3PK7A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens with mg and glycerol bound in the active site
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
403
structure length
396
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVYEPADSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens with MG and Glycerol bound in the active site
rcsb
source organism Chromohalobacter salexigens
molecule tags Isomerase
total genus 150
structure length 396
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2010-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3pk7A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3pk7A01
4HYRA 2PTXA 3S47A 4HN8A 3CYJA 4FI4A 1OEPA 3MY9A 1SJCA 3QLDA 3V5FA 4IL0A 2AL2B 2PCEA 1MDRA 3R0KA 2PA6A 3Q45A 2OQHA 3R11A 3TOYA 3P93A 4GYPA 3CB3A 4IT1A 1EC9A 3ZVHB 2PU1A 3ZLGA 1JCTA 3DG6A 3T9PA 3STPA 1PDZA 1ONEA 3EEZA 2PTYA 3CAWA 1E9IA 1KKRA 1MNSA 4E4FA 3IJQA 2PODA 2HNEA 3MZNA 2RDXA 3HPFA 2PP0A 3DGBA 2PSNA 3RCYA 3VCCA 3R25A 1DTNA 4MKSA 2P0IA 3VFCA 3R1ZA 5FJPA 2P8BA 3B97A 3OZYA 4H1ZA 3T6CA 3UJRA 3ENLA 1ELSA 3PWGA 2OKTA 3ES7A 1YEYA 1W6TA 2GSHA 1TKKA 1EBGA 2OZTA 4JN8A 3DIPA 2PTWA 2OVLA 4DN1A 1JPMA 3OPSA 2ZADA 4J3ZA 3FVDA 3UGVA 2PMQA 3UJ2A 4J1OA 1KCZA 4IZGA 3PFRA 3H8AA 2OG9A 3K1GA 3TJ4A 3TWAA 3SQSA 3BJSA 4GFIA 1TZZA 1WUFA 3RITA 3SN4A 3V4BA 3Q4DA 3U9IA 3UCDA 3MWCA 3MSYA 2PGEA 3NFUA 3U4FA 3TCSA 4IHCA 2OFJA 3MKCA 4A35A 3TWBA 3D47A 3CT2A 3IJLA 3NXLA 3H12A 2XH7A 4FP1A 4G7FA 7ENLA 1JPDX 4H2HA 1ECQA 3JZUA 2PP1A 4H83A 4KPLA 3SJNA 2XH4A 1SJBA 1TE6A 4X2PA 2OZ3A 4GGBA 4Z17A 3FXGA 4E6MA 3D46A 2MUCA 1EBHA 1WUEA 2XSXA 1MUCA 4JN7A 3I6TA 3T8QA 3RR1A 2OPJA 4M6UA 4G8TA 2XH0A 2AKZA 1FHUA 3OZMA 2XH2A 3N4EA 4IL2A 3SN0A 4ENLA 2PPGA 2QVHA 1KD0A 3N6JA 4H19A 3OP2A 3S5SA 3P0WA 4K8GA 3ES8A 4KT2A 2GDQA 3ZVHA 1MRAA 4M0XA 3NZGA 3H7VA 2OO6A 2QDEA 3FJ4A 2AL1A 2OQYA 3OW1A 4JHMA 1PDYA 4ROPA 1JDFA 1R0MA 1NELA 3TW9A 3GC2A 2DW7A 2P88A 3ZVIA 2QQ6A 3QN3A 2QJNA 3DFYA 4DX3A 5FJOA 4Z1YA 1P43A 4MGGA 1XS2A 3I4KA 3QPEA 2QGYA 4IP4A 2CHRA 3UXKA 3TJIA 2O56A 3SN1A 3IJIA 1KKOA 3ZLFA 2PS2A 4HNLA 1R6WA 3N6HA 5ENLA 3DERA 3JVAA 2P8CA 4GYPC 4GISA 3DESA 4DYEA 1SJAA 2POZA 3DDMA 2ONEA 4E8GA 3MQTA 4K1WA 2FYMA 1XPYA 2QDDA 4KWSA 3THUA 4ZCWA 4F4RA 3OTRA 4HCLA 1MDLA 4DHGA 4YWSA 3NO1A 3PK7A 2NQLA 2OX4A 4A6GA 3V3WA 3CK5A 1EC8A 2GGIA 3DFHA 1F9CA 3RO6A 3EKGA 4HCHA 1BKHA 2QJJA 3UJSA 1L8PA 3GY1A 3FCPA 3DG3A 2DW6A 1EC7A 3QTPA 2PGWA 4MMWA 2PU0A 2MNRA 3IK4A 3DEQA 6ENLA 2GGGA 4DWDA 2AL2A 3KUMA 5FJRA 2PP3A 3P3BA 4DXKA 3UCCA 4HPNA 3GO2A 2OLAA 5FJTA 5IDZA 1NU5A 4ZA0A 3V5CA 3H70A 4HCDA 2GGJA 4GMEA 1IYXA 5FJUA 1RVKA 4K2SA 3UJEA 2FKPA 5BOEA 2GGEA 4KEMA 2HXTA 2ZC8A 3R0UA 3PWIA 2P3ZA 2QJMA 4EWJA 3TTEA 2GGHA 1P48A 3TQPA 3VA8A 3RRAA 3N4FA 3UJFA 4IP5A 3VC6A 4GGHA 1FHVA 3JW7A 3FYYA 3ZLHA 3SSZA 2HXUA 3BSMA 2PTZA 3DG7A 3R10A 5BOFA 5EU9A 3FV9A 3RGTA 2OZ8A 3BOXA 1SJDA 4HNCA 5J04A 4GIRA 2XGZA 2I5QA 3MUCA 3VCNA 4A3RA 3UXLA 2GL5A 3CXOA 3VC5A 3QKEA 3VDGA 1BQGA 4E5TA 3T4WA 2AKMA 3I6EA 3GD6A 2HZGA 3SBFA 4E4UA
chains in the Genus database with same CATH superfamily
2PTXA 3F2CA 5BXPA 3CYJA 4XK2A 2EO7A 1U1HA 2BOEX 4CEUC 3L2MA 4IL0A 2GJXB 2OOGA 3LXCA 2Y8KA 4J5NA 2ZFAA 5M1TA 2CITA 3TOYA 4DUWA 1P6WA 2XVLA 4GYPA 2GOUA 3LN3A 4K8HA 3H2NA 1XINA 2IKHA 3FIGA 4JX5A 4R7WA 5DT5A 4EOUA 1BXCA 2ZE3A 1PDZA 1V02E 3V0TA 3GR8A 3W1TA 1UH3A 1LP6A 1V3MA 4LVAA 2NUXA 3DK9A 1DEDA 3TMLA 2DQXA 2FH6A 3MZNA 3NO3A 4ZE4A 2A7RA 2WHJA 3BAYA 3MUXA 3PPCA 3CBWA 5JCNA 1OFRA 5AYZA 1UG6A 3KCJA 1BTMA 2DT3A 4W5ZA 1JYNA 1K8XA 3QMSA 3EWUA 4QNWA 3ENLA 3L4ZA 3GFXA 2EPNA 4MDOA 1GGOA 1JPIA 1LLZA 3C2VA 3PAOA 1ZTVA 2Z1WA 4HJFA 4DJFD 1PXGA 2BOFX 2XN0A 2P53A 4DF2A 1ZY8A 3KOWA 1NWTA 3FG2P 1O4UA 3LA4A 3EDKA 3WUGA 3B0VC 5EMKA 2UY5A 1M65A 2XU2A 1ADDA 1BD0A 4AHPA 3ZJ7A 3G1FA 4OKDA 1M5WA 4QE4A 4IZGA 1ZMCA 1V03A 5LNRA 3WQOA 1G5AA 4L1WA 1K8ZA 2VGGA 3AIBA 3WLMA 4D6FA 1MNZA 3CLWA 1Q3NA 2HDJA 3ABOA 3Q37A 2E5AA 4I8DA 4AZCA 2CPUA 2Z1SA 1GHSA 4RE0A 1A0DA 4A35A 1CNVA 2QVNA 4H9YA 1YLVA 4G7FA 3AALA 1YPXA 1VCVA 3O6AA 3VIPA 4LU0A 1ECQA 1GPFA 3FAXA 1GKRA 1IXNA 1RQBA 2WCSA 4DWSC 3WK0A 3CMJA 4GUHA 3L65A 3DFQA 4Q8MA 2H8XA 4MWAA 1UD5A 4L7ZA 2Z1XA 3RYSA 2Z7GA 4DUXA 1RAKA 5C54A 2DZBA 4JN7A 3TN4A 3CQJA 1KQYA 3B8UA 1EA9C 2EKGA 1M7JA 3KX6A 5IM51 1B5TA 4GUIA 4XTIA 1MQRA 3PBWA 1OD0A 4F0RA 4B5XA 1K9DA 4P2VA 5C9RA 3SGGA 4UIOA 1G6CA 3ECQA 2KZHA 3G8EA 4ATLA 4PCNA 2QUTA 1FP9A 3ES8A 1X2GA 2JFEX 2VURA 4C6BA 4Y2WA 1ZXIC 1W5MA 1FWTA 3W1AA 2WZHA 1B31A 2BY0A 1UOZA 1TRIA 3BQ6A 2WMIB 1TQXA 1SZRA 4W8BA 5ECVA 1R7AA 3OHIA 1QBBA 1AJZA 3SY1A 1TYGA 4L1GA 5ABTA 2Y70A 3MPGA 4LRSA 4QDWA 3TW9A 4AXKA 3MA8A 3L5OA 1XD0A 2ZX6A 3NUKA 2XPKA 2ZUTA 5G4WA 1TUFA 1TWDA 1OVDA 5EY5A 3SUUA 4GYJA 5CG0A 2XVNA 5HAOA 1GRBA 5LA0A 4OGZA 2PS2A 4J57A 1FX6A 3UPBA 2AQOA 5DANA 4S3KA 3DUGA 4ACZB 3CHCA 2DUXA 1E56A 1P7TA 1ZHAA 3WDPP 3EWZA 4UTWA 2OSYA 4KERA 3LLXA 1XLJA 4LS2A 5LNWA 2PDWA 2E6DA 2PLKA 4D6DA 3EMZA 2ZKMX 2A3LA 4QJ3B 4PTMA 1WKYA 3KCLA 3MO4A 3TX9A 4F4RA 1LOLA 1G1YA 4NNAA 2NWSA 4H9MA 1SR0A 2WNQA 1FWRA 3M64A 1OIFA 6REQB 4QDMA 2WB5A 3LI1A 3RUBL 1DQXA 4P7OA 3NL2A 2IQDA 1VYRA 4PUKA 1QJWA 1EBDA 1HKVA 1NQKA 2J6VA 5GNYA 1WYIA 4WOZA 3UR2A 3UA3A 3QGVA 2RDTA 1XYLA 1IZKA 2WXDM 1EGZA 4BEQA 5IRPA 4CQDA 1GORA 3G1VA 1IZCA 2CU0A 1TG7A 3W1XA 3HG2A 5FS9A 2HSAA 1XP3A 2J7FA 4FF5A 3ITCA 1DKWA 4HVXA 1JD9A 1J0HA 1E1EA 2GJNA 3OBEA 4FO4A 4KWOA 3TQ0A 1IYXA 2DT0A 3VKCA 3IGSA 1WKFA 4MYAA 4WDXA 1W3JA 1XX1A 5KTLA 2XM1A 4AHQA 2XVPA 1X8FA 5C6MA 3N29A 1XYZA 3IV8A 3AIVA 2G5WA 3GTFA 1AW5A 4HYWA 4LUYA 5DCEA 1UZDA 3LBMA 3SB0A 4UC5A 4JHZA 3ZJ6A 4XKYA 2PTZA 3M0ZA 1GQKA 1K9FA 4C6PA 5EL1A 1YDOA 1US2A 4FOKA 1H2JA 5CJ5A 1CCWB 1MUWA 3RO8A 1ZALA 2F38A 3NTYA 1W2VA 2DSKA 3HPSA 1REQA 1OCJA 1JDAA 1N82A 1MQPA 3E02A 4BEUA 4L9YA 5JBFA 5HR6A 4TVUA 4RDVA 5B7ZA 4LV4A 4PCTA 1JGMA 4PN2A 4UTLA 1D3GA 1QXLA 3S47A 1GUVA 2BX7A 5EA9A 1UQZA 3HGOA 4D72A 3AMZA 4W4QA 2HNHA 2Y4SA 3TYEA 1Z41A 1UHVA 1V0MA 1R2RA 1TV7A 1W3NA 3M5XA 4GJ1A 2FMNA 3FS2A 2R94A 2G3NA 4AZ6A 2V38A 4DWSB 1PTDA 3T9PA 4DJED 1QTWA 3W7OA 2V5CA 3PP7A 4MTVA 2JKPA 2WYSA 4GXPA 2RJGA 3M6DA 1S3TC 1E6XM 5K2ZA 4KEZA 1EJXC 1CGWA 2Z1KA 3W1PA 1KRBC 1XIIA 4FR1A 4Y6GA 2EQ7A 2QPUA 4G9PA 3URQA 1RALA 1W3TA 1TQJA 3GVQA 2WVTA 1WV2A 2A79A 1A5NC 1H11A 4J9JA 1T96A 4GO8A 4XZHA 1SQ7A 2VKZG 4E4PA 1SSDA 1XBZA 1Q45A 3ZT5A 3ABQA 1N61C 1K4GA 3C2EA 4D2JA 1HN1A 4C6QA 1SMDA 4ZSTA 3HMJG 3GXDA 3IIXA 4XG1A 3HFYA 4HZMA 3I7RA 3ANYA 5GQBA 3N2CA 3S9ZA 1UQYA 1H49A 1V3LA 2J78A 4FS9A 1A50A 1NDAA 1ME7A 4ML9A 4R7OA 3DKJA 3LYEA 5DEZA 1PAMA 4I5RA 4TUFA 2VCBA 1BAGA 4DBUA 2CLPA 4YU1A 1FCVA 3VIJA 2W3RA 3GHTA 3DN5A 4NP7A 3NQ2A 1NHPA 1NEYA 3DECA 2WAGA 3HQNA 3CV2A 2HVOA 3N9RA 3CGTA 4FXSA 1UW9A 5CAHA 1J2WA 1RHCA 1NHRA 4HK6A 1MXSA 3TWBA 3UXIA 3FSTA 2CZFA 2XWDA 3G5EA 3RLHA 4CNUA 1AMKA 1C3FA 4LOCA 1R85A 1T40A 3STEA 2J25A 2E9LA 3LCIA 3FNDA 1QBAA 6TAAA 5DX7A 1YPIA 5GJMA 1TE6A 5FSEC 3NGFA 2FB2A 4XAPA 2MUCA 2NSXA 3R13A 1EBHA 3EGJA 3NPXA 3R0DA 3WKZA 1TRDA 4YXGA 2PF8A 1KNWA 3BG9A 4PMUA 1XLDA 1T0OA 4B16A 1IGWA 3CPGA 2XH0A 2C71A 3WQDA 4I7VA 3LDVA 1US3A 1ZBKA 3UWEA 1VBGA 1P1MA 3OQ8A 2H3BA 3B9JB 4HIBA 3ABRA 1W91A 1UZ1A 2GDQA 2J8FA 1NWSA 4BCEA 4N9DA 2RFGA 5HA7A 3GXPA 2E8ZA 5C55A 4B3LA 2E1DA 1AQ0A 2VO5A 2G0WA 3TLLA 3WJSA 2R82A 4MJ2A 2JGYA 2YW3A 5JCIA 1IR2A 4IISA 4ZB5A 3OEXA 3QMRA 4CNNA 2A7NA 2WW5A 1W9VA 5FF7A 1TTQA 3UBPC 1I0DA 3LLFA 2X40A 3W7GA 5CBJA 1ZS2A 1UKTA 4GABA 4XBJA 3W70A 4CN4A 1DOSA 3IJIA 1U22A 3HGJA 3BV4A 4O17A 3N3MA 2H8ZA 4TU1A 2C0HA 1BSIA 5ENLA 4ZVJA 3O6DA 5G2IA 4IPPA 4MFDA 2C1GA 3TYUA 4M81A 1Q6GA 2ONEA 2A7PA 4I3GA 1R86A 3A4XA 2ZVRA 4QSHA 3BUVA 5CCZA 2YCLA 3UU0A 5A8OA 3OVGA 2E9MA 3UA4A 4KWSA 3THUA 1A0CA 1KR0A 2EF9A 1CXHA 2WSYA 3HBLA 3OA3A 4YWSA 4W7UA 1TE1A 1N55A 5E70A 4DZAA 4C6FA 2CHOA 1CLXA 5CZTA 1TSIA 4C7DA 3GVRA 3DFHA 1UIOA 2NV2A 5D9MA 3TROA 3K1DA 4EM4A 2ADAA 2A8XA 4AISA 1EP2A 4YTTA 3GDRA 3V1PA 4HNVA 2V2CA 3W00A 2PP3A 4AC1X 1OADA 1XGDA 2PURA 3GD3A 1XLAA 3PBGA 2FLIA 2VXNA 5CKSA 4J3VA 4AZHA 1VCFA 1NTHA 3A12A 1DPMA 2F2KA 5C9ZA 1CXEA 1DJGA 2XZ9A 2C19A 1XFCA 1RV8A 1FWGC 4RZ5A 2OWXA 3A47A 1H50A 2DZTA 4JZ5A 4I5UA 4LS0A 4QQUA 2PI6A 1VZWA 3I6RA 3UEQA 4UNIA 4JKKA 3W2KA 3S0CA 3ATZA 2D0FA 4UFIA 1ODUA 1W1PA 1C8XA 2P1FA 2BASA 1FHVA 1GZGA 1GVYA 2WJEA 4M80A 4DVOA 4GRTA 4NI8A 2D0GA 3ZT6A 2Z27A 4ZFCA 2V3EA 5LNVA 5JCLA 4NT0A 1BLIA 4HHPA 2Y8UA 1BYBA 3WH5A 1WKEA 1RPKA 1Q6LA 3MVTA 1A5KC 1UKPA 4TVYA 4A3RA 1FDZA 3CXOA 1HL9A 3WCZA 3T4WA 2AKMA 1W2PA 2BC1A 2VRJA 3B03A 3RDKA 1FRBA 4HJWA 3H6OA 3ISIX 3NA8A 1DNCA 1SW0A 2X1IA 1GOQA 5C70A 4IQJA 1XSIA 3BLLA 2PB1A 4OBSA 3VNDA 4R53A 3HF3A 3R11A 3LM7A 7REQB 4TV5A 5G5IA 1BRLB 2PWHA 3MP3A 4EKJA 3SQPA 3JZEA 3KL3A 1JFXA 3RG6A 2HCVA 4GQBA 1X98A 4JDYA 4OJYA 3HGSA 1MVYA 1EO7A 3P61A 2CIPA 2IKGA 3AI0A 3D3AA 1H5YA 1DXEA 1MWOA 4B91A 1SPQA 3G0XA 4ORMA 4CNTA 3BARA 2QDHA 3KVMA 3VKJA 2HNEA 3KVKA 1HKMA 3PBUA 4P8VA 3NZQA 1ECEA 3STFA 3LNMA 1RY0A 4MKSA 3W7PA 4XWUA 3EZ4A 1G4PA 3A5VA 3NL3A 1FA2A 4A8IA 4LA1A 1FH8A 5DXXA 2ISFA 3VGEA 4D8ZA 1HKIA 1RM6B 1EBGA 2YOCA 4L64A 5U1OA 2Y88A 3LQLA 4F79A 2ZVIA 3O2LA 5BROA 4DJFC 4BI6A 3EDJA 1TX2A 1JPMA 3OPSA 4LS1A 4JQ1A 2OMAA 2YA2A 5LGXA 3FVDA 4J27A 2R6OA 3HZ3A 2VMFA 1Y8BA 3RMJA 3BMVA 2ZRUA 5A2AA 5IBXC 1W31A 1YRRA 2WMIA 3IIZA 4UB9A 3IPWA 1VEMA 5JQ9A 2IPWA 2B7OA 4GFIA 2YB1A 3N13A 3ALFA 4O1DA 3RM8A 2CETA 1KBKA 1HTIA 5AVNA 2BVDA 4TQTA 1FH9A 4O1BA 1E0WA 3AO0A 1KGUA 3NQ8A 3LPPA 1ZBVA 2CYGA 4IIEA 1J9YA 4Y9PA 4JQAA 2FPVA 5ABFB 4PSPA 1PEZA 2VDHA 1N5WC 2BODX 5HNNA 3TJXA 2PDJA 2B0MA 5CC3A 2PDPA 1LBFA 3C0QA 4JTQA 2BZNA 3DH7A 4ACZA 3I4EA 3SCUA 3KOXA 4GGBA 5AYYA 1AVAA 3H7UA 3C0SA 3SCRA 4B3ZA 5C7VA 4K8DA 4DPQA 1HIZA 1F4HA 2WK2A 1G01A 2NQJA 3M0YA 1IEWA 3ITTA 1HUVA 4MB5A 4A3YA 4LVFA 2A2IA 3ARPA 5BXSA 4LH8A 3EPNA 3MDWA 1UR8A 3R43A 1S5VA 4WDTA 3S5YA 1FHUA 3M16A 2EKCA 4ENLA 6REQA 1GREA 1WZAA 2GOKA 1EJSC 2WKJA 3VGFA 2NUYA 5JBEA 3Q65A 1YBQA 4RPQA 4NZJA 5E9XA 2WSKA 5E09A 3S5SA 3E5BA 3HG5A 3A4WA 2HV5A 4HSNA 1A47A 2ODOA 1MYRA 2W3ZA 4B92A 4AWEA 1DJXA 1P1XA 3W9ZA 1SR9A 3UXDA 3FJ4A 4LJ3A 3WQ5A 4DO4A 3WJXA 2GSEA 3SCWA 4B2DA 1UWTA 4UFKA 2Q71A 4H7CA 1R0MA 2ZZBA 2W5FA 1NSJA 1XCFA 3SGUA 5FL1A 1QNSA 4KKXA 1FWEC 4HA4A 1A5SA 5FJOA 4DX3A 4M7SA 5F4WA 1J0KA 1GK8A 2VNCA 4C1KA 4PGLA 2FB3A 3W74A 2VQTA 1NH6A 2OO0A 5E6ZA 3AS0A 2G4JA 3ZLFA 2DIJA 1AODA 1RJPA 3WLLA 2HBVA 4EMJA 4GISA 2QZRA 1VB9A 5FAJA 3PNZA 2PWVA 1X39A 1E72M 3M47A 5C9WA 3AXKA 2QW5A 4AWTA 5LSMA 4NZ4A 4E8GA 4WSJA 3BE7A 4F0HA 3UGRA 1PIFA 3AUJA 3MC5A 3TH6A 1E15A 3GWQA 2RJHA 5XIMA 3PAJA 4TXEA 5FS7A 4U33A 4QLKA 4Q8NA 4B9YA 1BVNP 3C8FA 2HISA 3W1LA 1X7IA 4RV3A 3TCEA 1QHOA 3QYSA 4PRTA 1AH4A 3V3WA 4I8YA 4WCJA 2WJZA 3FJLA 2VL4A 4NU7A 3UZWA 3EKGA 4LTSA 1TO3A 3KHJA 4H6QA 2GQ8A 4QAIA 3WH9A 1JRBA 3MJYA 3TTSA 1ME9A 3IK2A 4O4WA 2OX1A 4MZ8A 4PUWA 1AUSL 4JY9A 3UWZA 1ITXA 5TF0A 1Q6FA 2PWGA 2WCAA 3C86A 1JUEA 3UF9A 1ZAHA 3QPZA 1WPCA 3TTYA 1I2NA 4DWSA 1M53A 1NU5A 2NZLA 1E0XA 3MI2A 2E77A 1H41A 2J7BA 1F76A 4YNGA 4V2XA 1GVFA 3N04A 3IIOA 1G4TA 1OYBA 1GQNA 1FHLA 4PA8A 3NQGA 4S3FA 1QNQA 3AZSA 1BZLA 4MAVA 1PZ1A 3KL5A 1FFRA 1NDVA 1FFUC 1M7OA 2QEZA 1T99A 1J93A 2GGHA 5BXRA 2IQTA 3UJFA 3EYPA 3S42A 3WQVA 2HE8A 1Y7VA 2CBJA 3G0UA 1JYVA 4UCGA 3KLKA 3BSMA 3AXHA 3EDFA 4O10A 1JL8A 1QI2A 2ABBA 4IJRA 3S6DA 1ZRQA 4AC7C 2J88A 5G1MA 1D9EA 3VNLA 5CZJA 4LBSA 1PKMA 2AMXA 4GBUA 3T42A 2VX4A 3W07A 1BQGA 2VC6A 1XCXA 2EG7A 4W8AA 2CCRA 1KXTA 2PDXA 1QNOA 3C0JA 3SCVA 4J7RA 4DJDA 2Q3RA 3P67A 3V7PA 3MUAA 3B8VA 3CNYA 1OEPA 4UQBA 3TTQA 3BAJA 7PTDA 3DJGX 4XUGA 3Q45A 1WZKA 2R1KA 3SADA 4EMIA 5M17A 2REQB 2O7SA 4O19A 3DHDA 3FX4A 4L4MA 1PSCA 1XIGA 4UMAA 1JR1A 4DJEC 4C91A 4RZBA 1OQFA 1PL9A 3B9DA 4HD5A 3VTRA 1XIDA 2CLHA 3LUTA 2QGHA 3U57A 4EXAA 1OFDA 1XLIA 1T8QA 2BGNE 3S6OA 4DNAA 2BMBA 4MY9A 5F1UA 1ZDLA 3FK4A 3AISA 2AGTA 4H4SA 1HJUA 5F2IA 1GCYA 2VR4A 3W6YA 3VGGA 1XPGA 2PLCA 2ZUWA 1L6SA 2GSHA 3I3EA 4NYUA 1U5JA 4IMAA 5TIMA 1LZOA 2Z2AA 5D4YA 3WFLA 2P3EA 4DN1A 3PR2A 1S2TA 4MHBA 3PUGA 1UC5A 1DHPA 4H2CA 5DMNA 4POCA 1V6UA 3P5YA 1LBLA 3S9YA 1NDWA 2F6KA 1TPDA 3RM4A 3A3XA 3IS4A 1GOIA 1CXFA 4B4HA 2GJPA 5LXXA 2QV4A 1VYSX 4FHAA 3BJSA 4B15A 1K7XA 1EOKA 2QCFA 4GYKA 1W17A 1JPKA 5L9FA 1DJZA 1CXLA 1MSSA 5A3HA 1I75A 2X8RA 3TCSA 1NP2A 2XTKA 1M01A 3C3NA 3V1HA 1VEPA 4GK8A 3NXLA 2W3SA 1SFJA 4XO6A 1GTHA 3PZMA 1NQ6A 1V97A 1LUCB 3AU6A 3U2EA 1MZRA 1ZB5A 3GG0A 2BTMA 1W37A 2D2HA 2OTDA 3MP5A 4UBPC 3LK6A 1Q8AA 4BF9A 2BY1A 3D46A 3WZ0E 4S38A 2VCAA 3VDCA 2PBOA 4BURA 3WN6A 1FWJC 1XXXA 3W2MA 4PEEA 2NX3A 3GNRA 1EUAA 1HF6A 3AN1A 3T8QA 1JCYA 1C8QA 2QXWA 5CLTA 3L4YA 2YIHA 3WD0A 3CZEA 4M6UA 3IVTA 3M0MA 3OZMA 5TNVA 3T07A 3CJPA 3L21A 1XSKA 4K36A 2QVHA 4KCTA 1IEIA 5BW6A 1ESWA 5KITA 3GNPA 4MB4A 2X0HA 3WMSA 1XFBA 3AYSA 4HU3A 1O5KA 5AC6A 4WKHA 2YA0A 1OFPA 4BF7A 3AC0A 2B7PA 3KDOA 2W4XA 3MP4A 4HNUA 4L4OA 3LBOA 5MHBA 3AICA 3OW1A 1QI5A 1FTXA 1EX5A 2XWEA 3GC2A 1V7YA 3CHDA 4LUTB 3ZVIA 1UD6A 2VZTA 2J24A 1EZ2A 4X63A 1GKQA 1GESA 3MVIA 4W88A 1RJQA 2WANA 3TJIA 4JTUA 3GVVA 3DI1A 1NAL1 2VRKA 2VRQA 4QCFA 1KO0A 1F2JA 3OYXA 1R6WA 4H8VA 4PC8A 1YNYA 4M5PA 4UTKA 3N2MA 4DZIA 2VD9A 1GWJA 2PLMA 1BKSA 4QM1A 2EPKX 1GJWA 4LAZA 1H7PA 4LC6A 3N4AA 2X30A 4IIDA 1FO4A 3PBYA 3W4RA 1VF8A 4DEFA 1Q7ZA 3ABSA 4GKTA 1Z42A 4PUJA 2G3JA 3UPWA 1OX5A 4O1EA 2IMRA 3AHXA 3WQ8A 1OT1A 2Z0IA 3WD4A 1KFCA 2YBUA 3T1GA 2VOMA 1XLHA 3VMPA 3CK5A 5BXTA 4F8XA 3F03K 4KW2A 2ZA2A 4IQDA 3LCGA 2BVTA 4UQCA 1R47A 3EBVA 2DW6A 1AZ2A 2PU0A 4IIGA 4ZO6A 3AS1A 4ZOCA 3DEQA 4GWEA 3I10A 2W79A 2D3LA 4W87A 4DWDA 2TPRA 2V82A 4HPHA 2YYUA 1VC4A 5CSSA 1S5TA 1FKXA 2QMKA 5D32A 7REQA 1IXOA 3KLJA 3TVAA 3GYEA 1BRLA 2Z26A 2OYLA 4GUJA 4JTSA 4ICNA 1YXYA 4RV8A 1E1CB 4KS0A 3R8GA 1HX0A 2FHCA 1UC4A 3LHWA 9CGTA 3H4WA 3T0AA 2Z2BA 3N1AA 4H01A 2V69A 1O6IA 4GY0A 1M9HA 3JS3A 1F5ZA 1ZMDA 5LNSA 3Q2DA 4US6A 3ZLHA 4LFYA 3HIJA 5G2HA 2DH3A 4NY2A 3AZRA 1KM4A 4NEVA 4ZOHB 4IG2B 3AXIA 2RDWA 3BJFA 3R10A 3CAKA 3FV9A 3EA1A 3PFMA 5HWMA 5HMSA 4CD4A 1QWKA 4F9JA 1TWIA 5I78A 2G3MA 1BVWA 4XZIA 3E6EA 2CKRA 4PUDA 4DO7A 3SUVA 1WQ5A 5KZ6A 1E43A 1XL9A 4H9UA 3E49A 1CPUA 6XIMA 2QAPA 3EWBX 3RLGA 4BJHA 4JKLA 3SBFA 4PCSA 2CLEA 3SY8A 4JBRA 4HYRA 1JUKA 1DJNA 1LT7A 1RPXA 4EQWA 3L4TA 1B4KA 1GQIA 4OWGA 1EHAA 3UESA 1BYDA 3NGJA 1K02A 4Z2KA 3K8MA 2PRHA 1TPWA 3SECA 4HB7A 3VXGA 4UR7A 3S2NA 4MADA 2FTWA 2OQHA 1JF6A 1LOSA 3LLDA 3BCJA 1UCWA 4DO6A 4IIBA 4DBSA 3QEZA 3ANVA 3NS1B 1B3WA 2ZZ7A 1V6XA 1XYBA 3GXIA 1VFMA 2GVJA 2ACQA 5ABFA 3SR7A 4BQ5A 3UNTA 2VC5A 1FFQA 3FGCB 3FN9A 5CSYA 4Z2IA 1J96A 2VWTA 2JGQA 2KX9A 1KKRA 5HUPA 3P60A 4WKAA 1OFAA 3GIPA 3T81A 1LRNA 4ZQOA 2A1YA 3NQAA 3N12A 4QJ4B 1RQEA 1KQZA 2MANA 4IXHA 3H21A 2NT1A 2QNEA 2FZ9A 3SQLA 3LGDA 3K13A 3TN5A 1QOPA 4ATDA 2E1WA 4X22A 3W0KA 3H54A 4FB7A 3HQOA 3INPA 4LWWA 3GRTA 2OB3A 5DT7A 3WLHA 3CU2A 3H2AA 1FIQB 1R7OA 2CBUA 2BVYA 3OGVA 2GR0A 4O15A 2G3IA 3S1VA 2I17A 1Z44A 1WZLA 3UG3A 3P84A 1W3HA 4LSBA 4EAMA 3SUTA 2BHYA 3ZQ9A 1KWKA 3TJ4A 4URIA 2YXOA 2HTMA 3W7MA 3CASA 1T6MA 3TXZA 4CD8A 3V4BA 2FPTA 5IOBA 4OOUA 3L66A 4PFMA 1V93A 5IHSA 5FF3A 3IIVA 1GVIA 4XZWA 2BY3A 1TV3A 1J5SA 4O1FA 3NEVA 1A5UA 4Y8FA 3TA9A 4J4KA 5ER0A 4W7VA 2W66A 2XGBA 2YPIA 3NO5A 3RX4A 3NSNA 7ENLA 3JZUA 3HN3A 3UY7A 4AX7A 2D73A 2X99A 4DLFA 2VGBA 2IKIA 2XIJA 4RR4A 2PDGA 2GH5A 4Q4QA 2YVGA 4ZODA 3FXYA 2IPJA 3BWWA 3WY1A 3GTNA 1F05A 1BGAA 3BG3A 3DHFA 3S1GA 4D6HA 2EPLX 3R79A 2WZIA 3AS3A 1VFTA 2PDMA 4ZTXA 3AJXA 4Y9AA 4Q8OA 1S5MA 4I6VA 4MVAA 3O16A 3H4GA 4YLWA 3W7JA 4UTUA 4Z2LA 1I2OA 1GOOA 2CLMA 2G8ZA 1NY1A 1ZBWA 3KFTA 4TVWA 4KT2A 2QPXA 3ZVHA 3VFLA 4UTFA 4HMCA 1LLOA 2VX6A 3ONCA 1ISVA 3QZEA 3DGHA 5T9BG 5M03A 2CLLA 1IV8A 2FZBA 1TA3A 1ZUAX 1GNXA 3WEMA 4JHMA 3LZ5A 2V3FA 3CQIA 3A24A 5TD4A 2WQDA 5LIYX 4Z1CA 4FX7A 3RK8A 2O4QA 1PZ2A 2OSWA 1P43A 3GC4A 3TKFA 4BR1A 1IXPA 3OG2A 4OV4A 1N62C 1FP8A 1E0TA 2FIQA 4IPNB 3UG8A 2C0AA 3R12A 5I0DA 4JX6A 1B3VA 1F8WA 2NWRA 2ZUUA 5HULA 3CGCA 1OT2A 1M6IA 6TIMA 3BGGA 1JF5A 2NXHA 3WQ6A 3IGHX 3M44A 4DJFA 1H0IA 4MNLA 4P8UA 1Y5XA 3ZSTA 4GQ0A 4MYXA 3ZIZA 1GEUA 3U8GA 4V1XA 1JEHA 4EQRA 3CHVA 3C2RA 4YMZA 2WSQA 1MDLA 3WJZA 5IBXA 1UBPC 1I9CB 1R3VA 3RILA 1ONWA 2NQLA 3W7DA 2OX4A 3K46A 2E9BA 4QITA 3W71A 2WQPA 3G1AA 1EC8A 4GINA 4HK7A 5K3VA 3ANUA 2YCKX 3C52A 4HMEA 2BLEA 2Y7GA 1B57A 4AEFA 2EHHA 3ARSA 3MHUA 5DCBA 1RUSA 4YYCA 3P8JA 1RLDA 2DUAA 3NDYA 1QDSA 4CU6A 2QIIA 5AC7A 4B2DD 2G41A 3RIKA 4O8RA 5REQB 1CLKA 2INFA 3PG6A 2REQA 5FJTA 4H3DA 3CAVA 2RABA 1S38A 2VGIA 4UQ9A 1ZX9A 5LXEA 2ZX5A 4W93A 3L4VA 7XIMA 1TPEA 3BCDA 2NSOA 3QVQA 2GGEA 5EMMA 4A4AA 3A9IA 5D2WA 2FZ8A 5FL0A 4PTXA 3FW6A 2WZEA 5CG7A 3DOPA 3TTEA 1KBLA 2D24A 1LCOA 4IP5A 3MMUA 5C2CA 3JW7A 4GA8A 1Q1RA 2A4AA 3L5MA 4HA1A 2ATSA 1JYWA 4XVEA 5FJIA 3H22A 4CUCA 4UOJA 4IP7A 1V3IA 2UZ9A 4KPRA 1CZ1A 5FF2A 2OZ8A 2YZ5A 5J8LA 1J01A 3U2ZA 4GIRA 4XSMA 4GNVA 2C7FA 3PZTA 3TUUA 3W6LA 4OV9A 5A6BA 4J3UA 4GJJA 4A3HA 3PANA 3DFSA 5L6UA 4WEVX 3DZ1A 4L56A 4E4UA 3E9AA 5C7HA 1PWMA 3IAPA 4M82A 2R91A 5BU9A 2Y61A 1XISA 1FUYA 4YL2A 2ZRYA 1OGBA 4L6HA 3T2OA 5MKGB 1SFSA 1ITCA 1MDRA 2WOWA 1E51A 1SZEA 4D71A 4AH7A 3KZPA 1O5XA 4IT1A 4ERIA 8A3HA 4AWSA 1Z32X 2X1SA 3U5UA 4IGNA 3P2VA 1FWHC 1KRMA 5FEWA 1US0A 3GFZA 4D1IA 3F5JA 1UZHA 1XV8A 3PJWA 2E25A 3ARTA 5EBAA 2X16A 2JEQA 1LUCA 3RPMA 4N4PA 3M7WA 1AW2A 4JCMA 4IPJA 3IJQA 1YQZA 4Z2HA 3LRKA 1OC5A 5CGMA 4N2YA 2WOVA 3NG3A 2RHGA 3DC0A 3VX0A 3GH7A 1W5NA 1O12A 2UY4A 1DTNA 1MFVA 1GG0A 4F2TA 5BU6A 1E71M 2WV8A 1JCNA 1ZBCA 3VFCA 3EA3A 5CZ0A 3AMDA 3WH8A 2YW4A 1KV5A 2EQ9A 3LSBA 2ANUA 3WLOA 1NIUA 3BLOA 1LQ0A 4B3KA 1PX3A 1FEBA 2WM0A 3W7HA 4DF0A 4W85A 1OYAA 2C16A 4L80A 3BOLA 1EKOA 1UWRA 1CGXA 1GJUA 3EXRA 2A21A 5A8QA 4JDRA 1VLIA 4TV6A 1OX4B 2WBGA 1TB3A 1LPFA 4DJDD 2GUUA 1PYFA 4RXGA 1XLCA 3M41A 3U2OA 4J1OA 1UH4A 1DJQA 3S5NA 3N2OA 2J75A 3H8AA 3D9XA 3AMKA 3BSHA 3DHPA 4LUTA 3XIMA 1E5NA 1LDCA 3QFAA 5FACA 2EXOA 2VUNA 5E1QA 3PZVA 2OFJA 2XJ7A 3E38A 4E8DA 3AIEA 3FDKA 1QPKA 1V8EA 1U1UA 3RM9A 2WC7A 1X7FA 3QY7A 4LQ1A 4Z0JA 2E3TA 5H91A 1H0GA 1UUMA 4E2BA 4QG6A 2CC0A 1MI3A 4JPGA 3U4AA 4IUGA 4JNYA 1EJRC 3B9EA 4G6CA 3D6NA 1J2BA 1G94A 3W23A 3DK8A 1IZJA 3TN3A 4IMDA 2A3BA 1JG9A 3N4EA 3NQMA 3SN0A 1VFSA 2XN1A 2PPGA 3UPMA 1VGAA 4M6VA 4LEQA 3GNXA 1Z48A 8XIAA 1JUBA 3L4WA 4K8GA 1BEUA 3TAKA 3M4HA 4YWOA 1UB3A 2BNJA 1HO1A 3VNZA 1J12A 1F7BA 3VCRA 4JTCA 2IQ0A 4W84A 3PN8A 2V8ZA 1QWGA 4EWND 1WDSA 3V75A 5BOOA 1EDGA 1WP6A 3ARZA 4M7TA 4ZMGA 3WJYA 4DJEA 1GZJA 1DE6A 4JD4A 3P0XA 3TA6A 1PDYA 4HOXA 3ABXA 3SGZA 5AHNA 1A5LC 1NELA 4CD5A 4IM4A 2PWDA 3Q58A 3MSRA 1QI0A 1A4MA 3BPWA 1X6LA 2VHLA 1GG1A 4UQAA 2QKFA 1EGMA 1E1CA 4M29A 3HV9A 1VIZA 4EACA 3SCOA 2O56A 3QFWA 4RDYA 4AW7A 4JTFA 1N8IA 2O55A 2OGJA 4C6NA 2PCQA 3CL7A 5HQMA 1XSJA 4LYKA 5K4XA 5H1WA 5F2MA 1IR1A 1WYGA 4HHLA 4ZO7A 1KXHA 3EWDA 4TMCA 5F4SA 1RCXB 5HQLA 1A80A 3FEQA 3HG3A 4IG2A 1V4YA 5CSUA 2OKOA 3LCHA 1RR2A 3O63A 2XFYA 1TJ2A 3C0LA 3DAQA 4PL1A 1WZMA 2YL8A 3TNOA 3FA5A 1UASA 3NQFA 4NXKA 4YPJA 3G3MA 2NLIA 3FHAA 4FOJA 2R1PA 5EFDA 1VDVA 5FA5A 4GOAA 1KBJA 2ISSA 4ZB0A 4ROQA 3W38A 3CS2A 1QNRA 1DJIA 4P7LA 4KBXA 2X42A 1LRTA 4Y8EA 4N9EA 3UVAA 1Q6EA 3N73A 1PZ0A 2EPMX 1XLKA 4NRRA 2CDUA 2C8NA 2WHLA 3TU9A 5I5RA 3HFTA 5IHRA 5E5CA 1G4EA 1BG9A 7A3HA 4L1XA 3FVMA 4U2ZA 4V27A 4ZO8A 4S1FA 5D38A 1YXDA 3CQ0A 3VUSA 2Z1VA 2HPMA 5U25A 2HJPA 3H70A 3PSWA 3BG5A 4REQB 3W1MA 2GVGA 3W6MA 2E6FA 3W75A 5CLWA 1HO4A 3BGAA 2GGJA 4AIBA 4D6IA 3HB9A 3FGCA 4DPPA 5HNTA 1TJPA 5CPSA 2EPOA 3PM6A 3E2QA 4CN1A 2H3DA 3BDKA 4ZR8A 1AH3A 3SDOA 2BXZA 2YLAA 4MM1A 3W29A 3RRAA 1B30A 3R7MA 3SR6B 1TJ1A 1TMLA 4RE3A 4EE9A 2FH8A 3GKAA 1AFSA 4NYYA 3SSZA 3QYQA 1XF0A 5HNRA 2PD5A 4LRTA 3VOIA 4BKNA 1UJQA 4YCOA 4PTVA 1JFHA 1R3YA 1RH9A 3WBEA 4XISA 4OIFA 3R58A 4L4LA 3H26A 2VD8A 3GHUA 4LUJA 5A95A 4GCXA 3KXQA 1DBTA 3SUSA 3WLIA 2CFYA 2YZRA 4JAWA 3L2LA 1KRCC 3U5YA 4YWIA 2HZGA 1HG3A 1H51A 3O3RA 4KRTA 4B5TA 4WRHA 4IGHA 1TPUA 3LX9A 3GAKA 3W2LA 3GG7A 1AJ2A 3BMWA 4UFHA 3URBA 3DH9A 1ZCCA 3K8KA 3S5OA 4Z0SA 4QISA 3GNDA 2AL2B 4NJHA 4TOQA 1CB7B 1QATA 1E6PA 3V16A 4LALA 4ZL1A 1DXIA 3HPXA 4EM3A 4X9YA 8TIMA 4QRNA 1A5OC 1Q13A 2F6XA 3CMGA 4WX2A 4F40A 4WJ8A 1JCTA 3DG6A 4Q22A 1W5PA 1EP3A 3GX9A 4GH3A 4CCCA 2Y8VA 3B0UX 2PTYA 3KS5A 1EGVA 1Q4WA 3RPDA 1QPNA 3E0WA 3T0TA 2Y89A 2YB4A 4E4FA 5K9DA 5FF4A 2WVUA 2PP0A 3DGBA 3G1HA 3MCNA 1FWIC 5D2XA 3R25A 3KAOA 3G1DA 1R3SA 2VR2A 4J2PA 1WXYA 2P0IA 3P82A 3LY0A 4CNSA 3GHRA 3EWXA 1OCNA 2ZUSA 2J8GA 1ELSA 1EFZA 1I1XA 5FCZA 3ES7A 1W6TA 4IJBA 5EMJA 2TRSA 1ME8A 5HNUA 1OB0A 4C90A 4AX6A 1A4LA 3PPGA 3HQ1A 1NDZA 1ZFJA 3GTHA 3T2PA 3NZPA 4K7ZA 4IF2A 3A3HA 3WQFA 4RZ4A 3IJ7A 3UJ2A 2RUSA 4BHYA 3KOYA 3VIGA 1JZ5A 2ZX9A 1KCZA 3PJUA 3WD1A 2A3AA 4XIMA 3OLDA 4XAFA 2JQXA 4GKLA 2BGSA 1POJA 2LLEA 4QQ3A 3CT7A 1ISZA 4OHQA 1R3TA 4C6OA 4XZMX 3KDNA 4PBFA 5C8BB 4F9DA 1D7KA 3MSYA 3AMGA 2PGEA 4KIEA 3REQB 3KCOA 1P0EA 4IHCA 1DWGM 3CQKA 2XH7A 4L6DA 1ICQA 4AG0A 3R8HA 4HBKA 2PP1A 1OZMA 1DWIM 5CEWA 1UROA 3W72A 6XIAA 4PUNA 3SJNA 1FCBA 2XH4A 4Q7IA 2C14A 2BHZA 4QAWA 2J7EA 4BV6A 3FDGA 4UZUA 4FXJA 1A53A 2D2JA 4NL1A 1Z8AA 3AQUA 3B06A 2BOGX 4Z1BA 3BAKA 1OFOA 2BC0A 1HVQA 2J7CA 4TR9A 1G9HA 2AQVA 4TX8A 5M3WA 1R8LA 2NV1A 5CZSA 3LHVA 4PL2A 4M19A 4NNBA 4UMCA 1H62A 1XQLA 5E9AA 4EXQA 2DZXA 3W1UA 1YNQA 5JBDA 1STZA 3U3HA 3VZXA 5RUBA 2VTFA 4R9OA 3EOEA 1UWIA 4O0ZA 1LT8A 1V3KA 3A22A 4YVXA 3SUWA 4R85A 4O8AA 1SO6A 1K8CA 4GO9A 4WY0B 1GVOA 1L6WA 2IS7A 1TWSA 4RE2A 4A05A 1M7XA 5REQA 2OT1A 2FQIA 4H7ZA 4PMQA 4N6EA 1JDFA 1VPXA 2GJRA 2PWFA 2XINA 1QPOA 3B9NA 2Z25A 1Q4NX 5I79A 2QQ6A 1ZJIA 2QJNA 2RGMA 3EXSA 3ZS4A 1SYTA 3C61A 1QCWA 4GACA 4XQ6A 4IP4A 4GI8A 1M68A 5CPMA 1YMYA 1BG4A 4KRZA 3WD3A 4RW3A 4EF8A 2E68A 5JH2A 3XISA 2BSLA 1FY6A 1W3LA 3W84A 1R46A 1W1A1 5T91A 4DBDA 4UTHA 4AD5A 3PBVA 1RVGA 2Z6IA 3W22A 1FXPA 3AJ7A 4JNMA 2Y6ZA 4QGCA 1IQ8A 4GLEA 1ICPA 2V3BA 4QBXA 5CXPA 3QQ1A 3H2OA 1JEZA 4P8WA 1P0BA 2CNCA 3F5LA 3RNDA 2QDDA 3B4UA 1DWJM 3THQA 3HPZA 5SWUA 3WFAA 2JE8A 4A2RA 2X09A 2ZZ4A 3UR5A 2DZVA 4YS1A 3BICA 5BMWA 1MUMA 3UG4A 3PK7A 2BB0A 2J62A 4Y7EA 3FHQA 5EBKA 4GJIA 5BRPA 4C5ZA 1GT8A 4RDZA 3N9KA 1A5BA 2PE4A 1WDDA 3GDMA 3AFBA 3OZPA 4RNIA 5G2WA 1G67A 2W27A 4FLOA 3F4VA 1UR3M 5MKGA 3KUMA 4XAGA 3OZOA 4M1RA 1EWDA 3CIXA 3ITYA 1M7PA 4AIOA 1BWLA 1PHWA 1NHSA 1R3QA 4EQSA 1QASA 2JIEA 1UIPA 3EB3A 3EXTA 1KA9F 7TAAA 1H1ZA 5HOSA 3M5YA 3T0DA 1EHNA 1A0EA 1E70M 1JJKA 1GXFA 3MI3A 2C15A 1XG3A 2OELA 1UR9A 1YQ2A 4H00A 1WAWA 4MFEA 3CZ8A 4Z08A 2QJMA 1AOGA 1GVEA 2JIWA 2E8YA 1J8VA 3KBSA 4Q8QA 8XIMA 5ABEA 3LHZA 1LWHA 1TFVA 3OBAA 4AUBA 3TDFA 4J3WA 2QCEA 1PZ3A 2E7FA 3DG7A 4X61A 1OINA 1PCKA 2IPFA 2CLFA 1AG1O 3IRDA 5D9NA 4YVVA 2CFFA 4GQGA 2G95A 4Y9NA 4LC8A 2OLHA 4HU0A 4NRSA 4H8NA 3M07A 1JDEA 1CDGA 3CC1A 3DXIA 4IIFA 2GVLA 4CGTA 4ZQCA 1K7FA 1OX4A 3PNUA 4K7VA 1HKWA 2YSWA 5CPOA 3VVGA 3F4CA 1VD6A 2DIEA 1V6WA 4HN8A 1QO2A 1GEQA 3IJ6A 3K2GA 5DO8A 1KFEA 4FNTA 3UFYA 1XDIA 1I45A 1ZL1A 4I9MA 1XLMA 4UXDA 3V0UA 1XHCA 4NX5A 3L67A 1O5RA 3LCFA 2YVJA 1XHGA 4D1JA 4PTDA 1TYPA 4X3ZA 2E4TA 5A8GA 4Q4SA 2BV9A 1IIHA 2D3NA 3BCFA 3KWSA 4FLRA 3O15A 3SQMA 3LERA 1GV4A 1LOQA 4BQ2A 3B9AA 1B3XA 1TX0A 2V3AA 1JRCA 1OC7A 3I68A 2YA1A 1B0IA 4TMBA 1E9IA 4W9TA 4B5WA 5DY2A 2V63A 1XLLA 3FJ6A 1OK4A 1HVXA 1ZENA 3VINA 1ISWA 2XIIA 2GZXA 1T3QC 2PSNA 3TR2A 4UZSA 1A5MC 5TQLA 4PB5A 4RPPA 2D0HA 5A6MA 4Q6JA 1XANA 4H4XA 2VT0A 5XINA 5AC5A 1NOUA 3LCXA 3WF2A 1O7AA 4RUBA 5G1TA 3THAA 4H1ZA 3VILA 3FYPA 4AYGA 1C93A 3M0JA 1M3UA 1Q8JA 4PMVA 3W85A 4RX0A 4WXZA 2VWSA 2DVXA 1WCGA 4M1BA 1GYLA 1XC6A 2X1UA 3V18A 3VD9A 5A6BD 1L2UA 2V68A 3K4AA 1I1WA 1GRFA 4J3ZA 1FCQA 3KBMA 4Q32A 8CGTA 4OTKA 1O1ZA 1H60A 2BXYA 3CQHA 3T09A 1WKDA 2CWXA 2Q09A 3I7SA 4DJDC 4H9ZA 1JCMP 3EX6A 5K7JA 3B04A 3QR1A 1B90A 3SQSA 3XINA 3C4UA 1WUFA 4ZO9A 3LQGA 4MPKA 2EGZA 1VFFA 3PTQA 4XTDA 1HQTA 3AXMA 3PBMA 1KLZA 1OF6A 3QPYA 3U4FA 5LA1A 2HRWA 1KM2A 4OOZA 2Q3OA 3EPOA 2X0YA 1KBBA 2PDCA 3S5ZA 3RCMA 4LAMA 4OFCA 2P5NA 4EXBA 4LX4A 5D09A 4NI3A 4AMCA 3SRKA 1R87A 5HMDA 3OLGA 1F6PA 3VE9A 1LG2A 2ZC1A 1XBVA 3VOGA 4AD4A 5AHIA 1N8FA 4FSAA 4TTGA 3HRDC 3CV7A 3DKLA 4X2PA 2OZ3A 3A3WA 4AMAA 4GYFA 3KP1A 2GR2A 1YDYA 1ZGDA 2PDLA 3WDQA 1WUEA 3U2CA 4HOZA 3S3GA 2HMCA 1F07A 2ZXBA 4MLRA 3ARWA 2F61A 3I65A 2JALA 1O66A 4ALDA 1H3GA 4LVBA 4L5ZA 4NVTA 1HGWA 5GRTA 3GDLA 1W1B1 4FXRA 3TYDA 2AOSA 6A3HA 2QCGA 3QH2A 2Q6ZA 4HK5A 2YX0A 4NSBA 1XH0A 5T26A 2VC7A 1UKOA 3P8IA 3KVJA 3LGGA 3LCWA 4KRUA 3W1NA 3P6LA 4NUWA 2W91A 1P0DA 1XLEA 1F3PA 1PV8A 5C2XA 2WMFA 3UY8A 5F7UA 3LEPA 2CEQA 5AHEA 3KZSA 4GXMA 2NVDA 3MV01 4ZE5A 1VFLA 2A6NA 1WAUA 2BCPA 3R4IA 1EJ7L 3HU7A 1DQUA 5A1AA 2L5HA 4EAYA 1SFLA 4REQA 1D2KA 5F2GA 1DVJA 4Z1YA 4H6EA 1X1NA 1GEHA 3NWRA 4DB7A 1MOKA 3LNPA 4AEEA 4QCEA 4DBWA 3CL6A 3TLQA 3L2IA 1D7FA 1NP0A 2H90A 1TPVA 4UOZA 3WQ4A 4HPGA 1PO9A 1FH7A 3KTCA 3DESA 2XZ7A 2JBMA 4O57A 1JZ7A 4LANA 3GU2A 3IJ9A 4PTWA 4FPSA 1LJYA 2JEPA 3TYCA 2QCHA 4X0NA 2FTYA 3MU7A 1PX8A 2DU2A 9RUBA 3QBUA 2CLOA 5BNKA 5AHMA 2QIWA 5C0QA 5MF5A 1XRFA 3W53A 1Y5VA 1XH1A 2BY2A 5DY3A 2GGIA 1YE4A 3M0KA 3N11A 3CZKA 4UMBA 3CB8A 3RF9A 2C3CA 5CC7A 2BFGA 4ONVA 2QJJA 1XUUA 1L8PA 4S3GA 4BI5A 3FCPA 1C91A 2PGWA 4FNRA 3IK4A 2Z6JA 4S2CA 1S7MA 4ZZ9A 1DORA 2F6UA 2AL2A 2XUCA 4JTTA 2I16A 3FJNA 5AB3A 3MYOA 3IUIA 1MZHA 1QOQA 1HP5A 5HK4A 4ML4A 1MEIA 3TE9A 3QW4B 5IDZA 2GDUA 4AF0A 1MXDA 1DQWA 1ZY9A 1RCQA 3WDRA 5A6TC 3NSXA 2HBXA 4J2MA 1FDJA 4MKVA 3GW0A 3APYA 1Q2SA 3AROA 2FKPA 3GW3A 4C6LA 2ZYFA 3MUZ1 4KEMA 5CJNA 3CPRA 4W86A 1TPC1 3EMCA 3EA2A 2FGZA 3ZO9A 1OX6A 4L9ZA 1VPYA 5A8MA 1N63C 1S2UA 4AZCB 3WQGA 1MW2A 1Q63A 3AWOA 1E6QM 1J6PA 4XKMA 4MWAE 3SI9A 4QR6A 3VDAA 3QOKA 3LPFA 1KM0A 1SJDA 2PZ0A 2A85A 1R9ZA 2EQ6A 3G77A 2Y7DA 2I5QA 3WDJA 1XRVA 5FEZA 2WP5A 2DT1A 2OGYA 1CW2A 1IEVA 1EL3A 2CZ5A 2Y5JA 3D5HA 4E3TA 3QFEA 3N6QA 4DUOA 4E8CA 2H9AA 4N9BA 2VOTA 2WMKA 1UR2A 3NR0A 2NX9A 3QLDA 3TYZA 3VIOA 1PTGA 2XM2A 1R38A 4MF4A 2X2GA 3WD2A 3O0FA 5KSWA 3E2SA 2VUYA 4ZQNA 3P93A 1GW9A 2XVKA 1XIBA 4NAEB 3REQA 3QV6A 1V08A 4U10A 1XKJA 1JGIA 3N14A 4Q4RA 3PZGA 1ZKQA 1J0IA 5KETA 1GQLA 1QT1A 3HOJA 4HSOA 1JXKA 3WK1A 4FAMA 3G18A 2QULA 1VJSA 4MUZA 2CW6A 1WDRA 3UYCA 2GDVA 1NVMA 3W7EA 1EB3A 2PODA 4JQ9A 2RDXA 5FD0A 1A3WA 2XVGA 4H6RA 2XFRA 2O9RA 2BDQA 1XQKA 5KINA 4QLLA 3Q6JA 1VRXA 4UR9A 2ZZCA 3PULA 5LA2A 1HL2A 3TN6A 3SRHA 3DU0A 1WXZA 3G2GA 2FPYA 3N34A 5I3HA 1FOBA 5HR7A 2YL6A 3G22A 2GQ9A 4H4QA 3V5OA 2TSYA 2J27A 3ZXWA 1R5YA 3W1RA 1XUZA 3SW6A 1N5XA 2GYIA 3EWWA 3TFCA 4L4PA 3QY6A 5EYWA 3W7NA 4M3PA 2ZADA 2E5CA 1TR1A 3A64A 3LRLA 4AHOA 3QJAA 4XZBA 4R27A 2HE5A 4H41A 2PMQA 2WPFA 1GTEA 4KETA 3VGHA 4F0MA 2D69A 1W3IA 4R88A 3LADA 4GNKB 4RNFA 2J6XA 3K5XA 4WY0A 1CXKA 3LM3A 2XFWA 3PFRA 5AECA 3GFYA 1UUOA 3BC9A 1M1BA 4Z2GA 3Q4DA 3DK4A 2V6AA 4AZIA 1Q7MA 4WGXA 3NDOA 3DCPA 3E2RA 3WLSA 3EMQA 2VEKA 1PPIA 2C1IA 1BWVA 1CGVA 3SY5A 3N18A 2CXGA 1TIWA 4GI6A 5FI8A 2V6OA 4Q7BA 4PCPA 3R07C 2DSZA 2QV5A 3OGRA 3FA4A 3CWOX 4JIHA 5C2GA 3KTXA 1V3HA 1HXJA 1U1JA 3C8NA 4GVHA 2J13A 5DRCA 4R3UA 3AMLA 3IANA 3E0IA 3CUJA 4MJMA 5FS6A 2ALDA 4DO5A 3MKVA 1RP9A 5I09A 5LZLA 3TONA 1KCKA 1TZ9A 2VEIA 2XSBA 2CZVA 4IL2A 2ZQ0A 3NVYB 3SRFA 2VZSA 3LRMA 2GJXA 3PY2A 2XG9A 4JIPA 2RGLA 2EPHA 2WPGA 1E4LA 1GETA 1P6CA 4L61A 3P0WA 2NQ5A 4RL3A 1XM3A 1KFWA 1KFBA 1MRAA 3RMEA 1X97A 2J8TA 4M0XA 3O8AA 2I14A 4BZYA 3SFKA 2VGFA 1QK2A 3BZJA 3A4AA 3GUGA 4PB4A 4H9XA 2PDNA 1SO5A 3G1YA 3QQ0A 1PVNA 3CO8A 3ME3A 3T78A 4ZQPA 1RK6A 1UBSA 5B7YA 3WO8A 3UWVA 2WBAA 4DY1A 4YCPA 2J66A 2Q8XA 4GVIA 4KEUA 1JZ6A 4I90A 3R6IA 3PHAA 1UP2A 2XIBA 3EX3A 5AVHA 4QHRA 2OODA 3M0XA 3VOCA 3VGBA 1JDCA 1H09A 1H7RA 3LMZA 2YDRA 3NL6A 2P8CA 2X7WA 1K8YA 3A7UA 4D6CA 5I23A 4KWWA 2A3HA 2Y5SA 5JVLA 1GKPA 5LNUA 3DDMA 5D8WA 3SIZA 4K7YA 2PTDA 1GVRA 2PGFA 4NJKA 3S1UA 3PZUA 4O16A 3DYOA 2VC9A 4UTIA 3AHVA 4PULA 1HGYA 1K9TA 1UWAA 2DZWA 1TWZA 1G0CA 2WHMA 4NIRA 1NJJA 1S2CA 5M5DA 2J7DA 4O50A 4WVXA 3VAVA 4IXXA 3RRXA 2PDQA 5AYBA 4Q4KA 1YYAA 4A6GA 5T9CE 2PDYA 3LXAA 4W8LA 5EKYA 3SURA 3VMOA 3GXTA 1F9CA 4K6AA 3RO6A 1EXPA 3RNMA 4ZB2A 2D20A 3O0KA 4AQLA 1UR4A 3QTPA 1NOWA 4OUIA 2J9YA 1JI1A 3P7YA 3O0HA 4F48A 3M43A 2GQWA 3P3BA 5GJNA 2DZPA 2GRTA 3NL5A 4JICA 3QTGA 3HW2A 2OLAA 1F8IA 4I9TA 1JIBA 4P7RA 4XX6A 1ISYA 1BHGA 1Q6CA 1POKA 4AVFA 1E9YB 3OC4A 4NKCA 2DZSA 3TSMA 2DIKA 4GMEA 4E2DA 2O0TA 1UD2A 1ADSA 1E3XA 1UWUA 2NVAA 4P7NA 1B9BA 4GQRA 3WQPA 4MAZA 3KM8A 4CCZA 1KM3A 3UW6A 4KCWA 4BS0A 5KZMA 5DELA 2ZICA 4FLQA 2X0SA 1RY8A 5D2TA 3VD4A 3CL8A 3WELA 2QS8A 2GUBA 2XGIA 3T0CA 1FCUA 3GRSA 3OOQA 5A69A 4GVGA 2I57A 3QV9A 1W56A 3LBCA 5GNZA 1W1TA 3S46A 1NM9A 2QCCA 2XGZA 4IMGA 5A2BA 4PUMA 1ISXA 1E9LA 3UXLA 1MW0A 3HURA 1OF8A 4GZJA 1PUDA 3GQYA 4RJEA 4E5TA 1SW3A 3POCA 4IMEA 5IFTA 4K37A 3GNOA 4MG4A 4ZSUA 3LOTA 5FEPA 2OWCA 5LHFA 2O9PA 1VPQA 1D7YA 2W0UA 3BLDA 1KV8A 4FI4A 5C9UA 2EQ8A 1E4NA 5KVHA 4RE4A 1ADOA 3ATYA 1S2WA 4N4QA 3V5FA 2FGLA 5GPRA 5I3IA 4GVFA 4EPEC 1TCDA 3CB3A 1KW1A 3WIJA 2X1TA 1RCOB 1EZWA 1QI3A 4N6FA 1HT6A 1IEXA 2F8QA 3W24A 3NPVA 1WDPA 2W67A 3NRZB 1XR2A 4JCLA 4HGXA 3E0LA 1MNSA 4H8HA 4LCSA 3LPGA 5EGRA 3CUIA 1EYWA 1ZAIA 3NNTA 3LTYA 5TR3A 4WDWA 4CEXC 4R7JA 5I3KA 1IT7A 1R3WA 3T6CA 1EXBA 4GI4A 4LUIA 4FNQA 3QFBA 1N60C 4GXWA 4J56A 4E0CA 1DWFM 5F4XA 3D3FA 4HTYA 1C90A 1NFPA 3AIUA 4D8LA 3ZZ1A 4WSKA 1XYFA 1VAHA 1RBOB 4WJEA 2DORA 3TIMA 4MB1A 2C18A 2YYTA 4JEQA 3QF0A 4M8UA 3HA1A 3WBWA 2ABAA 2WM1A 4HT3A 2VDIA 1BGGA 4M51A 3TP4A 1D3HA 2OG9A 3LV5A 2HROA 1K1DA 4M52A 3THDA 1Q66A 2Z28A 1VHNA 4QIUA 4ZEPA 1KN0A 1MXGA 2B31A 3A13A 1TPB1 5DQPA 4RZ6A 1R9XA 4JTIA 3VE7A 4DZHA 1UA7A 3P5ZA 2VX7A 3VYLA 4XSLA 2ACUA 2Y24A 2WJFA 3DYPA 1SJBA 4J40A 1GQJA 2ZZ0A 3STGA 2Y1HA 4GRSA 2WVSA 1OCBA 5B80A 4LGXA 4G2DA 1H7XA 4UNKA 4C7FA 4HMNA 2TAAA 1XGZA 3TZFA 4LVDA 3I6TA 4H4IA 1PCWA 1CGYA 5I7GA 1V5XA 4JFWA 2YL9A 1KTBA 5U7SA 4JIIX 1VKFA 3B8WA 2V9DA 3RX3A 2WZTA 3CIVA 4Q33A 1XG4A 3EANA 3L12A 2WBKA 3VO0A 3NZRA 3A4JA 2WZMA 1PKNA 1KD0A 2VZOA 5AYIA 1K6WA 3SCSA 4ZOBA 2VELA 3GDBA 3BOFA 4IPLA 2CLKA 3MYPA 1TZ7A 3A21A 4A22A 1VFHA 3W02A 3NZGA 5EMLA 3WUBA 4JTAA 1M6JA 4W7WA 1J6OA 4H4TA 4AD1A 5BRBA 4HHHA 2OO6A 3QC0A 3FSUA 3TR9A 4S39A 1EP1A 2ICSA 4HZ8A 4ROPA 5A8PA 1XI3A 2YBVA 1H4PA 2P88A 3TC6A 1KWGA 2PDKA 2WOQA 4K8EA 4YN5A 1QPRA 5K9CA 3GUWA 3WQWA 4ILSA 4LV9A 3CPUA 3QPEA 3YPIA 1PHQA 3KVLA 3IRSA 2VEFA 4LNYA 5AHLA 4Q8UA 3ARRA 2W61A 3QC3A 1Z7AA 3FA3A 3OVPA 1OABA 3WLRA 2UBPC 4EF9A 4CCEA 4JIRA 5EFFA 4DM2A 1Q85A 3OG3A 2QJIA 2HK0A 1XBYA 3BV7A 4C6EA 4KGLA 4XIAA 3JU2A 1CGTA 4ZTYA 4HHMA 2OXNA 2C79A 5GJPA 4ZCWA 4DUVA 4H4ZA 5GVJA 4OECA 4BFAA 3A7AA 3NQCA 1GPWA 1XKYA 4UQDA 3L8KA 1H5VA 4LXFA 2R8WA 3R8RA 2G3FA 2C6QA 2PUZA 1QW9A 3IC9A 2C13A 1DWAM 3EOSA 4L6OA 4IIHA 3II4A 1EJWC 4NJJA 2V5BA 1EC7A 4HKPA 4QROA 3SCQA 3LS9A 4QLJA 4B5NA 4EVZA 2O9OA 3W27A 3GM8A 3PZNA 1E5JA 2BG5A 2ZZ1A 4GZ7A 3U0HA 4ZA0A 2YBTA 4IFOA 4NAEA 3V5CA 3QHMA 2ZZ5A 1H1NA 2BWGA 5A2CA 3TAOA 4U5IA 4CD7A 3WK3A 4N9CA 2ZC8A 5PTDA 3KEHA 4LYPA 1UWQA 3ELFA 1ONXA 3B0YA 3TQPA 3CUXA 7CGTA 3N4FA 3E1F1 3HPAA 4KFNA 2VX5A 1AJ0A 1X1ZA 2G96A 2CKSA 4RK8A 1DJYA 1H7OA 4ACYA 3AHZA 5DBUA 2GFTA 1W3KA 4MZ1A 1UZ4A 2D2GA 3VZYA 1M04A 1JQVA 5F1VA 3NQDA 3VNYA 2I7GA 5CZKA 5BWAA 1EYEA 5LIXX 3Q67A 2WJDA 4GZEA 2GL5A 4LYQA 3VDGA 2EJ1A 3OB8A 3LTSA 4PB3A 4N42A 3S9IA 1EJUC 3SCNA 1X38A 3HGRA 1LL4A 4MPQA 3GXFA 1U5VA 1VJIA 2F84A 3KL0A 1OK6A 3CHEA 3OIHA 3WK2A 1SJCA 2RDUA 3UQNA 4YTUA 3PS7A 3F2BA 2DDXA 4Q4OA 3C2YA 4C6JA 2WLYA 3PTKA 1YBQB 1LORA 4JYEA 4NZ3A 2QCNA 3BH4A 2WCGA 2IXVA 1XLBA 2QCDB 2GLKA 2PU1A 4O11A 4NJGA 4ZXLA 1PJ9A 2DUZA 2QCLA 4Q4MA 1K3UA 4U28A 1W1VA 3VIHA 3GIYA 1UR1A 3EEZA 3WH7A 3S83A 2CLIA 4GE8A 1DHKA 3PPFA 1MW3A 4YTQA 1VHCA 4XBSA 1A5CA 4KCVA 2NW0A 4US5D 2E6AA 4O0QA 1FFVC 1GSNA 3BL3A 4WZHA 5E0KA 4HTBA 4XV0A 5G4EA 2OYKA 4MNMA 4ZBCA 4AXNA 1QK0A 2ZWZA 1BF6A 3B05A 2ZTKA 3R1ZA 5FJPA 1W9PA 1KM6A 3CMFA 4DELA 2YKKA 1EPXA 1E3ZA 5BMXA 2ACSA 4FEZA 3WNPA 2WMHA 1XW8A 1MRQA 3AIRA 4HP5A 3EAOA 2VR5A 4IMCA 4NILA 5BRQA 1JAEA 1E4MM 2VFHA 3L7RA 1PBGA 3WLTA 4S2BA 3I3BA 3ZOAA 3TW6A 1IIGA 4RDWA 1W32A 4PMZA 4DI9A 3C3UA 4H4RA 4NJIA 4GG9A 5H6HA 4Y9OA 2PDUA 3GS6A 3GVGA 4BI7A 5CSRA 1OSEA 3GRIA 2VZVA 2QCMA 3VM7A 1YE6A 3SCTA 1B3YA 3ITLA 1F3TA 3RHGA 2X41A 3SN4A 2H6RA 4Q8PA 2W6RA 2CESA 4J28A 1UH2A 1XRSA 4OZOA 2V67A 3BLIA 3IARA 4AWUA 5HMEA 4MY1A 3MKCA 4R34A 3GK0A 2HS6A 3QM3A 1OM0A 4QJ5B 2WC4A 1JPDX 3VIKA 2PAJA 1QI4A 2VCCA 3EUB3 4OQVA 2DY3A 3G1XA 4FLSA 3B3DA 3K30A 3VKDA 3T4CA 1H1YA 4HNTA 3PUEA 2WVVB 3ZSSA 2X50A 4BF5A 1AMYA 1B9ZA 3VNJA 4YIWA 1OYCA 3EKZA 4UFJA 1MUCA 4ECLA 1EF3A 1E40A 1PB0A 1Y5WA 4LNCA 4D6JA 4CD6A 3NOYA 1SUXA 3DHUA 1JDDA 3QGAC 1CWYA 1X8CA 1GOWA 2QDGA 1ZP4A 4KIRA 1GOKA 4D6EA 3WBAA 4JGDA 5FS8A 1C8VA 4A8RA 3LPOA 3BLEA 4W89A 3UWUA 1ZNNA 1JAKA 2VEMA 3IGXA 3FEMA 1RP8A 4QG8A 3NVZB 1G7VA 2WC3A 3G8RA 1L6YA 4IQLA 2TODA 4JQ4A 4ZQRA 1KB3A 2FHFA 3MHFA 1J0JA 1A3XA 1XD1A 1X1OA 4HQVA 3W7LA 3TTOA 1RXOB 3NEHA 1E6SM 1K4HA 3CUZA 5LIKX 4RCXA 5H8PA 3EEGA 3WMBA 5DLCA 4C65A 2GR3A 2E0PA 4JTKA 1V0LA 2Y7FA 2CHRA 4OBRA 3W73A 3W83A 1TMHA 1X96A 1Q65A 3MJMA 2CXEA 4KCUA 4H50A 2X8HA 3VOJA 4E38A 2VENA 1WDWA 4M24A 3N6HA 2A5HA 3VI2A 3EOLA 4JDBA 3O1NA 1EF2A 3B40A 2I1OA 3G1SA 5I03A 2OEJA 3S2CA 2XHYA 2ALRA 1EIXA 1H7NA 4HA3A 4JTDA 3UWWA 4H9VA 4M56A 1FQ0A 4OU1A 1EEXA 5AHFA 1LLWA 4AVNA 2PLJA 4U31A 1OD8A 1WBHA 1ONRA 1UOKA 1XPYA 2D1ZA 3MO7A 1KFJA 1OWQA 3W37A 1K70A 4IWWA 1P4CA 5I3GA 1TYTA 5DRIA 2ATMA 5AZ1A 4NEWA 1S1RA 3CIWA 4LAOA 4RLIA 1BFNA 3TEVA 2ZIDA 3CUFA 1HNYA 2WNNA 1G4SA 1PKYA 4UNLA 3C2FA 4C6MA 1GOXA 3N19B 1GHRA 3QV8A 1JRPA 5U4NA 4I7WA 1EIBA 4LY4A 4CU7A 4AZ7A 3ITOA 1UPPA 3TYAA 3ID7A 3COTA 1IE7C 5H8UA 4APNA 4C6IA 2UWFA 3BAIA 4EPKA 4U4MA 3ZWTA 4ERGA 1YHTA 3W88A 3N25A 3W87A 1TPH1 5D30A 1RD6A 3M0HA 3EWCA 4HPNA 3A9BA 2W0HA 2PWEA 1J4EA 4ADTA 1DIKA 3NPUA 3QW3A 4ZENA 3NXFA 1A3HA 5D04C 4F2UA 3R89A 2J9ZA 1MO9A 3WH6A 1JOAA 4L65A 3BJTA 5XIAA 3EDEA 3S4TA 1RVKA 2DH2A 2QF8A 1OJXA 2PEVA 1VEOA 1QPQA 1GVQA 4LEFA 3MMWA 2AGKA 4EIVA 4IICA 4H04A 3CYVA 3E2VA 3NQ7A 4B4FA 2NQHA 4NQ1A 2JK6A 1CYGA 4UOQA 1R9YA 3VA8A 2ASHA 3NQEA 1B54A 4EX4A 3K8LA 1VLWA 3AIQA 3FYYA 2FVMA 1GOMA 1C7SA 2DEPA 4F0KA 1FECA 4WY0F 1JPHA 1VFOA 4S3DA 3KS6A 2QPSA 1DXFA 1EA0A 1FWDC 1TVPA 1W1ZA 2ZZ3A 4HNCA 1ZK7A 4DLMA 4LCRA 2I5IA 4FXFA 3VCNA 1J5TA 1PE1A 3VC5A 3IV3A 5IFPA 4XAYA 1AD4A 2RKXA 1XC4A 2WLZA 3M1ZA 4JS3A 1N8WA 5FEXA 1YTEA 3T55A 3ARXA 1Q7QA 5JH1A 3BVJA 4X2RA 4WIWA 1M41A 2IXUA 1JCJA 3GNNA 5HANA 4P5UA 4JTGA 5DN1A 4Q8TA 1P5BA 2X1RA 3BLPX 4FOUA 5I3DA 2O9TA 4QG9A 4JL2A 5ABHA 4I5XA 4Q3MA 2YVFA 3ZLGA 1CX9A 2QYGA 5FKYA 2OZ0A 4ORIA 3LD5A 3CAWA 3ORWA 5CPTA 1IT0A 4DI8A 4BA0A 3FOKA 2FZNA 4GCAA 3B9OA 1QHPA 1VH7A 4IX2A 1I2PA 3HPFA 1BXNA 1OFQA 3URHA 1O1HA 4TIMA 4DNMA 2GQAA 4LY8A 2E3ZA 2P8BA 3OZYA 2R1MA 3MTWA 3BURA 1OC6A 1Z69A 2Q8ZA 1RQHA 1IWPA 5LYRA 4CNPA 1KXVA 1YEYA 2WSPA 2GSJA 1EDQA 1LROA 3QV7A 1PS9A 2OZTA 4JN8A 1PIGA 1EUNA 1QO5A 2OVLA 4XBKA 1XLGA 1JXJA 1VCGA 4HZ6A 5CAKA 2NT0A 3DFTA 3WLQA 1F73A 4LPCA 2R9RA 3U48A 3RU8X 2GJLA 2X8GA 4UUIA 4FX8A 3HQPA 3LHYA 4EPDC 2DZUA 4S23A 3ZM8A 3S2LA 4BWLC 4GY7A 4NF7A 3CGDA 2I56A 2B7NA 4A3QA 4A2SA 3TWAA 5AYXA 4S3EA 1TZZA 3T08A 1JULA 2P10A 4FNSA 4GQQA 4NXSA 2DVUA 4FR6A 3B8TA 3RX2A 1W9UA 3MWCA 3WNMA 4Z42C 3MWAA 1E9ZB 4IPIA 3W82A 1EO5A 3FKKA 3IJLA 2DQWA 2W9MA 4HMDA 2ZX7A 4QXIA 1AQMA 1AH0A 1H63A 2YFNA 1ZJBA 4H2HA 4BY3A 1DV7A 3PUDA 1J0ZA 5DMLA 3EPMA 3SRDA 3ONBA 4FK9A 2Q02A 4DM1A 4PH6A 3GTXA 3KBWA 3T2QA 3FXGA 3MMDA 3PB0A 3NOEA 5AN7A 3Q94A 4H6KA 4ASTA 2AMGA 2R9ZA 1QMLA 1WE5A 3FAWA 2V81A 2J4GA 3M0LA 2POTA 4MKNA 1UP0A 4AZ5A 1K4QA 1RA0A 2XH2A 3WBYA 1I6NA 1U2YA 4O14A 3HTWA 4PMDA 4H4UA 3N6JA 1QNPA 4JEJA 4LW7A 2NQZA 4Q8WA 1XBXA 4CQCA 4JFUA 2YJQA 2C91A 1ZLPA 4X0VA 3WFZA 4IOTA 1DIOA 1WXJA 1EDTA 3KWXA 5LGZA 4ZQMA 3IUDA 3H7VA 2FDMA 2ZA3A 3M0IA 1YPFA 4O0KA 3RXZA 3WENA 2YQUA 4TVCA 5CPNA 5DMYA 2AL1A 4YTRA 2G50A 3OA5A 2FMOA 1LWIA 2DW7A 5FSDC 3OIXA 4F2BA 2R24A 5D33A 1XDMA 1X6UA 4EPBC 1A5AA 5A94A 1UA3A 5I07A 3ARQA 4IJCA 1H2IA 3I4KA 3I7QA 1O95A 1BYCA 2CBIA 3WDIA 4ES4A 3F4WA 1ALDA 4GX9A 5AOUA 1EQCA 1KTNA 1KKOA 4KMQA 4E2OA 2I5GA 4HNLA 1N2VA 4HSHA 4KWVA 2C3ZA 3DERA 5HINA 3TXVA 3SIMA 3TMQA 3AOFA 1GW1A 3BW2A 4JR5A 2PDFA 1RLCL 4H4PA 2IPGA 2XISA 4IUOA 4PYSA 3H2EA 3LGEA 2PD9A 4QE5A 4F3HA 3H4KA 1SW7A 2J3NA 5JIPA 3B0PA 4EP8C 3OTRA 4HCLA 4DAFA 3DGZA 3NO1A 4C1NB 3RLVA 1F6KA 1I60A 1XLFA 4XD6A 1Y0EA 2ZDSA 2YGYA 1E0UA 3OODA 2A3CA 3NSMA 3U6WA 3GTIA 2FVKA 4IFRA 3A5FA 2WSRA 3ALGA 4Q6XA 4GIAA 1BVZA 3MZ2A 3UR7A 3KRBA 1E4IA 2HK1A 5CPQA 2ISDA 2QUUA 4W5UA 1D8CA 3USBA 3ZMRA 3CZJA 4PMNA 5FJRA 3ZJKA 4GC4A 3MI6A 3F4NA 4HPJA 2ON3A 2C3DA 1C8YA 2BS9A 4RNJA 2XYLA 2QCDA 3BK0A 4B5SA 1VBRA 3WQCA 2E28A 2ZBTA 3OVRA 2PC8A 1I2RA 2JKAA 1GJPA 1LRQA 3ITGA 1S3HA 3QY8A 3ZR6A 1Q6QA 4JOMA 5D2VA 3DGRA 1SZNA 4G1NA 4I6KA 3NVTA 1S5WA 1TV2A 3FKRA 3NDZA 4CN6A 1ICSA 1THFD 4ICCX 3M7SA 1TV5A 1NWRA 4GZIA 5H8MA 1TMQA 4UTJA 2QMJA 2OWWA 1DWHM 3KW3A 2HXUA 1QW8A 1JVNA 2WMJA 3M0VA 3N3TA 1SU5A 1TVNA 3PZQA 3L68A 4IMFA 4Q8VA 3GSMA 3BOXA 4PODA 4MWAD 4WF7A 1JI2A 1V51A 3VOHA 3SJ3A 1HJWA 3I3DA 4C1LA 3C2OA 3OLIA 3HJZA 1E6ZA 1LYXA 2O92A 4XD3A 4S3CA 3KRSA 2HPIA 1NHQA 3GR7A 1HKKA 5D9OA 3VIFA 3NCOA 5J5RA 5JRBA 3HV8A 1J11A 1T7LA 2R14A 1HKJA 1TCMA 1CTNA 3QR0A 1CLVA 1ZAJA 5CH9A 2HS8A 3BO9A 3R0KA 2PA6A 3LXBA 2WP6A 4AD3A 1SZGA 2INEA 4NZFA 4MNJA 4K1GA 1W0MA 3W26A 2WPBA 1PWLA 3VPLA 1VQTA 3PC0A 3ZVHB 4DYJA 3STCA 1NWUA 3GG1A 1Y65A 3AM9A 1VR6A 3UCQA 1RZMA 1QVBA 1ONEA 1WNOA 2V0TA 4PSRA 2YDSA 1TA3B 3W2NA 4AD2A 1IXQA 1W1IE 1W54A 2ZX8A 3GAYA 1VJZA 4JTEA 4LYRA 3WF4A 2FVLA 1XJBA 3OQEA 2WVVA 1TV4A 3WL1A 5C5YA 5DXYA 4BQ3A 4PBEA 3JUGA 4PMYA 2FZMA 2XIMA 4IX0A 3UG5A 4AIUA 1TV8A 1TTIA 3AYVA 4GHRA 1GRHA 3UD6A 1JNEA 2P50A 4AZBA 4WUIA 4UFLA 2NXGA 4OUEA 4PZVA 4FA3A 4UTTC 2WOIA 3UP8A 2IUZA 1M03A 1CEOA 1JZ4A 1Q1WA 4NAFB 4XUYA 1TKKA 4RKAA 3ARVA 1B2YA 1KR1A 2WKLA 2I9UA 4R9XA 2Y62A 2OR2A 2PTWA 3L0KA 1J10A 4CQ8A 3KBVA 3L0NA 4FIRA 1NDYA 5DFAA 3WF0A 1EX1A 4AAJA 4P8XA 3GU9A 3NAVA 2PDHA 1VBJA 3VD5A 3N2TA 2ZTJA 4NX0A 5D02A 1J18A 1SB3B 2IKJA 5FOOA 4F66A 3WF3A 4UFMA 5G1YA 3G1RA 3SM0A 1KGWA 4C5YA 3O07A 1HJQA 3VABA 3O7UA 5FMHA 3UNDA 3LI0A 1EH9A 5CBIA 4O12A 1SZFA 3UCDA 2A6LA 3G0SA 2QUMA 4Q4PA 1R3RA 1KXQA 4DRSA 4YYFA 1C9DA 1TELA 1Q2RA 3CT2A 3H12A 3QHOA 5I3FA 1CXIA 1UD8A 2W54A 3W2UA 1XCWA 3NQVA 2J7HA 5FAGA 3IJDA 3OJGA 1XIEA 3M5ZA 3MSDA 2WPEA 3HG4A 1D8WA 2ZWYA 4G56A 1TJRA 4Z17A 3APTA 5CC5A 4DZ5A 2BVWA 5JUVA 1DYSA 3AXXA 4E3VA 2FJUB 5FJJA 4NZ1A 2D23A 5J5DA 2RH9A 2EG6A 1BXBA 3KOFA 3LSCA 3LENA 1YX1A 1U83A 1V6YA 3WMLA 3UXAA 4QEHA 1NFBA 2FZDA 1XYCA 3EWYA 2UY2A 4U2YA 2R1LA 1XYMA 3CUHA 1F3EA 2ZUMA 4HU4A 2EQDA 2Y63A 2ZXDA 5E0FA 1DJHA 4F0LA 2X2YA 4I9AA 1FHDA 4GH1A 3GXMA 3VGDA 3A7RA 3PF3A 1MW1A 1FKWA 4FF7A 1KFKA 5HQEA 3VNIA 4H7VA 3MDUA 1B4EA 4MGGA 3GB6A 1DIEA 1LBMA 1XIHA 3IGUA 3KOZA 4JQ2A 3ETRB 4QJ1A 3CHFA 3GBDA 4PMJA 1DJWA 3RU6A 3U7VA 4D9PA 5I77A 2GUYA 3LG3A 1W9XA 3JVAA 2VFFA 2QJGA 3J7HA 2Z1BA 2J47A 4E2VA 3S2MA 4XD5A 3EX4A 2XIOA 4PCFA 1S2AA 3MCMA 1E6NA 3E5PA 3MQTA 2OOFA 3W01A 3A23A 3QQWA 2QF7A 6PTDA 4JKMA 1AW1A 1OBAA 4CQAA 1TTJA 3AYTA 2NV9A 3BMXA 1E6RA 5IDIA 3TJLA 5EB8A 1MEHA 1QHZA 5EMYA 1V0NA 3H53A 1JCLA 1I8JA 2ZE0A 1VYPX 3VOFA 3LTPA 3CTTA 1XICA 1V59A 2XIQA 1MQQA 1RBLA 4J3SA 2GWNA 4FALA 3GD4A 3B0XA 1C9WA 2VEGA 5G5HB 3CGBA 3LCLA 3WF1A 3BQ5A 3QR3A 1HFBA 3S1XA 1O68A 4B5UA 4LT9A 4CCDA 3TV8A 5AY7A 3THCA 4ZGYA 3RPTA 1XDLA 3TOPA 1KCLA 3KRZA 1Z89A 3PTDA 4FZIA 4LAUA 4AY1A 4XZLX 3L9CA 4QS5A 3OU8A 1GERA 5DMMA 5I02A 5HWNA 3TC3A 1OIMA 2E09A 3NJ3A 3RCNA 3VM5A 3SAZA 4A29A 4MJ4A 3KBNA 3PWIA 4QX4A 1SM9A 1TR9A 4XD4A 2GK1B 2Z7KA 1H6VA 4JTRA 3WLNA 4UTMA 3NYZA 3EB4A 4F0SA 3LHUA 4PE8A 4LBRA 1P6BA 3BAWA 3PTMA 4AYSA 1S1PA 1K6AA 5HATA 3CXBA 2VP8A 2WMGA 3HJEA 4A3UA 1LG1A 4PFHA 2D2OA 3O05A 3VNMA 1U5HA 3MUCA 1AZ1A 2EEXA 2Z29A 1I2QA 4EK7A 3GZ3A 5BYWA 2XDFA 3GE7A 2YLLA 3ITVA 3E0FA 4AY7A 4V33A 2DSWA 2ACRA 2FGBA 2BGQA 1XIMA 2TYSA 1JROA 2PWUA 5E6YA 2GVEA 5IXEA 5HPCA 2VFIA 2ZRWA 3WX7A 1MEWA 5F2LA 2OQLA 4ICMA 4P61A 1LQAA 1RSCA 3L4XA 3TQKA 4JN6A 3GG8A 2PCEA 2WPCA 5JXQA 2QR6A 3BLFA 4AIEA 4D6GA 3WLKX 2YL5A 1JQXA 3S8HA 5A5WA 3H24A 2AAQA 3T44A 4YJ5A 1FDYA 2E6YA 4ZOAA 4DXXA 3W3OA 3QSRA 2PBGA 1R30A 5HDRA 4KQNA 4G7EB 3CZLA 9XIMA 3APGA 5JMUA 3MBFA 4QEEA 1RA5A 3RCYA 3VCCA 2O4MA 3WL0A 3QSTA 1IT8A 1MO0A 2VYOA 5K9XA 3GXNA 2G4FA 3VKKA 1Q6DA 1BTCA 1IGSA 2GPTA 1UYQA 4OE7A 1XDJA 3EDDA 4CLMA 4Y9MA 2HQMA 3CZGA 1FWBC 1YW1A 3MUY1 1L9WA 3DBPA 3GYCA 2VZUA 5EMUA 1ZQ5A 2HQAA 3VKBA 4Z1AA 3CH9A 3AMCA 3V0SA 1G69A 3O6CA 3CO4A 4XB3A 4J3XA 1KGXA 1SGJA 3QLLA 4NNCA 1SVDA 3E96A 1FEAA 3BLKA 1V77A 5D05A 4GD0A 3LXDA 1O5QA 2DSUA 1KCXA 1ZZMA 1R2SA 4AZGA 4XZNX 3W7QA 2A3EA 1XYAA 2YCJA 3WNLA 3WNOA 1WA3A 2YFOA 4LF1A 1AA1B 3R94A 3TK7A 3VIIA 3NYDA 3RITA 1HW6A 3VX1A 4M6QA 3MANA 2OEKA 2EG8A 1UD3A 4WK9A 1GZ1A 1SO4A 3NVDA 2UV8G 5H2ZA 3EX1A 3G24A 2Z24A 3PZ9A 3CEUA 4MY8A 1L0PA 5A6SA 4FP1A 4N02A 3SZ8A 3W81A 1LL7A 4MJZA 1UKQA 4KPLA 3TSBA 4HN4A 5KVIA 3GDKA 3OO2A 4E6MA 3PSVA 2VJXA 4TTUA 2XSXA 4JY8A 1ZCOA 4BK9A 1YTKA 1PTAA 1H61A 2VFEA 1N7KA 3RLUA 7ODCA 5I2UA 3GBEA 4WLCA 4AFYA 4WDUA 4LUSB 1YDNA