4J57A

Structure of plasmodium falciparum thioredoxin reductase-thioredoxin complex
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
499
structure length
483
Chain Sequence
HTYDYDYVVIGGGPGGMASAKEAAAHGARVLLFDYVKPSSQGTKWGIGGTCVNVGCVPKKLMHYAGHMGSIFKLDSKAYGWKFDNLKHDWKKLVTTVQSHIRSLNFSYMTGLRSSKVKYINGLAKLKDKNTVSYYLKGDLSKEETVTGKYILIATGCRPHIPDDVEGAKELSITSDDIFSLKKDPGKTLVVGASYVALECSGFLNSLGYDVTVAVRSIVLRGFDQQCAVKVKLYMEEQGVMFKNGILPKKLTKMDDKILVEFSDKTSELYDTVLYAIGRKGDIDGLNLESLNMNVNKSNNKIIADHLSCTNIPSIFAVGDVAENVPELAPVAIKAGEILARRLFKDSDEIMDYSYIPTSIYTPIEYGACGYSEEKAYELYGKSNVEVFLQEFNNLEISAVHRSTCLAKLVCLKNEDNRVIGFHYVGPNAGEVTQGMALALRLKVKKKDFDNCIGIHPTDAESFMNLFVTISSGLSYAAKGGCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase 2
publication title Crystal Structure of the Plasmodium falciparum Thioredoxin Reductase-Thioredoxin Complex.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 155
structure length 483
sequence length 499
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF00890 FAD_binding_2 FAD binding domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4j57A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4j57A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4j57A02
4O5UA 1ZK7A 4PAAA 1N4UA 4TM1A 3CGBA 4B63A 1GRAA 1NDAA 1YQZA 1LQTA 4U2SA 3REDA 3UOVA 4C5OA 2YAUA 3CN8A 4AT2A 4C3XA 3CGEA 4J56A 2V3AA 1RP0A 1ZOYA 1KFYA 3ALLA 3UP4A 3IHMA 4Z43A 4A99A 2BC1A 2IVDA 4FX9A 1XPQA 2WDQA 3CPJG 1PHHA 2F5ZA 2V6OA 2NVKX 2YVFA 2C73A 2JAEA 4H2PA 5BULA 2YG5A 4BURA 1JOAA 5BUKA 2C3CA 3UTFA 4H4ZA 4OPUA 2YLSA 3BHFA 4OPCA 4DSHA 5IQ4A 2WEUA 4EQWA 3FMWA 4GR1A 1HYUA 3GDNA 3SFEA 1CBOA 2VRLA 2BYBA 2BCPA 1M6IA 2WPFA 4ADWA 3I3LA 4YT0A 4BK3A 3UCLA 4C77A 2C67A 2GH5A 1P2EA 2BS3A 4FK1A 4B64A 4H4XA 1NEKA 2R4JA 1PBBA 1OJTA 4Z24A 3AE7A 4K7ZA 2AR8A 1TDEA 3GWFA 4JY3A 3VR8A 3CTYA 3EAOA 3VQRA 1PN0A 1XDIA 5ER0A 1NENA 3GRSA 4GF7A 3M12A 2PHHA 1DOBA 4A5LA 1DODA 5EOWA 3NN0X 2X8CA 1CJ2A 2R45A 3R9UA 4XWRA 4YTPA 4MJWA 2B7SA 1JRXA 2BC0A 2A8XA 2ACZA 2B7RA 2JKCA 3NHOX 5DBJA 1H86A 4JDRA 2B9XA 3AEEA 4H4SA 1Y0PA 3AE8A 2C66A 3NTDA 4A7AA 3LZWA 2Y6QA 4BK2A 2V5ZA 4XXGA 3P4PA 3DMEA 1E6EA 3QSEA 4CNKA 2E1MA 3H4KA 3AEGA 4K8DA 2B9YA 2XVFA 3GMBA 4IVOB 4OPGA 4K22A 1ZDLA 4IVMB 3EPTA 1L0VA 3UTGA 2BABA 2JB3A 4NTDA 3GDPA 4H4VA 1DJQA 3KPFA 1Y56B 1DJNA 1F8RA 2BK5A 2VRMA 3K7MX 3RP8A 3GWDA 1VDCA 2H89A 1FECA 1BF3A 3NK2X 3VR9A 3IWAA 3VRBA 1ZMCA 3NYFA 3ZDNA 3P4SA 3RNMA 2YVJA 5U25A 4EMJA 1S2QA 3SGLA 2FBWA 3ZYXA 3C96A 1S3BA 4BJYA 4YTNA 4EQRA 2NPXA 4UP3A 3CNPA 1FEAA 1GXFA 1F8SA 5KOXA 1H6VA 3ALJA 3DK8A 1IUXA 1GERA 5JCKA 2R0GA 4IV9A 2AAQA 3AXBA 1QLBA 5FMHA 4X9NA 5BRTA 4OVIA 2H88A 1FCDA 4U8PA 1P2HA 2C64A 3WE0A 2WU5A 1M64A 1K4QA 2Y6RA 2V60A 2IVEA 2Q6UA 1GRBA 3BNMA 3ICTA 2DKHA 1ZY8A 3AB1A 3GMCA 1DNCA 2YLTA 3II4A 2CVJA 1BZLA 3T37A 3OZ2A 4J34A 3URHA 2OLNA 4PABA 4LIIA 1KSSA 3ITJA 2WDRA 4K2XA 2QA1A 4B1BA 1AOGA 4H4UA 3UKQA 1B5QA 2APGA 3BI2A 2XVHA 3DA1A 2XLUA 2EQ9A 3EANA 3QJ4A 1L9CA 2YM1A 1S2YA 1ELIA 4H4TA 1FL2A 3KKJA 3ATQA 1CL0A 4DNAA 1NHQA 2AQJA 4OPLA 2C3DA 2WOWA 2R9ZA 4I59A 4EM3A 3UKLA 5U63A 3V76A 2GR3A 1O95A 2YG7A 3CPHG 2UZZA 4A9WA 5FS7A 1REOA 4C74A 1GRGA 1EL8A 1IUTA 3DGZA 3ICRA 5JCIA 3IF9A 1PDHA 2VOUA 3AWIA 2GMJA 3NG7X 2XVJA 1F3PA 2PYXA 4J36A 3LOVA 1PXCA 5CQFA 3F8RA 4Y4LA 2R0PA 3FG2P 5FS9A 1GOSA 3RP7A 2BXSA 2YG6A 2YLWA 3CPIG 1E1KA 4U8MA 2VVLA 2EQ7A 3PVCA 4NZHA 4X4JA 4YXDA 1CC2A 4JN9A 3AYLA 1DOEA 1NHPA 1GTHA 4EIPA 5KWFA 2WPCA 4OPDA 2X99A 2WOVA 4UDQA 4REKA 4A6NA 1K0IA 1L9DA 4NTEA 4AP1A 3AD7B 1CF3A 3H8IA 1EL5A 2VQ7A 1TRBA 4J57A 1H83A 4J31A 2WETA 2ZZ0A 1VRQB 3V3OA 4UDPA 5TR3A 1D4DA 3AE4A 2QCUA 4YSHA 2X3NA 1GESA 3UOXA 1JRZA 3CNTA 3ISHA 1GTEA 1UKVG 4RG3A 4TM4A 3SFDA 4LA1A 1L9EA 2XFOA 3VRAA 2FJAA 1D7YA 1EL9A 4NEWA 2WOIA 3GSIA 3DGHA 3QSMA 1OJAA 4YTMA 3BI4A 3KVEA 3UKAA 1GRHA 1LTXR 4EM4A 2C70A 3UOYA 3UTHA 2GR0A 2XCGA 4BJZA 1VG9A 3AE1A 1O94A 2Q7VA 1QJDA 4YSZA 1B37A 4A6NB 1GETA 4KPRA 4GUVA 4IA5A 3QVRA 5J60A 3DJGX 3DK4A 1D4EA 2CFYA 4Z2UA 3DK9A 3IC9A 2YR5A 4CCQA 4ECHA 2C75A 4B68A 3P4RA 2WQYA 4U8NA 4BK1A 4D03A 3K7TA 1ZX9A 2WP9A 4Y4MA 1GRFA 1DOCA 3S61A 5GRTA 2ZZCA 4EMIA 1E7PA 1OJDA 3FIMB 2X50A 5C3JA 3OC4A 4CNJA 3AD8B 3AE9A 4TLXA 5KVIA 3KA7A 3LB8A 4K5RA 2YLZA 2YR6A 1D4CA 4J33A 5JCLA 3QFBA 1CJCA 1YY5A 4U8LA 2YVGA 1EL7A 1IUVA 2XLSA 1H84A 3NNEA 1KNPA 4GDEA 3UKFA 1BWCA 1NHSA 5U1OA 1N4WA 3CNDA 1KF6A 1W4XA 4USQA 5JCNA 1VG0A 1JRYA 3ICSA 5CKUA 3LADA 4LU6A 4USRA 1H7XA 4DSGA 3NIXA 3FPZA 1PJ7A 2GEWA 2OALA 1Q1RA 3G5SA 1XANA 1LJ1A 5LV9A 2GAGB 1GPEA 3EF6A 4P9SA 4CY6A 4DGKA 1RYIA 1ZP0A 5KXJA 2HQMA 2JK6A 3NK0X 5EB5A 1KDGA 1KSUA 3C4NA 2X8HA 1XHCA 3ATRA 3NYEA 2WP5A 1BGJA 4IA6A 1TDOA 3G5RA 4C3YA 3B3RA 4EIQA 2BCGG 1YKJA 2TMDA 3PS9A 1E1MA 2C72A 2EQ6A 3AE6A 4D04A 4H50A 1CHUA 1PBEA 3Q9TA 3GYIA 1N1PA 4CCRA 3P9UA 4GDPA 2B9WA 1CC4A 4EQSA 5FS8A 4NEVA 1D5TA 1Q9IA 3NN6X 1MXTA 2WBAA 1Q1WA 2ZZBA 3O0HA 2XVEA 3PO7A 3D1CA 1GREA 4H2NA 4HB9A 2R0CA 4AOSA 3HZLA 2V3BA 3QVPA 4XWZA 3E1TA 2OA1A 1BGNA 2OLOA 4Z26A 2BS4A 3SM8A 2W0HA 2YLXA 1VQWA 3ABVA 5JCMA 2GRTA 3FBSA 1H81A 5BVAA 1H82A 2IIDA 3LXDA 2Q0KA 3CNSA 4HA6A 2TPRA 2X8GA 1B8SA 1LVLA 2XLPA 3AE5A 3S5WA 3QFAA 4ZN0A 3VRDB 4NTCA 1TDKA 4M52A 4ICYA 4YWOA 4EMWA 3V3NA 3AEAA 4Y4NA 3CIRA 1E1LA 1JNRA 2YG4A 3AEBA 4JQ9A 3F8PA 2WU2A 4Z2RA 3GRTA 3L1RA 2JB2A 2XLTA 3CGCA 2BK3A 3Q6JA 4APNA 4B67A 2YG3A 2FJBA 1K0LA 2JBVA 2ZBWA 4U2TA 4I58A 1TYPA 3JSKA 1KNRA 2XFQA 4KX6A 1LV0A 2R46A 2XDOA 3M0OA 1GT8A 2EQ8A 1JU2A 4H4WA 5J7XA 5M0ZA 4H2RA 3UTEA 4AP3A 2BA9A 2BS2A 1GSNA 2FJEA 3AE3A 3AEFA 3UKHA 2YLRA 2XFPA 2RGJA 3K7QX 3QSSA 5GSNA 3UKKA 4U8JA 3G5QA 4B66A 2WDVA 2WHDA 4A65A 4CBQA 3CNJA 3ALMA 4TM0A 2RGHA 5M10A 3C4AA 3COXA 4Z25A 3NRNA 3UOZA 1E39A 3SQPA 1IUUA 4WCTA 2C65A 2BXRA 2XYOA 1ONFA 4U2LA 2RGOA 1MOKA 4A79A 3I6DA 2QA2A 1F6MA 3GD3A 1Y56A 4YKFA 2XFUA 2CULA 2GV8A 1V59A 3AYIA 3KD9A 1NHRA 2B76A 3AEDA 1H7WA 4JY2A 2CDUA 4B69A 4OPTA 5EBKA 2C76A 4UDRA 2GQFA 1GV4A 1NG3A 4AT0A 2WP6A 5HXIA 1SEZA 2GR1A 2Z5YA 1MO9A 3BNUA 4TLZA 3B6DA 4WX1A 4AOXA 1O5WA 3GYJA 1PJ6A 3AE2A 4ZCDA 1FEBA 2VVMA 2VVLG 2E4GA 2GAHB 2OAMA 1PBDA 2YR4A 3D8XA 3LJPA 1TDNA 1CJ4A 2J3NA 3RHAA 4YKGA 1ZOVA 1BKWA 2BK4A 2XFNA 2YM2A 3AYJA 1GEUA 5KRQA 1QO8A 4O5QA 1YQ3A 3UP5A 4Z44A 5HY5A 3NTAA 1E1NA 1RSGA 3BI5A 5L46A 3NH3X 5KVHA 3NT6A 4K5SA 4U8KA 4E0VA 2GMHA 2VQBA 4X9MA 2C7GA 1Z6LA 5KOWA 2RABA 1D7LA 3NGCX 1ZMDA 3NLCA 4JNAA 1TDFA 4H4RA 4RG4A 3P4QA 1IJHA 1GNDA 5IPYA 2O9ZA 2GF3A 4BV6A 1EBDA 3BHKA 5FS6A 1S3EA 3DJEA 2DKIA 1PBFA 3L8KA 3M13A 2R4EA 2WPEA 4ZCCA 2FJDA 4GRTA 1NG4A 4FDCB 3IHGA 4OPIA 1COYA 4RSLA 3F8DA 3K30A 1TYTA 1N4VA 1NPXA 2XVIA 4FK1C 4B65A 2E5VA 1FOHA 2XLRA 4TM3A 1IUWA 1PXBA 2GB0A 2YWLA 4Z2TA 1IUSA 3LZXA 1ZKQA 2A89A 2GQWA 1B4VA 1PBCA 4H4PA 3CGDA 3GD4A 3NK1X 5IQ1A 3H8LA 1CJ3A 3DJDA 4H4QA 4H7UA 4H4YA 3AD9B 2GVCA 4H2QA 3RP6A 1JNZA 4GCMA 1GALA 2I0ZA 3NKSA 3AECA 2WESA 3DJJA 1PXAA 5C2TA 1JEHA 3NYCA 1YQ4A 4J2WA 4N9XA 4YSYA 1PS9A 3KLJA 3UKPA 1CC6A 2VZ2A 4OCGA 4U8OA 4U8IA 2GR2A 2BACA 1X31B 1F8WA 2ARDA 2YQUA 1PJ5A 3ADAB 4JNQA 3DH9A 5EB4A 2QAEA 2A87A 1LPFA 1K0JA 1LQUA 1GRTA 4EQXA 2WS3A 1OJ9A 4YSXA 5HHFA 2Q0LA 4CRTA 5HYMA 4CY8A 2Z5XA 1OJCA 1NAAA 1DXLA 2JB1A 2V61A 3P1WA 3KU9A
chains in the Genus database with same CATH superfamily
1ZK7A 3CGBA 1NDAA 2OPJA 3VDGA 1EBGA 4AT2A 3N6HA 2GGIA 2BC1A 2O56A 1JROA 3PK7A 1PHHA 4BURA 5BUKA 4OPUA 2YLSA 4GAPA 4EQWA 1CBOA 2BYBA 1M6IA 4ADWA 4YT0A 3UCLA 1NEKA 3AE7A 3ENLA 3VR8A 5ER0A 4GF7A 2PHHA 2AL2A 5EOWA 3TOYA 4XWRA 4GGHA 5KMPA 5DBJA 1H86A 3AEEA 4H4SA 1Y0PA 3UJSA 2GGGA 3NTDA 4HNLA 2V5ZA 1SB3B 3AEGA 2B9YA 3CYJA 5IDZA 3GDPA 1Y56B 4HPNA 1VDCA 3N4FA 1FECA 3V3WA 1F9CA 3P4SA 3ZDNA 3RNMA 3P0WA 1S3BA 4YTNA 1TE6A 5KOXA 1N63C 1H6VA 3ALJA 3EUB3 3UJFA 1IUXA 3NVZB 5FMHA 3SR6B 4OVIA 2H88A 2WU5A 2Y6RA 4II2A 1ZY8A 1BZLA 4FI4A 3ITJA 4B1BA 3BI2A 3NVVB 3EANA 2XH4A 4DNAA 1NHQA 2AQJA 3HRDC 1P43A 1N60C 4KPLA 4IL0A 5JCIA 3AWIA 3HPFA 2XVJA 3LOVA 4Y4LA 1EC8A 2BXSA 2VVLA 4YXDA 1NHPA 4DYEA 1GTHA 5KWFA 2WOVA 4A6NA 1CF3A 3T9PA 3SN4A 1TRBA 2PGWA 2ZZ0A 3V3OA 3MKCA 3AE4A 3U9IA 4YSHA 3ISHA 3PFRA 4G8TA 4HYRA 1L9EA 4NEWA 3DGHA 4EM4A 4GISA 3T8QA 4BJZA 1QJDA 3JZUA 1B37A 1PDYA 3S5SA 1D4EA 4Z2UA 1WUFA 1E9IA 4GGBA 4CCQA 4B68A 3DG6A 2HZGA 3K7TA 3UXLA 1GRFA 3V4BA 1SJBA 3RGTA 2X50A 2YLZA 2YR6A 4J33A 3TTEA 1CJCA 1EL7A 2XLSA 3OTRA 4J3ZA 4IL2A 3CNDA 1KF6A 5JCNA 4G7FA 5CKUA 4LU6A 3FPZA 3G5SA 1FO4A 1GPEA 4P9SA 5FJUA 1RYIA 2HQMA 1KDGA 2X8HA 3ATRA 3STPA 4IA6A 3B3RA 1YKJA 3AE6A 4HCLA 3GYIA 3P9UA 4GDPA 3DG3A 2XVEA 4K8GA 3IJLA 4HCHA 3AM9A 2W0HA 2YLXA 3ABVA 2OX4A 2GRTA 1H81A 2IIDA 2X8GA 2XLPA 3I4KA 4ZN0A 5BOFA 3PG6A 1TDKA 4EMWA 4Y4NA 1JNRA 3L1RA 3MSYA 2XLTA 3Q6JA 2FJBA 2JBVA 1TYPA 4DHGA 2XFQA 1MUCA 3M0OA 2EQ8A 5M0ZA 4G9KA 4AP3A 1GSNA 1RVKA 3SBFA 3K7QX 4CBQA 4TM0A 5M10A 3NVYB 1IUUA 4YWSA 1ONFA 3GD6A 2RGOA 3DGBA 3CK5A 1DTNA 1Y56A 3AYIA 3KD9A 3KPKA 4JN7A 4JY2A 4OPTA 5EBKA 4UDRA 1GV4A 2WP6A 4II3A 4TLZA 2Z5YA 2OAMA 1PBDA 3D8XA 4YKGA 1ZOVA 2XFNA 2YM2A 1GEUA 2OZTA 1YQ3A 3BI5A 1RM6B 4K5SA 2VQBA 5G5GB 1Z6LA 4G74A 3R25A 3KUMA 4H4RA 1GNDA 3R07C 4G6HA 2O9ZA 3SXIA 2GF3A 1EBDA 2E5AA 2DKIA 2WPEA 4OPIA 3IHGA 3CXOA 3F8DA 1TYTA 4B65A 4FP1A 2YWLA 4H19A 4Z2TA 3SZ0A 1PBCA 3GD4A 3NK1X 4ZOHB 3DG7A 3NO1A 4E5TA 2I0ZA 4MMWA 5C2TA 4YSYA 2W3SA 4U8OA 3ADAB 2ARDA 4JNQA 4DWDA 2A87A 1LPFA 2WS3A 3FV9A 4CRTA 1ELSA 1DXLA 2JB1A 4ENLA 4PAAA 3REDA 1YQZA 4U2SA 4C5OA 2POZA 1RP0A 3AN1A 3ALLA 3IHMA 1ONEA 2IVDA 1XPQA 3CPJG 2NVKX 5BULA 2P8BA 2YG5A 2C3CA 3UTFA 4H4ZA 5IQ4A 3T4WA 4ZA0A 2BCPA 3I3LA 4FK1A 2R4JA 1OJTA 3T2KA 3GWFA 2AR8A 3ES8A 3VQRA 3EAOA 1PN0A 1XDIA 2XGZA 3SQSA 3GRSA 4A5LA 3NN0X 2R45A 3R9UA 2GGHA 4YTPA 1JRXA 3T2ZA 2BC0A 2B7RA 2JKCA 2B9XA 4A7AA 3LZWA 4XXGA 3QSEA 3SZWA 3H4KA 4K8DA 3NS1B 3GMBA 2XVFA 4OPGA 1ZDLA 2BABA 4NNJA 4H4VA 1KKOA 1F8RA 2BK5A 2VRMA 3NYFA 3DDMA 2YVJA 5U25A 4BJYA 4GMEA 4EQRA 1GXFA 3DK8A 3AXBA 1QLBA 4X9NA 5BRTA 2C64A 1M64A 2V60A 3BNMA 3ICTA 2DKHA 1DNCA 4IT1A 3II4A 3T37A 3OZ2A 4J34A 2GGJA 4E4FA 2QA1A 4H4UA 3UKQA 1B5QA 3DA1A 1H2IA 2PSNA 3QJ4A 1S2YA 3VA8A 1EBHA 3OZYA 3DIPA 4OPLA 2C3DA 1WYGA 1FIQB 3ZLGA 4DXKA 1FFVC 2GR3A 1TKKA 1R6WA 3CPHG 4A9WA 5FS7A 4C74A 4HCDA 3IF9A 2DW6A 3NG7X 5CQFA 3FG2P 1GOSA 3OP2A 3CPIG 4U8MA 2EQ7A 1CC2A 4JN9A 2WPCA 3EEZA 2X99A 2PU1A 4EWJA 3AD7B 2DW7A 2VQ7A 2PGEA 1H83A 5TR3A 2QCUA 1GESA 3CNTA 1GTEA 1UKVG 1L8PA 4RG3A 3VRAA 3GSIA 3UKAA 3KVEA 2FYMA 3TJ4A 3NXLA 3VC5A 3BSMA 3T31A 3T6CA 1VQZA 1GETA 3QVRA 4ECHA 4MGGA 4D03A 4GAVA 2ONEA 2WP9A 4MKSA 4JN8A 3CXBA 1VDVA 4CNJA 3AD8B 3AE9A 4TLXA 3LB8A 1D4CA 5JCLA 4U8LA 3SN0A 2PP0A 3NNEA 4GDEA 2XH0A 3SX6A 4DSGA 2OALA 3SJNA 1XANA 3R1ZA 5KXJA 3C4NA 1XHCA 3NYEA 2WP5A 3BJSA 4C3YA 3U4FA 1E1MA 2C72A 4D04A 4H50A 1CHUA 1PBEA 4CCRA 3BOXA 4NEVA 1D5TA 3PWGA 3D1CA 1GREA 4AOSA 2V3BA 3QVPA 2OA1A 1BGNA 1X2GA 2BS4A 4HA6A 3LXDA 2TPRA 5BOEA 3ZLHA 4M52A 2C4CA 3V3NA 3AEAA 3AEBA 3F8PA 2WU2A 4Z2RA 3A7RA 2P88A 4APNA 3H12A 2ZBWA 3JSKA 1KNRA 1LV0A 1KN0A 5J04A 1S7MA 2PTYA 3UTEA 1FHUA 2W3RA 3B97A 2BS2A 3HYWA 1SJDA 3CMMA 2XFPA 2RGJA 5GSNA 2GDQA 3UKKA 2OZ3A 4B66A 4HNCA 3JW7A 2RGHA 3C4AA 3COXA 3UOZA 3DERA 1E39A 3SQPA 4U2LA 3UCCA 1MOKA 3I6DA 2QA2A 2XFUA 2GV8A 2B76A 3AEDA 2RDXA 3UCDA 3QKEA 2GR1A 1MO9A 4J1OA 3AE2A 4ZCDA 2VVMA 3LJPA 2GAHB 1TDNA 3FYYA 1BKWA 4O5QA 3UP5A 5HY5A 2OG9A 1E1NA 5L46A 5KVHA 3HYVA 3R0KA 4X9MA 3NLCA 4JNAA 5IPYA 4BV6A 5FS6A 2FKPA 2R4EA 4GRTA 1NG4A 4RSLA 4FK1C 1BKHA 1FOHA 1N5XA 2PPGA 1IUSA 4H4PA 3CGDA 1CJ3A 4H7UA 2PS2A 3QN3A 2PTZA 3VCNA 1GALA 3AECA 2WESA 1PXAA 1PS9A 4U8IA 4M6UA 2BACA 1F8WA 2YQUA 2QAEA 3SN1A 4F4RA 3SYIA 1GRTA 1OJ9A 5HHFA 2Q0LA 4M0XA 5HYMA 3ES7A 1OJCA 3D46A 2V61A 3ZVHB 4O5UA 3DEQA 3AMZA 1GRAA 1LQTA 2YAUA 3CN8A 3UGVA 3CGEA 4J56A 3RO6A 4Z43A 3JVAA 2WDQA 2V6OA 2C73A 4H2PA 3THUA 1JOAA 3HYXA 3BHFA 2WEUA 3FMWA 3SFEA 2VRLA 3TW9A 3FCPA 2WPFA 4BK3A 4C77A 4H4XA 3GO2A 1PBBA 4JY3A 1TDEA 3T2YA 3IK4A 1NENA 2OFJA 2CHRA 1DOBA 3TJIA 1DODA 2X8CA 2OQHA 4MJWA 3IJQA 2MUCA 2A8XA 2ACZA 3NHOX 2PA6A 2Y6QA 2NQLA 3DMEA 1E6EA 2E1MA 3UJRA 3UTGA 2JB3A 4NTDA 1DJQA 3KPFA 3FJ4A 1DJNA 3RP8A 3GWDA 2H89A 1BF3A 4TVWA 2AL2B 3VRBA 1ZMCA 1S2QA 3ZYXA 3C96A 3CNPA 1F8SA 5JCKA 4IV9A 1JDFA 3T0KA 4U8PA 2P3ZA 3D47A 1K4QA 2IVEA 2Q6UA 3GMCA 3DESA 2YLTA 3V5FA 2OLNA 4PABA 1KSSA 4K2XA 1AOGA 2APGA 3TQPA 2PP1A 2YM1A 1ELIA 4H4TA 3ATQA 1CL0A 4NWZA 2R9ZA 4I59A 4H1ZA 3V76A 1O95A 1IYXA 1WUEA 2YG7A 2OVLA 2OZ8A 1REOA 3TWBA 1GRGA 1EL8A 1IUTA 1MRAA 3ICRA 2VOUA 2GMJA 3RCYA 1F3PA 1PXCA 3RP7A 1N61C 2YG6A 2GSHA 1E1KA 2QQ6A 4IP5A 3AYLA 4REKA 1K0IA 1L9DA 4AP1A 3H8IA 2W55A 4J31A 2WETA 3FVDA 3NRZB 1VRQB 1D4DA 3N4EA 1JRZA 3B9JB 4LA1A 2XFOA 1D7YA 1EL9A 4E4UA 3QSMA 1OJAA 4YTMA 3BI4A 1GRHA 1LTXR 3UOYA 2I5QA 2XCGA 4GFIA 1VG9A 3AE1A 2Q7VA 4A6NB 3PWIA 3RR1A 5J60A 3DJGX 3DK4A 4X2PA 6ENLA 2E3TA 3SSZA 2C75A 3P4RA 2PU0A 3A7AA 1YEYA 1P48A 4Y4MA 3FXGA 3S61A 5GRTA 3GY1A 4EMIA 1E7PA 1OJDA 2QVHA 3FIMB 3K1GA 5C3JA 3OC4A 5KVIA 3KA7A 4K5RA 2XH7A 3DFYA 1KNPA 3UKFA 1BWCA 3MZNA 4USQA 2ZADA 1VG0A 3ICSA 1NU5A 1FHVA 3NIXA 1JPMA 3IJIA 1PJ7A 1Q1RA 5LV9A 2GAGB 3EF6A 4CY6A 4DGKA 3DFHA 1ZP0A 2JK6A 1KSUA 1BGJA 4EIQA 2BCGG 4Z1YA 3ZVHA 3Q9TA 1N1PA 2BRAA 1W6TA 3RITA 1MXTA 2ZZBA 1Q1WA 3O0HA 3PO7A 4HB9A 2MNRA 2R0CA 1SJAA 4XWZA 2OLOA 4Z26A 3SM8A 1VQWA 5JCMA 5BVAA 1B8SA 3S5WA 1JPDX 4ICYA 3CIRA 2PMQA 4JQ9A 2JB2A 1X2HA 4A35A 4B67A 2QJMA 1K0LA 4I58A 3VFCA 3OZMA 2R46A 2XDOA 1GT8A 1JCTA 4DN1A 4H2RA 2FJEA 3AEFA 3AE3A 3UKHA 2YLRA 5ENLA 3R11A 1KCZA 2HXUA 2WDVA 2WHDA 5KMSA 2HNEA 3CB3A 3CNJA 3ALMA 4Z25A 4HN8A 2XSXA 2C65A 2XYOA 3UJ2A 2AKMA 1KKRA 2CULA 1NHRA 3R0UA 1H7WA 2CDUA 1TZZA 1NG3A 5HXIA 1SEZA 4E6MA 5G5HB 1O5WA 2PP3A 2J3NA 4KT2A 4JHMA 2BK4A 1OEPA 5KRQA 3AYJA 1RSGA 3NH3X 4E0VA 2C7GA 5KOWA 1D7LA 1TDFA 4RG4A 1IJHA 4IP4A 2QDDA 3OW1A 4IZGA 4IHCA 1S3EA 1FFUC 3L8KA 2FJDA 4FDCB 1COYA 5KMQA 2P0IA 1N4VA 2E5VA 4TM3A 2GB0A 3LZXA 3H8LA 3D9XA 3DJDA 3OPSA 3AD9B 3RP6A 1JNZA 5FJTA 4J2WA 4N9XA 3KLJA 1CC6A 4OCGA 1X31B 5EB4A 1PJ5A 1LQUA 1MDRA 4GYPC 3ZVIA 3Q45A 2Z5XA 3NFUA 3P1WA 3H8AA 3KU9A 2AL1A 1N4UA 4TM1A 4B63A 3UOVA 4C3XA 2V3AA 1ZOYA 5FJPA 1KFYA 3UP4A 3UJEA 4A99A 4FX9A 2F5ZA 2PCEA 2JAEA 2YVFA 5FJRA 3S47A 4OPCA 4G6GA 4DSHA 3GDNA 4GR1A 1HYUA 3MUCA 4G73A 2C67A 1EC7A 2GH5A 1P2EA 7ENLA 2BS3A 4B64A 4Z24A 4K7ZA 3NZGA 3QLDA 3CTYA 1N62C 3QPEA 3M12A 1CJ2A 3RRAA 2B7SA 3L5OA 4JDRA 3AE8A 2C66A 4BK2A 3MWCA 3P4PA 5JRBA 4ZCWA 4CNKA 5FJOA 4IVOB 4K22A 4IVMB 3EPTA 1L0VA 3UXKA 3K7MX 3NK2X 3VR9A 3IWAA 4EMJA 1N5WC 3SGLA 2FBWA 2NPXA 4UP3A 2AKZA 1FEAA 1EC9A 1GERA 2R0GA 2BRYA 2AAQA 1FCDA 1P2HA 3T14A 3TWAA 1GRBA 3AB1A 2CVJA 4Z17A 5KNLA 2W54A 3URHA 4LIIA 2WDRA 1BQGA 2XVHA 2XLUA 2EQ9A 3TCSA 1L9CA 4K1WA 2XH2A 1FL2A 3KKJA 4H83A 2WOWA 3GC2A 4EM3A 3UKLA 5U63A 2UZZA 3Q4DA 3DGZA 1PDHA 2HXTA 2PYXA 4J36A 3F8RA 2R0PA 5FS9A 2YLWA 4TVYA 3PVCA 4NZHA 4X4JA 1DOEA 4EIPA 4OPDA 4UDQA 4NTEA 1EL5A 4J57A 4UDPA 1MDLA 2X3NA 3UOXA 2QJNA 3I6EA 4TM4A 3SFDA 2FJAA 3P3BA 2WOIA 2C70A 3UTHA 2GR0A 1O94A 1MNSA 4YSZA 3HW2A 4KPRA 4GUVA 2QJJA 4IA5A 2CFYA 3DK9A 3IC9A 2YR5A 3SZCA 4U8NA 2WQYA 4BK1A 1ZX9A 3H7VA 2OQYA 1DOCA 4GYPA 2ZZCA 3CT2A 3QFBA 1YY5A 2YVGA 1IUVA 1H84A 1NHSA 5U1OA 1N4WA 1W4XA 2PTXA 1JRYA 3LADA 1PDZA 4USRA 1H7XA 2GEWA 1LJ1A 4DX3A 4ROPA 2QDEA 3NK0X 5EB5A 1TDOA 3G5RA 2OKTA 2TMDA 3PS9A 2EQ6A 3ZLFA 1NELA 3EKGA 2B9WA 1CC4A 4EQSA 5FS8A 1Q9IA 3NN6X 2WBAA 1V97A 3ETRB 4H2NA 3HZLA 3E1TA 3FBSA 2PTWA 1H82A 3CNSA 2Q0KA 1LVLA 3AE5A 3QFAA 3VRDB 4NTCA 4YWOA 1E1LA 2YG4A 3GRTA 3VCCA 3CGCA 2BK3A 2YG3A 1KD0A 4U2TA 4KX6A 3P93A 5J7XA 1JU2A 4H4WA 3N6JA 3CAWA 2BA9A 1XS2A 1ECQA 3R10A 4A6GA 3QSSA 4U8JA 3G5QA 4A65A 2OO6A 3NRNA 2ZC8A 5EU9A 3H70A 4WCTA 2BXRA 3MY9A 5KMRA 3MQTA 4A79A 1F6MA 3GD3A 1ZXIC 4YKFA 1V59A 4K2SA 2PODA 4B69A 3SZFA 2C76A 2GQFA 4AT0A 3BNUA 3B6DA 1XPYA 4WX1A 4AOXA 3GYJA 1PJ6A 1FEBA 2VVLG 2YR4A 2E4GA 1CJ4A 3RHAA 3VC6A 1QO8A 4Z44A 3NTAA 3NT6A 2GGEA 4U8KA 2GMHA 2RABA 3GYXA 3NGCX 1ZMDA 3NVWB 3P4QA 3A7UA 3BHKA 3DJEA 1PBFA 3M13A 4ZCCA 1SJCA 1STZA 3V5CA 3K30A 1NPXA 2QGYA 2XVIA 2XLRA 4A3RA 1IUWA 1PXBA 4KEMA 1ZKQA 2A89A 2GQWA 1B4VA 5IQ1A 4H4QA 4H4YA 2GVCA 4H2QA 1T3QC 1R0MA 4H2HA 4GCMA 3NKSA 2GL5A 3DJJA 1JEHA 3SY4A 1JRPA 1YQ4A 3NYCA 2P8CA 3UKPA 2VZ2A 2GR2A 3DH9A 3I6TA 1K0JA 3QTPA 4E8GA 4EQXA 4KWSA 4YSXA 2OLAA 4CY8A 1NAAA 4GIRA 3WE0A
chains in the Genus database with same CATH topology
4O5UA 1ZK7A 4PAAA 1N4UA 4TM1A 3CGBA 4B63A 1GRAA 1NDAA 1YQZA 1LQTA 4U2SA 3REDA 3UOVA 4C5OA 2YAUA 3CN8A 4AT2A 4C3XA 3CGEA 4J56A 2V3AA 1RP0A 1ZOYA 1KFYA 3ALLA 3UP4A 3IHMA 4Z43A 4A99A 2BC1A 2IVDA 4FX9A 1XPQA 2WDQA 3CPJG 1PHHA 2F5ZA 2V6OA 2NVKX 2YVFA 2C73A 2JAEA 4H2PA 5BULA 2YG5A 4BURA 1JOAA 5BUKA 2C3CA 3UTFA 3HYXA 4H4ZA 4OPUA 2YLSA 3BHFA 4G6GA 4GAPA 4OPCA 4DSHA 2WEUA 4EQWA 3FMWA 4GR1A 1HYUA 3GDNA 3SFEA 1CBOA 2VRLA 2BYBA 2BCPA 1M6IA 2WPFA 4ADWA 3I3LA 4G73A 4YT0A 4BK3A 3UCLA 4C77A 2C67A 2GH5A 1P2EA 2BS3A 4FK1A 4B64A 4H4XA 1NEKA 2R4JA 1PBBA 1OJTA 4Z24A 3AE7A 4K7ZA 2AR8A 1TDEA 3GWFA 4JY3A 3T2KA 3VR8A 3CTYA 3EAOA 3VQRA 3T2YA 1PN0A 1XDIA 5ER0A 1NENA 3GRSA 4GF7A 3M12A 2PHHA 1DOBA 4A5LA 1DODA 5EOWA 3NN0X 2X8CA 1CJ2A 2R45A 3R9UA 4XWRA 4YTPA 4MJWA 2B7SA 1JRXA 3T2ZA 2BC0A 2A8XA 2ACZA 2B7RA 2JKCA 3NHOX 5DBJA 1H86A 5KMPA 3L5OA 4JDRA 2B9XA 3AEEA 4H4SA 1Y0PA 3AE8A 2C66A 3NTDA 4A7AA 3LZWA 2Y6QA 4BK2A 2V5ZA 4XXGA 3P4PA 3DMEA 5JRBA 1E6EA 3QSEA 4CNKA 2E1MA 3H4KA 3SZWA 3AEGA 4K8DA 2B9YA 2XVFA 3GMBA 4IVOB 4OPGA 4K22A 1ZDLA 4IVMB 3EPTA 1L0VA 3UTGA 2BABA 2JB3A 4NTDA 4NNJA 3GDPA 4H4VA 1DJQA 3KPFA 1Y56B 1DJNA 1F8RA 2BK5A 2VRMA 3K7MX 3RP8A 3GWDA 1VDCA 2H89A 1FECA 1BF3A 3NK2X 3VR9A 3IWAA 3VRBA 1ZMCA 3NYFA 3ZDNA 3P4SA 3RNMA 2YVJA 5U25A 4EMJA 1S2QA 3SGLA 2FBWA 3ZYXA 3C96A 1S3BA 4BJYA 4YTNA 4EQRA 2NPXA 4UP3A 3CNPA 1FEAA 1GXFA 1F8SA 5KOXA 1H6VA 3ALJA 3DK8A 1IUXA 1GERA 5JCKA 2R0GA 2BRYA 4IV9A 2AAQA 3AXBA 1QLBA 5FMHA 4X9NA 5BRTA 4OVIA 3T0KA 2H88A 1FCDA 4U8PA 1P2HA 2C64A 3WE0A 2WU5A 1M64A 1K4QA 2Y6RA 3T14A 2V60A 2IVEA 2Q6UA 1GRBA 3BNMA 3ICTA 2DKHA 1ZY8A 3AB1A 3GMCA 4II2A 1DNCA 2YLTA 3II4A 2CVJA 1BZLA 3T37A 5KNLA 3OZ2A 4J34A 3URHA 2OLNA 4PABA 4LIIA 1KSSA 3ITJA 2WDRA 4K2XA 2QA1A 4B1BA 1AOGA 4H4UA 3UKQA 1B5QA 2APGA 3BI2A 2XVHA 3DA1A 1H2IA 2XLUA 2EQ9A 3EANA 3QJ4A 1L9CA 2YM1A 1S2YA 1ELIA 4H4TA 1FL2A 3KKJA 3ATQA 1CL0A 4DNAA 1NHQA 2AQJA 4NWZA 4OPLA 2C3DA 2WOWA 2R9ZA 4I59A 4EM3A 3UKLA 5U63A 3V76A 2GR3A 1O95A 2YG7A 3CPHG 2UZZA 4A9WA 5FS7A 1REOA 4C74A 1GRGA 1EL8A 1IUTA 3DGZA 3ICRA 5JCIA 3IF9A 1PDHA 2VOUA 3AWIA 2GMJA 5IQ4A 3NG7X 2XVJA 1F3PA 2PYXA 4J36A 3LOVA 1PXCA 5CQFA 3F8RA 4Y4LA 2R0PA 3FG2P 5FS9A 1GOSA 3RP7A 2BXSA 2YG6A 2YLWA 3CPIG 1E1KA 4U8MA 2VVLA 2EQ7A 3PVCA 4NZHA 4X4JA 4YXDA 1CC2A 4JN9A 3AYLA 1DOEA 1NHPA 1GTHA 4EIPA 5KWFA 2WPCA 4OPDA 2X99A 2WOVA 4UDQA 4REKA 4A6NA 1K0IA 1L9DA 4NTEA 4AP1A 3AD7B 1CF3A 3H8IA 1EL5A 2VQ7A 1TRBA 4J57A 1H83A 4J31A 2WETA 2ZZ0A 1VRQB 3V3OA 4UDPA 5TR3A 1D4DA 3AE4A 2QCUA 4YSHA 2X3NA 1GESA 3UOXA 1JRZA 3CNTA 3ISHA 1GTEA 1UKVG 4RG3A 4TM4A 3SFDA 4LA1A 1L9EA 2XFOA 3VRAA 2FJAA 1D7YA 1EL9A 4NEWA 2WOIA 3GSIA 3DGHA 3QSMA 1OJAA 4YTMA 3BI4A 3KVEA 3UKAA 1GRHA 1LTXR 4EM4A 2C70A 3UOYA 3UTHA 2GR0A 2XCGA 4BJZA 1VG9A 3T31A 3AE1A 1O94A 2Q7VA 1QJDA 4YSZA 1B37A 4A6NB 1GETA 4KPRA 4GUVA 4IA5A 3QVRA 5J60A 3DJGX 3DK4A 1D4EA 2CFYA 4Z2UA 3DK9A 3IC9A 2YR5A 4CCQA 4ECHA 3SZCA 2C75A 4B68A 3P4RA 2WQYA 4U8NA 4BK1A 4GAVA 4D03A 3K7TA 1ZX9A 2WP9A 4Y4MA 1GRFA 1DOCA 3S61A 5GRTA 2ZZCA 4EMIA 1E7PA 1OJDA 3FIMB 2X50A 5C3JA 3OC4A 4CNJA 3AD8B 3AE9A 4TLXA 5KVIA 3KA7A 3LB8A 4K5RA 2YLZA 2YR6A 1D4CA 4J33A 5JCLA 3QFBA 1CJCA 1YY5A 4U8LA 2YVGA 1EL7A 1IUVA 2XLSA 1H84A 3NNEA 1KNPA 4GDEA 3UKFA 1BWCA 1NHSA 5U1OA 1N4WA 3CNDA 1KF6A 1W4XA 4USQA 5JCNA 3SX6A 1VG0A 1JRYA 3ICSA 5CKUA 3LADA 4LU6A 4USRA 1H7XA 4DSGA 3NIXA 3FPZA 1PJ7A 2GEWA 2OALA 1Q1RA 3G5SA 1XANA 1LJ1A 5LV9A 2GAGB 1GPEA 3EF6A 4P9SA 4CY6A 4DGKA 1RYIA 1ZP0A 5KXJA 2HQMA 2JK6A 3NK0X 5EB5A 1KDGA 1KSUA 3C4NA 2X8HA 1XHCA 3ATRA 3NYEA 2WP5A 1BGJA 4IA6A 1TDOA 3G5RA 4C3YA 3B3RA 4EIQA 2BCGG 1YKJA 2TMDA 3PS9A 1E1MA 2C72A 2EQ6A 3AE6A 4D04A 4H50A 1CHUA 1PBEA 3Q9TA 3GYIA 1N1PA 4CCRA 2BRAA 3P9UA 4GDPA 2B9WA 1CC4A 4EQSA 5FS8A 4NEVA 1D5TA 1Q9IA 3NN6X 1MXTA 2WBAA 1Q1WA 2ZZBA 3O0HA 2XVEA 3PO7A 3D1CA 1GREA 4H2NA 4HB9A 2R0CA 4AOSA 3HZLA 2V3BA 3QVPA 4XWZA 3E1TA 2OA1A 1BGNA 2OLOA 4Z26A 2BS4A 3SM8A 2W0HA 2YLXA 1VQWA 3ABVA 5JCMA 2GRTA 3FBSA 1H81A 5BVAA 1H82A 2IIDA 3LXDA 2Q0KA 3CNSA 4HA6A 2TPRA 2X8GA 1B8SA 1LVLA 2XLPA 3AE5A 3S5WA 3QFAA 4ZN0A 3PG6A 3VRDB 4NTCA 1TDKA 4M52A 2C4CA 4ICYA 4YWOA 4EMWA 3V3NA 3AEAA 4Y4NA 3CIRA 1E1LA 1JNRA 2YG4A 3AEBA 4JQ9A 3F8PA 2WU2A 4Z2RA 3GRTA 3L1RA 2JB2A 2XLTA 3CGCA 2BK3A 3Q6JA 4APNA 4B67A 2YG3A 2FJBA 1K0LA 2JBVA 2ZBWA 4U2TA 4I58A 1TYPA 3JSKA 1KNRA 2XFQA 4KX6A 1LV0A 2R46A 2XDOA 3M0OA 1KN0A 1GT8A 2EQ8A 1JU2A 4H4WA 5J7XA 5M0ZA 1S7MA 4H2RA 4G9KA 3UTEA 4AP3A 2BA9A 2BS2A 1GSNA 2FJEA 3AE3A 3AEFA 3HYWA 2YLRA 3UKHA 3CMMA 2XFPA 2RGJA 3K7QX 3QSSA 5GSNA 3UKKA 4U8JA 3G5QA 4B66A 2WDVA 2WHDA 5KMSA 4A65A 4CBQA 3CNJA 3ALMA 4TM0A 2RGHA 5M10A 3C4AA 3COXA 4Z25A 3NRNA 3UOZA 1E39A 3SQPA 1IUUA 4WCTA 2C65A 2BXRA 2XYOA 1ONFA 4U2LA 2RGOA 5KMRA 1MOKA 4A79A 3I6DA 2QA2A 1F6MA 3GD3A 1Y56A 4YKFA 2XFUA 2CULA 2GV8A 1V59A 3AYIA 3KD9A 1NHRA 2B76A 3AEDA 3KPKA 1H7WA 4JY2A 2CDUA 4B69A 3SZFA 4OPTA 5EBKA 2C76A 4UDRA 2GQFA 1GV4A 1NG3A 4AT0A 2WP6A 4II3A 5HXIA 1SEZA 2GR1A 2Z5YA 1MO9A 3BNUA 4TLZA 3B6DA 4WX1A 4AOXA 1O5WA 3GYJA 1PJ6A 3AE2A 4ZCDA 1FEBA 2VVMA 2VVLG 2E4GA 2GAHB 2OAMA 1PBDA 2YR4A 3D8XA 3LJPA 1TDNA 1CJ4A 2J3NA 3RHAA 4YKGA 1ZOVA 1BKWA 2BK4A 2XFNA 2YM2A 3AYJA 1GEUA 5KRQA 1QO8A 4O5QA 1YQ3A 3UP5A 4Z44A 5HY5A 3NTAA 1E1NA 1RSGA 3BI5A 5L46A 3NH3X 5KVHA 3NT6A 4K5SA 4U8KA 4E0VA 3HYVA 2GMHA 2VQBA 4X9MA 2C7GA 1Z6LA 5KOWA 2RABA 4G74A 1D7LA 3GYXA 3NGCX 1ZMDA 3NLCA 4JNAA 1TDFA 4H4RA 4RG4A 3P4QA 1IJHA 1GNDA 4G6HA 5IPYA 2O9ZA 3SXIA 2GF3A 4BV6A 1EBDA 3BHKA 5FS6A 1S3EA 3DJEA 2DKIA 1PBFA 3L8KA 3M13A 2R4EA 2WPEA 4ZCCA 2FJDA 4GRTA 1NG4A 4FDCB 3IHGA 4OPIA 1COYA 4RSLA 5KMQA 3F8DA 3K30A 1TYTA 1N4VA 1NPXA 2XVIA 4FK1C 4B65A 2E5VA 1FOHA 2XLRA 4TM3A 1IUWA 1PXBA 2GB0A 2YWLA 4Z2TA 1IUSA 3LZXA 1ZKQA 2A89A 2GQWA 3SZ0A 1B4VA 1PBCA 4H4PA 3CGDA 3GD4A 3NK1X 5IQ1A 3H8LA 3D9XA 1CJ3A 3DJDA 4H4QA 4H7UA 4H4YA 3AD9B 2GVCA 4H2QA 3RP6A 1JNZA 4GCMA 1GALA 2I0ZA 3NKSA 3AECA 2WESA 3DJJA 1PXAA 5C2TA 1JEHA 3SY4A 3NYCA 1YQ4A 4J2WA 4N9XA 4YSYA 1PS9A 3KLJA 3UKPA 1CC6A 2VZ2A 4OCGA 4U8OA 4U8IA 2GR2A 2BACA 1X31B 1F8WA 2ARDA 2YQUA 1PJ5A 3ADAB 4JNQA 3DH9A 5EB4A 2QAEA 2A87A 1LPFA 1K0JA 3SYIA 1LQUA 1GRTA 4EQXA 2WS3A 1OJ9A 4YSXA 5HHFA 2Q0LA 4CRTA 5HYMA 4CY8A 2Z5XA 1OJCA 1NAAA 1DXLA 2JB1A 2V61A 3P1WA 3KU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O5U A;  1ZK7 A;  4PAA A;  1N4U A;  4TM1 A;  3CGB A;  4B63 A;  1GRA A;  1NDA A;  1YQZ A;  1LQT A;  4U2S A;  3RED A;  3UOV A;  4C5O A;  2YAU A;  3CN8 A;  4AT2 A;  4C3X A;  3CGE A;  4J56 A;  2V3A A;  1RP0 A;  1ZOY A;  1KFY A;  3ALL A;  3UP4 A;  3IHM A;  4Z43 A;  4A99 A;  2BC1 A;  2IVD A;  4FX9 A;  1XPQ A;  2WDQ A;  3CPJ G;  1PHH A;  2F5Z A;  2V6O A;  2NVK X;  2YVF A;  2C73 A;  2JAE A;  4H2P A;  5BUL A;  2YG5 A;  4BUR A;  1JOA A;  5BUK A;  2C3C A;  3UTF A;  4H4Z A;  4OPU A;  2YLS A;  3BHF A;  4OPC A;  4DSH A;  5IQ4 A;  2WEU A;  4EQW A;  3FMW A;  4GR1 A;  1HYU A;  3GDN A;  3SFE A;  1CBO A;  2VRL A;  2BYB A;  2BCP A;  1M6I A;  2WPF A;  4ADW A;  3I3L A;  4YT0 A;  4BK3 A;  3UCL A;  4C77 A;  2C67 A;  2GH5 A;  1P2E A;  2BS3 A;  4FK1 A;  4B64 A;  4H4X A;  1NEK A;  2R4J A;  1PBB A;  1OJT A;  4Z24 A;  3AE7 A;  4K7Z A;  2AR8 A;  1TDE A;  3GWF A;  4JY3 A;  3VR8 A;  3CTY A;  3EAO A;  3VQR A;  1PN0 A;  1XDI A;  5ER0 A;  1NEN A;  3GRS A;  4GF7 A;  3M12 A;  2PHH A;  1DOB A;  4A5L A;  1DOD A;  5EOW A;  3NN0 X;  2X8C A;  1CJ2 A;  2R45 A;  3R9U A;  4XWR A;  4YTP A;  4MJW A;  2B7S A;  1JRX A;  2BC0 A;  2A8X A;  2ACZ A;  2B7R A;  2JKC A;  3NHO X;  5DBJ A;  1H86 A;  4JDR A;  2B9X A;  3AEE A;  4H4S A;  1Y0P A;  3AE8 A;  2C66 A;  3NTD A;  4A7A A;  3LZW A;  2Y6Q A;  4BK2 A;  2V5Z A;  4XXG A;  3P4P A;  3DME A;  1E6E A;  3QSE A;  4CNK A;  2E1M A;  3H4K A;  3AEG A;  4K8D A;  2B9Y A;  2XVF A;  3GMB A;  4IVO B;  4OPG A;  4K22 A;  1ZDL A;  4IVM B;  3EPT A;  1L0V A;  3UTG A;  2BAB A;  2JB3 A;  4NTD A;  3GDP A;  4H4V A;  1DJQ A;  3KPF A;  1Y56 B;  1DJN A;  1F8R A;  2BK5 A;  2VRM A;  3K7M X;  3RP8 A;  3GWD A;  1VDC A;  2H89 A;  1FEC A;  1BF3 A;  3NK2 X;  3VR9 A;  3IWA A;  3VRB A;  1ZMC A;  3NYF A;  3ZDN A;  3P4S A;  3RNM A;  2YVJ A;  5U25 A;  4EMJ A;  1S2Q A;  3SGL A;  2FBW A;  3ZYX A;  3C96 A;  1S3B A;  4BJY A;  4YTN A;  4EQR A;  2NPX A;  4UP3 A;  3CNP A;  1FEA A;  1GXF A;  1F8S A;  5KOX A;  1H6V A;  3ALJ A;  3DK8 A;  1IUX A;  1GER A;  5JCK A;  2R0G A;  4IV9 A;  2AAQ A;  3AXB A;  1QLB A;  5FMH A;  4X9N A;  5BRT A;  4OVI A;  2H88 A;  1FCD A;  4U8P A;  1P2H A;  2C64 A;  3WE0 A;  2WU5 A;  1M64 A;  1K4Q A;  2Y6R A;  2V60 A;  2IVE A;  2Q6U A;  1GRB A;  3BNM A;  3ICT A;  2DKH A;  1ZY8 A;  3AB1 A;  3GMC A;  1DNC A;  2YLT A;  3II4 A;  2CVJ A;  1BZL A;  3T37 A;  3OZ2 A;  4J34 A;  3URH A;  2OLN A;  4PAB A;  4LII A;  1KSS A;  3ITJ A;  2WDR A;  4K2X A;  2QA1 A;  4B1B A;  1AOG A;  4H4U A;  3UKQ A;  1B5Q A;  2APG A;  3BI2 A;  2XVH A;  3DA1 A;  2XLU A;  2EQ9 A;  3EAN A;  3QJ4 A;  1L9C A;  2YM1 A;  1S2Y A;  1ELI A;  4H4T A;  1FL2 A;  3KKJ A;  3ATQ A;  1CL0 A;  4DNA A;  1NHQ A;  2AQJ A;  4OPL A;  2C3D A;  2WOW A;  2R9Z A;  4I59 A;  4EM3 A;  3UKL A;  5U63 A;  3V76 A;  2GR3 A;  1O95 A;  2YG7 A;  3CPH G;  2UZZ A;  4A9W A;  5FS7 A;  1REO A;  4C74 A;  1GRG A;  1EL8 A;  1IUT A;  3DGZ A;  3ICR A;  5JCI A;  3IF9 A;  1PDH A;  2VOU A;  3AWI A;  2GMJ A;  3NG7 X;  2XVJ A;  1F3P A;  2PYX A;  4J36 A;  3LOV A;  1PXC A;  5CQF A;  3F8R A;  4Y4L A;  2R0P A;  3FG2 P;  5FS9 A;  1GOS A;  3RP7 A;  2BXS A;  2YG6 A;  2YLW A;  3CPI G;  1E1K A;  4U8M A;  2VVL A;  2EQ7 A;  3PVC A;  4NZH A;  4X4J A;  4YXD A;  1CC2 A;  4JN9 A;  3AYL A;  1DOE A;  1NHP A;  1GTH A;  4EIP A;  5KWF A;  2WPC A;  4OPD A;  2X99 A;  2WOV A;  4UDQ A;  4REK A;  4A6N A;  1K0I A;  1L9D A;  4NTE A;  4AP1 A;  3AD7 B;  1CF3 A;  3H8I A;  1EL5 A;  2VQ7 A;  1TRB A;  4J57 A;  1H83 A;  4J31 A;  2WET A;  2ZZ0 A;  1VRQ B;  3V3O A;  4UDP A;  5TR3 A;  1D4D A;  3AE4 A;  2QCU A;  4YSH A;  2X3N A;  1GES A;  3UOX A;  1JRZ A;  3CNT A;  3ISH A;  1GTE A;  1UKV G;  4RG3 A;  4TM4 A;  3SFD A;  4LA1 A;  1L9E A;  2XFO A;  3VRA A;  2FJA A;  1D7Y A;  1EL9 A;  4NEW A;  2WOI A;  3GSI A;  3DGH A;  3QSM A;  1OJA A;  4YTM A;  3BI4 A;  3KVE A;  3UKA A;  1GRH A;  1LTX R;  4EM4 A;  2C70 A;  3UOY A;  3UTH A;  2GR0 A;  2XCG A;  4BJZ A;  1VG9 A;  3AE1 A;  1O94 A;  2Q7V A;  1QJD A;  4YSZ A;  1B37 A;  4A6N B;  1GET A;  4KPR A;  4GUV A;  4IA5 A;  3QVR A;  5J60 A;  3DJG X;  3DK4 A;  1D4E A;  2CFY A;  4Z2U A;  3DK9 A;  3IC9 A;  2YR5 A;  4CCQ A;  4ECH A;  2C75 A;  4B68 A;  3P4R A;  2WQY A;  4U8N A;  4BK1 A;  4D03 A;  3K7T A;  1ZX9 A;  2WP9 A;  4Y4M A;  1GRF A;  1DOC A;  3S61 A;  5GRT A;  2ZZC A;  4EMI A;  1E7P A;  1OJD A;  3FIM B;  2X50 A;  5C3J A;  3OC4 A;  4CNJ A;  3AD8 B;  3AE9 A;  4TLX A;  5KVI A;  3KA7 A;  3LB8 A;  4K5R A;  2YLZ A;  2YR6 A;  1D4C A;  4J33 A;  5JCL A;  3QFB A;  1CJC A;  1YY5 A;  4U8L A;  2YVG A;  1EL7 A;  1IUV A;  2XLS A;  1H84 A;  3NNE A;  1KNP A;  4GDE A;  3UKF A;  1BWC A;  1NHS A;  5U1O A;  1N4W A;  3CND A;  1KF6 A;  1W4X A;  4USQ A;  5JCN A;  1VG0 A;  1JRY A;  3ICS A;  5CKU A;  3LAD A;  4LU6 A;  4USR A;  1H7X A;  4DSG A;  3NIX A;  3FPZ A;  1PJ7 A;  2GEW A;  2OAL A;  1Q1R A;  3G5S A;  1XAN A;  1LJ1 A;  5LV9 A;  2GAG B;  1GPE A;  3EF6 A;  4P9S A;  4CY6 A;  4DGK A;  1RYI A;  1ZP0 A;  5KXJ A;  2HQM A;  2JK6 A;  3NK0 X;  5EB5 A;  1KDG A;  1KSU A;  3C4N A;  2X8H A;  1XHC A;  3ATR A;  3NYE A;  2WP5 A;  1BGJ A;  4IA6 A;  1TDO A;  3G5R A;  4C3Y A;  3B3R A;  4EIQ A;  2BCG G;  1YKJ A;  2TMD A;  3PS9 A;  1E1M A;  2C72 A;  2EQ6 A;  3AE6 A;  4D04 A;  4H50 A;  1CHU A;  1PBE A;  3Q9T A;  3GYI A;  1N1P A;  4CCR A;  3P9U A;  4GDP A;  2B9W A;  1CC4 A;  4EQS A;  5FS8 A;  4NEV A;  1D5T A;  1Q9I A;  3NN6 X;  1MXT A;  2WBA A;  1Q1W A;  2ZZB A;  3O0H A;  2XVE A;  3PO7 A;  3D1C A;  1GRE A;  4H2N A;  4HB9 A;  2R0C A;  4AOS A;  3HZL A;  2V3B A;  3QVP A;  4XWZ A;  3E1T A;  2OA1 A;  1BGN A;  2OLO A;  4Z26 A;  2BS4 A;  3SM8 A;  2W0H A;  2YLX A;  1VQW A;  3ABV A;  5JCM A;  2GRT A;  3FBS A;  1H81 A;  5BVA A;  1H82 A;  2IID A;  3LXD A;  2Q0K A;  3CNS A;  4HA6 A;  2TPR A;  2X8G A;  1B8S A;  1LVL A;  2XLP A;  3AE5 A;  3S5W A;  3QFA A;  4ZN0 A;  3VRD B;  4NTC A;  1TDK A;  4M52 A;  4ICY A;  4YWO A;  4EMW A;  3V3N A;  3AEA A;  4Y4N A;  3CIR A;  1E1L A;  1JNR A;  2YG4 A;  3AEB A;  4JQ9 A;  3F8P A;  2WU2 A;  4Z2R A;  3GRT A;  3L1R A;  2JB2 A;  2XLT A;  3CGC A;  2BK3 A;  3Q6J A;  4APN A;  4B67 A;  2YG3 A;  2FJB A;  1K0L A;  2JBV A;  2ZBW A;  4U2T A;  4I58 A;  1TYP A;  3JSK A;  1KNR A;  2XFQ A;  4KX6 A;  1LV0 A;  2R46 A;  2XDO A;  3M0O A;  1GT8 A;  2EQ8 A;  1JU2 A;  4H4W A;  5J7X A;  5M0Z A;  4H2R A;  3UTE A;  4AP3 A;  2BA9 A;  2BS2 A;  1GSN A;  2FJE A;  3AE3 A;  3AEF A;  3UKH A;  2YLR A;  2XFP A;  2RGJ A;  3K7Q X;  3QSS A;  5GSN A;  3UKK A;  4U8J A;  3G5Q A;  4B66 A;  2WDV A;  2WHD A;  4A65 A;  4CBQ A;  3CNJ A;  3ALM A;  4TM0 A;  2RGH A;  5M10 A;  3C4A A;  3COX A;  4Z25 A;  3NRN A;  3UOZ A;  1E39 A;  3SQP A;  1IUU A;  4WCT A;  2C65 A;  2BXR A;  2XYO A;  1ONF A;  4U2L A;  2RGO A;  1MOK A;  4A79 A;  3I6D A;  2QA2 A;  1F6M A;  3GD3 A;  1Y56 A;  4YKF A;  2XFU A;  2CUL A;  2GV8 A;  1V59 A;  3AYI A;  3KD9 A;  1NHR A;  2B76 A;  3AED A;  1H7W A;  4JY2 A;  2CDU A;  4B69 A;  4OPT A;  5EBK A;  2C76 A;  4UDR A;  2GQF A;  1GV4 A;  1NG3 A;  4AT0 A;  2WP6 A;  5HXI A;  1SEZ A;  2GR1 A;  2Z5Y A;  1MO9 A;  3BNU A;  4TLZ A;  3B6D A;  4WX1 A;  4AOX A;  1O5W A;  3GYJ A;  1PJ6 A;  3AE2 A;  4ZCD A;  1FEB A;  2VVM A;  2VVL G;  2E4G A;  2GAH B;  2OAM A;  1PBD A;  2YR4 A;  3D8X A;  3LJP A;  1TDN A;  1CJ4 A;  2J3N A;  3RHA A;  4YKG A;  1ZOV A;  1BKW A;  2BK4 A;  2XFN A;  2YM2 A;  3AYJ A;  1GEU A;  5KRQ A;  1QO8 A;  4O5Q A;  1YQ3 A;  3UP5 A;  4Z44 A;  5HY5 A;  3NTA A;  1E1N A;  1RSG A;  3BI5 A;  5L46 A;  3NH3 X;  5KVH A;  3NT6 A;  4K5S A;  4U8K A;  4E0V A;  2GMH A;  2VQB A;  4X9M A;  2C7G A;  1Z6L A;  5KOW A;  2RAB A;  1D7L A;  3NGC X;  1ZMD A;  3NLC A;  4JNA A;  1TDF A;  4H4R A;  4RG4 A;  3P4Q A;  1IJH A;  1GND A;  5IPY A;  2O9Z A;  2GF3 A;  4BV6 A;  1EBD A;  3BHK A;  5FS6 A;  1S3E A;  3DJE A;  2DKI A;  1PBF A;  3L8K A;  3M13 A;  2R4E A;  2WPE A;  4ZCC A;  2FJD A;  4GRT A;  1NG4 A;  4FDC B;  3IHG A;  4OPI A;  1COY A;  4RSL A;  3F8D A;  3K30 A;  1TYT A;  1N4V A;  1NPX A;  2XVI A;  4FK1 C;  4B65 A;  2E5V A;  1FOH A;  2XLR A;  4TM3 A;  1IUW A;  1PXB A;  2GB0 A;  2YWL A;  4Z2T A;  1IUS A;  3LZX A;  1ZKQ A;  2A89 A;  2GQW A;  1B4V A;  1PBC A;  4H4P A;  3CGD A;  3GD4 A;  3NK1 X;  5IQ1 A;  3H8L A;  1CJ3 A;  3DJD A;  4H4Q A;  4H7U A;  4H4Y A;  3AD9 B;  2GVC A;  4H2Q A;  3RP6 A;  1JNZ A;  4GCM A;  1GAL A;  2I0Z A;  3NKS A;  3AEC A;  2WES A;  3DJJ A;  1PXA A;  5C2T A;  1JEH A;  3NYC A;  1YQ4 A;  4J2W A;  4N9X A;  4YSY A;  1PS9 A;  3KLJ A;  3UKP A;  1CC6 A;  2VZ2 A;  4OCG A;  4U8O A;  4U8I A;  2GR2 A;  2BAC A;  1X31 B;  1F8W A;  2ARD A;  2YQU A;  1PJ5 A;  3ADA B;  4JNQ A;  3DH9 A;  5EB4 A;  2QAE A;  2A87 A;  1LPF A;  1K0J A;  1LQU A;  1GRT A;  4EQX A;  2WS3 A;  1OJ9 A;  4YSX A;  5HHF A;  2Q0L A;  4CRT A;  5HYM A;  4CY8 A;  2Z5X A;  1OJC A;  1NAA A;  1DXL A;  2JB1 A;  2V61 A;  3P1W A;  3KU9 A; 
#chains in the Genus database with same CATH topology
 1ZK7 A;  3CGB A;  1NDA A;  2OPJ A;  3VDG A;  1EBG A;  4AT2 A;  3N6H A;  2GGI A;  2BC1 A;  2O56 A;  1JRO A;  3PK7 A;  1PHH A;  4BUR A;  5BUK A;  4OPU A;  2YLS A;  4GAP A;  4EQW A;  1CBO A;  2BYB A;  1M6I A;  4ADW A;  4YT0 A;  3UCL A;  1NEK A;  3AE7 A;  3ENL A;  3VR8 A;  5ER0 A;  4GF7 A;  2PHH A;  2AL2 A;  5EOW A;  3TOY A;  4XWR A;  4GGH A;  5KMP A;  5DBJ A;  1H86 A;  3AEE A;  4H4S A;  1Y0P A;  3UJS A;  2GGG A;  3NTD A;  4HNL A;  2V5Z A;  1SB3 B;  3AEG A;  2B9Y A;  3CYJ A;  5IDZ A;  3GDP A;  1Y56 B;  4HPN A;  1VDC A;  3N4F A;  1FEC A;  3V3W A;  1F9C A;  3P4S A;  3ZDN A;  3RNM A;  3P0W A;  1S3B A;  4YTN A;  1TE6 A;  5KOX A;  1N63 C;  1H6V A;  3ALJ A;  3EUB 3;  3UJF A;  1IUX A;  3NVZ B;  5FMH A;  3SR6 B;  4OVI A;  2H88 A;  2WU5 A;  2Y6R A;  4II2 A;  1ZY8 A;  1BZL A;  4FI4 A;  3ITJ A;  4B1B A;  3BI2 A;  3NVV B;  3EAN A;  2XH4 A;  4DNA A;  1NHQ A;  2AQJ A;  3HRD C;  1P43 A;  1N60 C;  4KPL A;  4IL0 A;  5JCI A;  3AWI A;  3HPF A;  2XVJ A;  3LOV A;  4Y4L A;  1EC8 A;  2BXS A;  2VVL A;  4YXD A;  1NHP A;  4DYE A;  1GTH A;  5KWF A;  2WOV A;  4A6N A;  1CF3 A;  3T9P A;  3SN4 A;  1TRB A;  2PGW A;  2ZZ0 A;  3V3O A;  3MKC A;  3AE4 A;  3U9I A;  4YSH A;  3ISH A;  3PFR A;  4G8T A;  4HYR A;  1L9E A;  4NEW A;  3DGH A;  4EM4 A;  4GIS A;  3T8Q A;  4BJZ A;  1QJD A;  3JZU A;  1B37 A;  1PDY A;  3S5S A;  1D4E A;  4Z2U A;  1WUF A;  1E9I A;  4GGB A;  4CCQ A;  4B68 A;  3DG6 A;  2HZG A;  3K7T A;  3UXL A;  1GRF A;  3V4B A;  1SJB A;  3RGT A;  2X50 A;  2YLZ A;  2YR6 A;  4J33 A;  3TTE A;  1CJC A;  1EL7 A;  2XLS A;  3OTR A;  4J3Z A;  4IL2 A;  3CND A;  1KF6 A;  5JCN A;  4G7F A;  5CKU A;  4LU6 A;  3FPZ A;  3G5S A;  1FO4 A;  1GPE A;  4P9S A;  5FJU A;  1RYI A;  2HQM A;  1KDG A;  2X8H A;  3ATR A;  3STP A;  4IA6 A;  3B3R A;  1YKJ A;  3AE6 A;  4HCL A;  3GYI A;  3P9U A;  4GDP A;  3DG3 A;  2XVE A;  4K8G A;  3IJL A;  4HCH A;  3AM9 A;  2W0H A;  2YLX A;  3ABV A;  2OX4 A;  2GRT A;  1H81 A;  2IID A;  2X8G A;  2XLP A;  3I4K A;  4ZN0 A;  5BOF A;  3PG6 A;  1TDK A;  4EMW A;  4Y4N A;  1JNR A;  3L1R A;  3MSY A;  2XLT A;  3Q6J A;  2FJB A;  2JBV A;  1TYP A;  4DHG A;  2XFQ A;  1MUC A;  3M0O A;  2EQ8 A;  5M0Z A;  4G9K A;  4AP3 A;  1GSN A;  1RVK A;  3SBF A;  3K7Q X;  4CBQ A;  4TM0 A;  5M10 A;  3NVY B;  1IUU A;  4YWS A;  1ONF A;  3GD6 A;  2RGO A;  3DGB A;  3CK5 A;  1DTN A;  1Y56 A;  3AYI A;  3KD9 A;  3KPK A;  4JN7 A;  4JY2 A;  4OPT A;  5EBK A;  4UDR A;  1GV4 A;  2WP6 A;  4II3 A;  4TLZ A;  2Z5Y A;  2OAM A;  1PBD A;  3D8X A;  4YKG A;  1ZOV A;  2XFN A;  2YM2 A;  1GEU A;  2OZT A;  1YQ3 A;  3BI5 A;  1RM6 B;  4K5S A;  2VQB A;  5G5G B;  1Z6L A;  4G74 A;  3R25 A;  3KUM A;  4H4R A;  1GND A;  3R07 C;  4G6H A;  2O9Z A;  3SXI A;  2GF3 A;  1EBD A;  2E5A A;  2DKI A;  2WPE A;  4OPI A;  3IHG A;  3CXO A;  3F8D A;  1TYT A;  4B65 A;  4FP1 A;  2YWL A;  4H19 A;  4Z2T A;  3SZ0 A;  1PBC A;  3GD4 A;  3NK1 X;  4ZOH B;  3DG7 A;  3NO1 A;  4E5T A;  2I0Z A;  4MMW A;  5C2T A;  4YSY A;  2W3S A;  4U8O A;  3ADA B;  2ARD A;  4JNQ A;  4DWD A;  2A87 A;  1LPF A;  2WS3 A;  3FV9 A;  4CRT A;  1ELS A;  1DXL A;  2JB1 A;  4ENL A;  4PAA A;  3RED A;  1YQZ A;  4U2S A;  4C5O A;  2POZ A;  1RP0 A;  3AN1 A;  3ALL A;  3IHM A;  1ONE A;  2IVD A;  1XPQ A;  3CPJ G;  2NVK X;  5BUL A;  2P8B A;  2YG5 A;  2C3C A;  3UTF A;  4H4Z A;  5IQ4 A;  3T4W A;  4ZA0 A;  2BCP A;  3I3L A;  4FK1 A;  2R4J A;  1OJT A;  3T2K A;  3GWF A;  2AR8 A;  3ES8 A;  3VQR A;  3EAO A;  1PN0 A;  1XDI A;  2XGZ A;  3SQS A;  3GRS A;  4A5L A;  3NN0 X;  2R45 A;  3R9U A;  2GGH A;  4YTP A;  1JRX A;  3T2Z A;  2BC0 A;  2B7R A;  2JKC A;  2B9X A;  4A7A A;  3LZW A;  4XXG A;  3QSE A;  3SZW A;  3H4K A;  4K8D A;  3NS1 B;  3GMB A;  2XVF A;  4OPG A;  1ZDL A;  2BAB A;  4NNJ A;  4H4V A;  1KKO A;  1F8R A;  2BK5 A;  2VRM A;  3NYF A;  3DDM A;  2YVJ A;  5U25 A;  4BJY A;  4GME A;  4EQR A;  1GXF A;  3DK8 A;  3AXB A;  1QLB A;  4X9N A;  5BRT A;  2C64 A;  1M64 A;  2V60 A;  3BNM A;  3ICT A;  2DKH A;  1DNC A;  4IT1 A;  3II4 A;  3T37 A;  3OZ2 A;  4J34 A;  2GGJ A;  4E4F A;  2QA1 A;  4H4U A;  3UKQ A;  1B5Q A;  3DA1 A;  1H2I A;  2PSN A;  3QJ4 A;  1S2Y A;  3VA8 A;  1EBH A;  3OZY A;  3DIP A;  4OPL A;  2C3D A;  1WYG A;  1FIQ B;  3ZLG A;  4DXK A;  1FFV C;  2GR3 A;  1TKK A;  1R6W A;  3CPH G;  4A9W A;  5FS7 A;  4C74 A;  4HCD A;  3IF9 A;  2DW6 A;  3NG7 X;  5CQF A;  3FG2 P;  1GOS A;  3OP2 A;  3CPI G;  4U8M A;  2EQ7 A;  1CC2 A;  4JN9 A;  2WPC A;  3EEZ A;  2X99 A;  2PU1 A;  4EWJ A;  3AD7 B;  2DW7 A;  2VQ7 A;  2PGE A;  1H83 A;  5TR3 A;  2QCU A;  1GES A;  3CNT A;  1GTE A;  1UKV G;  1L8P A;  4RG3 A;  3VRA A;  3GSI A;  3UKA A;  3KVE A;  2FYM A;  3TJ4 A;  3NXL A;  3VC5 A;  3BSM A;  3T31 A;  3T6C A;  1VQZ A;  1GET A;  3QVR A;  4ECH A;  4MGG A;  4D03 A;  4GAV A;  2ONE A;  2WP9 A;  4MKS A;  4JN8 A;  3CXB A;  1VDV A;  4CNJ A;  3AD8 B;  3AE9 A;  4TLX A;  3LB8 A;  1D4C A;  5JCL A;  4U8L A;  3SN0 A;  2PP0 A;  3NNE A;  4GDE A;  2XH0 A;  3SX6 A;  4DSG A;  2OAL A;  3SJN A;  1XAN A;  3R1Z A;  5KXJ A;  3C4N A;  1XHC A;  3NYE A;  2WP5 A;  3BJS A;  4C3Y A;  3U4F A;  1E1M A;  2C72 A;  4D04 A;  4H50 A;  1CHU A;  1PBE A;  4CCR A;  3BOX A;  4NEV A;  1D5T A;  3PWG A;  3D1C A;  1GRE A;  4AOS A;  2V3B A;  3QVP A;  2OA1 A;  1BGN A;  1X2G A;  2BS4 A;  4HA6 A;  3LXD A;  2TPR A;  5BOE A;  3ZLH A;  4M52 A;  2C4C A;  3V3N A;  3AEA A;  3AEB A;  3F8P A;  2WU2 A;  4Z2R A;  3A7R A;  2P88 A;  4APN A;  3H12 A;  2ZBW A;  3JSK A;  1KNR A;  1LV0 A;  1KN0 A;  5J04 A;  1S7M A;  2PTY A;  3UTE A;  1FHU A;  2W3R A;  3B97 A;  2BS2 A;  3HYW A;  1SJD A;  3CMM A;  2XFP A;  2RGJ A;  5GSN A;  2GDQ A;  3UKK A;  2OZ3 A;  4B66 A;  4HNC A;  3JW7 A;  2RGH A;  3C4A A;  3COX A;  3UOZ A;  3DER A;  1E39 A;  3SQP A;  4U2L A;  3UCC A;  1MOK A;  3I6D A;  2QA2 A;  2XFU A;  2GV8 A;  2B76 A;  3AED A;  2RDX A;  3UCD A;  3QKE A;  2GR1 A;  1MO9 A;  4J1O A;  3AE2 A;  4ZCD A;  2VVM A;  3LJP A;  2GAH B;  1TDN A;  3FYY A;  1BKW A;  4O5Q A;  3UP5 A;  5HY5 A;  2OG9 A;  1E1N A;  5L46 A;  5KVH A;  3HYV A;  3R0K A;  4X9M A;  3NLC A;  4JNA A;  5IPY A;  4BV6 A;  5FS6 A;  2FKP A;  2R4E A;  4GRT A;  1NG4 A;  4RSL A;  4FK1 C;  1BKH A;  1FOH A;  1N5X A;  2PPG A;  1IUS A;  4H4P A;  3CGD A;  1CJ3 A;  4H7U A;  2PS2 A;  3QN3 A;  2PTZ A;  3VCN A;  1GAL A;  3AEC A;  2WES A;  1PXA A;  1PS9 A;  4U8I A;  4M6U A;  2BAC A;  1F8W A;  2YQU A;  2QAE A;  3SN1 A;  4F4R A;  3SYI A;  1GRT A;  1OJ9 A;  5HHF A;  2Q0L A;  4M0X A;  5HYM A;  3ES7 A;  1OJC A;  3D46 A;  2V61 A;  3ZVH B;  4O5U A;  3DEQ A;  3AMZ A;  1GRA A;  1LQT A;  2YAU A;  3CN8 A;  3UGV A;  3CGE A;  4J56 A;  3RO6 A;  4Z43 A;  3JVA A;  2WDQ A;  2V6O A;  2C73 A;  4H2P A;  3THU A;  1JOA A;  3HYX A;  3BHF A;  2WEU A;  3FMW A;  3SFE A;  2VRL A;  3TW9 A;  3FCP A;  2WPF A;  4BK3 A;  4C77 A;  4H4X A;  3GO2 A;  1PBB A;  4JY3 A;  1TDE A;  3T2Y A;  3IK4 A;  1NEN A;  2OFJ A;  2CHR A;  1DOB A;  3TJI A;  1DOD A;  2X8C A;  2OQH A;  4MJW A;  3IJQ A;  2MUC A;  2A8X A;  2ACZ A;  3NHO X;  2PA6 A;  2Y6Q A;  2NQL A;  3DME A;  1E6E A;  2E1M A;  3UJR A;  3UTG A;  2JB3 A;  4NTD A;  1DJQ A;  3KPF A;  3FJ4 A;  1DJN A;  3RP8 A;  3GWD A;  2H89 A;  1BF3 A;  4TVW A;  2AL2 B;  3VRB A;  1ZMC A;  1S2Q A;  3ZYX A;  3C96 A;  3CNP A;  1F8S A;  5JCK A;  4IV9 A;  1JDF A;  3T0K A;  4U8P A;  2P3Z A;  3D47 A;  1K4Q A;  2IVE A;  2Q6U A;  3GMC A;  3DES A;  2YLT A;  3V5F A;  2OLN A;  4PAB A;  1KSS A;  4K2X A;  1AOG A;  2APG A;  3TQP A;  2PP1 A;  2YM1 A;  1ELI A;  4H4T A;  3ATQ A;  1CL0 A;  4NWZ A;  2R9Z A;  4I59 A;  4H1Z A;  3V76 A;  1O95 A;  1IYX A;  1WUE A;  2YG7 A;  2OVL A;  2OZ8 A;  1REO A;  3TWB A;  1GRG A;  1EL8 A;  1IUT A;  1MRA A;  3ICR A;  2VOU A;  2GMJ A;  3RCY A;  1F3P A;  1PXC A;  3RP7 A;  1N61 C;  2YG6 A;  2GSH A;  1E1K A;  2QQ6 A;  4IP5 A;  3AYL A;  4REK A;  1K0I A;  1L9D A;  4AP1 A;  3H8I A;  2W55 A;  4J31 A;  2WET A;  3FVD A;  3NRZ B;  1VRQ B;  1D4D A;  3N4E A;  1JRZ A;  3B9J B;  4LA1 A;  2XFO A;  1D7Y A;  1EL9 A;  4E4U A;  3QSM A;  1OJA A;  4YTM A;  3BI4 A;  1GRH A;  1LTX R;  3UOY A;  2I5Q A;  2XCG A;  4GFI A;  1VG9 A;  3AE1 A;  2Q7V A;  4A6N B;  3PWI A;  3RR1 A;  5J60 A;  3DJG X;  3DK4 A;  4X2P A;  6ENL A;  2E3T A;  3SSZ A;  2C75 A;  3P4R A;  2PU0 A;  3A7A A;  1YEY A;  1P48 A;  4Y4M A;  3FXG A;  3S61 A;  5GRT A;  3GY1 A;  4EMI A;  1E7P A;  1OJD A;  2QVH A;  3FIM B;  3K1G A;  5C3J A;  3OC4 A;  5KVI A;  3KA7 A;  4K5R A;  2XH7 A;  3DFY A;  1KNP A;  3UKF A;  1BWC A;  3MZN A;  4USQ A;  2ZAD A;  1VG0 A;  3ICS A;  1NU5 A;  1FHV A;  3NIX A;  1JPM A;  3IJI A;  1PJ7 A;  1Q1R A;  5LV9 A;  2GAG B;  3EF6 A;  4CY6 A;  4DGK A;  3DFH A;  1ZP0 A;  2JK6 A;  1KSU A;  1BGJ A;  4EIQ A;  2BCG G;  4Z1Y A;  3ZVH A;  3Q9T A;  1N1P A;  2BRA A;  1W6T A;  3RIT A;  1MXT A;  2ZZB A;  1Q1W A;  3O0H A;  3PO7 A;  4HB9 A;  2MNR A;  2R0C A;  1SJA A;  4XWZ A;  2OLO A;  4Z26 A;  3SM8 A;  1VQW A;  5JCM A;  5BVA A;  1B8S A;  3S5W A;  1JPD X;  4ICY A;  3CIR A;  2PMQ A;  4JQ9 A;  2JB2 A;  1X2H A;  4A35 A;  4B67 A;  2QJM A;  1K0L A;  4I58 A;  3VFC A;  3OZM A;  2R46 A;  2XDO A;  1GT8 A;  1JCT A;  4DN1 A;  4H2R A;  2FJE A;  3AEF A;  3AE3 A;  3UKH A;  2YLR A;  5ENL A;  3R11 A;  1KCZ A;  2HXU A;  2WDV A;  2WHD A;  5KMS A;  2HNE A;  3CB3 A;  3CNJ A;  3ALM A;  4Z25 A;  4HN8 A;  2XSX A;  2C65 A;  2XYO A;  3UJ2 A;  2AKM A;  1KKR A;  2CUL A;  1NHR A;  3R0U A;  1H7W A;  2CDU A;  1TZZ A;  1NG3 A;  5HXI A;  1SEZ A;  4E6M A;  5G5H B;  1O5W A;  2PP3 A;  2J3N A;  4KT2 A;  4JHM A;  2BK4 A;  1OEP A;  5KRQ A;  3AYJ A;  1RSG A;  3NH3 X;  4E0V A;  2C7G A;  5KOW A;  1D7L A;  1TDF A;  4RG4 A;  1IJH A;  4IP4 A;  2QDD A;  3OW1 A;  4IZG A;  4IHC A;  1S3E A;  1FFU C;  3L8K A;  2FJD A;  4FDC B;  1COY A;  5KMQ A;  2P0I A;  1N4V A;  2E5V A;  4TM3 A;  2GB0 A;  3LZX A;  3H8L A;  3D9X A;  3DJD A;  3OPS A;  3AD9 B;  3RP6 A;  1JNZ A;  5FJT A;  4J2W A;  4N9X A;  3KLJ A;  1CC6 A;  4OCG A;  1X31 B;  5EB4 A;  1PJ5 A;  1LQU A;  1MDR A;  4GYP C;  3ZVI A;  3Q45 A;  2Z5X A;  3NFU A;  3P1W A;  3H8A A;  3KU9 A;  2AL1 A;  1N4U A;  4TM1 A;  4B63 A;  3UOV A;  4C3X A;  2V3A A;  1ZOY A;  5FJP A;  1KFY A;  3UP4 A;  3UJE A;  4A99 A;  4FX9 A;  2F5Z A;  2PCE A;  2JAE A;  2YVF A;  5FJR A;  3S47 A;  4OPC A;  4G6G A;  4DSH A;  3GDN A;  4GR1 A;  1HYU A;  3MUC A;  4G73 A;  2C67 A;  1EC7 A;  2GH5 A;  1P2E A;  7ENL A;  2BS3 A;  4B64 A;  4Z24 A;  4K7Z A;  3NZG A;  3QLD A;  3CTY A;  1N62 C;  3QPE A;  3M12 A;  1CJ2 A;  3RRA A;  2B7S A;  3L5O A;  4JDR A;  3AE8 A;  2C66 A;  4BK2 A;  3MWC A;  3P4P A;  5JRB A;  4ZCW A;  4CNK A;  5FJO A;  4IVO B;  4K22 A;  4IVM B;  3EPT A;  1L0V A;  3UXK A;  3K7M X;  3NK2 X;  3VR9 A;  3IWA A;  4EMJ A;  1N5W C;  3SGL A;  2FBW A;  2NPX A;  4UP3 A;  2AKZ A;  1FEA A;  1EC9 A;  1GER A;  2R0G A;  2BRY A;  2AAQ A;  1FCD A;  1P2H A;  3T14 A;  3TWA A;  1GRB A;  3AB1 A;  2CVJ A;  4Z17 A;  5KNL A;  2W54 A;  3URH A;  4LII A;  2WDR A;  1BQG A;  2XVH A;  2XLU A;  2EQ9 A;  3TCS A;  1L9C A;  4K1W A;  2XH2 A;  1FL2 A;  3KKJ A;  4H83 A;  2WOW A;  3GC2 A;  4EM3 A;  3UKL A;  5U63 A;  2UZZ A;  3Q4D A;  3DGZ A;  1PDH A;  2HXT A;  2PYX A;  4J36 A;  3F8R A;  2R0P A;  5FS9 A;  2YLW A;  4TVY A;  3PVC A;  4NZH A;  4X4J A;  1DOE A;  4EIP A;  4OPD A;  4UDQ A;  4NTE A;  1EL5 A;  4J57 A;  4UDP A;  1MDL A;  2X3N A;  3UOX A;  2QJN A;  3I6E A;  4TM4 A;  3SFD A;  2FJA A;  3P3B A;  2WOI A;  2C70 A;  3UTH A;  2GR0 A;  1O94 A;  1MNS A;  4YSZ A;  3HW2 A;  4KPR A;  4GUV A;  2QJJ A;  4IA5 A;  2CFY A;  3DK9 A;  3IC9 A;  2YR5 A;  3SZC A;  4U8N A;  2WQY A;  4BK1 A;  1ZX9 A;  3H7V A;  2OQY A;  1DOC A;  4GYP A;  2ZZC A;  3CT2 A;  3QFB A;  1YY5 A;  2YVG A;  1IUV A;  1H84 A;  1NHS A;  5U1O A;  1N4W A;  1W4X A;  2PTX A;  1JRY A;  3LAD A;  1PDZ A;  4USR A;  1H7X A;  2GEW A;  1LJ1 A;  4DX3 A;  4ROP A;  2QDE A;  3NK0 X;  5EB5 A;  1TDO A;  3G5R A;  2OKT A;  2TMD A;  3PS9 A;  2EQ6 A;  3ZLF A;  1NEL A;  3EKG A;  2B9W A;  1CC4 A;  4EQS A;  5FS8 A;  1Q9I A;  3NN6 X;  2WBA A;  1V97 A;  3ETR B;  4H2N A;  3HZL A;  3E1T A;  3FBS A;  2PTW A;  1H82 A;  3CNS A;  2Q0K A;  1LVL A;  3AE5 A;  3QFA A;  3VRD B;  4NTC A;  4YWO A;  1E1L A;  2YG4 A;  3GRT A;  3VCC A;  3CGC A;  2BK3 A;  2YG3 A;  1KD0 A;  4U2T A;  4KX6 A;  3P93 A;  5J7X A;  1JU2 A;  4H4W A;  3N6J A;  3CAW A;  2BA9 A;  1XS2 A;  1ECQ A;  3R10 A;  4A6G A;  3QSS A;  4U8J A;  3G5Q A;  4A65 A;  2OO6 A;  3NRN A;  2ZC8 A;  5EU9 A;  3H70 A;  4WCT A;  2BXR A;  3MY9 A;  5KMR A;  3MQT A;  4A79 A;  1F6M A;  3GD3 A;  1ZXI C;  4YKF A;  1V59 A;  4K2S A;  2POD A;  4B69 A;  3SZF A;  2C76 A;  2GQF A;  4AT0 A;  3BNU A;  3B6D A;  1XPY A;  4WX1 A;  4AOX A;  3GYJ A;  1PJ6 A;  1FEB A;  2VVL G;  2YR4 A;  2E4G A;  1CJ4 A;  3RHA A;  3VC6 A;  1QO8 A;  4Z44 A;  3NTA A;  3NT6 A;  2GGE A;  4U8K A;  2GMH A;  2RAB A;  3GYX A;  3NGC X;  1ZMD A;  3NVW B;  3P4Q A;  3A7U A;  3BHK A;  3DJE A;  1PBF A;  3M13 A;  4ZCC A;  1SJC A;  1STZ A;  3V5C A;  3K30 A;  1NPX A;  2QGY A;  2XVI A;  2XLR A;  4A3R A;  1IUW A;  1PXB A;  4KEM A;  1ZKQ A;  2A89 A;  2GQW A;  1B4V A;  5IQ1 A;  4H4Q A;  4H4Y A;  2GVC A;  4H2Q A;  1T3Q C;  1R0M A;  4H2H A;  4GCM A;  3NKS A;  2GL5 A;  3DJJ A;  1JEH A;  3SY4 A;  1JRP A;  1YQ4 A;  3NYC A;  2P8C A;  3UKP A;  2VZ2 A;  2GR2 A;  3DH9 A;  3I6T A;  1K0J A;  3QTP A;  4E8G A;  4EQX A;  4KWS A;  4YSX A;  2OLA A;  4CY8 A;  1NAA A;  4GIR A;  3WE0 A; 
#chains in the Genus database with same CATH homology
 4O5U A;  1ZK7 A;  4PAA A;  1N4U A;  4TM1 A;  3CGB A;  4B63 A;  1GRA A;  1NDA A;  1YQZ A;  1LQT A;  4U2S A;  3RED A;  3UOV A;  4C5O A;  2YAU A;  3CN8 A;  4AT2 A;  4C3X A;  3CGE A;  4J56 A;  2V3A A;  1RP0 A;  1ZOY A;  1KFY A;  3ALL A;  3UP4 A;  3IHM A;  4Z43 A;  4A99 A;  2BC1 A;  2IVD A;  4FX9 A;  1XPQ A;  2WDQ A;  3CPJ G;  1PHH A;  2F5Z A;  2V6O A;  2NVK X;  2YVF A;  2C73 A;  2JAE A;  4H2P A;  5BUL A;  2YG5 A;  4BUR A;  1JOA A;  5BUK A;  2C3C A;  3UTF A;  3HYX A;  4H4Z A;  4OPU A;  2YLS A;  3BHF A;  4G6G A;  4GAP A;  4OPC A;  4DSH A;  2WEU A;  4EQW A;  3FMW A;  4GR1 A;  1HYU A;  3GDN A;  3SFE A;  1CBO A;  2VRL A;  2BYB A;  2BCP A;  1M6I A;  2WPF A;  4ADW A;  3I3L A;  4G73 A;  4YT0 A;  4BK3 A;  3UCL A;  4C77 A;  2C67 A;  2GH5 A;  1P2E A;  2BS3 A;  4FK1 A;  4B64 A;  4H4X A;  1NEK A;  2R4J A;  1PBB A;  1OJT A;  4Z24 A;  3AE7 A;  4K7Z A;  2AR8 A;  1TDE A;  3GWF A;  4JY3 A;  3T2K A;  3VR8 A;  3CTY A;  3EAO A;  3VQR A;  3T2Y A;  1PN0 A;  1XDI A;  5ER0 A;  1NEN A;  3GRS A;  4GF7 A;  3M12 A;  2PHH A;  1DOB A;  4A5L A;  1DOD A;  5EOW A;  3NN0 X;  2X8C A;  1CJ2 A;  2R45 A;  3R9U A;  4XWR A;  4YTP A;  4MJW A;  2B7S A;  1JRX A;  3T2Z A;  2BC0 A;  2A8X A;  2ACZ A;  2B7R A;  2JKC A;  3NHO X;  5DBJ A;  1H86 A;  5KMP A;  3L5O A;  4JDR A;  2B9X A;  3AEE A;  4H4S A;  1Y0P A;  3AE8 A;  2C66 A;  3NTD A;  4A7A A;  3LZW A;  2Y6Q A;  4BK2 A;  2V5Z A;  4XXG A;  3P4P A;  3DME A;  5JRB A;  1E6E A;  3QSE A;  4CNK A;  2E1M A;  3H4K A;  3SZW A;  3AEG A;  4K8D A;  2B9Y A;  2XVF A;  3GMB A;  4IVO B;  4OPG A;  4K22 A;  1ZDL A;  4IVM B;  3EPT A;  1L0V A;  3UTG A;  2BAB A;  2JB3 A;  4NTD A;  4NNJ A;  3GDP A;  4H4V A;  1DJQ A;  3KPF A;  1Y56 B;  1DJN A;  1F8R A;  2BK5 A;  2VRM A;  3K7M X;  3RP8 A;  3GWD A;  1VDC A;  2H89 A;  1FEC A;  1BF3 A;  3NK2 X;  3VR9 A;  3IWA A;  3VRB A;  1ZMC A;  3NYF A;  3ZDN A;  3P4S A;  3RNM A;  2YVJ A;  5U25 A;  4EMJ A;  1S2Q A;  3SGL A;  2FBW A;  3ZYX A;  3C96 A;  1S3B A;  4BJY A;  4YTN A;  4EQR A;  2NPX A;  4UP3 A;  3CNP A;  1FEA A;  1GXF A;  1F8S A;  5KOX A;  1H6V A;  3ALJ A;  3DK8 A;  1IUX A;  1GER A;  5JCK A;  2R0G A;  2BRY A;  4IV9 A;  2AAQ A;  3AXB A;  1QLB A;  5FMH A;  4X9N A;  5BRT A;  4OVI A;  3T0K A;  2H88 A;  1FCD A;  4U8P A;  1P2H A;  2C64 A;  3WE0 A;  2WU5 A;  1M64 A;  1K4Q A;  2Y6R A;  3T14 A;  2V60 A;  2IVE A;  2Q6U A;  1GRB A;  3BNM A;  3ICT A;  2DKH A;  1ZY8 A;  3AB1 A;  3GMC A;  4II2 A;  1DNC A;  2YLT A;  3II4 A;  2CVJ A;  1BZL A;  3T37 A;  5KNL A;  3OZ2 A;  4J34 A;  3URH A;  2OLN A;  4PAB A;  4LII A;  1KSS A;  3ITJ A;  2WDR A;  4K2X A;  2QA1 A;  4B1B A;  1AOG A;  4H4U A;  3UKQ A;  1B5Q A;  2APG A;  3BI2 A;  2XVH A;  3DA1 A;  1H2I A;  2XLU A;  2EQ9 A;  3EAN A;  3QJ4 A;  1L9C A;  2YM1 A;  1S2Y A;  1ELI A;  4H4T A;  1FL2 A;  3KKJ A;  3ATQ A;  1CL0 A;  4DNA A;  1NHQ A;  2AQJ A;  4NWZ A;  4OPL A;  2C3D A;  2WOW A;  2R9Z A;  4I59 A;  4EM3 A;  3UKL A;  5U63 A;  3V76 A;  2GR3 A;  1O95 A;  2YG7 A;  3CPH G;  2UZZ A;  4A9W A;  5FS7 A;  1REO A;  4C74 A;  1GRG A;  1EL8 A;  1IUT A;  3DGZ A;  3ICR A;  5JCI A;  3IF9 A;  1PDH A;  2VOU A;  3AWI A;  2GMJ A;  5IQ4 A;  3NG7 X;  2XVJ A;  1F3P A;  2PYX A;  4J36 A;  3LOV A;  1PXC A;  5CQF A;  3F8R A;  4Y4L A;  2R0P A;  3FG2 P;  5FS9 A;  1GOS A;  3RP7 A;  2BXS A;  2YG6 A;  2YLW A;  3CPI G;  1E1K A;  4U8M A;  2VVL A;  2EQ7 A;  3PVC A;  4NZH A;  4X4J A;  4YXD A;  1CC2 A;  4JN9 A;  3AYL A;  1DOE A;  1NHP A;  1GTH A;  4EIP A;  5KWF A;  2WPC A;  4OPD A;  2X99 A;  2WOV A;  4UDQ A;  4REK A;  4A6N A;  1K0I A;  1L9D A;  4NTE A;  4AP1 A;  3AD7 B;  1CF3 A;  3H8I A;  1EL5 A;  2VQ7 A;  1TRB A;  4J57 A;  1H83 A;  4J31 A;  2WET A;  2ZZ0 A;  1VRQ B;  3V3O A;  4UDP A;  5TR3 A;  1D4D A;  3AE4 A;  2QCU A;  4YSH A;  2X3N A;  1GES A;  3UOX A;  1JRZ A;  3CNT A;  3ISH A;  1GTE A;  1UKV G;  4RG3 A;  4TM4 A;  3SFD A;  4LA1 A;  1L9E A;  2XFO A;  3VRA A;  2FJA A;  1D7Y A;  1EL9 A;  4NEW A;  2WOI A;  3GSI A;  3DGH A;  3QSM A;  1OJA A;  4YTM A;  3BI4 A;  3KVE A;  3UKA A;  1GRH A;  1LTX R;  4EM4 A;  2C70 A;  3UOY A;  3UTH A;  2GR0 A;  2XCG A;  4BJZ A;  1VG9 A;  3T31 A;  3AE1 A;  1O94 A;  2Q7V A;  1QJD A;  4YSZ A;  1B37 A;  4A6N B;  1GET A;  4KPR A;  4GUV A;  4IA5 A;  3QVR A;  5J60 A;  3DJG X;  3DK4 A;  1D4E A;  2CFY A;  4Z2U A;  3DK9 A;  3IC9 A;  2YR5 A;  4CCQ A;  4ECH A;  3SZC A;  2C75 A;  4B68 A;  3P4R A;  2WQY A;  4U8N A;  4BK1 A;  4GAV A;  4D03 A;  3K7T A;  1ZX9 A;  2WP9 A;  4Y4M A;  1GRF A;  1DOC A;  3S61 A;  5GRT A;  2ZZC A;  4EMI A;  1E7P A;  1OJD A;  3FIM B;  2X50 A;  5C3J A;  3OC4 A;  4CNJ A;  3AD8 B;  3AE9 A;  4TLX A;  5KVI A;  3KA7 A;  3LB8 A;  4K5R A;  2YLZ A;  2YR6 A;  1D4C A;  4J33 A;  5JCL A;  3QFB A;  1CJC A;  1YY5 A;  4U8L A;  2YVG A;  1EL7 A;  1IUV A;  2XLS A;  1H84 A;  3NNE A;  1KNP A;  4GDE A;  3UKF A;  1BWC A;  1NHS A;  5U1O A;  1N4W A;  3CND A;  1KF6 A;  1W4X A;  4USQ A;  5JCN A;  3SX6 A;  1VG0 A;  1JRY A;  3ICS A;  5CKU A;  3LAD A;  4LU6 A;  4USR A;  1H7X A;  4DSG A;  3NIX A;  3FPZ A;  1PJ7 A;  2GEW A;  2OAL A;  1Q1R A;  3G5S A;  1XAN A;  1LJ1 A;  5LV9 A;  2GAG B;  1GPE A;  3EF6 A;  4P9S A;  4CY6 A;  4DGK A;  1RYI A;  1ZP0 A;  5KXJ A;  2HQM A;  2JK6 A;  3NK0 X;  5EB5 A;  1KDG A;  1KSU A;  3C4N A;  2X8H A;  1XHC A;  3ATR A;  3NYE A;  2WP5 A;  1BGJ A;  4IA6 A;  1TDO A;  3G5R A;  4C3Y A;  3B3R A;  4EIQ A;  2BCG G;  1YKJ A;  2TMD A;  3PS9 A;  1E1M A;  2C72 A;  2EQ6 A;  3AE6 A;  4D04 A;  4H50 A;  1CHU A;  1PBE A;  3Q9T A;  3GYI A;  1N1P A;  4CCR A;  2BRA A;  3P9U A;  4GDP A;  2B9W A;  1CC4 A;  4EQS A;  5FS8 A;  4NEV A;  1D5T A;  1Q9I A;  3NN6 X;  1MXT A;  2WBA A;  1Q1W A;  2ZZB A;  3O0H A;  2XVE A;  3PO7 A;  3D1C A;  1GRE A;  4H2N A;  4HB9 A;  2R0C A;  4AOS A;  3HZL A;  2V3B A;  3QVP A;  4XWZ A;  3E1T A;  2OA1 A;  1BGN A;  2OLO A;  4Z26 A;  2BS4 A;  3SM8 A;  2W0H A;  2YLX A;  1VQW A;  3ABV A;  5JCM A;  2GRT A;  3FBS A;  1H81 A;  5BVA A;  1H82 A;  2IID A;  3LXD A;  2Q0K A;  3CNS A;  4HA6 A;  2TPR A;  2X8G A;  1B8S A;  1LVL A;  2XLP A;  3AE5 A;  3S5W A;  3QFA A;  4ZN0 A;  3PG6 A;  3VRD B;  4NTC A;  1TDK A;  4M52 A;  2C4C A;  4ICY A;  4YWO A;  4EMW A;  3V3N A;  3AEA A;  4Y4N A;  3CIR A;  1E1L A;  1JNR A;  2YG4 A;  3AEB A;  4JQ9 A;  3F8P A;  2WU2 A;  4Z2R A;  3GRT A;  3L1R A;  2JB2 A;  2XLT A;  3CGC A;  2BK3 A;  3Q6J A;  4APN A;  4B67 A;  2YG3 A;  2FJB A;  1K0L A;  2JBV A;  2ZBW A;  4U2T A;  4I58 A;  1TYP A;  3JSK A;  1KNR A;  2XFQ A;  4KX6 A;  1LV0 A;  2R46 A;  2XDO A;  3M0O A;  1KN0 A;  1GT8 A;  2EQ8 A;  1JU2 A;  4H4W A;  5J7X A;  5M0Z A;  1S7M A;  4H2R A;  4G9K A;  3UTE A;  4AP3 A;  2BA9 A;  2BS2 A;  1GSN A;  2FJE A;  3AE3 A;  3AEF A;  3HYW A;  2YLR A;  3UKH A;  3CMM A;  2XFP A;  2RGJ A;  3K7Q X;  3QSS A;  5GSN A;  3UKK A;  4U8J A;  3G5Q A;  4B66 A;  2WDV A;  2WHD A;  5KMS A;  4A65 A;  4CBQ A;  3CNJ A;  3ALM A;  4TM0 A;  2RGH A;  5M10 A;  3C4A A;  3COX A;  4Z25 A;  3NRN A;  3UOZ A;  1E39 A;  3SQP A;  1IUU A;  4WCT A;  2C65 A;  2BXR A;  2XYO A;  1ONF A;  4U2L A;  2RGO A;  5KMR A;  1MOK A;  4A79 A;  3I6D A;  2QA2 A;  1F6M A;  3GD3 A;  1Y56 A;  4YKF A;  2XFU A;  2CUL A;  2GV8 A;  1V59 A;  3AYI A;  3KD9 A;  1NHR A;  2B76 A;  3AED A;  3KPK A;  1H7W A;  4JY2 A;  2CDU A;  4B69 A;  3SZF A;  4OPT A;  5EBK A;  2C76 A;  4UDR A;  2GQF A;  1GV4 A;  1NG3 A;  4AT0 A;  2WP6 A;  4II3 A;  5HXI A;  1SEZ A;  2GR1 A;  2Z5Y A;  1MO9 A;  3BNU A;  4TLZ A;  3B6D A;  4WX1 A;  4AOX A;  1O5W A;  3GYJ A;  1PJ6 A;  3AE2 A;  4ZCD A;  1FEB A;  2VVM A;  2VVL G;  2E4G A;  2GAH B;  2OAM A;  1PBD A;  2YR4 A;  3D8X A;  3LJP A;  1TDN A;  1CJ4 A;  2J3N A;  3RHA A;  4YKG A;  1ZOV A;  1BKW A;  2BK4 A;  2XFN A;  2YM2 A;  3AYJ A;  1GEU A;  5KRQ A;  1QO8 A;  4O5Q A;  1YQ3 A;  3UP5 A;  4Z44 A;  5HY5 A;  3NTA A;  1E1N A;  1RSG A;  3BI5 A;  5L46 A;  3NH3 X;  5KVH A;  3NT6 A;  4K5S A;  4U8K A;  4E0V A;  3HYV A;  2GMH A;  2VQB A;  4X9M A;  2C7G A;  1Z6L A;  5KOW A;  2RAB A;  4G74 A;  1D7L A;  3GYX A;  3NGC X;  1ZMD A;  3NLC A;  4JNA A;  1TDF A;  4H4R A;  4RG4 A;  3P4Q A;  1IJH A;  1GND A;  4G6H A;  5IPY A;  2O9Z A;  3SXI A;  2GF3 A;  4BV6 A;  1EBD A;  3BHK A;  5FS6 A;  1S3E A;  3DJE A;  2DKI A;  1PBF A;  3L8K A;  3M13 A;  2R4E A;  2WPE A;  4ZCC A;  2FJD A;  4GRT A;  1NG4 A;  4FDC B;  3IHG A;  4OPI A;  1COY A;  4RSL A;  5KMQ A;  3F8D A;  3K30 A;  1TYT A;  1N4V A;  1NPX A;  2XVI A;  4FK1 C;  4B65 A;  2E5V A;  1FOH A;  2XLR A;  4TM3 A;  1IUW A;  1PXB A;  2GB0 A;  2YWL A;  4Z2T A;  1IUS A;  3LZX A;  1ZKQ A;  2A89 A;  2GQW A;  3SZ0 A;  1B4V A;  1PBC A;  4H4P A;  3CGD A;  3GD4 A;  3NK1 X;  5IQ1 A;  3H8L A;  3D9X A;  1CJ3 A;  3DJD A;  4H4Q A;  4H7U A;  4H4Y A;  3AD9 B;  2GVC A;  4H2Q A;  3RP6 A;  1JNZ A;  4GCM A;  1GAL A;  2I0Z A;  3NKS A;  3AEC A;  2WES A;  3DJJ A;  1PXA A;  5C2T A;  1JEH A;  3SY4 A;  3NYC A;  1YQ4 A;  4J2W A;  4N9X A;  4YSY A;  1PS9 A;  3KLJ A;  3UKP A;  1CC6 A;  2VZ2 A;  4OCG A;  4U8O A;  4U8I A;  2GR2 A;  2BAC A;  1X31 B;  1F8W A;  2ARD A;  2YQU A;  1PJ5 A;  3ADA B;  4JNQ A;  3DH9 A;  5EB4 A;  2QAE A;  2A87 A;  1LPF A;  1K0J A;  3SYI A;  1LQU A;  1GRT A;  4EQX A;  2WS3 A;  1OJ9 A;  4YSX A;  5HHF A;  2Q0L A;  4CRT A;  5HYM A;  4CY8 A;  2Z5X A;  1OJC A;  1NAA A;  1DXL A;  2JB1 A;  2V61 A;  3P1W A;  3KU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...