2NQLA

Crystal structure of a member of the enolase superfamily from agrobacterium tumefaciens
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
388
structure length
388
Chain Sequence
MNSPIATVEVFTLTQPRKVPYLGALREGEVVNPNGYIVRKGNRTVYPTFDRSVLVRMTTEAGTVGWGETYGIVAPGAVAALINDLLAGFVIGRDASDPSAVYDDLYDMMRVRGYTGGFYVDALAALDIALWDIAGQEAGKSIRDLLGGGVDSFPAYVSGLPERTLKARGELAKYWQDRGFNAFKFATPVADDGPAAEIANLRQVLGPQAKIAADMHWNQTPERALELIAEMQPFDPWFAEAPVWTEDIAGLEKVSKNTDVPIAVGEEWRTHWDMRARIERCRIAIVQPEMGHKGITNFIRIGALAAEHGIDVIPHATVGAGIFLAASLQASSTLSMLKGHEFQHSIFEPNRRLLDGDMDCREGRYHLPSGPGLGVRPSEAALGLIERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Isomerase/lactonizing enzyme
publication title Crystal Structure of Enolase from Agrobacterium Tumefaciens C58
rcsb
source organism Agrobacterium tumefaciens str.
total genus 133
structure length 388
sequence length 388
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2nqlA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2nqlA01
3UGVA 3CXOA 4A6GA 1R0MA 1SJCA 3TQPA 6ENLA 4IZGA 2GGHA 2NQLA 3N4FA 2OFJA 1SJDA 2PS2A 4H2HA 4JHMA 3TWBA 2OVLA 3MUCA 5ENLA 4MMWA 3ES8A 3S47A 3CAWA 3FJ4A 3THUA 3BSMA 3BOXA 2PGWA 2XH4A 2XH0A 4DHGA 3OZYA 1SJBA 2P8BA 3VC5A 4E4UA 2DW6A 4IHCA 4IT1A 2QJMA 1MUCA 2GGJA 1TZZA 3EEZA 3OZMA 1DTNA 4IP5A 3UJFA 3DIPA 2QJJA 2POZA 4ROPA 2XGZA 1R6WA 2OKTA 3CT2A 2GSHA 4KPLA 1OEPA 3D46A 4DX3A 2GGEA 4FI4A 1EC7A 2P8CA 4K8GA 2PP1A 2HZGA 3BJSA 5IDZA 3TJIA 3JVAA 1ONEA 2ZADA 3NFUA 2QVHA 3R1ZA 4KT2A 3FCPA 4IL0A 4ZA0A 3I6TA 4MKSA 2OO6A 4HCLA 2PA6A 2PGEA 3SN4A 4DXKA 2AL1A 1PDYA 3H70A 2OZTA 1XPYA 3V3WA 3S5SA 3P3BA 3FYYA 2OQHA 3CYJA 3UCCA 3TWAA 3RCYA 3ENLA 3OP2A 2HNEA 4GMEA 3T9PA 3QN3A 3TW9A 3JZUA 3NXLA 4DYEA 1MRAA 5BOEA 2OLAA 1MDLA 3PWGA 3MY9A 3IJQA 4Z17A 2QDDA 3VDGA 2OZ8A 2CHRA 3MSYA 4A35A 4K1WA 3H7VA 3ZVHA 3QKEA 1KD0A 1TKKA 1WUEA 3DGBA 3MWCA 1BQGA 3ZVIA 1MNSA 4HPNA 1KKOA 2P3ZA 3FV9A 2PODA 3P93A 3N6JA 3DG7A 3H12A 3SN0A 2AL2A 3DFHA 3EKGA 4HNCA 3DG3A 4IL2A 1XS2A 3ZLHA 3RR1A 4JN8A 3GD6A 3R0KA 2ZC8A 1EBGA 2MUCA 1FHUA 4GIRA 3UXLA 3VFCA 1NU5A 3QPEA 3K1GA 2P88A 1E9IA 5BOFA 2DW7A 3UCDA 3TTEA 4H83A 4FP1A 3GC2A 4X2PA 1JDFA 4KEMA 3V4BA 2OX4A 2FYMA 3MQTA 1IYXA 1P48A 2PTYA 3UJRA 2PMQA 3SN1A 2PTZA 3PWIA 3RRAA 3RO6A 1BKHA 2PTWA 3ZVHB 2PP3A 3R0UA 4KWSA 3TOYA 3OW1A 3FXGA 2OZ3A 5FJPA 1ELSA 1EC9A 4JN7A 3RITA 2OQYA 2XH2A 4GGBA 3T8QA 2AL2B 3TCSA 3KUMA 1MDRA 2PSNA 4Z1YA 3DEQA 4ENLA 2PTXA 3R25A 3OPSA 4HCDA 2ONEA 4E4FA 3DFYA 4HCHA 3IJLA 1P43A 3ES7A 1RVKA 2GGGA 2OPJA 3SQSA 4HNLA 4J3ZA 4M6UA 3SJNA 1KKRA 4GYPA 3V5CA 2AKZA 4DN1A 2PP0A 3DESA 2RDXA 7ENLA 4G7FA 2QDEA 3NZGA 3JW7A 3MZNA 2PU1A 1EC8A 5J04A 4M0XA 1JCTA 3PK7A 3IJIA 2OG9A 3VCNA 1TE6A 3GY1A 5FJOA 4A3RA 1ECQA 3SBFA 3IK4A 4H19A 3UJEA 3MKCA 2GL5A 3SSZA 5FJUA 2PPGA 1W6TA 1YEYA 4E8GA 4MGGA 4EWJA 4GYPC 3TJ4A 4GGHA 3UJSA 3R11A 2PCEA 2AKMA 3T6CA 1JPDX 2I5QA 1JPMA 1PDZA 3P0WA 3STPA 4IP4A 3FVDA 4H1ZA 3U9IA 3CB3A 3Q45A 2P0IA 3DG6A 3UXKA 2O56A 3N4EA 3T4WA 4K2SA 3QTPA 4J1OA 3N6HA 3RGTA 3GO2A 3ZLFA 1KCZA 4DWDA 3D47A 3U4FA 3VC6A 1WUFA 1FHVA 3I4KA 4YWSA 3I6EA 3DERA 1SJAA 4E5TA 4E6MA 4G8TA 1EBHA 4HYRA 2FKPA 3R10A 1L8PA 4ZCWA 3HPFA 2QJNA 3VA8A 2MNRA 2GGIA 3B97A 2HXTA 1F9CA 3QLDA 3ZLGA 3UJ2A 1NELA 2XH7A 2QQ6A 4GISA 3OTRA 5FJTA 2HXUA 3PFRA 3Q4DA 4GFIA 2GDQA 2PU0A 2QGYA 3NO1A 4HN8A 3VCCA 5EU9A 3V5FA 4F4RA 3H8AA 2XSXA 3CK5A 5FJRA 3DDMA
chains in the Genus database with same CATH superfamily
3WQ6A 1ZCCA 2VEIA 1C8YA 3WLKX 4PMVA 2HPIA 3RU8X 2OVLA 2CNCA 1JF6A 3CQHA 5A8OA 1HN1A 3CAWA 3TSMA 2YYTA 3BOXA 4YWIA 3LRMA 5TF0A 2JKPA 4DHGA 2P8BA 3EUB3 5DXYA 4OECA 4H8VA 3CO8A 4GJJA 4ASTA 3W6LA 4IT1A 3C6CA 3CMGA 5FCZA 2Y24A 8A3HA 3BGAA 4F3HA 4WKFA 3ARZA 2O7QA 4DJFA 2CLIA 1Q4WA 3UR8A 4GRTA 3L0GA 1PUDA 1S2VA 5T91A 3MP5A 4O52A 2NWSA 3L2IA 1TPWA 2R94A 3HQOA 3CMFA 3GB6A 4OZOA 4EKJA 3VE7A 1IZCA 1ZY9A 3PM6A 1CXEA 1F3WA 5CLTA 3EOLA 4DX3A 4GXWA 1DJZA 3AYVA 6ALDA 5A6LA 2BSLA 4DPQA 2DQXA 1Q1WA 1H0GA 4BCEA 1W3IA 3BAIA 1I45A 4R27A 3LV6A 3QGKC 4E2BA 1LZOA 4KCVA 3A64A 1TV3A 2G95A 4ZQPA 5HQLA 4HCLA 4XIAA 3PNUA 3B05A 4Y9PA 4RZ6A 2X7VA 5KITA 5DRIA 4XX6A 3H70A 2NXIA 4ZFMA 5KZDA 4G7EA 4Y9AA 4CQ8A 4LBUA 1RLDA 1TCMA 1IXNA 3WMSA 4LF2A 3VZXA 1EJUC 4PMOA 3ENLA 2PWEA 1WKYA 4V33A 2XISA 2R14A 5D38A 1PTDA 2NZLA 1XGEA 3IV3A 1QOQA 3OODA 1O1ZA 4X61A 2V30A 1GQKA 3CAKA 1H51A 4EQSA 3LB8A 3MJMA 5DBTA 1LOLA 3KS5A 3KE0A 2XIIA 1E6SM 3UU0A 3P6LA 1BWCA 2F7FA 1JZ8A 2GZXA 4JL2A 1Q65A 5REQA 3BLFA 1UWUA 1ESWA 1NAL1 3AO0A 4BI7A 4A3HA 3QZEA 2C91A 2BOEX 2D22A 5BMWA 1QPNA 3I7RA 3BMVA 2JE8A 4P7LA 1AFSA 4Q8OA 1KCXA 1XRVA 3CUZA 3LSCA 1DV7A 3MW7A 2QS8A 3CUGA 3NO3A 3MQTA 3F4WA 1UIOA 4NZJA 5I3GA 2IW0A 3VNZA 2GVYA 1TYTA 2QUNA 3F2BA 2FB3A 5I7GA 3GVWA 5B7YA 1I9CB 1V8EA 4NSBA 4MFEA 4UFJA 1XPGA 2HROA 4ICCX 4DAIA 4J35A 2OSYA 1UOKA 1KFJA 1E5JA 1HP4A 2W4XA 2AL2B 1EH9A 3HFTA 4GOAA 4ONVA 4RXFA 2PTXA 1AL7A 1SO4A 2AOSA 4WHBA 4HCDA 3M7SA 1ICSA 4C7DA 3PBYA 3NVVB 2ZTJA 1OGGA 3W7OA 5A6AA 4C6PA 3BXWA 2C1HA 2V9DA 1V3MA 4M3PA 3O16A 2PP0A 4CQDA 1Q8JA 3BL3A 1H11A 5EBAA 4PEEA 3WKZA 2Y5SA 5KZEA 1S5WA 4BQ2A 3VGFA 1A5OC 5EPDA 1EC8A 1D7KA 3W75A 1R30A 3MI6A 3HPZA 3WQFA 5JCNA 4UQ9A 1ONFA 1HW6A 1JRBA 1S39A 3RPTA 4DLFA 3K30A 3ABRA 4RDWA 3MB9A 3W87A 2IKJA 1OFBA 3ITGA 2FPYA 3ZZ1A 1TIWA 3AZTA 1PYMA 1VZWA 3R11A 3UJSA 4CLMA 3L8KA 1FWJC 2NWRA 4WDXA 1JI2A 4ICNA 4TOQA 1G94A 4B92A 3NVDA 4AHQA 1V0NA 3MC5A 4ZO6A 3L5LA 4AC1X 3N13A 3CIXA 1UD6A 3QFWA 3QQ0A 3M16A 3PSVA 4AX7A 4RUBA 4H4YA 3F4CA 1OX4A 2WMIB 1XFCA 1C8VA 1POKA 5AHEA 3URBA 5B80A 3UR5A 3ZLFA 2DQWA 4C7FA 4TVDA 1CTNA 1GVOA 2NVDA 1T3QC 2ANUA 4LBRA 3MUAA 1EP3A 4O12A 2Q09A 5CSUA 1JD9A 1V3KA 3SI9A 3K4DA 4O0KA 3CL6A 3TA6A 2BFGA 1DJYA 3VNLA 3AZRA 4MY8A 3W53A 1TX2A 1GWJA 2WVSA 1TTIA 3GH7A 2HE8A 3IAQA 1R2TA 1WA3A 1G67A 3WJWA 4H4RA 3B9AA 1AH4A 3LD5A 3M0LA 4K37A 3KEHA 2V3GA 1VD6A 2QGHA 3UXIA 4ADUA 5EA9A 2A0NA 5I77A 5A69A 3U3HA 1E3XA 3N73A 4HZ8A 4HGXA 5C7HA 3BC9A 4F0MA 1Y5VA 2ALRA 1JQXA 5EU9A 3DC0A 1DXIA 4BZYA 3UP8A 3P2VA 5D2TA 1LBLA 4J57A 2UY3A 4RX0A 4ORMA 1MZHA 4M82A 4DWSD 2PDKA 1K6AA 2E5BA 2ZE0A 3O06A 2GQAA 4XUGA 3U5YA 4JQ4A 4WQ6A 4OGZA 5AN7A 1WXJA 3S1WA 1MW0A 1JUKA 3BSMA 1DL3A 1VPYA 2EKCA 1X1NA 4QS5A 4WDWA 4A2SA 2CLFA 3SCPA 3ARPA 3CB8A 2YCKX 2E40A 4DWSC 4GZ7A 3G3DA 3UEQA 4TVCA 5FF4A 1KN0A 3T7VA 5FS8A 1SR0A 1C9DA 1CDGA 1A53A 4E2DA 2EHHA 4W9TA 4O19A 1KNWA 5D09A 2VFEA 1DTNA 4Q8WA 5C55A 1XLEA 2NXHA 3LBOA 4KETA 1R38A 2Y62A 2E28A 5BMXA 3CT2A 4A3QA 3C56A 4ZQCA 1T96A 2FVLA 4PB4A 1TYPA 3E0FA 4MB5A 1V7YA 4A05A 2VWSA 4L1XA 2VFHA 2V8ZA 3B0UX 2A4AA 4JIRA 3I6TA 1N2VA 4Q4SA 4GNJA 1BF6A 1J5TA 3LCHA 1K8YA 3W85A 5G5GB 4EANA 1NTHA 3KTSA 3PG9A 3M4HA 1B9ZA 5FEPA 3OYZA 4K38A 4JIEA 4KWOA 1OFEA 4K6AA 3AICA 3VIFA 1KO0A 4CCDA 1M04A 4GG9A 3MBFA 4C6FA 3GXIA 3EANA 4I90A 2EO7A 3RF9A 2QYGA 4LYQA 3GIYA 1RVGA 3AMGA 2V5JA 5CC6A 1MO0A 3AHVA 4J3VA 2RKXA 4BQ3A 3KZSA 1FWFC 3AALA 3EXRA 2V67A 3CZ8A 3E2VA 4F0LA 3OLIA 3QKEA 4DYJA 2D0FA 3NQDA 3QHMA 4HSHA 2QJGA 4YVVA 1OB0A 1TREA 2PRHA 1MNSA 3AIEA 4XZLX 4GYKA 2EBNA 1TVLA 2PODA 2Q3RA 2X8HA 3CJPA 4U33A 1VYPX 3IACA 3SW6A 4KRUA 2DIKA 3DGRA 3P82A 1B3YA 1NJJA 4IMDA 4E3TA 1WQ5A 1FHUA 3GXNA 3MVTA 2RHGA 1E9IA 5B7ZA 3S5YA 1X98A 4X2PA 1IHIA 4HTYA 4MJZA 1CXLA 4D9PA 1CGWA 2E67A 1XWYA 3U48A 1LQ0A 4EXAA 3AMKA 3W01A 1GRAA 3VILA 4YTTA 1VCVA 4FOJA 4IWWA 4JTLA 4WJXA 1XHCA 2PTWA 2BHUA 4EACA 5CBIA 5FJPA 4AMAA 1OG0A 3V5OA 4R7JA 4LA1A 2CW6A 3PFMA 4DNMA 1WAWA 5LIUX 2G5WA 2UV8G 2IUZA 2C18A 3CWOX 1DJGA 2GRTA 5HK4A 2VC7A 4ZBCA 4C6DA 4CNOA 2PSNA 4FXSA 5KMYA 4DBSA 5L6UA 1EJTC 3DKLA 4Z08A 3VUSA 2VCBA 3L4XA 2GJPA 5HQMA 3TEVA 1UR9A 3WBAA 3MANA 1QI5A 1UD2A 5HMDA 3GQYA 3GHRA 3G1RA 4AXKA 1ZGDA 3NOYA 4XD6A 2IKGA 1X2GA 1A0DA 1ZHAA 1NM9A 5C8BB 1XLLA 3AXHA 1P1XA 1GRHA 1VEMA 3T81A 4I9TA 3HPAA 5AHLA 4NI3A 3KBSA 1EYWA 4WOQA 4XIMA 2NT1A 1U22A 4QNWA 1OYCA 1PXGA 2E68A 2ZXQA 4HIBA 3ZFHA 4A3RA 4L9ZA 4MDOA 2ACQA 2FTPA 2O7SA 3H4GA 5DMNA 3K4AA 3RG6A 3WBXA 3DX5A 3TA9A 3DXIA 3GWQA 4GGHA 3WNOA 1UASA 4LCQA 2I9UA 2BMBA 1JGIA 2QF8A 3N18A 5CLWA 2X8CA 2UBPC 1V6VA 3IEBA 4YVXA 1KWKA 5E93A 2ZUUA 4BV6A 1BYDA 2VZSA 3BW3A 2WKJA 3NDYA 3UBPC 4GNVA 4XBJA 3RGTA 5CXPA 3BO9A 1H2JA 1R3YA 1YNPA 1GESA 3CQIA 2TMDA 3I6EA 5T9BG 1RCQA 5BWAA 1ZNNA 2J9ZA 3VOIA 2X99A 4DJFD 3AIQA 4QE4A 4H4UA 1JUBA 1QR7A 3NM3A 4P7QA 4D6CA 5CGMA 3TTOA 1E1EA 2W62A 4MB3A 3BCJA 1F8MA 2XTKA 2D73A 3NZPA 1N7KA 1T7LA 1UBSA 1Z41A 4DJFC 3PBWA 2L5HA 4A4AA 2Y5EA 3WZ0E 3P67A 3VFLA 1O5QA 3WF4A 3MWAA 4GLEA 7PTDA 5LXXA 1GRFA 4NT0A 4H4IA 1AJZA 1G01A 1UP2A 3EDKA 4B5VA 5HPOA 3TV8A 5LNUA 2GDQA 1TPH1 3W1NA 1IZJA 5BNKA 6CGTA 1UD8A 1PB0A 4IGMA 1OFOA 3LRLA 2OCZA 9CGTA 3QQ1A 1BG4A 2W92A 1VBUA 3QVQA 1K77A 1XH1A 4MJ4A 1SJDA 4E2VA 3VU2A 2V5LA 3FGCB 2ZRXA 2Q8ZA 4PMJA 2V6AA 4FAMA 2DFAA 3L4UA 1M3UA 2J8TA 3QFAA 3CV6A 3KL3A 5FF0A 1GCYA 1M7JA 2CBVA 3W73A 2YA1A 3NG3A 5FJJA 4WR3A 5HWMA 1UP0A 2HK1A 2A5HA 2J7HA 3DFSA 3VOFA 4PGLA 7TAAA 1R7OA 3LX9A 4IPJA 1ICPA 4M81A 5PTDA 2OLSA 1FWCC 1RUSA 3BOLA 4JQ2A 4DWSB 3TN5A 2AMGA 3W83A 4LUSA 2G41A 4F0KA 3AMDA 2VEFA 1TJPA 4K68A 4QXIA 4KPLA 1UKOA 5DCEA 1R2SA 3W1MA 5FEWA 2E5AA 1NOFA 3PUOA 1VKFA 1EC7A 4S2BA 2P8CA 3S1UA 4K8GA 1VAHA 4Q8QA 1SUXA 4WDTA 1IEXA 1OFQA 3OO2A 2ZIDA 3R1ZA 1E0TA 3LMZA 3EA1A 2WQPA 2D2JA 1ZP3A 2YL8A 3BURA 2Z6JA 4WY0A 4MHBA 3AIBA 4TMCA 2FZ8A 3SUWA 4UMCA 3FEMA 4BA0A 4DXKA 1FWDC 2OZTA 4ZTYA 4G9PA 1W3JA 1Z89A 3H21A 3LHWA 4GO9A 3QY6A 5AYBA 2HDJA 3TWAA 4H9UA 1GT8A 4C7GA 3URQA 5LIYX 7A3HA 2X05A 2E5DA 2VHLA 2CBJA 3THCA 5HQEA 5D32A 4ATWA 1Z8AA 3MI2A 4S3BA 3T9PA 3ALGA 2J9XA 2C1IA 3S1XA 2PWGA 1V3LA 1MRAA 1ODZA 2QV4A 3GTXA 3MP4A 4GBDA 2REQA 3EDJA 2ZTKA 4CNUA 4Z17A 1VP5A 2B7QA 3N19B 2WPEA 5I02A 4US5A 3CWNA 2JALA 5JH1A 1Q66A 2HS6A 4H7ZA 3WK1A 3ANYA 1GHSA 4DZIA 1UROA 4BWLA 2WPBA 2VMFA 3LYEA 2WW5A 3SO7A 2X2YA 5GQBA 4QQUA 3NQ7A 1FWSA 1XYMA 2OOFA 2FJKA 1BVWA 2ZZ2A 2GQ3A 5BWFA 3DG7A 3B0YA 1A5NC 4PRTA 1E4LA 3GNOA 4M19A 5FEZA 2ZC8A 4LVGA 2DSVA 4UQBA 3GVGA 3U8GA 1RPKA 3A6OA 1M1BA 1VR6A 2Y63A 2OT0A 3EMZA 2OKOA 3PVFA 4Y90A 1AODA 1VCFA 1OX6A 2Z26A 3H2AA 3F1QA 5DY2A 3V0UA 4YNGA 1DP0A 3RO6A 2PWVA 4PL1A 4AD3A 3CAVA 2AQWA 5LYRA 1UWTA 4IQJA 1ZU8A 3NQ2A 3FXGA 2X1SA 2HVNA 4TTGA 3O9NA 1B54A 3UY7A 1TMLA 1NY1A 4M7SA 4GGBA 3WX7A 2R1MA 3R7MA 4Q32A 4ZB0A 3A12A 1NWRA 3REQB 1JPIA 3A4XA 1PSCA 2H3BA 1O60A 2FQIA 4FNUA 3R25A 4F8XA 4NXKA 2EGZA 3Q94A 3WK3A 3WFAA 1C8XA 3TU9A 4CNTA 5I24A 1REQA 1W9UA 4LNYA 3H2OA 5TR3A 4RE2A 4MFDA 2O55A 3GHSA 3RK8A 4RE0A 1AQFA 3UA3A 3GRIA 2JIWA 2XINA 1K4GA 3AISA 4NZFA 3ARQA 2INZA 2ZX6A 1A5CA 5D9MA 2NX1A 1TE1A 3BE7A 3UWVA 1ZRQA 1Z44A 3PC0A 3LQGA 1JCTA 4QE5A 4PBGA 3PR2A 3GX9A 2OG9A 2BXYA 1V0KA 2O4MA 1Q6CA 1YDNA 3N9SA 7REQB 4EE9A 4BI5A 1I4NA 1ECQA 1HTIA 4L56A 4PFMA 2CETA 9RUBA 2P3EA 1TZ9A 3GG1A 4XAYA 4I6VA 3W7PA 4KWVA 3LSBA 2DDXA 1XL9A 1AQ0A 1W5OA 4O50A 3CXBA 2PURA 4KW2A 1C7SA 3NQ8A 4S3JA 1GVYA 3BQ6A 4D6JA 4OHQA 4LS1A 3FVDA 3CV1A 3Q45A 3W71A 3SURA 2O56A 2OTDA 4F0SA 4K2SA 4QEEA 4Z42C 3GNNA 4PRWA 3CZJA 3N6HA 3M0MA 4O17A 2P10A 3NYDA 4DWDA 3TLLA 4EPEC 1BGGA 2C3CA 1HF6A 4YWSA 3RLHA 4W8AA 1HO1A 1GG0A 2V82A 2E7FA 4FHAA 1DE5A 2PBGA 4LTSA 3MCNA 5A6TC 2V3BA 1FECA 1KFEA 1A0CA 4UR9A 1KR1A 2W67A 4ZMGA 3CL8A 5BXRA 4S3DA 1EWDA 2EPLX 3DFTA 4MWAA 2PB1A 5E0CA 6REQA 4LC6A 3KCOA 4EMIA 4QCFA 3VIGA 2FMOA 2DZXA 2FMNA 1GVRA 3V75A 3TAKA 1ZAIA 1E4MM 3VKCA 4PTDA 3IGSA 1OVDA 1CEOA 4Q8MA 4YXGA 2QGYA 3C2OA 2WSQA 2OX1A 5CZSA 4ZSUA 1ITUA 2Z2UA 2GJXA 4OTKA 3T0CA 4F4RA 2IQDA 3EMCA 1UA3A 4HMDA 2PDQA 2E77A 3RXZA 2A2IA 1VENA 1H4PA 2QUVA 4QJ3B 4JZ5A 5LGZA 1KBJA 3AXIA 2FZ9A 3STCA 3GLCA 1M5WA 3RX2A 2DJXA 1F6YA 3W1RA 4CKQA 4AZCA 2Y4SA 4ADSA 1WAUA 1EJSC 2GWGA 3GG8A 1OIMA 5CAKA 4M6VA 3RO8A 2FZMA 5K7JA 5BOOA 2ZX5A 1XC6A 2BWGA 1DORA 3PPGA 1SW0A 2XGIA 3WQ4A 3UJFA 1EYEA 5GJPA 1LG2A 4GXMA 2QJJA 5BRPA 4WGHA 2DZWA 1WE5A 3UG3A 1V5XA 2XUCA 4UZUA 3AN1A 3W29A 3BMWA 5EKYA 1DQWA 4FI4A 4RJEA 3W25A 3S6TA 1VRXA 4IG2A 3NQEA 4J3TA 1IXQA 3EOSA 4IM4A 3JVAA 2D20A 4LUTA 2OGYA 1VHNA 5C6MA 1IXOA 4FF7A 5FKYA 5ER0A 4QGCA 3UFYA 1CPUA 1KGWA 3E6EA 4NJGA 1XUUA 1UKPA 1DXEA 2I1OA 2ACUA 4Y8EA 1QBBA 2VVNA 3C2RA 3DK4A 2E9LA 3MP3A 5MKGA 4JTUA 3KHDA 4CU7A 1JYWA 3SDOA 1ZBVA 3M46A 4AD4A 1KQZA 1HGWA 1OGSA 1QVBA 1OT2A 1QOPA 1A4MA 2NW0A 4OQVA 4Q4QA 4TX9A 2A3HA 5FS9A 1QASA 2JK6A 3IRSA 2IPJA 2J27A 1UR4A 2QULA 3M6DA 4Z2JA 4JDBA 4PA8A 3AMLA 3W7LA 3VXGA 1U1UA 4TU1A 2PDWA 3TIMA 4C6MA 3W1XA 2R1LA 1LLZA 4JQ1A 3IGHX 1M68A 1XLJA 2CC0A 5G1MA 5HWNA 5IHRA 4K1GA 1MQQA 4D2JA 3WLLA 4KS0A 3TR9A 3CH0A 3G5EA 1XKYA 3GH4A 1TWZA 5IBXA 4C6IA 1XH2A 1AA1B 3C3UA 3Q2DA 4N4QA 4TUFA 5K2ZA 2O0TA 1W3HA 2HQAA 1UUOA 4O16A 2OB3A 4S3CA 5LA1A 4CNNA 1XKJA 1H5YA 2YCIX 4NAFA 4UMAA 4X0NA 1S2UA 4ZSTA 2W66A 3V0SA 3AWNA 3G77A 1H7OA 3MO4A 1S3HA 5I3KA 5FAJA 1G9HA 1K7EA 1XD0A 3NA8A 4KESA 3AUJA 3ZJ8A 3LENA 5HR7A 3B8IA 4NVTA 1VLIA 4GJ1A 4AH7A 3IUHA 3EB2A 3C61A 5BROA 3NL6A 3TX9A 4NJHA 4GKTA 3VNYA 1LT8A 5J5DA 3L5MA 3N14A 1G4EA 3IJ7A 2D2GA 4O0ZA 1QJWA 2PTDA 3E9AA 3AMCA 3W74A 3TOYA 3GVQA 3GRSA 4FX8A 4X9SA 3T55A 1NWSA 1XBVA 3G18A 1I1WA 1E1CB 3IIPA 1TA3B 4PUMA 3RHGA 3N1AA 1O4UA 3N4AA 3GHUA 4Z1YA 4ENLA 1P5BA 3KL5A 4HU3A 2WKGA 4LEQA 2WVUA 3ZR5A 1CZ1A 1FH9A 1GEQA 1JRCA 1QK0A 1L6FA 5A8PA 4FDCB 4H4XA 2CKSA 1P43A 4JD4A 4CQ9A 3OZPA 1RP9A 2Z7GA 4Q33A 1JULA 4GYPA 3M47A 4R9OA 1H62A 4HYVA 3GU2A 3KVMA 3LCXA 5LIXX 3W72A 2G97A 3FJNA 1KA9F 3L65A 3MZNA 2GOUA 3FAXA 4MJMA 1FWGC 3E0LA 2CESA 1QI4A 1HL9A 2HEJA 3BDKA 2XFWA 2V6OA 2WOWA 1P7TA 5CSYA 1GJWA 1EL3A 1LWJA 1I2PA 3UA4A 2CLLA 3T09A 2QMKA 5HBFA 1G4PA 4H19A 1J0KA 1F74A 1TMHA 1NWTA 1EJXC 1EEPA 1W6TA 3VX1A 2DU2A 1XQLA 4FX6M 1Q8AA 3E5BA 1EJ7L 1QDSA 2NX3A 3N04A 1DOSA 3LOTA 2ZZ5A 2Y2WA 3EWCA 2P0IA 3WD2A 3ETRB 4UNIA 5AOUA 3VDCA 1F3PA 4AD0A 1V79A 4Q6JA 3W7QA 1VEOA 1HKKA 3MO7A 2OU4A 3N9KA 3AHXA 3ME3A 4IISA 4V15A 5M1TA 3EPMA 2V69A 5A3HA 2GFTA 1N61C 1M53A 3IJ9A 1NARA 4L61A 1GVEA 1SJAA 1EUNA 2I5GA 4PCTA 2MANA 5FEXA 1LRQA 3LNPA 3II1A 2F2HA 3LPOA 3V16A 2WK2A 4GUIA 3WBYA 2XM2A 2QCMA 3HPFA 4KCWA 2QJNA 3M44A 1W91A 1EQCA 1Y5WA 3H7RA 2VRQA 1LWIA 4JBRA 1V6WA 5C5YA 3SY8A 4TO8A 2B0MA 1OF8A 4BF7A 3T05A 1XIBA 4H9YA 3C8NA 4EP8C 5EMKA 5K4ZA 1P0BA 4PMRA 2NQ5A 1WZAA 4R34A 2F84A 3IC9A 4IXHA 5A94A 1KBLA 1EHAA 3OHMB 3NO1A 3LHVA 3EWUA 3LZ3A 3AS3A 1GV4A 2WOIA 2NXGA 5HPCA 3M0JA 1A80A 2O4QA 4CNPA 1SJCA 4YN5A 3CV2A 5A8GA 3L5AA 3CASA 3ID7A 5BRQA 2VC9A 4IIDA 3UZWA 3W7GA 2FHCA 3MKKA 4JAWA 4XBSA 3LCGA 4PODA 3VNKA 3NPUA 3GU1A 2XIBA 5G2HA 3UWUA 1JFHA 4C6CA 1EGVA 1IR1A 3VGEA 1E55A 1CXKA 3R89A 4E4UA 2DW6A 1RD6A 4MYAA 4JYFA 1HVQA 4LYRA 2GGJA 1XLCA 3DUGA 3DFNA 4JEQA 1E0WA 3GIPA 1CLVA 2VI0A 4QBXA 1VDVA 1HL2A 3NXFA 4UR7A 2PDGA 3DIPA 4ERGA 8XIAA 4UTKA 4ORIA 4ROPA 2C3ZA 5HXMA 3ERPA 1S1RA 3LB0A 4BWLC 3EPOA 1FTXA 2WWDA 5GNZA 1YXDA 2G3JA 1SZGA 1R86A 2FZNA 1FWTA 1OC6A 3WNMA 3B9OA 1A50A 1XF0A 2HV5A 2G4FA 4EXBA 3CQJA 2ZADA 4OT7A 4YS1A 2B31A 4Y7EA 4LS2A 1KBKA 3BLEA 3RNMA 2D69A 2X8GA 1XSIA 1XLAA 1W1TA 3IARA 4JTQA 5HDRA 1RXOB 2Z1BA 1XCFA 4AY8A 5F7UA 1W17A 2XFRA 2DEPA 3USBA 3KVJA 3V3WA 3S5SA 1JXKA 3A47A 3P3BA 1ME7A 1QI3A 3WQOA 3T0DA 1NPXA 1QPKA 3GHTA 4W88A 5EBUA 4L4MA 1RBLA 1XDIA 4J4KA 3MDWA 4XZBA 2TPRA 1I75A 1NQKA 1J0JA 3G1VA 3ABXA 2Y8UA 1X1ZA 2CZEA 4JY9A 2HNEA 4DB7A 9XIMA 5LNWA 4QRNA 3EOEA 3SCSA 1I8JA 2QVNA 4C6LA 4XSLA 2GSJA 2Y70A 4F2BA 1OYBA 3U0HA 3V18A 2RDTA 2YCLA 4H50A 1PKMA 4JYDA 2WLZA 4XAFA 2WJDA 1FP8A 3RU6A 2ZA1A 1JG9A 3WEZA 5FL0A 4JEJA 1E6RA 1EZWA 1O7AA 1OIFA 2JKAA 3G0UA 1XRFA 3H12A 2AL2A 4JHOA 4EPKA 5CPTA 3OG3A 3DFHA 1XG4A 1KFCA 4N02A 2YJQA 3ZO9A 4I7VA 4CCEA 2NQHA 2FLIA 4GCXA 5A2CA 5EL1A 2PLKA 1SMDA 1B2YA 1YNQA 4PUDA 3EWZA 4PUUA 2A1YA 2G3NA 1XYFA 4M56A 5F4WA 3ZSSA 4GC4A 2Y8VA 4KMQA 4IXXA 3SQLA 3AU2A 3FW6A 2VOMA 2YA0A 4H04A 2PTYA 3UJRA 3QPZA 1ME9A 3WUEA 3BLPX 4MM1A 3PS7A 3TC3A 4NASA 4P61A 5LHEA 2TPSA 1S2AA 2JF6A 5CPNA 2OWXA 3NYZA 3WJZA 3IGUA 4KGLA 3E2RA 4O28A 2H8ZA 1K3UA 3OA5A 1JAKA 4GIAA 1JCJA 3M41A 4RL3A 3ELFA 4HHLA 3CS2A 3W9ZA 2ZOXA 3GNRA 3ARYA 1JZ5A 2FIQA 4RE4A 2YB4A 2CHOA 2QCFA 1FFUC 1XLIA 3L9CA 3WJSA 3C2FA 1YBQA 4L80A 1Q13A 4HNLA 3SJNA 3TQ0A 1PV8A 4UTWC 1V59A 2WZTA 3ZWSA 5CJ5A 3JR2A 2WMIA 2I17A 2Y89A 5CJMA 4MWAD 1VIWA 3S1VA 3S2NA 2VUYA 1SFJA 3ZQ9A 4L64A 5J04A 4O0QA 3DH7A 3MUZ1 1B9BA 5CH9A 4CN4A 2DZBA 1PZ2A 4HA3A 4R3UA 3TZNA 2GK1B 5BXTA 4MWAC 5FJOA 3S9YA 1KV5A 1IIGA 3SBFA 1FXQA 2WSRA 4EIVA 4MGGA 4PMQA 3NL3A 1C9WA 4GD0A 1EGZA 3ANVA 2DT2A 5ABHA 3KTCA 4D1IA 4JYEA 4GVIA 1US3A 3T0AA 3OLEA 1JPMA 1FH7A 2QUUA 3M0KA 3MDUA 4IP4A 4QNEA 4L6OA 3L0KA 3U2EA 3TONA 2BHYA 3HG2A 4UNLA 3S5OA 2ZZ6A 4IX0A 3DG6A 3EKLA 1VQZA 3KDNA 4RV3A 1GOOA 3ITYA 5LNSA 4C6EA 3LCIA 3BZGA 4JTRA 1AMYA 4WLCA 3H55A 5FS6A 5ABFA 2XSAA 4RZ4A 5A1AA 3U2ZA 4H9TA 4DI9A 4EQRA 4QG9A 1XSKA 3GKFA 2HBVA 1EJRC 2FPTA 4H2CA 3CUXA 5AY7A 1LJYA 3OLDA 4G1KA 1KR0A 5HMSA 3N17A 3WDHA 1W1B1 3HPSA 3GC4A 2YW4A 3VA8A 2FH8A 1XXXA 4NEWA 2XHYA 1H2IA 3UYCA 3QMSA 3CUHA 4F2UA 1OJTA 2G50A 3NPWA 4LUSB 2XIOA 4GFIA 3AZSA 4HZMA 3VOHA 4YTRA 1V77A 2WSKA 2FZDA 3UGVA 1R85A 1R0MA 3TQPA 3EA3A 4IZGA 2PDJA 2WXDM 4IMFA 3E02A 2PS2A 3IVUA 3H6OA 1L6YA 1A5BA 4HPXA 3OLGA 5GJNA 1WNOA 4WY0B 2YL9A 5D02A 5CZTA 2GPTA 3H4XA 4Y6GA 5T8GA 4NU7A 4LV9A 3ANUA 3QV7A 1S7MA 4JOMA 1D3GA 3WH9A 2UY2A 2Z0IA 4IHCA 1XRSA 4RNFA 2VTFA 1JF5A 3TW7A 2PZNA 4Q4MA 4PZVA 4DEFA 4QJ4B 5K9CA 1CB7B 1DJNA 3FKKA 4B3LA 4W7WA 5FSDC 2ZICA 4AEFA 1AD4A 3TFXA 1UWAA 3VD7A 2YOCA 4LFYA 1C3FA 4MZ1A 4J40A 1UKSA 2QCGA 2ISVA 2NUXA 3RAOA 2Q6ZA 5JIPA 3TJLA 5AKQA 4DY1A 4E3VA 2ZDRA 4P8VA 1E72M 3I3BA 3I3DA 4Q8TA 4AVOA 1E43A 4B5NA 5LSMA 3TJIA 2YDQA 2ZKMX 4AIOA 1XCWA 5ECVA 1BF2A 1TV4A 1XM3A 4GUFA 3DGHA 3FCPA 4CNSA 3QC0A 4RDVA 3WLTA 1GHRA 3GAYA 3ZMRA 4M80A 4NJKA 3KAOA 2WJZA 4G5DA 1MO9A 1X96A 3GSMA 2YBVA 3V35A 1BWLA 5KZMA 2XFYA 5JVLA 2C19A 4WIWA 3PULA 4NG3A 1DIEA 2AL1A 3CIVA 1R3TA 3TYBA 3BICA 1J6PA 2V3DA 4ECLA 2Y8KA 1YDOA 5CQ1A 1OWQA 1BAGA 4GI4A 1AJ0A 3GE7A 4BF5A 1VYRA 5BU9A 1VF8A 3MUY1 3RCYA 3V0TA 3LN3A 3VD3A 1GNXA 2HNHA 4XB3A 1GW1A 2A21A 5IHSA 4ZODA 4GKLA 2QT3A 1WKFA 1QO5A 3WFLA 4C6NA 4E8CA 3O8AA 1V6TA 1R9ZA 1ZFJA 4D6IA 2OZ8A 3MI3A 3F5JA 4K1WA 1PX3A 1KQYA 3GDMA 4RR4A 2XM1A 1Z3NA 3Q58A 1S5TA 1BQGA 3NPVA 1EPVA 2INFA 4ZOAA 3SUUA 3NM1A 2QPSA 3SUVA 3DGZA 3FN9A 1ISWA 2PDLA 3SN0A 4LYPA 1VFMA 3H54A 2E6YA 2R1KA 3TN4A 3C5QA 3W26A 4P8WA 3RR1A 1MOKA 1YE6A 2G3FA 4HTBA 2WVTA 4UB9A 1RBOB 1MRQA 2AQOA 4WJEA 5BOFA 3EPNA 1V7AA 2VCCA 3Q6JA 2VRJA 4FNPA 1TQJA 3W1UA 3ONCA 3SB0A 2QJHA 1KV8A 3HZ3A 1TVNA 3RRAA 1WPCA 5JBFA 1QU4A 5KTLA 2EPHA 4EM4A 2Y6ZA 4LVDA 2PP3A 2IQTA 1X6LA 4H9VA 1Q6RA 3AIWA 2EEXA 2WZEA 4N9DA 1QNSA 3R2GA 1IEIA 4LC8A 1OADA 4DI8A 5GJMA 3D0CA 3L12A 2JGQA 1JNDA 1UQZA 2WCSA 2BB0A 2ZQ0A 4JCMA 3Q67A 2F2KA 3GG0A 1EFZA 2PAJA 2ASHA 1G5AA 3W7RA 3VABA 4IPLA 1U5JA 3NQBA 1YX1A 3TYEA 2WNZA 4MWAE 2X2GA 4YHGA 3W6MA 5KSWA 2I56A 2OLHA 1BEUA 1BFNA 3H2CA 5F2IA 1FCUA 5AHIA 4HSNA 3NCOA 1WKEA 2J7FA 2GVJA 1E4IA 3M6YA 1JYXA 4LGXA 3B40A 3TJXA 3LXBA 4GQBA 1XGDA 1XRTA 4JDYA 2XN1A 1TQXA 3H24A 1QHPA 2J77A 2E0PA 3BV7A 3D9XA 1TJRA 1LRTA 2BS9A 3TZFA 4PTNA 1UOZA 3DN5A 2G8ZA 1Q7ZA 1V6YA 1NDVA 3CHEA 5AYXA 3GK0A 3LTSA 2KAUC 3AS1A 1E6ZA 2OELA 4MWAB 4QLJA 3QSTA 3QLLA 5G4HC 5IRPA 4Z0JA 1QNOA 1T6MA 3STPA 1GEUA 4UIOA 1YPIA 4I7UA 2Q3OA 3VZZA 2Z1XA 4DQWA 2V5KA 2VD9A 4ZOEA 1RQHA 3EF6A 4HNTA 3QFBA 4GXPA 1YPFA 5D2XA 3IS4A 6PTDA 3N2OA 3POHA 1ZMDA 2GJXB 4XAPA 3E0WA 3FHAA 1MZRA 4N0RA 2VFFA 1XLGA 2Z2AA 1JYVA 2WAGA 4RW5A 4EAYA 2C13A 1H7RA 5E1QA 4G8TA 1NP2A 1H1NA 4HYRA 3AAMA 3C0LA 3FGCA 3UETA 4A8LA 2HCVA 5H91A 1ONWA 3KVLA 4LAUA 4ATLA 4C6BA 4AZCB 2OEJA 1J0ZA 3UPWA 3N3MA 1W3KA 1W1A1 2VGIA 3OEXA 3G1SA 4XVEA 3WQVA 5AHFA 2J7GA 2ISFA 4ZR8A 4D6HA 1US0A 2QW5A 2QQ6A 1DXLA 4GUGA 2PEVA 4FLQA 4AZ5A 4FO4A 4EF9A 2ZC1A 1ZKQA 3G6LA 4N2YA 4LEFA 4ES4A 3EAOA 2WSYA 2IKHA 2HWGA 4LX4A 2QLYA 5JCMA 1W2VA 1KCKA 3WDPP 4ZQNA 3ARSA 3RILA 2Q8XA 3NQVA 4IG2B 2GWNA 1FOBA 3GTFA 4PFHA 5A6SA 4JPGA 3IRDA 4LUTB 4DAFA 3TK7A 3ABZA 5BZAA 2V63A 1W56A 2BBFA 2HE5A 5D2VA 5RUBA 2BVDA 4J5NA 3VZYA 2WOVA 5HANA 4IIHA 1WX0A 1VFTA 5I3IA 1BLIA 3I68A 1G4TA 1BYAA 3B8UA 5GPRA 1VFFA 2QJMA 4MZ8A 2D0HA 2VDHA 2WVVB 1RK5A 1J0YA 2ZWZA 3OZMA 1F76A 4Y2WA 1RY8A 1QATA 2WYSA 1BGAA 4ACYA 3CEUA 1R6WA 1W9VA 2CLHA 2D3LA 1OEPA 5AC5A 1IEVA 1I2QA 4DBWA 1KLYA 1UH4A 2X42A 1O6IA 3THDA 4JX6A 1TPEA 2JF7A 4TX8A 3GTNA 4U10A 1BG9A 2BXVA 4V28A 5IDZA 3MYPA 1R2RA 3NFUA 4U3CA 2YSWA 2ZRVA 2VNCA 1X8CA 1XD1A 4KWUA 3UZZA 1XISA 4GY0A 1GSNA 3N34A 3I3EA 8RUCA 2ZX9A 3OG2A 1NVMA 3UW6A 3LHYA 3VNJA 3ARXA 3WLRA 1F61A 1AL8A 1XICA 3Q65A 3FA4A 5C9ZA 3VX0A 3R5EA 3CYJA 3G0SA 1GVQA 3M0XA 1I2NA 2ZFAA 3OVPA 3VGGA 1N5XA 1MQRA 2TAAA 3LPGA 3H4KA 5I2UA 3HA1A 2WMHA 1NDWA 3G1DA 3AJXA 2XGBA 2B7OA 4MDPA 1Q6DA 3WEMA 1MQPA 4NRSA 4PBEA 2OR2A 3AI0A 3WELA 3PWGA 4Q8PA 1JOAA 2W0HA 3WN6A 3UXAA 4GIYA 4MYXA 4FX9A 4NHVA 4BQ5A 4LYKA 2ZUMA 3MSYA 4ADWA 3H7UA 5CC7A 3QOKA 3CZEA 1E51A 3L68A 1PZ1A 1IR2A 1R3RA 3BTNA 3HMCA 1JQVA 1TELA 2QKFA 3O63A 3GXDA 3SADA 2F8QA 3M0VA 4IIGA 4L9YA 3SZ8A 3N15A 2XVKA 3L5OA 1OZMA 4MADA 4OFCA 2V38A 2VCAA 3P14A 2A3EA 3CQKA 1B31A 3PG6A 2HVMA 1KM4A 1TPB1 3REQA 1TPDA 1WOAA 1GYMA 2DT0A 3GD6A 2X0YA 4C1LA 3ITCA 3WQ5A 2VUNA 1EBGA 1KB3A 3K1GA 1AG1O 1XDMA 2DW7A 1IE7C 5K9DA 3F03K 1HKIA 1XSJA 2OX4A 4WX2A 3G1XA 4GK8A 3F4NA 5D33A 4XZMX 1XIDA 2X1IA 5TAOA 3WBEA 3O3RA 3SN1A 1CXFA 3BJTA 3WLIA 4ZE4A 4LSBA 1NP0A 3D3AA 2LLEA 3W2MA 1VHCA 1I0BA 1P7TB 3OW1A 1WOBA 1BRLA 3L4TA 4H4ZA 3OB8A 3DI1A 1JJKA 3RCNA 4DZ5A 7REQA 1WZMA 5DELA 3R4IA 1XDJA 3T8QA 3RMEA 1E3ZA 2CFYA 2ISSA 1Q3NA 3OQ8A 5G2IA 1V3HA 2J79A 3T4CA 2QAFA 2GJNA 1S2WA 1Z48A 3R07C 4FNRA 2OPJA 3URHA 2A7NA 5C9WA 3NOEA 5D04C 3HM7A 3NS1B 4QX4A 1K7XA 4JFUA 3VM5A 2AKZA 1D3CA 4DVOA 5K4XA 2ZUNA 3QJAA 5M17A 4D6EA 4ZB5A 2PWFA 5A6KA 2YFOA 2QNEA 3GW3A 2R82A 1SMAA 4O1AA 3TMLA 5D2WA 2HJPA 2E8ZA 1W9PA 5HJYA 4ZQMA 1Y8BA 3O2LA 3MMTA 3AHYA 3S0CA 1CWYA 4J3XA 2V2HA 5JMUA 1FHLA 4PUNA 5I07A 2ZRYA 2BVYA 1ZTVA 4EWJA 2Z4GA 2ZUTA 1UJPA 4BHYA 5BRBA 4FMVA 3EWYA 3UF9A 4ZL1A 1PBGA 1RJPA 4D6FA 1JROA 1DNCA 1EO5A 2GVEA 5IXEA 1PHQA 3ZM8A 3RM4A 4MY1A 2J66A 1UR8A 3LZ5A 1M03A 4IFOA 2VC6A 3NURA 2NX9A 3CYVA 3WUFA 3SRDA 1GJPA 5DT5A 1VFUA 4CUCA 1G6CA 2YCJA 4LS0A 4HK5A 4ATDA 4KRTA 2E8YA 3SCOA 1SZEA 3N11A 3W2NA 3ITTA 3DYMA 3AUOA 3HW2A 5LXEA 4O15A 3GO2A 3TDFA 4BEQA 1F5ZA 1JNEA 1MXDA 5H2ZA 1AQHA 4P8XA 1OBAA 4LUYA 2A7RA 3I4KA 4RPQA 3TE9A 5JCIA 1T0OA 4WK9A 5DBUA 1EJWC 1FVPA 3A7UA 1SW3A 3QV8A 4WZHA 4WGXA 3B9JB 4HJFA 3E1F1 4GJIA 4ERIA 3QV9A 3T40A 1XUZA 4HMCA 4O54A 2NQZA 1KRBC 3CGEA 4NNBA 2ATSA 3VE9A 2I14A 1TYGA 3O6YX 5XIMA 5D4YA 2DVTA 3B9DA 1AQMA 3TSDA 3BCFA 1CGYA 2HXTA 2G0WA 5H8PA 1CGVA 2EKGA 2HBXA 1KM1A 1LOQA 3EWDA 5FJTA 4XZNX 1MVYA 4QHRA 3UZYA 2RUSA 3HRDC 2GJRA 3LDVA 3WMLA 2QIWA 5IOBA 5G5HB 1XBYA 4MF4A 1BPLB 2VZOA 1IT7A 4TXEA 3UNDA 3RPDA 5HJLA 3EZ4A 2Y7EA 3P5YA 2HTMA 4HOXA 3S6OA 5DT7A 3RLGA 1OFDA 3UG8A 1QOXA 4YVPA 1SO6A 1S2CA 2CLOA 1BSLA 1OF6A 3UGRA 3E49A 1VYSX 4UFIA 1GQIA 5DQPA 4O1BA 4NYYA 3A5VA 2YKKA 4X63A 3K1DA 3WLMA 4XZWA 4PTWA 3UG5A 4JNZA 1O68A 1E73M 4NJIA 4U28A 1UIPA 2PGWA 5I5RA 5I3JA 1LTDA 4R33A 2VGGA 2Y5JA 3SIZA 3QR1A 3RNDA 3L0NA 4OJYA 1NOUA 4DUVA 4JHZA 3P74A 2WPGA 3BV4A 2JEQA 5M03A 3WCZA 4K36A 4UZSA 3ORWA 2WNQA 1O95A 3K5XA 5CZKA 5M2FX 2A85A 3HB9A 3DH9A 1OC7A 3PZUA 5HMEA 3QSRA 5E5CA 3LTYA 3RMJA 4IIFA 3WF3A 1AZ2A 1PKNA 3O15A 4W5UA 4LWWA 1ZBCA 4MVAA 1TR9A 1DQUA 3WNLA 3KRSA 2YCLB 2P50A 3QXBA 4TQTA 3QGVA 4RPPA 1M7OA 4IMCA 3GXPA 1KCLA 4JTCA 2OO6A 3HBLA 3G3MA 4CD7A 4O11A 4UOJA 2AAAA 1BWKA 2J7DA 2SFPA 4GVHA 2W27A 3S3GA 8CGTA 4AWUA 3TAOA 3EDEA 3GYEA 2CYGA 3STGA 4C6JA 3OP2A 1UWQA 4AZ6A 1E6XM 2FGLA 4PTXA 2G96A 3W07A 3NXLA 4RDYA 2OLAA 1YKWA 4A8IA 3VPLA 2XDFA 3GDTA 2X09A 3CV7A 4CU8A 4PULA 4OOZA 3S4TA 4UTHA 3C0QA 5MHBA 5E6YA 2G3MA 4IF2A 1RR2A 1SFTA 1QW9A 2CHRA 4XAZA 5K3VA 2IQ0A 5L9FA 2NVKX 2BY1A 4JS3A 2BGNE 1QBAA 4CCZA 4M51A 3LXDA 3MYOA 3LV5A 1FX6A 5H8UA 4CN6A 1HZYA 3MWCA 1EJVC 3W38A 2FTWA 4AY7A 3BSHA 3ZS4A 1K70A 1E5NA 3FV9A 3VIOA 4GWEA 3A13A 2GR3A 1E1CA 3W7JA 5T9CE 2QPXA 1JCMP 1TA3A 3XIMA 2PLJA 3GKAA 4O53A 1Q63A 5TBOA 2BGSA 3EA2A 6XIMA 3BAJA 1YBQB 3UCDA 1WV2A 3M43A 3WENA 3POCA 2FYMA 1BXBA 2CITA 2EJAA 1SZNA 1ZZMA 3L23A 4IMGA 2XG9A 2ZRWA 3NTYA 4B90A 1EIXA 4PMNA 3EOOA 2ZZ4A 1A5KC 1OGBA 3C2EA 2GR1A 3DHDA 1PHWA 2A3AA 1XYAA 2DORA 3AS0A 3P7YA 3MKVA 2EXOA 2YA2A 1QCWA 4QM1A 1EF3A 4XUYA 2OQYA 2CKRA 4B5SA 4DM2A 1UD5A 5KEZA 4DPPA 2BXZA 4LBSA 1J4EA 3OVQA 1B3WA 5KETA 1XIHA 1WDQA 1Q6EA 3O0FA 3TYAA 3S8HA 1UWSA 4GFSA 2Y7GA 3W7IA 3OPSA 3GUWA 4FALA 2PCQA 2H3DA 2DUAA 1UPMB 3GNDA 4TMBA 2CU0A 2GGGA 4KPRA 1QPQA 3SQSA 1X6NA 3IJ8A 2WO5A 4HHPA 4HPHA 7CGTA 3V5CA 1KFBA 4F0HA 3ARRA 5AYYA 3NIYA 3VI2A 4LY8A 4G7FA 3TW6A 1A5LC 1DHKA 2C3DA 3APGA 4UXDA 1E56A 4OKDA 1KW1A 4KERA 4UQCA 2VEGA 4QITA 2WJFA 5ABFB 2WANA 4LVBA 1R9YA 1L0PA 4O1FA 3TQVA 3SCRA 2VZVA 1XV8A 1J0IA 3WD4A 2BNJA 1DVJA 2J4GA 3UJEA 4GPNA 1RPXA 1OK6A 2DZVA 4AD2A 2J25A 5JRBA 1PIFA 3PUGA 4C91A 4H4QA 5HOSA 2WCAA 3TSBA 1MFVA 2PCEA 3W23A 2F6UA 3UWYA 2AKMA 2R8WA 4H4PA 3DK8A 1XANA 3B3DA 4A8RA 1ZJBA 3ARUA 1DJWA 1FKWA 3MBDA 2ESCA 4ZOBA 3QTPA 1QMLA 2WCGA 1X39A 3AJ7A 4YMZA 4EOUA 2X16A 2EQ8A 2EPKX 1F6PA 2WC3A 4BK9A 3SCUA 2JIEA 3CPGA 3TN3A 4O8RA 1QUMA 1ISXA 2CWXA 2WHKA 4E6MA 1K1DA 2YZ5A 1BSIA 4GIEA 2IKIA 2C14A 4BURA 3FFSA 1UP3A 4XZIA 2Z1WA 1XBXA 1QFEA 4S39A 3O07A 1L9WA 5G4EA 4NAEB 2Y7FA 3VMOA 4CU6A 2OT1A 1EOMA 5D8ZA 4D71A 2C71A 3VNDA 4UTJA 3DCPA 3CT7A 4JGDA 1H49A 3LMYA 1E40A 1IWAA 2DP3A 4KIEA 4GNKB 1SZFA 1EIBA 3ZWTA 1FWNA 3ITVA 3VOCA 1W3NA 3VCRA 2BG5A 2QR6A 4UQAA 3V5FA 2EG6A 4KFNA 1TTJA 2PDHA 3HJZA 2VFIA 3PNZA 2E25A 2GQWA 3E0VA 3BG5A 2QCDA 4IIBA 2G3IA 3CH9A 3GG7A 3QKZA 2R9ZA 2IS7A 4ACZB 4OOUA 1OCJA 3UYIA 4ICMA 1UKQA 3B03A 1H60A 1XGZA 2J78A 2XH0A 3VUPA 4LAZA 3EWWA 3CU2A 1RJRA 4WKHA 3B0PA 3EEZA 5DMMA 3HGRA 3FXYA 3QH2A 4HZ7A 2EQDA 1FCVA 1JXJA 4IP5A 3GXMA 5DCBA 3TVAA 1NF7A 4NZ4A 4A21A 1GPFA 1SQ7A 1GW9A 4M1RA 2XGZA 4HNUA 1WKDA 1I1XA 3NRZB 4JTAA 3RX4A 3S42A 4AEOA 2X40A 3G8RA 2GVGA 4MB1A 4JFVA 3A3WA 1VJZA 1XYZA 3OBEA 2PP1A 1JCNA 4GZJA 4HOWA 3PUDA 5GNXA 2PC8A 4B16A 4EQWA 3HN3A 1J5SA 3S5ZA 4PUEA 2BOGX 3TTYA 3AHZA 1XJBA 5JCLA 2OGJA 1N8WA 5AVNA 3ARTA 1ZJAA 4OVXA 2JKEA 3K4WA 1EX5A 2JEPA 3E0IA 4IH3A 4I9MA 2BC1A 4H4WA 4GVGA 2NVAA 2W0UA 3W27A 1UZHA 3WEOA 3UQNA 3F2DA 2GOKA 5BOEA 5FA5A 1KFLA 1TVPA 4ZOCA 1XX1A 1ISVA 1MDLA 3W2JA 1KM0A 5DY3A 3FK4A 4HU4A 2XVNA 1GKQA 1U33A 3THAA 4LQ1A 3O6CA 4A35A 2V2CA 5TNVA 2PGRA 3QV6A 3N29A 4TVWA 4MJ2A 1WUEA 1Q6QA 4JTEA 3NZRA 1GTHA 2FDSA 1W5QA 1Y0EA 4B9ZA 2E5CA 3KBJA 4HPNA 1LCOA 4IFKB 2TSYA 5ABEA 2P3ZA 1VPXA 4UTMA 4ZZ9A 3AFBA 4DUOA 2VX5A 2WWCA 1BWVA 1BVNP 3WH6A 1VLWA 2NSXA 1ZCOA 2DVUA 2WB5A 3SUTA 1K7FA 2CZFA 4REQA 1XLMA 2FDMA 5I00A 4INFA 1XYLA 1SZRA 4J7RA 1KXHA 3PB2A 4DYKA 3C0JA 3KCLA 2FGBA 3VMPA 3MV11 2E3TA 2NVCA 5AC8A 3LM3A 4DJED 1IYXA 1A3HA 4HNVA 1YTEA 3UCQA 2Z27A 1OCBA 1ITXA 2W5FA 1FEBA 1Q5MA 4N42A 1M9HA 1RK6A 3H2FA 4DJEC 1KXQA 4QFUA 3IIOA 3UERA 3T1GA 4F9DA 2C1GA 4FEZA 3F7JA 4WKAA 2GK1A 3ZR6A 2CCRA 1FWIC 4GC3A 1FWRA 2OO0A 2CLKA 1XP3A 4YTQA 2DT1A 3GVRA 3OVRA 2W55A 2Z24A 1U83A 4M5PA 1K8ZA 3W4RA 3CGCA 3W22A 5G2WA 3CWHA 4HK6A 1DJXA 3GH5A 4FZIA 4C1NB 4M6UA 2HS8A 3HGSA 1GRTA 3DESA 3WLJA 2ZUSA 3PBUA 4WOZA 1TPC1 5CPLA 4IPIA 1H6VA 1VJSA 2HVOA 4JTKA 4WRHA 3OIHA 1MI3A 2OWWA 3E2QA 5AHMA 5EFFA 3VD5A 3KBWA 4KGJA 1R7AA 2OEMA 1RSCA 1EBDA 2ZZ7A 1TZ7A 2Z25A 1PZ3A 4FXRA 3M07A 5BYWA 1NEYA 4GA8A 1XLHA 2CZVA 1I60A 4JR5A 1TE6A 2Z00A 3N3TA 3DYOA 2BODX 3PTQA 3MKCA 3KRZA 2EQ6A 3DC8A 4MY9A 2PPGA 1H1YA 4I5UA 1Q85A 4XKYA 4F40A 3LCLA 3UWQA 1HJVA 1P0NA 2WQDA 2QMJA 1L6GA 2GYIA 1UPPA 1J8VA 2X30A 1A3WA 2FGZA 3KDOA 5J8LA 3H26A 4YCPA 5FOOA 3WK2A 2EQ7A 3P8JA 3DYPA 1JPDX 4S3EA 3U57A 1NHPA 3L2MA 4XO6A 5CJNA 5I0DA 1EKOA 5JXQA 3Q37A 3W02A 4PMDA 3UWWA 4G1NA 3B06A 2CLPA 3HU7A 3VIPA 4S3FA 3LY0A 2VOTA 3A4JA 2VD8A 2E9BA 3BVJA 1RLCL 4MNMA 4AF0A 4NIRA 4HA1A 3U4FA 3T78A 5JH2A 1VBGA 1HGYA 3VC6A 1WYGA 1PJ9A 2WMFA 1HJSA 4F0RA 1RALA 3G22A 4BS0A 4O4VA 1OJXA 4XQ6A 5A6MA 3HF3A 1GYNA 3F4DA 3KX6A 1OZQA 1UZ1A 1A3XA 3R10A 4H9MA 3A3HA 1LROA 1A4LA 4HQVA 1KRCC 2XWEA 2DSKA 5LNRA 3PZTA 4OBRA 1QPOA 3CM4A 2QCEA 3G1FA 4X22A 4X3ZA 4OUIA 3VKJA 4EAMA 2P0OA 3KVKA 1E9LA 5AC6A 2YGYA 1A5UA 3KZPA 4HPGA 2WP6A 3GU9A 2W3SA 4D8LA 5HJXA 1WO2A 2PBOA 4DZAA 1ADSA 1K9EA 4K3ZA 3ABQA 3M0IA 4AC7C 1JZ3A 3MS8A 1GUVA 1GOKA 4N9BA 2VGFA 3M64A 3WIJA 2GGHA 1QWKA 1RD5A 2NQLA 4L65A 1AVAA 3VD9A 2D2HA 2DGAA 1KFWA 4H2HA 3B8DA 3QR0A 1BKSA 1MXGA 1VRDA 3OYXA 2YYUA 3L67A 3G1YA 1ZPTA 5CZJA 4LIIA 2BGQA 3CAQA 1P6BA 3D5HA 2GDUA 3G24A 3VC5A 3GZAA 1LOSA 2ZBTA 3CHVA 3PZNA 4B4FA 2FVKA 5I3HA 4J2PA 3ABOA 3AC0A 1DYSA 3MCOA 1TZZA 2PI6A 3FY1A 4Z1DA 4V2XA 4QISA 1N63C 5EMJA 2RDWA 1U1HA 2R6OA 2X1TA 1R3SA 3CTLA 4ZB2A 1XIJA 5CGTA 5EGRA 3ZR4A 4WUIA 2Z28A 3PZVA 4QIUA 1A5AA 3SUSA 4K7YA 2V68A 5JUVA 1Y5XA 2W61A 1WB0A 4AWTA 2D2OA 3RUBL 1TMQA 1KTCA 4KFOA 4C6KA 2E6FA 5FESA 2YLLA 1KFKA 3IJDA 1BTCA 1KBIA 3GDLA 4UR8A 1KC7A 2X8RA 1GK8A 1V4YA 3ZT7A 4GACA 3R8HA 4LPCA 3KW3A 4NILA 3EYPA 3CEPA 1BQCA 1GORA 3PTMA 3B0XA 4AZGA 3TQKA 4B15A 4MTVA 3C8FA 3FAWA 1CLXA 4Q4RA 2Q8LA 3DFOA 3A24A 3OGSA 1RAKA 2FB2A 5F4SA 4DF0A 1XR2A 1OFAA 1MUWA 5EFDA 2XN2A 1T8XA 3QN3A 4IICA 4DYEA 1O66A 1JAEA 2H90A 4OV4A 3T0TA 1WDDA 1X7FA 3UD6A 4FK9A 4GVFA 3VVGA 1BYBA 3MY9A 3T42A 3N2XA 3WDJA 4GZEA 3IJQA 1W8GA 1MW2A 5HA7A 3KLJA 2QDDA 4U4MA 4L6DA 3M0YA 3ZIZA 3BMXA 5IM51 2IMRA 1UMLA 2VEPA 1KD0A 1WYIA 3VKDA 4H4VA 3FX4A 1BRLB 4C6OA 3TLQA 3NVYB 1GKPA 4U31A 3OOQA 3LS9A 1TFVA 1M7PA 3LGGA 1HKJA 4GBUA 2CEQA 4PUWA 4HBKA 3WUGA 3FOKA 3P93A 3DHFA 4AUBA 2A3LA 4KRZA 3LBCA 2W54A 4IGHA 6TAAA 4MNKA 3KCJA 3M5VA 4JN8A 4PBFA 4HMEA 1F7BA 3DI0A 1ZENA 3R12A 4U5IA 4GIRA 1N60C 4E38A 1ODUA 4Q7NA 1A47A 3NO5A 5EMYA 1PCWA 2QUMA 3A22A 3H2EA 2DPEA 3TTEA 4QDMA 2O9RA 2BASA 2ZXBA 4ZQOA 4FOKA 1UJQA 5CZ0A 4HVXA 4K8HA 2GLKA 4W5ZA 1F6KA 4CN1A 6A3HA 1S38A 2ZWYA 3R0UA 1J10A 1KRAC 4UTWA 2WPFA 3AIUA 3MSDA 4JN7A 4LRTA 1FCBA 1IQ8A 1GOXA 4EPBC 2WPCA 1OYAA 1F2JA 5D9OA 3K13A 1XIGA 1GEHA 1JEZA 5GRTA 2R1NA 3C2VA 2QCLA 4G56A 1ZB5A 2NV2A 2FTYA 1LP6A 2YDAA 4JN6A 1GREA 1ZK7A 2JFEX 4C90A 1XI3A 1PS9A 4PMZA 5GNYA 3A5FA 3S2CA 1F3XA 1RVKA 3RX3A 3B0VC 7XIMA 2NPXA 3FS2A 2D24A 4J3ZA 2HPMA 3BLLA 4YTUA 1FHDA 4AY1A 1H63A 4UC5A 1IIHA 1W9BM 5JQ9A 4BFAA 2XU2A 1ENUA 3KRUA 1N55A 2E09A 1HX0A 4FNSA 3MMUA 3R43A 2PU1A 1FBAA 2V2DA 3RIKA 3FG2P 3VO0A 4QROA 4WF7A 3PK7A 5LIWX 3N2BA 5M5DA 4HMNA 1IT8A 2VWTA 1MEHA 1MSSA 3GY1A 3JZEA 3O1NA 4HN4A 1M6IA 4JKMA 1J11A 1LBFA 2EG7A 2R91A 3SSZA 4I3GA 4TV5A 4YTSA 2CBIA 1WDSA 4IFRA 1QRQA 3WD0A 3SCVA 2RAGA 3W7NA 4BY3A 1AZ1A 1X6UA 3A3XA 4IQEA 2H9AA 1AJ2A 2BY0A 3B9EA 4PUKA 5AECA 4LH8A 1LLOA 3GTHA 3NUKA 4Q3MA 2CWNA 3CTTA 1EDQA 3CIWA 4UCGA 3AWOA 5FIPA 3D3FA 2Q02A 2PRMA 5AYIA 5I6SA 4HT3A 2OYKA 1IF2A 1CYGA 4NL1A 1DIKA 3ICJA 1UG6A 1YE4A 4PCFA 4QLLA 4Z2GA 4AIUA 1YIXA 5LA2A 3FEQA 1KCZA 3TMQA 4M8UA 1WUFA 1UQYA 4WD0A 1XH0A 2XFFA 3VGDA 4HHMA 2DIEA 4FIRA 3QY8A 1J0HA 3DERA 4QQ3A 4DUXA 3H4WA 3U2OA 3CGTA 1LUCA 1RZMA 3L4WA 3MUXA 4YLWA 2PWHA 2EG8A 5LGXA 2V5DA 3HTWA 1LVLA 4BR1A 3TROA 2ZZ3A 1HKVA 4HA0A 3W7MA 2WBGA 5TQLA 4DUWA 3VDHA 3ZJ6A 1TWDA 4S3AA 3PJTA 2GGIA 3QW4B 2YVGA 3S6DA 1F9CA 3UJ2A 2OODA 3PJUA 1PL9A 2E4TA 3TXZA 1LG1A 3ONBA 4J3SA 5FD0A 3WK0A 3FIGA 3O05A 2WVVA 1QAPA 1Q7QA 4FXJA 4HNOA 1Z9AA 4LCRA 4MB4A 4QDWA 1R3QA 1PWMA 3WLQA 1DWAM 4G2DA 2Z29A 1CENA 4LANA 4DNHA 4LAKA 3U7VA 5FF3A 3KLKA 2JGYA 3KM8A 1H5VA 4UNKA 5D03A 5DO8A 3ZYZA 2BVTA 1B3VA 4MIMA 2YIHA 3NQMA 2DV0A 4U3AA 1ONRA 3GM8A 4M29A 4KEUA 2PC4A 5AC7A 4WY0F 3CQ0A 3PB0A 1JPHA 1H7NA 4XKMA 1HXJA 2OEKA 1FA2A 3IPWA 4AVFA 3BLOA 5AZ1A 5C9XA 1Q6OA 5J5RA 2PDBA 4D8AA 5AFDA 1GERA 1FCQA 3HV9A 2QIIA 3QTGA 3W2LA 3HGOA 5G1TA 3AXMA 3WO8A 1FFRA 4AYGA 3PG8A 3U6WA 4B5UA 4FS9A 2OKTA 5CG0A 3EX2A 2GSHA 4LUJA 3U2CA 3PJWA 1EWEA 3DAQA 4NYUA 1DIDA 3LM7A 4AIEA 4I5RA 3LCFA 3NZ1A 3TC6A 1IT0A 4A2RA 1TV7A 2YCEA 1LBMA 4MNJA 3CZGA 3FJ6A 1QW7A 3H53A 4WEVX 1GONA 1E9YB 1QWGA 4ZA0A 1KLZA 5EMMA 1H3GA 1HKMA 1B5TA 1X38A 2C6QA 1K9FA 1CLKA 1QNRA 3L2LA 4B3KA 1DPMA 2B4GA 2YL5A 3EX4A 2WC4A 3LU2A 1M6JA 3PAJA 4B5XA 5C2XA 4B2DD 3MUIA 3UT0A 3BH4A 3A4AA 1K03A 2B7NA 3H23A 1SGJA 1K8CA 3N9RA 4A3YA 1DJIA 1JDDA 1ZAHA 2ZZ0A 5EBKA 1H0IA 1UR0A 4NZ3A 4DNAA 2Z1VA 2J13A 3HO8A 4JTFA 2QDHA 3AYSA 1AH3A 3KLLA 3W00A 1AH0A 1U2YA 3E38A 3PBMA 3DENA 4GX8A 1EF2A 1PAMA 4YYCA 4UMBA 3VGHA 2F9RA 3PJXA 3ZXWA 5FAGA 2FZBA 1OQFA 2ZVIA 3VGBA 1UHVA 2ZVRA 2CIPA 1OC5A 2HRWA 2ABAA 1CNVA 2YL6A 3GDBA 2ACSA 3LUTA 4Q7BA 4WSKA 3BG9A 3EWBX 3BAWA 2Y61A 4JQ9A 4GZIA 2DZPA 2OXNA 3BGJA 3SGGA 2J7BA 3EDFA 1UR2A 4PUJA 4QDPA 1GKRA 1VBJA 4IGNA 3I65A 3WNPA 2CLEA 1EXBA 3VK5A 1BHGA 4DRSA 2IPFA 1J18A 2J9YA 1F3TA 4YL2A 4NF7A 4IPNB 1L6WA 2GDVA 1JGMA 2FPVA 1KM3A 2VFGA 1VIZA 4L4PA 3AROA 1W5NA 2VP8A 3CL7A 3LHZA 4PYSA 4M24A 5DF0A 2VEMA 4N9EA 3ZOAA 5FL1A 1WDWA 1D3HA 1TWWA 3ITLA 1FQ0A 4FR1A 1P0KA 3KRBA 3V7PA 1TPUA 1FXPA 3IAPA 4KKXA 1AW2A 1UBPC 1QPRA 4Y9MA 1J9YA 3P0XA 4O8AA 1HIZA 2PD5A 3LEPA 2CZ5A 3LBMA 2ZUVA 2YXOA 3EMQA 3OHIA 4EF8A 5HATA 3GS6A 1G69A 3B8TA 5HAOA 3SY1A 3SR7A 1B90A 2VR4A 3AXXA 1UD3A 2QDEA 3W1QA 3C3NA 3W84A 4OUEA 3T2PA 1J12A 3KOWA 4XK2A 4NKCA 4M0XA 5BU6A 3N25A 1L2UA 3SCNA 3PTKA 3LXCA 3FYOA 3RM8A 3WDQA 2ZZ1A 3GYCA 3IK4A 2IXVA 2P1FA 4IPPA 4KBXA 1UH2A 1CGTA 4QS6A 3EKZA 4R7OA 1SM9A 2QV5A 3UR2A 1EP1A 5DX7A 2VYOA 2A3BA 2GUBA 3AS2A 3AYTA 4RLIA 1I0DA 2UZ9A 4H7VA 2X7WA 3VIIA 3CMJA 1Q2SA 1PPIA 4E0CA 2YDSA 3OU8A 3GD3A 3CLMA 4HK7A 3U9IA 3OGRA 4AVNA 1TCDA 3M1ZA 3JUGA 4IMAA 1W1VA 2X1RA 4AIBA 1DEDA 1IWPA 2Y1HA 1OT1A 1L2QA 5XIAA 1Q6FA 3BWWA 3GAKA 4W7VA 2DIJA 1NFPA 4D6GA 4TVYA 3HG4A 2XSBA 1AD1A 1FFVC 1ADDA 1X8FA 3S2MA 3DHPA 2QJIA 3BANA 2QCDB 4LY4A 3W76A 1KM2A 4ZOHB 4L4OA 4Q4KA 3PBVA 3BOFA 4GQRA 1AUSL 3T44A 5T26A 1YTDA 1M41A 1PX4A 4PR4A 1V08A 1UUMA 3U4AA 1L8PA 4P7NA 3W88A 4WDUA 4N9CA 2MNRA 1JUEA 2WC7A 4PE8A 1IEWA 3IIZA 1LL6A 4O10A 2V5CA 3EOUA 2ZA2A 3VTRA 1FFQA 4Q8VA 4APNA 3BARA 1RCOB 3N2MA 3F5KA 1HJUA 2V81A 3W2KA 4FSAA 4GHRA 3G0XA 1ISZA 4AWEA 3Q4DA 1RA0A 1V0LA 1VFHA 4H4TA 5HNUA 3KP1A 5AVHA 3PZGA 3QY7A 4GCAA 4W89A 3JRKA 4LNCA 2P5NA 1W9XA 2OSXA 3CK5A 4O1CA 1A5SA 1CECA 3CXOA 5I03A 6ENLA 4W8BA 2A79A 3N4FA 1K9TA 3VOGA 1HJXA 4JHMA 4MPQA 1WDPA 5C0QA 3UG4A 2HK0A 1TJ0A 1HJQA 3BCDA 4JNMA 3TNOA 3FJ4A 3K8MA 2DZUA 2D3NA 3OZYA 3C86A 2VVSA 1V02E 4PL2A 2OSWA 1MYRA 3ALFA 5DN1A 2DZTA 3B9NA 1RHCA 4L7ZA 1GXFA 3GFYA 4LVFA 3GBEA 4ROQA 3MHFA 3ZT5A 2BY2A 4IUOA 1UMYA 3R79A 2QF7A 3TYUA 3EXTA 3KOZA 3FDKA 3QF0A 1KRMA 1V3JA 1YW1A 3QYQA 4B5WA 2HISA 3NPXA 3WH7A 4KIRA 3CBWA 4WJ8A 4LJ3A 3SRKA 4D72A 3WH5A 1SSGA 2QVHA 3GFZA 5DLCA 4H9XA 1N82A 3UZ5A 1EB3A 5G4WA 2I7GA 4EXQA 1OG6A 3W24A 2VZTA 2NQJA 2PA6A 3N12A 3LI0A 3SN4A 1TPFA 2KZHA 4BJHA 3P81A 4LOCA 4PSRA 1JI1A 1TPVA 2RDUA 1TRDA 2R9RA 1DIOA 1QXLA 2WM0A 4HA4A 2E1WA 1VCGA 4REQB 2QAPA 7ODCA 4PCNA 3WQ8A 3DBPA 1VS1A 3QQWA 1KWGA 1W1IE 4GY7A 2CZDA 4DM1A 1ITQA 1JPKA 5JBEA 2ADAA 3TW9A 3DFQA 1Z32X 2FHFA 3I7QA 2G37A 2VT0A 3UY8A 4UQDA 4H3DA 2YZRA 1ZUAX 4NQ1A 1HVXA 2J3NA 2Y85A 2DZSA 5C2CA 1VJIA 1HP5A 2Q01A 4TR9A 2J8FA 5D9NA 3OC4A 1P6CA 3PHAA 1SFSA 1XINA 1OINA 3FJLA 4EX4A 4NRRA 1PIGA 3ITOA 2P76A 4Q8UA 1UZDA 2ZZCA 5CPMA 4R9XA 4H01A 4J28A 1WXZA 4AZ7A 3BG3A 4LB3A 3ARWA 3E3HA 5D2YA 5JCKA 1B0IA 4HU8A 2E9MA 4CGTA 2E3ZA 1ZX9A 4XO7A 5U1OA 2WZMA 1UR3M 3S83A 3N6JA 1W2PA 1GQJA 3P60A 1TIMA 4NI8A 1OK4A 3PF3A 4MAVA 3LXAA 4IL2A 3I7SA 4UFLA 2YVFA 3R13A 3VDAA 1O5KA 2WHMA 3NL5A 3NSNA 3CO4A 3LPFA 4H83A 1F8IA 1S2TA 3MZ2A 4FIQA 2UWFA 4WXZA 4BEUA 5CC3A 4GE8A 1TV5A 3VKAA 2PMQA 3SRFA 1HJWA 5EYWA 3ZVHB 1Q1RA 1RY0A 3NEVA 3W28A 1QI2A 1YMYA 4W8LA 3HG5A 4RKAA 3CUFA 3IV8A 7TIMA 2C79A 4DZHA 3P80A 2A6LA 5BW6A 3M5XA 3WMBA 1UC4A 1Z6KA 1PE1A 4XKYB 4BKNA 3L21A 3UR7A 3F2CA 4XBKA 4S23A 1EZ2A 1GPWA 4ADTA 4M52A 3OJGA 3NSMA 4JTSA 1DWIM 2RH9A 3SQMA 3TNBA 5F4XA 3PZQA 1KTBA 4CQBA 1W5PA 1Z69A 4KFPA 5HNTA 2DT3A 4W84A 3WSUA 3ES7A 4ZEPA 2WBKA 4M1BA 2ZXDA 1XYBA 3FA5A 2GR0A 5MF5A 1TRIA 4AISA 3COTA 3WJXA 4JIHA 2ICSA 3KTXA 2WBAA 1C92A 1MWOA 4AF0B 2NV1A 1GZ1A 3WLNA 3LI1A 1ONXA 1P0EA 4AHOA 3LGEA 3ABSA 3WMCA 1XCXA 2GVLA 5I3DA 2EPNA 4IJRA 4Z1CA 2POTA 1IEQA 4PB3A 3FHQA 4Z0SA 3QRHA 4YJ5A 1EPXA 3I4EA 4GINA 1O94A 1UUQA 2BX7A 3LA4A 1DXFA 2ZX7A 4X0VA 2GH5A 4IP7A 3NWRA 1H50A 2PE4A 3NQGA 3O6AA 1E0UA 3TJ4A 1A0EA 4TIMA 3HIJA 4KH2A 3QHNA 4NAEA 3LTPA 2X50A 3TKFA 4W85A 1H7XA 2DZAA 4UFHA 1H41A 3E74A 3TCEA 4W7UA 3QMRA 1B3XA 4XV0A 1RCXB 2OYMA 2V5BA 1FUYA 2VENA 1C7TA 3QZ6A 5DEZA 1GQNA 1XQKA 3MMDA 3KOFA 1THFD 2BLEA 1P6WA 4GI9A 1K4HA 4JIPA 4H41A 1NDAA 3GNPA 2RFGA 3EX3A 3VIJA 3D6NA 4P8UA 4R88A 2FFCA 4E5TA 2H6RA 3PBGA 2QDGA 5A5WA 2C8NA 4QP0A 1ZQ5A 2ON3A 4O13A 1NIUA 4I9JA 4L6HA 4ACZA 3BAKA 1QW8A 3SFWA 4IOTA 2FVMA 5HMFA 4KEZA 4W87A 4PTMA 1H1ZA 1W3TA 3QW3A 3EAUA 3VKBA 4D8ZA 4I5XA 4MSSA 3QGAC 2XWDA 3OTRA 3C4UA 4KWWA 3LNMA 1HO4A 5LHFA 4QR6A 3PFRA 4DBUA 1GTEA 4RK8A 4AB4A 1LORA 2CBUA 1QNVA 1CIUA 2PU0A 4MOZA 4J9JA 3T07A 2XVGA 3UXDA 4AXNA 4GR1A 4YYFA 1FP9A 3GIQA 4ILSA 4W86A 1P0DA 1ITCA 5FJRA 5JU6A 1ZDLA 3SAZA 3PANA 4Z2IA 1Q6LA 3GFXA 1W31A 2J7EA 3NR0A 4F79A 2EF9A 3OA3A 1WBJA 1O1HA 3RFAA 4CVWA 1POJA 3S47A 4LV4A 4V1YA 4QJ1A 3THUA 4O1DA 4NJJA 4H6QA 1CXHA 1NQ6A 2BDQA 1SJBA 4RE3A 3W7HA 4AMCA 3GXFA 4EMJA 5C54A 3WL0A 2XVPA 4TTUA 1TWSA 2Z7KA 3APYA 3LLFA 4RV8A 2Z6IA 1GG1A 3QC3A 1F8WA 1XIIA 3EB4A 4AW7A 4GABA 1LM1A 2ZXAA 3UPMA 4C65A 2BCPA 3C0SA 4WSHA 3IGXA 1UC5A 1YRRA 2C16A 1R8LA 2VXNA 3HV8A 2E1DA 3E12A 2X0HA 4BF9A 1CGUA 4JL1A 4FPSA 3TP4A 5AB3A 4DF1A 4AAJA 1HG3A 2GQ9A 3B04A 1ZSXA 1FWEC 5U25A 2YPIA 1CXIA 3DK9A 3P61A 2PLCA 1EQPA 4IL0A 1VFLA 5GVJA 4EMWA 4ZO9A 1KM5A 2J47A 1VB9A 5SWUA 4Z2LA 2RJHA 4RCXA 1ADOA 2A3CA 3SCQA 4OBTA 2VDIA 1XLBA 3QPYA 4GUJA 4IFKA 1E15A 4JNYA 3S2LA 3SQPA 1PDYA 4O18A 2W3ZA 3FYYA 3OBKA 5C9UA 1CB2A 3OZOA 2OQHA 1MW1A 2WHJA 1T40A 1K9DA 4HJWA 4JX4A 3S1GA 1EA9C 2JK2A 5AZ0A 2PRLA 1KXTA 1O5XA 4CQCA 3PZ9A 1J01A 3W70A 5KZ6A 1F3EA 4NP7A 1RA5A 1Y7VA 1E0VA 1ZL1A 5XINA 1CBGA 1YQZA 2I16A 1K4QA 2YB1A 5DCDA 4NY2A 3HQ1A 3TXVA 3VDGA 1LQ2A 3DECA 3WY1A 2FFIA 4MZYA 4J3WA 1T41A 1VFOA 3WQPA 1GETA 2DSWA 3DOPA 1T99A 2O9TA 4LT9A 3STFA 4HD5A 3S9IA 1ZJIA 4NZ5A 4HOZA 1HL8A 2V3EA 2EAWA 3PN8A 4JIQA 3IVTA 5JIWA 2NLIA 1W0MA 1VC4A 1QT1A 2B7PA 4G7EB 2JBMA 2EJ1A 1AW5A 3TYZA 3WF1A 3SECA 2J6VA 1XDLA 1V3IA 3DG3A 1UCWA 5LZLA 3WLPA 2QHAA 3GC5A 1DQXA 3ZJKA 2UY4A 3UXLA 3G1AA 1QHOA 4C1NA 2D23A 3RJXA 1LWHA 4KEMA 4P2VA 2DSUA 1LL4A 4UTTA 1X1OA 4ZE5A 3HGJA 4DXXA 3KHJA 1P48A 4JFWA 4MLJA 3KBVA 4PC8A 2EPOA 3NVZB 4LALA 5REQB 4PMUA 1V6UA 3M0HA 3DJGX 1EC9A 2VKZG 1B4KA 3IIXA 4M7TA 1MEIA 4F9JA 2PDIA 4PH6A 4U2YA 4RNJA 2CHNA 3RLUA 3A9IA 1SO5A 1LF1A 4P7RA 4CEUC 3DBNA 4POCA 4GH3A 1ZMCA 3USZA 3MSGA 3YPIA 2H9AB 4R5EA 4URIA 5H8MA 1RH9A 2JQXA 3DFYA 1Q2RA 2PD9A 2XIJA 1FDJA 1YQ2A 1PKLA 3LERA 1V0MA 5A6BA 3PZIA 3T0BA 4FB7A 3HOJA 4HU0A 1UWRA 4JXCA 4FF5A 1ALDA 2ODOA 4H6KA 5D05A 3JW7A 4O1EA 4JIIX 3PSWA 3GW0A 4PN2A 4MLRA 3IVSA 2I9EA 4ZO8A 2Y0FA 4AQLA 4CEXC 1LUCB 1QHZA 1GRGA 2VJXA 1V03A 4J27A 4EWND 1F4AA 3ZSTA 1XFBA 3BSGA 3WH8A 1PIIA 3T08A 3CHFA 3QBUA 4PTVA 3AIVA 1M65A 5CPSA 4Z1BA 3W81A 1R3WA 4IQLA 3UZXA 1DWFM 4MAZA 3SEPA 5CSRA 2AAMA 2X41A 2DUXA 4C5YA 4AZHA 3UWZA 3EDDA 1PZ0A 2I5QA 5E09A 3P0WA 3NNTA 5KVHA 1OCQA 4LW7A 3W1PA 1SR9A 4QJ5B 3QEZA 4MKVA 3CGBA 4AYSA 3BW2A 4J1OA 4Y96A 2IPGA 4J56A 1YXYA 4S2CA 1ZP4A 3SCWA 2WLYA 4MUZA 4EQXA 3DZ1A 2VQTA 2AGTA 1NHQA 3MU7A 4XD5A 1EBHA 3W6YA 4ZQRA 2ISWA 2FKPA 1E6PA 1GVSA 3QM3A 3HMJG 4ZCWA 4ZGYA 1W9DM 3RPMA 5AC4A 4NX0A 1NWUA 1N5WC 4M6PA 5CSSA 4N6EA 2J8GA 3BW4A 3GTIA 4Y8FA 4B5TA 4DJDA 2CDUA 3SY5A 3UNTA 2BC0A 1CT5A 4C6QA 3VDBA 2YBTA 3G6MA 1QI0A 2XH7A 4Q8NA 3SJ3A 3BAXA 1JYNA 1OFRA 1VQTA 1OX4B 4NNCA 2PDCA 5C7VA 4FLOA 1B3ZA 1GZGA 3J7HA 3EWXA 4CD6A 4JTGA 4OV9A 2TYSA 1HFBA 1NHSA 4DO5A 1JZ4A 1IGSA 3HQNA 2XSXA 1SO3A 1Q4NX 1MNZA 3CPUA 4U5KA 4IGSA 4S1FA 3AYRA 4HPJA 3WD3A 5I06A 2ZDSA 4QSFA 4YCOA 2NSOA 2WZIA 2INEA 4UFKA 2OFJA 1OX5A 5ENLA 4AZBA 3VNIA 1C8QA 1LL7A 2BZNA 5TIMA 1HKWA 1K02A 8XIMA 1MMFA 4AD1A 2AMXA 3WQWA 2BOFX 4XZ9A 3WLOA 3NGFA 1H09A 1WZKA 4JCLA 5FJIA 5DANA 3NGJA 1LDCA 2BY3A 1GRBA 3JS3A 1U30A 4LXFA 1TX0A 4WSJA 4RZBA 3CZKA 3A21A 2YAUA 4MKNA 1BYCA 2DVXA 1ZXIC 5H1WA 1JEHA 1SU5A 5EMUA 2PF0A 2NUWA 1H7WA 4UOQA 4J3UA 1G7UA 1VFSA 3D46A 3FLUA 3BQ5A 2GGEA 2ZRUA 3W2UA 1ZY8A 2X0SA 2HZGA 2YR1A 3BJSA 1A49A 3LPPA 2XYLA 4E8DA 1EHNA 5G1YA 2TRSA 1MXSA 3I10A 4CQAA 4OWGA 4MKSA 4QSHA 4H00A 2VX4A 3B8WA 2V0TA 4IX2A 3RM9A 3APTA 3EX1A 5E9XA 2W79A 5HUOA 3IUDA 4KF1A 5CKSA 4R53A 3N2CA 2W63A 4UTUA 1XPYA 4I7WA 2X1UA 3H2MA 4K39A 5CPQA 4V1XA 2ZE3A 4GYFA 4OBSA 4US6A 2Y7DA 2I5IA 2QCHA 1ZLPA 2YX0A 3GDKA 3M9YA 4JTHA 4ZTXA 1Y65A 4HKPA 1ME8A 2D0GA 2QZRA 1YDYA 2QCCA 1PVNA 2YBUA 3JZUA 4AEEA 1LYXA 1S3TC 3KS6A 4MNLA 2FJUB 3QZAA 5JBDA 5CG7A 4YHEA 3VIMA 3ZT6A 4DO7A 4W93A 1HUVA 2XJ7A 3TUUA 3CPRA 2PDNA 1J2WA 2ZUWA 1X7IA 2PUZA 5M3WA 2GUUA 4Z2HA 3WF2A 3XINA 2A7PA 4CCCA 3WDIA 1TKKA 3S2JA 2IPWA 2YVJA 4AHPA 5AHNA 3P84A 3W1LA 2CLMA 4FLSA 3ZVIA 2ATMA 1MEWA 1PTAA 1TV2A 3RR4A 3RDKA 4US5D 5G5IA 3VOJA 4M6QA 4DJEA 2J6XA 1JL8A 1I2OA 3LHUA 4DLMA 4B3ZA 1XS2A 3L4ZA 2C15A 3R0KA 3TR2A 5FF7A 3F5LA 1YXCA 3VFCA 1NU5A 2P88A 4LF1A 2OYLA 3WG6A 2CERA 3BPWA 3DKJA 4FP1A 1NH6A 1JDFA 3V4BA 3W7KA 1G7VA 2QAEA 1B3OA 3SRHA 3NQAA 1TJ2A 3FDGA 2PTZA 3PWIA 4RW3A 3BLDA 4A22A 3ISIX 4KWSA 5DMLA 5LKYA 2YXGA 1V51A 1ELSA 5AYZA 3FKRA 3K8KA 4ZENA 3W7CA 3UESA