3RGTA

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with d-arabinohydroxamate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
403
structure length
383
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords D-mannonate dehydratase
publication title Crystal structure of d-mannonate dehydratase from Chromohalobacter salexigens complexed with d-arabinohydroxamate
rcsb
source organism Chromohalobacter salexigens
total genus 141
structure length 383
sequence length 403
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2011-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3rgtA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3rgtA01
2DW6A 1FHVA 4IZGA 3MWCA 1P43A 2PP0A 5ENLA 4X2PA 4HYRA 1SJAA 4HNLA 4HCHA 4ZCWA 3GD6A 2RDXA 2PPGA 2PGEA 5J04A 4K1WA 1L8PA 2PU1A 3UCCA 1E9IA 4IP4A 2ONEA 3DG3A 3UJSA 3TTEA 3FJ4A 3UXKA 3JW7A 3CB3A 1XPYA 3HPFA 1BQGA 4E4UA 3DG7A 2OPJA 2PS2A 2XH4A 2AL2A 4E5TA 3PK7A 2GSHA 3MZNA 2OG9A 1JPMA 4IP5A 4J1OA 3V5FA 3TOYA 4K8GA 3VCNA 3QPEA 2AKMA 3OTRA 2OO6A 2P88A 3SN1A 1RVKA 4GGHA 3S5SA 3QKEA 3UCDA 4K2SA 3D47A 3S47A 2POZA 2OFJA 4A3RA 3MSYA 4HNCA 6ENLA 3DDMA 2PP1A 4KWSA 1W6TA 2PMQA 1TZZA 3VFCA 4HN8A 2HXUA 1MUCA 4EWJA 2AL2B 1IYXA 3MUCA 3PWIA 3QTPA 3H70A 3P3BA 1MDLA 1TKKA 3U4FA 4Z1YA 1NU5A 3MY9A 3PFRA 4F4RA 3SBFA 4DN1A 2PODA 4A35A 5EU9A 3UGVA 2XH7A 2PTYA 3ES7A 1SJBA 3SN4A 3OP2A 1SJDA 3MQTA 3TCSA 3H12A 4M6UA 3B97A 3I6EA 2GGIA 5FJOA 2PTZA 4G8TA 3UJEA 4GYPA 5BOFA 1BKHA 4E4FA 2GGJA 2OQYA 3VCCA 4MGGA 3OW1A 4GFIA 2XH0A 3T9PA 3FCPA 2FYMA 3ZLHA 3VC6A 4GIRA 4DYEA 3N6HA 2OKTA 3R11A 4DHGA 4FI4A 3N6JA 2QJJA 4H1ZA 3TJ4A 3IJQA 1EC7A 3NFUA 2MUCA 4J3ZA 2GL5A 3T8QA 4GISA 4A6GA 2CHRA 4E6MA 1TE6A 1SJCA 2NQLA 3R0UA 3CT2A 2HXTA 4KPLA 3TWAA 3ZVHA 3FV9A 3DGBA 3Q4DA 4MKSA 3OZMA 1P48A 4GMEA 2QDDA 4MMWA 3GO2A 1WUEA 2PTXA 5FJPA 3SJNA 2XH2A 3UJFA 2PCEA 3QN3A 4H19A 1JCTA 3R25A 1EC9A 2QJNA 2OQHA 2O56A 2QQ6A 4JN8A 3TQPA 2QVHA 2OZ8A 2HZGA 4DX3A 1EBGA 5FJRA 1KKOA 2QDEA 3P0WA 3NO1A 4ENLA 3R1ZA 2MNRA 3CAWA 4KEMA 2OZTA 3ZVHB 2ZADA 4DWDA 3RITA 3SN0A 3ES8A 3SQSA 2PU0A 3N4FA 1EC8A 3I4KA 3PWGA 3ZLFA 4IT1A 2OX4A 3RR1A 3I6TA 3RCYA 2PSNA 1KD0A 4ZA0A 3DFYA 3OPSA 3VDGA 3BSMA 3DFHA 4JHMA 2DW7A 4GYPC 3IJIA 4YWSA 2ZC8A 3VC5A 1MNSA 4HCDA 2I5QA 5FJUA 3BOXA 3T4WA 1YEYA 5BOEA 2OLAA 3THUA 2P8CA 3V5CA 3UJ2A 3R10A 2XGZA 4IL2A 5FJTA 1NELA 5IDZA 3FXGA 1PDYA 4HCLA 2GDQA 3RRAA 3ENLA 3D46A 3CXOA 2QGYA 2HNEA 2AKZA 4Z17A 1ELSA 3UXLA 1R0MA 3GC2A 1XS2A 3JZUA 2GGEA 3MKCA 4H2HA 2GGHA 3ZVIA 3BJSA 3DEQA 3ZLGA 2P8BA 2PGWA 3OZYA 2PP3A 3V3WA 3NZGA 2XSXA 3UJRA 3TW9A 3R0KA 1F9CA 3TJIA 4ROPA 2PA6A 3FVDA 2P0IA 3GY1A 4GGBA 2AL1A 4IHCA 1FHUA 3DG6A 1ONEA 2OVLA 2QJMA 1ECQA 1KKRA 3DERA 3DIPA 4KT2A 3QLDA 3KUMA 3EKGA 3U9IA 3FYYA 3SSZA 3NXLA 3Q45A 1JPDX 4M0XA 3RO6A 3TWBA 1MDRA 3CK5A 1PDZA 2OZ3A 3VA8A 3CYJA 4DXKA 3V4BA 1MRAA 4H83A 2FKPA 1WUFA 3IK4A 1DTNA 1OEPA 3STPA 3K1GA 4FP1A 4HPNA 4IL0A 4JN7A 3H7VA 3N4EA 2PTWA 7ENLA 3EEZA 2P3ZA 4E8GA 3IJLA 3DESA 4G7FA 3RGTA 2GGGA 3JVAA 3T6CA 1JDFA 1R6WA 1EBHA 1KCZA 3H8AA 3P93A
chains in the Genus database with same CATH superfamily
3GS6A 2D69A 2Y8UA 4Q7NA 3NL3A 1O1ZA 3CLMA 4LS1A 1LP6A 3WLOA 4B3LA 3G1VA 5GQBA 4HNUA 3LY0A 2Y61A 1MW1A 3BANA 2PWUA 1FQ0A 4MADA 3GNRA 1M9HA 1PO9A 3P8IA 4RR4A 3TFXA 1R3WA 1GPWA 1R3VA 3KOYA 1POKA 3REQA 3TTOA 3GFYA 2UZ9A 1IE7C 3ARQA 1UHVA 7TAAA 3WBYA 5C9UA 2NUWA 1UD8A 1GJUA 1ZL1A 2AL2A 4AU0A 4UWMA 4K8EA 4R9OA 4JTFA 2GJXA 4BI5A 3II4A 3UVIA 4S3BA 2QIIA 5AECA 4V28A 2DZUA 3N11A 3C2VA 3DFOA 2ATMA 4AD4A 4GI6A 3R5EA 4XZBA 2WVUA 3M0YA 5IHRA 3DH7A 4KWWA 5EBAA 3IACA 3PZUA 2FZDA 3GU1A 1J96A 4KGLA 3AHXA 3TX9A 1RD5A 1E6PA 4JFTA 4K8HA 4BQ3A 2PWFA 3FEQA 3KAOA 4JIEA 4XKYB 1A5LC 4AHQA 3K4DA 4IPJA 2VR2A 4HN8A 2NQ9A 3LCFA 3UESA 3KTXA 4X60A 4R88A 3WY1A 3M64A 3PBGA 4LV4A 5EMJA 5JBEA 3WUBA 2GQAA 2F8QA 3ARRA 4J27A 4TMCA 2NXGA 3LHVA 1KB3A 2DJLA 3CLWA 3CHVA 2BCPA 1TMLA 1H0GA 2V5CA 4A35A 3LCIA 1JROA 3TH6A 4H4ZA 3GIQA 3GYEA 3HIJA 4E3VA 2VX6A 4I6VA 3H12A 3MT1A 3VDBA 5A94A 1NHQA 3W7PA 4QG6A 2R94A 1VFUA 4PA8A 4J28A 3VXGA 1F74A 1R3TA 4M52A 3TAOA 3T2PA 1M03A 4H4WA 1RUSA 4IPLA 1NDVA 4ZOBA 1IT7A 3FG2P 1J01A 2OKTA 1UUOA 2YOCA 3F5JA 4DHGA 2E8ZA 4EMJA 4S1FA 1AUSL 4DZAA 2PDMA 4CU6A 3PN8A 4FS9A 1RK5A 3POCA 1W5OA 1KR1A 3HQNA 3EDJA 2E6DA 4AZ5A 2Y7EA 3OHMB 3ZSSA 4F0HA 2ZUMA 1W1B1 2JEPA 1B3OA 4FIQA 5TF0A 5LA1A 1OGBA 1SJCA 4IJRA 1VS1A 4QLJA 1UMYA 1E3XA 3TWAA 2VGGA 3FV9A 2ZVRA 4HU8A 5JUVA 1DXFA 2ZXBA 5E09A 3THQA 5E9AA 2EO7A 2BHUA 4H6RA 5HWNA 1O12A 4JN8A 3TQPA 2Y7FA 5GJMA 5K2ZA 1V8EA 4ZFMA 4EX4A 2V5DA 1P6BA 4NX5A 1B31A 1JUEA 5I23A 5CBIA 2VWTA 2BODX 3VD7A 1WOAA 1HNYA 2J8TA 1UUQA 3LPOA 3ABXA 2BC0A 3EWDA 3LCGA 1YRRA 1EC8A 2VL4A 5HAOA 1I8JA 1JRBA 1DP0A 1HXJA 1OJTA 2WXDM 2VFIA 3NL2A 4L4LA 4YHEA 3B9OA 4JQ3A 4ZA0A 4GBDA 2YYUA 3EA2A 1WP6A 5AHIA 1RQHA 1TYGA 3C2EA 1D3GA 2PDQA 1UOKA 4N7QA 1CLXA 4JTDA 5ABEA 1H7RA 3NQGA 2Q6ZA 4J3VA 3NQ2A 2FFCA 3BSGA 3GIPA 4AF0A 1HP5A 1E56A 1S2AA 4GCXA 3T0AA 4CU7A 2ZYFA 1FHLA 4FNRA 1TZ7A 2JGQA 3LCXA 4ZOAA 4MM1A 3GB6A 2A85A 4H4IA 4GNKB 1NELA 3TYDA 1NTHA 1KFJA 3N2XA 4O0QA 3DAQA 2PWEA 4Q8PA 1UOZA 1WE5A 3DYOA 1YX1A 3NL6A 3GTFA 3WQ5A 5K9XA 1SSDA 3VUSA 1KM0A 3KVMA 4X63A 3WNMA 3LLFA 4Y9NA 3PP7A 2G41A 3N19B 1DIDA 3MSRA 1CGTA 2W91A 3TW9A 1TO3A 2ZUWA 2H9AB 4KMQA 3TW7A 4MYAA 2B0MA 1MOKA 3HOJA 4L1XA 4CQAA 2PF0A 1V6UA 1A0CA 1O4UA 2EBNA 5KVHA 1RCXB 2E09A 2QJMA 1WOBA 5H8UA 3N9RA 5C9ZA 3BLEA 3W6LA 3RDKA 1P0BA 3NQMA 1VPQA 2R8WA 3WLSA 5D2VA 4WJ8A 3UPMA 4ALDA 3SCVA 4KFPA 3G1HA 2QAFA 4U33A 3SUUA 1HVXA 3UW6A 2JK6A 1W3HA 3EXTA 4FLRA 3ARSA 5E9XA 3NO5A 4XO7A 1QATA 1UYQA 2FMNA 5J5DA 3SRHA 3STPA 2PUZA 1FWSA 1VHNA 3TVAA 3M46A 3NPVA 2EPKX 3QEZA 1XBZA 1PCWA 1XIIA 2JFEX 4NZFA 3MUY1 3BGJA 1S2UA 2XN1A 3MUZ1 4ZE5A 5G5IA 2AAAA 1OHLA 4FNTA 4I9TA 1GQIA 3EX6A 4IG2A 3W7RA 1H60A 3NYZA 4LALA 1RR2A 3OJGA 1DJXA 1WAUA 3B04A 1RJQA 3RLUA 3WD0A 4TXEA 4M6VA 2WSYA 4L1GA 1LLWA 3CL6A 3DKLA 1FWRA 3DU0A 2XFRA 4HK6A 4H8HA 4YLWA 5TQLA 4Q8VA 1EJTC 4RE4A 1BQGA 1X6UA 5CEWA 3UPBA 1FWFC 1VP5A 3CBWA 2QF7A 3BL3A 2OELA 4RKAA 4QSHA 4H4YA 1KWKA 3WZ0E 2E5DA 4BI7A 1JPMA 5F2MA 3S2JA 3VOFA 1C29A 1V77A 3GRTA 5ABHA 3EWYA 4H4PA 2BVDA 1XYFA 4C6FA 2ALRA 5JXQA 3SCPA 1YXCA 2V6AA 3VKKA 1HO4A 5ECVA 1QBBA 2P0OA 3TZNA 2RDUA 2VZSA 4UCGA 2ZUVA 2WOWA 1GQNA 2Q8ZA 1TVNA 3LDVA 1AVAA 3D3AA 4GWEA 3CASA 2WWCA 4UZUA 4U5KA 1ZBWA 1GYMA 2DSWA 4W86A 2OXNA 4EAYA 3FHQA 3VFCA 4FLQA 2VEGA 3PBMA 2HXUA 1RJPA 5DT5A 3HM7A 3FVMA 4F2UA 4YTSA 2GFTA 2B31A 3VX1A 4KF1A 3PB2A 2ZXQA 3FAXA 3UZ5A 3W6MA 3WL0A 2QPUA 3O7UA 4QJ5B 5SWUA 1JVNA 1ME8A 1BRLA 4F4RA 4C5ZA 2QCFA 1ONWA 2NXIA 4ORMA 2PODA 3K1DA 3I3BA 4ILSA 4JQ4A 4DUXA 4J2PA 3CZGA 4JTLA 3SGGA 2HWGA 3MUAA 1X97A 1NHRA 3ABRA 1KO0A 5M2FX 5FL0A 1ZRQA 3I6EA 4B5TA 4ZQCA 2AMXA 5CGMA 3GTIA 1UR9A 1EHNA 3EMZA 4I8YA 3CIVA 4GUFA 4R85A 3NXFA 2GQ3A 4QJ4B 4OECA 3OW1A 2OTDA 3RILA 4YWOA 1TJ2A 1GEUA 1E70M 1FXQA 4UZSA 3URAA 1J8VA 2PD5A 3LNPA 3WQCA 2DIKA 2WBAA 1EC7A 1DXIA 3VIJA 2J7EA 4LF2A 5A8MA 3BUVA 1IR2A 3M41A 4QNWA 5XIMA 1RK6A 4GZEA 4YVPA 1LJYA 1XW8A 3GXIA 4UTJA 4E6MA 3LB8A 3L66A 2EPOA 2YDRA 3R0UA 1XLJA 3VOCA 2Z4GA 1SYTA 1A5KC 4PODA 3A4XA 1OWQA 1NSJA 2J13A 1AK5A 3PBWA 2QDDA 2X16A 3TKFA 3N9SA 1DL3A 1NP2A 2Y89A 1SR0A 1SW3A 1NHSA 1KW1A 3ZR5A 2IPWA 3K13A 2EPMX 4H3DA 3LXAA 4MOZA 1RBOB 2Z1VA 4J7RA 3MANA 1IXOA 1W9PA 1IR1A 3HQOA 3ABZA 5G2IA 4CQBA 3CZJA 5JIWA 1E15A 2XN2A 3KW3A 4OBRA 4DWDA 2WHLA 4LVBA 3QW4B 4P61A 4F8XA 3TC6A 4Q4KA 2V0TA 2WC4A 2IMRA 3DKJA 1OT1A 3EMCA 3U5UA 3OBAA 3UETA 1QASA 2J9YA 3CIXA 1A3HA 1UQYA 4HOXA 1M04A 4K36A 4DYJA 3AHTA 3G8RA 1XIBA 3B0XA 1CGUA 4H7ZA 2GR0A 4CLMA 3E02A 2WVVA 2C1IA 3M4HA 3SCRA 1TYPA 3BG5A 4DAFA 2QMKA 2YXGA 1DEDA 1DIOA 5BOEA 1O68A 1KGUA 2ZDRA 1BF6A 4NY2A 3CNYA 1OFBA 4RE3A 4B9ZA 3M5ZA 2V8ZA 1EGMA 3S5ZA 3FSTA 5D2WA 3W7EA 4XB3A 1J9YA 2PTDA 2X05A 3TC7A 1TPH1 3H7RA 2OKOA 4OV9A 1SMAA 1WPCA 4NNBA 4PUUA 1E6ZA 1MW3A 3B8WA 3WMLA 1ELSA 2ZX5A 4IMFA 3STFA 4X61A 3NQFA 3HN3A 3W72A 2W3RA 4GZ7A 3ZJKA 4IFOA 3M0HA 3C5QA 3V3WA 2PP3A 2EQ7A 1A47A 1SQ7A 3AMLA 4XD3A 1Y7VA 5A6BA 2HJPA 1KFEA 4TV6A 5GJPA 1XSIA 2IKJA 4Z1AA 1BVWA 2OZ0A 2ZRVA 4JBRA 3UWVA 5A8OA 1GVEA 2DT2A 3MA8A 3DOPA 5BRQA 4UC5A 1KGWA 3BCJA 3L21A 1TPWA 4WSJA 3R07C 1SW7A 3U48A 1GW1A 3KUMA 3RM9A 3SSJA 4HZ8A 3MWAA 1X1NA 4LNYA 1GPFA 3EWZA 4G2DA 1YADA 1EJWC 2I14A 2R24A 5JCNA 3OLIA 3A22A 3CK5A 5F2IA 3W7NA 5U1OA 3HTWA 1ECEA 2R1NA 4NAFB 4JDRA 2OU4A 1SZGA 1SFTA 3QHOA 3VD3A 3M5VA 4LUYA 1C9WA 3V4BA 1JZ4A 3S1UA 4TVWA 2RDTA 2PRLA 5HWMA 1WXYA 1IT0A 2O9PA 2WCGA 1CLVA 3H53A 4KGJA 3TROA 3VZYA 1AQ0A 3PWAA 4MAZA 3BDKA 3N2OA 4JN6A 4C7FA 4DJDD 3S3GA 1KQYA 3BO9A 3ATYA 3EGJA 1JNDA 2G5WA 3RLGA 2PLCA 4LVGA 2DVXA 4XD4A 1F73A 2OWWA 5I5RA 3H8AA 3P5ZA 2ZOXA 1JZ2A 3WKZA 3WD1A 1OGSA 5DCBA 4LYPA 1SJAA 3WJYA 1JJKA 4ZVJA 3HRDC 1SB3B 4A3YA 3FAWA 3T8LA 4P8UA 3K8KA 3F4DA 2PGEA 2OOGA 3UG4A 3GXMA 4QEHA 3BPWA 1K9DA 3BW4A 1QUMA 3PY2A 2A8XA 1O1HA 2G8ZA 3JW7A 4ERIA 1UWUA 1TJ1A 4S3DA 3GUGA 1LL7A 1E4MM 1YQ2A 5AC5A 2V3BA 1R3RA 3USZA 4ATDA 3LHUA 2VFGA 3TOYA 1AJ2A 3RHGA 4AD5A 4IH3A 3V35A 1NPXA 1XGZA 2F7FA 1PX8A 1UKOA 4KS0A 3W3OA 4BURA 4K2SA 4C6OA 1U30A 5I00A 2Z27A 4KQNA 2RJGA 3LPFA 3RMJA 1LROA 4O57A 4HPXA 1EIXA 2PP1A 3D6NA 4MAVA 2V9DA 1EJVC 4BJHA 4MKNA 2VDIA 1PV8A 3P3BA 1TTIA 3N3TA 1IWBA 3TZFA 1MFVA 1MNZA 1KM1A 1P4CA 2VT0A 3RAOA 1PXGA 1TJRA 1QOPA 2BV9A 3FKRA 1VEMA 4K3ZA 2ACRA 3DYPA 4AX6A 1XANA 3HMCA 1CXHA 4JQ9A 3WJXA 1U33A 3W2KA 3WNPA 2XH7A 1C8YA 2WWDA 4IGMA 4DWSD 1Y5WA 3CQJA 3GE7A 1XF0A 2Z29A 2OGJA 2Y6ZA 3GFZA 1B9ZA 3UJEA 2GGJA 2CLEA 2H3BA 3VKBA 2TRSA 2DU2A 3WLMA 2C14A 4CNNA 3TYEA 3R11A 3W24A 3ZWTA 4ZFCA 3CO8A 1F6KA 1E73M 1JD7A 2YLLA 1LUCB 1BTMA 3AUJA 3WQPA 2BVTA 3E0FA 3W38A 4WXYA 5AFDA 2VZUA 2QCGA 1BLIA 2PLMA 5H6HA 2FTYA 4RX0A 2ZX9A 2WMIA 3OA5A 3W73A 1E43A 2W0UA 4E2BA 3G0SA 4YVVA 4S2CA 1GZGA 3SY8A 7ODCA 3Q4DA 1K9FA 4LIIA 3DN5A 3EWCA 1JCXA 3VNJA 4NASA 4A05A 3WLRA 3R4IA 4QX4A 5I77A 3UJFA 2PCEA 4MG4A 3WEOA 1ZJAA 4EPKA 3TXVA 4MZYA 3HGSA 3U4AA 5FA5A 4AEEA 4MJ2A 2XZ9A 5HQEA 2WZHA 4HQVA 2VEMA 5FEZA 4JIIX 2XZ7A 1BVZA 3MTWA 1TCMA 4UMAA 5FF7A 2VELA 4XBKA 2Z7KA 1K7XA 2OZTA 1K4GA 1IIHA 4XV0A 1US0A 3RITA 3R0DA 3QTGA 4RLIA 3DFNA 2OSXA 2V68A 4UQAA 1F07A 3B0VC 2ZTKA 4MWAA 3FA5A 4YXGA 7A3HA 2W3SA 3L4VA 4O10A 4C6LA 1XH1A 1RPKA 3I6RA 3UWQA 4FF7A 3DUGA 4IT1A 4LYRA 4A4AA 3CIWA 2PAJA 1RLCL 2V3AA 1Z89A 3H54A 4H04A 2ZRZA 4ACYA 4FF5A 4JTCA 4WY0A 4FOJA 5CG7A 2OO0A 4M81A 1Y8BA 5JQ9A 2WKGA 3UQNA 3CPUA 3C0JA 3ARYA 3XISA 3M6DA 4Q8MA 4YPJA 5K3VA 1DNCA 1ZCOA 3NTYA 3AUOA 1K8CA 3SRDA 3V5CA 3AXIA 4E0CA 3QV9A 4IFKB 2DGAA 3NVVB 3S4TA 3OU8A 1M41A 4XUYA 2E5BA 3PBUA 5JIPA 2Y5SA 4K37A 1E40A 1W8GA 1VC4A 5GNXA 4E2OA 4B5XA 5FS9A 2DH3A 4ORIA 3RU6A 1IEIA 4J4KA 3LD5A 1EHAA 1T40A 2PGWA 2YCJA 4AZ7A 2GDVA 3LMZA 2XVKA 3OIHA 3F4CA 1GVYA 2C0HA 2FHCA 2ANUA 4AIOA 1F8IA 2GLKA 3NYDA 1R86A 4QNEA 1D9EA 1ZKQA 4DZIA 2VOMA 1RP9A 5FIPA 5JCMA 4NJHA 5CLWA 3U57A 2XIIA 2Z24A 5D8WA 1KKRA 3TMLA 3VMPA 4HHMA 4FXJA 5KVIA 3DFQA 3VX0A 5AZ0A 3KLKA 4XIAA 3IJ7A 3EX3A 4AH7A 2GUYA 4PSRA 2HMCA 4GVIA 1E72M 3Q65A 1R9YA 3VUPA 2IKHA 4IOTA 1JPDX 1PE1A 2YGYA 4QITA 5EMYA 4H9XA 4MB5A 3WF1A 2CZEA 1KFWA 1VBRA 1FWTA 1MUWA 5DXYA 3C3UA 4QDWA 4S3AA 2WCSA 4TIMA 3H4XA 4J3UA 2G3FA 3PZNA 4XZHA 1RVGA 1OGGA 5EMMA 2CZFA 5LHFA 3CB8A 4PTXA 4O4VA 5CPQA 4M1RA 4LBRA 2VMFA 3JVAA 2XWDA 3MUXA 1O7AA 5IOBA 1R47A 2HTMA 4GACA 4IZGA 2AAQA 4Y96A 4D6EA 4O8AA 1X96A 2Z2UA 1Z69A 4I7VA 4MWAE 1UROA 1QW7A 3WYZA 3V0UA 2F5ZA 2D24A 3W1TA 4WKAA 7CGTA 4IUGA 1YNQA 4PFMA 4PMZA 1STZA 1AODA 2X1IA 2HV5A 2ZIDA 1N2VA 3TC3A 1A5MC 3AS2A 3AYTA 4Y7EA 1XYAA 2ZRUA 3UJSA 4DUOA 4I8DA 3UU0A 2VGBA 3QHNA 3NQVA 2F6UA 2XSBA 2PDFA 1CGVA 5CSUA 2B7QA 5I0DA 1A3WA 3B8UA 4MY1A 3WH8A 1M1BA 1XDIA 1I9CB 5E0CA 5CJMA 3W9ZA 1JUKA 3KBNA 3QPEA 2QCEA 1VCVA 2Y5EA 4DBDA 2RH9A 4HD5A 1I1WA 3QM3A 3S5SA 3URNA 4S2BA 1TZ9A 5DRCA 4CD8A 5B7ZA 3EDFA 3E49A 3DJGX 4R3UA 3GD3A 3MSYA 1FH9A 3DDMA 4IIBA 3CMGA 3BG3A 4CKQA 4DJFD 4LC8A 3RXZA 4WIWA 4XAFA 3G18A 1UD4A 4WOZA 1GEQA 3P67A 2ABBA 3EKLA 3R94A 3H23A 4D8LA 1OG6A 2J7FA 3TN5A 1QNQA 3LCLA 1D7YA 1EDGA 4PUKA 2E5AA 2WNQA 1OIFA 2POTA 4GQRA 2NLIA 5TBOA 1EJSC 3C86A 3ECQA 3FGCB 2YKKA 1SZFA 2J6XA 1GVOA 1IQ8A 1HF6A 3GW0A 3BLDA 1WZAA 4HPHA 3WDHA 2GVJA 4NRRA 1QI0A 3ES7A 4H01A 3RPMA 3UGRA 5I06A 2ISDA 1THFD 1K6AA 3LZ3A 1TRDA 3HQPA 4CCEA 2WZTA 1N8IA 2PTZA 1JGIA 3V7PA 4DO5A 3DFSA 1G1YA 2Y70A 5BOFA 4WSKA 3V36A 4U31A 4JX6A 4UTWA 4TV5A 1X39A 3P0XA 2PDKA 2XH0A 3QFAA 1WBJA 5F2GA 4U2YA 3TTSA 4ZQOA 3NZRA 2ACQA 3SO7A 3W1LA 1FO4A 1NF7A 3MI3A 3WEZA 3N13A 4V33A 1EGVA 4PRRA 2P1FA 3L2LA 4NX0A 3SW6A 4K6AA 1ONXA 4A6GA 1XUUA 3LI1A 5CZ0A 2DSVA 3N6QA 3GLCA 5C54A 5I78A 4IPNB 2BOEX 3DGBA 3IJ6A 4GXWA 1AMKA 2F61A 3B4UA 2WOVA 3HV8A 1M01A 3SJNA 2E3TA 3QN3A 3VFLA 1E1CB 1V3MA 1TPC1 1LRTA 1W5PA 1ISVA 3CQKA 1XICA 5IRPA 2VX5A 3OZPA 4LWWA 3GU9A 4GY1A 1EBGA 4O1BA 4EPDC 6CGTA 1PL9A 2Z26A 4CQDA 4EF8A 2V63A 3HZ3A 2R91A 3CAWA 4GFSA 1ZP3A 1GT8A 1OC6A 5LNSA 2VFFA 4L9YA 2PGRA 4HBKA 2Q02A 4WUIA 3M47A 1K7FA 5E6YA 1GWJA 2PDCA 3VOJA 3GRSA 1SO5A 4DNHA 2VGIA 4C6CA 1MXGA 4HZ7A 4N0RA 3PANA 2X7VA 5H8MA 5J8LA 3GDBA 3LYEA 1MZRA 2R9ZA 2C18A 2R1KA 3DK4A 2CBUA 1T0OA 4LYQA 1V03A 3EF6A 2DY3A 4DI9A 3RYSA 3EA1A 1EA9C 1K4HA 1QHZA 1M7OA 4JDBA 4H4QA 3NQ7A 3A64A 3UZYA 3WBXA 1VD6A 1UIOA 4YTTA 3NVWB 2VX4A 3SGZA 4DNMA 3STEA 1VBHA 2GR3A 1B90A 4GX8A 4ZOCA 5CPTA 3S9IA 2TPSA 3SUSA 4H4RA 1R87A 3AO0A 4IWWA 5IDZA 1XBXA 1GQLA 2O4QA 1J0IA 3EZ4A 4AISA 2B7PA 5MKGB 3ARVA 3PJWA 4JR5A 4IQEA 4URIA 1D3HA 2AKZA 1XXXA 2AQWA 2YL6A 1XS2A 1XR2A 3W7OA 2W54A 3VE7A 2GGHA 1GW9A 1OSEA 3U6WA 3WDQA 3NGFA 3ZLGA 3WO8A 3S5NA 1OADA 4BQ5A 1XG4A 5REQB 1WDDA 1GXFA 2PA6A 2P0IA 4HU4A 8CGTA 2AL1A 2WO5A 4IHCA 2OVLA 1M5WA 2ACSA 5CJNA 4KT2A 1A4MA 3WD3A 1WZMA 5EA9A 2Z2BA 2EG6A 3RJXA 3IJDA 4BI6A 3FYYA 3SSZA 4KEUA 1VPYA 5F4WA 3RK8A 4GYKA 3W2JA 3WLPA 5A2CA 3S5OA 3KTSA 3ITCA 1CIUA 2BMBA 2P50A 4AZCA 2EJ1A 1JZ7A 1UWTA 3PG8A 4CQ9A 9XIMA 1ZP4A 1WUFA 3BTNA 3B40A 4MWAC 1DOSA 4Q4OA 2AGTA 1QU4A 2WHJA 3B8TA 1V0MA 4IL0A 1MW2A 4PH6A 1QMLA 2GGGA 5HDRA 3MU7A 4D1IA 3B0UX 2X7WA 4YHGA 3GTNA 2J7DA 3A9IA 3KVLA 4GYFA 1M3UA 4Q8WA 1BSIA 1PZ0A 1TWIA 3AFBA 4RDYA 3CAVA 3PPHA 2VC5A 3N2CA 5DX7A 4LXFA 1H2JA 2PEVA 4QM1A 2I9UA 3SGUA 1RALA 5J04A 1UQZA 2GQWA 1WDSA 1BYDA 1HO1A 1WDWA 1UA7A 1LLOA 3AWNA 1QPQA 3GHTA 2ICSA 4JCLA 1EEPA 3Q94A 4F9JA 1IZKA 3CL7A 1QFEA 4NHVA 3AIBA 3BV7A 3TW6A 5ER0A 1G5AA 3S1WA 3MZNA 2OG9A 1M7JA 2J79A 1Q6FA 2EQ9A 3E2RA 4QDPA 2VC6A 4DVOA 4YCPA 3EANA 3EBVA 3EX2A 4LQ1A 1W0MA 3WF3A 1XLBA 1CECA 4YTQA 1XIFA 3QZAA 3BAXA 1YYAA 1QO2A 3A3XA 2F84A 4BZYA 4HNCA 2CLHA 1XRTA 3J7HA 2PWDA 3CU2A 4L4OA 2NX3A 3DX5A 6TAAA 2C6QA 5HUOA 2CEQA 1IYXA 2YCIX 3PWIA 4JZ5A 4W88A 4UQBA 1J5SA 1OB0A 1N55A 3SCNA 4JICA 2V6OA 1NWTA 4JFWA 4N2YA 3N25A 3ME3A 4TVYA 4N9BA 3S0CA 4V27A 3VKAA 5FS6A 1Q3NA 4XZWA 5GVJA 1PVNA 2BHZA 2CYGA 1A5UA 1S3HA 2OMAA 2XU2A 3M6YA 4E3TA 1SJBA 4ASTA 1F8WA 5D03A 4IQDA 2GVGA 5AY7A 1L6GA 3LB0A 1O5XA 2IQTA 4FNSA 2GGIA 3GNOA 1K8YA 3DC8A 1S3TC 3W25A 1JNEA 4J9JA 4LUSA 1G0CA 4N9EA 1KXHA 1QW8A 3E2QA 4C1KA 3SCOA 4DY1A 5IBXC 3V16A 4NZ3A 1O66A 2ZE3A 3N14A 2VP8A 1J10A 3E74A 4D1JA 3VGFA 4C7DA 1JCYA 1W56A 3COTA 5CSSA 1LRQA 4PMYA 1FFQA 4M8UA 1A5AA 1OCQA 1XIJA 5CZKA 1YNYA 2BSLA 2GR2A 2VD9A 2W0HA 2MUCA 2V5BA 4GD0A 4ATWA 4JFVA 2RGMA 3LXCA 4ZO8A 3T8QA 3VMOA 1SPQA 1GV4A 5C0QA 3T05A 1NOFA 4Q3MA 4AUBA 3KCLA 2HXTA 1GCYA 4LUJA 2EAWA 3LN3A 3AIUA 3BLPX 4JAWA 3ARWA 4QRNA 2J7HA 1S5NA 1SO3A 5FJPA 1Q6QA 1TUXA 4LV9A 3T0CA 2DP3A 1SFJA 5A1AA 1V6TA 4L9ZA 3BGGA 3ZS4A 4H9MA 1PIGA 3F1QA 2HPMA 1GERA 2VM8A 4XVDA 1QO5A 1H7XA 2DZPA 3LRMA 3POHA 1JGMA 2JKEA 1DWIM 1I1XA 3V0TA 3IPWA 2YDQA 3ISIX 2ZZ7A 3II1A 3UEQA 2Z1BA 4GI9A 3SUVA 3PAJA 1ZJHA 3N1AA 1E6SM 4YU1A 3H2CA 4XISA 2A4AA 2G50A 3N4FA 4H50A 3DI1A 5FEXA 4IQJA 3KCJA 2FB2A 4LX4A 4C6NA 3FKKA 5HR6A 3W1UA 5E70A 4GJIA 4EE9A 3FA4A 3RCYA 4LBUA 5M1TA 1XM3A 3M5YA 2CDUA 1S5VA 3O6DA 3VDGA 1LQ2A 5FS7A 3DBNA 2IUZA 4GQBA 1B9BA 2D73A 3GHRA 3DFHA 2TYSA 5FD0A 2E8YA 7REQA 4NZCA 3NPUA 1WB0A 2H9AA 4CCDA 4PTWA 1A49A 4GKLA 3W7LA 4PMRA 1TFVA 1XP3A 3THUA 2P8CA 5AHLA 3LX9A 2CLKA 5BYWA 2WVTA 2DUXA 2X41A 3M0XA 4EMWA 1OG0A 1PDYA 3LM7A 5M3WA 2QGYA 1ZBVA 1EFZA 4PYSA 1T3QC 5DBTA 3VDAA 1R0MA 1B5TA 1FWEC 4QP0A 2WOQA 2INFA 4FO4A 1WDQA 4NG3A 3SEPA 3VNIA 2FJUB 4HHLA 2PZ0A 4WY0F 1HP4A 2PDIA 3TJIA 2X09A 2P76A 3C8FA 1XFCA 2VDHA 4JTKA 3UXAA 1RBAA 3L4WA 4M24A 4ZTYA 4CQCA 3N34A 3AMZA 4GNVA 4Q7BA 1KCLA 3WLHA 1UW9A 4GKTA 3LCHA 3TYCA 4AW7A 5HUPA 1F6PA 3C56A 4JTGA 3KZPA 2ZVIA 1TVLA 2JBMA 3DHDA 1X2HA 3Q45A 3PTQA 2WLYA 1JYVA 4H4VA 1Q6OA 1XQLA 5KEZA 4RNHA 1SSGA 3O0HA 1GOMA 4KCUA 3DZ1A 1XCWA 5DFAA 4NAEB 2RABA 3CAQA 3K4AA 2D2GA 3L4YA 1GTHA 5DBUA 2ZA3A 1UC4A 5CSYA 3GD4A 1AD4A 4NZJA 1D2KA 1FWAC 4KEZA 1TTJA 4NSBA 3TLLA 2D3LA 4LVDA 4F79A 3LXDA 3GC5A 2FGZA 3FS2A 3T7VA 3AXKA 3CH0A 4GZIA 3FW6A 3VIPA 4CEUC 2V3EA 2C1HA 2HISA 3PZOA 1SU5A 4L4MA 2FZNA 3I3EA 1E6NA 2QUNA 1OF6A 4X2PA 2IQDA 2EPNA 3OVGA 1V4YA 1W9UA 1LL4A 3H55A 5HJLA 2PPGA 1I2RA 2O92A 3OC4A 3PULA 4HZ6A 3UNDA 1VYRA 4WRHA 3WDPP 5KETA 4IP4A 5D9OA 4MYXA 2PGFA 3G1RA 5C2XA 1LQ0A 2J47A 3G2GA 4D8ZA 1I6NA 1FHDA 5DCEA 3ITTA 2FZ9A 3WMSA 3WK3A 4A21A 3DG7A 1RPXA 1JZ3A 3GH5A 1IZCA 3O06A 3WLKX 3LXBA 3VGHA 3GU2A 2HSAA 4LEQA 2EPHA 1CNVA 1CPUA 1ZY9A 2AKMA 2X40A 3OTRA 4IX2A 4BHYA 4ZOHB 1TV3A 2WVSA 3KS6A 1ALDA 3CAKA 3PZGA 3MYOA 3ARPA 2J78A 3GK0A 4A3RA 4WZHA 2D0FA 2W79A 4PSPA 2YA0A 1EP1A 1RCOB 4JX5A 2CLFA 1VQTA 1XHCA 6ALDA 4TUFA 1AQMA 2FH8A 4F2BA 2YR1A 5K4XA 3TSDA 1D8CA 3ERPA 5HJXA 3WLNA 1TIMA 3MCNA 5D9MA 1PB0A 4NYYA 1LDCA 1B4EA 3HG4A 2CNCA 3BAWA 4GABA 1UD2A 1TQJA 1GRAA 3MY9A 3MCOA 3PFRA 3CGCA 1E9LA 4IIFA 4J35A 2BB0A 4UOJA 4PUJA 1OIMA 3KHJA 1VRXA 3DXIA 1AFSA 2VEPA 2D2OA 3GXPA 3VK5A 1EPXA 4ICCX 5DANA 4CN4A 3TTYA 1LL6A 1SMDA 3L67A 1OX6A 1NFPA 3WEMA 2ZWYA 3G8EA 2XG9A 4IMDA 2DJXA 3EWXA 2CBIA 3FCPA 3ZLHA 4GUIA 4PFHA 3LTPA 4HK5A 4G7EB 7TIMA 3RLVA 3N6JA 2WC7A 2VQUA 5BWAA 4RPPA 3QMTA 4BF7A 2E25A 3IC9A 4O14A 1UZ4A 4S3JA 3EUB3 1FFRA 1HKWA 2QPSA 2OEMA 4JEQA 4GZJA 1VEPA 5D30A 2FPVA 1O5KA 2CLOA 3T40A 2WM0A 4H41A 2IKGA 5BMWA 1S2TA 2C15A 3TQVA 2JGYA 4PMVA 3W71A 3L8KA 2X1SA 2NQ5A 1XQKA 1RAKA 3KWSA 4PMJA 3ZR6A 1L0PA 1EP3A 2FZBA 4S38A 2PTXA 5FL1A 1KQZA 4EKJA 4UNIA 4DO7A 4M1BA 1X98A 3AOFA 3FY1A 3A3WA 3W7GA 3JS3A 1K1DA 2XPKA 2E77A 2O56A 2VXNA 4LC6A 1AZ2A 1PCKA 1IGWA 3BCDA 5G4HC 2EQ8A 5CZSA 1NWSA 2FHFA 3T2QA 3TSBA 1Z8AA 2DZBA 1ZENA 2VFEA 1K7EA 1TPFA 3ITVA 4Y8FA 5DXXA 1B3YA 3GNXA 3LPPA 1FVPA 2CBVA 4KEMA 3QYSA 3ZVHB 4NRSA 4WKFA 4B4FA 3PHAA 3ZQ9A 5AVNA 4ERGA 2INZA 4Q22A 2VEIA 2WPBA 4QJ3B 2WSPA 2I56A 2D3NA 3UWUA 5D02A 2ZRYA 3L68A 1JPKA 3FJ6A 3VDCA 1Q8JA 1FH8A 2WSRA 4S3GA 1N62C 1S1PA 4M6QA 1C93A 3IAPA 1OFRA 1LLZA 4FX9A 1LOQA 1W1YA 3AJ7A 4WEVX 1O94A 4JPGA 4GNJA 4JHOA 3IJIA 4DELA 1EDQA 4YWSA 3KL3A 3NJ3A 5KINA 1MNSA 2BDQA 3O0KA 2AQVA 3LV6A 2XGIA 2WYSA 2QZRA 1LWIA 1ZNNA 1B3VA 1H5VA 1ONFA 2ASHA 1DYSA 9CGTA 3FXGA 4MNLA 1AH4A 1ZAJA 2A21A 2VENA 3P60A 1LWHA 4L1WA 3NCOA 3WH5A 1W3LA 4AWEA 1MEWA 3S42A 3MKCA 3CQIA 1XH0A 3C0LA 4MB4A 4H9VA 4ZBCA 4CNPA 4HNTA 1EGZA 4NAFA 3UERA 2WSQA 3W88A 1FWWA 1ZS2A 2GJNA 5HULA 3CPGA 1TMHA 1T5AA 1W9VA 1OBAA 4TTGA 1CBGA 5ABFB 3APYA 2HDJA 2ISFA 1X8FA 2J27A 2XVNA 4UTFA 1UP3A 1W5QA 4FZIA 3KOZA 1JUBA 2LLEA 4C91A 5EBUA 5I3GA 1NDWA 2O55A 3MDWA 4IMEA 3VIGA 1W5NA 4REQB 4GR1A 5CPNA 1H1ZA 2YSWA 2XTKA 1A5OC 2OZ3A 4O19A 1F7BA 1KCXA 1G4SA 3C52A 3DHFA 4QLLA 1DIEA 5CC7A 1DJZA 1JF5A 1TV4A 1Y65A 3SI9A 2QUMA 1OEPA 2XINA 2WBGA 1QR7A 2R82A 3K1GA 4FXSA 2J24A 2BGSA 4GH1A 3TXZA 1JFXA 1OFQA 1W1TA 4ADSA 5F4XA 1GZ1A 4Q32A 1KRBC 3OYZA 3SIZA 2H3DA 1EBHA 2QCHA 3CQ0A 5LNRA 1QNOA 2X1UA 2B81A 2Q3OA 4NI3A 2OEKA 4P7RA 1N82A 3S6OA 1ZBKA 3PJXA 3CUHA 1P43A 4NL1A 4A29A 4DJED 4ZCWA 2F6XA 3BAKA 3C6CA 3GD6A 3JU2A 3QYQA 3FDKA 4K1WA 3WD4A 3LGGA 3UCCA 1OQFA 4GQ0A 1HKKA 1EWDA 1P0NA 5FF4A 4RNIA 1XLLA 1WYGA 3RCNA 3KVKA 3A23A 3W6YA 1F3TA 4LY8A 1K9EA 2Z6JA 3MKVA 2VI0A 3IGHX 1YBQB 4QXIA 3PG6A 3CJPA 2Z6IA 3CHCA 4IP5A 4O13A 1YE6A 2XYLA 2XIJA 4C6JA 1A80A 2HEJA 1US2A 5LNUA 2UY5A 4O0KA 3RG6A 3A4WA 3KX6A 2WPCA 5BNKA 1FDZA 2HE8A 3GTXA 1YHTA 1RQEA 4LRSA 1UJPA 1UWQA 2JKPA 1EH9A 2GZXA 1ZMDA 2Y5JA 3W83A 4TVCA 5LIUX 3AZTA 3WNNA 3D0CA 4JIQA 2YX0A 5T9CE 1ZFJA 2FZMA 4R27A 3HPSA 1N7KA 3W87A 3BMWA 3WLLA 4S3CA 5BRPA 2CIPA 4Z2HA 4EWJA 3ELFA 3VINA 3BV4A 1JQVA 5L9FA 3EDDA 1IF2A 1MDLA 3UA3A 1T99A 3I4EA 5BCAA 2QDGA 3MHFA 3PUEA 3NUKA 4E2VA 2X99A 4WK9A 2QUUA 3GUWA 3QSRA 1SW0A 5EU9A 4PTVA 3Q6JA 2A3LA 3OP2A 4GJJA 4JL1A 4B91A 3AROA 4B3ZA 1EP2A 2G3IA 4U5IA 3B97A 2VCAA 1CXFA 5HXMA 5FJOA 5CKSA 3S9YA 4O54A 1HFBA 4IPPA 2Q01A 5DLCA 2OGYA 3P81A 1LBMA 4FK9A 1UUMA 4GFIA 2I5IA 1BVNP 4XZNX 1UR2A 4QSFA 3RRXA 1Y0EA 4LNCA 1GOQA 3VD5A 1OCJA 4KFNA 2NX1A 1H61A 3A24A 3G0XA 3CC1A 3W86A 2FGLA 1XIDA 4J3ZA 4JHZA 4NJGA 2GWNA 3ZMRA 4I90A 1IXNA 3LHWA 1CENA 4WOQA 3W7HA 4Z0JA 1B30A 2ZUSA 6REQB 4F0LA 1VFFA 3FSUA 3LCWA 1P48A 1XISA 3BJTA 1UKTA 3L5OA 3Q58A 1TWWA 4S23A 1Z42A 3NG3A 1BPLB 1J4EA 2W67A 1NWUA 2B7OA 2GJLA 3SFWA 3R25A 4FX6M 4HKPA 2AQOA 1NIUA 3KP0A 4O1CA 3W7QA 3AYSA 3GDKA 2QVHA 3HJEA 5AKQA 8XIMA 2O4MA 2W66A 1DVJA 4IGNA 1SZRA 2QDEA 1F61A 1P5BA 1V59A 3K2GA 2EHHA 1LVLA 3QRHA 1EZWA 3EYPA 1V6VA 2H8XA 2ZADA 3EDEA 1M65A 1UASA 3SN0A 4UOZA 1XI3A 2FVKA 4HMEA 3LU2A 2BXZA 5LA0A 2OB3A 1ZLPA 4IFKA 2VURA 3O6CA 1BYAA 4F0RA 1PPIA 3WQ8A 1HGYA 2BASA 3YPIA 1XPGA 3RR1A 3GTHA 3LPGA 6XIMA 1V0NA 4IX0A 1GYNA 1FTXA 2Z0IA 3H7UA 1MZHA 3O6AA 3SY1A 1G4PA 3KM8A 3RU8X 2PBOA 3PUDA 1LTDA 2X1RA 3CO4A 3KRZA 3SCUA 4H4XA 1FIQB 2RHGA 3QPYA 3NS1B 2HVOA 1F6YA 4DO6A 4CVUA 1GREA 3MYPA 1BRLB 4RDVA 1QVBA 5ABGA 1N8FA 2QUTA 3QZ6A 1YTDA 3WBAA 2QS8A 5E93A 2RGLA 3IV3A 4WVXA 2HNEA 4PL2A 4YVXA 3N9KA 4HGXA 1E0UA 1XRSA 4ZENA 1LBFA 4H2HA 4QE5A 5EFDA 4P7OA 3SR7A 4B5WA 5E5CA 2OSWA 1Z7AA 2CZDA 3GR4A 3WJSA 3KCOA 2E7FA 3VIHA 3P7YA 4OE7A 4TTUA 3A4JA 4LH8A 3E2VA 3ITGA 1XD1A 4JTUA 4GO9A 4A3UA 4B2DD 3PTDA 4M80A 3E5BA 5AZ1A 3TYAA 1ZDLA 4GINA 1B3ZA 1QK0A 1FHUA 3PJUA 1TV5A 2Y1HA 1K4QA 3T4CA 1GSNA 2QT3A 2YFNA 3QR0A 4F40A 3EKZA 2FGBA 3GX9A 1RHCA 1J2WA 1P0KA 3FA3A 1QCWA 3DC0A 2A7RA 1BGAA 3KOXA 6A3HA 4AXNA 2D0GA 4CEXC 4WR3A 3WF2A 3N2TA 3CT7A 3O16A 4QAWA 3QY8A 1XRVA 1PDZA 1XFBA 4XZIA 4AWUA 2F2KA 4AWTA 4OKDA 2Y88A 2XUCA 4DJDC 3V18A 3L4UA 3SRFA 1N8WA 3VOHA 3H2EA 2YBVA 3BE7A 1XLFA 4HNNA 1BWVA 4EOUA 3IK4A 1DTNA 4LU0A 4C6QA 1KV5A 4HN4A 3NPXA 3C0SA 5K9CA 5C6MA 3OIXA 1TB3A 1AMYA 1VIWA 3BSHA 4GVHA 1H1NA 3ZR4A 3H7VA 2HS8A 3CV7A 3TYUA 1W1PA 1AW2A 2Y63A 1Q6GA 5I3JA 3CEPA 3H21A 3SECA 4AHPA 3B8VA 4JQAA 2QMJA 3ZFHA 3I65A 2DZVA 4UR9A 3TEVA 1MEHA 3TNBA 3WQVA 5BXPA 4ZGYA 1DKWA 2HK0A 4CD5A 5LIKX 4H6KA 2CW6A 1QNPA 4LGXA 4YNGA 1P7TA 1SUXA 4V1YA 4GUJA 4K7VA 3V5OA 3QMRA 4D6JA 3G6LA 1OYCA 4TVUA 4Q8NA 3AS1A 3B9NA 4V1XA 2Y8KA 2B7NA 3O1NA 1DORA 3UPWA 1QNRA 3M1ZA 3TTEA 4NYUA 2E28A 3TK7A 3CWNA 1UD3A 1XPYA 3HPFA 4CU8A 3VNYA 2XH4A 3BAJA 1HVQA 4E5TA 2GSHA 1M6IA 1JXJA 4NJJA 2ZRXA 4MHBA 1UH4A 1RM6B 1HGWA 2Q71A 4PCNA 4RUBA 1IWAA 3EA3A 3QOMA 2J62A 1GZJA 3FGCA 4EQSA 3VIMA 4RXGA 1YDVA 2PB1A 3G3DA 3W76A 3HG2A 2V2HA 2ZFAA 1Z48A 4PEKA 2V38A 2YZRA 1W3TA 3RIKA 4Z2GA 5AYXA 4AZ6A 3ORWA 2HPIA 3SB0A 4W85A 3TYBA 1RJRA 2IPGA 5JU6A 3H2NA 5AYIA 4JD4A 5IXEA 1W6TA 3FHAA 3NQCA 2CERA 3NO3A 1XDMA 1BF2A 4AFYA 1LPFA 1V51A 4CNOA 4MFDA 1UR8A 1WAWA 3M7WA 2OLSA 3RM4A 1ZUAX 4DWSC 1EF2A 3T1GA 1VYSX 2DUAA 3I68A 1ZMCA 1Q7MA 2W4XA 1GESA 3T78A 2CC0A 2CXGA 2PRHA 2PTYA 3CUIA 2FJKA 3JZEA 4FXRA 4W89A 2BGNE 3DFPA 1IV8A 2P53A 3KVJA 1KRCC 4HA1A 3W7KA 3A3HA 3PF3A 3KL5A 2DVTA 3M0VA 4LAUA 3AM9A 3TFCA 2WCAA 3MS8A 4AC1X 4ACZB 4E4FA 4W84A 3RPDA 1PZ1A 4EIVA 5K9DA 4JTAA 1A0DA 1KM5A 4OOZA 3CTLA 3KRSA 1J0KA 1E1CA 4M82A 4DLMA 3BLLA 1L8NA 4KRTA 4IF2A 4NJIA 1GUVA 3W2NA 3SQPA 2ON3A 4KW2A 5C7VA 4J56A 3BLIA 3CWHA 1ITQA 1QOXA 2KZHA 3GZAA 4BF5A 1K6WA 3W1QA 3PZVA 1XYZA 1FECA 5H91A 4EK7A 2J7BA 1Z9AA 4Q4QA 5T26A 1ISXA 1FWIC 5GJNA 1HJXA 4US5A 3GQYA 3N04A 4MUZA 3WJWA 4WGXA 2WPGA 1MYRA 1ISYA 1S5WA 6XIAA 5AC8A 1X1OA 1Q7ZA 1HKIA 3M7SA 1S2CA 2YAUA 3MI6A 2INEA 2PWHA 3M44A 4S3FA 4NI8A 4UB9A 1FY6A 1NOWA 1VBGA 1GQJA 2GH5A 4GVGA 2FH6A 3VZXA 1R2RA 4O4WA 2GUUA 3H24A 1NFBA 3L4TA 3R1ZA 2EQ6A 1EEXA 1XG3A 1C91A 3W82A 1GRBA 4JQ1A 2QEZA 1P0EA 1UC5A 3LMYA 1NARA 1A5NC 4V2XA 4IXHA 3PTMA 2J7GA 3IANA 4XG1A 3I4KA 3QXBA 2PURA 5MKGA 2WMFA 2UBPC 2QUVA 8XIAA 1VKFA 3ZJ6A 2O0TA 1IEWA 1C8VA 3GDTA 1TVPA 4LAKA 1EQCA 5JMUA 5A6AA 4QEEA 1X7IA 4FLOA 3H2AA 2Y24A 5LGZA 1MRQA 2C91A 2WAGA 3EPNA 4XO6A 1CEOA 5KMYA 3R7MA 5REQA 2QAPA 3KWXA 4HNOA 3GR7A 2C1GA 4HCDA 1K8XA 4RPQA 3T4WA 1ZPTA 1LBLA 3E12A 4FX8A 3IIXA 3ZJ7A 3BZGA 1OVDA 3WUEA 2WV8A 4M3PA 3AWOA 1JYNA 3UXDA 3T0TA 5CBBA 2Y7GA 3MMTA 2BTMA 2DPEA 4XZ9A 1Q7QA 3RR4A 3HO8A 4QHRA 3NDYA 4FMVA 5LKYA 3U2EA 2F9RA 2V5KA 3NOEA 3T42A 2X50A 1QI3A 2B4GA 1R30A 3C3NA 4GQQA 3DEQA 1BXCA 3AU2A 2GJPA 1F8MA 3HPAA 2X8GA 4WJEA 2F38A 3W29A 4ZXLA 1MW0A 2V3GA 2GOUA 2W62A 4QG8A 1GOWA 4ML9A 2OODA 3NQEA 2IS7A 3FVDA 4NXKA 1NQ6A 1TWZA 2YDSA 3VGEA 2C79A 2OLHA 1HL8A 4XBJA 1ONEA 1V0LA 1WO2A 4RJEA 5BXSA 1OABA 1R2TA 3DHPA 3UZXA 1ICQA 3VKDA 3JUGA 1ZY8A 4D6GA 1E0XA 3BXWA 3SY5A 2O7QA 1FWBC 2Y0FA 1U83A 1TQXA 3G1AA 3EB4A 2HVNA 2BY1A 4H9UA 1HN1A 4DUVA 5JCLA 2AOSA 2WMIB 2D23A 3NXLA 1GRTA 1C90A 2HBXA 1CYGA 1MDRA 1SFLA 4GVFA 1OF8A 1OYBA 1PKMA 1TCDA 3TV8A 1L6FA 5A6JA 2VZVA 1GRFA 1I2NA 1A5BA 4Y6GA 4FNUA 2JE8A 1Z32X 3GW3A 3GSMA 3GAYA 4D6HA 1PJ9A 3F5KA 1QXLA 3PZ9A 3MJMA 3OEXA 5I09A 1A50A 4PTNA 1KFKA 3UZJA 1A5SA 5BXTA 3WBWA 3M43A 3N4EA 4PN2A 2V30A 3Q2DA 3CUFA 4GG9A 4TX6A 5G1YA 4D6FA 3EOEA 2FIQA 1RA5A 4ZO6A 3NSXA 3B0PA 3TJLA 5A95A 4W8LA 3UCQA 3QVQA 2CHOA 2GUBA 5U7SA 3N2MA 3MWCA 4YYCA 3VTRA 2DSUA 2W92A 5ENLA 3HQ1A 1DQWA 1JF6A 4PGLA 3W2UA 4MJMA 5DMNA 3NEVA 4B5SA 1PZ2A 3DK8A 2NUYA 1W2VA 1Q4NX 3L2IA 3WQ6A 3O3RA 4XSLA 3LBMA 3MI2A 3S2NA 2X0SA 1H1YA 1CB2A 3IRSA 3ARXA 1LG2A 1MO9A 4IPIA 1VFLA 3EB2A 4LVFA 2WQPA 3B9EA 2O9OA 2I57A 3SDOA 4HOWA 5KTLA 4NZ4A 5C2CA 1TPEA 2V82A 3V5FA 5BU6A 2PDBA 1FX6A 4TR9A 1H3GA 3UYCA 4DJFC 5D8ZA 1EPVA 4HHHA 2ODOA 4UTMA 3UCDA 1TSIA 2OFJA 4GYJA 5C55A 4W4QA 4HMDA 5I2UA 3MMDA 4IFRA 4GUHA 3AZRA 1E6RA 3CZLA 1EWEA 2CESA 4D2JA 4L65A 5HWJA 3MP5A 5LZLA 4US6A 2E5CA 4M19A 1UG6A 4HHPA 1W37A 3GNDA 9XIAA 4BQ2A 4D6CA 4DAIA 1TKKA 1B3XA 1MQRA 2GSEA 3EAUA 5D2YA 4O53A 4IGHA 5JH2A 4H7VA 3E6EA 5HNTA 1OX4B 2ZXDA 3L2MA 2JF7A 3BW3A 2WNWA 4JTRA 1GOXA 2R6OA 1FKWA 4I9MA 1X7FA 5CSRA 1XIMA 2ESCA 3WQGA 3WG6A 1Q63A 1X8CA 4GY0A 2WM1A 5D33A 5DMLA 4TU1A 2GDUA 4AD3A 1NDZA 2QCLA 4MGGA 1CGXA 1I75A 1YTKA 2ZCGA 2VX7A 3R8GA 1UD5A 3O63A 3L5MA 4RNFA 2REQB 3W1AA 4PCPA 5K4ZA 3L5LA 4FI4A 2QJJA 3UWZA 5G4WA 3URBA 3CV6A 3IJQA 1F3XA 2VCCA 4UFKA 3KLJA 3NFUA 3OVRA 1ITXA 5A6KA 1EUAA 1MMFA 4Y8EA 4JKKA 1PSCA 2BY0A 1CWYA 4ERAA 2CHRA 1JDAA 3GXDA 3CT2A 3SIMA 5PTDA 2VRQA 3WN6A 4JY9A 1W5MA 1UPMB 4E38A 1OZMA 3TR2A 3SCQA 4J3SA 4LS0A 4J3TA 3VMNA 2QDHA 1YQZA 4AXKA 3B03A 3WMCA 1V7AA 4MMWA 2ZWZA 3P84A 1LOSA 2HK1A 1Q2SA 5HJYA 3WSUA 3TN4A 4DUWA 3NRZB 3ZT7A 1D8WA 1V3IA 4DPPA 3C61A 3GG8A 4ML4A 3HF3A 2Q8XA 3P5YA 4L5ZA 3VOIA 3N73A 4O8RA 4MLRA 3RO8A 1WXJA 3CGTA 3QR3A 5EFFA 3LUTA 3WL1A 1C7SA 3OLEA 4XKMA 2A2IA 1HJQA 2G3JA 2BY2A 3PZMA 4GBUA 3FFSA 3VAVA 1G4EA 3A7AA 2HRWA 4CUCA 4UMBA 3G1XA 2BX7A 3PR2A 4AMCA 1MO0A 3NOYA 1D7FA 3NZQA 3PSWA 1FEAA 2AGKA 4GIYA 5HMSA 2PSNA 3GNPA 4IISA 3RM8A 5D04C 2UWFA 1DXEA 1NF0A 1SO6A 4XD6A 1F3WA 3H26A 4CCZA 4W5ZA 1KTBA 3AMKA 4PUDA 3PTKA 1AW1A 1MSSA 3LRLA 1W3NA 2HE5A 3KE0A 4L6OA 5DO8A 4Z1CA 2V5JA 4AC7C 4KCTA 2MANA 3UZZA 3QQWA 4DWSB 2VZTA 1W54A 1H51A 1OFDA 3P74A 2GWGA 1T6MA 1BTCA 5LIXX 4PMQA 1UP2A 1R8LA 4YCOA 1LORA 3VNDA 4A8RA 4WXZA 4JGDA 4QCFA 5AC7A 1ODUA 3G1SA 3N12A 3ANVA 3H6OA 3GFXA 3BJSA 2G37A 5H2ZA 1R3YA 2EGZA 1P0DA 4RNJA 3DI0A 3ZOAA 4L9XA 4HYVA 2XJ7A 3BICA 2D1ZA 2CXEA 5JCKA 2VJXA 4EPEC 3MV11 3QV7A 3MSDA 2CLMA 4NAEA 1QI4A 4O1DA 4Z2JA 2OWXA 3E38A 1E6XM 1H41A 1A4LA 1HJVA 4GXPA 4RE2A 3LBOA 1VGAA 4QBXA 3LADA 3WLTA 4R53A 5A6SA 3WJZA 4XZMX 4B5UA 4B3KA 2BGQA 1QHOA 1QBAA 1B0IA 1XINA 1E0VA 3OG2A 4JX4A 3W1NA 3ZIZA 1KWGA 4W8AA 3VKJA 1GJPA 1CB7B 3F2CA 1CTNA 5FJJA 4H7CA 4B16A 4XBSA 2FQIA 5FCZA 4PL1A 3CYJA 1XLIA 3UA4A 1MRAA 3ATZA 2UY2A 4UQCA 4H83A 1FXPA 4LRTA 2IXVA 1Q45A 5HA7A 1VCFA 1VFSA 1KRMA 3EEZA 1JRCA 4C1NB 3IJLA 2NT0A 1YE4A 4F0KA 1DJYA 1ICSA 4BWLA 3BOFA 3E0VA 2A3BA 2HQMA 1L6YA 2WHMA 3AHVA 4LB4A 4O1EA 1R46A 5FESA 1XGDA 4POCA 4UOQA 2NW0A 2ZDSA 1JXKA 1QNSA 5I6SA 5C7HA 3CGDA 2GSJA 4AZBA 2WOIA 4U3CA 5AC6A 4KH2A 3W01A 2OCZA 3W07A 1Q6LA 3MZ2A 2YDAA 3QSTA 1KBJA 4UTHA 1NDYA 2YCKX 4MIMA 3WNOA 3NZPA 1J2BA 1HX0A 2ZZ0A 2CKSA 3TONA 4E4UA 1X6NA 1L2QA 2OPJA 1UWSA 3TDFA 4DRSA 3DBPA 3S1GA 4B5NA 2YVFA 1XRFA 1HJUA 3LLXA 3NVYB 1XUZA 1FKXA 4QS5A 1XKJA 1QPRA 1QJWA 2W3ZA 3GWQA 4KCWA 4ZB5A 1GHRA 1SGJA 2OO6A 5DCDA 1PTGA 1HJSA 2VRKA 3WQDA 2PDGA 5F1UA 4G5DA 4FEZA 3AHYA 2Z1KA 3MO7A 4A2RA 2POZA 4DNAA 4KFOA 1EOMA 4ZSTA 3MBDA 3PC0A 1CXEA 3SR6B 3IGUA 1MXDA 1EL3A 3QOKA 3VOGA 3OG3A 1FDJA 3SQLA 1NY1A 1C9DA 2WJDA 1WCGA 4FR1A 1XYBA 4D6DA 1LZOA 2YCLB 4M56A 4OFCA 5CG0A 2E9LA 5G2WA 2YQUA 3EXSA 3KRBA 1QPKA 1UR3M 4LB3A 4XWUA 1EYWA 2QVNA 1GETA 2V3DA 3U7BA 4HOZA 1KBLA 5I3FA 3GVRA 3BH4A 2R14A 2OWCA 2CFFA 3P80A 4G7EA 2PLJA 4NEWA 1CW2A 3P6LA 1EYEA 4PULA 4UTTC 3EWWA 4XSMA 1MFUA 1YPIA 4DM2A 4H9YA 3PPCA 2VR5A 1YW1A 1PX3A 1ME9A 4DXVA 5F2LA 5A8GA 1E6QM 1LF1A 3QV6A 4RXFA 4G8TA 3RN6A 1ADSA 4GYPA 1JCLA 1TE1A 2DT0A 5CCZA 1G9HA 2OQYA 2Y62A 3VCCA 4AZCB 1ZHAA 5FEWA 1O6IA 2I9EA 3QR1A 3WK0A 3MW7A 5JH1A 1H7OA 1WX0A 4C5YA 1ZX9A 2NV1A 2DZAA 2Q8LA 4S3KA 1IIGA 4FXFA 4H1ZA 2PLKA 4PBEA 2YPIA 3UG3A 5TIMA 4E4PA 3LLDA 4YTRA 3GXNA 3B3DA 4JYEA 4DO4A 4LANA 3AS0A 3STGA 4GISA 2Y4SA 3OGVA 3ZT5A 4KERA 1TE6A 2OX1A 2ZQ0A 1DBTA 3OLDA 4IIGA 4AZIA 3E0WA 5FF2A 3ZVHA 2QCMA 3GH7A 1OFAA 1TPB1 3TQ0A 3SRKA 3VDHA 4LUTB 4QS6A 4FALA 3TP4A 2WNZA 2UV8G 2CCRA 1FWGC 3O05A 5I3DA 3GBDA 4N42A 1H4PA 1BWLA 3PPGA 4AY8A 4OGZA 5IM51 2YBTA 3A7UA 2FB3A 1XYLA 4KBXA 3IIOA 4DLFA 2QCDB 1J79A 1SZNA 4N6EA 5HNUA 3VM5A 4MNMA 3EDKA 3PJTA 1FCBA 4C6IA 1Q85A 4Z2LA 1BWCA 2E9BA 3VGDA 2CKRA 3AHZA 2DIEA 1I0DA 2PBGA 4LF1A 1HIZA 4P7NA 5FF3A 3LG3A 2JKAA 4UBPC 2JK2A 3WIJA 1RP8A 5HPOA 2V2DA 3GM8A 5LHEA 3LA4A 1JZ5A 2ZZ5A 4GJ1A 3WQEA 1WZLA 3PWGA 3MCMA 1E5JA 4EM4A 1RQBA 1KD0A 4DJEA 3DFYA 3KBSA 1XDLA 3SAZA 2X8RA 2GYIA 2NVKX 2NXHA 2DW7A 2VEKA 2H90A 2ALDA 1AH3A 1VJSA 1HL9A 1BFNA 3QC0A 3TNOA 5IBXA 4JTQA 2OLAA 1R9XA 1XIGA 1DIKA 5ABFA 4LUIA 4NUWA 3WMBA 3F4WA 4MJ4A 1XDJA 3P82A 4KESA 2GDQA 3KHDA 3HGOA 1F5ZA 3CXOA 3R79A 3OZOA 1DQUA 3KBJA 3V75A 5HATA 1HQTA 1XCFA 4U2ZA 1JI2A 4REQA 4CCCA 4UFMA 3DFTA 1Q6CA 3ZVIA 4LUSB 3GDMA 3I3DA 4RW5A 2W61A 3WQFA 4PUMA 1ZAHA 4AY1A 1HZYA 2NQJA 2BXYA 2OT1A 4R7OA 5RUBA 5AHNA 1DJHA 2VO5A 3E5PA 3SJ3A 2E1DA 1PS9A 3LRKA 5AVHA 3OVPA 4K68A 3HGJA 3BCFA 1RH9A 3HPXA 5E1QA 3CQHA 3UZWA 3W84A 2ISWA 4XX6A 1YIXA 4LBSA 1TREA 1E4NA 2D20A 3QLDA 4JXCA 4A3QA 2OJPA 1W1ZA 4H4UA 1KC7A 3CWOX 3ALFA 3AU6A 5EBKA 3EKGA 3Q67A 2E40A 3URQA 1V3LA 1U2YA 4J40A 2BY3A 1BZLA 1DWHM 2YB4A 3GRIA 3TYZA 1ZSXA 3F03K 3VA8A 2QF8A 3KLLA 4H6EA 1JI1A 1KR0A 2GOKA 1H7WA 5CBJA 5HNRA 3IVSA 4FR6A 2YL8A 4Q6JA 2CWXA 2XIMA 4MDOA 2X1TA 3ABQA 1X2GA 3VIIA 3B05A 2BS9A 3A4AA 2YCEA 4OT7A 5DY3A 3W26A 2QULA 4FHAA 1KFBA 2E68A 1R6WA 4L6DA 3SADA 1YBQA 4OV4A 2ZX7A 3P93A 4FLSA 2DW6A 4DYKA 4OUIA 3WDRA 4HYRA 1P1MA 1E0WA 3URHA 1FCVA 4BS0A 1MI3A 3I7SA 2DV0A 4YYFA 3A21A 5DELA 3DGRA 2J77A 4K39A 4CD6A 4CN1A 1XLMA 1R85A 1ADDA 4PEEA 3B9JB 4Q8QA 2OEJA 4WDWA 3N15A 3FJ4A 3CB3A 1WKFA 3UVAA 2YW4A 2WW5A 3AYRA 3O6YX 5I07A 7REQB 4RCXA 1EIBA 4KETA 5LGXA 3PK7A 3W27A 4NIRA 2XVPA 2ZX6A 1WKYA 1TUFA 2DVUA 4J1OA 2RUSA 4AIBA 2EXOA 1JDDA 1V3JA 1Z44A 3VCNA 4O1FA 4L80A 1NQKA 2ACUA 3ONCA 4ZL1A 3WDJA 1EDTA 1LM1A 4QROA 1TRIA 3QKEA 4ZO7A 2GK1B 2X2GA 3D47A 4A2SA 3BMXA 3FJLA 4DPQA 1S7MA 2A0NA 2FTPA 4XVEA 1HW6A 3E0LA 4R34A 3NZ1A 2J8GA 2ZUTA 1W3IA 2QXWA 3ABSA 3W1MA 5G5GB 3S83A 4TVDA 3WUFA 1NWRA 1TPDA 1US3A 2ZTJA 2XFFA 3MUCA 1TG7A 1AD1A 3R58A 3R89A 3EXRA 3B4YA 4B5VA 4PZVA 4DF0A 1K9TA 3BQ5A 2W9MA 2Y8VA 2O9TA 4UFLA 2VKZG 5GPRA 3ARZA 2XWEA 3T0BA 3IVUA 3KRUA 3SBFA 2OQLA 1XGEA 4GRSA 4INFA 2TODA 4X9SA 2C0AA 3CUGA 4YL2A 1VBJA 1IXPA 1CXIA 2PDXA 5T9BG 1UBSA 4BWLC 4O18A 2EJAA 1ESWA 1JG9A 3KBMA 3SZ8A 4C7GA 5DMMA 1CI1A 2ZZ6A 2NV9A 3RX2A 1TTQA 6REQA 1BKHA 3K46A 4TMBA 3T9PA 4NT0A 2NQZA 1V08A 3QHMA 2JIWA 2OR2A 4GIRA 4LVAA 5HMFA 1NJJA 4HSHA 1H11A 3U2ZA 1WKDA 1ISWA 5CGQA 4FX7A 3BC9A 4APNA 4ICMA 1U1HA 4B2DA 1TA3B 3CHDA 1BEUA 4GK8A 1CX9A 1OCNA 3OBEA 3QFBA 3AXXA 3IVTA 2NQLA 2BNJA 2YXOA 3CGEA 3PBVA 4AVFA 3TMQA 2DT3A 4J5NA 5HQMA 1LT8A 2PDWA 3MBFA 4C60A 3XINA 1H49A 4Z1DA 4F0SA 5CZTA 3W1RA 1B4KA 1WUEA 2WZIA 4C90A 2G3NA 3GKFA 1A53A 4UIOA 4WDTA 5CQ1A 3NSMA 1VFOA 4YWIA 4DX3A 1H09A 1ISZA 5KITA 2V3FA 4J2MA 4I5XA 5BW6A 2R1PA 2IQ0A 3DYMA 2Q09A 5DY2A 4UTUA 2NWSA 4PB5A 2OOFA 3LGEA 1L6SA 3W7CA 3GDRA 4PUWA 3FNDA 1E0TA 4EPBC 4OIFA 3BGAA 4L64A 4CNUA 4KIEA 2C71A 3B9AA 3RF9A 4C1LA 2WZEA 2JEQA 2D22A 4JTHA 2HQAA 3FXYA 3ZLFA 1ML1A 2J25A 2QW5A 1LWJA 3QC3A 5G5HB 1UA3A 2J74A 3S1VA 4WHBA 4C6DA 1D3CA 5LXEA 2BLEA 4G1KA 3BSMA 2KX9A 2VVSA 4RZ6A 3PNUA 1FCUA 2QLYA 4GYPC 4OOUA 3TE9A 3T07A 4W9TA 3ALGA 2V5LA 1Q65A 3GC4A 5I24A 2FDSA 5FJUA 3UWYA 4B92A 4PB3A 1YEYA 1E1FA 3QBUA 4PE8A 4GC4A 1GG1A 2R1MA 2VNCA 1JQXA 2P10A 4H00A 3W70A 4QG9A 1W9BM 1VIZA 3AIEA 2WP5A 4GRTA 4DBEA 4WD0A 5IDIA 3CUZA 4UQDA 3L0KA 3WLJA 1NEYA 3QGKC 4X9YA 1KV8A 3ANYA 2FMOA 4H6QA 1O5RA 3LHTA 4P2VA 4XKYA 3VKCA 3FX4A 5LIWX 2J8FA 1VQZA 5I3HA 1ITCA 1DE5A 2VR4A 2EKGA 3LTSA 4FSAA 4XAPA 4FIRA 3AIVA 4UFIA 4DBWA 3FLUA 4PMUA 4I3GA 3NEHA 1J5TA 1DJNA 4QE4A 5EYWA 4RZ4A 3P61A 2E67A 4MZ8A 1F2JA 1OFEA 1R3QA 4RK8A 5HK4A 3UWEA 1FWCC 3F2DA 4ECLA 1A3XA 3DG6A 5LA2A 2E3ZA 1OK4A 4GQGA 4KWOA 3QMSA 3O07A 2NVCA 1ZJIA 2FPTA 1SR9A 1G7VA 2Z25A 1QAPA 3DHUA 3ANUA 3A13A 3LNMA 4JNZA 1VLWA 4PMOA 1V79A 5EKYA 3ZT6A 3LM3A 4UTIA 4TX8A 2PI6A 4D9PA 1VCGA 1BYCA 3GG1A 4ZQMA 2DUZA 5JVLA 2J4GA 4Q8UA 1IEQA 4DXKA 1XLKA 4G1NA 5M17A 1JZ8A 5AHFA 1N60C 2YLAA 3OB8A 2W63A 1FBAA 1UB3A 2C3CA 3IUHA 2WMJA 3GXTA 1GEHA 3N3MA 4V15A 4DJEC 3GVWA 1W32A 1DJQA 2WB5A 4I7WA 3CV2A 3FN9A 3TAKA 4FOKA 1BKSA 1JAKA 1PKYA 4IQLA 1DWFM 2EG8A 1XLEA 2G4FA 1T96A 5L6UA 4RW3A 1JPIA 1DPMA 3QKZA 1PHWA 3ITYA 1RZMA 5A6MA 3KXQA 5B7YA 5AB3A 1IGSA 4U10A 3VNLA 1EO5A 5HMDA 3R6IA 4AEFA 6TIMA 4LCQA 4X3ZA 1JEHA 1E9IA 2QCCA 4H8NA 3CEUA 3S8HA 4HVXA 3R8RA 2GR1A 5BXRA 4DBUA 4NXSA 1OM0A 3ABOA 3K30A 3AALA 3L0GA 4JTSA 1G7UA 3CHEA 2DZWA 3HU7A 4UUIA 1JYXA 5F7UA 1N5XA 3AYVA 4UXDA 2QHAA 1EOKA 2G0WA 3MUIA 3TIMA 2WJZA 1F4AA 1B54A 2NSOA 5A2BA 3LBCA 3QQ1A 2XVGA 3THCA 1OD0A 1XC4A 4NU7A 2NSXA 3WK2A 2H8ZA 3SN1A 4GGHA 1GNXA 4HZMA 1YPFA 1FFVC 1Q1RA 4EP8C 2V2CA 4W8BA 1TELA 2ZZ4A 3GAKA 3W1PA 3S5YA 3M0ZA 1RV8A 1X1ZA 3HGRA 3T2OA 1YKWA 4KWSA 2BZNA 1RY8A 1L2UA 4MY8A 2KAUC 4KPRA 1SVDA 2OYKA 3LQGA 4ACZA 3OGSA 2ZZBA 2X0HA 1T8XA 3HB9A 1V7YA 3MV01 2P5NA 4OTKA 1FUYA 2RDWA 1EX5A 5CJ5A 4Z1YA 1UCWA 3PFMA 4ONVA 3SFKA 1IT8A 1M7XA 4A8LA 2PWGA 4M51A 4MB1A 2VC9A 4AX7A 3ZYZA 1GK8A 2JIEA 3I7RA 5KZDA 3OQ8A 3THDA 3UGVA 1EA0A 5BROA 1GKPA 3C2OA 3WFAA 5C8BB 3THAA 4I7UA 4QQUA 3TCSA 4QISA 1LT7A 1J6OA 4M6PA 3XIMA 1J0JA 1HUVA 2XFWA 3ARTA 5DEZA 3CS2A 5LIYX 4M29A 3GVGA 4S39A 3S9ZA 2X2YA 2C19A 3MB9A 3UYIA 1BXBA 3LV5A 4AD2A 1XYMA 3MMWA 5EMUA 3VGBA 1U5HA 3OOQA 4HPJA 4UFHA 4XD5A 4GLEA 3PS7A 5XINA 3IEBA 4HT3A 4AY7A 5DMYA 3VYLA 5HNNA 3JRKA 1DHPA 1TPVA 3VZZA 2CLPA 3N18A 4JYFA 4YIWA 2GVYA 3BVJA 3H2OA 3DECA 1S5TA 1FEBA 4KIRA 1UH2A 1GG0A 3GH4A 4F3HA 1CXLA 4UNKA 4H2CA 4J3XA 4KRUA 1E55A 3EAOA 3AAMA 1MWOA 3N2BA 2ZKMX 4Z08A 2C3ZA 3EOOA 4ZSUA 4CD4A 1ZGDA 1I2PA 1B2YA 1L6WA 1JCTA 3HPZA 1XH2A 4LY4A 2C16A 3HFTA 4JCMA 2NQHA 4Z1BA 1PKLA 4BA0A 1RXOB 2YJQA 4F66A 4W93A 5B80A 1LRNA 2A3AA 2VHLA 2YL9A 3P0WA 3C2FA 1AG1O 4LTSA 2PCQA 2E6FA 4HSOA 1NP0A 1WZKA 2VRJA 4S3EA 1DQXA 3OA3A 4KEVA 1ZCCA 2Y7DA 3G1DA 3TN6A 1N5WC 1IEXA 2WMGA 3LOTA 2ZA2A 2C8NA 2PRMA 3H22A 3ITXA 2C7FA 4A22A 2GQ9A 3APGA 1UKSA 1ITUA 3IIPA 4F2TA 1V02A 2F2HA 1Q8AA 1UP0A 4HB7A 4W7VA 4HNVA 3UR7A 1JRPA 4OWGA 5BMXA 5EL1A 4XZLX 3UNTA 2X0YA 8RUCA 3E2SA 3LERA 1UKQA 2PDNA 4NVTA 4JHMA 4Z42C 4UMCA 1XLAA 2ZC8A 1V6XA 1XX1A 4OUEA 8A3HA 4C6KA 3M5XA 1SO4A 3BLKA 2W55A 1SFSA 2DDXA 3OODA 1POJA 1UH3A 5FJTA 3VVGA 3RRAA 3ENLA 4O17A 2D2JA 4Z17A 3UXLA 5HPCA 2NV2A 3JZUA 4NF7A 2WP6A 5A8NA 4FDCB 3NQDA 5FMHA 3UY7A 3HA1A 1E5NA 3SM0A 1KRAC 1LYXA 1C3FA 3OZYA 4MPKA 1ICPA 5C2GA 5LSMA 1XV8A 3UJRA 5EGRA 1NVMA 4LOCA 4ROPA 3A5FA 2EG7A 3QZEA 3U8GA 3HW2A 2GVEA 2I16A 1VLIA 5CC5A 4N02A 3M07A 1ECQA 3RJYA 3M0MA 3DERA 4MZ1A 4L61A 1HKMA 3AMCA 3GHUA 4X0NA 1TV7A 2A7PA 3L12A 1J0HA 1R38A 4TO8A 5BZAA 2Z00A 4ZOEA 1VFHA 3DENA 3RO6A 2VFDA 1PWLA 3OHIA 2XFYA 1MQPA 3W22A 1BSLA 4KKXA 4AG0A 1EO7A 1XLDA 1H0IA 1ME7A 1JR1A 3PZTA 3RPTA 1GTEA 3BJFA 4WDXA 3BAYA 5TD4A 4HP5A 3PVFA 2IW0A 4CD7A 2A5HA 3OYXA 5D32A 4FP1A 4GX9A 4JTIA 3BMVA 1LCOA 3CTTA 5CGTA 1JCMP 4GIAA 2FTWA 5DRIA 1Y5VA 3IARA 3MHGA 1E4LA 3QV8A 2TPRA 5K7JA 1SM9A 4DF2A 4MF4A 2VDGA 4LT9A 2DEPA 1FHVA 3KS5A 3PB0A 1G69A 4JYDA 3LSCA 1REQB 1V02E 4UTLA 1P6CA 1HJWA 3AN1A 3WDIA 3TJXA 3WLQA 2WMKA 1L8PA 1JFHA 1KLZA 1JOAA 4ZEPA 2WHKA 3K8MA 3MKKA 1OFOA 3MVTA 1S1RA 4HSNA 3L5AA 1EBDA 5MHBA 1UR0A 2EEXA 2WC3A 1ZALA 4MTVA 1M53A 4JS3A 3NPWA 2TAAA 2FLIA 1LG1A 1R7OA 3GZ3A 3W74A 3LZ5A 3RCMA 4J3WA 5D4YA 3BG9A 4IIHA 1Z6KA 3NQAA 1V97A 4IIEA 3CL8A 1RVKA 1D7KA 3MO4A 2EF9A 1XKYA 1OX4A 3WD2A 1EQPA 1JL8A 4GY7A 3R2GA 3T55A 3F5LA 3HBLA 2CFYA 4JKLA 3REQB 1TR9A 4PRWA 2JALA 1VYPX 3W00A 3DGHA 1TZZA 2XIQA 1Q4WA 3Q37A 2L5HA 1XLGA 2AL2B 2X8HA 3QTPA 3LS9A 4R7WA 3NSNA 2GJXB 2CLLA 3NQ8A 1UD6A 1JAEA 2QCNA 5ECUA 1RLDA 2REQA 4U4MA 1ODZA 4DJDA 5IFPA 2A3EA 4DN1A 1DJWA 3LGDA 1QPNA 5CXPA 2A1YA 2XISA 2Q3RA 3SQMA 3W1XA 3SN4A 3OLGA 4RZ5A 1O60A 3CMFA 1ZXIC 4P7LA 1AL8A 3L23A 1GKQA 1XYCA 1QWGA 5CLTA 3HURA 3QPZA 3D9XA 1FDYA 1K3UA 4CQ8A 5IHSA 1FP9A 3QH2A 3EX4A 4R9XA 1I2QA 5C5YA 4JY8A 4P8VA 4DYEA 2C3DA 1UZDA 5JCIA 4HU0A 3RNDA 4HPGA 1ENUA 2PWVA 3ZSTA 3TJ4A 5I02A 1KTCA 1KLYA 1OX5A 4AAJA 1YDNA 3ITOA 1NOUA 1X38A 4K1GA 2TMDA 1UKPA 1VDVA 2GL5A 4JFSA 2YIHA 4R7JA 3ARUA 1YNPA 3CM4A 1LOLA 1W1VA 4L7ZA 3L4XA 3ITLA 3KBVA 4WX2A 3NAVA 1UBPC 2QAEA 1P7TB 5JBDA 3CZEA 3C0QA 3NGJA 1FWHC 4HA0A 2VCBA 3VNMA 5D09A 4Q7IA 3GO2A 2ZZCA 3R12A 5M5DA 1PUDA 1VENA 1ZAIA 5KZEA 3WLIA 3APTA 6PTDA 3QY7A 1EXBA 2PE4A 4F0MA 2Z1SA 2QJNA 1KNWA 2O7SA 5F1VA 1KCKA 1IEVA 1J6PA 4LCSA 4IM4A 1J0ZA 1M6JA 5D9NA 4EWND 1PWMA 1O5QA 1Y5XA 3GYCA 3NA8A 3MSGA 2J7CA 4CN6A 4PR4A 5DN1A 3U2OA 5EB8A 4O11A 3R8HA 3NURA 2MNRA 2VUYA 1R2SA 5A8QA 5TR3A 1IZJA 1JDCA 4MLJA 1S2VA 2WKLA 4Q4SA 3AXMA 2VUNA 2J9XA 4N9DA 4DWSA 8TIMA 2PU0A 3IK2A 2YFOA 4QDMA 4XIMA 5CPLA 4EF9A 3GVQA 2CZVA 3IUIA 3MP4A 4ES4A 2BC1A 5LNVA 1FWNA 4K7ZA 4HIBA 3OPSA 5H1WA 1V3HA 4NNCA 3G1YA 4EXBA 4U3AA 2QKFA 3LQLA 3T09A 5DF0A 1W9DM 2CZ5A 2JQXA 1XCXA 3PZQA 1I60A 5DT7A 5G2HA 4O16A 5CPMA 1XSJA 3GG7A 3MPGA 4N9CA 4LAMA 4PMNA 3G77A 2PDPA 4HA3A 3V1HA 1VPXA 4GC3A 1W3JA 1KN0A 4RDWA 1B57A 4EVZA 1J18A 2PDHA 1G01A 2QNEA 1C7TA 3CZKA 3W7MA 1MQQA 4YN5A 4PCTA 1Z3NA 1KBIA 4I6KA 3QGVA 1I45A 3T0DA 3EOSA 1W8SA 1GQKA 2QJIA 3TLQA 1E9ZB 2P8BA 5A5WA 1BGGA 3NZGA 2XSXA 4DF1A 1IXQA 1VBUA 2PF8A 1F9CA 1ADOA 2P3EA 4LCRA 3GY1A 5F4SA 2J75A 1AZ1A 3UG8A 2TSYA 4AF0B 3WQ4A 3I10A 1N63C 1ZU8A 4MPQA 1RY0A 3W7DA 4W5UA 1V93A 2A7NA 3P14A 4QQ3A 3UWWA 4Z0SA 1FFUC 1XD0A 2CHNA 4C1NA 4PTDA 3WX7A 2YXXA 4BKNA 4LFYA 3SCTA 2I1OA 2WK2A 3LI0A 3S2MA 2CETA 3KEHA 3KTCA 4XQ6A 2J88A 4IICA 2DSZA 4M0XA 3UR2A 3V0SA 3TWBA 3VI2A 1C8XA 4BR1A 2Z28A 1UPPA 2VGFA 1K03A 5T8GA 1GVIA 4UFJA 1GVFA 5AC4A 2FKPA 4AWSA 3PBYA 3C2RA 1WDPA 1F76A 2DZXA 4C6BA 4MFEA 3U5YA 1TV8A 2ZZ3A 1BHGA 3F7JA 3H4GA 2PTWA 3MVIA 1LUCA 5C71A 1GOOA 1RD6A 3DESA 1VB9A 4G7FA 3RFAA 3RGTA 1W17A 5HINA 4N4PA 4Z2IA 4B90A 4MUPA 3T6CA 1A0EA 1JDFA 3L4ZA 1PIFA 1H62A 2HROA 2PFHA 1XBVA 3MJYA 3P8JA 5C9XA 4L4PA 1J93A 4D71A 2H6RA 3AMDA 4Y9AA 5CZJA 3UR8A 2J3NA 4HA4A 4A3HA 2Z2AA 4PBGA 4YTUA 7PTDA 5C9WA 1GONA 1HTIA 5E0KA 1XC6A 2WZMA 1OY0A 1H50A 1U1JA 3DG3A 2E4TA 2NUXA 2VVNA 4PBFA 2EPLX 3L0NA 4I5UA 2YCLA 3NM3A 5LYRA 4FNPA 1V5XA 2E9MA 3EOUA 4MB3A 1BYBA 1CLKA 1V0KA 4JDYA 2BG5A 1T7LA 3TTQA 1WA3A 3WH9A 4IG2B 1GHSA 1UWAA 3WF4A 2Z1XA 3S2CA 5A6TC 4K8GA 3OQEA 2E6AA 1OT2A 2YYTA 1OC7A 3K5XA 1DE6A 1BAGA 4UTKA 3IGXA 3AI0A 1YTEA 4US5D 2PDLA 4N4QA 5G1MA 4YS1A 3B8SA 5ABTA 6ENLA 1UZHA 2CITA 3IS4A 2VOTA 4OQVA 1A5CA 5AYBA 3C4UA 4RZBA 3VILA 2PMQA 3EB3A 3TSMA 2NPXA 3SURA 3F4VA 1MUCA 2ATSA 2ZICA 5KSWA 4ZB0A 3ID7A 2BBFA 4GXMA 3HG5A 4HJWA 2NVDA 4X2RA 2A3CA 1EKOA 3TA6A 5HQLA 3VCRA 3M9YA 4P7QA 2A6LA 3BAIA 4GH3A 1F4HA 1W2PA 4B15A 4TX9A 3V1PA 1PYMA 1DJGA 5D37A 3KOWA 4LAZA 1GVRA 1GGOA 2NLYA 3EEGA 2CU0A 2UY3A 1TX2A 1BQCA 4OU1A 4IMCA 3KFTA 1UR4A 3K4WA 2RFGA 2OSYA 4IMGA 1OK6A 3A12A 1E4IA 2BFGA 1CGWA 4HTYA 1BXNA 1TWDA 2DH2A 3ONBA 3FYPA 3O2LA 2FVLA 1GRGA 4Q33A 1Q13A 4Q8TA 1CZ1A 2HCVA 4LUTA 3N17A 1JEZA 1BG9A 1QOQA 2Y2WA 4NEVA 4UCFA 5I3KA 3CHFA 4BEUA 1VF8A 1JULA 3NVTA 2W5FA 1WBHA 3WH7A 1I4NA 2WLZA 1AL7A 1K70A