3RGTA

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with d-arabinohydroxamate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
403
structure length
383
Chain Sequence
b'LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-mannonate dehydratase
molecule tags Lyase
source organism Chromohalobacter salexigens
publication title Crystal structure of d-mannonate dehydratase from Chromohalobacter salexigens complexed with d-arabinohydroxamate
rcsb
total genus 141
structure length 383
sequence length 403
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2011-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3rgtA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3rgtA01
4G7FA 3FXGA 2OZ3A 4KPLA 3I6EA 3OZMA 4GGHA 2XH4A 3V5FA 3U9IA 1NELA 3DEQA 3V4BA 2OZ8A 3UCDA 3VFCA 2PGWA 4DXKA 5IDZA 2I5QA 3QTPA 1ONEA 4DN1A 5BOFA 4F4RA 4GYPC 1MUCA 1MNSA 3FYYA 1FHVA 2OZTA 2OVLA 4EWJA 4IZGA 2QJMA 3MZNA 2PU0A 1EC7A 4H19A 2PODA 3Q45A 2QVHA 4IHCA 3CB3A 3QPEA 1RVKA 4ROPA 4HCHA 4HPNA 3T6CA 2XSXA 1DTNA 2AKMA 3ZVHB 4E4UA 2PS2A 3H70A 5FJUA 3NFUA 5EU9A 2OLAA 2P88A 3SN1A 3BSMA 3R11A 2DW6A 3DDMA 1L8PA 3H8AA 2PTWA 3FVDA 2CHRA 3SJNA 2PU1A 4MKSA 2QDDA 3BJSA 3RITA 3GO2A 4JHMA 3ZVHA 3ZLGA 1TE6A 2GGHA 1JPMA 1YEYA 3CXOA 4GYPA 1SJBA 4JN8A 2P3ZA 3K1GA 3TOYA 2XGZA 5FJPA 3B97A 3RR1A 4H2HA 3DG6A 2HNEA 1SJAA 2DW7A 5J04A 3OP2A 4DX3A 3DIPA 4HCLA 3IJLA 2ZC8A 3V5CA 4GGBA 2PSNA 3TQPA 4KT2A 3ZLFA 4J3ZA 3R0KA 4KEMA 4M6UA 2O56A 3VCNA 1SJDA 3SBFA 1FHUA 3CAWA 2ONEA 1EBHA 3CT2A 3PWGA 3T4WA 2OO6A 4E4FA 1JCTA 3PK7A 3MKCA 3RRAA 4ENLA 3UJSA 2RDXA 1MRAA 3DFHA 4K8GA 3R25A 1ECQA 3R1ZA 3EEZA 3DGBA 1TKKA 3UJRA 4DWDA 2FYMA 1NU5A 3ZVIA 4FP1A 3T8QA 1TZZA 1PDYA 3TJ4A 2P8BA 3UJEA 2XH2A 4G8TA 3D47A 4H1ZA 3DG7A 2GGEA 2PPGA 4FI4A 2PMQA 1KKOA 2PCEA 3P3BA 4YWSA 1R0MA 2AL1A 3SN4A 3R10A 3NXLA 1W6TA 3HPFA 1KCZA 4ZCWA 3Q4DA 3BOXA 4HNLA 1MDRA 4Z17A 3SQSA 4J1OA 2QDEA 1PDZA 2GDQA 4Z1YA 2MNRA 3OPSA 4KWSA 2AL2B 3GY1A 3H12A 3R0UA 2OKTA 5FJOA 3P93A 4JN7A 3NO1A 1EBGA 3ZLHA 1BKHA 2POZA 4E8GA 3N6HA 4M0XA 1SJCA 3PWIA 3IK4A 3I6TA 3TWAA 3GD6A 4H83A 3OTRA 3OW1A 3N4EA 3TJIA 4IL2A 4HN8A 3EKGA 4K1WA 1JPDX 4GIRA 2HZGA 2HXUA 1WUFA 3QN3A 3TCSA 2FKPA 2GGGA 4IP5A 2ZADA 3QKEA 3TWBA 2MUCA 3CK5A 1P43A 2QQ6A 2PP0A 3T9PA 2PA6A 2OQHA 3TTEA 2OPJA 2OFJA 3IJIA 2QJNA 3DG3A 3UXLA 3N6JA 3S5SA 3I4KA 1KD0A 3FV9A 2P0IA 4A6GA 4MGGA 3UCCA 1IYXA 3MUCA 3GC2A 3FJ4A 4K2SA 3P0WA 6ENLA 3VCCA 5BOEA 4MMWA 4DHGA 3UJ2A 3JVAA 4GFIA 1E9IA 2NQLA 1OEPA 1BQGA 3JW7A 2GGIA 1EC9A 4DYEA 3DFYA 4A35A 3H7VA 2AL2A 2XH0A 7ENLA 1KKRA 4GMEA 3THUA 3U4FA 3RO6A 1XS2A 4HCDA 5ENLA 1WUEA 1P48A 3MY9A 3STPA 4HNCA 3QLDA 2QJJA 3S47A 3DESA 1XPYA 4E6MA 1MDLA 3OZYA 2OQYA 3MWCA 2XH7A 4A3RA 1ELSA 5FJRA 2P8CA 3VDGA 3VC6A 2OG9A 3UJFA 2PP1A 3N4FA 2QGYA 1EC8A 2PP3A 3D46A 3MSYA 3NZGA 3UXKA 4IL0A 1F9CA 3RCYA 2AKZA 3DERA 5FJTA 3SSZA 3ENLA 3TW9A 2GSHA 3PFRA 3V3WA 1JDFA 1R6WA 2PGEA 2PTXA 4X2PA 3FCPA 4GISA 3IJQA 3MQTA 2GGJA 3SN0A 2GL5A 3JZUA 2OX4A 3ES7A 2PTZA 4HYRA 3VC5A 3CYJA 4IP4A 3KUMA 4ZA0A 3UGVA 3VA8A 3RGTA 2HXTA 2PTYA 3ES8A 4E5TA 4IT1A
chains in the Genus database with same CATH superfamily
4X0VA 3QZ6A 3LCHA 2FHBA 4IJCA 1NDAA 1XHGA 1JR1A 1EPVA 1TJ2A 4CU7A 1B3VA 1VYPX 1ZJHA 3RR4A 5KTLA 5K4ZA 3WYZA 4F48A 2VM8A 1MW1A 4L1GA 3FDKA 1BLIA 2J27A 3IV3A 1YDNA 2QCLA 4H9TA 1XI3A 4WJEA 3FYYA 3TW7A 3WF3A 2PLKA 3R5EA 3QJAA 2TPSA 1NHQA 4IPJA 1H1YA 4U2YA 3PWAA 1BSIA 4W7WA 3AROA 3MDUA 2OKOA 3AS0A 1EJUC 3DH7A 1HXJA 1UBSA 1TIMA 1MVYA 3CQKA 1NHPA 4MNKA 4HHPA 1P4CA 2G8ZA 3W1MA 3WK3A 2BNJA 3V1PA 3GDKA 3R11A 5I23A 3PBVA 1UC5A 1I8JA 2OYMA 2RUSA 3CEPA 1RSCA 2B31A 1UR9A 4PMDA 3CUJA 1MEWA 4MKSA 3P60A 3WF1A 1LQ2A 3GNNA 4M1RA 1RD6A 1K4GA 2CHNA 4XB3A 3ZJ6A 1Q6QA 2GGHA 1RV8A 2O0TA 1ZP3A 1US2A 3CXOA 3MMWA 1SFTA 2PAJA 4DAFA 4V33A 4O0KA 4BS0A 2HS8A 6A3HA 2F6XA 1VEOA 4HSNA 4XD4A 5I3KA 1GOIA 1EXPA 2ZWZA 4NZ1A 2I5IA 1MWOA 1XANA 1R3TA 1EBDA 2QIIA 4JYFA 4EWND 3AU6A 4A29A 3G6LA 2Z1VA 1BRLB 1H60A 3SGZA 1GVYA 3IJLA 2JKAA 4ZO6A 1ITXA 3M0ZA 1V8EA 1W3IA 4D6EA 3E2QA 2WC3A 2YL6A 1W37A 2GQ9A 4BQ5A 4QISA 4IPNB 4Z0JA 4KEMA 1BYDA 1POKA 4LV4A 1B2YA 2DVUA 4AMCA 3AISA 1WPCA 3S4TA 5CG7A 3G8RA 1EPXA 3GIQA 2XN2A 3VDAA 4LAOA 2CW6A 4IGMA 1W3NA 4BKNA 3BMVA 3N34A 4B5XA 3VOHA 1H4PA 5ABGA 3RU8X 2Y7DA 2XDFA 2VGBA 2WKLA 4BWLC 1VCGA 4PR4A 1GGOA 3GXDA 3H54A 3PSVA 2V81A 4XVDA 3T4CA 1Q7ZA 2WP5A 3KTSA 1WOAA 3BWWA 4LU0A 4EF9A 1B31A 4YTSA 4KGLA 9XIMA 4R7JA 3L67A 3W7IA 1MYRA 4TVCA 3N15A 4MJZA 4PUWA 5A6JA 1AMKA 3CZ8A 4W4QA 4D8AA 3RN6A 3H6OA 2XU2A 3XIMA 4LTSA 1UP2A 3W83A 3SCRA 3FX4A 2DU2A 2Z1WA 1FCVA 4QX4A 5D8WA 4H4QA 3W28A 5HXMA 1YQZA 3BGAA 3CQHA 4MB1A 2FGBA 5C8BB 4PYSA 4MDOA 4YWOA 4D6DA 2ZWYA 3GSMA 4JIEA 3WQCA 2RGMA 2VO5A 2WCAA 2AL2B 4L1XA 3NL2A 1W1IE 3PZGA 4PFHA 1TE1A 1N5WC 3WLJA 1MW0A 3BVJA 2GJLA 2POZA 3SI9A 2QMJA 4FIQA 3DK4A 3W87A 2BX7A 2QNEA 3EX4A 2X7VA 2B7OA 3GRTA 4ICMA 1NVMA 4BF7A 3G3DA 1JNDA 4HJWA 1TJPA 4PUNA 5AB3A 5I0DA 4XTDA 5A2AA 3RM4A 1IGWA 4PMNA 3FGCA 2ZFAA 4QIUA 3IUHA 3UW6A 7ODCA 2GGGA 3H2EA 4Q8PA 2NVAA 2I14A 1KBLA 4Z2LA 3RIKA 5DMYA 3LHTA 3DZ1A 2F61A 1TQXA 2V0TA 4JTLA 3TTEA 4UFMA 4HIBA 3WK2A 2BXVA 4EP8C 2QCNA 1GORA 3RLHA 1EH9A 3NOEA 1QWGA 4HGXA 1LROA 4MGGA 3UA4A 1VENA 1S2AA 1MUMA 1CXIA 1E1EA 2JIEA 3AMLA 3VCCA 4E8CA 5I03A 3MBDA 4L4OA 3L8KA 1DJQA 1S2CA 2NQLA 1TV3A 5E9AA 5KSWA 1LOSA 1F8WA 1NIUA 1NWUA 3U8GA 2A6NA 1RK6A 4ZB0A 4B4HA 1KKRA 1M7XA 1WDQA 3EWWA 2P53A 4IGHA 4XX6A 2NX1A 1Q65A 4LUSB 4MTVA 1GJPA 2Q8LA 5I3FA 1ZRQA 1RCXB 2ZZ0A 1M3UA 1I2OA 2ACRA 1GVIA 3KVKA 3E5PA 4S3KA 1EO7A 1US3A 3ITXA 2WMKA 3WY1A 1S2WA 3W02A 4AD5A 4FA3A 3NJ3A 4FLSA 3MSDA 1OT2A 2E68A 3STGA 4AEEA 3O3RA 1TWIA 1O66A 3F4VA 4CU8A 4TX9A 4QLJA 4O52A 1KR0A 4Q6JA 3TW9A 3GW0A 4AXNA 1IR1A 4PC8A 4K68A 3V3WA 2Y63A 5LA0A 2FVMA 3B9AA 1KBKA 2XM1A 1FIQB 1EHNA 1D7FA 3JU2A 4NYUA 2ZZ4A 4JHZA 3L5LA 3WCZA 4X9SA 4G7EA 2EXOA 4M5PA 5A95A 3RGTA 2PTYA 3KOFA 5AHFA 4ATLA 3ME3A 3OIXA 4MNMA 3QMSA 4BURA 2V5LA 4TV6A 2XSAA 3LXCA 2J7DA 2PFHA 1G0CA 4WHBA 1CDGA 5IDZA 3LHVA 1K8CA 5LYRA 3W7LA 4C7DA 4BV6A 3GW3A 3HTWA 1MZRA 1K9DA 1OT1A 2PWUA 2DSWA 1YXDA 2E40A 2QF7A 3S2MA 4OOUA 4DLMA 2CLEA 1A47A 2BY2A 3L2LA 3WF4A 3GBEA 4MUPA 1VEMA 4IHCA 3KOWA 4GRTA 1BWCA 3PTKA 1OFPA 3WDIA 4US6A 1S2VA 3ZVHB 1PTAA 3ZM8A 1CEOA 3II1A 1A5SA 1FTXA 4O17A 2P3EA 3BE7A 4R7WA 4OWGA 1UP0A 1OC6A 4RE4A 3OZPA 5I2UA 1MW2A 2P10A 5A8GA 1VQTA 2ZZ6A 4J3TA 5CJMA 4M6PA 3WDHA 4GO8A 2BSLA 3OQ8A 4OGZA 4I9TA 3KFTA 4KGJA 1V51A 4EAMA 3QC0A 1CGYA 2QJIA 4OBRA 5FD0A 4BJHA 1H7OA 1Q8AA 2NUWA 3N25A 2WOVA 3TYZA 3BV7A 5AFDA 3P5ZA 4XBKA 1HW6A 3WF0A 2FZ8A 5FI8A 1VLIA 3A12A 3N73A 1G67A 5AYBA 3WD1A 3ITTA 1WKFA 2WJDA 1C90A 3FHAA 2YX0A 1W1PA 3ZWSA 3EWXA 3H2FA 3RMEA 4AD4A 2GRTA 3UEQA 2VC5A 4GGBA 3KBVA 4JTDA 1C8XA 4OTKA 1XXXA 3ZLFA 4UTHA 3FS2A 4UTUA 2RGLA 2O56A 3CV1A 1JNEA 5ABFA 4MPKA 1QVBA 5EMKA 4ZO7A 1ZHAA 3CWHA 5K9DA 4WY0F 5M3WA 3QV6A 2P5NA 2XGBA 3NQVA 1YHTA 4WCJA 3AMZA 1F6PA 3VUPA 4GVIA 4MDPA 2GJRA 1U1HA 3AXMA 2WANA 3EB2A 5AKQA 4RNJA 2C18A 1JCXA 3LBCA 4IMGA 5C2CA 3W7NA 4DUWA 3PZ9A 4M6QA 1VF8A 4IFKA 2NSOA 1H61A 3F5LA 2OWXA 3OLGA 5GNZA 3PULA 1LBMA 4FP1A 4W93A 3H4XA 3U2ZA 1B3ZA 1TSIA 3WLIA 1ALDA 1KFLA 3B03A 2INEA 3UXAA 3UR2A 1KFWA 4S2BA 3CIVA 4AG0A 1GTHA 4FR6A 4XZNX 2XIQA 2AMXA 4ZCWA 1A5MC 4B3ZA 1K02A 1LOQA 1OCNA 1UZ4A 2EG7A 1TMLA 1OK4A 1V93A 3GG0A 2R9ZA 1E6SM 3AUOA 4DI9A 2ZXQA 1MNZA 5BXRA 4QQ3A 3TJLA 1G01A 4QG9A 1AUSL 5HULA 3A5VA 1OF8A 1YPXA 4DO6A 2O4QA 2XINA 1XCXA 2MNRA 4Q8QA 2FHFA 3CV6A 3H12A 2E1WA 4P8VA 3H26A 2WHLA 3TYEA 2G3MA 1ZMDA 2IUZA 1TR9A 3I7SA 3T0AA 1F8IA 1GVSA 3EGJA 2E8YA 4CNOA 4M0XA 3C2EA 3SUWA 1HIZA 3OTRA 2XFYA 2VWSA 2XFRA 1AZ1A 1T8QA 3EKGA 1N82A 3S2CA 1KQYA 3SURA 2C0HA 3LTPA 5H6HA 4K7ZA 4UC5A 3TSBA 3AN1A 1ICQA 2PA6A 1XF0A 4PMUA 2G96A 2WNZA 1XH0A 1HJXA 3DKJA 3OBEA 2HV5A 2OPJA 3CTTA 3H2NA 3GAYA 1PXGA 4L6HA 3BXWA 3HBLA 3WFAA 4RNIA 5BRBA 2WPFA 2TMDA 2J25A 3L0NA 1JEZA 2OEMA 3OG3A 3EAOA 3UA3A 4X0NA 3F4WA 4OBTA 1KB3A 2ZUMA 4LS0A 2AAMA 4V2XA 3TC7A 4UTFA 3GBDA 3IVSA 4OUEA 4ATDA 6REQA 3KCLA 4KERA 5A3HA 1I2RA 2VX4A 2NXGA 3UETA 3E0VA 5DBUA 1Q6OA 3URAA 3W85A 1ZBCA 1BXBA 4ICCX 3WBWA 3HOJA 3PPFA 1EC9A 4Q7NA 5E5CA 2VL4A 5CPTA 3OVQA 4ZQRA 4A2SA 1WAUA 3HQPA 3GVRA 3TQ0A 1WUEA 2YGYA 2WHMA 2J3NA 5EBAA 2A0NA 5HUOA 4N6EA 4ZXLA 1NEYA 2PURA 3G1RA 1K4QA 3IJ6A 3KWSA 2J7CA 3K2GA 4GK8A 4RUBA 3WJZA 4ZEPA 1IXQA 3H2AA 2DT1A 1HKMA 3HFYA 2DSKA 1ZDLA 3MPGA 4I9MA 1UIOA 3FY1A 1V97A 3DGZA 3SRDA 4QDMA 5CZSA 1E0UA 5AYIA 1QDSA 3W26A 2X30A 4CD8A 3BDKA 3PPHA 4O18A 1QOPA 1DE6A 2QULA 3TXZA 1MO0A 2Q71A 1O60A 3VIOA 3R7MA 3DFQA 3W1RA 5A6AA 5BXPA 4LQ1A 2JE8A 1ADOA 3E9AA 4UFIA 4UTTA 1B90A 3EWYA 4HNNA 1FKXA 3GUWA 3U4AA 6ALDA 2G50A 1DJIA 4FDCB 2WBAA 1MO9A 1ITUA 3TJXA 4LYKA 2BXYA 1E6RA 4AVOA 3G0XA 2OZ8A 3PUDA 2UY3A 2VCCA 1IWPA 1SGJA 3EF6A 3KBNA 4Z08A 1MNSA 4AIOA 1QU4A 2Y8UA 4QE5A 5IOBA 1I60A 1TREA 3PNUA 2VHLA 2CFFA 3NA8A 3UWUA 3ZZ1A 4D9PA 2X7WA 3VX0A 1XBYA 4DIAA 3O16A 3QHOA 3EDFA 2QVHA 1UD4A 3SUUA 2Z1BA 3HZ3A 3QPEA 4BF5A 2AQWA 3N2CA 5BOOA 4D71A 5EU9A 3NVVB 5ER0A 1J0HA 4YMZA 3H23A 1CGTA 1IGSA 3LG3A 1WE5A 3DI1A 1RY0A 1XL9A 3B0UX 3OO2A 4EKJA 2E9LA 1W8GA 5D37A 2XHYA 1U5HA 2R91A 4JHMA 4UR9A 4CD7A 4FIRA 2CXGA 1JCMP 1JPMA 3E0LA 4JN8A 2BY1A 4J3VA 2O92A 5AC7A 3W25A 3N14A 5FJPA 1VCFA 3WDJA 2F6UA 2UWFA 8RUCA 3QMRA 1KR1A 1FWNA 1LM1A 2ZRZA 1CCWB 4ACZB 1BG9A 4D2JA 1N61C 4PMRA 3T44A 2NX3A 2PE4A 4ALDA 4EVZA 5IRPA 3ZJKA 3HU7A 5CLTA 4Z1CA 4XUYA 3IGXA 1SO6A 3UXDA 1JF6A 3R0KA 4M6UA 3AHYA 3WD2A 3QKZA 4J28A 5BU6A 4JTSA 1R86A 1T7LA 4AF0A 3NS1B 1QPRA 2DY3A 5A6BA 1JQVA 1CIUA 1EGMA 2C1IA 4ENLA 1R9XA 2QEZA 4ZQMA 3CL8A 1PWLA 3WLMA 2P50A 1YQ2A 4GVHA 5CBBA 1ZCCA 1G4EA 4PBGA 2B7QA 4XK2A 2CZ5A 1V6WA 5DF0A 3MA8A 3WZ0E 1YXYA 1R8LA 3GH7A 3UBPC 4FX7A 4FX9A 3WFLA 4UTKA 2D23A 4GE8A 2J6VA 4MWAB 4EXAA 4L65A 1XJBA 3M47A 2X99A 3FFSA 3D5HA 2PPGA 3GB6A 4HPGA 4U5KA 4J9JA 3WLNA 2AL1A 2V5BA 3WMSA 2H6RA 4GKLA 5JXQA 2WPBA 4QQUA 1R3RA 2ZX6A 2X1UA 2GDUA 3GYCA 3PBYA 3S5ZA 5B7YA 1UD8A 3KE0A 4H4WA 3P82A 2DPEA 1VFLA 1IV8A 4RCXA 1SSDA 3TV8A 2DH3A 3LQLA 4W7UA 3UESA 4CCDA 4HNUA 3SUVA 1OZMA 3FEQA 1UKQA 1RQEA 2PRMA 3GTXA 2WNQA 2Y24A 2QJGA 3KWXA 2NVCA 3W07A 5D33A 4S2CA 2YDRA 1IIHA 4KF1A 2DVXA 3OVRA 3GZAA 4JQ4A 2HQMA 1WZLA 5BMWA 2XSBA 4UQCA 3NQDA 5D2VA 3IK4A 1YNYA 5AECA 2C79A 5CKSA 1W5PA 4DF0A 1UA3A 5T9BG 5C9UA 3MT1A 5T9CE 2Q02A 6PTDA 1JGIA 2ZZCA 4HTBA 2VGFA 4WGHA 3W2LA 3DFOA 4IQLA 4AZHA 5K9XA 1O95A 3RJXA 1HJQA 3BMXA 1NHRA 4TUFA 3JS3A 1Z3NA 3COTA 2GOUA 4BI5A 2XVKA 3W37A 1W5NA 3NSXA 1FWTA 4F8XA 5EYWA 1AQ0A 1W3TA 1BRLA 2OFJA 1DWFM 3P67A 1F76A 3URHA 4LBSA 1OJTA 4XBJA 2D73A 1I75A 3FDGA 1V5XA 4EK7A 2C3ZA 2HE8A 3LTYA 2F7FA 3VO0A 1OY0A 3BLFA 3VIIA 3HMJG 3O2LA 2FDSA 3W1NA 2OZ0A 4B5VA 4ADWA 4U4MA 1OWQA 4C6NA 1OX6A 3VIPA 4B92A 3SCTA 4EMJA 2F6KA 2GQ8A 3IACA 4P8XA 4Y6GA 1W2PA 3FYOA 4QBXA 1O1ZA 3NUKA 2WCGA 1U33A 5D38A 3GZ3A 3STPA 3WIJA 2RDUA 4HNCA 5LHEA 5DFAA 3MVTA 3QLDA 2CKRA 2QJJA 3S6DA 1BAGA 1R3VA 1Q2SA 5HJYA 3J7HA 4YWIA 3MMTA 3QGAC 2GQWA 1N55A 2TRSA 2CLKA 3IS4A 3SFWA 5I06A 4S23A 2QGYA 2PP3A 3BLDA 4A8LA 1BGGA 4XAZA 2YAUA 4N4QA 2B0MA 4HZ7A 1OF6A 1EJ7L 2DZTA 4AHQA 4AFYA 2J7HA 3RDKA 3I3BA 3AQUA 1A5LC 3M5ZA 1KFCA 4GISA 3MQTA 1NP0A 3LB8A 2DVTA 3ZR5A 4HSHA 3ES7A 3POCA 2V6AA 1QNOA 2FZMA 3UR5A 5I07A 5JMUA 3REQB 2GR2A 3WDRA 3CUXA 2W0HA 1H0IA 2NV9A 1LLWA 2YBUA 1VFSA 4GQRA 5DQPA 5IM51 1CLKA 4GYKA 3T05A 3UERA 1FKWA 3BSHA 3LDVA 1JFHA 1NELA 2XIJA 1OCQA 3LXDA 4IX0A 3STCA 2C15A 4TX6A 3QTPA 4QAIA 2V3DA 1JYWA 3LX9A 2G3IA 4RDYA 1MUCA 4QM1A 2EPKX 3PM6A 1EDTA 2H9AA 1RPKA 3KVJA 1XC6A 1IE7C 3WO8A 4GQGA 3EA3A 3FJ6A 1K8XA 4IZGA 4UQ9A 1PIGA 2ZYFA 3WH8A 1VFTA 2WXDM 1WKYA 4EE9A 1GHSA 5HPOA 4JBRA 2YIHA 4MLRA 3WH5A 3VNJA 3M6DA 2VTFA 4OT7A 1TRDA 2UZ9A 1NF0A 4EQWA 4H7VA 1ZP4A 2FTWA 3OZOA 3CUGA 4J3UA 5HK4A 1MSSA 2YXXA 5A6TC 1YX1A 3O05A 2Y7GA 3WUGA 2QDDA 2ZTKA 2VVSA 4R34A 6REQB 1WYGA 3ZLGA 1KXHA 3WBEA 1N7KA 1WZAA 2FH8A 1KBJA 3W7RA 8XIAA 3M16A 1E6ZA 1XUUA 3OLDA 3S42A 2YOCA 3GFXA 3E96A 5U7SA 4M8UA 1ZKQA 4U3CA 3CHDA 1N8IA 4JQ1A 4DYJA 4DXXA 2YXGA 1E6XM 5D2TA 4H2HA 2VOMA 1FWFC 3DFTA 3AYRA 4M81A 1S5VA 1IEIA 1P0BA 3W76A 2OGJA 3UVIA 1SR9A 3HO8A 2DT3A 5AHIA 5CPNA 4LEQA 4GHRA 4F2BA 1JQXA 4RE3A 1TB3A 2HDJA 4K36A 2BFGA 1V02A 5T26A 1ZMCA 1OYCA 4J3ZA 1TELA 1AMYA 3CUHA 1CNVA 4EPDC 3HW2A 3N3TA 3PF3A 1QWKA 3FSUA 4FLOA 3AHZA 4GUGA 3TVAA 3NL3A 4DVOA 1MRQA 2ONEA 3TC6A 3CZKA 3EPNA 3PK7A 1H41A 4QJ3B 1P6BA 4IIGA 4C90A 3DGHA 1MXGA 1J5SA 2VC7A 4Z1BA 4H8NA 4YVVA 1P6WA 2Y5SA 5FF2A 5DEZA 5HMDA 1A5BA 3O0FA 2DZXA 1O1HA 4JTEA 3N9RA 1U83A 4C6EA 2QDHA 3NQAA 1YNPA 1E3XA 1UD6A 2WZIA 1S3TC 3ARWA 1XSJA 3N13A 3C56A 5B80A 2PMQA 1KKOA 1VC4A 1CI1A 4MJ2A 4JCMA 2BZNA 4XBSA 1S5NA 1UUQA 7PTDA 2QF8A 5M03A 2A7NA 5FF0A 2IXVA 3IJ9A 1NSJA 3BOXA 1VHCA 1IWAA 2ZXBA 2EEXA 4IM4A 5KETA 2FPYA 3MCNA 3CHFA 3U57A 5DRIA 5FIPA 2GR0A 1GREA 1UASA 1EP1A 3W2KA 1Z6KA 3LHWA 2QHAA 1ZSXA 5L6UA 3GTFA 4Z1YA 1Q3NA 3M0JA 4FALA 3PPGA 4XZIA 2ZUTA 3GDLA 2BOEX 4ERAA 2MANA 1V6YA 3KHDA 1V02E 4ROQA 2GUYA 1XYFA 3SAZA 4LAUA 3TTOA 2E6AA 4ERIA 1QI0A 2DIKA 1BXNA 2OEKA 1OFQA 4DWSD 2CLIA 2XGIA 1BKHA 3F2BA 1K7FA 3SCOA 1VPQA 4D8LA 4E8GA 4RE0A 3NSMA 3W53A 4Q4RA 2VELA 1VHNA 4V15A 4O16A 1UZDA 5HNUA 1FDJA 4H2CA 1UWSA 5ABFB 5LSMA 3OLIA 3W2UA 3EEGA 1DWAM 4K1WA 1I6NA 2W67A 2D69A 1W9BM 3DAQA 4B9YA 4O11A 2BLEA 2VI0A 2OSYA 3UPBA 1H7XA 1NDYA 1QOQA 2OLHA 1D8CA 3O8AA 3EXSA 3NYDA 1A80A 2MUCA 4Y90A 1DIDA 5E70A 2OODA 4M7TA 4IQDA 2OQHA 3O1NA 3OEXA 3OGRA 4P7NA 2D2OA 3IJIA 3IK2A 4GCXA 3GHRA 4R27A 2QV4A 2JK6A 3IWPA 3N6JA 1L6SA 2G95A 1SFLA 4HZMA 4UNKA 3EOEA 4PUDA 3GC2A 1XIIA 4H4IA 2DIEA 4JPGA 2J4GA 3GFZA 4MWAA 3EDDA 1CGVA 3BCJA 4Q4KA 4YYFA 3H55A 3ITOA 2Q3RA 5LIUX 3PUOA 3W7GA 1VYSX 3T0CA 1A0EA 2PDJA 1XIFA 2QIWA 1JZ2A 4A3QA 4AH7A 1PKNA 1CXEA 2C0AA 3RO6A 4FNSA 2J88A 1KLYA 3O07A 2NW0A 4AZGA 3PANA 4A8IA 1EOKA 1IXOA 3AXKA 5D9MA 3OZYA 3LLFA 2Y85A 1Z9AA 4WXZA 1B54A 1SMAA 1CPUA 1JZ3A 3C61A 3W1LA 3W7QA 3O6YX 3MSYA 4DBEA 2EQ7A 3FXYA 4IXXA 1ZJAA 1M6JA 5PTDA 3PSWA 4LX4A 2AKZA 3EB3A 1J01A 2HEJA 2J8GA 2PD5A 1OQFA 5LNUA 3EX2A 1EO5A 5CBIA 2DEPA 4FNTA 2GSHA 3UQNA 2E8ZA 1JDFA 3G77A 3W00A 4HNVA 3IJQA 2PBOA 3CXBA 4J2PA 3BOFA 1E70M 1C29A 2JGYA 3BO9A 1ZZMA 5HWNA 5LGXA 2WMHA 4FO4A 2EQDA 4CQBA 3GG7A 1FWBC 3KP1A 3GDRA 5XIMA 4E5TA 5FOOA 3WQDA 3KBSA 4G1KA 2HK0A 3NOYA 4ZSTA 3HN3A 4GGHA 4QR6A 4PMXA 1JZ6A 1ZUAX 1IZCA 2DT0A 3VKKA 2WB5A 3GS6A 1ONEA 2P76A 2YCLA 2WPEA 4PTWA 5G5GB 2R1MA 3F03K 4GI9A 2CBUA 2WZTA 4NIRA 2ISDA 4EOUA 3RYSA 3HG4A 3DC0A 1JZ4A 2PDFA 1TV4A 3AMKA 2BMBA 5JBFA 1TX2A 1VIWA 1Z41A 4DF2A 2X8CA 4HA0A 2IQTA 4B5WA 2QAEA 3NYZA 2CLOA 1R30A 3QZEA 1BSLA 3EAUA 1JD7A 4J57A 2HBVA 4GZ7A 4KIEA 3VNDA 3KBMA 2PTWA 1QHZA 3TZFA 3LMYA 2G3NA 3W1XA 1E72M 3S5YA 1UD3A 1LRTA 1VZWA 1HG3A 1SW3A 2ISFA 1SJBA 3WX7A 1KM3A 1MI3A 1LQ0A 3QM3A 4AVFA 3M0HA 4P7OA 1FXQA 3TEVA 3S2JA 1FFVC 4GZIA 4RDWA 4MJMA 3O6CA 2F84A 1Y8BA 3L2IA 4WSHA 5A5WA 1I0BA 2Z2AA 3AC0A 3GE7A 4J3XA 5FEZA 3B8VA 3NWRA 3W7KA 1H7WA 5DXXA 3P2VA 5D32A 1ZX9A 4FS9A 4I6KA 2VDGA 3W22A 2A4AA 1VCVA 3L4YA 4ATWA 1G1YA 2ZUVA 2PSNA 2BS9A 3SEPA 5DT5A 3DBNA 2YCLB 1DEDA 3UYIA 1TV5A 4F2TA 2CITA 4TQTA 5EY5A 1ZAIA 4DJEA 1VR6A 3EOSA 1UJQA 1VFMA 1UHVA 2W66A 4DZIA 3PTDA 4PBFA 1F7BA 5HWJA 3RJYA 1QJWA 5JIWA 2Y6ZA 3QV7A 4RZ4A 3QGKC 4UQDA 1XD0A 5HJXA 3GNPA 2FZ9A 1GRHA 4GUIA 1O6IA 1GYLA 3BMWA 3OB8A 3BK0A 3B05A 3PP7A 2VRQA 2JK2A 2Y7FA 4NXSA 4MKVA 2P8BA 3LN3A 4GZJA 1SW7A 1MEIA 3K8MA 3LCLA 1V3HA 5CAHA 1W9UA 3GTNA 4H01A 1Q4NX 3KVMA 1Z44A 2GVLA 2YW3A 1QW9A 5F1UA 1VS1A 3NIYA 2Z25A 2PLMA 1EEXA 2BGQA 4DJDD 3VIGA 2FLIA 5FS7A 5JRBA 4Z17A 2EHHA 4DJDC 4CNSA 1OBAA 2BODX 2W0UA 2R1LA 4DAIA 4AD0A 2HWGA 4L4LA 3R89A 4EMWA 1NDWA 2ZZ2A 3IJ7A 2A3EA 5D4YA 2YCJA 4P2VA 4HA1A 4GNJA 1JIBA 2WZHA 2O55A 3T7VA 3RAOA 4ZO9A 3VMPA 3L68A 4URIA 1TV2A 4PODA 1AQHA 2VFIA 3N6HA 3CIXA 2QAFA 3CZJA 1ICPA 4C1LA 2R24A 2DZVA 4H83A 3F4CA 2WKGA 3S9IA 2Z6IA 1PZ2A 3LCWA 4LJ3A 3CV2A 3S1VA 3GG8A 1QW8A 1KXQA 2D3LA 2EO7A 1M7OA 2QQ6A 4WIWA 4KS0A 1MQPA 4FNPA 4AQLA 4C7FA 5FCZA 1YPFA 2R14A 4C91A 3IJ8A 1IQ8A 1E6NA 1KRMA 2YBVA 1DXLA 2RJGA 3HA1A 1UR2A 4QLLA 4Q32A 1V4YA 5F1VA 1M5WA 3FJ4A 3CWOX 3N2MA 3P0WA 4G7EB 4C6FA 4ERGA 2QUVA 1G9HA 2WM0A 4B4FA 5JCLA 2OJPA 2V3FA 3WNKA 3LY0A 3WELA 7REQB 3WNPA 5I24A 1ZS2A 2GGIA 2BVDA 4A35A 3TP4A 1GVRA 4BI6A 2YB1A 4M51A 2PDGA 3MI2A 3RHGA 3DFPA 2YPIA 4B3LA 3W4RA 1TUXA 1E40A 3T0DA 4LUYA 5D2YA 2R1PA 4FXFA 2QCMA 4PUEA 5A8PA 3HPSA 3A9BA 3NDZA 5KMYA 1KC7A 1MDLA 4KCVA 1WDDA 2VMFA 3RO8A 2GDVA 1TA3A 3VNZA 5FJRA 3KXQA 5IFTA 3T2PA 2PP1A 5CH9A 1RCQA 3TXVA 3T2QA 1LUCB 5C9WA 4DBDA 3NO5A 3W3OA 4PMYA 1LG1A 1KTBA 1XLKA 4K1GA 4GACA 4MJ4A 3L4VA 4MY1A 1ZAJA 3QR1A 5FAJA 3RX2A 2RJHA 1Z42A 2JQXA 5JBEA 4UBPC 2PGEA 4FB7A 2J74A 4TV5A 3AZTA 3H4KA 3HV9A 1XDLA 1CYGA 4PCFA 2ATSA 5FESA 1SZRA 3G24A 1W0MA 5FJJA 3K13A 3DYMA 1UCWA 3KRBA 4BEQA 3SQMA 4M7SA 3A21A 2W9MA 2DGAA 4R85A 1YADA 1KFBA 1QRQA 3VOJA 2B7PA 1PEZA 3MDWA 4FXRA 5IHSA 1KTCA 3LPPA 3VIFA 2E5CA 1V6TA 1YE4A 3LHYA 4F40A 3WJXA 1PX8A 3ATZA 1TYTA 2FZNA 4J35A 1ONWA 1RBAA 2Y61A 2Y2WA 3LGEA 1KTNA 3VGGA 4ZOBA 2NV2A 2WPCA 4JTTA 5C2XA 1IXPA 1XIMA 4PCPA 1BYAA 3K30A 3QW4B 2WVSA 3GXMA 1SZGA 3C2RA 4Q6XA 3V36A 1E9LA 4DI8A 3MO7A 2IPGA 2Y0FA 1E0WA 3KDOA 3HFTA 3O0HA 1GT8A 1GRFA 4ROPA 3RPTA 1J2BA 4TIMA 1FP8A 1X7FA 2PB1A 1QASA 4I5UA 3ALFA 1VGAA 2XN1A 4US5A 4QS5A 4H4ZA 3H8AA 1MOKA 4NJHA 1UPMB 1PUDA 1K6AA 3PZTA 4MYXA 3SCPA 3KBWA 4IJBA 2EG6A 4X61A 4ADSA 1XLFA 1TPVA 4RLIA 4I7VA 1GOWA 2POTA 1FWGC 4LB3A 4MKNA 3S6OA 2VCBA 5CPMA 3AICA 3VOIA 1HL8A 5G4EA 4UZUA 3O0KA 1SM9A 2DZWA 5EA9A 4QDPA 1XLHA 7CGTA 3TR2A 4UFHA 3TOYA 3S3GA 4EIVA 4C6LA 4Y8EA 2HS6A 1QXLA 3QPZA 2YYUA 1ZBWA 3UPWA 2ZICA 4ZSUA 3NVTA 5HUPA 3MKKA 4K7YA 3RLUA 3WEOA 3GHTA 1D2KA 2WVTA 1W54A 4YLWA 3WQ8A 1C3FA 1X2HA 3P8IA 4H4RA 4JX6A 3G18A 3BJTA 3LS9A 1GW1A 1XH2A 2VKZG 1JL8A 5LKYA 1EJTC 1XX1A 2YFNA 3URBA 1VB9A 1FHUA 4PTNA 3L0GA 2FFIA 4IPPA 1M03A 1EBHA 1EF3A 4MFEA 4ML4A 5XINA 1N8FA 3RRAA 3BCFA 4LIIA 2R1KA 3NVYB 2OR2A 1DQUA 2WNWA 3ZT5A 5CAKA 3EWCA 4DJFC 1LJYA 2INFA 1JCLA 1UR4A 5TBOA 3G1XA 3MI6A 3C4UA 3L4ZA 3F1QA 1O5QA 4P7LA 4Z1DA 1VFOA 3DHUA 4L9YA 1D8WA 1I0DA 3VD9A 3V0SA 1TZZA 2A3HA 3TJ4A 4JR5A 4ILSA 5AZ1A 2YR1A 2XVLA 2D2GA 5M17A 1KM4A 3CPGA 3KL3A 1QPOA 2PCEA 3FLUA 4Q33A 2E28A 1R0MA 1JRPA 1B57A 1WOBA 3QH2A 2VEKA 4Q8OA 5AOUA 1QBAA 5C9RA 2VP8A 4EQXA 2XWDA 1TA3B 3WQWA 2AGKA 3W7JA 3ZR4A 4HNLA 4J1OA 3PBUA 3N3MA 1IZJA 1FWJC 1RALA 4UNIA 4XTIA 2H8ZA 5ABHA 1ZBKA 4MM1A 1QW7A 3NPWA 4NNBA 4CCZA 1PV8A 3W1TA 3VKCA 1IT7A 3GXTA 3W88A 4W8LA 4L7ZA 3E2RA 3LHUA 1QPQA 1F4HA 5IXEA 3PTMA 2PF0A 5FF7A 1B4EA 3QHMA 2E25A 2BP1A 3CUFA 5KZ6A 3DCPA 5XIAA 2I7GA 5CJNA 3VDHA 1M53A 4XD3A 1GCYA 4DPQA 3KRZA 1W1TA 3SR7A 3HQNA 3MS8A 3TWAA 1U1JA 5U1OA 2PWHA 3T81A 4AU0A 3PZVA 1N8WA 2JEQA 4OJYA 4PB3A 1TPDA 3BLEA 2HVNA 2XIIA 3NSNA 5FAGA 1JPDX 2ZA2A 4O57A 1I1XA 3CTLA 4NZ4A 4O53A 1AOGA 2VVNA 3EOUA 3F5KA 1UW9A 4LY8A 4HT3A 1JD9A 1UR8A 3UG8A 5C71A 3KZSA 4WD0A 2A6LA 1JCNA 3TU9A 1XV8A 3TAOA 4IIBA 4ADTA 1JI2A 4QLKA 4WKHA 5LNWA 2QJNA 1DHKA 2W3ZA 1DWJM 3CZEA 3T55A 3HB9A 1EYWA 4O1BA 3HG5A 3NQBA 4GLEA 4V1XA 4QNWA 1GVEA 4K2SA 1X38A 2H8XA 4N9DA 5H8PA 1PBGA 3QFBA 2BOGX 3EKLA 4LOCA 5LNRA 2QW5A 5DCBA 1XYBA 4NKCA 1QT1A 3RX3A 3T1GA 1XBVA 4K6AA 5BU9A 3MHFA 2V6OA 5ECUA 1M9HA 4US5D 4Q4PA 1YE6A 2PC4A 3BZGA 2HMCA 4N42A 4CKQA 2VNCA 2BVYA 2J78A 1HFBA 1XS2A 3EMQA 1VBUA 1ZU8A 3MY9A 2G5WA 1GXFA 4LVDA 4PUKA 2BASA 1E5JA 1XPYA 5J5DA 4ZQPA 1X2GA 1UWAA 4KCWA 1OG0A 3TA6A 4JCLA 1CT5A 1WXYA 2W91A 3LXAA 4QAWA 3DOPA 3A64A 4XD6A 1XRTA 4TVDA 5EMJA 5I3IA 3OODA 1R5YA 3OGSA 2PEVA 1M1BA 1BPLB 4U10A 4KWWA 3ZO9A 3AJXA 1WNOA 5JCMA 4JYEA 1E71M 4O13A 1PE1A 4D6JA 4L61A 4HBKA 3SN0A 1GZ1A 3T78A 3G6MA 2C71A 1YPIA 3IGUA 2HXTA 2W5FA 4LAMA 2C3DA 2VJXA 3MYPA 2FJUB 3IV8A 1ICSA 2PRLA 1GYMA 3KS5A 1V59A 3OZMA 4GCAA 1H7PA 2XZ7A 4CCEA 2E9BA 2GLKA 2HPIA 4DXKA 3DHPA 3VGBA 1KGUA 5CPQA 5BCAA 4CCCA 4WOQA 4GVGA 4O14A 1O5RA 3LGDA 1UP3A 2ZXDA 3GDTA 3LUTA 4I90A 5CGTA 2OZTA 1EL3A 3KX6A 5H8MA 4OV4A 5CXPA 4HHHA 1E9ZB 2UBPC 1ZAHA 3IGHX 3H22A 5CSUA 2Z24A 3USBA 2Q09A 3H2CA 4KFPA 4NX0A 4YTUA 4WF7A 2WLZA 4A8RA 3UWQA 1W9DM 4NXKA 1Q8JA 1UZ1A 4AD1A 5B7ZA 2W6RA 3MUIA 1FP9A 3OIHA 2RABA 4JY9A 1DWGM 4Y9NA 3OA3A 2FZDA 1F74A 3N17A 1GETA 1H49A 3P7YA 3UCQA 1NY1A 1VBJA 2NLYA 1JDCA 3M9YA 3AO0A 3B8UA 3WBYA 5KINA 1SZFA 3VGEA 4R5EA 1H5YA 1UWIA 1ONRA 2C91A 3LNMA 3CMGA 1ZFJA 1A3WA 1JPKA 3B4YA 2G0WA 1P7TB 3TYCA 3R12A 1WAWA 1RCOB 3E12A 2DZBA 3DG6A 1FBAA 2I17A 2FVLA 3KM8A 2NLIA 4L4PA 2AGTA 5JIPA 4B5NA 2VR5A 4L64A 4BR1A 4DZAA 2V5CA 3K4AA 4Q4MA 1WDSA 5A69A 4TVYA 4OZOA 3HJEA 3ZMRA 3RX4A 1JJKA 3A3WA 3MO4A 4WDWA 1TWWA 4NZJA 5JQ9A 3ARYA 4UCGA 3ZWTA 5AZ0A 4O8AA 4GQ0A 2G97A 4GINA 1TRIA 2VRJA 5AHLA 2X0HA 3B8WA 3GNRA 3T4WA 2G3JA 4IFRA 1F61A 4Z2JA 3MVIA 3U2OA 1DL3A 3TYDA 2GVJA 1E73M 3GRIA 5GJNA 4HN4A 1HVQA 1IZKA 1RBLA 1GERA 4GPNA 3BARA 1QHPA 4R7OA 3R1ZA 4W9TA 1YTDA 1VJSA 1VBGA 3N9KA 3I65A 1F4AA 2R1NA 1OX4B 1F6YA 4RZ6A 3A6OA 3MSRA 3G3MA 4C5ZA 1Q66A 3W71A 2EGZA 1VDVA 3SW6A 4Q8UA 3DG7A 2PWEA 4Q7BA 2IPWA 3ETRB 3LM7A 4XWUA 4HU3A 2BDQA 3QLLA 3WQ6A 4J40A 3WNOA 4UB9A 3VE9A 1Y5VA 3SN4A 3NQCA 1YMYA 3KEHA 1T3QC 3FGCB 3MMDA 3HPFA 2OO0A 4Q3MA 3UG4A 5BRQA 3EXRA 1S38A 4I9JA 3WG6A 4NZCA 4XAYA 1V79A 1X8CA 3L9CA 4AIBA 4J7RA 1E51A 3UY8A 2ZZ3A 1V7AA 3SCVA 4HD5A 3MZ2A 5C7HA 4QP0A 2J6XA 5EB8A 4G2DA 3E0IA 3U0HA 5CZTA 1EX5A 1C7TA 2Y8VA 3EDEA 3IGSA 1TJ0A 4FXSA 3A4AA 1XLCA 2BC1A 4YHGA 3TE9A 5FS9A 4PZVA 1A5NC 1D3CA 2WC4A 3R0UA 3SQLA 3D3AA 3H4WA 3K4WA 4LANA 4N9BA 1FWWA 1RA5A 2EPLX 3ZS4A 4MY9A 5HWMA 4JHOA 1IEQA 2XTKA 3MTWA 4ZTYA 3I6TA 4ZOCA 3QQ1A 4Q8VA 5G4HC 2ABAA 1MMFA 4GXMA 3TJIA 3QV9A 2X0YA 4UUIA 3VU2A 3LD5A 3O7UA 4JDBA 2QAPA 3SQPA 3CH0A 1HO1A 3EMZA 1J0JA 3MWAA 4NRRA 3VGHA 3IAPA 5DY3A 1P43A 2V5JA 1K1DA 2QVNA 1ZQ5A 4DUVA 1QAPA 1RM6B 4IIFA 3VXGA 3CUIA 4OBSA 2J62A 5ABTA 1GRAA 1K4HA 4ASTA 4AZ5A 1NOWA 1QNSA 2EJAA 2QDGA 1W9PA 1DXFA 4S3FA 1JCJA 1F6KA 2Y62A 3L21A 3I3DA 4D6IA 5C0QA 3SFKA 4DJDA 5CZKA 1WX0A 9RUBA 4Y8FA 2X1TA 3LEPA 3JR2A 1KM2A 2UV8G 3B06A 4R9XA 1V6XA 1HQTA 3PBWA 2WJFA 1EB3A 2GK1B 1IXNA 4JNYA 4JNZA 3H7VA 3I6RA 1PZ3A 3VKAA 2EKCA 3IIPA 3P62A 1OABA 4HYWA 1NQ6A 5TR3A 3WQVA 3KLJA 1P48A 4KMQA 3MKVA 2OQLA 1S1PA 2OYKA 4DY1A 2WBGA 2PLJA 2P8CA 2VZTA 5BRPA 1HP5A 1ZJBA 1W2VA 4JX5A 2YXOA 3WLSA 1KGXA 2NQ5A 2D1ZA 3UY7A 2X0SA 4YIWA 3HQOA 1CWYA 4S38A 1J96A 3BAYA 4O1CA 4JFSA 1WP6A 1V77A 1R2SA 2YL5A 1R6WA 5FMHA 4M1BA 3C2FA 4A22A 2VRKA 3L4TA 3JRKA 1TTPA 4HK6A 4RPPA 1TTJA 2F8QA 1MW3A 2AOSA 2CU0A 3TMQA 5SWUA 4FK9A 2DV0A 1FVPA 2X09A 4IP4A 4PCNA 2CZFA 2EPMX 3FK4A 2GSEA 1GOMA 5KITA 2PDPA 4IT1A 2PDQA 3OOQA 1XYMA 3RCMA 3AIRA 4EM4A 1GONA 1S46A 5DN1A 2IKHA 2FJKA 1TMQA 1XWYA 1RAKA 2YDQA 5HBFA 3EOOA 4WUIA 2VFDA 1B9ZA 1ME7A 1RJRA 4C6DA 3TIMA 3VZXA 3W75A 4OQVA 5CEWA 4ZENA 4W86A 2FMOA 3AOFA 1ZBVA 2ZDSA 1W9XA 4NAEB 3NPVA 4NNAA 3CLMA 2WM1A 3G22A 2ZRVA 1EJWC 1OK6A 2I56A 4B5UA 1G6CA 4GA8A 1SSGA 4MF4A 1JULA 2QGHA 1EKOA 4QE1A 1B3YA 4AZ6A 4ZTXA 5EPDA 1CX9A 2VZOA 1DTNA 2AKMA 2PS2A 3L4WA 1XG4A 4ML9A 1L8PA 4EQSA 3ITCA 2CESA 3V18A 4WY0B 1JZ5A 2Z2BA 1EHAA 1TUFA 4LCSA 4J5NA 1FFQA 1BXCA 1F07A 1FWCC 3KAOA 4JN6A 4FLRA 2O9OA 3E2VA 4H4PA 3VKDA 1EA0A 4D6CA 2VZUA 4PSPA 1CTNA 1XDIA 2OB3A 3EPOA 4PCSA 3R8HA 4LUTB 4X60A 2OWCA 3S1GA 4UOZA 5IBXC 3KDNA 3C2YA 3K5XA 1EP3A 4MYAA 3OU8A 4HKPA 4KCUA 2O7SA 4CNNA 2VEPA 3F5JA 5AHEA 3W70A 1ZB5A 1ENUA 2ICSA 3BLPX 1XYCA 1AW1A 3V5CA 2VQUA 1QPNA 2WO5A 2RFGA 5EMUA 1VBRA 2KZHA 4PTMA 2VENA 1RQBA 2OLSA 3KVLA 2Z1KA 4XZBA 1BVWA 3CL7A 2NWRA 5EMMA 1IR2A 1SJDA 2E3ZA 4L5ZA 1LCOA 1GK8A 2GWNA 4XO6A 3PWGA 1DXIA 4HZ6A 3VX1A 2AMGA 4CD6A 2J79A 3MKCA 4D6FA 3VPLA 1XCFA 4LUJA 6XIMA 1S7MA 1R9ZA 3DKLA 5C54A 3NQEA 1GPFA 2WQPA 2ZUSA 1J2WA 4PRRA 1KM5A 4FSAA 5TAOA 1YTKA 1CLXA 3MBFA 3LENA 1TZ9A 1TX0A 1DWHM 5AC6A 2PGRA 4A3HA 3EYPA 2CIPA 5FS6A 2W3RA 4MNLA 1HNYA 4JTCA 2FHCA 3ARQA 1SFJA 4YTRA 1BZLA 5EFDA 4MG4A 2YQUA 4TMBA 3EPMA 1TV8A 4NASA 4HSOA 3VYLA 2RH9A 1GOQA 1DTUA 1I45A 4CQDA 7A3HA 3PB0A 3GTIA 5DXYA 3MCMA 1VFFA 3R4IA 4N6FA 1AJ0A 1FOBA 5FL0A 3ZT7A 1GVQA 3AZSA 4QRNA 3RFAA 4B9ZA 1Q6LA 1J11A 1Z48A 3W23A 1C9DA 4Y9MA 5CZJA 4EMIA 1O68A 5CGQA 4YXGA 1VPXA 3THCA 4GI8A 1VRXA 3M41A 3GU2A 3VD4A 3UT0A 3VKBA 1N63C 2PCQA 4LAZA 1HGWA 2NVKX 4RL3A 2P0OA 4AIEA 1XIGA 4GIAA 3MCOA 5AYYA 3O9NA 4KRZA 2EQ9A 3RU6A 2DZUA 4K3ZA 3UWEA 3EA1A 1B5TA 4DNHA 3TQKA 2YZRA 2Z1SA 2VEGA 1YW1A 3NL5A 4Y2WA 3HPXA 1EA9C 4MNJA 3R8GA 1JDDA 2NQZA 2ZX5A 3VNMA 3AZRA 2PDCA 2ZX7A 4S39A 3W7OA 3P84A 2JEPA 4IL2A 3Q58A 2VDHA 5EMYA 1O5XA 1QUMA 2J9ZA 3B0XA 2W63A 3DBPA 4HPJA 5HPCA 3DJJA 5D09A 2FKPA 3NGJA 4L9XA 1FRBA 5EGRA 2IW0A 5CC3A 5HQLA 3W73A 4HB7A 2RDTA 5C7VA 4NL1A 1E0XA 3H21A 3T0TA 1LYXA 1EXBA 4A3UA 2QLYA 1ISZA 3GFYA 3UNDA 2QCDA 2CC0A 4N02A 3LOTA 4LUTA 5HMFA 2ZX8A 1KD0A 5CJ5A 3KS6A 1BYBA 4GUFA 4E2BA 3EMCA 3MANA 1XLMA 1BD0A 4FNQA 4R88A 4U2ZA 3JVAA 3KL5A 3FAXA 4RE2A 4IMCA 3S8HA 2GJXB 1TG7A 3WN6A 5A2CA 4WY0A 1DE5A 2ZCGA 2WJZA 2GVYA 4Q8TA 3L12A 5AHNA 2AL2A 1IT0A 3UXIA 3UZXA 1QO2A 1G94A 4PMJA 2TODA 3E6EA 3NQ8A 3GXPA 1BTMA 4NYYA 3LM3A 3SDOA 1XGEA 4NX5A 1XIDA 3ANUA 1KGWA 2PDBA 4FAMA 3PUGA 2A21A 5GVJA 4A3RA 4GJIA 2WKJA 1CXKA 1A50A 1GEHA 4D8ZA 5F2GA 3QFWA 3GVWA 2QMKA 2DJXA 5C6MA 1ISVA 4UMAA 3V7PA 1FHLA 1E6PA 1DHPA 1TWDA 3W6YA 4FF7A 4WZHA 2Z00A 1TPWA 1OFDA 4K8DA 3CBWA 2UY4A 3PZOA 2XM2A 1XC4A 2CXEA 1R3SA 2J7BA 2J7EA 1EX1A 1XYZA 3SUSA 1RK5A 5CSYA 1YKWA 1JXKA 3CO8A 3ZT6A 5M5DA 1VRDA 1TVLA 3GQYA 2GGJA 5CPOA 3HGRA 4S1FA 1AL8A 3TCEA 1H09A 1PCWA 4HVXA 1HZYA 2CYGA 3EWZA 4O15A 1L2UA 5KZDA 4QGCA 3VE7A 4MZ8A 1JXJA 3BAWA 4NAFA 2YVJA 3TTQA 1M65A 3OHMB 2ALRA 2ZC1A 4IPIA 4LRTA 1CZ1A 1OG6A 2D2HA 1RXOB 1HN1A 3FXGA 4G9PA 4GX8A 5A8QA 5G2IA 3TN3A 3UZWA 3VFLA 1L6GA 2HPMA 2J66A 1Z32X 2BC0A 4KKXA 3G1FA 3H53A 1O94A 3WLKX 1UKPA 2DZSA 3BLIA 4PSRA 5KZEA 1KN0A 1UYQA 2EJ1A 4IUGA 1VLWA 5HA7A 1HO4A 2ZKMX 4B91A 4INFA 3V5OA 3C5QA 4O0QA 3UWWA 1WBJA 4LUIA 3VILA 1X98A 3MZNA 4AWSA 4HNTA 4H19A 2W62A 3I10A 4MSSA 2ZUNA 1H0GA 2E67A 4LCRA 2X40A 2X42A 1S1RA 3GR8A 3LCGA 3KRSA 1VFHA 3CB3A 4OVXA 5E0FA 2QXWA 3ABRA 4GIYA 2W92A 4LW7A 3ZOAA 3LLXA 3SN1A 2DW6A 4R33A 4FOUA 2BOFX 2VD8A 3QR3A 4WLCA 1LL6A 2C3CA 3TH6A 3A7UA 3HURA 4G5DA 3F4DA 4C6IA 3S9ZA 4M56A 3N29A 3BJSA 3SGGA 3AIBA 4JTQA 3TAKA 5LIXX 4GYJA 3WLQA 2FGZA 4PFMA 3C6CA 4TO8A 4M80A 3PBGA 3ITYA 1H5VA 3OVPA 4U3AA 3UR8A 2VUYA 1MQRA 3TROA 3KZPA 4H8VA 1BVNP 1YIXA 4P7QA 1SJAA 3Q65A 5J04A 3IC9A 3ELFA 3LRLA 2FDMA 1N62C 3W2NA 2QZRA 4PGLA 1J8VA 4XZWA 1V0NA 3Q94A 1QNQA 4G1NA 5TF0A 3PJTA 1Q6DA 3E0FA 1FWEC 1D3GA 1WV2A 2YCIX 3VIHA 1G7VA 4C7GA 2NXHA 3SJ3A 4CGTA 4D1JA 4DWSB 4ZL1A 1V6UA 5HATA 1JCTA 2HVOA 1E0TA 2YVGA 3VOFA 3V0TA 1MXDA 1FH8A 1XCWA 3GVQA 3IARA 1U5JA 1LRNA 4CN1A 3BAXA 1H1NA 4N4PA 2GPTA 2FPTA 5CSSA 4DJEC 4LC8A 4M6VA 3VGDA 1W5OA 2W54A 2WHJA 3G8EA 2F5ZA 4HMCA 4ICNA 2CCRA 3KP0A 3W24A 2WHKA 3PFMA 4XO7A 4QNEA 4H50A 2RHGA 5I79A 4G8TA 3OVGA 4REQB 4LCQA 1BWLA 2PWVA 3CJPA 4AC1X 2BG5A 4BI7A 3C2OA 2C16A 4KW2A 1DIOA 3BC9A 4Q8NA 2CNCA 3R10A 4H9ZA 5LXEA 2E6YA 1W6TA 1KCZA 3B8DA 5D04C 2E4TA 1PAMA 1HVXA 2BWGA 4OIFA 3L5MA 1EQCA 1THFD 3WH9A 2D2JA 1ZJIA 3BH4A 3W82A 4GH3A 2SFPA 1A5CA 3DK8A 3G1HA 3HG2A 2DUXA 3PVFA 4CUCA 1X1NA 3T40A 4RZ5A 4YCOA 1EIXA 4HOZA 3B04A 2GDQA 1LT7A 2FZBA 1TPC1 4ZGYA 1OVDA 3TW6A 3S0CA 3M0IA 4UNLA 1P1XA 1KO0A 3NRZB 4Y9AA 3QR0A 3U6WA 2O7QA 3LADA 4QJ4B 2ADAA 3NO1A 4DBSA 3AS2A 4N2YA 4AZBA 4JKMA 1DPMA 1DOSA 1SJCA 4R3UA 4FOKA 3RK8A 4BA0A 3N4EA 4PUJA 3PHAA 2QCDB 3CZLA 3QPYA 2I1OA 4YVPA 1TCMA 3S2LA 5DMMA 5F2IA 3UGRA 3VUSA 3F2CA 3KW3A 2ZADA 1ESWA 3NCOA 1YLVA 1PJ9A 2IPJA 2PDIA 2EG8A 4JY8A 3VVGA 5LA1A 5MKGB 1XHCA 4UIOA 2JIWA 4RXFA 3PS7A 3BAIA 1TMHA 2VEMA 3VZZA 3A4XA 2QJHA 2CZEA 1ISXA 3CNYA 3ZJ7A 4HQVA 4DWSC 4AVNA 3NQ2A 2ZRUA 1U1UA 1KM1A 3SB0A 4K37A 3CGDA 5AC4A 1QNRA 1V0LA 5K4XA 1XFBA 3WH6A 4DNMA 4BQ3A 3IIZA 2DZPA 2H90A 3W0KA 1V3MA 4HMNA 2V2DA 3DFYA 4QSFA 4H6EA 1L6YA 3R6IA 7ENLA 3CS2A 4B15A 4JTUA 2DIJA 4LVGA 2TSYA 3TK7A 2I57A 4OECA 4AZCB 1T96A 1J0YA 1HT6A 4LALA 5H2ZA 4K8HA 5A8OA 1TTIA 4JGDA 3CIWA 3OLEA 1X39A 1ELSA 1OFAA 2D0FA 3PAOA 2ZXAA 1UBPC 3DFNA 5E93A 3LK6A 4TOQA 1F73A 3W72A 3UR7A 4AW7A 3Q37A 5KZMA 2CPUA 1GYNA 4IPLA 4GD0A 1TFVA 1CXLA 1UB3A 3IUIA 5FJTA 3NPUA 3E5BA 4APNA 3LU2A 3SSZA 4GIEA 1OX5A 1AH0A 4O1FA 3TTYA 3UG3A 1A5KC 4NJKA 4CEXC 4ORIA 4W88A 2VYOA 4UMCA 3SR6B 3APTA 1R7OA 3UFYA 3P74A 1UKTA 3FKRA 3BW2A 1NFPA 2PF8A 3QFEA 3HIJA 1SO4A 2QV5A 2HBXA 1KBIA 5A6KA 1UIPA 1WYIA 3KOYA 3MW7A 4UZSA 1ADSA 1OGBA 3AIVA 3L4XA 3VKJA 1KFJA 4WDXA 3WMLA 4C6MA 3A5FA 4DO5A 1QOXA 5CG0A 2YLLA 1G4TA 4M19A 3DN5A 4B16A 4Z2GA 3F2DA 3UP8A 4PB5A 2JKPA 2PWGA 3GX9A 3R8RA 1TTQA 4GZEA 1R9YA 1JCYA 2VEIA 4IP7A 1SFSA 4CEUC 2PGWA 1M6IA 3T07A 4EANA 2CHOA 4AEOA 1NARA 4Q4OA 4U33A 2X8HA 5HR7A 5CSRA 2KAUC 1FX6A 1YRRA 4O28A 1FEBA 1VH7A 1FHVA 1ME9A 3FOKA 1RD5A 4FLQA 4RW3A 1D7KA 1FCQA 4TR9A 3F4NA 4UFJA 1E15A 3CWNA 2PODA 2O9PA 3I68A 4DPPA 2JKEA 1SW0A 4N9EA 1WO2A 1Z8AA 1C93A 1CW2A 4F66A 5FSDC 1RVKA 1W56A 4AB4A 1J79A 3PJUA 4NY2A 2VC6A 4PMQA 5GPRA 4PEEA 3W29A 1RJPA 1EUAA 2CLFA 1VQZA 2Y8KA 4J3SA 1YDOA 3BJFA 3CQ0A 1L0PA 1JGMA 2PGFA 2ZUWA 3W7CA 3WMBA 3SCWA 1KRBC 3GD4A 3PY2A 3GHUA 3SJNA 1NAL1 1Q4WA 3RITA 5I77A 1FH9A 4YU1A 3TNBA 1WBHA 4RKAA 1E1CA 2JF7A 4NI3A 1UG6A 3REQA 5HNRA 5RUBA 1ONFA 3LSCA 3CM4A 1Q6EA 1WDRA 2B4GA 4YCPA 1SMDA 2DW7A 4WEVX 3A24A 3LCFA 3P8JA 5DBTA 4JFVA 2WVUA 3DIPA 1W1YA 2Z6JA 3UD6A 1RLDA 3QY7A 3WUEA 3AS3A 3SADA 3R0DA 2V5DA 4XAPA 3VCNA 3SRFA 4O19A 4GY1A 4UTJA 4PN2A 2E3TA 4GC4A 2YCKX 4E4FA 3VINA 4ADUA 3OBAA 1GG1A 3OGVA 2IKJA 5D30A 1XRFA 3C0JA 3IRDA 4LYPA 4HZ8A 4HJFA 1JPHA 1U5VA 3R25A 1IWBA 3EDKA 4F9DA 1KFKA 3A3XA 1CGWA 3F7JA 2ZUUA 3WLPA 1DJNA 1L9WA 3DGBA 1GRBA 3WL1A 3NM3A 3ID7A 4AF0B 2FYMA 2A2IA 2ASHA 5DRCA 1XISA 1K8YA 2HNHA 2BHUA 3CU2A 4NZ5A 3DECA 1PDYA 3E2SA 1V6VA 5FEPA 2XH2A 1QATA 4TVWA 2GGEA 1NDZA 1P0DA 2GZXA 1A3HA 4HNOA 3PG6A 1HKJA 3VNLA 1E4NA 2YCEA 4JX4A 1UR0A 1JI1A 1VJIA 4L56A 4LGXA 1GQKA 3MSGA 1LTDA 2WW5A 1I1WA 2F2KA 4HTYA 4Q8MA 4NSBA 2VT0A 1DXEA 5FEXA 2Z0IA 2WC7A 3HG3A 3O63A 1MDRA 4AY7A 2OOFA 2XIBA 3O06A 5E9XA 2Y7EA 3KTCA 1CXFA 3N2BA 1T5AA 2Z2UA 3RPMA 1UH2A 2RAGA 3TR9A 4F2UA 3L7RA 4QSHA 1DJXA 1XYLA 1GEQA 4AUBA 2I9UA 2QS8A 4IUOA 5E0KA 3QTGA 1FHDA 1IHIA 1ADDA 3CB8A 1OSEA 3KHJA 2J7GA 2HE5A 3HMCA 4I7WA 4LYRA 4QEHA 1BWVA 1EWDA 3CV7A 4BFAA 2C1GA 2NT0A 1YNQA 1Q6CA 3QF0A 3NVZB 4GBUA 5GNYA 3W9ZA 3W6LA 3FSTA 1NHSA 1DYSA 3EUB3 4JTHA 4GXPA 4ZZ9A 3TONA 1E0VA 3AS1A 3OQEA 4GIRA 2HZGA 3VABA 4JL2A 3QN3A 2XUCA 1HTIA 5I3DA 3IVTA 1GVFA 1JF5A 2VFGA 1NOUA 2WSRA 2OOGA 1KW1A 3HQ1A 2PP0A 4UR7A 4H00A 1U22A 2OYLA 4A2RA 2J47A 3QMTA 4QJ5B 2Z27A 1V0KA 3WLOA 1KWGA 3FG2P 4HPXA 2VUNA 1M04A 3TZNA 4JKLA 3MUCA 3APYA 3HRDC 2PDUA 1XIHA 3AYTA 4M29A 3JZEA 6ENLA 3WQEA 4PH6A 4GJ1A 3UJ2A 5I02A 3UZYA 1BFNA 4PE8A 1OC7A 1R3WA 4Y7EA 1QK2A 4MWAD 3U5YA 4C6BA 4WKFA 5D05A 4HOXA 4QG6A 2BHYA 4IMEA 1CENA 4E8DA 1X6NA 4Z2IA 3THUA 1S5WA 2GJXA 2QPXA 3ERPA 4AXKA 3M5VA 3A3HA 3SCUA 3THAA 1C8YA 2CLMA 1PYFA 3KLKA 2EKGA 4N0RA 4MVAA 1UH4A 3BPWA 4MOZA 1ZK7A 4EAYA 1W5MA 3VD3A 2A79A 1PWMA 4UQBA 1EEPA 2FTYA 3VTRA 5U25A 4H41A 4JIHA 1W5QA 4AC7C 3L66A 3PFRA 1X1ZA 1OX4A 2DSUA 3ATYA 4L6DA 2J9YA 3PG9A 1JUEA 1UPPA 5HR6A 1GHRA 1TPFA 5JCNA 3OA5A 3FJLA 4IX2A 4POCA 2E0PA 5A6BD 1OC5A 1N2VA 2XISA 4JIPA 3GNOA 3IEBA 2DP3A 1PO9A 1U2YA 4O50A 2Q3OA 4LWWA 5FKYA 4BY3A 4UWMA 1FWSA 4O1DA 2OWWA 3ARZA 3L65A 4IGSA 3BZJA 2C1HA 4ZFMA 3U9IA 1J5TA 4A05A 2D0HA 8XIMA 3WENA 3BW4A 1WXZA 1AW5A 4DB7A 1X6LA 2G4FA 3B0PA 1TR1A 3N19B 1F5ZA 3URNA 2WBKA 5BOFA 1W31A 4EXQA 4F4RA 2WAGA 1C92A 3GYEA 2Q8XA 4QDWA 4FX6M 3P0XA 3UWYA 1TWZA 1ODUA 2OMAA 4H4UA 3R13A 1XQKA 3H2OA 4A3YA 1TWSA 2IS7A 1XGZA 3A23A 2BY0A 2YL9A 5BROA 3O6DA 3M07A 4G56A 3C86A 1IIGA 3APGA 2CERA 3BSMA 2CLPA 5G4WA 1GRTA 1H63A 1QI3A 2V30A 4W7VA 3OC4A 4NQ1A 3T2OA 7REQA 1H7NA 2GR3A 3AHXA 4GKTA 4JTRA 1NWSA 3DXIA 4JTFA 1Q6GA 3M7WA 1AL7A 1E4MM 2QCCA 1GUVA 3AALA 3FA5A 1YEYA 1HKWA 3V0UA 8TIMA 4JTIA 3ISIX 3B97A 3PJWA 4GY7A 4DEFA 3QY6A 2YSWA 1OIMA 1Q6FA 1W17A 4EPEC 4AYSA 2GQAA 3CGEA 1RY8A 2D20A 3GK0A 2NUYA 1OFEA 1ITQA 4LVBA 4Y96A 4DX3A 1E55A 1X7IA 4RJEA 2D22A 5AY7A 2BBFA 5HAOA 2VD9A 1FCBA 5ECVA 4P8UA 4S3JA 1LLOA 1VAHA 4D72A 2V69A 1EZ2A 1YYAA 1VPYA 4U5IA 1UH3A 3V1HA 2ISWA 2EF9A 8CGTA 3GR4A 3E49A 4H4SA 3EB4A 4UQEA 4IQJA 2B81A 4DYKA 4NG3A 3CAWA 1FO4A 4O8RA 2JBMA 2ON3A 3BOLA 3I4EA 2VX5A 3WDQA 3WD4A 3LQGA 5K7JA 3S1UA 2ZE3A 3W74A 3LCXA 2WVVA 1MFVA 3E02A 3TDFA 3W7PA 4LVFA 4MFDA 1D7YA 5I7GA 1QI2A 3EEZA 1PZ0A 3CHEA 3MJYA 3N4AA 1PHQA 3UVAA 2X1IA 4KCTA 2WCSA 4EPBC 2GH5A 3MJMA 5HMEA 1XKJA 5EBUA 1Q5MA 4CD5A 1L6FA 1Q6RA 4H1ZA 4PTXA 4KEZA 1Q1RA 1F2JA 2A7RA 1DJWA 1E56A 1DBTA 1ZNNA 3LV5A 1EQPA 4YWSA 3RLGA 3NXLA 4H7CA 4JTKA 2O9RA 1PKYA 1X8FA 1PHWA 3K1DA 3SY8A 2ALDA 1TIWA 3NG3A 4DQWA 3FNDA 4H4XA 3P6LA 3S5OA 1ZALA 3CYVA 1X6UA 3VIJA 4FZIA 4GUHA 3CMJA 5D2WA 5JCIA 5TIMA 1K9TA 3EWDA 2C8NA 1A4MA 4XUGA 3BICA 2VQTA 1TPH1 7TIMA 2ANUA 2ZRYA 1XGDA 4JYDA 4KWUA 2FGLA 1XLIA 2OKTA 3WEMA 5FJOA 1LPFA 1SR0A 1ZLPA 3SCQA 3ZLHA 5F4SA 3TSMA 1UWRA 2ISSA 3W1QA 4LH8A 1O7AA 5H8UA 3KLLA 2BXZA 1RQHA 4L4MA 3GD6A 4PCTA 4QXIA 4WDTA 3C0SA 4JS3A 5G5IA 5F2MA 3TNOA 5EL1A 1HGYA 2NXIA 4UTLA 1KV8A 1US0A 3UWVA 2PDNA 1P6CA 2HXUA 3KRUA 2Z29A 4KIRA 4JZ5A 1ME8A 2DDXA 4EPKA 2F2HA 2HVMA 1Y5WA 3E74A 3LI0A 5A6SA 1LWIA 2FFCA 1D3HA 3C52A 3TKFA 1V3IA 4UFLA 1WCGA 3TQVA 4CD4A 4YTQA 3AYVA 3BCDA 1BTCA 2UY2A 1FY6A 2C19A 2JGQA 1TJRA 1PYMA 4K8EA 5DMLA 3RM9A 1Z7AA 9CGTA 4ECLA 5I3HA 1VD6A 4OE7A 3M5YA 3OYZA 2TYSA 4A21A 4DF1A 1LORA 2V8ZA 2EPHA 4XZLX 3M5XA 1HKIA 4GXWA 2QKFA 3UPMA 3LZ3A 4R53A 5DX7A 4LT9A 1OEPA 2F38A 4AD3A 4NZ3A 4WSJA 2V5KA 4ZE4A 4E4PA 3W81A 4FF5A 2FPVA 1FDYA 3FA3A 3Q6JA 4GMEA 4S3GA 1UQYA 3U4FA 4N7QA 1KV5A 2Y5JA 5G1YA 2QUUA 5LNVA 3UWZA 1Q13A 4I7UA 4E6MA 4HA3A 3NQ6A 3USZA 4CQ8A 4NNCA 2OQYA 1RLCL 2ZQ0A 2EQ8A 3M0KA 1UROA 1VBHA 2QCHA 2VZSA 2ACSA 3ZQ9A 3SY1A 2XPKA 3ONCA 1W3JA 2Z7KA 3RNDA 3L5AA 4AMAA 3QOKA 1P7TA 3UXKA 3QYQA 4IISA 3BTNA 2J7FA 2QCGA 1ZTVA 1KWKA 2QCFA 4CN6A 2YA1A 1KXVA 3PUEA 4PRTA 2EQ6A 1G4PA 1DJZA 2GJPA 1DJGA 3M4HA 4LF1A 1EZWA 1Y65A 1LLZA 4HPHA 2PTXA 4CVWA 3N12A 4X2PA 3M0XA 1A0DA 3LTSA 4IG2B 4FNRA 3RG6A 2NT1A 4FHAA 1A5OC 4AZ7A 4AX7A 3GC5A 3UNTA 2ZOXA 1H3GA 5TD4A 1GW9A 5GNXA 3WLHA 2BHZA 3AXHA 3SO7A 3NEHA 2ZX9A 1S39A 4PUUA 1Q1WA 4GC3A 2WMFA 3SIMA 4UTIA 1TYGA 3TN6A 3C0LA 4V1YA 3SCNA 3B0YA 2PDXA 3WKZA 4JIQA 3CPRA 4QHRA 1WKDA 2OXNA 1IEXA 3EANA 1FEAA 1HKKA 2WOWA 3VFCA 3G1DA 5CPLA 2VGGA 2JALA 2A3BA 4YYCA 8A3HA 4EX4A 1YDYA 2A5HA 5HINA 1QTWA 1ITCA 1XG3A 3DC8A 1FCUA 4DJED 1K77A 4RNHA 4TTGA 4X22A 1V3KA 4C6QA 4WJXA 1FA2A 2E6FA 2QUTA 3M0VA 5C9XA 1HKVA 1XIBA 3C8FA 1E9YB 4UTTC 3QC3A 2XSXA 3P14A 3T6CA 3GUGA 4Z42C 3R07C 2VCAA 3QHNA 3ARXA 1W3HA 4YL2A 2OLAA 4X63A 1NDVA 1OADA 3LA4A 1FWDC 4ZOEA 2QUMA 1POJA 2CETA 4BEUA 4J3WA 4YNGA 5LXXA 1YTEA 1PX4A 2WQDA 3GD3A 3PC0A 3VI2A 3S83A 3WK0A 2PBGA 3LYEA 3CAKA 2V68A 4RDVA 3OHIA 2F9RA 5G2WA 2Z7GA 4XVEA 2X41A 4UQAA 3EOLA 1JROA 4DUXA 4ONVA 1C7SA 4Q7IA 3SSJA 4UCFA 1KBBA 1B30A 1A49A 4GO9A 2HNEA 4JTJA 3T09A 3UYCA 1XLDA 3W38A 5J5RA 3CUZA 1W1VA 3CQIA 3G5EA 2NQ9A 3WMCA 3S1WA 4HCLA 1AJZA 1UJPA 2G37A 4WSKA 2PDWA 1K03A 3GXNA 5U4NA 3TQPA 3WEZA 3QVQA 5I5RA 3LNPA 3FVMA 1EWEA 3M0YA 1W8SA 3GKFA 1T0OA 3FAWA 1A0CA 2Y70A 2HQAA 2X8RA 1F05A 4Y9PA 1YXCA 4E0CA 1VEPA 4H4VA 4JDRA 2YVFA 1HL2A 4RDZA 2RDXA 2WVVB 3WJSA 4F3HA 5H91A 4W8AA 2J9XA 4K8GA 5A6LA 4GVFA 3ABQA 3ITGA 1GOKA 1T40A 1RP9A 1JAEA 4X9YA 3VK5A 3SRKA 3VM5A 4ZVJA 2WSQA 4I8YA 4XV0A 3ZVIA 4EQRA 3VCRA 2CWNA 3BQ5A 4IWWA 2OGYA 4JTAA 4S3DA 4JL1A 4W89A 4IIHA 4RK8A 5E6YA 4J4KA 2QUNA 4BQ4A 4MB4A 2L5HA 3TYAA 4LNYA 3NQ7A 3NAVA 1R3QA 4A8NA 2EPOA 1BGAA 4O12A 2AAQA 2YA0A 2ZRWA 3W7HA 1GKPA 1D9EA 5AHMA 5HNTA 3AYSA 1JPIA 4LS2A 1E3ZA 3RNMA 4WR3A 3VDBA 3I7QA 3ORWA 3PTQA 1AD4A 1JDAA 3H2MA 2GVEA 1VFUA 2X2GA 2QYGA 2ZE0A 2OELA 5FL1A 5FS8A 3WBAA 3W2MA 1YBQB 1S3HA 2NSXA 4IFOA 3W1AA 3OPSA 2QT3A 3VNIA 3GY1A 2NQHA 3ZIZA 1P5BA 3BG3A 3GNXA 4OHQA 4AHOA 1UZHA 3ZXWA 5F2LA 1HJWA 1T8XA 3N9SA 1TCDA 1EJSC 3NURA 1PKMA 1A5AA 3KOZA 3O6AA 3DHFA 1GOXA 1J0IA 1V08A 4NF7A 3CO4A 3LB0A 3DX5A 3OW1A 5FEWA 1AQFA 3UZZA 3NXFA 4RV3A 4F79A 1I2QA 2HROA 3B4UA 4LC6A 4HN8A 4O0ZA 2VURA 1NPXA 3GWQA 2ODOA 4B5TA 1V3JA 3P61A 3S5NA 3EX3A 4LPCA 1LWJA 3FHQA 4IMFA 3XINA 3HGJA 3GRSA 4LSBA 1ZXIC 2RDWA 3TWBA 4NUWA 1B3OA 3W7MA 3CK5A 3L4UA 4H04A 2I5GA 1EDQA 3PAJA 1NWRA 1DJYA 3W2JA 4XD5A 4IMDA 2BY3A 1PIFA 1K9EA 1XRSA 4H7ZA 4LB4A 4DXVA 4QCEA 4ZE5A 1K7XA 4I5XA 4OU1A 1ML1A 4UR8A 3MMUA 2Y88A 1WXJA 5DLCA 1FFUC 3URQA 2GQ3A 3FV9A 2P0IA 3UZJA 3OBKA 3ANVA 2CEQA 2WZEA 4U31A 3UCCA 1BWKA 1JFXA 4XSLA 3LXBA 2FIQA 3AXXA 4XISA 2E1DA 3U5UA 4QROA 2WMIA 3AXIA 5CC7A 1FDZA 3NO3A 2X05A 1KQZA 4H6KA 1XINA 1UKSA 5EFFA 3IJDA 4AEFA 4IF2A 1JZ8A 3CGTA 5T8GA 3CGBA 4RPQA 1EJXC 4HCDA 2PWDA 2WOIA 1WQ5A 3RCNA 3AAMA 5D9NA 1LF1A 2ACQA 4H9UA 3G1SA 3H7RA 4NI8A 2PZ0A 4MAVA 1HL9A 5CBJA 2A1YA 3WQPA 4IGNA 4V27A 5D9PA 4DBUA 1SZEA 5I3GA 1EC8A 3NZGA 3K8LA 2ESCA 1YDVA 4LS1A 3B0VC 1OFBA 2P1FA 3DERA 5MHBA 1DQWA 3ITLA 1ISYA 9XIAA 4EACA 5AVHA 4AD2A 4XZHA 1AH4A 1JYNA 4P5UA 4QS6A 2Q6ZA 3M0LA 2CBIA 1GKQA 3PNZA 2PTZA 2XG9A 3VC5A 1R46A 3CYJA 2HISA 4UTWA 5FF4A 4CQAA 4ZA0A 4ACYA 4DJFD 3WDPP 1Q63A 5H1WA 5I6SA 3ES8A 4O54A 3EWBX 2Z28A 1O4UA 2IPFA 1SO5A 3PN8A 2V3GA 1FWAC 4GRSA 4KRUA 1EGZA 1N60C 2XIOA 4KPLA 3ARTA 4P61A 4Z2KA 3CHCA 4GQBA 3LV6A 1F3EA 3A47A 5G2HA 3R94A 3DEQA 1W9VA 3WQGA 1DNCA 1PB0A 1YBQA 2I5QA 5AYXA 4NT0A 4DN1A 2A85A 1GV4A 3GIPA 4FMVA 3NTYA 2CBJA 1JOAA 4PULA 1UWQA 3QRHA 3DHDA 1AK5A 5A8MA 2QJMA 5CC5A 5BXTA 2GUUA 4ACZA 1E4IA 2PWFA 5BWAA 4W5UA 3M64A 1H11A 3A7AA 3AM9A 1OB0A 4R9OA 5AC5A 3RILA 3M7SA 5HQEA 5I00A 1P0KA 4C6OA 3AMCA 1H6VA 4GNVA 1N5XA 4PRWA 5C2GA 4E4UA 5DANA 3NFUA 4GABA 4MY8A 1XP3A 2E6DA 3VNYA 4A4AA 3FYPA 5CGMA 3QSRA 4CNPA 1PVNA 4M24A 1L8NA 3FN9A 4L9ZA 4U28A 3ZJ8A 4DM1A 1DIKA 4UOJA 2PU1A 1B4KA 2GK1A 5REQB 3WNMA 5LIKX 4DRSA 2CBVA 4IIEA 1AA1B 1TZ7A 4C6JA 1QFEA 4DELA 4C1KA 6TIMA 3B8IA 3A13A 3LHZA 3MP4A 3PPCA 1GEUA 3GNDA 2P3ZA 1LUCA 1QPKA 4PB4A 5D9OA 4B5SA 1SB3B 4TVUA 4GI4A 1KRAC 3D9XA 3BG5A 3A4WA 3BW3A 3R58A 5C5YA 3MI3A 5MF5A 1CGXA 2XYLA 3VZYA 4LEFA 4KQNA 5MKGA 2E77A 1SYTA 3B8SA 4KH2A 2IQ0A 3PG8A 1NJJA 2AQVA 3SBFA 3MP5A 3NPXA 3D3FA 1KFEA 2DQXA 4H9XA 3W1PA 1DP0A 3VD5A 1ZCOA 3QYSA 5KVHA 3HF3A 3DFHA 4K38A 2OTDA 3W86A 1WDPA 3TMLA 3A4JA 4ORMA 2ZZBA 4I8DA 4GNKB 1NU5A 4I9AA 2WMGA 1HP4A 4WOZA 4DLFA 4F0MA 3W01A 1UKOA 4I3GA 3LSBA 3LLDA 3R79A 4XG1A 1AH3A 1K6WA 3D47A 3WQ5A 1OGGA 3NZ1A 4C6KA 3A22A 4MPQA 1A5UA 4NJJA 4FI4A 1KNWA 1W3KA 1I2NA 4FNUA 4GYFA 2PD9A 4PL1A 3VOGA 1NF7A 2X8GA 1VKFA 2VZVA 1PCKA 3R43A 1PTGA 3SRHA 3HV8A 3WLTA 1C8VA 3SQSA 3QXBA 3DI0A 2QDEA 4IXHA 3GH5A 4B2DA 5CZ0A 4NHVA 4Y9OA 1GJUA 3GM8A 3LBOA 2R9RA 3GH4A 4UMBA 3BGGA 1QCWA 3MV01 5CCZA 3BSGA 4MB3A 3AIWA 4LAKA 4UFKA 1TVPA 2E5BA 3SY5A 3WK1A 2DJLA 4GOAA 3P93A 1AODA 2FVKA 3INPA 4GH1A 4ZB2A 3TN5A 1M01A 2I9EA 1XM3A 1OYAA 4FXJA 5JVLA 3BURA 4HU4A 4OV9A 1CGUA 1TQJA 4NU7A 4AWTA 4IMAA 4Z2HA 3GKAA 2IKGA 3NL6A 3QZAA 2ISVA 4M3PA 3R2GA 4HMDA 5I09A 4E2OA 4PMOA 3BLOA 2WP6A 2RKXA 3G1YA 4IG2A 1CBGA 3MYOA 3B9NA 2R8WA 4PUMA 5TNVA 4B90A 4ES4A 4WX2A 2W3SA 3HGSA 1WB0A 2HRWA 4B3KA 1XICA 1XIEA 1FECA 2FTPA 1DKWA 2VX7A 5GRTA 2H3BA 3BUVA 1EF2A 3SZ8A 1KCLA 1EFZA 3LZ5A 1X1OA 3TN4A 3UXLA 1ZGDA 1RZMA 3S5SA 2YFOA 1OJXA 4NJIA 4E2DA 4H8HA 2X50A 1XIJA 3LPGA 3THDA 1IYXA 1I2PA 3L0KA 4O4VA 3GAKA 1DIEA 1KRCC 4JFUA 5LA2A 1Q7QA 3E1F1 1BQGA 4D6GA 4DYEA 2PDHA 1J93A 2WJEA 3Q2DA 1XLEA 3PZMA 2PZNA 3NGFA 3CLWA 4YHEA 5ENLA 3CAVA 4ZXOA 3LBMA 4YN5A 2A7PA 1M68A 1DWIM 2LLEA 5DO8A 4LY4A 2GFTA 3G0SA 3BAJA 2PUZA 3EZ4A 3ALGA 2XH7A 3THQA 2VC9A 1WA3A 3B9JB 2VFFA 3LRMA 3RF9A 2EAWA 1G4SA 2YL8A 2IKIA 4JTGA 5IFPA 2INZA 1LBLA 3C3NA 1REQB 2VEFA 2V3EA 1XLGA 1STZA 1E4LA 4DNAA 1R2RA 1AVAA 4QG8A 1EJRC 3VIKA 3GC4A 1GESA 1JRCA 1QI4A 2HCVA 1I9CB 1BF2A 4MB5A 5CLWA 4AWUA 4GI6A 4L1WA 1Q7MA 3E3HA 2O4MA 5K9CA 3QW3A 3N1AA 3QGVA 1RH9A 4RZBA 3CASA 2CWXA 3DYOA 2CDUA 1GQIA 1FWRA 2GL5A 1ECEA 2OX4A 4HYRA 1TVNA 1JYVA 3PR2A 2PLCA 3EXTA 1GPWA 2GJNA 3KUMA 5DT7A 3K8KA 4NAFB 2NWSA 1T41A 3QQWA 3NDOA 3LPOA 2WSKA 3K4DA 1AJ2A 2X2YA 3STEA 2BGSA 4HOWA 3I6EA 3L2MA 3V4BA 1A3XA 3AJ7A 3IVUA 5I78A 1LOLA 4JFWA 1SU5A 3U2EA 1R85A 2C6QA 4MZ1A 4QTGA 3QY8A 3H4GA 3MP3A 4AWEA 3ABOA 3C3UA 5BXSA 2GYIA 1GZJA 4O10A 3GDMA 1KXTA 3ZSSA 3N18A 4EWJA 1ZY9A 3CMFA 3VGFA 5JH2A 3Q45A 3WF2A 1H7RA 4LVAA 1F3WA 4HK7A 4F0HA 1DQXA 2CFYA 1JUBA 4HCHA 3KCJA 4FEZA 4WJ8A 4P8WA 5T91A 5I3JA 4LA1A 3DDMA 3GVVA 4ZB5A 3HJZA 2BTMA 4EXBA 5D02A 2DUAA 5K3VA 4HK5A 2B7NA 3EX6A 4PL2A 3DK9A 4GFSA 3OYXA 3GVGA 1XDJA 4OOZA 1E6QM 1H1ZA 5AYZA 3EDJA 5BMXA 1IEWA 2BB0A 3AMGA 1J18A 5G1TA 5AVNA 1S2UA 1Z69A 4KFOA 4GYPA 4CVUA 1FH7A 2D24A 5M1TA 2PDMA 2XGZA 2ATMA 3M0MA 3RUBL 1X96A 2W55A 2PTDA 4NP7A 3QQ0A 3VM7A 4K39A 1K8ZA 1W1B1 1XUZA 1Q45A 1LVLA 4W5ZA 4GJJA 1KLZA 2ZC8A 1BEUA 1B0IA 5CQ1A 4MAZA 1XLAA 1NH6A 3ANYA 2R6OA 1BG4A 4MADA 3UZ5A 1V0MA 2OSXA 1E43A 3DFSA 1LBFA 4MWAE 4PMZA 1GWJA 2QCEA