4J57A

Structure of plasmodium falciparum thioredoxin reductase-thioredoxin complex
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
499
structure length
483
Chain Sequence
HTYDYDYVVIGGGPGGMASAKEAAAHGARVLLFDYVKPSSQGTKWGIGGTCVNVGCVPKKLMHYAGHMGSIFKLDSKAYGWKFDNLKHDWKKLVTTVQSHIRSLNFSYMTGLRSSKVKYINGLAKLKDKNTVSYYLKGDLSKEETVTGKYILIATGCRPHIPDDVEGAKELSITSDDIFSLKKDPGKTLVVGASYVALECSGFLNSLGYDVTVAVRSIVLRGFDQQCAVKVKLYMEEQGVMFKNGILPKKLTKMDDKILVEFSDKTSELYDTVLYAIGRKGDIDGLNLESLNMNVNKSNNKIIADHLSCTNIPSIFAVGDVAENVPELAPVAIKAGEILARRLFKDSDEIMDYSYIPTSIYTPIEYGACGYSEEKAYELYGKSNVEVFLQEFNNLEISAVHRSTCLAKLVCLKNEDNRVIGFHYVGPNAGEVTQGMALALRLKVKKKDFDNCIGIHPTDAESFMNLFVTISSGLSYAAKGGCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase 2
publication title Crystal Structure of the Plasmodium falciparum Thioredoxin Reductase-Thioredoxin Complex.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 155
structure length 483
sequence length 499
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF00890 FAD_binding_2 FAD binding domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4j57A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4j57A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4j57A02
2QA2A 2BK3A 5BRTA 2GR0A 1FEAA 5J60A 4OPDA 1JNZA 2XVFA 4WCTA 3EF6A 5KRQA 3F8RA 2XVJA 4WX1A 1BZLA 3NKSA 5ER0A 1S2YA 5C3JA 1H84A 1CJCA 1D7LA 3REDA 1GPEA 2ACZA 3LB8A 4C5OA 2TPRA 3KLJA 1S3BA 1NHSA 2EQ9A 2BC0A 2YG3A 4Z2UA 1K0LA 3DK9A 1F8SA 1GT8A 2BA9A 4J33A 4KPRA 4B63A 2GF3A 1XDIA 1NHPA 3NHOX 2YAUA 4NZHA 2BXRA 4IVMB 3ADAB 1BWCA 3ATQA 3IF9A 1LVLA 3AYJA 2B7SA 2C72A 4EMJA 1IUVA 4DSGA 1PJ7A 2PYXA 2GH5A 5HXIA 2AQJA 1YQZA 3DGHA 3C4NA 2QA1A 1PXBA 1AOGA 5FS7A 2NPXA 1KSSA 4EMIA 5IQ4A 1GEUA 2GQWA 2ZZBA 2B9XA 2XFOA 4N9XA 4TM1A 4H4VA 3AE7A 3VQRA 2WESA 3LXDA 5U63A 4A6NA 3VR9A 1E1NA 1Q9IA 5HHFA 4CNJA 4YSHA 1NAAA 3O0HA 3ICSA 3C4AA 3OC4A 4H2NA 2GMJA 2XLPA 4USQA 2YR4A 4EIQA 2BK5A 2XFNA 2XDOA 1IUUA 4EQXA 1PHHA 3BNUA 4A5LA 1RSGA 1DOEA 2GEWA 2AAQA 4GDEA 2AR8A 1O5WA 2B9YA 3D1CA 3RP8A 1DJQA 3QFAA 1PJ5A 4EIPA 1LJ1A 3LOVA 3HZLA 4H50A 5EB4A 3AD8B 5KOXA 3ICRA 3GWDA 3AYLA 1NG4A 3QSSA 1PBDA 1CC4A 3I6DA 1PBFA 4NEWA 4A65A 1FEBA 1Q1WA 1DODA 3SFDA 3NYFA 1XANA 1H86A 3Q6JA 4UDQA 1YY5A 2YLXA 1V59A 1CJ3A 4I58A 2ZZCA 1D4CA 4IVOB 1E1MA 2APGA 3AEBA 5CKUA 4H4TA 1B8SA 2C67A 1IUWA 2F5ZA 5GRTA 2VQBA 3SM8A 1K4QA 3II4A 4U2SA 4YSZA 3F8PA 1LQTA 4Z44A 3GD4A 1K0JA 3AD7B 1VRQB 4H2PA 1TDNA 4UDPA 1PXCA 4BK1A 3K7MX 3P4RA 3F8DA 4JY2A 3URHA 4H4XA 5KVIA 1H7XA 4YSYA 4OPCA 3FIMB 3NK2X 3AE3A 1ZY8A 1GOSA 1N4UA 5JCKA 2W0HA 3AEEA 1F6MA 4CY8A 2IVEA 1B5QA 2C64A 2YLZA 2JB3A 4ZN0A 2XLRA 3AEAA 2HQMA 2Q0KA 2YR6A 3GDNA 4U2LA 4OVIA 2BACA 3K7QX 4B65A 3B6DA 1FECA 4FDCB 4K8DA 4TM0A 4XXGA 3R9UA 4B64A 3DJJA 4U8MA 1GRAA 4XWRA 2BS3A 1TRBA 4EQWA 3LADA 3RP7A 3NRNA 3V76A 4U8PA 2H88A 3K7TA 5L46A 3UP5A 1GRGA 2YLRA 1GSNA 1UKVG 3CPIG 3VR8A 4A79A 3H8LA 5DBJA 1KNRA 4DSHA 3AD9B 3GMCA 4K5RA 4UDRA 1EL5A 3CTYA 2GVCA 3DJDA 3NTDA 2Z5XA 3CNSA 2C3DA 3S61A 3AEDA 4H4PA 2CDUA 1O95A 2FJAA 1TDKA 4U8KA 1NHQA 2WPFA 1RP0A 4BJZA 3DMEA 4GR1A 5FS6A 2WU2A 2FJDA 5JCNA 3ABVA 4H4RA 1BKWA 4YTMA 2YLTA 1ONFA 3GRTA 2R46A 4M52A 3M13A 4XWZA 1DXLA 1GALA 2GAHB 4ZCDA 3P4SA 3ISHA 3RHAA 1PBEA 4U2TA 1KFYA 1EBDA 1S2QA 5EB5A 4EQSA 3AEGA 3FBSA 2VOUA 2WOIA 5GSNA 3AE4A 4TLXA 4TM3A 2JBVA 3AECA 1DNCA 1Y0PA 1JNRA 2X99A 1PBCA 2GV8A 5KOWA 5FS9A 4A99A 3ITJA 1M6IA 3B3RA 2VRMA 1GRHA 3UTGA 1E7PA 2R4EA 3IHMA 3L1RA 3CGBA 4O5UA 3BI2A 1PXAA 1ZDLA 3LZXA 1E1LA 4OPLA 1IUTA 4ICYA 2C66A 4C3XA 1LQUA 4UP3A 4DNAA 2WHDA 1OJTA 2WQYA 1M64A 3KU9A 4H7UA 4A9WA 3BI4A 1ZKQA 1L9EA 4U8NA 2YM1A 2YVGA 4O5QA 2DKHA 3DH9A 1REOA 2YWLA 1D4DA 1BF3A 2Q6UA 3UKLA 2B7RA 4H4YA 2EQ7A 3NK1X 4NTDA 3KKJA 4Y4MA 1NG3A 1CC2A 2YG4A 4MJWA 3GYIA 3UTHA 4YSXA 1GV4A 2ZBWA 4A7AA 1LV0A 2GB0A 3SGLA 2X3NA 3PO7A 2RGJA 1F3PA 3AB1A 3UKFA 3UKHA 3DK8A 4JNQA 1L9DA 4BK3A 4CCRA 2JAEA 2RABA 5KXJA 4H2QA 2BCGG 2WETA 5JCMA 1JU2A 3CGEA 4H4SA 1BGNA 3L8KA 2XVEA 5CQFA 4RG4A 2BS4A 4B68A 4X9MA 3NTAA 3KD9A 1H83A 3WE0A 1ZK7A 2WBAA 5BUKA 2VVLG 3Q9TA 2ARDA 2E1MA 4PABA 2OAMA 1CF3A 3IC9A 3VRAA 3CIRA 3NH3X 1E39A 3KPFA 3CNJA 2IIDA 3P4QA 2WPCA 1H7WA 2WDRA 3NN6X 1QLBA 3ZDNA 1N4VA 2V3BA 2EQ6A 3P1WA 1Z6LA 3CGDA 4EQRA 2OLOA 4E0VA 1PDHA 1OJ9A 1XPQA 1VDCA 2I0ZA 2R0GA 2R4JA 1EL7A 1CHUA 2IVDA 4BK2A 2EQ8A 2WS3A 4H4QA 1FCDA 2Q0LA 4J31A 4REKA 4NEVA 3AE2A 1VQWA 4AOXA 4YXDA 4GDPA 4H4ZA 4OPIA 5KVHA 2TMDA 1KSUA 4Z2RA 4JN9A 3QVRA 3CNPA 3QJ4A 3NNEA 2R9ZA 2BC1A 5U25A 1DOBA 1MXTA 2BK4A 2C76A 5IPYA 3NLCA 2H89A 3H8IA 2BYBA 3OZ2A 2WP5A 1PBBA 1QO8A 2FJBA 4YTPA 1B4VA 1NENA 2BS2A 4B1BA 4GUVA 2C3CA 3RP6A 3VRBA 2QCUA 5EBKA 3IWAA 4AOSA 3UKAA 3DJEA 5U1OA 4YWOA 2JK6A 3GRSA 2C75A 3CNTA 3UKPA 1TYPA 4FX9A 2X50A 1GTHA 1MOKA 2YLWA 4X4JA 2CVJA 2ZZ0A 3GD3A 1OJAA 2VVLA 3GMBA 3AYIA 2XLTA 2WOVA 1N4WA 2YVJA 4GCMA 2GMHA 3UKKA 4AT2A 3G5QA 4D03A 2V5ZA 2GR3A 2XCGA 1VG0A 2C7GA 2R0PA 2OA1A 4FK1A 2DKIA 1GESA 4HA6A 3DJGX 3EAOA 1S3EA 4C77A 2XLUA 4JNAA 4K5SA 4Y4LA 4U8IA 2JKCA 4YTNA 1COYA 1EL8A 4P9SA 4U8JA 1GETA 2XLSA 2XVHA 3DGZA 2E4GA 1KNPA 2V3AA 2VRLA 3AE6A 2BABA 3FG2P 3K30A 3KVEA 4TLZA 5HYMA 5IQ1A 3AWIA 4GRTA 2B76A 2X8HA 3NN0X 2WDVA 1JEHA 4IA6A 3FPZA 1D4EA 4JQ9A 3AE5A 2VVMA 3UKQA 3EPTA 5EOWA 1CBOA 3AE9A 3VRDB 1NDAA 3DA1A 4PAAA 1SEZA 3FMWA 3RNMA 4J57A 1E6EA 4CCQA 2CULA 1ELIA 4GF7A 4NTEA 3T37A 2FJEA 3NG7X 1ZMCA 2XVIA 3G5RA 1TDEA 2VZ2A 1B37A 1FL2A 2R45A 3CN8A 1YKJA 1RYIA 4YKGA 2C70A 2YG6A 4H4WA 5BULA 4B67A 2YG5A 4IV9A 1NPXA 2GRTA 3G5SA 3PVCA 4USRA 3UTEA 2OLNA 4K2XA 2YVFA 3V3OA 4YKFA 1TDFA 4JY3A 5M0ZA 1Y56B 3NK0X 4C74A 4LA1A 1KDGA 2YG7A 3NGCX 1K0IA 1PN0A 3CPHG 3NT6A 4NTCA 2WDQA 1F8WA 3COXA 4EMWA 4LU6A 2XFPA 2XFUA 3P4PA 4CNKA 2V60A 4D04A 5C2TA 3GDPA 4JDRA 1W4XA 1NEKA 3E1TA 2Y6RA 1D7YA 1EL9A 2Z5YA 1PJ6A 4J2WA 4U8OA 4J36A 4Z25A 1CJ4A 2RGHA 3BNMA 3CNDA 1LTXR 1Q1RA 4TM4A 2Y6QA 3CPJG 2JB1A 3UOXA 1GREA 4KX6A 3D8XA 1MO9A 1YQ4A 4CY6A 3GWFA 2B9WA 1BGJA 4U8LA 3UOVA 3H4KA 3AE1A 4EM4A 2Q7VA 3ALMA 4ECHA 3BHKA 2JB2A 2V61A 4FK1C 1JRZA 5KWFA 2PHHA 5M10A 3AEFA 3NYCA 2WEUA 2BCPA 1IUSA 1GTEA 2YQUA 4H2RA 4AP1A 3EANA 1L9CA 2GR1A 3GSIA 2WOWA 1PS9A 1LPFA 4IA5A 3M0OA 1DJNA 2YLSA 4C3YA 1GRTA 1CC6A 2A87A 1F8RA 4AT0A 3QSEA 4K7ZA 2WP6A 3NIXA 4Z24A 2NVKX 2CFYA 1FOHA 3BHFA 5FS8A 1YQ3A 4ADWA 3LJPA 1CL0A 1ZP0A 3V3NA 4J34A 4I59A 2XFQA 3NYEA 1H82A 3M12A 1GRBA 2OALA 1IUXA 4X9NA 5BVAA 1H6VA 3PS9A 1E1KA 1OJCA 3UCLA 1JOAA 4B69A 2WP9A 2O9ZA 1H81A 2VQ7A 1L0VA 4OPTA 1ZOYA 4CBQA 3SFEA 4BV6A 1OJDA 1O94A 3UP4A 3S5WA 2C73A 1ZX9A 5JCLA 1GNDA 3JSKA 2X8CA 4OPGA 2C65A 3P9UA 5TR3A 4RG3A 1ZMDA 1KF6A 5FMHA 1GRFA 1P2HA 2E5VA 2YM2A 5HY5A 4LIIA 1CJ2A 1DOCA 3ICTA 4CRTA 2QAEA 3LZWA 1HYUA 5J7XA 4A6NB 2RGOA 4B66A 4RSLA 4Y4NA 2J3NA 4EM3A 3UOZA 1X31B 2R0CA 2WU5A 5LV9A 3CGCA 2FBWA 4AP3A 1QJDA 3BI5A 1Y56A 4YT0A 3QVPA 1N1PA 3ATRA 1TYTA 1ZOVA 2A89A 4HB9A 3QFBA 4Z2TA 3ZYXA 1NHRA 3UTFA 3AXBA 4H4UA 4OPUA 1P2EA 2V6OA 2WPEA 1GXFA 3IHGA 3KA7A 1D5TA 3ALLA 3SQPA 4BURA 2UZZA 4APNA 1TDOA 2GAGB 2A8XA 3GYJA 4Z26A 3C96A 4Z43A 4K22A 1IJHA 1JRXA 4DGKA 3I3LA 2GR2A 1XHCA 3DK4A 2BXSA 3AE8A 3ALJA 2XYOA 1JRYA 3QSMA 2X8GA 4OCGA 1VG9A 2GQFA 4BJYA 4ZCCA 4J56A 2YR5A 3UOYA 5JCIA 1GERA
chains in the Genus database with same CATH superfamily
2BK3A 5BRTA 5J60A 4OPDA 2QJJA 2XVFA 4WCTA 5KRQA 3F8RA 4WX1A 1BZLA 1IYXA 2XH4A 4C5OA 3KLJA 3T0KA 2EQ9A 3DK9A 2P8CA 1F8SA 1KD0A 3S47A 2GF3A 5JRBA 4Z17A 1NHPA 2YAUA 3SR6B 1BWCA 3ATQA 1NELA 4DSGA 1PJ7A 2AQJA 1YQZA 3DGHA 3NO1A 2QA1A 2NPXA 1KSSA 3PFRA 2PCEA 5IQ4A 4MKSA 3QLDA 2B9XA 4N9XA 4KWSA 3AE7A 3VDGA 2I5QA 2WESA 5HHFA 4YSHA 3ICSA 3SZWA 3BJSA 2YR4A 3DG3A 4EQXA 3BNUA 4A5LA 1DOEA 3NVYB 3RP8A 3NVVB 1DJQA 4EIPA 3VCCA 3HW2A 4H50A 3AN1A 5KOXA 3ICRA 3AYLA 5J04A 3I6DA 1PBFA 4A65A 3SFDA 4I58A 1V59A 1W6TA 1D4CA 2VQBA 2F5ZA 2W55A 5GRTA 3SM8A 1K4QA 4U2SA 1TE6A 4UDPA 3OTRA 3RO6A 1PXCA 3P4RA 3F8DA 1S7MA 1N63C 5KVIA 4OPCA 3NK2X 3AEEA 1GOSA 2W0HA 1F6MA 4TVYA 2C64A 3T6CA 3AEAA 2AL1A 4OVIA 3K7QX 4B65A 4II2A 4FDCB 1WYGA 4U8MA 1TRBA 4HNCA 3SN0A 3NRNA 3GC2A 5L46A 3VCNA 2P8BA 3AD9B 3GMCA 4UDRA 2OKTA 3DJDA 3D47A 4J1OA 2C3DA 3AEDA 1O95A 1TDKA 2GGIA 1RP0A 5FS6A 4A6GA 2WU2A 3ABVA 2O56A 4M52A 1EBDA 4EQSA 3AEGA 2WOIA 2JBVA 3TWAA 4GAPA 1Y0PA 2POZA 5KOWA 2FKPA 3ITJA 2PA6A 1GRHA 3UTGA 1FHVA 2QJNA 3BI2A 4H1ZA 5KMQA 1LQUA 4UP3A 4A9WA 1OJTA 1ZKQA 1MRAA 1PDYA 2YVGA 2YM1A 1REOA 2YWLA 2Q6UA 2B7RA 2GGHA 4NTDA 3KKJA 1GV4A 3U4FA 4A7AA 3DESA 3DFYA 3PO7A 3R10A 2CHRA 4JNQA 3PG6A 1N61C 4H2QA 3IK4A 4HN8A 2XVEA 2BS4A 3WE0A 4M6UA 3NH3X 3P4QA 4JHMA 2WDRA 3P1WA 3H7VA 4EQRA 1PDHA 1XPQA 2I0ZA 1VDCA 1EC9A 2WS3A 1FCDA 2PTZA 4NEVA 1VQWA 3HYXA 2TMDA 1KSUA 3CNPA 3QJ4A 2R9ZA 5IPYA 1MXTA 2BK4A 3SY4A 2BYBA 1PBBA 4B1BA 4GUVA 3DERA 2QCUA 3VRBA 5EBKA 3GRSA 2C75A 1MOKA 3UXLA 2VVLA 3GMBA 3AYIA 2XLTA 2WOVA 2YVJA 3CYJA 3UKKA 4AT2A 3VC6A 2XCGA 2ZADA 1BQGA 2DKIA 1GESA 3DJGX 4C77A 2JKCA 1EL8A 1JROA 3DGZA 2V3AA 3U9IA 3KVEA 4IZGA 3SSZA 4GRTA 3NVZB 2WDVA 1JEHA 4IA6A 2VVMA 1CBOA 3DA1A 1V97A 4CCQA 3CMMA 1ELIA 3T37A 3NG7X 1ZMCA 3G5RA 1B37A 1L8PA 1YKJA 4B67A 3DIPA 3UTEA 2OLNA 2YVFA 5M0ZA 4NTCA 2WDQA 1F8WA 2XH2A 5C2TA 3GDPA 1W4XA 1NEKA 2Z5YA 1PJ6A 1FIQB 1CJ4A 2RGHA 3CNDA 1Q1RA 3QN3A 4ECHA 2PP3A 5G5HB 1JRZA 4G7FA 2PHHA 5M10A 3NYCA 1IUSA 1GTEA 3THUA 4IA5A 1DJNA 2YLSA 2PMQA 3HYWA 1F8RA 4NWZA 2CFYA 3OZYA 4ADWA 3V3NA 1CL0A 4GGHA 4I59A 1H82A 1OJCA 1FFUC 3SXIA 1H81A 1ZOYA 3SFEA 1OJDA 3S5WA 2C73A 2C65A 5TR3A 1TKKA 5FMHA 1GRFA 3JVAA 4G9KA 3LZWA 3ZLHA 2J3NA 3Q45A 2WU5A 3CGCA 2FBWA 1N1PA 3R11A 1D5TA 1ZXIC 2ONEA 3SQPA 2PSNA 2A8XA 3C96A 1WUEA 4DGKA 2MUCA 2GR2A 3MQTA 3ALJA 2XYOA 3QTPA 1X2HA 1VG9A 2GQFA 3UCDA 2GR0A 3T9PA 1FEAA 2XVJA 3ZLGA 1E9IA 1H84A 1CJCA 2PPGA 1GPEA 3CB3A 2TPRA 1FO4A 4GYPC 4IL0A 2XH0A 1S3BA 3TWBA 4GGBA 2DW7A 4KPRA 2PTWA 2PTXA 3NHOX 4NZHA 3UJ2A 2MNRA 3IF9A 1LVLA 3AYJA 4EMJA 4H83A 3ETRB 1AOGA 5FS7A 3R1ZA 2GGGA 2XFOA 3VR9A 2QVHA 3V3WA 1E1NA 1Q9IA 1NAAA 3O0HA 3C4AA 3OC4A 4H2NA 2BK5A 1RSGA 2GEWA 2AR8A 1H2IA 1LJ1A 3LOVA 2OFJA 5EB4A 1VQZA 3CT2A 4NEWA 2OX4A 1DODA 3NYFA 3II4A 4YSZA 3L5OA 4Z44A 1VRQB 2GSHA 3Q4DA 1H7XA 4YSYA 3GO2A 3AE3A 2JB3A 3P93A 2HQMA 4U2LA 4FP1A 2BACA 1FECA 3R0KA 2BS3A 3SYIA 3V76A 3K7TA 5KMPA 1GRGA 1UKVG 3CPIG 3T14A 4DSHA 1KNRA 4K5RA 2OPJA 4H19A 4DX3A 2CDUA 3UJFA 2FJAA 4U8KA 3DMEA 4GR1A 1EBGA 2FJDA 4YTMA 3GRTA 3HPFA 2R46A 4JN8A 4ZCDA 2GAHB 2AL2A 3FBSA 5GSNA 4TM3A 4K2SA 1DNCA 3TJ4A 5FS9A 3QKEA 2VRMA 3L1RA 3ZVHA 3LZXA 2C66A 1N60C 4DNAA 1L9EA 3ENLA 1D4DA 4YSXA 4IP4A 2ZBWA 2GB0A 2RGJA 1F3PA 3UKHA 5FJUA 1L9DA 4CCRA 2RABA 4H4SA 5CQFA 5BUKA 1ZK7A 2E1MA 3VRAA 3IC9A 3KPFA 2IIDA 1H7WA 1QLBA 2V3BA 2BRAA 2EQ6A 3A7RA 2R0GA 3DG6A 1CHUA 2EQ8A 4H4QA 3MSYA 4REKA 4KPLA 4H4ZA 4KT2A 4JN9A 3FVDA 2BC1A 5U25A 4TVWA 2H89A 2WP5A 1QO8A 4YTPA 1B4VA 1EC8A 1PDZA 5EU9A 3RP6A 3UKAA 3FYYA 3DJEA 4YWOA 4FX9A 1GTHA 2CVJA 2ZZ0A 3GD3A 4GCMA 1N4WA 2W3RA 4G6GA 2GR3A 4II3A 1VG0A 2C7GA 2R0PA 2XGZA 2OLAA 3R0UA 5KNLA 2XLUA 4JNAA 4Y4LA 4YTNA 3I4KA 3MKCA 4U8JA 1KNPA 3PWGA 3AE6A 2BABA 1MDRA 3AWIA 2X8HA 3AE5A 2DW6A 4PAAA 3RNMA 4J57A 1TDEA 2VZ2A 4E6MA 2C70A 2YG6A 1NPXA 3V3OA 4YKFA 2ZC8A 4JY3A 2OQHA 1KDGA 3CPHG 3NT6A 3VFCA 4EMWA 1FHUA 2XFUA 3CK5A 4U8OA 4J2WA 4J36A 1R0MA 3MUCA 4TM4A 2Y6QA 3CPJG 1GREA 1OEPA 3S5SA 3D8XA 3GD6A 1MO9A 1YQ4A 3I6EA 4HCHA 3GWFA 4ZOHB 1MDLA 3AEFA 2WEUA 2BCPA 3SQSA 4AP1A 4IL2A 1PS9A 1LPFA 3MZNA 4C3YA 1CC6A 4Z1YA 3BOXA 4K7ZA 2WP6A 4NNJA 4Z24A 2NVKX 1FOHA 3BHFA 4H2HA 5FS8A 2PGWA 1YQ3A 3LJPA 4J34A 5FJPA 1GRBA 3SZCA 5BVAA 3PS9A 3UCLA 1JOAA 4IP5A 2WP9A 2O9ZA 4B69A 2VQ7A 1ZX9A 2OZTA 3JSKA 4OPGA 1KF6A 4K1WA 7ENLA 1P2HA 2E5VA 4DHGA 5HY5A 4LIIA 3NXLA 4M0XA 2RGOA 4EM3A 5LV9A 1X31B 4AP3A 3BI5A 3EKGA 3QVPA 1TYTA 2A89A 4HB9A 1DTNA 2C4CA 3STPA 4H4UA 1GXFA 3KA7A 3I6TA 4APNA 4A35A 3N4EA 1JRXA 3DK4A 2HXUA 2X8GA 4OCGA 4ZCCA 4J56A 3FCPA 3KUMA 3H8LA 3B9JB 3NKSA 1ONEA 5C3JA 5ENLA 1D7LA 3REDA 2ACZA 3LB8A 3HYVA 2YG3A 3RGTA 1GT8A 2BA9A 1N5XA 4J33A 4B63A 3ADAB 3SZ0A 1IUVA 2PYXA 5HXIA 3C4NA 4G73A 4EMIA 4HPNA 3RITA 2ZZBA 4HYRA 3VQRA 3PWIA 3LXDA 4A6NA 3R07C 3DEQA 3TOYA 1WUFA 3B97A 3UXKA 2XLPA 4YWSA 1IUUA 2B9YA 3D1CA 2QGYA 1PJ5A 4GYPA 3HZLA 3AD8B 1CC4A 3ES7A 1H86A 1YY5A 1CJ3A 1SJCA 4IVOB 1E1MA 3AEBA 1B8SA 2C67A 1F9CA 1K0JA 3AD7B 4H2PA 1TDNA 3SN1A 4BK1A 1VDVA 1STZA 4JY2A 3AMZA 4H4XA 3EUB3 3FIMB 1N4UA 2IVEA 4GIRA 1B5QA 2Q0KA 2YR6A 3GDNA 1N62C 4G8TA 4B64A 4TM0A 4XXGA 3DJJA 1GRAA 3UGVA 4EQWA 3LADA 3NRZB 4J3ZA 2H88A 4FI4A 3UP5A 2YLRA 1GSNA 3VR8A 1EL5A 1EC7A 2GVCA 3CNSA 4H4PA 1NHQA 2WPFA 2W3SA 4BJZA 1MNSA 4H4RA 1ONFA 2OG9A 1GALA 3ISHA 3DFHA 1S2QA 1TZZA 3V5CA 3AE4A 4ZA0A 4TLXA 3CXOA 2PP1A 1KKOA 3AECA 4A99A 1M6IA 3UJRA 3CGBA 4O5UA 1ZDLA 3NVWB 4OPLA 3T2KA 4C3XA 2WHDA 1R6WA 2WQYA 1M64A 3KU9A 4O5QA 2DKHA 3DH9A 1BF3A 3UKLA 4Y4MA 1NG3A 1CC2A 4MJWA 3GYIA 3ZVIA 1XS2A 3UJEA 3SGLA 3RCYA 3PK7A 4BK3A 2JAEA 3FXGA 2BCGG 2WETA 1JU2A 3CGEA 1BGNA 3L8KA 4RG4A 4B68A 3NTAA 2PODA 2WBAA 3BSMA 3Q9TA 2ARDA 2OAMA 2P3ZA 1E39A 2WPCA 4HCLA 3NN6X 1N4VA 3T2ZA 5FJRA 1Z6LA 2RDXA 3V5FA 2R4JA 1EBHA 4MGGA 3AE2A 4AOXA 4GDPA 4DN1A 5KVHA 3TCSA 3QVRA 3T31A 3NNEA 1DOBA 2C76A 3H8IA 2BS2A 2C3CA 4X2PA 1JDFA 3IWAA 3CXBA 4AOSA 3CNTA 2JK6A 3T4WA 2YLWA 4X4JA 1OJAA 2GMHA 1T3QC 3G5QA 4D03A 2OA1A 4FK1A 3EAOA 1NU5A 3OZMA 4K5SA 2AKZA 1JPDX 4P9SA 1BKHA 1GETA 2PU0A 2XVHA 3P0WA 2VRLA 3K30A 5HYMA 2B76A 3NN0X 1D4EA 4JQ9A 3UKQA 3EPTA 4KEMA 3AE9A 3N6JA 4GAVA 1NDAA 1E6EA 3RRAA 4GF7A 3EEZA 2FJEA 2XVIA 1FL2A 2OQYA 2R45A 3GY1A 5BULA 4H4WA 2YG5A 4IV9A 3G5SA 2GRTA 4USRA 1RVKA 4E4UA 3PVCA 2HNEA 4K2XA 4C74A 2YG7A 3NGCX 1K0IA 3COXA 4LU6A 2XFPA 2QJMA 2V60A 4D04A 4JDRA 3E1TA 1EL9A 3BNMA 2OVLA 2JB1A 3UOXA 3IJIA 1KN0A 3D9XA 2PP0A 1JPMA 3UOVA 3H4KA 3AE1A 2JB2A 5KWFA 4FK1C 3K1GA 4ROPA 4H2RA 1L9CA 3GSIA 2XH7A 3M0OA 1P43A 2A87A 4AT0A 3NIXA 3IJQA 1ZP0A 2XSXA 3DG7A 4JN7A 3OP2A 3NYEA 3NFUA 3M12A 2OALA 1SJDA 1H6VA 1E1KA 2E5AA 1L0VA 4OPTA 3H12A 4CBQA 1O94A 2PS2A 3UP4A 4GMEA 1GNDA 3P9UA 1ZMDA 2YM2A 3ICTA 4A6NB 5J7XA 4B66A 4RSLA 4Y4NA 1X2GA 1Y56A 3ATRA 4DYEA 1ZOVA 4Z2TA 4E4FA 3UTFA 3AXBA 4E5TA 3ES8A 2E3TA 1P2EA 2V6OA 2BRYA 3IHGA 4BURA 2UZZA 2FYMA 2GAGB 1ELSA 2OZ3A 1IJHA 1XPYA 3I3LA 1JRYA 1MUCA 1FFVC 2YR5A 5JCIA 1GERA 3MWCA 2QA2A 5KMRA 3MY9A 3TQPA 1JNZA 3EF6A 5ER0A 1S2YA 3A7AA 2GGJA 1NHSA 2BC0A 4IHCA 4Z2UA 1K0LA 3H70A 1XDIA 1N5WC 5FJOA 4DWDA 2BXRA 4IVMB 1SJAA 3N6HA 2B7SA 2C72A 5BOFA 2GH5A 1PXBA 1GEUA 2GQWA 4TM1A 4H4VA 5U63A 4CNJA 4USQA 2GMJA 4EIQA 2XFNA 2XDOA 1PHHA 2AAQA 4GDEA 1O5WA 1KCZA 3QFAA 3GWDA 1NG4A 5IDZA 3QSSA 1PBDA 1FEBA 1Q1WA 1XANA 3Q6JA 3AM9A 4UDQA 2YLXA 2ZZCA 3SJNA 2APGA 5CKUA 4H4TA 1IUWA 3F8PA 1LQTA 3GD4A 4EWJA 3K7MX 3URHA 2GL5A 3RR1A 1ZY8A 5JCKA 4CY8A 2YLZA 4ZN0A 3TTEA 2XLRA 5BOEA 3QPEA 3B6DA 3SZFA 4K8DA 3R9UA 4XWRA 2OO6A 3A7UA 3RP7A 3R25A 4U8PA 4E8GA 4A79A 5DBJA 3CTYA 4K8GA 3NTDA 2Z5XA 3S61A 5JCNA 1BKWA 2YLTA 3M13A 4XWZA 1DXLA 3RHAA 3P4SA 1PBEA 4U2TA 1KFYA 5EB5A 2VOUA 3P3BA 1JNRA 2X99A 1PBCA 2GV8A 1SJBA 3B3RA 1ECQA 3JW7A 1E7PA 2R4EA 3IHMA 1PXAA 1E1LA 2AKMA 1IUTA 4ICYA 4F4RA 4H7UA 2GDQA 3BI4A 3VA8A 4U8NA 3DGBA 4H4YA 2EQ7A 3NK1X 2YG4A 1YEYA 3UTHA 2NQLA 3V4BA 2QQ6A 1LV0A 2X3NA 3AB1A 3UKFA 3SBFA 3DK8A 2GGEA 3OPSA 5KXJA 2P88A 2AL2B 5JCMA 4G74A 3NS1B 4X9MA 2HXTA 3KD9A 1H83A 2VVLG 4PABA 1KKRA 1CF3A 3KPKA 3CIRA 3CNJA 3ZVHB 4ZCWA 3ZDNA 3CGDA 2OLOA 4E0VA 1OJ9A 1EL7A 2IVDA 2P0IA 4BK2A 3JZUA 2Q0LA 4J31A 2QDDA 4YXDA 4OPIA 4Z2RA 4ENLA 3NLCA 3OZ2A 2FJBA 1NENA 5FJTA 2PU1A 5U1OA 4GFIA 3UKPA 2QDEA 1TYPA 2X50A 3UCCA 3OW1A 2V5ZA 2HZGA 2OZ8A 4HA6A 1S3EA 4DXKA 4U8IA 1COYA 4IT1A 2XLSA 2E4GA 3FG2P 4TLZA 3H8AA 5IQ1A 3GYXA 3FPZA 5EOWA 3VRDB 1SEZA 3FMWA 2CULA 4NTEA 4HCDA 3CN8A 4YKGA 1RYIA 1TDFA 2W54A 3D46A 3VC5A 1Y56B 3NK0X 4LA1A 3HRDC 3SX6A 1PN0A 4CNKA 3P4PA 3UJSA 4G6HA 2Y6RA 1D7YA 4Z25A 3FJ4A 1LTXR 5KMSA 4KX6A 2PTYA 3N4FA 4A3RA 1JRPA 4CY6A 2B9WA 3FV9A 1BGJA 4U8LA 3ZLFA 4EM4A 2Q7VA 3ALMA 3BHKA 2V61A 2PGEA 2YQUA 3IJLA 3EANA 2GR1A 2WOWA 1GRTA 6ENLA 3QSEA 3T2YA 2XFQA 1P48A 4GISA 1IUXA 4X9NA 3SN4A 1RM6B 4BV6A 5JCLA 2X8CA 4RG3A 3NZGA 1CJ2A 1DOCA 4CRTA 2QAEA 1HYUA 5G5GB 4MMWA 3UOZA 2R0CA 1QJDA 4YT0A 3QFBA 3ZYXA 1NHRA 3CAWA 3T8QA 4OPUA 2WPEA 4HNLA 3ALLA 1TDOA 3TJIA 3GYJA 4Z26A 1SB3B 4Z43A 4K22A 3TW9A 1XHCA 2BXSA 3AE8A 3QSMA 1JCTA 4BJYA 3DDMA 3UOYA
chains in the Genus database with same CATH topology
2QA2A 5KMRA 2BK3A 5BRTA 2GR0A 1FEAA 5J60A 4OPDA 1JNZA 2XVFA 4WCTA 3EF6A 5KRQA 3F8RA 2XVJA 4WX1A 1BZLA 3NKSA 5ER0A 1S2YA 5C3JA 1H84A 1CJCA 1D7LA 3REDA 1GPEA 2ACZA 3LB8A 4C5OA 2TPRA 3KLJA 3HYVA 3T0KA 1S3BA 1NHSA 2EQ9A 2BC0A 2YG3A 4Z2UA 1K0LA 3DK9A 1F8SA 1GT8A 2BA9A 4J33A 4KPRA 4B63A 2GF3A 5JRBA 1XDIA 1NHPA 3NHOX 2YAUA 4NZHA 2BXRA 4IVMB 3ADAB 1BWCA 3ATQA 3IF9A 1LVLA 3AYJA 2B7SA 2C72A 4EMJA 3SZ0A 1IUVA 4DSGA 1PJ7A 2PYXA 2GH5A 5HXIA 2AQJA 1YQZA 3DGHA 3C4NA 2QA1A 1PXBA 1AOGA 5FS7A 2NPXA 1KSSA 4G73A 4EMIA 5IQ4A 1GEUA 2GQWA 2ZZBA 2B9XA 2XFOA 4N9XA 4TM1A 4H4VA 3AE7A 3VQRA 2WESA 3LXDA 5U63A 4A6NA 3VR9A 1E1NA 1Q9IA 5HHFA 4CNJA 4YSHA 1NAAA 3O0HA 3ICSA 3C4AA 3SZWA 3OC4A 4H2NA 2GMJA 2XLPA 4USQA 2YR4A 4EIQA 2BK5A 2XFNA 2XDOA 1IUUA 4EQXA 1PHHA 3BNUA 4A5LA 1RSGA 1DOEA 2GEWA 2AAQA 4GDEA 2AR8A 1O5WA 2B9YA 3D1CA 3RP8A 1DJQA 1H2IA 3QFAA 1PJ5A 4EIPA 1LJ1A 3LOVA 3HZLA 4H50A 5EB4A 3AD8B 5KOXA 3ICRA 3GWDA 3AYLA 1NG4A 3QSSA 1PBDA 1CC4A 3I6DA 1PBFA 4NEWA 4A65A 1FEBA 1Q1WA 1DODA 3SFDA 3NYFA 1XANA 1H86A 3Q6JA 4UDQA 1YY5A 2YLXA 1V59A 1CJ3A 4I58A 2ZZCA 1D4CA 4IVOB 1E1MA 2APGA 3AEBA 5CKUA 4H4TA 1B8SA 2C67A 1IUWA 2F5ZA 5GRTA 2VQBA 3SM8A 1K4QA 3II4A 4U2SA 4YSZA 3L5OA 3F8PA 1LQTA 4Z44A 3GD4A 1K0JA 3AD7B 1VRQB 4H2PA 1TDNA 4UDPA 1PXCA 4BK1A 3K7MX 3P4RA 3F8DA 1S7MA 4JY2A 3URHA 4H4XA 5KVIA 1H7XA 4YSYA 4OPCA 3FIMB 3NK2X 3AE3A 1ZY8A 1GOSA 1N4UA 5JCKA 2W0HA 3AEEA 1F6MA 4CY8A 2IVEA 1B5QA 2C64A 2YLZA 2JB3A 4ZN0A 2XLRA 3AEAA 2HQMA 2Q0KA 2YR6A 3GDNA 4U2LA 4OVIA 2BACA 3K7QX 4B65A 3B6DA 1FECA 4II2A 4FDCB 4K8DA 4TM0A 4XXGA 3R9UA 3SZFA 3DJJA 4B64A 4U8MA 1GRAA 4XWRA 2BS3A 1TRBA 4EQWA 3LADA 3RP7A 3NRNA 3SYIA 3V76A 4U8PA 2H88A 3K7TA 5KMPA 5L46A 3UP5A 1GRGA 2YLRA 1GSNA 1UKVG 3CPIG 3VR8A 4A79A 3T14A 3H8LA 5DBJA 1KNRA 4DSHA 3AD9B 3GMCA 4K5RA 4UDRA 1EL5A 3CTYA 2GVCA 3DJDA 3NTDA 2Z5XA 3CNSA 2C3DA 3S61A 3AEDA 4H4PA 2CDUA 1O95A 2FJAA 1TDKA 4U8KA 1NHQA 2WPFA 1RP0A 4BJZA 3DMEA 4GR1A 5FS6A 2WU2A 2FJDA 5JCNA 3ABVA 4H4RA 1BKWA 4YTMA 2YLTA 1ONFA 3GRTA 2R46A 4M52A 3M13A 4XWZA 1DXLA 1GALA 2GAHB 4ZCDA 3P4SA 3ISHA 3RHAA 1PBEA 4U2TA 1KFYA 1EBDA 1S2QA 5EB5A 4EQSA 3AEGA 3FBSA 2VOUA 2WOIA 5GSNA 3AE4A 4TLXA 4TM3A 2JBVA 3AECA 1DNCA 4GAPA 1Y0PA 1JNRA 2X99A 1PBCA 2GV8A 5KOWA 5FS9A 4A99A 3ITJA 1M6IA 3B3RA 2VRMA 1GRHA 3UTGA 1E7PA 2R4EA 3IHMA 3L1RA 3CGBA 4O5UA 3BI2A 1PXAA 1ZDLA 3LZXA 1E1LA 5KMQA 4OPLA 1IUTA 4ICYA 2C66A 3T2KA 4C3XA 1LQUA 4UP3A 4DNAA 2WHDA 1OJTA 2WQYA 1M64A 3KU9A 4H7UA 4A9WA 3BI4A 1ZKQA 1L9EA 4U8NA 2YM1A 2YVGA 4O5QA 2DKHA 3DH9A 1REOA 2YWLA 1D4DA 1BF3A 2Q6UA 3UKLA 2B7RA 4H4YA 2EQ7A 3NK1X 4NTDA 3KKJA 4Y4MA 1NG3A 1CC2A 2YG4A 4MJWA 3GYIA 3UTHA 4YSXA 1GV4A 2ZBWA 4A7AA 1LV0A 2GB0A 3SGLA 2X3NA 3PO7A 2RGJA 1F3PA 3AB1A 3UKFA 3UKHA 3DK8A 4JNQA 1L9DA 4BK3A 3PG6A 4CCRA 2JAEA 2RABA 5KXJA 4H2QA 2BCGG 2WETA 1JU2A 5JCMA 3CGEA 4G74A 4H4SA 1BGNA 3L8KA 2XVEA 5CQFA 4RG4A 2BS4A 4B68A 4X9MA 3NTAA 3KD9A 1H83A 3WE0A 1ZK7A 2WBAA 5BUKA 2VVLG 3Q9TA 2ARDA 2E1MA 4PABA 2OAMA 1CF3A 3IC9A 3KPKA 3CIRA 3VRAA 3NH3X 1E39A 3KPFA 3CNJA 2IIDA 3P4QA 2WPCA 1H7WA 2WDRA 3NN6X 1QLBA 3ZDNA 2V3BA 1N4VA 3T2ZA 2BRAA 2EQ6A 3P1WA 1Z6LA 3CGDA 4EQRA 2OLOA 4E0VA 1PDHA 1OJ9A 1XPQA 1VDCA 2I0ZA 2R0GA 2R4JA 1EL7A 1CHUA 2IVDA 4BK2A 2EQ8A 2WS3A 4H4QA 1FCDA 2Q0LA 4J31A 4REKA 4NEVA 3AE2A 1VQWA 4AOXA 4YXDA 4GDPA 3HYXA 4H4ZA 4OPIA 5KVHA 2TMDA 1KSUA 4Z2RA 4JN9A 3QVRA 3T31A 3CNPA 3QJ4A 3NNEA 2R9ZA 2BC1A 5U25A 1DOBA 1MXTA 2BK4A 2C76A 5IPYA 3SY4A 3NLCA 2H89A 3H8IA 2BYBA 3OZ2A 2WP5A 1PBBA 1QO8A 2FJBA 4YTPA 1B4VA 1NENA 2BS2A 4B1BA 4GUVA 2C3CA 3RP6A 3VRBA 2QCUA 5EBKA 3IWAA 4AOSA 3UKAA 3DJEA 5U1OA 4YWOA 2JK6A 3GRSA 2C75A 3CNTA 3UKPA 1TYPA 4FX9A 2X50A 1GTHA 1MOKA 2YLWA 4X4JA 2CVJA 2ZZ0A 3GD3A 1OJAA 2VVLA 3GMBA 3AYIA 2XLTA 2WOVA 1N4WA 2YVJA 4GCMA 2GMHA 3UKKA 4AT2A 3G5QA 4G6GA 2V5ZA 4D03A 2GR3A 2XCGA 4II3A 1VG0A 2C7GA 2R0PA 2OA1A 4FK1A 2DKIA 1GESA 4HA6A 3DJGX 3EAOA 1S3EA 5KNLA 4C77A 2XLUA 4JNAA 4K5SA 4Y4LA 4U8IA 2JKCA 4YTNA 1COYA 1EL8A 4P9SA 4U8JA 1GETA 2XLSA 2XVHA 3DGZA 2E4GA 1KNPA 2V3AA 2VRLA 3AE6A 2BABA 3FG2P 3K30A 3KVEA 4TLZA 5HYMA 5IQ1A 3AWIA 4GRTA 2B76A 2X8HA 3GYXA 2WDVA 1JEHA 3NN0X 3FPZA 4IA6A 1D4EA 4JQ9A 3AE5A 2VVMA 3UKQA 3EPTA 5EOWA 1CBOA 3AE9A 4GAVA 3VRDB 1NDAA 3DA1A 4PAAA 1SEZA 3FMWA 3RNMA 4J57A 1E6EA 3CMMA 4CCQA 2CULA 1ELIA 4GF7A 4NTEA 3T37A 2FJEA 3NG7X 1ZMCA 2XVIA 3G5RA 1TDEA 2VZ2A 1B37A 1FL2A 2R45A 3CN8A 1YKJA 1RYIA 4YKGA 2C70A 2YG6A 4H4WA 5BULA 4B67A 2YG5A 4IV9A 1NPXA 2GRTA 3G5SA 3PVCA 4USRA 3UTEA 2OLNA 4K2XA 2YVFA 3V3OA 4YKFA 1TDFA 4JY3A 5M0ZA 1Y56B 3NK0X 4C74A 4LA1A 1KDGA 2YG7A 3NGCX 1K0IA 3SX6A 1PN0A 3CPHG 3NT6A 4NTCA 2WDQA 1F8WA 3COXA 4EMWA 4LU6A 2XFPA 2XFUA 3P4PA 4CNKA 2V60A 4D04A 5C2TA 3GDPA 4JDRA 1W4XA 1NEKA 4G6HA 3E1TA 2Y6RA 1D7YA 1EL9A 2Z5YA 1PJ6A 4J2WA 4U8OA 4J36A 4Z25A 1CJ4A 2RGHA 3BNMA 3CNDA 1LTXR 1Q1RA 4TM4A 2Y6QA 3CPJG 5KMSA 2JB1A 3UOXA 1GREA 4KX6A 1KN0A 3D8XA 3D9XA 1MO9A 1YQ4A 4CY6A 3GWFA 2B9WA 1BGJA 4U8LA 3UOVA 3H4KA 3AE1A 4EM4A 2Q7VA 3ALMA 4ECHA 3BHKA 2JB2A 2V61A 4FK1C 1JRZA 5KWFA 2PHHA 5M10A 3AEFA 3NYCA 2WEUA 2BCPA 1IUSA 1GTEA 2YQUA 4H2RA 4AP1A 3EANA 1L9CA 2GR1A 3GSIA 2WOWA 1PS9A 1LPFA 4IA5A 3M0OA 1DJNA 2YLSA 3HYWA 4C3YA 1GRTA 1CC6A 2A87A 1F8RA 4AT0A 3QSEA 4NWZA 4K7ZA 2WP6A 3NIXA 4NNJA 4Z24A 2NVKX 2CFYA 1FOHA 3BHFA 5FS8A 3T2YA 1YQ3A 4ADWA 3LJPA 1CL0A 1ZP0A 3V3NA 4J34A 4I59A 2XFQA 3NYEA 1H82A 3M12A 1GRBA 2OALA 1IUXA 4X9NA 3SZCA 5BVAA 1H6VA 3PS9A 1E1KA 1OJCA 3UCLA 1JOAA 4B69A 2WP9A 2O9ZA 3SXIA 1H81A 2VQ7A 1L0VA 4OPTA 1ZOYA 4CBQA 3SFEA 4BV6A 1OJDA 1O94A 3UP4A 3S5WA 2C73A 1ZX9A 5JCLA 1GNDA 3JSKA 2X8CA 4OPGA 2C65A 3P9UA 5TR3A 4RG3A 1ZMDA 1KF6A 5FMHA 1GRFA 1P2HA 2E5VA 2YM2A 5HY5A 4LIIA 1CJ2A 1DOCA 3ICTA 4CRTA 2QAEA 4G9KA 3LZWA 1HYUA 5J7XA 4A6NB 2RGOA 4B66A 4RSLA 4Y4NA 2J3NA 4EM3A 3UOZA 1X31B 2R0CA 2WU5A 5LV9A 3CGCA 2FBWA 4AP3A 1QJDA 3BI5A 1Y56A 4YT0A 3QVPA 1N1PA 3ATRA 1TYTA 1ZOVA 2A89A 4HB9A 3QFBA 4Z2TA 3ZYXA 1NHRA 3UTFA 3AXBA 2C4CA 4H4UA 4OPUA 1P2EA 2V6OA 2WPEA 2BRYA 1GXFA 3IHGA 3KA7A 1D5TA 3ALLA 3SQPA 4BURA 2UZZA 4APNA 1TDOA 2GAGB 2A8XA 3GYJA 4Z26A 3C96A 4Z43A 4K22A 1IJHA 1JRXA 4DGKA 3I3LA 2GR2A 1XHCA 3DK4A 2BXSA 3AE8A 3ALJA 2XYOA 1JRYA 3QSMA 2X8GA 4OCGA 1VG9A 2GQFA 4BJYA 4ZCCA 4J56A 2YR5A 3UOYA 5JCIA 1GERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA2 A;  2BK3 A;  5BRT A;  2GR0 A;  1FEA A;  5J60 A;  4OPD A;  1JNZ A;  2XVF A;  4WCT A;  3EF6 A;  5KRQ A;  3F8R A;  2XVJ A;  4WX1 A;  1BZL A;  3NKS A;  5ER0 A;  1S2Y A;  5C3J A;  1H84 A;  1CJC A;  1D7L A;  3RED A;  1GPE A;  2ACZ A;  3LB8 A;  4C5O A;  2TPR A;  3KLJ A;  1S3B A;  1NHS A;  2EQ9 A;  2BC0 A;  2YG3 A;  4Z2U A;  1K0L A;  3DK9 A;  1F8S A;  1GT8 A;  2BA9 A;  4J33 A;  4KPR A;  4B63 A;  2GF3 A;  1XDI A;  1NHP A;  3NHO X;  2YAU A;  4NZH A;  2BXR A;  4IVM B;  3ADA B;  1BWC A;  3ATQ A;  3IF9 A;  1LVL A;  3AYJ A;  2B7S A;  2C72 A;  4EMJ A;  1IUV A;  4DSG A;  1PJ7 A;  2PYX A;  2GH5 A;  5HXI A;  2AQJ A;  1YQZ A;  3DGH A;  3C4N A;  2QA1 A;  1PXB A;  1AOG A;  5FS7 A;  2NPX A;  1KSS A;  4EMI A;  5IQ4 A;  1GEU A;  2GQW A;  2ZZB A;  2B9X A;  2XFO A;  4N9X A;  4TM1 A;  4H4V A;  3AE7 A;  3VQR A;  2WES A;  3LXD A;  5U63 A;  4A6N A;  3VR9 A;  1E1N A;  1Q9I A;  5HHF A;  4CNJ A;  4YSH A;  1NAA A;  3O0H A;  3ICS A;  3C4A A;  3OC4 A;  4H2N A;  2GMJ A;  2XLP A;  4USQ A;  2YR4 A;  4EIQ A;  2BK5 A;  2XFN A;  2XDO A;  1IUU A;  4EQX A;  1PHH A;  3BNU A;  4A5L A;  1RSG A;  1DOE A;  2GEW A;  2AAQ A;  4GDE A;  2AR8 A;  1O5W A;  2B9Y A;  3D1C A;  3RP8 A;  1DJQ A;  3QFA A;  1PJ5 A;  4EIP A;  1LJ1 A;  3LOV A;  3HZL A;  4H50 A;  5EB4 A;  3AD8 B;  5KOX A;  3ICR A;  3GWD A;  3AYL A;  1NG4 A;  3QSS A;  1PBD A;  1CC4 A;  3I6D A;  1PBF A;  4NEW A;  4A65 A;  1FEB A;  1Q1W A;  1DOD A;  3SFD A;  3NYF A;  1XAN A;  1H86 A;  3Q6J A;  4UDQ A;  1YY5 A;  2YLX A;  1V59 A;  1CJ3 A;  4I58 A;  2ZZC A;  1D4C A;  4IVO B;  1E1M A;  2APG A;  3AEB A;  5CKU A;  4H4T A;  1B8S A;  2C67 A;  1IUW A;  2F5Z A;  5GRT A;  2VQB A;  3SM8 A;  1K4Q A;  3II4 A;  4U2S A;  4YSZ A;  3F8P A;  1LQT A;  4Z44 A;  3GD4 A;  1K0J A;  3AD7 B;  1VRQ B;  4H2P A;  1TDN A;  4UDP A;  1PXC A;  4BK1 A;  3K7M X;  3P4R A;  3F8D A;  4JY2 A;  3URH A;  4H4X A;  5KVI A;  1H7X A;  4YSY A;  4OPC A;  3FIM B;  3NK2 X;  3AE3 A;  1ZY8 A;  1GOS A;  1N4U A;  5JCK A;  2W0H A;  3AEE A;  1F6M A;  4CY8 A;  2IVE A;  1B5Q A;  2C64 A;  2YLZ A;  2JB3 A;  4ZN0 A;  2XLR A;  3AEA A;  2HQM A;  2Q0K A;  2YR6 A;  3GDN A;  4U2L A;  4OVI A;  2BAC A;  3K7Q X;  4B65 A;  3B6D A;  1FEC A;  4FDC B;  4K8D A;  4TM0 A;  4XXG A;  3R9U A;  4B64 A;  3DJJ A;  4U8M A;  1GRA A;  4XWR A;  2BS3 A;  1TRB A;  4EQW A;  3LAD A;  3RP7 A;  3NRN A;  3V76 A;  4U8P A;  2H88 A;  3K7T A;  5L46 A;  3UP5 A;  1GRG A;  2YLR A;  1GSN A;  1UKV G;  3CPI G;  3VR8 A;  4A79 A;  3H8L A;  5DBJ A;  1KNR A;  4DSH A;  3AD9 B;  3GMC A;  4K5R A;  4UDR A;  1EL5 A;  3CTY A;  2GVC A;  3DJD A;  3NTD A;  2Z5X A;  3CNS A;  2C3D A;  3S61 A;  3AED A;  4H4P A;  2CDU A;  1O95 A;  2FJA A;  1TDK A;  4U8K A;  1NHQ A;  2WPF A;  1RP0 A;  4BJZ A;  3DME A;  4GR1 A;  5FS6 A;  2WU2 A;  2FJD A;  5JCN A;  3ABV A;  4H4R A;  1BKW A;  4YTM A;  2YLT A;  1ONF A;  3GRT A;  2R46 A;  4M52 A;  3M13 A;  4XWZ A;  1DXL A;  1GAL A;  2GAH B;  4ZCD A;  3P4S A;  3ISH A;  3RHA A;  1PBE A;  4U2T A;  1KFY A;  1EBD A;  1S2Q A;  5EB5 A;  4EQS A;  3AEG A;  3FBS A;  2VOU A;  2WOI A;  5GSN A;  3AE4 A;  4TLX A;  4TM3 A;  2JBV A;  3AEC A;  1DNC A;  1Y0P A;  1JNR A;  2X99 A;  1PBC A;  2GV8 A;  5KOW A;  5FS9 A;  4A99 A;  3ITJ A;  1M6I A;  3B3R A;  2VRM A;  1GRH A;  3UTG A;  1E7P A;  2R4E A;  3IHM A;  3L1R A;  3CGB A;  4O5U A;  3BI2 A;  1PXA A;  1ZDL A;  3LZX A;  1E1L A;  4OPL A;  1IUT A;  4ICY A;  2C66 A;  4C3X A;  1LQU A;  4UP3 A;  4DNA A;  2WHD A;  1OJT A;  2WQY A;  1M64 A;  3KU9 A;  4H7U A;  4A9W A;  3BI4 A;  1ZKQ A;  1L9E A;  4U8N A;  2YM1 A;  2YVG A;  4O5Q A;  2DKH A;  3DH9 A;  1REO A;  2YWL A;  1D4D A;  1BF3 A;  2Q6U A;  3UKL A;  2B7R A;  4H4Y A;  2EQ7 A;  3NK1 X;  4NTD A;  3KKJ A;  4Y4M A;  1NG3 A;  1CC2 A;  2YG4 A;  4MJW A;  3GYI A;  3UTH A;  4YSX A;  1GV4 A;  2ZBW A;  4A7A A;  1LV0 A;  2GB0 A;  3SGL A;  2X3N A;  3PO7 A;  2RGJ A;  1F3P A;  3AB1 A;  3UKF A;  3UKH A;  3DK8 A;  4JNQ A;  1L9D A;  4BK3 A;  4CCR A;  2JAE A;  2RAB A;  5KXJ A;  4H2Q A;  2BCG G;  2WET A;  5JCM A;  1JU2 A;  3CGE A;  4H4S A;  1BGN A;  3L8K A;  2XVE A;  5CQF A;  4RG4 A;  2BS4 A;  4B68 A;  4X9M A;  3NTA A;  3KD9 A;  1H83 A;  3WE0 A;  1ZK7 A;  2WBA A;  5BUK A;  2VVL G;  3Q9T A;  2ARD A;  2E1M A;  4PAB A;  2OAM A;  1CF3 A;  3IC9 A;  3VRA A;  3CIR A;  3NH3 X;  1E39 A;  3KPF A;  3CNJ A;  2IID A;  3P4Q A;  2WPC A;  1H7W A;  2WDR A;  3NN6 X;  1QLB A;  3ZDN A;  1N4V A;  2V3B A;  2EQ6 A;  3P1W A;  1Z6L A;  3CGD A;  4EQR A;  2OLO A;  4E0V A;  1PDH A;  1OJ9 A;  1XPQ A;  1VDC A;  2I0Z A;  2R0G A;  2R4J A;  1EL7 A;  1CHU A;  2IVD A;  4BK2 A;  2EQ8 A;  2WS3 A;  4H4Q A;  1FCD A;  2Q0L A;  4J31 A;  4REK A;  4NEV A;  3AE2 A;  1VQW A;  4AOX A;  4YXD A;  4GDP A;  4H4Z A;  4OPI A;  5KVH A;  2TMD A;  1KSU A;  4Z2R A;  4JN9 A;  3QVR A;  3CNP A;  3QJ4 A;  3NNE A;  2R9Z A;  2BC1 A;  5U25 A;  1DOB A;  1MXT A;  2BK4 A;  2C76 A;  5IPY A;  3NLC A;  2H89 A;  3H8I A;  2BYB A;  3OZ2 A;  2WP5 A;  1PBB A;  1QO8 A;  2FJB A;  4YTP A;  1B4V A;  1NEN A;  2BS2 A;  4B1B A;  4GUV A;  2C3C A;  3RP6 A;  3VRB A;  2QCU A;  5EBK A;  3IWA A;  4AOS A;  3UKA A;  3DJE A;  5U1O A;  4YWO A;  2JK6 A;  3GRS A;  2C75 A;  3CNT A;  3UKP A;  1TYP A;  4FX9 A;  2X50 A;  1GTH A;  1MOK A;  2YLW A;  4X4J A;  2CVJ A;  2ZZ0 A;  3GD3 A;  1OJA A;  2VVL A;  3GMB A;  3AYI A;  2XLT A;  2WOV A;  1N4W A;  2YVJ A;  4GCM A;  2GMH A;  3UKK A;  4AT2 A;  3G5Q A;  4D03 A;  2V5Z A;  2GR3 A;  2XCG A;  1VG0 A;  2C7G A;  2R0P A;  2OA1 A;  4FK1 A;  2DKI A;  1GES A;  4HA6 A;  3DJG X;  3EAO A;  1S3E A;  4C77 A;  2XLU A;  4JNA A;  4K5S A;  4Y4L A;  4U8I A;  2JKC A;  4YTN A;  1COY A;  1EL8 A;  4P9S A;  4U8J A;  1GET A;  2XLS A;  2XVH A;  3DGZ A;  2E4G A;  1KNP A;  2V3A A;  2VRL A;  3AE6 A;  2BAB A;  3FG2 P;  3K30 A;  3KVE A;  4TLZ A;  5HYM A;  5IQ1 A;  3AWI A;  4GRT A;  2B76 A;  2X8H A;  3NN0 X;  2WDV A;  1JEH A;  4IA6 A;  3FPZ A;  1D4E A;  4JQ9 A;  3AE5 A;  2VVM A;  3UKQ A;  3EPT A;  5EOW A;  1CBO A;  3AE9 A;  3VRD B;  1NDA A;  3DA1 A;  4PAA A;  1SEZ A;  3FMW A;  3RNM A;  4J57 A;  1E6E A;  4CCQ A;  2CUL A;  1ELI A;  4GF7 A;  4NTE A;  3T37 A;  2FJE A;  3NG7 X;  1ZMC A;  2XVI A;  3G5R A;  1TDE A;  2VZ2 A;  1B37 A;  1FL2 A;  2R45 A;  3CN8 A;  1YKJ A;  1RYI A;  4YKG A;  2C70 A;  2YG6 A;  4H4W A;  5BUL A;  4B67 A;  2YG5 A;  4IV9 A;  1NPX A;  2GRT A;  3G5S A;  3PVC A;  4USR A;  3UTE A;  2OLN A;  4K2X A;  2YVF A;  3V3O A;  4YKF A;  1TDF A;  4JY3 A;  5M0Z A;  1Y56 B;  3NK0 X;  4C74 A;  4LA1 A;  1KDG A;  2YG7 A;  3NGC X;  1K0I A;  1PN0 A;  3CPH G;  3NT6 A;  4NTC A;  2WDQ A;  1F8W A;  3COX A;  4EMW A;  4LU6 A;  2XFP A;  2XFU A;  3P4P A;  4CNK A;  2V60 A;  4D04 A;  5C2T A;  3GDP A;  4JDR A;  1W4X A;  1NEK A;  3E1T A;  2Y6R A;  1D7Y A;  1EL9 A;  2Z5Y A;  1PJ6 A;  4J2W A;  4U8O A;  4J36 A;  4Z25 A;  1CJ4 A;  2RGH A;  3BNM A;  3CND A;  1LTX R;  1Q1R A;  4TM4 A;  2Y6Q A;  3CPJ G;  2JB1 A;  3UOX A;  1GRE A;  4KX6 A;  3D8X A;  1MO9 A;  1YQ4 A;  4CY6 A;  3GWF A;  2B9W A;  1BGJ A;  4U8L A;  3UOV A;  3H4K A;  3AE1 A;  4EM4 A;  2Q7V A;  3ALM A;  4ECH A;  3BHK A;  2JB2 A;  2V61 A;  4FK1 C;  1JRZ A;  5KWF A;  2PHH A;  5M10 A;  3AEF A;  3NYC A;  2WEU A;  2BCP A;  1IUS A;  1GTE A;  2YQU A;  4H2R A;  4AP1 A;  3EAN A;  1L9C A;  2GR1 A;  3GSI A;  2WOW A;  1PS9 A;  1LPF A;  4IA5 A;  3M0O A;  1DJN A;  2YLS A;  4C3Y A;  1GRT A;  1CC6 A;  2A87 A;  1F8R A;  4AT0 A;  3QSE A;  4K7Z A;  2WP6 A;  3NIX A;  4Z24 A;  2NVK X;  2CFY A;  1FOH A;  3BHF A;  5FS8 A;  1YQ3 A;  4ADW A;  3LJP A;  1CL0 A;  1ZP0 A;  3V3N A;  4J34 A;  4I59 A;  2XFQ A;  3NYE A;  1H82 A;  3M12 A;  1GRB A;  2OAL A;  1IUX A;  4X9N A;  5BVA A;  1H6V A;  3PS9 A;  1E1K A;  1OJC A;  3UCL A;  1JOA A;  4B69 A;  2WP9 A;  2O9Z A;  1H81 A;  2VQ7 A;  1L0V A;  4OPT A;  1ZOY A;  4CBQ A;  3SFE A;  4BV6 A;  1OJD A;  1O94 A;  3UP4 A;  3S5W A;  2C73 A;  1ZX9 A;  5JCL A;  1GND A;  3JSK A;  2X8C A;  4OPG A;  2C65 A;  3P9U A;  5TR3 A;  4RG3 A;  1ZMD A;  1KF6 A;  5FMH A;  1GRF A;  1P2H A;  2E5V A;  2YM2 A;  5HY5 A;  4LII A;  1CJ2 A;  1DOC A;  3ICT A;  4CRT A;  2QAE A;  3LZW A;  1HYU A;  5J7X A;  4A6N B;  2RGO A;  4B66 A;  4RSL A;  4Y4N A;  2J3N A;  4EM3 A;  3UOZ A;  1X31 B;  2R0C A;  2WU5 A;  5LV9 A;  3CGC A;  2FBW A;  4AP3 A;  1QJD A;  3BI5 A;  1Y56 A;  4YT0 A;  3QVP A;  1N1P A;  3ATR A;  1TYT A;  1ZOV A;  2A89 A;  4HB9 A;  3QFB A;  4Z2T A;  3ZYX A;  1NHR A;  3UTF A;  3AXB A;  4H4U A;  4OPU A;  1P2E A;  2V6O A;  2WPE A;  1GXF A;  3IHG A;  3KA7 A;  1D5T A;  3ALL A;  3SQP A;  4BUR A;  2UZZ A;  4APN A;  1TDO A;  2GAG B;  2A8X A;  3GYJ A;  4Z26 A;  3C96 A;  4Z43 A;  4K22 A;  1IJH A;  1JRX A;  4DGK A;  3I3L A;  2GR2 A;  1XHC A;  3DK4 A;  2BXS A;  3AE8 A;  3ALJ A;  2XYO A;  1JRY A;  3QSM A;  2X8G A;  4OCG A;  1VG9 A;  2GQF A;  4BJY A;  4ZCC A;  4J56 A;  2YR5 A;  3UOY A;  5JCI A;  1GER A; 
#chains in the Genus database with same CATH topology
 2BK3 A;  5BRT A;  5J60 A;  4OPD A;  2QJJ A;  2XVF A;  4WCT A;  5KRQ A;  3F8R A;  4WX1 A;  1BZL A;  1IYX A;  2XH4 A;  4C5O A;  3KLJ A;  3T0K A;  2EQ9 A;  3DK9 A;  2P8C A;  1F8S A;  1KD0 A;  3S47 A;  2GF3 A;  5JRB A;  4Z17 A;  1NHP A;  2YAU A;  3SR6 B;  1BWC A;  3ATQ A;  1NEL A;  4DSG A;  1PJ7 A;  2AQJ A;  1YQZ A;  3DGH A;  3NO1 A;  2QA1 A;  2NPX A;  1KSS A;  3PFR A;  2PCE A;  5IQ4 A;  4MKS A;  3QLD A;  2B9X A;  4N9X A;  4KWS A;  3AE7 A;  3VDG A;  2I5Q A;  2WES A;  5HHF A;  4YSH A;  3ICS A;  3SZW A;  3BJS A;  2YR4 A;  3DG3 A;  4EQX A;  3BNU A;  4A5L A;  1DOE A;  3NVY B;  3RP8 A;  3NVV B;  1DJQ A;  4EIP A;  3VCC A;  3HW2 A;  4H50 A;  3AN1 A;  5KOX A;  3ICR A;  3AYL A;  5J04 A;  3I6D A;  1PBF A;  4A65 A;  3SFD A;  4I58 A;  1V59 A;  1W6T A;  1D4C A;  2VQB A;  2F5Z A;  2W55 A;  5GRT A;  3SM8 A;  1K4Q A;  4U2S A;  1TE6 A;  4UDP A;  3OTR A;  3RO6 A;  1PXC A;  3P4R A;  3F8D A;  1S7M A;  1N63 C;  5KVI A;  4OPC A;  3NK2 X;  3AEE A;  1GOS A;  2W0H A;  1F6M A;  4TVY A;  2C64 A;  3T6C A;  3AEA A;  2AL1 A;  4OVI A;  3K7Q X;  4B65 A;  4II2 A;  4FDC B;  1WYG A;  4U8M A;  1TRB A;  4HNC A;  3SN0 A;  3NRN A;  3GC2 A;  5L46 A;  3VCN A;  2P8B A;  3AD9 B;  3GMC A;  4UDR A;  2OKT A;  3DJD A;  3D47 A;  4J1O A;  2C3D A;  3AED A;  1O95 A;  1TDK A;  2GGI A;  1RP0 A;  5FS6 A;  4A6G A;  2WU2 A;  3ABV A;  2O56 A;  4M52 A;  1EBD A;  4EQS A;  3AEG A;  2WOI A;  2JBV A;  3TWA A;  4GAP A;  1Y0P A;  2POZ A;  5KOW A;  2FKP A;  3ITJ A;  2PA6 A;  1GRH A;  3UTG A;  1FHV A;  2QJN A;  3BI2 A;  4H1Z A;  5KMQ A;  1LQU A;  4UP3 A;  4A9W A;  1OJT A;  1ZKQ A;  1MRA A;  1PDY A;  2YVG A;  2YM1 A;  1REO A;  2YWL A;  2Q6U A;  2B7R A;  2GGH A;  4NTD A;  3KKJ A;  1GV4 A;  3U4F A;  4A7A A;  3DES A;  3DFY A;  3PO7 A;  3R10 A;  2CHR A;  4JNQ A;  3PG6 A;  1N61 C;  4H2Q A;  3IK4 A;  4HN8 A;  2XVE A;  2BS4 A;  3WE0 A;  4M6U A;  3NH3 X;  3P4Q A;  4JHM A;  2WDR A;  3P1W A;  3H7V A;  4EQR A;  1PDH A;  1XPQ A;  2I0Z A;  1VDC A;  1EC9 A;  2WS3 A;  1FCD A;  2PTZ A;  4NEV A;  1VQW A;  3HYX A;  2TMD A;  1KSU A;  3CNP A;  3QJ4 A;  2R9Z A;  5IPY A;  1MXT A;  2BK4 A;  3SY4 A;  2BYB A;  1PBB A;  4B1B A;  4GUV A;  3DER A;  2QCU A;  3VRB A;  5EBK A;  3GRS A;  2C75 A;  1MOK A;  3UXL A;  2VVL A;  3GMB A;  3AYI A;  2XLT A;  2WOV A;  2YVJ A;  3CYJ A;  3UKK A;  4AT2 A;  3VC6 A;  2XCG A;  2ZAD A;  1BQG A;  2DKI A;  1GES A;  3DJG X;  4C77 A;  2JKC A;  1EL8 A;  1JRO A;  3DGZ A;  2V3A A;  3U9I A;  3KVE A;  4IZG A;  3SSZ A;  4GRT A;  3NVZ B;  2WDV A;  1JEH A;  4IA6 A;  2VVM A;  1CBO A;  3DA1 A;  1V97 A;  4CCQ A;  3CMM A;  1ELI A;  3T37 A;  3NG7 X;  1ZMC A;  3G5R A;  1B37 A;  1L8P A;  1YKJ A;  4B67 A;  3DIP A;  3UTE A;  2OLN A;  2YVF A;  5M0Z A;  4NTC A;  2WDQ A;  1F8W A;  2XH2 A;  5C2T A;  3GDP A;  1W4X A;  1NEK A;  2Z5Y A;  1PJ6 A;  1FIQ B;  1CJ4 A;  2RGH A;  3CND A;  1Q1R A;  3QN3 A;  4ECH A;  2PP3 A;  5G5H B;  1JRZ A;  4G7F A;  2PHH A;  5M10 A;  3NYC A;  1IUS A;  1GTE A;  3THU A;  4IA5 A;  1DJN A;  2YLS A;  2PMQ A;  3HYW A;  1F8R A;  4NWZ A;  2CFY A;  3OZY A;  4ADW A;  3V3N A;  1CL0 A;  4GGH A;  4I59 A;  1H82 A;  1OJC A;  1FFU C;  3SXI A;  1H81 A;  1ZOY A;  3SFE A;  1OJD A;  3S5W A;  2C73 A;  2C65 A;  5TR3 A;  1TKK A;  5FMH A;  1GRF A;  3JVA A;  4G9K A;  3LZW A;  3ZLH A;  2J3N A;  3Q45 A;  2WU5 A;  3CGC A;  2FBW A;  1N1P A;  3R11 A;  1D5T A;  1ZXI C;  2ONE A;  3SQP A;  2PSN A;  2A8X A;  3C96 A;  1WUE A;  4DGK A;  2MUC A;  2GR2 A;  3MQT A;  3ALJ A;  2XYO A;  3QTP A;  1X2H A;  1VG9 A;  2GQF A;  3UCD A;  2GR0 A;  3T9P A;  1FEA A;  2XVJ A;  3ZLG A;  1E9I A;  1H84 A;  1CJC A;  2PPG A;  1GPE A;  3CB3 A;  2TPR A;  1FO4 A;  4GYP C;  4IL0 A;  2XH0 A;  1S3B A;  3TWB A;  4GGB A;  2DW7 A;  4KPR A;  2PTW A;  2PTX A;  3NHO X;  4NZH A;  3UJ2 A;  2MNR A;  3IF9 A;  1LVL A;  3AYJ A;  4EMJ A;  4H83 A;  3ETR B;  1AOG A;  5FS7 A;  3R1Z A;  2GGG A;  2XFO A;  3VR9 A;  2QVH A;  3V3W A;  1E1N A;  1Q9I A;  1NAA A;  3O0H A;  3C4A A;  3OC4 A;  4H2N A;  2BK5 A;  1RSG A;  2GEW A;  2AR8 A;  1H2I A;  1LJ1 A;  3LOV A;  2OFJ A;  5EB4 A;  1VQZ A;  3CT2 A;  4NEW A;  2OX4 A;  1DOD A;  3NYF A;  3II4 A;  4YSZ A;  3L5O A;  4Z44 A;  1VRQ B;  2GSH A;  3Q4D A;  1H7X A;  4YSY A;  3GO2 A;  3AE3 A;  2JB3 A;  3P93 A;  2HQM A;  4U2L A;  4FP1 A;  2BAC A;  1FEC A;  3R0K A;  2BS3 A;  3SYI A;  3V76 A;  3K7T A;  5KMP A;  1GRG A;  1UKV G;  3CPI G;  3T14 A;  4DSH A;  1KNR A;  4K5R A;  2OPJ A;  4H19 A;  4DX3 A;  2CDU A;  3UJF A;  2FJA A;  4U8K A;  3DME A;  4GR1 A;  1EBG A;  2FJD A;  4YTM A;  3GRT A;  3HPF A;  2R46 A;  4JN8 A;  4ZCD A;  2GAH B;  2AL2 A;  3FBS A;  5GSN A;  4TM3 A;  4K2S A;  1DNC A;  3TJ4 A;  5FS9 A;  3QKE A;  2VRM A;  3L1R A;  3ZVH A;  3LZX A;  2C66 A;  1N60 C;  4DNA A;  1L9E A;  3ENL A;  1D4D A;  4YSX A;  4IP4 A;  2ZBW A;  2GB0 A;  2RGJ A;  1F3P A;  3UKH A;  5FJU A;  1L9D A;  4CCR A;  2RAB A;  4H4S A;  5CQF A;  5BUK A;  1ZK7 A;  2E1M A;  3VRA A;  3IC9 A;  3KPF A;  2IID A;  1H7W A;  1QLB A;  2V3B A;  2BRA A;  2EQ6 A;  3A7R A;  2R0G A;  3DG6 A;  1CHU A;  2EQ8 A;  4H4Q A;  3MSY A;  4REK A;  4KPL A;  4H4Z A;  4KT2 A;  4JN9 A;  3FVD A;  2BC1 A;  5U25 A;  4TVW A;  2H89 A;  2WP5 A;  1QO8 A;  4YTP A;  1B4V A;  1EC8 A;  1PDZ A;  5EU9 A;  3RP6 A;  3UKA A;  3FYY A;  3DJE A;  4YWO A;  4FX9 A;  1GTH A;  2CVJ A;  2ZZ0 A;  3GD3 A;  4GCM A;  1N4W A;  2W3R A;  4G6G A;  2GR3 A;  4II3 A;  1VG0 A;  2C7G A;  2R0P A;  2XGZ A;  2OLA A;  3R0U A;  5KNL A;  2XLU A;  4JNA A;  4Y4L A;  4YTN A;  3I4K A;  3MKC A;  4U8J A;  1KNP A;  3PWG A;  3AE6 A;  2BAB A;  1MDR A;  3AWI A;  2X8H A;  3AE5 A;  2DW6 A;  4PAA A;  3RNM A;  4J57 A;  1TDE A;  2VZ2 A;  4E6M A;  2C70 A;  2YG6 A;  1NPX A;  3V3O A;  4YKF A;  2ZC8 A;  4JY3 A;  2OQH A;  1KDG A;  3CPH G;  3NT6 A;  3VFC A;  4EMW A;  1FHU A;  2XFU A;  3CK5 A;  4U8O A;  4J2W A;  4J36 A;  1R0M A;  3MUC A;  4TM4 A;  2Y6Q A;  3CPJ G;  1GRE A;  1OEP A;  3S5S A;  3D8X A;  3GD6 A;  1MO9 A;  1YQ4 A;  3I6E A;  4HCH A;  3GWF A;  4ZOH B;  1MDL A;  3AEF A;  2WEU A;  2BCP A;  3SQS A;  4AP1 A;  4IL2 A;  1PS9 A;  1LPF A;  3MZN A;  4C3Y A;  1CC6 A;  4Z1Y A;  3BOX A;  4K7Z A;  2WP6 A;  4NNJ A;  4Z24 A;  2NVK X;  1FOH A;  3BHF A;  4H2H A;  5FS8 A;  2PGW A;  1YQ3 A;  3LJP A;  4J34 A;  5FJP A;  1GRB A;  3SZC A;  5BVA A;  3PS9 A;  3UCL A;  1JOA A;  4IP5 A;  2WP9 A;  2O9Z A;  4B69 A;  2VQ7 A;  1ZX9 A;  2OZT A;  3JSK A;  4OPG A;  1KF6 A;  4K1W A;  7ENL A;  1P2H A;  2E5V A;  4DHG A;  5HY5 A;  4LII A;  3NXL A;  4M0X A;  2RGO A;  4EM3 A;  5LV9 A;  1X31 B;  4AP3 A;  3BI5 A;  3EKG A;  3QVP A;  1TYT A;  2A89 A;  4HB9 A;  1DTN A;  2C4C A;  3STP A;  4H4U A;  1GXF A;  3KA7 A;  3I6T A;  4APN A;  4A35 A;  3N4E A;  1JRX A;  3DK4 A;  2HXU A;  2X8G A;  4OCG A;  4ZCC A;  4J56 A;  3FCP A;  3KUM A;  3H8L A;  3B9J B;  3NKS A;  1ONE A;  5C3J A;  5ENL A;  1D7L A;  3RED A;  2ACZ A;  3LB8 A;  3HYV A;  2YG3 A;  3RGT A;  1GT8 A;  2BA9 A;  1N5X A;  4J33 A;  4B63 A;  3ADA B;  3SZ0 A;  1IUV A;  2PYX A;  5HXI A;  3C4N A;  4G73 A;  4EMI A;  4HPN A;  3RIT A;  2ZZB A;  4HYR A;  3VQR A;  3PWI A;  3LXD A;  4A6N A;  3R07 C;  3DEQ A;  3TOY A;  1WUF A;  3B97 A;  3UXK A;  2XLP A;  4YWS A;  1IUU A;  2B9Y A;  3D1C A;  2QGY A;  1PJ5 A;  4GYP A;  3HZL A;  3AD8 B;  1CC4 A;  3ES7 A;  1H86 A;  1YY5 A;  1CJ3 A;  1SJC A;  4IVO B;  1E1M A;  3AEB A;  1B8S A;  2C67 A;  1F9C A;  1K0J A;  3AD7 B;  4H2P A;  1TDN A;  3SN1 A;  4BK1 A;  1VDV A;  1STZ A;  4JY2 A;  3AMZ A;  4H4X A;  3EUB 3;  3FIM B;  1N4U A;  2IVE A;  4GIR A;  1B5Q A;  2Q0K A;  2YR6 A;  3GDN A;  1N62 C;  4G8T A;  4B64 A;  4TM0 A;  4XXG A;  3DJJ A;  1GRA A;  3UGV A;  4EQW A;  3LAD A;  3NRZ B;  4J3Z A;  2H88 A;  4FI4 A;  3UP5 A;  2YLR A;  1GSN A;  3VR8 A;  1EL5 A;  1EC7 A;  2GVC A;  3CNS A;  4H4P A;  1NHQ A;  2WPF A;  2W3S A;  4BJZ A;  1MNS A;  4H4R A;  1ONF A;  2OG9 A;  1GAL A;  3ISH A;  3DFH A;  1S2Q A;  1TZZ A;  3V5C A;  3AE4 A;  4ZA0 A;  4TLX A;  3CXO A;  2PP1 A;  1KKO A;  3AEC A;  4A99 A;  1M6I A;  3UJR A;  3CGB A;  4O5U A;  1ZDL A;  3NVW B;  4OPL A;  3T2K A;  4C3X A;  2WHD A;  1R6W A;  2WQY A;  1M64 A;  3KU9 A;  4O5Q A;  2DKH A;  3DH9 A;  1BF3 A;  3UKL A;  4Y4M A;  1NG3 A;  1CC2 A;  4MJW A;  3GYI A;  3ZVI A;  1XS2 A;  3UJE A;  3SGL A;  3RCY A;  3PK7 A;  4BK3 A;  2JAE A;  3FXG A;  2BCG G;  2WET A;  1JU2 A;  3CGE A;  1BGN A;  3L8K A;  4RG4 A;  4B68 A;  3NTA A;  2POD A;  2WBA A;  3BSM A;  3Q9T A;  2ARD A;  2OAM A;  2P3Z A;  1E39 A;  2WPC A;  4HCL A;  3NN6 X;  1N4V A;  3T2Z A;  5FJR A;  1Z6L A;  2RDX A;  3V5F A;  2R4J A;  1EBH A;  4MGG A;  3AE2 A;  4AOX A;  4GDP A;  4DN1 A;  5KVH A;  3TCS A;  3QVR A;  3T31 A;  3NNE A;  1DOB A;  2C76 A;  3H8I A;  2BS2 A;  2C3C A;  4X2P A;  1JDF A;  3IWA A;  3CXB A;  4AOS A;  3CNT A;  2JK6 A;  3T4W A;  2YLW A;  4X4J A;  1OJA A;  2GMH A;  1T3Q C;  3G5Q A;  4D03 A;  2OA1 A;  4FK1 A;  3EAO A;  1NU5 A;  3OZM A;  4K5S A;  2AKZ A;  1JPD X;  4P9S A;  1BKH A;  1GET A;  2PU0 A;  2XVH A;  3P0W A;  2VRL A;  3K30 A;  5HYM A;  2B76 A;  3NN0 X;  1D4E A;  4JQ9 A;  3UKQ A;  3EPT A;  4KEM A;  3AE9 A;  3N6J A;  4GAV A;  1NDA A;  1E6E A;  3RRA A;  4GF7 A;  3EEZ A;  2FJE A;  2XVI A;  1FL2 A;  2OQY A;  2R45 A;  3GY1 A;  5BUL A;  4H4W A;  2YG5 A;  4IV9 A;  3G5S A;  2GRT A;  4USR A;  1RVK A;  4E4U A;  3PVC A;  2HNE A;  4K2X A;  4C74 A;  2YG7 A;  3NGC X;  1K0I A;  3COX A;  4LU6 A;  2XFP A;  2QJM A;  2V60 A;  4D04 A;  4JDR A;  3E1T A;  1EL9 A;  3BNM A;  2OVL A;  2JB1 A;  3UOX A;  3IJI A;  1KN0 A;  3D9X A;  2PP0 A;  1JPM A;  3UOV A;  3H4K A;  3AE1 A;  2JB2 A;  5KWF A;  4FK1 C;  3K1G A;  4ROP A;  4H2R A;  1L9C A;  3GSI A;  2XH7 A;  3M0O A;  1P43 A;  2A87 A;  4AT0 A;  3NIX A;  3IJQ A;  1ZP0 A;  2XSX A;  3DG7 A;  4JN7 A;  3OP2 A;  3NYE A;  3NFU A;  3M12 A;  2OAL A;  1SJD A;  1H6V A;  1E1K A;  2E5A A;  1L0V A;  4OPT A;  3H12 A;  4CBQ A;  1O94 A;  2PS2 A;  3UP4 A;  4GME A;  1GND A;  3P9U A;  1ZMD A;  2YM2 A;  3ICT A;  4A6N B;  5J7X A;  4B66 A;  4RSL A;  4Y4N A;  1X2G A;  1Y56 A;  3ATR A;  4DYE A;  1ZOV A;  4Z2T A;  4E4F A;  3UTF A;  3AXB A;  4E5T A;  3ES8 A;  2E3T A;  1P2E A;  2V6O A;  2BRY A;  3IHG A;  4BUR A;  2UZZ A;  2FYM A;  2GAG B;  1ELS A;  2OZ3 A;  1IJH A;  1XPY A;  3I3L A;  1JRY A;  1MUC A;  1FFV C;  2YR5 A;  5JCI A;  1GER A;  3MWC A;  2QA2 A;  5KMR A;  3MY9 A;  3TQP A;  1JNZ A;  3EF6 A;  5ER0 A;  1S2Y A;  3A7A A;  2GGJ A;  1NHS A;  2BC0 A;  4IHC A;  4Z2U A;  1K0L A;  3H70 A;  1XDI A;  1N5W C;  5FJO A;  4DWD A;  2BXR A;  4IVM B;  1SJA A;  3N6H A;  2B7S A;  2C72 A;  5BOF A;  2GH5 A;  1PXB A;  1GEU A;  2GQW A;  4TM1 A;  4H4V A;  5U63 A;  4CNJ A;  4USQ A;  2GMJ A;  4EIQ A;  2XFN A;  2XDO A;  1PHH A;  2AAQ A;  4GDE A;  1O5W A;  1KCZ A;  3QFA A;  3GWD A;  1NG4 A;  5IDZ A;  3QSS A;  1PBD A;  1FEB A;  1Q1W A;  1XAN A;  3Q6J A;  3AM9 A;  4UDQ A;  2YLX A;  2ZZC A;  3SJN A;  2APG A;  5CKU A;  4H4T A;  1IUW A;  3F8P A;  1LQT A;  3GD4 A;  4EWJ A;  3K7M X;  3URH A;  2GL5 A;  3RR1 A;  1ZY8 A;  5JCK A;  4CY8 A;  2YLZ A;  4ZN0 A;  3TTE A;  2XLR A;  5BOE A;  3QPE A;  3B6D A;  3SZF A;  4K8D A;  3R9U A;  4XWR A;  2OO6 A;  3A7U A;  3RP7 A;  3R25 A;  4U8P A;  4E8G A;  4A79 A;  5DBJ A;  3CTY A;  4K8G A;  3NTD A;  2Z5X A;  3S61 A;  5JCN A;  1BKW A;  2YLT A;  3M13 A;  4XWZ A;  1DXL A;  3RHA A;  3P4S A;  1PBE A;  4U2T A;  1KFY A;  5EB5 A;  2VOU A;  3P3B A;  1JNR A;  2X99 A;  1PBC A;  2GV8 A;  1SJB A;  3B3R A;  1ECQ A;  3JW7 A;  1E7P A;  2R4E A;  3IHM A;  1PXA A;  1E1L A;  2AKM A;  1IUT A;  4ICY A;  4F4R A;  4H7U A;  2GDQ A;  3BI4 A;  3VA8 A;  4U8N A;  3DGB A;  4H4Y A;  2EQ7 A;  3NK1 X;  2YG4 A;  1YEY A;  3UTH A;  2NQL A;  3V4B A;  2QQ6 A;  1LV0 A;  2X3N A;  3AB1 A;  3UKF A;  3SBF A;  3DK8 A;  2GGE A;  3OPS A;  5KXJ A;  2P88 A;  2AL2 B;  5JCM A;  4G74 A;  3NS1 B;  4X9M A;  2HXT A;  3KD9 A;  1H83 A;  2VVL G;  4PAB A;  1KKR A;  1CF3 A;  3KPK A;  3CIR A;  3CNJ A;  3ZVH B;  4ZCW A;  3ZDN A;  3CGD A;  2OLO A;  4E0V A;  1OJ9 A;  1EL7 A;  2IVD A;  2P0I A;  4BK2 A;  3JZU A;  2Q0L A;  4J31 A;  2QDD A;  4YXD A;  4OPI A;  4Z2R A;  4ENL A;  3NLC A;  3OZ2 A;  2FJB A;  1NEN A;  5FJT A;  2PU1 A;  5U1O A;  4GFI A;  3UKP A;  2QDE A;  1TYP A;  2X50 A;  3UCC A;  3OW1 A;  2V5Z A;  2HZG A;  2OZ8 A;  4HA6 A;  1S3E A;  4DXK A;  4U8I A;  1COY A;  4IT1 A;  2XLS A;  2E4G A;  3FG2 P;  4TLZ A;  3H8A A;  5IQ1 A;  3GYX A;  3FPZ A;  5EOW A;  3VRD B;  1SEZ A;  3FMW A;  2CUL A;  4NTE A;  4HCD A;  3CN8 A;  4YKG A;  1RYI A;  1TDF A;  2W54 A;  3D46 A;  3VC5 A;  1Y56 B;  3NK0 X;  4LA1 A;  3HRD C;  3SX6 A;  1PN0 A;  4CNK A;  3P4P A;  3UJS A;  4G6H A;  2Y6R A;  1D7Y A;  4Z25 A;  3FJ4 A;  1LTX R;  5KMS A;  4KX6 A;  2PTY A;  3N4F A;  4A3R A;  1JRP A;  4CY6 A;  2B9W A;  3FV9 A;  1BGJ A;  4U8L A;  3ZLF A;  4EM4 A;  2Q7V A;  3ALM A;  3BHK A;  2V61 A;  2PGE A;  2YQU A;  3IJL A;  3EAN A;  2GR1 A;  2WOW A;  1GRT A;  6ENL A;  3QSE A;  3T2Y A;  2XFQ A;  1P48 A;  4GIS A;  1IUX A;  4X9N A;  3SN4 A;  1RM6 B;  4BV6 A;  5JCL A;  2X8C A;  4RG3 A;  3NZG A;  1CJ2 A;  1DOC A;  4CRT A;  2QAE A;  1HYU A;  5G5G B;  4MMW A;  3UOZ A;  2R0C A;  1QJD A;  4YT0 A;  3QFB A;  3ZYX A;  1NHR A;  3CAW A;  3T8Q A;  4OPU A;  2WPE A;  4HNL A;  3ALL A;  1TDO A;  3TJI A;  3GYJ A;  4Z26 A;  1SB3 B;  4Z43 A;  4K22 A;  3TW9 A;  1XHC A;  2BXS A;  3AE8 A;  3QSM A;  1JCT A;  4BJY A;  3DDM A;  3UOY A; 
#chains in the Genus database with same CATH homology
 2QA2 A;  5KMR A;  2BK3 A;  5BRT A;  2GR0 A;  1FEA A;  5J60 A;  4OPD A;  1JNZ A;  2XVF A;  4WCT A;  3EF6 A;  5KRQ A;  3F8R A;  2XVJ A;  4WX1 A;  1BZL A;  3NKS A;  5ER0 A;  1S2Y A;  5C3J A;  1H84 A;  1CJC A;  1D7L A;  3RED A;  1GPE A;  2ACZ A;  3LB8 A;  4C5O A;  2TPR A;  3KLJ A;  3HYV A;  3T0K A;  1S3B A;  1NHS A;  2EQ9 A;  2BC0 A;  2YG3 A;  4Z2U A;  1K0L A;  3DK9 A;  1F8S A;  1GT8 A;  2BA9 A;  4J33 A;  4KPR A;  4B63 A;  2GF3 A;  5JRB A;  1XDI A;  1NHP A;  3NHO X;  2YAU A;  4NZH A;  2BXR A;  4IVM B;  3ADA B;  1BWC A;  3ATQ A;  3IF9 A;  1LVL A;  3AYJ A;  2B7S A;  2C72 A;  4EMJ A;  3SZ0 A;  1IUV A;  4DSG A;  1PJ7 A;  2PYX A;  2GH5 A;  5HXI A;  2AQJ A;  1YQZ A;  3DGH A;  3C4N A;  2QA1 A;  1PXB A;  1AOG A;  5FS7 A;  2NPX A;  1KSS A;  4G73 A;  4EMI A;  5IQ4 A;  1GEU A;  2GQW A;  2ZZB A;  2B9X A;  2XFO A;  4N9X A;  4TM1 A;  4H4V A;  3AE7 A;  3VQR A;  2WES A;  3LXD A;  5U63 A;  4A6N A;  3VR9 A;  1E1N A;  1Q9I A;  5HHF A;  4CNJ A;  4YSH A;  1NAA A;  3O0H A;  3ICS A;  3C4A A;  3SZW A;  3OC4 A;  4H2N A;  2GMJ A;  2XLP A;  4USQ A;  2YR4 A;  4EIQ A;  2BK5 A;  2XFN A;  2XDO A;  1IUU A;  4EQX A;  1PHH A;  3BNU A;  4A5L A;  1RSG A;  1DOE A;  2GEW A;  2AAQ A;  4GDE A;  2AR8 A;  1O5W A;  2B9Y A;  3D1C A;  3RP8 A;  1DJQ A;  1H2I A;  3QFA A;  1PJ5 A;  4EIP A;  1LJ1 A;  3LOV A;  3HZL A;  4H50 A;  5EB4 A;  3AD8 B;  5KOX A;  3ICR A;  3GWD A;  3AYL A;  1NG4 A;  3QSS A;  1PBD A;  1CC4 A;  3I6D A;  1PBF A;  4NEW A;  4A65 A;  1FEB A;  1Q1W A;  1DOD A;  3SFD A;  3NYF A;  1XAN A;  1H86 A;  3Q6J A;  4UDQ A;  1YY5 A;  2YLX A;  1V59 A;  1CJ3 A;  4I58 A;  2ZZC A;  1D4C A;  4IVO B;  1E1M A;  2APG A;  3AEB A;  5CKU A;  4H4T A;  1B8S A;  2C67 A;  1IUW A;  2F5Z A;  5GRT A;  2VQB A;  3SM8 A;  1K4Q A;  3II4 A;  4U2S A;  4YSZ A;  3L5O A;  3F8P A;  1LQT A;  4Z44 A;  3GD4 A;  1K0J A;  3AD7 B;  1VRQ B;  4H2P A;  1TDN A;  4UDP A;  1PXC A;  4BK1 A;  3K7M X;  3P4R A;  3F8D A;  1S7M A;  4JY2 A;  3URH A;  4H4X A;  5KVI A;  1H7X A;  4YSY A;  4OPC A;  3FIM B;  3NK2 X;  3AE3 A;  1ZY8 A;  1GOS A;  1N4U A;  5JCK A;  2W0H A;  3AEE A;  1F6M A;  4CY8 A;  2IVE A;  1B5Q A;  2C64 A;  2YLZ A;  2JB3 A;  4ZN0 A;  2XLR A;  3AEA A;  2HQM A;  2Q0K A;  2YR6 A;  3GDN A;  4U2L A;  4OVI A;  2BAC A;  3K7Q X;  4B65 A;  3B6D A;  1FEC A;  4II2 A;  4FDC B;  4K8D A;  4TM0 A;  4XXG A;  3R9U A;  3SZF A;  3DJJ A;  4B64 A;  4U8M A;  1GRA A;  4XWR A;  2BS3 A;  1TRB A;  4EQW A;  3LAD A;  3RP7 A;  3NRN A;  3SYI A;  3V76 A;  4U8P A;  2H88 A;  3K7T A;  5KMP A;  5L46 A;  3UP5 A;  1GRG A;  2YLR A;  1GSN A;  1UKV G;  3CPI G;  3VR8 A;  4A79 A;  3T14 A;  3H8L A;  5DBJ A;  1KNR A;  4DSH A;  3AD9 B;  3GMC A;  4K5R A;  4UDR A;  1EL5 A;  3CTY A;  2GVC A;  3DJD A;  3NTD A;  2Z5X A;  3CNS A;  2C3D A;  3S61 A;  3AED A;  4H4P A;  2CDU A;  1O95 A;  2FJA A;  1TDK A;  4U8K A;  1NHQ A;  2WPF A;  1RP0 A;  4BJZ A;  3DME A;  4GR1 A;  5FS6 A;  2WU2 A;  2FJD A;  5JCN A;  3ABV A;  4H4R A;  1BKW A;  4YTM A;  2YLT A;  1ONF A;  3GRT A;  2R46 A;  4M52 A;  3M13 A;  4XWZ A;  1DXL A;  1GAL A;  2GAH B;  4ZCD A;  3P4S A;  3ISH A;  3RHA A;  1PBE A;  4U2T A;  1KFY A;  1EBD A;  1S2Q A;  5EB5 A;  4EQS A;  3AEG A;  3FBS A;  2VOU A;  2WOI A;  5GSN A;  3AE4 A;  4TLX A;  4TM3 A;  2JBV A;  3AEC A;  1DNC A;  4GAP A;  1Y0P A;  1JNR A;  2X99 A;  1PBC A;  2GV8 A;  5KOW A;  5FS9 A;  4A99 A;  3ITJ A;  1M6I A;  3B3R A;  2VRM A;  1GRH A;  3UTG A;  1E7P A;  2R4E A;  3IHM A;  3L1R A;  3CGB A;  4O5U A;  3BI2 A;  1PXA A;  1ZDL A;  3LZX A;  1E1L A;  5KMQ A;  4OPL A;  1IUT A;  4ICY A;  2C66 A;  3T2K A;  4C3X A;  1LQU A;  4UP3 A;  4DNA A;  2WHD A;  1OJT A;  2WQY A;  1M64 A;  3KU9 A;  4H7U A;  4A9W A;  3BI4 A;  1ZKQ A;  1L9E A;  4U8N A;  2YM1 A;  2YVG A;  4O5Q A;  2DKH A;  3DH9 A;  1REO A;  2YWL A;  1D4D A;  1BF3 A;  2Q6U A;  3UKL A;  2B7R A;  4H4Y A;  2EQ7 A;  3NK1 X;  4NTD A;  3KKJ A;  4Y4M A;  1NG3 A;  1CC2 A;  2YG4 A;  4MJW A;  3GYI A;  3UTH A;  4YSX A;  1GV4 A;  2ZBW A;  4A7A A;  1LV0 A;  2GB0 A;  3SGL A;  2X3N A;  3PO7 A;  2RGJ A;  1F3P A;  3AB1 A;  3UKF A;  3UKH A;  3DK8 A;  4JNQ A;  1L9D A;  4BK3 A;  3PG6 A;  4CCR A;  2JAE A;  2RAB A;  5KXJ A;  4H2Q A;  2BCG G;  2WET A;  1JU2 A;  5JCM A;  3CGE A;  4G74 A;  4H4S A;  1BGN A;  3L8K A;  2XVE A;  5CQF A;  4RG4 A;  2BS4 A;  4B68 A;  4X9M A;  3NTA A;  3KD9 A;  1H83 A;  3WE0 A;  1ZK7 A;  2WBA A;  5BUK A;  2VVL G;  3Q9T A;  2ARD A;  2E1M A;  4PAB A;  2OAM A;  1CF3 A;  3IC9 A;  3KPK A;  3CIR A;  3VRA A;  3NH3 X;  1E39 A;  3KPF A;  3CNJ A;  2IID A;  3P4Q A;  2WPC A;  1H7W A;  2WDR A;  3NN6 X;  1QLB A;  3ZDN A;  2V3B A;  1N4V A;  3T2Z A;  2BRA A;  2EQ6 A;  3P1W A;  1Z6L A;  3CGD A;  4EQR A;  2OLO A;  4E0V A;  1PDH A;  1OJ9 A;  1XPQ A;  1VDC A;  2I0Z A;  2R0G A;  2R4J A;  1EL7 A;  1CHU A;  2IVD A;  4BK2 A;  2EQ8 A;  2WS3 A;  4H4Q A;  1FCD A;  2Q0L A;  4J31 A;  4REK A;  4NEV A;  3AE2 A;  1VQW A;  4AOX A;  4YXD A;  4GDP A;  3HYX A;  4H4Z A;  4OPI A;  5KVH A;  2TMD A;  1KSU A;  4Z2R A;  4JN9 A;  3QVR A;  3T31 A;  3CNP A;  3QJ4 A;  3NNE A;  2R9Z A;  2BC1 A;  5U25 A;  1DOB A;  1MXT A;  2BK4 A;  2C76 A;  5IPY A;  3SY4 A;  3NLC A;  2H89 A;  3H8I A;  2BYB A;  3OZ2 A;  2WP5 A;  1PBB A;  1QO8 A;  2FJB A;  4YTP A;  1B4V A;  1NEN A;  2BS2 A;  4B1B A;  4GUV A;  2C3C A;  3RP6 A;  3VRB A;  2QCU A;  5EBK A;  3IWA A;  4AOS A;  3UKA A;  3DJE A;  5U1O A;  4YWO A;  2JK6 A;  3GRS A;  2C75 A;  3CNT A;  3UKP A;  1TYP A;  4FX9 A;  2X50 A;  1GTH A;  1MOK A;  2YLW A;  4X4J A;  2CVJ A;  2ZZ0 A;  3GD3 A;  1OJA A;  2VVL A;  3GMB A;  3AYI A;  2XLT A;  2WOV A;  1N4W A;  2YVJ A;  4GCM A;  2GMH A;  3UKK A;  4AT2 A;  3G5Q A;  4G6G A;  2V5Z A;  4D03 A;  2GR3 A;  2XCG A;  4II3 A;  1VG0 A;  2C7G A;  2R0P A;  2OA1 A;  4FK1 A;  2DKI A;  1GES A;  4HA6 A;  3DJG X;  3EAO A;  1S3E A;  5KNL A;  4C77 A;  2XLU A;  4JNA A;  4K5S A;  4Y4L A;  4U8I A;  2JKC A;  4YTN A;  1COY A;  1EL8 A;  4P9S A;  4U8J A;  1GET A;  2XLS A;  2XVH A;  3DGZ A;  2E4G A;  1KNP A;  2V3A A;  2VRL A;  3AE6 A;  2BAB A;  3FG2 P;  3K30 A;  3KVE A;  4TLZ A;  5HYM A;  5IQ1 A;  3AWI A;  4GRT A;  2B76 A;  2X8H A;  3GYX A;  2WDV A;  1JEH A;  3NN0 X;  3FPZ A;  4IA6 A;  1D4E A;  4JQ9 A;  3AE5 A;  2VVM A;  3UKQ A;  3EPT A;  5EOW A;  1CBO A;  3AE9 A;  4GAV A;  3VRD B;  1NDA A;  3DA1 A;  4PAA A;  1SEZ A;  3FMW A;  3RNM A;  4J57 A;  1E6E A;  3CMM A;  4CCQ A;  2CUL A;  1ELI A;  4GF7 A;  4NTE A;  3T37 A;  2FJE A;  3NG7 X;  1ZMC A;  2XVI A;  3G5R A;  1TDE A;  2VZ2 A;  1B37 A;  1FL2 A;  2R45 A;  3CN8 A;  1YKJ A;  1RYI A;  4YKG A;  2C70 A;  2YG6 A;  4H4W A;  5BUL A;  4B67 A;  2YG5 A;  4IV9 A;  1NPX A;  2GRT A;  3G5S A;  3PVC A;  4USR A;  3UTE A;  2OLN A;  4K2X A;  2YVF A;  3V3O A;  4YKF A;  1TDF A;  4JY3 A;  5M0Z A;  1Y56 B;  3NK0 X;  4C74 A;  4LA1 A;  1KDG A;  2YG7 A;  3NGC X;  1K0I A;  3SX6 A;  1PN0 A;  3CPH G;  3NT6 A;  4NTC A;  2WDQ A;  1F8W A;  3COX A;  4EMW A;  4LU6 A;  2XFP A;  2XFU A;  3P4P A;  4CNK A;  2V60 A;  4D04 A;  5C2T A;  3GDP A;  4JDR A;  1W4X A;  1NEK A;  4G6H A;  3E1T A;  2Y6R A;  1D7Y A;  1EL9 A;  2Z5Y A;  1PJ6 A;  4J2W A;  4U8O A;  4J36 A;  4Z25 A;  1CJ4 A;  2RGH A;  3BNM A;  3CND A;  1LTX R;  1Q1R A;  4TM4 A;  2Y6Q A;  3CPJ G;  5KMS A;  2JB1 A;  3UOX A;  1GRE A;  4KX6 A;  1KN0 A;  3D8X A;  3D9X A;  1MO9 A;  1YQ4 A;  4CY6 A;  3GWF A;  2B9W A;  1BGJ A;  4U8L A;  3UOV A;  3H4K A;  3AE1 A;  4EM4 A;  2Q7V A;  3ALM A;  4ECH A;  3BHK A;  2JB2 A;  2V61 A;  4FK1 C;  1JRZ A;  5KWF A;  2PHH A;  5M10 A;  3AEF A;  3NYC A;  2WEU A;  2BCP A;  1IUS A;  1GTE A;  2YQU A;  4H2R A;  4AP1 A;  3EAN A;  1L9C A;  2GR1 A;  3GSI A;  2WOW A;  1PS9 A;  1LPF A;  4IA5 A;  3M0O A;  1DJN A;  2YLS A;  3HYW A;  4C3Y A;  1GRT A;  1CC6 A;  2A87 A;  1F8R A;  4AT0 A;  3QSE A;  4NWZ A;  4K7Z A;  2WP6 A;  3NIX A;  4NNJ A;  4Z24 A;  2NVK X;  2CFY A;  1FOH A;  3BHF A;  5FS8 A;  3T2Y A;  1YQ3 A;  4ADW A;  3LJP A;  1CL0 A;  1ZP0 A;  3V3N A;  4J34 A;  4I59 A;  2XFQ A;  3NYE A;  1H82 A;  3M12 A;  1GRB A;  2OAL A;  1IUX A;  4X9N A;  3SZC A;  5BVA A;  1H6V A;  3PS9 A;  1E1K A;  1OJC A;  3UCL A;  1JOA A;  4B69 A;  2WP9 A;  2O9Z A;  3SXI A;  1H81 A;  2VQ7 A;  1L0V A;  4OPT A;  1ZOY A;  4CBQ A;  3SFE A;  4BV6 A;  1OJD A;  1O94 A;  3UP4 A;  3S5W A;  2C73 A;  1ZX9 A;  5JCL A;  1GND A;  3JSK A;  2X8C A;  4OPG A;  2C65 A;  3P9U A;  5TR3 A;  4RG3 A;  1ZMD A;  1KF6 A;  5FMH A;  1GRF A;  1P2H A;  2E5V A;  2YM2 A;  5HY5 A;  4LII A;  1CJ2 A;  1DOC A;  3ICT A;  4CRT A;  2QAE A;  4G9K A;  3LZW A;  1HYU A;  5J7X A;  4A6N B;  2RGO A;  4B66 A;  4RSL A;  4Y4N A;  2J3N A;  4EM3 A;  3UOZ A;  1X31 B;  2R0C A;  2WU5 A;  5LV9 A;  3CGC A;  2FBW A;  4AP3 A;  1QJD A;  3BI5 A;  1Y56 A;  4YT0 A;  3QVP A;  1N1P A;  3ATR A;  1TYT A;  1ZOV A;  2A89 A;  4HB9 A;  3QFB A;  4Z2T A;  3ZYX A;  1NHR A;  3UTF A;  3AXB A;  2C4C A;  4H4U A;  4OPU A;  1P2E A;  2V6O A;  2WPE A;  2BRY A;  1GXF A;  3IHG A;  3KA7 A;  1D5T A;  3ALL A;  3SQP A;  4BUR A;  2UZZ A;  4APN A;  1TDO A;  2GAG B;  2A8X A;  3GYJ A;  4Z26 A;  3C96 A;  4Z43 A;  4K22 A;  1IJH A;  1JRX A;  4DGK A;  3I3L A;  2GR2 A;  1XHC A;  3DK4 A;  2BXS A;  3AE8 A;  3ALJ A;  2XYO A;  1JRY A;  3QSM A;  2X8G A;  4OCG A;  1VG9 A;  2GQF A;  4BJY A;  4ZCC A;  4J56 A;  2YR5 A;  3UOY A;  5JCI A;  1GER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...