3RGTA

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with d-arabinohydroxamate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
403
structure length
383
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of d-mannonate dehydratase from Chromohalobacter salexigens complexed with d-arabinohydroxamate
rcsb
source organism Chromohalobacter salexigens
molecule tags Lyase
molecule keywords D-mannonate dehydratase
total genus 141
structure length 383
sequence length 403
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2011-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3rgtA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3rgtA01
3GD6A 1EC8A 3UCDA 3U9IA 6ENLA 2HXUA 1XPYA 5FJOA 3PWIA 1JCTA 3ZLHA 2XGZA 2RDXA 3RRAA 3THUA 5IDZA 3H70A 4MMWA 4HCDA 3V5CA 3DIPA 2PTWA 3OTRA 3UJFA 3CT2A 1KD0A 3RR1A 3R1ZA 2GGIA 3JVAA 4HNCA 2ZC8A 4KPLA 1P48A 2GGEA 3DESA 3BOXA 2QGYA 3KUMA 4FI4A 4A6GA 4K2SA 3SN4A 2QDDA 1DTNA 4IL2A 3MSYA 1EBHA 1NU5A 1SJBA 3I6TA 4G7FA 2XSXA 4DX3A 2P88A 3CYJA 1KKRA 4A3RA 3N4EA 4HCLA 3S5SA 2ZADA 4A35A 2DW7A 3VA8A 4DYEA 2MNRA 1MDRA 1KCZA 4GMEA 1MDLA 3PK7A 3FJ4A 2PU0A 3TJ4A 3D46A 4JN8A 3OZMA 2OQYA 1MNSA 1BKHA 4M0XA 3DGBA 3T8QA 1JPDX 4GIRA 3QTPA 2OO6A 2POZA 2DW6A 3V3WA 2AL2A 5FJUA 2GGHA 3U4FA 3FCPA 3TCSA 3RGTA 3DEQA 3D47A 3P0WA 1WUEA 3DG7A 3UGVA 3ZVHB 3DERA 3S47A 3NO1A 2AL2B 3N4FA 4DN1A 2OG9A 2PGEA 3IJLA 4DWDA 1R6WA 1SJAA 2QQ6A 3RCYA 1TZZA 3T4WA 4IT1A 4IL0A 3ENLA 2P0IA 3IJIA 2HNEA 3Q45A 2GGGA 3I4KA 1TE6A 2PP0A 2I5QA 2PS2A 4HPNA 3UJEA 3HPFA 3SN0A 2XH0A 1SJCA 4YWSA 3FV9A 1MUCA 5FJTA 5BOEA 4MGGA 4KT2A 4GGHA 3IJQA 3SJNA 4GFIA 4GISA 3V5FA 3TWBA 4GYPA 4H1ZA 3FXGA 2GSHA 3VFCA 4M6UA 3P3BA 1TKKA 4JHMA 1OEPA 2GDQA 2PODA 3IK4A 4HYRA 4IHCA 3STPA 4ENLA 3FVDA 3H12A 4F4RA 4ZCWA 2PTXA 4X2PA 1WUFA 1L8PA 1SJDA 5BOFA 3N6JA 2PCEA 2OZTA 4E4UA 1EC7A 3VCNA 3SBFA 1FHUA 4GYPC 4IP4A 2GL5A 1RVKA 3SN1A 2GGJA 4J1OA 2PTYA 4EWJA 3BJSA 3OZYA 4G8TA 1EBGA 3UCCA 3TTEA 2OQHA 4HN8A 3R10A 4E5TA 3QKEA 4J3ZA 4JN7A 3DG3A 3MUCA 2PMQA 4E6MA 3VC6A 3DDMA 3MWCA 5ENLA 1KKOA 3T9PA 3ZLGA 3QN3A 3I6EA 4E8GA 1YEYA 2PA6A 2OVLA 2P3ZA 3N6HA 1PDYA 2P8BA 3DG6A 3R0KA 2O56A 2PU1A 3CAWA 4KWSA 4IP5A 5FJPA 4HCHA 3MY9A 7ENLA 3ZVIA 3OW1A 2OX4A 1PDZA 3FYYA 5J04A 2AL1A 2XH4A 1R0MA 3V4BA 3EKGA 3ZLFA 4H2HA 2AKZA 4IZGA 3CK5A 3B97A 4H83A 3PWGA 2FYMA 2HXTA 3R25A 4Z17A 3VCCA 2QVHA 3R11A 3CB3A 3UJRA 2PTZA 3ZVHA 2ONEA 3DFYA 3TW9A 3TQPA 3ES7A 1FHVA 3UXLA 4H19A 3MZNA 1IYXA 3JZUA 3MKCA 3UJ2A 4GGBA 2PSNA 2MUCA 5EU9A 1JPMA 5FJRA 4DHGA 3GC2A 2QJNA 3P93A 3UJSA 1MRAA 4Z1YA 3VDGA 3T6CA 4ROPA 3TWAA 3MQTA 3BSMA 2OKTA 2XH7A 3ES8A 3PFRA 1P43A 4K1WA 1ECQA 3DFHA 3EEZA 3NXLA 3NFUA 2HZGA 3NZGA 1F9CA 2QDEA 1JDFA 4HNLA 2PP1A 2P8CA 2FKPA 2AKMA 3QPEA 3TOYA 1NELA 1XS2A 3H7VA 4FP1A 2OZ8A 2PGWA 1W6TA 4K8GA 3CXOA 4DXKA 3R0UA 4E4FA 2OFJA 2PPGA 3RO6A 1E9IA 2PP3A 1BQGA 3SSZA 3OP2A 1EC9A 3K1GA 3H8AA 2XH2A 2NQLA 2QJMA 2OZ3A 3GO2A 2CHRA 2QJJA 2OPJA 3TJIA 4ZA0A 3Q4DA 2OLAA 3UXKA 4KEMA 3JW7A 4MKSA 3GY1A 3RITA 3OPSA 1ELSA 3QLDA 3SQSA 1ONEA 3VC5A
chains in the Genus database with same CATH superfamily
1UG6A 3V0UA 2D73A 1ZNNA 2PGFA 2ZTJA 4XBSA 2ZRZA 3QEZA 2J7FA 3LX9A 3T09A 1UZ1A 3TXZA 3DH7A 4LANA 3ZLHA 4MJ2A 4RKAA 3A7AA 4MMWA 3SCWA 3SEPA 1XGZA 3CAKA 2YL8A 3WL1A 2GGIA 3U8GA 2YGYA 4M52A 1FDJA 1J0IA 2Q6ZA 4HPGA 4GIAA 4RZ5A 1KBIA 1VLWA 3R2GA 1PWLA 4X9SA 2GQ9A 4EACA 4PMDA 2CXEA 3SCNA 4YXGA 5DELA 1SSDA 1GNXA 4S1FA 3BPWA 1EX1A 4UTJA 4LBRA 2V9DA 1VCFA 1S2VA 2BX7A 1QBAA 1LJYA 3W88A 1KFWA 4QE1A 3RUBL 3IARA 4V1YA 1G0CA 3GVGA 4WXYA 1FDZA 4S3DA 1HZYA 4GH1A 2X1RA 3GNXA 3PTKA 3BLKA 4QNEA 3PG6A 2H9AB 2PDJA 1EDQA 3GG7A 1UD6A 4CN1A 3NPUA 2E3TA 2OR2A 1UWRA 3VD9A 1V6VA 2POZA 1JD9A 1QK2A 2DDXA 5JMUA 1K3UA 1HO4A 2RHGA 1RR2A 1D9EA 4DO4A 1G4TA 2D22A 4QQ3A 5D30A 3ANUA 3TCSA 1ZJIA 3UZZA 3AIEA 5HMFA 3A3WA 5ECUA 1RA5A 4DM1A 2PEVA 3YPIA 4V2XA 5F1VA 2W54A 1R6WA 1TZZA 4DJDD 1VCVA 3VFLA 2QCMA 2HNEA 3QV8A 5J5RA 1EQPA 3EDKA 4QJ5B 1JYWA 3RPMA 3ZS4A 3TYZA 1VFFA 3HPFA 4YYFA 4XKMA 2GJPA 4IIBA 1GRBA 3VIOA 1IR2A 3TYBA 1HKWA 4BA0A 2CDUA 3ARTA 3WZ0E 4GCXA 2X1SA 3V5FA 4YWIA 5FAGA 1OC5A 1MW2A 3BH4A 4JTDA 5CLWA 3A6OA 1TFVA 1BWCA 3FDGA 3GR4A 3H24A 4HA1A 3UFYA 2R14A 1TR1A 2W62A 1JRCA 4ZOAA 2ATSA 5G4EA 2YLAA 3VDHA 3PAOA 2ZRYA 3W07A 3RLGA 3H12A 3UA3A 4RJEA 4U31A 2D20A 4MY1A 1GJUA 1RY0A 3KL0A 2YL6A 4OKDA 1TJPA 2BTMA 1SB3B 3CWOX 5FI8A 4IGHA 4D1IA 2W92A 1GOXA 1JQXA 2DVTA 2Y7FA 1PXGA 4K68A 1CX9A 1LLOA 4TV5A 4EM3A 5FL0A 3SBFA 1D2KA 3CUIA 3FA5A 3UZYA 2W67A 1S3HA 2Z1BA 4S2BA 2DQWA 5FJIA 2HV5A 4K3ZA 4HD5A 4Q33A 4IP4A 2E7FA 3LRMA 2C1HA 5JVLA 1J18A 2ZRWA 2J24A 3IAPA 3N9KA 2PTYA 3QZEA 2Y85A 1JI1A 4EWJA 3KWSA 2EJ1A 3M0XA 5REQA 3LPFA 1BYDA 3RXZA 3DC0A 5M1TA 2GDVA 4QSHA 6REQA 5IFPA 1YKWA 4E6MA 1XG4A 2NXIA 4LJ3A 3IGHX 2FFCA 3C3UA 5LIWX 1TA3B 4ZMGA 4E8GA 1ONFA 2KX9A 4HNUA 3GVVA 3D3FA 1XUUA 2UZ9A 1PDYA 1FQ0A 2PWDA 2ZRVA 1E40A 1A5SA 2BCPA 2P3EA 2BXVA 5I3FA 1QU4A 4AEOA 4NEVA 1OFAA 1F6YA 1ZAJA 4EAMA 5LXEA 2Z7KA 1XIJA 2W0UA 3QGAC 5TAOA 2OSXA 1H63A 4LVBA 5I79A 1VZWA 4GY0A 1UP3A 3E5BA 3HA1A 3NL2A 1NWUA 2V3FA 3HPAA 3SGUA 3ARYA 1XYZA 3PHAA 1KR1A 4Z17A 4Q6XA 3SADA 3UPMA 3NGFA 1P1MA 4H4XA 1NFPA 3UJRA 2PTZA 3W00A 3ZVHA 3ZMRA 2R6OA 1KC7A 1F73A 5I6SA 4UNLA 3VOGA 1V6YA 1GYNA 2EQ8A 3S2CA 1FHDA 2QJHA 2AQVA 3EXSA 1HGWA 5AHFA 1CB2A 3AROA 2OMAA 4IUOA 1KFEA 2ZQ0A 2QJNA 2VDHA 4QLKA 2PZ0A 3TWAA 2VZOA 3QBUA 4XZLX 2CBIA 4LUYA 2A3AA 2DT1A 2CZ5A 3CZGA 2P10A 3NXLA 4ZVJA 3ABQA 3UXDA 1E72M 4AWUA 1YPIA 4TV6A 3NYZA 1MO0A 4WUIA 1O60A 1KR0A 3LMYA 2HS8A 4GIEA 5HPOA 4HZ8A 2JALA 4Q4RA 4RDVA 4K38A 1I45A 1GJWA 1G01A 2OZ8A 3MI3A 3VM7A 1Z41A 4A8IA 5IHRA 3EZ4A 4YMZA 3G1HA 5A6SA 4O0ZA 3CUFA 4GBUA 4IJBA 2ZA2A 4YS1A 1GQIA 1JJKA 2GR3A 2XH2A 4PUEA 3L0KA 3UWZA 2OZ3A 4RNFA 4UWMA 4KFPA 3FGCA 4Z2HA 4W5ZA 4HSOA 3NXFA 4EF9A 5FESA 3LSBA 2B7QA 3GBEA 1KWKA 1DNCA 3CIWA 5A95A 3DBPA 3TONA 3LXAA 5F4WA 1SO4A 2R9RA 2PB1A 4IPLA 2QV4A 4NNAA 2V3AA 3W7MA 3G6LA 3W53A 4S39A 3VIIA 4I7WA 4ILSA 4KETA 4WOQA 4TVDA 3BK0A 1E3ZA 2UWFA 1QNQA 4ADUA 5I24A 3CQHA 3K4WA 3GD3A 3HF3A 5KSWA 2I5IA 3W7GA 2GZXA 3M0YA 4PL2A 3AXHA 4BQ5A 3CHVA 4FNTA 4LSBA 3VKDA 5LIXX 3G0SA 2D0GA 4GZEA 3ZZ1A 2X8CA 5M03A 4A6GA 2MANA 2ZWZA 2Q3OA 3B05A 4NILA 1DKWA 3SN4A 4GOAA 4JTCA 5CPSA 2CNCA 1EJRC 2V3GA 2GR1A 4AMCA 3LERA 2V6AA 4E8DA 1TVNA 4HA0A 3S5ZA 2YL5A 1FWSA 3NAVA 3W7DA 3QJAA 3VA8A 4JQ3A 2WCGA 1RP8A 1RCQA 5TQLA 1MDRA 4O4VA 4XD3A 2AGTA 1YYAA 2ZZ0A 3C0SA 4QFUA 4LW7A 1JPKA 1JCXA 2BC1A 4X2RA 1O68A 3G1FA 4MPQA 2FH8A 4HU0A 2VFIA 3GDBA 3T8QA 4HA3A 3IVSA 2OO6A 1R87A 3GFXA 3E3HA 2ZXAA 3EAUA 1H60A 3W01A 3LENA 1ITUA 2ZA1A 4I9MA 5FJUA 1UD4A 1IF2A 2VQTA 2VEPA 5T9CE 2GGHA 2Z25A 4K39A 1K8XA 1KGUA 1OYBA 5BXTA 1U5HA 4C1KA 2ANUA 1AOGA 4I7VA 2REQA 4PE8A 1CZ1A 4GYJA 4KH2A 2V8ZA 1QCWA 2DZWA 3MCNA 1EP2A 4G7EB 3CUZA 4IT1A 4IL0A 2E77A 1GUVA 1G6CA 3KRZA 1EEPA 4HT3A 3WF0A 5A6KA 3P7YA 4N0RA 1EZWA 4KGLA 4BS0A 4ONVA 4G6CA 4A8RA 1WE5A 4DEFA 4J5NA 4ORIA 1W56A 4K7ZA 1GESA 5J8LA 4AX7A 1BPLB 3EYPA 4NEWA 5C2XA 1UQYA 4DPQA 1H6VA 3IIZA 5HNUA 3WG6A 2DSWA 4ZBCA 1RLDA 4RPQA 3PANA 2BOGX 1CENA 5EPDA 2XIBA 1KGXA 4O0KA 1M03A 3GRTA 2WZMA 5E9AA 1KO0A 1QFEA 2Y8VA 3O6YX 2GQ8A 1UB3A 2DV0A 3HMJG 1QR7A 3EXTA 1XICA 1KQZA 3TA6A 4CUCA 5JH1A 4Y8EA 2EKGA 1P6BA 4UFKA 2Y6ZA 1GEHA 2J7CA 4NAEB 4KERA 3Q2DA 4MOZA 3RNDA 4LRTA 1TPC1 4KQNA 2JKEA 3W1QA 3QOKA 3LK6A 2ZZBA 1JULA 3E74A 1NDYA 1XIHA 4A4AA 4E4UA 4EPKA 3NEHA 3HPXA 4EMWA 3VZZA 5A6AA 1MXSA 4LY4A 1NDAA 4WKHA 2PURA 3CPGA 1JCNA 1ME8A 1T0OA 1H41A 5JCMA 2GJXA 4YL2A 2CBJA 3P2VA 1XGEA 3W7HA 1QI0A 2PDCA 3NQ8A 4P7QA 3P84A 2BSLA 2H3DA 3NDOA 4UZSA 5BXPA 3B03A 2A6LA 3TU9A 3LY0A 4AXNA 4NIRA 3WJXA 4L6DA 4J3WA 4JX5A 3WLRA 2GDUA 2XGIA 1M9HA 3ZLGA 2NZLA 3T2OA 2VELA 1FOBA 2PA6A 3A3HA 3N15A 3QGVA 3VOHA 4H4WA 1TTJA 5I09A 2CLMA 3PZIA 5FJPA 3E2VA 3TLQA 3KVJA 4Z1CA 3NQFA 2I9UA 4DO6A 1XQLA 3CMGA 5G4WA 4HOZA 5CKSA 4LUIA 4IMEA 3N73A 3T05A 1XD1A 5D38A 4HP5A 2AKZA 2Y1HA 4PMZA 4FIRA 1RY8A 2VKZG 3R25A 3SCOA 1FEBA 1JZ2A 1MFVA 1EPXA 1J79A 4YU1A 2WKGA 2FJKA 3BQ6A 1GYMA 2BOEX 2FJUB 3DJJA 1W5PA 3TW9A 1TV7A 3MZNA 2VZUA 4DUOA 2QPUA 1XDIA 3CIXA 3ERPA 1WO2A 1BD0A 2DFAA 4LU0A 5AZ1A 3S1GA 4MJ4A 4PCSA 3WX7A 1IXOA 1J6OA 3N11A 4QCFA 4DYJA 3JU2A 4KGJA 4JQ9A 4Q8WA 1UC5A 2C19A 5KZ6A 5I0DA 5EMUA 3LTPA 4AW7A 4XO6A 2E8YA 3WBWA 5IHSA 3T44A 3QRHA 3EEZA 3O0HA 4UFIA 4DYKA 2QNEA 5HBFA 4RE2A 3XISA 1FCBA 1X98A 3GUWA 1EQCA 2CERA 1ICPA 2P8CA 4JQ2A 4GBDA 2PLMA 4JBRA 2J3NA 2XUCA 5DBTA 1HP4A 4PODA 2NW0A 3QPEA 1GSNA 1RK6A 3GNPA 4N02A 4W8LA 3AMDA 1RSCA 2XSBA 3NYDA 1ONXA 3ZJ8A 3PZVA 1W6TA 4NJKA 4PUJA 3PVFA 3GX9A 1YBQA 3TC3A 1G4EA 3UERA 3BGAA 4JFUA 4JX6A 4Y9PA 4ACZA 2JKAA 1FWJC 5I7GA 2ZZ5A 1MMFA 2B4GA 3LOTA 3UG5A 3BG3A 3O06A 3SGGA 3ZFHA 1H5VA 4R27A 1OCNA 2FVLA 1JZ6A 4I5UA 4AZGA 4HU3A 3TEVA 2WSQA 4YTQA 3DC8A 2J47A 4U3AA 4UQCA 1VIZA 2NWRA 5DLCA 5LNUA 1DHPA 4JTRA 2QCDA 5HNRA 2VGIA 4UTLA 3F7JA 1IIGA 2ZXQA 2NQZA 3GH4A 1H5YA 1NOUA 3UCDA 3CQIA 3JS3A 1WYGA 3LXDA 4C1LA 1OFBA 2CU0A 5FS8A 2W3SA 4HSHA 5HA7A 5A3HA 3ATZA 3VABA 3GXFA 1ZZMA 2ACQA 3PF3A 2QEZA 3DFQA 4CD8A 3RRAA 2GJLA 3MPGA 1LF1A 3HTWA 3VD3A 4XZMX 3WH8A 2VC9A 3SQPA 1UUOA 5F7UA 2XFRA 4NZ3A 3F5LA 4HNCA 3O07A 3WLTA 2I5GA 3REQA 3LHYA 2DZSA 4G1KA 3UY7A 3LADA 4NAFA 3K30A 1EJUC 2XJ7A 3BCJA 4AXKA 1B3XA 1HJUA 3S5NA 2GK1A 3NL5A 3L0GA 4RK8A 4WY0F 5D9NA 1OADA 1ZJAA 4A05A 3THDA 2VDGA 1XBVA 1HJSA 3TTYA 4KCWA 1AZ1A 1GREA 2ZADA 4LPCA 3SIMA 1FFVC 1A5AA 1P0EA 4A3QA 4X22A 4IM4A 3SCUA 3QYQA 3S42A 1S3TC 1TPEA 3GC5A 3JR2A 1W1IE 1YNYA 3M7WA 1K9TA 3C0JA 1US0A 3IJ9A 1I2RA 4UMAA 1GEUA 4CQDA 3LI1A 3NZPA 4GQQA 2EQ9A 4GX8A 3W2NA 4JDRA 5A2AA 2V0TA 4GR1A 3LXCA 3BLFA 1OX6A 1J0JA 4WF7A 1KM4A 2XN0A 4EPBC 1XL9A 3IIXA 1RQHA 1W9BM 4CVUA 3FA3A 4DNAA 4GC3A 2E6AA 3P8JA 1K8ZA 1R30A 1YADA 1DXFA 3W85A 3RF9A 1FP8A 1QATA 3IJLA 2J75A 1LORA 3GDTA 1EDTA 3DU0A 1UW9A 3BURA 4C1NB 3XINA 4X0VA 1SMDA 3G1XA 3JRKA 1TPDA 4HK7A 4N9CA 5EMLA 3EOOA 3I4KA 2PP0A 4TX8A 2I5QA 3TTOA 2X09A 1Q7QA 2DIKA 5T9BG 1A5KC 1F4AA 1XLIA 2ZUWA 3SUSA 7XIMA 3TK7A 3CIVA 1C92A 1ZPTA 4L56A 1JZ4A 2OXNA 1HKKA 3VZYA 5F4SA 2A5HA 1OK4A 2OB3A 2QDHA 3DK9A 4U33A 4MLJA 1ODZA 2BP1A 3HBLA 4H3DA 1L9WA 5CG7A 2VEIA 4CN4A 4PC8A 2B81A 2X0HA 3G18A 3G6MA 4JQAA 4M6UA 4OZOA 3LGDA 5L9FA 3QKZA 2RUSA 4JHMA 5A6BD 3EA3A 4MUZA 2AGKA 3UNDA 2E5AA 1ZFJA 3UPBA 2QCFA 1IEWA 4R53A 4IIDA 4Z2KA 4F4RA 3N25A 1OX4B 4HB7A 3OIHA 3QXBA 4QP0A 3E2RA 2F38A 1KV5A 3CZEA 1NF0A 4L9ZA 1E43A 4JTKA 2QF8A 3WQVA 1NEYA 2VFEA 4W8BA 1MFUA 3RK8A 1TJ0A 1V3MA 3KVMA 1FH8A 3VGGA 4ZO9A 1E4IA 4XWUA 3BMVA 4KS0A 1DJYA 1W2VA 2WOVA 3PZUA 5HATA 3AS0A 1R2TA 3SB0A 3UCCA 1EPVA 1CGYA 2W63A 1AH0A 1KM5A 2ZDRA 1IQ8A 4GJ1A 5LKYA 4QM1A 1TWSA 2ZDSA 3A64A 4LH8A 4MWAA 4W4QA 4WSJA 3WF2A 1JAEA 3ZQ9A 1H1YA 2CWNA 3PR2A 1V7YA 2YDAA 3U2ZA 4UR8A 2WVUA 2OOFA 4GUGA 3P81A 4HQVA 6ALDA 1BYAA 5I78A 1XHCA 4IP5A 2QUTA 1UBPC 1N8WA 2OQLA 3CHDA 2WSPA 7ENLA 2J8FA 1WB0A 1Q66A 2OX4A 4ECLA 2QCDB 2EQ6A 2AL1A 2PF8A 3S2LA 3BTNA 1ZBCA 1ZMDA 4WIWA 4HNNA 3UP8A 5I77A 1XKJA 4M56A 3LHUA 4DF1A 1OFPA 2ISSA 1DIEA 2R1NA 5EMYA 2Q8ZA 3I7SA 4LYQA 3R11A 5FEWA 4O19A 3DFOA 3T08A 3LM3A 2CLPA 4W93A 1OJXA 4IJCA 1OG6A 5EMKA 3MUAA 3M5XA 1C93A 1IZJA 3W25A 2J27A 5KZMA 1KFLA 2G3IA 1CGVA 1V03A 1GHRA 1XLFA 3BE7A 3ARZA 3VDGA 1OFOA 4NXKA 4XZWA 3RDKA 3MBFA 2DORA 4RE0A 3RM4A 4D6FA 5H8UA 1OABA 2ZA3A 2XH7A 2X50A 4Z2GA 1E9LA 3IGXA 2HZGA 1O1ZA 1VBUA 2DZUA 1U33A 3VE7A 3L2MA 2DT3A 2V2DA 3C3NA 4UCGA 4BEUA 3U57A 3QV6A 4PGLA 4DWSD 3KEHA 3R5EA 4ML4A 3W1XA 1F8WA 3ORWA 3SFWA 4G9PA 3T81A 4RW5A 4AC7C 1XS2A 5G1YA 4F0KA 5LNSA 4TX9A 3CWNA 3MMDA 5A6MA 5GVJA 3R0UA 3G5EA 3E02A 1FUYA 3WQ5A 3WJSA 1AMKA 2HE8A 1A3WA 3ZSSA 3CJPA 1VYRA 1M53A 3FW6A 1C8XA 1O94A 1UKOA 1E3XA 2H90A 1PS9A 3RJXA 1E1CB 1QJWA 1KXHA 3W26A 1Z6KA 3GHTA 5CGMA 4PCPA 3NQ2A 1XM3A 3L12A 3TFXA 4O57A 4Y9MA 3MUIA 2Z4GA 4JFSA 2X16A 2BVYA 2W0HA 4QNWA 5DCBA 1JF5A 1ELSA 4IF2A 4RE4A 3PM6A 2QYGA 4FNRA 4BQ3A 3KS6A 3TC6A 1M7OA 5E93A 4O8AA 5LA2A 1UMYA 3HOJA 3U48A 2DSZA 4U3CA 4A2RA 3PC0A 4HHHA 3PNZA 1IHIA 3II4A 3A4WA 3EOLA 5CZSA 4LT9A 4QS5A 3KZPA 4AG0A 4YTTA 2GR2A 3R8RA 3SRKA 4DVOA 4B4HA 1B31A 3DESA 1I9CB 2ATMA 2V5DA 2HBVA 1TUXA 3E1F1 1W3LA 4TVUA 4FX6M 1E6SM 1EBHA 4Z2IA 4GJIA 5U1OA 3C61A 2EQDA 4OTKA 1UASA 3W1PA 3S5SA 1VRDA 4AIEA 1KM0A 2X1UA 2BHZA 4N2YA 5I07A 1MDLA 1CLXA 4J3SA 5A5WA 1VEMA 3BMWA 3TJ4A 3H2AA 2D2GA 4GQGA 2FZ8A 1TV3A 4H9YA 2WC3A 4POCA 3M46A 1NAL1 1MNSA 4TVWA 5G4HC 2V3EA 5LA0A 5LIUX 1XCFA 4GO8A 2XWEA 1RCOB 2AL2A 2H8XA 3SAZA 3W23A 3ITTA 4H2CA 3TYDA 2BY3A 2FPYA 2XVNA 5D2TA 1RJRA 3C5QA 4DZAA 4HU4A 3S1WA 5DFAA 1WUEA 4JIEA 3M9YA 3W1UA 5M5DA 1NFBA 3GG0A 4IX2A 1K9EA 3N4FA 3COTA 4GY1A 1Q6DA 1GQLA 4QS6A 4RDYA 1MSSA 2YA1A 3W27A 1GETA 4EMIA 4W9TA 1GOOA 1JQVA 4F48A 3LBMA 3GIPA 3WCZA 4K8HA 3QZ6A 1B3VA 4R33A 4K8DA 4O13A 3WLLA 1ZBKA 5AC4A 1ZENA 4RZ4A 1JD7A 1H7PA 4DI9A 3AXXA 1MUCA 1HW6A 3FFSA 3FDKA 4PFHA 4Y9OA 2W3RA 4F3HA 5ABTA 1H7NA 1YE6A 2A3CA 2YZ5A 2YX0A 2F8QA 3BV4A 3CPRA 5HQLA 4GYPA 1RVGA 2E67A 3FXGA 3ABOA 4PRRA 3TX9A 1WZMA 3W87A 3RLUA 2WP6A 5FA5A 3WBAA 2Q8XA 4QHRA 3VZXA 3WLIA 5LXXA 2ZUSA 2HISA 3EA2A 3CM4A 4C6OA 3D5HA 2A3HA 4H9XA 1H4PA 3F2DA 4AZCA 1F6PA 1W3NA 4UTMA 3FOKA 2OWCA 4GUIA 3LM7A 2FB2A 1C9WA 4O28A 1J0YA 3M5YA 4IIGA 4HSNA 2IQTA 2NQJA 4LEFA 1EC7A 1R3QA 3GHUA 1H11A 4NX0A 2WCAA 3FNDA 1V8EA 3GVWA 4US5A 4B3LA 4M7TA 2BY2A 1F3XA 2C13A 3E0VA 3NURA 4ZODA 4JNZA 1I1WA 2VMFA 4WGHA 3PFMA 1Q1RA 1D3GA 3WDQA 2WW5A 4XZNX 1GRFA 2GQWA 1ZJBA 1MEIA 3OG2A 1G94A 1S2CA 2E28A 1CGTA 2BVTA 2H3BA 1PO9A 1V3LA 4PL1A 3GW3A 4IXHA 4NI3A 4HNOA 1AQ0A 1E1EA 4ZSUA 1F76A 4RUBA 4KKXA 1B2YA 3G2GA 4FLOA 3HJZA 3QGKC 3TVAA 5FEZA 2W55A 2P8BA 3FAXA 3UWYA 2INZA 4X3ZA 3D6NA 3RM8A 3U6WA 3W29A 4DAIA 3GYCA 3UVAA 1H3GA 3GC4A 4DY1A 2Y7EA 2R9ZA 3ZLFA 5CPTA 4LAKA 8XIMA 1GJPA 5D9OA 1G69A 3GXMA 3VIFA 1UIPA 3KFTA 4YHGA 4AU0A 4KWOA 2OWWA 3KHJA 1IEVA 1NWSA 1SR9A 1V77A 3BW2A 3ES7A 2E25A 1QWKA 4L61A 4UFMA 3C0LA 7CGTA 1MYRA 2ZUUA 3MKCA 3CUHA 4CNOA 2JIWA 1V5XA 4LCQA 4DNHA 1S5WA 1LRQA 5FJRA 1UWUA 2D2JA 3BAWA 3VX0A 4F0MA 1W5NA 1UD5A 2NVKX 1ADOA 2Y24A 3IVTA 5IM51 4MB1A 1POKA 1LBLA 1EP3A 3EPNA 4NU7A 2O9PA 4X60A 1WA3A 2ISFA 3BLEA 4XBJA 3W7CA 1I2QA 3ES8A 3BANA 4ZTYA 4C90A 2GOKA 4HHMA 4MIMA 1V6TA 2HSAA 1RA0A 3RPTA 3N34A 3CO8A 1EL3A 4YPJA 2R1LA 3DN5A 1PUDA 3AHYA 4ZGYA 4ZB5A 4W86A 4UNIA 1H1ZA 3RILA 1HUVA 4US5D 1UH2A 3GXTA 3MJYA 3E96A 8XIAA 3BARA 3P5YA 3MHUA 4M1BA 2KAUC 3MMUA 1P7TB 5FF7A 3ICJA 4PRWA 3KL5A 4HMCA 2A3EA 5DMMA 5A8OA 2ADAA 1UH4A 3WEOA 2OFJA 3RO6A 4MVAA 2PP3A 4LTSA 4PBEA 3NQAA 3N4AA 4LVGA 5AYZA 4IMFA 3K1GA 5K4XA 2WHMA 4M19A 2WVTA 2E1DA 2WM0A 2EPNA 2J78A 2ZC1A 3TDFA 1C29A 3UNTA 2G97A 3N12A 5FF4A 5DMYA 2Y62A 3THAA 3K5XA 4OECA 1PX3A 1U1UA 3E38A 1EH9A 4NF7A 3CTTA 3NIYA 5DBUA 3WQFA 3PJWA 4DWSA 1R9YA 1BF2A 3GU2A 2WQPA 4FEZA 3DFSA 3ZXWA 1EC8A 3NZ1A 3INPA 4MAZA 1VDVA 3O9NA 3OBEA 1W32A 4OBSA 4A3UA 2ZXDA 4BI5A 1TJRA 1NOFA 4J3TA 5HJXA 1XPYA 4AWEA 4CU7A 4AFYA 4RZBA 3GU1A 1TVPA 2WBGA 3DENA 1E9ZB 1GHSA 1RK5A 3F4CA 1E4NA 4L9YA 3FAWA 2X05A 7REQB 3OTRA 1Q6OA 1WKYA 3IPWA 5E6YA 3V0TA 1XLLA 3TC7A 1GVRA 3C2RA 5F2IA 3WBEA 4MY9A 1P0BA 4C7GA 1Y8BA 2W91A 4DAFA 4XK2A 4FLRA 3TR2A 3WF3A 3IVUA 4GXPA 3K8LA 4H4ZA 2VRJA 4JTGA 2X7WA 3LNPA 1BXNA 3AMKA 2I16A 1ISWA 2JEQA 1A0DA 1ZLPA 3MKVA 2GSJA 4FPSA 4JDYA 3HV9A 4E2DA 1CXHA 1OY0A 3WN6A 4JKKA 2W27A 2OYLA 1B54A 1L2UA 4JEQA 1NWRA 1F05A 2ACSA 4C6FA 4V28A 1DWHM 2HDJA 3WNOA 1CEOA 2Y89A 5CPOA 4O1FA 3N2XA 5DF0A 3IACA 2DEPA 4PUMA 3K8KA 1XFBA 3KHDA 3L23A 4AZBA 3TYUA 5CC6A 4OUIA 2W6RA 1B1YA 2GLKA 4YTUA 4WSKA 2WMJA 4LBUA 1GKRA 3V3WA 3V1PA 4N9EA 4CU8A 3U4FA 1QPKA 3APGA 3BJFA 3R43A 3UW6A 2BB0A 3FLUA 1J96A 1P6WA 3TSMA 3NM3A 4H7CA 3WDJA 3IAQA 2E5CA 3GYEA 4W88A 5D33A 2WOQA 1VIWA 3O8AA 3UXIA 1W1VA 2Z00A 1TRDA 4JYEA 2CLHA 2D3NA 3KLLA 1GQNA 2P0IA 1K7XA 1O66A 2CESA 5CBJA 1HKMA 4XAYA 4XTIA 1HKIA 1GK8A 2YXGA 2ZXBA 1EO5A 3SN0A 3UJEA 3SQLA 4LAZA 4UCFA 5CSYA 3PSWA 5C9ZA 1W17A 3M0KA 3DHFA 4KT2A 3GD4A 3PUDA 4I6KA 1YBQB 2FHFA 1CECA 1Q5MA 1IWAA 5DANA 1C8VA 5K3VA 1DTUA 4IFOA 1CBGA 4QEHA 3P3BA 4DQWA 4Y8FA 2IQ0A 3ZT5A 2QR6A 4K36A 1KBKA 1V6XA 1EJTC 2VEMA 4HYRA 3CB8A 4UXDA 3KTXA 1JZ3A 3H2OA 4LS2A 3AIUA 1O95A 1ITXA 3FVDA 1JPIA 3SSJA 4GABA 2PDNA 3BAXA 1XIBA 3BMXA 4Y9AA 4DUVA 4NJGA 4A8LA 5FKYA 3IRSA 2PTDA 5HWJA 3FG2P 4AEEA 1CWYA 5BOFA 4GLEA 1VJSA 3ARVA 3QPZA 4WKFA 1E15A 4JTFA 3VILA 2GFTA 4QDWA 1U5JA 1XC6A 1Q6FA 3BDKA 4Q32A 1C91A 2J7GA 3SIZA 3DHPA 1RD6A 3H2EA 1A5NC 5AC8A 4F0LA 4BKNA 3BLDA 1CLVA 3MMTA 1EJXC 4LAOA 1JCMP 1A5OC 1M1BA 2ZX8A 3L68A 5C70A 3SI9A 4NNBA 3BJSA 4ERIA 4JTHA 1OFDA 4GI4A 2VT0A 3WLOA 3KVKA 2ACUA 4PMNA 4UOJA 1RBOB 4AZ6A 4JN7A 1NJJA 1UPPA 2D0FA 1KWGA 4W7WA 4N9DA 3DDMA 2E8ZA 2GWNA 3AC0A 4ZENA 1R3YA 3NVWB 1FVPA 3DYPA 3TUUA 4ZEPA 5H6HA 2NT0A 3G8RA 4S3CA 3AAMA 1KNWA 2TPSA 2OKOA 3AZRA 3T0TA 4G5DA 3CV1A 4KEUA 3VNIA 3WQOA 4E4PA 4IWWA 4MHBA 1G1YA 3LLFA 3UF9A 1HO1A 1J11A 1NPXA 2OT0A 3PY2A 3ZR4A 1A5LC 3ZT6A 5A2CA 1WCGA 4DO5A 1OT2A 4PUWA 3NQDA 2G3MA 1G7VA 2ZBTA 3M1ZA 1YMYA 3PS7A 5AY7A 3GM8A 3HU7A 3N18A 3K8MA 3L8KA 3TJLA 3HURA 3DFYA 1YXDA 1OF6A 3FKKA 4F2BA 4HVXA 1E56A 1GPFA 4XTDA 7ODCA 2A3BA 1DXEA 5JCNA 2BZNA 4JEJA 3W72A 3BLOA 3ITOA 3NPWA 4CD7A 3BJTA 1VGAA 5DCDA 1ADSA 1DXIA 5K9DA 1TX0A 3POHA 1AL8A 3GNRA 5EU9A 4ZL1A 4R7WA 3EWCA 2WXDM 1F3TA 3WF4A 1OIFA 4Q8TA 4GVGA 4FXJA 2TMDA 4N7QA 1E0TA 2DJXA 1JIBA 4XAPA 3M43A 4OV9A 2WVSA 4E0CA 3O0FA 2WNNA 1I0BA 4ZOHB 1GG0A 2G37A 4GYKA 3ARRA 4JGDA 1H49A 3S6DA 3GVRA 4H01A 1FWAC 2PWUA 4HNLA 2J6XA 4ZE5A 1RZMA 3E6EA 4XD5A 1AQMA 3TYAA 4YIWA 1QTWA 1GVSA 2XIMA 1ZP4A 3D3AA 1HXJA 4OWGA 5EL1A 4KIRA 4C6MA 1UWAA 4MY8A 1WP6A 1JDCA 2J25A 4RZ6A 3NQVA 1LPFA 3O7UA 4XO7A 3H21A 3DAQA 4CD6A 3VX1A 3VNJA 3BAJA 1J2WA 1K8YA 1DWFM 4GINA 4NG3A 1LUCB 3LHZA 9XIAA 2H8ZA 4YVVA 5AN7A 3FN9A 2R82A 3Q6JA 1W3KA 2XFWA 5F2MA 4KRZA 2F6UA 3S83A 2J6VA 5A6TC 1AUSL 1R3WA 1P0NA 3A5VA 3PP7A 4AY7A 2WMHA 4V1XA 3PWIA 1P5BA 5DRIA 4EPDC 5GRTA 1QNPA 4DZHA 2J9YA 4BY3A 5CC7A 5JCLA 2O0TA 2VOTA 2AQWA 1LLWA 5U4NA 3CUJA 3VYLA 2X1IA 3M6DA 4B5TA 1SR0A 1EGZA 4PCFA 5H2ZA 3KRSA 3EPMA 2AAAA 3CZLA 4FNSA 1P48A 2VFHA 3GRIA 1FCVA 2VYOA 3I3EA 5H1WA 4FOUA 5I00A 2PWFA 3IV3A 4L1GA 1AJZA 4KIEA 3B9AA 1SM9A 5B7ZA 3QZAA 1XSIA 4Y96A 3EOEA 4US6A 4EXAA 4UTTC 2A6NA 2QS8A 5JXQA 3WLHA 4AWSA 4B9YA 3UZJA 2PF0A 3CUXA 4H7ZA 4DJED 2Z1XA 1SMAA 4DJFA 2A4AA 5HMDA 3G1RA 4PN2A 2YIHA 1BG9A 1UKQA 2VVNA 3FHQA 3APYA 4JN8A 1KGWA 4PUKA 3LUTA 3A7UA 5JCKA 3QY6A 3GXPA 3MA8A 4M0XA 1FWRA 3IS4A 3WH9A 1E0XA 2YZRA 3W2LA 2UY4A 4OE7A 3PSVA 3J7HA 1U5VA 3B8DA 4H4PA 3F4WA 1J0HA 2FZNA 3VMPA 3M5ZA 1EIBA 1TJ2A 1W5OA 1ZKQA 4QXIA 1GKPA 4OHQA 2DH2A 1XRVA 3NO1A 4D6IA 5H91A 1B9BA 1EF3A 1JGIA 4UOZA 2IKIA 4MTVA 1XRSA 2XIIA 4GVFA 5I2UA 3ETRB 1JEZA 3VNZA 3OIXA 3NNTA 5ECVA 4Z1BA 3N2TA 4LYKA 2PS2A 2FHBA 3ALGA 1SVDA 3TW6A 3STFA 2CETA 3FIGA 4WD0A 1KV8A 5BOEA 4ATDA 2C1IA 5FF3A 3SR7A 1K4GA 1IZCA 1UHVA 1XX1A 2BC0A 2EG7A 4GISA 5MKGB 2ZFAA 3AWOA 4WCJA 1E55A 2CCRA 3ZSTA 2OWXA 4EF8A 1KCKA 1CYGA 4GNJA 1VCGA 1STZA 2WWCA 4ADSA 4XAFA 3PZ9A 4QG9A 4CGTA 4EVZA 2VUYA 2ZOXA 5AYXA 2AAMA 4WY0B 3G1DA 1E0WA 2GJRA 5C8BB 1DQWA 1HGYA 1J5TA 2HBXA 3AISA 4UTFA 3R12A 3SZ8A 1A3HA 3VNKA 4DZIA 1Z89A 1Q6RA 5CJNA 3WD1A 4JTIA 2PRHA 4NI8A 3SN1A 4ZSTA 1T5AA 3IV8A 3EKZA 3OVGA 1DL3A 2DUAA 3OZYA 5C55A 2FPTA 3H6OA 1XINA 1Q1WA 1WYIA 2CITA 1EJWC 4R7JA 5AYIA 2ZVIA 3HFYA 1SO5A 4J3ZA 3DG3A 3CNYA 3N1AA 3B0YA 1N55A 4A22A 5ENLA 5AHMA 2WJZA 2VUNA 3T7VA 2ZZ1A 3E2SA 4F8XA 1ZXIC 1PPIA 1FFQA 2DZTA 4KWSA 3THQA 2FVMA 5C9WA 2CLKA 5BOOA 2OLSA 4NNCA 2GVJA 1TELA 2PWHA 1E6PA 1PDZA 4J57A 3KOZA 1F3PA 3I7QA 2PI6A 4AY1A 4Q8VA 1QW7A 4R5EA 1DJXA 1EGMA 5I06A 2Z7GA 1XLAA 1EB3A 4AZIA 2OU4A 1E0VA 1JROA 5HMEA 3N9RA 1EYWA 2HK1A 3H23A 2F2HA 3L4XA 1YNPA 4XKYB 3NWRA 4CNTA 2QVHA 5CZJA 1SW0A 4GI6A 1FIQB 1TG7A 1YE4A 2BY1A 1SZFA 3P14A 3B4YA 1IYXA 2XPKA 3L66A 1EJSC 1Z32X 4AZHA 2VRQA 2WMIA 3SDOA 1GERA 2HWGA 1DIOA 1K4HA 3N2BA 1D8CA 4H8HA 2PDFA 3NG3A 3SCTA 2WPGA 4XAZA 4DHGA 3GC2A 1LTDA 1ZALA 2XZ9A 4K6AA 4Y9NA 4PMJA 3LHTA 3T6CA 4EX4A 3MP5A 4AQLA 2F7FA 1BKSA 1DJNA 1BTMA 3U2EA 1Y7VA 2OGJA 4WJEA 2YQUA 3WUFA 1W3IA 6XIMA 1LRNA 4TU1A 1P43A 3HV8A 4K1WA 3I3DA 3CYVA 3AOFA 2YBTA 3T78A 3U5YA 1F9CA 1V7AA 1JDFA 2G96A 4EXBA 2YB4A 2OSYA 2WNZA 3F5JA 3WDHA 3BL3A 3NSNA 3DKLA 1F07A 4Q3MA 4JYFA 1A4LA 3P74A 4FP1A 1MI3A 1NTHA 2GVGA 3EOUA 4W84A 1YTEA 4AZCB 1GKQA 4ZE4A 5CSUA 1J01A 4ZXOA 3W1TA 3KZSA 3G0UA 4LCSA 1W3HA 4O54A 1LL6A 5CJMA 1E4MM 3EDEA 2G5WA 3K4DA 3VNDA 1JZ8A 3P6LA 3B8SA 3TKFA 1G5AA 3N29A 4D8ZA 5I5RA 1E1FA 4GVHA 3T2QA 4H8UA 2XGBA 4KESA 2CHRA 1Q45A 1JZ7A 2RKXA 3TJIA 4ZA0A 3S0CA 4REQB 3D0CA 3S2JA 3G22A 2CPUA 1NWTA 5D32A 4EQRA 1S39A 1UH3A 4O14A 1DJQA 2VDIA 5F4XA 3V36A 3S46A 2CLIA 2OEMA 2IS7A 1M6IA 1SW7A 1XH1A 2P76A 3CGEA 1KM3A 2XN1A 3CWHA 4FMVA 5EKYA 4LVFA 2ESCA 2A7PA 5CZ0A 1SFSA 2Z0IA 1E6NA 3REQB 2FVKA 2YCJA 5IDZA 1OZMA 5JBDA 2QCEA 1N8IA 1GTHA 3T55A 3WUBA 4QG8A 4NRSA 3W37A 3R1ZA 5FACA 4BF7A 1DE5A 2QCGA 3L7RA 4S3BA 4L1WA 1NP2A 1TYTA 1WDWA 2VD9A 2OX1A 3KUMA 4F0RA 5D03A 1B4EA 3W2KA 4A3HA 3BGGA 1UD2A 2OGYA 1ME9A 5IRPA 4F9DA 4JTQA 2J9XA 1GGOA 3NCOA 4IX0A 3MZ2A 2O7SA 5C5YA 2P53A 2F9RA 4FX8A 4H8VA 4KCUA 4BI6A 4PB4A 4AZ5A 3G1AA 1X1ZA 1R3VA 4XSLA 5E5CA 4JCMA 2J8GA 3QTPA 1CI1A 3W2UA 1PL9A 1QNOA 4D6HA 4PBFA 3RYSA 3DYMA 1ODUA 3WLKX 2TPRA 1GPWA 2YYUA 3N13A 4B9ZA 4DXVA 1DWJM 5BWFA 5D09A 1PBGA 2NV1A 4IG2B 4IJRA 4P61A 2CXGA 1B5TA 4IISA 1AG1O 1VFTA 4RE3A 3WD4A 3ZVHB 1S2WA 2INEA 2O55A 5CAHA 3H55A 3WELA 1IWPA 5BW6A 1C8YA 1FWFC 1M68A 1AQFA 4H8NA 3QC0A 5KVIA 4C6KA 1WKDA 1Z42A 1ZBVA 4H6EA 4HZ6A 1JDEA 3C8NA 4J9JA 1Z9AA 1E5NA 2BMBA 1K6AA 4W87A 4RW3A 1GZJA 1NARA 3VUSA 1JYVA 1W1YA 3CEUA 3NJ3A 1TPH1 1S5MA 3GNOA 3W75A 4JFWA 5HR7A 2VFFA 4Q7BA 1KM1A 2QJIA 4QRNA 3AS2A 1QOQA 3TWBA 1BYCA 4FXSA 3QSRA 3N3TA 3QMSA 1UWQA 2GSHA 3AU6A 3M0JA 3W1AA 1TKKA 2NSOA 1PZ0A 4FR1A 2F84A 4KCVA 4AZ7A 3VDBA 2QULA 1LYXA 4NKCA 3W28A 4IHCA 1ZAHA 2XU2A 3MC5A 2J62A 3BW3A 2DZBA 3BOFA 4K7YA 1WZKA 1TSIA 2HVNA 2V2CA 4HK5A 4BEQA 2VCCA 3T40A 3UGRA 3CV6A 4XB3A 2PCEA 4N4QA 5FS9A 1CB7B 2WSRA 3PBUA 1X8FA 3KBVA 2YVFA 3AJ7A 5AHEA 4MYXA 4D8LA 1N61C 5AYBA 2JE8A 4AYSA 3EMQA 1TCMA 4FNQA 7REQA 1GWJA 5LNRA 5A2BA 3FEMA 5M3WA 2CLFA 3CHCA 1OVDA 1EBGA 4NZ5A 1US3A 4LXFA 1E6QM 1M6JA 1R46A 1VS1A 5E0CA 5CCZA 3STGA 3KAOA 2GQ3A 1OC6A 1TJ1A 1BWVA 4LC8A 3UWQA 1S5NA 4D1JA 1UR9A 2WAGA 2WZTA 1B0IA 3EX3A 3RMJA 5G5IA 3L67A 2E5BA 4ZQNA 2ZUMA 2P3ZA 4ATLA 1I60A 1XYMA 3LQLA 1XIIA 1ZMCA 2NXHA 1XFCA 3QR1A 1X6LA 5AECA 1EEXA 1ISZA 2ALDA 2YKKA 3EGJA 1V6UA 5E0KA 2V5BA 3AI0A 4G1NA 1UR4A 4H83A 3HIJA 2YOCA 3K2GA 4UZUA 3IIPA 4GQ0A 1JNEA 3O1NA 1WDDA 2W66A 3OQ8A 4CQ9A 1V93A 1IEIA 3TQPA 4TQTA 2NUXA 3TLLA 3EPOA 2ZZCA 3WNMA 3POCA 4BI7A 3A9BA 1GZGA 3UJ2A 1FXPA 3WH5A 1X6UA 1EA9C 2ASHA 3LI0A 2CHNA 2C0AA 2EHHA 3TN3A 4BZYA 5D02A 4ROPA 3BSMA 5HNNA 4MLRA 2OKTA 1JVNA 4K1GA 3N2MA 4J2MA 3B9EA 4QBXA 2EG8A 1ECQA 3W1LA 1Z7AA 3DUGA 5F2GA 4IIFA 5AYYA 2FTYA 1LLZA 3N19B 1SFJA 3AHVA 4Z0JA 4EWND 5BRQA 1Q2RA 1GQKA 5GQBA 3O2LA 1EGVA 2EPHA 5IBXA 4OOZA 5XIMA 4AYGA 5A8PA 3UA4A 3UR5A 1TPUA 1XIFA 2OEJA 5PTDA 2NV9A 1AD1A 2GUBA 2ZX6A 3CXOA 4DF2A 1MZHA 1F7BA 4ZZ9A 1QK0A 1XCXA 4QQUA 8TIMA 1XR2A 3PUOA 4W8AA 3BG5A 3PZGA 3W7JA 4UUIA 4PEEA 3IK2A 3SCSA 1EXPA 1KB3A 5ABGA 3MI6A 1ICQA 2DIJA 1XXXA 3VD4A 3UY8A 5G1MA 4BF9A 3OGVA 5HQMA 3U0HA 2YW4A 1I1XA 2CZVA 4DJFC 3N2OA 3UXKA 3UG4A 3QHOA 4DLFA 2JGYA 2C79A 1B9ZA 3MJMA 3BVJA 2DT0A 3C4UA 1XDMA 4HJWA 1YTKA 1GOWA 1TMQA 3P60A 5K4ZA 1Q6LA 5FJOA 2O4MA 1CT5A 1LQ0A 3B0PA 4FK9A 2VZVA 4M80A 5BROA 4HCDA 5U7SA 1NHSA 1HL9A 3W82A 3IJ6A 2GJXB 2QDGA 3W2JA 3V0SA 5T26A 2FGLA 3RCNA 4YJ5A 1KBBA 1DOSA 3LRLA 3RCMA 3WK1A 4NZCA 2V5KA 1DTNA 3KLKA 4X9YA 3AHTA 2I7GA 3IIOA 2XSXA 3IRDA 1XG3A 3TQVA 2REQB 2QGHA 3EDDA 5LGZA 1TTIA 3N2CA 1KKRA 2BDQA 4OIFA 3RO8A 4UTHA 3B8IA 1EUNA 2DW7A 4Y7EA 4TO8A 1H1NA 1TTPA 2WKJA 1R85A 1FWIC 3M0VA 3GTFA 2E5DA 3M47A 1RUSA 4GKLA 4GMEA 5I03A 4PUUA 7PTDA 3PK7A 4JTEA 3FJ4A 3BZJA 1W31A 4EQXA 1V0LA 4IOTA 5I23A 3VIMA 1J2BA 4QEEA 1V0KA 3MYOA 3V18A 3ZM8A 3QFBA 1BSLA 2IPFA 3PBGA 4F66A 2BXYA 4AF0B 2XG9A 4RLIA 4C6EA 1F6KA 3GW0A 2GJNA 3LNMA 3VGFA 4XSMA 3UR2A 2WVVB 1TPVA 3HPZA 3NQCA 4RPPA 4AWTA 1A3XA 4H9ZA 3CUGA 1BEUA 4U2ZA 3NQEA 5CAKA 1XH2A 3O05A 1E6RA 1VENA 5HR6A 4IGNA 3VOFA 4U28A 1Q6QA 4WJXA 1IXPA 3W38A 3M4HA 4IIHA 1RLCL 1VD6A 3ZR5A 5D8WA 1C9DA 2B0MA 3WQWA 1LL4A 2NX3A 4J35A 5T91A 1O6IA 1E51A 1NFGA 4WJ8A 4Q4KA 3C86A 1QI2A 2CEQA 3VKJA 4XUYA 4GFIA 3DHUA 1F5ZA 4GZ7A 4JHOA 3HFTA 3A4XA 2QIWA 2VR5A 2ZRUA 4S38A 1P1XA 3H2CA 2PD5A 1N8FA 1XLMA 3SUTA 1J4EA 4GJJA 3GZ3A 3GG1A 4D6JA 4DJDC 4MZYA 5E9XA 1OBAA 1VBGA 4LALA 4ROQA 4LS1A 1IEQA 5GJMA 3TN6A 4FX7A 4RDZA 4ZCWA 3P8IA 1YXYA 3LEPA 8RUCA 4IMGA 1FH9A 1WUFA 1V02A 3GDLA 2CIPA 4FXRA 2OZTA 1IIHA 3MMWA 3ONCA 1X38A 2PDKA 3IJDA 4LC6A 1VYSX 3GH5A 1VBHA 2WCSA 1JNDA 4QJ1A 1XQKA 3ANVA 1JCYA 3W1RA 3ITLA 3SY1A 2C91A 3VKAA 4LCRA 1X1OA 4WRHA 1MUMA 2GR0A 1PKMA 3W73A 3CASA 1XBXA 3IGSA 2UY2A 1WDRA 4PRTA 3R8GA 1D7YA 3SR6B 4MB5A 5E1QA 1XANA 4Z2JA 2QPXA 3HQ1A 3WLNA 1RQEA 4R9XA 4FF5A 2Z2AA 3ALFA 5E09A 1KFBA 4HJFA 1UPMB 2Y70A 4AD4A 1YEYA 3W7NA 1U30A 4OT7A 1VP5A 3PPCA 3SFKA 1UUQA 5ER0A 4JZ5A 3M07A 3U2CA 3A24A 3FYYA 2HPIA 4O1AA 1VQTA 3SO7A 2PDUA 1JF6A 1O5QA 3Q94A 1EZ2A 2WJDA 4IPPA 1LT7A 4N9BA 2HNHA 4BV6A 5G2HA 2ZZ3A 2PBOA 2WSYA 1KRBC 2V81A 1JYNA 1MQQA 2D3LA 1K77A 4HU8A 2XZ7A 4WVXA 2CFFA 3LRKA 2DUXA 4H19A 3S9IA 3H2NA 2X99A 3BCDA 1ALDA 1LM1A 4ASTA 5AC7A 4IQJA 3EB2A 3C56A 3K1DA 1WX0A 4KFOA 3VU2A 4O0QA 5HMSA 4Z1YA 5DMLA 2CKRA 4UC5A 2WMGA 2YFOA 3L5AA 1TPFA 1GOQA 3GDMA 4PTWA 2EG6A 1UUMA 1QI3A 3B9DA 2WOWA 3N3MA 1UKPA 1PSCA 2QDEA 4W89A 4LUTA 5C54A 4TOQA 5H8MA 3NQ6A 1UKSA 4J4KA 5CLTA 1VFOA 3WMLA 1CXKA 5EBAA 2FKPA 5T8GA 3PBWA 1GT8A 2FIQA 4TXEA 3IJ7A 1HL8A 4MWAE 1SZNA 1NELA 3STCA 1KM6A 4IFKB 2O92A 1JCLA 1B3OA 4CEXC 2WNQA 4K8GA 1R8LA 4YVPA 4FS9A 3VIJA 5JCIA 4HNVA 3TZNA 4PMYA 2RDTA 5C9UA 2YR1A 4J7RA 1UJQA 5TBOA 3QW3A 2ZUNA 4KEZA 4S23A 1ONWA 4FOJA 2OYKA 1JFXA 4NZ4A 1BRLB 4CNNA 5FS6A 3WQ6A 2GPTA 1HL2A 3OQEA 4R34A 4ZXLA 3PG8A 2O4QA 3WYZA 3GLCA 1TV2A 1ZB5A 3MV11 1ZJHA 5BYWA 1E6ZA 5HJLA 1MXDA 5LSMA 2Z29A 1MQPA 4MG4A 4JKMA 6ENLA 4C6LA 2QUVA 4DM2A 1XV8A 1T8QA 2XGZA 1FWTA 5TIMA 1T99A 1GW9A 2X42A 4FZIA 4EK7A 3TAKA 3NOYA 3H26A 5A94A 1EKOA 4HN4A 3RR1A 1BHGA 4GUFA 5KINA 4B5VA 4RL3A 2A7NA 2QGYA 3G1YA 1ML1A 4H4TA 4K2SA 3L9CA 5J5DA 3OHMB 1Y5VA 4IL2A 4MWAB 1SJBA 4G7FA 1PWMA 5LNVA 4BHYA 5HXMA 2CBVA 2R91A 3FYPA 2PLCA 2O7QA 4QLLA 3CV2A 2Y8UA 1EOKA 1WAWA 4HCLA 3O6DA 1J0ZA 4CCCA 1RH9A 1OYAA 3GHRA 3THCA 4XKYA 1OT1A 3KOWA 1W1PA 1W8GA 1OZQA 2J7DA 2VL4A 4H41A 1UR3M 2VEGA 4PTMA 1J8VA 3PUEA 4D72A 1JPDX 1V6WA 3IANA 4UOQA 1F8IA 1VH7A 2Y0FA 4GXWA 3S2MA 4EQWA 1OCQA 2XDFA 1FXQA 1J0KA 1JCJA 1QHZA 1DEDA 1BGGA 3WQEA 2RJHA 3M64A 3UG8A 1LRTA 2Y4SA 2EF9A 4GG9A 2Y7DA 2PFHA 1HX0A 4KWUA 3DYOA 5HULA 2CZFA 5CPMA 4IQDA 3ENLA 1PHQA 1FWGC 2DUZA 3Q45A 1I6NA 2GGGA 4AVOA 1WQ5A 3B3DA 4PBGA 1S5VA 2INFA 1AD4A 1PKLA 4OJYA 3OLGA 1E71M 3BV7A 1KFCA 4MNLA 3G1VA 4QX4A 1KRAC 3KM8A 5CEWA 4B90A 2EPLX 5KMYA 3RNMA 3VKBA 4LBSA 2BGQA 3GIQA 4IG2A 3EWDA 1SQ7A 4L4PA 1NHRA 3VGBA 1Z44A 3G8EA 2PODA 2WBAA 3OZPA 1FCQA 3W74A 1T41A 1AJ2A 1XDJA 3MUXA 2ZKMX 2VNCA 2WPEA 4GHRA 2R8WA 4RNJA 4JXCA 4KRTA 1IWBA 2E4TA 1EYEA 1RPKA 5DQPA 4CVWA 2X0SA 5LGXA 1C90A 4YLWA 3AYTA 1DQUA 4ZOBA 1AA1B 3WH7A 2OT1A 3C2YA 4IGMA 1EF2A 1VAHA 1T8XA 3TN5A 4W5UA 1DPMA 2ZYFA 3KW3A 3FS2A 1NQKA 5KVHA 3B8VA 4JTSA 1TWDA 1F3WA 1REQB 2Y2WA 1R7AA 3VE9A 4B91A 5GNYA 1XJBA 3B04A 1M7PA 2OQHA 3GDRA 3IIVA 3R10A 3W1MA 1AZ2A 3GR8A 2CLLA 5CJ5A 4P5UA 2FZDA 4H6RA 3KBNA 1XW8A 3VC6A 1WBHA 3DCPA 4AAJA 1O12A 1FWDC 4GZJA 1LDCA 2OYMA 2VGFA 3GVQA 4BURA 2DGAA 3CAVA 1Z3NA 3DG6A 3R0KA 4RXGA 5GNXA 2OEKA 4GRTA 2VX7A 5ABHA 1HVQA 2CC0A 3ZVIA 4BR1A 1OFEA 2Y88A 4O1BA 4ICMA 3TROA 3SY5A 2XH4A 1ZX9A 4XD4A 2J7EA 4Q8PA 2DP3A 5D2XA 3PB0A 3ZYZA 3ONBA 4GQBA 2E09A 4KWVA 1ONRA 5TD4A 1XRFA 1UP2A 3R07C 3VNYA 4L9XA 2PWGA 2PE4A 3RU8X 3D9XA 5CG0A 2A8XA 3O0KA 4APNA 1WPCA 2HQAA 4LNCA 5AB3A 4M8UA 3BCFA 2JF7A 4B5UA 3VGEA 3M0LA 1POJA 3W7EA 2YCEA 4U5KA 1GYLA 3VD7A 4BQ4A 3MS8A 1MVYA 2CLOA 4S3EA 3L4ZA 4B15A 3M0HA 3BSGA 5K7JA 1UBSA 4AHPA 4YYCA 2FZ9A 3EDFA 3K46A 4N6FA 2DPEA 5TF0A 5G1TA 5JIPA 2NX9A 3CH0A 1ZTVA 3NZGA 2XIQA 2J4GA 3I7RA 5IOBA 2H9AA 2VM8A 3OLIA 2OO0A 2JKPA 3NQMA 3V1HA 2AKMA 3GQYA 3CAQA 2EPMX 4UMCA 5C0QA 4HK6A 1HJQA 4Z08A 2ZIDA 3CO4A 4NHVA 5HUPA 3OVRA 3KBMA 5C9RA 1NVMA 2XINA 4YTSA 3T07A 1Z48A 2CZDA 4WSHA 5CXPA 2HROA 1O4UA 1H61A 3N04A 1MOKA 1ZSXA 1W8SA 1I4NA 2J74A 4DJEC 3H8AA 1M7XA 1Q13A 4KBXA 1V79A 2NQLA 5CZTA 3W7RA 3LXBA 4CQBA 2HVOA 3IUIA 4UTWC 1B4KA 2C15A 4IMDA 3HB9A 4AHQA 5FSDC 4WDUA 2NLIA 4GUJA 2G50A 1ONEA 1VFHA 2VX6A 2EGZA 6TIMA 2C8NA 3S6TA 3VI2A 2DU2A 3HJEA 4O10A 1UCWA 3URAA 3VIGA 3VDCA 4V27A 1VJIA 4LY8A 3HO8A 1S2AA 4H4YA 1UMLA 3HQOA 1VFMA 3C2OA 3CL6A 3LPOA 2VFGA 4TUFA 1WDPA 4FF7A 2ZWYA 5FS7A 5K9XA 4O50A 3UWUA 1I8JA 3S5OA 1Q63A 4LUJA 5A8QA 4J28A 2ZC8A 3DXIA 5JUVA 4IFRA 1FDYA 3ABXA 4FI4A 4YVXA 5HDRA 3W81A 1OX5A 2XVKA 3M0IA 2XVPA 3HQPA 4DBUA 1Y0EA 3WK0A 1MW1A 4ICCX 4IUGA 2JEPA 3CL8A 1WOAA 4UMBA 5HOSA 1W9XA 3N4EA 4JNMA 3B0VC 4A35A 4NJIA 1WBJA 3R0DA 1NHQA 4MSSA 2VGGA 3BG9A 2PU0A 4Q6JA 4P7RA 3H53A 1AW1A 3Q65A 1JUBA 2DZXA 3W7KA 3SJ3A 1XLGA 1EA0A 1A47A 1VBJA 2WM1A 2IKJA 3HPSA 2D0HA 1AW5A 1LWJA 4CCZA 3EAOA 2EBNA 4IH3A 1CXFA 3PZTA 4LYRA 3FCPA 3S4TA 3IC9A 4JCLA 3A3XA 4F9JA 1EJ7L 3C8FA 2RGMA 4IQLA 1SO6A 3OOQA 3F2BA 4ALDA 1PZ1A 4DIAA 2PGEA 1UZDA 1L6FA 2JIEA 3RCYA 3MI2A 3T4WA 4YCOA 4DBSA 1IEXA 3GHSA 2V63A 2YBVA 2NUYA 3NQBA 3LHWA 1A80A 1NOWA 4UR9A 3WQ8A 4YWSA 3R7MA 3F03K 1ISXA 2V3BA 4GVIA 3EWWA 1CTNA 2RFGA 3GKFA 1YDOA 3L21A 2WPCA 4GACA 3NSMA 5BNKA 1N60C 1XLHA 3WJZA 1HTIA 4RX0A 3ITCA 2PGRA 4ZQCA 4Q4SA 1TV4A 1FKWA 4E2BA 5MKGA 1S7MA 4ZR8A 3U3HA 2BBFA 1UD3A 3M0MA 4X63A 4DUWA 1IE7C 3P67A 4IQEA 3PJXA 1UZHA 2PDIA 2XTKA 4PSPA 4HGXA 1N5WC 3MHFA 4PFMA 1L2QA 1QI4A 4WY0A 1W3JA 3WNKA 1GCYA 4O53A 1X97A 1R3TA 2WLYA 4Q4OA 2DQXA 2C18A 3VD5A 1ZBWA 2WP5A 2NWSA 1SPQA 4URIA 3SCRA 3ATYA 3WJWA 3AALA 1PKNA 2Y63A 2QCLA 2GSEA 1XBYA 3QV7A 1RVKA 5C2CA 3LCFA 4J1OA 4JTTA 3S9YA 5LIYX 4Z1AA 4G8TA 1QASA 2HCVA 3LLXA 1MEHA 2KZHA 5AHIA 2AQOA 4E5TA 3HG4A 5CGQA 1O5XA 2IQDA 3GAKA 1RALA 1SSGA 3L2IA 1B3WA 3MDUA 3W6MA 4L64A 1S1PA 1X1NA 1X7FA 5HK4A 3N6HA 1XLEA 4H4IA 3FGCB 2YCKX 1NDVA 3AMZA 4KCTA 4MNMA 4XZIA 1QNSA 1TX2A 2YFNA 3OJGA 1H2JA 3RMEA 3IUHA 4DWSC 3LB0A 1EOMA 2DH3A 1TWZA 4ICNA 2SFPA 4M24A 1W37A 2Y61A 2YDSA 1SU5A 2B31A 1TV8A 4JAWA 3EB3A 4H6KA 3VCCA 1EWEA 5KEZA 4FLQA 3NL3A 1MNZA 3OBAA 3MTWA 3LB8A 2YCLB 3GSMA 3WQ4A 1XLDA 1S5TA 1BZLA 2CYGA 2A1YA 2VX5A 4R7OA 3ELFA 3BZGA 4D6DA 1FECA 1ZS2A 3WLQA 3R94A 2MUCA 3PJUA 5C6MA 3MSRA 4KWWA 1LG2A 2C14A 3OBKA 4PTVA 4FALA 1JPMA 2QCCA 2FDMA 3LGGA 2PRLA 3P93A 3UJSA 4H04A 1HKVA 4JN6A 4PMUA 1BF6A 4LF1A 4C7DA 4M82A 3S6OA 2W61A 3S5YA 1W5QA 4NSBA 1DWAM 4Q4QA 1ZGDA 3VOIA 3PJTA 4LV9A 5BCAA 5EFFA 3EBVA 4HPHA 1AH4A 1VFSA 4CLMA 1P0KA 2ZUVA 1D3HA 3R89A 1R7OA 2FLIA 3G1SA 4J3UA 4H7VA 3CC1A 3ZJKA 1ZCOA 3NDYA 1ZDLA 1C7SA 3W3OA 2PDBA 5D05A 2A0NA 1YW1A 3PZQA 2XVLA 3FEQA 2WC7A 3W86A 3PWAA 5I3HA 3TMLA 1H51A 1IXQA 2EQ7A 1JG9A 3MKKA 3WH6A 3H2FA 5K2ZA 3QV9A 1VB9A 4MFEA 2V5CA 3KL3A 4JFTA 5FF0A 5HWMA 1BQCA 3T0BA 1EC9A 3M16A 4A21A 1LOLA 3CU2A 2I57A 1VHCA 4HHPA 2QJMA 4M1RA 3TSBA 4PMXA 1L8NA 3RFAA 1DWIM 2P1FA 4D71A 2OPJA 2Y7GA 1H2IA 4KFNA 1L6GA 1EFZA 1H7OA 1L6WA 3NDZA 5BU6A 4O18A 1T3QC 2QUNA 1BFNA 1TIMA 1E9YB 2QPSA 4REQA 5EGRA 3QMTA 4GQRA 1RBLA 2YA0A 1QT1A 3UD6A 2E68A 2VEFA 1EP1A 3RX2A 2NLYA 3RRXA 3FKRA 4GH3A 5EMJA 2XHYA 3VDAA 1E73M 3N9SA 3OB8A 5G5GB 1W2PA 1FFRA 2QXWA 3MP3A 4KPLA 1O5KA 1WKFA 4PYSA 2Y5JA 6A3HA 5D2VA 1PCKA 1IT8A 2C7FA 2BFGA 6TAAA 3AFBA 2NSXA 2B7NA 3H4XA 3I6TA 3WLSA 3CYJA 1R86A 2Z1KA 3WD2A 5E6ZA 1Q4WA 3DKJA 2AAQA 1X39A 3ZR6A 4PEKA 3PUGA 4PMVA 3RX3A 4FIQA 5H8PA 4HA4A 2DJLA 2HPMA 4AIUA 2J9ZA 4PA8A 2RDUA 3SCVA 1EUAA 5XINA 1KCXA 2OJPA 1QMLA 3BLIA 3NA8A 3V16A 3UZ5A 3QQWA 3AXKA 2JFEX 4LWWA 2V69A 3LZ5A 1UR2A 4LVAA 3C0QA 5DXXA 2X40A 2QCNA 1FY6A 1TPB1 1SFTA 1LWIA 4DF0A 4B5XA 3TTSA 1WOBA 2RABA 3VMOA 1TE1A 4U2YA 1ECEA 3WBYA 1PX8A 3FYOA 1E1CA 3LV6A 3EUB3 3MV01 3UCQA 3RX4A 2WYSA 1VEPA 1TE6A 3TNOA 1WXYA 4EAYA 2Y5EA 4PSRA 3WJYA 3AJXA 2XN2A 3CZJA 3F4NA 4R85A 2ON3A 5IDIA 2ZVRA 1H7XA 1GOKA 1R47A 4YTRA 1V0NA 2BODX 1YDNA 2YL9A 2OODA 1KTCA 1V4YA 4AEFA 3UVIA 3LTYA 2GH5A 4I8DA 2GRTA 2VFDA 4GA8A 4DJFD 3GWQA 4ORMA 3CTLA 1XH0A 3GIYA 3MDWA 2NPXA 4NX5A 1A50A 6CGTA 3GBDA 2FTWA 3VCNA 2QVNA 3BLLA 1KRCC 3PTDA 1BTCA 4L1XA 4NY2A 4S3AA 4MUPA 2QF7A 1GG1A 5CSRA 2GVYA 3PBYA 4UTKA 3ABZA 4H6QA 3AZSA 1HVXA 2WK2A 1JDAA 3TTEA 4HN8A 2G4FA 1D3CA 2DZPA 3QKEA 5DN1A 1G4PA 3UG3A 1ZAIA 3LU2A 3ID7A 1JDDA 1QOPA 3M44A 4JD4A 3RLHA 1Q4NX 1DQXA 5HQEA 2ZZ2A 2PU1A 1G4SA 1A5CA 2C0HA 4QR6A 3KCOA 3OW1A 3UWWA 1HIZA 1V0MA 3ZO9A 4HZ7A 3WLPA 5C2GA 1IV8A 3EDJA 4BF5A 5DEZA 1AJ0A 2XWDA 5BU9A 4JQ4A 4JS3A 1WDSA 1Q8AA 1OINA 2WQDA 1XIDA 3RAOA 2DZVA 2FYMA 4P8XA 1R2SA 3LGEA 3QM3A 1SZGA 3HM7A 3B40A 3A7RA 3G3DA 4OV4A 4ZOEA 3T0DA 1MZRA 4YNGA 2VOMA 4ZO8A 3GTXA 1J10A 3PPGA 2F6XA 1KBLA 4FDCB 1E5JA 1NSJA 2FPVA 2ISWA 3CPUA 2FH6A 3QY7A 1V3KA 4EANA 1NHPA 1UC4A 4GI9A 3QHNA 1KA9F 5D9PA 3BSHA 3OO2A 2FDSA 3STEA 2Y8KA 4MNJA 5B80A 4F0SA 4PTDA 1FP9A 3NFUA 4N6EA 5DRCA 3N14A 4K37A 3GNDA 1AODA 4PUNA 5AC6A 3UWVA 4E38A 2D1ZA 3URNA 4NASA 4XISA 4UQAA 1LZOA 4OOUA 4L65A 4ZFMA 4UTWA 1ZUAX 3MWAA 1JUKA 3E0WA 1DIKA 4MKNA 4DXKA 2Q02A 4MB4A 2YXOA 3VVGA 4R9OA 1JEHA 4NYUA 4U5IA 4MAVA 1JI2A 1RQBA 1ADDA 2IPJA 1PKYA 1BQGA 3B06A 1QO2A 1VYPX 3A13A 4AUBA 3OP2A 1Q85A 3W6YA 4G56A 1KLYA 1W9UA 2AMXA 2HE5A 1UR0A 3RM9A 2W3ZA 5A6BA 3VKCA 3F2CA 2BVWA 3MYPA 4OVXA 3TNBA 4RR4A 4KEMA 1AH3A 4P8WA 5LNWA 3ITYA 1OWQA 3VK5A 5GPRA 3NVVB 3VO0A 1QNRA 3WSUA 1LROA 5EYWA 1U1HA 3KDNA 4JL2A 4Z2LA 2NVDA 4WHBA 4H4RA 4IP7A 4ZTXA 4ZQMA 3OODA 1FBAA 2V6OA 1RXOB 1SO3A 5JH2A 1K02A 3P0XA 6REQB 1KFJA 3A5FA 4C91A 2IPWA 4EQSA 2PDLA 3UJFA 1KD0A 3NS1B 3VPLA 1CGXA 4LQ1A 4TMBA 2J77A 2HK0A 3MP4A 1TQXA 1FWCC 5JBFA 2PDPA 2D2HA 2Q01A 4CQCA 3KBWA 4LIIA 2ZE0A 1N5XA 3TP4A 3LA4A 1YX1A 1SZEA 5EBUA 2QDDA 4EXQA 1IZKA 2Z2UA 4NP7A 3LCGA 2J7HA 1LOSA 1NM9A 4M3PA 3G24A 5FEXA 2WC4A 3GFZA 1YHTA 4DX3A 4L5ZA 2DZAA 5FSEC 3LCIA 4J27A 3DK8A 1FX6A 1FCUA 4HKPA 2VI0A 2WLZA 1ZY8A 4LEQA 1B57A 4EPEC 1YIXA 2QZRA 5M17A 4AC1X 1TREA 1H09A 3LPGA 2FHCA 3BUVA 1W9PA 2YB1A 2NXGA 4WEVX 3T0AA 4NXSA 5AHLA 2C1GA 1F3EA 4Q8NA 4DUXA 2OSWA 3DECA 3W0KA 4LF2A 1G7UA 1DJIA 3WFLA 2Z1VA 4INFA 4PMQA 4M51A 4JTJA 6XIAA 3TTQA 3TMQA 2WJFA 2NQ5A 3KP0A 1MEWA 4NZJA 1FWNA 4HOWA 4UNKA 2B7OA 2W4XA 4HYVA 3OEXA 2XM2A 2Z2BA 1D8WA 4CCDA 1MUWA 3WD3A 2BXZA 1JR1A 1I2OA 4WXZA 5A6JA 5FIPA 1BG4A 2OG9A 1JZ5A 4WDWA 3QFWA 4GNVA 5BXSA 1Q6GA 4XG1A 3I3BA 5IXEA 3NVZB 4H4SA 4HZMA 2D69A 1VRXA 4D6GA 4WQ6A 1TMLA 3FV9A 4O8RA 1HKJA 2X8RA 3CEPA 1HJXA 4S3FA 4IPJA 1JYXA 1CLKA 4MPKA 1ICSA 2WPFA 4MFDA 1Q2SA 4H9VA 1H0IA 3NO5A 4PH6A 3CLMA 5JRBA 1MW3A 3BW4A 4RDWA 3VNLA 3WEMA 3F4DA 3E0IA 1NDZA 3GH7A 3NZQA 5IBXC 3QF0A 4B16A 4KW2A 3G0XA 4YHEA 2ALRA 4KRUA 3URHA 3STPA 3A4AA 3VXGA 2Z26A 4ENLA 1V02E 3L0NA 3P5ZA 5B7YA 3AMGA 4L4LA 4G7EA 1RD5A 3B8WA 5FF2A 5I3GA 4U10A 3SM0A 1HF6A 1R9ZA 1BGAA 3L4YA 4L7ZA 1XIEA 1W3TA 3EX1A 2YA2A 1SJDA 1BVZA 4UR7A 5IFTA 3UETA 4Z42C 4QITA 1GRAA 4EKJA 4JKLA 5D9MA 3BAYA 1FHLA 3BWWA 4UQ9A 4MNKA 2L5HA 3VIPA 2YSWA 4B3ZA 1XWYA 2WMKA 1UQZA 1GZ1A 4F2TA 1XC4A 4P8VA 4C6PA 3EX4A 2GGJA 3AHZA 7A3HA 4CEUC 2V5JA 9CGTA 3S8HA 1EO7A 2BS9A 6PTDA 1W1A1 3O15A 1ISYA 2E1WA 1OGSA 3IEBA 3QFEA 2X2YA 1QPNA 2E40A 4C6IA 1I2NA 1DYSA 3T9PA 3I6EA 3PULA 1TB3A 2WMIB 4X61A 4QCEA 2E6FA 2JGQA 3EMCA 1OJTA 2JK6A 4XVEA 1OCJA 1O1HA 3OU8A 4I9TA 3MY9A 2ABBA 2IXVA 4GY7A 5SWUA 4UFLA 1WKEA 2WHLA 4JOMA 1V3HA 3V4BA 2R1MA 2GOUA 3EKGA 1KTBA 2FQIA 4GE8A 2VP8A 4IZGA 4Q7NA 1DJZA 1WAUA 4GXMA 3ISIX 1OYCA 4JIQA 2HXTA 2EO7A 4YCPA 4AD3A 3NRZB 2ONEA 3MO4A 1BAGA 2C16A 3EWZA 4FR6A 3RG6A 3UXLA 2GVEA 2PRMA 4Y6GA 3E5PA 1O5RA 4ZOCA 5FJJA 3NQ7A 4AMAA 2PWEA 4X0NA 2BASA 4TVCA 4ZO6A 2EAWA 1AW2A 2J13A 1H0GA 1ME7A 3WL0A 2YVJA 2PC4A 4YWOA 3SY8A 2OLHA 4H9TA 3R4IA 2Z28A 4AIOA 3FY1A 1NH6A 2VWTA 3DFHA 4Z0SA 1PV8A 3GZAA 2C3ZA 5DMNA 4JIIX 3SECA 3DI1A 4NRRA 4E8CA 2ZE3A 4D2JA 1VPYA 4ADWA 1DORA 3XIMA 1QW9A 3WK2A 1Y5WA 3P61A 3QMRA 4HPJA 2PGWA 1OB0A 2PLJA 1B3ZA 4PB3A 1GEQA 5D2WA 4IFKA 1C3FA 1XSJA 3MW7A 5A1AA 3LSCA 1W5MA 3WQPA 5DY3A 4MB3A 3SSZA 3B8UA 4GK8A 3EA1A 3MVTA 1JOAA 3WK3A 2CW6A 4W7UA 5LYRA 1TPWA 2C71A 1R3SA 2NVCA 4ES4A 1FWHC 1TRIA 1H7WA 1M65A 1SW3A 1JRPA 4FLSA 2PUZA 4P8UA 3KTCA 4MKSA 4DBWA 3KOXA 4OFCA 2G8ZA 3SQSA 4IGSA 1W91A 3I4EA 4WOZA 2DIEA 3UPWA 1V3JA 1QW8A 3U9IA 1C7TA 3ARPA 3VINA 3QC3A 2G0WA 4QJ3B 5BMWA 1VF8A 2QAEA 3ZWTA 3AYRA 3UBPC 1RHCA 5M2FX 1IXNA 2QKFA 3V5CA 3KCLA 3DJGX 2WWDA 4ACZB 3EKLA 3SRFA 1XBZA 4DJEA 1YTDA 2VVSA 2ZZ4A 3VKKA 3EMZA 1F4HA 2PAJA 2GGEA 1Y5XA 4I90A 1V08A 3W7QA 1XD0A 4B5WA 2EJAA 3TJXA 4UB9A 3T2PA 2QCHA 1SUXA 1N62C 1A0CA 5HWNA 2R94A 1WNOA 4EP8C 1R38A 1NU5A 5I3JA 2VXNA 3NR0A 3II1A 3KE0A 3HGRA 2C3DA 3MBDA 5KTLA 1LP6A 1JGMA 1KBJA 1SZRA 1V3IA 3G77A 2WO5A 3AMCA 3KBSA 2MNRA 3KS5A 3AIVA 4R88A 4MJZA 1KCZA 4NJHA 3GTHA 1XPGA 2YXXA 3ECQA 3URQA 4NL1A 5AC5A 4C6BA 1K70A 2G95A 1XIGA 4ATWA 3Q67A 3OLEA 2YLLA 3DGZA 1BKHA 4D9PA 1R2RA 4ERAA 3F1QA 3ITGA 4GC4A 2DVUA 3TR9A 5KZEA 1R5YA 2HJPA 2J79A 2A7RA 1TCDA 3PB2A 4QSFA 1V59A 1JFHA 1S46A 3LV5A 2VX4A 1M7JA 1TR9A 1SFLA 3NGJA 4F79A 2XIOA 2E9LA 3P80A 2DSVA 1CGWA 2UY5A 1HNYA 5JU6A 1DXLA 1JUEA 4XZHA 1W54A 5EB8A 3ABRA 4FNPA 3W7IA 2PD9A 4H4QA 5CGTA 4DWDA 3VUPA 1OFRA 4Q8MA 2IPGA 3KX6A 4CCEA 5DCEA 1QNVA 4TX6A 1OQFA 5HAOA 2VR4A 4GUHA 1VEOA 3DFTA 3DGHA 2QT3A 4WKAA 4B2DD 3NVTA 1PYMA 3W4RA 1D7FA 4AD0A 4GCAA 5CPQA 2VTFA 5HNTA 1M04A 2POTA 4DLMA 3MVIA 4GGHA 1S2UA 4JIPA 1XI3A 4LS0A 4AX6A 3FHAA 1BXBA 1KLZA 4M81A 4NQ1A 3M5VA 4QROA 1T6MA 4Q8QA 2VURA 1A4MA 1RJQA 2IKHA 4MWAD 4PZVA 2GUUA 3BLPX 1OD0A 1UIOA 2GDQA 3IK4A 2QAPA 4I8YA 1LOQA 3DGRA 2WHKA 4PB5A 2QAFA 1ZY9A 1MXGA 3CQJA 4C1NA 1CIUA 2H6RA 3LYEA 2VCAA 5DT7A 3AZTA 1DWGM 4ZB2A 1H50A 3N6JA 3MUY1 3EOSA 3SURA 3UEQA 2A2IA 3R79A 4QTGA 1P4CA 3PNUA 3CMFA 1N7KA 5REQB 1FHUA 3T8LA 3H4WA 4L4MA 1CCWB 4HBKA 4TTGA 2VC5A 4O16A 7TAAA 3LPPA 3SRHA 1IGWA 2R1KA 3QPYA 1J12A 2UV8G 4UFHA 1GONA 4NAFB 4YN5A 1EWDA 1TA3A 2WNWA 3A4JA 1PTGA 4O1EA 4JR5A 5MHBA 3SGZA 3L2LA 3W7PA 4DBEA 3VNMA 1VFUA 3OVPA 3PPHA 3AS1A 2A21A 2OVLA 4E3TA 4LB3A 4ACYA 3VIHA 4WZHA 1XHGA 1PTAA 2O56A 3CZ8A 4B4FA 3VOCA 2A79A 2Q09A 1LL7A 2PDQA 4AIBA 2X30A 5JIWA 4B2DA 3EANA 4TIMA 1YDYA 4JFVA 4JL1A 5I3IA 3ARSA 2F2KA 1BXCA 3MUZ1 3DFNA 3CK5A 3AYVA 3AN1A 5EBKA 1VPQA 1QPOA 3TN4A 1QXLA 1EHNA 5HJYA 1OG0A 1NQ6A 3S2NA 3UWEA 3CB3A 3TQKA 4JYDA 1NDWA 3IJ8A 1EHAA 4QAWA 5A69A 4RNHA 3KCJA 3C2VA 2VEKA 4HIBA 3LQGA 3JZUA 2VCBA 5ABEA 3QOMA 2NT1A 2ZZ7A 4A29A 4P7OA 3DFPA 3CHEA 2PDHA 5A8MA 1VJZA 2VHLA 3VGDA 2ODOA 1PE1A 1KXVA 1RP9A 3HQNA 3MQTA 1G67A 1PVNA 1AMYA 5K9CA 5E70A 4HYWA 2WZEA 2G3NA 1HT6A 3O63A 1GXFA 2BV9A 2WANA 1UWIA 4AD2A 1GVIA 5LZLA 4UIOA 1Q6EA 2ZX7A 3DI0A 4P2VA 2CWXA 1ESWA 1X6NA 1YQZA 2XSAA 5HPCA 2PP1A 3B0XA 4H4UA 2XFYA 2WZHA 3KOFA 4KPRA 3ARQA 3LTSA 3E49A 3MO7A 4KEVA 2TYSA 5XIAA 1LBFA 2ICSA 5EMMA 2V68A 3CXBA 5RUBA 3AXIA 1A5UA 4CU6A 3AIWA 4S3KA 3HG2A 1NP0A 2WBKA 1W9VA 4R3UA 3P62A 3FSUA 3F4VA 3GRSA 3M7SA 4I5RA 2VC7A 1PB0A 4LUSB 1LQAA 1GRTA 3CS2A 1OIMA 4C7FA 2Q3RA 3Q4DA 3ME3A 4PMOA 2O9TA 3NVYB 4XZBA 3JW7A 2OZ0A 3OPSA 2OTDA 3W02A 2CKSA 3UR8A 1K9DA 5KZDA 4HOXA 4M5PA 4LAMA 3CQKA 1LWHA 3GD6A 1U1JA 3A9IA 3WIJA 4TMCA 3K4AA 3GXDA 1PX4A 4ZFCA 1CXLA 3WLMA 2RDXA 2OOGA 3THUA 4IPIA 3KWXA 3S1UA 2I9EA 1UWSA 4JTLA 1K03A 2GYIA 2QUMA 3EWUA 4O1DA 3ARUA 1VLIA 4L80A 1F74A 2QHAA 2BVDA 1US2A 1DJWA 1OGGA 2I17A 3BOXA 5AOUA 2WVVA 3WDRA 4FB7A 3FA4A 5G2IA 3ZT7A 3CQ0A 2CHOA 3IUDA 1T7LA 3H7UA 2TODA 1HN1A 1RV8A 3MSYA 1YNQA 4KMQA 5DY2A 2PLKA 2GQAA 4AH7A 1OFQA 5CZKA 4UQBA 4A3YA 1GQJA 3BOLA 3GXNA 4L4OA 4RCXA 1TO3A 3OZMA 3GNNA 3A23A 3VIKA 1UWTA 3PPFA 4JQ1A 4GIRA 1QPQA 3H4KA 4CQAA 3NPXA 3R13A 3MB9A 2PDMA 3W71A 1RJPA 1JAKA 3P82A 4XX6A 1K7FA 1KM2A 4MADA 4GRSA 2I56A 1XCWA 3RGTA 2ISDA 2TRSA 3P0WA 3KOYA 3DG7A 3E0FA 5I3KA 4I9AA 3WQDA 1U83A 2D23A 3S47A 2V67A 2WZIA 5FAJA 2YCIX 2PDYA 1SJAA 2QQ6A 5L6UA 3EWBX 4I5XA 4L6OA 4FX9A 4WX2A 3IJIA 1IT0A 4H9MA 1ISVA 4LFYA 4HTBA 3QH2A 3E12A 4HPNA 1PIIA 5TR3A 4JTUA 4UFJA 2O9RA 2E6DA 3OC4A 2Z6IA 3AXMA 1K8CA 3LDVA 5FJTA 3B8TA 4AD5A 1TWWA 3OYZA 2E3ZA 1ZQ5A 2C6QA 1XIMA 2WOIA 1E70M 3CV7A 2W79A 4HNTA 3TV8A 4UTIA 1ZHAA 1UA3A 2PBGA 3NZRA 1IT7A 4BQ2A 4C5YA 1VHNA 1J5SA 4MJMA 3E2QA 1HQTA 5CBIA 3RLVA 1AK5A 3MU7A 1GOMA 3QFAA 4U4MA 5JBEA 5CPLA 4HTYA 3MCOA 1VFLA 3M41A 1BWKA 3TXVA 5CBBA 1UJPA 5FL1A 1E0UA 2VR2A 4QGCA 5LHFA 1XLJA 3QW4B 3MANA 4WK9A 4JX4A 1D7KA 1OD8A 1YPFA 4GPNA 3BQ5A 1NF7A 4QISA 1U2YA 1F61A 4C6JA 2HRWA 5C7HA 4CD5A 2GWGA 1VC4A 1QBBA 1UZ4A 2CFYA 4WLCA 2V5LA 4BWLA 1VQZA 3EEGA 4IIEA 2YDQA 3WQGA 1XLKA 1KW1A 3EXRA 4WR3A 3WF1A 4WGXA 1DP0A 1MW0A 3E9AA 2BGNE 4O17A 4GD0A 4XAGA 5HANA 2WJEA 3QQ1A 3PZNA 3QQ0A