4J57A

Structure of plasmodium falciparum thioredoxin reductase-thioredoxin complex
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
499
structure length
483
Chain Sequence
HTYDYDYVVIGGGPGGMASAKEAAAHGARVLLFDYVKPSSQGTKWGIGGTCVNVGCVPKKLMHYAGHMGSIFKLDSKAYGWKFDNLKHDWKKLVTTVQSHIRSLNFSYMTGLRSSKVKYINGLAKLKDKNTVSYYLKGDLSKEETVTGKYILIATGCRPHIPDDVEGAKELSITSDDIFSLKKDPGKTLVVGASYVALECSGFLNSLGYDVTVAVRSIVLRGFDQQCAVKVKLYMEEQGVMFKNGILPKKLTKMDDKILVEFSDKTSELYDTVLYAIGRKGDIDGLNLESLNMNVNKSNNKIIADHLSCTNIPSIFAVGDVAENVPELAPVAIKAGEILARRLFKDSDEIMDYSYIPTSIYTPIEYGACGYSEEKAYELYGKSNVEVFLQEFNNLEISAVHRSTCLAKLVCLKNEDNRVIGFHYVGPNAGEVTQGMALALRLKVKKKDFDNCIGIHPTDAESFMNLFVTISSGLSYAAKGGCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Plasmodium falciparum Thioredoxin Reductase-Thioredoxin Complex.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase 2
total genus 155
structure length 483
sequence length 499
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF00890 FAD_binding_2 FAD binding domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4j57A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4j57A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4j57A02
2WETA 4A79A 4H7UA 3AD7B 2EQ8A 4C5OA 3OC4A 2BABA 3NIXA 1EL9A 3T37A 1EBDA 4N9XA 4LIIA 4EQRA 3KVEA 1W4XA 4H4VA 3RNMA 4DSHA 1N1PA 5C2TA 4Z43A 1Q9IA 5JCLA 3FBSA 1D4CA 2FJAA 3NYEA 1HYUA 4USQA 2WPEA 5HYMA 1CHUA 1YY5A 1GT8A 3P9UA 1IUVA 1GERA 1D7LA 3BNMA 3RP6A 4A7AA 4Z25A 2C3CA 1X31B 2WP6A 3B3RA 2XLUA 1NDAA 2XCGA 3ISHA 4CRTA 4U8PA 2YLSA 2X8CA 3DK8A 1ZX9A 1GREA 5KWFA 5FS6A 4Z2UA 3DJEA 3DK9A 3KD9A 1PJ6A 1TDKA 3NYCA 1NHQA 4B68A 4EIPA 3E1TA 1S2YA 3CPJG 1DODA 2BXSA 2DKIA 4U2LA 4LA1A 1GNDA 1OJDA 2WQYA 3V3NA 2WOIA 4FX9A 5JCIA 2VRMA 3CGDA 4JDRA 2WOWA 2B76A 1GRAA 4C77A 4YSXA 2XDOA 3QVPA 5BRTA 1IJHA 4YSYA 2OAMA 2YVJA 2WPFA 2GQFA 2C66A 1L9DA 2GMHA 3NK2X 3DGZA 4MJWA 4FK1A 3NK1X 5BULA 3VRAA 3KU9A 1DXLA 1CL0A 1OJCA 3CGCA 1KSUA 3CN8A 3AEFA 4B69A 1JRZA 4FDCB 3ZDNA 4H4UA 5U25A 3LB8A 1BGNA 2R4EA 3NH3X 4B1BA 4CY8A 4B63A 3G5RA 3GDPA 3H4KA 1CJ3A 5KRQA 3ADAB 2YG6A 4Y4LA 2OLNA 3K30A 1ELIA 1TRBA 1TYTA 2R45A 3SGLA 1M64A 2GV8A 5GRTA 1IUTA 1N4UA 4EQSA 1H81A 2GAHB 3L8KA 1N4WA 3I6DA 3QSMA 1ZP0A 3UKHA 2EQ6A 2YLRA 3UOZA 2BYBA 3NKSA 4JNAA 1FCDA 2O9ZA 3GMBA 2NPXA 5KVIA 3RHAA 4UDPA 3GMCA 3KPFA 1BKWA 2R46A 4U2SA 4C74A 1H7WA 4ECHA 4A99A 2BS4A 2GRTA 1PBBA 1D4EA 1ZKQA 2E5VA 5J7XA 3IHGA 1PXAA 2IVDA 2YR6A 4ADWA 2AQJA 5ER0A 3G5SA 2EQ7A 5EOWA 3BI5A 3URHA 2WOVA 2YVGA 2AR8A 3AECA 2GR2A 2WBAA 2F5ZA 3GYIA 3NHOX 1KNPA 3NNEA 4WX1A 1V59A 1S2QA 1LVLA 4J36A 1YQ4A 3RP7A 3R9UA 3AXBA 1DOBA 2XVIA 2YLXA 3ALJA 1ZDLA 3BHFA 3I3LA 1GETA 2V3BA 4YT0A 1E1KA 2XLRA 2QAEA 2BCPA 2VQBA 3S61A 1PXBA 2WPCA 1F8RA 2YR5A 4BJZA 1E7PA 3Q9TA 4APNA 2H89A 3V3OA 4EQWA 4XXGA 2IVEA 5M0ZA 1XPQA 3F8RA 4Z2RA 3CPIG 3UOVA 1YKJA 1JOAA 1PDHA 2C64A 4H4YA 4U8MA 4UDQA 3FMWA 4H4WA 4A9WA 1GRFA 3AB1A 1GPEA 4H4SA 4XWZA 2VQ7A 1MXTA 2C67A 4YTNA 1GESA 1NEKA 2X3NA 4H4TA 2VVMA 4H2RA 4JQ9A 1NAAA 3LXDA 2YG4A 3CNSA 2GR0A 3GRTA 1H83A 4I59A 4Z24A 5FS7A 3AEAA 2OA1A 1GRBA 2BCGG 3AEDA 3GWFA 1KNRA 1YQZA 1B8SA 4U8IA 1XANA 2YG7A 2X99A 4C3XA 4B67A 3CGEA 4EMJA 2IIDA 3ALMA 4J34A 4OCGA 2Y6QA 3II4A 3BHKA 2ZZBA 3BI4A 3D1CA 1PS9A 5CKUA 3LJPA 3H8LA 4D03A 2JKCA 4HB9A 2J3NA 1F8SA 3NLCA 2GR3A 2A89A 2YM1A 3IHMA 1SEZA 4A65A 1IUUA 5KOXA 4KX6A 3REDA 1VG9A 4IA5A 3ATQA 5U63A 3CNTA 4AT0A 1K0IA 2C70A 2V61A 2Q6UA 3LADA 3V76A 2V6OA 2QA1A 5EBKA 1Z6LA 2JAEA 2BXRA 3UTFA 1E1LA 3CNPA 4EIQA 1XHCA 3AE2A 1FOHA 3QJ4A 4EM3A 1NHSA 5IQ4A 3UOYA 4U8LA 3AYIA 1EL8A 2FJEA 2V3AA 5BUKA 3DJJA 2UZZA 4J56A 3NN0X 4AP1A 5FS9A 1L0VA 1Q1WA 1BWCA 4NTCA 4NZHA 4H50A 4CNJA 3DGHA 3DH9A 5TR3A 2ZZCA 1LQUA 5GSNA 4X9MA 5JCMA 4BV6A 2RGOA 3EPTA 2WU2A 2V60A 4BK1A 2WHDA 4I58A 4NTEA 4EM4A 4BURA 3UOXA 3IWAA 2A8XA 5JCNA 1QJDA 2B7SA 3AE7A 3FG2P 1F3PA 3IF9A 4OPDA 4OVIA 2B9WA 4C3YA 1O94A 2XLPA 1P2HA 1OJAA 2AAQA 2VRLA 3CNDA 3KA7A 1PBFA 3COXA 2DKHA 1LJ1A 2R0PA 2WDVA 1GTEA 4JY3A 4U8JA 1D4DA 1S3EA 3LZXA 4NEVA 4U2TA 1GRHA 4USRA 3UKKA 5JCKA 3M12A 3P4SA 3UKAA 1LQTA 3GDNA 5KVHA 1RP0A 1Y56B 3UTEA 2JB3A 3UTHA 2YLZA 2C75A 3QFBA 3S5WA 4K5RA 4TLXA 1MOKA 4DNAA 2ACZA 2EQ9A 2BACA 4H2PA 2JB2A 2JBVA 3Q6JA 2XVHA 3ICSA 2YQUA 4CCQA 3C4NA 4X9NA 3G5QA 3AD8B 4GF7A 2X8HA 5DBJA 2R0GA 1BZLA 3EAOA 1K0JA 5EB4A 1DOCA 1GRGA 1L9CA 4GDEA 4YKFA 4CBQA 2C3DA 1GTHA 1E39A 2YM2A 1PBDA 2BS3A 3AEBA 2GVCA 3NG7X 4FK1C 1L9EA 4GCMA 4H2QA 2ZZ0A 2GR1A 1TDOA 4GUVA 4OPTA 4OPUA 2Y6RA 3UCLA 1D7YA 1TYPA 1DJQA 2C65A 4RG4A 2OALA 2B9XA 1Y56A 1PXCA 4TM4A 3FIMB 1KSSA 1Y0PA 2XFNA 2E4GA 3ICRA 1RSGA 2QCUA 3B6DA 3IC9A 4YTMA 1NPXA 3O0HA 1CF3A 4ICYA 4AOXA 1F8WA 4PAAA 4AOSA 3BNUA 2TPRA 3AYJA 1S3BA 1GV4A 4J57A 1B5QA 1NHPA 1Q1RA 2TMDA 2BK5A 5BVAA 2NVKX 1E6EA 5FS8A 3HZLA 2Q0KA 1KF6A 4Y4NA 4DSGA 3KLJA 3F8PA 3AEEA 3OZ2A 4GDPA 3P4QA 4H2NA 3EF6A 4K7ZA 3NYFA 4A5LA 1FECA 4YXDA 1MO9A 1LPFA 3K7TA 1TDFA 4JN9A 1DNCA 1ZY8A 4H4RA 3LOVA 1NG4A 5IPYA 5FMHA 2WP5A 2PYXA 1K4QA 1VDCA 2WS3A 3GSIA 5M10A 2R0CA 4M52A 4CCRA 4OPIA 2YVFA 2H88A 3PVCA 3NK0X 4Z44A 1LV0A 4D04A 1OJTA 2QA2A 2FJBA 4IVOB 5IQ1A 3UP4A 2XLSA 1JEHA 2CULA 4ZCDA 3UKFA 3P4RA 2C73A 3JSKA 5HXIA 3DJGX 1CBOA 1YQ3A 2BS2A 2VVLA 1M6IA 3C4AA 3P1WA 1ONFA 4YWOA 4OPGA 4Z26A 1ZOVA 1VQWA 3VR8A 3SFDA 1OJ9A 2BC0A 3CGBA 1GXFA 1EL5A 4K5SA 2BK4A 2WESA 1PBCA 3CNJA 1QLBA 2VZ2A 3L1RA 2YG3A 3AE6A 2GMJA 4OPCA 3VRDB 3AE8A 1FEBA 2JK6A 1ZMCA 1GRTA 4J2WA 1ZK7A 2C72A 2FBWA 1KFYA 1NENA 1PN0A 4A6NB 3NN6X 5KOWA 2I0ZA 4B64A 3ATRA 2YWLA 1JRYA 2RGJA 2C7GA 5C3JA 4IV9A 1DJNA 2B7RA 4UP3A 1CJ4A 3VRBA 4Y4MA 3UKPA 1TDNA 4BK3A 3K7MX 4H4XA 4HA6A 4TM3A 4TM1A 3M13A 3AE1A 2GQWA 1VRQB 4U8KA 4AT2A 3GYJA 4WCTA 2VOUA 3F8DA 2X8GA 2C76A 3D8XA 1NG3A 1FEAA 1E1NA 4KPRA 4P9SA 4O5UA 4REKA 4J33A 5KXJA 2E1MA 3AEGA 3QVRA 1IUXA 3NTAA 4IA6A 1GEUA 3QSEA 4YKGA 3SFEA 3DA1A 1RYIA 3VR9A 2GF3A 3BI2A 1REOA 2W0HA 2R4JA 4UDRA 4RSLA 4JY2A 4XWRA 2RABA 4ZCCA 2YAUA 3ITJA 4CNKA 5U1OA 1F6MA 1COYA 2XFOA 2YLWA 3CPHG 2WDRA 4H4QA 5EB5A 3ALLA 1PBEA 4GR1A 3SQPA 3ABVA 4EMIA 2JB1A 4GRTA 3UKLA 1UKVG 2XFPA 3M0OA 1B4VA 1IUWA 1GALA 2GEWA 2WP9A 2RGHA 3NTDA 1PHHA 2ARDA 3PS9A 3GWDA 2OLOA 2PHHA 5CQFA 4NTDA 2WU5A 4OPLA 4RG3A 2B9YA 1N4VA 4IVMB 4X4JA 4BK2A 3EANA 2VVLG 3AD9B 4H4ZA 1IUSA 4BJYA 3UP5A 2HQMA 3DJDA 3P4PA 1H7XA 3QFAA 4A6NA 2CDUA 4PABA 5LV9A 1O5WA 2Z5YA 1K0LA 4AP3A 3AWIA 4DGKA 3VQRA 1CJCA 3AE3A 1CC2A 1B37A 1P2EA 2XYOA 4TLZA 4O5QA 3SM8A 3ZYXA 4EMWA 2WDQA 3GRSA 2Z5XA 2XFQA 2BA9A 2WEUA 2XFUA 2R9ZA 5HHFA 3KKJA 2BK3A 1PJ5A 1ZOYA 4CY6A 3AE9A 4Z2TA 4ZN0A 3C96A 4K22A 2CVJA 2V5ZA 3CTYA 2FJDA 4U8NA 2XLTA 1CC4A 4TM0A 2Q7VA 3CIRA 4NEWA 1ZMDA 1GOSA 3AE4A 1XDIA 1BF3A 4B66A 1PJ7A 4K2XA 1QO8A 2APGA 1NHRA 3DK4A 1LTXR 1JU2A 2XVJA 3RP8A 2Q0LA 4YSZA 2GAGB 2ZBWA 3FPZA 3ICTA 4H4PA 2GH5A 1FL2A 2YG5A 2A87A 2CFYA 4K8DA 1H86A 2GB0A 2X50A 3DMEA 3AE5A 3UKQA 1H84A 1H82A 4YSHA 3GD3A 4B65A 1BGJA 3GD4A 5HY5A 4J31A 1E1MA 1VG0A 1JNZA 1JNRA 4E0VA 1D5TA 1O95A 3K7QX 1TDEA 1GSNA 1AOGA 4JNQA 2XVEA 3NRNA 3PO7A 3AYLA 2YLTA 4EQXA 2XVFA 4LU6A 1DOEA 1EL7A 1H6VA 2BC1A 1JRXA 4YTPA 1KDGA 3H8IA 5J60A 4U8OA 5L46A 3NGCX 3WE0A 3LZWA 1CJ2A 3QSSA 1CC6A 2YR4A 3UTGA 3NT6A
chains in the Genus database with same CATH superfamily
2PCEA 2EQ8A 3NIXA 1EBDA 3OTRA 4H4VA 1P43A 1D4CA 2FJAA 3NYEA 1YY5A 1D7LA 3BNMA 3B3RA 4CRTA 3RCYA 3DK8A 3A7UA 5KWFA 5FS6A 1NHQA 4B68A 1S2YA 3CPJG 3V3NA 3PK7A 2WOIA 5JCIA 2VRMA 2WOWA 2B76A 4NNJA 4C77A 1IJHA 2OAMA 4FK1A 4B69A 4H4UA 3LB8A 3NH3X 4B1BA 2YG6A 1ELIA 3MY9A 2R45A 3SGLA 2GAHB 1N4WA 3I6DA 3QSMA 1ZP0A 4II3A 2CHRA 3R10A 3ZLGA 1FCDA 3VCCA 2NPXA 5KVIA 4GIRA 3RHAA 3HYXA 2E5VA 2AQJA 5ER0A 5EOWA 3T9PA 2WOVA 5G5HB 2GR2A 1S2QA 1LVLA 1DOBA 1GETA 2V3BA 2XLRA 3IJIA 2BCPA 2VQBA 1PXBA 3UJFA 2YR5A 4K1WA 1BKHA 3R11A 4EQWA 4XXGA 3SZFA 1YKJA 1JOAA 1KKRA 4H4YA 3FMWA 3BOXA 3AB1A 2VQ7A 4YTNA 1NEKA 4H4TA 4H2RA 2GR0A 1RM6B 2OA1A 4HCHA 3T2YA 3AEDA 3A7RA 1KNRA 3UXLA 1PDZA 3CGEA 3ALMA 4J34A 4OCGA 4HB9A 1SEZA 1IUUA 3VCNA 3CB3A 5U63A 3CNTA 2V6OA 4KT2A 3AE2A 3H8AA 4U8LA 1EC7A 4H19A 4E4FA 5BOEA 3FYYA 2C4CA 4AP1A 3DDMA 4NZHA 4CNJA 5TR3A 4E6MA 1LQUA 3S47A 3SYIA 1N63C 1X2HA 4BK1A 4BURA 5JCNA 1QJDA 3IF9A 4OVIA 4C3YA 1O94A 2XLPA 4K8GA 2VRLA 1S3EA 3LZXA 4NEVA 4U2TA 1GRHA 3M12A 3UKAA 1LQTA 3GDNA 3UTEA 3QFBA 2BACA 4H2PA 3TWBA 3Q6JA 3ZLFA 2MNRA 4H83A 3EAOA 3N4FA 1L9CA 4GDEA 4YKFA 3PWIA 2YM2A 2BS3A 1ECQA 4OPUA 2Y6RA 1D7YA 3BSMA 1DJQA 2C65A 2OALA 4TM4A 2XFNA 3AMZA 2E4GA 3R25A 4F4RA 1CF3A 4JHMA 1F8WA 4PAAA 2P8CA 2QDDA 4J57A 1NHPA 5BVAA 2NVKX 3FV9A 3ZLHA 4DWDA 4H2NA 4A5LA 4YXDA 3N6HA 3K7TA 1DNCA 1ZY8A 2I5QA 5M10A 2YVFA 2XLSA 2CULA 4ZCDA 2O56A 2BS2A 3PWGA 1VQWA 1OJ9A 4IL0A 1GXFA 1EL5A 4K5SA 3FXGA 2WESA 4GFIA 3VRDB 1GRTA 3MSYA 2C72A 3MUCA 4A6GA 3MKCA 3UGVA 2B7RA 4UP3A 2PU1A 3UJSA 4Y4MA 1BQGA 4GISA 4TM1A 3AE1A 3NZGA 4AT2A 3NRZB 3D8XA 1E1NA 4HPNA 4KPRA 4P9SA 4J33A 2E1MA 3AEGA 1IUXA 3VDGA 3NTAA 4IA6A 3S5SA 3DA1A 4G8TA 1RYIA 1REOA 2P3ZA 4RSLA 4XWRA 2YAUA 5U1OA 1F6MA 2JB1A 3M0OA 1B4VA 1GALA 2GEWA 2WP9A 1PHHA 2ARDA 3CMMA 3UJ2A 1T3QC 4H4ZA 5FJPA 3H12A 4M6UA 2CDUA 1K0LA 1CJCA 3AE3A 1B37A 1P2EA 2XYOA 4O5QA 3SM8A 4DXKA 1MDRA 3ZYXA 2AKZA 2XFQA 2BA9A 1FHVA 2XFUA 5HHFA 4CY6A 2W54A 3CIRA 4NEWA 1ZMDA 3AE4A 3QPEA 1WYGA 1P48A 1BF3A 2OZ8A 4K2XA 1QO8A 2APGA 1JU2A 2XVJA 1FFUC 3ICTA 2GH5A 2CFYA 4K8DA 2X50A 4GMEA 1H84A 3GD3A 4J31A 3UCDA 3TW9A 1JNRA 1TZZA 1AOGA 4JNQA 1XPYA 2YLTA 1DOEA 3DESA 1JRXA 4YTPA 5KMSA 4U8OA 3NGCX 3QSSA 3NT6A 2OLAA 2BABA 4N9XA 3KVEA 4DSHA 5JCLA 4USQA 2AL2B 2WPEA 1CHUA 4YWSA 3P9UA 1JDFA 1GERA 4Z25A 2C3CA 2WP6A 3FJ4A 3ISHA 3OZYA 2XCGA 2PMQA 4U8PA 3L5OA 3I4KA 1SJBA 5BOFA 1ZX9A 1GREA 3DGBA 4Z2UA 3KD9A 1TDKA 3E1TA 3THUA 3HW2A 3STPA 2BXSA 4JDRA 1GRAA 3ENLA 2XDOA 5BRTA 3BJSA 2YVJA 4GYPA 3QKEA 4MJWA 1OJCA 3NVYB 3CN8A 3AEFA 2ZC8A 4CY8A 3G5RA 3GDPA 2MUCA 5KRQA 3ADAB 3K30A 1TYTA 3UCCA 3UJRA 2EQ6A 2BYBA 3NKSA 1BKWA 4C74A 1L8PA 2BS4A 3U9IA 3R07C 1ZKQA 3IHGA 1KKOA 3AECA 3SN1A 3GYIA 3NHOX 3NNEA 4FI4A 1JCTA 3AXBA 3ALJA 3I6TA 2YLXA 4YT0A 5IDZA 5KMRA 2QAEA 2WPCA 1F8RA 2XH2A 1E7PA 3EKGA 3V3OA 4K2SA 4Z2RA 3F8RA 4IP5A 4E4UA 4UDQA 1GRFA 1GESA 2GGHA 4JQ9A 1NAAA 2YG4A 3EUB3 1H83A 4Z24A 2XH0A 1GRBA 3GWFA 2PS2A 3KPKA 1XANA 2POZA 2X99A 3II4A 1RVKA 2ZZBA 3D1CA 5CKUA 3LJPA 2J3NA 4TVYA 2A89A 2YM1A 3IHMA 4KX6A 4HN8A 4IA5A 3ATQA 2C70A 2QA1A 2W3RA 3UTFA 1MNSA 4GYPC 5IQ4A 1XHCA 3QJ4A 3UOYA 4G74A 4FP1A 3AYIA 1EL8A 2FJEA 3DJJA 4J56A 3NN0X 2HZGA 2NQLA 3SY4A 4NTCA 5FJRA 2ZZCA 5JCMA 4BV6A 2RGOA 4I58A 3RRAA 3UOXA 3IWAA 1JROA 2B7SA 3NFUA 2B9WA 4DN1A 1OJAA 3KA7A 3CNDA 3COXA 1LJ1A 1GTEA 1D4DA 2QJNA 4DHGA 3P4SA 2YLZA 2C75A 4TLXA 4DNAA 1R6WA 2XVHA 3C4NA 3G5QA 2X8HA 5DBJA 1K0JA 1GRGA 4CBQA 2PP3A 2C3DA 3AEBA 2E5AA 4KWSA 4FK1C 1L9EA 4OPTA 3UCLA 1TYPA 2B9XA 1Y0PA 3ICRA 1NPXA 4AOXA 4AOSA 2E3TA 3VC6A 3DG3A 1KF6A 4DSGA 3KLJA 4IZGA 3RR1A 3OZ2A 3SR6B 4K7ZA 3NYFA 3B97A 3LOVA 5FMHA 2PYXA 2WS3A 2R0CA 3PVCA 3NK0X 1LV0A 4D04A 3UP4A 3UKFA 2C73A 4G73A 5HXIA 4GGHA 1CBOA 3D47A 3OZMA 1ONFA 4YWOA 1FHUA 3SZ0A 1EBHA 1PBCA 2YG3A 3TJIA 4OPCA 4J2WA 1PN0A 4A6NB 4B64A 3ATRA 2YWLA 3DFYA 2XH4A 3ETRB 3M13A 2GQWA 1VRQB 4U8KA 3GYJA 2PP1A 3F8DA 4REKA 3QVRA 3QSEA 3IJQA 3SFEA 2GF3A 3JW7A 1SJDA 2R4JA 4UDRA 4JY2A 4ZCCA 5EB5A 3CPHG 2WDRA 4H4QA 4ENLA 4GR1A 3SQPA 3IJLA 4HCLA 5J04A 4GRTA 2XFPA 1IUWA 2PU0A 3GWDA 2PHHA 3AD9B 3OP2A 2HQMA 1EBGA 3FVDA 3AWIA 3VQRA 4ZCWA 1CC2A 3TWAA 2OPJA 4EMWA 3HYVA 3U4FA 2WDQA 3TQPA 4ROPA 3KKJA 2PGWA 4ZN0A 3MZNA 2Q7VA 1GOSA 3T31A 1PJ7A 1KN0A 1NHRA 3DK4A 3Q4DA 3TOYA 1FL2A 1H82A 4YSHA 3CXOA 1BGJA 5HY5A 1D5TA 3K7QX 1TE6A 2XVEA 2PPGA 3PO7A 3FCPA 1H6VA 3H8IA 5J60A 3SN4A 3UTGA 4A79A 1PDYA 4H7UA 3ZVHB 4C5OA 3OC4A 1EL9A 1W4XA 2XGZA 3N4EA 1N1PA 5C2TA 1Q9IA 3FBSA 2OX4A 5HYMA 2FKPA 1GT8A 1IUVA 4A7AA 2W55A 3K1GA 1FFVC 4KPLA 3T6CA 3DJEA 3NYCA 4HNCA 3CGDA 3ZVHA 4YSXA 1WUFA 4YSYA 1L9DA 1H2IA 2GMHA 1N60C 3NK1X 5BULA 3NVWB 3KU9A 1DTNA 3IK4A 1DXLA 5U25A 1BGNA 3CXBA 3H4KA 1CJ3A 2XH7A 2OLNA 1H81A 3UKHA 4IP4A 3UOZA 2OO6A 3GMBA 1N61C 3GMCA 3KPFA 2R46A 4ECHA 3SQSA 1H7WA 4A99A 2HXUA 3DFHA 5J7XA 4KEMA 2IVDA 2YR6A 3TCSA 3G5SA 3AN1A 3QTPA 3BI5A 3URHA 2YVGA 3UXKA 1STZA 2AR8A 2WBAA 1KNPA 4II2A 4WX1A 3RP7A 3R9UA 2XVIA 3DG7A 3I3LA 4NWZA 3S61A 2OZ3A 1MDLA 3DG6A 3Q9TA 2H89A 1XPQA 3CPIG 2C64A 4U8MA 4X2PA 4A9WA 4H4SA 2OQYA 3T4WA 2VVMA 1XS2A 4BJYA 3GRTA 1B8SA 5KMPA 3CYJA 4C3XA 1KCZA 4B67A 4EMJA 2IIDA 2Y6QA 3RITA 1PS9A 3H8LA 2JKCA 3GY1A 3NLCA 2GR3A 4A65A 4JN8A 3REDA 1VG9A 2W3SA 4AT0A 4G6GA 2Q6UA 3LADA 3V76A 4GGBA 1Z6LA 2BXRA 2QQ6A 1E1LA 3CNPA 4EIQA 1FOHA 1NHSA 2UZZA 5FS9A 3SN0A 1Q1WA 1BWCA 2QJMA 3DH9A 5GSNA 1TKKA 2WU2A 4NTEA 5FJOA 4EIPA 2A8XA 3AE7A 3FG2P 4OPDA 3SX6A 1P2HA 1PBFA 2DKHA 2P8BA 4U8JA 4DX3A 4EWJA 1S7MA 1ZXIC 4USRA 3UKKA 5JCKA 4MGGA 5KVHA 2JB3A 3UTHA 3S5WA 4A35A 2ACZA 2EQ9A 3ICSA 2YQUA 3AD8B 4GF7A 2R0GA 1BZLA 1KD0A 1DOCA 1SJCA 2ONEA 2OG9A 3A7AA 1GTHA 3NG7X 1PBDA 2GVCA 3NO1A 4GCMA 4H2QA 2ZZ0A 1TDOA 2PP0A 3GD6A 3NVVB 1RSGA 1SB3B 3IC9A 4ICYA 3O0HA 2TPRA 3AYJA 1S3BA 1GV4A 3DEQA 4JN7A 1B5QA 4DYEA 1Q1RA 4IL2A 2GGGA 5FS8A 2Q0KA 2OFJA 3AEEA 3P4QA 3EF6A 1LPFA 1TDFA 4H4RA 4ZA0A 2WP5A 1VDCA 3GSIA 2PSNA 4OPIA 4E8GA 2HNEA 3SXIA 2QA2A 3QN3A 1JEHA 3P4RA 3DJGX 1YQ3A 1M6IA 3C4AA 4Z26A 1ZOVA 3VR8A 3SFDA 2BC0A 3V3WA 3CGBA 3ES8A 3SJNA 2BK4A 1QLBA 2ZADA 3L1RA 3AE6A 1V97A 2GMJA 4IHCA 3VA8A 2QVHA 3AE8A 2OVLA 1FEBA 2JK6A 2FBWA 3B9JB 5KOWA 2I0ZA 2DW7A 1JRYA 2C7GA 5C3JA 1DJNA 3R1ZA 3VRBA 1TDNA 4BK3A 2VOUA 1NG3A 3HYWA 3I6EA 3T2KA 1GEUA 2BRYA 3VR9A 2QJJA 3BI2A 2RABA 4CNKA 1COYA 3ALLA 1PBEA 3NS1B 3MWCA 2OQHA 1UKVG 2RGHA 1N5XA 2OLOA 4Z17A 2WU5A 4OPLA 4RG3A 3TTEA 2B9YA 1N4VA 4X4JA 4BK2A 3EANA 2VVLG 3TJ4A 1IUSA 3UP5A 3DJDA 3P4PA 1H7XA 3QFAA 4A6NA 2Z5YA 4DGKA 1F9CA 5ENLA 5FJTA 2Z5XA 3P93A 2WEUA 3V4BA 3AM9A 2BK3A 4Z2TA 3CAWA 1NU5A 2CVJA 2XLTA 1CC4A 1ELSA 1XDIA 4B66A 3ES7A 2Q0LA 4YSZA 2GAGB 4H4PA 2GSHA 2A87A 1H86A 2GB0A 3DMEA 4B65A 2QGYA 2AL1A 1E1MA 2GDQA 2PTZA 4E0VA 4GAVA 1TDEA 3CT2A 3AYLA 1ONEA 1KDGA 1MRAA 5L46A 3WE0A 3LZWA 4Z1YA 1CJ2A 1CC6A 1N62C 3GD4A 2WETA 3AD7B 2BRAA 3T37A 4LIIA 4EQRA 6ENLA 3RNMA 3V5FA 4Z43A 2GGIA 1HYUA 3H70A 3SZWA 3RP6A 1X31B 2OKTA 2XLUA 1NDAA 2PTXA 2YLSA 2X8CA 2PTYA 3DK9A 1PJ6A 2PODA 1X2GA 1DODA 2DKIA 4U2LA 4LA1A 1GNDA 1OJDA 2WQYA 4FX9A 3QVPA 3CK5A 2WPFA 1R0MA 2C66A 2GQFA 3NK2X 3DGZA 3VRAA 3EEZA 1CL0A 3CGCA 1KSUA 1JRZA 4FDCB 3ZDNA 2R4EA 2HXTA 2QDEA 2FYMA 4B63A 1SJAA 4Y4LA 1TRBA 1M64A 2GV8A 5GRTA 1IUTA 1N4UA 4EQSA 3L8KA 1IYXA 2YLRA 4JNAA 2O9ZA 3HRDC 4UDPA 4U2SA 2GRTA 1PBBA 1D4EA 5EU9A 1PXAA 4ADWA 3SZCA 2EQ7A 2RDXA 2F5ZA 1V59A 4J36A 1YQ4A 1W6TA 3N6JA 3BHFA 1ZDLA 3T8QA 5G5GB 1E1KA 3DIPA 4BJZA 4APNA 3NVZB 2IVEA 5M0ZA 3UOVA 1PDHA 4H4WA 1GPEA 4XWZA 1MXTA 2C67A 1JPMA 4J3ZA 2X3NA 4TVWA 3LXDA 3CNSA 3SBFA 4I59A 5FS7A 3AEAA 2BCGG 1YQZA 4U8IA 2YG7A 5KNLA 3JZUA 3BHKA 3T0KA 2OZTA 3BI4A 4D03A 1YEYA 1F8SA 2GGEA 5KOXA 3P3BA 3P0WA 1K0IA 2V61A 5EBKA 4GAPA 2JAEA 5JRBA 4EM3A 1WUEA 2PTWA 2V3AA 5BUKA 1JPDX 3PG6A 3KUMA 1L0VA 3GO2A 4H50A 7ENLA 3DGHA 4X9MA 1JRPA 1VDVA 3EPTA 2V60A 2WHDA 4EM4A 1F3PA 4H2HA 2AAQA 4H1ZA 2WDVA 2R0PA 4JY3A 1EC9A 3H7VA 1RP0A 1Y56B 3RO6A 4K5RA 2GL5A 1MOKA 2JB2A 2JBVA 4CCQA 3ZVIA 4X9NA 2PA6A 2P0IA 4IT1A 3JVAA 5EB4A 3PFRA 1NELA 1E39A 3R0UA 2GR1A 4GUVA 3T14A 4RG4A 1Y56A 1PXCA 3FIMB 1KSSA 2QCUA 3B6DA 4YTMA 3OPSA 3BNUA 5KMQA 4HYRA 3D46A 2P88A 4G7FA 3HPFA 2TMDA 2BK5A 1E6EA 3HZLA 4Y4NA 3F8PA 4GDPA 1FECA 1MO9A 3R0KA 4JN9A 1NG4A 5IPYA 1K4QA 4E5TA 4M52A 4CCRA 2H88A 4Z44A 1OJTA 2FJBA 4IVOB 5IQ1A 3JSKA 4G6HA 2VVLA 4MMWA 3GC2A 3P1WA 4OPGA 3CNJA 1OEPA 2VZ2A 3NXLA 1ZMCA 1ZK7A 3D9XA 1KFYA 1NENA 3VC5A 3NN6X 2RGJA 2AL2A 4IV9A 1CJ4A 1E9IA 3UKPA 2PGEA 3K7MX 4H4XA 4HA6A 4TM3A 2XSXA 4WCTA 2X8GA 2C76A 1FIQB 1FEAA 4O5UA 5KXJA 3RGTA 4G9KA 4YKGA 3QLDA 2W0HA 3GYXA 3ITJA 4MKSA 2XFOA 2YLWA 5FJUA 3ABVA 4HCDA 4EMIA 3UKLA 3V5CA 3NTDA 3PS9A 5CQFA 3DERA 4NTDA 4IVMB 4M0XA 4J1OA 1N5WC 4PABA 5LV9A 1O5WA 3Q45A 4TLZA 4HNLA 3GRSA 2R9ZA 1PJ5A 1ZOYA 3AE9A 3C96A 1FO4A 4K22A 2V5ZA 3CTYA 2FJDA 4U8NA 4TM0A 3UJEA 3MQTA 1LTXR 3RP8A 2ZBWA 3FPZA 4A3RA 2YG5A 3VFCA 1VQZA 3AE5A 3UKQA 2GGJA 1VG0A 1JNZA 1O95A 4ZOHB 1GSNA 2DW6A 1MUCA 3NRNA 4EQXA 2XVFA 4LU6A 2AKMA 1EL7A 3OW1A 3SSZA 2BC1A 1EC8A 4AP3A 2YR4A 3T2ZA
chains in the Genus database with same CATH topology
2WETA 4A79A 4H7UA 3AD7B 2EQ8A 2BRAA 4C5OA 3OC4A 2BABA 3NIXA 1EL9A 3T37A 1EBDA 4N9XA 4LIIA 4EQRA 3KVEA 1W4XA 4H4VA 3RNMA 4DSHA 1N1PA 5C2TA 4Z43A 1Q9IA 5JCLA 3FBSA 1D4CA 2FJAA 3NYEA 1HYUA 4USQA 2WPEA 5HYMA 1CHUA 1YY5A 3SZWA 1GT8A 3P9UA 1IUVA 1GERA 1D7LA 3BNMA 3RP6A 4A7AA 4Z25A 2C3CA 1X31B 2WP6A 3B3RA 2XLUA 1NDAA 2XCGA 3ISHA 4CRTA 4U8PA 2YLSA 3L5OA 2X8CA 3DK8A 1ZX9A 1GREA 5KWFA 5FS6A 4Z2UA 3DJEA 3DK9A 3KD9A 1PJ6A 1TDKA 3NYCA 1NHQA 4B68A 4EIPA 3E1TA 1S2YA 3CPJG 1DODA 2BXSA 2DKIA 4U2LA 4LA1A 1GNDA 1OJDA 2WQYA 3V3NA 2WOIA 4FX9A 5JCIA 2VRMA 3CGDA 4JDRA 2WOWA 2B76A 1GRAA 4NNJA 4C77A 4YSXA 2XDOA 3QVPA 5BRTA 1IJHA 4YSYA 2OAMA 2YVJA 2WPFA 2GQFA 2C66A 1L9DA 1H2IA 2GMHA 3NK2X 3DGZA 4MJWA 4FK1A 3NK1X 5BULA 3VRAA 3KU9A 1DXLA 1CL0A 1OJCA 3CGCA 1KSUA 3CN8A 3AEFA 4B69A 1JRZA 4FDCB 3ZDNA 4H4UA 5U25A 3LB8A 1BGNA 2R4EA 3NH3X 4B1BA 4CY8A 4B63A 3G5RA 3GDPA 3H4KA 1CJ3A 5KRQA 3ADAB 2YG6A 4Y4LA 2OLNA 3K30A 1ELIA 1TRBA 1TYTA 2R45A 3SGLA 1M64A 2GV8A 5GRTA 1IUTA 1N4UA 4EQSA 1H81A 2GAHB 3L8KA 1N4WA 3I6DA 3QSMA 1ZP0A 4II3A 3UKHA 2EQ6A 2YLRA 3UOZA 2BYBA 3NKSA 4JNAA 1FCDA 2O9ZA 3GMBA 2NPXA 5KVIA 3RHAA 4UDPA 3GMCA 3KPFA 1BKWA 2R46A 4U2SA 4C74A 1H7WA 3HYXA 4ECHA 4A99A 2BS4A 2GRTA 1PBBA 1D4EA 1ZKQA 2E5VA 5J7XA 3IHGA 1PXAA 2IVDA 2YR6A 4ADWA 2AQJA 5ER0A 3SZCA 3G5SA 2EQ7A 5EOWA 3BI5A 3URHA 2WOVA 2YVGA 2AR8A 3AECA 2GR2A 2WBAA 2F5ZA 3GYIA 3NHOX 1KNPA 3NNEA 4II2A 4WX1A 1V59A 1S2QA 1LVLA 4J36A 1YQ4A 3RP7A 3R9UA 3AXBA 1DOBA 2XVIA 2YLXA 3ALJA 1ZDLA 3BHFA 3I3LA 1GETA 2V3BA 4YT0A 1E1KA 4NWZA 2XLRA 5KMRA 2QAEA 2BCPA 2VQBA 3S61A 1PXBA 2WPCA 1F8RA 2YR5A 4BJZA 1E7PA 3Q9TA 4APNA 2H89A 3V3OA 4EQWA 4XXGA 2IVEA 3SZFA 5M0ZA 1XPQA 3F8RA 4Z2RA 3CPIG 3UOVA 1YKJA 1JOAA 1PDHA 2C64A 4H4YA 4U8MA 4UDQA 3FMWA 4H4WA 4A9WA 1GRFA 3AB1A 1GPEA 4H4SA 4XWZA 2VQ7A 1MXTA 2C67A 4YTNA 1GESA 1NEKA 2X3NA 4H4TA 2VVMA 4H2RA 4JQ9A 1NAAA 3LXDA 2YG4A 3CNSA 2GR0A 3GRTA 1H83A 4I59A 4Z24A 5FS7A 3AEAA 2OA1A 3T2YA 1GRBA 2BCGG 3AEDA 3GWFA 1KNRA 1YQZA 1B8SA 3KPKA 4U8IA 5KMPA 1XANA 2YG7A 2X99A 4C3XA 4B67A 3CGEA 4EMJA 2IIDA 3ALMA 5KNLA 4J34A 4OCGA 2Y6QA 3II4A 3BHKA 3T0KA 2ZZBA 3BI4A 3D1CA 1PS9A 5CKUA 3LJPA 3H8LA 4D03A 2JKCA 4HB9A 2J3NA 1F8SA 3NLCA 2GR3A 2A89A 2YM1A 3IHMA 1SEZA 4A65A 1IUUA 5KOXA 4KX6A 3REDA 1VG9A 4IA5A 3ATQA 5U63A 3CNTA 4AT0A 1K0IA 2C70A 2V61A 2Q6UA 4G6GA 3LADA 3V76A 2V6OA 2QA1A 5EBKA 1Z6LA 4GAPA 2JAEA 2BXRA 3UTFA 1E1LA 3CNPA 4EIQA 1XHCA 3AE2A 1FOHA 5JRBA 4EM3A 1NHSA 3QJ4A 5IQ4A 3UOYA 4G74A 4U8LA 3AYIA 1EL8A 2FJEA 2V3AA 5BUKA 3DJJA 2UZZA 4J56A 3NN0X 4AP1A 2C4CA 5FS9A 3PG6A 1L0VA 1Q1WA 1BWCA 3SY4A 4NTCA 4NZHA 4H50A 4CNJA 3DGHA 3DH9A 5TR3A 2ZZCA 1LQUA 5GSNA 4X9MA 5JCMA 4BV6A 2RGOA 3EPTA 2WU2A 3SYIA 2V60A 4BK1A 2WHDA 4I58A 4NTEA 4EM4A 4BURA 3UOXA 3IWAA 2A8XA 5JCNA 1QJDA 2B7SA 3AE7A 3FG2P 1F3PA 3IF9A 4OPDA 4OVIA 2B9WA 4C3YA 1O94A 3SX6A 2XLPA 1P2HA 1OJAA 2AAQA 2VRLA 3CNDA 3KA7A 1PBFA 3COXA 2DKHA 1LJ1A 2R0PA 2WDVA 1GTEA 4JY3A 4U8JA 1D4DA 1S3EA 3LZXA 4NEVA 4U2TA 1GRHA 1S7MA 4USRA 3UKKA 5JCKA 3M12A 3P4SA 3UKAA 1LQTA 3GDNA 5KVHA 1RP0A 1Y56B 3UTEA 2JB3A 3UTHA 2YLZA 2C75A 3QFBA 3S5WA 4K5RA 4TLXA 1MOKA 4DNAA 2ACZA 2EQ9A 2BACA 4H2PA 2JB2A 2JBVA 3Q6JA 2XVHA 3ICSA 2YQUA 4CCQA 3C4NA 4X9NA 3G5QA 3AD8B 4GF7A 2X8HA 5DBJA 2R0GA 1BZLA 3EAOA 1K0JA 5EB4A 1DOCA 1GRGA 1L9CA 4GDEA 4YKFA 4CBQA 2C3DA 1GTHA 1E39A 2YM2A 1PBDA 2BS3A 3AEBA 2GVCA 3NG7X 4FK1C 1L9EA 4GCMA 4H2QA 2ZZ0A 2GR1A 1TDOA 4GUVA 4OPTA 4OPUA 2Y6RA 3T14A 3UCLA 1D7YA 1TYPA 1DJQA 2C65A 4RG4A 2OALA 2B9XA 1Y56A 1PXCA 4TM4A 3FIMB 1KSSA 1Y0PA 2XFNA 2E4GA 3ICRA 1RSGA 2QCUA 3B6DA 3IC9A 4YTMA 1NPXA 3O0HA 1CF3A 4ICYA 4AOXA 1F8WA 4PAAA 4AOSA 3BNUA 2TPRA 3AYJA 1S3BA 1GV4A 5KMQA 4J57A 1B5QA 1NHPA 1Q1RA 2TMDA 2BK5A 5BVAA 2NVKX 1E6EA 5FS8A 3HZLA 2Q0KA 1KF6A 4Y4NA 4DSGA 3KLJA 3F8PA 3AEEA 3OZ2A 4GDPA 3P4QA 4H2NA 3EF6A 4K7ZA 3NYFA 4A5LA 1FECA 4YXDA 1MO9A 1LPFA 3K7TA 1TDFA 4JN9A 1DNCA 1ZY8A 4H4RA 3LOVA 1NG4A 5IPYA 5FMHA 2WP5A 2PYXA 1K4QA 1VDCA 2WS3A 3GSIA 5M10A 2R0CA 4M52A 4CCRA 4OPIA 2YVFA 2H88A 3PVCA 3NK0X 4Z44A 1LV0A 3SXIA 4D04A 1OJTA 2QA2A 2FJBA 4IVOB 5IQ1A 3UP4A 2XLSA 1JEHA 2CULA 4ZCDA 3UKFA 3P4RA 2C73A 3JSKA 4G6HA 4G73A 5HXIA 3DJGX 1CBOA 1YQ3A 2BS2A 2VVLA 1M6IA 3C4AA 3P1WA 1ONFA 4YWOA 4OPGA 4Z26A 1ZOVA 1VQWA 3VR8A 3SFDA 1OJ9A 2BC0A 3SZ0A 3CGBA 1GXFA 1EL5A 4K5SA 2BK4A 2WESA 1PBCA 3CNJA 1QLBA 2VZ2A 3L1RA 2YG3A 3AE6A 2GMJA 4OPCA 3VRDB 3AE8A 1FEBA 2JK6A 1ZMCA 1GRTA 4J2WA 1ZK7A 3D9XA 2C72A 2FBWA 1KFYA 1NENA 1PN0A 4A6NB 3NN6X 5KOWA 2I0ZA 4B64A 3ATRA 2YWLA 1JRYA 2RGJA 2C7GA 5C3JA 4IV9A 1DJNA 2B7RA 4UP3A 1CJ4A 3VRBA 4Y4MA 3UKPA 1TDNA 4BK3A 3K7MX 4H4XA 4HA6A 4TM3A 4TM1A 3M13A 3AE1A 2GQWA 1VRQB 4U8KA 4AT2A 3GYJA 4WCTA 2VOUA 3F8DA 2X8GA 2C76A 3D8XA 1NG3A 1FEAA 1E1NA 4KPRA 4P9SA 4O5UA 4REKA 4J33A 3HYWA 5KXJA 2E1MA 3AEGA 3QVRA 1IUXA 4G9KA 3T2KA 3NTAA 4IA6A 1GEUA 3QSEA 2BRYA 4YKGA 3SFEA 3DA1A 1RYIA 3VR9A 2GF3A 3BI2A 1REOA 2W0HA 2R4JA 4UDRA 4RSLA 4JY2A 3GYXA 4XWRA 2RABA 4ZCCA 2YAUA 3ITJA 4CNKA 5U1OA 1F6MA 1COYA 2XFOA 2YLWA 3CPHG 2WDRA 4H4QA 5EB5A 3ALLA 1PBEA 4GR1A 3SQPA 3ABVA 4EMIA 2JB1A 4GRTA 3UKLA 1UKVG 2XFPA 3M0OA 1B4VA 1IUWA 1GALA 2GEWA 2WP9A 2RGHA 3NTDA 1PHHA 2ARDA 3PS9A 3GWDA 2OLOA 2PHHA 3CMMA 4NTDA 2WU5A 5CQFA 4OPLA 4RG3A 2B9YA 1N4VA 4IVMB 4X4JA 4BK2A 3EANA 2VVLG 3AD9B 4H4ZA 1IUSA 4BJYA 3UP5A 2HQMA 3DJDA 3P4PA 1H7XA 3QFAA 4A6NA 2CDUA 4PABA 5LV9A 1O5WA 2Z5YA 1K0LA 4AP3A 3AWIA 4DGKA 3VQRA 1CJCA 3AE3A 1CC2A 1B37A 1P2EA 2XYOA 4TLZA 4O5QA 3SM8A 3ZYXA 4EMWA 3HYVA 2WDQA 3GRSA 2Z5XA 2XFQA 2BA9A 2WEUA 2XFUA 2R9ZA 5HHFA 3KKJA 2BK3A 1PJ5A 1ZOYA 4CY6A 3AE9A 4Z2TA 4ZN0A 3C96A 4K22A 2CVJA 2V5ZA 3CTYA 2FJDA 4U8NA 2XLTA 1CC4A 4TM0A 2Q7VA 3CIRA 4NEWA 1ZMDA 1GOSA 3AE4A 3T31A 1XDIA 1BF3A 4B66A 1PJ7A 4K2XA 1QO8A 2APGA 1KN0A 1NHRA 3DK4A 1LTXR 1JU2A 2XVJA 3RP8A 2Q0LA 4YSZA 2GAGB 2ZBWA 3FPZA 3ICTA 4H4PA 2GH5A 1FL2A 2YG5A 2A87A 2CFYA 4K8DA 1H86A 2GB0A 2X50A 3DMEA 3AE5A 3UKQA 1H84A 1H82A 4YSHA 3GD3A 4B65A 1BGJA 3GD4A 5HY5A 4J31A 1E1MA 1VG0A 1JNZA 1JNRA 4E0VA 1D5TA 4GAVA 1O95A 3K7QX 1TDEA 1GSNA 1AOGA 4JNQA 2XVEA 3NRNA 3PO7A 3AYLA 2YLTA 4EQXA 2XVFA 4LU6A 1DOEA 1EL7A 1H6VA 2BC1A 1JRXA 4YTPA 1KDGA 3H8IA 5J60A 4U8OA 5KMSA 5L46A 3NGCX 3WE0A 3LZWA 1CJ2A 3QSSA 1CC6A 2YR4A 3T2ZA 3UTGA 3NT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WET A;  4A79 A;  4H7U A;  3AD7 B;  2EQ8 A;  4C5O A;  3OC4 A;  2BAB A;  3NIX A;  1EL9 A;  3T37 A;  1EBD A;  4N9X A;  4LII A;  4EQR A;  3KVE A;  1W4X A;  4H4V A;  3RNM A;  4DSH A;  1N1P A;  5C2T A;  4Z43 A;  1Q9I A;  5JCL A;  3FBS A;  1D4C A;  2FJA A;  3NYE A;  1HYU A;  4USQ A;  2WPE A;  5HYM A;  1CHU A;  1YY5 A;  1GT8 A;  3P9U A;  1IUV A;  1GER A;  1D7L A;  3BNM A;  3RP6 A;  4A7A A;  4Z25 A;  2C3C A;  1X31 B;  2WP6 A;  3B3R A;  2XLU A;  1NDA A;  2XCG A;  3ISH A;  4CRT A;  4U8P A;  2YLS A;  2X8C A;  3DK8 A;  1ZX9 A;  1GRE A;  5KWF A;  5FS6 A;  4Z2U A;  3DJE A;  3DK9 A;  3KD9 A;  1PJ6 A;  1TDK A;  3NYC A;  1NHQ A;  4B68 A;  4EIP A;  3E1T A;  1S2Y A;  3CPJ G;  1DOD A;  2BXS A;  2DKI A;  4U2L A;  4LA1 A;  1GND A;  1OJD A;  2WQY A;  3V3N A;  2WOI A;  4FX9 A;  5JCI A;  2VRM A;  3CGD A;  4JDR A;  2WOW A;  2B76 A;  1GRA A;  4C77 A;  4YSX A;  2XDO A;  3QVP A;  5BRT A;  1IJH A;  4YSY A;  2OAM A;  2YVJ A;  2WPF A;  2GQF A;  2C66 A;  1L9D A;  2GMH A;  3NK2 X;  3DGZ A;  4MJW A;  4FK1 A;  3NK1 X;  5BUL A;  3VRA A;  3KU9 A;  1DXL A;  1CL0 A;  1OJC A;  3CGC A;  1KSU A;  3CN8 A;  3AEF A;  4B69 A;  1JRZ A;  4FDC B;  3ZDN A;  4H4U A;  5U25 A;  3LB8 A;  1BGN A;  2R4E A;  3NH3 X;  4B1B A;  4CY8 A;  4B63 A;  3G5R A;  3GDP A;  3H4K A;  1CJ3 A;  5KRQ A;  3ADA B;  2YG6 A;  4Y4L A;  2OLN A;  3K30 A;  1ELI A;  1TRB A;  1TYT A;  2R45 A;  3SGL A;  1M64 A;  2GV8 A;  5GRT A;  1IUT A;  1N4U A;  4EQS A;  1H81 A;  2GAH B;  3L8K A;  1N4W A;  3I6D A;  3QSM A;  1ZP0 A;  3UKH A;  2EQ6 A;  2YLR A;  3UOZ A;  2BYB A;  3NKS A;  4JNA A;  1FCD A;  2O9Z A;  3GMB A;  2NPX A;  5KVI A;  3RHA A;  4UDP A;  3GMC A;  3KPF A;  1BKW A;  2R46 A;  4U2S A;  4C74 A;  1H7W A;  4ECH A;  4A99 A;  2BS4 A;  2GRT A;  1PBB A;  1D4E A;  1ZKQ A;  2E5V A;  5J7X A;  3IHG A;  1PXA A;  2IVD A;  2YR6 A;  4ADW A;  2AQJ A;  5ER0 A;  3G5S A;  2EQ7 A;  5EOW A;  3BI5 A;  3URH A;  2WOV A;  2YVG A;  2AR8 A;  3AEC A;  2GR2 A;  2WBA A;  2F5Z A;  3GYI A;  3NHO X;  1KNP A;  3NNE A;  4WX1 A;  1V59 A;  1S2Q A;  1LVL A;  4J36 A;  1YQ4 A;  3RP7 A;  3R9U A;  3AXB A;  1DOB A;  2XVI A;  2YLX A;  3ALJ A;  1ZDL A;  3BHF A;  3I3L A;  1GET A;  2V3B A;  4YT0 A;  1E1K A;  2XLR A;  2QAE A;  2BCP A;  2VQB A;  3S61 A;  1PXB A;  2WPC A;  1F8R A;  2YR5 A;  4BJZ A;  1E7P A;  3Q9T A;  4APN A;  2H89 A;  3V3O A;  4EQW A;  4XXG A;  2IVE A;  5M0Z A;  1XPQ A;  3F8R A;  4Z2R A;  3CPI G;  3UOV A;  1YKJ A;  1JOA A;  1PDH A;  2C64 A;  4H4Y A;  4U8M A;  4UDQ A;  3FMW A;  4H4W A;  4A9W A;  1GRF A;  3AB1 A;  1GPE A;  4H4S A;  4XWZ A;  2VQ7 A;  1MXT A;  2C67 A;  4YTN A;  1GES A;  1NEK A;  2X3N A;  4H4T A;  2VVM A;  4H2R A;  4JQ9 A;  1NAA A;  3LXD A;  2YG4 A;  3CNS A;  2GR0 A;  3GRT A;  1H83 A;  4I59 A;  4Z24 A;  5FS7 A;  3AEA A;  2OA1 A;  1GRB A;  2BCG G;  3AED A;  3GWF A;  1KNR A;  1YQZ A;  1B8S A;  4U8I A;  1XAN A;  2YG7 A;  2X99 A;  4C3X A;  4B67 A;  3CGE A;  4EMJ A;  2IID A;  3ALM A;  4J34 A;  4OCG A;  2Y6Q A;  3II4 A;  3BHK A;  2ZZB A;  3BI4 A;  3D1C A;  1PS9 A;  5CKU A;  3LJP A;  3H8L A;  4D03 A;  2JKC A;  4HB9 A;  2J3N A;  1F8S A;  3NLC A;  2GR3 A;  2A89 A;  2YM1 A;  3IHM A;  1SEZ A;  4A65 A;  1IUU A;  5KOX A;  4KX6 A;  3RED A;  1VG9 A;  4IA5 A;  3ATQ A;  5U63 A;  3CNT A;  4AT0 A;  1K0I A;  2C70 A;  2V61 A;  2Q6U A;  3LAD A;  3V76 A;  2V6O A;  2QA1 A;  5EBK A;  1Z6L A;  2JAE A;  2BXR A;  3UTF A;  1E1L A;  3CNP A;  4EIQ A;  1XHC A;  3AE2 A;  1FOH A;  3QJ4 A;  4EM3 A;  1NHS A;  5IQ4 A;  3UOY A;  4U8L A;  3AYI A;  1EL8 A;  2FJE A;  2V3A A;  5BUK A;  3DJJ A;  2UZZ A;  4J56 A;  3NN0 X;  4AP1 A;  5FS9 A;  1L0V A;  1Q1W A;  1BWC A;  4NTC A;  4NZH A;  4H50 A;  4CNJ A;  3DGH A;  3DH9 A;  5TR3 A;  2ZZC A;  1LQU A;  5GSN A;  4X9M A;  5JCM A;  4BV6 A;  2RGO A;  3EPT A;  2WU2 A;  2V60 A;  4BK1 A;  2WHD A;  4I58 A;  4NTE A;  4EM4 A;  4BUR A;  3UOX A;  3IWA A;  2A8X A;  5JCN A;  1QJD A;  2B7S A;  3AE7 A;  3FG2 P;  1F3P A;  3IF9 A;  4OPD A;  4OVI A;  2B9W A;  4C3Y A;  1O94 A;  2XLP A;  1P2H A;  1OJA A;  2AAQ A;  2VRL A;  3CND A;  3KA7 A;  1PBF A;  3COX A;  2DKH A;  1LJ1 A;  2R0P A;  2WDV A;  1GTE A;  4JY3 A;  4U8J A;  1D4D A;  1S3E A;  3LZX A;  4NEV A;  4U2T A;  1GRH A;  4USR A;  3UKK A;  5JCK A;  3M12 A;  3P4S A;  3UKA A;  1LQT A;  3GDN A;  5KVH A;  1RP0 A;  1Y56 B;  3UTE A;  2JB3 A;  3UTH A;  2YLZ A;  2C75 A;  3QFB A;  3S5W A;  4K5R A;  4TLX A;  1MOK A;  4DNA A;  2ACZ A;  2EQ9 A;  2BAC A;  4H2P A;  2JB2 A;  2JBV A;  3Q6J A;  2XVH A;  3ICS A;  2YQU A;  4CCQ A;  3C4N A;  4X9N A;  3G5Q A;  3AD8 B;  4GF7 A;  2X8H A;  5DBJ A;  2R0G A;  1BZL A;  3EAO A;  1K0J A;  5EB4 A;  1DOC A;  1GRG A;  1L9C A;  4GDE A;  4YKF A;  4CBQ A;  2C3D A;  1GTH A;  1E39 A;  2YM2 A;  1PBD A;  2BS3 A;  3AEB A;  2GVC A;  3NG7 X;  4FK1 C;  1L9E A;  4GCM A;  4H2Q A;  2ZZ0 A;  2GR1 A;  1TDO A;  4GUV A;  4OPT A;  4OPU A;  2Y6R A;  3UCL A;  1D7Y A;  1TYP A;  1DJQ A;  2C65 A;  4RG4 A;  2OAL A;  2B9X A;  1Y56 A;  1PXC A;  4TM4 A;  3FIM B;  1KSS A;  1Y0P A;  2XFN A;  2E4G A;  3ICR A;  1RSG A;  2QCU A;  3B6D A;  3IC9 A;  4YTM A;  1NPX A;  3O0H A;  1CF3 A;  4ICY A;  4AOX A;  1F8W A;  4PAA A;  4AOS A;  3BNU A;  2TPR A;  3AYJ A;  1S3B A;  1GV4 A;  4J57 A;  1B5Q A;  1NHP A;  1Q1R A;  2TMD A;  2BK5 A;  5BVA A;  2NVK X;  1E6E A;  5FS8 A;  3HZL A;  2Q0K A;  1KF6 A;  4Y4N A;  4DSG A;  3KLJ A;  3F8P A;  3AEE A;  3OZ2 A;  4GDP A;  3P4Q A;  4H2N A;  3EF6 A;  4K7Z A;  3NYF A;  4A5L A;  1FEC A;  4YXD A;  1MO9 A;  1LPF A;  3K7T A;  1TDF A;  4JN9 A;  1DNC A;  1ZY8 A;  4H4R A;  3LOV A;  1NG4 A;  5IPY A;  5FMH A;  2WP5 A;  2PYX A;  1K4Q A;  1VDC A;  2WS3 A;  3GSI A;  5M10 A;  2R0C A;  4M52 A;  4CCR A;  4OPI A;  2YVF A;  2H88 A;  3PVC A;  3NK0 X;  4Z44 A;  1LV0 A;  4D04 A;  1OJT A;  2QA2 A;  2FJB A;  4IVO B;  5IQ1 A;  3UP4 A;  2XLS A;  1JEH A;  2CUL A;  4ZCD A;  3UKF A;  3P4R A;  2C73 A;  3JSK A;  5HXI A;  3DJG X;  1CBO A;  1YQ3 A;  2BS2 A;  2VVL A;  1M6I A;  3C4A A;  3P1W A;  1ONF A;  4YWO A;  4OPG A;  4Z26 A;  1ZOV A;  1VQW A;  3VR8 A;  3SFD A;  1OJ9 A;  2BC0 A;  3CGB A;  1GXF A;  1EL5 A;  4K5S A;  2BK4 A;  2WES A;  1PBC A;  3CNJ A;  1QLB A;  2VZ2 A;  3L1R A;  2YG3 A;  3AE6 A;  2GMJ A;  4OPC A;  3VRD B;  3AE8 A;  1FEB A;  2JK6 A;  1ZMC A;  1GRT A;  4J2W A;  1ZK7 A;  2C72 A;  2FBW A;  1KFY A;  1NEN A;  1PN0 A;  4A6N B;  3NN6 X;  5KOW A;  2I0Z A;  4B64 A;  3ATR A;  2YWL A;  1JRY A;  2RGJ A;  2C7G A;  5C3J A;  4IV9 A;  1DJN A;  2B7R A;  4UP3 A;  1CJ4 A;  3VRB A;  4Y4M A;  3UKP A;  1TDN A;  4BK3 A;  3K7M X;  4H4X A;  4HA6 A;  4TM3 A;  4TM1 A;  3M13 A;  3AE1 A;  2GQW A;  1VRQ B;  4U8K A;  4AT2 A;  3GYJ A;  4WCT A;  2VOU A;  3F8D A;  2X8G A;  2C76 A;  3D8X A;  1NG3 A;  1FEA A;  1E1N A;  4KPR A;  4P9S A;  4O5U A;  4REK A;  4J33 A;  5KXJ A;  2E1M A;  3AEG A;  3QVR A;  1IUX A;  3NTA A;  4IA6 A;  1GEU A;  3QSE A;  4YKG A;  3SFE A;  3DA1 A;  1RYI A;  3VR9 A;  2GF3 A;  3BI2 A;  1REO A;  2W0H A;  2R4J A;  4UDR A;  4RSL A;  4JY2 A;  4XWR A;  2RAB A;  4ZCC A;  2YAU A;  3ITJ A;  4CNK A;  5U1O A;  1F6M A;  1COY A;  2XFO A;  2YLW A;  3CPH G;  2WDR A;  4H4Q A;  5EB5 A;  3ALL A;  1PBE A;  4GR1 A;  3SQP A;  3ABV A;  4EMI A;  2JB1 A;  4GRT A;  3UKL A;  1UKV G;  2XFP A;  3M0O A;  1B4V A;  1IUW A;  1GAL A;  2GEW A;  2WP9 A;  2RGH A;  3NTD A;  1PHH A;  2ARD A;  3PS9 A;  3GWD A;  2OLO A;  2PHH A;  5CQF A;  4NTD A;  2WU5 A;  4OPL A;  4RG3 A;  2B9Y A;  1N4V A;  4IVM B;  4X4J A;  4BK2 A;  3EAN A;  2VVL G;  3AD9 B;  4H4Z A;  1IUS A;  4BJY A;  3UP5 A;  2HQM A;  3DJD A;  3P4P A;  1H7X A;  3QFA A;  4A6N A;  2CDU A;  4PAB A;  5LV9 A;  1O5W A;  2Z5Y A;  1K0L A;  4AP3 A;  3AWI A;  4DGK A;  3VQR A;  1CJC A;  3AE3 A;  1CC2 A;  1B37 A;  1P2E A;  2XYO A;  4TLZ A;  4O5Q A;  3SM8 A;  3ZYX A;  4EMW A;  2WDQ A;  3GRS A;  2Z5X A;  2XFQ A;  2BA9 A;  2WEU A;  2XFU A;  2R9Z A;  5HHF A;  3KKJ A;  2BK3 A;  1PJ5 A;  1ZOY A;  4CY6 A;  3AE9 A;  4Z2T A;  4ZN0 A;  3C96 A;  4K22 A;  2CVJ A;  2V5Z A;  3CTY A;  2FJD A;  4U8N A;  2XLT A;  1CC4 A;  4TM0 A;  2Q7V A;  3CIR A;  4NEW A;  1ZMD A;  1GOS A;  3AE4 A;  1XDI A;  1BF3 A;  4B66 A;  1PJ7 A;  4K2X A;  1QO8 A;  2APG A;  1NHR A;  3DK4 A;  1LTX R;  1JU2 A;  2XVJ A;  3RP8 A;  2Q0L A;  4YSZ A;  2GAG B;  2ZBW A;  3FPZ A;  3ICT A;  4H4P A;  2GH5 A;  1FL2 A;  2YG5 A;  2A87 A;  2CFY A;  4K8D A;  1H86 A;  2GB0 A;  2X50 A;  3DME A;  3AE5 A;  3UKQ A;  1H84 A;  1H82 A;  4YSH A;  3GD3 A;  4B65 A;  1BGJ A;  3GD4 A;  5HY5 A;  4J31 A;  1E1M A;  1VG0 A;  1JNZ A;  1JNR A;  4E0V A;  1D5T A;  1O95 A;  3K7Q X;  1TDE A;  1GSN A;  1AOG A;  4JNQ A;  2XVE A;  3NRN A;  3PO7 A;  3AYL A;  2YLT A;  4EQX A;  2XVF A;  4LU6 A;  1DOE A;  1EL7 A;  1H6V A;  2BC1 A;  1JRX A;  4YTP A;  1KDG A;  3H8I A;  5J60 A;  4U8O A;  5L46 A;  3NGC X;  3WE0 A;  3LZW A;  1CJ2 A;  3QSS A;  1CC6 A;  2YR4 A;  3UTG A;  3NT6 A; 
#chains in the Genus database with same CATH topology
 2PCE A;  2EQ8 A;  3NIX A;  1EBD A;  3OTR A;  4H4V A;  1P43 A;  1D4C A;  2FJA A;  3NYE A;  1YY5 A;  1D7L A;  3BNM A;  3B3R A;  4CRT A;  3RCY A;  3DK8 A;  3A7U A;  5KWF A;  5FS6 A;  1NHQ A;  4B68 A;  1S2Y A;  3CPJ G;  3V3N A;  3PK7 A;  2WOI A;  5JCI A;  2VRM A;  2WOW A;  2B76 A;  4NNJ A;  4C77 A;  1IJH A;  2OAM A;  4FK1 A;  4B69 A;  4H4U A;  3LB8 A;  3NH3 X;  4B1B A;  2YG6 A;  1ELI A;  3MY9 A;  2R45 A;  3SGL A;  2GAH B;  1N4W A;  3I6D A;  3QSM A;  1ZP0 A;  4II3 A;  2CHR A;  3R10 A;  3ZLG A;  1FCD A;  3VCC A;  2NPX A;  5KVI A;  4GIR A;  3RHA A;  3HYX A;  2E5V A;  2AQJ A;  5ER0 A;  5EOW A;  3T9P A;  2WOV A;  5G5H B;  2GR2 A;  1S2Q A;  1LVL A;  1DOB A;  1GET A;  2V3B A;  2XLR A;  3IJI A;  2BCP A;  2VQB A;  1PXB A;  3UJF A;  2YR5 A;  4K1W A;  1BKH A;  3R11 A;  4EQW A;  4XXG A;  3SZF A;  1YKJ A;  1JOA A;  1KKR A;  4H4Y A;  3FMW A;  3BOX A;  3AB1 A;  2VQ7 A;  4YTN A;  1NEK A;  4H4T A;  4H2R A;  2GR0 A;  1RM6 B;  2OA1 A;  4HCH A;  3T2Y A;  3AED A;  3A7R A;  1KNR A;  3UXL A;  1PDZ A;  3CGE A;  3ALM A;  4J34 A;  4OCG A;  4HB9 A;  1SEZ A;  1IUU A;  3VCN A;  3CB3 A;  5U63 A;  3CNT A;  2V6O A;  4KT2 A;  3AE2 A;  3H8A A;  4U8L A;  1EC7 A;  4H19 A;  4E4F A;  5BOE A;  3FYY A;  2C4C A;  4AP1 A;  3DDM A;  4NZH A;  4CNJ A;  5TR3 A;  4E6M A;  1LQU A;  3S47 A;  3SYI A;  1N63 C;  1X2H A;  4BK1 A;  4BUR A;  5JCN A;  1QJD A;  3IF9 A;  4OVI A;  4C3Y A;  1O94 A;  2XLP A;  4K8G A;  2VRL A;  1S3E A;  3LZX A;  4NEV A;  4U2T A;  1GRH A;  3M12 A;  3UKA A;  1LQT A;  3GDN A;  3UTE A;  3QFB A;  2BAC A;  4H2P A;  3TWB A;  3Q6J A;  3ZLF A;  2MNR A;  4H83 A;  3EAO A;  3N4F A;  1L9C A;  4GDE A;  4YKF A;  3PWI A;  2YM2 A;  2BS3 A;  1ECQ A;  4OPU A;  2Y6R A;  1D7Y A;  3BSM A;  1DJQ A;  2C65 A;  2OAL A;  4TM4 A;  2XFN A;  3AMZ A;  2E4G A;  3R25 A;  4F4R A;  1CF3 A;  4JHM A;  1F8W A;  4PAA A;  2P8C A;  2QDD A;  4J57 A;  1NHP A;  5BVA A;  2NVK X;  3FV9 A;  3ZLH A;  4DWD A;  4H2N A;  4A5L A;  4YXD A;  3N6H A;  3K7T A;  1DNC A;  1ZY8 A;  2I5Q A;  5M10 A;  2YVF A;  2XLS A;  2CUL A;  4ZCD A;  2O56 A;  2BS2 A;  3PWG A;  1VQW A;  1OJ9 A;  4IL0 A;  1GXF A;  1EL5 A;  4K5S A;  3FXG A;  2WES A;  4GFI A;  3VRD B;  1GRT A;  3MSY A;  2C72 A;  3MUC A;  4A6G A;  3MKC A;  3UGV A;  2B7R A;  4UP3 A;  2PU1 A;  3UJS A;  4Y4M A;  1BQG A;  4GIS A;  4TM1 A;  3AE1 A;  3NZG A;  4AT2 A;  3NRZ B;  3D8X A;  1E1N A;  4HPN A;  4KPR A;  4P9S A;  4J33 A;  2E1M A;  3AEG A;  1IUX A;  3VDG A;  3NTA A;  4IA6 A;  3S5S A;  3DA1 A;  4G8T A;  1RYI A;  1REO A;  2P3Z A;  4RSL A;  4XWR A;  2YAU A;  5U1O A;  1F6M A;  2JB1 A;  3M0O A;  1B4V A;  1GAL A;  2GEW A;  2WP9 A;  1PHH A;  2ARD A;  3CMM A;  3UJ2 A;  1T3Q C;  4H4Z A;  5FJP A;  3H12 A;  4M6U A;  2CDU A;  1K0L A;  1CJC A;  3AE3 A;  1B37 A;  1P2E A;  2XYO A;  4O5Q A;  3SM8 A;  4DXK A;  1MDR A;  3ZYX A;  2AKZ A;  2XFQ A;  2BA9 A;  1FHV A;  2XFU A;  5HHF A;  4CY6 A;  2W54 A;  3CIR A;  4NEW A;  1ZMD A;  3AE4 A;  3QPE A;  1WYG A;  1P48 A;  1BF3 A;  2OZ8 A;  4K2X A;  1QO8 A;  2APG A;  1JU2 A;  2XVJ A;  1FFU C;  3ICT A;  2GH5 A;  2CFY A;  4K8D A;  2X50 A;  4GME A;  1H84 A;  3GD3 A;  4J31 A;  3UCD A;  3TW9 A;  1JNR A;  1TZZ A;  1AOG A;  4JNQ A;  1XPY A;  2YLT A;  1DOE A;  3DES A;  1JRX A;  4YTP A;  5KMS A;  4U8O A;  3NGC X;  3QSS A;  3NT6 A;  2OLA A;  2BAB A;  4N9X A;  3KVE A;  4DSH A;  5JCL A;  4USQ A;  2AL2 B;  2WPE A;  1CHU A;  4YWS A;  3P9U A;  1JDF A;  1GER A;  4Z25 A;  2C3C A;  2WP6 A;  3FJ4 A;  3ISH A;  3OZY A;  2XCG A;  2PMQ A;  4U8P A;  3L5O A;  3I4K A;  1SJB A;  5BOF A;  1ZX9 A;  1GRE A;  3DGB A;  4Z2U A;  3KD9 A;  1TDK A;  3E1T A;  3THU A;  3HW2 A;  3STP A;  2BXS A;  4JDR A;  1GRA A;  3ENL A;  2XDO A;  5BRT A;  3BJS A;  2YVJ A;  4GYP A;  3QKE A;  4MJW A;  1OJC A;  3NVY B;  3CN8 A;  3AEF A;  2ZC8 A;  4CY8 A;  3G5R A;  3GDP A;  2MUC A;  5KRQ A;  3ADA B;  3K30 A;  1TYT A;  3UCC A;  3UJR A;  2EQ6 A;  2BYB A;  3NKS A;  1BKW A;  4C74 A;  1L8P A;  2BS4 A;  3U9I A;  3R07 C;  1ZKQ A;  3IHG A;  1KKO A;  3AEC A;  3SN1 A;  3GYI A;  3NHO X;  3NNE A;  4FI4 A;  1JCT A;  3AXB A;  3ALJ A;  3I6T A;  2YLX A;  4YT0 A;  5IDZ A;  5KMR A;  2QAE A;  2WPC A;  1F8R A;  2XH2 A;  1E7P A;  3EKG A;  3V3O A;  4K2S A;  4Z2R A;  3F8R A;  4IP5 A;  4E4U A;  4UDQ A;  1GRF A;  1GES A;  2GGH A;  4JQ9 A;  1NAA A;  2YG4 A;  3EUB 3;  1H83 A;  4Z24 A;  2XH0 A;  1GRB A;  3GWF A;  2PS2 A;  3KPK A;  1XAN A;  2POZ A;  2X99 A;  3II4 A;  1RVK A;  2ZZB A;  3D1C A;  5CKU A;  3LJP A;  2J3N A;  4TVY A;  2A89 A;  2YM1 A;  3IHM A;  4KX6 A;  4HN8 A;  4IA5 A;  3ATQ A;  2C70 A;  2QA1 A;  2W3R A;  3UTF A;  1MNS A;  4GYP C;  5IQ4 A;  1XHC A;  3QJ4 A;  3UOY A;  4G74 A;  4FP1 A;  3AYI A;  1EL8 A;  2FJE A;  3DJJ A;  4J56 A;  3NN0 X;  2HZG A;  2NQL A;  3SY4 A;  4NTC A;  5FJR A;  2ZZC A;  5JCM A;  4BV6 A;  2RGO A;  4I58 A;  3RRA A;  3UOX A;  3IWA A;  1JRO A;  2B7S A;  3NFU A;  2B9W A;  4DN1 A;  1OJA A;  3KA7 A;  3CND A;  3COX A;  1LJ1 A;  1GTE A;  1D4D A;  2QJN A;  4DHG A;  3P4S A;  2YLZ A;  2C75 A;  4TLX A;  4DNA A;  1R6W A;  2XVH A;  3C4N A;  3G5Q A;  2X8H A;  5DBJ A;  1K0J A;  1GRG A;  4CBQ A;  2PP3 A;  2C3D A;  3AEB A;  2E5A A;  4KWS A;  4FK1 C;  1L9E A;  4OPT A;  3UCL A;  1TYP A;  2B9X A;  1Y0P A;  3ICR A;  1NPX A;  4AOX A;  4AOS A;  2E3T A;  3VC6 A;  3DG3 A;  1KF6 A;  4DSG A;  3KLJ A;  4IZG A;  3RR1 A;  3OZ2 A;  3SR6 B;  4K7Z A;  3NYF A;  3B97 A;  3LOV A;  5FMH A;  2PYX A;  2WS3 A;  2R0C A;  3PVC A;  3NK0 X;  1LV0 A;  4D04 A;  3UP4 A;  3UKF A;  2C73 A;  4G73 A;  5HXI A;  4GGH A;  1CBO A;  3D47 A;  3OZM A;  1ONF A;  4YWO A;  1FHU A;  3SZ0 A;  1EBH A;  1PBC A;  2YG3 A;  3TJI A;  4OPC A;  4J2W A;  1PN0 A;  4A6N B;  4B64 A;  3ATR A;  2YWL A;  3DFY A;  2XH4 A;  3ETR B;  3M13 A;  2GQW A;  1VRQ B;  4U8K A;  3GYJ A;  2PP1 A;  3F8D A;  4REK A;  3QVR A;  3QSE A;  3IJQ A;  3SFE A;  2GF3 A;  3JW7 A;  1SJD A;  2R4J A;  4UDR A;  4JY2 A;  4ZCC A;  5EB5 A;  3CPH G;  2WDR A;  4H4Q A;  4ENL A;  4GR1 A;  3SQP A;  3IJL A;  4HCL A;  5J04 A;  4GRT A;  2XFP A;  1IUW A;  2PU0 A;  3GWD A;  2PHH A;  3AD9 B;  3OP2 A;  2HQM A;  1EBG A;  3FVD A;  3AWI A;  3VQR A;  4ZCW A;  1CC2 A;  3TWA A;  2OPJ A;  4EMW A;  3HYV A;  3U4F A;  2WDQ A;  3TQP A;  4ROP A;  3KKJ A;  2PGW A;  4ZN0 A;  3MZN A;  2Q7V A;  1GOS A;  3T31 A;  1PJ7 A;  1KN0 A;  1NHR A;  3DK4 A;  3Q4D A;  3TOY A;  1FL2 A;  1H82 A;  4YSH A;  3CXO A;  1BGJ A;  5HY5 A;  1D5T A;  3K7Q X;  1TE6 A;  2XVE A;  2PPG A;  3PO7 A;  3FCP A;  1H6V A;  3H8I A;  5J60 A;  3SN4 A;  3UTG A;  4A79 A;  1PDY A;  4H7U A;  3ZVH B;  4C5O A;  3OC4 A;  1EL9 A;  1W4X A;  2XGZ A;  3N4E A;  1N1P A;  5C2T A;  1Q9I A;  3FBS A;  2OX4 A;  5HYM A;  2FKP A;  1GT8 A;  1IUV A;  4A7A A;  2W55 A;  3K1G A;  1FFV C;  4KPL A;  3T6C A;  3DJE A;  3NYC A;  4HNC A;  3CGD A;  3ZVH A;  4YSX A;  1WUF A;  4YSY A;  1L9D A;  1H2I A;  2GMH A;  1N60 C;  3NK1 X;  5BUL A;  3NVW B;  3KU9 A;  1DTN A;  3IK4 A;  1DXL A;  5U25 A;  1BGN A;  3CXB A;  3H4K A;  1CJ3 A;  2XH7 A;  2OLN A;  1H81 A;  3UKH A;  4IP4 A;  3UOZ A;  2OO6 A;  3GMB A;  1N61 C;  3GMC A;  3KPF A;  2R46 A;  4ECH A;  3SQS A;  1H7W A;  4A99 A;  2HXU A;  3DFH A;  5J7X A;  4KEM A;  2IVD A;  2YR6 A;  3TCS A;  3G5S A;  3AN1 A;  3QTP A;  3BI5 A;  3URH A;  2YVG A;  3UXK A;  1STZ A;  2AR8 A;  2WBA A;  1KNP A;  4II2 A;  4WX1 A;  3RP7 A;  3R9U A;  2XVI A;  3DG7 A;  3I3L A;  4NWZ A;  3S61 A;  2OZ3 A;  1MDL A;  3DG6 A;  3Q9T A;  2H89 A;  1XPQ A;  3CPI G;  2C64 A;  4U8M A;  4X2P A;  4A9W A;  4H4S A;  2OQY A;  3T4W A;  2VVM A;  1XS2 A;  4BJY A;  3GRT A;  1B8S A;  5KMP A;  3CYJ A;  4C3X A;  1KCZ A;  4B67 A;  4EMJ A;  2IID A;  2Y6Q A;  3RIT A;  1PS9 A;  3H8L A;  2JKC A;  3GY1 A;  3NLC A;  2GR3 A;  4A65 A;  4JN8 A;  3RED A;  1VG9 A;  2W3S A;  4AT0 A;  4G6G A;  2Q6U A;  3LAD A;  3V76 A;  4GGB A;  1Z6L A;  2BXR A;  2QQ6 A;  1E1L A;  3CNP A;  4EIQ A;  1FOH A;  1NHS A;  2UZZ A;  5FS9 A;  3SN0 A;  1Q1W A;  1BWC A;  2QJM A;  3DH9 A;  5GSN A;  1TKK A;  2WU2 A;  4NTE A;  5FJO A;  4EIP A;  2A8X A;  3AE7 A;  3FG2 P;  4OPD A;  3SX6 A;  1P2H A;  1PBF A;  2DKH A;  2P8B A;  4U8J A;  4DX3 A;  4EWJ A;  1S7M A;  1ZXI C;  4USR A;  3UKK A;  5JCK A;  4MGG A;  5KVH A;  2JB3 A;  3UTH A;  3S5W A;  4A35 A;  2ACZ A;  2EQ9 A;  3ICS A;  2YQU A;  3AD8 B;  4GF7 A;  2R0G A;  1BZL A;  1KD0 A;  1DOC A;  1SJC A;  2ONE A;  2OG9 A;  3A7A A;  1GTH A;  3NG7 X;  1PBD A;  2GVC A;  3NO1 A;  4GCM A;  4H2Q A;  2ZZ0 A;  1TDO A;  2PP0 A;  3GD6 A;  3NVV B;  1RSG A;  1SB3 B;  3IC9 A;  4ICY A;  3O0H A;  2TPR A;  3AYJ A;  1S3B A;  1GV4 A;  3DEQ A;  4JN7 A;  1B5Q A;  4DYE A;  1Q1R A;  4IL2 A;  2GGG A;  5FS8 A;  2Q0K A;  2OFJ A;  3AEE A;  3P4Q A;  3EF6 A;  1LPF A;  1TDF A;  4H4R A;  4ZA0 A;  2WP5 A;  1VDC A;  3GSI A;  2PSN A;  4OPI A;  4E8G A;  2HNE A;  3SXI A;  2QA2 A;  3QN3 A;  1JEH A;  3P4R A;  3DJG X;  1YQ3 A;  1M6I A;  3C4A A;  4Z26 A;  1ZOV A;  3VR8 A;  3SFD A;  2BC0 A;  3V3W A;  3CGB A;  3ES8 A;  3SJN A;  2BK4 A;  1QLB A;  2ZAD A;  3L1R A;  3AE6 A;  1V97 A;  2GMJ A;  4IHC A;  3VA8 A;  2QVH A;  3AE8 A;  2OVL A;  1FEB A;  2JK6 A;  2FBW A;  3B9J B;  5KOW A;  2I0Z A;  2DW7 A;  1JRY A;  2C7G A;  5C3J A;  1DJN A;  3R1Z A;  3VRB A;  1TDN A;  4BK3 A;  2VOU A;  1NG3 A;  3HYW A;  3I6E A;  3T2K A;  1GEU A;  2BRY A;  3VR9 A;  2QJJ A;  3BI2 A;  2RAB A;  4CNK A;  1COY A;  3ALL A;  1PBE A;  3NS1 B;  3MWC A;  2OQH A;  1UKV G;  2RGH A;  1N5X A;  2OLO A;  4Z17 A;  2WU5 A;  4OPL A;  4RG3 A;  3TTE A;  2B9Y A;  1N4V A;  4X4J A;  4BK2 A;  3EAN A;  2VVL G;  3TJ4 A;  1IUS A;  3UP5 A;  3DJD A;  3P4P A;  1H7X A;  3QFA A;  4A6N A;  2Z5Y A;  4DGK A;  1F9C A;  5ENL A;  5FJT A;  2Z5X A;  3P93 A;  2WEU A;  3V4B A;  3AM9 A;  2BK3 A;  4Z2T A;  3CAW A;  1NU5 A;  2CVJ A;  2XLT A;  1CC4 A;  1ELS A;  1XDI A;  4B66 A;  3ES7 A;  2Q0L A;  4YSZ A;  2GAG B;  4H4P A;  2GSH A;  2A87 A;  1H86 A;  2GB0 A;  3DME A;  4B65 A;  2QGY A;  2AL1 A;  1E1M A;  2GDQ A;  2PTZ A;  4E0V A;  4GAV A;  1TDE A;  3CT2 A;  3AYL A;  1ONE A;  1KDG A;  1MRA A;  5L46 A;  3WE0 A;  3LZW A;  4Z1Y A;  1CJ2 A;  1CC6 A;  1N62 C;  3GD4 A;  2WET A;  3AD7 B;  2BRA A;  3T37 A;  4LII A;  4EQR A;  6ENL A;  3RNM A;  3V5F A;  4Z43 A;  2GGI A;  1HYU A;  3H70 A;  3SZW A;  3RP6 A;  1X31 B;  2OKT A;  2XLU A;  1NDA A;  2PTX A;  2YLS A;  2X8C A;  2PTY A;  3DK9 A;  1PJ6 A;  2POD A;  1X2G A;  1DOD A;  2DKI A;  4U2L A;  4LA1 A;  1GND A;  1OJD A;  2WQY A;  4FX9 A;  3QVP A;  3CK5 A;  2WPF A;  1R0M A;  2C66 A;  2GQF A;  3NK2 X;  3DGZ A;  3VRA A;  3EEZ A;  1CL0 A;  3CGC A;  1KSU A;  1JRZ A;  4FDC B;  3ZDN A;  2R4E A;  2HXT A;  2QDE A;  2FYM A;  4B63 A;  1SJA A;  4Y4L A;  1TRB A;  1M64 A;  2GV8 A;  5GRT A;  1IUT A;  1N4U A;  4EQS A;  3L8K A;  1IYX A;  2YLR A;  4JNA A;  2O9Z A;  3HRD C;  4UDP A;  4U2S A;  2GRT A;  1PBB A;  1D4E A;  5EU9 A;  1PXA A;  4ADW A;  3SZC A;  2EQ7 A;  2RDX A;  2F5Z A;  1V59 A;  4J36 A;  1YQ4 A;  1W6T A;  3N6J A;  3BHF A;  1ZDL A;  3T8Q A;  5G5G B;  1E1K A;  3DIP A;  4BJZ A;  4APN A;  3NVZ B;  2IVE A;  5M0Z A;  3UOV A;  1PDH A;  4H4W A;  1GPE A;  4XWZ A;  1MXT A;  2C67 A;  1JPM A;  4J3Z A;  2X3N A;  4TVW A;  3LXD A;  3CNS A;  3SBF A;  4I59 A;  5FS7 A;  3AEA A;  2BCG G;  1YQZ A;  4U8I A;  2YG7 A;  5KNL A;  3JZU A;  3BHK A;  3T0K A;  2OZT A;  3BI4 A;  4D03 A;  1YEY A;  1F8S A;  2GGE A;  5KOX A;  3P3B A;  3P0W A;  1K0I A;  2V61 A;  5EBK A;  4GAP A;  2JAE A;  5JRB A;  4EM3 A;  1WUE A;  2PTW A;  2V3A A;  5BUK A;  1JPD X;  3PG6 A;  3KUM A;  1L0V A;  3GO2 A;  4H50 A;  7ENL A;  3DGH A;  4X9M A;  1JRP A;  1VDV A;  3EPT A;  2V60 A;  2WHD A;  4EM4 A;  1F3P A;  4H2H A;  2AAQ A;  4H1Z A;  2WDV A;  2R0P A;  4JY3 A;  1EC9 A;  3H7V A;  1RP0 A;  1Y56 B;  3RO6 A;  4K5R A;  2GL5 A;  1MOK A;  2JB2 A;  2JBV A;  4CCQ A;  3ZVI A;  4X9N A;  2PA6 A;  2P0I A;  4IT1 A;  3JVA A;  5EB4 A;  3PFR A;  1NEL A;  1E39 A;  3R0U A;  2GR1 A;  4GUV A;  3T14 A;  4RG4 A;  1Y56 A;  1PXC A;  3FIM B;  1KSS A;  2QCU A;  3B6D A;  4YTM A;  3OPS A;  3BNU A;  5KMQ A;  4HYR A;  3D46 A;  2P88 A;  4G7F A;  3HPF A;  2TMD A;  2BK5 A;  1E6E A;  3HZL A;  4Y4N A;  3F8P A;  4GDP A;  1FEC A;  1MO9 A;  3R0K A;  4JN9 A;  1NG4 A;  5IPY A;  1K4Q A;  4E5T A;  4M52 A;  4CCR A;  2H88 A;  4Z44 A;  1OJT A;  2FJB A;  4IVO B;  5IQ1 A;  3JSK A;  4G6H A;  2VVL A;  4MMW A;  3GC2 A;  3P1W A;  4OPG A;  3CNJ A;  1OEP A;  2VZ2 A;  3NXL A;  1ZMC A;  1ZK7 A;  3D9X A;  1KFY A;  1NEN A;  3VC5 A;  3NN6 X;  2RGJ A;  2AL2 A;  4IV9 A;  1CJ4 A;  1E9I A;  3UKP A;  2PGE A;  3K7M X;  4H4X A;  4HA6 A;  4TM3 A;  2XSX A;  4WCT A;  2X8G A;  2C76 A;  1FIQ B;  1FEA A;  4O5U A;  5KXJ A;  3RGT A;  4G9K A;  4YKG A;  3QLD A;  2W0H A;  3GYX A;  3ITJ A;  4MKS A;  2XFO A;  2YLW A;  5FJU A;  3ABV A;  4HCD A;  4EMI A;  3UKL A;  3V5C A;  3NTD A;  3PS9 A;  5CQF A;  3DER A;  4NTD A;  4IVM B;  4M0X A;  4J1O A;  1N5W C;  4PAB A;  5LV9 A;  1O5W A;  3Q45 A;  4TLZ A;  4HNL A;  3GRS A;  2R9Z A;  1PJ5 A;  1ZOY A;  3AE9 A;  3C96 A;  1FO4 A;  4K22 A;  2V5Z A;  3CTY A;  2FJD A;  4U8N A;  4TM0 A;  3UJE A;  3MQT A;  1LTX R;  3RP8 A;  2ZBW A;  3FPZ A;  4A3R A;  2YG5 A;  3VFC A;  1VQZ A;  3AE5 A;  3UKQ A;  2GGJ A;  1VG0 A;  1JNZ A;  1O95 A;  4ZOH B;  1GSN A;  2DW6 A;  1MUC A;  3NRN A;  4EQX A;  2XVF A;  4LU6 A;  2AKM A;  1EL7 A;  3OW1 A;  3SSZ A;  2BC1 A;  1EC8 A;  4AP3 A;  2YR4 A;  3T2Z A; 
#chains in the Genus database with same CATH homology
 2WET A;  4A79 A;  4H7U A;  3AD7 B;  2EQ8 A;  2BRA A;  4C5O A;  3OC4 A;  2BAB A;  3NIX A;  1EL9 A;  3T37 A;  1EBD A;  4N9X A;  4LII A;  4EQR A;  3KVE A;  1W4X A;  4H4V A;  3RNM A;  4DSH A;  1N1P A;  5C2T A;  4Z43 A;  1Q9I A;  5JCL A;  3FBS A;  1D4C A;  2FJA A;  3NYE A;  1HYU A;  4USQ A;  2WPE A;  5HYM A;  1CHU A;  1YY5 A;  3SZW A;  1GT8 A;  3P9U A;  1IUV A;  1GER A;  1D7L A;  3BNM A;  3RP6 A;  4A7A A;  4Z25 A;  2C3C A;  1X31 B;  2WP6 A;  3B3R A;  2XLU A;  1NDA A;  2XCG A;  3ISH A;  4CRT A;  4U8P A;  2YLS A;  3L5O A;  2X8C A;  3DK8 A;  1ZX9 A;  1GRE A;  5KWF A;  5FS6 A;  4Z2U A;  3DJE A;  3DK9 A;  3KD9 A;  1PJ6 A;  1TDK A;  3NYC A;  1NHQ A;  4B68 A;  4EIP A;  3E1T A;  1S2Y A;  3CPJ G;  1DOD A;  2BXS A;  2DKI A;  4U2L A;  4LA1 A;  1GND A;  1OJD A;  2WQY A;  3V3N A;  2WOI A;  4FX9 A;  5JCI A;  2VRM A;  3CGD A;  4JDR A;  2WOW A;  2B76 A;  1GRA A;  4NNJ A;  4C77 A;  4YSX A;  2XDO A;  3QVP A;  5BRT A;  1IJH A;  4YSY A;  2OAM A;  2YVJ A;  2WPF A;  2GQF A;  2C66 A;  1L9D A;  1H2I A;  2GMH A;  3NK2 X;  3DGZ A;  4MJW A;  4FK1 A;  3NK1 X;  5BUL A;  3VRA A;  3KU9 A;  1DXL A;  1CL0 A;  1OJC A;  3CGC A;  1KSU A;  3CN8 A;  3AEF A;  4B69 A;  1JRZ A;  4FDC B;  3ZDN A;  4H4U A;  5U25 A;  3LB8 A;  1BGN A;  2R4E A;  3NH3 X;  4B1B A;  4CY8 A;  4B63 A;  3G5R A;  3GDP A;  3H4K A;  1CJ3 A;  5KRQ A;  3ADA B;  2YG6 A;  4Y4L A;  2OLN A;  3K30 A;  1ELI A;  1TRB A;  1TYT A;  2R45 A;  3SGL A;  1M64 A;  2GV8 A;  5GRT A;  1IUT A;  1N4U A;  4EQS A;  1H81 A;  2GAH B;  3L8K A;  1N4W A;  3I6D A;  3QSM A;  1ZP0 A;  4II3 A;  3UKH A;  2EQ6 A;  2YLR A;  3UOZ A;  2BYB A;  3NKS A;  4JNA A;  1FCD A;  2O9Z A;  3GMB A;  2NPX A;  5KVI A;  3RHA A;  4UDP A;  3GMC A;  3KPF A;  1BKW A;  2R46 A;  4U2S A;  4C74 A;  1H7W A;  3HYX A;  4ECH A;  4A99 A;  2BS4 A;  2GRT A;  1PBB A;  1D4E A;  1ZKQ A;  2E5V A;  5J7X A;  3IHG A;  1PXA A;  2IVD A;  2YR6 A;  4ADW A;  2AQJ A;  5ER0 A;  3SZC A;  3G5S A;  2EQ7 A;  5EOW A;  3BI5 A;  3URH A;  2WOV A;  2YVG A;  2AR8 A;  3AEC A;  2GR2 A;  2WBA A;  2F5Z A;  3GYI A;  3NHO X;  1KNP A;  3NNE A;  4II2 A;  4WX1 A;  1V59 A;  1S2Q A;  1LVL A;  4J36 A;  1YQ4 A;  3RP7 A;  3R9U A;  3AXB A;  1DOB A;  2XVI A;  2YLX A;  3ALJ A;  1ZDL A;  3BHF A;  3I3L A;  1GET A;  2V3B A;  4YT0 A;  1E1K A;  4NWZ A;  2XLR A;  5KMR A;  2QAE A;  2BCP A;  2VQB A;  3S61 A;  1PXB A;  2WPC A;  1F8R A;  2YR5 A;  4BJZ A;  1E7P A;  3Q9T A;  4APN A;  2H89 A;  3V3O A;  4EQW A;  4XXG A;  2IVE A;  3SZF A;  5M0Z A;  1XPQ A;  3F8R A;  4Z2R A;  3CPI G;  3UOV A;  1YKJ A;  1JOA A;  1PDH A;  2C64 A;  4H4Y A;  4U8M A;  4UDQ A;  3FMW A;  4H4W A;  4A9W A;  1GRF A;  3AB1 A;  1GPE A;  4H4S A;  4XWZ A;  2VQ7 A;  1MXT A;  2C67 A;  4YTN A;  1GES A;  1NEK A;  2X3N A;  4H4T A;  2VVM A;  4H2R A;  4JQ9 A;  1NAA A;  3LXD A;  2YG4 A;  3CNS A;  2GR0 A;  3GRT A;  1H83 A;  4I59 A;  4Z24 A;  5FS7 A;  3AEA A;  2OA1 A;  3T2Y A;  1GRB A;  2BCG G;  3AED A;  3GWF A;  1KNR A;  1YQZ A;  1B8S A;  3KPK A;  4U8I A;  5KMP A;  1XAN A;  2YG7 A;  2X99 A;  4C3X A;  4B67 A;  3CGE A;  4EMJ A;  2IID A;  3ALM A;  5KNL A;  4J34 A;  4OCG A;  2Y6Q A;  3II4 A;  3BHK A;  3T0K A;  2ZZB A;  3BI4 A;  3D1C A;  1PS9 A;  5CKU A;  3LJP A;  3H8L A;  4D03 A;  2JKC A;  4HB9 A;  2J3N A;  1F8S A;  3NLC A;  2GR3 A;  2A89 A;  2YM1 A;  3IHM A;  1SEZ A;  4A65 A;  1IUU A;  5KOX A;  4KX6 A;  3RED A;  1VG9 A;  4IA5 A;  3ATQ A;  5U63 A;  3CNT A;  4AT0 A;  1K0I A;  2C70 A;  2V61 A;  2Q6U A;  4G6G A;  3LAD A;  3V76 A;  2V6O A;  2QA1 A;  5EBK A;  1Z6L A;  4GAP A;  2JAE A;  2BXR A;  3UTF A;  1E1L A;  3CNP A;  4EIQ A;  1XHC A;  3AE2 A;  1FOH A;  5JRB A;  4EM3 A;  1NHS A;  3QJ4 A;  5IQ4 A;  3UOY A;  4G74 A;  4U8L A;  3AYI A;  1EL8 A;  2FJE A;  2V3A A;  5BUK A;  3DJJ A;  2UZZ A;  4J56 A;  3NN0 X;  4AP1 A;  2C4C A;  5FS9 A;  3PG6 A;  1L0V A;  1Q1W A;  1BWC A;  3SY4 A;  4NTC A;  4NZH A;  4H50 A;  4CNJ A;  3DGH A;  3DH9 A;  5TR3 A;  2ZZC A;  1LQU A;  5GSN A;  4X9M A;  5JCM A;  4BV6 A;  2RGO A;  3EPT A;  2WU2 A;  3SYI A;  2V60 A;  4BK1 A;  2WHD A;  4I58 A;  4NTE A;  4EM4 A;  4BUR A;  3UOX A;  3IWA A;  2A8X A;  5JCN A;  1QJD A;  2B7S A;  3AE7 A;  3FG2 P;  1F3P A;  3IF9 A;  4OPD A;  4OVI A;  2B9W A;  4C3Y A;  1O94 A;  3SX6 A;  2XLP A;  1P2H A;  1OJA A;  2AAQ A;  2VRL A;  3CND A;  3KA7 A;  1PBF A;  3COX A;  2DKH A;  1LJ1 A;  2R0P A;  2WDV A;  1GTE A;  4JY3 A;  4U8J A;  1D4D A;  1S3E A;  3LZX A;  4NEV A;  4U2T A;  1GRH A;  1S7M A;  4USR A;  3UKK A;  5JCK A;  3M12 A;  3P4S A;  3UKA A;  1LQT A;  3GDN A;  5KVH A;  1RP0 A;  1Y56 B;  3UTE A;  2JB3 A;  3UTH A;  2YLZ A;  2C75 A;  3QFB A;  3S5W A;  4K5R A;  4TLX A;  1MOK A;  4DNA A;  2ACZ A;  2EQ9 A;  2BAC A;  4H2P A;  2JB2 A;  2JBV A;  3Q6J A;  2XVH A;  3ICS A;  2YQU A;  4CCQ A;  3C4N A;  4X9N A;  3G5Q A;  3AD8 B;  4GF7 A;  2X8H A;  5DBJ A;  2R0G A;  1BZL A;  3EAO A;  1K0J A;  5EB4 A;  1DOC A;  1GRG A;  1L9C A;  4GDE A;  4YKF A;  4CBQ A;  2C3D A;  1GTH A;  1E39 A;  2YM2 A;  1PBD A;  2BS3 A;  3AEB A;  2GVC A;  3NG7 X;  4FK1 C;  1L9E A;  4GCM A;  4H2Q A;  2ZZ0 A;  2GR1 A;  1TDO A;  4GUV A;  4OPT A;  4OPU A;  2Y6R A;  3T14 A;  3UCL A;  1D7Y A;  1TYP A;  1DJQ A;  2C65 A;  4RG4 A;  2OAL A;  2B9X A;  1Y56 A;  1PXC A;  4TM4 A;  3FIM B;  1KSS A;  1Y0P A;  2XFN A;  2E4G A;  3ICR A;  1RSG A;  2QCU A;  3B6D A;  3IC9 A;  4YTM A;  1NPX A;  3O0H A;  1CF3 A;  4ICY A;  4AOX A;  1F8W A;  4PAA A;  4AOS A;  3BNU A;  2TPR A;  3AYJ A;  1S3B A;  1GV4 A;  5KMQ A;  4J57 A;  1B5Q A;  1NHP A;  1Q1R A;  2TMD A;  2BK5 A;  5BVA A;  2NVK X;  1E6E A;  5FS8 A;  3HZL A;  2Q0K A;  1KF6 A;  4Y4N A;  4DSG A;  3KLJ A;  3F8P A;  3AEE A;  3OZ2 A;  4GDP A;  3P4Q A;  4H2N A;  3EF6 A;  4K7Z A;  3NYF A;  4A5L A;  1FEC A;  4YXD A;  1MO9 A;  1LPF A;  3K7T A;  1TDF A;  4JN9 A;  1DNC A;  1ZY8 A;  4H4R A;  3LOV A;  1NG4 A;  5IPY A;  5FMH A;  2WP5 A;  2PYX A;  1K4Q A;  1VDC A;  2WS3 A;  3GSI A;  5M10 A;  2R0C A;  4M52 A;  4CCR A;  4OPI A;  2YVF A;  2H88 A;  3PVC A;  3NK0 X;  4Z44 A;  1LV0 A;  3SXI A;  4D04 A;  1OJT A;  2QA2 A;  2FJB A;  4IVO B;  5IQ1 A;  3UP4 A;  2XLS A;  1JEH A;  2CUL A;  4ZCD A;  3UKF A;  3P4R A;  2C73 A;  3JSK A;  4G6H A;  4G73 A;  5HXI A;  3DJG X;  1CBO A;  1YQ3 A;  2BS2 A;  2VVL A;  1M6I A;  3C4A A;  3P1W A;  1ONF A;  4YWO A;  4OPG A;  4Z26 A;  1ZOV A;  1VQW A;  3VR8 A;  3SFD A;  1OJ9 A;  2BC0 A;  3SZ0 A;  3CGB A;  1GXF A;  1EL5 A;  4K5S A;  2BK4 A;  2WES A;  1PBC A;  3CNJ A;  1QLB A;  2VZ2 A;  3L1R A;  2YG3 A;  3AE6 A;  2GMJ A;  4OPC A;  3VRD B;  3AE8 A;  1FEB A;  2JK6 A;  1ZMC A;  1GRT A;  4J2W A;  1ZK7 A;  3D9X A;  2C72 A;  2FBW A;  1KFY A;  1NEN A;  1PN0 A;  4A6N B;  3NN6 X;  5KOW A;  2I0Z A;  4B64 A;  3ATR A;  2YWL A;  1JRY A;  2RGJ A;  2C7G A;  5C3J A;  4IV9 A;  1DJN A;  2B7R A;  4UP3 A;  1CJ4 A;  3VRB A;  4Y4M A;  3UKP A;  1TDN A;  4BK3 A;  3K7M X;  4H4X A;  4HA6 A;  4TM3 A;  4TM1 A;  3M13 A;  3AE1 A;  2GQW A;  1VRQ B;  4U8K A;  4AT2 A;  3GYJ A;  4WCT A;  2VOU A;  3F8D A;  2X8G A;  2C76 A;  3D8X A;  1NG3 A;  1FEA A;  1E1N A;  4KPR A;  4P9S A;  4O5U A;  4REK A;  4J33 A;  3HYW A;  5KXJ A;  2E1M A;  3AEG A;  3QVR A;  1IUX A;  4G9K A;  3T2K A;  3NTA A;  4IA6 A;  1GEU A;  3QSE A;  2BRY A;  4YKG A;  3SFE A;  3DA1 A;  1RYI A;  3VR9 A;  2GF3 A;  3BI2 A;  1REO A;  2W0H A;  2R4J A;  4UDR A;  4RSL A;  4JY2 A;  3GYX A;  4XWR A;  2RAB A;  4ZCC A;  2YAU A;  3ITJ A;  4CNK A;  5U1O A;  1F6M A;  1COY A;  2XFO A;  2YLW A;  3CPH G;  2WDR A;  4H4Q A;  5EB5 A;  3ALL A;  1PBE A;  4GR1 A;  3SQP A;  3ABV A;  4EMI A;  2JB1 A;  4GRT A;  3UKL A;  1UKV G;  2XFP A;  3M0O A;  1B4V A;  1IUW A;  1GAL A;  2GEW A;  2WP9 A;  2RGH A;  3NTD A;  1PHH A;  2ARD A;  3PS9 A;  3GWD A;  2OLO A;  2PHH A;  3CMM A;  4NTD A;  2WU5 A;  5CQF A;  4OPL A;  4RG3 A;  2B9Y A;  1N4V A;  4IVM B;  4X4J A;  4BK2 A;  3EAN A;  2VVL G;  3AD9 B;  4H4Z A;  1IUS A;  4BJY A;  3UP5 A;  2HQM A;  3DJD A;  3P4P A;  1H7X A;  3QFA A;  4A6N A;  2CDU A;  4PAB A;  5LV9 A;  1O5W A;  2Z5Y A;  1K0L A;  4AP3 A;  3AWI A;  4DGK A;  3VQR A;  1CJC A;  3AE3 A;  1CC2 A;  1B37 A;  1P2E A;  2XYO A;  4TLZ A;  4O5Q A;  3SM8 A;  3ZYX A;  4EMW A;  3HYV A;  2WDQ A;  3GRS A;  2Z5X A;  2XFQ A;  2BA9 A;  2WEU A;  2XFU A;  2R9Z A;  5HHF A;  3KKJ A;  2BK3 A;  1PJ5 A;  1ZOY A;  4CY6 A;  3AE9 A;  4Z2T A;  4ZN0 A;  3C96 A;  4K22 A;  2CVJ A;  2V5Z A;  3CTY A;  2FJD A;  4U8N A;  2XLT A;  1CC4 A;  4TM0 A;  2Q7V A;  3CIR A;  4NEW A;  1ZMD A;  1GOS A;  3AE4 A;  3T31 A;  1XDI A;  1BF3 A;  4B66 A;  1PJ7 A;  4K2X A;  1QO8 A;  2APG A;  1KN0 A;  1NHR A;  3DK4 A;  1LTX R;  1JU2 A;  2XVJ A;  3RP8 A;  2Q0L A;  4YSZ A;  2GAG B;  2ZBW A;  3FPZ A;  3ICT A;  4H4P A;  2GH5 A;  1FL2 A;  2YG5 A;  2A87 A;  2CFY A;  4K8D A;  1H86 A;  2GB0 A;  2X50 A;  3DME A;  3AE5 A;  3UKQ A;  1H84 A;  1H82 A;  4YSH A;  3GD3 A;  4B65 A;  1BGJ A;  3GD4 A;  5HY5 A;  4J31 A;  1E1M A;  1VG0 A;  1JNZ A;  1JNR A;  4E0V A;  1D5T A;  4GAV A;  1O95 A;  3K7Q X;  1TDE A;  1GSN A;  1AOG A;  4JNQ A;  2XVE A;  3NRN A;  3PO7 A;  3AYL A;  2YLT A;  4EQX A;  2XVF A;  4LU6 A;  1DOE A;  1EL7 A;  1H6V A;  2BC1 A;  1JRX A;  4YTP A;  1KDG A;  3H8I A;  5J60 A;  4U8O A;  5KMS A;  5L46 A;  3NGC X;  3WE0 A;  3LZW A;  1CJ2 A;  3QSS A;  1CC6 A;  2YR4 A;  3T2Z A;  3UTG A;  3NT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...