2NQLA

Crystal structure of a member of the enolase superfamily from agrobacterium tumefaciens
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
388
structure length
388
Chain Sequence
MNSPIATVEVFTLTQPRKVPYLGALREGEVVNPNGYIVRKGNRTVYPTFDRSVLVRMTTEAGTVGWGETYGIVAPGAVAALINDLLAGFVIGRDASDPSAVYDDLYDMMRVRGYTGGFYVDALAALDIALWDIAGQEAGKSIRDLLGGGVDSFPAYVSGLPERTLKARGELAKYWQDRGFNAFKFATPVADDGPAAEIANLRQVLGPQAKIAADMHWNQTPERALELIAEMQPFDPWFAEAPVWTEDIAGLEKVSKNTDVPIAVGEEWRTHWDMRARIERCRIAIVQPEMGHKGITNFIRIGALAAEHGIDVIPHATVGAGIFLAASLQASSTLSMLKGHEFQHSIFEPNRRLLDGDMDCREGRYHLPSGPGLGVRPSEAALGLIERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Enolase from Agrobacterium Tumefaciens C58
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
molecule keywords Isomerase/lactonizing enzyme
total genus 133
structure length 388
sequence length 388
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2nqlA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2nqlA01
3DDMA 4H83A 4HNCA 3ZLFA 2HZGA 4IP4A 3VFCA 3DFHA 3NFUA 1ECQA 3DG3A 3FV9A 3N4FA 3TJ4A 4HNLA 4Z1YA 1NELA 3U4FA 1BQGA 3MSYA 4KEMA 2PPGA 2P88A 4F4RA 4GGHA 2XGZA 3OPSA 3JZUA 1KKOA 4IL0A 3MZNA 4FP1A 2PU1A 2OQYA 2P8BA 3UXLA 2NQLA 2QQ6A 3V4BA 1P48A 4M6UA 3STPA 3DERA 2PTXA 3ZVHB 3EKGA 3BJSA 2RDXA 4G8TA 4H1ZA 3DFYA 1EC7A 3PK7A 2P3ZA 2P0IA 5FJUA 3SBFA 5BOFA 4A35A 2PODA 3R11A 3PWIA 2ONEA 3IJQA 3DEQA 1NU5A 3UJ2A 2PGWA 3T9PA 3VCNA 2GGEA 4KPLA 2HXTA 4E6MA 3GO2A 1SJDA 2OO6A 2ZADA 3CK5A 3TW9A 1JDFA 3RRAA 4JN8A 2XH7A 4DYEA 4ENLA 4H2HA 4IT1A 4E4FA 3P93A 2OKTA 3R1ZA 1WUEA 3K1GA 3R0KA 3P0WA 2OVLA 1JPDX 3H8AA 3RO6A 2QVHA 2QGYA 2GSHA 2OQHA 2PGEA 3RITA 2GDQA 3FCPA 3ZVHA 3FXGA 1FHUA 3BSMA 3THUA 2QJNA 4K1WA 3CAWA 2DW6A 1SJBA 3HPFA 1TZZA 2AL2A 1W6TA 5FJPA 3N4EA 3TTEA 4ZCWA 3IJIA 4DN1A 3DIPA 3ZLGA 1OEPA 2GGGA 3I4KA 4K8GA 1BKHA 1XS2A 2XSXA 3FVDA 1KD0A 2XH0A 1DTNA 2XH4A 4M0XA 1MRAA 3TCSA 4ROPA 3TJIA 1R0MA 5FJOA 5J04A 3N6JA 4E4UA 3CB3A 1RVKA 3JW7A 5ENLA 3VCCA 3PWGA 1P43A 2GGJA 4GMEA 3NO1A 3NZGA 2OZTA 2O56A 3VC6A 3TWBA 3SN1A 1PDYA 2PS2A 2FYMA 3UCCA 4A6GA 3CYJA 2OZ3A 4GISA 3NXLA 3CT2A 5FJTA 3EEZA 4G7FA 1EBHA 1ONEA 2CHRA 3MY9A 3OZYA 7ENLA 3B97A 1SJCA 3H12A 3QTPA 1YEYA 3IK4A 1KCZA 3T8QA 2PMQA 3SJNA 4DHGA 1F9CA 3MQTA 4MMWA 3MUCA 4HCDA 3OP2A 1FHVA 3QN3A 2OZ8A 1EC8A 1XPYA 3FYYA 4H19A 3GY1A 3R10A 3SN4A 3UXKA 3TQPA 3V5FA 2AL2B 3P3BA 4KT2A 4YWSA 3ZVIA 4GFIA 1JCTA 5IDZA 3GD6A 4MKSA 3S5SA 1IYXA 1MUCA 4EWJA 3DG6A 2OX4A 3DG7A 1KKRA 4IHCA 3H70A 2OPJA 1MDLA 2DW7A 3QPEA 1E9IA 2PP0A 1SJAA 3R25A 4E5TA 2PA6A 4HPNA 3UCDA 4GIRA 3V3WA 2QDEA 2MUCA 3UJSA 4HN8A 3ES8A 3DGBA 4K2SA 4A3RA 2AKZA 3KUMA 3PFRA 1R6WA 4J3ZA 3VC5A 1L8PA 3TOYA 2PTZA 3TWAA 4HYRA 2GGHA 4DWDA 3R0UA 6ENLA 5BOEA 3N6HA 4IL2A 2OLAA 3U9IA 1TE6A 3I6EA 4DX3A 2POZA 4IP5A 1EC9A 3QLDA 3RR1A 2GGIA 4FI4A 5FJRA 2GL5A 3QKEA 2PSNA 3UGVA 2PU0A 3MKCA 3CXOA 3H7VA 2AKMA 3UJFA 2QDDA 3RGTA 1TKKA 3FJ4A 3VDGA 4Z17A 3ES7A 3SSZA 2QJMA 3GC2A 3UJEA 2AL1A 3OW1A 4DXKA 3OZMA 2PP1A 2PTWA 4J1OA 3UJRA 3JVAA 3MWCA 4E8GA 2MNRA 3S47A 4GYPA 4HCLA 3OTRA 4JHMA 3T4WA 4HCHA 3D46A 1WUFA 3Q4DA 2ZC8A 3DESA 3D47A 4GGBA 2PCEA 3T6CA 3ZLHA 4MGGA 3VA8A 1JPMA 2OFJA 3SQSA 3I6TA 2P8CA 3ENLA 4JN7A 2FKPA 2HNEA 2OG9A 5EU9A 4KWSA 1EBGA 3SN0A 4GYPC 3RCYA 2I5QA 3IJLA 1ELSA 3BOXA 4ZA0A 2XH2A 4IZGA 4X2PA 3V5CA 1MNSA 3Q45A 2QJJA 2PP3A 1MDRA 2HXUA 1PDZA 2PTYA
chains in the Genus database with same CATH superfamily
1YDVA 4A8LA 4JIEA 2X2GA 1LTDA 3ZLFA 2D2OA 3CZJA 5KITA 1Q2SA 4PUUA 3C2EA 5JCLA 2AQWA 4DJEC 2Q01A 1XLGA 4GVIA 1GYNA 3GWQA 3NO3A 2A0NA 1TJRA 4DXXA 4XVEA 5C8BB 3KCJA 1VDVA 4PMQA 2ZRYA 2O0TA 4H4SA 2XIBA 4TV6A 4QJ5B 4N42A 2WMHA 5IHRA 5KVIA 1A0CA 2GVGA 3OPSA 3OJGA 5A6MA 3M0VA 1RQEA 1AODA 3V36A 4EE9A 3OQEA 4Q32A 3SFKA 3GG0A 3PF3A 1L6SA 3VGGA 5JRBA 1UH3A 2GRTA 1BXNA 2W62A 1EWDA 3HBLA 3UQNA 1M7OA 4A4AA 2P0IA 3TTYA 1GXFA 1DWGM 3E2QA 3E0VA 4NZCA 5IM51 3QFWA 1PVNA 2I1OA 3ZR6A 4JGDA 3SCSA 1F2JA 4PSRA 3B8SA 3UJ2A 3WJZA 4JTIA 3AS1A 2VELA 3U7VA 3R89A 5FEXA 3PY2A 3MMDA 4R7JA 2V63A 4D6CA 4H00A 3NDYA 2XVGA 4R34A 3PZUA 1AMKA 1NARA 5CC5A 3LG3A 2YAUA 2BFGA 2O9OA 2J25A 3P93A 3WD0A 3PTMA 4NJKA 2WSQA 4NJJA 3R1ZA 5D37A 3GVQA 1VQTA 4IIEA 4C1NA 3P0WA 1ZHAA 3RO6A 3GNDA 1OCBA 1XI3A 1ONRA 1WKFA 2I17A 4RZBA 6XIAA 2P3EA 4Q4KA 4DBDA 4JTAA 1FCQA 4NP7A 4UQCA 4P7RA 1U5VA 3THUA 3HRDC 1A3XA 1Z41A 1AUSL 1EP2A 3CQKA 3N12A 4JQ3A 1UWSA 4UFMA 4XWUA 1JDEA 1VRXA 2OO0A 1TFVA 1QR7A 1OEPA 2B7QA 4PRTA 3Q37A 3KDOA 4FXRA 4Z0JA 3DHDA 1V6TA 2GJNA 5CPSA 1OYCA 1QPRA 2J8FA 4B5VA 2QV4A 3A47A 5A6AA 2PWFA 1RY8A 4MJZA 1OX5A 1TPC1 4IF2A 4BI7A 3GTNA 1ICPA 4EACA 3ZS4A 3LXCA 5LNRA 4ZMGA 3S5YA 1W5OA 2FIQA 1SW3A 2G95A 5FS7A 2PURA 2E7FA 4O14A 5G5HB 2OWCA 2Y5EA 4DUWA 1KWKA 1NDAA 1TSIA 4XV0A 3F4CA 3AJ7A 3B8TA 5CBJA 3LX9A 3TH6A 2VDHA 2NUWA 2EJ1A 4J3VA 3QR1A 1BYDA 3LD5A 2BGSA 1WYGA 4UTWA 3EEZA 1W31A 1TZ9A 4S3BA 4NASA 4DLFA 1J11A 4B5SA 4LF1A 1BGAA 2I5GA 3M5YA 1S5VA 4C5YA 4O54A 1P1MA 2PDBA 1E9ZB 1DOSA 3P8IA 2BDQA 1V0NA 1OD8A 2VD8A 3BOLA 1L2UA 3D9XA 2NVKX 3SN4A 3RX2A 3KTSA 4QEEA 3W1LA 1JCYA 4LRTA 4QNWA 2P0OA 2ZZ0A 3M47A 1GOIA 1PKMA 4QAIA 1EH9A 1X1OA 2ZUMA 4IFKB 5IFTA 1M1BA 4DM2A 1XYLA 2ADAA 1MFVA 2PLMA 4PCPA 5HNTA 1W1TA 4S39A 3HQNA 3VZXA 4W93A 4DJFA 5C9RA 4AF0B 4NNBA 2YVGA 1U22A 3GVRA 1EXPA 3CUIA 2XVNA 5JUVA 2Y7DA 3DHPA 4U2YA 1N55A 1EZWA 1N8WA 2GH5A 3SQMA 5CSUA 4FSAA 3AUJA 3HPSA 3GDRA 4J9JA 5DMMA 4WY0A 3O63A 4CN6A 4F9DA 1WXJA 1XBZA 3B0XA 3A5VA 2HE5A 3VC5A 1KR1A 2VRKA 4UTWC 1JYWA 4X2RA 4JL2A 4A8IA 3VINA 4R53A 2PDLA 1SSDA 3EDJA 1T96A 1W1IE 3IS4A 4FXSA 4LAUA 4ZQCA 1ZAHA 2BODX 3EOLA 1LL4A 4MJ4A 2Z4GA 4L5ZA 3KRBA 4B5NA 3ABOA 4YCPA 4H4RA 3VGBA 1RCOB 2Z24A 2VZUA 3D3AA 2QAFA 3PG9A 2X1TA 3RDKA 3CL8A 3SECA 4GIEA 3ALFA 2A3BA 3T0BA 3R79A 2IKHA 4BA0A 3CUJA 1H7PA 5ABHA 4J4KA 2FHBA 1A5CA 3VNJA 2A7NA 2X40A 1KNWA 2O9TA 1WE5A 2BASA 3VX0A 2VGBA 4M52A 1X1NA 2VD9A 3OZMA 1S3HA 4NJGA 1TV8A 3PUGA 4GCAA 3VNYA 5CKSA 2TSYA 3MB9A 3WBYA 1KV8A 1C91A 1ZBCA 3M0LA 4J3UA 3TN4A 4ILSA 1K8YA 3NEHA 4P8UA 3D47A 4Y9MA 4AVNA 2QF8A 1ZBKA 2WZHA 3W1QA 3UPMA 2I16A 3MUY1 3BOFA 5EU9A 1PZ3A 4W8BA 1LP6A 5IXEA 4Y8FA 4DNAA 3E5PA 1D2KA 5CPMA 1M6IA 1N8FA 1SFTA 4PUDA 1PKYA 5I02A 1MDRA 5CBBA 4PN2A 4S23A 2JFEX 1QVBA 2VWSA 3L2LA 2Q8LA 4MUZA 2VZOA 3JR2A 1BKSA 1A5OC 2ZZ2A 1QUMA 4HA0A 4N9EA 4C6PA 3MUZ1 1TIMA 3UA4A 4AY1A 1KGUA 2XPKA 5DBUA 1BYAA 1M3UA 1PPIA 2C1GA 1NWSA 1MW3A 1YTDA 1VQZA 2FZ8A 3SZ8A 1JAKA 3U5YA 4MNJA 2PU1A 2HRWA 2OQYA 3TNBA 2PDFA 3W7MA 4RNHA 1AH4A 3S42A 4MPKA 4DPQA 3P81A 3P84A 3FG2P 5AECA 1A3WA 3PK7A 3E96A 2HROA 1D8WA 2E68A 4KGJA 1KRBC 4U2ZA 4AXNA 5HUOA 2XN0A 4BZYA 2G3FA 2SFPA 3KBNA 4DJDD 2ONEA 3IJQA 1E0XA 1I2PA 3K8MA 3WD4A 1GEQA 4GIAA 3T9PA 5B7YA 1LLZA 5IBXA 2GSJA 3A23A 4TOQA 3W28A 1QASA 3NS1B 1FWNA 4MF4A 5ECUA 1XKJA 3WNKA 4ZTYA 1B9ZA 3MJYA 1TPVA 2WLYA 4WF7A 1VFUA 4AX6A 4UTTA 2OYLA 3VD9A 3GRTA 4RDWA 2E9MA 5GNZA 3R0KA 2J6XA 4LVGA 5JXQA 4GY7A 1XD1A 4JIQA 4WX2A 1GT8A 3RK8A 1IXNA 1GERA 3OO2A 1RBOB 1TELA 1ZTVA 1K9DA 4YIWA 3A9BA 2TRSA 2B7NA 3N14A 5LHEA 2ZX9A 3LUTA 1GG1A 1ZPTA 4HMEA 4RDVA 1ME9A 2HBVA 3UWZA 1GZGA 4IMCA 4K8GA 4IGMA 3KWXA 4N6FA 1XS2A 3ZWSA 4IPIA 2XH0A 5TBOA 2XH4A 3QZ6A 1J0HA 4P7QA 2DSZA 2YFNA 3DK4A 3NG3A 1HKMA 1LOLA 3NDOA 2WBKA 3IVSA 3LHTA 3WUEA 4PCNA 2QPXA 5T9BG 4DJED 3BDKA 4GUJA 4E4UA 2PDHA 3QGAC 2O4MA 1IE7C 4OTKA 1TZ7A 3L4XA 3LTSA 4EMIA 1KXTA 4ALDA 1TV4A 3UY7A 1LDCA 1SZRA 1TPEA 4LS0A 1KO0A 2CBJA 5GQBA 4C1KA 3INPA 2X05A 2CLMA 3H2MA 4PTMA 3A13A 3P5YA 1XYZA 3K1DA 1H63A 3RLGA 2PDCA 3WDIA 5A6KA 1Q6LA 2ZIDA 1GG0A 1T3QC 4B3ZA 3IPWA 4RXGA 2DVTA 5HPCA 1NP0A 1HJXA 2ISSA 3SJNA 3UVAA 2VHLA 4TX8A 1VFMA 3F7JA 3MJMA 2ZX6A 3G0UA 1Z44A 3VU2A 1SR0A 1YPIA 3GIPA 2Z1XA 3ZR5A 5AC8A 1XPYA 2XN2A 1PS9A 1Y0EA 3GY1A 4M6VA 5FJJA 3KP0A 1P0NA 2QF7A 4NKCA 5FMHA 1KLYA 1H0GA 4FMVA 1K4HA 2OSYA 1OFDA 3CAQA 1UP2A 3GD6A 1FXPA 4ZO7A 5EMYA 3G1VA 1H4PA 2ABBA 3TX9A 2OGJA 1SFJA 2XHYA 4P8XA 1KFLA 2QZRA 3VIGA 4C6OA 3I4EA 4J57A 2GOUA 1JXKA 1TR1A 3PP7A 2FTWA 4M7TA 1XIEA 2VZTA 4C6DA 3B06A 4ICMA 4GY1A 4LVAA 1R3SA 1UZ1A 1S2AA 7REQA 1RQHA 3ARTA 4FX6M 3RHGA 5DT5A 2Y7FA 4WGXA 4RPQA 3DOPA 3MC5A 2MANA 3AO0A 1T99A 4EX4A 2KX9A 2OODA 4HHHA 4WQ6A 2PTZA 2CDUA 1MXDA 4DAFA 1ADOA 4Q8OA 4W7WA 2XFFA 1SZFA 4QRNA 2ZQ0A 3S9IA 4WR3A 4HPGA 3P0XA 4EP8C 1E51A 4L4PA 5U4NA 3HQ1A 5C9XA 4JX5A 1TE6A 1SSGA 1SZGA 5EMUA 1D8CA 3MKVA 1R30A 4N4PA 3E74A 1RA5A 3O6CA 3FVMA 1H1ZA 1V3HA 2Y88A 3FN9A 4ZXOA 3DH9A 2DT3A 3NQVA 1C7TA 3BUVA 2F6XA 3VM5A 3MU7A 1B2YA 4KFOA 4MJMA 1OIFA 2WJFA 1DWIM 2XN1A 2PU0A 3ARPA 1GPWA 3LSBA 5LXXA 1KM0A 2YGYA 1JF5A 3RM9A 2WOWA 1JD7A 1X2HA 4Z17A 1H62A 3SSZA 1DHKA 4KMQA 1CWYA 3LQGA 3RFAA 3WLLA 2YL8A 4QCEA 2PP1A 1UD2A 2ATSA 2WMJA 4JFVA 3UJRA 1W0MA 3ANYA 3EMZA 3G8EA 4O16A 2BG5A 2W3SA 2J77A 4JHMA 4MJ2A 1WDPA 3G1XA 4JBRA 2YBVA 3RYSA 3VGDA 4DELA 5BZAA 3EX3A 5I77A 1GEUA 3NRZB 5HR6A 1O5XA 3L2IA 1JPMA 3C2OA 4DO7A 2OFJA 1PL9A 1EX1A 1VIWA 3R8HA 4GZIA 3BLDA 3W7JA 1MEHA 1B0IA 1Q6OA 7TAAA 3GH4A 1FA2A 4Y7EA 2ZZ1A 1UH2A 4GACA 3WBWA 3NPVA 5KZMA 1W9XA 3FAWA 2YR1A 3W4RA 2YZ5A 3CV7A 3GR7A 2X8HA 3URAA 5FSEC 1GRGA 4RV8A 1QNSA 4DJDA 1GW9A 1PYMA 2WKGA 2PC8A 2QCEA 3LHWA 1MQQA 2YKKA 1FWIC 2P5NA 1RLCL 3FK4A 1XDLA 4NJHA 2DVXA 3TJXA 3RM8A 2BLEA 3OGRA 3TJ4A 3THDA 3AS2A 3NQFA 2ZTJA 1ONWA 1ZBWA 4YHEA 3PUEA 1QK2A 3QY7A 2PPGA 2WOQA 2P88A 4ZE5A 5A2CA 3FHAA 2RABA 1CENA 2W0UA 2BVDA 1HG3A 4XZMX 3TC6A 3EX1A 1GSNA 1V4YA 4MKNA 3UXLA 4PUEA 1Z8AA 4V33A 2NQLA 3V4BA 2VFDA 4LU0A 1X6LA 2R1NA 1JGMA 4WSJA 3KTXA 4HNNA 1XXXA 4OT7A 4TVCA 1U2YA 1F05A 2CLKA 3VNLA 5I5RA 1KM5A 3BJSA 2QCMA 2CLIA 4Y8EA 3XIMA 1S5TA 1NH6A 1UC4A 1PIIA 1VYRA 4UTUA 3A7UA 1VGAA 3OOQA 2BGNE 3GXPA 3ZQ9A 4Y9AA 2EHHA 3R7MA 2PGWA 4W4QA 3VIPA 3NO5A 2A3AA 5TIMA 3WLHA 5KETA 4P61A 3S4TA 3RRAA 4BQ5A 2O9PA 2VDIA 4Q7BA 5EFDA 1LCOA 1CXKA 4GCXA 4ZOCA 1GK8A 2NWSA 2X1SA 3K4AA 4AZCB 2QVHA 1QDSA 1SO6A 1B31A 3QW4B 1UKSA 1NTHA 5DX7A 1FHUA 1EDGA 5EBAA 3M5VA 1KCXA 4S3CA 3HPFA 3WQ6A 1F7BA 1FDZA 1BFNA 2V5CA 3CL7A 5FJPA 1TV3A 4ZCWA 1ZAIA 2GSEA 1PBGA 1H2IA 3E0FA 3ITOA 1WDQA 4Q7IA 2Y0FA 5F4WA 3P74A 1X38A 4B9ZA 1WDDA 1C93A 2BVWA 4GABA 4PE8A 4GX9A 2C1HA 2FVKA 5HJXA 1LRQA 3LNPA 5BMXA 4EAYA 4OBTA 1O95A 3TJIA 1UQZA 4HU8A 2HPMA 3UWEA 3PSVA 4M1BA 3TZNA 1XLLA 2A5HA 3WLPA 3TONA 1R0MA 4NNCA 5EMLA 1WNOA 3H7UA 3TIMA 2CFYA 1RVKA 1WDRA 2A6NA 5ENLA 4GZJA 1OT2A 1F8IA 4GZEA 4D6FA 1G6CA 3WNOA 3VIOA 3M0MA 4HSOA 1R47A 1G4SA 1E6NA 2BC0A 3UCCA 3QSTA 2D1ZA 4PUNA 5C54A 3BMVA 2H9AA 3AHXA 4GH3A 1E1CB 3E0WA 1NAL1 2G50A 5B7ZA 4XTDA 5XIMA 2V68A 3FGCB 4PYSA 3W84A 2ZVRA 2XFWA 4O1EA 1P7TA 4K1GA 2DZBA 2QPSA 1IXQA 3PJXA 4FALA 3ALGA 2G4JA 1V08A 4BI6A 1FWCC 1JZ2A 4Z2GA 1IWPA 1XYFA 3GVWA 2YPIA 1GRFA 1FHVA 4PCTA 3EKZA 2OZ8A 3R94A 2VYOA 4ASTA 5T91A 3AYVA 1QPNA 3ABSA 3APYA 1XM3A 4XK2A 4M5PA 3R10A 4ZTXA 5BOOA 3L8KA 1W3KA 1EHNA 2V69A 1ZBVA 2VX6A 4US5D 1K1DA 3GU1A 4F0HA 3IIZA 5E9XA 4QLKA 3PR2A 3USBA 1RA0A 3CH9A 5L6UA 3DG6A 3W02A 4GNKB 3VK5A 1O1HA 1EOMA 5AHIA 1GVFA 3LCLA 1R3QA 2QCCA 1VS1A 3KDNA 1WZMA 1H11A 1SM9A 3AALA 4GYKA 2YA2A 2DUZA 3VAVA 4V27A 2MUCA 4HN8A 3ES8A 3FW6A 5A6TC 2OT1A 4AH7A 4WY0B 4F40A 4HNVA 4QDWA 3HTWA 1WZKA 1BF6A 4F66A 2C19A 1JCXA 1WYIA 3PTKA 5HJYA 4B5UA 4PMRA 3GX9A 3NM3A 1L6FA 1EIBA 3AYTA 4DWDA 1YXCA 3ITTA 4GQBA 5K7JA 3GLCA 4H3DA 5HWMA 1QNQA 2E8ZA 2V67A 4BQ2A 5C9ZA 1B3YA 3RMEA 3LXDA 1Q63A 2WVTA 3HM7A 2ISFA 5D38A 5MHBA 3C0JA 4NZFA 1BQCA 2WHKA 3L4ZA 1P0DA 4ZSUA 1VYPX 3QBUA 5BXRA 4QFUA 4GA8A 1A0EA 1OZQA 2F84A 1A80A 4EM3A 2NUXA 4LF2A 1X8FA 2VP8A 1A50A 3WDHA 3F2CA 3KBMA 4ECLA 3WDRA 2BTMA 3K8KA 1Q85A 4J1OA 4ZZ9A 3JVAA 2NQ9A 1AMYA 3APTA 3G0XA 4JEQA 3IUDA 3MUAA 3CGBA 1KQYA 4AHPA 1W9VA 3RJXA 1H41A 4HU3A 2EEXA 1QCWA 1UHVA 1OSEA 4KKXA 3L4UA 1NP2A 1I2NA 3EDFA 1XFCA 4N7QA 4EQRA 1QI4A 1UR4A 2Q6ZA 3ENLA 1TUXA 2FMNA 2PEVA 5CC6A 2HNEA 4BQ4A 1F4AA 1VPYA 1UOZA 3VGEA 1JRBA 3H22A 1JYVA 3L66A 2G3JA 4DAIA 1K70A 3H24A 1AW5A 3FY1A 1XLDA 3NOYA 4RPPA 2V82A 4RDZA 1WKEA 1P0KA 1XGDA 3V5CA 5HXMA 2ACUA 4C1NB 3AAMA 1UD8A 2W54A 1W17A 4E2VA 4AG0A 3V1HA 5CPQA 3CQJA 1E72M 2Z1WA 4JFTA 2FB2A 2NQZA 1V6XA 4Q8QA 2XSAA 1KXQA 4AWSA 4NVTA 3URQA 1WP6A 4I9JA 3N4FA 4UMBA 3W75A 2A3CA 2VXNA 3BCJA 4GBUA 2CKRA 3BICA 5LKYA 1K3UA 2F8QA 3AZRA 4TQTA 1RBLA 2ZA2A 4XAZA 1VB9A 2NPXA 3MZNA 1DQXA 3GIQA 3PPFA 3IIXA 3WK2A 1DIKA 3MUXA 2FPYA 1H5VA 1KFEA 1BG4A 4M6UA 4DNHA 2BY1A 4KPRA 1XLBA 1L0PA 1Z48A 4G8TA 1E71M 4HHMA 4ZB0A 1PZ2A 2DH3A 3Q94A 1XPGA 4MM1A 3AHYA 4IOTA 5G2HA 4ERGA 4U33A 3PWIA 3E2RA 3M16A 5I3DA 1W9DM 4PB3A 1UP3A 1BEUA 4CU8A 2O92A 3R43A 4GG9A 2XG9A 4RKAA 4WKHA 4KBXA 4CLMA 5G2WA 4GNJA 1FKWA 2WZTA 5HOSA 1XJBA 2YBUA 4DZIA 3U2CA 1GVEA 1JDFA 4DYEA 2V6OA 2VGIA 1Q6GA 3PUDA 2PRMA 1Z42A 1NFGA 1K7FA 3L65A 2WC3A 5JMUA 4B2DD 4AD4A 2QCDA 2W66A 3SUUA 3O7UA 1UWAA 1ESWA 3BAJA 1VBGA 3BH4A 2A3LA 2ICSA 3TC7A 5CLWA 4HHLA 1A3HA 5HBFA 2JKEA 2VCAA 3DGZA 3D6NA 3G22A 2ZWZA 3IAPA 1KBIA 4Q4PA 3BW2A 3N4EA 2W61A 1TVLA 2XTKA 1HVXA 1ICQA 1Q2RA 2NQHA 1XANA 3N17A 3CB8A 5HA7A 3F2DA 3N6QA 1UWUA 1YLVA 3FVDA 1KD0A 4J28A 2C3ZA 4QR6A 3DJGX 3E3HA 1UP0A 2CESA 1LM1A 1TWDA 1A5SA 4KFNA 1HKVA 1FWWA 3IK2A 3S1WA 2WM1A 4ZB5A 1WBJA 3LY0A 1SMDA 1CLVA 4AWTA 1XBYA 4AVFA 3AM9A 2BOEX 4JFSA 3SQPA 3NZGA 4H8HA 1ZB5A 3VC6A 1RJRA 5XINA 2DORA 1RPKA 1DJZA 1H7XA 2PWDA 1R5YA 3AXMA 3NXLA 4PRRA 4TMBA 1GESA 2UY4A 3WBEA 2FDSA 3C61A 5E9AA 2YYTA 1J0KA 4XZ9A 1J5TA 3GXTA 1FFVC 4OUIA 2ZUWA 1ONXA 4H4XA 3VMNA 1H5YA 5DT7A 4ZQMA 3S2MA 3I7SA 5AY7A 3L67A 4AZ5A 3QR3A 4H19A 3ANUA 4R33A 2XIJA 4K7ZA 5DLCA 2BVYA 1XHGA 4HGXA 3EOOA 3O05A 3GVVA 4UCGA 3QMRA 5I03A 3P3BA 5A8QA 3KXQA 4TX6A 2C6QA 3NVZB 3N73A 4J3SA 1E73M 4JCMA 5JCKA 2QYGA 1EJRC 2PDMA 4KWWA 1GVSA 2Z28A 3EYPA 4HK7A 1W5QA 1ZJHA 4D6IA 1VPQA 3QY6A 1NOWA 1KKRA 2QCGA 3BJFA 1JQXA 3PAOA 2GJPA 2F61A 4GZ7A 3T2QA 3BAIA 4BS0A 1S7MA 1KR0A 4UR7A 4D6GA 1M7JA 2VUNA 2CWXA 3VDHA 2INZA 3WQOA 3KOFA 3KAOA 3LPGA 5BU6A 5A6JA 2BWGA 2WPGA 5BMWA 1Q5MA 2V2HA 3TR2A 4CCEA 1RJPA 3A9IA 2GZXA 2EQ9A 1UZHA 4DZAA 1V3JA 1H7WA 1O5RA 3N04A 3IARA 1L8NA 3WY1A 5DY3A 2XIQA 3VKBA 3R0UA 4KCUA 3PVFA 5DO8A 3TN5A 8XIMA 4IX0A 3EPMA 4D6JA 2W92A 1FCUA 5BOEA 4IL2A 4WSKA 4LVFA 8CGTA 3NR0A 5AHFA 3U9IA 1ZY8A 4IISA 3BAXA 4XZIA 4KEVA 4U4MA 3MHFA 5DF0A 1EC9A 3VXGA 3CV6A 4B3KA 2GGIA 3N3TA 3F4WA 5M1TA 3QOMA 4PTNA 1UKTA 1UQYA 3W86A 3TV8A 2AAMA 3OQ8A 2Z1SA 1JYNA 3CXOA 2XVKA 1X1ZA 2HVNA 1WOBA 2C91A 1NF7A 2NXGA 2PDQA 3KW3A 5RUBA 1V02A 3TTOA 5TAOA 3EB3A 1FDYA 3UERA 2YDQA 3AMDA 3ARXA 3EWXA 1HO4A 4PMVA 4P8VA 3IUHA 3MWCA 1BSIA 4I8YA 1H50A 4J3XA 5A2BA 5BYWA 4GYPA 3N25A 2WK2A 3D46A 1XICA 2OGYA 1FWDC 1WUFA 3Q4DA 4YHGA 4JAWA 1PX8A 4CQ9A 3NQCA 1OCNA 1YTKA 2BOFX 3H55A 4LRSA 2Z6JA 3E6EA 3IVTA 1LWHA 4FOJA 4HTYA 2J9YA 4WK9A 3MV11 2EG7A 5CGMA 2OG9A 4K39A 4KWSA 4DNMA 1CYGA 1A5BA 3BOXA 4HYWA 2CXGA 4ML4A 1UR0A 3B04A 1OG0A 3SGZA 3MPGA 2HXUA 1EEXA 1Y65A 3MCOA 3P7YA 1TRDA 3GHUA 1LL7A 4GXPA 1PB0A 4H4QA 1B3XA 5M3WA 2VEGA 4L4LA 5AYYA 3QC3A 3POHA 1VBUA 3KM8A 4LBSA 3FAXA 1VD6A 4A2RA 2GYIA 5FF7A 2X0HA 3KOXA 4W8LA 1KFWA 2I57A 3W7PA 2Y2WA 2YL9A 4R7WA 3AMCA 5GJPA 1SZEA 2TYSA 3N2TA 1ADDA 1VKFA 1MZHA 5HMDA 3OIXA 2GVLA 1D9EA 3VKAA 1F07A 3LCWA 4JX6A 5D2XA 3UPWA 1J4EA 2Y62A 2PGRA 3TLLA 1GQIA 3Q58A 2J7GA 4UQ9A 4UFJA 4DJFD 3VUPA 4BJHA 3SBFA 3L9CA 2PODA 4ZOAA 1Y8BA 3DEQA 2D2GA 1S5MA 4GX8A 4WDUA 2EGZA 1E6QM 2B81A 2CC0A 3VCNA 5GNXA 4W86A 3PBGA 2ZZ7A 1LG2A 3A3HA 4J35A 1K4QA 1NEYA 4BWLA 4CVUA 3CK5A 4IP7A 3TW9A 2XH7A 5D9MA 1GQJA 2V5LA 5AHLA 3CZLA 2OEJA 3C2VA 5DFAA 3L4VA 4TVUA 3W1NA 3EA3A 4O4VA 4HJFA 4H41A 2X50A 1DXFA 5HMFA 4GJJA 1CZ1A 2ZVIA 2X1UA 4RXFA 4D6DA 1BXBA 2OQHA 2PGEA 3DU0A 3VGHA 2EPHA 1W8SA 5D02A 5DRCA 2G3NA 3XISA 3MI2A 1LZOA 4ZL1A 4PUMA 3H21A 4EPDC 4XSLA 1VEOA 2AL2A 3IJ9A 3KBWA 1SO4A 5T9CE 1F3XA 2JGYA 1C8XA 1UIPA 1XFBA 5EY5A 3T07A 1BTCA 3GZAA 1YTEA 4QCFA 5D33A 2FFCA 4F48A 3NPWA 3PZVA 2E3ZA 4W89A 3PPGA 2WYSA 4X9SA 4XO6A 1P6WA 5BU9A 2Z7GA 3TQ0A 4M0XA 4IFOA 4U5KA 1GWJA 3BGJA 2QV5A 1Q6RA 1O1ZA 1LUCB 3IJDA 1PZ0A 1S39A 2W27A 5F2MA 2VGFA 4GE8A 1E43A 2C71A 4Z2KA 1WDSA 5FJOA 5J04A 1YXYA 2PLCA 4WHBA 3LCHA 1QPOA 1PJ9A 3BV7A 2X8CA 1VIZA 4H6RA 1K8XA 3FDGA 3VX1A 1EO5A 3PWGA 3B4YA 5G4HC 3RPTA 3CMFA 4M56A 3QV7A 4GYJA 3SURA 3W81A 4O13A 1EP1A 1F76A 1FWAC 1KM1A 2QCFA 3NQ7A 2V8ZA 3QV8A 3STGA 4UB9A 5C9UA 1XYBA 3CAVA 3CYJA 2CLPA 2IPGA 4GISA 1FWSA 4NNAA 1QOQA 3MZ2A 4H4PA 3QHMA 3EDKA 1SJCA 3WF1A 3VKKA 2GOKA 2KAUC 4UMAA 2DUXA 3W25A 2RDUA 3QXBA 2ZUNA 3QHOA 3LMYA 3FOKA 4AC1X 4DJDC 4TR9A 4Q3MA 2RAGA 4H7ZA 4POCA 3IGHX 1MW2A 4JS3A 3F5JA 4K8HA 4LEQA 4O0ZA 3TQKA 1AA1B 3LXBA 3WLMA 4LY4A 4O53A 3A4AA 3ZVIA 1X97A 5FEWA 3EXRA 1BD0A 1XW8A 3GW0A 3MYOA 2D69A 3MCMA 4S1FA 1E5NA 1MUCA 1JEHA 1YXDA 4YWOA 2R24A 3OBAA 4J5NA 3DG7A 1ZNNA 4GINA 4AIBA 4QTGA 3C3NA 1LYXA 1QT1A 4CQ8A 2YOCA 3O0KA 2PC4A 2VM8A 1ZFJA 5FIPA 5REQA 1J96A 4IMEA 2E8YA 4AQLA 1VENA 5I79A 3M0ZA 2NQ5A 4V2XA 1KBKA 5I0DA 3W1RA 2P1FA 3MP3A 5I6SA 2QKFA 4C6FA 9XIAA 1HJVA 2PGFA 3GDKA 4OKDA 1TPUA 1CXHA 4GIYA 3UXIA 1CTNA 1LBFA 5LGXA 1PSCA 3R2GA 3GZ3A 4Q6XA 2WMIA 2DJLA 3M7WA 4QE5A 3SUWA 4EANA 2XINA 3CU2A 3QJAA 2ZRWA 1QO2A 2PRHA 3LXAA 3TXVA 1KWGA 4LAMA 4EQWA 4BEUA 4GUHA 4FR1A 3KOZA 1VJSA 3VDGA 3W1MA 3BC9A 3GC2A 3WQEA 2ZE0A 5EGRA 1PHQA 1Q4WA 3F1QA 4D6HA 2HVOA 3CPRA 2PTWA 4GHRA 3CMJA 2QUNA 1HGWA 1HT6A 1I0DA 2IS7A 4LV9A 1NHRA 3D5HA 1R38A 4Q8WA 3WK3A 2JALA 3M6DA 4EIVA 4UFHA 1YPFA 3A64A 2WZIA 3B9OA 2CYGA 2X30A 3QV6A 1E6XM 1TX2A 4YYCA 4RNIA 4I6KA 4YLWA 4JQ1A 1QBBA 2V3GA 1DVJA 2DZSA 2J7HA 4A8RA 2P8CA 2DV0A 4JN7A 4XIAA 3CASA 1H1NA 3W7RA 4JYFA 3SRDA 4ADTA 4AW7A 2YBTA 5GJNA 1KBJA 1BWVA 4JTHA 1I2RA 1H09A 2BZNA 5FI8A 1KW1A 3W7QA 4AYGA 1CGTA 2A79A 1ZALA 4C6IA 4O18A 5EBKA 3CGEA 2DSWA 3G0SA 3FV9A 1CEOA 1NFPA 4DF2A 2Q8ZA 2A2IA 5I78A 5IFPA 1GONA 3KLJA 4Z1YA 4WJ8A 4JTLA 4ZE4A 4D8AA 3MSYA 5F1VA 2NWRA 5D9PA 1K6WA 3UZWA 4P7NA 1K03A 3ITVA 1Q7MA 4HBKA 1KBLA 2WNWA 3SEPA 1TA3A 4UTKA 3EOUA 3NPUA 4DUVA 4R7OA 4YVPA 2F2HA 3LBMA 4PH6A 3MWAA 3N2BA 1U1JA 4H6KA 3U0HA 2XVLA 5HANA 2YXGA 4RNFA 4BQ3A 3GDLA 1TRIA 3FIGA 4EPKA 4IUOA 4FIQA 2PLJA 3PUOA 3CZEA 4ICNA 3N3MA 3STCA 1XIFA 4PB4A 3VIKA 5H8MA 3H7RA 4OWGA 3T0CA 4CNUA 3Q67A 2VRQA 1PYFA 2UWFA 4NEVA 4MWAD 1LPFA 4AEOA 3HGRA 4ATDA 3WBAA 2PTDA 2QHAA 1LG1A 4LPCA 1DWHM 3PS7A 1KQZA 3WYZA 3GO2A 3N19B 3U4AA 2OO6A 1F73A 4C65A 1GNXA 2EPLX 3U5UA 3DN5A 3DC8A 4E4FA 1WV2A 1TQJA 4TVYA 2PWUA 3EPOA 3UZXA 1X7FA 3WQ5A 3IUIA 4QDPA 3H2AA 3C2FA 2OVLA 1UW9A 3CC1A 3C2YA 1LT7A 3W3OA 1UBSA 4L65A 1KN0A 4LBUA 4NZ1A 4B5WA 4MOZA 3BSMA 3WO8A 3LMZA 2YVFA 3UW6A 4JR5A 4B5XA 2A85A 4J56A 1CI1A 3OODA 4IQDA 4LTSA 4JNYA 1YKWA 1LLOA 2DEPA 2VR4A 2ZFAA 4KWVA 2EPOA 4MB5A 1H51A 3W2MA 1R9YA 3TKFA 1RK6A 4JFWA 3TNOA 2FGBA 3B9JB 3LU2A 1UWIA 4OBRA 4C7GA 3O0FA 3HQPA 1Q13A 3AYRA 4UQBA 3W88A 3GXIA 3AC0A 2VVSA 1XL9A 2YJQA 4MHBA 1JZ3A 2RGMA 1W1A1 3REQB 4H9VA 1PIGA 2DZUA 4IQJA 1AQHA 4LAOA 3ZSTA 3URNA 2FVLA 3ATZA 1ISWA 4JDRA 3Q65A 4XAPA 1Z7AA 2UY2A 1DWFM 1IXOA 2ODOA 5CZKA 3W6MA 4JQ4A 3BV4A 3OG3A 4TXEA 2ZX8A 4KRUA 3VUSA 1XLKA 1J8VA 5JCIA 1IT0A 1EDQA 3NO1A 2OZTA 4IXHA 4EXQA 1UR2A 2OLSA 4DWSA 2RDWA 4A6GA 9RUBA 3QQWA 4UTTC 5AKQA 1A5LC 3M64A 5EMJA 1H60A 3BQ5A 2DPEA 3NWRA 4G7FA 1LOSA 3VZYA 2CHOA 3CEPA 1HO1A 1OT1A 4LSBA 5BCAA 3QTPA 2DZWA 1EOKA 5HDRA 1X39A 4ZXLA 3FSUA 3NCOA 1OGBA 2VL4A 2F38A 4HCDA 4G56A 4AXKA 3AYSA 1DIOA 2ZZ6A 3NGFA 4IH3A 1GPFA 2BBFA 3URHA 2H8XA 3OA5A 3T55A 1BWKA 3KRUA 1A5UA 4MB4A 5ABFA 4JHOA 3VOJA 3V5FA 2VZVA 4ZOBA 1FFQA 1ZCOA 2UV8G 4LAZA 4WKFA 4TTGA 3DI0A 2R94A 1VJIA 2GVJA 2O55A 1V0MA 2R9ZA 3IRSA 2V3AA 1IYXA 3TYBA 1X96A 2P50A 3GXNA 1G94A 2ZX5A 3AIVA 3TUUA 4GXWA 5D09A 2BVTA 1AH0A 2OPJA 4K8EA 2AQVA 5KINA 1XSIA 3LRLA 5HQMA 3CGDA 1BG9A 3WH8A 2ZICA 3GFZA 3HPZA 2PF0A 3DZ1A 2E67A 2C15A 3I3EA 3IAQA 1XLMA 2VQUA 3KLKA 3MSGA 1DJXA 4QJ4B 1MYRA 1ZX9A 4ADUA 1E40A 7REQB 3IJ7A 1UROA 2IUZA 3MBFA 2XU2A 3E9AA 5JU6A 3B8DA 4PB5A 2G41A 1UA7A 2J7BA 1GRAA 3TR9A 3LQLA 5I7GA 5I2UA 4TUFA 5AB3A 1HNYA 2VT0A 4BK9A 3I6RA 2GLKA 4LX4A 5DMNA 4PODA 2OYMA 2VFEA 3LI1A 3G18A 2B31A 4C6MA 4E8CA 2CHNA 1DJIA 2OJPA 4RUBA 2YDSA 2A7RA 4AMCA 1CXIA 3WDJA 1UOKA 3KWSA 5A8PA 2W63A 4M8UA 3TA9A 4MFEA 1FFRA 1W3HA 4FXFA 3AMGA 3MCNA 4EXBA 1OABA 4DBUA 2OCZA 1QPKA 4ATWA 2JGQA 4LCRA 3P2VA 4JTCA 5D9NA 2QDDA 3LEPA 1QNVA 3W7HA 2HEJA 1JPKA 3L4WA 5GRTA 1T0OA 1RM6B 2XISA 2VQTA 3H2CA 4XG1A 4JKMA 2GDVA 3PANA 6A3HA 1VZWA 4WZHA 4CNNA 2V30A 1CB2A 2YVJA 1FY6A 1JULA 4S3GA 4WXZA 3H6OA 4L1WA 3AN1A 1TTJA 3F5LA 4DF0A 4EQSA 2FZNA 5LIWX 5BROA 2DIJA 3CUXA 4HCLA 5H91A 3W7CA 2VKZG 3OTRA 3ETRB 4RZ4A 4JTUA 3T6CA 2WSKA 4I9MA 2J7FA 1NOUA 1QW9A 3LHUA 4K68A 4EOUA 3SQSA 4F0MA 4JL1A 4EF9A 2QVNA 1TPWA 1YE6A 4JIRA 5U1OA 2A3HA 2EG6A 4JQ9A 1UKPA 4GYPC 5CPTA 2I56A 4E2DA 4XIMA 4ZA0A 1ALDA 4WJEA 5K4XA 1KM3A 5J8LA 3T09A 1H61A 1JRPA 1EYEA 2AMGA 3QTGA 4IPNB 2PTYA 3MI6A 3PNZA 3WLKX 2V2DA 4LALA 4B91A 4LH8A 2VEKA 4I7UA 3O6DA 3WEOA 3W7GA 1M04A 2WKJA 2PUZA 4WVXA 1JEZA 3AU2A 3VVGA 4A2SA 3BMXA 3TAOA 3RU6A 4RL3A 5FD0A 3BLPX 1IV8A 3QMSA 3S46A 4HSNA 3H2FA 1NQKA 4OE7A 1W5PA 4KEMA 5CBIA 1HVQA 3EOSA 2V3EA 2J8GA 2G3MA 3VO0A 1RUSA 4NI8A 1FWFC 3W70A 5E6ZA 2A3EA 3NQ8A 3KVLA 2CLHA 3TK7A 2YL5A 1E3ZA 4OUEA 4C91A 4JPGA 1EC7A 4ML9A 1I2QA 1TIWA 4UTHA 3ME3A 3OVPA 2D2JA 2D23A 3MVIA 1XQLA 4F2TA 3HMJG 3DC0A 2R14A 4CNPA 3WQ4A 1MSSA 4CD4A 1B30A 1E0TA 1ITXA 1WBHA 2ESCA 3WEZA 1POJA 4XZLX 5K2ZA 1KFCA 4Y6GA 1XRVA 2QR6A 5CSRA 1XF0A 3W1PA 3MP5A 3N9SA 3GKAA 3C3UA 5D8ZA 4KERA 3N29A 2FZMA 4NU7A 1UMYA 4CU7A 4LOCA 3W74A 4FX9A 3N4AA 2J66A 2QJIA 1N63C 3ZZ1A 3GAKA 1T7LA 4LW7A 1K7EA 2YW3A 3A4XA 4NSBA 3N13A 1RLDA 4K8DA 1RAKA 1TG7A 3RXZA 3VKCA 4WLCA 3ERPA 1QWKA 3B3DA 4UOZA 4Q4SA 3CHVA 1D7YA 3REQA 2OYKA 4K1WA 4PMDA 1B3OA 3EPNA 4PMNA 2GK1A 3LB0A 1Q8JA 5GVJA 2O7SA 2EQ7A 4DIAA 1STZA 5AC4A 5BNKA 3WH7A 4M80A 1XLAA 4XISA 3GK0A 4HTBA 3N11A 3AIWA 3SIZA 3T78A 2CBVA 2FLIA 3MV01 6TAAA 1FH7A 1XGEA 4TIMA 3S6OA 2WANA 2L5HA 3EA1A 4DF1A 3TCEA 4AZBA 1UWTA 2Z26A 4PMYA 3SRHA 1W2VA 1RK5A 3EXTA 4I7WA 3IGUA 3H26A 4FNUA 5CJMA 3G3DA 3AWNA 3ABRA 4F0LA 5BW6A 3ANVA 4LANA 4EPBC 4Z1CA 3G8RA 1P4CA 2ON3A 2J3NA 4AVOA 2DT0A 1IZCA 3BCDA 2VGGA 4M7SA 3SUTA 1Q6FA 4H4WA 2OZ3A 2CHRA 3MY9A 3RILA 3PFMA 1KCZA 2OLHA 1XYAA 2FHCA 2ZRXA 1E1EA 1SW7A 3I10A 4JQ2A 3SI9A 3MMTA 3TMLA 3QN3A 2F6UA 1OD0A 5D9OA 4R9OA 3L5OA 1XLFA 2QGHA 3M4HA 1IEWA 1CGYA 3SRKA 2Z27A 4WIWA 4J7RA 1GZ1A 1D3GA 1OWQA 2EXOA 4HN4A 4MAZA 5AHMA 1RCXB 1QJWA 2DGAA 4URIA 1ZGDA 5K9XA 3EX6A 2G5WA 1UPMB 3BG5A 1K9EA 4GQRA 5MKGA 1P0BA 3NOEA 4ZOEA 2PE4A 3WFLA 2WVUA 3TTSA 1D3CA 3KL3A 3QFEA 4RV3A 1J93A 1QOPA 3VTRA 2ZCGA 5CPNA 3TQVA 1CDGA 1XC6A 3NL6A 3W72A 1FIQB 1Y5XA 4HT3A 2UBPC 4X0VA 4Z1AA 2ZZ5A 4LUYA 3GSMA 3E12A 2O4QA 4Q8VA 4NAEA 1J9YA 4ZOHB 4ATLA 1PHWA 1IEVA 3U57A 4DY1A 5HPOA 1Z9AA 1L9WA 3PFRA 1R6WA 3PTQA 4GNVA 3KCLA 3GFXA 2E6FA 1OF6A 3WH6A 4GOAA 1CECA 2GGHA 3JZEA 1QI0A 3NYZA 1OIMA 3UWWA 5JBEA 4PMOA 3MS8A 1JI1A 4S2CA 4W85A 3N15A 1LROA 6PTDA 1ZAJA 2VFFA 5FESA 4BWLC 3LGDA 1PIFA 3WNPA 3V1PA 4QJ1A 1XSKA 3BSHA 3W23A 1UA3A 4N6EA 1FXQA 2J6VA 4B9YA 5A94A 4JYEA 4CN4A 1OGGA 2E3TA 3MKCA 5C7HA 4YCOA 1ZDLA 3WQFA 1JDAA 1C9DA 1EA0A 1TKKA 3KCOA 1E0WA 4XO7A 3K30A 5C0QA 1WQ5A 5F2GA 3ITLA 1UZDA 4NAFA 2B7PA 3GNXA 2E28A 4X9YA 2YCIX 4J2MA 1JFHA 2XVPA 1G7VA 4JOMA 5CQ1A 5A8NA 1P0EA 2H3BA 1XLEA 2R6OA 4Z2LA 3VE7A 2EG8A 3SY1A 4S3FA 2GJLA 2PZ0A 4FX7A 2X0YA 2Y1HA 4FOUA 1HKJA 1I8JA 4G2DA 4TMCA 1TJ0A 3I65A 1YNYA 1CBGA 2NX1A 4XBKA 1AZ2A 3B8VA 3CS2A 2C3DA 1YX1A 2VI0A 3OLDA 3OHMB 2ZUTA 1ELSA 1XD0A 2I5IA 4H9MA 4XKMA 4C6EA 3KLLA 3VGFA 1WXZA 1EJ7L 2QJJA 3BSGA 3RR4A 3DHFA 1GKPA 3OBEA 4H83A 4K7VA 1UWRA 1ZMCA 1G1YA 1TPB1 3LNMA 4HP5A 2NSOA 3MMUA 4YXGA 1HL8A 2FFIA 3N9KA 3DG3A 3EB4A 2WWCA 5CLTA 1V6WA 3BW3A 4ZR8A 3RAOA 3W83A 4Q4OA 3GYCA 1V6UA 5LXEA 1H1YA 1WA3A 1ZJAA 3WJSA 3MUIA 3FJNA 5JQ9A 1RBAA 3PULA 4GUIA 4J3WA 1OX6A 4G1NA 2EQ6A 4DVOA 4IICA 4PL1A 4JN6A 4V15A 4FNPA 1HL9A 3VMOA 1HGYA 1Q3NA 1LJYA 2E40A 3STPA 3HOJA 6REQB 3UZZA 4H4TA 3QLLA 1CLXA 2RDXA 2EJAA 2VR2A 1JJKA 3S6DA 2NVDA 1OFOA 1EJTC 3R5EA 2QCHA 1EHAA 2D24A 4GKLA 1ME8A 4CCCA 5F4XA 1JRCA 2FTYA 3CLWA 2EKGA 4GO8A 4BFAA 3GG1A 3ONCA 3E2SA 3WQVA 3A4WA 4NQ1A 4ADSA 3APGA 1CXFA 1M68A 4LY8A 4IT1A 1DEDA 3P80A 1R2RA 4L1GA 2X16A 4FNQA 2YDRA 2YZRA 5JH2A 1KRCC 4KEZA 5JBFA 1KB3A 1MI3A 4S3KA 1G4TA 3NZPA 1ML1A 3C52A 3UR7A 1U5JA 1LLWA 3ITXA 3WQWA 3FYOA 4OQVA 3VE9A 2GDQA 4LYQA 5GPRA 2Q09A 1KLZA 1EJUC 3L0GA 3P67A 2J24A 5I3FA 4DBEA 2VFHA 2DW6A 1VBHA 3ARQA 2NVAA 1JNEA 5BRBA 4UBPC 3B8UA 4DN1A 1W9UA 3O6YX 4O15A 3LOTA 3J7HA 2VOTA 3RX4A 2YB4A 4C6KA 5DRIA 5FCZA 4O19A 3QH2A 3NQGA 3CNYA 1UKOA 3F2BA 1SYTA 5HINA 1IIGA 3D3FA 4UUIA 4D71A 5T8GA 3HB9A 4RE3A 3DK9A 4WKAA 3LB8A 1V51A 3LGGA 3QV9A 3OBKA 5LYRA 2ZC1A 3W26A 1JG9A 3UR2A 3EBVA 4GMEA 4QS6A 7A3HA 1IQ8A 2V3BA 3A7RA 3L5LA 1J10A 4EPEC 2WOVA 1E70M 3EF6A 3EOEA 1SO3A 3BZJA 1IHIA 1GYMA 3UNTA 5AVHA 4H9TA 5FJTA 3AMLA 1EBHA 3PZGA 3OZYA 5DQPA 1XBXA 8A3HA 3MDWA 2ZDRA 4NT0A 1XRTA 3HURA 2V5BA 1HJWA 4IIGA 3U2EA 2BY2A 4MNLA 1CPUA 1ISVA 3MUCA 3O06A 3VI2A 1YNQA 4H9YA 1FWRA 2PDNA 4UXDA 3W2LA 2VEMA 4W7UA 2Z2AA 1B5TA 1UMLA 1MQRA 3AZSA 2X1RA 2OQLA 4PTVA 2C3CA 3CWNA 3QM3A 5FA5A 1TREA 3M0IA 3GIYA 3SCVA 5I3IA 3W1AA 3UT0A 3UG4A 1L6WA 1NSJA 1MQPA 2EPKX 4B92A 4FXJA 2ACSA 3GTHA 4G1KA 3B0YA 3SW6A 4EMJA 2HSAA 1NHQA 5E6YA 3ISIX 2E1WA 4JIIX 4X0NA 4UMCA 3UA3A 3S83A 3WLJA 2IPJA 4MWAA 3NZRA 3BLOA 3UCDA 2XGIA 1DIEA 2WJZA 3NSXA 3UJSA 2DVUA 4OVXA 1FVPA 4K2SA 2OB3A 4RR4A 2FDMA 3SGGA 4D8ZA 4ZB2A 1JNDA 3C0LA 3KBVA 3EXSA 4GI9A 2GR1A 5DBTA 2CPUA 3ZSSA 1TVNA 2DZVA 1PWLA 3BGAA 2R1PA 2Y8KA 4MLJA 1QNPA 3GW3A 1FO4A 1TX0A 1H7NA 1XUZA 2BXYA 4GYFA 2PWGA 4F3HA 2FGZA 5K9DA 4Z1DA 4JYDA 2Y24A 4DJFC 3EUB3 1FCVA 3GTIA 4W88A 3S5NA 1O94A 1R7AA 3S1GA 3W82A 9CGTA 5DEZA 4QHRA 4GO9A 1DIDA 4I7VA 3GDMA 4RDYA 4XKYA 4PRWA 3CO4A 3FS2A 1V3LA 4LNCA 3FJ4A 3K8LA 1V02E 3EB2A 2W4XA 1PKNA 1GW1A 4DXKA 2FH6A 2VO5A 2D2HA 3DGHA 1KFJA 2VUYA 4A3HA 1OCJA 3TXZA 1TWIA 5ABEA 4UNIA 4QS5A 1O7AA 1XCXA 1QTWA 3ITGA 2PDIA 1Q7ZA 3FDKA 1WZAA 2VDGA 1AD4A 4I5RA 2FTPA 2YYUA 4XD5A 4HSHA 4Y90A 4HMDA 2OWWA 3VA8A 1F3WA 4D8LA 3VYLA 4CD7A 3LLXA 1AH3A 4Y2WA 2ACQA 4CD8A 1XKYA 3OZPA 3VNIA 3P14A 1XP3A 5ABGA 4CD6A 4JIPA 1QI5A 2J27A 1EBGA 4KEUA 2CCRA 4HPHA 2TMDA 3M6YA 1UD3A 5DANA 5EL1A 3QRHA 3G1HA 1VEMA 4GLEA 3KVKA 1J2WA 4MB3A 4A22A 3SCPA 4J40A 1TMLA 3FLUA 4ZO6A 5JIWA 5I3KA 2OX1A 4LXFA 1F8MA 3OC4A 1RR2A 3KE0A 2RUSA 1C29A 2PDUA 1QU4A 3L7RA 3DDMA 1SUXA 1R3YA 3HW2A 3EANA 3VIFA 3SM0A 1GOWA 3MI3A 1P1XA 5XIAA 1YQZA 2Z2BA 2W3ZA 2W55A 4F0KA 4GD0A 3STFA 2Q3RA 4HNLA 1MNZA 2WO5A 4AD3A 4CUCA 1GRTA 3V7PA 1F3TA 2PWVA 3M9YA 4L4MA 4JTEA 1OINA 3CGTA 3WENA 3VD5A 2B0MA 3EX4A 1E3XA 3FHQA 4M3PA 3GUGA 2OMAA 1EBDA 3DYPA 3S2LA 3W07A 4DO6A 3BAWA 4HJWA 2PTXA 1WKDA 3P5ZA 5IRPA 2NZLA 4JXCA 3VNKA 4H1ZA 5D04C 4IM4A 3QZAA 5FJUA 4HIBA 4H7CA 1Q1RA 4FLRA 3W7EA 1I6NA 5BOFA 3RLHA 3QHNA 2WB5A 4H9UA 2YIHA 3VDCA 2JKPA 3ZJKA 3TU9A 4IG2B 3VOCA 1EF2A 3A3XA 1RP9A 2I7GA 3OVRA 1O5QA 4N02A 5MF5A 1JD9A 1MEWA 5IDIA 2V5JA 4GQQA 5F2LA 2E1DA 5E0KA 4H8NA 4IIBA 4MZYA 4I5UA 1SVDA 1KRAC 3AHZA 4HNTA 1JPDX 2ZE3A 4OZOA 4AWUA 3SO7A 1F61A 1BYCA 4S38A 2FB3A 5LSMA 3GR8A 3O07A 2XYLA 2JF6A 2E25A 5EMKA 4OECA 1PKLA 4JDYA 2QJNA 3O16A 4QP0A 2DZPA 3PB2A 5C6MA 1SJBA 1AG1O 4UTMA 1E0VA 1IXPA 2CZ5A 1VCFA 4WEVX 1XCFA 4ZO9A 3H23A 1MXGA 1UG6A 3DIPA 2QCDB 3S2CA 5H8UA 2FH8A 3NQDA 4MUPA 4LFYA 4UFIA 2DP3A 1R3VA 3SY8A 2WCAA 5D8WA 4IG2A 4OV4A 8XIAA 2WQDA 1TPFA 3OLEA 3HG5A 2V3DA 2E4TA 3WMSA 5DN1A 4ES4A 2CLFA 3W38A 5FL1A 5LA0A 3II4A 1RV8A 2J7EA 2O9RA 3H4GA 4IFKA 2WP6A 2DU2A 3NVDA 3W1XA 1UIOA 4GKTA 2GGJA 4R88A 3L2MA 3B0PA 1A47A 3FEQA 2XIIA 4YTSA 1VFTA 1C7SA 4X3ZA 1YDOA 1S2CA 4H4ZA 1GOKA 1O66A 4WSHA 1A5AA 1AOGA 1ONEA 1EJSC 2RJHA 3FGCA 2C16A 1C9WA 4ZFCA 2HWGA 2VX4A 3MQTA 2UZ9A 4K38A 2Y61A 5LHFA 5FF2A 4JEJA 3CQHA 4Q6JA 1GTHA 1ONFA 1RZMA 2V38A 2WNQA 5EBUA 3DKLA 3PG6A 1LWIA 2QAPA 2Z1KA 5AVNA 3ZOAA 4BHYA 4MLRA 3PM6A 4S3AA 1JCTA 1ZCCA 2EKCA 3T40A 4O1AA 5FACA 2AQOA 4UTIA 1CGVA 2QULA 4REQA 3ZXWA 1SPQA 1W5NA 3EWUA 3T8LA 4MDPA 1YQ2A 1QO5A 4LUTA 2X41A 4RK8A 1RVGA 5JCMA 4LCSA 1RH9A 1VFOA 3K4DA 4HD5A 4HPNA 1ISZA 2CU0A 3NGJA 3CQIA 5A5WA 3UXDA 1BVNP 1FRBA 3V0SA 1RY0A 1LVLA 2ZUUA 5E5CA 1DE6A 4L6DA 3VNDA 2OOFA 3UETA 3PNUA 4DI9A 1JUEA 3W37A 2O7QA 3BCFA 2R91A 1N8IA 3TWAA 4IJBA 3L5AA 1NJJA 4PCFA 2VX5A 1CGXA 3ZJ7A 2V6AA 4HA3A 6ENLA 3NQBA 4XZWA 4JNZA 4HNOA 3A24A 5T26A 4MB1A 3WLOA 3VMPA 4C90A 4FIRA 5AYBA 4NXSA 1UKQA 3ORWA 3QF0A 5SWUA 3M0JA 2QCNA 4M19A 4FI4A 4LUTB 5K9CA 5KZ6A 1Y5WA 3ZT5A 1I4NA 5DELA 1E6ZA 3GHTA 1IIHA 4P7OA 3PZNA 3GHRA 3HG3A 5HNUA 1LOQA 3BMWA 3W53A 3CMGA 3T81A 4UC5A 1XR2A 4DYKA 4CVWA 4WCJA 1IWAA 1GRBA 1LQAA 2FMOA 4XB3A 1Y5VA 4NJIA 5LGZA 4BI5A 4KCVA 2WNNA 4QNEA 2R1MA 4Z2IA 3T4WA 1V0KA 3ZLHA 3AXXA 4E3TA 5AYZA 3CT7A 3B8IA 2BV9A 2JBMA 1KM6A 1XINA 1O4UA 3VOFA 3N2XA 2ASHA 4K37A 2FKPA 2Z7KA 1K8CA 5FF3A 2PRLA 2CKSA 4LB4A 5CSSA 4R5EA 5ECVA 1CT5A 1R3RA 3MBDA 1VFSA 2Z25A 1OZMA 2DZXA 4YYFA 2CZVA 2PP3A 1J0IA 2W79A 2ZRZA 5AC7A 4HOZA 1G4PA 3GQYA 4IMGA 3R13A 4UQAA 4FOKA 2HZGA 4IP4A 3C8FA 2DJXA 1YPXA 1B3ZA 1TWZA 1ITCA 4W5UA 2Z2UA 3OIHA 4EM4A 4UOQA 2INFA 1BVZA 4H4UA 3ABXA 1ZUAX 3T44A 3CUZA 3DKJA 5FAJA 4AX7A 5D4YA 1K77A 2QDGA 1EPXA 1KM2A 4G7EA 3KZSA 2P8BA 2QLYA 2TODA 3QMTA 3AZTA 4FNRA 3EKGA 3JS3A 1HIZA 2AGKA 2HS6A 4YTUA 1AL8A 2ZKMX 1VCGA 2Y8UA 3LPOA 3RF9A 1JF6A 1HP5A 3KS5A 2FJKA 3LV5A 2QS8A 2JQXA 4UFLA 2IPFA 3ICJA 1IT7A 2GQ3A 1UPPA 2GR2A 2Y8VA 5KSWA 4N9DA 5BRPA 1PV8A 4ADWA 3ARWA 3V5OA 4U3CA 1WCGA 4H4IA 3DFTA 1A0DA 4O52A 1FWGC 3GD3A 4Y9NA 1M9HA 1JQVA 2NUYA 3AUOA 3BO9A 4JN8A 4NRSA 3ARUA 4WY0F 2UY5A 2OKTA 3P82A 1WUEA 3K1GA 4LYPA 1UR8A 3R4IA 2WPFA 4O1CA 2QGYA 3DBPA 2GSHA 3HFTA 4NF7A 3RNDA 1A49A 4CQCA 4MYAA 4X22A 1HJQA 3GS6A 1E6SM 4OFCA 1N82A 3B9EA 4C6LA 4GXMA 4PFMA 3BURA 4XAGA 3MSRA 1QBAA 1YE4A 2P76A 2ACRA 1TJPA 3LERA 4MDOA 2D0GA 3ZLGA 1GJPA 3AOFA 4IJCA 3RLUA 4AZCA 2IKJA 5LNUA 5MKGB 3M44A 4UNKA 4C6NA 3I4KA 4Q8NA 1DWAM 3W7DA 1MEIA 2GDUA 4WDXA 2WQPA 4GK8A 5JCNA 4W5ZA 4JKLA 4H8UA 1S2TA 2VZSA 1HKIA 1JFXA 3RCMA 3GU2A 4AIOA 1YADA 5HWNA 1IGSA 5REQB 1MO0A 2DZTA 5KVHA 3ITYA 1ME7A 4OBSA 2YCJA 3VCCA 1P43A 4LBRA 3TA6A 2RH9A 1IGWA 4IMDA 3LGEA 2ISWA 3EAOA 3TWBA 3LHZA 2DSKA 4DZ5A 2PS2A 8TIMA 1BAGA 2Y7EA 1BVWA 1RD5A 4HU4A 4CKQA 3CT2A 2FPVA 3LM3A 3WBXA 2WZEA 3B97A 3H12A 2HJPA 2Q02A 3OLIA 3POCA 4JTKA 3V35A 4LIIA 3IIPA 1YDYA 1C90A 4GI4A 1TJ2A 3ZWTA 1LBLA 3FKRA 5FEZA 3TDFA 2DT2A 5A3HA 4LEFA 3S2NA 4X63A 3GVGA 3VIJA 1REQB 2ZRVA 1Q6DA 3S1XA 4ZENA 2GQWA 4W87A 4IXXA 3O6AA 4H9ZA 3NQAA 1DQUA 1JI2A 2VC5A 3KVMA 4N4QA 2DT1A 2X8GA 1DL3A 3C6CA 2CETA 2DIEA 3TW7A 1W1PA 1GQNA 4AFYA 2PB1A 3QPEA 2WC7A 3KX6A 3NL3A 2BMBA 3HV8A 2V9DA 1U1UA 2Q3OA 3LI0A 4KW2A 4H04A 4Q22A 1L6YA 5CGTA 1FEBA 2R8WA 3QVQA 2GR3A 4MTVA 1RCQA 3CIWA 4KWUA 3UR8A 1K7XA 4CQAA 1JPIA 1VF8A 3I3BA 3KFTA 4Y9PA 2VX7A 1PTGA 3I68A 1EJXC 2VCBA 4QE4A 3V0TA 1G69A 3DENA 1EWEA 2VEFA 5CZJA 4KCWA 4MWAC 1TV7A 1EX5A 2RFGA 3WFAA 4ERAA 1WOAA 2NV1A 4JY9A 4F2BA 2E5AA 2QIIA 4PMXA 1A5KC 4DX3A 2X99A 1JZ6A 2G4FA 5LA2A 1XQKA 2VTFA 1VR6A 3GNNA 3DXIA 1C8QA 4DLMA 1LRNA 2GWNA 1UH4A 4HZMA 2XM1A 2WPCA 1A5NC 2W9MA 3M0XA 1YYAA 5FJRA 2CBIA 1XGZA 4LAKA 3IACA 5DCDA 3O2LA 1UUQA 2ZXBA 4MZ8A 4DEFA 1TA3B 3ITCA 3RGTA 1Q6EA 3E0IA 4LJ3A 3BLIA 4L9XA 1ZY9A 4KIEA 3OW1A 4FEZA 1LRTA 3CHEA 3AIRA 4HOWA 4FHAA 2AGTA 1O5KA 6CGTA 5D2YA 5M2FX 1POKA 2QJHA 2ZBTA 2IXVA 4GGBA 5CG0A 7CGTA 2QCLA 5L9FA 4XZBA 1OYAA 2BXVA 3MSDA 3LCFA 1Q65A 1PO9A 4K7YA 3BL3A 2J9XA 2OZ0A 1GJWA 3DGRA 1EJVC 3BK0A 4Q8TA 3WF4A 3AQUA 5KZDA 1E4NA 2A7PA 1ECEA 3CHCA 5D30A 1BWCA 4LUJA 2YB1A 1JCLA 1DV7A 5CPLA 3KOYA 1XIHA 4EKJA 3TOPA 4GI6A 4AHOA 2PDJA 3ZR4A 2CITA 1H7RA 5LIYX 3FEMA 3VFCA 3DFHA 3WF3A 1ECQA 2IXUA 3LK6A 3GTFA 3G1SA 4JTJA 4XBJA 5HAOA 3AHVA 3ZO9A 4EAMA 3CPUA 2WNZA 4O0QA 3R12A 3K46A 1W3JA 4ZSTA 3LZ5A 1J6OA 4Q4QA 3G77A 3IVUA 4YTTA 3N9RA 4IIDA 4RE0A 1KKOA 3KL0A 3W24A 2AOSA 3HGSA 1VFHA 1RALA 4L6HA 2XZ9A 1CXLA 2IKGA 3DUGA 3WLIA 4GVHA 5C2XA 1JAEA 2PDYA 3S6TA 1I60A 1L2QA 3IV3A 3EWCA 1KXVA 3S1UA 5A8MA 3O3RA 4US6A 4H7VA 4K36A 1DWJM 4HKPA 3MANA 4A35A 3L0KA 3T08A 1ZL1A 4M82A 2CWNA 1JXJA 4V1YA 5G1TA 2QPUA 4QX4A 5CCZA 3BW4A 3DFPA 1E55A 3O0HA 4QBXA 1X7IA 4R9XA 4FK9A 1H49A 3GBEA 1EJWC 4G6CA 1HKWA 5CG7A 5E1QA 1YIXA 2NX9A 2BCPA 1SJDA 4KETA 3P8JA 1N62C 2D0FA 5JH1A 3LLFA 2WOIA 2XZ7A 4H8VA 4R3UA 1QXLA 1R86A 1H7OA 3DBNA 2G3IA 1CB7B 5KTLA 4HMCA 2Z0IA 3WK0A 3W22A 5KEZA 1V7AA 3CZKA 1BZLA 4PA8A 4S3EA 3WK1A 3GXFA 4NZ5A 4MVAA 1D7KA 3W7NA 3UR5A 3W7IA 2REQA 3E0LA 4DWSC 4LC8A 4XVDA 3IJ8A 4I6VA 4UTJA 4K6AA 2WMFA 4H6EA 3EZ4A 3JUGA 3T2PA 2WPEA 5AFDA 2VJXA 1M01A 4TX9A 3DK8A 1XCWA 4X61A 1BKHA 1UBPC 3NVVB 2FVMA 1ZSXA 4DZHA 6ALDA 1N2VA 1B54A 3M0KA 4XD3A 1RXOB 2OU4A 1ZMDA 1US2A 3LHVA 4W84A 2XWEA 3M07A 4EXAA 4PTXA 1FWJC 1QW8A 3CB3A 5F1UA 4PBEA 3B9AA 5C2GA 1KTBA 4G9PA 2C1IA 2EF9A 4KIRA 1VLWA 1UASA 1T8XA 4E2BA 4F79A 3XINA 3M1ZA 1XIDA 1JVNA 4GFSA 2Q8XA 4O1FA 2G37A 3T42A 1EKOA 3NQEA 4MADA 2J7DA 4QROA 3CQ0A 4WGHA 3QGKC 2ZZBA 5FS6A 6XIMA 5A95A 3DFOA 1J0ZA 3QGVA 1FWHC 4AZIA 3WKZA 2PF8A 3G1YA 1VFFA 3LRMA 3NNTA 4KS0A 3WNNA 1ZK7A 1OC6A 4UWMA 3DFQA 4JFUA 2WVVB 1UYQA 3WQPA 4DUOA 3ABZA 4RZ6A 1GVRA 1FX6A 4IFRA 3SCQA 3FYYA 3M0HA 4B90A 3TN6A 2CEQA 3EWWA 2WHMA 4D1IA 3VDBA 4HYVA 4NX0A 3VIMA 1EL3A 1EGVA 1W9PA 2JEQA 4YWSA 4JTGA 3DX5A 4GFIA 3U8GA 1E6RA 2YCLA 4REQB 5IDZA 1C8YA 3T0DA 3QEZA 4P7LA 2X7VA 1KFKA 2E5BA 4F9JA 1TWWA 5LIXX 3K13A 1NY1A 2GVYA 1CIUA 2HQAA 2YQUA 3ZT6A 2DW7A 1E9IA 3NDZA 1TV2A 2H9AB 4O1BA 4JTDA 3UEQA 2DFAA 3TE9A 3KHDA 3R25A 1MZRA 3OYZA 1PCWA 5TD4A 3FSTA 2NLIA 1NIUA 4TVDA 3O15A 1E9LA 3T7VA 4JCLA 2HV5A 3DGBA 4L9YA 4WD0A 3MO4A 4QJ3B 3CZGA 3SR6B 3KUMA 3AFBA 1ODUA 3R6IA 4QIUA 1ZRQA 1EB3A 3B0VC 2WVVA 2F9RA 2WW5A 1Q66A 5CAKA 4ZGYA 1GVYA 2PAJA 3A21A 3AI0A 2CLOA 3WMBA 1QATA 4HK5A 1M5WA 3CYVA 1JIBA 3N6HA 1IZKA 4RNJA 4E2OA 4ZQNA 1XIJA 3CHDA 3EMCA 4Y96A 2CZDA 1XLHA 1FTXA 3S2JA 2WMIB 3OGVA 1E0UA 2RJGA 2QXWA 4U31A 4AY7A 1S5NA 3CO8A 1J18A 4TVWA 1S46A 3BWWA 1TTQA 1W1VA 1HFBA 3TROA 2X09A 1ITQA 1BTMA 5H2ZA 1DXEA 2J62A 2J74A 3M46A 1W56A 2V3FA 1NQ6A 1FH9A 2YSWA 3WD3A 4LB3A 1QHZA 4U5IA 3FX4A 1KGXA 1R3TA 1BWLA 3FA3A 4GJIA 3WG6A 4YS1A 1Q4NX 4DQWA 1R87A 5HK4A 1Z6KA 4RE4A 4E0CA 3QFAA 5E0CA 4GUFA 1HP4A 2J47A 3PZ9A 2PLKA 4YPJA 1E4MM 3ZFHA 2E5CA 1XWYA 2WSRA 3UZJA 1GUVA 3R07C 2XIOA 3OG2A 3D0CA 4KRTA 1FKXA 3IJLA 4LUSA 3W9ZA 3B9NA 3TYZA 4F0RA 4NY2A 2YA1A 1V97A 3DYOA 3W01A 4ZBCA 1GZJA 2PBOA 1T41A 2C18A 4UR9A 4JTSA 5DY2A 1PX4A 3IRDA 1DP0A 2XIMA 1US3A 1RQBA 1YDNA 4XUYA 1XRSA 1OY0A 5FJIA 4D72A 5G1MA 4J3TA 5A2AA 3SUSA 2YXOA 2R1KA 3BAYA 3T0TA 1J79A 4NG3A 2F2KA 3AIBA 1AZ1A 2XGZA 2YDAA 5ABTA 3GDBA 3TSMA 3NL2A 2V0TA 1QHPA 1O68A 2IQDA 2CZEA 3DERA 3ZVHB 1GV4A 1FCBA 2JIWA 5A6BD 4E38A 4EWND 1O12A 4GWEA 3RPDA 4HZ7A 3DCPA 3W6YA 3M0YA 3W87A 1CW2A 1O60A 3L68A 1PEZA 4M6QA 5EYWA 2EBNA 1TV5A 3SCTA 1XHCA 1B3VA 1E15A 1XDJA 3KP1A 4OU1A 4KPLA 3CWHA 4AEFA 3P61A 3TFCA 3EWYA 3UESA 1RHCA 3BXWA 3QZEA 4CEXC 2BY0A 1OK6A 3C86A 5I09A 4UFKA 2FGLA 3NVYB 1K8ZA 5A6BA 4WOZA 1G7UA 2D73A 4NZJA 4QM1A 7TIMA 1NPXA 3GYEA 3WNLA 2QDHA 1KCKA 4QQ3A 1KA9F 2ZZ4A 3B8WA 4V28A 4WJXA 1SFSA 4AZ7A 5H8PA 1T6MA 3RITA 2ZOXA 1HL2A 4NUWA 1THFD 2QNEA 3ZVHA 4DWSB 2H90A 3K2GA 5I23A 1U83A 3PN8A 2BP1A 1FFUC 3G3MA 3EDEA 2POTA 3W00A 4MZ1A 1VEPA 3IJIA 2BB0A 3AMZA 2PWEA 5FF0A 1XUUA 5M5DA 1VRDA 1QAPA 3F5KA 3THQA 2VC9A 4QSHA 2RHGA 4LQ1A 2NVCA 3DFNA 1VAHA 7PTDA 4HA1A 5TQLA 2YW4A 2EQDA 2E9LA 3G6MA 3CM4A 2P10A 3BGGA 3GDTA 3N6JA 4QE1A 4PCSA 1N5XA 4GUGA 1K4GA 3W1TA 5EA9A 1GKRA 3H2NA 2GFTA 3E49A 4CNSA 1SFLA 2W6RA 3N34A 5F7UA 3TZFA 2HPIA 1LT8A 1R3WA 1NDVA 2O56A 2PD5A 1TB3A 1PDYA 3SN1A 3ARRA 1A5MC 1N5WC 3LDVA 4JTRA 1UC5A 1SO5A 4YTRA 3GNRA 1LBMA 1TVPA 2J88A 1NFBA 4AU0A 3CV2A 4QDMA 3H4KA 1WXYA 1JDCA 2Y5JA 2Y7GA 2H6RA 4KGLA 4IIFA 4J27A 5E09A 4AD5A 3WMCA 1EYWA 3GXMA 3W27A 1Q6CA 4O17A 4RZ5A 3ABQA 3P6LA 3VZZA 1TR9A 4O57A 3OP2A 1EP3A 3EMQA 1JGIA 4O8RA 3NZ1A 3RX3A 3AXKA 2A8XA 4IQEA 1F8WA 3G5EA 1N7KA 3UU0A 2IQTA 2CFFA 4O12A 1AJ0A 3TQPA 2FPTA 1R85A 2GK1B 4IWWA 1OC5A 2X1IA 3LHYA 5I07A 4DRSA 4O1DA 2GUBA 4UR8A 1SU5A 3PTDA 4MKSA 4IPLA 4FZIA 1W8GA 4TTUA 1XH1A 3TYAA 1TO3A 4UCFA 4L56A 4TO8A 2AMXA 4GQ0A 4B2DA 1TMHA 2PP0A 3QQ0A 1CCWB 4GY0A 3WQGA 1TWSA 4Q33A 4YTQA 2VEIA 4IUGA 4GIRA 4OGZA 2R1LA 4D2JA 2QDEA 4MSSA 1EZ2A 5A69A 4BF9A 4H50A 2GQAA 1UD5A 1KXHA 2AKZA 4OV9A 4ZO8A 1KGWA 1H3GA 3THCA 4J3ZA 3L23A 4LS2A 1L8PA 1GQKA 2WCGA 3U2OA 2WP5A 1G67A 1L6GA 1B4EA 1X8CA 2ALDA 2XWDA 4FR6A 3HJEA 4C6BA 3C4UA 5JIPA 4O0KA 2OXNA 2XDFA 3EAUA 4UIOA 1EFZA 3QFBA 1W3IA 1XIBA 3BLEA 3W7LA 1S2UA 4L1XA 2DIKA 3HPXA 1H2JA 1QNOA 4WXYA 4MY1A 1V3KA 1J6PA 1ZJBA 2D0HA 1XIIA 1IEIA 4R85A 3LADA 3LCXA 4O28A 2GJXB 2E5DA 2GL5A 1G4EA 2ZDSA 1QW7A 1DJWA 2ZXAA 3G1RA 3H7VA 4S2BA 4WDTA 4Q8PA 3ARYA 1RP8A 3W73A 2CERA 3M7SA 3WLRA 1XRFA 4PULA 4JZ5A 2C8NA 2IW0A 2BS9A 1BRLA 1OX4B 1S1PA 4O8AA 3LCGA 3HA1A 4YL2A 3IIVA 2X0SA 1XG4A 2MNRA 1AQFA 1FOBA 2WBGA 1AW1A 2EPMX 1TCDA 2RKXA 4CN1A 3WD2A 4E8DA 1S1RA 2VFGA 3FA5A 4C6QA 4HMNA 3WNMA 4NZ3A 5HWJA 1KCLA 3UGRA 3OVGA 1HF6A 3I3DA 4M1RA 3KHJA 4XZHA 2HNHA 1UCWA 3VIHA 2ZWYA 4NL1A 2QIWA 2GUYA 5J5DA 1EIXA 2OR2A 3TFXA 3VPLA 1UUOA 1T5AA 2HE8A 2NV9A 1QI3A 2WSYA 1R7OA 1Z69A 4CQDA 3UWYA 3TSDA 1V3MA 1NDYA 4NIRA 1AQ0A 1TPH1 4HA4A 2G97A 1G5AA 3FXYA 1PAMA 1NWRA 3U4FA 4MAVA 3WQCA 1YW1A 2BHUA 2VURA 2B7OA 4E4PA 1KTCA 4PTDA 2JE8A 2QUVA 4XBSA 4IL0A 1GOQA 3QY8A 2OOGA 3LBCA 4AC7C 3GB6A 2QQ6A 2Z00A 4IGSA 1P48A 2C13A 4Q8UA 2YCEA 1SW0A 4QLLA 4A3UA 3ZJ6A 5ER0A 4DWSD 2XSBA 4QG6A 2PFHA 5F4SA 4DB7A 2C14A 3MYPA 2XJ7A 3ONBA 2HISA 1WDWA 3WQDA 3WN6A 4AISA 1HN1A 1ZP3A 3AMKA 3N18A 3SQLA 2VENA 1PX3A 3SSJA 1WX0A 2NW0A 3WIJA 4ORMA 5D2VA 1ISYA 3A22A 3V16A 4Q4MA 2YLAA 1XYCA 4E6MA 2WCSA 1ODZA 3QW3A 2ZADA 5TR3A 1W37A 2VR5A 3HIJA 1XLCA 3UG5A 5BRQA 3S9YA 3AIQA 1Q6QA 3G1FA 4CEUC 4EMWA 1QK0A 3CIVA 4H4YA 4KQNA 1FHDA 1JUKA 2Y63A 3H8AA 1U33A 5CJ5A 1E1FA 2V2CA 3TEVA 3OZOA 2DQWA 3ELFA 1D3HA 2HK1A 1V79A 3EWZA 3MW7A 2J7CA 4A8NA 1J0YA 5U25A 3FXGA 1AL7A 2NT0A 4D9PA 2C7FA 3N2OA 3WF0A 4Y9OA 5F2IA 3DI1A 1E4IA 3CAKA 2WSPA 4AEEA 3QYQA 1W6TA 4XD6A 4EVZA 4XX6A 4QGCA 4AD2A 4XUGA 4FB7A 2WKLA 3WF2A 1C92A 3THAA 4C5ZA 1XV8A 3VOGA 5E93A 4FF7A 4UZSA 3RPMA 4AUBA 2OWXA 4BEQA 3TTQA 1DKWA 3E38A 3WZ0E 4NILA 5FOOA 2H3DA 1E5JA 5CC7A 3C5QA 1YHTA 4GC3A 5C7VA 1GGOA 3BANA 2ABAA 2F5ZA 1I75A 3C0QA 3WJYA 3EDDA 2E0PA 2JEPA 5I24A 3IJ6A 2QMJA 3ARSA 1F5ZA 1YBQA 3WSUA 3RG6A 1VPXA 3BTNA 5DCBA 3WDPP 4LGXA 4DBWA 1F4HA 4PTWA 1TYPA 3C2RA 1JCNA 1OFPA 2JF7A 1IZJA 1XG3A 5C2CA 1JPHA 1G0CA 4JY8A 2FYMA 1FEAA 1IWBA 4PEEA 4PR4A 1ISXA 1T8QA 3HMCA 3T05A 1I1WA 1YEYA 5FAGA 3LLDA 3T8QA 2E09A 3USZA 4BKNA 3LPFA 4LWWA 1JOAA 3GXDA 4DHGA 1AQMA 2JKAA 3AWOA 3NAVA 3SCOA 3HN3A 4MMWA 5I3HA 1P5BA 1NHSA 1I0BA 4FPSA 1XH2A 2JK6A 1XLJA 4LYRA 4P8WA 4Q8MA 5M03A 4U10A 4XKYB 1BF2A 1K02A 4MFDA 1ITUA 3NVTA 2X2YA 3WMLA 1QFEA 1WKYA 5D2TA 3CIXA 5LNVA 3HZ3A 1VCVA 5CZTA 3MA8A 4XSMA 3VOIA 3KBJA 2G96A 3OHIA 1R2SA 3B4UA 1FP8A 4EWJA 3DFSA 3PZOA 2OX4A 2PD9A 3IC9A 2I9UA 1Q8AA 3H70A 3SRFA 3B05A 2IMRA 3QPYA 4OJYA 2WC4A 5ABFB 3VNZA 3W7KA 1V03A 1MRQA 4AF0A 1LL6A 1E1CA 3GNOA 4E5TA 3N2MA 1OFEA 4NAFB 3V3WA 5A8GA 4JKKA 4DM1A 2C0HA 1P6BA 4NI3A 3KS6A 2ZRUA 4L9ZA 4H4VA 3FKKA 3TOYA 4QQUA 3KL5A 1XLIA 1GKQA 3F4VA 3EX2A 1M65A 1DYSA 4S3DA 1ZENA 4GPNA 1FWTA 2OLAA 1HJSA 1ZQ5A 3IGSA 3GH7A 2WZMA 3I6EA 3LBOA 4I5XA 1M41A 2DSVA 2PDGA 4WRHA 1SGJA 4GI8A 4IP5A 2OT0A 1FHLA 3PWAA 1NWTA 4FNSA 1US0A 4FA3A 4C7FA 4DBSA 1V7YA 5CAHA 4UQEA 3RIKA 1GVQA 3QKEA 2PSNA 4AY8A 2AAQA 3WH5A 1VLIA 3C0SA 3BAKA 3VKDA 3UNDA 3UPBA 4AIUA 1K6AA 3KBSA 4QG8A 2RGLA 3RO8A 5G2IA 3RRXA 2WM0A 1R46A 1U5HA 1AK5A 1JZ8A 4M6PA 1XIMA 3T4CA 2ZX7A 4B3LA 1M7PA 2QJMA 5A6LA 4U28A 4GVGA 2AL1A 4I8DA 5LIUX 3G6LA 5EFFA 3WH9A 2J13A 1E4LA 1DXLA 2ZXDA 4D6EA 1BSLA 3IV8A 1DE5A 3JRKA 4MNKA 3N1AA 3PHAA 2CXEA 2NLYA 2PCEA 5K3VA 4MGGA 4AZ6A 3MKKA 1F74A 5AHEA 3TP4A 2WAGA 1FH8A 2NXIA 3W85A 1NWUA 2FZBA 4FDCB 1ZLPA 2QW5A 3SY5A 3VM7A 2CNCA 2OSXA 2JIEA 3WCZA 3LZ3A 3YPIA 1VBJA 2GVEA 5D32A 3VKJA 4KH2A 1W54A 4HPXA 5A6SA 1VHCA 4K3ZA 2F6KA 1RSCA 4Z2JA 4KFPA 2PWHA 3UVIA 1OFRA 1AW2A 2J78A 2D22A 4O11A 3LA4A 4UQDA 4I9AA 4L6OA 1SMAA 3T0AA 5HJLA 5FF4A 1BQGA 1SR9A 1JUBA 1W2PA 2PCQA 3MO7A 1X6UA 1UD6A 4WUIA 3SCNA 2VRJA 5H1WA 3BZGA 4MIMA 4EF8A 3HG2A 2GR0A 2VFIA 5TNVA 1M53A 3EKLA 1QNRA 3E02A 1GREA 4L7ZA 4RW5A 1KRMA 3BG9A 3PPHA 2P3ZA 5AN7A 2VCCA 4LUSB 3II1A 3NUKA 3SUVA 3QC0A 4PBFA 2DZAA 4PSPA 3LCIA 4IGHA 3AJXA 4B16A 4ZFMA 2WLZA 2GGEA 1UWQA 1HW6A 3M43A 4ZQOA 3BQ6A 2QUTA 3VFLA 1V6VA 4ENLA 2PDPA 1HJUA 2ZYFA 4FX8A 1CXEA 5D2WA 5I3JA 3SIMA 1EGMA 4AZGA 2BOGX 4HB7A 1CLKA 4JICA 1DTUA 1MUWA 3G2GA 3ARVA 1EEPA 4QAWA 1DPMA 3FFSA 4FNTA 3FCPA 2B4GA 2Z1VA 3I7QA 3EWBX 4MKVA 1BPLB 1OQFA 2HCVA 8RUCA 2Y5SA 5JVLA 2Z6IA 1R8LA 3R8GA 2CBUA 1T40A 2R9RA 3AS3A 1I2OA 2HS8A 2FZDA 4W9TA 5I06A 1JYXA 2G0WA 4R27A 2GGGA 4JX4A 4QSFA 3HGJA 1OM0A 4F0SA 4AMAA 3N2CA 1JZ4A 2XSXA 2YFOA 3NQMA 1DTNA 1MWOA 5DXYA 4DPPA 2DY3A 4EK7A 1IR1A 3WD1A 4A3QA 5I00A 4RX0A 1TQXA 2BSLA 2DH2A 2CW6A 1BLIA 3A5FA 3QR0A 3WFZA 4NX5A 4IGNA 3DECA 3UWUA 1KC7A 5FEPA 3HU7A 1Q45A 4RLIA 3SCUA 2GPTA 2OSWA 3JW7A 4UZUA 1RJQA 1UR1A 3SR7A 2XFYA 1BHGA 1XISA 4YU1A 3CTLA 3NQ6A 3PSWA 3B0UX 2EQ8A 4M24A 2TPSA 1OJTA 1ADSA 4UOJA 2J9ZA 3CHFA 1VHNA 1VYSX 3RN6A 1WAUA 4LS1A 1IF2A 1TPDA 3HGOA 4MY8A 1LWJA 4B4HA 3VABA 2ALRA 1I9CB 3QPZA 2BXZA 7ENLA 1OCQA 2PMQA