3RR1A

Crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
384
structure length
372
Chain Sequence
MVKITRLTTYRLPPRWMFLKVETDEGVTGWGEPVIEGRARTVEAAVHELSDYLIGQDPSRINDLWQTMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLGVPVYELLGGLVRDKMRTYSWVGGDRPADVIAGMKALQAGGFDHFKLNGCEEMGIIDTSRAVDAAVARVAEIRSAFGNTVEFGLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAETYARLAAHTHLPIAAGERMFSRFDFKRVLEAGGVSILQPDLSHAGGITECVKIAAMAEAYDVALAPHCPLGPIALAACLHVDFVSWNATLQEQSMELLDYVRNKADFALEGGYIRPPRLPGLGVDIDEALVIERSKEAPPVWRHADGSVAEWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of enolase PRK14017 from Ralstonia pickettii
rcsb
source organism Ralstonia pickettii
molecule tags Lyase
molecule keywords Putative D-galactonate dehydratase
total genus 111
structure length 372
sequence length 384
chains with identical sequence B
ec nomenclature ec 4.2.1.6: Galactonate dehydratase.
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3rr1A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3rr1A01
2PTZA 3S47A 2ONEA 3T8QA 3N6HA 3P0WA 4DHGA 4GGHA 1P48A 3UXLA 3RO6A 4IL2A 3JW7A 4DXKA 2OZ8A 3OW1A 1F9CA 5ENLA 1PDZA 4KPLA 2OQHA 3OZMA 3HPFA 4JN8A 3MSYA 3H12A 1JDFA 4H1ZA 1ECQA 1MDLA 3MZNA 2HZGA 4IHCA 4IP5A 4M0XA 1L8PA 3KUMA 3ZVHB 4EWJA 3R11A 3DFHA 2CHRA 3ES8A 2HNEA 3N4FA 3TW9A 1KCZA 3PWIA 5FJTA 4HN8A 2OG9A 2QQ6A 2PTYA 3SBFA 4YWSA 2P8BA 3VC6A 4IZGA 5EU9A 3IJIA 3MQTA 4Z17A 4FP1A 2P0IA 3CAWA 3NO1A 4ROPA 3DG3A 3DESA 3N6JA 3SN1A 3QLDA 3R1ZA 3NFUA 3TOYA 1NELA 3FJ4A 3PFRA 3RCYA 7ENLA 3I6TA 5J04A 2NQLA 3TWBA 2PODA 1SJDA 1BQGA 3T4WA 2OVLA 3B97A 4Z1YA 1PDYA 3UCDA 2P88A 2POZA 2MUCA 3QKEA 3D46A 3TTEA 4E4FA 1MRAA 2PTWA 2QJMA 3QTPA 3TJIA 3GD6A 2HXTA 5FJPA 4HNLA 3RRAA 4FI4A 3V3WA 3TCSA 1WUFA 3VC5A 1JPDX 3EEZA 1ELSA 2PGEA 1ONEA 2GGIA 3DG6A 1EC7A 2GDQA 3BOXA 3CYJA 3D47A 6ENLA 3GO2A 3UJRA 1EBGA 2ZADA 4GIRA 3UXKA 4H2HA 1XS2A 4DWDA 1JCTA 4KT2A 4K8GA 3SN4A 2AL1A 2RDXA 1KKOA 2GL5A 4G7FA 3S5SA 4E4UA 4H83A 2MNRA 2PMQA 4KWSA 3DDMA 4GYPA 1TKKA 3MKCA 2OZ3A 3DIPA 3JZUA 4MGGA 2AKMA 5BOFA 4MMWA 3U4FA 2OO6A 2AL2A 3VA8A 5IDZA 3ZVHA 2PA6A 3CB3A 1XPYA 1EC9A 3THUA 3IJLA 3EKGA 1DTNA 2HXUA 4IT1A 3ES7A 3SQSA 4IL0A 4HCLA 3UJFA 1FHUA 2PGWA 4ZCWA 3IJQA 4HCHA 1MNSA 3V5FA 5BOEA 3DERA 2ZC8A 3N4EA 4ZA0A 3ENLA 3STPA 3R0UA 3PWGA 2PP1A 5FJUA 2OQYA 4A6GA 1KKRA 2PS2A 1FHVA 4K1WA 2PP3A 1RVKA 2I5QA 3VDGA 1JPMA 3PK7A 3GY1A 4K2SA 4A35A 3P93A 3R10A 3H70A 3FVDA 2XH7A 3I6EA 1TE6A 3I4KA 4IP4A 3UJ2A 3IK4A 2DW7A 4E8GA 1SJCA 4KEMA 2OKTA 3BJSA 4DN1A 4F4RA 3OZYA 2GSHA 2AKZA 2QJNA 1TZZA 1P43A 2OX4A 1W6TA 2P3ZA 2QGYA 3MWCA 3ZLFA 3DGBA 4HPNA 3VFCA 3VCNA 1E9IA 3Q4DA 4GYPC 1OEPA 4H19A 2QVHA 3DG7A 4JN7A 1R0MA 2XH4A 3UGVA 4G8TA 2XSXA 2O56A 3CK5A 2GGJA 2OZTA 4X2PA 2OFJA 3ZLGA 3V4BA 3H7VA 3CXOA 5FJOA 3T6CA 4GGBA 3FCPA 3QPEA 3QN3A 3V5CA 4GMEA 4E6MA 1EBHA 1SJBA 2PPGA 2GGHA 3OTRA 4HCDA 2AL2B 4GISA 3VCCA 2FYMA 4HNCA 1MUCA 3Q45A 1R6WA 2QDEA 4ENLA 3DEQA 1NU5A 4J3ZA 1MDRA 3FYYA 3SN0A 3OP2A 2PTXA 3DFYA 4M6UA 4E5TA 2OPJA 1YEYA 1KD0A 1IYXA 2XH0A 3FV9A 4DYEA 3ZVIA 1BKHA 3CT2A 3SJNA 5FJRA 4J1OA 4GFIA 3MY9A 4A3RA 1SJAA 2FKPA 3NXLA 3ZLHA 2QDDA 2PCEA 2PSNA 2QJJA 2PP0A 3BSMA 3T9PA 3P3BA 3TQPA 2GGEA 3UCCA 2XH2A 3UJSA 4JHMA 4MKSA 3K1GA 4HYRA 2DW6A 3JVAA 3NZGA 3MUCA 3R25A 2PU1A 3U9IA 2OLAA 3FXGA 2GGGA 3UJEA 2XGZA 3GC2A 3OPSA 3RITA 3R0KA 4DX3A 2P8CA 3TJ4A 3TWAA 1WUEA 2PU0A 3H8AA 3RR1A 1EC8A 3SSZA 3RGTA
chains in the Genus database with same CATH superfamily
4YYFA 2OEKA 1SO4A 3RMEA 3ZR6A 3N6HA 3GC5A 2X50A 1H62A 1H7NA 5A95A 4OV9A 4XKMA 3GVQA 3OW1A 2WYSA 1QNOA 3MMUA 3J7HA 2QCEA 2GWNA 3HV9A 3DZ1A 1TO3A 2PBOA 1C93A 4M0XA 3CM4A 1SZEA 3OQ8A 1RH9A 5LIWX 3M46A 3SY1A 3CWOX 1S3HA 2GOKA 3IVUA 1ZMCA 1KFWA 3DYMA 2R24A 4FEZA 4XIMA 4PUMA 2R1KA 2QQ6A 1U2YA 3FKRA 2PTYA 1SZRA 1R5YA 2SFPA 3CQ0A 4EXQA 2WSYA 4AD4A 2ZE3A 2QPSA 1LF1A 3PUOA 2YZRA 3W7NA 3UPMA 2I17A 2WO5A 1FWEC 4RNHA 2X2GA 5F4WA 3LCIA 3R1ZA 3GNXA 1NF7A 2EAWA 4MWAA 2HSAA 3AIEA 3DFOA 4YS1A 4PFHA 7ENLA 2C14A 1Q8AA 2O0TA 2I5IA 4WKHA 4AHPA 3UPWA 2PFHA 2PBGA 5L6UA 1AL8A 5LHFA 4GCAA 4GO9A 2XN2A 1DJXA 1F2JA 3GLCA 3LUTA 3ARUA 4M51A 3W00A 3QHNA 2QCMA 4HNVA 1XIIA 1F74A 3O16A 1LP6A 4FPSA 3CQHA 1PTGA 4DNAA 3HQPA 1S5TA 1JZ2A 4O1AA 3FHAA 4NP7A 2QT3A 1Q2RA 1RCOB 2PWHA 4UFLA 3DGZA 3ATZA 4QAWA 3DC8A 1TMHA 1UG6A 4Y9OA 2G50A 5REQA 3LB0A 4RLIA 2CLLA 1BXBA 4YCOA 1F07A 2GGIA 3LMZA 3RHGA 3DG6A 1BSIA 5FMHA 4CCEA 3VOHA 1A5OC 5DMLA 3W7PA 4PTDA 1JUBA 1CXHA 2BX7A 1FIQB 1LRQA 5T26A 2PDGA 3ZIZA 3CPGA 1XS2A 3GU9A 5JBDA 3GWQA 2NLIA 1J6PA 1JCTA 3EWBX 1OFAA 3DFQA 1VCGA 1UKSA 4WY0B 1KV8A 4NHVA 1TZ9A 1P6BA 3O7UA 4C6IA 1HJUA 3ERPA 2PMQA 1EJVC 3DDMA 4GYPA 1P1XA 1QT1A 4AB4A 1EJ7L 5BOFA 2V2DA 4XV0A 4MMWA 3MSGA 3MZ2A 5CG7A 1FWCC 1LQAA 2OO6A 4D6GA 1V59A 2ZUTA 3MS8A 3T55A 4MYXA 1KGXA 3FA3A 3UWZA 5LSMA 5T8GA 1VFUA 3OGSA 1ITCA 3K1DA 2WP5A 3PBVA 4MKNA 2Q8XA 3ARVA 3RLUA 2FZBA 4ML4A 3SUTA 2J74A 5HUPA 3CV1A 4PUJA 3UJFA 1PTDA 3NQMA 2NV1A 3JZEA 4PB3A 1R85A 4UFHA 4IIGA 2HBVA 2VFIA 3ENLA 3NO5A 1QK2A 1UR9A 1I8JA 1ISXA 3HIJA 4EVZA 5EYWA 3L9CA 1GGOA 2X30A 4REQA 4PE8A 3F5JA 5G5IA 2CFFA 1LORA 3VDGA 1V93A 4D8ZA 3ORWA 2PWUA 3FG2P 1EP2A 4LXFA 1B4KA 4MB4A 1P0KA 4X63A 3TSDA 1A0EA 1A3HA 5I3FA 2X1TA 2GYIA 4HU4A 2R9RA 3I68A 2C6QA 2NQZA 3QSTA 4AISA 2WOQA 2VX4A 2Q02A 1TA3B 3CQJA 5EPDA 5IHRA 2AGKA 1E5NA 4H4YA 1EA0A 3LERA 2HNHA 4RDZA 2C1GA 2VGGA 1A5MC 1TZZA 4IQDA 1R9YA 1TV7A 4BKNA 1TTIA 3MMDA 2QUTA 4XISA 1UD2A 4HPNA 3KOXA 3LI1A 3PZMA 3L5AA 4GYPC 3G1SA 1H49A 3B0XA 1B3ZA 4Q8QA 4QLKA 2JGQA 2ZZ5A 1CNVA 2O56A 4W5UA 5BXTA 1BVNP 3W73A 2GGJA 2YVJA 2D0FA 4GXMA 1Z42A 2YLAA 2GSEA 3EX1A 3HOJA 2R14A 2IQDA 4G5DA 4FOKA 4NKCA 3P62A 1FP9A 4TTGA 1UR0A 2VFGA 1C29A 4HOWA 4KRTA 1UOKA 3H7UA 2ISWA 4KFPA 1HZYA 1BWVA 3WLHA 4AEFA 3GFXA 2X7WA 4PBGA 1UQYA 3NQ8A 4KCUA 3NVYB 2GDVA 2EEXA 4KQNA 4QLJA 5D02A 3ZFHA 5FF2A 4QE4A 1WV2A 3ITTA 2VI0A 4U2YA 5I23A 4IIEA 3ZVIA 4H4PA 5JRBA 4LS2A 3WQ5A 3BW4A 3PHAA 1GJPA 4J1OA 3DFSA 2YVGA 1B3XA 3A3HA 3M43A 1UH3A 3VO0A 3DHFA 3KWSA 2FKPA 4AWUA 5XIMA 1WQ5A 3KRZA 3L66A 4NT0A 1JG9A 1MZHA 1YXYA 2IS7A 1EO5A 1ZENA 3K1GA 3QVQA 5BU9A 3WF1A 3BGGA 1ML1A 2VNCA 2I14A 4F40A 4DM2A 4LUIA 2W54A 3OVRA 1TV5A 1TJPA 3FLUA 2TODA 5ABEA 4RPQA 4JX4A 2V5BA 5HMSA 2NXIA 5I5RA 3W72A 1SSDA 2EQDA 1HXJA 4QDMA 1BHGA 2QCDA 3N11A 4HMNA 2NZLA 3N2CA 4PCSA 2BNJA 4GNJA 4H00A 3SURA 2VVSA 2GJNA 2XVLA 2ZZ4A 5FF0A 1DXEA 5JQ9A 2CCRA 3S9YA 2DZAA 5EBUA 4UZUA 4ACZA 1OGGA 1RQHA 3MSYA 1JDFA 3N2TA 1VJZA 4MWAB 1MDLA 3W22A 2F6KA 4NJGA 1YIXA 4GG9A 3W24A 1KWKA 4RE2A 2FJUB 3IV8A 5GPRA 1UWAA 1ZX9A 2WMKA 4FXRA 1F6YA 1GRAA 1YMYA 4A8NA 3RJYA 5C9ZA 5EU9A 4B91A 4JYDA 5H8MA 1E1FA 4QLLA 1CZ1A 3AC0A 1VS1A 4U28A 3VNYA 5BW6A 3QW4B 3QLDA 3TOYA 1NOFA 3GXFA 3SRDA 6ALDA 4H4SA 3CZEA 3I6TA 5I09A 1W56A 1JPHA 5C9XA 4IPLA 4CU6A 3VKAA 2ZQ0A 1UPPA 4GI6A 4NRRA 3W7GA 3GSMA 3SGZA 2MUCA 2C0HA 1NY1A 3V0SA 4J3SA 1GSNA 3P5YA 2GVJA 3ZJKA 3IGHX 4GC3A 5L9FA 2CESA 4QXIA 3L2MA 1FBAA 5KZMA 1H2IA 3PSWA 1I2RA 2XISA 1K7FA 3E02A 2GJLA 1OF6A 2A7PA 1ONRA 2OT1A 3D47A 3M5YA 3EWYA 3VTRA 5C8BB 3AXIA 3C3UA 3L2IA 4AG0A 2INZA 5KEZA 4KWOA 3TTYA 3L23A 4L7ZA 1FDZA 1W0MA 3U2CA 2EQ6A 2HK1A 3TN4A 3I7SA 2BSLA 1O5RA 5DMMA 5CC3A 1C3FA 4FXFA 2UY3A 2YCIX 3LYEA 3VKDA 1TRIA 4RR4A 3CZJA 3FGCB 1TKKA 2YFNA 2H3DA 1NOUA 1LQ0A 3CV6A 2O7SA 3QGVA 2P53A 3GG1A 2ZTJA 1XI3A 1XBVA 3KDOA 4ZR8A 1Q6LA 2JK2A 3CWNA 2YOCA 4DZIA 3MYOA 1JR1A 1BQCA 3NUKA 4WLCA 2PWVA 5IXEA 5CZKA 3AWNA 3MUZ1 4JQ1A 5JMUA 3PJUA 4R9XA 1SZGA 3AIBA 3MP4A 4F2BA 1EH9A 4GQBA 3R6IA 4IGMA 1DIDA 3N18A 2R6OA 1T8XA 1J12A 3OYZA 1HW6A 2W9MA 1RD5A 5JUVA 2OODA 3VIMA 4NI8A 1NIUA 1PKMA 3A47A 1U5JA 1W1ZA 5JCMA 4JNZA 1OC7A 1V3KA 1HJXA 1JPMA 4OOZA 2ZUNA 4LU0A 1RQBA 2RUSA 2BODX 4K2SA 4AX6A 1S38A 4ONVA 4BV6A 1TV2A 4TUFA 3DCPA 2E6FA 4B3LA 3SCUA 1SFLA 4UCGA 2TYSA 3QV6A 4B3ZA 5FOOA 3B0PA 3U5UA 4JIEA 5CEWA 2V3FA 4LFYA 1JYVA 1I9CB 1A5LC 2EKGA 4YYCA 5BXSA 4XB3A 1SJCA 3GHUA 3NZ1A 4E2DA 2XN1A 2J7HA 1XFBA 1ZBCA 1DEDA 1YPFA 4ZO7A 2Y1HA 1P43A 4OUEA 3GTFA 2G4JA 2ZUUA 4DO6A 2OXNA 3B05A 4LUSA 2F61A 3WF4A 1LL4A 1T0OA 4GI8A 3DFTA 5CJ5A 1E5JA 2BHYA 4B5SA 3U2EA 2WZHA 4DEFA 1CENA 2YIHA 4S3DA 2NVCA 3G24A 3NL6A 4JTEA 4XO6A 1E6SM 1GYNA 3RPDA 5CBJA 5E70A 3HG5A 4PUWA 2FTYA 2OZTA 3LNPA 3T81A 2YL5A 3SIMA 3H7VA 3FOKA 4TVWA 4JICA 4DO5A 1CIUA 3NVDA 3PZNA 2VRJA 4E6MA 1TVPA 2CLMA 3R2GA 1TJRA 1QDSA 3TJLA 5JXQA 4IPJA 4IF2A 4JZ5A 1K6WA 4UMAA 4N02A 3VOJA 3TYDA 3IARA 4P7OA 4KFOA 4XBSA 2DIKA 3H2OA 4KBXA 3OP2A 3ZJ7A 3GU2A 1QI5A 3SCSA 2YBTA 3W7QA 1FDJA 1S5NA 4RDVA 4HBKA 3F7JA 2GWGA 2XDFA 4GI9A 3NQ6A 1XW8A 1IWAA 4PYSA 5U4NA 1FWGC 1VEMA 3CT2A 2CXEA 5FJRA 3K4AA 3W7JA 3FEQA 4I7VA 3WH5A 1GYLA 4R7WA 3P61A 4DBEA 2QEZA 4C6CA 5G1MA 2WP6A 1W3IA 1KR0A 3FDGA 1VR6A 2OYMA 5CAHA 3OIXA 4QROA 3NZGA 1WZAA 1ZJAA 2A3CA 4M29A 4C6NA 3NYDA 5FIPA 1NFPA 2V9DA 3FJLA 5IDIA 5E6ZA 1SQ7A 3P5ZA 4HA3A 4Q8WA 1U5VA 2GK1A 3N17A 3RITA 4J4KA 1Y0EA 3JUGA 1EEPA 3TWAA 4YNGA 1VEOA 2CKSA 2IUZA 1CGUA 3LG3A 3A5FA 4RUBA 4Z1DA 3RGTA 3KP1A 2QUMA 1JCYA 1XDLA 4BURA 4PTNA 3C2VA 5ABHA 1M7JA 3O8AA 3VOIA 1R30A 3CZGA 1XIEA 3UXLA 3RO6A 3VD4A 3JW7A 1FA2A 2XINA 1V5XA 4R27A 5BRBA 2XFFA 4S3GA 4F8XA 3OC4A 3W7KA 2OX1A 1P6WA 4ZOEA 4AD5A 5JCKA 3MCNA 1GVRA 1O60A 2I9UA 5HR7A 4JQAA 4O15A 4UQDA 2XSBA 1A4MA 2OU4A 6TIMA 2BOFX 2L5HA 3NL3A 1LM1A 1JXKA 1GVQA 3DKLA 1V7AA 1KV5A 4N9CA 3B9NA 4QGCA 1J18A 2E0PA 2HPMA 3W29A 2IPJA 4IMCA 4Z17A 1TV4A 1LJYA 1NQ6A 2A3EA 3RPTA 4W87A 3CL7A 2XZ9A 2OGYA 4CLMA 3PFRA 3UD6A 4XD5A 3W7EA 4DWSA 4LNYA 3VDBA 3FAWA 5LNVA 1A53A 2R1NA 6CGTA 4K3ZA 1KTBA 2J8TA 2W92A 3B97A 3TN5A 1GQKA 3WBEA 2OGJA 1GCYA 3Q2DA 1EZ2A 3KL0A 5A3HA 4UR7A 1W5MA 3H2MA 2EPNA 1ZTVA 2JF7A 2QUUA 2WWDA 2R1PA 4RCXA 2F9RA 1PZ2A 3BLPX 5BXRA 4M7TA 1OT2A 3FXYA 1HIZA 3GD4A 4Z0JA 3TN3A 2P0OA 3GH5A 5JCNA 3POHA 1VCFA 4XZ9A 3KOWA 4LAMA 2GPTA 3O0FA 4JTLA 4FSAA 4XZLX 2E5BA 1KCXA 1W1VA 4IWWA 3G1RA 2DVXA 2FFIA 4K1GA 3G1HA 4KEUA 4TQTA 2J13A 4MTVA 1JVNA 4PCNA 4M52A 1OZQA 2E09A 3VZYA 2WCSA 5C2CA 1WE5A 4X60A 3W1XA 2J77A 3GFYA 4O1CA 1ZRQA 1GERA 2BGNE 4LVAA 2NVKX 4JS3A 3ABZA 5IRPA 3S5OA 5AYZA 3URHA 3WDRA 4IX2A 2BMBA 4M82A 4HOXA 1XLMA 1KA9F 1RZMA 4H4VA 4FS9A 3L0NA 3UG8A 1ZCOA 4ADWA 2ZUWA 3EX4A 1SR9A 5EL1A 4F0KA 2J7EA 2ZICA 4P7NA 1J4EA 4GXPA 4JTKA 1CXEA 4K7YA 4AIBA 3HPAA 1B3YA 3BV7A 5A94A 1EJWC 3LBOA 1VBRA 4WJXA 4HHLA 2ZUVA 5DY2A 4HA0A 3E38A 2NUWA 4AEEA 4FHAA 3V5FA 5EMMA 2ZDRA 3I3DA 2DJXA 4EWND 1X8FA 3N4EA 4JTGA 5LGZA 3LHUA 1RR2A 3MMTA 3XINA 3U2OA 5JU6A 1AQMA 4IFKB 3W1MA 3EAUA 4UFMA 3KCJA 4DIAA 4J3VA 1F3WA 4LYPA 2A1YA 3MV01 1I2PA 3M0ZA 4P7LA 2J9YA 4POCA 1NHRA 5G5HB 2O7QA 3NRZB 3CEPA 1GW1A 3H70A 4WVXA 1DORA 1V6TA 3LDVA 3Q58A 3QKZA 3E0FA 4GQRA 1JNDA 4C1KA 1H50A 2YCLB 1VFSA 3KE0A 1OYAA 1SO5A 4YVPA 2VUNA 5HQLA 3HMCA 1J2BA 2FTPA 2V5CA 3WEMA 3LHWA 3GD3A 4MM1A 1UIOA 5CG0A 3B4UA 4DM1A 3OZYA 1YNYA 1TWIA 3USZA 2GSHA 4GVIA 4JNMA 4CCZA 1H2JA 2QGYA 1ZJBA 3MP5A 1B2YA 1UA3A 1X6UA 1P1MA 4LWWA 4C1LA 1X38A 5DT7A 3RDKA 2EQ7A 2B7QA 2VEMA 3B0VC 1JQVA 1OM0A 3CWHA 1W1B1 4K8DA 3ARQA 2WLYA 5G4HC 2VGFA 5M5DA 4WGHA 5HPCA 3L4TA 3NR0A 3IGXA 4O50A 3ABOA 1LVLA 2ACSA 4LSBA 3TH6A 4NYUA 1M7PA 3CUHA 2X1RA 5JH1A 4D72A 3TVAA 2PC4A 1N8IA 5CZJA 4Z1CA 3GS6A 4O0QA 3KX6A 2QAFA 2PWGA 1OINA 4NASA 3IAPA 2NWRA 2OEJA 2CBIA 3SN0A 3HG2A 3VNJA 2ZA2A 3C0QA 1UBSA 3CHCA 1PIGA 3TSBA 4IIHA 1E73M 4Z2IA 3SFWA 4KIRA 4JNYA 1IEVA 3U48A 1S5VA 4NVTA 1OFEA 2Z7KA 1AFSA 4LQ1A 1KXTA 1P0BA 3SUWA 1TWWA 1FCBA 3NG3A 1BXNA 3IUDA 3DGHA 1TVLA 2W79A 4JHMA 4Y8EA 3BC9A 1YPXA 5EBAA 1W9UA 3R25A 1OG6A 1JAEA 2Y61A 3STGA 1WDWA 3BVJA 2BS9A 4GJJA 2R1MA 1JRBA 1S2TA 2B0MA 1XKYA 4BFAA 1GPFA 2X7VA 4QS5A 2WMFA 1EA9C 4LTSA 3LEPA 3WUEA 1FKWA 4IFRA 3E96A 1MNZA 3PG8A 1Q6FA 1N62C 2YCLA 3KBMA 2J7FA 4GLEA 2IXUA 1CYGA 2PB1A 3N4AA 4IL2A 3SZ8A 3ZT6A 1POJA 2PDUA 4HZ7A 4ZENA 1TWDA 4US6A 2CWNA 4CGTA 3LQLA 1JYXA 1JXJA 3HPFA 1FWIC 1XGZA 4C6QA 4MJ4A 3MUXA 2FGBA 2A7NA 3R11A 4D1JA 4GRTA 2YJQA 1B31A 3A24A 3WJWA 4H8NA 4A2SA 4GY1A 1FTXA 1EXPA 1HO4A 1ZU8A 3CXBA 3G5EA 2XVNA 4JTFA 1E9ZB 4I9TA 2ESCA 4AF0A 3OLGA 1X1NA 5DCBA 2XM2A 3E3HA 3UPBA 1ODZA 5G1TA 1UWIA 3PZGA 3TROA 2O9OA 3TYCA 3M7SA 5HMDA 2WPGA 4F0LA 1NELA 4HU0A 1XJBA 3VAVA 3N25A 3QQ0A 1WBHA 4DUWA 4F2UA 4KRZA 1VPQA 3TSMA 3W7DA 3NPVA 4B15A 3UQNA 1H4PA 2VC5A 3W1RA 4AZHA 1K4GA 4ZO8A 5A6KA 3W7CA 1EQPA 2NX1A 4CN6A 3M16A 2OVLA 4S3JA 1XH0A 1MW0A 3AS3A 1PWMA 1Y65A 2BDQA 1Q13A 4PB5A 1TJ1A 4P8XA 4LUSB 1MVYA 3AISA 3VD9A 3EF6A 5HNRA 1WPCA 4PBEA 4HU8A 1HKVA 4GXWA 1EOKA 5U25A 1VH7A 3VMNA 4MADA 1FFRA 4JKMA 2YVFA 4K7VA 3SSJA 3VE7A 3CNYA 2W62A 5F7UA 2Y89A 4WD0A 1J2WA 4CQBA 2GDQA 3F03K 2WCGA 1SVDA 4JDYA 3VGHA 4CKQA 5CPTA 2Z1VA 1MOKA 1NP2A 2V0TA 1FY6A 3UXKA 3QR3A 3C5QA 5EKYA 1REQB 1A5UA 1VEPA 1TIWA 2RDXA 1JZ5A 3W07A 4XKYB 3N1AA 2VEPA 2OLSA 4GQQA 2PLKA 2J62A 1XYFA 1F3PA 4B2DD 3AQUA 4H9MA 4DUXA 1TPUA 2H9AA 1JCNA 4OECA 1BAGA 4HNUA 5IDZA 3UESA 1RK6A 3HGOA 3NA8A 5D38A 5E0CA 3TR2A 3ANYA 5CC5A 2A8XA 2DZUA 4IL0A 1K1DA 4CU8A 2P50A 3T09A 1IIHA 4M24A 2Y85A 3KZSA 4YN5A 1ZBKA 3N12A 3WDJA 1ZBVA 4JTQA 4RDWA 4J40A 4D8LA 3NDYA 1DIEA 1VF8A 4Q22A 4MDOA 2CZFA 4DJFD 3LBMA 2VWTA 2C18A 4LYQA 1MXDA 3WLIA 4AZCB 4HQVA 3S83A 1S2CA 2GR0A 1LBFA 2C8NA 4E3VA 3PC0A 3GXMA 1UKQA 1GUVA 2ZYFA 4JTSA 4XZHA 3C61A 3PK7A 4LRSA 4JTJA 3WCZA 4U3CA 2PDNA 3GIQA 2R1LA 1NF0A 3WMCA 3NWRA 1B1YA 1XLHA 1UKOA 3FNDA 4O11A 1HL9A 4TVYA 2XIIA 3ZT5A 3IK4A 3VIFA 3LCGA 4E8GA 1Z44A 3SY8A 2YDSA 1V02A 1O6IA 2DORA 4TU1A 1LRTA 4F9JA 3WLQA 1F61A 3LGEA 1GEQA 2BG5A 4OIFA 1VAHA 2OX4A 2HV5A 3WF3A 4OWGA 1GREA 3WD2A 1V3HA 2VP8A 1DJYA 3I3EA 1C8YA 6XIAA 1Q4NX 1DP0A 4OHQA 3Q4DA 4HHMA 3GKFA 1B9BA 4X3ZA 1G0CA 3WD0A 2WKGA 4US5D 1US3A 3S1UA 3VINA 3GNOA 1Q6EA 2VX7A 4M6VA 4I8DA 1ALDA 4O12A 4AIEA 4FIRA 2PDXA 1I45A 3NQDA 3GXTA 3DH7A 1KQZA 3ARXA 2WOVA 2J7DA 1V02E 3HURA 4O14A 2PGRA 1WKYA 4E0CA 3QPEA 2O9RA 1H63A 4NEWA 3I7QA 4JFUA 4LAUA 1REQA 3G3DA 3Q45A 4TO8A 2F2KA 2WNWA 5A6AA 2FPVA 3LTSA 1ODUA 4XBJA 3QHMA 3NNTA 5GJMA 5JCLA 2GDUA 2ACRA 4M6UA 2DZTA 1S3TC 3ZQ9A 3BL3A 2V69A 4D6FA 1RY8A 5DEZA 1RLCL 2D1ZA 1YE4A 4KCVA 2E5CA 2XH0A 4HHPA 4U33A 3WQWA 3R58A 3PJXA 3OG3A 4Y8FA 4N9DA 2ZOXA 4INFA 2YL6A 1PHWA 1CT5A 3G77A 4DWSC 1UZ1A 2G41A 1GOXA 4EOUA 3URAA 2XG9A 1G4EA 1XUUA 4PRTA 2VOTA 4IJBA 4HKPA 1QU4A 2XH2A 5B80A 1EWEA 3RMJA 3SQMA 2EKCA 1YE6A 1H3GA 3OA3A 1TYTA 2WNNA 1XSKA 2G0WA 1BTMA 4K36A 4C65A 1EGZA 3B9JB 3OOQA 5BZAA 4H8HA 3AMLA 3WJYA 2QF8A 4AZCA 4DXXA 3RFAA 3FX4A 1GETA 5JH2A 3OB8A 1U1UA 4W86A 1H41A 5D32A 3UP8A 1A5AA 1XYZA 2ZWYA 2JIWA 2QR6A 2V3GA 2EQ8A 3E2VA 3LPOA 3L2LA 3A4AA 2CFYA 1OVDA 4ZQOA 2IKJA 4XTDA 1RSCA 1Q6OA 4KPLA 5GVJA 3FFSA 3WQFA 2DJLA 3P0XA 3LTPA 3T40A 5KETA 3NZPA 4PCFA 2E40A 4M6QA 3WN6A 2CHRA 2RAGA 3CH9A 3BDKA 3VVGA 3O3RA 4NUWA 4CCCA 1NHQA 4O8AA 4AZ5A 2XTKA 5FJTA 4DZAA 4WDXA 5I79A 3OLEA 5J8LA 4A3QA 1IEWA 1RA5A 4F2TA 2ZRVA 3PP7A 4XVDA 2FDMA 1DWAM 3RX3A 2ISFA 1GQIA 1TSIA 1TX2A 2GVEA 4NAEB 2FZ8A 3N04A 2VCAA 4W89A 3H7RA 3POCA 4LJ3A 3N73A 4K39A 4L1XA 3CZ8A 1RJPA 2NWSA 5HMFA 4UZSA 3NEHA 1HUVA 3F5LA 1E0UA 2YLLA 2VO5A 3OLIA 2PURA 3F2BA 3DJJA 4E4FA 1ZCCA 3C0SA 5EMYA 2QIIA 4JY8A 2QJMA 4EPKA 7CGTA 1QI3A 3W01A 3TJIA 2XFYA 4OU1A 2E6AA 2ZA3A 1DXLA 5DXXA 3T1GA 4Y9MA 2HVNA 1KM0A 3LPFA 4ZOAA 1C91A 4YMZA 5CSYA 3BQ6A 1Y5WA 2OR2A 1AH3A 4GR1A 2CYGA 3GDTA 5CSRA 3HRDC 4B4HA 2GR2A 2VENA 5SWUA 1AVAA 1O68A 3GO2A 4H2CA 3MT1A 4AZGA 1AH0A 3S1VA 3QFEA 3S2MA 4S3EA 3BGAA 3G1DA 4L5ZA 2OYKA 4DWDA 2GR1A 4DUVA 3XISA 1KM3A 1UQZA 1TPDA 4I9MA 1YNPA 3T0DA 5HQEA 2JEQA 3L4VA 3NDZA 1M7XA 5DANA 2Z1BA 4D1IA 1A80A 1OC5A 4MGGA 2DZXA 1FWJC 2DQXA 3IJ6A 4ICNA 3K5XA 1VYPX 5T9CE 4B4FA 3KVJA 1Q7QA 1OX4B 1W32A 4UNLA 1E6NA 3D0CA 4O1DA 4UMBA 4NNCA 4C6KA 4PA8A 1MW1A 2Z0IA 3W2LA 1XPYA 4H8UA 3W28A 4OJYA 2XFRA 1UMLA 5F1UA 3SQSA 3CQKA 4JX6A 1ZBWA 1XUZA 4AAJA 4FX9A 3NQGA 3WFLA 3GTXA 1VCVA 2PUZA 4ZCWA 2J9XA 4LGXA 3QH2A 2JKAA 2PDKA 3O0HA 2ZC8A 5AYXA 8A3HA 2OSYA 1GZGA 3IGSA 5FJUA 5HJLA 1W8GA 1SO3A 3AROA 4KCWA 2ZZ2A 1GQNA 3JU2A 4JDRA 3AYRA 1KKRA 1GJWA 3NVTA 1MI3A 3N2BA 4Q32A 4M6PA 3WFAA 4UQ9A 3ICJA 3TTSA 1KQYA 1OCQA 1SGJA 4NX0A 3VIIA 4PFMA 1DPMA 3P93A 3R10A 1VB9A 2OLHA 2E5AA 4NI3A 3GTHA 4RKAA 2G8ZA 4Q7NA 1HKKA 3IS4A 1OJXA 1D3GA 3QOKA 3B06A 4H04A 4LOCA 1NJJA 3N2OA 1R3VA 2NVAA 4KIEA 3SCQA 2XFWA 1ISZA 3A13A 4F4RA 3ARTA 1U1HA 4NXKA 4TVDA 7REQA 2OWCA 4BF7A 3MDUA 1OD0A 3BLKA 2ZX7A 1PHQA 1GXFA 3GRSA 4P61A 5HOSA 4JIHA 1YDVA 4MWAE 1L0PA 1XLDA 4MPKA 1Q1WA 4QFUA 3MWCA 2YX0A 5C71A 5BCAA 3CGDA 2I5GA 4JCLA 3EOEA 4H19A 4J3TA 2ZUMA 3GKAA 3VMPA 2Q71A 4GACA 4WDTA 3Q37A 4IP7A 1SPQA 5XINA 4QJ4B 5KMYA 3V4BA 4BQ4A 5FJOA 3M0MA 3RM9A 3F4VA 3B0YA 3PPFA 2W55A 3SDOA 3TQ0A 3GZ3A 2Q3OA 4WXYA 1US0A 4J3WA 3UY7A 5AC5A 1E43A 3IWPA 1E15A 1JGIA 1W3LA 5EMLA 4GY7A 1BRLB 1L8NA 2QDEA 3THDA 3MPGA 2ABBA 3VX0A 3FYYA 1NH6A 3GHRA 4Z2KA 1EDGA 5IBXC 2OPJA 3H4XA 3KHDA 3VX1A 4MFDA 2O92A 4DYEA 4GQGA 3G0XA 3N29A 3PTQA 4O52A 1FWAC 5AVNA 3M64A 4PEEA 5FACA 5CCZA 3EOUA 3R13A 2WWCA 3U2ZA 4HTBA 3RR4A 3WNNA 1KB3A 4JOMA 3WD3A 3QYQA 3W88A 3M0LA 3P3BA 3MBFA 3OVGA 2GGEA 3WH9A 3AIRA 2BOGX 1KRCC 2KZHA 2YW4A 4TR9A 4HSNA 2CKRA 1TPVA 2PU1A 4AWSA 4DO7A 4UTJA 3WK3A 4IMEA 4Q4OA 2Z27A 2GGGA 9CGTA 3PZTA 4AWEA 4XAGA 1V0MA 1H1ZA 3RJXA 3T05A 1E4LA 2PDLA 3SCVA 1GESA 3UFYA 1G7VA 3SRKA 1KN0A 1OSEA 2QIWA 5AHIA 1F4AA 3ITYA 4GKTA 1TPB1 3AIVA 3CHDA 1UJQA 4JEQA 4WZHA 1SZFA 2YQUA 3UA4A 1SW7A 3PN8A 4DJEC 4ZB5A 2FZMA 3WD1A 2GQ8A 4DB7A 3M0HA 4QX4A 2H6RA 1G94A 2DY3A 3GUGA 4H1ZA 3GUWA 4CVUA 1RVGA 1ECQA 3V7PA 1IR2A 3RM8A 3TAOA 4IP5A 1KXVA 3WNOA 5CQ1A 3GDMA 3DFHA 3LRMA 1MYRA 4MJMA 4AMCA 5CPSA 4C7GA 4IUOA 4AZBA 1BXCA 2YCEA 4QJ1A 2AOSA 3PWIA 2OG9A 4GVHA 2DZVA 1ITXA 3AMGA 2IW0A 1PKNA 2WM0A 4EE9A 2PDCA 4IZGA 3GR7A 4LBRA 4AIOA 2QJIA 2YDQA 3VNLA 3IJ8A 4PTWA 2VURA 3GX9A 1MW2A 1B3VA 2Q8LA 3TMLA 3WG6A 1BFNA 3LZ3A 1CTNA 4QDWA 1WNOA 5A8OA 5FEZA 1P0NA 5AYBA 4QS6A 3WUGA 2G3IA 2VGBA 4IXXA 1FKXA 3GXIA 4WDWA 2XM1A 3II4A 4A05A 2FJKA 4ZEPA 2D3LA 4WIWA 1UASA 1JCXA 3MCOA 1X2HA 3T0TA 3STEA 4AD1A 1XFCA 3W1PA 3B9AA 5C7HA 1D8CA 1UWQA 2Y2WA 5CZSA 3C2RA 3DHUA 4RV8A 1VP5A 2YR1A 1NVMA 4S3KA 2W61A 1JPDX 1KGUA 4M8UA 2YDAA 8TIMA 3EUB3 3FW6A 5LZLA 3GBDA 1DXFA 4XIAA 3W76A 2DZBA 1EQCA 1I1WA 3BSGA 1UKPA 2Y6ZA 3S8HA 3M0VA 1RQEA 1JCMP 1OFBA 3AU6A 1DNCA 1AG1O 1TQJA 4GA8A 4MB3A 4EIVA 2Y8VA 5CJNA 2QNEA 1QNRA 4KT2A 5IHSA 4LUJA 1E3ZA 4S2CA 2A3AA 4N4QA 2YXXA 3S4TA 1BVZA 2BFGA 4AVNA 4LY4A 1NDAA 1NDYA 3UY8A 3B0UX 1LBLA 4J9JA 2ZC1A 1AD1A 1OQFA 2C7FA 4EP8C 3CUFA 4XKYA 4ORIA 1JD7A 2PC8A 4DF1A 3UG5A 2RGLA 1RBAA 1QW7A 3KFTA 5CLTA 3THUA 1UKTA 3EKGA 4L80A 4AZIA 3H54A 1HKMA 2WSRA 4PN2A 1W5PA 4FF5A 5HAOA 1ZAIA 4AD3A 4MOZA 2AMGA 4GZJA 5F2IA 1LRNA 4DF2A 2FB2A 4O0ZA 3EWWA 4H9TA 4GJ1A 3ZO9A 5CC7A 1EJUC 2V5JA 1HKIA 3GG8A 2ZUSA 3MUY1 3K30A 3U8GA 3BLIA 2W5FA 1JDDA 4XUGA 1HKJA 4BEQA 4ICMA 3QQWA 1KLZA 4DRSA 4R7JA 4MG4A 3BE7A 1KBJA 1UC4A 4L4MA 5LNSA 2VUYA 3HA1A 4WKAA 1DYSA 1EFZA 4W9TA 2IPWA 4S3CA 4GE8A 1GZ1A 1D7YA 3L21A 1PIFA 1W5OA 2FIQA 4IQLA 4RW5A 3NQ7A 2QV5A 1TE6A 2NT0A 1M6IA 1GEHA 3TW6A 1I60A 4H9XA 2EPKX 3GG7A 4HNOA 4WX2A 1RHCA 1ESWA 3G1AA 4MNKA 4L4OA 1MMFA 1TPEA 2AKZA 4ZE4A 4FLOA 3ZM8A 1W1YA 1V6VA 5G1YA 2QCFA 1H60A 4G6CA 1E6PA 1ZKQA 3PNUA 3KLKA 1ZSXA 4BS0A 3VFCA 3W7RA 3A21A 4AFYA 3QGAC 1M53A 3PULA 5FF7A 5KZDA 1BEUA 4G8TA 3AU2A 2XSXA 2PLJA 4HT3A 3GNPA 4GK8A 3NOEA 4NAEA 1QATA 2FMNA 4B5VA 1Q7ZA 2J6XA 3RRXA 3QC3A 3SFKA 4L64A 3PBUA 2A4AA 1IQ8A 4RJEA 4B3KA 5BWFA 2WW5A 1TUFA 3GRIA 4IIFA 1E0WA 3PZIA 4I5XA 4CQ9A 4Q6JA 3SY5A 3WMBA 4AZ6A 1JUEA 4FIQA 1ZB5A 4GPNA 4J3ZA 4XAZA 5CPMA 3B8TA 3G1XA 4E5TA 1V51A 2DT0A 1AUSL 4PUNA 3WLJA 3EA2A 2Y0FA 4V2XA 4F0HA 1ICPA 2RDTA 3ZMRA 4M5PA 5I3DA 4UBPC 1XANA 4A3RA 3BUVA 3W2NA 3PNZA 8XIMA 3CIXA 3H24A 2CDUA 1UUMA 4R9OA 4W93A 1LTDA 2QJJA 5DCDA 1D9EA 2PP0A 4U3AA 3DK4A 2GUYA 3DU0A 3TQPA 4S23A 3T2OA 2YL9A 3MSDA 4U31A 5LHEA 1KO0A 2W0HA 4ATLA 4JQ9A 1DQXA 5C7VA 1OGBA 4K68A 1VFHA 2Z28A 5ABFB 4FOUA 4KH2A 4AC7C 2F6XA 4V1YA 3SO7A 1FOBA 3W1LA 3APYA 2W3RA 1Z3NA 4DX3A 4DLMA 1WXJA 2UY2A 4S1FA 2GFTA 3GE7A 1WUEA 2PU0A 1JEZA 4C6PA 5C55A 1OX4A 1R3TA 4NJKA 3VNKA 4DBWA 5BRPA 4EK7A 3BJFA 4EANA 1ZQ5A 1PX4A 2HROA 5FJJA 4B2DA 4Y9AA 3OA5A 1GVEA 3RN6A 2YXOA 3BCJA 4GZIA 3L5OA 4WUIA 3A7RA 3TA9A 1FWRA 1VIWA 4Y90A 4FNRA 2FVLA 3CIWA 4ZQPA 3SI9A 4W88A 1DJHA 1STZA 2RDUA 4V33A 1N55A 1J0KA 4DJED 2BLEA 3KEHA 4U2ZA 1XHGA 1KCZA 4WSKA 3JS3A 4HD5A 4GQ0A 4EPDC 3E5PA 3H22A 1YTDA 3N3MA 4TX9A 1FDYA 4IFOA 4DAFA 4DJFA 4FP1A 1VHNA 1SMDA 3FEMA 2V5LA 2W3ZA 4ZOHB 3DYPA 3CPUA 5E09A 1ZUAX 1GRBA 4KEZA 4G7EB 4NAFB 4QP0A 3QYSA 1ZNNA 3ARZA 3WQDA 4O57A 3LV5A 1R3YA 2ZVIA 1EP1A 4PULA 2E1DA 3OLDA 2DEPA 3W53A 1PDYA 3K13A 1ZJHA 5DMNA 4FMVA 5TF0A 3O6CA 4HNNA 4O4VA 2XN0A 1H61A 4MWAD 3WDPP 4IMDA 5FJPA 1YKWA 4Q4QA 3SQLA 3KBNA 1H0IA 3T2QA 4AY7A 3GNNA 2R8WA 2Z4GA 2H3BA 2WVVA 3P60A 4BI5A 1N82A 3VC5A 1CWYA 4CVWA 3P14A 1Q2SA 4YVXA 1PX8A 1A47A 4MFEA 1HVXA 3YPIA 4TTUA 2JIEA 1BGAA 4ADUA 3OEXA 2B31A 3V1PA 1Y7VA 3UZZA 1R3SA 4C7FA 3SR7A 2RJGA 4GX8A 2TRSA 3MTWA 1X98A 3G8EA 1SB3B 1DOSA 1RV8A 1I2NA 4QEEA 3S2CA 4KGLA 2VEKA 4OBRA 1O95A 2VFEA 1KKOA 5FSEC 3S2LA 4C90A 2ADAA 3LXBA 3KAOA 4CN4A 3QRHA 4EQRA 1X6LA 3OGRA 4O0KA 1DJQA 3LCXA 2QVNA 4H7VA 2IKGA 1W1TA 1PPIA 4GYKA 1ZK7A 2WMIB 4NG3A 2QCLA 3EOOA 4AY8A 1DTNA 1AD4A 2WBKA 4KERA 1TCMA 1KFJA 2XUCA 3KVLA 5DFAA 2WAGA 2R94A 4P5UA 1O66A 4M1BA 1WXZA 3B8IA 1O5QA 1QWGA 3GVVA 4C7DA 5FJIA 3TNBA 3KVKA 1FFVC 1DJIA 4D6IA 1Q6CA 1VZWA 4A6GA 4UQCA 4JYEA 2OB3A 3O6DA 2X40A 4DJDC 1KM2A 1FCQA 4WQ6A 3WLTA 2X8RA 3GY1A 1K9EA 4Q6XA 5HATA 3QV9A 5D03A 3PB2A 3P7YA 4AD0A 4H4WA 1F3EA 1CLKA 3I4KA 3LZ5A 1TJ2A 1QI4A 1WDRA 2WKJA 1H1YA 4GZEA 5ECVA 1VJSA 4PRRA 1XCXA 3EOSA 1TWSA 1UIPA 1Z6KA 2G4FA 4AX7A 5AC8A 3W6LA 5F2LA 1KBLA 1H7PA 3PZ9A 2X05A 2VYOA 3CL6A 3VD5A 2PE4A 3MKKA 5I3IA 1RUSA 1GNXA 4UUIA 2TPSA 4QM1A 4B9YA 4LVFA 3PANA 5A8QA 2XVGA 3WLMA 1R87A 2J25A 3E0IA 7TAAA 1RXOB 4WF7A 4O4WA 1PL9A 3TU9A 2VMFA 1OFDA 3A6OA 3E1F1 5K9XA 4X2PA 5I78A 3TK7A 5DMYA 1LOSA 3H21A 2VZUA 2YW3A 2GQ9A 4NZ5A 3E5BA 4GMEA 1OYCA 1L9WA 1F4HA 1IXNA 3SUVA 4J56A 1UUQA 1LBMA 4XAPA 3TC3A 3B04A 3IC9A 3GYEA 4MY1A 3ARPA 1ZY8A 2ANUA 4XSMA 2WJFA 4PMJA 1L6FA 4UTFA 4R7OA 1V6WA 2CWXA 4YLWA 1U1JA 5I7GA 5A8NA 4JBRA 1NDWA 4IH3A 3UWUA 5GQBA 2VDHA 3PZOA 2Y88A 1CECA 4NZFA 1JNEA 3EBVA 3OHMB 2Q09A 4DBUA 5LGXA 1K3UA 1PCWA 2V82A 3BZJA 2D3NA 3VPLA 3RUBL 3WJZA 3EWZA 1EIBA 2BWGA 3VZZA 3S42A 1IXQA 3DK9A 2V3DA 4ZOBA 1J79A 2PCQA 3SEPA 1WYIA 3TOPA 3ZLHA 2PCEA 1I4NA 3IGUA 2V2CA 2ZXDA 3BSMA 2J7BA 3NL5A 5DLCA 3G0SA 3QMTA 1QMLA 2VR4A 3UCCA 3WQ4A 3TC7A 4QNEA 2GJXB 2ZVRA 1UB3A 3ONBA 4B90A 3EXRA 2WM1A 3U9IA 4ADSA 2CC0A 1E3XA 3BTNA 1BLIA 3NM1A 5EGRA 1BVWA 2Z1XA 4V27A 5CBBA 3HG4A 2DQWA 4NJJA 1E72M 3CJPA 1X8CA 3CQIA 3GNDA 2PI6A 3LADA 1O7AA 2X1SA 3THAA 4KWVA 1AK5A 3WZ0E 5K2ZA 3LHTA 1TWZA 4NY2A 3S6OA 3UETA 4GABA 1WBJA 1K4HA 1WDSA 4I7WA 4IGNA 4Z08A 1GOIA 3HPSA 1XH2A 3SSZA 2VEFA 4PL1A 4CNNA 3UXIA 2DP3A 2JALA 4JTRA 1V0LA 3ALFA 2QF7A 2OZ8A 2J88A 2RKXA 4O19A 1X97A 1QHPA 3A5VA 4LBSA 4MAZA 1E9LA 3GDBA 4JD4A 4YWIA 3TKFA 2IPFA 3ZWSA 2QZRA 1GTEA 4AU0A 3D9XA 1W3NA 3LOTA 3UWQA 3RLVA 4H7CA 7ODCA 4QQ3A 1JGMA 4KWUA 4YWSA 1UP3A 4URIA 3E6EA 1WZLA 4QTGA 4JAWA 2JKPA 3LS9A 1W9XA 2QGHA 2ZRXA 1HJQA 3OG2A 2Z1WA 3WNLA 3MUIA 4YL2A 3NO1A 2J6VA 2F2HA 4N7QA 4AMAA 1BYAA 3WBYA 4WXZA 1XHCA 3EYPA 3GQYA 1NP0A 3IIPA 3VU2A 3PG9A 1KWGA 3U6WA 1E6QM 3E74A 1XISA 4Q4RA 4UTHA 1JFXA 3RILA 4ZB2A 3C2EA 4AZ7A 4EPEC 1A5SA 5AC4A 5KINA 2RH9A 8CGTA 4DWSD 5I00A 2HJPA 3W82A 3S5YA 1UWTA 1YDOA 3CUJA 4Q8NA 2VC6A 4PB4A 1EBDA 3KP0A 1PIIA 4JR5A 2VC7A 3E12A 3LPPA 4GRSA 4HZ8A 4MNJA 3W1NA 2XWEA 1TE1A 3N9KA 2Q3RA 1NOWA 3WQEA 1E1CA 3UR8A 3VDCA 1K7XA 3KLLA 3H26A 4EXBA 4L6DA 2A6LA 3W3OA 3QBUA 3FA4A 3QY7A 3IIZA 3A4WA 2WJZA 1C7SA 2ZADA 5FD0A 4GFSA 3IVTA 5HQMA 2WHJA 4DI9A 2XYLA 2VR5A 5M3WA 4MAVA 4PGLA 1DKWA 2EPLX 4XK2A 5F2GA 3IACA 3WK0A 2QULA 3VGFA 1E0VA 4PC8A 1AH4A 2NLYA 3N15A 1GK8A 1XH1A 3VDAA 2E25A 1B3OA 1EXBA 1T96A 4W7VA 4L6OA 1G1YA 3AXKA 3MKCA 3JZUA 1P0DA 3N13A 2EQ9A 1EZWA 3C86A 1SFTA 4KFNA 5F1VA 1LG1A 2CNCA 3B03A 4MY9A 3VKJA 4JTAA 1W17A 2WJEA 1CW2A 3IJLA 1S2AA 4IT1A 3R94A 4BF9A 2VD9A 4TVUA 1UR3M 3BO9A 3N19B 2E6DA 3TZFA 3D5HA 2WMGA 2P3EA 3IJQA 4HCHA 1PXGA 4NNBA 1UOZA 4IMAA 4BA0A 2A7RA 1Q5MA 1W2VA 5CGTA 3TDFA 4LEQA 3CEUA 3IJ7A 1L2QA 1RJQA 3NGFA 3KBSA 1EHNA 3ABQA 2J8GA 5A2BA 4N6EA 1K4QA 2V38A 2YB4A 1QTWA 2ZZ6A 1B9ZA 3BANA 5AB3A 5HULA 1TR9A 1CLVA 4P2VA 2A5HA 4DAIA 2Z2UA 3V18A 3GVGA 1EHAA 3EPMA 2X41A 2ZA1A 1XG3A 2BZNA 4BQ3A 4M19A 2NUXA 1S2UA 5BWAA 3WK1A 1UW9A 1HX0A 5D04C 3T0CA 4FX6M 4QISA 1PYFA 4GJIA 5I06A 1IT0A 3MJMA 3DXIA 1GZJA 1QAPA 5AC7A 4PUUA 4Q4KA 1JZ3A 2BY1A 2E4TA 3II1A 2ZBTA 1GKQA 2VCCA 3KM8A 3S1WA 3T78A 2W0UA 3VILA 1VFFA 3KBJA 2E67A 3L5MA 5FI8A 1JROA 3QLLA 3S5ZA 3CK5A 1G01A 1TVNA 2OJPA 3B4YA 4J28A 2OFJA 4A3UA 3CXOA 4IISA 5FF3A 5C70A 3K8MA 4UQBA 1FWTA 1Q85A 3MDWA 4UR9A 4AC1X 4QSHA 1JDCA 2AL2B 3UU0A 4FDCB 2DSVA 1IV8A 3VCCA 1MUCA 4ENLA 1XIHA 1LCOA 3VYLA 1VFLA 1FQ0A 3IIOA 4H7ZA 5JCIA 3RF9A 2Z00A 4GD0A 1TA3A 1IIGA 2WQDA 3G2GA 4LVBA 1IYXA 1EGVA 4LCRA 4ZBCA 1QBAA 1A5CA 2VTFA 2YDRA 1P4CA 4HJWA 2H8XA 2PF0A 5DCEA 1GVYA 1JRCA 2CLHA 1YLVA 4WY0F 4BHYA 5TD4A 1TTJA 1O5XA 1KFBA 3PBGA 2Z29A 3L4XA 3L0GA 3L4ZA 4FR1A 3IIXA 4HMDA 1GEUA 1HF6A 4FNPA 2DZSA 4JL2A 5HXMA 5HNUA 5HMEA 2E68A 3U7VA 1P5BA 4JQ4A 2CW6A 3WNMA 3MUCA 4WJEA 2J79A 1K8ZA 3CUXA 1XLIA 5CPLA 3R8GA 1VBGA 2J75A 4LS1A 2E9LA 4IPNB 3EDDA 3OODA 1NM9A 4H6EA 4C6EA 1Z32X 3C8NA 1UROA 2NV2A 1DXIA 3MJYA 3R12A 3RNMA 3HGSA 1JPKA 2NV9A 5FEPA 3AS2A 1UBPC 2ZX6A 1J0IA 2AAAA 1JOAA 1VBUA 3RR1A 1Z8AA 3MU7A 3WMSA 1XD0A 2A6NA 3WLNA 1THFD 2PTZA 1C8VA 1PAMA 4TXEA 4NJIA 3LY0A 3WBXA 3FIGA 3CPRA 2YBUA 1GW9A 1GKRA 5AHMA 3SCPA 4ZTXA 4FK9A 1H11A 1FHLA 3VNDA 2CU0A 2Y63A 1RY0A 3QC0A 3AO0A 4RDYA 4JN8A 3C6CA 5I03A 3O07A 4H9VA 1J5SA 4MKVA 1MW3A 1TPH1 3O15A 3ABSA 1L8PA 4MPQA 1F8MA 1MUMA 2AQOA 3CGTA 2IXVA 3BURA 1KLYA 3N4FA 4QG6A 4CQ8A 3CUGA 4H4ZA 5JVLA 3M7WA 2EXOA 4IPPA 3RO8A 1XM3A 4H4UA 3IK2A 4EAMA 3SBFA 3CO4A 3RX2A 2WB5A 3EWCA 4L61A 3EWUA 1ADDA 4UNIA 4JX5A 4XZNX 1KFLA 4EM4A 1XLLA 2X8CA 4GBDA 3H6OA 1YDNA 3UR2A 3KW3A 3UWWA 4PMRA 3AHVA 2W4XA 5MKGB 2CETA 2YKKA 4E3TA 4ATWA 1G7UA 1R7AA 1PO9A 2WPBA 4O1BA 3A7AA 3EOLA 1DWIM 4MLRA 8XIAA 3RIKA 4PMVA 1FH7A 1DWFM 4O1FA 2Y5EA 1IWPA 1SM9A 2OCZA 4BK9A 1E6RA 1Q6RA 2PTWA 1OHLA 3FSUA 2D20A 4O8RA 5GJNA 1P0EA 1AL7A 5D37A 4HNLA 3P84A 2OSXA 3GVWA 2FVMA 3W7LA 2D2HA 3RCMA 1WXYA 4PODA 3R4IA 2BGQA 2BXVA 3O0KA 4H6KA 3QHOA 3STCA 1X1OA 5LKYA 2WVVB 3KBVA 4JPGA 2GQWA 2EJ1A 3L5LA 4RXGA 2G95A 2ZRYA 3GC4A 5AN7A 4Z0SA 4FAMA 5D09A 1T41A 5JBFA 4C1NA 1E6XM 2ACUA 3TJXA 2PDHA 3GU1A 4BEUA 3AALA 3NQEA 4U10A 4IGSA 4TX6A 1I0DA 5KSWA 3O2LA 2WBAA 1DJGA 2A3HA 2OZ3A 1K03A 4MZ8A 4UNKA 3OZPA 3PWAA 1AW1A 1G4SA 2IKHA 2WOIA 4FNQA 1PCKA 3NURA 1DJNA 2BC1A 5FESA 3BWWA 5EMKA 1J93A 4OBTA 2QKFA 3MHUA 2Y7FA 3RX4A 2XGIA 1MSSA 2C79A 2QHAA 1VRXA 3VOGA 4LH8A 1E6ZA 3VUSA 1OCBA 4UR8A 3PF3A 4MZYA 5AHEA 4R34A 1C9WA 2WCAA 2PAJA 1GQJA 4MNMA 5A69A 3ME3A 3QZAA 3W70A 2DSWA 3W1TA 2VFFA 1L6GA 3UT0A 2WLZA 2X0HA 3QPYA 2DPEA 2I5QA 4J2PA 2J8FA 2C1IA 3BAKA 1B3WA 3MYPA 4D8AA 6REQB 3OZOA 2HBXA 2CLEA 3LD5A 3ITOA 3CTTA 3NQVA 2DU2A 2VHLA 1XDIA 3I6EA 2EG8A 1BKSA 5D2VA 3RU8X 1BTCA 2DW7A 1K8YA 2OOGA 2C3ZA 2WJDA 1MQPA 2GLKA 1JCJA 3K4DA 1VPXA 4GO8A 3TC6A 1TPWA 3R07C 2CLOA 4LB4A 1FWHC 4CNOA 3UWVA 4Q33A 3COTA 4H01A 1K70A 4GVGA 1G67A 4GX9A 4NF7A 2CHOA 1BZLA 4ATDA 2I57A 2TAAA 3ISIX 4LV9A 4LY8A 4B5NA 3BG3A 2NSXA 2JBMA 3DG7A 4W8BA 5IM51 3CT7A 2HMCA 2NX3A 4F79A 2E8ZA 4AVFA 1B54A 1FUYA 4W8LA 1GONA 1VBJA 4ZFMA 1EIXA 4C91A 4IPIA 3BPWA 3NL2A 3TAKA 2FHCA 1KRMA 3PZQA 4QSFA 2VZTA 3QN3A 2QJHA 5DN1A 5LXEA 4LUTB 5CJMA 5LA0A 4GISA 2PDPA 2E8YA 3BLOA 4V28A 3LB8A 1MQQA 3A23A 4YTUA 1UMYA 1EWDA 2Y4SA 3DEQA 3PPGA 4H3DA 2VZOA 1R38A 2PTXA 4EM3A 2J3NA 3N6QA 1V6YA 3H23A 3AMCA 1GWJA 4IG2B 2AQWA 3MMWA 5CPNA 3W37A 4Q7IA 2X1IA 3WQ8A 3AXXA 3WLSA 4MIMA 5AOUA 5T91A 5I3KA 1PSCA 2PSNA 5HWNA 5A6BA 3T9PA 5LNUA 3EWDA 3LMYA 1RBLA 4MUPA 5CXPA 4MKSA 3PUGA 3VNIA 3HB9A 5EA9A 1H51A 4UFIA 4CD5A 3T2PA 3ZJ6A 3QR0A 4KEVA 4AQLA 1QPRA 2XGZA 4H9ZA 1TX0A 3DBNA 1DQUA 2XGBA 1CPUA 4FLRA 1T5AA 1W9BM 2WV8A 3TJ4A 2DT2A 5FA5A 1HTIA 4Z1AA 1ME7A 3HMJG 1NQKA 3GTNA 1XQLA 1MWOA 2YA0A 5G4EA 2AAQA 3LM7A 3EAOA 1B4EA 3PPHA 4ZB0A 2DSZA 4CQCA 1OFOA 5AHNA 4D9PA 4AYSA 4HN4A 5D8ZA 4C6OA 1QNVA 2W66A 4CNPA 5FEWA 1P48A 4KESA 3HZ3A 1H5YA 1MEHA 2FB3A 5B7ZA 4QE1A 4DXKA 4RE4A 1PKLA 3V16A 4HPXA 1QPOA 3CTLA 4Q3MA 3UBPC 3W2KA 3M0KA 1EYWA 5MKGA 1YHTA 3MZNA 2ZZBA 3IEBA 3TW7A 2LLEA 3R0DA 1QNQA 3ZOAA 3ZVHB 1AQHA 4PCPA 5H1WA 1UHVA 4F48A 2FZNA 4JEJA 1ZZMA 5K3VA 3NO3A 1BYBA 3UA3A 4MWAC 5CSSA 5E5CA 2ZDSA 4DVOA 4QR6A 4JXCA 1DV7A 4ZO9A 1Q4WA 1JJKA 3MC5A 1JDEA 2Z2BA 3CLMA 3LENA 1WAWA 3KDNA 3U57A 3LHZA 4ZQNA 3WH8A 2E5DA 3VIHA 1F7BA 3VABA 4I90A 1P6CA 3NFUA 3DAQA 3Q6JA 2FDSA 1PX3A 3WH7A 3EMQA 1KRAC 2OEMA 3TCEA 4B5WA 1YBQA 1EUAA 3LK6A 5J04A 2QCGA 3NAVA 5A6SA 1EOMA 5K9CA 3HFTA 1O4UA 3WELA 3S46A 2CZDA 1SO6A 3W26A 1BQGA 3M9YA 2D23A 4XZWA 4OVXA 1VLWA 4HJFA 5A6JA 3L4UA 5H8UA 3C52A 3SCTA 3W2MA 1KM6A 2VZSA 2XIJA 1RD6A 3A9BA 2EPOA 1GV4A 4B16A 5HWMA 1S5WA 2V68A 2WPCA 3W7MA 2CLPA 3AHTA 2V3EA 3MUAA 2J47A 3WLPA 1UD8A 1XWYA 3OBKA 8RUCA 4JIRA 1MXSA 3AHZA 3E0WA 3RRAA 3S2NA 5AECA 1XIDA 1AJ2A 1UR4A 2WC4A 3JR2A 5GRTA 2V30A 2PZNA 4N9EA 4TV6A 4UTTA 4IGHA 1UPMB 2QYGA 4KWWA 2PGEA 1SSGA 2GQ3A 1NDZA 1WCGA 2EHHA 5D2XA 4DZHA 2NQ9A 5HDRA 4XD4A 1OD8A 3C3NA 3MHGA 3BICA 6ENLA 2HS6A 4A29A 2QCDB 4RPPA 2QUNA 4WCJA 1M41A 2O9TA 4GIRA 4PUEA 5FS6A 1N7KA 4Q8UA 4MVAA 2GUUA 4ILSA 4GY0A 3ZJ8A 4AH7A 1X2GA 2FPYA 1SFJA 5E1QA 1HGWA 4ACZB 3TEVA 1VFOA 2QCHA 2Z6IA 3IUIA 1AW2A 4NIRA 1ONXA 4IJRA 1FXQA 2D24A 1D7KA 4YCPA 1OYBA 2C16A 4A21A 5FEXA 4FLSA 1O12A 3T7VA 3VA8A 1XLGA 5G2WA 4JTHA 3EWXA 5EB8A 5DRIA 4PTXA 2XU2A 3LPGA 1C8QA 4NQ1A 3ARSA 1B30A 5HJXA 1GJUA 1XSIA 3QXBA 4OBSA 2RDWA 5AY7A 2E7FA 1Q6DA 3MP3A 4KS0A 3H2EA 2GUBA 1FHUA 3MBDA 2A3BA 3ZS4A 1WDDA 3LA4A 4HP5A 3L0KA 1F8IA 5EFDA 3FAXA 5BOEA 3BQ5A 2ZXAA 1ONFA 1OK4A 4D6CA 4F3HA 5D2TA 2E3ZA 1T40A 4HOZA 3GW3A 3PWGA 1IEQA 4EQSA 2OQYA 3PTKA 7XIMA 2BP1A 3PM6A 4HIBA 1QNPA 1QCWA 1ZAHA 3DJGX 4LAOA 3HTWA 3NPWA 2Y7DA 1V77A 2E9BA 3PUEA 4MZ1A 2CLIA 2H90A 3RPMA 2UY4A 3WK2A 3AYSA 4A35A 1MXGA 4J5NA 1GRGA 2PDIA 3C8FA 4ERGA 1XIMA 1R3RA 5CZTA 2GVLA 4GH3A 5A6MA 3TTQA 4O13A 3FVDA 3N2MA 1AW5A 3UR5A 3DHDA 2WZMA 4H4XA 2ZKMX 1OK6A 4DELA 2PRHA 4CEUC 3BMVA 2YXGA 1JUKA 2WSQA 5TNVA 4UCFA 2OKTA 3WJSA 2R9ZA 1F8WA 3FVMA 4MJ2A 2HWGA 1LROA 4DYJA 4I6KA 1W6TA 3W1QA 3M41A 1A0CA 3BW2A 3DI0A 3PPCA 1XD1A 2J7GA 1GQLA 4ZODA 4FO4A 4E2BA 2BV9A 3NQFA 4EKJA 2BTMA 3NZRA 1OEPA 3OBEA 3S9ZA 3UGVA 1DTUA 4RE0A 4EACA 1LLWA 3EXSA 1ICSA 4IG2A 2WC7A 3AXHA 3APTA 1XLKA 3PB0A 2ATMA 1KM5A 3ABXA 3T44A 1QFEA 5CLWA 1V3LA 2W3SA 5E0KA 1G4TA 4GGBA 1FECA 3V5CA 4NEVA 1XRTA 3KCLA 4WOZA 5HINA 1H09A 1AMYA 4UXDA 4PH6A 3H2CA 4HNCA 2EBNA 3W7HA 2O4QA 4P7QA 2H9AB 4DZ5A 2OSWA 4QIUA 3EB2A 3GAYA 4P8WA 2OWWA 5K4ZA 2Z26A 1NU5A 1MDRA 1X1ZA 2AGTA 3TYAA 4PMNA 4M81A 4LYKA 2QLYA 3H4GA 4YHGA 3S3GA 4TOQA 2BVWA 3EX3A 4PR4A 2IKIA 1GOMA 4Z2JA 1TMLA 5PTDA 3WDQA 2MANA 1VRDA 1BKHA 2DUAA 4QAIA 1V6UA 3MY9A 2YL8A 1E4IA 3W6MA 1E9YB 5LA1A 3CGCA 1C92A 3AMKA 4BWLA 1EDTA 5LYRA 2XVPA 5K7JA 1MEWA 3PJTA 1XLJA 2REQB 5A5WA 2DH2A 3UVIA 4D6HA 2DW6A 4GWEA 4IUGA 3PR2A 1WZKA 3W75A 5A8GA 2VJXA 2XPKA 4XVEA 4WRHA 3C2OA 1XIGA 1GVIA 4UFJA 2HPIA 3OPSA 2J24A 5CPQA 5J5DA 2E6YA 2ODOA 4YPJA 5HNNA 1DE6A 3NPUA 2I7GA 3HGJA 3A9IA 3WUFA 4FOJA 1X39A 1Y8BA 1B0IA 1XIBA 1K77A 3HO8A 5FS7A 1OB0A 1PYMA 3DN5A 3CO8A 4DBDA 1NPXA 3UYCA 2FMOA 1FCVA 3AMDA 1H5VA 4HPJA 3VMOA 1F6PA 3R8HA 1F9CA 3TFCA 2ZZ7A 2WZIA 1PDZA 1VDVA 4GC4A 3N3TA 3L68A 4LEFA 2DT1A 3DGRA 1IGSA 5HK4A 2DUXA 1IEXA 4IICA 1HQTA 2DFAA 4WKFA 1XLCA 1E4MM 3ES8A 2BC0A 2W6RA 1XG4A 3OQEA 3NEVA 2PLCA 3ARWA 4U5KA 2G3NA 5H6HA 3HQOA 3SUSA 5C5YA 4ECLA 5HJYA 3OVQA 1AZ2A 1TREA 1JDAA 4AXKA 3KS6A 3VIJA 2OKOA 1CEOA 1LWJA 3V35A 5EBKA 3BG5A 3V0TA 3IJIA 3G3MA 3SRHA 5M2FX 3DC0A 3CAWA 2P5NA 3M5XA 3QTGA 4N2YA 3G1VA 5D8WA 4ROPA 3QJAA 1NHPA 4BWLC 1OCJA 3NXFA 3STFA 1W3KA 3A22A 3R8RA 3OYXA 1JZ7A 7TIMA 1GHRA 4GH1A 3VIPA 3O6AA 2ZRZA 3AHYA 3EA1A 5FCZA 1UJPA 3CGBA 3UW6A 3FGCA 1VKFA 3PFMA 3U0HA 5ER0A 3UCDA 5JBEA 3UNDA 4QBXA 4WHBA 2XJ7A 4ASTA 3D46A 4JDBA 2PF8A 4DNHA 4DUOA 3EDJA 3DH9A 5BRQA 3W9ZA 4Z2LA 1GVFA 1IR1A 4X0NA 3NVWB 3GXNA 4ZMGA 1QPNA 4A3YA 1HT6A 2GK1B 1JZ6A 3CS2A 3O63A 2GQAA 1MFVA 2WSPA 3EEZA 4OOUA 4RX0A 3W83A 2REQA 4I9JA 4DF0A 2BASA 1XKJA 4LUTA 4MB5A 3S0CA 2Y8KA 4LX4A 1XIJA 3CAQA 1W8SA 1LG2A 6PTDA 1XLEA 1X96A 1KM1A 2CBVA 3M0IA 3TNOA 2QCNA 4K8GA 3UXDA 2G3JA 4GI4A 2NXHA 3DHPA 3GM8A 4H83A 2IMRA 2Z1SA 4QITA 1J01A 5H8PA 2XIBA 4HK6A 3ITGA 4NILA 2E1WA 1KXHA 3B3DA 5BOOA 3L7RA 4IQEA 1GTHA 1RPXA 1Z7AA 4W85A 4Y6GA 3S6TA 3O1NA 1J8VA 1RM6B 5D33A 4V1XA 3AI0A 4X61A 5CGQA 1ENUA 1EC9A 3URNA 3SQPA 3AN1A 3CAKA 2VR2A 4RZBA 3AYTA 1G5AA 3V1HA 4LAKA 1WAUA 2BY2A 5G4WA 4HCLA 1PE1A 1RCXB 1NHSA 4IJCA 2UWFA 1M04A 5RUBA 1WOBA 3WSUA 2IPGA 3DERA 4ZA0A 2HE5A 5D9MA 2VXNA 1UWSA 2BHZA 1UR8A 4NX5A 1ITUA 2QCCA 2EPHA 1H6VA 1FHVA 4AY1A 2JQXA 3A64A 4EF8A 1C7TA 1RA0A 4IMGA 4FXJA 5E6YA 4OE7A 1JAKA 1E56A 3GAKA 1KM4A 4GZ7A 4HMCA 3W1AA 3W74A 3CASA 3GIYA 4QE5A 4B92A 2DVTA 1VYSX 4W7UA 3VFLA 4XZMX 1R3QA 5CH9A 4XZBA 3FJNA 3L67A 4X22A 3BOLA 1XPGA 4CCDA 3UNTA 2PDBA 3DYOA 2QXWA 3MHFA 3BZGA 3PZVA 3KTCA 1XBXA 1FCUA 4ADTA 2OWXA 4APNA 1RK5A 3T08A 5TR3A 2C15A 4OKDA 3PG6A 4Y9NA 4AW7A 2JKEA 4FA3A 1D3HA 1XC4A 1Q1RA 4PCTA 1ADSA 1E0TA 2BCPA 1EPXA 1G9HA 3TN6A 3WQPA 2RGMA 1PUDA 2XIOA 3BXWA 1CLXA 3NDOA 4XQ6A 5FS8A 3S9IA 2OO0A 1CCWB 4LCQA 4LNCA 2CZ5A 3W4RA 5DXYA 4DQWA 3B8WA 1YBQB 3KTSA 2D73A 4JKKA 2DV0A 1ZY9A 2YPIA 3TYEA 2YCJA 2DUZA 3M0XA 2WHLA 4L1WA 3MB9A 3FJ6A 3TONA 3TR9A 2VFHA 3NJ3A 1W31A 2WSKA 3EPOA 1V0NA 2HEJA 4R33A 3VK5A 1JEHA 4YTRA 1M03A 1XX1A 1NWRA 3I3BA 5I0DA 1D3CA 2OELA 2ICSA 3AFBA 1GYMA 1UD6A 2FLIA 4S3BA 3CZLA 4Z2GA 5A1AA 3THQA 1F73A 2A2IA 2CLFA 2RHGA 4GUJA 1CI1A 3H2AA 5C9WA 1K7EA 2ZTKA 3B9EA 3GYCA 1JFHA 3I10A 3ABRA 2QDDA 2EG6A 2BB0A 1I6NA 4S2BA 4GINA 4HSHA 1VENA 1Z89A 3AS1A 2VX6A 5K4XA 3JVAA 3FKKA 2OLAA 4GYJA 3H4KA 4ERIA 1LL7A 1DJWA 1XYAA 2QJGA 1UP0A 3GC2A 2V5KA 1TMQA 1HO1A 1UH2A 1ISWA 3OBAA 5AKQA 5DY3A 2WZTA 3VZXA 4Y7EA 4B5TA 4Q8PA 2J4GA 4UTTC 3VOCA 2GOUA 5AFDA 5A8PA 4RNFA 1EC8A 1UZDA 1V03A 1D2KA 3S47A 4H9YA 3BW3A 3NYZA 3P0WA 4TMBA 1W3HA 4M7SA 1NDVA 3BK0A 4RXFA 1S2WA 4J3XA 4J57A 1ZAJA 1AA1B 1ISVA 4QJ3B 1MO9A 2W67A 4BI6A 2HDJA 2HQMA 1QW8A 1B90A 5HWJA 3N9SA 5F4XA 3NPXA 1RJRA 2HZGA 4J27A 4L65A 4JTCA 4ORMA 3L4YA 2GH5A 3KS5A 5H91A 4CN1A 1IE7C 4BCEA 1ZJIA 1AQFA 4AYGA 1UC5A 1NTHA 4US5A 4N6FA 1BD0A 1TV3A 1W5QA 2EO7A 1TPC1 2Y62A 2FVKA 2NX9A 1LUCB 2J66A 2NT1A 1LT7A 3VNMA 3O9NA 4DYKA 3RXZA 3WLKX 2NW0A 3TV8A 3KL3A 4F66A 3BLDA 3LLXA 4WY0A 3FJ4A 4ACYA 3B8UA 3LLDA 1MEIA 4C6DA 7PTDA 3ZT7A 3NTYA 4EX4A 2EG7A 4UIOA 2TPRA 3WQVA 2PODA 2HVOA 3T4WA 2HTMA 1S46A 3A3XA 3ID7A 1IHIA 4PRWA 4UOZA 4UTUA 5DBUA 3AAMA 1M3UA 3VNZA 5A6LA 2Q01A 1YADA 2ZXBA 3PAOA 4NL1A 1NSJA 5LIKX 3B8SA 3HPZA 2WKLA 3CU2A 2PWEA 3QOMA 3CMGA 2DGAA 3OGVA 2P76A 3CV7A 4G9PA 4Q4SA 3URQA 2VWSA 1CXFA 1WKDA 1FVPA 2IQTA 4A22A 4HZ6A 4DXVA 1JIBA 3FY1A 3OJGA 4HTYA 2ZX9A 2ZWZA 1Y5XA 1PTAA 3VXGA 1QOQA 3AOFA 1DHPA 3LRLA 3NIYA 4P7RA 4JFWA 4H2HA 2CHNA 1PZ0A 4JYFA 3GRTA 1UD5A 1XGEA 2DZPA 3TMQA 3XIMA 5AVHA 3SN4A 4RZ5A 4LC8A 2DT3A 3DBPA 3R7MA 2UBPC 1XGDA 2MNRA 3VGGA 1WO2A 1M1BA 2Y7GA 2GVGA 5KZEA 3QGKC 4KWSA 4YXGA 1BG9A 2AAMA 3DIPA 5A2AA 3F4CA 3AWOA 1KBKA 4H8VA 3PZUA 2VZVA 1POKA 1M65A 5D30A 2VX5A 4DPPA 3V0UA 1K6AA 4N9BA 1WX0A 3TYUA 1PEZA 3CB3A 3VDHA 2HISA 1EEXA 4NSBA 1VHCA 1QHOA 1DHKA 3WDIA 5EY5A 1UUOA 3ES7A 3DKJA 5DBTA 4MLJA 2J9ZA 1N61C 3W1UA 1YTEA 1W1IE 3UZWA 5TIMA 1PVNA 3VM5A 2CZEA 1L6SA 3TZNA 4CD4A 4RZ4A 1C9DA 3MKVA 3IRDA 3LLFA 1CXLA 1FX6A 5I2UA 2G3FA 3THCA 3AIQA 3HPXA 3B8DA 5IFTA 4LUYA 4NRSA 4S3AA 4L4LA 1UA7A 5IOBA 1TJ0A 2QDHA 1H7WA 3C2YA 3MW7A 4K6AA 1C90A 1FHDA 4P8VA 1NEYA 3UXAA 1QW9A 3CGEA 1NFGA 4E8CA 3UJ2A 4XZIA 3NQCA 3ITCA 2NUYA 1DWGM 4ZOCA 3BV4A 1TB3A 1H7XA 2Y7EA 1LWHA 4ZVJA 1XYMA 4H6QA 4CEXC 2V2HA 3LGDA 2GRTA 2RABA 3RLGA 4PMUA 1GVSA 3LN3A 3ZSSA 5DQPA 4RL3A 3MVIA 3GBEA 3UYIA 1LLZA 1FP8A 2X99A 3P8JA 5F2MA 4IOTA 3ZLFA 2Y70A 1ITQA 4K8HA 2E3TA 3VCNA 2PDQA 2BVTA 1GHSA 3T8LA 3DECA 1DE5A 1F6KA 3MV11 1N5XA 2W63A 1OJTA 3CHEA 4FB7A 3VGDA 2I16A 1BF2A 4L9ZA 3M0YA 3RYSA 5AZ0A 3G22A 4ZSUA 1V4YA 4XSLA 4ROQA 4N42A 4QG9A 2ZX5A 1KFEA 3F4NA 1SJBA 3EDEA 3O06A 4HCDA 4LB3A 3ZYZA 2FYMA 3CUZA 4CQDA 3F5KA 2BY3A 5LNWA 3AMZA 3F2DA 2VQUA 3W87A 1JPIA 1R3WA 1RPKA 1HL8A 1I75A 4JHOA 3W0KA 4ZZ9A 4LANA 3ZXWA 4DJDD 1PJ9A 2YYUA 1R86A 2FH8A 1UD3A 1EJXC 4DWSB 1AOGA 4IXHA 3SCNA 1NWSA 3FV9A 1VBHA 5D9NA 1QOXA 4PEKA 3KOYA 5A6TC 3EMZA 2QPXA 3AIWA 4LF1A 3NXLA 3WENA 3GDRA 4K7ZA 2OZ0A 1WKFA 3RM4A 3UR7A 2GVYA 3FYPA 4WDUA 3WY1A 3IVSA 1CGWA 4XO7A 1LWIA 3WLLA 1N2VA 5HA7A 4TVCA 2YA1A 4HYRA 4MUZA 3ARYA 4GUHA 4XG1A 3GXPA 1GG0A 4ZQCA 5A6BD 4L1GA 4XD3A 3IRSA 4H4QA 1ZLPA 4BR1A 4YVVA 4LT9A 3G6LA 4JCMA 2PDYA 3WQGA 4AF0B 3R0KA 3VCRA 1SR0A 4W7WA 1Q65A 2Z25A 4HGXA 4GBUA 4QEHA 1WOAA 2HS8A 1DWJM 3GDLA 1S2VA 3CUIA 4I6VA 3EEGA 4EPBC 2F5ZA 4PTMA 1EX5A 1SW0A 3GR4A 4MF4A 3SIZA 1UCWA 1ZXIC 1EKOA 2DVUA 1J0JA 4GGHA 4M3PA 3M5ZA 5GNYA 3EB4A 2I1OA 3VKCA 4LALA 2YYTA 1BPLB 3KXQA 5ENLA 2NVDA 1E55A 4PMDA 4KCTA 3LV6A 1XRSA 1EF3A 2YFOA 4GVFA 2F38A 3WH6A 1OADA 2XHYA 3GR8A 1HP5A 3LX9A 3NQAA 3MCMA 4HB7A 1TZ7A 4ZE5A 1V3MA 1KBBA 3M4HA 3UG4A 4FZIA 4DLFA 1M5WA 2H8ZA 3LSBA 1Q3NA 3CIVA 4Y9PA 4LW7A 2G3MA 3VIOA 4AUBA 2GJXA 6XIMA 4H4RA 3W38A 4RV3A 2X0SA 4O1EA 3WJXA 4Q8MA 5CBIA 3AZRA 3VGEA 4U4MA 1GOQA 1AODA 1T99A 3BCDA 4LV4A 3GHTA 3EKZA 4TMCA 3RNDA 5MHBA 4IFKA 2A3LA 3U4AA 4LVGA 2WPEA 3QQ1A 5HUOA 2NQJA 2X1UA 2FGZA 1W1A1 4C6BA 3ZR4A 2TMDA 4JIPA 1N60C 2BXZA 2C71A 1KRBC 2UY5A 3M44A 3VE9A 1ZHAA 1CGVA 4DJDA 3RU6A 4EXAA 4EQXA 2OMAA 2B81A 1MRAA 5D4YA 3PS7A 3PY2A 2ZZ0A 2F7FA 3AJXA 1QPQA 1HJVA 1JYNA 3KZPA 1K9DA 3ZWTA 1WZMA 1HJWA 4E8DA 1PBGA 1WUFA 3SAZA 5LNRA 1H0GA 3AHXA 1IZCA 3IJDA 1ONEA 1GOWA 4L4PA 3TQVA 2O9PA 2J78A 1EC7A 2B4GA 3U5YA 3HFYA 3ECQA 2RJHA 3P8IA 5CC6A 3UEQA 1UZ4A 5E9XA 4C6MA 3N2XA 4HHHA 3EPNA 3EMCA 1BG4A 3L65A 3AICA 1FWWA 4LAZA 4JFSA 4UOJA 3S5SA 1VLIA 5E9AA 2W91A 3MA8A 4ES4A 4WSHA 4KMQA 1BYDA 2XZ7A 1S1PA 1H1NA 2D0GA 4Q7BA 3VM7A 1WKEA 1XRFA 1QNSA 4KPRA 5JIWA 1YTKA 1OZMA 1VQZA 3M1ZA 1YQZA 1WB0A 1YRRA 1T6MA 4JHZA 3WLOA 1XQKA 1L6WA 2Y24A 2KAUC 4EMIA 4LA1A 4LBUA 3QW3A 1FXPA 3LU2A 5GNZA 2PWFA 2C19A 3I7RA 3VKKA 3KVMA 2GR3A 3KL5A 3KTXA 2ZCGA 4JY9A 1XP3A 4UTIA 1FWBC 3D6NA 2A21A 3CHFA 2EGZA 3K4WA 3WQCA 5A8MA 3BJTA 2X09A 3RCNA 5HPOA 1E1CB 3LQGA 4BY3A 2PP1A 1EUNA 4M80A 4C6LA 1E51A 4K38A 3G18A 3W86A 3S6DA 3TUUA 4OGZA 2P10A 4B5UA 3EA3A 2PP3A 4A8IA 1OX5A 3D3FA 2ISDA 3LCWA 3VKBA 2NQHA 3WL1A 4QG8A 4MJZA 4GIAA 3LHYA 3HQ1A 4RNIA 4ZQMA 1JD9A 1ECEA 3NOYA 4YHEA 2WHMA 4Q4MA 2ACQA 4IP4A 1V7YA 1OIMA 4W8AA 1EJSC 4RZ6A 5ECUA 5DF0A 2JEPA 5HNTA 3EDFA 1V08A 4BJHA 4OV4A 2B7OA 1QWKA 1R2TA 1ZGDA 5KVHA 2BBFA 4WGXA 3IPWA 1F3XA 1KC7A 1QI2A 4P8UA 2P3ZA 1OFRA 3R43A 4JFVA 4JTTA 1NWTA 1JI2A 4QJ5B 3LCLA 2AQVA 2VOMA 2VL4A 4I3GA 1XDJA 3IV3A 2CBJA 3QV8A 3ETRB 4J2MA 3V75A 2XH4A 4DNMA 4J3UA 3W23A 3KWXA 3QSRA 1BWCA 3LXDA 3VIGA 5ABGA 1F76A 3CB8A 3HV8A 4E2OA 4MDPA 3BLFA 3KHJA 3T6CA 1QUMA 1T8QA 4GKLA 2C0AA 2UV8G 4LIIA 2Y5JA 2GGHA 3ZZ1A 3P81A 3OHIA 1A3WA 3CMJA 4DY1A 5I3HA 5C0QA 3VGBA 2VC9A 3W6YA 3QY8A 4QCFA 1D7FA 2PDWA 1PZ1A 3DFYA 1GRTA 5DX7A 1AJ0A 1WDPA 4NYYA 3UERA 3NSXA 4JTUA 2VVNA 1LLOA 1XRVA 9RUBA 2O55A 5D9PA 5D2WA 3NVVB 3A7UA 1SUXA 1J96A 2HK0A 1SJAA 1IEIA 1PWLA 4K8EA 1X7IA 1EJRC 1EX1A 1H7OA 3MVTA 5M03A 3W85A 3TA6A 3PBWA 4K37A 2YB1A 3UJSA 2F6UA 5LIUX 2WOWA 3DOPA 3LXCA 4KETA 3QY6A 3ZSTA 1X6NA 4WSJA 3I4EA 3HN3A 3AM9A 1VGAA 3UJEA 3QMSA 1G69A 1VD6A 3W71A 3QFBA 4H50A 3W02A 5KZ6A 4XTIA 4L9YA 1FFUC 4OQVA 3R79A 4PSPA 4X9YA 1N63C 4KF1A 5D2YA 3WBAA 3HU7A 4Z1BA 3AYVA 4A8RA 2ATSA 2CXGA 4XWUA 4O54A 1OBAA 3T0BA 2JF6A 2PEVA 4DHGA 3W7IA 3IIVA 4AVOA 2D2GA 1P7TA 2BGSA 1KTCA 2WXDM 3WNKA 5TBOA 3IJ9A 1U33A 1Q6QA 2OQHA 1IF2A 4B5XA 4QQUA 3QF0A 1XICA 1FFQA 3EZ4A 5LIXX 1E4NA 3KOFA 4EF9A 4HK7A 4J7RA 3NS1B 4CUCA 4UMCA 3NSMA 2TSYA 4G2DA 1QI0A 3LRKA 3S2JA 2X8HA 1KTNA 1EO7A 2HNEA 1TQXA 4FNUA 3EB3A 1XF0A 3TW9A 3C0LA 4CNUA 3NSNA 4IM4A 5C54A 4ZXLA 4UQAA 4GIYA 4LYRA 1FEBA 4OUIA 2D22A 5ABFA 1LYXA 3IAQA 4L56A 1BRLA 2P8BA 1Z9AA 3VC6A 3AUJA 3MQTA 2OT0A 2ABAA 1OFQA 5MF5A 2P0IA 3B9DA 1GT8A 2WVSA 2V67A 3W7OA 4WR3A 3GVRA 5JIPA 1PZ3A 5KVIA 1LUCA 3T0AA 4F0RA 2X8GA 3DX5A 2XVKA 4IMFA 2QAEA 3TWBA 1J5TA 3UCQA 4FNSA 3UG3A 4J35A 1K8XA 3RLHA 1US2A 1ONWA 3Q94A 4GHRA 3TYZA 3REQB 4IX0A 3TTEA 2FTWA 4OZOA 1GOOA 5BU6A 1KFKA 4GCXA 4UC5A 3FK4A 1J0HA 1IGWA 5IBXA 3QZ6A 4FI4A 4GUFA 3TCSA 1UZHA 2D2OA 2PRLA 3FN9A 5C2GA 1VYRA 3PTDA 1AJZA 1EDQA 3Q65A 1V97A 1TELA 2E9MA 3H2FA 1HL2A 3M5VA 2GJRA 4PMOA 1F05A 1EBGA 5B7YA 1K8CA 4I5UA 3QR1A 1WP6A 4GUIA 4X2RA 1OC6A 4JL1A 4GUGA 4Z42C 3UZYA 4G7EA 4KGJA 3ANVA 4NAFA 2EPMX 3G1FA 2AL1A 4E4UA 1HFBA 2EJAA 3CZKA 1AZ1A 4PL2A 1YQ2A 4PMYA 3SECA 3HF3A 3I6RA 1Z69A 2WC3A 3PSVA 3E0VA 1GVOA 2V3BA 3GH4A 4QHRA 3W2JA 3TXZA 1XIFA 1EF2A 2VDIA 1NAL1 1Y5VA 1Q6GA 3F4DA 2PA6A 4GIEA 1A3XA 4JIQA 1I1XA 1R9ZA 4GNKB 2HXUA 1DIOA 1PKYA 4NZCA 4TV5A 4Q8VA 9XIMA 1U5HA 3EKLA 4ALDA 1JL8A 3K2GA 3AJ7A 2ALRA 4ZSTA 3DFPA 1JYWA 4FXSA 3BG9A 2Q6ZA 4EMWA