3RR1A

Crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
384
structure length
372
Chain Sequence
b'MVKITRLTTYRLPPRWMFLKVETDEGVTGWGEPVIEGRARTVEAAVHELSDYLIGQDPSRINDLWQTMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLGVPVYELLGGLVRDKMRTYSWVGGDRPADVIAGMKALQAGGFDHFKLNGCEEMGIIDTSRAVDAAVARVAEIRSAFGNTVEFGLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAETYARLAAHTHLPIAAGERMFSRFDFKRVLEAGGVSILQPDLSHAGGITECVKIAAMAEAYDVALAPHCPLGPIALAACLHVDFVSWNATLQEQSMELLDYVRNKADFALEGGYIRPPRLPGLGVDIDEALVIERSKEAPPVWRHADGSVAEWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative D-galactonate dehydratase
publication title Crystal structure of enolase PRK14017 from Ralstonia pickettii
rcsb
source organism Ralstonia pickettii
molecule tags Lyase
total genus 111
structure length 372
sequence length 384
chains with identical sequence B
ec nomenclature ec 4.2.1.6: Galactonate dehydratase.
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3rr1A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3rr1A01
1R0MA 3JVAA 3T4WA 3TCSA 3NO1A 3P93A 3VC6A 4KWSA 3DFHA 4JHMA 3MSYA 3ZLGA 2XH7A 3RO6A 3TQPA 4E6MA 2P88A 3NXLA 3IK4A 3VFCA 1BQGA 4GYPC 4DWDA 3I4KA 3DG3A 3GY1A 2QJJA 4KEMA 2OQHA 2DW7A 2GGIA 2GSHA 3FV9A 1MUCA 2NQLA 3DEQA 1RVKA 1TKKA 2PMQA 2PCEA 3EEZA 3UGVA 3H12A 1EC7A 3UJEA 2PP3A 3SN0A 1WUEA 1ELSA 3DGBA 4DXKA 2OPJA 1ECQA 2PTZA 3JW7A 3V4BA 1PDYA 3S5SA 4DN1A 1E9IA 1EC9A 3DG7A 1KD0A 2OO6A 3HPFA 3DERA 4A35A 4GISA 2MUCA 2GL5A 3CYJA 3R1ZA 3OZYA 5ENLA 4JN7A 4M6UA 3GC2A 3S47A 1JPDX 3Q4DA 2QVHA 3TWBA 2ONEA 3UCDA 3QTPA 4FP1A 4K2SA 1SJCA 3ZLFA 3SSZA 4HCDA 4IL2A 2O56A 3V5CA 4GGHA 4IZGA 1SJBA 4JN8A 4E4UA 3MZNA 4HN8A 2I5QA 1EBHA 1MRAA 4GYPA 4KPLA 4A6GA 2PTYA 3UJ2A 3SN1A 2PTXA 2OLAA 4A3RA 2ZC8A 3EKGA 3PWIA 2AL2B 3SBFA 2HXUA 1JDFA 2RDXA 3Q45A 3V5FA 2ZADA 3BJSA 3PWGA 3T6CA 1L8PA 3UCCA 1MNSA 3STPA 1P48A 4ZA0A 5FJUA 3UXLA 3SJNA 2PA6A 3RGTA 3R25A 3THUA 3MY9A 4J1OA 3H8AA 4Z17A 2OZ3A 4J3ZA 4DYEA 1F9CA 3IJLA 2PTWA 2GGJA 6ENLA 5IDZA 3ZLHA 2OG9A 3DIPA 2QDEA 3VDGA 1IYXA 3FVDA 1FHVA 3NZGA 3UJRA 3D46A 3RR1A 2QGYA 4EWJA 3N6JA 2PODA 3QKEA 4IHCA 3ZVIA 2OFJA 2OX4A 4IP4A 2FYMA 3H70A 4HPNA 3TJ4A 3FYYA 2PSNA 3VCNA 3TJIA 4ROPA 3D47A 3V3WA 2AL2A 3B97A 3ES8A 1EC8A 4IP5A 3QN3A 4GFIA 4HCLA 2PPGA 3PFRA 3KUMA 4H19A 3GD6A 4YWSA 4Z1YA 3MUCA 2XGZA 3K1GA 1W6TA 4H83A 4HNCA 2PS2A 3VCCA 5BOFA 1MDLA 1JPMA 2PGWA 4HNLA 1TZZA 2P0IA 2FKPA 4G8TA 4GIRA 3I6EA 3RCYA 1WUFA 2OVLA 4G7FA 4DHGA 3OTRA 3MKCA 4H2HA 1P43A 3I6TA 1KCZA 3ENLA 3OPSA 1PDZA 1TE6A 2GDQA 1MDRA 3TWAA 4MGGA 1KKOA 2OZ8A 7ENLA 4GMEA 5FJPA 1EBGA 3MWCA 4M0XA 4ENLA 3OZMA 3R0KA 4HCHA 3DFYA 3RRAA 3TW9A 2XH2A 2P8BA 3OP2A 3TOYA 2P8CA 3FXGA 1ONEA 3SQSA 1XS2A 1SJDA 3R10A 2AL1A 3ZVHB 3VA8A 4E4FA 4K8GA 3T8QA 2XSXA 3JZUA 1OEPA 4GGBA 3CAWA 3H7VA 5FJRA 2GGHA 4E8GA 2POZA 3CT2A 2QDDA 4X2PA 3IJQA 2AKMA 2CHRA 1NELA 3RITA 2GGGA 3OW1A 3DG6A 4HYRA 2OKTA 1SJAA 3VC5A 2PU1A 3N4EA 3N6HA 2GGEA 2PP1A 4DX3A 5FJTA 2P3ZA 3ES7A 3ZVHA 1DTNA 4KT2A 3P3BA 4ZCWA 2HNEA 2OZTA 1XPYA 1R6WA 4F4RA 2QQ6A 3R11A 4FI4A 2DW6A 3FCPA 3N4FA 3U9IA 4MMWA 3MQTA 3BOXA 3DDMA 4K1WA 2PGEA 3BSMA 3CK5A 1FHUA 3CXOA 3QLDA 4E5TA 3DESA 2AKZA 5FJOA 2PP0A 1BKHA 3UJSA 3UXKA 3SN4A 2XH0A 5EU9A 3IJIA 2MNRA 2HXTA 2QJNA 1YEYA 1KKRA 1JCTA 3T9PA 3P0WA 3R0UA 4MKSA 3FJ4A 5J04A 4IT1A 4IL0A 3UJFA 2XH4A 3CB3A 2OQYA 4H1ZA 1NU5A 2PU0A 2HZGA 3GO2A 3QPEA 3NFUA 3PK7A 3U4FA 5BOEA 3TTEA 2QJMA
chains in the Genus database with same CATH superfamily
5CZ0A 5HULA 4P7LA 2BGQA 1JI2A 4N6EA 3R8GA 3VDBA 2BY0A 4JTRA 1K03A 1M04A 3TXVA 4E6MA 2P88A 2YPIA 4AC7C 2FVLA 1XINA 3T1GA 2KZHA 5I23A 1P6BA 2ZE0A 4G6CA 4PUJA 4TX8A 4GJJA 4GNJA 1QHOA 4Z1AA 4IGMA 3RU8X 2Z29A 3T42A 4AY8A 2UV8G 2Y7GA 2J7CA 2IPFA 1JXJA 2VR4A 5GRTA 5LIUX 4MJMA 4ATDA 1TCDA 1V08A 1XBVA 4Q8UA 3WFZA 3KLLA 1IZJA 4GQGA 3CL7A 2WCGA 3SN0A 5I3IA 1V6VA 2I5IA 1LLWA 4PCTA 4DJEA 3ERPA 2XUCA 4H9YA 4Z1CA 3T2PA 3BCDA 4KS0A 3W7LA 3XINA 5ABTA 2WJZA 1PO9A 1QO5A 1EJUC 3F1QA 3CHVA 3EBVA 3VKJA 1T8XA 1OX6A 1KBIA 3WFLA 9XIMA 3GYEA 1UB3A 1GHRA 1QFEA 1YBQA 3OVGA 3KLKA 1VJZA 1DBTA 2ZRYA 3AHTA 4FLRA 3RFAA 3SY1A 3GXTA 3W2JA 2OOGA 2WOWA 1R9XA 1UPPA 1V3HA 3FHQA 5AHNA 1A0CA 2F5ZA 1Y0EA 1EDQA 2XFYA 4UOQA 1U5VA 3UG8A 3ID7A 4HNVA 1MXGA 3VMPA 1ME8A 3STGA 3SQPA 3VE7A 3BG3A 2VL4A 3DC8A 2FIQA 5I77A 1UG6A 4J3WA 3WQFA 1EJ7L 1EWEA 3HB9A 1XIHA 2ZX8A 5REQB 3MVTA 3GTXA 4GUGA 1BF2A 2OSXA 4OTKA 3E3HA 1GYNA 1NP0A 4C91A 1GKPA 3M0MA 1AODA 3O0HA 1I2PA 3GH4A 4EQRA 4ZA0A 4LSBA 1F05A 4XTIA 2BCPA 3NXFA 3V36A 3LADA 2CWNA 3CGTA 1F9CA 3GVWA 3LGDA 3GUGA 3LPOA 5CCZA 5IDZA 4J5NA 3UWQA 1S2AA 3ANYA 4DJDC 4V1XA 1B1YA 2FB3A 2J7HA 4UC5A 3BK0A 1KFWA 3G1DA 3UJRA 5FAJA 2CLKA 3AXMA 4IHCA 1EGZA 1X97A 1DNCA 2FYMA 3CLMA 3EB4A 1W3HA 1F4HA 3B3DA 1S7MA 3DHPA 3UY8A 4FX8A 4FLQA 4O50A 5C7HA 1NF7A 2OCZA 5KZMA 3NQFA 2C8NA 2V3DA 2QCNA 2VFDA 3WLTA 4XX6A 2ZYFA 2PPGA 2F38A 4A3YA 4I9JA 1O1HA 2Y85A 3BARA 1EBDA 3AIEA 4B2DA 2X7VA 4D9PA 3CS2A 2P50A 2O92A 3CUFA 5A6AA 1KNWA 3F5KA 3OA3A 3G0UA 4AYGA 4AFYA 5BOFA 4KKXA 5G5IA 2PGWA 2DH2A 4NILA 1GKRA 1EXBA 3V0SA 1VLIA 5HQLA 1WUFA 3OC4A 5CSSA 2D0GA 3EEGA 1XKYA 2P0OA 4EM4A 4H6QA 3OZPA 3P82A 1A3WA 3NG3A 5HR7A 1VPXA 1V7YA 2A79A 3ZWSA 4NAFB 4NKCA 1JD9A 4JKKA 3W1NA 4KRTA 1GGOA 4RPQA 1FH7A 2R1KA 3OZMA 5HAOA 4V2XA 2ZX9A 1UROA 1MVYA 1XIEA 4FR1A 5JXQA 4DBUA 5A6TC 1W32A 5D8WA 1JCJA 3W24A 3NZQA 2ATMA 1EZWA 2G5WA 1DWFM 1WZLA 3H55A 2XIQA 2Y7FA 1X1NA 3QYQA 4KFPA 3XISA 5GJMA 2WPEA 1OEPA 4GJ1A 4JTCA 2XINA 3CH9A 4CCDA 1NHRA 1MRQA 1OX4A 4AAJA 4XZMX 1B3YA 3AZTA 3BUVA 3W07A 1OGBA 4IQDA 1OFBA 4Q4KA 4DBDA 3GLCA 2V9DA 2YCJA 3LA4A 3CL8A 4M81A 2YCLB 4UTKA 1QRQA 1XC4A 3VOIA 1M9HA 1XYZA 3H4KA 1XFCA 4AISA 5FEWA 4W88A 4MYAA 3MUY1 1ZUAX 4AY1A 1H1YA 2L5HA 2ZRZA 2P3EA 3I10A 3UY7A 3PVFA 3HN3A 4N2YA 3TDFA 5ABGA 5A1AA 4RXGA 2NSOA 1QK2A 1ZAIA 3F2CA 3G6MA 1GEUA 3MI3A 4FI4A 5CZSA 3UNDA 3EA3A 4IFKB 2ZZ3A 3BJFA 4I8DA 1XDLA 3KL5A 3TYEA 4O10A 1BLIA 1EDGA 3Q94A 5BRBA 3ITOA 3ABRA 2Y5SA 4GC4A 3R43A 1QI3A 3C2FA 1ZQ5A 1RCXB 1BKHA 3WEMA 4RW5A 1EUNA 3CAKA 3PZOA 4ZB2A 3V75A 3OA5A 4L4MA 5J5RA 3AQUA 4L5ZA 3GHSA 4LUYA 4MFDA 4YLWA 5C54A 4Y9AA 4DJEC 3W7JA 4L4PA 3ARRA 4XUYA 4AMAA 2UZ9A 1LQ0A 4Y6GA 5D37A 1T7LA 4AMCA 2WZEA 2E6DA 3K13A 1ISXA 1GYLA 3OYXA 3IARA 3SAZA 2DZBA 1RA5A 1XG3A 1VPYA 4Z1BA 1IEIA 2V3EA 1W1VA 4IFOA 1GPWA 2WMHA 3FJLA 3JVAA 1RPXA 1Q6DA 2OU4A 4XO7A 1DJQA 3G2GA 3VC6A 4L4OA 4L80A 3GWQA 3SIMA 1R2RA 2ZE3A 2CU0A 1KM1A 1FY6A 3LBOA 3AZSA 5E5CA 3M0XA 2HNHA 2WP6A 4LVFA 4GH3A 1TIMA 2ZTJA 2GJRA 4M29A 5CSUA 3CTTA 4AEOA 2BB0A 1SGJA 1XLKA 4B90A 1FEBA 1YXCA 3QVQA 4PGLA 3HG2A 3UPWA 1OZQA 2OLSA 1GVEA 4P7QA 2Z1KA 2PP3A 3MB9A 4LALA 3WF4A 1ZS2A 2OPJA 1CW2A 4TU1A 1CENA 3SQMA 3LXBA 3VE9A 1WX0A 4MDOA 3AMDA 5D8ZA 2PCQA 2BTMA 2E28A 1GORA 1SU5A 1VGAA 1KV8A 4LT9A 1DJHA 4RK8A 3NGFA 4W87A 4AH7A 1WOBA 1RD6A 2MANA 3Q4DA 2Z1WA 4LV4A 1Z6KA 1H7NA 3LV5A 3BQ5A 3CEUA 4FALA 3MHFA 1VBHA 3IK2A 4N6FA 3N3MA 4L6OA 3F03K 1WV2A 3W1TA 4MSSA 1B3OA 5CKSA 1PWLA 2HISA 2R1NA 1CYGA 1R47A 4NX0A 2O4QA 4H9UA 3T2QA 3O6DA 4QAIA 4LV9A 2OEKA 2DV0A 3HPAA 1LRTA 4UFLA 3BWWA 3BOLA 3MS8A 1DWAM 2PDLA 1V97A 3LQLA 4HN8A 3TYAA 1MRAA 4ZODA 2D2OA 1LT7A 3KWXA 3QH2A 4QJ1A 2VQTA 2CLEA 2WV8A 2Z6JA 4PB3A 4AIUA 3A7AA 2ZC8A 4IISA 5C2CA 1QU4A 3VNIA 1G4EA 2ISSA 1IT8A 3TYZA 3SFWA 3A21A 1E15A 3DFQA 3TH6A 4K6AA 3WO8A 3GQYA 2XVNA 2EPNA 2PF8A 1ENUA 1L2QA 2W54A 4CD8A 4GCAA 1MNSA 3WQ8A 5LSMA 3SJNA 1KGUA 3L5AA 5ABFB 3H8AA 2CKRA 2OZ3A 1HL9A 3PG8A 1QI5A 3WY1A 5D02A 4GY1A 1X98A 1B0IA 2FZ9A 2FZNA 3WL0A 1D3HA 3UGRA 2QDEA 3TLQA 1TMQA 1CDGA 3FVDA 3W2NA 1FHVA 3NQCA 1F73A 3OIXA 4ERGA 3CWHA 1GEQA 1G67A 1E0TA 4AHPA 3C2OA 4PUMA 4HPNA 3KBJA 4F0LA 3TJ4A 1XLDA 1TV8A 4C7DA 4BFAA 1GWJA 2YL5A 2ABBA 3NM1A 3QSRA 4LYKA 5F4XA 2ZA2A 4FXJA 3TC7A 4C6IA 1ISVA 3HQ1A 4H19A 3HRDC 1TPFA 4DB7A 2GK1B 1N62C 4F2UA 3K1GA 3BG9A 1EP3A 1MZHA 4QE1A 1D8WA 5D38A 1ZAHA 4JTFA 3FG2P 2CITA 1MEHA 3DFOA 4TIMA 3FEQA 2REQB 4REQA 3OLGA 1TPDA 4XO6A 2Y70A 4LUIA 3BL3A 4LVGA 1JRCA 4XQ6A 4H2HA 3EMCA 5HWNA 1OJXA 3OPSA 4I9MA 4ONVA 1PDZA 1RP9A 3GTHA 3HPSA 2ZUMA 3QW3A 4Z0JA 4BWLA 3VD5A 2D20A 3H4XA 4GFSA 4YTUA 3R13A 4HHHA 3DKJA 2NV2A 3K4AA 4AU0A 3FKKA 4CN1A 5LZLA 4H4VA 4MNJA 2F6KA 3VKAA 4JIIX 5JU6A 1KXHA 2VCAA 4JN6A 3MI2A 4K39A 3GUWA 3N12A 4MTVA 2R1LA 3URBA 2J47A 4WY0A 2OXNA 3DFTA 1KN0A 3D3FA 4DO5A 7TIMA 1EX1A 2QPXA 2A85A 3TMQA 5HMDA 2HWGA 4EPKA 3KVMA 3L0NA 2Q02A 3IVUA 5CC6A 1IXNA 4JTQA 4UQAA 1NELA 5B7YA 4HYRA 1CECA 3N4AA 3I4EA 4B15A 3CMJA 4Z08A 1KLYA 1MMFA 4B4HA 3W9ZA 1W3TA 5C8BB 2PC4A 1DE6A 3WLOA 1UKTA 2P10A 1ZY8A 3S1WA 3VD4A 1BPLB 3VX0A 3IIPA 4D8LA 1GOIA 4DF2A 4IJCA 4DYJA 3OVPA 3WQEA 1N5WC 5BXSA 2GSJA 1KFJA 4PFHA 3OG3A 4EPDC 2YZRA 4XKMA 1HUVA 1HX0A 4QIUA 2OTDA 4LYPA 1QW7A 4K1WA 2GVJA 2IXUA 1ITCA 3BLFA 4QG8A 3AIRA 4UNLA 4LY4A 2A0NA 3W02A 4DUVA 1N63C 1O94A 3DK4A 2BHYA 4IMAA 3HG5A 1X1OA 3TMLA 3LHZA 1TO3A 3GX9A 3M0YA 1W5OA 4N02A 5H8MA 1MO9A 4PCPA 3SUWA 4C6JA 3IV3A 3TNOA 4AIOA 1S3TC 3R4IA 1SO4A 4GH1A 4AD3A 1YEYA 4GI6A 1ZJHA 3RUBL 3LLXA 3EYPA 3VIGA 4S1FA 2ABAA 1SO6A 2E8YA 1EEXA 2QPUA 3O3RA 2G3JA 3UR2A 5H6HA 3T05A 3P84A 2WMKA 2F8QA 4O0ZA 3RCNA 3ONCA 4C6MA 3PAOA 3CEPA 3RX2A 4JOMA 3PTDA 2V5CA 2H6RA 5T9CE 4H7ZA 1L6SA 2W3SA 4M3PA 4ZO8A 4O57A 1GXFA 1KLZA 3CWOX 1F2JA 2Z1XA 4WGHA 1JZ5A 5FF4A 4GRSA 4A8NA 3CYVA 1MQQA 2YYTA 3WLNA 4H41A 3MCMA 3B0PA 3GDLA 2PLKA 4H01A 2VDIA 4E0CA 4JTLA 1VHNA 3YPIA 2W62A 4JR5A 3T40A 1XH2A 3TN6A 2QAFA 3R07C 3QY7A 1QDSA 2DW7A 2EQDA 2YGYA 2VEIA 3CAVA 4LC8A 5HBFA 3KBMA 2DUZA 3MYPA 1VZWA 4YIWA 1Y5WA 5FL0A 1XRVA 1GRBA 5JCLA 4JTTA 4IIDA 1R3VA 1FHDA 4EPEC 4XIAA 3B8SA 2QIWA 3OGSA 1UC5A 2D0FA 2YBTA 3L23A 4N9DA 2E1DA 3MHUA 3LBMA 2MUCA 3CYJA 3THAA 3WJWA 3L5OA 1LL6A 3G22A 3AJXA 4TTGA 3NDYA 2WZTA 2FVKA 1PKNA 4G2DA 4GX8A 4BS0A 4P8WA 4WJEA 1J96A 1SJCA 1X7IA 3AJ7A 2YOCA 3E49A 1D8CA 2BFGA 3BICA 2X1RA 2Z2UA 5D33A 3GR4A 3N2OA 1TE1A 2Q09A 2W0UA 5EB8A 1UD2A 2W79A 5TD4A 4Z42C 2A4AA 3W87A 4A6GA 3VZZA 1KBKA 3O63A 5FF0A 3W1PA 2VR2A 7A3HA 4A3RA 3A7UA 2KX9A 4QGCA 1PKYA 2A6NA 2V5LA 3KXQA 1JYNA 2JGYA 1F8WA 2BXZA 3CMGA 2YLLA 3R8HA 3T6CA 3LV6A 3UCCA 1C91A 3WUGA 2J3NA 3FSUA 5IRPA 3S83A 2EPOA 4BWLC 1Q1RA 4FX7A 1QBAA 1VBUA 5CPTA 3R25A 3THUA 4S23A 4URIA 2VC9A 3P74A 2PTWA 2FVMA 2OG9A 5I3HA 4ZO9A 3MW7A 1UD5A 2J88A 1AQHA 3M0HA 3VO0A 4FHAA 1YE4A 1EJRC 4JGDA 4J9JA 1VR6A 3WF3A 1UKOA 8TIMA 3H2MA 3W1AA 2OT1A 3NSMA 1FDYA 2HVNA 4UCGA 2YFNA 4S3GA 3DK9A 3PFRA 5E9AA 2OWWA 1UA7A 3M0JA 3T08A 1JF5A 2VEFA 4CD4A 2Z1VA 4QR6A 4ML9A 3GDTA 1OFRA 3R2GA 4H83A 3CHEA 4JFVA 4UQDA 3E12A 3GD3A 2XISA 1XYFA 2JEQA 1TQJA 4MJ2A 3TUUA 1HG3A 4ALDA 1V0NA 1N61C 4PBGA 4KFOA 3GG1A 2HCVA 1XGZA 3RCYA 4JYFA 3LS9A 2ISFA 1WNOA 2GJXA 1U2YA 3NS1B 5JRBA 4QXIA 1AW1A 1BGGA 1JNEA 4M51A 3N14A 2QMKA 1GRAA 4YTQA 1MDRA 3QEZA 3TYUA 2WVSA 1VP5A 3UD6A 3SW6A 1FWJC 4EM3A 1B57A 2OZ8A 5CPOA 4AZ7A 5IHSA 3A3WA 3MUIA 4M0XA 4MF4A 5U1OA 4C1NA 4LY8A 3WQOA 1JUEA 2P8BA 3MU7A 4ZENA 3PZGA 1FWNA 3G77A 1XS2A 4AX7A 1XYAA 3N11A 1E1CA 3W7NA 1SJDA 1NOUA 1NSJA 1NP2A 1UIOA 4OE7A 4BHYA 1AZ2A 1YQZA 2VFFA 5D2YA 1KFKA 3WDPP 3C3NA 3ZZ1A 3AWOA 3QC3A 3C4UA 3FOKA 4ZFMA 7REQB 4O53A 3KFTA 2LLEA 1UKQA 3OO2A 2VNCA 2J7DA 2J77A 3SI9A 3EZ4A 4RV8A 2XJ7A 3E38A 2QIIA 1DTUA 2GGEA 1GTEA 3HM7A 4ZL1A 3NVVB 4WXYA 4K36A 2A7PA 1C9WA 2Q01A 1RCQA 4H9ZA 3H26A 2OYKA 2PDNA 4LAUA 5F2MA 3CZEA 1XIFA 1VYSX 3LDVA 2QKFA 2I5GA 1IEXA 2GYIA 1J0IA 1LM1A 3QXBA 2J8FA 1TPEA 5AKQA 2XZ7A 4MAZA 4UB9A 1EP2A 5L6UA 3OYZA 4MY1A 4MB1A 4OV9A 3M0LA 3BSMA 4YL2A 5AOUA 3W72A 3WNOA 4E3VA 4J3UA 3BQ6A 3EGJA 4E5TA 3UFYA 2WLYA 1HW6A 1KRAC 3BTNA 3W2MA 4H4QA 3GVQA 4L7ZA 1XLJA 1JD7A 3W75A 1A0DA 3IIOA 1BG4A 2DZTA 1GOXA 2W92A 3F2DA 2J66A 3UR5A 3AXIA 5FOOA 3QPZA 1NF0A 4JIRA 3SR6B 1VCGA 3WQVA 2JALA 3GBEA 1LUCB 1ODZA 3BPWA 4L4LA 2C18A 3OGRA 2HRWA 3A64A 3UYIA 3ALGA 3MUXA 3GO2A 5HPOA 3NFUA 2PBOA 2F61A 4IPPA 2PDUA 3QF0A 1F61A 3EDFA 3T55A 3WMCA 3O05A 1I1XA 1SZRA 1UWTA 2NSXA 4J27A 1GHSA 4UOZA 4ADWA 1LQAA 3B8IA 4LUTB 5DX7A 5LHEA 5A6LA 1GZ1A 5FS7A 1PVNA 3HMCA 3BAIA 4O8AA 4CNPA 2PDCA 3O07A 1QHPA 5CZJA 3WENA 2ZTKA 3HQNA 4XSLA 3M46A 1DIEA 2Y8UA 4HHLA 3P6LA 1E72M 3KCLA 3DEQA 4D6EA 4RZ4A 3KS5A 1KCXA 3HGOA 1HJXA 1GG1A 4O12A 3TAOA 3WBXA 5I78A 1DE5A 2W0HA 2H8ZA 3DGZA 4B16A 3DGBA 2WC3A 2X8HA 3FN9A 3LB8A 4H4ZA 1F5ZA 1H61A 4S3DA 2FJUB 5M03A 4M24A 4DN1A 1EB3A 2OZ0A 3TSMA 5C2GA 2I9UA 3WK0A 5I5RA 5DCDA 3VKKA 3CUXA 2BX7A 5H91A 5MHBA 4RE0A 4X63A 1WXYA 2W27A 3SY8A 3SUVA 1ZBWA 3W70A 5HNTA 3ITYA 1JROA 4JDRA 4WY0B 4YCPA 3W0KA 1SFTA 4MNLA 1M7PA 1RAKA 1XH0A 4H4PA 1DHPA 1FDZA 4JTUA 1TYGA 2PD5A 1W8SA 5C0QA 3NVYB 4U31A 3EF6A 3S6TA 4DO4A 1OM0A 3HA1A 5FS8A 1QJWA 3GXDA 1EJWC 2X1UA 3SCQA 1AOGA 3QTGA 2OOFA 2AL2B 4GK8A 4D6JA 4TVCA 5D9OA 4R3UA 1HIZA 4X61A 1JXKA 5FACA 1TV5A 4XIMA 1K9DA 1K6WA 1QOPA 1GRHA 5JBFA 1AQ0A 1E9ZB 4DJDD 4W86A 2G3NA 2DIKA 2CLMA 5K9DA 2HVMA 3M0KA 3FYPA 3QQWA 1OQFA 4C6QA 3VABA 3N6JA 3DFSA 4O16A 5HQEA 2WVUA 5E1QA 2ZZ2A 1PTDA 4WR3A 4I9AA 2X09A 1DWHM 2SFPA 3NVWB 5G1MA 4ECLA 1OIFA 3A13A 3AN1A 1J9YA 1O60A 2WVVB 4C6LA 5FEZA 3KOYA 2WSPA 3FAWA 2G41A 4MPQA 1FWDC 2X2YA 4MB4A 1WDWA 3PUOA 1DWJM 4M5PA 3MVIA 1JGMA 1BYCA 5CJNA 4XBSA 2GOUA 3M4HA 4DZ5A 1WDRA 5DXYA 3G5EA 5H8UA 1N7KA 1UP2A 1E1FA 5BMWA 3NSXA 4HNLA 4AF0B 4ATLA 2X99A 1ZP4A 4MPKA 4XZ9A 4X9SA 4PN2A 3NVTA 4H8HA 3E9AA 4HOXA 1TX2A 4RDVA 1HQTA 1V59A 7TAAA 3EOEA 5C5YA 3Q6JA 2Q8LA 1Z48A 2VDHA 3O06A 4HTBA 1EZ2A 1O12A 3VIOA 1FH9A 3S3GA 2YR1A 4JXCA 5KSWA 1RXOB 1F3TA 5DEZA 3A4XA 2GR2A 1BG9A 2QAEA 4F0KA 4JCLA 4LEFA 1J5TA 1BVNP 3UXIA 2DQWA 1QNSA 3T44A 1QNPA 3UERA 2Z2BA 4K37A 2XSXA 1MFVA 4C6CA 1XDIA 5H2ZA 1QW8A 5FCZA 1TV2A 2PAJA 1UD4A 4US5D 1V8EA 3LMZA 3K8KA 1EFZA 4B91A 4CLMA 3QV7A 1ZJBA 4L1GA 1TTPA 1FWRA 1P0DA 2HJPA 3VC5A 1FWHC 1SSGA 1PSCA 1H41A 1BGAA 4YYFA 3E2RA 2EQ6A 1XQKA 4GG9A 3HPXA 3VAVA 4NEVA 1KW1A 2VCCA 3A4WA 4I5RA 3GNNA 5MF5A 3P62A 4JHOA 4LRSA 4H8VA 1E6PA 2XFWA 1KM0A 2WP5A 4RDYA 1XUZA 1JOAA 3O15A 3FGCA 2BASA 4D6IA 1TZ7A 2WCSA 3S2NA 1VFSA 2OODA 4GCXA 2D3LA 5F2GA 2RH9A 4V1YA 3G24A 3JR2A 2G0WA 4OKDA 2NVDA 1QPOA 2FZ8A 4US6A 2AGKA 8XIMA 1MW2A 2D3NA 2ZXQA 4RJEA 2IUZA 3LRMA 4AWUA 2PURA 3FKRA 3PUGA 4FSAA 2RHGA 1QMLA 1IF2A 3W27A 3F5JA 3K2GA 2QJGA 4DY1A 1FWBC 3UXKA 3WQDA 4U28A 3AIWA 3RU6A 4C6DA 3NYDA 3G0SA 4DJED 5CGTA 4GINA 4OFCA 3AYVA 4HKPA 3TR2A 4KEZA 5I6SA 1XCWA 3LSBA 1JCTA 3T9PA 1O7AA 3UJFA 2CETA 3WH8A 4G7EA 2XH4A 2DQXA 2C6QA 1NU5A 4UMAA 1OFAA 2PRMA 1ADSA 3CZGA 1YLVA 5D09A 4IJBA 3VUPA 2UBPC 4CN4A 2QCEA 3BW2A 4ZOEA 2E3ZA 4PMQA 2ZDRA 5SWUA 1R0MA 4UTJA 3P93A 4RXFA 1HJVA 1UWIA 1HVXA 1V3IA 5AN7A 3H7UA 2J24A 2ALRA 4GQRA 4NQ1A 1EQPA 1GVFA 1DWGM 1ME7A 5EBKA 3T0CA 3F4VA 4ZBCA 3WF2A 4Y2WA 4AXNA 1M7OA 1P5BA 4NAEA 4IM4A 4LB3A 1QT1A 4GI8A 5AHIA 4BCEA 3IUIA 3MPGA 3RLVA 4XZWA 3S6OA 1BAGA 2X40A 1VD6A 2FPYA 1BRLA 4Q8QA 4W85A 1JQVA 4J56A 1W5MA 1UJPA 3W1QA 3T8LA 3UJEA 1IHIA 3V7PA 3VNJA 3UWEA 3M5VA 4DXKA 5EMMA 3B40A 4C6NA 3VZXA 1CLVA 4LUSB 4PTVA 1PDYA 3O0KA 2BHZA 2JKPA 3WQ4A 2ZZ6A 3N29A 3TR9A 3QV8A 1FDJA 2ZRWA 1JFHA 2BODX 4KCVA 1JCLA 3VD9A 4YMZA 2DU2A 4KEVA 1QPNA 2PDKA 1JPDX 4DBEA 1EPVA 1KBJA 3D6NA 4H00A 4WLCA 4S2CA 5C55A 5I3KA 2NWRA 1XFBA 4OU1A 2PFHA 3NQDA 1XRFA 3GIYA 4B9ZA 4B92A 1J6PA 3ZLFA 1IE7C 4B2DD 1AVAA 1FTXA 1DJGA 4Z2IA 2E67A 3V5CA 3W7KA 3NZ1A 1AL8A 5C9XA 4FR6A 2QCFA 1QWKA 3QOMA 1EO7A 2BLEA 3UJ2A 1FKXA 4H4TA 4GUIA 1QXLA 3GTFA 4JFWA 3TSDA 2YW3A 5CJ5A 3NURA 3MMTA 1MWOA 1REQA 2QEZA 3FA5A 1GONA 3MP5A 4Q8VA 1LG2A 1EWDA 1XUUA 3CL6A 3VOCA 1XWYA 4GUHA 1P0EA 2EEXA 3ZT5A 2FDMA 3A4AA 1TELA 5ABEA 1V6XA 5D2XA 4HMCA 4LYQA 4RW3A 4LPCA 1H6VA 1XGDA 2BHUA 5A6BD 3OODA 3BLDA 4RL3A 1Q8AA 5D04C 5BMXA 3QKEA 1H7OA 1QBBA 3PFMA 4WVXA 5HNRA 3RJYA 1H7XA 4H4SA 2PSNA 4KIRA 3TJIA 3D47A 2WWCA 5LYRA 3FFSA 4L9YA 3TROA 5JCIA 1R3WA 4Q4OA 3ES8A 1EC8A 1R8LA 1W9PA 4GFIA 1J2BA 1J0JA 3Q58A 1LCOA 1WBJA 4GYJA 4B3ZA 3CV6A 4KCTA 2VI0A 1W1IE 4NF7A 4XD3A 1UUQA 3TK7A 4KW2A 3VGBA 5CZTA 1TB3A 4R9XA 4LRTA 3NEHA 2NQ9A 3II4A 3NPWA 3CU2A 1GSNA 2XM1A 3TSBA 1KBLA 4MKNA 2CDUA 2XIIA 3AMKA 3NO3A 1GOKA 3I6EA 1QWGA 3UZWA 3VKDA 3VGFA 2OLHA 2EXOA 3EMQA 3I6TA 3U7BA 2Y0FA 4IOTA 1PZ2A 4NJKA 4MJ4A 3CHFA 2GDQA 3QRHA 3TX9A 4A3UA 1XANA 1HO4A 3B06A 4MWAB 4F66A 4FPSA 1GVIA 2C1HA 4RZ5A 2Y88A 4AD2A 3LCIA 3V0TA 1OF6A 5F1UA 3ZR5A 4CUCA 4PB4A 3HTWA 3DHDA 3CUGA 2V2CA 3GU9A 4E4FA 4K8GA 1A49A 3H21A 3DJJA 4GGBA 4GUFA 1SM9A 2JK2A 1MSSA 1EGMA 3EKZA 3TQ0A 7PTDA 1LTDA 2QUNA 4HJWA 5HQMA 4UTFA 1FCQA 3ZM8A 2AKMA 2CHRA 3OBKA 4AX6A 1SZEA 3VGHA 3I7RA 3LNMA 4DUWA 1H5VA 3C0LA 4H4UA 3DX5A 2VZUA 1G4PA 2YCEA 4E38A 3VGGA 1FCBA 1AJ2A 4B5SA 4IMCA 3CXBA 4NZ4A 3TTQA 4WJXA 3QV9A 4DWSA 2FGLA 5HXMA 2VC7A 1VB9A 1LRQA 3PZVA 4R7WA 3EKLA 4GBDA 2WYSA 4FS9A 4N4QA 2NXGA 2A6LA 3CIXA 4CVUA 2QJHA 2Y8VA 4QBXA 1EP1A 3MV01 3WK2A 3AYRA 4C1KA 3VINA 4CQDA 1BXNA 4UFHA 3RN6A 4Q8OA 3UPMA 1UBSA 1OK4A 3HQPA 3CZJA 4O1FA 1JVNA 1V3JA 3CXOA 4LWWA 2QCDA 2PF0A 2WM0A 2D23A 1OB0A 1WXJA 2AKZA 1V3KA 2HQAA 1UPMB 3DCPA 3APTA 1PXGA 4JTEA 2VZSA 1XPGA 4LNCA 1L0PA 4JPGA 4KWUA 2J62A 4MNMA 3REQA 3SCVA 3AUOA 1GJUA 3R0UA 1JJKA 4KEUA 5J04A 4J7RA 4TQTA 1T0OA 1Q6EA 1WZMA 3OQ8A 4UTLA 2I7GA 4PTXA 3T78A 2CLPA 1IR2A 2HZGA 4AD1A 4UOJA 4WUIA 5HMEA 4W8AA 1GOMA 1V7AA 1BVZA 2E25A 2VX5A 3MJMA 4CD7A 2FTYA 1O5RA 1EUAA 3CM4A 3TZNA 4FX9A 2CLIA 4C7GA 3T4WA 4R85A 5KVHA 3WLLA 3DFHA 1R7AA 1HJQA 1ZJAA 4NVTA 2XH7A 3RM4A 1B3XA 3DN5A 4ZZ9A 2DZUA 1P1XA 4YVVA 2AQVA 3DFPA 5FJIA 4CD5A 4M6QA 3GY1A 2BWGA 3HV8A 1WDSA 2OQHA 1J8VA 3FV9A 4QDPA 2TODA 4PMDA 3TP4A 4PMOA 1P7TA 3NQ2A 1IXOA 4O19A 4AZBA 3V35A 4PUUA 1E4MM 3KLJA 3TQVA 3LTPA 4FNRA 3WDIA 2G97A 1GVRA 3GH7A 2BC1A 2J8GA 1ECQA 2XIJA 3BCJA 4D6HA 4BR1A 4WKHA 3AMCA 1O68A 2HPMA 4V27A 5CPSA 1LZOA 1DJWA 5LNRA 4TR9A 1ICPA 4TOQA 4WDXA 4MZYA 3A5FA 1Y5VA 1VFLA 2Y6ZA 4C6PA 3N34A 1R3TA 3PULA 3IIXA 4PEKA 5CPMA 2X50A 2VGFA 1FFUC 5JMUA 4U2YA 1R3SA 3JRKA 4PUNA 4FP1A 2GLKA 4ZXOA 3P8IA 1XKJA 1C29A 2X42A 5EA9A 5C9RA 1OX5A 3BLKA 4EWND 5D30A 5F2LA 2JF6A 5AVNA 1CGVA 4N9BA 3CGDA 2DDXA 3BSHA 1BQCA 1NHSA 1H1ZA 3SN1A 1NJJA 4UQ9A 3IGHX 4TX6A 3U2CA 1F6YA 2OLAA 3FY1A 1H50A 4WQ6A 4ML4A 3ITCA 3PB2A 2ISVA 1RPKA 2B7OA 3KDNA 2ZUVA 5LKYA 2CXEA 5CSYA 3DBNA 3DYMA 3OEXA 3FEMA 4I5XA 1P48A 4EP8C 1BF6A 2RGLA 2UY3A 1Z7AA 4FX6M 1Y7VA 3RM9A 4J1OA 4HNNA 3AS2A 6ENLA 2G3IA 4RCXA 2OGYA 3BG5A 3VDGA 5E6ZA 4K7VA 3IAPA 3W22A 4BKNA 1VFFA 3O16A 1RBLA 4GLEA 2CZFA 2OFJA 2PDFA 3N6QA 5HANA 3W82A 2FFIA 4K7YA 2EKGA 1CLXA 3OHMB 1J93A 2QCLA 3ZJ6A 3SCSA 5REQA 2IPGA 4LH8A 2WJFA 2WNZA 1BXBA 3B0YA 2RDUA 3LG3A 1Q7MA 3VPLA 3RMEA 4N7QA 3DI1A 5K7JA 2ZOXA 1KGWA 1NM9A 1X6LA 3OLIA 1G7UA 4G7EB 2GQ8A 1UKSA 1KTNA 3PBVA 3UG4A 3VX1A 3W7OA 8A3HA 4DPQA 1IT0A 2VR5A 3RMJA 4Q4RA 3RXZA 2QF8A 2WHKA 4JKLA 3KTSA 3OJGA 1VLWA 1EKOA 1TQXA 1PIGA 3WJZA 3VNMA 3PZQA 3MCOA 4KRUA 4EXAA 1LOQA 2VEGA 2RKXA 4EMWA 1FP8A 3LCFA 3AMLA 3MHGA 3GNOA 4R9OA 1PX4A 1FH8A 4TX9A 1U30A 2HMCA 1CGTA 1FHLA 1EIXA 4ZOCA 1FA2A 1XL9A 5LXXA 2V5BA 2ZZ0A 4GXPA 4C6FA 1UBPC 3FDGA 4PYSA 3TW9A 1W1B1 2Z27A 2P8CA 4OOZA 2G50A 3U48A 1LWIA 3SQSA 3ARPA 3F4NA 3GXFA 1HTIA 3PN8A 3TEVA 2WMIB 3GD4A 5IHRA 5BU6A 5AFDA 3H7VA 2WZHA 4YHGA 1BHGA 4LANA 4PUWA 1KTBA 3PPCA 1S1PA 2JGQA 1W1ZA 4NAFA 1OABA 3MWAA 3EWZA 4XZHA 3N6HA 4PL2A 5ECVA 3WD4A 2WMGA 4EPBC 1C92A 3A22A 7XIMA 5AECA 2HQMA 4AZ5A 3KBVA 5HMSA 3PG6A 4A3HA 3NQBA 3OLDA 3SCRA 3DK8A 4GO8A 1BKSA 3GNDA 1AQFA 1HJUA 4B5NA 1YKWA 2TPRA 1IGSA 4WEVX 2ZUUA 3GNXA 3O2LA 4JX6A 4Y90A 2H3DA 2A3LA 3W37A 3O6YX 4KWWA 1QOQA 2PDBA 3U9IA 5BRPA 4MMWA 3GTIA 2VTFA 1MEIA 3L65A 1YPXA 3WQ6A 2C3ZA 4P8VA 4RNJA 1NDWA 4FNQA 1GRFA 2XGIA 2YCLA 3RR4A 1A3XA 2Y61A 4MKVA 1HVQA 4ZQMA 3WK1A 5FJOA 1UJQA 1S46A 2CLHA 2PDXA 1ZU8A 1YDNA 5BU9A 1ZRQA 4CCEA 1WCGA 2WSQA 3KCOA 3HGSA 4WZHA 1ZL1A 2V6OA 1E0UA 4NEWA 2A21A 1C7SA 2DSUA 1ZBCA 3RPMA 2NUXA 4G1NA 1QPQA 3B4YA 2WQPA 3QFEA 3A47A 3P0WA 2DFAA 2A2IA 2BNJA 5ABHA 3W1MA 3I65A 4CQCA 4N0RA 3UVIA 1E55A 2C3CA 2OQYA 2C71A 4IFKA 3R12A 5GNZA 4HSNA 4AZ6A 2YCKX 2PU0A 1S5NA 1N82A 1X8CA 1U22A 1XC6A 1JI1A 4HD5A 1JRPA 1JZ7A 3WH6A 2ZVIA 3BJTA 2WBAA 2VM8A 3TCSA 2EQ9A 4ORMA 1XHCA 1OCQA 3VKCA 2GWNA 4LQ1A 4B5XA 4XK2A 1V4YA 4A8LA 3AIVA 3IV8A 3W53A 2FB2A 4AWEA 4TMBA 4EQXA 4EAMA 4B9YA 4NNCA 3U7VA 1DQXA 1BQGA 4QG9A 4LS0A 3DG3A 1STZA 3PNUA 4CU7A 2FZDA 3VCRA 4NZ1A 4KEMA 2HPIA 5AHLA 2PTDA 3O9NA 3NZPA 1T6MA 4O1CA 4ZQPA 4MHBA 4LC6A 3CMFA 4HPJA 3L8KA 4PEEA 1EJXC 3UZYA 1ZALA 4FNTA 1A53A 1U83A 1EC7A 1E71M 4MM1A 1WUEA 3IVTA 1EL3A 1NVMA 3SCPA 3NO5A 3W74A 1UH4A 3H2EA 5IXEA 4A4AA 3PSWA 1DJZA 4I3GA 4KCUA 3GXMA 3G3MA 3AYTA 4TMCA 1YXYA 3D5HA 1GVSA 3EX2A 4O1BA 1B3VA 3ORWA 2YSWA 2ZWYA 4OWGA 5HUOA 4PR4A 5K9CA 3WLJA 3PG9A 5KETA 2Z1SA 1MI3A 1SZGA 2NX9A 3BE7A 1KFLA 4AD5A 3NPUA 3VI2A 1NDZA 4JTJA 4GO9A 2FGBA 2X05A 1S39A 1WBHA 2O56A 2PDGA 2NXHA 3MA8A 4S39A 3UXDA 3E0LA 3PZIA 3IC9A 1UZ4A 2NV9A 4CU6A 1VEMA 4GYPA 5CEWA 4KPLA 2D73A 1E9YB 4WX2A 4FF5A 2DEPA 4HPHA 3LXAA 1W3JA 4JTAA 3ECQA 3T09A 1YIXA 1F07A 1R9ZA 4UTTA 3JU2A 3QMTA 1UR3M 3AS0A 2R24A 3L21A 3LQGA 1P1MA 4IQEA 3ITXA 5MKGB 4JY8A 3V5FA 1Q4WA 1CWYA 1XICA 4XVDA 4W7WA 1EF2A 3EOUA 4QNEA 2XZ9A 3STPA 2YB1A 1IWAA 1YW1A 1UZHA 4HNTA 1GRGA 4RZBA 2Z26A 3UA3A 4UIOA 5CQ1A 2GGJA 2J78A 1P6CA 5E93A 4O1EA 2D2GA 2O9PA 4ZOHB 4X2RA 4BZYA 1L6FA 3WLPA 2FHFA 3ISIX 3ABSA 3LENA 2E9BA 3G1AA 3NVDA 4IP5A 4JIPA 4MWAE 3FIGA 1C8VA 4AQLA 3GD6A 4YWSA 4AD4A 2B7NA 2R14A 4PMZA 3PJWA 2PGFA 5CC7A 1XRTA 5ABFA 1AH4A 2NUYA 2DT0A 4LOCA 3W7PA 1T8QA 4EE9A 4HPXA 3BO9A 4KGJA 1JPMA 3PBYA 3ZFHA 5D32A 3LI1A 2XIBA 1OFQA 5D03A 1TR1A 2B31A 2P0IA 3KL0A 2NPXA 3IPWA 3VYLA 3CQKA 2QMJA 4NZJA 4L65A 3D0CA 3LCHA 2IQTA 4MNKA 2ZKMX 3IVSA 1WKEA 3SFKA 4GNVA 3QR3A 1I0DA 3L68A 1GOQA 3U4AA 4FDCB 3GG8A 5DY3A 1KXQA 2AMGA 4D6FA 2EQ8A 1QI4A 1UH2A 1WZKA 2GK1A 2O4MA 5DO8A 2HDJA 4UFMA 1PIFA 4LFYA 3TOYA 1LROA 4WOQA 5DXXA 1TRDA 2WMJA 4Y8FA 2REQA 3BGJA 4DUXA 1F3XA 3GFYA 4XV0A 3CWNA 4ZMGA 3LY0A 1QUMA 2G37A 1W2PA 2EO7A 5FJRA 1WQ5A 1YMYA 3AFBA 3H7RA 1YPIA 3B8WA 2ISWA 1GZGA 4HA4A 1JRBA 1L6YA 2WSKA 1QI2A 3IJQA 3F4WA 1G4SA 4QJ4B 5M1TA 1OINA 1X38A 4X22A 4QCEA 4OJYA 3VNYA 3GNRA 1BSIA 2Y7EA 4GKLA 1W37A 1J0ZA 3N4EA 3THQA 4DX3A 4LS2A 2XTKA 1ZX9A 3C0SA 2BOGX 3UXAA 6XIAA 5CH9A 3RM8A 5EY5A 2V5KA 3TZFA 2DUXA 1FWEC 4LB4A 2HNEA 4Z0SA 2XVLA 2FPTA 2CWXA 1ZMCA 4S3KA 3H2CA 1DPMA 1PL9A 4DJFA 3EDEA 3T07A 1WDDA 4HSHA 4UBPC 3RLUA 5DELA 5AC7A 2ZQ0A 3N2MA 4LBSA 2PGEA 2Z28A 1BTMA 1DP0A 1MUWA 3W25A 3IACA 1K9FA 2ZCGA 4O17A 4ADUA 4ERIA 1LWHA 5KVIA 3ME3A 3H4GA 1DIDA 1PHQA 3HJZA 4XZIA 2YX0A 3GDRA 3VMNA 2Y1HA 1OFOA 1XYBA 1Q6GA 1US2A 5JCNA 1VRDA 3GVGA 3HZ3A 2VWTA 1TWWA 1I2OA 4YTSA 2B7QA 3GH5A 2WANA 3U5UA 3RILA 3B8VA 4CQ8A 3LBCA 3WBYA 2VEMA 4HNUA 1AH3A 3B9AA 1B4KA 3RPDA 1H60A 2CESA 1F3EA 4QQUA 1R46A 5KINA 5HK4A 3CPGA 2YVJA 1ZDLA 3ETRB 3BW4A 4GE8A 4OBSA 5AHMA 2DY3A 1ZHAA 1WDPA 2QCMA 4I7VA 5EBAA 5LIKX 4IX2A 4KWSA 4Y7EA 4NUWA 4L56A 3FDKA 3S1VA 1WOAA 4OBRA 2VRJA 2ACQA 3MV11 5RUBA 1Y5XA 2AAMA 1Z9AA 5HR6A 2WNWA 1XCXA 2I17A 4AZIA 3MDUA 4GYPC 2XN2A 5A8MA 4Q4PA 1FXPA 5FEPA 3GFXA 2VGBA 1VFOA 1Q6QA 4JZ5A 1TJPA 1MUCA 3P61A 3NGJA 2OEJA 1GVOA 1RBOB 4I7WA 3EX4A 2AOSA 3A6OA 1MO0A 3AU6A 4DYKA 3EEZA 1ZGDA 3S2CA 2RUSA 4FOJA 2FJKA 4NI3A 5E6YA 4EF8A 4UWMA 1BXCA 3CNYA 3MANA 3WNKA 2JKAA 1P6WA 4UXDA 1TG7A 1GT8A 4ADSA 1TWZA 5KMYA 2DZSA 1X8FA 3NQGA 2OX1A 3DG7A 1MQRA 5FSDC 3R0DA 1RUSA 5BXTA 1A50A 1V0LA 4E2BA 3MSGA 1VAHA 5DMYA 4DELA 2DVXA 5D2VA 2QUUA 2YBUA 3A5VA 4IG2B 4C6KA 1C3FA 3N9SA 4BI6A 3MCNA 1GESA 4IL2A 5LNUA 2JFEX 3NQVA 3VTRA 1NIUA 3WELA 3QFBA 3MMWA 3URAA 1OD0A 4RNIA 2VUNA 3MBDA 4HB7A 8CGTA 1XLGA 3FVMA 2H9AB 1F7BA 2XN0A 2Y62A 3GVVA 3UVAA 1R9YA 3N1AA 5E0CA 1FX6A 2PDMA 2HXUA 3ITLA 1UQZA 3QW4B 3KHDA 4RUBA 5HATA 4NJJA 3Q2DA 2Y4SA 1N60C 3QY6A 3K8MA 2PWFA 3I6RA 3LPPA 1P4CA 3UXLA 2VVSA 1E73M 3FA4A 3UG3A 5CC5A 2NVKX 4K38A 3POCA 2ZZBA 1PCWA 4CGTA 4DBWA 3QGVA 3PUDA 3RX3A 3USBA 2VOTA 3P5ZA 3DC0A 4WKAA 1E70M 3IRSA 1YTDA 3K4WA 2X0SA 5E70A 4IUGA 2PI6A 5D9NA 4D6GA 4CNTA 4O52A 2XYLA 1JEZA 2CLFA 2XWEA 4RKAA 5H1WA 1CB2A 2VHLA 1NARA 3VKBA 2BVDA 4PMYA 2POTA 2EPHA 4FIRA 3QGAC 1K4GA 5DFAA 1V79A 5A8QA 2O9RA 4UQBA 9RUBA 3W6MA 3GVRA 1PAMA 5IFTA 3Q65A 1G0CA 5LGXA 1MDLA 4IGHA 3SADA 4H4IA 4TV5A 4IGNA 4L61A 1JAEA 1TZZA 3CBWA 4PCSA 4G7FA 5FAGA 3C0JA 4R7JA 2A5HA 3NDZA 3CJPA 4C5ZA 5I2UA 1HXJA 3N17A 2V3GA 5CZKA 5A95A 2D1ZA 2F9RA 1BZLA 3ZIZA 1TPUA 5EL1A 1E5NA 3K8LA 2ZRUA 4DJFC 3OHIA 5I3DA 2V63A 3STFA 2CLLA 1UD3A 4ZQOA 5I3FA 3MSRA 4B3LA 4U2ZA 1E3XA 3A4JA 3W2UA 4AHQA 4UTIA 4AY7A 4OT7A 3VUSA 3FHAA 4JIQA 5G1TA 4LAMA 4HA0A 1ONWA 1OK6A 3EB3A 3KVJA 1KFBA 1W31A 1EJVC 3GG0A 4RZ6A 1S2VA 2R6OA 2QPSA 3MMDA 3N2XA 1FWGC 3R79A 3MI6A 5DCEA 4A2SA 3ABOA 1GPFA 2CZVA 3TN3A 4NXKA 1XIJA 3DG6A 4JTHA 2GRTA 4O4WA 4GRTA 1SJAA 4MB3A 3KOWA 3SUTA 1RBAA 4XUGA 1PTGA 4JL1A 2ZC1A 4ZOAA 1A5AA 4MUPA 1H4PA 3EB2A 4JHZA 1TVPA 1A5NC 4H6RA 1K1DA 1DXLA 2A7RA 5A6SA 3BV4A 1G5AA 4QEEA 3UQNA 5CLTA 1PX8A 3P3BA 3WQCA 3PBWA 3TIMA 3VDCA 4F0HA 2J7EA 1R6WA 3AZRA 3TA6A 4F4RA 4KBXA 1TTQA 3TKFA 1H51A 7REQA 1J11A 2FLIA 1LP6A 1Q8JA 2J75A 1AW5A 1OY0A 3AHYA 3TXZA 4IQJA 3O6AA 2E9MA 1DXEA 4HP5A 3LRKA 1RP8A 4RPPA 3FX4A 4DAIA 2E6YA 3T0BA 1DXIA 3WJXA 4TVDA 5FL1A 1XJBA 3KBSA 1VCVA 3KOFA 5DCBA 2O9OA 4U33A 3LHTA 1OYAA 4GACA 4JIEA 5HWMA 3EXSA 1OG6A 4MDPA 1QK0A 5CGQA 1FWFC 3W2KA 4AB4A 1ZCOA 5T8GA 3W01A 3VD7A 1F4AA 2E68A 4XB3A 1S2UA 1HJSA 3KTCA 3KBNA 5AYYA 4YS1A 3NJ3A 3MUZ1 4PCNA 3ZT6A 4BF7A 1BWKA 4UTMA 4J2PA 2ZXBA 2PGRA 4D71A 1YQ2A 5BWFA 2G4FA 4F3HA 6TAAA 4M80A 1ZNNA 3H2NA 3ONBA 3SCUA 4J3SA 4GKTA 4HHMA 1XGEA 4JHMA 1PZ3A 3L4UA 3ZLGA 3LPGA 3O1NA 1M3UA 5AYIA 4XAYA 1H7PA 3C8FA 4O28A 1E6SM 3NQ6A 1A0EA 4GQ0A 1XLLA 3Q67A 1Q65A 3A3HA 1EIBA 2QJJA 3DHUA 4PBEA 2GPTA 1LUCA 2I16A 3M0ZA 1KFCA 4M8UA 3LHUA 4ICNA 1DJIA 3WDRA 4QSHA 1H2JA 1OYBA 4PB5A 1I8JA 1P0KA 4H3DA 3R94A 2CHOA 5I0DA 2HSAA 1JCYA 1H7RA 1J79A 2WVTA 3WF0A 1RM6B 2V3AA 4CEXC 1ALDA 4LUTA 2GDUA 1XIIA 2GJPA 3HOJA 3VOFA 4INFA 1H63A 4POCA 3TJXA 4DI9A 1KD0A 3HPFA 1X39A 5CC3A 1JF6A 5AC5A 1A47A 1DWIM 1M03A 1HKIA 4M6UA 3GC2A 1CCWB 1US3A 2Y2WA 4QJ5B 4B5UA 2R91A 3W1UA 4JD4A 4LVDA 3KS6A 1A4LA 4K2SA 1LYXA 1UR4A 3NUKA 1LL7A 4AZCB 1OCJA 2Y8KA 5C71A 2OSYA 1PYFA 4UMBA 5U4NA 1HKVA 1KTCA 1SJBA 1PX3A 3BZJA 2JIWA 4V33A 1RQBA 2I5QA 1S2TA 2ZRXA 3AHVA 2QT3A 1OCBA 2A3BA 4ACZB 1YNYA 3SRKA 1I60A 4EF9A 4Z2KA 2PLMA 4NG3A 2FMNA 2ZA1A 1H5YA 2YBVA 1ZCCA 5AZ0A 4IPNB 4JQ1A 3EPOA 3MP3A 3FW6A 1WO2A 1TZ9A 5LNVA 1L8PA 2C7FA 3WN6A 1ZPTA 1E0WA 3LZ5A 3LMYA 4TXEA 1P0BA 3V1HA 4DIAA 3FLUA 2E4TA 3WMBA 3KW3A 3MDWA 3S5OA 9CGTA 1VJIA 3F5LA 1TIWA 1YDVA 1GQKA 5G1YA 3PY2A 1YYAA 3WX7A 4O1AA 4Q22A 1Q3NA 2ADAA 1K7EA 2QCCA 4IP4A 1NTHA 1PE1A 4K68A 3AC0A 3CUHA 2J8TA 3V3WA 4GVHA 3QR0A 2AL2A 1Q7QA 4JTGA 3E74A 3M07A 4QTGA 1CPUA 1ICSA 3DBPA 2C1GA 3VIMA 1MOKA 4W7VA 3UYCA 1XLCA 3PBGA 3FK4A 1AW2A 1EQCA 1NOWA 3PSVA 1ZLPA 1OG0A 2XGZA 1TVNA 1PPIA 1W6TA 3V16A 3TTOA 3W6LA 3ZR4A 1EYWA 2PS2A 2VQUA 1N8IA 2Z1BA 1GV4A 1Q7ZA 3LRLA 1Q2RA 1LVLA 2OGJA 1S2WA 5H8PA 1W5NA 3KZSA 5GNXA 2V2HA 3NQEA 2FTWA 1ONFA 1CI1A 2Z00A 4DNMA 1UC4A 2WKGA 1TWDA 3SUSA 1VIZA 1ADDA 1KRCC 3W4RA 3U2OA 1XLHA 1AMKA 3ENLA 4ZB0A 2HVOA 4JTKA 2WVVA 4NYUA 4WJ8A 5DRIA 1F8MA 4GXMA 4TO8A 3QKZA 1RZMA 4MIMA 3LNPA 4GC3A 1ZBKA 5G5GB 3HO8A 2QJIA 3QV6A 5HJLA 1UW9A 1IXQA 4C7FA 3NZRA 1WDQA 5G2HA 3LB0A 1AUSL 5JBDA 3FSTA 3ZVHB 3KZPA 1JR1A 4H4XA 2X0HA 3GR7A 4AF0A 3T8QA 1GVYA 1G94A 1JCMP 2ZXDA 4IUOA 1FRBA 3T4CA 1A5KC 1FUYA 3ALFA 3SR7A 4NZCA 4S3CA 1K4QA 1DYSA 2I1OA 1SMAA 3CASA 2QR6A 4N9EA 3W81A 2ACUA 3GC5A 1O5KA 2OKTA 2INEA 4AVNA 4P8XA 3TFCA 2PZ0A 3CQJA 3G18A 4OECA 3QZEA 2GVGA 3IGSA 3HBLA 4JQ2A 4HK5A 1W2VA 1ZFJA 4BQ3A 3LHYA 2QZRA 5LGZA 1KQYA 1WZAA 3F7JA 1XPYA 4IF2A 4OVXA 3S5ZA 4C90A 3WQPA 5DRCA 4ZQRA 1TA3B 5L9FA 3W7CA 2E3TA 4O18A 3FNDA 3EOSA 5I00A 3AALA 1XH1A 3WNLA 1FHUA 4Q8NA 1VBGA 2UY5A 3O0FA 3F2BA 4RX0A 3EAOA 3QHMA 3LZ3A 3OU8A 3UR7A 2X1IA 1OZMA 3LYEA 4HOWA 3WNPA 2Z0IA 1Z41A 1MNZA 4MADA 1W1TA 1DIKA 1LLZA 5AC6A 4S3FA 3W84A 4ZQNA 2Z2AA 4HU8A 3HG4A 1KKRA 2OT0A 1W5PA 4XAPA 4PRWA 1XBZA 2GQAA 4DJDA 3TTSA 4IXXA 3V0UA 4H1ZA 4IFRA 3UZ5A 1JDCA 1JNDA 3W2LA 3NTYA 4W5UA 1BWCA 5I3JA 5FD0A 1N8FA 3QPEA 4PL1A 1ICQA 2FDSA 3PK7A 3S2MA 1B5TA 4KWVA 2D0HA 5FEXA 2C3DA 2DIEA 1Z44A 1XYMA 3QQ0A 3AOFA 5FMHA 2DP3A 5CG0A 4XBJA 1OCNA 4QSFA 5I7GA 3MSYA 4NZFA 2V69A 3RO6A 1T3QC 4QHRA 2YXXA 4GYKA 3IK4A 4CNNA 2A7NA 1EO5A 1JUBA 4PMRA 2PUZA 2VD8A 3I4KA 4NASA 3AXXA 5T26A 2VFHA 2EJ1A 1J0HA 1G01A 2CFFA 4Q8MA 2NQLA 3WQWA 4DLMA 3WKZA 1EX5A 3RHGA 4MFEA 2WK2A 4ZVJA 4HMDA 4DRSA 1DJXA 4MYXA 1S2CA 3CZLA 4MB5A 2XPKA 3WH9A 4QRNA 3EWBX 4XTDA 1CXKA 2R82A 2W4XA 1Q6LA 1F6KA 1X7FA 4BQ2A 3U2EA 2BGSA 3IIZA 4G9PA 3DENA 4JS3A 2OO6A 3E0WA 2O9TA 1VBRA 2GL5A 1L8NA 1W54A 2VX4A 1PTAA 3GHRA 5C7VA 1VC4A 3AHZA 3OGVA 5FESA 3W38A 4YCOA 2TYSA 3KRZA 2ANUA 2E6AA 3VM7A 1GW9A 2V5JA 3PTMA 4H6EA 4HA1A 1UWRA 3U5YA 2R1MA 2ZWZA 2WJDA 1VH7A 3MJYA 4HCDA 2QXWA 5FS6A 2EG8A 2WSRA 2X1TA 5TF0A 4HT3A 2PRHA 4EVZA 2JQXA 4LUSA 4A21A 2JKEA 1A5BA 3L2MA 2E0PA 1NH6A 1Q1WA 3NR0A 1RJQA 1DV7A 2PTYA 2VT0A 2XIMA 2J4GA 4JCMA 1N8WA 3L12A 5T9BG 4NT0A 1ESWA 1FCVA 3PZTA 3RK8A 3MP4A 2DSZA 3LGEA 2RJHA 3RX4A 1F74A 1JDFA 3PR2A 3NL6A 4K3ZA 3GK0A 3W76A 1TV7A 2TPSA 1FIQB 4CQBA 3A7RA 3KCJA 1H0GA 1NQ6A 4JL2A 2J6XA 2WKJA 2HBVA 2PA6A 3PANA 3BLEA 4RE2A 3KAOA 4L6DA 1IT7A 3CUZA 4IIGA 1GERA 4XZLX 3RCMA 3ABXA 2BV9A 4CEUC 2NT1A 4P8UA 5DN1A 1JAKA 4LAKA 3ARTA 1UIPA 3TAKA 1UR1A 4F2BA 2WOQA 2ZX6A 2CZEA 4QCFA 3LGGA 2Y89A 2NLIA 3TA9A 3WEOA 1B31A 1UUOA 2WC4A 3RYSA 4D6DA 5LNWA 2W61A 1DKWA 4HCLA 4OOUA 3N3TA 4BJHA 4CNOA 1A5SA 4P61A 1XW8A 4M19A 1C9DA 3EANA 3TE9A 1XIGA 3SSJA 4Q8TA 4Z1YA 1VFUA 2E40A 3LXCA 2A3HA 2BXYA 3AI0A 3T81A 2PD9A 4HNCA 2WWDA 1DIOA 2IQ0A 3SCNA 4OZOA 1LLOA 4ZSUA 4IIEA 4GR1A 2V81A 2ZFAA 1UCWA 2BVTA 5EMUA 5CSRA 2CERA 2V82A 1H09A 1NHQA 1QO2A 3WLMA 4E2DA 5FKYA 1VEPA 3NPVA 2CEQA 2X8RA 2W5FA 3OTRA 1KCZA 3AO0A 4FOUA 1LPFA 4WIWA 3H22A 2XWDA 1GJWA 3P60A 4HHPA 1TTJA 1LORA 5A94A 4KCWA 1AH0A 1ISZA 3IJ8A 2Z25A 2J9ZA 2BY2A 4E8DA 3QR1A 7ENLA 1B4EA 3A12A 4CVWA 3W7RA 3R0KA 5G4WA 1VCFA 2DGAA 3H54A 4BY3A 4NIRA 1KXTA 2A3CA 4A29A 1AL7A 1HKKA 4AEFA 2IKIA 3RF9A 3QC0A 2FQIA 3EAUA 4XKYB 5XIAA 3ZJ7A 2D22A 3MTWA 4E8GA 1GRTA 3DHFA 1GEHA 1H62A 3EXTA 2VZOA 2G95A 2V6AA 2PDYA 1RVGA 3KL3A 3WLKX 4O8RA 3OW1A 4MWAA 4S3EA 1UWSA 1FWCC 1EOMA 4LEQA 1O5QA 3KBWA 5IBXA 2WPGA 5FJTA 4HN4A 3E02A 4HPGA 1FFQA 5ECUA 3AHXA 3BMVA 1HN1A 3AS3A 2VD9A 4J2MA 1K8CA 1SVDA 5M3WA 5TR3A 1MXSA 3N25A 2OZTA 3GAKA 3XIMA 4XAGA 4NXSA 3A9IA 5BXPA 3WLRA 4F40A 2QCGA 1BYDA 1KM5A 2DW6A 3FCPA 3BW3A 3LHWA 2VFIA 2DSVA 4WSJA 1G4TA 3CO8A 3WUEA 3G1VA 1UP3A 4DZIA 1V0KA 4PTWA 4Q7NA 1M68A 4EKJA 4S3AA 4Q4MA 5HA7A 1A5OC 2XH0A 4XSMA 2BSLA 4LNYA 4XZBA 4ZOBA 1I45A 5EPDA 3VIPA 2ZICA 2QJNA 1OD8A 1B90A 4JX4A 4MVAA 3ZT7A 1ZSXA 3FJNA 4IPLA 2FZMA 4H4WA 3U6WA 4G1KA 2VOMA 4IL0A 1XLBA 4P5UA 3SM0A 3BAKA 4JFSA 2P1FA 4A8RA 2W9MA 1G1YA 1JZ4A 1K77A 1RK6A 3DGHA 1SZNA 1V77A 2O7SA 5A6BA 2E1WA 3I7QA 4PTNA 1OWQA 3LLFA 2DORA 3VNLA 2FHBA 1ZY9A 3GZ3A 1GETA 5F7UA 3WNNA 1RK5A 5C9UA 2GVYA 4R5EA 2CBIA 3WD3A 3RJXA 3T0DA 4HZMA 4BEQA 3E5BA 3NM3A 1W17A 2YVGA 1W8GA 4PUDA 1UH3A 1SMDA 3VOHA 2R1PA 1KFEA 3CLWA 5LIXX 3VFCA 4JBRA 4DWDA 3LLDA 2XGBA 5A5WA 5FF2A 1RLCL 4KETA 2P76A 3VILA 3QPYA 2BC0A 3M7WA 4RDWA 1SFSA 3OBEA 4JNYA 2V68A 2CCRA 2WCAA 1A80A 3DH9A 1Q2SA 1O4UA 3S8HA 1BD0A 3EWDA 3QY8A 3UGVA 3RLHA 3H12A 4JTIA 3ICJA 2YDSA 3AXKA 1XQLA 3BURA 2PWHA 5JH1A 1IGWA 2QV4A 4JEQA 2JIEA 4IPJA 2B81A 3H24A 1SZFA 3R58A 1E9IA 1K3UA 2WBGA 4XD5A 1S5MA 3AIBA 4JX5A 4M1RA 1XD1A 1SFLA 4X3ZA 3GS6A 4M52A 1FVPA 2RGMA 1ZP3A 2QULA 2DIJA 1DQWA 4MJZA 1TRIA 1QNRA 3DYOA 1NPXA 1XD0A 4L6HA 4PSPA 4KQNA 4M6VA 2P5NA 4FMVA 3WLIA 1L2UA 3MBFA 5B7ZA 1MW3A 2CLOA 1OT2A 2X41A 3GW3A 4GGHA 1H7WA 4D2JA 4ATWA 1TUXA 4PCFA 3D3AA 3CC1A 3LPFA 2X16A 4GY0A 3W1LA 1E4NA 5HPCA 3M5ZA 4AVOA 2C15A 1C7TA 2CXGA 1VFTA 4QS5A 4NHVA 3G6LA 1LBLA 1Y65A 3VK5A 1HP5A 3NQ8A 1LQ2A 2WZIA 3EKGA 1BVWA 2VURA 4QE4A 3NIYA 2WOIA 3QM3A 3DGRA 1E40A 3N2BA 2P53A 3NQAA 1J4EA 1QHZA 4PH6A 5FJUA 3W1RA 1AD4A 5FA5A 5LNSA 1N2VA 4HSOA 4NY2A 4WSHA 4ERAA 2X1SA 6REQA 3KOXA 1D3GA 4YNGA 5GPRA 2PRLA 1DJNA 4QLJA 2HBXA 2W67A 1SW3A 3VDAA 3MO4A 4LS1A 4Z2JA 4MAVA 3NZGA 2D69A 2OMAA 1R3RA 4IJRA 1PB0A 1S5VA 1O6IA 3HU7A 4IPIA 4GUJA 4GWEA 3CPUA 1QR7A 2UY2A 4C6OA 1LOSA 1GK8A 1E4IA 4W84A 3IUDA 2Z4GA 3RRXA 2HROA 3PBMA 3ZXWA 1LL4A 4DM2A 5A8NA 8XIAA 4JDBA 3HFYA 3EWYA 1R85A 1M53A 1K8YA 1TREA 3EDJA 5GVJA 4MWAC 1I2RA 1RQHA 1J0YA 2ZBTA 4UTHA 2I56A 1MZRA 2V67A 4Z1DA 4JFUA 3GNPA 5IBXC 1SO3A 2QUTA 4A2RA 3BXWA 5GJNA 4CCZA 4R34A 3HURA 2VC6A 4G8TA 1KWGA 3UR8A 3K5XA 1JCXA 1HGYA 1Q4NX 1RSCA 1YADA 3I3EA 3L9CA 3VIJA 4BQ4A 4DJFD 5D05A 1FFVC 1FWAC 1XBYA 3H4WA 3SZ8A 5HINA 1OYCA 3A9BA 2WKLA 1B9ZA 1IIGA 1NY1A 1EBGA 1TPB1 4NZ5A 3QGKC 4ILSA 3LCXA 3UETA 4W9TA 4IWWA 1L6WA 3T0AA 1DVJA 3CO4A 2AQWA 3FXGA 2VGGA 1CGXA 2DT3A 4HZ7A 1CXEA 3ARYA 4B5WA 2ISDA 3BVJA 1S5TA 2NQZA 4S3JA 1PUDA 1DEDA 3ZQ9A 1E6RA 2E5CA 2CPUA 5AC4A 3HW2A 3OQEA 3WQGA 2I9EA 3OLEA 4LF2A 4EK7A 2ZZ7A 2W6RA 3BH4A 3VD3A 3H2FA 3EPMA 1AJZA 1B30A 1NDVA 4J28A 3VXGA 5BROA 3IJ7A 3KP1A 3WCZA 4Q3MA 3ZS4A 2E5DA 1C90A 4ZQCA 4XVEA 1HZYA 3GKAA 1GQJA 2FTPA 3FAXA 4E3TA 2VFEA 2EG6A 3HJEA 2BZNA 3T7VA 2PP1A 4RE3A 1W9VA 1L9WA 1H2IA 1KV5A 3PTKA 4I9TA 4AW7A 4DM1A 4HU4A 4JQAA 1RA0A 4XD6A 1CXFA 5GJPA 2WMIA 4WK9A 3V18A 2C0AA 2PWDA 3GBDA 5A2CA 1AK5A 1PZ1A 4HIBA 1FXQA 3W29A 6A3HA 3W73A 1A4MA 1M65A 2HV5A 4K8HA 4HMEA 1IV8A 1THFD 1JQXA 3KOZA 3PJXA 2XVKA 3VOJA 4FO4A 1ZKQA 3M0IA 3N4FA 2QUVA 2R9RA 4ZO7A 2GUBA 3IAQA 2PC8A 5JUVA 1XRSA 2AAQA 3CHCA 3AYSA 4Y96A 3MKKA 5DMMA 4NJHA 4J3TA 3NRZB 4GQQA 2B0MA 3DESA 4JQ3A 1NQKA 2ATSA 3UPBA 3IUHA 2NV1A 1O66A 4AIEA 3IJIA 4R53A 2MNRA 3ZSTA 4GIAA 3G1XA 4PRTA 1FWWA 3CZ8A 4MZ1A 3S2JA 2Y7DA 2DT2A 3U0HA 2G8ZA 2DZAA 5DT7A 3ATYA 3ELFA 5KZEA 1XCFA 1LT8A 1RJPA 2FGZA 1DOSA 1EJSC 1I9CB 5FSEC 4PZVA 3PC0A 5I03A 3GU1A 5A6KA 1HNYA 1EOKA 1E9LA 4DNHA 3L4VA 4DAFA 2ASHA 3UCQA 4KFNA 1UHVA 1RY8A 4OGZA 4DPPA 4E4PA 1WXZA 3APYA 4ROQA 1FCUA 3NOEA 2V3BA 1LBMA 3VDHA 2PE4A 3IJ9A 3PM6A 3KX6A 2TRSA 1KRMA 4PMJA 3P8JA 1MW0A 4LIIA 1YNPA 1EDTA 4PUKA 2PBGA 1U33A 3AS1A 4B5TA 3P80A 2DPEA 3TJLA 3RNDA 4U3CA 2NW0A 1XLIA 3CPRA 3AIQA 1KC7A 1KO0A 4N42A 4F9JA 3OZOA 4FNPA 1YBQB 2Z7KA 3WUBA 1HT6A 3H2AA 1UR2A 1W56A 3S9ZA 3H23A 3ZR6A 4CN6A 4H04A 3NPXA 1GW1A 3M6YA 4G56A 3URNA 4IGSA 1YXDA 1ECEA 3NAVA 3WMSA 4GJIA 1HL8A 1ELSA 4JFTA 3UU0A 1FP9A 1CXHA 3VIKA 3DUGA 3PP7A 4C5YA 1T99A 1X96A 2YZ5A 1NEYA 1EC9A 3SCTA 4EANA 4NYYA 3EA1A 3VM5A 2YDQA 2X30A 1DHKA 1GTHA 3M43A 3WK3A 3GHUA 2JK6A 4PMXA 2ON3A 1LF1A 2QVHA 3TWBA 2XVPA 2A3AA 4V28A 3MO7A 1ZENA 2HE8A 5JVLA 4GZEA 4Q4SA 2QDHA 3WDQA 4N4PA 4X0NA 1TV3A 3AWNA 4M6PA 2E9LA 3KHJA 5I02A 2C16A 3PJTA 3L7RA 5XIMA 4JTDA 2NQJA 4JEJA 2KAUC 1V02E 1C8QA 4GVGA 1ONXA 1CZ1A 4AZGA 2G3FA 1TWIA 1EA0A 2ALDA 3H53A 3ZMRA 4IMFA 2C19A 5AB3A 1E51A 1ONRA 1PEZA 4FK9A 4BK9A 1XSIA 2C13A 5CPLA 2YKKA 1AZ1A 1CIUA 4HNOA 3SIZA 5ER0A 2RDXA 5AYZA 4LAZA 2PDQA 3S9YA 2BY1A 3CAQA 1D3CA 5IDIA 1TV4A 2IS7A 4ZE5A 3BV7A 3QMRA 3TFXA 1G6CA 1CLKA 4EXQA 4FLSA 3S42A 4CU8A 2IPWA 1UUMA 2CYGA 1UMLA 1W0MA 3LCLA 3DIPA 3O6CA 2EQ7A 1KA9F 1E43A 3TN5A 1JCNA 2BG5A 4M7TA 3NA8A 4ZGYA 4EWJA 3SQLA 4GNKB 5CLWA 2PLCA 1R2SA 2XVGA 3AAMA 4GABA 2IKJA 2IXVA 4P7NA 2OQLA 3FS2A 3CV1A 3VCNA 4O15A 3UWZA 5G2IA 1GKQA 4ROPA 5B80A 2DT1A 5E9XA 2OSWA 5MKGA 2AQOA 2BXVA 1R3QA 2EJAA 2NQHA 2PWVA 2CW6A 3W7EA 4U10A 4RDZA 4N9CA 1IEQA 1GG0A 3N9KA 4C6BA 1MXDA 4OUEA 4HVXA 3CTLA 5K2ZA 1ZXIC 2VMFA 1QASA 2FH6A 1U1HA 4OHQA 4B5VA 1UWUA 4LA1A 1W1YA 2GSEA 2E09A 2QV5A 2RDTA 2WAGA 4FA3A 4DI8A 3VCCA 2PDWA 3VGDA 4HK6A 2J9YA 4BURA 4B3KA 1EH9A 4R88A 5I07A 4LBUA 1UZ1A 4CCCA 4A05A 1NWSA 1SR0A 1E0XA 1JEHA 1E6QM 2YJQA 3HFTA 1WPCA 4JQ9A 3TU9A 1OX4B 3C6CA 1E6ZA 1GQIA 3TWAA 3WNMA 2BS9A 3I7SA 4WHBA 1K7XA 1JUKA 1R86A 1W3IA 3PUEA 2RABA 4DO6A 5HNUA 4QS6A 3KWSA 1CX9A 5G4HC 5A3HA 5AZ1A 3EMZA 3DFYA 1VPQA 4YYCA 5BRQA 5LIWX 4FAMA 4DO7A 4J4KA 2BP1A 2EPLX 3W83A 3KRSA 4BA0A 3TONA 2UY4A 3NQ7A 2NVCA 3NCOA 4OQVA 1FOBA 3W1XA 4FNSA 1ISWA 2W3ZA 4F8XA 3CAWA 3B9JB 3MYOA 4JQ4A 1HP4A 2BVWA 1BWLA 2GZXA 5G2WA 4IIFA 1AD1A 2GUUA 1BFNA 3RAOA 1ITXA 1N5XA 4J3VA 2A3EA 4LW7A 5G4EA 3CV2A 3RITA 2RAGA 1J01A 1RCOB 2G4JA 3ITGA 1XX1A 3DKLA 5DY2A 1Q5MA 3K46A 3PZNA 1UMYA 1GZJA 2PEVA 1AA1B 3RLGA 4R7OA 4HOZA 4HU3A 5AHFA 3QHNA 1K70A 5K9XA 1NFBA 3M9YA 1WKFA 1UASA 4KT2A 2HEJA 3CQHA 4ZCWA 5EMJA 1VRXA 2ZZ4A 3L4WA 3WF1A 3NDOA 1QOXA 4DBSA 2DZPA 1FWIC 4JKMA 4JAWA 4W93A 4AHOA 1D2KA 4AWSA 4M1BA 3TLLA 2XFFA 2NZLA 2WBKA 2YDRA 4Q8WA 3GIPA 2VO5A 4CQAA 4D8AA 1GUVA 3R11A 4WDWA 3IGXA 1F6PA 4ZFCA 1RQEA 1XYLA 3DDMA 4EXBA 1I0BA 3STCA 1DORA 4RV3A 3TNBA 3B0UX 2E8ZA 2VZVA 4QM1A 3R5EA 1G9HA 1UQYA 3GU2A 3BAYA 2PDPA 2PP0A 3HGJA 3ZSSA 2VX7A 1V6UA 1JDAA 2ESCA 4WXZA 3OBAA 2YW4A 3S1GA 2XIOA 1XIDA 4GYFA 4LJ3A 4Q33A 3UG5A 2HXTA 4EQWA 4PA8A 3S5YA 1V0MA 5KITA 1WYGA 4J40A 4MKSA 4IT1A 6REQB 5JCKA 2VJXA 4H9VA 1TJRA 5AHEA 1XDMA 2W3RA 4XD4A 3M41A 4NU7A 1EEPA 1QTWA 3W23A 2X2GA 3C2EA 1F8IA 1X6NA 3VIHA 1VFHA 5F1VA 2NQ5A 3PWAA 3WL1A 2ZUWA 3E1F1 3U4FA 5KZDA 3QBUA 3COTA 4Q4QA 5M17A 4GA8A 3NO1A 2QCHA 1RR2A 3DZ1A 4A3QA 2GVLA 5FF7A 3OOQA 4HBKA 3LX9A 2VELA 3W88A 3AROA 3TC6A 2AGTA 3NOYA 3W7IA 1SFJA 5J8LA 3PF3A 4GPNA 1R3YA 5AVHA 4S2BA 1QI0A 4K8DA 4WD0A 4F0SA 4Z2LA 1A5LC 2HS6A 1K02A 4I90A 1UOZA 2INZA 1RVKA 2D2JA 2ZZCA 3I3DA 2PMQA 2BGNE 3PJUA 4GVIA 3UT0A 1H0IA 2EBNA 2D24A 4BF9A 1GQLA 2GQ3A 1FO4A 3SUUA 2VWSA 3BGGA 5IM51 5HDRA 2QDGA 3W7GA 3LSCA 4KESA 3RNMA 1K8ZA 1C8YA 1J2WA 4KH2A 4KWOA 4A35A 2CC0A 5JIWA 2J7GA 4GISA 1P0NA 2NXIA 2YL8A 4JIHA 4OUIA 1UKPA 3TVAA 4JN7A 4F2TA 2E5BA 1JYWA 1TSIA 1PWMA 2X8CA 1D9EA 2ONEA 3UCDA 1EHAA 3UP8A 1SPQA 2YLAA 4OIFA 4DWSC 1LJYA 1NWTA 3QMSA 2OB3A 1VS1A 1UYQA 5A8OA 4I6KA 3P0XA 3M5XA 4O13A 4YVPA 1XF0A 4Y8EA 5F4WA 4FB7A 3S1UA 1CXIA 5JH2A 1VEOA 5AYXA 5KEZA 3N18A 4GXWA 1R30A 1TR9A 2OR2A 4E4UA 1VKFA 3NL5A 3BLIA 1DXFA 2GOKA 3GZAA 3ZO9A 1I4NA 4J35A 4KF1A 3ARSA 3MSDA 4H4RA 1RY0A 2F6XA 3DH7A 3TYCA 4W8BA 1VFMA 3JUGA 3B04A 2DSKA 3ANUA 4AG0A 1M6JA 3W7MA 1ZAJA 2ZADA 1I2QA 1E56A 4LCSA 3ZWTA 2Y5EA 4IG2A 3W26A 1VYRA 1S5WA 2CBVA 4UTWA 1YX1A 3FA3A 4Z17A 3W6YA 4DYEA 1M1BA 2PWGA 4FLOA 1EJTC 3ITVA 4C6EA 3ZLHA 5T91A 4REQB 3M6DA 1DJYA 4ADTA 1FWSA 6XIMA 1NDYA 4I5UA 1X2HA 3RR1A 4D72A 4ZTYA 4W5ZA 2QGYA 2F84A 5F2IA 1V93A 2H9AA 3VIFA 2B7PA 2CNCA 3M44A 1V5XA 1ZMDA 3HIJA 3QN3A 2J9XA 5XINA 1FEAA 1TX0A 3B8TA 3KUMA 1G69A 1SR9A 2TSYA 1E3ZA 4JICA 5I24A 3GRTA 4H9TA 2HE5A 5EBUA 1YE6A 3DI0A 1JZ8A 1XV8A 4HJFA 3M16A 1FECA 5BZAA 2VC5A 2VFGA 3K4DA 4CD6A 5CGMA 1SO5A 2DZVA 4D6CA 3IS4A 5CAKA 2NT0A 1JPIA 3GAYA 3WG6A 4R33A 4MY8A 3DXIA 2FKPA 4GIRA 2OKOA 1Q45A 3ARWA 2GFTA 1KM6A 2YXGA 4H9MA 2VKZG 5LXEA 2O0TA 3TYBA 3V5OA 1IWBA 2RFGA 1X2GA 4EOUA 3R8RA 1QPKA 2WXDM 1IEWA 1OFEA 5JBEA 2ZX5A 6CGTA 1YNQA 1A5UA 3EOOA 3TW6A 4ENLA 1BWVA 1F3WA 2GR1A 1PIIA 3AIUA 5LIYX 2DUAA 5EFFA 4QE5A 2HS8A 2NLYA 5PTDA 1TVLA 1OHLA 2DH3A 1ADOA 5E09A 3LTYA 3RIKA 1PHWA 1DQUA 4YJ5A 3IRDA 2GDVA 3GDKA 3PZMA 1IIHA 1HKMA 1UR8A 1V6YA 4W89A 6ALDA 3SGGA 2DJLA 3ARZA 2FPVA 4XWUA 1I6NA 3C5QA 2VXNA 4GBUA 3NWRA 4H2CA 3PZUA 2HTMA 3APGA 1KM3A 5GQBA 3B8UA 3N13A 1WYIA 2C79A 2G3MA 2DSWA 2YB4A 1HKWA 5BCAA 2DZXA 1U5HA 2IPJA 1TWSA 3D9XA 2VX6A 2EG7A 1QNOA 5K4XA 4NI8A 3E0IA 4QLKA 3S1XA 2OELA 1OGSA 1XG4A 2YA0A 3SRHA 1OFDA 4BI7A 3TC3A 3S46A 2C0HA 1VBJA 5LA1A 2WZMA 4K7ZA 2NX1A 4AVFA 5HJYA 2XN1A 1M01A 3ZYZA 4PTMA 1TJ2A 4PRRA 1A5MC 1EF3A 4HGXA 1Q6RA 3QOKA 1V6TA 3THCA 1Q6FA 3S5NA 1JULA 2BMBA 3CZKA 3GIQA 3GW0A 3L0GA 3P67A 5DBTA 2GR0A 2OO0A 5GNYA 4JY9A 1MEWA 2R9ZA 3SN4A 1XDJA 3UEQA 3EDDA 2JE8A 4WDUA 1SUXA 1M5WA 2VEPA 2Z7GA 1V6WA 4DUOA 3TOPA 1TJ1A 1CGWA 1JG9A 3KP0A 1KWKA 4MG4A 1UWAA 1XHGA 1RALA 2CZ5A 4I7UA 4W7UA 2QYGA 3QQ1A 3IIVA 1MW1A 3M7SA 2V30A 1RLDA 1JDDA 1Z3NA 3KVLA 3EOLA 4I6VA 3IJDA 1VIWA 2PZNA 3GDBA 3GG7A 1C93A 3CB8A 2GJNA 3WFAA 5LHFA 1W1A1 5BOEA 2RDWA 3TTEA 4QAWA 2V2DA 3DECA 3BAWA 2QJMA 1E4LA 3GRIA 1QW9A 3SGZA 4ZSTA 3B0VC 3T0TA 1JPHA 1VHCA 3QHOA 2BY3A 4PMNA 1U5JA 2YVFA 3TQPA 4KMQA 3BAJA 3E2SA 1W3NA 1CGYA 3GM8A 5HNNA 1VYPX 3UZJA 3SDOA 2F2HA 4P7OA 1ZB5A 1R2TA 3AUJA 2CBUA 4D1JA 4AD0A 1Q6CA 2GGIA 1KGXA 2YA1A 3TN4A 5I3GA 6TIMA 1T41A 2H3BA 4O1DA 4GI4A 2AMXA 3N2TA 1TKKA 2FHCA 4ICCX 1J10A 1O95A 2PCEA 4IX0A 4F48A 2OYMA 1HGWA 2GUYA 5FS9A 3UBPC 2Z24A 4V15A 4WRHA 2W91A 3W71A 3N73A 1ITQA 1OADA 4UTWC 5HMFA 1Q6OA 3JW7A 3V4BA 3S5SA 2Q8ZA 4U3AA 3UWWA 5BWAA 3KTXA 4Y9MA 3B4UA 1T5AA 4WF7A 1NHPA 3OZYA 4AZHA 2GQWA 5ENLA 3S47A 2CIPA 4APNA 2A1YA 4OBTA 4QX4A 4FXSA 4XAFA 1OFPA 4Q7BA 3W28A 1V3MA 2YDAA 3RO8A 4WSKA 3G1FA 5G5HB 5DLCA 3HQOA 2YAUA 2VP8A 3WD1A 4EX4A 1V03A 1PCKA 1TPH1 5FI8A 5I09A 4Y9PA 3FXYA 4IIBA 4TUFA 1XR2A 1M7JA 3IJ6A 4IZGA 3RPTA 4GIYA 3NEVA 3V1PA 1QVBA 3EWXA 3MZ2A 4GZIA 5D4YA 1EBHA 3JZEA 4IH3A 1Z89A 1VQTA 1TPC1 2ZX7A 3QJAA 4HZ6A 1PBGA 1GNXA 1EGVA 2YYUA 2PTXA 4NJGA 5DF0A 1PV8A 5A6MA 1NAL1 3GXIA 4JDYA 3QZ6A 1M6IA 3ANVA 2ZA3A 3G8RA 3L4ZA 4L64A 3G1RA 4NSBA 1XSJA 1GVQA 1FFRA 4H9XA 3Q45A 4ZO6A 3NYZA 3GKFA 1BYBA 5DT5A 3B0XA 1IXPA 1TFVA 4U5IA 1UR9A 1IZCA 3VOGA 3N9RA 3PB0A 2F2KA 3BAXA 1XBXA 1U1UA 3QSTA 4AZCA 5BYWA 2J7FA 2ZVRA 1M7XA 3UWUA 3B03A 4J3ZA 4RLIA 8RUCA 2J13A 2V5DA 2ZXAA 3K30A 1YPFA 2WOVA 1JZ2A 5TIMA 4NP7A 4Q7IA 3E6EA 4MUZA 2WW5A 3IANA 5TNVA 4ACZA 4TVWA 1K9TA 3WUFA 2GJXB 2WQDA 3ABQA 3H70A 1Z69A 4LVBA 2E77A 2QVNA 3LI0A 3C3UA 4Z2GA 3CGEA 5U25A 4Y9OA 4OV4A 2TAAA 2XDFA 1HL2A 5AC8A