4J56A

Structure of plasmodium falciparum thioredoxin reductase-thioredoxin complex
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
504
structure length
504
Chain Sequence
b'HTYDYDYVVIGGGPGGMASAKEAAAHGARVLLFDYVKPSSQGTKWGIGGTCVNVGCVPKKLMHYAGHMGSIFKLDSKAYGWKFDNLKHDWKKLVTTVQSHIRSLNFSYMTGLRSSKVKYINGLAKLKDKNTVSYYLKGDLSKEETVTGKYILIATGCRPHIPDDVEGAKELSITSDDIFSLKKDPGKTLVVGASYVALECSGFLNSLGYDVTVAVRSIVLRGFDQQCAVKVKLYMEEQGVMFKNGILPKKLTKMDDKILVEFSDKTSELYDTVLYAIGRKGDIDGLNLESLNMNVNKSNNKIIADHLSCTNIPSIFAVGDVAENVPELAPVAIKAGEILARRLFKDSDEIMDYSYIPTSIYTPIEYGACGYSEEKAYELYGKSNVEVFLQEFNNLEISAVHRQKHIRAQKDEYDLDVSSTCLAKLVCLKNEDNRVIGFHYVGPNAGEVTQGMALALRLKVKKKDFDNCIGIHPTDAESFMNLFVTISSGLSYAAKGGSGGGKCG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Thioredoxin reductase 2
publication title Crystal Structure of the Plasmodium falciparum Thioredoxin Reductase-Thioredoxin Complex.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 159
structure length 504
sequence length 504
chains with identical sequence B, C, D
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2013-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF00890 FAD_binding_2 FAD binding domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 4j56A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4j56A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4j56A02
2XVFA 3DK4A 1E6EA 2EQ9A 1CC2A 5CKUA 1COYA 1YQ4A 2C70A 2AR8A 2YLRA 4X9NA 3AE3A 3ISHA 5JCKA 4TM0A 3QFBA 1PBFA 1P2EA 2RGHA 2V3AA 1CF3A 2YWLA 2VRMA 1LQTA 2X3NA 2WOVA 1B8SA 1ZOYA 2WS3A 1CJ2A 3E1TA 2WDQA 3F8PA 4OPCA 2VVMA 4H2RA 4DSHA 2PHHA 1NHPA 2J3NA 1M6IA 2BABA 3ALJA 3DH9A 4EMWA 2ZZ0A 1N4VA 2Z5XA 3AECA 3P4PA 1B4VA 3S61A 4B67A 5U63A 1XDIA 3T37A 2C66A 5BULA 3AD7B 1O5WA 3DJJA 5KVHA 1YQZA 2WU5A 1H81A 4Z2RA 1D7YA 3DMEA 4YKGA 5IQ4A 3RNMA 3NN6X 1PXAA 3KA7A 4H7UA 1ZK7A 1DODA 1O94A 3AE7A 5L46A 1F6MA 4USQA 1P2HA 4H4PA 4XXGA 1Y56A 2WOWA 1RP0A 1QO8A 1NPXA 4H50A 4X4JA 2GB0A 4EMIA 3LOVA 4B69A 4A5LA 2ZZBA 3ADAB 2HQMA 4U2TA 2CULA 3SQPA 4UP3A 3F8RA 2B9WA 3PS9A 3GSIA 2YR4A 1CC6A 3ICTA 2YVFA 4C3YA 2OAMA 3AE5A 1CJ3A 3FBSA 2JK6A 5J7XA 4NEVA 3IF9A 1Y56B 1YKJA 2C67A 1ZKQA 2GQFA 3KVEA 2E5VA 3O0HA 4J56A 3M13A 3SFDA 4A9WA 4B1BA 1KSSA 2Y6RA 2YLXA 4NZHA 4Z25A 2DKIA 1XANA 1ZX9A 1AOGA 1X31B 1S3BA 2XVHA 2Q6UA 3DA1A 2APGA 2BS2A 3NIXA 4A7AA 2YG6A 1N4UA 1TYPA 1GREA 4Z2UA 3NNEA 4GCMA 3VR8A 3QVRA 4ECHA 4OVIA 4JY3A 3LB8A 3NK2X 3NHOX 2A8XA 3RP7A 1DXLA 1XPQA 1GRAA 3B3RA 4BURA 4GR1A 2O9ZA 3AYIA 4OPUA 3UKFA 3LXDA 3EF6A 1QJDA 3QJ4A 4HA6A 2YM2A 1W4XA 1GRGA 3GDNA 3C4NA 3F8DA 4BJYA 2R0GA 2XDOA 1ELIA 2X50A 2IVEA 3ATQA 1BGNA 1DJQA 2GF3A 3UOYA 4BK2A 4APNA 2GR3A 5JCMA 4BK3A 3GWDA 5DBJA 1FECA 4LIIA 4Z44A 2VZ2A 5C2TA 4Y4MA 3AE6A 3AEGA 4AOXA 1D4EA 3RP6A 3LZWA 2GR1A 1LQUA 4IVMB 2GVCA 5FS9A 2E1MA 2NVKX 3RHAA 3SFEA 1IUSA 3CTYA 3DGZA 4OPIA 3ITJA 3NYFA 4O5UA 3COXA 1JNRA 1PJ6A 2WPEA 2YVJA 4EQXA 4CCRA 4EIQA 1GESA 1PBDA 2QA1A 3AB1A 1GRHA 4IV9A 4DNAA 5KWFA 2XLSA 4GUVA 1RYIA 3R9UA 3NN0X 4RG3A 3QSMA 4B66A 2WP5A 1GRTA 1IUTA 4REKA 1ZP0A 4FK1A 1ZMCA 3FG2P 2R0PA 3NT6A 4U8NA 4U8IA 4YT0A 1H6VA 3VR9A 5M0ZA 2GAHB 2WOIA 4JY2A 4CCQA 2Y6QA 1EL8A 1TYTA 4OPLA 5BRTA 1PHHA 4NEWA 4B64A 2R0CA 3P4QA 3UKKA 1OJ9A 1PN0A 3I6DA 2TPRA 1OJDA 3CPHG 5HXIA 3LADA 3PO7A 2GQWA 4Y4NA 1Q1WA 2QA2A 2OALA 1D5TA 2BC1A 1GTEA 3URHA 4A6NB 2YVGA 4XWRA 2XFNA 2VOUA 3UP5A 2C65A 3RP8A 3S5WA 1DOEA 1VDCA 1GV4A 2C76A 4AT2A 2JKCA 2ZBWA 4UDPA 2B9YA 2C3CA 2ARDA 2VRLA 3ALMA 2V60A 4FX9A 3GD3A 4OPDA 1H7XA 2VVLA 2FJEA 4U8KA 4AT0A 5U25A 1GOSA 3SGLA 4J31A 4GRTA 4U2LA 4H4YA 3GRTA 3NGCX 4H4TA 3AEFA 2H89A 4YTPA 3AEEA 3AD9B 4J34A 3NG7X 4UDQA 3GMBA 4BK1A 2WPFA 4J2WA 3ALLA 4U8MA 4CRTA 2VQ7A 2Q7VA 2GMJA 3K30A 4IVOB 4CNKA 2BC0A 4WX1A 3UOVA 1BF3A 1N4WA 2FJBA 2R46A 4YSXA 3UKQA 2PYXA 3NTDA 3UOZA 1K4QA 2C3DA 4IA5A 1ZOVA 3C4AA 3II4A 3NRNA 3AE9A 1LTXR 3OC4A 3GDPA 2C64A 5HY5A 2JB1A 2YR5A 1M64A 3AEDA 1FL2A 4U8LA 4B65A 1SEZA 2RGJA 1YQ3A 2XLUA 3H4KA 3AYLA 1DOBA 3GYJA 4JNAA 4RG4A 1EL5A 1TDEA 5EB4A 4B68A 5KOWA 4YSHA 3V3OA 2Q0KA 3ATRA 4X9MA 4YSYA 2DKHA 3K7TA 1PJ5A 1CJCA 3KLJA 3EAOA 1KDGA 2WBAA 3CPJG 1DNCA 2V6OA 1GNDA 3C96A 3VRDB 1E1NA 1NHRA 2QAEA 4IA6A 3UKHA 4A99A 4C5OA 3P1WA 4CNJA 1L9CA 3CIRA 5FS7A 2X8HA 5GRTA 1CHUA 1F8WA 2V61A 1OJAA 2CDUA 4EQWA 3IHMA 3H8LA 1BWCA 4TLXA 3CGDA 4ZCDA 2RGOA 2RABA 1NG4A 2WP9A 4JDRA 1TDNA 2R4EA 1DJNA 2AQJA 4JNQA 2JBVA 4MJWA 4USRA 1PBCA 2GV8A 3ZDNA 4KPRA 2R9ZA 1H7WA 1JRXA 1UKVG 1ZMDA 2XFPA 1BGJA 4TLZA 3VQRA 1KNRA 3DJGX 1EBDA 3DJEA 1Q1RA 3GWFA 4I58A 2XLTA 3UKPA 2BCGG 3NK1X 1HYUA 4U8OA 2GR2A 2X99A 2XFUA 2XVIA 2YLWA 4OPGA 4H4ZA 2B9XA 3ZYXA 4H4WA 2WHDA 4PABA 3NYCA 4CBQA 2ACZA 3H8IA 3NTAA 1KF6A 3K7MX 1D7LA 4K22A 1Z6LA 2GRTA 1YY5A 4K7ZA 4K5RA 4H4XA 4EIPA 4OPTA 5U1OA 4U8PA 3GRSA 1L0VA 4ZN0A 1ZDLA 1S2QA 3P4SA 2XFQA 2BA9A 4ADWA 3AE1A 5HHFA 5JCLA 1K0IA 2B76A 2H88A 2YG5A 3NK0X 1DOCA 3UKLA 1NDAA 3CNDA 5HYMA 2B7SA 1GTHA 1TRBA 1F3PA 1E1MA 4NTCA 1E7PA 1FCDA 5EBKA 4Z2TA 1TDOA 3L8KA 4C74A 3L1RA 1NHQA 2C73A 1VRQB 1GEUA 1CJ4A 3KPFA 4BJZA 1E1KA 4CY8A 2GH5A 4A65A 4C77A 2QCUA 3NYEA 1S3EA 1REOA 2C72A 1GT8A 1PXBA 2WQYA 2XLRA 3K7QX 4BV6A 1PS9A 1MO9A 4J36A 2EQ6A 1NG3A 4A79A 4EQSA 2I0ZA 3BNMA 1FOHA 1H84A 2ZZCA 2C75A 3CNSA 2F5ZA 1RSGA 4UDRA 1JU2A 3IC9A 2JB2A 3CNTA 4YWOA 2OLOA 2BXRA 1F8SA 1GPEA 2FJAA 3KKJA 4TM1A 2XCGA 4E0VA 3NH3X 3CNJA 2AAQA 3QSSA 4YTMA 4LU6A 4YSZA 1OJCA 2BK5A 3AEAA 3OZ2A 5BVAA 1PBBA 1GERA 4EM4A 2EQ8A 1B37A 1VQWA 2B7RA 1JNZA 5IQ1A 3CN8A 2GAGB 2GR0A 2YLSA 1QLBA 3BI4A 1JOAA 3AE4A 3UKAA 1GXFA 2WPCA 2XVJA 3DK8A 1K0LA 4H2QA 3UTFA 2BS4A 3AXBA 3DK9A 1KSUA 1D4DA 5J60A 2CVJA 4H4SA 1NHSA 4B63A 1LVLA 3LJPA 2VVLG 4GF7A 4PAAA 1FEBA 4Z24A 3D8XA 2V3BA 4I59A 2XYOA 2XVEA 3BI5A 3B6DA 4DSGA 4M52A 3ABVA 3ICRA 3QFAA 1IJHA 1K0JA 1TDKA 1NEKA 3G5SA 3KU9A 2X8GA 2BK4A 2E4GA 2R4JA 3AYJA 3EPTA 2EQ7A 4Z43A 4H4VA 4N9XA 2X8CA 2BCPA 1KFYA 3IWAA 3VRBA 4JQ9A 2XLPA 4C3XA 2R45A 2YLZA 5IPYA 3CGCA 1L9EA 1Y0PA 3GMCA 1NENA 2Z5YA 1IUWA 4H4UA 3P9UA 3Q6JA 1EL7A 1BKWA 3DJDA 4AP3A 3UCLA 4WCTA 3BHFA 1OJTA 1H82A 3AEBA 5KRQA 4HB9A 1EL9A 4KX6A 2XFOA 1Q9IA 3QVPA 4K8DA 4J33A 3WE0A 4Z26A 2YAUA 3JSKA 4GDPA 3V76A 4J57A 1GETA 1ONFA 2VQBA 2CFYA 3D1CA 2A87A 4OCGA 3UP4A 4EMJA 2YM1A 1FEAA 5TR3A 4ICYA 1MOKA 4ZCCA 3SM8A 1GRBA 3CGBA 2A89A 2YG3A 3KD9A 2BK3A 4Y4LA 2WP6A 1JRYA 1H86A 4U8JA 2WETA 5KOXA 3M0OA 1CC4A 3M12A 1B5QA 4CY6A 2FJDA 1D4CA 1GRFA 2JAEA 2GMHA 4D03A 1GALA 2TMDA 3HZLA 4AOSA 4P9SA 3CNPA 1BZLA 3NKSA 4H2NA 2WEUA 5EOWA 3BNUA 1PJ7A 5JCNA 5C3JA 2YG4A 4JN9A 1O95A 5KXJA 3VRAA 5ER0A 5BUKA 1NAAA 1PXCA 5FMHA 3AE8A 4U2SA 4LA1A 1GSNA 4XWZA 4H4QA 1V59A 3UOXA 5FS6A 3EANA 2BYBA 2FBWA 3BI2A 3FPZA 5LV9A 1MXTA 2WU2A 1S2YA 3CGEA 2IIDA 4FK1C 3UTHA 4AP1A 1PBEA 1VG0A 3FIMB 3CPIG 5CQFA 3REDA 3FMWA 3GD4A 4TM3A 4GDEA 3AWIA 4YKFA 3Q9TA 3AD8B 1PDHA 2V5ZA 3UTGA 3PVCA 2WESA 5EB5A 5GSNA 3LZXA 1L9DA 4TM4A 2OA1A 1N1PA 2OLNA 2Q0LA 1E1LA 4YXDA 1LPFA 1JEHA 2BACA 2NPXA 4NTEA 5JCIA 4K5SA 4EQRA 4DGKA 4FDCB 3GYIA 3G5RA 3DGHA 1CBOA 2C7GA 2WDVA 1KNPA 5FS8A 1IUVA 3G5QA 4YTNA 3I3LA 3P4RA 1CL0A 4K2XA 4RSLA 3NLCA 4D04A 5M10A 2YR6A 5KVIA 1JRZA 4NTDA 4A6NA 2BS3A 2GEWA 1H83A 1LJ1A 4EM3A 2UZZA 1F8RA 3IHGA 2WDRA 2YG7A 3BHKA 4H4RA 2BXSA 3QSEA 3V3NA 3AE2A 4H2PA 4O5QA 2YLTA 3UTEA 2JB3A 1VG9A 1E39A 2IVDA 1ZY8A 2YQUA 1TDFA 1LV0A 1IUUA 1IUXA 3ICSA 1XHCA 2W0HA
chains in the Genus database with same CATH superfamily
1COYA 4Z1YA 2AR8A 1FFUC 3TQPA 2WOVA 1B8SA 1CJ2A 2PHHA 4EMWA 2Z5XA 1B4VA 3CMMA 1XDIA 1O5WA 3ZLGA 1H81A 1D7YA 1P48A 1ZK7A 5L46A 3QKEA 3QLDA 1P2HA 1NPXA 2XH2A 3SQPA 2B9WA 2YVFA 2OAMA 3FBSA 2GQFA 2E5VA 4J56A 4A9WA 4B1BA 2YLXA 4NZHA 4G6HA 2HZGA 1XANA 1AOGA 2Q6UA 2BS2A 3B9JB 3SQSA 3NNEA 3NK2X 3NHOX 5FJTA 1DXLA 3HW2A 2PA6A 3QTPA 4BURA 4GR1A 3LXDA 3GDNA 3C4NA 2R0GA 2X50A 1R6WA 4APNA 3UCDA 4BK3A 3GWDA 1FECA 4Y4MA 1LQUA 5FS9A 2E1MA 3SFEA 1IUSA 3GY1A 4OPIA 3ITJA 4G73A 1PJ6A 4EQXA 2QA1A 5J04A 2WP5A 4REKA 2AKMA 1JROA 5M0ZA 2WOIA 3SYIA 4CCQA 2RDXA 1TYTA 1PHHA 1YEYA 3UKKA 1OJ9A 4ZA0A 1RVKA 2GQWA 3NVWB 2GL5A 1GTEA 2YVGA 2XFNA 2VOUA 1FHVA 3RP8A 3UP5A 3R1ZA 1GV4A 4GISA 4FX9A 3GD3A 1N63C 1H7XA 2VVLA 4U8KA 4AT0A 2W3RA 4J34A 2VQ7A 3V4BA 2BC0A 2AL1A 3CB3A 3K1GA 2FJBA 4II3A 3P0WA 2HNEA 4IA5A 3AE9A 3D47A 1LTXR 2C64A 1MDRA 1M64A 2XLUA 1YQ3A 3H4KA 3N4EA 1EL5A 5EB4A 3PWIA 2XSXA 3V3OA 3UXLA 3ATRA 2DKHA 3TOYA 3EAOA 4DN1A 1DNCA 3VRDB 1E1NA 3MWCA 3UCCA 4IA6A 3UKHA 3UJRA 4A99A 4C5OA 1L9CA 3CIRA 2P8CA 5BOEA 5GRTA 3R0UA 3MY9A 4EQWA 3R0KA 4G7FA 4ZCDA 1TDNA 1DJNA 2AQJA 3PFRA 2R9ZA 1H7WA 1UKVG 3VQRA 4TLZA 2W3SA 3DJEA 1Q1RA 4I58A 1HYUA 3NFUA 2XVIA 2YLWA 4OPGA 3ZYXA 2FYMA 4H4WA 1D7LA 1L0VA 3P4SA 2XFQA 5HHFA 3TCSA 2YG5A 1XS2A 1NDAA 1TDOA 2C73A 2PCEA 1GEUA 3KPFA 3DDMA 4A65A 1S3EA 2C72A 2WQYA 1EC9A 2XLRA 1PS9A 4J36A 4A6GA 4A79A 5G5GB 1H84A 2ZZCA 1JU2A 3CNTA 2OLOA 2FJAA 3CNJA 4NNJA 2XH0A 4EM4A 1JNZA 4KWSA 3CN8A 4HNLA 1QLBA 2GSHA 3AE4A 1GXFA 1K0LA 1KSUA 3U9IA 3H7VA 1ONEA 4H4SA 4B63A 1LVLA 3LJPA 2VVLG 4PAAA 3D8XA 3UJEA 3ICRA 2PTZA 3S5SA 2X8GA 2BK4A 2E4GA 3EEZA 4N9XA 4H4VA 3H12A 4C3XA 1SB3B 1JPDX 2Z5YA 4H83A 3Q6JA 3DJDA 3UCLA 4WCTA 3AEBA 4GYPA 4GFIA 1EL9A 2XFOA 4G9KA 3WE0A 4Z26A 2YAUA 4GDPA 4OCGA 3D1CA 2VQBA 2CFYA 4EMJA 4ICYA 3SM8A 2CHRA 2YG3A 2BK3A 3NS1B 2WP6A 2WETA 3M0OA 3M12A 2FJDA 2JAEA 4D03A 2TMDA 3HZLA 2PSNA 2WEUA 1ZXIC 1TE6A 1PJ7A 5JCNA 3SZCA 4JN9A 3VRAA 5ER0A 3AE8A 4HYRA 3ES8A 4LA1A 1V59A 1IYXA 3EANA 3TTEA 4AP1A 4FK1C 3UTHA 1VG0A 3FIMB 3CPIG 5CQFA 3FMWA 2QJMA 2PP3A 1TKKA 3LZXA 4TM4A 1SJAA 3ZVHB 4NTEA 4KPLA 3DGHA 3FXGA 5FS8A 3P4RA 5M10A 4X2PA 4D04A 2YR6A 5KVIA 1H83A 1LJ1A 2UZZA 3GYXA 3BHKA 3AM9A 4O5QA 2GGGA 2OZ8A 1KKRA 3ICSA 1LV0A 3ZDNA 1XHCA 2XVFA 3CXOA 2EQ9A 5FJRA 2YLRA 4X9NA 5JCKA 3QFBA 1PBFA 2YWLA 2POZA 3E1TA 4DSHA 2VVMA 3UGVA 2J3NA 1M6IA 2NQLA 3ALJA 2ZZ0A 3QPEA 3P4PA 5FJUA 1WYGA 5KVHA 5IQ4A 3ZLFA 1ELSA 3VC6A 1F6MA 1EBHA 1Y56A 3DFYA 2OX4A 4H50A 4X4JA 2GB0A 3LOVA 4A5LA 2ONEA 1S7MA 3ADAB 3OZMA 3ICTA 4J3ZA 1CJ3A 2JK6A 1MDLA 2C67A 1ZKQA 3KVEA 2PGWA 2DKIA 1ZX9A 1S3BA 2APGA 2YG6A 1N4UA 4Z2UA 4GCMA 3VR8A 4ECHA 3LB8A 3RP7A 3IJLA 1WUEA 4OPUA 4G8TA 3UKFA 5G5HB 5FJPA 4HN8A 2YM2A 3OP2A 2IVEA 3ATQA 4JN8A 1N61C 2OO6A 4DYEA 4LIIA 5C2TA 3SX6A 3LZWA 2GR1A 4E4UA 2NVKX 2PU0A 1PDYA 3NYFA 3COXA 1JNRA 2WPEA 3STPA 3CT2A 3DGBA 5KWFA 4B66A 1GRTA 1ZP0A 4U8IA 1KD0A 3P3BA 2Y6QA 4NWZA 2OPJA 1BQGA 4NEWA 3OW1A 4B64A 3CPHG 3LADA 1Q1WA 4A6NB 3S5WA 1VDCA 2QJJA 2AL2B 2C3CA 1SJDA 4OPDA 1R0MA 4H1ZA 1GOSA 3SGLA 4H4YA 1JRPA 3GRTA 4J1OA 3NG7X 4UDQA 3GMBA 4J2WA 3UJ2A 7ENLA 2Q7VA 2GMJA 4WX1A 3UOVA 3UOZA 1K4QA 1X2GA 4IP5A 3T2KA 1NU5A 1SEZA 3GYJA 5KMPA 1RM6B 3V5CA 5KOWA 3VCNA 4YSHA 4YSYA 4X9MA 3K7TA 3VA8A 2GGIA 1CJCA 1FHUA 3A7UA 1KDGA 2QAEA 3TW9A 3P1WA 4CNJA 5FS7A 2X8HA 2CDUA 3IHMA 3H8LA 1BWCA 2RGOA 4JNQA 1PBCA 3SZWA 1N62C 2XLTA 3NK1X 2QDDA 3NYCA 2ACZA 3NTAA 1KF6A 4K22A 1Z6LA 1YY5A 4K7ZA 4EIPA 4MKSA 4ZN0A 1ZDLA 1S2QA 4ADWA 3AE1A 3NK0X 5ENLA 3ZVHA 1F3PA 1E1MA 3MQTA 4Z2TA 4HCDA 3L8KA 3L1RA 3PG6A 4CY8A 1E1KA 2GH5A 4C77A 2QCUA 3NYEA 1VDVA 3R10A 3I6TA 3V5FA 3K7QX 1N60C 1NG3A 4EQSA 2PODA 2C75A 2F5ZA 3SN4A 2QVHA 3ETRB 4UDRA 5KNLA 1F8SA 2MUCA 1GPEA 3AMZA 3P93A 2XCGA 3NH3X 3SN0A 3QSSA 2AAQA 1KCZA 1B37A 1VQWA 3SZ0A 4IL0A 5KMQA 3UKAA 3JVAA 3DK8A 4HNCA 2BS4A 3HYWA 5J60A 1NHSA 3RR1A 1STZA 4Z24A 4E8GA 3B6DA 3BI5A 4Z43A 3T8QA 2GGJA 3IWAA 2XLPA 5IPYA 3VCCA 3GMCA 3BSMA 1NENA 1IUWA 3BHFA 1OJTA 4DHGA 5KRQA 4KX6A 2XGZA 2OZ3A 3FJ4A 1Q9IA 4K8DA 3NVZB 4IP4A 3V76A 4TVYA 1GETA 1ONFA 2QDEA 2YM1A 1FEAA 5TR3A 4ZCCA 1GRBA 3RCYA 3CGBA 2A89A 3NXLA 1H86A 3VC5A 1T3QC 4TVWA 4P9SA 4GGHA 3CNPA 2W54A 2YG4A 1PXCA 4U2SA 3RRAA 4XWZA 3T2ZA 3UOXA 5FS6A 2DW6A 2BYBA 3FPZA 2FBWA 3H70A 1S2YA 3UXKA 1PBEA 4GDEA 3AWIA 1N5XA 4ROPA 3RITA 3UTGA 3PVCA 2I5QA 3VFCA 2WESA 5EB5A 5GSNA 3U4FA 2GGEA 1N1PA 4A3RA 4YXDA 1SJCA 5JCIA 4K5SA 4EQRA 4FDCB 3GYIA 3G5RA 3R11A 1KNPA 2C4CA 3VDGA 1CL0A 3RO6A 4RSLA 2OQYA 1JRZA 4A6NA 2GEWA 2YG7A 1EC8A 2BXSA 3AE2A 4H2PA 2AL2A 1EC7A 2YLTA 3UTEA 3TJIA 1ZY8A 1TDFA 1IUXA 3DK4A 1E6EA 1CC2A 1YQ4A 3AE3A 3DEQA 4TM0A 2OZTA 2V3AA 2VRMA 2X3NA 1ZOYA 3F8PA 4OPCA 2WDQA 3DFHA 3DH9A 3AECA 3S61A 1N5WC 1VQZA 2C66A 5BULA 3AD7B 1YQZA 3RNMA 3NN6X 3DG6A 3GC2A 2ZC8A 3KA7A 2P8BA 1DODA 1O94A 4XXGA 1RP0A 3ES7A 2ZZBA 4MMWA 2HQMA 2W55A 4GYPC 3NRZB 3PK7A 3F8RA 3GSIA 2YR4A 1CC6A 4C3YA 3IF9A 5BOFA 1YKJA 3M13A 2Y6RA 2PTWA 4DX3A 4Z25A 1X31B 3DA1A 2P0IA 1W6TA 3FVDA 4KT2A 3QVRA 2A8XA 1GRAA 2O9ZA 3EF6A 1QJDA 3QJ4A 4HA6A 1W4XA 4BJYA 1TZZA 1BGNA 1DJQA 2GR3A 1JPMA 3D9XA 2VZ2A 4K8GA 3AE6A 3AEGA 4IVMB 2GVCA 3RHAA 3DGZA 3QN3A 4O5UA 4K1WA 2AKZA 3OPSA 1GRHA 2XLSA 4GUVA 1RYIA 3ENLA 4RG3A 3R9UA 3QSMA 1IUTA 4FK1A 1ZMCA 2R0PA 4YT0A 1H6VA 3S47A 1L8PA 4ZCWA 4OPLA 2R0CA 4YWSA 3P4QA 1PN0A 3OZYA 2TPRA 1OJDA 3PO7A 4Y4NA 5KMRA 2OALA 3N6HA 3A7AA 2BC1A 3URHA 4XWRA 4AT2A 2JKCA 2ZBWA 2B9YA 2ARDA 2VRLA 3ALMA 2PS2A 5U25A 3EKGA 4J31A 4GRTA 4U2LA 3NGCX 2H89A 2ZADA 3AD9B 3MSYA 1KN0A 3ALLA 4U8MA 4CNKA 2PYXA 3NTDA 4ZOHB 2HXUA 1ZOVA 3C4AA 3NRNA 3OC4A 2PP1A 3GDPA 5HY5A 2E3TA 3A7RA 2BRYA 2OVLA 3GO2A 4M6UA 3IK4A 3KLJA 2WBAA 3CPJG 1EBGA 3C96A 3H8AA 1CHUA 1F8WA 2V61A 1OJAA 3CGDA 2RABA 1NG4A 4MJWA 2JBVA 4USRA 2GV8A 4MGGA 4KPRA 1JRXA 2XFPA 4II2A 3DJGX 4GGBA 3GWFA 4FI4A 3SJNA 3UKPA 2BCGG 3AN1A 4U8OA 2GR2A 2XFUA 4H4ZA 5JRBA 2WHDA 3R07C 4CBQA 3Q45A 4K5RA 4H4XA 4U8PA 5JCLA 2B76A 1DOCA 3UKLA 2B7SA 1TRBA 4NTCA 1FCDA 5EBKA 1NHQA 1VRQB 3SSZA 1PXBA 3NVVB 2EQ6A 3BOXA 1FOHA 4E6MA 1RSGA 2PGEA 3IC9A 4TM1A 4LU6A 4YSZA 1P43A 1OJCA 2BK5A 3AEAA 3GD6A 3OZ2A 5BVAA 1GERA 2GAGB 2GR0A 4KEMA 2YLSA 1JOAA 1JDFA 2O56A 2XVJA 3UTFA 4H2QA 3AXBA 2OFJA 1D4DA 4E4FA 4GIRA 1OEPA 3T14A 4GF7A 4GAVA 3SXIA 2OQHA 2XVEA 4M52A 3ABVA 3QFAA 1K0JA 3G5SA 2R4JA 3EPTA 2EQ7A 1H2IA 2BCPA 4JQ9A 4F4RA 2R45A 3CGCA 3MZNA 1L9EA 1Y0PA 1X2HA 3P9UA 1BKWA 2FKPA 1EL7A 4AP3A 4HB9A 3QVPA 3JSKA 1E9IA 3UP4A 1MOKA 4Y4LA 1JRYA 1V97A 1CC4A 1D4CA 1GRFA 3HPFA 2GMHA 1GALA 1SJBA 4GMEA 3I6EA 4H2NA 5KXJA 1O95A 5BUKA 3Q4DA 1NAAA 5FMHA 1GSNA 4H4QA 3UJFA 3SZFA 5LV9A 3BJSA 2P88A 2IIDA 3GD4A 3T2YA 4YKFA 3AD8B 1PDHA 2V5ZA 3FV9A 1L9DA 1LPFA 2NPXA 3SN1A 4DGKA 3CXBA 1CBOA 2C7GA 2WDVA 3G5QA 4EWJA 4M0XA 4H2HA 4EM3A 2WDRA 3QSEA 4H19A 2JB3A 4HCHA 1E39A 2IVDA 2YQUA 4DWDA 2W0HA 5CKUA 2C70A 3ISHA 1P2EA 2RGHA 1WUFA 1CF3A 1XPYA 1LQTA 2WS3A 4H2RA 1NHPA 2BABA 1N4VA 4B67A 5U63A 3T37A 3DJJA 2WU5A 4Z2RA 3DMEA 4YKGA 1PXAA 4H7UA 3AE7A 3T6CA 4USQA 4H4PA 2WOWA 1QO8A 4EMIA 4B69A 3MUCA 4U2TA 2CULA 4UP3A 3NVYB 3DERA 4A35A 3PS9A 3AE5A 5J7XA 3DESA 4NEVA 1NELA 1Y56B 3O0HA 3SFDA 1KSSA 2XVHA 3NIXA 4A7AA 1TYPA 1GREA 4OVIA 3CYJA 1FO4A 4JY3A 3SBFA 1XPQA 3DIPA 3B3RA 3AYIA 4DXKA 3T0KA 1GRGA 3F8DA 2XDOA 1ELIA 3ZVIA 4ENLA 1KKOA 2GF3A 3UOYA 4BK2A 3JZUA 3NZGA 2PTXA 5JCMA 5DBJA 4Z44A 2PP0A 3T31A 4AOXA 1D4EA 3RP6A 4Z17A 3CTYA 3JW7A 3CK5A 4CCRA 2YVJA 4EIQA 1GESA 1PBDA 3AB1A 4IV9A 4DNAA 3NN0X 5IDZA 3FG2P 1ECQA 3NT6A 4U8NA 4FP1A 3EUB3 3THUA 3VR9A 2GAHB 4JY2A 1EL8A 5BRTA 3FYYA 4JN7A 3I6DA 5HXIA 2OG9A 2QA2A 1D5TA 3HYVA 2C65A 1DOEA 3T9PA 2C76A 4UDPA 2V60A 2FJEA 5EU9A 1JCTA 1FIQB 4H4TA 3AEFA 4YTPA 3AEEA 2QJNA 3DG3A 4JHMA 4BK1A 2WPFA 3UJSA 2PMQA 4GAPA 4CRTA 3MKCA 2DW7A 3K30A 4IVOB 3KPKA 1BF3A 1N4WA 2R46A 4YSXA 3UKQA 4K2SA 2C3DA 3II4A 2JB1A 2YR5A 3AEDA 3RGTA 1FL2A 4E5TA 4U8LA 4B65A 2RGJA 3AYLA 3NO1A 1DOBA 4JNAA 4RG4A 1TDEA 4B68A 3TJ4A 2Q0KA 3I4KA 3OTRA 1PJ5A 2PU1A 1FFVC 2V6OA 1GNDA 1NHRA 1DTNA 4TLXA 2WP9A 4JDRA 2R4EA 1ZMDA 1BGJA 1KNRA 1EBDA 4G6GA 3SY4A 2QGYA 2X99A 3SR6B 3N4FA 2B9XA 2GDQA 5FJOA 4PABA 3H8IA 3TWBA 3K7MX 2GRTA 4OPTA 5U1OA 3GRSA 2BA9A 1F9CA 1K0IA 2H88A 3CAWA 3CNDA 5HYMA 1GTHA 1E7PA 4C74A 2HXTA 1CJ4A 4BJZA 1BKHA 1REOA 1GT8A 3HRDC 4BV6A 1MO9A 2E5AA 3FCPA 2I0ZA 3BNMA 3CNSA 2JB2A 4YWOA 2BXRA 3KKJA 4E0VA 4YTMA 1PBBA 2EQ8A 2B7RA 5IQ1A 4G74A 3BI4A 2WPCA 4IT1A 3IJIA 3DK9A 5KMSA 2CVJA 3N6JA 6ENLA 1FEBA 1PDZA 2GGHA 2V3BA 2PTYA 4I59A 2XYOA 4DSGA 1IJHA 2P3ZA 3PWGA 1TDKA 1NEKA 3KU9A 3AYJA 2X8CA 1KFYA 3VRBA 2YLZA 3R25A 2OKTA 3T4WA 1MNSA 4H4UA 1MRAA 1H82A 4J33A 4J57A 4IHCA 2A87A 3KD9A 4U8JA 5KOXA 1B5QA 4CY6A 3HYXA 4AOSA 2OLAA 3IJQA 1BZLA 3L5OA 3NKSA 4IZGA 3B97A 5EOWA 3BNUA 3KUMA 5C3JA 3DG7A 3BI2A 3TWAA 1MXTA 2WU2A 4HPNA 3CGEA 4IL2A 3REDA 4HCLA 3D46A 4TM3A 3Q9TA 2PPGA 2MNRA 2OA1A 2OLNA 2Q0LA 1E1LA 2BACA 1JEHA 3V3WA 2BRAA 1MUCA 1IUVA 4YTNA 3I3LA 4K2XA 3NLCA 4NTDA 2BS3A 2XH7A 1F8RA 3IHGA 4H4RA 3V3NA 2XH4A 3ZLHA 1VG9A 2QQ6A 1IUUA
chains in the Genus database with same CATH topology
2XVFA 3DK4A 1E6EA 2EQ9A 1CC2A 5CKUA 1COYA 1YQ4A 2C70A 2AR8A 2YLRA 4X9NA 3AE3A 3ISHA 5JCKA 4TM0A 3QFBA 1PBFA 2V3AA 1P2EA 2RGHA 1CF3A 2YWLA 2VRMA 1LQTA 2X3NA 2WOVA 1B8SA 1ZOYA 2WS3A 1CJ2A 3E1TA 2WDQA 3F8PA 4OPCA 2VVMA 4H2RA 4DSHA 2PHHA 1NHPA 2J3NA 1M6IA 2BABA 3ALJA 3DH9A 4EMWA 2ZZ0A 1N4VA 2Z5XA 3AECA 3P4PA 1B4VA 3S61A 4B67A 3CMMA 5U63A 1XDIA 3T37A 2C66A 5BULA 3AD7B 1O5WA 3DJJA 5KVHA 1YQZA 2WU5A 1H81A 4Z2RA 1D7YA 3DMEA 4YKGA 5IQ4A 3RNMA 3NN6X 1PXAA 3KA7A 4H7UA 1ZK7A 1DODA 1O94A 3AE7A 5L46A 1F6MA 4USQA 1P2HA 4H4PA 4XXGA 1Y56A 2WOWA 1RP0A 1QO8A 1NPXA 4H50A 4X4JA 2GB0A 4EMIA 3LOVA 4B69A 4A5LA 2ZZBA 1S7MA 3ADAB 2HQMA 4U2TA 2CULA 3SQPA 4UP3A 3F8RA 2B9WA 3PS9A 3GSIA 2YR4A 1CC6A 3ICTA 2YVFA 4C3YA 2OAMA 3AE5A 1CJ3A 3FBSA 2JK6A 5J7XA 4NEVA 3IF9A 1Y56B 1YKJA 2C67A 1ZKQA 2GQFA 3KVEA 2E5VA 3O0HA 4J56A 3M13A 3SFDA 4A9WA 4B1BA 1KSSA 2Y6RA 2YLXA 4NZHA 4G6HA 2DKIA 4Z25A 1XANA 1ZX9A 1AOGA 1X31B 1S3BA 2XVHA 2Q6UA 3DA1A 2APGA 2BS2A 3NIXA 4A7AA 2YG6A 1N4UA 1TYPA 1GREA 4Z2UA 3NNEA 4GCMA 3VR8A 3QVRA 4ECHA 4OVIA 4JY3A 3LB8A 3NK2X 3NHOX 2A8XA 3RP7A 1DXLA 1XPQA 1GRAA 3B3RA 4BURA 4GR1A 2O9ZA 3AYIA 4OPUA 3UKFA 3LXDA 3EF6A 1QJDA 3QJ4A 4HA6A 2YM2A 3T0KA 1W4XA 1GRGA 3GDNA 3C4NA 3F8DA 4BJYA 2R0GA 2XDOA 1ELIA 2X50A 2IVEA 3ATQA 1BGNA 1DJQA 2GF3A 3UOYA 4BK2A 4APNA 2GR3A 5JCMA 4BK3A 3GWDA 5DBJA 1FECA 3D9XA 4LIIA 4Z44A 2VZ2A 5C2TA 3T31A 4Y4MA 3AE6A 3SX6A 3AEGA 4AOXA 1D4EA 3RP6A 3LZWA 2GR1A 1LQUA 4IVMB 2GVCA 5FS9A 2E1MA 2NVKX 3RHAA 3SFEA 1IUSA 3CTYA 3DGZA 4OPIA 3ITJA 4G73A 3NYFA 4O5UA 3COXA 1JNRA 1PJ6A 2WPEA 2YVJA 4EQXA 4CCRA 4EIQA 1GESA 1PBDA 2QA1A 3AB1A 1GRHA 4IV9A 4DNAA 5KWFA 2XLSA 4GUVA 1RYIA 3R9UA 3NN0X 4RG3A 3QSMA 4B66A 2WP5A 1GRTA 1IUTA 4REKA 1ZP0A 4FK1A 1ZMCA 3FG2P 2R0PA 3NT6A 4U8NA 4U8IA 4YT0A 1H6VA 3VR9A 5M0ZA 2GAHB 2WOIA 4JY2A 3SYIA 4NWZA 2Y6QA 4CCQA 1EL8A 1TYTA 4OPLA 5BRTA 1PHHA 4NEWA 4B64A 2R0CA 3P4QA 3UKKA 1OJ9A 1PN0A 3I6DA 2TPRA 1OJDA 3CPHG 5HXIA 3LADA 3PO7A 2GQWA 4Y4NA 1Q1WA 5KMRA 2QA2A 2OALA 1D5TA 2BC1A 1GTEA 3URHA 4A6NB 2YVGA 4XWRA 2XFNA 3HYVA 2VOUA 3UP5A 2C65A 3RP8A 3S5WA 1DOEA 1VDCA 1GV4A 2C76A 4AT2A 2JKCA 2ZBWA 4UDPA 2B9YA 2C3CA 2ARDA 2VRLA 3ALMA 2V60A 4FX9A 3GD3A 4OPDA 1H7XA 2VVLA 2FJEA 4U8KA 4AT0A 5U25A 1GOSA 3SGLA 4J31A 4GRTA 4U2LA 4H4YA 3GRTA 3NGCX 4H4TA 3AEFA 2H89A 4YTPA 3AEEA 3AD9B 4J34A 3NG7X 4UDQA 3GMBA 4BK1A 2WPFA 4J2WA 1KN0A 3ALLA 4U8MA 4GAPA 4CRTA 2VQ7A 2Q7VA 2GMJA 3K30A 4IVOB 4CNKA 2BC0A 3KPKA 4WX1A 3UOVA 1BF3A 1N4WA 2FJBA 2R46A 4YSXA 3UKQA 4II3A 2PYXA 3NTDA 3UOZA 1K4QA 2C3DA 4IA5A 1ZOVA 3C4AA 3II4A 3NRNA 3T2KA 3AE9A 1LTXR 3OC4A 3GDPA 2C64A 5HY5A 2JB1A 2YR5A 1M64A 3AEDA 1FL2A 4U8LA 4B65A 1SEZA 2RGJA 1YQ3A 2XLUA 3H4KA 3AYLA 1DOBA 3GYJA 4JNAA 4RG4A 2BRYA 5KMPA 1EL5A 1TDEA 5EB4A 4B68A 5KOWA 4YSHA 3V3OA 2Q0KA 3ATRA 4X9MA 4YSYA 2DKHA 3K7TA 1PJ5A 1CJCA 3KLJA 3EAOA 1KDGA 2WBAA 3CPJG 1DNCA 2V6OA 1GNDA 3C96A 3VRDB 1E1NA 1NHRA 2QAEA 4IA6A 3UKHA 4A99A 4C5OA 3P1WA 4CNJA 1L9CA 3CIRA 5FS7A 2X8HA 5GRTA 1CHUA 1F8WA 2V61A 1OJAA 2CDUA 4EQWA 3IHMA 3H8LA 1BWCA 4TLXA 3CGDA 4ZCDA 2RGOA 2RABA 1NG4A 2WP9A 4JDRA 1TDNA 2R4EA 1DJNA 2AQJA 4JNQA 2JBVA 4MJWA 4USRA 1PBCA 2GV8A 3ZDNA 3SZWA 4KPRA 2R9ZA 1H7WA 1JRXA 1UKVG 1ZMDA 2XFPA 1BGJA 4TLZA 4II2A 1KNRA 3DJGX 3VQRA 1EBDA 3DJEA 1Q1RA 3GWFA 4G6GA 4I58A 3SY4A 2XLTA 3UKPA 2BCGG 3NK1X 1HYUA 4U8OA 2GR2A 2X99A 2XFUA 2XVIA 2YLWA 4OPGA 4H4ZA 5JRBA 2B9XA 3ZYXA 4H4WA 2WHDA 4PABA 3NYCA 4CBQA 2ACZA 3H8IA 3NTAA 1KF6A 3K7MX 1D7LA 4K22A 1Z6LA 2GRTA 1YY5A 4K7ZA 4K5RA 4H4XA 4EIPA 4OPTA 5U1OA 4U8PA 3GRSA 1L0VA 4ZN0A 1ZDLA 1S2QA 3P4SA 2XFQA 2BA9A 4ADWA 3AE1A 5HHFA 5JCLA 1K0IA 2B76A 2H88A 2YG5A 3NK0X 1DOCA 3UKLA 1NDAA 3CNDA 5HYMA 2B7SA 1GTHA 1TRBA 1F3PA 1E1MA 4NTCA 1E7PA 1FCDA 5EBKA 4Z2TA 1TDOA 3L8KA 4C74A 3L1RA 1NHQA 3PG6A 2C73A 1VRQB 1GEUA 1CJ4A 3KPFA 4BJZA 1E1KA 4CY8A 2GH5A 4A65A 4C77A 2QCUA 3NYEA 1S3EA 1REOA 2C72A 1GT8A 1PXBA 2WQYA 2XLRA 3K7QX 4BV6A 1PS9A 1MO9A 4J36A 2EQ6A 1NG3A 4A79A 4EQSA 2I0ZA 3BNMA 1FOHA 1H84A 2ZZCA 2C75A 3CNSA 2F5ZA 1RSGA 4UDRA 1JU2A 3IC9A 2JB2A 3CNTA 4YWOA 2OLOA 2BXRA 5KNLA 1F8SA 1GPEA 2FJAA 3KKJA 4TM1A 2XCGA 4E0VA 3NH3X 3CNJA 2AAQA 3QSSA 4NNJA 4YTMA 4LU6A 4YSZA 1OJCA 2BK5A 3AEAA 3OZ2A 5BVAA 1PBBA 1GERA 4EM4A 2EQ8A 1B37A 1VQWA 3SZ0A 2B7RA 5KMQA 1JNZA 5IQ1A 4G74A 3CN8A 2GAGB 2GR0A 2YLSA 1QLBA 3BI4A 1JOAA 3AE4A 3UKAA 1GXFA 2WPCA 2XVJA 3DK8A 1K0LA 4H2QA 3UTFA 2BS4A 3AXBA 3DK9A 1KSUA 3HYWA 1D4DA 5KMSA 5J60A 2CVJA 4H4SA 1NHSA 4B63A 1LVLA 3LJPA 2VVLG 3T14A 4GF7A 4PAAA 4GAVA 1FEBA 4Z24A 3D8XA 3SXIA 2V3BA 4I59A 2XYOA 2XVEA 3BI5A 3B6DA 4DSGA 4M52A 3ABVA 3ICRA 3QFAA 1IJHA 1K0JA 1TDKA 1NEKA 3G5SA 3KU9A 2X8GA 2BK4A 2E4GA 2R4JA 3AYJA 3EPTA 2EQ7A 4Z43A 4H4VA 4N9XA 1H2IA 2X8CA 2BCPA 1KFYA 3IWAA 3VRBA 4JQ9A 2XLPA 4C3XA 2R45A 2YLZA 5IPYA 3CGCA 1L9EA 1Y0PA 3GMCA 1NENA 2Z5YA 1IUWA 4H4UA 3P9UA 3Q6JA 1EL7A 1BKWA 3DJDA 4AP3A 3UCLA 4WCTA 3BHFA 1OJTA 1H82A 3AEBA 5KRQA 4HB9A 1EL9A 4KX6A 2XFOA 1Q9IA 3QVPA 4K8DA 4J33A 4G9KA 3WE0A 4Z26A 2YAUA 3JSKA 4GDPA 3V76A 4J57A 1GETA 1ONFA 2VQBA 2CFYA 3D1CA 2A87A 4OCGA 3UP4A 4EMJA 2YM1A 1FEAA 5TR3A 4ICYA 1MOKA 4ZCCA 3SM8A 1GRBA 3CGBA 2A89A 2YG3A 3KD9A 2BK3A 4Y4LA 2WP6A 1JRYA 1H86A 4U8JA 2WETA 5KOXA 3M0OA 1CC4A 3M12A 1B5QA 4CY6A 2FJDA 1D4CA 1GRFA 2JAEA 2GMHA 4D03A 1GALA 3HYXA 2TMDA 3HZLA 4AOSA 4P9SA 3CNPA 1BZLA 3L5OA 3NKSA 4H2NA 2WEUA 5EOWA 3BNUA 1PJ7A 5JCNA 3SZCA 5C3JA 2YG4A 4JN9A 1O95A 5KXJA 3VRAA 5ER0A 5BUKA 1NAAA 1PXCA 5FMHA 3AE8A 4U2SA 4LA1A 1GSNA 4XWZA 4H4QA 1V59A 3T2ZA 3UOXA 5FS6A 3EANA 2BYBA 2FBWA 3BI2A 3FPZA 3SZFA 1MXTA 5LV9A 2WU2A 1S2YA 3CGEA 2IIDA 4FK1C 3UTHA 4AP1A 1PBEA 1VG0A 3FIMB 3CPIG 5CQFA 3REDA 3FMWA 3GD4A 4TM3A 3T2YA 4GDEA 3AWIA 4YKFA 3Q9TA 3AD8B 1PDHA 2V5ZA 3UTGA 3PVCA 2WESA 5EB5A 5GSNA 3LZXA 1L9DA 4TM4A 2OA1A 1N1PA 2OLNA 2Q0LA 1E1LA 4YXDA 1LPFA 1JEHA 2BACA 2NPXA 4NTEA 5JCIA 4K5SA 4EQRA 4DGKA 4FDCB 2BRAA 3GYIA 3G5RA 3DGHA 1CBOA 2C7GA 2WDVA 1KNPA 5FS8A 1IUVA 2C4CA 3G5QA 4YTNA 3I3LA 3P4RA 1CL0A 4K2XA 4RSLA 3NLCA 4D04A 5M10A 2YR6A 5KVIA 1JRZA 4NTDA 4A6NA 2BS3A 2GEWA 1H83A 1LJ1A 4EM3A 2UZZA 1F8RA 3IHGA 3GYXA 2WDRA 2YG7A 3BHKA 4H4RA 2BXSA 3QSEA 3V3NA 3AE2A 4H2PA 4O5QA 2YLTA 3UTEA 2JB3A 1VG9A 1E39A 2IVDA 1ZY8A 2YQUA 1TDFA 1LV0A 1IUUA 1IUXA 3ICSA 1XHCA 2W0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XVF A;  3DK4 A;  1E6E A;  2EQ9 A;  1CC2 A;  5CKU A;  1COY A;  1YQ4 A;  2C70 A;  2AR8 A;  2YLR A;  4X9N A;  3AE3 A;  3ISH A;  5JCK A;  4TM0 A;  3QFB A;  1PBF A;  1P2E A;  2RGH A;  2V3A A;  1CF3 A;  2YWL A;  2VRM A;  1LQT A;  2X3N A;  2WOV A;  1B8S A;  1ZOY A;  2WS3 A;  1CJ2 A;  3E1T A;  2WDQ A;  3F8P A;  4OPC A;  2VVM A;  4H2R A;  4DSH A;  2PHH A;  1NHP A;  2J3N A;  1M6I A;  2BAB A;  3ALJ A;  3DH9 A;  4EMW A;  2ZZ0 A;  1N4V A;  2Z5X A;  3AEC A;  3P4P A;  1B4V A;  3S61 A;  4B67 A;  5U63 A;  1XDI A;  3T37 A;  2C66 A;  5BUL A;  3AD7 B;  1O5W A;  3DJJ A;  5KVH A;  1YQZ A;  2WU5 A;  1H81 A;  4Z2R A;  1D7Y A;  3DME A;  4YKG A;  5IQ4 A;  3RNM A;  3NN6 X;  1PXA A;  3KA7 A;  4H7U A;  1ZK7 A;  1DOD A;  1O94 A;  3AE7 A;  5L46 A;  1F6M A;  4USQ A;  1P2H A;  4H4P A;  4XXG A;  1Y56 A;  2WOW A;  1RP0 A;  1QO8 A;  1NPX A;  4H50 A;  4X4J A;  2GB0 A;  4EMI A;  3LOV A;  4B69 A;  4A5L A;  2ZZB A;  3ADA B;  2HQM A;  4U2T A;  2CUL A;  3SQP A;  4UP3 A;  3F8R A;  2B9W A;  3PS9 A;  3GSI A;  2YR4 A;  1CC6 A;  3ICT A;  2YVF A;  4C3Y A;  2OAM A;  3AE5 A;  1CJ3 A;  3FBS A;  2JK6 A;  5J7X A;  4NEV A;  3IF9 A;  1Y56 B;  1YKJ A;  2C67 A;  1ZKQ A;  2GQF A;  3KVE A;  2E5V A;  3O0H A;  4J56 A;  3M13 A;  3SFD A;  4A9W A;  4B1B A;  1KSS A;  2Y6R A;  2YLX A;  4NZH A;  4Z25 A;  2DKI A;  1XAN A;  1ZX9 A;  1AOG A;  1X31 B;  1S3B A;  2XVH A;  2Q6U A;  3DA1 A;  2APG A;  2BS2 A;  3NIX A;  4A7A A;  2YG6 A;  1N4U A;  1TYP A;  1GRE A;  4Z2U A;  3NNE A;  4GCM A;  3VR8 A;  3QVR A;  4ECH A;  4OVI A;  4JY3 A;  3LB8 A;  3NK2 X;  3NHO X;  2A8X A;  3RP7 A;  1DXL A;  1XPQ A;  1GRA A;  3B3R A;  4BUR A;  4GR1 A;  2O9Z A;  3AYI A;  4OPU A;  3UKF A;  3LXD A;  3EF6 A;  1QJD A;  3QJ4 A;  4HA6 A;  2YM2 A;  1W4X A;  1GRG A;  3GDN A;  3C4N A;  3F8D A;  4BJY A;  2R0G A;  2XDO A;  1ELI A;  2X50 A;  2IVE A;  3ATQ A;  1BGN A;  1DJQ A;  2GF3 A;  3UOY A;  4BK2 A;  4APN A;  2GR3 A;  5JCM A;  4BK3 A;  3GWD A;  5DBJ A;  1FEC A;  4LII A;  4Z44 A;  2VZ2 A;  5C2T A;  4Y4M A;  3AE6 A;  3AEG A;  4AOX A;  1D4E A;  3RP6 A;  3LZW A;  2GR1 A;  1LQU A;  4IVM B;  2GVC A;  5FS9 A;  2E1M A;  2NVK X;  3RHA A;  3SFE A;  1IUS A;  3CTY A;  3DGZ A;  4OPI A;  3ITJ A;  3NYF A;  4O5U A;  3COX A;  1JNR A;  1PJ6 A;  2WPE A;  2YVJ A;  4EQX A;  4CCR A;  4EIQ A;  1GES A;  1PBD A;  2QA1 A;  3AB1 A;  1GRH A;  4IV9 A;  4DNA A;  5KWF A;  2XLS A;  4GUV A;  1RYI A;  3R9U A;  3NN0 X;  4RG3 A;  3QSM A;  4B66 A;  2WP5 A;  1GRT A;  1IUT A;  4REK A;  1ZP0 A;  4FK1 A;  1ZMC A;  3FG2 P;  2R0P A;  3NT6 A;  4U8N A;  4U8I A;  4YT0 A;  1H6V A;  3VR9 A;  5M0Z A;  2GAH B;  2WOI A;  4JY2 A;  4CCQ A;  2Y6Q A;  1EL8 A;  1TYT A;  4OPL A;  5BRT A;  1PHH A;  4NEW A;  4B64 A;  2R0C A;  3P4Q A;  3UKK A;  1OJ9 A;  1PN0 A;  3I6D A;  2TPR A;  1OJD A;  3CPH G;  5HXI A;  3LAD A;  3PO7 A;  2GQW A;  4Y4N A;  1Q1W A;  2QA2 A;  2OAL A;  1D5T A;  2BC1 A;  1GTE A;  3URH A;  4A6N B;  2YVG A;  4XWR A;  2XFN A;  2VOU A;  3UP5 A;  2C65 A;  3RP8 A;  3S5W A;  1DOE A;  1VDC A;  1GV4 A;  2C76 A;  4AT2 A;  2JKC A;  2ZBW A;  4UDP A;  2B9Y A;  2C3C A;  2ARD A;  2VRL A;  3ALM A;  2V60 A;  4FX9 A;  3GD3 A;  4OPD A;  1H7X A;  2VVL A;  2FJE A;  4U8K A;  4AT0 A;  5U25 A;  1GOS A;  3SGL A;  4J31 A;  4GRT A;  4U2L A;  4H4Y A;  3GRT A;  3NGC X;  4H4T A;  3AEF A;  2H89 A;  4YTP A;  3AEE A;  3AD9 B;  4J34 A;  3NG7 X;  4UDQ A;  3GMB A;  4BK1 A;  2WPF A;  4J2W A;  3ALL A;  4U8M A;  4CRT A;  2VQ7 A;  2Q7V A;  2GMJ A;  3K30 A;  4IVO B;  4CNK A;  2BC0 A;  4WX1 A;  3UOV A;  1BF3 A;  1N4W A;  2FJB A;  2R46 A;  4YSX A;  3UKQ A;  2PYX A;  3NTD A;  3UOZ A;  1K4Q A;  2C3D A;  4IA5 A;  1ZOV A;  3C4A A;  3II4 A;  3NRN A;  3AE9 A;  1LTX R;  3OC4 A;  3GDP A;  2C64 A;  5HY5 A;  2JB1 A;  2YR5 A;  1M64 A;  3AED A;  1FL2 A;  4U8L A;  4B65 A;  1SEZ A;  2RGJ A;  1YQ3 A;  2XLU A;  3H4K A;  3AYL A;  1DOB A;  3GYJ A;  4JNA A;  4RG4 A;  1EL5 A;  1TDE A;  5EB4 A;  4B68 A;  5KOW A;  4YSH A;  3V3O A;  2Q0K A;  3ATR A;  4X9M A;  4YSY A;  2DKH A;  3K7T A;  1PJ5 A;  1CJC A;  3KLJ A;  3EAO A;  1KDG A;  2WBA A;  3CPJ G;  1DNC A;  2V6O A;  1GND A;  3C96 A;  3VRD B;  1E1N A;  1NHR A;  2QAE A;  4IA6 A;  3UKH A;  4A99 A;  4C5O A;  3P1W A;  4CNJ A;  1L9C A;  3CIR A;  5FS7 A;  2X8H A;  5GRT A;  1CHU A;  1F8W A;  2V61 A;  1OJA A;  2CDU A;  4EQW A;  3IHM A;  3H8L A;  1BWC A;  4TLX A;  3CGD A;  4ZCD A;  2RGO A;  2RAB A;  1NG4 A;  2WP9 A;  4JDR A;  1TDN A;  2R4E A;  1DJN A;  2AQJ A;  4JNQ A;  2JBV A;  4MJW A;  4USR A;  1PBC A;  2GV8 A;  3ZDN A;  4KPR A;  2R9Z A;  1H7W A;  1JRX A;  1UKV G;  1ZMD A;  2XFP A;  1BGJ A;  4TLZ A;  3VQR A;  1KNR A;  3DJG X;  1EBD A;  3DJE A;  1Q1R A;  3GWF A;  4I58 A;  2XLT A;  3UKP A;  2BCG G;  3NK1 X;  1HYU A;  4U8O A;  2GR2 A;  2X99 A;  2XFU A;  2XVI A;  2YLW A;  4OPG A;  4H4Z A;  2B9X A;  3ZYX A;  4H4W A;  2WHD A;  4PAB A;  3NYC A;  4CBQ A;  2ACZ A;  3H8I A;  3NTA A;  1KF6 A;  3K7M X;  1D7L A;  4K22 A;  1Z6L A;  2GRT A;  1YY5 A;  4K7Z A;  4K5R A;  4H4X A;  4EIP A;  4OPT A;  5U1O A;  4U8P A;  3GRS A;  1L0V A;  4ZN0 A;  1ZDL A;  1S2Q A;  3P4S A;  2XFQ A;  2BA9 A;  4ADW A;  3AE1 A;  5HHF A;  5JCL A;  1K0I A;  2B76 A;  2H88 A;  2YG5 A;  3NK0 X;  1DOC A;  3UKL A;  1NDA A;  3CND A;  5HYM A;  2B7S A;  1GTH A;  1TRB A;  1F3P A;  1E1M A;  4NTC A;  1E7P A;  1FCD A;  5EBK A;  4Z2T A;  1TDO A;  3L8K A;  4C74 A;  3L1R A;  1NHQ A;  2C73 A;  1VRQ B;  1GEU A;  1CJ4 A;  3KPF A;  4BJZ A;  1E1K A;  4CY8 A;  2GH5 A;  4A65 A;  4C77 A;  2QCU A;  3NYE A;  1S3E A;  1REO A;  2C72 A;  1GT8 A;  1PXB A;  2WQY A;  2XLR A;  3K7Q X;  4BV6 A;  1PS9 A;  1MO9 A;  4J36 A;  2EQ6 A;  1NG3 A;  4A79 A;  4EQS A;  2I0Z A;  3BNM A;  1FOH A;  1H84 A;  2ZZC A;  2C75 A;  3CNS A;  2F5Z A;  1RSG A;  4UDR A;  1JU2 A;  3IC9 A;  2JB2 A;  3CNT A;  4YWO A;  2OLO A;  2BXR A;  1F8S A;  1GPE A;  2FJA A;  3KKJ A;  4TM1 A;  2XCG A;  4E0V A;  3NH3 X;  3CNJ A;  2AAQ A;  3QSS A;  4YTM A;  4LU6 A;  4YSZ A;  1OJC A;  2BK5 A;  3AEA A;  3OZ2 A;  5BVA A;  1PBB A;  1GER A;  4EM4 A;  2EQ8 A;  1B37 A;  1VQW A;  2B7R A;  1JNZ A;  5IQ1 A;  3CN8 A;  2GAG B;  2GR0 A;  2YLS A;  1QLB A;  3BI4 A;  1JOA A;  3AE4 A;  3UKA A;  1GXF A;  2WPC A;  2XVJ A;  3DK8 A;  1K0L A;  4H2Q A;  3UTF A;  2BS4 A;  3AXB A;  3DK9 A;  1KSU A;  1D4D A;  5J60 A;  2CVJ A;  4H4S A;  1NHS A;  4B63 A;  1LVL A;  3LJP A;  2VVL G;  4GF7 A;  4PAA A;  1FEB A;  4Z24 A;  3D8X A;  2V3B A;  4I59 A;  2XYO A;  2XVE A;  3BI5 A;  3B6D A;  4DSG A;  4M52 A;  3ABV A;  3ICR A;  3QFA A;  1IJH A;  1K0J A;  1TDK A;  1NEK A;  3G5S A;  3KU9 A;  2X8G A;  2BK4 A;  2E4G A;  2R4J A;  3AYJ A;  3EPT A;  2EQ7 A;  4Z43 A;  4H4V A;  4N9X A;  2X8C A;  2BCP A;  1KFY A;  3IWA A;  3VRB A;  4JQ9 A;  2XLP A;  4C3X A;  2R45 A;  2YLZ A;  5IPY A;  3CGC A;  1L9E A;  1Y0P A;  3GMC A;  1NEN A;  2Z5Y A;  1IUW A;  4H4U A;  3P9U A;  3Q6J A;  1EL7 A;  1BKW A;  3DJD A;  4AP3 A;  3UCL A;  4WCT A;  3BHF A;  1OJT A;  1H82 A;  3AEB A;  5KRQ A;  4HB9 A;  1EL9 A;  4KX6 A;  2XFO A;  1Q9I A;  3QVP A;  4K8D A;  4J33 A;  3WE0 A;  4Z26 A;  2YAU A;  3JSK A;  4GDP A;  3V76 A;  4J57 A;  1GET A;  1ONF A;  2VQB A;  2CFY A;  3D1C A;  2A87 A;  4OCG A;  3UP4 A;  4EMJ A;  2YM1 A;  1FEA A;  5TR3 A;  4ICY A;  1MOK A;  4ZCC A;  3SM8 A;  1GRB A;  3CGB A;  2A89 A;  2YG3 A;  3KD9 A;  2BK3 A;  4Y4L A;  2WP6 A;  1JRY A;  1H86 A;  4U8J A;  2WET A;  5KOX A;  3M0O A;  1CC4 A;  3M12 A;  1B5Q A;  4CY6 A;  2FJD A;  1D4C A;  1GRF A;  2JAE A;  2GMH A;  4D03 A;  1GAL A;  2TMD A;  3HZL A;  4AOS A;  4P9S A;  3CNP A;  1BZL A;  3NKS A;  4H2N A;  2WEU A;  5EOW A;  3BNU A;  1PJ7 A;  5JCN A;  5C3J A;  2YG4 A;  4JN9 A;  1O95 A;  5KXJ A;  3VRA A;  5ER0 A;  5BUK A;  1NAA A;  1PXC A;  5FMH A;  3AE8 A;  4U2S A;  4LA1 A;  1GSN A;  4XWZ A;  4H4Q A;  1V59 A;  3UOX A;  5FS6 A;  3EAN A;  2BYB A;  2FBW A;  3BI2 A;  3FPZ A;  5LV9 A;  1MXT A;  2WU2 A;  1S2Y A;  3CGE A;  2IID A;  4FK1 C;  3UTH A;  4AP1 A;  1PBE A;  1VG0 A;  3FIM B;  3CPI G;  5CQF A;  3RED A;  3FMW A;  3GD4 A;  4TM3 A;  4GDE A;  3AWI A;  4YKF A;  3Q9T A;  3AD8 B;  1PDH A;  2V5Z A;  3UTG A;  3PVC A;  2WES A;  5EB5 A;  5GSN A;  3LZX A;  1L9D A;  4TM4 A;  2OA1 A;  1N1P A;  2OLN A;  2Q0L A;  1E1L A;  4YXD A;  1LPF A;  1JEH A;  2BAC A;  2NPX A;  4NTE A;  5JCI A;  4K5S A;  4EQR A;  4DGK A;  4FDC B;  3GYI A;  3G5R A;  3DGH A;  1CBO A;  2C7G A;  2WDV A;  1KNP A;  5FS8 A;  1IUV A;  3G5Q A;  4YTN A;  3I3L A;  3P4R A;  1CL0 A;  4K2X A;  4RSL A;  3NLC A;  4D04 A;  5M10 A;  2YR6 A;  5KVI A;  1JRZ A;  4NTD A;  4A6N A;  2BS3 A;  2GEW A;  1H83 A;  1LJ1 A;  4EM3 A;  2UZZ A;  1F8R A;  3IHG A;  2WDR A;  2YG7 A;  3BHK A;  4H4R A;  2BXS A;  3QSE A;  3V3N A;  3AE2 A;  4H2P A;  4O5Q A;  2YLT A;  3UTE A;  2JB3 A;  1VG9 A;  1E39 A;  2IVD A;  1ZY8 A;  2YQU A;  1TDF A;  1LV0 A;  1IUU A;  1IUX A;  3ICS A;  1XHC A;  2W0H A; 
#chains in the Genus database with same CATH topology
 1COY A;  4Z1Y A;  2AR8 A;  1FFU C;  3TQP A;  2WOV A;  1B8S A;  1CJ2 A;  2PHH A;  4EMW A;  2Z5X A;  1B4V A;  3CMM A;  1XDI A;  1O5W A;  3ZLG A;  1H81 A;  1D7Y A;  1P48 A;  1ZK7 A;  5L46 A;  3QKE A;  3QLD A;  1P2H A;  1NPX A;  2XH2 A;  3SQP A;  2B9W A;  2YVF A;  2OAM A;  3FBS A;  2GQF A;  2E5V A;  4J56 A;  4A9W A;  4B1B A;  2YLX A;  4NZH A;  4G6H A;  2HZG A;  1XAN A;  1AOG A;  2Q6U A;  2BS2 A;  3B9J B;  3SQS A;  3NNE A;  3NK2 X;  3NHO X;  5FJT A;  1DXL A;  3HW2 A;  2PA6 A;  3QTP A;  4BUR A;  4GR1 A;  3LXD A;  3GDN A;  3C4N A;  2R0G A;  2X50 A;  1R6W A;  4APN A;  3UCD A;  4BK3 A;  3GWD A;  1FEC A;  4Y4M A;  1LQU A;  5FS9 A;  2E1M A;  3SFE A;  1IUS A;  3GY1 A;  4OPI A;  3ITJ A;  4G73 A;  1PJ6 A;  4EQX A;  2QA1 A;  5J04 A;  2WP5 A;  4REK A;  2AKM A;  1JRO A;  5M0Z A;  2WOI A;  3SYI A;  4CCQ A;  2RDX A;  1TYT A;  1PHH A;  1YEY A;  3UKK A;  1OJ9 A;  4ZA0 A;  1RVK A;  2GQW A;  3NVW B;  2GL5 A;  1GTE A;  2YVG A;  2XFN A;  2VOU A;  1FHV A;  3RP8 A;  3UP5 A;  3R1Z A;  1GV4 A;  4GIS A;  4FX9 A;  3GD3 A;  1N63 C;  1H7X A;  2VVL A;  4U8K A;  4AT0 A;  2W3R A;  4J34 A;  2VQ7 A;  3V4B A;  2BC0 A;  2AL1 A;  3CB3 A;  3K1G A;  2FJB A;  4II3 A;  3P0W A;  2HNE A;  4IA5 A;  3AE9 A;  3D47 A;  1LTX R;  2C64 A;  1MDR A;  1M64 A;  2XLU A;  1YQ3 A;  3H4K A;  3N4E A;  1EL5 A;  5EB4 A;  3PWI A;  2XSX A;  3V3O A;  3UXL A;  3ATR A;  2DKH A;  3TOY A;  3EAO A;  4DN1 A;  1DNC A;  3VRD B;  1E1N A;  3MWC A;  3UCC A;  4IA6 A;  3UKH A;  3UJR A;  4A99 A;  4C5O A;  1L9C A;  3CIR A;  2P8C A;  5BOE A;  5GRT A;  3R0U A;  3MY9 A;  4EQW A;  3R0K A;  4G7F A;  4ZCD A;  1TDN A;  1DJN A;  2AQJ A;  3PFR A;  2R9Z A;  1H7W A;  1UKV G;  3VQR A;  4TLZ A;  2W3S A;  3DJE A;  1Q1R A;  4I58 A;  1HYU A;  3NFU A;  2XVI A;  2YLW A;  4OPG A;  3ZYX A;  2FYM A;  4H4W A;  1D7L A;  1L0V A;  3P4S A;  2XFQ A;  5HHF A;  3TCS A;  2YG5 A;  1XS2 A;  1NDA A;  1TDO A;  2C73 A;  2PCE A;  1GEU A;  3KPF A;  3DDM A;  4A65 A;  1S3E A;  2C72 A;  2WQY A;  1EC9 A;  2XLR A;  1PS9 A;  4J36 A;  4A6G A;  4A79 A;  5G5G B;  1H84 A;  2ZZC A;  1JU2 A;  3CNT A;  2OLO A;  2FJA A;  3CNJ A;  4NNJ A;  2XH0 A;  4EM4 A;  1JNZ A;  4KWS A;  3CN8 A;  4HNL A;  1QLB A;  2GSH A;  3AE4 A;  1GXF A;  1K0L A;  1KSU A;  3U9I A;  3H7V A;  1ONE A;  4H4S A;  4B63 A;  1LVL A;  3LJP A;  2VVL G;  4PAA A;  3D8X A;  3UJE A;  3ICR A;  2PTZ A;  3S5S A;  2X8G A;  2BK4 A;  2E4G A;  3EEZ A;  4N9X A;  4H4V A;  3H12 A;  4C3X A;  1SB3 B;  1JPD X;  2Z5Y A;  4H83 A;  3Q6J A;  3DJD A;  3UCL A;  4WCT A;  3AEB A;  4GYP A;  4GFI A;  1EL9 A;  2XFO A;  4G9K A;  3WE0 A;  4Z26 A;  2YAU A;  4GDP A;  4OCG A;  3D1C A;  2VQB A;  2CFY A;  4EMJ A;  4ICY A;  3SM8 A;  2CHR A;  2YG3 A;  2BK3 A;  3NS1 B;  2WP6 A;  2WET A;  3M0O A;  3M12 A;  2FJD A;  2JAE A;  4D03 A;  2TMD A;  3HZL A;  2PSN A;  2WEU A;  1ZXI C;  1TE6 A;  1PJ7 A;  5JCN A;  3SZC A;  4JN9 A;  3VRA A;  5ER0 A;  3AE8 A;  4HYR A;  3ES8 A;  4LA1 A;  1V59 A;  1IYX A;  3EAN A;  3TTE A;  4AP1 A;  4FK1 C;  3UTH A;  1VG0 A;  3FIM B;  3CPI G;  5CQF A;  3FMW A;  2QJM A;  2PP3 A;  1TKK A;  3LZX A;  4TM4 A;  1SJA A;  3ZVH B;  4NTE A;  4KPL A;  3DGH A;  3FXG A;  5FS8 A;  3P4R A;  5M10 A;  4X2P A;  4D04 A;  2YR6 A;  5KVI A;  1H83 A;  1LJ1 A;  2UZZ A;  3GYX A;  3BHK A;  3AM9 A;  4O5Q A;  2GGG A;  2OZ8 A;  1KKR A;  3ICS A;  1LV0 A;  3ZDN A;  1XHC A;  2XVF A;  3CXO A;  2EQ9 A;  5FJR A;  2YLR A;  4X9N A;  5JCK A;  3QFB A;  1PBF A;  2YWL A;  2POZ A;  3E1T A;  4DSH A;  2VVM A;  3UGV A;  2J3N A;  1M6I A;  2NQL A;  3ALJ A;  2ZZ0 A;  3QPE A;  3P4P A;  5FJU A;  1WYG A;  5KVH A;  5IQ4 A;  3ZLF A;  1ELS A;  3VC6 A;  1F6M A;  1EBH A;  1Y56 A;  3DFY A;  2OX4 A;  4H50 A;  4X4J A;  2GB0 A;  3LOV A;  4A5L A;  2ONE A;  1S7M A;  3ADA B;  3OZM A;  3ICT A;  4J3Z A;  1CJ3 A;  2JK6 A;  1MDL A;  2C67 A;  1ZKQ A;  3KVE A;  2PGW A;  2DKI A;  1ZX9 A;  1S3B A;  2APG A;  2YG6 A;  1N4U A;  4Z2U A;  4GCM A;  3VR8 A;  4ECH A;  3LB8 A;  3RP7 A;  3IJL A;  1WUE A;  4OPU A;  4G8T A;  3UKF A;  5G5H B;  5FJP A;  4HN8 A;  2YM2 A;  3OP2 A;  2IVE A;  3ATQ A;  4JN8 A;  1N61 C;  2OO6 A;  4DYE A;  4LII A;  5C2T A;  3SX6 A;  3LZW A;  2GR1 A;  4E4U A;  2NVK X;  2PU0 A;  1PDY A;  3NYF A;  3COX A;  1JNR A;  2WPE A;  3STP A;  3CT2 A;  3DGB A;  5KWF A;  4B66 A;  1GRT A;  1ZP0 A;  4U8I A;  1KD0 A;  3P3B A;  2Y6Q A;  4NWZ A;  2OPJ A;  1BQG A;  4NEW A;  3OW1 A;  4B64 A;  3CPH G;  3LAD A;  1Q1W A;  4A6N B;  3S5W A;  1VDC A;  2QJJ A;  2AL2 B;  2C3C A;  1SJD A;  4OPD A;  1R0M A;  4H1Z A;  1GOS A;  3SGL A;  4H4Y A;  1JRP A;  3GRT A;  4J1O A;  3NG7 X;  4UDQ A;  3GMB A;  4J2W A;  3UJ2 A;  7ENL A;  2Q7V A;  2GMJ A;  4WX1 A;  3UOV A;  3UOZ A;  1K4Q A;  1X2G A;  4IP5 A;  3T2K A;  1NU5 A;  1SEZ A;  3GYJ A;  5KMP A;  1RM6 B;  3V5C A;  5KOW A;  3VCN A;  4YSH A;  4YSY A;  4X9M A;  3K7T A;  3VA8 A;  2GGI A;  1CJC A;  1FHU A;  3A7U A;  1KDG A;  2QAE A;  3TW9 A;  3P1W A;  4CNJ A;  5FS7 A;  2X8H A;  2CDU A;  3IHM A;  3H8L A;  1BWC A;  2RGO A;  4JNQ A;  1PBC A;  3SZW A;  1N62 C;  2XLT A;  3NK1 X;  2QDD A;  3NYC A;  2ACZ A;  3NTA A;  1KF6 A;  4K22 A;  1Z6L A;  1YY5 A;  4K7Z A;  4EIP A;  4MKS A;  4ZN0 A;  1ZDL A;  1S2Q A;  4ADW A;  3AE1 A;  3NK0 X;  5ENL A;  3ZVH A;  1F3P A;  1E1M A;  3MQT A;  4Z2T A;  4HCD A;  3L8K A;  3L1R A;  3PG6 A;  4CY8 A;  1E1K A;  2GH5 A;  4C77 A;  2QCU A;  3NYE A;  1VDV A;  3R10 A;  3I6T A;  3V5F A;  3K7Q X;  1N60 C;  1NG3 A;  4EQS A;  2POD A;  2C75 A;  2F5Z A;  3SN4 A;  2QVH A;  3ETR B;  4UDR A;  5KNL A;  1F8S A;  2MUC A;  1GPE A;  3AMZ A;  3P93 A;  2XCG A;  3NH3 X;  3SN0 A;  3QSS A;  2AAQ A;  1KCZ A;  1B37 A;  1VQW A;  3SZ0 A;  4IL0 A;  5KMQ A;  3UKA A;  3JVA A;  3DK8 A;  4HNC A;  2BS4 A;  3HYW A;  5J60 A;  1NHS A;  3RR1 A;  1STZ A;  4Z24 A;  4E8G A;  3B6D A;  3BI5 A;  4Z43 A;  3T8Q A;  2GGJ A;  3IWA A;  2XLP A;  5IPY A;  3VCC A;  3GMC A;  3BSM A;  1NEN A;  1IUW A;  3BHF A;  1OJT A;  4DHG A;  5KRQ A;  4KX6 A;  2XGZ A;  2OZ3 A;  3FJ4 A;  1Q9I A;  4K8D A;  3NVZ B;  4IP4 A;  3V76 A;  4TVY A;  1GET A;  1ONF A;  2QDE A;  2YM1 A;  1FEA A;  5TR3 A;  4ZCC A;  1GRB A;  3RCY A;  3CGB A;  2A89 A;  3NXL A;  1H86 A;  3VC5 A;  1T3Q C;  4TVW A;  4P9S A;  4GGH A;  3CNP A;  2W54 A;  2YG4 A;  1PXC A;  4U2S A;  3RRA A;  4XWZ A;  3T2Z A;  3UOX A;  5FS6 A;  2DW6 A;  2BYB A;  3FPZ A;  2FBW A;  3H70 A;  1S2Y A;  3UXK A;  1PBE A;  4GDE A;  3AWI A;  1N5X A;  4ROP A;  3RIT A;  3UTG A;  3PVC A;  2I5Q A;  3VFC A;  2WES A;  5EB5 A;  5GSN A;  3U4F A;  2GGE A;  1N1P A;  4A3R A;  4YXD A;  1SJC A;  5JCI A;  4K5S A;  4EQR A;  4FDC B;  3GYI A;  3G5R A;  3R11 A;  1KNP A;  2C4C A;  3VDG A;  1CL0 A;  3RO6 A;  4RSL A;  2OQY A;  1JRZ A;  4A6N A;  2GEW A;  2YG7 A;  1EC8 A;  2BXS A;  3AE2 A;  4H2P A;  2AL2 A;  1EC7 A;  2YLT A;  3UTE A;  3TJI A;  1ZY8 A;  1TDF A;  1IUX A;  3DK4 A;  1E6E A;  1CC2 A;  1YQ4 A;  3AE3 A;  3DEQ A;  4TM0 A;  2OZT A;  2V3A A;  2VRM A;  2X3N A;  1ZOY A;  3F8P A;  4OPC A;  2WDQ A;  3DFH A;  3DH9 A;  3AEC A;  3S61 A;  1N5W C;  1VQZ A;  2C66 A;  5BUL A;  3AD7 B;  1YQZ A;  3RNM A;  3NN6 X;  3DG6 A;  3GC2 A;  2ZC8 A;  3KA7 A;  2P8B A;  1DOD A;  1O94 A;  4XXG A;  1RP0 A;  3ES7 A;  2ZZB A;  4MMW A;  2HQM A;  2W55 A;  4GYP C;  3NRZ B;  3PK7 A;  3F8R A;  3GSI A;  2YR4 A;  1CC6 A;  4C3Y A;  3IF9 A;  5BOF A;  1YKJ A;  3M13 A;  2Y6R A;  2PTW A;  4DX3 A;  4Z25 A;  1X31 B;  3DA1 A;  2P0I A;  1W6T A;  3FVD A;  4KT2 A;  3QVR A;  2A8X A;  1GRA A;  2O9Z A;  3EF6 A;  1QJD A;  3QJ4 A;  4HA6 A;  1W4X A;  4BJY A;  1TZZ A;  1BGN A;  1DJQ A;  2GR3 A;  1JPM A;  3D9X A;  2VZ2 A;  4K8G A;  3AE6 A;  3AEG A;  4IVM B;  2GVC A;  3RHA A;  3DGZ A;  3QN3 A;  4O5U A;  4K1W A;  2AKZ A;  3OPS A;  1GRH A;  2XLS A;  4GUV A;  1RYI A;  3ENL A;  4RG3 A;  3R9U A;  3QSM A;  1IUT A;  4FK1 A;  1ZMC A;  2R0P A;  4YT0 A;  1H6V A;  3S47 A;  1L8P A;  4ZCW A;  4OPL A;  2R0C A;  4YWS A;  3P4Q A;  1PN0 A;  3OZY A;  2TPR A;  1OJD A;  3PO7 A;  4Y4N A;  5KMR A;  2OAL A;  3N6H A;  3A7A A;  2BC1 A;  3URH A;  4XWR A;  4AT2 A;  2JKC A;  2ZBW A;  2B9Y A;  2ARD A;  2VRL A;  3ALM A;  2PS2 A;  5U25 A;  3EKG A;  4J31 A;  4GRT A;  4U2L A;  3NGC X;  2H89 A;  2ZAD A;  3AD9 B;  3MSY A;  1KN0 A;  3ALL A;  4U8M A;  4CNK A;  2PYX A;  3NTD A;  4ZOH B;  2HXU A;  1ZOV A;  3C4A A;  3NRN A;  3OC4 A;  2PP1 A;  3GDP A;  5HY5 A;  2E3T A;  3A7R A;  2BRY A;  2OVL A;  3GO2 A;  4M6U A;  3IK4 A;  3KLJ A;  2WBA A;  3CPJ G;  1EBG A;  3C96 A;  3H8A A;  1CHU A;  1F8W A;  2V61 A;  1OJA A;  3CGD A;  2RAB A;  1NG4 A;  4MJW A;  2JBV A;  4USR A;  2GV8 A;  4MGG A;  4KPR A;  1JRX A;  2XFP A;  4II2 A;  3DJG X;  4GGB A;  3GWF A;  4FI4 A;  3SJN A;  3UKP A;  2BCG G;  3AN1 A;  4U8O A;  2GR2 A;  2XFU A;  4H4Z A;  5JRB A;  2WHD A;  3R07 C;  4CBQ A;  3Q45 A;  4K5R A;  4H4X A;  4U8P A;  5JCL A;  2B76 A;  1DOC A;  3UKL A;  2B7S A;  1TRB A;  4NTC A;  1FCD A;  5EBK A;  1NHQ A;  1VRQ B;  3SSZ A;  1PXB A;  3NVV B;  2EQ6 A;  3BOX A;  1FOH A;  4E6M A;  1RSG A;  2PGE A;  3IC9 A;  4TM1 A;  4LU6 A;  4YSZ A;  1P43 A;  1OJC A;  2BK5 A;  3AEA A;  3GD6 A;  3OZ2 A;  5BVA A;  1GER A;  2GAG B;  2GR0 A;  4KEM A;  2YLS A;  1JOA A;  1JDF A;  2O56 A;  2XVJ A;  3UTF A;  4H2Q A;  3AXB A;  2OFJ A;  1D4D A;  4E4F A;  4GIR A;  1OEP A;  3T14 A;  4GF7 A;  4GAV A;  3SXI A;  2OQH A;  2XVE A;  4M52 A;  3ABV A;  3QFA A;  1K0J A;  3G5S A;  2R4J A;  3EPT A;  2EQ7 A;  1H2I A;  2BCP A;  4JQ9 A;  4F4R A;  2R45 A;  3CGC A;  3MZN A;  1L9E A;  1Y0P A;  1X2H A;  3P9U A;  1BKW A;  2FKP A;  1EL7 A;  4AP3 A;  4HB9 A;  3QVP A;  3JSK A;  1E9I A;  3UP4 A;  1MOK A;  4Y4L A;  1JRY A;  1V97 A;  1CC4 A;  1D4C A;  1GRF A;  3HPF A;  2GMH A;  1GAL A;  1SJB A;  4GME A;  3I6E A;  4H2N A;  5KXJ A;  1O95 A;  5BUK A;  3Q4D A;  1NAA A;  5FMH A;  1GSN A;  4H4Q A;  3UJF A;  3SZF A;  5LV9 A;  3BJS A;  2P88 A;  2IID A;  3GD4 A;  3T2Y A;  4YKF A;  3AD8 B;  1PDH A;  2V5Z A;  3FV9 A;  1L9D A;  1LPF A;  2NPX A;  3SN1 A;  4DGK A;  3CXB A;  1CBO A;  2C7G A;  2WDV A;  3G5Q A;  4EWJ A;  4M0X A;  4H2H A;  4EM3 A;  2WDR A;  3QSE A;  4H19 A;  2JB3 A;  4HCH A;  1E39 A;  2IVD A;  2YQU A;  4DWD A;  2W0H A;  5CKU A;  2C70 A;  3ISH A;  1P2E A;  2RGH A;  1WUF A;  1CF3 A;  1XPY A;  1LQT A;  2WS3 A;  4H2R A;  1NHP A;  2BAB A;  1N4V A;  4B67 A;  5U63 A;  3T37 A;  3DJJ A;  2WU5 A;  4Z2R A;  3DME A;  4YKG A;  1PXA A;  4H7U A;  3AE7 A;  3T6C A;  4USQ A;  4H4P A;  2WOW A;  1QO8 A;  4EMI A;  4B69 A;  3MUC A;  4U2T A;  2CUL A;  4UP3 A;  3NVY B;  3DER A;  4A35 A;  3PS9 A;  3AE5 A;  5J7X A;  3DES A;  4NEV A;  1NEL A;  1Y56 B;  3O0H A;  3SFD A;  1KSS A;  2XVH A;  3NIX A;  4A7A A;  1TYP A;  1GRE A;  4OVI A;  3CYJ A;  1FO4 A;  4JY3 A;  3SBF A;  1XPQ A;  3DIP A;  3B3R A;  3AYI A;  4DXK A;  3T0K A;  1GRG A;  3F8D A;  2XDO A;  1ELI A;  3ZVI A;  4ENL A;  1KKO A;  2GF3 A;  3UOY A;  4BK2 A;  3JZU A;  3NZG A;  2PTX A;  5JCM A;  5DBJ A;  4Z44 A;  2PP0 A;  3T31 A;  4AOX A;  1D4E A;  3RP6 A;  4Z17 A;  3CTY A;  3JW7 A;  3CK5 A;  4CCR A;  2YVJ A;  4EIQ A;  1GES A;  1PBD A;  3AB1 A;  4IV9 A;  4DNA A;  3NN0 X;  5IDZ A;  3FG2 P;  1ECQ A;  3NT6 A;  4U8N A;  4FP1 A;  3EUB 3;  3THU A;  3VR9 A;  2GAH B;  4JY2 A;  1EL8 A;  5BRT A;  3FYY A;  4JN7 A;  3I6D A;  5HXI A;  2OG9 A;  2QA2 A;  1D5T A;  3HYV A;  2C65 A;  1DOE A;  3T9P A;  2C76 A;  4UDP A;  2V60 A;  2FJE A;  5EU9 A;  1JCT A;  1FIQ B;  4H4T A;  3AEF A;  4YTP A;  3AEE A;  2QJN A;  3DG3 A;  4JHM A;  4BK1 A;  2WPF A;  3UJS A;  2PMQ A;  4GAP A;  4CRT A;  3MKC A;  2DW7 A;  3K30 A;  4IVO B;  3KPK A;  1BF3 A;  1N4W A;  2R46 A;  4YSX A;  3UKQ A;  4K2S A;  2C3D A;  3II4 A;  2JB1 A;  2YR5 A;  3AED A;  3RGT A;  1FL2 A;  4E5T A;  4U8L A;  4B65 A;  2RGJ A;  3AYL A;  3NO1 A;  1DOB A;  4JNA A;  4RG4 A;  1TDE A;  4B68 A;  3TJ4 A;  2Q0K A;  3I4K A;  3OTR A;  1PJ5 A;  2PU1 A;  1FFV C;  2V6O A;  1GND A;  1NHR A;  1DTN A;  4TLX A;  2WP9 A;  4JDR A;  2R4E A;  1ZMD A;  1BGJ A;  1KNR A;  1EBD A;  4G6G A;  3SY4 A;  2QGY A;  2X99 A;  3SR6 B;  3N4F A;  2B9X A;  2GDQ A;  5FJO A;  4PAB A;  3H8I A;  3TWB A;  3K7M X;  2GRT A;  4OPT A;  5U1O A;  3GRS A;  2BA9 A;  1F9C A;  1K0I A;  2H88 A;  3CAW A;  3CND A;  5HYM A;  1GTH A;  1E7P A;  4C74 A;  2HXT A;  1CJ4 A;  4BJZ A;  1BKH A;  1REO A;  1GT8 A;  3HRD C;  4BV6 A;  1MO9 A;  2E5A A;  3FCP A;  2I0Z A;  3BNM A;  3CNS A;  2JB2 A;  4YWO A;  2BXR A;  3KKJ A;  4E0V A;  4YTM A;  1PBB A;  2EQ8 A;  2B7R A;  5IQ1 A;  4G74 A;  3BI4 A;  2WPC A;  4IT1 A;  3IJI A;  3DK9 A;  5KMS A;  2CVJ A;  3N6J A;  6ENL A;  1FEB A;  1PDZ A;  2GGH A;  2V3B A;  2PTY A;  4I59 A;  2XYO A;  4DSG A;  1IJH A;  2P3Z A;  3PWG A;  1TDK A;  1NEK A;  3KU9 A;  3AYJ A;  2X8C A;  1KFY A;  3VRB A;  2YLZ A;  3R25 A;  2OKT A;  3T4W A;  1MNS A;  4H4U A;  1MRA A;  1H82 A;  4J33 A;  4J57 A;  4IHC A;  2A87 A;  3KD9 A;  4U8J A;  5KOX A;  1B5Q A;  4CY6 A;  3HYX A;  4AOS A;  2OLA A;  3IJQ A;  1BZL A;  3L5O A;  3NKS A;  4IZG A;  3B97 A;  5EOW A;  3BNU A;  3KUM A;  5C3J A;  3DG7 A;  3BI2 A;  3TWA A;  1MXT A;  2WU2 A;  4HPN A;  3CGE A;  4IL2 A;  3RED A;  4HCL A;  3D46 A;  4TM3 A;  3Q9T A;  2PPG A;  2MNR A;  2OA1 A;  2OLN A;  2Q0L A;  1E1L A;  2BAC A;  1JEH A;  3V3W A;  2BRA A;  1MUC A;  1IUV A;  4YTN A;  3I3L A;  4K2X A;  3NLC A;  4NTD A;  2BS3 A;  2XH7 A;  1F8R A;  3IHG A;  4H4R A;  3V3N A;  2XH4 A;  3ZLH A;  1VG9 A;  2QQ6 A;  1IUU A; 
#chains in the Genus database with same CATH homology
 2XVF A;  3DK4 A;  1E6E A;  2EQ9 A;  1CC2 A;  5CKU A;  1COY A;  1YQ4 A;  2C70 A;  2AR8 A;  2YLR A;  4X9N A;  3AE3 A;  3ISH A;  5JCK A;  4TM0 A;  3QFB A;  1PBF A;  2V3A A;  1P2E A;  2RGH A;  1CF3 A;  2YWL A;  2VRM A;  1LQT A;  2X3N A;  2WOV A;  1B8S A;  1ZOY A;  2WS3 A;  1CJ2 A;  3E1T A;  2WDQ A;  3F8P A;  4OPC A;  2VVM A;  4H2R A;  4DSH A;  2PHH A;  1NHP A;  2J3N A;  1M6I A;  2BAB A;  3ALJ A;  3DH9 A;  4EMW A;  2ZZ0 A;  1N4V A;  2Z5X A;  3AEC A;  3P4P A;  1B4V A;  3S61 A;  4B67 A;  3CMM A;  5U63 A;  1XDI A;  3T37 A;  2C66 A;  5BUL A;  3AD7 B;  1O5W A;  3DJJ A;  5KVH A;  1YQZ A;  2WU5 A;  1H81 A;  4Z2R A;  1D7Y A;  3DME A;  4YKG A;  5IQ4 A;  3RNM A;  3NN6 X;  1PXA A;  3KA7 A;  4H7U A;  1ZK7 A;  1DOD A;  1O94 A;  3AE7 A;  5L46 A;  1F6M A;  4USQ A;  1P2H A;  4H4P A;  4XXG A;  1Y56 A;  2WOW A;  1RP0 A;  1QO8 A;  1NPX A;  4H50 A;  4X4J A;  2GB0 A;  4EMI A;  3LOV A;  4B69 A;  4A5L A;  2ZZB A;  1S7M A;  3ADA B;  2HQM A;  4U2T A;  2CUL A;  3SQP A;  4UP3 A;  3F8R A;  2B9W A;  3PS9 A;  3GSI A;  2YR4 A;  1CC6 A;  3ICT A;  2YVF A;  4C3Y A;  2OAM A;  3AE5 A;  1CJ3 A;  3FBS A;  2JK6 A;  5J7X A;  4NEV A;  3IF9 A;  1Y56 B;  1YKJ A;  2C67 A;  1ZKQ A;  2GQF A;  3KVE A;  2E5V A;  3O0H A;  4J56 A;  3M13 A;  3SFD A;  4A9W A;  4B1B A;  1KSS A;  2Y6R A;  2YLX A;  4NZH A;  4G6H A;  2DKI A;  4Z25 A;  1XAN A;  1ZX9 A;  1AOG A;  1X31 B;  1S3B A;  2XVH A;  2Q6U A;  3DA1 A;  2APG A;  2BS2 A;  3NIX A;  4A7A A;  2YG6 A;  1N4U A;  1TYP A;  1GRE A;  4Z2U A;  3NNE A;  4GCM A;  3VR8 A;  3QVR A;  4ECH A;  4OVI A;  4JY3 A;  3LB8 A;  3NK2 X;  3NHO X;  2A8X A;  3RP7 A;  1DXL A;  1XPQ A;  1GRA A;  3B3R A;  4BUR A;  4GR1 A;  2O9Z A;  3AYI A;  4OPU A;  3UKF A;  3LXD A;  3EF6 A;  1QJD A;  3QJ4 A;  4HA6 A;  2YM2 A;  3T0K A;  1W4X A;  1GRG A;  3GDN A;  3C4N A;  3F8D A;  4BJY A;  2R0G A;  2XDO A;  1ELI A;  2X50 A;  2IVE A;  3ATQ A;  1BGN A;  1DJQ A;  2GF3 A;  3UOY A;  4BK2 A;  4APN A;  2GR3 A;  5JCM A;  4BK3 A;  3GWD A;  5DBJ A;  1FEC A;  3D9X A;  4LII A;  4Z44 A;  2VZ2 A;  5C2T A;  3T31 A;  4Y4M A;  3AE6 A;  3SX6 A;  3AEG A;  4AOX A;  1D4E A;  3RP6 A;  3LZW A;  2GR1 A;  1LQU A;  4IVM B;  2GVC A;  5FS9 A;  2E1M A;  2NVK X;  3RHA A;  3SFE A;  1IUS A;  3CTY A;  3DGZ A;  4OPI A;  3ITJ A;  4G73 A;  3NYF A;  4O5U A;  3COX A;  1JNR A;  1PJ6 A;  2WPE A;  2YVJ A;  4EQX A;  4CCR A;  4EIQ A;  1GES A;  1PBD A;  2QA1 A;  3AB1 A;  1GRH A;  4IV9 A;  4DNA A;  5KWF A;  2XLS A;  4GUV A;  1RYI A;  3R9U A;  3NN0 X;  4RG3 A;  3QSM A;  4B66 A;  2WP5 A;  1GRT A;  1IUT A;  4REK A;  1ZP0 A;  4FK1 A;  1ZMC A;  3FG2 P;  2R0P A;  3NT6 A;  4U8N A;  4U8I A;  4YT0 A;  1H6V A;  3VR9 A;  5M0Z A;  2GAH B;  2WOI A;  4JY2 A;  3SYI A;  4NWZ A;  2Y6Q A;  4CCQ A;  1EL8 A;  1TYT A;  4OPL A;  5BRT A;  1PHH A;  4NEW A;  4B64 A;  2R0C A;  3P4Q A;  3UKK A;  1OJ9 A;  1PN0 A;  3I6D A;  2TPR A;  1OJD A;  3CPH G;  5HXI A;  3LAD A;  3PO7 A;  2GQW A;  4Y4N A;  1Q1W A;  5KMR A;  2QA2 A;  2OAL A;  1D5T A;  2BC1 A;  1GTE A;  3URH A;  4A6N B;  2YVG A;  4XWR A;  2XFN A;  3HYV A;  2VOU A;  3UP5 A;  2C65 A;  3RP8 A;  3S5W A;  1DOE A;  1VDC A;  1GV4 A;  2C76 A;  4AT2 A;  2JKC A;  2ZBW A;  4UDP A;  2B9Y A;  2C3C A;  2ARD A;  2VRL A;  3ALM A;  2V60 A;  4FX9 A;  3GD3 A;  4OPD A;  1H7X A;  2VVL A;  2FJE A;  4U8K A;  4AT0 A;  5U25 A;  1GOS A;  3SGL A;  4J31 A;  4GRT A;  4U2L A;  4H4Y A;  3GRT A;  3NGC X;  4H4T A;  3AEF A;  2H89 A;  4YTP A;  3AEE A;  3AD9 B;  4J34 A;  3NG7 X;  4UDQ A;  3GMB A;  4BK1 A;  2WPF A;  4J2W A;  1KN0 A;  3ALL A;  4U8M A;  4GAP A;  4CRT A;  2VQ7 A;  2Q7V A;  2GMJ A;  3K30 A;  4IVO B;  4CNK A;  2BC0 A;  3KPK A;  4WX1 A;  3UOV A;  1BF3 A;  1N4W A;  2FJB A;  2R46 A;  4YSX A;  3UKQ A;  4II3 A;  2PYX A;  3NTD A;  3UOZ A;  1K4Q A;  2C3D A;  4IA5 A;  1ZOV A;  3C4A A;  3II4 A;  3NRN A;  3T2K A;  3AE9 A;  1LTX R;  3OC4 A;  3GDP A;  2C64 A;  5HY5 A;  2JB1 A;  2YR5 A;  1M64 A;  3AED A;  1FL2 A;  4U8L A;  4B65 A;  1SEZ A;  2RGJ A;  1YQ3 A;  2XLU A;  3H4K A;  3AYL A;  1DOB A;  3GYJ A;  4JNA A;  4RG4 A;  2BRY A;  5KMP A;  1EL5 A;  1TDE A;  5EB4 A;  4B68 A;  5KOW A;  4YSH A;  3V3O A;  2Q0K A;  3ATR A;  4X9M A;  4YSY A;  2DKH A;  3K7T A;  1PJ5 A;  1CJC A;  3KLJ A;  3EAO A;  1KDG A;  2WBA A;  3CPJ G;  1DNC A;  2V6O A;  1GND A;  3C96 A;  3VRD B;  1E1N A;  1NHR A;  2QAE A;  4IA6 A;  3UKH A;  4A99 A;  4C5O A;  3P1W A;  4CNJ A;  1L9C A;  3CIR A;  5FS7 A;  2X8H A;  5GRT A;  1CHU A;  1F8W A;  2V61 A;  1OJA A;  2CDU A;  4EQW A;  3IHM A;  3H8L A;  1BWC A;  4TLX A;  3CGD A;  4ZCD A;  2RGO A;  2RAB A;  1NG4 A;  2WP9 A;  4JDR A;  1TDN A;  2R4E A;  1DJN A;  2AQJ A;  4JNQ A;  2JBV A;  4MJW A;  4USR A;  1PBC A;  2GV8 A;  3ZDN A;  3SZW A;  4KPR A;  2R9Z A;  1H7W A;  1JRX A;  1UKV G;  1ZMD A;  2XFP A;  1BGJ A;  4TLZ A;  4II2 A;  1KNR A;  3DJG X;  3VQR A;  1EBD A;  3DJE A;  1Q1R A;  3GWF A;  4G6G A;  4I58 A;  3SY4 A;  2XLT A;  3UKP A;  2BCG G;  3NK1 X;  1HYU A;  4U8O A;  2GR2 A;  2X99 A;  2XFU A;  2XVI A;  2YLW A;  4OPG A;  4H4Z A;  5JRB A;  2B9X A;  3ZYX A;  4H4W A;  2WHD A;  4PAB A;  3NYC A;  4CBQ A;  2ACZ A;  3H8I A;  3NTA A;  1KF6 A;  3K7M X;  1D7L A;  4K22 A;  1Z6L A;  2GRT A;  1YY5 A;  4K7Z A;  4K5R A;  4H4X A;  4EIP A;  4OPT A;  5U1O A;  4U8P A;  3GRS A;  1L0V A;  4ZN0 A;  1ZDL A;  1S2Q A;  3P4S A;  2XFQ A;  2BA9 A;  4ADW A;  3AE1 A;  5HHF A;  5JCL A;  1K0I A;  2B76 A;  2H88 A;  2YG5 A;  3NK0 X;  1DOC A;  3UKL A;  1NDA A;  3CND A;  5HYM A;  2B7S A;  1GTH A;  1TRB A;  1F3P A;  1E1M A;  4NTC A;  1E7P A;  1FCD A;  5EBK A;  4Z2T A;  1TDO A;  3L8K A;  4C74 A;  3L1R A;  1NHQ A;  3PG6 A;  2C73 A;  1VRQ B;  1GEU A;  1CJ4 A;  3KPF A;  4BJZ A;  1E1K A;  4CY8 A;  2GH5 A;  4A65 A;  4C77 A;  2QCU A;  3NYE A;  1S3E A;  1REO A;  2C72 A;  1GT8 A;  1PXB A;  2WQY A;  2XLR A;  3K7Q X;  4BV6 A;  1PS9 A;  1MO9 A;  4J36 A;  2EQ6 A;  1NG3 A;  4A79 A;  4EQS A;  2I0Z A;  3BNM A;  1FOH A;  1H84 A;  2ZZC A;  2C75 A;  3CNS A;  2F5Z A;  1RSG A;  4UDR A;  1JU2 A;  3IC9 A;  2JB2 A;  3CNT A;  4YWO A;  2OLO A;  2BXR A;  5KNL A;  1F8S A;  1GPE A;  2FJA A;  3KKJ A;  4TM1 A;  2XCG A;  4E0V A;  3NH3 X;  3CNJ A;  2AAQ A;  3QSS A;  4NNJ A;  4YTM A;  4LU6 A;  4YSZ A;  1OJC A;  2BK5 A;  3AEA A;  3OZ2 A;  5BVA A;  1PBB A;  1GER A;  4EM4 A;  2EQ8 A;  1B37 A;  1VQW A;  3SZ0 A;  2B7R A;  5KMQ A;  1JNZ A;  5IQ1 A;  4G74 A;  3CN8 A;  2GAG B;  2GR0 A;  2YLS A;  1QLB A;  3BI4 A;  1JOA A;  3AE4 A;  3UKA A;  1GXF A;  2WPC A;  2XVJ A;  3DK8 A;  1K0L A;  4H2Q A;  3UTF A;  2BS4 A;  3AXB A;  3DK9 A;  1KSU A;  3HYW A;  1D4D A;  5KMS A;  5J60 A;  2CVJ A;  4H4S A;  1NHS A;  4B63 A;  1LVL A;  3LJP A;  2VVL G;  3T14 A;  4GF7 A;  4PAA A;  4GAV A;  1FEB A;  4Z24 A;  3D8X A;  3SXI A;  2V3B A;  4I59 A;  2XYO A;  2XVE A;  3BI5 A;  3B6D A;  4DSG A;  4M52 A;  3ABV A;  3ICR A;  3QFA A;  1IJH A;  1K0J A;  1TDK A;  1NEK A;  3G5S A;  3KU9 A;  2X8G A;  2BK4 A;  2E4G A;  2R4J A;  3AYJ A;  3EPT A;  2EQ7 A;  4Z43 A;  4H4V A;  4N9X A;  1H2I A;  2X8C A;  2BCP A;  1KFY A;  3IWA A;  3VRB A;  4JQ9 A;  2XLP A;  4C3X A;  2R45 A;  2YLZ A;  5IPY A;  3CGC A;  1L9E A;  1Y0P A;  3GMC A;  1NEN A;  2Z5Y A;  1IUW A;  4H4U A;  3P9U A;  3Q6J A;  1EL7 A;  1BKW A;  3DJD A;  4AP3 A;  3UCL A;  4WCT A;  3BHF A;  1OJT A;  1H82 A;  3AEB A;  5KRQ A;  4HB9 A;  1EL9 A;  4KX6 A;  2XFO A;  1Q9I A;  3QVP A;  4K8D A;  4J33 A;  4G9K A;  3WE0 A;  4Z26 A;  2YAU A;  3JSK A;  4GDP A;  3V76 A;  4J57 A;  1GET A;  1ONF A;  2VQB A;  2CFY A;  3D1C A;  2A87 A;  4OCG A;  3UP4 A;  4EMJ A;  2YM1 A;  1FEA A;  5TR3 A;  4ICY A;  1MOK A;  4ZCC A;  3SM8 A;  1GRB A;  3CGB A;  2A89 A;  2YG3 A;  3KD9 A;  2BK3 A;  4Y4L A;  2WP6 A;  1JRY A;  1H86 A;  4U8J A;  2WET A;  5KOX A;  3M0O A;  1CC4 A;  3M12 A;  1B5Q A;  4CY6 A;  2FJD A;  1D4C A;  1GRF A;  2JAE A;  2GMH A;  4D03 A;  1GAL A;  3HYX A;  2TMD A;  3HZL A;  4AOS A;  4P9S A;  3CNP A;  1BZL A;  3L5O A;  3NKS A;  4H2N A;  2WEU A;  5EOW A;  3BNU A;  1PJ7 A;  5JCN A;  3SZC A;  5C3J A;  2YG4 A;  4JN9 A;  1O95 A;  5KXJ A;  3VRA A;  5ER0 A;  5BUK A;  1NAA A;  1PXC A;  5FMH A;  3AE8 A;  4U2S A;  4LA1 A;  1GSN A;  4XWZ A;  4H4Q A;  1V59 A;  3T2Z A;  3UOX A;  5FS6 A;  3EAN A;  2BYB A;  2FBW A;  3BI2 A;  3FPZ A;  3SZF A;  1MXT A;  5LV9 A;  2WU2 A;  1S2Y A;  3CGE A;  2IID A;  4FK1 C;  3UTH A;  4AP1 A;  1PBE A;  1VG0 A;  3FIM B;  3CPI G;  5CQF A;  3RED A;  3FMW A;  3GD4 A;  4TM3 A;  3T2Y A;  4GDE A;  3AWI A;  4YKF A;  3Q9T A;  3AD8 B;  1PDH A;  2V5Z A;  3UTG A;  3PVC A;  2WES A;  5EB5 A;  5GSN A;  3LZX A;  1L9D A;  4TM4 A;  2OA1 A;  1N1P A;  2OLN A;  2Q0L A;  1E1L A;  4YXD A;  1LPF A;  1JEH A;  2BAC A;  2NPX A;  4NTE A;  5JCI A;  4K5S A;  4EQR A;  4DGK A;  4FDC B;  2BRA A;  3GYI A;  3G5R A;  3DGH A;  1CBO A;  2C7G A;  2WDV A;  1KNP A;  5FS8 A;  1IUV A;  2C4C A;  3G5Q A;  4YTN A;  3I3L A;  3P4R A;  1CL0 A;  4K2X A;  4RSL A;  3NLC A;  4D04 A;  5M10 A;  2YR6 A;  5KVI A;  1JRZ A;  4NTD A;  4A6N A;  2BS3 A;  2GEW A;  1H83 A;  1LJ1 A;  4EM3 A;  2UZZ A;  1F8R A;  3IHG A;  3GYX A;  2WDR A;  2YG7 A;  3BHK A;  4H4R A;  2BXS A;  3QSE A;  3V3N A;  3AE2 A;  4H2P A;  4O5Q A;  2YLT A;  3UTE A;  2JB3 A;  1VG9 A;  1E39 A;  2IVD A;  1ZY8 A;  2YQU A;  1TDF A;  1LV0 A;  1IUU A;  1IUX A;  3ICS A;  1XHC A;  2W0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...