3RR1A

Crystal structure of enolase prk14017 (target efi-500653) from ralstonia pickettii 12j
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
384
structure length
372
Chain Sequence
MVKITRLTTYRLPPRWMFLKVETDEGVTGWGEPVIEGRARTVEAAVHELSDYLIGQDPSRINDLWQTMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLGVPVYELLGGLVRDKMRTYSWVGGDRPADVIAGMKALQAGGFDHFKLNGCEEMGIIDTSRAVDAAVARVAEIRSAFGNTVEFGLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAETYARLAAHTHLPIAAGERMFSRFDFKRVLEAGGVSILQPDLSHAGGITECVKIAAMAEAYDVALAPHCPLGPIALAACLHVDFVSWNATLQEQSMELLDYVRNKADFALEGGYIRPPRLPGLGVDIDEALVIERSKEAPPVWRHADGSVAEWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of enolase PRK14017 from Ralstonia pickettii
rcsb
source organism Ralstonia pickettii
molecule tags Lyase
molecule keywords Putative D-galactonate dehydratase
total genus 111
structure length 372
sequence length 384
chains with identical sequence B
ec nomenclature ec 4.2.1.6: Galactonate dehydratase.
pdb deposition date 2011-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3rr1A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3rr1A01
2PU0A 3H12A 3CXOA 3RRAA 4EWJA 3VFCA 3R25A 4HPNA 4FP1A 3CT2A 2QJNA 4H83A 3MWCA 2XH0A 3UGVA 1EC8A 3FJ4A 3SN4A 3FVDA 4HYRA 2NQLA 1JDFA 4ZCWA 3GO2A 3DDMA 3FYYA 4ROPA 4IP5A 3UCCA 2P0IA 1FHVA 2ONEA 4M6UA 2OQYA 3R10A 4K1WA 3MKCA 3GD6A 3R0UA 5FJTA 1SJCA 4DYEA 2OO6A 3IJLA 4E6MA 3P93A 2OX4A 1IYXA 3HPFA 3DERA 1BQGA 2GGIA 3DG3A 5FJRA 7ENLA 3T6CA 4ENLA 3MUCA 3OTRA 4DWDA 2HXUA 3DGBA 4X2PA 3ZLFA 2OKTA 3V5FA 1SJAA 1MDLA 3DG6A 3SN1A 1KCZA 2PTXA 3ZVHB 3OZMA 3QKEA 1KKRA 1PDYA 3N4EA 3MY9A 3KUMA 3H8AA 4J3ZA 4HCDA 4DN1A 1W6TA 5FJOA 1PDZA 4HCHA 2PPGA 4GYPC 1KKOA 3NO1A 2OZTA 3DESA 3TJIA 3SN0A 5BOFA 1MUCA 2PODA 3GY1A 2QVHA 4H2HA 3S5SA 2OPJA 5EU9A 1F9CA 4G7FA 4J1OA 2OZ3A 4IL0A 3D46A 3FCPA 2GDQA 3SSZA 2PGWA 4JN8A 1JPDX 3V4BA 3RR1A 2QDDA 4E4FA 2PMQA 2PTZA 1TZZA 4KWSA 2HZGA 3UXLA 3NFUA 1EC9A 3FXGA 2O56A 5FJPA 3H7VA 3I4KA 4E8GA 4HN8A 1ECQA 3R11A 2OQHA 3I6EA 3S47A 3DFHA 4JN7A 3QLDA 2XH2A 2DW6A 3N6JA 1WUEA 3CK5A 5J04A 1ONEA 3TW9A 2QJJA 1YEYA 4E5TA 3IK4A 4GIRA 2QGYA 3EEZA 3ZVIA 2GGJA 1BKHA 3SQSA 3OP2A 2HNEA 2PU1A 4MKSA 2GGHA 4H19A 2P8CA 2ZADA 3TCSA 3V3WA 3TJ4A 3NXLA 4HCLA 1SJBA 2PP0A 3NZGA 3PK7A 3SJNA 3ES8A 2CHRA 1MDRA 1DTNA 3VCNA 3TQPA 1XS2A 4FI4A 1KD0A 4YWSA 2FKPA 3BJSA 3CAWA 4F4RA 1TKKA 3Q45A 4GGBA 3VC5A 5FJUA 1SJDA 2POZA 5ENLA 2XH7A 3P3BA 2PP1A 2PTWA 3MQTA 1FHUA 3N4FA 4E4UA 3CB3A 3DEQA 1JCTA 5IDZA 3QN3A 3PWGA 2AKZA 3CYJA 4H1ZA 2GGEA 3B97A 3JZUA 2I5QA 4G8TA 3U9IA 4KPLA 3T4WA 3MZNA 3U4FA 3ZVHA 1R0MA 4ZA0A 3DIPA 3UJ2A 3SBFA 2PSNA 2HXTA 2GL5A 2PP3A 4IHCA 1OEPA 2P3ZA 2AL2B 2OFJA 3STPA 4GMEA 5BOEA 3VA8A 2FYMA 2OVLA 2PTYA 4A35A 3IJQA 3PFRA 2GSHA 2QJMA 4KEMA 4GFIA 2OZ8A 4IL2A 4GISA 3I6TA 3R0KA 3FV9A 4K8GA 3UJRA 3D47A 3ES7A 2XH4A 3VCCA 1EBGA 1P43A 4IP4A 4MGGA 4JHMA 2QDEA 4A3RA 1E9IA 1TE6A 1MRAA 3Q4DA 4Z1YA 2PGEA 3IJIA 4DXKA 2P8BA 3UCDA 3P0WA 3H70A 4HNCA 3DFYA 3VC6A 3RITA 2DW7A 2ZC8A 4IT1A 4DX3A 4GYPA 2XSXA 2OG9A 4HNLA 1MNSA 3MSYA 4Z17A 3ZLGA 1NELA 2MNRA 3QTPA 3RGTA 3T8QA 1WUFA 6ENLA 3TTEA 4DHGA 4MMWA 1P48A 3N6HA 3TOYA 1RVKA 4IZGA 4A6GA 3OW1A 1EC7A 3THUA 1R6WA 2PCEA 3RCYA 4KT2A 3TWAA 3K1GA 2QQ6A 1EBHA 1L8PA 2OLAA 3V5CA 3UJFA 3BSMA 3VDGA 2P88A 3OZYA 3ZLHA 3UJSA 3RO6A 2GGGA 2PA6A 2AL2A 2AKMA 3JW7A 3QPEA 3PWIA 3TWBA 1JPMA 2RDXA 4GGHA 2AL1A 2MUCA 1ELSA 2XGZA 3ENLA 3JVAA 3R1ZA 3T9PA 3OPSA 3DG7A 3UJEA 4M0XA 3GC2A 3EKGA 1XPYA 3UXKA 1NU5A 2PS2A 3BOXA 4K2SA
chains in the Genus database with same CATH superfamily
3HV8A 4RV3A 2FIQA 1GKPA 3PZNA 1TPDA 4JICA 3UR2A 4H8HA 3UGVA 2EO7A 1MO9A 3EDEA 1T8QA 1GYNA 3S2JA 2PEVA 4HK7A 1WNOA 3U57A 1B4KA 3RAOA 3DGZA 4B9YA 2VXNA 2TYSA 2IMRA 4A8RA 3GM8A 3W7EA 2IW0A 3P93A 3VKDA 4MDOA 3TSBA 3EUB3 4W5ZA 1RA0A 3AOFA 4ZVJA 4EM3A 3L66A 2V5LA 1SFJA 1TG7A 3F4WA 4B2DA 3NQBA 4F0SA 3AS0A 1XKYA 4KCWA 4CQDA 3G24A 5FESA 3KXQA 1M7JA 2J8FA 3DGBA 4X2PA 3DYPA 3UFYA 4TVCA 4LH8A 3U2CA 3VIHA 1AZ2A 1UROA 3BPWA 2V82A 4LNYA 1KKRA 3CAVA 2CLKA 3U2EA 1Q7MA 4LAKA 1G7UA 2ALRA 1QJWA 1ZS2A 3KBSA 3F5JA 1UPMB 4EP8C 1SFSA 4FO4A 4PUWA 1DP0A 2Z1VA 1F76A 1HO4A 2PZNA 3LDVA 3MDUA 5BXRA 3PBWA 1A3XA 1N5WC 1D3CA 4C6QA 1ZCOA 1PL9A 4QCEA 1WDRA 4JFSA 3N34A 2XN0A 3RLGA 2PCQA 2PFHA 4IL0A 1W3LA 3W7DA 4JTAA 4DVOA 2ZZ6A 3GW0A 3NDOA 1V59A 1V3IA 3CHEA 4E3VA 4EF9A 2CERA 3E0FA 1MO0A 5G2WA 2OEJA 3KX6A 1MUWA 3C2RA 3GRSA 3S9IA 5CXPA 2H9AB 3W88A 1JCMP 2QYGA 1K9TA 1W9BM 2XVGA 4JXCA 3W27A 4RJEA 1MQQA 4FXRA 3WEMA 4WK9A 1HX0A 2GVEA 3KS6A 4HHPA 5AC7A 1XLBA 5CBIA 1WUEA 4C91A 3U4AA 3ZT5A 1UR3M 2QJJA 1AMKA 1TWDA 2ZWYA 3WO8A 3RCMA 3IK4A 3EEZA 4XUGA 2DV0A 1PVNA 3BC9A 1KM6A 3RF9A 3OP2A 2AAMA 2GGHA 3BMVA 3SUWA 3PZQA 2GDVA 1GREA 3E96A 3WD4A 1DTUA 1Q85A 3G0SA 4TX9A 3ES8A 2BGSA 1GVSA 1IGSA 1CLKA 4KCVA 1BYCA 1QUMA 2BCPA 3B06A 3K30A 5HQEA 1UZ1A 3WK2A 1EDQA 2DH2A 1CGUA 4F4RA 3L67A 5L9FA 3MUAA 2J8TA 3EWCA 3WBAA 1GPFA 1K4HA 2Q3OA 1CYGA 3THCA 1OJXA 4WDXA 3T0AA 1X1OA 2FHBA 4K68A 4H1ZA 3B8DA 3WL0A 3W87A 4B3ZA 4MLRA 3LPFA 3U4FA 3ZVHA 1CGWA 1P7TB 1B90A 4H4IA 4M7TA 3MO7A 4CQAA 3S42A 3OLDA 2FB2A 4AB4A 3SI9A 1MQRA 2W3RA 4H6RA 1O66A 2AL2B 4CD5A 1PZ1A 3STPA 1C90A 2JGQA 2NSOA 1SZFA 4AF0A 4A35A 3RX3A 4Y90A 3SW6A 3N2CA 3E0LA 1QO2A 1WDPA 4L65A 1RM6B 1RCQA 4QSHA 5C9UA 4WQ6A 3VCCA 4WR3A 3DFQA 4OT7A 1EJWC 3EB2A 1P43A 3M16A 1JZ3A 1XBVA 1PYMA 4LEFA 5EMUA 2YB4A 1H62A 3C0LA 2G96A 2ZKMX 4R9XA 5AC6A 3CTTA 4LUTB 1EP2A 4UQDA 1AL8A 5J8LA 5F2IA 1DV7A 1I9CB 1KW1A 4CCZA 2AGKA 3MMTA 5D9NA 4D6JA 3LLXA 4GOAA 3W1TA 3VMPA 3RILA 3L5OA 5ECUA 4AZHA 2D3NA 5G1MA 1Q6OA 1JCJA 3GIPA 1NF0A 1R3TA 4PTVA 3MSYA 3KBMA 1XDLA 3TH6A 2NV2A 1K6WA 3VDCA 1TIWA 5A8MA 4LYRA 4OGZA 1W1IE 1CXEA 1XANA 3LPPA 4MMWA 1W9PA 3G22A 1XDIA 1K7XA 2X05A 4RV8A 2FGLA 4AEEA 1HG3A 2ZZ5A 4KS0A 1UP2A 3K1GA 4CVUA 1VRDA 3V5CA 1HT6A 4K39A 3BV4A 2WCGA 4EQSA 3UJFA 5EMKA 4MOZA 4BHYA 1Q3NA 2ZZ3A 4F0LA 1N2VA 4MB3A 1VQTA 4N4QA 4P8XA 4PYSA 4LF2A 4PR4A 3UD6A 2AKMA 4UZUA 2VURA 3WQPA 3W84A 1MW0A 1UR4A 2Z6JA 2YGYA 4ERIA 3RNDA 5HUOA 1VP5A 2PDMA 3LHUA 1WP6A 4S3CA 1W9DM 1GOXA 1LORA 1ZMDA 3GC4A 2WVVA 2PDBA 4WJ8A 3QH2A 1C3FA 3L2LA 5HDRA 1TJ0A 4AX6A 4P8WA 2XM2A 2IUZA 3M0ZA 2A3AA 4WSJA 3GDTA 2D23A 3WQGA 9XIAA 4H9UA 4GPNA 3H12A 4DF0A 4KBXA 1AA1B 1FFUC 2OU4A 2EG8A 2VENA 4S39A 3FJNA 4MFDA 3G1XA 5ER0A 2V2CA 5F2LA 4C65A 3VD5A 4I90A 4DNAA 4WDWA 1F6KA 4QE1A 1SB3B 3LLDA 4ZCWA 3PJXA 1V3KA 3GO2A 2PWDA 2XZ9A 1GJPA 1I2NA 1YXCA 4IPPA 1RSCA 2WZHA 1JCYA 3EWXA 1I2RA 1JI2A 4OV4A 2DZVA 2R91A 1UH3A 4S3EA 1X6LA 1BPLB 2I16A 1VFHA 3QFBA 4IG2A 4L80A 4H2CA 4O10A 5IBXA 3KRSA 1A5AA 1TMLA 1EP3A 5H8PA 1QNVA 4EQXA 5BXTA 5JH1A 5G5HB 2FZDA 4CNOA 4TMCA 2Z4GA 2HXUA 2J27A 1ALDA 1O1HA 1LF1A 3TIMA 1EEPA 2ZE0A 3STCA 1MDLA 1THFD 4NXSA 4FXJA 2NV1A 3IIVA 4A8LA 3RIKA 5H1WA 2DGAA 4FOKA 3T2PA 4GYKA 1D9EA 4L1WA 3EDFA 3BAKA 1BQCA 1KM1A 3UWEA 3K4WA 3E1F1 4XBSA 3UESA 3WQ5A 2QDGA 3SSJA 4C1LA 1GKQA 2CZDA 2TPRA 3DCPA 4JY8A 2VX6A 1P0DA 3A3WA 3S83A 1VBJA 4AEFA 2YXOA 1B54A 1VRXA 3CUGA 1H11A 4WVXA 4OHQA 2A7RA 3SSZA 1XL9A 1EGZA 4L1XA 1VC4A 3MSRA 3FFSA 4P7NA 3CWHA 1BLIA 2GLKA 3FA3A 1FWAC 2R94A 4JFUA 4APNA 4AEOA 1GEQA 2HISA 3DKJA 2J7EA 3WMBA 2A3BA 4NIRA 1E9LA 4FNRA 1HN1A 1WCGA 3IIPA 3N11A 4FF7A 4UTLA 3SDOA 3LN3A 2PDHA 4KESA 2IXUA 1X8FA 4ZB0A 5IHRA 1OCJA 3YPIA 4ES4A 2EQ8A 1PIIA 3C0QA 5L6UA 4JYDA 3B9JB 2YCKX 3UR7A 4L61A 3LV5A 3H4GA 1K4QA 5CZ0A 1E1EA 1VBHA 3GIQA 4AZCB 4TVYA 3EOSA 2CITA 1QOXA 5FEZA 3T2OA 1PPIA 2GRTA 1L9WA 3K5XA 4GUGA 3W7RA 5CAHA 1JGMA 1QT1A 4HTBA 1TVPA 1YADA 4WCJA 4RE4A 4HCLA 2ICSA 2PDYA 4P7LA 2E9LA 4H4TA 1AG1O 2I7GA 3PTDA 4E8CA 4RK8A 1QPNA 3U3HA 3VKCA 4XAZA 3BAXA 1OINA 3NNTA 3B4YA 4XSMA 1TKKA 1XIHA 4X9SA 5LNVA 1ZU8A 1KNWA 1XFCA 1TO3A 4XTIA 1XWYA 3V75A 2ZX7A 4QE4A 2NW0A 1AQFA 3T4CA 4GXWA 3GKAA 2YCEA 4EMWA 1FWDC 3DEQA 4C60A 3TMLA 5GJMA 5B7YA 2RDTA 1B3XA 1OX5A 4M6VA 2I5QA 4JTEA 3XINA 2WKGA 2ISWA 4IPLA 5JU6A 3N17A 2ABAA 1CXHA 3KTCA 4PCFA 3DJGX 3URHA 5G4EA 2XU2A 5BU6A 3GG7A 4LNCA 2NXHA 1ZENA 5HATA 2E6AA 4X0NA 4F3HA 1LYXA 3L4UA 4XKYB 1JDEA 3VA8A 3MS8A 1ADOA 4DB7A 4BURA 2QLYA 4CD7A 4QX4A 3OC4A 4MNMA 3WBEA 1U2YA 3DENA 1JDDA 5D32A 4E2DA 3DFOA 3M43A 4N9BA 1EB3A 1ZL1A 2CLMA 3FSTA 1CXFA 3GH7A 5HK4A 4WJEA 3KM8A 1OG0A 1G1YA 1KFJA 2FVLA 3G1DA 3QLLA 3ARRA 3WUEA 1WKDA 1Q2RA 2HVNA 2NXIA 3QMRA 4OUEA 3MP3A 2IQ0A 3SUSA 4AZBA 4LIIA 2ACSA 3H55A 2PDWA 1VYPX 1GOWA 3WQOA 1SZGA 2OSYA 2D1ZA 4KWWA 5AFDA 2DVTA 4KWUA 3UPWA 3DFTA 2NXGA 3PPCA 4GY0A 1XG4A 5I3JA 3CTLA 3LHWA 4XKMA 1XIEA 3KDNA 3LBOA 3DECA 7PTDA 1ZNNA 4O52A 2ZRXA 3WMLA 2ATMA 1T99A 3UU0A 1KLYA 1L2UA 4NNAA 3TOYA 1RVKA 3ARWA 3TDFA 3PG6A 4JTKA 3URBA 5HQMA 3EBVA 4TOQA 3QFAA 3FXYA 3I3EA 4KFOA 1QW9A 4HOZA 4L6DA 5TNVA 4E3TA 4ADTA 2YBVA 2E1WA 1KM0A 1LLWA 2EKCA 1HGWA 3P7YA 4BQ4A 3GD3A 3S5NA 4F0MA 4Q8QA 2VGGA 4WSHA 1UD5A 1GW1A 3E5PA 1PKYA 4Z1DA 1J8VA 3MB9A 4G56A 1LDCA 3ECQA 5E6ZA 2Z1XA 3CU2A 2O9TA 2XTKA 1EWDA 4PUMA 5FSDC 4K36A 4GXPA 5M3WA 4GZIA 3BZJA 2A3HA 3GUGA 2GYIA 1LRQA 3SCSA 3B0YA 3BLDA 5IHSA 4M81A 4LYKA 3WH7A 2GR1A 3COTA 3VNYA 5BRPA 3WLSA 4MIMA 4EXQA 4US5D 1GW9A 5I5RA 3CXOA 4FALA 3BSGA 3K8LA 3M7WA 1UH2A 1PIGA 3EWUA 3LEPA 3S9YA 2C3CA 1DJYA 2PZ0A 3S4TA 4X61A 3LSCA 3ATZA 2C8NA 1FWWA 3KOWA 5CC5A 1G9HA 3E6EA 5LA1A 4AD0A 5K9XA 3EMQA 1FX6A 4LEQA 5REQB 3W22A 2G37A 4PH6A 1KM2A 1ECEA 1IYXA 2E6YA 3HPFA 4PRTA 1Q6QA 1T7LA 4OV9A 1NFBA 1K1DA 4HK5A 1V6TA 4Z2IA 1FXQA 1WKYA 4UUIA 4YTUA 1FH8A 4M3PA 4GWEA 1SO5A 3UYIA 1LCOA 4O28A 1TQJA 3QSTA 4TR9A 1VHNA 1G01A 3GTFA 3DN5A 2RUSA 4Q4OA 4FNQA 1SW3A 3AC0A 1W8SA 2VOMA 4ZO9A 3ZVHB 2XWEA 4RDZA 3QTGA 1VD6A 4G1KA 3IANA 4X9YA 3OHIA 1JUEA 1Q1WA 3TQVA 4TU1A 1KKOA 1A4LA 2A3CA 2E09A 4JL1A 4O15A 2IPWA 3AMDA 2VDGA 1B0IA 4LA1A 2JEQA 2X7VA 3MVTA 4WEVX 4AVOA 1EQCA 4KIRA 5F4WA 3PSWA 1TPFA 4PUNA 1Z48A 1E4LA 2QR6A 4O11A 2XUCA 1LRNA 3IUHA 4PMUA 2W3ZA 3NSMA 5KSWA 1D7YA 5F1UA 4BF9A 2PWUA 3M4HA 3A4XA 1XLMA 4AH7A 2YL9A 3N9KA 3WD1A 3ONBA 4R34A 3D3AA 3IGXA 1H7PA 4PB4A 1JEZA 4NXKA 4O12A 4UR7A 1VJZA 1OVDA 1UW9A 2HZGA 2VQUA 3UXLA 1VQZA 4B2DD 3NFUA 4L9ZA 2X1UA 2Z29A 3ZJ7A 2WNZA 3BCDA 2J7BA 3M0LA 3CHFA 2Z27A 4MY9A 5T26A 2DSVA 3NQ6A 4DEFA 2E5AA 5XIMA 3VNIA 4UR8A 3C52A 2E28A 1RPXA 4CU6A 3QQ0A 1QR7A 1BKHA 4DM1A 4H19A 1JI1A 2P8CA 2WM0A 1UR2A 1EXPA 1C9WA 3CIVA 4XZIA 3GD4A 4PMVA 4H4XA 5AHLA 2WVTA 2OKOA 4B92A 3SCQA 2XIMA 2GR2A 4E2VA 4E2BA 1OFQA 1XRTA 2PDXA 1JZ5A 2XGBA 1DXEA 2QHAA 3CAWA 2WBAA 4J3UA 4AYGA 1XH2A 1F07A 1SJDA 1KV8A 4YYCA 3LHVA 4HNVA 3UWYA 4PB3A 1WZAA 3BAYA 2PP1A 5HQLA 1XIMA 1OT1A 4HJWA 2NSXA 4Q4RA 1RBAA 5IDZA 3ZO9A 4K7YA 5XIAA 1AQHA 3RLUA 1DHKA 4AZIA 3CM4A 4UFLA 3PN8A 4P8VA 4D1IA 1OJTA 1L6FA 1J0HA 5MHBA 4WXZA 3F4VA 2QF7A 5A69A 4PMXA 1AJZA 3ANYA 4H9MA 3G1HA 1XC6A 2PP3A 1N8WA 4QJ4B 2Z25A 1WB0A 1OEPA 2Q71A 3WJYA 4ACZA 4I7VA 3TN4A 4NRSA 5LGXA 2VZVA 5M2FX 4F9DA 4B5UA 3HFYA 1GOMA 2OXNA 5CLWA 1M41A 3G1AA 3VM7A 5LZLA 1I2PA 2VKZG 1JD7A 1PKMA 1IXPA 2VGIA 1VFSA 4U28A 2WQPA 3A7UA 2CLFA 3PPHA 1AW1A 2PGEA 3UVAA 2A5HA 4LVGA 1EHAA 4MB1A 4UMCA 4GIYA 1BHGA 4ZB5A 4WXYA 1X6UA 4A2SA 3VKBA 1ME8A 3W7GA 4E8DA 1I6NA 3PTMA 4Q4MA 5CGQA 3RRXA 3SB0A 4CD4A 2IQDA 3CHCA 4Z17A 2Y2WA 3C61A 2Z28A 4QDMA 1OGGA 2A0NA 2GZXA 3T8QA 6ENLA 2EPOA 2PDFA 1P5BA 3NTYA 4YVXA 2R9RA 4M80A 1L8PA 2E5DA 3W6LA 4U2YA 1QW8A 3GC5A 1K3UA 1VFMA 4J4KA 2F6UA 3L23A 1R5YA 2PDGA 3W86A 3KDOA 3CZEA 3UG4A 3PWIA 2WJDA 4CD8A 3AYTA 3FA5A 1JPMA 1D3GA 3TFXA 1QI5A 3RO8A 2OWXA 5HNRA 3RJXA 3CC1A 4DNMA 5D8WA 4FK9A 2ZRWA 4JNZA 2D3LA 1UR9A 5A6MA 2WVVB 4EE9A 3WLTA 3B8TA 4M0XA 3MBFA 4A8IA 4PMYA 2PWFA 5HOSA 3W7OA 4EXAA 4MNJA 2P10A 1DXFA 4MYXA 2DQWA 2PU0A 2AOSA 4KEVA 3GSMA 1I1XA 3BWWA 1UWTA 4M6QA 3RMEA 1JJKA 3N29A 2G50A 1O6IA 4L9YA 4A05A 3KWXA 1TV3A 1KWKA 3W24A 2L5HA 1K8XA 2TODA 2FJKA 7REQB 3PTQA 4DUVA 3I65A 1FWNA 3CLWA 5I3IA 1F05A 3L9CA 4IOTA 2H8ZA 2P0IA 2QCFA 2YCJA 4M6UA 4KFPA 4MJ2A 3M41A 2CZVA 3MKVA 3G5EA 4MKVA 4H8UA 5D9OA 2PUZA 1V77A 2OZ0A 3HOJA 2Y5JA 1XIBA 2JALA 3W7HA 4ZOAA 4OZOA 1TPWA 3DUGA 4N9CA 1TMQA 3AHXA 3NL2A 3T6CA 4ENLA 1CTNA 1YQ2A 5EGRA 2PGFA 3NOEA 4D6GA 1B3WA 3W74A 3NQMA 1OX4B 1RBLA 2E1DA 3WCZA 1EFZA 3R4IA 4NEVA 2BXZA 3MMUA 3VIGA 5AHEA 5GJNA 4KW2A 2F84A 1HJVA 3QKEA 1V3HA 1CGYA 1IGWA 3NPWA 4A3QA 3BW2A 3W2NA 2BY0A 1HVXA 4Q4KA 4QQUA 1JZ2A 3MI2A 1H7XA 3TYAA 2DSUA 4Y8EA 2C91A 1PDZA 4HCHA 5DBUA 4ZE5A 2DT0A 1MEHA 1E1FA 3W76A 4Q8WA 4DJFD 4ACYA 4PUEA 2QDHA 5E5CA 3F2DA 3VE7A 4DJFC 3OQEA 4MYAA 3RDKA 5EU9A 2WLYA 1DJWA 4DJED 5DN1A 4ZSUA 4QG6A 3IARA 2WPCA 4YVPA 1O4UA 4GH3A 1TPUA 4JBRA 4ZB2A 3TROA 4KPRA 3NVDA 3WK1A 5FF0A 1M04A 2PTZA 4H6EA 1S46A 3WLRA 3LTPA 5C2CA 3TCEA 1LUCA 5HPCA 3NRZB 2GUYA 1EA0A 2XISA 1J0JA 1GT8A 2XN2A 4M5PA 5EYWA 3MCOA 1TELA 4M6PA 3K8MA 1PX4A 3LHTA 2DSZA 1GQIA 3M0VA 4JL2A 3U48A 4AUBA 1Q4WA 1W37A 1JCLA 4JX6A 1DIEA 2CEQA 2CZ5A 3IIOA 4DAIA 4KWVA 2FHFA 3BK0A 4B5XA 1OQFA 5FA5A 5LA0A 2C7FA 4KCTA 2GVGA 5U4NA 2WSPA 6TAAA 2VUYA 2QGYA 3NAVA 5JIPA 1YDNA 1E72M 2Y61A 3QHNA 4W7WA 5EMJA 4LTSA 3R13A 4XD4A 2R24A 1ZK7A 4W86A 1LT7A 1O7AA 3Q67A 2D69A 3IVUA 5D03A 2XVLA 3O7UA 3LA4A 1A80A 2B7QA 2BP1A 1IWAA 3VCNA 1H1ZA 2W61A 5LHFA 3NVZB 3LUTA 3ZXWA 1XINA 1W5MA 3AU2A 4LCRA 3W2KA 3G8RA 3OBKA 3CH0A 3B3DA 2G0WA 3BJSA 2G3MA 2ZOXA 1JD9A 1GQNA 3PVFA 4DBDA 4YCOA 2YXXA 4ASTA 5FJUA 3LENA 4X22A 4OIFA 4DJEA 3W00A 3BDKA 3LRKA 2Y7FA 1L0PA 4DPPA 1MRQA 1S5VA 1XP3A 4GCXA 4IMCA 1J6PA 2PLJA 3B9OA 1N55A 2XVNA 4DIAA 4OBSA 5I00A 2BHZA 5C9XA 1C7TA 3A4JA 1PBGA 3TONA 1V3MA 4K7ZA 2KZHA 2VWSA 2CW6A 1QWKA 1DJIA 4JQAA 2ISVA 3DI0A 2FQIA 1QHPA 2Y5EA 2OGJA 1GVOA 4QRNA 1E3XA 3ARZA 3AWNA 4GFIA 1NM9A 3DBNA 3I6TA 1LG2A 2NVDA 1LP6A 3HPXA 4N02A 2CLIA 4O18A 2ZZBA 1QPRA 1JULA 2ISFA 1MI3A 3URQA 4LRSA 4NHVA 1JDAA 3NJ3A 2HVOA 2PRMA 1EJ7L 2QT3A 3VINA 1B1YA 2A1YA 5DQPA 3P82A 3H2AA 4MJMA 3VZZA 1KXVA 3QHOA 1GRHA 5LNSA 3CHVA 4GZJA 1Y5VA 2F5ZA 2CU0A 1G69A 3G1SA 1VBRA 3TLQA 4HPHA 1Z69A 3LCGA 4EX4A 3T0DA 4NL1A 5ABFA 1FWEC 2ZUTA 3IACA 4Z0JA 4PMQA 1RJPA 3H54A 4UQ9A 4K38A 3SZ8A 3DK4A 4PN2A 3ZLGA 2BMBA 3OZOA 1FXPA 1GETA 3NL3A 8XIMA 3BTNA 3MKKA 4DHGA 4YWOA 3A9IA 1PAMA 3GXMA 1QHZA 1RLDA 1WAWA 1JNDA 3R43A 4NNBA 3ZM8A 4WHBA 3EA1A 4OECA 1OFAA 5I3GA 3W28A 1ISYA 5LYRA 3AS1A 4R88A 3VDGA 1TX2A 2PDCA 3HPAA 1W1YA 1GOKA 7A3HA 1AODA 2VX4A 1SFTA 2NQJA 4ERGA 1CZ1A 3EOOA 4CUCA 1JVNA 1W3IA 3EA2A 4C6LA 1JDCA 1ELSA 1KQZA 5K9DA 4QAWA 5G5IA 5CSUA 9RUBA 3RPTA 1EO7A 4BA0A 1GESA 4XISA 3GC2A 2XIIA 3AMZA 2OODA 3UXKA 2PS2A 2R1KA 3SAZA 1XF0A 1D3HA 2FZ9A 4U31A 3MJMA 4JQ9A 4ZOEA 4IGHA 3P80A 3KVLA 3EAOA 1N5XA 2WSRA 4QGCA 3F5LA 4EWND 3WX7A 4BF5A 4JAWA 1EF2A 3CUXA 3VOHA 3FYOA 4RNIA 1UP0A 3QBUA 1DOSA 5K7JA 1IR1A 2NQLA 1FWIC 2A2IA 2XM1A 4GY7A 2WNWA 2X8HA 1NY1A 4TIMA 3WMCA 4LFYA 1SMAA 4IX0A 3U5YA 3W01A 4M29A 1DWGM 3B8VA 4CU7A 2UV8G 1CI1A 4WIWA 2VZUA 1H1NA 1XLCA 3LM3A 1E1CA 4LX4A 1GQLA 4I9MA 3LMYA 1OF8A 1E43A 3GU1A 1IEWA 5HJXA 2PF0A 2EHHA 4C6KA 4HPGA 1BWKA 1U1HA 3C8NA 3ITOA 1B57A 3WYZA 1VPXA 2NWSA 2POTA 4WGHA 2G41A 4ZEPA 4Q22A 2G8ZA 2EGZA 3PB2A 2HPMA 1XR2A 1H60A 3DG6A 3SUTA 1XSKA 3BSHA 1LBMA 3UG5A 3PBGA 2WBGA 2IKGA 1C8VA 1JROA 2INFA 5CPLA 3KP1A 2PDUA 3CPGA 2QUVA 4IUGA 1GG0A 3M6DA 4NNCA 1W32A 1ZMCA 2VT0A 2ACUA 2E8ZA 4IFKB 3D9XA 3BGAA 1MEIA 1TWSA 1S1RA 3NO1A 3ELFA 2V5JA 3BV7A 2C18A 1YRRA 1V02A 5CSSA 2WB5A 4RNHA 5D30A 8A3HA 3LHYA 3II1A 5FAJA 1QRQA 1A47A 4LALA 1T6MA 4XIMA 4ZL1A 1NFPA 4DF1A 4JIQA 2YCLB 5JBEA 4GUIA 1F2JA 3W7IA 3O6DA 2EPLX 1JEHA 1WZLA 4G7FA 4OWGA 1E4MM 3BGGA 1OY0A 5DT7A 2G4JA 4K37A 2FFIA 3TYUA 3P5ZA 4MY8A 2PBGA 3OZPA 5I7GA 1KCXA 4FLSA 3NEVA 3CNYA 5IM51 1IT0A 1LRTA 4C6BA 1ITXA 5HULA 5DY2A 1W3HA 4QITA 1IIGA 1QHOA 5HANA 1M03A 4HN8A 4J35A 1ECQA 1A53A 3FS2A 3O15A 3R11A 2OQHA 1GRGA 1JRPA 2NVCA 2OX1A 2WZIA 1K4GA 3AXIA 4YMZA 2WAGA 4JN7A 4YNGA 2P76A 3T0BA 2H8XA 4ADSA 1QWGA 1XLFA 4GJJA 1VFOA 3UGRA 4H01A 3W7NA 1KBIA 4KWOA 5CJ5A 2WZMA 5IBXC 1PS9A 4TMBA 4LBUA 3QR3A 4Y6GA 2B4GA 1W0MA 1V8EA 3VIIA 4HNOA 2ZADA 1EQPA 2X2GA 1ML1A 3ICJA 3VVGA 5AECA 3AUOA 2WHMA 3TW6A 1P0BA 1XS2A 4CNUA 1MEWA 2FDSA 3O63A 2Z24A 1TTIA 5DLCA 3KRZA 3WQDA 1J93A 3TJXA 1M5WA 4HA1A 3S6TA 2PAJA 3MU7A 1EUAA 1I2OA 3FGCA 4LW7A 2A7PA 3W7CA 3UR5A 4MZ8A 1OFEA 4PODA 3BICA 3BURA 3HMJG 1QNRA 3QFEA 4ZQRA 1RA5A 4XD3A 4KPLA 4M51A 4PTMA 3MZNA 2YXGA 2ZXDA 1JZ7A 3O6YX 1Z44A 2QGHA 4F66A 4DLMA 4L56A 3VNKA 1PYFA 4PUDA 4DO6A 1PXGA 3GXTA 3PG9A 3H26A 4MB5A 3SECA 2J7GA 3NQVA 4HU8A 2OT0A 1DWJM 1PTGA 1R3RA 3UP8A 4AISA 2WVSA 4WGXA 3GDBA 4GQGA 1XDJA 2CKRA 1V02E 3AS2A 2OZ8A 2RHGA 2VQTA 7CGTA 3FV9A 2EPKX 3PSVA 2X8GA 3VNLA 1LZOA 1AH3A 1XH0A 1EP1A 4A3RA 1KRCC 3WK0A 1JYNA 2ZC1A 1XYMA 4LB4A 4Q6XA 1OG6A 1VYSX 5TD4A 3H4XA 4HHMA 1TV2A 1ZRQA 5BRBA 2OQLA 2GQWA 1NOWA 2X8CA 1HL8A 1MW1A 4AC1X 1M6IA 2O0TA 3LSBA 2WC7A 1OX4A 2VL4A 1W1B1 1X97A 1NDYA 4NX5A 3U6WA 3S5ZA 5E0FA 2PB1A 4C6PA 2JIWA 4DZAA 1FCQA 1VFUA 4J27A 4YVVA 4WRHA 4RNJA 4UTIA 3G6MA 3STEA 4H9XA 2FTWA 4MTVA 4A3HA 2MNRA 3ZJKA 2WQDA 2INEA 1UZ4A 1G0CA 2JIEA 1RR2A 4U5IA 4NX0A 2FTYA 2Y4SA 1G67A 4I5UA 1R6WA 3TTOA 4JIPA 1S5TA 4AIOA 3TNOA 1Q2SA 5C54A 1X96A 2D2GA 4ATDA 5A6TC 3S1WA 1I75A 2P88A 5DBTA 3EWZA 2PA6A 3BVJA 3M7SA 1R3YA 3KL3A 2NX9A 2TRSA 4S3FA 3RR4A 4DLFA 1J0KA 3ABSA 2V5CA 3WQ8A 3UYCA 3HGOA 2C19A 1QW7A 1IZJA 5D8ZA 4PUUA 1YPFA 1UH4A 1PCWA 2J74A 1PIFA 2JKPA 3CB8A 3UA3A 1F74A 1D2KA 4ORMA 4QS5A 2IPFA 4IMFA 1KFLA 5I02A 1NU5A 1AOGA 1CGVA 3V0SA 2Y1HA 3BJFA 1OYCA 1KXHA 1OC6A 4LCSA 1NP2A 3CEUA 3T1GA 3QOKA 4I8DA 4W8BA 3RRAA 2DY3A 5I3DA 2JFEX 1FUYA 5E9AA 3L21A 1NDWA 4FP1A 4FNUA 3B0PA 1YQZA 2WOIA 2CFFA 1N62C 2W3SA 4DO7A 4FXFA 1W5OA 3W75A 3KTXA 1CXKA 4HYRA 1ZB5A 5G4WA 3DX5A 4LS1A 3BQ6A 3N4AA 4C6OA 3KL5A 1CXLA 3CZJA 2GJXB 4RXGA 6PTDA 3P0XA 4H00A 3OOQA 3B9EA 1L6SA 5CJNA 1SJCA 1EZWA 1JUKA 3L65A 1YKWA 4L4LA 3N6QA 1X98A 2VD9A 5CLTA 4TTUA 1SPQA 3H22A 4NYYA 1VS1A 2Z1BA 4UQEA 5FL1A 1KLZA 4DZ5A 7ENLA 1RAKA 2VC7A 1KR0A 3B0UX 1GEHA 3AICA 3U7BA 1VAHA 1UC4A 4FLRA 2GJLA 4DWDA 2WP6A 5DCDA 4JHZA 2B7NA 1SGJA 1HF6A 2QUUA 3ZLFA 3PNUA 4IXXA 4H7ZA 2DUXA 3GB6A 1B3OA 1AH4A 1P6WA 3NDYA 5B80A 3F2CA 2DSKA 1VEPA 3AYSA 1ZXIC 2I5IA 1VBGA 3IRSA 2FH6A 2HBVA 5CSYA 4EAYA 1V6WA 3IAQA 1Q45A 2FVMA 4CQ9A 4J56A 1FO4A 5FACA 5HMEA 2QAPA 4L4OA 2UY5A 2VVNA 1FWCC 4LT9A 2XN1A 4UFKA 4PCPA 5C2GA 3OIXA 1UD6A 1ODUA 3MHFA 4HOXA 2QPSA 3PHAA 1MUCA 2PI6A 2XIJA 3GE7A 1CENA 3SIMA 1DNCA 4DJDA 4GH1A 5FSEC 2WMIB 4YU1A 3IGHX 3FAWA 3ITGA 1SU5A 3AJ7A 3WLQA 4DWSC 1ONWA 3ZMRA 2IPGA 4R85A 4V15A 1HTIA 4YS1A 4F0RA 1QMLA 3VZXA 2RGLA 3H53A 3SRHA 2PRHA 4QCFA 1K8YA 3DJJA 1LUCB 3GTHA 2XJ7A 4NZ4A 4JKKA 1V51A 4JN6A 4MHBA 2B7OA 1ZJBA 4H8NA 3DHFA 2O56A 5BXPA 5C71A 1GZJA 2CHNA 4HA4A 4YTQA 3WDRA 4NI3A 2QCHA 1E3ZA 3A9BA 2VFIA 3GRIA 1XUZA 4Q8TA 2XHYA 5FD0A 3D6NA 5E0CA 5FS8A 3NGFA 4N0RA 4ZO7A 4O17A 5TBOA 3QPYA 4D9PA 4CQCA 1NDAA 4H4YA 5J04A 2HS8A 2O4MA 1IEIA 3PPGA 1QI4A 1XLHA 5I3HA 3N2BA 3BLKA 3OB8A 2IKHA 2QNEA 2VP8A 3N25A 4H4PA 1UMYA 1V7AA 7XIMA 3PR2A 3TCSA 3SCPA 5DMMA 4HPXA 4GX9A 3M64A 1ZJAA 1RH9A 4NP7A 1BGGA 4ICMA 3DGHA 1YX1A 1CB7B 1VCGA 4XZBA 2J9ZA 1W9UA 3TTSA 4K6AA 2OEKA 4S3AA 1OZQA 3CMJA 3SGGA 4Z2LA 2Z2UA 3QW4B 4G7EA 4DXVA 6ALDA 4L6OA 2XH7A 4P7QA 1VEOA 4X63A 3N4FA 4YIWA 3BLEA 2GJPA 4UTWC 4KFNA 2A7NA 2QCCA 2VI0A 1WZMA 5DXXA 1R86A 2C13A 4Q6JA 3AN1A 1EEXA 1PTDA 1U83A 1HFBA 1ZHAA 5GNZA 1W54A 3TN3A 4JKLA 4J3WA 3R2GA 3W1NA 2D0FA 1S38A 2YLLA 4MF4A 2E68A 2FMNA 1R2TA 3ABXA 1UUQA 4ZQOA 4GYFA 5A2BA 1WQ5A 3S9ZA 1G94A 3EOUA 2EEXA 2PWGA 5DMYA 2Z0IA 3G6LA 1LBFA 1H4PA 3RM9A 1N61C 3C3UA 4JNYA 2DZAA 3GR7A 5CH9A 2J62A 1KRAC 5KINA 3VCRA 3RPDA 3BO9A 1X6NA 4JHMA 1XYFA 2Y7DA 3E3HA 1TTQA 4C6CA 4DELA 2REQA 1O1ZA 3VIPA 1WA3A 1WKEA 5JMUA 3DH9A 1DVJA 4LXFA 3GNRA 3K8KA 2WWCA 3PJTA 4NZ3A 3P0WA 4DWSB 1EZ2A 1I0DA 3H70A 2PDNA 4WSKA 4AY1A 1XIJA 3LHZA 3C86A 3CQ0A 1I45A 4FR1A 2DIJA 4JQ3A 4RZ4A 2H90A 1JQXA 2FZ8A 4UXDA 1TREA 1F3PA 3HQNA 4FX6M 1QBAA 5TQLA 3CZGA 1QI3A 3UXAA 3LXDA 5BWAA 5CGMA 4UFHA 4H4RA 2OB3A 6A3HA 1UJPA 3R8HA 1CDGA 3EX1A 2DZUA 3CAKA 1NAL1 2XG9A 4H4ZA 4FX9A 1BXNA 3OZYA 3E02A 3CHDA 3QR0A 3ONCA 3RO6A 1QPKA 3V0TA 1S7MA 1X39A 2QCNA 2OMAA 4LUIA 3WLJA 4HU0A 3GR8A 2YBUA 2D73A 4AMAA 2QIIA 3TWBA 4GE8A 3HB9A 3I3BA 4O1DA 4PFMA 5KVHA 4GI8A 3L5LA 5JCNA 3LRLA 4R5EA 3N2MA 5C2XA 2Q6ZA 4KEZA 1ADDA 3QVQA 2F7FA 3MDWA 3O6CA 4PTNA 4S38A 3OBAA 3EKLA 4W9TA 4LUYA 2ZICA 1JYVA 1UIPA 3U7VA 3LPGA 1PZ3A 4XK2A 2E4TA 1DPMA 1HKMA 1P1MA 4L64A 4BV6A 2YDAA 5D4YA 3M0HA 4HPNA 2CBJA 1RZMA 3BLFA 3T42A 1JXJA 3T40A 3WLKX 1TPB1 3S1UA 1KTCA 2D20A 1UZHA 1KFWA 1KQYA 4AW7A 5HAOA 2CYGA 1EDGA 4P2VA 2OYKA 4V27A 3U2OA 4NJIA 2DZWA 3FVMA 2GOKA 3VGDA 2YX0A 3EX6A 3HMCA 1V97A 4B5VA 1L6GA 1IXNA 4DZIA 3KWSA 1R3QA 4E6MA 4H9TA 3GRTA 1RCOB 1E51A 2BFGA 4HZ8A 4ZXLA 1YNQA 2QZRA 5FEXA 4XAYA 1V6VA 4PEKA 2H3BA 5LNUA 3NIYA 3P67A 4JD4A 3L2MA 3KLKA 3FSUA 3QSRA 3O0HA 1TIMA 2A21A 2EPMX 3A13A 3B8UA 5JVLA 4GVHA 3VIJA 1AL7A 3AUJA 3WQVA 2FHCA 3AJXA 4GY1A 1K9DA 3IWPA 6REQA 1KRBC 5C55A 1Q1RA 3DH7A 1ZJIA 2D2HA 3S2NA 1VJSA 3AO0A 4FHAA 2R8WA 1T8XA 2C0HA 4JTFA 2CCRA 4EACA 3T0TA 3L0GA 1TUFA 4MFEA 3UBPC 4GYJA 4F2BA 1CCWB 5LKYA 5I09A 3IEBA 3O0KA 4CQ8A 2D2JA 4RZBA 1QI0A 1EHNA 3LCHA 2C1GA 5BOOA 4HMCA 3AU6A 2PODA 2VZSA 3NM1A 3OA5A 3T08A 4I5RA 3BG5A 4LBRA 1MXDA 3IRDA 3G3DA 4F0KA 2OZ3A 3BCJA 2PRLA 3BARA 1GQKA 1OK4A 3L4XA 1E9YB 1XFBA 2QMJA 4UNLA 3V4BA 3QGVA 1BD0A 3WH8A 2W55A 3CEPA 2G95A 3W7LA 4KWSA 1E0TA 4GO9A 2E5BA 1ICSA 1J11A 3HG4A 1RXOB 2GWGA 1YNYA 3LGEA 3SCRA 2X7WA 2DZSA 3WNKA 1EA9C 4H9YA 4MVAA 5DRIA 2YR1A 4TVWA 4HZMA 2HCVA 2F8QA 2WMIA 3WLHA 2BX7A 3M1ZA 4XZHA 1GXFA 2XH2A 2VEKA 4CVWA 1G7VA 4QLLA 1RK5A 2DIEA 1DHPA 3C8FA 1SZNA 2FFCA 3MJYA 4IIBA 1YMYA 3JRKA 1ZLPA 1HXJA 1J96A 2ASHA 4HKPA 1Q7ZA 3RMJA 3NZGA 1YPXA 2FPVA 2ZWZA 3MUZ1 1G4TA 1RQEA 4Y9AA 2WMKA 4M19A 4GRSA 1JG9A 4IIDA 4UWMA 2YKKA 5I06A 1TVNA 4YWSA 4UTUA 2VCAA 4FMVA 4C7FA 4D6DA 3EWYA 5D05A 3QMTA 3GH5A 5G1YA 1NOFA 3QKZA 3W9ZA 3HURA 2J88A 5F7UA 4I8YA 3W4RA 1G4SA 5TAOA 3MQTA 3NVVB 5LNWA 1V6XA 2A6NA 1J10A 2G97A 4QS6A 4HHLA 3CYJA 3JU2A 1ITCA 3ZIZA 3B97A 3PBVA 3VNDA 1TZ7A 3M5XA 1RPKA 2Q8XA 3CQKA 1KO0A 1UA3A 4LRTA 1IF2A 2QV4A 3W2UA 4PL1A 1A3WA 4LBSA 3TC3A 3ALGA 3ZR4A 1M01A 5I3FA 1QO5A 3CV2A 3PFRA 3P6LA 1XQKA 1BVZA 2GSHA 4CLMA 3ITXA 4DY1A 4JPGA 5CPNA 2QJMA 3TOPA 3BL3A 2D0HA 5C5YA 3UWWA 2OCZA 4PUKA 3WUBA 4GISA 3EDKA 3A64A 2BZNA 1GGOA 1O94A 3H7UA 5DF0A 4NQ1A 4A21A 3R6IA 3PG8A 4RXFA 2V38A 3W6MA 3FIGA 2HBXA 1UOKA 4Y7EA 3ARTA 4ZTXA 4GUJA 1EBDA 1PZ0A 3PBUA 4WDTA 5F2MA 2YPIA 3NQEA 3I4EA 3AAMA 2HWGA 3GW3A 1EOKA 4W93A 1NP0A 3LS9A 4D8AA 2X1TA 2YSWA 3TP4A 3O2LA 1DORA 1SVDA 1XLJA 4I7UA 1A5OC 2F6XA 3I68A 4ERAA 3L4VA 3MHUA 3RITA 2DW7A 4CD6A 1MUMA 4XD5A 3OVQA 4M82A 1Q8JA 2YZRA 5I07A 2X09A 4Y9OA 3M0KA 1NVMA 3WKZA 3SRKA 1XW8A 3KVMA 4IMGA 1P48A 1BF2A 1GYLA 3N6HA 4GQ0A 3GZ3A 3MSGA 3S2LA 3ITVA 4FIRA 1VCFA 1LWHA 1O5XA 3KCOA 3P14A 4M7SA 4UCGA 5U7SA 3W2LA 3A12A 1OGBA 3N9SA 3URAA 3THDA 1MXGA 4C5ZA 4KIEA 3FKRA 3R12A 4UBPC 1Z8AA 1O60A 3RLHA 1NWUA 2CETA 1DQWA 3BLPX 1UWIA 4DI8A 2VFEA 1TV7A 4EM4A 3VIKA 5HBFA 2QCEA 1ZBCA 1BYDA 3EMZA 1RP9A 3PFMA 3L5MA 2VEFA 4O50A 4ZFMA 3TYCA 4K8EA 4NSBA 2IKJA 1V79A 4QJ1A 4S1FA 1LWJA 1N82A 1RY8A 1GEUA 2V3AA 4NZFA 2VX7A 2KAUC 3NQGA 3V35A 3TSMA 4LUJA 5A5WA 3C3NA 2QJNA 1YE6A 1CLVA 2YFOA 6XIAA 2XH0A 3D5HA 2TAAA 3ZQ9A 4HTYA 4W5UA 3FVDA 1AMYA 3NZRA 3VD4A 2V6OA 1JXKA 3LLFA 2BVTA 4D8ZA 3VTRA 3OJGA 4V1XA 2J3NA 1RBOB 4W88A 3HG5A 2CPUA 2EQ6A 1SO6A 1Y5XA 1UASA 1HKVA 4CNPA 1IV8A 4KRTA 1BG9A 1QATA 1EYWA 2CBUA 3UCQA 1TR9A 1PV8A 1PTAA 4IPIA 4Z1CA 3LG3A 3WZ0E 2GJNA 3EZ4A 4YCPA 3WQ4A 3B8SA 1JF5A 3WLMA 1YDYA 3QFWA 3OTRA 3O8AA 1Q63A 2UBPC 3P5YA 2G3IA 3WDIA 3W71A 1EIXA 3EMCA 1B9BA 1HP4A 2B31A 3V5FA 2RJGA 2B7PA 2FGBA 3W7QA 6XIMA 4BKNA 5JCKA 2E6DA 3IJ7A 1K8CA 2VEPA 3NVTA 4NJKA 2ABBA 2X30A 4QIUA 1R2RA 1XQLA 3MTWA 4GBDA 3C4UA 3ZSTA 3VIOA 2R14A 1Z89A 4C90A 2ZE3A 1UBPC 4BY3A 1AW5A 1JR1A 5PTDA 1H7RA 3E2RA 1F8MA 2GOUA 3LGGA 3MO4A 1ZY8A 1JRBA 2VEGA 3NL5A 3LB0A 3M47A 2QIWA 4AY7A 1RJQA 2WANA 1W3NA 6TIMA 1F9CA 4O4VA 4H41A 3UZYA 1W2PA 5AYZA 1E6PA 1JFXA 5IXEA 2HE5A 3HU7A 4MJ4A 3WLOA 4GX8A 2ZA3A 2ZXQA 1CT5A 2INZA 3OBEA 1Z3NA 2HQAA 2AQVA 1EJXC 4U10A 1EC9A 4WKHA 1ICQA 4REQB 4I7WA 4P7OA 4ATLA 1S5MA 4JTCA 7TIMA 4GG9A 3H7VA 2CFYA 3NQ8A 4AD2A 2XINA 4FPSA 5EMMA 1GRAA 5KZDA 2V2HA 3FW6A 1UP3A 1ZJHA 4X2RA 2C3DA 3HRDC 5IFTA 4K3ZA 4O57A 1UYQA 2D22A 5U25A 1K6AA 1Q5MA 3VD9A 2JF6A 2W5FA 1W3KA 2VR4A 3WQCA 4AD4A 4MJZA 3QV9A 5REQA 2QXWA 2XWDA 1AK5A 1FWGC 1IQ8A 1IXOA 4HGXA 1N63C 1A0CA 2PP0A 1RALA 1V3LA 1A5CA 1I60A 1FHDA 2CHRA 4GACA 1MDRA 2O9RA 1UJQA 3PZTA 4D6CA 5C9WA 4DWSD 2X1SA 1B5TA 2R1MA 1EGMA 2RDWA 4OTKA 1K9FA 1DWHM 1H1YA 3WNOA 4JR5A 1WZKA 4Y9PA 2WZEA 5K9CA 3LZ3A 3UA4A 3EWDA 3WDQA 1FCVA 5CC6A 5I23A 1A5KC 2CC0A 3O05A 2ZFAA 2NLYA 4LANA 1I2QA 3GNOA 4LYQA 3VU2A 3PWGA 4JQ2A 3AZTA 3BUVA 4G8TA 3VDBA 4XD6A 3U9IA 4PBFA 2J7FA 4MSSA 2PF8A 1OCQA 3A3XA 2YYTA 2NT1A 1P4CA 3L12A 4GABA 4ICNA 3HQOA 4KF1A 3FHAA 3T55A 2Z1SA 3L5AA 3V0UA 3C0JA 1YTEA 8RUCA 2YFNA 4U3CA 4J28A 2ZUVA 3B40A 1ZP3A 2PDLA 2ZUUA 3GNPA 4H9ZA 1YE4A 3EEGA 2I9EA 3UJRA 1WAUA 3KCLA 4MB4A 3WFAA 4GZEA 1EKOA 1J0IA 3FY1A 1ONRA 3LU2A 3GBEA 5MF5A 3TR9A 2P53A 3N15A 4REQA 4WOZA 3W1RA 1VZWA 3LI1A 2RDUA 4HT3A 5JBDA 3W7PA 3H23A 4HBKA 1B3VA 2UY3A 1QCWA 2WMFA 3LCWA 4BQ2A 4UTTA 3AI0A 4OOZA 1XISA 4LV9A 3EX4A 4DF2A 4ALDA 3QYQA 2ZUSA 4ZENA 2PD9A 4XX6A 4DWSA 1GG1A 4HNCA 2BNJA 3DFYA 5LIUX 1A5SA 3MC5A 3TXZA 5D2WA 4RE0A 1UKTA 3NQ2A 1ME9A 3O3RA 3P84A 3NWRA 1B4EA 2ZRZA 4HMEA 1UQZA 3PZVA 2WSKA 3QR1A 3EPNA 3S3GA 2CKSA 2J77A 1WUFA 4BK9A 5D2VA 2JBMA 3OW1A 2WO5A 1IWBA 2VC5A 3NYZA 3W3OA 3AIVA 1UBSA 2HROA 4ML9A 2BV9A 4KERA 1DXLA 3SQPA 3W72A 3MWAA 3GBDA 4O1CA 3QHMA 1GK8A 1FY6A 2Y88A 2P0OA 4ACZB 5AVNA 1UIOA 1HKWA 1XGEA 1VEMA 2CBVA 4LAOA 3HBLA 1JCNA 4DUOA 2RDXA 3NURA 4IGMA 3UZWA 2AL1A 1W1VA 1QFEA 4J3XA 3OHMB 3AIUA 3ENLA 1A5LC 1UR1A 3NQDA 3R1ZA 1HP5A 3ABOA 4AZ6A 1ZP4A 3A3HA 4S2BA 1BYAA 2PWHA 5HMDA 3KOFA 4TV6A 3LRMA 2NQ9A 5LA2A 1S2VA 1UKOA 4H6QA 4NJHA 4O8RA 3WLPA 5CPMA 1TQXA 2ZDRA 5BXSA 1IEQA 3ALFA 2J7DA 5CBJA 2PLKA 1XH1A 3CZKA 4EMIA 4EAMA 1E4NA 4JTJA 2YVGA 2VR5A 1X2HA 4G6CA 4H83A 1EH9A 1AVAA 2WSQA 4HP5A 4I6VA 4IISA 3GS6A 3THAA 2ODOA 1FKXA 3GNDA 2WYSA 2ZXAA 2VFGA 1PX3A 3W70A 3OG3A 3S0CA 1A49A 3NEHA 1ESWA 4YJ5A 5I0DA 3V16A 3S6OA 1JYXA 4LAZA 2WZTA 1DWAM 4BF7A 1ME7A 5FOOA 3A23A 2FGZA 1KCKA 4H4VA 1NOUA 2VZOA 4H7VA 4Y96A 3SQMA 2GDUA 2CWXA 3EDDA 4YXGA 2V0TA 4PMNA 2Z2BA 2WBKA 3GXIA 3VKJA 3F4NA 1B2YA 4YTRA 2YVJA 3KBVA 3CGCA 1ONXA 4IFRA 1AH0A 3TXVA 3V1PA 4UIOA 1XG3A 3S8HA 5BCAA 2OKTA 3INPA 3SQLA 1OFOA 2E9BA 1QDSA 1KCZA 4JX5A 1VIWA 3AMKA 4U4MA 2BC1A 2D2OA 2G5WA 3CZ8A 2BBFA 3ZWTA 5AZ1A 5E1QA 3E2SA 1XIGA 5TF0A 1PEZA 3LQGA 2E40A 1NFGA 1UZDA 3TZNA 3ETRB 3TJIA 2X99A 4NASA 4HNTA 3H4KA 5IRPA 3KVJA 4AIBA 3TYZA 1UKPA 2ZBTA 4KMQA 3UWVA 2C71A 5AC5A 3UY8A 3CUJA 4YHGA 3OA3A 2C79A 2WM1A 3CLMA 4XVDA 1OIFA 3H2FA 3SFKA 4UTKA 2AQWA 5ECVA 1XCXA 2PGWA 2ZXBA 5A6JA 3AISA 1JPDX 1GVQA 2CESA 2V30A 5A8GA 2QDDA 3B8IA 4LC6A 2PMQA 2V69A 3BAIA 1YIXA 4NUWA 4G2DA 3A24A 3PZUA 3LGDA 2BS9A 1U33A 4W87A 3E49A 3K4DA 5AHMA 5HINA 2DFAA 2DQXA 4DO4A 5D2YA 2JEPA 1TSIA 5ABFB 4BS0A 1DJHA 1J18A 4IXHA 1GVEA 1CIUA 5F4SA 1ZAHA 5D2TA 4OOUA 3TZFA 3EDJA 5C70A 1KTNA 3GFZA 1NQKA 3TV8A 3A6OA 1M7PA 4PRWA 4J3SA 1HO1A 5EB8A 3SQSA 1H0IA 2ZYFA 5FS9A 3P60A 2PU1A 3NO3A 2IPJA 3HW2A 5D04C 2OELA 1F3XA 5MKGB 2Z00A 4MZ1A 3DI1A 3NS1B 5A2AA 4QXIA 1ZSXA 4XO6A 1K03A 2XDFA 4FF5A 1V3JA 4LCQA 3VIFA 2DP3A 1MZHA 3VC5A 2W67A 3WDHA 1K7FA 1DJNA 4XVEA 2DJXA 1HNYA 3S5OA 2BY3A 3SJ3A 1DE6A 2VYOA 5D38A 1W56A 3LD5A 4HMNA 1ZZMA 2LLEA 2AKZA 3OYXA 5FL0A 1M68A 1J2BA 3DK8A 4ADUA 5HPOA 4NZ5A 3T4WA 3CQHA 3OO2A 3UJ2A 3I7SA 5T8GA 3SO7A 5C8BB 2PSNA 3VNJA 2QULA 3T0CA 1UUOA 1H51A 3URNA 3IJ9A 3FYPA 3L4TA 3WIJA 4C1KA 2OFJA 3ARQA 4MDPA 2Y63A 2FYMA 1PCKA 3WUFA 3REQB 4E4PA 1V0LA 3GHRA 4W4QA 2ZZ2A 3SCWA 1SSGA 4CN1A 2HDJA 4UTFA 5D37A 3H6OA 2PWEA 4PMDA 2NVKX 4MAZA 1TMHA 3ES7A 1G4PA 3CUHA 1QNPA 2DZXA 4TX6A 5DT5A 1DQUA 2Q09A 3MUIA 3CQIA 4UMAA 2I56A 1OABA 1QPQA 2I57A 1F7BA 3OVPA 3QC3A 1TE6A 5FS7A 1UD3A 1E56A 3SUUA 1U30A 4A4AA 4JCMA 1V6UA 2QS8A 1ZX9A 3GR4A 3CMFA 1KFBA 3V36A 4R7WA 3VGGA 2GPTA 2X2YA 1KGXA 1DWIM 4GR1A 5HUPA 3FA4A 5I24A 5GVJA 1QI2A 4UR9A 2DEPA 3MW7A 2VZTA 4JY9A 1T41A 3MCMA 3AYVA 2NQHA 1JRCA 3LCLA 3PUOA 4PL2A 5FKYA 1XDMA 2OG9A 3M5ZA 3TN6A 4FX7A 4HSOA 2V63A 4ADWA 3S1XA 1EJVC 4RDVA 5KZ6A 2YYUA 1FWJC 4IZGA 5E93A 3S1VA 3BAWA 1XRFA 1HQTA 1GVIA 2UY2A 3CL6A 3WJXA 4EOUA 3QF0A 1VFLA 3DFSA 2JKEA 4DBUA 2SFPA 5B7ZA 1XX1A 3BLIA 3DYOA 2CLPA 1RY0A 4PSRA 1PO9A 3CZLA 4WDUA 3S2CA 3B05A 3H7RA 4OE7A 2Y85A 3ZT6A 4JYEA 4LUSB 9XIMA 4C5YA 3P2VA 3TTYA 4WY0B 4GVIA 4PTWA 2C16A 2VNCA 3K1DA 3UZ5A 3VABA 1Q4NX 2XPKA 3WNNA 2QUMA 4MWAC 3R8GA 1SO4A 5JQ9A 3VD3A 4G7EB 1XICA 3ZR6A 2QJHA 5FI8A 1I4NA 1CECA 1TYPA 3OVGA 1MQPA 4EPEC 1WDQA 2VDIA 3U0HA 2NX1A 1FIQB 3VFCA 4A22A 4B5WA 3WQ6A 1C9DA 3HG2A 4B90A 3BG9A 3N3MA 3S6DA 1H63A 1LJYA 1KB3A 3EANA 2V3FA 2HNHA 3OGSA 3Q6JA 1KN0A 3VNMA 3Q58A 1AQMA 4LUTA 1KC7A 4JQ1A 2CLLA 3DHDA 4GUFA 2VC9A 4ROPA 2BVWA 5BMXA 1J0ZA 1O95A 2FB3A 3MT1A 2DPEA 5G4HC 5BZAA 2W66A 4K1WA 2WC4A 4JEJA 2BLEA 4PA8A 1ONFA 4US6A 4FA3A 3N13A 1RQBA 2HMCA 4BR1A 3ITTA 3WL1A 2GGIA 3DOPA 1TRDA 1F4AA 3GFXA 3PY2A 1W5PA 5FCZA 4W85A 3N9RA 2BC0A 3MUCA 1NHRA 3VKAA 3G18A 3RCNA 3XIMA 3APYA 2YIHA 5ABEA 3USBA 3G0XA 4IMAA 1UKSA 4OBRA 3J7HA 3NCOA 1DKWA 2AQOA 3N4EA 5JCIA 2X41A 1VPYA 3VYLA 1RUSA 4DN1A 4XQ6A 1PWMA 1H7NA 5HXMA 1E6XM 4O1FA 2R1LA 4X3ZA 3LNMA 4YTTA 3SN0A 1M1BA 2AGTA 4RNFA 1NQ6A 4LVFA 3SCNA 1W3TA 1T5AA 2OYLA 3ABRA 2RFGA 3HFTA 3S5SA 1OZMA 3PAJA 3PBMA 5K2ZA 4Q7NA 1MW3A 1ZBVA 4RL3A 4I9JA 2QCDB 3AHZA 1L2QA 4QDWA 2WNQA 1VH7A 2GDQA 3WFZA 5M5DA 3STFA 2WOVA 4UQAA 4ML4A 1CX9A 1H49A 3RXZA 1DJXA 4YLWA 4BWLA 3KRBA 3PJWA 3C2VA 3FXGA 4YWIA 1QAPA 4U5KA 2D24A 1KXQA 5A6AA 4MZYA 3AMGA 3FJ6A 1YPIA 3H4WA 2O7SA 1TE1A 2QJIA 1W9VA 1YTKA 3AALA 4B4FA 1IT8A 1RHCA 1V0KA 2DDXA 1AFSA 2G3NA 3N6JA 2VEIA 4LAUA 1PSCA 5ABTA 1KFCA 3G8EA 3IVTA 4B5SA 4UFIA 1GKRA 5D9PA 3VIMA 1AD1A 2GGJA 4AVFA 4RR4A 4LVDA 2J6VA 2FZNA 2PDIA 2C1HA 4JEQA 1DIDA 2H3DA 3MMDA 1ZKQA 1H3GA 3VILA 1SJBA 3PK7A 4NRRA 1QXLA 3EOLA 4C6FA 4AHOA 1GRFA 5AB3A 3REQA 1FOBA 1F3EA 3NPVA 4FI4A 5AYXA 3VGEA 1YYAA 5LIWX 4BZYA 1FWBC 2OYMA 1V5XA 4N4PA 2E67A 1NHPA 1HL2A 3DKLA 3L4YA 5ENLA 4NAEA 5G5GB 1KGUA 3FEQA 4W89A 3UWUA 3W07A 1PJ9A 2EKGA 3U5UA 1BG4A 3UVIA 1JCTA 3BAJA 5KZEA 3QN3A 4CU8A 4N7QA 1NH6A 1OT2A 5KZMA 1OBAA 4MAVA 5T9BG 3MP4A 3SIZA 4D71A 2J78A 1QNQA 1BYBA 1XD1A 3WBXA 2VRJA 3K4AA 1R87A 2ZX6A 2P3ZA 2XFWA 3E38A 3WG6A 1H5YA 3CT7A 5E70A 4PCNA 2VEMA 1H6VA 3SY1A 4RX0A 5AC4A 1E6NA 1XLIA 2BDQA 1E71M 3CH9A 3PPFA 8TIMA 1R30A 4ZE4A 3NG3A 3GZAA 3NDZA 2R1PA 1SO3A 2Q8ZA 2X0HA 3R0KA 1UWRA 3CL8A 4ZBCA 1X38A 4K8GA 2YVFA 4XZLX 4KETA 1XIIA 3FAXA 3EA3A 3VDAA 1JNEA 1SM9A 3NL6A 2BSLA 2VFHA 4C6DA 8CGTA 4NYUA 1XYLA 2UWFA 5SWUA 2CLOA 2Y8VA 2ZVRA 4XTDA 1J6OA 4O0KA 4ROQA 5D9MA 2X50A 4Z0SA 1LWIA 3II4A 3K46A 3UCDA 4FOUA 5E09A 3TQ0A 4ZMGA 3N1AA 4GVGA 3VC6A 4ZODA 4ZR8A 1YTDA 3T05A 2HE8A 3P81A 2XFYA 4CCEA 3SCOA 1E5JA 1RD6A 5LGZA 1MVYA 4IH3A 2GUUA 4AG0A 4HNLA 5CPOA 1IIHA 1PUDA 1PHQA 2VCBA 4B3KA 4XZ9A 4C6NA 1GHRA 5GRTA 4UFJA 4MUPA 4ILSA 3RU8X 3L2IA 3THUA 3L8KA 3RUBL 3MV01 2ZZ1A 1FH7A 1TV5A 2OSXA 1US0A 4O13A 3HN3A 3QOMA 3TVAA 2ZIDA 1V0NA 2YDRA 3ZLHA 4HNNA 4R3UA 2PDJA 2C1IA 4IJRA 3TYEA 2E9MA 3KVKA 1O68A 3LM7A 1ZAIA 1Z6KA 4QE5A 2OGYA 4RE3A 2WJEA 3WQWA 2WPFA 4PBEA 1SYTA 3B9DA 4RDWA 3GHSA 3PWAA 1YBQA 3IIXA 1MXSA 2XGZA 4HZ7A 4AFYA 3TYDA 3WSUA 1W1A1 2V5KA 3W1UA 4NI8A 2VRQA 1A5UA 1DXIA 1EXBA 3XISA 4LVAA 2NT0A 4W7VA 3JS3A 5I03A 3UNTA 2ZRVA 3SGZA 3VZYA 4WKFA 1US3A 3MBDA 4JNMA 3VXGA 4PC8A 4GA8A 4RUBA 2Q3RA 5LNRA 3VMNA 2JGYA 4J3TA 1ZALA 1NWTA 3NZPA 1UR0A 1BKSA 4EWJA 3R25A 3W85A 1EX1A 2OR2A 1A50A 3QV8A 2I1OA 3UERA 2VD8A 4I6KA 4WJXA 3M46A 4J57A 4DQWA 3ITYA 1VB9A 4EANA 5A3HA 5I6SA 5GNXA 3STGA 3OU8A 1TFVA 2ZZ4A 1POKA 1ZBKA 3UZJA 3B8WA 5CC3A 1AJ2A 4L1GA 3SCTA 3FOKA 1PZ2A 4DYJA 2A8XA 1Q65A 1FHVA 4NU7A 3C2FA 3R5EA 2HV5A 3MZ2A 2CLEA 3I7RA 3UXDA 3MKCA 5FJTA 3THQA 1TV4A 1FDYA 3QV7A 1WDSA 4WF7A 1KV5A 2EQDA 4FSAA 3W81A 1KWGA 1HVQA 3SRDA 1ZUAX 3TEVA 3UEQA 3HZ3A 4HIBA 3S2MA 2GUBA 3VGHA 1BRLA 3O6AA 1W91A 4QM1A 2ZRUA 3TTQA 1E6QM 4AQLA 1AZ1A 2YW4A 4GI6A 4O14A 5D02A 4MY1A 1TTJA 3SN1A 3AZSA 3GG1A 3NXFA 3WENA 2B81A 3OZMA 4TUFA 4JTDA 2A4AA 3CUIA 3H8AA 4ORIA 4XZMX 1ZDLA 1VLIA 4QG8A 2WJZA 4O16A 1GTEA 2NLIA 2XIOA 1WYIA 1Q7QA 4JTUA 2ZX9A 2YA2A 1SR9A 3HPSA 3UETA 4GYPC 1YLVA 5KEZA 4NJGA 1S39A 1XSIA 1C8XA 4NAEB 3T78A 5C9RA 4UTWA 1B3ZA 4IUOA 2RABA 3BW4A 4ZO8A 3M0XA 4UCFA 1O5QA 2OPJA 2QAEA 1XLAA 4QSFA 3BOLA 1TPEA 4U33A 3G2GA 1E4IA 5LXXA 4M56A 4GVFA 4BCEA 5A94A 3OQ8A 3IVSA 3RR1A 4NEWA 4S3KA 5A2CA 4P8UA 5JCLA 4HHHA 3HQ1A 4S2CA 5DX7A 2VTFA 3LX9A 4QJ5B 2QEZA 3QM3A 5A6BD 1J2WA 3NA8A 3VX1A 4AU0A 2ZA1A 3I4KA 3AIBA 1YBQB 2HPIA 2W0UA 5D2XA 4Q32A 3JZEA 3VAVA 3M44A 3TK7A 1RCXB 1WX0A 4C1NA 3GFYA 3N18A 3LXCA 2Z26A 4JDRA 3PTKA 2GK1B 2Y89A 3MVIA 3VOIA 3VI2A 1ONEA 1M7XA 2RKXA 4ZOBA 4E5TA 2PLCA 4GLEA 1FRBA 1OFRA 1JL8A 3FDKA 3AIEA 3BZGA 4DM2A 1GZ1A 2C6QA 5EKYA 3LI0A 1UR8A 3TAKA 1XLDA 4TO8A 4BI6A 3GX9A 4JTQA 2WJFA 5C7VA 1EPXA 3DXIA 3OEXA 2YBTA 3WLLA 1TYTA 3ARYA 1S1PA 4PTDA 3F1QA 3GTIA 3N12A 3GDRA 4UOQA 3LERA 1F3WA 2FKPA 2W63A 1GHSA 3TN5A 3GLCA 3DFNA 1W5QA 2V8ZA 2WPBA 5FS6A 3CWOX 4V2XA 2DU2A 3B03A 1E0WA 1XIDA 1TJRA 3IJ8A 1FHUA 4B4HA 4JIEA 9CGTA 2YB1A 4HVXA 3WFLA 3WK3A 3RX2A 4MNKA 1TUXA 2BVYA 3A4AA 2J47A 1UHVA 3S5YA 4ZZ9A 3H24A 1F6YA 2QUTA 4UC5A 4CNNA 4JQ4A 4H4QA 3C2EA 4QISA 4DBSA 1Z41A 3QGKC 3W82A 4GNVA 1S2CA 3GKFA 2VFFA 1IEXA 3E5BA 1SSDA 4HU4A 4F0HA 3SY8A 1GJWA 4HK6A 1H09A 1KM3A 4YN5A 5HWMA 5CSRA 2C14A 2V67A 2TMDA 3VK5A 4KEMA 2Y8KA 1JAEA 1K02A 4LV4A 3CQJA 3JUGA 2O55A 1UPPA 3LADA 3NVWB 5HR7A 4Y2WA 1OGSA 5H2ZA 7REQA 4AC7C 1WDDA 1W1ZA 5CPSA 3GYEA 2RH9A 2E6FA 1M53A 4L7ZA 4F9JA 4EQWA 4Z1YA 3S1GA 3W1QA 1NTHA 1T40A 3O1NA 1NARA 3PUDA 1Z32X 3NVYB 1A3HA 1SMDA 4GKTA 4F2UA 1LPFA 1TWIA 3FN9A 4Y9MA 4JIIX 3R7MA 1K7EA 1ZPTA 2QJGA 2YCLA 5F2GA 1TPVA 3RK8A 1YHTA 4UOZA 3UZZA 4RW3A 4AYSA 3BLOA 4CEUC 2DSWA 2WOWA 3EXTA 8XIAA 3QTPA 3RGTA 5C9ZA 3V1HA 2IKIA 2P3EA 3LMZA 1FECA 1O5RA 3IGUA 4DUXA 3W26A 3EXRA 4H8VA 3IS4A 5JXQA 2BGNE 1KCLA 1U5JA 2GVLA 1OWQA 3M5VA 4JTIA 3H2OA 1E6RA 3O16A 4M24A 3ZT7A 1XRSA 5FMHA 3VFLA 5GNYA 1OADA 2Z1KA 2F6KA 5J5RA 1S5NA 3UZXA 1EWEA 4UTHA 1IXQA 4PCSA 4YPJA 1F4HA 2MUCA 1LL7A 4ZGYA 1ISWA 2YL8A 1TCMA 4WUIA 4NKCA 2ZCGA 4JGDA 4NVTA 5HJLA 4GIAA 4O1BA 3QV6A 3WN6A 3EKGA 1UUMA 1J5SA 1X7IA 1TA3B 5DXYA 2A6LA 3GG8A 1CGXA 4CCDA 2J79A 4Q3MA 3CO4A 5D09A 4Q33A 4TTGA 2Q8LA 4MPQA 3GUWA 4TVUA 4G9PA 4Q4PA 1FWFC 5BYWA 2NZLA 2ZQ0A 2O4QA 1ADSA 3HTWA 4CEXC 3SN4A 1L8NA 2BG5A 3B4UA 3ABQA 2VGBA 2I5GA 4Y9NA 1J12A 2VRKA 1W1PA 4KGJA 2J9YA 3BMXA 3KOZA 3NSNA 5H91A 2NV9A 1FA2A 2J75A 2A79A 3DU0A 1FP9A 2OWCA 4WOQA 5TR3A 1UWQA 3KCJA 3MSDA 4JKMA 1QOPA 1T3QC 1F8WA 2CXEA 4JX4A 4IG2B 1M65A 3M0YA 4UMBA 5AC8A 5EBUA 2RAGA 2XZ7A 5H6HA 3RHGA 3WLIA 2R9ZA 5EBKA 3GDMA 1Z42A 3D3FA 1XIFA 5C0QA 2YQUA 1HZYA 2GVJA 1W8GA 1S5WA 1PHWA 3WMSA 5EMLA 4EF8A 4HZ6A 4E0CA 3MMWA 1OB0A 3WF1A 3DZ1A 4JTLA 1PDYA 3AXMA 2J66A 2G4FA 2XGIA 1OD8A 2W27A 1AQ0A 4HCDA 2JKAA 2YL5A 4IICA 4HSHA 3UG8A 1G5AA 2E8YA 3R79A 2CLHA 1Q6FA 4DJDC 1MYRA 2OZTA 2Z7KA 3DESA 2HK1A 3PC0A 3W1MA 4L4MA 4WKAA 1C92A 5FF7A 1BVNP 1WYGA 5T9CE 5HNNA 1EJUC 4GZ7A 2J7CA 3G0UA 3NPUA 1SW0A 2WK2A 4AX7A 2GQ3A 2ZDSA 3EGJA 4JZ5A 1D8WA 3MV11 1UC5A 4XIAA 3AS3A 4NZJA 1GVRA 4GQQA 4XG1A 3SURA 4FIQA 5ABGA 4F40A 3LY0A 2GH5A 3IUDA 1TZZA 2HK0A 4M1RA 3DYMA 4GBUA 3ZJ6A 3F7JA 3VOGA 1P7TA 3G1FA 1VDVA 2O92A 2ZRYA 4FLQA 5FJPA 1LG1A 2ESCA 4JTSA 5CG7A 1HKIA 3PBYA 1HJWA 3GH4A 3SFWA 3GDLA 3PULA 1FWTA 1E9ZB 4TVDA 2Y8UA 1U1JA 4QFUA 3WELA 3ZSSA 1F5ZA 4AAJA 1IE7C 1IWPA 1XBXA 4CKQA 3EX3A 4FB7A 3PAOA 4S3BA 2WHLA 3WNPA 3H2NA 3E74A 2ACQA 5EY5A 3ZVIA 1PB0A 4EPDC 1A5BA 4R7JA 3WF3A 1JF6A 3QZEA 2HNEA 3EB4A 3EF6A 3MHGA 1J4EA 5HA7A 1OYAA 1H41A 3TJ4A 3NXLA 1YXYA 3SJNA 4BQ5A 3TMQA 1V93A 3QZ6A 1HJXA 1PKNA 3O0FA 3KLJA 4GXMA 2EG6A 5CJMA 1W31A 5HNTA 1R85A 4XWUA 1GYMA 4DXXA 2WMGA 3Q45A 4GK8A 3VGFA 2QPXA 4CCCA 4JTTA 4XUYA 4YTSA 2X42A 2VWTA 1WXJA 2FZMA 3LK6A 3Q37A 1C29A 5BMWA 1H2IA 3QZAA 3W7JA 3AIWA 4FXSA 1T0OA 1UCWA 3WD3A 2GSEA 4HYVA 4Q8VA 4QQ3A 4D2JA 1R0MA 3WH9A 2ZUMA 1D7KA 1FKWA 2G3JA 2CXGA 4QLKA 1LL6A 3BW3A 3KP0A 1S2WA 1RVGA 4LSBA 2QCGA 4D6IA 1B30A 1US2A 4EXBA 3OLGA 2DVXA 4HB7A 1BWLA 1FCBA 1AUSL 3PUEA 3UY7A 1KBJA 1GRBA 2AAQA 4UQBA 5KITA 3GU2A 4J7RA 3HGSA 5FF4A 4AWUA 4I9TA 4UTTC 1ODZA 3LCXA 1HJSA 4TV5A 4RCXA 4TQTA 4MGGA 1UG6A 4I5XA 1S3HA 3DFPA 2VELA 1XV8A 2UY4A 3N2OA 2QPUA 1FQ0A 3Q4DA 2OWWA 2Q02A 4NAFA 3P74A 3VNZA 1OIMA 3BXWA 3HA1A 2P8BA 4AWSA 3KFTA 4GKLA 3FKKA 1GQJA 1K70A 3NZ1A 4BWLC 2WPEA 4S3GA 1HUVA 1TRIA 4XZWA 3BE7A 4IQDA 1R7OA 1NELA 3UT0A 2VUNA 4JTHA 1R3SA 3WD2A 4OU1A 4GI4A 2PC8A 3RLVA 1CXIA 3CPRA 4KT2A 1EBHA 3KZSA 3DC0A 5GJPA 1KGWA 3HM7A 3POHA 4V1YA 3LTYA 5CAKA 5A1AA 4CN6A 1GNXA 2OJPA 1BAGA 3AIRA 3VM5A 5T91A 3AHTA 1M3UA 1Q6EA 2WP5A 4L5ZA 3LBCA 1A5MC 4JDBA 4ZQCA 1DL3A 3APTA 3T8LA 1DQXA 4J40A 1JPIA 3AHVA 2VDHA 1GONA 1A0EA 1TZ9A 2PLMA 4P7RA 1HL9A 3O9NA 2QCDA 2Z6IA 1XD0A 1JPKA 3A5VA 3WJZA 2OLHA 2CDUA 4O0ZA 1HJUA 2TSYA 3BOXA 4LU0A 1Q6DA 3IGSA 1XGDA 4XAPA 4DI9A 4Z2HA 2W0HA 1DJZA 1D7FA 2GK1A 2YA1A 3MI3A 4LOCA 3QEZA 1Q13A 2NQ5A 4KCUA 2ZTKA 1QVBA 3AXXA 2WKLA 2RJHA 1FDZA 4XV0A 3FLUA 4TXEA 4J9JA 3PJUA 1ZTVA 3B9AA 2WMHA 3A7AA 5AYYA 2PBOA 2BOEX 2WCAA 1PX8A 2NQZA 4C6MA 4GC3A 4JS3A 1TV8A 3UCCA 2I9UA 2PD5A 4QAIA 1WV2A 1H2JA 3FJLA 3ABZA 1Z9AA 1DEDA 2OO6A 3IJLA 1UB3A 4JIRA 4QLJA 2OX4A 4AIEA 1Y8BA 3GXFA 4KRUA 4QHRA 1NHQA 1VCVA 1F3TA 5DCBA 4IIFA 1NSJA 1BQGA 2E0PA 3DG3A 4H3DA 1IHIA 3CGDA 1VJIA 4FNSA 3CUZA 4H4SA 3VDHA 1ICPA 3SADA 4MWAD 4EKJA 5EMYA 1HJQA 4S3DA 1GPWA 5FF3A 2VGFA 2WKJA 3KBNA 4NF7A 5GPRA 1SJAA 1VLWA 2BGQA 1N60C 1UD2A 3FGCB 3TC6A 3KUMA 4HOWA 4J3ZA 2I17A 5IOBA 3IV3A 4A2RA 3QXBA 4PULA 1EUNA 1W6TA 5DMNA 3QY7A 3QW3A 4RZ5A 3LPOA 1JIBA 1NJJA 3BMWA 3IIZA 3CXBA 3DHPA 1C8QA 4O0QA 4LC8A 4C7GA 1W9XA 5BOFA 4FX8A 4CNTA 3EKZA 4R7OA 1GV4A 4F2TA 1EDTA 1XRVA 1Q8AA 1TVLA 2WNNA 3VX0A 2Z1WA 3B0XA 1TX0A 4J1OA 1H0GA 2OLSA 1T96A 3TA6A 3V7PA 1OYBA 4BEQA 4KQNA 3IJ6A 5IDIA 2V9DA 4JN8A 3WF0A 1QPOA 3QMSA 2EJ1A 2CHOA 1ZCCA 3GAKA 4NT0A 5LIKX 1SW7A 4C7DA 4Q8NA 3CV1A 1YDVA 3R0DA 7TAAA 3NSXA 3MCNA 6CGTA 4E8GA 3PP7A 4UB9A 4MADA 1Q6LA 3GVWA 1QK0A 4LY8A 4WZHA 1MMFA 2HQMA 3ITCA 4IWWA 2ZX5A 2DVUA 3KHDA 3HF3A 1U5HA 3A21A 2O9PA 2YZ5A 1STZA 5BWFA 2DW6A 4GNKB 5I77A 4A29A 1FEBA 2Q01A 3CK5A 2QF8A 4PFHA 3TUUA 3M0IA 1BEUA 2IQTA 4QROA 2Y7GA 2E7FA 2VO5A 2XIBA 2ZUNA 5HJYA 3OVRA 1JPHA 3AQUA 2J25A 2BY1A 1LBLA 3V3WA 1ISZA 2EG7A 1F8IA 3H21A 1LT8A 1UD4A 1SZRA 3FX4A 4DYKA 5EPDA 1QNOA 1P6BA 4QR6A 1RK6A 2VR2A 1JYWA 3E12A 1SZEA 3APGA 1UA7A 3PS7A 4UFMA 1R46A 5HR6A 2PWVA 4IFKA 4H4WA 1E1CB 5DRCA 2DZPA 3SCUA 3P3BA 2E25A 2WV8A 4EIVA 2FPTA 1E0XA 3NGJA 1UMLA 4BFAA 4ZOCA 5CZJA 1WKFA 1A0DA 3RYSA 1CEOA 5JH2A 4BJHA 6REQB 4Q7BA 3IC9A 1GERA 1E40A 3QY6A 1Q6GA 3KE0A 4JTRA 2GL5A 2BVDA 3UXIA 1LQ2A 3GYCA 1DIOA 1OCNA 2XYLA 5BOEA 4AXKA 2X0YA 2PTYA 2QAFA 1HKJA 3CV6A 3PM6A 4KGLA 1VFTA 3A5FA 1DYSA 1NDVA 5MKGA 4AMCA 3IJDA 1TCDA 3UF9A 4QEEA 4R33A 1KM4A 2X1RA 2XH4A 3GDKA 1EBGA 3RM8A 2J24A 2FMOA 5AHNA 1NWRA 3GAYA 3DAQA 3AWOA 4IFOA 3LCFA 4IPJA 4J3VA 4MM1A 3KBJA 4U2ZA 3W02A 3OODA 3W6YA 3WF2A 3W7KA 2GFTA 4WY0A 2JQXA 5I78A 3CV7A 1JZ8A 4XO7A 3FHQA 4L4PA 4EK7A 2W91A 1FH9A 1EL3A 2R6OA 4N6FA 3NZQA 2ZC8A 4IT1A 1H7OA 4URIA 3B0VC 4J5NA 3WJWA 1BSIA 3MUY1 1HIZA 2XSXA 3MUXA 3QQ1A 4GJIA 3RU6A 3NR0A 2OOGA 1R3VA 3RX4A 3SCVA 3LB8A 1TWWA 2Z7GA 1JAKA 1FP8A 3POCA 1XLEA 3TTEA 1C7SA 4H7CA 4A6GA 1IEVA 3TW7A 1H50A 2F61A 3PZMA 2QQ6A 2V3DA 3E0IA 3VUSA 3VE9A 3B04A 4P5UA 4JFVA 3M5YA 2PDQA 3NPXA 1W1TA 3GWQA 3KRUA 2QMKA 3UJSA 1YXDA 2ZX8A 3LCIA 1XHGA 1NEYA 3FDGA 4LWWA 3QPEA 2V2DA 1V0MA 5DO8A 2CBIA 3GVRA 1DE5A 4EPBC 3UPMA 4GGHA 1LQAA 1HKKA 4AXNA 4K7VA 3Q94A 4D6FA 1XLGA 2CZFA 5FF2A 1X8CA 1E0VA 3AXKA 3F4CA 1RV8A 1FWRA 1EGVA 3DG7A 4LQ1A 3WEZA 1P0KA 1YDOA 1O5KA 1ZY9A 4ZFCA 1OF6A 1R3WA 3LNPA 2O7QA 3LQLA 4IQEA 4HN4A 3RN6A 5A6KA 2EAWA 1UQYA 1SUXA 2VX5A 5I2UA 4Q8MA 1J79A 3DBPA 2DORA 2ALDA 1ZGDA 3CT2A 4W8AA 1XXXA 3S46A 4XSLA 1NIUA 3MPGA 3KS5A 4HD5A 3A22A 1FFQA 3Q65A 5E0KA 1JDFA 3GU9A 4AWEA 4IMEA 1S2TA 1G4EA 4RZ6A 1JFHA 4KEUA 5DANA 3MP5A 2YLAA 4GD0A 1WBJA 4ZQNA 4OBTA 5CBBA 5LSMA 2NPXA 1LTDA 4JHOA 1BGAA 4UOJA 3VD7A 2ZZ0A 3PZ9A 1KXTA 3AYRA 1XYBA 3TAOA 1OM0A 4QP0A 3DERA 4PEEA 4A3YA 1TJ1A 2GQ9A 1TWZA 1K8ZA 2WHJA 1CW2A 2X1IA 4IJCA 1I1WA 3I6RA 5CEWA 3LOTA 2CZEA 5CZKA 5DELA 2QCLA 4JFWA 5HNUA 4IX2A 4B3LA 5K4ZA 2FJUB 2TPSA 4AD5A 1K77A 3NQFA 3TR2A 4ZQPA 1V03A 3R94A 1XUUA 1GORA 3CPUA 3NQCA 2QVNA 1VKFA 3W53A 4YHEA 5H8MA 3KAOA 3WD0A 4QG9A 4S23A 4K1GA 1D8CA 2VMFA 2OT1A 4O1AA 5F1VA 3LZ5A 4K8HA 3ZWSA 1N8IA 1XYZA 1DBTA 2QW5A 3O06A 4UTJA 4BEUA 3L4ZA 3WY1A 4AD3A 4UQCA 1FDJA 5CC7A 3GXDA 2EQ7A 3D46A 3G1RA 3FCPA 3WF4A 1GRTA 1FWHC 3TYBA 4DJFA 2Y7EA 1WXYA 5M1TA 2BY2A 3GG0A 1U22A 2GQ8A 4E4FA 4IMDA 3TKFA 4XBKA 2W4XA 1C91A 3W37A 3KL0A 4UZSA 1ISVA 1TJ2A 3OYZA 1BFNA 2WOQA 2DH3A 1JOAA 1NDZA 2BHUA 5KVIA 2J8GA 1JZ6A 3OLEA 1I8JA 3EXSA 4H50A 4OVXA 1WOAA 3KW3A 1J0YA 1NWSA 1XC4A 1MFVA 4MWAB 2W79A 3M0JA 1Y7VA 3WH5A 1GCYA 3GNNA 3V5OA 3BCFA 4WLCA 4IGSA 2WC3A 4HYWA 3WJSA 3W7MA 1CB2A 1PKLA 3SM0A 5DY3A 2ADAA 2EJAA 4MUZA 4PMOA 4IPNB 1EIBA 3FNDA 4AWTA 3G1YA 3TQKA 1KD0A 3UQNA 5M03A 1R47A 4GJ1A 3SR7A 4JFTA 4MLJA 3LXBA 4V33A 1WE5A 4LUSA 4F48A 4HSNA 4L9XA 4GGBA