2NQLA

Crystal structure of a member of the enolase superfamily from agrobacterium tumefaciens
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
388
structure length
388
Chain Sequence
MNSPIATVEVFTLTQPRKVPYLGALREGEVVNPNGYIVRKGNRTVYPTFDRSVLVRMTTEAGTVGWGETYGIVAPGAVAALINDLLAGFVIGRDASDPSAVYDDLYDMMRVRGYTGGFYVDALAALDIALWDIAGQEAGKSIRDLLGGGVDSFPAYVSGLPERTLKARGELAKYWQDRGFNAFKFATPVADDGPAAEIANLRQVLGPQAKIAADMHWNQTPERALELIAEMQPFDPWFAEAPVWTEDIAGLEKVSKNTDVPIAVGEEWRTHWDMRARIERCRIAIVQPEMGHKGITNFIRIGALAAEHGIDVIPHATVGAGIFLAASLQASSTLSMLKGHEFQHSIFEPNRRLLDGDMDCREGRYHLPSGPGLGVRPSEAALGLIERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isomerase/lactonizing enzyme
publication title Crystal Structure of Enolase from Agrobacterium Tumefaciens C58
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 133
structure length 388
sequence length 388
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2nqlA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2nqlA01
4JN7A 2GGIA 3UJRA 3ES7A 1R6WA 1MRAA 1EC9A 4IP5A 1BQGA 2AL2A 4Z17A 3UJFA 3N6HA 1FHVA 4IP4A 3MZNA 4HYRA 1ECQA 1JCTA 3OP2A 3NXLA 4K1WA 2GGEA 2PTWA 3TCSA 6ENLA 3QN3A 3VCCA 3N4FA 3BOXA 2OG9A 3UGVA 2ZADA 3D46A 2O56A 3ZVHA 4A3RA 1SJDA 4GMEA 3SN4A 3VC6A 4M6UA 1P48A 3FXGA 3MKCA 2GGGA 1F9CA 4MMWA 2CHRA 3SN0A 3MUCA 4IT1A 3ES8A 2QGYA 4ROPA 7ENLA 3DIPA 3EEZA 1SJCA 3Q45A 4KT2A 3QKEA 1JPDX 1EBGA 2PTZA 2PCEA 4KEMA 3ENLA 3QPEA 3QLDA 3CT2A 3P0WA 1E9IA 3IJLA 3FYYA 3MQTA 4ZCWA 1SJAA 3EKGA 3IJIA 3DESA 2XH4A 2MNRA 4J3ZA 4X2PA 3V5FA 3R10A 1OEPA 3H70A 2ZC8A 3UJSA 3VA8A 5J04A 3VCNA 3DFYA 3R25A 3D47A 2XGZA 3FJ4A 1KCZA 3RO6A 4YWSA 3VC5A 4IL0A 3UCDA 3TJIA 4H83A 3I6TA 5ENLA 2XH7A 3OPSA 2PSNA 2XH0A 4ENLA 2MUCA 3DERA 2PU0A 4M0XA 2OQYA 4H2HA 3DFHA 3DG7A 3BSMA 3QTPA 5BOEA 4KWSA 4J1OA 3MY9A 1IYXA 1PDZA 3R1ZA 2OLAA 2PTYA 1R0MA 3PFRA 4Z1YA 3N6JA 2GSHA 1DTNA 1ELSA 3RRAA 1TE6A 3I4KA 3DGBA 3GD6A 4IHCA 3ZLGA 2PTXA 2P3ZA 1MNSA 3OZMA 4E5TA 3GO2A 3SJNA 3RGTA 1RVKA 3HPFA 4MKSA 3CB3A 1XS2A 4GISA 1JDFA 4K8GA 5IDZA 4IZGA 1NU5A 1FHUA 3THUA 4JN8A 3ZVIA 3BJSA 2OFJA 4GYPA 2PS2A 2HXTA 2GGJA 1EC8A 1PDYA 4HCLA 3PWGA 3TQPA 4G7FA 3RR1A 2AKZA 3KUMA 2PPGA 2PP0A 1KD0A 1L8PA 3UXLA 3UCCA 1EBHA 1YEYA 3IJQA 3FVDA 4E4UA 5EU9A 3DDMA 2OQHA 4E4FA 3SQSA 2PGEA 3FCPA 2QJMA 3B97A 2HZGA 2OPJA 2FKPA 2FYMA 4DHGA 4HN8A 1ONEA 1BKHA 4F4RA 3U4FA 3UJ2A 2QVHA 1MDRA 3VFCA 3CK5A 4HPNA 3CAWA 2OZ3A 4DX3A 2HXUA 3OW1A 1SJBA 3T8QA 2DW6A 3GY1A 3R0UA 2HNEA 1TKKA 1XPYA 3ZLHA 4EWJA 3TWAA 3S5SA 3NO1A 4HCHA 3VDGA 3P93A 1NELA 3OZYA 2AL2B 2PP3A 2QJJA 2QQ6A 2P0IA 4FI4A 2XH2A 3Q4DA 3N4EA 4DXKA 2OKTA 4FP1A 5FJRA 3STPA 3PWIA 2PU1A 2PP1A 3IK4A 4A35A 3TJ4A 1MUCA 2ONEA 2PMQA 4HNLA 5FJTA 1KKOA 2GGHA 3MWCA 2OZ8A 3NZGA 5FJPA 3ZVHB 1KKRA 4HCDA 4A6GA 3MSYA 4GIRA 4H1ZA 3H8AA 3UJEA 3JZUA 2PGWA 3GC2A 4GFIA 3V3WA 2OO6A 3T9PA 1MDLA 3SN1A 2GL5A 3S47A 3DEQA 2OVLA 2QDEA 3PK7A 1JPMA 4G8TA 4HNCA 2AKMA 4DN1A 3TOYA 3TWBA 3V5CA 1W6TA 4DWDA 2POZA 4GGHA 5BOFA 3H7VA 4E6MA 2PA6A 2P8CA 3CYJA 3H12A 2PODA 3SSZA 3TW9A 2QJNA 3ZLFA 1EC7A 3I6EA 4IL2A 2AL1A 3R0KA 5FJOA 4H19A 2QDDA 1P43A 3T4WA 3JVAA 4GGBA 5FJUA 2OX4A 3DG3A 1WUFA 4JHMA 3P3BA 2NQLA 4E8GA 3CXOA 1TZZA 3JW7A 2I5QA 4KPLA 2GDQA 4K2SA 4ZA0A 2DW7A 4DYEA 3OTRA 2OZTA 3K1GA 3T6CA 3RITA 3UXKA 2RDXA 4GYPC 3NFUA 1WUEA 2P8BA 3V4BA 4MGGA 3SBFA 2XSXA 3TTEA 3U9IA 2P88A 3DG6A 3R11A 3RCYA 3FV9A
chains in the Genus database with same CATH superfamily
4EQSA 3GD3A 4LAKA 5H6HA 3MA8A 3Q65A 4RDVA 1FWRA 3NUKA 2WPBA 5K9DA 3R79A 1EB3A 4OGZA 1AW1A 1KLZA 4B5SA 4V33A 1HKIA 4GX9A 4NZ4A 5LIYX 6ALDA 3G22A 4PTXA 3UD6A 3LRKA 5G4EA 1KRMA 2BDQA 1SW3A 1QOXA 5JBDA 5ABFB 2FZ8A 4PODA 1YDVA 1H7WA 4QAWA 3BSHA 3UGVA 3B8VA 3W2LA 4Z08A 2Y5SA 4XISA 1BGAA 4BJHA 1CLVA 4C6CA 1VCGA 3RM9A 3R8GA 3CV6A 4AU0A 2XHYA 4US5D 4QSHA 1K4GA 1LL7A 1TO3A 3C2YA 1IXNA 4FLRA 4UMCA 3FGCB 1FWAC 5CGTA 5ECUA 3NZ1A 1XC4A 3ELFA 1F3TA 4MNMA 5RUBA 1AK5A 4E2BA 3F03K 4KGJA 2JF7A 5LNVA 3C0SA 3LTYA 3CT2A 4OKDA 4ACZA 3L5LA 3CGDA 3BV4A 2X1UA 2QCGA 2O4MA 4LXFA 5TIMA 2XH4A 1KBJA 3ANUA 1SMDA 3E74A 4JTGA 2J7HA 1EJUC 2NT0A 1VR6A 2J88A 2W61A 4O10A 3HN3A 2BLEA 2NX3A 3UJSA 3WLKX 1ZRQA 4XVDA 1YDYA 3VCNA 4LAUA 1IZJA 3O6CA 4KRTA 1OC5A 1G6CA 2Z1BA 3N2TA 4H6QA 1GQKA 3SI9A 1R87A 5D02A 3RPDA 1GOMA 2YCJA 4FNQA 4ENLA 5JCKA 2W3ZA 4B91A 1ZAIA 2A8XA 2PU0A 3W84A 3BGGA 3V16A 3W72A 4KWSA 5SWUA 1P0NA 4UNKA 1QK0A 2YCLA 4BR1A 2C19A 5CPLA 1FFQA 1R2SA 3NSNA 4PEKA 1V79A 3B4UA 4PTVA 1XYLA 4FHAA 3DGBA 5ABGA 1GETA 2VR5A 2ZX6A 4QDWA 3PZUA 2I7GA 2P3ZA 5LA1A 3TEVA 4LYQA 4DPPA 2AAMA 4H8HA 1O95A 4GI9A 3W1NA 1Z8AA 3UA3A 1XYMA 1UR9A 1QASA 4CQCA 2QULA 3OODA 5H8MA 3L2IA 2Y7FA 3R5EA 1W1YA 2DUZA 4HHPA 3AIBA 3CHVA 2A5HA 2EAWA 1CB2A 2JK2A 2P1FA 3HO8A 4PMDA 3GXMA 3G5EA 4S3CA 2V0TA 1FP9A 5AHFA 2D3NA 4G7FA 2FIQA 3V7PA 1Q63A 2D1ZA 1KGUA 4O18A 2WVTA 1KFCA 3W73A 1XKJA 4TUFA 1UWTA 4QX4A 4K68A 2BXVA 3WELA 3SQPA 4DNAA 2WLZA 2C7FA 4GQBA 1YTEA 4F4RA 2BY0A 4GKTA 3DK8A 4PMVA 1XUZA 2J9YA 4BF5A 3G0SA 3RF9A 1UKSA 2G8ZA 2J47A 3T8QA 3KZPA 1NWSA 1AVAA 3R0UA 3RPTA 4B16A 4JBRA 3TLLA 1Q6DA 4JIQA 4IG2B 4R9OA 4RE4A 3ZLHA 5A2CA 1H6VA 3GR8A 1H3GA 3TONA 3MVTA 1XJBA 1Q6LA 2KZHA 3EOOA 4W5UA 4GRTA 3GXTA 4N9BA 2BHYA 1V0LA 4PB3A 4HSHA 2P0IA 1IIHA 3PZ9A 4OTKA 2A85A 2QIWA 3NQEA 4F2UA 3KE0A 4LU0A 3THAA 4KQNA 1ZJBA 2OKTA 4PMJA 1D7FA 4AZ6A 4UTWA 3HFYA 4GXMA 5I23A 5IXEA 3LD5A 1WXJA 2INFA 3CB8A 4F2BA 4BS0A 1QJWA 2YGYA 1U2YA 3OIXA 4JTQA 1OY0A 5FJPA 3GZ3A 2NWRA 4ADWA 1E9LA 1KTNA 2VCCA 2CXEA 3W7RA 3MU7A 1G4EA 3SADA 3GW0A 3A4XA 1E6RA 4CD6A 3PJWA 5LHFA 3WH7A 4MLRA 3OBEA 3GC2A 4QITA 1X38A 5I77A 1N5WC 3KX6A 4C6LA 4AF0A 4R5EA 4F2TA 4CNUA 1NSJA 1HGYA 1XBYA 1DWGM 1ICPA 2E5DA 2QUNA 4PCPA 5T26A 3EGJA 3TWBA 3STCA 5U4NA 4DBSA 4KPRA 1H49A 4XX6A 1XDJA 3LBCA 2BGSA 2X1RA 4F79A 1A5NC 3W86A 2IW0A 3WH5A 4I5RA 4Y9PA 1C93A 1CIUA 4JHOA 3MBDA 3SW6A 3B9OA 1C92A 2OODA 1K6AA 1OFQA 4GBDA 2QUUA 3W6MA 4L80A 1OWQA 3UR8A 4Y9NA 4YU1A 1TQXA 5EMMA 2V5JA 4QDPA 4TMBA 4HQVA 4F0KA 4ATLA 3RNMA 4CD8A 3A5FA 3HPSA 2X7VA 3MDUA 3A24A 3GZAA 2W3SA 2F2KA 5HULA 4FXJA 2XIMA 4UZSA 3P2VA 3B0YA 3SBFA 1IGWA 3LOTA 4G7EA 3R7MA 2PDYA 3BUVA 3M0MA 4PUEA 1TREA 3AI0A 3HQPA 3DG6A 3G1DA 1FUYA 3DH7A 1J6PA 2GGIA 5CXPA 1R6WA 1NM9A 3O07A 4BK9A 2WBKA 4C6BA 1UZ4A 2D20A 1ZCOA 1JR1A 3BLFA 2C0HA 2WKLA 1JZ6A 1B9BA 3VNDA 4Z2GA 1AD4A 4I6KA 2ZZ3A 4AXNA 1MYRA 3LNMA 3QN3A 4LRSA 3Q37A 3N4FA 3S83A 1B3VA 2A6LA 3B0XA 1BSIA 1ZPTA 2AAQA 3UVIA 3NSXA 3PTKA 4D6FA 1WAUA 2ZRUA 3R43A 5EMYA 1E1EA 1RP9A 4GC3A 5F4SA 2QCNA 2DZVA 3MUCA 3MP3A 2NLIA 1OM0A 1H5VA 3BZGA 3UWYA 5LIKX 2J7EA 5K9XA 5M1TA 7ENLA 1W3IA 1H4PA 3GBDA 2INEA 1RR2A 2XINA 3NRZB 4RK8A 3DFNA 4Y96A 3QKEA 1JPDX 2PWGA 4L1WA 3ZS4A 1A4MA 2DT3A 3NVDA 3LCXA 4NILA 1VD6A 3P0WA 2OSWA 5HDRA 4XTIA 3QMTA 3WUGA 1UUOA 2VVNA 5EBUA 4W88A 3OA5A 2R91A 3QR0A 4QNWA 2BSLA 4ZVJA 4H6KA 1RH9A 4MWAD 3QGVA 2ZX8A 2D73A 4P7OA 3VA8A 2E1DA 1FWNA 1A50A 3TU9A 4ZOCA 1M3UA 3T42A 3TJXA 3AUJA 1EO5A 1KGWA 3PY2A 4AHPA 2XGZA 3P61A 4QG8A 2Z4GA 5LNUA 3CZGA 3VK5A 4TV5A 4RL3A 2V3BA 3KRZA 1I9CB 4Z1DA 4UR8A 4B4FA 2EPMX 2FGZA 4XD5A 4KS0A 3ARUA 4EACA 1FWCC 4DZAA 2E3TA 1KBIA 3ARTA 1WQ5A 2D69A 3LUTA 3MJYA 3W7GA 3SB0A 4X3ZA 3S2LA 4RNIA 3M64A 4PUJA 2FVMA 3MY9A 1E56A 3NQVA 1W2VA 3AS0A 1XLFA 5JIWA 4K7ZA 1V51A 2GSHA 3P80A 1EGVA 2NX1A 3A7AA 3UR5A 3WK3A 3BAKA 3LCHA 1FEBA 4H6RA 1X39A 5A94A 2EEXA 4HU0A 5B7YA 1J2WA 1SZEA 3SECA 2F84A 1E9ZB 2ZX5A 5MKGA 3HPFA 3SCPA 5HNTA 1R2TA 4JFUA 3GNOA 1AW5A 4DNHA 1NEYA 3K5XA 1EOKA 3MYOA 3QZEA 1F6PA 4DYKA 3HG3A 5LSMA 4XKYA 3ZM8A 4JKKA 3SR7A 2JQXA 2XWDA 1GOKA 2PDPA 4X2RA 4B2DA 3AIWA 2ZX7A 1ALDA 4NY2A 4O57A 1Q6EA 2TSYA 4PEEA 4F66A 1MQQA 2VWSA 4GO9A 1ONEA 1F6KA 4K38A 5IBXA 4HYWA 2YXXA 1MDRA 3RCNA 2HV5A 1YMYA 1E0WA 1XUUA 2GR3A 3PS7A 3WLJA 2X05A 3DGRA 1R3SA 1JZ4A 3U2OA 4HZ6A 1OX6A 1M41A 4XSMA 1ZBWA 4RDZA 4E2VA 1LWJA 1U22A 1GK8A 4PRTA 2WJFA 1HL8A 1UD5A 1XLLA 2X8CA 1SO3A 2HNEA 1LUCB 2VFFA 3WDPP 3RCMA 1UKPA 1JPKA 1WP6A 1QVBA 1AJ2A 4LAOA 3S5SA 5AHEA 1VFHA 3P93A 2QJJA 4Y7EA 3GK0A 4UOZA 2TYSA 4FB7A 2WM0A 4K6AA 3ZYZA 1XRVA 3AHZA 1IXQA 1QMLA 3UQNA 4IWWA 4O1BA 4PN2A 4FP1A 4L4LA 1DJNA 5LKYA 3AS2A 1RQHA 1DIDA 5HUOA 2WC4A 3NL2A 3K4AA 3WNOA 3T4CA 2QF8A 5AHMA 1EHNA 3M7WA 3VD4A 4YN5A 1A47A 3TXVA 3OVPA 4JAWA 1RQBA 1XM3A 1KW1A 4FALA 5CLTA 1H7PA 2ISSA 3RAOA 3UZXA 3W83A 3DK9A 3U57A 1I0BA 3F4VA 3I65A 4H7ZA 1PWLA 3RX3A 2NVCA 3DEQA 1ZAHA 5LZLA 4TTUA 1Z32X 4BA0A 3A3XA 3PK7A 1JPMA 1CGTA 4OOZA 2NUYA 1L8NA 1XLHA 2REQB 5HA7A 4IIDA 3H7VA 2J3NA 3AZSA 3M5XA 2C3ZA 1KO0A 2A21A 2EG8A 4IL2A 2C91A 3K46A 2RJGA 3I7SA 4IPNB 5AVNA 3R07C 2ZZ2A 4YHEA 4LF2A 4ZFMA 1ADSA 1WX0A 3MBFA 2IS7A 1GVRA 1EDGA 3K8MA 3W85A 4MJ4A 3V0TA 3TOPA 1LWIA 3RK8A 2W66A 4I8DA 4S3GA 4TVCA 4E8GA 2DIJA 3MMUA 3PHAA 1M7PA 3FFSA 4PMOA 3GHSA 4ZO8A 3WF4A 3BLEA 1E43A 2GDQA 4XVEA 2EG6A 3OYXA 3QFEA 3G3DA 1Y5XA 1C3FA 4BI7A 1YDOA 2DY3A 1MSSA 4EMIA 3L4XA 2DJXA 3GU1A 3VDAA 1M03A 2BMBA 1Q13A 1FEAA 1ONWA 2XIIA 1FH7A 1CGUA 5CLWA 1JZ3A 3R89A 3BLIA 2Y85A 3MS8A 1XH2A 1C8YA 1EEXA 3NIYA 4W9TA 5CJMA 3I6RA 4UTIA 1AJZA 2W63A 4DJEC 5FL1A 3BJFA 3EWYA 1OZQA 4FF5A 4PL2A 1OGSA 3OP2A 1I60A 4CCDA 1OGGA 4K1WA 3IVSA 3S9ZA 2CFFA 3GRIA 2W91A 3AICA 3WNLA 3OVGA 3PFMA 1KTCA 1PZ0A 2EPNA 2BVYA 5D2XA 1OFRA 1FRBA 2IXUA 3U2ZA 2IKGA 1JQVA 1PZ2A 3W7QA 2FTWA 5A2AA 1GZJA 1W3NA 2GGGA 5I0DA 7TAAA 2C1GA 1LPFA 5D32A 4QIUA 3E2QA 3NWRA 3PNZA 4PCSA 4IT1A 3W7HA 5DCDA 5DY3A 3ES8A 5C9XA 3L2MA 4PSPA 1ZENA 1XLAA 3N9RA 2NSOA 3EEZA 1IR2A 2BB0A 3WH6A 5EMUA 4QCFA 3AMLA 1X6LA 1W5PA 1WDSA 3FKKA 3H7UA 2BZNA 4EQXA 1BWKA 4EAMA 2Y7EA 2VDIA 1OFBA 3KBVA 1TV7A 2Z29A 1W1IE 1JPHA 3M0YA 3QPYA 1F05A 4K7VA 2HE5A 1TJ1A 4WVXA 3HOJA 3VZYA 2CZ5A 1P6WA 1RK6A 1CNVA 3U5YA 4XSLA 5I3GA 1IQ8A 1V6UA 1QNRA 3TYEA 4U4MA 1V7YA 3DOPA 1BF6A 1NDYA 2BXYA 3H55A 3NR0A 1AQHA 2D2JA 3SO7A 1LVLA 5FESA 4HHLA 2YLLA 3SCQA 3C8FA 2J6XA 2GFTA 3VGDA 2VZUA 2CLFA 4GZEA 3STEA 1PTDA 1UH3A 1UG6A 1HW6A 3P5YA 3KCOA 2RGLA 1YTDA 3QEZA 3S5YA 3B3DA 4D6GA 2ZX9A 5CPSA 4XZBA 2A7PA 1G94A 1SQ7A 1TX0A 4GQGA 4MB3A 4MJMA 4K8GA 4GE8A 1GQLA 1J0HA 4HA3A 3LSCA 1ML1A 1QNVA 3E0WA 3S2CA 4ERAA 1ME8A 4JIRA 4IMAA 5EGRA 3WENA 1J12A 1EC8A 3UR7A 4RCXA 5E70A 1LM1A 3HJZA 2CBIA 4JQ9A 6TIMA 4PCNA 4J35A 3H4GA 3L8KA 2XN1A 1UH4A 1AD1A 1J01A 3FVDA 3TQ0A 1P7TB 2ZUTA 1IXPA 1XG3A 2A79A 2Q71A 2XGBA 3M1ZA 4BEQA 1W5OA 2IKIA 4DHGA 5FF2A 1RJRA 5DBTA 4UCGA 1A80A 1GHSA 4JTUA 4JHZA 1ADOA 4HPNA 3E6EA 2WVSA 3VINA 1IWAA 1VLIA 1M01A 1JL8A 3TKFA 1H7RA 2Y5EA 4ZZ9A 5CC5A 4PUWA 1C7TA 2GWGA 2ZQ0A 2CHNA 2BNJA 3AXMA 4B5VA 4NEVA 4EWJA 5T8GA 2V8ZA 3E0LA 3M0KA 4MZ8A 3NO1A 3SURA 2Y89A 1UASA 2DU2A 3H26A 4XO7A 4BZYA 4IGMA 1B3WA 1I75A 2AL2B 2HDJA 4GNVA 2HCVA 2IPGA 1QPQA 2PDMA 1G0CA 1TUFA 3Q4DA 4GACA 1XCWA 1IEIA 4H4PA 1I2NA 2Z2BA 4TXEA 2ISDA 4JTJA 3I68A 4IUOA 2PU1A 1OVDA 4YVXA 3VMNA 4CD7A 2UZ9A 2QCMA 1F76A 2GQ8A 4AZ7A 3LCGA 3W70A 4J2MA 2YDQA 3FYOA 1QPNA 4AZHA 4D6JA 4R27A 5FEWA 4RUBA 1FIQB 2J7FA 1NQKA 5GVJA 3W53A 3T78A 1PS9A 1AG1O 4DQWA 1EGZA 3PUGA 2WPEA 4KMQA 3HFTA 3ABOA 1FTXA 3KBWA 4LX4A 3WBYA 4L56A 1IT0A 2BGNE 1SW0A 3EBVA 3OBKA 1CCWB 2RJHA 1MUWA 4FOJA 3LCFA 1AL7A 1UKOA 1H7XA 1F8IA 2YZRA 1O1HA 4HNCA 1YYAA 4KCWA 3JS3A 3MUY1 1TUXA 1GESA 2W79A 3UXIA 1P6BA 2HS8A 3NL6A 1QWKA 2X99A 3SSZA 1EOMA 1XF0A 2YL9A 3MW7A 3RX4A 4Q33A 2OSXA 5AC4A 3EDKA 4R53A 3L5MA 1CGXA 4FX9A 1BPLB 1K9EA 4PR4A 2OX4A 1PKLA 4KCTA 2V82A 3L23A 2Q09A 1FFVC 3VIPA 3IACA 4WSHA 1NHQA 5BROA 3W1UA 2KAUC 1CXEA 1JRCA 1UBSA 2MANA 4OZOA 2TMDA 2ZDRA 2Y8KA 3G1RA 3MUXA 5AYBA 2C6QA 4C60A 1UJPA 3WH8A 4JTCA 4ZTXA 4AHQA 2E9BA 2QAFA 2I14A 1TRIA 4ML9A 2WKGA 4FZIA 4GVHA 1JUKA 1P0BA 3GX9A 4LUSA 3EX4A 1VYPX 3LRMA 3HW2A 1TA3A 1C29A 2P8BA 4DJDA 9XIAA 1ICSA 4AD5A 1QBAA 4N2YA 1RBOB 4MGGA 3DHUA 3GIQA 4R7WA 3W7DA 1GERA 1UWAA 3RXZA 2ZOXA 4NAFA 2FZNA 1KFBA 4E8DA 4ONVA 3UJRA 1BWVA 3PNUA 2A1YA 2QDHA 3EZ4A 5FF4A 4IP4A 2Y88A 1H50A 1OJXA 3TYCA 4B90A 3TROA 1R46A 3CLMA 1STZA 1YBQA 2Y8UA 3OA3A 5M17A 4H8VA 4DO7A 2E67A 1O4UA 5FS8A 5FEXA 2FPTA 2WANA 4RW3A 1UA7A 3ZVHA 2WCSA 3LPFA 3R8RA 4D1IA 2EJ1A 1SB3B 3IIOA 2UY5A 4L9XA 3GDRA 1TIWA 5FS6A 1UPPA 3I3DA 4ZODA 1FQ0A 3JZEA 4K3ZA 4ZQCA 2R1MA 4ZOAA 4QE5A 3JUGA 1R3WA 5BU6A 3AIVA 3E1F1 4OV9A 1M1BA 4RV3A 1IIGA 1CXLA 3NGJA 3S6TA 2QF7A 1P4CA 3EX2A 1XIDA 3PR2A 4L1GA 1LBLA 4A21A 3PWAA 4US5A 1OG6A 2PI6A 3OZOA 3PBYA 3TA9A 2R6OA 3BK0A 1WKFA 2J9ZA 2BWGA 4MY1A 2ZRWA 3TYUA 1WDRA 3NTYA 2B7QA 3SCUA 1WZAA 4ZQRA 5FKYA 2ZIDA 2P50A 3DH9A 2NVDA 2CITA 1E1CA 4U3AA 5EL1A 3NQFA 3KM8A 4EOUA 2OJPA 3EAOA 5KETA 5HOSA 5HWMA 2BVDA 2EQ7A 4DO5A 4HP5A 1XLJA 2CLEA 2VNCA 1NFGA 3BSMA 4XBSA 2VZOA 2B7NA 1FKXA 4J27A 2X0YA 4NL1A 3GW3A 4BURA 3NA8A 2Y7DA 3NQAA 4HSNA 1OIMA 3KOFA 2VGBA 5A6SA 4RDWA 4IHCA 4ZB2A 3FX4A 3M0IA 3KXQA 4Q22A 2WCGA 1DHKA 1EWEA 1MNSA 4KRZA 1HJWA 2JGQA 1XP3A 5I79A 2J62A 3URNA 5DQPA 4UZUA 1Q6QA 4UFIA 4PRWA 1E6XM 2WVUA 1THFD 1F7BA 1H62A 4WXYA 3KW3A 1S1RA 5U7SA 5JQ9A 4H4SA 3QW4B 2VX5A 3CZLA 1DJWA 3CAKA 3S5NA 3II4A 1OQFA 5JBEA 4LEFA 2VEPA 2GK1A 3UERA 2FH6A 4GY7A 5M03A 5FAJA 2IKJA 4Y8EA 3VKKA 4QFUA 3UCQA 3BVJA 3W1AA 1EL3A 1OFOA 3TP4A 2G4JA 4E4UA 4JTIA 3FCPA 1JNDA 4AIBA 2HZGA 3PBGA 1RK5A 3W1RA 4QM1A 3RYSA 3GVRA 1NDAA 4H4ZA 1UBPC 1E51A 1VGAA 2O92A 4DLMA 4H4IA 2BBFA 4JTDA 2Q3OA 1GVEA 3CQHA 4ZO6A 5F2LA 2HXUA 1GJWA 2Y6ZA 4ZQPA 4YVPA 1UD6A 3MP5A 5DMYA 4WKFA 3KVJA 3F2CA 3T44A 4G2DA 2X2YA 2P76A 4U31A 4ECLA 3GKFA 3PVFA 2I5IA 4S39A 3EDFA 2CLOA 4CCZA 1XICA 1W9VA 3FW6A 3N4EA 3PPFA 5HAOA 2VGFA 1B4EA 3STPA 1UWUA 5DXYA 3H2NA 3PBMA 4DBEA 4HA1A 4A35A 3VU2A 3H22A 3GRTA 4V2XA 1TCMA 1KKOA 3TTYA 3GDTA 3GTXA 2CWXA 3N73A 4WK9A 1JJKA 1TJ2A 3NQBA 5FS7A 2D24A 1I2RA 1WBJA 3HG5A 2ZZ6A 4ZQNA 4HPJA 3R58A 2B31A 4A3UA 3T9PA 4XAFA 2ZXQA 1D3CA 4BI5A 2GL5A 1EZWA 3UYIA 4DUXA 3VKAA 3P6LA 1XR2A 5C9UA 4F40A 3ZT7A 1Q4NX 3ICJA 4XK2A 2X50A 1GOIA 2DPEA 2VT0A 1DOSA 4X0NA 4C6JA 4M1RA 1OYAA 5D33A 4IISA 1YE6A 3GVQA 1VRDA 4UFJA 4UNIA 3WLPA 5HPCA 1P43A 4A05A 3GNRA 1X96A 4O53A 4H41A 3JRKA 4NIRA 3C2FA 3ZR4A 4X61A 5I00A 4GUFA 1OADA 3DFTA 1T40A 1NWRA 3L2LA 4W8BA 2W55A 1PL9A 3FSTA 3TE9A 4NZ5A 5C2CA 2GJXA 3UY8A 2XIBA 4LC6A 4AD0A 1EUNA 3GG0A 2DZWA 4E4PA 1Q7MA 1IGSA 3BURA 4K36A 3HPAA 3K8KA 2PLCA 3OTRA 2OZTA 5F1UA 3G1XA 1EDQA 3KWSA 3RITA 3TQKA 3CC1A 2XDFA 1OT1A 3C5QA 1RBAA 2ZRXA 7CGTA 3KZSA 3OHIA 1EXBA 1ZSXA 3SR6B 4Q32A 3T40A 2XSAA 2VFGA 3QFWA 2E4TA 3UF9A 1FCQA 3CM4A 3ES7A 4AB4A 1G67A 1QUMA 1MRAA 2RDUA 4LF1A 1VFSA 1BQGA 3BLOA 1V3MA 4NHVA 3UJFA 3FJ6A 5LNSA 4Q8MA 4MOZA 3QHNA 2PDIA 1IR1A 4Q6XA 4H4WA 1JCNA 2WPCA 2ESCA 1OX4A 3WQVA 5FOOA 3W82A 3MV11 3WK0A 3NVYB 4J56A 2WP5A 4LAMA 3UFYA 3T2OA 1QNSA 3BLLA 5FF0A 3D46A 2O56A 1U30A 4A3RA 1TE1A 3QPZA 4O4WA 4JNYA 4FNSA 4RDYA 1S3HA 4GLEA 3CUZA 3FXGA 4AZGA 1GONA 1ZNNA 4HIBA 3AIRA 4XZMX 1KWKA 4GVFA 4HK7A 2JK6A 1P0DA 4JNMA 3SZ8A 1EP1A 5BMWA 1YRRA 2VVSA 4JYEA 4MUPA 3DKLA 5HJLA 3BW2A 2QW5A 4YCOA 4ZOHB 3W7LA 4EWND 1JUEA 4M1BA 1Y8BA 3VO0A 3N15A 3V0SA 1FA2A 1N8FA 4LV4A 1OEPA 1DWFM 3KL0A 2ZC8A 1Q5MA 1KN0A 1I2QA 4DIAA 1TZ7A 3VILA 5XINA 4HNOA 4GI8A 2EG7A 3UGRA 2B0MA 4CCCA 3TVAA 4GWEA 2FZDA 2WV8A 2HK0A 1TPVA 2YJQA 5DXXA 5MF5A 1EHAA 2F6UA 1YXYA 3W7EA 5JCNA 2DSZA 2QCDB 5L9FA 1GVOA 3WK1A 1S5NA 5C55A 2CLHA 5K3VA 2ZVRA 3CLWA 3KBMA 4H9UA 3MHFA 5EFDA 3PUDA 1H2JA 4IPJA 3EA3A 3UT0A 4QRNA 1DIOA 4KCUA 4E3TA 1ZL1A 2PCQA 1QO2A 4W89A 3BAJA 1B2YA 2QIIA 3IRSA 2WOVA 4V28A 2Y62A 3UG3A 4DBDA 4U2ZA 5LIWX 5I5RA 3N2MA 3CPUA 1PJ9A 1BRLA 3HURA 4M24A 1EP2A 3G1VA 4MYXA 4TX8A 1G4SA 3TTSA 1N62C 4JFWA 2G37A 3IJ6A 4S38A 3T0CA 1EPVA 1VAHA 3B8UA 3M0LA 4QJ4B 3MUIA 4E5TA 4CU8A 3BAWA 5FF3A 4O0KA 2PTDA 1G7UA 1TPUA 3N14A 4P8WA 5I3KA 2GVGA 3E0FA 1W3JA 1S2VA 4UWMA 3N2XA 4R9XA 3KTSA 4U5KA 1FWBC 1E4IA 2PS2A 3G0UA 4JFTA 3M0VA 4HZMA 4IGSA 1NFPA 1GPWA 4JQ4A 3TQPA 1RBLA 1S5MA 2AKZA 5AYYA 4W4QA 5ABFA 5M2FX 2XVKA 1PO9A 6REQB 3IAPA 3IJQA 3IEBA 1XIEA 1J11A 5H1WA 3WEZA 3LG3A 1NDWA 1R9ZA 2H6RA 2L5HA 3W81A 1RCOB 4ORMA 1HUVA 3WL0A 4CVWA 1GOXA 1NAL1 2ZXDA 1VDVA 1FDZA 1HL9A 4JTFA 1SZNA 2VC6A 3LPPA 1D8WA 3DXIA 5JVLA 5G5HB 3VIJA 1BGGA 1YE4A 1EJXC 1YPIA 2PWDA 3FGCA 3W38A 2FFIA 4PTWA 3EPOA 1Q2RA 2ADAA 4AVFA 1OHLA 2OXNA 4D1JA 4GY0A 3N6QA 2TRSA 3N1AA 4ICNA 5HJXA 4A22A 1ITUA 1CW2A 3FOKA 2BY2A 1OX5A 2YR1A 3BCFA 2HBXA 3WD0A 3UPMA 1I8JA 4JTHA 2J9XA 3QW3A 4IX0A 1TVPA 2X1TA 1W8GA 4AEEA 4NT0A 3VIGA 4JX5A 4AISA 4ZXOA 5C9ZA 3IUIA 4O11A 3TMLA 1N7KA 3UWQA 1I6NA 2R82A 2C13A 3NVTA 3F4WA 4ERIA 3ZJ6A 1F74A 2YL6A 3M5YA 4DUVA 3WJXA 1KTBA 3G1AA 5DO8A 4O1AA 3MWCA 1LQ2A 2QAPA 3NDZA 3OGVA 5GNZA 4AY1A 3WEOA 3LM7A 1HKMA 4N02A 3ZMRA 2WBGA 2CESA 4G5DA 4LCRA 1F61A 1YQZA 2OCZA 2WBAA 1MXSA 4AQLA 3W25A 3AROA 3B0UX 4JQAA 4N9EA 4HOXA 4C6KA 5GJPA 3ALGA 2J7BA 3WBAA 3WQGA 4JKLA 2DH2A 5A8NA 1L6WA 3GH5A 3SY1A 4P5UA 1MQRA 1QFEA 3MO4A 4EQRA 3BLDA 2PDXA 1N2VA 4L6OA 3LHWA 2ASHA 1WDDA 3Q58A 2JEPA 3DECA 3OYZA 2QCFA 2R9ZA 2YPIA 3R0KA 4H19A 2WZHA 1NOUA 5JCMA 1QO5A 3NL3A 3W1LA 4UFKA 1W3HA 4C1KA 3B06A 4JDYA 2B81A 4LT9A 2C3CA 3H6OA 4A2SA 3T0BA 4MNKA 4I9JA 1DIKA 1W9UA 1W1ZA 1OK6A 1XIJA 3KCLA 5G2HA 3W1PA 1Q1WA 1E6SM 3W74A 1XQLA 3NDOA 2A3EA 1R38A 3W2NA 3UEQA 4AZ5A 5JCIA 4WSJA 1TMQA 2D0HA 1DBTA 5I2UA 3B8DA 4M6QA 3EA2A 3QGAC 4NX5A 1RAKA 1S5WA 1XLGA 5D8ZA 2Y61A 2VL4A 2NVKX 2XSXA 3TTEA 3CHDA 4U33A 4IG2A 3BXWA 2Z24A 4LVAA 3RCYA 3FV9A 4R7JA 3QZAA 4JN7A 1XD1A 1PHQA 1E3ZA 2E9LA 2O9TA 2I57A 2ZA2A 3LV5A 1LL4A 1LT8A 4KF1A 4IP5A 1JUBA 2QT3A 4TO8A 1N8IA 2VXNA 4LNCA 1X1OA 4WGXA 7XIMA 5CEWA 1RY8A 4JX6A 1IXOA 1M68A 4JDBA 1PUDA 3LTPA 3VABA 1S2WA 2BOGX 4GG9A 1PZ1A 4ZENA 3S3GA 4Q8WA 1CXFA 1I1XA 4GI6A 3SQMA 3KOYA 4UQ9A 3SUTA 1QOPA 1FWGC 3EKZA 3SN4A 4C6DA 4PUNA 4M6UA 1SO5A 3EB2A 3CZJA 2WSYA 1F3EA 3WJWA 4BI6A 2ZZBA 4R33A 1UYQA 3S6DA 1R86A 4YLWA 3M0ZA 1X6NA 5C6MA 1DJIA 3IVUA 3VOGA 5CPOA 5A6BD 4CQBA 1U33A 4PMYA 3PSVA 3PSWA 3KOXA 3PAOA 1L6GA 4LUTB 5J5DA 4EPEC 4OIFA 3WUFA 3D9XA 5KSWA 1WV2A 3WLLA 3QLDA 1MFUA 3UXDA 1TX2A 1HO1A 2YCEA 2PBGA 1OGBA 3TTQA 3SUUA 5D05A 4X2PA 2V69A 4Q8UA 1HO4A 4V15A 2NQZA 2G3FA 3KEHA 3DFYA 1SUXA 5F7UA 2HMCA 1MO9A 3B05A 4EQWA 4MF4A 3AU2A 4YWSA 4RW5A 4XG1A 3ARQA 5KVHA 3D3FA 1QBBA 1OYBA 4LYPA 3TTOA 5DRIA 5BW6A 4W5ZA 2E5AA 1JAKA 3TSDA 4H04A 2A3CA 4QLJA 2HPIA 3QM3A 1LL6A 1CYGA 3KVLA 1A4LA 4NASA 1OD0A 3W4RA 3OQ8A 2H3BA 1W9DM 1K3UA 3N18A 1TPEA 4Q8PA 4WY0F 3QTGA 4O13A 4LRTA 1VFLA 4PBGA 4I90A 3PFRA 5XIMA 1AL8A 5HATA 1GRFA 1ELSA 2CETA 3LEPA 3P8JA 4DF0A 3SCNA 3B0VC 3ZLGA 1UQYA 1WOAA 1O5RA 4L4OA 3HGSA 3WQDA 3H2OA 5FD0A 1VBRA 2V5LA 4PUDA 6PTDA 3QGKC 3I3BA 1EIBA 4JTRA 1HZYA 1Q6CA 1EA9C 2ABBA 3LERA 5A8OA 4IPIA 3L0KA 3MMDA 4FX8A 2OWWA 4H7VA 4IX2A 1E4LA 1XLIA 1VP5A 3S46A 4M19A 5IFPA 3MO7A 4IP7A 2CLPA 1AQFA 5C5YA 4H4YA 2GGJA 2AOSA 2VHLA 1AW2A 1UKTA 5TNVA 4OECA 3RR1A 4F0MA 1FCVA 1R3RA 4Q8OA 2OX1A 3SQLA 5D2TA 1JZ8A 1HFBA 1EH9A 4KFPA 1FY6A 3EX3A 1ODZA 1QW9A 4REQB 2OGYA 3MSDA 2PGEA 1QWGA 1EP3A 3EDDA 3WQ4A 2OO0A 4I7VA 4CUCA 3RR4A 5KINA 3CGEA 4J40A 4NZFA 5KEZA 3FIGA 3MPGA 4I7WA 3CK5A 3I7RA 3CAWA 4OE7A 1GRTA 4ROQA 3ITOA 3CTLA 3GVWA 4LUJA 6A3HA 2DW6A 2Y2WA 4XUYA 1PIIA 1CPUA 1DPMA 2WMFA 3SFKA 4TVYA 3VDHA 2PDHA 3ABQA 1GRHA 3E3HA 3RHGA 1QATA 2IQTA 2ZWYA 1X1NA 3NSMA 4IIGA 1MZRA 1X98A 1NF0A 1JD7A 2QQ6A 4JGDA 1P5BA 3W28A 3ITVA 2ACRA 3CGTA 2XUCA 4ERGA 5LXXA 4M51A 4DXKA 2ZUUA 1R3YA 2PDQA 4NXKA 1XPGA 3PUOA 4WJEA 5A6AA 3NURA 2ONEA 5BCAA 4RXFA 2EPLX 2IQ0A 2ZYFA 4ZQMA 4PE8A 1N55A 4YYFA 2PC4A 3S6OA 2E6DA 4W7UA 4LS2A 1R85A 2NW0A 4UTMA 2X1IA 4DO6A 1U5JA 3JZUA 1OT2A 3KHJA 4GFIA 2OO6A 3VNLA 4RPPA 2JALA 3SN1A 3AYSA 2WOQA 4JIEA 4GYJA 2IMRA 3WDQA 3LBMA 5JU6A 8CGTA 3SFWA 2CERA 3POCA 1EXPA 1PIGA 1B1YA 4FNTA 4LWWA 4FR1A 3N2BA 2X16A 3KTXA 4LGXA 2AKMA 2VC5A 2ACUA 4Q8VA 3WX7A 3EOEA 4XIMA 4GGHA 3SCRA 1PX8A 4GVIA 4S2BA 4IQEA 2J7CA 2P8CA 3AZTA 5DANA 1REQB 4LV9A 4CEUC 1VB9A 4J57A 1RD6A 3TFXA 4UFLA 1QU4A 1GV4A 1PB0A 1RA5A 3QFAA 1LRQA 1BXCA 4P61A 1R7AA 3A9IA 1EJWC 2WNZA 4EPDC 1WUFA 2EQ8A 1XL9A 3VDBA 2X8HA 4PMNA 1AQMA 1ITXA 3ITCA 1UP0A 3M47A 1S2UA 4GQ0A 2EKGA 4JYDA 3JW7A 2EBNA 4A8RA 4GC4A 3NQ2A 3T0DA 3B4YA 3EWBX 4Q4OA 1XDIA 4KWWA 4Z1CA 3LK6A 3GE7A 4HK5A 3C0JA 4M3PA 4IFRA 4JIPA 4G6CA 4EMWA 3AHXA 4JL2A 3XIMA 2A3AA 4NYUA 1A5OC 4S3KA 5I03A 3EB4A 4QJ3B 3TZFA 3B9JB 1WUEA 4LB3A 3BGAA 4AY7A 4GR1A 3TC3A 3WLRA 3S1XA 3VKCA 2AGKA 1V6YA 4D6HA 1Y5WA 3LBOA 4H4VA 2A3HA 2V5CA 1LUCA 3A9BA 2J7GA 3U9IA 3GG7A 5J5RA 3WL1A 2P88A 2WB5A 5IRPA 1UWIA 3IARA 2IQDA 5CPQA 4URIA 4M6VA 2Z1WA 4YHGA 4Y90A 4TU1A 3GR7A 3BW4A 4MY8A 2YCIX 3C0QA 2Z2AA 2WZEA 3RU8X 2G3MA 2IPFA 1JZ7A 3D3AA 4YIWA 1GG1A 2F38A 3S2NA 4KGLA 2W5FA 4L6DA 4NI3A 5C70A 4C91A 4EF9A 5D2VA 1XFBA 1GRGA 1HTIA 2WWDA 3E5BA 4MY9A 2R9RA 1ZBKA 4DVOA 3P81A 1XRSA 3GC5A 2X42A 4XV0A 1EFZA 3RRXA 3CHCA 5HMFA 4MYAA 3AIUA 2IPJA 2RFGA 3MYPA 3IGUA 5C54A 3LN3A 1I2OA 3QYSA 3IRDA 3P74A 3ME3A 4CN6A 5AC8A 2E9MA 4UTUA 1NPXA 7A3HA 2I9UA 4HHHA 3EMZA 1JOAA 1O12A 4N6FA 5KITA 1PCWA 1UC5A 2F6KA 2GSEA 3BLKA 3GD4A 4HZ7A 4ZCWA 1FXPA 2DIEA 2REQA 4C5ZA 2BOEX 4HA0A 2GJPA 4UFHA 4NZJA 1V97A 1BF2A 3WFZA 3DBNA 2PWUA 1Q45A 1CLXA 2CLIA 5J04A 3MKKA 2FFCA 3FN9A 3A7UA 1VFOA 1Q3NA 1B4KA 3B04A 1OZMA 1LORA 3W3OA 4H83A 2WPFA 2XH7A 3OPSA 1R7OA 8XIMA 2RHGA 1XD0A 4H9XA 1HJSA 1H63A 3WMCA 1NTHA 4MWAE 3G1SA 8A3HA 4Q4QA 2WC3A 1EWDA 2I16A 4JXCA 1YKWA 4W7VA 3EEGA 3ORWA 2DQXA 9CGTA 3MCOA 2PF8A 3RRAA 3W07A 5AKQA 2BFGA 4J3VA 4CU6A 3RLHA 4BF9A 1CGWA 1W1PA 2XFFA 1LOSA 3DAQA 4QEHA 3SJNA 3GFYA 3M41A 4GISA 3C52A 1V59A 3GXNA 2G3JA 1FHUA 1TPWA 3THUA 3WDRA 3PBVA 4JN8A 3ZVIA 3IIPA 1OC6A 1V6WA 1Z41A 5FL0A 4JD4A 3FA3A 3ABSA 3WY1A 3NGFA 3OIHA 4HN4A 1A5SA 1QCWA 1XSKA 3G8EA 3BG3A 1DXEA 2OELA 4B5UA 5C2GA 3CAQA 2ZE3A 3RX2A 3QZ6A 3WLMA 1KM2A 3EXSA 4E4FA 3KRSA 1FWDC 2QMJA 1VEOA 3B97A 5HQLA 1EX1A 2CLKA 3WD3A 1TPH1 4YCPA 1KXTA 1WXYA 2NVAA 3N2OA 5F2MA 3W02A 1PTAA 2BV9A 4YL2A 3ZWTA 3W29A 3L4YA 2Z1XA 3CNYA 4PSRA 3UNDA 4DJDD 3NPUA 4DI9A 3YPIA 1KA9F 4LS1A 4I8YA 3T2QA 1K6WA 4K8EA 2EGZA 1A0DA 1KXHA 1A5MC 3B8WA 3FJNA 4D72A 2DJLA 1KV8A 2QGHA 5DCBA 1TTQA 3GTFA 3NQCA 1W1A1 3WNMA 3RO8A 1OSEA 3OQEA 3L12A 3WH9A 4HGXA 3CS2A 3IWPA 5CZKA 4MHBA 2PUZA 1XIMA 4FX7A 1X2GA 5GPRA 4N4QA 2GOUA 3WQ5A 4S3EA 2WM1A 2FMOA 3TMQA 1HVXA 3GH7A 4HU4A 1UW9A 2HVMA 1Q1RA 1LDCA 1Z9AA 1GRBA 1KKRA 5D2YA 5LYRA 5LXEA 1WOBA 4GIRA 3WSUA 4WZHA 4FMVA 5AY7A 2QPUA 3VD3A 3H8AA 4QE4A 3XISA 1FO4A 1LLOA 3W1MA 3VZXA 1Z44A 4FO4A 3NM1A 3THCA 1GOWA 4AZCB 1V5XA 3EAUA 2ZZ4A 1OF8A 2G50A 1MZHA 4AX7A 1BYBA 1OBAA 1V02E 3M6DA 3S5ZA 4EF8A 2HROA 3TZNA 1IV8A 3VD5A 3TDFA 2CC0A 4CKQA 2XVLA 3GG8A 2HE8A 3PG6A 2WLYA 1EA0A 1UZDA 3GXFA 4M81A 1BVZA 1VJIA 2IXVA 4ZMGA 3VIFA 4FX6M 1PAMA 4XZNX 4DJEA 3TIMA 4NNCA 1EEPA 3W9ZA 3JVAA 4JTKA 1GEHA 2R94A 4K8DA 1SVDA 1ZALA 5LGZA 4DJFD 4FAMA 1GPFA 1XBZA 2GRTA 2DZBA 4W87A 2PGRA 4IJBA 3MUZ1 1QI2A 3CUJA 4GQRA 3ZIZA 1P7TA 2PWHA 3O1NA 3QMRA 4ZBCA 1Q66A 1JEHA 3SAZA 1SZGA 2OKOA 4B92A 1F8MA 2E5BA 1BQCA 4IMDA 1S39A 3DK4A 1KBBA 5HK4A 1RJPA 4YYCA 1K9DA 4FXFA 3PZOA 4DYEA 3KHDA 1TJ0A 1GTEA 4MFDA 3DGZA 2V67A 3AXKA 1PPIA 3NPVA 4LCSA 3RMJA 3AZRA 4HPGA 4QP0A 3BTNA 3W88A 3NPXA 5JIPA 1TYTA 1IEXA 2V3EA 3NVZB 2RDTA 4YPJA 3VPLA 3F4NA 1DJQA 1V08A 5CKSA 4FXSA 1Y65A 3W0KA 4JICA 5DX7A 5D9PA 2AL2A 4JQ1A 1Z3NA 3TN4A 1Z42A 3WZ0E 1L9WA 2NZLA 3GAYA 1VJZA 1E4NA 1KM6A 3WBXA 4N42A 4MNJA 3M5VA 3VOIA 4JFSA 3NXLA 2FGBA 3EWZA 3W7JA 4AXKA 2YYTA 3O3RA 2YDSA 3F4CA 5E93A 3BOXA 4JQ2A 5FAGA 3R12A 2YA2A 1V7AA 1B30A 1E70M 2AQOA 3QY7A 4UUIA 1NF7A 1O5KA 3USBA 5FA5A 1RP8A 4MMWA 3SN0A 3DZ1A 1JYXA 1KCKA 1E71M 2OWCA 4J2PA 3ABXA 4ROPA 4JTLA 3AYVA 1B5TA 2P10A 1CI1A 4GHRA 2X0HA 3PUEA 3WF2A 1ODUA 1OFAA 3QQ0A 4JKMA 2ISWA 3N34A 2XPKA 2WVVB 3U7BA 3HG2A 4ZO9A 2R1LA 5F1VA 1H2IA 3N19B 4J3TA 3VOCA 2OMAA 3UYCA 2FTYA 4LVDA 3URHA 3ARSA 2QV5A 3THDA 3L4WA 2W9MA 3R10A 1XWYA 3WMSA 3S42A 2PC8A 5DLCA 4GUJA 2E8YA 1SFTA 4W93A 1GNXA 1XYAA 1FECA 4NJIA 1Q65A 1RD5A 2E25A 4TV6A 2C0AA 4G9PA 5AYIA 3SUSA 1WKYA 4MJ2A 5LA0A 2OQYA 3W7PA 3KBSA 2WAGA 4GY1A 3QR3A 2GLKA 1O66A 1V3IA 3V35A 2YW4A 2E68A 3G1YA 1E0VA 3MCNA 3LPOA 2Y1HA 2HS6A 3SIMA 4XD4A 4D8AA 1LRNA 5H91A 1R3QA 1AOGA 3W2KA 4WDWA 3M0HA 2PTXA 3ITLA 1J4EA 1Y5VA 2QUTA 3H2FA 2FGLA 3KS5A 3EWDA 1F3XA 3W1QA 2W92A 2Z1SA 4EK7A 2XN0A 5G2WA 5IM51 4XB3A 1KGXA 3DI0A 3QF0A 2HSAA 5REQB 5IDZA 1NU5A 5D37A 9XIMA 3L67A 3AMGA 5KZMA 3BE7A 2CWNA 4WOQA 1EX5A 3BJSA 1LP6A 3ATYA 3AYTA 4WF7A 4GYPA 1FDJA 4CCEA 4NZ3A 2X8RA 1HKKA 4M8UA 3E49A 2YB1A 1YLVA 3WLOA 4DXXA 4XKMA 1MXGA 1B54A 1MMFA 1BG4A 2OWXA 3WG6A 3B9AA 4GUGA 4AEOA 3GNNA 2BX7A 2QJMA 4S23A 1VFUA 4DWSC 2X30A 2FKPA 5E5CA 1LT7A 3C2RA 2ZZ0A 1PYFA 1BYAA 1CGVA 5H8UA 4L7ZA 3TSBA 4H4QA 2YVGA 2QVHA 3PG9A 4C6FA 2WMIB 1R2RA 1XFCA 3O6AA 1QR7A 2NX9A 4Y9AA 2R24A 2CXGA 3AS3A 3HQ1A 1OCQA 4DX3A 5TF0A 1TV2A 1AH4A 5CC6A 2WOWA 4EXQA 1P0EA 2EF9A 3KDOA 4XZWA 3II1A 2QPSA 3BQ5A 4GIAA 3MTWA 1WB0A 3VZZA 2XN2A 1J5TA 3MMTA 3P84A 4D6IA 1YDNA 1FCUA 2BS9A 3O9NA 5BXRA 3VI2A 5CC3A 4UTKA 4NZ1A 3TAOA 5AHLA 2HJPA 4R3UA 1TWDA 3RM8A 1FWHC 3H2CA 3LMZA 2YCKX 4JNZA 3TJ4A 1UD3A 1RVGA 5PTDA 3T7VA 5CBIA 3WLQA 3ARRA 2YVJA 4QISA 4WLCA 3TYBA 2OLHA 1TG7A 2C1IA 3A4JA 3SJ3A 4DF2A 2I9EA 3FKRA 1SFSA 1IEWA 3GXDA 4A6GA 2OYMA 3HV8A 4NYYA 2PBOA 3TUUA 3Q6JA 1W91A 4AY8A 2AQVA 4DZIA 2PD5A 4GABA 4O0ZA 2A6NA 1RZMA 4A8LA 4JTSA 2O9PA 2PDWA 3V3WA 4CVUA 4H9ZA 2XWEA 2R8WA 3VYLA 3OLIA 4PGLA 4AX6A 3A22A 3IC9A 4OUIA 3W24A 4MAVA 3RJXA 4JYFA 5K2ZA 1A3HA 4KEUA 5LNWA 5AZ1A 1RALA 4LSBA 4ZEPA 3PPHA 4KRUA 3UVAA 3W1TA 2DFAA 2Y24A 5CAHA 3LV6A 1P6CA 3V5CA 3MMWA 4AIOA 5CZTA 4WKHA 1MO0A 1LCOA 5HUPA 4E38A 1ZMCA 5KMYA 2FH8A 4ADSA 3N12A 1AMYA 2FPYA 2NUXA 1TPFA 2Q8LA 3FHQA 1ICQA 4RZBA 5FJUA 5LNRA 4AUBA 1GCYA 4GPNA 1XLMA 1W1B1 4S1FA 4J28A 4AHOA 3P3BA 3LTSA 5I3HA 5CH9A 2ZZ5A 5JCLA 4XAPA 2J13A 4AD4A 2I5QA 2VCBA 3OVQA 4LEQA 2V63A 1E1FA 1CXIA 3RILA 4DWSB 1JYNA 5DFAA 1M6IA 4QLKA 3KRUA 2C3DA 4OBSA 3QFBA 4M7SA 4BCEA 2QDGA 1JGIA 3LNPA 3UXKA 4CU7A 1ME9A 4F0HA 1HT6A 2KX9A 1AODA 3LA4A 2NT1A 1BLIA 3PJTA 3CEUA 1Z7AA 1UQZA 1BSLA 4UIOA 1Q85A 1W3KA 3ZXWA 2G41A 2QMKA 4H4XA 2ZUVA 4MB1A 1FWSA 3HGJA 1NHSA 4QJ1A 3UETA 5DY2A 2E1WA 1BEUA 3GRSA 3EMCA 3W37A 1O5QA 2VC7A 3CUGA 2ANUA 3ARXA 4RNHA 4UR7A 1H1NA 2Y8VA 3ZT6A 1FX6A 3MZNA 4HYRA 4IPPA 1ECQA 5G1YA 1FDYA 2A4AA 1VFFA 3GTHA 4W84A 2JIEA 1HL2A 1JCLA 5DRCA 4BV6A 2UY4A 3IJDA 1KM1A 3CH0A 1J10A 3EWWA 1G4TA 4K7YA 3MKVA 3WJYA 4KEZA 2VFDA 4IM4A 3VNKA 3NZPA 2G4FA 1Q4WA 1DNCA 3M6YA 3MJMA 5I09A 3N04A 5CGQA 5DCEA 1AUSL 1RJQA 2DVTA 4POCA 4NX0A 3QV6A 1HKWA 3FJLA 4B5NA 4HTYA 2RH9A 5HINA 1I4NA 2DZSA 3KWXA 4QS5A 5FSEC 4WD0A 4A4AA 3H2AA 1LRTA 1NJJA 3VMOA 3ZOAA 1GZGA 1RY0A 3ZJ8A 4E8CA 4O8RA 3ZT5A 3GXIA 3APGA 5AECA 3V5FA 4ZOEA 2GQAA 2PWEA 2HPMA 5EB8A 3KDNA 4XIAA 5TQLA 5A6BA 6XIAA 4OJYA 1QRQA 4KCVA 2RKXA 1KLYA 1XCFA 2E7FA 3L4VA 4KH2A 1VCVA 5DBUA 4PC8A 3L21A 2ZXAA 1FBAA 1AH3A 4M6PA 3CZ8A 3SCSA 3N4AA 3O7UA 1LBFA 1ZGDA 4JTAA 1BVWA 4H2HA 4ZXLA 1W17A 4AG0A 4IJRA 4HNVA 3HQOA 3CL6A 4AMCA 1WZLA 1PDZA 2INZA 3WFAA 4FEZA 1Q7ZA 2PTYA 3EMQA 2PLJA 1LOLA 4OU1A 1E15A 2QCLA 3N6JA 2G96A 4FNRA 3FA4A 3SCWA 3SM0A 2JIWA 1JXKA 4GKLA 5CZJA 5C7VA 2BHZA 5A8PA 2H8ZA 1V93A 1K8ZA 2XVGA 4IICA 1PSCA 3GU2A 3LQLA 4J5NA 1OYCA 1VFMA 4GH3A 4XAYA 5HQEA 1FFRA 4UNLA 1V3JA 1S2CA 3K2GA 1V3HA 5HR6A 3TR9A 2NQ9A 2BGQA 3VX0A 4D8LA 3VMPA 4ZSUA 3CQJA 1HJVA 5HR7A 4FS9A 2VR4A 3LZ5A 1XGEA 1PKNA 1UJQA 2XFRA 2QJHA 3DX5A 4GXWA 3MCMA 1XW8A 1KD0A 4B15A 5ER0A 3S9IA 3LXBA 4GNKB 4CN4A 1UMYA 3AWOA 3U0HA 1H1YA 3IGHX 4XD3A 2OQHA 7PTDA 1CLKA 5I24A 5D9NA 1FFUC 2FYMA 2I5GA 2Z6JA 5DMLA 4EMJA 5FEPA 3PULA 2C1HA 4LH8A 2QCCA 1F4HA 1VIWA 1DP0A 2R1NA 2DZAA 3QHOA 2WJEA 2XGIA 4GD0A 2FLIA 3IANA 3GY1A 4Y9MA 2GDVA 1HNYA 5FJIA 1SMAA 2E40A 1FH9A 2A3BA 2V2HA 2VRJA 3TX9A 3GHTA 1OIFA 4DPQA 1CXHA 1ONFA 4UTTA 1JPIA 1VC4A 5IOBA 4DI8A 1OFPA 3B9EA 1QI4A 4RX0A 4KFOA 4MPKA 2WQDA 1X2HA 4YS1A 3MC5A 2FTPA 3LSBA 1XLBA 2W4XA 3SUWA 1K7XA 3C61A 2BTMA 3F2DA 3I10A 3RG6A 4C6QA 4H7CA 1YW1A 2HQMA 1MUCA 4IXHA 2WK2A 3WQFA 3O16A 4RV8A 4DM2A 1VCFA 1EQCA 2QCDA 4GXPA 2EQ6A 1C7SA 4PB4A 4XAZA 2WMKA 3W2UA 3T05A 1R5YA 3ZFHA 4QBXA 5FF7A 4IIHA 3TK7A 3HB9A 1KRCC 4D8ZA 5I02A 1NARA 2PGWA 4W8AA 4J9JA 3ZR5A 1TPB1 4CQ8A 2XSBA 3LCWA 3LXAA 4UQBA 1CB7B 3F4DA 4X9YA 4GIYA 4LB4A 3F5LA 1IE7C 3TH6A 1OF6A 1W6TA 1EIXA 1KR0A 1E0UA 2YW3A 5L6UA 3VVGA 1MUMA 2BASA 1RQEA 2PODA 3N25A 1R8LA 4U2YA 1UUQA 1CXKA 4MWAC 3GDBA 5I3IA 3STFA 2HTMA 5GNYA 2WHLA 4PFMA 3UPBA 3BJTA 3B8TA 2YAUA 4AWEA 2BODX 4I7UA 3GB6A 2D2GA 3NO5A 3LY0A 1JRBA 3BG5A 3W22A 3AOFA 4D9PA 1FP8A 4HNUA 1K7FA 4EM4A 2VR2A 4B5TA 4C6EA 6REQA 5HQMA 3EWXA 2J8FA 2QJIA 1JZ2A 2ATSA 4KPLA 2TAAA 4NNAA 1DIEA 4ZA0A 2OZ0A 4H50A 1XDMA 1UR1A 3W27A 2BVWA 2DW7A 3B8SA 3N2CA 4YXGA 2V38A 3T6CA 1KXVA 5E0CA 3AHVA 2RAGA 2WW5A 1UA3A 2RDXA 2BC1A 5I07A 5GJMA 3HQNA 3DN5A 2E3ZA 1KFLA 1G69A 2Z7KA 3BZJA 4ADUA 1FCBA 4H6EA 3LADA 3K8LA 5CSUA 1DE6A 4LOCA 1TV5A 1E4MM 1MW1A 3T8LA 1V3KA 4MZ1A 2YSWA 1XC6A 2QYGA 3G1HA 1C8XA 3V1PA 1OFDA 5C71A 4OWGA 2POTA 3BPWA 1CX9A 1XLEA 3PBWA 3WUEA 2X1SA 3W2MA 4CNPA 3C2VA 2WQPA 4PMXA 3NQDA 4YTTA 1ZZMA 3CHFA 4BWLC 1POJA 3NZRA 3TC6A 4JS3A 1SJDA 1JF5A 5BXSA 3KLKA 1TELA 3VKDA 4RE2A 3SRKA 3A64A 3PP7A 1W3LA 4OOUA 1BTCA 2DP3A 4WEVX 1OJTA 2GUBA 5TBOA 3GUGA 4N4PA 3KBJA 3DIPA 1XV8A 1DE5A 4DELA 1SJCA 4O4VA 3RFAA 1QPRA 1ISYA 4RE0A 2PCEA 4FIRA 5BNKA 2VTFA 1BWLA 4EP8C 4YVVA 1UD8A 4L5ZA 1GOOA 1E9IA 4K37A 2YXGA 3KFTA 1Q6OA 1RPXA 1TR1A 1JEZA 3FA5A 1V6VA 1OCJA 1YTKA 1NP0A 3BOLA 2D0FA 4HMDA 3VKJA 4JR5A 4H01A 1JCMP 1XLDA 4MWAB 4HVXA 3WFLA 4C6IA 3CUXA 3EANA 4MB5A 3BAYA 3UNTA 3NOEA 3MP4A 4GUHA 4X63A 2WP6A 2WSKA 3UCDA 3ID7A 4Q4SA 2DIKA 5ENLA 4QTGA 2PSNA 3VXGA 2XH0A 2PDFA 1RUSA 3D5HA 2ZWZA 4AYGA 3PG8A 2YLAA 1K1DA 3CV7A 4B9ZA 3O06A 3PTMA 3S1GA 1VPQA 4O17A 4R85A 3R1ZA 4S3FA 1K4QA 3W7KA 2PURA 3A6OA 4MKVA 4KBXA 4TX9A 2CZDA 3P62A 3VNYA 3KOWA 2ZUSA 2XISA 3P60A 3EOUA 4TVWA 3O6DA 2BVTA 4PBEA 3I4KA 1O7AA 4LJ3A 4Y8FA 3CYVA 3W75A 4H8NA 1VH7A 4UTFA 1UD4A 1WKDA 1CBGA 4U28A 4PA8A 1XGDA 3QOKA 5AB3A 3V5OA 1WYIA 2YDAA 3J7HA 1A5BA 3N9KA 1ZP4A 4W85A 3KVMA 3U3HA 3MWAA 4Z2HA 1F3PA 5JBFA 2GR2A 2VP8A 3NYDA 5CZSA 3H4WA 3WCZA 1N61C 4S3AA 1KBLA 1MNZA 4DBWA 2J74A 1QHPA 3AJXA 3PZNA 5GRTA 3PANA 4H4RA 2G3IA 4JL1A 4PUKA 2V3FA 1Q6FA 3MI3A 3THQA 3KL3A 4JEQA 2RABA 4JY8A 1DWIM 1TV8A 3RLUA 1ECEA 4J3UA 2OPJA 2Y7GA 4I5UA 3HPXA 3TN5A 1E6ZA 4IFKB 4O0QA 2PRLA 3VIIA 3CIXA 4LYRA 3TYDA 8RUCA 2WMJA 1OCBA 4C65A 2NQJA 2E8ZA 1KV5A 2CHOA 2JGYA 4YTQA 3UXAA 2OZ3A 4P7QA 4L4PA 3GM8A 1DXIA 3LCLA 2QEZA 4IMFA 4LUTA 4M80A 3N9SA 3LHVA 4XBKA 1WE5A 6CGTA 1OB0A 1TWWA 3QC3A 3T81A 3VDCA 1KRAC 4HCHA 3VDGA 1J9YA 1QNPA 1KWGA 3Q2DA 3S2MA 3F1QA 3OZYA 1EF3A 1XBVA 4NSBA 5CC7A 2UY3A 4Z0JA 1UUMA 1QT1A 1D7KA 4RPQA 1YNYA 4S2CA 1ZBVA 1JI1A 1XIBA 3QQWA 3TN6A 4YTSA 1OINA 1XYFA 2HISA 4GINA 5F2IA 4WSKA 2VQUA 1N82A 4QG6A 1W5QA 3AQUA 3DYPA 5GQBA 3TAKA 1JCYA 5BMXA 1WPCA 1XRTA 3W01A 3GR4A 3W7NA 3UG5A 2ZTJA 3G2GA 1GKPA 5C9WA 3SCTA 5HPOA 3VNZA 1D2KA 4V27A 4DYJA 1GEUA 4AEFA 4GRSA 4F8XA 3REQB 1UZ1A 4ZSTA 2NXHA 3EXRA 2RGMA 3NEVA 2Z25A 3ISIX 3LS9A 3TOYA 4KWVA 3MT1A 1HGWA 5BOFA 3CGCA 2QCEA 2ZRYA 3BLPX 1RCQA 1Q8JA 4WHBA 2PA6A 3H12A 1EC7A 4IIFA 3O6YX 2GOKA 1MI3A 1ZY8A 1KFWA 4ZR8A 3OLEA 2Q6ZA 2NQ5A 4JN6A 3CAVA 2DZUA 3CQ0A 1O68A 2BY1A 3K1DA 3R0DA 5E9AA 1KXQA 1UPMB 2VELA 1S5TA 5EFFA 1MOKA 4XTDA 1Z89A 3DC0A 4PMRA 1EZ2A 4REQA 4Z2KA 4QJ5B 3O0KA 2QLYA 1Q6GA 1JAEA 4W86A 1NDZA 1ISWA 3TN3A 3TQVA 3V1HA 4PULA 1D7YA 3FLUA 3HGRA 2GQ9A 3VX1A 3FHAA 4D6DA 2DGAA 3AIQA 1GVFA 2F61A 1XYCA 5AC5A 3U2EA 4QHRA 1VF8A 4TMCA 3TCEA 4DJFA 4J4KA 3N3TA 1DL3A 2V5BA 1RV8A 3EOSA 3WQOA 1ISVA 1QI3A 4R7OA 2WNWA 2DSVA 3EF6A 1JNEA 5CJ5A 5EA9A 3ABRA 3C0LA 3URAA 4IUGA 4ASTA 3GUWA 2ODOA 1DQXA 2YYUA 1T0OA 3CZKA 2W6RA 3CV2A 3C2OA 4MG4A 3W7CA 4Z17A 1L6SA 2Q01A 4BQ2A 3SRFA 5D9MA 3DBPA 1LG2A 4IMGA 5LGXA 4TVDA 1B31A 4UQAA 4LBSA 2XJ7A 4J3WA 5CSYA 3B40A 2PTWA 6ENLA 4V1YA 3EDJA 3VCCA 1FVPA 3UWZA 2CEQA 2P0OA 1E55A 1E6QM 5JUVA 1VBJA 3ZSTA 5B7ZA 4GMEA 3FXYA 2D2HA 5AZ0A 2XYLA 5BU9A 3TJLA 1GTHA 4I6VA 1SFLA 1TR9A 1PZ3A 1PHWA 3HIJA 3W26A 5M3WA 3O05A 1UIOA 4Z0SA 3ZWSA 3IIZA 2VUYA 2GJNA 1WNOA 3CQKA 3M7SA 2I56A 4F9DA 1EBGA 5G4HC 4BEUA 3KVKA 3E0IA 3IUDA 3SSJA 1VHNA 3FYPA 2V6OA 1M53A 5FIPA 3JR2A 3ETRB 5A6TC 2J7DA 3DESA 4QAIA 3L5AA 1Q7QA 3AHTA 1CDGA 2GZXA 1J8VA 1REQA 5A8MA 3W6LA 3H70A 3AN1A 4Z1AA 4LYKA 3CT7A 2WNNA 4X60A 2O7SA 5BOOA 2B7OA 2J8TA 9RUBA 2HWGA 3EYPA 1DEDA 3WDJA 4IL0A 4JPGA 4LVBA 2CKSA 1PVNA 2G5WA 3OLDA 4NAEB 4A8NA 3CPRA 3WQWA 2ACQA 1G9HA 3WKZA 4YWOA 4IFOA 1GXFA 2C16A 3GNDA 3BWWA 3VGHA 3WK2A 3H2EA 3L7RA 1X6UA 5B80A 2ZCGA 3CIVA 4J1OA 1RM6B 2OB3A 5A6MA 4XD6A 4IGHA 1QI5A 4WJXA 1IYXA 4ES4A 3HRDC 1UP3A 2OLAA 5ABHA 3M0JA 3AXXA 2JFEX 4GBUA 4M82A 4DZHA 4NVTA 4UTLA 4GZJA 2YXOA 3H23A 1HX0A 3PZQA 4O1CA 1WKEA 1VEPA 1PYMA 1T96A 3OZMA 4FDCB 2D3LA 2J77A 1RVKA 3GVGA 3WUBA 1F4AA 3CB3A 4GZIA 3FVMA 4QEEA 1Q6RA 1PX3A 4MPQA 2JE8A 4OFCA 1GGOA 1K77A 3AMCA 3Q67A 5A3HA 4YWIA 4DJED 3LPGA 2E5CA 2OFJA 1JIBA 2Q3RA 1VBHA 2WNQA 3DU0A 4TX6A 4HOWA 4NJJA 1GJUA 2OEKA 5JMUA 4F0LA 3VNMA 2PPGA 1W31A 3GH4A 3CJPA 2CW6A 1TTIA 3UCCA 3ZJ7A 5BWFA 3IGSA 1VJSA 2H90A 3WO8A 3VD9A 4NJHA 1TWZA 1GKRA 1GQJA 5EU9A 2OQLA 1V3LA 3CMJA 2YL8A 4DBUA 2Z00A 5CBBA 1D8CA 4NRSA 4LC8A 4S3JA 1TTJA 3WDIA 3PB0A 4LUIA 2OTDA 4GOAA 3WJZA 3OW1A 2PZ0A 1F5ZA 1NHPA 1TKKA 2J78A 3M9YA 5DF0A 1K4HA 2CZVA 3BCDA 3BSGA 3WF3A 2J79A 4DZ5A 1NELA 3URQA 2WJZA 4AFYA 1ZAJA 3E02A 2Q02A 3LHTA 1ZY9A 2XH2A 1QW8A 1DTUA 2W67A 3NG3A 5KZDA 3VNIA 1ZU8A 3B9NA 2V2CA 2FHCA 4KW2A 3AMKA 2CBVA 4Z2LA 3VOJA 1S2AA 2PDGA 3AALA 3A3HA 3L65A 3BARA 4FNPA 3CASA 5BRQA 4NNBA 4DM1A 2O0TA 4RZ5A 3T0AA 1DWAM 3TXZA 4JTTA 4MTVA 3MV01 1HKVA 2H9AA 4FNUA 3GSMA 3WQ6A 2PRHA 4Z42C 2DUXA 2QDEA 2DZXA 1NOFA 1EJRC 1VPXA 2GVJA 4X9SA 3SY5A 1R3TA 2GVYA 4ZO7A 2YOCA 2POZA 3CZEA 4GZ7A 3C2EA 2VO5A 3LDVA 3GNPA 5IDIA 3EWUA 3A21A 2ALRA 3WN6A 3H4XA 2ZZCA 4RXGA 5A95A 3V36A 4O19A 3BDKA 4A8IA 3IPWA 4DNMA 2TPRA 4BQ5A 3L68A 1YPFA 3CV1A 3WIJA 4LY4A 4AWTA 1SM9A 3QYQA 3EKLA 1ZHAA 1GREA 4I9TA 2GVEA 2DT1A 7REQB 3QY6A 3IIVA 2QS8A 5FACA 1A5UA 3C6CA 1ZB5A 1N8WA 4UB9A 2GPTA 4K2SA 1JRPA 2J25A 1YQ2A 4NF7A 1WZKA 1ZMDA 1YADA 3EPMA 3BG9A 4BQ4A 1A0CA 4EE9A 1LG1A 3K1GA 3OOQA 3VM5A 2BY3A 2G0WA 5HWNA 3NFUA 3QSRA 1Z69A 3P0XA 4FIQA 2X7WA 2ZRVA 4IH3A 5EMLA 1PWMA 5E6ZA 1BG9A 4K39A 2GJRA 1POKA 1GQNA 3S9YA 1ADDA 3R11A 1X1ZA 3WF1A 4ZQOA 4GO8A 2PAJA 4X22A 3NDYA 3QY8A 2CDUA 4XO6A 2EXOA 1B3YA 2W27A 4RJEA 1QPOA 1H60A 3AFBA 1G5AA 2O4QA 5CAKA 1KCXA 4YTRA 2GGEA 2YBVA 4M52A 4XZHA 3H7RA 3VFLA 1W56A 3AMDA 1A53A 3B8IA 4LIIA 5E9XA 2PDCA 3C4UA 2BC0A 3VC6A 4Q4KA 5BXTA 4C1NB 3MKCA 1JQXA 2CHRA 3APYA 2QGYA 2Q8XA 3MVIA 2EQDA 2UWFA 4HOZA 1W1VA 3UG4A 3BH4A 2QUVA 4AZCA 1HN1A 2ZBTA 3R94A 3R6IA 1BAGA 5FMHA 1ISZA 2J75A 1E0XA 2OEMA 1JF6A 2EPKX 3APTA 3ENLA 1SZRA 1S1PA 1H09A 2VWTA 3OEXA 4IJCA 1US0A 3G18A 4O12A 1OC7A 4N9CA 2ZXBA 1AQ0A 2NPXA 1SJAA 1DJGA 2XU2A 3W7IA 2PDKA 3KL5A 3ZQ9A 2MNRA 4J3ZA 2DZPA 1ZX9A 1SFJA 1W32A 4PTDA 4N7QA 2FQIA 4KESA 3GLCA 4MAZA 1BHGA 1FOBA 5CZ0A 3ANYA 3R25A 4GCXA 1ZJAA 1DQWA 3QRHA 4WGHA 1EGMA 3RO6A 4M7TA 4NJKA 1M65A 4U5IA 3WLTA 2GWNA 4PB5A 1GW1A 4MM1A 4PMQA 1JDAA 4I3GA 3SGUA 4NU7A 4UTHA 4HPHA 4XQ6A 3WJSA 4X0VA 1MWOA 3O0FA 4Q8NA 3DERA 4S3BA 3DCPA 3VGEA 4E0CA 4L4MA 4MKNA 2VKZG 3BMVA 5AFDA 3CMGA 4M0XA 1TQJA 3NO3A 2WJDA 3QTPA 5LA2A 3UWWA 3HJEA 5BOEA 3COTA 1H7NA 3A23A 3KCJA 1V03A 3LGDA 1RLCL 4HZ8A 1GG0A 3L0NA 1ZP3A 1R0MA 3VIMA 1MRQA 3GTIA 4IF2A 1DHPA 1YNQA 1DTNA 1T41A 2ALDA 1TE6A 2WSQA 3E2SA 3V75A 5G5IA 4FOUA 5FJJA 4Q7IA 2A3LA 1UWSA 2WCAA 3FSUA 1DXFA 4LUYA 3WF0A 4CQAA 4FSAA 4BF7A 2VEIA 5CG0A 3UWUA 3RGTA 1KBKA 4J3XA 4Q8TA 1FWIC 1KNWA 2YVFA 4Q4PA 3IV8A 3R2GA 1RCXB 3ATZA 3QV7A 1EYWA 4MUZA 3CO8A 3NCOA 4MZYA 3GG1A 3U2CA 5I3DA 4MIMA 4Y9OA 3FS2A 3FAWA 3OU8A 1UR2A 4IQDA 3LLDA 3G0XA 1TWIA 3M0XA 3PWGA 1QOQA 1PX4A 3E96A 3UXLA 3UZ5A 2NXGA 1K8YA 4DEFA 3LX9A 2Z1KA 3W1XA 1B3OA 4WY0B 1CENA 1T8QA 3LU2A 4WDTA 3ZZ1A 2UBPC 4O54A 1KQYA 4GJ1A 3AYRA 3BQ6A 1O6IA 3U4FA 1TVNA 4UCFA 3UJ2A 3CWHA 3AIEA 3RLGA 4WX2A 3TNOA 1UD2A 4HK6A 1EJSC 2H8XA 1W37A 4H3DA 2TODA 4R88A 2WVVA 3NXFA 4QE1A 3GHUA 1SR0A 4C6OA 2H3DA 2W0UA 1UIPA 2NV9A 4AWSA 1VIZA 2ZUWA 4HMEA 1SZFA 3WLIA 5HJYA 3USZA 3GU9A 1GVSA 3HMCA 3BANA 1T99A 1FWFC 3ZSSA 2Y63A 2PP3A 3AS1A 2CCRA 3ANVA 1R9XA 1JYWA 1MW3A 4QG9A 4HT3A 1ZJHA 3NPWA 3WYZA 4PMZA 3CXBA 1HIZA 4UOJA 3PWIA 1MVYA 4HU3A 2PP1A 1CT5A 3UZZA 4CD5A 2ZRZA 4ZL1A 1E9YB 4LTSA 2V68A 3O2LA 3NS1B 3C8NA 1B3XA 2VMFA 2Z7GA 4H9YA 5T9CE 7ODCA 3VOHA 3NZGA 3XINA 1TCDA 5HWJA 2VCAA 3EUB3 4XBJA 1TB3A 1UOZA 3DGHA 1V6TA 1GRAA 2UV8G 5HNUA 4FA3A 1QHOA 3WLNA 1U5VA 3OVRA 1H11A 1E40A 4EXAA 4WRHA 4ORIA 5D30A 1YXCA 2AGTA 4OV4A 1ZCCA 5I78A 3HA1A 4IQJA 3KTCA 4QQUA 3I4EA 4AIEA 1PKYA 3JU2A 1QAPA 2VX6A 2PZNA 2XFWA 2JKPA 2E6AA 4DB7A 4G8TA 4ACZB 5I6SA 2GH5A 1DQUA 3E0VA 5EBKA 3IV3A 2W0HA 3H4KA 1C8VA 3NNTA 2X41A 2NQHA 2YL5A 1M6JA 1E6NA 5REQA 1XISA 4UOQA 3WD2A 1MW2A 3I6EA 2PD9A 3SGGA 3BMXA 4NUWA 2CIPA 2WPGA 3HF3A 2VURA 4PMUA 4APNA 3CH9A 2GQWA 4UTWC 4UQCA 5U1OA 1B9ZA 3A4AA 2BXZA 4IIEA 5IFTA 3GXPA 4H4TA 1SW7A 5T9BG 4QQ3A 1ZKQA 3PBUA 2HRWA 3GFXA 3DHDA 3S1VA 4CGTA 3BL3A 1A5LC 2YCLB 2NWSA 1AH0A 3MSRA 4CNNA 4GJIA 1NP2A 1UOKA 2VI0A 2WMIA 1P1MA 4GYPC 1HP4A 3TW6A 3CL7A 4UFMA 1OK4A 4WOZA 4C6NA 4RZ6A 1NWTA 3UESA 1M7XA 3NZQA 3WDHA 5C2XA 4WXZA 1NOWA 5EMJA 4LANA 4GCAA 2PDJA 1KRBC 4GK8A 2F6XA 4ACYA 1UKQA 3PZVA 4MFEA 5LHEA 3GC4A 1J96A 4EX4A 3N6HA 3E38A 3TYAA 1FHVA 3ITXA 1VYRA 3SY8A 1GYMA 1X7IA 3DHPA 4P8UA 5F2GA 3L66A 3DYMA 4BY3A 4AMAA 4P7RA 2NV2A 2ZA3A 3EB3A 1GWJA 4CNTA 1LROA 3TCSA 5FEZA 2DT2A 4US6A 1TYPA 2OG9A 4DAIA 1L2QA 1J0YA 4H4UA 1BYCA 1H41A 4Q7BA 1P48A 1XINA 1H5YA 2CPUA 2P5NA 2J66A 5TAOA 2Z6IA 2YFOA 3R13A 4CQ9A 1X7FA 1WAWA 1QHZA 1EQPA 4LW7A 2AAAA 2VUNA 3K13A 4HTBA 1W9XA 1TMLA 1UWRA 1BFNA 4PL1A 2QHAA 4E2DA 1F73A 5C0QA 5JH2A 5BWAA 3OLGA 3MANA 3PJUA 3QPEA 1ESWA 2VGGA 3QLLA 1EBDA 4RR4A 2VYOA 4IOTA 1CWYA 3W87A 1ZFJA 4UBPC 5EMKA 5G4WA 3IJ8A 2QJGA 4GYFA 3ARPA 1ZK7A 4A3HA 4MB4A 4ZFCA 3CTTA 2Y0FA 5H2ZA 3AU6A 1C9DA 3D47A 3DFPA 3KP1A 4LQ1A 1SPQA 1K02A 2QR6A 1KCZA 1RSCA 1WDPA 4U10A 1U5HA 4Y2WA 3BICA 1UR4A 3LGGA 3I6TA 5BRBA 3NQMA 1UZHA 1ZTVA 3OZPA 1B90A 3LI1A 1EYEA 2I17A 2V5KA 2XVPA 1IT8A 2QCHA 2VZSA 3M07A 1X8FA 2V3GA 3OHMB 1JI2A 5A5WA 1XSJA 4DWSA 1G01A 1NVMA 3Q94A 4P2VA 3BC9A 1KFEA 3OC4A 4OBRA 3NM3A 1LJYA 3EWCA 1BZLA 1A5KC 5D04C 4Z1YA 2FDSA 3NVVB 2HBVA 4AF0B 1C90A 3OB8A 1C8QA 4XUGA 1DJXA 3GD6A 5HMEA 1D3HA 5KTLA 4QNEA 5H8PA 4MJZA 1PEZA 3GO2A 4I9AA 1VEMA 3URBA 2X8GA 2F5ZA 1JDFA 1WBHA 5AHIA 1US3A 1OFEA 3IVTA 5DMNA 3BV7A 3IS4A 3MSGA 3GDMA 2HK1A 4L1XA 1FWEC 2CNCA 5C7HA 4C7GA 1V0KA 4B5XA 1XX1A 1QI0A 3ONCA 3RPMA 3G6LA 4YNGA 2WZIA 2PP0A 2X0SA 2ZKMX 5D09A 1KCLA 4XZIA 1GVIA 5G5GB 4GYKA 3ZJKA 5DT7A 3HG4A 3CU2A 3W76A 4Q4RA 3AO0A 1F07A 1KFKA 3VUSA 3AM9A 1V77A 3ITYA 2RDWA 4L65A 3A5VA 3W7MA 4E3VA 1TIMA 3VGGA 3NQ8A 1M5WA 3WQPA 1NDVA 3IGXA 5CPMA 3LM3A 4GJJA 4EAYA 1KQZA 3C56A 1UMLA 4WQ6A 1UROA 1AA1B 2ZC1A 5XIAA 4QSFA 1FWWA 4G7EB 3LQGA 3SIZA 1L2UA 2ZE0A 3EPNA 3PZMA 5LIUX 5A8QA 3TWAA 3RJYA 3NAVA 1VQTA 1JG9A 1XI3A 4PBFA 1LYXA 4NEWA 1QK2A 1XSIA 2Z27A 3G8RA 3H24A 4FI4A 4PRRA 5HBFA 2QVNA 2WHKA 1F3WA 2DDXA 2WHMA 4EANA 1SSGA 2JF6A 3UWVA 4F0SA 4IPLA 2VFHA 4AZIA 3LLXA 2F2HA 5FJTA 3I7QA 2VGIA 3UPWA 2HQAA 3O0HA 3FEMA 1S46A 1CTNA 4L9YA 1EJTC 4ICMA 3SRHA 4Z2IA 1BWCA 2FZ9A 2NXIA 4Q3MA 4GIEA 4H1ZA 5A6LA 3UR2A 4G1KA 3T55A 5U25A 5IBXC 2DSUA 2QKFA 1MDLA 2QUMA 3FEQA 3U5UA 3VIKA 2R1PA 3BOFA 3DENA 5CGMA 4UXDA 3O8AA 3G1FA 3CUFA 4G1NA 4CQDA 1FWTA 4JQ3A 2G3NA 3IJ9A 4DN1A 1C91A 4FOKA 1H0GA 3MI6A 1ZBCA 4GUIA 5FSDC 1JULA 1V6XA 4O1FA 3RUBL 1NHRA 1VS1A 3T2PA 3WD4A 4DXVA 4NP7A 1B57A 1ZDLA 3UW6A 1HG3A 2OYKA 2WZMA 2GUUA 1I0DA 3L4TA 3T4WA 4C5YA 2VOMA 3NVWB 2EQ9A 1U1HA 1E72M 3W2JA 3IIXA 4PCTA 5A8GA 1OABA 2NQLA 1M04A 1SO4A 3WQ8A 2DUAA 3P67A 2DVXA 1TPDA 4WKAA 3AISA 5TR3A 2WKJA 3TW7A 2PDUA 1K8CA 2VM8A 3TA6A 2VEGA 1M7JA 4FLQA 1S7MA 1FKWA 5BRPA 5A6JA 4H9TA 1RLDA 4Y6GA 4FXRA 4H8UA 1XH0A 3CL8A 3U4AA 4EM3A 5A1AA 1DORA 1ZQ5A 2FDMA 2VEFA 4JTEA 5AYZA 5MKGB 3IAQA 3MDWA 5CQ1A 2YZ5A 1ZUAX 3ZO9A 3LXDA 3T07A 2FVLA 8TIMA 1XIIA 4C1LA 3BCJA 5EPDA 3PC0A 3PTDA 1BXBA 4WR3A 4ZB5A 4BHYA 4B3KA 1S3TC 1D3GA 1GVQA 3N3MA 4PFHA 3TC7A 4XKYB 3OJGA 4WUIA 3ABZA 3LMYA 1GT8A 3WNNA 1GHRA 3HU7A 4AWUA 1I1WA 1TV3A 2FB3A 4HJFA 1S2TA 1HJUA 4P7NA 4HYVA 2XM2A 4R34A 2FPVA 3NYZA 4WDUA 1J0ZA 2JEQA 3B03A 4OQVA 4UTTC 4RNJA 2LLEA 3D0CA 1AZ1A 2XVNA 4QGCA 2VQTA 3C3UA 3NQ6A 1UR0A 4O16A 3VAVA 1U1JA 3UZJA 2QZRA 1SGJA 3Q45A 4FF7A 3PM6A 3GDLA 5EY5A 4CNSA 2PTZA 4GI4A 3EDEA 2W62A 1BD0A 1MXDA 1DJYA 4JCMA 1PBGA 5CG7A 1MEWA 1FXQA 3NOYA 3MQTA 4HA4A 1GVYA 3W71A 3MUAA 1NQ6A 4GX8A 3VE7A 1ZJIA 4GNJA 4L6HA 3GWQA 3AUOA 2XIOA 5I06A 1XXXA 3SCVA 1LLZA 3ITTA 5E09A 3T1GA 1O5XA 3AHYA 3M43A 5EBAA 1TMHA 3GBEA 2E28A 3IJ7A 7TIMA 5G1MA 3VC5A 3QQ1A 2BG5A 4GH1A 2VEKA 3C3NA 1OCNA 2VZTA 1K8XA 3G77A 1IF2A 3W6YA 5ECVA 3S5OA 3QMSA 1HF6A 4RKAA 1BTMA 3N17A 2XM1A 3A4WA 4PH6A 1T5AA 1V4YA 3STGA 3GS6A 2G97A 1GZ1A 3AXHA 1CEOA 4C7FA 3ARZA 2E6YA 4JDRA 1H51A 1PXGA 1NWUA 5EYWA 1K03A 3DJGX 2OT1A 2DT0A 1H7OA 1HJXA 4JOMA 2XFYA 4ZB0A 1LOQA 3W7OA 2OU4A 4B9YA 4M29A 4HMNA 2CBJA 1SR9A 3VGFA 2JKAA 1EDTA 3AJ7A 1F8WA 3A12A 2FZMA 2X40A 2VDHA 1XHGA 4Z1BA 3WEMA 4LALA 4EVZA 3M16A 4ADTA 1E3XA 3WNKA 3G24A 4ZTYA 5K9CA 3KLLA 1UHVA 4LA1A 2XZ7A 4INFA 4IMCA 4HCLA 1SSDA 1UR3M 1ME7A 1CZ1A 5G2IA 3WBWA 2PDLA 3QKZA 3RM4A 3GKAA 5KZEA 3KUMA 2YA1A 5HXMA 1M7OA 1L8PA 1EBHA 3WMBA 1