2NQLA

Crystal structure of a member of the enolase superfamily from agrobacterium tumefaciens
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
388
structure length
388
Chain Sequence
MNSPIATVEVFTLTQPRKVPYLGALREGEVVNPNGYIVRKGNRTVYPTFDRSVLVRMTTEAGTVGWGETYGIVAPGAVAALINDLLAGFVIGRDASDPSAVYDDLYDMMRVRGYTGGFYVDALAALDIALWDIAGQEAGKSIRDLLGGGVDSFPAYVSGLPERTLKARGELAKYWQDRGFNAFKFATPVADDGPAAEIANLRQVLGPQAKIAADMHWNQTPERALELIAEMQPFDPWFAEAPVWTEDIAGLEKVSKNTDVPIAVGEEWRTHWDMRARIERCRIAIVQPEMGHKGITNFIRIGALAAEHGIDVIPHATVGAGIFLAASLQASSTLSMLKGHEFQHSIFEPNRRLLDGDMDCREGRYHLPSGPGLGVRPSEAALGLIERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isomerase/lactonizing enzyme
publication title Crystal Structure of Enolase from Agrobacterium Tumefaciens C58
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 133
structure length 388
sequence length 388
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2nqlA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2nqlA01
3BOXA 2QJMA 3STPA 3SN4A 1MUCA 2AL2B 4E5TA 3SQSA 5IDZA 1XS2A 3NFUA 2OQHA 3NO1A 3UCDA 3ZLGA 4DN1A 3JW7A 2PU0A 3DESA 3UXKA 3GC2A 3ZVHB 1KKOA 2QJJA 4GMEA 3RITA 3S5SA 3IJLA 3MQTA 5BOFA 2PP1A 2FYMA 3TWBA 3H8AA 2PGWA 2QQ6A 2P88A 1FHUA 2OZ3A 4A3RA 3FYYA 3UJSA 3RGTA 2PU1A 2PPGA 3PWGA 3VDGA 1PDZA 3OTRA 2P8BA 4DYEA 4G7FA 2I5QA 2FKPA 2POZA 2XH4A 1E9IA 3P3BA 3UJRA 4MGGA 1ONEA 1RVKA 4IP4A 4IL2A 4HCDA 2GGJA 2XH7A 5ENLA 3DFYA 3SBFA 1JPDX 2PGEA 3FV9A 4HNLA 3ES8A 4KPLA 1YEYA 4ZA0A 3H7VA 3NZGA 2OO6A 4GIRA 3T9PA 5FJPA 3JZUA 1SJDA 4DXKA 3DG6A 4E4UA 1KCZA 2PTXA 2OVLA 3VC6A 2XH0A 3TOYA 4GISA 2OG9A 2QVHA 2PA6A 3UJ2A 3BSMA 2OLAA 4K8GA 3H12A 3T8QA 2GL5A 3D47A 3FXGA 3JVAA 4X2PA 3UXLA 2XSXA 4KWSA 2QDDA 3VC5A 3U9IA 3N6HA 2NQLA 3UGVA 3I6EA 1ELSA 3GO2A 4HN8A 2OFJA 2QJNA 2OKTA 1KKRA 3TWAA 4GGBA 4GYPA 3ES7A 3V3WA 2ZADA 1EC8A 3EKGA 3QLDA 4E8GA 4Z1YA 6ENLA 3ZLHA 2PP0A 1TKKA 4GFIA 4Z17A 1DTNA 3VFCA 3NXLA 1BQGA 3FCPA 5FJUA 5J04A 1JPMA 3I6TA 3DFHA 4FI4A 3EEZA 1OEPA 1TE6A 1P43A 4F4RA 3P0WA 3SSZA 3RO6A 2GSHA 4DX3A 2XH2A 3SN0A 2AL2A 2P8CA 3MSYA 4DHGA 2MNRA 2CHRA 2PTYA 3GD6A 3TW9A 2OZ8A 3ZLFA 4HCLA 3GY1A 1NELA 3OPSA 3UJEA 3BJSA 4HPNA 3H70A 1FHVA 4GGHA 3FVDA 3UCCA 3TTEA 4H1ZA 3QPEA 3IJQA 5FJTA 2QDEA 3N6JA 2GGHA 4GYPC 2GGEA 5FJOA 2AKMA 1L8PA 2XGZA 3P93A 4IT1A 3D46A 4JN7A 3DGBA 2AKZA 3DEQA 4JHMA 4IZGA 2PODA 4ENLA 1SJCA 3B97A 3DG7A 3CB3A 3DERA 1WUEA 3CAWA 1EBGA 3RR1A 3UJFA 3N4EA 2OZTA 4KEMA 3CXOA 3QTPA 4HYRA 4YWSA 4MMWA 1EBHA 3MKCA 3CYJA 3S47A 2ONEA 4M6UA 3Q45A 2GGIA 3N4FA 3HPFA 2OX4A 3R0UA 1KD0A 3R25A 3ZVIA 4JN8A 3PWIA 4ROPA 3KUMA 3R11A 4J3ZA 1BKHA 3DIPA 3VA8A 4KT2A 4IHCA 1R6WA 4A35A 4HCHA 2PMQA 2PS2A 4HNCA 3OW1A 2O56A 2OQYA 1W6TA 1MRAA 2PCEA 3R1ZA 1NU5A 3R0KA 2P3ZA 3CK5A 2HZGA 2GGGA 4H83A 3RRAA 5EU9A 3V4BA 1MNSA 4G8TA 2HXTA 4A6GA 2ZC8A 4K1WA 2P0IA 1TZZA 3ENLA 4DWDA 7ENLA 3DG3A 1XPYA 2QGYA 3V5FA 4E6MA 1R0MA 1JDFA 3R10A 1IYXA 4J1OA 4H2HA 3MY9A 2MUCA 2PTZA 3PK7A 4FP1A 1PDYA 3T4WA 2GDQA 3OZMA 1MDRA 1WUFA 1JCTA 3CT2A 1SJBA 3QN3A 3VCCA 2DW7A 3ZVHA 4M0XA 3QKEA 1SJAA 3IK4A 3TQPA 4MKSA 3TJ4A 3SJNA 3TJIA 1EC9A 5BOEA 1ECQA 3Q4DA 3T6CA 3FJ4A 3MUCA 4EWJA 3RCYA 2AL1A 5FJRA 3IJIA 3THUA 1P48A 3K1GA 3V5CA 3OP2A 4IL0A 3TCSA 1EC7A 3I4KA 3VCNA 3SN1A 4H19A 2HXUA 2HNEA 3OZYA 3MZNA 4IP5A 3PFRA 2PP3A 3U4FA 1MDLA 3MWCA 2OPJA 2PSNA 3DDMA 4E4FA 1F9CA 2RDXA 4K2SA 2DW6A 4ZCWA 2PTWA
chains in the Genus database with same CATH superfamily
3NO5A 5U7SA 2WXDM 3DC8A 1JI1A 2YXXA 4UQEA 4C6NA 5LGXA 4QBXA 4FLSA 4GH1A 1PKMA 4FX9A 4K7ZA 1MUMA 4PMNA 3ZFHA 1XS2A 4UUIA 4NEVA 1QPKA 2YB4A 5FS6A 3CL8A 1HO4A 4X3ZA 5ABEA 4L64A 2QUVA 1KRAC 4QJ5B 1H61A 4FR6A 1LWIA 6REQB 2PUZA 3OHMB 2VO5A 3C2FA 4EWND 3RITA 4MUPA 1TWZA 1OM0A 6PTDA 3WYZA 2WNWA 3IJLA 4LWWA 1WDDA 3VMOA 4NVTA 2J6VA 4Z2JA 3RU6A 2QDHA 3WFAA 1FHUA 4AX6A 3G0SA 1GRTA 1T3QC 1RJPA 4PUMA 1GKPA 2G3FA 5CPTA 2WMFA 3TEVA 2ZZ2A 5B7YA 3B04A 3T8LA 4BQ4A 1BEUA 1C3FA 4HZ7A 5A6BA 2QULA 4MZYA 2R1NA 2IKJA 5DT5A 2DVTA 2EQ9A 3SBFA 2TSYA 4EQXA 5HINA 3GDBA 1J0IA 1QPRA 3H7VA 3L4UA 4HMNA 3L8KA 3VYLA 3BDKA 2Y7GA 1QASA 2JEQA 4INFA 3U2OA 2XH0A 3AYVA 3RU8X 4MJ4A 3RMJA 1A3XA 2O9PA 4BR1A 1M5WA 2ZE3A 4UR8A 3VNYA 1CB2A 2BMBA 3PBGA 5I7GA 3GXPA 3SO7A 2QNEA 4NT0A 2VGIA 1CTNA 5E09A 2ALRA 2FTPA 4ML9A 1XLKA 5JCNA 3I3DA 3UGVA 3I6EA 3NPUA 1JDAA 4GUHA 4O11A 4Q3MA 3WLLA 1O4UA 3L12A 3APTA 4L1GA 3NQ2A 1EWEA 4GNKB 1OYAA 3VKJA 2CZDA 5JCKA 1K03A 1XRFA 1BF6A 1EC8A 1WX0A 3F03K 4JL2A 4B4FA 3AFBA 5LNRA 4AG0A 4ZQPA 2ISSA 3OOQA 1T8QA 4JYDA 3WD1A 3U2CA 5CPMA 2PDBA 1J10A 1ZPTA 4PMDA 4H4YA 2Z1WA 3TP4A 4DPPA 4Y9PA 4AD4A 4ZEPA 2QUUA 2RDUA 1QNRA 3DECA 1PCKA 3NL3A 4XUYA 1B3XA 4LEFA 4DHGA 5T91A 4JYEA 5HJYA 5ABFB 4GXPA 4GIEA 4XAFA 4HCLA 1BYDA 1TO3A 5LIWX 3UWYA 1ZCOA 3OPSA 4IJCA 3PZGA 4JFSA 3O06A 4RNFA 1MEHA 4Q7NA 2Y89A 4LAOA 1XGZA 3LA4A 2EXOA 3CJPA 3LZ5A 2GK1B 1PX4A 1RQBA 4DJDA 2AKMA 2EO7A 2CPUA 1DXFA 1AQ0A 2PFHA 3GDTA 4RDVA 4O0QA 3QR3A 1OD0A 3TC3A 1X6LA 3FDGA 1WE5A 1JGIA 1DKWA 3W22A 2AKZA 2EG6A 2WSPA 1D3HA 3LSCA 2NWSA 1WKEA 3LTPA 3UESA 1KTNA 3B05A 4TU1A 1A0CA 5AYXA 2OZTA 4QJ4B 3M64A 1QXLA 1EBHA 4EMWA 2J6XA 3GNXA 3IVSA 2HNHA 1P4CA 2BC0A 1VHCA 2AGTA 3WX7A 3H55A 4HN4A 2YA0A 3BXWA 2OGYA 4K8EA 3VKCA 5I3KA 3TK7A 5AYYA 2CHOA 1E6PA 4GQQA 4IP7A 2VYOA 2QIWA 4E2VA 5CXPA 3II4A 4YTRA 3V0UA 2DZUA 2J62A 3WLPA 1GXFA 1V0LA 3TE9A 1S5VA 1F74A 2WQPA 3MW7A 1WV2A 4UBPC 2X16A 1FIQB 4JQ2A 2R24A 3GZ3A 4BF5A 2WPBA 3BG5A 2VCAA 2Q71A 1FWEC 2QIIA 4CD7A 1UP0A 1O66A 2WP5A 3MV11 3LI0A 1RQHA 1GRFA 2DIKA 1Q5MA 1XV8A 3OODA 3VDHA 1SFLA 2F84A 7ENLA 3BC9A 3CT7A 1C29A 3AWNA 4M29A 2WWCA 4GI6A 4IMCA 3IVTA 5BMXA 3O0FA 1DJGA 2GDQA 1XXXA 4E38A 3BLPX 3C86A 2NVAA 1ME8A 4M19A 3I65A 2G8ZA 4UTTC 4XTIA 1THFD 1BWCA 2A3CA 2JEPA 4EM3A 1OGBA 4GYKA 2BASA 2ZUNA 2C1GA 1KXTA 5D09A 5BZAA 5J8LA 5I24A 4DYKA 2E3TA 4EWJA 3CZEA 1XC4A 1B9ZA 3V5CA 3NNTA 4V28A 1BAGA 1EC7A 4D6JA 1MMFA 1Z48A 4GJ1A 2H8XA 4H6RA 3NXFA 2WOQA 1P6WA 2V3FA 1GEQA 2X50A 4GK8A 2YXGA 3GTIA 2W3SA 1E72M 2WVSA 4GHRA 1XSIA 1EA9C 1O68A 1W1IE 3TYZA 2V2HA 2RGLA 4NZ4A 1QT1A 3CAKA 1K1DA 1PKNA 4GVHA 3OVRA 1XIBA 4PGLA 3UY8A 1LQ2A 4TVYA 4DF1A 4O8RA 1AW2A 1CPUA 5IRPA 4C1LA 4OBSA 1UWAA 1JCXA 2DZBA 2C71A 4DN1A 1F07A 1US3A 4AYGA 1E0VA 4OBTA 2YL5A 1QVBA 2ZBTA 3G22A 3CH9A 5EL1A 3HM7A 4FNUA 3FAXA 5C70A 4O1EA 2CLFA 2CYGA 2WMGA 5BOFA 2OELA 3S1WA 2GR2A 3KOFA 4KESA 5BU6A 3BAIA 5I3FA 4US5D 4O16A 3H8AA 3KTSA 1V7YA 5HNRA 2P88A 3FHAA 3ALGA 3F2CA 3W7KA 1SZEA 4OZOA 3MUXA 3M43A 3KTCA 4MZ1A 5BOOA 3K8MA 3ZT6A 3NR0A 4PUKA 3WLJA 1Z41A 3N3TA 5E0CA 4OUEA 2XH4A 4F0HA 2QCLA 3QXBA 3HGJA 4ERGA 3HG3A 1HKMA 4GBDA 3PUGA 4X63A 3WUEA 4KGLA 1UJPA 4CNPA 2OO6A 5U25A 4HPHA 1HVQA 3FVMA 2OWWA 1R2SA 4R7WA 1MFUA 4EVZA 3PUDA 4ZTXA 3N9KA 4NL1A 4DXKA 3DG6A 1QNVA 3XIMA 4IGHA 4FR1A 1IXNA 5H91A 3RUBL 4C6KA 4GIYA 2IPGA 2BXVA 3BSHA 1GOQA 3LHVA 5CCZA 4AWTA 1R3QA 3W85A 5JU6A 1HTIA 4RDWA 3QHMA 3JVAA 5G4EA 2XIOA 3QPYA 3WN6A 2Z24A 3R94A 2W9MA 1E9YB 2CIPA 3LCXA 3RG6A 3HQ1A 4MDPA 2GYIA 2WQDA 4M6PA 1WPCA 2DQXA 3VILA 5C8BB 4A2RA 1W54A 4W9TA 4OT7A 3KDOA 1AD1A 4GUIA 1V5XA 2ZRYA 4J3XA 2ZZ4A 3AMZA 3VIGA 1EPVA 1JVNA 4IMAA 1QTWA 2R1PA 3B9NA 5CC6A 3W1LA 3A13A 2BX7A 4L6OA 1TX0A 4P7QA 3QFBA 4M80A 1PX8A 3ME3A 5XIMA 4RDYA 4Q4KA 3QC0A 3P61A 5D32A 4DJFA 3LCHA 2WC7A 5F7UA 3CZLA 3T40A 2A7PA 2Z2UA 5CJ5A 3P0WA 4R33A 2W3RA 3GC4A 2VNCA 4NX5A 5HULA 3SB0A 5G5GB 1FDJA 2C16A 3L65A 4DZ5A 1DWHM 5FJIA 3OJGA 1AQFA 2YLLA 2CHRA 2YW4A 1ZKQA 1TWIA 4PUEA 4WY0F 3IJ8A 1IWPA 4NYYA 1P0BA 1C8XA 5ER0A 1E3XA 3CPGA 3UJEA 1GVOA 3ITCA 3H4KA 3C2VA 4PMVA 2DFAA 3F2DA 3LB8A 1M6JA 4AIOA 3FVDA 3E6EA 2Q3RA 4ZODA 3CIWA 3MI6A 3ITGA 2X2GA 1TZ9A 4HNVA 3SECA 1R5YA 5REQB 3T4CA 4A3QA 4PC8A 3WZ0E 4XKMA 1XUUA 3MHGA 4EXQA 2YGYA 2DH3A 4AWUA 3T07A 3WELA 3DEQA 4ZOBA 2BP1A 5BW6A 1XDLA 4GWEA 1A3WA 3FKRA 1B3WA 5FEWA 1QJWA 5LNSA 2FIQA 4DVOA 3GKAA 3S1GA 3D3FA 5BXPA 1W1YA 3S47A 4ZO7A 3SW6A 1IZKA 2PDXA 1UD3A 3GHTA 3DFQA 2Y7DA 4BY3A 2OX4A 3FA5A 1A50A 3ZVIA 2XIMA 3WQVA 2X8RA 1TSIA 4E2BA 1GEUA 1BRLA 5CZKA 3OVPA 3EANA 2YL8A 1HX0A 5H8PA 1P7TB 1C7SA 3KW3A 4CVWA 1RCXB 1ISXA 1BSIA 1MRAA 2Y8KA 2PCEA 1J0JA 1PO9A 1YTKA 5T26A 3TC7A 2UY4A 3VPLA 3QGVA 2YBUA 3EWUA 3N13A 4H83A 3EDKA 2HE8A 1FH8A 3M0LA 2ISVA 4P8VA 1K4GA 2P0IA 1VFLA 2NLYA 3CTTA 4HHPA 1UWQA 3K5XA 2E9LA 3G1FA 2E5CA 4AUBA 1JDFA 3H21A 3N34A 4DLMA 1PDYA 3UZJA 4Q8QA 1XGDA 1A5CA 1OGGA 2Y7EA 4B15A 5AHMA 3ZVHA 2PDWA 4WDTA 4M0XA 2CZFA 1ZY9A 1GYNA 4V33A 3N2MA 4GJIA 3FG2P 3A9BA 4IXXA 4QDPA 3E3HA 1Q3NA 3DZ1A 3S5NA 3E1F1 2C13A 3HG4A 3EXSA 1EKOA 3VO0A 4MAVA 5AZ0A 2C3CA 4QE1A 3TUUA 1FP8A 4HOZA 1KO0A 3VOIA 4C5YA 3HBLA 2P1FA 1OCQA 3PB0A 3QPZA 3USBA 3RM8A 3T1GA 4LVGA 5C0QA 5CLWA 4OVXA 2E6DA 4DY1A 1EHAA 2V5JA 3VZXA 4Y9MA 2FZBA 2XN1A 4UMBA 1VLIA 4HT3A 4AFYA 3M0HA 1A4LA 3F5LA 3G8EA 3CPRA 1VBJA 1W9BM 2DU2A 3RLUA 4NZFA 2V3DA 1HL2A 4DAIA 4Y9NA 2GK1A 1VBRA 3LLXA 4IJBA 4HJFA 1JCNA 4Z2HA 4B2DA 1EJVC 4AAJA 1CLXA 3NZQA 4ACYA 3PZUA 3GUWA 1R9ZA 1F61A 3ITTA 2EQ6A 3GR4A 1OF8A 4UTWA 4H04A 2BGSA 3KS6A 2WCSA 4TTGA 4REQA 2CXEA 4ACZB 3W1QA 1R38A 2GVGA 4PCTA 3TMLA 4DAFA 3AIEA 1ZSXA 3ITVA 1P5BA 4W86A 1HKWA 3GB6A 1GJPA 3WY1A 1LLWA 3LG3A 5IBXA 1MRQA 1JULA 2IS7A 1T6MA 4D6EA 1AW1A 3P5ZA 1XKJA 2DSKA 2GUUA 3LX9A 4F0KA 3LS9A 5HJXA 3BG9A 2CW6A 2FVKA 2XVLA 4E8DA 4HYVA 1EXPA 3WMBA 3N14A 1U5HA 4JIHA 3IV8A 4A8NA 2PPGA 4KW2A 4TVCA 4GVFA 1G6CA 3COTA 3PZ9A 2RABA 5FF3A 1VFHA 1YKWA 4JFUA 1V59A 4EM4A 1VAHA 1CLKA 1GV4A 1B57A 4JAWA 3AISA 4LS0A 3N25A 2CLHA 3P0XA 4QCFA 3FV9A 5JBEA 4HK6A 3PTQA 3LCGA 2WSYA 1ZHAA 4WKFA 2HSAA 1B3YA 3STFA 2ASHA 5CPOA 1M6IA 2VJXA 4AC7C 2ZOXA 3QV8A 4R9XA 3TR9A 2R82A 4ZBCA 4B5TA 3HV8A 1VIWA 4RE0A 2GR1A 1W1B1 1ZBCA 1EX1A 2HMCA 3TJLA 3SCRA 2PDFA 3MANA 2OLAA 1LBMA 3NL6A 2J24A 2FPTA 1E6NA 2DSUA 3W84A 3CAQA 1XQKA 3IJDA 5KITA 3SFWA 3F2BA 1NFPA 4TX6A 2QDDA 3VC5A 1L6YA 4PMYA 3VI2A 5EMMA 3N6HA 3VNKA 3AU2A 4ZB0A 3CUIA 1PWMA 2G4JA 3GO2A 4MWAD 4C1KA 1Q45A 4FXFA 2C1HA 4WJ8A 1NSJA 1CGVA 3NVDA 2Z25A 1FUYA 1LRQA 3W2JA 2ZADA 1U33A 4MB5A 4RNJA 3W7DA 4KS0A 1Q13A 3W0KA 3GG1A 3TQKA 4V2XA 1LRTA 2LLEA 3L0NA 3U6WA 4BQ2A 3W7MA 3CHDA 4PB3A 4HHHA 4S3CA 2DSVA 2VM8A 3DXIA 2Z1VA 3NXLA 5XIAA 3UD6A 2JF6A 3RNDA 4HU0A 4D72A 3OEXA 1S46A 4AVOA 3NDYA 4AVFA 4AZ5A 4FI4A 3H4XA 3TAOA 3O6YX 5C9XA 3MP5A 2PTDA 3RO6A 2HVNA 4O4WA 1ITUA 1SR9A 1K9TA 3QFAA 4NI8A 5HWNA 1TZ7A 3MSYA 2YL9A 4YWOA 3TW9A 1W2VA 1E56A 4H4TA 3AQUA 3GBDA 1NELA 3CEPA 1JUKA 2X1RA 4HPNA 2OO0A 4DNAA 4PUUA 4C6JA 1EP3A 3W02A 4GX9A 1ZJHA 1RY0A 1O5KA 1MO0A 5FS9A 4JFWA 2GGHA 4GYPC 2EPKX 4NXKA 4P8XA 1DQUA 1M04A 2I16A 2OSYA 2XPKA 1ZENA 2C8NA 4G6CA 4WR3A 5FSEC 1KM0A 5J5DA 1RP8A 3JS3A 3GTFA 3VE7A 1W3LA 4Q8NA 1GWJA 3MO7A 2WCGA 3PZTA 4HA3A 2C3DA 1TIMA 4KWOA 3DBNA 4F48A 2H9AB 3HO8A 1S2VA 3UJFA 2VFIA 1XCFA 1UC5A 3GLCA 4U3AA 4UQBA 3UCQA 4DF0A 1Y8BA 4E4PA 4PSRA 2VQTA 4MVAA 2J66A 1XQLA 4TVDA 1XLGA 3LCWA 4O18A 1V3HA 1B9BA 3MI2A 4LEQA 3WQFA 3PBVA 5M1TA 1EYWA 3VA8A 4XD5A 2PF0A 1HVXA 4R3UA 3GAYA 3DHPA 3C0LA 1O12A 4EPBC 1FWIC 3S3GA 1N5XA 4ZQRA 1IEQA 1SFSA 3K4DA 4R53A 5LNUA 3QMTA 1BVZA 1W6TA 1QUMA 1OFBA 1X6UA 3CIVA 4QP0A 5E5CA 4FAMA 2W67A 3MC5A 3N9RA 1LL7A 3WLMA 4JTLA 2OR2A 1GZJA 3KVMA 5EU9A 4BURA 2JKAA 3I6RA 1UW9A 2A0NA 2PDLA 4L4MA 1V3LA 4H3DA 5BROA 4Y9AA 4GXMA 3DG3A 1GRHA 1SMDA 4KCTA 3OHIA 1XW8A 4RW5A 3UT0A 1V3MA 1VEMA 1IXQA 2VD8A 3WBXA 4H2HA 4CKQA 2MUCA 4FP1A 3OLGA 1MDRA 3GW0A 1H11A 1FWBC 1Q6OA 2DW7A 3LRKA 4DWSA 4XV0A 1KGUA 4LY4A 4Q4RA 1TYGA 2F2KA 1E51A 3VU2A 2CBUA 5AN7A 2FPYA 3W23A 4DB7A 3CGDA 3TJIA 2QCFA 2ZVIA 4YNGA 1JUBA 1UOZA 5JVLA 1EXBA 3A24A 3AOFA 3T44A 1TIWA 3RLVA 2ZTKA 4TMCA 2DH2A 1R3WA 2WNQA 5BNKA 1ITCA 4NKCA 1VQZA 1XFCA 1TPUA 1DJQA 2BCPA 2VR2A 1G0CA 3GX9A 4IOTA 4OWGA 1LPFA 1FQ0A 4ERAA 5EY5A 3WMSA 4FXSA 2QAPA 3LLFA 1DORA 4XAGA 1W9VA 3UFYA 5AC6A 4H8UA 4K3ZA 1PUDA 3EDJA 4W8LA 4Z2KA 5REQA 1S38A 1E0UA 1ZBVA 4CNOA 4IPNB 3NL2A 4CU7A 4OJYA 1Q6FA 2QPSA 3TVAA 4QLKA 1SM9A 2VCCA 5A6LA 4CNSA 3CWHA 3WJZA 1V6YA 4I5UA 4MYXA 1I2RA 1J5TA 4CQBA 3FJLA 4GACA 4GC4A 2W54A 2OU4A 3GTXA 1NEYA 1MEWA 2EHHA 2W6RA 3QV6A 5AHEA 2ZZ1A 4QSFA 3WD2A 4N02A 1JZ7A 2HE5A 3LU2A 4EQRA 3TWBA 4EXAA 2IW0A 4AF0B 4EPDC 1POKA 2D3LA 3USZA 3PTMA 2YBTA 4LAZA 1G69A 3D0CA 1MVYA 6ALDA 2B7NA 1XD0A 5FI8A 1VRDA 2P8BA 4Q8VA 4G7FA 1BHGA 2ZDRA 1H0IA 3VIFA 3VIPA 1E9IA 2YXOA 2NLIA 1UD2A 3STCA 1ONEA 1RVKA 4HCDA 4DUXA 2QCNA 3N6QA 5F4SA 3DFYA 5LA1A 3G0XA 4LB4A 3PNZA 1SPQA 3K8LA 4UQAA 1PV8A 2IPFA 3VZZA 5D2XA 2E6AA 4PSPA 4ZA0A 3H2OA 1J96A 4I6KA 3CM4A 1NWSA 3LB0A 3GZAA 1OZMA 1DIOA 1P6CA 1YQ2A 3GNNA 1GJWA 1KQZA 2GQAA 3QYQA 1KWGA 1N63C 1XYLA 5B7ZA 4C7DA 2YX0A 5FOOA 1XLEA 1V08A 3UJ2A 1LOQA 2RH9A 4LA1A 3H53A 2Y88A 3DH9A 4BI5A 4X2PA 3VOFA 4ADSA 3RJYA 2Q8LA 4IGNA 4C6CA 1Y5VA 3MMDA 2W5FA 3WF0A 3S9IA 2A3HA 2NUXA 2E8ZA 2NV1A 5A6AA 4O28A 5IDIA 3AMLA 4EAYA 1QI0A 4U10A 1ZAIA 2QJHA 5I06A 2A79A 5D9NA 2Q09A 4MNMA 4EAMA 3TN4A 1XX1A 4XWUA 3EWWA 1GQKA 3CYVA 3LQGA 4GXWA 4CCZA 2UWFA 4LYRA 3W83A 3FEMA 2WO5A 4Z1YA 3V18A 2UBPC 4CCCA 2ATSA 4L7ZA 4KKXA 2XSBA 4GI8A 4IMDA 4ORMA 2IPWA 1V0NA 4GFIA 4KERA 1KFEA 1OJTA 3W73A 4EPKA 5FJUA 3UZWA 5J04A 4ZXLA 3POCA 1TELA 2OWCA 4UOQA 1JZ6A 2VEIA 4F4RA 1GOOA 3UXAA 1PKLA 1PPIA 2MANA 4EF9A 1X1OA 3KWXA 4D1JA 1Q8JA 1P1MA 1V0KA 4YU1A 2WANA 1QHOA 2QKFA 1JPIA 2GJNA 5HR6A 3KBMA 3ABQA 1EP1A 2ZE0A 1AW5A 3H70A 5GQBA 1GZ1A 2WVVA 1EJTC 1OIMA 3RPTA 2GFTA 2FGLA 4AIUA 3A64A 2J8GA 1G9HA 3BUVA 2FDSA 2WMJA 3W2UA 4D8LA 3WH5A 2HEJA 3CGBA 4TUFA 2D2GA 4N9EA 4U4MA 1K9FA 2A21A 4R85A 4JN7A 4MLJA 2XIQA 1IIGA 1UQYA 1G5AA 2WJZA 4RCXA 3GIYA 4HMEA 1BG4A 3C5QA 2X05A 2FJKA 3MO4A 3KOWA 2OT1A 3M46A 5AYIA 3TU9A 1OJXA 4ASTA 1ITXA 4GZ7A 2VXNA 2OTDA 3L2MA 3AIQA 4RNIA 5I07A 5KZEA 1V6WA 2D73A 3SRKA 3LSBA 4C5ZA 2OQLA 4AHOA 2RAGA 5I03A 5G4WA 1DXLA 1GJUA 4CEUC 1PKYA 4I5XA 1ICQA 3G5EA 4Z0JA 5F4XA 1KCKA 3KUMA 1OYCA 2WPCA 1QK0A 1TQXA 3U8GA 4JDYA 3TZNA 1DE6A 4A35A 3VM5A 4ZFMA 4HCHA 2PS2A 4C65A 4HNCA 4OECA 2INFA 3ZJ7A 5AECA 1H3GA 1N60C 1GOXA 4H9XA 1FCVA 3R0KA 1K8XA 4WEVX 5DANA 4WDUA 1U30A 3VZYA 5KTLA 4JTTA 4K1GA 4AQLA 5A6KA 1S5WA 4P7LA 4FXRA 4UR7A 2HROA 3WEMA 3KBNA 3INPA 1WKFA 1B2YA 3T78A 3A4JA 3CEUA 3OLDA 4J1OA 4PUNA 2ALDA 4MWAB 3AHTA 5K3VA 3ITXA 3MV01 5E9AA 4Q4SA 3ATZA 3T4WA 4GY7A 1DP0A 2BVYA 2V8ZA 3VOGA 3UA3A 1F73A 4NRRA 1VJIA 1VP5A 4BF9A 2NT1A 3AZRA 4BZYA 3QKEA 4TX8A 4ZE5A 2Y5JA 2PWUA 1G4EA 3VIMA 2EBNA 1MFVA 3EMZA 4EXBA 4WIWA 3LM3A 3C0QA 1NDAA 1VFSA 5EA9A 1J0YA 2CNCA 2P50A 4V1XA 1HQTA 4TXEA 1UUOA 1MXGA 3QR0A 1KR0A 2AL1A 4D8AA 2VDHA 4PMOA 1XIJA 3GNOA 9XIMA 1W17A 1UASA 3GW3A 3WLSA 3AXHA 3VIKA 1KXQA 3U4AA 2V82A 4ROQA 3EOUA 1UKTA 2C15A 4LUYA 3ARYA 3PFRA 3HURA 4U3CA 3CUJA 3K13A 4QRNA 4QG8A 2A5HA 4KETA 1KM1A 3CXBA 1RPKA 1WNOA 2G3MA 1ADSA 3TTYA 4NU7A 4GNJA 3RAOA 8XIMA 5JXQA 1J8VA 1E9LA 2RHGA 2D20A 3G24A 3SRHA 4US5A 5D05A 4ZO8A 3W70A 1BPLB 3BLIA 5LNWA 4DXXA 4FIQA 4HU3A 4ZMGA 5IDZA 2PDUA 3LERA 1W0MA 1M68A 3GAKA 2H8ZA 2A3LA 5RUBA 7TAAA 4PCPA 3QW3A 2VMFA 3SCPA 1KKOA 4PUDA 4LYKA 2ZXDA 3QYSA 3CV1A 1XUZA 3H4WA 1ME7A 1H7OA 2BVDA 2E40A 1CX9A 1G1YA 3O3RA 1CECA 3WG6A 1JD7A 4ADUA 5D4YA 3REQA 2WZMA 5TBOA 1GOMA 3EDFA 4G1NA 3UVIA 3WNPA 4P2VA 3HPXA 3W75A 4KMQA 3WK3A 3JUGA 3SCTA 2Q01A 3B8WA 3H6OA 3S46A 2GJPA 2HPMA 1AJ0A 3BICA 1SW0A 2WHMA 3H2EA 2DSWA 1CI1A 4AZBA 1HGWA 3ITYA 3NZGA 2W92A 1VJSA 3ECQA 2EF9A 1DPMA 3R13A 2X1UA 3VDBA 3MCMA 2Y70A 3UZYA 1DQWA 1Y5WA 3S1XA 4U28A 1PAMA 1WO2A 2IQ0A 1D7KA 4GR1A 1FCUA 1JYWA 3DJJA 5FJJA 4LAMA 5I00A 4FPSA 3TYBA 3SCVA 5GNXA 1F3TA 1SW3A 1XSJA 3BO9A 2I14A 3FJNA 4TVWA 2Y6ZA 4LB3A 3W7EA 3KBJA 4JS3A 2ZRWA 1A0EA 2FZ8A 5C9ZA 4E0CA 4AZ7A 2QJNA 4JIPA 2JIEA 2WKGA 3CH0A 3PSVA 2WMKA 3AAMA 1KFWA 2JKPA 3S83A 2BTMA 2P10A 3W00A 5D2YA 4DIAA 4R27A 4JCMA 3TC6A 1C8QA 2RKXA 3N3MA 4U2YA 4GZJA 5G1YA 3QSRA 3SY8A 3NZPA 3F4DA 1M03A 4LSBA 1LWJA 4HPJA 4R9OA 3EEZA 3A4WA 5HAOA 2EPNA 1LRNA 2I9EA 5MHBA 1JI2A 1K6AA 3NZ1A 7CGTA 1E5JA 3WFLA 3B0XA 3GU2A 1VZWA 2NUWA 1OINA 2YCLB 5H2ZA 4JTQA 3GD6A 3RILA 1H7RA 3WQWA 4W8AA 1KM6A 4A3HA 4XAPA 5HK4A 4L9YA 2WP6A 1UA7A 3BJSA 1XG4A 1OCJA 2CLLA 2VC9A 1KC7A 3QVQA 3N19B 5U4NA 2B31A 4MLRA 3G6LA 1DJXA 3GIPA 2H6RA 1TJPA 4X22A 1UZ4A 1TJ2A 1X38A 1BD0A 4ZSTA 4FOKA 1IEXA 3DGZA 3MUZ1 1NF0A 4WX2A 3GG0A 4JBRA 2J77A 4AF0A 3AZSA 3JR2A 5EMJA 4PB4A 1KLYA 4LNCA 5FMHA 4O1BA 4UCFA 3LD5A 1BGAA 1FHDA 1HJWA 1V6VA 1R86A 5M2FX 3QZ6A 1EBGA 3RJXA 4QFUA 3IRSA 2FGZA 4KEMA 4XB3A 3CXOA 3A7RA 2YBVA 4PCSA 4DM2A 1I8JA 4DO7A 3VD5A 3V0TA 2BVTA 5T9BG 3QJAA 4GO8A 4HMDA 3C4UA 3Q45A 4JIRA 3I7SA 3FIGA 1K3UA 3WNNA 4UOZA 3B9DA 4Y2WA 1TA3B 1Z69A 2BWGA 4DBEA 3U7VA 1UCWA 3HMJG 2WYSA 3LI1A 3R11A 4YTTA 1W5NA 1WCGA 4OOUA 3NPWA 4XAYA 4J27A 4RKAA 4NF7A 5CBIA 1ZAJA 3PBWA 3WLIA 2UY3A 4KEVA 4WD0A 4DJEC 4D8ZA 1A5LC 2WBAA 5LA2A 1TJ0A 2GJXA 5HQLA 1TPB1 2Y61A 5EB8A 5ABGA 1RD5A 4Q6JA 4G7EA 3SUVA 3TDFA 3L5OA 2GUYA 1D3GA 5GNZA 3B0UX 4MJMA 4AIBA 1WYIA 3NQBA 4W88A 3FYOA 2EKGA 1ZRQA 3DGHA 1UMYA 3TZFA 3BOFA 4HD5A 2HBVA 1WUFA 2PDYA 1WZAA 1JRBA 4K8HA 1TB3A 4KRUA 3EA3A 3V16A 1K9EA 2D22A 3G1RA 4QJ3B 4RZBA 4EANA 4N9CA 3N2BA 4TIMA 2AAQA 2WV8A 1GVEA 4H8HA 1QR7A 5CKSA 3WUBA 2EG8A 4LYPA 5KVHA 1A4MA 3R6IA 3LNMA 3H23A 3IJIA 3GD3A 3R79A 3WD3A 3DFNA 2VX7A 2IMRA 3H7UA 3TCSA 2WMIB 5XINA 4WQ6A 3I4KA 4D71A 3MZNA 4MADA 1KXVA 2E1WA 2X42A 1HXJA 4AVNA 4HSNA 1P0DA 4TO8A 4PTXA 2TRSA 1B3OA 2OPJA 1JUEA 2PDNA 2YPIA 3HZ3A 2OCZA 4C91A 4ZCWA 5BXSA 2C91A 5JUVA 2PDKA 1NOUA 3LXAA 3PZQA 1H7PA 3TA9A 3UNTA 1CXHA 1UKQA 3NRZB 1UC4A 1F4HA 2EG7A 4Z1AA 3T81A 3PHAA 3ICJA 3UWUA 3NGFA 1UWIA 4A8LA 1JJKA 5K9DA 3KXQA 3DGRA 2Q02A 4KGJA 5L9FA 2OQHA 3NO1A 3LNPA 4UTUA 3GR8A 5HA7A 3GC2A 3EB4A 1T7LA 3V75A 3R4IA 2YJQA 5A8GA 3VUPA 4TTUA 1YQZA 4PZVA 1XICA 4GMEA 3D5HA 2DGAA 3M0VA 4JFTA 3BZJA 3BZGA 3BOLA 2PP1A 3THDA 4KCVA 1V3IA 5AC7A 4KCWA 3QC3A 4ZZ9A 5LXXA 3QM3A 4ZL1A 4M51A 3W72A 1OGSA 1CBGA 2GPTA 3L4VA 5DXXA 1VS1A 4PFMA 5G1TA 4LUTB 1U22A 4QS5A 4ZOCA 3VDGA 5FA5A 4C90A 3J7HA 1RK6A 1X2HA 1NF7A 2WSRA 1EOMA 2POZA 2DT2A 3WQOA 1V0MA 2A8XA 2XVGA 4GZEA 4ERIA 2Q6ZA 4WRHA 2BZNA 4LQ1A 4NNCA 2W55A 1GVYA 3B8SA 3BANA 4DJFD 2E6YA 2REQB 4OGZA 5CJNA 1J01A 1X7FA 3VOJA 3WLNA 4B5XA 1KRCC 2ZZ6A 4MWAA 3QLLA 1F76A 4NAFA 3S42A 3DAQA 2CKRA 1W31A 3M0IA 3IIOA 2ZUVA 3GH5A 4QSHA 3LBCA 7REQB 1UPPA 1LVLA 2V6AA 1BXCA 3UG5A 1S5MA 4OQVA 2ZA3A 5CJMA 3PPFA 2YYUA 4K39A 3I4EA 4BEUA 1U83A 2WHKA 4C6FA 1SSDA 4J3VA 2GVYA 3KLLA 2BG5A 5I77A 4YCPA 2CBVA 1FCQA 2ZUMA 3L5MA 3S6DA 2UV8G 4OTKA 2E5BA 4G2DA 3ABOA 5C9UA 3WQPA 3L2LA 5AYZA 2FDMA 3LHYA 2B81A 4HSOA 2F8QA 1PEZA 4GGBA 1I75A 4AWEA 2EJ1A 3OZPA 1TR1A 4WY0A 1AZ2A 5IXEA 1C8VA 3W7GA 3U3HA 4HVXA 3KLKA 4IIHA 1PIIA 5D2WA 4GRTA 1DTNA 1J6PA 1QAPA 1KV5A 2J7HA 1JPMA 1XLCA 1VFTA 2OT0A 3DJGX 4GNVA 4GCAA 5CC3A 4H9YA 4L80A 5GJPA 5JCLA 1AVAA 4S3FA 2X8CA 1UHVA 1ZAHA 3OZOA 2IQTA 4LAKA 5LIXX 2XZ9A 2NXGA 1TCMA 3GY1A 1EIXA 1EGVA 2ZICA 4M6QA 4J5NA 4UZSA 2VURA 1PE1A 2O7QA 3HW2A 3W27A 1GVQA 2ZXQA 3L2IA 3QPEA 2DY3A 3WQ5A 1QOQA 3N6JA 3PJXA 3CQJA 2A6LA 2WC3A 3TYDA 3ZJ8A 5JH2A 1XLHA 3ZO9A 3DKJA 2FB3A 1LQAA 3P8IA 3H2FA 2HVMA 4QROA 3PPCA 2YVJA 2I56A 3WKZA 4P61A 4H7ZA 3GU9A 3T0CA 1ZQ5A 3R5EA 4ENLA 3QY6A 3VNLA 3O0HA 3DG7A 2QXWA 3O6AA 1M3UA 3P5YA 2XIBA 3PZIA 3P14A 3VGHA 2YOCA 4JEJA 1RXOB 2VRJA 3KEHA 4S3BA 4AY1A 1QATA 2V5KA 3IIZA 1D2KA 1IR2A 2DV0A 2F5ZA 3IJ6A 1HP4A 2XM1A 3DIPA 2G3IA 2WBKA 3S2JA 3DENA 2PLCA 3SUUA 2WKJA 3B9OA 1HKKA 2B7QA 1F6YA 1DJHA 4JIQA 5D8ZA 4UZUA 2P3ZA 1KW1A 1XDMA 4G56A 2FPVA 1XD1A 4AC1X 3EWCA 1BXBA 3WK1A 4UTJA 4G8TA 1TE1A 1FVPA 4QAWA 4K1WA 3KRUA 3WENA 3ANVA 3CNYA 3EX4A 3H2NA 4XTDA 4LUIA 3SUWA 1B4KA 4DBUA 1DWIM 1TPVA 3GU1A 3G1SA 2FTWA 3AMDA 2V69A 3EX2A 4LVDA 3AM9A 2PLMA 4D6CA 4F9DA 3O8AA 3TXVA 5E70A 3W26A 3VXGA 2RFGA 4TV6A 5BCAA 3CT2A 3QQWA 4F2BA 7TIMA 5KINA 4PBGA 2VVNA 3AO0A 4RR4A 1SU5A 4B9YA 2VTFA 1UOKA 3KAOA 4NQ1A 1F05A 3TSDA 3S5OA 4KPRA 3KRBA 3HGSA 2NVKX 4DELA 4Q8WA 4XISA 1OFPA 4BWLC 4A4AA 5A8MA 2WPFA 1JF5A 4D6GA 1ONXA 1XGEA 2CDUA 2OOGA 4XSMA 4NJIA 3PFMA 4NG3A 1UZ1A 4UTIA 4AU0A 3V7PA 4PMXA 2XISA 1TYTA 5KVIA 1T40A 1KBJA 5LIUX 3MHUA 2WLYA 2VT0A 6TIMA 5C5YA 5CC5A 5EBUA 4MJ2A 1EJSC 3G18A 3OZYA 3PBYA 4GPNA 3RF9A 2HCVA 2CETA 4B4HA 4U2ZA 1UUMA 1RLDA 1HFBA 5EBKA 1LWHA 4DEFA 4B3LA 4XIMA 3CV2A 3LN3A 1EPXA 3O1NA 1H2IA 1H0GA 4JQ3A 4MTVA 1REQA 4ATWA 1E1CA 2PB1A 5HQMA 2YLAA 2QUMA 3NQGA 3SN4A 2NV2A 2NSXA 3L68A 4P7NA 1W91A 6A3HA 4I90A 1C93A 3CGCA 2EKCA 4BA0A 2C14A 4MYAA 1NP0A 1J4EA 2PZNA 2R91A 2POTA 3CO8A 3S5ZA 2RGMA 4FB7A 3RIKA 4O57A 1PWLA 2J13A 3GD4A 2F2HA 1EHNA 5EMUA 2GVEA 4BK9A 5CAKA 1NHQA 2NQ9A 3CMFA 2EPHA 3HPAA 2V2CA 5LSMA 3AN1A 4Q4MA 2V0TA 3ZZ1A 2PGWA 4UMAA 2B0MA 3VTRA 3GH7A 2YDSA 1YDNA 4IIFA 3BLDA 5DEZA 2R9RA 3EF6A 3WQ8A 4CU6A 3B8TA 3PWGA 1K7EA 3W01A 2GJLA 3ARUA 4AISA 4DYEA 2BODX 4PMRA 1TV7A 1TWWA 2HK1A 1QMLA 3SM0A 1SSGA 3OBEA 3NVZB 4JKKA 4Q32A 1LT7A 4ZR8A 1YNPA 2WHLA 1NM9A 3W7PA 4IL2A 4JEQA 2PD9A 2VRKA 4DO6A 3HTWA 3AWOA 3SUSA 2BXZA 1QI5A 1WXJA 3EEGA 1W5OA 1L2UA 4XK2A 1P1XA 4GIRA 1K77A 2XVKA 4LBRA 2GVJA 2HTMA 3JZUA 1JDEA 4GKTA 4TVUA 4PEKA 4JTIA 2VP8A 3GVVA 1UA3A 2Y8VA 4MF4A 2WVTA 4Z42C 2OG9A 3ABZA 1FA2A 4KWVA 3AIVA 3BSMA 4JTEA 3VGBA 2R8WA 3BVJA 1WAWA 4MDOA 1CXFA 3URAA 1LYXA 3CHEA 3EDEA 1R3VA 3N12A 3NCOA 1PB0A 4WOQA 4HIBA 7A3HA 3OB8A 2WMIA 4F0RA 1B31A 3T0TA 2GJRA 3WK0A 3W76A 2GWGA 4AD5A 3EPOA 5K4ZA 2EGZA 4HPXA 4XZMX 2GSEA 1TTPA 3VABA 4JTCA 2PP0A 3S0CA 1DYSA 2OZ0A 3SZ8A 1UD5A 3IIXA 3FSUA 2VZUA 3UG8A 1OC5A 3CUHA 1TE6A 3Q67A 2WVUA 2FMNA 1GETA 2VEKA 4AHPA 1RV8A 1UKOA 3PANA 1WAUA 2PAJA 2XH2A 3W1UA 4XZIA 4JTGA 4XG1A 2D69A 2X0YA 1QBBA 2E1DA 5AKQA 3WSUA 3MUIA 1AK5A 3FNDA 3TFXA 4UFKA 3HB9A 4Q6XA 1W1PA 3ARWA 5D33A 4J3UA 1H51A 2D0HA 3AS2A 2PEVA 4R7JA 1W37A 4RX0A 4D6IA 1GW1A 3N4AA 4IF2A 1VJZA 3KE0A 4DZAA 2ZZCA 2DUZA 4PTNA 3FDKA 5HPCA 4H00A 2A7NA 2ZZBA 3TTOA 1Q4WA 4UOJA 3S8HA 3GRSA 1NWRA 4S3GA 3VNZA 1TPFA 4IGMA 3QH2A 4UCGA 2XYLA 3UNDA 5ABHA 5JCMA 2FH8A 4M6UA 1EL3A 1Q7MA 4OOZA 4RV8A 6TAAA 4NZ5A 2VD9A 2REQA 1JNEA 4V27A 1A5OC 1PZ1A 5F2MA 2PLKA 3NG3A 3MDWA 4ROPA 3SCOA 2VGBA 1JXKA 1W5QA 3WUGA 1RZMA 4UTFA 3NVVB 3L66A 1JQVA 4JTSA 3QEZA 2FHCA 2WZIA 2PMQA 4J3WA 3NQEA 3HMCA 3PPGA 5D9PA 4QS6A 1TVLA 7REQA 1CXLA 4CQAA 2BBFA 1HL8A 4QLLA 1C92A 4LF2A 2VC5A 4FEZA 4O4VA 3GE7A 4Q7IA 4APNA 1LL6A 3TYUA 4YLWA 2ZC8A 1KFKA 1OFQA 5D04C 4HOXA 2QUNA 4JX5A 1Q8AA 2QMKA 1FO4A 5I0DA 1GOWA 2WAGA 1F8WA 3TLQA 3HQOA 4YXGA 3ARTA 5JIWA 2FVLA 1VB9A 3C61A 3B9AA 3UPBA 3IPWA 4F9JA 1QW9A 1O1ZA 3GKFA 3HRDC 5A3HA 3VKBA 2C7FA 3DKLA 4QM1A 1TV8A 4Z2GA 1FXPA 1RCOB 1QPOA 4ZENA 3MSDA 2XUCA 4L1WA 3F7JA 2GRTA 1UR4A 3W7CA 3OQEA 4XVEA 1EQCA 3B8DA 1BWLA 4GOAA 4IPIA 3OVGA 1YNQA 3T6CA 2X41A 1UIPA 3ANUA 4XD6A 3NZRA 2DT0A 3CB8A 3EKZA 5K2ZA 4DBSA 4L4LA 4G5DA 4DO4A 1Z3NA 1ZX9A 5DLCA 2HWGA 3BJFA 3UWWA 1BRLB 3SJ3A 4M3PA 1IWBA 2VZSA 2YL6A 2HNEA 2OJPA 1XF0A 1JGMA 2W0HA 2Z1BA 5FF4A 1PIGA 2V3EA 1XFBA 2CFFA 1STZA 4MB4A 1R47A 8TIMA 3KL3A 3PVFA 3NQCA 1AA1B 1KCXA 1EB3A 2D23A 4CQCA 3UR7A 2V2DA 3VDCA 2ZZ5A 4MKNA 3V5OA 4GJJA 4DXVA 5AOUA 4R88A 2BOEX 2FMOA 3UG3A 1G94A 4LTSA 3S6OA 1AMKA 1WP6A 2TODA 1R2RA 3CUFA 3ARPA 3I3EA 3VNJA 4W7VA 1F8MA 3CUGA 5G2WA 5DMMA 1K4HA 3WQ6A 3SCNA 1BTCA 4QTGA 2ZXBA 4XZ9A 4I8YA 5MKGA 1CB7B 2PU0A 5DX7A 2HQMA 3ZVHB 1B54A 4F0MA 5I23A 5E0FA 2QJJA 1UH3A 4AWSA 1ZP3A 3KHDA 4UXDA 4NX0A 5AY7A 3E2VA 1RQEA 1XIDA 4QITA 4X9SA 3HN3A 2PD5A 4X60A 4XIAA 4J3SA 4LX4A 2HQAA 3CQ0A 3O7UA 3SQLA 3TYCA 1ZGDA 4MUZA 2F7FA 2GUBA 3VGFA 3IGXA 3KOZA 3UU0A 1UZHA 4HK5A 1FCBA 2Z4GA 1XR2A 2O55A 1Y7VA 3EZ4A 1W9PA 5EYWA 2JF7A 3E0WA 3NAVA 1PTDA 3LHWA 2GGJA 1FECA 3HJEA 4CQDA 3BWWA 5GRTA 1XJBA 3MP4A 4FNRA 1YYAA 1UD6A 1JOAA 4UFIA 3UETA 1ZNNA 4Y6GA 1PZ0A 1VYSX 4B5UA 3UVAA 2CC0A 2FJUB 2IKIA 4HKPA 1FP9A 3WDHA 3UP8A 2J9ZA 5E0KA 4REQB 2E68A 3GDMA 3CS2A 3HA1A 3VVGA 5KETA 4GY1A 1J0KA 4CNUA 1PHWA 4DO5A 1D7YA 4EK7A 4LC8A 4DUWA 1SB3B 3WH9A 3WNLA 1YADA 1FH9A 4JR5A 3UZ5A 1VRXA 4KEUA 1E4LA 3EWYA 3WL1A 2X1SA 3FK4A 4PA8A 2DPEA 3CHVA 2PDJA 5EFDA 3SCWA 3TA6A 3G8RA 1KKRA 1OHLA 4O13A 3NQFA 1W1ZA 3WK2A 3QLDA 3STEA 5BMWA 2F61A 1US2A 1XHCA 1VCGA 5AC8A 3WLOA 1EZWA 3TOPA 1BVWA 5LXEA 1Q65A 4QE5A 3S2LA 2CERA 1I1WA 3AYRA 1E40A 4RK8A 4N4PA 1H2JA 2YZRA 5IM51 3C6CA 1LORA 3LCFA 4PL1A 3AJXA 3EPMA 3PP7A 1HJVA 1GOIA 1JCYA 1VFUA 4LS1A 3CC1A 1VPYA 3MBFA 4JQ1A 4RPQA 2CKSA 2AMXA 5JH1A 2HISA 3ZLFA 3RM4A 4FS9A 4TMBA 5FKYA 4XSLA 3PM6A 4CEXC 1ESWA 2QF8A 4U33A 1CENA 5AVNA 4E3VA 2F9RA 5FAGA 5CZJA 3UCCA 5CGMA 1XI3A 1MXDA 1K70A 3AS3A 1KFJA 2QDEA 1YXCA 1FHLA 3ZMRA 2GGEA 4W87A 1GOKA 1JEZA 3M0JA 3RN6A 4Z1BA 5GJNA 1ZXIC 4IQDA 1JPKA 2O92A 4K37A 3MSGA 3TV8A 1GG1A 4GUJA 3URHA 3OO2A 4JY8A 5EMLA 5CPLA 3N2TA 3P67A 3FA4A 3ZT7A 3B97A 3CB3A 3URQA 3DERA 1HW6A 1XBYA 3GQYA 4CN1A 1ZP4A 3NVYB 1HZYA 1U5VA 4FX6M 3B40A 2EJAA 2INEA 3POHA 1K7XA 2BDQA 3WH8A 4LC6A 3N4FA 2RDTA 3OQ8A 3PWIA 4B5VA 1Q6DA 4IUOA 2C79A 4W93A 1BKHA 2KZHA 2WPEA 2AOSA 4DJDC 2AAAA 5A6SA 3T2PA 1R9XA 2DT3A 1IGWA 3R58A 1N62C 2ZTJA 4IFKA 4C6OA 3CK5A 1OT1A 4IISA 4Q8TA 2YDQA 3ONCA 3I10A 2XIIA 1FX6A 1Z42A 1GZGA 4NILA 3E0LA 1C9WA 3BLKA 1ISWA 4EKJA 4OIFA 4XO6A 4D2JA 1R0MA 4E2OA 4PCNA 1SUXA 1QRQA 4IUGA 1VIZA 1YNYA 4QEHA 1SJBA 1XKYA 4ECLA 5CZ0A 4WDXA 2EPMX 2YDRA 2CLKA 4XBJA 3LGDA 1WXZA 4DYJA 1MXSA 3M44A 3O15A 3OA3A 3TJ4A 2A3BA 4ML4A 3DYMA 3GXDA 3UY7A 1EJRC 3EWDA 2PGFA 2YA2A 3Q4DA 5FL0A 3FJ4A 2WPGA 1S3HA 3F5KA 4AHQA 5FJRA 3PG6A 1A5MC 1P48A 7ODCA 2ZDSA 4D1IA 1RUSA 4DLFA 3EAOA 2Y7FA 4YYFA 4H19A 2HXUA 4XZWA 1B0IA 1S7MA 4UNKA 5D8WA 3A12A 3U4FA 3W28A 2J4GA 5G2IA 2F38A 4O15A 2AQWA 3WLRA 3C8NA 1X2GA 3IUDA 1PCWA 1GVFA 4C1NB 2KAUC 2RDXA 4K2SA 4LV4A 4N6EA 4F40A 3BLOA 3ZR5A 1DHKA 1NFBA 2Y5SA 3ZYZA 1JQXA 1VD6A 1WOAA 1FWGC 2PRMA 3GRTA 4QAIA 4HNOA 3GNDA 3BLLA 3QHOA 2TAAA 4BWLA 1FRBA 3SQSA 2P53A 1JL8A 2PURA 3CQKA 2FZ9A 1AQMA 5HOSA 4HOWA 1RH9A 1A47A 3TN5A 1WKYA 3CWOX 1E6ZA 1OT2A 1EUAA 4ZXOA 2C19A 2QYGA 4LUSA 3ZLGA 3BV4A 3ZJ6A 3B8IA 1ISVA 2FB2A 3VX1A 3LCLA 3JU2A 3OYZA 3PN8A 4DWSB 4H8VA 3TSBA 1I4NA 4S2BA 3EA2A 2PZ0A 5CLTA 3QOMA 3B03A 4O0ZA 1N82A 3NQVA 1AUSL 4HGXA 3DUGA 3ABXA 3MQTA 4J28A 4PRWA 5I78A 5KEZA 1EQPA 5JCIA 2CWNA 4H7VA 3WF3A 3MCOA 5H1WA 1NDZA 4GINA 2QQ6A 3TYAA 1S3TC 3SCSA 1LLOA 3RGTA 3S5YA 1EEPA 1FFUC 2PU1A 2VZOA 1IGSA 2CU0A 1PIFA 3E74A 4UB9A 1EGZA 3LHZA 4WDWA 4GD0A 1G4PA 1TWDA 4LCQA 5FIPA 3QV9A 4EPEC 3B4YA 2IPJA 4M24A 5HWJA 2XFYA 4W85A 2C3ZA 4IP4A 1E0TA 3R07C 3QZEA 3G2GA 4NSBA 4LCRA 4XD4A 3LY0A 1WZLA 4E3TA 3VUSA 3SDOA 2RJGA 4FLOA 4DBWA 1J0ZA 2ZVRA 4F3HA 5FL1A 3GG8A 4B3KA 1W5MA 1EF3A 3M41A 1VH7A 1E55A 3W07A 4ZOHB 1H50A 1WKDA 3DFTA 2E8YA 4O14A 1RY8A 2OVLA 1FXQA 4A8IA 3SQPA 1F8IA 2Z2BA 1NHRA 3WUFA 2Z6IA 3TW7A 3FEQA 1OFRA 3O6DA 2GSJA 1GVRA 3VOCA 5AZ1A 1OZQA 4BQ3A 3FXGA 4KQNA 3UXLA 1IXOA 1ISYA 5DELA 5LIKX 2XSXA 3O16A 1SO4A 4QDWA 4LPCA 5FSDC 4FSAA 2ZKMX 1BQCA 5TD4A 1XINA 4HN8A 2V5LA 2XFFA 2ZRZA 4XKYA 1LBLA 1X1ZA 2BLEA 3F5JA 1V7AA 1HJSA 1HL9A 3UZXA 1WBJA 3KP0A 3QMRA 1ZJIA 3IAQA 4B9ZA 3ES7A 3V3WA 3WDJA 3V1HA 3GC5A 4E8GA 1QI4A 4O1AA 1RM6B 1IQ8A 1TVPA 1DEDA 3UR5A 3MP3A 5D9OA 4B90A 2OGJA 3W6YA 2L5HA 4S3EA 3VFCA 2NSOA 2J7CA 2JGYA 3A21A 3FCPA 5JIPA 3NYDA 1H09A 5IHRA 3B9EA 1OEPA 2ZIDA 1HJUA 3SY1A 4BJHA 4NZCA 5SWUA 3W88A 5A94A 2J7EA 4KFNA 3AIBA 3UWZA 3RCMA 2Y5EA 1QW8A 1GRGA 4ADTA 4I7VA 2G41A 2OZ8A 2ZRUA 2HRWA 2V30A 3V35A 4HBKA 3KBSA 3GH4A 1EBDA 4HYWA 1FHVA 1O6IA 4C60A 3CLWA 2XSAA 1WDPA 3ABSA 3IJQA 3RLHA 3G0UA 3GVWA 5AHLA 3TR2A 2E9MA 2A85A 1IT7A 4CVUA 3A7AA 1UMLA 3P84A 3W7HA 1N8IA 2NQZA 1PTGA 2EAWA 4ZQNA 4EE9A 2X1TA 3M7SA 5AHFA 2BNJA 1TPC1 3DGBA 4JHMA 2VKZG 1W2PA 3XISA 2X8GA 1IIHA 4J57A 1PVNA 2INZA 1K7FA 1J2BA 4QIUA 1UP3A 4WF7A 4H4ZA 1UR1A 4HYRA 3PZOA 3FHQA 1R30A 1QPNA 2ZZ7A 5CQ1A 3CV7A 1N55A 1KCLA 3E49A 5C55A 2CCRA 2ONEA 4IG2A 1Q6EA 1W5PA 2AAMA 3W87A 4AZGA 3CLMA 4AW7A 3DBPA 3QY7A 2VGGA 4JTJA 4US6A 2G50A 3L4ZA 2DUAA 4X2RA 3EXRA 1TREA 3UWEA 2W0UA 1WDQA 1GHRA 3B8UA 1AOGA 3WJWA 3CMGA 1R6WA 1VDVA 3CV6A 3M0YA 3EX3A 4GUGA 1S2UA 1VBGA 1TTJA 3L7RA 4AZIA 5LYRA 3GXMA 2QVNA 3NSNA 3FY1A 3FKKA 1XH2A 4U5IA 1LTDA 4H41A 1NU5A 3GTHA 3WLKX 1ZTVA 1I0DA 1KGXA 2HPIA 1JIBA 2E3ZA 3E9AA 5DQPA 1LUCA 3LADA 4JTKA 1NQ6A 2C18A 4S3AA 2WVVB 4XO7A 4L56A 1A80A 3W82A 4LJ3A 1W9XA 2AQVA 5FAJA 4NNBA 1F7BA 1SFTA 1V3KA 4RL3A 3ARVA 1ISZA 3CUZA 3CZGA 2VEPA 3NEHA 3R10A 2YCIX 4Q8UA 3MY9A 3KZSA 4IMGA 3TAKA 2VRQA 1P0NA 3D6NA 3OLEA 3SIZA 4EQWA 2JKEA 4I5RA 5A2BA 4IMEA 4H4IA 3IAPA 3THQA 1TCDA 2WOVA 4MZ8A 4H4RA 3DHFA 5IOBA 4Z08A 3F4NA 1G4TA 3FN9A 2ACSA 1XM3A 4ATLA 2ZXAA 2NZLA 3G1HA 4XZLX 4WLCA 1AL7A 2FGBA 1KV8A 1DVJA 3P81A 1B30A 1BWKA 1BYAA 4AX7A 4O1CA 4ZGYA 4GBUA 2FQIA 4MG4A 1F3XA 3O63A 1QPQA 5EGRA 1U2YA 1SZRA 3KZPA 4EIVA 3MU7A 2RDWA 4HZ8A 2QPUA 1FWNA 4IFRA 5ECUA 1Q6LA 3NVWB 1E71M 3L23A 2DVUA 3IVUA 1QNOA 2VOTA 2YCJA 3CZKA 3KCLA 1E4NA 3W6MA 2J75A 3VKAA 1UROA 1OK4A 2WW5A 1OYBA 4PB5A 5BRPA 3MWCA 4P7RA 1O1HA 1T5AA 2EPOA 2G5WA 1RD6A 3NQDA 1X97A 1NIUA 4RUBA 2QT3A 1H7XA 1QOXA 4QHRA 3ERPA 3BOXA 4IJRA 4MHBA 4A29A 1TTQA 4JXCA 1JAKA 4NXSA 4YHEA 4XAZA 3W3OA 4L4PA 5D38A 2OYLA 3U57A 4A05A 2BHUA 3SURA 1V97A 2PWDA 3E0FA 5TIMA 1ZALA 3BCJA 3NFUA 4ZOAA 3MUY1 3M5VA 2QCCA 3UCDA 4PMQA 1RBOB 4J35A 2D2OA 4UQDA 1EZ2A 5D2VA 1HG3A 1TMQA 3M0ZA 1KXHA 4AD1A 1S39A 4IX2A 2ACRA 3P74A 5FF0A 1UJQA 1LF1A 5C9WA 3ZR4A 4E8CA 2I9UA 4I9MA 2BOGX 3GXIA 2PDGA 1H5YA 1J0HA 4I3GA 3IWPA 3KBWA 1XYFA 1JNDA 3VKKA 3MB9A 3T0DA 3OTRA 1GW9A 3EUB3 2EEXA 2XZ7A 1MEIA 3WF2A 2J47A 4PMUA 2I57A 4UTWC 2FZMA 2R1KA 1IZCA 3PF3A 2XH7A 1JPDX 4ILSA 4QLJA 5EPDA 1GGOA 3D3AA 1F3EA 2A4AA 2C1IA 2H90A 1TWSA 4GYJA 4LW7A 1O94A 3N2CA 2JIWA 2VX4A 2B7PA 4UMCA 4MSSA 4FIRA 5F2IA 3VC6A 3TKFA 5DRIA 2QVHA 3WDRA 1DIDA 2SFPA 5D2TA 3FX4A 4OV4A 1E1EA 3WIJA 1H5VA 5C54A 2GL5A 1BWVA 1Q6RA 1JZ8A 1OX6A 3KLJA 3C3NA 3LUTA 2Z28A 4Y8FA 1TTIA 3BE7A 4IIDA 2QUTA 6XIAA 3FW6A 3K46A 1NAL1 3Q58A 3GHRA 1KTCA 4YHGA 3IRDA 2NQLA 1DV7A 4K7VA 5FEXA 5AHIA 1MZRA 1PTAA 3LYEA 3S4TA 4CN4A 3RFAA 3VMPA 4ZOEA 2QHAA 4EP8C 4IIBA 1E6RA 3IEBA 4C6PA 2ACQA 1TUFA 5A69A 3AIWA 3LENA 3EB2A 3BSGA 3REQB 1RVGA 2ISFA 3CAVA 4ALDA 3NWRA 3WNOA 3L4XA 4UQ9A 4C1NA 5BU9A 2VFDA 4LVAA 3L21A 4FMVA 3GWQA 1XDIA 1ICPA 1EJWC 4S3KA 4G9PA 2GSHA 2IQDA 4GG9A 3EKLA 3GUGA 2CWXA 1B4EA 3LZ3A 3TFCA 2YQUA 2CZ5A 1F6PA 5HANA 2QCHA 1B3ZA 5A5WA 1ODZA 2V3BA 3RM9A 2P76A 3TCEA 4YTSA 1GRBA 1QHPA 9CGTA 4JIEA 5EBAA 4HA1A 2O9OA 3V36A 3GXNA 4GGHA 1X1NA 2WZEA 3TTEA 1IEVA 4O8AA 4RDZA 3PC0A 4QGCA 3T55A 4IQJA 5BWAA 3EDDA 2VC6A 3QGAC 4A2SA 1TFVA 2QJGA 1R3TA 3D46A 4IPJA 1GRAA 2GLKA 3H4GA 1V02E 4LRSA 4CCDA 3SCUA 3TQVA 4ZFCA 1AZ1A 2PODA 2TYSA 4MKVA 3I3BA 1LROA 1X98A 1SJCA 1POJA 4GVGA 4JD4A 3RR1A 3NSMA 3QGKC 5C7HA 1XLIA 4BF7A 3ZSTA 4WKAA 2YB1A 1NWUA 3CBWA 3PR2A 3W53A 2NV9A 4WSKA 5I3IA 2GGIA 1QBAA 4AY7A 5B80A 2XHYA 1KD0A 3R25A 4H9UA 4H50A 4UTTA 4I9AA 4Q22A 1HKVA 1CT5A 4ICNA 1WZMA 1P0KA 1FKWA 4GE8A 5CSYA 3CL6A 2DVXA 3WH7A 1A5UA 5CG0A 1OFEA 3EMQA 4FNPA 3APYA 2YCKX 4FF5A 1R87A 1I1XA 3UWVA 3NM3A 1QO5A 5IFPA 2DZPA 1VFOA 3O0KA 1T99A 4UWMA 3WQ4A 1PSCA 4O10A 4F2UA 5AVHA 2VEMA 3W2KA 4KBXA 1GTHA 4GZIA 1XYAA 1TZZA 2J7GA 4W7WA 1JCJA 1RJQA 4C6MA 5HUOA 1E9ZB 8A3HA 1Z9AA 3AU6A 1KN0A 2BY2A 3RX3A 2ADAA 3RNMA 3ID7A 1VC4A 3OZMA 5EFFA 4AZCA 4ZTYA 1JCTA 4Q4PA 4BI7A 1XYBA 3K4AA 3IIVA 4WZHA 5DCDA 3EMCA 2VC7A 1BXNA 2YVGA 1A5KC 4XX6A 1NTHA 4ZQCA 4V15A 4F0SA 1ME9A 3WBYA 4CGTA 1CGYA 5LZLA 4WXYA 1R2TA 1OBAA 5A6MA 3AXKA 3G3MA 1O95A 3BLFA 3A5VA 3EOEA 5CPNA 1IHIA 3DC0A 4XBKA 4P7OA 2ZZ0A 2E4TA 3DX5A 3GHSA 5DFAA 2VQUA 3WMLA 3BQ6A 5KZMA 4B5SA 1V93A 4H4WA 1MW1A 2PC8A 5CPQA 3UWQA 3ANYA 1E0XA 1AL8A 2NT0A 3UYIA 2J7FA 3IJ9A 4GCXA 3UXIA 1UYQA 3QY8A 5TNVA 2ZX6A 4LT9A 1EJ7L 2C0HA 3WMCA 4Q4QA 5CGQA 1H1ZA 4RZ5A 4PUJA 3OBAA 3C56A 3BCDA 1E4MM 1DIKA 2GJXB 1Q2RA 2DUXA 4H9ZA 4DWSC 3BW4A 1DWJM 2D24A 3MI3A 3SGGA 4AMAA 3UG4A 1YXYA 3EGJA 4G7EB 1JRPA 3M47A 3W6LA 4E5TA 1LJYA 4XZHA 3T09A 2FZNA 2HK0A 1S1RA 4CU8A 5A6TC 2BGNE 1SW7A 1K6WA 1VFMA 1E73M 4UNLA 3TJXA 1L0PA 2OKOA 4Q7BA 3RPMA 2DIJA 1NDVA 4DI8A 3GSMA 2V5CA 1OWQA 1UBPC 2Z0IA 4PMZA 1OX4B 3P8JA 1EUNA 4B3ZA 4M5PA 3PSWA 5CSSA 5AC5A 5F2LA 4PBFA 1KQYA 2QZRA 2ODOA 1TRIA 3KRZA 1XIGA 1ONRA 2OZ3A 2XVPA 5PTDA 1XLBA 4S38A 1SO6A 2VR5A 5G5HB 4JQ4A 3ARXA 4HU4A 3WH6A 3PZNA 3TLLA 1J11A 3OGSA 3W7JA 1X8FA 4JQAA 5ENLA 4YVPA 4HNLA 3B0VC 1W8SA 3IUIA 1ZBKA 3N9SA 1XBXA 3BMWA 2ABAA 1F6KA 3SI9A 1EEXA 1K8CA 1D8WA 3T9PA 2ZX9A 1G67A 1O5QA 1KCZA 1YXDA 2E5DA 2PTXA 2VZVA 2GDVA 3VD9A 3DYOA 3TOYA 4GISA 3W2NA 1MYRA 2C6QA 1E70M 1OVDA 2A1YA 4H4UA 5A6JA 2NX3A 1TQJA 2Y0FA 2ATMA 2Y4SA 5HBFA 1CXKA 2EQ7A 1IXPA 1MWOA 4KIRA 2O9TA 2ZUSA 3PAJA 4LFYA 1CXIA 2XGBA 2PDMA 4MPKA 5DRCA 3VOHA 2F6XA 4FDCB 5GJMA 5TQLA 4ES4A 1JZ4A 2PBOA 1V8EA 3G1XA 5KZDA 1HKJA 3KVJA 1DTUA 5CC7A 3A5FA 3ITLA 4LF1A 3MKKA 4B16A 3UR2A 2CLPA 3AUOA 4BS0A 1YMYA 4K38A 3KP1A 4HB7A 1EYEA 1KBIA 4Z0SA 3W9ZA 3PBUA 3DFHA 3MMWA 4NAEA 3GG7A 4YMZA 1TPWA 2GQWA 4Q8PA 3SSZA 2XTKA 3G1YA 4M7TA 4QXIA 3MDUA 1F2JA 1JZ5A 2BHZA 2PC4A 1RBLA 5E6YA 2X8HA 4HMCA 1UD8A 3NSXA 1GQJA 4NAFB 1EA0A 4H8NA 3TQ0A 3NOYA 2O4QA 4OHQA 3EX1A 5H8MA 2P3EA 4IX0A 3VAVA 2EQ8A 1UG6A 5K7JA 2ZQ0A 1RPXA 3GFZA 1TV2A 3BW3A 1D7FA 5FJTA 3UPWA 1GERA 5CAHA 1M1BA 3KFTA 1SO3A 2CLOA 3WNMA 5I02A 3CZJA 3IUHA 4HNTA 1X8CA 2E77A 4LH8A 4IWWA 3P93A 3V1PA 4EX4A 1K8ZA 4F66A 3M6DA 3O6CA 2D1ZA 3DK9A 1RP9A 1YTDA 1FY6A 4GX8A 2JALA 2TMDA 4JX6A 1Z7AA 4CD8A 1AG1O 3WD4A 4WKHA 4RXGA 5E93A 1MNZA 3N4EA 3UBPC 2PCQA 5H6HA 2Z7KA 4WY0B 4JYFA 1O60A 5DBUA 1A3HA 3W1PA 1D8CA 3M9YA 1W3TA 1HT6A 1VFFA 3C2YA 5EMKA 2P5NA 3K8KA 3A47A 3CPUA 4O17A 1QNSA 3QQ0A 2PDQA 1C7TA 5CEWA 4DJED 3VIHA 1XISA 1XPGA 5CG7A 3L4YA 4OU1A 2G97A 1LL4A 2J25A 3TW6A 4AMCA 1TJ1A 4LXFA 3BW2A 2PI6A 1VEPA 2OMAA 1T96A 3QW4B 1N61C 1JRCA 4A22A 4UTHA 2O56A 3IS4A 1G4SA 3EWZA 4IIEA 3SSJA 1M7JA 1VPXA 1XH0A 3QTGA 4JX4A 1FWCC 3WFZA 5CGTA 4JTAA 3CQIA 2YR1A 4GC3A 2PBGA 1Q7QA 1V4YA 3GIQA 1L6WA 3URBA 1IEWA 2OEKA 3R0DA 3DK8A 4WGXA 2WZTA 3V5FA 3JRKA 3WBAA 1KTBA 3PUEA 2O0TA 2W63A 1HJXA 3BGJA 2DSZA 3MT1A 1MQRA 3WJYA 1GYLA 3NQ8A 2I5GA 2ZCGA 1ZDLA 1PS9A 1E3ZA 2DZXA 3C2EA 1Z6KA 2GOUA 3IC9A 5F1VA 2GDUA 3F1QA 6REQA 3LTYA 1TV4A 1ODUA 4X9YA 2CEQA 3BURA 1EIBA 4UNIA 1ZCCA 3II1A 1E6SM 1SFJA 1AJZA 1CDGA 3AJ7A 4WSHA 1WOBA 5C71A 3ZWTA 3DK4A 3M5ZA 1VPQA 3P6LA 1B3VA 3THUA 3MUAA 3DN5A 1ITQA 1KFBA 4OE7A 4C7FA 2Z1KA 1BKSA 1UWTA 2J9YA 3U48A 4K8DA 1V02A 2XU2A 1KBBA 1EF2A 2XVNA 4LUJA 3EOSA 1GUVA 3GXTA 2BY0A 2BFGA 1H41A 2E28A 4KEZA 2OX1A 3DDMA 3H2CA 4LCSA 4E4FA 1F9CA 3TNOA 4JTDA 3RPDA 2DW6A 3C52A 2ZA1A 5I5RA 1CGTA 4JDRA 1GKQA 4JZ5A 3R8HA 1HO1A 2QAFA 2W27A 2WSQA 3STPA 2HS8A 1PZ3A 2WM0A 2O7SA 2NQ5A 1DE5A 2V3AA 4FOUA 3AXXA 1RHCA 3WF1A 4K7YA 3VNMA 1D9EA 1V6TA 2ISWA 1RA5A 1DJIA 2PDIA 3VCRA 4CUCA 2I1OA 3UXKA 4NRSA 5HMDA 1XBVA 1AMYA 4ONVA 2CBIA 3SEPA 5FACA 1NFGA 3EYPA 4S23A 3ATYA 3EX6A 1QK2A 3BH4A 5I3DA 2OXNA 1GG0A 3HOJA 3R43A 2GQ3A 4NUWA 2ON3A 4K68A 3R8RA 4NP7A 2IKHA 1DBTA 1TR9A 1LG2A 3L9CA 1KRMA 2XJ7A 1QOPA 1HIZA 2WMHA 4OKDA 1UWUA 5LHFA 4NHVA 1NH6A 4A3YA 4QISA 4B91A 1KM2A 3L0KA 3PJTA 3QHNA 4W4QA 5A2AA 2FKPA 4DBDA 2DZSA 5C9RA 5BYWA 4EMIA 4TV5A 2H3DA 1O7AA 1E1FA 2WJEA 3W71A 3SCQA 2PGEA 3ES8A 1E0WA 2Z00A 2XM2A 2YCEA 1MO9A 5ABFA 1R85A 1EGMA 3NIYA 3WDIA 4H4PA 3TTSA 1REQB 1E1CB 4FALA 3HJZA 4L9XA 1SJDA 1MW2A 4YN5A 3O2LA 1L2QA 3TIMA 4YCOA 4UR9A 2G4FA 4RJEA 1PXGA 2E5AA 1AD4A 4ICCX 3BAJA 1QNPA 2XN0A 1C8YA 2X2YA 1DIEA 3UGRA 2PRHA 3KVKA 2OYKA 4AD2A 2YSWA 1UH4A 4FNTA 3R89A 4NIRA 3N73A 1YBQB 4OBRA 1DWGM 4NZJA 2BY3A 1ZMDA 2ZX5A 3CWNA 1W32A 2OFJA 2I17A 2PWVA 1JCLA 2V68A 1W9DM 5BWFA 3BG3A 4L61A 1HUVA 1IT0A 3TWAA 4GYPA 1L9WA 4JGDA 3W29A 3MWAA 2J74A 2R9ZA 1XRSA 3ZR6A 1CXEA 4QNWA 3GYCA 1US0A 1LBFA 4Z17A 3UEQA 1H49A 2QCGA 1BQGA 1UWSA 3C2RA 3M6YA 3LHTA 5I3GA 1JAEA 1XL9A 4GABA 2J8FA 3M0MA 2QV5A 2ZFAA 3URNA 2NQJA 3UA4A 3TONA 1QU4A 1CGWA 1FWDC 4RNHA 1E43A 3LRMA 4V1YA 4HTBA 5FCZA 3BMXA 3LTSA 3MKVA 4HNNA 2PTYA 1JG9A 1SZGA 2BV9A 2BS9A 2ZYFA 2PRLA 3WJXA 2X0SA 3GVRA 1XLDA 4MY1A 1I45A 3BAKA 4D6DA 1DOSA 3W24A 2PDPA 3L4WA 2QR6A 4H1ZA 1OX4A 5HMSA 1AH0A 2J9XA 4H2CA 4HPGA 3W1RA 2BC1A 1GQLA 4XQ6A 4H4VA 1L8PA 3BJTA 1FEAA 2VCBA 1CW2A 1JD9A 4F2TA 3P7YA 2IUZA 1A5AA 3F4VA 1SYTA 2OOFA 1ZJBA 1OG6A 1FWSA 3WQDA 4IQEA 1Y0EA 2WSKA 4EOUA 2BHYA 3SQMA 3CIXA 7XIMA 4YWIA 2G0WA 3RCNA 3NQAA 1J79A 3VKDA 5HQEA 4O52A 4DZHA 1NWTA 3T7VA 2ZWYA 2WM1A 3E0VA 4PTVA 4I9JA 1XP3A 3BARA 5FF2A 4W5ZA 3GVQA 3A3XA 3E12A 1Q2SA 4ZB2A 3MMTA 1WBHA 3WEZA 1BZLA 4S39A 1OB0A 2NW0A 5E6ZA 1SZFA 3W7QA 1VR6A 3E96A 1QO2A 2GWNA 1XIMA 5D9MA 1ENUA 3BAXA 1T0OA 2PLJA 1Q1RA 1DQXA 3SR7A 3WL0A 1TVNA 4YPJA 3C8FA 1DJYA 1XLAA 4GA8A 2JGQA 1TV5A 3H26A 3K4WA 5C2GA 3E5PA 3FGCB 3LLDA 3M7WA 3RX4A 3V4BA 4FF7A 4M82A 2NVCA 3R8GA 5DCEA 1H60A 2QJIA 2TPSA 4HHMA 2WOWA 1DHPA 4DWDA 2XFRA 1HF6A 2QGYA 4X0NA 2E6FA 1GQNA 3RO8A 1IYXA 3DI0A 2V38A 3HGRA 2OLSA 1TYPA 4BI6A 4DPQA 5T8GA 4LNYA 2XG9A 1U5JA 3GM8A 1OC6A 1UR3M 5HATA 2QDGA 1CEOA 1H1YA 1CWYA 1C91A 1JDDA 3AYSA 2IXVA 3LXBA 2VVSA 2G95A 3E38A 4RE2A 2ANUA 2GOKA 1GORA 4U5KA 4IPPA 3TQPA 1DXEA 2J7DA 1GQIA 3OGRA 3MBDA 4P5UA 1QWKA 5CSRA 3EOOA 2WC4A 1DJZA 4JTFA 3W7OA 4S3DA 4XZNX 1WDRA 4S3JA 1EDQA 1HKIA 4C6IA 3OP2A 5I09A 3O05A 4URIA 3PULA 4JNYA 3AI0A 2UY5A 1C9DA 4H6EA 4NY2A 4KRTA 4H9TA 3A7UA 3E2RA 4GQRA 3SN1A 1Q4NX 1Q6QA 5D30A 2X7WA 3Q2DA 3LPFA 4ZO9A 1I60A 1CZ1A 1OCNA 4L6HA 6CGTA 3MCNA 3NOEA 5DY2A 3GBEA 5IHSA 3RYSA 3NQ7A 2WOIA 4IICA 2D2HA 3NGJA 2HDJA 1V03A 4GYFA 4D9PA 4PBEA 1MUWA 1W56A 3N2XA 2FHBA 4Y7EA 2AQOA 1JYXA 5M17A 3LXCA 4W8BA 1M01A 2QV4A 5LA0A 1Z89A 2DZTA 5I6SA 4JTUA 4XZBA 1W8GA 1J18A 3PJWA 4TQTA 4A8RA 5HMEA 1M41A 1YE4A 5F1UA 1D3CA 3TROA 3HQPA 1G7UA 3GDLA 1DJNA 1UP2A 1BF2A 1AODA 3PZVA 1KRBC 2PWHA 4RPPA 3DCPA 2A7RA 2E67A 2WKLA 1VCFA 3OIHA 4UFMA 1P6BA 1NVMA 2DZWA 5MF5A 4OV9A 4AZ6A 1EOKA 4YVVA 1K8YA 3RK8A 1XIIA 1MQQA 2ABBA 4WXZA 3FYYA 1FWHC 2VOMA 1F4AA 2FVMA 3IK2A 4PE8A 4MNJA 2GQ9A 1Y65A 3BQ5A 1EJXC 4Q4OA 4AD3A 2F6UA 4H9MA 2FFCA 3M4HA 4X0VA 5BXTA 2Y1HA 1FBAA 2FTYA 5JQ9A 4BKNA 1UBSA 2W61A 3WQGA 3QKZA 4NZ3A 3GVGA 4FXJA 3WBEA 3BCFA 3UJRA 5LHEA 2QS8A 4JKLA 5FF7A 3MYOA 1AFSA 1OG0A 1GTEA 4PR4A 4MY9A 4M6VA 3NDOA 3P80A 3UPMA 3AALA 1AH3A 1KB3A 3AMCA 5TAOA 3FFSA 3SADA 1KWKA 5FJPA 1K4QA 2G37A 4E4UA 3TTQA 5A95A 5DMNA 5JRBA 4KWWA 2GR0A 1MI3A 4POCA 4FX8A 3NEVA 1GKRA 1NY1A 1M7PA 1QHZA 3SIMA 2YW3A 4FX7A 3KL5A 1BSLA 4DRSA 2JK6A 3MS8A 2FLIA 3SY5A 5MKGB 2A6NA 1LG1A 3ZM8A 3CU2A 2CBJA 4L4OA 4NJJA 1AQHA 1VQTA 4KRZA 1H4PA 5DMLA 2DEPA 4GRSA 5A8PA 4Z1CA 3H7RA 1JCMP 2X40A 1YW1A 1UKPA 1HJQA 4O1FA 3BK0A 5FEZA 3AC0A 1XSKA 4CQ9A 4C6DA 3OG3A 3GK0A 1ZU8A 1CGUA 1UKSA 2YA1A 1PZ2A 3CGTA 3RRXA 2VDGA 4FNSA 2G3JA 1UR8A 3EWXA 1TRDA 1UR2A 4NEWA 1FWAC 1KFLA 3A9IA 3G77A 3RMEA 4MWAC 3MTWA 4LYQA 3WLHA 3E02A 3VK5A 1BGGA 3IANA 3I6TA 1SMAA 3FA3A 1VYPX 2NX9A 2XWDA 3SGUA 1P7TA 1EP2A 1SR0A 3GR7A 4N9BA 4J3TA 5EKYA 4H4XA 1ZJAA 4EF8A 3UF9A 4CCEA 3GDKA 1UH2A 3N29A 3B4UA 3KOYA 1A53A 2JK2A 3W7LA 4Z1DA 2BVWA 4JN6A 3KBVA 4J2PA 2ZX8A 1V6UA 1Q6CA 4IIGA 1S2WA 3DFPA 1GCYA 3W74A 3ARZA 3I68A 5EMYA 5AFDA 5BRQA 3UYCA 4DM1A 8RUCA 3CGEA 2XGZA 4TR9A 4QCEA 4IT1A 1T8XA 3MJMA 1XCXA 3A3WA 3LGEA 3UERA 1YE6A 1RA0A 2OWXA 2Y24A 4ZE4A 4MOZA 4HNUA 2QEZA 2V63A 4NZ1A 4BFAA 1A5BA 1GREA 1IR1A 2OSWA 2W3ZA 5K9CA 1R3RA 1FWRA 4M7SA 4WUIA 3HFYA 3CYJA 3CMJA 1IF2A 3E0IA 3B9JB 4R5EA 3QSTA 3U0HA 3W1TA 1R3SA 4CD5A 5C7VA 4PCFA 1YHTA 4C6LA 2W4XA 4LVFA 2P0OA 3ZOAA 4KT2A 2DZAA 5HNNA 4G1KA 4GVIA 2YZ5A 1UQZA 1XG3A 4K6AA 1VYRA 3RR4A 1TJRA 5GNYA 3OW1A 2Y2WA 1FKXA 2HV5A 2VFGA 2CFYA 3WEOA 2NUYA 2V81A 1VLWA 3W2LA 2DJXA 3U2EA 1AJ2A 1V51A 3RRAA 2GH5A 1MNSA 2HXTA 4JNZA 1R46A 4GIAA 3APGA 1YBQA 3ENLA 1UWRA 2QCMA 3U7BA 1JYVA 2V5DA 1I2NA 3NVTA 4PL2A 4MNLA 1R8LA 3KL0A 3UXDA 4H4SA 1LOLA 1OX5A 4K36A 3IJ7A 3PS7A 4CQ8A 4ACZA 3AHVA 1A0DA 3OG2A 5HNTA 3N18A 1W1VA 3OC4A 1YLVA 3AMGA 4N4QA 5F2GA 4I9TA 3OBKA 1EO5A 3MMUA 5GPRA 3NO3A 2ZX7A 1NDWA 4H6KA 1VENA 2PWEA 4JHZA 3M1ZA 2OODA 3SRFA 4QJ1A 3IK4A 2WB5A 2Y85A 2YYTA 4J7RA 4MKSA 2H3BA 4I7WA 3SJNA 3M0KA 4JNMA 4PH6A 3GDRA 5BOEA 3KRSA 1H63A 2D0FA 4L5ZA 4S2CA 3M0XA 4M8UA 3K1GA 1Q7ZA 4JPGA 2WBGA 1MQPA 3I7RA 4IL0A 3VINA 3S2MA 4B5NA 1CYGA 1GVSA 1UR0A 5E9XA 2DZVA 1JPHA 4ZB5A 1W3KA 2X30A 2J88A 4HHLA 4QX4A 4NJGA 3NUKA 1W3HA 1IT8A 3U2ZA 1MDLA 4YS1A 4MAZA 3ELFA 4IFKB 3HIJA 3HG5A 1PJ9A 3W38A 2V9DA 4RLIA 3T05A 4P8UA 3T0AA 1ADOA 4L65A 1Z32X 2PTWA 1QI2A 1RR2A 4CLMA 4PN2A 4ZSUA 2Y8UA 4CN6A 4RV3A 4RZ4A 1JFHA 4RZ6A 1OCBA 4JIIX 3BTNA 1XWYA 1XHGA 1FOBA 4A21A 3BPWA 4R34A 7PTDA 4KIEA 3BGGA 1XYZA 1JF6A 5DN1A 1M7OA 3WBWA 3DOPA 3U5UA 3N2OA 3C2OA 4DZIA 3EOLA 3KVLA 3WLQA 1ZB5A 3AXIA 4ATDA 4LV9A 3S5SA 3PZMA 3M16A 1CIUA 3HF3A 1ZS2A 2XFWA 1QW7A 1NHSA 3ETRB 2O9RA 3MPGA 4A3RA 4DI9A 1W3JA 4MY8A 3ARSA 2CITA 4L9ZA 3EAUA 3Q6JA 1FEBA 3BMVA 1GVIA 3LGGA 3RHGA 5A8QA 4GQGA 1RSCA 3AZTA 4LRTA 2QPXA 1NOWA 2VL4A 4Q33A 4QNEA 3QOKA 3FGCA 3KHJA 4MWAE 4GQ0A 1J12A 1OC7A 2VEGA 3CUXA 4MFEA 5K9XA 5AHNA 3PWAA 3S2NA 1DJWA 3A4AA 3ZQ9A 4UC5A 1ZL1A 4DUVA 3P62A 1QCWA 3W25A 3VGGA 2Z29A 4HK7A 3O9NA 3IGSA 5A6BD 2ACUA 1JZ3A 5KSWA 4L1XA 4Y8EA 4B5WA 4ADWA 1B90A 3AHZA 4LUSB 1NP2A 4UTKA 2V6OA 3VE9A 4QQ3A 4YIWA 3W81A 3LRLA 1EX5A 2FFIA 4JQ9A 2Y62A 1FFQA 4FZIA 2E09A 3AMKA 1FWTA 3ALFA 1HN1A 3E2SA 3N11A 4AY8A 1JFXA 3R12A 4EMJA 4JCLA 2QAEA 2H9AA 2HVOA 5HR7A 2XDFA 1VKFA 2Z1XA 2ZUUA 4DNMA 3HU7A 3EKGA 4UFHA 1LZOA 4UFJA 3TMQA 3ZLHA 3LMZA 4I6VA 4E2DA 1G01A 3B0YA 3RXZA 2NWRA 3VIOA 5IFTA 3CL7A 3B06A 3LM7A 4PODA 3R2GA 4PTMA 1GESA 4R7OA 1P43A 1XIHA 1Z44A 4BCEA 5HWMA 1TG7A 4JKMA 2