3RGTA

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with d-arabinohydroxamate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
403
structure length
383
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-mannonate dehydratase
publication title Crystal structure of d-mannonate dehydratase from Chromohalobacter salexigens complexed with d-arabinohydroxamate
rcsb
source organism Chromohalobacter salexigens
molecule tags Lyase
total genus 141
structure length 383
sequence length 403
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2011-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3rgtA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3rgtA01
1EC8A 1SJCA 3Q45A 4FI4A 3CYJA 4A3RA 5BOEA 3GY1A 3IJLA 3R0KA 3ZVHB 1P48A 4HPNA 1TZZA 3IJIA 3SJNA 3FJ4A 2PTYA 2GL5A 3SN1A 4G7FA 2OQHA 4GGHA 4Z17A 3UJ2A 2GGIA 3TJIA 4KEMA 2P8BA 3MZNA 4EWJA 2XH0A 1BKHA 2QJMA 4J3ZA 4MGGA 3ZLHA 5J04A 3RCYA 4DHGA 2PA6A 4M6UA 3TQPA 4A6GA 2P3ZA 3JW7A 5FJUA 1WUEA 3HPFA 3ES8A 4GISA 4KT2A 3OZMA 3CT2A 3DERA 1XPYA 1NELA 3S47A 1EBGA 2QJJA 3N6HA 1SJDA 3FYYA 3DDMA 4GYPA 2P88A 2OG9A 3N6JA 3CK5A 1WUFA 2GGHA 2CHRA 3JVAA 4IP4A 2NQLA 3PK7A 2O56A 3NZGA 4H2HA 3RR1A 4KWSA 2HNEA 3T9PA 3DIPA 3U4FA 4IT1A 2OPJA 3CB3A 2AKMA 2PTXA 2GGEA 4G8TA 3U9IA 1TKKA 2QDDA 3I6TA 4HCDA 4IL2A 3S5SA 3FV9A 3UCCA 3SQSA 2OKTA 4HNLA 4GYPC 3V3WA 1W6TA 2PP1A 3IJQA 3MQTA 2XH4A 2PU0A 4A35A 3VC6A 3ES7A 3PWIA 4HCHA 3DFHA 3TCSA 4ENLA 1BQGA 5EU9A 4HN8A 2MUCA 1TE6A 2PTZA 4X2PA 4IP5A 2GGGA 3IK4A 3QN3A 3MSYA 4HYRA 3OZYA 3KUMA 1P43A 1FHVA 3VFCA 2XH2A 4DN1A 2PU1A 4H83A 3H7VA 1SJBA 4GFIA 3OP2A 3CXOA 4K1WA 3T6CA 2OVLA 4ZCWA 4JHMA 1MDRA 1MRAA 1EBHA 1KKRA 3MWCA 1PDZA 3N4EA 4DYEA 1MNSA 4J1OA 2XH7A 7ENLA 3THUA 2P8CA 3QTPA 3K1GA 4MKSA 3T4WA 3UCDA 5BOFA 2OX4A 1KD0A 4DX3A 2PODA 1JPMA 2AKZA 5FJPA 3VA8A 3QLDA 4K8GA 3DESA 3PWGA 1FHUA 4K2SA 5FJTA 3ZLFA 1L8PA 1RVKA 4ZA0A 2PMQA 4E4UA 2GGJA 4E4FA 3DG3A 1JDFA 3N4FA 1JPDX 2FYMA 3PFRA 2I5QA 2ZC8A 3MUCA 3I6EA 3UJFA 3R1ZA 5FJRA 3V5CA 5IDZA 3TOYA 1YEYA 4M0XA 2AL2A 1NU5A 4YWSA 1KCZA 2P0IA 3TJ4A 3NO1A 2HXUA 2DW7A 2GSHA 2PPGA 4IL0A 4ROPA 2HZGA 2ZADA 3UJSA 3B97A 3DG6A 3D46A 3QKEA 3VDGA 3P3BA 2QDEA 3H8AA 3UXLA 4DXKA 3UGVA 3TWBA 3VCCA 3DFYA 3OPSA 3JZUA 3DG7A 4E8GA 3H12A 2QVHA 4DWDA 4GIRA 6ENLA 1MUCA 1KKOA 2OO6A 3R11A 3BOXA 3D47A 2OLAA 1XS2A 2OZ3A 1ELSA 3P0WA 4Z1YA 4GMEA 3SN0A 3RITA 2AL2B 3UXKA 3R25A 2AL1A 3DGBA 3SN4A 2PP3A 2OQYA 1JCTA 3QPEA 2PS2A 3FCPA 3BSMA 3BJSA 3I4KA 3CAWA 4HNCA 1SJAA 3V5FA 4HCLA 3H70A 2HXTA 4F4RA 2OZ8A 3GC2A 2PTWA 1OEPA 1EC7A 3NXLA 3ZLGA 1R6WA 4KPLA 1IYXA 4JN7A 2ONEA 3FVDA 3T8QA 4FP1A 2OFJA 3DEQA 1ONEA 3STPA 3RO6A 3VC5A 4H1ZA 3GD6A 3EEZA 3MKCA 2PGWA 2FKPA 3ENLA 3MY9A 2XSXA 2MNRA 3SSZA 4IZGA 4IHCA 4GGBA 3V4BA 1F9CA 3ZVHA 3NFUA 5ENLA 2QQ6A 1R0MA 3EKGA 3P93A 2POZA 2PSNA 3ZVIA 3FXGA 2QGYA 4JN8A 2DW6A 3R0UA 2OZTA 1DTNA 2RDXA 4MMWA 4E5TA 3R10A 3VCNA 1E9IA 3RRAA 1ECQA 3UJEA 3RGTA 3TW9A 3SBFA 1MDLA 2QJNA 3GO2A 5FJOA 3TTEA 3OTRA 1EC9A 2PCEA 4H19A 2GDQA 2PP0A 3UJRA 4E6MA 2PGEA 3TWAA 1PDYA 3OW1A 3Q4DA 2XGZA
chains in the Genus database with same CATH superfamily
4PYSA 3BAYA 1WAUA 3CYJA 1VIZA 2PFHA 2Z28A 3EOSA 1UR0A 5A6BA 3AYRA 2EEXA 1CIUA 4Z1BA 1O95A 3WDRA 1OM0A 1OQFA 4ZTYA 3ZOAA 5C55A 3G1RA 1MXDA 3ZS4A 3ZWTA 4S3AA 4JTGA 3KVMA 3TJIA 3SCUA 1V6XA 2J7BA 3GHUA 4KMQA 3L2LA 2V3DA 3VIIA 3SQPA 4JTSA 1VGAA 3TCEA 1BKHA 2CC0A 1PB0A 3EPMA 4DNMA 4ZENA 4DHGA 2BDQA 2GOKA 1H2JA 3BZJA 4FNTA 4C6LA 5TIMA 1KFLA 3C2EA 4UZSA 2GQWA 4JTEA 3W84A 1AW1A 4PMNA 1JD9A 3TTSA 3SJ3A 1IR2A 4PFHA 3T05A 1BSIA 1ZJBA 4O8RA 3D3AA 4BF5A 3DDMA 1JFXA 3CL7A 2CLOA 2QGHA 3GNPA 3AIUA 2X8RA 2PDYA 4YYCA 4NZCA 1JZ6A 1HT6A 3IGUA 1J8VA 3J7HA 2NVKX 2WHMA 4LA1A 2XIOA 2VT0A 2PDFA 3UG5A 2NVAA 4S3CA 3RR1A 3WMBA 5JXQA 3ZMRA 4LBUA 5A6AA 2QCLA 3AYVA 4AY8A 5CEWA 1Z69A 3LBCA 1Z41A 2HBXA 5D9PA 3SCVA 1WBJA 1JAEA 1XFCA 3I7QA 3SI9A 3FN9A 3O8AA 4LUSB 2BY1A 2D23A 3FV9A 3UCCA 3KWSA 3EB4A 3SUSA 3LEPA 1RBAA 4TVDA 2Y4SA 3QV6A 3UVAA 3W53A 1Y5VA 2YL5A 4DB7A 4KIEA 1H49A 1WOBA 1UQYA 2VUNA 1E51A 3EMCA 3WIJA 3UY7A 1WXYA 1KV5A 3VE7A 2PUZA 5DX7A 2OSYA 4K1GA 2O55A 2VFIA 4LVFA 5A6KA 4UNKA 3BAWA 2CWXA 1VYSX 4BURA 4AC1X 1OG6A 2D69A 1GRBA 4JN6A 2BVTA 1XHGA 3O3RA 2C1GA 3W7CA 3QZEA 2HCVA 2OGYA 3CXOA 1BYBA 1TPFA 1PXGA 3AS2A 3CL8A 1E1CA 3URBA 5AYZA 2ZYFA 1FHLA 4QDPA 3CIWA 1GZ1A 1CXKA 3K46A 1TV8A 3BMWA 3KDOA 4WDUA 3KS5A 2QF8A 1V51A 1GOWA 2I14A 4JNYA 1P7TB 1AMKA 4GKTA 1H5VA 5FAGA 1REQB 4HNNA 3B0PA 1ME8A 3C86A 4LCRA 1S2UA 3ZT6A 4O57A 3TYCA 2DJXA 3PZQA 4UNLA 4F9DA 4JTIA 1S2WA 4RCXA 3GHSA 3PWGA 1EQCA 3GVRA 4HSHA 1PKYA 3CV6A 4JIIX 5FA5A 5CAKA 1T6MA 3TA6A 2QMJA 4HKPA 3N4FA 4AVFA 3TSBA 2YCLA 3TN3A 1KWKA 3S9YA 3C0QA 4ZTXA 4DJEC 3LQGA 2OGJA 2G97A 3R1ZA 4AZ6A 5IDZA 1GJWA 3ANVA 3NTYA 1SO5A 1YEYA 1L6FA 4FXSA 3WLJA 1VKFA 3W71A 3PBVA 3BAJA 2DZAA 2BASA 3PC0A 1E6SM 3THCA 5AB3A 1BD0A 4LEQA 3WBXA 2V68A 2BC1A 2O4MA 1EA9C 2DW7A 1E0XA 4B16A 3B97A 3HV9A 1A5OC 1F6PA 1HO1A 2ZZ2A 1SSGA 1BRLA 4UCFA 4CN6A 5LIWX 5ECVA 1XYLA 3L8KA 3VOFA 1TYPA 3P74A 3W9ZA 1Q6QA 1QBAA 4Q4SA 3R89A 2C19A 2NQ9A 3G1VA 3MZ2A 1OIFA 3E9AA 3NPVA 4EPDC 3GR8A 1UR3M 1ELSA 3PZIA 4GMEA 4H50A 5A6LA 1NAL1 1UKPA 4AD3A 1YBQB 4JQ9A 4GIAA 1VBGA 4G1NA 1KQYA 1HKMA 1VRDA 3CT7A 1TREA 1XRTA 4DJDC 3EAUA 3MP4A 1TB3A 2Y8VA 4BWLA 4JY9A 3RIKA 1X38A 3W00A 4JFUA 1O7AA 3ABRA 3LY0A 1GSNA 1CXHA 3TXVA 5G2HA 3RJXA 4GBDA 3C8NA 3BWWA 3KCOA 1HJSA 3G6MA 1J2WA 2RJGA 4D6CA 1A3XA 5HANA 4XSMA 4RDZA 2QEZA 4IGNA 1JL8A 4GPNA 1S3HA 2I5GA 2NX1A 2VDIA 1LDCA 3R2GA 2Y2WA 2YDRA 3IIVA 5CPQA 1NOUA 3W7LA 3HA1A 1GTEA 2Y8UA 3P8IA 4YWIA 1FKXA 4LNCA 3ZVHA 4M52A 3LD5A 4EXAA 4LYPA 1VEMA 3MCNA 3G1HA 5A95A 4EQXA 2GQ9A 2C7FA 1FEAA 2BC0A 3E38A 4ICMA 3TN6A 1GRHA 1MQRA 1H50A 4L6DA 3SBFA 3ETRB 2V0TA 1OFOA 2QUNA 4LBSA 4GUHA 2W91A 5BU6A 1QO2A 3CU2A 3N11A 4DUXA 5IOBA 5TAOA 2CPUA 1DIEA 4I5XA 4L80A 4XISA 4AY1A 4D8ZA 4TMCA 3LU2A 2P50A 4LQ1A 4I6VA 1VEPA 5JIWA 3P80A 1AG1O 2ATMA 1R8LA 1E6XM 4I5RA 3UXAA 4JEQA 3WDQA 1KV8A 3KHJA 3SR6B 5H91A 4HMNA 1JZ4A 1L6YA 4APNA 1TJ0A 1PTDA 4ZL1A 2VC5A 1YE6A 4C6NA 3NQDA 1XBZA 4GZ7A 1VB9A 3EB2A 1K8YA 2WVVB 1GQIA 5CPLA 3M6YA 2QUMA 5KVHA 4RJEA 2XINA 3V5OA 2DUZA 2C16A 2H9AA 4MB5A 4OE7A 1H1ZA 4LTSA 4XZLX 5A6TC 4DBDA 1C3FA 4XV0A 3S1GA 1D7KA 4WGXA 5JMUA 1QDSA 1OSEA 2J62A 1NFPA 1EJWC 2WNQA 4CNPA 4CQBA 1BZLA 3OODA 3BW4A 4L65A 1G7UA 3AISA 3S2JA 1Q6LA 2P88A 3USBA 3BLOA 2INEA 4IP4A 3RR4A 1HG3A 1C8VA 5CZKA 3SCSA 5EPDA 4M6PA 1B9BA 1V0KA 4BEUA 3WJXA 5HNTA 1F2JA 1XIJA 4S1FA 4GI6A 3P5YA 4JFWA 4LCQA 4YLWA 2ZRXA 1U5HA 4M6VA 4PMOA 1WKFA 1Z48A 1MNZA 3BC9A 4IPLA 1OD0A 2ZA1A 2YL9A 4MWAA 2ACRA 2O9RA 3WBWA 3ES7A 1V7YA 4JY8A 4QS6A 3F4VA 3LM7A 4ICNA 4PEEA 2D0HA 3GH7A 3M4HA 5CJ5A 4DF0A 5FS7A 5LNRA 3A24A 3BG9A 1ITXA 1O60A 3I68A 1SR9A 2Z25A 3R8RA 3E6EA 4TTGA 1F4HA 3NOYA 4WZHA 2G3MA 2AMGA 3SO7A 1FEBA 4Y2WA 1CXFA 4IMAA 4H8HA 1EJSC 2TPRA 1QK0A 1HUVA 2D2OA 2QCFA 3K13A 1F3WA 2FGBA 2V81A 5C6MA 2V5KA 4MAVA 1YQZA 2A3HA 4JIRA 3ITTA 4P8XA 7REQB 3ARTA 2XGIA 1VCGA 1IEIA 2ZIDA 3KBVA 1TQXA 4EIVA 3TTOA 3MWCA 1QO5A 4HHMA 3M47A 2WMHA 2F38A 3EDDA 1JJKA 2BCPA 4MPKA 3WEMA 3E02A 1D8WA 4C5YA 4JICA 4DPPA 3BGGA 3F03K 1KD0A 4P8VA 4FR6A 2ESCA 2G4JA 4MKNA 1QRQA 2HSAA 4AC7C 1W3KA 3VGHA 1GHRA 2I57A 1BF2A 4FHAA 1M01A 1LL6A 2QIIA 1O1HA 1YX1A 1KFEA 3NQEA 1XIGA 2NXHA 4ZA0A 2XGBA 3NCOA 3PPFA 1O68A 5TBOA 3UA3A 2VO5A 1V7AA 3T0DA 5ER0A 1H7XA 2WVTA 3IIOA 3VGEA 5HJLA 1FTXA 3TOYA 2C71A 1DV7A 1H7NA 4JPGA 5E9XA 2E8ZA 1H1NA 1AOGA 3W7JA 3TQKA 3GXIA 3SZ8A 4QE4A 1QT1A 2YVFA 3QW3A 3UBPC 2C0HA 2QW5A 4S3FA 4IL0A 1GW1A 1W1IE 1R2SA 3R6IA 3QKEA 3WELA 3PANA 4CUCA 2GRTA 2QV4A 3VCCA 4GX8A 3LPFA 3JU2A 1LT8A 3VIJA 5IHSA 4GIRA 4LB3A 3VIMA 2QJHA 4MDPA 1MUCA 1CB2A 4Q8UA 3S2NA 1XSJA 3R11A 3UW6A 1BVWA 2WOVA 3SQMA 1NOWA 4B5TA 2QCDB 3VK5A 1B0IA 3A5VA 3NJ3A 3WJZA 4Z1YA 1NDZA 3ALFA 4OHQA 2VQTA 4X0NA 4LVBA 3KRBA 3N04A 1K7XA 1LJYA 3L4ZA 4J35A 1VR6A 3E0FA 3AAMA 3L5MA 3HGJA 3TN5A 3NL6A 5DBUA 1Q6DA 3MU7A 5I0DA 1PX3A 1N8IA 5LZLA 1ZJAA 1IHIA 3VM7A 2EGZA 2J9YA 3CUGA 3WNNA 2BODX 1Z89A 4JIPA 1I0DA 5BRPA 3NGFA 4NI8A 3AIWA 1HQTA 1V03A 2J13A 3KOZA 3E0VA 4TV5A 5C9ZA 3FW6A 4ZGYA 1IT0A 4J3UA 3QZAA 2F6XA 1T96A 4UTIA 3EEZA 4MUPA 4LY8A 1A80A 4ZR8A 3KVJA 3KOFA 1IIHA 1DWIM 2PURA 1FQ0A 3VIGA 1F9CA 1JOAA 1XIIA 3WNMA 3INPA 4MJZA 4Q8WA 3C5QA 2IPFA 2QQ6A 3EX6A 4KKXA 3EKGA 5D33A 1IXNA 2GJXA 1UUOA 2PGRA 4GABA 1CLVA 3E2SA 4MY8A 5DN1A 1DXFA 3WH5A 4FIQA 4FA3A 1DNCA 3SUUA 2V2HA 1PYMA 5F4SA 2Y89A 2BXVA 1VEOA 1MDLA 1HGWA 3EGJA 3MUY1 3KBMA 5FJOA 4QAIA 2ZUTA 5C9WA 2WC3A 5DFAA 2ZZ1A 3HN3A 4PBGA 2R9ZA 2YBUA 2JKAA 2G50A 1KGUA 2HNHA 8TIMA 1MEIA 2YQUA 1YTKA 4JZ5A 1E9LA 3UQNA 4X22A 2JQXA 3LPPA 3SGZA 4EANA 2XM2A 1D3HA 1VYPX 4IGMA 1US0A 3GM8A 4IJBA 4KEMA 2VWSA 1A3HA 3HZ3A 1AQMA 2A5HA 2BOGX 2V69A 3E2VA 1AZ1A 3TVAA 3NZRA 2XH0A 3PWAA 3QW4B 4AMCA 4MGGA 1V3MA 1EGVA 2Z1BA 2PA6A 1ECEA 3AMLA 1EDGA 2V5JA 3MUZ1 3W22A 4H4VA 3CH0A 1XBYA 4OQVA 3A12A 4O1DA 2WNWA 1QHZA 3IIPA 4W7VA 1CW2A 1U22A 4X61A 2EBNA 1TRIA 3LCHA 4N6FA 2EG7A 4LANA 1UA3A 1CXLA 2QNEA 1DJZA 3TW6A 1XCFA 3CK5A 4A8NA 3CASA 1VAHA 4GXWA 4PTVA 2E4TA 3MUAA 4D8LA 2CZVA 5C9UA 3AROA 1RBOB 2O56A 4WUIA 4Z2IA 2VFEA 5D30A 2W4XA 4BI5A 3M0VA 1W37A 1ICPA 4S3JA 3EBVA 3NAVA 1J79A 4I7WA 1RCXB 1W9UA 2OCZA 3NQAA 5MKGB 1QJWA 5LA2A 1U2YA 4D6EA 5I09A 3A3HA 1TKKA 2D0GA 3O0HA 4FXRA 4ZB5A 1SZFA 1MW1A 3RM9A 4XZIA 1ENUA 4H4UA 3BG5A 4GYPC 4NG3A 3TC6A 1OVDA 3CV7A 1A4MA 3K2GA 4B5SA 8RUCA 3WBAA 2B31A 3W7KA 1BQGA 3N13A 1WDQA 3LMZA 4QIUA 2WZTA 2W3SA 3OB8A 3WG6A 4H4ZA 3V1HA 3GXPA 4W8LA 2JALA 2ICSA 4XIMA 4S38A 3KUMA 4F2TA 3WQGA 3H7UA 3ME3A 3MW7A 3SQLA 3TQVA 1DJHA 3LRMA 2EPOA 3TW7A 1YDVA 3VIPA 3B4YA 1OK4A 4N7QA 1Q4NX 2OVLA 2PWVA 5HJYA 1MDRA 7PTDA 5FS9A 2YXOA 3B9JB 4K37A 1VCFA 1TIMA 1H61A 4D72A 4UQBA 3KRZA 3CZEA 5KZ6A 1QK2A 1M03A 4RXFA 3GG8A 4Y8EA 1C7SA 2AAMA 4Q4PA 1POJA 4P7LA 2FMNA 3PJWA 1ESWA 5FJPA 3TU9A 1EOKA 1H41A 3I7RA 4C7GA 4HT3A 3M0KA 3GUGA 4KCVA 3VKDA 4YTQA 4UTMA 4RDVA 4C6FA 1GOXA 3W74A 5CBBA 2CLHA 2PDJA 1SFTA 1YTEA 4GD0A 3DC8A 4ADWA 3OO2A 5JU6A 4EPKA 1KBIA 3C8FA 3RN6A 1WKDA 1M6IA 3H2FA 3VGFA 3WQ6A 4IFKA 1ZUAX 1WV2A 4I7VA 1XLJA 1P4CA 3PUDA 2PF8A 4IMFA 1GVQA 3EOUA 2QDGA 4XTDA 1NU5A 1Q45A 1AL8A 4MZ8A 2Z2UA 1AW5A 4W7UA 3M0MA 1LPFA 4ZXOA 3LG3A 4FF7A 3CGDA 3DUGA 4AVNA 4H4PA 3UG3A 4C6JA 4YHGA 5HR6A 3O15A 1UKQA 3D0CA 4GNVA 4PN2A 4QTGA 1RVGA 1KNWA 4FALA 3RYSA 1K6AA 3F2CA 4J4KA 1TPB1 3VDHA 2WOIA 4YTUA 2QDEA 3UXLA 5CGTA 4NZ5A 3RMJA 1QATA 2A3BA 1DXIA 3BK0A 4DM2A 1UOZA 2P5NA 3TR2A 4AXNA 3VZZA 3VAVA 4GY1A 1S5VA 2VVNA 3DENA 3GTFA 2QCHA 3NA8A 1NM9A 3QMSA 3QGAC 2VFDA 3QVQA 2ZDSA 1BSLA 2HK0A 6XIAA 3WK1A 4PTDA 1NARA 3N19B 1WCGA 5CKSA 3MV01 1ZBCA 5E0KA 3L4VA 2C18A 4UC5A 1HJXA 1MUMA 3EA3A 3OU8A 5I3DA 1GVYA 1LTDA 3WNKA 2YLLA 2D1ZA 1GZGA 1CXEA 4ZO7A 3H4GA 4JHZA 1OEPA 5DRCA 1EC7A 3SY1A 3AUOA 4XSLA 4KWVA 1B1YA 2D3NA 5FCZA 1W3IA 4JL2A 3NDZA 1FWGC 5CAHA 1NDAA 2IUZA 3COTA 4TU1A 3UWUA 1XUZA 4YIWA 2TPSA 3N17A 2EKGA 1DWJM 3GE7A 1GOMA 2XFRA 3KVLA 1XCWA 3LGEA 4IZGA 1T7LA 3BW3A 5FEZA 3CO4A 2VX5A 3TOPA 3AXIA 4BKNA 1HGYA 3DN5A 1K9DA 4AWUA 3Q67A 5G1TA 3N9RA 2QLYA 1OC7A 4LUIA 2JIEA 4UFJA 4KWOA 3ZVIA 4F0HA 4CKQA 4QQ3A 2ZUMA 5IFPA 5EFFA 2RDXA 4WDXA 1AW2A 4J27A 3OIHA 4CLMA 5I77A 3NNTA 1DJQA 1HW6A 4QLLA 1D7YA 1X7IA 3B0XA 3BCFA 3M44A 4GUGA 3RU6A 4GZJA 1QOXA 1ZK7A 2YBTA 1EH9A 4C1LA 4M24A 4GOAA 3VNYA 4Z42C 4H19A 2DZTA 3TJLA 4MVAA 4IM4A 4PCNA 1R7AA 3FAXA 2CZDA 3O16A 1TPWA 2V5CA 5DT7A 1OCJA 4MSSA 4AEOA 4NZ3A 5BOEA 4HYVA 1PPIA 4FNQA 4BF9A 4FLQA 1P48A 1TZZA 4GC4A 2R94A 3M6DA 1Q85A 1QHPA 2UY3A 3BQ5A 1OX4B 5F4XA 4XBJA 3FOKA 1Z8AA 3O7UA 4CD8A 3WLPA 4Q8MA 3CB8A 1EIBA 2RUSA 3P67A 3GAYA 1TMLA 2J88A 4ACZB 3LHTA 1S1RA 3LERA 2ZUNA 4IX2A 3N4AA 1YMYA 3N15A 2ZZCA 2X42A 1MSSA 1W3TA 1R85A 1ZQ5A 4CQCA 3D3FA 2ZICA 3PBUA 2C3ZA 5HUPA 4YJ5A 3Q6JA 5LNUA 3ATZA 2DP3A 1W9XA 3FJNA 3VMPA 3TROA 1PS9A 4HYWA 3EXRA 1ZAHA 3THQA 4WLCA 4Y8FA 3LHYA 2UY4A 2GLKA 4A8IA 3R79A 1Q6FA 4AF0B 2FPTA 5I3KA 4DO7A 3JVAA 4MYXA 2NQLA 3LCXA 3U2OA 2QCMA 1KM0A 3PK7A 4TTUA 3MMDA 3IEBA 2FIQA 1ISZA 1TWWA 2H3BA 5U1OA 4K6AA 4RZBA 1ZX9A 3D6NA 3IGHX 1BHGA 4MLJA 4KERA 5M3WA 3H55A 5DANA 3DJJA 3QMRA 5XIAA 4R9XA 5G5IA 2FPVA 3E96A 2ZKMX 3RNDA 3AHZA 3KRUA 2HJPA 4PCFA 5AC4A 3H21A 4WJ8A 3R8HA 3MS8A 1QW7A 1O6IA 1Q8AA 1H6VA 3DFPA 5CJMA 3MKVA 3DFHA 3IV8A 5A6MA 2YCKX 4B5WA 1GVFA 4GUJA 3SURA 4N4QA 4KF1A 4O53A 1L2QA 2PDHA 4FXJA 3N6QA 1RK5A 1PZ2A 3KL3A 3H4WA 4UTLA 2PTZA 5BNKA 4R85A 3VNJA 2GGGA 2OJPA 3S9ZA 1YIXA 3TZFA 2DFAA 4HYRA 5C8BB 1XLDA 1I8JA 2E6YA 3REQA 1FWIC 3M5ZA 3GDMA 3RX3A 5I06A 5F4WA 5JVLA 3KX6A 1EWEA 3EANA 4ZCWA 3CLMA 3SR7A 5AC8A 4GVGA 3CPUA 1JR1A 2XHYA 2NQJA 5I23A 2DZVA 2WNNA 4GZEA 4O12A 3GW0A 3NSMA 2PC8A 3THUA 3C52A 5BXTA 3GWQA 4MYAA 1UYQA 2Y24A 1FXQA 5D9MA 1XR2A 3WLMA 1T8QA 3SCOA 2A3EA 1FWAC 2EJAA 1V4YA 4AWTA 1GRGA 1E43A 3WLHA 5FSEC 4J5NA 4BFAA 1BEUA 1FO4A 2QKFA 2WXDM 5D2TA 2J4GA 5AYYA 1SO4A 3STEA 4D1IA 2ISVA 3W0KA 4L64A 4GQBA 4AYSA 1KTBA 1KB3A 4H7CA 1IXQA 3CWHA 4DIAA 1NTHA 2XJ7A 3JR2A 1JYXA 3I6EA 3OA3A 1ZBVA 4BS0A 3FNDA 2BNJA 5A8MA 1FIQB 3S2LA 2PBGA 3TC3A 4EQWA 4UFHA 1ONFA 3HO8A 1DJXA 4GY0A 1J18A 3LI0A 4MB4A 4NNAA 3PZTA 3MI2A 4I3GA 1GTHA 1LLWA 2E0PA 3A5FA 1WKYA 3NWRA 1WDSA 1BVNP 2A6NA 1S38A 3UJSA 5AHLA 2IS7A 3G8EA 2JFEX 3K4WA 1R30A 1GVEA 3DHPA 4BV6A 1J5TA 4GNKB 2WO5A 1IXPA 2A8XA 3W7OA 2EHHA 1B3YA 3W1RA 4ZQOA 1TV2A 3BSGA 1BGGA 1J0IA 1DIDA 1DVJA 4WDTA 5F2MA 2WAGA 5EYWA 2VNCA 2ZFAA 1NIUA 1EJ7L 4WY0B 1O5RA 5A69A 2GJXB 3WJYA 4KFPA 2W9MA 1F05A 3UXKA 3T7VA 3NQ7A 3LI1A 3H2OA 3G0SA 3WD3A 2OSWA 4CQ9A 4V27A 4N6EA 3W7HA 3EYPA 3GXTA 1GNXA 1RLDA 3K4DA 4HB7A 3F5LA 3NG3A 2DZSA 4HNCA 4NZ1A 1JYNA 2WJZA 4HCLA 2DZBA 2PWEA 3FLUA 1U5VA 1EDQA 3WO8A 4YMZA 4LCSA 1JPKA 4BQ4A 2G3FA 4R88A 5M17A 3NVZB 5CXPA 4IGHA 3T8QA 2EG6A 1H0GA 2D2JA 1T3QC 4JBRA 1E3XA 1ONEA 4F0LA 3I6RA 6TAAA 3EAOA 4ACYA 2X0SA 1EO5A 3RPMA 3WKZA 1OFRA 4XZMX 3VIOA 3UWZA 1E70M 4PTWA 4LAUA 4RL3A 2PWFA 3WH8A 3BPWA 4HNVA 3FJ6A 5ENLA 4LT9A 4N0RA 1IEXA 1UC4A 2QF7A 5CPOA 3BARA 1I2PA 1KFBA 4JQ2A 3KLLA 5EBUA 5A6JA 3UT0A 1I45A 1WXJA 3BVJA 3EA2A 1LRNA 4I9MA 2Y7DA 2CKSA 2XG9A 3RX2A 1TYTA 2PDIA 4ERGA 2XISA 2BGSA 4CNOA 2PP0A 1VQZA 1TVNA 3UJRA 4C6EA 3BTNA 4AD2A 5I2UA 5D8ZA 3FAWA 2W54A 3EB3A 4MADA 3LGGA 1UPPA 2WMJA 4FI4A 4IG2B 1JDDA 2BY3A 2J6VA 1VZWA 1PX8A 3SAZA 5H8PA 3QQWA 1UQZA 4J57A 1M65A 1K9FA 3QZ6A 4FNPA 4J2MA 3UJ2A 3L4WA 3H26A 4Y9NA 1W91A 4LU0A 2O7SA 5D2YA 6TIMA 1SZNA 3WH6A 1HJQA 5T26A 2H6RA 5HXMA 2NSXA 1TTJA 4RW3A 1GYLA 2VZUA 4C65A 4PSPA 4EVZA 1C92A 4WY0F 4A6GA 1ITCA 1ISXA 3URQA 2R9RA 2FH8A 3LSBA 3DHFA 5B80A 5A2AA 1XLEA 5HNNA 4GISA 2HS8A 4V1YA 1ZHAA 3SEPA 1E55A 1X8CA 3NL5A 3U8GA 3N6HA 4B4FA 4PMRA 4AXKA 2Z0IA 3A3WA 1IZKA 4H6EA 4AY7A 3KLJA 2C1IA 1TIWA 4L56A 2X16A 1PIGA 1E9ZB 1QNQA 2VC6A 3VXGA 4ZEPA 4CD7A 1GHSA 4OZOA 5BZAA 4PBFA 4R9OA 3E2QA 1A5LC 4YVVA 3U4FA 5KZDA 1W3JA 2OYMA 3LPOA 4JTTA 2P53A 3C4UA 2PTXA 5I03A 1WP6A 2JE8A 3LHWA 5GRTA 3I6TA 1UWQA 4HCDA 3LX9A 4HK7A 3VO0A 1EYEA 1A0CA 2X0YA 4L6OA 4IXXA 4HPGA 2OLHA 2J47A 2HROA 3A4XA 3GQYA 3N2TA 1FUYA 2WW5A 2RH9A 4CN1A 2WMIA 5HWJA 4TX6A 4LC8A 3JZEA 1YNYA 3ARWA 3WF2A 3MO4A 4ZOAA 1DE6A 4AEEA 3NIYA 2W67A 1SB3B 2V3EA 4GUFA 4QNEA 2C3DA 1UWAA 2QCEA 1A47A 3IVSA 1GYMA 4DVOA 3HFYA 3KL5A 3QY7A 5LHFA 5FL0A 5AYXA 1KGWA 1IGSA 4IFKB 1AVAA 3UXDA 3WFAA 2UBPC 4RUBA 3T6CA 1RXOB 3UYIA 1W1PA 2VP8A 4KGJA 3W81A 4B2DD 4GZIA 3KBNA 3B0YA 4G56A 1ZMDA 3T42A 2GWGA 3AIQA 4DYEA 4NNBA 3FXYA 4QS5A 1GGOA 3LSCA 4J7RA 4GQRA 1MNSA 1W1B1 5U25A 5K9DA 2NWSA 1G7VA 2E7FA 1X39A 3ITXA 2DIKA 1RZMA 5FACA 1RK6A 3K1GA 3T4WA 4WVXA 3SCPA 3T09A 1KM5A 5DMLA 2D3LA 1FWJC 3OBAA 1EL3A 5AHNA 2FHBA 2VCBA 4YL2A 3RUBL 3N2CA 1VFTA 2CHOA 3AICA 2GVEA 4XO7A 2VL4A 2QDHA 4O10A 1JPHA 2J9ZA 3GS6A 5B7ZA 4ZB0A 5FJTA 1QBBA 3W75A 5L6UA 1SPQA 5EMUA 1TSIA 3DG3A 1JDFA 3CQHA 2C6QA 3PB2A 3UJFA 3W7RA 1E6RA 1FY6A 1UD3A 4BWLC 1BGAA 1QWKA 3EX1A 2XSAA 2OT0A 3R13A 5A1AA 3STGA 2E25A 2OKOA 1KCZA 4Q4RA 1G01A 2JK2A 3PJTA 4DWSD 3A9IA 2GSHA 2BTMA 3P81A 4GO8A 4PCPA 2CZFA 1RQBA 4ZODA 5XIMA 1KBKA 3A47A 3ZJKA 1H0IA 1AK5A 4IIEA 4DXKA 3UGVA 2PLKA 1LBMA 3W1NA 4WKFA 2Z6IA 1MMFA 2WSRA 3QPYA 3OG3A 4YHEA 3DYMA 4LALA 3AHXA 2GZXA 2PDBA 1Q6CA 1V0LA 1KM1A 3UPWA 4Q33A 4AWEA 4AX7A 3UU0A 3SIZA 1GERA 3LBOA 4GK8A 3BOXA 3NDOA 1T8XA 3B8IA 4LUTB 4HVXA 1S2VA 3K8LA 1E40A 3GDBA 4NZFA 8A3HA 1E4LA 3GR4A 2PDWA 4AISA 1RY0A 5DMYA 2Y63A 3W02A 3OBEA 4H9TA 4GYKA 1GQKA 1WAWA 4PUUA 3AS3A 2VURA 4PMVA 1JCTA 4WK9A 3FCPA 1VBUA 3PFMA 5EMKA 1V3LA 1SJAA 4E2OA 3RU8X 1A50A 4E4PA 2HXTA 3CGEA 4FNRA 5EY5A 2PTWA 4UBPC 2NT1A 4C1NB 3A4JA 3HRDC 1P5BA 1XC6A 3VD9A 3BL3A 4WHBA 2F84A 1OD8A 1QFEA 2YB1A 3UZWA 3W3OA 3HV8A 2V67A 3WQ4A 2Q3OA 1TVPA 1GESA 1DQUA 9RUBA 3QGVA 1KCKA 5DQPA 1NP2A 1RAKA 4ERAA 4GX9A 1AH3A 1NY1A 2RAGA 1F8IA 1E6QM 2D73A 1H11A 3O1NA 4MJMA 1S2AA 1VDVA 6PTDA 1TMQA 3RPTA 2YOCA 4FMVA 1KGXA 1D3GA 4EXQA 2JEPA 3C2RA 3PNUA 1OFEA 4EF8A 3G1YA 1NDYA 4MKVA 5DCBA 3GIQA 2VELA 3W1XA 2YCJA 5DXYA 2GUYA 2R1PA 5DY2A 5LIYX 3G1SA 1TV4A 4HZ7A 3TTEA 3UGRA 3O06A 4CVUA 2OX1A 2W63A 1A5MC 3SY8A 3W2NA 4Q7IA 4E38A 1CGTA 3O0FA 1E6NA 1R9ZA 3NSNA 3N18A 3W07A 1PDYA 4NAFA 3OW1A 5G5HB 4CCCA 2ZRZA 2FZ9A 4F0KA 5TD4A 3TYBA 3IC9A 1I9CB 2J7CA 4RW5A 3B04A 3TYEA 4F3HA 2F8QA 1YXDA 3MWAA 3NOEA 1E0UA 3SFKA 4HU3A 3W7IA 3QOMA 4CU6A 3CQKA 2W66A 4ORIA 1GVOA 4QG6A 3GAKA 4LGXA 5HMSA 4UR9A 1X1NA 3DZ1A 4PUEA 1W9PA 1FWWA 4Q8VA 5ABFA 2B7OA 5CH9A 3UR8A 1FBAA 1GKPA 2Z1VA 2NW0A 4C91A 1ZJIA 1O1ZA 4IPJA 1E6PA 4PB3A 3ZLHA 4UTHA 3LCFA 3N9SA 4L6HA 3WK0A 2PWGA 1GW9A 3DYPA 3P82A 4GY7A 3CV2A 1XBXA 3DHUA 5KTLA 4LJ3A 2IQ0A 4RNJA 4ECLA 1F74A 4DEFA 5FJUA 1OYAA 1R3WA 4LUSA 3G77A 2VX6A 1LLOA 3ES8A 3ELFA 3T8LA 4W89A 4UXDA 5GNZA 3H23A 2CDUA 1IGWA 2DSZA 5HJXA 5C5YA 3WDIA 2HPMA 3PG9A 5CC5A 4GYPA 4NIRA 1Q1RA 1BYDA 2H8ZA 1FH7A 3REQB 4NJJA 4YWOA 5I00A 2Y5JA 4MF4A 4GQ0A 1UBSA 3R58A 1HVXA 3EPNA 3CUHA 2HVOA 1P0DA 3XIMA 3F4NA 2JF6A 1QI5A 4RV8A 4RZ6A 1LP6A 1L0PA 3N25A 4ROQA 1TQJA 3G18A 3IVTA 1ZP3A 1GORA 3SIMA 4IOTA 3U6WA 3W26A 2YZ5A 1I60A 2QDDA 1NHQA 3M0JA 2Q01A 3ZT7A 3AJ7A 2V8ZA 1UR8A 2GUUA 4GI8A 1ZY9A 1XHCA 4JYFA 1XLIA 4CCDA 1MFUA 2VOMA 4INFA 4DUOA 2WC7A 3MDWA 1RSCA 2CXGA 4JFVA 4KWUA 2FZBA 3SUVA 1P7TA 2YLAA 1EX5A 2PLMA 4PL2A 2ZDRA 1REQA 1EEPA 3PJUA 2CZ5A 3PM6A 3ARUA 3QN3A 3MSYA 3GNDA 3L66A 1TV7A 2Q71A 4L1WA 4U2YA 3VPLA 5MHBA 4FLSA 1IE7C 2PU1A 1V97A 3HB9A 4H4IA 4O1AA 3GDTA 4JDBA 1FWFC 1XIEA 4DYKA 2EQDA 1AODA 2PDUA 3EXSA 1ONWA 2CU0A 1RY8A 4EMIA 2ZRWA 3NS1B 5E6ZA 1S46A 4F0SA 1MW3A 4KEUA 1V77A 4OV4A 3FIGA 1NOFA 4MWAE 3K8KA 3WUGA 2XH7A 2WZHA 4XUYA 4D1JA 1D2KA 4M29A 1M7XA 3CL6A 3MCMA 3PY2A 4W85A 8CGTA 2B81A 1NWSA 2XVGA 3VMNA 2E9LA 4S3GA 2O4QA 4OTKA 4QCEA 4A4AA 3WQVA 3FEQA 4QDWA 4K8GA 4DWSA 4Y9PA 3OVRA 4RK8A 1EPXA 1B31A 3N3TA 4JEJA 5BXSA 1JCLA 3EWXA 4IXHA 2FTWA 1KM6A 3FGCB 1NQKA 1NEYA 2GGJA 2Z2AA 3CTTA 3T0TA 3PG6A 1EP1A 2I5QA 3LXBA 5E09A 1E0WA 1TPDA 1EEXA 1V3JA 3GBEA 1OF8A 2OMAA 3CMFA 3GD4A 1YHTA 3NVYB 3FDKA 4OBSA 1YBQA 2CWNA 2BFGA 2GOUA 2IKHA 5HBFA 3C0SA 5CGMA 1E72M 1XSIA 3PAJA 1V3IA 3RO8A 4YPJA 3NQCA 4HHLA 4NI3A 2G3JA 3H8AA 3NURA 4AHPA 5HDRA 1KR1A 3QXBA 5KZMA 4F0MA 3ZSSA 4QM1A 3HG4A 1GETA 4A2RA 1LUCB 4L7ZA 3WLTA 4EPBC 2PDMA 4BEQA 2WK2A 3R8GA 4BQ3A 4GJ1A 2AGKA 3M46A 2WM1A 1VFSA 4KPRA 4QAWA 2ZRUA 3SN0A 3KFTA 1XLCA 1MZHA 3ABZA 2YL8A 2AL2B 2WNZA 5CZTA 4IP7A 4RE4A 2EQ6A 1AJZA 1IWBA 2RKXA 4E8DA 2AL1A 4H4RA 4JXCA 4LRTA 3QPZA 1XL9A 1RPKA 4M8UA 1P6BA 2E28A 1E4MM 1O5QA 3HF3A 3LPGA 2G3NA 4UWMA 4F66A 4O52A 1IT7A 3GC2A 4U10A 1OWQA 1EPVA 2UV8G 4GA8A 4Z2GA 1UMYA 2XIIA 1Z7AA 4PUWA 4QSFA 5RUBA 4V2XA 4FP1A 2QPXA 1WZLA 5JUVA 1H3GA 3GNOA 2WV8A 4JL1A 1VF8A 2VD8A 2PGWA 3F2BA 5CC7A 3ATYA 2X30A 4U5KA 5AYIA 2UY5A 4JDRA 1WO2A 4JYEA 4GGBA 2DORA 3QEZA 4POCA 4CNTA 5IM51 3LS9A 3NFUA 2ISFA 2WHJA 4FZIA 3MBFA 3LQLA 2I5IA 1MUWA 4G5DA 5A94A 3I3DA 4GVIA 1TO3A 1GJUA 2OXNA 4JTHA 3SCRA 1X6NA 4MMWA 3CZGA 4C7FA 2E9MA 3POHA 2WVVA 4IPIA 2IQDA 4PRWA 2VVSA 4BHYA 1UD5A 5D04C 2PCEA 4DJFD 3VOHA 3W7GA 4GRSA 1GV4A 3TJXA 2PGEA 4O28A 4D71A 4U5IA 3GZAA 1XLHA 4P7OA 1KM4A 5KZEA 3OGSA 3B06A 3O05A 3AU6A 1M5WA 2WCAA 1PVNA 1NSJA 4DQWA 1LRTA 1W3HA 3P62A 1J0KA 4G6CA 3W85A 5F2GA 4KEZA 1ML1A 4O11A 3VKCA 4EX4A 3TE9A 4HJFA 3LCGA 1E3ZA 3VNIA 1EZWA 4B5UA 1R87A 5C9RA 2GGIA 4JDYA 4JHOA 3BLKA 1YXYA 4NT0A 2R1LA 3NYZA 2P8BA 4DNAA 1UR9A 2ZZBA 1LM1A 5LGZA 3KZPA 1SU5A 4IF2A 1C93A 4KW2A 4M6UA 8XIAA 3BLEA 3IK2A 1E4IA 3MI6A 3C3NA 1PHQA 5AHFA 4C5ZA 1FCVA 4N2YA 3V36A 2C15A 4M3PA 4YNGA 3GTNA 3VTRA 3H2CA 3ZJ7A 3DKLA 5KITA 3WLLA 1UP2A 3LHZA 5ABHA 4JIHA 5FD0A 1NELA 1KCLA 4HSNA 2J7HA 1TRDA 1WB0A 2ZTKA 1HXJA 5LYRA 4ZQMA 5HNUA 4R27A 2EQ7A 1HIZA 1PV8A 1ZTVA 4DELA 2CHNA 1G69A 3GRTA 4IMCA 1V6YA 4LYRA 1RD6A 2XZ9A 3Q94A 3E74A 1XBVA 2VHLA 2E6FA 3ITOA 1EBDA 4L4PA 4NRRA 2FVLA 1G0CA 3DIPA 4X63A 3AFBA 4AIUA 4XAGA 5TNVA 3A23A 1FCUA 3BAKA 1XLKA 3E12A 5LNVA 1GKRA 1VLWA 2DQWA 1LBFA 3S5SA 5FEPA 4KESA 2OKTA 7REQA 3RG6A 4H9UA 2CLMA 4OECA 4I9TA 2WB5A 1XI3A 1KFCA 2X1IA 1GQLA 4QR6A 2OWWA 4EAMA 1WDDA 3NVWB 4Q32A 2NVDA 1EHNA 4MLRA 5GVJA 4HN8A 5EFDA 4LS2A 5HNRA 1U33A 1XCXA 4K8EA 3C0JA 1N7KA 2PEVA 1TA3B 2QUVA 3AU2A 2HMCA 4TX8A 4PBEA 4O0QA 2IW0A 3NZ1A 2CLEA 4CNUA 3HPSA 2FZ8A 4O4VA 1Q2RA 4HZ8A 1W32A 1JG9A 3EPOA 1EJXC 1JUKA 4YTRA 1LG1A 3WDHA 3CO8A 1E56A 3JRKA 4EQRA 1V0MA 4H9YA 2YSWA 3MMTA 5E70A 3KE0A 3M1ZA 3VMOA 3GHRA 1YNQA 3WY1A 7TIMA 2PZNA 4FNUA 1VFLA 3AIBA 2YW4A 4BR1A 3GD3A 4H41A 3UYCA 1PZ3A 1JYWA 3QTPA 1W3LA 1HKVA 1UR2A 5FOOA 2WYSA 4JGDA 1M53A 1ME9A 2VR5A 1JPMA 3ABOA 1TPEA 1JDAA 1JQXA 2WKJA 1FKWA 1FWDC 3U2CA 3WDJA 3DESA 3VGBA 2ZC1A 4K7YA 1RVKA 3H24A 1ZKQA 2X1RA 5EL1A 4A8LA 3L2MA 2PBOA 1RCQA 2DT1A 1S5MA 1KRAC 4H8NA 4Q8QA 1J93A 1XSKA 3LENA 3PFRA 3THDA 1PKNA 1WBHA 2HEJA 4Q6XA 3RNMA 2QCDA 2BGNE 3SCNA 1OT2A 1ZENA 1UP0A 3GIPA 1WXZA 1N8FA 1K70A 3S1VA 4YWSA 1O94A 1R9XA 3GC5A 3O2LA 3HFTA 2Z1SA 4ERIA 1DWAM 5D8WA 1UR4A 3W83A 1FCQA 2V3GA 1SQ7A 3NO1A 1QWGA 4QX4A 1JI1A 4NNCA 3VZXA 1GVIA 4KFOA 3T44A 2ZADA 3SRKA 1CDGA 1IEVA 4OIFA 1H09A 3D46A 2V2DA 3VDGA 4DUWA 3MVTA 3DGHA 3MUIA 1LF1A 2XIJA 1B30A 1B54A 3DCPA 4LSBA 3SY5A 4PRTA 1MQQA 4BI6A 3PBWA 3GXMA 2Y7GA 4YU1A 1QW8A 1UD2A 1CXIA 1K03A 1ZXIC 3TFCA 1QU4A 2TYSA 3P0WA 3T55A 3CIXA 4AIOA 3RITA 2VZSA 4B5NA 4FOUA 3PF3A 3KXQA 4CQAA 2BP1A 1DIOA 4DZIA 1VHCA 3SN4A 2PP3A 3GU9A 2FFCA 4HJWA 3GU2A 4O0KA 4IMEA 1NPXA 5BOOA 1XG4A 3WJWA 3I4KA 3N2XA 3BW2A 3TTYA 3MHUA 1W2VA 5HQEA 4XAZA 3QFAA 2FDMA 2G0WA 3NO3A 1WQ5A 3BLPX 2Y5EA 4IQJA 4NAFB 4DBWA 2YFNA 2DV0A 1FWEC 2F7FA 3I65A 3GZ3A 2CZEA 3ZWSA 4CGTA 1YE4A 1JYVA 3QFBA 2FQIA 4J3XA 1HF6A 1JFHA 3OG2A 5E0CA 1TUXA 3DEQA 4AWSA 2ZTJA 2JKPA 3M0YA 1ZB5A 3WF1A 1EGMA 1BXBA 1OZQA 4AW7A 5CPMA 2C14A 1Y5XA 2J74A 2MNRA 3W73A 3EOLA 5ABFB 3CAQA 5I02A 3FS2A 3MI3A 4LFYA 3CUXA 3ITLA 4CD5A 5JCNA 1IZCA 4C90A 1CT5A 3T78A 4QP0A 4PMUA 3FXGA 4IJCA 3A4AA 1DTNA 3PB0A 1WKEA 4AD1A 1RLCL 1DPMA 5IXEA 1JZ5A 3GO2A 4P2VA 5GJMA 1NHRA 1BYAA 3GSMA 1UJPA 2XN1A 4PUMA 3IV3A 4LEFA 3W2LA 3K4AA 2W92A 1D7FA 3L0KA 2X1SA 3LCWA 2B7PA 4W86A 4WDWA 3OLGA 3UZZA 5K9XA 2Z2BA 3L2IA 4WSKA 1CGUA 4HPNA 4BI7A 4FB7A 3IJIA 4KFNA 4C6MA 3UWVA 1HNYA 1ZMCA 4OBRA 4E3TA 4Z17A 3GRSA 5IHRA 2VGFA 4YS1A 3DBPA 2TSYA 3MTWA 5G2IA 3L0GA 2QZRA 4HK5A 3B8UA 4EWJA 1PBGA 2BV9A 4O19A 1S7MA 4O0ZA 3KBSA 5IRPA 5MKGA 4URIA 5CPSA 3JW7A 2BLEA 1O5KA 3UPMA 5HWMA 2EKCA 3OZMA 4LAOA 4NZ4A 5D37A 2XWEA 3VOCA 3AMGA 1RCOB 1XDLA 2DVXA 4TVYA 1EBGA 3G24A 4O13A 2GK1A 3MPGA 4XZ9A 3R43A 1ODZA 4B90A 3Q2DA 4UOQA 1YYAA 4LRSA 3EUB3 2LLEA 2OYKA 3WX7A 1XH0A 3KAOA 1JD7A 2DIEA 1TE1A 3CUJA 4HA4A 2RHGA 3AIEA 5M5DA 4UUIA 3URHA 4Q8PA 4GIEA 4F2UA 1W5QA 2DSKA 3IRSA 2ZZ6A 2NQ5A 3P84A 1IT8A 3W25A 1C90A 1FDZA 2OEJA 3DI0A 4O50A 2PLCA 4US5A 3AC0A 1ZRQA 3T0CA 4QROA 3MA8A 4UR7A 3KTXA 1JXKA 1OGSA 3BLFA 3SQSA 3FA4A 3MO7A 3G22A 5KSWA 3KM8A 2VEFA 2W6RA 4W9TA 3IJQA 4E8CA 3FY1A 4RXGA 1DHPA 2QJGA 3GG1A 3WNOA 3WK3A 4NXKA 3CLWA 5FESA 4QHRA 4FAMA 4DWSB 3U5YA 1GUVA 4IWWA 5FAJA 3LNPA 2R1NA 1MO0A 3LXCA 1Q4WA 5AN7A 3UR5A 1EJRC 1LRQA 3S3GA 4XUGA 3Q37A 4E2DA 3V1PA 3SFWA 3S2MA 1DEDA 1J0HA 1RA5A 3VYLA 1JZ7A 4I7UA 2R82A 4B9YA 3PS7A 1UPMB 2QHAA 5C9XA 1GVRA 4RE0A 1POKA 1VRXA 3M64A 4I8DA 2ZUUA 3AUJA 1Q63A 3C6CA 4K1WA 1X6UA 3TV8A 4AYGA 3CHCA 1IQ8A 1YPIA 3HQNA 1KKRA 1X96A 2J25A 4EPEC 3OC4A 4HTYA 2QPUA 2V3FA 1QOPA 1DWFM 4J1OA 3VFLA 1VFOA 5HAOA 2BGQA 3B03A 4L4LA 3ABXA 3CGTA 1UD6A 1ZLPA 4DX3A 1B2YA 1CZ1A 4ILSA 4ML9A 1KXTA 1JIBA 4C6QA 3TX9A 2NV9A 4NAEA 2WBAA 4IIHA 5A8PA 1XGDA 4C60A 4EWND 1DJNA 4Y90A 3E1F1 1L8PA 3T4CA 4CCEA 1QNOA 4K39A 2HVMA 2PD9A 3P8JA 6ALDA 1R5YA 1GOOA 1OCQA 3LB8A 5A5WA 3APYA 4N02A 4ZFMA 4BK9A 4D6GA 1XLAA 1PWLA 2ACQA 2BOEX 4DO4A 2E77A 4UCGA 1BWLA 2WBKA 1ZBKA 3OJGA 4US6A 3FHAA 4JX4A 1JRCA 2I16A 4K68A 2NV2A 1YRRA 1SFLA 1B3WA 1G5AA 3C0LA 2J8GA 2HXUA 2X05A 2EQ9A 5AVHA 3WLIA 1PTGA 3IANA 2PRLA 5C2CA 3DG6A 3TFXA 3G2GA 2PWUA 4FX6M 1Q6RA 3HOJA 1VFUA 1U1HA 1XIMA 4WRHA 5BCAA 4HP5A 1YNPA 1TVLA 3OPSA 3A22A 1A5KC 3AMDA 1P1MA 4EMJA 1XIHA 2QVHA 4L1GA 4MUZA 2QT3A 3UWQA 3TYZA 1XS2A 3S5NA 3GVGA 1FH8A 4RE2A 3T0BA 1UB3A 3EWZA 1A5AA 2W55A 1FFVC 8XIMA 5HQMA 3S4TA 4FF5A 4H7VA 5AY7A 4IUGA 2YDQA 4HHHA 2CBUA 3GH4A 3AWNA 2Y85A 3QPEA 3BSMA 1HKWA 1PSCA 1XXXA 4P5UA 3EZ4A 1SVDA 2PDGA 3I10A 2DVTA 4M81A 3KHDA 1DYSA 3GVQA 3NR0A 1TCMA 1E9YB 4U33A 3A21A 3ZLGA 1OCNA 2AGTA 1SFJA 2ANUA 1MI3A 3PHAA 4LY4A 1EO7A 5LIKX 5HOSA 4GI4A 3WUFA 2J77A 5H6HA 3AS0A 4H2CA 3UCQA 2Z6JA 2CEQA 3I7SA 3LLXA 2EO7A 1GYNA 2PRMA 1JDCA 3HQOA 1BVZA 3G1FA 3G6LA 3C61A 4D9PA 3FDGA 4NUWA 3S6DA 1G4SA 1RHCA 1C91A 3G5EA 3N34A 4ATLA 4PC8A 2E1WA 4HU0A 1OX4A 1QNPA 2FB2A 4KH2A 5CPTA 2IQTA 3H4XA 1OB0A 3BICA 4Q4OA 2RABA 1ZL1A 4DYJA 3BOFA 1VYRA 4ACZA 1AZ2A 5IFTA 2GVYA 2E68A 4GVHA 5GJPA 1B3ZA 5BWFA 3AQUA 3GKFA 2G96A 3N29A 4X9SA 1TJRA 1U83A 3FX4A 3EKLA 4CN4A 1T5AA 2QR6A 3GBDA 2FPYA 1IIGA 2J27A 4JNZA 1DWGM 5FF4A 3QV7A 2DH2A 4ML4A 2W61A 1W2PA 4O15A 3GY1A 2B7NA 1IEQA 4JQ4A 2PDNA 1Q7MA 4JTCA 3W28A 1KLZA 3SN1A 1QPQA 4AF0A 3L4UA 2WBGA 1TG7A 1ZPTA 2HISA 3ONBA 2A3CA 4LWWA 6REQA 1MXGA 3K30A 3FA5A 1LBLA 3QYSA 1K9TA 2E1DA 3MZNA 4ZSTA 4U4MA 1SMAA 2E9BA 1NDVA 3L4XA 3EWDA 4M7TA 4DPQA 3U48A 5CZ0A 1EXPA 1ZY8A 1CEOA 3SSJA 1JPIA 1GQNA 1XPYA 1FDYA 3DH9A 1P0KA 2DSVA 5CLTA 1DXLA 1OG0A 2WJEA 1L6WA 3N14A 3LCIA 4XK2A 3OYXA 4M1RA 4MM1A 2Y7FA 3GKAA 1QVBA 1WUFA 2WP6A 3ARRA 1QOQA 4DI8A 3PZ9A 2J8FA 1AMYA 1XKYA 3SCWA 1CB7B 4XWUA 4N9EA 3F5JA 1NWTA 4B92A 4OUEA 3SCTA 5FIPA 3RM8A 1XM3A 3ZIZA 4Z1CA 2PTDA 3DOPA 3BXWA 4GH1A 1GRAA 3VABA 2QS8A 1B90A 1QAPA 2Z7GA 4JNMA 3HJEA 1XLLA 4QXIA 2VFGA 3VUPA 4FLRA 1HL8A 4IX0A 1XKJA 2E6DA 1Q8JA 4J40A 1V93A 1X1ZA 4B3ZA 4HCHA 1W1A1 3BURA 5LA1A 3T1GA 3DI1A 3WUEA 1V6VA 4MPQA 1MRQA 4UIOA 5HUOA 2ISSA 4W84A 4YTSA 5L9FA 3C56A 4LV9A 3PZNA 1X1OA 3H2NA 3RK8A 3T2PA 2QCNA 1BTMA 4H4TA 4AQLA 1DJIA 1B57A 1KBBA 1G9HA 4L61A 3W70A 3BZGA 3VD5A 1ONXA 4UFLA 2NVCA 4GFIA 4BJHA 5HR7A 1VH7A 3WL1A 3H2MA 1E1FA 5I3JA 4JHMA 3M0XA 3W86A 2WPFA 2QPSA 3BLDA 4MJ4A 4UOZA 1QUMA 1PDZA 4ASTA 4HMEA 1M41A 3MBDA 4PCTA 3HPAA 2AOSA 5HMEA 7ENLA 1PAMA 3ZJ6A 1KTCA 1G4PA 1G4TA 2WQPA 2YX0A 4EE9A 4D6IA 1XRSA 5DEZA 5IBXC 3H2AA 1RJQA 1AUSL 3NO5A 2DUAA 3NL2A 2OLSA 1JZ2A 4CEUC 3WD0A 4MZYA 4XAPA 3F4CA 3VGDA 2WJDA 4M80A 4GUIA 2F2KA 4C6CA 1GWJA 2CESA 3E49A 2OT1A 3WJSA 5DBTA 4FS9A 4PTMA 5HMDA 4E4UA 1UD4A 2V6OA 2VUYA 1OGGA 4UTKA 2V63A 2F6KA 4XAYA 1JPDX 2FYMA 1R3VA 2ZC8A 3VU2A 2DH3A 4RPQA 3RPDA 1UWSA 1LZOA 4Q4KA 3CGCA 4UFKA 3SECA 3DC0A 3MHFA 1DQWA 3PNZA 1XDIA 2FZMA 4WY0A 4NYYA 3HJZA 3LGDA 3M0LA 1EJUC 3OQEA 3W37A 1VPXA 1GRFA 2I56A 1UKTA 3VINA 4K3ZA 3E0WA 4N9DA 4GI9A 9XIAA 4P7QA 2CLPA 1N8WA 2IXVA 2OU4A 5A8NA 2GJNA 5B7YA 1PTAA 3VNMA 5E9AA 4O18A 1YPXA 5I07A 3DFSA 4IPNB 5BU9A 3W76A 4PCSA 1XDMA 2NUYA 2V2CA 2BS9A 3H12A 4N9BA 1RR2A 2JGQA 1V6WA 2E5BA 1X98A 2FLIA 3CNYA 1TCDA 1KKOA 4AZBA 1SW0A 5EMMA 4H9XA 3IJ9A 2NX3A 4RDYA 3NDYA 3RFAA 5AC6A 1TX0A 4M56A 1HJVA 4UTWC 1GOIA 2J7GA 1M7JA 3WF4A 2VX4A 1KR0A 2CYGA 3IIXA 4AB4A 5KVIA 4TIMA 2X40A 4EMWA 4L9ZA 2ZOXA 4H4QA 1R47A 5BROA 1XDJA 3RLVA 3WF0A 2OZ8A 4ZQRA 1MZRA 4HQVA 1QR7A 4HPHA 3TYAA 2ONEA 4WXZA 2Z29A 3CM4A 3EDEA 3SRHA 3W7PA 3WZ0E 1TPC1 1C9DA 4PUJA 4XBKA 5CSSA 1R38A 3QR3A 1QTWA 4LBRA 3IIZA 3W23A 3UR7A 1WZMA 2E3TA 4IG2A 5EGRA 3MY9A 3CAVA 3PP7A 4HGXA 3LB0A 3SSZA 1R3TA 3WBEA 4H7ZA 2DU2A 4L1XA 1R0MA 4QLKA 4R7WA 1QPNA 3O63A 3P93A 4MNJA 4R53A 1TTPA 2PSNA 4JN8A 5J5DA 1J5SA 2EPHA 1XD0A 3IPWA 1NVMA 5FF7A 3IS4A 2NXGA 1F3XA 3ARQA 3RRAA 3PTQA 4GQGA 4JFTA 3UJEA 2OEMA 1OK6A 3SRFA 1S5TA 2RGLA 3KBWA 3CUFA 1JF5A 4R33A 2FVKA 5JBDA 1JAKA 4YN5A 2ZCGA 1MWOA 5FS6A 1LL4A 4AEFA 2GK1B 4NHVA 1M3UA 3TWAA 2W5FA 1QI4A 1GT8A 3AWOA 3H54A 4O16A 3STCA 4AU0A 3Q45A 1A49A 3W27A 1K4HA 4H4YA 3T2QA 2CERA 1U1UA 3BGJA 3AS1A 1F8MA 4PMXA 3FJ4A 4ES4A 4GHRA 4FDCB 3GLCA 4O1FA 2CCRA 4G7FA 1CPUA 5C2XA 1SW3A 3EWYA 3F5KA 3OZPA 3M7SA 3GFZA 1KM3A 4WQ6A 5CCZA 4LOCA 1OX5A 3DKJA 2BG5A 1ISWA 4WSHA 4KCUA 1HL9A 1FFQA 3ABQA 3AXMA 1XH2A 4JFSA 3EDFA 3T07A 2C0AA 1W0MA 4ZQNA 3W01A 3WD4A 5CZJA 4QFUA 1OF6A 3RCYA 4NKCA 2IKIA 2NWRA 3OGRA 1H60A 1I4NA 2P3ZA 4UQ9A 2OYLA 2R1KA 1F3EA 5BW6A 4MY9A 4C6BA 4GNJA 2OR2A 4AZIA 1GQJA 3O6YX 1TX2A 1XYAA 1RQEA 2MANA 5G4HC 2Y70A 4S3BA 1UR1A 1S5WA 2QJJA 3QHNA 4EM4A 1Z32X 4HBKA 1C9WA 2Y62A 2V6AA 2WP5A 1EX1A 5KMYA 3QSTA 3BOLA 4EQSA 3F7JA 4H6RA 2ZWZA 5C70A 1E0VA 2XFFA 4LH8A 3B8WA 2VM8A 3NZGA 1MEHA 4H2HA 2RFGA 4JTAA 4TR9A 1KCXA 7CGTA 4AZCB 4IT1A 3P61A 3B9NA 1IZJA 1PCKA 3M5XA 4IIDA 2XU2A 4GO9A 2OELA 3CHVA 1FOBA 4G7EB 3U9IA 3F4DA 4CD6A 5U4NA 3KZSA 4HIBA 4GC3A 1A4LA 1W6TA 5JCLA 5AECA 1H4PA 1UKOA 4FXFA 3O6CA 4UOJA 4DWSC 3PPHA 2DEPA 3VKJA 3W7DA 4PGLA 3SDOA 4K8HA 1LWJA 4ENLA 3IVUA 2NLIA 1J2BA 4NAEB 2G3IA 1OFBA 2BBFA 4X2PA 1Z3NA 1BXCA 3A7AA 4E2BA 2WPCA 1S3TC 2E09A 4AVOA 3W1PA 1HJUA 1GZJA 4YXGA 5AOUA 4M19A 3GTIA 3RDKA 2OTDA 2X8CA 2ACUA 1K3UA 3G3DA 4M1BA 4K7ZA 5DMNA 4P61A 3GDLA 3WLNA 3ITVA 4JX5A 2Q8LA 4JTRA 3CEUA 2JEQA 3RJYA 1LOSA 4A3HA 3W29A 4HZ6A 1D8CA 5CQ1A 3GR7A 3NGJA 1A5UA 2KZHA 1SZRA 2Q09A 3UCDA 4PUKA 5FS8A 4Y7EA 1Y5WA 3QQ0A 5K4ZA 1C8QA 1VJZA 2PODA 2BHZA 1OINA 2V5LA 1QI2A 1ODUA 4TQTA 3FSTA 1K8CA 1ALDA 4NEWA 1LVLA 1W5MA 1XGZA 1OX6A 1UWRA 5CSRA 5C7HA 3ABSA 3SADA 2QIWA 5F1UA 3TC7A 1FHUA 4XQ6A 3ZLFA 3TNBA 3KWXA 3HG3A 5EBKA 2DSWA 2QYGA 1W9BM 5AYBA 3NQ2A 2WMGA 1V08A 5LIXX 1DJYA 4WEVX 3AIVA 3JUGA 3V35A 5JH2A 2GYIA 5JCKA 4LUTA 3VOGA 3ERPA 1S5NA 4LVGA 3BJFA 1VHNA 4PMDA 4K36A 4QITA 3EF6A 1F6YA 1I2NA 3O0KA 3DYOA 3GDRA 3B9OA 4C6OA 2WKLA 3R7MA 2HZGA 1WYGA 1EQPA 1MO9A 1YDNA 2JGYA 5K4XA 3W87A 4DLMA 4C1NA 1F3PA 2CLLA 2Y5SA 2ZXDA 4PMZA 2WOQA 2VI0A 1SMDA 1RJPA 4PRRA 4J3VA 1W8GA 2VCAA 5XINA 2G95A 4A29A 4JD4A 1QNRA 1Y8BA 3WQCA 1EIXA 2VEPA 3O07A 1Q1WA 1VPQA 3NM3A 4MWAD 3WLSA 3BLLA 3B9AA 3MMUA 3LHVA 2VOTA 3UWWA 1RP9A 3PN8A 5KETA 4WJEA 2VGGA 3NEHA 4A3YA 4HPXA 3S5YA 4YCPA 2YPIA 3LLDA 2PS2A 3RXZA 1GJPA 1QHOA 4PE8A 2W3RA 3CS2A 3MKKA 2HTMA 2VFHA 3CJPA 1XD1A 3L5OA 2BXYA 4OUIA 4W7WA 4F4RA 2IPWA 1DOSA 2GH5A 4Q8TA 2FJUB 4I9JA 4KRTA 3GTXA 3QC0A 4KPLA 3PZUA 4WIWA 1EUAA 2CLFA 3BMXA 2RDWA 1B3VA 4UNIA 3S1UA 4HOZA 1FXPA 2GQ8A 1Q6GA 4ZO9A 1CLKA 3TYUA 2Q6ZA 5BRQA 4BF7A 1QPKA 1YDYA 4J3TA 2TMDA 2NT0A 3TSMA 4Q22A 1TELA 1RQHA 2PWHA 3QY8A 2DGAA 5AHMA 1JCYA 1GONA 4IHCA 6REQB 5TR3A 1UWUA 5K7JA 3E5PA 1LQ2A 3UERA 4TO8A 1XH1A 3DU0A 3V75A 3B8TA 4H4WA 1RUSA 2HE5A 4QNWA 3LUTA 3W6YA 5E6YA 3WQ8A 2X7VA 3YPIA 1J10A 1ICQA 2YW3A 2D0FA 2V5DA 1DJWA 3WLQA 3RCNA 1EC9A 4IFRA 3ALGA 3IWPA 1MYRA 1FWHC 3HGRA 3VOJA 2ZZ0A 5EMLA 1H51A 1PUDA 1N62C 2EG8A 1QXLA 2FDSA 1R46A 1V3HA 5C7VA 2ACSA 5T8GA 1WZKA 1A0DA 4REQB 1F8WA 1M04A 1UZ1A 2EPLX 2BVDA 2XTKA 1X2HA 2CIPA 3GX9A 4N42A 4ZB2A 4BQ5A 1N2VA 2OQHA 3GDKA 2J9XA 4B5XA 1ZFJA 5CG7A 3TA9A 2OWXA 5D9OA 3CHFA 4DUVA 4O4WA 3B8VA 4S3EA 2XVPA 3S42A 2KAUC 3ANYA 2FVMA 3L5AA 1R3QA 2XPKA 2X1UA 1KLYA 1K9EA 2FGLA 3TIMA 2X50A 2EPMX 5J04A 1E5JA 3WLKX 4Q8NA 5DCEA 5I3GA 3NQMA 2FB3A 3VNZA 1H62A 1GRTA 1UHVA 2GJPA 4KCWA 1ZS2A 2F9RA 4I9AA 1UIPA 4R34A 3LADA 4Z0SA 1WDRA 2J8TA 3A9BA 3DERA 1XYMA 2V3AA 1D3CA 2IXUA 4LUYA 4DXVA 1CGVA 3HW2A 3DGRA 4MHBA 4W93A 4KRUA 4Y96A 3WLOA 4PEKA 4HMCA 1ISVA 4LC6A 1AJ0A 3PTDA 3G8RA 1WA3A 1JCJA 4W8BA 1SO3A 4JOMA 1R2TA 4GBUA 3VE9A 4WKAA 3WD2A 1E0TA 3BMVA 1EKOA 3UG4A 5JBEA 2VJXA 2XN0A 5GQBA 3OVQA 4UTUA 5D09A 1OJTA 3EDJA 3WH9A 2GGEA 3N2BA 5CLWA 1ZNNA 3G3MA 3BH4A 1JCMP 2P10A 1OY0A 3ORWA 3IJ7A 3GC4A 2PP1A 3DAQA 4JKMA 5H1WA 1A5NC 4UMCA 1IXOA 5REQB 4MNLA 2VGBA 4V15A 4LIIA 2ABBA 5D05A 4A22A 1UH3A 3LYEA 5FSDC 3RMEA 1H7WA 5EU9A 2VGIA 1EYWA 5I3HA 1FFUC 1TE6A 1OGBA 1PKMA 4MZ1A 3EMQA 3W38A 3UESA 4IP5A 1FWNA 3IK4A 3CWNA 6XIMA 3WUBA 3GW3A 5HMFA 2C8NA 3W1QA 1B4EA 1OC5A 2REQB 2A4AA 3MCOA 3R07C 3L4YA 5EMYA 1FHVA 1H5YA 4EM3A 1PO9A 4X0VA 3SGUA 4F0RA 1H7RA 3BCJA 3FGCA 4D8AA 2Y88A 1L2UA 2DSUA 1AD4A 1E73M 1BWKA 1DE5A 2Z24A 3U0HA 4RX0A 3E3HA 1JUBA 2QAPA 3B9DA 3G1DA 3NQGA 3L21A 1KRMA 1BXNA 1HZYA 5G5GB 2VEIA 2IKJA 4JS3A 4WX2A 2P8CA 1KTNA 2RDTA 4FIRA 1UWIA 2OX4A 3QGKC 2YCEA 3WH7A 2PRHA 4KQNA 4WOQA 4ONVA 2WM0A 3VA8A 1JNEA 4ADUA 1QPRA 4RE3A 5H8MA 4ZOEA 1P1XA 2PLJA 4H9ZA 1Q2SA 5D4YA 1A5SA 1BFNA 1AD1A 1W54A 9CGTA 4PMJA 1KM2A 4LVAA 4LF2A 1ONRA 4AAJA 3UY8A 3LHUA 4H6KA 4XD6A 1JRPA 4CQDA 3AZSA 1LUCA 3MSRA 2CLIA 3VGGA 4IQLA 3VI2A 3PBGA 1OFDA 1HKJA 2ZBTA 4RZ4A 1TTQA 2YBVA 3NVDA 3UG8A 2AL2A 1V5XA 3DBNA 3CMGA 2YFOA 2FTYA 4NYUA 1V0NA 1FCBA 2NSOA 5JRBA 4LV4A 3V0SA 4V33A 3LDVA 1PL9A 3HPZA 1HP4A 4AUBA 4DJFC 2OOGA 1RALA 3USZA 3A7UA 3MJYA 3KOYA 3E0LA 3HQ1A 1T40A 1LWHA 1Q5MA 2YKKA 3GK0A 2OQLA 4H6QA 1Q7QA 4H8UA 2ALDA 3DG7A 4OKDA 1UKSA 1TTIA 3M0IA 2ISDA 5HATA 4A21A 5EKYA 1K77A 1CLXA 3M0ZA 1LCOA 4NJIA 1I2OA 1VC4A 2OLAA 2OZ3A 3W2JA 1OYCA 1ZAIA 1JROA 4NRSA 3CH9A 5C71A 4EK7A 4PL1A 3AMZA 1PZ1A 1VCVA 1I1WA 3DGBA 2YDSA 1G67A 2ZX6A 3CXBA 4XBSA 1BQCA 3B0UX 3M5VA 3TMQA 3EOEA 1WYIA 2ASHA 2V38A 2WMKA 1UCWA 3GHTA 4XKYB 4Q3MA 2G8ZA 3QBUA 2JIWA 3DK8A 2XIMA 3OOQA 4L4OA 4Q6JA 2QAEA 3WK2A 3WMSA 5CBIA 1RD5A 1MOKA 4HHPA 3GD6A 4S2CA 3OQ8A 3KW3A 2ON3A 2HK1A 3VM5A 3V4BA 4FR1A 1ZZMA 1ZCOA 3C2VA 4DAFA 1J0JA 5BRBA 4EAYA 5D32A 1VPYA 3QM3A 3KOXA 2VEKA 1YLVA 1WE5A 3NM1A 4P8UA 2QGYA 4ADSA 3LXDA 2V3BA 3MSDA 4M7SA 3URAA 3R10A 1E9IA 1VENA 3FJLA 7A3HA 3TW9A 3PR2A 1FFRA 4ZOCA 4JTJA 1L6GA 4HN4A 3AN1A 5GPRA 3LZ3A 3N1AA 3F1QA 2IKGA 1FWTA 3W7EA 2FZDA 2VD9A 3LTYA 1ZCCA 3EX4A 2WCSA 4XG1A 2NPXA 2XYLA 4UQDA 5M1TA 4QBXA 3LTPA 3KRSA 1GOQA 1ME7A 1FVPA 4LNYA 3BGAA 3CZJA 4Z2LA 4AHQA 4H00A 4QJ4B 1K7EA 5CC3A 3DH7A 5MF5A 4K8DA 3NPXA 1M1BA 4ZO8A 2YVJA 1JCXA 4R7OA 4XD3A 3DGZA 2BWGA 4B91A 1THFD 4IISA 3BCDA 4EP8C 2DY3A 4GQQA 3WNPA 5LSMA 2GQAA 3P2VA 4PTNA 4J3ZA 3GXFA 3W4RA 1GXFA 4QCFA 1E4NA 2OZ0A 3TQPA 4H4SA 3PUEA 1DKWA 4WF7A 1JUEA 2W79A 1XIDA 1DQXA 1E5NA 2Q02A 1E71M 1E1EA 2VZVA 3O6DA 1J9YA 3V0UA 3A13A 3N73A 3S47A 2GJRA 2ZZ5A 2YIHA 1EFZA 1NQ6A 2A3LA 2INZA 5GNXA 5JQ9A 5F2LA 3SM0A 5HA7A 3VUSA 3N6JA 1O66A 2BSLA 4Q8OA 3WN6A 4P7NA 4QLJA 4JTDA 1VP5A 1VIWA 5BYWA 3IGXA 4LW7A 4K7VA 3MANA 1TA3A 4J56A 4P8WA 1Z6KA 4C6KA 3V18A 1XV8A 1HTIA 1CGXA 3T9PA 1DBTA 1HFBA 2V5BA 4RZ5A 4UTFA 5LIUX 3KDNA 4XD4A 4D6FA 4MDOA 2JBMA 1KC7A 4HNLA 2PDQA 4YVPA 3D5HA 1V8EA 5D03A 1VLIA 5DMMA 2HDJA 3MSGA 4A35A 3W24A 3MP5A 4BZYA 3AZRA 1ISYA 4A8RA 3CZKA 1CI1A 3TCSA 3KP1A 4H4XA 3GRIA 3QTGA 4HA0A 5H2ZA 4PZVA 2FHFA 4L4MA 4ZFCA 1UC5A 2YAUA 5KINA 4AHOA 4XKMA 3UFYA 5IBXA 1U5JA 3KCLA 1KWGA 3WLRA 1WDPA 5I24A 3DK4A 2IPGA 1C7TA 3H7VA 2BY2A 1KQZA 3PG8A 3ZM8A 5SWUA 3ZR5A 1OFQA 2XFYA 2BY0A 1MRAA 1F6KA 4GH3A 1Q6OA 3RRXA 3UEQA 3W2MA 2HQAA 3O6AA 1VJIA 3W88A 1M9HA 1CGYA 1OIMA 2QULA 4DO5A 3S1XA 1VQTA 3CQJA 2BMBA 3DFOA 1TWSA 3TLQA 1W3NA 5PTDA 3UNTA 3II4A 2GR0A 3POCA 2QJIA 3CQ0A 4JTFA 4UB9A 1VBJA 2AKZA 3S2CA 4W5ZA 3I3EA 4NXSA 2VC7A 2WWDA 5ABEA 5A3HA 4CU7A 2I9EA 4HZMA 1RP8A 3B4UA 4PB5A 2X99A 2NV1A 2DIJA 2B4GA 1RH9A 2PMQA 3RAOA 4E4FA 1E1CB 3MHGA 4UTTC 3NL3A 2HVNA 2R6OA 5BXPA 2O9TA 1NWRA 3BE7A 4GYFA 1MEWA 4PTXA 3GG0A 1MW2A 1NDWA 2P0IA 4UTWA 5CSYA 4ZVJA 5I79A 2F6UA 2FGZA 1P6CA 4K38A 4M6QA 4OOUA 3KTCA 4KEVA 3GFYA 1BG4A 3GTHA 3RM4A 1J0YA 3FFSA 5DELA 5FEXA 3GNXA 3QRHA 2GFTA 4KETA 4QGCA 3UNDA 3P14A 2WPGA 1FWSA 3RHGA 1V02E 1ICSA 4R5EA 2BOFX 4CQ8A 2R91A 5C2GA 4GJIA 5K2ZA 2YCLB 3G0UA 3D47A 2ADAA 1PE1A 5T9CE 7ODCA 3QC3A 2YVGA 4WCJA 1FA2A 1LQAA 2CBJA 1XWYA 4L5ZA 1JEHA 3VKAA 3AIRA 4TX9A 3SUWA 1PZ0A 4DBEA 1XLFA 1N60C 1EP3A 1JI2A 5I6SA 1DL3A 3R12A 2BHUA 5ABGA 3AZTA 1N55A 4EXBA 3OIXA 2VDGA 4XZNX 4IQEA 2A79A 1SGJA 1BRLB 2GJLA 3QHOA 1H7OA 3RILA 3ARSA 1R6WA 2C1HA 2NUXA 5DT5A 1L6SA 3FVDA 4W4QA 5KEZA 2OOFA 1VBHA 3U5UA 4RR4A 1UOKA 2R24A 3R4IA 2WPEA 3MJMA 3RO6A 5HQLA 4BA0A 4Q7BA 4J3WA 4LX4A 2NXIA 3HURA 3AMKA 3S83A 5C0QA 1XYCA 3ZR4A 5AZ0A 5A2BA 1C8YA 2BVYA 1N63C 2ODOA 3Q65A 4DJED 3LN3A 2J79A 1L8NA 3C2YA 4H01A 2EJ1A 5F2IA 1F5ZA 3DFTA 4X2RA 4GLEA 3S6OA 1NJJA 5CGQA 4FNSA 4BY3A 1A5BA 2ISWA 4E5TA 2WOWA 3VNKA 2AQVA 4LF1A 5JCMA 3CHDA 2J7FA 2QJNA 4HNUA 5LA0A 3IJ6A 3PJXA 1IV8A 1UASA 2DT3A 2RDUA 1KO0A 3M41A 4UMBA 1ZSXA 3BAXA 4MB3A 1XQKA 4B2DA 1FRBA 4WXYA 1UJQA 1Y0EA 3FSUA 2NLYA 1EJTC 3B0VC 5LNSA 2GSEA 5FEWA 3ECQA 4WSJA 4A05A 3QF0A 3IJLA 3R0KA 3EX3A 3ZVHB 3UZ5A 1LWIA 2YB4A 3FKKA 1PX4A 3WSUA 4NJHA 4MJ2A 4WGHA 2AMXA 2QUTA 4NILA 2VCCA 1J0ZA 1XFBA 2ZZ7A 4UQEA 3WMCA 6CGTA 1P0BA 3FA3A 2O7QA 3ARZA 2Z1WA 1YADA 4G1KA 2KX9A 2DJLA 3NXFA 2BHYA 3LNMA 2PWDA 4DJDD 3HG2A 3OA5A 1LOLA 1JGIA 3U2EA 3MC5A 5T91A 2QXWA 1JGMA 1US3A 2BX7A 3ZJ8A 4S39A 2HS6A 1F61A 2ATSA 4L9YA 1S39A 4ZQCA 1GCYA 3QY6A 4NZJA 1ITUA 2E5AA 3THAA 3FHQA 3VD7A 4O14A 5I7GA 3IARA 1GPFA 1SJDA 3FYYA 4QEEA 3W72A 2E3ZA 4HPJA 4I6KA 3GVWA 3ARXA 2WVUA 1QW9A 4LVDA 3EOOA 5J5RA 1CECA 1W56A 1KBLA 1H1YA 1GEQA 1HKIA 2GUBA 1NF7A 1O12A 2TRSA 3NQFA 5AC5A 2X1TA 3CWOX 3TYDA 4ATDA 1Q7ZA 2HNEA 3OYZA 2CITA 2H9AB 5JH1A 1MQPA 1EF3A 2AKMA 3HIJA 5G4EA 2XIBA 1KW1A 2OWCA 1BWVA 1XRVA 9XIMA 3E0IA 3G1AA 1O4UA 4IL2A 5EBAA 4M82A 2YXXA 4DAIA 5AFDA 4ALDA 1EXBA 2NQHA 2ZVIA 4HK6A 4P7RA 3VC6A 3ZO9A 3PWIA 3PUGA 5JCIA 3AHTA 3EWWA 1DORA 4MY1A 3LRLA 3EEGA 3DXIA 4D2JA 1LL7A 4YYFA 2BB0A 2ZUSA 3FYPA 3V0TA 3LBMA 4D6HA 1G94A 1AL7A 2PDLA 3TLLA 1P0NA 2X0HA 3W1UA 3G0XA 4N4PA 1TPH1 1W1ZA 4MFDA 4JCLA 3WYZA 2B0MA 1XW8A 4H83A 5DRIA 3T40A 1DWHM 2HBVA 3WFLA 3DK9A 3WENA 4TVWA 2QUUA 2PI6A 4DY1A 4FX9A 4ZXLA 4MWAB 2HE8A 4B9ZA 1Y7VA 4DF2A 4EACA 1MVYA 3C2FA 1ZP4A 4W8AA 3CBWA 2P3EA 1XYFA 3S1WA 2Z1KA 3UXIA 3N2OA 2A7NA 3VILA 1XINA 3TQ0A 2ZE3A 3EX2A 3BSHA 1GKQA 3RLGA 4PUDA 3VNLA 3CV1A 1IR1A 3QR1A 3DECA 2WANA 2F61A 3AXKA 5ABTA 4AH7A 2WCGA 2ZWYA 1UROA 2ZA2A 3IJ8A 3APTA 4Y6GA 5D2WA 1GG1A 3VIKA 2VEGA 3LV5A 3PSWA 1GEUA 4IIBA 4F9JA 3MUCA 2UWFA 1X97A 4X3ZA 4DBUA 2PAJA 1W17A 1WDWA 2VRQA 2VR4A 3HG5A 1WX0A 3IJDA 3KBJA 2XUCA 4RV3A 3A6OA 1QI0A 4E2VA 3HU7A 1UUQA 1I2RA 3B8DA 4JQAA 3C2OA 5AKQA 1I2QA 2Y0FA 1EA0A 3LV6A 2PPGA 3TTQA 4IMGA 3VKKA 3FG2P 4F2BA 3FK4A 3ZT5A 3WMLA 3P3BA 1XYBA 3BLIA 3VDBA 1BF6A 1VJSA 3U4AA 3RF9A 4I8YA 3ZSTA 2WPBA 3JZUA 3PPCA 1K1DA 2QAFA 2YA0A 4XIAA 1H7PA 4IFOA 3W1AA 5CJNA 3A4WA 3RCMA 4FO4A 3FYOA 1NWUA 3W2UA 3KS6A 5CC6A 4QE5A 2W3ZA 3IGSA 4DLFA 1OADA 1XC4A 2ZA3A 3MUXA 1HO4A 2E67A 2J7DA 1ZDLA 4NX5A 5JIPA 2WZEA 3VKBA 1K02A 1KFJA 2FJKA 1QASA 3WQOA 1EDTA 4U2ZA 2ZXBA 4OBTA 4ZOHB 3IUDA 3AM9A 4JX6A 4DJEA 4CCZA 4XTIA 4XZHA 2VRJA 4CNSA 4OGZA 3V5FA 1GG0A 1TR1A 4UFMA 4PA8A 5AC7A 1TPUA 4H8VA 2WKGA 3KTSA 1EOMA 1IYXA 3DFQA 5CPNA 3S6TA 1JVNA 1JQVA 5G1MA 5D02A 1YW1A 1HL2A 2I9UA 3SB0A 4IUOA 2FKPA 1SZGA 1F7BA 1CWYA 3K5XA 1LG2A 2Q3RA 2BXZA 4NL1A 3AYTA 1TMHA 3ITCA 3VCRA 3N12A 1V3KA 3UR2A 1EF2A 4S3DA 3L12A 1HP5A 2POZA 2D2HA 1W9VA 2ZRVA 1K7FA 4IPPA 4HA1A 3BG3A 3UZXA 1QPOA 1N5WC 1U1JA 4FK9A 2ZX5A 5DLCA 1XICA 1YTDA 3GXDA 1HVQA 2J7EA 5AHIA 3I4EA 1UP3A 1L9WA 2GDQA 2YGYA 3QH2A 3CHEA 4DJDA 5HK4A 4C6DA 3AXHA 3UP8A 1ZAJA 4HD5A 1T0OA 1OFPA 2P1FA 3VZYA 3XINA 3C3UA 3NZQA 1W1TA 2BVWA 3OLEA 1RM6B 3OLDA 5I3IA 4OU1A 3VDCA 1A53A 4J28A 5K3VA 5FMHA 3MMWA 1I75A 2PTYA 1CX9A 3ZQ9A 1BPLB 4GGHA 4WJXA 3NPWA 2OSXA 1TPVA 1M7OA 2ZRYA 2DQXA 4NY2A 1Q6EA 1YPFA 2X41A 1KRBC 1XX1A 1VD6A 4LS0A 3WQFA 3A64A 4O54A 4Z2HA 3IACA 1FWCC 5F7UA 1R3RA 3O9NA 4Y9OA 3F4WA 4GIYA 2HRWA 1CYGA 3VNDA 5F1VA 2GVLA 2Y61A 3AMCA 4AD5A 4GXPA 1OC6A 3PZOA 4U3AA 3WBYA 4C1KA 1CGWA 3VX1A 5J8LA 4XVDA 3M0HA 3MV11 4AD4A 1YKWA 2NQZA 1J01A 4NF7A 4XAFA 1J4EA 4O1CA 2OG9A 2J75A 2GGHA 3BANA 4LPCA 2AAAA 3LXAA 5FJJA 3DHDA 4EKJA 3UPBA 5HULA 2NX9A 3L5LA 2X2GA 1RV8A 4Y9AA 3M9YA 1UW9A 2DT2A 1SSDA 2JKEA 3GNRA 3ZXWA 3L67A 1JRBA 5A6SA 1KN0A 2OPJA 3MDUA 1MXSA 2FMOA 3QJAA 2RJHA 2AAQA 4ZSUA 4Z2KA 2CFFA 4G8TA 4H9MA 3UF9A 4R7JA 2CBVA 3N2MA 2VXNA 3OZOA 1P0EA 2E6AA 1LQ0A 2XDFA 3V3WA 1XRFA 3MQTA 4QSHA 2WHKA 3HTWA 1J11A 5K9CA 2WLZA 2CETA 4LAKA 1DXEA 1NFGA 5C54A 2G5WA 1I0BA 4MFEA 2MUCA 1QI3A 4AX6A 4RNFA 1TWDA 1B3XA 3IUIA 4KCTA 3HMCA 4GWEA 4I90A 1EWDA 2W0HA 4GCAA 3H4KA 3CZLA 1GK8A 1SW7A 4FLOA 3LMYA 3BUVA 4F48A 4F40A 1PIIA 5I5RA 2A7RA 3A7RA 2XH2A 4LB4A 3TP4A 1DHKA 1AA1B 2VRKA 1M68A 1BYCA 1HX0A 2GPTA 4JTLA 1V6UA 3UA4A 1S2TA 1B5TA 3P7YA 3KEHA 1BG9A 4Q4QA 4PSRA 1A0EA 3TONA 3B8SA 3AOFA 1HN1A 4V28A 3AJXA 3NQ6A 4DNHA 3HGOA 4MKSA 3QOKA