3PK7A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens with mg and glycerol bound in the active site
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
403
structure length
396
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVYEPADSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens with MG and Glycerol bound in the active site
rcsb
source organism Chromohalobacter salexigens
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
total genus 150
structure length 396
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2010-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3pk7A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3pk7A01
2QDDA 1ELSA 3DFYA 4E5TA 4HYRA 1EC7A 3PK7A 2PTXA 3MQTA 1TE6A 3FCPA 3BOXA 2QJJA 1JPDX 3IK4A 3R0UA 2OPJA 4JN8A 4A3RA 1JPMA 3ES8A 3UXKA 3ZVHA 1KKOA 3ZLHA 3I6EA 3FYYA 2PP0A 3ZVHB 2P3ZA 3BSMA 4JHMA 1ONEA 2AL2A 3MSYA 3T6CA 2RDXA 2OZ8A 3CT2A 2PU0A 4FI4A 4ENLA 2OKTA 2GSHA 4JN7A 1MDRA 2ONEA 2FYMA 3DIPA 1NU5A 3B97A 3IJIA 4HCHA 3NFUA 2ZC8A 3EKGA 3TJIA 2HXUA 1SJDA 2GGJA 2CHRA 1L8PA 3GC2A 3MWCA 3OPSA 3R10A 4MGGA 1FHUA 4GIRA 3VDGA 1P48A 3S5SA 4HN8A 2XH0A 3T8QA 3SN4A 2QDEA 2OQYA 2GL5A 4MMWA 1SJAA 2OZ3A 3OTRA 4GMEA 2XH4A 4GYPA 1YEYA 3Q4DA 4YWSA 3VCNA 1P43A 3SJNA 4ROPA 4K1WA 4HPNA 1EBHA 3VA8A 4HCDA 5BOEA 3CYJA 3SQSA 4DXKA 4IP4A 1EC9A 4H19A 4E4FA 4IL0A 3TW9A 2FKPA 4IL2A 4EWJA 4IP5A 3QN3A 5J04A 3UJSA 4A35A 2OFJA 1FHVA 4K2SA 3RCYA 3DEQA 3ZLGA 4X2PA 4DYEA 3OZMA 3R1ZA 1R0MA 3I4KA 3NZGA 3T9PA 2XGZA 1KCZA 3TTEA 2GDQA 3N4EA 3V5CA 3IJLA 1EBGA 3SN0A 2OG9A 4E6MA 3QLDA 2DW7A 2MNRA 3H7VA 1KD0A 1EC8A 2OVLA 3SBFA 2OQHA 2HZGA 2POZA 2AL1A 3DERA 3DG3A 2P88A 2GGEA 2PTZA 3S47A 4IZGA 4IHCA 3OP2A 3CAWA 3N6JA 1RVKA 2I5QA 3MZNA 3V5FA 1JCTA 2XH7A 3N6HA 3FVDA 2PSNA 2O56A 1DTNA 3DDMA 3FV9A 4J1OA 3VC6A 3CK5A 3P93A 7ENLA 3NXLA 4G8TA 5FJTA 3DESA 3GO2A 4Z1YA 2PTYA 2XSXA 1E9IA 3CB3A 2P8BA 1PDZA 2HXTA 4KEMA 4J3ZA 1F9CA 3TJ4A 2GGHA 2QQ6A 5IDZA 3SSZA 4Z17A 1JDFA 2HNEA 2OO6A 2PPGA 3UCCA 4E8GA 2AL2B 2XH2A 4GGHA 3SN1A 3P3BA 1TZZA 1KKRA 3P0WA 2PMQA 3PWGA 1BQGA 3HPFA 2PTWA 3QKEA 3PWIA 3MUCA 3QPEA 3V3WA 3QTPA 3TCSA 3T4WA 2PP3A 5BOFA 3TWAA 2PODA 5EU9A 4H1ZA 3RGTA 3UCDA 3VC5A 4FP1A 3H12A 3OW1A 3NO1A 2OZTA 3ES7A 4H83A 1OEPA 4KT2A 3U4FA 3DG6A 5FJOA 2DW6A 3R11A 3THUA 3TWBA 3CXOA 2QJMA 1WUFA 3JW7A 3VCCA 4DWDA 3UGVA 2QJNA 4KPLA 3V4BA 2PS2A 1MUCA 4GGBA 5FJPA 2PA6A 4GISA 3MY9A 2AKMA 4DN1A 3GY1A 3UJ2A 1WUEA 3UJEA 3JVAA 1ECQA 3UJFA 3D47A 3K1GA 1R6WA 4A6GA 4ZCWA 2NQLA 3JZUA 2QGYA 2PCEA 2PGWA 3DGBA 3ZLFA 3H70A 2ZADA 1XPYA 4HCLA 3IJQA 3PFRA 5FJUA 3RRAA 4GYPC 3N4FA 4G7FA 4MKSA 4DHGA 3R0KA 4IT1A 3FJ4A 3UJRA 3TQPA 3STPA 2OLAA 1MNSA 1BKHA 3H8AA 3I6TA 2P0IA 3KUMA 3EEZA 6ENLA 4ZA0A 3DFHA 3BJSA 3RR1A 2GGGA 3U9IA 3GD6A 3R25A 2MUCA 4E4UA 4F4RA 4M6UA 2PU1A 3FXGA 4GFIA 2AKZA 1XS2A 3MKCA 5FJRA 3VFCA 2PGEA 2QVHA 1SJBA 3Q45A 4HNCA 3RITA 4M0XA 3ZVIA 1MRAA 2GGIA 4DX3A 3D46A 3ENLA 3OZYA 1MDLA 1W6TA 2PP1A 1TKKA 2P8CA 5ENLA 4K8GA 1PDYA 1NELA 3RO6A 4KWSA 2OX4A 3TOYA 4HNLA 4H2HA 3UXLA 1IYXA 1SJCA 3DG7A
chains in the Genus database with same CATH superfamily
1ELSA 3IRSA 4B4FA 4DELA 2YXOA 1F3XA 3VGBA 1O68A 1NP2A 5AHLA 4C90A 3KL5A 4BZYA 1DJXA 5GJMA 3KRBA 4A2SA 1V02E 4NASA 4IM4A 1JPDX 3FG2P 1F8MA 1Z69A 5FA5A 3N18A 1E6ZA 5CBBA 4F2TA 4A3RA 1VBUA 1A5LC 3ARXA 2DY3A 2ZUSA 1V08A 3BLPX 3DI1A 3LGGA 2A8XA 1UZ4A 4ZL1A 1PX3A 1RA5A 1X7IA 4S3CA 3AXKA 4LAOA 3WMCA 5JH1A 3USZA 2DZPA 5I77A 4DZHA 3CS2A 1FRBA 3BJTA 1VBRA 4DVOA 2QJHA 1FDJA 2ZE3A 1QASA 4GK8A 1SZEA 2GSHA 4CVWA 5FEPA 3GG7A 3GE7A 3IJ7A 1LYXA 3G5EA 4YU1A 2Z4GA 1YXDA 3UT0A 3BURA 4C60A 3DENA 1JI2A 1NOUA 1OCBA 4D1JA 3M0YA 3TJIA 2DP3A 3WLRA 2FMNA 3W1AA 3PZVA 4D8ZA 4XWUA 1FHUA 4HPHA 2WCGA 3VDGA 1P48A 1TJ0A 3LNMA 3TMQA 1TPDA 4J2MA 1POJA 1R2RA 1DP0A 4IXHA 4RE3A 3GNRA 1PXGA 3OYZA 2OB3A 1I0DA 1BVWA 5EPDA 2B7OA 3IGHX 1EEPA 1UD2A 4JQ9A 4TX8A 2GK1B 1CCWB 3U7VA 3L4XA 3WLSA 4H04A 3GQYA 4IX2A 3BTNA 5BMXA 1XXXA 4ORMA 3ABSA 5E0KA 4ICNA 3E6EA 5SWUA 3UWQA 4U31A 1C90A 4X9YA 1UMYA 1EL3A 4IG2B 2F6KA 3ABZA 2GK1A 3ITLA 3OB8A 1UG6A 1SO6A 2R94A 3WYZA 5D30A 2DZWA 1SB3B 4MY1A 2ACUA 3CUZA 1R0MA 4X22A 3PZOA 4MWAC 1L9WA 1ZGDA 3HF3A 2FMOA 4R53A 5CG7A 3TTEA 3EGJA 3NQ6A 3AHXA 3MB9A 3A6OA 3N4EA 2QV4A 4PB3A 3ID7A 3CIVA 3N2BA 2D20A 1ICSA 2WHMA 5AVNA 2PDCA 4TVCA 1ZMDA 1F7BA 4OV4A 1ZDLA 4HP5A 5F4XA 1XUUA 6A3HA 1EKOA 3DG3A 2RFGA 3L21A 3BLIA 2CDUA 3O7UA 4ZE5A 1AJZA 1X8FA 1K4GA 4LUIA 4IHCA 1CTNA 2VCAA 3ITVA 2B0MA 4GZEA 1HKKA 2YW3A 3P0XA 2UY3A 4CQCA 3CZEA 1MYRA 3GHTA 3FA5A 2DVUA 2C79A 1O1HA 4W87A 1KB3A 1X2GA 3S1WA 3RYSA 3G0UA 1XG4A 1O60A 2D0GA 2JGQA 2QCCA 1JRBA 3VDCA 5A6KA 1AUSL 1F9CA 3NO5A 2ZUWA 2NV2A 1YE4A 3DKLA 1BVNP 3H2AA 2ABBA 4Z17A 1TWZA 1JNEA 1XYCA 1SR0A 1I75A 3VKAA 3N15A 3PR2A 4AD3A 2PWVA 1J2BA 4IXXA 3MP4A 1EZ2A 3HPFA 1ZNNA 2W5FA 2PTWA 2J79A 4YTTA 3GM8A 5AHIA 3PVFA 4HMCA 1H61A 2GVGA 1S2TA 4QDMA 3WF3A 1E6PA 3H22A 3LG3A 1WBJA 2PCQA 3QW4B 4CU6A 1WDQA 4GX9A 1KCLA 4EACA 1OEPA 4GINA 3WIJA 2DW6A 3LCIA 4PGLA 5IBXC 4DBEA 3WNKA 1B90A 1AW5A 1EJSC 4AWTA 2V67A 2VD8A 1K1DA 3TQ0A 3I3DA 4OBTA 5BXRA 3VAVA 2RGMA 3WBAA 4IICA 3LPGA 4JIQA 1K4HA 3AMZA 1JUKA 3G3DA 1XPGA 2CETA 1GXFA 1UOZA 3K1GA 2W55A 1E1EA 4HHLA 4JBRA 3BAKA 2Y5EA 1DEDA 4F2BA 2E25A 5C9RA 1WV2A 3KBJA 2D22A 3KL0A 3VABA 2YL9A 5EMYA 3AUJA 4S2BA 4QQ3A 3WQCA 3SO7A 1TV2A 3IJQA 1VJZA 2NQZA 3NVDA 4ATLA 4PUJA 4KFOA 3N4FA 4DHGA 3ARYA 1CGWA 3EWZA 4PBEA 4GI9A 5XIAA 4XUYA 3WF0A 4NVTA 4CNOA 4IMGA 4QBXA 4BS0A 1R3YA 1FWTA 2F2KA 4FX6M 4B4HA 5BXPA 1RK5A 3LEPA 1RY0A 4D6CA 2H8ZA 2I7GA 1UUOA 4Z1BA 3W26A 4M8UA 1TFVA 3U2OA 3TOPA 1FX6A 4UTTC 3QYQA 3CEPA 4UMCA 3GU1A 3GC5A 5DY2A 1SZFA 3LHTA 2VMFA 2BFGA 4Q4QA 1CGTA 3QYSA 3W4RA 4HNCA 1AD4A 4MHBA 3NVWB 1HJXA 2ZRXA 3ZVIA 1TV3A 2B4GA 3ENLA 2OEKA 3H2OA 4GQRA 3CUXA 2VZOA 2E9BA 2VUYA 3RU8X 5FS7A 5F2MA 4O54A 1XLCA 3NG3A 3V0TA 1V0KA 3FEMA 5A8GA 5HJYA 2F6UA 3TMLA 4I7VA 4QG6A 5HPCA 3LHUA 3RO6A 3W7PA 3G8RA 2R9RA 4J3WA 3G22A 2ZUVA 1KXVA 5DBTA 2ZE0A 2JK2A 2VWSA 3M0MA 4H50A 1B3YA 4IIEA 5GJNA 1SJCA 4TXEA 3WCZA 5JRBA 4CNPA 3CL6A 4L56A 4H01A 2B7QA 2DGAA 3H2NA 3FJ6A 5DF0A 3NDZA 1KM4A 3BUVA 4W88A 5HANA 4IF2A 5HPOA 2J9XA 1I2PA 2ZC1A 2C18A 3WLHA 3ONCA 2WPGA 3IK4A 2WZHA 3F5LA 4JIHA 1TV5A 1PZ2A 2J78A 3ES8A 4NZ5A 1ONXA 4EQXA 2QUUA 1NOWA 2CLHA 4HA1A 4MLJA 5AYXA 3HGRA 1XC4A 3AMGA 3LU2A 3PM6A 3GU9A 6REQB 2GQWA 3Q67A 4FNPA 2OGYA 4PMYA 1SSGA 2CWXA 4P8UA 5FMHA 3KX6A 1TWSA 3BGGA 4P7RA 4AHPA 1JIBA 3W1XA 2P3EA 2IQ0A 1PEZA 1XYAA 3UGRA 1AZ2A 5I3FA 2V3EA 3GG1A 4UXDA 1M7JA 4LVDA 3WJSA 4NUWA 3QEZA 4O12A 1VBGA 2VC9A 1Q7QA 4A8NA 3F4DA 1BAGA 3NFUA 3QGVA 3URAA 1SJDA 4C6EA 2P50A 7PTDA 4LANA 3S5SA 2X1TA 2Y5SA 1M7OA 3SN4A 1TUXA 1W8SA 3TYUA 5MKGB 2WC4A 1JGMA 1Q66A 1ZRQA 2BVTA 2YVFA 3UG8A 3SFWA 4IIDA 5A3HA 2YCJA 2CU0A 4LWWA 1U5JA 4U4MA 3MMUA 5AKQA 5BOEA 4FX8A 3TLQA 3O6AA 1R8LA 3LGDA 1OC6A 2J9ZA 1RHCA 4MIMA 3BLFA 1S7MA 4HMDA 4PUWA 5GQBA 4M5PA 3W22A 3NQDA 1DQWA 1OX4A 4GQBA 3OZMA 4Y8EA 2BGQA 6XIMA 4JCLA 3GD3A 2V5DA 3V16A 1K4QA 5J5RA 3EYPA 1KCZA 1UJQA 2D2HA 3C0JA 1JQVA 1XLMA 1F3PA 2FTYA 2INFA 1PHWA 2NW0A 1QW7A 1V0MA 2WJFA 4Q6XA 3VE9A 2J75A 1B5TA 1U5VA 1HKMA 3WEOA 1T96A 2P88A 4Y9PA 3UPWA 4DO7A 5DT7A 4IZGA 3WLNA 2Y4SA 3O3RA 2FHFA 5DCDA 3WQOA 3FVDA 3SECA 1HVXA 3A21A 3GNPA 3S2LA 2OODA 2OOGA 3WDRA 1RH9A 3FGCA 4HA0A 7ENLA 4KFNA 4B90A 4GC4A 4UZSA 3SCNA 4KWUA 3KFTA 4WXYA 3CH0A 1BG9A 4GFSA 3QOKA 1YW1A 1D7YA 3G1VA 3CZGA 4NQ1A 4DAFA 3PP7A 4JS3A 1JUBA 3NDYA 3OGRA 3VMNA 1GQNA 1JG9A 2XH2A 3G0XA 4ZOEA 3SN1A 4S3BA 3PSWA 4JEQA 4JYEA 1TJ2A 2X0HA 1KM5A 2W92A 4I8YA 1M04A 3VFLA 1E9YB 3PWIA 4ZO9A 3QPEA 3SAZA 1EPXA 1O5KA 5E0FA 3MSDA 4YMZA 3GAYA 5LHEA 3S2CA 5DMLA 3TZFA 4LALA 1G67A 2ANUA 4GUIA 5E9XA 1KFEA 4BWLA 4YCOA 4RZ5A 5H91A 5L6UA 3VX1A 1ENUA 1EP1A 3KBWA 1JROA 2YL6A 3A3HA 2YB4A 2WMFA 5CZSA 5HJLA 3PBGA 3I3EA 1YNQA 3LCWA 1Z48A 2VCBA 3SADA 4FXFA 4G6CA 4W85A 1LF1A 2HE8A 4LUTA 3QQWA 4F9JA 4K7ZA 5EFFA 3WQWA 2PLJA 1LRTA 3E0IA 1O12A 2CBUA 3B8TA 3EBVA 2GQAA 4MNKA 3SFKA 4W9TA 4NKCA 1W3NA 5BU9A 2GH5A 5AHEA 4JYDA 2V5CA 5FF7A 1LL4A 1QNVA 2OXNA 1VYRA 4QJ5B 4IWWA 1X6LA 2X1IA 1NHPA 3TW6A 3KVMA 4M19A 4O14A 1XUZA 3WK0A 3URHA 5IHSA 3DGBA 4CCCA 4A2RA 5JIWA 3HO8A 2OGJA 3IUDA 3F4WA 3KE0A 1TPH1 4Z1CA 1RQHA 2NXIA 5D2XA 3MO7A 3M7WA 4ZO6A 4YTRA 4C1LA 8CGTA 5CPNA 3OVGA 3I6TA 4YVPA 4CQ8A 1NEYA 5D2WA 4MWAB 3P82A 1D3GA 4O28A 2E1WA 4A21A 1SW7A 2WOVA 4AD1A 3DK4A 1TA3B 1YXCA 4K8HA 3VCRA 4M56A 1H2JA 3VDBA 1CXIA 1JYXA 3B40A 1JOAA 4GKLA 1CB2A 2XU2A 1XFBA 4UC5A 4UFIA 3TVAA 3V36A 1VFSA 4ATWA 1W9BM 2PDNA 1CLXA 1CW2A 1US0A 5AHFA 1ITUA 2H3BA 3RK8A 1ADSA 4HOZA 1J10A 4DF0A 4PULA 2WVTA 4U28A 2F2HA 1BZLA 3OBAA 3AZRA 3AJ7A 2X8CA 3EOUA 1QAPA 2CLKA 2C7FA 3T40A 3A47A 1YPXA 4C6FA 3GTIA 1GKQA 3RLVA 1H3GA 5IHRA 1E5NA 3LLFA 3PUDA 4G7EB 2F9RA 2ZKMX 3BZJA 3CU2A 1N8FA 1RP8A 3SR6B 4BQ3A 4O57A 4C6DA 4BI5A 2JALA 1WNOA 4F40A 1VFUA 2HVNA 2OTDA 1LL6A 3TUUA 3VDAA 3RNMA 4XBSA 1VFTA 2O92A 2UY4A 1UWSA 2GR3A 4AW7A 3LDVA 1Q63A 4ADSA 4EQRA 5LYRA 1S5MA 1JEHA 3CH9A 3C3UA 2FDSA 2O0TA 1R3SA 3VD9A 1L8NA 1OF8A 3PG6A 3M0ZA 4RE0A 1UA7A 1FWCC 4DZIA 1REQB 5E0CA 3U2CA 4F3HA 2X2YA 1GQJA 1HJQA 2QUMA 3LBOA 1U1HA 2CZEA 1RLDA 3Q2DA 1YHTA 2Q09A 1UKQA 4YN5A 2VZVA 1UR8A 3A3WA 4GRSA 3RJXA 3KDNA 3P5YA 1QTWA 2VFHA 3HV8A 2ZC8A 3N14A 2VEGA 3GC2A 2GJPA 2Y8VA 2X09A 5A6LA 1X2HA 3W88A 1KFLA 4ZFMA 2Z1KA 3UXAA 3L8KA 4TIMA 1EH9A 2OZ3A 2J3NA 2TPSA 4OIFA 1UH2A 2ISFA 2ICSA 3D6NA 5DLCA 3TAKA 3CWNA 1IGWA 1DQXA 4GOAA 3CJPA 2DH2A 1IZKA 4GYFA 4H4UA 3C2EA 1TPEA 5AFDA 2QHAA 2FZBA 5EMLA 4QITA 3AS3A 5J04A 1EJWC 2J6VA 2ZDSA 2E28A 2OFJA 4K2SA 4KRUA 4HVXA 4R3UA 4GG9A 2V2CA 5A94A 5HINA 1FWDC 3TLLA 4AWSA 5A6BA 3WBWA 1B1YA 3NPXA 3NOYA 1G4EA 5KEZA 4F0SA 4OZOA 2ZQ0A 4JL2A 3AZSA 4XZIA 1BWCA 1JZ4A 4RE2A 3BAIA 4ZB5A 2E9MA 2OJPA 1EBGA 2I16A 2QPUA 2BOGX 4IPIA 3SBFA 4KWVA 5EL1A 1GTEA 4OBSA 2X2GA 1XHCA 1UROA 4S3EA 4INFA 3W1NA 1EJRC 1M41A 3WLQA 2JKEA 2FFCA 4GPNA 4IMCA 2GWNA 1Q7MA 4BHYA 1ZBVA 1YQZA 2PSNA 4RR4A 1UIOA 4J56A 4C91A 4LNYA 4WX2A 1FH8A 3FYPA 3MSRA 4AXKA 1PYMA 1H60A 3THQA 3UVIA 4OOUA 4LTSA 3VZYA 3RDKA 4C1NA 5FJTA 2C8NA 3N2CA 2YQUA 4AZCA 4AZGA 3WD0A 4U3AA 3S9YA 4Z1YA 1W1PA 3AIWA 3HQPA 3IACA 4FR6A 3SY1A 1NAL1 3WFZA 2ZRWA 4HYVA 4XAYA 3VM5A 1TPC1 2CITA 2R6OA 1O5XA 5F1VA 1QPKA 1FUYA 1KR1A 4IJCA 4CUCA 3CT7A 3M47A 2VR4A 4H7CA 3ZJKA 1ZAIA 4S23A 2WZTA 4HK5A 1W9VA 3NPVA 4QHRA 3PWGA 1TV4A 4ICCX 4Z42C 1UUMA 2A79A 4J3UA 3L5OA 5G1MA 5I3KA 4CQAA 4KETA 4U5KA 5LA0A 2QVNA 5K9XA 1UZDA 2ZFAA 2E8ZA 2VFGA 2QDHA 3TSMA 1WDDA 2B81A 3DX5A 3TA9A 1EQPA 4AU0A 4IFKB 5K9DA 4JN6A 1V6YA 3LQLA 4DO4A 3ES7A 1NQ6A 1UWTA 1W2PA 3A22A 3GAKA 3CXOA 1XLEA 4W4QA 3RCMA 4DNAA 4PA8A 1IXOA 3AYVA 3GHUA 4ZSUA 3VU2A 1TJPA 1MUCA 3EA3A 2TSYA 2X7VA 5FF2A 1A3HA 1GSNA 1RQBA 5FKYA 3M5XA 1BEUA 1ZALA 4GUGA 3W9ZA 5ABFB 3QMRA 2JEPA 1QI5A 3KOZA 4XO7A 3AIBA 3O06A 2VHLA 1GG0A 3EX1A 3NCOA 1N2VA 1R2TA 4F0LA 1ZFJA 1TTPA 3EOSA 4HN4A 4XISA 1R6WA 1GOXA 4JDYA 2WVVB 3ARZA 4IFRA 1KCXA 3EB3A 3VIGA 4LQ1A 4GQQA 2A0NA 4H6QA 1QATA 2ZXAA 3K4DA 3VPLA 3KS6A 4CD4A 1WKDA 3UNDA 1G9HA 4LBUA 1Z8AA 2ZX7A 4L5ZA 4YHEA 1X38A 4DJDA 5GNZA 1XBVA 3E2RA 3A4WA 4EQSA 2DORA 1MO9A 2BXYA 3A4AA 3FVMA 1HG3A 2JF6A 3DFHA 4H4QA 5G2WA 1GKRA 1WOAA 1FHLA 3T05A 3AROA 5KZMA 4UTWA 3HOJA 4R7WA 1KLZA 4C1KA 4U2YA 3WJZA 3G0SA 1AQHA 1XKJA 1GQIA 3QV6A 1MFVA 1OFOA 3STCA 3CZJA 4JL1A 4HOXA 4H4SA 3P8JA 4NZJA 2YGYA 1QI3A 2GVJA 1W6TA 1BHGA 1W5PA 4K8GA 1KFCA 3UF9A 2ZWYA 1XRSA 1PDYA 2ZZ5A 9CGTA 1ZBCA 1UKSA 2BY1A 3PJTA 1NDYA 1F07A 3TQKA 4C6JA 3S1GA 4DUVA 1O66A 2C91A 3GR8A 1OFPA 1XX1A 2ALDA 3QBUA 1M6IA 3V5OA 2XIIA 1OFEA 5LNWA 5JUVA 1UR1A 3ARTA 1NTHA 5BXSA 3LM3A 4DLFA 4FLQA 3M07A 4RX0A 1KM2A 4X61A 4QE4A 3UWUA 4UZUA 5C9XA 3MBDA 3B9AA 1XH1A 5F4WA 2DJXA 4S3JA 1EP2A 4JIRA 4GHRA 4EWND 2ZICA 2DPEA 1W0MA 2C6QA 1UB3A 3TX9A 5CG0A 4FALA 2VD9A 2G37A 3W1LA 1A5UA 1T8QA 5K7JA 4WJXA 4D72A 4DYJA 4S3AA 4C1NB 2OZ8A 5LNSA 3G1XA 4FXRA 2OYMA 5LIUX 4NSBA 3MUY1 1XYFA 2Z27A 2PDJA 2WLZA 1DYSA 1B3VA 1SMDA 3H21A 2QV5A 4JTKA 2IS7A 2MANA 4N42A 4RNFA 5C9UA 2HPMA 3Q6JA 3EPOA 1XD0A 1N60C 3CHEA 4QISA 3TTYA 1LQ2A 3OHMB 1YNPA 3N2MA 2FYMA 1VP5A 4WD0A 2ZA2A 4GY1A 2A4AA 3EDEA 4WDTA 2Y70A 1TJ1A 1ITXA 1E1FA 4H41A 3LCHA 2G8ZA 3R10A 4GIRA 2VP8A 4FF5A 4XSMA 6TIMA 1UC5A 3GSMA 3U48A 3E3HA 4AYGA 1K02A 4O1AA 9XIAA 1QXLA 3MDWA 3HPXA 4HKPA 5LIWX 4CNSA 5BU6A 3QV9A 4QP0A 4HNVA 4JKLA 1RM6B 2F8QA 1OJTA 1IWPA 2ZYFA 2ZZ6A 1QI0A 2YZRA 5HNRA 5CSUA 1NWTA 2PWFA 1VQZA 5HXMA 2VVNA 3AYTA 3MI6A 1EBHA 3BV7A 3P81A 4HZ7A 1TYTA 3CYJA 3N04A 4Q8PA 3TW9A 3NA8A 3WO8A 3EKLA 1GRGA 5HNTA 1KV5A 3B06A 4KWWA 4ZTXA 2WJZA 4GBUA 5I24A 1QNOA 4QLKA 4AEEA 1S3TC 4KPRA 1KFBA 1GONA 3EOLA 4H4WA 4DQWA 2INZA 1X6UA 3R4IA 2WMHA 1SW3A 3OEXA 1EHAA 4ZENA 4E6MA 4D6GA 1RSCA 1EJXC 3OC4A 3ARPA 3ARQA 3UYCA 3IIPA 4RW5A 1C8VA 3H7VA 1PAMA 4MAVA 2ISWA 3O2LA 3TA6A 3STEA 3WD2A 2C13A 4IJRA 2NUXA 1Q4WA 1EYWA 1HO1A 2YOCA 3LCXA 4JTLA 3F03K 1GYLA 2I5QA 2A7RA 4NX0A 3F5JA 3GR4A 1EF2A 1OYAA 2Y62A 2R82A 4MFEA 4UQBA 3N2TA 1V79A 2E5BA 4GVIA 3MJYA 3ZJ6A 4GXWA 1KM6A 2XIBA 3VKBA 2C19A 2Z6IA 4AYSA 3DH7A 3LHYA 4XIAA 3INPA 3VNJA 4A3UA 2PTYA 3MV11 3CASA 3GRIA 3LYEA 4TU1A 1HT6A 4ERIA 3A4JA 4M7SA 4E2BA 1VB9A 2ZA3A 1NHRA 4Q4PA 1J0KA 3WQ5A 1U22A 3EMCA 2OO6A 2YX0A 1K9DA 3P3BA 2IKHA 3E49A 5G1YA 2EPKX 4P7NA 5A95A 2Q8XA 4HOWA 1QI2A 4ZOAA 2G3IA 1P0KA 3U7BA 2F6XA 4PODA 1ZJBA 3L4VA 4FNUA 1CT5A 1PKLA 4JNYA 1JFHA 2YW4A 3NQ7A 2XSBA 3TWAA 2XUCA 2YZ5A 1Z9AA 4H7ZA 4UTIA 2JE8A 4O1DA 3OODA 4TTUA 4NP7A 4DYKA 5KZEA 3UCDA 1VEOA 3DHDA 4LCSA 4JZ5A 4A05A 4MNLA 1UD8A 3G6MA 5AB3A 4OUIA 1YDYA 3LPFA 3L0KA 1OINA 3R12A 5DCEA 3MHGA 2PRHA 2J7GA 3VKJA 4DWDA 2Z29A 4KPLA 3FKKA 3IJ8A 4W86A 1UKOA 1RCXB 4QJ3B 1JDAA 2PA6A 3GLCA 3BPWA 1J9YA 1WZKA 2DZXA 4U10A 3WMBA 2JQXA 1K9TA 2VXNA 4DI8A 3R79A 3IS4A 5FS6A 5U1OA 5A6BD 1HKIA 4UMAA 1ZHAA 1E0VA 1KW1A 2WB5A 3CUIA 5TD4A 4NJJA 3O6DA 4R9XA 1P7TB 1XIFA 1GVIA 4WOQA 5CPSA 3K1DA 2RGLA 4KWOA 2YSWA 3W2LA 4YLWA 2J77A 2GUBA 4PUMA 1XPYA 3ZR4A 3L67A 4OQVA 1IIHA 3T1GA 4M1RA 5FJUA 4R9OA 5I3GA 4GYPC 3HZ3A 5DELA 3FJ4A 1G1YA 1ZS2A 4LOCA 1GVFA 2PF0A 1KBKA 2VRKA 1GZGA 2W63A 3SGGA 1VKFA 3H54A 1PSCA 3VMOA 4DB7A 4Z1DA 2CHNA 3L2LA 2P0OA 5C2CA 1JI1A 4D71A 3AZTA 2IQTA 1UQZA 3P14A 5CQ1A 2ZTKA 3DYOA 3D9XA 4F0MA 3SURA 2W0HA 3U5YA 1CPUA 3WL0A 4GYJA 3QV7A 1E4NA 1XR2A 1C29A 4ZQRA 2Q6ZA 2NVDA 1F3WA 2IPFA 2P8CA 4UNKA 1PCKA 1NELA 4AIEA 1RY8A 1FP9A 4IQLA 1FWBC 5FS9A 1AQMA 1EYEA 1XLIA 2HMCA 3MC5A 4NX5A 1QK0A 1UD4A 5D9PA 1LQAA 3EOOA 4Z2IA 1SQ7A 2X42A 3UEQA 2FIQA 2VDHA 4NZCA 2YL8A 4AX6A 4PMQA 3S1VA 2R8WA 3DFYA 3QHMA 5D9MA 1ZPTA 2R1LA 1V5XA 3G1HA 4GR1A 1PKNA 4JGDA 2ACRA 4D6FA 1DE5A 1LG1A 4I9MA 2VOTA 4ADWA 4XZLX 3M41A 1LRNA 2WSKA 3VIHA 3EDJA 1P5BA 2Q02A 4EK7A 3ZLHA 2TMDA 2NQHA 3ABOA 1LT8A 1NIUA 4HNTA 4W5ZA 3W25A 2A7NA 4IPPA 3UNTA 2D73A 3NQMA 1GZJA 1LWIA 5LNUA 1MDRA 3ZWSA 3GG0A 2ONEA 3WFLA 3R0DA 3NTYA 1W17A 2FJKA 2OT0A 1D7KA 2W54A 2BMBA 3WBEA 3G18A 3H4XA 3F4CA 2DZSA 3VGGA 3K46A 3ZT6A 3ZWTA 3W1UA 2NWRA 3W1MA 4GD0A 3ITCA 2Z7GA 2Q3RA 1L6FA 4S38A 1TPB1 4IGHA 1LL7A 2V3DA 3SUSA 5GPRA 3JR2A 3NUKA 1A5CA 3GHSA 1EX1A 1VYPX 2XH4A 3UZWA 1I2OA 1Q5MA 1MW1A 2EQ7A 3NDOA 4WY0A 2ZZ2A 1B3OA 4JDBA 1DWHM 4NXKA 1CIUA 4IP4A 3RXZA 2BY2A 4FDCB 2HROA 4IL2A 4EWJA 3QN3A 4LS0A 4HHMA 3L5AA 1REQA 1HL9A 1ZY8A 3PPCA 1UYQA 3BSGA 1LOQA 1VLIA 3W74A 1UUQA 2P5NA 2QKFA 3IUHA 4B5UA 1M5WA 2OMAA 3SCOA 5F2LA 1VIZA 4TO8A 3RRXA 5TIMA 2GDQA 2X05A 5IRPA 1KXTA 4K8DA 4GX8A 3E2SA 2QZRA 1Q65A 3WQFA 3NVVB 1OD8A 9RUBA 3R8GA 1KGWA 4CCZA 5E6ZA 3VKCA 5C5YA 4PBFA 3MMTA 3OGVA 1EIXA 3HIJA 2Z00A 5K3VA 2YA2A 2ZZ0A 1OX5A 2ZVRA 3LM7A 2D3NA 1FWNA 3UU0A 5C70A 3ZJ7A 3PANA 3FV9A 1TMHA 3VC6A 4FOJA 4YHGA 3M0VA 3WJYA 3WLPA 2Y61A 2GSEA 5BXTA 1WAUA 2YB1A 3DI0A 3UWYA 3GO2A 1YTKA 3ETRB 1Q8AA 4S3GA 3EX6A 1WKFA 2VURA 3DYMA 4LUSB 1E9IA 3W7HA 3E0WA 4WDWA 3GW0A 1H11A 2XISA 2WMJA 1LDCA 2HVOA 1T7LA 3MUXA 1KTBA 1R3TA 1KM3A 3II4A 2CPUA 4GYKA 2W66A 1VFFA 3VD7A 5HNUA 4PCNA 1BYDA 3CGDA 4PCSA 4AC1X 1DL3A 3VNMA 1NF7A 5HNNA 1D8WA 3B9NA 3ZIZA 1Q1WA 1FIQB 4A3YA 1YMYA 1V3MA 3CUGA 1ZUAX 1AH0A 4FP1A 4Y9NA 1KBLA 3MSGA 4FMVA 5C7HA 3KLJA 3NEVA 3O6YX 3HBLA 3U4FA 1J79A 5D33A 3CEUA 1RJQA 2QJMA 2WZMA 3VCCA 3M9YA 3UVAA 1WDWA 2PS2A 3LPPA 1BF2A 3W29A 2WMIB 2CYGA 4QXIA 3TYZA 1YBQA 2ZZ7A 3GHRA 1XHGA 3F2CA 1MWOA 1G4PA 1Q6EA 3KZSA 4OWGA 2G3NA 3WF1A 3WQ8A 4AQLA 2VRQA 4AY1A 4N9BA 4EVZA 1JJKA 3VIOA 1ITCA 3D47A 4CN6A 2Z1VA 4GCAA 1ISVA 4A6GA 1F6PA 1A4MA 1WBHA 2NQLA 2AAMA 2I14A 4DWSD 4L64A 1UR2A 4A22A 4I5XA 4DNHA 3CHFA 4MDOA 3CZLA 2EEXA 1FKXA 1NFPA 3ITGA 4GLEA 4B91A 1N63C 2HV5A 3HMCA 1F3EA 1KM0A 4S3FA 4BWLC 1H7PA 3UPBA 1QHPA 3LXDA 2XFYA 2DSWA 2W67A 3QFWA 1FH7A 3FA4A 2B7NA 5CZJA 2OLAA 2XN2A 1PKMA 1OGGA 5JBDA 2CBJA 3AMDA 3WLLA 3U4AA 1AG1O 3GH7A 1BRLB 5EMKA 3VOHA 3GD6A 1PBGA 3AS0A 4LF2A 7XIMA 4PUKA 3F1QA 1R7OA 2L5HA 4AWEA 3BMWA 4GFIA 3PG8A 3SCTA 4O1FA 4GO9A 1TVPA 5ABTA 3O05A 4KEZA 3T0TA 4H4ZA 2P53A 4BK9A 4LH8A 3LHWA 4BEQA 3QMTA 2FGLA 3L66A 4IG2A 2DSKA 7TAAA 1MUMA 2JF7A 2NT0A 4N0RA 4V15A 4YXGA 3VX0A 1ZB5A 4X0VA 3FAWA 3USBA 4C6KA 4AX7A 2BZNA 2XZ9A 1RP9A 2O4MA 5HWNA 2WC3A 1HFBA 7ODCA 2XM1A 3TIMA 2E6YA 2VO5A 4Y2WA 3WMLA 2YXXA 1BYAA 2FZ9A 1DXIA 4JHZA 3I3BA 3OLIA 4ORIA 1Y65A 1FKWA 4RV8A 1Q4NX 1S2AA 3PTKA 4EPDC 5EYWA 1CWYA 1V6UA 5M2FX 4J57A 3KTXA 4AF0A 5D02A 3PK7A 3QC3A 1K8CA 2V2HA 3BH4A 3S42A 1VDVA 4B5TA 3NL2A 1AH3A 3QV8A 3L2IA 3OQ8A 1SFTA 1GEQA 4YYCA 3U57A 3UPMA 4DWSB 1R3VA 4UBPC 5EBAA 2PP0A 4Y9OA 2DQWA 4I90A 1BXBA 3UR2A 2YBTA 1PHQA 2A1YA 1ZQ5A 1GRFA 3H2EA 1TSIA 2ZTJA 3CT2A 4BCEA 2ZCGA 1XSKA 2PI6A 3CM4A 5G5GB 4UTJA 2PDPA 3V35A 1MQPA 4C6LA 4US5A 4JN7A 1GOWA 3T08A 1DOSA 1XCFA 4GZIA 2YYUA 3AIUA 4UMBA 1VEMA 1EOMA 3DIPA 4GA8A 4MWAA 7A3HA 1HTIA 2E6FA 5JMUA 3WX7A 1GTHA 2YVGA 5F2IA 2CHRA 1L8PA 3WJWA 3SGZA 4AZ6A 3G1SA 4FF7A 5K2ZA 2XH0A 3PNUA 4ZOBA 1EWDA 3N13A 4FHAA 3OTRA 4XKYB 4PZVA 4EP8C 4F48A 3NQFA 1PZ1A 1Z7AA 4XKYA 1DORA 4HK7A 2BOEX 1H7XA 3B4YA 3OVPA 4FPSA 2ISSA 5F1UA 3BVJA 3W2KA 3BK0A 1XI3A 3M0IA 3HQNA 1A5SA 3XISA 1UH3A 2EGZA 1G94A 3DBPA 2G3JA 4BY3A 3DAQA 5A8OA 2J7EA 3QPZA 1W1VA 5GNYA 4X2RA 3FIGA 1GRTA 2ZXDA 2DUAA 4LBRA 1WCGA 5FSEC 4HZMA 2JKPA 2ESCA 3GXTA 4UR8A 3SGUA 4GXPA 4W8LA 3GDMA 3T9PA 2QAFA 4FNQA 4JKMA 1SFSA 5C54A 3AU2A 3UWWA 2YCIX 4PUUA 1K7FA 4JTDA 3ANYA 5BWAA 4B9YA 3CV2A 3TYCA 4V1XA 4Q4SA 2G97A 5EMMA 2OVLA 4IP7A 4GH3A 3HJZA 3CAKA 2Z1BA 3T42A 1E6SM 2XTKA 3UXDA 3MP5A 1MMFA 3S47A 3W53A 1BYCA 3VNLA 3N6JA 3LMYA 1XGDA 5T9CE 3V5FA 2A3EA 3HRDC 3R7MA 1E73M 3WQEA 1HNYA 3N12A 1XDMA 3LBCA 2PWEA 3DKJA 5A6TC 3T2PA 5HUOA 2CNCA 2QCMA 1W31A 4XAZA 4O8AA 2OLSA 3IV8A 3B0VC 3D5HA 1OC7A 2Y8UA 5M03A 4LUTB 4Q22A 4RK8A 3DGHA 4P5UA 1C8YA 2PUZA 3VMPA 3BGJA 3UCCA 4B5VA 4GIEA 2PTDA 4PN2A 1AK5A 5CGQA 4AZIA 3ICJA 2AAAA 4GRTA 4HBKA 1G5AA 1HF6A 5A8QA 3CAVA 3MU7A 3RX4A 1GQLA 5CPQA 5I07A 3WUEA 3CWHA 5KVIA 3WH6A 4YVVA 4Q8WA 1B3ZA 1XQKA 2J7CA 1MFUA 4LYQA 3V0SA 1I60A 1A5NC 4FNRA 4FZIA 3FDKA 3R11A 4U33A 2X7WA 4NIRA 3NEHA 1KRMA 1WUFA 3ECQA 3POHA 5AC8A 1CYGA 4XTIA 5CZTA 2INEA 1VYSX 3B8VA 3ZR5A 1P6WA 1QNSA 4KESA 3KWSA 1YTDA 4GGBA 3KM8A 4NF7A 3DK9A 5C6MA 2RDTA 5IXEA 1FWIC 3ORWA 4LYPA 1DIEA 3N1AA 4MY9A 2FVLA 5JBFA 2IMRA 1EDQA 2J74A 3UJFA 4EM4A 4HZ8A 3UD6A 2VZTA 1G4TA 1RUSA 1STZA 3GNOA 1M6JA 4FB7A 4XK2A 4L9YA 1TR9A 1SSDA 4GWEA 5B80A 1DHKA 3KAOA 3QHNA 2HJPA 2C1IA 3W75A 4QAIA 3CYVA 1SFLA 2BV9A 1AJ0A 2ZX6A 3VOIA 5HR6A 2NLIA 3PZUA 2WO5A 4M6PA 4P7QA 2HRWA 1GCYA 1YDNA 3S1XA 5JIPA 4PUNA 1HJSA 1GVRA 3BLKA 1IEQA 1XDIA 4NYYA 4M1BA 3TQPA 2RJHA 3N73A 2VEFA 1LLZA 3BGAA 3SEPA 3UY7A 3C4UA 4DPPA 2DU2A 1QOQA 3FKRA 3W02A 3LBMA 5KITA 3T2QA 1W56A 3QF0A 1H51A 1JCMP 3N2XA 1Q2SA 1ZBWA 5CC6A 3BJSA 3W7QA 2CBIA 2QLYA 3PZQA 4D6EA 4F4RA 5LKYA 1ODUA 4M6UA 4MPQA 3OA3A 2CLPA 4QS6A 1R38A 2RDWA 3UCQA 5FJRA 1NPXA 4O1BA 1PX4A 4XV0A 1QVBA 5IBXA 3IRDA 3QHOA 1ME8A 2V69A 1JQXA 4AB4A 2GGIA 1O7AA 3AXMA 3PULA 3SZ8A 4PTWA 3IIXA 4XAPA 4WHBA 4EXQA 4UFMA 3GS6A 5HUPA 3HPAA 3DUGA 4RXFA 2VJXA 3POCA 1V3IA 3B8DA 3CGCA 1P0NA 3TYAA 3Q58A 3O1NA 1XDJA 1GV4A 4J7RA 3G1AA 5IM51 4AEFA 4L65A 4ERGA 1A5OC 1S3HA 1TMLA 1OG0A 1TV8A 3PTQA 7REQB 4ZQOA 3FGCB 1BXCA 4O8RA 2Q8ZA 1YPIA 4H9ZA 4JTSA 1UW9A 4MUPA 4KEVA 2VELA 3NWRA 3ITTA 5FI8A 3K30A 2OYLA 3UA4A 5JU6A 1XCXA 2AQVA 4KFPA 4WUIA 2DZAA 4L6DA 1QMLA 3A64A 5G2HA 3ZVHA 5LSMA 3GVQA 2PLMA 4XD5A 1DJQA 2NT1A 1QOPA 2P3ZA 3TROA 3GXPA 3NQ8A 2GDUA 3BZGA 3GFYA 3EWXA 2QEZA 1SYTA 2NVAA 3SRFA 1H1ZA 1NDWA 4PBGA 1OK6A 4XAGA 2EBNA 2A5HA 3W28A 1QHOA 3E02A 1V6TA 3TR2A 1OYBA 4K3ZA 2RHGA 3MUZ1 2O9OA 1L6GA 3B97A 4UCFA 1R3RA 4QEEA 4REQB 3O07A 2HCVA 1TJRA 5E5CA 4JTUA 3UZYA 2EKGA 3KCJA 3NXFA 4JHOA 3RM4A 4FLSA 2ZX8A 3Q65A 4WEVX 2YDAA 3TAOA 4XB3A 4IIFA 4Y9MA 3NQGA 3IV3A 3CO8A 5A6AA 1PZ3A 2DZUA 3GG8A 2E7FA 4HNUA 4O17A 2QR6A 1J0YA 3MMWA 5D9NA 1YBQB 5LIXX 3WJXA 5I2UA 3MUAA 3JU2A 1XM3A 3CNYA 3QH2A 3VA8A 4E8DA 3E2QA 1PTAA 4E2VA 4K7YA 2X40A 4YIWA 3KWXA 5HA7A 4G2DA 1BYBA 1J18A 1T3QC 4IGMA 2W91A 1MOKA 3FHQA 5RUBA 4JCMA 1G01A 4OECA 1QFEA 3VIMA 3N17A 3OO2A 3RCYA 2DDXA 2VNCA 3WMSA 1FFRA 1SGJA 4DWSC 1OBAA 5FF3A 2W3RA 3QGKC 3FFSA 4OBRA 4AG0A 1VS1A 2GVLA 2BB0A 1EX5A 5C9WA 3BCJA 4IQEA 1UBSA 4XZHA 2Y85A 5FL0A 1GGOA 3OBKA 2J4GA 2TODA 3W70A 1B9ZA 3OG2A 2WOQA 3EDFA 1QNQA 1WP6A 2CZVA 2G5WA 2QDGA 5AC4A 4PC8A 1H62A 3KOYA 3SRDA 1KGXA 3B8SA 3M0XA 1BTCA 1FWGC 1JZ2A 1I2QA 3I7SA 2OELA 2XH7A 4CEUC 2C1HA 1ZJAA 2VGGA 3HV9A 5JQ9A 2WBAA 1UKPA 2GUUA 3A23A 5LHFA 1M01A 4JIPA 1ME9A 2YLAA 4EE9A 3TK7A 1FO4A 2IKGA 3WY1A 3GXDA 4RL3A 4ZQNA 1UASA 3IUIA 1S2WA 4D6DA 1G7UA 1S5TA 1R2SA 3UR5A 4WDUA 3PUGA 1UR3M 4ZQPA 3LERA 4KEMA 4KCWA 3UR8A 1XLGA 4UWMA 4Z0JA 4CQBA 4WLCA 5HWJA 2GRTA 3AYSA 3W7MA 4LFYA 1QHZA 1JDFA 5LGXA 1BPLB 1C93A 5AOUA 1F73A 2C71A 1E55A 1LP6A 4LYRA 2AMXA 1TZZA 1PZ0A 4WQ6A 1LTDA 2XINA 3LCLA 3R13A 5H1WA 4HPJA 1BQGA 5GRTA 2CZDA 4DLMA 4LBSA 3B0PA 3C3NA 4YYFA 3TN6A 4G9PA 2X16A 3CQ0A 4LVAA 1QDSA 2CLMA 5HULA 5XIMA 2FVMA 4UOQA 1PIFA 2CZ5A 2XIMA 5FJOA 3T2OA 3BLDA 1XLHA 2OYKA 4ATDA 3LI0A 1GVYA 4PMXA 4E2OA 3MY9A 1IXQA 3VKDA 3MP3A 4F0HA 2WZEA 1BKSA 3HURA 2XYLA 1HJWA 4G1NA 4ECLA 3IC9A 4AD2A 4PCPA 1QCWA 2PEVA 1OGBA 5I03A 3MKVA 1SW0A 1GPFA 2PRLA 8XIAA 3VUSA 3GVVA 1WYGA 2QYGA 4B5WA 4LEQA 4H8HA 3R8RA 1JPKA 3JZUA 5ABHA 2TPRA 1VPQA 1PB0A 3T7VA 3T0CA 1JDDA 2GLKA 1L6YA 2WNQA 1FHDA 2A21A 2EPLX 3QXBA 4Q8VA 2WBGA 1KCKA 1PCWA 3AN1A 3P60A 1FFQA 2VYOA 1B9BA 1UZ1A 4I6KA 5ABGA 1OVDA 1FXPA 2WQDA 2HPIA 4J9JA 3UETA 5IFPA 4IGSA 2J13A 2V8ZA 3RR1A 4NEVA 1QPRA 3MMDA 2C1GA 3CXBA 2HNHA 2VUNA 5CAKA 1XIHA 3MKCA 2AGKA 4GH1A 3D3FA 1H09A 2QVHA 4N9DA 5LXEA 3SM0A 4TTGA 3W76A 2VTFA 3I10A 2WSYA 4TVWA 2CLLA 3CZKA 3W71A 2AOSA 3PZIA 5MF5A 4C5ZA 5C2XA 3DU0A 1JF5A 1FDYA 4B15A 2ALRA 2AQOA 2WPFA 1Y5XA 3GXIA 2TAAA 3QM3A 3WQPA 2V63A 2W62A 3RX2A 1XG3A 1MW2A 5JCKA 3UERA 1OFQA 2YCLA 3A7UA 2ADAA 3AJXA 3SQMA 3EEGA 5I06A 1M3UA 3WH9A 1Q6FA 2WW5A 3EA1A 2PTXA 1KC7A 1M68A 3BXWA 3AM9A 1BSIA 2O7QA 5I0DA 2Q71A 2HTMA 2G41A 3NQEA 3OLDA 1RQEA 1A0EA 2VFIA 1E56A 3QVQA 1A47A 1H0IA 1LJYA 5I5RA 4N4QA 3C6CA 1KA9F 3DN5A 3L4ZA 3ZVHB 4DNMA 4GQ0A 2P76A 1NFGA 3T6CA 1Z41A 5CBJA 2EPNA 2QCDB 1PWLA 2IUZA 2G95A 4H3DA 4UFLA 1TRDA 1Y5VA 2WNWA 4FO4A 3DHPA 3F2BA 1PE1A 4ZXOA 5A69A 3NNTA 4IUGA 1O4UA 4AUBA 3FHAA 4R85A 2QUVA 3ARRA 3QZ6A 8A3HA 4WDXA 2E5DA 5FL1A 2X50A 3EKGA 3DOPA 4E2DA 2QIIA 3W1TA 2OZ0A 4MUZA 2VC7A 3AFBA 4F79A 3GNXA 2PDQA 1TWIA 1IT7A 1XW8A 4Q8QA 1CNVA 3GDTA 3RFAA 3TW7A 4JQ3A 4NZ4A 1GNXA 2ACSA 4GJ1A 3GK0A 3IJDA 1E4LA 1GORA 1UWIA 3PY2A 2E68A 3SQLA 1RJPA 3LOTA 2WHJA 4ERAA 3HTWA 2ZZBA 5CLTA 3GU2A 1ESWA 2HBXA 3SQPA 3MTWA 1XYZA 4K1GA 3DBNA 4HPGA 1O1ZA 5M5DA 4CD7A 4K1WA 2OEJA 3B9DA 1B2YA 1B3XA 4IH3A 4NU7A 3CGBA 4NHVA 3W2UA 3FK4A 4O11A 5LA1A 3S5ZA 1NDAA 1ZP3A 3QRHA 4US6A 1TPFA 2YCLB 1F4HA 1PKYA 2ATSA 2QPXA 4HU4A 2XN0A 4JFTA 2HVMA 3LCGA 5CAHA 5LGZA 3AHZA 1UQYA 3BE7A 1F8IA 1LROA 4KCVA 2WMGA 2OSXA 1XLDA 3N11A 4OJYA 5LNVA 2ZZ4A 3HW2A 1EC8A 3GNNA 4MG4A 1Q13A 3VINA 3IEBA 1GYNA 1HP4A 3H2CA 3IJ6A 4RDWA 4PTMA 3WK2A 1WKYA 4P2VA 4GXMA 3ZR6A 4QROA 1N8IA 1SM9A 3LXBA 1FWEC 2TRSA 4PSRA 1RVKA 4EANA 3DDMA 4PEKA 3AS2A 2YA1A 2ABAA 3TYDA 1VFLA 3W1RA 4G8TA 4Y96A 1JRCA 4C7GA 4QFUA 2POTA 1JAKA 5G4HC 1HP5A 3MDUA 2X1SA 3APGA 3TONA 3VNIA 2QJIA 1H7OA 1DNCA 2HNEA 1ITQA 2PPGA 4E8GA 2PWGA 3S0CA 4NEWA 4Q8OA 4TX6A 4PRWA 2FPYA 1IZCA 1KKRA 2WC7A 3DK8A 1GWJA 2VDIA 3PUOA 2QCEA 1AODA 3AXHA 1VEPA 4RPPA 4EXAA 3BQ5A 3MS8A 1DV7A 3W7LA 1K77A 3G1RA 2A7PA 1T0OA 2QCFA 1XIBA 3R07C 4YTQA 1WZMA 3B8UA 4QGCA 2PODA 3EB4A 1SO3A 3HFTA 4Z0SA 1GPWA 2BY0A 1ZENA 3HQOA 2GR0A 3C61A 2HEJA 3NO1A 2NPXA 2QXWA 2GQ9A 2ACQA 3R2GA 1WPCA 3CPRA 5REQA 5AYYA 1M1BA 2CHOA 4JTGA 3EWWA 5REQB 2ISVA 3UGVA 4W7VA 3SCPA 3RAOA 7TIMA 4WF7A 3AXIA 4DN1A 1X96A 3DZ1A 1OT2A 2XHYA 1KGUA 2PF8A 1QWGA 4L4MA 2OLHA 4O1EA 3OU8A 1SU5A 3TJXA 4NY2A 3UZ5A 1MQQA 3G24A 2X0SA 2FGBA 3A9BA 2XGIA 4HJWA 3EPNA 4B9ZA 4WGXA 4WY0F 6PTDA 4LB3A 4H8VA 1FWRA 1VJSA 1R46A 1XIMA 3RM8A 4K38A 3CIWA 3W2JA 1FWAC 4EM3A 1QR7A 3BWWA 1D3CA 2E6AA 4UB9A 2QULA 2NV9A 2NX1A 4LW7A 4Y9AA 4Q7IA 1V6VA 3CHCA 2NX9A 4QJ1A 2CFYA 4NAFB 2DIJA 1FEBA 4JKKA 4YWIA 1Q6QA 4XD4A 5EFDA 2CXGA 3S46A 3BW2A 1ISZA 1XCWA 3R25A 4CLMA 1ME7A 5JVLA 4UQEA 3T55A 5CEWA 2XDFA 4NILA 1XBYA 3Q45A 4X0NA 3PBMA 3HGOA 1P6BA 4HHHA 4XQ6A 1F2JA 2UV8G 4E3VA 1RZMA 3VOGA 3VNDA 1F05A 2G3FA 3GDBA 2PP1A 3O63A 1J6OA 2BNJA 3OZPA 3OIXA 1T99A 5D8WA 1VRXA 4P8WA 5D2VA 1P1MA 5C8BB 4PTNA 4ACYA 3EAOA 5B7ZA 3TYEA 1PV8A 3W7OA 2WNZA 4HSNA 2GQ3A 3W1QA 4WKAA 1KFWA 4DO5A 2VDGA 5J8LA 3AC0A 1XLLA 2FPVA 3B4UA 3PJXA 1FWFC 1BVZA 1SZRA 2DSUA 3MQTA 1TE6A 1V6WA 4EF8A 1LWHA 4WGHA 2QJJA 3NRZB 2VGFA 4BQ2A 3ANUA 5JCNA 1ZCCA 4E4PA 4MJMA 4JOMA 3WDHA 2A3HA 2OPJA 1YTEA 2Z26A 5H6HA 4YPJA 3KVKA 4R27A 4O52A 3WEZA 1E3XA 3LUTA 5DMMA 3CMGA 4FLRA 1UR0A 2Q01A 2NSOA 4KQNA 1IWAA 3VOCA 3SY8A 4MWAD 4XBKA 3ITOA 3C0QA 2EQDA 4ENLA 5BMWA 1KO0A 4MWAE 1XRFA 3QGAC 2ZUMA 1GOMA 1TWWA 4IPNB 3NSNA 2Y7EA 3GDLA 1W1ZA 2GGJA 3LGEA 5DMYA 1TQXA 3VKKA 4AZHA 1J5SA 4MF4A 3PWAA 4NZFA 3A3XA 1L2QA 1H7RA 1DJHA 4AZBA 1ODZA 3LTSA 1UWAA 2C15A 4LCQA 3E12A 1KTCA 2W6RA 2WMKA 1IEVA 5HATA 3NVZB 4B16A 4DJFD 3NR0A 3ANVA 6CGTA 3Q4DA 2QMKA 2VCCA 3A5VA 5EKYA 4H4PA 1F6KA 1XGZA 3BAJA 5CJ5A 3TFCA 2H9AB 2V9DA 1A49A 2GJXB 5A6SA 4JTQA 2XWDA 4H19A 4E4FA 4IL0A 2PDWA 1DTUA 1EXPA 1L6WA 1AQ0A 4I9TA 3UJSA 1ZKQA 1EUNA 4LUSA 4CVUA 3I6RA 3R58A 2CZFA 8XIMA 2GUYA 2FZ8A 4AD4A 4ZVJA 3I4KA 3NZGA 4J40A 3BV4A 4XD3A 3JRKA 4XAFA 1K6WA 3MZ2A 3WKZA 4M6QA 4R34A 3VVGA 1QBBA 1K3UA 1RLCL 4AY7A 1C7SA 1UD6A 1EJUC 2GQ8A 3SN0A 3FOKA 1UCWA 1JAEA 1W1B1 2DW7A 3MPGA 1OHLA 3BJFA 1XFCA 1KBJA 1DIDA 2WK2A 4IMEA 2PDXA 3QQ1A 3ME3A 1XINA 4AZ5A 3W2NA 2C3DA 5H8PA 4O0QA 1Z6KA 4ZTYA 2PZNA 1E0XA 4LEFA 4LUYA 3RPMA 1HL8A 3AYRA 1JCTA 4JTFA 3VO0A 4WVXA 1FWJC 3GH4A 4J1OA 1S38A 1UD3A 1E0WA 1PTDA 2Y7FA 3EX2A 1UHVA 3LXCA 2XN1A 4A3HA 1AW2A 4AC7C 2V5KA 4B5NA 3T78A 3W1PA 3W7IA 2ZZ3A 3LENA 1N82A 1OCQA 5HMFA 3RPTA 3LRKA 1TYGA 3TJ4A 2QQ6A 1H5VA 3BL3A 3PN8A 4NNBA 3IPWA 4A8RA 5JBEA 4O1CA 4GGHA 1UOKA 4RNJA 2XIQA 1W5NA 1A0CA 3WBYA 2WBKA 3ISIX 2Z1XA 2CC0A 4XSLA 3PSVA 4ZMGA 4JTEA 3OA5A 1SMAA 3R6IA 3LCFA 5FIPA 5I79A 4X60A 3GFZA 1KFKA 1TIWA 3LTYA 2PB1A 3MUCA 2IPWA 1K7EA 2EG7A 2PE4A 2LLEA 4R7JA 1R9YA 3T4WA 1GVEA 2IW0A 1NHSA 4DEFA 3IJ9A 4JPGA 4JY9A 1RBLA 2VZUA 2GVEA 4PB4A 5K4ZA 3TN5A 2DUZA 2W79A 5A6JA 3OW1A 1OQFA 3T0DA 1KLYA 3KP1A 4O0ZA 2WPCA 2AMGA 4OE7A 4W7WA 3QKZA 1W9DM 3ARUA 5E09A 3VOJA 5TF0A 2CKSA 4B3ZA 3ONBA 4YCPA 4I5RA 1MVYA 4ILSA 4F0RA 4LAKA 3PG9A 2PDIA 4MZYA 1NVMA 2GWGA 4J3VA 4GISA 4DJEA 4J2PA 3LTPA 3GTHA 3UJ2A 1V59A 5E9AA 5AVHA 2WP6A 3DYPA 3QR0A 1SUXA 2XJ7A 4O13A 2VX6A 2Y8KA 3S6TA 2W9MA 4QDWA 1E72M 4H6EA 5K4XA 2QCDA 4ZCWA 3EWUA 2BTMA 4ZQMA 1GRHA 2ZRUA 3TN3A 4HPXA 3NL6A 3WDIA 2FHCA 2YCEA 5AECA 4DIAA 4P8VA 3N3TA 3H70A 1K8ZA 2VKZG 2GR1A 1JZ3A 2RJGA 4Q4MA 1TB3A 2VVSA 1U1UA 5DCBA 4IT1A 2PBGA 1PS9A 3BCDA 2F61A 4O0KA 4QSFA 3BAYA 3CTLA 4FLOA 4JXCA 4JQ1A 3PB2A 3P84A 1VGAA 1OF6A 3IVUA 1X98A 1GT8A 1TO3A 2VEKA 4K8EA 1ALDA 4GIYA 2VQUA 3OYXA 1DJNA 1GVOA 3E96A 3APYA 1V7YA 1CBGA 2AKZA 4PSPA 4Y7EA 3S4TA 3PS7A 4XVEA 5T91A 2J8TA 4QE5A 4K6AA 1EUAA 1W9UA 3NQAA 4PMRA 5G1TA 2D23A 3FS2A 3D46A 3VILA 3WEMA 4BQ5A 3ATZA 1ONWA 4JQ4A 5J5DA 1MDLA 2ZRYA 4JDRA 1I0BA 5CGTA 1GW1A 2CCRA 4AVNA 3BDKA 1R9XA 1TYPA 1C3FA 5GVJA 3V7PA 2Z2AA 3GH5A 1LPFA 4MKVA 3LPOA 1XD1A 4TQTA 5CSRA 4PL1A 1E15A 3SUWA 1WXYA 4XTDA 5D32A 2WM1A 1OCJA 3BW3A 3AALA 3C2FA 5HDRA 3SIMA 1XLJA 2WHKA 3GWQA 4MJ2A 3RU6A 3SCVA 2O9PA 1EC7A 5DO8A 1QOXA 4GC3A 3AO0A 4DBDA 1EEXA 3QW3A 1E4MM 3ABQA 1BWVA 4Q6JA 2YIHA 4JN8A 1JPMA 4UQAA 4FXJA 2PWUA 5M17A 4DM2A 1KWKA 4HIBA 1EBDA 3I6EA 3VNYA 4DAIA 4J3XA 4CU8A 1E1CA 2C16A 1S2UA 4PH6A 4Z2LA 1W91A 2QCGA 4OOZA 4PFHA 3H4KA 1LLWA 4QS5A 3TC3A 1VHNA 3AHYA 3CPUA 3H24A 1TCMA 3CHVA 3Q94A 3KEHA 2VQTA 4MM1A 5L9FA 3BLOA 3D0CA 4CCDA 1LBLA 2ZA1A 1E6QM 4UQ9A 2OKTA 2PLKA 4S3DA 1HZYA 1DJGA 3KRZA 1OX6A 3CQKA 5T9BG 1QO5A 2ZUNA 1UH4A 2XIOA 1OIMA 4AMCA 4CKQA 1RJRA 2CESA 2YBUA 1XH0A 3WLJA 4JTAA 1YYAA 2PWHA 4GUFA 3AS1A 3RMJA 4DUXA 3CB8A 3IANA 1ZXIC 4AD0A 1GG1A 4MZ1A 1HVQA 1PYFA 3U6WA 1NWRA 1NP0A 1PIIA 2P1FA 2E4TA 5JCMA 4L1GA 1YQ2A 1GOQA 4E38A 4J5NA 3P80A 4UFJA 2J7FA 3PBUA 2WQPA 4BEUA 2ZBTA 4QE1A 4W7UA 5U4NA 3BMVA 4PMDA 3HN3A 1V02A 1EJTC 5FAJA 1DXLA 3NAVA 4QLLA 1Q2RA 3W87A 4HSHA 3TU9A 2CIPA 4R7OA 4ADTA 4PUEA 5LNRA 4GZ7A 3M16A 4X2PA 4DYEA 1C7TA 3MT1A 2ATMA 1XSJA 3TH6A 1AJ2A 5CPMA 3UZXA 5DRCA 2CLIA 2A6NA 1ZU8A 3L68A 2H6RA 4YS1A 2E77A 4GNKB 4Z1AA 1QBAA 3UR7A 4D6JA 4IGNA 3H53A 1OABA 3VIJA 4F2UA 3A24A 5FEZA 3RJYA 3W7RA 3QJAA 4GNVA 4O15A 4RPQA 2ZZCA 3BOLA 3C2VA 4FSAA 5LXXA 2W4XA 5GNXA 1GERA 3RCNA 4Z2GA 1V77A 2WAGA 1A80A 2X0YA 2BG5A 3K4AA 4EPKA 2E8YA 1WOBA 4QEHA 3N6HA 1QPQA 3L7RA 2DZBA 5TAOA 5E6YA 1DTNA 4EPBC 4WKHA 4QNWA 4UR7A 2O9TA 1AL7A 4ZZ9A 1VFOA 3M7SA 1QNPA 1IT8A 3C8NA 4KBXA 1Z42A 3BC9A 3CL7A 1WKEA 2WJDA 3W7DA 1H49A 2I57A 2HXTA 2J62A 4WZHA 3VGHA 1SZNA 3DECA 3HG4A 3B9EA 1GUVA 4UQCA 1U30A 3A4XA 1N8WA 1D9EA 3XIMA 3PPGA 3NGJA 2D3LA 1GEUA 5A5WA 1NSJA 2W3SA 4LC6A 1H7WA 3VIIA 4ZB2A 2F38A 2J24A 4A29A 4RKAA 1KWGA 4RLIA 1J4EA 1AZ1A 2R9ZA 1XISA 2CWNA 2E9LA 2Q3OA 4W5UA 3OZOA 1J5TA 2BC1A 2QCNA 3TJLA 4P7OA 3BLEA 1R86A 3T4CA 1YXYA 3V3WA 3EPMA 3W81A 3EXSA 1X1NA 2WVVA 1ISXA 3ZOAA 5HMDA 4C6BA 3VD4A 1Q3NA 2XG9A 4H1ZA 3MO4A 1KRBC 4M81A 2R14A 1UD5A 1B4EA 1H41A 4ROQA 4KT2A 3LLDA 1H50A 1LM1A 2WV8A 3S83A 3VD5A 4GKTA 1R9ZA 1YX1A 2I1OA 5HOSA 4H9XA 4NJIA 3PZ9A 3L9CA 1CB7B 3S5OA 4KEUA 5CKSA 5C0QA 3QMSA 5EBUA 4QAWA 3NGFA 2KZHA 2PC8A 5E1QA 3AIVA 1Y7VA 5FEWA 4AISA 1N5XA 4ZO8A 2D0FA 5I23A 4JTJA 4ZEPA 3S3GA 1PO9A 2GJXA 3GUWA 5LA2A 4QCFA 2XM2A 1FOBA 4AHQA 2J7BA 3S6DA 3ZM8A 1Q6LA 2NXGA 3LV5A 3M5VA 3UFYA 4PYSA 2QGYA 4LCRA 3RLHA 2HK1A 2DV0A 3G1YA 2Z24A 4RJEA 2QUTA 4EX4A 3ARVA 3EMZA 5EGRA 1HJVA 4BJHA 4XZNX 1PJ9A 4TR9A 4UNIA 3KVJA 1GQKA 1XIGA 4DBWA 4LAZA 4Q8UA 4JQAA 1BKHA 1KXQA 3H8AA 3CUFA 2BHUA 2DJLA 1CECA 3UWVA 3WD3A 5T26A 3RMEA 3G3MA 3PFMA 4ZOCA 3HPSA 2YDRA 4WJ8A 2HE5A 1D8CA 3W86A 3EAUA 4HT3A 1RV8A 2F84A 2PU1A 4LVFA 1N61C 3BG9A 4HTBA 3VFCA 1YADA 4NI8A 3MHUA 4MVAA 1OSEA 1M53A 3GYEA 1I6NA 1UIPA 5BROA 5I02A 2C3CA 2QT3A 3PUEA 1GZ1A 1M9HA 4HNNA 4OVXA 2ZXBA 2IQDA 3S2NA 2NX3A 4C6MA 4QNEA 4IQJA 3ZSTA 4CU7A 2ZDRA 4IQDA 4GACA 3IARA 5DXXA 3KTCA 5FJIA 3S1UA 4C6OA 2OO0A 1E70M 1I8JA 2BGNE 5AYBA 2Z1SA 4LF1A 4MJZA 2DUXA 3MWAA 2WWDA 3AUOA 1ZJHA 1J2WA 3W7GA 4WKFA 3KTSA 1NWUA 4KMQA 1EIBA 4DJFC 2NUYA 3O16A 1EPVA 4HNOA 4UNLA 2WM0A 4A3QA 3UYIA 3UXIA 1J8VA 3UESA 2BX7A 1M7XA 3KDOA 4PTVA 3GZ3A 4UTHA 1T40A 3AWNA 3UXKA 2BS9A 5C9ZA 2FDMA 4B2DA 1DWJM 4E3TA 2UY2A 3PAJA 4JFSA 5T8GA 2GJLA 3PZNA 2ZOXA 1HL2A 2HQAA 1OD0A 1C92A 3TSBA 2DT2A 1S5VA 8RUCA 1ZTVA 2WCSA 3ZJ8A 2CXEA 5KTLA 1P0DA 3EUB3 1E51A 2GFTA 3IIOA 3K8KA 1KM1A 4Z08A 3WDQA 4KH2A 3E9AA 2Z2UA 2QAPA 1EDTA 2QPSA 3IJIA 4HCHA 1ZZMA 1H6VA 1WAWA 3M5YA 3T09A 1DVJA 4L7ZA 3TTSA 3PAOA 2RDUA 4MGGA 1BG4A 4GO8A 3U2ZA 1PVNA 3UA3A 1IWBA 3KHJA 3NO3A 1DWIM 4JIEA 4DF1A 4PE8A 1H5YA 5LIKX 4ASTA 4DJEC 1RCQA 2WZIA 4GYPA 1B3WA 3AMKA 4B5SA 3KOWA 3REQB 1QW8A 5M1TA 3SJNA 4ROPA 5CPLA 4MYAA 1RBAA 3S5NA 3TXVA 4DXKA 3BAXA 1S5WA 2WOIA 4TV6A 3SCWA 1OFRA 2EXOA 1Q45A 1GW9A 3RUBL 3B0UX 1LQ0A 3PC0A 4J28A 3IVTA 5CPOA 4ZO7A 4H4RA 4WJEA 4E8CA 3LZ3A 4KF1A 2CW6A 1UZHA 1YE6A 4UFKA 2V3FA 2R1NA 3IJLA 4L1XA 1UP2A 4X63A 4HD5A 5D4YA 1US3A 3GYCA 4LSBA 1A53A 3W07A 4CD8A 2OQHA 3WNNA 1V8EA 1BGGA 2A3AA 4UTKA 1DJZA 1WQ5A 4M3PA 5AHNA 5TBOA 1JDCA 1D2KA 1ADDA 4JX5A 4RDYA 3RO8A 3N9KA 4XZWA 1V3KA 3CV1A 1I2RA 1GJWA 4NJHA 2YXGA 2NUWA 1QRQA 2ON3A 3AWOA 2BSLA 4KCTA 4JTIA 3LB8A 3DXIA 3T81A 4GI8A 2XSXA 5H8MA 2YFOA 3LADA 3W84A 3CB3A 5DBUA 5AC6A 2GGHA 5BWFA 5ABFA 2DT0A 1MZRA 3GRTA 1IIGA 1JR1A 1EDGA 4JTTA 2NVKX 3RF9A 3UZJA 4NRSA 4C6IA 1XH2A 2G96A 2OWCA 1DXFA 4S1FA 2PMQA 1V3HA 4HMNA 3O0HA 3R5EA 3N2OA 4W8BA 2NQJA 1TTJA 2A2IA 2YDSA 2PAJA 5LIYX 3UZZA 3KL3A 1R3WA 2REQA 3IVSA 3BSHA 5EU9A 3PZTA 3SCSA 3ZZ1A 2PLCA 2YVJA 3KCOA 1LBFA 5EY5A 1W1A1 1MW3A 4QIUA 3RR4A 4BF5A 4LYKA 4ZXLA 3CHDA 2BXZA 1GKPA 5HWMA 4ES4A 4N9CA 1L0PA 2NQ9A 2QF8A 3LRMA 1EA9C 2GR2A 4MKNA 4ALDA 1K7XA 4XZ9A 1SVDA 1UC4A 3QR1A 4KIEA 3G1FA 2DSZA 3SRKA 3EWBX 3H6OA 4AVOA 2YCKX 2Z7KA 1V3LA 2OSWA 2FTWA 2RUSA 5FD0A 1B4KA 5H8UA 2BVWA 5A8PA 4H4XA 3UY8A 1IXPA 2XPKA 3MI2A 3QY8A 4GUJA 2ZWZA 4NZ1A 3FJNA 3QFEA 1XYMA 1M7PA 4W93A 3M1ZA 1WDRA 5CJMA 4NZ3A 2ZADA 2BLEA 4HCLA 3FDGA 1CGYA 3C2OA 2ISDA 1XLKA 3LX9A 3R0KA 5DY3A 2ZUUA 2E09A 5M3WA 1K6AA 3M46A 1AMYA 1ONFA 1ZCOA 4LY8A 2OU4A 4DI9A 1OYCA 4Y8FA 4N9EA 1W5MA 1EGZA 3P2VA 4UTMA 1J12A 3WN6A 1QK2A 1ZP4A 3PJWA 4LRSA 2AGTA 4HA4A 2HS8A 1OFDA 4GNJA 5B7YA 1U1JA 2EPMX 5FCZA 2ZIDA 4GUHA 3B04A 3REQA 4LT9A 3IIZA 2V3AA 3NS1B 1U2YA 3DC0A 4CD6A 4DX3A 1WDSA 4BI6A 3G1DA 3OZYA 2XWEA 1QJWA 4XD6A 2YAUA 1TA3A 4B92A 1IEWA 3KCLA 5A6MA 4Z2HA 1YIXA 1TKKA 4B3LA 3N3MA 3NM1A 2GVYA 2XFWA 1K9EA 1BD0A 4HK6A 3WL1A 1JXKA 1Q6DA 3P8IA 3OIHA 4N4PA 1X6NA 3L2MA 4PR4A 5E93A 1DWGM 2VX5A 4OTKA 4EAMA 1F6YA 1LBMA 1FXQA 3W23A 2DIKA 4N02A 1J0ZA 1ECEA 1F3TA 4B5XA 4I5UA 1WZLA 3C5QA 3THAA 5KVHA 3QTGA 3FA3A 2E3ZA 4WIWA 1WX0A 5AC5A 4IOTA 1KKOA 1NM9A 2WSPA 2CERA 1FP8A 1BSLA 1DBTA 5A2AA 3AQUA 3BSMA 2OCZA 4H9YA 4RZ6A 1ONEA 3MSYA 1DIOA 4S39A 2VFFA 1XIIA 3IWPA 3EXTA 3KOXA 3TTQA 4V28A 3RILA 2QS8A 3KBSA 1ZL1A 5AYIA 3KHDA 4DBUA 5AZ0A 1HO4A 1MZHA 2ODOA 4MNMA 3VE7A 5KSWA 1FCBA 3M0KA 5GJPA 3M4HA 4GVGA 4AF0B 4ACZA 2IXVA 2EAWA 1B30A 4GI6A 3EX4A 2Y5JA 3L23A 1PUDA 3WSUA 1G6CA 1VBHA 4BA0A 3EWCA 3HU7A 1JYNA 3B9OA 3KBVA 4H9TA 3WQ4A 2FQIA 4J3SA 1CZ1A 3WZ0E 5C7VA 5BRBA 2OQYA 1EOKA 2GL5A 2J8GA 3QSTA 1OG6A 4LIIA 5DRIA 3H4GA 4PB5A 3W27A 4CQDA 3NURA 4GMEA 4BURA 3EDDA 3A7AA 2V6AA 3GX9A 4N6FA 4K68A 2PDYA 1DJIA 3VCNA 3WUFA 1JPHA 3NQBA 1RALA 3CV7A 4F66A 6ALDA 2VEPA 2XIJA 3SQSA 2DQXA 5JCIA 1F74A 3WBXA 2YDQA 4NJGA 4C7FA 1W5OA 4GY7A 4LRTA 4HHPA 2R1MA 4EMWA 4LNCA 1TQJA 3GKAA 4K36A 4KIRA 3II1A 2PWDA 3M5ZA 3BMXA 3MVTA 4A35A 2E67A 1O95A 3FAXA 4MB4A 2E1DA 4CD5A 5AYZA 4LB4A 2V30A 3TP4A 4MADA 2XGBA 4YTSA 1CGUA 1GHSA 2V38A 4I9AA 3QSRA 4N2YA 1FFVC 4O10A 3DC8A 1W1IE 2A3CA 4MY8A 4NAEA 3PNZA 4N7QA 1XSIA 4NNCA 3SUUA 4GQGA 1HXJA 1QU4A 2RAGA 4M6VA 3H2MA 4DBSA 2VR2A 3QOMA 2E5AA 3EANA 1DJYA 1WYIA 3R94A 2C3ZA 1R7AA 3V75A 3DHUA 4TOQA 4UIOA 2BODX 3M44A 1E40A 5K9CA 3UQNA 5ABEA 1NJJA 4FXSA 3F7JA 1DE6A 1P4CA 2TYSA 4WCJA 1JCJA 5I78A 1LCOA 4YNGA 5TQLA 2OWXA 3SDOA 1IHIA 4U5IA 5EMJA 4OFCA 4BF7A 4P61A 4D1IA 1TUFA 1Q6GA 4EQWA 2VC5A 4UTUA 1UWUA 5CSYA 5E70A 3P5ZA 1VFMA 1IGSA 1C8XA 2ZX5A 1XYLA 5CLWA 2V5LA 1S5NA 1JCYA 5EB8A 1TZ9A 1FH9A 5FJJA 3ARSA 1V97A 2G4FA 4MB1A 2RH9A 3BARA 3GTNA 4REQA 3VIPA 4BQ4A 1EZWA 3KLLA 4L4PA 4NJKA 4IMAA 4JFWA 3TNBA 1TG7A 3O6CA 1BXNA 4I6VA 5BW6A 1DWAM 5DQPA 2YKKA 4YVXA 3LMZA 3L4UA 3OLGA 1E3ZA 3CBWA 2BC0A 2WLYA 4HU8A 3E74A 3H12A 3BAWA 4R33A 3ITXA 3VUPA 2D2GA 2OSYA 4H83A 1S1PA 5IOBA 3P74A 2WCAA 3LSBA 3KVLA 1CGVA 1GETA 1K03A 2JK6A 2WP5A 1TREA 1L6SA 4HMEA 3V4BA 2PC4A 3KW3A 3IAQA 3OHIA 3N19B 1W37A 3GY1A 4ZODA 3W7EA 4H9MA 4UOZA 1V4YA 2J7HA 1JDEA 1WB0A 2WXDM 5BRQA 3AHTA 3LN3A 1FWWA 2DFAA 5C71A 3SCQA 3CQIA 1GVSA 1ONRA 1TCDA 3ZFHA 5U7SA 1VH7A 4O19A 1EA0A 2VX4A 5A8NA 4KRTA 4US5D 2VENA 4GVFA 2NV1A 5FF4A 2NWSA 3LSCA 3NYZA 1NWSA 3GVWA 2CLOA 4IX0A 1W2VA 5HR7A 2WWCA 4I9JA 2BHYA 3QQ0A 3UJRA 4AVFA 4MDPA 3STGA 1W32A 3O8AA 4XO6A 3I7QA 1S2VA 1MEIA 1XWYA 2BXVA 1E71M 3EB2A 3EEZA 4O16A 5TNVA 3WNPA 4AY8A 3F4VA 1DQUA 3N9RA 3L5MA 4H4IA 4DZ5A 5HQEA 5CH9A 4JEJA 1FCVA 2MUCA 4E4UA 1CXEA 3ZS4A 3APTA 1DHPA 4F9DA 1X7FA 1A3XA 2X8GA 2PGEA 4MYXA 3WLKX 1SJBA 3WH5A 3H2FA 3PZGA 4WXZA 2QF7A 4I3GA 1JCLA 2E5CA 4GJJA 2V3GA 2I5IA 4PMOA 4EPEC 3CLWA 4Q4OA 3RN6A 4Q32A 1DJWA 5IDIA 3SJ3A 3KZPA 2VR5A 3CPGA 6XIAA 4OHQA 5FOOA 4PRRA 5KINA 1W5QA 3ZT7A 2PDFA 1LUCB 5CJNA 1UP0A 1GJUA 1QW9A 4HNLA 5MHBA 1EWEA 3NZRA 3S9IA 3G8EA 1UP3A 3VGDA 3LQGA 3QY6A 4NXSA 3W00A 3DG7A 5IFTA 4C6PA 4UOJA 2J8FA 3VI2A 4E5TA 4S3KA 1JZ6A 4J3TA 3N4AA 2Y7GA 4DO6A 4IMFA 4M80A 4K37A 2ZUTA 3TSDA 2A3BA 2QGHA 2WVSA 2OEMA 3TKFA 1FQ0A 1H1YA 3R0UA 4OGZA 3NZPA 2UBPC 4EKJA 3SSJA 1TTQA 4CNNA 3N34A 3XINA 1FWSA 2RKXA 2YR1A 1YDVA 4X3ZA 7CGTA 2IPJA 5H2ZA 1GK8A 2ZXQA 3MJMA 1K70A 3OGSA 1RAKA 2X8RA 1KRCC 1XKYA 3OLEA 5HQMA 1V0NA 3EKZA 1FFUC 3GXMA 1N55A 2VGBA 4FI4A 3WELA 1J93A 3QZAA 3ZQ9A 4Z2JA 2DT3A 3W82A 1KBBA 1O94A 3WLMA 1BFNA 1S39A 3PB0A 3N25A 3NQVA 1LOSA 2Y63A 3BICA 3KS5A 3P61A 4BI7A 3B9JB 4PTDA 2ASHA 3V18A 3NQ2A 1OX4B 4LUJA 3TYBA 4FIRA 1DXEA 1ZAHA 3WENA 1XBZA 1XRVA 4C65A 1OADA 3NZQA 3CQHA 3TNOA 4J35A 1FCQA 2OT1A 2Y7DA 2HBVA 4RE4A 2QDEA 2EF9A 1OM0A 3VTRA 1SJAA 4L1WA 4RXGA 1SZGA 1VPYA 2O9RA 2CFFA 4YWSA 4ZSTA 3TC6A 2W0UA 1UMLA 2V68A 3EZ4A 4HPNA 4H00A 3VNZA 3ARWA 1MW0A 4DY1A 2G3MA 4QM1A 3N6QA 3I65A 4O50A 1FHVA 1WXJA 3S5YA 3TCEA 2HWGA 3WLTA 2FB3A 3ZLGA 1EO7A 3URBA 1G0CA 3SCRA 1IEIA 3TEVA 3R1ZA 3QLLA 3TN4A 2CEQA 1AOGA 1CI1A 4QTGA 2A85A 2D1ZA 4QJ4B 3DJJA 4RV3A 3A9IA 4TMCA 1G7VA 1U33A 3N29A 4URIA 4L61A 3SIZA 1B54A 3BANA 1W54A 2KX9A 3PJUA 4UQDA 5D03A 3U2EA 1OT1A 1JGIA 1KQZA 3VK5A 4UTFA 1Q6CA 1O5RA 1RVGA 3KRSA 2EG8A 1LOLA 3L0NA 1POKA 1TELA 3OP2A 1MUWA 4QQUA 1Z89A 5AN7A 2GZXA 4CQ9A 2O56A 4AHOA 2JGYA 1JZ5A 2F5ZA 3W2MA 4LS1A 1LORA 3CK5A 1MI3A 4XBJA 1SR9A 1K8YA 3WNLA 1K8XA 1H63A 4G5DA 3DESA 4ZBCA 1JNDA 4XZMX 1HKJA 2W61A 1RCOB 3W6MA 5HJXA 3TZNA 2YL5A 2UY5A 1BGAA 5G2IA 3F2DA 1JVNA 2XVGA 1FDZA 4EXBA 1CEOA 4MAZA 5D37A 4M24A 3ELFA 1HN1A 4FIQA 1EQCA 3RLGA 4ZGYA 2X41A 4M29A 4RZ4A 1MXSA 5C55A 1PX8A 1DWFM 1TTIA 1Q1RA 4FNTA 2FH6A 3FXYA 4Q4KA 3THDA 3DGRA 1J01A 1JYWA 4IPJA 3QKEA 3UP8A 2VFEA 3QTPA 3TTOA 3W7CA 1XRTA 3GVGA 1WA3A 5BOFA 3E38A 1V3JA 4BFAA 4I8DA 1EF3A 1TX0A 2VFDA 1V51A 3E0FA 4HSOA 1S1RA 3AI0A 2OZTA 1MRQA 2YJQA 1TRIA 1J0JA 4BF9A 4QRNA 1JZ7A 2VT0A 3AAMA 3HA1A 3MUIA 1FY6A 2G50A 2XVLA 1B0IA 3VYLA 3WFAA 1C9DA 3C8FA 2WKJA 3EDKA 4DUWA 4ACZB 2R24A 4MB5A 2FFIA 3WF4A 4IFKA 5FJPA 2AKMA 4O4WA 1L2UA 2D0HA 3GDKA 4H4VA 2GOKA 4ZE4A 4JFVA 1HKWA 3VOFA 3ZYZA 1XICA 3KBMA 1UR9A 4XG1A 3SB0A 3UJEA 4PUDA 1VIWA 4I7UA 3FN9A 2BHZA 1MXGA 4UUIA 2OWWA 3F4NA 4GE8A 4YTUA 4D6HA 3GTFA 4AEOA 4FR1A 3UWEA 1CENA 1XV8A 2PGWA 1NFBA 4M51A 2SFPA 3M0JA 3CQJA 4LS2A 2JIEA 2VOMA 1NDZA 1P7TA 4G7FA 3C0LA 3LHZA 1J0IA 2EQ9A 2FPTA 3TXZA 4AAJA 2QW5A 3IGUA 4NNAA 4CN4A 1A5MC 1U83A 1MEWA 2XZ7A 4KW2A 4HZ6A 1G4SA 1MNSA 4QX4A 4NL1A 2P0IA 3BOFA 3W0KA 3YPIA 1BLIA 1YDOA 3CGTA 3K5XA 3RLUA 5DN1A 4FOUA 5I3HA 3GR7A 3S6OA 2H8XA 3TR9A 3PBWA 2EQ6A 3FXGA 1XS2A 1Y0EA 5BRPA 1VBJA 3H23A 1ZJIA 1HGWA 3W72A 5BNKA 3KRUA 3L65A 2JFEX 1UWRA 4D9PA 2VC6A 3CMJA 5D8ZA 4GCXA 3PTDA 4L4OA 1Y5WA 2BOFX 2ZVIA 4AIUA 2PDMA 1CGXA 3E5BA 2JKAA 1ISYA 4NAFA 3H7UA 2BCPA 5KMYA 2XSAA 5D38A 1IYXA 2GJNA 2R1KA 1X39A 2UZ9A 3GRSA 3GXFA 1UPPA 3BCFA 3F5KA 3IK2A 1TV7A 3VXGA 1KN0A 1NH6A 1B57A 4D8LA 1TVNA 1HJUA 1OZMA 4LV9A 2BVDA 2OOFA 3FCPA 4KRZA 2FGZA 3L4TA 4Q8MA 3SW6A 5F7UA 1RD6A 4Q8NA 1GOKA 1T41A 2QJGA 3FYYA 4BKNA 4DXXA 1VD6A 2AL2A 1JRPA 5U25A 1XL9A 2XVNA 3HB9A 4APNA 3BG5A 1HIZA 3AMCA 2NQ5A 1GRBA 1GHRA 3A5FA 5CC3A 4LY4A 4Y90A 1KRAC 3O0KA 4RZBA 4DF2A 1AVAA 1QO2A 3U0HA 2PD9A 1XQLA 1W3KA 2Z28A 3LLXA 3L4WA 2VL4A 1BQCA 3SRHA 1J96A 5A1AA 3MCOA 1WDPA 4UTTA 4PMZA 3MW7A 2WKGA 3LRLA 2H90A 2BASA 3QFAA 1JD7A 3LA4A 3OPSA 2X99A 5BCAA 4EF9A 3PPHA 4R5EA 4DJDD 5LZLA 2W3ZA 2PURA 3HQ1A 4NRRA 1PWMA 1OC5A 3JS3A 3AHVA 1IQ8A 1JULA 1QNRA 3G2GA 4MMWA 3VGEA 3TFXA 4B2DD 3MANA 4X9SA 2WANA 5FAGA 1CLVA 1EXBA 2FH8A 4ZOHB 3A12A 3AISA 3DFSA 2OKOA 4UFHA 1EO5A 2CKRA 1W3IA 1TPUA 1VCGA 3WLIA 3CGEA 3GBDA 4GJIA 4ONVA 3C86A 3RM9A 2FKPA 1LZOA 2J7DA 2WHLA 3ABRA 4XVDA 1E6NA 1IF2A 4D8AA 2XVKA 4OUEA 4PFMA 2Z0IA 1EHNA 1VZWA 4P7LA 4W89A 3HG3A 1A5BA 4JX6A 1FBAA 2RABA 3V5CA 1YNYA 4DJED 1JZ8A 1A0DA 4KERA 2OG9A 3B8WA 4Z2KA 4W84A 2P10A 1FA2A 1E6RA 1KD0A 2FVKA 2WSRA 4CNUA 1QWKA 1KV8A 1LUCA 1AFSA 1W3JA 1XP3A 4BR1A 2POZA 4ZFCA 2AL1A 3GIQA 3DERA 5A2BA 3WDJA 1OGSA 1NQKA 3SR7A 1VLWA 3CAWA 1OY0A 1IXNA 1UBPC 1KBIA 2GPTA 3PBVA 4J27A 1JXJA 4MNJA 2E6DA 4FOKA 3AIQA 1YKWA 3KP0A 1ICPA 3P93A 3NXLA 2G0WA 3IGXA 3LXAA 4QG9A 1NHQA 1E4IA 1GOIA 1TPVA 3U8GA 4A8LA 4F0KA 2QMJA 4U3CA