1MUCA

Structure of muconate lactonizing enzyme at 1.85 angstroms resolution
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
369
structure length
360
Chain Sequence
ALIERIDAIIVDLPTIRQQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MUCONATE LACTONIZING ENZYME
publication title The refined X-ray structure of muconate lactonizing enzyme from Pseudomonas putida PRS2000 at 1.85 A resolution.
pubmed doi rcsb
molecule tags Isomerase
total genus 140
structure length 360
sequence length 369
chains with identical sequence B
ec nomenclature ec 5.5.1.1: Muconate cycloisomerase.
pdb deposition date 1995-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1mucA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1mucA01
4DN1A 3RCYA 4IP4A 4YWSA 2PTXA 4G8TA 1DTNA 2PCEA 3N4FA 4IHCA 1FHUA 5FJPA 1EC8A 3D47A 3GC2A 6ENLA 4KT2A 3MUCA 3MKCA 4DYEA 3N6HA 3R10A 4K1WA 1FHVA 2ZC8A 3EEZA 1MDRA 3RR1A 2GGIA 3P3BA 3R11A 3R25A 3TWBA 3K1GA 4E4FA 3SBFA 4HCDA 1EC7A 3IJIA 3DG3A 3N4EA 3TTEA 3TQPA 3QKEA 2FYMA 3IK4A 1W6TA 2PU1A 4HPNA 1JDFA 3DERA 2OLAA 2PGWA 1SJBA 2XH0A 4F4RA 4MGGA 3OP2A 2AKMA 2GGEA 1KD0A 1MUCA 3JW7A 3QPEA 3ZVHA 4ENLA 2QQ6A 3T6CA 3NZGA 3GD6A 3I6EA 1NELA 1MNSA 1R0MA 2GGJA 3ES8A 4KEMA 4GYPC 1ELSA 3DEQA 4GGHA 4ZA0A 4EWJA 4E6MA 2OVLA 5IDZA 4Z1YA 1P43A 2AL2B 3TJ4A 4HCLA 4MKSA 4HYRA 4A35A 3VCNA 2OX4A 3OPSA 3BSMA 2PGEA 4JN8A 3T4WA 2HNEA 3H12A 3OW1A 3NXLA 4IL0A 3UCDA 2QVHA 3MQTA 3TWAA 3UCCA 1OEPA 4H19A 2PS2A 3IJLA 4GYPA 5BOEA 2P3ZA 3MY9A 2QJMA 3DFYA 3VCCA 3UXLA 4ZCWA 3CXOA 2PTWA 2PP1A 1KCZA 3ENLA 5FJOA 2P8BA 4A6GA 3STPA 3DDMA 4GISA 3JVAA 3I4KA 2GGGA 3H7VA 2XH7A 3SN4A 4HN8A 2QGYA 2MNRA 1ECQA 3GO2A 1EBHA 4GFIA 2PP0A 1IYXA 2ONEA 2I5QA 4K2SA 2GDQA 2PODA 1P48A 3FCPA 1RVKA 1TZZA 3QTPA 1TKKA 4HNCA 2AL1A 3H8AA 3SSZA 3ZLHA 2P88A 3DG7A 3V5FA 2DW6A 2QDDA 4J1OA 3OTRA 1PDYA 3RRAA 3ZLGA 1JPMA 2OKTA 3OZMA 2PP3A 3DESA 3OZYA 3FVDA 3S5SA 1KKOA 3VC6A 1XS2A 2OZTA 3FV9A 2POZA 2MUCA 3GY1A 2PSNA 2NQLA 2QJJA 3TOYA 1MDLA 3D46A 3R0UA 4H2HA 4HCHA 3CK5A 2CHRA 3CAWA 4IP5A 3VDGA 5J04A 3SQSA 3FYYA 4IL2A 3DG6A 3NFUA 2QDEA 3SN0A 3R0KA 1TE6A 2OO6A 4Z17A 3BOXA 3MSYA 4MMWA 3V3WA 3P0WA 1YEYA 4H1ZA 3UJFA 1WUFA 4IT1A 1WUEA 3T8QA 3HPFA 4E4UA 2P8CA 3I6TA 5EU9A 2HXUA 1PDZA 3PWGA 3TW9A 3NO1A 2P0IA 3MZNA 3PWIA 3U9IA 3QLDA 2PMQA 3FXGA 3PFRA 1EBGA 1NU5A 2HZGA 3T9PA 1MRAA 5ENLA 2OZ3A 4KPLA 2XGZA 4GGBA 2PTZA 1JPDX 2HXTA 2XH4A 2OPJA 3RITA 3KUMA 2XSXA 3SN1A 4H83A 4M0XA 4KWSA 1SJDA 2OFJA 2AKZA 1XPYA 3RGTA 2PPGA 3S47A 2GSHA 4X2PA 1ONEA 3U4FA 3UJRA 3P93A 4A3RA 3QN3A 1SJAA 3FJ4A 2GGHA 3ZLFA 4JHMA 3UXKA 3B97A 3EKGA 4JN7A 3TJIA 4DWDA 3BJSA 2PTYA 2FKPA 3R1ZA 2OQHA 4HNLA 3CYJA 2OG9A 7ENLA 2ZADA 4FI4A 4DHGA 4M6UA 3MWCA 3Q4DA 3ZVHB 1L8PA 3VFCA 2AL2A 4DXKA 3THUA 2DW7A 1JCTA 2QJNA 4ROPA 1KKRA 2GL5A 1BKHA 4E5TA 1BQGA 3DGBA 3V5CA 3CT2A 4E8GA 4G7FA 2OQYA 3JZUA 2PU0A 4K8GA 3UJ2A 2XH2A 1F9CA 1EC9A 3CB3A 5FJTA 3UJEA 1E9IA 3SJNA 4FP1A 3ES7A 5BOFA 4IZGA 2RDXA 1SJCA 5FJUA 4GMEA 3RO6A 2O56A 3Q45A 4J3ZA 3ZVIA 3IJQA 3UGVA 3V4BA 3N6JA 3UJSA 3DIPA 3DFHA 3H70A 3VC5A 3TCSA 2OZ8A 3PK7A 1R6WA 4GIRA 5FJRA 3VA8A 4DX3A 2PA6A
chains in the Genus database with same CATH superfamily
2GH5A 4LAOA 1NWTA 4WXYA 4H4PA 5J5DA 2I14A 2H8ZA 2PCEA 1XKJA 4FZIA 4L1WA 4KMQA 1PV8A 1F05A 1UZ4A 2ZZ4A 2WPCA 1XYZA 2ACUA 2YDAA 5DCBA 4C6KA 3M4HA 5E6ZA 3W2UA 1YNQA 3MKCA 1XBYA 4DYEA 3IAQA 2GK1B 2O9TA 3P3BA 2BP1A 1UD5A 1REQB 1P0DA 1Z42A 4IM4A 4ZE4A 2ZZ1A 3OHMB 4J3XA 4RZBA 4HNVA 1IIGA 4JHZA 4ZODA 3TCEA 2DQWA 5CQ1A 4O8AA 5I0DA 2VZOA 1RH9A 4NNAA 3TFCA 1KRBC 3LHVA 1XRFA 3DHUA 1WB0A 3W74A 1EA0A 1U33A 4QXIA 1TG7A 2W92A 1PTDA 2HS8A 3ES8A 1K7FA 4GYPC 2XJ7A 2G95A 3GNRA 1P1XA 4I6VA 3S4TA 1HKKA 4DUOA 1VEPA 4K7YA 2XFYA 1TPDA 3S3GA 3BAWA 2ZICA 3E0VA 5A3HA 3M16A 2NLIA 2WSPA 3CZEA 4CQDA 4HHHA 1XG4A 3PB0A 1AODA 2E9MA 1DWJM 3KL0A 3RMJA 3WJWA 1IXOA 4H4ZA 3M0VA 4AWEA 2RFGA 4NZ5A 3B9NA 1KO0A 4DJFC 2ALDA 4FLOA 4L4PA 1JXJA 5BZAA 1GEHA 3WUGA 4LEQA 2VGGA 1GT8A 5I77A 3BSHA 1NM9A 3H7VA 1FVPA 3KDOA 1VCFA 1KXQA 3IRDA 2VC5A 1L2QA 3HV8A 4U28A 2YJQA 3WUFA 3URQA 3WL0A 3KBSA 1DQXA 4MLRA 2VFFA 4EACA 1B90A 3NZQA 5LGXA 3NSMA 3C6CA 1ISYA 4Y90A 2ZRVA 4AX7A 3A4AA 4O17A 4I5UA 1TKKA 2GUBA 4W85A 2YCIX 4D6CA 3WEMA 3HGRA 1QBBA 3T07A 3B0PA 3DG7A 1FDJA 4S3BA 4O1AA 2I56A 1OZMA 1OG0A 3LD5A 4IG2A 3TZFA 1I1WA 3MP4A 3P8JA 2FHCA 4HK5A 4CCZA 3RRAA 2VFHA 2EQ7A 4J40A 4ZFCA 5BMXA 1CIUA 1AH0A 1HXJA 3FJ6A 5HUPA 1FWSA 1R38A 1E4IA 3CM4A 4JFTA 4GY7A 1UQZA 1K03A 1LG1A 1TJ1A 4ZB5A 4DI9A 2OZTA 4Y8EA 3SCWA 1SO5A 3GRIA 2BY0A 1JCMP 3DGHA 2NQLA 3EZ4A 1J0HA 2OOFA 4MF4A 3GLCA 2G37A 1ZPTA 2WQDA 2E7FA 1UZDA 2C15A 4K1GA 2V2HA 2E1DA 1P4CA 1K70A 1NJJA 3SQSA 2PFHA 3NFUA 3UXDA 3HW2A 5G4EA 4Q7BA 3G1RA 3MSYA 4N4PA 1UKPA 2D3NA 8RUCA 4HJWA 3M0LA 2CZEA 1CLXA 2CLMA 4H1ZA 1N5XA 1GRFA 3UJFA 4LGXA 1DJNA 4LH8A 4A29A 3IPWA 1KBBA 4G9PA 1EF3A 1G1YA 5DMMA 1XLKA 3F7JA 5EMUA 3FGCB 1MWOA 1KQZA 2ZX6A 4LEFA 2P0IA 4AEFA 3NQ2A 3NZRA 5I3JA 1Y65A 5JRBA 3C8FA 3W7QA 1Q7QA 3VDBA 2WNZA 3QFBA 3GTIA 4DNMA 2D3LA 4FAMA 2XGZA 1IQ8A 3IGSA 2GR1A 4RXGA 4M3PA 1A5BA 4WRHA 3QGKC 5AC8A 5KZDA 3ZWTA 8TIMA 1ALDA 3WBXA 4QRNA 4C6NA 4EF9A 1FCQA 2BY1A 2DVXA 2DJXA 1OCNA 4GIEA 1N2VA 3CC1A 2Y5EA 1VBUA 5G2HA 1QNSA 4IGHA 1OX4A 1Z8AA 5BW6A 2HQAA 1E9LA 3CEPA 1EJSC 3MKVA 3U4FA 1Q7MA 2XTKA 1H1YA 4IUOA 1OINA 1FDZA 3NL5A 3M1ZA 1SQ7A 2TODA 3GHSA 2MANA 1R3SA 2BBFA 3CASA 5HMDA 1VCGA 1E73M 2G97A 1LP6A 4UFHA 3EKGA 5BOOA 1LRTA 4IMFA 1POKA 2C0HA 2AQVA 2VX4A 4J3SA 1WOBA 3NQBA 1KLZA 3C2FA 3G0XA 3KL3A 3N19B 3WSUA 5G1MA 4G7EA 1PZ2A 3GTHA 5E9AA 1VEOA 1W2PA 3NTYA 3BW4A 3SUVA 5I5RA 3VZZA 4PR4A 1MYRA 4WSKA 4HZMA 1DIOA 1OYCA 4AZGA 1ZMDA 3PZ9A 7CGTA 4UFMA 2DSKA 2X8CA 3VIHA 3PG8A 3F1QA 2VWTA 2XZ7A 4MZYA 1I6NA 2D20A 3D5HA 3I7RA 2Y88A 3GTNA 3T0CA 3CB8A 5BYWA 3A7AA 3W82A 3FJNA 1NVMA 3FAXA 3HQOA 5GVJA 3FK4A 5BXTA 1P7TA 3IJDA 3S1VA 2QHAA 1EO5A 3GTFA 1MOKA 1K7EA 3DK4A 3G1AA 3UZWA 3EX4A 1A5NC 3BAIA 2HMCA 3DCPA 4PMJA 3UY7A 4GIRA 1JGMA 3UNTA 1UPPA 1UA3A 4LUSB 4AVOA 3MUZ1 4J56A 3U4AA 3TN5A 1NH6A 1E0TA 3MYPA 2PTXA 1W3LA 1RAKA 1V08A 2JKEA 4TX6A 3N11A 1VFHA 4CN1A 1DJQA 3QM3A 2O55A 4RJEA 3GQYA 3SRFA 1E1EA 9CGTA 1QBAA 2H3BA 2RKXA 3FN9A 4QX4A 5HXMA 3A7UA 5T91A 3BC9A 4PL1A 1JZ7A 1RBLA 1XI3A 3NSNA 2Z1KA 1GQJA 1RCXB 1QK2A 4XD5A 1E6QM 5U7SA 1KRMA 4P8XA 5AHNA 2PU1A 3KP1A 1P0NA 4ZGYA 4N0RA 4RE2A 1LORA 4LC8A 1GVYA 4W8BA 1NAL1 3BGJA 1QVBA 4ZSUA 1FHDA 1XDIA 2C1HA 5LA2A 3CUFA 4MGGA 2VFGA 1H7OA 3FEMA 1NFBA 3DN5A 2A3BA 4LX4A 1MNSA 1Q2RA 1LPFA 3IJ6A 5JVLA 1XCXA 3DYPA 4C1NA 5GJPA 1UZHA 1JCLA 3LHUA 3W2KA 4JCMA 5I06A 4ZA0A 1FWGC 4UFLA 3VM7A 4ZFMA 5LA0A 5AHFA 5I03A 2H6RA 4YTTA 3O07A 4IPPA 1QI2A 5CSUA 4HA1A 3AUOA 2PWGA 5GRTA 3GG1A 1RBAA 3B8VA 1TTQA 4LYQA 2J8FA 1TPB1 4JR5A 4O16A 4U5KA 5DCDA 3SEPA 4UMBA 1G69A 1OGBA 1JDCA 4J3TA 1U2YA 1V7AA 5BOEA 4HPXA 4Q4QA 4WGXA 5D32A 1P7TB 2FZNA 3VCCA 3UXLA 2C3ZA 1IF2A 4BQ4A 3H23A 3LCIA 1JZ5A 4AAJA 3QKZA 3P7YA 2GGGA 2E4TA 1QW8A 4O18A 1H0GA 3BH4A 3VIGA 5CJ5A 2V3BA 2MNRA 4FX9A 4JDYA 4AU0A 3ETRB 5KITA 4JX6A 4YVPA 1U22A 2WHLA 2V9DA 1F3EA 1LWJA 4AVFA 4EP8C 1TZZA 4AMCA 3W7EA 4KIEA 2AL1A 4A3YA 1RLDA 2EHHA 3HJEA 3UR7A 4NJKA 3TLQA 3GC5A 1NTHA 4OT7A 4E3TA 1T41A 2DZWA 3ZSTA 1DWHM 1M65A 3STEA 1LF1A 1JPMA 3V1PA 4O13A 1B2YA 1CDGA 4Q7NA 1VFFA 1GTHA 3GG0A 3LV5A 3R6IA 4DAFA 2HK0A 3P8IA 3S2LA 4JYFA 1VB9A 1DWFM 2NWSA 3VC6A 1HG3A 4IF2A 3UWZA 2PSNA 1S46A 3D0CA 1W0MA 2DDXA 2QJHA 1WDSA 2E77A 3W6MA 2QJJA 4QTGA 1GVSA 2XIJA 4K6AA 3DGRA 4OBSA 3SFKA 1K8CA 1VFSA 2ZQ0A 4I8YA 1D3CA 4H6EA 3C0SA 4INFA 4F79A 4AEEA 3QHMA 1XLFA 2YB4A 3L0KA 4GY1A 3II4A 4ERAA 2YR1A 4O57A 4CKQA 3EXSA 1KM1A 5F1VA 1R2RA 1ISWA 2QIIA 2X1IA 3UETA 1UP3A 1J10A 1WUFA 1W2VA 4C7DA 4AF0A 1GOWA 3SJ3A 4F0LA 1AFSA 1DNCA 1EOKA 1WKYA 2Z1SA 3EOSA 4TV5A 3OQEA 2HXUA 3EB2A 3LBCA 4Y9MA 4JPGA 3B8DA 4I9TA 3FSTA 1FQ0A 1R85A 2VC9A 2WPBA 4I5RA 1S5TA 3CZKA 3FA4A 3KTSA 5EGRA 1OX6A 1SFLA 2X8GA 3EB3A 2GR2A 4PFHA 3T0DA 4EMWA 3SZ8A 4HK7A 3LA4A 2YBVA 1R9XA 3Q94A 2OSWA 4CN6A 3KHJA 4D6IA 3CXBA 1WKEA 4HZ8A 1W8SA 3TXZA 3WN6A 5DEZA 3DH7A 2HRWA 1CENA 3WLHA 2VEIA 2A79A 5DF0A 3W7LA 1E51A 1XC6A 2ZXAA 2OYLA 3EOOA 1AH3A 3T44A 3XIMA 4AZCA 3VGFA 4CD4A 1F07A 2YXGA 3I3BA 2P3EA 3FDKA 1C8VA 3M43A 1EIXA 3E2SA 1GOIA 1Q4WA 4DWDA 1HGWA 3GIQA 3EDDA 4HPGA 1HFBA 1HNYA 1PS9A 1LQAA 3CYJA 4LA1A 1K77A 1NWUA 5C7HA 4IMEA 4L4LA 4GVFA 1P0BA 2ATSA 4I7WA 1T3QC 1IEVA 5M17A 4J2PA 3MWCA 4EAMA 4YL2A 3K8KA 1XQKA 3OJGA 3KP0A 4PBFA 4NF7A 4J7RA 2NUXA 1C9DA 1GQLA 2L5HA 3Q6JA 1OG6A 3IS4A 4NG3A 1QPOA 2HBXA 3UZYA 1F9CA 3ZR4A 4W8LA 3LU2A 5LIKX 3PBWA 3L67A 3W7KA 5HR6A 1TX0A 5BOFA 1EGVA 3VOCA 3HG3A 3NG3A 4GMEA 4PMXA 3U2OA 2GLKA 4ZL1A 1VBGA 1US2A 2W91A 2G41A 3TR2A 3RIKA 3KXQA 2VX5A 2FZ8A 3H70A 2QCMA 3GDTA 1R3RA 3LOTA 1PAMA 2A0NA 2VCCA 1HP4A 2H8XA 2QW5A 3NS1B 1CLKA 3G1HA 3A4JA 3EMZA 3DK8A 4FK9A 5E0KA 4DO5A 1Q66A 1EUNA 1ZNNA 3PZUA 2GVLA 4G8TA 1UP0A 1W5NA 3U0HA 2JKAA 4AUBA 4BCEA 4NJHA 2D0FA 1J93A 3N9RA 3TUUA 1R46A 4TIMA 3N17A 4ORIA 1BF6A 1V3IA 3AQUA 2YXXA 3UVIA 1HF6A 1WZLA 3S5ZA 3V16A 1PWLA 1ZENA 3D47A 4EQWA 4U5IA 3HPZA 4BK9A 2V8ZA 1G7VA 4LY4A 1WYIA 5K7JA 1HP5A 4GKLA 4CN4A 4NNCA 1G4EA 1JI2A 3PTMA 2FQIA 1ZJHA 3CUGA 1Q6QA 1UA7A 5JCKA 2OT1A 4WKFA 1N8FA 2XSBA 4GK8A 5DX7A 3QOMA 3W24A 5JCLA 1IT8A 2FTWA 3HMJG 1FH8A 2ZCGA 4EPEC 2J3NA 3DERA 2WOWA 1B3VA 3VD9A 1MUCA 3TTSA 1UR0A 4FB7A 4GUIA 4ES4A 2QF8A 4JIEA 4O11A 3W28A 2W0UA 3UZ5A 3PPHA 2Y70A 3IIOA 4GGHA 3K1DA 4US5D 1L6GA 3CEUA 3M64A 3NEVA 4ZMGA 2QLYA 2PD9A 1LJYA 3BSMA 3YPIA 3MU7A 3MZ2A 3ZJKA 2XISA 2WSKA 1G6CA 3UCDA 2VC6A 4O1CA 2C18A 3GFYA 3GUWA 1A80A 4E2DA 4MLJA 1WCGA 4YNGA 3T09A 5ABFA 3NCOA 5CBBA 1S39A 4FO4A 4EPKA 2NXHA 1F4AA 3NNTA 5CG0A 3W7IA 2RUSA 3EX1A 3GNNA 4A05A 1B30A 3SQLA 1XIBA 4NUWA 4IQEA 1F6PA 4IPJA 1E15A 4NJGA 1QOXA 1T8QA 1UKQA 3JVAA 2CHNA 3AJ7A 2G3MA 3SN4A 4H4TA 2IQTA 2YL9A 6XIAA 3E0WA 4CLMA 1LLZA 3TYBA 2OJPA 5EL1A 2BOGX 2WKLA 2QUUA 1YLVA 4GOAA 2DEPA 2I17A 1IWAA 3N25A 4CQCA 1GUVA 2BCPA 1U1UA 4MPKA 4NZJA 1J2BA 1PKLA 3WNLA 4MNJA 3UR5A 1OHLA 4J1OA 2DT3A 2INEA 1WE5A 1Q45A 2ZBTA 3QSTA 2YW3A 4YTSA 1E6SM 2WCAA 1Y5XA 4B5NA 3UBPC 3DESA 3II1A 3TNBA 4EAYA 3LPFA 2ZZBA 3SRHA 4X0VA 4JNYA 2ZYFA 3NDOA 4RL3A 3E49A 5T9BG 1KBLA 2WMIA 4PCTA 1VH7A 4Q8WA 2QZRA 5IBXC 3RCNA 4J5NA 3N2MA 4HU8A 3PULA 1TB3A 2XU2A 1FO4A 1OM0A 5HNNA 4N2YA 4F8XA 1GVIA 3VGGA 3S6TA 4P7RA 2Y0FA 4QG9A 5D09A 1UOZA 3HPXA 1MEIA 2VEFA 1LRNA 5CZKA 2FZBA 3NQMA 3QFEA 2NXGA 1I2RA 1CW2A 3ITCA 1OY0A 1XWYA 3RRXA 4B90A 1BQCA 1YEYA 3B9JB 5HR7A 1X1NA 3OZPA 1W3HA 3T2OA 1GRTA 2CDUA 2R1KA 5A2BA 2OZ0A 4MG4A 1EJWC 3ARSA 4AYSA 7REQA 3DHPA 1XYLA 4MY8A 3SECA 4MY9A 4AWSA 4YVXA 4J9JA 1B3WA 4D1IA 4WY0A 3AFBA 3MV11 1AZ1A 3HG5A 2BG5A 2HE8A 1EFZA 3BOFA 1JDEA 1BG4A 3PN8A 2FHFA 2QUMA 3G6LA 4LV9A 4KWSA 1WDRA 1GHRA 3BV7A 5BXPA 4W86A 3BAJA 1EJRC 4Y9AA 3KBNA 1TWZA 3OYZA 4EPDC 1AQ0A 1MW0A 3N4AA 4JIPA 2P10A 4QE4A 5G5IA 2YCEA 4PMVA 3UJRA 3MVTA 3TEVA 1H63A 1Q65A 4L6OA 3R58A 1C9WA 3SIZA 4YVVA 3A22A 3VCRA 2D24A 3IUDA 4YYCA 1KFLA 4Q6JA 1UHVA 2FMNA 3E96A 3CUHA 1LWHA 4WDUA 4XBKA 4X61A 2J24A 2G3NA 1EWDA 1SZNA 4ERGA 4HNLA 3ONCA 1V3KA 2PC4A 2DGAA 4FI4A 4FOUA 2YOCA 1CPUA 1E43A 3ITLA 1CXHA 2DP3A 2FTYA 3WNNA 4MNMA 1L8PA 3UPBA 2Z1WA 1DVJA 1KKRA 1EDQA 1X2HA 1EX5A 4L9XA 4G7FA 2V3DA 2YCLB 1JNEA 3TX9A 2CZFA 1Q5MA 5CJMA 3CZGA 4UTMA 2P1FA 3UG3A 3SM0A 3VE7A 4M80A 3RO6A 3UNDA 2GJXA 4AXKA 3EPMA 5D4YA 2XWEA 3ZVIA 3OEXA 3CV6A 4KBXA 4O0QA 4DAIA 3W37A 3VC5A 1JCNA 2Q02A 3AZSA 3UYIA 4UBPC 2OLHA 5E09A 3S1UA 1R6WA 3MBFA 4GKTA 1QJWA 1ZGDA 4F2BA 1TCDA 3R8HA 4CVUA 2PDCA 1IT7A 2WMKA 1H2IA 3PR2A 3C86A 5AZ1A 3H53A 4CQAA 1R3WA 1U1JA 3NAVA 2WZHA 3PAOA 3ARPA 2J7DA 4EOUA 3W9ZA 2TPRA 4QISA 2FZMA 3VDHA 2EGZA 1F6YA 3ZR5A 6ENLA 4HU3A 2FH6A 4ZO9A 2NQZA 4LUTA 1XIDA 3EWZA 2PRMA 1D7FA 2NXIA 2X1UA 2W55A 2C71A 3WBWA 4V27A 3VZXA 4LSBA 3W1UA 1GVOA 3FDGA 1GETA 3N14A 2EO7A 1GORA 1Z9AA 1JUKA 2PGWA 2GYIA 1DJXA 1R2SA 2W62A 4XZIA 1KBKA 2IKHA 2IPFA 3G8RA 1GCYA 1PKMA 1GJPA 3WH9A 3W71A 4NAEB 3WF4A 1QNVA 2D2GA 3EUB3 1AUSL 5CC7A 3APYA 3BANA 2OVLA 3GR4A 3A3XA 2JK6A 3L4ZA 5JMUA 1JD7A 2NT0A 3O16A 1KB3A 3VCNA 1L6SA 3ZS4A 4R5EA 3ABRA 3TV8A 3CIWA 4HBKA 5LIWX 1D9EA 1EJTC 3LXAA 2EQDA 2EKGA 2JEPA 4YLWA 1F5ZA 3E6EA 4KFPA 4C6EA 1OBAA 3M0HA 1N5WC 2XIBA 4TV6A 4F0HA 3G0UA 1IZKA 1TFVA 2J7HA 3TH6A 4CQBA 5F4SA 4QSFA 5LHEA 3H54A 5LIUX 4HB7A 4H9VA 3IUHA 1DIDA 2A85A 3LPPA 2I57A 5LNWA 2PP0A 3DUGA 4AY8A 4DUVA 5DXXA 3URHA 3T0AA 1Z7AA 1GOKA 4BQ2A 2P5NA 2BVTA 4FXJA 4GVGA 3TXVA 3AU2A 3M6YA 3GRTA 1UMYA 1UD6A 2ZDRA 3DFTA 2DZBA 1R86A 5LNRA 2P88A 2DW6A 3WL1A 4W89A 5IDIA 3CJPA 3R12A 5JH1A 4GI4A 4RE0A 1PDYA 2Z0IA 1YNYA 3OLDA 1I9CB 2DIEA 4M52A 3AHVA 3FVDA 1YDVA 2CEQA 1J5SA 3L5OA 4PE8A 1IWBA 3WFZA 4DBUA 5CPTA 3B9AA 5FAJA 3WKZA 3KVLA 2B31A 2DZSA 4OKDA 4AC7C 4H6KA 4ZB0A 1YTEA 1X1ZA 1ZCCA 1BWVA 2PDBA 2VRJA 3S9YA 1JROA 1X98A 2QDEA 2Y89A 5FEXA 2EAWA 5C2GA 3GNDA 2VELA 1FHLA 4MMWA 3V3WA 2FIQA 3VKAA 1BRLB 1W3KA 4BR1A 2WP5A 3A6OA 1V7YA 2V68A 4V28A 1V4YA 3V75A 4HOZA 1JULA 4IIDA 4JHOA 3GUGA 1TPFA 4XAYA 3R4IA 3CQIA 4TVDA 1Q1RA 1E0VA 2VR5A 5F2IA 4DPPA 3FOKA 2HBVA 3BURA 4X2RA 4W4QA 5LA1A 4QLJA 2WAGA 5AYBA 2G4JA 3RITA 1W31A 2E9LA 3ICJA 4OGZA 4RW3A 5CZJA 4GABA 2QV4A 3DENA 5EYWA 5KSWA 4E2VA 4PMQA 2Q8ZA 3WELA 3QV9A 4L4OA 1R7AA 5D2TA 3RGTA 3WUEA 3NJ3A 1V51A 4K3ZA 4DJED 2YL6A 4OFCA 1HTIA 1AJZA 3QN3A 3BMXA 3WK1A 3UQNA 1V59A 2X42A 3W1QA 3KBMA 5C5YA 4DLMA 1OFOA 5HAOA 3W7NA 4UMCA 1OC6A 3HB9A 3TROA 1ZDLA 3B97A 4QFUA 4UR9A 3URNA 3L21A 3TC6A 4WSJA 4F9DA 3M44A 3W1NA 4HD5A 1FCUA 3H24A 4NEVA 1XYMA 2E09A 2B7PA 1H61A 3AU6A 4KWUA 3I68A 3P61A 1JAEA 2FB2A 1AQHA 4R27A 4HOXA 3A24A 1XICA 1OFEA 2V67A 1FEBA 3KZSA 3ANUA 1EGMA 4JN6A 1J12A 1P1MA 1OJTA 2BGSA 1HJWA 1EZWA 4NU7A 4DBEA 1QI5A 4GYJA 4US5A 3SJNA 1OT1A 1KNWA 3A7RA 3CGTA 4KGLA 1VPQA 2ZC1A 4LU0A 4C6CA 3AHXA 4LNCA 3WQ5A 1FH7A 1Q6OA 3Q45A 2W79A 4LW7A 3U7VA 1W3NA 4A3HA 3V4BA 5D2WA 1AD4A 2V69A 1THFD 3I10A 3LYEA 4Z0JA 2SFPA 1RQEA 4NZ1A 3KWXA 2ZXDA 1YKWA 3VVGA 3FVMA 1D3HA 4HSNA 4L61A 5AKQA 3SAZA 4WD0A 2QR6A 2XGIA 4QLKA 2YFOA 1RQBA 2J78A 3BMVA 1BYAA 3MDWA 5GNZA 3BOLA 5AHIA 3U8GA 2HPMA 4DLFA 2V5KA 4P5UA 4Q8PA 3DHFA 3W2NA 5FL0A 5U4NA 3NVYB 1YIXA 4PTMA 4F48A 4ACYA 3S5OA 1ZAJA 4K1WA 2G4FA 2Y7FA 3HJZA 3W29A 3GH7A 1GRGA 2I9EA 4KESA 2IQ0A 2DT0A 1V79A 1KM4A 5EMYA 3AXHA 2VD9A 2A6LA 4H2CA 3QRHA 1JF6A 1XBXA 3CWNA 3ERPA 1QW9A 5L9FA 1HGYA 2GSJA 3TSBA 4XUGA 4PTVA 3OP2A 5AC6A 1HKMA 4ACZB 5TIMA 3QPEA 3ZVHA 2XGBA 3N3MA 4XAFA 4GJ1A 4XG1A 1TV3A 3MP5A 2AAQA 1M7PA 4KEMA 5KINA 3O6YX 4DWSC 1XLBA 4M1RA 4QJ1A 4WKAA 4CU7A 2HV5A 3SR6B 1K6WA 4TU1A 4AVNA 2Z2BA 1BTCA 5HANA 4JTTA 2YA0A 3TMLA 1XQLA 2Y2WA 2PGEA 1QPQA 3IUIA 1GOOA 3KCOA 1W1YA 1A0EA 4DNHA 1PWMA 1UR2A 1J2WA 2HNEA 2F84A 3VIJA 1DIEA 4PZVA 4MIMA 1GJWA 2QCHA 4MDOA 4X63A 4PMDA 2Z6IA 2JEQA 5FACA 3W25A 1CT5A 3VM5A 2QUNA 1XDLA 3AZRA 5HUOA 2GR0A 2QF7A 3CLMA 1CNVA 1JZ2A 1V6XA 3GWQA 3AISA 1NF7A 1E3ZA 4Q4OA 4AEOA 1F3XA 1XYCA 1M01A 3VI2A 2WKGA 1I45A 1DHKA 1KWGA 1UJQA 2CLOA 1ZKQA 3VDAA 5K4ZA 2GWNA 1XIEA 5G2WA 1NOUA 2W3ZA 2DVUA 2ISWA 2PWUA 2VEKA 1TV2A 4N9BA 3FLUA 5AB3A 4DQWA 3M5ZA 3PY2A 1DJIA 4YHGA 3BJTA 4UTFA 2VYOA 4PGLA 2XUCA 5HBFA 5D9OA 3GAKA 2QCLA 4E0CA 2O9OA 4OZOA 3KHDA 4B15A 2ZKMX 4P7OA 3VMNA 1VR6A 3Q2DA 4J57A 2RHGA 1XUZA 1DKWA 4YMZA 4L80A 5FL1A 3OTRA 2WKJA 1N8IA 3WEOA 2I9UA 4FHAA 2PP3A 1M04A 3MV01 2UZ9A 3LM7A 1WYGA 1QTWA 2PE4A 2JK2A 3AYRA 1Q2SA 2WYSA 2ZVIA 1JQVA 1FWFC 1L0PA 4RZ6A 1B1YA 1NWSA 1VQZA 2OSYA 3EKLA 2P0OA 2RDWA 2YAUA 3RCMA 3M9YA 2EKCA 4JQ2A 4QAIA 3HURA 4UXDA 4OECA 3EDJA 3A47A 4IP5A 4C1KA 2F8QA 3IIZA 4AWUA 5E9XA 3R0KA 3W1RA 3I7SA 5HWMA 1LCOA 3QHNA 1HIZA 3VOFA 3T8QA 2C1IA 3HGJA 1NIUA 1V6UA 1E56A 3L12A 2VM8A 4D6JA 1D2KA 2QAPA 3VD5A 2YBUA 3TW9A 2XWDA 1ZXIC 1C8YA 5XINA 4NZ4A 3LK6A 4NHVA 2GFTA 3DU0A 3ZXWA 2G3FA 4ZR8A 4TVWA 4IISA 3A21A 4C60A 3VO0A 1W9DM 1H0IA 1VENA 1QT1A 1RUSA 2JQXA 2GVYA 3WIJA 2ZZ2A 1RPXA 4Z2KA 3VKKA 3RILA 1Q6EA 3LCFA 5C9ZA 3C2EA 3M0XA 1YPXA 4H8VA 1K3UA 1XIFA 2PPGA 3S47A 2X1TA 2VC7A 1BXBA 1VFLA 3I3EA 1Z44A 3W27A 3CL8A 3BAKA 3AHZA 3MUXA 2UY4A 2YYUA 2V63A 3TN4A 1RQHA 2PC8A 4FDCB 3GG7A 4N9CA 1IGWA 1BXNA 4R34A 1JFXA 1H1ZA 5DMLA 1SMDA 2REQA 3VXGA 3W84A 5IRPA 1F8MA 3J7HA 1Q63A 1TUXA 1DQWA 1UKSA 1IZCA 3L4XA 1GXFA 1IGSA 1ICPA 2YLLA 1ZUAX 3PNUA 1QWGA 5FOOA 3QR0A 2CFFA 2QMKA 3VFCA 2AL2A 4MUPA 2FTPA 1HN1A 2QCGA 5GJMA 3PJUA 4CUCA 1NDVA 3N2XA 1PX3A 4LVAA 2BOEX 4GACA 3FJLA 4N9EA 4LQ1A 2BMBA 3WDPP 2XH2A 1IIHA 4GQQA 1QOQA 2Z2AA 1OVDA 2QCFA 3QGAC 2FB3A 2J62A 4JS3A 4H9MA 4A2RA 4A8NA 2O56A 1NP0A 1OF6A 4X9SA 3IJQA 3UJSA 4B2DA 2Y85A 5G5GB 1QNPA 3CV7A 3AXIA 3JZEA 1KBIA 4YCOA 2W3RA 4CNPA 4CNTA 3Q65A 4BHYA 1YW1A 5JU6A 5HDRA 3B8TA 4GIYA 1UR9A 3DYMA 2OMAA 4NZFA 4KWWA 4AIOA 4GI8A 1EYWA 4IPLA 3AI0A 3LXBA 2E6AA 2C79A 3BVJA 3I3DA 3LB0A 2BC0A 3GX9A 3AMLA 2V6AA 2EG8A 3LRMA 5I79A 1YXCA 3QJAA 3R0DA 4AY1A 3POCA 1GZJA 3LHTA 2YL8A 1HKWA 3R11A 3NWRA 4E4FA 4O28A 1QHZA 1QPRA 1TV7A 2A3LA 4GUHA 2ISVA 1R87A 4LRTA 3KWSA 4EXBA 3W7CA 2YL5A 1E1FA 3IVSA 5H8PA 1YHTA 5IHSA 3B9EA 1WOAA 1SSGA 4FNRA 4FA3A 3G3DA 4TMCA 2REQB 4H8HA 1R0MA 4KIRA 4IX0A 1AMYA 3AWNA 4UR7A 5A2CA 1YTDA 2Y7GA 5HINA 4WJ8A 1UD3A 2AL2B 3AMDA 3WLIA 3AWOA 2FFIA 4QDMA 3H21A 3LRLA 2IQDA 1I1XA 4RNJA 1PYFA 4C1LA 3V35A 3VGEA 5A69A 3H12A 2ZA2A 3NL2A 5JCNA 4GO9A 4RZ5A 4Q4SA 4IJRA 1ITXA 4MFEA 4F3HA 2CERA 4H19A 2QV5A 1SYTA 6REQA 1A49A 4O8RA 3W02A 1M41A 5A6KA 1KGWA 4ADTA 3W6LA 4JTRA 4LBSA 2YZ5A 1IEIA 4C6PA 3T1GA 3DFYA 3EXRA 5MKGB 3UPWA 5ECUA 4D9PA 1A5KC 5D37A 1S5MA 4IPNB 3UT0A 1Y5VA 4H4VA 4OOUA 3BLIA 1UH2A 2E6FA 1MO0A 2EPMX 5A1AA 1DJWA 3KEHA 1DV7A 3SUTA 3VNLA 5H2ZA 3L4YA 3R2GA 3NDYA 3ELFA 4NAFA 1PZ0A 4OOZA 2PODA 2F6KA 1XW8A 3TONA 3SUWA 4CCDA 3SUSA 3QMRA 4HNCA 4V1XA 3TYEA 4M7SA 3RLGA 1GHSA 1XPGA 2A7PA 4M7TA 1SO3A 2CBIA 1W3TA 1XH0A 5D02A 1NFGA 3S42A 4ZQOA 4FXSA 4LVFA 4DJEA 3SCOA 3W83A 3N1AA 2X50A 4XV0A 4QQ3A 3OZMA 5BMWA 2X05A 2E3ZA 5KMYA 4O15A 4YJ5A 4W88A 5D33A 2VCBA 1XS2A 2CESA 4N42A 2E67A 2MUCA 4GI6A 5LNUA 4K8DA 3AIWA 2X99A 4MOZA 1Q85A 3VOGA 6CGTA 1Z41A 2CWXA 3TTOA 1EKOA 1W3IA 2CZ5A 2YVGA 3H4KA 3WLLA 3CK5A 1FDYA 4KCWA 4FSAA 1E1CA 3WMCA 4I6KA 3PPFA 4QIUA 3PZQA 4FNSA 1H7PA 3M0MA 3ARZA 1QOPA 5I3DA 3CU2A 1UWQA 4DJDA 1ZX9A 2AMXA 2QPXA 3BDKA 1VJZA 2B7NA 1QXLA 1A5AA 3QZAA 1Q3NA 3EX6A 5M2FX 1TIMA 3ALFA 3TFXA 3QFAA 1ME9A 4G56A 1JRPA 2EF9A 3I6TA 1OF8A 3L23A 1DOSA 1X8FA 4MKVA 2UBPC 3FXGA 6REQB 5I09A 4JICA 1JFHA 1WDQA 3EDEA 3L9CA 2DUXA 4KPLA 3FHQA 1NHSA 2YVJA 3RU8X 5EBKA 1KXVA 3NEHA 4JBRA 4E2BA 1XV8A 3E2VA 4REQA 1WAWA 1VPYA 2E8ZA 1RZMA 4Q6XA 4ZOAA 3UG8A 1ZJAA 4BF5A 1VBHA 4PTNA 1LBFA 3BZJA 3IIVA 1FKXA 4H7CA 2EEXA 1FECA 3VPLA 2W9MA 1NP2A 1XF0A 4PC8A 4ZXOA 4DF2A 4YPJA 3WMSA 2DU2A 1VZWA 2XDFA 4IIFA 4UB9A 1EJVC 1P6WA 2A7RA 4NL1A 2QMJA 5F4WA 2XVNA 1PCKA 3CNYA 3OQ8A 4FS9A 3H2CA 4YS1A 3M47A 1ZLPA 4H9XA 3QZ6A 1FCBA 4LFYA 4FX7A 2VZSA 1M7JA 2OSXA 1OCBA 3K4DA 1O6IA 1SZGA 3KOXA 3N2TA 4UNLA 3DI0A 3OIHA 4PTXA 3NVWB 3SCQA 1A5SA 2XIQA 1IEQA 2WANA 1DL3A 2ZE3A 5H8MA 1Z32X 4YIWA 2YQUA 3LMZA 4HZ6A 3B4YA 3MO4A 4MYXA 3APTA 5CH9A 1K8ZA 1W1PA 2BNJA 1JCTA 1CLVA 3POHA 2QYGA 4B4FA 3H2AA 3H2FA 3BO9A 4K68A 4LVGA 1ZRQA 4ZBCA 5TD4A 3LUTA 4XSLA 5CZ0A 5BU6A 3EOUA 3KVJA 3LS9A 4M8UA 2WPGA 3LV6A 3OO2A 3UJEA 4IMCA 4BS0A 1Y0EA 3PZTA 2EQ8A 3QC3A 1W1TA 3O05A 4IZGA 4DB7A 3EWXA 3HOJA 1SVDA 3BJFA 3P14A 4JTLA 3PWAA 2ZA3A 1QNQA 4FALA 4PUKA 1MUWA 2E6DA 4UTHA 4KCUA 2QKFA 1IZJA 2OZ8A 3GKFA 3EYPA 1N62C 4DWSB 1X97A 2PBGA 4Z42C 4CU8A 4DX3A 3TYUA 3CQ0A 4JCLA 2WNQA 4S23A 4L1GA 5XIAA 1XLIA 1KW1A 4JY8A 1AZ2A 4HA3A 4NYUA 4F0MA 1F73A 1A4LA 3WQ4A 4MVAA 4YWOA 3OLEA 1W1B1 2NPXA 1DBTA 3NGJA 2PWEA 2CIPA 2ZRZA 2VI0A 4OBRA 2BY2A 1S38A 2WBKA 3DOPA 1E3XA 1FFQA 1W1A1 1DIKA 4BURA 1HVXA 1PTGA 1UR8A 4TOQA 3RR1A 4GXPA 1T8XA 3WF0A 5GNXA 5FS8A 1I0BA 1XBZA 4S3JA 1W6TA 3P81A 4H41A 4HPNA 4FR1A 4JTAA 3OIXA 4PUDA 4D2JA 2Q6ZA 3G0SA 4HN4A 2J7BA 2J7GA 1BKSA 4R53A 5I07A 4L6DA 2CLFA 2YLAA 2O4QA 2GGJA 1CBGA 1LLOA 3LCWA 1XR2A 1GPFA 4EX4A 4JTFA 5HMFA 3AN1A 3ZJ8A 1P43A 2QCNA 1TRDA 4BWLA 3W7GA 2R91A 4EVZA 3HTWA 1U1HA 3AUJA 1ZBKA 1GRAA 2J77A 1OK4A 1JEZA 2CLEA 3W81A 1HJQA 3EWWA 3TE9A 3PJTA 4ICMA 1UQYA 3NIYA 4ML9A 3ORWA 4I8DA 2GOKA 3BV4A 1TPVA 4HPJA 1UC4A 4HVXA 2E28A 4IQJA 2VQUA 5A6SA 1E6ZA 2P3ZA 1VFOA 3ABZA 1NHRA 5CGMA 1DJZA 5A6JA 1JGIA 2IKIA 5A5WA 3CXOA 4H9ZA 3CPGA 4BZYA 3UESA 1KCZA 1J0KA 3ITYA 1F8WA 2QS8A 1UD4A 3KTXA 4PMRA 4GISA 1YDNA 4F9JA 4HMDA 5HPOA 2VHLA 4JTGA 4MZ8A 2QGYA 3SQPA 1EHAA 3K5XA 2NX3A 1AL8A 1KLYA 2KZHA 4NILA 3W3OA 4G2DA 3WEZA 1WXZA 2VVSA 4HNNA 1V6WA 3FYOA 3R8GA 3RFAA 2GK1A 3NL3A 3D9XA 2ZFAA 3P5YA 3S1XA 2FPYA 1NF0A 1WZMA 3AIVA 1FEAA 1JPIA 3SSZA 4HTBA 2ASHA 9XIAA 1E5NA 3HN3A 4S3CA 5KTLA 3NDZA 4LT9A 3TOPA 1SPQA 2CLPA 3H2OA 4RDVA 2OGJA 4QDPA 4PUJA 4BJHA 1GG1A 1KGXA 2FJUB 1S3HA 2DIJA 3EXTA 2W63A 2E40A 2EPKX 1B4EA 2Z2UA 3PTKA 2FPVA 1J0IA 1MW3A 3R7MA 1UUMA 3R94A 1I4NA 3GY1A 4CNNA 1BTMA 4JIRA 5A94A 1JUBA 4W8AA 4TVCA 2DV0A 3H4GA 1UH3A 4H4QA 4YU1A 5C71A 4UQDA 3VK5A 2OO0A 2ZX9A 2HQMA 2YCKX 1W9BM 3CH0A 3UR8A 3WLPA 3R79A 2RJGA 5JH2A 2H3DA 3M5XA 4DBDA 4Z17A 5LSMA 2DUZA 3V5OA 2C91A 3NQAA 4RNFA 4LPCA 4AC1X 1J4EA 3E5PA 1Q6LA 4MWAE 3PBVA 3VNDA 1G4TA 2XHYA 4XX6A 4E4UA 1U83A 4J4KA 4G1KA 3C0JA 3B9DA 2YW4A 5CGQA 1RBOB 3KS5A 3UZZA 4DO6A 3PFRA 4ASTA 1XISA 3SRKA 4XK2A 2YCJA 2HZGA 1J18A 3ECQA 3B8UA 2E3TA 4FNPA 2P76A 2GJLA 2WB5A 1W5MA 2ZZ6A 4GD0A 4KFOA 3T8LA 4UZUA 4UOJA 1EB3A 1RJRA 4K37A 2GVGA 2C19A 4H83A 3RMEA 3NSXA 2J9YA 1YTKA 2VR2A 2R1LA 3MYOA 4Z1AA 2C6QA 3CTLA 4DJFD 1EPXA 1VF8A 3U7BA 3CMJA 4PYSA 1OFDA 3OBEA 2FJKA 2V5BA 4WGHA 3URBA 4RE3A 4M6VA 4PCNA 4AH7A 3SURA 5M3WA 5LGZA 1MW2A 1JZ3A 3NGFA 4UTTA 1TJ0A 3P93A 4GO8A 1XCFA 3U3HA 4HNUA 1W32A 3K4AA 5K9XA 3LSCA 3W76A 4JTUA 5DELA 5I3FA 3TYAA 2XIMA 3SGGA 5AYYA 1I60A 1KFCA 2YSWA 3MB9A 3WD3A 3F2CA 4WKHA 2PTYA 3RM4A 2WW5A 4MYAA 4W87A 3AYVA 5C8BB 3E2QA 4NP7A 1HW6A 1V0LA 3SCSA 2E25A 1A5MC 4LCSA 2WBGA 3B0YA 3BLEA 4KRTA 1YX1A 1ME7A 3THUA 4AZ6A 1E5JA 4LWWA 1GVQA 2WVSA 4IWWA 4LC6A 1JXKA 3ABXA 4KW2A 3WQ6A 1EC9A 4MY1A 4PEEA 3RJYA 4IOTA 4A8LA 3HQPA 4U10A 2VDIA 1PB0A 1S2AA 2OOGA 3SDOA 3N34A 5ECVA 1L6YA 5D8WA 4DM1A 3THCA 1IV8A 1JVNA 1Q6FA 1E0UA 3OGSA 5AC4A 3FGCA 1KTBA 1G7UA 1BPLB 3PBYA 4KQNA 4NYYA 4PB5A 5LIXX 3W1TA 3LG3A 3WYZA 1FWIC 5CBJA 2R14A 3WQ8A 3C3NA 4LYPA 2WC4A 1XIGA 1X39A 1I2OA 5EMLA 1H7XA 1QU4A 2J8GA 4Q22A 4Q32A 2EJAA 1Z6KA 4DI8A 4DYJA 4UQCA 3G24A 3MS8A 4GNKB 5I3GA 1GQKA 3LTSA 4C6JA 3I4EA 3UPMA 2XVLA 3QQ1A 4DN1A 4ZTXA 1OK6A 1J11A 1ZSXA 5TBOA 2A6NA 4HA4A 4YWSA 3IK2A 2ZE0A 3HF3A 3GW0A 2C14A 2WSYA 4JXCA 4LOCA 3IVTA 4NX0A 1UD2A 1V0KA 2DVTA 1GW1A 4C6QA 1JYXA 1UIOA 1YNPA 4IHCA 1KCXA 4AY7A 2V38A 4GPNA 2JIWA 3WH8A 3CUZA 4Z2LA 4PTDA 3S5YA 3CAQA 4UQ9A 3N18A 1A5CA 4L7ZA 3FHAA 1W1ZA 4HNOA 1MNZA 3FW6A 3S46A 3TJXA 5MF5A 2GGIA 3L4WA 3FEQA 5HJXA 1HX0A 4GC3A 2CBUA 3BGAA 3N4EA 3T0TA 3JS3A 1M03A 2PDQA 4GCAA 4C7GA 1S1RA 5IHRA 4DIAA 3PVFA 4AHOA 5AVNA 1OC5A 2DIKA 3U2EA 5BRQA 4XSMA 3TIMA 4C6IA 1LBLA 1ODZA 3TLLA 2C3CA 3VNIA 2AKMA 4TVUA 2WNNA 4LAKA 3U5YA 1A4MA 3I6EA 1KQYA 4DO4A 3P84A 3W01A 2OGYA 3TTYA 4XO6A 4Q8MA 4Z2GA 1V6TA 2CLIA 3NVTA 1H6VA 2GOUA 1RVGA 4JTSA 4HYRA 5CJNA 4XKYB 4WCJA 1UR4A 3ONBA 3G22A 2ZZ0A 2PBOA 4OVXA 4MZ1A 1B3YA 3WENA 2AQWA 1G9HA 2D0HA 4N7QA 2XINA 1IR1A 3NM3A 3ZT7A 3QLLA 3W70A 2ZX5A 1UWUA 4LUSA 2QJMA 4GX9A 1FIQB 3RG6A 2CBVA 2V3AA 3KZPA 3AS2A 2VZUA 2ZZ5A 1XM3A 5MHBA 3W7RA 2PP1A 4H4WA 4ZEPA 3G3MA 4H9YA 2W66A 4UCFA 4C65A 1GKQA 1RSCA 1XLLA 3KX6A 1EL3A 4X9YA 3GH4A 3HQ1A 2J8TA 1WDWA 2OTDA 3H2NA 4R7JA 3VOHA 4PCSA 4Q7IA 2Q3OA 1MVYA 1H5YA 3AMZA 2WO5A 5C54A 4K2SA 2GDQA 2TAAA 1P48A 4MUZA 4PN2A 3UWQA 2F61A 3ITVA 4K8HA 4M5PA 2RABA 3WQVA 3H8AA 2I5GA 3MT1A 4F0SA 3L7RA 5HQLA 2ZUTA 4WX2A 2D69A 1WBHA 3PZMA 4NKCA 4HOWA 1A5UA 1NDZA 5CG7A 1R3YA 1OT2A 5A6AA 2C3DA 4J3WA 3KE0A 4Y7EA 5A6MA 1CXLA 5I3HA 3L5MA 1JRCA 4ZQNA 4JTHA 3SGZA 3N04A 4BQ3A 3N3TA 1IEWA 3L4TA 4UWMA 2J88A 3WMBA 3DFQA 2Y4SA 3WQFA 2YXOA 4DVOA 3D3FA 3A4WA 1CGWA 2I1OA 1NDYA 4FIQA 2ACRA 4NZCA 2R6OA 1A5LC 3M5YA 1M1BA 3R0UA 2VFIA 4H50A 1GPWA 3H2EA 4IMDA 1CTNA 1S2UA 2Z24A 5SWUA 5FS7A 1TWIA 2ZX7A 1VJIA 2DUAA 3V36A 2JGYA 1UWIA 2WHMA 1R2TA 3W7HA 1FXQA 1XINA 2F38A 2R1PA 1KM2A 5BROA 1X8CA 3LCLA 2YDQA 4P2VA 4H4RA 2PURA 4ZENA 4DF1A 3KTCA 1XRSA 2P8CA 3AXKA 4FLRA 3WH6A 3CHEA 1MFUA 3LN3A 1BF2A 4PULA 4PH6A 4ZQRA 3DX5A 5C9RA 7TIMA 2FH8A 1A0DA 4UCGA 1RD5A 2BX7A 2AGKA 5CAHA 4KFNA 3ATZA 4JNMA 1QI3A 4W5ZA 2X1RA 4GGBA 3W1AA 2VZTA 4PL2A 2XSXA 3TMQA 3NQGA 3GK0A 3WH7A 1VJSA 1K02A 3OG3A 1PIIA 3CHCA 2BASA 4JYDA 1XIIA 4Q4PA 2DY3A 1ONEA 3C2VA 2HNHA 3M0YA 5DN1A 2VT0A 1V02A 1DE5A 2XN1A 4LS1A 5CPSA 1J5TA 3UXKA 4POCA 5CSSA 4Z2HA 4JN7A 3VX1A 1A50A 1VRXA 3A12A 3QF0A 1ZBVA 4GQGA 1GZGA 3WQGA 3LXCA 4B5VA 1VYSX 1XL9A 4M6UA 1QPKA 1DP0A 1VCVA 2A3CA 1PJ9A 2PWVA 4AMAA 3EBVA 1Z69A 3VNMA 4AW7A 1DHPA 2X2GA 4GXWA 1IXNA 1JCJA 1QI4A 1BKHA 3CHDA 2WZTA 1NDWA 3CT2A 2Q01A 1JOAA 4CCEA 3WUBA 1XG3A 1JCYA 5EB8A 2X1SA 5AYXA 3HFYA 3WJYA 2YA2A 2F2KA 3AS3A 3SADA 2D22A 1ITQA 3ISIX 1AL7A 2Z6JA 1GRBA 4S3DA 2C7FA 4XZHA 1SW0A 3NURA 1HUVA 4NQ1A 3UGVA 3NVZB 3B8IA 1O5XA 4S39A 2AAMA 3DIPA 5DRIA 3TCSA 3F2DA 4O1EA 5REQB 3W2JA 5FJRA 2NV9A 2OLSA 1C91A 1W8GA 5DBTA 4TQTA 3CIXA 2PF0A 2I7GA 3ARWA 2XN0A 4YN5A 2PDLA 2BODX 3S2NA 1DTNA 4LANA 2R24A 1E4MM 1NQKA 3WLOA 3QW4B 3G1DA 2PWHA 3MMDA 5FJPA 3DKLA 1PIFA 1S2VA 3L5LA 1R7OA 5C2CA 3WDJA 4PUEA 3R10A 1QK0A 4JOMA 2WPFA 3CMGA 3BCFA 3SIMA 2TMDA 3G6MA 1CX9A 1LL6A 3TU9A 6ALDA 3L68A 1VIZA 3TSMA 4K7VA 1EF2A 5DXYA 1UB3A 1GYLA 1TYTA 3QKEA 4I9JA 4A21A 4M24A 1OYBA 2GDUA 3L2IA 3VFLA 4J3UA 4J2MA 4MJ4A 5ABTA 2C0AA 1UP2A 2OLAA 1XLGA 2XH0A 2ZUVA 3GE7A 4JFWA 4WOZA 4PUNA 4R9OA 4Q8TA 3AALA 4CNUA 4EM4A 4MB4A 3WNPA 1SR9A 4YTRA 4ENLA 3PB2A 2JE8A 3VGHA 3T6CA 3NZGA 1XCWA 4FX6M 8XIAA 1H7RA 3B0UX 3L4VA 3EDFA 3CZJA 1XP3A 3F5KA 2OQLA 3RPTA 4FMVA 3LBOA 3WNOA 4P8WA 3IC9A 1YQZA 5FD0A 1TREA 5G2IA 2NSXA 1FP9A 4JTIA 1A3HA 4JIQA 5TF0A 4LS2A 3ANYA 4IL0A 1C90A 4TTGA 2PDYA 1M3UA 3BK0A 3CTTA 4I3GA 1YDOA 3RLVA 2A2IA 1VS1A 4RKAA 4EQRA 4ICNA 3IJLA 3PBGA 4IXXA 1YXDA 4GYPA 1MXSA 3V0TA 4DELA 3VNKA 1XANA 4QCEA 3BSGA 1TR1A 1XLHA 5F2MA 5FKYA 1NHPA 5EMMA 3I7QA 1BHGA 2FPTA 4J35A 4ZCWA 3B8SA 3FA3A 4GE8A 3KBWA 2HPIA 1T5AA 4OU1A 4AX6A 2P8BA 3QVQA 4ZSTA 2CYGA 3MSRA 4BEQA 2NV2A 3LCHA 1KFKA 2DT1A 1G4PA 1KC7A 2O4MA 4A4AA 1ML1A 2QCDA 3E0LA 2WBAA 3HV9A 2ZXBA 4LVDA 2IPWA 3PP7A 5FSEC 1PZ1A 5CPLA 1F7BA 1OFAA 1OX5A 1DXEA 3RXZA 4NJJA 1MMFA 3KRBA 1B4KA 2XVKA 3UZJA 3OVQA 3BW2A 1MQPA 3VU2A 4HT3A 4P7NA 3COTA 4DJFA 2W67A 4H8NA 3IANA 1L6FA 5D05A 2BWGA 4Z0SA 1P6BA 3M07A 1HL2A 4LYKA 4MTVA 5CSRA 5G4HC 1K4QA 2BXVA 3W1LA 5GQBA 3SCNA 4PB3A 2J9ZA 3ZM8A 5D04C 3W1XA 4GUJA 4Z2IA 1JJKA 4S3GA 1NY1A 3BLDA 4LAMA 4NRRA 3FV9A 3KRZA 3SUUA 4DY1A 2PDUA 3UF9A 1VPXA 1XD0A 1IE7C 1IWPA 1LG2A 5J5RA 3LADA 2A4AA 3WF1A 3VIPA 5C7VA 2FVLA 1XBVA 4QP0A 1TJPA 3IAPA 3FG2P 4KCTA 1GYMA 3TYCA 4JL2A 3ZT5A 1XH2A 3T0BA 1O5QA 3C2OA 4WZHA 3VGDA 4F2UA 2Y8VA 4JKMA 4ZOCA 1LT8A 5CBIA 1EHNA 1PDZA 1HJUA 1ZHAA 2VDGA 3W38A 3U2ZA 4QSHA 2OZ3A 1H7NA 4JAWA 4EXQA 1CGYA 4YTQA 1HO4A 2NVKX 5CKSA 4D71A 2GQWA 2D23A 3VKCA 5M1TA 5DMYA 5T8GA 3WNKA 2NQ9A 1V3JA 2PDGA 4FEZA 4K8EA 3P60A 5LHFA 4UMAA 2Q8LA 3M7SA 3QY8A 2OFJA 4I7UA 1JZ8A 5DT7A 4IIGA 3PUGA 3ANVA 1AA1B 2FDSA 1UOKA 2QCDB 2Q71A 3PUDA 1PXGA 1P0KA 2WK2A 3HIJA 2DQXA 4PA8A 4O0ZA 4M6QA 4A3RA 4QM1A 1YE6A 2E5DA 3BLLA 1RA0A 4NXKA 4PBGA 3GKAA 3VIMA 1PSCA 4KEVA 2BHUA 3F2BA 3WLRA 1XGDA 3NQFA 3HPAA 1GQIA 3LSBA 1TJRA 4HSOA 5HJLA 3GH5A 5FSDC 3LHZA 1JDAA 2OEKA 2O92A 4W7UA 7ENLA 2GQAA 3C0LA 3VINA 3S83A 3F03K 2TSYA 3G77A 4XB3A 1X96A 3B0XA 4O14A 4I7VA 3FS2A 3AOFA 3TAOA 1ONWA 5JBFA 2QJNA 1VFUA 4CQ8A 4DZHA 1V3MA 4M1BA 4IH3A 5BU9A 4E5TA 3LGGA 4OBTA 1H41A 3CUJA 3VDCA 1XX1A 4F66A 3JZUA 2PU0A 2IMRA 3SRDA 1UKOA 1UIPA 3N9SA 2YX0A 1KRAC 4MJ2A 3WJXA 1E9IA 3LHWA 1RA5A 3ME3A 1HJXA 1TV5A 4JTEA 3W85A 1YE4A 1RY0A 3ABOA 4UQEA 3QMTA 4D6FA 1QO2A 2X7WA 3N6JA 1DJYA 1K9DA 1RM6B 2VOTA 3T05A 3UWWA 2ZUNA 3JRKA 1PYMA 2WHJA 2ADAA 4QLLA 2BTMA 1E6NA 2WM1A 3MJMA 3REQB 4QS6A 1M6JA 1DWIM 2ABAA 1BSLA 3NO3A 3L5AA 3VNYA 1OFPA 1ZY8A 1NEYA 2Z1XA 2BDQA 3N4FA 4DF0A 3MCNA 1XYBA 2FMOA 1PHQA 5BXRA 1H49A 3L2MA 3MMUA 1QNOA 1BEUA 1O94A 1J0ZA 3H7UA 4GXMA 4QCFA 5E1QA 3S2JA 1MQRA 4CD7A 3LPOA 3DZ1A 5IFPA 3TJLA 3E3HA 1KCLA 1LT7A 2WXDM 1IHIA 3CGCA 1EC7A 1AMKA 5GNYA 4R3UA 4DZAA 1JYNA 3GW3A 4JDRA 5GJNA 1BYCA 4QG6A 1VD6A 1UG6A 5A6BD 1J8VA 1B57A 1YBQB 1O60A 4UTLA 3RR4A 2QJIA 1JDFA 5LIYX 4XZNX 4F4RA 3WJZA 1G67A 2ZTJA 3EANA 2A21A 2D1ZA 4GBDA 3RM9A 2NVCA 4D72A 4QAWA 5EPDA 4OQVA 4HMCA 2CZVA 3GD6A 4BY3A 3PUOA 2ON3A 5AC7A 1F3TA 1EZ2A 4JEQA 1IT0A 4TTUA 3PNZA 3LNPA 1W5OA 4NT0A 3VIOA 3ZSSA 1ZQ5A 2YCLA 4H04A 4E6MA 5IDZA 1XHCA 3VD3A 3WX7A 3KOWA 4HCLA 4IQDA 2EQ9A 1US3A 4AIUA 3D6NA 3GDRA 3DFNA 1GRHA 3VE9A 4ONVA 4HU0A 4XBSA 3NXLA 3TQVA 4P8VA 3MQTA 4KWOA 2F2HA 3QW3A 4XAPA 3WJSA 2J27A 1M53A 1JD9A 5D8ZA 3TVAA 4IXHA 3CT7A 2V3GA 3ZIZA 3A5FA 2PS2A 4HTYA 2NVDA 3R43A 5HMSA 1FXPA 2AQOA 1VYPX 5FF7A 1W5PA 3LRKA 2WMGA 3T7VA 2WVVB 2A1YA 1A5OC 3RO8A 1K4HA 3ENLA 4JTJA 4ECLA 2Z7GA 3SCUA 3DECA 1BFNA 1TO3A 4HYVA 3S9IA 3BARA 3M0ZA 3NQ8A 1ECQA 1EBHA 1OB0A 1OQFA 4GFIA 2WOVA 1KFJA 3ABQA 3PANA 4YXGA 1JZ4A 2Y1HA 4K39A 2O0TA 4PMNA 4H4XA 1RHCA 1UC5A 4JFUA 3NZPA 4FR6A 4PODA 1E6PA 1P0EA 1WV2A 3GFXA 4S3FA 3RPDA 3S9ZA 2CNCA 4Z1DA 3WK0A 1POJA 3TYDA 4EMIA 1S5VA 3N2OA 2V30A 4ERIA 2OODA 5A8PA 3A3WA 3HM7A 2HVOA 1UR3M 3O0KA 5I7GA 4WSHA 2FGLA 1KCKA 1U5HA 3SY1A 2INZA 3MI2A 3S5SA 6A3HA 1TPC1 1JIBA 4NAEA 1VFTA 3ZYZA 3UY8A 3ZQ9A 4V15A 1G01A 3MCMA 4JFSA 2W4XA 4A3QA 2JBMA 2WNWA 3CL6A 1W9PA 3T40A 4UTUA 3ZMRA 3CWHA 3KCLA 1VRDA 4H2HA 1FFRA 3VOIA 4WF7A 1C3FA 1LZOA 2BZNA 2J9XA 4F2TA 3BOXA 3CGBA 2D2HA 3OGRA 4HGXA 4NY2A 4MPQA 3WQCA 3GYCA 3KVMA 1B3XA 4KEUA 4Y9NA 1ADDA 4WQ6A 4QHRA 4LUYA 3T42A 1SSDA 4RXFA 3GXDA 4XD3A 2WV8A 3HPFA 1V3LA 2WJZA 3PWGA 1X2GA 2WVTA 5A6TC 2PTDA 3LQLA 3GVGA 3ALGA 1VBRA 3M0KA 4NNBA 3DFPA 3S8HA 3T9PA 5B80A 1LUCB 4XD4A 3UWEA 3A5VA 1H51A 1OABA 1X7IA 4E8CA 5AN7A 3W26A 2HXTA 1W1IE 1DPMA 1PZ3A 3ZJ7A 3SN1A 4Z2JA 3CL7A 2DZUA 1I2NA 4ZTYA 3NPXA 4X22A 1EP1A 1R3TA 4CVWA 2HDJA 1SFTA 1XIMA 8XIMA 1D8WA 5D38A 5G1TA 2OEMA 1RCOB 4M19A 3ZFHA 3BAXA 5A2AA 2VUYA 4X2PA 2QNEA 2EPOA 1V97A 4YTUA 1ISVA 5I02A 4XIAA 1H7WA 1D8CA 1MUMA 3GXTA 3O8AA 2XN2A 3GZAA 4RDYA 1YRRA 1K9FA 4U3AA 2FZDA 2R94A 2TRSA 3TAKA 4EKJA 1E6XM 2YZRA 3NQVA 3QEZA 1PTAA 3BMWA 2NUWA 1X1OA 3PBMA 3HGOA 4HJFA 2FLIA 3T81A 4OJYA 5F2LA 3PZGA 2VVNA 4FX8A 4LRSA 5I23A 4UOQA 4MSSA 3ITTA 2ISDA 2EG6A 4PUWA 1R8LA 3GXNA 4AZ7A 2WM0A 3B06A 1N63C 1FWBC 2DW7A 2POTA 3UCQA 1GEUA 2G50A 2GPTA 1JUEA 2Y5SA 2GL5A 5DBUA 5HQEA 2WZIA 4PSRA 1LQ0A 3EMQA 5A6LA 3CPRA 3MSGA 3HU7A 1GVRA 2J25A 4IFRA 1M7OA 3GDKA 5FEZA 2V6OA 1RV8A 4MNLA 4HQVA 1BRLA 4TX9A 3OBAA 3VIIA 3QQ0A 2RDXA 5K3VA 3EOEA 1XD1A 1W3JA 3PF3A 4IQLA 4Q8UA 4DBWA 1H50A 5I24A 4JX4A 1KM6A 3F5LA 1FWHC 1H1NA 4W93A 1GK8A 3PM6A 3GNXA 3AMCA 2DSZA 3LCGA 2HK1A 2R9ZA 2DH3A 4RX0A 3RPMA 3VA8A 3OLGA 4XAGA 3IRSA 1EEPA 1XSIA 2TPSA 3CGEA 1TPUA 3O1NA 5FMHA 3WK3A 3ZZ1A 1XLDA 5FA5A 1BYBA 4MKNA 3Q37A 3DJJA 3G1YA 2WSRA 4NI3A 3ITXA 4Z1BA 4RE4A 1OADA 1EGZA 4H4IA 2J79A 3E12A 1EC8A 2PB1A 3MMTA 2WPEA 3G1SA 3SR7A 3ARVA 3R89A 1FHVA 3EEZA 5D9NA 1PEZA 1HO1A 3AIUA 2PDKA 3F4NA 4WDWA 5I6SA 3QZEA 1PL9A 2IPGA 1XLMA 2VZVA 1LYXA 2FFCA 1DE6A 4QE1A 3KCJA 4IG2B 3ZO9A 2GVJA 2J7EA 1Z89A 2X0SA 3WLNA 4AWTA 1O1ZA 4GG9A 4CCCA 2VTFA 3WBYA 5C9UA 1XRTA 3WFAA 4Q4MA 4XWUA 3EA3A 1LBMA 3LMYA 3MTWA 5CAKA 2XVPA 4EM3A 1ISZA 1U30A 2E68A 2OWXA 3A13A 3AXMA 3GU2A 1RLCL 1QCWA 2XG9A 3G18A 1C7TA 4IUGA 5HMEA 4QS5A 1BVNP 1GREA 4ZB2A 1ISXA 4LF2A 4H00A 3RX3A 5AFDA 2VFDA 2UY2A 3UCCA 2LLEA 4U2YA 3DYOA 4FPSA 4WUIA 5D2XA 3UA3A 1XIHA 3KS6A 3GXIA 3EGJA 1LVLA 1GOQA 3UWUA 1TPWA 5CEWA 5C6MA 4JY9A 2XM1A 1EXBA 2TYSA 3WD0A 4LY8A 2EPNA 2PWFA 1FWNA 4NX5A 4FXFA 3W53A 1JYWA 2RGLA 3DC0A 3DBNA 1FWAC 1IXPA 2X30A 3EX3A 3H4WA 3MDUA 3NQCA 3RUBL 5DY2A 4JDBA 2VMFA 4C6LA 2XH7A 1O4UA 4J27A 4RNHA 1GEQA 1TMLA 4HK6A 3MBDA 1IYXA 3W86A 2HCVA 1GERA 2FHBA 2BB0A 1ZTVA 1TR9A 4B5WA 1OX4B 1QASA 3OB8A 2QJGA 4O0KA 3XINA 3C56A 3GZ3A 1U5JA 3VUPA 2DPEA 3CLWA 3DFOA 5C9XA 2VEGA 4D6EA 2FVKA 2VP8A 4LBRA 3L2LA 1X6NA 1KWKA 3LCXA 4ACZA 2AAAA 4TXEA 3V18A 3RLUA 4GUGA 2G3IA 3EAUA 3GHRA 4AG0A 2ACQA 3UG5A 4YHEA 3PUEA 4GH3A 4G7EB 1KN0A 2PAJA 3VNZA 2QT3A 5C0QA 2JGQA 1JDDA 1TJ2A 5XIMA 2CHRA 1NQ6A 1B9ZA 3ZJ6A 3H7RA 1O66A 3K2GA 3IGXA 5G5HB 1TE6A 3BW3A 1J01A 1NSJA 3GRSA 1VHNA 4JTDA 3BCJA 3TYZA 2GJPA 1EDGA 1ONRA 3GG8A 4GRTA 4FXRA 2DSWA 4DWSD 1F8IA 4C6DA 1VQTA 4FLQA 3GC4A 1WUEA 3O9NA 3E74A 1FCVA 3M0IA 3SCRA 4S3EA 4IFOA 2XM2A 1HL8A 3G8EA 5EU9A 5IBXA 2WC7A 1YXYA 3IJ7A 2PUZA 5IOBA 3U9IA 1S1PA 1PHWA 3QLDA 2IXVA 4M29A 1BGAA 3PJXA 4S1FA 5EFFA 1XSKA 2Q3RA 2R1NA 1MRAA 2QXWA 4ROQA 1WPCA 3W2MA 4G6CA 3EMCA 4AD4A 4Q33A 3P2VA 3RJXA 4BI5A 4K36A 5FS9A 4W7VA 4EXAA 3FSUA 2YDSA 2VFEA 4N6EA 1MEWA 1XPYA 3H22A 4HHPA 1QAPA 3MWAA 1MXDA 1RXOB 4JQ1A 1FY6A 2I16A 4H8UA 2I5IA 5CZSA 2W0HA 4XZBA 1A53A 3S5NA 3ARYA 4DPQA 1I0DA 1KM0A 3CBWA 3PZIA 4WY0F 3A3HA 2UY5A 1NOFA 4MJZA 3CUIA 3ZLFA 1RJPA 2WVUA 1UMLA 4M51A 5H91A 2V2DA 5CPQA 4B9ZA 4OTKA 5BNKA 1NARA 2WMJA 4LTSA 1UYQA 1EDTA 1S7MA 3E2RA 2BC1A 5C2XA 2BVWA 1FRBA 2OQHA 1N82A 4CNOA 2CFYA 1ZALA 2O7SA 1C92A 1CXEA 3IGHX 4LV4A 5ER0A 3KOZA 4PEKA 4P7QA 3TC7A 3GHTA 1SMAA 4MWAD 4JQAA 4QDWA 2GWGA 3U2CA 5A6BA 1TA3A 1WX0A 2OYKA 5CC6A 2WMFA 4AZ5A 1EX1A 4ROPA 3GDMA 2YBTA 4IPIA 3O6DA 4RW5A 4C1NB 5EMJA 4QE5A 1BQGA 1EYEA 2QPSA 3RDKA 1XHGA 3CWOX 3RX4A 3UJ2A 2NZLA 3WBAA 3G1XA 5HOSA 3B03A 2CW6A 3GR8A 4OV9A 1S2WA 1CWYA 3VUSA 4R85A 1RR2A 4ZOHB 2GR3A 3M41A 4JL1A 1UW9A 4Q4RA 2PZ0A 1U5VA 2HSAA 4GCXA 1TVLA 3SFWA 1TWSA 2BY3A 4R9XA 2KAUC 2RJHA 2B7OA 3P6LA 3WH5A 1XDMA 3H26A 3M46A 5CCZA 1V6VA 1I75A 3CV2A 4FOJA 5JCMA 5IFTA 2WCSA 1LL4A 1TTIA 1EXPA 3HRDC 3KAOA 4NVTA 1EPVA 1WZAA 2X16A 1KFEA 3RYSA 3HO8A 4V1YA 1GJUA 1LL7A 5IXEA 1NOWA 1EH9A 1LTDA 4N4QA 2O9PA 4E3VA 5CC5A 2F9RA 1ZFJA 9XIMA 4KRZA 4DNAA 3FKKA 3EWUA 2WOIA 4L64A 3NRZB 3K30A 3GNOA 2ZC8A 2VENA 4AD1A 2J74A 4JGDA 4JTKA 3E38A 3BQ6A 3TC3A 1TYGA 3TWBA 3AXXA 3A9BA 3SBFA 3QV6A 3IJIA 4HCDA 3STGA 3TTEA 2FYMA 3KL5A 4NXSA 5HNRA 4MWAC 1V02E 2HISA 2Y6ZA 1B54A 5LKYA 2PDJA 2PD5A 3GBEA 3NVDA 2HS6A 3S2MA 4GQ0A 4A22A 1JPHA 1ZCOA 2JALA 3MA8A 4Y6GA 3VX0A 2VX7A 3MHUA 4WJXA 3WG6A 1PBGA 2XPKA 1ZBWA 1XGZA 3GFZA 1MI3A 2X0YA 3KOFA 4IJBA 4RDZA 5E5CA 4CNSA 2IKGA 3DEQA 3A64A 4PMYA 4R33A 1LOLA 3KDNA 4GNJA 1TA3B 3GU1A 3TP4A 4AZHA 1AW2A 2HTMA 1YPFA 3TJ4A 4A35A 3CAVA 3CQHA 1XSJA 4M82A 2FZ9A 1Y5WA 4JN8A 1F3WA 3K13A 4UZSA 4GRSA 1R3QA 2ZZ3A 3MKKA 4LJ3A 4Y96A 5HJYA 3OYXA 1OCJA 1VIWA 3NQEA 2QVNA 2D2JA 2EBNA 2BVYA 4AF0B 1ME8A 3AMKA 4GA8A 3W23A 4O1FA 1K9TA 2Y7DA 1SZFA 4ICCX 4Q8NA 3HG4A 5JIPA 3BLOA 3GYEA 4PMUA 2RAGA 4GINA 1UWAA 5HK4A 1FWRA 1T40A 3L0GA 3STPA 1ICQA 3DDMA 1FWDC 4P7LA 3I4KA 3BUVA 2BHYA 4CU6A 2HWGA 3G1VA 7PTDA 3B9OA 5H1WA 3GVVA 4O54A 4XQ6A 4DXXA 3LTYA 1CYGA 4UFJA 4WJEA 3ARQA 3GIPA 1OIMA 4CQ9A 1KTCA 5F4XA 3AZTA 2Q8XA 3BXWA 4JNZA 4P8UA 1J96A 1G94A 3UXIA 4HNTA 4J3VA 3ZLHA 5DY3A 2NSOA 4EMJA 1ODUA 4D8LA 4LCQA 3W4RA 3LGEA 4DYKA 1FOBA 1DJHA 2V5LA 2B81A 1MRQA 4KEZA 5G1YA 4AIEA 3WQOA 2E5AA 3WD2A 4BI7A 2Z00A 4MAZA 2OKTA 4AZCB 1BZLA 1ITUA 1P5BA 3N15A 1BWCA 4L9ZA 4DXVA 4D1JA 3FKRA 3GHUA 3BG3A 1DJGA 2R82A 4GNVA 3NPUA 3EAOA 3LTPA 2HROA 4GWEA 4ZOBA 1CXKA 1ZJIA 2Y5JA 3C61A 2WZMA 3CYVA 2J13A 1RP8A 5L6UA 3GVWA 2PF8A 3QHOA 3NZ1A 3PFMA 2NX9A 5FJIA 1F3PA 3TOYA 3LQGA 4B3LA 4PCPA 1WXYA 3WLSA 1TPH1 1ITCA 3NPWA 5RUBA 1H62A 2J7FA 3VDGA 2PRHA 4ADUA 4O4VA 1HQTA 5I78A 5E70A 3FYYA 4ZO6A 3DG6A 3E0IA 3SGUA 1W1VA 3EPNA 1T6MA 2PLKA 1BSIA 4NEWA 4E4PA 4C5ZA 1W9XA 3AMGA 4H7ZA 3RX2A 8A3HA 2V5CA 4AIBA 4CGTA 3GD3A 1EJXC 4B5UA 2D0GA 5MKGA 1V8EA 5A8GA 4RUBA 3MSDA 3RHGA 2P53A 1UASA 4FNQA 2PMQA 4LF1A 3PJWA 4TX8A 1EBGA 4O53A 3SY5A 3OU8A 1WBJA 2IW0A 1AK5A 2G8ZA 3PG6A 1WO2A 3HMCA 1Q7ZA 2GVEA 3MUIA 4B5SA 1SM9A 5U25A 2ZRXA 4LB3A 3LDVA 1IXQA 3AHTA 1OGSA 1TE1A 4D6GA 3MUAA 4F40A 3CPUA 4IX2A 3V0UA 5DCEA 3L65A 4ILSA 3EA2A 1BAGA 3CAKA 1PIGA 2WZEA 4FIRA 1AG1O 3QR1A 1UWRA 4WK9A 3UYCA 2WJFA 7ODCA 1H2JA 3GXMA 2EPHA 2PDWA 2GRTA 1UKTA 1W9VA 4AD2A 1WKFA 1ENUA 2GGHA 1V0MA 3HG2A 3BTNA 2B0MA 2DFAA 2G3JA 3UD6A 4WLCA 3L4UA 4RR4A 2J6VA 1Q8AA 3B0VC 3CO4A 4ZOEA 3N2CA 3L66A 4IGMA 4DHGA 1H5VA 1UR1A 3QC0A 3GVQA 1R3VA 4XVEA 3LNMA 3Q4DA 2J6XA 3BL3A 2R1MA 4RDWA 4UFIA 2YYTA 1RJQA 1NPXA 4LUIA 1GTEA 3W7OA 3WLTA 3BLKA 3V5CA 4J28A 1OGGA 2OQYA 4D6DA 4PBEA 1AVAA 2GUUA 3QOKA 3TKFA 2VURA 3PZNA 5J8LA 3OC4A 1VYRA 4IMAA 2J75A 1MZHA 2GJRA 2ISFA 4F0RA 1QW7A 1Q4NX 3UZXA 4CD5A 1DYSA 7TAAA 2BV9A 2YB1A 1SJCA 1RK6A 1M9HA 4TVYA 1XRVA 5AYZA 3FY1A 1JEHA 1HZYA 4B91A 1KA9F 1PUDA 4CD8A 5ABFB 3WLJA 1V77A 4LALA 3KLJA 1T7LA 4HKPA 4KCVA 3QY7A 1FP8A 3F4VA 2E5CA 3HPSA 3LLDA 1GZ1A 3VKBA 3A9IA 4XIMA 3LY0A 4IP4A 3CGDA 4AD5A 2XVGA 3URAA 4AHPA 3M6DA 3JUGA 2G5WA 1C8QA 4C6MA 4NI8A 4DM2A 3THAA 1ADOA 2J7CA 2E8YA 1HKIA 3B4UA 3F5JA 1SFSA 4W84A 3PZVA 2OKOA 1XLJA 4KKXA 1HT6A 4HYWA 1E55A 3AIBA 3K8MA 2NWRA 2FVMA 5IM51 4M6PA 1LQ2A 4JQ4A 1J0JA 3W75A 2YDRA 3K1GA 5I00A 2VUNA 3DG3A 3I6RA 2G96A 1ZB5A 3B40A 4JKKA 1N55A 3NQ6A 4XTDA 1GQNA 1KR0A 1A0CA 1QHPA 3ARTA 4ZE5A 3R8RA 1GG0A 1SZEA 1UJPA 3BG9A 5FESA 1UH4A 3TQ0A 3LHYA 3GXFA 3JW7A 1L6WA 1XKYA 3AO0A 2QQ6A 1SO6A 5KZ6A 4Z08A 1K8XA 2WWDA 4N9DA 3ARRA 2WMIB 4JFVA 2QDGA 3UG4A 1E72M 4JX5A 4EWJA 2CITA 5HWJA 1KXHA 4H01A 4PUUA 5CZTA 1BGGA 2OX4A 1D7YA 1JCXA 2ZDSA 4GYKA 1ONXA 3NOEA 4H4UA 3EOLA 2OX1A 3T4WA 5K9CA 3H55A 3AC0A 3N2BA 3OHIA 4RK8A 5D2YA 5K2ZA 4R7OA 3BZGA 5TAOA 3SO7A 5DQPA 3RNMA 4IFKA 2PDXA 2HJPA 4GC4A 3AAMA 2VGIA 4DWSA 1HKVA 1UROA 5FJJA 1HL9A 3ITOA 3MY9A 3DBPA 3VKDA 7REQB 2DT2A 4H7VA 3WQEA 5CSYA 1VFMA 1FWWA 3NYDA 2PTWA 3U5UA 4URIA 1Z3NA 3LI1A 4A6GA 5H8UA 3GAYA 2HE5A 4WY0B 1S5NA 4LYRA 4LAUA 3SI9A 1OZQA 4PRWA 2QULA 4L65A 3CZLA 1UPMB 5HATA 4OUIA 5FF0A 5M5DA 2I5QA 1CXIA 1W54A 4K38A 1T99A 5B7ZA 3PZOA 3NA8A 3AIRA 5K9DA 3AM9A 3P74A 3LZ5A 4C6BA 5EA9A 3APGA 3RN6A 3C2RA 4UTWC 4KETA 5EFDA 1SW3A 2X8RA 3MW7A 1AD1A 4O4WA 3UWVA 4TR9A 3T4CA 4UQBA 4AFYA 3OA3A 5H6HA 5DLCA 4PCFA 4GQRA 1A3WA 3AJXA 2JIEA 2ZOXA 4MAVA 4GZEA 5AHLA 1S5WA 2OB3A 2ZVRA 3IJ8A 1R47A 4AZIA 4QNWA 2R9RA 4H3DA 2H90A 3NXFA 4WEVX 1MDLA 1TWDA 3CV1A 1GVFA 1XYAA 3GDLA 4NZ3A 3W7JA 1CGUA 1K7XA 1STZA 5I3KA 4MWAA 3Q58A 5JBEA 2CBJA 4B2DD 4O52A 1JI1A 4D6HA 2VWSA 1Q6GA 1CECA 3ABSA 4GY0A 1SB3B 4WDTA 4ADSA 2E1WA 1E4NA 3BLPX 1BLIA 3P0WA 2CWNA 3B04A 2ALRA 5A8OA 4XUYA 1AW5A 1WDDA 1XXXA 2V82A 2YIHA 3IGUA 4D8AA 3DXIA 4IMGA 3USZA 3KLLA 4GBUA 4LVBA 1LLWA 2GJXB 4LBUA 4B5XA 1FH9A 4ATWA 1O7AA 3K4WA 1UWSA 4QQUA 1ONFA 5LNSA 3NQDA 2VR4A 3W00A 4BQ5A 3WNMA 2ZA1A 4IFKB 1JPKA 2FGZA 1FX6A 4Y9PA 3VD4A 3G2GA 2PLMA 5HA7A 3V0SA 2Z27A 4G1NA 3NM1A 5CXPA 3O7UA 1JPDX 4MDPA 3TA6A 3KUMA 3P80A 1J79A 2VDHA 5E93A 4ZO7A 4JIIX 1VC4A 1K8YA 5GPRA 1XYFA 3V7PA 3WLQA 4GHRA 4U4MA 1L9WA 1AJ0A 1ZS2A 2GSHA 4LS0A 4B3KA 1BXCA 4LUTB 1XUUA 5T26A 1F2JA 3RK8A 5CPOA 1WXJA 3RLHA 1YQ2A 4V2XA 4QGCA 3W0KA 3IEBA 2NQ5A 1XIJA 1RY8A 3H6OA 1FKWA 1SW7A 1VP5A 2WCGA 4AISA 1GGOA 4ZZ9A 1BG9A 1DXFA 4GI9A 1ZU8A 2OR2A 2X0HA 1X7FA 2FKPA 2B7QA 1PPIA 2RH9A 3AHYA 2D73A 2OG9A 4JQ3A 1LM1A 2NLYA 2QDHA 4GQBA 2BXYA 3VOJA 1TQJA 4HP5A 1DXLA 4UR8A 2VGFA 5BWFA 1F4HA 4H9TA 5F7UA 2B4GA 4IIBA 4BEUA 3FXYA 3SCVA 3TK7A 5LZLA 1ICSA 3QBUA 5JCIA 3CMFA 2NQHA 5FF2A 1IR2A 1EP2A 4ALDA 5FJTA 1J0YA 4B3ZA 3VGBA 4MWAB 2A5HA 1BYDA 4LB4A 1XFCA 2XFRA 3E0FA 4Q8OA 4O19A 1GVEA 2FDMA 5FJUA 4UUIA 1EJ7L 3CO8A 2PDMA 2BFGA 3JR2A 1H60A 1JAKA 5I2UA 4APNA 2OCZA 4H6RA 3WF3A 4NASA 3TQKA 1AQMA 4ML4A 3N9KA 4IGNA 4NSBA 3RCYA 4X0NA 3Q67A 2VL4A 2P50A 4GVHA 1W17A 1KV5A 3TDFA 2ISSA 1TV8A 4EQXA 1EO7A 3WBEA 3BG5A 2Z7KA 2WC3A 1GOXA 3U6WA 5PTDA 3CUXA 3GBDA 3NR0A 5M03A 1FHUA 1I2PA 4O1BA 1YDYA 2R8WA 3T2PA 3C0QA 2J66A 1CB2A 1Q13A 3MUCA 2ODOA 2W3SA 4L1XA 5AHMA 2WLZA 3E1F1 3LLFA 3QYSA 2E9BA 4K7ZA 1KGUA 2ZIDA 3LERA 1OSEA 1QR7A 3LENA 5I3IA 3M7WA 1TMHA 3UW6A 3TN3A 1FWJC 1D7KA 1OFQA 3GS6A 5T9CE 4HIBA 4L56A 1ZK7A 4WOQA 1QHOA 4IICA 4DRSA 2GDVA 1E4LA 3EA1A 1PCWA 4UIOA 3SCPA 1NWRA 2ZTKA 5FAGA 5LXXA 3W7DA 1C29A 1OFRA 2X41A 4HU4A 4XZLX 1CGTA 1GONA 3R5EA 4JIHA 2WP6A 2CPUA 4U2ZA 3RM8A 4DJDD 3RU6A 3S0CA 3FNDA 3QGVA 3C8NA 2QEZA 1F76A 1LDCA 3OGVA 4RNIA 3UVAA 2C16A 4IGSA 4KRUA 1HJSA 4JYEA 5HQMA 3ZT6A 2BXZA 3W2LA 4BF9A 1E0XA 5FIPA 3F4DA 1CB7B 1AQFA 1AOGA 4MKSA 4HHMA 1KFBA 1KV8A 3DI1A 1A3XA 3GVRA 2C8NA 3P0XA 4RZ4A 4XVDA 3NOYA 3QR3A 1JYVA 2HVMA 3PPGA 2QVHA 3TWAA 3IACA 4L6HA 3VMPA 4L4MA 5BRBA 2KX9A 3VTRA 2VOMA 5AC5A 3SB0A 3CIVA 1TV4A 2ZXQA 2CKSA 1TVPA 3VIFA 3K46A 3KW3A 1N61C 2VQTA 2QUTA 4EPBC 2WJDA 1QDSA 1R9ZA 1O12A 1KRCC 1L8NA 5DMNA 3MI3A 3T55A 4DJEC 4JZ5A 3LLXA 3STFA 1QPNA 2A7NA 2NT1A 5D9MA 3L0NA 4PUMA 2HEJA 5AECA 2NV1A 3GO2A 1TELA 2W54A 4AZBA 2DZAA 2IPJA 3CZ8A 1X6UA 4AQLA 2ONEA 1A47A 3GM8A 1DQUA 4ZQMA 5CGTA 3BE7A 4ZO8A 1RVKA 1TTPA 3MHGA 2CXGA 3QTPA 2Y8KA 2CCRA 2EG7A 2OU4A 3IIXA 3NL6A 2QDDA 5EKYA 1W91A 2ZRWA 2OEJA 5A95A 3VZYA 3VNJA 1W9UA 1OD8A 1X38A 3ZLGA 1ZP4A 4XZMX 1ZMCA 3NPVA 3MJYA 4GX8A 1VGAA 1B3OA 3T2QA 4MJMA 4DJDC 1O5RA