2NQLA

Crystal structure of a member of the enolase superfamily from agrobacterium tumefaciens
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
388
structure length
388
Chain Sequence
b'MNSPIATVEVFTLTQPRKVPYLGALREGEVVNPNGYIVRKGNRTVYPTFDRSVLVRMTTEAGTVGWGETYGIVAPGAVAALINDLLAGFVIGRDASDPSAVYDDLYDMMRVRGYTGGFYVDALAALDIALWDIAGQEAGKSIRDLLGGGVDSFPAYVSGLPERTLKARGELAKYWQDRGFNAFKFATPVADDGPAAEIANLRQVLGPQAKIAADMHWNQTPERALELIAEMQPFDPWFAEAPVWTEDIAGLEKVSKNTDVPIAVGEEWRTHWDMRARIERCRIAIVQPEMGHKGITNFIRIGALAAEHGIDVIPHATVGAGIFLAASLQASSTLSMLKGHEFQHSIFEPNRRLLDGDMDCREGRYHLPSGPGLGVRPSEAALGLIERI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isomerase/lactonizing enzyme
molecule tags Structural genomics, unknown function
source organism Agrobacterium tumefaciens str.
publication title Crystal Structure of Enolase from Agrobacterium Tumefaciens C58
rcsb
total genus 133
structure length 388
sequence length 388
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2nqlA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2nqlA01
1W6TA 3IJLA 3ES7A 1XPYA 4KPLA 3STPA 3EKGA 4H83A 4A3RA 2QJMA 2I5QA 1KKOA 3MSYA 3MUCA 4X2PA 3SSZA 4JN8A 1JDFA 4GYPA 3DG3A 3R0UA 3VDGA 3QKEA 3V5FA 3ENLA 3SBFA 3VC5A 3RR1A 3U4FA 1R0MA 3UJEA 3TQPA 5FJOA 3TTEA 4HNCA 3SQSA 3TWBA 3PWGA 2P8BA 2PCEA 4FI4A 3NO1A 3GO2A 3QLDA 1RVKA 2FKPA 3SN4A 3VCNA 3MWCA 3ZVIA 3FJ4A 4ZCWA 3NZGA 3V5CA 3I6EA 3ZLHA 2OQHA 4IZGA 2PODA 4KWSA 2MNRA 2PTXA 1MDRA 4DN1A 3FCPA 1MDLA 1KKRA 3TCSA 3RO6A 2AKZA 3RITA 3PWIA 2MUCA 1KCZA 3DG7A 3V3WA 1EBHA 2AL2B 3OW1A 2OX4A 3RCYA 4E8GA 6ENLA 3DDMA 3T4WA 2QDEA 2QDDA 4HN8A 2AKMA 3VCCA 2P0IA 1OEPA 2PTYA 4A6GA 3JVAA 2GGIA 3P93A 4HPNA 4E4FA 2PTZA 3GD6A 4Z17A 4G7FA 4M0XA 4E6MA 2OVLA 3FYYA 3I4KA 2GGHA 1R6WA 2AL2A 3CXOA 3R10A 2XH2A 2HNEA 1NELA 3OP2A 4HCDA 3T6CA 1MRAA 1KD0A 3TOYA 3KUMA 1BKHA 4GGBA 4J1OA 3UGVA 1EC7A 3BSMA 4GFIA 1SJCA 1P43A 5EU9A 3TJIA 4IP5A 5FJTA 3T9PA 2PSNA 2PGWA 5ENLA 2PU0A 1L8PA 2XGZA 3DESA 3UJRA 3VA8A 3DIPA 3ZLGA 2XH7A 3S5SA 2OG9A 4YWSA 2PA6A 2OZ8A 1F9CA 3K1GA 1PDYA 2GGJA 3ZLFA 4MGGA 1TZZA 3ZVHA 1YEYA 3S47A 3I6TA 1JPDX 2O56A 1NU5A 3V4BA 3VC6A 4H1ZA 3N6HA 4DYEA 4IP4A 3JZUA 1ONEA 4IL0A 2PMQA 2XSXA 3TJ4A 2OKTA 1BQGA 4JHMA 4J3ZA 2QJNA 4GISA 2RDXA 3Q45A 3UXKA 3DGBA 1P48A 1EBGA 4GGHA 3FV9A 2GGGA 3PK7A 2HXTA 5BOEA 3OTRA 1E9IA 2P8CA 4K8GA 2QVHA 1DTNA 3H70A 3CAWA 4Z1YA 3QTPA 4E5TA 3QPEA 4FP1A 4DX3A 2PGEA 3P0WA 3FVDA 1ECQA 3BOXA 7ENLA 3CB3A 3IK4A 3THUA 3ES8A 5FJRA 3VFCA 3UJFA 2PP1A 4HYRA 4DXKA 3D46A 4MMWA 5IDZA 2AL1A 2POZA 4ENLA 3PFRA 4H2HA 1WUFA 3DFYA 3SJNA 1SJBA 1PDZA 2XH4A 3OPSA 2GDQA 1SJDA 1XS2A 3P3BA 3GC2A 3N4FA 1JPMA 4JN7A 4HCHA 1IYXA 1EC8A 4E4UA 1MNSA 1FHVA 3UJSA 3HPFA 2XH0A 4M6UA 3RRAA 3UCCA 3QN3A 2DW6A 4IL2A 3R1ZA 3R25A 2OO6A 3H7VA 3DG6A 2DW7A 3UXLA 2GL5A 4EWJA 2GGEA 4G8TA 2PS2A 5FJUA 4IT1A 4HCLA 3N6JA 2FYMA 4HNLA 3SN0A 3DFHA 3H8AA 4GIRA 2ZADA 3U9IA 3CT2A 3MZNA 3SN1A 5BOFA 4IHCA 2PPGA 1SJAA 3JW7A 4MKSA 1MUCA 3MKCA 3R0KA 2OLAA 4GYPC 3RGTA 2QQ6A 3TW9A 3UCDA 2PU1A 2PP0A 4K1WA 4KT2A 5FJPA 3OZYA 3T8QA 1ELSA 4A35A 1EC9A 2NQLA 4F4RA 1WUEA 3H12A 3MY9A 2PTWA 3GY1A 3CYJA 2OQYA 3B97A 4DHGA 2QGYA 4ROPA 3IJQA 3OZMA 3CK5A 3NXLA 1TKKA 3D47A 2P88A 3R11A 2HXUA 2ONEA 3N4EA 4H19A 4ZA0A 2OPJA 2ZC8A 2OFJA 3DEQA 2OZ3A 3DERA 1FHUA 2P3ZA 3TWAA 2GSHA 2HZGA 1JCTA 2CHRA 3FXGA 4DWDA 1TE6A 4K2SA 3UJ2A 5J04A 3IJIA 4GMEA 2OZTA 3EEZA 3NFUA 3ZVHB 4KEMA 2QJJA 3Q4DA 2PP3A 3BJSA 3MQTA
chains in the Genus database with same CATH superfamily
3PZ9A 3B9NA 4RW5A 2Z24A 3UZXA 2Q8ZA 2I5QA 4OBSA 1XDJA 1IV8A 1JDFA 4OZOA 3XINA 5HUOA 3RIKA 3QGVA 4MM1A 3PB0A 3QKEA 5D04C 1LQAA 2GK1A 1KA9F 2PUZA 1ZHAA 3ZJ7A 3VC5A 1MVYA 3TAKA 3LZ5A 1RALA 4TU1A 1DOSA 4C7GA 3TTEA 3U8GA 4CD5A 3WMBA 3RMEA 1DEDA 1E3XA 4CQAA 3M64A 3CZGA 1VP5A 3SN4A 4EQSA 1R5YA 3NQMA 3FJ4A 4QR6A 2FGLA 4E2VA 4PSPA 1WZAA 1S46A 2WZHA 1RR2A 2XZ7A 5G1TA 2DH3A 1JCLA 4JDYA 3II1A 1DBTA 2ZRXA 1VFHA 4HSNA 3LPOA 4DXXA 1OT2A 5LZLA 3PWIA 4HBKA 4XBSA 2QULA 3KTCA 1WDPA 4ERIA 1AVAA 1DKWA 1DV7A 1TPWA 1WDWA 3UPWA 3AYSA 1Q3NA 1DIEA 3JVAA 3S2CA 3FGCB 3QY7A 1N60C 2PDCA 3LHWA 1CGYA 1SB3B 2REQA 2OELA 4HU8A 5KVIA 1KM6A 4FF5A 5CPMA 3WQOA 2RHGA 5KINA 1MO9A 2PFHA 2HNEA 2Z1SA 2PURA 3E0FA 1H11A 4IWWA 2FHFA 4I9AA 3ITTA 4UTFA 3PAJA 1US3A 2ISDA 4O1BA 1M7PA 1GERA 3PBUA 2TPRA 4HT3A 2Y89A 1XRFA 4AY1A 3NO5A 3CZKA 4N0RA 2YA1A 1SFSA 5D03A 2Y2WA 4PTVA 1OHLA 4XZIA 3EA1A 1SW0A 4AYSA 1B3OA 3KTXA 2R1KA 1HZYA 2XFWA 2BXZA 4KRZA 4AD4A 3POHA 4U31A 3RK8A 3W7LA 2OO0A 4LAZA 2HS6A 1JXJA 1HVXA 2DUZA 4AY7A 2PA6A 2ZZ1A 2WVTA 1AH0A 1OFBA 3EGJA 1J18A 4LBRA 5U4NA 1FWIC 1PDYA 2WNZA 3LN3A 5AYXA 3EXSA 1XLAA 4ORIA 2CHOA 1VHCA 2WHLA 3EMQA 4FDCB 3MC5A 3OVQA 4XKMA 4GY0A 5AHEA 1KRMA 1FWJC 3OGVA 1PEZA 4U5KA 1S3HA 4WDTA 1S38A 3V4BA 1HJVA 3IJ9A 2C13A 1E4LA 3ARSA 4AEOA 1TQJA 3LCGA 1AOGA 1IEWA 4UR9A 2EJ1A 4BI5A 5LIKX 2BFGA 1E1CB 3QSRA 4TVUA 1BQGA 3AALA 2BSLA 2CFFA 2ODOA 4WOQA 1PKLA 3VABA 3DGHA 4H4WA 2Y88A 1JG9A 3RUBL 4B5XA 3CQJA 3CGCA 1KXVA 3EWYA 3WBAA 2FTWA 1A4LA 1PKYA 4E8DA 1UPPA 3LV5A 5FJJA 1LVLA 3RLUA 5BNKA 4GPNA 4H9UA 2XZ9A 4K6AA 1LL6A 2J8GA 3TE9A 3W29A 3B0UX 2E68A 3OEXA 3WBEA 1EJVC 3PM6A 5FESA 4GYJA 1XCXA 1VKFA 1MEWA 4OHQA 1KCLA 2CETA 4MPKA 1SJBA 1FWNA 2A6NA 4IIDA 1FEAA 1VYRA 1ICPA 1P0BA 4JIEA 2JFEX 2NXGA 3PZNA 4XZNX 5I3HA 3RU8X 1IEVA 3BSGA 4NAEB 3P0XA 5M1TA 1Y7VA 2V0TA 1HX0A 1OM0A 3UG3A 1UMYA 1ITXA 1VBGA 2EQDA 4UTIA 5D8WA 2JKAA 2DVXA 3ALFA 3G1SA 2GL5A 4PYSA 4IOTA 2X1TA 2OEMA 2QPUA 1QPRA 1R7AA 5LGZA 3TAOA 1RM6B 3P81A 2GJXA 3URQA 1NTHA 1O5XA 3TN5A 3L23A 3M47A 4Q3MA 3U9IA 1HF6A 2VGBA 5GJPA 3E38A 2XSAA 3EB2A 1S7MA 3UG5A 2PDBA 4IQJA 5DT5A 1TV4A 4NSBA 1KM4A 3MBDA 4Y7EA 1ADSA 2D20A 3O05A 3ANVA 5DCDA 3HJEA 1NJJA 3L2MA 2VJXA 3N29A 3W1PA 1KM1A 4E3VA 4CQBA 2HV5A 1K02A 1AZ1A 2F2HA 3ABZA 3N4AA 4A35A 1CXKA 1PIIA 1WUEA 1UKQA 5CJ5A 3ZIZA 4O17A 3T44A 3UR2A 4DJED 4IISA 1C9WA 4H8UA 3MHFA 1LZOA 2GVEA 1WV2A 3CK5A 4S3EA 3NXLA 1GOMA 3WJWA 3SB0A 3ARXA 3TZNA 4P8XA 4M19A 1XBZA 4H19A 1K6AA 4OQVA 2VVNA 3DJJA 4EACA 1EF3A 2BWGA 3GFXA 3GB6A 3C2RA 3ZFHA 3W2UA 3SZ8A 3QLLA 1J12A 1CLVA 3O15A 2Z26A 2V3DA 2BS9A 1R3TA 2GJPA 2VNCA 3GR8A 4GC3A 4H41A 4ZL1A 4A3RA 3PPFA 1IEIA 3MCMA 4XSMA 3WKZA 4X2PA 2CXGA 4MNLA 1XYFA 1AD1A 2XISA 1XYBA 5J8LA 1UKPA 3KL3A 4LWWA 3LMZA 1QOXA 4DLFA 1HJSA 2J6XA 3WUEA 3NDOA 3BLKA 3A9BA 4HOXA 1HKIA 2YCJA 2BTMA 4BF9A 3UJEA 1X8CA 2B7PA 3QV9A 3GX9A 3NL5A 1KW1A 1B9BA 1SO6A 1ZENA 3DFTA 5C54A 1EP3A 3DHFA 3VI2A 2C79A 3ZVIA 1IT7A 1VGAA 3HZ3A 3REQB 1Z48A 3WQ4A 1G5AA 3CS2A 4O8AA 4GBUA 3K8LA 2VD9A 3PUDA 2Y7EA 1PYFA 2A8XA 2D0GA 1MDRA 1NSJA 2TPSA 4G9PA 2QMKA 3B05A 1FQ0A 3TU9A 4O52A 2G4JA 4GZ7A 1ZUAX 5CC7A 1GVIA 3MDUA 4D1IA 1JQXA 4C6IA 1PKMA 2DZVA 3AS1A 3L2IA 1ZMDA 2DVTA 3WDRA 3FSTA 1LOLA 2BC0A 4EX4A 4AC1X 4GIYA 3GD6A 4XWUA 1RD5A 1UQYA 2J78A 1I45A 4G7FA 4M0XA 1I2RA 1A80A 3EX6A 1PL9A 5A6TC 5CZTA 1UD5A 2OWXA 4W84A 5JCLA 2W63A 2JK6A 5C2CA 2E5AA 1R3WA 4IMEA 2BOGX 3NAVA 5M03A 3W70A 4JTQA 1XYAA 3B8DA 4ZOBA 2A3BA 3QC3A 5EL1A 2IPJA 2J3NA 2WM1A 1P1XA 2BY2A 5IFPA 3AMKA 3KOFA 3GH7A 1UHVA 4DJEC 4KFOA 1RY8A 3WSUA 3GNRA 1V7AA 4MWAC 3W0KA 3AZSA 3UPMA 1ISWA 1Z9AA 2VGFA 5CH9A 3TYDA 4IH3A 1MQPA 3B8VA 2WPCA 1RBLA 5ENLA 2AMGA 4HNTA 2NXHA 3AJXA 3E02A 3CPGA 3VX1A 4IPJA 1E4MM 1P0KA 1XHCA 3AS2A 3OO2A 2ANUA 4NZCA 4QX4A 1CLKA 1IWPA 3ICJA 1TZ7A 3FFSA 1RSCA 1PB0A 3TQVA 2VC7A 1C9DA 2X1SA 1BF6A 2GGJA 3KL5A 4S3AA 2NX9A 1BEUA 3TXZA 4AIUA 1YNPA 3TXVA 1N8FA 1JI1A 4R5EA 5GRTA 1AMYA 3CU2A 4Q8OA 2WVUA 4PB3A 3M1ZA 3EOEA 3CWHA 5C9WA 2VKZG 1RVGA 2EG7A 4JD4A 4XKYA 4ATLA 4KF1A 5I3DA 4D6FA 2A5HA 5CAKA 2PC4A 1Q7QA 3GZAA 3NZPA 4IPLA 4D71A 4B15A 3AHZA 4LRSA 2F9RA 3PK7A 3LCLA 1S2WA 1LORA 3ZQ9A 4ZOCA 2IS7A 2RFGA 4XO6A 1AG1O 2P8CA 1Y5XA 4IXHA 1PS9A 4G7EA 4I5UA 1LCOA 3I7RA 3LDVA 2PGEA 1JD9A 1YQZA 3BAJA 1JFXA 4L56A 1B3ZA 4ZO8A 5D9MA 4G1KA 4NKCA 1E9YB 4RNIA 1W5QA 1OIFA 3UR8A 2AL1A 3JZEA 1Q7MA 2FIQA 4Q8NA 4F0SA 2YB4A 4WD0A 1ZGDA 3E6EA 2W66A 2YYTA 4H50A 3M4HA 3NPUA 4GUFA 5FMHA 2CPUA 4EAMA 2EF9A 4J3WA 2OJPA 2QCDB 1DWAM 3PZQA 1IXQA 2XN1A 4M81A 3HMCA 3GQYA 1I6NA 1NAL1 1V3KA 1V3IA 4NG3A 3PR2A 3R1ZA 4Y9PA 5A8MA 4HPGA 3EZ4A 4ZBCA 4BK9A 1UJPA 4RXFA 2RDWA 3VO0A 2VX4A 1ZLPA 3E5PA 4D9PA 1HXJA 3GDKA 4BEUA 1XANA 3WNKA 2FZ9A 3DK9A 2Z1BA 3WQGA 1BYCA 1TJPA 5BW6A 1BSIA 3CT2A 3KCJA 4N9CA 1FDZA 3NQAA 3UPBA 1K1DA 3VOJA 5B7YA 1JZ4A 4JTSA 4JQ9A 1VBUA 2GVLA 7REQA 3NVTA 5FJPA 5EMKA 3KEHA 3CQIA 1A3XA 3U5UA 4YIWA 1I4NA 1HUVA 3LYEA 4RNJA 2PCQA 5LHFA 5XIMA 4LB3A 1KN0A 3SQLA 2ZUNA 1W3JA 2Q8LA 1XG3A 3L7RA 3IAPA 5AYIA 4JGDA 1U5VA 3W2NA 1MFUA 1WE5A 4JL2A 4PB5A 4LC6A 1L6SA 3I7QA 1JZ8A 4AIBA 2P88A 3EX2A 2JQXA 3KRBA 3SM0A 3IVUA 3PTKA 2OPJA 1H41A 4S3JA 3PUGA 4IIFA 3L67A 1FWHC 4L9XA 9XIMA 3TWAA 2WVVB 3LCHA 2HROA 4CQ8A 4O4VA 4O1FA 3NQEA 3QBUA 1RHCA 3W76A 4FXSA 3FXGA 4NEWA 3OBKA 2XIJA 2NV1A 5J04A 3H4KA 4WZHA 3EEZA 3NFUA 4FIQA 4LCQA 4KEMA 2NVCA 2HS8A 5DANA 1W5OA 3OQEA 3RHGA 1B57A 1KCXA 2C18A 5F1VA 3T09A 3WLKX 1LLWA 4TQTA 3TP4A 3L4YA 3WBWA 3MUCA 3JR2A 4PL1A 4A29A 2Q6ZA 3HG3A 4PMZA 3WEOA 3LTPA 2X41A 3EB4A 5BOOA 4LAKA 1VENA 5A8PA 1VLIA 3TC3A 1NVMA 4O54A 1ITUA 2Z1XA 2PDKA 1QI4A 4M52A 5C9XA 4NNCA 4MDOA 1VYSX 1D8CA 2XIMA 2PCEA 3VGEA 1F3TA 4JTLA 2Y70A 4JFUA 1XGEA 4GXWA 1SZNA 1S5MA 4TMBA 3MSRA 4APNA 1ZBVA 3LTSA 1WDSA 1TV5A 1F3XA 3ARTA 4TOQA 2F2KA 5CJMA 1A5SA 3KL0A 1DJNA 1FHDA 3VK5A 1FWTA 1OABA 3FCPA 5FAGA 3TCSA 4BQ5A 4N4PA 1IF2A 4UUIA 3OLEA 3FJNA 2XWEA 2NWSA 4PEKA 3BW3A 3VNJA 4HD5A 4AEEA 2DIKA 4DWSA 4M7TA 2QDDA 1UKTA 3W81A 5G2HA 1TB3A 1L8NA 4XD6A 2G3IA 3W7MA 2OYLA 4I7UA 1XD0A 3BG3A 3AS0A 1X1OA 2ZQ0A 2P53A 1OFQA 3DKLA 1ISVA 3VAVA 1VLWA 3GVGA 3LU2A 4CNOA 5HNNA 1K8ZA 3RX4A 1H4PA 3MWAA 3I4KA 4GI9A 2TSYA 3WMLA 2CZDA 3NQ8A 5LNRA 1BSLA 1KC7A 1FXPA 3IVSA 4QCFA 1XFCA 3EAUA 3PUOA 1BLIA 1D3GA 1BF2A 1FIQB 4H4RA 2WHJA 4UOZA 3Q6JA 1VFLA 3IUIA 1U5JA 1LTDA 4U2ZA 1TJRA 4KW2A 2D0HA 1QK0A 2DSUA 4ZFCA 3HO8A 4EMJA 3VIMA 1M9HA 4BJHA 2DUAA 1GKPA 1XLLA 1VFSA 3BAKA 3O6CA 1EOKA 2CYGA 2IXUA 3L5LA 4US5D 2GQAA 3K5XA 3V1PA 2OZ0A 3ZT5A 1ZY9A 5D38A 3QQ0A 3A4JA 5TIMA 2VWSA 2ZRYA 4MVAA 4DQWA 2X7WA 1JROA 3B9EA 1Q8JA 4XIAA 5EPDA 3W28A 2I16A 2QCMA 4IJRA 1VDVA 2ALRA 4LS2A 5C8BB 3CQ0A 1ONWA 3KBVA 3GVRA 3AHTA 1LM1A 4DELA 1I2PA 3RF9A 2YL6A 1ZZMA 3PSWA 5G4EA 4GVHA 5K9XA 2QAEA 1IGWA 3AM9A 2DT2A 1TMLA 3GZ3A 3S9YA 4LUJA 4LV9A 2QJNA 1MXSA 4HZ7A 5C55A 1P48A 2F7FA 3NL3A 2J7BA 3F2BA 4IQLA 1H7OA 5DRCA 4GGHA 3B0YA 2ZZ7A 2HMCA 2WSYA 3O2LA 2JIWA 1TA3B 3VNIA 4R27A 1OFEA 3CWOX 4QLJA 3CZEA 4QLLA 3B9JB 3D6NA 4YU1A 4JCLA 1SFJA 2VZOA 4O13A 2EG8A 3B0VC 1BWLA 4E5TA 1N61C 4O18A 3W38A 3FVDA 3BAYA 3SIMA 2G3NA 4W5ZA 3GTHA 4GXMA 3VVGA 4IPPA 1R30A 3SCQA 4J40A 3JRKA 4NJJA 1LUCA 5LIWX 1W91A 2ZUTA 2CKSA 1GHSA 4IMFA 4JTCA 3EMZA 5H1WA 3SJNA 4FO4A 5HWNA 1PDZA 3KOWA 5I07A 2WZMA 1F61A 4W5UA 4F0KA 4DVOA 1A5BA 1JPMA 1CYGA 3T0CA 2GR2A 1UH2A 2OLHA 2BBFA 2FFIA 4MPQA 4OVXA 1BKSA 4TVDA 3OLIA 2AAMA 1D8WA 5JCNA 4B91A 3BL3A 3W7JA 2XWDA 3USZA 4AUBA 2Q8XA 4NHVA 2GGEA 3DFNA 5JXQA 1UCWA 3MUZ1 4GQQA 1QNVA 3N6JA 4AAJA 3WJSA 4IJBA 1VJZA 2G0WA 4JTIA 3K4WA 5E70A 3SN1A 4G2DA 1O5RA 4ATDA 3A7RA 4XQ6A 4YS1A 1PO9A 1M53A 3EOUA 1MUCA 4AYGA 3GTXA 3W26A 5AVNA 3W2LA 3TW9A 4C90A 1T7LA 2J75A 3P5ZA 3T0BA 3W22A 4L80A 1IE7C 3LGGA 3CL6A 5FEZA 4NIRA 1OIMA 3VKKA 2EO7A 1EC9A 5HMFA 4BQ3A 4C6EA 4MADA 4FNSA 4K8DA 4LEFA 3NXFA 3VNZA 5E93A 4X9YA 2INFA 4J3XA 4K8EA 2WVVA 3W2JA 1M6IA 2DSZA 2Y7DA 3QYQA 3GFYA 1KLYA 3BUVA 4W86A 5HQEA 3M5YA 2YL5A 2O4MA 4GNKB 3KVLA 3VUSA 2J77A 1XL9A 4I5XA 1HW6A 3E0WA 2ZC8A 4GNJA 3R43A 3AU2A 4NYYA 3AYTA 2E5CA 1OX5A 3WK3A 3GNOA 3WUBA 4CNSA 2X30A 2WJZA 3PNZA 3VM7A 4CGTA 3LUTA 5DN1A 4KWWA 1DJQA 3ITVA 4O57A 4ZE4A 3MQTA 2PLCA 3PP7A 4UCGA 4LT9A 4LYPA 5AY7A 1XYCA 2XM1A 2UWFA 1K6WA 3LS9A 3S2NA 2CWNA 1ML1A 4UFMA 3WFAA 1REQA 3Q65A 2QV5A 3CXBA 5LKYA 1JAKA 1JUBA 4H01A 3GG1A 1IHIA 3KWSA 3STGA 2TAAA 1UZ1A 1GPFA 2EBNA 2PDLA 2YCKX 4L7ZA 2VUNA 3GNNA 2WMKA 4PUJA 1JUEA 3RJYA 2WMHA 1SZFA 4W7VA 3TWBA 5JRBA 4WSJA 3NQDA 5IOBA 1H5YA 4D6CA 3TNOA 5LIUX 4HOZA 2VCBA 1M7OA 5C9ZA 4DF0A 4PMRA 3MWCA 4PR4A 4A3YA 2B7OA 4WJEA 4KIEA 1YPIA 1HJQA 3MMTA 1TPC1 1GWJA 4CVWA 2YDQA 2GK1B 3GR4A 3E9AA 2Z6IA 4DN1A 2FMOA 3BCFA 4F9JA 5A6SA 4H4TA 3WQ8A 3SCWA 1V3JA 2AL2B 1R7OA 3OW1A 2E4TA 3VPLA 3H7RA 4AX6A 4D1JA 5SWUA 2QDEA 7REQB 3VCCA 3BGJA 4OT7A 2VT0A 1T0OA 4HZMA 4IUOA 3LXDA 4GACA 1Y0EA 2D23A 3G0UA 3THQA 2CIPA 1XJBA 4MY1A 2VWTA 4E2OA 3BPWA 4FK9A 2FPVA 3C2OA 1P7TB 5FD0A 3R89A 3PNUA 3VGGA 5HMEA 4NJKA 3MP3A 1UOKA 3ORWA 2ISFA 2XU2A 3GYCA 5BMXA 2A7RA 3TOYA 2Q01A 4U28A 1NOFA 4P8WA 4ZOAA 3GU1A 1V6XA 4UTTC 3ZJ8A 4GLEA 4WVXA 1J6OA 2ZUUA 3NZQA 4PUWA 1KV5A 1XWYA 2WXDM 4XK2A 1KFLA 1VPQA 2UBPC 3UVAA 4LVFA 4E3TA 4AW7A 2DIJA 4J28A 4YHEA 3GVWA 4W93A 3ELFA 3C61A 1UROA 4PZVA 4KH2A 3G3DA 4PGLA 4N9DA 3SRKA 1MWOA 3LNPA 1AJ0A 3P82A 1D2KA 4FEZA 2XIOA 1EYEA 1CB2A 1OADA 1R46A 1XBYA 4LCSA 4KBXA 3VIIA 3LLXA 2J24A 1D9EA 1JOAA 3R6IA 1W1YA 2JBMA 3E2VA 3GKAA 2PWEA 3QZAA 1KTCA 3IGHX 3K1GA 3WYZA 4C6OA 2WMIA 2XFFA 3DU0A 2HQMA 1YNYA 2PB1A 2PEVA 1EFZA 1FCQA 4KEVA 4US6A 1NOWA 5JCKA 4J3UA 1TFVA 1Y65A 1NQKA 3MP5A 4RPPA 3IJDA 5EFDA 4IP4A 3C8FA 2ZA3A 3WN6A 1PJ9A 2NLYA 1ALDA 2R1LA 1A3WA 1VBHA 4Q7IA 1DVJA 4H4ZA 1SW7A 1VPYA 4N6FA 3B8TA 3FGCA 2NSXA 4AZIA 3DK8A 1IR2A 1LWJA 3L4ZA 3QVQA 1HN1A 2C19A 3SUSA 1TVNA 3G1RA 2HISA 3NPVA 1FY6A 1WKFA 2BB0A 3K30A 3L68A 4ADTA 3VKCA 4K8GA 2VURA 3CV1A 1XXXA 3RNMA 1GZ1A 5AC8A 1I1WA 4FP1A 1LWHA 4FMVA 2WNWA 4IGNA 1RH9A 1YE4A 3ARVA 2V2HA 2WMIB 1GYLA 3W7DA 3ES8A 4XD4A 1N2VA 4H4XA 4D8LA 3IGSA 1XSJA 4QTGA 3ISIX 5G1YA 1V0KA 4ENLA 1XI3A 4JS3A 1XH2A 1KGWA 4V2XA 5IBXC 1QBBA 3N2MA 5D30A 5TD4A 1R8LA 1VAHA 1XCFA 3MI3A 1R2SA 5IM51 3GC5A 1IYXA 2PDHA 1OZMA 3B04A 5IXEA 5A6JA 2D2OA 3MS8A 3TTOA 4B5SA 2JGQA 2QUNA 1TPUA 1V0LA 3UJSA 1OD8A 3RRAA 1DHKA 4DZ5A 1QU4A 3H7VA 5KZ6A 3G8EA 1NHPA 3UXLA 3GWQA 2V63A 3O07A 3UR5A 2NVKX 1OG0A 1JVNA 3BZJA 1HIZA 3HU7A 2BY0A 1TIMA 4A21A 1H2JA 1X39A 3N3TA 4JFTA 4NVTA 4ZTXA 1OFOA 1J8VA 3WUGA 5D9OA 3SURA 2FTYA 1QPKA 4LVBA 3SCRA 3HV8A 1EH9A 4KS0A 3G18A 4XBKA 3SFKA 1M7JA 2Y62A 2CWXA 4MWAB 1ZCCA 2OYKA 4HTBA 3JUGA 4PFMA 2HNHA 1CGTA 1ELSA 1MMFA 6ALDA 2CESA 2W6RA 3WBYA 2X09A 1QWGA 2RKXA 3AIEA 3W7EA 2YPIA 2ZUSA 2OQYA 4S2CA 2GVJA 4WSHA 1XIJA 4ZQMA 1CCWB 2ZZ2A 3IJQA 1XBXA 2VFDA 4IF2A 5D2TA 4TVCA 2D2HA 3BTNA 4AZHA 2XDFA 1WNOA 3S9IA 3LXAA 3N4EA 5T91A 5TNVA 1VIZA 2DPEA 4C6JA 2PDWA 2INZA 3UWWA 1V08A 3HGSA 1QW9A 3UYCA 3W37A 1KM3A 4L6OA 1GG1A 2VR2A 1HJWA 3G5EA 1XUUA 2HZGA 2WMJA 2R14A 3SGUA 4JDBA 2ABAA 1TWWA 2C8NA 3QRHA 2WYSA 1EQPA 5F2GA 2BVDA 4Y9MA 1NHRA 2RUSA 2PDYA 4FR1A 3S2JA 2PP3A 2YCIX 2JF7A 3NJ3A 4S3DA 4HIBA 3L0KA 1KLZA 1KKOA 3PZUA 8A3HA 3MUXA 3TQ0A 4DM1A 2XGIA 4S23A 1SR9A 2Z6JA 4DUVA 1X6LA 4GQRA 1TTJA 1TREA 1UZDA 4HNNA 2ZVRA 3DH9A 2VHLA 3IIZA 3SBFA 3BO9A 2HJPA 1KGXA 4C6PA 3FAXA 3W7RA 1AQ0A 1R0MA 5E9XA 3D0CA 3Q67A 3N9RA 1A0EA 1N62C 1NPXA 5KEZA 5I79A 3JS3A 2WC4A 4QLKA 2OOFA 3CM4A 4FI4A 4CN6A 5GNYA 1UBPC 3TNBA 4QEEA 4D8AA 3AIRA 4NT0A 4GA8A 3LERA 2DT0A 4H9TA 3RCNA 1E0XA 2TMDA 5KZEA 3VNMA 1W1IE 1GVEA 3JU2A 2X0HA 4L64A 3P80A 3WEZA 2AKZA 3H24A 1R87A 4ICCX 3H2EA 4UTKA 2QUUA 5G1MA 2P0IA 1E9LA 3WX7A 4D6HA 1YKWA 3GUGA 3TUUA 2NLIA 2X1IA 2JK2A 1HKWA 3F2DA 3CAQA 5HNUA 4NJIA 1PZ0A 3CTTA 1Q6GA 2NQ9A 3OHIA 5I3FA 3O7UA 5IDIA 1WZMA 2PDNA 3W7KA 3R10A 3MI6A 4MUPA 4HNUA 5HJYA 1DNCA 4HCDA 4CD7A 4O1AA 1RPKA 3VZXA 2X2YA 3QGKC 1YDOA 1OQFA 1UC5A 4PMYA 3RX3A 1TQXA 4KERA 1NFGA 2EPHA 1TX2A 4UQBA 3CT7A 4PODA 1PYMA 1K7EA 2QHAA 3LEPA 2XN2A 4L65A 4HK5A 4RZ6A 3AZRA 3G8RA 2JIEA 1OFPA 1NFPA 1XSKA 3PFMA 4Q4KA 4AB4A 4ZO7A 3QTGA 3ANYA 2PSNA 1JDDA 5E0CA 4FA3A 4B92A 3S46A 4ZB5A 4QG6A 4C91A 4TX6A 3DESA 4MTVA 5TF0A 3FK4A 3VD9A 2IQDA 3KHDA 3R8RA 1KWKA 3BQ5A 4UFLA 4BV6A 2Y63A 5IHSA 1YXYA 1TG7A 1W1PA 4FNUA 3REQA 5CPQA 1CBGA 3LM7A 4MNMA 5DMMA 4CQDA 1BWCA 2XVKA 4JTGA 1HO1A 4X61A 3T0AA 1VCVA 4DI8A 1XRTA 2PTDA 3WNLA 2ZUMA 2JF6A 3TC6A 3WD3A 1V79A 2ZUWA 4EM4A 3STFA 1ONEA 4AIEA 2A21A 2D69A 1LG2A 2V3EA 4JX4A 4C7FA 2GR0A 4KKXA 5U25A 1H5VA 3P60A 1BWKA 4CQ9A 4GD0A 1MI3A 2GQ3A 2TYSA 4M82A 3KVJA 3B40A 1YNQA 4KWOA 1FEBA 2Y0FA 2EEXA 2CZFA 2W3ZA 4XSLA 1JYXA 5AC4A 4X63A 1OYCA 2ZWZA 4BKNA 2CW6A 3UD6A 4HA1A 2AMXA 5AHMA 1SSDA 1QO2A 2FHBA 2V3GA 5E6ZA 3FXYA 3PPCA 2Y7GA 4QDWA 5I3KA 4OECA 3NQ7A 1GZGA 2V30A 1BTMA 1FWWA 4QITA 7ENLA 7TIMA 2XJ7A 2BNJA 5REQB 4M51A 3VMOA 2J7CA 4YVXA 2PP1A 4AZ5A 4CU6A 1NWRA 3KBJA 4WSKA 4LYRA 1TJ2A 2DY3A 2WOWA 2VENA 1TCDA 2O4QA 3PG6A 3L65A 3V36A 3VILA 1W1TA 1UG6A 1OGGA 1MNZA 3PJUA 3GC4A 1VF8A 4QHRA 4J57A 1XM3A 3ITCA 2V6AA 4M6PA 2HDJA 4YL2A 1VEPA 2ACUA 3BJFA 1DE5A 3PG9A 4W8AA 1M7XA 3SCTA 1QNRA 3S4TA 4JIIX 1RK6A 3U2ZA 1D3CA 4NZ3A 2ZRZA 1XKJA 2J6VA 3DC8A 2ZX8A 3KM8A 3A3WA 4EK7A 1ZS2A 3B8UA 4MZYA 1EGVA 4JKLA 3DGZA 3VDCA 3MTWA 4QJ4B 1NP0A 4GIRA 2QAPA 3DI1A 1F07A 2O0TA 2PLKA 1SPQA 4WY0A 4IHCA 4MYAA 3IV3A 3UNDA 3E5BA 1T8XA 3GKFA 3T1GA 1V93A 1UWUA 3VIPA 1VFFA 4ECLA 1LROA 3VCRA 1RQEA 2QQ6A 4H4QA 2H3DA 3CHVA 3HRDC 4CNTA 3T05A 4ZQOA 3CH0A 1BGGA 4Q22A 1MO0A 1RQHA 4HZ8A 3HOJA 2P5NA 1PKNA 4E2DA 3T40A 4RE2A 1R9YA 3DOPA 3CZLA 4PUEA 4GI4A 5ABEA 2V38A 3LK6A 2ZC1A 3CYJA 4UOQA 1QVBA 5FF7A 4ROPA 3O0KA 3N6QA 4GQGA 1UP3A 3HPAA 4B90A 3TROA 4AD0A 1PV8A 4AD5A 1BG9A 2WSRA 4JTUA 3ETRB 1JGMA 2DEPA 3ABSA 3GUWA 3W4RA 4ZA0A 3ZT7A 2PGFA 3R12A 2HCVA 3VDHA 3APTA 2B4GA 3RPMA 1UD8A 3BGAA 2YYUA 4WRHA 2YSWA 1TVPA 2GSHA 2DT3A 4B4FA 1ZTVA 5MKGB 3LM3A 1XV8A 1C92A 1GKRA 1H49A 1W2PA 1A49A 1E0TA 2J79A 2VEKA 4DAFA 3OB8A 1OVDA 1XPYA 5E5CA 3EKGA 3DHUA 3EDFA 4MJ4A 2G3JA 2VZTA 4DBDA 1HO4A 4JN8A 2OEJA 4I90A 4H4VA 4EPEC 4CQCA 2I1OA 3P7YA 4OV9A 1GEUA 2WWCA 4B3KA 4H4UA 1PXGA 3WLTA 5G4HC 5A6BD 1KFJA 4HJWA 3BG9A 1O1ZA 4JOMA 2YW3A 3ZSSA 3PJTA 1OSEA 4CKQA 1XD1A 5EMJA 3M5XA 3CV2A 5AZ1A 4C6NA 1E40A 1O7AA 1RP9A 4Y9NA 4KPRA 1RVKA 2WCSA 1XF0A 3IJ7A 1XRVA 4DO6A 1OGSA 2EGZA 3W1MA 5MKGA 1QRQA 4HVXA 2G37A 1RA5A 3ABOA 3HG2A 3URAA 4IZGA 2EG6A 2ZCGA 4IPNB 3K8KA 4HKPA 2WB5A 4HJFA 4HYWA 4KCVA 1MDLA 3UWEA 4M6QA 1GORA 3WFZA 1GVFA 1D7KA 3UA4A 1A5OC 4Y2WA 2VC5A 3VUPA 3LHUA 2EPMX 1IZJA 5T9CE 3MSDA 3F4VA 1OEPA 2HTMA 1OF6A 1ZK7A 3WLJA 2V67A 3CWNA 3EWDA 4C6FA 2IKHA 3HTWA 1JRBA 3H2FA 1HL2A 4Q7NA 3QJAA 3CGDA 2O9RA 4O10A 2W55A 5A8OA 3DI0A 1FBAA 3FOKA 1W9DM 4HHHA 2QV4A 5KZDA 5BXSA 3FN9A 1SZRA 3HFYA 1KD0A 4J56A 4PCNA 1KBBA 4KWUA 5C5YA 1K77A 1L6FA 2UV8G 4HMEA 5DRIA 3HB9A 4Q8PA 4J1OA 1J0JA 1A5AA 1GTHA 3RLHA 2O92A 5U7SA 2VCCA 4N6EA 4F0MA 4GFIA 2GWGA 2WPBA 2CFYA 1KRCC 3WH5A 2J8FA 1GUVA 4I7WA 5E6YA 3SO7A 4DBUA 4YVPA 2A0NA 2PRMA 2FB2A 3WF3A 2BG5A 4KIRA 4OV4A 2W67A 2NUYA 1BGAA 3VIHA 1BYBA 5CJNA 3AYVA 4JIHA 1LPFA 1G94A 5EBKA 2FPTA 4JXCA 4NU7A 2GQWA 5D8ZA 2BX7A 4CU8A 3S1UA 1X98A 1NF0A 1MQQA 4RE0A 4Z0JA 4O28A 3ARPA 1PAMA 3RCMA 3W2MA 2QGHA 2WZEA 2WP5A 2HPMA 3RM4A 2HVOA 3PTQA 1T96A 3N2CA 3AUOA 4DZAA 1B90A 1U1JA 3VC6A 4JTEA 3VOCA 2R9ZA 4L5ZA 2GYIA 2ATMA 3KRUA 4Q8VA 3IV8A 2PWVA 3AROA 3M43A 1QW7A 3EX3A 2OKTA 1VQZA 1QBAA 3O6AA 3PZMA 4OOUA 2VXNA 1K3UA 1J96A 4H4SA 4RE3A 1Q65A 3II4A 3QQWA 4FIRA 1QW8A 3E96A 3CAKA 4F40A 1LOQA 4PB4A 4NL1A 4Q4OA 3ZR6A 2EAWA 1C8VA 4UTTA 3ZWSA 1KWGA 3N73A 2QVHA 2Y7FA 3CAWA 5E9AA 4PCPA 4BR1A 3EANA 1ECQA 2VC9A 2D24A 1XHGA 2OEKA 3W7OA 2WSPA 2GOKA 2OKOA 1CI1A 1GYMA 3DGRA 2OCZA 2J62A 4XUYA 1XFBA 1KBLA 1N63C 4V1YA 1ZU8A 1B4EA 4FLSA 2V3BA 4JR5A 2G95A 4JNYA 5LA0A 2GDQA 1E0WA 4Q4QA 1YTDA 3LQGA 3ONBA 2WJEA 4IG2B 1ME8A 4WJXA 5I06A 1XYMA 1JGIA 3KDNA 1TTPA 3V0TA 4S39A 2ZKMX 1UPMB 1FCVA 1EHAA 1R47A 4XAYA 5FJUA 4EAYA 5HDRA 2FJUB 5E0KA 5EFFA 3QFBA 1KFBA 3MV11 3R13A 1GRBA 3V35A 3NM1A 3TYUA 2E8YA 1F6PA 3QC0A 3APGA 1F76A 4UTWA 3WFLA 2BVYA 2DZSA 1OJTA 3LA4A 4LQ1A 3AWNA 1F73A 3R7MA 3CHCA 4FPSA 2OLAA 3URBA 2CU0A 4K8HA 3UZJA 4MIMA 1WKDA 4UXDA 3LXCA 4QQ3A 1X7FA 2BP1A 4OBRA 2QIWA 2PRLA 5AFDA 3T42A 4AIOA 2WOIA 2W9MA 3A5FA 4W4QA 4NRRA 2Y5EA 3E1F1 5LIXX 3CQHA 3N1AA 3Q2DA 3U0HA 3NPWA 3PPHA 1T40A 4HNVA 3MBFA 4WQ6A 3PULA 1VCFA 2VEPA 1IWBA 2ZOXA 1LQ2A 5LNSA 2ZZ4A 4JTAA 4QEHA 4CCEA 4ZOEA 3TLQA 1YPFA 3TR9A 4PCTA 5K2ZA 1MOKA 2OFJA 1FHUA 3S5YA 4I5RA 2BY1A 1M68A 2E8ZA 2WWDA 2WAGA 3TW6A 1DIDA 1X96A 4GMEA 1WP6A 3H4GA 5C9RA 4L61A 2RGMA 4Z2IA 4QJ3B 1XIHA 3DN5A 3BJSA 4JTFA 4KPLA 3A21A 3UWYA 4TIMA 3QR3A 3W87A 5LXXA 2DZAA 1Z3NA 2PDJA 4GYPA 3S5ZA 3LZ3A 4MKVA 3R0UA 1OBAA 1JCNA 1TYGA 5REQA 3V5FA 4UQCA 3BURA 1OT1A 3MVIA 1STZA 3W7PA 4EMIA 4KESA 4EVZA 3UETA 4BA0A 4RPQA 2YVGA 3EEGA 2DQWA 4NJGA 4TO8A 5HK4A 1BXNA 1VBJA 2WJDA 5C7HA 1V5XA 2Q09A 2E6DA 3CUZA 3IARA 2PI6A 5KZMA 1VHNA 3SJ3A 3U4AA 4AHQA 1Q6RA 3PBWA 1MSSA 4YWOA 2QEZA 4LGXA 7XIMA 1V8EA 4RJEA 2EKGA 1AQMA 1C7SA 3EWXA 1FA2A 4KWVA 1XIMA 4WY0B 3W25A 2YL9A 4A2SA 4W88A 1QWKA 4MJMA 3LHVA 5CZKA 4O4WA 4K68A 2ZBTA 4MYXA 5M3WA 5A8QA 2XFRA 1H50A 2OX4A 3QFWA 3DDMA 3GXIA 2ZXQA 3POCA 4XZ9A 3KOYA 3WNNA 1RZMA 3W88A 3N2XA 3N9KA 5ECUA 3AXIA 3UESA 3UWZA 3ONCA 4YCPA 3VXGA 3TSBA 4E4FA 1ZMCA 1SW3A 2WOQA 5FIPA 2QF7A 2ZXDA 4L6HA 3S5NA 1W8GA 3R58A 3W72A 1V6YA 3A7UA 4ACZA 1XR2A 3SUWA 1I2NA 3CZJA 2GJLA 5AC6A 2VGIA 1NF7A 3WNMA 1SZEA 4QJ1A 4XX6A 5CC6A 2V5DA 1NWSA 4Y9AA 2D1ZA 4JQ2A 1WCGA 3SRDA 4Q32A 4PMNA 3BAWA 5AVHA 4EE9A 1ZCOA 2P0OA 3BOLA 1JNDA 3T0TA 2BC1A 1TPDA 2HWGA 3IIOA 4FALA 3AS3A 3GYEA 3NQ2A 4IP5A 4QGCA 4CEUC 4JFWA 4UQDA 2FMNA 5G4WA 4GWEA 4N42A 3AIVA 3UJRA 1NM9A 2DZWA 5CSSA 2WKGA 3GXFA 3V0UA 3DIPA 1CW2A 3WDHA 5EY5A 2WOVA 3OIHA 4CD6A 4NEVA 4XAZA 3AXXA 5EBUA 3U2EA 4V1XA 4JIPA 1F9CA 1NDYA 3T2PA 5PTDA 1DIKA 3AU6A 1FTXA 3AXHA 3L0GA 3ME3A 2P3EA 3MO7A 5DX7A 3U48A 1JPDX 1FFRA 4B5TA 4YN5A 4HQVA 4RV3A 3N6HA 4GZEA 1BPLB 5DO8A 5IHRA 1E6PA 3UY8A 2FVMA 3QY6A 2XSXA 3FIGA 3W1LA 4PUKA 2VRJA 4EMWA 4DBEA 3EKZA 5F4SA 4JHMA 1W32A 1J01A 2GVYA 2MANA 1ZRQA 2FZDA 1HKVA 5LIYX 3W9ZA 4G56A 2I9UA 1FWBC 4I3GA 5LNWA 3WENA 1H3GA 4IPIA 1VB9A 1A3HA 4NY2A 4D8ZA 3NL2A 3OODA 3AIUA 1FWEC 1CEOA 1LRTA 4N2YA 1FFUC 3CL8A 4FX8A 4JTHA 4N02A 3GDBA 4PUDA 2OR2A 3THUA 1RCQA 3GR7A 1IXOA 4Z2GA 2XG9A 1JZ6A 1CGWA 2BGSA 1H1YA 2QAFA 5HXMA 3FHAA 4HZ6A 3DX5A 3DC0A 4ACYA 3AO0A 1LRNA 1BG4A 3H2OA 4BF5A 5G5GB 3S6TA 1M3UA 5D37A 1GRFA 3GC2A 4FR6A 3QH2A 4AEFA 3MVTA 3O0FA 4JN7A 4L9YA 1U30A 4BWLA 4LA1A 4EKJA 2V8ZA 2E28A 3F4DA 1FHVA 2BV9A 4UOJA 4C1NB 5LXEA 3GIQA 3KWXA 1R85A 4UCFA 1V6UA 3R25A 2OO6A 1OWQA 4RL3A 3M41A 4S3KA 3I3DA 4IMCA 1EP1A 1T99A 3NM3A 3WY1A 1LL7A 3LRMA 1VFOA 2NXIA 4HNLA 4JHOA 1UIPA 2ZUVA 2E3ZA 4GOAA 3LENA 5HBFA 5CG7A 3RG6A 3WLIA 1S3TC 4BQ2A 4MLJA 4L9ZA 1F3PA 5F7UA 4KFNA 2F84A 3R0KA 3L4XA 1Q7ZA 4BFAA 3GDMA 4KEUA 3WIJA 1P5BA 5CPOA 5EMYA 2PP0A 3SFWA 2WK2A 2X8GA 2VDIA 3UR7A 1LBMA 3WD2A 4LANA 3PN8A 1UA3A 1PCKA 3W73A 4QNWA 2W4XA 2QR6A 1JDEA 3C0LA 1UYQA 3F2CA 2KX9A 3R2GA 4AF0B 2GDVA 5KITA 1DIOA 1YBQB 2A7NA 5I03A 3PBVA 3CUIA 3GG7A 3KXQA 1R3RA 4JY9A 1J93A 4PH6A 2V5JA 1W31A 3VGFA 5LHEA 1M1BA 2X0YA 3TJLA 3GVQA 3D3FA 3L9CA 1WB0A 1KM0A 1G4EA 3ITOA 3A3XA 1EO5A 5D2VA 2BZNA 4H9ZA 3UXDA 1ONRA 3DERA 4C6MA 2QCEA 3UERA 4YTSA 2J27A 1JCTA 5EA9A 2PGRA 4CCZA 3AFBA 3W86A 1JYWA 2W79A 3EX1A 5HJLA 3GK0A 3UJ2A 2CBVA 2GUBA 3W1UA 3FYOA 5CGMA 2VRQA 3FAWA 2FZMA 4AMAA 3O1NA 3Q4DA 4AH7A 1OC7A 3PTMA 5BZAA 3AWOA 3ES7A 1EBDA 3W27A 2YA2A 2ZTJA 4CEXC 3L4VA 4MY9A 1CXHA 3LLFA 4G7EB 4HSOA 4LXFA 1J0HA 1I2QA 1THFD 5CSYA 5JH1A 3GW3A 1MW0A 1DXFA 1QI5A 3LV6A 2ZZ3A 2Y8UA 1E5NA 3GAKA 2VTFA 4XZMX 3QHNA 1Z41A 4IXXA 1JZ3A 1EL3A 4YVVA 3W23A 3BH4A 3S2LA 4EQXA 2P8BA 2BGNE 3S42A 2Y24A 5HINA 1W8SA 4G5DA 2WCGA 5T8GA 1V02A 3CNYA 5FF3A 5D02A 4J3TA 2YDAA 1QHZA 2H9AA 4JTJA 5C2GA 1AW5A 4WOZA 1B54A 1VFMA 1W9UA 5CLWA 1P6CA 3VIGA 4LBUA 4FNRA 4OJYA 2QPSA 4A8RA 5JIPA 2Z25A 4KGLA 5CPSA 4AG0A 2MUCA 2YLLA 1NDVA 3QPYA 3ABQA 3T4WA 2HK1A 1DJIA 2WHMA 4JTKA 3UEQA 3T07A 2V5BA 1XLJA 1DXEA 3LD5A 3RLGA 3S1WA 3L12A 3GD3A 5I78A 4NRSA 4IQEA 2C91A 4TVYA 5BXTA 1H1ZA 3GTIA 2WV8A 5EMUA 4WUIA 1OX4B 3APYA 1Y5VA 4ICMA 4JDRA 1PX8A 3OYZA 3U5YA 2WPGA 4Y8FA 1XX1A 1SFTA 2VEGA 4O0QA 3F7JA 4GE8A 4H9VA 4JL1A 2ZX7A 3M7WA 4FX6M 1KNWA 1HKJA 1KO0A 1KXTA 2AAQA 3BLEA 2PF8A 3KW3A 2E40A 2PWHA 1H09A 3E0IA 2DVUA 3WH8A 2WHKA 3TMLA 2H3BA 4Z1CA 2ZRWA 3A4WA 3ZJ6A 4UTJA 1DJZA 3QW4B 1H61A 4UTHA 3WDQA 3UWVA 2KAUC 1ZP3A 1EP2A 2ICSA 2D2JA 5JIWA 3S5SA 3OC4A 1IT8A 1YTKA 1EZWA 4Q8MA 1KTNA 3FSUA 5AN7A 4QE1A 2BLEA 2UY5A 3TVAA 4GVIA 2AAAA 1FKWA 1W9PA 2E3TA 3AQUA 1LP6A 3GFZA 4Q8QA 5DBUA 3OBEA 1FHLA 2OGJA 2J7HA 4DAIA 1US2A 1UH3A 3PZOA 3FEMA 1V97A 1RBOB 1RCOB 3GXTA 3WF1A 1GRGA 2Q3RA 3WF2A 4HA0A 1Q6FA 5D9NA 1G9HA 9RUBA 3N3MA 1KBJA 3BCJA 1N5XA 3HQOA 3DGBA 1P0DA 3KVKA 4ICNA 2EXOA 4GABA 3B4YA 1FH8A 1GOXA 1RJRA 4DXVA 2JKEA 4JYEA 4JICA 1GQNA 2V3FA 4PRTA 4ORMA 4Y90A 3K46A 3G6MA 1XINA 5I2UA 1I1XA 3MA8A 4DX3A 1A4MA 1C7TA 1S5VA 3ATYA 4GVFA 2WLYA 3LTYA 1E0UA 5DFAA 3KFTA 2EPNA 3GXDA 3O6YX 3G24A 4QISA 2B7NA 1SSGA 2PDMA 2Z29A 3EXRA 3PZTA 4H6EA 1TUFA 1WOAA 2VI0A 1K9EA 5I3JA 2IKIA 2XH4A 1CECA 1EA9C 2WVSA 4JY8A 4MSSA 1HVQA 1SJDA 1F6KA 1XC6A 4CNUA 4DWSB 3P3BA 4LV4A 4WLCA 5FSEC 3NUKA 3THAA 1J2WA 4C5ZA 3B9OA 1B30A 4PL2A 3L5AA 5CPLA 1M65A 1UOZA 4NJHA 5FJIA 3ZT6A 1PUDA 3PJWA 3I68A 2YCEA 1MW1A 3L4WA 4ES4A 3MUY1 1UBSA 3W85A 1GQJA 4B9ZA 3TEVA 3KVMA 1IZKA 3UA3A 1O60A 1GRTA 3B8IA 3MKKA 5AOUA 1M04A 1IR1A 3RN6A 3VZZA 2FYMA 4AD1A 2YBUA 4MDPA 1F8WA 3NIYA 4EXAA 3SECA 5AC7A 5HULA 3T7VA 4CLMA 3ECQA 4J7RA 1ZAIA 2ZADA 3UG4A 4GRSA 5CKSA 3I65A 4H9XA 3LRKA 1TPFA 2AQWA 3MZ2A 2ZXAA 3STEA 4R85A 3CUGA 1PSCA 1W3KA 3RGTA 2E5DA 2BOFX 1Q1RA 1ENUA 4K1WA 2ZVIA 4R7OA 4YMZA 1F74A 2P50A 3CUFA 5EB8A 1O94A 1MXDA 4C1NA 1KFCA 3F03K 2GJXB 3TH6A 4IMAA 3MHGA 4NUWA 1H7NA 1ODZA 4AZ6A 2CZEA 4RK8A 3N15A 1EEPA 4UFHA 1EOMA 4YTTA 1GCYA 3EYPA 1W37A 4DHGA 1BQCA 1TJ0A 4FF7A 4NX0A 4Q4MA 4FZIA 4FSAA 3IPWA 5I00A 3YPIA 4NZ5A 1I0DA 4NZ1A 4S3GA 1N7KA 4P8VA 2X1RA 1XUZA 5FOOA 1BTCA 1E6ZA 2G5WA 2RJHA 4GIAA 4AD3A 4GNVA 2F6XA 4B5VA 2ZZBA 1ISXA 3HG4A 5K9CA 2OZ3A 2NVAA 4A8NA 1OYAA 3LNMA 5EYWA 5ABHA 4MOZA 2CHRA 2C3DA 4ILSA 4P7RA 4V33A 1ITQA 3M5VA 1L6WA 2QPXA 3I4EA 2AOSA 2GH5A 1RUSA 2VL4A 3NGFA 1AFSA 1W5PA 3W1NA 5H2ZA 4H83A 1UD3A 2QJMA 3VKJA 1EIXA 4O1DA 3GDLA 3UP8A 2ZDRA 3VDGA 3G2GA 3RJXA 3CASA 1TELA 4HU4A 5DF0A 1Z89A 3WBXA 3U4FA 4N9BA 2ZRVA 3CZ8A 3IVTA 1UR2A 4ZMGA 3SQSA 1EF2A 1GRAA 4O15A 1NARA 4WGXA 3PWGA 5C71A 2RABA 3E0VA 1QJWA 2RAGA 3VU2A 3GO2A 4XAFA 3HFTA 1W9XA 5HNTA 2FKPA 5HWMA 1E3ZA 1V6VA 4ZCWA 1PIGA 3M0LA 2PD5A 4H04A 2E5BA 1NDAA 1ZAJA 4W8BA 4D6IA 4MB4A 3BW2A 3UCQA 4C6BA 2O7QA 1QASA 1WYGA 2GLKA 1H0IA 3OLGA 4HGXA 3G6LA 1ZJBA 3WNOA 1S2CA 3AZTA 1KCZA 3E12A 2R94A 2NPXA 1DWGM 4YJ5A 3BZGA 3VX0A 1TYTA 2GR1A 1I60A 4R88A 1TJ1A 3IRSA 4MJ2A 5XINA 1UZHA 5CPNA 2ACQA 3A24A 2OVLA 3UYIA 4A8LA 3EF6A 3HMJG 5EGRA 5HJXA 2XH2A 4AU0A 1TTIA 1Q13A 3IJ6A 1G7UA 2FVLA 4XISA 4H9MA 3DXIA 4JX5A 1QT1A 3TMQA 3RO8A 2C1GA 1BKHA 4GCXA 4GGBA 3CMJA 1XGZA 5I09A 3LSCA 1H1NA 3OYXA 4CD4A 3CLWA 4REQB 1UWRA 1OCNA 5BRBA 5C9UA 3DHDA 3BDKA 1DQXA 1WBHA 3ZS4A 3H23A 2XIBA 1LDCA 1LL4A 1FECA 4XAPA 4IGSA 1EIBA 5FJTA 5A2CA 1TPB1 2XGBA 1DJHA 1VRXA 1EJWC 3ZSTA 3ZLGA 3TYCA 4CVUA 3GDRA 2HVMA 1NWUA 4MWAE 1DJGA 1PTAA 5CSRA 2OZ8A 1XPGA 1A47A 3T81A 2VX5A 3AHXA 4H2CA 3M0IA 2PBOA 3EWWA 1SVDA 4MGGA 2HK0A 3U3HA 2QUTA 1W1A1 3SAZA 1I75A 1VCGA 1SZGA 3FLUA 3IUDA 4LFYA 3ABXA 3GU9A 4DO5A 1O5QA 3COTA 1QAPA 1AZ2A 1XIGA 3NQGA 3CEPA 2Z00A 3FX4A 2PZNA 4QE4A 2RJGA 3QMRA 1WXJA 1YMYA 1J0IA 3O16A 3OHMB 1CDGA 1XLGA 3WG6A 3BSHA 1EJUC 1MW3A 3KBWA 4U3CA 1ONXA 1PBGA 5HQMA 2V6OA 2E9MA 4MAZA 1V03A 6TIMA 2HXTA 3PHAA 4FXJA 5MHBA 5F2IA 1W9BM 5LGXA 4ACZB 2EQ6A 5H8MA 3H70A 2QCCA 4DBSA 1YXDA 1PCWA 3KS6A 1GEHA 3RFAA 3IK4A 2VVSA 1XDIA 1GQLA 3NVVB 2W91A 3VFCA 3XIMA 3TONA 3KLJA 4W7UA 4GHRA 4DXKA 1GJUA 3WUFA 3GRTA 4XVDA 4ZO6A 3HW2A 4H2HA 4BURA 3OZOA 2R91A 3WMSA 4AWUA 3DAQA 4RDWA 5KMYA 2JE8A 1XISA 4H6QA 3TYBA 4UZUA 1QPNA 3FYPA 3PY2A 2ZZ6A 3EDEA 1GW9A 3RILA 5K9DA 1V3LA 3DJGX 4CNNA 4PA8A 3N12A 4WY0F 4AISA 2W0UA 1UH4A 4H00A 4LYKA 4GKTA 1HKMA 2GDUA 3PC0A 4W9TA 2DW6A 1NWTA 4H4IA 3B03A 5ABFA 1EDGA 1TE1A 1NHQA 4IFKB 4KETA 3CL7A 2G3FA 3IJ8A 3UZWA 3VKBA 1KR1A 4IT1A 3LBCA 3VZYA 4PBFA 4RLIA 3HJZA 1EGMA 3R8GA 5F2LA 2PDXA 1FWAC 2UY3A 1QUMA 2OB3A 1CZ1A 3WH6A 2YFNA 3OVGA 5HANA 3XISA 3CV7A 2E1DA 2GQ9A 1RLDA 5EKYA 3LGEA 5JBEA 4XZHA 3BWWA 2QVNA 2EPKX 3L2LA 3MKCA 2HBVA 4JTRA 3QPZA 2PU1A 1DJWA 5LA2A 5JVLA 3GHUA 3T8QA 4A4AA 1TRIA 4IG2A 4JHZA 5LNUA 5K4XA 4LUTB 3HGOA 2VZVA 1W5MA 5KTLA 5AYZA 4ASTA 1GQKA 2CC0A 4WDXA 2YZ5A 4ML9A 5A1AA 2ALDA 2PTWA 3NSMA 1B4KA 2A3EA 3DCPA 5LSMA 3L8KA 3VNKA 6A3HA 3FA5A 4DJFD 4M8UA 1JNEA 3MDWA 2D0FA 1VRDA 1N8WA 2L5HA 2EJAA 1KRAC 1RJPA 1SMAA 2A2IA 3WH9A 1K03A 4ZFMA 1YDVA 5HATA 4FXFA 1BVWA 2VZSA 1OJXA 4BCEA 2GUUA 4BEQA 2FH6A 1C29A 3N2TA 4DF2A 4EXQA 3GW0A 2PD9A 1TE6A 4KCTA 4U2YA 3BW4A 2X8HA 2O9PA 1GEQA 3KZPA 1ONFA 3LRLA 2QCFA 1T8QA 3ZVHB 1ODUA 4DO4A 5I3GA 2E9BA 3B3DA 4RDZA 1GHRA 4FHAA 4FLOA 3GD4A 1BWVA 3IC9A 1JCMP 3HURA 1AD4A 4FOKA 1ZBWA 3DFSA 4QFUA 3QW3A 3TA6A 2XVPA 4ZXLA 3PWAA 8CGTA 1CENA 1XLBA 1ICQA 5TR3A 4KRUA 3AC0A 1A50A 4JNZA 3CHDA 1LOSA 1XQKA 4LNCA 1PZ1A 3V5OA 1EA0A 2BGQA 3W7GA 3WQEA 1TSIA 4TMCA 3S0CA 2E9LA 1P0EA 2IPGA 4HNCA 1QOQA 4PCFA 1J5SA 1N8IA 4C6KA 4EWND 5K7JA 1OCJA 4H4PA 3M0MA 2FHCA 3IACA 3LHZA 1SYTA 1Z32X 3IRDA 2QCNA 4UBPC 3CHFA 3W83A 3V5CA 4G6CA 3LB0A 2DJLA 5H8UA 1DP0A 1W3IA 2YZRA 5DEZA 3A4XA 4ADWA 2PE4A 1ZL1A 4BHYA 6TAAA 2VEIA 3QZ6A 2YX0A 3SADA 3PZVA 5GNZA 3TYZA 4PRWA 3AAMA 1X1ZA 4LJ3A 1FX6A 4HPXA 3BGGA 3DG7A 4FNQA 4D6EA 3MHUA 8RUCA 1QHPA 1UR3M 1JXKA 1W5NA 4MB5A 5CXPA 1A53A 2WMFA 1KGUA 3N2BA 2I5GA 2CLFA 2OSWA 1E56A 1PIFA 1C91A 4PN2A 2AQOA 4J9JA 3WJYA 1E55A 5AZ0A 1XDMA 2NV9A 3FYYA 1G1YA 2AL2A 2QIIA 4Z1DA 1EJRC 1YHTA 1H51A 2GUYA 1W1VA 1UIOA 4WDWA 3T6CA 1MRAA 3EOLA 4HHPA 3M0YA 1Q5MA 2VFIA 5FF2A 3CV6A 4JIQA 1KV8A 3WELA 4OIFA 1GZJA 4F9DA 2YDRA 2QJGA 1PPIA 1KTBA 4KCUA 4QAWA 3V75A 3AICA 4UR8A 5BXPA 1LG1A 2A1YA 1J9YA 3DFPA 1GVRA 1Q6OA 4L4OA 3EKLA 1JIBA 3PB2A 1XLDA 2BXYA 3G77A 4HB7A 3H21A 1JDCA 2Z28A 5KETA 1HL9A 3BQ6A 5D4YA 3QV6A 3T2QA 3GTNA 3AJ7A 2Q02A 3MPGA 4NQ1A 2DJXA 1A0CA 3MSGA 1K9DA 4E8CA 3WL0A 1E15A 3SRHA 3W75A 1GV4A 4GO8A 1WYIA 3SGZA 5D2WA 5HR6A 1OFRA 3H22A 5JBFA 3HV9A 3WDJA 3BE7A 1YEYA 3MMDA 4MF4A 1K7FA 2HEJA 4AF0A 3TSDA 3JZUA 4WKHA 2QF8A 4U10A 1L2QA 3PSVA 4OUEA 4M29A 1AJ2A 4GI8A 3SDOA 1B31A 4URIA 4IUGA 1US0A 5FS6A 3MU7A 4IGMA 3A13A 1ZBCA 4WKFA 2EQ8A 4GY7A 4RUBA 1VC4A 2PC8A 1UD4A 3W07A 4IICA 3N25A 4LUTA 3NZ1A 5HA7A 4RZBA 1JUKA 1OX4A 4I9JA 3LPPA 2RDUA 1E5JA 3NS1B 2OU4A 1NH6A 3M07A 1OK4A 1M41A 1B2YA 4IMGA 2V2DA 3BG5A 5G2WA 4GYFA 4Q6JA 2FGZA 3LHYA 4H8VA 2JEPA 4IX0A 3M0HA 2B81A 2G50A 1DE6A 1AH4A 3AOFA 1Q4WA 1JFHA 3QF0A 1WUFA 3DFYA 3R94A 1E9ZB 2Y5SA 4YTUA 1S5NA 3G1DA 4O8RA 1P6WA 3SY5A 1YDYA 2A3HA 4UMAA 3OG3A 4K37A 2Z27A 3MO4A 4AWEA 4S2BA 3VMPA 4L6DA 2DFAA 3STCA 3S2MA 3U6WA 3ZM8A 1J2BA 3MYOA 3FA3A 2G8ZA 1BXCA 1O12A 4QIUA 4AMCA 1FH9A 3WF0A 1O95A 3DG6A 4V28A 7ODCA 4IJCA 4NASA 5D09A 3WQ6A 4UTMA 3UWQA 3OIXA 1ZJAA 1V6TA 3MMUA 4YCOA 4GX8A 3LPFA 2J7EA 4V27A 3H2NA 4PCSA 1R2TA 1GT8A 3QFAA 1PWLA 3L0NA 1UR9A 3MZNA 1X2HA 1WXYA 2XUCA 2C1HA 3MP4A 1HG3A 1X6UA 1P1MA 1YADA 4GZJA 3NZRA 4X0VA 4J3VA 4W87A 1SUXA 5G2IA 1UP0A 4GY1A 3FVMA 4RDYA 3NDYA 2QT3A 2NZLA 2Y8KA 2XVGA 3H12A 4MY8A 2J7FA 3OA3A 4DUXA 1IWAA 2QGYA 3PS7A 4S1FA 3WLQA 3LBOA 3EAOA 4ERGA 2E0PA 5I24A 1U2YA 2ISWA 2QZRA 1JCJA 2JALA 2OT0A 4DYKA 4YPJA 1UWSA 3K8MA 4L4PA 1FP8A 3DEQA 4Y9OA 1IZCA 3UBPC 4NXSA 1U22A 5CAHA 1VS1A 3UVIA 2J47A 4CU7A 2IQ0A 2ZRUA 4DWDA 2OWWA 1R3YA 3S8HA 3SCPA 1JZ7A 2J7DA 2J13A 5H8PA 2OZTA 3MB9A 1A0DA 1SM9A 4OFCA 4JN6A 1XW8A 4JTDA 1W6TA 4GO9A 1YIXA 3LI1A 1JPHA 4ZB0A 4AD2A 4M6VA 3N18A 4BQ4A 4HA3A 4GYKA 1MEHA 4S3BA 3VD3A 3RR4A 4J27A 4DLMA 1U5HA 3I3EA 4DB7A 3SY1A 1T3QC 2YXXA 2RDTA 2QUVA 3LGDA 1ZPTA 4B3ZA 3L66A 2XHYA 3VIOA 2FPYA 2FDSA 3V18A 3R07C 3VM5A 4AZGA 4MWAD 5JCIA 2XSBA 2YCLB 1XLKA 3H2CA 3ZO9A 2DIEA 2XTKA 4ZXOA 1P0NA 4C6QA 1E1FA 1VR6A 5M2FX 1TRDA 4JEJA 4WK9A 3WK1A 3VTRA 5FF4A 2CLPA 1CNVA 3ITGA 3WNPA 1WXZA 2OQHA 5A8NA 1XIEA 4PMXA 4DZHA 2XFYA 1UD6A 4MHBA 1AQFA 3FHQA 2PDIA 3E3HA 4LAMA 4GUGA 3D5HA 1HFBA 5F4XA 4P7OA 1TCMA 1OYBA 3AIQA 4EQWA 5CBBA 3NQVA 2C0HA 4WHBA 3EX4A 4DIAA 4IGHA 3AHYA 5FSDC 1GQIA 4H6RA 5FS9A 3EWBX 1MYRA 1UC4A 4US5A 2G4FA 4ATWA 4Z17A 1JULA 4DEFA 3A6OA 4MB3A 3Q37A 1KXQA 4U33A 4B5UA 5FA5A 2IXVA 8XIAA 3VE7A 5XIAA 2ZZ0A 1TPEA 3FDKA 4DM2A 2WNQA 3BMXA 3GS6A 3DYMA 2V5KA 3MT1A 1EKOA 3E2QA 3KCOA 3C3NA 3KS5A 3E49A 3KUMA 4NZJA 1F2JA 5A3HA 1FFVC 2VFHA 4FB7A 1KQZA 4F0RA 1EPVA 5CC5A 3UWUA 4WX2A 1R3QA 3R0DA 4R34A 1SJCA 1AMKA 4MZ8A 4PTDA 3W6MA 3KLKA 3TFCA 2GRTA 3PBMA 5H91A 1TR1A 1ZQ5A 1JPIA 1EB3A 1XG4A 1NIUA 1AJZA 2QCDA 2Y4SA 5G5HB 2ZICA 2VX6A 3BLPX 4K7VA 3VIJA 2QDHA 4JFVA 4O19A 1MW2A 4JYDA 3FKRA 3BXWA 3W82A 4E2BA 1QFEA 1YYAA 3C0QA 3NRZB 2FJKA 4NP7A 4X22A 3PJXA 3ITYA 4QSHA 3ZXWA 1RCXB 4A22A 5A5WA 2BCPA 4H3DA 1XIDA 3ZVHA 3RMJA 2WQPA 4B9YA 4WIWA 2A79A 1GYNA 1TWDA 4DYEA 1W2VA 3C3UA 2YR1A 2BODX 3NVZB 1FUYA 1GVSA 2WMGA 2Y61A 5AYYA 4KMQA 4FS9A 2H6RA 3W71A 3C2VA 3VYLA 1A5NC 3I6RA 2GR3A 4MWAA 3S3GA 2PWFA 3LX9A 2G97A 1PZ3A 3KBNA 1EBGA 1FWGC 4XV0A 1W0MA 3AMDA 4NAEA 3WQCA 4DF1A 2QJIA 5ECVA 4B16A 4MNJA 2E67A 5I3IA 1WO2A 5BU6A 2E25A 1HJUA 4A3QA 2R8WA 4Z1YA 1X6NA 1E71M 2EPOA 1HP4A 5HPCA 3A5VA 3ARZA 3BOXA 1Q8AA 1GESA 4IIGA 3IIXA 3SCVA 3VKAA 2YAUA 1Z8AA 4HK6A 3LG3A 3AXKA 3T0DA 3G3MA 4U3AA 4UC5A 4TV5A 2NQJA 4UNLA 4KCWA 2CBUA 2E1WA 4GUHA 4S3CA 3W3OA 5K4ZA 3GG0A 1L6GA 2GSJA 3QHMA 3RM8A 4TUFA 2ABBA 4GRTA 5FS7A 1B9ZA 3N4FA 5CGTA 4LVAA 1DWIM 1UWIA 4AWTA 3CMFA 3GBDA 4E4UA 2ZE3A 1MXGA 3TTSA 3BLFA 1VFTA 3HGJA 1M5WA 1Z69A 3QEZA 4PBEA 1ZXIC 3G1VA 1XCWA 2NWRA 3ABRA 1E0VA 4C6CA 1FWCC 4OKDA 1P4CA 3QOMA 1J6PA 2NUWA 4O1EA 1J79A 1NFBA 1JDAA 5AHFA 4QJ5B 4ZQPA 1YQ2A 5L9FA 2CKRA 4K3ZA 4QG8A 1S2VA 1C8XA 1DPMA 1Q45A 1EYWA 3SR6B 1KFWA 1ZALA 3MW7A 3A23A 1GONA 1BD0A 3W01A 1I0BA 1BHGA 5I02A 3ZR4A 3H7UA 4AHPA 1LWIA 1J4EA 4PMOA 2QS8A 4L1WA 1G69A 3VMNA 4JEQA 1RQBA 1XIIA 4W7WA 2WSQA 1DORA 2X8CA 1ME9A 4Q33A 3C4UA 3SQMA 1Q6EA 1K70A 4QRNA 2Z1KA 3C8NA 3B06A 2CCRA 4F8XA 1QR7A 2OODA 2BMBA 3VDBA 3TQKA 3UY7A 3KOZA 1TV2A 8XIMA 4LPCA 4FX9A 1Q6CA 2ONEA 3W7HA 1CGUA 2INEA 2NUXA 5FEPA 3PVFA 2PDFA 1J0ZA 5FL0A 3SW6A 2VDGA 5GPRA 1TMQA 4XTDA 2YB1A 1CX9A 4MLRA 3OQ8A 1VYPX 1W3TA 1G7VA 4A3UA 3LLDA 1X2GA 1YPXA 3SQPA 2P3ZA 5AB3A 4FLQA 3TX9A 1F6YA 3NYDA 3TDFA 3HQPA 4GG9A 3ZJKA 1XYZA 5T9BG 3TKFA 3UW6A 2R6OA 1V0NA 2OWCA 2YDSA 3NPXA 4D72A 1YTEA 2VRKA 1AODA 1V77A 1ESWA 5CSUA 1C93A 5ABFB 4Q4PA 3LPGA 3HPZA 3QYSA 4JNMA 1XLIA 4LU0A 3M9YA 2W3RA 3GHTA 3FA4A 4DJDD 2PZ0A 4N4QA 4GI6A 4B3LA 3QQ1A 1GNXA 4NI8A 5FI8A 2ADAA 3V16A 1JYVA 2ZZ5A 3NNTA 4B2DD 4CD8A 2I7GA 4DJDC 3M5ZA 3CQKA 2J9YA 2WPEA 2OSYA 2ASHA 1S5TA 3QY8A 3QSTA 4GJJA 1SR0A 3VOIA 1U1UA 4MJZA 4ROQA 2ZX5A 4MUZA 5A6BA 4HPHA 1ZJIA 4LUSB 3BVJA 3W02A 4W85A 1XBVA 4YXGA 1UMLA 3W1XA 2VM8A 4D6JA 2MNRA 2NV2A 3LCXA 3SUUA 3AI0A 4FOJA 2R1NA 4YNGA 1QPOA 2A3CA 3KBSA 3G0XA 3T4CA 2PRHA 4LOCA 1GOIA 2VUYA 4GQ0A 1EJ7L 1AA1B 4DO7A 4E8GA 4C5YA 2ESCA 2AKMA 1TV8A 1YXCA 1ICSA 3UQNA 1O6IA 4WDUA 2UZ9A 1HL8A 2JGYA 2PTZA 5GNXA 6REQA 4PMVA 4UIOA 3WQDA 1MRQA 1DJYA 4CCCA 3U2CA 2H90A 1GTEA 2EHHA 3DECA 3H4XA 3OGSA 4QDMA 4HSHA 1NELA 2HBXA 4TX9A 3A64A 4F2BA 1RAKA 3BC9A 2WANA 1X1NA 2VC6A 4OU1A 4QAIA 1W17A 4HYVA 4H7VA 3M0VA 4YTQA 1UR0A 3W53A 1ZY8A 5E09A 3RNDA 3IUHA 1EZ2A 3ZR5A 3E74A 3UXAA 4AZCA 1L8PA 2XGZA 1TZ9A 4RX0A 1PHWA 3VA8A 2IUZA 5GJNA 4O0ZA 3QMSA 1J11A 4LB4A 3C0SA 2CLKA 2SFPA 3BJTA 2I9EA 1WOBA 3W7QA 5CZSA 3URNA 1HTIA 2XYLA 4AQLA 3SI9A 1EWDA 1QCWA 3U2OA 5J5RA 1LBLA 3S47A 3P2VA 3I6TA 2ZWYA 4HMDA 3TV8A 4GCAA 1FXQA 4GQBA 1L9WA 1FRBA 3C56A 2D73A 3M46A 3GG8A 2OMAA 3QGAC 4H1ZA 1PZ2A 3NWRA 1Q2RA 5A95A 4ADUA 3AISA 4KQNA 4IL0A 4O14A 2BDQA 4R3UA 3WD1A 4I8YA 2VR5A 1XDLA 5A6KA 2AGKA 1MEIA 3ANUA 3TFXA 1V0MA 4P2VA 1FKXA 1C3FA 3UXIA 2Q71A 2YIHA 1WAUA 4TX8A 2E6AA 5E0FA 2Z2AA 4PC8A 1OCBA 4XZBA 5DCBA 4HOWA 2EQ9A 1EDTA 2A4AA 2J4GA 3EOOA 4XVEA 4K1GA 4EPDC 4Y8EA 2CBJA 4C6DA 3KTSA 3BK0A 3IGUA 3WD4A 4Y6GA 1E6XM 3AUJA 4J35A 1E6NA 3CO8A 2ZFAA 3ZZ1A 1WKEA 1KXHA 1N5WC 1KCKA 3RDKA 1Q1WA 4ZB2A 1U33A 3ARYA 3DYOA 2DSWA 2D3NA 2CZVA 1PTGA 2WJFA 3G22A 3OPSA 3G0SA 3V7PA 1UUQA 1XS2A 1E1CA 3VINA 5F1UA 5C70A 3USBA 1TV7A 3TK7A 2V3AA 1CXIA 1AW2A 1UP2A 3DH7A 1KM2A 3MCNA 3MJMA 4H6KA 1R3SA 4DNMA 5BRPA 1QNPA 4H9YA 1GVYA 4YTRA 5KSWA 1DWFM 1JCYA 2CLIA 2V82A 3KDOA 3Q58A 3QV8A 2JEQA 2X40A 1I8JA 4AY8A 1ZFJA 4XG1A 2BVWA 2E09A 4NI3A 2PDUA 1SJAA 2YLAA 3JW7A 2ZA1A 1KFKA 4L1GA 2OOGA 1XICA 4NAFB 3TOPA 1EGZA 2DZBA 3UCDA 2QUMA 3KBMA 4H7ZA 3D3AA 1Y5WA 2V9DA 3C2FA 3F4WA 3WO8A 1M6JA 3CIXA 2C6QA 4GKLA 1OF8A 1RK5A 4XBJA 1L2UA 3WCZA 3L4UA 3SCNA 5JMUA 5JH2A 4N9EA 1AW1A 1GXFA 1HP5A 1WX0A 1FWSA 3U7VA 1JRPA 2FZ8A 2VD8A 2WW5A 3R4IA 1GREA 3M7SA 1E43A 2WC7A 5JU6A 3TTYA 4EPKA 5DXXA 5F4WA 1XIBA 3CB8A 4GVGA 2E6FA 2WBAA 2Z1WA 1R9ZA 1VFUA 2ZXBA 3NA8A 5A2BA 1VIWA 4QROA 2V2CA 3QR1A 2QKFA 4R33A 1FCUA 2WC3A 4J2PA 1TX0A 1E70M 3SCOA 1ZB5A 1Q6QA 4C7DA 4HMNA 1W3LA 4LALA 1ZP4A 1KBIA 4RDVA 1CIUA 5FAJA 1MQRA 3IJIA 3WLLA 1A5CA 1H0GA 3OJGA 1FWDC 2A85A 1UZ4A 4JQ1A 2QJJA 3CUHA 2RGLA 1B3VA 1WPCA 1VEOA 3WJXA 3BLOA 3NVYB 9XIAA 3OGRA 3WQ5A 4TR9A 4DJEA 3W00A 4EXBA 5A69A 1MUWA 1ISZA 2HE8A 1BVZA 3KCLA 3AHVA 2IPWA 2XINA 2X1UA 1E4NA 5HNRA 1B3XA 2A3AA 4PBGA 3A22A 3WK0A 4B5NA 1DXIA 3UNTA 1EJXC 5FEWA 2DZXA 2X7VA 4Z2KA 1Z7AA 1E72M 3K2GA 3M6YA 3H2AA 3RX2A 4PUUA 3GH4A 2CLHA 4Z1BA 1YX1A 1J0YA 3FJLA 2DU2A 2FZNA 4HK7A 3CGBA 1OG6A 3EDKA 3FEQA 4QP0A 4PE8A 1VPXA 2FLIA 2PTXA 4MFEA 2I57A 3W1RA 1WKYA 1JQVA 1ADDA 1LT8A 4R53A 5D2YA 1EXPA 4Z1AA 2CEQA 1EBHA 2IKJA 1SO3A 3NO3A 3S1GA 5JQ9A 1BZLA 5I6SA 1CGXA 4G1NA 4A2RA 2Y1HA 5DY2A 4AC7C 1RLCL 3C2YA 4HPNA 2O9OA 1R2RA 4P7NA 1UUOA 3EDDA 1CT5A 3U7BA 2R9RA 4Z0SA 4E4PA 4E6MA 2FTPA 4UTUA 4HU0A 4JQAA 5CZ0A 3M0JA 1OGBA 5D32A 4IM4A 5DELA 2I5IA 2WBKA 1GW1A 4F0LA 5ABTA 1CPUA 3QR0A 2CLEA 3A4AA 1TR9A 3H55A 4GUIA 4DNHA 3SEPA 3AMZA 4HN4A 1A5KC 3NVWB 1QK2A 3S6OA 3EOSA 3CLMA 4HHMA 1BFNA 3TN3A 3UZZA 4WCJA 4UQAA 2QDGA 1XLCA 3RPTA 1V4YA 2VCAA 3TJIA 4P61A 3GXMA 3WLHA 5A2AA 1QO5A 2W61A 6REQB 4P5UA 1YRRA 2V81A 3VNYA 4F0HA 3FKKA 7CGTA 1OZQA 1P7TA 3HF3A 5I23A 5LNVA 2GZXA 4LF1A 4Q8UA 2GPTA 4RR4A 1DQWA 3KRSA 1E51A 3TR2A 1H7RA 4DJDA 2BY3A 2R24A 3QXBA 1LLZA 2GOUA 2C0AA 2P10A 2YVJA 2XN0A 2X05A 3TW7A 4BZYA 4RE4A 3AYRA 2OLSA 1CXFA 2ATSA 1UA7A 3GE7A 4GIEA 5HPOA 3EMCA 3EBVA 2BXVA 3O6DA 1I2OA 4AVFA 5D2XA 3FG2P 4KEZA 1ZSXA 4F66A 2W54A 3W6LA 2FZBA 1B0IA 1Q66A 3TJ4A 3O06A 2IPFA 1SFLA 4PMDA 1HJXA 1UWQA 3HPSA 5AHLA 3WK2A 1F8IA 1OFDA 3NL6A 2DH2A 1BRLA 3G1HA 3KE0A 5DQPA 5GVJA 4I9TA 1VJIA 1VD6A 4ZSUA 3FV9A 1Z44A 2GQ8A 1A5UA 1V3MA 1W9VA 3CUXA 3CAVA 4EIVA 4AXNA 1SO5A 3O9NA 4HP5A 4CN4A 3CYVA 4F3HA 1YBQA 3QPEA 3IIPA 2HPIA 1E1EA 2FGBA 3TSMA 1UW9A 4HU3A 1EO7A 2BOEX 3OU8A 2A6LA 1XH0A 3LOTA 2C16A 1G6CA 4HMCA 4GFSA 4FLRA 4GXPA 1TYPA 1E73M 3WDIA 2X50A 3PAOA 3WMCA 1W3NA 2PDQA 4JX6A 3F4CA 1W3HA 3GU2A 2J9XA 1FFQA 2C15A 4GK8A 3PBYA 1A5MC 1EEXA 2NT0A 3WLNA 5FF0A 4UNIA 4K36A 3PANA 2VZUA 1AL8A 2G41A 4GH3A 1G4SA 3HPFA 2FB3A 3UCCA 5IBXA 2D3LA 4Z2LA 4H4YA 3N17A 3MYPA 4NAFA 2F5ZA 2YFOA 5CGQA 3EPNA 2VOTA 1EPXA 3MUAA 4G8TA 1C90A 4EANA 1YDNA 2PS2A 4IQDA 5J5DA 4HCLA 4OGZA 2PLJA 1TVLA 4O0KA 2F6UA 2NVDA 2WLZA 1N82A 3MUIA 5JUVA 5HQLA 2Z4GA 3FJ6A 2QXWA 1H6VA 1HQTA 3PTDA 2ACRA 5TQLA 4YLWA 4DBWA 4GYPC 1IXNA 2O55A 3WLPA 4QXIA 3HQNA 3ZOAA 3WQVA 4RCXA 2NT1A 4GINA 3HG5A 4ZR8A 1XLFA 3KP1A 4QCEA 4Q6XA 2NQ5A 2CXEA 2R82A 3A47A 1K8XA 1GOQA 3OOQA 1R86A 1GJPA 2C1IA 1D3HA 1G01A 3URHA 1QMLA 3CPUA 1REQB 3K1DA 4XZLX 5M17A 4C6LA 3C2EA 1Y8BA 1VZWA 1KBKA 4X60A 3M44A 4YYFA 4M80A 4Q4RA 4C65A 3S6DA 2OXNA 1QI2A 4XD5A 2TODA 1PX3A 3NVDA 4O16A 3T55A 2XIIA 1C8QA 4ZO9A 1W56A 1BYAA 3WZ0E 2HQAA 1CXLA 2DDXA 4B5WA 2V5LA 2Z7KA 3THCA 1G0CA 3ARRA 1J10A 2R1PA 4K2SA 3BMVA 1K4QA 4IP7A 3ATZA 3KP0A 1S2AA 1OD0A 4AXKA 3UFYA 4Z2HA 4ONVA 5BYWA 3QOKA 5BWFA 3EWZA 1JEZA 3NEHA 3CHEA 3F5JA 2PLMA 1MUMA 1S2UA 4IX2A 1GKQA 2V68A 4WJ8A 1KM5A 1QHOA 1EX1A 2UY4A 3WQWA 3ENLA 4NZ4A 3LSBA 1X7IA 2CHNA 3IANA 1UASA 1K8YA 1B1YA 3TQPA 4LYQA 4B4HA 3P6LA 4LX4A 2F61A 6CGTA 2J7GA 1TWIA 3IAQA 1EJSC 3QLDA 2FQIA 3RM9A 5DMLA 5HMSA 3T78A 4EOUA 1F3EA 4LH8A 4W8LA 3KOXA 3NOEA 1QI0A 4GBDA 3HPXA 4QM1A 1CGVA 1E6RA 1DWJM 1A5LC 3ZLHA 4GR1A 5C7VA 3GIYA 4P8UA 1K8CA 4KWSA 2OT1A 3RAOA 2VR4A 2Y5JA 5HR7A 5KVHA 1GRHA 3LY0A 4JFSA 4DPQA 1KKRA 1Q6LA 4HPJA 3ARQA 5MF5A 4ERAA 1TPVA 4D6GA 3PF3A 3V3WA 3N11A 1NQ6A 4ML4A 3R8HA 6ENLA 3R79A 4CN1A 3B4UA 4EF9A 4AVNA 2ACSA 4Z42C 2PTYA 3HGRA 5AHIA 1PWMA 4QS5A 3CH9A 3PZIA 4ADSA 5BCAA 4XAGA 2CLMA 3G1XA 4DJFC 2XM2A 2YKKA 1ZJHA 1R6WA 1TPH1 3CXOA 4DJFA 4I9MA 1DQUA 2YL8A 4NILA 2ISSA 2CDUA 4U4MA 3VOFA 1C8YA 5JCMA 4PTNA 5ABGA 3BLIA 4QBXA 4XZWA 1KQYA 1VEMA 4D2JA 1S39A 4UQEA 4JAWA 5CC3A 4GC4A 5FL1A 3UGVA 2GFTA 4ZQCA 3P62A 4XKYB 4LS0A 4D6DA 2I14A 3RPDA 1BYDA 2C3ZA 5EU9A 3B9AA 4M7SA 3E2SA 7PTDA 1QXLA 1P6BA 2X42A 3LBMA 2WZIA 3N14A 2PGWA 1MFVA 1TIWA 1H7WA 5TAOA 3G1YA 3QFEA 4RNFA 5I5RA 1G4PA 2XH7A 4JQ3A 2VELA 2OG9A 1SMDA 4LCRA 2CERA 3VIKA 3UU0A 1ADOA 1POJA 4C60A 3FW6A 3HN3A 4L1XA 1QDSA 3ARUA 4ZGYA 3CMGA 2FDMA 3TIMA 3SRFA 3WL1A 3GSMA 4AVOA 3BARA 4UQ9A 1TUXA 1JZ5A 1TZZA 3IGXA 4X0NA 4PUMA 2DV0A 3DHPA 2XVNA 1EX5A 1YLVA 5CZJA 1NU5A 1XH1A 7TAAA 4A3HA 5AHNA 5DMYA 1SU5A 4ZOHB 3M6DA 2YBTA 1RBAA 2F38A 2PMQA 3N04A 3N13A 2B31A 1O68A 2RH9A 1FO4A 4YHGA 1B5TA 1WBJA 2RDXA 1VQTA 4TVWA 2WP6A 2OQLA 2YJQA 2ZZCA 1ISYA 4XIMA 1O1HA 2O9TA 3NGJA 3Q94A 1NEYA 5K3VA 3LCIA 4MG4A 4UZSA 3GVVA 3OTRA 5I0DA 1KB3A 1XKYA 1RY0A