4J56A

Structure of plasmodium falciparum thioredoxin reductase-thioredoxin complex
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
504
structure length
504
Chain Sequence
HTYDYDYVVIGGGPGGMASAKEAAAHGARVLLFDYVKPSSQGTKWGIGGTCVNVGCVPKKLMHYAGHMGSIFKLDSKAYGWKFDNLKHDWKKLVTTVQSHIRSLNFSYMTGLRSSKVKYINGLAKLKDKNTVSYYLKGDLSKEETVTGKYILIATGCRPHIPDDVEGAKELSITSDDIFSLKKDPGKTLVVGASYVALECSGFLNSLGYDVTVAVRSIVLRGFDQQCAVKVKLYMEEQGVMFKNGILPKKLTKMDDKILVEFSDKTSELYDTVLYAIGRKGDIDGLNLESLNMNVNKSNNKIIADHLSCTNIPSIFAVGDVAENVPELAPVAIKAGEILARRLFKDSDEIMDYSYIPTSIYTPIEYGACGYSEEKAYELYGKSNVEVFLQEFNNLEISAVHRQKHIRAQKDEYDLDVSSTCLAKLVCLKNEDNRVIGFHYVGPNAGEVTQGMALALRLKVKKKDFDNCIGIHPTDAESFMNLFVTISSGLSYAAKGGSGGGKCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Plasmodium falciparum Thioredoxin Reductase-Thioredoxin Complex.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase 2
total genus 159
structure length 504
sequence length 504
chains with identical sequence B, C, D
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF00890 FAD_binding_2 FAD binding domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4j56A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4j56A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4j56A02
3CGCA 1V59A 3KLJA 3IHMA 3AYIA 4OPTA 4YKGA 3GD3A 3UCLA 1GRHA 3UTGA 2ZZ0A 1QO8A 2OA1A 4OPDA 1GRGA 4M52A 2WDVA 4GUVA 2OLNA 4BJZA 5EBKA 2JAEA 3NKSA 4GF7A 2GF3A 3FG2P 1H6VA 1H86A 1KNPA 4Z26A 1FECA 3UP4A 2YLRA 4P9SA 3GWFA 1PHHA 4YWOA 1PXCA 4H4UA 2JBVA 3GSIA 3QSMA 3UOXA 3VRAA 1N4UA 2XLTA 1ZX9A 2WS3A 1NHRA 3ALLA 4NTEA 2EQ9A 1GT8A 1EBDA 2V61A 1PBBA 4USRA 2CVJA 2WPCA 4YTNA 1HYUA 3S5WA 5FMHA 3NK0X 3H4KA 1DJNA 5JCKA 1Q9IA 1BZLA 3PO7A 4H4QA 4EMJA 3ADAB 1ZOYA 1ZY8A 3NLCA 2YLXA 1FEAA 2XFNA 4RG4A 1QLBA 2OAMA 4TLXA 5GSNA 5KWFA 3K7MX 4GDPA 1IUVA 1NHPA 1MXTA 2FJDA 4O5UA 5HY5A 3CPIG 3QVPA 3EF6A 2XVHA 1ZMDA 4B66A 4Z43A 1E39A 2BACA 2C3CA 3R9UA 3UTHA 1YQ3A 4JNAA 4OVIA 2GR1A 1D7LA 2R45A 2EQ6A 5FS7A 4H7UA 4ZN0A 3B3RA 2RABA 5FS6A 2QCUA 1F6MA 4MJWA 4U8NA 1E1MA 1GESA 4NEVA 2GH5A 2C75A 2BXSA 2Z5XA 4ZCDA 1JNRA 1NENA 4K7ZA 3BHFA 2X50A 4OCGA 4CCRA 2XVJA 2V3BA 1E1NA 5JCIA 5BVAA 5IPYA 4H4ZA 1B37A 1F3PA 4A9WA 3GMCA 3ICTA 1PBEA 2E1MA 4OPUA 3GMBA 4E0VA 3CGDA 1SEZA 1RYIA 3BNUA 1GETA 2VRLA 2QA2A 1CHUA 3AD9B 3M13A 4O5QA 4EM3A 1GRAA 2QAEA 1K0IA 3G5QA 2YVFA 4A5LA 3UKHA 4CNJA 3UKQA 2A87A 1H7XA 3UP5A 2FJAA 2UZZA 2WPFA 3COXA 3FIMB 2B9YA 2C3DA 3M0OA 1LTXR 4EQSA 3SM8A 1CC4A 3GDPA 4BK3A 5CKUA 5EB4A 1LPFA 2WOIA 4RSLA 3P9UA 2H88A 4NTCA 2A8XA 3QFAA 2FJEA 4TM3A 1K0JA 1NDAA 2ZZBA 3DGZA 2BK4A 4H4VA 2GAGB 4D03A 4Y4LA 2C66A 1DJQA 1H82A 4K22A 1NHQA 3DGHA 2YQUA 4Z2TA 2XFPA 2YG4A 1O95A 2BXRA 4K8DA 3NRNA 4Y4MA 5CQFA 4A99A 1PDHA 3V76A 5C3JA 1EL5A 4J2WA 4FDCB 4IV9A 2FBWA 3F8PA 4C77A 3CNDA 2VVLA 4OPIA 1VG0A 5L46A 3P4PA 4Z2RA 2GQWA 1Y0PA 1KF6A 1FL2A 1JRZA 4AP1A 3AXBA 1PS9A 4Y4NA 1NPXA 2YG7A 5U25A 1CF3A 4YTPA 4GRTA 2XDOA 2YG3A 4JN9A 4J31A 5JCLA 4YKFA 2XCGA 2WHDA 2C64A 3CTYA 2X3NA 1TDKA 4U2LA 2WU2A 2YLWA 5IQ4A 3FBSA 4IVOB 1PXAA 4PAAA 4H50A 1KSSA 3VR8A 1YQZA 1EL7A 1S2YA 3FMWA 3UKLA 2IVEA 2ZZCA 3ZYXA 1LQTA 2ACZA 4ICYA 2JB2A 5JCNA 2CFYA 3DK9A 1N1PA 1Q1RA 3AE3A 4ADWA 1PBCA 3AB1A 4C3YA 1O94A 1IJHA 1XANA 1B8SA 1Y56B 2Q7VA 2GRTA 3NH3X 4CY6A 3EANA 3OZ2A 4OPCA 4YSZA 2WEUA 5BRTA 2ARDA 1EL9A 3AD8B 3VQRA 2YM2A 1GRBA 4JY2A 4H2QA 2VQ7A 5KRQA 3ABVA 3S61A 4X4JA 3AE1A 1ONFA 1GNDA 1S3BA 2R0GA 4H4WA 3GRSA 3UOVA 4J56A 1KDGA 4FK1C 1FOHA 2CULA 5J7XA 2BS3A 2BS4A 3IWAA 5BULA 3NK2X 4D04A 1D5TA 2GAHB 4DSGA 2GV8A 2YAUA 3LZWA 2Z5YA 4IA5A 1PJ7A 2YWLA 1YY5A 3ITJA 3NHOX 3P4SA 4UP3A 3REDA 2AQJA 2NVKX 3ICSA 3UKKA 5JCMA 4B68A 1H7WA 1TDFA 4J57A 2PHHA 3DH9A 4EQWA 3LADA 2V60A 2Y6RA 4KPRA 1Y56A 4B65A 2V5ZA 4U8MA 1PBFA 3CGBA 1ZMCA 2XFUA 3L1RA 2WQYA 3UTFA 4H4YA 4YT0A 3DMEA 2IIDA 1O5WA 2B7SA 4NTDA 3WE0A 2XVFA 3QSSA 4XWZA 2EQ7A 2IVDA 2YVGA 3SFEA 3DK4A 1Z6LA 2O9ZA 2YG5A 2W0HA 2JK6A 1DOEA 1REOA 2BK3A 1PXBA 3Q9TA 4K5SA 1X31B 2X8GA 1VG9A 2BCGG 2XFQA 4EQRA 1PN0A 1BGNA 1EL8A 4GCMA 1JRXA 3AYLA 4PABA 4YTMA 3AD7B 5U1OA 4K5RA 2BC0A 5BUKA 1GALA 2VRMA 2J3NA 1DOBA 1VRQB 2R4EA 1IUWA 3QSEA 3BI4A 4EM4A 5ER0A 2B76A 4APNA 3O0HA 3GYIA 5EB5A 5HHFA 1DXLA 4A7AA 4YSHA 3DJEA 4AP3A 1E6EA 1IUUA 2XLPA 1KFYA 5KOWA 1LV0A 2GVCA 3DJDA 4WX1A 2ZBWA 1JEHA 3URHA 1FCDA 1ZK7A 4AOSA 2X8HA 2V3AA 1LQUA 4B69A 3K30A 1KNRA 1P2EA 2WBAA 2YR4A 1GTHA 1GV4A 3AE6A 2C67A 3I6DA 2OLOA 1MOKA 2JB1A 3BI5A 2CDUA 4GDEA 2QA1A 4GR1A 1XPQA 3BNMA 1TDEA 1DNCA 4KX6A 1GRTA 4DNAA 2OALA 2R9ZA 4H4XA 3GWDA 1D7YA 3CIRA 1JRYA 2VOUA 4NEWA 3AECA 3NK1X 1B5QA 3C96A 3RP8A 3BI2A 3GYJA 1CJ4A 4BK2A 3P1WA 4U2TA 4FK1A 1GRFA 2VVMA 2TMDA 3CN8A 3KA7A 2BYBA 5KXJA 1ZOVA 3BHKA 3AEBA 4U8LA 1H84A 3NYCA 4CBQA 4N9XA 4U2SA 4LU6A 1TYPA 3AEDA 1D4DA 4U8PA 3SGLA 1KSUA 3AE4A 4B67A 3NN6X 3DK8A 2XLRA 2Q0KA 3DJGX 1RP0A 3CNJA 2AAQA 2YVJA 3AYJA 3UKAA 3C4NA 2JKCA 1DODA 3ATQA 2BC1A 3PS9A 3NYEA 1GTEA 3NG7X 4WCTA 1COYA 4B63A 1DOCA 2C70A 3IC9A 3SFDA 4A79A 2DKIA 4YXDA 4H4TA 2R4JA 3NTDA 4U8JA 3CPJG 2BS2A 3CNTA 4UDQA 2BA9A 4EMIA 1IUXA 4A65A 4AOXA 3L8KA 4BURA 1TRBA 1BGJA 4JQ9A 4I59A 1OJAA 2R46A 1XDIA 3LXDA 1JU2A 3UOYA 1VQWA 4USQA 3F8RA 2Q6UA 2B9WA 1NG3A 1NAAA 1OJDA 3EPTA 4LA1A 2GB0A 4BV6A 2B9XA 1S2QA 4CCQA 4HA6A 3D1CA 3ATRA 3CNSA 2E4GA 3QFBA 3LOVA 4B64A 2C7GA 2VVLG 1OJCA 2A89A 4H4PA 1ZDLA 2HQMA 2TPRA 3IF9A 4IA6A 3EAOA 4JY3A 5M0ZA 2YLSA 4AT2A 3AWIA 3ZDNA 2RGHA 4A6NB 1TYTA 2PYXA 2AR8A 3V3NA 1OJ9A 4I58A 4K2XA 1CBOA 5FS8A 4FX9A 4UDRA 3KPFA 4XXGA 1JNZA 3LJPA 2WETA 3NGCX 4H2NA 3CNPA 1GPEA 1D4EA 2GEWA 3H8LA 3UKFA 2YG6A 1UKVG 3KVEA 4Z2UA 1GXFA 4Z24A 3JSKA 3QJ4A 4OPLA 5DBJA 1IUTA 1E1KA 1GEUA 3G5RA 2VQBA 3QVRA 1YKJA 1ELIA 1PBDA 3AEEA 3KKJA 1MO9A 1VDCA 2H89A 2RGJA 2C72A 3CPHG 4H2PA 3K7TA 1JOAA 1GOSA 4NZHA 4C74A 2V6OA 1L9CA 3ALMA 3K7QX 1CJ3A 3M12A 2WDRA 3GD4A 3SQPA 2R0CA 4UDPA 1LVLA 4TLZA 1S3EA 4J34A 4TM4A 3GDNA 4U8OA 2WESA 1YQ4A 1K4QA 2YR5A 2BK5A 2VZ2A 3AEAA 3P4RA 4J33A 3UTEA 2GR3A 3KD9A 2DKHA 2WOVA 5TR3A 2BABA 2B7RA 1L9EA 1CJCA 1L9DA 1RSGA 2C65A 2XLSA 3T37A 3RHAA 4B1BA 4BJYA 4TM1A 5IQ1A 4YSYA 3H8IA 4U8IA 1N4WA 5KVIA 4U8KA 1XHCA 5HXIA 4X9NA 2RGOA 2WPEA 5KOXA 3HZLA 4X9MA 2XVIA 3DA1A 3AEFA 1D4CA 3F8DA 5FS9A 3IHGA 4IVMB 2NPXA 1H81A 1PJ5A 3ICRA 4C3XA 5EOWA 3ISHA 2EQ8A 1BWCA 4JNQA 3AE7A 2R0PA 1CL0A 2C76A 3CGEA 4CNKA 3II4A 3VRDB 3RNMA 2BCPA 1QJDA 2WP5A 3UKPA 4YSXA 4CY8A 4BK1A 4J36A 4A6NA 3NIXA 3NNEA 2GQFA 1GSNA 3D8XA 5M10A 4ECHA 5LV9A 2X99A 1AOGA 4LIIA 2XLUA 5GRTA 1TDNA 4JDRA 4EIQA 1CJ2A 4H2RA 3I3LA 2XFOA 4ZCCA 4TM0A 3FPZA 3C4AA 2GMJA 2YLZA 2FJBA 1H83A 3OC4A 1NHSA 2JB3A 4Z25A 2YLTA 2I0ZA 4AT0A 2WOWA 1N4VA 3NTAA 2YM1A 4EQXA 2GMHA 1IUSA 3G5SA 3P4QA 3LZXA 3AEGA 3PVCA 3VRBA 1F8WA 5KVHA 4OPGA 4CRTA 3RP7A 1ZKQA 1OJTA 1ZP0A 3NT6A 1P2HA 1L0VA 4HB9A 2X8CA 1E1LA 3RP6A 4RG3A 3GRTA 1BKWA 1M64A 1B4VA 2GR0A 2F5ZA 4Z44A 1F8SA 2WP9A 3UOZA 3NN0X 3AE2A 1Q1WA 4EIPA 3B6DA 3KU9A 3VR9A 2Q0LA 1CC6A 2E5VA 2APGA 1F8RA 3ALJA 2WU5A 4C5OA 1CC2A 4DSHA 4DGKA 2C73A 2XYOA 4H4RA 1BF3A 2XVEA 3AE8A 3AE5A 1GREA 1NEKA 1LJ1A 4XWRA 1FEBA 4EMWA 4H4SA 2YR6A 1TDOA 3DJJA 1K0LA 3Q6JA 3E1TA 1PJ6A 3V3OA 2WP6A 2WDQA 5J60A 3LB8A 1E7PA 5U63A 4REKA 3AE9A 1NG4A 1M6IA 5HYMA 1W4XA 2Y6QA 2GR2A 3NYFA 5C2TA 1GERA
chains in the Genus database with same CATH superfamily
3T8QA 1V59A 3IHMA 3AYIA 3EKGA 1N60C 4YKGA 1GRHA 2ZZ0A 3V5FA 4HCDA 1GRGA 3NKSA 5FJRA 2GF3A 1KNPA 1H6VA 1PXCA 1N4UA 2XLTA 2WS3A 2EQ9A 2V61A 4YTNA 3DEQA 1HYUA 3H4KA 3L5OA 4GFIA 5JCKA 1FO4A 1BZLA 4EMJA 2MNRA 1FEAA 4RG4A 3K7MX 3P93A 4O5UA 3CPIG 3EF6A 3TTEA 2XVHA 4B66A 1E39A 3R9UA 4JNAA 2GR1A 2R45A 4H7UA 3B3RA 1JCTA 3GC2A 4GISA 4NEVA 2C75A 4ZCDA 1JNRA 4OCGA 5KMSA 4J3ZA 2V3BA 1E1NA 2E1MA 4OPUA 3GMBA 2GGHA 3CGDA 4E0VA 1GETA 3AD9B 1GRAA 1R0MA 2QAEA 3A7AA 3G5QA 4II3A 3TOYA 3UP5A 2PTYA 2UZZA 3SJNA 3FIMB 2AKZA 3U9IA 2C3DA 1LTXR 4EQSA 3SM8A 1CC4A 4RSLA 3P9UA 2A8XA 3NS1B 3QFAA 1N63C 2FJEA 3TCSA 3T6CA 2C66A 4E5TA 3DGHA 2MUCA 4K8DA 1PDHA 5C3JA 3DIPA 3P4PA 3HYVA 2GQWA 1SB3B 1JRZA 1PS9A 1NPXA 5U25A 1CF3A 4HNCA 2YG3A 1VQZA 5JCLA 1TDKA 2WU2A 3FBSA 4H50A 1S2YA 2ZZCA 3RR1A 5JCNA 3DK9A 2PCEA 3CYJA 4EWJA 3AB1A 3OZYA 2Q7VA 4FP1A 2GRTA 3NH3X 4OPCA 4H1ZA 1EL9A 4JY2A 3V4BA 2E5AA 3HYWA 3AMZA 1FOHA 3IWAA 5BULA 4E4UA 5JCMA 4F4RA 4EQWA 3RCYA 4KPRA 1Y56A 4U8MA 2V5ZA 4AP3A 3CGBA 2XFUA 3L1RA 3BSMA 3DMEA 1PDYA 3WE0A 3N6HA 2YVGA 1Z6LA 2O9ZA 1PXBA 3PWGA 1X31B 4MKSA 4EQRA 4GCMA 4PABA 3AD7B 3DG7A 5U1OA 4K5RA 2BC0A 5BUKA 2R4EA 3QSEA 3BI4A 5EB5A 3RITA 4A7AA 1E6EA 2GVCA 4NNJA 1FCDA 4TVYA 2PGEA 1P2EA 3D9XA 1GV4A 3I6DA 3FVDA 3DESA 3BNMA 4KX6A 3IK4A 4DNAA 2R9ZA 3GWDA 1JRYA 1MRAA 3RP8A 3BI2A 4BK2A 5FJOA 4TVWA 3DG3A 3CN8A 3SQSA 3TQPA 3TW9A 4B67A 4KT2A 4GAPA 4E6MA 4A6GA 3DK8A 2PU1A 2Q0KA 3DJGX 2C4CA 1RP0A 2YVJA 2JKCA 4J1OA 5FJPA 3NG7X 1COYA 4B63A 1DOCA 1SJDA 3IC9A 3UJSA 3SFDA 4A79A 4M0XA 2R4JA 1IUXA 3L8KA 1S7MA 4I59A 3LXDA 4USQA 4K2SA 4G73A 3EPTA 2GB0A 3UXLA 4HA6A 4GIRA 3CNSA 4G9KA 3LOVA 2C7GA 2VVLG 2OO6A 2P8CA 3VCNA 1OJCA 2A89A 4H4PA 2HQMA 3IF9A 4IA6A 4JY3A 1TZZA 4HYRA 3Q45A 3DDMA 3ZDNA 1MNSA 2PYXA 1OJ9A 4K2XA 3SN1A 4FX9A 3KPFA 1JNZA 3LJPA 3NGCX 3SXIA 2FKPA 3JSKA 1E1KA 3ZLHA 3T2ZA 2C72A 4ZA0A 3M12A 3GD4A 1LVLA 1S3EA 4U8OA 2BK5A 4J33A 2DKHA 2WOVA 1L9EA 1RSGA 1L9DA 4BJYA 4U8IA 3QLDA 4U8KA 5KOXA 3D46A 2XVIA 3MUCA 2AL1A 3F8DA 1D4CA 5FS9A 4IVMB 3CK5A 1PJ5A 3ICRA 4C3XA 5EOWA 4JNQA 2BCPA 1QJDA 3UKPA 2QGYA 4CY8A 3UGVA 4BK1A 3NIXA 3D8XA 4K1WA 4E4FA 1MDLA 2XH7A 2GDQA 3C4AA 2FJBA 2JB3A 3OC4A 4Z25A 2WOWA 1N4VA 4EQXA 2GMHA 3VRBA 2PTWA 1P2HA 2X8CA 1E1LA 3GRTA 3H12A 1F8SA 3UOZA 3NN0X 4EIPA 3GD6A 2Q0LA 1CC6A 2E5VA 3PG6A 1F8RA 4C5OA 2DW6A 3ZLGA 2BRYA 1TDOA 1K0LA 1EC7A 1PJ6A 5J60A 3P3BA 3CXOA 1M6IA 1NG4A 2GR2A 5BOEA 1GERA 2GL5A 3FXGA 4OPTA 3GD3A 3UCLA 3UTGA 4OPDA 3N4FA 5EBKA 2P0IA 2JAEA 2E3TA 2YLRA 4P9SA 1PHHA 2JBVA 3GSIA 3UOXA 4NTEA 4USRA 2CVJA 3S5WA 3NK0X 3ADAB 3NLCA 1ZOYA 2YLXA 4IP5A 2OAMA 5GSNA 2FJDA 3SR6B 5HY5A 3IJQA 4Z43A 2BACA 3BJSA 2C3CA 4OVIA 2EQ6A 5FS7A 4ZN0A 4ROPA 2RABA 5FS6A 3P0WA 3ENLA 2BXSA 1EC9A 1NENA 5IPYA 1B37A 3ICTA 5KMPA 3V5CA 2HXTA 1RYIA 1CHUA 2YVFA 4A5LA 3UKHA 4CNJA 1ONEA 2A87A 1H7XA 2WPFA 2B9YA 4M6UA 4A35A 1LPFA 1JDFA 1NELA 4NTCA 1NDAA 5IDZA 4Y4MA 4A99A 2FBWA 3CNDA 4OPIA 3CT2A 3AXBA 4Y4NA 2YG7A 4GRTA 2WHDA 4U2LA 5IQ4A 1PXAA 4PAAA 3VR8A 1YQZA 3N6JA 1LQTA 3ZYXA 4ICYA 3R0KA 1EBHA 3AE3A 1O94A 4YSZA 3OZ2A 2WEUA 4G7FA 3TWBA 3AD8B 2GGIA 3ABVA 3AE1A 1ONFA 1TE6A 3SZ0A 4FK1C 5J7XA 1MUCA 2OZ8A 2BS3A 1T3QC 4D04A 3SBFA 4GAVA 2Z5YA 3NHOX 3REDA 2AQJA 3ICSA 3A7RA 1TDFA 3DH9A 2V60A 1H2IA 4YT0A 2WQYA 4H4YA 3RGTA 1O5WA 2IVDA 2YG5A 2W0HA 1DOEA 2XH2A 2BK3A 4II2A 1JPDX 2HNEA 4DX3A 1PN0A 1BGNA 1EL8A 1JRXA 3AYLA 4YTMA 1GALA 2VRMA 2AL2A 4EM4A 5ER0A 5HHFA 3JW7A 3GYIA 1DXLA 1KFYA 4Z17A 1LV0A 4WX1A 5J04A 1JEHA 3CMMA 1ZK7A 1LQUA 4B69A 2OZTA 2YR4A 1GTHA 3RRAA 2QJNA 4IP4A 1VDVA 2JB1A 3SZFA 1XPQA 2OKTA 1XPYA 1D7YA 2VOUA 4NEWA 3AECA 2PP3A 2OLAA 3KA7A 2BYBA 2QVHA 5KXJA 1ZOVA 3BHKA 1TYPA 3NFUA 3SSZA 3AE4A 3CNJA 3C4NA 3ATQA 3PS9A 3ZVIA 4H4TA 3NTDA 2BA9A 4EMIA 1FHVA 4A65A 1TRBA 1XDIA 3I4KA 3CB3A 4JN7A 1NAAA 4BV6A 1S2QA 4CCQA 3NRZB 1IYXA 3IJIA 3ATRA 2E4GA 3NXLA 3R10A 3MY9A 4GYPA 2YLSA 4AT2A 2AR8A 3SN4A 4H2NA 2GEWA 1UKVG 3G5RA 3IJLA 2PSNA 1MO9A 3SZCA 2H89A 2RGJA 3K7TA 4C74A 2V6OA 3K7QX 5EU9A 1CJ3A 2WDRA 3NVYB 4TLZA 3ES8A 1ZXIC 3GDNA 1YQ4A 3P4RA 2VZ2A 3AEAA 6ENLA 4B1BA 5IQ1A 1N4WA 2PPGA 5HXIA 2RGOA 2WPEA 3DA1A 4H2HA 3AEFA 3IHGA 3KUMA 4IT1A 1TKKA 2R0PA 4HNLA 3VDGA 4A6NA 3NNEA 5M10A 4ECHA 3T2KA 2HZGA 5LV9A 1AOGA 5GRTA 1CJ2A 4H2RA 1EC8A 2YLTA 1IUSA 3AEGA 1F8WA 5KVHA 1ZKQA 3NT6A 1L0VA 4HB9A 2AKMA 1M64A 4Z44A 1STZA 4MGGA 3B6DA 3VR9A 2PTZA 4A3RA 3ALJA 2QQ6A 1CC2A 4DSHA 4DGKA 4H4RA 2XVEA 3QPEA 1GREA 4XWRA 4H4SA 3OP2A 3BOXA 2WP6A 2W54A 2WDQA 3AE9A 1W4XA 2XGZA 2Y6QA 3R11A 3D47A 3KLJA 2PTXA 3UCDA 2OA1A 4GUVA 2WDVA 3FJ4A 4H19A 1H86A 4Z26A 1FECA 1N61C 4ENLA 1ZX9A 1NHRA 1EBDA 1PBBA 3PFRA 2WPCA 1DJNA 4IL2A 1Q9IA 3PO7A 4H4QA 1ZY8A 3TWAA 2XFNA 2OX4A 3FYYA 5ENLA 1QLBA 4TLXA 1ELSA 1MXTA 3UJEA 1YEYA 1YQ3A 1KD0A 4HN8A 2QCUA 1F6MA 4MJWA 4CCRA 2X50A 2XVJA 1R6WA 5BVAA 4A9WA 1PBEA 3AM9A 1P48A 2VRLA 2QA2A 3M13A 1N5WC 2P8BA 2FJAA 3M0OA 4BK3A 5CKUA 2WOIA 1FFUC 4K8GA 1V97A 1K0JA 4DHGA 3DGZA 2BK4A 4H4VA 4D03A 4Y4LA 1H82A 4K22A 3H8AA 2YQUA 1MDRA 2W55A 4Z2TA 2XFPA 1O95A 2BXRA 3NRNA 5CQFA 3TJ4A 1EL5A 4J2WA 4FDCB 4C77A 1ECQA 1VG0A 2PA6A 1Y0PA 1KF6A 1FL2A 4AP1A 4DWDA 4YKFA 2XDOA 2XCGA 3CTYA 2C64A 2X3NA 4IVOB 1KSSA 4HCHA 2ACZA 2JB2A 2CFYA 4GGHA 1Q1RA 4ADWA 4C3YA 1B8SA 3I6TA 3EANA 5BRTA 2ARDA 2YM2A 4H2QA 3S61A 4X4JA 3ZLFA 4Z1YA 3UOVA 4JN8A 2RDXA 2BS4A 3NK2X 1KKRA 3OZMA 1D5TA 2GAHB 2GV8A 2YAUA 3NVZB 4G8TA 2YWLA 1YY5A 3ITJA 3P4SA 3UKKA 4B68A 4J57A 2Y6RA 4B65A 3MKCA 1PBFA 2B7SA 4NTDA 2O56A 2XVFA 3QSSA 4G6GA 2I5QA 1F9CA 3DK4A 2JK6A 1VG9A 3SZWA 4X2PA 1IUWA 2B76A 3O0HA 1IUUA 2XLPA 5KOWA 3DJDA 2ZBWA 7ENLA 3K30A 2WBAA 2C67A 3DFHA 3JVAA 1KKOA 1JROA 2XH0A 2CDUA 4GDEA 3CXBA 2FYMA 4H4XA 3C96A 1PDZA 3GYJA 1CJ4A 3P1WA 4U2TA 1GRFA 3H70A 2NQLA 4U8LA 1H84A 3NYCA 4CBQA 4GYPC 4N9XA 4U2SA 4LU6A 3SGLA 4HCLA 1RM6B 3AYJA 3UKAA 1DODA 1GTEA 2C70A 3SYIA 3CPJG 3CNTA 4BURA 1BGJA 4JQ9A 2OZ3A 1OJAA 2R46A 1JU2A 3UOYA 3F8RA 3U4FA 4B64A 2BRAA 2PS2A 1ZDLA 2PP0A 3EAOA 5M0ZA 3I6EA 3AWIA 2PGWA 2RGHA 4A6NB 1TYTA 3V3NA 4I58A 1CBOA 5FS8A 4XXGA 3FCPA 4Z2UA 1GXFA 3QJ4A 4OPLA 5DBJA 1IUTA 2VQBA 3QVRA 4MMWA 3QKEA 1PBDA 3R0UA 3HRDC 3KKJA 2OG9A 3DG6A 2XH4A 3CPHG 4H2PA 1GOSA 4NZHA 1L9CA 3ALMA 2R0CA 4UDPA 4J34A 2PU0A 4TM4A 5KMRA 1K4QA 3MSYA 3UTEA 3KD9A 3VFCA 1X2GA 4DYEA 2XLSA 3RHAA 3UXKA 3QN3A 1XHCA 4X9NA 4G74A 1RVKA 1BKHA 1E9IA 2QDEA 2NPXA 1SJCA 3AE7A 2C76A 4CNKA 3DFYA 2WP5A 4J36A 3Q4DA 2X99A 4LIIA 3S5SA 2POZA 1TDNA 4JDRA 4ZCCA 2W3RA 3VA8A 3FPZA 2YLZA 1SJBA 1H83A 4DXKA 3VC5A 3NTAA 3G5SA 3LZXA 1DTNA 3PVCA 4OPGA 1OJTA 4DN1A 1W6TA 1BKWA 2ZADA 2F5ZA 3SY4A 2WP9A 1Q1WA 3OW1A 3KU9A 2C73A 1BF3A 3AE8A 1KN0A 1NEKA 1FEBA 4EMWA 3DJJA 3JZUA 1E7PA 5U63A 4REKA 5C2TA 3CAWA 3CGCA 2GGEA 4NWZA 1QO8A 4M52A 4BJZA 2OLNA 4GF7A 3FG2P 2QJJA 3UP4A 4GGBA 3GWFA 4YWOA 4H4UA 3QSMA 3VRAA 5G5GB 3ALLA 1N5XA 1GT8A 1WUFA 5FMHA 2QDDA 3TJIA 3HYXA 5KWFA 3GY1A 4H83A 4GDPA 1IUVA 1NHPA 3N4EA 3QVPA 3SN0A 1ZMDA 5JRBA 3UTHA 1D7LA 4G6HA 4U8NA 1E1MA 1GESA 2GH5A 4KPLA 2Z5XA 4K7ZA 3BHFA 5JCIA 4H4ZA 3GYXA 1F3PA 3GMCA 1SEZA 3T9PA 3BNUA 4O5QA 4EM3A 1K0IA 3K1GA 3UKQA 1X2HA 3COXA 3MQTA 3GDPA 5EB4A 2H88A 3ZVHA 1P43A 3HPFA 4TM3A 2ZZBA 2GAGB 4YWSA 1DJQA 1NHQA 1BQGA 1OEPA 2XSXA 2YG4A 3EEZA 3ETRB 3ES7A 3R25A 3V76A 4IV9A 2W3SA 3F8PA 2VVLA 5L46A 4Z2RA 1XS2A 1L8PA 2OQHA 3NVVB 1FFVC 4YTPA 4JN9A 4J31A 2YLWA 5FJTA 5KMQA 3MZNA 1EL7A 3FMWA 3UKLA 2IVEA 4IL0A 1N1PA 1PBCA 1IJHA 1XANA 1Y56B 5KNLA 4CY6A 2GSHA 3VQRA 1GRBA 2VQ7A 5KRQA 1GNDA 1S3BA 2R0GA 4H4WA 3GRSA 4J56A 1KDGA 2CULA 3ZVHB 4DSGA 3LZWA 4IA5A 1PJ7A 2OVLA 3H7VA 4UP3A 1WUEA 2NVKX 1H7WA 2CHRA 3THUA 2PHHA 2QJMA 3LADA 3UTFA 1ZMCA 3B9JB 2IIDA 1NU5A 4XWZA 2EQ7A 3SFEA 1REOA 3Q9TA 4K5SA 2PMQA 3AN1A 2X8GA 2BCGG 2XFQA 3DERA 1N62C 2J3NA 1DOBA 1VRQB 2P88A 2OFJA 4APNA 4YSHA 3DJEA 3URHA 4AOSA 2V3AA 2X8HA 1KNRA 3UJRA 3AE6A 2OLOA 1MOKA 3BI5A 2OPJA 1KCZA 2QA1A 4GR1A 1WYGA 1TDEA 1DNCA 1GRTA 2OALA 3CIRA 4GMEA 3QTPA 3NK1X 1B5QA 4FI4A 4ZCWA 4IHCA 4FK1A 2GGJA 3DGBA 2PP1A 2VVMA 2TMDA 3MWCA 2DW7A 3AEBA 1SJAA 3AEDA 1D4DA 4U8PA 1KSUA 3NZGA 3T14A 3NN6X 2XLRA 2AAQA 3R1ZA 3UJ2A 2BC1A 2ZC8A 3NYEA 4WCTA 4KWSA 3RO6A 3V3WA 4YXDA 1EBGA 2DKIA 4U8JA 2BS2A 4UDQA 3PK7A 4AOXA 3B97A 1VQWA 2Q6UA 2B9WA 4JHMA 1NG3A 1OJDA 3KPKA 4LA1A 2OQYA 2B9XA 3D1CA 3QFBA 3OTRA 2TPRA 3VC6A 3PWIA 3VCCA 3A7UA 4UDRA 2WETA 3CNPA 1GPEA 1D4EA 3H8LA 3UKFA 2YG6A 3KVEA 4Z24A 1GEUA 2GGGA 1JPMA 2PODA 1YKJA 1ELIA 3AEEA 1VDCA 1JOAA 3R07C 3T4WA 3SQPA 3EUB3 2WESA 1FIQB 2YR5A 2GR3A 5TR3A 2BABA 2B7RA 1CJCA 2C65A 3GO2A 3T37A 4TM1A 4YSYA 3H8IA 5KVIA 1JRPA 3HZLA 4X9MA 3T0KA 3UJFA 3T31A 4KEMA 5FJUA 1H81A 3FV9A 3ISHA 2EQ8A 1BWCA 1CL0A 3CGEA 3II4A 3VRDB 3RNMA 4YSXA 2GQFA 1GSNA 2AL2B 2XLUA 4ZOHB 3NVWB 4EIQA 3I3LA 2XFOA 4TM0A 2GMJA 1NHSA 2I0ZA 4AT0A 2YM1A 3P4QA 1FHUA 2ONEA 4CRTA 3RP7A 1ZP0A 3RP6A 4RG3A 3STPA 1B4VA 2GR0A 4IZGA 3AE2A 3UCCA 4HPNA 3HW2A 2APGA 2WU5A 2XYOA 3NO1A 3AE5A 1LJ1A 2HXUA 2YR6A 3E1TA 3Q6JA 3V3OA 3LB8A 2P3ZA 5BOFA 5G5HB 3SX6A 5HYMA 3NYFA 3S47A 3T2YA 3OPSA 4E8GA
chains in the Genus database with same CATH topology
3CGCA 1V59A 3KLJA 3IHMA 3AYIA 4OPTA 4YKGA 3GD3A 3UCLA 1GRHA 4NWZA 3UTGA 2ZZ0A 1QO8A 2OA1A 4OPDA 1GRGA 4M52A 2WDVA 4GUVA 2OLNA 4BJZA 5EBKA 2JAEA 3NKSA 4GF7A 2GF3A 3FG2P 1H6VA 1H86A 1KNPA 4Z26A 1FECA 3UP4A 2YLRA 4P9SA 3GWFA 1PHHA 4YWOA 1PXCA 4H4UA 2JBVA 3GSIA 3QSMA 3UOXA 3VRAA 1N4UA 2XLTA 1ZX9A 2WS3A 1NHRA 3ALLA 4NTEA 2EQ9A 1GT8A 1EBDA 2V61A 1PBBA 4USRA 2CVJA 2WPCA 4YTNA 1HYUA 3S5WA 5FMHA 3NK0X 3H4KA 3L5OA 1DJNA 5JCKA 1Q9IA 1BZLA 3PO7A 4H4QA 4EMJA 3ADAB 1ZOYA 1ZY8A 3NLCA 3HYXA 2YLXA 1FEAA 2XFNA 4RG4A 1QLBA 2OAMA 4TLXA 5GSNA 5KWFA 3K7MX 4GDPA 1IUVA 1NHPA 1MXTA 2FJDA 4O5UA 5HY5A 3CPIG 3QVPA 3EF6A 2XVHA 1ZMDA 4B66A 4Z43A 1E39A 2BACA 2C3CA 3R9UA 5JRBA 3UTHA 1YQ3A 4JNAA 4OVIA 2GR1A 1D7LA 2R45A 2EQ6A 5FS7A 4H7UA 4G6HA 3B3RA 4ZN0A 2RABA 5FS6A 2QCUA 1F6MA 4MJWA 4U8NA 1E1MA 1GESA 4NEVA 2GH5A 2C75A 2BXSA 2Z5XA 4ZCDA 1JNRA 1NENA 4K7ZA 3BHFA 2X50A 4OCGA 4CCRA 5KMSA 2XVJA 2V3BA 1E1NA 5JCIA 5BVAA 5IPYA 4H4ZA 1B37A 3GYXA 1F3PA 4A9WA 3GMCA 3ICTA 1PBEA 2E1MA 4OPUA 3GMBA 5KMPA 4E0VA 3CGDA 1SEZA 1RYIA 3BNUA 1GETA 2VRLA 2QA2A 1CHUA 3AD9B 3M13A 4O5QA 4EM3A 1GRAA 2QAEA 1K0IA 3G5QA 2YVFA 4II3A 3UKHA 4A5LA 4CNJA 3UKQA 2A87A 1H7XA 3UP5A 2FJAA 2UZZA 2WPFA 3COXA 3FIMB 2B9YA 2C3DA 3M0OA 1LTXR 4EQSA 3SM8A 1CC4A 3GDPA 4BK3A 5CKUA 5EB4A 1LPFA 2WOIA 4RSLA 3P9UA 2H88A 4NTCA 2A8XA 3QFAA 2FJEA 4TM3A 1K0JA 1NDAA 2ZZBA 3DGZA 2BK4A 4H4VA 2GAGB 4D03A 4Y4LA 2C66A 1DJQA 1H82A 4K22A 1NHQA 3DGHA 2YQUA 4Z2TA 2XFPA 2YG4A 1O95A 2BXRA 4K8DA 3NRNA 4Y4MA 5CQFA 4A99A 1PDHA 3V76A 5C3JA 1EL5A 4J2WA 4FDCB 4IV9A 2FBWA 3F8PA 4C77A 3CNDA 2VVLA 4OPIA 1VG0A 5L46A 3P4PA 4Z2RA 3HYVA 2GQWA 1Y0PA 1KF6A 1FL2A 1JRZA 4AP1A 3AXBA 1PS9A 4Y4NA 1NPXA 2YG7A 5U25A 1CF3A 4YTPA 4GRTA 2XDOA 2YG3A 4JN9A 4J31A 5JCLA 4YKFA 2XCGA 2WHDA 2C64A 3CTYA 2X3NA 1TDKA 4U2LA 2WU2A 2YLWA 5IQ4A 3FBSA 4IVOB 5KMQA 1PXAA 4PAAA 4H50A 1KSSA 3VR8A 1YQZA 1EL7A 1S2YA 3FMWA 3UKLA 2IVEA 2ZZCA 3ZYXA 1LQTA 2ACZA 4ICYA 2JB2A 5JCNA 2CFYA 3DK9A 1N1PA 1Q1RA 3AE3A 4ADWA 1PBCA 3AB1A 4C3YA 1O94A 1IJHA 1XANA 1B8SA 1Y56B 2Q7VA 5KNLA 2GRTA 3NH3X 4CY6A 3EANA 3OZ2A 4OPCA 4YSZA 2WEUA 5BRTA 2ARDA 1EL9A 3AD8B 3VQRA 2YM2A 1GRBA 4JY2A 4H2QA 2VQ7A 5KRQA 3ABVA 3S61A 4X4JA 3AE1A 1ONFA 1GNDA 1S3BA 2R0GA 4H4WA 3HYWA 3SZ0A 3GRSA 3UOVA 4J56A 1KDGA 4FK1C 1FOHA 2CULA 5J7XA 2BS3A 2BS4A 3IWAA 5BULA 3NK2X 4D04A 1D5TA 2GAHB 4DSGA 2GV8A 2YAUA 4GAVA 3LZWA 2Z5YA 4IA5A 1PJ7A 2YWLA 1YY5A 3ITJA 3NHOX 3P4SA 4UP3A 3REDA 2AQJA 2NVKX 3ICSA 3UKKA 5JCMA 4B68A 1H7WA 1TDFA 4J57A 2PHHA 3DH9A 4EQWA 3LADA 2V60A 2Y6RA 4KPRA 1Y56A 4B65A 2V5ZA 1H2IA 1PBFA 3CGBA 1ZMCA 2XFUA 3L1RA 2WQYA 4U8MA 4H4YA 3UTFA 4YT0A 3DMEA 2IIDA 1O5WA 2B7SA 4NTDA 3WE0A 2XVFA 3QSSA 4G6GA 4XWZA 2EQ7A 2IVDA 2YVGA 3SFEA 3DK4A 1Z6LA 2O9ZA 2YG5A 2W0HA 2JK6A 1DOEA 1REOA 2BK3A 1PXBA 3Q9TA 4K5SA 1X31B 4II2A 2X8GA 1VG9A 2BCGG 3SZWA 2XFQA 4EQRA 1PN0A 1BGNA 1EL8A 4GCMA 1JRXA 3AYLA 4PABA 4YTMA 3AD7B 5U1OA 4K5RA 2BC0A 5BUKA 1GALA 2VRMA 2J3NA 1DOBA 1VRQB 2R4EA 1IUWA 3QSEA 3BI4A 4EM4A 5ER0A 2B76A 4APNA 3O0HA 3GYIA 5EB5A 5HHFA 1DXLA 4A7AA 4YSHA 3DJEA 4AP3A 1E6EA 1IUUA 2XLPA 1KFYA 5KOWA 1LV0A 2GVCA 3DJDA 4WX1A 2ZBWA 1JEHA 4NNJA 3URHA 3CMMA 1FCDA 1ZK7A 4AOSA 2V3AA 2X8HA 1LQUA 4B69A 3K30A 1KNRA 1P2EA 2WBAA 2YR4A 3D9XA 1GTHA 1GV4A 3AE6A 2C67A 3I6DA 2OLOA 1MOKA 2JB1A 3BI5A 2CDUA 4GDEA 2QA1A 4GR1A 1XPQA 3BNMA 1TDEA 1DNCA 4KX6A 3SZFA 1GRTA 4DNAA 2OALA 2R9ZA 4H4XA 3GWDA 1D7YA 3CIRA 1JRYA 2VOUA 4NEWA 3AECA 3NK1X 1B5QA 3C96A 3RP8A 3BI2A 3GYJA 1CJ4A 4BK2A 3P1WA 4U2TA 4FK1A 1GRFA 2VVMA 2TMDA 3CN8A 3KA7A 2BYBA 5KXJA 1ZOVA 3BHKA 3AEBA 4U8LA 1H84A 3NYCA 4CBQA 4N9XA 4U2SA 4LU6A 1TYPA 3AEDA 1D4DA 4U8PA 3SGLA 1KSUA 3AE4A 4B67A 3T14A 4GAPA 3NN6X 3DK8A 2XLRA 2Q0KA 3DJGX 2C4CA 1RP0A 3CNJA 2AAQA 2YVJA 3AYJA 3UKAA 3C4NA 2JKCA 1DODA 3ATQA 2BC1A 3PS9A 3NYEA 1GTEA 3NG7X 4WCTA 1COYA 4B63A 1DOCA 2C70A 3IC9A 3SFDA 4A79A 2DKIA 4YXDA 3SYIA 4H4TA 2R4JA 3NTDA 4U8JA 3CPJG 2BS2A 3CNTA 4UDQA 2BA9A 4EMIA 1IUXA 4A65A 4AOXA 3L8KA 4BURA 1TRBA 1BGJA 4JQ9A 1S7MA 4I59A 1OJAA 2R46A 1XDIA 3LXDA 1JU2A 3UOYA 1VQWA 4USQA 3F8RA 2Q6UA 2B9WA 1NG3A 1NAAA 4G73A 1OJDA 3EPTA 3KPKA 4LA1A 2GB0A 4BV6A 2B9XA 1S2QA 4CCQA 4HA6A 3D1CA 3ATRA 3CNSA 2E4GA 3QFBA 3LOVA 4G9KA 4B64A 2C7GA 2BRAA 2VVLG 1OJCA 2A89A 4H4PA 1ZDLA 2HQMA 2TPRA 3IF9A 4IA6A 3EAOA 4JY3A 5M0ZA 2YLSA 4AT2A 3AWIA 3ZDNA 2RGHA 4A6NB 1TYTA 2PYXA 2AR8A 3V3NA 1OJ9A 4I58A 4K2XA 1CBOA 5FS8A 4FX9A 4UDRA 3KPFA 4XXGA 1JNZA 3LJPA 2WETA 3NGCX 4H2NA 3CNPA 1GPEA 1D4EA 2GEWA 3H8LA 3UKFA 2YG6A 1UKVG 3KVEA 4Z2UA 1GXFA 4Z24A 3SXIA 3JSKA 3QJ4A 4OPLA 5DBJA 1IUTA 1E1KA 1GEUA 3G5RA 2VQBA 3QVRA 1YKJA 1ELIA 1PBDA 3AEEA 3KKJA 3T2ZA 1MO9A 1VDCA 3SZCA 2H89A 2RGJA 2C72A 3CPHG 4H2PA 3K7TA 1JOAA 1GOSA 4NZHA 4C74A 2V6OA 1L9CA 3ALMA 3K7QX 1CJ3A 3M12A 2WDRA 3GD4A 3SQPA 2R0CA 4UDPA 1LVLA 4TLZA 1S3EA 4J34A 4TM4A 3GDNA 4U8OA 2WESA 5KMRA 1YQ4A 1K4QA 2YR5A 2BK5A 2VZ2A 3AEAA 3P4RA 4J33A 3UTEA 2GR3A 3KD9A 2DKHA 2WOVA 5TR3A 2BABA 2B7RA 1L9EA 1CJCA 1L9DA 1RSGA 2C65A 2XLSA 3T37A 3RHAA 4B1BA 4BJYA 4TM1A 5IQ1A 4YSYA 3H8IA 4U8IA 1N4WA 5KVIA 4U8KA 1XHCA 5HXIA 4X9NA 2RGOA 4G74A 2WPEA 5KOXA 3HZLA 4X9MA 3T0KA 3T31A 2XVIA 3DA1A 3AEFA 1D4CA 3F8DA 5FS9A 3IHGA 4IVMB 2NPXA 1H81A 1PJ5A 3ICRA 4C3XA 5EOWA 3ISHA 2EQ8A 1BWCA 4JNQA 3AE7A 2R0PA 1CL0A 2C76A 3CGEA 4CNKA 3II4A 3VRDB 3RNMA 2BCPA 1QJDA 2WP5A 3UKPA 4YSXA 4CY8A 4BK1A 4J36A 4A6NA 3NIXA 3NNEA 2GQFA 1GSNA 3D8XA 5M10A 4ECHA 3T2KA 5LV9A 2X99A 1AOGA 4LIIA 2XLUA 5GRTA 1TDNA 4JDRA 4EIQA 1CJ2A 4H2RA 3I3LA 2XFOA 4ZCCA 4TM0A 3FPZA 3C4AA 2GMJA 2YLZA 2FJBA 1H83A 3OC4A 1NHSA 2JB3A 4Z25A 2YLTA 2I0ZA 4AT0A 2WOWA 1N4VA 3NTAA 2YM1A 4EQXA 2GMHA 1IUSA 3G5SA 3P4QA 3LZXA 3AEGA 3PVCA 3VRBA 1F8WA 5KVHA 4OPGA 4CRTA 3RP7A 1ZKQA 1OJTA 1ZP0A 3NT6A 1P2HA 1L0VA 4HB9A 2X8CA 1E1LA 3RP6A 4RG3A 3GRTA 1BKWA 1M64A 1B4VA 2GR0A 2F5ZA 3SY4A 4Z44A 1F8SA 2WP9A 3UOZA 3NN0X 3AE2A 1Q1WA 4EIPA 3B6DA 3KU9A 3VR9A 2Q0LA 1CC6A 2E5VA 3PG6A 2APGA 1F8RA 3ALJA 2WU5A 4C5OA 1CC2A 4DSHA 4DGKA 2C73A 2XYOA 4H4RA 1BF3A 2XVEA 3AE8A 1KN0A 1GREA 1NEKA 3AE5A 1LJ1A 2BRYA 4XWRA 1FEBA 4EMWA 4H4SA 2YR6A 1TDOA 3DJJA 1K0LA 3Q6JA 3E1TA 1PJ6A 3V3OA 2WP6A 2WDQA 5J60A 3LB8A 1E7PA 5U63A 4REKA 3AE9A 1NG4A 1M6IA 3SX6A 1W4XA 2Y6QA 2GR2A 3NYFA 5HYMA 5C2TA 3T2YA 1GERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CGC A;  1V59 A;  3KLJ A;  3IHM A;  3AYI A;  4OPT A;  4YKG A;  3GD3 A;  3UCL A;  1GRH A;  3UTG A;  2ZZ0 A;  1QO8 A;  2OA1 A;  4OPD A;  1GRG A;  4M52 A;  2WDV A;  4GUV A;  2OLN A;  4BJZ A;  5EBK A;  2JAE A;  3NKS A;  4GF7 A;  2GF3 A;  3FG2 P;  1H6V A;  1H86 A;  1KNP A;  4Z26 A;  1FEC A;  3UP4 A;  2YLR A;  4P9S A;  3GWF A;  1PHH A;  4YWO A;  1PXC A;  4H4U A;  2JBV A;  3GSI A;  3QSM A;  3UOX A;  3VRA A;  1N4U A;  2XLT A;  1ZX9 A;  2WS3 A;  1NHR A;  3ALL A;  4NTE A;  2EQ9 A;  1GT8 A;  1EBD A;  2V61 A;  1PBB A;  4USR A;  2CVJ A;  2WPC A;  4YTN A;  1HYU A;  3S5W A;  5FMH A;  3NK0 X;  3H4K A;  1DJN A;  5JCK A;  1Q9I A;  1BZL A;  3PO7 A;  4H4Q A;  4EMJ A;  3ADA B;  1ZOY A;  1ZY8 A;  3NLC A;  2YLX A;  1FEA A;  2XFN A;  4RG4 A;  1QLB A;  2OAM A;  4TLX A;  5GSN A;  5KWF A;  3K7M X;  4GDP A;  1IUV A;  1NHP A;  1MXT A;  2FJD A;  4O5U A;  5HY5 A;  3CPI G;  3QVP A;  3EF6 A;  2XVH A;  1ZMD A;  4B66 A;  4Z43 A;  1E39 A;  2BAC A;  2C3C A;  3R9U A;  3UTH A;  1YQ3 A;  4JNA A;  4OVI A;  2GR1 A;  1D7L A;  2R45 A;  2EQ6 A;  5FS7 A;  4H7U A;  4ZN0 A;  3B3R A;  2RAB A;  5FS6 A;  2QCU A;  1F6M A;  4MJW A;  4U8N A;  1E1M A;  1GES A;  4NEV A;  2GH5 A;  2C75 A;  2BXS A;  2Z5X A;  4ZCD A;  1JNR A;  1NEN A;  4K7Z A;  3BHF A;  2X50 A;  4OCG A;  4CCR A;  2XVJ A;  2V3B A;  1E1N A;  5JCI A;  5BVA A;  5IPY A;  4H4Z A;  1B37 A;  1F3P A;  4A9W A;  3GMC A;  3ICT A;  1PBE A;  2E1M A;  4OPU A;  3GMB A;  4E0V A;  3CGD A;  1SEZ A;  1RYI A;  3BNU A;  1GET A;  2VRL A;  2QA2 A;  1CHU A;  3AD9 B;  3M13 A;  4O5Q A;  4EM3 A;  1GRA A;  2QAE A;  1K0I A;  3G5Q A;  2YVF A;  4A5L A;  3UKH A;  4CNJ A;  3UKQ A;  2A87 A;  1H7X A;  3UP5 A;  2FJA A;  2UZZ A;  2WPF A;  3COX A;  3FIM B;  2B9Y A;  2C3D A;  3M0O A;  1LTX R;  4EQS A;  3SM8 A;  1CC4 A;  3GDP A;  4BK3 A;  5CKU A;  5EB4 A;  1LPF A;  2WOI A;  4RSL A;  3P9U A;  2H88 A;  4NTC A;  2A8X A;  3QFA A;  2FJE A;  4TM3 A;  1K0J A;  1NDA A;  2ZZB A;  3DGZ A;  2BK4 A;  4H4V A;  2GAG B;  4D03 A;  4Y4L A;  2C66 A;  1DJQ A;  1H82 A;  4K22 A;  1NHQ A;  3DGH A;  2YQU A;  4Z2T A;  2XFP A;  2YG4 A;  1O95 A;  2BXR A;  4K8D A;  3NRN A;  4Y4M A;  5CQF A;  4A99 A;  1PDH A;  3V76 A;  5C3J A;  1EL5 A;  4J2W A;  4FDC B;  4IV9 A;  2FBW A;  3F8P A;  4C77 A;  3CND A;  2VVL A;  4OPI A;  1VG0 A;  5L46 A;  3P4P A;  4Z2R A;  2GQW A;  1Y0P A;  1KF6 A;  1FL2 A;  1JRZ A;  4AP1 A;  3AXB A;  1PS9 A;  4Y4N A;  1NPX A;  2YG7 A;  5U25 A;  1CF3 A;  4YTP A;  4GRT A;  2XDO A;  2YG3 A;  4JN9 A;  4J31 A;  5JCL A;  4YKF A;  2XCG A;  2WHD A;  2C64 A;  3CTY A;  2X3N A;  1TDK A;  4U2L A;  2WU2 A;  2YLW A;  5IQ4 A;  3FBS A;  4IVO B;  1PXA A;  4PAA A;  4H50 A;  1KSS A;  3VR8 A;  1YQZ A;  1EL7 A;  1S2Y A;  3FMW A;  3UKL A;  2IVE A;  2ZZC A;  3ZYX A;  1LQT A;  2ACZ A;  4ICY A;  2JB2 A;  5JCN A;  2CFY A;  3DK9 A;  1N1P A;  1Q1R A;  3AE3 A;  4ADW A;  1PBC A;  3AB1 A;  4C3Y A;  1O94 A;  1IJH A;  1XAN A;  1B8S A;  1Y56 B;  2Q7V A;  2GRT A;  3NH3 X;  4CY6 A;  3EAN A;  3OZ2 A;  4OPC A;  4YSZ A;  2WEU A;  5BRT A;  2ARD A;  1EL9 A;  3AD8 B;  3VQR A;  2YM2 A;  1GRB A;  4JY2 A;  4H2Q A;  2VQ7 A;  5KRQ A;  3ABV A;  3S61 A;  4X4J A;  3AE1 A;  1ONF A;  1GND A;  1S3B A;  2R0G A;  4H4W A;  3GRS A;  3UOV A;  4J56 A;  1KDG A;  4FK1 C;  1FOH A;  2CUL A;  5J7X A;  2BS3 A;  2BS4 A;  3IWA A;  5BUL A;  3NK2 X;  4D04 A;  1D5T A;  2GAH B;  4DSG A;  2GV8 A;  2YAU A;  3LZW A;  2Z5Y A;  4IA5 A;  1PJ7 A;  2YWL A;  1YY5 A;  3ITJ A;  3NHO X;  3P4S A;  4UP3 A;  3RED A;  2AQJ A;  2NVK X;  3ICS A;  3UKK A;  5JCM A;  4B68 A;  1H7W A;  1TDF A;  4J57 A;  2PHH A;  3DH9 A;  4EQW A;  3LAD A;  2V60 A;  2Y6R A;  4KPR A;  1Y56 A;  4B65 A;  2V5Z A;  4U8M A;  1PBF A;  3CGB A;  1ZMC A;  2XFU A;  3L1R A;  2WQY A;  3UTF A;  4H4Y A;  4YT0 A;  3DME A;  2IID A;  1O5W A;  2B7S A;  4NTD A;  3WE0 A;  2XVF A;  3QSS A;  4XWZ A;  2EQ7 A;  2IVD A;  2YVG A;  3SFE A;  3DK4 A;  1Z6L A;  2O9Z A;  2YG5 A;  2W0H A;  2JK6 A;  1DOE A;  1REO A;  2BK3 A;  1PXB A;  3Q9T A;  4K5S A;  1X31 B;  2X8G A;  1VG9 A;  2BCG G;  2XFQ A;  4EQR A;  1PN0 A;  1BGN A;  1EL8 A;  4GCM A;  1JRX A;  3AYL A;  4PAB A;  4YTM A;  3AD7 B;  5U1O A;  4K5R A;  2BC0 A;  5BUK A;  1GAL A;  2VRM A;  2J3N A;  1DOB A;  1VRQ B;  2R4E A;  1IUW A;  3QSE A;  3BI4 A;  4EM4 A;  5ER0 A;  2B76 A;  4APN A;  3O0H A;  3GYI A;  5EB5 A;  5HHF A;  1DXL A;  4A7A A;  4YSH A;  3DJE A;  4AP3 A;  1E6E A;  1IUU A;  2XLP A;  1KFY A;  5KOW A;  1LV0 A;  2GVC A;  3DJD A;  4WX1 A;  2ZBW A;  1JEH A;  3URH A;  1FCD A;  1ZK7 A;  4AOS A;  2X8H A;  2V3A A;  1LQU A;  4B69 A;  3K30 A;  1KNR A;  1P2E A;  2WBA A;  2YR4 A;  1GTH A;  1GV4 A;  3AE6 A;  2C67 A;  3I6D A;  2OLO A;  1MOK A;  2JB1 A;  3BI5 A;  2CDU A;  4GDE A;  2QA1 A;  4GR1 A;  1XPQ A;  3BNM A;  1TDE A;  1DNC A;  4KX6 A;  1GRT A;  4DNA A;  2OAL A;  2R9Z A;  4H4X A;  3GWD A;  1D7Y A;  3CIR A;  1JRY A;  2VOU A;  4NEW A;  3AEC A;  3NK1 X;  1B5Q A;  3C96 A;  3RP8 A;  3BI2 A;  3GYJ A;  1CJ4 A;  4BK2 A;  3P1W A;  4U2T A;  4FK1 A;  1GRF A;  2VVM A;  2TMD A;  3CN8 A;  3KA7 A;  2BYB A;  5KXJ A;  1ZOV A;  3BHK A;  3AEB A;  4U8L A;  1H84 A;  3NYC A;  4CBQ A;  4N9X A;  4U2S A;  4LU6 A;  1TYP A;  3AED A;  1D4D A;  4U8P A;  3SGL A;  1KSU A;  3AE4 A;  4B67 A;  3NN6 X;  3DK8 A;  2XLR A;  2Q0K A;  3DJG X;  1RP0 A;  3CNJ A;  2AAQ A;  2YVJ A;  3AYJ A;  3UKA A;  3C4N A;  2JKC A;  1DOD A;  3ATQ A;  2BC1 A;  3PS9 A;  3NYE A;  1GTE A;  3NG7 X;  4WCT A;  1COY A;  4B63 A;  1DOC A;  2C70 A;  3IC9 A;  3SFD A;  4A79 A;  2DKI A;  4YXD A;  4H4T A;  2R4J A;  3NTD A;  4U8J A;  3CPJ G;  2BS2 A;  3CNT A;  4UDQ A;  2BA9 A;  4EMI A;  1IUX A;  4A65 A;  4AOX A;  3L8K A;  4BUR A;  1TRB A;  1BGJ A;  4JQ9 A;  4I59 A;  1OJA A;  2R46 A;  1XDI A;  3LXD A;  1JU2 A;  3UOY A;  1VQW A;  4USQ A;  3F8R A;  2Q6U A;  2B9W A;  1NG3 A;  1NAA A;  1OJD A;  3EPT A;  4LA1 A;  2GB0 A;  4BV6 A;  2B9X A;  1S2Q A;  4CCQ A;  4HA6 A;  3D1C A;  3ATR A;  3CNS A;  2E4G A;  3QFB A;  3LOV A;  4B64 A;  2C7G A;  2VVL G;  1OJC A;  2A89 A;  4H4P A;  1ZDL A;  2HQM A;  2TPR A;  3IF9 A;  4IA6 A;  3EAO A;  4JY3 A;  5M0Z A;  2YLS A;  4AT2 A;  3AWI A;  3ZDN A;  2RGH A;  4A6N B;  1TYT A;  2PYX A;  2AR8 A;  3V3N A;  1OJ9 A;  4I58 A;  4K2X A;  1CBO A;  5FS8 A;  4FX9 A;  4UDR A;  3KPF A;  4XXG A;  1JNZ A;  3LJP A;  2WET A;  3NGC X;  4H2N A;  3CNP A;  1GPE A;  1D4E A;  2GEW A;  3H8L A;  3UKF A;  2YG6 A;  1UKV G;  3KVE A;  4Z2U A;  1GXF A;  4Z24 A;  3JSK A;  3QJ4 A;  4OPL A;  5DBJ A;  1IUT A;  1E1K A;  1GEU A;  3G5R A;  2VQB A;  3QVR A;  1YKJ A;  1ELI A;  1PBD A;  3AEE A;  3KKJ A;  1MO9 A;  1VDC A;  2H89 A;  2RGJ A;  2C72 A;  3CPH G;  4H2P A;  3K7T A;  1JOA A;  1GOS A;  4NZH A;  4C74 A;  2V6O A;  1L9C A;  3ALM A;  3K7Q X;  1CJ3 A;  3M12 A;  2WDR A;  3GD4 A;  3SQP A;  2R0C A;  4UDP A;  1LVL A;  4TLZ A;  1S3E A;  4J34 A;  4TM4 A;  3GDN A;  4U8O A;  2WES A;  1YQ4 A;  1K4Q A;  2YR5 A;  2BK5 A;  2VZ2 A;  3AEA A;  3P4R A;  4J33 A;  3UTE A;  2GR3 A;  3KD9 A;  2DKH A;  2WOV A;  5TR3 A;  2BAB A;  2B7R A;  1L9E A;  1CJC A;  1L9D A;  1RSG A;  2C65 A;  2XLS A;  3T37 A;  3RHA A;  4B1B A;  4BJY A;  4TM1 A;  5IQ1 A;  4YSY A;  3H8I A;  4U8I A;  1N4W A;  5KVI A;  4U8K A;  1XHC A;  5HXI A;  4X9N A;  2RGO A;  2WPE A;  5KOX A;  3HZL A;  4X9M A;  2XVI A;  3DA1 A;  3AEF A;  1D4C A;  3F8D A;  5FS9 A;  3IHG A;  4IVM B;  2NPX A;  1H81 A;  1PJ5 A;  3ICR A;  4C3X A;  5EOW A;  3ISH A;  2EQ8 A;  1BWC A;  4JNQ A;  3AE7 A;  2R0P A;  1CL0 A;  2C76 A;  3CGE A;  4CNK A;  3II4 A;  3VRD B;  3RNM A;  2BCP A;  1QJD A;  2WP5 A;  3UKP A;  4YSX A;  4CY8 A;  4BK1 A;  4J36 A;  4A6N A;  3NIX A;  3NNE A;  2GQF A;  1GSN A;  3D8X A;  5M10 A;  4ECH A;  5LV9 A;  2X99 A;  1AOG A;  4LII A;  2XLU A;  5GRT A;  1TDN A;  4JDR A;  4EIQ A;  1CJ2 A;  4H2R A;  3I3L A;  2XFO A;  4ZCC A;  4TM0 A;  3FPZ A;  3C4A A;  2GMJ A;  2YLZ A;  2FJB A;  1H83 A;  3OC4 A;  1NHS A;  2JB3 A;  4Z25 A;  2YLT A;  2I0Z A;  4AT0 A;  2WOW A;  1N4V A;  3NTA A;  2YM1 A;  4EQX A;  2GMH A;  1IUS A;  3G5S A;  3P4Q A;  3LZX A;  3AEG A;  3PVC A;  3VRB A;  1F8W A;  5KVH A;  4OPG A;  4CRT A;  3RP7 A;  1ZKQ A;  1OJT A;  1ZP0 A;  3NT6 A;  1P2H A;  1L0V A;  4HB9 A;  2X8C A;  1E1L A;  3RP6 A;  4RG3 A;  3GRT A;  1BKW A;  1M64 A;  1B4V A;  2GR0 A;  2F5Z A;  4Z44 A;  1F8S A;  2WP9 A;  3UOZ A;  3NN0 X;  3AE2 A;  1Q1W A;  4EIP A;  3B6D A;  3KU9 A;  3VR9 A;  2Q0L A;  1CC6 A;  2E5V A;  2APG A;  1F8R A;  3ALJ A;  2WU5 A;  4C5O A;  1CC2 A;  4DSH A;  4DGK A;  2C73 A;  2XYO A;  4H4R A;  1BF3 A;  2XVE A;  3AE8 A;  3AE5 A;  1GRE A;  1NEK A;  1LJ1 A;  4XWR A;  1FEB A;  4EMW A;  4H4S A;  2YR6 A;  1TDO A;  3DJJ A;  1K0L A;  3Q6J A;  3E1T A;  1PJ6 A;  3V3O A;  2WP6 A;  2WDQ A;  5J60 A;  3LB8 A;  1E7P A;  5U63 A;  4REK A;  3AE9 A;  1NG4 A;  1M6I A;  5HYM A;  1W4X A;  2Y6Q A;  2GR2 A;  3NYF A;  5C2T A;  1GER A; 
#chains in the Genus database with same CATH topology
 3T8Q A;  1V59 A;  3IHM A;  3AYI A;  3EKG A;  1N60 C;  4YKG A;  1GRH A;  2ZZ0 A;  3V5F A;  4HCD A;  1GRG A;  3NKS A;  5FJR A;  2GF3 A;  1KNP A;  1H6V A;  1PXC A;  1N4U A;  2XLT A;  2WS3 A;  2EQ9 A;  2V61 A;  4YTN A;  3DEQ A;  1HYU A;  3H4K A;  3L5O A;  4GFI A;  5JCK A;  1FO4 A;  1BZL A;  4EMJ A;  2MNR A;  1FEA A;  4RG4 A;  3K7M X;  3P93 A;  4O5U A;  3CPI G;  3EF6 A;  3TTE A;  2XVH A;  4B66 A;  1E39 A;  3R9U A;  4JNA A;  2GR1 A;  2R45 A;  4H7U A;  3B3R A;  1JCT A;  3GC2 A;  4GIS A;  4NEV A;  2C75 A;  4ZCD A;  1JNR A;  4OCG A;  5KMS A;  4J3Z A;  2V3B A;  1E1N A;  2E1M A;  4OPU A;  3GMB A;  2GGH A;  3CGD A;  4E0V A;  1GET A;  3AD9 B;  1GRA A;  1R0M A;  2QAE A;  3A7A A;  3G5Q A;  4II3 A;  3TOY A;  3UP5 A;  2PTY A;  2UZZ A;  3SJN A;  3FIM B;  2AKZ A;  3U9I A;  2C3D A;  1LTX R;  4EQS A;  3SM8 A;  1CC4 A;  4RSL A;  3P9U A;  2A8X A;  3NS1 B;  3QFA A;  1N63 C;  2FJE A;  3TCS A;  3T6C A;  2C66 A;  4E5T A;  3DGH A;  2MUC A;  4K8D A;  1PDH A;  5C3J A;  3DIP A;  3P4P A;  3HYV A;  2GQW A;  1SB3 B;  1JRZ A;  1PS9 A;  1NPX A;  5U25 A;  1CF3 A;  4HNC A;  2YG3 A;  1VQZ A;  5JCL A;  1TDK A;  2WU2 A;  3FBS A;  4H50 A;  1S2Y A;  2ZZC A;  3RR1 A;  5JCN A;  3DK9 A;  2PCE A;  3CYJ A;  4EWJ A;  3AB1 A;  3OZY A;  2Q7V A;  4FP1 A;  2GRT A;  3NH3 X;  4OPC A;  4H1Z A;  1EL9 A;  4JY2 A;  3V4B A;  2E5A A;  3HYW A;  3AMZ A;  1FOH A;  3IWA A;  5BUL A;  4E4U A;  5JCM A;  4F4R A;  4EQW A;  3RCY A;  4KPR A;  1Y56 A;  4U8M A;  2V5Z A;  4AP3 A;  3CGB A;  2XFU A;  3L1R A;  3BSM A;  3DME A;  1PDY A;  3WE0 A;  3N6H A;  2YVG A;  1Z6L A;  2O9Z A;  1PXB A;  3PWG A;  1X31 B;  4MKS A;  4EQR A;  4GCM A;  4PAB A;  3AD7 B;  3DG7 A;  5U1O A;  4K5R A;  2BC0 A;  5BUK A;  2R4E A;  3QSE A;  3BI4 A;  5EB5 A;  3RIT A;  4A7A A;  1E6E A;  2GVC A;  4NNJ A;  1FCD A;  4TVY A;  2PGE A;  1P2E A;  3D9X A;  1GV4 A;  3I6D A;  3FVD A;  3DES A;  3BNM A;  4KX6 A;  3IK4 A;  4DNA A;  2R9Z A;  3GWD A;  1JRY A;  1MRA A;  3RP8 A;  3BI2 A;  4BK2 A;  5FJO A;  4TVW A;  3DG3 A;  3CN8 A;  3SQS A;  3TQP A;  3TW9 A;  4B67 A;  4KT2 A;  4GAP A;  4E6M A;  4A6G A;  3DK8 A;  2PU1 A;  2Q0K A;  3DJG X;  2C4C A;  1RP0 A;  2YVJ A;  2JKC A;  4J1O A;  5FJP A;  3NG7 X;  1COY A;  4B63 A;  1DOC A;  1SJD A;  3IC9 A;  3UJS A;  3SFD A;  4A79 A;  4M0X A;  2R4J A;  1IUX A;  3L8K A;  1S7M A;  4I59 A;  3LXD A;  4USQ A;  4K2S A;  4G73 A;  3EPT A;  2GB0 A;  3UXL A;  4HA6 A;  4GIR A;  3CNS A;  4G9K A;  3LOV A;  2C7G A;  2VVL G;  2OO6 A;  2P8C A;  3VCN A;  1OJC A;  2A89 A;  4H4P A;  2HQM A;  3IF9 A;  4IA6 A;  4JY3 A;  1TZZ A;  4HYR A;  3Q45 A;  3DDM A;  3ZDN A;  1MNS A;  2PYX A;  1OJ9 A;  4K2X A;  3SN1 A;  4FX9 A;  3KPF A;  1JNZ A;  3LJP A;  3NGC X;  3SXI A;  2FKP A;  3JSK A;  1E1K A;  3ZLH A;  3T2Z A;  2C72 A;  4ZA0 A;  3M12 A;  3GD4 A;  1LVL A;  1S3E A;  4U8O A;  2BK5 A;  4J33 A;  2DKH A;  2WOV A;  1L9E A;  1RSG A;  1L9D A;  4BJY A;  4U8I A;  3QLD A;  4U8K A;  5KOX A;  3D46 A;  2XVI A;  3MUC A;  2AL1 A;  3F8D A;  1D4C A;  5FS9 A;  4IVM B;  3CK5 A;  1PJ5 A;  3ICR A;  4C3X A;  5EOW A;  4JNQ A;  2BCP A;  1QJD A;  3UKP A;  2QGY A;  4CY8 A;  3UGV A;  4BK1 A;  3NIX A;  3D8X A;  4K1W A;  4E4F A;  1MDL A;  2XH7 A;  2GDQ A;  3C4A A;  2FJB A;  2JB3 A;  3OC4 A;  4Z25 A;  2WOW A;  1N4V A;  4EQX A;  2GMH A;  3VRB A;  2PTW A;  1P2H A;  2X8C A;  1E1L A;  3GRT A;  3H12 A;  1F8S A;  3UOZ A;  3NN0 X;  4EIP A;  3GD6 A;  2Q0L A;  1CC6 A;  2E5V A;  3PG6 A;  1F8R A;  4C5O A;  2DW6 A;  3ZLG A;  2BRY A;  1TDO A;  1K0L A;  1EC7 A;  1PJ6 A;  5J60 A;  3P3B A;  3CXO A;  1M6I A;  1NG4 A;  2GR2 A;  5BOE A;  1GER A;  2GL5 A;  3FXG A;  4OPT A;  3GD3 A;  3UCL A;  3UTG A;  4OPD A;  3N4F A;  5EBK A;  2P0I A;  2JAE A;  2E3T A;  2YLR A;  4P9S A;  1PHH A;  2JBV A;  3GSI A;  3UOX A;  4NTE A;  4USR A;  2CVJ A;  3S5W A;  3NK0 X;  3ADA B;  3NLC A;  1ZOY A;  2YLX A;  4IP5 A;  2OAM A;  5GSN A;  2FJD A;  3SR6 B;  5HY5 A;  3IJQ A;  4Z43 A;  2BAC A;  3BJS A;  2C3C A;  4OVI A;  2EQ6 A;  5FS7 A;  4ZN0 A;  4ROP A;  2RAB A;  5FS6 A;  3P0W A;  3ENL A;  2BXS A;  1EC9 A;  1NEN A;  5IPY A;  1B37 A;  3ICT A;  5KMP A;  3V5C A;  2HXT A;  1RYI A;  1CHU A;  2YVF A;  4A5L A;  3UKH A;  4CNJ A;  1ONE A;  2A87 A;  1H7X A;  2WPF A;  2B9Y A;  4M6U A;  4A35 A;  1LPF A;  1JDF A;  1NEL A;  4NTC A;  1NDA A;  5IDZ A;  4Y4M A;  4A99 A;  2FBW A;  3CND A;  4OPI A;  3CT2 A;  3AXB A;  4Y4N A;  2YG7 A;  4GRT A;  2WHD A;  4U2L A;  5IQ4 A;  1PXA A;  4PAA A;  3VR8 A;  1YQZ A;  3N6J A;  1LQT A;  3ZYX A;  4ICY A;  3R0K A;  1EBH A;  3AE3 A;  1O94 A;  4YSZ A;  3OZ2 A;  2WEU A;  4G7F A;  3TWB A;  3AD8 B;  2GGI A;  3ABV A;  3AE1 A;  1ONF A;  1TE6 A;  3SZ0 A;  4FK1 C;  5J7X A;  1MUC A;  2OZ8 A;  2BS3 A;  1T3Q C;  4D04 A;  3SBF A;  4GAV A;  2Z5Y A;  3NHO X;  3RED A;  2AQJ A;  3ICS A;  3A7R A;  1TDF A;  3DH9 A;  2V60 A;  1H2I A;  4YT0 A;  2WQY A;  4H4Y A;  3RGT A;  1O5W A;  2IVD A;  2YG5 A;  2W0H A;  1DOE A;  2XH2 A;  2BK3 A;  4II2 A;  1JPD X;  2HNE A;  4DX3 A;  1PN0 A;  1BGN A;  1EL8 A;  1JRX A;  3AYL A;  4YTM A;  1GAL A;  2VRM A;  2AL2 A;  4EM4 A;  5ER0 A;  5HHF A;  3JW7 A;  3GYI A;  1DXL A;  1KFY A;  4Z17 A;  1LV0 A;  4WX1 A;  5J04 A;  1JEH A;  3CMM A;  1ZK7 A;  1LQU A;  4B69 A;  2OZT A;  2YR4 A;  1GTH A;  3RRA A;  2QJN A;  4IP4 A;  1VDV A;  2JB1 A;  3SZF A;  1XPQ A;  2OKT A;  1XPY A;  1D7Y A;  2VOU A;  4NEW A;  3AEC A;  2PP3 A;  2OLA A;  3KA7 A;  2BYB A;  2QVH A;  5KXJ A;  1ZOV A;  3BHK A;  1TYP A;  3NFU A;  3SSZ A;  3AE4 A;  3CNJ A;  3C4N A;  3ATQ A;  3PS9 A;  3ZVI A;  4H4T A;  3NTD A;  2BA9 A;  4EMI A;  1FHV A;  4A65 A;  1TRB A;  1XDI A;  3I4K A;  3CB3 A;  4JN7 A;  1NAA A;  4BV6 A;  1S2Q A;  4CCQ A;  3NRZ B;  1IYX A;  3IJI A;  3ATR A;  2E4G A;  3NXL A;  3R10 A;  3MY9 A;  4GYP A;  2YLS A;  4AT2 A;  2AR8 A;  3SN4 A;  4H2N A;  2GEW A;  1UKV G;  3G5R A;  3IJL A;  2PSN A;  1MO9 A;  3SZC A;  2H89 A;  2RGJ A;  3K7T A;  4C74 A;  2V6O A;  3K7Q X;  5EU9 A;  1CJ3 A;  2WDR A;  3NVY B;  4TLZ A;  3ES8 A;  1ZXI C;  3GDN A;  1YQ4 A;  3P4R A;  2VZ2 A;  3AEA A;  6ENL A;  4B1B A;  5IQ1 A;  1N4W A;  2PPG A;  5HXI A;  2RGO A;  2WPE A;  3DA1 A;  4H2H A;  3AEF A;  3IHG A;  3KUM A;  4IT1 A;  1TKK A;  2R0P A;  4HNL A;  3VDG A;  4A6N A;  3NNE A;  5M10 A;  4ECH A;  3T2K A;  2HZG A;  5LV9 A;  1AOG A;  5GRT A;  1CJ2 A;  4H2R A;  1EC8 A;  2YLT A;  1IUS A;  3AEG A;  1F8W A;  5KVH A;  1ZKQ A;  3NT6 A;  1L0V A;  4HB9 A;  2AKM A;  1M64 A;  4Z44 A;  1STZ A;  4MGG A;  3B6D A;  3VR9 A;  2PTZ A;  4A3R A;  3ALJ A;  2QQ6 A;  1CC2 A;  4DSH A;  4DGK A;  4H4R A;  2XVE A;  3QPE A;  1GRE A;  4XWR A;  4H4S A;  3OP2 A;  3BOX A;  2WP6 A;  2W54 A;  2WDQ A;  3AE9 A;  1W4X A;  2XGZ A;  2Y6Q A;  3R11 A;  3D47 A;  3KLJ A;  2PTX A;  3UCD A;  2OA1 A;  4GUV A;  2WDV A;  3FJ4 A;  4H19 A;  1H86 A;  4Z26 A;  1FEC A;  1N61 C;  4ENL A;  1ZX9 A;  1NHR A;  1EBD A;  1PBB A;  3PFR A;  2WPC A;  1DJN A;  4IL2 A;  1Q9I A;  3PO7 A;  4H4Q A;  1ZY8 A;  3TWA A;  2XFN A;  2OX4 A;  3FYY A;  5ENL A;  1QLB A;  4TLX A;  1ELS A;  1MXT A;  3UJE A;  1YEY A;  1YQ3 A;  1KD0 A;  4HN8 A;  2QCU A;  1F6M A;  4MJW A;  4CCR A;  2X50 A;  2XVJ A;  1R6W A;  5BVA A;  4A9W A;  1PBE A;  3AM9 A;  1P48 A;  2VRL A;  2QA2 A;  3M13 A;  1N5W C;  2P8B A;  2FJA A;  3M0O A;  4BK3 A;  5CKU A;  2WOI A;  1FFU C;  4K8G A;  1V97 A;  1K0J A;  4DHG A;  3DGZ A;  2BK4 A;  4H4V A;  4D03 A;  4Y4L A;  1H82 A;  4K22 A;  3H8A A;  2YQU A;  1MDR A;  2W55 A;  4Z2T A;  2XFP A;  1O95 A;  2BXR A;  3NRN A;  5CQF A;  3TJ4 A;  1EL5 A;  4J2W A;  4FDC B;  4C77 A;  1ECQ A;  1VG0 A;  2PA6 A;  1Y0P A;  1KF6 A;  1FL2 A;  4AP1 A;  4DWD A;  4YKF A;  2XDO A;  2XCG A;  3CTY A;  2C64 A;  2X3N A;  4IVO B;  1KSS A;  4HCH A;  2ACZ A;  2JB2 A;  2CFY A;  4GGH A;  1Q1R A;  4ADW A;  4C3Y A;  1B8S A;  3I6T A;  3EAN A;  5BRT A;  2ARD A;  2YM2 A;  4H2Q A;  3S61 A;  4X4J A;  3ZLF A;  4Z1Y A;  3UOV A;  4JN8 A;  2RDX A;  2BS4 A;  3NK2 X;  1KKR A;  3OZM A;  1D5T A;  2GAH B;  2GV8 A;  2YAU A;  3NVZ B;  4G8T A;  2YWL A;  1YY5 A;  3ITJ A;  3P4S A;  3UKK A;  4B68 A;  4J57 A;  2Y6R A;  4B65 A;  3MKC A;  1PBF A;  2B7S A;  4NTD A;  2O56 A;  2XVF A;  3QSS A;  4G6G A;  2I5Q A;  1F9C A;  3DK4 A;  2JK6 A;  1VG9 A;  3SZW A;  4X2P A;  1IUW A;  2B76 A;  3O0H A;  1IUU A;  2XLP A;  5KOW A;  3DJD A;  2ZBW A;  7ENL A;  3K30 A;  2WBA A;  2C67 A;  3DFH A;  3JVA A;  1KKO A;  1JRO A;  2XH0 A;  2CDU A;  4GDE A;  3CXB A;  2FYM A;  4H4X A;  3C96 A;  1PDZ A;  3GYJ A;  1CJ4 A;  3P1W A;  4U2T A;  1GRF A;  3H70 A;  2NQL A;  4U8L A;  1H84 A;  3NYC A;  4CBQ A;  4GYP C;  4N9X A;  4U2S A;  4LU6 A;  3SGL A;  4HCL A;  1RM6 B;  3AYJ A;  3UKA A;  1DOD A;  1GTE A;  2C70 A;  3SYI A;  3CPJ G;  3CNT A;  4BUR A;  1BGJ A;  4JQ9 A;  2OZ3 A;  1OJA A;  2R46 A;  1JU2 A;  3UOY A;  3F8R A;  3U4F A;  4B64 A;  2BRA A;  2PS2 A;  1ZDL A;  2PP0 A;  3EAO A;  5M0Z A;  3I6E A;  3AWI A;  2PGW A;  2RGH A;  4A6N B;  1TYT A;  3V3N A;  4I58 A;  1CBO A;  5FS8 A;  4XXG A;  3FCP A;  4Z2U A;  1GXF A;  3QJ4 A;  4OPL A;  5DBJ A;  1IUT A;  2VQB A;  3QVR A;  4MMW A;  3QKE A;  1PBD A;  3R0U A;  3HRD C;  3KKJ A;  2OG9 A;  3DG6 A;  2XH4 A;  3CPH G;  4H2P A;  1GOS A;  4NZH A;  1L9C A;  3ALM A;  2R0C A;  4UDP A;  4J34 A;  2PU0 A;  4TM4 A;  5KMR A;  1K4Q A;  3MSY A;  3UTE A;  3KD9 A;  3VFC A;  1X2G A;  4DYE A;  2XLS A;  3RHA A;  3UXK A;  3QN3 A;  1XHC A;  4X9N A;  4G74 A;  1RVK A;  1BKH A;  1E9I A;  2QDE A;  2NPX A;  1SJC A;  3AE7 A;  2C76 A;  4CNK A;  3DFY A;  2WP5 A;  4J36 A;  3Q4D A;  2X99 A;  4LII A;  3S5S A;  2POZ A;  1TDN A;  4JDR A;  4ZCC A;  2W3R A;  3VA8 A;  3FPZ A;  2YLZ A;  1SJB A;  1H83 A;  4DXK A;  3VC5 A;  3NTA A;  3G5S A;  3LZX A;  1DTN A;  3PVC A;  4OPG A;  1OJT A;  4DN1 A;  1W6T A;  1BKW A;  2ZAD A;  2F5Z A;  3SY4 A;  2WP9 A;  1Q1W A;  3OW1 A;  3KU9 A;  2C73 A;  1BF3 A;  3AE8 A;  1KN0 A;  1NEK A;  1FEB A;  4EMW A;  3DJJ A;  3JZU A;  1E7P A;  5U63 A;  4REK A;  5C2T A;  3CAW A;  3CGC A;  2GGE A;  4NWZ A;  1QO8 A;  4M52 A;  4BJZ A;  2OLN A;  4GF7 A;  3FG2 P;  2QJJ A;  3UP4 A;  4GGB A;  3GWF A;  4YWO A;  4H4U A;  3QSM A;  3VRA A;  5G5G B;  3ALL A;  1N5X A;  1GT8 A;  1WUF A;  5FMH A;  2QDD A;  3TJI A;  3HYX A;  5KWF A;  3GY1 A;  4H83 A;  4GDP A;  1IUV A;  1NHP A;  3N4E A;  3QVP A;  3SN0 A;  1ZMD A;  5JRB A;  3UTH A;  1D7L A;  4G6H A;  4U8N A;  1E1M A;  1GES A;  2GH5 A;  4KPL A;  2Z5X A;  4K7Z A;  3BHF A;  5JCI A;  4H4Z A;  3GYX A;  1F3P A;  3GMC A;  1SEZ A;  3T9P A;  3BNU A;  4O5Q A;  4EM3 A;  1K0I A;  3K1G A;  3UKQ A;  1X2H A;  3COX A;  3MQT A;  3GDP A;  5EB4 A;  2H88 A;  3ZVH A;  1P43 A;  3HPF A;  4TM3 A;  2ZZB A;  2GAG B;  4YWS A;  1DJQ A;  1NHQ A;  1BQG A;  1OEP A;  2XSX A;  2YG4 A;  3EEZ A;  3ETR B;  3ES7 A;  3R25 A;  3V76 A;  4IV9 A;  2W3S A;  3F8P A;  2VVL A;  5L46 A;  4Z2R A;  1XS2 A;  1L8P A;  2OQH A;  3NVV B;  1FFV C;  4YTP A;  4JN9 A;  4J31 A;  2YLW A;  5FJT A;  5KMQ A;  3MZN A;  1EL7 A;  3FMW A;  3UKL A;  2IVE A;  4IL0 A;  1N1P A;  1PBC A;  1IJH A;  1XAN A;  1Y56 B;  5KNL A;  4CY6 A;  2GSH A;  3VQR A;  1GRB A;  2VQ7 A;  5KRQ A;  1GND A;  1S3B A;  2R0G A;  4H4W A;  3GRS A;  4J56 A;  1KDG A;  2CUL A;  3ZVH B;  4DSG A;  3LZW A;  4IA5 A;  1PJ7 A;  2OVL A;  3H7V A;  4UP3 A;  1WUE A;  2NVK X;  1H7W A;  2CHR A;  3THU A;  2PHH A;  2QJM A;  3LAD A;  3UTF A;  1ZMC A;  3B9J B;  2IID A;  1NU5 A;  4XWZ A;  2EQ7 A;  3SFE A;  1REO A;  3Q9T A;  4K5S A;  2PMQ A;  3AN1 A;  2X8G A;  2BCG G;  2XFQ A;  3DER A;  1N62 C;  2J3N A;  1DOB A;  1VRQ B;  2P88 A;  2OFJ A;  4APN A;  4YSH A;  3DJE A;  3URH A;  4AOS A;  2V3A A;  2X8H A;  1KNR A;  3UJR A;  3AE6 A;  2OLO A;  1MOK A;  3BI5 A;  2OPJ A;  1KCZ A;  2QA1 A;  4GR1 A;  1WYG A;  1TDE A;  1DNC A;  1GRT A;  2OAL A;  3CIR A;  4GME A;  3QTP A;  3NK1 X;  1B5Q A;  4FI4 A;  4ZCW A;  4IHC A;  4FK1 A;  2GGJ A;  3DGB A;  2PP1 A;  2VVM A;  2TMD A;  3MWC A;  2DW7 A;  3AEB A;  1SJA A;  3AED A;  1D4D A;  4U8P A;  1KSU A;  3NZG A;  3T14 A;  3NN6 X;  2XLR A;  2AAQ A;  3R1Z A;  3UJ2 A;  2BC1 A;  2ZC8 A;  3NYE A;  4WCT A;  4KWS A;  3RO6 A;  3V3W A;  4YXD A;  1EBG A;  2DKI A;  4U8J A;  2BS2 A;  4UDQ A;  3PK7 A;  4AOX A;  3B97 A;  1VQW A;  2Q6U A;  2B9W A;  4JHM A;  1NG3 A;  1OJD A;  3KPK A;  4LA1 A;  2OQY A;  2B9X A;  3D1C A;  3QFB A;  3OTR A;  2TPR A;  3VC6 A;  3PWI A;  3VCC A;  3A7U A;  4UDR A;  2WET A;  3CNP A;  1GPE A;  1D4E A;  3H8L A;  3UKF A;  2YG6 A;  3KVE A;  4Z24 A;  1GEU A;  2GGG A;  1JPM A;  2POD A;  1YKJ A;  1ELI A;  3AEE A;  1VDC A;  1JOA A;  3R07 C;  3T4W A;  3SQP A;  3EUB 3;  2WES A;  1FIQ B;  2YR5 A;  2GR3 A;  5TR3 A;  2BAB A;  2B7R A;  1CJC A;  2C65 A;  3GO2 A;  3T37 A;  4TM1 A;  4YSY A;  3H8I A;  5KVI A;  1JRP A;  3HZL A;  4X9M A;  3T0K A;  3UJF A;  3T31 A;  4KEM A;  5FJU A;  1H81 A;  3FV9 A;  3ISH A;  2EQ8 A;  1BWC A;  1CL0 A;  3CGE A;  3II4 A;  3VRD B;  3RNM A;  4YSX A;  2GQF A;  1GSN A;  2AL2 B;  2XLU A;  4ZOH B;  3NVW B;  4EIQ A;  3I3L A;  2XFO A;  4TM0 A;  2GMJ A;  1NHS A;  2I0Z A;  4AT0 A;  2YM1 A;  3P4Q A;  1FHU A;  2ONE A;  4CRT A;  3RP7 A;  1ZP0 A;  3RP6 A;  4RG3 A;  3STP A;  1B4V A;  2GR0 A;  4IZG A;  3AE2 A;  3UCC A;  4HPN A;  3HW2 A;  2APG A;  2WU5 A;  2XYO A;  3NO1 A;  3AE5 A;  1LJ1 A;  2HXU A;  2YR6 A;  3E1T A;  3Q6J A;  3V3O A;  3LB8 A;  2P3Z A;  5BOF A;  5G5H B;  3SX6 A;  5HYM A;  3NYF A;  3S47 A;  3T2Y A;  3OPS A;  4E8G A; 
#chains in the Genus database with same CATH homology
 3CGC A;  1V59 A;  3KLJ A;  3IHM A;  3AYI A;  4OPT A;  4YKG A;  3GD3 A;  3UCL A;  1GRH A;  4NWZ A;  3UTG A;  2ZZ0 A;  1QO8 A;  2OA1 A;  4OPD A;  1GRG A;  4M52 A;  2WDV A;  4GUV A;  2OLN A;  4BJZ A;  5EBK A;  2JAE A;  3NKS A;  4GF7 A;  2GF3 A;  3FG2 P;  1H6V A;  1H86 A;  1KNP A;  4Z26 A;  1FEC A;  3UP4 A;  2YLR A;  4P9S A;  3GWF A;  1PHH A;  4YWO A;  1PXC A;  4H4U A;  2JBV A;  3GSI A;  3QSM A;  3UOX A;  3VRA A;  1N4U A;  2XLT A;  1ZX9 A;  2WS3 A;  1NHR A;  3ALL A;  4NTE A;  2EQ9 A;  1GT8 A;  1EBD A;  2V61 A;  1PBB A;  4USR A;  2CVJ A;  2WPC A;  4YTN A;  1HYU A;  3S5W A;  5FMH A;  3NK0 X;  3H4K A;  3L5O A;  1DJN A;  5JCK A;  1Q9I A;  1BZL A;  3PO7 A;  4H4Q A;  4EMJ A;  3ADA B;  1ZOY A;  1ZY8 A;  3NLC A;  3HYX A;  2YLX A;  1FEA A;  2XFN A;  4RG4 A;  1QLB A;  2OAM A;  4TLX A;  5GSN A;  5KWF A;  3K7M X;  4GDP A;  1IUV A;  1NHP A;  1MXT A;  2FJD A;  4O5U A;  5HY5 A;  3CPI G;  3QVP A;  3EF6 A;  2XVH A;  1ZMD A;  4B66 A;  4Z43 A;  1E39 A;  2BAC A;  2C3C A;  3R9U A;  5JRB A;  3UTH A;  1YQ3 A;  4JNA A;  4OVI A;  2GR1 A;  1D7L A;  2R45 A;  2EQ6 A;  5FS7 A;  4H7U A;  4G6H A;  3B3R A;  4ZN0 A;  2RAB A;  5FS6 A;  2QCU A;  1F6M A;  4MJW A;  4U8N A;  1E1M A;  1GES A;  4NEV A;  2GH5 A;  2C75 A;  2BXS A;  2Z5X A;  4ZCD A;  1JNR A;  1NEN A;  4K7Z A;  3BHF A;  2X50 A;  4OCG A;  4CCR A;  5KMS A;  2XVJ A;  2V3B A;  1E1N A;  5JCI A;  5BVA A;  5IPY A;  4H4Z A;  1B37 A;  3GYX A;  1F3P A;  4A9W A;  3GMC A;  3ICT A;  1PBE A;  2E1M A;  4OPU A;  3GMB A;  5KMP A;  4E0V A;  3CGD A;  1SEZ A;  1RYI A;  3BNU A;  1GET A;  2VRL A;  2QA2 A;  1CHU A;  3AD9 B;  3M13 A;  4O5Q A;  4EM3 A;  1GRA A;  2QAE A;  1K0I A;  3G5Q A;  2YVF A;  4II3 A;  3UKH A;  4A5L A;  4CNJ A;  3UKQ A;  2A87 A;  1H7X A;  3UP5 A;  2FJA A;  2UZZ A;  2WPF A;  3COX A;  3FIM B;  2B9Y A;  2C3D A;  3M0O A;  1LTX R;  4EQS A;  3SM8 A;  1CC4 A;  3GDP A;  4BK3 A;  5CKU A;  5EB4 A;  1LPF A;  2WOI A;  4RSL A;  3P9U A;  2H88 A;  4NTC A;  2A8X A;  3QFA A;  2FJE A;  4TM3 A;  1K0J A;  1NDA A;  2ZZB A;  3DGZ A;  2BK4 A;  4H4V A;  2GAG B;  4D03 A;  4Y4L A;  2C66 A;  1DJQ A;  1H82 A;  4K22 A;  1NHQ A;  3DGH A;  2YQU A;  4Z2T A;  2XFP A;  2YG4 A;  1O95 A;  2BXR A;  4K8D A;  3NRN A;  4Y4M A;  5CQF A;  4A99 A;  1PDH A;  3V76 A;  5C3J A;  1EL5 A;  4J2W A;  4FDC B;  4IV9 A;  2FBW A;  3F8P A;  4C77 A;  3CND A;  2VVL A;  4OPI A;  1VG0 A;  5L46 A;  3P4P A;  4Z2R A;  3HYV A;  2GQW A;  1Y0P A;  1KF6 A;  1FL2 A;  1JRZ A;  4AP1 A;  3AXB A;  1PS9 A;  4Y4N A;  1NPX A;  2YG7 A;  5U25 A;  1CF3 A;  4YTP A;  4GRT A;  2XDO A;  2YG3 A;  4JN9 A;  4J31 A;  5JCL A;  4YKF A;  2XCG A;  2WHD A;  2C64 A;  3CTY A;  2X3N A;  1TDK A;  4U2L A;  2WU2 A;  2YLW A;  5IQ4 A;  3FBS A;  4IVO B;  5KMQ A;  1PXA A;  4PAA A;  4H50 A;  1KSS A;  3VR8 A;  1YQZ A;  1EL7 A;  1S2Y A;  3FMW A;  3UKL A;  2IVE A;  2ZZC A;  3ZYX A;  1LQT A;  2ACZ A;  4ICY A;  2JB2 A;  5JCN A;  2CFY A;  3DK9 A;  1N1P A;  1Q1R A;  3AE3 A;  4ADW A;  1PBC A;  3AB1 A;  4C3Y A;  1O94 A;  1IJH A;  1XAN A;  1B8S A;  1Y56 B;  2Q7V A;  5KNL A;  2GRT A;  3NH3 X;  4CY6 A;  3EAN A;  3OZ2 A;  4OPC A;  4YSZ A;  2WEU A;  5BRT A;  2ARD A;  1EL9 A;  3AD8 B;  3VQR A;  2YM2 A;  1GRB A;  4JY2 A;  4H2Q A;  2VQ7 A;  5KRQ A;  3ABV A;  3S61 A;  4X4J A;  3AE1 A;  1ONF A;  1GND A;  1S3B A;  2R0G A;  4H4W A;  3HYW A;  3SZ0 A;  3GRS A;  3UOV A;  4J56 A;  1KDG A;  4FK1 C;  1FOH A;  2CUL A;  5J7X A;  2BS3 A;  2BS4 A;  3IWA A;  5BUL A;  3NK2 X;  4D04 A;  1D5T A;  2GAH B;  4DSG A;  2GV8 A;  2YAU A;  4GAV A;  3LZW A;  2Z5Y A;  4IA5 A;  1PJ7 A;  2YWL A;  1YY5 A;  3ITJ A;  3NHO X;  3P4S A;  4UP3 A;  3RED A;  2AQJ A;  2NVK X;  3ICS A;  3UKK A;  5JCM A;  4B68 A;  1H7W A;  1TDF A;  4J57 A;  2PHH A;  3DH9 A;  4EQW A;  3LAD A;  2V60 A;  2Y6R A;  4KPR A;  1Y56 A;  4B65 A;  2V5Z A;  1H2I A;  1PBF A;  3CGB A;  1ZMC A;  2XFU A;  3L1R A;  2WQY A;  4U8M A;  4H4Y A;  3UTF A;  4YT0 A;  3DME A;  2IID A;  1O5W A;  2B7S A;  4NTD A;  3WE0 A;  2XVF A;  3QSS A;  4G6G A;  4XWZ A;  2EQ7 A;  2IVD A;  2YVG A;  3SFE A;  3DK4 A;  1Z6L A;  2O9Z A;  2YG5 A;  2W0H A;  2JK6 A;  1DOE A;  1REO A;  2BK3 A;  1PXB A;  3Q9T A;  4K5S A;  1X31 B;  4II2 A;  2X8G A;  1VG9 A;  2BCG G;  3SZW A;  2XFQ A;  4EQR A;  1PN0 A;  1BGN A;  1EL8 A;  4GCM A;  1JRX A;  3AYL A;  4PAB A;  4YTM A;  3AD7 B;  5U1O A;  4K5R A;  2BC0 A;  5BUK A;  1GAL A;  2VRM A;  2J3N A;  1DOB A;  1VRQ B;  2R4E A;  1IUW A;  3QSE A;  3BI4 A;  4EM4 A;  5ER0 A;  2B76 A;  4APN A;  3O0H A;  3GYI A;  5EB5 A;  5HHF A;  1DXL A;  4A7A A;  4YSH A;  3DJE A;  4AP3 A;  1E6E A;  1IUU A;  2XLP A;  1KFY A;  5KOW A;  1LV0 A;  2GVC A;  3DJD A;  4WX1 A;  2ZBW A;  1JEH A;  4NNJ A;  3URH A;  3CMM A;  1FCD A;  1ZK7 A;  4AOS A;  2V3A A;  2X8H A;  1LQU A;  4B69 A;  3K30 A;  1KNR A;  1P2E A;  2WBA A;  2YR4 A;  3D9X A;  1GTH A;  1GV4 A;  3AE6 A;  2C67 A;  3I6D A;  2OLO A;  1MOK A;  2JB1 A;  3BI5 A;  2CDU A;  4GDE A;  2QA1 A;  4GR1 A;  1XPQ A;  3BNM A;  1TDE A;  1DNC A;  4KX6 A;  3SZF A;  1GRT A;  4DNA A;  2OAL A;  2R9Z A;  4H4X A;  3GWD A;  1D7Y A;  3CIR A;  1JRY A;  2VOU A;  4NEW A;  3AEC A;  3NK1 X;  1B5Q A;  3C96 A;  3RP8 A;  3BI2 A;  3GYJ A;  1CJ4 A;  4BK2 A;  3P1W A;  4U2T A;  4FK1 A;  1GRF A;  2VVM A;  2TMD A;  3CN8 A;  3KA7 A;  2BYB A;  5KXJ A;  1ZOV A;  3BHK A;  3AEB A;  4U8L A;  1H84 A;  3NYC A;  4CBQ A;  4N9X A;  4U2S A;  4LU6 A;  1TYP A;  3AED A;  1D4D A;  4U8P A;  3SGL A;  1KSU A;  3AE4 A;  4B67 A;  3T14 A;  4GAP A;  3NN6 X;  3DK8 A;  2XLR A;  2Q0K A;  3DJG X;  2C4C A;  1RP0 A;  3CNJ A;  2AAQ A;  2YVJ A;  3AYJ A;  3UKA A;  3C4N A;  2JKC A;  1DOD A;  3ATQ A;  2BC1 A;  3PS9 A;  3NYE A;  1GTE A;  3NG7 X;  4WCT A;  1COY A;  4B63 A;  1DOC A;  2C70 A;  3IC9 A;  3SFD A;  4A79 A;  2DKI A;  4YXD A;  3SYI A;  4H4T A;  2R4J A;  3NTD A;  4U8J A;  3CPJ G;  2BS2 A;  3CNT A;  4UDQ A;  2BA9 A;  4EMI A;  1IUX A;  4A65 A;  4AOX A;  3L8K A;  4BUR A;  1TRB A;  1BGJ A;  4JQ9 A;  1S7M A;  4I59 A;  1OJA A;  2R46 A;  1XDI A;  3LXD A;  1JU2 A;  3UOY A;  1VQW A;  4USQ A;  3F8R A;  2Q6U A;  2B9W A;  1NG3 A;  1NAA A;  4G73 A;  1OJD A;  3EPT A;  3KPK A;  4LA1 A;  2GB0 A;  4BV6 A;  2B9X A;  1S2Q A;  4CCQ A;  4HA6 A;  3D1C A;  3ATR A;  3CNS A;  2E4G A;  3QFB A;  3LOV A;  4G9K A;  4B64 A;  2C7G A;  2BRA A;  2VVL G;  1OJC A;  2A89 A;  4H4P A;  1ZDL A;  2HQM A;  2TPR A;  3IF9 A;  4IA6 A;  3EAO A;  4JY3 A;  5M0Z A;  2YLS A;  4AT2 A;  3AWI A;  3ZDN A;  2RGH A;  4A6N B;  1TYT A;  2PYX A;  2AR8 A;  3V3N A;  1OJ9 A;  4I58 A;  4K2X A;  1CBO A;  5FS8 A;  4FX9 A;  4UDR A;  3KPF A;  4XXG A;  1JNZ A;  3LJP A;  2WET A;  3NGC X;  4H2N A;  3CNP A;  1GPE A;  1D4E A;  2GEW A;  3H8L A;  3UKF A;  2YG6 A;  1UKV G;  3KVE A;  4Z2U A;  1GXF A;  4Z24 A;  3SXI A;  3JSK A;  3QJ4 A;  4OPL A;  5DBJ A;  1IUT A;  1E1K A;  1GEU A;  3G5R A;  2VQB A;  3QVR A;  1YKJ A;  1ELI A;  1PBD A;  3AEE A;  3KKJ A;  3T2Z A;  1MO9 A;  1VDC A;  3SZC A;  2H89 A;  2RGJ A;  2C72 A;  3CPH G;  4H2P A;  3K7T A;  1JOA A;  1GOS A;  4NZH A;  4C74 A;  2V6O A;  1L9C A;  3ALM A;  3K7Q X;  1CJ3 A;  3M12 A;  2WDR A;  3GD4 A;  3SQP A;  2R0C A;  4UDP A;  1LVL A;  4TLZ A;  1S3E A;  4J34 A;  4TM4 A;  3GDN A;  4U8O A;  2WES A;  5KMR A;  1YQ4 A;  1K4Q A;  2YR5 A;  2BK5 A;  2VZ2 A;  3AEA A;  3P4R A;  4J33 A;  3UTE A;  2GR3 A;  3KD9 A;  2DKH A;  2WOV A;  5TR3 A;  2BAB A;  2B7R A;  1L9E A;  1CJC A;  1L9D A;  1RSG A;  2C65 A;  2XLS A;  3T37 A;  3RHA A;  4B1B A;  4BJY A;  4TM1 A;  5IQ1 A;  4YSY A;  3H8I A;  4U8I A;  1N4W A;  5KVI A;  4U8K A;  1XHC A;  5HXI A;  4X9N A;  2RGO A;  4G74 A;  2WPE A;  5KOX A;  3HZL A;  4X9M A;  3T0K A;  3T31 A;  2XVI A;  3DA1 A;  3AEF A;  1D4C A;  3F8D A;  5FS9 A;  3IHG A;  4IVM B;  2NPX A;  1H81 A;  1PJ5 A;  3ICR A;  4C3X A;  5EOW A;  3ISH A;  2EQ8 A;  1BWC A;  4JNQ A;  3AE7 A;  2R0P A;  1CL0 A;  2C76 A;  3CGE A;  4CNK A;  3II4 A;  3VRD B;  3RNM A;  2BCP A;  1QJD A;  2WP5 A;  3UKP A;  4YSX A;  4CY8 A;  4BK1 A;  4J36 A;  4A6N A;  3NIX A;  3NNE A;  2GQF A;  1GSN A;  3D8X A;  5M10 A;  4ECH A;  3T2K A;  5LV9 A;  2X99 A;  1AOG A;  4LII A;  2XLU A;  5GRT A;  1TDN A;  4JDR A;  4EIQ A;  1CJ2 A;  4H2R A;  3I3L A;  2XFO A;  4ZCC A;  4TM0 A;  3FPZ A;  3C4A A;  2GMJ A;  2YLZ A;  2FJB A;  1H83 A;  3OC4 A;  1NHS A;  2JB3 A;  4Z25 A;  2YLT A;  2I0Z A;  4AT0 A;  2WOW A;  1N4V A;  3NTA A;  2YM1 A;  4EQX A;  2GMH A;  1IUS A;  3G5S A;  3P4Q A;  3LZX A;  3AEG A;  3PVC A;  3VRB A;  1F8W A;  5KVH A;  4OPG A;  4CRT A;  3RP7 A;  1ZKQ A;  1OJT A;  1ZP0 A;  3NT6 A;  1P2H A;  1L0V A;  4HB9 A;  2X8C A;  1E1L A;  3RP6 A;  4RG3 A;  3GRT A;  1BKW A;  1M64 A;  1B4V A;  2GR0 A;  2F5Z A;  3SY4 A;  4Z44 A;  1F8S A;  2WP9 A;  3UOZ A;  3NN0 X;  3AE2 A;  1Q1W A;  4EIP A;  3B6D A;  3KU9 A;  3VR9 A;  2Q0L A;  1CC6 A;  2E5V A;  3PG6 A;  2APG A;  1F8R A;  3ALJ A;  2WU5 A;  4C5O A;  1CC2 A;  4DSH A;  4DGK A;  2C73 A;  2XYO A;  4H4R A;  1BF3 A;  2XVE A;  3AE8 A;  1KN0 A;  1GRE A;  1NEK A;  3AE5 A;  1LJ1 A;  2BRY A;  4XWR A;  1FEB A;  4EMW A;  4H4S A;  2YR6 A;  1TDO A;  3DJJ A;  1K0L A;  3Q6J A;  3E1T A;  1PJ6 A;  3V3O A;  2WP6 A;  2WDQ A;  5J60 A;  3LB8 A;  1E7P A;  5U63 A;  4REK A;  3AE9 A;  1NG4 A;  1M6I A;  3SX6 A;  1W4X A;  2Y6Q A;  2GR2 A;  3NYF A;  5HYM A;  5C2T A;  3T2Y A;  1GER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...