2NQLA

Crystal structure of a member of the enolase superfamily from agrobacterium tumefaciens
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
388
structure length
388
Chain Sequence
MNSPIATVEVFTLTQPRKVPYLGALREGEVVNPNGYIVRKGNRTVYPTFDRSVLVRMTTEAGTVGWGETYGIVAPGAVAALINDLLAGFVIGRDASDPSAVYDDLYDMMRVRGYTGGFYVDALAALDIALWDIAGQEAGKSIRDLLGGGVDSFPAYVSGLPERTLKARGELAKYWQDRGFNAFKFATPVADDGPAAEIANLRQVLGPQAKIAADMHWNQTPERALELIAEMQPFDPWFAEAPVWTEDIAGLEKVSKNTDVPIAVGEEWRTHWDMRARIERCRIAIVQPEMGHKGITNFIRIGALAAEHGIDVIPHATVGAGIFLAASLQASSTLSMLKGHEFQHSIFEPNRRLLDGDMDCREGRYHLPSGPGLGVRPSEAALGLIERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Enolase from Agrobacterium Tumefaciens C58
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
molecule keywords Isomerase/lactonizing enzyme
total genus 133
structure length 388
sequence length 388
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2nqlA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2nqlA01
3TW9A 3DEQA 4DHGA 3RRAA 1XPYA 2GSHA 4GMEA 2MUCA 2DW7A 3NXLA 2GGGA 3JZUA 3T9PA 2XH4A 3V5CA 2PGWA 1P48A 5FJUA 4JHMA 2PTYA 4GGBA 3CK5A 7ENLA 1IYXA 3ES8A 2OPJA 2GGEA 2FYMA 3RCYA 3QPEA 1R0MA 3DERA 3UJFA 3BSMA 4G7FA 1KKRA 1ONEA 1SJDA 3B97A 4A6GA 1JDFA 2DW6A 4DYEA 4J3ZA 3R10A 3UJ2A 2I5QA 4DX3A 4K2SA 3IK4A 1KKOA 4ZA0A 4JN8A 3H70A 3FVDA 1YEYA 4A3RA 2QVHA 1L8PA 3CAWA 3ZVHB 4E8GA 3VCNA 3DG7A 3MY9A 3BJSA 3UJRA 3QTPA 2ZADA 3ZLHA 1KD0A 2RDXA 2P88A 3TWAA 2PP3A 3FCPA 1F9CA 1P43A 3PK7A 3VC6A 1MDRA 3I4KA 3TQPA 2AL2A 2PGEA 4YWSA 3OZYA 3ENLA 3JW7A 3R0UA 3GC2A 3MWCA 4IL0A 1OEPA 1EBGA 3EEZA 2QDEA 3DG6A 3Q4DA 4M0XA 3MQTA 2XH0A 2QDDA 4HPNA 1W6TA 3MSYA 3DESA 1PDZA 3N6JA 3RGTA 4Z1YA 3UCDA 2NQLA 2QGYA 4HCHA 4F4RA 2OO6A 3GD6A 3U9IA 3SN4A 1EBHA 3IJLA 3UJSA 3T8QA 1BKHA 1EC8A 3N4EA 4E4FA 3DDMA 4GIRA 4GGHA 3RO6A 3N6HA 2PPGA 3D47A 2XGZA 2QJNA 1JPMA 1JPDX 3OW1A 2PS2A 3U4FA 3TCSA 1R6WA 4H2HA 2AL2B 2OFJA 4E6MA 3CT2A 2OQHA 3GO2A 3SN1A 2GDQA 2P8BA 4GFIA 3UCCA 3UXLA 3SJNA 2HZGA 3OTRA 3VC5A 2PU0A 3ZVIA 2POZA 3FXGA 3ES7A 2PTWA 4KWSA 3RR1A 3T4WA 5J04A 4EWJA 3STPA 2MNRA 3THUA 3PFRA 5BOEA 2ONEA 4X2PA 4G8TA 2AL1A 2OZ8A 4IHCA 4ROPA 3S5SA 2HXUA 2XH2A 1NELA 3RITA 1PDYA 2HNEA 2P0IA 1ELSA 2GL5A 3OZMA 3ZLFA 3S47A 2PTZA 1TKKA 1EC9A 4M6UA 1FHVA 4HCLA 3TWBA 3R1ZA 4HNLA 4MKSA 4IP4A 3DFHA 2PSNA 3OPSA 1MDLA 3UGVA 3QKEA 3SSZA 3IJQA 2OVLA 2OG9A 2GGHA 2XH7A 1NU5A 4H1ZA 2O56A 1ECQA 3R25A 5EU9A 4Z17A 3N4FA 3MZNA 1BQGA 4ZCWA 3TJ4A 4IT1A 1XS2A 2OKTA 4J1OA 4KEMA 2PCEA 1SJAA 3H7VA 3SBFA 3VCCA 3FYYA 1MRAA 2QJJA 1RVKA 1SJBA 4K8GA 5BOFA 2PP1A 3CB3A 3QLDA 3PWIA 2OX4A 4KPLA 4GYPA 4GYPC 3NO1A 3UJEA 4ENLA 3FJ4A 4FI4A 2AKMA 3I6TA 3DGBA 3DG3A 2P8CA 3D46A 3QN3A 3IJIA 3DIPA 3K1GA 4A35A 3TTEA 3JVAA 2ZC8A 3MKCA 3EKGA 2FKPA 3MUCA 2HXTA 1MNSA 1DTNA 3HPFA 3R11A 4HN8A 2OLAA 3P93A 3CXOA 2PU1A 4JN7A 5FJRA 3GY1A 6ENLA 4IZGA 3VA8A 1FHUA 3Q45A 2QQ6A 2GGJA 3FV9A 3I6EA 3H8AA 4KT2A 4IL2A 1EC7A 1KCZA 2PP0A 4FP1A 1WUEA 1TZZA 4H83A 4MMWA 3V4BA 3OP2A 2OZ3A 2OQYA 2PMQA 3V5FA 2PTXA 3KUMA 4DN1A 1JCTA 4MGGA 2QJMA 3H12A 3BOXA 3R0KA 2P3ZA 4K1WA 2CHRA 5FJTA 5FJPA 3NFUA 3TOYA 5ENLA 3PWGA 4E5TA 3DFYA 1E9IA 1WUFA 3VFCA 3CYJA 2PODA 4DWDA 4GISA 3ZLGA 1MUCA 5FJOA 3NZGA 5IDZA 3P3BA 1TE6A 2AKZA 2OZTA 4DXKA 3SN0A 3UXKA 3V3WA 3VDGA 4HNCA 3P0WA 2XSXA 1SJCA 2PA6A 4H19A 3T6CA 4HCDA 3ZVHA 4HYRA 4E4UA 4IP5A 3TJIA 2GGIA 3SQSA
chains in the Genus database with same CATH superfamily
5T26A 4RNHA 1ZAIA 3L5MA 3H7RA 4G7EB 3E96A 2E3ZA 2VEFA 2DW7A 4Z1DA 1M04A 3TXVA 1I1WA 1MXSA 3CV7A 4FXSA 3NURA 2ACQA 1V6WA 3HFYA 1QFEA 2OWCA 1DNCA 1HO1A 2EQ9A 1IZCA 2ZZ6A 3ABQA 3OYXA 3WH6A 5K9CA 4Q8WA 4RLIA 2YCEA 4J3ZA 1JZ2A 3E0WA 3VK5A 2GDUA 1PZ3A 4KW2A 3PBGA 1G4SA 3A3WA 4PGLA 5IDIA 1LT8A 3BG5A 1Z44A 1FCQA 4MYAA 1F73A 3MANA 5FEXA 1FDZA 4RDVA 4WF7A 5DT7A 1HX0A 2ACRA 1MNZA 2J27A 4F48A 3W82A 4HPXA 3TQPA 2AL2A 4D8LA 1PV8A 4XZIA 4GLEA 1M5WA 3KP1A 1FH7A 1DV7A 3WD3A 1W17A 2WB5A 1VCGA 4IL0A 3UWWA 2AQVA 3AMDA 3VIJA 3S0CA 2V2DA 2WLZA 3KTCA 3BO9A 5IBXA 3OGSA 8A3HA 1I45A 3TK7A 2Z25A 1N7KA 4A2RA 3EKZA 3AIUA 1P6BA 3NQMA 1W6TA 2P53A 3CTLA 1MFVA 3AROA 4W8LA 1P1XA 4S3CA 3EMCA 1XDLA 1EJUC 1MUMA 3IV8A 4R3UA 4S38A 4G6CA 1J2WA 3GXDA 2GQ8A 3CO4A 4LALA 3YPIA 4IQDA 1S39A 1W32A 2C91A 3HZ3A 1EC8A 3AISA 1MEIA 1YXCA 2ZX6A 4GUJA 3G0UA 2VUNA 2GFTA 4UB9A 2QJNA 1DXIA 3A4WA 2PDCA 3KOXA 1ZLPA 1OF8A 3LS9A 4OOUA 2XVNA 1DWAM 1UASA 3UR7A 3PZNA 4HU8A 4ZMGA 2LLEA 4EMWA 3B9NA 5DELA 2YAUA 3TEVA 1RP9A 2FZNA 5A2BA 4ZQNA 4WOZA 3WQEA 2V81A 4MUPA 3UCCA 4HA3A 1JF6A 4WRHA 3T44A 3VC5A 1VBRA 3AXMA 1T0OA 5F1UA 4E0CA 1BXBA 4Q6JA 3TYBA 5C71A 4DBWA 3ZIZA 4UWMA 1UQZA 3P0XA 3RFAA 1OG0A 2CNCA 1ZAJA 4N4QA 3EGJA 3LYEA 3C56A 1TQXA 3PVFA 1GVRA 2XH2A 3QFAA 3NYDA 3S47A 2Z2BA 2VD8A 5DY3A 2QAFA 4Z2KA 1X97A 3VTRA 3W02A 3LQLA 4DYJA 4MKSA 4E3TA 1XRSA 3UZZA 3WZ0E 1OFQA 5JCKA 1PYFA 3IPWA 1PHWA 1AW1A 1AVAA 2J7BA 3LPGA 3TJXA 3ITCA 4KFOA 4OBSA 2XPKA 1NY1A 4NY2A 1QR7A 4ZCWA 2YVFA 4UR7A 3N2CA 4GG9A 3A3XA 4TTGA 1SJAA 2Z1SA 1IWBA 5HNRA 5CH9A 5GVJA 4U2ZA 2Q3OA 5FF7A 5G1YA 4B90A 2Z1XA 2YVGA 3DBPA 3N1AA 1TJRA 4TV5A 1NF0A 2WOQA 3H2EA 5A2AA 4TX8A 2CFFA 2BVTA 5LXEA 1C9WA 3UJEA 1V77A 4M7SA 1L6FA 1SW7A 5AC8A 1WYGA 1VPXA 3FYPA 1RR2A 3QN3A 1UKQA 4UFHA 1MZRA 3MKCA 2ISWA 4GVIA 2CWNA 3VNJA 1ZY9A 2PD5A 2GWNA 3TYAA 1A49A 1V7AA 2OLAA 4U4MA 1IZKA 4BFAA 4JTCA 2PBOA 2GLKA 4CN4A 2UWFA 1UC5A 3IIOA 1FWCC 3A7RA 4WX2A 1JQXA 4NJKA 2WJZA 3NVVB 1UC4A 3TMLA 3HIJA 1D8CA 2PLCA 4XVDA 1IT7A 1XGEA 1S2UA 1WKDA 3W3OA 1RPXA 4Y9MA 4PBFA 3H26A 3VNMA 1UB3A 4UQCA 3NQ7A 4WY0A 3T0TA 4YCPA 3ZOAA 2EQ8A 2ZQ0A 1MXDA 3OLDA 3P5YA 3GHUA 2OQYA 3S83A 1NQKA 4PUMA 1VGAA 3C0LA 3DAQA 3M0XA 4X0VA 2GWGA 4J2MA 3LD5A 1HQTA 1UR3M 3SCWA 4EACA 5A6MA 4P2VA 3PZUA 3T09A 1IEWA 2BBFA 3CL8A 3LI1A 2I1OA 3TNBA 4H7VA 4PMQA 4P61A 3W7HA 3V7PA 4BZYA 1PHQA 4CU8A 4LEQA 4JQ3A 4I3GA 4IQJA 3UXIA 3W71A 3IEBA 4GI4A 3FIGA 4EPKA 4GVHA 5LIYX 3FG2P 3WEZA 2GOUA 2ZA2A 5A5WA 3WLOA 3GM8A 4UZUA 4IGMA 1ONFA 3TP4A 4OVXA 1DVJA 3NA8A 4CD8A 3UXKA 3VDGA 3DYMA 2XSXA 4FOUA 3PR2A 5HNNA 3F4CA 5ABFA 4F0LA 1FP8A 1XLJA 3K30A 1J96A 3TW9A 2R14A 4AF0B 3WDIA 1F07A 3VKKA 1XIBA 2E5DA 3CIVA 3HV8A 1R8LA 5AHIA 1GVSA 3SW6A 5HUOA 4NEWA 4LUTA 4C7DA 4C6FA 2FQIA 4IF2A 1R2RA 1SO6A 4Y8EA 2O9TA 1IYXA 3GG7A 1EQPA 2J77A 3KRUA 4YL2A 1R46A 2GQWA 3N2XA 4D6EA 3TR2A 4JQ4A 4Z08A 3RMEA 2G0WA 5ECVA 4AC1X 2ZXDA 3W87A 4AG0A 1SR9A 3RX3A 4JIRA 2QMJA 3ALGA 2R1NA 3UG5A 3NQAA 4PN2A 1PZ2A 5I06A 1AZ2A 1HJXA 1EHAA 4HOWA 1ZQ5A 2P10A 4D6FA 2VC9A 2QVHA 3CAWA 4V33A 4E2VA 3W23A 2Y70A 1S5NA 3BVJA 2WJDA 1HUVA 4NQ1A 2RDXA 1SW0A 1F9CA 1ICQA 3GXTA 1HIZA 3URAA 1XIMA 2BGNE 1KV8A 4X9YA 2WSQA 1EL3A 1UMYA 4F0RA 2P50A 4IIBA 3EEZA 1K9EA 2C0AA 2BS9A 4K8HA 1QPQA 4L4LA 1CX9A 1OCBA 1W3HA 3G77A 2QEZA 3VNDA 2PWDA 4MJMA 4X61A 3W1TA 3WMLA 1TRDA 1XIEA 4S23A 5DLCA 4WKAA 4N6FA 3HGOA 2GK1A 3OQEA 4AD3A 1JOAA 1QI5A 1ZP4A 5GJNA 1KO0A 1KM3A 4MVAA 4KWWA 4LVAA 4N7QA 1DIKA 3O6CA 4GVGA 5IXEA 1F8WA 3N6HA 3D47A 2CW6A 3V0TA 2Q8ZA 3OW1A 5AC4A 2J8TA 5A8GA 2BOEX 2A4AA 3VNKA 1KM0A 5BROA 4H2HA 3WEOA 3OYZA 3AMLA 3VUSA 5JCLA 3OTRA 2O9RA 3R58A 1RJRA 3T4WA 3A5VA 4ZQCA 2HRWA 1UR2A 4DYKA 4LY4A 1NFBA 4MTVA 5I07A 2AL1A 2PDKA 1LLZA 2Z6JA 1K70A 4GACA 3BH4A 3OODA 5D37A 4BV6A 3S5SA 4GBDA 5CJMA 4XUGA 2HXUA 4H4WA 2P0IA 2PDFA 2QCNA 5ABGA 4ZGYA 1J6PA 1RQHA 2IKJA 3KL5A 1GRHA 1PKLA 2DY3A 4K38A 4X0NA 2FVKA 4GXPA 2G3JA 4UTJA 1SW3A 3IARA 1ISXA 1JCNA 4FXRA 4QNEA 3C6CA 3WNPA 2IMRA 1S38A 1T41A 3H54A 3DC0A 3TZNA 1KGXA 3HGSA 5DMNA 1DIOA 4MWAC 3F7JA 2GGHA 2CLEA 3HM7A 1M53A 1NOUA 1HGWA 2ZZ0A 3FDGA 3L0NA 1M41A 5FF2A 3TNOA 3CUHA 4ERIA 2RABA 3TONA 3TJ4A 3DJJA 1B54A 2C6QA 3OBEA 3LQGA 5TIMA 1CXEA 1GYMA 2A0NA 3CWHA 3THAA 1QNVA 4KETA 3T55A 4N9CA 4K8GA 5HNUA 4KCTA 1GOIA 4WQ6A 4A4AA 2OCZA 1IF2A 4PTDA 1OG6A 4FX9A 1DJYA 1NF7A 5GQBA 3LPFA 2DQWA 4DI8A 3FGCA 1HNYA 3DGBA 5DFAA 1GVYA 3RO8A 2RDWA 4AU0A 1BPLB 1UH3A 3VGFA 3L68A 1UP0A 2NQJA 3KBJA 3T4CA 2BMBA 2G3MA 5B80A 4M24A 1MQRA 3W1UA 1OSEA 2ZKMX 4QE1A 2ZC8A 4L1XA 2REQB 4PEEA 3LCXA 3MUCA 2R1MA 2C1HA 1W3LA 3PFMA 2V3FA 1Q6GA 2W4XA 2ZWYA 1QHPA 4GA8A 3CGCA 1Q3NA 1CXFA 3IK2A 2FPVA 3A3HA 1QNOA 2PB1A 3VA8A 1NOWA 1JPIA 4RE2A 1YDYA 4AWUA 1J5TA 4ML9A 1Z6KA 3EA1A 4O17A 3QF0A 1TIWA 2FTPA 1EP2A 1ZALA 3KVLA 2DJLA 2WBGA 1UR9A 4MYXA 3BTNA 3FJ6A 3NQ6A 4XV0A 2XZ9A 3M0ZA 5REQB 1WNOA 3QY6A 1WPCA 3BJTA 5LIXX 3W29A 1F74A 1WDPA 3KDNA 2POTA 5IFPA 3K4WA 2ZZ5A 3RX2A 4S39A 7REQA 1STZA 4YNGA 1VENA 3UT0A 4XIMA 2YYUA 1UUOA 4HTYA 4MKVA 4LUTB 1BG4A 4JDRA 3B8UA 1HZYA 4NP7A 3W1AA 2ATSA 1TREA 1G4EA 3NFUA 4F0HA 3ARUA 2W3RA 1ECEA 3GC5A 1Q4NX 1U22A 2ZRXA 2J6VA 4LUSA 3W72A 4U10A 4DWDA 2WNWA 3SRFA 1GJWA 3MP4A 1PZ0A 2WHLA 3C0JA 5JUVA 3WLRA 1XQKA 1L6GA 1HO4A 4P8XA 1UROA 3AMGA 2PGFA 3WUBA 1OCQA 2Q6ZA 4DEFA 1SJCA 1E73M 4FNRA 2CEQA 1X1NA 4EMIA 2OT0A 3HB9A 5EMMA 2XN1A 1H5VA 4KMQA 1WDQA 1V6YA 2P5NA 4R88A 5F1VA 1BFNA 1UUMA 2W0UA 4F0KA 1RV8A 1FHDA 4M52A 1LWIA 4MB3A 5DRIA 4JQAA 2FZ9A 3G8EA 5BU9A 2J78A 2OEJA 4C5YA 3MUIA 3ES8A 2VI0A 4HD5A 2IXVA 3P2VA 4I9TA 5LYRA 1XPGA 3O8AA 1K4QA 5G2WA 3ITOA 2INZA 4WVXA 4GC4A 3ATZA 1ADOA 2ZZ4A 1M01A 1A3XA 4OIFA 5HAOA 3IVTA 5GNYA 3H6OA 1ZGDA 1F6YA 2FLIA 3MBDA 3NSNA 4B15A 3L5LA 1UWUA 4EQXA 1LQ2A 1BAGA 3W88A 3FVDA 4HK7A 3RMJA 4A3RA 5KEZA 4O16A 4E8GA 3L0KA 2Z6IA 1Z89A 1AJ2A 2PDMA 2GJLA 4WY0F 5BRQA 5BXTA 2X8CA 2V5CA 2C16A 5CCZA 3VOCA 4JNYA 1YE6A 4QSHA 1N2VA 1F4AA 3MT1A 4ADUA 2F7FA 4XSMA 3S5YA 1SB3B 3CZLA 4KGJA 3IIXA 4YWSA 2CLHA 1I4NA 3G24A 5G5HB 1YNYA 1RBAA 4IFKA 4GHRA 3RG6A 4WDXA 4DJFC 1ONXA 3WEMA 3NDYA 2E5AA 4AIOA 1EIBA 3LHZA 4K8EA 2PDBA 3EDDA 3CNYA 3AMCA 5HATA 2OYLA 4HU3A 1XH2A 3MQTA 1EIXA 3R7MA 1BZLA 1XRTA 2WPBA 4W4QA 1XBXA 1XQLA 5C7VA 3HGJA 3WFLA 5J5DA 2X0YA 2OO6A 4QM1A 3MI2A 1QTWA 4Q8QA 4YMZA 8RUCA 2PLJA 1QPRA 3GG0A 1X6LA 4MDPA 1W1PA 1RM6B 3BSGA 3OA3A 2WSYA 4US6A 1J6OA 5HPCA 3QJAA 1I2QA 2YDSA 4I9JA 4BF9A 3CXBA 1UUQA 3ALFA 5CPOA 3CQJA 1WP6A 1I6NA 1VBJA 3U4FA 4AWTA 2HCVA 2QYGA 1ME9A 2X0HA 1DJXA 4J56A 5H6HA 3W4RA 4TVWA 1NEYA 1O68A 4GFIA 4IX0A 1PX4A 3ES7A 2YSWA 4LW7A 2W3SA 3TN6A 2E09A 2XFRA 2WVSA 4HZMA 2EJ1A 1O12A 4LPCA 1MW2A 1CTNA 1J79A 1C7TA 3E5PA 2VC5A 4ZOCA 3IRSA 3LXBA 3EAOA 1GWJA 3BGAA 4TTUA 1P0KA 4GCAA 3J7HA 5E93A 3R43A 1A4MA 4PCSA 4DJED 2NWRA 4HKPA 4Q8TA 5E9XA 1T7LA 4OE7A 1TG7A 3KOFA 1DWIM 2BODX 4OECA 3DFHA 4IIFA 3TC6A 4F3HA 4UIOA 1AH3A 2NQ5A 4E2OA 2UBPC 3FLUA 1VDVA 4JIIX 5FEPA 4MADA 4QCFA 3PWAA 1ZNNA 3MZNA 4FXFA 2E9BA 3M0KA 2WMKA 5D9OA 3U7VA 1IXNA 4W5ZA 1ZCCA 4NSBA 1R2SA 3TSBA 1NOFA 3DI1A 1Q6LA 4WJEA 4DNMA 3AYVA 2RJHA 2I57A 4MF4A 4PUNA 3T2QA 3B8TA 1XDMA 1DXEA 2A3CA 1C92A 4PSRA 5LIWX 2Q02A 2E7FA 6XIAA 1MI3A 3T0BA 4F9DA 4AD1A 3W7CA 3TDFA 3UZ5A 3PWIA 2JGQA 1KFWA 1IEQA 3SR7A 1MMFA 1Q1RA 1P6CA 5AHNA 5HDRA 2AMXA 1XSIA 1QK2A 4P8UA 1OJTA 1U1JA 5HWMA 4LSBA 1VAHA 4A8NA 3VIGA 2VFEA 3PY2A 3K1GA 4B92A 4A35A 3RPTA 4B5NA 1FBAA 2VCCA 3FK4A 1MNSA 4FNQA 1E3ZA 1GOWA 1IWAA 3LB8A 1OFEA 2WZHA 4BHYA 1YPFA 2WVTA 3C2EA 1JZ6A 4WK9A 1V5XA 3AXXA 4HA1A 4B5SA 2Y8VA 1MW0A 4M19A 3MKKA 2YXXA 1GTEA 1ZBCA 1I0BA 1V7YA 4JIQA 1WUEA 3MP3A 1TZZA 3GKAA 2ZX5A 3AUOA 2RGMA 3O05A 4AB4A 3WQWA 3VD3A 4MMWA 2X7WA 4DJEA 1LBFA 1H1YA 2GJXB 3EDJA 1KM1A 3T8LA 3MUY1 4RZ6A 3S9ZA 1YDOA 4C6DA 5T9CE 2VRQA 3QY8A 1VJIA 4LUSB 3BAKA 1HF6A 2VX6A 3URBA 4K39A 2CHOA 2PD9A 4RDZA 4IFOA 4DY1A 4ONVA 4NF7A 2DIJA 1DKWA 1N61C 3PC0A 5AYIA 2YLAA 2I9EA 3BMXA 2P3ZA 3SRKA 1FWTA 3CUIA 4JIPA 3RRXA 4AVNA 3L2LA 4UMAA 3NZPA 4MY1A 4KKXA 1US2A 2ZUUA 2IW0A 4FR1A 4JCMA 1X39A 3BARA 1FKXA 3PZGA 1MEWA 3VKJA 4XWUA 1YW1A 2ISFA 1K8CA 3ZMRA 4M6PA 5M5DA 3CGTA 3K8MA 3PUOA 1A5LC 4DXKA 3SN0A 3JU2A 2ZC1A 1KTBA 2ZUWA 1FA2A 4H19A 4HIBA 3AHVA 4E4UA 2E5CA 2Z2UA 1XYZA 3TA9A 5C9XA 3RILA 4B2DA 1PUDA 2NVAA 1JRCA 3L4UA 4ZTXA 4RZBA 2BASA 1CLXA 2XH4A 3LNPA 1FECA 4IIDA 3B03A 3O0HA 1KRAC 1IR2A 4G7EA 3CHFA 5EL1A 3VILA 4Y2WA 1Z8AA 4ZEPA 1QPNA 3NXFA 2YJQA 4PRWA 4XB3A 3W6LA 3NM1A 4RUBA 3ZSSA 2EO7A 2CBIA 4I8DA 4RE0A 1LVLA 1UIOA 4V15A 2X50A 1C8YA 5I03A 4KWUA 1EFZA 5I00A 2TMDA 1ONEA 4Y9AA 4L56A 4A6GA 4ZO6A 3VIFA 4DM1A 3N3MA 1L2UA 1NSJA 4PUDA 4QE4A 3WNKA 2YW4A 1E5JA 3EAUA 2OQLA 3N12A 1ZMCA 4JIEA 2JKPA 1TPDA 4HSOA 1J0HA 1OBAA 4ES4A 3RJYA 3PZVA 3VGDA 4H9UA 3HO8A 4FIQA 4C6BA 3GW0A 1FWGC 3MYOA 3V35A 5C54A 4CVUA 1QI4A 3S4TA 4PR4A 3WDJA 3LBCA 1ZTVA 4UFKA 5CZKA 5A8PA 1MO9A 3DI0A 1LT7A 3VC6A 1ZBKA 1KA9F 3SQMA 2CZFA 5CG7A 4LCQA 4B3KA 5FF0A 4MFDA 3GAYA 2CXEA 4NVTA 3UWYA 4NAFB 2V6OA 1AJ0A 4V28A 3ZYZA 4JIHA 4NJIA 1W37A 5BWAA 1JEHA 4PUWA 1H3GA 3MMUA 4CNTA 1E1FA 1W91A 5I6SA 3UCDA 1DHPA 1HT6A 3AHYA 2C71A 3FFSA 4HMCA 3FKKA 2XJ7A 5HQMA 4GUFA 4C1NB 3AO0A 4YWOA 3UY8A 3KCJA 1TELA 1XLBA 1P7TB 3SI9A 2JBMA 2VR2A 3W1QA 1W2PA 1WZLA 3MHFA 2Z26A 1JGIA 4E8DA 3D6NA 1JPDX 1YXDA 1CWYA 4HZ7A 2XHYA 2FPTA 3KRSA 3MSDA 3O63A 1UWAA 4LAUA 4Q6XA 1AG1O 1XINA 1GOKA 3PZOA 4UQEA 3EWDA 2OFJA 3LV6A 4HNOA 5LGZA 4P7OA 1Q7ZA 2G3IA 2VGGA 3C0SA 2HQAA 4GQQA 4H7CA 4HGXA 1O7AA 3ZVIA 3CYVA 2PDWA 1TSIA 3RR4A 5DT5A 3STEA 3STPA 2HJPA 1MZHA 1R3TA 3QMRA 3H23A 3EKLA 2X42A 3DGZA 1KM5A 1HJUA 3MTWA 2DUXA 1DQUA 4EOUA 4C6NA 4RXGA 4AHOA 1W1TA 3W1LA 4FO4A 3FJLA 2NVDA 1KLYA 1UR0A 1JRPA 3GHSA 5G2IA 2FFIA 1BG9A 4H4SA 1OC5A 3VFLA 4WDWA 1GT8A 2NXIA 1YQZA 1VPQA 1NP2A 3U48A 1EC9A 2REQA 1N55A 4MNLA 1FHVA 4HTBA 4HA4A 1POJA 3GUWA 3D5HA 3S1UA 1E9LA 3OPSA 2AAQA 1FOBA 3SSZA 4DB7A 1IV8A 2OGYA 3NPVA 4WKHA 2ZBTA 5JCMA 1NU5A 4Q8OA 3GUGA 4QXIA 4TX6A 5FS8A 2VR5A 2WMIB 2BDQA 4XKMA 3MO4A 5TF0A 3G1FA 1LG1A 1WE5A 3PPHA 1R9ZA 5K4XA 1KCKA 3NUKA 1G01A 3WG6A 1SM9A 2PP1A 2BWGA 2WZTA 4W5UA 3CLWA 4KPLA 4GRTA 4FOKA 2JEPA 3R4IA 3WF2A 2OOFA 2NX1A 5XINA 1MQPA 3O7UA 2E9MA 1O94A 4FI4A 1DYSA 1B57A 3P5ZA 3SGZA 3M0IA 1ZRQA 1NWTA 2XSAA 1QU4A 1XUUA 8XIAA 2BC1A 4HQVA 4JKLA 1TE1A 4XZHA 2H90A 4LB3A 3GNOA 4NJGA 2DT0A 1FWSA 4MB1A 5CSYA 2HXTA 3GBEA 1ISZA 5D09A 4G2DA 4JKKA 3O3RA 4XK2A 4HN8A 1VYRA 3GU9A 4D8ZA 5A8QA 3URHA 3P93A 1TO3A 1ADDA 1ZENA 2R6OA 3CUJA 3GY1A 3EX2A 1LRNA 2VFFA 4CD6A 3I6EA 2XIQA 4HYWA 2PEVA 3GTFA 2RJGA 4U3CA 2PDLA 4JTFA 2CIPA 4O53A 3Q6JA 2XG9A 3SIMA 4FZIA 1AQHA 1IZJA 3TFXA 5KVHA 1M7JA 1LP6A 1VYPX 4OUIA 1BYCA 1E9YB 4RE3A 1K02A 2J4GA 1W3IA 1I8JA 3UBPC 3WMBA 4DWSD 1LLOA 1CCWB 2OZ3A 4GKLA 3SCQA 4PBGA 2OR2A 1B9ZA 3RM9A 4Q8NA 4YJ5A 3FW6A 3OOQA 3VNZA 4EPEC 5REQA 2W92A 2A8XA 4CVWA 4LBRA 1H2JA 3GE7A 2CLLA 4Q4SA 1V02E 1VHNA 1OFAA 2VX4A 4U28A 2I5IA 2J7GA 4XZBA 1JDDA 4BI6A 1WZMA 1E0TA 2E6AA 4M7TA 3VAVA 2BFGA 1ESWA 2WWCA 1C9DA 1CLKA 2HWGA 3OG2A 4NYUA 3GRTA 1TE6A 1JXJA 1E15A 3PG9A 3NZRA 4ADTA 4CLMA 3W00A 2C15A 4W86A 4HYRA 4N02A 2XM1A 3WKZA 4DXXA 3THQA 1H61A 4MJ2A 2WBAA 4PULA 4Q7BA 3ERPA 3PNZA 3QBUA 1VQZA 3OJGA 1XPYA 3NQEA 4J3VA 1ITXA 1MYRA 2BY2A 3VIMA 4EQSA 1P48A 1V93A 3M4HA 2JEQA 1OFBA 4IUOA 2YX0A 4RK8A 3EB4A 3SCOA 4FX6M 4QJ3B 2OOGA 2E67A 2OJPA 3ZQ9A 2F6XA 5JBEA 3DERA 1SZEA 4NX5A 3UJFA 1VR6A 5DBUA 5C9ZA 3CWNA 3TFCA 4PMDA 3RK8A 4AD0A 2BGSA 2WOVA 4FNPA 2QCDA 1A5AA 2YCJA 3UP8A 4K2SA 3T42A 1JDCA 5HMEA 5A6BD 4H6KA 3QSRA 5LZLA 4H9XA 3LGGA 4HJFA 3GKFA 3FEQA 3UY7A 4L4MA 4D6GA 4DJFD 1QI3A 4C90A 4GBUA 5AVHA 4L7ZA 1GXFA 2QCMA 3PB2A 1YE4A 3VMPA 2PLKA 4LC6A 3RCNA 1Q6OA 4DXVA 1GRTA 4H9TA 5A8OA 3G18A 1B30A 3R0UA 2HK0A 3N2BA 3R0DA 1K7XA 2WVVA 1KXQA 3S6OA 2EF9A 4JTAA 3ABSA 3SGUA 3DG6A 1AA1B 3B8IA 1EF3A 3T7VA 3KDOA 4AYSA 4APNA 4EXQA 5U25A 1S1RA 4HPNA 2DZPA 4J27A 2XIBA 1XSJA 2ZTJA 3LLDA 4K36A 5G4WA 2H9AB 3W0KA 1B3VA 3LPOA 2YCLA 3A9IA 4OHQA 1EJWC 3H2NA 1WKEA 3ZWSA 2ACSA 4KQNA 3E0LA 5LKYA 4H3DA 4MY8A 4DF0A 4B5UA 4KCVA 1VRXA 4MPQA 3GG8A 1F61A 4JX6A 1H11A 1GEQA 3GNXA 4UBPC 5DF0A 3B9OA 1H09A 3VD9A 5J8LA 3GR8A 4JAWA 4PTWA 3BLLA 4I9AA 2DJXA 1I2OA 4R33A 4WJ8A 2BCPA 4MB4A 4YVVA 2YCIX 3T0CA 4E6MA 3CM4A 5G5IA 1ZX9A 3KLLA 3A6OA 2YQUA 2W9MA 4ATDA 4JTRA 4H4RA 3A64A 1NFGA 3WDQA 4NZJA 3HQOA 3QC0A 1R7AA 4B91A 3GXPA 1A0CA 1CPUA 1GUVA 5CLTA 3KCLA 3PFRA 1SU5A 2CLPA 1CI1A 6TIMA 4TUFA 1JR1A 3V5OA 3ITXA 4D2JA 4GO8A 2NXGA 3FX4A 1UD4A 3WF0A 1H5YA 3CGBA 2V5JA 3W75A 1XRFA 4A3QA 3E2QA 1KFBA 2O4MA 1FRBA 3N2TA 3QZEA 2EAWA 5CPSA 3CEUA 1ELSA 4QIUA 4GI9A 1CXLA 2DVXA 3QGAC 4CU6A 3S2CA 4LVFA 3FA3A 1GEUA 2QNEA 4Q33A 3MDUA 2J47A 5T8GA 3QGVA 1W9PA 1HP5A 3KL0A 4DLFA 1Z9AA 3QKEA 4KCWA 1J93A 1W5QA 3VDAA 1RJPA 3GTNA 3KRZA 2HSAA 2JIEA 4KRZA 5J5RA 2PDIA 3N4FA 2NPXA 3CTTA 3IANA 1GK8A 2J88A 3IS4A 1V6XA 2V2HA 4J1OA 3FGCB 4G1KA 1CGVA 1QNSA 1W0MA 5U1OA 2DZTA 3RJXA 2ISSA 1GHRA 2OTDA 1FWHC 2YXGA 1O66A 3DHUA 3WLJA 1LG2A 3BMVA 3CHCA 3GIQA 3I6RA 2GSEA 1B4EA 3EPMA 3TAOA 2WMJA 1EXBA 4PMVA 3B8VA 3DUGA 4IISA 3WBEA 4UUIA 2DDXA 1ZBVA 4DJDA 3QV7A 4AZCA 2BG5A 1B3WA 2VDHA 4IGNA 4RKAA 1JAKA 1EGZA 4H4UA 1BF2A 1DEDA 5D2VA 1NJJA 3S5ZA 2E6FA 4MJ4A 1B3OA 2Z2AA 4O10A 1GYNA 3QM3A 3KWSA 1A0EA 4MLRA 3EOUA 1QJWA 1GESA 5AYYA 3JUGA 4P7QA 5TNVA 2WBKA 4JXCA 4O8RA 4U5KA 1K77A 4XISA 3KHDA 2J9YA 4MWAA 2CFYA 3FV9A 1E6QM 5I3IA 2VFIA 4MNMA 4TVUA 3ZR4A 3K8KA 1SGJA 3C2YA 3AUJA 2PP0A 4UR8A 4ROQA 2GPTA 1YNQA 2PWGA 1EJXC 4IMAA 1SO3A 1VB9A 1YX1A 3PANA 1HTIA 2B7PA 4BA0A 7A3HA 5JH2A 4AMCA 5CZSA 2YA0A 2D0GA 2D22A 2VFGA 4J3SA 1IR1A 4BURA 2VM8A 3CZJA 4XAGA 2Z27A 3TMQA 2INEA 4QROA 3LZ5A 3UYCA 5CBBA 5CPQA 1XHGA 5DMYA 2CHNA 2EEXA 3BZJA 1I60A 3LHTA 4JICA 1VFMA 3WO8A 1Q5MA 4JOMA 2XYLA 3V1HA 1HVXA 1TYTA 2WV8A 3ZJ7A 2WC7A 4RV8A 5LXXA 2EPNA 4PUKA 2R1PA 2OWWA 1XFCA 5DQPA 1CBGA 4IM4A 1QOXA 3ABOA 4POCA 1R86A 4UQ9A 3KVMA 4JS3A 3V1PA 5M17A 3HQNA 1XP3A 4KH2A 3RU6A 5FJOA 1CEOA 5IDZA 4L9YA 2WJFA 3WLLA 3BLIA 2OZTA 3V3WA 3ANVA 1E4NA 5FS9A 4AISA 2Y7GA 1IEVA 1TR9A 1TYPA 2YL5A 1LTDA 2OSXA 3MP5A 1J12A 3BGJA 3VX1A 1PL9A 1IE7C 3G2GA 3R89A 4A8LA 3P7YA 3NGFA 4O1FA 3WYZA 2W91A 1WCGA 4TX9A 5FJUA 1TMHA 2QDHA 3TC7A 4H4IA 1BLIA 1TPFA 1H1ZA 1KBIA 3VIHA 2V9DA 3KBWA 2AQOA 3CQKA 5M03A 3F5JA 5A2CA 3B4YA 1GPWA 4EAMA 1EKOA 3S8HA 1H0IA 2IXUA 3FDKA 1DWGM 2FZDA 3PAOA 2DW6A 3SDOA 1AW5A 1GRGA 4MNKA 5MHBA 4WR3A 3R8RA 1GERA 4W88A 2RDTA 4AZIA 4Z1CA 2GQ3A 4K3ZA 4XBSA 3ZWTA 4PTMA 4AEOA 1T3QC 4TOQA 1EB3A 3BJSA 5C8BB 2DVTA 1JI2A 4BJHA 3EA2A 5BXSA 4ECLA 4DBSA 2TAAA 5F7UA 5A94A 2CZDA 4RPQA 2Y89A 3T2OA 1DTUA 1XHCA 4D1JA 4DRSA 2AAAA 2ABBA 1QPOA 3ENLA 3AXIA 2ANUA 3LA4A 3L66A 1ICSA 4K68A 3WNMA 1CECA 1JROA 1EBGA 4CD7A 3ZT7A 5CEWA 4CN6A 3CS2A 2D2OA 1GOOA 4AIBA 3NYZA 4GZIA 3FY1A 4Q4OA 5BNKA 4KFPA 3AJXA 4WSHA 3FA4A 3RPDA 4MZYA 5CPLA 3C86A 2VUYA 2XSBA 2YPIA 2VGBA 4BQ5A 4PC8A 3RLUA 1ISVA 3UA4A 2NQLA 4HCHA 1UWQA 4X22A 2YKKA 2FH8A 4XBJA 1TPWA 1U5VA 1E6PA 1XIGA 4AZ5A 2DSKA 1A5OC 4O19A 1OD0A 3WQOA 1RUSA 4O4WA 4Q8UA 1J18A 2E68A 3ECQA 3GVGA 1Q7QA 2CZ5A 4UTIA 1BXCA 1TV3A 2XVKA 4DUOA 2ZX9A 3RAOA 4KEZA 3LB0A 4O11A 4CQ8A 1QI0A 1KWKA 3STGA 2A7RA 4ZL1A 3DN5A 4LTSA 4AXKA 3NQ2A 4XZLX 3SJNA 1EGVA 2EG8A 3BW4A 1KM6A 2YL8A 1XYLA 1A4LA 4EWJA 4J3TA 1VLWA 3AJ7A 3H53A 1M9HA 4AVFA 4UFLA 1RK5A 4ZZ9A 1FUYA 4PMNA 2F6UA 2HQMA 1IIHA 1XISA 2GR0A 1E0WA 1SR0A 1B3ZA 1A80A 1GNXA 2FGBA 4QGCA 7TAAA 3AYSA 1VIZA 2Y8UA 4B5TA 4JYDA 3TSDA 4NZFA 4MWAE 3O0FA 4QISA 1OQFA 2YBVA 1KCXA 1EJ7L 5E70A 4IP4A 3VOGA 2CXGA 3POCA 2PWFA 3AS1A 3GYCA 3NM3A 5H8UA 3OGVA 4ICNA 1B0IA 1GYLA 1B1YA 1LZOA 1B4KA 4F2BA 4O1AA 2C8NA 1EHNA 2O56A 4CQCA 4Z17A 3WLIA 2HBVA 4WUIA 3KE0A 1ZY8A 1Y0EA 2QIWA 4UXDA 1PJ9A 3NEHA 1G5AA 1TZ7A 3KOZA 3UETA 2PWVA 4KEMA 3WQ8A 3VIPA 5FEWA 3M6YA 5A6SA 5K4ZA 4XZNX 3NOYA 5CSRA 3N04A 3WQ6A 2I56A 3USZA 3TYDA 1QO2A 5HMFA 1BEUA 3W7OA 1W5NA 4Q3MA 4BF5A 2WM1A 4DBEA 4FF7A 4IUGA 3KWXA 4I6KA 3KVKA 4PCFA 2A3LA 3R12A 3HFTA 1P4CA 4OBTA 3BAIA 2I16A 2Q71A 2VZUA 1RCXB 1A5MC 2B7QA 2CLFA 3EWYA 3L4TA 4ASTA 4RR4A 2X99A 2EBNA 3BGGA 3MW7A 4NI8A 3DFOA 3W85A 3FYOA 5DXYA 1HJVA 1ZK7A 2WSPA 5KTLA 5I3JA 4G5DA 2G37A 2QPXA 2YZ5A 3BOLA 2DUAA 3AHZA 2BVDA 1ZMDA 4J3XA 1XJBA 3CLMA 1EQCA 1LLWA 4CEXC 1GVOA 5JRBA 1DBTA 5M1TA 2EPOA 1E71M 1XKJA 4LS2A 4AH7A 3W2NA 1W5MA 3LV5A 1PS9A 4H83A 2O4QA 1KFCA 4TXEA 1KFEA 4IIHA 2J66A 1UOKA 4DJDD 2XGBA 1US3A 2H6RA 3V4BA 2DFAA 3M1ZA 3PG8A 4NZ1A 2BVYA 3OP2A 4RL3A 2ACUA 4GZEA 1TVNA 3MUXA 4S3AA 1IIGA 2OWXA 4PL1A 4B2DD 2WK2A 1S5VA 3GXIA 3ARPA 1G0CA 4UTTA 4P8VA 4B3LA 1DWHM 1TWSA 2HDJA 4S3GA 5DX7A 5FSDC 1IWPA 2J3NA 4IMGA 3B05A 4M1BA 5IBXC 2W63A 3LHWA 4XUYA 1WXYA 5CZTA 5D9PA 1ZU8A 1JIBA 3TQKA 1CXIA 3TH6A 1H7WA 3T07A 3B8WA 5AYXA 3FJNA 4QNWA 3CB8A 3UCQA 1UKTA 3MV01 1MUCA 4XVEA 4HJWA 3SUUA 3HA1A 3QXBA 4AD5A 1W5OA 3LADA 3MCOA 1WAWA 4NNAA 1R3VA 3AWNA 3Q94A 1N62C 2D3LA 1Q7MA 3NDOA 4JTDA 4HCDA 2C14A 2DQXA 1A5NC 5DY2A 2PDUA 1BGAA 3W70A 2X16A 4Q7IA 2ISDA 1KRCC 3N9RA 2WPGA 5AHLA 4DHGA 1RQEA 1OT2A 4R53A 4GX8A 2MUCA 3H4XA 4N4PA 4WSKA 3JZUA 3T9PA 4O12A 5CC3A 4C6EA 5LNSA 1V6TA 4NXSA 1UWSA 4XD6A 1OCJA 3FKRA 4EM3A 4BQ2A 3EANA 1B3XA 4ML4A 3DHFA 2WVUA 1ZKQA 3SIZA 4OV4A 2V3BA 2GR3A 5D32A 3OVRA 2WMFA 1W8GA 3P61A 1WKFA 4G7FA 3TROA 3M0LA 4AVOA 2BTMA 5A6KA 3B97A 2VP8A 3WLTA 3QSTA 4JCLA 2XIJA 4HK5A 4O8AA 2JGYA 4H01A 3U57A 5AKQA 4B4FA 4CCZA 5D05A 1BF6A 3AU6A 1NHPA 1XLGA 2UY2A 4G9PA 1OF6A 4O0ZA 5E09A 4F2UA 3GXFA 4ATLA 4QEEA 4NNCA 3SAZA 3VCNA 3QFBA 1E40A 3W7RA 4GC3A 1IXOA 4FDCB 4QJ1A 3VINA 1LRTA 2P88A 1XCXA 2PP3A 2G3NA 3DBNA 3MWAA 2YA1A 4F2TA 4FR6A 3WDRA 4GD0A 4IFRA 1AH4A 4XD5A 2PZ0A 1Z7AA 3JW7A 2Z00A 5L6UA 1VF8A 4RCXA 3UVAA 4RJEA 2E8YA 3T40A 3LM3A 2TPRA 1C7SA 1QW7A 3C8NA 1DL3A 4W89A 5HR7A 3W28A 2FPYA 2OB3A 5HPOA 4GABA 1J2BA 3W37A 4JQ2A 2VZVA 3E49A 4JTLA 1M7PA 1VD6A 4XZ9A 4GNKB 4FX7A 3NQDA 1LRQA 3U2EA 4Z1YA 1TV4A 2D73A 1WAUA 5ECUA 1GORA 4JYEA 1NWUA 4B5XA 1GG0A 3GD6A 2D2JA 4XZMX 3P8IA 3R5EA 5U4NA 3N17A 3DJGX 1A5BA 3IJLA 2XFWA 4N42A 3BLFA 2VOMA 3LBOA 4IP7A 2YBUA 4NAEB 4P7NA 3W73A 3VO0A 3WL1A 2PDHA 4RW3A 3WQCA 1QNQA 2A6LA 1FHLA 2W6RA 3G5EA 2ABAA 1Z42A 3L7RA 4ZE5A 2PDQA 5A8MA 2A2IA 3GTXA 1TV8A 3H4WA 2NUWA 3L4VA 4NAEA 3VDHA 4XG1A 1DJIA 4H8UA 3UXLA 2WCSA 4AY8A 3WBWA 1DXFA 3UF9A 2WMIA 4GY0A 1VHCA 1OGBA 2B31A 4FHAA 2BNJA 5J04A 2QUTA 3CAQA 4GQGA 5BOEA 1G7VA 4YS1A 8CGTA 1XKYA 3CAVA 2D2GA 4RNIA 4D72A 1MW1A 4JKMA 3PP7A 1C29A 1TPUA 1YXYA 1DORA 3DC8A 3PHAA 1LBLA 2UV8G 1J10A 2EQ7A 3TYEA 1WBHA 3KHJA 1OY0A 2GL5A 1AJZA 3LENA 1SZRA 3BLEA 3GX9A 4UR9A 4M6UA 2YDQA 2VVNA 1T99A 2VEKA 4XBKA 3QV9A 4HCLA 4U2YA 1SFSA 3WD1A 2OSWA 4HZ8A 2PSNA 4ZO7A 1P7TA 1MDLA 1OB0A 4WSJA 1DE5A 3GDTA 4W9TA 3UR5A 5AB3A 4CQAA 1HKJA 1MWOA 3S1WA 3BSHA 3WX7A 4J40A 5AOUA 3R25A 1L6SA 5EU9A 3F4DA 3OEXA 3GNRA 1VFHA 5H91A 3BQ5A 3VUPA 2V0TA 1P6WA 2BV9A 2PCEA 1JG9A 1RCOB 1FDYA 2WOIA 4H9VA 4H00A 5HNTA 1H7XA 3FYYA 1Q1WA 1JDEA 6A3HA 5MKGA 4OTKA 3C2OA 3VCRA 2ZZ2A 1Q2RA 1PSCA 2QF7A 1XDIA 3ABRA 3A7UA 3O2LA 3NAVA 2HPIA 1VRDA 5TR3A 4QRNA 4URIA 3CT7A 1V51A 4FX8A 2DIKA 1QI2A 1HJSA 3BAXA 4P7LA 4W84A 4O1BA 1LOSA 3H7UA 4H4ZA 1YTDA 5I78A 4CCCA 1K9TA 3II1A 3EMQA 2O55A 3M44A 3ARSA 5HJXA 3VIKA 3W83A 4QJ5B 4WY0B 1F76A 4J7RA 4UMBA 1ODZA 4XTDA 1GVFA 3ARXA 2H9AA 1H0GA 3BL3A 2VC6A 4AWSA 4TQTA 2VOTA 3OIXA 3G1RA 4IZGA 1FHUA 4XIAA 2QQ6A 4QE5A 4KWVA 4EAYA 1W1VA 2VC7A 3F4VA 3M0HA 1F3EA 4H9MA 3B9AA 1XSKA 3KLJA 2J7DA 1QO5A 2QJGA 4YHEA 3E5BA 3UZYA 2F6KA 5KZ6A 4WHBA 1LUCA 4EF9A 2I17A 2B7OA 3FAXA 3F4NA 4JX5A 3GH7A 1EWEA 3HJZA 3VABA 3NNTA 4AC7C 1PCKA 4O0KA 3S9IA 1W1A1 3IUIA 2PMQA 1ZFJA 2HVMA 4PBEA 3KUMA 3AICA 4AD4A 3C3NA 1JCTA 3V75A 4MGGA 2KAUC 4FK9A 1O4UA 1H4PA 3KX6A 3EWWA 1OYBA 4L1WA 3GTHA 3TTQA 2CBJA 1S46A 2WSKA 5DMLA 5FJPA 4DWSC 1K4GA 3UPBA 5IOBA 5M3WA 3BMWA 3QPZA 1LDCA 1DJZA 1JI1A 3N34A 4MFEA 3PZIA 1BYAA 3VPLA 1ZJHA 3PZMA 2P0OA 2DEPA 3B40A 4U31A 1FTXA 3O9NA 2FB3A 4RV3A 4IIGA 2Z1BA 4BK9A 2FHBA 1FWDC 5H8PA 4R85A 3W1XA 3O06A 4PE8A 1N60C 2Y85A 1MRQA 3M41A 1A3HA 3E2VA 4UQDA 1XLDA 4EX4A 3VDCA 3VNIA 3WUFA 1YTKA 4JY9A 5IHRA 4IQEA 3QV6A 3RYSA 3AXHA 4X9SA 1EO7A 3NL3A 3IJ9A 2WHMA 1TR1A 2XISA 3AOFA 4LJ3A 4MB5A 3CU2A 1CLVA 4GH3A 2PZNA 2WNNA 4H41A 4DPPA 5JH1A 3NXLA 1S2TA 3V5CA 1GGOA 2ZYFA 1VQTA 2HBXA 5EBAA 4U5IA 3TKFA 3N73A 3QVQA 1AL7A 3UXDA 7ENLA 4BI7A 4PYSA 2Y7EA 4Q8VA 1BWCA 3OHIA 4LCSA 2RKXA 3RCYA 3PS7A 1R0MA 3TSMA 3UNTA 4LYPA 4DZHA 4LIIA 1K9FA 5F4SA 1UZ1A 2PC4A 1J5SA 1K1DA 1KWGA 3CAKA 2ZDSA 5HBFA 5EPDA 4DZ5A 3UU0A 4B16A 2OO0A 3LNMA 3PUGA 1WX0A 5EFDA 4W93A 5KVIA 3AZSA 5BYWA 1DQWA 4FNUA 1GPFA 1J0YA 3DK9A 5AHFA 4NRSA 4QJ4B 1TA3B 2ZADA 4O13A 1GW1A 1KD0A 3QTGA 2QCCA 3GH4A 2VFHA 3HBLA 3O16A 3PSWA 1FQ0A 1GZGA 2PWHA 2QVNA 2I5GA 2HEJA 2VURA 4YWIA 5K2ZA 3HN3A 3MWCA 4LFYA 5I3DA 3L4ZA 3G1DA 4LU0A 1YPXA 2PTDA 1SSGA 3KL3A 3RHGA 4LS1A 2CLKA 2NV1A 1CGWA 4M0XA 1TTIA 2QAPA 4JTHA 5CPTA 5C2GA 1G69A 4L9XA 3W7IA 3URNA 1HXJA 3SCSA 3WQFA 3P84A 2JKAA 1BTCA 1XBVA 1C90A 3QGKC 1XL9A 3ELFA 1TJ2A 2CKSA 2ZE3A 4AIEA 1XGZA 3GLCA 6CGTA 9RUBA 3L5OA 3EX1A 4CD4A 3T8QA 1FFUC 4GGHA 4DWSB 3A13A 3NPWA 3LX9A 1F2JA 1JPMA 1SVDA 3GVWA 1QHOA 4P5UA 5AHEA 3MV11 3CJPA 3VD7A 1WXJA 3G0SA 5KZDA 2PS2A 3N29A 4L65A 1UJPA 1AMKA 3SQPA 2VXNA 2X09A 3UZWA 2P8BA 4OT7A 2HZGA 5EBKA 4WD0A 4ZQRA 1IQ8A 3IVUA 2PTWA 4LV9A 3SJ3A 2QCDB 2PDYA 1D2KA 4K8DA 3OB8A 2ZRYA 1XIIA 2Y0FA 3LHYA 3ONBA 2FZ8A 2PRLA 3LXAA 5G2HA 3THDA 3SY5A 2D1ZA 4JTJA 5D8WA 3HMCA 3W24A 1BWLA 3UGRA 3IACA 2R24A 3KBMA 4QDWA 4H9YA 3N14A 3WLQA 2BVWA 3TR9A 5FD0A 5BZAA 2DSVA 4XD3A 2BOFX 4S1FA 3U3HA 1OT1A 4LNYA 1Y5WA 2V30A 1V8EA 4ZBCA 3TWBA 3AIWA 1UR4A 1M68A 1U30A 4IGSA 1D8WA 3T08A 2X41A 3UGVA 1VBUA 1GEHA 1LYXA 2IPFA 1KBBA 2EPKX 5C2CA 4S3JA 4XKYB 1MEHA 1EO5A 3AAMA 1E4LA 3UW6A 4GY1A 1FWNA 3FAWA 2X30A 4QITA 3AXKA 2J74A 3LI0A 2GRTA 2Y88A 4PZVA 4S3DA 4LAKA 1C8QA 4J4KA 1UD5A 1NDVA 2EQDA 4HHPA 4EXBA 5JCIA 5HWJA 1JXKA 3TE9A 1AOGA 3JRKA 2YGYA 1GJPA 1KTCA 3HPSA 2OEKA 3L21A 3RDKA 1GTHA 1BQCA 2Q09A 1NHSA 3E74A 5KSWA 3NO1A 3EUB3 3IIZA 4HN4A 1SSDA 4B9ZA 1GV4A 1E1CB 1KR1A 2C19A 3BWWA 1XG3A 1AODA 3DG3A 4A22A 4TVYA 3CHVA 5CPMA 4OUEA 3GU2A 2PBGA 1SO5A 1YHTA 3JVAA 2IQ0A 4R9XA 2ZDRA 4LF2A 1JDAA 1ZSXA 4GNJA 1CXKA 3QMSA 4DBUA 3CMJA 1TA3A 2HVOA 2D69A 4KWOA 1AW2A 1IEXA 2SFPA 4KS0A 1V3HA 2R82A 2PDNA 3T0AA 4UTLA 2PAJA 1FFRA 3SR6B 3S2LA 3SCPA 4FP1A 4KRTA 4Y9OA 1W9DM 1UPPA 1TJ0A 4AX7A 1SPQA 1XC4A 1NFPA 5T9BG 1WKYA 3S1GA 4DJFA 1XYAA 3GBDA 4JEJA 2D0FA 1TB3A 2EPHA 1J4EA 2H3DA 2TYSA 1O60A 2ALDA 1ISYA 1QW8A 4GK8A 1RAKA 2FH6A 3DCPA 4D6DA 1REQA 4DO7A 4HA0A 3OA5A 1R38A 2A7NA 1KCLA 3W07A 1V97A 3VD4A 2I9UA 4UC5A 3M6DA 1E43A 3TXZA 2F9RA 4HSHA 1RBLA 3CUZA 4PMOA 2YYTA 5FL1A 4ERGA 2G3FA 3QW4B 1I75A 2E40A 2P76A 4LAMA 3WQDA 1OHLA 2BZNA 3T1GA 4YHGA 4YCOA 2NVCA 3STCA 4UNLA 4O1CA 3N15A 2J7EA 2Y24A 4YTTA 3O6AA 2P1FA 3VGBA 3IC9A 4UOZA 1UWTA 1PEZA 5DEZA 1XCWA 2R94A 4PB5A 4ZOEA 4Z2HA 3WDPP 2QT3A 5FL0A 3H55A 3TYUA 3TTSA 2QCHA 3VU2A 4K7YA 1UKOA 3BCJA 1VLIA 2BSLA 4PMYA 3G1SA 4Z2GA 2V5KA 3EOSA 2W5FA 1V3KA 5ER0A 1BXNA 1XGDA 2CKRA 4UTWA 3MHUA 2HE5A 4R7OA 4UTKA 3DX5A 2OLHA 3U5YA 4XX6A 1M6IA 2C0HA 2OPJA 4PMJA 2E8ZA 1GG1A 1G1YA 4HHMA 4D71A 3LSCA 4ACZB 3H24A 4LBSA 1E0XA 4ORMA 3N9SA 2VEIA 1R87A 2DT1A 1UH4A 5C2XA 1FWJC 1FCBA 2X7VA 3DENA 3UJ2A 4V2XA 3QW3A 1KKOA 4ZA0A 3W7PA 4JN8A 1XDJA 3AIQA 1PYMA 3GW3A 1P1MA 3QEZA 3M7WA 5CAKA 4ICMA 3WH9A 4L6HA 1KBKA 4B5WA 1YBQA 4GNVA 4QEHA 1HP4A 4GX9A 3VIOA 3N11A 3TAKA 3G0XA 2QCGA 2PGEA 4MNJA 3JZEA 3RNMA 4AD2A 1IT8A 3L5AA 1GQIA 4AY7A 3DH9A 4GZJA 3D9XA 1LJYA 4AIUA 4KESA 4IMFA 2GDVA 4NZ5A 3QQ0A 1P0BA 4RNFA 1EUAA 3OLIA 3K2GA 3TOPA 1BYDA 1J0JA 1KXVA 1X8FA 1WDRA 2QDDA 3CASA 1WV2A 4C6PA 4JTIA 3SUTA 2WQDA 2D2HA 3WJWA 4TU1A 4K37A 3W7EA 5C9UA 1GVIA 2QGYA 3ORWA 2QLYA 2XFYA 1V0KA 3SFWA 1M3UA 1YNPA 4LUIA 4PUJA 2ZZ1A 3WH5A 2HNHA 2PE4A 4H6EA 3W84A 3DFSA 4JN6A 3LOTA 4C1KA 3FSTA 1ML1A 1XI3A 1POKA 3DDMA 3W1NA 5D2YA 3AM9A 3E0VA 1AK5A 1EJRC 4AZGA 3IJ8A 5RUBA 2VJXA 1A5UA 7XIMA 1NAL1 1X2HA 4HPHA 3SN1A 2C3DA 3W76A 1SYTA 4PB3A 3DKLA 3A24A 2PUZA 1V59A 1D7FA 5FEZA 3NPXA 3RM8A 1O95A 4HU4A 4KWSA 3SQLA 1ALDA 4QHRA 5D33A 3AMKA 2ONEA 1RQBA 1O5XA 4RX0A 4A8IA 3WD4A 2R1KA 2J24A 3NQFA 4ADWA 3MYPA 4Y9NA 2GVEA 4QSFA 1VIWA 2ZZBA 2FJUB 3CZ8A 1UWIA 4A8RA 3RITA 1FWBC 2HNEA 3LGDA 3KVJA 2QF8A 4C1LA 4HNVA 2IPGA 2HTMA 3WN6A 3ZLFA 5H1WA 4O0QA 2FMOA 2JF6A 4P7RA 1TKKA 2PURA 1OIMA 3S5NA 5L9FA 3TLQA 3QHNA 1KC7A 4YVPA 4WDTA 1TRIA 1GVQA 3V16A 1ZJIA 3UQNA 3WNOA 2W62A 2NUXA 4HZ6A 2OMAA 1V79A 3P74A 3QLLA 1H51A 1XBYA 4DELA 3OU8A 1XIDA 1W1ZA 4UQBA 1J0ZA 4D6IA 1TWIA 4JY8A 1LCOA 4IT1A 2QJIA 2VQUA 1XS2A 1PPIA 3KLKA 1U1UA 3PTKA 3AIBA 2OYMA 3E0FA 3GG1A 1UHVA 3CIWA 1T6MA 4J2PA 5HINA 4XAYA 1Q4WA 4BY3A 5IM51 4WGXA 1OYCA 3VNYA 3UG4A 1FVPA 3PJTA 4IPLA 1PTAA 3VMOA 2J79A 5I09A 4F8XA 1NQ6A 1O1ZA 5C6MA 3DFPA 3VZXA 5FAGA 3QKZA 5I3GA 4QX4A 1L2QA 4ACZA 1VBGA 4HPJA 1X7IA 4F9JA 3FN9A 1H63A 3U6WA 2P8CA 1EXPA 4FEZA 4FPSA 3OLEA 1LBMA 3DIPA 4V27A 3L65A 2HISA 4QS6A 1QNPA 4AHQA 1JZ3A 1DTNA 2VDGA 3C61A 3AMZA 3TX9A 3HPFA 3I7QA 3ITLA 3PZ9A 1IXPA 1HVQA 2NSXA 3WIJA 2G8ZA 1CW2A 3VOHA 5KETA 7REQB 2OYKA 7CGTA 4O28A 3Q45A 4UZSA 2GGJA 1K3UA 2WZMA 3H8AA 2NWSA 4E2BA 1OC7A 3CPRA 2C3ZA 4W8AA 2VNCA 3WLSA 2CLMA 4K7ZA 3SY1A 2O9PA 3KOYA 5CZJA 4GOAA 3PBMA 4FNTA 4FLQA 2J7CA 1PX3A 2YDRA 1WQ5A 1U5HA 3TYZA 5JXQA 2VEPA 2PLMA 1UP3A 2VMFA 4Q4KA 4EANA 3QQWA 3SCTA 3ZJKA 5XIMA 3MMTA 2ZRZA 4ZE4A 4O50A 4N9EA 4ZXLA 3RIKA 3COTA 3XISA 5LA1A 1BRLA 2BX7A 2WKGA 3VNLA 3IGHX 3EWBX 1CGYA 2W67A 1PE1A 1XD0A 5FI8A 4ZO9A 4FAMA 5E9AA 1PXGA 2NX3A 4EXAA 3NZGA 4JL2A 5DN1A 2X1SA 5BRBA 1JPHA 4JTQA 1HG3A 3NCOA 3ZVHA 2QXWA 2QV5A 3HQ1A 7ODCA 4L9ZA 3TJIA 3CUXA 1UD2A 1W3TA 4BS0A 3GDBA 5HA7A 4EPBC 4H4QA 3P67A 3AIVA 4XAFA 4O52A 3CH9A 1JCJA 1REQB 2R9ZA 5SWUA 4PH6A 4G1NA 4JHMA 5D02A 1KFLA 2V69A 3NL5A 3IVSA 5D9NA 4GYFA 1TWDA 5CC7A 2Y8KA 1HN1A 1MW3A 3HV9A 3IJ7A 2NV9A 1GRAA 1TCMA 4CUCA 5F4WA 3LG3A 3ARVA 2XM2A 3I65A 2ZIDA 1C8VA 4HK6A 2VGFA 5FA5A 3SECA 5D30A 1JNDA 1JF5A 4S2CA 4MZ8A 4GUIA 3TN5A 1XLIA 5I24A 3WK0A 3IK4A 3E02A 4HHLA 3UZXA 2X1RA 4RZ5A 2GH5A 4QG6A 3E9AA 4GY7A 3SM0A 3GVRA 2V6AA 3WF4A 3MI6A 1CENA 2O7SA 2GUUA 1Z3NA 2XVGA 2QV4A 2WW5A 2JK6A 2Z1WA 5DRCA 4Q8PA 1OZQA 3I4KA 3VM7A 2J7FA 2WPEA 6XIMA 1OABA 1D3HA 4MJZA 4MY9A 3WBXA 1N5XA 1OEPA 4OQVA 4EQRA 3EF6A 2QDEA 3W53A 4HNNA 1CT5A 1X6UA 5HK4A 1F3TA 3OLGA 3BANA 1JNEA 3P82A 5ABFB 1Q63A 3PNUA 2FTWA 2Y63A 4F4RA 3UD6A 1FEAA 2EKCA 2Z24A 1N82A 1VC4A 4X60A 3VMNA 3WD0A 3QOKA 4YVXA 1GKPA 4AZ7A 4FS9A 3WELA 1THFD 3N4EA 4E4FA 4GJIA 4GIRA 4NHVA 1DJHA 1QXLA 4W8BA 1W9UA 2ICSA 3HG2A 3NPUA 5AC5A 1DJWA 4DJDC 3TCSA 2CLOA 2FTYA 3V0UA 4B4HA 5JBFA 2D24A 1VFFA 3F2CA 5D2TA 5G5GB 1W9BM 2HS6A 4IGHA 3CPUA 3W22A 4YU1A 3G1YA 4DI9A 3BV4A 2MNRA 1AMYA 1GETA 1WYIA 5EB8A 4MLJA 2NT0A 1R3QA 2OT1A 1Q13A 3GR4A 1OFOA 1Z48A 4IPIA 3UESA 4UFIA 3MPGA 1P0EA 2ISVA 2WNQA 3LUTA 2X8RA 2Q01A 1TWWA 1ITUA 1F7BA 2BXYA 1XXXA 4PMUA 1Z69A 4ZSTA 3DZ1A 1G4PA 3GNPA 2D0HA 1W1YA 3ONCA 4BR1A 3SGGA 3TLLA 1UA7A 3KOWA 1H7RA 3HU7A 3IJQA 5EKYA 1LQ0A 2J8GA 1U83A 1ECQA 2OELA 2E3TA 4C6QA 3II4A 3R8GA 1HW6A 4CD5A 3ZJ8A 3C2RA 1W5PA 2VELA 4QFUA 3PG6A 4G56A 4D1IA 3PN8A 3EWZA 3BPWA 2OKOA 1X1OA 4H8VA 3KS5A 1OCNA 1Q6RA 1W56A 3KZPA 2OKTA 5EYWA 3SBFA 2DZXA 3VDBA 3GNDA 1OD8A 3EOOA 4O54A 2DVUA 4DZAA 4KCUA 2IKIA 4TMCA 1DP0A 4EKJA 3WDHA 4RNJA 4MG4A 4NAFA 2ALRA 4J3UA 4H4TA 3W1PA 5E1QA 1XH0A 4CQBA 1TTJA 1TMQA 3MBFA 4MZ1A 4D6JA 1JGMA 3S6TA 2DSZA 5G1TA 3IJIA 2EGZA 4DAFA 3C52A 2OU4A 5DXXA 3W2KA 1JRBA 3BLKA 1UZDA 2I7GA 2PDJA 4EM4A 3RX4A 5I79A 4ZQPA 1R2TA 4C1NA 3VGHA 1WDWA 1S1PA 4NUWA 2WPCA 1GHSA 2DZBA 5KINA 1GZ1A 4GWEA 1FWFC 2J9ZA 4Q22A 4H04A 2A5HA 1Q6DA 2WWDA 3LCFA 4PCNA 2G97A 3M0MA 4ADSA 1TTQA 4MIMA 2XVLA 3RLHA 5FJIA 5H2ZA 4DUXA 1GW9A 3QV8A 3GFZA 4MHBA 1NPXA 3Q37A 4KIEA 3P81A 3KM8A 3S3GA 3D3AA 3MCNA 2J13A 3USBA 2WZEA 3PAJA 2AGTA 3R79A 1FWIC 2X2YA 1CZ1A 3FXYA 2GJRA 1EDTA 5H8MA 1FXPA 1QASA 2DZSA 3LEPA 4IIEA 5LNVA 1T96A 8XIMA 1EA9C 4JNZA 3AIEA 1QAPA 2JF7A 4WXZA 4NG3A 4LAOA 2GJXA 1LM1A 1LOLA 2ODOA 5FF4A 5EMJA 2CETA 4YLWA 5D03A 3PM6A 3GIPA 4M8UA 2ON3A 4J9JA 1B3YA 4LNCA 3DHDA 2Q3RA 4IPPA 3BDKA 3G3DA 2AKZA 3BCFA 3W7MA 2W3ZA 4ZO8A 3M5YA 5HQLA 4M6QA 4C60A 2ZRWA 1I0DA 1L8NA 4KEUA 3W86A 1MXGA 4M80A 3QYQA 1GOMA 1TJPA 2XWDA 2VEMA 1KRBC 4MAZA 5FACA 4JFSA 4REQB 2B81A 1VEMA 1AD1A 2YFNA 3PUDA 5XIAA 1UA3A 2DT3A 4PEKA 1FFQA 3H2MA 2PGWA 1F4HA 1PWMA 1EZ2A 2YW3A 1YDVA 5FCZA 1UQYA 2ZA1A 1QBBA 3CK5A 1Q8AA 1A0DA 1R85A 1UKSA 1XV8A 4GQRA 4A05A 4ZODA 2B4GA 1QUMA 3U5UA 1WZKA 2FB2A 1M65A 3LY0A 4O57A 5FS7A 3B3DA 3BSMA 4ORIA 3K4AA 3R2GA 4GIAA 5HJLA 2J9XA 1GQLA 3ZO9A 3WNLA 2BXVA 1JDFA 3M64A 5AFDA 1ZUAX 1UMLA 4H8HA 3I3DA 1VPYA 1UYQA 3H70A 1YEYA 2WANA 1K8ZA 3W2UA 4AUBA 4CNNA 1E6RA 2J62A 4JHZA 4R7JA 1UG6A 3MY9A 1YIXA 3LLXA 1OC6A 1ZCOA 3DK4A 1V3JA 3H2OA 5FSEC 5ABTA 3QRHA 2OSYA 4BEUA 4JX4A 3WUGA 3MVIA 3PF3A 3CUGA 1BWVA 1VH7A 4JGDA 4AZ6A 2GQAA 5K9XA 2E0PA 1W3KA 1G6CA 5CGMA 2HMCA 4PRRA 3VI2A 3WUEA 4H4VA 3GVQA 4LEFA 3GH5A 2HROA 3S6DA 4A3HA 4UCFA 1OJXA 3THCA 1HKIA 3RF9A 1QRQA 4OFCA 3AS3A 4OOZA 3W25A 5I23A 1NP0A 3WSUA 2PRMA 1D7YA 3U9IA 5GRTA 1I9CB 1WA3A 4NASA 3BCDA 1W8SA 2CBUA 2V3DA 1H50A 5E6ZA 1J0KA 3WJYA 5ABEA 5E5CA 4CKQA 3GK0A 1O5RA 3Q67A 2GR1A 4BKNA 4FLOA 3TU9A 1PO9A 1BWKA 4AZCB 1G67A 4C6JA 2ZVRA 4L4OA 3NQGA 4I6VA 2O0TA 3S9YA 3IJ6A 1AUSL 4O15A 3Q58A 1OK4A 2AL2B 4M6VA 5AYZA 3ISIX 2QJHA 1XW8A 5CJ5A 1LL7A 3S46A 1WZAA 4K6AA 1RLCL 3L67A 3DYPA 4PODA 3CUFA 3FXGA 4C6LA 2ZXQA 1Q6EA 2XGIA 4EPDC 3N18A 4HSNA 4XZWA 2DZAA 3WCZA 2X1UA 3L2IA 4CEUC 3T0DA 3TN4A 2PFHA 1XLFA 1T8QA 2E9LA 5KITA 1JL8A 4NZCA 4LYRA 1UPMB 4H6RA 3EWCA 4HU0A 1GKRA 1C8XA 2QGHA 2PTZA 3W6YA 1ONRA 2GJNA 2NZLA 4QLKA 3ANYA 3VM5A 3ATYA 1ENUA 3CZEA 3TZFA 4GQBA 4IH3A 2WKLA 3BLOA 4NRRA 2AAMA 3KP0A 1ODUA 3P14A 4PTVA 4N6EA 3EOEA 2OG9A 1IHIA 2FVMA 1A53A 3BQ6A 1Y65A 4JTTA 3C5QA 4HNTA 4O1DA 5CPNA 3RLVA 3TN3A 1ISWA 1R9XA 1ZHAA 4GZ7A 4A29A 4FNSA 2BHZA 1ZJBA 5BOFA 1SO4A 3G22A 3MUZ1 3QLDA 5G4EA 3WQ5A 3CGEA 1V02A 4GVFA 1EX5A 4XO7A 5CLWA 1IGWA 4GYPC 3NO5A 1E4IA 2NQZA 1EP1A 9CGTA 4GR1A 1BVNP 2QR6A 2F8QA 3CMFA 4MAVA 2Y61A 4EIVA 5AHMA 2XUCA 3A5FA 1U2YA 1BVWA 1XICA 2G50A 3U2CA 1E56A 1GQKA 1OGGA 4IXXA 3MC5A 1TZ9A 1QOQA 4GUGA 3WJSA 1R3WA 2G96A 1FX6A 1PBGA 2HE8A 4FALA 3L2MA 1UBPC 2BOGX 1GSNA 3QY7A 4WXYA 1TJ1A 4C6KA 1GVEA 1DJGA 4LBUA 2FHFA 1W3JA 1UBSA 2WJEA 3EEGA 1ME7A 1WDSA 3QFWA 2XVPA 1D7KA 5I02A 2HPMA 2C1GA 2G41A 2EKGA 3A21A 4NT0A 1QW9A 1GKQA 3QR1A 3IIVA 3H12A 3WLHA 3R0KA 5BCAA 1EOKA 4J57A 1EDQA 1QMLA 2QCLA 2CDUA 4H2CA 2V68A 1AQMA 2JKEA 3RPMA 3EOLA 3NR0A 3TOYA 4GJJA 2CWXA 2WLYA 5DCDA 1J11A 4IJBA 4EE9A 3RUBL 2ZE0A 4LCRA 3F1QA 3KS6A 1XWYA 2GVGA 1TPB1 3A9BA 3NQ8A 2VR4A 3P3BA 1EX1A 3P8JA 1XYBA 4P8WA 4E2DA 4LXFA 2DP3A 2JALA 2J6XA 3FNDA 5LNUA 1F3XA 3T6CA 4IP5A 1QCWA 3OBKA 4WIWA 1LUCB 2INFA 3FA5A 5HOSA 3GDLA 4DO4A 2VL4A 3QFEA 2IPJA 5B7YA 2YVJA 5A6JA 4ZB2A 1G9HA 4C5ZA 2P3EA 3H4KA 3A4AA 2VZSA 4CQDA 1TQJA 3IJDA 2QW5A 3OGRA 2QPSA 3DOPA 2Y7DA 2IQDA 4XD4A 3TTOA 2WO5A 3F5KA 2F2HA 3GC4A 3ZR5A 3BOFA 2H3BA 4INFA 4CGTA 3EX6A 2CERA 3VOJA 3LZ3A 1S2WA 1NHRA 4OJYA 3QPEA 1RA0A 2Y62A 3AHXA 3BAYA 2PF8A 1B5TA 3OVGA 4BEQA 2F2KA 3NIYA 1ZPTA 1R47A 2I5QA 3WJZA 4MUZA 3HPXA 3N9KA 3BAJA 3Q2DA 3LU2A 4LAZA 1EJSC 3W9ZA 3NVYB 4KPRA 1GOXA 3TIMA 3NZ1A 2XINA 3EDEA 4IICA 3MS8A 1HKWA 5A6LA 3M9YA 3TWAA 3FCPA 4ZB5A 3HPAA 4AMAA 1CYGA 3G1VA 3WMCA 3OZYA 2Q8XA 1SZFA 1KXTA 3GB6A 3UR8A 1BVZA 2QHAA 3ITVA 4TO8A 1QBAA 2VCAA 4CCEA 4JYFA 1JUEA 1YYAA 5FIPA 1TCDA 4CNPA 5E0FA 1BSIA 2D20A 4MM1A 3W2MA 1EPXA 3DESA 5DMMA 2NXHA 1EP3A 4GXMA 4JHOA 3VGGA 1O5KA 1P0DA 2VD9A 3E3HA 3VYLA 4WJXA 3WQGA 1RD6A 4FB7A 4ALDA 3L23A 2A79A 1E4MM 2QS8A 1HL8A 4JFUA 2V3EA 2DPEA 4Q4QA 3SRHA 2YZRA 1ZS2A 3VKCA 4L6OA 2E5BA 3I10A 4GCXA 3SB0A 1RK6A 3EDFA 3EWUA 2ZCGA 2QULA 3KRBA 1FIQB 1UW9A 2PPGA 3UXAA 4GPNA 2PF0A 2CC0A 4DJEC 3LDVA 2CCRA 1X98A 3W2LA 1R6WA 3EXSA 1R3YA 2Y5SA 4J35A 4CN1A 4QTGA 2GDQA 4TMBA 2E1DA 3MDWA 1FDJA 3EXRA 2E4TA 3PUEA 4AW7A 3EA3A 5U7SA 4AZHA 5CGTA 1L6WA 1UZ4A 2TSYA 3RR1A 4YN5A 1XANA 3WQVA 2TPSA 3ARZA 2RDUA 2CITA 4M1RA 4Z2IA 4N2YA 5EGRA 2CESA 1F8MA 5LHEA 1TPC1 4Y6GA 1QK0A 5C0QA 1YTEA 3IWPA 5CC5A 2QDGA 2OZ8A 1KFKA 2J7HA 3A47A 3PTMA 1RD5A 4W87A 1NWRA 3GAKA 4LY8A 1NELA 4XSLA 1PDYA 3AS0A 1UCWA 4C6OA 4ZOHB 4IOTA 3L4YA 1IGSA 2H8ZA 1KM2A 1Q85A 5BWFA 3RXZA 4GRSA 4IPNB 3P80A 4HNLA 1VKFA 4NEVA 4IQLA 2ZZ7A 2VQTA 3VGEA 1K9DA 4LOCA 5JMUA 4NILA 3AU2A 1M03A 3ABXA 1R3RA 5C7HA 1EPVA 4MOZA 2OVLA 3BLPX 1UOZA 2BY0A 4LUYA 4WGHA 3ARWA 3WBYA 2E6DA 3N19B 5CJNA 1QNRA 5K9DA 1H6VA 3NOEA 3MSRA 4NI3A 1HL2A 2V8ZA 2NVKX 1S7MA 1NIUA 5C5YA 5FAJA 3H7VA 5EMYA 3GXMA 2W27A 3TTYA 4E4PA 2VTFA 3OG3A 5AC6A 4JDYA 1R3SA 3UFYA 4V1YA 3N4AA 4DVOA 2VYOA 3LMZA 1Q8JA 4AXNA 3SCRA 3DFQA 3ARQA 2FIQA 3AALA 3LTYA 1VEOA 1DIDA 2NLIA 3IIPA 3AYTA 4KFNA 4X3ZA 4YTSA 1NWSA 4DQWA 5HXMA 3SADA 5K7JA 1VBHA 1X6NA 1NDWA 3SSJA 1S3TC 4RPPA 3UG3A 1VJSA 2GR2A 4UMCA 2A1YA 1XYFA 2QUMA 4NIRA 1TTPA 4HYVA 4XTIA 2CYGA 4EWND 1QPKA 4DO6A 3M5VA 4DNHA 3ARRA 4JN7A 2OODA 1YDNA 1TWZA 1NDZA 3VE9A 2J25A 2B7NA 4QAWA 2O92A 1O6IA 3HG3A 1EC7A 2A7PA 3EZ4A 3RCMA 4JFWA 4JPGA 1JZ7A 1RPKA 2ZXBA 1DHKA 3MI3A 2Z4GA 2XWEA 4HPGA 5TAOA 1P5BA 3I7RA 5I3KA 2ASHA 3ICJA 1VZWA 4NJJA 2X8HA 3G1AA 3V5FA 1SQ7A 4NZ4A 1OWQA 4JTSA 5HR6A 2DGAA 2CHRA 4S2BA 2V38A 3UWEA 2VRJA 4DWSA 3AI0A 5LSMA 3KBVA 4J3WA 4OV9A 3NJ3A 2TRSA 3DFYA 2L5HA 1SZNA 1E9IA 1R5YA 1U33A 3KXQA 3CYJA 1FY6A 4TV6A 3ZLGA 3WD2A 4TIMA 3DECA 4PB4A 3A4XA 2X1IA 3P6LA 1PIIA 2KX9A 3NGJA 2YR1A 3I3EA 1J8VA 4QBXA 2A3EA 3AZRA 2X1TA 4NNBA 3CIXA 1E6XM 1XLHA 3PJWA 3L4WA 3VOIA 2Z29A 3DEQA 3A4JA 2WCAA 2WAGA 5CKSA 2XIMA 2F61A 1HL9A 1JEZA 3AWOA 2EG6A 4GFSA 3SRDA 3N13A 2W61A 2EPMX 4NJHA 3VOFA 4HNUA 2ZUVA 4WOQA 1ZXIC 5FS6A 3AS2A 2W0HA 1CDGA 4RDYA 4WKFA 4M81A 1W9VA 1UR8A 2UZ9A 3KTSA 4US5A 2ZOXA 2HK1A 2EQ6A 1XC6A 1F5ZA 3FVMA 3UERA 3DU0A 1IXQA 4HVXA 1PIFA 3UG8A 4QDMA 4X2RA 1FH8A 2RFGA 3R10A 4I90A 4NYYA 4QAIA 3WLNA 4ILSA 2C3CA 1RXOB 3VX0A 3CGDA 1L8PA 3QHMA 2PDXA 3L12A 3MMDA 4EK7A 2ZZCA 4GINA 1XBZA 3LM7A 2VKZG 3F03K 4FIRA 2JK2A 3LTSA 3H2AA 3E0IA 2Z7KA 4XAPA 3GTIA 3HOJA 5AC7A 3W7JA 4DIAA 2WC3A 3JR2A 5HQEA 1TPH1 4JFTA 1PCWA 2OEMA 1Z32X 1B9BA 5HUPA 3BC9A 5LNRA 2ZFAA 2QCEA 3Q4DA 2DH3A 3CWOX 3N25A 2WQPA 4AYGA 1ADSA 2IPWA 3TW7A 3W1RA 1PDZA 4WEVX 2V3AA 3P62A 3RGTA 1LQAA 3U8GA 4S3EA 3IUDA 1MO0A 3CMGA 4HT3A 4GJ1A 3GYEA 1KN0A 1N5WC 1KLZA 3ZM8A 1BKHA 3HGRA 3KW3A 4RZ4A 1LF1A 1XUZA 5BXPA 1Y5XA 1RY8A 2XIIA 3EPOA 4JQ1A 1WXZA 3E6EA 4CCDA 5F2IA 3S5OA 4AHPA 1XX1A 2XN0A 3K13A 3GHRA 3CT2A 1B2YA 9XIAA 4HMDA 3OQ8A 1Y7VA 1NM9A 2QMKA 3PSVA 1OYAA 2PU0A 1XIHA 3T2PA 3E2RA 1J0IA 2G95A 1OGSA 1R30A 2A6NA 4HP5A 3CHDA 3ZT5A 4X2PA 1V03A 1X2GA 3ME3A 2R9RA 4G8TA 3GHTA 2V82A 3C0QA 5IHSA 3M47A 3QHOA 1A50A 1DXLA 4JNMA 1LOQA 3BW3A 1KR0A 1EEPA 3W7NA 1XLKA 4FOJA 1KGUA 1TV2A 4ZOAA 1LWHA 4S3BA 1JCXA 5C70A 4M56A 4QG8A 1H7PA 3LCLA 3W38A 2FDMA 2NT1A 2VZTA 4XQ6A 3EYPA 2IUZA 2AGKA 4MKNA 4C7GA 2A3HA 2FZMA 4IFKB 4DLMA 1KM4A 1V6VA 3NL2A 2VT0A 1JD7A 3IUHA 2Y4SA 1K03A 4H1ZA 1YPIA 2DSWA 1JFXA 5ABHA 5D8ZA 3M0YA 4CNUA 3WK3A 3LERA 4EVZA 2PC8A 3LN3A 1E1EA 3DFNA 4ZQMA 3OZOA 3BURA 3GQYA 3F5LA 4MWAD 2CBVA 1VCFA 3VIIA 3LHVA 4UQAA 1KB3A 2QJJA 4Z2LA 3OBAA 3HMJG 5BXRA 3ZXWA 5JBDA 4E8CA 3CB3A 2NQHA 1HKVA 4HB7A 2OX4A 1G4TA 1JCYA 3FEMA 4H9ZA 3CPGA 4AAJA 1VFSA 3O6DA 2YA2A 3NQCA 4H4PA 1P0NA 2Z28A 2AKMA 4PMXA 1CIUA 1X1ZA 5CXPA 3F2BA 2YLLA 1JJKA 1GQNA 4RE4A 3D46A 3KEHA 1EGMA 3TTEA 2ZWZA 1EBDA 1OFRA 1S2AA 3C8FA 1SFJA 3W01A 4NL1A 2ZUSA 5BU6A 2GZXA 1LWJA 2WMGA 2PWUA 1M6JA 3N6QA 3T81A 2PU1A 4GYJA 1Q45A 6ENLA 1RBOB 2PI6A 3AIRA 4LF1A 3QOMA 2UY5A 4PMZA 5D38A 4Y90A 1TV5A 3LPPA 1V4YA 3B8SA 1QOPA 4DM2A 4R9OA 1L0PA 2ZTKA 1H49A 1BD0A 2WVVB 1XD1A 3I7SA 4C7FA 4K7VA 2O9OA 2Y5EA 2PGRA 1W1B1 2JE8A 3GDMA 6REQB 3GD4A 4QR6A 3GVVA 2WC4A 1MFUA 2PTXA 1AQFA 2TODA 3QQ1A 2FGLA 5AZ0A 5TBOA 2FFCA 3WLKX 1OFDA 4PA8A 4V1XA 4I5RA 5FMHA 1CGTA 2YOCA 2E25A 3WENA 1PKNA 3V0SA 3A23A 3LXDA 1F3PA 3BAWA 2E77A 4S3FA 4E5TA 2IKGA 1V6UA 3VKAA 3I4EA 1KFJA 1WB0A 1WUFA 3E2SA 2YBTA 4C91A 1M1BA 2DZVA 3O6YX 3PPFA 1PIGA 4HBKA 5G1MA 4EMJA 4C6IA 3UR2A 1KQYA 1JYVA 2GOKA 1DOSA 3P0WA 3LCWA 1EZWA 3LRLA 3GS6A 2VHLA 3G6MA 1XF0A 2QKFA 1FXQA 1XLAA 3H2FA 2YB1A 5C9WA 1E3XA 3QMTA 3AC0A 3S2JA 5DCEA 4JTKA 1OINA 3SCNA 3ETRB 3KFTA 1S5MA 3LCGA 3APYA 2Z7GA 1YBQB 4PTNA 4ICCX 4LYQA 4GMEA 5FKYA 1TYGA 2Q8LA 1S2CA 2GGGA 3DYOA 1K8XA 2YDAA 3KAOA 4HOXA 4U3AA 1K6WA 1XRVA 3UWQA 1E55A 5D2WA 3LRMA 2WXDM 2GVLA 4KGLA 1YQ2A 1TVLA 5EFFA 1X96A 4DF1A 4KBXA 2A85A 1DE6A 3H21A 4EQWA 3BW2A 3ARYA 5PTDA 4WCJA 3EXTA 3F4WA 4DYEA 3TCEA 3B06A 3H2CA 1W31A 4LV4A 3CZGA 4D6HA 4JBRA 4FLRA 3QR0A 3NEVA 4ZFMA 1C91A 5GNZA 1AQ0A 1DJQA 4FXJA 2Z1KA 3DG7A 3PBVA 3DGRA 4NU7A 3ZLHA 2BP1A 4MSSA 1P43A 2AMGA 5MKGB 1F6KA 3PK7A 2OXNA 1MDRA 3C3UA 5EBUA 1A5KC 1A5SA 1RJQA 3S1VA 3MSGA 4E3VA 5A8NA 4Y8FA 1DWFM 1V3MA 3CZKA 4I7WA 4ATWA 1UD6A 3WJXA 1H7NA 3HQPA 1J01A 3ZJ6A 3G8RA 2BY3A 3DXIA 2BHUA 4PFHA 4J28A 4Z1AA 4PUUA 4LQ1A 4CNOA 2NX9A 2XH0A 4JTGA 3ANUA 4M29A 4LWWA 1J9YA 1VFLA 1BSLA 1E6NA 3BZGA 4ZQOA 7TIMA 3LBMA 4A3UA 1VFUA 3KZSA 4Q4MA 4IX2A 1OM0A 1XIJA 3W74A 1EBHA 3CEPA 3GFXA 1MQQA 1V0LA 4DPQA 1E0VA 2JIWA 1VCVA 4HMEA 4W85A 4IMDA 2ZRVA 3NQBA 1BGGA 2J8FA 4WLCA 5I77A 3ITTA 1NDYA 1HKMA 3PBYA 3M0JA 5CGQA 1YKWA 4I8YA 3M7SA 2GUYA 3U0HA 1M7XA 4QQ3A 7PTDA 4L64A 3S2NA 4W7UA 2CLIA 4JZ5A 1SZGA 1D9EA 4YYCA 2CPUA 1Q6QA 1H41A 3MJYA 2Y1HA 1KBLA 2HS8A 1ZZMA 2OLSA 2H8XA 3THUA 3WFAA 3S2MA 1JCLA 3VZZA 2V67A 2CZVA 3W2JA 1FWAC 3NZQA 3D3FA 4JFVA 3WK1A 3B0XA 4ROPA 3O15A 4C6MA 2QCFA 3WY1A 3PJUA 3PZTA 4L61A 3A22A 1EOMA 1C3FA 1QDSA 1HKKA 1HGYA 1FCUA 2X40A 3W7DA 4WZHA 4UTHA 5EA9A 3NL6A 4M51A 3B9JB 3PBWA 3ZZ1A 2WZIA 4GKTA 1LPFA 2RGLA 1NTHA 5E0KA 4AEFA 2WP5A 3VVGA 2V5LA 1LL6A 2XH7A 1TX0A 1W3NA 4MWAB 3UWUA 3CC1A 1FWEC 2XDFA 1BTMA 3N3TA 1Q6FA 1RY0A 3DH7A 1BQGA 4H7ZA 4GYKA 1CNVA 1TX2A 2YCKX 1TMLA 2HV5A 2GQ9A