3RGTA

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with d-arabinohydroxamate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
403
structure length
383
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of d-mannonate dehydratase from Chromohalobacter salexigens complexed with d-arabinohydroxamate
rcsb
source organism Chromohalobacter salexigens
molecule tags Lyase
molecule keywords D-mannonate dehydratase
total genus 141
structure length 383
sequence length 403
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2011-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3rgtA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3rgtA01
3EKGA 4M6UA 2QDEA 2AL2A 2CHRA 3MKCA 2O56A 3S47A 5FJOA 2GGHA 3FV9A 2MUCA 2FKPA 3TW9A 3BSMA 3TQPA 1DTNA 4E8GA 3QKEA 3ES8A 3R1ZA 4DWDA 4IT1A 4DN1A 4HNCA 2PU0A 2PTXA 3R11A 3P93A 3PWGA 4X2PA 4IL0A 1W6TA 2PMQA 4HCLA 1FHUA 3TCSA 2P0IA 4JN7A 2PTWA 7ENLA 2ZC8A 2AL2B 3TWBA 3Q45A 3MY9A 3ZLGA 2PTYA 3I6TA 4M0XA 4GGBA 3ZVIA 1MDLA 4GFIA 3Q4DA 3UJFA 3UJRA 4DXKA 2PGEA 3DG6A 3TWAA 4DHGA 4MMWA 2GSHA 3CXOA 3N4FA 3ZLHA 1JCTA 2XSXA 3VA8A 4IP5A 4HYRA 3MUCA 4E4UA 3ES7A 4A6GA 4ZCWA 4FI4A 2ONEA 5FJRA 4KT2A 3D46A 4A35A 4ZA0A 4GYPC 3ZVHA 2PGWA 3V4BA 3CAWA 3VCCA 3GY1A 3RRAA 1WUFA 3DIPA 1JPDX 2AKZA 2QJJA 4DX3A 4JHMA 2OZ3A 5FJUA 3OP2A 1EC7A 2OFJA 1ECQA 2OO6A 1P43A 3DESA 2DW7A 2QDDA 4KWSA 3PK7A 4GGHA 2OG9A 2NQLA 3JVAA 4IP4A 4J3ZA 3MSYA 3CB3A 2PP0A 3VFCA 4HPNA 3TTEA 4MKSA 1RVKA 3SN0A 3SJNA 2OX4A 3DG3A 3IJQA 2PA6A 2P88A 3QN3A 3ZVHB 4Z1YA 3VCNA 2P8BA 2HZGA 1BQGA 1EBGA 3T9PA 4E5TA 3STPA 2QVHA 3SN1A 1JPMA 3RITA 1P48A 1L8PA 1NU5A 3FXGA 3R10A 2PSNA 2AKMA 4MGGA 3GO2A 3SQSA 4KPLA 3I6EA 1XPYA 2ZADA 1ELSA 1KKOA 5BOFA 3N6JA 3IJIA 4J1OA 5IDZA 3KUMA 3H70A 3RCYA 3R25A 1MNSA 2XH4A 3P0WA 3DG7A 2OPJA 4HN8A 1NELA 3SBFA 1F9CA 3OW1A 3QPEA 3JW7A 2PU1A 3MQTA 4IL2A 4E4FA 3FCPA 1TKKA 1SJAA 2PPGA 1YEYA 3PWIA 4G8TA 3V5FA 3DDMA 3T8QA 1ONEA 3UJ2A 4GYPA 4A3RA 1R0MA 4ENLA 4YWSA 3NFUA 1OEPA 4G7FA 1JDFA 3DFHA 2PODA 3B97A 3BOXA 3IK4A 2HXUA 2GGGA 3RR1A 1TZZA 3R0KA 1EC9A 3PFRA 3UCCA 3R0UA 1IYXA 2GGJA 2OKTA 3T4WA 3CK5A 4KEMA 2OZ8A 2HNEA 3CYJA 1TE6A 3H7VA 3SN4A 3U4FA 3FVDA 3FYYA 3K1GA 3GC2A 3D47A 4EWJA 4DYEA 4E6MA 3VDGA 2PP3A 3RO6A 1EBHA 2I5QA 2XH7A 1MUCA 2XH2A 4HCDA 1KD0A 1XS2A 4FP1A 3RGTA 4ROPA 1MDRA 4GIRA 3UJEA 1PDZA 2MNRA 3DEQA 1FHVA 1SJCA 2PCEA 4H19A 2QGYA 2GGIA 3MZNA 3I4KA 3UJSA 2OQYA 3GD6A 2OVLA 2DW6A 1EC8A 1SJBA 6ENLA 4H1ZA 3UGVA 3H8AA 1WUEA 3MWCA 5FJPA 3ZLFA 2QJMA 3TJ4A 3OZMA 2GGEA 2GDQA 3DERA 3N4EA 1E9IA 2FYMA 3N6HA 3JZUA 4HNLA 4JN8A 4K1WA 2HXTA 3CT2A 3FJ4A 2POZA 2PTZA 3V5CA 3DFYA 3UCDA 1MRAA 4Z17A 3THUA 4GISA 3T6CA 3DGBA 2RDXA 2PP1A 3EEZA 1KCZA 2P3ZA 2OQHA 3S5SA 5ENLA 3U9IA 3TOYA 5EU9A 3VC5A 1PDYA 1BKHA 2PS2A 3ENLA 4IZGA 1SJDA 3OPSA 3NO1A 3OZYA 4IHCA 2XH0A 3IJLA 4F4RA 3UXKA 5BOEA 1R6WA 3P3BA 3QTPA 4HCHA 4K8GA 2AL1A 2QQ6A 3TJIA 4H2HA 4H83A 2XGZA 5FJTA 1KKRA 2OZTA 3SSZA 3BJSA 4K2SA 3UXLA 3NXLA 3V3WA 4GMEA 2P8CA 5J04A 3HPFA 3QLDA 3VC6A 3H12A 3OTRA 2OLAA 3NZGA 2QJNA 2GL5A
chains in the Genus database with same CATH superfamily
1LUCA 3INPA 7XIMA 4M6UA 2DZWA 2RJGA 3PZGA 3TKFA 1F3XA 3KLJA 1IIGA 4J3TA 2HWGA 1S2UA 2AQOA 3KBSA 3W3OA 4AF0B 4AZBA 4FMVA 5LNRA 1RY8A 3T2QA 3IJ7A 3B0VC 3II1A 1C8QA 4XK2A 1UD5A 3U7VA 2J6XA 4M24A 4UNIA 5AC7A 5EYWA 5FF4A 2GUBA 1Q7MA 3AIVA 1FH7A 5DCEA 1AZ1A 2NLYA 4AMAA 2CHNA 3A23A 1V3KA 1REQB 4E2VA 4KWOA 6REQB 2ZE3A 4TO8A 1A49A 1FFVC 3ZQ9A 1SU5A 1C8YA 2VRJA 2PTYA 1JNDA 4WQ6A 1KM3A 3NURA 1ISZA 3U2CA 1UQYA 4R88A 1Z48A 4LV9A 4C5YA 1Q6EA 1JL8A 4CNPA 1HKKA 3QRHA 1ZL1A 4O53A 2DT0A 5LIUX 4MTVA 2WSQA 1YX1A 3QEZA 4KIEA 1A0DA 4AD5A 2J77A 2YBUA 3AJ7A 1FWDC 2EPLX 3DOPA 1E6RA 2VUYA 4UR7A 2BG5A 3CXOA 2E40A 5CGTA 1WPCA 1JCTA 4BCEA 3WQ8A 1M7PA 1WOAA 1RD5A 3I4EA 1M41A 4H8UA 2WKLA 2GQ3A 5HOSA 1BVNP 2AMXA 3GKFA 4PUDA 1Q5MA 3KFTA 4ZA0A 3O6DA 2GWGA 1QBAA 2R9RA 1YRRA 3MSGA 5CZJA 3BCDA 4NF7A 3RRAA 1FKWA 1NHSA 2V8ZA 2Y62A 2YOCA 5EMMA 5G2HA 1MSSA 2NXGA 2SFPA 4L64A 3PG6A 4E2OA 3ZR4A 1NEYA 2FZMA 3K46A 1N7KA 4EM3A 4GIEA 1A50A 3FW6A 4NJIA 1C9DA 2PRHA 4AC1X 3WBWA 1UKQA 3NQBA 4LCRA 1WYGA 4GG9A 2X7WA 2J75A 2REQB 5EBAA 2ALDA 4GABA 1VFLA 4DNHA 3H23A 5CPSA 1BSLA 4XD6A 2GVYA 1YXCA 3ZVHB 1E0VA 4QEHA 2VR5A 1V59A 3BO9A 5M1TA 2P8BA 1DPMA 1S7MA 4GZ7A 2ZE0A 2OT1A 3GG1A 2WLYA 3XISA 4K37A 1Q6LA 1Q7ZA 1H7RA 1QOQA 1CCWB 4EK7A 2XM1A 3LEPA 2D2JA 3WD0A 2WPEA 1KKOA 1QNRA 4GUIA 5JIPA 1SZGA 2AQVA 4D72A 3OGSA 3VKBA 3NQCA 4B4FA 4OZOA 1JFXA 3SBFA 3CTLA 2I9EA 3OW1A 3B9OA 2XVPA 1VR6A 4NZ1A 2FTPA 4XIMA 1ZXIC 4ZFMA 4PA8A 2ZTJA 1TKKA 5DXYA 5JCLA 4XD3A 5CPNA 4NILA 1TV4A 2ISFA 1SSGA 3VUPA 3UPMA 1I4NA 2E3ZA 1P7TB 1WKDA 3T0AA 3ID7A 3B8SA 1J4EA 2TMDA 2ZZ3A 4FXJA 2QDGA 4MWAA 2VOTA 5D8ZA 2ZX5A 3WJXA 1PAMA 2HE8A 5B7ZA 2X99A 4G7FA 3GR4A 3WNPA 2CLKA 2RDUA 3WH5A 3HMCA 1ITUA 1K03A 2E67A 1L2QA 4NZ5A 3FA5A 1TPEA 1JROA 5ABFA 1D3CA 1IT7A 1TTQA 3H4KA 5I6SA 3VOCA 4L7ZA 4EQRA 2QPSA 3GNNA 1KM2A 2C0HA 3SCOA 1TPUA 3LCGA 1XD1A 5DELA 4ATLA 5I77A 1HNYA 4WGHA 3C61A 2PP3A 4FOJA 2O55A 2PD9A 1LRTA 1HUVA 3VOIA 1HKVA 3QV6A 1PZ3A 2YDAA 1XS2A 3TYUA 1ZMDA 3Q58A 4NP7A 1H62A 4XZWA 3NL2A 4GCAA 1B4KA 1PL9A 4JTHA 4FAMA 5ABFB 4WZHA 4ILSA 1XUUA 2PDBA 3VKDA 2OVLA 4JN6A 4A8RA 1FCBA 4Q7IA 1A80A 5KINA 5FIPA 2FVMA 4FK9A 4FALA 3A9IA 3BWWA 2P50A 5FJPA 3LCHA 3G3DA 1XYBA 1GHSA 3ZLFA 2J66A 2ZDRA 4R33A 3UFYA 3IARA 1VD6A 5F4XA 2QCGA 3QTGA 4DF1A 5LZLA 3QH2A 4JTIA 2NZLA 3BJFA 1QO2A 3G0UA 3DHFA 5DBTA 1DIOA 4U3CA 1WXJA 1DE5A 3P62A 3VD7A 3GDKA 3TN5A 1MNZA 4GJ1A 1J5SA 6TIMA 3VO0A 3QM3A 1GERA 4UTTA 1M53A 2DUAA 5A3HA 1TUXA 2VT0A 2NLIA 1GZ1A 1MRAA 2ZA1A 4Q4MA 3UG4A 3L12A 3OBKA 3N25A 3CLWA 1J6PA 1T8XA 3M1ZA 2V3DA 1L6FA 3F5KA 5E6ZA 1GT8A 1OFDA 4MFEA 3W7MA 3IPWA 5C55A 1NOFA 4DY1A 1QVBA 2VCBA 1QATA 3DYMA 4DVOA 5CPTA 5LYRA 3A7RA 3JRKA 1TIWA 2XJ7A 2KZHA 3GKAA 1YDYA 3AZRA 1ZAHA 2J7GA 1ONXA 3CTTA 1RP9A 3B9JB 3R6IA 2PC8A 1JJKA 5E9AA 3LHVA 1NWRA 4IMEA 1I2NA 4WUIA 3CZGA 4Q8UA 2QCEA 3ZJ7A 7CGTA 4HU4A 2Z0IA 4DWSB 2OLAA 4DYJA 4HSNA 3GFXA 4JFVA 4NAFA 1EUAA 4BFAA 4YTSA 3CU2A 2PAJA 4E0CA 3QV8A 4AY7A 2J74A 3BGAA 3GH4A 4HU8A 3O16A 3S47A 4BF5A 2WZMA 2HCVA 4AEOA 2VEPA 4L6DA 3NVWB 3W6YA 1TJ2A 1KLZA 1W3NA 4ATWA 2B81A 4U10A 3FOKA 5BU6A 3PNZA 4QROA 1CGXA 5FSEC 2OLHA 4HJWA 4DWDA 3W7RA 4DPPA 2ON3A 3C2VA 4I9TA 4F0MA 1R3WA 3VE7A 2J7FA 1BYDA 4S3CA 3GYCA 1GZJA 1DWGM 3ARTA 3KDOA 4UR8A 4Q8MA 3PJXA 2GRTA 4H4VA 3W28A 1E40A 1EDQA 3I6TA 2VL4A 3BLKA 1LJYA 2CKSA 4GRTA 1MUMA 4N9DA 4X60A 3V0UA 1EEPA 8CGTA 1O5KA 4I90A 2OU4A 3SY8A 4JFTA 2BGSA 3WQPA 4AAJA 5C9XA 1FWJC 1TZ9A 3OHMB 3KOYA 1AD4A 2VM8A 1H41A 1KR1A 5DXXA 3G0SA 3KCJA 2WJFA 4QGCA 2ZZCA 3EAOA 2V81A 4HD5A 4CNTA 3ZLHA 5K3VA 1J6OA 3CQJA 4HK5A 1VJZA 2NV1A 3MUCA 1JCYA 2ZCGA 5M3WA 2C1HA 4WCJA 3AO0A 3C56A 3WF1A 3S4TA 4FX8A 5REQA 4F0RA 3EPOA 3ITGA 2YCKX 4JBRA 3H2AA 4GPNA 3UETA 2OR2A 2UWFA 3VNIA 3WUEA 4C6QA 5KZDA 2YYTA 1NF7A 1F6YA 2VFGA 1GOXA 4H6QA 1J79A 4QJ3B 4FHAA 1D8CA 4FPSA 4PMUA 5FF3A 2EEXA 1P43A 2W67A 4WDTA 2WJZA 2DW7A 3E0WA 4KWSA 3S1XA 1Z7AA 1HIZA 1Y5WA 1W0MA 2NQLA 1R2RA 4R34A 1DJXA 3L4UA 3CQIA 1WZMA 3HO8A 2WSPA 3SJNA 1Q13A 4A3QA 2PWFA 4A29A 3M0VA 2J7CA 4S3KA 4KKXA 4A3YA 4AYSA 3RDKA 2A5HA 4IGMA 4ERGA 1WAUA 4E2DA 1ZMCA 3VNMA 1B3XA 1FDYA 1FBAA 4IIEA 4P2VA 5KTLA 1Z8AA 3DXIA 1TA3B 1H09A 4XZNX 2A6NA 1ONFA 4DLFA 3R5EA 3WCZA 1HP4A 4AHQA 1GEUA 2AKMA 4WK9A 5I3HA 3IUDA 3W6LA 5FAGA 2J13A 3EA2A 4AW7A 3P7YA 5I5RA 2F38A 3MCNA 2WVUA 1WQ5A 3EX3A 4K68A 1BWVA 2CXGA 2XFYA 5I03A 4JTFA 3OO2A 2PUZA 4QQUA 1H7WA 1IGSA 4DUXA 2EAWA 1XHGA 2PLCA 2QJIA 3KVLA 2Q02A 4O50A 3NSMA 1OX4A 3S1VA 4IXXA 1KFCA 2H90A 2X2GA 5I00A 1UWQA 3ZJ6A 2E9BA 2ZUNA 4PMOA 4GYPA 1POKA 4Q22A 2Y61A 3GDRA 1TJRA 1UR8A 4A21A 3TFCA 2FMNA 4FNRA 1FWGC 4QLLA 3OGVA 4AZCB 1HKWA 1FUYA 1BG9A 1NPXA 3UY8A 3HM7A 3RLUA 1J12A 5BCAA 1J93A 1WB0A 3H54A 2FH6A 3DC0A 4S3DA 1FWCC 3GDMA 4FX9A 2YA0A 3L23A 2YB1A 3VGGA 3PFMA 1PV8A 1J18A 4AD3A 2WBGA 2WZEA 3I7SA 1TSIA 1KGWA 2F61A 2QUNA 3DFPA 3CUGA 2UY5A 1W17A 1VS1A 2V5DA 3BLOA 1SZRA 5A6TC 4JY8A 1FCQA 4PMZA 2BHUA 5H91A 5BXPA 1FEBA 1GYMA 1T99A 1U5VA 1CECA 2JKEA 3I3DA 3UJSA 1H5VA 1XYLA 2QCMA 4IFKB 3WUGA 2I5GA 4GA8A 3W25A 4M52A 1FXPA 3NVTA 3CZJA 5G4WA 4CEXC 4FIRA 4IQLA 1N63C 1FA2A 3UR5A 3M41A 1UR1A 4EAMA 1GJWA 4NUWA 1YADA 3B8DA 1IXNA 1DE6A 2QCCA 4DB7A 2QIWA 5MKGB 3TXZA 2GDQA 4GC4A 1IXOA 4DZ5A 4DWSD 2ADAA 2NQ9A 2NXIA 3QY6A 1Y0EA 4DNMA 2I7GA 2XGBA 1AJZA 1KB3A 4M1RA 3IAPA 5FS6A 3N6QA 3WNLA 2A3CA 1RCXB 2G8ZA 3RILA 1SZNA 3NCOA 4XISA 2Q3OA 4D6JA 5TAOA 3PJWA 3A9BA 2A7PA 1LT7A 3KOXA 2CWNA 4GY1A 5T8GA 5F2MA 1BHGA 1SFLA 5A6JA 4WJ8A 2JK6A 2RDXA 2XIIA 1IEQA 3WDPP 1CYGA 2PB1A 3SUUA 2E25A 3QF0A 1PDYA 4MB1A 1TYTA 4PBGA 1I9CB 4JX6A 4WX2A 3IIPA 1V7AA 2NUXA 2GR2A 1DXIA 1ITCA 3W9ZA 3AICA 1M7XA 1SYTA 1MQQA 2D3NA 4Q8OA 4K8GA 3EOUA 3EXRA 1MMFA 3NZPA 3LENA 3DFOA 4MFDA 3CQ0A 1Z9AA 1HJSA 4JIPA 1XIGA 2ABAA 3PWAA 2A2IA 3C8FA 5TR3A 4WVXA 4A3UA 5A8MA 1VIWA 2TODA 3AXIA 2GK1A 1XCXA 3VIKA 1OYCA 1N55A 2X8HA 2O7SA 1B3ZA 1JGIA 1VF8A 3DCPA 1UP2A 2R8WA 4MWAB 2IPGA 1Z44A 3TQPA 3NSNA 4W87A 2EO7A 3PNUA 4XWUA 2O9OA 4C6BA 3G6MA 3WZ0E 4NZ4A 2PWHA 3GNDA 4LBSA 2EPNA 1DTUA 5IFPA 3SAZA 3FDKA 2OOGA 2WOVA 2EG6A 4UNKA 2ZA3A 1LG2A 3W24A 1BPLB 3B8UA 4I5RA 3IGSA 3L68A 1T5AA 2IKJA 1XQKA 3OG2A 2G3MA 4ATDA 3FS2A 1IWAA 2HSAA 3MY9A 1QW7A 1ZP3A 1JI1A 2XN1A 1EGZA 2WMIA 4QSFA 3W0KA 1AK5A 3LXDA 1BD0A 3S1UA 2NXHA 4LTSA 2NT1A 4AY8A 2BDQA 3RPMA 1FFQA 1XIMA 2ZFAA 4H7ZA 1W37A 1IT0A 2H9AA 1RBAA 3QPZA 3CYVA 3P74A 4CQDA 5JVLA 5D9PA 4GK8A 3ES7A 4OUEA 1GREA 1OINA 1XFBA 2G4JA 3ZIZA 5CG7A 5D9MA 3WUFA 5A95A 2FZBA 2DUXA 4F9DA 4TMCA 2PF0A 2OYKA 5F7UA 2YL8A 4GYPC 1A5LC 2YYUA 1AH4A 3KEHA 5K2ZA 1LBLA 2WVVB 2QJJA 4MPQA 4JHMA 4MZ1A 4Q6XA 2FGZA 2OFJA 2G97A 3VU2A 1SVDA 3U7BA 5KZMA 3O1NA 2YPIA 3KZSA 3CUJA 4RE0A 5K4XA 2Q71A 4XTDA 2QHAA 2Y8UA 3PK7A 1GG1A 1LOLA 2YFNA 2ZDSA 3CB3A 3VIHA 1H2JA 1K7EA 2NT0A 5HR7A 1ZQ5A 3WELA 1E1CB 1IEXA 2WVSA 3ABQA 3OA3A 2DVXA 4IG2A 1JEZA 4OKDA 1W1B1 2FVLA 4OV9A 3S83A 4ZB2A 4B2DA 1OGSA 2PDQA 4KIRA 1OJTA 2VZTA 2I14A 2IKGA 1E0TA 2C6QA 4AZ7A 3WLKX 3LN3A 1QHOA 2TYSA 2J9ZA 2DIJA 3PB0A 4O0ZA 4C65A 1AVAA 3I6EA 1M68A 3JZEA 3VDBA 4GVIA 4QR6A 2C3ZA 1MNSA 1SMAA 1EUNA 4XAPA 4S3GA 2DVUA 4MLJA 3LXBA 4A3HA 4HNTA 2X1SA 1RH9A 3UZXA 4C6KA 3VIJA 4LGXA 1XIBA 4LUTB 4P7LA 2Y5EA 2OGJA 4DJFD 1DXFA 3VKCA 4ALDA 5DQPA 4C1NB 3UJ2A 2Z1WA 2QXWA 4DI8A 2OKOA 2ZRWA 1TR9A 1FO4A 4YTQA 1CEOA 4BQ2A 1EO5A 3E12A 4GX8A 4NX5A 4UFJA 3UCCA 3W75A 3NO5A 4RKAA 5G5IA 8RUCA 3CYJA 5E1QA 3CWOX 1S46A 3AN1A 3W38A 2DT2A 4U4MA 3H7VA 3U4FA 1DNCA 5BZAA 3STGA 1KBLA 2P0OA 3IIXA 1EA0A 1QTWA 1JDDA 1GOWA 1PCWA 1XW8A 4LEFA 4L4MA 3RGTA 4C6LA 3FVMA 1PIIA 3GHSA 4H4IA 2BGNE 4NYYA 1CGUA 2YL9A 3WLTA 1TTPA 3MZNA 4UQAA 4EF8A 1VPQA 4PTDA 5CBIA 3DI1A 3UZWA 3KOWA 1JRBA 2DH2A 2ISDA 1NP2A 4G7EB 3ATYA 6ENLA 3N9RA 4LJ3A 1GVYA 3A4XA 2R14A 3CV1A 1LCOA 4P7OA 3N14A 3MVIA 4UQCA 2BY2A 1UW9A 2QS8A 1W9PA 5GJPA 2FYMA 2ZVRA 2GK1B 3OLEA 1R7AA 4YHGA 2ISWA 4S2CA 4H9VA 1FFUC 3CT7A 3TSDA 3K4DA 1XLGA 2GWNA 4AX6A 4W5ZA 1M3UA 1QPKA 2BXVA 3VILA 2YSWA 3LCLA 3TNOA 5K4ZA 2CZVA 2Y88A 4LC8A 3THCA 2PFHA 1VZWA 3U9IA 4ORIA 4ZQRA 2EPOA 4ZBCA 2VDGA 3TR9A 5B80A 1F8WA 2W92A 3DI0A 4APNA 4UBPC 1JZ6A 5E09A 1UKPA 3TN4A 3QC3A 2CLMA 2EKCA 3W7LA 3UXIA 1PX3A 1GVRA 1ZAIA 4K2SA 1GRAA 2NQHA 3IK2A 3N34A 1UUOA 1Q6FA 3MI2A 2Y85A 5J04A 1RJQA 4FOKA 4S38A 3CMFA 1NM9A 4CQ9A 1HO4A 3W4RA 2YJQA 5CC6A 1JCLA 2QDEA 1LVLA 1HP5A 5HATA 3HGSA 1Q8AA 1TPWA 1EGMA 1WBHA 4KS0A 4D6IA 2GZXA 1LDCA 1GNXA 4BKNA 4H4SA 2BWGA 1JZ8A 2YZ5A 4AXNA 4NJHA 4QITA 3SUVA 4IT1A 4LUIA 5A6BA 4ZMGA 1W3TA 2HDJA 2TRSA 2PRLA 2Y8VA 2OWCA 3CZ8A 2TPSA 5DANA 4Q4SA 1YNPA 4K38A 2OWWA 1ODZA 1Q2RA 2CIPA 3WK0A 4E8CA 3LLDA 3NVYB 4QCFA 3WK1A 4YTTA 1VFUA 1GHRA 4V2XA 4BJHA 4JIEA 3EEGA 4CU8A 1UR4A 1OYAA 3NOEA 3STCA 2FQIA 2HQMA 4UXDA 4JOMA 2E6AA 2ZICA 3DG6A 5JCIA 1CLVA 4GQQA 5HQLA 2WVTA 1R2TA 2XG9A 1K4HA 4JDYA 1H1YA 1YHTA 4MG4A 4XZBA 3HQ1A 4PYSA 2XSXA 1FVPA 4ORMA 4GI8A 4M51A 1NWUA 4HHHA 4R7JA 3P82A 5U1OA 3PSWA 2XIMA 4GOAA 3ANYA 1LBFA 1MO0A 4DF0A 3NDOA 5DMMA 1RP8A 4UOJA 3DIPA 4Q8NA 4EXAA 1TV3A 4NSBA 1E6QM 5AY7A 2E1WA 1HKMA 4TVCA 3AU6A 4A2RA 1QNSA 4IMFA 4UFHA 1VFOA 1MEWA 1W1YA 4DO6A 1TRIA 4PUUA 3G1RA 3NYZA 1GK8A 3PN8A 4WKAA 3H26A 1V02E 3AIQA 2YW4A 3TAKA 1OFRA 2VGIA 5TD4A 1VYPX 2OMAA 3BAIA 1UWIA 1NIUA 2PTDA 1KQYA 3I6RA 1ADOA 2FFIA 3VGEA 3T4CA 2CLLA 1NARA 3BSHA 3D0CA 1BTMA 1WE5A 4JNZA 1NFPA 8TIMA 2V3BA 5CAHA 2FGLA 1YXYA 3O0KA 3EOSA 3FXGA 3TDFA 2ZRZA 2YZRA 3CHCA 4M6PA 4H4UA 1ELSA 3H6OA 4PEKA 4J1OA 5A8NA 3HB9A 1NSJA 1JUEA 3ARWA 1H7PA 3O05A 5I0DA 3PR2A 3H2EA 1ZK7A 1QAPA 2BOEX 4PUNA 3AIEA 1TFVA 3WDRA 1CGWA 1E9ZB 3N3TA 3E0VA 4X63A 2E5DA 1ICQA 1F8IA 1K77A 1XD0A 5JQ9A 2G4FA 3KTXA 2DT1A 3OVQA 3WL1A 1XSIA 1R0MA 1DHPA 2JALA 3M47A 3B9EA 4U28A 3HG4A 1R5YA 3WMBA 2X8GA 2GGGA 1CLXA 4WR3A 1XDLA 2LLEA 3ECQA 3WYZA 3KL3A 3QJAA 3WY1A 4AMCA 3CK5A 3KHDA 3IUHA 3GG0A 4AZ5A 3LHYA 1QPNA 3WF0A 4EF9A 1WNOA 1W1IE 1FY6A 3ZWTA 1VRXA 4J4KA 1UWUA 4LW7A 2EQ8A 5LSMA 3O0HA 2V9DA 1V6VA 4FA3A 4XQ6A 1V79A 1E4LA 3H2MA 2E5CA 1WDWA 2GSJA 4ZTXA 4NI3A 3GFYA 3QC0A 3A7UA 4ROPA 3A3WA 2OOFA 3EDKA 1C91A 4X0NA 4TXEA 1XF0A 2X41A 1CGVA 2CW6A 2D3LA 2QGYA 3OZPA 2GGIA 4AWSA 2NV2A 4ADTA 1J8VA 3RM8A 4UTHA 4AY1A 4LBRA 2BY1A 1V0NA 2OO0A 5I3KA 2AMGA 2V82A 1ZB5A 1DL3A 1UKSA 3AI0A 1TCDA 2V5KA 5JBEA 3TVAA 1WUEA 3EMQA 3WJSA 2OSWA 9XIMA 4LANA 3WFLA 4OFCA 2BC0A 4H7VA 4HMDA 3N13A 2HRWA 2D2HA 4IMCA 1O7AA 4CUCA 1VJSA 5AYXA 3WKZA 2VOMA 4GYKA 1QR7A 5E70A 1KFLA 3FNDA 1TWIA 3CT2A 4W84A 2QUMA 3RLGA 4B9YA 2W79A 2JIEA 1BG4A 3BV7A 4F40A 4PMYA 4B16A 4CU7A 1W2VA 1ZBCA 1N8FA 3LBCA 4ZB5A 3KP1A 1KM0A 2R1KA 4BK9A 3W1XA 4NAFB 1XLMA 4HA0A 2GFTA 5AVHA 1E6SM 5FJIA 4DQWA 3LPPA 1WOBA 5EKYA 1K8ZA 4YCOA 3RO8A 3TCEA 4DPQA 3E02A 4NG3A 1P6BA 4Q8TA 4KWWA 3HN3A 3CL6A 4IHCA 1G4PA 4WDUA 3A4WA 4UTKA 3H4GA 1K9FA 4U2YA 4U31A 1K1DA 3THAA 2ZX9A 4W7WA 4N9CA 3OLIA 3LPGA 4ZENA 3V3WA 1VLWA 3GRSA 3QR3A 1EH9A 4DBUA 3VE9A 3H12A 4KETA 3S2CA 4EPDC 2QJNA 4AXKA 5D8WA 3B8TA 3V18A 3VOHA 1QCWA 3GR8A 3DK9A 1KWKA 4N42A 4LQ1A 3EPNA 4HPXA 1VBRA 4UCFA 3HQNA 4FR1A 2C16A 1K7XA 1I75A 2BBFA 2GGHA 1TYGA 3HW2A 3OLDA 4O28A 1KXVA 1F5ZA 1TVPA 3GTIA 2I17A 4HQVA 4JCLA 1UWSA 2BHZA 3HF3A 4P5UA 2A7RA 3M16A 3R1ZA 4JNMA 1TTJA 5FF0A 4DUWA 1NWTA 5CSYA 1D7YA 4Q4KA 3QQWA 5LNWA 5AB3A 3WN6A 1GVOA 3QW4B 1VFFA 2WWDA 2H9AB 5D37A 1DQWA 3AALA 2ZQ0A 1JPHA 2A85A 4CLMA 4HCLA 3LADA 1U83A 3CAKA 1XP3A 3E96A 3TWBA 3O15A 3U0HA 2W3RA 4H9TA 4WSKA 3MWAA 2RABA 4JTQA 3VMOA 1L6YA 1QWKA 2Z4GA 1V6TA 3CHDA 4HNVA 4BQ5A 2V63A 2HROA 5HNTA 4CQ8A 1WCGA 1P1MA 3WQVA 4DAFA 4ZOHB 1YDNA 5A6KA 2WSKA 3V35A 1WYIA 4HMNA 2JKAA 1AH0A 3LCFA 3EA3A 4JTAA 2J24A 1K9EA 2YDQA 5HINA 3IGHX 3PB2A 1S5TA 5FS9A 3VA8A 1XC6A 3VZZA 2V67A 1JZ4A 4GWEA 4GQRA 3T09A 1L6WA 3QZ6A 2WM1A 1S3HA 3PJTA 2BC1A 2YDSA 3DJJA 3E5BA 4WSHA 2WPCA 4QQ3A 3LA4A 4R7WA 2R1PA 3CWNA 3BICA 1UC5A 1WV2A 1FH8A 2WHKA 5FJUA 3CPGA 3GTHA 4MY8A 3L4ZA 3F03K 2CERA 1F3EA 2XZ7A 5CJMA 3UD6A 1GTEA 2V68A 3R0DA 1VCVA 3C5QA 2PP0A 2HK0A 2XVLA 1JPKA 4GXMA 5CGQA 4DM2A 3UWWA 1V7YA 3SN0A 4L61A 3WLRA 3EXTA 3KE0A 2OGYA 1OWQA 3A47A 2O7QA 4GZIA 4IGNA 3H22A 4AZGA 1XG4A 4AWTA 3AUJA 2ZZ5A 1RY0A 3LYEA 4AIBA 3FJLA 3K2GA 4KEUA 3R89A 1XLBA 4HU3A 4LUSB 4FNPA 1JPMA 2OCZA 3WDIA 1NY1A 1C8XA 3O6AA 3GX9A 3W72A 3MS8A 4W7UA 5LNVA 1JDEA 1NTHA 3TROA 1J9YA 3H4XA 3J7HA 1V3LA 1XYAA 1B9ZA 3UQNA 4O10A 4JFWA 1B3VA 5CJ5A 1CXFA 1XIHA 3RFAA 3QPEA 1F7BA 1ZY8A 5K9DA 2D0GA 1X1ZA 2PE4A 3HQPA 3S1WA 5D09A 3NG3A 5T9BG 1BZLA 4U5IA 5IXEA 4KF1A 1WKYA 1V4YA 1ONWA 4MNKA 5CH9A 1KM6A 1X8CA 3CUIA 4NZ3A 2QCFA 1TPFA 4JQAA 3PZ9A 3UZYA 4TX9A 3O8AA 3BG5A 4LVBA 1VFHA 2VNCA 4BEQA 2POTA 1XCFA 2DZVA 1OIFA 2V30A 1JDFA 2JGYA 3UU0A 4DRSA 3M0HA 2AAAA 3KLKA 3MMWA 2JBMA 2DZXA 1UYQA 1WKFA 4DXVA 4Q3MA 3GZ3A 3A12A 2WC4A 1EC9A 1ESWA 1IYXA 3HGJA 3SR7A 3VGHA 3RYSA 3TTSA 3T0BA 2WNQA 3W1NA 4YYCA 1OGBA 2WQDA 3V75A 3PG9A 4EMIA 1ICPA 1UOZA 4K6AA 2FFCA 3BCJA 3ISIX 4Q4QA 4OGZA 1YE4A 3M9YA 3QOKA 5LIWX 3GC2A 1B3WA 1GRFA 3W1LA 1BYAA 2Z1KA 1RPXA 2Q8XA 3S46A 2XH7A 3BL3A 4MWAD 1I45A 3BE7A 3HBLA 4NJGA 2R94A 4GIRA 3S5NA 1TELA 2YX0A 1QPQA 3WJZA 4ADWA 2YL5A 1XDJA 4F3HA 4IGSA 4GNKB 1I0DA 5AHLA 1DYSA 3NEHA 4YVPA 5JH1A 5REQB 3W29A 3BLDA 1D2KA 2PWVA 1VEMA 3EMCA 1K3UA 1I6NA 1EJUC 2WWCA 3BLLA 4XBJA 2WHLA 4DZIA 4O52A 2PURA 3OQEA 3KXQA 4B4HA 1QK2A 5A69A 3N4EA 4EPKA 1AODA 2D2OA 4FLRA 3AMLA 2OB3A 1PB0A 2C14A 1KRMA 1B54A 3EZ4A 3M0LA 3G2GA 4HNOA 2OLSA 4C1NA 1W8GA 3FA4A 4QDWA 1AQ0A 4J57A 2WC7A 3DFYA 3F4CA 4D6FA 1CXEA 2NVCA 4HYVA 1W56A 1GQJA 3NM3A 4CNNA 2A3LA 3L5LA 1GPFA 3EEZA 4K8EA 4UFMA 4NRRA 3ZYZA 5ENLA 4QNEA 4UMBA 2RFGA 2PS2A 1KXQA 4Y96A 4JNYA 1RQBA 3S5ZA 1H51A 4U5KA 2WSYA 3FA3A 2QYGA 4WRHA 3B9DA 2FGBA 1XQLA 3IJLA 4F0LA 3UWYA 2I1OA 3DHUA 3GM8A 3N9KA 2W55A 3OVRA 5D9OA 1XLLA 2GYIA 4H2HA 4JD4A 2OZTA 1OFQA 3N2MA 1QNOA 3EDJA 1V3MA 3BH4A 4JDRA 1G1YA 2F8QA 4XZHA 2VEFA 3CC1A 4JXCA 1MFUA 3Q67A 3SCVA 4NEWA 1I1XA 3AU2A 1POJA 3P80A 5A94A 4TVWA 3EX1A 2C19A 3NZGA 3USZA 2GL5A 1IWBA 4O16A 2G3JA 1ZJBA 4HK6A 1TQJA 3QY7A 2AL2A 5I23A 4C6IA 3MKCA 1DP0A 1PIGA 4INFA 3D6NA 1W9XA 2VWSA 2O92A 1KN0A 1HTIA 3II4A 5FSDC 3HG2A 1J5TA 4PB3A 1R3RA 1B3OA 4PZVA 2Y63A 1LWJA 1M5WA 1MVYA 1U33A 3MV11 5FI8A 1WA3A 3TC6A 5CAKA 6A3HA 1O1HA 3AHZA 4AWUA 1GW9A 3C2EA 4LB4A 1O4UA 1WXZA 3MMUA 3L0NA 3QZEA 5HPOA 2WKGA 5E0FA 5GJMA 4IL0A 2Y70A 1W6TA 4J3UA 5BRBA 2PMQA 4LY8A 3OG3A 3VIPA 5E6YA 4PGLA 3W01A 4UQBA 3WFAA 2ICSA 1VLIA 1P0NA 1FWEC 1SO5A 3AHYA 2WMIB 3VIMA 2E3TA 1E15A 4XSLA 1VHNA 4LSBA 1GORA 3PTMA 3GK0A 6REQA 3ZVIA 1MDLA 4DJED 2CFYA 4QG8A 3ZS4A 3KVMA 4RL3A 5LNSA 5I07A 2YLAA 2HK1A 4C6JA 1QBBA 5BU9A 1SSDA 3M7WA 1IZKA 3IAQA 2Z6IA 1VDVA 4ECLA 1X7IA 3B0YA 4UZUA 3ZR6A 4R7OA 4HYRA 4M8UA 1H6VA 1TWSA 4AF0A 3ZOAA 2YIHA 2E8ZA 4ZCWA 3W1PA 4RW3A 1NVMA 3SIZA 3MA8A 4TIMA 1Z89A 2XUCA 3DHPA 4GYJA 5BRPA 1QOPA 1FQ0A 3KL5A 1S5MA 1C29A 3K8KA 1YBQA 2V2CA 5H8MA 1QDSA 2PDFA 2OZ3A 1EC7A 1VB9A 1L9WA 3AZTA 5DRIA 1A5KC 3WD3A 2XN0A 3TYAA 3G1DA 3GIYA 1SMDA 4N7QA 4IP4A 4UTUA 2PGRA 3HU7A 3URHA 2G41A 3QGAC 4AHPA 4JDBA 1A0EA 1UBPC 1XH0A 5D2WA 4DJFA 3IJQA 1Y65A 5CG0A 4X9SA 3KBWA 4GACA 5HXMA 2YL6A 3VXGA 1P0EA 4I6VA 5EMLA 1CT5A 1BQGA 1ZBKA 4ACYA 4LYQA 4X0VA 4Y8EA 4Y9MA 1YNQA 3W87A 4Z42C 1TWZA 3TIMA 4UOQA 5HNRA 1M6IA 2PSNA 1P7TA 1HO1A 1HKIA 1R46A 3GO2A 3DJGX 2J7DA 3G77A 4AWEA 1CPUA 3C0JA 1GVSA 1ZBWA 3LBOA 3OEXA 3B04A 3R25A 2AGTA 8XIAA 4GI4A 1BRLA 3CIVA 1NDYA 2CITA 1EJVC 3W1MA 4AIEA 3CHEA 4CD6A 1BKSA 1XGEA 2PU1A 4A22A 5IFTA 1AW5A 4IX2A 1CGTA 1GEHA 4MWAE 1CXIA 4B92A 1OHLA 1E1EA 4B5UA 1GOOA 4PL1A 3TP4A 1HF6A 3N3MA 3W7GA 1Q2SA 2WP6A 5EBKA 4EWND 1ITQA 2HNHA 4UOZA 1F05A 2BODX 4PTNA 3C0LA 1GQIA 4OHQA 1UBSA 5HMSA 4KRTA 2GVJA 4J5NA 3VIFA 1YW1A 4QHRA 2DJXA 3HA1A 1PWMA 1D3HA 5KVIA 2R24A 1JZ2A 2Z1BA 3RR1A 2Z26A 5C9UA 3W23A 4W88A 3R0UA 1TA3A 4HMCA 7REQA 4EX4A 1TIMA 3GG7A 2ZZ2A 3TZFA 3F4WA 1BQCA 1EQCA 1EEXA 3E1F1 2X30A 2I57A 1OD0A 3B4YA 5LA1A 6XIMA 3FG2P 2XIQA 4PRRA 1Q63A 1S1PA 2W5FA 5PTDA 1LL7A 4L1WA 4E6MA 3FY1A 1OC7A 5C9WA 4C5ZA 2QULA 1DJNA 3L2MA 3G1VA 1XRSA 1UWRA 3TC7A 1O5QA 1MYRA 1RQEA 1G01A 4EMJA 3M5YA 4YVXA 3LCXA 2Q8ZA 4KERA 1HL8A 4HSHA 3TNBA 1YBQB 3RMJA 3PVFA 1N62C 1XFCA 2CZFA 3RNMA 3WF4A 5CPQA 5C2XA 3NGJA 3DECA 5DLCA 4D6EA 1VFSA 5CC7A 2XVNA 1UD2A 1YIXA 4AEFA 2YA1A 3TYBA 4OUIA 2GDVA 3R12A 4W7VA 3GE7A 2XVGA 4G7EA 1IZJA 2WBAA 4W9TA 1OK6A 4AZCA 1E9IA 2WV8A 2FIQA 2Q01A 4MKVA 1BAGA 1TPB1 3GNXA 4QJ5B 4NJJA 2VZOA 1W9UA 4K1WA 4E4PA 2JF6A 3ITXA 4JQ1A 4PTVA 5FEXA 3ELFA 3U2EA 2YAUA 2QJHA 3H55A 2PLJA 2D0FA 4OBRA 2B7OA 1Y5VA 2IQDA 4UTJA 3IIZA 3GYEA 5CPLA 1W9VA 3RK8A 3WH8A 3A24A 2GR1A 3LCIA 3FJ6A 2DVTA 2PP1A 4WLCA 4UTLA 3CH0A 3SI9A 1DWFM 3O3RA 3KAOA 3VC5A 3AISA 1BKHA 3UNDA 5TBOA 2IPWA 4XZLX 4HP5A 1QI3A 2W27A 3AROA 4OECA 3BTNA 4S3JA 4F4RA 4D2JA 4NASA 4MADA 1R6WA 4LUTA 3QTPA 4C90A 4OV4A 4IOTA 5AC6A 4IICA 2F6KA 8XIMA 2VR4A 4S3BA 3DZ1A 4DJEA 2XGZA 1KKRA 1JAEA 4EM4A 2WMKA 4R53A 1ZTVA 6TAAA 1LBMA 1UUMA 2ZUSA 2VX7A 4Z0SA 2IW0A 5GRTA 9XIAA 4BF7A 4MDOA 3SR6B 1M04A 1EX5A 1YLVA 1GV4A 2JEPA 5XIAA 4WDXA 4XVEA 2P10A 3R7MA 1S5WA 1H61A 3F4VA 1E51A 2RUSA 3TW6A 2Z2AA 4ZODA 1D7FA 1B0IA 5BNKA 1K7FA 2O56A 3WLOA 2WCGA 1JDCA 4JEJA 2MUCA 3BLEA 3W27A 2VFFA 4BI5A 4O8AA 2GQ8A 1MI3A 4JYEA 3M4HA 2XWEA 4RDYA 5FF2A 2ZX6A 2Z6JA 4BI6A 4CQAA 1SW3A 4HNCA 4JR5A 4XX6A 1V93A 3GWQA 5D9NA 1B30A 4I8YA 3WNKA 1AQFA 3VIIA 3BLFA 2P0IA 2ATSA 4NZFA 3TYZA 3DH9A 1TJPA 4LH8A 4I3GA 3IJDA 1C9WA 1C7TA 5EL1A 1TMQA 2WJDA 3C0QA 3MHUA 1KTNA 3ZLGA 1PZ1A 3KRUA 2V38A 3KL0A 2BP1A 1KRCC 1K8CA 3H7RA 4OT7A 3URAA 3IVSA 3CGDA 4RXFA 1GCYA 5EB8A 3CL8A 3S3GA 3UWQA 4DBDA 3EOOA 3TW7A 1TPC1 2RAGA 1EPXA 3W26A 3AMGA 3BQ5A 2VVSA 3DAQA 1JNEA 4E4UA 3F2BA 2E1DA 4UTWC 2WCSA 2QV4A 3DK8A 4DZAA 2VWTA 5LXXA 4ZQPA 2YCLB 3RM9A 1RCOB 1KO0A 4QG6A 3VM5A 3QVQA 3FHAA 4H4TA 3V4BA 2QGHA 1FECA 1ADDA 4GINA 3E74A 3C2OA 4EIVA 1UKTA 2AKZA 4J56A 2A3BA 3BMWA 4IIHA 1OC6A 4IPJA 3UWUA 1GRBA 3OB8A 1UB3A 1SO3A 3B40A 2V5JA 1ECQA 3QR0A 3HPAA 2VEMA 3H2FA 4HB7A 3GQYA 3WEOA 1TV7A 2NVDA 3EX2A 3GAYA 1O6IA 4ZXOA 3GBDA 2FTWA 1EOMA 3MMDA 5U4NA 1U5HA 1US2A 1I0BA 2ABBA 1RVKA 1DXLA 5DT5A 2BVYA 3N17A 4GD0A 1KCXA 3UESA 2J8TA 3NL5A 1JXKA 3O63A 3CM4A 3PZUA 4P61A 1XSJA 1PO9A 3DFQA 3S8HA 1EBGA 3CQHA 3IWPA 1W8SA 1HQTA 1R86A 3GU2A 4V1YA 1ZKQA 1L8PA 3VIOA 3OHIA 5A6LA 1S2WA 3ZSSA 1VENA 4TVDA 4MKNA 4YTRA 3QKZA 1NHQA 3CZKA 4EANA 2XPKA 1QO5A 5G5HB 3UZJA 4LS1A 1TRDA 2YVJA 1UIPA 3MUIA 3ABSA 3WK3A 3SY5A 3W2KA 5CXPA 4AUBA 4ZGYA 4A05A 3SRKA 4O12A 5BMWA 3O6YX 2VFHA 4WHBA 1DJWA 2ZRVA 2O4MA 3STEA 1E56A 3BLPX 3T8QA 1A5MC 4ZQMA 1W91A 3OYZA 2DZBA 1B1YA 2BV9A 3WQCA 4BZYA 3CAVA 3G1SA 4JTTA 1JZ5A 1RV8A 1T0OA 4H4ZA 1ENUA 2OEMA 2FZ8A 3L66A 4KGJA 4Q8PA 1HFBA 2XIJA 4DM1A 1Q6QA 1XICA 2OZ8A 1ZBVA 3MJMA 3NDZA 1D3GA 5E0KA 4FS9A 3K1DA 3DFTA 3SM0A 4PTMA 3EB2A 2DFAA 5JCNA 4F79A 4IIBA 4F9JA 2PZ0A 5G4HC 4W86A 1EIBA 3NJ3A 3P81A 4IM4A 7TIMA 4HCDA 4V27A 4FP1A 2OYMA 3PBWA 4QE4A 3A3XA 3WD2A 3DEQA 3U5YA 3QQ1A 2PCEA 2V6OA 3FKKA 4AZIA 1CX9A 1FEAA 5C70A 3M64A 2A21A 1DQXA 3KHJA 5AHEA 3S2JA 2OZ0A 1XX1A 3MCOA 4ROQA 1QASA 4H50A 2DW6A 4DBSA 3W1RA 4R5EA 2NQJA 1NWSA 3MWCA 3PZOA 1UROA 3AMDA 1VRDA 1V3JA 4D6DA 4MZYA 3LQLA 3BG9A 2OQLA 1ITXA 1WKEA 1XG3A 3KWSA 1H63A 2E9LA 4PCTA 1EZWA 4MPKA 1JCMP 3ZM8A 2J47A 3QFEA 2XN2A 1H2IA 1F4AA 4XAYA 4RNHA 2WLZA 3NNTA 4LUJA 1RK6A 4IUGA 1QRQA 4HHPA 3NUKA 4DO4A 1F3WA 2X09A 1R30A 5AHFA 4E38A 1A5CA 1PZ2A 4G5DA 1OG6A 1E6ZA 4JIHA 1G4TA 4BHYA 5AHNA 5AC5A 4GUJA 1VYSX 2VFEA 3S5SA 4N6EA 3W7DA 2JEQA 4M6QA 3VX1A 3FK4A 2DP3A 3E6EA 4FZIA 3VKJA 1PCKA 1MFVA 1O60A 4IF2A 4TQTA 2NW0A 3ARVA 5FACA 1PKNA 2QDHA 2JGQA 3OZYA 4O1FA 2VP8A 3STFA 4UFIA 1TV2A 3WO8A 4DYKA 3RMEA 3U4AA 3AS1A 2VX6A 3F7JA 3G1FA 4LWWA 1FH9A 1ICSA 1LTDA 3BK0A 5MHBA 3QSRA 5U25A 3TONA 2QVNA 4DJDC 3HV8A 3R43A 4U2ZA 5CBBA 4RE3A 1PYFA 2A3AA 3IJ8A 1OF8A 4W5UA 1KTCA 3NS1B 4ZVJA 4B5SA 1UZ1A 1E1FA 5D2XA 1BVWA 4TOQA 1JQXA 3GH7A 1A5AA 1CZ1A 2OEKA 4D8ZA 5KZ6A 3OBAA 1VBJA 3BGGA 2QZRA 1CIUA 1V51A 2W3ZA 1ZS2A 3BANA 3UT0A 5HQMA 4QXIA 4CN6A 2WBKA 4MYAA 3I7QA 1MXSA 4TTUA 5A2CA 1DTNA 1GESA 4RK8A 4FNQA 5D03A 1Y8BA 1MW0A 5ABGA 1X97A 4JQ3A 4KW2A 4LPCA 3GXFA 4XVDA 1U22A 3LPOA 2ANUA 2GDUA 4DJDA 4K36A 3ZJKA 3TE9A 3GLCA 1BWCA 4JN7A 1SZFA 2OSXA 2FZ9A 3KCOA 4L9XA 1QW8A 5TQLA 1GVEA 2NQ5A 1J2WA 3LCWA 1XLDA 5LGZA 4JKLA 4X61A 3Q94A 2HTMA 2Z1SA 2O9TA 1RHCA 5D32A 1MRQA 1VBHA 3PPFA 4XUGA 5HUOA 4DWSA 3TWAA 4XBSA 4CVUA 3RRXA 3GXTA 2GSHA 3HIJA 4JGDA 2XZ9A 1N5WC 1DIKA 2VC9A 1IF2A 3NGFA 3VINA 3IEBA 3OIXA 4BQ3A 1LOQA 4I9MA 4WGXA 4B3LA 3SCNA 4FI4A 1TUFA 3SJ3A 2EG8A 1VCGA 4EE9A 1S2CA 1XIDA 3D46A 2H3DA 4K1GA 4A35A 3SURA 1I2QA 3EGJA 1R38A 4F8XA 4MAZA 4WJEA 2PWEA 3IC9A 1W5OA 3H2NA 4O1CA 3VNLA 3SADA 4UCGA 4DX3A 1TX2A 4NVTA 3HPSA 1VYRA 2OO6A 1ONRA 3N73A 4XKYB 1DIDA 3VKAA 2EQDA 1H0IA 3IV3A 4XKYA 3QZAA 3W88A 1LPFA 1F3PA 2NX9A 3QXBA 3IVTA 3GXIA 1S2TA 1UD6A 4N9EA 1UR2A 4F48A 4FDCB 2OX4A 5C7HA 4JEQA 1MW3A 1JCNA 3KX6A 2CFFA 1B57A 1GKPA 2QUVA 2V2HA 4ICCX 3C2FA 5JH2A 4NT0A 2TAAA 3APGA 3UA4A 4PC8A 2V6AA 2QVHA 3VM7A 3RUBL 2UV8G 1WX0A 3NIYA 3NSXA 1C7SA 3N19B 1HL2A 1FCUA 2EHHA 3RITA 3TMLA 1V3HA 3LV6A 4YWIA 1VBGA 3P8IA 4PCFA 2VZVA 1JEHA 4M56A 2V5LA 3W6MA 3ALFA 3IGXA 2X40A 1EKOA 4EQSA 3AHTA 1L6GA 3LRLA 3RCYA 5TF0A 2ZRUA 3P0WA 3CS2A 4FOUA 5I3IA 3URNA 5AZ1A 2X8CA 2VGGA 4J3XA 4TV5A 3S9YA 1O12A 1F9CA 1H11A 1NFGA 5GQBA 4UFKA 3ZZ1A 4AVOA 4CCCA 1JOAA 3MBDA 5HANA 3V7PA 2PDUA 3DDMA 5AOUA 5E0CA 4LIIA 4WXYA 4IGHA 2DSVA 3PULA 3NPVA 4GC3A 1QXLA 3ONBA 3BQ6A 1GSNA 4ENLA 3M5XA 2PDNA 2OT0A 3QHMA 3GTNA 1YTDA 3DFHA 4LVGA 1KGXA 3BLIA 4GRSA 1ZAJA 3B97A 5J5DA 2PDLA 3LOTA 3KTCA 4MIMA 1H49A 4ADSA 3CUFA 1LROA 4F0SA 4V1XA 2DUZA 3WMLA 1UA3A 3C6CA 3G5EA 1E5NA 2YQUA 2R91A 1TE6A 1ECEA 1X6NA 4BWLA 1W1PA 3FVDA 3LY0A 5KMYA 4C6PA 4KWUA 3D47A 1JG9A 2F5ZA 4H9MA 3AMKA 2VXNA 3ITOA 1MW1A 3VDGA 3AYTA 4LT9A 3WQDA 2E77A 4BV6A 3L21A 3RO6A 1G6CA 1PSCA 2DIEA 1Q7QA 1XLJA 2I5QA 4O19A 3B8VA 1KD0A 5C6MA 4J3SA 4NZCA 4TU1A 4CCEA 4PRWA 3VNYA 1R3TA 3UJEA 1C8VA 2A79A 3H7UA 3G6LA 2G3NA 1FHVA 1EQPA 3F2CA 4ERAA 3CB8A 3VK5A 3UXAA 5AHMA 2H3BA 3ATZA 3PTDA 4IIFA 2ZUMA 3EWCA 1BXNA 1QPRA 1SQ7A 1FX6A 2JE8A 4RV8A 1K02A 1JRPA 3OZOA 3THDA 2A6LA 4YNGA 1YYAA 4CD7A 4KGLA 5CGMA 1PBGA 1TWWA 4HIBA 2QNEA 1KCKA 2GOKA 3GRIA 3LMZA 2VJXA 1L6SA 2VD8A 4ZOCA 4CVWA 5LKYA 5BROA 2YXOA 2WO5A 3WQ4A 3CWHA 4K7VA 2PTZA 3GVGA 2V3GA 1YQ2A 4MSSA 1OD8A 4ZR8A 3W76A 4NNAA 1XH2A 4QSHA 4FEZA 3ZT5A 3TJXA 3TJLA 4G1NA 1I2RA 1GYNA 1OJXA 1TO3A 4UTWA 1S5NA 1T41A 2P3ZA 3DX5A 3E38A 1CLKA 3TA6A 1ISWA 1ME7A 4CGTA 3AS0A 5LHFA 3T42A 1SO6A 3URBA 4LVFA 3ERPA 3NO1A 3BJTA 4F0KA 2HVMA 2NVKX 2GVLA 2IMRA 3EX6A 3RAOA 4GX9A 2F9RA 4Y9OA 3PUGA 5H8PA 1RZMA 1FP9A 3TMQA 4H9ZA 1KWGA 3RG6A 4FXSA 3XINA 3QHOA 4WY0B 3GC4A 2NWSA 3UA3A 4TVYA 4NXKA 4TX8A 2CBJA 4GMEA 3TSMA 1CB7B 2P8CA 1UWAA 1OT2A 2ZXQA 2DDXA 2DZAA 3MTWA 1BLIA 4QTGA 1IEVA 2EG7A 1G67A 1KR0A 3IACA 2DQXA 2J78A 3SO7A 4JX5A 2Z2UA 3O7UA 4Y90A 1HX0A 2ZUWA 3ARRA 3NRZB 1P4CA 1X1NA 1HVQA 2FLIA 1CBGA 4Z0JA 2XYLA 5FKYA 3TYCA 2ZX7A 4C6CA 4KEVA 3O0FA 1PZ0A 1ZJHA 4BQ4A 3CMJA 2ACUA 2XU2A 4N4QA 1E4NA 4JTEA 3R11A 3MUAA 4H9UA 1FRBA 1W3IA 1MO9A 4J2PA 1YDVA 1AL7A 1KTBA 3TQKA 2ZZ1A 1V0MA 3SQPA 4GFIA 3EDFA 3OGRA 1XI3A 1HZYA 3ONCA 1Q4WA 3ARQA 3L2LA 4BF9A 3R8GA 4Q4RA 3T0CA 4DJEC 4M82A 3L4TA 3IANA 3WSUA 5DY2A 2QKFA 3BVJA 1LM1A 2CLFA 4F2BA 1V6XA 3M46A 3VGDA 1HXJA 3KTSA 4KFOA 4YLWA 3NQAA 5FEZA 4GXWA 1FHLA 3PS7A 5HULA 3W2UA 2WB5A 2V3AA 3ETRB 1IV8A 1KFKA 5HWNA 3CZEA 2Q8LA 2ONEA 4Q32A 3WMCA 4JYFA 3KBNA 5DO8A 3GAKA 3ARUA 5B7YA 1JD9A 3DKLA 1R9ZA 2C79A 3GNOA 3TXVA 4ZOAA 3B0UX 3PZMA 1ZNNA 4CCZA 3ITTA 2C71A 3PSVA 5AHIA 1LQ0A 5LHEA 3S9ZA 2XDFA 5E9XA 4L80A 3UG3A 2ZXDA 3FAXA 4XUYA 4ZEPA 1MEIA 2EPKX 1VEOA 3ZWSA 3JVAA 3KM8A 3E2SA 4C1LA 1JYVA 2W61A 1J10A 2J8GA 3AC0A 4I7UA 3GW3A 3IGUA 5CC5A 3FGCA 1EF2A 2XTKA 2P88A 1QHPA 2VEGA 1XRFA 2FJKA 4S23A 2BXYA 1RM6B 1LRNA 1OX6A 3GU9A 3B03A 3S42A 4YYFA 2HZGA 4WKFA 3LGGA 2EKGA 2CLPA 2RHGA 3PUOA 1TYPA 1P48A 2OYLA 1XC4A 5I79A 3SQSA 5EBUA 4KPLA 4AD1A 4EQXA 4EXBA 1FWTA 4H2CA 3WDJA 2VX5A 5CZSA 2X1UA 4PUEA 4LX4A 3L65A 3H70A 2XH4A 4GI6A 3WLQA 3V5OA 1XLHA 2BVDA 2OPJA 1EP2A 4JX4A 2QT3A 1ZPTA 3HPXA 4DBEA 2UY2A 5LA0A 4JTLA 3SGGA 3P6LA 3A7AA 5FMHA 3RLHA 4XSMA 3FCPA 3LDVA 2E09A 3G24A 3FHQA 3AM9A 1B90A 1CXKA 1T96A 3L5AA 1ZP4A 4REQA 4FX6M 1C92A 4I9JA 3AYVA 2RKXA 1GXFA 2Z2BA 4HOZA 1ISYA 3N12A 4DBWA 4HT3A 1IEIA 4GO9A 1E1CA 1OEPA 1D8WA 5FEWA 4M80A 4H3DA 5HMEA 2Q3RA 2PDIA 1V08A 2PODA 1UZHA 4CD8A 1SFTA 1FWBC 5JIWA 1DKWA 2Y2WA 3VUSA 4GFSA 4H6RA 1QJWA 3T0DA 1GRHA 5EMKA 1RD6A 2BSLA 3MCMA 4HOXA 2XHYA 2A8XA 3LM3A 5D02A 1F4HA 3WH6A 3SCWA 5I06A 2YVFA 4L9YA 1XBXA 3L4VA 3OC4A 4CNOA 3T44A 4EWJA 1VFTA 5H8UA 3HJEA 4ADUA 3PBMA 3PJUA 2BMBA 3LZ5A 4MJ4A 1Z3NA 1BSIA 4AC7C 2Y5SA 5J5RA 5HQEA 1OFEA 3VCRA 3NA8A 4OTKA 4Z1DA 4I5XA 1X8FA 2BVWA 4HNNA 2FB3A 1JQVA 4M3PA 4C7GA 4IPLA 3GR7A 1EZ2A 4BURA 3S5YA 3KOFA 5D2VA 4MY9A 1PDZA 2RDWA 3PBUA 1KC7A 3CGEA 3W74A 1RBLA 1Y7VA 3GD6A 2YCJA 4C7DA 1E0XA 3H21A 3MP3A 5LIKX 3RR4A 3U5UA 4H1ZA 4UC5A 2WANA 3BGJA 3ICJA 2VEKA 2B31A 2X0SA 4IMGA 1UP0A 2NWRA 1X6UA 1FWHC 2BGQA 4JIIX 1M1BA 3VABA 4LOCA 3UYCA 4HNLA 3NDYA 3P60A 5IHSA 3FX4A 4OWGA 4EXQA 2DY3A 2P76A 4JN8A 4CN4A 5KSWA 3A13A 2ACSA 5DCBA 1G4SA 4PSPA 4D8LA 1XKJA 3NQDA 1E71M 2D23A 3LLFA 3WEZA 4O0KA 4RDWA 4IIGA 3EPMA 1KCZA 2QCDB 1OC5A 3LK6A 3ZT6A 4ML4A 3ENLA 3M0ZA 1HN1A 3EX4A 1HVXA 3A64A 4D71A 1V5XA 1QMLA 2P5NA 4HK7A 1QOXA 4IFKA 2INZA 4OOZA 3KRBA 1X2GA 4MDPA 3N4AA 4LF1A 5TNVA 4H83A 1N8IA 4KWVA 1JIBA 1GKRA 3ALGA 4N6FA 4ML9A 4H6KA 4MB4A 1VBUA 3QOMA 3MW7A 4YWOA 1FCVA 3QLDA 2D22A 3VC6A 4B2DD 2DSUA 3ITCA 3OTRA 2YBVA 3UZZA 3SW6A 3EOLA 4JIRA 2GQAA 4WJXA 4AZHA 3W2LA 1WZAA 3AXMA 2I56A 4QDMA 2ESCA 3BW2A 3P8JA 2Q09A 1VAHA 3TN3A 2CC0A 4KFNA 4ZSTA 2YVGA 3GIQA 1VC4A 3UXDA 3PC0A 4HZ8A 4IQJA 2C13A 2X42A 1DWHM 1K9DA 3VNDA 3MBFA 3PTKA 3W7HA 1SFJA 3RU8X 4PFMA 5JXQA 1SZEA 1BWLA 2PTXA 2PCQA 2DIKA 3B05A 3CH9A 2RJHA 2ZUUA 1PS9A 1H50A 3LS9A 4K8HA 1OBAA 1LQ2A 1M6JA 1KGUA 2PDHA 3ARZA 3P0XA 1W32A 2I5IA 4S1FA 3CUHA 1P5BA 1IGWA 5LNUA 1NDAA 4FLSA 3MDUA 1Q6GA 5FAJA 4MNJA 1V97A 3R2GA 2V69A 3UR2A 2IQ0A 4LY4A 1NDWA 2ZUVA 3WUBA 3WBYA 1AJ0A 5ABTA 3WQ5A 1X38A 3R07C 4AIOA 1WZLA 1K8XA 4RZ4A 2VYOA 2EF9A 4DXKA 1XANA 1LG1A 3B9NA 2O0TA 4NY2A 3V0TA 4ZO8A 3GVQA 3GS6A 1RALA 1UH3A 1KBJA 5AFDA 3FYPA 1WDDA 5I2UA 2EXOA 4KT2A 1M01A 4MJ2A 2ZOXA 3ANUA 4XAZA 2Z24A 3HGOA 3LTPA 1BTCA 5F1VA 1A5NC 3P14A 3QMRA 4CEUC 4B5NA 1XBZA 2PGWA 3QQ0A 4BWLC 2J62A 2PGFA 5CJNA 3HPZA 3OA5A 1C90A 3T07A 1Q6CA 4J3WA 2KAUC 4D8AA 3N11A 1IEWA 4EAYA 3OP2A 1LP6A 1VKFA 2PI6A 4Q6JA 5SWUA 5EMUA 1FDJA 1QI2A 1XGDA 1T40A 3POCA 2GJLA 1ZSXA 2FB2A 2FPVA 3AS2A 4M5PA 4PUWA 1G5AA 4LAOA 4RV3A 3WQ6A 4OVXA 4RZBA 2JK2A 3E0FA 2CLHA 5A2BA 2C7FA 2GQWA 4HPNA 4JIQA 4MKSA 1EO7A 5C71A 3EB3A 2BXZA 2WPGA 2WQPA 4FLOA 4UTIA 2CKRA 3CGBA 4FLQA 1PUDA 4YCPA 2DV0A 4KBXA 2PDYA 1WP6A 1GGOA 2V5CA 1OABA 2BX7A 2ZYFA 3K8LA 4KH2A 2VUNA 3W22A 4P8UA 1AA1B 3IIOA 4ZFCA 4J3VA 1F6PA 3W7JA 3DBNA 5AYYA 4NNBA 1WDSA 1NP0A 4KCWA 4CKQA 1NHRA 5BOFA 3AYRA 5IDZA 3ABXA 3UGRA 3K13A 4HZ6A 2WP5A 2VDIA 4L4OA 3S6DA 1KM1A 4AQLA 1RVGA 5J8LA 1FDZA 1NOUA 4GQ0A 1NELA 2EPHA 2WW5A 4Z2KA 3NOYA 1RA0A 1NFBA 3FEQA 4YPJA 4WF7A 3MDWA 1UPPA 1VPYA 4D9PA 5JRBA 4RE4A 4NXSA 3V5FA 1E6PA 2XINA 4IFRA 4NI8A 2DZSA 4IJBA 4H8NA 2WOIA 3LNPA 4PMRA 3P61A 4ZQOA 4LCQA 4YWSA 1PVNA 1RQHA 2Z25A 4HYWA 3H2OA 5I3GA 3L4XA 3BOXA 5CPMA 2FPTA 1LZOA 3EB4A 4A8NA 1MXGA 2G95A 1EYWA 3FEMA 5K9CA 2BY3A 4Z08A 3PFRA 1JZ7A 2OKTA 2J6VA 2ODOA 4GBDA 4O11A 4DELA 1R87A 3A4AA 5ABEA 3EBVA 4HPJA 1Q1WA 1GQLA 3MP4A 1Q6RA 4U33A 1AW1A 1Z32X 4ZB0A 4B5TA 3K4AA 3U48A 4IUOA 2Y24A 2GLKA 1J0IA 3ABRA 1HW6A 5HNNA 3TA9A 3EDEA 1W3LA 1G94A 1PWLA 2D0HA 4PCPA 1K4QA 5GNZA 3PZQA 5CSUA 2BZNA 3V1HA 5C54A 3UPWA 3NTYA 3U2ZA 2E6FA 3RX3A 1OGGA 3T55A 3GHTA 3A4JA 3CHVA 3Q37A 3T81A 3UG5A 1EC8A 2OEJA 2O4QA 2ZC1A 3H8AA 5BW6A 4PBEA 2WJEA 3OZMA 4WEVX 1MQRA 3QLLA 3GZAA 3RPTA 1U2YA 3AIUA 3WH9A 1DWIM 1A53A 1CXHA 3O07A 1W5MA 3KBMA 1GTHA 4Z2LA 1DJIA 1OFAA 3N29A 1EJTC 5AYIA 4C6FA 3ANVA 4A2SA 1J0KA 1LRQA 3AWNA 2GJNA 5HWJA 2POZA 4C6NA 2AQWA 3L8KA 1JDAA 4Y9NA 1PHQA 1QHZA 4QIUA 3CL7A 1S2VA 4S3FA 4YN5A 3T1GA 2ZXAA 3VOGA 2DGAA 5HPCA 4C7FA 1OK4A 2CLIA 2DZPA 3BAYA 3ABZA 4XAGA 1N82A 2P53A 3EUB3 2Y7GA 1UIOA 2EBNA 5D38A 1EWEA 2W3SA 1P6WA 3BAXA 4NHVA 3PZNA 1HJUA 1BXCA 1J2BA 2J8FA 1QW9A 4A8LA 3PUDA 2XWDA 4O54A 3GVVA 1Z42A 5LGXA 4UTTC 1X96A 4PMNA 1NQ6A 3BDKA 2VGFA 1PPIA 4H04A 3QFWA 4PL2A 3MSRA 3MANA 4UQ9A 3WLIA 3L0GA 1ZJAA 3S5OA 3VYLA 3PHAA 4IFOA 2CZ5A 5A5WA 3OJGA 2NX3A 5U7SA 2V3FA 3K30A 4N2YA 5AZ0A 1UUQA 3SY1A 1T3QC 3UEQA 2VELA 1IIHA 4BR1A 3EKGA 3M6YA 1LQAA 4H4PA 2BTMA 4X2RA 3KZPA 3BMXA 2VQTA 1GQNA 2NUYA 1W3KA 3FV9A 4RUBA 1KRBC 3HURA 4QDPA 1TV5A 1WXYA 4MNLA 3LQGA 3LERA 3E0LA 5C2GA 3XIMA 4KESA 3GXMA 4YS1A 2E28A 3A5FA 4O14A 3IVUA 1QNQA 4AVNA 1ZY9A 3DN5A 3LB0A 4X2PA 3DYOA 3HOJA 5FA5A 1US3A 3BW3A 4WOZA 4KRZA 9CGTA 5XIMA 2FZNA 1RBOB 3LI0A 2PTWA 3B0XA 1VCFA 1XKYA 4XD5A 3BAJA 3Q45A 1NHPA 2C1IA 3UYIA 3L5OA 2R1NA 3GD4A 4H9XA 3R4IA 5FESA 1DJQA 3LI1A 3W84A 1PYMA 1ME9A 5IOBA 3GNPA 5D05A 3S2NA 1EP1A 1TJ0A 3UJFA 1TREA 3U3HA 2WCAA 3IV8A 1KV5A 3ORWA 3F4NA 3GVRA 3UJRA 3N04A 2ZBTA 2PGEA 3NL3A 5IBXC 1OX5A 3V36A 4ZTYA 4MMWA 1GOMA 3WNMA 4ZSUA 4HZMA 1GOQA 2BNJA 1GJUA 4US5D 1A5BA 2DZUA 3WBXA 2HBVA 3SRFA 3W7OA 1OFBA 3UPBA 3P2VA 3W53A 4MHBA 3P67A 3UG8A 1M7OA 3CUZA 1J11A 2QUUA 2YLLA 3W73A 5G1MA 1B3YA 4MYXA 1X2HA 2FTYA 2G3IA 3WF2A 3VMNA 3ZVHA 3IJ6A 3NR0A 4Q7BA 3NL6A 3VCCA 5EA9A 1ZALA 3EXSA 2NSOA 1JZ3A 4ACZB 2H6RA 1TPH1 3L7RA 3DH7A 3WFZA 1RJRA 1KLYA 1Q3NA 1HJWA 1SW0A 4B9ZA 1L2UA 1IQ8A 1FIQB 4ASTA 3LHUA 4K39A 3EA1A 4Y6GA 1TV8A 2OJPA 3MSYA 4Y8FA 2IKHA 4XZIA 4AISA 4IJRA 3F5JA 1EHAA 2PD5A 5C9ZA 1SM9A 1GEQA 2IQTA 4F0HA 1H4PA 3EOEA 1SR9A 3C8NA 1D7KA 1WBJA 4C6EA 2QMKA 1AMYA 3KLLA 4QEEA 1AH3A 4HTBA 1JI2A 2VDHA 4LFYA 4RDVA 3T9PA 2R6OA 1EL3A 1E72M 3QGVA 3STPA 3LLXA 5HMFA 3VZXA 4JYDA 4M19A 1M7JA 3PANA 1NU5A 2VI0A 2ZZ6A 4MY1A 4MGGA 2VX4A 3KW3A 3AIWA 1R8LA 5HA7A 1JYWA 1XPYA 4KMQA 4QS5A 3WX7A 2W0HA 4TVUA 5I3JA 3AIRA 4Y9PA 3NQFA 3CASA 4HHMA 1JD7A 3CXBA 1ZFJA 1GRTA 3T0TA 3W86A 1KM4A 3NO3A 1EJSC 3JW7A 3ME3A 5I02A 1ZUAX 5HDRA 4XV0A 3PPGA 1QFEA 4RX0A 3APYA 4Q8VA 2PPGA 4MLRA 3FDGA 1Z41A 2BCPA 2TPRA 2VMFA 4JZ5A 2PF8A 4M6VA 4QJ4B 1NOWA 2IPJA 1EIXA 2QIIA 4Q8WA 5BWAA 3G1XA 3WBAA 3N2OA 4GKTA 3TTYA 4B5XA 3DBPA 3EWUA 3F2DA 3WQWA 5FF7A 5HR6A 3SIMA 4ICNA 2ZWYA 4MB3A 2HNEA 5CZ0A 2JF7A 3L4WA 3A6OA 2VFIA 4JTDA 2L5HA 4LA1A 1A47A 1XYMA 4H01A 1UC4A 1OCBA 1ZCCA 1OCNA 2QPUA 2PEVA 3M0YA 2WNWA 3SCTA 3CEPA 2NUWA 2QAEA 1TTIA 5DMYA 3KBJA 2PDWA 5GNYA 3VZYA 1S38A 4OJYA 4J2MA 1XJBA 4PBFA 5TIMA 3W81A 1J0YA 1DOSA 3RPDA 3I3BA 1MZHA 1FKXA 1R47A 1SJCA 3KCLA 4H19A 3UW6A 3SB0A 1CW2A 4H4XA 3TFXA 4ZE4A 3LUTA 2C0AA 4KPRA 3RN6A 3K8MA 5FEPA 2QW5A 2QAFA 3UERA 5T9CE 1UWTA 2ISVA 1DHKA 3LZ3A 2QJMA 4E8DA 4RZ5A 4IISA 1K9TA 3DERA 4J27A 3T7VA 4JICA 4IPNB 1E4IA 1A3WA 1E3XA 1ADSA 1W3JA 2WMHA 3KVKA 2Q6ZA 4JQ4A 2OX1A 3OU8A 4JAWA 3FFSA 1KQZA 4L6OA 3FJ4A 2C3DA 5DMNA 1MWOA 2E9MA 3V5CA 4EQWA 3QV9A 1CI1A 1DEDA 2ZRYA 3AWOA 3MMTA 2AOSA 5H6HA 2XGIA 1W1TA 3BZGA 1Q6OA 2OQHA 3G1YA 4B15A 3LHZA 4RDZA 3D3AA 5D4YA 4LNCA 2QF8A 2VCCA 3HG5A 4TMBA 3N18A 2HV5A 3GC5A 3UXKA 3P3BA 1A5UA 5LIXX 4J28A 1P6CA 1LWHA 2W91A 5FJTA 1VFMA 3MHFA 1H60A 4S39A 3VD9A 1H7OA 3BOFA 3QFBA 4B5VA 3S0CA 1N2VA 3UWVA 1H7NA 2FHBA 3LU2A 3C0SA 1FXQA 4YMZA 3CEUA 2ZZ0A 3W7NA 1CWYA 2AGKA 2J9YA 3WQFA 1OX4B 2XFFA 1TCMA 4GH1A 3VOFA 3QW3A 4GIYA 5FJOA 1XSKA 3KRZA 3W83A 3QSTA 3BSMA 1MXDA 3LXCA 1SO4A 4LAUA 1IR1A 1XYFA 2XIOA 2VZUA 5AC4A 1HKJA 1H7XA 4DN1A 1JULA 1LF1A 4TV6A 1LLOA 5A8PA 4QRNA 2EJ1A 1OZMA 4GZEA 1DWJM 4ICMA 4ZL1A 1JAKA 3W7QA 5E93A 1U1JA 1EXBA 3LG3A 4CNUA 3LV5A 4R85A 2AL2B 2CWXA 4V15A 1YKWA 1OG0A 4GGBA 3N2CA 1GONA 4NYUA 3UF9A 3RIKA 1UJQA 2QPXA 2O9PA 3VKKA 1YPXA 1LLWA 5M17A 4LB3A 3KRSA 4X22A 4GY7A 9RUBA 1FWWA 4DHGA 4ERIA 2G5WA 2UY4A 1XLKA 3GDLA 3MKKA 3QR1A 3PBYA 5HBFA 4IWWA 4QLKA 1QI0A 3WDHA 3M0KA 1EXPA 3WEMA 3SGUA 4A6GA 1DWAM 4POCA 3E2RA 2CLOA 3HG3A 4EP8C 1GYLA 3TZNA 1ZZMA 2JQXA 3JUGA 4XKMA 4LS2A 1GVIA 3KWXA 3PM6A 3U2OA 4M7TA 5EY5A 1SB3B 4MWAC 3NQ7A 1EPVA 2D2GA 5D33A 1S5VA 5EFFA 4UUIA 1UG6A 3REQA 5C9RA 2DSZA 1XRVA 2YB4A 4ZQCA 1UMYA 2R82A 2BOGX 3VOJA 2OG9A 5K9XA 3D9XA 3BOLA 3U57A 3V1PA 2ATMA 4JKKA 5AVNA 2CCRA 2WXDM 3HJZA 2FHCA 1VGAA 1TMLA 3CGCA 6XIAA 2X50A 3QN3A 3CGTA 4AX7A 1X7FA 3VFLA 3W70A 5C5YA 1FWSA 4QBXA 2NV9A 3NQMA 1T6MA 4QLJA 4EOUA 3AS3A 3CPRA 3MVTA 1RA5A 2QCHA 1H3GA 1UQZA 1W1ZA 2GJPA 2GH5A 3DK4A 1ODUA 4LYRA 4FNSA 1HGWA 3MYOA 4FX7A 5FD0A 3SRDA 3OBEA 1KFEA 3GRTA 1UASA 3QMTA 3IRDA 1EJXC 2ZUTA 1OY0A 2H8XA 4E4FA 2DU2A 4JTJA 1SJAA 2YBTA 3GIPA 2Z29A 3PWIA 4G8TA 2DH3A 3I68A 4I7VA 3C3UA 3GVWA 3W2JA 4CU6A 3NAVA 3WMSA 2W54A 1AL8A 3T40A 4O4VA 1DVJA 4KFPA 2GVEA 2EQ6A 3SCRA 1JF6A 3DC8A 3DU0A 4JCMA 1RCQA 4XZ9A 4X3ZA 4K7YA 2GR3A 1B4EA 3MSDA 1K6WA 1TB3A 3AZSA 3EWZA 2PDMA 1LOSA 3A22A 3NZRA 1OM0A 5ABHA 1Q1RA 2E8YA 1NF0A 2FHFA 3TTQA 1HT6A 3GHUA 3B9AA 1YTEA 4JL1A 4JQ2A 4L5ZA 3LHTA 4Z2JA 4DYEA 3PTQA 1BXBA 3BURA 4DEFA 4GLEA 3W07A 4F2UA 2VRQA 3JU2A 5DMLA 3MP5A 3T8LA 4GQGA 1MUCA 4R9OA 4HHLA 3LD5A 1MDRA 1AUSL 4RXGA 2JKPA 3LMYA 5F2IA 3E3HA 4XO6A 1DV7A 3N1AA 2WKJA 1G7VA 7REQB 3AUOA 4ZO7A 4B3ZA 1OYBA 1XL9A 1IXPA 1THFD 3I7RA 5EFDA 1SJBA 4PMJA 1PIFA 4PN2A 3KS5A 2XSBA 4GVGA 2XVKA 4MF4A 3U8GA 4IXHA 1QI5A 1B31A 2QF7A 4E3TA 2Z28A 4L1XA 1PTDA 1ML1A 3BC9A 4QAWA 4YJ5A 3N6HA 4E2BA 1CTNA 3JZUA 1IWPA 2ALRA 3NYDA 3G3MA 4HMEA 5MKGA 3W82A 2GJXB 3F5LA 2VFDA 2ISSA 3KS6A 2YR1A 3A5VA 4IMAA 3MV01 4NAEA 3QY8A 2DJLA 4C60A 3CPUA 1S1RA 4UTMA 1FFRA 1E9LA 1G9HA 1F73A 3B4UA 4XD4A 1OIMA 2VC6A 4ES4A 4H6EA 1W3HA 4CNSA 2PZNA 2A0NA 3IJ9A 4NEVA 4JL2A 3T2PA 3N2TA 1PXGA 4R3UA 1BF2A 2ZVIA 3M7SA 3F4DA 1M9HA 2VGBA 4DUVA 4KCVA 4LAKA 2F84A 2X1IA 3RHGA 5BOEA 4MOZA 4LYKA 3TLLA 4LYPA 4D1IA 2A4AA 3I65A 1V02A 4ZZ9A 2QQ6A 1W54A 3HFTA 1WAWA 4HN4A 2ZKMX 2GUUA 4AU0A 1XBYA 1Y5XA 3FJNA 3VGBA 3UXLA 3MUY1 1OCQA 4H9YA 4GH3A 4CD4A 1GVQA 2FZDA 5GVJA 1JF5A 3EKLA 4GUGA 5GNXA 2I16A 1OB0A 3N15A 1UR3M 3T08A 1VP5A 1REQA 3TUUA 5JMUA 3H53A 2YGYA 2QR6A 1TX0A 4M1BA 4UQDA 4O1DA 3M5VA 2CETA 4MAVA 2X8RA 3DGZA 1ZCOA 3AQUA 1B2YA 3UR8A 1O94A 3ES8A 5BYWA 1XRTA 3ITLA 3VDCA 4ZO6A 2E5AA 3CAQA 2IXVA 4KRUA 5D2TA 1XLCA 2HPMA 1H5YA 3P93A 1IE7C 3PWGA 4LVDA 2D20A 4FR6A 4IMDA 3O06A 1X1OA 5DBUA 3GG8A 5HNUA 7ENLA 2CEQA 2ZC8A 2NSXA 3H4WA 1X98A 3W00A 4G1KA 2WMJA 1PTGA 1DJHA 2CZDA 3WLNA 3DKJA 4J35A 2HPIA 3IRSA 3LTYA 4H41A 2Y89A 3Q4DA 1D9EA 1YTKA 4LRTA 4O13A 4BEUA 2IUZA 4LRSA 3GD3A 3RF9A 1B5TA 1V77A 4ZQNA 4ONVA 5FCZA 2CNCA 4W93A 2Z1VA 1EWDA 2E6DA 4HPGA 3WLPA 2J88A 2WC3A 4NU7A 4PODA 1R3SA 3MUZ1 3WH7A 4URIA 3THQA 1MQPA 4JHOA 1V8EA 1V6WA 3WIJA 1PX4A 2W66A 5HK4A 3O2LA 2XFRA 1GWJA 2VZSA 3CUXA 5IRPA 4R9XA 3WLMA 4P7NA 1HJQA 4PE8A 2PWDA 4JFUA 2OXNA 3GY1A 2A1YA 1IZCA 4J9JA 1GUVA 2QCNA 3EDDA 1KXTA 4MB5A 4PUKA 3OIHA 4E3VA 3ARPA 3N2BA 3S9IA 4IH3A 1P0DA 1MZRA 1ISVA 1UA7A 4RR4A 5A6SA 3VFCA 2CXEA 4W85A 3MJYA 5HWMA 3TK7A 4RE2A 2WZIA 2GJRA 3DG3A 2CDUA 3R94A 2PDKA 1SGJA 2W4XA 2V0TA 4WKHA 3M0MA 1TQXA 2J7EA 3WQEA 1UR0A 3TSBA 1XR2A 1S2AA 1MUWA 4AHOA 4JPGA 1WDRA 1G69A 3VD4A 3CO8A 4AG0A 1XCWA 4KCTA 1UPMB 2Y8KA 3LXAA 2ZADA 3RLVA 1US0A 3BZJA 3MI3A 3AFBA 4BA0A 3LGDA 3DG7A 4S3EA 3G18A 1VIZA 1R3QA 1LORA 5EMYA 5A6BD 1SFSA 4PB4A 2Z27A 2QMJA 1Z69A 4C1KA 3FKRA 3LBMA 1SUXA 4QE5A 2Y6ZA 4WXZA 4D1JA 1E43A 5L6UA 1XWYA 2EQ7A 3RJYA 1A3HA 4GVFA 3M0IA 3NFUA 1GQKA 2JIWA 3UWZA 3ITYA 2W6RA 3FGCB 4DF2A 4HSOA 1BGAA 1MW2A 4GVHA 4RJEA 1YPIA 2HS8A 3AOFA 3B06A 1JYXA 4BY3A 2J3NA 4RCXA 2C1GA 4KEMA 3P84A 1E0UA 2GJXA 2Y7DA 1K70A 5G4EA 3SN4A 4XIAA 1RUSA 1H1ZA 3E5PA 3TX9A 4NAEB 1UD4A 5A8OA 4GY0A 4BS0A 1XBVA 3MB9A 1WDQA 2Z7GA 4UZSA 3LGEA 1KXHA 1EBHA 2WMGA 3W1TA 4W8BA 4PULA 6ALDA 2C91A 3P5YA 4AYGA 1UH4A 3B0PA 4IQEA 5G2IA 2W9MA 5BXRA 3M44A 1ZHAA 3G22A 3UCQA 3LRKA 3TH6A 2FDMA 5JUVA 4GBUA 3BAKA 3EWYA 3RXZA 1BEUA 5KETA 2MANA 3WLLA 2GOUA 4FXFA 1KRAC 3TAOA 2EGZA 2EPMX 2NQZA 3M43A 4D6HA 1BYCA 2AAQA 3TJ4A 3G8RA 1UKOA 4AD0A 3MT1A 3VNZA 4S2BA 1R3VA 1I2OA 3VIGA 4C6OA 1EYEA 2F7FA 3SFWA 3ARSA 4GIAA 5KVHA 2XSAA 4A8IA 2IKIA 4FB7A 2CYGA 3MZ2A 2HVOA 1AG1O 1V0KA 1VH7A 1GZGA 1VJIA 4JTCA 3WENA 5DCDA 5FL1A 4Z17A 5E5CA 3T6CA 3FN9A 3KP0A 3DGBA 3AYSA 2BB0A 2G96A 2BS9A 3CIXA 1TPDA 1YXDA 4QNWA 3REQB 1Q6DA 2PDXA 3CZLA 2PLMA 5EU9A 3WG6A 2W63A 2FDSA 4MZ8A 2B7PA 3M0JA 3OPSA 3ITVA 4NKCA 4WY0F 1T8QA 4PB5A 5IM51 1Q8JA 3ZMRA 4P7RA 4KQNA 1OQFA 1XLFA 1EJ7L 4JTSA 1VEPA 4HCHA 2FMOA 5DRCA 1UP3A 4NZJA 1NAL1 4BI7A 4G56A 2YCEA 1UJPA 3GW0A 4EPEC 3VX0A 4Z2IA 1FWFC 3W85A 1E4MM 4Z1AA 1XPGA 1ZU8A 4AD4A 3VI2A 1MEHA 3HPFA 4J7RA 3APTA 3CV7A 4LV4A 3L5MA 2GQ9A 4N4PA 4IX0A 2VD9A 3SQLA 3GNRA 3S1GA 4XTIA 1UMLA 2CHRA 3R8HA 3NVZB 5JBDA 1QNVA 1OT1A 2D73A 2FKPA 1IR2A 3EAUA 4DWSC 3SCSA 5JCMA 3TW9A 1OFOA 4GYFA 4IPPA 5CCZA 1V3IA 3DGRA 3N2XA 1XINA 4E8GA 5I09A 4QISA 2QCDA 5DN1A 4Y9AA 2X1RA 2PU0A 5CLWA 3DUGA 1F07A 3PY2A 3BV4A 2EQ9A 3DHDA 3NQ2A 3EMZA 4ACZA 2PDJA 1ZJIA 2J7BA 4XZMX 3VTRA 1KM5A 1XLAA 3T05A 4W4QA 3HQOA 3ZFHA 4O8RA 3A21A 5ER0A 2VENA 2YCLA 3HTWA 5DX7A 3L67A 5LIYX 7TAAA 2ZRXA 4IIDA 4UWMA 3VMPA 4WD0A 3O6CA 2J25A 2X16A 1LUCB 3QFAA 4OOUA 1EF3A 4H4YA 5BMXA 1X6LA 2QJGA 3IIVA 2G37A 1P1XA 5C0QA 5LXEA 4YHEA 4DAIA 5I3FA 3KBVA 2VVNA 3IS4A 3W1QA 1BF6A 3GHRA 3GH5A 1JRCA 4GNJA 3WK2A 2CZEA 5BXTA 1W5QA 5T91A 4Z2GA 1CB2A 1L8NA 3EWWA 4Y2WA 5F4SA 5G2WA 4EPBC 4FF7A 2P1FA 2ASHA 5CQ1A 3NQ6A 1HJXA 3G1AA 4JTUA 4QS6A 1JR1A 2XISA 4S3AA 3ZR5A 3PBGA 3MKVA 2PWUA 4FXRA 4JQ9A 1WUFA 5HJLA 2DPEA 2RH9A 4K7ZA 2VC5A 1H1NA 3LRMA 2E68A 3E2QA 2FJUB 2HQAA 3W7CA 3VD5A 1Q65A 3YPIA 2QDDA 2C3CA 2REQA 2Y7EA 3TQ0A 4J3ZA 2WPFA 3OOQA 3AAMA 4H8HA 3AXKA 4HJFA 1FWRA 4ZE5A 3T78A 1QPOA 4PCNA 4XAFA 4OBTA 1GVFA 4H8VA 4WDWA 3EANA 2J7HA 1V03A 2G3FA 1NDZA 3LTSA 5AYZA 4M81A 1J96A 3UP8A 3AMCA 1TE1A 1PKLA 3ZSTA 3W37A 4OBSA 3R8RA 3CNYA 1DJYA 4B3KA