANA 1LPFA 3NN6X 3FG2P 4Z26A 1GT8A 3GDPA 4JDRA 5JCIA 2VVMA 2YLXA 3QVPA 3CPHG 4J2WA 2AQJA 2VRLA 4Z25A 1S2YA 2WP5A 1D7LA 4PAAA 1ZK7A 4YWOA 4U2LA 1NHRA 4DSGA 3ZDNA 3NK0X 3M12A 5M0ZA 4A9WA 4ZN0A 2V3BA 2YG7A 3UP4A 2GR2A 2F5ZA 4IV9A 1MOKA 2JK6A 1PBCA 1PBEA 1LVLA 2QA2A 4OCGA 4ZCDA 2GAGB 4J36A 3CNDA 4JQ9A 4NEWA 3VQRA 2WOVA 4PABA 2XFUA 4OPLA 1BGJA 4YTNA 3V76A 5BVAA 1MXTA 1OJCA 2E1MA 3IHGA 3DK4A 3IWAA 4U8IA 4H4WA 3AYIA 2CDUA 3B3RA 3RNMA 4AOSA 5U63A 5ER0A 3S61A 2C7GA 3VRAA 3UOYA 2C76A 3G5RA 4D03A 3C4AA 3LZWA 3DH9A 1E1MA 2R45A 4DGKA 1VG0A 4FK1A 3WE0A 4K5RA 5EB5A 1H7XA 1Y56B 2Y6RA 1FEBA 5J7XA 1B8SA 3L1RA 4NEVA 1CJ4A 1GPEA 1IJHA 3EAOA 5JCKA 1NAAA 4UDPA 4NTDA 5IQ4A 3NTDA 1XDIA 2YAUA 1PHHA 1JU2A 3DMEA 2BACA 2O9ZA 3RP8A 3UTFA 3VR8A 2X50A 5BRTA 3GMCA 1YQ3A 4MJWA 3RHAA 3SFEA 3K7QX 3NNEA 1D4DA 2R0GA 2YLSA 3DJJA 2BS2A 2Q0KA 5IQ1A 2WPEA 1W4XA 1GRTA 1YY5A 4JN9A 1GRGA 4RSLA 4UDQA 3EPTA 2GMJA 4Y4MA 3GSIA 2HQMA 3NTAA 3ABVA 2VRMA 3RP6A 1GRBA 2BCGG 3DGZA 2AAQA 4A7AA 3RP7A 4Z2UA 3D1CA 1RYIA 1Y0PA 3AD9B 4YTMA 3GRTA 4EQSA 5FMHA 5KVIA 3AEAA 3ICSA 3GD4A 4UDRA 4CCQA 3ALJA 3COXA 3ALMA 1AOGA 3BHKA 3UKPA 3DK8A 3AEGA 1ZKQA 1TDFA 2C75A 1P2EA 2J3NA 4YXDA 2XLRA 2FJDA 5HHFA 2GMHA 3ZYXA 4WCTA 4GDEA 3GDNA 4Z43A 3AEBA 1L9CA 2GAHB 1PBFA 2VQBA 3AYLA 2WPFA 2WESA 1TDKA 3GYIA 4BK2A 4Z2TA 1LV0A 2ZZCA 3BNUA 2E5VA 1D4CA 4TLZA 1GTEA 2C67A 1RP0A 3B6DA 4A6NA 2RGOA 4U2SA 3LJPA 4U8PA 3UTHA 4B1BA 1NPXA 4H4SA 3ITJA 3H8IA 3NLCA 4H2RA 2BC0A 2JB1A 1E6EA 4YSZA 2WOWA 1GREA 2OA1A 1GALA 1F6MA 4AT2A 1JEHA 1GV4A 2TPRA 4Y4NA 3K30A 3ATQA 3UTEA 4YSXA 3CPJG 1VRQB 2XLSA 1D7YA 2BC1A 1NG4A 1Y56A 2Z5YA 3UKAA 2VOUA 3M13A 3UKFA 1KNPA 1S3EA 1TDNA 3EF6A 2PHHA 2XLTA 2YLRA 5M10A 3P4RA 4U8OA 2QCUA 2R0PA 1M6IA 3NK2X 3GWDA 4HA6A 4TM3A 4D04A 1KSSA 3NK1X 4WX1A 4OPIA 2YQUA 2C65A 4C3XA 1H83A 3NIXA 5IPYA 4IA5A 1GXFA 2GH5A 2FJEA 2OAMA 2WDVA 1GRHA 1E1LA 2JBVA 4I58A 1SEZA 5C3JA 1NHPA 5J60A 4GCMA 2B9WA 1CF3A 2H88A 1EL7A 3JSKA 4CY8A 2EQ9A 2GRTA 2Q6UA 4YSYA 4E0VA 2YM2A 2ARDA 4FDCB 3VRBA 5TR3A 2I0ZA 3FIMB 3KA7A 2C73A 1FECA 4Y4LA 4J33A 5GRTA 2QAEA 2BK4A 4XXGA 1IUSA 2YLTA 3CIRA 2WDRA 3CNJA 2X8GA 3QFBA 2R46A 1RSGA 1TDEA 1GTHA 4EM3A 3LZXA 1FEAA 1H7WA 5EB4A 2GV8A 3I3LA 2FJBA 2R4EA 2XLUA 3CGEA 2RGJA 4X9NA 1PJ5A 1B5QA 5JCNA 4IVOB 3AE7A 4CCRA 1K4QA 1KSUA 3UTGA 4TM1A 2XVHA 1D5TA 4H2QA 3C4NA 3URHA 3KVEA 3F8DA 1PXAA 4AOXA 1PJ7A 2YWLA 3NGCX 1BF3A 3GYJA 3OZ2A 4U8JA 4EIQA 5KOWA 1Q1RA 1D4EA 4APNA 2B7SA 1DOEA 1OJDA 1EL9A 2QA1A 1VDCA 3AEEA 4BV6A 2WP9A 4H7UA 3H8LA 2X99A 1PN0A 2XVJA 1CJ3A 2BK3A 3CGCA 4YTPA 2Q0LA 4H50A 1DNCA 3AE3A 1OJAA 4CNKA 1JNZA 3FMWA 3DJGX 1CC2A 1Q1WA 3KLJA 4KPRA 4B69A 2GR3A 3LOVA 4X9MA 3UKQA 3GRSA 4M52A 4EQRA 1FCDA 1H86A 1JNRA 4RG3A 1O94A 3V3NA 2R4JA 2YVFA 2JB2A 1CHUA 3L8KA 2C3DA 4H4UA 4OPCA 1PBBA 3O0HA 1S3BA 4B63A 1MO9A 4H2NA 1JOAA 2XCGA 2BA9A 3G5QA 2GB0A 2X3NA 2Y6QA 1BGNA 1N4WA 2WS3A 1GOSA 3KKJA 5KOXA 5LV9A 1KFYA 3FPZA 4OVIA 1H84A 4AP1A 2GEWA 1GSNA 4ADWA 4CRTA 2V61A 1E1KA 4USQA 3DJEA 1P2HA 2YG3A 3C96A 1IUUA 2XYOA 1KNRA 3P4PA 2YLZA 2R9ZA 5CQFA 3P1WA 4ECHA 1GEUA 1F8WA 4H2PA 3VRDB 4EM4A 3ADAB 4RG4A 5FS9A 2W0HA 3AEFA 4ICYA 4IVMB 3KD9A 4BURA 3REDA 3AYJA 3VR9A 2V5ZA 2WBAA 4YKGA 1VQWA 3K7TA 5BULA 4TM4A 3H4KA 4EMIA 4O5UA 2YLWA 1ZMDA 1F8RA 3AEDA 1KF6A 1H81A 1OJTA 1PXBA 2FBWA 1Z6LA 4C74A 5JCLA 2X8CA 3ALLA 1F8SA 1F3PA 4N9XA 2IVDA 1IUXA 3I6DA 1K0IA 5GSNA 4CY6A 5KRQA 2WU2A 3PO7A 2B76A 4KX6A 3IHMA 2GQWA 3IF9A 2WU5A 1TYTA 4FK1C 1ELIA 5C2TA 3SQPA 4J57A 1ZP0A 1FL2A 4B66A 3CNSA 2NVKX 2XFPA 4U8MA 5BUKA 3UOXA 2WPCA 1LQUA 4A5LA 2VVLG 3ATRA 1PJ6A 3ICTA 2C64A 2WHDA 1BWCA 5FS8A 4Z24A 3BI2A 5FS7A 4X4JA 4B64A 1EL5A 1CC6A 3UKKA 1ZDLA 2NPXA 3FBSA 3AE2A 3F8RA 2VVLA 1L9EA 2CVJA 2DKHA 3KPFA 4J31A 4LIIA 1ZY8A 1DXLA 2VQ7A 1CJCA 1EL8A 1Q9IA 3NRNA 2YR4A 1O5WA 2ZZ0A 5EBKA 4GUVA 3GWFA 1S2QA 3Q9TA 4GF7A 2JB3A 3UCLA 1XANA 3M0OA 4K7ZA 3QJ4A 3UKHA 2YVJA 1E7PA 2BS4A 1E39A 1COYA 1PDHA 2RABA 2WETA 2C3CA 2GR0A 1L9DA 2OLOA 1NHSA 5FS6A 1IUVA 2XFQA 2C66A 2AR8A 1BZLA 2UZZA 2RGHA 1PXCA 4H4XA 1ZOVA 3PS9A 3DJDA 1JRYA 4LA1A 2OLNA 4U8LA 4TLXA 3LADA 1REOA 3V3OA 1VG9A 1GRFA 4OPTA 1GRAA 5HYMA 3II4A 1DJQA 3F8PA 3GMBA 3AE4A 2GQFA 4AT0A 3DGHA 4XWRA 4H4QA 4UP3A 4C77A 2CULA 1H6VA 1QLBA 3CPIG 4K22A 4OPGA 2BYBA 2E4GA 3HZLA 3P9UA 1GERA 1ONFA 4JNAA 2XVIA 2TMDA 4H4TA 1E1NA 2V60A 4GRTA 4J34A 4OPUA 3R9UA 3NH3X 2BXRA 4NTCA 1GESA 3AE8A 3PVCA 3AE5A 4A6NB 2V3AA 1IUTA 4BK3A 1TYPA 3CGBA 4H4VA 2XLPA 2IIDA 2GF3A 2YVGA 4O5QA 3AECA 2ACZA 2B7RA 2JAEA 4Z2RA 2WQYA 2XVFA 4A79A 4H4ZA 1JRXA 2Q7VA 2CFYA 5CKUA 2YG4A 2C70A 3CNTA 5EOWA 2GVCA 3K7MX 2A89A 1ZX9A 2A87A 2BXSA 1DODA 4EIPA 3BHFA 2BK5A 3AD7B 3IC9A 2C72A 5HY5A 4A99A 1QJDA 3SFDA 3T37A 1H82A 1NHQA 4B67A 4NZHA 3DA1A 5U1OA 1PS9A 2BS3A 3QSSA 3NHOX 5U25A 1O95A 2JKCA 2YR6A 4HB9A 2V6OA 1CL0A 2XDOA 3AD8B 3AE1A 3NT6A 3NYFA 3SM8A 3AE6A 1FOHA 4U8KA 1NDAA 3NYCA 2ZBWA 4CBQA 3CN8A 1EBDA 5KWFA 5L46A 3DK9A 2XFOA 2Z5XA 4AP3A 4USRA 4LU6A 3UKLA 4H4YA 4H4RA 4Z44A 2EQ7A 1NEKA 4EQXA 3BNMA 3NG7X 4NTEA 1UKVG 3AWIA 4GR1A 1XHCA 2OALA 3CGDA 2B9YA 5DBJA 2XFNA 2ZZBA 1CJ2A 4DSHA 5JCMA 2GR1A 2WOIA 1N4VA 3CTYA 3QSEA 2APGA 1JRZA 1ZOYA 1YQZA 3AB1A 4JNQA 2EQ6A 2PYXA 3QFAA 4I59A 3LB8A 1NG3A 3P4QA 1DOBA 3UP5A 4REKA 4OPDA 1V59A 1N1PA 4K2XA 2BCPA 1TRBA 3ICRA 4YKFA 2H89A 4A65A 1CBOA 1DJNA 2YG6A 4EQWA 2YR5A 3AE9A 4DNAA 4BJYA 1B37A 4U2TA 2WEUA
chains in the Genus database with same CATH superfamily
2YM1A 4BK1A 4GAVA 4JY3A 2YG5A 3D8XA 1WUFA 4P9SA 2X8HA 2DKIA 2AL2A 3NYEA 3G5SA 1YKJA 2VZ2A 3AMZA 3CNPA 4HCHA 3BI4A 4ZCCA 3KU9A 3BI5A 3CMMA 4K5SA 1BKWA 1KCZA 3ES8A 4E4FA 3RO6A 1GT8A 3DFHA 2YLXA 4J2WA 1PDZA 4Z25A 1ZK7A 4YWOA 1NHRA 3ZDNA 3NK0X 2V3BA 2YG7A 2GR2A 2F5ZA 2JK6A 1JPMA 1LVLA 2GAGB 1NU5A 2XFUA 3NXLA 1BGJA 4YTNA 4GGHA 5G5GB 5BVAA 2E1MA 3DK4A 2CDUA 4GYPC 4IHCA 2C7GA 3VRAA 4TVYA 3UOYA 3G5RA 4D03A 3I6TA 3LZWA 3DH9A 4DGKA 1VG0A 5EB5A 1H7XA 3SX6A 1FEBA 5J7XA 1B8SA 4NEVA 1GPEA 1IJHA 3QTPA 3STPA 5IQ4A 3KUMA 1JU2A 3DMEA 2O9ZA 3VR8A 3NVVB 4MJWA 1D4DA 2R0GA 3DJJA 1MNSA 4UDQA 3NTAA 4ZA0A 4A7AA 3RP7A 3D1CA 4YTMA 3AEAA 3ICSA 4UDRA 2AKMA 3COXA 3UXLA 2C75A 3V4BA 2XLRA 2GMHA 3AEBA 2E5VA 4A6GA 4G73A 1SJBA 1X2GA 3V5CA 1NPXA 4H4SA 3ITJA 3NLCA 4FP1A 3JZUA 2BC0A 3T2ZA 1GALA 2GDQA 4Y4NA 3DIPA 3NVYB 1D7YA 2Z5YA 2VOUA 3M13A 1KNPA 1TDNA 2PHHA 4U8OA 1ZXIC 2QCUA 2R0PA 2DW6A 4TM3A 1KSSA 1JPDX 3NK1X 3CAWA 2C65A 3NIXA 2FJEA 2CHRA 3TTEA 1NHPA 4FDCB 4MKSA 3EKGA 2I0ZA 3FIMB 2C73A 4Y4LA 2QAEA 2BK4A 2YLTA 3SZWA 2WDRA 4EM3A 5EB4A 3I3LA 1PJ5A 4CCRA 3UTGA 2XVHA 4H2QA 3C4NA 2P0IA 2ZADA 4H2HA 3OZ2A 4EIQA 2BRYA 3VCNA 3DFYA 2BK3A 4GAPA 4H50A 3NS1B 3FMWA 1CC2A 3DESA 4J1OA 3UKQA 3T4WA 4RG3A 1O94A 4H4UA 4B63A 1JOAA 2BA9A 1BGNA 2WS3A 5LV9A 1KFYA 2GEWA 1GSNA 1V97A 3DJEA 1IUUA 3P4PA 2R9ZA 3VRDB 1MDLA 4RG4A 3DG7A 3AEFA 4ICYA 3AYJA 2V5ZA 3T31A 5BULA 4ZCWA 3AEDA 2FBWA 1Z6LA 3AN1A 3NZGA 3I6DA 3SN4A 2WU2A 2C4CA 4ROPA 2QJMA 4B66A 1RM6B 4A5LA 2PODA 1S7MA 4X4JA 4B64A 4G9KA 3KPFA 2QJNA 1JRPA 1EL8A 1O5WA 5EBKA 3ZLHA 4GUVA 3UCLA 4K7ZA 2YVJA 1E39A 1F9CA 1L9DA 3T6CA 5IDZA 1NHSA 3CYJA 4K8GA 1IUVA 2XFQA 3QPEA 1ZOVA 3V3OA 3N6HA 5JRBA 4H4QA 3CT2A 3CPIG 3DDMA 3HZLA 2XGZA 2XVIA 3R9UA 3NH3X 4GYPA 1GESA 4KPLA 3DERA 3PVCA 4A6NB 3FV9A 1KKOA 2NQLA 1TYPA 2XLPA 3MWCA 3D46A 2ACZA 3H8AA 2WQYA 2XVFA 4H4ZA 2CFYA 1VQZA 5KMRA 2C70A 2GVCA 4IT1A 5HY5A 4A99A 3TQPA 1KKRA 1E9IA 3AE1A 3AE6A 4CBQA 1EBDA 4H1ZA 3DK9A 2Z5XA 1MDRA 1SJDA 4H4YA 2EQ7A 4NTEA 3NFUA 1UKVG 2BRAA 3SZCA 3CGDA 2XFNA 3CXBA 4DSHA 1ZOYA 4JNQA 3QFAA 3FYYA 3UP5A 1N1PA 2XH2A 1TRBA 3ICRA 4EQWA 3CB3A 2YR5A 3AE9A 2I5QA 4BJYA 2E3TA 3VC6A 1VDVA 3NN0X 3SZ0A 3THUA 4KEMA 3T9PA 4U8NA 4G74A 1NENA 1N4UA 4BJZA 3LXDA 1GNDA 2WDQA 1ONEA 5KXJA 3QSMA 5J04A 2PTZA 1LTXR 1N62C 3GD3A 5FJOA 1N60C 1L0VA 2FYMA 4JHMA 1HYUA 4FX9A 4C5OA 3Q6JA 5KVHA 1LJ1A 4EMWA 4YSHA 4Z26A 3FG2P 1EC9A 2W3SA 3GDPA 3QVPA 3CPHG 3SBFA 2WP5A 4PAAA 1FHVA 3M12A 4ZN0A 3UP4A 1MOKA 5FJPA 1PBEA 3MUCA 4ZCDA 4NEWA 4PABA 4K1WA 1MXTA 1OJCA 3IWAA 3B3RA 3S61A 3GYXA 2C76A 3C4AA 1E1MA 4K5RA 4MMWA 1Y56B 3MY9A 1CJ4A 3SXIA 3A7AA 3RR1A 4NTDA 3NTDA 1XDIA 3SQSA 3RP8A 2X50A 5BRTA 3GMCA 1YQ3A 3SFEA 3B97A 3OPSA 2WPEA 1W4XA 1YY5A 4JN9A 2PSNA 3GSIA 2VRMA 1GRBA 2AAQA 4Z2UA 3AD9B 4EQSA 3JW7A 4HCDA 3BHKA 3UKPA 5HHFA 2FJDA 4DN1A 4GDEA 3GDNA 1L9CA 2GAHB 2VQBA 3AYLA 1LV0A 2ZZCA 1D4CA 2RGOA 4U2SA 3UTHA 2JB1A 1E6EA 3T0KA 2POZA 2OA1A 4AT2A 1F6MA 3NVWB 1JEHA 2TPRA 1R0MA 3K30A 3UTEA 4YSXA 3QLDA 2BC1A 1NG4A 2XLTA 2OVLA 3P4RA 2GSHA 4WX1A 4OPIA 1W6TA 4C3XA 5IPYA 4IA5A 3ZLGA 2GH5A 1E1LA 2W3RA 2GGEA 4KT2A 5J60A 1CF3A 2H88A 1EL7A 4CY8A 2EQ9A 2GRTA 2Q6UA 2YM2A 2ARDA 5TR3A 3KA7A 3DG3A 1FECA 3Q45A 3CIRA 1TDEA 1GTHA 3LZXA 1FEAA 1KN0A 2OZTA 2RGJA 4X9NA 2W54A 3AE7A 1D5TA 3MZNA 3URHA 1H2IA 2YWLA 3GYJA 4U8JA 1FIQB 4APNA 1DOEA 2XH4A 4GISA 2QA1A 2WP9A 4H7UA 1PN0A 2XVJA 3CGCA 4IL2A 1DNCA 3AE3A 1OJAA 1JNZA 3DJGX 1Q1WA 3KLJA 3R11A 3LOVA 4X9MA 3GRSA 1FCDA 1H86A 3UJFA 2C3DA 1PBBA 1S3BA 1KD0A 1MO9A 4G7FA 2X3NA 2Y6QA 1N4WA 1GOSA 5KOXA 3FPZA 4AP1A 1JCTA 3KPKA 4CRTA 2V61A 1KNRA 5CQFA 4E5TA 3T2YA 4ECHA 1GEUA 4H2PA 3IK4A 4EM4A 3ADAB 1ELSA 2W0HA 4IVMB 1VQWA 3K7TA 4IL0A 2PU1A 2YLWA 1F8RA 3U9IA 1H81A 3SR6B 1OJTA 3SN1A 5JCLA 2X8CA 3ALLA 1F3PA 5BOFA 1K0IA 5GSNA 5KRQA 2PP0A 3PO7A 4KX6A 3IHMA 2GQWA 2WU5A 1TYTA 1ELIA 1ZP0A 4U8MA 3UOXA 2WPCA 5FS8A 4Z24A 3T8QA 2PGEA 1EL5A 3UKKA 3R25A 2NPXA 3FBSA 3AE2A 3F8RA 2DKHA 2OLAA 4J31A 4LIIA 1ZY8A 1DXLA 1CJCA 1Q9IA 3NRNA 2YR4A 3TJIA 3OP2A 2ZC8A 3M0OA 2OG9A 3UKHA 4M6UA 2WETA 2PGWA 2C3CA 5FS6A 4G8TA 2AR8A 2RGHA 4H4XA 4LA1A 4TLXA 1VG9A 1GRFA 3II4A 1DJQA 3F8PA 3GMBA 4XWRA 4UP3A 4C77A 1IYXA 4ENLA 2BYBA 3P9UA 2HZGA 1ONFA 2V60A 4GRTA 3PWGA 5ENLA 4NTCA 3ZVHA 3AE5A 3CGBA 2OX4A 2OZ8A 4DX3A 2YVGA 1EC7A 1MRAA 4NWZA 4Z2RA 4A79A 2Q7VA 5CKUA 2YG4A 3CNTA 3BOXA 1ZX9A 3PWIA 2A87A 2RDXA 3DGBA 1DODA 3BHFA 3IC9A 2C72A 3T37A 1H82A 3GY1A 4NZHA 3DA1A 2BS3A 3HYVA 5U25A 3NHOX 2YR6A 2V6OA 1CL0A 3AD8B 3NYFA 3NYCA 5KWFA 4IP4A 3CN8A 5L46A 2QJJA 4AP3A 4H4RA 3PFRA 3R0KA 3RRAA 1CJ2A 2WOIA 1TZZA 1N4VA 3CTYA 2APGA 1JRZA 2PYXA 1BKHA 1DOBA 3MKCA 4OPDA 1V59A 2BCPA 3A7RA 3ETRB 4AT0A 4EWJA 1TDOA 4NNJA 4G6HA 2BABA 1PBDA 2XH7A 3UOZA 2IVEA 2HXUA 3E1TA 3VCCA 1CC4A 1MUCA 3HRDC 1M64A 4K8DA 1X31B 3AXBA 3P4SA 2HXTA 1GETA 3NKSA 1ZMCA 2GL5A 3UJ2A 4B65A 1XPQA 4J56A 2B9XA 3SGLA 2FJAA 3QN3A 5FJRA 3JVAA 3S5WA 1KDGA 1ECQA 4GDPA 1LQTA 4IA6A 4IZGA 3EANA 3H12A 4A3RA 4JDRA 2VVMA 1S2YA 2FKPA 4A9WA 4K2SA 4IV9A 2PU0A 2QA2A 4J36A 3CNDA 4JQ9A 3TOYA 3IHGA 3UCCA 1NELA 4AOSA 2OQHA 5ER0A 3R10A 2R45A 2Y6RA 3D9XA 1NAAA 4UDPA 2YAUA 3UTFA 1TE6A 3RHAA 2QDDA 3NNEA 4A35A 2BS2A 1PDYA 4Y4MA 3RCYA 2BCGG 3R07C 2PMQA 2E5AA 3ALMA 1AOGA 2P8BA 1TDFA 3AEGA 2J3NA 3ZYXA 1PBFA 2OZ3A 2WPFA 4HNCA 4Z2TA 3BNUA 4TLZA 1XPYA 1GTEA 2C67A 1RP0A 3ZVIA 3LJPA 4U8PA 4GFIA 1JROA 2ONEA 1GREA 3TCSA 3CPJG 2MUCA 1VRQB 4JN8A 2XLSA 1Y56A 3UKAA 1P48A 3UKFA 1S3EA 3R0UA 3EF6A 2YLRA 1XS2A 1M6IA 3NK2X 2OPJA 4D04A 3IJLA 2YQUA 4HYRA 3UCDA 2OAMA 2WDVA 1GRHA 4I58A 1FFUC 5C3JA 3H70A 3UXKA 2P3ZA 3TWAA 4GCMA 2GGGA 3JSKA 3P0WA 3GD6A 3OTRA 3I4KA 4YSYA 3VRBA 3K1GA 3V3WA 5GRTA 1IUSA 3CNJA 2R46A 1H7WA 3AM9A 1B5QA 5JCNA 1KSUA 2QQ6A 4TM1A 3EEZA 3N6JA 3T14A 3F8DA 3OZMA 1PXAA 6ENLA 4AOXA 1PJ7A 3NGCX 1BF3A 5KOWA 3S47A 3P3BA 1D4EA 2B7SA 1OJDA 1EL9A 1VDCA 4BV6A 3H8LA 2X99A 3VFCA 2Q0LA 4CNKA 4B69A 4KPRA 2GR3A 3L5OA 3OW1A 1X2HA 2YVFA 2JB2A 1CHUA 3B9JB 3L8KA 4OPCA 4H2NA 3G5QA 2XCGA 2GB0A 2MNRA 3SN0A 3KKJA 3QKEA 5EU9A 4OVIA 1H84A 1E1KA 1P2HA 3C96A 2XYOA 5KNLA 1EBGA 3P1WA 2PA6A 4KWSA 1BQGA 3DEQA 2OQYA 2PP3A 3REDA 3VR9A 2WBAA 1R6WA 4YKGA 4TM4A 3HYWA 3H4KA 1KF6A 1N63C 2OKTA 1F8SA 4N9XA 2IVDA 1IUXA 4HPNA 4IP5A 4CY6A 2B76A 5C2TA 3CNSA 5BUKA 3TJ4A 2VVLG 3ATRA 3ICTA 2C64A 2QDEA 2WHDA 3BI2A 1CC6A 1L9EA 2AKZA 2CVJA 2ZZ0A 3GWFA 2XSXA 1S2QA 4GF7A 1XANA 4X2PA 3CK5A 3QJ4A 4M0XA 1COYA 1SB3B 1PDHA 2RABA 3RITA 1TKKA 3RGTA 2OLOA 2C66A 3I6EA 2UZZA 2P8CA 3DJDA 4U8LA 3LADA 1REOA 2PPGA 4OPTA 5HYMA 2GQFA 4GGBA 2W55A 2CULA 3UGVA 4K22A 4OPGA 2E4GA 2TMDA 4J34A 4E4UA 4E6MA 2PTXA 5FJTA 2BXRA 4GIRA 2V3AA 1IUTA 4BK3A 4H4VA 2IIDA 5G5HB 2GF3A 2B7RA 4JN7A 1JRXA 4HCLA 2BXSA 1WYGA 4EIPA 2BK5A 3AD7B 4TVWA 3SFDA 4B67A 3QSSA 2JKCA 2XDOA 1FOHA 4U8KA 2PTYA 2ZBWA 4FI4A 2XFOA 4II2A 4USRA 1OEPA 4Z44A 1NEKA 3VC5A 3BNMA 1JDFA 3NG7X 3AWIA 3T2KA 1XHCA 5DBJA 2B9YA 5JCMA 2GR1A 4F4RA 1YQZA 3U4FA 4I59A 4J3ZA 4REKA 4A65A 2YG6A 1DJNA 4DNAA 4U2TA 2A8XA 4EMJA 2QVHA 4CNJA 1N5XA 1SJAA 4H4PA 1B4VA 3HPFA 1YQ4A 2R0CA 4XWZA 1QO8A 3UJEA 3UOVA 1K0JA 4YT0A 4C3YA 2GGIA 3OC4A 5HXIA 3QVRA 1DOCA 3ZVHB 4TM0A 2WP6A 2XVEA 1N61C 1K0LA 4B68A 4JY2A 3SJNA 2EQ8A 1OJ9A 3ISHA 1IUWA 1LPFA 3NN6X 2GGHA 2DW7A 5JCIA 3HW2A 2AQJA 2VRLA 1D7LA 4U2LA 4DSGA 5M0ZA 3N4EA 1PBCA 4OCGA 3VQRA 2WOVA 4OPLA 3H7VA 3V76A 3MQTA 4U8IA 4H4WA 5BOEA 3AYIA 3RNMA 5U63A 4DWDA 4FK1A 3WE0A 3VDGA 2PCEA 3L1RA 3EAOA 5JCKA 1PHHA 2BACA 3K7QX 2YLSA 3IJIA 2Q0KA 5IQ1A 7ENLA 1GRTA 4MGGA 1GRGA 4DHGA 4RSLA 3EPTA 2GMJA 2HQMA 3RP6A 3ABVA 3DGZA 1EC8A 1RYIA 1Y0PA 4II3A 3GRTA 5FMHA 5KVIA 1DTNA 3GD4A 4CCQA 3ALJA 3R1ZA 3DK8A 3SZFA 1ZKQA 1P2EA 4YXDA 3V5FA 2OFJA 4WCTA 4Z43A 3GYIA 2WESA 1TDKA 4BK2A 3B6DA 4A6NA 4B1BA 3H8IA 4H2RA 3IJQA 3UJSA 4YSZA 2WOWA 1L8PA 1GV4A 3ATQA 4YWSA 3TWBA 4GMEA 5M10A 3GWDA 4HA6A 2PS2A 1H83A 1GXFA 2JBVA 1SEZA 3PK7A 2B9WA 5KMPA 4E0VA 2AL1A 3FCPA 3BSMA 4J33A 4HN8A 4XXGA 3FJ4A 1P43A 2X8GA 3QFBA 1RSGA 2GV8A 2FJBA 2R4EA 2XLUA 3CGEA 4IVOB 1YEYA 1K4QA 2XH0A 1STZA 3KVEA 4E8GA 2PTWA 3SYIA 1Q1RA 1WUEA 3AEEA 3Q4DA 1CJ3A 4YTPA 3NVZB 4M52A 4EQRA 1JNRA 3V3NA 2R4JA 4HNLA 3O0HA 3BJSA 2O56A 4DXKA 4ADWA 3ZLFA 4USQA 2YG3A 2YLZA 3OZYA 3SSZA 3NO1A 1F8WA 5FS9A 3VA8A 1RVKA 3KD9A 4BURA 4Z1YA 3PG6A 4EMIA 4O5UA 1ZMDA 1T3QC 2AL2B 1PXBA 4C74A 4H19A 4ZOHB 5FJUA 2GGJA 3IF9A 4FK1C 1N5WC 3SQPA 4J57A 1FL2A 2NVKX 2XFPA 1LQUA 1PJ6A 2OO6A 3ENLA 1BWCA 2QGYA 5FS7A 1ZDLA 2VVLA 1FFVC 2P88A 2VQ7A 3NRZB 4G6GA 3ES7A 3Q9TA 3S5SA 2JB3A 3FXGA 1E7PA 2BS4A 4DYEA 1EBHA 4Z17A 2GR0A 1BZLA 3DG6A 1PXCA 3PS9A 2HNEA 1FO4A 1JRYA 2OLNA 1GRAA 3GC2A 1SJCA 3AE4A 3DGHA 3FVDA 3D47A 1H6VA 1QLBA 1GERA 4JNAA 4H83A 5KMQA 4H4TA 1E1NA 3HYXA 4OPUA 3P93A 3UJRA 3AE8A 3GO2A 4O5QA 3AECA 2JAEA 3CXOA 5EOWA 3K7MX 2A89A 1FHUA 1QJDA 1NHQA 2PP1A 4HB9A 5U1OA 1PS9A 1O95A 3NT6A 3SM8A 1NDAA 3TW9A 4LU6A 3UKLA 4EQXA 4GR1A 2OALA 2ZZBA 3A7UA 3QSEA 3AB1A 2EQ6A 5KMSA 3LB8A 3SY4A 1NG3A 3P4QA 3EUB3 4K2XA 4YKFA 3N4FA 2H89A 1CBOA 3MSYA 1B37A 2WEUA
chains in the Genus database with same CATH topology
2YM1A 1TDOA 4NNJA 4G6HA 2A8XA 2BABA 1PBDA 3NN0X 3SZ0A 4BK1A 4EMJA 4GAVA 4JY3A 2YG5A 4CNJA 3UOZA 2IVEA 3D8XA 3E1TA 4P9SA 4U8NA 2X8HA 1CC4A 4H4PA 2DKIA 1B4VA 4G74A 4HB9A 3NYEA 1M64A 1YQ4A 2R0CA 1NENA 1N4UA 4BJZA 4XWZA 1QO8A 4K8DA 1X31B 3AXBA 3G5SA 3P4SA 3UOVA 3LXDA 1GNDA 1K0JA 1GETA 2WDQA 1YKJA 2VZ2A 3NKSA 4YT0A 4C3YA 5KXJA 3CNPA 1ZMCA 3OC4A 3QSMA 5HXIA 3QVRA 1DOCA 3BI4A 1LTXR 4ZCCA 4TM0A 4B65A 3KU9A 2WP6A 3GD3A 2XVEA 3BI5A 1XPQA 4J56A 2B9XA 3CMMA 1L0VA 1K0LA 2FJAA 4K5SA 3S5WA 3SGLA 4B68A 1KDGA 4JY2A 1HYUA 4FX9A 1BKWA 2EQ8A 4GDPA 3Q6JA 1LQTA 5KVHA 1OJ9A 1LJ1A 4C5OA 4EMWA 3ISHA 4IA6A 1IUWA 4YSHA 3EANA 1LPFA 3NN6X 3FG2P 4Z26A 1GT8A 3GDPA 4JDRA 5JCIA 2VVMA 2YLXA 3QVPA 3CPHG 4J2WA 2AQJA 2VRLA 4Z25A 1S2YA 2WP5A 1D7LA 4PAAA 1ZK7A 4YWOA 4U2LA 1NHRA 4DSGA 3ZDNA 3NK0X 3M12A 5M0ZA 4A9WA 4ZN0A 2V3BA 2YG7A 3UP4A 2GR2A 2F5ZA 4IV9A 1MOKA 2JK6A 1PBCA 1PBEA 1LVLA 2QA2A 4OCGA 4ZCDA 2GAGB 4J36A 3CNDA 4JQ9A 4NEWA 3VQRA 2WOVA 4PABA 2XFUA 4OPLA 1BGJA 4YTNA 3V76A 5BVAA 1MXTA 1OJCA 2E1MA 3IHGA 3DK4A 3IWAA 4U8IA 4H4WA 3AYIA 2CDUA 3B3RA 3RNMA 4AOSA 5U63A 5ER0A 3S61A 2C7GA 3VRAA 3UOYA 3GYXA 2C76A 3G5RA 4D03A 3C4AA 3LZWA 3DH9A 1E1MA 2R45A 4DGKA 1VG0A 4FK1A 3WE0A 4K5RA 5EB5A 1H7XA 1Y56B 2Y6RA 1FEBA 5J7XA 3SX6A 1B8SA 3L1RA 4NEVA 3D9XA 1CJ4A 1GPEA 3SXIA 1IJHA 3EAOA 5JCKA 1NAAA 4UDPA 4NTDA 5IQ4A 3NTDA 1XDIA 2YAUA 1PHHA 1JU2A 3DMEA 2BACA 2O9ZA 3RP8A 3UTFA 3VR8A 2X50A 5BRTA 3GMCA 1YQ3A 4MJWA 3RHAA 3SFEA 3K7QX 3NNEA 1D4DA 2R0GA 2YLSA 3DJJA 2BS2A 2Q0KA 5IQ1A 2WPEA 1W4XA 1GRTA 1YY5A 4JN9A 1GRGA 4RSLA 4UDQA 3EPTA 2GMJA 4Y4MA 3GSIA 2HQMA 3NTAA 3ABVA 2VRMA 3RP6A 1GRBA 2BCGG 3DGZA 2AAQA 4A7AA 3RP7A 4Z2UA 3D1CA 1RYIA 1Y0PA 3AD9B 4II3A 4YTMA 3GRTA 4EQSA 5FMHA 5KVIA 3AEAA 3ICSA 3GD4A 4UDRA 4CCQA 3ALJA 3COXA 3ALMA 1AOGA 3BHKA 3UKPA 3DK8A 3AEGA 1ZKQA 1TDFA 3SZFA 2C75A 1P2EA 2J3NA 4YXDA 2XLRA 2FJDA 5HHFA 2GMHA 3ZYXA 4WCTA 4GDEA 3GDNA 4Z43A 3AEBA 1L9CA 2GAHB 1PBFA 2VQBA 3AYLA 2WPFA 2WESA 1TDKA 3GYIA 4BK2A 4Z2TA 1LV0A 2ZZCA 3BNUA 2E5VA 1D4CA 4TLZA 1GTEA 2C67A 4G73A 1RP0A 3B6DA 4A6NA 2RGOA 4U2SA 3LJPA 4U8PA 3UTHA 4B1BA 1NPXA 4H4SA 3ITJA 3H8IA 3NLCA 4H2RA 2BC0A 2JB1A 1E6EA 3T0KA 4YSZA 2WOWA 1GREA 3T2ZA 2OA1A 1GALA 1F6MA 4AT2A 1JEHA 1GV4A 2TPRA 4Y4NA 3K30A 3ATQA 3UTEA 4YSXA 3CPJG 1VRQB 2XLSA 1D7YA 2BC1A 1NG4A 1Y56A 2Z5YA 3UKAA 2VOUA 3M13A 3UKFA 1KNPA 1S3EA 1TDNA 3EF6A 2PHHA 2XLTA 2YLRA 5M10A 3P4RA 4U8OA 2QCUA 2R0PA 1M6IA 3NK2X 3GWDA 4HA6A 4TM3A 4D04A 1KSSA 3NK1X 4WX1A 4OPIA 2YQUA 2C65A 4C3XA 1H83A 3NIXA 5IPYA 4IA5A 1GXFA 2GH5A 2FJEA 2OAMA 2WDVA 1GRHA 1E1LA 2JBVA 4I58A 1SEZA 5C3JA 1NHPA 5J60A 4GCMA 2B9WA 1CF3A 2H88A 1EL7A 3JSKA 4CY8A 2EQ9A 5KMPA 2GRTA 2Q6UA 4YSYA 4E0VA 2YM2A 2ARDA 4FDCB 3VRBA 5TR3A 2I0ZA 3FIMB 3KA7A 2C73A 1FECA 4Y4LA 4J33A 5GRTA 2QAEA 2BK4A 4XXGA 1IUSA 2YLTA 3CIRA 3SZWA 2WDRA 3CNJA 2X8GA 3QFBA 2R46A 1RSGA 1TDEA 1GTHA 4EM3A 3LZXA 1FEAA 1H7WA 1KN0A 5EB4A 2GV8A 3I3LA 2FJBA 2R4EA 2XLUA 3CGEA 2RGJA 4X9NA 1PJ5A 1B5QA 5JCNA 4IVOB 3AE7A 4CCRA 1K4QA 1KSUA 3UTGA 4TM1A 2XVHA 1D5TA 4H2QA 3C4NA 3URHA 3KVEA 3T14A 3F8DA 3SYIA 1PXAA 4AOXA 1H2IA 1PJ7A 2YWLA 1BF3A 3GYJA 3NGCX 3OZ2A 4U8JA 4EIQA 2BRYA 5KOWA 1Q1RA 1D4EA 4APNA 2B7SA 1DOEA 1OJDA 1EL9A 2QA1A 1VDCA 3AEEA 4BV6A 2WP9A 4H7UA 3H8LA 2X99A 1PN0A 2XVJA 1CJ3A 2BK3A 3CGCA 4YTPA 2Q0LA 4H50A 4GAPA 1DNCA 3AE3A 1OJAA 4CNKA 1JNZA 3FMWA 3DJGX 1CC2A 1Q1WA 3KLJA 4KPRA 4B69A 2GR3A 3LOVA 4X9MA 3UKQA 3GRSA 3L5OA 4M52A 4EQRA 1FCDA 1H86A 1JNRA 4RG3A 1O94A 3V3NA 2R4JA 2YVFA 2JB2A 1CHUA 3L8KA 2C3DA 4H4UA 4OPCA 1PBBA 3O0HA 1S3BA 4B63A 1MO9A 4H2NA 1JOAA 2XCGA 2BA9A 3G5QA 2GB0A 2X3NA 2Y6QA 1BGNA 1N4WA 2WS3A 1GOSA 3KKJA 5KOXA 5LV9A 1KFYA 3FPZA 4OVIA 1H84A 4AP1A 2GEWA 1GSNA 4ADWA 3KPKA 4CRTA 2V61A 1E1KA 4USQA 3DJEA 1P2HA 2YG3A 3C96A 1IUUA 2XYOA 1KNRA 3P4PA 2YLZA 5KNLA 2R9ZA 5CQFA 3P1WA 3T2YA 4ECHA 1GEUA 1F8WA 4H2PA 3VRDB 4EM4A 3ADAB 4RG4A 5FS9A 2W0HA 3AEFA 4ICYA 4IVMB 3KD9A 4BURA 3REDA 3AYJA 3VR9A 2V5ZA 2WBAA 3T31A 3PG6A 4YKGA 1VQWA 3K7TA 5BULA 4TM4A 3HYWA 3H4KA 4EMIA 4O5UA 2YLWA 1ZMDA 1F8RA 3AEDA 1KF6A 1H81A 1OJTA 1PXBA 2FBWA 1Z6LA 4C74A 5JCLA 2X8CA 3ALLA 1F8SA 1F3PA 4N9XA 2IVDA 1IUXA 3I6DA 1K0IA 5GSNA 4CY6A 5KRQA 2WU2A 3PO7A 2B76A 4KX6A 3IHMA 2GQWA 3IF9A 2WU5A 1TYTA 4FK1C 1ELIA 2C4CA 5C2TA 3SQPA 4J57A 1ZP0A 1FL2A 4B66A 3CNSA 2NVKX 2XFPA 4U8MA 5BUKA 3UOXA 2WPCA 1LQUA 4A5LA 2VVLG 3ATRA 1PJ6A 3ICTA 2C64A 2WHDA 1BWCA 5FS8A 4Z24A 3BI2A 1S7MA 5FS7A 4X4JA 4B64A 1EL5A 1CC6A 3UKKA 1ZDLA 2NPXA 3FBSA 3AE2A 3F8RA 2VVLA 1L9EA 4G9KA 2CVJA 2DKHA 3KPFA 4J31A 4LIIA 1ZY8A 1DXLA 2VQ7A 1CJCA 1EL8A 1Q9IA 3NRNA 2YR4A 1O5WA 2ZZ0A 5EBKA 4G6GA 4GUVA 3GWFA 1S2QA 3Q9TA 4GF7A 2JB3A 3UCLA 1XANA 3M0OA 4K7ZA 3QJ4A 3UKHA 2YVJA 1E7PA 2BS4A 1E39A 1COYA 1PDHA 2RABA 2WETA 2C3CA 2GR0A 1L9DA 2OLOA 1NHSA 5FS6A 1IUVA 2XFQA 2C66A 2AR8A 1BZLA 2UZZA 2RGHA 1PXCA 4H4XA 1ZOVA 3PS9A 3DJDA 1JRYA 4LA1A 2OLNA 4U8LA 4TLXA 3LADA 1REOA 3V3OA 1VG9A 1GRFA 4OPTA 1GRAA 5HYMA 5JRBA 3II4A 1DJQA 3F8PA 3GMBA 3AE4A 2GQFA 4AT0A 3DGHA 4XWRA 4H4QA 4UP3A 4C77A 2CULA 1H6VA 1QLBA 3CPIG 4K22A 4OPGA 2BYBA 2E4GA 3HZLA 3P9UA 1GERA 1ONFA 4JNAA 2XVIA 5KMQA 2TMDA 4H4TA 1E1NA 2V60A 4GRTA 4J34A 3HYXA 4OPUA 3R9UA 3NH3X 2BXRA 4NTCA 1GESA 3AE8A 3PVCA 3AE5A 4A6NB 2V3AA 1IUTA 4BK3A 1TYPA 3CGBA 4H4VA 2XLPA 2IIDA 2GF3A 2YVGA 4O5QA 3AECA 2ACZA 2B7RA 4NWZA 2JAEA 4Z2RA 2WQYA 2XVFA 4A79A 4H4ZA 1JRXA 2Q7VA 2CFYA 5CKUA 5KMRA 2YG4A 2C70A 3CNTA 5EOWA 2GVCA 3K7MX 2A89A 1ZX9A 2A87A 2BXSA 1DODA 4EIPA 3BHFA 2BK5A 3AD7B 3IC9A 2C72A 5HY5A 4A99A 1QJDA 3SFDA 3T37A 1H82A 1NHQA 4B67A 4NZHA 3DA1A 5U1OA 1PS9A 2BS3A 3QSSA 3HYVA 5U25A 1O95A 2JKCA 2YR6A 3NHOX 2V6OA 1CL0A 2XDOA 3AD8B 3AE1A 3NT6A 3NYFA 3SM8A 3AE6A 1FOHA 4U8KA 1NDAA 3NYCA 2ZBWA 4CBQA 3CN8A 1EBDA 5KWFA 5L46A 3DK9A 2XFOA 2Z5XA 4II2A 4AP3A 4USRA 4LU6A 3UKLA 4H4YA 4H4RA 4Z44A 2EQ7A 1NEKA 4EQXA 3BNMA 3NG7X 4NTEA 1UKVG 3AWIA 3T2KA 4GR1A 1XHCA 2BRAA 3SZCA 2OALA 3CGDA 2B9YA 5DBJA 2XFNA 2ZZBA 1CJ2A 4DSHA 5JCMA 2GR1A 2WOIA 1N4VA 3CTYA 3QSEA 2APGA 1JRZA 1ZOYA 1YQZA 3AB1A 4JNQA 2EQ6A 2PYXA 3QFAA 5KMSA 4I59A 3LB8A 1NG3A 3P4QA 1DOBA 3SY4A 4REKA 3UP5A 4OPDA 1V59A 1N1PA 4K2XA 2BCPA 1TRBA 3ICRA 4YKFA 2H89A 4A65A 1CBOA 1DJNA 2YG6A 4EQWA 2YR5A 3AE9A 4DNAA 4BJYA 1B37A 4U2TA 2WEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YM1 A;  1TDO A;  2A8X A;  2BAB A;  1PBD A;  3NN0 X;  4BK1 A;  4EMJ A;  4JY3 A;  2YG5 A;  4CNJ A;  3UOZ A;  2IVE A;  3D8X A;  3E1T A;  4P9S A;  4U8N A;  2X8H A;  1CC4 A;  4H4P A;  2DKI A;  1B4V A;  3NYE A;  1M64 A;  1YQ4 A;  2R0C A;  1NEN A;  1N4U A;  4BJZ A;  4XWZ A;  1QO8 A;  4K8D A;  1X31 B;  3AXB A;  3G5S A;  3P4S A;  3UOV A;  3LXD A;  1GND A;  1K0J A;  1GET A;  2WDQ A;  1YKJ A;  2VZ2 A;  3NKS A;  4YT0 A;  4C3Y A;  5KXJ A;  3CNP A;  1ZMC A;  3OC4 A;  3QSM A;  5HXI A;  3QVR A;  1DOC A;  3BI4 A;  1LTX R;  4ZCC A;  4TM0 A;  4B65 A;  3KU9 A;  2WP6 A;  3GD3 A;  2XVE A;  3BI5 A;  1XPQ A;  4J56 A;  2B9X A;  1L0V A;  3SGL A;  1K0L A;  2FJA A;  4K5S A;  3S5W A;  4B68 A;  1KDG A;  4JY2 A;  1HYU A;  4FX9 A;  1BKW A;  2EQ8 A;  4GDP A;  3Q6J A;  1LQT A;  5KVH A;  1OJ9 A;  1LJ1 A;  4C5O A;  4EMW A;  3ISH A;  4IA6 A;  1IUW A;  4YSH A;  3EAN A;  1LPF A;  3NN6 X;  3FG2 P;  4Z26 A;  1GT8 A;  3GDP A;  4JDR A;  5JCI A;  2VVM A;  2YLX A;  3QVP A;  3CPH G;  4J2W A;  2AQJ A;  2VRL A;  4Z25 A;  1S2Y A;  2WP5 A;  1D7L A;  4PAA A;  1ZK7 A;  4YWO A;  4U2L A;  1NHR A;  4DSG A;  3ZDN A;  3NK0 X;  3M12 A;  5M0Z A;  4A9W A;  4ZN0 A;  2V3B A;  2YG7 A;  3UP4 A;  2GR2 A;  2F5Z A;  4IV9 A;  1MOK A;  2JK6 A;  1PBC A;  1PBE A;  1LVL A;  2QA2 A;  4OCG A;  4ZCD A;  2GAG B;  4J36 A;  3CND A;  4JQ9 A;  4NEW A;  3VQR A;  2WOV A;  4PAB A;  2XFU A;  4OPL A;  1BGJ A;  4YTN A;  3V76 A;  5BVA A;  1MXT A;  1OJC A;  2E1M A;  3IHG A;  3DK4 A;  3IWA A;  4U8I A;  4H4W A;  3AYI A;  2CDU A;  3B3R A;  3RNM A;  4AOS A;  5U63 A;  5ER0 A;  3S61 A;  2C7G A;  3VRA A;  3UOY A;  2C76 A;  3G5R A;  4D03 A;  3C4A A;  3LZW A;  3DH9 A;  1E1M A;  2R45 A;  4DGK A;  1VG0 A;  4FK1 A;  3WE0 A;  4K5R A;  5EB5 A;  1H7X A;  1Y56 B;  2Y6R A;  1FEB A;  5J7X A;  1B8S A;  3L1R A;  4NEV A;  1CJ4 A;  1GPE A;  1IJH A;  3EAO A;  5JCK A;  1NAA A;  4UDP A;  4NTD A;  5IQ4 A;  3NTD A;  1XDI A;  2YAU A;  1PHH A;  1JU2 A;  3DME A;  2BAC A;  2O9Z A;  3RP8 A;  3UTF A;  3VR8 A;  2X50 A;  5BRT A;  3GMC A;  1YQ3 A;  4MJW A;  3RHA A;  3SFE A;  3K7Q X;  3NNE A;  1D4D A;  2R0G A;  2YLS A;  3DJJ A;  2BS2 A;  2Q0K A;  5IQ1 A;  2WPE A;  1W4X A;  1GRT A;  1YY5 A;  4JN9 A;  1GRG A;  4RSL A;  4UDQ A;  3EPT A;  2GMJ A;  4Y4M A;  3GSI A;  2HQM A;  3NTA A;  3ABV A;  2VRM A;  3RP6 A;  1GRB A;  2BCG G;  3DGZ A;  2AAQ A;  4A7A A;  3RP7 A;  4Z2U A;  3D1C A;  1RYI A;  1Y0P A;  3AD9 B;  4YTM A;  3GRT A;  4EQS A;  5FMH A;  5KVI A;  3AEA A;  3ICS A;  3GD4 A;  4UDR A;  4CCQ A;  3ALJ A;  3COX A;  3ALM A;  1AOG A;  3BHK A;  3UKP A;  3DK8 A;  3AEG A;  1ZKQ A;  1TDF A;  2C75 A;  1P2E A;  2J3N A;  4YXD A;  2XLR A;  2FJD A;  5HHF A;  2GMH A;  3ZYX A;  4WCT A;  4GDE A;  3GDN A;  4Z43 A;  3AEB A;  1L9C A;  2GAH B;  1PBF A;  2VQB A;  3AYL A;  2WPF A;  2WES A;  1TDK A;  3GYI A;  4BK2 A;  4Z2T A;  1LV0 A;  2ZZC A;  3BNU A;  2E5V A;  1D4C A;  4TLZ A;  1GTE A;  2C67 A;  1RP0 A;  3B6D A;  4A6N A;  2RGO A;  4U2S A;  3LJP A;  4U8P A;  3UTH A;  4B1B A;  1NPX A;  4H4S A;  3ITJ A;  3H8I A;  3NLC A;  4H2R A;  2BC0 A;  2JB1 A;  1E6E A;  4YSZ A;  2WOW A;  1GRE A;  2OA1 A;  1GAL A;  1F6M A;  4AT2 A;  1JEH A;  1GV4 A;  2TPR A;  4Y4N A;  3K30 A;  3ATQ A;  3UTE A;  4YSX A;  3CPJ G;  1VRQ B;  2XLS A;  1D7Y A;  2BC1 A;  1NG4 A;  1Y56 A;  2Z5Y A;  3UKA A;  2VOU A;  3M13 A;  3UKF A;  1KNP A;  1S3E A;  1TDN A;  3EF6 A;  2PHH A;  2XLT A;  2YLR A;  5M10 A;  3P4R A;  4U8O A;  2QCU A;  2R0P A;  1M6I A;  3NK2 X;  3GWD A;  4HA6 A;  4TM3 A;  4D04 A;  1KSS A;  3NK1 X;  4WX1 A;  4OPI A;  2YQU A;  2C65 A;  4C3X A;  1H83 A;  3NIX A;  5IPY A;  4IA5 A;  1GXF A;  2GH5 A;  2FJE A;  2OAM A;  2WDV A;  1GRH A;  1E1L A;  2JBV A;  4I58 A;  1SEZ A;  5C3J A;  1NHP A;  5J60 A;  4GCM A;  2B9W A;  1CF3 A;  2H88 A;  1EL7 A;  3JSK A;  4CY8 A;  2EQ9 A;  2GRT A;  2Q6U A;  4YSY A;  4E0V A;  2YM2 A;  2ARD A;  4FDC B;  3VRB A;  5TR3 A;  2I0Z A;  3FIM B;  3KA7 A;  2C73 A;  1FEC A;  4Y4L A;  4J33 A;  5GRT A;  2QAE A;  2BK4 A;  4XXG A;  1IUS A;  2YLT A;  3CIR A;  2WDR A;  3CNJ A;  2X8G A;  3QFB A;  2R46 A;  1RSG A;  1TDE A;  1GTH A;  4EM3 A;  3LZX A;  1FEA A;  1H7W A;  5EB4 A;  2GV8 A;  3I3L A;  2FJB A;  2R4E A;  2XLU A;  3CGE A;  2RGJ A;  4X9N A;  1PJ5 A;  1B5Q A;  5JCN A;  4IVO B;  3AE7 A;  4CCR A;  1K4Q A;  1KSU A;  3UTG A;  4TM1 A;  2XVH A;  1D5T A;  4H2Q A;  3C4N A;  3URH A;  3KVE A;  3F8D A;  1PXA A;  4AOX A;  1PJ7 A;  2YWL A;  3NGC X;  1BF3 A;  3GYJ A;  3OZ2 A;  4U8J A;  4EIQ A;  5KOW A;  1Q1R A;  1D4E A;  4APN A;  2B7S A;  1DOE A;  1OJD A;  1EL9 A;  2QA1 A;  1VDC A;  3AEE A;  4BV6 A;  2WP9 A;  4H7U A;  3H8L A;  2X99 A;  1PN0 A;  2XVJ A;  1CJ3 A;  2BK3 A;  3CGC A;  4YTP A;  2Q0L A;  4H50 A;  1DNC A;  3AE3 A;  1OJA A;  4CNK A;  1JNZ A;  3FMW A;  3DJG X;  1CC2 A;  1Q1W A;  3KLJ A;  4KPR A;  4B69 A;  2GR3 A;  3LOV A;  4X9M A;  3UKQ A;  3GRS A;  4M52 A;  4EQR A;  1FCD A;  1H86 A;  1JNR A;  4RG3 A;  1O94 A;  3V3N A;  2R4J A;  2YVF A;  2JB2 A;  1CHU A;  3L8K A;  2C3D A;  4H4U A;  4OPC A;  1PBB A;  3O0H A;  1S3B A;  4B63 A;  1MO9 A;  4H2N A;  1JOA A;  2XCG A;  2BA9 A;  3G5Q A;  2GB0 A;  2X3N A;  2Y6Q A;  1BGN A;  1N4W A;  2WS3 A;  1GOS A;  3KKJ A;  5KOX A;  5LV9 A;  1KFY A;  3FPZ A;  4OVI A;  1H84 A;  4AP1 A;  2GEW A;  1GSN A;  4ADW A;  4CRT A;  2V61 A;  1E1K A;  4USQ A;  3DJE A;  1P2H A;  2YG3 A;  3C96 A;  1IUU A;  2XYO A;  1KNR A;  3P4P A;  2YLZ A;  2R9Z A;  5CQF A;  3P1W A;  4ECH A;  1GEU A;  1F8W A;  4H2P A;  3VRD B;  4EM4 A;  3ADA B;  4RG4 A;  5FS9 A;  2W0H A;  3AEF A;  4ICY A;  4IVM B;  3KD9 A;  4BUR A;  3RED A;  3AYJ A;  3VR9 A;  2V5Z A;  2WBA A;  4YKG A;  1VQW A;  3K7T A;  5BUL A;  4TM4 A;  3H4K A;  4EMI A;  4O5U A;  2YLW A;  1ZMD A;  1F8R A;  3AED A;  1KF6 A;  1H81 A;  1OJT A;  1PXB A;  2FBW A;  1Z6L A;  4C74 A;  5JCL A;  2X8C A;  3ALL A;  1F8S A;  1F3P A;  4N9X A;  2IVD A;  1IUX A;  3I6D A;  1K0I A;  5GSN A;  4CY6 A;  5KRQ A;  2WU2 A;  3PO7 A;  2B76 A;  4KX6 A;  3IHM A;  2GQW A;  3IF9 A;  2WU5 A;  1TYT A;  4FK1 C;  1ELI A;  5C2T A;  3SQP A;  4J57 A;  1ZP0 A;  1FL2 A;  4B66 A;  3CNS A;  2NVK X;  2XFP A;  4U8M A;  5BUK A;  3UOX A;  2WPC A;  1LQU A;  4A5L A;  2VVL G;  3ATR A;  1PJ6 A;  3ICT A;  2C64 A;  2WHD A;  1BWC A;  5FS8 A;  4Z24 A;  3BI2 A;  5FS7 A;  4X4J A;  4B64 A;  1EL5 A;  1CC6 A;  3UKK A;  1ZDL A;  2NPX A;  3FBS A;  3AE2 A;  3F8R A;  2VVL A;  1L9E A;  2CVJ A;  2DKH A;  3KPF A;  4J31 A;  4LII A;  1ZY8 A;  1DXL A;  2VQ7 A;  1CJC A;  1EL8 A;  1Q9I A;  3NRN A;  2YR4 A;  1O5W A;  2ZZ0 A;  5EBK A;  4GUV A;  3GWF A;  1S2Q A;  3Q9T A;  4GF7 A;  2JB3 A;  3UCL A;  1XAN A;  3M0O A;  4K7Z A;  3QJ4 A;  3UKH A;  2YVJ A;  1E7P A;  2BS4 A;  1E39 A;  1COY A;  1PDH A;  2RAB A;  2WET A;  2C3C A;  2GR0 A;  1L9D A;  2OLO A;  1NHS A;  5FS6 A;  1IUV A;  2XFQ A;  2C66 A;  2AR8 A;  1BZL A;  2UZZ A;  2RGH A;  1PXC A;  4H4X A;  1ZOV A;  3PS9 A;  3DJD A;  1JRY A;  4LA1 A;  2OLN A;  4U8L A;  4TLX A;  3LAD A;  1REO A;  3V3O A;  1VG9 A;  1GRF A;  4OPT A;  1GRA A;  5HYM A;  3II4 A;  1DJQ A;  3F8P A;  3GMB A;  3AE4 A;  2GQF A;  4AT0 A;  3DGH A;  4XWR A;  4H4Q A;  4UP3 A;  4C77 A;  2CUL A;  1H6V A;  1QLB A;  3CPI G;  4K22 A;  4OPG A;  2BYB A;  2E4G A;  3HZL A;  3P9U A;  1GER A;  1ONF A;  4JNA A;  2XVI A;  2TMD A;  4H4T A;  1E1N A;  2V60 A;  4GRT A;  4J34 A;  4OPU A;  3R9U A;  3NH3 X;  2BXR A;  4NTC A;  1GES A;  3AE8 A;  3PVC A;  3AE5 A;  4A6N B;  2V3A A;  1IUT A;  4BK3 A;  1TYP A;  3CGB A;  4H4V A;  2XLP A;  2IID A;  2GF3 A;  2YVG A;  4O5Q A;  3AEC A;  2ACZ A;  2B7R A;  2JAE A;  4Z2R A;  2WQY A;  2XVF A;  4A79 A;  4H4Z A;  1JRX A;  2Q7V A;  2CFY A;  5CKU A;  2YG4 A;  2C70 A;  3CNT A;  5EOW A;  2GVC A;  3K7M X;  2A89 A;  1ZX9 A;  2A87 A;  2BXS A;  1DOD A;  4EIP A;  3BHF A;  2BK5 A;  3AD7 B;  3IC9 A;  2C72 A;  5HY5 A;  4A99 A;  1QJD A;  3SFD A;  3T37 A;  1H82 A;  1NHQ A;  4B67 A;  4NZH A;  3DA1 A;  5U1O A;  1PS9 A;  2BS3 A;  3QSS A;  3NHO X;  5U25 A;  1O95 A;  2JKC A;  2YR6 A;  4HB9 A;  2V6O A;  1CL0 A;  2XDO A;  3AD8 B;  3AE1 A;  3NT6 A;  3NYF A;  3SM8 A;  3AE6 A;  1FOH A;  4U8K A;  1NDA A;  3NYC A;  2ZBW A;  4CBQ A;  3CN8 A;  1EBD A;  5KWF A;  5L46 A;  3DK9 A;  2XFO A;  2Z5X A;  4AP3 A;  4USR A;  4LU6 A;  3UKL A;  4H4Y A;  4H4R A;  4Z44 A;  2EQ7 A;  1NEK A;  4EQX A;  3BNM A;  3NG7 X;  4NTE A;  1UKV G;  3AWI A;  4GR1 A;  1XHC A;  2OAL A;  3CGD A;  2B9Y A;  5DBJ A;  2XFN A;  2ZZB A;  1CJ2 A;  4DSH A;  5JCM A;  2GR1 A;  2WOI A;  1N4V A;  3CTY A;  3QSE A;  2APG A;  1JRZ A;  1ZOY A;  1YQZ A;  3AB1 A;  4JNQ A;  2EQ6 A;  2PYX A;  3QFA A;  4I59 A;  3LB8 A;  1NG3 A;  3P4Q A;  1DOB A;  3UP5 A;  4REK A;  4OPD A;  1V59 A;  1N1P A;  4K2X A;  2BCP A;  1TRB A;  3ICR A;  4YKF A;  2H89 A;  4A65 A;  1CBO A;  1DJN A;  2YG6 A;  4EQW A;  2YR5 A;  3AE9 A;  4DNA A;  4BJY A;  1B37 A;  4U2T A;  2WEU A; 
#chains in the Genus database with same CATH topology
 2YM1 A;  4BK1 A;  4GAV A;  4JY3 A;  2YG5 A;  3D8X A;  1WUF A;  4P9S A;  2X8H A;  2DKI A;  2AL2 A;  3NYE A;  3G5S A;  1YKJ A;  2VZ2 A;  3AMZ A;  3CNP A;  4HCH A;  3BI4 A;  4ZCC A;  3KU9 A;  3BI5 A;  3CMM A;  4K5S A;  1BKW A;  1KCZ A;  3ES8 A;  4E4F A;  3RO6 A;  1GT8 A;  3DFH A;  2YLX A;  4J2W A;  1PDZ A;  4Z25 A;  1ZK7 A;  4YWO A;  1NHR A;  3ZDN A;  3NK0 X;  2V3B A;  2YG7 A;  2GR2 A;  2F5Z A;  2JK6 A;  1JPM A;  1LVL A;  2GAG B;  1NU5 A;  2XFU A;  3NXL A;  1BGJ A;  4YTN A;  4GGH A;  5G5G B;  5BVA A;  2E1M A;  3DK4 A;  2CDU A;  4GYP C;  4IHC A;  2C7G A;  3VRA A;  4TVY A;  3UOY A;  3G5R A;  4D03 A;  3I6T A;  3LZW A;  3DH9 A;  4DGK A;  1VG0 A;  5EB5 A;  1H7X A;  3SX6 A;  1FEB A;  5J7X A;  1B8S A;  4NEV A;  1GPE A;  1IJH A;  3QTP A;  3STP A;  5IQ4 A;  3KUM A;  1JU2 A;  3DME A;  2O9Z A;  3VR8 A;  3NVV B;  4MJW A;  1D4D A;  2R0G A;  3DJJ A;  1MNS A;  4UDQ A;  3NTA A;  4ZA0 A;  4A7A A;  3RP7 A;  3D1C A;  4YTM A;  3AEA A;  3ICS A;  4UDR A;  2AKM A;  3COX A;  3UXL A;  2C75 A;  3V4B A;  2XLR A;  2GMH A;  3AEB A;  2E5V A;  4A6G A;  4G73 A;  1SJB A;  1X2G A;  3V5C A;  1NPX A;  4H4S A;  3ITJ A;  3NLC A;  4FP1 A;  3JZU A;  2BC0 A;  3T2Z A;  1GAL A;  2GDQ A;  4Y4N A;  3DIP A;  3NVY B;  1D7Y A;  2Z5Y A;  2VOU A;  3M13 A;  1KNP A;  1TDN A;  2PHH A;  4U8O A;  1ZXI C;  2QCU A;  2R0P A;  2DW6 A;  4TM3 A;  1KSS A;  1JPD X;  3NK1 X;  3CAW A;  2C65 A;  3NIX A;  2FJE A;  2CHR A;  3TTE A;  1NHP A;  4FDC B;  4MKS A;  3EKG A;  2I0Z A;  3FIM B;  2C73 A;  4Y4L A;  2QAE A;  2BK4 A;  2YLT A;  3SZW A;  2WDR A;  4EM3 A;  5EB4 A;  3I3L A;  1PJ5 A;  4CCR A;  3UTG A;  2XVH A;  4H2Q A;  3C4N A;  2P0I A;  2ZAD A;  4H2H A;  3OZ2 A;  4EIQ A;  2BRY A;  3VCN A;  3DFY A;  2BK3 A;  4GAP A;  4H50 A;  3NS1 B;  3FMW A;  1CC2 A;  3DES A;  4J1O A;  3UKQ A;  3T4W A;  4RG3 A;  1O94 A;  4H4U A;  4B63 A;  1JOA A;  2BA9 A;  1BGN A;  2WS3 A;  5LV9 A;  1KFY A;  2GEW A;  1GSN A;  1V97 A;  3DJE A;  1IUU A;  3P4P A;  2R9Z A;  3VRD B;  1MDL A;  4RG4 A;  3DG7 A;  3AEF A;  4ICY A;  3AYJ A;  2V5Z A;  3T31 A;  5BUL A;  4ZCW A;  3AED A;  2FBW A;  1Z6L A;  3AN1 A;  3NZG A;  3I6D A;  3SN4 A;  2WU2 A;  2C4C A;  4ROP A;  2QJM A;  4B66 A;  1RM6 B;  4A5L A;  2POD A;  1S7M A;  4X4J A;  4B64 A;  4G9K A;  3KPF A;  2QJN A;  1JRP A;  1EL8 A;  1O5W A;  5EBK A;  3ZLH A;  4GUV A;  3UCL A;  4K7Z A;  2YVJ A;  1E39 A;  1F9C A;  1L9D A;  3T6C A;  5IDZ A;  1NHS A;  3CYJ A;  4K8G A;  1IUV A;  2XFQ A;  3QPE A;  1ZOV A;  3V3O A;  3N6H A;  5JRB A;  4H4Q A;  3CT2 A;  3CPI G;  3DDM A;  3HZL A;  2XGZ A;  2XVI A;  3R9U A;  3NH3 X;  4GYP A;  1GES A;  4KPL A;  3DER A;  3PVC A;  4A6N B;  3FV9 A;  1KKO A;  2NQL A;  1TYP A;  2XLP A;  3MWC A;  3D46 A;  2ACZ A;  3H8A A;  2WQY A;  2XVF A;  4H4Z A;  2CFY A;  1VQZ A;  5KMR A;  2C70 A;  2GVC A;  4IT1 A;  5HY5 A;  4A99 A;  3TQP A;  1KKR A;  1E9I A;  3AE1 A;  3AE6 A;  4CBQ A;  1EBD A;  4H1Z A;  3DK9 A;  2Z5X A;  1MDR A;  1SJD A;  4H4Y A;  2EQ7 A;  4NTE A;  3NFU A;  1UKV G;  2BRA A;  3SZC A;  3CGD A;  2XFN A;  3CXB A;  4DSH A;  1ZOY A;  4JNQ A;  3QFA A;  3FYY A;  3UP5 A;  1N1P A;  2XH2 A;  1TRB A;  3ICR A;  4EQW A;  3CB3 A;  2YR5 A;  3AE9 A;  2I5Q A;  4BJY A;  2E3T A;  3VC6 A;  1VDV A;  3NN0 X;  3SZ0 A;  3THU A;  4KEM A;  3T9P A;  4U8N A;  4G74 A;  1NEN A;  1N4U A;  4BJZ A;  3LXD A;  1GND A;  2WDQ A;  1ONE A;  5KXJ A;  3QSM A;  5J04 A;  2PTZ A;  1LTX R;  1N62 C;  3GD3 A;  5FJO A;  1N60 C;  1L0V A;  2FYM A;  4JHM A;  1HYU A;  4FX9 A;  4C5O A;  3Q6J A;  5KVH A;  1LJ1 A;  4EMW A;  4YSH A;  4Z26 A;  3FG2 P;  1EC9 A;  2W3S A;  3GDP A;  3QVP A;  3CPH G;  3SBF A;  2WP5 A;  4PAA A;  1FHV A;  3M12 A;  4ZN0 A;  3UP4 A;  1MOK A;  5FJP A;  1PBE A;  3MUC A;  4ZCD A;  4NEW A;  4PAB A;  4K1W A;  1MXT A;  1OJC A;  3IWA A;  3B3R A;  3S61 A;  3GYX A;  2C76 A;  3C4A A;  1E1M A;  4K5R A;  4MMW A;  1Y56 B;  3MY9 A;  1CJ4 A;  3SXI A;  3A7A A;  3RR1 A;  4NTD A;  3NTD A;  1XDI A;  3SQS A;  3RP8 A;  2X50 A;  5BRT A;  3GMC A;  1YQ3 A;  3SFE A;  3B97 A;  3OPS A;  2WPE A;  1W4X A;  1YY5 A;  4JN9 A;  2PSN A;  3GSI A;  2VRM A;  1GRB A;  2AAQ A;  4Z2U A;  3AD9 B;  4EQS A;  3JW7 A;  4HCD A;  3BHK A;  3UKP A;  5HHF A;  2FJD A;  4DN1 A;  4GDE A;  3GDN A;  1L9C A;  2GAH B;  2VQB A;  3AYL A;  1LV0 A;  2ZZC A;  1D4C A;  2RGO A;  4U2S A;  3UTH A;  2JB1 A;  1E6E A;  3T0K A;  2POZ A;  2OA1 A;  4AT2 A;  1F6M A;  3NVW B;  1JEH A;  2TPR A;  1R0M A;  3K30 A;  3UTE A;  4YSX A;  3QLD A;  2BC1 A;  1NG4 A;  2XLT A;  2OVL A;  3P4R A;  2GSH A;  4WX1 A;  4OPI A;  1W6T A;  4C3X A;  5IPY A;  4IA5 A;  3ZLG A;  2GH5 A;  1E1L A;  2W3R A;  2GGE A;  4KT2 A;  5J60 A;  1CF3 A;  2H88 A;  1EL7 A;  4CY8 A;  2EQ9 A;  2GRT A;  2Q6U A;  2YM2 A;  2ARD A;  5TR3 A;  3KA7 A;  3DG3 A;  1FEC A;  3Q45 A;  3CIR A;  1TDE A;  1GTH A;  3LZX A;  1FEA A;  1KN0 A;  2OZT A;  2RGJ A;  4X9N A;  2W54 A;  3AE7 A;  1D5T A;  3MZN A;  3URH A;  1H2I A;  2YWL A;  3GYJ A;  4U8J A;  1FIQ B;  4APN A;  1DOE A;  2XH4 A;  4GIS A;  2QA1 A;  2WP9 A;  4H7U A;  1PN0 A;  2XVJ A;  3CGC A;  4IL2 A;  1DNC A;  3AE3 A;  1OJA A;  1JNZ A;  3DJG X;  1Q1W A;  3KLJ A;  3R11 A;  3LOV A;  4X9M A;  3GRS A;  1FCD A;  1H86 A;  3UJF A;  2C3D A;  1PBB A;  1S3B A;  1KD0 A;  1MO9 A;  4G7F A;  2X3N A;  2Y6Q A;  1N4W A;  1GOS A;  5KOX A;  3FPZ A;  4AP1 A;  1JCT A;  3KPK A;  4CRT A;  2V61 A;  1KNR A;  5CQF A;  4E5T A;  3T2Y A;  4ECH A;  1GEU A;  4H2P A;  3IK4 A;  4EM4 A;  3ADA B;  1ELS A;  2W0H A;  4IVM B;  1VQW A;  3K7T A;  4IL0 A;  2PU1 A;  2YLW A;  1F8R A;  3U9I A;  1H81 A;  3SR6 B;  1OJT A;  3SN1 A;  5JCL A;  2X8C A;  3ALL A;  1F3P A;  5BOF A;  1K0I A;  5GSN A;  5KRQ A;  2PP0 A;  3PO7 A;  4KX6 A;  3IHM A;  2GQW A;  2WU5 A;  1TYT A;  1ELI A;  1ZP0 A;  4U8M A;  3UOX A;  2WPC A;  5FS8 A;  4Z24 A;  3T8Q A;  2PGE A;  1EL5 A;  3UKK A;  3R25 A;  2NPX A;  3FBS A;  3AE2 A;  3F8R A;  2DKH A;  2OLA A;  4J31 A;  4LII A;  1ZY8 A;  1DXL A;  1CJC A;  1Q9I A;  3NRN A;  2YR4 A;  3TJI A;  3OP2 A;  2ZC8 A;  3M0O A;  2OG9 A;  3UKH A;  4M6U A;  2WET A;  2PGW A;  2C3C A;  5FS6 A;  4G8T A;  2AR8 A;  2RGH A;  4H4X A;  4LA1 A;  4TLX A;  1VG9 A;  1GRF A;  3II4 A;  1DJQ A;  3F8P A;  3GMB A;  4XWR A;  4UP3 A;  4C77 A;  1IYX A;  4ENL A;  2BYB A;  3P9U A;  2HZG A;  1ONF A;  2V60 A;  4GRT A;  3PWG A;  5ENL A;  4NTC A;  3ZVH A;  3AE5 A;  3CGB A;  2OX4 A;  2OZ8 A;  4DX3 A;  2YVG A;  1EC7 A;  1MRA A;  4NWZ A;  4Z2R A;  4A79 A;  2Q7V A;  5CKU A;  2YG4 A;  3CNT A;  3BOX A;  1ZX9 A;  3PWI A;  2A87 A;  2RDX A;  3DGB A;  1DOD A;  3BHF A;  3IC9 A;  2C72 A;  3T37 A;  1H82 A;  3GY1 A;  4NZH A;  3DA1 A;  2BS3 A;  3HYV A;  5U25 A;  3NHO X;  2YR6 A;  2V6O A;  1CL0 A;  3AD8 B;  3NYF A;  3NYC A;  5KWF A;  4IP4 A;  3CN8 A;  5L46 A;  2QJJ A;  4AP3 A;  4H4R A;  3PFR A;  3R0K A;  3RRA A;  1CJ2 A;  2WOI A;  1TZZ A;  1N4V A;  3CTY A;  2APG A;  1JRZ A;  2PYX A;  1BKH A;  1DOB A;  3MKC A;  4OPD A;  1V59 A;  2BCP A;  3A7R A;  3ETR B;  4AT0 A;  4EWJ A;  1TDO A;  4NNJ A;  4G6H A;  2BAB A;  1PBD A;  2XH7 A;  3UOZ A;  2IVE A;  2HXU A;  3E1T A;  3VCC A;  1CC4 A;  1MUC A;  3HRD C;  1M64 A;  4K8D A;  1X31 B;  3AXB A;  3P4S A;  2HXT A;  1GET A;  3NKS A;  1ZMC A;  2GL5 A;  3UJ2 A;  4B65 A;  1XPQ A;  4J56 A;  2B9X A;  3SGL A;  2FJA A;  3QN3 A;  5FJR A;  3JVA A;  3S5W A;  1KDG A;  1ECQ A;  4GDP A;  1LQT A;  4IA6 A;  4IZG A;  3EAN A;  3H12 A;  4A3R A;  4JDR A;  2VVM A;  1S2Y A;  2FKP A;  4A9W A;  4K2S A;  4IV9 A;  2PU0 A;  2QA2 A;  4J36 A;  3CND A;  4JQ9 A;  3TOY A;  3IHG A;  3UCC A;  1NEL A;  4AOS A;  2OQH A;  5ER0 A;  3R10 A;  2R45 A;  2Y6R A;  3D9X A;  1NAA A;  4UDP A;  2YAU A;  3UTF A;  1TE6 A;  3RHA A;  2QDD A;  3NNE A;  4A35 A;  2BS2 A;  1PDY A;  4Y4M A;  3RCY A;  2BCG G;  3R07 C;  2PMQ A;  2E5A A;  3ALM A;  1AOG A;  2P8B A;  1TDF A;  3AEG A;  2J3N A;  3ZYX A;  1PBF A;  2OZ3 A;  2WPF A;  4HNC A;  4Z2T A;  3BNU A;  4TLZ A;  1XPY A;  1GTE A;  2C67 A;  1RP0 A;  3ZVI A;  3LJP A;  4U8P A;  4GFI A;  1JRO A;  2ONE A;  1GRE A;  3TCS A;  3CPJ G;  2MUC A;  1VRQ B;  4JN8 A;  2XLS A;  1Y56 A;  3UKA A;  1P48 A;  3UKF A;  1S3E A;  3R0U A;  3EF6 A;  2YLR A;  1XS2 A;  1M6I A;  3NK2 X;  2OPJ A;  4D04 A;  3IJL A;  2YQU A;  4HYR A;  3UCD A;  2OAM A;  2WDV A;  1GRH A;  4I58 A;  1FFU C;  5C3J A;  3H70 A;  3UXK A;  2P3Z A;  3TWA A;  4GCM A;  2GGG A;  3JSK A;  3P0W A;  3GD6 A;  3OTR A;  3I4K A;  4YSY A;  3VRB A;  3K1G A;  3V3W A;  5GRT A;  1IUS A;  3CNJ A;  2R46 A;  1H7W A;  3AM9 A;  1B5Q A;  5JCN A;  1KSU A;  2QQ6 A;  4TM1 A;  3EEZ A;  3N6J A;  3T14 A;  3F8D A;  3OZM A;  1PXA A;  6ENL A;  4AOX A;  1PJ7 A;  3NGC X;  1BF3 A;  5KOW A;  3S47 A;  3P3B A;  1D4E A;  2B7S A;  1OJD A;  1EL9 A;  1VDC A;  4BV6 A;  3H8L A;  2X99 A;  3VFC A;  2Q0L A;  4CNK A;  4B69 A;  4KPR A;  2GR3 A;  3L5O A;  3OW1 A;  1X2H A;  2YVF A;  2JB2 A;  1CHU A;  3B9J B;  3L8K A;  4OPC A;  4H2N A;  3G5Q A;  2XCG A;  2GB0 A;  2MNR A;  3SN0 A;  3KKJ A;  3QKE A;  5EU9 A;  4OVI A;  1H84 A;  1E1K A;  1P2H A;  3C96 A;  2XYO A;  5KNL A;  1EBG A;  3P1W A;  2PA6 A;  4KWS A;  1BQG A;  3DEQ A;  2OQY A;  2PP3 A;  3RED A;  3VR9 A;  2WBA A;  1R6W A;  4YKG A;  4TM4 A;  3HYW A;  3H4K A;  1KF6 A;  1N63 C;  2OKT A;  1F8S A;  4N9X A;  2IVD A;  1IUX A;  4HPN A;  4IP5 A;  4CY6 A;  2B76 A;  5C2T A;  3CNS A;  5BUK A;  3TJ4 A;  2VVL G;  3ATR A;  3ICT A;  2C64 A;  2QDE A;  2WHD A;  3BI2 A;  1CC6 A;  1L9E A;  2AKZ A;  2CVJ A;  2ZZ0 A;  3GWF A;  2XSX A;  1S2Q A;  4GF7 A;  1XAN A;  4X2P A;  3CK5 A;  3QJ4 A;  4M0X A;  1COY A;  1SB3 B;  1PDH A;  2RAB A;  3RIT A;  1TKK A;  3RGT A;  2OLO A;  2C66 A;  3I6E A;  2UZZ A;  2P8C A;  3DJD A;  4U8L A;  3LAD A;  1REO A;  2PPG A;  4OPT A;  5HYM A;  2GQF A;  4GGB A;  2W55 A;  2CUL A;  3UGV A;  4K22 A;  4OPG A;  2E4G A;  2TMD A;  4J34 A;  4E4U A;  4E6M A;  2PTX A;  5FJT A;  2BXR A;  4GIR A;  2V3A A;  1IUT A;  4BK3 A;  4H4V A;  2IID A;  5G5H B;  2GF3 A;  2B7R A;  4JN7 A;  1JRX A;  4HCL A;  2BXS A;  1WYG A;  4EIP A;  2BK5 A;  3AD7 B;  4TVW A;  3SFD A;  4B67 A;  3QSS A;  2JKC A;  2XDO A;  1FOH A;  4U8K A;  2PTY A;  2ZBW A;  4FI4 A;  2XFO A;  4II2 A;  4USR A;  1OEP A;  4Z44 A;  1NEK A;  3VC5 A;  3BNM A;  1JDF A;  3NG7 X;  3AWI A;  3T2K A;  1XHC A;  5DBJ A;  2B9Y A;  5JCM A;  2GR1 A;  4F4R A;  1YQZ A;  3U4F A;  4I59 A;  4J3Z A;  4REK A;  4A65 A;  2YG6 A;  1DJN A;  4DNA A;  4U2T A;  2A8X A;  4EMJ A;  2QVH A;  4CNJ A;  1N5X A;  1SJA A;  4H4P A;  1B4V A;  3HPF A;  1YQ4 A;  2R0C A;  4XWZ A;  1QO8 A;  3UJE A;  3UOV A;  1K0J A;  4YT0 A;  4C3Y A;  2GGI A;  3OC4 A;  5HXI A;  3QVR A;  1DOC A;  3ZVH B;  4TM0 A;  2WP6 A;  2XVE A;  1N61 C;  1K0L A;  4B68 A;  4JY2 A;  3SJN A;  2EQ8 A;  1OJ9 A;  3ISH A;  1IUW A;  1LPF A;  3NN6 X;  2GGH A;  2DW7 A;  5JCI A;  3HW2 A;  2AQJ A;  2VRL A;  1D7L A;  4U2L A;  4DSG A;  5M0Z A;  3N4E A;  1PBC A;  4OCG A;  3VQR A;  2WOV A;  4OPL A;  3H7V A;  3V76 A;  3MQT A;  4U8I A;  4H4W A;  5BOE A;  3AYI A;  3RNM A;  5U63 A;  4DWD A;  4FK1 A;  3WE0 A;  3VDG A;  2PCE A;  3L1R A;  3EAO A;  5JCK A;  1PHH A;  2BAC A;  3K7Q X;  2YLS A;  3IJI A;  2Q0K A;  5IQ1 A;  7ENL A;  1GRT A;  4MGG A;  1GRG A;  4DHG A;  4RSL A;  3EPT A;  2GMJ A;  2HQM A;  3RP6 A;  3ABV A;  3DGZ A;  1EC8 A;  1RYI A;  1Y0P A;  4II3 A;  3GRT A;  5FMH A;  5KVI A;  1DTN A;  3GD4 A;  4CCQ A;  3ALJ A;  3R1Z A;  3DK8 A;  3SZF A;  1ZKQ A;  1P2E A;  4YXD A;  3V5F A;  2OFJ A;  4WCT A;  4Z43 A;  3GYI A;  2WES A;  1TDK A;  4BK2 A;  3B6D A;  4A6N A;  4B1B A;  3H8I A;  4H2R A;  3IJQ A;  3UJS A;  4YSZ A;  2WOW A;  1L8P A;  1GV4 A;  3ATQ A;  4YWS A;  3TWB A;  4GME A;  5M10 A;  3GWD A;  4HA6 A;  2PS2 A;  1H83 A;  1GXF A;  2JBV A;  1SEZ A;  3PK7 A;  2B9W A;  5KMP A;  4E0V A;  2AL1 A;  3FCP A;  3BSM A;  4J33 A;  4HN8 A;  4XXG A;  3FJ4 A;  1P43 A;  2X8G A;  3QFB A;  1RSG A;  2GV8 A;  2FJB A;  2R4E A;  2XLU A;  3CGE A;  4IVO B;  1YEY A;  1K4Q A;  2XH0 A;  1STZ A;  3KVE A;  4E8G A;  2PTW A;  3SYI A;  1Q1R A;  1WUE A;  3AEE A;  3Q4D A;  1CJ3 A;  4YTP A;  3NVZ B;  4M52 A;  4EQR A;  1JNR A;  3V3N A;  2R4J A;  4HNL A;  3O0H A;  3BJS A;  2O56 A;  4DXK A;  4ADW A;  3ZLF A;  4USQ A;  2YG3 A;  2YLZ A;  3OZY A;  3SSZ A;  3NO1 A;  1F8W A;  5FS9 A;  3VA8 A;  1RVK A;  3KD9 A;  4BUR A;  4Z1Y A;  3PG6 A;  4EMI A;  4O5U A;  1ZMD A;  1T3Q C;  2AL2 B;  1PXB A;  4C74 A;  4H19 A;  4ZOH B;  5FJU A;  2GGJ A;  3IF9 A;  4FK1 C;  1N5W C;  3SQP A;  4J57 A;  1FL2 A;  2NVK X;  2XFP A;  1LQU A;  1PJ6 A;  2OO6 A;  3ENL A;  1BWC A;  2QGY A;  5FS7 A;  1ZDL A;  2VVL A;  1FFV C;  2P88 A;  2VQ7 A;  3NRZ B;  4G6G A;  3ES7 A;  3Q9T A;  3S5S A;  2JB3 A;  3FXG A;  1E7P A;  2BS4 A;  4DYE A;  1EBH A;  4Z17 A;  2GR0 A;  1BZL A;  3DG6 A;  1PXC A;  3PS9 A;  2HNE A;  1FO4 A;  1JRY A;  2OLN A;  1GRA A;  3GC2 A;  1SJC A;  3AE4 A;  3DGH A;  3FVD A;  3D47 A;  1H6V A;  1QLB A;  1GER A;  4JNA A;  4H83 A;  5KMQ A;  4H4T A;  1E1N A;  3HYX A;  4OPU A;  3P93 A;  3UJR A;  3AE8 A;  3GO2 A;  4O5Q A;  3AEC A;  2JAE A;  3CXO A;  5EOW A;  3K7M X;  2A89 A;  1FHU A;  1QJD A;  1NHQ A;  2PP1 A;  4HB9 A;  5U1O A;  1PS9 A;  1O95 A;  3NT6 A;  3SM8 A;  1NDA A;  3TW9 A;  4LU6 A;  3UKL A;  4EQX A;  4GR1 A;  2OAL A;  2ZZB A;  3A7U A;  3QSE A;  3AB1 A;  2EQ6 A;  5KMS A;  3LB8 A;  3SY4 A;  1NG3 A;  3P4Q A;  3EUB 3;  4K2X A;  4YKF A;  3N4F A;  2H89 A;  1CBO A;  3MSY A;  1B37 A;  2WEU A; 
#chains in the Genus database with same CATH homology
 2YM1 A;  1TDO A;  4NNJ A;  4G6H A;  2A8X A;  2BAB A;  1PBD A;  3NN0 X;  3SZ0 A;  4BK1 A;  4EMJ A;  4GAV A;  4JY3 A;  2YG5 A;  4CNJ A;  3UOZ A;  2IVE A;  3D8X A;  3E1T A;  4P9S A;  4U8N A;  2X8H A;  1CC4 A;  4H4P A;  2DKI A;  1B4V A;  4G74 A;  4HB9 A;  3NYE A;  1M64 A;  1YQ4 A;  2R0C A;  1NEN A;  1N4U A;  4BJZ A;  4XWZ A;  1QO8 A;  4K8D A;  1X31 B;  3AXB A;  3G5S A;  3P4S A;  3UOV A;  3LXD A;  1GND A;  1K0J A;  1GET A;  2WDQ A;  1YKJ A;  2VZ2 A;  3NKS A;  4YT0 A;  4C3Y A;  5KXJ A;  3CNP A;  1ZMC A;  3OC4 A;  3QSM A;  5HXI A;  3QVR A;  1DOC A;  3BI4 A;  1LTX R;  4ZCC A;  4TM0 A;  4B65 A;  3KU9 A;  2WP6 A;  3GD3 A;  2XVE A;  3BI5 A;  1XPQ A;  4J56 A;  2B9X A;  3CMM A;  1L0V A;  1K0L A;  2FJA A;  4K5S A;  3S5W A;  3SGL A;  4B68 A;  1KDG A;  4JY2 A;  1HYU A;  4FX9 A;  1BKW A;  2EQ8 A;  4GDP A;  3Q6J A;  1LQT A;  5KVH A;  1OJ9 A;  1LJ1 A;  4C5O A;  4EMW A;  3ISH A;  4IA6 A;  1IUW A;  4YSH A;  3EAN A;  1LPF A;  3NN6 X;  3FG2 P;  4Z26 A;  1GT8 A;  3GDP A;  4JDR A;  5JCI A;  2VVM A;  2YLX A;  3QVP A;  3CPH G;  4J2W A;  2AQJ A;  2VRL A;  4Z25 A;  1S2Y A;  2WP5 A;  1D7L A;  4PAA A;  1ZK7 A;  4YWO A;  4U2L A;  1NHR A;  4DSG A;  3ZDN A;  3NK0 X;  3M12 A;  5M0Z A;  4A9W A;  4ZN0 A;  2V3B A;  2YG7 A;  3UP4 A;  2GR2 A;  2F5Z A;  4IV9 A;  1MOK A;  2JK6 A;  1PBC A;  1PBE A;  1LVL A;  2QA2 A;  4OCG A;  4ZCD A;  2GAG B;  4J36 A;  3CND A;  4JQ9 A;  4NEW A;  3VQR A;  2WOV A;  4PAB A;  2XFU A;  4OPL A;  1BGJ A;  4YTN A;  3V76 A;  5BVA A;  1MXT A;  1OJC A;  2E1M A;  3IHG A;  3DK4 A;  3IWA A;  4U8I A;  4H4W A;  3AYI A;  2CDU A;  3B3R A;  3RNM A;  4AOS A;  5U63 A;  5ER0 A;  3S61 A;  2C7G A;  3VRA A;  3UOY A;  3GYX A;  2C76 A;  3G5R A;  4D03 A;  3C4A A;  3LZW A;  3DH9 A;  1E1M A;  2R45 A;  4DGK A;  1VG0 A;  4FK1 A;  3WE0 A;  4K5R A;  5EB5 A;  1H7X A;  1Y56 B;  2Y6R A;  1FEB A;  5J7X A;  3SX6 A;  1B8S A;  3L1R A;  4NEV A;  3D9X A;  1CJ4 A;  1GPE A;  3SXI A;  1IJH A;  3EAO A;  5JCK A;  1NAA A;  4UDP A;  4NTD A;  5IQ4 A;  3NTD A;  1XDI A;  2YAU A;  1PHH A;  1JU2 A;  3DME A;  2BAC A;  2O9Z A;  3RP8 A;  3UTF A;  3VR8 A;  2X50 A;  5BRT A;  3GMC A;  1YQ3 A;  4MJW A;  3RHA A;  3SFE A;  3K7Q X;  3NNE A;  1D4D A;  2R0G A;  2YLS A;  3DJJ A;  2BS2 A;  2Q0K A;  5IQ1 A;  2WPE A;  1W4X A;  1GRT A;  1YY5 A;  4JN9 A;  1GRG A;  4RSL A;  4UDQ A;  3EPT A;  2GMJ A;  4Y4M A;  3GSI A;  2HQM A;  3NTA A;  3ABV A;  2VRM A;  3RP6 A;  1GRB A;  2BCG G;  3DGZ A;  2AAQ A;  4A7A A;  3RP7 A;  4Z2U A;  3D1C A;  1RYI A;  1Y0P A;  3AD9 B;  4II3 A;  4YTM A;  3GRT A;  4EQS A;  5FMH A;  5KVI A;  3AEA A;  3ICS A;  3GD4 A;  4UDR A;  4CCQ A;  3ALJ A;  3COX A;  3ALM A;  1AOG A;  3BHK A;  3UKP A;  3DK8 A;  3AEG A;  1ZKQ A;  1TDF A;  3SZF A;  2C75 A;  1P2E A;  2J3N A;  4YXD A;  2XLR A;  2FJD A;  5HHF A;  2GMH A;  3ZYX A;  4WCT A;  4GDE A;  3GDN A;  4Z43 A;  3AEB A;  1L9C A;  2GAH B;  1PBF A;  2VQB A;  3AYL A;  2WPF A;  2WES A;  1TDK A;  3GYI A;  4BK2 A;  4Z2T A;  1LV0 A;  2ZZC A;  3BNU A;  2E5V A;  1D4C A;  4TLZ A;  1GTE A;  2C67 A;  4G73 A;  1RP0 A;  3B6D A;  4A6N A;  2RGO A;  4U2S A;  3LJP A;  4U8P A;  3UTH A;  4B1B A;  1NPX A;  4H4S A;  3ITJ A;  3H8I A;  3NLC A;  4H2R A;  2BC0 A;  2JB1 A;  1E6E A;  3T0K A;  4YSZ A;  2WOW A;  1GRE A;  3T2Z A;  2OA1 A;  1GAL A;  1F6M A;  4AT2 A;  1JEH A;  1GV4 A;  2TPR A;  4Y4N A;  3K30 A;  3ATQ A;  3UTE A;  4YSX A;  3CPJ G;  1VRQ B;  2XLS A;  1D7Y A;  2BC1 A;  1NG4 A;  1Y56 A;  2Z5Y A;  3UKA A;  2VOU A;  3M13 A;  3UKF A;  1KNP A;  1S3E A;  1TDN A;  3EF6 A;  2PHH A;  2XLT A;  2YLR A;  5M10 A;  3P4R A;  4U8O A;  2QCU A;  2R0P A;  1M6I A;  3NK2 X;  3GWD A;  4HA6 A;  4TM3 A;  4D04 A;  1KSS A;  3NK1 X;  4WX1 A;  4OPI A;  2YQU A;  2C65 A;  4C3X A;  1H83 A;  3NIX A;  5IPY A;  4IA5 A;  1GXF A;  2GH5 A;  2FJE A;  2OAM A;  2WDV A;  1GRH A;  1E1L A;  2JBV A;  4I58 A;  1SEZ A;  5C3J A;  1NHP A;  5J60 A;  4GCM A;  2B9W A;  1CF3 A;  2H88 A;  1EL7 A;  3JSK A;  4CY8 A;  2EQ9 A;  5KMP A;  2GRT A;  2Q6U A;  4YSY A;  4E0V A;  2YM2 A;  2ARD A;  4FDC B;  3VRB A;  5TR3 A;  2I0Z A;  3FIM B;  3KA7 A;  2C73 A;  1FEC A;  4Y4L A;  4J33 A;  5GRT A;  2QAE A;  2BK4 A;  4XXG A;  1IUS A;  2YLT A;  3CIR A;  3SZW A;  2WDR A;  3CNJ A;  2X8G A;  3QFB A;  2R46 A;  1RSG A;  1TDE A;  1GTH A;  4EM3 A;  3LZX A;  1FEA A;  1H7W A;  1KN0 A;  5EB4 A;  2GV8 A;  3I3L A;  2FJB A;  2R4E A;  2XLU A;  3CGE A;  2RGJ A;  4X9N A;  1PJ5 A;  1B5Q A;  5JCN A;  4IVO B;  3AE7 A;  4CCR A;  1K4Q A;  1KSU A;  3UTG A;  4TM1 A;  2XVH A;  1D5T A;  4H2Q A;  3C4N A;  3URH A;  3KVE A;  3T14 A;  3F8D A;  3SYI A;  1PXA A;  4AOX A;  1H2I A;  1PJ7 A;  2YWL A;  1BF3 A;  3GYJ A;  3NGC X;  3OZ2 A;  4U8J A;  4EIQ A;  2BRY A;  5KOW A;  1Q1R A;  1D4E A;  4APN A;  2B7S A;  1DOE A;  1OJD A;  1EL9 A;  2QA1 A;  1VDC A;  3AEE A;  4BV6 A;  2WP9 A;  4H7U A;  3H8L A;  2X99 A;  1PN0 A;  2XVJ A;  1CJ3 A;  2BK3 A;  3CGC A;  4YTP A;  2Q0L A;  4H50 A;  4GAP A;  1DNC A;  3AE3 A;  1OJA A;  4CNK A;  1JNZ A;  3FMW A;  3DJG X;  1CC2 A;  1Q1W A;  3KLJ A;  4KPR A;  4B69 A;  2GR3 A;  3LOV A;  4X9M A;  3UKQ A;  3GRS A;  3L5O A;  4M52 A;  4EQR A;  1FCD A;  1H86 A;  1JNR A;  4RG3 A;  1O94 A;  3V3N A;  2R4J A;  2YVF A;  2JB2 A;  1CHU A;  3L8K A;  2C3D A;  4H4U A;  4OPC A;  1PBB A;  3O0H A;  1S3B A;  4B63 A;  1MO9 A;  4H2N A;  1JOA A;  2XCG A;  2BA9 A;  3G5Q A;  2GB0 A;  2X3N A;  2Y6Q A;  1BGN A;  1N4W A;  2WS3 A;  1GOS A;  3KKJ A;  5KOX A;  5LV9 A;  1KFY A;  3FPZ A;  4OVI A;  1H84 A;  4AP1 A;  2GEW A;  1GSN A;  4ADW A;  3KPK A;  4CRT A;  2V61 A;  1E1K A;  4USQ A;  3DJE A;  1P2H A;  2YG3 A;  3C96 A;  1IUU A;  2XYO A;  1KNR A;  3P4P A;  2YLZ A;  5KNL A;  2R9Z A;  5CQF A;  3P1W A;  3T2Y A;  4ECH A;  1GEU A;  1F8W A;  4H2P A;  3VRD B;  4EM4 A;  3ADA B;  4RG4 A;  5FS9 A;  2W0H A;  3AEF A;  4ICY A;  4IVM B;  3KD9 A;  4BUR A;  3RED A;  3AYJ A;  3VR9 A;  2V5Z A;  2WBA A;  3T31 A;  3PG6 A;  4YKG A;  1VQW A;  3K7T A;  5BUL A;  4TM4 A;  3HYW A;  3H4K A;  4EMI A;  4O5U A;  2YLW A;  1ZMD A;  1F8R A;  3AED A;  1KF6 A;  1H81 A;  1OJT A;  1PXB A;  2FBW A;  1Z6L A;  4C74 A;  5JCL A;  2X8C A;  3ALL A;  1F8S A;  1F3P A;  4N9X A;  2IVD A;  1IUX A;  3I6D A;  1K0I A;  5GSN A;  4CY6 A;  5KRQ A;  2WU2 A;  3PO7 A;  2B76 A;  4KX6 A;  3IHM A;  2GQW A;  3IF9 A;  2WU5 A;  1TYT A;  4FK1 C;  1ELI A;  2C4C A;  5C2T A;  3SQP A;  4J57 A;  1ZP0 A;  1FL2 A;  4B66 A;  3CNS A;  2NVK X;  2XFP A;  4U8M A;  5BUK A;  3UOX A;  2WPC A;  1LQU A;  4A5L A;  2VVL G;  3ATR A;  1PJ6 A;  3ICT A;  2C64 A;  2WHD A;  1BWC A;  5FS8 A;  4Z24 A;  3BI2 A;  1S7M A;  5FS7 A;  4X4J A;  4B64 A;  1EL5 A;  1CC6 A;  3UKK A;  1ZDL A;  2NPX A;  3FBS A;  3AE2 A;  3F8R A;  2VVL A;  1L9E A;  4G9K A;  2CVJ A;  2DKH A;  3KPF A;  4J31 A;  4LII A;  1ZY8 A;  1DXL A;  2VQ7 A;  1CJC A;  1EL8 A;  1Q9I A;  3NRN A;  2YR4 A;  1O5W A;  2ZZ0 A;  5EBK A;  4G6G A;  4GUV A;  3GWF A;  1S2Q A;  3Q9T A;  4GF7 A;  2JB3 A;  3UCL A;  1XAN A;  3M0O A;  4K7Z A;  3QJ4 A;  3UKH A;  2YVJ A;  1E7P A;  2BS4 A;  1E39 A;  1COY A;  1PDH A;  2RAB A;  2WET A;  2C3C A;  2GR0 A;  1L9D A;  2OLO A;  1NHS A;  5FS6 A;  1IUV A;  2XFQ A;  2C66 A;  2AR8 A;  1BZL A;  2UZZ A;  2RGH A;  1PXC A;  4H4X A;  1ZOV A;  3PS9 A;  3DJD A;  1JRY A;  4LA1 A;  2OLN A;  4U8L A;  4TLX A;  3LAD A;  1REO A;  3V3O A;  1VG9 A;  1GRF A;  4OPT A;  1GRA A;  5HYM A;  5JRB A;  3II4 A;  1DJQ A;  3F8P A;  3GMB A;  3AE4 A;  2GQF A;  4AT0 A;  3DGH A;  4XWR A;  4H4Q A;  4UP3 A;  4C77 A;  2CUL A;  1H6V A;  1QLB A;  3CPI G;  4K22 A;  4OPG A;  2BYB A;  2E4G A;  3HZL A;  3P9U A;  1GER A;  1ONF A;  4JNA A;  2XVI A;  5KMQ A;  2TMD A;  4H4T A;  1E1N A;  2V60 A;  4GRT A;  4J34 A;  3HYX A;  4OPU A;  3R9U A;  3NH3 X;  2BXR A;  4NTC A;  1GES A;  3AE8 A;  3PVC A;  3AE5 A;  4A6N B;  2V3A A;  1IUT A;  4BK3 A;  1TYP A;  3CGB A;  4H4V A;  2XLP A;  2IID A;  2GF3 A;  2YVG A;  4O5Q A;  3AEC A;  2ACZ A;  2B7R A;  4NWZ A;  2JAE A;  4Z2R A;  2WQY A;  2XVF A;  4A79 A;  4H4Z A;  1JRX A;  2Q7V A;  2CFY A;  5CKU A;  5KMR A;  2YG4 A;  2C70 A;  3CNT A;  5EOW A;  2GVC A;  3K7M X;  2A89 A;  1ZX9 A;  2A87 A;  2BXS A;  1DOD A;  4EIP A;  3BHF A;  2BK5 A;  3AD7 B;  3IC9 A;  2C72 A;  5HY5 A;  4A99 A;  1QJD A;  3SFD A;  3T37 A;  1H82 A;  1NHQ A;  4B67 A;  4NZH A;  3DA1 A;  5U1O A;  1PS9 A;  2BS3 A;  3QSS A;  3HYV A;  5U25 A;  1O95 A;  2JKC A;  2YR6 A;  3NHO X;  2V6O A;  1CL0 A;  2XDO A;  3AD8 B;  3AE1 A;  3NT6 A;  3NYF A;  3SM8 A;  3AE6 A;  1FOH A;  4U8K A;  1NDA A;  3NYC A;  2ZBW A;  4CBQ A;  3CN8 A;  1EBD A;  5KWF A;  5L46 A;  3DK9 A;  2XFO A;  2Z5X A;  4II2 A;  4AP3 A;  4USR A;  4LU6 A;  3UKL A;  4H4Y A;  4H4R A;  4Z44 A;  2EQ7 A;  1NEK A;  4EQX A;  3BNM A;  3NG7 X;  4NTE A;  1UKV G;  3AWI A;  3T2K A;  4GR1 A;  1XHC A;  2BRA A;  3SZC A;  2OAL A;  3CGD A;  2B9Y A;  5DBJ A;  2XFN A;  2ZZB A;  1CJ2 A;  4DSH A;  5JCM A;  2GR1 A;  2WOI A;  1N4V A;  3CTY A;  3QSE A;  2APG A;  1JRZ A;  1ZOY A;  1YQZ A;  3AB1 A;  4JNQ A;  2EQ6 A;  2PYX A;  3QFA A;  5KMS A;  4I59 A;  3LB8 A;  1NG3 A;  3P4Q A;  1DOB A;  3SY4 A;  4REK A;  3UP5 A;  4OPD A;  1V59 A;  1N1P A;  4K2X A;  2BCP A;  1TRB A;  3ICR A;  4YKF A;  2H89 A;  4A65 A;  1CBO A;  1DJN A;  2YG6 A;  4EQW A;  2YR5 A;  3AE9 A;  4DNA A;  4BJY A;  1B37 A;  4U2T A;  2WEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...