4J56A

Structure of plasmodium falciparum thioredoxin reductase-thioredoxin complex
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
504
structure length
504
Chain Sequence
HTYDYDYVVIGGGPGGMASAKEAAAHGARVLLFDYVKPSSQGTKWGIGGTCVNVGCVPKKLMHYAGHMGSIFKLDSKAYGWKFDNLKHDWKKLVTTVQSHIRSLNFSYMTGLRSSKVKYINGLAKLKDKNTVSYYLKGDLSKEETVTGKYILIATGCRPHIPDDVEGAKELSITSDDIFSLKKDPGKTLVVGASYVALECSGFLNSLGYDVTVAVRSIVLRGFDQQCAVKVKLYMEEQGVMFKNGILPKKLTKMDDKILVEFSDKTSELYDTVLYAIGRKGDIDGLNLESLNMNVNKSNNKIIADHLSCTNIPSIFAVGDVAENVPELAPVAIKAGEILARRLFKDSDEIMDYSYIPTSIYTPIEYGACGYSEEKAYELYGKSNVEVFLQEFNNLEISAVHRQKHIRAQKDEYDLDVSSTCLAKLVCLKNEDNRVIGFHYVGPNAGEVTQGMALALRLKVKKKDFDNCIGIHPTDAESFMNLFVTISSGLSYAAKGGSGGGKCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase 2
publication title Crystal Structure of the Plasmodium falciparum Thioredoxin Reductase-Thioredoxin Complex.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 159
structure length 504
sequence length 504
chains with identical sequence B, C, D
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF00890 FAD_binding_2 FAD binding domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4j56A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4j56A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4j56A02
3P4PA 2XFPA 5U63A 4CY6A 3UKQA 1K4QA 4ZN0A 4EQXA 1IUSA 1NG3A 3CN8A 1S2YA 5HY5A 1LTXR 2H88A 4AP1A 3LZWA 4EIPA 5DBJA 2C75A 4A99A 1NAAA 1ZOYA 2ZZBA 3L1RA 1YQZA 4Z44A 1RSGA 1IUTA 3CPJG 1ZP0A 3F8PA 4C77A 2BK4A 1H6VA 2V5ZA 4JNQA 1DOCA 2PYXA 3OZ2A 3LZXA 5KRQA 2VRMA 1JU2A 3D1CA 4FK1C 3UOZA 4BK3A 4AT2A 2CFYA 4ADWA 1K0LA 1PXAA 2Q7VA 2QA1A 2APGA 4LU6A 3K7MX 3Q9TA 2GRTA 2FJDA 2UZZA 3KLJA 5IPYA 3ICSA 3AEFA 4REKA 3G5SA 2TMDA 3CGBA 3I6DA 2XLUA 4UDPA 2EQ9A 1TYPA 2C64A 2BS2A 4H4RA 1B5QA 2X99A 1GRGA 1W4XA 4TM0A 1REOA 1JOAA 3NNEA 3GYJA 1NG4A 4K7ZA 1O5WA 3CNTA 3LB8A 3CGDA 4GRTA 3BI4A 4B65A 4EIQA 1N1PA 3C4AA 4GDPA 3QSMA 4HB9A 4OPLA 5TR3A 1O95A 1XHCA 3WE0A 2WS3A 4YSYA 3E1TA 1YQ3A 2CULA 2ACZA 4KPRA 2C76A 1CC4A 1DODA 4EM3A 1EBDA 4Z24A 4H4YA 4TLXA 1ZDLA 3NYEA 4A5LA 2X8GA 4UP3A 1EL8A 3T37A 3VR8A 4Z25A 3ALJA 2XVIA 3KPFA 4B67A 4OVIA 1L9CA 4A79A 1F3PA 3ATRA 3CNJA 3G5RA 3D8XA 4YXDA 2YAUA 1GERA 2H89A 2JB1A 1PDHA 1VRQB 4OPCA 2WEUA 3IHGA 5J60A 4FDCB 3IF9A 3UKKA 1BWCA 3QSSA 1JNZA 1GTHA 3AE9A 2C3CA 2FJBA 3UP5A 4K22A 5JCLA 1L9DA 4HA6A 3VRBA 1L9EA 2YM1A 4B66A 2B9WA 1FCDA 2WHDA 3ADAB 4U8KA 1CF3A 2X50A 2X8HA 1H7XA 3AB1A 2OALA 1PBCA 4ECHA 4H4VA 3SQPA 2BA9A 2WBAA 1JNRA 2VVLG 3M12A 5CQFA 1D4EA 1V59A 3UKHA 4IVMB 1LJ1A 5GRTA 4U2SA 3AD9B 1GPEA 2WP5A 1Y0PA 2B7RA 3C4NA 1N4VA 2WOWA 2YVFA 4KX6A 4BK1A 4K5SA 1CJ2A 2OLNA 1LQTA 4D03A 2GH5A 1XANA 3DK4A 3QJ4A 4FK1A 4LIIA 3SGLA 5BRTA 2VRLA 4DSGA 2GF3A 4GCMA 4U8NA 3COXA 3SFEA 2GR0A 1NEKA 3O0HA 1D7YA 2X3NA 2XLPA 4H2PA 1IUVA 3AD7B 3NH3X 2OAMA 1TDOA 1VG0A 2YVJA 1PBFA 2WP9A 3NT6A 3VQRA 1O94A 1YQ4A 2BK5A 4PABA 4BJZA 1NHPA 1YKJA 4CY8A 1FOHA 5ER0A 3QFBA 2CVJA 4YKGA 1PJ5A 3GMBA 3AE3A 3CGCA 1NPXA 1QO8A 2GB0A 3BHFA 2YG6A 3DA1A 1PHHA 2YLWA 3IWAA 5FMHA 3P4QA 2OA1A 2YVGA 1TDNA 4GDEA 1QJDA 3AE2A 4Z43A 4H4UA 4O5UA 3VRDB 2WDQA 5IQ1A 4IA6A 5U1OA 4CNKA 1PBEA 2VQ7A 1NHSA 1E1MA 1TDEA 2QCUA 2WU2A 2IVEA 1GXFA 4YKFA 1M64A 4DGKA 4Z2UA 2R46A 2R0PA 3NKSA 2XLTA 2C7GA 2WESA 1H81A 3AE5A 1TYTA 1GESA 2WQYA 1IUWA 4H4PA 2GEWA 3CIRA 2YG4A 4H7UA 3AEGA 4B63A 4WX1A 1BF3A 4Z2RA 4EQRA 5L46A 3QFAA 4AP3A 4BV6A 3C96A 2BABA 3QSEA 1GRBA 2RABA 3P4RA 4N9XA 1Q1RA 1COYA 1RYIA 2FJEA 4K8DA 3ABVA 1H83A 3AECA 1XDIA 3FG2P 3ICTA 2BXRA 2C3DA 4H4ZA 1FECA 3K30A 3NG7X 4J31A 2QAEA 5EOWA 3FPZA 5KXJA 1DXLA 2YWLA 2BS4A 3R9UA 3P9UA 1H82A 2DKHA 1OJCA 2Y6QA 4PAAA 3CNSA 3M13A 3BHKA 2R45A 4CCQA 1ZY8A 2E4GA 1LQUA 2NPXA 5FS7A 2JKCA 3B6DA 1L0VA 3H8LA 1Y56B 4GR1A 4J36A 4JNAA 2FBWA 4K2XA 2GMJA 3S5WA 4EMIA 1GETA 2BCPA 1JRYA 2BXSA 1PJ6A 1N4WA 2DKIA 4EQWA 3S61A 2B9XA 3DGZA 1PXBA 1EL5A 2YLZA 5KVIA 4JN9A 4X9MA 3REDA 2EQ6A 5FS8A 2YG5A 3AYLA 4B1BA 4H2NA 1LVLA 1CC6A 2XLRA 1K0JA 2E1MA 3AWIA 2JBVA 1KNPA 3AEBA 4H2RA 4JY2A 1F8RA 2XFNA 1E39A 1GT8A 4A6NA 2BACA 4YSZA 1Q9IA 1ZOVA 4I59A 4OPGA 1BZLA 2GAHB 1KDGA 4OPDA 4TM4A 4IVOB 3DMEA 3LOVA 4J34A 3BI2A 4NEWA 2Q0LA 5BULA 1GRHA 1MOKA 2QA2A 1DNCA 5J7XA 3OC4A 2A87A 2V61A 3NRNA 1H7WA 3GWDA 4A65A 4A7AA 4EM4A 4RSLA 4YWOA 1D5TA 1DOBA 1E1KA 1KSUA 3NIXA 3BNMA 1GSNA 3SFDA 4YTMA 1TDKA 1D4DA 1KNRA 1M6IA 4U8OA 4BJYA 2NVKX 2WDRA 3F8DA 5KWFA 2V3BA 4H4XA 5BVAA 3Q6JA 3IHMA 4D04A 1RP0A 2ZZCA 1H84A 1FEBA 3NN0X 3P1WA 1PBDA 4ICYA 2WDVA 4J56A 1DJNA 3UTGA 2WP6A 4X4JA 5JCKA 3AEAA 1PXCA 1GEUA 4NTEA 2Y6RA 1IUXA 1D4CA 4OPIA 2B9YA 3ICRA 1PBBA 2RGHA 1OJDA 4H4SA 2GMHA 2AR8A 2B76A 1OJAA 5C3JA 4YT0A 4OPTA 1DOEA 3QVPA 5M0ZA 3BNUA 2YG7A 3BI5A 2XCGA 4CBQA 1YY5A 1GALA 3RP7A 1NHQA 2XVFA 4NTCA 3FBSA 4APNA 3KVEA 3UOXA 3NHOX 1E1LA 2JAEA 1AOGA 2XVEA 4C5OA 1NDAA 4GF7A 1B8SA 3PO7A 3LJPA 4K5RA 2C73A 3RP6A 2XVJA 1OJ9A 1UKVG 4FX9A 1ZMCA 1B4VA 2ZBWA 3NK1X 3EPTA 4J33A 2FJAA 2HQMA 2AQJA 2WOIA 1EL9A 3KA7A 2VVLA 1F8WA 1N4UA 1NENA 1PN0A 2GV8A 1KF6A 4U8JA 1CJ3A 3GD3A 1K0IA 3CPIG 3NTDA 2B7SA 1ELIA 2YR5A 1GREA 4DNAA 3ALLA 4OPUA 4X9NA 5LV9A 3KD9A 1PJ7A 2VVMA 4RG4A 2IVDA 3UKAA 2YM2A 4JY3A 5U25A 2BS3A 4OCGA 5FS6A 3DK9A 2YLSA 5M10A 1CL0A 3H8IA 3DH9A 3ALMA 1GOSA 3HZLA 2WOVA 3GSIA 3L8KA 1LPFA 5KOWA 3H4KA 4CCRA 4E0VA 2C67A 1Q1WA 1JEHA 1Z6LA 2CDUA 3GRTA 4XWRA 3AYIA 4XWZA 4GUVA 2WPEA 3UKLA 1ONFA 4H50A 4UDRA 2Z5XA 3AE1A 1E6EA 4Z26A 3GD4A 1DJQA 3JSKA 1KFYA 4DSHA 3AEEA 2GR3A 2BK3A 3URHA 4XXGA 3DJGX 3UOYA 4YSHA 4LA1A 1S3BA 1PS9A 4C3XA 2GAGB 2EQ7A 4ZCCA 2Q0KA 2YQUA 2R9ZA 1VDCA 4U8MA 3DJEA 3EF6A 3DGHA 3P4SA 1VQWA 2W0HA 4UDQA 1TRBA 1SEZA 1ZKQA 3ATQA 3DK8A 2YG3A 2YLTA 2XDOA 3F8RA 1GRTA 3AE8A 4U8IA 3V3NA 4EMJA 1D7LA 1E1NA 2RGOA 3UTFA 2XFOA 3NYCA 4IV9A 4MJWA 1CC2A 5CKUA 1CJ4A 2BCGG 4C3YA 5JCNA 3GDNA 4IA5A 4TLZA 4EMWA 4USQA 4NTDA 4CNJA 2PHHA 3NK2X 2IIDA 3NN6X 3PVCA 3ISHA 4U8PA 4H4QA 2VQBA 3AE4A 3GYIA 1S3EA 2YR6A 1IUUA 3SM8A 3II4A 1JRZA 2C66A 2Q6UA 3B3RA 4I58A 4U2TA 3ZYXA 4NZHA 4CRTA 4JQ9A 4AOXA 5JCIA 3CPHG 2R4JA 2F5ZA 3CTYA 5HHFA 2WPFA 3NLCA 1GTEA 1GNDA 1NHRA 3NYFA 1ZK7A 2VZ2A 2O9ZA 4B69A 2XYOA 2J3NA 3AE7A 2GQWA 1QLBA 3GRSA 3NTAA 4H2QA 4A9WA 4H4WA 3PS9A 2VOUA 2XVHA 5JCMA 3ITJA 3VR9A 1OJTA 4B68A 4YTPA 3GMCA 2V3AA 4EQSA 2Z5YA 3UTEA 1CBOA 2YR4A 3AEDA 4U8LA 2V60A 3UCLA 2XFUA 2ARDA 1MO9A 1ZMDA 3EAOA 2OLOA 4TM1A 4USRA 1XPQA 3UKFA 1GV4A 2JB2A 2C70A 2WPCA 1E7PA 1P2HA 2GR2A 2AAQA 2X8CA 2ZZ0A 4ZCDA 3NGCX 1BGNA 1KSSA 4WCTA 2YLXA 1F6MA 4JDRA 3CNDA 4U2LA 1CHUA 4NEVA 5BUKA 1BKWA 3DJJA 2JB3A 2GR1A 2YLRA 1H86A 3M0OA 1JRXA 3UOVA 2WU5A 1VG9A 4Z2TA 3NK0X 2GQFA 3DJDA 2V6OA 3AYJA 1IJHA 1X31B 4Y4LA 2C72A 3LXDA 4A6NB 4J2WA 1HYUA 1GRAA 3RNMA 1S2QA 4BURA 4YSXA 2A89A 4O5QA 3EANA 3UKPA 2R4EA 4BK2A 5EBKA 2XFQA 4AT0A 5HXIA 4Y4NA 3KU9A 1MXTA 2E5VA 1ZX9A 2C65A 2BC0A 4RG3A 4B64A 3RP8A 3LADA 1CJCA 1Y56A 5IQ4A 1FEAA 3FMWA 2TPRA 3AXBA 1GRFA 2BYBA 4Y4MA 4AOSA 3RHAA 2A8XA 3AE6A 2BC1A 1F8SA 1P2EA 3VRAA 4J57A 4C74A 3V76A 5C2TA 1EL7A 4M52A 5EB5A 5EB4A 4YTNA 3IC9A 3FIMB 3I3LA 2JK6A 1FL2A 3UTHA 2I0ZA 5GSNA 3K7QX 5KOXA 1BGJA 2R0GA 3CGEA 2XLSA 3KKJA 1B37A 3GDPA 1TDFA 4P9SA 2R0CA 3AD8B 5FS9A 4H4TA 5KVHA 3GWFA 5HYMA 3UP4A 4TM3A 2WETA 2RGJA 1LV0A 3G5QA 3K7TA 3ZDNA 3QVRA 3CNPA 3V3OA 2GVCA 2EQ8A
chains in the Genus database with same CATH superfamily
4G6HA 3NVWB 1LTXR 3DG7A 3TW9A 2H88A 4AP1A 1VDVA 2ZZBA 3L1RA 3I6EA 5G5HB 3F8PA 2BK4A 1DOCA 3HYXA 2VRMA 1JU2A 2P8BA 3OPSA 3UGVA 2CFYA 2QA1A 2Q7VA 1EC7A 4G6GA 3K7MX 2GRTA 3T9PA 2CHRA 3D9XA 3VC6A 1TKKA 3CGBA 3I6DA 2GDQA 2EQ9A 1TYPA 2C64A 2X99A 4TM0A 1REOA 1STZA 3GYJA 4K7ZA 1IYXA 3TTEA 1SJDA 3BI4A 1R6WA 4GDPA 4OPLA 2WS3A 3E1TA 1YQ3A 2CULA 4EM3A 4Z24A 4H4YA 2X8GA 4OVIA 3G5RA 2YAUA 1VRQB 3IHGA 4FDCB 3UKKA 3QSSA 3AE9A 2FJBA 5JCLA 2PSNA 2WHDA 4H4VA 3SQPA 2VVLG 1D4EA 4IVMB 3SQSA 2PS2A 4HCLA 3FJ4A 2WP5A 2YVFA 4BK1A 1CJ2A 3QKEA 2OLNA 3UJSA 4LIIA 3SGLA 2VRLA 4DSGA 2ONEA 3SFEA 3VDGA 2GR0A 4DXKA 2XLPA 1IUVA 4ENLA 3NH3X 1VG0A 2WP9A 4HPNA 3QFBA 2CVJA 3NO1A 3AE3A 1QO8A 3BHFA 2YG6A 3P4QA 5FMHA 4GDEA 3DESA 1PBEA 3P0WA 1GXFA 4Z2UA 3NKSA 1IUWA 1R0MA 1RYIA 3IJQA 3FG2P 5KXJA 1FO4A 3K30A 1DXLA 4X2PA 2YWLA 3UJEA 2DKHA 2Y6QA 3T8QA 4PAAA 3M13A 4YWSA 3H8LA 4GR1A 5KNLA 3S5WA 4EMIA 2BCPA 1H2IA 1PJ6A 3SXIA 2EQ6A 3ZVHA 1CC6A 3AWIA 2JBVA 2XFNA 4A6NA 1GT8A 4YSZA 1ZOVA 2OLAA 2GAHB 3TWBA 2GGEA 3A7AA 3BI2A 2Q0LA 1T3QC 2V61A 4YWOA 1DOBA 3BNMA 3SFDA 2HZGA 1D4DA 3CYJA 3NS1B 3CB3A 3BOXA 3PWGA 4ICYA 3UTGA 4X4JA 3FYYA 3UXKA 1D4CA 3H8AA 3N4FA 1VQZA 2B9YA 3ICRA 2RGHA 3GYXA 2PU1A 1JCTA 3JZUA 2B76A 4YT0A 3NVZB 2XCGA 1YY5A 1NHQA 2XVFA 4APNA 3T2YA 2JAEA 4M0XA 3LJPA 2HXTA 2C73A 3R11A 3SZWA 2ZBWA 4J33A 4GISA 2GV8A 4KPLA 3DGBA 1N61C 3KD9A 2VVMA 5FJOA 1S7MA 5U25A 1EBGA 2QJJA 5M10A 1CL0A 3H8IA 3DH9A 1RM6B 2WOVA 1FFUC 4E0VA 2C67A 2OPJA 2CDUA 3AYIA 1ONEA 4GUVA 1YEYA 4Z26A 4H1ZA 2GR3A 7ENLA 3URHA 4YSHA 4C3XA 3R1ZA 3KUMA 2Q0KA 1N60C 4GYPA 3OP2A 2W0HA 2YG3A 3F8RA 3V3NA 3UTFA 1V97A 3NYCA 4IV9A 3OZMA 5JCNA 4TLZA 4EMWA 4CNJA 1EC8A 2IIDA 3DDMA 3ISHA 4U8PA 3AE4A 5FJPA 1S3EA 1JRZA 2Q6UA 3ZLFA 4CRTA 4AOXA 3RITA 3OW1A 3NRZB 1WUFA 2ZC8A 4J3ZA 1ZK7A 4B69A 3AE7A 2XYOA 2J3NA 3GRSA 4H4WA 3VR9A 5JRBA 1CBOA 3SSZA 1XS2A 2XFUA 4TM1A 3UKFA 6ENLA 1E7PA 1P2HA 2AAQA 2GR2A 4U2LA 3DJJA 1FHVA 2GQFA 2V6OA 3AM9A 4K2SA 2AKMA 3THUA 4KWSA 4A6NB 1S2QA 2E5VA 4B64A 1Y56A 4GFIA 3RHAA 2A8XA 1P2EA 3VRAA 4C74A 5EB5A 4YTNA 3IC9A 3I3LA 3UTHA 2I0ZA 3K7QX 3JVAA 4II3A 2QDDA 3K7TA 3QVRA 2EQ8A 4ZN0A 3P3BA 3CN8A 1S2YA 3DIPA 4EIPA 2C75A 2I5QA 1NAAA 1RSGA 1IUTA 3ES7A 5KMPA 1H6VA 2V5ZA 3RGTA 3QLDA 2PYXA 2HNEA 1P43A 4FP1A 3Q9TA 2FJDA 3CK5A 3KLJA 3ICSA 3G5SA 2TMDA 4UDPA 2GGHA 2BS2A 1B5QA 1ZXIC 3NNEA 3NVYB 4DHGA 3AN1A 1N5WC 1O5WA 1EBHA 3CGDA 1X2GA 4B65A 1N1PA 4HB9A 3R25A 4YSYA 4A3RA 2POZA 5FJRA 3QPEA 1NU5A 4F4RA 3TOYA 1L9CA 1W6TA 3ATRA 3T2KA 2H89A 2JB1A 1SJAA 4IL2A 1GTHA 3UP5A 1L9DA 4HA6A 1FCDA 3ADAB 4U8KA 3PFRA 2OALA 5CQFA 1V59A 1LJ1A 4U2SA 1Y0PA 3ETRB 1N4VA 1ECQA 4K5SA 2DW7A 2GH5A 1XANA 4IHCA 2X3NA 3SN0A 4H2PA 1N63C 2YVJA 1PBFA 3UJRA 2AKZA 4JN8A 4PABA 3BJSA 4A35A 1YQ4A 3NXLA 1FOHA 2MUCA 4YKGA 1PJ5A 2GGIA 3IWAA 2OA1A 1TDNA 2GGJA 4IA6A 2MNRA 1E1MA 2WU2A 3DG3A 1N5XA 2R46A 2R0PA 1H81A 1GESA 2WQYA 4H4PA 2GEWA 3MY9A 3CIRA 1BF3A 4EQRA 5L46A 4BV6A 2BABA 2RABA 3P4RA 4N9XA 1COYA 3ABVA 1PDZA 3NVVB 4H4ZA 1FECA 4J31A 2QAEA 3FPZA 2BS4A 2OQHA 3BHKA 1Y56B 4J36A 3B97A 2GMJA 1MRAA 1N4WA 2DKIA 3PWIA 2GL5A 4E4UA 4JN9A 3REDA 3AYLA 4B1BA 4H2NA 3SJNA 2BACA 4OPGA 1BZLA 4IVOB 3SBFA 2ZADA 2OQYA 1DNCA 2OZ3A 3OC4A 3CMMA 4A65A 3A7UA 4EM4A 1N62C 1JPDX 1GSNA 1JROA 2PP1A 2NVKX 5KWFA 2V3BA 4H4XA 3IHMA 1RP0A 3FV9A 4NTEA 1IUXA 2RDXA 3FCPA 4H4SA 3TCSA 1DOEA 3QVPA 4ZOHB 3BNUA 3BI5A 4CBQA 4NTCA 3KVEA 3VFCA 2PU0A 4GF7A 1B8SA 3PO7A 3RP6A 1OJ9A 1UKVG 3DFYA 1SJBA 3NK1X 2FJAA 2HQMA 4FI4A 2OO6A 4G8TA 1EL9A 1F8WA 1N4UA 1KF6A 3T31A 1K0IA 3KPKA 3A7RA 4IP5A 3ALLA 4X9NA 5LV9A 4G7FA 2IVDA 3BSMA 2QQ6A 2XH7A 2YM2A 4JY3A 2BS3A 1TE6A 1GOSA 3GSIA 5KOWA 3H4KA 4CCRA 3SR6B 1Q1WA 3MQTA 1Z6LA 4XWRA 1ONFA 2Z5XA 3AE1A 1KFYA 3AEEA 4XXGA 4LA1A 1PS9A 4ZCCA 2R9ZA 4U8MA 2PPGA 3DJEA 4GAPA 2E5AA 3EKGA 4UDQA 2YLTA 4U8IA 3AE8A 2RGOA 1CC2A 5CKUA 4IA5A 3NN6X 2XH4A 4H4QA 2VQBA 2YR6A 3II4A 4U2TA 4E4FA 4I58A 2W3RA 4NZHA 5JCIA 3CPHG 2R4JA 3CTYA 5HHFA 2WPFA 3HPFA 3NLCA 1GTEA 1NHRA 2VZ2A 2O9ZA 4A9WA 2GQWA 5G5GB 4E6MA 3RRAA 4B68A 2OKTA 3MSYA 3SN4A 1SB3B 2AL1A 3H12A 3CXBA 2ARDA 1MO9A 2OLOA 4USRA 4M6UA 1GV4A 2WPCA 2X8CA 4ZCDA 1KSSA 3CNDA 4G9KA 1CHUA 4NEVA 1JRPA 3Q4DA 2YLRA 4H19A 3M0OA 3UOVA 5J04A 2WU5A 2XH0A 3DJDA 3CT2A 3AYJA 1X31B 3PK7A 2XSXA 1PDYA 3LXDA 3D46A 1HYUA 1GRAA 3RNMA 2A89A 3UKPA 3KU9A 1MXTA 2C65A 4RG3A 5IQ4A 1FEAA 4Y4MA 3AXBA 1GRFA 2BC1A 1F8SA 3V76A 5C2TA 3FIMB 2JK6A 4DN1A 2XGZA 5GSNA 2R0GA 4G73A 3GDPA 4P9SA 3TWAA 1BKHA 3GWFA 5FS9A 5HYMA 2WETA 2RGJA 3ZDNA 3CNPA 2GVCA 3P4PA 2XFPA 5U63A 1IUSA 1NG3A 5HY5A 2QVHA 1L8PA 4A99A 1ZOYA 3EUB3 4Z44A 5KRQA 1XPYA 3D1CA 4FK1C 2APGA 5IPYA 3I6TA 2OFJA 4H4RA 1GRGA 3DFHA 1FIQB 3FVDA 4TVYA 1NG4A 2DW6A 4EIQA 3C4AA 3QSMA 5TR3A 1XHCA 1FHUA 4H2HA 4EWJA 1CC4A 1DODA 1EBDA 3RO6A 5IDZA 3SZ0A 3NYEA 4Z25A 1EL8A 4KT2A 2C4CA 3ALJA 3KPFA 4A79A 3EEZA 4YXDA 2WEUA 5J60A 4GGHA 1L9EA 4DX3A 1CF3A 2X50A 2X8HA 3AB1A 3U9IA 4GIRA 4ECHA 2WBAA 3M12A 3UKHA 1SJCA 5GRTA 1WUEA 3AD9B 1GPEA 4GYPC 2B7RA 3C4NA 4Z1YA 2PMQA 2WOWA 4KX6A 2OZTA 1LQTA 3DK4A 5BRTA 3HYWA 2PP3A 1NEKA 3O0HA 1D7YA 3JW7A 3AD7B 2BRAA 3NT6A 3VQRA 1O94A 1NHPA 3D47A 1TZZA 1YKJA 4CY8A 3GMBA 2GB0A 3DA1A 2YLWA 2PTWA 2YVGA 3Q45A 3AE2A 3IJLA 3CAWA 4O5UA 3VRDB 5IQ1A 5U1OA 1NHSA 4YKFA 1M64A 4DGKA 2C7GA 1TYTA 4H7UA 3C96A 3TJIA 3QSEA 2QJNA 2FJEA 3UJFA 1XDIA 3SX6A 3FXGA 4HNCA 3ZVIA 5ENLA 1H82A 5KMSA 5FS7A 4JNAA 2FBWA 4K2XA 3S47A 3CXOA 4KEMA 3NZGA 1GETA 4HN8A 2BXSA 2P3ZA 3S61A 4EQWA 4DWDA 1PXBA 1EL5A 2YLZA 5KVIA 4X9MA 2YG5A 3UJ2A 4J1OA 1LVLA 2XLRA 1K0JA 3VA8A 4H2RA 4JY2A 4ZA0A 1E39A 1Q9IA 4I59A 3LOVA 5BULA 3ENLA 1MOKA 3R0KA 4E8GA 4RSLA 1E1KA 1KSUA 2QGYA 4YTMA 1TDKA 1M6IA 4U8OA 2GSHA 2WDRA 3Q6JA 4D04A 1H84A 1FEBA 1PBDA 2WP6A 1GEUA 2Y6RA 3ZLHA 1OJAA 2OZ8A 5C3JA 3SZFA 4OPTA 2YG7A 3RR1A 2PODA 3FBSA 1E1LA 2XVEA 4HYRA 4K5RA 2BRYA 2XVJA 2P0IA 3QTPA 5EU9A 4GMEA 4FX9A 1ZMCA 4JN7A 2AQJA 2WOIA 1MNSA 1NENA 1E9IA 3GD3A 3CPIG 3NTDA 1ELIA 4DNAA 1MDLA 4OPUA 4RG4A 3UKAA 4OCGA 2FKPA 3V3WA 2YLSA 3OTRA 3L8KA 1LPFA 3GRTA 3R0UA 4XWZA 3MKCA 2WPEA 4IP4A 4H50A 2GGGA 4DSHA 3JSKA 2BK3A 3DJGX 1S3BA 3T4WA 2EQ7A 4JHMA 2PTYA 2YQUA 3DGHA 3P4SA 1TRBA 1SEZA 1ZKQA 3ATQA 2O56A 3GD6A 4EMJA 1D7LA 1E1NA 3VC5A 2W54A 1CJ4A 2BCGG 4C3YA 3GDNA 2PHHA 3PVCA 1IUUA 3SM8A 3IJIA 3HYVA 4MKSA 2OVLA 1JPMA 3NYFA 2QJMA 2W3SA 4H2QA 3NTAA 3I4KA 1QLBA 1KN0A 2VOUA 2XVHA 4YTPA 3ITJA 1OJTA 2V3AA 3UTEA 4DYEA 2YR4A 4U8LA 3UCLA 1ZMDA 3EAOA 1XPQA 2JB2A 5FJUA 2OG9A 3NGCX 1BGNA 4WCTA 1F6MA 3HW2A 2PP0A 3T0KA 2GR1A 1H86A 4Z2TA 3NK0X 2P8CA 2PTZA 1IJHA 3R07C 4J2WA 4MMWA 1KD0A 3EANA 2R4EA 4BK2A 2XFQA 4Y4NA 3TJ4A 2BC0A 3RP8A 3LADA 3FMWA 2BYBA 3AE6A 4J57A 1RVKA 4M52A 1FL2A 3H7VA 5KOXA 1BGJA 2XLSA 3KKJA 1B37A 1TDFA 2R0CA 4H4TA 1DTNA 4TM3A 3DG6A 3V3OA 4CY6A 3UKQA 1K4QA 4EQXA 3LZWA 5DBJA 1YQZA 3CPJG 1ZP0A 4C77A 4JNQA 3OZ2A 3LZXA 3UOZA 4BK3A 4AT2A 4ADWA 1K0LA 1PXAA 2HXUA 4LU6A 2UZZA 3AEFA 2E3TA 3T6CA 4REKA 2XLUA 3PG6A 1W4XA 1JOAA 3CNTA 3LB8A 3N6HA 4GRTA 1O95A 5FJTA 3WE0A 2ACZA 4KPRA 2C76A 1P48A 1NELA 1ZDLA 4TLXA 2XH2A 4A5LA 3T37A 4UP3A 3VR8A 2XVIA 4B67A 1KKOA 1F3PA 3CNJA 3D8XA 3R10A 1GERA 4OPCA 1PDHA 3IF9A 1BWCA 1JDFA 3K1GA 1JNZA 4IL0A 2C3CA 4K22A 3VRBA 4NWZA 2YM1A 3MUCA 4B66A 2B9WA 1H7XA 1PBCA 2AL2A 2BA9A 1JNRA 4IT1A 2PTXA 4D03A 3UCCA 3QJ4A 4FK1A 4HCDA 2GF3A 4GCMA 4U8NA 3COXA 1FFVC 3SYIA 2PGEA 2OAMA 1TDOA 3GY1A 3ZLGA 2BK5A 4BJZA 1ELSA 5ER0A 1KKRA 3OZYA 3CGCA 1NPXA 1PHHA 1QJDA 4Z43A 4H4UA 2WDQA 4CNKA 4HNLA 2VQ7A 4II2A 2QCUA 1TDEA 2IVEA 5BOFA 2XLTA 2WESA 3AE5A 3IK4A 3N4EA 3V4BA 2YG4A 3AEGA 4B63A 4WX1A 4Z2RA 1OEPA 3QFAA 4AP3A 1BQGA 1EC9A 3RCYA 1GRBA 4NNJA 1Q1RA 3V5FA 4K8DA 2P88A 1H83A 3AECA 3ICTA 2BXRA 2C3DA 3DEQA 5EOWA 3NG7X 3N6JA 3R9UA 3P9UA 1OJCA 3CNSA 2R45A 4CCQA 1ZY8A 4GGBA 1F9CA 2E4GA 3DERA 1LQUA 2NPXA 4A6GA 2JKCA 3B6DA 3UCDA 1L0VA 4E5TA 3S5SA 1JRYA 2B9XA 3DGZA 5FS8A 4MGGA 2E1MA 1KNPA 3AEBA 1F8RA 3VCCA 4ZCWA 3T14A 5KMQA 4OPDA 1KDGA 4TM4A 1MUCA 3DMEA 4J34A 3AMZA 4NEWA 3NFUA 1GRHA 4K1WA 2QA2A 5J7XA 2A87A 3NRNA 1H7WA 3GWDA 4A7AA 1D5TA 3NIXA 3SN1A 1KNRA 4BJYA 3F8DA 2FYMA 5BVAA 2ZZCA 3NN0X 3P1WA 2WDVA 4J56A 1DJNA 5JCKA 3AEAA 1PXCA 3H70A 2NQLA 4OPIA 1PBBA 1OJDA 2GMHA 2AR8A 5M0ZA 1GALA 3RP7A 3UOXA 3NHOX 1AOGA 4C5OA 3ZVHB 1NDAA 4K8GA 1B4VA 3EPTA 3KA7A 2VVLA 3SZCA 1PN0A 4U8JA 1CJ3A 4ROPA 1WYGA 2B7SA 2YR5A 1GREA 4G74A 3GO2A 1PJ7A 3SY4A 2PCEA 2AL2B 5FS6A 3DK9A 3ALMA 3HZLA 3B9JB 3GC2A 1JEHA 5KMRA 3UKLA 4UDRA 1MDRA 1E6EA 5BOEA 3GD4A 1DJQA 3TQPA 3UOYA 2GAGB 1X2HA 1VDCA 3UXLA 3EF6A 2W55A 1VQWA 2OX4A 3QN3A 3DK8A 4GAVA 2XDOA 1GRTA 3VCNA 1KCZA 2XFOA 4MJWA 4H83A 4USQA 4NTDA 2PGWA 3NK2X 3GYIA 2C66A 3HRDC 3B3RA 3ZYXA 4JQ9A 2F5ZA 1GNDA 3ES8A 3MWCA 3PS9A 5JCMA 3GMCA 2PA6A 4EQSA 2Z5YA 3AEDA 4Z17A 2V60A 3P93A 2C70A 2ZZ0A 2YLXA 4JDRA 5BUKA 1BKWA 3T2ZA 2JB3A 3U4FA 1JRXA 1VG9A 4HCHA 4Y4LA 2C72A 3STPA 4BURA 4YSXA 4O5QA 5EBKA 4AT0A 5HXIA 1ZX9A 1CJCA 2TPRA 4AOSA 3V5CA 1EL7A 5EB4A 4TVWA 3L5OA 4IZGA 3CGEA 3AD8B 5KVHA 3UP4A 1LV0A 3MZNA 3G5QA 2QDEA
chains in the Genus database with same CATH topology
3P4PA 2XFPA 5U63A 4CY6A 3UKQA 1K4QA 4ZN0A 4G6HA 4EQXA 1IUSA 1NG3A 3CN8A 1S2YA 5HY5A 1LTXR 2H88A 4AP1A 3LZWA 4EIPA 5DBJA 2C75A 4A99A 1NAAA 1ZOYA 2ZZBA 3L1RA 1YQZA 4Z44A 1RSGA 1IUTA 3CPJG 1ZP0A 3F8PA 4C77A 5KMPA 2BK4A 1H6VA 2V5ZA 4JNQA 1DOCA 2PYXA 3HYXA 3LZXA 3OZ2A 5KRQA 2VRMA 1JU2A 3D1CA 4FK1C 3UOZA 4BK3A 4AT2A 2CFYA 4ADWA 1K0LA 1PXAA 2Q7VA 2QA1A 2APGA 4LU6A 4G6GA 3K7MX 3Q9TA 2GRTA 2FJDA 2UZZA 3KLJA 3D9XA 5IPYA 3ICSA 3AEFA 4REKA 3G5SA 2TMDA 3CGBA 3I6DA 2XLUA 4UDPA 2EQ9A 1TYPA 3PG6A 2BS2A 2C64A 4H4RA 1B5QA 2X99A 1GRGA 1W4XA 4TM0A 1REOA 1JOAA 3NNEA 3GYJA 1NG4A 4K7ZA 1O5WA 3CNTA 3LB8A 3CGDA 4GRTA 3BI4A 4B65A 4EIQA 1N1PA 3C4AA 4GDPA 3QSMA 4HB9A 4OPLA 5TR3A 1O95A 1XHCA 3WE0A 2WS3A 4YSYA 3E1TA 1YQ3A 2CULA 2ACZA 4KPRA 2C76A 1CC4A 1DODA 4EM3A 1EBDA 4Z24A 4H4YA 3SZ0A 4TLXA 1ZDLA 3NYEA 4A5LA 2X8GA 4UP3A 1EL8A 3T37A 3VR8A 4Z25A 2C4CA 3ALJA 2XVIA 3KPFA 4B67A 4OVIA 1L9CA 4A79A 1F3PA 3ATRA 3CNJA 3G5RA 3D8XA 3T2KA 2YAUA 1GERA 2H89A 2JB1A 1PDHA 1VRQB 4OPCA 4YXDA 2WEUA 3IHGA 5J60A 4FDCB 3IF9A 3UKKA 1BWCA 3QSSA 1JNZA 1GTHA 3AE9A 2C3CA 2FJBA 3UP5A 4K22A 5JCLA 1L9DA 4HA6A 3VRBA 1L9EA 2YM1A 4NWZA 4B66A 2B9WA 1FCDA 2WHDA 3ADAB 4U8KA 1CF3A 2X50A 2X8HA 1H7XA 3AB1A 2OALA 1PBCA 4ECHA 4H4VA 3SQPA 2BA9A 2WBAA 1JNRA 2VVLG 3M12A 5CQFA 1D4EA 1V59A 3UKHA 4IVMB 1LJ1A 5GRTA 4U2SA 3AD9B 1GPEA 2WP5A 1Y0PA 2B7RA 3C4NA 1N4VA 2WOWA 2YVFA 4KX6A 4BK1A 4K5SA 1CJ2A 2OLNA 1LQTA 4D03A 2GH5A 1XANA 3DK4A 3QJ4A 4FK1A 4LIIA 3SGLA 5BRTA 2VRLA 4DSGA 2GF3A 4GCMA 4U8NA 3COXA 3HYWA 3SFEA 2GR0A 1NEKA 3O0HA 1D7YA 3SYIA 2X3NA 2XLPA 4H2PA 1IUVA 3AD7B 3NH3X 2OAMA 1TDOA 1VG0A 2YVJA 1PBFA 2WP9A 2BRAA 3NT6A 3VQRA 1O94A 1YQ4A 2BK5A 4PABA 4BJZA 1NHPA 1YKJA 4CY8A 1FOHA 5ER0A 3QFBA 2CVJA 4YKGA 1PJ5A 3GMBA 3AE3A 3CGCA 1NPXA 1QO8A 2GB0A 3BHFA 2YG6A 3DA1A 1PHHA 2YLWA 3IWAA 5FMHA 3P4QA 2OA1A 2YVGA 1TDNA 4GDEA 1QJDA 3AE2A 4Z43A 4H4UA 4O5UA 3VRDB 2WDQA 5IQ1A 4IA6A 5U1OA 4CNKA 1PBEA 2VQ7A 1NHSA 1E1MA 1TDEA 2QCUA 2WU2A 2IVEA 4II2A 1GXFA 4YKFA 1M64A 4DGKA 4Z2UA 2R46A 2R0PA 3NKSA 2XLTA 2C7GA 2WESA 1H81A 3AE5A 1TYTA 1GESA 2WQYA 1IUWA 4H4PA 2GEWA 3CIRA 2YG4A 4H7UA 3AEGA 4B63A 4WX1A 1BF3A 4Z2RA 4EQRA 5L46A 3QFAA 4AP3A 4BV6A 3C96A 2BABA 3QSEA 1GRBA 2RABA 3P4RA 4NNJA 4N9XA 1Q1RA 1COYA 1RYIA 2FJEA 4K8DA 3ABVA 1H83A 3AECA 1XDIA 3FG2P 3ICTA 2BXRA 2C3DA 4H4ZA 3SX6A 1FECA 3K30A 3NG7X 4J31A 2QAEA 5EOWA 3FPZA 5KXJA 1DXLA 2YWLA 2BS4A 3R9UA 3P9UA 1H82A 2DKHA 1OJCA 2Y6QA 4PAAA 3CNSA 3M13A 3BHKA 2R45A 4CCQA 1ZY8A 5KMSA 2E4GA 1LQUA 2NPXA 5FS7A 2JKCA 3B6DA 1L0VA 3H8LA 1Y56B 4GR1A 4J36A 4JNAA 5KNLA 2FBWA 4K2XA 2GMJA 3S5WA 4EMIA 1GETA 2BCPA 1JRYA 2BXSA 1H2IA 1PJ6A 1N4WA 2DKIA 4EQWA 3S61A 2B9XA 3DGZA 1PXBA 1EL5A 2YLZA 5KVIA 4JN9A 4X9MA 3REDA 2EQ6A 3SXIA 5FS8A 2YG5A 3AYLA 4B1BA 4H2NA 1LVLA 1CC6A 2XLRA 1K0JA 2E1MA 3AWIA 2JBVA 1KNPA 3AEBA 4H2RA 4JY2A 1F8RA 2XFNA 1E39A 1GT8A 4A6NA 2BACA 3T14A 4YSZA 1Q9IA 1ZOVA 4I59A 4OPGA 5KMQA 1BZLA 2GAHB 1KDGA 4OPDA 4TM4A 4IVOB 3DMEA 3LOVA 4J34A 3BI2A 4NEWA 2Q0LA 5BULA 1GRHA 1MOKA 2QA2A 1DNCA 5J7XA 3OC4A 2A87A 2V61A 3CMMA 1H7WA 3GWDA 3NRNA 4A65A 4A7AA 4EM4A 4RSLA 4YWOA 1D5TA 1DOBA 1E1KA 1KSUA 3NIXA 3BNMA 1GSNA 3SFDA 4YTMA 1TDKA 1D4DA 1KNRA 1M6IA 4U8OA 4BJYA 2NVKX 2WDRA 3F8DA 5KWFA 2V3BA 4H4XA 5BVAA 3Q6JA 3IHMA 4D04A 1RP0A 2ZZCA 1H84A 1FEBA 3NN0X 3P1WA 1PBDA 4ICYA 2WDVA 4J56A 1DJNA 3UTGA 2WP6A 4X4JA 5JCKA 3AEAA 1PXCA 1GEUA 4NTEA 2Y6RA 1IUXA 1D4CA 4OPIA 2B9YA 3ICRA 1PBBA 2RGHA 1OJDA 4H4SA 2GMHA 3GYXA 2AR8A 2B76A 1OJAA 5C3JA 3SZFA 4YT0A 4OPTA 1DOEA 3QVPA 5M0ZA 3BNUA 2YG7A 3BI5A 2XCGA 4CBQA 1YY5A 1GALA 3RP7A 1NHQA 2XVFA 4NTCA 3FBSA 4APNA 3KVEA 3UOXA 3NHOX 1E1LA 2JAEA 1AOGA 3T2YA 2XVEA 4C5OA 1NDAA 4GF7A 1B8SA 3PO7A 3LJPA 4K5RA 2C73A 2BRYA 3RP6A 2XVJA 1OJ9A 3SZWA 1UKVG 4FX9A 1ZMCA 1B4VA 2ZBWA 3NK1X 3EPTA 4J33A 2FJAA 2HQMA 2AQJA 2WOIA 1EL9A 3KA7A 2VVLA 1F8WA 1N4UA 3SZCA 1NENA 1PN0A 2GV8A 1KF6A 4U8JA 1CJ3A 3GD3A 3T31A 1K0IA 3CPIG 3KPKA 3NTDA 2B7SA 1ELIA 2YR5A 1GREA 4DNAA 4G74A 3ALLA 4OPUA 4X9NA 5LV9A 3KD9A 1PJ7A 2VVMA 4RG4A 2IVDA 3UKAA 2YM2A 3SY4A 4JY3A 1S7MA 5U25A 2BS3A 4OCGA 5FS6A 3DK9A 2YLSA 5M10A 1CL0A 3H8IA 3DH9A 3ALMA 1GOSA 3HZLA 2WOVA 3GSIA 3L8KA 1LPFA 5KOWA 3H4KA 4CCRA 4E0VA 2C67A 1Q1WA 1JEHA 1Z6LA 2CDUA 3GRTA 4XWRA 3AYIA 4XWZA 4GUVA 2WPEA 5KMRA 3UKLA 1ONFA 4H50A 4UDRA 2Z5XA 3AE1A 1E6EA 4Z26A 3GD4A 1DJQA 3JSKA 1KFYA 4DSHA 3AEEA 2GR3A 2BK3A 3URHA 4XXGA 3DJGX 3UOYA 4YSHA 4LA1A 1S3BA 1PS9A 4C3XA 2GAGB 2EQ7A 4ZCCA 2Q0KA 2YQUA 2R9ZA 1VDCA 4U8MA 3DJEA 3EF6A 3DGHA 4GAPA 3P4SA 1VQWA 2W0HA 4UDQA 1TRBA 1SEZA 1ZKQA 3ATQA 3DK8A 2YG3A 2YLTA 4GAVA 2XDOA 3F8RA 1GRTA 3AE8A 4U8IA 3V3NA 4EMJA 1D7LA 1E1NA 2RGOA 3UTFA 2XFOA 3NYCA 4IV9A 4MJWA 1CC2A 5CKUA 1CJ4A 2BCGG 4C3YA 5JCNA 3GDNA 4IA5A 4TLZA 4EMWA 4USQA 4NTDA 4CNJA 2PHHA 3NK2X 2IIDA 3NN6X 3PVCA 3ISHA 4U8PA 4H4QA 2VQBA 3AE4A 3GYIA 1S3EA 2YR6A 1IUUA 3SM8A 3II4A 1JRZA 2C66A 2Q6UA 3B3RA 3HYVA 4I58A 4U2TA 4NZHA 3ZYXA 4CRTA 4JQ9A 4AOXA 5JCIA 3CPHG 2R4JA 2F5ZA 3CTYA 5HHFA 2WPFA 3NLCA 1GTEA 1GNDA 1NHRA 3NYFA 1ZK7A 2VZ2A 2O9ZA 4B69A 2XYOA 2J3NA 3AE7A 2GQWA 1QLBA 3GRSA 3NTAA 4H2QA 4A9WA 1KN0A 4H4WA 3PS9A 2VOUA 5JRBA 5JCMA 2XVHA 3ITJA 1OJTA 3VR9A 4B68A 3GMCA 4YTPA 2V3AA 4EQSA 2Z5YA 3UTEA 1CBOA 2YR4A 3AEDA 4U8LA 2V60A 3UCLA 2XFUA 2ARDA 1MO9A 1ZMDA 3EAOA 2OLOA 4TM1A 4USRA 1XPQA 3UKFA 1GV4A 2JB2A 2C70A 2WPCA 1E7PA 1P2HA 2AAQA 2GR2A 2X8CA 2ZZ0A 4ZCDA 3NGCX 1BGNA 1KSSA 4WCTA 2YLXA 1F6MA 4JDRA 3CNDA 4G9KA 1CHUA 4NEVA 4U2LA 5BUKA 1BKWA 3DJJA 2JB3A 2GR1A 2YLRA 1H86A 3M0OA 1JRXA 3T0KA 3T2ZA 2WU5A 3UOVA 1VG9A 4Z2TA 3NK0X 2GQFA 3DJDA 2V6OA 3AYJA 1IJHA 1X31B 4Y4LA 2C72A 3LXDA 4A6NB 4J2WA 1HYUA 1GRAA 3RNMA 1S2QA 4BURA 4YSXA 2A89A 4O5QA 3EANA 3UKPA 2R4EA 4BK2A 5EBKA 2XFQA 4AT0A 5HXIA 4Y4NA 3KU9A 1MXTA 2E5VA 1ZX9A 2C65A 2BC0A 4RG3A 4B64A 3RP8A 3LADA 1CJCA 1Y56A 5IQ4A 1FEAA 3FMWA 2TPRA 3AXBA 1GRFA 2BYBA 4Y4MA 4AOSA 3RHAA 2A8XA 3AE6A 2BC1A 1F8SA 1P2EA 3VRAA 4J57A 4C74A 3V76A 5C2TA 1EL7A 4M52A 5EB5A 5EB4A 4YTNA 3IC9A 3FIMB 3I3LA 2JK6A 1FL2A 3UTHA 3L5OA 2I0ZA 5GSNA 3K7QX 5KOXA 1BGJA 2R0GA 4G73A 3CGEA 2XLSA 3KKJA 4II3A 1B37A 3GDPA 1TDFA 4P9SA 2R0CA 3AD8B 5FS9A 4H4TA 5KVHA 3GWFA 5HYMA 3UP4A 4TM3A 2WETA 2RGJA 1LV0A 3G5QA 3K7TA 3ZDNA 3QVRA 3CNPA 3V3OA 2GVCA 2EQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4P A;  2XFP A;  5U63 A;  4CY6 A;  3UKQ A;  1K4Q A;  4ZN0 A;  4EQX A;  1IUS A;  1NG3 A;  3CN8 A;  1S2Y A;  5HY5 A;  1LTX R;  2H88 A;  4AP1 A;  3LZW A;  4EIP A;  5DBJ A;  2C75 A;  4A99 A;  1NAA A;  1ZOY A;  2ZZB A;  3L1R A;  1YQZ A;  4Z44 A;  1RSG A;  1IUT A;  3CPJ G;  1ZP0 A;  3F8P A;  4C77 A;  2BK4 A;  1H6V A;  2V5Z A;  4JNQ A;  1DOC A;  2PYX A;  3OZ2 A;  3LZX A;  5KRQ A;  2VRM A;  1JU2 A;  3D1C A;  4FK1 C;  3UOZ A;  4BK3 A;  4AT2 A;  2CFY A;  4ADW A;  1K0L A;  1PXA A;  2Q7V A;  2QA1 A;  2APG A;  4LU6 A;  3K7M X;  3Q9T A;  2GRT A;  2FJD A;  2UZZ A;  3KLJ A;  5IPY A;  3ICS A;  3AEF A;  4REK A;  3G5S A;  2TMD A;  3CGB A;  3I6D A;  2XLU A;  4UDP A;  2EQ9 A;  1TYP A;  2C64 A;  2BS2 A;  4H4R A;  1B5Q A;  2X99 A;  1GRG A;  1W4X A;  4TM0 A;  1REO A;  1JOA A;  3NNE A;  3GYJ A;  1NG4 A;  4K7Z A;  1O5W A;  3CNT A;  3LB8 A;  3CGD A;  4GRT A;  3BI4 A;  4B65 A;  4EIQ A;  1N1P A;  3C4A A;  4GDP A;  3QSM A;  4HB9 A;  4OPL A;  5TR3 A;  1O95 A;  1XHC A;  3WE0 A;  2WS3 A;  4YSY A;  3E1T A;  1YQ3 A;  2CUL A;  2ACZ A;  4KPR A;  2C76 A;  1CC4 A;  1DOD A;  4EM3 A;  1EBD A;  4Z24 A;  4H4Y A;  4TLX A;  1ZDL A;  3NYE A;  4A5L A;  2X8G A;  4UP3 A;  1EL8 A;  3T37 A;  3VR8 A;  4Z25 A;  3ALJ A;  2XVI A;  3KPF A;  4B67 A;  4OVI A;  1L9C A;  4A79 A;  1F3P A;  3ATR A;  3CNJ A;  3G5R A;  3D8X A;  4YXD A;  2YAU A;  1GER A;  2H89 A;  2JB1 A;  1PDH A;  1VRQ B;  4OPC A;  2WEU A;  3IHG A;  5J60 A;  4FDC B;  3IF9 A;  3UKK A;  1BWC A;  3QSS A;  1JNZ A;  1GTH A;  3AE9 A;  2C3C A;  2FJB A;  3UP5 A;  4K22 A;  5JCL A;  1L9D A;  4HA6 A;  3VRB A;  1L9E A;  2YM1 A;  4B66 A;  2B9W A;  1FCD A;  2WHD A;  3ADA B;  4U8K A;  1CF3 A;  2X50 A;  2X8H A;  1H7X A;  3AB1 A;  2OAL A;  1PBC A;  4ECH A;  4H4V A;  3SQP A;  2BA9 A;  2WBA A;  1JNR A;  2VVL G;  3M12 A;  5CQF A;  1D4E A;  1V59 A;  3UKH A;  4IVM B;  1LJ1 A;  5GRT A;  4U2S A;  3AD9 B;  1GPE A;  2WP5 A;  1Y0P A;  2B7R A;  3C4N A;  1N4V A;  2WOW A;  2YVF A;  4KX6 A;  4BK1 A;  4K5S A;  1CJ2 A;  2OLN A;  1LQT A;  4D03 A;  2GH5 A;  1XAN A;  3DK4 A;  3QJ4 A;  4FK1 A;  4LII A;  3SGL A;  5BRT A;  2VRL A;  4DSG A;  2GF3 A;  4GCM A;  4U8N A;  3COX A;  3SFE A;  2GR0 A;  1NEK A;  3O0H A;  1D7Y A;  2X3N A;  2XLP A;  4H2P A;  1IUV A;  3AD7 B;  3NH3 X;  2OAM A;  1TDO A;  1VG0 A;  2YVJ A;  1PBF A;  2WP9 A;  3NT6 A;  3VQR A;  1O94 A;  1YQ4 A;  2BK5 A;  4PAB A;  4BJZ A;  1NHP A;  1YKJ A;  4CY8 A;  1FOH A;  5ER0 A;  3QFB A;  2CVJ A;  4YKG A;  1PJ5 A;  3GMB A;  3AE3 A;  3CGC A;  1NPX A;  1QO8 A;  2GB0 A;  3BHF A;  2YG6 A;  3DA1 A;  1PHH A;  2YLW A;  3IWA A;  5FMH A;  3P4Q A;  2OA1 A;  2YVG A;  1TDN A;  4GDE A;  1QJD A;  3AE2 A;  4Z43 A;  4H4U A;  4O5U A;  3VRD B;  2WDQ A;  5IQ1 A;  4IA6 A;  5U1O A;  4CNK A;  1PBE A;  2VQ7 A;  1NHS A;  1E1M A;  1TDE A;  2QCU A;  2WU2 A;  2IVE A;  1GXF A;  4YKF A;  1M64 A;  4DGK A;  4Z2U A;  2R46 A;  2R0P A;  3NKS A;  2XLT A;  2C7G A;  2WES A;  1H81 A;  3AE5 A;  1TYT A;  1GES A;  2WQY A;  1IUW A;  4H4P A;  2GEW A;  3CIR A;  2YG4 A;  4H7U A;  3AEG A;  4B63 A;  4WX1 A;  1BF3 A;  4Z2R A;  4EQR A;  5L46 A;  3QFA A;  4AP3 A;  4BV6 A;  3C96 A;  2BAB A;  3QSE A;  1GRB A;  2RAB A;  3P4R A;  4N9X A;  1Q1R A;  1COY A;  1RYI A;  2FJE A;  4K8D A;  3ABV A;  1H83 A;  3AEC A;  1XDI A;  3FG2 P;  3ICT A;  2BXR A;  2C3D A;  4H4Z A;  1FEC A;  3K30 A;  3NG7 X;  4J31 A;  2QAE A;  5EOW A;  3FPZ A;  5KXJ A;  1DXL A;  2YWL A;  2BS4 A;  3R9U A;  3P9U A;  1H82 A;  2DKH A;  1OJC A;  2Y6Q A;  4PAA A;  3CNS A;  3M13 A;  3BHK A;  2R45 A;  4CCQ A;  1ZY8 A;  2E4G A;  1LQU A;  2NPX A;  5FS7 A;  2JKC A;  3B6D A;  1L0V A;  3H8L A;  1Y56 B;  4GR1 A;  4J36 A;  4JNA A;  2FBW A;  4K2X A;  2GMJ A;  3S5W A;  4EMI A;  1GET A;  2BCP A;  1JRY A;  2BXS A;  1PJ6 A;  1N4W A;  2DKI A;  4EQW A;  3S61 A;  2B9X A;  3DGZ A;  1PXB A;  1EL5 A;  2YLZ A;  5KVI A;  4JN9 A;  4X9M A;  3RED A;  2EQ6 A;  5FS8 A;  2YG5 A;  3AYL A;  4B1B A;  4H2N A;  1LVL A;  1CC6 A;  2XLR A;  1K0J A;  2E1M A;  3AWI A;  2JBV A;  1KNP A;  3AEB A;  4H2R A;  4JY2 A;  1F8R A;  2XFN A;  1E39 A;  1GT8 A;  4A6N A;  2BAC A;  4YSZ A;  1Q9I A;  1ZOV A;  4I59 A;  4OPG A;  1BZL A;  2GAH B;  1KDG A;  4OPD A;  4TM4 A;  4IVO B;  3DME A;  3LOV A;  4J34 A;  3BI2 A;  4NEW A;  2Q0L A;  5BUL A;  1GRH A;  1MOK A;  2QA2 A;  1DNC A;  5J7X A;  3OC4 A;  2A87 A;  2V61 A;  3NRN A;  1H7W A;  3GWD A;  4A65 A;  4A7A A;  4EM4 A;  4RSL A;  4YWO A;  1D5T A;  1DOB A;  1E1K A;  1KSU A;  3NIX A;  3BNM A;  1GSN A;  3SFD A;  4YTM A;  1TDK A;  1D4D A;  1KNR A;  1M6I A;  4U8O A;  4BJY A;  2NVK X;  2WDR A;  3F8D A;  5KWF A;  2V3B A;  4H4X A;  5BVA A;  3Q6J A;  3IHM A;  4D04 A;  1RP0 A;  2ZZC A;  1H84 A;  1FEB A;  3NN0 X;  3P1W A;  1PBD A;  4ICY A;  2WDV A;  4J56 A;  1DJN A;  3UTG A;  2WP6 A;  4X4J A;  5JCK A;  3AEA A;  1PXC A;  1GEU A;  4NTE A;  2Y6R A;  1IUX A;  1D4C A;  4OPI A;  2B9Y A;  3ICR A;  1PBB A;  2RGH A;  1OJD A;  4H4S A;  2GMH A;  2AR8 A;  2B76 A;  1OJA A;  5C3J A;  4YT0 A;  4OPT A;  1DOE A;  3QVP A;  5M0Z A;  3BNU A;  2YG7 A;  3BI5 A;  2XCG A;  4CBQ A;  1YY5 A;  1GAL A;  3RP7 A;  1NHQ A;  2XVF A;  4NTC A;  3FBS A;  4APN A;  3KVE A;  3UOX A;  3NHO X;  1E1L A;  2JAE A;  1AOG A;  2XVE A;  4C5O A;  1NDA A;  4GF7 A;  1B8S A;  3PO7 A;  3LJP A;  4K5R A;  2C73 A;  3RP6 A;  2XVJ A;  1OJ9 A;  1UKV G;  4FX9 A;  1ZMC A;  1B4V A;  2ZBW A;  3NK1 X;  3EPT A;  4J33 A;  2FJA A;  2HQM A;  2AQJ A;  2WOI A;  1EL9 A;  3KA7 A;  2VVL A;  1F8W A;  1N4U A;  1NEN A;  1PN0 A;  2GV8 A;  1KF6 A;  4U8J A;  1CJ3 A;  3GD3 A;  1K0I A;  3CPI G;  3NTD A;  2B7S A;  1ELI A;  2YR5 A;  1GRE A;  4DNA A;  3ALL A;  4OPU A;  4X9N A;  5LV9 A;  3KD9 A;  1PJ7 A;  2VVM A;  4RG4 A;  2IVD A;  3UKA A;  2YM2 A;  4JY3 A;  5U25 A;  2BS3 A;  4OCG A;  5FS6 A;  3DK9 A;  2YLS A;  5M10 A;  1CL0 A;  3H8I A;  3DH9 A;  3ALM A;  1GOS A;  3HZL A;  2WOV A;  3GSI A;  3L8K A;  1LPF A;  5KOW A;  3H4K A;  4CCR A;  4E0V A;  2C67 A;  1Q1W A;  1JEH A;  1Z6L A;  2CDU A;  3GRT A;  4XWR A;  3AYI A;  4XWZ A;  4GUV A;  2WPE A;  3UKL A;  1ONF A;  4H50 A;  4UDR A;  2Z5X A;  3AE1 A;  1E6E A;  4Z26 A;  3GD4 A;  1DJQ A;  3JSK A;  1KFY A;  4DSH A;  3AEE A;  2GR3 A;  2BK3 A;  3URH A;  4XXG A;  3DJG X;  3UOY A;  4YSH A;  4LA1 A;  1S3B A;  1PS9 A;  4C3X A;  2GAG B;  2EQ7 A;  4ZCC A;  2Q0K A;  2YQU A;  2R9Z A;  1VDC A;  4U8M A;  3DJE A;  3EF6 A;  3DGH A;  3P4S A;  1VQW A;  2W0H A;  4UDQ A;  1TRB A;  1SEZ A;  1ZKQ A;  3ATQ A;  3DK8 A;  2YG3 A;  2YLT A;  2XDO A;  3F8R A;  1GRT A;  3AE8 A;  4U8I A;  3V3N A;  4EMJ A;  1D7L A;  1E1N A;  2RGO A;  3UTF A;  2XFO A;  3NYC A;  4IV9 A;  4MJW A;  1CC2 A;  5CKU A;  1CJ4 A;  2BCG G;  4C3Y A;  5JCN A;  3GDN A;  4IA5 A;  4TLZ A;  4EMW A;  4USQ A;  4NTD A;  4CNJ A;  2PHH A;  3NK2 X;  2IID A;  3NN6 X;  3PVC A;  3ISH A;  4U8P A;  4H4Q A;  2VQB A;  3AE4 A;  3GYI A;  1S3E A;  2YR6 A;  1IUU A;  3SM8 A;  3II4 A;  1JRZ A;  2C66 A;  2Q6U A;  3B3R A;  4I58 A;  4U2T A;  3ZYX A;  4NZH A;  4CRT A;  4JQ9 A;  4AOX A;  5JCI A;  3CPH G;  2R4J A;  2F5Z A;  3CTY A;  5HHF A;  2WPF A;  3NLC A;  1GTE A;  1GND A;  1NHR A;  3NYF A;  1ZK7 A;  2VZ2 A;  2O9Z A;  4B69 A;  2XYO A;  2J3N A;  3AE7 A;  2GQW A;  1QLB A;  3GRS A;  3NTA A;  4H2Q A;  4A9W A;  4H4W A;  3PS9 A;  2VOU A;  2XVH A;  5JCM A;  3ITJ A;  3VR9 A;  1OJT A;  4B68 A;  4YTP A;  3GMC A;  2V3A A;  4EQS A;  2Z5Y A;  3UTE A;  1CBO A;  2YR4 A;  3AED A;  4U8L A;  2V60 A;  3UCL A;  2XFU A;  2ARD A;  1MO9 A;  1ZMD A;  3EAO A;  2OLO A;  4TM1 A;  4USR A;  1XPQ A;  3UKF A;  1GV4 A;  2JB2 A;  2C70 A;  2WPC A;  1E7P A;  1P2H A;  2GR2 A;  2AAQ A;  2X8C A;  2ZZ0 A;  4ZCD A;  3NGC X;  1BGN A;  1KSS A;  4WCT A;  2YLX A;  1F6M A;  4JDR A;  3CND A;  4U2L A;  1CHU A;  4NEV A;  5BUK A;  1BKW A;  3DJJ A;  2JB3 A;  2GR1 A;  2YLR A;  1H86 A;  3M0O A;  1JRX A;  3UOV A;  2WU5 A;  1VG9 A;  4Z2T A;  3NK0 X;  2GQF A;  3DJD A;  2V6O A;  3AYJ A;  1IJH A;  1X31 B;  4Y4L A;  2C72 A;  3LXD A;  4A6N B;  4J2W A;  1HYU A;  1GRA A;  3RNM A;  1S2Q A;  4BUR A;  4YSX A;  2A89 A;  4O5Q A;  3EAN A;  3UKP A;  2R4E A;  4BK2 A;  5EBK A;  2XFQ A;  4AT0 A;  5HXI A;  4Y4N A;  3KU9 A;  1MXT A;  2E5V A;  1ZX9 A;  2C65 A;  2BC0 A;  4RG3 A;  4B64 A;  3RP8 A;  3LAD A;  1CJC A;  1Y56 A;  5IQ4 A;  1FEA A;  3FMW A;  2TPR A;  3AXB A;  1GRF A;  2BYB A;  4Y4M A;  4AOS A;  3RHA A;  2A8X A;  3AE6 A;  2BC1 A;  1F8S A;  1P2E A;  3VRA A;  4J57 A;  4C74 A;  3V76 A;  5C2T A;  1EL7 A;  4M52 A;  5EB5 A;  5EB4 A;  4YTN A;  3IC9 A;  3FIM B;  3I3L A;  2JK6 A;  1FL2 A;  3UTH A;  2I0Z A;  5GSN A;  3K7Q X;  5KOX A;  1BGJ A;  2R0G A;  3CGE A;  2XLS A;  3KKJ A;  1B37 A;  3GDP A;  1TDF A;  4P9S A;  2R0C A;  3AD8 B;  5FS9 A;  4H4T A;  5KVH A;  3GWF A;  5HYM A;  3UP4 A;  4TM3 A;  2WET A;  2RGJ A;  1LV0 A;  3G5Q A;  3K7T A;  3ZDN A;  3QVR A;  3CNP A;  3V3O A;  2GVC A;  2EQ8 A; 
#chains in the Genus database with same CATH topology
 4G6H A;  3NVW B;  1LTX R;  3DG7 A;  3TW9 A;  2H88 A;  4AP1 A;  1VDV A;  2ZZB A;  3L1R A;  3I6E A;  5G5H B;  3F8P A;  2BK4 A;  1DOC A;  3HYX A;  2VRM A;  1JU2 A;  2P8B A;  3OPS A;  3UGV A;  2CFY A;  2QA1 A;  2Q7V A;  1EC7 A;  4G6G A;  3K7M X;  2GRT A;  3T9P A;  2CHR A;  3D9X A;  3VC6 A;  1TKK A;  3CGB A;  3I6D A;  2GDQ A;  2EQ9 A;  1TYP A;  2C64 A;  2X99 A;  4TM0 A;  1REO A;  1STZ A;  3GYJ A;  4K7Z A;  1IYX A;  3TTE A;  1SJD A;  3BI4 A;  1R6W A;  4GDP A;  4OPL A;  2WS3 A;  3E1T A;  1YQ3 A;  2CUL A;  4EM3 A;  4Z24 A;  4H4Y A;  2X8G A;  4OVI A;  3G5R A;  2YAU A;  1VRQ B;  3IHG A;  4FDC B;  3UKK A;  3QSS A;  3AE9 A;  2FJB A;  5JCL A;  2PSN A;  2WHD A;  4H4V A;  3SQP A;  2VVL G;  1D4E A;  4IVM B;  3SQS A;  2PS2 A;  4HCL A;  3FJ4 A;  2WP5 A;  2YVF A;  4BK1 A;  1CJ2 A;  3QKE A;  2OLN A;  3UJS A;  4LII A;  3SGL A;  2VRL A;  4DSG A;  2ONE A;  3SFE A;  3VDG A;  2GR0 A;  4DXK A;  2XLP A;  1IUV A;  4ENL A;  3NH3 X;  1VG0 A;  2WP9 A;  4HPN A;  3QFB A;  2CVJ A;  3NO1 A;  3AE3 A;  1QO8 A;  3BHF A;  2YG6 A;  3P4Q A;  5FMH A;  4GDE A;  3DES A;  1PBE A;  3P0W A;  1GXF A;  4Z2U A;  3NKS A;  1IUW A;  1R0M A;  1RYI A;  3IJQ A;  3FG2 P;  5KXJ A;  1FO4 A;  3K30 A;  1DXL A;  4X2P A;  2YWL A;  3UJE A;  2DKH A;  2Y6Q A;  3T8Q A;  4PAA A;  3M13 A;  4YWS A;  3H8L A;  4GR1 A;  5KNL A;  3S5W A;  4EMI A;  2BCP A;  1H2I A;  1PJ6 A;  3SXI A;  2EQ6 A;  3ZVH A;  1CC6 A;  3AWI A;  2JBV A;  2XFN A;  4A6N A;  1GT8 A;  4YSZ A;  1ZOV A;  2OLA A;  2GAH B;  3TWB A;  2GGE A;  3A7A A;  3BI2 A;  2Q0L A;  1T3Q C;  2V61 A;  4YWO A;  1DOB A;  3BNM A;  3SFD A;  2HZG A;  1D4D A;  3CYJ A;  3NS1 B;  3CB3 A;  3BOX A;  3PWG A;  4ICY A;  3UTG A;  4X4J A;  3FYY A;  3UXK A;  1D4C A;  3H8A A;  3N4F A;  1VQZ A;  2B9Y A;  3ICR A;  2RGH A;  3GYX A;  2PU1 A;  1JCT A;  3JZU A;  2B76 A;  4YT0 A;  3NVZ B;  2XCG A;  1YY5 A;  1NHQ A;  2XVF A;  4APN A;  3T2Y A;  2JAE A;  4M0X A;  3LJP A;  2HXT A;  2C73 A;  3R11 A;  3SZW A;  2ZBW A;  4J33 A;  4GIS A;  2GV8 A;  4KPL A;  3DGB A;  1N61 C;  3KD9 A;  2VVM A;  5FJO A;  1S7M A;  5U25 A;  1EBG A;  2QJJ A;  5M10 A;  1CL0 A;  3H8I A;  3DH9 A;  1RM6 B;  2WOV A;  1FFU C;  4E0V A;  2C67 A;  2OPJ A;  2CDU A;  3AYI A;  1ONE A;  4GUV A;  1YEY A;  4Z26 A;  4H1Z A;  2GR3 A;  7ENL A;  3URH A;  4YSH A;  4C3X A;  3R1Z A;  3KUM A;  2Q0K A;  1N60 C;  4GYP A;  3OP2 A;  2W0H A;  2YG3 A;  3F8R A;  3V3N A;  3UTF A;  1V97 A;  3NYC A;  4IV9 A;  3OZM A;  5JCN A;  4TLZ A;  4EMW A;  4CNJ A;  1EC8 A;  2IID A;  3DDM A;  3ISH A;  4U8P A;  3AE4 A;  5FJP A;  1S3E A;  1JRZ A;  2Q6U A;  3ZLF A;  4CRT A;  4AOX A;  3RIT A;  3OW1 A;  3NRZ B;  1WUF A;  2ZC8 A;  4J3Z A;  1ZK7 A;  4B69 A;  3AE7 A;  2XYO A;  2J3N A;  3GRS A;  4H4W A;  3VR9 A;  5JRB A;  1CBO A;  3SSZ A;  1XS2 A;  2XFU A;  4TM1 A;  3UKF A;  6ENL A;  1E7P A;  1P2H A;  2AAQ A;  2GR2 A;  4U2L A;  3DJJ A;  1FHV A;  2GQF A;  2V6O A;  3AM9 A;  4K2S A;  2AKM A;  3THU A;  4KWS A;  4A6N B;  1S2Q A;  2E5V A;  4B64 A;  1Y56 A;  4GFI A;  3RHA A;  2A8X A;  1P2E A;  3VRA A;  4C74 A;  5EB5 A;  4YTN A;  3IC9 A;  3I3L A;  3UTH A;  2I0Z A;  3K7Q X;  3JVA A;  4II3 A;  2QDD A;  3K7T A;  3QVR A;  2EQ8 A;  4ZN0 A;  3P3B A;  3CN8 A;  1S2Y A;  3DIP A;  4EIP A;  2C75 A;  2I5Q A;  1NAA A;  1RSG A;  1IUT A;  3ES7 A;  5KMP A;  1H6V A;  2V5Z A;  3RGT A;  3QLD A;  2PYX A;  2HNE A;  1P43 A;  4FP1 A;  3Q9T A;  2FJD A;  3CK5 A;  3KLJ A;  3ICS A;  3G5S A;  2TMD A;  4UDP A;  2GGH A;  2BS2 A;  1B5Q A;  1ZXI C;  3NNE A;  3NVY B;  4DHG A;  3AN1 A;  1N5W C;  1O5W A;  1EBH A;  3CGD A;  1X2G A;  4B65 A;  1N1P A;  4HB9 A;  3R25 A;  4YSY A;  4A3R A;  2POZ A;  5FJR A;  3QPE A;  1NU5 A;  4F4R A;  3TOY A;  1L9C A;  1W6T A;  3ATR A;  3T2K A;  2H89 A;  2JB1 A;  1SJA A;  4IL2 A;  1GTH A;  3UP5 A;  1L9D A;  4HA6 A;  1FCD A;  3ADA B;  4U8K A;  3PFR A;  2OAL A;  5CQF A;  1V59 A;  1LJ1 A;  4U2S A;  1Y0P A;  3ETR B;  1N4V A;  1ECQ A;  4K5S A;  2DW7 A;  2GH5 A;  1XAN A;  4IHC A;  2X3N A;  3SN0 A;  4H2P A;  1N63 C;  2YVJ A;  1PBF A;  3UJR A;  2AKZ A;  4JN8 A;  4PAB A;  3BJS A;  4A35 A;  1YQ4 A;  3NXL A;  1FOH A;  2MUC A;  4YKG A;  1PJ5 A;  2GGI A;  3IWA A;  2OA1 A;  1TDN A;  2GGJ A;  4IA6 A;  2MNR A;  1E1M A;  2WU2 A;  3DG3 A;  1N5X A;  2R46 A;  2R0P A;  1H81 A;  1GES A;  2WQY A;  4H4P A;  2GEW A;  3MY9 A;  3CIR A;  1BF3 A;  4EQR A;  5L46 A;  4BV6 A;  2BAB A;  2RAB A;  3P4R A;  4N9X A;  1COY A;  3ABV A;  1PDZ A;  3NVV B;  4H4Z A;  1FEC A;  4J31 A;  2QAE A;  3FPZ A;  2BS4 A;  2OQH A;  3BHK A;  1Y56 B;  4J36 A;  3B97 A;  2GMJ A;  1MRA A;  1N4W A;  2DKI A;  3PWI A;  2GL5 A;  4E4U A;  4JN9 A;  3RED A;  3AYL A;  4B1B A;  4H2N A;  3SJN A;  2BAC A;  4OPG A;  1BZL A;  4IVO B;  3SBF A;  2ZAD A;  2OQY A;  1DNC A;  2OZ3 A;  3OC4 A;  3CMM A;  4A65 A;  3A7U A;  4EM4 A;  1N62 C;  1JPD X;  1GSN A;  1JRO A;  2PP1 A;  2NVK X;  5KWF A;  2V3B A;  4H4X A;  3IHM A;  1RP0 A;  3FV9 A;  4NTE A;  1IUX A;  2RDX A;  3FCP A;  4H4S A;  3TCS A;  1DOE A;  3QVP A;  4ZOH B;  3BNU A;  3BI5 A;  4CBQ A;  4NTC A;  3KVE A;  3VFC A;  2PU0 A;  4GF7 A;  1B8S A;  3PO7 A;  3RP6 A;  1OJ9 A;  1UKV G;  3DFY A;  1SJB A;  3NK1 X;  2FJA A;  2HQM A;  4FI4 A;  2OO6 A;  4G8T A;  1EL9 A;  1F8W A;  1N4U A;  1KF6 A;  3T31 A;  1K0I A;  3KPK A;  3A7R A;  4IP5 A;  3ALL A;  4X9N A;  5LV9 A;  4G7F A;  2IVD A;  3BSM A;  2QQ6 A;  2XH7 A;  2YM2 A;  4JY3 A;  2BS3 A;  1TE6 A;  1GOS A;  3GSI A;  5KOW A;  3H4K A;  4CCR A;  3SR6 B;  1Q1W A;  3MQT A;  1Z6L A;  4XWR A;  1ONF A;  2Z5X A;  3AE1 A;  1KFY A;  3AEE A;  4XXG A;  4LA1 A;  1PS9 A;  4ZCC A;  2R9Z A;  4U8M A;  2PPG A;  3DJE A;  4GAP A;  2E5A A;  3EKG A;  4UDQ A;  2YLT A;  4U8I A;  3AE8 A;  2RGO A;  1CC2 A;  5CKU A;  4IA5 A;  3NN6 X;  2XH4 A;  4H4Q A;  2VQB A;  2YR6 A;  3II4 A;  4U2T A;  4E4F A;  4I58 A;  2W3R A;  4NZH A;  5JCI A;  3CPH G;  2R4J A;  3CTY A;  5HHF A;  2WPF A;  3HPF A;  3NLC A;  1GTE A;  1NHR A;  2VZ2 A;  2O9Z A;  4A9W A;  2GQW A;  5G5G B;  4E6M A;  3RRA A;  4B68 A;  2OKT A;  3MSY A;  3SN4 A;  1SB3 B;  2AL1 A;  3H12 A;  3CXB A;  2ARD A;  1MO9 A;  2OLO A;  4USR A;  4M6U A;  1GV4 A;  2WPC A;  2X8C A;  4ZCD A;  1KSS A;  3CND A;  4G9K A;  1CHU A;  4NEV A;  1JRP A;  3Q4D A;  2YLR A;  4H19 A;  3M0O A;  3UOV A;  5J04 A;  2WU5 A;  2XH0 A;  3DJD A;  3CT2 A;  3AYJ A;  1X31 B;  3PK7 A;  2XSX A;  1PDY A;  3LXD A;  3D46 A;  1HYU A;  1GRA A;  3RNM A;  2A89 A;  3UKP A;  3KU9 A;  1MXT A;  2C65 A;  4RG3 A;  5IQ4 A;  1FEA A;  4Y4M A;  3AXB A;  1GRF A;  2BC1 A;  1F8S A;  3V76 A;  5C2T A;  3FIM B;  2JK6 A;  4DN1 A;  2XGZ A;  5GSN A;  2R0G A;  4G73 A;  3GDP A;  4P9S A;  3TWA A;  1BKH A;  3GWF A;  5FS9 A;  5HYM A;  2WET A;  2RGJ A;  3ZDN A;  3CNP A;  2GVC A;  3P4P A;  2XFP A;  5U63 A;  1IUS A;  1NG3 A;  5HY5 A;  2QVH A;  1L8P A;  4A99 A;  1ZOY A;  3EUB 3;  4Z44 A;  5KRQ A;  1XPY A;  3D1C A;  4FK1 C;  2APG A;  5IPY A;  3I6T A;  2OFJ A;  4H4R A;  1GRG A;  3DFH A;  1FIQ B;  3FVD A;  4TVY A;  1NG4 A;  2DW6 A;  4EIQ A;  3C4A A;  3QSM A;  5TR3 A;  1XHC A;  1FHU A;  4H2H A;  4EWJ A;  1CC4 A;  1DOD A;  1EBD A;  3RO6 A;  5IDZ A;  3SZ0 A;  3NYE A;  4Z25 A;  1EL8 A;  4KT2 A;  2C4C A;  3ALJ A;  3KPF A;  4A79 A;  3EEZ A;  4YXD A;  2WEU A;  5J60 A;  4GGH A;  1L9E A;  4DX3 A;  1CF3 A;  2X50 A;  2X8H A;  3AB1 A;  3U9I A;  4GIR A;  4ECH A;  2WBA A;  3M12 A;  3UKH A;  1SJC A;  5GRT A;  1WUE A;  3AD9 B;  1GPE A;  4GYP C;  2B7R A;  3C4N A;  4Z1Y A;  2PMQ A;  2WOW A;  4KX6 A;  2OZT A;  1LQT A;  3DK4 A;  5BRT A;  3HYW A;  2PP3 A;  1NEK A;  3O0H A;  1D7Y A;  3JW7 A;  3AD7 B;  2BRA A;  3NT6 A;  3VQR A;  1O94 A;  1NHP A;  3D47 A;  1TZZ A;  1YKJ A;  4CY8 A;  3GMB A;  2GB0 A;  3DA1 A;  2YLW A;  2PTW A;  2YVG A;  3Q45 A;  3AE2 A;  3IJL A;  3CAW A;  4O5U A;  3VRD B;  5IQ1 A;  5U1O A;  1NHS A;  4YKF A;  1M64 A;  4DGK A;  2C7G A;  1TYT A;  4H7U A;  3C96 A;  3TJI A;  3QSE A;  2QJN A;  2FJE A;  3UJF A;  1XDI A;  3SX6 A;  3FXG A;  4HNC A;  3ZVI A;  5ENL A;  1H82 A;  5KMS A;  5FS7 A;  4JNA A;  2FBW A;  4K2X A;  3S47 A;  3CXO A;  4KEM A;  3NZG A;  1GET A;  4HN8 A;  2BXS A;  2P3Z A;  3S61 A;  4EQW A;  4DWD A;  1PXB A;  1EL5 A;  2YLZ A;  5KVI A;  4X9M A;  2YG5 A;  3UJ2 A;  4J1O A;  1LVL A;  2XLR A;  1K0J A;  3VA8 A;  4H2R A;  4JY2 A;  4ZA0 A;  1E39 A;  1Q9I A;  4I59 A;  3LOV A;  5BUL A;  3ENL A;  1MOK A;  3R0K A;  4E8G A;  4RSL A;  1E1K A;  1KSU A;  2QGY A;  4YTM A;  1TDK A;  1M6I A;  4U8O A;  2GSH A;  2WDR A;  3Q6J A;  4D04 A;  1H84 A;  1FEB A;  1PBD A;  2WP6 A;  1GEU A;  2Y6R A;  3ZLH A;  1OJA A;  2OZ8 A;  5C3J A;  3SZF A;  4OPT A;  2YG7 A;  3RR1 A;  2POD A;  3FBS A;  1E1L A;  2XVE A;  4HYR A;  4K5R A;  2BRY A;  2XVJ A;  2P0I A;  3QTP A;  5EU9 A;  4GME A;  4FX9 A;  1ZMC A;  4JN7 A;  2AQJ A;  2WOI A;  1MNS A;  1NEN A;  1E9I A;  3GD3 A;  3CPI G;  3NTD A;  1ELI A;  4DNA A;  1MDL A;  4OPU A;  4RG4 A;  3UKA A;  4OCG A;  2FKP A;  3V3W A;  2YLS A;  3OTR A;  3L8K A;  1LPF A;  3GRT A;  3R0U A;  4XWZ A;  3MKC A;  2WPE A;  4IP4 A;  4H50 A;  2GGG A;  4DSH A;  3JSK A;  2BK3 A;  3DJG X;  1S3B A;  3T4W A;  2EQ7 A;  4JHM A;  2PTY A;  2YQU A;  3DGH A;  3P4S A;  1TRB A;  1SEZ A;  1ZKQ A;  3ATQ A;  2O56 A;  3GD6 A;  4EMJ A;  1D7L A;  1E1N A;  3VC5 A;  2W54 A;  1CJ4 A;  2BCG G;  4C3Y A;  3GDN A;  2PHH A;  3PVC A;  1IUU A;  3SM8 A;  3IJI A;  3HYV A;  4MKS A;  2OVL A;  1JPM A;  3NYF A;  2QJM A;  2W3S A;  4H2Q A;  3NTA A;  3I4K A;  1QLB A;  1KN0 A;  2VOU A;  2XVH A;  4YTP A;  3ITJ A;  1OJT A;  2V3A A;  3UTE A;  4DYE A;  2YR4 A;  4U8L A;  3UCL A;  1ZMD A;  3EAO A;  1XPQ A;  2JB2 A;  5FJU A;  2OG9 A;  3NGC X;  1BGN A;  4WCT A;  1F6M A;  3HW2 A;  2PP0 A;  3T0K A;  2GR1 A;  1H86 A;  4Z2T A;  3NK0 X;  2P8C A;  2PTZ A;  1IJH A;  3R07 C;  4J2W A;  4MMW A;  1KD0 A;  3EAN A;  2R4E A;  4BK2 A;  2XFQ A;  4Y4N A;  3TJ4 A;  2BC0 A;  3RP8 A;  3LAD A;  3FMW A;  2BYB A;  3AE6 A;  4J57 A;  1RVK A;  4M52 A;  1FL2 A;  3H7V A;  5KOX A;  1BGJ A;  2XLS A;  3KKJ A;  1B37 A;  1TDF A;  2R0C A;  4H4T A;  1DTN A;  4TM3 A;  3DG6 A;  3V3O A;  4CY6 A;  3UKQ A;  1K4Q A;  4EQX A;  3LZW A;  5DBJ A;  1YQZ A;  3CPJ G;  1ZP0 A;  4C77 A;  4JNQ A;  3OZ2 A;  3LZX A;  3UOZ A;  4BK3 A;  4AT2 A;  4ADW A;  1K0L A;  1PXA A;  2HXU A;  4LU6 A;  2UZZ A;  3AEF A;  2E3T A;  3T6C A;  4REK A;  2XLU A;  3PG6 A;  1W4X A;  1JOA A;  3CNT A;  3LB8 A;  3N6H A;  4GRT A;  1O95 A;  5FJT A;  3WE0 A;  2ACZ A;  4KPR A;  2C76 A;  1P48 A;  1NEL A;  1ZDL A;  4TLX A;  2XH2 A;  4A5L A;  3T37 A;  4UP3 A;  3VR8 A;  2XVI A;  4B67 A;  1KKO A;  1F3P A;  3CNJ A;  3D8X A;  3R10 A;  1GER A;  4OPC A;  1PDH A;  3IF9 A;  1BWC A;  1JDF A;  3K1G A;  1JNZ A;  4IL0 A;  2C3C A;  4K22 A;  3VRB A;  4NWZ A;  2YM1 A;  3MUC A;  4B66 A;  2B9W A;  1H7X A;  1PBC A;  2AL2 A;  2BA9 A;  1JNR A;  4IT1 A;  2PTX A;  4D03 A;  3UCC A;  3QJ4 A;  4FK1 A;  4HCD A;  2GF3 A;  4GCM A;  4U8N A;  3COX A;  1FFV C;  3SYI A;  2PGE A;  2OAM A;  1TDO A;  3GY1 A;  3ZLG A;  2BK5 A;  4BJZ A;  1ELS A;  5ER0 A;  1KKR A;  3OZY A;  3CGC A;  1NPX A;  1PHH A;  1QJD A;  4Z43 A;  4H4U A;  2WDQ A;  4CNK A;  4HNL A;  2VQ7 A;  4II2 A;  2QCU A;  1TDE A;  2IVE A;  5BOF A;  2XLT A;  2WES A;  3AE5 A;  3IK4 A;  3N4E A;  3V4B A;  2YG4 A;  3AEG A;  4B63 A;  4WX1 A;  4Z2R A;  1OEP A;  3QFA A;  4AP3 A;  1BQG A;  1EC9 A;  3RCY A;  1GRB A;  4NNJ A;  1Q1R A;  3V5F A;  4K8D A;  2P88 A;  1H83 A;  3AEC A;  3ICT A;  2BXR A;  2C3D A;  3DEQ A;  5EOW A;  3NG7 X;  3N6J A;  3R9U A;  3P9U A;  1OJC A;  3CNS A;  2R45 A;  4CCQ A;  1ZY8 A;  4GGB A;  1F9C A;  2E4G A;  3DER A;  1LQU A;  2NPX A;  4A6G A;  2JKC A;  3B6D A;  3UCD A;  1L0V A;  4E5T A;  3S5S A;  1JRY A;  2B9X A;  3DGZ A;  5FS8 A;  4MGG A;  2E1M A;  1KNP A;  3AEB A;  1F8R A;  3VCC A;  4ZCW A;  3T14 A;  5KMQ A;  4OPD A;  1KDG A;  4TM4 A;  1MUC A;  3DME A;  4J34 A;  3AMZ A;  4NEW A;  3NFU A;  1GRH A;  4K1W A;  2QA2 A;  5J7X A;  2A87 A;  3NRN A;  1H7W A;  3GWD A;  4A7A A;  1D5T A;  3NIX A;  3SN1 A;  1KNR A;  4BJY A;  3F8D A;  2FYM A;  5BVA A;  2ZZC A;  3NN0 X;  3P1W A;  2WDV A;  4J56 A;  1DJN A;  5JCK A;  3AEA A;  1PXC A;  3H70 A;  2NQL A;  4OPI A;  1PBB A;  1OJD A;  2GMH A;  2AR8 A;  5M0Z A;  1GAL A;  3RP7 A;  3UOX A;  3NHO X;  1AOG A;  4C5O A;  3ZVH B;  1NDA A;  4K8G A;  1B4V A;  3EPT A;  3KA7 A;  2VVL A;  3SZC A;  1PN0 A;  4U8J A;  1CJ3 A;  4ROP A;  1WYG A;  2B7S A;  2YR5 A;  1GRE A;  4G74 A;  3GO2 A;  1PJ7 A;  3SY4 A;  2PCE A;  2AL2 B;  5FS6 A;  3DK9 A;  3ALM A;  3HZL A;  3B9J B;  3GC2 A;  1JEH A;  5KMR A;  3UKL A;  4UDR A;  1MDR A;  1E6E A;  5BOE A;  3GD4 A;  1DJQ A;  3TQP A;  3UOY A;  2GAG B;  1X2H A;  1VDC A;  3UXL A;  3EF6 A;  2W55 A;  1VQW A;  2OX4 A;  3QN3 A;  3DK8 A;  4GAV A;  2XDO A;  1GRT A;  3VCN A;  1KCZ A;  2XFO A;  4MJW A;  4H83 A;  4USQ A;  4NTD A;  2PGW A;  3NK2 X;  3GYI A;  2C66 A;  3HRD C;  3B3R A;  3ZYX A;  4JQ9 A;  2F5Z A;  1GND A;  3ES8 A;  3MWC A;  3PS9 A;  5JCM A;  3GMC A;  2PA6 A;  4EQS A;  2Z5Y A;  3AED A;  4Z17 A;  2V60 A;  3P93 A;  2C70 A;  2ZZ0 A;  2YLX A;  4JDR A;  5BUK A;  1BKW A;  3T2Z A;  2JB3 A;  3U4F A;  1JRX A;  1VG9 A;  4HCH A;  4Y4L A;  2C72 A;  3STP A;  4BUR A;  4YSX A;  4O5Q A;  5EBK A;  4AT0 A;  5HXI A;  1ZX9 A;  1CJC A;  2TPR A;  4AOS A;  3V5C A;  1EL7 A;  5EB4 A;  4TVW A;  3L5O A;  4IZG A;  3CGE A;  3AD8 B;  5KVH A;  3UP4 A;  1LV0 A;  3MZN A;  3G5Q A;  2QDE A; 
#chains in the Genus database with same CATH homology
 3P4P A;  2XFP A;  5U63 A;  4CY6 A;  3UKQ A;  1K4Q A;  4ZN0 A;  4G6H A;  4EQX A;  1IUS A;  1NG3 A;  3CN8 A;  1S2Y A;  5HY5 A;  1LTX R;  2H88 A;  4AP1 A;  3LZW A;  4EIP A;  5DBJ A;  2C75 A;  4A99 A;  1NAA A;  1ZOY A;  2ZZB A;  3L1R A;  1YQZ A;  4Z44 A;  1RSG A;  1IUT A;  3CPJ G;  1ZP0 A;  3F8P A;  4C77 A;  5KMP A;  2BK4 A;  1H6V A;  2V5Z A;  4JNQ A;  1DOC A;  2PYX A;  3HYX A;  3LZX A;  3OZ2 A;  5KRQ A;  2VRM A;  1JU2 A;  3D1C A;  4FK1 C;  3UOZ A;  4BK3 A;  4AT2 A;  2CFY A;  4ADW A;  1K0L A;  1PXA A;  2Q7V A;  2QA1 A;  2APG A;  4LU6 A;  4G6G A;  3K7M X;  3Q9T A;  2GRT A;  2FJD A;  2UZZ A;  3KLJ A;  3D9X A;  5IPY A;  3ICS A;  3AEF A;  4REK A;  3G5S A;  2TMD A;  3CGB A;  3I6D A;  2XLU A;  4UDP A;  2EQ9 A;  1TYP A;  3PG6 A;  2BS2 A;  2C64 A;  4H4R A;  1B5Q A;  2X99 A;  1GRG A;  1W4X A;  4TM0 A;  1REO A;  1JOA A;  3NNE A;  3GYJ A;  1NG4 A;  4K7Z A;  1O5W A;  3CNT A;  3LB8 A;  3CGD A;  4GRT A;  3BI4 A;  4B65 A;  4EIQ A;  1N1P A;  3C4A A;  4GDP A;  3QSM A;  4HB9 A;  4OPL A;  5TR3 A;  1O95 A;  1XHC A;  3WE0 A;  2WS3 A;  4YSY A;  3E1T A;  1YQ3 A;  2CUL A;  2ACZ A;  4KPR A;  2C76 A;  1CC4 A;  1DOD A;  4EM3 A;  1EBD A;  4Z24 A;  4H4Y A;  3SZ0 A;  4TLX A;  1ZDL A;  3NYE A;  4A5L A;  2X8G A;  4UP3 A;  1EL8 A;  3T37 A;  3VR8 A;  4Z25 A;  2C4C A;  3ALJ A;  2XVI A;  3KPF A;  4B67 A;  4OVI A;  1L9C A;  4A79 A;  1F3P A;  3ATR A;  3CNJ A;  3G5R A;  3D8X A;  3T2K A;  2YAU A;  1GER A;  2H89 A;  2JB1 A;  1PDH A;  1VRQ B;  4OPC A;  4YXD A;  2WEU A;  3IHG A;  5J60 A;  4FDC B;  3IF9 A;  3UKK A;  1BWC A;  3QSS A;  1JNZ A;  1GTH A;  3AE9 A;  2C3C A;  2FJB A;  3UP5 A;  4K22 A;  5JCL A;  1L9D A;  4HA6 A;  3VRB A;  1L9E A;  2YM1 A;  4NWZ A;  4B66 A;  2B9W A;  1FCD A;  2WHD A;  3ADA B;  4U8K A;  1CF3 A;  2X50 A;  2X8H A;  1H7X A;  3AB1 A;  2OAL A;  1PBC A;  4ECH A;  4H4V A;  3SQP A;  2BA9 A;  2WBA A;  1JNR A;  2VVL G;  3M12 A;  5CQF A;  1D4E A;  1V59 A;  3UKH A;  4IVM B;  1LJ1 A;  5GRT A;  4U2S A;  3AD9 B;  1GPE A;  2WP5 A;  1Y0P A;  2B7R A;  3C4N A;  1N4V A;  2WOW A;  2YVF A;  4KX6 A;  4BK1 A;  4K5S A;  1CJ2 A;  2OLN A;  1LQT A;  4D03 A;  2GH5 A;  1XAN A;  3DK4 A;  3QJ4 A;  4FK1 A;  4LII A;  3SGL A;  5BRT A;  2VRL A;  4DSG A;  2GF3 A;  4GCM A;  4U8N A;  3COX A;  3HYW A;  3SFE A;  2GR0 A;  1NEK A;  3O0H A;  1D7Y A;  3SYI A;  2X3N A;  2XLP A;  4H2P A;  1IUV A;  3AD7 B;  3NH3 X;  2OAM A;  1TDO A;  1VG0 A;  2YVJ A;  1PBF A;  2WP9 A;  2BRA A;  3NT6 A;  3VQR A;  1O94 A;  1YQ4 A;  2BK5 A;  4PAB A;  4BJZ A;  1NHP A;  1YKJ A;  4CY8 A;  1FOH A;  5ER0 A;  3QFB A;  2CVJ A;  4YKG A;  1PJ5 A;  3GMB A;  3AE3 A;  3CGC A;  1NPX A;  1QO8 A;  2GB0 A;  3BHF A;  2YG6 A;  3DA1 A;  1PHH A;  2YLW A;  3IWA A;  5FMH A;  3P4Q A;  2OA1 A;  2YVG A;  1TDN A;  4GDE A;  1QJD A;  3AE2 A;  4Z43 A;  4H4U A;  4O5U A;  3VRD B;  2WDQ A;  5IQ1 A;  4IA6 A;  5U1O A;  4CNK A;  1PBE A;  2VQ7 A;  1NHS A;  1E1M A;  1TDE A;  2QCU A;  2WU2 A;  2IVE A;  4II2 A;  1GXF A;  4YKF A;  1M64 A;  4DGK A;  4Z2U A;  2R46 A;  2R0P A;  3NKS A;  2XLT A;  2C7G A;  2WES A;  1H81 A;  3AE5 A;  1TYT A;  1GES A;  2WQY A;  1IUW A;  4H4P A;  2GEW A;  3CIR A;  2YG4 A;  4H7U A;  3AEG A;  4B63 A;  4WX1 A;  1BF3 A;  4Z2R A;  4EQR A;  5L46 A;  3QFA A;  4AP3 A;  4BV6 A;  3C96 A;  2BAB A;  3QSE A;  1GRB A;  2RAB A;  3P4R A;  4NNJ A;  4N9X A;  1Q1R A;  1COY A;  1RYI A;  2FJE A;  4K8D A;  3ABV A;  1H83 A;  3AEC A;  1XDI A;  3FG2 P;  3ICT A;  2BXR A;  2C3D A;  4H4Z A;  3SX6 A;  1FEC A;  3K30 A;  3NG7 X;  4J31 A;  2QAE A;  5EOW A;  3FPZ A;  5KXJ A;  1DXL A;  2YWL A;  2BS4 A;  3R9U A;  3P9U A;  1H82 A;  2DKH A;  1OJC A;  2Y6Q A;  4PAA A;  3CNS A;  3M13 A;  3BHK A;  2R45 A;  4CCQ A;  1ZY8 A;  5KMS A;  2E4G A;  1LQU A;  2NPX A;  5FS7 A;  2JKC A;  3B6D A;  1L0V A;  3H8L A;  1Y56 B;  4GR1 A;  4J36 A;  4JNA A;  5KNL A;  2FBW A;  4K2X A;  2GMJ A;  3S5W A;  4EMI A;  1GET A;  2BCP A;  1JRY A;  2BXS A;  1H2I A;  1PJ6 A;  1N4W A;  2DKI A;  4EQW A;  3S61 A;  2B9X A;  3DGZ A;  1PXB A;  1EL5 A;  2YLZ A;  5KVI A;  4JN9 A;  4X9M A;  3RED A;  2EQ6 A;  3SXI A;  5FS8 A;  2YG5 A;  3AYL A;  4B1B A;  4H2N A;  1LVL A;  1CC6 A;  2XLR A;  1K0J A;  2E1M A;  3AWI A;  2JBV A;  1KNP A;  3AEB A;  4H2R A;  4JY2 A;  1F8R A;  2XFN A;  1E39 A;  1GT8 A;  4A6N A;  2BAC A;  3T14 A;  4YSZ A;  1Q9I A;  1ZOV A;  4I59 A;  4OPG A;  5KMQ A;  1BZL A;  2GAH B;  1KDG A;  4OPD A;  4TM4 A;  4IVO B;  3DME A;  3LOV A;  4J34 A;  3BI2 A;  4NEW A;  2Q0L A;  5BUL A;  1GRH A;  1MOK A;  2QA2 A;  1DNC A;  5J7X A;  3OC4 A;  2A87 A;  2V61 A;  3CMM A;  1H7W A;  3GWD A;  3NRN A;  4A65 A;  4A7A A;  4EM4 A;  4RSL A;  4YWO A;  1D5T A;  1DOB A;  1E1K A;  1KSU A;  3NIX A;  3BNM A;  1GSN A;  3SFD A;  4YTM A;  1TDK A;  1D4D A;  1KNR A;  1M6I A;  4U8O A;  4BJY A;  2NVK X;  2WDR A;  3F8D A;  5KWF A;  2V3B A;  4H4X A;  5BVA A;  3Q6J A;  3IHM A;  4D04 A;  1RP0 A;  2ZZC A;  1H84 A;  1FEB A;  3NN0 X;  3P1W A;  1PBD A;  4ICY A;  2WDV A;  4J56 A;  1DJN A;  3UTG A;  2WP6 A;  4X4J A;  5JCK A;  3AEA A;  1PXC A;  1GEU A;  4NTE A;  2Y6R A;  1IUX A;  1D4C A;  4OPI A;  2B9Y A;  3ICR A;  1PBB A;  2RGH A;  1OJD A;  4H4S A;  2GMH A;  3GYX A;  2AR8 A;  2B76 A;  1OJA A;  5C3J A;  3SZF A;  4YT0 A;  4OPT A;  1DOE A;  3QVP A;  5M0Z A;  3BNU A;  2YG7 A;  3BI5 A;  2XCG A;  4CBQ A;  1YY5 A;  1GAL A;  3RP7 A;  1NHQ A;  2XVF A;  4NTC A;  3FBS A;  4APN A;  3KVE A;  3UOX A;  3NHO X;  1E1L A;  2JAE A;  1AOG A;  3T2Y A;  2XVE A;  4C5O A;  1NDA A;  4GF7 A;  1B8S A;  3PO7 A;  3LJP A;  4K5R A;  2C73 A;  2BRY A;  3RP6 A;  2XVJ A;  1OJ9 A;  3SZW A;  1UKV G;  4FX9 A;  1ZMC A;  1B4V A;  2ZBW A;  3NK1 X;  3EPT A;  4J33 A;  2FJA A;  2HQM A;  2AQJ A;  2WOI A;  1EL9 A;  3KA7 A;  2VVL A;  1F8W A;  1N4U A;  3SZC A;  1NEN A;  1PN0 A;  2GV8 A;  1KF6 A;  4U8J A;  1CJ3 A;  3GD3 A;  3T31 A;  1K0I A;  3CPI G;  3KPK A;  3NTD A;  2B7S A;  1ELI A;  2YR5 A;  1GRE A;  4DNA A;  4G74 A;  3ALL A;  4OPU A;  4X9N A;  5LV9 A;  3KD9 A;  1PJ7 A;  2VVM A;  4RG4 A;  2IVD A;  3UKA A;  2YM2 A;  3SY4 A;  4JY3 A;  1S7M A;  5U25 A;  2BS3 A;  4OCG A;  5FS6 A;  3DK9 A;  2YLS A;  5M10 A;  1CL0 A;  3H8I A;  3DH9 A;  3ALM A;  1GOS A;  3HZL A;  2WOV A;  3GSI A;  3L8K A;  1LPF A;  5KOW A;  3H4K A;  4CCR A;  4E0V A;  2C67 A;  1Q1W A;  1JEH A;  1Z6L A;  2CDU A;  3GRT A;  4XWR A;  3AYI A;  4XWZ A;  4GUV A;  2WPE A;  5KMR A;  3UKL A;  1ONF A;  4H50 A;  4UDR A;  2Z5X A;  3AE1 A;  1E6E A;  4Z26 A;  3GD4 A;  1DJQ A;  3JSK A;  1KFY A;  4DSH A;  3AEE A;  2GR3 A;  2BK3 A;  3URH A;  4XXG A;  3DJG X;  3UOY A;  4YSH A;  4LA1 A;  1S3B A;  1PS9 A;  4C3X A;  2GAG B;  2EQ7 A;  4ZCC A;  2Q0K A;  2YQU A;  2R9Z A;  1VDC A;  4U8M A;  3DJE A;  3EF6 A;  3DGH A;  4GAP A;  3P4S A;  1VQW A;  2W0H A;  4UDQ A;  1TRB A;  1SEZ A;  1ZKQ A;  3ATQ A;  3DK8 A;  2YG3 A;  2YLT A;  4GAV A;  2XDO A;  3F8R A;  1GRT A;  3AE8 A;  4U8I A;  3V3N A;  4EMJ A;  1D7L A;  1E1N A;  2RGO A;  3UTF A;  2XFO A;  3NYC A;  4IV9 A;  4MJW A;  1CC2 A;  5CKU A;  1CJ4 A;  2BCG G;  4C3Y A;  5JCN A;  3GDN A;  4IA5 A;  4TLZ A;  4EMW A;  4USQ A;  4NTD A;  4CNJ A;  2PHH A;  3NK2 X;  2IID A;  3NN6 X;  3PVC A;  3ISH A;  4U8P A;  4H4Q A;  2VQB A;  3AE4 A;  3GYI A;  1S3E A;  2YR6 A;  1IUU A;  3SM8 A;  3II4 A;  1JRZ A;  2C66 A;  2Q6U A;  3B3R A;  3HYV A;  4I58 A;  4U2T A;  4NZH A;  3ZYX A;  4CRT A;  4JQ9 A;  4AOX A;  5JCI A;  3CPH G;  2R4J A;  2F5Z A;  3CTY A;  5HHF A;  2WPF A;  3NLC A;  1GTE A;  1GND A;  1NHR A;  3NYF A;  1ZK7 A;  2VZ2 A;  2O9Z A;  4B69 A;  2XYO A;  2J3N A;  3AE7 A;  2GQW A;  1QLB A;  3GRS A;  3NTA A;  4H2Q A;  4A9W A;  1KN0 A;  4H4W A;  3PS9 A;  2VOU A;  5JRB A;  5JCM A;  2XVH A;  3ITJ A;  1OJT A;  3VR9 A;  4B68 A;  3GMC A;  4YTP A;  2V3A A;  4EQS A;  2Z5Y A;  3UTE A;  1CBO A;  2YR4 A;  3AED A;  4U8L A;  2V60 A;  3UCL A;  2XFU A;  2ARD A;  1MO9 A;  1ZMD A;  3EAO A;  2OLO A;  4TM1 A;  4USR A;  1XPQ A;  3UKF A;  1GV4 A;  2JB2 A;  2C70 A;  2WPC A;  1E7P A;  1P2H A;  2AAQ A;  2GR2 A;  2X8C A;  2ZZ0 A;  4ZCD A;  3NGC X;  1BGN A;  1KSS A;  4WCT A;  2YLX A;  1F6M A;  4JDR A;  3CND A;  4G9K A;  1CHU A;  4NEV A;  4U2L A;  5BUK A;  1BKW A;  3DJJ A;  2JB3 A;  2GR1 A;  2YLR A;  1H86 A;  3M0O A;  1JRX A;  3T0K A;  3T2Z A;  2WU5 A;  3UOV A;  1VG9 A;  4Z2T A;  3NK0 X;  2GQF A;  3DJD A;  2V6O A;  3AYJ A;  1IJH A;  1X31 B;  4Y4L A;  2C72 A;  3LXD A;  4A6N B;  4J2W A;  1HYU A;  1GRA A;  3RNM A;  1S2Q A;  4BUR A;  4YSX A;  2A89 A;  4O5Q A;  3EAN A;  3UKP A;  2R4E A;  4BK2 A;  5EBK A;  2XFQ A;  4AT0 A;  5HXI A;  4Y4N A;  3KU9 A;  1MXT A;  2E5V A;  1ZX9 A;  2C65 A;  2BC0 A;  4RG3 A;  4B64 A;  3RP8 A;  3LAD A;  1CJC A;  1Y56 A;  5IQ4 A;  1FEA A;  3FMW A;  2TPR A;  3AXB A;  1GRF A;  2BYB A;  4Y4M A;  4AOS A;  3RHA A;  2A8X A;  3AE6 A;  2BC1 A;  1F8S A;  1P2E A;  3VRA A;  4J57 A;  4C74 A;  3V76 A;  5C2T A;  1EL7 A;  4M52 A;  5EB5 A;  5EB4 A;  4YTN A;  3IC9 A;  3FIM B;  3I3L A;  2JK6 A;  1FL2 A;  3UTH A;  3L5O A;  2I0Z A;  5GSN A;  3K7Q X;  5KOX A;  1BGJ A;  2R0G A;  4G73 A;  3CGE A;  2XLS A;  3KKJ A;  4II3 A;  1B37 A;  3GDP A;  1TDF A;  4P9S A;  2R0C A;  3AD8 B;  5FS9 A;  4H4T A;  5KVH A;  3GWF A;  5HYM A;  3UP4 A;  4TM3 A;  2WET A;  2RGJ A;  1LV0 A;  3G5Q A;  3K7T A;  3ZDN A;  3QVR A;  3CNP A;  3V3O A;  2GVC A;  2EQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...