3RR1A

Crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
384
structure length
372
Chain Sequence
MVKITRLTTYRLPPRWMFLKVETDEGVTGWGEPVIEGRARTVEAAVHELSDYLIGQDPSRINDLWQTMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLGVPVYELLGGLVRDKMRTYSWVGGDRPADVIAGMKALQAGGFDHFKLNGCEEMGIIDTSRAVDAAVARVAEIRSAFGNTVEFGLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAETYARLAAHTHLPIAAGERMFSRFDFKRVLEAGGVSILQPDLSHAGGITECVKIAAMAEAYDVALAPHCPLGPIALAACLHVDFVSWNATLQEQSMELLDYVRNKADFALEGGYIRPPRLPGLGVDIDEALVIERSKEAPPVWRHADGSVAEWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Putative D-galactonate dehydratase
publication title Crystal structure of enolase PRK14017 from Ralstonia pickettii
rcsb
source organism Ralstonia pickettii
total genus 111
structure length 372
sequence length 384
chains with identical sequence B
ec nomenclature ec 4.2.1.6: Galactonate dehydratase.
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3rr1A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3rr1A01
1E9IA 4E6MA 1ONEA 2DW7A 2FYMA 3MZNA 3H7VA 3R10A 4K1WA 1TKKA 2OO6A 2RDXA 3Q4DA 3ZLFA 3KUMA 3IJQA 2GGJA 2OVLA 2PSNA 3NZGA 2XH0A 1MDRA 3FXGA 4HCDA 3OPSA 2NQLA 4ZCWA 4Z17A 3ZVHA 2PP1A 2AL1A 2I5QA 3PWIA 4K8GA 2P8CA 3DESA 1MUCA 5ENLA 2AL2B 4HNCA 3N4FA 1EBGA 5FJUA 2OZTA 3V5FA 4GYPA 3BOXA 2PCEA 4HYRA 4YWSA 3D47A 1IYXA 2PODA 3GY1A 2FKPA 3RITA 3ZVHB 4M6UA 1MNSA 3MWCA 3MKCA 2ZADA 1JPDX 2P0IA 2XH2A 4GGBA 3I6EA 3VCCA 4FI4A 3GO2A 2GGHA 2PMQA 3IK4A 3U9IA 3TCSA 2GDQA 4H19A 3DDMA 1JDFA 3R11A 5BOFA 1NELA 1ECQA 1TE6A 3DFHA 3HPFA 4E4UA 3OTRA 4A3RA 3UCCA 1MRAA 2MUCA 3FYYA 4IHCA 4H83A 3PFRA 4G8TA 3RO6A 1KKRA 4JN8A 3ENLA 3I4KA 3IJIA 4GFIA 3ES8A 2HXTA 1WUEA 3SBFA 3TQPA 4KT2A 2OPJA 3GD6A 3VC6A 3RCYA 2OX4A 2PP3A 2QQ6A 5FJRA 2OZ3A 3BSMA 4DXKA 2QDEA 4KPLA 2HXUA 4JN7A 4DWDA 3TWAA 4DX3A 2AL2A 2PTZA 3FCPA 3S47A 3STPA 3RRAA 3UJSA 2HNEA 4HCHA 2OQHA 3N4EA 2XSXA 3R0KA 5FJPA 3TJ4A 3CYJA 3PWGA 2GGIA 4J3ZA 4MKSA 1EC8A 3Q45A 4MMWA 3VC5A 1PDZA 3TTEA 1W6TA 5IDZA 3SN0A 2QJJA 1NU5A 1PDYA 2GSHA 4GYPC 4E4FA 2XGZA 2PTWA 3NFUA 1EC9A 3DG3A 2O56A 3S5SA 3T8QA 3UGVA 5BOEA 1JPMA 3DG6A 2PGEA 1P48A 3P3BA 1FHVA 3UXLA 4HPNA 3V4BA 3TW9A 3VDGA 2PTYA 3GC2A 4Z1YA 3FVDA 2CHRA 2PPGA 4M0XA 5J04A 4K2SA 3EKGA 1MDLA 2PS2A 3UJ2A 2OQYA 3SN1A 1SJCA 3R1ZA 1R6WA 3MY9A 1WUFA 3H70A 2XH7A 3U4FA 4KEMA 3MSYA 2QVHA 3DIPA 3T9PA 1RVKA 3JW7A 1XS2A 5EU9A 3CAWA 3QN3A 4ZA0A 4J1OA 3TOYA 2PU0A 4HNLA 3DGBA 3B97A 2GGGA 2P88A 4DN1A 1OEPA 3RGTA 1L8PA 2ZC8A 4HCLA 3ZLGA 2OFJA 3RR1A 3VFCA 3IJLA 3QLDA 1BKHA 3TJIA 1SJAA 3UJFA 3ZVIA 3CK5A 2POZA 2AKMA 4DHGA 3SQSA 3THUA 3MUCA 1ELSA 1YEYA 2QDDA 3ES7A 4F4RA 3SSZA 3OZMA 2QJNA 2OLAA 3TWBA 1SJBA 3R0UA 3UCDA 3UJEA 4E5TA 2PTXA 4IP4A 7ENLA 1KD0A 4A6GA 3VA8A 1EC7A 1BQGA 3NXLA 2GL5A 1KCZA 4A35A 3OZYA 1XPYA 1DTNA 3ZLHA 3DFYA 3N6JA 4H1ZA 3N6HA 4G7FA 4IT1A 1SJDA 3T6CA 2P3ZA 1KKOA 3JVAA 2DW6A 2OKTA 4GMEA 3H8AA 3I6TA 3DG7A 4HN8A 4FP1A 3D46A 4KWSA 2XH4A 3QPEA 3JZUA 4ROPA 4DYEA 4IL2A 3P0WA 3CXOA 3CB3A 2GGEA 4GIRA 4IP5A 2HZGA 2AKZA 3R25A 3K1GA 3CT2A 5FJTA 2OZ8A 4E8GA 4H2HA 4IL0A 4GISA 1R0MA 3V3WA 3EEZA 3OW1A 4ENLA 3H12A 3UXKA 2PGWA 1TZZA 3FV9A 4EWJA 1P43A 2P8BA 5FJOA 3P93A 3T4WA 2QJMA 2MNRA 3OP2A 3FJ4A 3QTPA 4GGHA 2PA6A 4MGGA 3QKEA 3SN4A 2QGYA 2PU1A 2PP0A 1FHUA 2ONEA 1EBHA 4JHMA 3NO1A 3UJRA 6ENLA 3VCNA 3MQTA 1JCTA 4X2PA 3PK7A 3V5CA 3DERA 2OG9A 3SJNA 4IZGA 1F9CA 3DEQA 3BJSA
chains in the Genus database with same CATH superfamily
2UY2A 1D9EA 3TXZA 2DW7A 1KNWA 1UH4A 2QT3A 1O5RA 3H7VA 2GQWA 4EM3A 1FH8A 4UZUA 3V0SA 2VCBA 2QUNA 3CIXA 1KXHA 5H8UA 3BJTA 1X1ZA 1SW3A 1F7BA 3ZM8A 2E9MA 2OWWA 4B92A 4X22A 1D8WA 4MY1A 5BCAA 2VZOA 2V8ZA 4ZO7A 4J3VA 4Q8OA 1EO7A 3PY2A 5LNRA 1J4EA 1RA0A 1BWKA 3H2NA 1CGTA 3B0UX 2I56A 2QGHA 9XIAA 1GTHA 1EBGA 3W6LA 4MJ2A 2WCGA 1EYWA 4RK8A 2E9LA 1HVQA 2WOVA 1HJVA 1HNYA 3RAOA 4FLSA 3BSGA 1VJIA 2G96A 4YTQA 2FKPA 4UTWA 2F2KA 3L2IA 2CW6A 4HU4A 1Z8AA 1G5AA 3EX3A 2V68A 3AIBA 1EHAA 4PMRA 4KERA 4U2YA 2XH2A 3WQ4A 2E40A 4FI4A 1JRPA 3IJ9A 4BZYA 3L0KA 4FNSA 3BOFA 3REQA 2O9RA 4IFRA 2GDQA 4KGLA 3KBNA 1EXBA 4DJFC 3S6TA 1Q6FA 2IMRA 3G0UA 2C19A 5EMUA 2QAPA 5H8MA 3FG2P 1V3MA 3EWWA 5FF0A 1YBQB 3W1MA 4H83A 2D2JA 4IPPA 3L4VA 1V6UA 1UWUA 1DE5A 2YPIA 2J7HA 4LPCA 3NS1B 4O8RA 5DELA 2SFPA 2FGBA 3W7EA 3M43A 3AROA 3C5QA 3CEUA 1TPFA 4XVEA 3VC6A 1ZBWA 1UB3A 4XUYA 2H3DA 4O19A 1JR1A 5ABFB 3KOYA 3EEGA 4ZB5A 2JEPA 1EWDA 4WKHA 3BDKA 1VYSX 3HZ3A 4A4AA 4QLLA 3BOLA 3S0CA 1ZJIA 2ZTKA 1ZBCA 4BI5A 4M6VA 7REQB 3GVVA 5CPTA 1JF5A 4MB1A 1QAPA 5D03A 3FLUA 2YZ5A 1HL8A 1CGWA 1LBLA 3C52A 3C6CA 1J6PA 4GC4A 4D6FA 3LSBA 2C1GA 1D2KA 5G1MA 3DYOA 2NVKX 1SFLA 2WMGA 2R6OA 2HS8A 1ZJAA 4ICNA 2I57A 2O55A 3LCLA 4G1NA 3OYXA 2PWUA 2AQVA 2DEPA 3VC5A 4NJKA 3MSGA 4H9ZA 3LZ5A 4L9XA 3IGXA 1CECA 1OGGA 3NQAA 2HNHA 1OQFA 3AQUA 5C0QA 4GIEA 1EO5A 3RR4A 4JDRA 3CWNA 4J4KA 1JNEA 1DWJM 3V4BA 1CGVA 3F7JA 4JFUA 4Y8FA 2FTWA 2R1NA 1A80A 2OR2A 1M03A 1QFEA 3NQBA 3N29A 3ZR5A 3TLQA 4K37A 1SJCA 5JCNA 1WXJA 2GUUA 4PCNA 3U2ZA 2Y7GA 4EXQA 1N62C 3MHFA 5EU9A 4PMOA 1LLOA 4ZA0A 3L66A 3GKFA 3W71A 1HP4A 3QV7A 3CUZA 1TQXA 3Q37A 2D22A 4CD4A 3ZWSA 1C8XA 4NXSA 1OSEA 1IEXA 4XUGA 1F73A 4XB3A 3THAA 1VLWA 1N8FA 2HEJA 3WG6A 1JZ3A 2RJHA 4G5DA 3CK5A 1K8XA 3SQSA 3HF3A 2WHLA 2C14A 4YXGA 2NT0A 1U30A 1B1YA 4XAPA 4ADWA 3EDEA 3ES7A 3NQMA 3TJLA 3G1AA 4PUMA 2Z1SA 4A8NA 3TSDA 1PVNA 1WXZA 2E1WA 4UMCA 1B90A 5ABGA 5GRTA 1P1MA 5DMLA 1MO0A 1KLZA 1R3TA 3VA8A 5U25A 4OUIA 4LBSA 1E6QM 4LVBA 5DANA 3TVAA 5F7UA 1XJBA 4TV6A 2XFWA 5EFDA 2D20A 3VD9A 1DIDA 1IEIA 1LWJA 2ZUVA 4QSHA 5EY5A 2ZWZA 4J27A 3WLLA 4DNHA 3DAQA 1H50A 4QS5A 1LT7A 2VGBA 1WAWA 3VNYA 4CD7A 1AFSA 2VZTA 4JFSA 5G2HA 3S5YA 1E1EA 5JIPA 1YQ2A 2Z24A 2NLYA 2YKKA 4PB3A 3LEPA 4H4SA 3U2OA 3MC5A 2FZMA 3TN3A 3AHTA 4E8CA 3TYBA 4UTIA 3FV9A 3WDRA 3FA3A 1F3PA 3CHEA 3RILA 3VX1A 3TTQA 3TDFA 4W87A 5CSYA 5DF0A 5EA9A 3L8KA 3APGA 3CV2A 2I1OA 3F4NA 1VPQA 4WXZA 2VC7A 3W22A 3CWOX 5BNKA 1T96A 4NAFB 1S5TA 4E6MA 3UZZA 1XYBA 3VIFA 1M01A 1A4MA 4TU1A 4DJEA 2CLLA 4IISA 2HBVA 2ANUA 4ZENA 2ZDSA 4UFJA 1AMKA 3FFSA 3DU0A 4FIRA 3EX6A 1FH9A 1J18A 3KUMA 1MEHA 3NZGA 2F84A 2F6XA 1XINA 1JL8A 2XIMA 4JKMA 1HQTA 3KBWA 3VDHA 3ZVHA 1VR6A 1YXDA 1KFWA 3A9BA 1MUCA 3IAPA 3G1FA 1XLIA 3NRZB 1EB3A 4FA3A 3I3EA 4FLQA 4PMZA 2OZTA 4U31A 5DFAA 1NWUA 4J2MA 1TIWA 3LB0A 4PMJA 2IQDA 1Y5XA 4HOWA 2RDWA 2YFNA 1V7YA 5LHEA 1VB9A 1ZX9A 3SIZA 3BANA 2CLFA 4O0ZA 1CZ1A 2WC7A 2HK0A 4K36A 1W2PA 1L8NA 4DO7A 2HMCA 4DELA 3VD5A 2VWTA 1UZ1A 3NVDA 1VYRA 3U9IA 4AISA 3LD5A 3DDMA 1V93A 1VFFA 3R11A 3ZJKA 3N9KA 4O4VA 3W7LA 3GG8A 2UY5A 3HPFA 2Z25A 3LHZA 5D9NA 2MUCA 4JEQA 2EAWA 1ONXA 2BVDA 4LC6A 3PFRA 4H4YA 3WLKX 4AW7A 1KKRA 3RF9A 4UTHA 1DQWA 2V82A 3ENLA 3IJIA 5E9XA 1MMFA 1AQFA 2E09A 2EGZA 4C6DA 2OX4A 4M1BA 1FWFC 3GX9A 5C9UA 1XISA 3E5PA 3UY7A 3W2UA 4LALA 2JF7A 2EF9A 2GQ9A 3HPAA 2DZAA 3G24A 3AIVA 4KFOA 4WDXA 4M8UA 3W73A 4AX7A 3PTKA 3KS6A 4MM1A 4R34A 5C8BB 2AGKA 5HAOA 3WLNA 4L9ZA 4ZB0A 5A2BA 4HCHA 4W5ZA 4Z1DA 4RL3A 1VBJA 4XQ6A 2GOKA 4AF0A 2W62A 2YBVA 3BAYA 1C90A 3RU6A 3EMZA 5A3HA 4DWSC 3KVLA 3TJ4A 3B8SA 4JAWA 2FB3A 3VIMA 3MKVA 2XN0A 1PDZA 2DZPA 2W61A 3TTEA 1QNVA 1RCQA 3SN0A 4EPKA 1KN0A 1K4QA 4GY7A 4H4IA 2Y7DA 4GYPC 2Z1XA 3NFUA 2EEXA 1W1B1 3CM4A 4B2DD 4LRTA 4LGXA 2W0UA 1TVNA 1NOFA 2YCLB 4GUJA 3ERPA 3BLPX 1R7OA 4CN1A 1ZKQA 3XIMA 3G1VA 2AOSA 3H22A 4GI9A 1EOMA 3SRFA 3LI0A 4JGDA 4R53A 3R1ZA 4GBDA 2VFIA 4N9DA 4PUKA 3SUSA 4FX7A 3W7RA 4OT7A 1QDSA 5IHRA 2QVHA 4LBRA 2CLHA 1PIGA 3IJ7A 3BLKA 1KCLA 3OIXA 3RM8A 3NZQA 5FI8A 1TPVA 3ABQA 3TSMA 4CVWA 3IGUA 4IMGA 1KGXA 3D0CA 4M5PA 1GVFA 3NURA 1OEPA 5D8ZA 3WBWA 3AS2A 4RDVA 1XYMA 2X30A 2C91A 4JFVA 3D5HA 2Z1BA 1LBFA 4RE4A 2CLIA 4LVAA 3ZOAA 3P2VA 4RE3A 2IW0A 3M5YA 3R8GA 5K3VA 3WYZA 3ITGA 3UD6A 4DIAA 1TV2A 3QMTA 2DSUA 4K68A 4S23A 1JCYA 1DHPA 4D6JA 3TWBA 4MAVA 1NPXA 4UIOA 5FOOA 4ZZ9A 3KBSA 3VMOA 4C91A 1F74A 3MDUA 1GCYA 2AMGA 4XBJA 3T2OA 3KRUA 3VILA 1REQB 1M7PA 2EJ1A 1FWGC 4GA8A 2WMIA 2WVVB 2GVGA 4WVXA 3N2MA 2YXXA 1K77A 3TIMA 4RCXA 1TCMA 3N6JA 1PZ2A 4AFYA 1KRAC 3T0AA 4BY3A 4OBTA 1DJZA 2EPNA 1FTXA 5FL0A 4ADUA 4E2OA 1Q2SA 2XVPA 5G2WA 3OO2A 3GD4A 3SUWA 4FP1A 3L9CA 3HGOA 3GR4A 2XH4A 2QYGA 3QPEA 3JZUA 1ZZMA 2A3LA 2WB5A 5LNSA 2DZSA 3ARZA 1GSNA 3G77A 3CO4A 3M5XA 4PSPA 5BMWA 1DIEA 4IP5A 2GJLA 3UR2A 3L5AA 2W92A 1FCBA 2MANA 4U2ZA 4CNOA 4M6PA 3DFNA 4EP8C 3WDPP 3BGJA 1GWJA 4OE7A 1Y8BA 4DF0A 1FEAA 4EIVA 4AIEA 2PF0A 1W1YA 3EOSA 5I78A 2ZA3A 4XAZA 2VFDA 4RNJA 3B06A 1DJXA 5AYZA 1XF0A 2FPVA 1L6SA 2PBOA 1F3WA 3RXZA 3WF2A 1TJPA 2BY2A 4C6PA 2IXVA 4EQWA 4D1JA 2X42A 3TX9A 3TONA 3WLIA 4ZFMA 2C16A 2GVEA 2YW4A 5CC3A 2PEVA 1K1DA 4DLFA 4NAEB 3KVMA 1O94A 5TAOA 2A6NA 3DERA 4NL1A 1W1A1 3F1QA 2ICSA 2GQ3A 4AC1X 7XIMA 1GJPA 2E25A 4JTCA 3S2CA 5ABHA 1ONEA 3GE7A 4TMCA 2WO5A 3CT7A 4JQ9A 1KBLA 4E2VA 1K9TA 3I7SA 5JVLA 3NIYA 2YFOA 4AX6A 4YTUA 4H4WA 1OFPA 2V5BA 1SFSA 2Z27A 3APYA 3SQMA 1ZGDA 3PZMA 2OO6A 2P53A 3EWDA 3OG3A 3WQWA 4DUVA 2Q01A 3DK9A 4WSJA 3KW3A 3T1GA 1B4EA 4AD5A 1UMYA 4JL2A 4D2JA 4J57A 4G6CA 5CC6A 1XM3A 4H50A 1NWTA 2F7FA 5JU6A 4YTSA 2C3ZA 4WKFA 4NQ1A 4V27A 2GR3A 2YR1A 4J3SA 4LAUA 1VEMA 3M7SA 3WLSA 4GZEA 2VC5A 1MOKA 4P7QA 3L12A 1SO5A 3RPDA 3APTA 4S2CA 5F4SA 1JRBA 2BC0A 1B3YA 4HU0A 1GW1A 1NP0A 3B40A 4DYJA 3LADA 2P10A 4GI6A 3HJZA 4V15A 2OJPA 2ZRWA 3EB4A 1VGAA 3VKCA 4WOZA 4H6EA 2INFA 3GVWA 2YBUA 3HTWA 2ZVRA 1LVLA 1GRTA 2FZDA 1L2UA 2XWEA 2JF6A 3GDRA 4XZLX 2EQ7A 1OCBA 3GH4A 2OT1A 1JDFA 3FJLA 5EBAA 5BOFA 1NELA 4K6AA 1EH9A 3LTSA 3SDOA 4HNTA 1MEWA 1S2TA 3DX5A 1T0OA 3NNTA 1X6LA 1YE4A 3WCZA 3CL7A 1LL4A 5CGMA 4DO6A 4UFMA 3RO6A 2XVGA 1G9HA 4GPNA 1X98A 2ZX9A 1WPCA 3AYTA 1DXEA 4OOZA 2WJZA 1P6WA 1KO0A 4KT2A 3WKZA 2J75A 3VIIA 2WZMA 3LGDA 3BPWA 1A5OC 2XWDA 1ME8A 1IE7C 1V7AA 2P5NA 3PULA 1BG4A 2DUXA 3BLDA 1C29A 3TU9A 2WBAA 1EHNA 2ESCA 3GVGA 5E93A 5BXPA 3TQ0A 1RY0A 4WUIA 1YKWA 2B7QA 1GKRA 1XIGA 4L56A 4LEFA 1X2HA 5GVJA 3GQYA 1SW0A 3CQHA 4O52A 3ZMRA 2PLMA 2E3ZA 4DBDA 1ZU8A 1XIEA 4RX0A 5HXMA 2ALDA 1QUMA 3KS5A 3PF3A 3U3HA 4G9PA 4C6LA 4CGTA 4LIIA 3MCNA 4AEEA 2JIWA 4J3ZA 3A4XA 3TOPA 4RUBA 3DH9A 4MMWA 4QITA 4H8HA 3C0LA 2DT2A 1FKXA 3VXGA 1J6OA 3QR1A 4H4UA 5H2ZA 3FKRA 3PNZA 4GVHA 4O53A 4IMCA 1FCQA 4MB4A 1VBUA 3BC9A 1G01A 2F2HA 2CZ5A 2WMJA 4TXEA 1CW2A 4OVXA 1T40A 2FVMA 5BOEA 4KBXA 1JPMA 4XTIA 3GC5A 1BKSA 1TV7A 1GKPA 5J5RA 3NUKA 1FHLA 4S3KA 2NVDA 3OBAA 3W74A 1F4HA 1IIGA 3B9EA 2V5JA 3UXIA 3LPGA 3SM0A 4D71A 2ZZ0A 3FAWA 1TTJA 2DT3A 1MDLA 2VEKA 5AC5A 5A95A 5DRIA 1TJ1A 3MYOA 4ML4A 4QDWA 1YX1A 3MY9A 3K4WA 2E1DA 4Y9PA 2QUTA 4DM1A 1TPH1 1TX0A 2OU4A 1W3KA 2OB3A 3BAIA 1ZRQA 3DJJA 3IC9A 4J3WA 2EKCA 2PDJA 3TC7A 2PU0A 3T81A 1ITUA 5AY7A 4P8XA 4KIEA 2ZC8A 4ASTA 1IT8A 3SJ3A 3R89A 4DZAA 1LL6A 1B3VA 3TJIA 2DZUA 3SB0A 3L2MA 2VD8A 1ZBVA 3TP4A 3WLQA 5DCBA 2ZUTA 1T8QA 1RSCA 2YGYA 1ELSA 2H6RA 4POCA 2X50A 3FOKA 2RH9A 4R7WA 5A69A 3BLFA 3N3TA 4BEUA 4F4RA 3A7AA 1UKPA 3WNNA 2DVTA 2VTFA 3HGRA 3MKKA 4KW2A 3XISA 4C90A 3RRXA 2BP1A 1JROA 1UZDA 4O54A 1UZHA 1W31A 3LXAA 5CBJA 3KP0A 4ZXOA 1W56A 2W55A 5DY2A 2FFIA 3IIOA 4JIHA 4JPGA 3GU1A 2J88A 1W9VA 4KWWA 2XFFA 4NRSA 1EJXC 2PWHA 5U7SA 2JE8A 2YA0A 1RCXB 2NSXA 5C2CA 2UV8G 2OGYA 3WEOA 3WJXA 2WWDA 1N8IA 2BXVA 4L6OA 1VPYA 1MW2A 4QX4A 4P7LA 3AMZA 5DX7A 4AZGA 5AC8A 3LM3A 4LBUA 4DBSA 2VQTA 3O06A 5FF3A 3TMLA 2HS6A 4G7EB 3MWAA 4BV6A 1RQEA 1V6TA 3M0VA 3W1RA 3KL5A 1RQHA 3W53A 2JEQA 1NDWA 2E6FA 2EKGA 4Z2GA 4F0SA 2O92A 1MZHA 1A5CA 2BZNA 2Q02A 3DFQA 2PGWA 4JY9A 3W87A 3V5OA 4KFPA 1DKWA 2WPCA 1GVRA 3CUJA 1KWKA 1AL8A 4PTWA 1JUEA 3EWUA 4JQ4A 3OP2A 4AVOA 3PZNA 1BYAA 1T6MA 3QSRA 1QU4A 1ZMDA 1ITQA 3H7UA 2PU1A 3DYPA 3B3DA 3SRHA 3NYDA 4Z0JA 1W91A 4JFTA 3RFAA 6ENLA 4HPGA 4O17A 4W7VA 3UYCA 4GIAA 4R7OA 2VX4A 1WBHA 2DJLA 1V6XA 3M5ZA 4L65A 3BW2A 4NY2A 3U5UA 1BGGA 1IGWA 4UZSA 3E5BA 1KBKA 1E9IA 3W3OA 3NWRA 3MV01 3FEQA 1JYVA 2EBNA 1Y5WA 1UWSA 2NWSA 3U57A 4Y7EA 1OG6A 3G5EA 1XFBA 2V81A 2KZHA 1GGOA 3SY1A 3RX2A 2X0YA 1BTMA 5IFPA 1MQQA 1E0XA 1AL7A 4U5IA 3W76A 4KFNA 2QVNA 3B9DA 1WYGA 1UW9A 2VNCA 2BWGA 4H9VA 2O9PA 3IJQA 1KR1A 2PRHA 3PPCA 1V4YA 5HWMA 3W1PA 4N6FA 3OPSA 3I4EA 3N2BA 3NZRA 4Z17A 3VINA 3WMCA 1DP0A 1XLHA 3M0JA 4AZBA 4LAMA 3LS9A 2AQOA 5F4WA 3HO8A 1CCWB 3R43A 4IP7A 1UR1A 3E0LA 3PZOA 5LGXA 2AL2B 4WIWA 4LVGA 4FIQA 5FJUA 1AK5A 3GHTA 4QP0A 3U4AA 2WJEA 1HGWA 3AS1A 4YWSA 2ZRUA 3R79A 4QRNA 5MKGA 1JGIA 1OF6A 3FHQA 3GY1A 3CPGA 3FXYA 1Z44A 4QG6A 3WLTA 4DWSB 4EF9A 1Y0EA 2ZADA 3AIUA 3S9ZA 1XGEA 4GC3A 5DEZA 3TXVA 1XCWA 1UKTA 4E2BA 5E6ZA 3PBMA 3NQ8A 4REQB 2OLSA 3W7JA 4JR5A 1W32A 1AD1A 3S5OA 1QI4A 4MUZA 1XYAA 3PTMA 4AHPA 1FFUC 2IUZA 3GBEA 2G41A 3UQNA 4JTRA 1UJQA 2OWCA 4AB4A 5HOSA 3MP3A 3EANA 3SFWA 3WUFA 3WD1A 2X0SA 5TIMA 4ACZB 1XQLA 1ZSXA 2J27A 4IQEA 2VYOA 1PZ0A 4UTTA 3VPLA 3GXPA 4Q8UA 1G4PA 1ZY9A 4GLEA 1J5SA 1MRQA 4EOUA 4F79A 1T8XA 3STPA 2A21A 2VHLA 4DO5A 3QJAA 3ZT7A 4NYUA 3GIPA 4I9MA 2JFEX 4L4MA 4ATLA 3R0KA 1VFUA 1D3HA 4W86A 2FIQA 3BAXA 2QLYA 4IGMA 2OEJA 2VDGA 4BQ4A 4GUIA 2Z7KA 4NZ3A 1E0TA 3CH9A 1NU5A 1VFLA 3P60A 2HCVA 1XPGA 4GH3A 3WMSA 3AXXA 3PJTA 4PGLA 1BRLA 1I75A 1LORA 3UXLA 3M5VA 3UWQA 2OQLA 3TW9A 3DKJA 4CD6A 4QROA 2J47A 1I2QA 4LUJA 1K70A 1T5AA 3PPGA 5J04A 5CLTA 4Y9AA 3MYPA 2QCLA 1SZEA 4PTMA 1NHQA 1OFQA 4B5XA 2XIJA 3BCDA 2WVSA 2Z1VA 4PMYA 3UA4A 2ZICA 3ZFHA 5CZSA 2BNJA 1FDZA 3URNA 2CZEA 1V02A 2DGAA 4IJRA 4RE0A 5AFDA 4Y6GA 4HIBA 2Y88A 4HU8A 1G4SA 2P88A 3SEPA 4CEXC 1GG0A 1J0KA 3GNOA 4ZODA 5E1QA 3UJFA 4AEOA 2J7GA 4G2DA 1R8LA 4BK9A 2ZUSA 4HJWA 2XZ9A 1IIHA 4KH2A 4J2PA 2QR6A 2J9XA 3VGGA 2OSXA 3A3WA 3VIJA 3VNMA 3P8JA 3T7VA 1UD3A 2A4AA 1G4EA 2FGZA 2Y62A 4BI7A 4PE8A 3QKZA 1RR2A 3N2XA 4F0MA 1NDAA 4IUOA 1VRDA 3K1DA 4ALDA 5HPOA 3ARVA 1A5SA 4URIA 1E9ZB 4LV4A 1WDWA 5F4XA 3VOGA 1CENA 2ZTJA 3W38A 3DFYA 4L4PA 3P61A 1GQKA 4ORMA 1ESWA 3GXMA 3S1VA 1TPC1 2QUVA 3M0MA 4NRRA 4GMEA 3LSCA 2WWCA 1XIJA 1U5VA 2WSRA 4XWUA 2Q3OA 2NX3A 3R4IA 2GSJA 4MNJA 4ZL1A 1OCQA 3FAXA 2BLEA 4DAFA 3ARXA 2VEIA 1WKEA 3AHXA 1XR2A 6REQB 2YL6A 2FJUB 3N2TA 3NPXA 4P8WA 2HZGA 2VR4A 2L5HA 3MUY1 3R25A 4V33A 3ITTA 1TPB1 3FW6A 3PHAA 3HA1A 3B9JB 1O1ZA 5FS9A 5JIWA 3CMGA 3VCRA 4R88A 2O0TA 1GVYA 3FGCB 2WKLA 4J3TA 4U3CA 4EWJA 2E0PA 2YW3A 1NFPA 3R13A 1IXOA 1NFBA 1IZJA 4D9PA 1EPVA 4PRWA 4JDYA 2BGSA 1CXKA 4L64A 4R27A 4TQTA 3WNPA 3ITVA 3DENA 3W7HA 4FF5A 1EBHA 1B3OA 1UR0A 4QE4A 3VU2A 1B4KA 3I3BA 1TYTA 1VPXA 1H2JA 2WMHA 1RM6B 1YDVA 2J25A 3PK7A 3KZSA 4JTHA 1V6YA 3WN6A 3TKFA 4DLMA 1ZXIC 5E6YA 2FHFA 3F5JA 4NZJA 4IZGA 4UB9A 3CUFA 4Q7IA 1J93A 1XH0A 4XAFA 4ZFCA 1F6PA 2TMDA 2A8XA 5T26A 5H91A 3A21A 3QYSA 1XIMA 5I79A 3IRDA 1TWDA 4XKYA 1P4CA 9XIMA 3RJYA 3W2JA 3L4YA 5E09A 3FY1A 5K9CA 3AC0A 1Q1WA 4GINA 2Q8ZA 3DFOA 4BF5A 3LHYA 3MT1A 1IWBA 3FXGA 5DXXA 4TVYA 4YHEA 3GD3A 1VS1A 4JX5A 3TR9A 1W3LA 4YVPA 3IGHX 2V9DA 4LS0A 4MZYA 4P7RA 2YZRA 4Z2LA 4O1FA 1SGJA 4F40A 4ZTYA 4G56A 1P7TB 3GTNA 5L6UA 4GUFA 3BAJA 1KM5A 3DFSA 5HMDA 2B81A 3BOXA 5A1AA 3URAA 3G1DA 2CBVA 2PODA 1DIOA 2CKSA 2ZE3A 4QEHA 1AH3A 3T44A 1CXFA 3F03K 4M19A 3MKCA 2Z00A 4EPBC 2XGIA 5EGRA 1DJQA 2P0IA 3WQVA 3AJXA 5JQ9A 3N2CA 3UNDA 2PGFA 1J2BA 1UBPC 1XW8A 3UBPC 3TQKA 1ZL1A 2DP3A 4HYVA 1J8VA 3AYSA 7TAAA 4HSHA 4BCEA 3TZFA 3I3DA 4YJ5A 4TX8A 4IIEA 3KLJA 1RK5A 1BYBA 3BTNA 2XHYA 3W7NA 3I4KA 1GT8A 3BCFA 1WKYA 3NXFA 2YL8A 5XIAA 4GFSA 3ES8A 4GZIA 4NF7A 1LROA 1SU5A 1XHGA 3GRTA 5I2UA 4K3ZA 3DBNA 3GD6A 4TX9A 3W84A 3KBJA 3USBA 2QNEA 5LKYA 2A7PA 3U5YA 1CXIA 1Z9AA 2HXUA 4GJJA 3N17A 5FF2A 5I3GA 4OFCA 4C1LA 1LPFA 4I7WA 2RUSA 5FMHA 4H9TA 4XD6A 4I9AA 1QMLA 3FCPA 1OGSA 2I16A 3QMSA 3EPOA 3PB2A 3AAMA 2WCAA 4BJHA 2FH6A 3GTIA 1DORA 4NZCA 1CPUA 2EG7A 3CZEA 1PV8A 3PG9A 1W8GA 2Z6IA 4QE5A 3CYJA 1CIUA 1XLJA 1LOLA 5DO8A 1M7XA 1O60A 5A8MA 5C55A 1FHDA 1EC8A 3CO8A 3ANUA 1PTAA 1MW0A 1YYAA 1ZUAX 1JGMA 2GR0A 5TD4A 1JYNA 1HP5A 1XSJA 2VRQA 1NWSA 5FF7A 5A6BA 4AYSA 4IMEA 4GACA 1F6KA 2JGQA 2ISFA 1UKQA 1JZ5A 1MW1A 1S2WA 3G1RA 1F3XA 2BV9A 1X96A 2GUBA 1UR2A 2VVNA 4IF2A 3GVRA 3N25A 4W4QA 3RJXA 3OGVA 2PDQA 2GQ8A 4NX5A 1QTWA 3VNZA 3BG9A 2IPJA 4CCDA 3GW0A 4B9ZA 1PHWA 4FXSA 2VDHA 3SN1A 1GONA 1HG3A 1OD8A 4CEUC 4EPDC 3MP4A 2GSEA 1TWIA 4TUFA 4A22A 1RP8A 4LUSB 1AMYA 3URBA 2H9AA 3U7BA 1WKDA 3QZ6A 1Q7MA 4DQWA 1SO4A 1CLVA 4PCFA 1N7KA 1W1TA 1Q6EA 1BXNA 3B97A 3UZWA 4DN1A 5CH9A 1WV2A 7A3HA 3PZGA 1VKFA 2C18A 3VKBA 3A24A 4MZ8A 2DUZA 1GRFA 1SJAA 1X38A 3MCMA 2PDXA 3MPGA 2X7VA 3GLCA 1IXQA 3MMTA 1UR8A 1WE5A 2ZX6A 4QJ3B 3NDYA 5FJIA 1PSCA 2CETA 1J01A 4DAIA 4IJCA 2KX9A 1BLIA 1RK6A 3ELFA 3I6RA 3CTTA 3L4WA 3UJEA 5H6HA 8XIMA 4LXFA 1QW7A 5XIMA 5IM51 3VNLA 7ENLA 1ZLPA 1X39A 4WJXA 4HA0A 1F3EA 4C5YA 3MZ2A 2R94A 3B8DA 3FJNA 2FH8A 5HUPA 2E9BA 4UR7A 2WHMA 3LRLA 4WRHA 3QH2A 5AKQA 1DJNA 5CZTA 3QFBA 1KKOA 2D2HA 3CQ0A 4NU7A 2OKTA 4WD0A 3EX4A 4HK6A 1J79A 3L23A 1OCNA 3IIVA 5I23A 4KWSA 2ZQ0A 3IVUA 7TIMA 4GO9A 2CHNA 2FPYA 3HM7A 1VP5A 2ADAA 4GI4A 3WQEA 1C8QA 2VC6A 4MWAA 1QW9A 1Q65A 3RU8X 4IQDA 3K1GA 4M1RA 1G4TA 4BQ5A 1PX4A 1I9CB 3LM7A 4GISA 1A0DA 4C6NA 1KCKA 1W9DM 1W5PA 1FWIC 3UETA 9RUBA 3W6YA 2BDQA 3RO8A 4LAZA 2GR1A 1ZENA 3KHDA 4C1NA 4OU1A 2ZZ5A 3IUHA 4F0HA 5A8GA 4KQNA 2PGRA 3HQ1A 1HKVA 5KMYA 1JEZA 1RJRA 2XFRA 1H09A 4M29A 4M56A 1HN1A 4ZXLA 4QQUA 3GH7A 2GJXA 2PDYA 1VBRA 3CS2A 1XBXA 2ACRA 4MADA 5CQ1A 4N9BA 8CGTA 2EG6A 1O5KA 1XQKA 3KZPA 1MZRA 2IPGA 4HNNA 3TYDA 3SJNA 3WX7A 2VKZG 3JZEA 4DZHA 4NZFA 1JCMP 4EQRA 1QO2A 2FZ8A 3NM3A 3PBWA 1H7OA 1S2VA 5I09A 4CU6A 2D24A 3O1NA 1GOMA 2PZ0A 5EYWA 1XLCA 4US5D 1BXCA 2FZNA 2B31A 2J4GA 1FX6A 2E3TA 3KLKA 1TKKA 3OJGA 1VYPX 5C2XA 3PZ9A 3TE9A 3Q4DA 2IKIA 4A3HA 4YU1A 3VIOA 3LXCA 2ISDA 2OYLA 1PHQA 2PLKA 1GREA 4GXMA 5EMLA 2A7RA 2YDSA 1EGMA 1QOXA 2PI6A 1R9ZA 4IGSA 3VK5A 1X8FA 1UWQA 2Z6JA 4C7GA 1LRNA 4ADSA 3IS4A 4WF7A 1EIXA 4Q8MA 3STGA 1SZFA 3PG8A 1RH9A 4DVOA 1TMLA 1V6VA 2JBMA 1U33A 1E1CA 5A8QA 2IQ0A 1B30A 3QY8A 3BVJA 1R38A 1QNSA 3B9OA 4PCPA 3HJEA 1R85A 3Q6JA 3C8FA 3HOJA 4Q8PA 2GOUA 1GQNA 1UWIA 4N7QA 3ZVHB 3HU7A 3AJ7A 3SY8A 5FS6A 4M6UA 3UYIA 1FDJA 3E3HA 4C1KA 1JPDX 3VCCA 1CI1A 1SYTA 1JI1A 2NZLA 1ZK7A 1B2YA 4PTXA 3H2EA 3VGHA 4ECLA 5JXQA 3L4ZA 1HF6A 1I60A 1ONRA 3N9SA 4BWLA 3C2EA 1V5XA 3OODA 3A7UA 4ZSUA 1RD6A 1WZKA 4TMBA 4GFIA 4KPRA 3TQPA 3TAOA 2KAUC 4DXVA 4GYFA 3L5OA 4ZGYA 2ODOA 5K7JA 1TV3A 1D7FA 1QNPA 3O16A 4L6HA 2Z2BA 1VBGA 3BK0A 5BRQA 3WF3A 1YLVA 2PP3A 2INZA 2R91A 1A3XA 1UD5A 2OZ3A 3WQCA 5HA7A 3CPUA 2YX0A 1E4IA 4PMVA 1JF6A 5CEWA 1P6BA 4CQ9A 2GR2A 2WXDM 2VVSA 2G3JA 3HG3A 4XV0A 3G3MA 3DC8A 4FX9A 2IPWA 1EX1A 3N4EA 4XD5A 3UG3A 3WDIA 2PDWA 4HA4A 4GG9A 2WCSA 4R9XA 1S5VA 2YL5A 2X1RA 4DBEA 4RXGA 4PZVA 1T99A 2UZ9A 1KWGA 3PWGA 2WK2A 4DJDA 4EACA 2QCGA 2HE8A 5HNUA 2WP6A 3K8MA 2OO0A 1YADA 3WLJA 3JS3A 5AC7A 1BVZA 4GJIA 1VJZA 1U83A 2CKRA 4Z2HA 3U7VA 3S2NA 3LNPA 3WEMA 2HTMA 3SR7A 3SUVA 1B9BA 3UGVA 1YBQA 1M65A 1GVQA 2NWRA 3H23A 2YIHA 3O6YX 2QW5A 4HPNA 1W8SA 5E0KA 4O0QA 4HA3A 1Q4NX 4EK7A 4ZOEA 1MVYA 2VUNA 4HQVA 2CWNA 4K2SA 2YDRA 5BU9A 2PS2A 1AOGA 4D6IA 2WPGA 1FEBA 3VZXA 5DQPA 2OSWA 4L6DA 3TA6A 3ZJ6A 2J7FA 3AICA 3W27A 3MSYA 4X9YA 1M6IA 5DLCA 1YMYA 1QI5A 3VOJA 1VFOA 5ABFA 1OZMA 5HDRA 2XJ7A 2HQAA 7REQA 3N34A 1DJWA 3V75A 2OX1A 1SZGA 5LHFA 5D2WA 4DPPA 1H51A 1MXGA 4IIDA 3PWAA 2OFJA 3W1AA 4PC8A 2REQB 1M6JA 3DKLA 3AALA 4N4QA 3VDBA 1OX4A 2POZA 4UTTC 3GG0A 4GI8A 3T0CA 3MUCA 1H1ZA 3GDKA 3THUA 1X8CA 1CGUA 3UWWA 1ZAHA 2ZZ6A 1OFDA 3PBVA 2YYUA 5CJNA 4F0LA 2JK6A 1DTUA 4CN6A 3TC6A 1DE6A 3QFWA 1FKWA 5C7VA 3G6MA 1R46A 3BZGA 4IICA 4W85A 1HKIA 1GORA 5D02A 4K1GA 3AS0A 3R0UA 1MUMA 3L7RA 4F2BA 2RHGA 3NQCA 3GZAA 1I6NA 2YOCA 3MO4A 1BGAA 3RPMA 1JIBA 2V2DA 1KCZA 3LDVA 2BODX 1PIFA 4J9JA 4JYEA 4C7DA 5I03A 1P1XA 4AD1A 2E6AA 3PFMA 5EBUA 2HRWA 3GM8A 3OZOA 3RX3A 4LF1A 1NQKA 3CB8A 3P7YA 3LTPA 1GHRA 2FPTA 1DWFM 4JDBA 3EDKA 1IR2A 1XC4A 4NILA 1LLWA 5LXXA 3VKAA 3CXOA 1X7FA 2GGEA 1FOBA 4GQ0A 2W66A 4LA1A 3H24A 3IJDA 3F4VA 5LIWX 4HK5A 4UOZA 4Q7BA 4XIMA 4N2YA 1IEQA 4H4TA 2BVTA 2WNNA 4N9CA 2O4QA 5A6SA 1Y5VA 5L9FA 3QMRA 3WSUA 5LXEA 3VAVA 5A8OA 4E3TA 3CGDA 3OVGA 2Y8UA 2ZZ3A 1MXSA 1QPNA 4DPQA 3UPBA 3S8HA 1YRRA 1GOIA 5M3WA 3O63A 3SN4A 1F5ZA 4ZR8A 1Z7AA 4WY0F 3A4WA 3MHUA 1JXJA 4ZOCA 4TVCA 2G50A 3PPFA 4L7ZA 2EPKX 2OWXA 1B9ZA 1GZ1A 3WH7A 1VQTA 3CUGA 4LVFA 1TFVA 2CESA 2Z29A 1V51A 2PC4A 1NIUA 3RMEA 4O16A 3IUDA 3GUGA 4QM1A 5HANA 2J8TA 4HZMA 5RUBA 1JZ6A 3CV1A 3AIRA 3PJWA 1KRCC 2Y89A 3IJ8A 2Q3RA 3VX0A 4Y9OA 4IPIA 1PKYA 2FLIA 4NEVA 4AIBA 4OUEA 3TYAA 3NM1A 3WNOA 5HMEA 1DEDA 3S1XA 3OOQA 3HGJA 4GNKB 1UROA 3LV6A 5M03A 2PE4A 2RDXA 5HWNA 3ZLFA 1CXLA 4XD4A 4OQVA 3HQOA 1MO9A 4HMNA 3HGSA 1R3YA 5JCKA 3GFXA 3B9AA 1HKWA 3GVQA 5C7HA 2EO7A 3OYZA 2D73A 4QEEA 1AJ0A 3SY5A 1H7NA 1H7XA 4TOQA 1U1HA 2QDGA 1FVPA 3LK6A 5G4HC 4LFYA 1W2VA 1JAEA 1PE1A 3SCQA 5TF0A 4J40A 3NOYA 3C56A 3NQEA 1Q6OA 4J56A 2CLEA 3DHFA 2G8ZA 3SADA 1HL2A 1UUMA 4JTJA 1KLYA 4Q8QA 4PUDA 2YQUA 4H9XA 3UWUA 3EA1A 4ZVJA 3G1SA 3MWCA 3T07A 1VAHA 3IARA 1K6AA 2W27A 4C6CA 4HOZA 3GO2A 1XWYA 3URHA 3GAYA 2OYMA 3KOWA 5CSRA 1WNOA 4B5UA 3K30A 1CXHA 1JOAA 3PPHA 2G4FA 3UCCA 1MRAA 1FY6A 1AW2A 2YL9A 3VO0A 2DZWA 1OYAA 3HQPA 3LNMA 5C9RA 2WSKA 2CZDA 1EP1A 1KW1A 3BLIA 4R85A 5GJMA 3DZ1A 3AXMA 2WVTA 2W3ZA 4GJ1A 3H26A 5LIXX 2G4JA 1VD6A 4P7NA 1PTDA 3W37A 1SUXA 1XICA 4XBSA 4DXKA 2QDEA 2GFTA 1RY8A 1CEOA 4Y2WA 4D8AA 2DORA 2A1YA 1H41A 1E9LA 4YVVA 3ECQA 3GS6A 3GH5A 4RZ6A 4PB5A 4QISA 1H49A 3BMVA 4S3JA 2QUUA 4LSBA 1X6NA 5B7YA 2C13A 4INFA 2XN2A 1WQ5A 2ZKMX 1QBAA 2HPMA 1XSIA 2ZX8A 1W5NA 1CLXA 1W1ZA 2A79A 1US3A 4UTFA 1QI2A 3M0XA 3BQ5A 3W81A 4NNAA 3M9YA 5FD0A 2BBFA 2A7NA 8XIAA 3DN5A 2WNWA 3FS2A 4KF1A 3THCA 1Q5MA 1KM3A 4HMEA 2D1ZA 1TWZA 4A2SA 3SW6A 3UESA 3WK1A 1W1PA 3P84A 1TA3A 1KM0A 3DG3A 4NZ5A 3R12A 4DJED 3QFEA 4HKPA 3SCSA 2PDFA 3GBDA 2H90A 4M51A 4M7TA 4LCSA 4K8HA 1V3HA 4LUTB 2ZZ2A 4GUGA 2D2OA 1KFBA 2QJHA 2CBUA 4UCFA 4UFIA 4LOCA 3ZZ1A 1C7TA 2NW0A 3QOKA 1OT2A 1EOKA 2C0AA 4GZJA 3QXBA 1XH2A 1XDJA 5GNYA 4C60A 1THFD 4KEMA 2BOGX 2PFHA 2EPHA 1L2QA 3RYSA 3P80A 1JDAA 1EGZA 3W88A 3PNUA 3CHFA 4GVFA 4OBSA 3KM8A 1E4LA 3CC1A 4ZQRA 4NYYA 2QCMA 4HB7A 1LRQA 5T91A 2NX1A 1D8CA 2R9ZA 1BFNA 3MV11 2PWDA 4R5EA 2VR2A 3QBUA 4O8AA 4DBUA 4XZHA 2Y5SA 5CC5A 3MI2A 3II4A 1UUOA 1Q66A 5C9WA 1NARA 2NVCA 3NA8A 1FWHC 2QUMA 4CCCA 2I5GA 4I6KA 1IR1A 4S3EA 2VO5A 3E2VA 1UR3M 3HFTA 1OFRA 3ZSTA 1SQ7A 4O1CA 1S2CA 1P0DA 2NSOA 3NVWB 5M17A 2PDNA 4JS3A 1KFCA 2GH5A 2YCLA 1STZA 3PS7A 2YCIX 4WR3A 2ZRYA 1V0MA 3CQIA 1TR1A 4DB7A 3H2MA 2QIIA 1FP8A 3PAJA 1WBJA 2Y63A 1O12A 2Z4GA 3T6CA 3WMLA 4AZHA 2AAAA 2DT1A 4JQ1A 3STFA 1KM4A 1X7IA 4Q4MA 4AD2A 3AZRA 1BVNP 3K13A 3POCA 4YPJA 4Z1CA 4IFKB 1C91A 5JCIA 3L67A 2ZUUA 4DYEA 5AHNA 2QCDB 3GXFA 4IL2A 1GESA 1TELA 5D2VA 1MXDA 3TFCA 1XIIA 3T55A 1MW3A 5BWAA 5K4XA 3A9IA 1W17A 4LAOA 4K7VA 3SCWA 2Q09A 4PFHA 1GJWA 1GVOA 4PL1A 3H12A 4ES4A 3UXKA 3ARQA 2ISSA 3GIYA 3KWXA 3W2MA 1NEYA 3G0XA 2XM1A 5BRBA 3ETRB 1P0NA 2DZBA 1R86A 3T4WA 2QV5A 4O28A 4JQ3A 3U2EA 3SUTA 1XBVA 4H4PA 2OZ0A 1ONWA 3W7KA 3J7HA 4FNTA 3DXIA 1GRBA 3WFAA 3EKLA 3NO1A 2XIBA 1WOBA 2WVVA 2C8NA 5A2AA 1GRAA 5CG0A 3DGZA 4EAMA 2BFGA 3FDKA 4AUBA 4UQ9A 2NUXA 3MS8A 4C6KA 1EQPA 3FHAA 1POJA 1V02E 2PLJA 1HL9A 3L4XA 4KMQA 5HMSA 3WJWA 1E6PA 4Z2JA 3TH6A 3HG4A 3PANA 4FOJA 4K1WA 2R24A 1PCWA 4QBXA 3S2MA 1TPUA 4ATWA 3QV6A 1K6WA 3COTA 1E56A 1AW5A 3M46A 3V1HA 3W7MA 4JQAA 1XYZA 3TCEA 2TPRA 2GK1A 4RPQA 4ZCWA 3NEHA 5BRPA 1BWVA 4HOXA 1UKOA 1JYXA 2Y7FA 2J8FA 1QHOA 2V5DA 1HT6A 3ABZA 3L0GA 4TTGA 3ZJ8A 2V3AA 4UBPC 4X9SA 4NIRA 1FCUA 3O3RA 1JAKA 3V5FA 3EGJA 3M0LA 1WDPA 3EF6A 3GU2A 2E4TA 1JI2A 1PB0A 4KWUA 3VD7A 4H9YA 3OLDA 1GKQA 3RCNA 1KBIA 3KRBA 4LY8A 4LC8A 1ADSA 4MTVA 3SRDA 2PCQA 1A5KC 2QPUA 4GGBA 4NAEA 4X0VA 4GZ7A 1YDOA 2X1TA 3CZJA 3KOZA 4RLIA 3R8HA 4CU8A 3DBPA 4CU7A 4CNUA 4DJFA 4YIWA 4YTRA 1ZP3A 2I5IA 4CUCA 3VGFA 4IHCA 2EHHA 2G3FA 5G1YA 1IGSA 4GOAA 3WIJA 3MUAA 2PRLA 3QLLA 4AZ7A 1B3XA 2GYIA 4MFEA 1WUEA 1P0BA 4A29A 5KITA 4FOUA 3CTLA 4MFDA 1V3IA 4GCXA 4OJYA 6TAAA 4E8DA 1E4MM 5GPRA 1RV8A 2OCZA 5EL1A 3H4WA 4CCZA 5FJRA 5I06A 2QAEA 2HPIA 3G1XA 1PS9A 4LWWA 2BS9A 4HPHA 3OC4A 3CJPA 1LWHA 3LQGA 3LHTA 4PR4A 4DWDA 1GEQA 2RKXA 4FR1A 2X7WA 4XAYA 3OEXA 2HNEA 1VF8A 3W1LA 4OBRA 1SR9A 4AYGA 3TEVA 3IVTA 2INEA 4PTVA 3MO7A 3VM7A 2P0OA 1VFHA 4WXYA 1N63C 1QR7A 3WNKA 4CQDA 2PURA 1LQ0A 3CGEA 4H3DA 1XCXA 3DHUA 4M82A 1BG9A 3CYVA 3NGFA 2WKJA 4MB3A 1OG0A 3C0QA 2OSYA 2V2HA 1VEPA 4Y9NA 3W07A 3SIMA 3W26A 3BCJA 4OOUA 4UNKA 5DT5A 3PJUA 2OOGA 4Q4KA 1JZ2A 3EDFA 2EQ8A 2VT0A 3SCOA 3F2BA 3L68A 1DQXA 3NSMA 5AYIA 2ASHA 2PTYA 3T0DA 3VKKA 1OYBA 3BAWA 1JXKA 4PTNA 3WJZA 1F07A 2PDBA 3UJ2A 4WSKA 5EMYA 2G95A 3H70A 4E3VA 1PCKA 4IQJA 3DIPA 1K7XA 4QHRA 5JCLA 1ICSA 3CUHA 4GX9A 4A8LA 2D69A 4BWLC 3PBYA 1FWWA 3TOYA 4S2BA 3GXDA 1FXPA 1QASA 4D6EA 2NXIA 3M07A 3SGUA 4QTGA 4YWIA 5D4YA 1WA3A 3OGRA 5D32A 1L8PA 2V5KA 3IUIA 3WQ6A 5C5YA 3FSUA 4OWGA 2PF8A 5FCZA 3HBLA 3EAOA 3B05A 4QQ3A 4PH6A 4JZ5A 2VMFA 3WLHA 2VEPA 1E40A 2Y5EA 4FLRA 3CAQA 4QS6A 1WYIA 2HDJA 3S42A 3N13A 2CBIA 3SCRA 3MI6A 2HSAA 2CBJA 1B54A 3SR6B 1PEZA 4LTSA 4UR9A 1SZNA 5I3KA 1GRGA 1VC4A 4DJDC 4NHVA 4EANA 2Z0IA 3E74A 1XI3A 1EC7A 4CLMA 1JVNA 2NLIA 2I14A 4LX4A 1ODZA 1DTNA 1BQCA 2GJPA 3BL3A 2X99A 1J5TA 3LCHA 3SCUA 3JRKA 1RUSA 3W7PA 1GPWA 2Y85A 3JVAA 1GEUA 1A5UA 3W9ZA 1G6CA 4AVNA 1AODA 5DXYA 1M1BA 1JZ4A 1YTKA 4PBFA 3CMFA 3AO0A 2UY3A 2X05A 5B7ZA 4ROPA 1TG7A 3TYCA 4M81A 2TSYA 5G1TA 2ZX5A 4PMUA 3CHVA 2AKZA 3OZPA 4Q6JA 4XZBA 4PUWA 2I9EA 1CT5A 1KBBA 3N6QA 3PUEA 3EEZA 3RX4A 4AH7A 2FZ9A 3NVYB 1ADOA 2OMAA 3OW1A 4W7UA 4L80A 4GQRA 4S3GA 1NVMA 4HHMA 3USZA 4TX6A 4JCMA 4AZCA 1Q7QA 4A8RA 3JUGA 3O0HA 1Q6DA 5AVNA 1XG3A 5FJOA 5G2IA 3VIPA 2Y8VA 1K8CA 2MNRA 2FVKA 3EOLA 1ISXA 4NASA 4B5TA 4F66A 1UH3A 2J7EA 3O05A 1XLEA 3TYUA 3UG4A 3EWXA 4Q8WA 3U48A 3UXAA 1MFVA 5JH1A 3PAOA 4X2PA 4J5NA 4Y9MA 1PUDA 4PB4A 3NO5A 3R6IA 3F4DA 3IV3A 3F5KA 2HJPA 3GDTA 1R9YA 4BA0A 3WD0A 1XLDA 3WNLA 1A5NC 4KCTA 3UWZA 5PTDA 3BH4A 1Q4WA 3D9XA 2OEKA 3P14A 1Q45A 2J66A 1ZQ5A 2Q6ZA 5D9MA 1I4NA 1R7AA 3LV5A 2VGFA 2VFFA 1H5VA 3QW4B 4ICCX 4W89A 2J79A 3MJMA 1DBTA 3BWWA 5JUVA 4N9EA 3K5XA 3HPXA 2OYKA 1S39A 5DMNA 3GSMA 3C3NA 2GGJA 3DUGA 3L5LA 3UXDA 1R2RA 2NX9A 3V35A 1D7YA 2NQLA 5T9BG 5G5HB 2PP1A 1DJIA 3PWIA 4XZ9A 3N73A 1S5NA 1FWAC 3NQDA 1I8JA 2B4GA 2BXZA 1V3JA 2OGJA 5T9CE 5ENLA 1XLAA 3PSVA 4XKYB 3UR5A 4HNCA 3OHIA 4FEZA 3B0YA 4NI3A 3KDNA 1N8WA 4B4FA 4PEEA 3S1UA 4GQGA 1EKOA 1FFRA 1KQYA 2W91A 4V1YA 8RUCA 4BEQA 1EBDA 3IVSA 3AYRA 4IIBA 3RCMA 1MNSA 1R30A 4A21A 4I8DA 2DVUA 1KRMA 1F3TA 3LERA 3ITCA 5HJYA 2GGHA 2PMQA 5HNTA 5J5DA 1UR9A 1E6NA 4X2RA 2WW5A 5CG7A 3WY1A 2V0TA 3CASA 3DFHA 4HK7A 5IHSA 1CYGA 5A6KA 1H60A 2JQXA 4LY4A 4ML9A 3SAZA 3VGDA 4CN4A 4ZO8A 2Y7EA 4UOJA 1PYMA 4FF7A 4MLJA 4XAGA 2HXTA 2TODA 3FN9A 1RAKA 5AYXA 1HW6A 2I7GA 4US6A 1FIQB 2TAAA 4GKTA 3VDCA 2DSVA 1H0GA 4H4XA 3CPRA 5CAKA 2XU2A 1P0KA 4O1DA 4P7OA 4B5WA 3VD3A 3GTXA 3G3DA 1H1YA 1YE6A 3WK2A 3FSTA 3W7QA 2EQ9A 4WZHA 5ER0A 4S38A 2F5ZA 2J9ZA 4GABA 1QI3A 3QGKC 3GB6A 4LU0A 1E4NA 2CLMA 1Q6RA 2AL2A 3WFLA 5C70A 1LUCB 3K8KA 4MSSA 3IACA 3GR7A 2OQHA 2ZRVA 3M4HA 4X3ZA 4C6BA 3ATZA 4F0RA 6XIAA 1KXVA 1L6YA 4DWSA 3IIPA 2FVLA 3AISA 2WM1A 1EF3A 5F2GA 3NOEA 5GNXA 4B4HA 5A6AA 5IDZA 2GZXA 3G8RA 1HKJA 4HMDA 1R87A 2GSHA 5D09A 1M7JA 4REQA 3WQGA 5CSUA 4YWOA 4PEKA 5TBOA 2WC4A 2R8WA 2CLKA 3AXHA 3UERA 3W23A 1DNCA 3UZYA 2ZIDA 1OGBA 3VDGA 3ZS4A 4L9YA 3GC2A 2DU2A 3WEZA 1JJKA 5LIYX 4RNIA 3UZ5A 3BLEA 5AYBA 4FX8A 1F2JA 1UUQA 4GYJA 1GVSA 3LB8A 4ACZA 3U4FA 5FJJA 3NZPA 4JBRA 5ECUA 4O14A 3EAUA 4NG3A 3DI1A 4NSBA 1TE1A 3AIQA 1W9BM 3MUZ1 5JMUA 1AH4A 1H0IA 3SUUA 1UD2A 2Z28A 1TV4A 3LHUA 3L4TA 3TA9A 4FOKA 3TJXA 4DNAA 1D3CA 2J7DA 3WUBA 5ABTA 3VTRA 1GV4A 1Q8JA 3QLDA 2A0NA 1H2IA 6A3HA 4UTJA 1VCGA 1DWHM 1KFEA 1Z6KA 4S1FA 4TO8A 4MJ4A 2Z2AA 3FEMA 1JNDA 2QV4A 1PYFA 1OY0A 4TV5A 1KXQA 1WP6A 1QWGA 1FWDC 3B8UA 4H6RA 4WY0A 1K8ZA 4WJ8A 3LZ3A 1HJWA 2OLAA 1GOKA 1YPFA 4QE1A 4MZ1A 1D3GA 2BASA 3ZT6A 1K02A 1V3LA 2EPOA 3MCOA 3LOTA 1H7WA 4BURA 1KD0A 1XANA 3HFYA 1BHGA 1TV8A 3MVIA 4LAKA 3KXQA 1SMDA 1SO3A 1RPKA 1S5WA 5K4ZA 1KTBA 4PSRA 4DI9A 1PKMA 5BXTA 4YYCA 4ADTA 1TV5A 1Q7ZA 2GQAA 1ZPTA 2E8YA 1H4PA 3O6DA 3ITLA 4UFHA 3A22A 3AWOA 3H8AA 1E0WA 2ZVIA 3MTWA 4XBKA 5A2CA 1GPFA 1ZBKA 1IT7A 1O5XA 3T42A 2WZHA 3TUUA 5EMJA 3LLFA 3VGEA 4KEZA 1OC7A 4Y8EA 2YVGA 3UT0A 3CBWA 5I3JA 1IXNA 4WCJA 3R58A 3RG6A 4XO6A 1S1RA 1PZ3A 4S3DA 4Q32A 5FJTA 4MG4A 4IL0A 5A6JA 2QAFA 1E5JA 2VEGA 1QWKA 4W93A 3HB9A 3F5LA 1MWOA 1WX0A 1LYXA 2VZVA 5D2YA 4Q33A 3WQFA 1K9DA 1IZCA 3Q2DA 5I77A 3GDBA 1KM6A 1TZZA 3QGAC 3QFAA 4AZ6A 3TMQA 4W9TA 4YNGA 4U28A 4JNMA 1J96A 2BY3A 1AQHA 2WLYA 1LOQA 4K38A 1OX6A 1TRIA 2FZBA 1V79A 3F4WA 2VOTA 3B8WA 4KCUA 2FJKA 4FSAA 2NUYA 1OADA 2YAUA 3MQTA 3BQ6A 5FEZA 1JCTA 1EZWA 1T41A 4MY8A 1Q6QA 1N55A 4XZIA 2A5HA 3AXIA 1XBZA 2C15A 3E0VA 3DHDA 1XD1A 1R3RA 1XLMA 1IEVA 2CIPA 4XZWA 4ICMA 2QJIA 4C5ZA 1IT0A 3EKZA 3LBOA 2OELA 1VENA 2CPUA 1AG1O 3IV8A 3WK3A 4BI6A 3P62A 2GJXB 2PWGA 3MA8A 2W0HA 1RXOB 4O0KA 4HBKA 1JPHA 1AW1A 1T3QC 3A5FA 3KRZA 5HJXA 3TYZA 1JD7A 1NDZA 4AY1A 3VYLA 1EJTC 4AVFA 2OVLA 1AJ2A 4CVUA 3CAVA 5EMKA 2JALA 3LG3A 4QIUA 3DESA 4CQAA 4EX4A 3PUOA 3ZYZA 1RBLA 5ABEA 4JTFA 5EB8A 2HBXA 1FWTA 4AZIA 3EOOA 4B15A 5K9DA 1UCWA 1TMQA 2WHJA 4AMAA 2PDGA 3LCIA 4P8UA 3CGCA 2R1LA 3C0JA 3D47A 4MYAA 2VEFA 3ICJA 3UVIA 4UTWC 1EIBA 3E49A 2RAGA 1JULA 1KQZA 2YCJA 4WK9A 2PDLA 1FH7A 4XD3A 1DXLA 3SCVA 4QDPA 1KRBC 2VJXA 2WBKA 1GZGA 1JUBA 1QPQA 5KVHA 1W54A 3EOUA 3IK4A 3F2DA 4D6GA 3LN3A 5HQEA 3EXRA 3TLLA 4E4UA 3OTRA 2X8HA 5KZ6A 1F8WA 2NV2A 4WDTA 2A3AA 3WZ0E 1DL3A 4JYDA 3GTFA 3KE0A 3W7IA 2VI0A 3CHDA 3QSTA 4FO4A 1TIMA 2CYGA 1OC5A 1R3WA 2HV5A 3QC3A 4PTDA 3QQWA 1XD0A 1JDEA 3ALGA 3V18A 3MANA 5HATA 4IG2B 2CXGA 3SCNA 4GBUA 4YLWA 2WZTA 2QCNA 2J7CA 4HSNA 3ABXA 4JYFA 3SURA 1UH2A 3QEZA 5FF4A 3LCFA 4JTKA 3NJ3A 3WL0A 1TTPA 2WJFA 3TWAA 5HR7A 3DHPA 5D04C 2E5AA 1P7TA 2DSWA 2GVYA 3EA2A 5G5IA 4MDOA 3G0SA 5HWJA 3BURA 5BWFA 2Q8LA 3A12A 2QPSA 2TPSA 5KEZA 1TPEA 5FJPA 1SMAA 1ENUA 4X61A 3S2LA 2ZWYA 9CGTA 3KL3A 3BAKA 1EXPA 3GYEA 3UCQA 3SI9A 3QF0A 3TN6A 4XVDA 5REQB 3E1F1 2E67A 2NQZA 2D0HA 2C3CA 2QCCA 4LB3A 3AWNA 2YYTA 4WOQA 3W02A 3NZ1A 2WPFA 1VHCA 2Y8KA 3EWYA 5TNVA 3S5SA 1HKKA 2DVXA 2PGEA 3SQPA 3B0VC 1YXYA 8A3HA 2P3EA 3MW7A 2DZVA 2CDUA 4AD4A 1OIFA 1QBBA 6TIMA 3W24A 4N02A 4P5UA 3EKGA 4V1XA 3GNRA 4Q3MA 1I45A 1SB3B 2WSQA 2HE5A 1R6WA 3EYPA 1O5QA 2WLZA 3G22A 2QJGA 4UMAA 3NVVB 4K7YA 1KFLA 2QHAA 2R9RA 3GNPA 3JW7A 1C93A 2BXYA 1MEIA 3W7GA 3HMJG 3WO8A 1XLBA 5I3FA 3TYEA 4J1OA 5HR6A 3HQNA 4J7RA 1JD9A 3QPZA 1PTGA 2ZCGA 1PL9A 3T2QA 1AVAA 3GYCA 2C0HA 1M41A 4BKNA 1M04A 2VFHA 1XUZA 1O1HA 3IJLA 2V67A 3AIWA 2B7NA 2CFYA 1J9YA 3N18A 3S6OA 2AAQA 1F6YA 4KEUA 3WQPA 3HG5A 1IWPA 4Q4SA 4H8NA 4DYKA 1SSGA 3B8VA 2ZC1A 1V03A 2JGYA 2VQUA 3SSZA 3INPA 2EPLX 4WSHA 1XUUA 4Q8VA 1RP9A 3ITXA 1RBAA 2J78A 3EPMA 1Q63A 1KR0A 1FRBA 3F2CA 1P6CA 4DNMA 4C6JA 2EQ6A 1RLDA 3K2GA 1ALDA 1OX4B 1HVXA 1NDVA 1Z89A 2GL5A 1OFOA 3W83A 3GXNA 4DM2A 2VM8A 1ZTVA 2HWGA 2H3BA 4IT1A 1R3QA 4PBGA 1QO5A 4R3UA 1A5AA 1QNOA 3P5ZA 1QVBA 4HN8A 3GDLA 4LUSA 1WAUA 3WF4A 3TQVA 1VLIA 2HROA 2VZUA 1YQZA 5DBUA 1H6VA 4QLKA 1HX0A 3P0WA 3WD4A 3UP8A 4BF7A 4Y90A 3PSWA 4APNA 5CPSA 5AECA 3GIQA 4LYQA 4H2HA 1GQIA 1QT1A 2P76A 1Q6CA 1GVIA 4ENLA 6CGTA 2XTKA 4MNMA 3BARA 1SZRA 1W1VA 2ZZ1A 3ANYA 3K8LA 2O7QA 1R5YA 4RR4A 3H21A 3O9NA 5A6BD 3MUXA 1KC7A 1SM9A 2NT1A 4JHOA 2QJMA 3QHNA 3RLHA 1UD8A 4HA1A 2LLEA 4NJGA 2XYLA 2R1PA 1OZQA 4UTUA 3KWSA 2PDMA 2W54A 1RHCA 5E9AA 3KOXA 4EM4A 4RNHA 3A64A 2I17A 2VRKA 4ZQNA 5IDIA 5E0CA 2J74A 3WDHA 2NXGA 5FEWA 2YDAA 1YNYA 2X09A 3E2QA 1BEUA 2PDHA 3GHSA 1E6ZA 2O9OA 2DFAA 3AUOA 4H4QA 2WM0A 4LANA 1R9XA 4RZ4A 4H9MA 1C9WA 4DUXA 2Z1WA 1CGYA 4JTIA 3DGHA 4CQ8A 5A8NA 4JOMA 2Z2UA 2ZRZA 4DJEC 3IJ6A 1TUFA 4KRZA 4FX6M 4UQCA 3RPTA 2E5CA 3CUIA 1J10A 3BXWA 3WBYA 4GQQA 2GWGA 2Q71A 1G0CA 1X97A 4ERAA 4YHGA 1V0LA 3QYQA 1UHVA 3A4JA 1Y65A 2G97A 1AA1B 2XH0A 1LBMA 3WH9A 1V97A 3VNDA 3VUPA 4Q8NA 2I5QA 2V5CA 1E43A 2PAJA 4K8GA 1E9YB 2P8CA 4GKLA 4B16A 3QPYA 4IOTA 3OIHA 2CWXA 5D8WA 1XLKA 3DK4A 4TVDA 1CXEA 2NQHA 3AFBA 3N4FA 3E0IA 2Y1HA 1IQ8A 3MHGA 2PCEA 3MDWA 3KEHA 5U1OA 5LZLA 3A13A 3N1AA 3O0KA 1OD0A 5HUOA 1N61C 3NVTA 1R3SA 5D37A 4EMWA 3UG8A 3VOHA 1C9DA 1TJ0A 5IXEA 2WQPA 2H8XA 3DFTA 5CGQA 4UTKA 3C2YA 1AUSL 1FXQA 4RDZA 3NEVA 5C9XA 2XG9A 4FMVA 4H4RA 1A50A 4V2XA 3GR8A 1A53A 4MKVA 1M7OA 2GDVA 1TO3A 4MY9A 1G7UA 1AZ2A 1OF8A 4X60A 1EUNA 4WDWA 4S3BA 3VNJA 2QCFA 4MWAD 3ZT5A 5AB3A 3FA5A 3LHVA 5JBFA 3KOFA 2ACSA 1UASA 4FAMA 1CWYA 1C8VA 4LT9A 3BO9A 4H6QA 4JTAA 2VWSA 3H2FA 3WD3A 4U4MA 3NL3A 3AMKA 3KBVA 3M1ZA 3ARPA 3QY6A 4IIFA 4J28A 2D23A 4RE2A 1XG4A 4AU0A 4L5ZA 4LS1A 1ZB5A 2QZRA 1GK8A 3LU2A 3ONBA 4M3PA 3QY7A 3WJYA 1XGDA 2ZXQA 3T0BA 3VKJA 3AM9A 1E72M 1FWRA 3PZUA 2WYSA 4E2DA 5IFTA 4ZQOA 4QGCA 2PDIA 3H53A 4Z1AA 1BYDA 3LY0A 4EF8A 1PZ1A 1YTDA 2AMXA 2GGIA 3WQ8A 1LOSA 3QQ0A 3AZTA 4Q6XA 1UC4A 3V1PA 4AWSA 1EQCA 1W6TA 1XRTA 2Y6ZA 3TR2A 3KRSA 3T8QA 1ICPA 4NUWA 2YCEA 4YYFA 1EEPA 2V3DA 3TN4A 1ZMCA 2FDMA 4M24A 1V77A 4QNEA 4Q8TA 4LJ3A 3CEPA 4QXIA 3W2LA 1N5WC 2G5WA 3FIGA 1K7EA 1UA7A 2OQYA 1K4GA 2XSAA 1QW8A 1TA3B 4JIRA 4EXBA 2IKJA 3ARWA 3EWBX 4MJZA 1TTIA 3T9PA 1ML1A 3MUIA 4EVZA 3ORWA 4W88A 2Y61A 1ZAJA 3NL5A 2W63A 3CAWA 2QKFA 4H00A 1F61A 1SFTA 1TCDA 3TTOA 2FGLA 3CZGA 5FAGA 1PO9A 3MVTA 4JKKA 4ZOBA 4BR1A 3DGBA 4YS1A 2J62A 5XINA 2ZXAA 1VCFA 1GUVA 3AOFA 1AQMA 3BSHA 3HN3A 3TROA 8TIMA 4NVTA 2FHBA 3UVAA 1A3WA 3F4CA 2AKMA 1Q13A 1E0UA 1UOKA 2VR5A 2QDDA 3KTCA 1E6SM 1LQ2A 2D2GA 3RDKA 4AD3A 1H62A 3UF9A 1SW7A 2O9TA 5CBBA 2DH2A 1KGWA 3LPPA 4FXFA 4RZ5A 2W3RA 3DECA 4XKMA 4QJ4B 2G3IA 3W7OA 3WH5A 2DIJA 1FA2A 3QZEA 1L6FA 3UCDA 3A23A 2GPTA 3EWCA 3D3AA 1DYSA 2BB0A 3GRIA 4I5UA 5FL1A 2TYSA 1N82A 3GFYA 4O1EA 3LRKA 4UQDA 3GU9A 4K8DA 3NAVA 4PODA 4JFWA 1E55A 2FHCA 4AAJA 4M52A 4KGJA 1EX5A 1UR4A 3OB8A 5CZJA 3VFLA 1ONFA 5BZAA 3GFZA 1IXPA 3W86A 4I3GA 3GAKA 5I3DA 3VD4A 2G3NA 3ITOA 5CPLA 4MPKA 3PZTA 1XDMA 1G94A 3D46A 3T78A 2XN1A 1TTQA 1PIIA 2XVNA 1WDQA 1TPWA 3CB3A 3NPUA 4Z1BA 4DJDD 3A3HA 5H8PA 1UC5A 5CZ0A 4JX6A 1W5MA 1KTCA 2EPMX 1R0MA 2REQA 1G7VA 4OV9A 3BZJA 4AXNA 2POTA 1GEHA 1SFJA 4XISA 1TVPA 4JTGA 4MIMA 3SFKA 1XIDA 1ISZA 2YVJA 3SQLA 4GHRA 2F6KA 2CCRA 5CCZA 1K7FA 1Y7VA 3FJ4A 1B3WA 3OA5A 2PDPA 3AUJA 1LF1A 2FMOA 5A6LA 1BSLA 1TRDA 4ZQMA 2PDCA 2HVNA 2PZNA 1O7AA 2ONEA 1PJ9A 3M7WA 1J0ZA 1EGVA 1DJGA 3JU2A 1QOPA 1TREA 4A8IA 2H8ZA 1A47A 3ABRA 4PRTA 3B0PA 5CJMA 1WZLA 3QC0A 4Z2IA 3R07C 1RZMA 2W67A 3REQB 5CPOA 2XISA 4IUGA 3GWQA 4AG0A 3FYOA 3M16A 3S3GA 4ZOHB 1I0BA 4KKXA 2X8CA 4ACYA 2V2CA 2PTDA 4F8XA 5HULA 3DI0A 2QS8A 1EJSC 3BG5A 1HJQA 4HHPA 2X40A 4J35A 2Y24A 3WD2A 4TIMA 4ZSTA 4IMFA 2C3DA 2WSPA 4QJ1A 1OFBA 3MP5A 4JTTA 2R14A 1RQBA 3GXIA 1OINA 4UFKA 1FP9A 1V59A 4DZIA 4F3HA 5C54A 5DMYA 4O13A 2VX6A 4QLJA 2V6OA 5LIUX 4JN6A 3GRSA 4IM4A 2JKAA 3CZ8A 4L1GA 3VMNA 2UWFA 4B9YA 3NSNA 3HURA 3G6LA 1N60C 3M44A 2V3BA 5FKYA 3B04A 1L6GA 1NQ6A 1IYXA 3BMXA 4IIHA 2GK1B 2A3CA 2BY1A 2ABBA 1QNQA 4WGXA 2V3FA 4R9OA 3C86A 3CUXA 4XIAA 2WPBA 5KVIA 1S2UA 3TSBA 2VX5A 3A6OA 1XX1A 2WZIA 3ZQ9A 1QPRA 3QOMA 3STCA 4A3RA 3HPSA 5A8PA 2X41A 1UG6A 2X1IA 3LBCA 3Q58A 2F38A 3ATYA 3W29A 2O4MA 3WH8A 6XIMA 3AHYA 4HTBA 4W8BA 4JTUA 2D0FA 1YDNA 4FNUA 3SBFA 4KRUA 5JBDA 3SECA 3H4KA 2OPJA 1U5HA 1GERA 1TWSA 1O66A 1XIBA 3W28A 1XLGA 2XUCA 1PWLA 3IAQA 1W5QA 5CPMA 1U1UA 2PDKA 1I0DA 3U8GA 1XXXA 3POHA 2EXOA 4RDYA 1YNPA 3WLPA 4H2CA 3H2AA 5FS7A 4QAIA 4N42A 1FO4A 1LRTA 3S46A 4Q4OA 2NVAA 3RRAA 1E71M 4S3AA 1TVLA 3NG3A 3I10A 4XG1A 2E7FA 3CH0A 4LQ1A 3WL1A 3WLMA 5JBEA 1DXFA 2WOWA 1N5XA 4ZO9A 2PWEA 1R2SA 3B4YA 1JQXA 4OV4A 5KINA 2VDIA 1OIMA 2V38A 1T7LA 3W25A 4EE9A 3WNMA 1TX2A 2RDUA 1RJQA 2RFGA 4I7UA 1MQRA 3O2LA 4DEFA 1NHPA 3ANVA 5DMMA 1PDYA 4C6EA 2XGZA 5GQBA 2A2IA 2GVJA 5DCDA 5GJNA 4GVIA 1X2GA 2FTYA 2VFGA 1HZYA 1K9EA 4ZOAA 3UFYA 3P3BA 4F0KA 4QJ5B 1EPXA 2GDUA 1PX3A 1Q8AA 1CX9A 3FVDA 4B3KA 1OCJA 1H5YA 1PWMA 1OWQA 4M0XA 4KWOA 2VCAA 1K3UA 3QHMA 3LLXA 3DOPA 1JFXA 5G5GB 3LCGA 4FXRA 1ISWA 4ZO6A 1E3XA 3KP1A 2D0GA 1O68A 4LH8A 1E5NA 5D38A 2E8ZA 3OGSA 1XRVA 2DY3A 3P6LA 2W6RA 3EX2A 3M64A 1OYCA 1KFJA 3TNOA 4GCAA 1OFAA 3H6OA 4RZBA 2C71A 1KGUA 2VRJA 4NZ1A 1ZCCA 1F4AA 3RGTA 4FXJA 3FDGA 5AVHA 3L2LA 3CL8A 2PWVA 2IKHA 3NYZA 4R33A 5EMMA 1XFCA 2BOFX 2YXOA 4I5RA 3BUVA 3VOCA 5F2LA 3PUDA 1QXLA 1NDYA 5M2FX 2CFFA 2UBPC 1Z48A 3OZMA 3E9AA 4S39A 2PUZA 1O95A 3W01A 4NKCA 4H7ZA 3SCPA 4E5TA 3DYMA 1EFZA 4OIFA 3W85A 1CB7B 1E73M 3DH7A 4WHBA 4LUTA 4GRTA 5E5CA 4TVUA 1W9UA 4H9UA 4DUOA 3LGGA 1BQGA 2D3LA 2OODA 3ISIX 2X8RA 4CKQA 4HJFA 2Q8XA 3G2GA 5C71A 3K4AA 4MPQA 3LLDA 2CC0A 3PTQA 1XSKA 2P1FA 1VIWA 2P3ZA 3NDOA 3UA3A 3UW6A 4JKLA 5BYWA 2DW6A 3TAKA 3W1QA 1UQZA 3TFXA 3T4CA 5IBXA 4AQLA 1S5MA 1DWIM 4LB4A 1C8YA 1IEWA 4WKAA 4X0NA 5MHBA 3PP7A 3NR0A 1QNRA 4I9TA 3WJSA 2ZX7A 1RVGA 5A5WA 2OZ8A 5G4WA 1XCFA 1C7SA 4E8GA 5LA2A 1RALA 1U5JA 5DY3A 3NSXA 2FFCA 3H7RA 2AQWA 4UUIA 1RCOB 3EX1A 4GNJA 1HJXA 4KESA 1CTNA 4NI8A 2ZFAA 2A3BA 4BHYA 4GO8A 4X63A 5I7GA 2HVOA 5AHMA 3GUWA 3PZVA 3Q94A 5DCEA 1LP6A 5TQLA 3QTPA 1GZJA 3B4UA 3H2CA 2C6QA 5T8GA 3H55A 1TWWA 1WDSA 1PX8A 1A0CA 1M5WA 2V30A 3N4AA 4LNCA 3W4RA 1BF6A 3O0FA 3T09A 4GVGA 1HO4A 3V5CA 4RW3A 2OOFA 3CGBA 1VZWA 4AZCB 1FFQA 1VQZA 1EF2A 2YA1A 4UOQA 4YVXA 2E28A 2ZYFA 3MZNA 3VNKA 1DVJA 3UR8A 5D05A 3N19B 4IFKA 4ZMGA 3LA4A 1ODUA 2OT0A 3ARTA 4ZQCA 4B2DA 2F8QA 3LPOA 4XSMA 2QCDA 1S38A 4PMXA 3KCOA 3FVMA 3M47A 3CHCA 4FALA 5C9ZA 4GE8A 2VENA 4CD5A 4LS2A 2C7FA 4W84A 3KCJA 5A94A 4UR8A 2E68A 3S6DA 1BSIA 4LCQA 3PR2A 3H4XA 3HRDC 4JICA 2QF8A 3KL0A 1W3JA 5EFFA 5BU6A 4HGXA 4IXXA 3H4GA 3WUEA 1F8IA 4AIOA 1U1JA 1H63A 1OB0A 3M0KA 1Q3NA 3MMUA 3V36A 4ZEPA 1W0MA 4FK9A 2VCCA 1L0PA 3LRMA 4AF0B 4HYRA 2OEMA 1LJYA 4PRRA 3RITA 3PG6A 4Y96A 1ME7A 5KZMA 2G3MA 2VOMA 4IQLA 1HO1A 2R1KA 1EDQA 3IRSA 3KHJA 1I1XA 4C6QA 2WVUA 1EP3A 4O57A 1P5BA 3ALFA 3G1YA 3QR0A 3W1NA 4AZ5A 2NXHA 4H8UA 1FCVA 1RJPA 2BTMA 2QMJA 4IMAA 2GVLA 2V5LA 3UG5A 1GG1A 3T0TA 1KBJA 4C6IA 2NQ5A 4G8TA 3I68A 2WNZA 4LVDA 3R2GA 3IK2A 3ARYA 4EXAA 1BTCA 1HGYA 2VX7A 1B5TA 1QHPA 3GG1A 1TYPA 1ISYA 2QCEA 3OLGA 5ECVA 4F48A 1OVDA 5AC6A 4LV9A 1CDGA 5D9PA 4B3ZA 4RV3A 4CQCA 2ACUA 2J9YA 2ZUWA 1NF0A 5AN7A 5BOOA 2NV1A 4YL2A 3UWVA 4HZ7A 3GNDA 1UWRA 3VE7A 4DX3A 3D6NA 3NQ7A 1ZDLA 2W4XA 2YLLA 4YCOA 5AHFA 5I3HA 1TYGA 2J13A 3S47A 3RNMA 3UJSA 2OXNA 4LYRA 1H11A 3D3FA 3KBMA 3R8RA 2PD9A 4JEJA 4O10A 3KFTA 3B03A 4UQAA 2W9MA 5AHLA 1Q85A 2HK1A 3TV8A 1ADDA 1SVDA 3QRHA 3V16A 1ISVA 4QCFA 3A4AA 3RLUA 3UU0A 2PB1A 4JQ2A 4WGHA 1UBSA 4WQ6A 3PTDA 3PB0A 1H3GA 2E6YA 3BLOA 3W1UA 2PTWA 1EC9A 2PLCA 1J12A 5JRBA 4XZMX 3MJYA 2YB1A 5G4EA 4RKAA 4M6QA 1FHVA 4RJEA 4GX8A 5JCMA 3W7DA 4FNPA 1HKMA 3RLGA 1JQVA 3RLVA 2WMIB 1B57A 3I65A 5KTLA 4I7VA 3HW2A 4A3UA 1W3TA 2QMKA 1QI0A 1NOUA 4PL2A 1XDIA 3OVPA 4WLCA 3PZIA 1TJRA 2WHKA 1G1YA 3WF1A 1W3IA 1SSDA 5HJLA 3RIKA 3M6YA 2BHUA 4ZE5A 2B0MA 4UQEA 2VELA 1PKLA 3VMPA 1XS2A 1KFKA 1I2OA 2EJAA 1I2NA 3CU2A 1IF2A 2JKEA 3NDZA 2BCPA 5U4NA 2XIIA 4HSOA 1LWIA 4D8ZA 1SO6A 1ZJHA 3VOIA 4AWEA 1W9PA 1H1NA 3VFCA 4H04A 1BKHA 7CGTA 4H6KA 4D8LA 3GC4A 1ITCA 3ZVIA 5KSWA 4FB7A 4H4ZA 4EPEC 3CV6A 4IGNA 1K4HA 1E70M 4DJFD 4AEFA 4DO4A 4O4WA 5TR3A 1Z42A 4NX0A 2ON3A 2WNQA 2QJNA 1BXBA 4QG9A 4HN4A 3WDQA 3T08A 3W2KA 3KTSA 4OECA 2PTXA 1N2VA 4MB5A 3W72A 2YVFA 2YJQA 5KZDA 1JUKA 3S1WA 4OGZA 1BWCA 7PTDA 3EA3A 3WBEA 5CGTA 1GTEA 1Q6LA 3QGVA 1NY1A 1WOAA 3FNDA 1UMLA 3R7MA 1BAGA 1XH1A 1BWLA 3WBAA 4G7FA 4WY0B 4O50A 3VDAA 5I00A 3V0TA 2DT0A 3R94A 1TR9A 4DF1A 4LW7A 3I6TA 2YLAA 5C2GA 4MUPA 4MLRA 3UZJA 4F2UA 4JIIX 2GJRA 2ZZBA 3N9RA 1QPKA 5I24A 4P8VA 3NQVA 3SSJA 5I5RA 4PA8A 3EMQA 2E77A 3A5VA 3CL6A 2VGIA 2V69A 4UNIA 4OTKA 4RW5A 4NAFA 3P93A 2DZXA 4DRSA 4U3AA 3TC3A 4PUUA 2PA6A 4JTSA 4K8EA 5FAJA 4IPNB 1GW9A 4MYXA 1UP0A 4GXWA 5F2IA 4MKNA 4JHMA 4GNVA 3UJRA 1YTEA 3ARUA 5LSMA 3UZXA 3EB3A 1VFSA 2PWFA 1O4UA 2Z1KA 5D30A 4QFUA 3BJFA 2F61A 1QK2A 2OG9A 2VP8A 3W7CA 2CLOA 1SR0A 4OHQA 1F9CA 1Z3NA 1H7PA 2EQDA 1GOXA 5LA0A 1JZ7A 1VH7A 5IRPA 1ZFJA 5AZ1A 3CIWA 1G69A 3AIEA 3QV8A 3ABSA 3HPZA 3N2OA 2IS7A 5F1VA 1RBOB 4QSFA 2FMNA 3O07A 4ERIA 3E0FA 5CLWA 1WB0A 2E5DA 5CSSA 2YXGA 4OZOA 3MBDA 3MB9A 1DHKA 3N11A 4L4LA 2BMBA 4XO7A 4MJMA 4AWUA 1UP2A 4HU3A 3V7PA 1VFMA 4ATDA 4GH1A 2PSNA 3W00A 1NAL1 3CIVA 1A5LC 4AIUA 4HZ8A 4FNQA 4LRSA 3GHRA 2O7SA 5DN1A 3B9NA 4LCRA 4A3YA 1WZAA 2RABA 2CU0A 1KCXA 5KETA 4IPLA 3P0XA 4H4VA 5J8LA 4JIQA 3PBUA 4Z0SA 3RUBL 2BSLA 3AZSA 2BY0A 5D33A 3KDOA 5FIPA 3BICA 3HG2A 3S1GA 1WDRA 1MQPA 1EA9C 3KVJA 2DV0A 4Z42C 2VZSA 4GD0A 4W8AA 1JCLA 1DWAM 3E38A 1I2RA 3IEBA 3LYEA 1X6UA 4NNBA 4U5KA 1YIXA 2B7PA 4WX2A 3OBEA 4HT3A 5F2MA 3I6EA 3NCOA 3TCSA 1E51A 4GXPA 4JIPA 3LMYA 1R2TA 5FSEC 2CEQA 4B5SA 1QATA 4IWWA 3URQA 4PMQA 4A3QA 2GRTA 3AMLA 3GNXA 1XIHA 4UCGA 3C61A 2HQMA 7ODCA 3T8LA 4ROQA 1NHRA 1JDDA 1OK4A 2GLKA 4QCEA 4IJBA 4AC7C 3TTYA 5C6MA 2XVKA 4LYKA 4GUHA 2NPXA 1UD6A 1IWAA 3ZJ7A 1IHIA 2ZA1A 4DZ5A 5AHEA 3T2PA 1XYLA 4JTLA 4KS0A 4IFOA 2QXWA 3RCYA 2VFEA 2QQ6A 2OTDA 3PM6A 3M41A 3W0KA 3ZSSA 2WC3A 1AH0A 3U2CA 2V63A 1MFUA 3W70A 2PTZA 3SRKA 1V08A 4H41A 4I90A 4EMIA 2XSXA 4J3XA 2XINA 1QCWA 5A6MA 3AXKA 4JX4A 4HZ6A 5CZKA 1TPDA 1E15A 2OLHA 1A3HA 1V6WA 3EZ4A 3SCTA 4HTYA 4YCPA 1S7MA 4ZQPA 1XRSA 5GJPA 4XX6A 4O15A 3VIKA 2QDHA 1CGXA 3W1TA 1KM2A 3I7RA 2J7BA 1VDVA 3L0NA 4CNTA 2QJJA 1GXFA 1UIOA 1C92A 4UWMA 4E4FA 4D72A 3CQKA 1UJPA 4JNYA 1GYMA 3G18A 3VI2A 4GY0A 1H7RA 2J77A 2QEZA 4UFLA 1ZJBA 1P48A 4GY1A 2TRSA 3WELA 1MUWA 5I02A 3WFZA 4RPPA 2NQ9A 3O6CA 4Z1YA 3AU6A 4GK8A 3VZZA