1MUCA

Structure of muconate lactonizing enzyme at 1.85 angstroms resolution
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
369
structure length
360
Chain Sequence
ALIERIDAIIVDLPTIRQQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords MUCONATE LACTONIZING ENZYME
publication title The refined X-ray structure of muconate lactonizing enzyme from Pseudomonas putida PRS2000 at 1.85 A resolution.
pubmed doi rcsb
total genus 140
structure length 360
sequence length 369
chains with identical sequence B
ec nomenclature ec 5.5.1.1: Muconate cycloisomerase.
pdb deposition date 1995-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1mucA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1mucA01
2PU1A 2PTXA 4E4UA 2OO6A 3K1GA 3OP2A 3BJSA 3H7VA 2QJMA 3DDMA 4EWJA 1P43A 1XS2A 3DERA 4IZGA 4F4RA 3DEQA 1SJCA 4M0XA 3TJ4A 2PP0A 2GGIA 4ZCWA 1W6TA 3STPA 4IL2A 2P3ZA 2OQHA 2OZTA 3OTRA 3RCYA 3U4FA 3ZLHA 2GDQA 2AL2B 3P3BA 1SJDA 4KT2A 3FVDA 3BSMA 3RGTA 1NELA 1RVKA 3CAWA 4GISA 3RRAA 4Z1YA 2OLAA 4IHCA 3TWBA 3V3WA 3I6TA 3H70A 3EKGA 1PDYA 4GYPA 3OW1A 3DESA 4G7FA 4KWSA 4H2HA 3CK5A 3MSYA 4GMEA 4HCLA 2QDDA 2I5QA 1TKKA 3VDGA 3MWCA 1R6WA 2GGEA 3ES7A 2ZC8A 3OZYA 4E4FA 3UJ2A 1MNSA 3H8AA 3VA8A 4IT1A 4IP4A 4HCHA 2QVHA 1FHVA 5FJRA 1P48A 1SJBA 2P8CA 3FV9A 2XH7A 2MUCA 3DG6A 4JN7A 4ENLA 1KKOA 1XPYA 3R10A 2XSXA 2HNEA 3DGBA 3I6EA 1DTNA 1YEYA 1KD0A 3Q45A 2OX4A 3CYJA 3OZMA 4DN1A 1ONEA 1KKRA 2P8BA 3T8QA 1L8PA 3ZVHA 3FXGA 2FYMA 2OQYA 4JN8A 1SJAA 3CT2A 3S47A 2GGHA 1EC8A 4Z17A 5EU9A 4DX3A 3QTPA 3V5FA 3Q4DA 3SN4A 1ECQA 1MDLA 2OZ3A 4YWSA 2PA6A 3UJFA 3H12A 2AKZA 3QKEA 3R0UA 4DXKA 2OVLA 2POZA 3JZUA 3PWIA 3SSZA 5J04A 2QQ6A 1EBGA 4E6MA 3RR1A 4FP1A 3IJIA 2O56A 4HNCA 4GYPC 5FJUA 3S5SA 3JVAA 3PK7A 1R0MA 3QPEA 3MY9A 1OEPA 2DW6A 3UGVA 3VFCA 3PWGA 2PSNA 2HXTA 4HN8A 2DW7A 3IJLA 3VCCA 4MGGA 1EC9A 2AL2A 4MKSA 3UCDA 1PDZA 1FHUA 3KUMA 5BOFA 3JW7A 7ENLA 2PTYA 2GGJA 3I4KA 3NFUA 4GIRA 4X2PA 4G8TA 2OFJA 3R0KA 4K8GA 2PCEA 2AL1A 3P93A 3P0WA 2OPJA 2PP3A 3CXOA 3BOXA 1F9CA 2PGEA 2PP1A 4FI4A 3TQPA 3T6CA 3D46A 2CHRA 3TOYA 1WUFA 3ES8A 3IK4A 4A6GA 3R1ZA 2NQLA 2FKPA 3V5CA 3MUCA 4MMWA 6ENLA 2PODA 4K2SA 5FJPA 3TW9A 3TCSA 2MNRA 3GO2A 3PFRA 2ZADA 3SN1A 1NU5A 3N4FA 2QDEA 4KEMA 3TJIA 3N4EA 1JCTA 2AKMA 3TWAA 5IDZA 2RDXA 3MZNA 4E5TA 4E8GA 3QN3A 3GD6A 4HNLA 3T4WA 4J3ZA 3UJSA 2ONEA 2GGGA 4DWDA 3UCCA 3NXLA 3GC2A 3DIPA 3THUA 3SN0A 2HZGA 2PS2A 2PTZA 3UJRA 3MKCA 2PTWA 3FYYA 3UXLA 1BKHA 4A35A 3UJEA 3DFHA 2HXUA 1EC7A 1MDRA 2P0IA 3MQTA 3SBFA 3T9PA 2OKTA 3GY1A 3SQSA 2XH0A 4IP5A 4KPLA 1JPDX 2XGZA 2PMQA 3NZGA 4A3RA 4H83A 1TE6A 3EEZA 4HCDA 4DHGA 2PU0A 4ZA0A 4JHMA 2QGYA 5BOEA 2PGWA 1IYXA 2OZ8A 3R25A 2XH4A 1BQGA 4ROPA 5FJTA 3FCPA 3VC5A 3OPSA 2XH2A 4J1OA 4M6UA 1KCZA 3D47A 3V4BA 4H1ZA 2QJJA 3ZVIA 4DYEA 1WUEA 3U9IA 1MRAA 3QLDA 2GL5A 2GSHA 1ELSA 3ZLFA 1EBHA 3VC6A 3N6JA 3SJNA 1E9IA 3UXKA 3ZVHB 3VCNA 3ENLA 3IJQA 2P88A 4IL0A 5ENLA 3DG3A 3RITA 4GFIA 4GGHA 4H19A 5FJOA 3RO6A 3DG7A 3CB3A 3FJ4A 1TZZA 1JPMA 3NO1A 2PPGA 3TTEA 1MUCA 4K1WA 3R11A 3B97A 2OG9A 3HPFA 3N6HA 2QJNA 4GGBA 3DFYA 1JDFA 4HPNA 4HYRA 3ZLGA
chains in the Genus database with same CATH superfamily
1VLWA 5G2WA 4Z1AA 2GUYA 1JRPA 3N19B 4LEQA 2EKCA 4BY3A 5BXRA 3N2MA 4GYJA 2J8FA 3DDMA 1GYMA 4DJFA 5C9ZA 5C2CA 2PWHA 3ZZ1A 4A8NA 3WLRA 1C90A 2YGYA 5AKQA 3TEVA 3N2TA 1QJWA 1ZBWA 2J13A 2QUTA 4MNKA 1UMYA 4YHGA 2VD9A 3WJWA 1PE1A 2POTA 4AX7A 2NVCA 4QE4A 4YYFA 2F7FA 4MY1A 3NPVA 2OEMA 1JFHA 1M9HA 4PEEA 1E43A 4MY8A 1E4NA 1OX4A 3WK3A 3W81A 2ZXAA 1QPNA 1JDCA 2O9OA 4G7FA 3WH5A 3W85A 1UQYA 3FJNA 2JE8A 1GVIA 1HJXA 3W6MA 2VCBA 4W7VA 3DGZA 2ZDRA 1VFHA 3IIVA 4WSHA 4EQXA 1TV8A 3G5EA 1WOBA 3AIVA 3Q67A 2ZC8A 1JZ3A 1EX1A 1TREA 4JTFA 3B8SA 2Y5SA 1E15A 1Z3NA 1XLJA 4NEVA 1K1DA 3CHFA 1C3FA 2J4GA 3W1PA 2Y4SA 4PMYA 3QR3A 3FV9A 2QPSA 5FCZA 1SO4A 2CHNA 4C5YA 3HJZA 5K9CA 2G3JA 5HJYA 3R10A 1A4MA 3LI0A 3RG6A 3W75A 8CGTA 5I3GA 3FAXA 4GZJA 1QATA 1E1CB 4Y9OA 4PUWA 1S7MA 4FNSA 2W5FA 4ZTXA 1HJSA 4UQDA 2X42A 5C9XA 1FEAA 1KCLA 3VOFA 2R1KA 1LP6A 4Y8EA 4JTHA 1OY0A 3SY5A 3UQNA 1CECA 2DT0A 1IQ8A 3ARVA 4OECA 2D2OA 4M81A 1QXLA 2YCEA 3VNDA 3WQVA 4LFYA 1EPVA 2JQXA 4QAIA 1GESA 3SN4A 2GQ8A 4YWSA 4I9TA 2E8ZA 3PBYA 3GD3A 4PCSA 2EO7A 4U3AA 4U33A 2Z7GA 3AXXA 4LUIA 3EF6A 1TPH1 2FZDA 3JZUA 1X39A 1DYSA 4LVBA 3LTYA 2RJGA 5FS7A 5A6JA 1K03A 1WX0A 3BH4A 4PUEA 1J79A 1I0BA 1QHOA 3VKBA 3NQ6A 2WBAA 4K6AA 1DTUA 1SSGA 1JR1A 1E9YB 5I3HA 3QBUA 3CLWA 4B91A 4XAFA 5G2IA 1X2HA 1TX0A 4REQB 2R9ZA 4BQ3A 1VQTA 3WJXA 2QIWA 4IQLA 3CO4A 1PZ2A 3O6YX 1Y65A 2VJXA 1C8XA 3CZJA 2BCPA 4F79A 1J0KA 2AMGA 3PR2A 4NY2A 2V3FA 4HIBA 1WAUA 2WPBA 2OSYA 1KFLA 2Z0IA 4O8RA 1C93A 4Z2LA 2Z6JA 4ZENA 3G3DA 2PP3A 3SGZA 1F9CA 4N9DA 4S2BA 1F3EA 2YW4A 4AIBA 2NXHA 3D46A 5EYWA 1V6YA 1TV5A 1N2VA 1WUFA 2WQDA 3HQOA 2ANUA 2ODOA 2CXEA 2V9DA 3IC9A 1W17A 2ZUVA 4DXXA 2DY3A 1LRQA 3ZR5A 1TE1A 1N8IA 2Z1VA 3GRTA 3D6NA 2NLYA 3MBFA 2HTMA 1DHPA 4HB7A 3W2LA 4YYCA 3EMQA 4JOMA 4TX9A 5A8QA 2C3ZA 4E5TA 1OGBA 3CUIA 3UZZA 2WLYA 2YDQA 3HIJA 1OFRA 3RU8X 3UCQA 1Q6CA 1EQPA 4M7TA 3RLGA 1MXDA 1M01A 2EPMX 1V93A 1JROA 3WQ4A 3S1VA 1TV7A 1DKWA 1XISA 3L4YA 3SN0A 3M5ZA 1L6WA 3B8UA 4PTNA 4B3ZA 5HATA 3MKKA 1S5TA 1OZQA 5IHSA 1ISZA 3TSMA 3SCSA 4XWUA 3AMGA 1O5RA 3EX3A 1CTNA 1V59A 1S5NA 3GSMA 3WL1A 1V0NA 4QAWA 2EPLX 2H90A 2G3MA 4BF9A 1GEUA 4AISA 4QSHA 2XDFA 3CPRA 1RR2A 3WEOA 3N1AA 3CTLA 4N2YA 1GYLA 3GX9A 4ILSA 4H6QA 2A7PA 1YBQB 3URAA 2PGWA 4IP7A 3U7BA 1H7NA 2YYUA 3V0SA 1Z9AA 4ORIA 1JF6A 3F4WA 1XANA 2XVKA 1U1UA 1ZBVA 4S39A 2C0AA 4W4QA 3ZVIA 3MJYA 1TCMA 4DWSC 3KL5A 3L4XA 3LY0A 3SQMA 3MA8A 3GVRA 2D73A 4FEZA 4LX4A 5DBUA 3SCRA 2DUXA 4O4WA 1X8FA 5ECVA 4QJ5B 1XD0A 2X1SA 3ENLA 2E4TA 2B7QA 4UTLA 1KR1A 2PWUA 4H8UA 1FBAA 4GABA 2ZYFA 3E3HA 4O1AA 4GI6A 2FVLA 2UY5A 3GDBA 4DUWA 5D9PA 4S3FA 3B8TA 3QMRA 4J3TA 5H6HA 1VC4A 4H4VA 3N73A 2DZUA 1ONXA 1XR2A 4OZOA 3BARA 3K46A 3F5KA 5FJJA 4MHBA 4OHQA 1EOKA 1XM3A 4GQBA 1P6CA 3OG2A 1UJPA 1US3A 1GKPA 4M0XA 3T2QA 3DYPA 2OODA 2YB4A 4CNNA 2BVDA 2XUCA 3BAIA 4EE9A 1GVQA 4E2DA 4BWLA 1V3MA 1W56A 1RV8A 5AVNA 2FTWA 3BLFA 4QSFA 2G3IA 1RVGA 1F5ZA 1GOQA 1O95A 2ZDSA 1K02A 4EVZA 1L9WA 4JKKA 1VFLA 3A24A 1FTXA 4O50A 4TOQA 2BXVA 3K5XA 1CCWB 5D2WA 2X05A 1AQHA 4GMEA 3ITGA 4O0QA 2G3NA 2TSYA 2FB3A 1ADSA 2RJHA 5C2GA 3BANA 2XG9A 1DWIM 3OQ8A 1VBUA 3IJ9A 1PCKA 4JTDA 1OCQA 3TZFA 1TTPA 4JHZA 3NDZA 4Y96A 1G01A 3W07A 2NSXA 1F07A 4OJYA 3W2UA 2FH8A 1SJBA 2ADAA 3ARPA 4YN5A 1RSCA 1ZBKA 2XPKA 3MHGA 3QHMA 3SFKA 1U1HA 1J0ZA 5AB3A 3DFPA 1FFQA 3B9AA 4R7OA 1KM5A 1PUDA 2E28A 1E9ZB 2V38A 4C1NB 1C92A 1B3XA 2E68A 3PAJA 4UQCA 3V1HA 2O9PA 4BV6A 1DE6A 3GYCA 2A8XA 3RXZA 1CXIA 5CPTA 4AUBA 1XIDA 3L8KA 3SM0A 4AD2A 2B7OA 4F0KA 3M0KA 5CAHA 1IHIA 4N9BA 4MJZA 4O13A 3CIVA 3JU2A 2O7SA 3KBMA 1YNQA 1GTEA 2GOUA 3B3DA 3APGA 3QTPA 1B3WA 3MYPA 3AUJA 3RILA 3AXHA 1E6ZA 3R4IA 4B3KA 1Z89A 2IS7A 1AODA 3UEQA 4DUOA 3GFYA 1S5VA 1RLDA 2QCMA 4PRRA 3M41A 4HNNA 2J7BA 1AZ2A 1ZCCA 1H11A 2G37A 5CXPA 1QUMA 1CNVA 4ZOAA 4LAMA 2WOVA 3SSZA 3B06A 4TVDA 2EKGA 4GIEA 4LNCA 2VEGA 5AYZA 5D2TA 2V68A 2O56A 3WQDA 2UY2A 3CQKA 3QQ0A 3H22A 4WLCA 5HPCA 1A0DA 3G8RA 4IWWA 1XG3A 1R2RA 3UGVA 4LRTA 3ORWA 3MT1A 1JXJA 3GK0A 3QHOA 4TX6A 3ZR4A 2DW7A 3IJLA 3I68A 1RJPA 3R6IA 3H2FA 5BMWA 2WW5A 4B5UA 4U10A 4R9XA 2ZX6A 4RDZA 4EAMA 2VR2A 3ALGA 1KXQA 1UKPA 2ZX7A 1P0NA 2DVTA 3VKDA 3GXTA 1A3HA 4IGHA 3EOEA 3CZLA 1EO5A 1ISVA 1W5MA 4GACA 2W62A 1KCKA 1Z48A 2Y7FA 1B9ZA 3KRBA 4KWVA 3WH8A 4IIFA 4BQ5A 1X98A 1PTDA 3WQOA 3NPUA 7TAAA 3VDBA 4QCFA 4E2BA 4XZIA 4J27A 3FY1A 3E38A 4FNTA 4K2SA 4RZ6A 2NPXA 3A5FA 3LERA 2P50A 5JCNA 3SN1A 3N2CA 3NL5A 2PF0A 4H00A 4D6HA 2WV8A 4Z08A 3WMLA 3B40A 4Z1CA 4E8GA 1QI3A 2CBIA 1GGOA 2HE5A 4XAYA 1YTDA 4HNLA 3QR1A 5K9XA 3MV01 1FHLA 2OT1A 2Z24A 3QXBA 1HQTA 1TR1A 4ASTA 1AJ0A 4H7VA 1P6WA 2IMRA 2WSPA 3NXLA 5EY5A 1REQB 4HD5A 3OLEA 4DJEA 1AZ1A 5CZKA 1RP9A 3E5BA 1GRBA 2EXOA 3GRIA 5E0FA 2FHBA 1KRAC 2HXUA 3CWHA 1QW8A 1KM1A 3R7MA 3W7OA 5DX7A 4L6HA 1W1PA 3VD3A 1XRFA 3U2ZA 3J7HA 4RZ5A 3EEZA 1FWBC 5I00A 3WK2A 3LCIA 1OFAA 3OG3A 1PIFA 4HVXA 3WBWA 4AF0A 4ZBCA 3OLGA 5FACA 2FMNA 3SI9A 4WX2A 1DQWA 1UD3A 1BSLA 2QXWA 4WY0A 3DGRA 3DECA 2P53A 4JTRA 1R3VA 3L0GA 2AAMA 3FCPA 4UTHA 4R7JA 3ARSA 2PWFA 4LVDA 3DBPA 4ZB5A 4N42A 4FO4A 4AFYA 3M5XA 3VNYA 2XHYA 4DAFA 4F9DA 3SQPA 2VFDA 1RY8A 1VRDA 4RPQA 3VC6A 3LM7A 4JTGA 4XTIA 1W3TA 4NJKA 5HWJA 5ENLA 1IEWA 2V2CA 3MUIA 1WDWA 3UXAA 2J6VA 1Q5MA 2Q6ZA 3HGSA 3K4WA 4ADTA 3EWUA 1H3GA 3AROA 4C91A 3KE0A 3PJTA 2Q8XA 2CWXA 1NFPA 4FOJA 2V5BA 1E73M 3A4JA 4WUIA 4PMNA 2OG9A 1H62A 3FK4A 4G56A 1QO2A 4RZBA 2DT1A 1UZDA 3N9RA 1TMQA 1R9XA 1HL2A 2PWVA 3W1TA 1W1B1 3BW2A 1RHCA 2QJMA 3DUGA 2BC0A 1W9PA 4EWJA 3QY6A 1TA3A 1E6RA 1WBJA 3CZGA 3DKLA 3IAPA 1MZHA 4LW7A 1S2AA 2QT3A 1PTAA 4XBSA 3TJ4A 4EMIA 5ABGA 3SZ8A 3FJ6A 4LY8A 4Z0JA 1Z6KA 1QTWA 4HNVA 2A6LA 2GVEA 5IM51 3LHTA 5A95A 5J5DA 4NAEA 3I65A 1J0IA 2CFFA 5E70A 4KT2A 5HULA 1FH8A 4JFWA 4UFHA 2WANA 5I5RA 4PGLA 1O94A 2EG7A 3CUHA 4C6EA 4GISA 2D3LA 3A23A 4GX8A 3MW7A 1N62C 3E0FA 3G1HA 3NM3A 3UR2A 1CLKA 4O17A 1K7FA 1MFVA 3LN3A 1L2QA 4H6KA 3M9YA 3BUVA 5CSRA 3OVRA 4ZE5A 1ZDLA 5IBXC 3C3NA 3GG7A 4NRSA 4HTYA 3OZYA 3CQ0A 1N82A 1WDDA 4HOWA 4EP8C 4LCRA 3S4TA 2E09A 3E0LA 4XKMA 6REQB 4H4ZA 5A8OA 1A5SA 4PCTA 3WG6A 4S3DA 2H9AA 2GDVA 1P48A 2QCEA 4LT9A 5ABHA 2Y24A 4IG2A 3W1LA 4W8LA 2RDTA 2YL6A 2VQUA 4AIOA 4DWSD 4HHMA 4LUSB 4DO4A 1EJ7L 1XPYA 1C8YA 2HNEA 4M29A 3W7IA 1VQZA 2ZVRA 4WQ6A 3CC1A 3KL3A 3VE9A 2NT1A 2R1MA 1LWHA 4R5EA 1HFBA 3GIPA 4G2DA 1H0GA 3P82A 2ZZCA 4QEEA 2QPUA 4KIRA 3W7QA 3MDUA 4Q4MA 2JALA 1MVYA 5D2VA 1WKYA 4JN8A 3TW6A 4I7VA 2DZVA 1POJA 4PCFA 2J8GA 4H4SA 5CLWA 3SCWA 1QWKA 2OX1A 3KVMA 3KCJA 4FIRA 4LB3A 1HL8A 3ARXA 1ECQA 4NNCA 3JRKA 1Y7VA 5LIYX 1WXJA 2VENA 1G94A 1GYNA 3AHVA 3LCXA 1N55A 2WZHA 5CBJA 2DSVA 3M46A 5A6MA 4QQ3A 2QQ6A 4XZLX 2QS8A 3GXPA 4HGXA 3RM4A 3DAQA 3Q58A 1ZP4A 3IJIA 5LIUX 5HNTA 2PDPA 4Y90A 1X1OA 3BPWA 1S3TC 1XC4A 4PA8A 5BXSA 4ZL1A 1V6WA 2AQOA 3MY9A 4UFMA 4NZFA 4O15A 4L6OA 4JIHA 4JFVA 3PWGA 5CCZA 3CGBA 5GPRA 4L1WA 3B4UA 3WNOA 2V82A 2PFHA 3APTA 4UFKA 1TV3A 2QV4A 6ALDA 3UZYA 2PTYA 2GGJA 3VGEA 4YTTA 1VJIA 2FPTA 1HJQA 5DRCA 3N25A 1VD6A 3O0KA 3VUSA 1AW5A 4H4YA 2WB5A 2PGEA 2WP5A 1F74A 1UPMB 5HPOA 1WB0A 3P81A 3K1DA 4GC4A 5AC6A 4YU1A 3RHGA 1P0BA 4A6GA 4GXPA 3HGOA 1FXPA 2YX0A 2PLKA 5KINA 5MKGA 3ZOAA 3PFRA 3GNXA 1EGZA 3LCGA 1TQJA 2HQMA 4AY1A 4YCPA 3AC0A 3OVPA 2X7VA 5G4HC 1PV8A 3RMJA 3VNZA 3MZNA 3KLKA 3ABZA 3GD6A 1FVPA 1ZTVA 4G9PA 3GB6A 1PKLA 4C7GA 4J3ZA 4IFRA 4HZ7A 3LZ5A 3BQ6A 3FA3A 3DH7A 7TIMA 1DORA 1LLWA 1LVLA 3MYOA 4JDBA 4AAJA 3AIQA 4GZEA 3L68A 4EAYA 4O0KA 2Y61A 1W37A 3MKCA 4RX0A 3F4NA 1VHNA 5F2GA 1RAKA 4HQVA 3GDLA 3W7GA 1HKKA 2Y7GA 4ZO8A 5EMLA 1MDRA 4LALA 1RY0A 2DPEA 5TD4A 5B7ZA 2RH9A 2G3FA 2XH0A 1GV4A 3V5OA 1FA2A 5BRQA 2W9MA 2PCQA 3C2FA 3UVAA 1V6VA 3LUTA 3KXQA 3HPSA 3C8FA 4H3DA 3WEMA 3VGGA 4JHMA 3CV1A 5A8NA 1X38A 2W92A 2JF7A 2AGKA 3C52A 3TYUA 3BW4A 4OBSA 1EOMA 1GVSA 1KFJA 4CCCA 1MOKA 1KM4A 4BCEA 1GG0A 4FXSA 3BGAA 5IRPA 4EM3A 4M24A 5J5RA 1V3LA 3KBSA 1N60C 1MW1A 3HRDC 2HCVA 5LYRA 1WUEA 3TQVA 4LVGA 2NVAA 2A3LA 4XKYA 4OBTA 3T0AA 3GC4A 1TJPA 2DVUA 3R58A 1VKFA 5G4WA 1Q6EA 4PH6A 5A6LA 4U4MA 5EFDA 1LWJA 5EBKA 1IEXA 1PPIA 5JCLA 3LHUA 4QE5A 3N15A 4BEQA 2EQ9A 4Y8FA 3HFYA 1J5TA 1UUMA 3RO6A 5FJOA 2OOFA 3L2IA 3DG7A 2BZNA 1DJXA 3W0KA 1AQMA 4DPQA 1IEQA 3NO1A 4JD4A 3ANUA 2H8ZA 4GJJA 4YVVA 4YTRA 3HQ1A 1UWQA 3N6HA 3OA5A 4RK8A 1YNPA 2WBKA 2PU1A 3S5ZA 4H4IA 3CEUA 3ITXA 4S3EA 4APNA 3C86A 3H4KA 3H2OA 1S2TA 4DXVA 4CNOA 4QM1A 1UWRA 2UWFA 3NCOA 3NNTA 3QV6A 4MUPA 4LVAA 3B9JB 4ERGA 1BLIA 3M43A 3G18A 2Y70A 4IZGA 1J2BA 4CQCA 3S6TA 1MSSA 2OO0A 2G41A 2DIKA 3FEQA 1JVNA 3EEGA 3QFBA 1ZJBA 5LKYA 1HKVA 3GNRA 4H9VA 1KGUA 4A2RA 1ME7A 2YLAA 2DH2A 3YPIA 4J3UA 4PUKA 3MPGA 4GY7A 4ZMGA 3C0SA 3RR4A 4EACA 3HG3A 2HK1A 4HHPA 4EIVA 1UBPC 2VMFA 3QR0A 5JQ9A 3OEXA 2EJ1A 1JD7A 2WZIA 3G6MA 4KWSA 5CJ5A 1UCWA 1GEHA 2NV2A 1OHLA 1QI2A 2OCZA 2Q09A 4NIRA 5G5GB 3QGKC 4I6VA 1E0UA 3EDDA 2D0FA 2CLOA 4WGHA 5F1VA 1HNYA 3HN3A 4FX9A 3NZPA 4RUBA 2Z00A 3U4AA 1CLVA 4LTSA 4P8VA 3O7UA 4HCHA 4PUNA 5CPNA 4FX8A 4NJJA 2PDWA 1KLZA 1MNZA 1CGYA 1R5YA 4PRWA 4IICA 1DJHA 4KETA 2YZ5A 2MUCA 4PCNA 4G1KA 4M5PA 5M1TA 1XUUA 4FLRA 1TV2A 4AZ7A 5LIKX 2P76A 3TFXA 1IT8A 3AIRA 1L6FA 1OK4A 2V3EA 3I6EA 1U5HA 1UR4A 3GWQA 4GHRA 1B3ZA 3O9NA 4J35A 3N12A 1ESWA 2WNZA 5JMUA 1RQEA 4DN1A 1SMDA 1KKRA 1O1ZA 2NX1A 2P8BA 1FFRA 3BOLA 4GZ7A 3QH2A 2R8WA 3GLCA 3E96A 1IF2A 1GOMA 1E71M 2X8HA 1I45A 2WHMA 5EMYA 4QR6A 1XINA 4UTFA 1NWTA 2FH6A 1AA1B 1UBSA 2GJXA 3PTMA 4XZ9A 4CQAA 1AD1A 5JBFA 1DQUA 4H7ZA 3PPCA 3FJLA 5EBAA 3AUOA 4UUIA 4P8UA 2IPGA 5ABFA 2OZ3A 4X22A 2Y85A 4WIWA 3QSTA 3GHUA 1Q6LA 2BXYA 2PLMA 1EEXA 3EKLA 5BCAA 5TIMA 3WF4A 5DT7A 4IMFA 4FP1A 2BY0A 5LHEA 1RBAA 1SZRA 1T7LA 4XD5A 2V5CA 1KTBA 4OU1A 4K39A 3BJFA 4C6JA 1E56A 4OGZA 3IANA 4I7WA 4GE8A 4ZQNA 1E6NA 3D9XA 2HXTA 2IW0A 2ZOXA 3H4GA 1XYCA 4LF1A 3EXSA 2AL2A 2G95A 1FHUA 5LA1A 1EJSC 3I4KA 3RPTA 1CT5A 3NQEA 4D1IA 1PKYA 3EAUA 1RQHA 2X40A 1A5BA 3VO0A 4AB4A 1I9CB 4P61A 1ZNNA 4LBUA 4HPHA 2RDWA 2PDKA 2QCLA 1RBLA 3PTQA 4UTWC 1NJJA 3URNA 2ZUNA 3F4DA 1JZ5A 1N63C 3LRKA 4L80A 4D6DA 5AYXA 4HPGA 1UUQA 2UZ9A 2XM2A 3SY8A 2ZA3A 1F4HA 1L6SA 4QDPA 1SQ7A 2WVVA 4NP7A 3ZSSA 3LHWA 1NU5A 3H21A 5CPLA 3IS4A 1EJTC 1JCTA 4V1YA 3VZXA 4FHAA 4RV8A 4AG0A 4NEWA 2WMIA 2DT2A 1NDVA 3Q2DA 2GGGA 4BK9A 1L6GA 3QYSA 1XYFA 3TE9A 2Z27A 3GC2A 3O16A 3BAWA 3VIJA 2BVWA 4B92A 2ACQA 3UJRA 2DQWA 4CUCA 4U28A 3FYYA 3QW3A 4FZIA 2G4JA 2BV9A 1LQ2A 3F4VA 2H6RA 4GJ1A 2YB1A 3NQAA 3WD2A 3VOHA 3M0YA 2YFNA 3N17A 5FL0A 2Q71A 5LGZA 1AFSA 1IZKA 1UD6A 3GDRA 3UZXA 4A3UA 3WCZA 1G4SA 5JIPA 5JBDA 3DENA 5JH2A 1Q63A 2PMQA 3NZGA 4JDRA 1WE5A 1OX5A 3EDEA 1OVDA 3B8IA 2VUYA 1C8QA 4H4UA 2Y5JA 1R86A 4GRSA 3U8GA 4LCSA 2XFWA 1CGUA 5I2UA 1M68A 3W27A 2JGYA 2DSKA 1LQAA 3LSBA 3B0YA 3L4TA 4F66A 1QVBA 1YPFA 3UFYA 2MANA 1KXTA 3R25A 2VC6A 1XDJA 4AD1A 1DNCA 2E1DA 4UFIA 1POKA 1YDVA 3TV8A 2Y6ZA 1FDJA 1UMLA 1O7AA 4O0ZA 4H01A 3A9BA 5BZAA 3D47A 4A3YA 1SFLA 3H53A 3OZPA 3LGGA 1XLCA 1OJXA 3CIWA 1PB0A 2GR0A 4JFSA 1QPKA 5AZ0A 4NASA 7REQA 2ZRXA 1MZRA 3WF1A 4OOZA 2NQZA 3C61A 1JGMA 1MUWA 1OX6A 2GPTA 3ATZA 1UR0A 3M5YA 3TA6A 5BRBA 4I7UA 3DJJA 2OWWA 3USBA 5LNWA 4QP0A 4AZIA 2NX9A 3EWCA 1VCGA 3PUGA 3BLOA 3SGGA 2PDMA 4Q8MA 2C91A 3KTXA 4QS6A 3WF0A 3DOPA 1TB3A 1O68A 3PZVA 1ZQ5A 1OJTA 2NLIA 3B04A 3KTSA 1NQ6A 3BURA 4B16A 3WFAA 8XIAA 3QOKA 2XGIA 5CGMA 3ITVA 1XBVA 5CBBA 2JIEA 5DCEA 3A7UA 1GUVA 4KFOA 4PODA 3A7AA 2ZZ1A 1A5LC 4H9TA 1UW9A 5EA9A 5KZMA 1KWGA 2HV5A 5FIPA 5C55A 3IUIA 3O63A 3DERA 1W1YA 3TJXA 4GOAA 3MP5A 3CUXA 2GOKA 1SR9A 1DWAM 1Z8AA 2YDSA 4DNHA 2C18A 3DK8A 3PWAA 4DNMA 1W8GA 4AF0B 1E9LA 2D2HA 4IQDA 1W1ZA 4KRZA 4Z2JA 2WC7A 3P60A 4WY0B 3AYSA 4K68A 1EL3A 2VZUA 1TTQA 1WKEA 2VKZG 1EIBA 1NELA 3ZT7A 1BFNA 4B5WA 3S5OA 3TWBA 3RPDA 3I6TA 2ISFA 1TWSA 2J24A 3AXKA 4Z2IA 5AC4A 4MAZA 2FHFA 3T78A 2WZMA 2YAUA 1RK5A 5IXEA 2VWSA 1P0DA 4FXFA 3ALFA 4Z2HA 9RUBA 5IBXA 4AW7A 1B2YA 3S42A 5CGTA 1XIGA 1YXDA 1VBGA 2GJLA 4AHOA 3ONBA 2F5ZA 3TW7A 5A6SA 1XYAA 3GAYA 3PUOA 2OZ0A 3DHUA 1H7OA 3LNPA 1YE4A 2C1IA 1X97A 2P8CA 1FCBA 2E67A 1TPDA 1SMAA 1CWYA 1E40A 4FALA 2C71A 4WDXA 2WJZA 2QF7A 2J27A 1EP2A 2DZBA 3S46A 5AOUA 4KW2A 4F2BA 1NQKA 1FXQA 3LMYA 4GIYA 4K8DA 1ONEA 3A3XA 1V6UA 5KMYA 3T8QA 3RAOA 4C5ZA 1LLZA 1THFD 1XLDA 2QLYA 3AHXA 1KGXA 2OB3A 1TYPA 3GKAA 3SRDA 1UC5A 5HMSA 3L9CA 1BAGA 2I14A 1C91A 3LNMA 1AH4A 1GOXA 3INPA 3VM7A 4R33A 3N13A 4ZFMA 5HWNA 1CB7B 1EC8A 2GQ3A 1PVNA 2ASHA 3DZ1A 3WNMA 3S9YA 1SO5A 4UNLA 4GCAA 3FA5A 2I16A 1H1YA 2TYSA 4NAEB 1W9DM 4K37A 4AD0A 5DXYA 1GJPA 3ZWTA 3UJFA 4GVHA 2YYTA 2E6AA 4HA0A 2OKOA 5D32A 1MWOA 3LD5A 3UYIA 1NPXA 3PJWA 1X7IA 2JIWA 4U5KA 3DKJA 2UY4A 1VH7A 3QZAA 1H7PA 2WO5A 4JQ4A 3UA3A 5D2XA 4KH2A 5CQ1A 3S5SA 5XINA 4AVOA 3GHTA 1EF2A 4Q8PA 5CGQA 2HROA 2ZA1A 4O1CA 3FXYA 4N02A 3TUUA 4HU0A 1O6IA 4GUGA 3KRSA 2ALRA 2ZBTA 1FFVC 2BTMA 3QF0A 4G8TA 1R9YA 2PCEA 1JRCA 3VVGA 3VIFA 2ATSA 4IG2B 1JZ7A 3U2CA 1E3ZA 5AY7A 2XIIA 1QPOA 1R30A 4AD3A 4DO7A 1XIFA 1AMKA 3P62A 4HA4A 1BHGA 2VI0A 1KLYA 2ZIDA 4WXZA 5FF7A 4S23A 1GQIA 5GNZA 1H41A 4QLLA 3ZWSA 4DBDA 3BJTA 1VBHA 4R85A 1R2TA 5CZ0A 1QW9A 1B9BA 4OTKA 3VGHA 1VEPA 1XX1A 3ZYZA 2VVNA 4DNAA 1U33A 2XIQA 3GBEA 4I6KA 1TMHA 4B5NA 2CPUA 1EGMA 4Q32A 3BAKA 5E1QA 4ICMA 4U2YA 5CC3A 3A13A 1VAHA 1PHQA 2DUZA 2J9YA 1E1CA 3GG1A 1SYTA 2VFIA 3UCCA 3GTIA 1US2A 4Y9PA 4I9AA 3ZT6A 1QNSA 3AXMA 4MJMA 1B5TA 1HIZA 4AQLA 3NM1A 3QPZA 1UWSA 3WQ8A 2QGHA 5M2FX 2RDUA 4XIAA 1F73A 3M5VA 4AC7C 5HR7A 4L4MA 1NHQA 3A6OA 2V5DA 3GY1A 3OODA 5DFAA 3WMSA 1GRGA 1JPDX 4B5VA 2DV0A 5FAGA 2TMDA 1T99A 2XN1A 4NRRA 3NVYB 1A80A 4KGLA 4A2SA 1A5KC 1VGAA 2GYIA 1UD5A 5BOEA 2EF9A 4P5UA 1ITUA 3C8NA 5HQLA 5HANA 2XH4A 1JCMP 3C2RA 3B8DA 3IV3A 1QPQA 1OFQA 3VC5A 5D9NA 2J62A 3BGJA 3WF3A 2HVOA 4DJDC 2HWGA 4H9UA 4IQJA 2X16A 3U2OA 4B4HA 1DQXA 2IUZA 4EQWA 5I7GA 1DJZA 1J11A 3VPLA 3W6LA 4PULA 2NQ5A 2GJRA 4Z42C 5MKGB 3ZR6A 4E2OA 3CAKA 3GR7A 3WLOA 1AJZA 3L5OA 4C6FA 2XFRA 1QK0A 4JTAA 4QBXA 2PGFA 2XIMA 2FZNA 3CO8A 3DHFA 2FB2A 3UR5A 2BY1A 2J3NA 1Q6FA 3EDFA 3OBAA 3TTYA 1DWJM 1FDZA 5GJPA 5A2BA 2QUVA 3RO8A 1UROA 3TYZA 2VRKA 4UTUA 2G0WA 3LEPA 1TWDA 2C14A 3AICA 3WH6A 1A5CA 1A4LA 3SUVA 1NOWA 2I9UA 3SFWA 1D3GA 1GKQA 2PZNA 3PANA 2PDJA 2UY3A 1NDYA 1Q45A 1KA9F 4FB7A 2OYKA 1XS2A 4F2TA 3P7YA 4N6EA 1EHNA 1SFJA 4XQ6A 1OYAA 1CEOA 3IWPA 3UWUA 2NZLA 4GVIA 3FGCB 4C1LA 4HSOA 2GJPA 4X0VA 1JOAA 4Y7EA 5FEZA 3TXZA 3W7JA 1M41A 2BHZA 1W3KA 2VP8A 2FGLA 1V7AA 2FJKA 1LL6A 1W1TA 3LM3A 3QFEA 1GQLA 4AC1X 3RRAA 2V2DA 1QPRA 1PO9A 3G1DA 2YCIX 5FS9A 1Z44A 3ITYA 2VTFA 2YVJA 3W2NA 1XL9A 3DESA 3ICJA 1ODZA 4UB9A 5C0QA 5K7JA 1IGSA 1NVMA 1R8LA 3GR8A 2BGQA 3RN6A 4DUVA 6PTDA 4LAZA 4ICCX 2IPWA 4UOZA 3VNIA 4ZVJA 4JNMA 4N0RA 3KHDA 3KZPA 4DWSB 3M47A 3LCHA 2CCRA 2E9MA 4RDYA 4D71A 4E4FA 1YBQA 2GUBA 1RM6B 1JQVA 2JFEX 3LHVA 3AS2A 4WOQA 2GVJA 3PUEA 5HQMA 4GNKB 2IQ0A 5CAKA 3LG3A 3R13A 1XGDA 4X63A 5TNVA 1O60A 3RX2A 3F4CA 1QO5A 1YADA 2Z26A 3RIKA 1UUOA 2QEZA 4PRTA 2VELA 3LB8A 2ISWA 3NYZA 5LNVA 3OIXA 4GG9A 4GBDA 1XH0A 1XUZA 5XIMA 2J88A 2BY2A 3Q45A 1XBXA 3CYJA 6CGTA 5LZLA 3LTPA 4JKLA 4GYFA 3PG8A 1RD6A 2WHLA 1YTEA 1AUSL 1GK8A 1XSKA 4S3CA 1D3HA 2OLHA 4EPDC 3DC8A 3IGUA 1HL9A 1Q2SA 2DIEA 1UH4A 2QAPA 3PULA 3EX2A 3P61A 3TTQA 1OF8A 3LCLA 3SCUA 3M0ZA 2IXUA 3EWWA 2BP1A 1FCVA 3FOKA 3EXTA 1EUAA 2PA6A 3EMCA 1UR1A 3QKEA 3R0UA 1SW0A 3WBEA 2ZTKA 2WSRA 2XZ7A 2R14A 1QW7A 4GI4A 2DZTA 1XKYA 1MW3A 3MDWA 2DQXA 5E0CA 1J9YA 1VYPX 2X7WA 4UZSA 4MZ8A 3ZMRA 5EPDA 4B5XA 5K4ZA 4PB4A 1XBYA 4ZQRA 4B2DA 1VR6A 2ABBA 2DW6A 1TPB1 3G1AA 3V16A 1OADA 4A3QA 1OCJA 3OGRA 1DXFA 3UWEA 2WNNA 4MKSA 2EPNA 1XPGA 3SUTA 3K8MA 3AMCA 3LLFA 4GLEA 1G9HA 4P7LA 1KM2A 2PEVA 1NIUA 1ZUAX 2OFJA 3R0KA 5D30A 2G96A 5M03A 1XDIA 3HV9A 4YXGA 1VFMA 2W54A 3W22A 4JTKA 1HUVA 3T6CA 3VGFA 3G22A 4H4QA 4CCDA 2CZFA 3D3AA 3LLXA 4XAGA 1M7PA 2WPFA 3R1ZA 1XC6A 2WKLA 1SZNA 1V02E 1VS1A 4NAFB 1IT0A 1HG3A 4YLWA 5LNUA 4GX9A 1Z32X 3QJAA 4UTTA 4JHOA 3EWYA 1BTMA 4TTGA 3TNBA 1STZA 3WQCA 3SR6B 3CEPA 5DCBA 3L4WA 3N4EA 2EHHA 1E6SM 1NTHA 5HUPA 1KBKA 1K6WA 4FOKA 1GSNA 2RDXA 4E4PA 4RL3A 2GJXB 1EJUC 2J79A 3TYCA 4H7CA 5M17A 1Q13A 3AJXA 1A5MC 4K38A 4V1XA 4NZ3A 4HMDA 4LYPA 1VEMA 2ZWZA 2VHLA 3N4AA 3BAXA 4WHBA 3THUA 3NL2A 5CJNA 2QCNA 1MEHA 1CENA 4WK9A 4JCLA 1GOIA 4TXEA 5K3VA 3USZA 1Q6RA 3SRFA 4UNIA 5A3HA 1DJIA 1JL8A 2QR6A 3PJUA 2VX5A 1NDAA 1TELA 4HBKA 2VXNA 3PZTA 3SURA 4A3RA 4FX6M 3CV7A 5KITA 5CBIA 3AYVA 4DHGA 3EOOA 1V97A 4XG1A 4LSBA 2HVNA 1VFTA 1NH6A 4W8AA 2J8TA 3BXWA 4INFA 3MUZ1 4KCWA 4Q4SA 2D23A 4MWAC 1SFSA 1LLOA 4QNEA 4O52A 1F2JA 4F0RA 1SZFA 4ROPA 4GRTA 2QAFA 2D20A 1TTJA 3NUKA 4IPLA 3AQUA 1C8VA 1IZJA 1VENA 3PVFA 2VEFA 1DXIA 2ZC1A 4DZIA 2QJJA 2R6OA 5DRIA 5XIAA 4NZJA 1MRAA 4CU7A 2PDIA 1XLMA 4FDCB 4CU6A 3GE7A 1JUEA 4MOZA 2AOSA 3O6AA 1LG2A 2WVVB 3E2QA 1Y0EA 3ZVHB 3HQPA 4IGSA 1JZ6A 3MCOA 1RK6A 4ZOCA 1CDGA 1Q4WA 2PDBA 2WCGA 2WMIB 4QTGA 1LUCB 5HJLA 1NF7A 2INFA 3CB3A 3EKZA 2VL4A 4AWUA 2NQJA 4FK9A 1TVLA 4JIPA 5REQA 4GVFA 3BO9A 4ZSTA 1JZ2A 1XHCA 5T91A 3UY8A 4BI5A 4A4AA 3DX5A 3TZNA 4GC3A 3PSVA 2INZA 4KEZA 1OSEA 2X09A 3UG5A 4MPQA 2RHGA 4HSNA 3WDQA 1T0OA 4AEOA 4J4KA 4K7VA 2HNHA 2OR2A 2NV9A 3NL6A 3BV7A 3CS2A 1I2NA 1U5JA 3BG5A 4K8HA 2BMBA 3A4AA 4KCTA 1G4TA 3KOZA 2X8GA 3VU2A 3S6DA 3U4FA 3M07A 4FMVA 1XYBA 3ANYA 4HOZA 5IOBA 2GR1A 2GDQA 3ZT5A 3HA1A 3HOJA 4NVTA 5HMFA 2CLHA 4OWGA 4O11A 3H4XA 2FDSA 3GH4A 4JS3A 3I7QA 4JEQA 2DGAA 4OQVA 4GYPA 3MSGA 5SWUA 2ZZ3A 3P8IA 1QOPA 4FIQA 3GS6A 2BVTA 2CITA 3URQA 2EJAA 2YA0A 4JL2A 5EBUA 4E3VA 3RX3A 1JEZA 1JNEA 3OOQA 1PL9A 1E6XM 4FF7A 2VDIA 3IUHA 4JR5A 4FX7A 3H8AA 3VX1A 1R7AA 3HPXA 1YX1A 3GR4A 7REQB 3A7RA 4LU0A 4LY4A 1QNQA 4JTLA 1PZ3A 2WK2A 1M03A 2ZZ4A 1W3JA 2CESA 3GH7A 4BR1A 3KOXA 1FHVA 1XLIA 3AHYA 6TIMA 4DJDD 3OVQA 1HVQA 3WSUA 3LPOA 3HMCA 4HNTA 1W32A 1V6TA 1S5MA 3CUZA 5F2LA 4BKNA 3QY8A 3UWWA 4U31A 5C2XA 3VYLA 2PDFA 1RZMA 1UP3A 1OFBA 1M6JA 4AVNA 3E74A 4MJ2A 4CQBA 1AG1O 4W85A 2BGSA 2YJQA 3FXGA 3VIGA 5I07A 4JCMA 1A5UA 1V3KA 2GGHA 4D6CA 3EWZA 3P2VA 4GH3A 4JDYA 3LYEA 4Z17A 4V33A 3LRMA 1A0CA 1R38A 1HZYA 1PHWA 2XINA 3V5FA 4DM2A 3BSHA 4CVUA 2ISVA 4RW3A 3ABOA 3VM5A 2RAGA 3O3RA 1MXGA 4Z1BA 1XBZA 3WJSA 3FA4A 1SZEA 2PE4A 2QKFA 4A8IA 3II4A 1EYEA 3ME3A 2POZA 5GJNA 5FS8A 4JFTA 3NQMA 3KBWA 4O18A 2WHJA 2Z2UA 5GRTA 1UC4A 3GUWA 3KRZA 5LXEA 3TIMA 1JJKA 1RA5A 3EPNA 3AS3A 4J5NA 1PKMA 2X0HA 3QPEA 4ICNA 3TTOA 4AZHA 3KDNA 2CZ5A 4J7RA 4IIEA 3CNYA 1NWUA 3QV8A 4H41A 1V8EA 4XUGA 2HRWA 3OHIA 3CAVA 1XICA 3WK1A 1IXPA 5GNXA 1PDZA 5KZ6A 1HF6A 2VOTA 3R0DA 4HA1A 3VOJA 5CPQA 1Y5XA 4IFOA 2PDXA 1MW0A 4Q6XA 3TP4A 3AFBA 1ME8A 5JXQA 1QHZA 5TBOA 4Q4KA 3R8GA 4AWSA 2CETA 1WXZA 1DOSA 8A3HA 1JPKA 1G7VA 1OQFA 2ZCGA 4Q4OA 1ICQA 2GVYA 4YMZA 3WD0A 3UPMA 1HW6A 2BODX 5CC6A 2XWEA 9XIMA 4JTJA 1N7KA 2XWDA 2NQLA 1L8NA 1GXFA 1WZKA 5A8GA 3MUCA 2O7QA 4CQ9A 1RH9A 2PWDA 5JU6A 2PZ0A 4LUTA 4GXWA 4GWEA 1OGGA 3M0IA 2QF8A 1ZB5A 3GO2A 4OVXA 4GCXA 1F6YA 3CGTA 5I3FA 2DZXA 4C65A 3QPYA 4C6DA 1UD8A 4LYQA 1VBJA 1BYCA 3FSTA 4KQNA 1LOQA 3AWNA 2EG8A 3QN3A 1OABA 4MAVA 4UQEA 4LC6A 3BCJA 1AH3A 3SB0A 4CCEA 2V5LA 3LCWA 2ICSA 4JBRA 1EP3A 3V75A 2QCCA 3MZ2A 4F40A 2PS2A 2FZMA 4M8UA 1QI5A 1U83A 2J7GA 4J28A 4R7WA 5CSSA 1GRTA 3WLQA 1ZK7A 3PG9A 2HBVA 4LB4A 4Q7BA 3T9PA 4LIIA 1XHGA 2OKTA 3DJGX 3SCVA 2TAAA 2NXIA 3PG6A 1KN0A 3TC6A 4ALDA 3KP0A 2E9LA 2ZUWA 3N18A 1GREA 3ZJ8A 4FNRA 1EWEA 1H1NA 2QGYA 1BPLB 5PTDA 1TWZA 1XIIA 4GH1A 3AALA 2Z4GA 2C3DA 4BZYA 1P4CA 2C7FA 1F61A 5JUVA 3TC7A 2X8RA 1B57A 4D6JA 5DCDA 3O2LA 1Q85A 1I2QA 4XTDA 2WMHA 4NNBA 1TCDA 1R7OA 2ISDA 2A85A 2YQUA 3WELA 1OT2A 5DQPA 4XUYA 5E9AA 1BD0A 3GU1A 3IGSA 1HT6A 3I4EA 2Y1HA 2R1NA 4KGJA 2J77A 1BXNA 4CD8A 3GXFA 3VNLA 1BYBA 1J6OA 3NIYA 4BURA 2DIJA 2VCAA 4GGHA 4ZFCA 2GQAA 4ATLA 2C79A 1FWHC 3F2DA 3M6DA 4ZSUA 1DWFM 2HK0A 1JDDA 3G8EA 1UOZA 3UESA 1D8CA 5F4WA 1MUCA 1X1NA 1IXOA 3HQNA 1BWLA 1CGVA 1XCWA 4UFLA 3KBNA 4AMAA 1M53A 1S2WA 4K7ZA 4E4UA 3QVQA 2QYGA 3LDVA 3R07C 3THQA 3DXIA 1I75A 1TPVA 3N34A 3WLPA 3T05A 4XO7A 3B8WA 1ITCA 1UP2A 4D9PA 4RE4A 3B8VA 4O1BA 5L9FA 4YHEA 2D3NA 3TYBA 3LZ3A 2A0NA 1BVZA 4NJIA 1A53A 3BLKA 2W79A 1PXGA 3UG8A 2J7FA 4CN4A 1BGAA 2YKKA 4KF1A 3I3EA 3POCA 2FTPA 4O8AA 4RV3A 1R46A 2KX9A 3MV11 2RGMA 2WM1A 1F3WA 2GLKA 4W9TA 2GWGA 1E72M 1VJSA 2Z29A 3RGTA 4C6QA 3LXDA 2WC4A 2IKJA 3A3WA 3V3WA 4R88A 3MTWA 1P1MA 4LA1A 4GUHA 2OOGA 1W9XA 3H70A 3EKGA 3N3MA 4R9OA 2WXDM 2ZFAA 1EZ2A 4NZCA 3WY1A 1K9FA 3MSYA 3W7NA 3ARTA 3PC0A 1W1A1 4AZ5A 5U25A 5ER0A 3W71A 3MMWA 2ALDA 3L66A 2YFOA 5AHEA 4GPNA 1K77A 1G6CA 5EB8A 2BOGX 4MWAD 2E0PA 2X0SA 4UCFA 1OM0A 4HKPA 5I06A 1TRDA 1E0WA 3BCDA 2Z1SA 2EBNA 4M80A 2L5HA 3CWNA 3IAQA 5F4SA 2DZSA 3SUSA 2DVXA 3IPWA 4HMEA 3W84A 3EPOA 2VR5A 3GZAA 3W37A 3KWSA 3CXBA 4AH7A 4X60A 2A21A 3UWVA 3STCA 1TZ7A 3W3OA 3G0SA 1WAWA 1W1VA 3AIUA 1E0TA 2F2HA 4YWIA 1T8XA 1EKOA 2YL9A 1ZALA 1BRLB 3RK8A 2EAWA 5FSDC 2BXZA 2VD8A 5A6BD 3DHPA 5B80A 1V3JA 3OLIA 4FLSA 3IJ8A 5G5HB 3VINA 1P7TA 3EPMA 1AD4A 4M6PA 2OQYA 4IMCA 4MLRA 3TQKA 3P8JA 3S47A 1LOLA 4Y9MA 3VUPA 5G1YA 4DJFC 1KM0A 3UPBA 2ACUA 2WMKA 2V3DA 4ACZA 4XAZA 1CXEA 5ABEA 3IRDA 4UR7A 4DX3A 1ZXIC 4PUJA 4Q4RA 5C7HA 4E8CA 3SECA 4W7UA 3MUXA 3BQ5A 5C9WA 4H8HA 1TV4A 4PUMA 3P5ZA 1W0MA 3H12A 3NTYA 3PTKA 3PZOA 4TX8A 2C1GA 3UU0A 1VJZA 3BMWA 4J2MA 1KBJA 2UV8G 2ZE3A 3SJ3A 3WH9A 4S3JA 1WKFA 3L67A 5HDRA 5T8GA 3W9ZA 1E3XA 1GKRA 4PMXA 3S2CA 2NT0A 4X3ZA 1OEPA 1X6LA 3L0NA 4RNFA 3R12A 4E8DA 1J4EA 1OFPA 5HBFA 1SFTA 2QPXA 4HP5A 3W7CA 1T8QA 4QLJA 3HTWA 1LOSA 7ENLA 4LV9A 1IXNA 1GVYA 2P5NA 4H4RA 3MCNA 3VOIA 4S3KA 1O5QA 3KTCA 3TCEA 1O12A 5FL1A 2VT0A 2YCKX 4PMZA 4EX4A 3CQJA 2O9TA 2CHRA 2WM0A 4JY8A 4PR4A 3CZEA 3UR8A 2JBMA 3V5CA 2PDHA 4GKLA 3AS1A 1D9EA 3KBVA 3W7PA 3WDRA 2VGBA 1H0IA 4HOXA 1ZBCA 3R89A 2ZADA 1UWTA 4XSMA 3T4CA 2VGFA 2E5CA 5L6UA 1Y5WA 3STGA 1KRCC 1E4LA 2Y8UA 3G0XA 4JY9A 4DLMA 3W4RA 1VBRA 1M7JA 3TK7A 4OFCA 3UA4A 3GH5A 1EJRC 4IF2A 3T2OA 1PIIA 2BBFA 3NVDA 2CZDA 4PUUA 2QUMA 4NJGA 3Q6JA 3C2YA 2PBOA 3CHEA 2NVKX 1YW1A 4J3XA 1FWNA 4IJBA 3AMDA 1QCWA 1YYAA 1YQZA 1DVJA 1UKTA 1H09A 3LPFA 3TSDA 1UIOA 1PZ0A 4Y9NA 1B4EA 3FX4A 1EC7A 4GXMA 4M6VA 1O1HA 2E40A 3LSCA 3E0VA 4C6KA 5BOOA 2XGZA 3SW6A 3L12A 3L23A 2Q8LA 1WPCA 3P6LA 3U57A 3V18A 5A2AA 1RCOB 5D2YA 2W4XA 5F2IA 3JZEA 1V0LA 1HXJA 4IFKA 2IPFA 4EQSA 2WP6A 3P5YA 1O5KA 4R53A 3ABRA 4MWAA 2QCDA 1UHVA 2E6FA 2R1PA 2V3BA 2VM8A 2E5AA 1J93A 1S5WA 3EX4A 1OF6A 4XO6A 1XLBA 5D8WA 4M6UA 5KTLA 3KLJA 2E77A 1VB9A 4FLQA 3S2LA 3H6OA 4BF5A 2ZVIA 3L4ZA 1GHSA 2GSHA 1ZP3A 2GSJA 4RPPA 3A5VA 3EAOA 1U5VA 1ENUA 3LBCA 3CWOX 2IQDA 3WUEA 2CHOA 4GO8A 2E3ZA 3TROA 2VZSA 4M56A 2A3CA 5AECA 3WLJA 1ZRQA 2G50A 1QAPA 3DG3A 3NA8A 4HT3A 5G5IA 1G69A 1EZWA 3FS2A 1G5AA 1ZLPA 3KOWA 4H19A 5BROA 4N9EA 1EH9A 3W53A 3BMXA 3OHMB 9XIAA 4PFHA 1LYXA 3R11A 1DJGA 1WDSA 3LGDA 1TVNA 4YIWA 1K8XA 3R8HA 4MNMA 1NFGA 3D3FA 1EBDA 3I7SA 3WDPP 1UASA 2FIQA 1H51A 1W3HA 4JTQA 4Q4PA 4P7OA 4XV0A 1W3NA 3F1QA 1IEVA 3CZKA 3PZQA 4NU7A 5BYWA 1FWGC 4GI9A 1A50A 2W61A 4Q8UA 5I78A 4M1BA 3LENA 2P3ZA 2FFIA 1Q1RA 1SVDA 4J3WA 3N6QA 2C15A 3LRLA 3PZIA 2XN2A 5AYYA 2CLIA 3TN6A 4GJIA 3AU2A 3BZJA 3QFWA 1SUXA 3NQ7A 3STFA 3VD4A 4NI8A 4GUJA 3VILA 4JIEA 1Z42A 1FP8A 2GRTA 4B5SA 2F84A 1E51A 3LPGA 3V0UA 1WV2A 1L2UA 1VCVA 4TU1A 9CGTA 4O16A 2VURA 2Z1KA 2QDDA 5HWMA 4H50A 1D7KA 3MBDA 2W27A 4RE3A 1KTCA 1XXXA 4GFSA 3DGHA 3L5AA 1S1RA 4K7YA 1B30A 3S5NA 1XH1A 3VGBA 1XCXA 1UA3A 3G1XA 2GR2A 4M7SA 3VNJA 1CIUA 1HN1A 4DZHA 1YPIA 2NUWA 5DMNA 1TZ9A 3IVSA 2RUSA 2ZWYA 3ONCA 1M3UA 1X8CA 3CAQA 1Q6DA 2XYLA 1VPYA 5DF0A 3B9OA 4C6PA 1B3VA 3MCMA 3MHUA 5D8ZA 4A21A 3KFTA 1UG6A 5REQB 3O8AA 1ZSXA 3PZNA 3BK0A 2ACRA 2EPHA 2W0UA 2VYOA 2QUNA 5T26A 1V4YA 3PHAA 3ZIZA 4KRTA 2Q3RA 3MI3A 3CT2A 4MB1A 1A3XA 1PKNA 3KAOA 3GTFA 3WLSA 4EXBA 3IVTA 1LTDA 2TODA 2PGRA 4WGXA 1ZHAA 3BMVA 3E02A 4ZEPA 1HKMA 2J75A 1QNPA 4BWLC 1JYNA 3CM4A 1FCQA 3EB2A 1WDPA 2Z7KA 3VFLA 2D2JA 4UQAA 4D2JA 5A5WA 2OT0A 3FFSA 4DZAA 4GY0A 4DLFA 2Z6IA 4RXGA 1K6AA 3CPGA 4E6MA 2PLJA 4AIUA 4PMRA 2QV5A 3C6CA 4YTSA 5I3JA 1FQ0A 1VFOA 1OC5A 4ML4A 5I02A 3C2OA 4KBXA 4AZCA 3QW4B 1YKWA 1F7BA 3U5YA 4LS0A 5LA0A 1GJWA 1XDLA 3V35A 1FH7A 3MANA 2IKIA 1TJ1A 1XIMA 2Q01A 1D7YA 2OU4A 3DFOA 4J9JA 3DFTA 1TRIA 3DI0A 3RX4A 5HJXA 4AD4A 4RZ4A 3B0UX 2RGLA 1GRAA 3C3UA 2PP1A 3H4WA 3WKZA 1IT7A 1XGZA 3Q65A 1JCYA 1PEZA 1UKOA 2F6KA 2ZUTA 4WEVX 2HS8A 1J2WA 2HJPA 1GNXA 2YDAA 3E0WA 3DFNA 1I2OA 3NQDA 3EANA 5A8PA 2C19A 4MPKA 3AU6A 3T0TA 3S1XA 1ISYA 2MNRA 1WA3A 4HZ6A 4JEJA 3RFAA 2FZ9A 1UA7A 3T44A 3E9AA 1W5PA 1EIXA 2ZZ6A 1ZJIA 1NAL1 3A64A 1ZJAA 3TWAA 3HURA 5IDZA 4QJ1A 3ZJ7A 4MB4A 1Q4NX 1IV8A 4C6IA 3UVIA 2H8XA 1TPEA 1BWKA 4KWUA 2ZXDA 4BEUA 3EA1A 1JULA 1U30A 3PM6A 3ARZA 2BLEA 2XN0A 4HTBA 4CD6A 2CLMA 4LS1A 5AN7A 4AZ6A 2PTZA 5LSMA 4DJFD 7ODCA 2R9RA 5CPMA 1XIBA 2GK1A 4RXFA 3UBPC 4HN4A 3QMSA 1RJRA 3T07A 2GVLA 2CBVA 2CKRA 3ITTA 4RKAA 2OWXA 3UY7A 4MFEA 1CI1A 4KWWA 2CEQA 4KPLA 4M1RA 4EXQA 3NGJA 4N9CA 3H2MA 4D8ZA 1CXFA 1TE6A 1D8WA 4HSHA 3E2RA 3ERPA 1UZ1A 3E5PA 3NPWA 1QWGA 3FKRA 1XRVA 3WJZA 4IH3A 2YZRA 4Q8VA 1CXKA 3H26A 3QGAC 3OGSA 2W67A 1KQYA 3TONA 4RNHA 1XLLA 4QHRA 1XJBA 3B03A 3VNKA 4B5TA 2B31A 2XH2A 3VGDA 5HOSA 1DBTA 1G7UA 1KCZA 2PUZA 2YA1A 3N9KA 5CEWA 1PCWA 1VF8A 5FJIA 3GNDA 2XFYA 3AI0A 1JUKA 1ELSA 1ZX9A 2VEPA 1TJ0A 2GZXA 2QCFA 4LUTB 1Q65A 3HW2A 2YBTA 4Z2KA 4PB3A 4A3HA 3IUDA 4DF1A 2W0HA 4IL0A 4AY8A 2ACSA 1H7RA 4ZE4A 1XWYA 3QZEA 3VKCA 3PPHA 3FJ4A 3VKJA 1B0IA 3VI2A 3NQ2A 4ADSA 5A8MA 1FX6A 3GIYA 3AMZA 1BZLA 3HPFA 2OELA 4GGBA 1F6PA 3H24A 3O1NA 4DJEC 3VIPA 3VCRA 1VFUA 4L5ZA 5MHBA 1S46A 2EGZA 4EOUA 1PX3A 4KERA 2PWEA 3TN3A 1LDCA 2OLSA 1MW2A 3H7VA 1Q7MA 3RRXA 1OYCA 1LRTA 1RLCL 2PURA 2X99A 1P43A 3AXIA 4QFUA 1QMLA 4ACYA 2QUUA 3MI6A 3DEQA 2Z25A 4DBWA 3WD1A 2FLIA 3SDOA 3A47A 5E5CA 1W6TA 5DEZA 1AW2A 1H49A 5DY2A 1GQJA 4AU0A 1FWJC 1ZFJA 3QM3A 1YXCA 1C29A 1ME9A 4JPGA 5H8PA 2VX6A 4S2CA 2XVLA 4RNIA 2VQTA 3PP7A 4A05A 4TVUA 4LV4A 4AHPA 1TYTA 1PDYA 3QKZA 4V15A 1H2IA 1EYWA 4JQ2A 1R3TA 4YTUA 4O28A 1QOXA 4HCLA 2ZKMX 4IPNB 3FG2P 4JX5A 5AYBA 3EWBX 1SW7A 4IMAA 1RBOB 1BVWA 3L21A 1MNSA 3MMDA 3WUGA 2Y8KA 3TXVA 3AJ7A 6A3HA 1DV7A 3VA8A 5CC5A 4IT1A 3CZ8A 3IJ6A 5H91A 3EYPA 3AIWA 1BWVA 2XU2A 2C6QA 3VDCA 3P67A 4C6OA 4AVFA 3JS3A 5D9OA 1WKDA 3NQVA 5I03A 4Y9AA 1KV5A 2CERA 3B9NA 1I1WA 4CEXC 4YL2A 3GTXA 3E0IA 1OD8A 4I3GA 4GZIA 3AHZA 4XVDA 4UWMA 2D0HA 2R1LA 3W25A 2ZZ5A 2ZUMA 3M7WA 3VK5A 3MUY1 3MO7A 3VIHA 2JKPA 3BV4A 5D33A 3ABSA 1GZJA 3P74A 1W31A 2QJHA 2CU0A 2D69A 4O19A 3REQA 2DSWA 3V0TA 3G3MA 4PEKA 1OGSA 1FP9A 1VHCA 4MF4A 1RCXB 1YRRA 2WQPA 3KRUA 4HJFA 2G8ZA 3CBWA 1W1IE 3WJYA 1ZENA 2DH3A 3MMUA 4ZXLA 2PD9A 4WDUA 2JGQA 2XVGA 2PDGA 3UZWA 4CKQA 1F3XA 2IPJA 5GQBA 4AXNA 2PDLA 1V02A 2D2GA 4KWOA 1MO0A 1AL8A 1ISXA 4Q7NA 4GIAA 3OO2A 4I5UA 3VOCA 1JAKA 5JIWA 1SO3A 2YW3A 3BG9A 1HGWA 2CXGA 4HYVA 1RP8A 3FGCA 3VZZA 1N5XA 3CQHA 2VEIA 3Q94A 3S1UA 3TDFA 1MUMA 2GH5A 4V2XA 2FPVA 3AISA 4E2VA 2HS6A 2PI6A 1KFEA 5FAJA 2OQLA 1ZCOA 4Q8OA 3HZ3A 4NF7A 5LIWX 3F2CA 2UBPC 4PBFA 4JTEA 5I3IA 5FEWA 4LPCA 2JKAA 3GG8A 3HPAA 3DU0A 3GTHA 1LT7A 3DYMA 3LV5A 4HMNA 5C9UA 3C56A 1QNVA 5EMKA 2PC4A 1LJYA 3CMFA 3OVGA 5FF2A 3CT7A 1VIWA 1XCFA 2W91A 3PBVA 3C2VA 3ITLA 3UR7A 4DWSA 3ELFA 3R5EA 5LGXA 3IIOA 3LB0A 3QYQA 3CMGA 4B9ZA 1P7TB 2VZOA 1HX0A 1O66A 4HU8A 1FWDC 1UR9A 5MF5A 1IE7C 1AQFA 5C71A 5JVLA 2GVGA 1MRQA 1R3RA 1JFXA 4ACZB 3DCPA 1GPWA 1T96A 2F9RA 1JF5A 3AS0A 4XZWA 3KCLA 2PDYA 4XZNX 4L65A 1QBAA 2V2HA 1BF6A 3M0MA 3FYPA 1AJ2A 1K4QA 4RE0A 1V77A 5E6ZA 3SO7A 1JQXA 3MHFA 3VD5A 3DIPA 2V81A 4J40A 5CH9A 1ODUA 2Y63A 1BQCA 1K3UA 4MNJA 3LCFA 3NR0A 2QJGA 3CYVA 4HYWA 3TMQA 2O4MA 1EDQA 1UOKA 4RE2A 3TR9A 4JQ1A 1K9EA 1MQQA 3OQEA 1JCNA 4JIIX 3PZGA 1LM1A 5KVHA 4LH8A 4UNKA 2G5WA 4PE8A 1H63A 3U48A 5JBEA 4Q33A 2TPRA 2NXGA 4LAUA 3FW6A 2GQWA 3DN5A 2EQ7A 4JQ9A 3T42A 1XFCA 2OZ8A 4F0MA 3ZXWA 3WQPA 1F05A 3BLDA 4IOTA 5FJTA 3IRSA 4GBUA 1W3IA 3DC0A 8XIMA 1W9BM 2J7EA 2WOQA 1YDNA 2CC0A 2VRJA 3VTRA 3O06A 1G67A 5I3DA 4UR8A 4C6NA 4WD0A 3TX9A 3ZQ9A 3EB3A 4L7ZA 3QOMA 1Q6OA 1U2YA 4B9YA 4JNZA 3VCNA 1TUXA 3DI1A 3IJQA 3RITA 2V30A 4WF7A 2V5KA 4TTUA 3FHAA 4GFIA 3U6WA 3ZSTA 1LCOA 1OYBA 1MQRA 4GD0A 3GXDA 4O1FA 1WYIA 3PBGA 3AMLA 2PPGA 3TTEA 3KLLA 4D8AA 2QDGA 1GONA 3S1GA 2YL8A 4NAFA 2A1YA 3F7JA 4HYRA 3HG5A 3O6CA 4P7QA 1PJ9A 1SPQA 1WXYA 4S38A 3N04A 3SSJA 4CD5A 4CLMA 1M5WA 3LADA 3NWRA 3W7HA 2OYLA 2A7RA 2QNEA 1J0JA 1SJCA 2ZZ0A 1R3QA 2HMCA 1EWDA 4IL2A 3SQLA 3KVKA 2O92A 3WD4A 5AC8A 3A21A 3RCYA 2I5IA 1X6UA 5DMYA 1CPUA 4LJ3A 1JYXA 4IFKB 4HK7A 4HNUA 4WKAA 2V5JA 3W70A 1PWLA 3EWXA 2FJUB 3LXAA 1PZ1A 3NVZB 3A22A 1SJDA 4MWAB 3FVDA 2QCDB 3BSMA 4IIHA 4I8DA 5FSEC 3FSUA 3L65A 3S8HA 2QULA 1EXPA 1V0MA 4Z1YA 4IHCA 5A69A 3HO8A 1E6PA 1V79A 4IGNA 5HNUA 4HJWA 5D05A 3EZ4A 1H61A 1UYQA 5AHMA 1JZ8A 3M16A 5GNYA 3CK5A 3XINA 3V7PA 4YWOA 4WDWA 2JEPA 3W87A 4PUDA 3UETA 3W7MA 2EPOA 3MWCA 1R6WA 5BWAA 1IGWA 3NQCA 4K3ZA 5BXTA 2GUUA 2IQTA 2YXOA 3NPXA 4HNOA 4UTJA 4RR4A 1J6PA 1FWIC 3VE7A 5B7YA 4O14A 3WLNA 1A3WA 3V36A 4O54A 3THCA 1XQKA 1F6KA 1M7OA 2J9XA 3WENA 1R3YA 4MZYA 1TJRA 3WFZA 7CGTA 4NZ1A 4WCJA 3M6YA 5GVJA 2FVKA 3CMJA 4ZO9A 2BB0A 1FWRA 4HHLA 1FH9A 3DGBA 1RPXA 1YEYA 4WRHA 4LAOA 1IXQA 3GDTA 2HVMA 4X2RA 1KB3A 4XK2A 3DHDA 1ISWA 4QS5A 4NG3A 3T0BA 3QY7A 4AMCA 3O0HA 1QNRA 2VZVA 3LQGA 1EPXA 4P8WA 3MMTA 4UTIA 3ZVHA 4DI9A 3DK9A 4RLIA 2FYMA 1KW1A 3GNNA 1LUCA 2NQHA 2XM1A 1FWWA 3A12A 3ISIX 4L1XA 2WPGA 1E4IA 3WLIA 4AEFA 3LLDA 3AZSA 2BFGA 2W63A 1XYMA 5EU9A 1H2JA 3FYOA 3II1A 2BWGA 4EMWA 1ADOA 4DJED 2QMKA 1MDLA 3S9ZA 4TMBA 2WMFA 1ZGDA 3GAKA 4AD5A 3AN1A 3W7EA 4L1GA 4MUZA 4DXKA 1HP4A 3LHYA 4QEHA 3QZ6A 2WZTA 4H4PA 1AL7A 1UKQA 1R87A 1Z69A 4US5D 4TO8A 4CGTA 4PSRA 1WBHA 2SFPA 3WNLA 3LA4A 3VD7A 4GYKA 2G97A 1BTCA 3NSXA 3BZGA 1OG6A 1S3HA 2X2YA 3TYAA 1A5AA 3EX1A 4F0HA 5FOOA 3GNOA 1JI1A 4BHYA 2ZXBA 1EC9A 1WOAA 4JN6A 1NP2A 3GUGA 4M6QA 3QGVA 2OJPA 1SW3A 3FHQA 4GIRA 4K8GA 1UKSA 4J57A 4TV5A 2OPJA 3CXOA 4JX6A 1UWUA 4UTMA 3NDOA 1F3PA 1ITXA 3ES8A 2F6XA 3B4YA 5FS6A 5BW6A 3VNMA 3TR2A 4MMWA 2RFGA 2H3DA 3CL6A 4LS2A 4JGDA 3TOPA 1ZKQA 4L4LA 4WSJA 4TUFA 3BCFA 2DZWA 1MQPA 4O1DA 5LIXX 2QDEA 2A3AA 3CUFA 1VYRA 3B0PA 4P2VA 5K2ZA 4Y6GA 3W29A 4JIQA 3A4XA 1W2PA 2WMGA 1GETA 4Z0SA 4EF8A 4WJ8A 2O0TA 4M52A 5JRBA 3H23A 3GHSA 3PPGA 4ZQCA 2J78A 3TKFA 2NWSA 1XDMA 4MWAE 1VZWA 1DJNA 2HQAA 1FWCC 1ALDA 2DZAA 2ZRWA 1Q6QA 4D6FA 2Y7DA 3FKKA 4C6BA 1UD4A 1HKWA 4AZBA 3UXLA 3FVMA 3WBYA 5G1MA 3K30A 4W93A 5IFPA 4PMDA 2I5GA 4W87A 3H2CA 4GY1A 3MP4A 4QE1A 4JAWA 1B1YA 3IJDA 4AZCB 1ITQA 3N2BA 4HCDA 3V1PA 1UH2A 5F2MA 4HPXA 1XH2A 1LQ0A 4ZA0A 1P5BA 3CH0A 3CL7A 4ADUA 3W24A 4AZGA 2D1ZA 2HE8A 3NZRA 3GKFA 1IYXA 3HGRA 1OFDA 5TQLA 3UW6A 5CPOA 3T0CA 4LANA 3ATYA 5KSWA 3NRZB 1XQLA 3TC3A 1TMLA 2VDGA 3OPSA 4ML9A 4J1OA 4ZZ9A 3CHCA 3SR7A 1FIQB 2BOEX 5F4XA 3OIHA 3V4BA 5DLCA 2DP3A 4D6EA 4IXXA 3KCOA 1I2RA 1GOWA 2OXNA 1Q66A 4KCVA 3L5MA 4TR9A 5HXMA 2EQ6A 4JTSA 4N4PA 2AAAA 3RDKA 1ECEA 3PBMA 2I17A 1K9DA 1SU5A 1IIGA 1QI4A 3DK4A 4JZ5A 5IFTA 1TZZA 2QZRA 1TPUA 1IR1A 2HBXA 3SCTA 2YIHA 1NP0A 4XZMX 1T5AA 1R85A 3B97A 1B3OA 1N8WA 3DFYA 1JDFA 3C0QA 4HPNA 4YVXA 3VAVA 2A3BA 2YA2A 1TSIA 4JQAA 1V7YA 3PNUA 1TPFA 2OO6A 3LXCA 4FS9A 3K1GA 1XD1A 3BJSA 1E4MM 2QAEA 2GK1B 5A94A 4XAPA 1RA0A 2X50A 3MS8A 1IR2A 2V6AA 4KKXA 5KETA 1EF3A 5JH1A 4MKNA 3E2SA 4WKFA 3NGFA 1TWIA 2Y5EA 4QDWA 4US5A 5H8UA 1X2GA 3CASA 5A6AA 4JIRA 4H9MA 4ZB0A 1NOUA 3KOFA 3KZSA 3RUBL 4S3GA 3ZLHA 2XVNA 3PUDA 3P3BA 4V28A 2PRLA 2E6YA 4KFNA 4ZOBA 4BF7A 1RVKA 3RM8A 2R82A 4L9XA 4HZMA 2BY3A 4G1NA 1XP3A 2PF8A 2X1IA 1FCUA 2JK6A 2ISSA 2XGBA 1KGWA 1H5VA 3QEZA 2A2IA 1MMFA 4DUXA 4MB3A 3BW3A 3VDGA 3NXFA 5C70A 4PMVA 3N3TA 2W66A 3S0CA 1X96A 4IGMA 1JRBA 2FFCA 2PRMA 3BL3A 3NOEA 1E5NA 5DO8A 4QXIA 5HINA 3AM9A 4FSAA 1F76A 2A79A 3MO4A 4URIA 7XIMA 1M04A 2AAQA 1XYZA 3WQFA 1XSIA 5AFDA 1XFBA 2ZUSA 4I8YA 4NSBA 1KFWA 1X7FA 2X2GA 3WK0A 2EQ8A 2E5DA 2Y8VA 3CLMA 3WEZA 4JKMA 3GW0A 5HMDA 2DDXA 3RU6A 3HG2A 2W3SA 2Y62A 4UBPC 1GZGA 1PAMA 4D1JA 5KZEA 2AMXA 3NQBA 5J8LA 3CGEA 3G1YA 2YLLA 4M51A 2P3EA 3UERA 4J3VA 2O55A 1RCQA 4CQ8A 1NARA 3QSRA 4NJHA 3PNZA 4WR3A 4IIGA 1TUFA 4GA8A 2XIBA 1Y5VA 2WKGA 4O12A 1CXLA 4XB3A 1SM9A 3WMBA 3G1VA 4OBRA 3N14A 1MO9A 3M0JA 1CZ1A 3K8KA 2RABA 2Z2AA 3D0CA 4M82A 3SEPA 5F1UA 4Q3MA 1FFUC 1J12A 2CYGA 3WUFA 3RNMA 3NZQA 2Y2WA 5EGRA 3BLPX 4ORMA 3H2AA 2KZHA 2OVLA 4ZQPA 5DMMA 3W26A 1VDVA 4PBEA 3RR1A 5C9RA 3TQ0A 3THAA 1AMYA 3XIMA 3U0HA 2CLLA 1PS9A 3L4UA 3F5LA 1XLFA 5HNNA 1E1EA 4RJEA 3MWAA 5CG7A 1J5SA 4WXYA 5ECUA 1S2UA 3ARUA 3SCNA 1Q7ZA 1GQKA 1D2KA 1T41A 8RUCA 3T09A 4BI7A 1F8IA 1ZMCA 3AO0A 1GCYA 3AZRA 1JG9A 1JNDA 1ZZMA 2Y7EA 3BOXA 1W3LA 4AX6A 3SCPA 1EJWC 3ZJ6A 2Y0FA 1ZU8A 2KAUC 1XYLA 2AQWA 1SGJA 3GBDA 3M64A 1A5NC 1NWRA 3VIMA 3IK4A 4DBUA 5KVIA 3VIKA 4ZO7A 1VFSA 2I1OA 1KBLA 6ENLA 2A3HA 3GXNA 1I0DA 3QLLA 3NS1B 2YOCA 5A6KA 4L4PA 3REQB 3C4UA 3TJIA 3TLQA 3CGCA 1JIBA 3OBKA 1NEYA 3M1ZA 1BXBA 1QASA 1TVPA 3KEHA 1QOQA 1V3IA 1BRLA 4XBKA 1M65A 3UJSA 4WOZA 5H1WA 4A8RA 4DWDA 2PDUA 6XIMA 1V51A 3RPMA 3EXRA 4IIDA 3WNNA 4S1FA 2HSAA 4BJHA 2R94A 1TX2A 3AYTA 5C6MA 3EA2A 4K36A 1TPC1 1NWSA 1HTIA 1BKHA 2VEKA 3WQ5A 2DSUA 3PBWA 1P0EA 1CGTA 3OB8A 2P0IA 4DPPA 2O9RA 1OX4B 4POCA 1HJUA 3M0LA 3SQSA 1XRSA 3GU2A 3RLHA 4FOUA 4CEUC 4LGXA 3QC0A 3P14A 2D0GA 3NG3A 2W3RA 3CHDA 1AQ0A 1TJ2A 3OYZA 3WLLA 4HU3A 1U1JA 3GHRA 1GZ1A 4RNJA 5AHLA 1GVOA 1E70M 3CTTA 3HFTA 5TF0A 2YDRA 4DIAA 4FR6A 4HHHA 3N11A 2CZVA 3WN6A 4UOQA 4HMCA 4XSLA 2ZUUA 3P80A 4QITA 4H4XA 2XJ7A 4PL1A 4ZODA 2F61A 3IEBA 1EUNA 2BC1A 3KS6A 3KM8A 5C8BB 1Q6GA 4IMGA 1AVAA 4LYRA 3S3GA 3W28A 1W8SA 4L64A 4XZBA 1BSIA 3QLDA 3G6LA 2GL5A 2ON3A 3W01A 5JCMA 3EOUA 3S9IA 3BE7A 5IDIA 3CGDA 1C7SA 1BWCA 1KO0A 3N6JA 1GT8A 2CLFA 4ZQMA 1NOFA 2VFHA 2HPIA 4OT7A 2FVMA 5E09A 3LU2A 4G7EA 2ZTJA 4PTMA 1X1ZA 3FIGA 3GVWA 2X41A 3RMEA 2WJFA 1PIGA 3IACA 4DVOA 5U7SA 2QMJA 5DMLA 2PTXA 4I9MA 1NSJA 1EFZA 3TYEA 3W7RA 3NEHA 4TVYA 1I4NA 3LK6A 3UG3A 2DUAA 5DXXA 2OGJA 1E0VA 3G0UA 2O4QA 1ZAJA 3E2VA 4QG9A 2GSEA 4BS0A 2WWDA 5FF4A 3VABA 4C90A 2NV1A 4F4RA 4LEFA 4Q7IA 2B81A 1BVNP 3STPA 2FGBA 5E0KA 3SIZA 5HQEA 2V67A 4US6A 4W5UA 3WUBA 4OV4A 2YBVA 2F6UA 1OC6A 5I79A 1GQNA 1C9WA 4RDVA 1W5QA 4DM1A 2OSXA 2R91A 2FGZA 2VR4A 1TWWA 2V3GA 2WNQA 1EP1A 1VPQA 1P0KA 4H04A 1TO3A 4IPIA 5U4NA 2DSZA 3IGXA 3NJ3A 1JUBA 2I5QA 2WSQA 2A4AA 2JF6A 2FPYA 3HF3A 2CNCA 4IPPA 3L7RA 2WCSA 1LZOA 2A5HA 3UJ2A 5I24A 1TG7A 2BVYA 2BG5A 3NVWB 1RUSA 1P6BA 4QQUA 4H9YA 1FKWA 3TAKA 3OZOA 5AHFA 1KTNA 2GJNA 2WSKA 3BLEA 5GJMA 3G1FA 1GTHA 3ITOA 3P84A 2WCAA 3T55A 3DG6A 4TVCA 4JN7A 4ENLA 3WH7A 1E0XA 1YDYA 2VCCA 3APYA 1D3CA 4E3TA 1DWHM 4CU8A 3N2OA 4GUFA 1OC7A 1UWAA 4UTWA 3SCOA 1BEUA 3UXIA 4KFPA 4HA3A 4IX2A 1EO7A 1SB3B 1A5OC 4O1EA 1H60A 4IUGA 1Q7QA 4GNJA 3E1F1 1Q1WA 4EPEC 2ATMA 1KBIA 5F7UA 1ZJHA 1FWTA 1DIOA 1JYVA 1OZMA 4IPJA 4DF0A 4JXCA 1JDAA 4DEFA 3BWWA 3WLHA 3BTNA 2ZX8A 3FDGA 3SIMA 5FEXA 3NQFA 7PTDA 4AYSA 2V3AA 3ZM8A 3L5LA 3W74A 4EM4A 1FWEC 2PDCA 1WDQA 4KEUA 3EX6A 2AKZA 1XLEA 3TN5A 2VFFA 3GC5A 1XG4A 3MU7A 4WKHA 1OCBA 1XLAA 5J04A 3LOTA 4H6EA 1T3QC 1YIXA 3VMNA 3W2JA 3ARQA 2XZ9A 1K70A 1K7EA 2NUXA 1J96A 3VOGA 1U22A 1ICPA 5FJUA 4L61A 1TIWA 3PK7A 4ZXOA 3F03K 3OYXA 1DIKA 3GG0A 3AHTA 3QMTA 1FO4A 4GK8A 5DANA 1HGYA 4FNQA 1R47A 1R9ZA 4FNPA 2IKGA 3KX6A 3KUMA 3FAWA 3EGJA 4GNVA 3BC9A 3GRSA 4ECLA 3HBLA 2BHUA 2OGYA 4HPJA 3WBXA 3SRKA 1Z7AA 2XFFA 1OFOA 4UCGA 4IM4A 4QGCA 3TQPA 2DFAA 3P0XA 1UH3A 1XIJA 5CZSA 3M7SA 5RUBA 3NSNA 1CXHA 2CWNA 4ZOHB 2W6RA 3QQWA 4BQ2A 4CCZA 4B90A 1FUYA 4I9JA 3RCMA 5E93A 2IXVA 5LNSA 1J10A 1G4EA 2XISA 3CPUA 5FA5A 1A47A 1MEIA 1OINA 3EDJA 2Z2BA 3TCSA 3VIOA 1M1BA 1J18A 1KR0A 3CJPA 3R94A 1XSJA 2VOMA 4EKJA 4H9ZA 3HPZA 1Y8BA 5BU9A 2XVPA 3GM8A 2J7DA 1NDWA 3R43A 2ZQ0A 1HP5A 5BMXA 1S2VA 5EL1A 2EPKX 4W84A 4GVGA 5A1AA 4LF2A 1LL7A 3TFCA 3W2KA 1C9DA 1ZPTA 1XLGA 4YVPA 3PZUA 3PBUA 3WNPA 5HAOA 4UTKA 4EPKA 3WQGA 1CB2A 4OOUA 3GFZA 2C13A 1EHAA 4M19A 3NYDA 5HA7A 4B3LA 3DFHA 3WZ0E 5AZ1A 3ARWA 2WBGA 4PTDA 3BOFA 3NQGA 1JCLA 1CLXA 4GQRA 3MJMA 3GNPA 4IMDA 3WO8A 3ZFHA 4BFAA 3K13A 4AWEA 2PLCA 1XF0A 4H83A 2YCLA 2EEXA 1KM3A 1RALA 1FWFC 2DEPA 5EMMA 2CZEA 3GZ3A 4X9YA 1KFCA 2PU0A 3W1UA 1GRFA 2I7GA 1H5YA 4RW5A 4QCEA 3FLUA 3BGGA 3VXGA 4AEEA 4CNUA 1TIMA 2ZXQA 3PY2A 3UWQA 1HO1A 2QDHA 1NY1A 4IUOA 3KL0A 5JCIA 4NT0A 3GDKA 5CPSA 3WIJA 3T7VA 2HEJA 3PPFA 2PWGA 3MB9A 3G1SA 3OU8A 3UGRA 2WMJA 4H1ZA 2ZRYA 2DU2A 3DH9A 1MI3A 5BWFA 3BSGA 2VFEA 4EPBC 2FMOA 4LUYA 4PMOA 4QX4A 1S38A 5FEPA 4UTTC 2DORA 3S2MA 2CBJA 3IV8A 3CV6A 2P88A 4MDPA 4U2ZA 4MJ4A 2ZZ7A 4WVXA 2B7PA 3QRHA 1FRBA 3CV2A 4UQBA 3URHA 4DBEA 3CIXA 3RM9A 1HKJA 5A6TC 1QR7A 2OTDA 5LHFA 4ZQOA 1ML1A 3WQWA 2QCGA 3GVGA 5CKSA 5EFFA 4IMEA 4GI8A 4H6RA 5HUOA 1FDYA 3WDHA 1N61C 1R2SA 2GQ9A 3FN9A 4LRSA 3GD4A 4LNYA 4MVAA 5AVHA 3B0VC 1C7TA 2V63A 2YSWA 1JPIA 4DO6A 2JK2A 3HV8A 4KEVA 3ID7A 1X6NA 1UZ4A 3OJGA 2PP0A 3KP1A 1Q8JA 2TRSA 2YVGA 3UG4A 3OTRA 3TTSA 1QHPA 3UZJA 1G0CA 2WSYA 3K8LA 4IQEA 3FEMA 3PTDA 1CYGA 3F2BA 1XLHA 4GR1A 1CGXA 1VP5A 3U7VA 3CAWA 1D7FA 2VC9A 3ZS4A 4OKDA 3W1QA 1JEHA 5IHRA 4FAMA 3EDKA 5BU6A 4CD4A 4R27A 3HGJA 3VDAA 3OW1A 2B0MA 1OIFA 3O6DA 2REQA 4AWTA 3FNDA 3G24A 3TU9A 3LX9A 4B4FA 2CDUA 4MYXA 4ADWA 1UR3M 1DEDA 3WF2A 4QRNA 3ES7A 1WYGA 1QU4A 3UT0A 1EA9C 3E49A 1H6VA 4C7FA 4OE7A 3RCNA 4IP4A 1BYAA 1E1FA 4J3SA 2QVHA 3I3DA 1EJXC 1UR2A 5I3KA 3VD9A 2XH7A 3MVIA 1KBBA 3TNOA 4MZ1A 4R34A 5I23A 2XSXA 3VIIA 2PAJA 1DTNA 1DE5A 3TAOA 4YCOA 3KHJA 4ZB2A 1PWMA 2I57A 1Q3NA 3NVVB 4ROQA 1L8PA 2FTYA 1BXCA 3N9SA 4DF2A 1WNOA 4ZTYA 3DFQA 1PSCA 1W91A 4L56A 1HJWA 3S2NA 2D22A 1V5XA 2Z1XA 4AY7A 4ZR8A 1W5NA 4BA0A 1F3TA 3LBMA 3H2NA 3IGHX 2OEKA 3L2LA 4DRSA 5AC5A 4KIEA 3Q37A 1KFKA 5D9MA 5I77A 4KCUA 3PWIA 1EBGA 4CNSA 2V0TA 4AXKA 2WKJA 2CBUA 2RKXA 4E38A 2AGTA 4PMJA 4MSSA 4HNCA 3FDKA 3RNDA 4GYPC 4I5RA 4HZ8A 2Q3OA 4PZVA 4EXAA 4OUEA 1JI2A 1DJQA 1EEPA 3NURA 2PSNA 3W00A 2VNCA 1YDOA 3VCCA 2CKSA 2J7HA 4MGGA 5D4YA 3WLMA 2TPSA 3GVQA 2QVNA 3KBJA 3C5QA 2WJEA 2CLEA 5E9XA 4NYUA 4BI6A 2VDHA 1WZMA 3HB9A 4UMAA 3LPPA 3L0KA 4JYEA 5FESA 5DT5A 2AL1A 3P0WA 1QNOA 4W89A 3S83A 1DPMA 1PX8A 2HISA 2ZRVA</