1MUCA

Structure of muconate lactonizing enzyme at 1.85 angstroms resolution
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
369
structure length
360
Chain Sequence
ALIERIDAIIVDLPTIRQQQTLVVLRVRCSDGVEGIGEATTIGGLAYGYESPEGIKANIDAHLAPALIGLAADNINAAMLKLDKLAKGNTFAKSGIESALLDAQGKRLGLPVSELLGGRVRDSLEVAWTLASGDTARDIAEARHMLEIRRHRVFKLKIGANPVEQDLKHVVTIKRELGDSASVRVDVNQYWDESQAIRACQVLGDNGIDLIEQPISRINRGGQVRLNQRTPAPIMADESIESVEDAFSLAADGAASIFALKIAKNGGPRAVLRTAQIAEAAGIGLYGGTMLEGSIGTLASAHAFLTLRQLTWGTELFGPLLLTEEIVNEPPQYRDFQLHIPRTPGLGLTLDEQRLARFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MUCONATE LACTONIZING ENZYME
publication title The refined X-ray structure of muconate lactonizing enzyme from Pseudomonas putida PRS2000 at 1.85 A resolution.
pubmed doi rcsb
molecule tags Isomerase
total genus 140
structure length 360
sequence length 369
chains with identical sequence B
ec nomenclature ec 5.5.1.1: Muconate cycloisomerase.
pdb deposition date 1995-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1mucA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1mucA01
3DIPA 3PFRA 4IL0A 2GGEA 4KWSA 3MUCA 2POZA 4HNCA 4DXKA 3VDGA 1MNSA 3CYJA 2OX4A 1BKHA 2PP0A 2GL5A 3OZMA 2CHRA 4J1OA 3OTRA 1IYXA 2PMQA 1SJDA 1NELA 1DTNA 3MWCA 4H1ZA 4EWJA 3TTEA 3TOYA 3IJIA 3V5CA 3UCCA 2XH2A 5BOFA 4Z1YA 2PU1A 1TKKA 4E4FA 1XPYA 3RRAA 3T6CA 1SJAA 7ENLA 3PWGA 2MNRA 3VC5A 3D46A 2P3ZA 4HYRA 3RITA 1FHVA 5FJRA 5FJTA 3STPA 4JN8A 3N6HA 4G7FA 2I5QA 4H19A 3OPSA 3NO1A 4DWDA 3DFHA 2PGWA 3IJQA 3DESA 4J3ZA 4GGHA 3TQPA 3BSMA 4GYPA 1FHUA 3P93A 3N4EA 4IP5A 1ECQA 4E6MA 2HXUA 4GMEA 2PPGA 1EC9A 3GO2A 3UXKA 4Z17A 4E5TA 1E9IA 3TJ4A 3SQSA 3ZVHA 1EC8A 3DDMA 2AKMA 1WUFA 4F4RA 1JDFA 3H7VA 4K8GA 5FJPA 3PK7A 3ZVIA 4IZGA 3TW9A 3FVDA 3SN0A 2FYMA 2GGIA 1JPMA 3SN4A 3MY9A 3N6JA 4DX3A 1PDYA 4K2SA 2PCEA 3ZVHB 2QGYA 2ZADA 4GISA 3U9IA 3Q45A 3VA8A 3VC6A 3UJEA 1XS2A 2OZ8A 4MMWA 3CXOA 1SJCA 3PWIA 3SN1A 3Q4DA 2OQYA 3T8QA 3UCDA 1TZZA 2QJNA 3HPFA 4H83A 3TCSA 4JHMA 4GIRA 4A3RA 3TJIA 1SJBA 3MSYA 2OLAA 1ONEA 1WUEA 3THUA 3QKEA 5EU9A 3I6EA 2OO6A 2ZC8A 2P88A 5FJOA 1OEPA 1P48A 2ONEA 4ZA0A 3RO6A 4HN8A 3K1GA 4KPLA 1RVKA 3ES8A 2GGGA 3DGBA 1JCTA 3I4KA 3OW1A 4K1WA 5FJUA 2AL1A 4GFIA 3CK5A 3VCCA 3H70A 1R0MA 3ES7A 4HCHA 4IT1A 6ENLA 3BJSA 4H2HA 2QVHA 3DG3A 2OKTA 3U4FA 4MGGA 3CB3A 3V5FA 3IK4A 2GSHA 2MUCA 2HNEA 3R0UA 3UJRA 3P0WA 2OZTA 3ENLA 3IJLA 2DW6A 3EKGA 3V3WA 1PDZA 2AKZA 3R10A 2DW7A 2PP3A 3NXLA 1L8PA 3T4WA 3UJ2A 3OP2A 4HCDA 3BOXA 2AL2B 4HCLA 3D47A 3CT2A 4JN7A 3FV9A 2NQLA 3GD6A 2QQ6A 4ROPA 2OVLA 3DG7A 3UJSA 1KKRA 3FYYA 2PTXA 5ENLA 4E8GA 2XH4A 2O56A 3B97A 3T9PA 2HXTA 3JW7A 3DG6A 3FCPA 3S5SA 2HZGA 4ZCWA 3R11A 3OZYA 4IHCA 3VCNA 3EEZA 3H12A 3JVAA 2FKPA 2OZ3A 1R6WA 2QDEA 3NFUA 4HNLA 2PA6A 3DERA 2RDXA 3FJ4A 3QPEA 3ZLFA 3DEQA 2P8BA 4IP4A 4G8TA 3ZLHA 3I6TA 3TWBA 4X2PA 4E4UA 3MKCA 4M6UA 2PTWA 3RR1A 3TWAA 4KEMA 1NU5A 1JPDX 3RCYA 3MZNA 1W6TA 2PS2A 1EC7A 1TE6A 3GY1A 3R0KA 1BQGA 2OG9A 2OFJA 2PTZA 3V4BA 3QLDA 2PGEA 1KCZA 3GC2A 5BOEA 3N4FA 4FI4A 2GGHA 2OPJA 4GYPC 1EBHA 3SJNA 2AL2A 4KT2A 3QN3A 3UXLA 2GDQA 4FP1A 4DHGA 1MDRA 2PP1A 1KD0A 3CAWA 3ZLGA 3NZGA 3UJFA 3JZUA 4ENLA 5IDZA 3MQTA 1P43A 3FXGA 4A6GA 2OQHA 1MUCA 1KKOA 2PTYA 3H8AA 3VFCA 2QJJA 3S47A 4MKSA 3SBFA 1MDLA 2P8CA 2XGZA 5J04A 2QJMA 3R1ZA 3P3BA 3UGVA 3DFYA 4IL2A 4GGBA 2P0IA 3KUMA 4HPNA 2PU0A 4YWSA 2PSNA 4M0XA 4DYEA 3SSZA 2PODA 2GGJA 4DN1A 2XH7A 2XH0A 1YEYA 2QDDA 1EBGA 3QTPA 1ELSA 2XSXA 1F9CA 3RGTA 4A35A 3R25A 1MRAA
chains in the Genus database with same CATH superfamily
1JZ7A 2YIHA 3HQ1A 1UWRA 3CGTA 3M6YA 4MJMA 1KBJA 4H3DA 1E40A 3VDGA 4O1DA 3SSJA 3GC4A 5D05A 3PR2A 3N2MA 5ECVA 3RM4A 5CPQA 4EMWA 2HV5A 2XSBA 4DIAA 3ANYA 3MWCA 1H2JA 3WEMA 3TTEA 4WCJA 4BQ4A 1E6RA 3ITLA 4QBXA 4JDBA 2WMHA 2YDAA 1KWGA 3CL6A 4ZOAA 2PU1A 5I3HA 3H2OA 3N1AA 4ZSTA 4X3ZA 1AJ2A 4NZJA 3VC5A 5FS6A 1YDVA 1W9DM 4B91A 4D6HA 1I75A 5FJRA 1SFLA 4RL3A 4JN8A 2FPYA 3W7GA 3BV7A 3EA1A 3QJAA 4QX4A 1SO4A 2E28A 4I6KA 1FEBA 1PZ0A 3GXIA 1VHNA 4GGHA 5G4HC 4GI9A 4HJWA 2WAGA 4L65A 1OX5A 3V0SA 3RX4A 2EAWA 4O54A 2WQDA 4JPGA 3NVZB 3TC7A 1J5SA 1G4TA 2W4XA 1DJWA 2PPGA 2AQOA 4JQ4A 2YFNA 5C9UA 2VRQA 3DDMA 1QVBA 2DH3A 4RXGA 1JDFA 4ZXLA 1J12A 4NAEB 4XBSA 1V6WA 4AZBA 3FVDA 1BWCA 5G2HA 4Q4QA 1WDDA 1ZJHA 4GG9A 3AXXA 8XIMA 3OVQA 3IJ8A 1RQBA 2GSEA 1DIKA 4UMCA 5K4ZA 3LCIA 1N7KA 1EX1A 1R30A 1JAKA 2O9PA 3NPUA 4XZBA 5IM51 1QOXA 4Z1BA 5F2LA 1H09A 2PE4A 4DJFA 3ZT6A 4EQXA 3SN1A 2BGQA 1CCWB 3TTOA 2JIEA 3FG2P 3KBMA 1T8QA 3T8QA 3UCDA 1GUVA 3DOPA 2EQ7A 4QM1A 1GEQA 1QPRA 4NY2A 4JIQA 2Q8ZA 2R8WA 2VHLA 5EY5A 1X7IA 3IAQA 3FEQA 1ZBKA 1UR2A 3S5YA 1S38A 4ZOBA 2C13A 4DB7A 4JCLA 5AOUA 3CIXA 3SCRA 1NSJA 3RO6A 3AHVA 3SJ3A 2WOIA 5FL0A 3W2JA 1NF7A 1RVKA 4LAUA 1LRTA 2EQ8A 4F3HA 1B3WA 2AL1A 2F84A 4K38A 2ABBA 1SZFA 4XKMA 1XANA 3H70A 1R0MA 1U83A 2QF8A 4ZR8A 4GY0A 1GCYA 5DQPA 4IT1A 5BROA 5FEWA 4PRTA 5D02A 3TXZA 4J56A 6XIAA 1M6IA 2B0MA 1S5WA 4MYXA 4AD1A 3M41A 4DJDD 3O07A 1ZZMA 1L0PA 5JH1A 4UQBA 5HWJA 3UJRA 5AECA 2D73A 1GVIA 4Y9AA 4UIOA 3EB2A 1K6AA 2JKEA 3R10A 1H5VA 4IGHA 3N11A 2WZIA 3MUZ1 4IUGA 3E38A 1XINA 3QW4B 3VIGA 4LJ3A 5LXXA 2XVGA 3QMTA 2BC1A 2FPTA 2NQHA 4ICCX 3FV9A 4CGTA 4W89A 4FHAA 2OVLA 4H9MA 4JCMA 1GOQA 1W3HA 1AK5A 1QK2A 2DZSA 2FZDA 3KZSA 3GXMA 4GYFA 3KBJA 3AIEA 2X1RA 1JZ4A 2QPXA 3C2VA 4GIAA 3SAZA 3RR4A 5A6JA 1XLFA 2QKFA 4AZCB 4EKJA 3PZUA 1JUBA 2VTFA 5T91A 2Z29A 3OQEA 3OQ8A 3HPZA 3I10A 4XZNX 3TWBA 2PBOA 3TU9A 4M19A 3WFAA 1RY8A 4U3AA 3RR1A 4TV6A 5C2GA 2BASA 3UGRA 1YDYA 4J5NA 1YDNA 2VZVA 1UKTA 3M5YA 4IIGA 1W3IA 3ZO9A 4NX0A 4S1FA 3VNMA 4QQUA 4LVDA 2NX1A 2RGLA 3GNXA 4GVFA 2E6YA 4DLMA 3W7IA 2J6VA 4XVDA 3B8DA 4S3CA 3MVTA 1UWTA 1E9YB 3LHVA 2VM8A 3CS2A 1QPOA 1ISYA 1EYWA 2CXGA 1VP5A 2DUXA 4XAPA 4NI8A 3GBEA 4LBSA 4L6OA 3WH7A 1ZHAA 4WKHA 3BMVA 2FH6A 5LIKX 3MP5A 3B0YA 1KD0A 4AZ6A 1J2WA 4ZO6A 1B3XA 1O5KA 1ZUAX 3T1GA 3EMCA 5D9PA 3HIJA 4OE7A 4PTVA 3S47A 1CB7B 3A5FA 4Q7IA 4P61A 2ZA2A 2E09A 3BLDA 3QMSA 2VWSA 5U1OA 2YVJA 4LUIA 3DFYA 5F7UA 1B4EA 1A0EA 3MS8A 4FNRA 2WJEA 3EMQA 4HMDA 1M41A 2PU0A 5AYZA 5JU6A 3OYZA 3CV1A 4DZAA 1W9UA 3GM8A 3WL0A 3PG9A 2PWUA 3ZMRA 4F48A 2PDCA 1Q6FA 1ESWA 3LD5A 2Y7DA 4EACA 3N14A 5BU6A 3SY5A 4MYAA 2IKIA 2V2DA 1CXLA 3URAA 4H6QA 4B9ZA 4JAWA 2CIPA 2J7CA 3S8HA 1EJVC 1LBMA 4HGXA 4A35A 3ERPA 3USBA 2PDXA 5AHMA 4H9ZA 1I2PA 3CGCA 3MUCA 3G3DA 1IZCA 1T41A 3C0QA 1DL3A 2OT1A 3LGEA 4DXKA 5K9DA 2DT0A 3MSDA 4C1NA 1KRBC 1BTCA 1BYBA 1H61A 3A22A 1FHDA 4Q7NA 4I7UA 3LV6A 4F0HA 3W6YA 2PCQA 2W79A 1KV8A 2AMGA 3W7CA 2R9RA 3RRXA 4X0NA 3UYIA 1L2QA 2WJFA 3TW6A 3M0XA 1ICPA 2VP8A 3QHNA 3SW6A 1HJWA 4LUSB 3H4KA 2F6UA 3NO3A 3NQEA 2JKPA 3QV7A 5I0DA 1GJWA 5I7GA 3SIMA 4E2BA 7ENLA 1GOOA 4DYJA 5FJJA 1EL3A 1VLIA 4DUXA 8RUCA 2FVMA 2XWEA 3W84A 2V3BA 5FJTA 4JYFA 3IGXA 3VDAA 3N2TA 2NUYA 4PUJA 4NX5A 3NO1A 2D24A 2RJHA 3F5KA 4MZYA 4OQVA 1OYAA 2WKGA 3H55A 5IDIA 2OYKA 1TUXA 4L4LA 4IP5A 4E6MA 3SCOA 5I79A 3V18A 3P81A 1YE4A 2WP6A 1C9DA 1MZRA 4HPGA 3LB0A 3R6IA 2VUNA 2QZRA 3WDIA 2BP1A 4Z2KA 7TAAA 2QCGA 2Z4GA 1A3XA 3PM6A 1CXFA 4BF7A 3YPIA 4B5NA 4JZ5A 4M6VA 3SN0A 3BQ6A 1YRRA 1BSIA 3HG2A 2WWDA 4HNNA 1IF2A 5EB8A 5A6LA 1JCMP 2YL6A 4LUYA 3S3GA 4JFTA 4AHQA 4F66A 3V1PA 4DZHA 1Z9AA 4JQ3A 3VOGA 3OGVA 4D1JA 2CZEA 4FIRA 3LRMA 3NZQA 1ZS2A 4PZVA 5FF2A 2PDKA 4FLRA 2FTYA 1PBGA 3OGRA 5C71A 1W3JA 5EMUA 1RQEA 4KCVA 3OVPA 2XFRA 2FVLA 4I8DA 2F8QA 4HMCA 3HPFA 2QT3A 2R91A 1GJPA 3EX6A 5LIWX 1UR9A 3MSYA 3GDBA 1G0CA 4F9JA 2VFEA 4F2TA 3WEZA 3OBKA 3UXIA 4GQQA 1K6WA 1RA5A 3B4UA 3L65A 1BVNP 4B3LA 3MJYA 1NOWA 2CZ5A 3AI0A 3H2EA 2IPWA 5AVHA 1F07A 1J0JA 3HGJA 4O18A 4D8AA 4HNVA 3TAKA 3A4AA 1E51A 1UIOA 3B0VC 7REQA 3F5LA 4NASA 1WP6A 4AF0A 1MO0A 2ZUMA 3GRTA 2MUCA 1TUFA 3R0DA 4NXKA 1T96A 4ZOHB 1F8IA 3CHVA 3IJLA 5U4NA 5C2CA 4F0RA 1A5CA 4YNGA 4C6QA 4U33A 1TTIA 1QNQA 1EXBA 3QSTA 4WXZA 3KTXA 4LYQA 1L8PA 1R9ZA 3OP2A 5AHLA 1OADA 1JOAA 3GFYA 4LUTB 1KFWA 1LWHA 2DSZA 1FRBA 2VX5A 2WMIA 4Q8TA 1Q1WA 2VFFA 3IJ6A 3EWDA 2NQLA 3E0FA 4GC4A 2DIKA 2WQPA 2TODA 3ITTA 1KKRA 2ZVRA 1EH9A 2YCLB 1DJQA 1V4YA 3BW3A 1ITCA 3T9PA 2FFIA 1XXXA 4YL2A 3BOLA 4JQAA 3AMLA 4IUOA 4I7VA 4LU0A 1KGXA 2XINA 4C7FA 3OVRA 8A3HA 1M01A 3S83A 2OZ3A 2W54A 4J57A 3THQA 4B5XA 2P1FA 4HNLA 2HNHA 3EWBX 4GKLA 4C6KA 3S1VA 1TYPA 3EMZA 1BF2A 3FYPA 4G8TA 2EG8A 1IEQA 5F1UA 4O17A 1AL8A 2VRJA 1XIGA 4ICNA 3TWAA 2AQWA 3QV6A 1TE6A 1IQ8A 3UQNA 1HJSA 3LZ3A 1OT1A 3NA8A 2NV9A 1FUYA 1TO3A 1BQGA 3L0KA 5G1TA 4EVZA 1DORA 2Y0FA 1XW8A 2J6XA 5K9XA 3I7RA 4HT3A 2Y5SA 2P0OA 3TNBA 1PEZA 2WSKA 4GHRA 1UASA 4MWAC 1VRXA 1Z41A 3PN8A 4UNKA 1KCLA 4NNCA 2J62A 2EPMX 3ZYZA 1EUNA 1P7TB 4FP1A 4CNPA 1SR0A 3AWNA 4GZ7A 5CAHA 5D09A 1B54A 1IT0A 4DY1A 4TVWA 2X2GA 3VKBA 1Y0EA 4IISA 5LNRA 4H01A 3C2YA 1C9WA 3EOOA 3N9KA 3DXIA 3W6LA 4GQBA 1IHIA 1MFVA 1KQZA 1EX5A 2X8GA 3RM9A 3SUUA 1F2JA 1GQIA 4IL2A 2ACRA 1NDWA 3V0TA 4L56A 3KFTA 1S2UA 1OM0A 3AFBA 1YBQA 3HJZA 1WDPA 3O6CA 5BU9A 3FHAA 2EPLX 2C0AA 3FGCB 4A2RA 3WLNA 2ISSA 2VX7A 5ABEA 4DJFC 1AUSL 3GDTA 1V3MA 4GY1A 1GG1A 3PNZA 1AMKA 1EJWC 4I7WA 3WUBA 1MEIA 2KX9A 2Y70A 4BF5A 4C6IA 4DAFA 2W3RA 3WF4A 1A5LC 2B81A 2IMRA 3F4DA 3IVUA 1CTNA 3IVSA 4QNEA 4QS6A 3M43A 3TA9A 3PJWA 2ZCGA 4LC8A 3APYA 4RW3A 1S46A 2NQ5A 1CNVA 1ZP4A 5CPNA 2V30A 3LXCA 3KHJA 5ABTA 5FSEC 3GTFA 1E5JA 3S6DA 1JXJA 5A8PA 5A8OA 3CV2A 4TVDA 1WZMA 1PKMA 3UWVA 3NGFA 1GVFA 4KFNA 1DIEA 2P53A 4H8VA 4Q8PA 4HNUA 1JI1A 1OG6A 2RKXA 1C8VA 1N2VA 2Y1HA 5DX7A 1EO7A 4V27A 3PG6A 4I5UA 4JX5A 4UCFA 4CCZA 4MKNA 2YDSA 1NOUA 4A21A 3WJWA 4WUIA 2JF7A 4EPBC 2XZ9A 4P8WA 1ZFJA 1UBSA 2J7GA 3CPRA 1TVNA 3FSTA 1X2GA 4Q6JA 2Q3RA 3RLVA 4GYPA 1FHUA 2I1OA 4HKPA 3UXAA 2HK1A 1NQKA 2ZTJA 1SW0A 1GVRA 4GIYA 3SZ8A 3POHA 4WDXA 1KRMA 3MO4A 1US3A 1HJVA 1O7AA 1U1UA 5BXPA 3AZRA 1ISVA 1KTNA 2E77A 3WQ5A 3OEXA 4QDWA 3ZVIA 1BQCA 4MB3A 3PSVA 2DSUA 3AXKA 3B8WA 4BA0A 4H4VA 4UTWA 1IV8A 1XD0A 2E9LA 1FFVC 5XIAA 1W9PA 2DFAA 3SEPA 2ZUNA 5H8UA 3ID7A 3ZVHB 4W93A 2GQAA 3IGHX 1J6OA 4R3UA 1NH6A 4LTSA 2ISDA 1X1OA 4PMQA 1E72M 3WLJA 3FJNA 1XS2A 3W71A 5I6SA 2ZZ5A 1K7XA 4C7GA 5D33A 4G9PA 3KCJA 4K39A 3INPA 2EHHA 2ZZ6A 4N7QA 3UG5A 3P6LA 3BG3A 2OQLA 3WH8A 3NQGA 1K8XA 4RZBA 1PSCA 3PPHA 3QKEA 3WQWA 5LA1A 4EAMA 2V6OA 1VENA 5M03A 1W0MA 4US6A 3T78A 2XM1A 4IXXA 1AZ1A 3JUGA 3UPMA 7A3HA 3ABQA 2CC0A 4YN5A 3QFWA 3L4TA 4YPJA 2Q09A 4XSLA 2O9OA 1M68A 4C5YA 5G4EA 1XRFA 4R27A 4DWSA 6ENLA 1A49A 1HQTA 2BFGA 1XH2A 1G69A 3WUGA 2CLMA 3QQ1A 1JDEA 2GJLA 3ARVA 1TYGA 2NPXA 3PBGA 4IICA 2OZTA 4R7JA 3DHDA 2Z28A 4L80A 4F40A 3GAKA 2VMFA 3F7JA 1GWJA 2TMDA 2JBMA 4MPQA 1ZKQA 4W7UA 1H1NA 2X05A 4AIUA 1KBKA 3BOXA 2AL2B 1LL7A 3FA4A 3W0KA 4AYGA 3P2VA 1EF2A 4FA3A 2E4TA 4BI6A 3PAOA 1KO0A 1AOGA 2B7PA 1UHVA 4H00A 1MQQA 2I17A 4DPQA 4J28A 4G1KA 1E73M 4RZ5A 4UNIA 3PZ9A 3UJSA 4DO7A 4HP5A 4A29A 4MLJA 3LX9A 3VK5A 2W27A 2XH4A 5E5CA 2OCZA 5AVNA 2JEQA 4AYSA 1NHQA 5E9AA 6A3HA 1P6WA 2PEVA 1KB3A 4GVIA 4WJEA 3VUPA 3LQGA 4ZQRA 1VB9A 2VR2A 4DVOA 3AYSA 5A6AA 1VYSX 2G3IA 5HJYA 1GYLA 4NRRA 4FB7A 5C70A 2VO5A 3GZAA 3OODA 3TFCA 1C92A 4YJ5A 3LTYA 2FZ9A 4AZ5A 3I6TA 4DO5A 5HUPA 3RXZA 1LRQA 1FTXA 5FD0A 1X97A 3W7KA 3MZNA 4TX9A 3U3HA 4GD0A 1RK6A 2CLOA 4NU7A 4LB4A 3M44A 5DY2A 2ZZ7A 3WNPA 5DT5A 2FHFA 3BICA 4LY4A 2QV4A 1LWJA 2RUSA 3F2DA 1EOMA 3AYVA 4MUZA 4N9EA 2V0TA 4Q8NA 4IQDA 4HU0A 4UZSA 2GDQA 2HDJA 4UR9A 3W1LA 4EMJA 5E0CA 4NZCA 2WCAA 2YAUA 1EP2A 3W1NA 4ZQCA 4X2RA 3VNYA 1UOZA 1EGZA 3TR9A 1JRPA 3A6OA 3H4GA 4MWAE 4WHBA 1X39A 1XIMA 4WY0F 3AHZA 4QR6A 1K9DA 3L8KA 1PHWA 3CHDA 1N5WC 3UXDA 1C7TA 1H0GA 4H4PA 4WXYA 5J04A 3HQPA 4CQDA 3W7JA 4PR4A 4GE8A 2V5DA 5I09A 1PPIA 1W1A1 3CUHA 4K7YA 4G7EB 4PCTA 4AD0A 2WNZA 3L0GA 3AXIA 3VD7A 4FXSA 1M7PA 2Y62A 3LTSA 2HE8A 3QM3A 2A6LA 3NQMA 2D69A 3E02A 4MAVA 4ZB2A 1NFPA 4M0XA 3HPSA 3ORWA 2Y63A 1VBRA 2VZUA 2XISA 1HKVA 3W2UA 3G1DA 4GRTA 1UR4A 1WZLA 3GW0A 1TVLA 2INFA 1RD5A 1GZGA 4OBSA 1GG0A 3GW3A 2FJUB 2X42A 2PURA 5AC5A 1OGSA 3U4AA 4CNNA 1NHPA 4I5RA 4FX7A 3VNJA 2AAQA 4P8VA 4O28A 4YMZA 3VI2A 3OJGA 1GV4A 1AJ0A 3N73A 1DWJM 3GG0A 3GFXA 1BKHA 1ZBWA 4LRTA 3TV8A 5EBAA 2BBFA 1W56A 4MTVA 1MO9A 2G0WA 1BF6A 3MYPA 2OO0A 4WD0A 1SJDA 1QTWA 3OLEA 3FA3A 6TAAA 4M3PA 3I3BA 3UCCA 4ZQMA 2WO5A 3PG8A 3TYUA 1LUCB 2REQB 2G3MA 3TP4A 2MNRA 2I14A 4HOWA 4HYRA 5FCZA 2GRTA 4N02A 2X1TA 1ALDA 3ETRB 9RUBA 5A2BA 4Z0JA 3HMJG 3VGFA 3NYZA 2YDQA 1UD8A 2G8ZA 3W7DA 2HE5A 1ZSXA 1ENUA 3SI9A 4NXSA 1YHTA 1HL9A 2ZX8A 1ECQA 3H4WA 4YYFA 3R13A 4KIRA 1ZENA 2Y2WA 1OZQA 1V7AA 3VKCA 1WUFA 3G1VA 3EWXA 3EPNA 1ITXA 4RE3A 1UZDA 3HB9A 1YKWA 3ZSSA 1M65A 3UEQA 3OIHA 1NIUA 5TAOA 3HGSA 1OINA 5D8WA 3C56A 3SN4A 2VC5A 2YA1A 3JRKA 4PTWA 1O1ZA 1JZ8A 4M80A 3Q6JA 3VGHA 1E0UA 1Z7AA 5SWUA 2CFFA 2VC7A 3WBYA 4UTHA 2QGYA 1NWTA 3B9DA 3ARZA 3KDOA 4GISA 2WZHA 1NHRA 2J8FA 4IFOA 3THAA 3UWYA 5A2AA 3VZZA 3CQHA 2QW5A 3AMZA 3FW6A 3G0SA 1RALA 3WUFA 1YNPA 6REQA 4NF7A 2DP3A 1KFCA 4H83A 1OJXA 3GVQA 3KRBA 5I78A 1VCGA 1Q4NX 2PGRA 5BNKA 3G22A 4DF0A 1W9VA 3H7UA 2C16A 3N4AA 2J9ZA 2VGFA 1IXOA 3QZ6A 3AC0A 2ZRUA 5D37A 2OEJA 3AJXA 4BQ2A 1JDDA 1OC5A 2GLKA 4DWSD 4PEKA 3PFMA 2BVYA 2HISA 4C6CA 2PFHA 4KWUA 5HMDA 4UTMA 1R2SA 1TPUA 2VOTA 3PPFA 2Z0IA 3UG4A 2BDQA 3C8NA 4YHEA 4EM3A 1S39A 4FLSA 1TV7A 1VFSA 1UA3A 1S5VA 3CB3A 3IK4A 3L7RA 3V5FA 3I7QA 4M52A 5A6TC 5HANA 3WDJA 4M7SA 5JCNA 1LJYA 2HS8A 4EF9A 3R0UA 1VCVA 2QAEA 3LBCA 3P0WA 1R2RA 4J3UA 4XAYA 3M47A 1RCOB 3LHWA 3IACA 4APNA 2E40A 4FNTA 1L8NA 2V9DA 4HCDA 1V8EA 3LCWA 4MFDA 4RV8A 3FK4A 3B40A 2XYLA 1UP0A 3TN3A 1TV4A 3CT2A 2EG7A 1I9CB 3LGDA 4LF2A 1YDOA 1CGWA 1CW2A 5HNUA 1HVXA 4QRNA 1TPWA 4GK8A 2VEMA 1UG6A 1TIWA 4HB7A 3VGGA 3VKAA 1JPIA 1NDAA 3AMKA 1GRFA 4ZCWA 3SURA 3R11A 3WLTA 1TMHA 2E1DA 2A7RA 1QI4A 2PDMA 3PJXA 2ABAA 4HHLA 5A3HA 3S2JA 2XVNA 1GPWA 1MEHA 4TX6A 3QPEA 1JJKA 3T44A 2YQUA 5HAOA 4XBKA 4B2DA 3AS2A 1P0BA 2VRKA 1FWJC 1MQPA 3ITOA 3TSBA 2VZTA 3DHUA 2XJ7A 3BMXA 1EDTA 4IIHA 4XZMX 4UQEA 3TCEA 4GBUA 2ZUWA 1WE5A 4GBDA 1J6PA 3ZT5A 1TV2A 4K1GA 3GDRA 4O4VA 2A21A 1QAPA 1RK5A 1UYQA 1WA3A 1ZP3A 1JQXA 3MHFA 1Q45A 3GSMA 3TLQA 4IQEA 3TQKA 4GYPC 4XD4A 1POKA 2XIMA 1RM6B 4WVXA 1GQNA 2VELA 2X8RA 5REQB 4DHGA 1BHGA 4HK5A 3CAWA 3WF3A 3JZUA 3HN3A 2YFOA 3ZQ9A 5AHEA 5JXQA 1GHRA 4KIEA 4AZ7A 5CLWA 2GQ9A 3U5YA 4XAGA 4YVPA 2QJJA 1E6QM 1EEXA 4F8XA 4P7QA 1LOQA 4LT9A 3JS3A 3RAOA 2QJMA 3C52A 4QXIA 1I1XA 3GH5A 4XZHA 4UTWC 2P50A 1ZTVA 3KOZA 1UKSA 1XQLA 3VILA 2VYOA 4DBSA 4KWWA 3WYZA 4HU3A 1AD1A 3WLRA 4C7DA 1D7FA 4NYYA 2FGLA 1HO1A 4PEEA 4GUGA 4IXHA 3W25A 3UVIA 5I3KA 1HT6A 1SFSA 4H4SA 1XKYA 4L64A 3IARA 1W8GA 4ADSA 2GK1A 1EJUC 2V3AA 1S1RA 4X0VA 4GYKA 2ZZ0A 4RE0A 1J18A 2GGJA 4F0SA 4YWIA 2WC7A 4H4QA 1WBJA 3WQVA 4ZENA 1OBAA 3ARRA 4FNUA 4GUIA 3CUGA 4HZMA 3LPPA 4UTFA 1JZ5A 1VKFA 1F9CA 1S2TA 3RGTA 1LBFA 1A53A 3S0CA 4LY8A 2GGEA 3GDLA 2PLMA 4MY9A 3MT1A 3NQBA 2NUXA 3F5JA 1K7EA 3AMDA 4H04A 2ZUUA 1XIHA 1D8WA 4E2VA 3FNDA 2PDWA 1XLMA 3HFTA 4QCFA 5HPCA 5KEZA 1IYXA 3LPFA 1DTNA 3CQKA 4GX8A 4C6FA 1WDSA 3QEZA 4DWSC 5HATA 2POTA 1THFD 4ES4A 3KTCA 1LRNA 1HF6A 3N9RA 3RRAA 1A0CA 1IGSA 1WPCA 5AHIA 2OWWA 3N15A 3LBOA 3WDRA 3N19B 3E5PA 4NAFA 5XIMA 3D6NA 4KEZA 3H2NA 3WFLA 1J4EA 1NY1A 1U5HA 4H4RA 2XPKA 1U1JA 3DFTA 3DESA 3IK2A 3L4WA 4KETA 4PUMA 3SDOA 3TUUA 4U5IA 3BSMA 4UTTA 1KC7A 4H8NA 1O1HA 3VAVA 1D3CA 3LNPA 2V67A 2OGJA 3BZJA 4ORIA 1K03A 2VZOA 4PE8A 3SGGA 4P7NA 3SY8A 5EBUA 3DECA 4LVBA 3UR2A 1HN1A 2GDVA 3REQA 1RLDA 3O05A 2VOMA 5FJPA 5AY7A 2CLKA 3H6OA 4QJ1A 2YZ5A 4B5UA 1PUDA 4YLWA 2DT3A 4UFJA 2YCKX 1HJUA 1UUOA 2H9AA 4LB3A 4JYEA 1OFRA 4CQBA 2YBTA 2ZX6A 2WOQA 3T55A 3CHEA 1I1WA 3RPDA 3KZPA 3IUIA 4MJ2A 3WQ8A 1S2WA 2IUZA 1QI3A 4ML9A 1XH0A 8TIMA 1OFBA 1E1CA 5F2MA 2R6OA 2GQWA 4CVUA 4RZ6A 1DXIA 1CXHA 3BK0A 1NOFA 2VCBA 2A7NA 5I03A 4UTIA 4DUVA 5K9CA 4BS0A 5HNRA 1EJRC 2WVVB 5DLCA 4AU0A 5BRQA 2C79A 1T6MA 1V3LA 1K8YA 1H51A 4LA1A 1HGYA 3LBMA 3BAYA 3SR6B 5EMLA 1YXYA 1LQ2A 2DH2A 4DJED 2E3ZA 2WPGA 1OIFA 2ZXBA 4AZIA 4K37A 4AD3A 1TMQA 4LGXA 5BMWA 4IX2A 3CXBA 3C2FA 1O5RA 2BVWA 5FEXA 2X2YA 3A13A 3K46A 2ZUSA 1GYMA 1VBHA 3B9NA 1J0YA 2PD9A 3NDYA 4TV5A 4WX2A 1J01A 2GOUA 4AG0A 5JIPA 5LSMA 3BJSA 1GW9A 3KVJA 2EPOA 3U4FA 4LAZA 4UTJA 2VGIA 5CLTA 5CSRA 1MI3A 3P62A 5DANA 2PDPA 2HJPA 2WZMA 4BR1A 1FWAC 3BLFA 1RBLA 1N8WA 3B9AA 2ZX9A 4E2OA 1UA7A 2AKZA 4U2YA 3LS9A 1W37A 2DW7A 4IMAA 3T4WA 1VJSA 2O55A 2AQVA 2QVNA 2V3FA 1OCNA 2BHYA 1Z48A 3PJTA 3NYDA 2BZNA 2WXDM 1RJQA 3UBPC 4HTYA 2QQ6A 2YW4A 1I60A 3II4A 1ISZA 3V35A 1OK4A 1NPXA 1KW1A 3W72A 5DCEA 3P74A 3MTWA 1QJWA 2QHAA 1OFEA 2WM0A 3TE9A 2G3FA 3FCPA 4O19A 3MMDA 1LROA 3TYCA 4FS9A 1JEZA 2QAPA 5KSWA 1EP3A 4FNPA 1C8QA 3JVAA 1SMAA 4E38A 2RDWA 1R6WA 2EGZA 1UKQA 2ZXQA 4NHVA 4ICMA 4DO4A 2PA6A 4DEFA 1YPIA 4LFYA 1EEPA 1O12A 2E6AA 4QDPA 3T0AA 3ZLFA 2YXOA 2VGBA 1TV8A 1XV8A 1EXPA 3N29A 4NZ5A 3S4TA 3MSRA 1J93A 1V08A 5DMYA 3VNLA 2QLYA 3BAKA 4FIQA 3WG6A 1OFAA 2CWNA 4HD5A 2ODOA 2QYGA 3SECA 3LPOA 3EWYA 1QDSA 1XM3A 1A5AA 3CIVA 2OJPA 1SFJA 1OYCA 1N61C 4TMCA 3IIOA 2QPSA 3R2GA 3FX4A 3QF0A 3GC2A 3OBEA 1Q6LA 2WSYA 1H0IA 4LRSA 1FCVA 4GJ1A 5HULA 3WQOA 3PANA 1AH3A 4E2DA 5LIYX 3C3NA 4JTLA 1JDCA 1ITUA 2J7BA 1TQXA 4QE5A 1XHGA 2ZZ2A 5IDZA 3MQTA 2R1PA 1B57A 3BH4A 4GINA 1VBUA 2QULA 3TZFA 1ECEA 3SCVA 3N2BA 3E0LA 4J9JA 2VX4A 3ONCA 5ABFA 3A3XA 4RPPA 5CC3A 1WBHA 1W9BM 5F2IA 2DVTA 4PH6A 3R1ZA 2QV5A 1RPXA 3B05A 3HG5A 1GQLA 1Q2RA 1JL8A 1FHLA 2OMAA 4FAMA 3RO8A 4KRTA 4LUJA 3LOTA 1LBLA 1ME9A 4JTGA 4YWSA 1JCYA 2XIOA 3ZT7A 3BUVA 4HBKA 2NSXA 4WY0A 3HG3A 2XVPA 3P8IA 1PCWA 4QIUA 2G3NA 1WX0A 2XM2A 3LMZA 3ISIX 3G1YA 4RLIA 2FGZA 5KZDA 2PBGA 2P5NA 4MY8A 3BJFA 3AIVA 1DE5A 3CM4A 2YX0A 5I77A 4S3DA 3CJPA 4AXNA 1LOLA 2DZBA 2GSJA 3MMUA 1H7OA 3PFRA 4S3AA 1TFVA 3AWOA 3KRSA 2UZ9A 3B8IA 4WDTA 4UXDA 5CBIA 2PD5A 5G1YA 4LBRA 3HA1A 1XG4A 1ZJAA 2CLHA 1PE1A 2CEQA 5CEWA 5TR3A 4LOCA 1GT8A 2C15A 4ZVJA 3CGBA 1FIQB 1OCJA 4HSNA 2MANA 3PSWA 4CQ8A 3OTRA 1OCBA 1UZHA 3HMCA 5K4XA 2ISVA 1ZNNA 4D6JA 2I7GA 2VFIA 4US5A 2PZ0A 5DXYA 3S42A 3K4AA 5G5IA 1XGZA 4GWEA 1UROA 1AZ2A 1G01A 4IPNB 1EOKA 1PVNA 3BJTA 3UR5A 1DWFM 1K1DA 3NAVA 1KXQA 1XPYA 4C1NB 3BSHA 1WAWA 4GZJA 4ERIA 1W5MA 2JE8A 3EAUA 3QFBA 3BQ5A 1JG9A 5DBTA 4Q8UA 3BE7A 2XIIA 4MB5A 1F74A 2NLIA 1UWUA 2WW5A 3E12A 3V5OA 5KZMA 4JTRA 2UY3A 3G1FA 5HXMA 2EF9A 2VC6A 4PUKA 1Q6RA 2D2JA 3PBWA 3GTHA 2X50A 5F1VA 1CLVA 3B3DA 4XQ6A 1D9EA 1PCKA 3TC3A 3BV4A 1M5WA 4E5TA 4KMQA 5H91A 3VNZA 3KW3A 3E74A 2IXVA 3C2EA 3R89A 3VIHA 1ZU8A 3ITCA 1XLBA 2BB0A 1TVPA 2QUNA 2V3EA 2YCJA 3QPYA 1OFPA 2X99A 4H4TA 5M1TA 2X16A 1YMYA 4XBJA 3QVQA 1LF1A 3EPOA 1WDWA 1JPMA 5GVJA 2G3JA 5EMMA 4NQ1A 5EMYA 5EGRA 3W7PA 1O5QA 1VPQA 1F61A 1FWDC 1XYMA 5FIPA 3ZSTA 4RDWA 1CZ1A 1FCQA 1RH9A 3WF2A 2QJHA 2ZVIA 3TJXA 3STEA 3RX2A 4MMWA 2UBPC 4LYKA 4M81A 4OZOA 1JFXA 3Q4DA 1QWKA 4R34A 2VFGA 5IHSA 3N2XA 5HA7A 1V51A 5I2UA 4GIRA 1OD0A 4FO4A 3MA8A 3C6CA 3NVWB 4C6JA 3GR4A 3LK6A 3GR8A 3I6EA 2EKGA 5JBDA 2QCMA 2A3EA 4BQ5A 3XINA 1Q13A 1M6JA 5EKYA 3NL3A 3EX1A 3GTXA 5I3IA 3CLMA 3KBNA 4Z2GA 4XUYA 5M17A 4XZLX 2CZFA 1GKPA 3ES8A 5I3FA 1LZOA 3B9JB 2P76A 2W92A 4TVUA 4AWSA 1UKOA 4KESA 4B9YA 3UT0A 4NAEA 1UZ4A 3UPBA 4HOZA 1PIGA 4IIEA 3LXBA 3SGUA 2E0PA 3NG3A 1OB0A 3FXYA 1FY6A 9CGTA 5AC8A 4MSSA 2ZZ1A 4LAKA 1OWQA 1U2YA 5HMEA 1UCWA 4L6DA 3EKGA 4UFKA 3AM9A 4EIVA 2Y4SA 2J77A 7REQB 2E25A 5E70A 2FPVA 4KRUA 1CGUA 4JS3A 1LLWA 1XH1A 1UD5A 4L7ZA 3QOMA 2XFWA 4PCFA 1YTEA 3GXFA 3VIIA 4YTSA 2RFGA 1KM3A 1A5SA 4MVAA 1WAUA 4YWOA 1E1EA 4ZQOA 3CQJA 4BHYA 1PV8A 4AY8A 1OK6A 5FEPA 3DBPA 1SVDA 4E3TA 3EB3A 1XL9A 4FNSA 1QOQA 1DEDA 4CU6A 1GTHA 1UC4A 4GXWA 3OZYA 1UB3A 4H4ZA 1TA3A 3AOFA 4L61A 4ZOEA 2WMIB 3B0PA 4R5EA 2PDNA 1EWEA 4A2SA 3NS1B 4KKXA 2PDYA 3W73A 3MC5A 4D9PA 2VC9A 3DGRA 1LL4A 3DERA 1DJZA 4W7WA 4NRSA 1O95A 3VM5A 2ACUA 4H6KA 1MXDA 3WD2A 2VFHA 1TTPA 3MKCA 3H2AA 1H6VA 3G1SA 4IMDA 1HKIA 1NU5A 1R5YA 1WKYA 1EUAA 4HPXA 5BWAA 1OZMA 1EC7A 5CPTA 2Q01A 1VAHA 3CASA 1V03A 2GJXA 4FPSA 1C91A 1R3SA 4MLRA 4Y9PA 2A8XA 4JNZA 1Z6KA 3DGHA 3CB8A 1W3TA 1TV3A 2VFDA 2NXHA 3A3WA 3LXAA 3CWOX 4J7RA 1TIMA 3GIQA 1F6KA 3F03K 5BRPA 1VFMA 4O14A 1UH2A 2PP1A 4ENLA 1NVMA 4GPNA 3KLLA 5AFDA 4H8UA 3GKAA 1BGGA 3RLHA 4GR1A 3WD4A 2Z7KA 3H8AA 5BXSA 4FXRA 7CGTA 2CKSA 4ACZA 4ADTA 1DWAM 1H7WA 4EM4A 1XIEA 1WO2A 1ITQA 4GQRA 1I0DA 1SZEA 3OA5A 4C6EA 1VR6A 4GGBA 2YPIA 4MPKA 3CHFA 1N82A 4XIAA 3UWEA 3AQUA 1XCWA 3NPVA 4AZCA 3IAPA 2WHJA 1UD2A 2X0SA 3EOLA 3W75A 2AOSA 4MDOA 4BZYA 1F6PA 3FDGA 4CQAA 3KP1A 1AJZA 3TNOA 1C3FA 1KBBA 4GO9A 1PHQA 3UR7A 5E1QA 2YYUA 4PUWA 1V79A 1XKJA 3H22A 3LZ5A 2ZRYA 4F0MA 3QTPA 7ODCA 5CBBA 1S2VA 4XZWA 4HN4A 1QNRA 1XFCA 1RBAA 5J5DA 3E49A 4L4OA 4AEFA 1TX2A 5AKQA 3AMCA 1F6YA 1JNEA 4I90A 1FKXA 2VI0A 3D0CA 4P5UA 2ALRA 2OX4A 3GVVA 4K8HA 4J2MA 2PP0A 2YBVA 3OZMA 2QCLA 1NJJA 4K8DA 2PDUA 3RK8A 2PZNA 4KPRA 1XLCA 2BODX 1XWYA 3T09A 2W66A 4JN6A 1W9XA 2BHZA 2J8TA 4NEWA 3PWAA 4KF1A 4UFMA 3KEHA 3GLCA 4I9TA 2ZUTA 3UWQA 1UJQA 2J8GA 4C1KA 1JRBA 4GJJA 4GC3A 1E71M 3VM7A 1GZ1A 2VDHA 4KCTA 1DXLA 2OGYA 4W85A 4NJKA 3TN4A 3LPGA 4EQSA 1GW1A 1NM9A 3O0FA 3ME3A 4UQ9A 3NUKA 2DSKA 3NQ7A 5MKGA 2HS6A 4KRZA 1WKEA 1E3XA 2I5QA 4Z1AA 5TBOA 4JKLA 2G95A 3E9AA 4QG8A 1Q85A 1UMYA 3M0KA 1XIDA 1PTDA 3LN3A 3WD3A 3KCOA 3WK1A 4ORMA 4H9YA 3PJUA 4ZTYA 3CZEA 3BGAA 1JVNA 1CBGA 1W8SA 3LMYA 4KCUA 3NVDA 2D0GA 3M5XA 1EC9A 3GO2A 3SB0A 3C3UA 1E6NA 3QLLA 4UNLA 2ZX7A 3EDFA 1JRCA 4DM1A 1XLHA 5I07A 3DBNA 4HTBA 3DX5A 3PZTA 1KNWA 5E6ZA 1H2IA 4AVOA 3TW9A 4UB9A 2PLKA 4TTUA 2PGFA 1Q7MA 3MY9A 3N6JA 4DX3A 3NM3A 2YYTA 4H4UA 3WH6A 1PKNA 2WSQA 3HPXA 2DQWA 3CU2A 3M0MA 1HFBA 2FTWA 3F4NA 4I8YA 2EQ6A 2W62A 1JULA 1YTDA 4IGNA 3NZ1A 5GJPA 2QCNA 4H7ZA 1Y5WA 1QXLA 3KRZA 2IQDA 5CPLA 1E5NA 2QJNA 1IT7A 3W2KA 5FF0A 2YSWA 4GABA 3NSMA 1K4GA 3HO8A 2OYMA 4O12A 1OX4A 4AUBA 3ABOA 1JUKA 3EUB3 3OZPA 1TB3A 3ZJKA 3LGGA 2PAJA 3GTNA 2ZC8A 1JCNA 1OC7A 4S38A 4PSRA 4GQ0A 3A4WA 3AXHA 3PAJA 3W7QA 1P48A 4PFHA 1ZJIA 2CWXA 5M3WA 1O6IA 1Q4WA 4TQTA 2QUTA 1PO9A 3EXSA 4GI6A 1S1PA 2FMOA 3EXRA 4ADWA 2Y8UA 4H6EA 4PSPA 1ZDLA 1EB3A 4GFIA 3SR7A 3VCCA 4JDYA 5C9ZA 1FXPA 1RUSA 3RHGA 3DG3A 2OKTA 4MZ1A 3L4ZA 4H6RA 2GUYA 4MGGA 2ZUVA 1LPFA 4MADA 1ODUA 5G2IA 3KVKA 4AZGA 1CX9A 4P8XA 2Y7EA 2QS8A 4GY7A 5C9WA 2HROA 2PP3A 5M2FX 3UWWA 4JFWA 5PTDA 4DWSB 3II1A 4CD5A 1L6FA 5BXTA 2E6DA 2G37A 4DLFA 3S6TA 1OABA 1BG4A 2Z1BA 1YNQA 3GB6A 4JTUA 4IF2A 1WXZA 1GVQA 2W0HA 3GD6A 2DZAA 2WKJA 3TYZA 1WB0A 4HU8A 4JTAA 3FYYA 3CGEA 1TJ0A 2YL8A 1E4NA 4TU1A 1KR1A 3F4WA 4E8GA 3ABXA 2JK2A 4XIMA 3VIOA 1UD6A 1XIFA 1Y7VA 3S9YA 2WNWA 2HZGA 3EDKA 1F3TA 1RJRA 3W1UA 1HNYA 4C6BA 4FDCB 4WDWA 4CLMA 3KOYA 2CBIA 2FKPA 4LX4A 2QDEA 2FB2A 5ECUA 4CQ9A 4K36A 3WX7A 1FWBC 1H63A 4H7VA 2E8ZA 1GORA 4O0QA 1N60C 3CL7A 4Q8QA 1V77A 4U10A 3HQNA 3DGZA 4X2PA 1X8CA 1Q65A 2QIWA 2QDGA 3IANA 3VIKA 1FFUC 4YVVA 3EOSA 1JPDX 6CGTA 2C6QA 2GVLA 1W1PA 3LRKA 5C2XA 2H6RA 4HPJA 4JHZA 1RBOB 1TJ1A 3DYPA 1P0DA 1R3WA 3MPGA 1FWFC 1TV5A 5FEZA 1FWGC 1DE6A 3EXTA 2DZXA 2EG6A 3IC9A 4RPQA 3W23A 4FX6M 1ZLPA 3BL3A 3TEVA 4OUIA 5BXRA 4LIIA 2TRSA 5T8GA 1IR2A 1HGWA 4KT2A 2YOCA 1B90A 2J47A 1XGDA 1TQJA 2WLZA 4EOUA 3U48A 4INFA 3OG3A 3DCPA 1AG1O 3CTLA 4CNSA 1H7PA 4AMCA 2YCLA 2EBNA 1GGOA 1BSLA 1HKMA 4IQLA 4MWAA 1WDQA 4LPCA 3AYTA 1AQFA 4XAZA 5FF4A 1P4CA 4NZ1A 3LLXA 4LWWA 1POJA 4CUCA 4HYWA 4Y2WA 5KZ6A 3CUZA 1K4HA 1V6TA 3RF9A 4Q4MA 2CDUA 3MDWA 1H41A 2WPCA 1UZ1A 3DKJA 3MV11 1PTGA 1A0DA 3KVMA 2ZFAA 2WBKA 2PWFA 4Q8OA 4OBTA 3UP8A 1ICSA 3KXQA 3T42A 1R9XA 1EO5A 4QTGA 2GVJA 1P0EA 3AYRA 1XIJA 3SCPA 5G5HB 4UR8A 4Q8VA 1DNCA 3WENA 4ZOCA 1CB2A 1FX6A 3MV01 4JDRA 2GQ8A 1OF8A 2XSXA 2YA0A 2VCCA 1SYTA 4XB3A 4ADUA 1E55A 2R1LA 4I6VA 4HNCA 3EX4A 3BPWA 3Q37A 2YGYA 3O7UA 2A0NA 4P7RA 4GCXA 3F4VA 4JY8A 4IOTA 2OOGA 1KWKA 1FWRA 1P7TA 3SCNA 3UA3A 4MAZA 1XDMA 4B5TA 5FSDC 3UERA 5DXXA 2NQ9A 5DCDA 3PTQA 4O50A 2OEMA 4EWJA 2DVUA 1FO4A 4PL1A 4PTDA 3WQDA 2DZTA 1XHCA 1O68A 2GUBA 3BWWA 4NZFA 4ERAA 3NVTA 4Z1YA 4D1IA 1OF6A 5KVIA 3PTMA 4OJYA 2I5GA 1XRSA 1UPPA 1QOPA 1XPGA 2Q8LA 3WSUA 3UZJA 3TQVA 3H7RA 4CQCA 1UQYA 1ZCCA 1W5QA 1S5TA 3TXVA 2I9UA 4G7FA 1MW3A 4L1XA 1S3HA 2DSVA 1HX0A 4H19A 1ZBVA 1LCOA 3T0BA 4GQGA 3R07C 4FLQA 4OBRA 3FGCA 1G1YA 5C9RA 3UD6A 3ATYA 2CETA 1OFOA 3DK4A 2UWFA 3NQ8A 2EXOA 4S3BA 4X22A 4MJ4A 1UUQA 4L9ZA 1R38A 3BGJA 2O4MA 4H4XA 2V5JA 2ZRVA 3W27A 3W2LA 4EXAA 1EZWA 4W5ZA 1BXNA 2EPKX 3C61A 1MXSA 4OOUA 3EWCA 3BLOA 2VQUA 1A4MA 3QGKC 3B8TA 3O0KA 1IGWA 3AO0A 4ATWA 3VKKA 5JQ9A 1FWCC 1MMFA 3URBA 3PPCA 5H6HA 4IG2A 2J88A 2NV1A 2E5CA 4EANA 2BXYA 3SRHA 4O0ZA 2ZDSA 5F2GA 3QZAA 2ZADA 3AIUA 4XUGA 1W3KA 2WSPA 3CYVA 1E4MM 3EGJA 4REQB 2YKKA 1A80A 4UCGA 3RM8A 3SRFA 1H62A 2PC8A 4POCA 2IW0A 1BLIA 3B0XA 3W07A 4ROQA 3VOCA 4NJGA 5CPSA 3M5ZA 3GX9A 2PDLA 5I02A 4XVEA 5A6MA 4HIBA 1VEOA 3IGSA 1R87A 4ZMGA 1VEPA 3PB0A 3NL6A 1SU5A 4IGMA 4HSHA 4W4QA 3L5AA 3OLGA 4QLKA 2J3NA 1CGXA 2WMFA 3A7AA 4X60A 2D2OA 3HURA 3NOYA 3MI3A 3L4UA 2FDMA 4Y9MA 4G56A 3O9NA 4KPLA 3F4CA 3NVYB 1V0LA 2A3BA 4DM2A 1TCMA 1KM2A 1I2QA 3ALGA 1XDJA 2GYIA 3I7SA 1TJRA 4DI8A 3CK5A 2ISWA 3PBMA 4FX9A 4Z42C 4HCHA 1VF8A 2EPNA 3MKKA 3TN5A 1N5XA 1JYXA 3GU2A 3VABA 4WJ8A 1WOAA 4NNAA 3VGEA 4MNJA 3GAYA 4PN2A 1UWAA 1W32A 1KBIA 1RV8A 5G2WA 3H53A 1VS1A 5CZ0A 5D2WA 4IJRA 5DO8A 3R94A 3MB9A 3CAQA 4TOQA 3TSMA 3TAOA 1XX1A 2W3SA 5TD4A 1BWLA 1MW1A 1QNSA 1TELA 2F2KA 1SZRA 2X1SA 1OHLA 2YCIX 5FOOA 3LXDA 4GFSA 2H8ZA 1BTMA 3QV9A 3CQIA 2WANA 4HQVA 4H41A 4UQAA 4LAOA 2VWTA 5BZAA 8XIAA 5C9XA 1JYWA 4QITA 4MB4A 3PZMA 4O0KA 4GZEA 4PBEA 3B97A 1GYNA 1BVZA 2D22A 1RP8A 3DG6A 4NILA 3MUY1 5E0KA 4B15A 2JGQA 4LS2A 2AAAA 4JTKA 4DO6A 3WUEA 1UBPC 1WNOA 2ACSA 1XYLA 5D30A 2GR1A 3NQCA 3I4EA 1SZNA 1V0NA 2Y88A 1QPKA 5LGXA 5BW6A 3DUGA 2FH8A 2NZLA 1QPNA 1ZY9A 1IEIA 3IEBA 3HF3A 3ZLHA 2D20A 2EEXA 5HQMA 3C0SA 4OV4A 3DKLA 1HP5A 3QYQA 4WDUA 3BLEA 1EIBA 3URQA 4D2JA 2DT1A 1KA9F 3R0KA 3COTA 1M53A 3UNDA 2NXIA 5D2YA 1SO5A 2OG9A 1LL6A 5A95A 3LHYA 1XG3A 4J35A 2PTZA 2DU2A 1S5NA 3NR0A 3FEMA 1C8YA 3DFQA 4QCEA 4ML4A 2WB5A 4FSAA 2RAGA 4MKVA 1E9ZB 1H5YA 1A50A 4GXMA 3FJLA 1H7RA 3CLWA 3K4WA 2AL2A 3SY1A 3HV9A 3GE7A 1AL7A 4F0KA 4MWAD 3ZLGA 3AIRA 1A5OC 4WKFA 4CEXC 3QV8A 5D2XA 3TLLA 3SFKA 4JIRA 3P5ZA 2V3DA 2HVNA 2XU2A 3G1RA 4AWEA 2V82A 3E0VA 1B2YA 2OR2A 5FS9A 4X9SA 5I00A 4QAWA 3OO2A 1E56A 4JTCA 1MFUA 1MW2A 2BCPA 1E4IA 3WLQA 3MBDA 4IPPA 2OX1A 1X6LA 3NCOA 3T7VA 1TPFA 4PB4A 1ZRQA 2V5CA 3D3FA 3GVRA 2I16A 4AD4A 1WDRA 3N17A 4WLCA 4Q8MA 3QQWA 3PP7A 1KRCC 1CWYA 4HOXA 2BLEA 2C19A 4DZIA 2V2CA 1YPXA 4A4AA 4DJFD 3PUDA 4E3VA 4AW7A 4PFMA 1V5XA 7PTDA 1CDGA 3S46A 3R25A 2D0FA 3N25A 3P7YA 2VEKA 5CGMA 4UC5A 3DIPA 4IL0A 4GUJA 3LSBA 1FFRA 4QSHA 4PMVA 4PUNA 3QBUA 1HW6A 2GK1B 2JKAA 2YDRA 3VPLA 1CGYA 1IWPA 5HR7A 4B4FA 2GL5A 5EMJA 3PPGA 4O52A 1WZKA 3GNNA 2CHRA 2CERA 3GXDA 2EKCA 3GD3A 4WR3A 1KFBA 3PB2A 3SCQA 4FF7A 3TOYA 2DUAA 3V5CA 3OU8A 4LVAA 2FZ8A 5G5GB 1ML1A 1YLVA 4F2BA 1OT2A 5HOSA 4OWGA 1VLWA 4I5XA 3W00A 4G7EA 2NSOA 4DNMA 1E3ZA 3HM7A 3OG2A 2VD8A 4DXVA 4KFPA 1EDQA 3A3HA 5C6MA 4W86A 4BEQA 3WDHA 3DFHA 3EAOA 5H8MA 4WGHA 3FKRA 5A2CA 3DH7A 1N8FA 3L9CA 3MUIA 4LNCA 2HXUA 1XBZA 3AN1A 1H7NA 3M64A 2D23A 5KTLA 5A8MA 3W7LA 4ATDA 1CXEA 3H7VA 4RDVA 4ZTXA 3M4HA 3AUJA 5U7SA 2Q02A 4KEUA 3URHA 4K8GA 1G9HA 2E6FA 3VDHA 1D7YA 1K8CA 3BAJA 1U1HA 2GGIA 4LAMA 5DN1A 4K68A 4H2CA 5FJIA 1XCFA 2Z00A 4KCWA 1V0MA 2CYGA 4HZ8A 4K2SA 3QY8A 4DF1A 5D9NA 3ARSA 3W76A 2CHOA 2XN1A 5DBUA 3ARUA 3REQB 3RX3A 5CC5A 1HUVA 3FDKA 1GK8A 3LCLA 3Q45A 3W26A 4EF8A 3WELA 2EJAA 2A85A 2YCEA 4ZE5A 5EBKA 2REQA 4AISA 2GR0A 1JD9A 3GNRA 1RVGA 2H9AB 3QKZA 5DMMA 1JIBA 3FA5A 3MSGA 4A3RA 1SMDA 2C18A 3EWUA 2TSYA 2OLAA 3NM1A 2F38A 4N4QA 3IUDA 2OEKA 3THUA 5AC4A 5EU9A 3UWZA 2P10A 2UY4A 5DY3A 5JVLA 2P88A 4R85A 3BO9A 3O16A 4G1NA 4Q32A 1E1CB 3E2RA 4JTIA 3BG9A 3GG1A 2O4QA 4JICA 3WMSA 3RMJA 2ZXDA 1LDCA 1KR0A 3DFPA 2FJKA 1UWQA 4QEHA 5LXEA 1GRGA 3I4KA 2WP5A 3SCSA 4K1WA 1FDZA 4LV9A 3PZOA 4LS1A 3LCHA 3DH9A 2ZBTA 4ZL1A 3GU9A 1JXKA 1TWZA 1UR8A 5J8LA 1G94A 3W9ZA 3ZWTA 3E6EA 1BRLB 4JTDA 3ZWSA 4XG1A 4GX9A 2XHYA 1Q8JA 3QHOA 2JQXA 3M46A 3PZNA 3C0LA 5CG7A 1JZ2A 5FF7A 1W91A 3VDBA 3BAWA 4Q4PA 4HCLA 3MU7A 1XBVA 4UFHA 3D47A 4AWTA 4N9CA 4YTRA 3PULA 2GVGA 3D5HA 5IXEA 2P3EA 5JMUA 1SUXA 3E2SA 1I2NA 3QQ0A 4DI9A 2R94A 4DBEA 4Z2HA 1G4EA 3JW7A 4UOJA 5B7ZA 3KL3A 3W7RA 2CLPA 2PTDA 1X6NA 2ZIDA 5RUBA 4PMYA 3W7NA 3WNOA 3W2NA 3W02A 2HRWA 3PF3A 3BW4A 1PWMA 4AC1X 2C1IA 4JL1A 3CZLA 1LORA 2HWGA 3HOJA 2IKHA 3PBYA 4QLLA 1V02E 4WOQA 4LBUA 1M04A 2VGGA 5TNVA 3T2OA 4IP4A 4DZ5A 1KGWA 5ABHA 1VCFA 3QGVA 4M6UA 1EIXA 2D2GA 2W9MA 4IJCA 3SUSA 1JPKA 4AEEA 2ATSA 3RNDA 1X1NA 1E0VA 5GRTA 3G1AA 1X6UA 2A4AA 5CZKA 3QY6A 4W7VA 2PLCA 5JBEA 1FEAA 3CV7A 1ONFA 1ZY8A 3SADA 1DP0A 2RJGA 1JZ6A 4GOAA 4N42A 3WKZA 1V3IA 1QT1A 4F2UA 5JCKA 2R24A 3ATZA 4LANA 5A69A 3R79A 1MNZA 1SGJA 2J74A 2WVTA 3FFSA 1T40A 3KWXA 4JTHA 3GH4A 2XTKA 2OQHA 1P1XA 2NQJA 4EQWA 1BXBA 3KLKA 3VGDA 1B1YA 1E70M 1XJBA 3DHPA 2GZXA 3NOEA 5LA0A 1AW5A 4MKSA 4HA3A 2VENA 4DJDA 1BYDA 3MZ2A 4IIBA 4OFCA 5H2ZA 1QUMA 1IXQA 3VXGA 3P3BA 5HINA 2A3CA 4JY9A 4GNJA 1F3PA 1KTBA 1IT8A 4UWMA 1SPQA 2Q3OA 3EBVA 3P82A 2YVGA 3MDUA 3B0UX 3Q94A 3B06A 4PTXA 4C90A 2J9YA 3O15A 4DBUA 4J40A 3S2LA 4DYEA 5ABFB 4LXFA 2W6RA 3CMFA 2VURA 4O1AA 1XIBA 5CKSA 3VMPA 4AVNA 4L9XA 2XH7A 4W87A 5D8ZA 3TQ0A 2PRMA 2D3LA 2DIJA 3GHUA 1K9EA 4TO8A 1V3KA 4S39A 1D3HA 1EBGA 5CG0A 3VZXA 4P8UA 2J78A 1OD8A 2X1IA 4O1FA 4AMAA 4EPKA 4QE4A 3QY7A 4N2YA 1QHOA 3LNMA 1HL2A 3PTKA 3EOUA 4KWSA 2VD9A 4QSFA 1NWUA 1NWSA 3UR8A 5DRCA 3UCQA 3K5XA 2OWXA 3N6QA 4IFKA 3G2GA 3A4XA 5JRBA 1IIGA 4BKNA 3Q67A 2FGBA 4W88A 1S3TC 4PUUA 3U2CA 3VD9A 1EZ2A 2CITA 2TPRA 2PMQA 1EWDA 3EA2A 1ZALA 3UG3A 2DQXA 2WM1A 2BNJA 3F1QA 1YXCA 4LCSA 4GUFA 3NIYA 3W83A 1WV2A 5C8BB 1DKWA 4C65A 1A5BA 1AD4A 1ADDA 5AZ0A 4J4KA 3PWGA 1Y5VA 5HQLA 1PS9A 4S3FA 1EYEA 3AZTA 2CXEA 1RA0A 4H9TA 5GJNA 4EX4A 4UTUA 3N6HA 4IMEA 1FA2A 1OGGA 4V33A 4Z08A 3TYDA 2X7VA 5J5RA 2JK6A 2HK0A 5FESA 3UZYA 3O1NA 3N4EA 1DJIA 4JTFA 1VBJA 4NT0A 4Y6GA 1FDYA 2QNEA 1JPHA 1WQ5A 2C0HA 4ZBCA 3TJ4A 2WKLA 5FS8A 4GRSA 4X9YA 3GXPA 2HMCA 1UJPA 5A6BA 1TTJA 3GHSA 4TR9A 1IEVA 1I2OA 4H4IA 4C91A 1J2BA 1ODZA 1VRDA 1XSIA 3NQ6A 3F2BA 1VZWA 1R3YA 4ZSUA 4NUWA 5AC7A 1YPFA 2WMKA 3W87A 3QFAA 1XBXA 1Q7ZA 4PMZA 1AQHA 3AIBA 3QR0A 5IHRA 1HZYA 3AJ7A 3QC0A 3U9IA 3AROA 3CC1A 5DELA 3E2VA 3W7MA 3WH9A 1Q6QA 3PZVA 3O6DA 3MO7A 5FA5A 1NF0A 2OZ8A 1BWKA 4BI5A 2G5WA 2OLHA 3PWIA 3VIMA 1BYAA 3GQYA 3S6OA 5A6KA 2XSAA 3W82A 4OU1A 3TJIA 2A3LA 5FF3A 3RU6A 1XLDA 2Q71A 4GCAA 2WC3A 4LV4A 2I56A 5B7YA 1GTEA 2G4FA 3LLFA 2HVMA 5H8PA 2QCFA 4JXCA 4DPPA 4H9XA 3MANA 4Q4OA 3O0HA 1TJ2A 2CLFA 3T0DA 2ZYFA 1KXHA 4EQRA 3WN6A 2X41A 2ZZCA 4ZQPA 2E68A 3EKZA 2NVKX 1E6ZA 1D7KA 1V3JA 2CBJA 4OIFA 3FS2A 5JCIA 5A8QA 1T99A 1F05A 1VYRA 3CPGA 4ZO7A 4A8IA 4D6EA 4WF7A 4CNOA 2E9MA 1E1FA 3LRLA 3VE9A 1T7LA 2WJDA 3QHMA 1QNOA 1EJTC 1KLZA 4AQLA 3GD4A 3IIVA 4YVXA 4GH3A 4HVXA 1DIOA 4PCSA 3NXLA 4XD6A 2YA2A 4KERA 1T3QC 3UETA 3GK0A 3BCFA 3SUWA 2OTDA 4MIMA 3L68A 3QTGA 3FIGA 2QR6A 5EMKA 2F6XA 1UR1A 1EGVA 1M1BA 4RUBA 3SM0A 3N2OA 3D9XA 1I45A 3W6MA 4ROPA 3APGA 3W74A 3NRZB 2V69A 2NT1A 1US2A 3ICJA 3WQ4A 2WVVA 4MFEA 2Z27A 2H90A 3HPAA 3WLOA 1FP8A 4UQCA 1Q6EA 5JH2A 3QFEA 2WZEA 4V1XA 4MM1A 3K8KA 1PX4A 3VCNA 1BEUA 2WSRA 4EAYA 4JTEA 4B4HA 3O06A 1CYGA 2X09A 1H3GA 3WBWA 1VH7A 2WHLA 3VZYA 3AICA 4CD8A 2QCHA 3TDFA 4AD5A 2RDXA 1U22A 1W1ZA 2J27A 3H23A 1TG7A 3DEQA 3KS5A 3HG4A 1V6VA 2D1ZA 5GPRA 4EMIA 4UOZA 3LHUA 3DC8A 4E4UA 3DFOA 3G77A 3NDOA 4KEMA 2HPIA 3RYSA 4AEOA 1TA3B 5A6SA 5CJ5A 3ABSA 1N62C 4D8ZA 2NXGA 3AMGA 4IPIA 2OFJA 3C8FA 1VC4A 3BLKA 1RLCL 5DMLA 1NP0A 4A3YA 1HKJA 1PZ3A 3BANA 4Q6XA 3SQLA 1Z69A 3A12A 5EL1A 2GGHA 2AGKA 1OCQA 3SJNA 1E6XM 3KOFA 1MZHA 1DOSA 1TCDA 5F4WA 3LV5A 4S3KA 4OVXA 2GJXB 3DN5A 1ME8A 1GVOA 1JYVA 1P43A 4A6GA 4AAJA 1A5UA 3LCFA 1GRAA 3NJ3A 3J7HA 4N0RA 3QGAC 2CPUA 1G5AA 3BLIA 3GG8A 3VFCA 4DUOA 1XC4A 1U30A 1IZKA 2Z1SA 2PRLA 4GXPA 3KX6A 2VT0A 4JIEA 4M1RA 1FH7A 3VX0A 1TPDA 1ZMCA 4V28A 1FH9A 3O63A 1K70A 1BKSA 4W8AA 3MCMA 5FAGA 4H9VA 1UH4A 3NQDA 1P6CA 5EFDA 4IQJA 5CGTA 5BRBA 2I9EA 2CCRA 1EQCA 3ZJ7A 1QMLA 2R14A 1XYZA 4FNQA 2WMJA 1AFSA 3BAXA 2GQ3A 4BWLA 3CH9A 3AHXA 4FMVA 4ACZB 3JZEA 3SSZA 4H4WA 4NYUA 4R88A 3IV8A 1P0NA 4R7WA 1UMLA 1XLKA 3TOPA 3WK2A 3MWAA 2BY3A 4LYRA 1S7MA 5CQ1A 1I8JA 3U6WA 3A4JA 4J3XA 1A5MC 3LEPA 4RNIA 2XIBA 3OYXA 1R9YA 3N9SA 2A7PA 4L4PA 4Y8FA 2WPEA 1OJTA 1UIPA 3LY0A 3L5OA 3OB8A 1Z32X 3T07A 3DI0A 1J0HA 4JX4A 4JEQA 1UD4A 4PC8A 1DHPA 1SW3A 1N55A 4DUWA 4PGLA 2TYSA 4ZO8A 2OSXA 1EJSC 4NJIA 2IKJA 3M0JA 2QDHA 3S1GA 5AZ1A 1MWOA 2RGMA 2VX6A 3FYOA 4YTUA 3P14A 7TIMA 1EFZA 3LHTA 2QEZA 2G97A 3FAXA 4LH8A 1HXJA 4IPJA 5D2VA 1Z44A 1DQWA 2HVOA 1QI0A 1RR2A 3BAIA 3ONBA 1QHPA 3GDMA 2PGWA 1EJ7L 2JGYA 2EO7A 3ARYA 2O0TA 4HZ6A 5A6BD 1TR1A 3MCNA 1UC5A 4Z17A 4PB3A 4AHPA 2VEIA 3VDCA 1J0IA 4YXGA 1PYFA 3OA3A 5BOOA 3T81A 1X2HA 3NPXA 5MKGB 3I65A 1QW8A 4A8RA 1ZXIC 1I6NA 1GEUA 3LA4A 2F61A 5CZSA 4D6DA 1OIMA 2B4GA 4YCPA 1L6WA 1ZB5A 3PK7A 1O60A 2ZWYA 4F9DA 3RJYA 3R5EA 1H60A 1BZLA 3I68A 4AY7A 3UG8A 2ZICA 3LCGA 3GG7A 1TMLA 1XLIA 4NIRA 5C0QA 4M56A 1TWWA 2CFYA 3GHRA 2H8XA 4OOZA 2A6NA 4QQ3A 3MMTA 3O2LA 2BOEX 4F0LA 3VA8A 3KRUA 1LTDA 1GOXA 4CN6A 2HBXA 3XISA 2JEPA 3WF0A 5IRPA 3CL8A 3ITGA 1KCKA 1JQVA 2OQYA 4IFRA 4CNTA 2B7QA 1MYRA 2VL4A 5LNVA 4JHMA 4Y9NA 3C86A 3W86A 2VZSA 1BFNA 3XIMA 2ZQ0A 1N63C 3NQFA 2HCVA 4J27A 2VXNA 3C0JA 3VTRA 1H1YA 4DNAA 2WHKA 1K7FA 2H3BA 4YIWA 1OEPA 3AU2A 1LG1A 5HK4A 2BG5A 4XX6A 3VCRA 2ONEA 4TIMA 3GUGA 3CIWA 4HN8A 4GA8A 5FS7A 4X61A 3O8AA 1NFBA 1XICA 1LWIA 4GJIA 1OX4B 1XLLA 5BWFA 4DJDC 2IPGA 4QHRA 3G0XA 1FH8A 2QVHA 5HNTA 3W38A 1VPXA 1MQRA 4PL2A 1SSDA 2G4JA 1E0TA 4RXFA 3KBVA 3W1AA 3VU2A 3V3WA 2C1GA 4GACA 2B31A 1C93A 1RY0A 2IPJA 3CUXA 3OGSA 4DQWA 2DY3A 1VBGA 3ZJ8A 3OVGA 1PZ1A 2J25A 4D71A 4AB4A 2TAAA 1DV7A 1V93A 4PBGA 4RW5A 4QNWA 5I06A 1Q66A 2Z6JA 4UFLA 2PWEA 4MB1A 2W61A 3KHDA 1RAKA 5G4WA 2B7NA 2EQ9A 4PRRA 3T08A 4O16A 1F7BA 1GPFA 3M6DA 3BZGA 2XGBA 3M7SA 2J66A 4IM4A 4GVHA 2DIEA 5EFFA 2HXTA 1RZMA 5LIUX 1YIXA 3C4UA 1PX3A 4IMGA 3GZ3A 4LEFA 2XN2A 3NQVA 3VD5A 1LLZA 4JTQA 4JTTA 3WQ6A 4BQ3A 1W31A 1VFHA 1H50A 1FCBA 3B4YA 4JHOA 1QI2A 1GHSA 4V1YA 3LLDA 2GR2A 1SM9A 3DHFA 3ZOAA 4KGLA 2GWGA 1B3OA 3G24A 1XRTA 1YX1A 3RCMA 1GOWA 4YCOA 1LQAA 1CGTA 1AODA 4D6FA 2Y7GA 2AMXA 3ECQA 2RDTA 2IQTA 4N6FA 2DEPA 4D8LA 1L9WA 1AQMA 4W8BA 4P7LA 3L66A 2VDGA 2CZDA 3IJ7A 4QLJA 1F73A 5HQEA 1WKFA 3UY7A 1U5JA 3PZIA 4RE4A 4ZFMA 2PUZA 3EYPA 1EA0A 4NSBA 1XQKA 4XISA 2PGEA 1EPVA 2WLYA 1EHAA 4WGXA 5A1AA 3MCOA 3W3OA 4RZ4A 6ALDA 3OOQA 3CMGA 1LVLA 3EX2A 4JYDA 4NI3A 3WLKX 1KM6A 1MDRA 2J75A 3MMWA 5KMYA 3T0TA 4NJHA 1MUCA 3EF6A 3UWUA 5AYBA 1Q63A 2G50A 2C7FA 1W5OA 1R85A 6TIMA 1M7XA 1VFFA 4XSMA 3WNNA 4JIPA 2ZZ4A 2JIWA 3BCJA 1MDLA 3L5LA 3LI0A 3M0IA 5HUOA 4P2VA 3BARA 3UZZA 3A9IA 3G6LA 3M7WA 2INEA 3VKDA 2O9TA 3L2MA 5HBFA 2C91A 2J7FA 1W5PA 1ZX9A 1KN0A 1A5NC 2VNCA 4O4WA 2HQMA 4XO6A 3V75A 2Y89A 1JYNA 4Y9OA 1B5TA 4TUFA 4O13A 2Z1VA 4B16A 4KEVA 1XDIA 1SR9A 4MWAB 4C6OA 1BAGA 1X1ZA 3H54A 3AUOA 3IJ9A 1A3HA 1J0KA 3NSNA 3QYSA 3NNTA 1F3EA 2V8ZA 5DT7A 1HTIA 4CN1A 2C8NA 3G8EA 2ZWZA 2QDDA 1GETA 3CO4A 3RUBL 1ELSA 1JR1A 2X8HA 1DXFA 1BYCA 3WL1A 1G4SA 3OZOA 3VE7A 3WH5A 5K3VA 4JR5A 4GYJA 4U4MA 3RN6A 1KM1A 3SRDA 5HNNA 3RCNA 1K8ZA 3SFWA 3TH6A 3VFLA 4FEZA 3WDQA 1EDGA 1JNDA 2PWGA 3NPWA 5AHFA 4EWND 2O92A 4PB5A 4XK2A 3VNDA 1EJXC 3IJIA 3M16A 3N13A 1FECA 1TSIA 3KBSA 1QW9A 4NNBA 4FXJA 2X1UA 3EB4A 3T6CA 1RJPA 1F4AA 3WMCA 2R82A 3R8RA 4GUHA 2P3ZA 3FHQA 3VOFA 1OC6A 2DORA 1XD1A 2OZ0A 4RK8A 2F9RA 4KW2A 1W1B1 1P0KA 3ARTA 3GS6A 1XUUA 2J13A 3MI6A 4DWDA 1HP4A 2X0HA 2WC4A 4OTKA 2W63A 1NHSA 2F5ZA 2NUWA 3H24A 4MJZA 2Z1WA 5EPDA 4KH2A 4NJJA 2WBAA 1UW9A 2FVKA 5LGZA 4BI7A 2YLLA 2VKZG 1I2RA 1Q8AA 4RCXA 5D32A 3B9EA 2AKMA 2J4GA 3AS3A 1US0A 3AHYA 3KL5A 3TKFA 3E3HA 5CXPA 4YU1A 4OKDA 3BXWA 2C71A 3CT7A 3WJXA 3M0HA 1OVDA 3WIJA 1JGIA 3NWRA 4EK7A 3KAOA 2FYMA 3S2NA 1YQZA 1NDYA 3DFNA 4K7VA 3AIWA 3T8LA 2WWCA 1C29A 1VIZA 3U2ZA 2F7FA 5E0FA 1FBAA 1VYPX 5HPOA 3RMEA 1W1IE 3O3RA 2XZ7A 3QC3A 3C5QA 1KFLA 2IPFA 1WXYA 3R58A 1W2VA 1VIWA 3LADA 1KM4A 4B2DD 3CXOA 4MY1A 4BFAA 2ASHA 3VD4A 3G5EA 2Z7GA 3OLDA 4IG2B 4WRHA 2JF6A 4JFUA 1P6BA 2DV0A 6PTDA 1DHKA 1K9FA 2FQIA 1ONEA 1JI2A 2ZDRA 4JTJA 2CBUA 3DJGX 4G2DA 4C6PA 2X40A 1LYXA 1I4NA 3D3AA 2PI6A 1C7SA 3LERA 3NQ2A 3URNA 3CZJA 1KRAC 2Y7FA 3K1GA 1GVEA 3HQOA 1SB3B 2QUUA 1TPC1 3LM7A 1A4LA 2YB1A 1LG2A 5CPMA 1Y5XA 3F2CA 2GJNA 2BY1A 4PMUA 1F8MA 1IZJA 4BCEA 3K13A 1MW0A 3MHUA 3HGOA 3IIPA 2VEPA 2HNEA 4IH3A 4NVTA 5LZLA 1REQA 1E43A 1XI3A 5JCMA 1IWBA 4ALDA 3P60A 3RPTA 3IGUA 4XKYA 1PDZA 3C2RA 4S2BA 1KFJA 1R2TA 3CZ8A 1ZJBA 2BXVA 4BWLC 2WBGA 1DJYA 1VFTA 2GUUA 3E1F1 4U3CA 1SW7A 2QCDA 3Q58A 3R8HA 1QBBA 1YW1A 2XVLA 3GIYA 2Z1XA 1B0IA 4LEQA 3ITYA 1RP9A 3WQEA 5BCAA 4N6EA 3PVFA 3BW2A 1ZL1A 5AB3A 1EF3A 4S23A 1AH0A 4QJ3B 3QZEA 5F4XA 3PBUA 1FOBA 1SO6A 4LC6A 3G6MA 3AS0A 5GNXA 2CNCA 2NVAA 1H11A 3UNTA 2DT2A 1DBTA 2WVSA 5L6UA 1UH3A 3U7BA 1R8LA 4O1EA 4EXQA 3NFUA 3M9YA 1JD7A 1XIIA 1M03A 4GH1A 1MEWA 4JQ9A 3W53A 1J10A 4MDPA 2UY5A 4CNUA 4AFYA 1BVWA 1UPMB 4AD2A 5T26A 3POCA 3S1XA 1YQ2A 3KTSA 4BY3A 3WBXA 1P5BA 2NX3A 4XV0A 3ARXA 1A5KC 2YB4A 3IS4A 4KWVA 1TWIA 3IVTA 4QJ5B 4AXKA 1GREA 3A9BA 4L4MA 2Z6IA 5BOEA 3N4FA 4RNHA 2DZUA 1DTUA 1OG0A 2D2HA 5CAKA 2OPJA 4QAIA 1DVJA 4QROA 2NW0A 4LVGA 4A3UA 1KTCA 2YZRA 3TYEA 2HTMA 3CV6A 3N12A 3QN3A 3AS1A 1M3UA 4Z2JA 2IXUA 4J3TA 4CD7A 4WQ6A 2BGSA 4KBXA 3W70A 2PTYA 1WCGA 1R3VA 1M7JA 3NL5A 3KBWA 1OX6A 1GZJA 3R4IA 3W85A 3CH0A 3HW2A 4OECA 3W1PA 3BURA 1UQZA 2Z26A 4ZZ9A 1GOMA 3TYAA 3S2CA 4HPNA 1K9TA 3N04A 1F5ZA 4JIHA 4Z0SA 1E6PA 3RDKA 3PUOA 3CQ0A 2OKOA 4J3WA 1VQZA 1JCXA 1JCJA 1XLEA 1D8CA 3CEUA 2ICSA 4Q4SA 3GRSA 2PODA 3IWPA 4PTMA 4B5VA 1KV5A 2G96A 2ZA1A 1ADOA 1ZAIA 2E5DA 1R46A 4XWUA 3CUIA 1HL8A 3A47A 5D9MA 1VJZA 4PULA 3TK7A 2CLIA 3W01A 4M7TA 4UUIA 1X8FA 1W3NA 3S9ZA 3EDEA 3NEVA 3I3EA 4WEVX 1G7UA 1GRTA 3B03A 3ZIZA 4B3KA 4X63A 2ACQA 3VNKA 3CWNA 1MNSA 2AAMA 4E0CA 1GESA 3CMJA 5FAJA 5CJNA 1W1VA 1W54A 1AA1B 3T4CA 2CLEA 1HKKA 5CH9A 4PMDA 2R9ZA 3EDJA 2FZBA 1OFQA 2OSYA 1H4PA 3GXNA 4HK7A 3BLLA 3HRDC 2BOFX 3HFYA 4JKKA 1ONRA 1JROA 4D6GA 4E4FA 3W88A 3QMRA 4XTIA 1O66A 1RXOB 4QGCA 2RDUA 2A2IA 3U5UA 3G1HA 3UZXA 4YHGA 3OPSA 3HJEA 3SCUA 1ICQA 2EQDA 4HMEA 4HA1A 5A8NA 1DJXA 2VEFA 2PDGA 5I24A 3TQPA 3WZ0E 2Y5EA 3H2FA 3PZQA 3L12A 4PUDA 4Y96A 4GMEA 1BG9A 3GHTA 1W2PA 1PKYA 1TR9A 3T2PA 4TXEA 3WF1A 1Q3NA 2I5IA 3GR7A 3BLPX 2E1WA 5AN7A 2GFTA 4S3JA 4W84A 1GERA 3ZZ1A 3STGA 4AF0B 1OY0A 1FWSA 1S5MA 4O1BA 5LNSA 2ZOXA 3M0VA 4WSKA 3GTIA 1GJUA 3VOJA 1GKQA 4NEVA 3M07A 3L0NA 1PDYA 4AY1A 3ITXA 2E9BA 1KXVA 4ZB0A 4M1BA 5C54A 3E0WA 3SUTA 3LENA 3GWQA 3VIPA 3AALA 2CKRA 1G7VA 4PMJA 2CBVA 2OXNA 2Q6ZA 1BD0A 1LT8A 3UJEA 3MJMA 1AVAA 4PMXA 5A5WA 1E0XA 3SUVA 4DELA 2FIQA 3NO5A 3T05A 3HTWA 3PS7A 1VHCA 1BXCA 4AIOA 3N3TA 4LF1A 2YW3A 4O1CA 1E9LA 2BY0A 1DWGM 3P0XA 2HEJA 3AXMA 3WQGA 1IWAA 1SJBA 3K30A 4D72A 1Q5MA 4Z2LA 3LQLA 1WUEA 3AISA 3PUGA 3UY8A 3BSGA 4Y90A 5D9OA 4CD6A 1VEMA 1YTKA 4EP8C 4FF5A 5FJOA 2E67A 2WNQA 1WZAA 2DPEA 3W7EA 5LYRA 3W29A 4W9TA 2XDFA 2VJXA 4NP7A 2Y24A 2XFYA 5DFAA 1RCQA 4O8AA 1EBDA 1HO4A 3DZ1A 4UR7A 3EOEA 1JCTA 3NGJA 5FACA 1B3YA 5I5RA 1OSEA 2W67A 2ZE3A 1NTHA 3UF9A 4O57A 1K02A 1XYAA 5CSYA 2GSHA 3U7VA 3G18A 4H4YA 1PB0A 1G6CA 5I3DA 3I6RA 5B80A 1QASA 4MNLA 5HJLA 2Y85A 1XP3A 1ME7A 1J96A 4REQA 1MSSA 5LKYA 3UJ2A 1UR0A 5KVHA 3EPMA 3N2CA 2GPTA 3IUHA 3ZR6A 1FWEC 1C90A 3BMWA 1V6YA 3W1QA 1CLXA 3WK0A 1DJHA 1B9BA 2CESA 3DG7A 3BVJA 2ZA3A 4FXFA 5A8GA 3FVMA 1V59A 1XLJA 3IRSA 3WQPA 1NAL1 1Z8AA 4BF9A 5HWMA 2D0HA 3KWSA 2GOKA 3A5VA 4AHOA 2V38A 4AVFA 3S5SA 1P1MA 1Q6GA 1J9YA 3V1HA 3UVAA 1QCWA 3V7PA 3MW7A 3WDPP 1ONWA 1B4KA 4RNJA 2IQ0A 1X98A 2OLSA 3UYCA 1F4HA 1PX8A 1YBQB 3PZGA 2XIJA 3EWZA 2WPBA 4HNOA 5L9FA 2PWVA 3GC5A 3T2QA 5JUVA 4JOMA 1V02A 1GOKA 1RHCA 4US5D 2PDHA 5KZEA 4QDMA 4WJXA 4DF2A 1CLKA 3GYEA 2XIQA 3NL2A 3UPWA 5IFTA 4Y7EA 3L23A 4Y8EA 2H3DA 3I3DA 3EZ4A 3CPUA 3QRHA 1TYTA 3RU8X 1LM1A 4HZ7A 4JQ2A 1QI5A 3K2GA 3LG3A 3TC6A 5DRIA 3V4BA 1KXTA 1KBLA 2FMNA 3OIXA 1QO5A 1YYAA 2E5AA 4DJEA 4OT7A 1KCZA 1LOSA 1X38A 4OHQA 3ALFA 2Z2AA 3GYCA 2ZRXA 2WYSA 4ECLA 4J3SA 4GKTA 3LCXA 1H1ZA 4QG9A 4ACYA 2HQAA 5C55A 3FXGA 5LNWA 2VR4A 4AX7A 3AIQA 1XBYA 3WLSA 1AH4A 2R1NA 1RQHA 1A3WA 4FALA 2OB3A 3SO7A 4BV6A 3DENA 1JDAA 2FLIA 3P67A 1CEOA 3B8VA 4IIDA 1LT7A 3KP0A 1OGBA 4PUEA 3GIPA 3IIXA 2XGZA 2ISFA 1ZPTA 4R7OA 4PRWA 2ZTKA 4RE2A 3JU2A 3BOFA 3UGVA 1J11A 1XLAA 3KUMA 1EHNA 4HJFA 1DJNA 2W5FA 3RNMA 4FOJA 1Q1RA 1TJPA 1ZGDA 2R1MA 3W22A 4J2PA 5CC6A 1GNXA 3VOHA 1VFUA 4S2CA 3UFYA 4TTGA 3TJLA 1G67A 3MYOA 4HSOA 1PXGA 1WKDA 2INZA 1Q7QA 3CNYA 4C6NA 3MI2A 5CBJA 3S5OA 3G8RA 2A3AA 3VD3A 3SQPA 2PC4A 3H21A 5D03A 2W3ZA 3G3MA 4FOUA 2FZMA 5IFPA 1UKPA 1TPB1 4KWOA 4LUSA 4W8LA 1GVYA 3VINA 5MHBA 1I0BA 4CD4A 5D38A 2IS7A 4PMNA 4J1OA 5E93A 2NWRA 5KETA 1NEYA 4UQDA 4MHBA 1T0OA 2CW6A 3KDNA 2Z2BA 2C3DA 1MUWA 1TPVA 1QK0A 3K1DA 5BOFA 1CECA 1SZGA 1VJIA 2PDJA 4IFKB 2ZRZA 1SJAA 4QJ4B 4JNMA 3TSDA 2JALA 1DIDA 3ZS4A 2ZZBA 4HA4A 1FHVA 2O7SA 3KOXA 4CEUC 2BY2A 1TRDA 3STPA 5JIWA 3RFAA 2EJ1A 4JFSA 3LSCA 3DAQA 3LDVA 3STFA 4UMAA 1S2AA 4W5UA 3TA6A 2F6KA 2V3GA 4UBPC 4J3ZA 2WJZA 1Z3NA 1CT5A 2V5KA 1QW7A 2TPSA 1J5TA 4HYVA 3ZR4A 1M9HA 3UZWA 2J7EA 3WJSA 4N9DA 3ARWA 3CUFA 2C3ZA 4DBWA 4MNMA 4J3VA 3QW3A 4N4PA 4XD3A 3L2LA 4B3ZA 1STZA 4V15A 1HJXA 1W5NA 2BSLA 2V68A 3GH7A 4H8HA 1H49A 1M7OA 3L4YA 3TFXA 3BGGA 3M0YA 2YL9A 3SCTA 4DAIA 1CIUA 1GXFA 1YE6A 3WLLA 4PCNA 3KL0A 1TPEA 5EYWA 1KM0A 4OUEA 1T5AA 2W0UA 3A21A 3W24A 4K6AA 5K2ZA 3MBFA 1UUMA 3M0LA 2Y8VA 4RJEA 1F76A 4LCRA 4TVCA 4IPLA 4URIA