3RR1A

Crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
384
structure length
372
Chain Sequence
MVKITRLTTYRLPPRWMFLKVETDEGVTGWGEPVIEGRARTVEAAVHELSDYLIGQDPSRINDLWQTMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLGVPVYELLGGLVRDKMRTYSWVGGDRPADVIAGMKALQAGGFDHFKLNGCEEMGIIDTSRAVDAAVARVAEIRSAFGNTVEFGLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAETYARLAAHTHLPIAAGERMFSRFDFKRVLEAGGVSILQPDLSHAGGITECVKIAAMAEAYDVALAPHCPLGPIALAACLHVDFVSWNATLQEQSMELLDYVRNKADFALEGGYIRPPRLPGLGVDIDEALVIERSKEAPPVWRHADGSVAEWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative D-galactonate dehydratase
publication title Crystal structure of enolase PRK14017 from Ralstonia pickettii
rcsb
source organism Ralstonia pickettii
molecule tags Lyase
total genus 111
structure length 372
sequence length 384
chains with identical sequence B
ec nomenclature ec 4.2.1.6: Galactonate dehydratase.
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3rr1A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3rr1A01
3CYJA 3SSZA 1EBGA 4DWDA 6ENLA 3ZLHA 3NFUA 1WUFA 3V5FA 2ONEA 2P0IA 3R1ZA 3RR1A 5ENLA 3U4FA 3BSMA 3RITA 5IDZA 2QJMA 4ZA0A 4H2HA 2OX4A 2HZGA 3HPFA 1OEPA 3VC5A 3V4BA 3GD6A 4KWSA 4E4UA 3IJQA 5FJOA 3TJIA 1SJBA 3N4FA 1PDZA 3PFRA 1EC7A 2XSXA 3T9PA 4GGBA 4J3ZA 3RRAA 2XH0A 3OPSA 3FJ4A 3P0WA 4M6UA 2XH2A 3ZVHA 4YWSA 2OVLA 3JZUA 4ENLA 3QPEA 3D47A 4E5TA 1YEYA 3SJNA 1ECQA 2I5QA 4GMEA 1F9CA 2PTWA 4GIRA 3I6EA 3SN4A 4DX3A 3R25A 4MGGA 2QGYA 3RGTA 3UXLA 3MZNA 3DESA 3CB3A 4HPNA 4DXKA 4Z1YA 1MUCA 3UJFA 2XH7A 4Z17A 2OZ3A 2DW6A 3SN1A 4JHMA 3H12A 4IL2A 3DIPA 4IL0A 3UXKA 3T6CA 2HXUA 3SN0A 3U9IA 1NU5A 3MWCA 3OZYA 3UCDA 3DG6A 3OTRA 3ZVIA 3STPA 4EWJA 3FCPA 2OO6A 4IHCA 2PTXA 2PP1A 5FJUA 3PWIA 3DG3A 3TCSA 4E8GA 2PPGA 3GO2A 4ZCWA 4JN7A 3TQPA 1SJAA 2OZ8A 1NELA 2GGIA 2P3ZA 1EC8A 3EKGA 2HXTA 4IP4A 3TTEA 4A6GA 3OP2A 5J04A 1SJDA 4H19A 3CXOA 2PODA 2GDQA 3ES7A 2AL2A 3R11A 3R0UA 3VCCA 4K8GA 4X2PA 2MUCA 1KKRA 3Q45A 4K2SA 5BOFA 3B97A 1MNSA 1IYXA 3KUMA 4HCLA 3SQSA 3MQTA 3ES8A 4G7FA 3BOXA 2PP3A 2HNEA 3VDGA 4M0XA 5FJTA 3UCCA 4HYRA 3I6TA 3RO6A 3TJ4A 3N4EA 3TWAA 4IZGA 2CHRA 2GGHA 3IJLA 3ZVHB 2QDDA 4DN1A 2AKMA 3GC2A 3DERA 2PS2A 4FI4A 3MKCA 2QJJA 1E9IA 3UJRA 2OKTA 2PU0A 1JDFA 1SJCA 4G8TA 1KD0A 2XH4A 4HCDA 2PP0A 1XS2A 3P3BA 3FV9A 4DYEA 3UGVA 2OQYA 3JW7A 1R6WA 1KKOA 4E4FA 3DFYA 3PK7A 5FJPA 4GGHA 2GGGA 4IP5A 1R0MA 4ROPA 3CAWA 1FHVA 5BOEA 2POZA 3DG7A 3EEZA 3I4KA 2P8CA 3IK4A 3TOYA 2GGJA 1BQGA 3S5SA 4JN8A 2OQHA 3VCNA 2OLAA 1JPDX 2P8BA 3N6HA 3OW1A 3DGBA 1EC9A 3DDMA 4K1WA 4F4RA 1P48A 3UJEA 2PU1A 3THUA 2OZTA 3V5CA 4FP1A 2FKPA 2DW7A 2PTYA 4A3RA 3FYYA 3MY9A 2FYMA 3OZMA 3QN3A 2P88A 3S47A 2RDXA 4HN8A 3ZLGA 3GY1A 4KT2A 3UJSA 2AL2B 3VA8A 3RCYA 2PCEA 1BKHA 2AL1A 3H7VA 1FHUA 4A35A 4HNCA 2AKZA 3FVDA 2ZC8A 3N6JA 4DHGA 3IJIA 3H70A 2XGZA 3H8AA 4MMWA 1MDLA 1KCZA 2OFJA 4KPLA 3V3WA 3BJSA 2QVHA 3R0KA 4GYPC 3JVAA 4H83A 4H1ZA 4HCHA 5FJRA 2GGEA 3QTPA 3T4WA 2NQLA 4KEMA 3NZGA 2OPJA 1TZZA 2MNRA 2QDEA 1MDRA 3P93A 2PA6A 3DEQA 1WUEA 4HNLA 1EBHA 1ONEA 1JPMA 1RVKA 1P43A 3FXGA 3T8QA 1DTNA 3DFHA 3Q4DA 4J1OA 1MRAA 4GISA 4IT1A 5EU9A 1ELSA 1W6TA 2ZADA 3NO1A 3MUCA 2PMQA 4E6MA 3D46A 3VFCA 3ZLFA 1TKKA 3PWGA 2QQ6A 1TE6A 4MKSA 1PDYA 3QLDA 2PTZA 3SBFA 3VC6A 4GYPA 3CT2A 2PGEA 2O56A 3CK5A 3QKEA 3TW9A 4GFIA 2PSNA 3K1GA 1JCTA 3TWBA 2GL5A 3ENLA 3MSYA 2PGWA 3NXLA 1XPYA 7ENLA 2QJNA 2OG9A 3UJ2A 1L8PA 2GSHA 3R10A
chains in the Genus database with same CATH superfamily
4NZCA 1XC6A 2Y5EA 2DP3A 3M6DA 4RDWA 4V1YA 1BWLA 3UD6A 1EJVC 2QCCA 3TQVA 1WBHA 4LALA 4IPLA 1N5XA 7CGTA 3OG3A 4EPEC 2JF7A 1FWAC 4GUFA 4UQCA 1VD6A 1UH2A 5HMFA 2JIWA 1FA2A 5AC7A 2H8ZA 5M3WA 4DUXA 1DE5A 4LVAA 3L4UA 4NRSA 5LKYA 4KWSA 3IJDA 1V3HA 5BCAA 1CLXA 1BF6A 3W25A 2V63A 4TX9A 1XLJA 1MUWA 4ALDA 5E09A 1JRPA 2I14A 3NDYA 1MQPA 4GGBA 3WL1A 1YADA 3FJ4A 3BAJA 1ZU8A 2DUXA 4X3ZA 3UY8A 1YEYA 4RXFA 3AXXA 4S3CA 1JCNA 3SN4A 3LGGA 1F73A 1J9YA 2A3BA 1OQFA 1F2JA 1E5JA 3CGCA 3TNBA 1LQAA 2C7FA 1RCXB 5E9AA 2AAAA 2Q8XA 3LGEA 3WEMA 3A22A 3UESA 2YYTA 1PE1A 1NAL1 4F0MA 3K30A 3T6CA 3HPAA 4Q4RA 1WA3A 3ZZ1A 4OUIA 1EJTC 1KM4A 3QSTA 4GO8A 2ZFAA 1LQ0A 3BDKA 1XIIA 3OTRA 1Q7QA 3FCPA 2DSVA 5LGZA 2ZZ0A 1FWEC 1S46A 4J3WA 2XFYA 2C3DA 1J0JA 1ITXA 1JEZA 5FAGA 5IBXA 1SZFA 4AZCB 4P61A 3WLMA 1DIKA 3PBVA 4MPQA 5AHIA 2V5JA 2ACRA 2D0GA 4A21A 3N9SA 1OCQA 1E51A 1V51A 4IP4A 4BA0A 2D3NA 4HZ6A 4Z1DA 2J7FA 3K8KA 4H19A 2BXYA 2W3ZA 3ARUA 4R85A 3JZEA 4YN5A 2ZXDA 3ITVA 4X2PA 2PB1A 3Q45A 2DSZA 5TNVA 4K2SA 2BVYA 4XAPA 3SCQA 1XLAA 4IIFA 5LGXA 4FA3A 2WVVA 1WZKA 2W3RA 2XFFA 4KS0A 4DO5A 5A8OA 3MUXA 2V68A 1BXCA 3PF3A 1V3JA 3EWUA 3WDHA 4KFPA 2FZ8A 3GS6A 9XIAA 3G6LA 4RLIA 3OBEA 2BP1A 5DMMA 3CPUA 4DF1A 3E0FA 3HMCA 2IPFA 1LOQA 3AIUA 5CKSA 3UEQA 1N62C 3QEZA 1SQ7A 2B81A 2GGHA 2QJGA 4LVGA 4LAZA 4AC1X 1R3TA 2ZKMX 1CGVA 3VNJA 4FI4A 4JKKA 1XC4A 2QJJA 3BC9A 3F2BA 2YL6A 3L0KA 3BTNA 1KR0A 2DU2A 3F4VA 2KZHA 2PU0A 4S23A 1VFTA 5DN1A 2PWGA 3PULA 4LBSA 5HQLA 3NQ2A 1GRGA 4JDRA 2G37A 4HU3A 4OBRA 3PZQA 2CESA 3GAYA 3OQEA 1H2IA 2ZVIA 4WGXA 3AIRA 3JW7A 1Q6QA 4KEUA 3ZR6A 3ARSA 5EMJA 1NFPA 1Z32X 3AIEA 2OLSA 2GGGA 3GXPA 4J9JA 1SW3A 3S1VA 1R0MA 3AI0A 3RF9A 4IQEA 3TVAA 4LUSB 1UP3A 2V5KA 4MNMA 3UWYA 3LERA 1VEPA 1O5RA 3CV6A 3M0HA 1HUVA 4RK8A 2ZZ2A 1E1FA 3CZJA 3AIWA 3O0FA 1SYTA 5MKGB 2V6OA 4AG0A 4C6FA 5A1AA 1VFSA 3S8HA 1XSJA 4XZIA 5BNKA 4QDPA 3RFAA 4CCEA 4LRSA 4X63A 1OJTA 2OOGA 2OZTA 3NQCA 1W0MA 3U3HA 2NV2A 3IGUA 1XIGA 4PCSA 4LT9A 1F3WA 1MFVA 3ITLA 3OHIA 4U5KA 3TSDA 2WK2A 4EQXA 3KL5A 1KFEA 3QN3A 2P88A 2IKGA 1U2YA 4AUBA 1TJ0A 1Q6CA 5G5GB 1XRTA 4QM1A 3RIKA 1AL7A 2TPRA 3NO5A 3ZT5A 1C7SA 3THCA 4WSHA 1QBBA 3AM9A 5D9OA 2J78A 1VH7A 2XYLA 3DYMA 4KH2A 5U7SA 1K4HA 2AKZA 3NYDA 1JCXA 1JQXA 1W5PA 2ZYFA 2D1ZA 1OJXA 2FH6A 2XGZA 2VZSA 1QK2A 3OYXA 3OVQA 4DUOA 2Y5JA 2AGTA 2QJIA 3HRDC 1GJPA 4YLWA 2J8FA 1DJIA 1NPXA 1R7AA 3KOWA 3ABSA 3F5KA 3MV11 3S5YA 3PBWA 4ZR8A 5CPNA 4KERA 4Z0JA 2I17A 4QJ4B 5JH2A 3KBNA 2MNRA 4DJEC 1P7TB 4JS3A 3WQ4A 2FFCA 4MSSA 5FSEC 2OTDA 5EB8A 3KCLA 4B16A 4CQ9A 1KXVA 1EJRC 1E4MM 3KBWA 2A3HA 1BTMA 2BGNE 1A0CA 1US2A 2FFIA 4IG2A 3VNZA 3GH5A 2RH9A 1H7XA 1P6WA 4GWEA 4OQVA 4WX2A 3G5EA 3CT2A 2DZSA 3G8RA 3CZ8A 3E3HA 3G8EA 4JD4A 4LUYA 3NZQA 2CLOA 1MWOA 3WLLA 3WD4A 1J6OA 4IMDA 4TR9A 3FJLA 4HGXA 1X2GA 4GYJA 3GUWA 2OG9A 2PZNA 1N61C 2VM8A 2XGBA 4FF5A 4IGSA 1E0TA 3WF4A 2C0AA 3ZO9A 2ZUNA 4IJBA 1Q7ZA 2Z1BA 1XL9A 5EMLA 5IHRA 3H22A 4RNFA 3VFLA 4L6OA 4W93A 3TYUA 2PE4A 2NZLA 3GVVA 4ZA0A 2ZA3A 4ORMA 1EJ7L 3LCGA 5HPCA 4LBUA 1GUVA 2A7RA 3MDUA 1DVJA 3O2LA 3IIOA 4V15A 3GHUA 4U28A 1Z6KA 4C1LA 1FEBA 3RAOA 4V33A 2ZBTA 3PFRA 3KZSA 2XSXA 2J66A 3P74A 1DJZA 3WLOA 4S3EA 4A2RA 1GOWA 4M6UA 1FWDC 1NDWA 2UY2A 4AD5A 1K9EA 1QWGA 3BGGA 3C8NA 2OZ0A 4H8VA 1KRBC 4G6CA 2I5QA 4Z1BA 3RPDA 3OEXA 1L6SA 5AY7A 4NEWA 1LROA 5EBUA 3CZKA 4DBUA 3AMZA 2CLMA 4NRRA 3W85A 3QYQA 5AFDA 4Z17A 1Y5WA 2VURA 3S9ZA 2D20A 5A2AA 3IACA 1JI1A 2J25A 2C14A 2V81A 3BCDA 4WK9A 3OVRA 4WLCA 1QW8A 4D1IA 4Z1CA 2V3DA 2DSWA 5FOOA 4DZHA 1R46A 2NXIA 4H4RA 4WXZA 1SMDA 1YQ2A 2YDRA 4EX4A 1HVXA 4FXJA 2KX9A 3CNYA 2J8TA 4A2SA 4FNUA 4INFA 4LW7A 1J8VA 3BJTA 4O13A 5AN7A 1QI0A 3PTKA 5AHMA 4B2DA 2IPWA 1RXOB 2WPCA 1A3XA 4ZSTA 1XYCA 3PWIA 1CYGA 1FFRA 2E5BA 1S3TC 4AB4A 4J2PA 3A5VA 5BMXA 4REQA 4IX0A 1ADDA 3RNMA 3HBLA 2CBVA 3QZAA 4KIRA 1NWSA 3NYZA 3J7HA 4PMDA 2CZVA 1DIEA 1E9YB 4ZENA 1F76A 3WKZA 1XICA 2GDQA 1IZKA 2HPMA 2PWFA 2DZTA 3E2SA 3KDOA 1XDJA 4ICMA 3LRMA 3QW3A 4ZFCA 3IWPA 3WH7A 2EKCA 5C5YA 3S2MA 1L6FA 3BOLA 3KLLA 1XG4A 4GQGA 3QVQA 5CBBA 1HKIA 1Q65A 3EXTA 5CAHA 1G6CA 4BI7A 4JCMA 1F7BA 1V3LA 1YNPA 3T09A 3BH4A 3AROA 3I7RA 2ZX5A 4S3DA 4ZFMA 4JTJA 4AZ6A 3PB0A 1V6UA 3IJLA 3LXCA 2EQ6A 3TK7A 5KVHA 4ZOAA 2W4XA 3GVWA 4NJJA 3CGEA 2XWEA 4A05A 3AHXA 4UCGA 4D8LA 2R1NA 1XH2A 1DXEA 1GCYA 1JDFA 3W1XA 5JU6A 1UHVA 1VQZA 3UNTA 4XIAA 3P3BA 4WY0B 3FV9A 1ZTVA 1UIPA 1F8WA 2BODX 4TV5A 3AZSA 4W88A 4HSHA 4KCVA 4QG9A 2CYGA 4IM4A 3LOTA 1Z7AA 3TZFA 5MKGA 5GNZA 1N60C 2GVLA 3M6YA 1Q7MA 1K6AA 3EB3A 4CNNA 2P8CA 3H2OA 3P8IA 4XZNX 3HGRA 3TLQA 3TR2A 5LIXX 5A5WA 3FOKA 4D6CA 2EJAA 3E38A 2B7PA 4P5UA 4RE2A 4LC6A 4UOQA 1WKFA 1XFCA 4OOZA 3W4RA 3THUA 3WDPP 1PTAA 1AMYA 2WBKA 4V2XA 4IIEA 4R53A 1E1CB 5CSSA 3PY2A 2DT3A 4UWMA 3W86A 1GKPA 3ZLGA 3OO2A 2FPTA 3GAKA 3QZ6A 4I7VA 3BZJA 1XLMA 1REQB 1I9CB 5A8PA 3GNDA 5D02A 4GIEA 1M68A 5J5RA 1QNSA 3MMUA 4K7VA 1EEPA 4B92A 1PBGA 4H7CA 4A8IA 3SUWA 2ZC8A 5HPOA 3PZ9A 2HROA 4JFUA 2QNEA 4QJ5B 3H8AA 1JYVA 1KM1A 2ZCGA 1FFQA 1TWIA 2XIBA 3BJSA 2O9OA 3K8LA 1M41A 1RR2A 4GPNA 1HFBA 2Q01A 4H1ZA 3SCNA 1P7TA 4PRTA 2VGBA 2XPKA 3MI2A 1GVEA 4GNJA 1GRBA 4D9PA 3XIMA 4JQ9A 1PZ0A 1NP0A 3ARZA 2VQUA 4LUTA 1WPCA 1ONEA 3DK8A 1JPMA 3BO9A 4AHPA 1UR2A 4XD5A 2PDWA 4FXSA 4M24A 2YCEA 5EFFA 3BW4A 4GISA 4I6VA 4ZOHB 1JZ5A 1X38A 7ODCA 2WWCA 2Z1SA 2NUXA 3NO1A 3WFLA 4RX0A 1EPXA 4J3TA 4UB9A 3D46A 4X2RA 5F4WA 2QAEA 3O16A 1BD0A 3ZSSA 1PYFA 1W9BM 2Q3RA 4MKSA 5H91A 4D71A 3HM7A 1K8ZA 1LZOA 3IGXA 2X1SA 4DWSC 3TW9A 2VFEA 4L9XA 3S1UA 3LLXA 2ISVA 1RSCA 3VOCA 1XD0A 3RR4A 4H4VA 2WPBA 4DLMA 1DJGA 3WMLA 4GRTA 3E0VA 1UP0A 4B2DD 3ZWTA 2VRKA 1QNQA 3SSZA 3VUSA 4FXRA 2YDQA 1MRQA 1S5VA 4E3VA 3APTA 3R1ZA 4UNLA 1VFOA 2VGIA 3VNLA 1W1B1 3LADA 4QLKA 1UBSA 2YIHA 3CAKA 1GRTA 4R27A 3GK0A 1S5TA 1QR7A 1NJJA 2VEIA 3ITYA 5EMMA 8CGTA 1QTWA 3K2GA 2ZTJA 5AYIA 5I77A 2X1IA 3R12A 3UR8A 2RHGA 1KO0A 3UU0A 3AALA 1EJUC 1VBUA 1Q2RA 3W23A 1KCLA 4WSJA 2DZVA 4BI5A 1RBOB 1XGDA 1S2WA 4DBEA 1V7AA 1KNWA 5FF2A 3SCWA 3V1HA 3G6MA 1VP5A 1ICSA 1UR0A 3FKRA 1F5ZA 3LCXA 1PXGA 3RGTA 3NSNA 3ZQ9A 1BAGA 3URQA 2EPMX 1J0HA 1TTQA 3KTCA 1OX5A 1KBLA 4DO4A 1Q5MA 3NQAA 3MANA 2BDQA 1Z41A 3DBNA 3AXKA 2WLYA 4ACZB 3CO8A 4WVXA 4HNVA 4QDWA 4IUOA 4JTQA 4XX6A 2W55A 3C0JA 1E0XA 1YW1A 3MUY1 5EY5A 1XDMA 4E0CA 2X8GA 3RK8A 4RJEA 4S3AA 4PMVA 4ILSA 1HJQA 1PVNA 3ZVIA 3WF3A 3U2ZA 5CH9A 3UW6A 4GKLA 2P0OA 3WD0A 4I7UA 3K5XA 1BXNA 2J6XA 3UR2A 3M43A 1WYGA 1NHQA 3BCFA 4AF0A 1IT8A 3G22A 1RD5A 2V69A 4BV6A 3SGUA 3W7PA 3O06A 5HWNA 3EKGA 3C56A 2DDXA 3RRXA 1CT5A 4GIYA 4LS2A 3DUGA 3B03A 5JCIA 4CN4A 1L6YA 1MFUA 2VVNA 3L7RA 1GRHA 1RA0A 3GDKA 1A50A 1CGTA 4K8GA 3ID7A 1GVYA 1CI1A 2FJUB 4R7WA 1A3HA 3UNDA 3RHGA 3ZS4A 4FLRA 3W53A 3WLPA 2PUZA 2BY0A 3LPPA 3MT1A 2QT3A 1PEZA 3FXYA 5CLTA 5FESA 1P6CA 1VGAA 3MYOA 1GOXA 1LORA 2FH8A 3WBXA 3WBAA 4ADTA 1KWGA 2Y7DA 5DY3A 4PB4A 4BI6A 3TZNA 3QR3A 1VLIA 4HHHA 4C6IA 4JTKA 4C7FA 4UNIA 1KGXA 4IMEA 4LUJA 3UVAA 1ONFA 2VZOA 3OIHA 3WLTA 1EZ2A 3QFWA 1NH6A 1ZALA 2GDUA 1I0BA 2AMGA 4C65A 5ABEA 4WKFA 5FF7A 1TRIA 4L6HA 3BMXA 3ZYZA 4G8TA 2YCLA 3H4WA 3W71A 3UG4A 2QDGA 3W81A 3LY0A 4Q4MA 4O54A 4QQ3A 4UFLA 3FHQA 3AC0A 3H2NA 2AAQA 2GQ3A 1R6WA 4F0RA 4GXPA 1XHGA 3XISA 1AMKA 4DIAA 4QISA 4PR4A 1FWWA 1IE7C 1VFLA 1LDCA 1YTEA 5K3VA 4R3UA 3ICJA 4OVXA 1HL9A 2PWDA 2ZICA 2ACUA 2W61A 3KRZA 2W54A 3CLMA 1Q13A 3AS0A 3U57A 3B9NA 1J2WA 4PUNA 3WJXA 4OGZA 5LNVA 4HN8A 1EJWC 2VFIA 2P1FA 1OVDA 4HBKA 4DXXA 4W7WA 4XAYA 2AL1A 1DV7A 1TTPA 3RM9A 3WBEA 3UWUA 1UH3A 1TPH1 4PB3A 4UCFA 4GY1A 2DZPA 5D04C 4GA8A 4H50A 1P1MA 1OHLA 3ITGA 3R7MA 4YVPA 1GOOA 1JUKA 2VCCA 3IEBA 3FA5A 4TVCA 1N8FA 3GZ3A 5E0FA 1PKNA 2XGIA 4TV6A 1QT1A 4IX2A 2C79A 2CC0A 4O50A 1LTDA 4ZTXA 1RLDA 4B15A 4QE5A 1GYLA 1PWMA 4FLOA 2TSYA 1E71M 1I2RA 4JKMA 3W2LA 4ZQOA 5K4XA 9RUBA 2F2HA 2F7FA 3W07A 3QQ0A 2QUNA 5L6UA 4A8RA 5K9DA 2QDEA 1I2OA 5GRTA 3LCWA 1R87A 4LF2A 5JRBA 4NZJA 1G4SA 2E9MA 2W9MA 3T1GA 1KQYA 4K8DA 4FOUA 4ZL1A 1FWSA 1GREA 3TMQA 4LAOA 3HIJA 1S3HA 4UFMA 1UWUA 1O7AA 2XN0A 4GFIA 3H54A 5DLCA 3KW3A 3L2IA 4KMQA 3NGFA 3LB0A 4XD6A 1XLDA 3B40A 3W0KA 3UJ2A 1L8PA 2RJGA 3C61A 4E38A 5FF3A 3NIYA 3H53A 1GJWA 3NCOA 1TPDA 3KBSA 5AC6A 3GU1A 1DWHM 1PO9A 2WKJA 5AECA 3GQYA 1UZHA 2ATMA 4S3JA 3M0ZA 1XBZA 1I4NA 3BSMA 5LSMA 1KFCA 4DUWA 4HYWA 3VD3A 3DZ1A 3ZJ7A 3HPFA 1I6NA 2PDNA 1T5AA 4Y9MA 5HNNA 3PHAA 4N4QA 4WDWA 3CHDA 5D03A 3R8RA 2XIMA 3E9AA 3PAOA 3PTQA 1GVRA 3WCZA 4PRRA 1YQZA 4IICA 1BG9A 3MSGA 5CC3A 2ISWA 4U31A 3PNZA 1S1RA 2Z0IA 2BC1A 3HQ1A 4G9PA 1WAUA 2GR0A 3AYSA 1GQNA 5D38A 3QPEA 1EA9C 3IIVA 4UTTA 3CWHA 4TOQA 4WCJA 4ONVA 2NT0A 1PS9A 3W27A 3W7LA 2PWVA 3R25A 3LHTA 4LJ3A 4J2MA 4JFWA 1VBJA 3C52A 2HK1A 4JTSA 4U2YA 3W7MA 1GQIA 4ACZA 4PL2A 4Z1YA 2X0SA 3G1HA 3GXNA 3E12A 1C8VA 3NOEA 3UVIA 1PX8A 4H4UA 3O6CA 4JHMA 1UP2A 3UXAA 4MDOA 3GH7A 2WHKA 3H26A 3CBWA 2XFWA 1C9WA 4X0NA 3Q6JA 1TJ1A 4W5ZA 3VOFA 4ZQCA 2A3LA 1XYBA 3U9IA 1ECEA 1OZQA 3E2VA 3MWCA 3OZYA 3U5YA 1S39A 1P0KA 4HZ7A 1Q6FA 2BOGX 4R33A 4GLEA 3WO8A 1GVFA 2OO6A 4KCWA 4AW7A 2PP1A 1W3IA 1S7MA 4WJXA 4HHPA 3GXMA 2CU0A 2B4GA 2BX7A 3KDNA 1YLVA 3EDEA 2WSRA 2DUZA 3TOPA 3G1FA 3TQPA 1VRXA 1VZWA 1W8SA 2OZ8A 4WOQA 2J77A 3SZ8A 2FZNA 4F79A 4KGLA 3A9BA 3EOSA 4NXSA 4GH3A 3AU6A 4Q4QA 4J7RA 1XIHA 1YBQA 1OD8A 5G5IA 2QPXA 3SCSA 1O94A 1Q66A 2MUCA 3P80A 1KKRA 2J88A 3KE0A 4Z2LA 5CGTA 3UYIA 5A8NA 2CLEA 1R9XA 5KEZA 3NL2A 1QI5A 1IYXA 4DBDA 3MQTA 2QAFA 2Z2UA 3SY5A 5LA1A 1UIOA 3BOXA 3GLCA 2WOIA 3W1TA 1DPMA 4W84A 4AQLA 5JIPA 1TREA 3HB9A 1XSIA 4TUFA 1XJBA 3GR8A 1DNCA 1K02A 2W91A 4BF5A 2WVTA 4YCPA 4UUIA 2VQTA 3AS3A 2VT0A 2QXWA 5F2IA 4I90A 4A4AA 1FTXA 3OZPA 4H4IA 3GTFA 3WJWA 2WCAA 4S3BA 7PTDA 1BVNP 1OFBA 2O55A 1HKJA 4M1BA 1ITCA 3F7JA 4AIOA 1WB0A 3BV4A 5LIWX 1ZFJA 1KRCC 3ERPA 1GZGA 4W7VA 1OABA 1W3LA 1BF2A 2POTA 1OK4A 1UQYA 3A7AA 2OT1A 2G50A 4UNKA 3QV7A 3M9YA 1R2RA 4FIQA 3NXFA 4FXFA 4PMQA 2J6VA 2QS8A 4I8YA 4ROPA 1G67A 3PUOA 2POZA 4GABA 5TD4A 2J74A 3H23A 3ALGA 2XVLA 3CUIA 3OBKA 2YZ5A 3M0VA 2QV4A 4OBSA 1IEVA 3A23A 3QM3A 2XIJA 2INEA 1E6QM 3BAIA 4ATDA 4LX4A 2OJPA 1S2UA 3CPRA 1JDCA 2WOWA 4EQWA 5ABFB 1XKJA 3I3DA 3QMSA 3MW7A 4F40A 1PX3A 1Z44A 4WY0F 5A6SA 3E96A 5K7JA 4GY7A 3RX3A 1L9WA 1HZYA 3WFAA 4M81A 5FMHA 5CJNA 2WZIA 3W7DA 2HCVA 1BKHA 3FSUA 4ZB0A 3N3MA 3NL5A 1UPPA 1TMLA 5E6YA 4Y9AA 3GVGA 2NX9A 4G7EB 4NXKA 1XRSA 5FJJA 4DHGA 3M16A 3H70A 1K9TA 4IIGA 3C2RA 3EWYA 1M04A 1CGWA 4A22A 1ZMDA 1KCZA 4GYFA 2Z1WA 4CD7A 3RMJA 1H5YA 1KWKA 1R7OA 3R0KA 1HP4A 3L4WA 5TBOA 2X99A 3WD1A 3W29A 3C2EA 1U1HA 2YOCA 4H83A 4FR6A 3GG1A 3ELFA 3TN4A 1HO4A 1DP0A 2G4JA 1GEQA 3DYOA 1C7TA 2DT2A 4C6QA 3NVWB 2YLLA 4C60A 3ATYA 2R1MA 4IUGA 2J9YA 3BW2A 4KEZA 3UERA 4C7GA 2YA0A 2QF8A 4MLJA 1D9EA 2PDKA 2JKEA 2E77A 1P43A 3FXGA 2V6AA 1TO3A 1N82A 4DAFA 3H2CA 3NVDA 4IT1A 3GC4A 4GKTA 3PZMA 3TYCA 3LA4A 4E2DA 3MSRA 5KITA 1MXSA 1K6WA 3PWGA 3KS5A 3AFBA 4XD4A 3NR0A 3II4A 3KFTA 2X7VA 3L9CA 2Z27A 2ZA2A 3TWBA 3O6YX 2QCGA 1UR3M 1OYBA 1UKPA 4KWWA 5BXSA 4FR1A 3R10A 1CXEA 1HKWA 1WV2A 2B7OA 3PZIA 1FQ0A 1YNYA 5KZMA 4L6DA 1V4YA 1XLEA 3BMVA 1YRRA 3CLWA 2BXZA 5CEWA 1DKWA 1TZ7A 2DQWA 4U5IA 4XAGA 3NFUA 3TIMA 4NAFB 1B3WA 3AU2A 2PBOA 3VUPA 3VD4A 3O3RA 1JYXA 2PWUA 2WJFA 5A8GA 2Y7EA 5ENLA 3OYZA 1OT1A 3QPZA 3REQB 3S1XA 2ZRVA 2PWHA 2HZGA 1OEPA 1NDAA 2ZDSA 4GXMA 3QBUA 3LSCA 4E4UA 1TWZA 3LENA 5KTLA 4JTHA 3W7EA 3TJIA 1XBVA 2QV5A 1ZGDA 1ISZA 1DQXA 3B9EA 3Q58A 5H2ZA 4D8ZA 4DO6A 4LOCA 1AQHA 3DN5A 3EDFA 5D2XA 1B9BA 4HMCA 3TSBA 2G3IA 3OA3A 2OCZA 3QHMA 4Y8FA 2J79A 3R8HA 1XYAA 2D3LA 4GMEA 1CXLA 5D05A 2OWWA 1X2HA 4QX4A 3N2XA 2D2GA 5EBAA 1OD0A 3VIPA 1T6MA 4GI8A 3ABZA 3VKAA 2YA1A 1A4LA 4CN1A 4GD0A 3GW0A 1OFEA 3I10A 3A3XA 3G2GA 3O05A 4XAZA 1EP1A 3TU9A 2B0MA 2R9RA 3HG4A 2C1HA 1DXIA 5AHLA 1UZDA 4M6QA 4IL2A 1IWPA 1SUXA 2OX1A 4LH8A 5G2HA 3LM7A 3TH6A 3G0UA 3G77A 3E6EA 5IXEA 3S6OA 2E09A 4FNQA 5EGRA 1F3PA 1EB3A 4RZBA 5I23A 4PCPA 4YIWA 3STPA 3EZ4A 3VOJA 1UA3A 3QV9A 4OTKA 4LB3A 4KF1A 3TROA 1J2BA 2GK1B 1LP6A 3AISA 4E2OA 4NNCA 3EA3A 2PPGA 4B5WA 4HHMA 4EVZA 3GD3A 4HNNA 2Y5SA 2P53A 1XLFA 5ECUA 4UTTC 4Q8UA 1KBJA 3BG3A 2W3SA 2HEJA 4AWSA 1L6GA 4JQ3A 3M47A 1SJDA 2J75A 4GRSA 2V30A 3W7CA 1H11A 1TFVA 1ME7A 4IMCA 4MYAA 4J28A 3WNPA 4XISA 4AMAA 3CHCA 4MJ4A 4CVWA 3QZEA 1JROA 1Q6LA 1OGBA 1Y0EA 1YDNA 2Z29A 4CNTA 1P0EA 4E3TA 2TMDA 3VKDA 3FNDA 3JR2A 1NSJA 1UWSA 3U2CA 4EM3A 3LD5A 4H4ZA 2UZ9A 1PCKA 3USZA 3I6TA 3RO6A 4DJFA 1IIHA 2Z25A 2PDQA 2RUSA 4DN1A 2ZE3A 2VD8A 1GTEA 1AH3A 5CSYA 2HMCA 5JCMA 3DI0A 3MS8A 4JCLA 5HULA 2GR3A 4GZ7A 3B3DA 4OE7A 1H09A 5LXXA 5I2UA 2EPNA 3UZWA 1QO2A 2PP0A 2XZ9A 3TA6A 3CEPA 2VR4A 2CEQA 2D2HA 3CEUA 1EP2A 3A7RA 4DYEA 4RCXA 3QFBA 3N25A 4CD4A 4N9EA 1PPIA 3D3AA 3LGDA 1W3HA 4HP5A 4OV4A 2PFHA 5FJPA 3HGJA 1C8XA 5HNRA 4D2JA 1PUDA 2JBMA 3LBOA 2VYOA 2I7GA 4NY2A 1FIQB 5A2BA 2DY3A 4UMCA 1XLHA 5C7HA 3SW6A 4FLSA 1VPXA 2GVEA 4U4MA 2ZZ5A 4K7YA 3TC3A 3USBA 3VIKA 4J56A 1S2VA 1FFUC 1XIEA 4KRUA 2O7SA 2OXNA 4YHGA 1BEUA 3DGBA 5BU6A 5TQLA 5I3FA 1EL3A 1V6WA 2WOQA 3QHNA 1RQEA 4FP1A 1DE6A 2DW7A 1UWAA 3GVRA 2E1WA 3WQ5A 3OOQA 3SO7A 4YTUA 4JEQA 3URHA 4ML9A 3QQ1A 2WCGA 3CGBA 1V6TA 4N9CA 1EQCA 1XLKA 4FS9A 1G4EA 2YCJA 4Q32A 1ALDA 3E2QA 2PCEA 3EUB3 5KETA 3SECA 4XUGA 3L2LA 4JTEA 2X2GA 1PTDA 5FKYA 3NM1A 2F84A 4NZ3A 1SO3A 1EJXC 1O4UA 3KLKA 4O52A 4UTLA 2Q8LA 4QAWA 1HVQA 1FWCC 4APNA 1A5BA 3APYA 2BG5A 1F6KA 3GXIA 3RXZA 4AHOA 2QCDA 3NDOA 1EJSC 2IS7A 4LAMA 3H7RA 3R2GA 4DNMA 2OFJA 4IMGA 1FH9A 3T81A 3IVSA 5C2CA 1PZ3A 3KCJA 4RL3A 4O1AA 2QPSA 2SFPA 4ASTA 1HKKA 2NLYA 1O68A 4JTUA 4HU0A 2Y62A 3EOUA 4QAIA 1POKA 2E6AA 2V2HA 1GXFA 2WZTA 3QJAA 2GOKA 1OC5A 4JTLA 4C6OA 3W01A 1A3WA 1IEIA 3LCFA 3DEQA 1SSGA 3CT7A 4B3LA 2CPUA 1EF2A 3HF3A 3CTTA 1TQJA 2JKAA 4JQ2A 2NSOA 4S38A 2CLPA 4UQEA 1ELSA 1W6TA 2GFTA 4IGHA 1NDYA 2DEPA 2A1YA 1B31A 3VNKA 3NAVA 3QLDA 4XV0A 3VIGA 3NQEA 4JYDA 1IQ8A 5RUBA 3AOFA 4B4HA 5D9MA 3R89A 1T8QA 3DFQA 2L5HA 3STEA 4H7VA 1VCVA 3PNUA 4BK9A 5I6SA 3B4YA 2O9PA 2PDCA 1W5OA 4LANA 3L21A 4QNEA 3OGRA 4BEUA 1R85A 5FD0A 3EA1A 3P2VA 3VIFA 4U33A 4MJMA 1J01A 2C6QA 1W56A 2VL4A 3MKVA 1XLGA 4PTVA 3ZLHA 1UQZA 3KRSA 4ZOBA 3MBDA 2WJDA 1JEHA 3P82A 3TYZA 3LHVA 2QJMA 1TPUA 1EEXA 3LXAA 3B8TA 1PHQA 4IH3A 3MBFA 5LHFA 5TAOA 5TR3A 5T91A 2VZTA 4DNHA 5FS9A 1Q2SA 1OIFA 3FDKA 5FJOA 3W7NA 3N4FA 3WLRA 4AY1A 2X50A 5C8BB 5M2FX 2Y7GA 3VGEA 1RP8A 2X1RA 1GONA 3W82A 1AZ1A 2YCKX 3M41A 3GD4A 1SZEA 4PUEA 4YJ5A 4E5TA 2PEVA 4HK5A 4O1CA 5G2IA 3N15A 3SUVA 4F0SA 3TTSA 2E40A 4DX3A 1CWYA 3NQVA 4H6QA 3FSTA 3MZNA 3S2JA 1THFD 3MZ2A 2YL5A 1GESA 3VDAA 3A3WA 3OGSA 4WGHA 5CSUA 1RALA 2YBVA 3QPYA 3N2TA 2R8WA 3ZOAA 2D0HA 2GJRA 2XSBA 4Z0SA 5LXEA 3DK4A 2J4GA 1GHRA 1H1YA 3PM6A 1W1ZA 2PDJA 3HJEA 4ZOEA 3HJZA 4XQ6A 1JZ4A 1JRBA 1Q8AA 5M03A 3VINA 2YZRA 4EWJA 5HJLA 4PUKA 3OBAA 1XR2A 1OCBA 2Q8ZA 4H4WA 2HWGA 2NWRA 2HISA 4NZ4A 5CPMA 1RA5A 3BPWA 2O92A 4WRHA 1Y5XA 3T7VA 1R3QA 3BAKA 4H9VA 3HTWA 2WXDM 1Q6EA 2WZHA 5BWAA 4LWWA 3T2OA 3W1MA 4YHEA 3WQWA 4A6GA 5CAKA 3OP2A 3WENA 3MC5A 3T0BA 2DSUA 2R9ZA 6REQB 2E3ZA 4XTIA 3MB9A 4C1NB 3EAUA 2LLEA 3EB2A 2YR1A 1JXKA 5G4HC 3ABQA 4LYRA 3SIZA 5C9UA 2XVPA 3BK0A 3T0AA 1K7XA 3BSGA 1H0IA 1TV7A 7TIMA 4W8AA 3WQ8A 1R5YA 2BOFX 2HJPA 4PSPA 3LMYA 3I3BA 4TTUA 1WDDA 2REQB 1KW1A 2Z28A 4MJ2A 4PUWA 2WV8A 4AVOA 1OSEA 2FZMA 4HSOA 2XM1A 2VZVA 3S0CA 4L9YA 4CKQA 2PDGA 3STGA 1ITUA 2QDDA 3ITOA 2QCHA 3GNXA 2QULA 3MPGA 3VE7A 1E6XM 3MKCA 2GJPA 2X41A 1IT0A 2BGQA 3IV3A 5CSRA 3VTRA 2C3CA 3P67A 4E2VA 1FWBC 3H24A 3NA8A 1CGUA 4JIHA 3DI1A 4IMFA 1C92A 1Q1WA 3KS6A 3BLKA 3WNNA 5H1WA 1DJXA 2IUZA 3LRLA 3G1VA 3TLLA 1JF6A 4FMVA 2G95A 1B54A 4PBEA 1NFGA 1XW8A 5HBFA 1EXPA 5CJ5A 2PGRA 1F3TA 1J79A 2QZRA 4O1EA 1JCJA 1NTHA 3OIXA 2XIIA 3EXRA 4ES4A 2HE8A 3NZ1A 1OFAA 3GNNA 4JDYA 2BCPA 5D4YA 3EB4A 2WZMA 3ABRA 4LPCA 1BGAA 3KVKA 1V0NA 2OLAA 2P8BA 3H4GA 4Q7NA 5A8QA 1DTUA 1E6NA 4CEXC 4DJFC 1JYNA 2YGYA 1VCFA 3HGOA 2NQZA 2J7DA 2FGLA 3ARWA 3WQVA 4CCDA 4DF2A 1XLIA 1YKWA 3ZFHA 1K4QA 1M01A 3UR7A 3OG2A 2VP8A 5CPLA 2HK0A 2Z4GA 3LX9A 4QDMA 1KV5A 2PDPA 3R94A 1WZAA 4D6HA 5GJNA 4XIMA 1FCQA 1NWUA 2HSAA 3MCMA 1VYRA 4YNGA 1QPOA 3B06A 1FRBA 4S3KA 3GNRA 1HGYA 2ZRYA 4K39A 3CXBA 3WF2A 4E8DA 1HQTA 1XUUA 1OFQA 4QR6A 3HO8A 1N2VA 1SZGA 3C0QA 3ZT7A 4LAKA 1QNVA 3LLDA 1CENA 2J7CA 4DYJA 2D2JA 3GXTA 1MDLA 1TVPA 3KVJA 1B1YA 1FHDA 2DQXA 1EX5A 2FTYA 3FK4A 2JF6A 4GYPC 2G97A 2WBGA 3E0IA 1LCOA 3F2DA 3SCTA 4ZVJA 4FOJA 3TTOA 2GQWA 5FJRA 3DFPA 3NVYB 4MZ1A 5AOUA 2NQLA 3WQ6A 1H61A 1MMFA 3LB8A 4IIBA 1ZQ5A 3S1WA 4D6JA 5G1YA 3SFKA 3PJUA 1MDRA 3P93A 2R24A 1WUEA 1J0YA 4QG6A 1O1ZA 4FNTA 1PCWA 1TA3A 4LNYA 1XV8A 1U83A 3W7RA 1IXNA 3WLKX 3A24A 3I65A 1LUCB 1QK0A 2J9ZA 2AQVA 2PMQA 5EBKA 4G5DA 2WMIB 2PGEA 2VDIA 3PANA 1J0IA 1UROA 2PLJA 3C5QA 3AJXA 1YMYA 1JCTA 2BMBA 5FEWA 2Y85A 4PGLA 3G1RA 3WMSA 2WM0A 2ISFA 3MVTA 3P84A 1OX4A 1V02A 4MUPA 3BLIA 1RY8A 2IPGA 2WWDA 1W1TA 3H2MA 1ZBKA 2WHJA 1EIXA 2EAWA 3U4FA 1S2AA 2XUCA 3TONA 4L61A 1ZBWA 2X8CA 5BWFA 3GXFA 3VC5A 3NDZA 4QSFA 1ZRQA 5DQPA 1QHZA 4JTCA 4XBSA 1J12A 5HUPA 3HV8A 1ZBVA 3CM4A 3B8DA 1PDZA 1EC7A 2E8YA 3GTHA 4JBRA 2Q6ZA 2GJXB 4X0VA 1RPXA 2QUUA 5GQBA 1AD4A 2Y8UA 3P0WA 3WLIA 4J3SA 2TPSA 1GKQA 5LA0A 1HJVA 4LVBA 1E6ZA 2J7EA 3N6QA 2X16A 2V0TA 2PDYA 4GBDA 3SJNA 5CQ1A 3DFOA 3V0TA 2Y63A 1XINA 1UUMA 4O57A 4X61A 3H7UA 4PTNA 4B3KA 4HVXA 4GCAA 1BPLB 1E6SM 1V6YA 1JAEA 2A4AA 3B0UX 4JOMA 2ZUTA 1MUCA 1LLWA 4FNSA 4QS5A 1ZJAA 4UTIA 2ZUWA 5C0QA 1RCQA 2Y7FA 1OIMA 1F8MA 4FX7A 5G4EA 3AS2A 1TMHA 3ARVA 3GBDA 2WMJA 5PTDA 3LTPA 3H12A 2YXXA 1VB9A 3GKFA 4L7ZA 2HXUA 1V0LA 3SQMA 1ZJBA 1MQRA 2CBIA 3M7SA 3PTDA 4H41A 4UQAA 4RXGA 5FSDC 2YAUA 3NEHA 5DEZA 2HS6A 4IJCA 4P2VA 3RM4A 3KHJA 2PTXA 5KZ6A 1BYDA 4FNRA 3CZEA 1L8NA 3DG3A 3IS4A 3HQOA 2C15A 4Q8MA 4TIMA 4C1NA 2VX7A 4ZGYA 2A85A 1NELA 1BYBA 2P3ZA 2FB2A 1CGYA 4HA4A 4IFKA 2OO0A 3VABA 4H6RA 3TTEA 3IC9A 2PI6A 1B4KA 3RJXA 4OT7A 2PODA 2WPEA 3N12A 2AL2A 2V5LA 1XIMA 2VRQA 3DFSA 3DECA 3IAPA 4Y9NA 2YBTA 2UY5A 3POCA 1WKDA 3TN6A 1A5AA 3TFCA 1JNDA 3VM5A 1AJ0A 3DGHA 1KR1A 3CQJA 2REQA 2RFGA 5I06A 5DMYA 3KUMA 1X39A 3QYSA 3GM8A 3AN1A 5H8UA 5LNRA 1W1YA 3IRSA 3FHAA 3CO4A 1F6YA 4HYRA 1B4EA 3NPUA 2E6FA 2HVOA 4GC3A 1M3UA 5JQ9A 2WMKA 4B5UA 1KXHA 2E9LA 1XSKA 1SM9A 4R88A 2GWNA 3S9IA 3V36A 5JBEA 3DJGX 1EF3A 3K1DA 2INFA 1YX1A 2IPJA 4GX8A 1XIFA 3SCPA 3W83A 1UD2A 2VEGA 1E5NA 4LRTA 1SJCA 3HQPA 4H4SA 4P7QA 2FZBA 4Y6GA 4C6NA 1W3KA 1PIGA 3SR7A 1R9YA 2PDUA 3QC0A 4Q4PA 3L66A 3N19B 4OWGA 7REQA 1BKSA 3VX1A 3VNMA 2GQ9A 4E4FA 1QW9A 3PK7A 3AHZA 5EMYA 3CPGA 1NVMA 3W3OA 2PC8A 3MHFA 5G4WA 3LPGA 2AAMA 4JL1A 1FHVA 2OLHA 3CL7A 3DG7A 3GG7A 1OG0A 4NAEB 1OX6A 4OU1A 3M4HA 3N13A 3NQMA 1U5HA 2E25A 1LL6A 4DO7A 2W79A 1S5MA 3TW6A 1B3YA 1OC7A 1K7FA 3GXDA 4W89A 3MV01 4UTKA 4J35A 1YDVA 6ALDA 3EOOA 1V3MA 2W6RA 2RKXA 5CXPA 1X7IA 2FYMA 4HHLA 4R9XA 3TCEA 3SI9A 4GG9A 3VVGA 1MO0A 4EACA 4ACYA 4XBJA 3QRHA 2Y70A 3DC8A 3DFTA 3QR1A 2FPYA 3RCYA 6CGTA 3RO8A 3SRFA 3GHSA 1A5OC 4MG4A 3VDHA 3R0DA 1FWRA 3DX5A 3PZNA 3UY7A 1JZ3A 3APGA 2G5WA 1SSDA 4UTWA 4ZO8A 1J18A 5DCBA 1UZ4A 1VYPX 2XVKA 3N6JA 1LBMA 5C70A 4MMWA 4IXHA 1N7KA 1X97A 2CLHA 5A6LA 3ABXA 4UR7A 2XM2A 3K13A 2V5DA 4O4VA 4XUYA 1AL8A 3P0XA 2FHCA 3GDTA 1XXXA 5EL1A 3QTPA 4I9MA 4WUIA 3ZJ6A 3MJMA 6TAAA 1F3XA 3NSMA 1FCBA 4HZMA 1W1PA 3ONBA 3QV6A 3M5ZA 1TZZA 4MWAB 3ARTA 1LUCA 3KZPA 1EBHA 1JIBA 1RVKA 5DXXA 3Q4DA 4OIFA 3CIVA 4Y2WA 4IQJA 4QCEA 5REQB 1E73M 4LV4A 4JY9A 3L5LA 2PDMA 1PKYA 1XCFA 4LUIA 3CV2A 1SVDA 1J93A 4G1NA 3CAQA 4KKXA 1MXDA 1TCDA 4HA0A 1X1OA 2X2YA 3CK5A 4J57A 3MP5A 4AWUA 2TODA 3M0JA 4Z2KA 1YTDA 3NQDA 2GL5A 4EOUA 3S4TA 1IXQA 3KCOA 1TYPA 2E6DA 5IFTA 1RPKA 1GKRA 4UIOA 1TPWA 4IISA 3V5OA 4TVYA 3Q37A 4Q6XA 4MM1A 1CXIA 2O7QA 4DWDA 4U3AA 1P1XA 3MDWA 4Y9OA 4GBUA 4NI3A 4ADSA 2IKJA 4XZWA 2ZZ3A 4A8LA 1LOSA 3AXHA 1G1YA 4C6DA 2X30A 4JIQA 3W38A 3EDDA 1R3RA 1W32A 1LQ2A 1X7FA 5DXYA 4UR9A 3UFYA 2NVCA 1GRAA 1M6JA 4L56A 2CW6A 1B3XA 5E0KA 2XISA 2ISDA 2W66A 2ZZCA 4H9UA 3G1DA 1H49A 1S1PA 1UKQA 3GZAA 3T9PA 1E0WA 1D8WA 4W85A 4GOAA 4J3ZA 2UBPC 1JCLA 2O9TA 3ZVHA 2OVLA 4H8UA 2QW5A 3LG3A 5HQEA 5E93A 2VFFA 2BHZA 1W5NA 3GHTA 4F2UA 4NJHA 5HA7A 1YXDA 3AZTA 1EOMA 2GSJA 3BV7A 3WDJA 2YX0A 4UFKA 4WQ6A 4MGGA 1GYNA 2FJKA 3EOLA 1D7YA 3TV8A 3DESA 2V9DA 4HSNA 1W1A1 2XH7A 1NF0A 1MEIA 2WANA 1F4AA 4LEQA 2VXNA 4WOZA 1GOIA 1PSCA 3C3NA 1IEWA 5TIMA 1DJQA 3AHYA 4YTSA 2NQHA 2CKSA 3M0IA 1WX0A 3K4DA 3SN0A 3GX9A 1QHPA 4B5VA 4IPNB 1KM5A 2WNWA 3BSHA 3KAOA 4JTIA 2GJLA 4UR8A 2VEFA 5M5DA 2QUMA 3VKCA 4EANA 2WHMA 5BRPA 3W2MA 1M7XA 4Q22A 2NSXA 2G8ZA 5C2XA 1QCWA 3KTSA 1K4GA 2PTDA 2ISSA 4AXNA 4ZCWA 3GVQA 2VVSA 4UTHA 2GVGA 2F6UA 3PJXA 4WZHA 5FIPA 5U25A 4J3UA 4H4QA 2DT1A 2YL8A 4MB1A 5KINA 2Y24A 5B7ZA 2J24A 3RPTA 1MZHA 4FB7A 3GIPA 4O18A 3HPSA 2FVMA 5JH1A 1V8EA 3RCMA 1JUBA 1LM1A 4HCLA 1RJQA 3ITXA 1K77A 1JQVA 2HNEA 1QASA 4NZ1A 2YJQA 4M51A 1XUZA 1RJPA 2WVUA 2ZIDA 3U6WA 2OYLA 3OGVA 1QOXA 3IARA 2Z6IA 3MA8A 3IUDA 4MJZA 2X40A 2AKMA 3CMJA 1X98A 1BTCA 4GO9A 3S2LA 3EEGA 2PS2A 1LT7A 5L9FA 2EG8A 1UASA 4OHQA 1HJSA 1POJA 4J4KA 1TUXA 2EG6A 2OQLA 2NQ5A 4HOXA 3DHPA 3H21A 3L5MA 4PB5A 2ABAA 2Y61A 2YW4A 3KX6A 3NQBA 1CZ1A 2JKPA 4ERAA 3LCIA 5AYYA 1UKSA 2C3ZA 2ZE0A 3UYCA 3UZXA 3QGVA 1Y8BA 3O0KA 3WK1A 3RU6A 3W74A 4L80A 1DORA 4WSKA 1TJRA 3MMWA 2P76A 2XIOA 4CQCA 3I4KA 2CKRA 3IK4A 3IPWA 4QE1A 4F8XA 1CXHA 1QRQA 1V6VA 3B8SA 1IF2A 3QH2A 4DI9A 4EPKA 3NURA 4AWEA 4YU1A 4I7WA 5D33A 3CS2A 5GNXA 2Y8VA 3NOYA 1W2PA 2ZRXA 3T08A 2DZBA 4BURA 2PD9A 4A3RA 1XANA 3FDGA 1O95A 4S1FA 4Z1AA 2CBUA 4PMOA 3URAA 2QIWA 2WP5A 5GVJA 3WF0A 3LK6A 4GUGA 3FGCB 4HNOA 4KT2A 4H4XA 2ZA1A 3UJSA 3DC0A 2DZUA 1JOAA 1VKFA 3B9DA 3QW4B 1NDVA 4K36A 3FA3A 3TDFA 4GFSA 3QMTA 3K46A 5JBDA 1T8XA 3S5NA 1F07A 3WH8A 3M0XA 1EIBA 2VO5A 2A3CA 1KBKA 1ZUAX 4X9SA 5JCLA 2GH5A 4PUMA 4DZ5A 3NO3A 4EMJA 3QOMA 5CBIA 3V3WA 2F2KA 4DI8A 2ZX8A 4OZOA 2VEPA 3N34A 3TMLA 3P7YA 3B8WA 3PR2A 1MW3A 2E5AA 4RW3A 1F3EA 4RNIA 5D9PA 3N14A 3O0HA 2FPVA 1OYAA 4P7RA 4KEMA 4PMRA 2ZRWA 5A69A 1E3XA 1M7OA 1NF7A 3QV8A 1DJYA 3MP4A 1FKWA 3ONCA 5DCDA 1NEYA 1QI3A 3BAYA 2EO7A 3A4WA 3NQ8A 4DPQA 5REQA 3WNKA 1CEOA 3LU2A 4ATLA 3WG6A 1MQQA 1AH4A 2D22A 3LBCA 4EXQA 4XAFA 4MNJA 3AAMA 3TXZA 5HAOA 1GEUA 3FEMA 2VZUA 2WP6A 3SSJA 3C0LA 4HOWA 1KB3A 1Q6DA 4NP7A 3M1ZA 3BARA 2QQ6A 3P81A 3GB6A 4CNOA 3II1A 2QMJA 1FXPA 1HJXA 1A5SA 1J10A 1FH7A 5BMWA 1DEDA 1HF6A 4L4PA 2WBAA 3GSMA 1QXLA 4CU8A 3WDIA 4JNYA 3N2BA 3E02A 4Q3MA 1K70A 3CUFA 3ENLA 3BOFA 4AZIA 3DGRA 2QJNA 3T78A 4AZCA 5I00A 2WHLA 4DAIA 3WQDA 3QF0A 1W9PA 1EH9A 3RX2A 4MFEA 2DIEA 4N9BA 1VYSX 1E6RA 2F9RA 1AH0A 5ECVA 3EA2A 1VDVA 1G69A 1D3CA 1GVSA 1AW2A 4NU7A 4GK8A 4HZ8A 3H6OA 3EGJA 1H7OA 1QNRA 1VF8A 4UTMA 4I3GA 4HU4A 3FYOA 3WK3A 3NUKA 1BXBA 3RLUA 5BRQA 9CGTA 2VI0A 4M1RA 4AZGA 3ITTA 3BMWA 1UWRA 1QUMA 4LIIA 4BHYA 3MMTA 5CLWA 3RLHA 1FH8A 4H01A 1GW9A 1W37A 1YNQA 4A8NA 3EBVA 4Y96A 1TVLA 1FKXA 1YYAA 1KTCA 4UTUA 3ITCA 4WDXA 2PRMA 2XHYA 5DBTA 4JHZA 1XFBA 3C86A 4IOTA 3TYDA 4J3XA 2W0UA 3LPFA 3F5LA 1CXFA 1BSIA 3CH9A 3TR9A 3BQ5A 2XSAA 1W5MA 3VD7A 4C6CA 4KRZA 5KZDA 3JS3A 1K8XA 3R58A 4DXKA 2EEXA 4XSMA 1JPIA 1GZ1A 1OGGA 5IBXC 1T40A 1VFMA 2ZX6A 1AOGA 2H9AB 4MPKA 2OWXA 5I78A 4WR3A 1FO4A 4RPPA 3AUJA 1JG9A 2DH3A 5CGMA 4UZUA 3S1GA 3GFYA 1E4IA 4EP8C 1W9UA 1WDWA 4JNMA 4LUSA 2C1IA 2CHOA 1NU5A 1MSSA 2WLZA 2NUYA 1FY6A 5JXQA 4ROQA 1TV3A 3UQNA 4TX6A 4DBSA 1P5BA 2GQ8A 4Z2HA 3CC1A 5LNSA 4WDUA 4Z2IA 1XIBA 3F5JA 1DIDA 2FIQA 2HBVA 4NJIA 5FJUA 3S6DA 2Z1KA 3FY1A 1BRLB 3TCSA 4WHBA 4PTDA 3CUJA 1AQ0A 4XSLA 5DELA 3ARYA 2OWCA 4MDPA 3GFZA 2VR5A 2VCBA 5G2WA 4GVGA 4M56A 4IQDA 1HKVA 2Z24A 3CXOA 3ETRB 1UR8A 1P0DA 1B0IA 3ES7A 3EKLA 5TF0A 3VM7A 1UH4A 1WDQA 3DKJA 5DY2A 2YQUA 3MHUA 4PUDA 3P6LA 4TTGA 1ZCOA 2X0HA 4HB7A 5AVNA 4CD8A 4QSHA 2GUYA 3MP3A 3B04A 3WQFA 1TWSA 3AS1A 2BS9A 3DYPA 4AD1A 1JF5A 3VIOA 1E0VA 4ERIA 3GDLA 1E72M 1ME8A 3KM8A 4PUUA 1UYQA 3C2FA 4GYKA 1XLCA 5HINA 1GNXA 1KC7A 5F7UA 3GU2A 1ZLPA 7XIMA 1FHLA 1AW5A 4LCRA 3B0PA 3CUXA 5A6JA 3KBJA 1M6IA 4GQBA 5A6MA 1GPWA 3LCLA 3V75A 1E9IA 4Y8EA 1G0CA 1C3FA 3W6MA 3CUGA 1XI3A 4Q8QA 4P7NA 4C6BA 1PKLA 3L4XA 1FXQA 1KD0A 3NJ3A 1RV8A 3JRKA 4NI8A 3WUEA 3VGGA 4E8CA 5FS6A 4CU6A 4GQ0A 4O11A 4PTWA 1FP8A 2IW0A 1EUNA 1T7LA 1A53A 1UUOA 3WJSA 3M07A 1V6XA 4WKHA 3DFYA 3WK0A 4MFDA 4RE4A 3HURA 3U7VA 1B30A 2CZFA 4JR5A 5G5HB 1GJUA 3JU2A 1TX2A 4RDZA 3MUZ1 1TMQA 1B2YA 3VAVA 2F5ZA 1YE6A 1E0UA 1Z3NA 2OQHA 1TPC1 3VE9A 2CFFA 1CBGA 4H8NA 4NG3A 1N5WC 2HQAA 4AYSA 4HMNA 3W1RA 3UJEA 1QWKA 2XVGA 2PBGA 4RE3A 3FGCA 2ZXBA 4HIBA 3WELA 2NPXA 2PZ0A 4HOZA 3EDKA 2J3NA 2VDGA 4I5RA 1MVYA 4FNPA 1GGOA 5AC4A 3S47A 1ODUA 3A4JA 1MNZA 4AC7C 4LYPA 4NEVA 3GY1A 1J6PA 4JXCA 2D69A 3VA8A 4MF4A 1RK6A 3UR5A 1EFZA 3IIZA 2DGAA 3M5VA 2I5IA 7A3HA 3MTWA 1UB3A 2QJHA 3M5XA 3LMZA 2WVVB 4GJ1A 3MU7A 5DX7A 3W02A 1GERA 2WC7A 4M52A 2A0NA 1VCGA 1A5NC 2ATSA 3TFXA 3T42A 2GR2A 4ZB2A 3TXVA 3BICA 2QCEA 2WO5A 2Z1XA 4DRSA 2BSLA 3MHGA 4NUWA 3Q2DA 2CBJA 1OYCA 3PG9A 2Y8KA 2YVJA 2XN1A 3WD3A 4LVFA 1XCXA 3EX4A 4XG1A 1QOQA 2P10A 4WKAA 2NUWA 4QLLA 3GTIA 3TYEA 1EXBA 3S9YA 4HNLA 4HJWA 5AYZA 1YPIA 3T8QA 2EHHA 2V8ZA 3HMJG 2EF9A 3LV6A 3LN3A 5AKQA 3W1NA 3U0HA 2PLCA 1XKYA 2E1DA 2VGFA 1H4PA 1ZPTA 4IPIA 4NSBA 2NV9A 1IEQA 4KPRA 2WAGA 1UJPA 3CMGA 4UFJA 2F8QA 1TE6A 2W63A 3UWVA 4PMZA 4AH7A 1ZCCA 1UOKA 1W1IE 3CUZA 3BANA 5H8PA 1ODZA 3TX9A 3BXWA 1CPUA 1I2NA 1F74A 4M8UA 2JGYA 1DJHA 4H8HA 4LSBA 1V7YA 4DJDA 1RQBA 2AGKA 4PMXA 3ANVA 4DJEA 4FX9A 1PZ2A 1EGMA 1GQLA 3KVMA 3VGBA 4US5D 5BW6A 3T55A 2ZUSA 1N8IA 3P5ZA 3H55A 1ZNNA 1HL8A 5FJIA 1ZAHA 2ONEA 3SY8A 2PRHA 1EOKA 1TSIA 4HK7A 1WDRA 3KP1A 2PD5A 1XM3A 3MI3A 4N0RA 4Q33A 4NZFA 1OADA 3PPGA 2Q09A 2OX4A 2R1KA 5AHEA 2OSYA 3W70A 1KV8A 3HFTA 3BLEA 1UD5A 1NHPA 3WUBA 2YB1A 3N1AA 3FA4A 2J47A 3GFXA 5DCEA 2ZZ4A 4DVOA 2CWXA 2QHAA 4LV9A 1AD1A 3ARRA 2J27A 4DWSB 2VHLA 2Z2AA 4TMCA 1ADSA 2O4QA 3RRAA 2WNNA 2WJEA 5I7GA 3LHUA 5F1VA 1EDQA 3GC5A 3QR0A 5AC5A 3PG8A 2H9AA 2DORA 3FS2A 4GIRA 3AHVA 9XIMA 5I0DA 4H4PA 1FWTA 6A3HA 5FEZA 3BLFA 5A6KA 1H7RA 2G3NA 4WY0A 4YCOA 3PBUA 1EGZA 5A3HA 2WMFA 1IV8A 1GQJA 1LWJA 2TYSA 3CMFA 3VIIA 4ZO6A 5AHNA 1JZ8A 3UG8A 3VOHA 5CG7A 3LM3A 1P0BA 5C55A 2E7FA 3W26A 4KIEA 1D7FA 3B8UA 4BS0A 1OF8A 4O28A 3NL6A 3VKJA 4R9OA 3GDBA 1D3GA 4CUCA 4F0KA 4HT3A 4EE9A 4IG2B 3ZJKA 4BEQA 5HJYA 5FA5A 3VK5A 5JBFA 4K8EA 5I3KA 1FWGC 4H2CA 1SFSA 3DK9A 2WC3A 3MUIA 1GQKA 2VC6A 3L4TA 4AU0A 4JN7A 3INPA 3PAJA 3VIHA 2OR2A 3EAOA 4XO7A 1E3ZA 1E1CA 2QUVA 1E4LA 4ZBCA 2NQJA 1JPKA 2QEZA 1TV2A 3DKLA 5CJMA 1H5VA 2JE8A 4NX5A 4C7DA 1C8QA 1REQA 3P5YA 3VZYA 3G1AA 3FEQA 3RJYA 2VDHA 4GVIA 3IJ8A 1JAKA 1UBPC 1PB0A 4GZEA 3OLIA 2Z1VA 5FJTA 3W7GA 2W67A 5I5RA 3TJ4A 5ABHA 3TWAA 1T0OA 3QKZA 4N4PA 1YXCA 1M65A 5DANA 1M5WA 1N55A 2PDIA 3WLJA 4BF7A 1KXTA 4ZQRA 4BZYA 2H90A 1R2TA 5D37A 1VBGA 3SDOA 1U5VA 2BB0A 2QAPA 1GV4A 3B9JB 2VTFA 4R34A 1EGVA 2OKTA 4MAVA 4HPHA 2X7WA 3KOXA 2DIJA 2GPTA 5BZAA 1QHOA 4B9ZA 4D6EA 1RH9A 2DFAA 2HVNA 2PLMA 2FVLA 4M5PA 3WQCA 4GJIA 3OJGA 1LRTA 1XS2A 3MCOA 3N73A 3GYCA 6XIMA 3LPOA 5AC8A 2EPOA 3FG2P 2VFGA 3LCHA 4PUJA 1KKOA 5D8ZA 1UC5A 2YDAA 1NDZA 1TV8A 3VDBA 4CD6A 2J7GA 3CAWA 5BOEA 1K1DA 4MIMA 3HZ3A 2D23A 4P8UA 3EX6A 4AEOA 3EX3A 2H3BA 2PURA 2V3EA 3MUAA 3PBGA 2C71A 1U5JA 1DL3A 1XYMA 1P4CA 1F6PA 2W5FA 3CHEA 1ZP3A 3N6HA 3G3DA 4JX6A 3ZJ8A 3GRSA 1X1ZA 4DJDD 4I5UA 3UCQA 1JFHA 3V5CA 4REQB 4GQQA 2VMFA 4DJED 3EX1A 4V1XA 4LB4A 1WO2A 3W84A 4DELA 3FW6A 4KCUA 3SB0A 4V28A 1BYCA 3BJFA 4GCXA 3EWZA 3BURA 5LZLA 3A4XA 4C6PA 4O15A 1TR9A 4YYCA 3B05A 4AZBA 1AQFA 1NY1A 2ZVRA 1S5WA 5KVIA 4TVDA 1AW1A 3FVDA 1BWCA 5U1OA 1EPVA 4IWWA 5BXTA 5BROA 1JXJA 1GVQA 2X1TA 4MB5A 3RUBL 1ZXIC 3OC4A 4PFMA 4MB3A 4I6KA 1VEOA 2WKGA 1FWNA 3M0KA 1VLWA 2WC4A 4F9DA 3UZJA 3LHYA 5F2GA 4ZO9A 4NX0A 3WD2A 3NZGA 3PVFA 3L5AA 1SU5A 6PTDA 4QNWA 4B3ZA 1O12A 3R4IA 3VU2A 1GOQA 5DT5A 4K68A 1ONRA 4HU8A 4QLJA 1J0KA 5HWMA 1EWEA 2G3JA 4RDVA 4DF0A 4RPQA 3I6RA 1QNPA 3LHWA 2E68A 2F6XA 3MUCA 3VMNA 3NPWA 3VFCA 1TPFA 4LTSA 4U2ZA 4W87A 5D2VA 4I9TA 3VC6A 1NOFA 2DUAA 2P3EA 4L1XA 1EQPA 1XCWA 2ACSA 4RE0A 3E1F1 2CXGA 1WXJA 2WSYA 1WDPA 1OY0A 3SCVA 4PFHA 1TWWA 3G24A 1H1ZA 3EXSA 4Q8NA 1ISWA 1Q6RA 5HMDA 4WD0A 2BV9A 2WNZA 1CX9A 3W2UA 2YYUA 1IXPA 1R47A 3QSRA 1WUFA 2ZWYA 3TW7A 1K9FA 4DZAA 3VMOA 4O14A 3PUEA 5CCZA 4BF9A 3RLVA 4H2HA 3U8GA 4JFSA 1AJ2A 2VJXA 5I3GA 4KGJA 1KLYA 4DWSA 3STCA 2YB4A 3CQIA 3SEPA 1Z48A 2WOVA 1Y7VA 1ICQA 3IJQA 1GHSA 4L1WA 1FCVA 2IQ0A 4I8DA 2RABA 1SR0A 4L5ZA 3SADA 1VFHA 2QR6A 3NTYA 1G7VA 2XH0A 1GYMA 4R7JA 2XH2A 1W8GA 3W1QA 3RMEA 1BWVA 3JZUA 5CZSA 3U2EA 2Q02A 3C8FA 1SFLA 2YL9A 1MW0A 1DHKA 2VRJA 4NZ5A 2R91A 1F9CA 1GT8A 2HE5A 1I60A 4HNUA 3GR7A 1UW9A 2V2CA 2ZUMA 1UD3A 4DJDC 4Q4OA 2C18A 1A5CA 4QQUA 2Q71A 1JI2A 3UA3A 1T41A 2D0FA 2A5HA 3UA4A 3PJWA 3M44A 1K8YA 3UJFA 3UPWA 1FECA 4LYQA 1R8LA 3THDA 3CWNA 4XKYB 1OFPA 1ZDLA 1B3VA 1WKYA 2PDLA 1XDIA 1LT8A 4MTVA 2YW3A 4LUTB 4RR4A 2FTWA 2OGJA 4O0ZA 3OQ8A 5HMSA 4AD2A 2QVNA 3AMCA 4OKDA 4I5XA 1G5AA 1GWJA 1PAMA 4F0HA 5ABGA 2VKZG 4BFAA 3SFWA 1TCMA 5U4NA 1L2QA 2RJHA 3OLDA 4Q8PA 1CB7B 4MKVA 4IHCA 4Q4SA 4W5UA 4QRNA 3SURA 1FCUA 1WOAA 2NVDA 5E0CA 1NOWA 4M6PA 2ZZ6A 3SQLA 1GEHA 5AZ1A 2BGSA 4N7QA 1JR1A 4F9JA 2UY4A 3DJJA 5B80A 3JUGA 4TX8A 1PZ1A 5DF0A 4NNAA 1EC8A 1HNYA 3GWQA 3STFA 1B3ZA 1UG6A 4GUIA 2I16A 3PZTA 3S5OA 3W75A 3W6YA 4GHRA 2A6NA 1DJWA 4KWVA 3CHFA 4M29A 3A6OA 2CLFA 1YXYA 4JX4A 2FLIA 4POCA 2I9UA 1B5TA 4ZOCA 3LZ3A 1CCWB 1XRFA 3TAKA 1EA0A 3W1UA 1JD9A 5E5CA 4HPJA 4CQDA 4S39A 4BWLA 5IOBA 3OVGA 2QPUA 2KAUC 3LDVA 1U1JA 1R3YA 4QCFA 5CC5A 5A6TC 3QGAC 4X9YA 1B57A 1NWTA 1UKOA 1UZ1A 3SUTA 2WM1A 3QQWA 2C8NA 1CW2A 3GRTA 2ZRUA 3LTSA 1XGZA 3TN3A 3LI1A 3NPXA 3VGHA 1RBLA 3N9RA 4YTRA 5CPOA 4JDBA 3UZZA 3W7QA 3LBMA 2ON3A 1E6PA 1W1VA 4JFTA 2ZTKA 1HX0A 1XYZA 1RJRA 1UCWA 1HJWA 4DUVA 1SW0A 2OELA 5A6AA 4IIDA 4Y9PA 2TRSA 2DIKA 1J5TA 1IGWA 1HW6A 4MB4A 2A7PA 3C4UA 4GH1A 3CH0A 4PMYA 3TYBA 1DXLA 4P8XA 2ZC1A 1O60A 4DY1A 3K4AA 3BVJA 4W4QA 5JCNA 2VOMA 3EEZA 3HN3A 3QOKA 3TOYA 3NZRA 4LXFA 5DFAA 4AEFA 5D2WA 3D6NA 4NVTA 2VWSA 3GKAA 1IEXA 1IIGA 4PTMA 4XWUA 5CC7A 1V5XA 3OW1A 4Q7IA 1MUMA 1LVLA 3QFEA 3DDMA 1X8FA 1WXZA 4K1WA 4F4RA 4AF0B 1TB3A 1XF0A 1GRFA 4H4TA 1GW1A 4CEUC 3MMDA 4JIIX 3EPMA 5C71A 3MY9A 3SUSA 1KQZA 4NYUA 5XIMA 3MI6A 3URNA 4F66A 5HR6A 3G0SA 2VX5A 2RDXA 1WE5A 2ABBA 1H60A 2Z7KA 4P8VA 1A5UA 4V27A 4MYXA 1HGWA 3WDQA 1AG1O 1FHUA 4A35A 2IKHA 1IXOA 3WMBA 4XZHA 3KLJA 4A29A 1FWFC 1ITQA 2NWSA 3LQGA 1QFEA 4DWSD 3SAZA 5KMYA 2R14A 1US3A 1R86A 3PZUA 1CB2A 1PV8A 4WXYA 4KPLA 1CLVA 1U22A 1H7WA 4TU1A 4KFNA 3WNLA 4F0LA 1XLLA 3TP4A 4D72A 3UWZA 2WPFA 1H7NA 1AFSA 3E49A 4PE8A 5HWJA 1JRCA 4JIPA 2CFYA 3CIWA 2HBXA 5JMUA 4H9YA 2J7HA 2VWTA 2OPJA 2A6LA 2FZDA 4M3PA 4F3HA 3WLQA 2PDXA 2PA6A 1X6UA 1RY0A 3QXBA 3NVZB 4H4YA 1TZ9A 5F2LA 1U1UA 4CU7A 2C0HA 4Y7EA 4D6FA 1WZLA 2YCLB 1QMLA 3HOJA 1TR1A 2C91A 4JQAA 4QE4A 3R6IA 5GJPA 4UOZA 5HR7A 2B7QA 4E6MA 3ZLFA 1SZRA 3QLLA 3T2QA 4GI6A 1ENUA 1HT6A 1OK6A 2Q3OA 4M7TA 4AMCA 3V35A 4JKLA 4P7LA 1ZAIA 3UWWA 1GG0A 1UR9A 4YVXA 4DEFA 1Q1RA 3CIXA 1PWLA 3HFYA 2CLKA 4CD5A 2ZUUA 1IR1A 1H50A 3WJYA 3UT0A 4GACA 4O53A 2BVDA 3GUGA 4ZB5A 3RITA 4AIBA 2QYGA 4Q8VA 4L64A 2Y88A 4WJ8A 3H2FA 1EKOA 4DZIA 1VBRA 4IPJA 3VOIA 1KTBA 4K37A 1FOBA 3SQPA 4UQDA 1U30A 8RUCA 3EPNA 3BLDA 3O1NA 1UJQA 2ALRA 3XINA 5T8GA 1KFKA 1OWQA 3CB8A 3LLFA 4GXWA 1IHIA 2PCQA 3WIJA 1PJ9A 5HANA 4YWSA 3WQGA 1PYMA 5K4ZA 4IF2A 1RD6A 3NQ7A 3MYPA 3MWAA 2P50A 3ZWSA 1GZJA 2DVTA 4I9AA 4XKYA 4G1KA 5A95A 1A4MA 1FUYA 3N3TA 3UXDA 1KGWA 3PWAA 1O5KA 2DJXA 5FI8A 3VMPA 1TIWA 1B90A 2IQDA 1W9VA 3AMGA 5FEXA 4C6EA 2OZ3A 3AIVA 2A2IA 5HDRA 2CCRA 4R5EA 1UPMB 4Z2GA 4TMBA 8XIMA 3M5YA 3R5EA 2E4TA 1NM9A 2UWFA 4JGDA 4YS1A 1H62A 4QS6A 1TVNA 4AZHA 3WNOA 4MOZA 4PODA 4EWND 3O15A 3B8IA 2DVUA 3L8KA 5LIYX 2E3TA 1LG2A 2B31A 4S2CA 1STZA 1YPFA 2ZZ1A 3C2YA 4O4WA 3BLPX 5G1MA 5K2ZA 1W3JA 5BXRA 3T44A 5JCKA 3W2JA 3ALFA 3N4AA 3TE9A 2XJ7A 3B4UA 3IRDA 3THAA 5ABFA 3VXGA 4LBRA 2Y6ZA 3SRDA 3O9NA 1QPNA 4LS0A 3GU9A 2ZWZA 2WSKA 2X0YA 1CXKA 3POHA 1D2KA 2V38A 5GNYA 3LNPA 3WBWA 3R0UA 1GTHA 1RM6B 1BQCA 1TPVA 3COTA 5A2CA 3A3HA 1HJUA 1X96A 2XDFA 2Z7GA 3B97A 4MZ8A 1MNSA 1A0DA 4G7EA 1K7EA 1A47A 3ANUA 2NLIA 1US0A 3KOFA 2VX6A 2UY3A 3G0XA 3U48A 1JCYA 2IQTA 3VPLA 4RNHA 3ARQA 5DRIA 1HL2A 1YDOA 4ZODA 1PL9A 2ZUVA 2CHRA 1W17A 1E9ZB 1B9ZA 3KTXA 1LBLA 2CERA 4OV9A 4Q6JA 3HA1A 1GVIA 4XBKA 4ICCX 3AUOA 3W37A 1HIZA 3L4VA 1WCGA 4PSRA 4PH6A 3LV5A 2J7BA 3DHFA 1LLOA 1TTIA 3AICA 3GIQA 4ZXLA 1HO1A 1QNOA 2ACQA 4DBWA 2XFRA 3GR4A 2E0PA 3UWEA 4AZ5A 5D09A 1EWDA 1Z89A 4C6KA 3UGVA 1CNVA 2EQ9A 2BVWA 3V16A 2GR1A 1YIXA 4IIHA 2BY3A 1UOZA 1K3UA 4AX6A 2Z2BA 1XBYA 4G2DA 4IP5A 3T0CA 1PHWA 4PC8A 4F2TA 2FB3A 5I03A 3I7SA 4HJFA 3CHVA 3GTXA 5BU9A 4BWLC 1C9DA 3F1QA 1E15A 3L67A 1UD4A 2VOTA 2QKFA 2CZEA 3VCNA 2VFHA 1AZ2A 4JICA 2WMGA 4LYKA 3CAVA 3E0WA 4NAFA 3PP7A 3NS1B 4TVWA 3WEZA 4MY9A 1P48A 3CGDA 1KBBA 4PCFA 5CPTA 2A79A 1I2QA 3DFNA 3REQA 2FKPA 1KRAC 4N6FA 3GBEA 1OINA 4AXKA 1R30A 2EPHA 2EQ7A 2I5GA 1DIOA 1H63A 1YBQB 4BQ5A 1QOPA 1W5QA 4PYSA 4RZ5A 4C6JA 1KN0A 4LNCA 1ZY8A 2R6OA 2AQWA 3PBYA 4CGTA 1TRDA 4O19A 2VR2A 2EQDA 3B0YA 4A3QA 7TAAA 4O0KA 3WFZA 4HNCA 4B9YA 2FGZA 2WYSA 2H6RA 3A4AA 1V08A 3IJIA 4B5XA 5CPQA 5C6MA 1WP6A 3AXMA 3D9XA 3WQOA 3P62A 5HK4A 3UP8A 4LC8A 3WZ0E 1UA7A 3QMRA 1FP9A 3G1YA 1BHGA 1FDYA 4ZE4A 1FDZA 1S5NA 2ZZ7A 1ONWA 3MCNA 4PEKA 2YSWA 3C2OA 2FVKA 3FKKA 4AWTA 4B4FA 5F2MA 4HPGA 1XYFA 3FX4A 4EK7A 4KETA 3IIXA 4CCZA 1H41A 4RDYA 1OFRA 1I8JA 2WSPA 4OUEA 5C54A 1VJIA 1ZKQA 1MRAA 1ZB5A 4PZVA 4WF7A 4UOJA 1SR9A 4GI9A 5KSWA 4PRWA 5HNTA 1NIUA 5JVLA 1XBXA 5D2TA 5J5DA 1ADOA 3TN5A 3SBFA 3QY7A 5GPRA 2GK1A 3QKEA 2OT0A 1Z9AA 4LY4A 3K1GA 1XP3A 3RLGA 3L4ZA 3NXLA 1LJYA 4US6A 2V67A 3LYEA 2QUTA 1TWDA 1GG1A 3UETA 4O8RA 2NXGA 2AOSA 2FHBA 3N2MA 5FL1A 2C16A 4ERGA 3CYJA 1XG3A 3K4WA 4Z42C 4LU0A 3CGTA 3RPMA 1LG1A 1ZJHA 5HXMA 5HJXA 5CZ0A 4OFCA 1HG3A 2P0IA 3CJPA 3NRZB 5KZEA 1YTKA 5CZKA 5IDZA 3DBPA 3L65A 2OU4A 3BLLA 2PGFA 5C9RA 5I24A 2X09A 3C0SA 3C6CA 5IRPA 2Z26A 2VGGA 5F1UA 3A9IA 1ZBCA 3GD6A 3B8VA 2YPIA 5I3JA 2GJNA 3NWRA 4K38A 4ZQMA 2GOUA 3D5HA 2X42A 1MI3A 3HG3A 3S83A 2DZXA 2AMXA 6XIAA 1H7PA 1FX6A 3S6TA 2G3FA 3EWWA 3CZLA 4A3YA 3N11A 4TO8A 2BHUA 4XZ9A 4DPPA 1N63C 4EQRA 2QCLA 2PTWA 3N18A 4LCSA 1GETA 1WZMA 3MSDA 2RGLA 3AXIA 1TTJA 4AY8A 2FMNA 3UXLA 2RDUA 3PSWA 3B0XA 3C3UA 2PDBA 1C29A 2BWGA 1AA1B 4N9DA 5G1TA 2QF7A 1C8YA 3KOZA 2X8HA 4QJ3B 2DW6A 3AYRA 4O16A 4BY3A 4DLFA 1X6NA 4PL1A 2DZWA 4EAMA 4JEJA 1UUQA 4C90A 1XGEA 3DENA 5EPDA 3GYEA 3L23A 4MHBA 3CWOX 4C5YA 4C91A 2WZEA 3DG6A 3UGRA 4N6EA 1T99A 1MEWA 8A3HA 3WEOA 3ZT6A 2YCIX 3GO2A 4EMWA 4GINA 3S5ZA 1S2TA 1BWKA 4U10A 1WOBA 1E9LA 1Z69A 1SO4A 3LZ5A 3PC0A 2J9XA 3ZMRA 2O0TA 1X6LA 4IFRA 5HATA 4JIEA 1E43A 4XK2A 4GC4A 3NQFA 1LWIA 2V5BA 5LA2A 2VELA 2W27A 4E4PA 2DJLA 4DNAA 1J11A 1VRDA 1VC4A 3PS7A 2R1PA 1ZS2A 5DT7A 1EDGA 4P7OA 2EBNA 1JGMA 4LCQA 2ICSA 2O9RA 1UWIA 3ARPA 3VX0A 1A49A 3GH4A 4M0XA 3MO7A 4ZQPA 3WMCA 1KFLA 1K8CA 1QU4A 4GUJA 4GX9A 3TTYA 5I02A 4H9XA 5CC6A 3HPZA 4B5SA 1AODA 3Q94A 5BRBA 3PFMA 4QEHA 4JQ1A 3DGZA 3NG3A 4LF1A 1PTGA 3WUGA 2EQ8A 2GYIA 1JDDA 2YLAA 1MOKA 3T0DA 2NXHA 1NHSA 4Y90A 3TNOA 2ZDRA 5EMKA 8TIMA 3FAXA 3ZSTA 2XH4A 1OB0A 3P14A 5CG0A 3LUTA 1VFFA 3W1LA 2QCNA 1JFXA 1M1BA 1ZSXA 3HG5A 3IUHA 3AWNA 2OQYA 1A0EA 4FX8A 3UZYA 2QCMA 3S42A 1LLZA 1ZENA 5T26A 3TYAA 2DZAA 2PDFA 3QY6A 1I2PA 3VCRA 3S2NA 1KRMA 2HPIA 3EWBX 4F48A 4UTFA 4TQTA 2W92A 2VENA 1ZHAA 3CQKA 1OCNA 1ZJIA 3EYPA 4EKJA 4UTJA 3WN6A 1M03A 3EPOA 1JPDX 2V82A 4QROA 3NQGA 1R3VA 2TAAA 2EKGA 1H2JA 1M53A 4QGCA 1XQLA 1J5SA 5ER0A 3LNMA 2VUYA 2Z6JA 2I56A 4MUZA 2WQDA 1DHPA 4HA3A 1KBIA 3FYYA 1I0DA 1XWYA 4IP7A 3WH6A 3I3EA 3WH9A 3KP0A 2YXOA 3PZVA 3T4CA 3ARXA 2WW5A 4AVFA 1D8CA 4KRTA 3SCRA 1DXFA 3ZXWA 1M9HA 3V1PA 1DWGM 3F4NA 3OODA 3QC3A 4J40A 1JCMP 4JTRA 3IAQA 2CXEA 1TELA 3DU0A 8XIAA 1DBTA 4YWIA 1H1NA 4HA1A 4ZEPA 4LAUA 3SGGA 4IFOA 4K3ZA 1ZK7A 2P5NA 1L2UA 3SR6B 4UFHA 4GJJA 2GUUA 2QVHA 2ZZBA 4AFYA 1Q63A 1KA9F 4O1FA 4EAYA 2JQXA 3GNOA 2BY1A 4HCHA 2GGEA 2HRWA 2ZXAA 1IWBA 4QIUA 4GNVA 1BVZA 4EQSA 3BZGA 1A80A 1FDJA 4GE8A 2AQOA 4JN6A 5I79A 4HNTA 3SGZA 1A5LC 4LVDA 4PBGA 1FWHC 1WYIA 3NL3A 1ICPA 2V3GA 3DFHA 3W24A 1QJWA 2J8GA 1ZMCA 2D2OA 4PEEA 2NVKX 4ZTYA 2ZADA 3R79A 2NQ9A 1TKKA 4ECLA 2PTZA 2RDWA 3VNYA 3TEVA 3BUVA 2O56A 4NF7A 2G96A 4XB3A 3B9AA 2PSNA 3NQ6A 1FVPA 4QG8A 3VGDA 2PGWA 4HMEA 2VC5A 4H6KA 1VIZA 1OG6A 4IXXA 2I9EA 4MKNA 3W7HA 1JZ7A 3CTLA 3QY8A 3DHDA 4JPGA 4IGNA 5IHSA 1JDAA 2OB3A 1IWAA 1RQHA 6ENLA 1UMYA 6REQA 2IXVA 4Q8TA 3OLEA 1J96A 4IQLA 4BQ2A 3V5FA 4QHRA 2E67A 4WEVX 3GIYA 2BZNA 2VC9A 3W7JA 1TPEA 1Q4WA 5FS8A 5CZJA 3VIJA 3A12A 1T96A 1ISYA 3N17A 3SCUA 3MVIA 3RYSA 3BAWA 3CYVA 2W0HA 1KLZA 2BBFA 3AQUA 1V03A 3PZOA 4RUBA 4XD3A 4B90A 5C9WA 4B91A 1ONXA 1SMAA 2C19A 3VNDA 4U3CA 4PCTA 2G41A 1V97A 4NJKA 1QPQA 5EKYA 4FX6M 2ANUA 3O7UA 4JQ4A 5D2YA 4PMNA 4CNUA 2NVAA 3WL0A 3D47A 2QCDB 1KGUA 1ECQA 4GZIA 1WQ5A 1RZMA 3RN6A 2OMAA 3HPXA 2VX4A 1KFBA 2G3MA 1KFJA 3KL3A 4QBXA 2QGYA 4QFUA 5K9XA 3CASA 5FEPA 5FACA 3CB3A 1HTIA 3UXIA 3NZPA 1V77A 2Y89A 3LHZA 4BCEA 4CNSA 3V18A 1MO9A 1V02E 1E70M 2VEKA 4XO6A 3SN1A 1GK8A 2GLKA 3VOGA 1XISA 4NILA 1C90A 3VDCA 1RP9A 4B5NA 2F61A 3DIPA 4IL0A 2EGZA 2W62A 3T0TA 1MW1A 4LQ1A 3RM8A 1UR4A 2J62A 4C1KA 1MW2A 1XPGA 2QCFA 4X60A 4OBTA 1TX0A 2G4FA 3HW2A 2ADAA 2WVSA 1F4HA 3LS9A 3W76A 3ZR4A 3M0YA 5BXPA 1EO7A 3QFAA 1JGIA 2VUNA 1D7KA 4Q4KA 3S3GA 3C2VA 1R3SA 3FIGA 1M7JA 3VYLA 1G4PA 1EBDA 3WLHA 4R7OA 1Q6OA 1W31A 1SJAA 1XH0A 1TV5A 3V0UA 1TJ2A 2HXTA 3HV9A 5J04A 1G94A 4OJYA 2YVGA 2BC0A 2YVFA 2BLEA 2IKIA 4J27A 3ME3A 3VCCA 2A3EA 4L65A 4HPXA 5BOFA 3AHTA 2H8XA 4KQNA 1U33A 4JY8A 4FLQA 1AK5A 4K7ZA 2JEQA 4M80A 3RILA 4ICNA 1NP2A 2YFNA 3LRKA 3ECQA 2ZRZA 1BYAA 4GZJA 5FCZA 1XRVA 2FTPA 4UZSA 3W7OA 4ZSUA 1OCJA 4H00A 4H9MA 1PIFA 4EIVA 2FGBA 3EDJA 2V3FA 3IJ6A 3N04A 4N42A 2OEMA 3DERA 2VNCA 4D6GA 1V93A 3A7UA 1W91A 1SB3B 1CDGA 1X8CA 3UJRA 4UC5A 1FWJC 3FYPA 1ME9A 4W9TA 4L9ZA 1GSNA 4WDTA 1F05A 4JYFA 3WLSA 1HP5A 2DV0A 3THQA 5AB3A 4MZYA 2YBUA 1VJZA 3IJ7A 3E5PA