3PK7A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens with mg and glycerol bound in the active site
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
403
structure length
396
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVYEPADSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens with MG and Glycerol bound in the active site
rcsb
source organism Chromohalobacter salexigens
molecule tags Isomerase
total genus 150
structure length 396
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2010-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3pk7A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3pk7A01
3FCPA 4A3RA 3QPEA 4IT1A 4IP5A 4HN8A 4IHCA 3DEQA 4KWSA 3TWBA 3MZNA 4E5TA 3QKEA 5FJTA 2HXTA 3IK4A 3UJEA 2GGJA 2AL1A 3PWGA 2PU1A 3R11A 3QN3A 3I4KA 2PA6A 3OPSA 4DX3A 2XGZA 2OLAA 3ZVIA 3THUA 3TQPA 3IJLA 3U4FA 3K1GA 4HNCA 3PK7A 4K8GA 1SJCA 1RVKA 2PP0A 1EC8A 4ZA0A 3PWIA 3DG6A 3TW9A 3GY1A 4EWJA 3DG3A 3RGTA 3V3WA 2HXUA 2P8BA 3CB3A 3TJIA 5FJRA 3S5SA 4GGHA 1WUEA 3VCNA 4H19A 2NQLA 3ZLHA 3UJFA 2QDDA 4X2PA 2PGWA 4DWDA 5BOFA 1PDYA 3TWAA 3T9PA 4KPLA 3MWCA 1MUCA 1L8PA 4DHGA 4E4UA 4GGBA 3RO6A 2CHRA 4MKSA 3TTEA 4JN8A 1BKHA 3CAWA 1JPDX 3GC2A 4KT2A 3T8QA 2PGEA 1P48A 3JW7A 3NXLA 4HNLA 4E8GA 1ELSA 5EU9A 3DIPA 2O56A 1SJDA 2PSNA 3KUMA 3MSYA 3UCDA 4FP1A 3TJ4A 2FYMA 1E9IA 4F4RA 2QJMA 1KKOA 3OZYA 2P88A 3I6EA 3ES7A 3R0KA 3D46A 2HNEA 2XH0A 3T6CA 3D47A 3RITA 4A6GA 1JCTA 3V5CA 3IJIA 4DYEA 4K2SA 5FJOA 4HCHA 2PODA 2OFJA 1F9CA 3GO2A 2FKPA 3MKCA 3MQTA 3P0WA 3OZMA 4IL0A 2PTZA 3ZLFA 4K1WA 5ENLA 3NZGA 4H1ZA 1PDZA 1FHVA 3RR1A 3OP2A 2RDXA 3OW1A 3UJSA 4MMWA 3ZLGA 1EBGA 4E6MA 4JHMA 2P0IA 3DDMA 3FV9A 3UCCA 2PP1A 3SN4A 3MY9A 3DGBA 3V4BA 2PCEA 3DERA 4IL2A 4MGGA 1TZZA 2ONEA 2GGGA 3T4WA 2MNRA 3H8AA 1R0MA 3R1ZA 2POZA 2HZGA 1KD0A 3UJ2A 3FJ4A 1JDFA 1KKRA 1SJAA 3CK5A 3NFUA 3N4FA 3FVDA 2AL2A 1JPMA 2PTXA 3JZUA 2OO6A 3DFHA 4YWSA 3B97A 1TE6A 4Z17A 3DG7A 3R10A 4HYRA 4ENLA 2AKMA 3NO1A 3BOXA 5IDZA 2XH7A 4Z1YA 3SQSA 2OG9A 3JVAA 3MUCA 2DW6A 2OQHA 3UJRA 2XH2A 2OQYA 4FI4A 4GFIA 3PFRA 1MRAA 2I5QA 2AL2B 4HPNA 4ZCWA 4A35A 3UGVA 1BQGA 2GL5A 2QVHA 3UXKA 4M0XA 3P93A 4GYPC 1FHUA 2OX4A 3N6JA 4G8TA 2GGEA 3DFYA 3N4EA 3P3BA 3V5FA 3VFCA 1W6TA 4JN7A 3CXOA 3CYJA 3H70A 1EC7A 4HCLA 1EC9A 3EKGA 4H2HA 5J04A 3RCYA 5FJUA 3ZVHA 4GMEA 2XH4A 4J1OA 1IYXA 1YEYA 1OEPA 4J3ZA 4E4FA 2QQ6A 2GGIA 3TCSA 3FXGA 3Q45A 3STPA 4KEMA 3QLDA 1NU5A 3VA8A 2GDQA 4GIRA 3H12A 3CT2A 3SN1A 3VC5A 1WUFA 1R6WA 3OTRA 1ECQA 4H83A 3DESA 4IP4A 4HCDA 2PPGA 3VDGA 2GSHA 2OZ8A 3SBFA 3ZVHB 1XPYA 1ONEA 4M6UA 1TKKA 1MNSA 2ZC8A 2XSXA 2QGYA 6ENLA 4GISA 1NELA 5FJPA 1EBHA 3TOYA 3R0UA 2OKTA 1MDRA 3SSZA 4ROPA 2PU0A 4DXKA 3N6HA 4GYPA 4G7FA 4DN1A 2P8CA 3VC6A 2OZTA 2OZ3A 2PTWA 3H7VA 2MUCA 3HPFA 2P3ZA 1SJBA 3GD6A 3BSMA 2QDEA 3VCCA 2PP3A 2GGHA 1KCZA 1XS2A 3RRAA 3IJQA 3R25A 2AKZA 3QTPA 3EEZA 2OVLA 3Q4DA 3ENLA 7ENLA 3BJSA 2PMQA 2DW7A 3I6TA 2OPJA 3ES8A 2QJJA 3FYYA 1P43A 2ZADA 4IZGA 2PTYA 2QJNA 3SN0A 3SJNA 1DTNA 5BOEA 3S47A 2PS2A 1MDLA 3UXLA 3U9IA
chains in the Genus database with same CATH superfamily
7REQB 3DAQA 2FLIA 2PDHA 2P3EA 4CD8A 4JL2A 4NHVA 3VDCA 5I23A 3CV2A 5JU6A 4UB9A 3FDGA 1IT0A 1OYAA 3TR2A 2GPTA 1TMQA 5PTDA 1H2JA 1DTUA 3C0JA 1RLCL 4JOMA 3ITCA 3IPWA 4A2SA 4RNFA 4LH8A 2Q8XA 1TQJA 1GQLA 1X7IA 1QWKA 4DM2A 4DX3A 3R79A 1HJWA 1V97A 5JBDA 3KLKA 1VYPX 2EJ1A 3G0XA 3KTSA 2WVSA 2R14A 3O0HA 2Q8LA 1UROA 3T4CA 4IMFA 1ONWA 1XYMA 3WENA 1A3XA 3KFTA 3TW9A 1E1FA 2VELA 3M0KA 4ORMA 2C6QA 4AFYA 2VQUA 5CGQA 3GTIA 2PGFA 1EOKA 3V3WA 4GNVA 1PYMA 2FMOA 3CB3A 2OO0A 3CQIA 4N7QA 3QSRA 1JDEA 5EMLA 5CH9A 2F38A 2JGYA 3TN4A 1A50A 5BOFA 3RLGA 2XSAA 3AIQA 1E0VA 2VR2A 3TYEA 3IJ9A 2V3FA 1MUCA 3RR4A 1XG3A 1XCXA 5CZSA 4UQ9A 4DJDD 3QGAC 1RSCA 5E93A 5JBFA 3DKLA 2BODX 3FSTA 2CKSA 4NAFB 4AC7C 1T40A 5BMWA 2GQ3A 4WEVX 1BTMA 2AQOA 1OFOA 2O56A 2EF9A 5A69A 1E9IA 1TV7A 3LV5A 3VZXA 4YTTA 3FVMA 1QRQA 3APTA 3NQ6A 4B91A 4HVXA 3EOEA 1QJWA 3VI2A 4RDVA 1Q8JA 4TOQA 4UTTA 1GOKA 2WBAA 2IKIA 3ES7A 2Y6ZA 3PWAA 4DB7A 4F3HA 3N34A 4QG9A 4DQWA 2VC5A 4DJFA 2XZ7A 2ZA2A 1JCTA 2X0SA 1GUVA 3BTNA 4O1CA 1EH9A 1Y5VA 4DYEA 3NQAA 5FJOA 2A3EA 2X8HA 4HSNA 2PODA 2WHMA 2JIEA 3MWAA 4KW2A 4RE0A 3R8HA 3N25A 3MKKA 5ENLA 3GFZA 4L4OA 6CGTA 1WKDA 3M6DA 1VFMA 1SW3A 4TV5A 3W26A 5KZDA 1AQ0A 4MJZA 1ZENA 1QASA 4PTDA 3KWXA 2QCDA 4B5TA 4EWND 4C5ZA 2DUAA 4PE8A 1LRNA 1K7FA 3UCCA 4BR1A 1BXBA 1CLVA 3HN3A 3I10A 5B7ZA 2GR2A 2VVSA 2GGGA 3WLRA 2OGYA 3T4WA 3TC7A 3I3BA 4J5NA 3M5ZA 3WDRA 3LLXA 3UG8A 1QHOA 1GEQA 2Z24A 3W4RA 2E77A 1TJRA 4BK9A 2R1MA 5CLWA 3OVPA 4XAGA 1XJBA 3W76A 4FDCB 2AL2A 1H09A 1B9ZA 5HINA 1XUZA 3W23A 4AF0B 4IIDA 1FVPA 1G94A 2PDJA 3P14A 5BMXA 1LLOA 1Q65A 1O68A 2W92A 3GHSA 4PMXA 1Q7QA 2X05A 2VCBA 3W7OA 2IPWA 3TW6A 1HL8A 3AZRA 1LOLA 4W7VA 4L4LA 5E0KA 2HS6A 1EEXA 4L6OA 2Q02A 1LT7A 4GFIA 1H1YA 3H4GA 4JTGA 4XTDA 1OJTA 2FFIA 3GU1A 3UGVA 1UYQA 5GJMA 3ABRA 3CL7A 4HPHA 1TRIA 3BOFA 3V0SA 2QS8A 1HXJA 1HP4A 3UYIA 5G5GB 1LORA 3N4EA 4I9JA 3P5YA 2GWNA 1NAL1 4F8XA 1GZJA 4L9XA 4HTYA 1EC9A 5LIWX 3GG1A 4NZFA 1AL7A 1BWKA 1DOSA 4HNNA 4Y96A 1IYXA 1YEYA 1OEPA 1ZRQA 2J6XA 4US6A 2VUYA 1GVSA 1JG9A 1MZRA 2WJZA 1OBAA 3KCOA 1IIHA 1BXNA 4UFKA 4GE8A 2OYLA 3KEHA 4Q8PA 3SQMA 3IIVA 1W9DM 1M7PA 3WQPA 2PPGA 3QC0A 3IJ8A 2C1GA 5EGRA 1GJUA 3HB9A 1NOFA 1RAKA 3W7MA 2Y1HA 2DZBA 2DUZA 3T78A 3W07A 3M7SA 4NG3A 4M7TA 2DIEA 4AHQA 1V5XA 2XG9A 3C2EA 1TKKA 4V15A 4WIWA 3CGEA 2BGSA 2FPVA 4AX6A 2XSXA 3GIQA 3Q6JA 2DIKA 1OT2A 2BXZA 1FDZA 1S39A 1DJIA 1TV3A 1G5AA 2VURA 4Q7BA 3BUVA 3R7MA 2BC0A 3SFKA 3PZUA 1XGDA 3WELA 2HV5A 4JNMA 3H21A 4LYRA 1TR1A 3BDKA 3UZYA 4GJ1A 4J9JA 4DN1A 1BF6A 1U1UA 3L2LA 2A7RA 1H1NA 3L5AA 2QCNA 4N6EA 3ZMRA 4F66A 3AS1A 2YL6A 2FTWA 4LY8A 3QFAA 3LHTA 3VU2A 1JQXA 4XSLA 5AHEA 4WRHA 4AWUA 1UJPA 3IJQA 1BYBA 3LXBA 4MNMA 3E5PA 2E1DA 1ODUA 3S1UA 3ES8A 3KVMA 2OXNA 1MUWA 3A3HA 2X7WA 3LB0A 3LHZA 2CPUA 1G4TA 3HG2A 4AW7A 4LCQA 5DN1A 3MHGA 1W5MA 4FS9A 3OVRA 1PVNA 3WLHA 3M5VA 2QJGA 4Z0JA 1HVXA 3VGEA 4PL2A 2J9XA 3S2LA 1BPLB 4C1NA 2RDTA 5AYIA 3VM7A 5M5DA 2YGYA 1V3IA 4GCAA 3WEZA 4IIHA 3SSJA 3M0MA 1YRRA 1J93A 5FS8A 3LRKA 4B16A 2YZRA 2QCLA 1VENA 1X39A 4R85A 1W1PA 1LQ2A 2ZQ0A 3EF6A 1YTKA 4HOZA 1U1JA 2YLLA 1V59A 1JDDA 3WF4A 2DZAA 5F4WA 1N7KA 1KRBC 3C4UA 2R24A 4DO4A 1OGSA 4NQ1A 1S5TA 3ONBA 3W7CA 3ABSA 1J18A 2WK2A 4GNJA 3PN8A 2BXYA 4C5YA 3EEGA 2XIJA 3WUGA 1UP0A 4ROQA 3S6DA 2J24A 4JX4A 1RALA 1XQLA 3MBDA 7TIMA 4PTNA 4H04A 4ZQPA 7XIMA 2GUYA 1O95A 4JYEA 3BGAA 1YDNA 3KW3A 3T09A 1Q1RA 3EPOA 1G01A 1GCYA 3APGA 4PH6A 4E8DA 2YJQA 2RUSA 1ME8A 3ITOA 1KR1A 3GTFA 2Q3RA 4H6QA 3ZLHA 8XIAA 3N29A 4IJBA 1TTJA 1EIBA 3EWWA 4MWAE 1QMLA 4H7ZA 3TMQA 3O6AA 5D9PA 1D3GA 5C2XA 4DWSB 5MKGA 1ICPA 1FX6A 5HUPA 4EPKA 4FNTA 5CG0A 4Y9PA 4JTKA 3S0CA 1IZCA 4JFWA 2V63A 1MVYA 4HMCA 3A9IA 3T8QA 4Y90A 3WQOA 3JW7A 4GZEA 3SUSA 3GTNA 1W5NA 3TA9A 3ATYA 1JCJA 1TG7A 3F1QA 4FB7A 3RPTA 3W29A 1TPFA 1QPNA 3LBOA 5G5HB 5HBFA 2V5BA 3QYQA 4GC3A 3OZYA 1O5QA 3WDHA 5F2GA 2P88A 4YS1A 1K9EA 3U6WA 3IIOA 5B7YA 1OINA 4NY2A 3AXKA 4U28A 2RGMA 3NR0A 3OVQA 1KQYA 4FNPA 4Z42C 5LIXX 1QHZA 2PEVA 3UQNA 3HF3A 4RK8A 4XSMA 3BCFA 3NQDA 4WKHA 2HWGA 3LM3A 3H2AA 2WSRA 4UTJA 3CUHA 1NH6A 3WJXA 3L4UA 2V2DA 3OBAA 1AW2A 1V3LA 2EG8A 2UZ9A 3AIRA 2OMAA 2RDXA 1ISYA 4JEQA 5HA7A 3S5YA 4C6PA 4G56A 1XSIA 3E0LA 1QI5A 1X6NA 3XINA 1XHCA 4H3DA 4HN4A 4TVCA 3ZWSA 1G7UA 3S8HA 3IVUA 1VEOA 1NARA 3ZSTA 3ZFHA 1PXGA 1KW1A 2E25A 4JFSA 2OZ0A 3B4UA 1JPIA 3GB6A 4I7VA 1KD0A 3WN6A 3HPXA 4LVBA 1H4PA 4GVGA 1JYNA 2WVVB 3GSMA 1DWJM 4ENLA 4R33A 3CUXA 3A3XA 5CC7A 4Z1YA 4UUIA 3DYPA 4AAJA 1T0OA 4MWAB 2VZVA 4FO4A 3UZWA 1X8CA 3PG6A 3BAKA 2DT3A 3EWCA 3S9IA 1ITQA 3TTOA 2OQYA 1OFQA 4DWSC 3CO4A 1MEIA 4JQ1A 3ANVA 4GXPA 3PZQA 1OK4A 3FDKA 4GBDA 3UXKA 3VGDA 1AMYA 3PTMA 4AIOA 1E4IA 4HP5A 4RCXA 4OE7A 4GYPC 1E73M 4XZ9A 1JEZA 4Z1CA 4W8AA 2PDCA 2F2HA 4GRSA 4GJJA 3IV8A 5CLTA 3STGA 1FWNA 5C7VA 4O13A 3U3HA 4EQSA 1AH4A 3RNMA 2J7BA 2BHZA 3TJXA 3E0WA 3HMJG 3LV6A 3GYCA 2O7SA 4HZ8A 4AXKA 2IMRA 1A5CA 3A4JA 3U8GA 5HQMA 3UG3A 3STPA 3UGRA 2JFEX 3EZ4A 4MAVA 1J01A 3RF9A 3BG3A 2G0WA 3OLGA 1NF7A 5FA5A 5MF5A 3BLDA 1GESA 2F6XA 3VC5A 1WYIA 1VFFA 2PD9A 5K2ZA 4LUSA 3OODA 3VDGA 2PC4A 3N18A 1EL3A 3UPBA 1GW9A 4QJ4B 3FG2P 3W0KA 4BY3A 2OEMA 3CL6A 4FR1A 4R88A 2Z1VA 3GH5A 2BWGA 1US2A 1KFLA 3FW6A 2NV9A 2DPEA 4YN5A 4ZR8A 2X1UA 2YVGA 3FAXA 1KC7A 1H2IA 1K77A 5FF7A 4H4WA 4MKVA 3P7YA 2GWGA 3G24A 1K8XA 2BOGX 3O0FA 4S3FA 4MVAA 1FWAC 1FDJA 4KMQA 3RMEA 2QUVA 5DF0A 5JQ9A 1JYVA 4ERGA 4UXDA 4GYJA 3VOFA 2W54A 1RA5A 2DFAA 4IG2A 1W9PA 3TOPA 3IGUA 1IXOA 1AJ0A 2WLYA 3DHPA 5M17A 8A3HA 4MWAC 2ACSA 2BY1A 2CHOA 1A5MC 2GQAA 3K30A 3C3UA 1JVNA 2Y70A 2NQJA 3B0PA 4QEHA 4H7VA 2PGRA 3N11A 1AQFA 3CQKA 3CZ8A 2WPEA 2J25A 4E2DA 1M3UA 3W1UA 4QROA 1UZ4A 2XGIA 3D0CA 3MMTA 3PJXA 4QIUA 4MNLA 4LAUA 1GW1A 4IMGA 4LQ1A 4D1JA 2VMFA 2Y2WA 1W1TA 1A5LC 2E8YA 4MTVA 2Z6JA 5E0FA 4QE4A 1S2CA 2VXNA 4PMOA 4AVFA 3TH6A 3HV9A 3WD4A 4KWWA 4J3UA 1PIGA 3CHEA 5IM51 3ORWA 3KVLA 4U10A 2J7CA 3VKDA 3VD7A 2PB1A 3IEBA 1JI2A 1TJ0A 1MWOA 1GRGA 4NAEB 1T6MA 2W3SA 4AXNA 3ARRA 4KFOA 4ZO8A 1R3TA 3CIVA 2NT1A 3FHAA 4Z1DA 1RHCA 1H49A 1OM0A 3SM0A 5LNUA 5A2BA 4R7OA 2C3DA 3NS1B 2BXVA 4KFNA 5EFFA 4REQB 3R07C 3IC9A 2Z29A 3HIJA 1J6OA 3ARYA 4L6DA 4ZA0A 1NSJA 1G9HA 3WUBA 3PS7A 1LL7A 3OGVA 3KAOA 3P60A 4IM4A 3W25A 5CZ0A 4K7VA 2E9MA 1QNVA 4S3AA 1OX4B 4C6QA 1JYWA 5M2FX 3NO3A 2PLKA 3BLKA 3AMGA 4C7GA 3GDTA 2ZWYA 4EMIA 4ACZA 4LIIA 3KP1A 4M5PA 5DT7A 1K9TA 4U2ZA 1OIMA 2BP1A 1LRTA 2YFNA 1GJWA 4EP8C 3VOHA 4Y2WA 2PDNA 1Q7ZA 3A24A 4H4UA 1QDSA 3BSGA 3TTEA 3WQWA 1R2TA 1TV8A 1H41A 4JN8A 1IHIA 2DH3A 1E3XA 4KPRA 2PGEA 3TYBA 1FOBA 2NWRA 4NT0A 2J78A 4LF1A 4AMCA 3DIPA 3A13A 5DY3A 3MV11 3STFA 1WB0A 3KUMA 5I3HA 3ZSSA 4APNA 2W6RA 4HSOA 1UH3A 1ZBKA 4UTWA 3N13A 1S2WA 1PO9A 2J7FA 3ALFA 3KDNA 5CGMA 1AL8A 2HNEA 1R86A 1KM3A 2OQLA 5JUVA 4PSPA 1EWEA 4PUKA 3F4VA 3QC3A 1LG1A 3EXTA 3CMJA 4H00A 3OA3A 2PWHA 4J27A 1CLKA 3R89A 1QAPA 1QR7A 3HG5A 3WQ8A 3QFEA 2X30A 4NEVA 1PDZA 5H8PA 3WDPP 4GHRA 3BZGA 3GNNA 1DL3A 4MMWA 1NDZA 2NSOA 4E6MA 1AD1A 1UR1A 3A5FA 2VI0A 1EYEA 3LRLA 3G3MA 4UTFA 3TYDA 1RBAA 2PP1A 3V4BA 4A3HA 1DV7A 2AGTA 3EMZA 5J5DA 1NP2A 4ML9A 3LCGA 1UKSA 5CAHA 5D30A 2POZA 4FIRA 2J66A 4NSBA 2YCJA 3GRSA 3NFUA 4W8LA 2VEIA 3EX6A 5K4ZA 3UPMA 2ZE0A 2HBVA 4L80A 1MO9A 3QFWA 3O6DA 1TTQA 3WJWA 3BOXA 1F05A 3URQA 2V3AA 5I09A 5AVNA 1DWIM 1ZJIA 2ZZ6A 3WJYA 4OTKA 1WZMA 4FXSA 2EKCA 2YB1A 2FHBA 3PPHA 3SGUA 4LV4A 5CZKA 3NSNA 4ZCWA 3Q2DA 7ODCA 3G1SA 4KRZA 1JAEA 5GJPA 5EA9A 4AY8A 4M0XA 4O10A 1W32A 4ADTA 5I07A 1NY1A 4CD4A 5FAGA 3M0JA 1H62A 4G1KA 4XBSA 1DJXA 5T8GA 4LYQA 3RCNA 4RPPA 2XVGA 5G2IA 3RX4A 3NEVA 4Q32A 2IPGA 1GJPA 2V5CA 5AY7A 3H4KA 2G3FA 5IFPA 3EKGA 4ZOHB 2Y62A 3E5BA 1JROA 4WY0B 3WK2A 3SURA 1RD6A 1S1RA 2GGIA 1RV8A 2ISVA 1GEHA 1FWFC 2NV2A 3VZYA 1QHPA 5TD4A 3SAZA 4P7NA 2GDQA 3CT2A 3GNXA 2D0HA 3SN1A 3P61A 4ZQCA 1FFVC 1ZY8A 1Y7VA 1RJRA 3GS6A 3UXIA 3R8GA 3W22A 3WZ0E 1C9WA 3UF9A 5FSEC 1V0KA 1DJHA 4GCXA 4FLQA 4I5XA 1UZHA 1N8WA 3LB8A 4QHRA 1MNSA 4UTKA 2HVNA 3T8LA 1UA3A 1QOPA 2NSXA 2QF7A 2Z1WA 3DYOA 4PL1A 3TJLA 4IJCA 2G97A 1NELA 3P74A 1SFJA 5C54A 4OU1A 1TMHA 4B3LA 4LVGA 3T0DA 3W6MA 5A6KA 4GZ7A 1KFEA 3PC0A 3TXZA 2XN2A 2GDUA 1VFOA 2PWDA 1O66A 1LF1A 4MIMA 1XLHA 1V51A 1NWUA 1MW2A 2ASHA 1XCWA 5EMUA 1UWQA 3VNYA 1Q13A 1M6JA 2NUYA 4IWWA 1XPGA 5E6ZA 4P7QA 4FNQA 4W87A 5G2HA 1WDDA 3UWVA 1A5BA 1H7PA 1PEZA 2A5HA 1E1CB 2Y7EA 3VNLA 1P6CA 2PRLA 5D37A 9XIAA 4C6IA 3RRAA 1MQPA 2DZWA 2PRHA 4IF2A 4QDWA 2YX0A 4A21A 1IXQA 1JIBA 4QITA 3LPPA 5CPSA 3GR7A 3EWDA 3ARXA 1E71M 3QZ6A 3AU6A 1P1XA 3F7JA 1ISZA 5IRPA 1BEUA 3CO8A 3OHIA 3AUJA 4NX0A 4OECA 3IGXA 3TFXA 2O4QA 2V3DA 1T8QA 4IX2A 2EQ6A 2RJGA 1XD1A 1IEVA 1R7AA 1UKTA 5DMNA 2PDGA 3G0SA 4N9CA 2CC0A 3YPIA 3GRTA 2PDQA 5JBEA 4R34A 1KBIA 2QLYA 2WXDM 3SUUA 2GUUA 3QBUA 4DF1A 2CLEA 3B9OA 1E43A 2VM8A 2AL1A 1GOIA 1C8VA 5KZMA 1H1ZA 3NOYA 1NWSA 5AOUA 3VVGA 3LHVA 2H9AA 1OCQA 1E9ZB 2EHHA 2TMDA 5ABTA 3S9YA 1FH7A 3NTYA 4AZCA 2E6YA 4F0LA 3GY1A 4IMDA 3WD3A 2REQA 4UMAA 3EWYA 4MZ8A 3H2EA 1B0IA 1D9EA 1BSIA 1D7YA 1XLMA 1OG6A 1VHCA 5DBUA 4QRNA 2VX5A 1HF6A 2ACUA 1J6PA 4ZXOA 3QHNA 1JYXA 4F0SA 5HXMA 1KGWA 5HUOA 3GKFA 2C79A 1TPWA 1XYFA 4PCNA 1NHRA 4QBXA 3W82A 1A49A 4S2CA 4LEFA 3GVGA 1T7LA 1PTAA 1MXSA 2JGQA 4WX2A 2PF8A 5A6BA 1L8PA 3DOPA 3DX5A 3QZAA 1OIFA 4K38A 1ZGDA 4ZODA 5IDIA 2H6RA 3EWUA 2HS8A 3QR0A 5U1OA 4MKSA 4MY1A 4AZHA 3N1AA 1O4UA 6TIMA 2E67A 1XSJA 1H5YA 1B3WA 1DORA 4HNLA 3DU0A 4MDOA 4PEEA 4E8GA 3I3DA 5EU9A 1XKJA 4EK7A 5I5RA 4K37A 1EJUC 1MXDA 3L5OA 2GUBA 4KF1A 2A21A 4DBEA 4O1DA 5K3VA 1F7BA 1HX0A 2O9PA 4BF5A 1PSCA 3LM7A 5AHLA 3E0VA 1WQ5A 5A95A 3D46A 1VFSA 3N4AA 5BXTA 3URAA 1UD3A 1C93A 3T6CA 4PMUA 2FIQA 2WZEA 1P6WA 3NPWA 4A6GA 2ZZ0A 3HRDC 1B3OA 3DC8A 3BWWA 3QLLA 3MUAA 3L0GA 1DYSA 3W24A 2PTZA 3PR2A 3AYSA 4WQ6A 1NQKA 4F40A 3KDOA 4S2BA 1OC5A 4EM4A 3CHCA 3NM3A 4XWUA 1V0LA 1XRFA 1FIQB 1Z6KA 4M29A 2ZBTA 1JULA 2X2YA 4JIIX 4YNGA 5FEXA 4BEQA 2BSLA 2D73A 2VENA 5K9CA 1UR8A 3BAXA 3NGJA 1PZ3A 3UZZA 5LNWA 1XBZA 3GXTA 3AHXA 1ZCOA 1JRCA 1SZEA 2I16A 2OO6A 3SGZA 1QBBA 4C6DA 3BQ6A 1NP0A 4AY1A 3UA3A 3DH9A 1JXJA 3PNUA 5REQA 3WH9A 4HYRA 3VK5A 3N2OA 1BZLA 2ZRZA 1JAKA 3W00A 3L66A 3EYPA 2WJFA 4MB1A 3HURA 3CZLA 5AC7A 3E74A 4B5XA 4BQ4A 1FWSA 3NL3A 1J0KA 1V77A 4IGSA 3T2PA 4L9YA 3LGGA 1JZ6A 3BG9A 4J56A 1JEHA 4JX6A 4B9ZA 1A3WA 1EPVA 4XZLX 3UBPC 4PYSA 3S83A 4GUIA 2JALA 2DJLA 3PPCA 4GXWA 4O0QA 1W56A 1XLJA 2EKGA 4ZXLA 3W88A 4M51A 1E6PA 3V5FA 4L1GA 2XHYA 1OFEA 5AC6A 1NOUA 4IIEA 1XRVA 3NVWB 3I7QA 2PBGA 1GQIA 2WQPA 3SCTA 1ZL1A 5J04A 1QW8A 5EPDA 4LW7A 3TE9A 3AAMA 2QV5A 2R1LA 1JDCA 2C91A 1C8YA 2G3NA 4J3ZA 1FWJC 4NJJA 3TZNA 1C9DA 5EKYA 3CQJA 3BAWA 3SY5A 4D1IA 4GIRA 2E4TA 7CGTA 1G4EA 1RJQA 4L64A 1B90A 1B3XA 3QV9A 2VEPA 3PZOA 4HOWA 3DESA 1E0UA 2VUNA 4IP4A 1FTXA 4MG4A 1KRAC 2ZZBA 2INZA 3ZVHB 1VCFA 1KWKA 3W75A 3EDFA 4HQVA 2Q3OA 5A6LA 5BZAA 3RJYA 4DJEC 3W7JA 4DUWA 2E3TA 3O3RA 1AZ1A 2GH5A 3BAYA 5AZ0A 1BAGA 3ME3A 1A0CA 4GRTA 2C13A 5FD0A 1IWPA 1LL6A 4QXIA 3N6HA 1K4QA 3T7VA 5A8GA 1UP3A 2OZ3A 2X8CA 3VIHA 3CIWA 3L7RA 1SJBA 5BROA 3CYVA 1V3MA 4LBUA 1MQQA 4IX0A 1YNPA 4KCUA 4QAWA 2Y4SA 1NF0A 2GGHA 4JIRA 1DBTA 4LOCA 7REQA 2AKZA 1AH3A 4U5IA 5AZ1A 4GABA 7ENLA 1A3HA 5AYBA 3PBGA 2QIWA 4BHYA 4NU7A 3NDYA 1IWAA 4TVWA 2PTYA 4QTGA 3KL3A 3VGHA 3SN0A 3AICA 1KB3A 1DTNA 3BW2A 3UZ5A 2PS2A 4WOZA 2FHCA 1HO1A 2PRMA 3TXVA 2W3RA 3KXQA 3UY7A 4DPQA 1PTGA 2NUXA 5KZEA 2YAUA 1CEOA 4IP5A 1BG4A 1CGXA 3LRMA 4KWSA 1B57A 4JQ9A 1V6YA 1B9BA 1FH9A 1W1A1 1LM1A 1WBHA 1DPMA 5DMMA 3LCLA 1CIUA 1XIEA 4M52A 3C2OA 2QCEA 3T42A 1X38A 3UPWA 3LTYA 2BX7A 3PPGA 3SRFA 1GG1A 5GVJA 3TLLA 4HGXA 1QNOA 4EF8A 1T96A 3VD4A 2V68A 2ZXQA 4IOTA 1JUKA 3WLLA 3NQ8A 4EQXA 3IJLA 2Z2AA 1FKXA 3TDFA 1R85A 4HYWA 1ML1A 4O54A 3DHFA 1MI3A 1JCYA 4UOZA 3NA8A 3WLPA 3CPGA 4JN6A 2IKGA 2E3ZA 1TUXA 1JFXA 3GQYA 2Y7DA 2EAWA 3PB2A 4WDWA 2ZXBA 4HU0A 4NAFA 1TJ1A 4J7RA 1KTNA 3UJFA 1KGXA 3N2TA 3W28A 2QDDA 5HAOA 4A3QA 2ZA1A 1UOKA 3GZ3A 3S6OA 4JYDA 4IGNA 1E5JA 4AZ7A 2UWFA 1LYXA 2ZCGA 3BK0A 4A22A 3B3DA 4JHZA 1GPWA 2ZIDA 3DK4A 3SB0A 3K5XA 3GXNA 3EX2A 2BGQA 2DZTA 4B2DD 1TIWA 2B4GA 2VX6A 1UG6A 4YTUA 2ZVRA 1W3KA 4TTGA 2ZWZA 4K8HA 5CKSA 4H6EA 3EAUA 3CUFA 5AKQA 3QXBA 1ZP4A 4MUPA 3DGRA 1I0BA 1FUYA 1JGMA 1F4HA 2O4MA 1Q85A 1SW7A 4EF9A 4H9YA 3SECA 4RL3A 2CEQA 2X1IA 3UYCA 1QW7A 1Z89A 1XIMA 3AHYA 3HU7A 3MUIA 4AD2A 1XC6A 3LXAA 4AYSA 2P50A 1OD0A 1WAUA 3EMCA 4OJYA 3N14A 2WP6A 1B4EA 2YW4A 4AF0A 2VOMA 3APYA 1BGGA 4NJGA 3VAVA 4UTLA 4EACA 3PZGA 2PDFA 4XQ6A 4MB4A 3H7RA 3DBNA 5HWJA 2J9YA 2JF6A 3VPLA 3ZR5A 3IAQA 3NQ7A 4H2CA 3IUHA 2CBJA 3DERA 1VJZA 3PBYA 4NKCA 3HPSA 2WMGA 3DCPA 4O50A 1S5WA 3FJ6A 4F2BA 2ZKMX 4PRRA 5DEZA 2WO5A 4PB5A 4U33A 5F4XA 4W9TA 5KVIA 1N55A 2MANA 1DWFM 4CUCA 3S2CA 4E2VA 3B97A 3GVRA 3ZZ1A 3PANA 3CAVA 3VINA 4O53A 3DFQA 3LN3A 4UOQA 4S3JA 2IPJA 1ZJAA 1XWYA 2J3NA 4BFAA 1XGEA 3VKJA 3ONCA 5I3FA 3TU9A 2D2OA 1MW0A 4L1WA 3AI0A 1GYNA 1GVOA 1IXNA 1TPUA 2WJEA 1RPKA 1CPUA 4BQ5A 1TELA 3DC0A 4PMNA 4WGHA 3UXDA 4EIVA 2L5HA 1WE5A 3S5OA 3EB2A 1FWTA 2I17A 2XSBA 3NO5A 3QM3A 1H0IA 3N15A 2PDBA 3G1DA 2GGEA 3DFYA 4PMQA 3A7UA 1FWIC 5HDRA 3P67A 5HOSA 4CEUC 5A2CA 2A8XA 4HNOA 3H22A 4H2HA 1GKQA 1GOOA 3XISA 4S3EA 3VNDA 1HKKA 3HQOA 4CVWA 4NXSA 1WDPA 4J35A 3QW4B 3TCSA 4DJDC 3Q45A 4FIQA 3SRHA 2G8ZA 2YCEA 1N63C 4LS2A 1CT5A 1QU4A 3H12A 4WZHA 3BURA 4XZWA 3OLIA 4BI5A 3OTRA 3EMQA 2YYUA 3GHTA 1I60A 3PF3A 4JTCA 3WMBA 3W74A 2DT0A 4FAMA 3PB0A 1CGWA 4GC4A 1Z32X 2FH6A 1ZXIC 5E6YA 2ZC8A 4CN1A 2QGYA 3V18A 3NPVA 4QE5A 2GR0A 1Z42A 5DMYA 4NI8A 4H8VA 4C65A 4EVZA 4DZIA 2R94A 4EPBC 4C6KA 3LXDA 1P7TA 1KBLA 2EXOA 1EP2A 1KBKA 4MY9A 2W27A 4JFUA 1TPB1 1XRSA 1SW0A 2VX7A 3ZJ6A 4AQLA 1D3HA 1QPOA 3NYDA 5XINA 5KMYA 1B3VA 3L9CA 2Q8ZA 2QJIA 3NPUA 3M1ZA 3DKJA 2WKLA 2Z7GA 3H7VA 1BWVA 3BPWA 3LHUA 1IGWA 1TWDA 4TQTA 1DXEA 3PBMA 2YCLB 1OCNA 3ECQA 2VWSA 2RGLA 4QJ3B 1EYWA 5GPRA 4GR1A 2Q01A 4GI9A 4EPEC 1Q7MA 3QYSA 1PZ1A 2WMIB 5H91A 3F4NA 3FYYA 1NDAA 3DECA 3QOKA 4P7RA 5JCMA 4HA4A 4I8YA 1UR4A 1Q63A 3WD0A 2FHFA 2X40A 4NZCA 1FEBA 1TPDA 1DE6A 5D33A 1CCWB 4L6HA 1ICSA 5TF0A 4MAZA 4X61A 1E0WA 2OELA 3HPAA 4IP7A 1NWRA 4B9YA 1WOAA 4IT1A 4HU3A 2Z1SA 3NCOA 4PMRA 3MTWA 1GRBA 1J0IA 3FX4A 4IHCA 4YIWA 1XDIA 4LNCA 5D9MA 3V5OA 1YNQA 5DCBA 4CQBA 4TR9A 3T44A 2A3CA 4OT7A 2WANA 3GHRA 2V3EA 3PWGA 2PU1A 3G8RA 3BMXA 2QUNA 3BH4A 3CNYA 3R11A 1US3A 4ZOBA 2JKAA 2XFFA 5C9XA 3FHQA 5IBXC 4K6AA 1WNOA 3WLKX 4WGXA 3M5YA 1LRQA 1IEQA 3S5NA 3SJ3A 2Z7KA 3SCWA 5DX7A 4RZ4A 3TAOA 1G4PA 1VJSA 9RUBA 1RVKA 2YYTA 3MBFA 3NG3A 4E2BA 4DWSA 1UHVA 5LA2A 5LHFA 5K4XA 2C14A 2O55A 1EGVA 4H8HA 4P7OA 2YCIX 3NDZA 3A3WA 4MPKA 2FVKA 2VC7A 1JXKA 3FEQA 2ZX5A 4QE1A 1HJQA 3TTSA 1P0DA 3SY1A 3HJZA 3CLWA 1XBYA 3PAOA 1OT1A 1AW1A 3ITTA 2QR6A 4GWEA 4GZJA 3W85A 1I6NA 4ZVJA 4UQBA 1UMLA 3DFNA 2WAGA 5IOBA 2FDMA 4AWSA 4K7YA 5RUBA 1IV8A 5KINA 4ZB0A 4BWLC 1HL2A 2PGWA 3EA3A 4NVTA 2UY5A 1OFDA 2J13A 5TIMA 4CQ9A 2A0NA 3WQCA 1RBOB 4DHGA 3BO9A 3KCJA 4N42A 1D7FA 1PIFA 3BLLA 3LUTA 2CHRA 3DGHA 5HMEA 5IFTA 3FGCB 3GXFA 1V6VA 4M3PA 3UXAA 5D2VA 3NXFA 5A5WA 1P4CA 3ARVA 3KRBA 5B80A 1SO4A 2VOTA 3B8SA 4GJIA 2DZUA 2FGBA 1FO4A 2OEKA 4AB4A 4K8DA 8RUCA 1FCQA 1TYGA 3EX4A 4Q33A 3QOMA 3I6EA 4XG1A 4JAWA 3ZM8A 1ZPTA 1PV8A 2I56A 5HNNA 3VNKA 4HNVA 2V82A 1UUQA 2FVMA 3QQ1A 1QPQA 2ANUA 2D22A 4K2SA 3VOCA 1DJNA 3CQ0A 2PC8A 3CM4A 3N12A 5CG7A 4O0KA 3TNBA 4F48A 1OY0A 1JR1A 3P0WA 4Q7NA 2BTMA 5HMFA 4MSSA 4JQ3A 3ZLFA 4ZQRA 5D32A 4Y8FA 4UTIA 2WVVA 4LB4A 2ZX7A 1J0ZA 2F61A 3EOUA 1FWEC 3MUZ1 3S9ZA 1WAWA 4ZO9A 3Q67A 1FHLA 2CLLA 3FV9A 2YXOA 3IACA 3DK8A 3VNMA 1YPXA 4MGGA 4BQ2A 3LHYA 4AMAA 3PBUA 1GSNA 4YVVA 3TW7A 4MWAA 3GUGA 3ZJKA 2C3ZA 1KN0A 2WPCA 5C7HA 2AAAA 4O52A 4J3WA 3UJ2A 2CITA 1EPXA 3GG0A 3HW2A 1GVRA 1JPMA 1SR0A 2WP5A 1I1XA 5DRCA 2HISA 3RX3A 3GVWA 4PBGA 3PBVA 2YZ5A 5BRBA 5GNYA 3LXCA 4IISA 4GNKB 4XD3A 1EQPA 4US5A 3B8TA 4PMVA 1X6UA 3VUPA 3SQSA 1TJPA 5FL0A 2QT3A 2W0HA 1AZ2A 4C6OA 5L6UA 2VC6A 1T8XA 3CJPA 3C52A 2QCFA 4BZYA 1E3ZA 3H26A 6XIAA 4WSJA 4NZ4A 3V1PA 4A05A 4RX0A 4GY1A 4GOAA 1RBLA 4M82A 1KCKA 1KTBA 4XUYA 3EXSA 2VKZG 1K6AA 4OFCA 3PUGA 5TAOA 1FCBA 3ZT7A 1U83A 4IGHA 1YE6A 4TX8A 2Y24A 4Q8OA 3KOWA 1X1NA 2C3CA 2BVTA 4B5WA 3H70A 3EDJA 1OFRA 1ZCCA 2R6OA 4QJ5B 2ZX8A 3SW6A 4J1OA 4UQEA 2VFDA 4D2JA 1JOAA 3NL5A 3LQGA 1FXQA 1W3IA 1U22A 5CC6A 1OCBA 3QLDA 2D1ZA 1NU5A 3SCVA 4EX4A 1XLIA 4BA0A 4M6VA 3K4AA 1WUFA 3IGSA 2O9OA 4H83A 4C6EA 4QLJA 3LCIA 4PUNA 2ZZ4A 1EZWA 1H7RA 4IXHA 1MW3A 3H2OA 2GSHA 4OGZA 3WFAA 4CCDA 5CBBA 5I02A 2VC9A 1W17A 1LL4A 5C9WA 1R9YA 3KM8A 2Q71A 2GVJA 5LGZA 2CLIA 4TVYA 1OFAA 4KFPA 5EB8A 6ENLA 3TC6A 4C60A 4YWIA 2Z25A 1TIMA 4AH7A 4MYXA 1VF8A 3PUOA 1I2OA 1UASA 4AU0A 3OBKA 1MDRA 3AMKA 2EGZA 2QCDB 3UVAA 4G1NA 4BI7A 3AXMA 1EUAA 4FNRA 4A3YA 1EIXA 5ECVA 3AISA 2GVGA 2DZPA 1QPRA 2Z1KA 3ZR6A 2MUCA 5DFAA 1DJQA 1QOQA 3GD6A 3NZPA 3B8DA 1M5WA 3DJJA 3K1DA 5HMSA 3VCCA 1JUBA 4H9MA 3W1RA 1LLZA 3GX9A 5FEWA 3R25A 3EANA 1F2JA 3QGKC 1J11A 1KRMA 2PDXA 2J8GA 1QNPA 3EEZA 4JCLA 1UUMA 4S23A 1SUXA 3VKCA 4X60A 3W37A 3TROA 1Q4WA 1C3FA 4GUFA 1W8SA 4BS0A 3WQ4A 5G5IA 4JTRA 1OWQA 2VFEA 3TR9A 2POTA 4JTLA 4JFVA 3M0YA 4KEUA 2J62A 2ZDRA 3GD3A 4NAEA 3KWSA 4QNWA 3VE7A 1MDLA 4HU4A 3TQKA 1VCGA 2FGZA 3H2FA 1YNYA 3GW3A 3QMSA 3QPEA 3RAOA 4S39A 3RDKA 1JGIA 2J79A 4IPJA 2TAAA 4E5TA 4NL1A 3IK4A 3AMDA 3GBEA 3OJGA 4EMWA 3UVIA 3NQ2A 1NHQA 2VO5A 1OHLA 4YVPA 4CD7A 1EF2A 1J2WA 3KZSA 4INFA 3WLNA 5I6SA 3K8MA 4DJFC 4JQ4A 2E8ZA 4H7CA 1W1IE 2CHNA 3MP5A 1HN1A 3LBMA 3MDUA 1PZ2A 1J4EA 3K1GA 4WKAA 3AYRA 2QGHA 3DG6A 3IIPA 4RR4A 3M0XA 3J7HA 5D05A 3LQLA 1A4LA 4IMEA 5FJRA 1KM1A 4XIAA 1TA3B 4F0MA 1V02E 5HULA 3OG3A 4I5RA 1ADOA 3S1VA 4C91A 2TYSA 3D6NA 4O1AA 2NX9A 5T26A 4XZHA 3W1NA 2FZNA 2QUMA 3NPXA 1WP6A 1JD9A 1B3ZA 2QULA 4PR4A 3G1XA 2EG7A 4JEJA 3B04A 2C1HA 1J2BA 1K4HA 4YL2A 5FI8A 2HPIA 1M68A 1XR2A 1U33A 3UY8A 4O4WA 1K9FA 2CZDA 5D2TA 1UOZA 4XAPA 2DGAA 3EA2A 1K8YA 2V5LA 4GUGA 4U31A 4WLCA 3FKKA 3AIVA 1YHTA 3MS8A 5LZLA 3HQPA 8CGTA 5LNVA 3MSYA 4MYAA 4QM1A 1SFSA 3P0XA 1A47A 1UR3M 3H23A 2NUWA 3QTGA 4MLJA 1UWRA 5CPMA 2JE8A 1OX6A 3R0KA 3THCA 1ZQ5A 4ZFCA 4JNYA 3VKBA 1UIOA 2XIOA 3V5CA 4JTHA 1N2VA 4ICCX 2Z4GA 1XW8A 4LY4A 3WH6A 3ZIZA 1C7SA 2QXWA 3RFAA 1QFEA 1KFWA 2W5FA 3WMSA 5A8QA 2GOUA 4AVNA 1UZDA 2X0YA 1N5XA 4ERAA 4LGXA 1U5HA 1FHVA 2PLCA 3OP2A 5EMKA 1CXHA 2J7DA 2Y8VA 3OW1A 4FLRA 3QPZA 4HZ6A 4MUZA 3TUUA 3UP8A 1WBJA 5D9NA 4EMJA 1WO2A 2XWDA 4GO9A 1XIBA 2DSWA 3VIFA 5JIWA 5ECUA 4HMEA 3OIHA 2FTPA 5F4SA 1S38A 5F2IA 1PS9A 4LUYA 4PGLA 4FX6M 1PIIA 4OWGA 1AOGA 2D20A 1XI3A 1NDWA 3BXWA 3CEPA 4XZIA 4FX9A 1KLYA 5BNKA 2EG6A 3ATZA 3VMNA 2RABA 2Z28A 1VGAA 3WJZA 1P0BA 3NQGA 4PMYA 2AKMA 3BLFA 3NO1A 3FJNA 2CFYA 3MP3A 3FYOA 5M03A 1A4MA 2BHUA 1F8IA 4IFRA 1RY0A 3RHGA 1KV5A 1NHPA 5ER0A 2OQHA 4TX9A 2O7QA 3UJRA 3N19B 2WSKA 3ZT5A 1XSKA 3AO0A 4WY0A 1UZ1A 2PDLA 3GFXA 2IUZA 4ADUA 3W1AA 1BQGA 1O94A 3EB4A 4A29A 1V7YA 4GACA 4X9YA 4J2PA 1VIWA 3NZRA 4B5VA 1R2SA 4CCZA 2PTDA 3CS2A 4DEFA 4ZENA 4YCOA 1S3TC 2HQMA 1UWSA 1POKA 4FALA 1XYAA 3CWNA 4RXFA 5A3HA 2EQ9A 1ITUA 3FEMA 2H3BA 2ZXAA 1V3HA 5G4HC 1XANA 3COTA 4AHPA 1XLEA 3URNA 2GYIA 4FOUA 2NT0A 2YA2A 2VEFA 1CYGA 3SADA 2C15A 4N9BA 4A2RA 3CQHA 1K6WA 1XYZA 3R58A 4E3VA 2YPIA 1XLCA 3MMDA 4S38A 1XUUA 1WZLA 1M41A 3EOSA 2QCGA 4PUJA 1Z8AA 4ZEPA 3GC5A 2ODOA 4OIFA 4K1GA 4YYCA 1HKMA 3UZJA 2XZ9A 1GOXA 4Q4OA 4OBTA 1JZ7A 1FY6A 4NZ1A 1Z48A 1E1CA 1Y5XA 5I3IA 1EJWC 3GG7A 2EPKX 1CGTA 3UW6A 5D2YA 4WD0A 4UCGA 3WUEA 5AC4A 6A3HA 4GK8A 4DXKA 4B5SA 1OVDA 3GUWA 2RDWA 4L1XA 3B9AA 1X7FA 4ZSTA 2D2GA 5LXXA 4AYGA 3WFZA 5G1TA 2I9UA 3ARPA 1WXZA 1ECEA 3LGDA 3FS2A 4PCFA 1VFTA 3TYAA 4JY8A 1HGWA 3E2RA 1UBSA 2FZ8A 4CU8A 3MI3A 1F6YA 4RW5A 4ATWA 3AS3A 1FECA 3FIGA 4UQCA 4EXQA 5JH2A 4KETA 1FP9A 3I6TA 1X98A 2NZLA 3CGDA 2TRSA 2BY3A 1EJSC 3V35A 4MJ2A 2CESA 3GAYA 1YXYA 4Z08A 3PZIA 5BOEA 4XAZA 1RZMA 5K7JA 5FIPA 5CJ5A 3M64A 2BFGA 4N4PA 3OEXA 1DXLA 2XGBA 3ITYA 3OVGA 2E0PA 3B9DA 4L9ZA 1YBQA 4HN8A 4Q8MA 4UC5A 2WCAA 2BGNE 3E1F1 1GZ1A 5I03A 3IJ7A 3WL1A 2HE8A 1UD8A 4AIUA 1Q3NA 2QAFA 4DPPA 3LMZA 3KRUA 3ALGA 3UR8A 2ZFAA 4OVXA 4AWTA 3I4KA 1I9CB 2W79A 4CD5A 2R8WA 3IJDA 2B7NA 1E9LA 1EA0A 4HB7A 1ZJBA 2A7NA 2XGZA 4AX7A 3AXXA 2VFIA 3THUA 4M1RA 1GKRA 2WMKA 2B7OA 4C1KA 1Q6EA 2VD8A 1JI1A 2EO7A 2BB0A 3DK9A 3A22A 3IWPA 4QS5A 2WWCA 2WHLA 5A8PA 1E6NA 4GKLA 2G41A 3C56A 5EBUA 3QY7A 2WBKA 4ACYA 3THQA 4C6BA 3W7KA 3VCNA 3OQEA 4TVUA 1QK2A 1XP3A 3L0KA 3C86A 4W5ZA 3MCOA 1OQFA 3L0NA 1LPFA 3E12A 3VE9A 1L6YA 3CV1A 4HT3A 1A0DA 1AUSL 4X2PA 1J5SA 1YPIA 3BV4A 4BEUA 4WXYA 1TSIA 1OADA 3QV6A 5D8ZA 1GHRA 2YR1A 4I6VA 5T91A 3S2MA 2F84A 1GVIA 3N9KA 3A7AA 4S1FA 3AOFA 5C71A 1ZLPA 3UWUA 3LS9A 5CXPA 4IPIA 1JPDX 3GC2A 4WDUA 4CNNA 3OGRA 1U30A 4KT2A 2AAQA 1JCXA 1W1B1 2YBUA 3S5ZA 2WNQA 1H6VA 4IG2B 3CV6A 3GVQA 5K9XA 3W72A 3AMCA 1SVDA 1YPFA 2BDQA 2C8NA 3F5JA 1U5VA 1ZU8A 2WQDA 4Y9AA 1BG9A 3M6YA 4NEWA 4IPPA 1DKWA 1XLLA 5HWNA 3GDRA 4DJEA 2F2KA 1OABA 1OYBA 1A5KC 4DNAA 3MYPA 4LB3A 4WKFA 4GIEA 3L5MA 2VTFA 5C9RA 2BOEX 2FKPA 4DAIA 1ZBVA 1BD0A 4JDYA 2Z1XA 3W38A 2R1NA 3N2BA 1TVNA 4PMDA 3EX3A 3R8RA 4N02A 3TV8A 3NZGA 4IICA 1ZP3A 3SCNA 4JNZA 1DWAM 2W55A 1KXHA 1P0NA 5HMDA 2ISDA 1NVMA 3DDMA 3B8VA 1F07A 2PWVA 2VD9A 3LCFA 1E1EA 2V0TA 3AQUA 2ATMA 3GNDA 2ZZ3A 2E09A 2AAMA 1QVBA 3UA4A 2VJXA 4DIAA 1SU5A 1I2RA 1RLDA 2D69A 2E7FA 3FJ4A 4DBDA 3TTQA 3CMFA 2EPHA 3UCQA 1T3QC 3CK5A 2PDPA 3T0TA 3DFHA 3LCHA 4N2YA 1TVLA 1I45A 1E9YB 4FF5A 3AHZA 2V38A 1Q5MA 4C6LA 2Y63A 4C1LA 2WSPA 3KL0A 3AIBA 2HK1A 3RMJA 3DFPA 2FJKA 2D2JA 1Z7AA 3EDDA 3ARQA 2XDFA 1E15A 1QO5A 3KE0A 3SEPA 4NRSA 4HPNA 1CGVA 3W2KA 3CH9A 2DORA 2DV0A 2LLEA 4E3TA 4F2TA 3BZJA 1BSLA 1T41A 4U3AA 5HR7A 1PX8A 2W67A 2YXGA 3LLDA 2CLKA 3BQ5A 3PAJA 1K7EA 2Y5EA 2INEA 3SR7A 4R3UA 5JVLA 1RQBA 3CL8A 4YJ5A 1EC7A 4JIHA 4C6MA 3K13A 4QNEA 4O16A 2GJLA 3ZVHA 4DNHA 2XH4A 2YIHA 1KFBA 4NXKA 3O15A 1L8NA 2C16A 4D9PA 1AQHA 3CUZA 4XZNX 4XZMX 1XBXA 4R9XA 3TSDA 4Q6XA 4NILA 3LK6A 1LUCA 1F3XA 4JIQA 2C0AA 3M0VA 4HTBA 3SRDA 3WF3A 3IS4A 2OOFA 2DU2A 4N9DA 3I3EA 4TU1A 2B31A 1FRBA 5CZJA 3OO2A 4ALDA 4LVAA 3O16A 4Q8WA 3M7WA 1JJKA 1YIXA 3NVYB 2QVNA 3CMGA 4FOKA 4E38A 1EBDA 4K68A 1EP3A 4U2YA 2PFHA 1E0TA 5FJPA 3PNZA 1Z9AA 3N2XA 1GEUA 4CNPA 4BF7A 2JKPA 1TZ7A 2XWEA 3AJXA 1XL9A 2PU0A 1S1PA 4C6FA 4RV8A 1W1VA 2F8QA 2W62A 3RLVA 2QPXA 1XD0A 2I5IA 1XISA 1R46A 1GQNA 3HPFA 3NAVA 4ZB2A 4F9JA 3CEUA 3UWEA 4XO7A 2VGFA 2J7EA 3MB9A 1FKWA 5BXSA 2QDEA 2EEXA 3T2OA 2PP3A 3MZ2A 4JZ5A 4PC8A 4MKNA 2GK1B 5I2UA 3RXZA 4CNUA 1PL9A 4KCWA 3I68A 2OWXA 2DW7A 3P8IA 3BE7A 3AWOA 3VIJA 5XIMA 1BYAA 1EOMA 3W1TA 5DT5A 2DJXA 4DO6A 4J3TA 3EKZA 2X42A 5AYXA 2CLMA 3LYEA 1CNVA 4WXZA 1B4KA 1ZK7A 1J79A 1DQWA 1M7XA 2PWUA 3VIOA 1XKYA 4AD3A 1TO3A 4QEEA 2ISFA 2FZ9A 4KWVA 2GQ9A 4N6FA 3PHAA 4LCSA 1K1DA 4HYVA 1FWDC 3LSBA 1PHQA 3OYZA 4Z1AA 4F0KA 2WOVA 3CGBA 2E5CA 4J4KA 4PCPA 4DZHA 3UJEA 1Y5WA 2ABAA 5AVHA 3O2LA 1SFLA 3F4CA 3HQ1A 3OGSA 3LG3A 2HROA 1EJ7L 5KSWA 4C6NA 4FOJA 4B3KA 1NWTA 2X8RA 1KR0A 3W1QA 5BCAA 3V1HA 1VH7A 4L56A 2FPTA 3VDAA 3UWQA 3WJSA 3U4FA 4XBJA 2O9TA 1REQA 3W7NA 3PK7A 2XISA 2GJRA 3II4A 2PP0A 3W2UA 1UWAA 3PWIA 3MKVA 1A5SA 3URBA 1IZJA 4H4RA 3DG3A 4HNUA 4DZAA 5HPOA 3E2VA 3WX7A 4RW3A 4GGHA 3WNMA 1NJJA 5TQLA 2GFTA 5H8MA 3PZ9A 3H54A 4AISA 1KTCA 1TYTA 5E9AA 3GAKA 2BCPA 5KZ6A 2X09A 2D3LA 3QEZA 3WO8A 4XKYB 3FLUA 2P76A 2F6UA 1V93A 4DJDA 4GLEA 3W7EA 3F2DA 5D03A 1KLZA 3PULA 3N9RA 3WEMA 5EMMA 4Q4SA 3GE7A 2E5AA 2QUTA 2DDXA 4TVDA 4LWWA 1BRLB 4P8WA 4J40A 4GYKA 1LDCA 4HPGA 1UD2A 3VDBA 1WDQA 3N6QA 4KIRA 1WZAA 2Q6ZA 4D6EA 5A94A 2OT0A 1S5NA 3FY1A 3KZPA 1R8LA 2HTMA 4KCVA 2GJPA 3WQ5A 4CQAA 1DEDA 3BW3A 4G7EA 4DJFD 3MA8A 1XBVA 2JK2A 4UFJA 4LVDA 3T05A 4OV4A 3EB3A 2WKJA 1US0A 3ABXA 4AD1A 1H0GA 1HKJA 1ONXA 4UFMA 1H60A 2QAEA 1JZ4A 1AG1O 1R38A 3WMCA 4Z2KA 1P0EA 1QCWA 3IRDA 4IMAA 2ZZCA 4LBSA 3RN6A 3W9ZA 3GVVA 4HIBA 2FGLA 2G50A 3BAJA 2VEKA 3CHDA 2WMFA 1U2YA 1EBGA 3NURA 4KWOA 4ZQMA 9CGTA 1UKQA 3MDWA 4OQVA 3A7RA 4J3VA 3ITLA 5KETA 4JHOA 3IVTA 2J8TA 5EYWA 1CW2A 2PCEA 1OF6A 3FFSA 2WM0A 4G5DA 1Q45A 5XIAA 1IF2A 2WVTA 4AEFA 1XQKA 1JDFA 1K70A 1XH0A 2NVKX 5EMJA 4EXAA 2G3IA 1SJAA 3FVDA 2HK0A 1RD5A 3GU9A 3GDLA 4GFSA 3SIZA 3IIXA 4LS0A 4Z17A 3NNTA 3A64A 3S42A 2DVXA 2I14A 4HZMA 4P8XA 3B0UX 4Q22A 1V4YA 2E6DA 3GDMA 3KX6A 5HK4A 4HNTA 1X97A 3IUIA 4I5UA 2OKOA 5DXXA 3WBWA 2REQB 5CQ1A 2ZUNA 4ZE4A 3SUTA 5CC5A 1LBFA 2OLHA 4KS0A 4KWUA 4HKPA 2FTYA 2WM1A 1J10A 3PFRA 2I5QA 3Q94A 5HJLA 3DI0A 1XFCA 2ZX9A 1HJVA 2GL5A 3KS5A 4GXMA 4ZBCA 4ATDA 3GXIA 4AD0A 3N2MA 2ZDSA 1YTDA 2WZTA 4PFMA 4YWOA 1E55A 1YDVA 1GRHA 3W7GA 4PCSA 5IBXA 4JN7A 2QF8A 3BMWA 3QMRA 2P5NA 4MM1A 2PDMA 5H6HA 3RCYA 1OZQA 4GMEA 2YDSA 1UR2A 1B54A 3ABOA 4XAFA 4S3KA 4LFYA 3C2FA 1XIHA 2VZUA 1PWMA 1Q6FA 4E4FA 2A3HA 2XU2A 3WH7A 3C61A 2WOIA 2G4JA 4B90A 4L5ZA 1SO3A 5CZTA 4UFLA 4JDBA 3QV8A 2ZUTA 3VX1A 2YOCA 2IXUA 3KS6A 3U57A 3NIYA 4UNLA 4RZ6A 1S5VA 3WQEA 1E6RA 2Z1BA 3A47A 4B4FA 2O0TA 3DENA 5AHIA 2PWGA 4M6UA 1TREA 4BWLA 3EUB3 2NPXA 1GYLA 3A5VA 2WHJA 3TONA 1SSGA 3QJAA 4GISA 1ZX9A 4DUXA 1CXKA 4J3XA 4WHBA 1YDYA 4G2DA 2YCLA 5ABFA 2GLKA 4AZIA 4DLMA 1SGJA 1B30A 3DFOA 4MNJA 3WLMA 1CECA 1JRBA 3B9JB 8TIMA 4J57A 3T07A 1DXIA 4QJ1A 3FOKA 1QWGA 4U5KA 4IFKB 1N5WC 4H9UA 5GNZA 2FB2A 1LWIA 3KTCA 4LNYA 1GK8A 1ADSA 3CTTA 3OG2A 4DXXA 4HPJA 3JZEA 3M9YA 4JTDA 2CZ5A 2GSJA 4OKDA 2I5GA 5FS6A 4YHEA 1AJ2A 1M01A 9XIMA 3P82A 4DF0A 3LCWA 3VIIA 3RLUA 1EB3A 1IIGA 1S2TA 1TPEA 2ABBA 4YLWA 1UQZA 4JCMA 2OVLA 3ENLA 4NUWA 4RLIA 3VMPA 2NQ5A 3V16A 5I78A 4PUMA 1XIFA 3SY8A 4JTSA 2OSYA 2QJNA 1W31A 3KBNA 5JMUA 5GRTA 2A1YA 1YE4A 3CBWA 5DRIA 4QGCA 1D8CA 3SZ8A 1HIZA 4KCTA 3STEA 1FBAA 2CW6A 4PB4A 3TP4A 5ABEA 4PUEA 1FQ0A 3E2SA 1ISWA 3ARTA 3L65A 5C9ZA 1KXVA 3QY6A 3MANA 3QKEA 3S46A 3A21A 5EFDA 4D71A 2GGJA 2JIWA 3EPNA 3VCRA 1W1YA 3N04A 4R5EA 4YTSA 3BVJA 1GXFA 2XJ7A 4IIGA 4JTAA 1PHWA 3CU2A 3EGJA 3HQNA 1UWIA 1K7XA 3EX1A 4HNCA 2DY3A 2X99A 3UERA 2VHLA 4LEQA 4EOUA 1W2VA 1I0DA 2D23A 3OHMB 2XIIA 5JCIA 3GKAA 1E70M 5D2WA 4FNSA 5CJMA 2NV1A 1GVEA 1PKLA 4NYYA 3W27A 5AHFA 2YL8A 1O1ZA 1Q6QA 4O1BA 1SMAA 1WCGA 4CU6A 1Z3NA 4DWDA 2ZVIA 4XUGA 4O19A 5G2WA 1JF5A 1FH8A 4JTIA 3W7LA 3EOLA 4X63A 4MFDA 3Q37A 1JNDA 2PDIA 3KCLA 1ME7A 3HG3A 5EBKA 2GVYA 3QKZA 4XD6A 2A6LA 2H3DA 1RQHA 4NZ3A 2GR3A 1XX1A 1ME9A 4I7WA 1VFHA 5LNSA 1QOXA 4XD4A 4PBEA 2QCMA 4WSHA 5CSSA 1NFGA 4V33A 3E2QA 1JPHA 4C7DA 5HWMA 4NZ5A 3UCDA 4LT9A 1C8XA 1MRQA 2FYMA 4DF2A 3LPOA 1A5UA 3VFLA 4NIRA 2GOKA 3HGRA 1GRAA 3AN1A 2V30A 1HL9A 1BLIA 3S2NA 1VHNA 3SRKA 4WY0F 3PPFA 1R3VA 5BOOA 2YQUA 4L7ZA 3USZA 3LENA 1R7OA 1W3NA 1EHNA 2J6VA 4RNIA 3C6CA 5HNTA 3RM8A 2WWDA 3GO2A 3MKCA 3C0SA 3PSVA 5E1QA 4RPQA 2HJPA 3BMVA 4Q8NA 1R3YA 1LJYA 2V2CA 1SZGA 4H1ZA 3BW4A 5G1MA 2XIMA 1DIEA 4JIPA 3UWWA 1JZ5A 3HMCA 4A4AA 4M81A 2BBFA 3HTWA 4RUBA 3QY8A 3RUBL 4OZOA 3MY9A 1EKOA 4M7SA 2RAGA 2A85A 2C0HA 2X8GA 4XAYA 3WSUA 3VTRA 1UD6A 3HZ3A 2G96A 3L4YA 1TJ2A 3GTXA 1UB3A 4ATLA 4ZMGA 3VYLA 2WHKA 1GHSA 2OU4A 4WDTA 4Q4MA 3JRKA 2G37A 3NQFA 5KITA 1KM2A 1ZZMA 2I57A 5IDZA 4JKLA 1KO0A 4GH1A 4Z2IA 1VIZA 2PZNA 3CZKA 1HKVA 2OYMA 4L61A 4OBSA 1AD4A 5T9CE 2V5KA 2C1IA 1IEWA 3GG8A 1G69A 1EGMA 4PB3A 3LSCA 3UR7A 3P93A 2VR5A 4YTQA 2DEPA 2WSYA 1LQAA 1E40A 3N6JA 3AMZA 2SFPA 1ESWA 3JR2A 3T08A 3L21A 2PDYA 2PLMA 4UZSA 3DBPA 4B4HA 1VPQA 1ZTVA 3FA3A 1I8JA 5HATA 2XM2A 4J2MA 1N61C 5H2ZA 4S3GA 4DBWA 3STCA 3A23A 3L67A 3ZT6A 1WX0A 4RDYA 1TV5A 3B03A 3B9EA 4LS1A 5I3DA 4H4TA 1HW6A 1XDJA 4LUTB 1H7XA 2ZRVA 1A0EA 1UD4A 2YL9A 2I1OA 1RQEA 1ZUAX 3SBFA 3EOOA 1ONEA 3PG8A 4P8VA 1AW5A 5HNUA 3W7PA 2CXGA 4V1YA 1XG4A 2XIQA 3A6OA 4HU8A 2KAUC 2PZ0A 1UWUA 3HOJA 1FEAA 4ML4A 4DVOA 1UMYA 3G18A 1F3TA 1EXPA 2CBVA 4PFHA 4AZBA 4RZBA 1O1HA 1IZKA 2G5WA 3K2GA 1V3JA 1F8WA 1TFVA 3WG6A 4XBKA 3LTSA 3VC6A 4H9ZA 5E0CA 3WNOA 4NJKA 1VFLA 3DYMA 3H6OA 4GI6A 3O0KA 2P3ZA 4JQAA 3W2JA 3AXIA 3BSMA 3W6YA 3W86A 4IMCA 4R7WA 1IQ8A 3G1YA 4PMZA 4TX6A 6REQB 3KBMA 1OFPA 4JY9A 3E38A 5U7SA 4ZL1A 2X1SA 3AFBA 1TE1A 3RYSA 3WBYA 1R3WA 2OODA 3TSBA 1JUEA 5HANA 3U5UA 3CXBA 3O6CA 3RJXA 2OPJA 1O60A 4PTWA 1FWGC 3C2RA 1OG0A 3M47A 3UWZA 2BVWA 3BCDA 1Q6GA 2VRJA 2O9RA 2DH2A 2ZE3A 3L12A 3TQVA 3MT1A 4KH2A 3VD3A 3KHDA 3O6YX 4A8NA 3FCPA 3OYXA 1EJXC 3GU2A 2VGIA 2WB5A 5C6MA 3TWBA 4N9EA 4FR6A 3CWOX 2RFGA 2VEGA 2OX1A 4HK7A 2VDHA 2HXTA 3TVAA 3EDKA 3EA1A 3CIXA 1TA3A 1HO4A 5F1VA 1WPCA 1F3WA 4MOZA 2ZOXA 4PZVA 2DVTA 1OX5A 4IH3A 5A8NA 1ZDLA 2OLAA 3VIGA 2ZRWA 4Q3MA 4CKQA 3MYOA 3MHUA 1KV8A 1TV2A 3GDKA 3ANUA 3K4DA 5KVHA 1EC8A 4WCJA 1V03A 1YADA 4BURA 2ZX6A 1EQCA 1FA2A 3CHVA 1KFJA 4GQGA 4QG6A 4Z2LA 4HMNA 1XYLA 4ZSUA 1UPMB 2CIPA 2P0OA 3U2EA 3K8KA 1JZ8A 1K02A 1GORA 1W5PA 7PTDA 3CC1A 2WBGA 2BG5A 2WKGA 1P7TB 2WCSA 4AZ6A 4CCEA 2EPLX 5DQPA 4IXXA 4I8DA 3WLTA 4Q4QA 1V0MA 1R3QA 5LNRA 4AG0A 1OC7A 3TSMA 3FK4A 2WYSA 3P80A 5C55A 1B5TA 1W0MA 4AZGA 3UZXA 4U4MA 3EAOA 3WNPA 2OR2A 1ONFA 5F1UA 4GVIA 2WJDA 4LU0A 1THFD 1PYFA 2VZOA 1XYBA 2IPFA 4ZGYA 2PCQA 4TTUA 5BW6A 3MV01 2E9LA 2PURA 3DFTA 3PTKA 1V08A 1W9VA 3EXRA 3V36A 4G6CA 2DSUA 2CBUA 4D6GA 3E9AA 5JH1A 3D47A 2V67A 5SWUA 2D0FA 2XM1A 2ZTKA 4GQQA 1C92A 2AMXA 1NOWA 4Y9MA 3VMOA 2CCRA 3AIUA 2QDGA 2FFCA 2WW5A 3BLPX 1G0CA 1KRCC 1Q1WA 1F3PA 1QK0A 1C7TA 2V5DA 4FLSA 5DCEA 2YL5A 1PE1A 3B0VC 5JCLA 1CB7B 1MW1A 3FXYA 1ZSXA 3M16A 2XVPA 4O11A 3KP0A 1V02A 3P5ZA 2P0IA 1BXCA 4FSAA 2QZRA 2V3BA 4D6JA 5AHMA 5IHSA 2JQXA 1EXBA 4W85A 2NQ9A 1H3GA 3LA4A 3BCJA 5D9OA 3ZJ7A 2Q09A 1PCWA 2CLPA 3TA6A 1EJRC 5HQLA 3CH0A 4BV6A 3GM8A 2B7PA 5BYWA 2YBVA 4UTHA 2CYGA 3JZUA 1KBJA 1NHSA 1SYTA 3H2NA 3VUSA 4HZ7A 1POJA 2WNWA 5AYZA 1OC6A 1SO5A 2A79A 4DAFA 4IIFA 3S6TA 1P0KA 4BKNA 5CEWA 2ALDA 5C8BB 4CQDA 2X7VA 5CBIA 5FOOA 2GVEA 4HPXA 5C70A 1K3UA 2DZSA 1SMDA 2DW6A 1QPKA 3DHUA 4UR9A 3WY1A 1CI1A 4C7FA 4R53A 1O6IA 3TYCA 4CN6A 3ARZA 1S46A 1F61A 2XFWA 3D3AA 1GQJA 2CBIA 4PEKA 4KIEA 4GA8A 4AC1X 4CLMA 4F0HA 4GIYA 2VYOA 3QR3A 3W2NA 2PD5A 1FWBC 2J7GA 5FKYA 3TX9A 3LEPA 1PKNA 3CXOA 3IUDA 1XDMA 4ZTXA 5C5YA 2ZYFA 4H9TA 4WOQA 1R9ZA 3U7BA 1YTEA 1KQZA 5GNXA 4AHOA 1L6WA 4KESA 1ZMCA 3EKLA 4GZIA 4D8ZA 4KEMA 1UQYA 2ZUWA 2QDHA 3PY2A 3AS2A 5FCZA 4H4YA 1L0PA 1FXPA 2X2GA 2E1WA 1GTHA 5FJJA 3TMLA 1UPPA 1F8MA 1KXQA 1A5AA 5D09A 3RNDA 4HCDA 3KBSA 1Q2RA 5JCNA 3BJFA 1JNEA 2YLAA 3GW0A 2HE5A 2OZ8A 3TLQA 3PTDA 4DM1A 2XN0A 4TXEA 5U4NA 4P7LA 3NQCA 3VO0A 1M9HA 1VD6A 1FWHC 2BZNA 4NX5A 2HRWA 3EBVA 3RU6A 4W8BA 3W1MA 2W4XA 1Q6RA 2X50A 5A6SA 1TCMA 3N2CA 3R0UA 2OKTA 1AJZA 2FB3A 3GBDA 4CQCA 3H24A 3WH8A 3BICA 1JL8A 5I3KA 3VM5A 3SCRA 4J3SA 2IXVA 3ZOAA 3S1XA 2C7FA 1QTWA 2B7QA 5A6MA 1VKFA 4H4ZA 1F4AA 3F2BA 2GQ8A 4L65A 4Y9NA 3VGGA 1GQKA 3FA5A 3QW3A 3VNIA 3ARUA 2FVLA 3I7SA 1W9BM 1O7AA 3ARSA 5D04C 2XPKA 3BV7A 3P8JA 4O17A 1J0HA 1L9WA 1ZMDA 3WYZA 3WBEA 1DXFA 4GD0A 4PODA 2DIJA 1N8FA 1J96A 2ZADA 3MU7A 4NJHA 2OEJA 4IFOA 1EJTC 3N17A 3MW7A 2GVLA 3R6IA 3UFYA 4H4PA 4RDWA 3L2IA 1Q4NX 1PWLA 3C3NA 1U5JA 1I2QA 1O5KA 1UP2A 1IT7A 1GVFA 3BJTA 3GXDA 2CZFA 4W7WA 1VQZA 4O8RA 1KBBA 1GERA 4RV3A 2FMNA 3ZJ8A 4HMDA 2BC1A 2PUZA 4JR5A 3MZNA 4LX4A 1MZHA 4AVOA 1DHKA 2V6OA 1RVGA 1DJGA 1DNCA 3AUOA 1BYDA 1DJZA 1WV2A 2CKRA 2BVYA 2KX9A 3POHA 2FPYA 3IAPA 5FS7A 1H63A 2XIBA 4MJ4A 1QXLA 1HUVA 1ZY9A 3RM4A 1SFTA 3H2CA 5A6AA 1SJCA 3ZO9A 2EPNA 4JKMA 2VFHA 3WQFA 3T55A 2A7PA 2WV8A 2QMJA 3WL0A 1G6CA 1FP8A 3BLOA 4W89A 3P6LA 3L68A 4CNSA 2WPFA 4OOZA 1RH9A 1CWYA 1LOSA 4UWMA 3S4TA 4D8LA 1TWZA 1TPVA 5LSMA 3V7PA 1H51A 3E96A 3WQDA 2Y5SA 1PCKA 5A6BD 4AD5A 3ZWTA 1RP8A 4Q8QA 5AC8A 2RDUA 4E4UA 4HSHA 4WUIA 2QNEA 5FS9A 1QI3A 4LAMA 3NL6A 5G4EA 3UR2A 4W93A 3H4WA 3CAQA 2YA1A 3PJWA 1QT1A 3NQVA 3WNLA 4P5UA 5FAJA 3K8LA 1KM0A 2ZXDA 3L4XA 3O7UA 2GJXB 1M65A 5CBJA 1Z69A 1EX5A 1XLGA 3TJ4A 4O1EA 4QDPA 4H9VA 2NX3A 2QJMA 4JQ2A 3CGCA 2RH9A 2D2HA 1ZALA 4FPSA 4UIOA 4LC8A 4WDXA 1U1HA 1F6KA 3AALA 3CUIA 1BWLA 3ABQA 2DUXA 1CXEA 1KNWA 1R87A 1JRPA 3II1A 4UMBA 5CSYA 1UUOA 3OQ8A 5DBTA 3MQTA 3OZMA 4A8LA 3DHDA 4K1WA 2Y88A 3H4XA 2QMKA 3HO8A 4DI9A 1QUMA 4M80A 2OSXA 1IXPA 2DT2A 1V8EA 2VT0A 3EPMA 2RJHA 3LNPA 2ZICA 1F74A 1IE7C 4PTXA 4UBPC 2OT1A 4JHMA 3WF2A 3VABA 1STZA 2GJNA 1PKMA 3WLJA 4MFEA 3AIEA 1DIDA 1HQTA 4GYFA 3W02A 3LU2A 1H61A 3KVKA 4YYFA 1UKPA 2F7FA 2MNRA 4GH3A 2VZSA 1MYRA 3RRXA 4P2VA 1EGZA 4LAZA 3K46A 2BNJA 1IR2A 2OYKA 3LHWA 2R9RA 1W8GA 4YWSA 1TE6A 3F5KA 2CLFA 3SQPA 3SQLA 4AEEA 1CBGA 2Y8KA 1YQZA 5HJYA 4NP7A 4EQWA 3AS0A 2EQ8A 2WOQA 3U2OA 1ZFJA 4Z2HA 4NRRA 3W7DA 3CT7A 3WEOA 1JCLA 3CPRA 1VYRA 5G4WA 5FJIA 1CXIA 4MADA 5LYRA 1UW9A 1VP5A 4JXCA 4QISA 1IEXA 4E2OA 2HDJA 5FESA 4ILSA 2YBTA 3C5QA 3E6EA 4D6FA 3IRSA 1X1OA 4CEXC 3W6LA 3SR6B 3SCOA 4DBSA 1TB3A 4C90A 1RXOB 4PUWA 5AB3A 3WLIA 3OU8A 4RXGA 1DQXA 3VKKA 1Q6DA 5FJUA 3W73A 1R30A 1GOMA 3PG9A 4AIEA 4KRTA 4XV0A 3NUKA 1H50A 3AJ7A 4W88A 1DWGM 2BASA 1DVJA 1WXJA 1EO7A 1VCVA 3TKFA 5FF2A 3M0HA 1C91A 3G22A 1J12A 1MMFA 1R6WA 4A8IA 3GK0A 5LA1A 2Z2UA 4IUGA 4H4QA 2PF0A 3F03K 3GRIA 1UD5A 1VFUA 3WDIA 4AY7A 2Y5JA 1VRDA 2TODA 4ZOEA 3URHA 2WC3A 1TUFA 2VRQA 4X0VA 4Q8TA 4V1XA 2WSQA 1UH4A 3NZ1A 3QV7A 2GQWA 1UA7A 4ZE5A 4LRTA 1W54A 2UBPC 1LP6A 2ZZ1A 2XYLA 3W1LA 1I2NA 2QPUA 2GK1A 4KERA 3LTPA 1CLXA 2WVUA 1W91A 2JBMA 1UCWA 4ROPA 4JBRA 3RILA 1TVPA 3TIMA 3ETRB 1F73A 2VCCA 1WKYA 3B05A 4GYPA 5BXRA 1IWBA 2YXXA 2QUUA 4Q8UA 3CGTA 1SZRA 4NASA 3B9NA 2WCGA 1JD7A 1H5VA 3B06A 1VBGA 2PWFA 2QCHA 4FHAA 4UTMA 1NTHA 3REQB 4JICA 4U3CA 1UKOA 1XS2A 2QYGA 2F5ZA 3LZ5A 3KOXA 3P2VA 3KBJA 2FZMA 5C2GA 4RDZA 1S2AA 4LF2A 3UG5A 1FFQA 4MZYA 2JEPA 4XIMA 4GI4A 1VBJA 1V7AA 1W1ZA 3DH7A 1OK6A 1FCVA 2WZHA 4YMZA 5FF4A 2R1KA 4GVHA 3VILA 2QHAA 3GR8A 5EBAA 3M07A 4QLKA 1KM6A 3NVTA 2DSVA 3W7HA 3B8UA 3BSHA 3WLOA 2AOSA 3C8NA 2WZIA 5D38A 3G0UA 3ZXWA 1M7JA 1VS1A 1HGYA 2V8ZA 2HPMA 4RZ5A 1MFVA 5E5CA 4Q8VA 2ZRXA 1HKIA 3L4TA 1XXXA 1GT8A 4BI6A 1OGGA 3WK3A 3SGGA 2QKFA 4W86A 1UJQA 1EDTA 1B31A 2PA6A 3OPSA 1RPXA 4GKTA 3KL5A 4O1FA 4S3CA 3HBLA 3F5LA 1DE5A 3S1GA 3MMUA 1BHGA 2ZZ5A 4EKJA 2YVJA 2WC4A 5IXEA 4UNKA 4XKYA 4M6QA 1ZBWA 2IQ0A 2DP3A 2OWWA 5HPCA 1NFBA 1N8IA 5FF0A 1JPKA 3W3OA 1AVAA 3UWYA 2EQ7A 3BOLA 4NNBA 3PZMA 3G2GA 5CPQA 5LHEA 1ISXA 1VYSX 2ZC1A 3RM9A 4ZQNA 1BRLA 4WJ8A 5CPOA 2WZMA 3VIMA 1I2PA 1PDYA 3MP4A 4FXFA 3WUFA 1EZ2A 2ATSA 1P6BA 3AROA 1N82A 4M1BA 3MI2A 4GGBA 3RO6A 3SCUA 1UWTA 4MB5A 4B2DA 1EF3A 1BKHA 1IR1A 2NVAA 2J88A 4H6KA 1LROA 4YXGA 1HTIA 2Y0FA 1SZFA 3T40A 1X2GA 1YMYA 3TAKA 1PZ0A 1SJDA 3M41A 4XZBA 4AEOA 1GGOA 3VGBA 4R27A 3M44A 2D0GA 4ADSA 3GTHA 1J8VA 1L6FA 1L2QA 4GX8A 3QH2A 2YW3A 1BQCA 1P1MA 1XLKA 1RJPA 5CSUA 3GXMA 4QS6A 3AHTA 4GQ0A 3L8KA 3FYPA 3RIKA 3LERA 4O0ZA 4K39A 4H4VA 3I7RA 1VPXA 4DUOA 2VVNA 5AC5A 2IKHA 3RPDA 3MSDA 4IL0A 1IT8A 3MJYA 3QHMA 3IARA 1CGUA 3VX0A 3RPMA 3L23A 2W9MA 4ZO6A 4FX7A 3ZLGA 4TUFA 4JD4A 1YBQB 1V6XA 3ZS4A 2OJPA 1MUMA 3SN4A 1Y0EA 3DGBA 3V0TA 2P1FA 4IL2A 1TX0A 2QAPA 3C2YA 3LGEA 5A6JA 1GONA 5HNRA 1R0MA 2HZGA 3FN9A 1DWHM 1EFZA 5TBOA 4LYPA 3V75A 3W7IA 2VR4A 1E6SM 2Z0IA 2BS9A 3PZTA 3EDEA 2NQHA 1TRDA 1R3SA 5H8UA 4LBRA 4KRUA 5FL1A 3T0AA 1UR0A 3AYTA 1A80A 5LIYX 3T0BA 2D24A 1VBRA 4DY1A 2ZUVA 5DCDA 4TMCA 3THDA 3KRZA 4W84A 4MDPA 1XLDA 2PDKA 3DN5A 2XH7A 3CUGA 2OG9A 4Q4KA 2G95A 3JVAA 3MUCA 3T81A 4MF4A 4MHBA 3INPA 1UC5A 4FI4A 2WOWA 3MUY1 2VGBA 1XH1A 2CDUA 2AL2B 3TQ0A 1VLWA 2EBNA 2OCZA 3MUXA 4WK9A 4MZ1A 4GQRA 1F6PA 4PRTA 1OFBA 4QG8A 1RCQA 4DI8A 1FHUA 2D3NA 1H7WA 2W61A 2I9EA 5I0DA 3KOFA 3WD2A 3PJTA 1L2UA 1FDYA 3DXIA 1BYCA 3D9XA 3C8FA 5AYYA 3R12A 4M56A 5F7UA 3TN5A 4LUJA 2ACRA 3KVJA 1OD8A 3CYJA 3OA5A 2NVDA 3M43A 2Y8UA 4GY7A 3NEHA 3KBWA 1N60C 2DQXA 3U7VA 4B92A 3G1VA 1V0NA 2CERA 5F2LA 1KXTA 3LLFA 1ICQA 4E8CA 4REQA 4ZB5A 3OLEA 3VXGA 1T99A 1Q6LA 3K4WA 4HA3A 3HM7A 1ECQA 1W5OA 3A4WA 3R0DA 3KLJA 2F6KA 1R47A 4Z1BA 2BLEA 3QHOA 2QPSA 2HVOA 1KCLA 1XPYA 4IFKA 2NVCA 4UTTC 1EHAA 1OX4A 2YSWA 1M03A 2W63A 3W2MA 1J5TA 3GH7A 4KBXA 3BL3A 3N73A 4UQDA 3GC4A 2A4AA 4HK6A 3C0LA 3THAA 2EPOA 4KKXA 8XIMA 1BVNP 1RA0A 1EBHA 1XLBA 1EDQA 1XRTA 3RCMA 3E49A 3NSMA 3CB8A 1LT8A 3UNDA 3E0FA 3PM6A 1V3KA 2HQAA 4JL1A 4M6PA 4J28A 1PAMA 5GQBA 3ELFA 5A2AA 4S3DA 1YW1A 3ZQ9A 2Y89A 2Y85A 3WDQA 4JX5A 2OZTA 2PTWA 4H50A 4CN4A 2AGKA 4V28A 3MCMA 2BVDA 4GX9A 2R82A 2J77A 3M0LA 1A53A 1HT6A 2E5BA 4M24A 2R9ZA 3A4XA 1DQUA 4B5UA 2NWSA 4O8AA 2NQZA 5DANA 2YFOA 4IQEA 5CC3A 3R94A 1VLIA 3Q4DA 3OBEA 3AIWA 1KA9F 1KFCA 3FSUA 1VRXA 5CSRA 4HHMA 3WLSA 2VX4A 5G1YA 1LG2A 3NGFA 1K8CA 1H7OA 2XVNA 3CASA 3RO8A 1TYPA 1ZAHA 3S47A 1DIOA 2XFYA 3KHJA 2E28A 4MNKA 4R7JA 1X96A 4WJEA 3QRHA 3UESA 1JF6A 2PLJA 4LJ3A 5BRPA 3SI9A 3UEQA 1DIKA 2ZUUA 3TC3A 3HPZA 2J27A 1M1BA 4LPCA 4NZJA 5FJTA 2Y7GA 1E6ZA 2HSAA 1WDRA 1XFBA 1S7MA 3LZ3A 4FEZA 4Y6GA 1OYCA 1HKWA 2DZXA 4TMBA 4UFIA 3NL2A 4PULA 3RLHA 1S2UA 1LTDA 1E56A 4OBRA 4PCTA 3BGJA 1QI0A 5M1TA 4C1NB 2V9DA 2GR1A 3G1RA 4WR3A 4DWSD 4PTMA 1XLFA 1LUCB 3QMTA 1GYMA 4AZ5A 2WC7A 5DLCA 4QCEA 4X3ZA 1ZKQA 2R91A 4K36A 2HXUA 1VBUA 3KLLA 3R4IA 1FHDA 3T2QA 3PZVA 4D6HA 5GJNA 1Q6OA 3VGFA 1Q2SA 2WPBA 3B40A 3B0XA 3KTXA 4H4XA 1WUEA 3WH5A 1VEMA 3BG5A 4H19A 2BOFX 1A5OC 2NQLA 1MSSA 3BLEA 1XDLA 3A9BA 2YDAA 1CGYA 2P53A 3TCEA 5DMLA 1OB0A 3ANYA 5AECA 1ZBCA 3TWAA 2ESCA 2BY2A 3AC0A 1EEPA 4KPLA 4XO6A 1LBMA 4CQ8A 3NVVB 4LAKA 1SPQA 3TTYA 1FWCC 4LRSA 2VRKA 2Z26A 3HGJA 5JXQA 2QEZA 1I4NA 1MEHA 1XCFA 5KTLA 4KEZA 4HA0A 4OUEA 3SO7A 3IANA 5D2XA 1ELSA 4ECLA 1F76A 5A6TC 1CB2A 3L4WA 1WKEA 1SR9A 3RX2A 4GUHA 3OZOA 5TR3A 2JEQA 4F4RA 1KKOA 2JKEA 4RE3A 1E0XA 4ORIA 5FEZA 4WVXA 3QQ0A 5MKGB 3G6MA 4UFHA 1ADDA 3N3MA 4PTVA 2J47A 3B8IA 3MVIA 4LALA 4QP0A 1W3HA 2WNNA 1VJIA 4DZ5A 3IJIA 4K3ZA 2ACQA 1F9CA 2CZVA 3PSWA 3IVSA 4PUDA 2KZHA 2J8FA 3KBVA 1YXDA 1VC4A 3NM1A 1JZ3A 3RR1A 3VNJA 5C2CA 1EWDA 1HJSA 3QVQA 1TQXA 1R9XA 5A1AA 3HG4A 2C18A 1TZ9A 4H9XA 3GLCA 1BVWA 2A6NA 3AXHA 4KEVA 1E4MM 3QSTA 2VP8A 2VDGA 4XKMA 1AH0A 4MWAD 1TZZA 2ONEA 4QAIA 4ADWA 3AM9A 2QW5A 2PDWA 3DFSA 2DSZA 3H8AA 3G3DA 3KOZA 3W70A 1KCXA 5CAKA 5E09A 2AMGA 3U2ZA 4IGMA 3N4FA 2H90A 4ZO7A 1HVQA 4EM3A 4O4VA 1JQVA 2PTXA 4YU1A 3CZGA 2QCCA 4DXVA 1H7NA 1P5BA 3DG7A 1GPFA 1TWSA 4US5D 4LC6A 1BVZA 4B5NA 4D72A 1REQB 3VOIA 3QPYA 2CWXA 3GYEA 1D8WA 1G67A 4ES4A 3W87A 1NFPA