3PK7A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens with mg and glycerol bound in the active site
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
403
structure length
396
Chain Sequence
b'LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVYEPADSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens with MG and Glycerol bound in the active site
rcsb
source organism Chromohalobacter salexigens
molecule tags Isomerase
total genus 150
structure length 396
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2010-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3pk7A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3pk7A01
4Z1YA 3GY1A 4HPNA 4A3RA 3UJSA 3QN3A 4K2SA 3CB3A 2QJJA 3ZVHB 2P0IA 3OZYA 3DFHA 3FXGA 3Q45A 3VFCA 3D47A 2GGIA 3MUCA 3PFRA 2I5QA 3V4BA 1P48A 2DW7A 3DG6A 2QDEA 3IJQA 1ECQA 1WUEA 2QJMA 4H19A 2P3ZA 5FJPA 2AL2B 3VA8A 4IL0A 6ENLA 5J04A 3ES7A 4JN7A 2PPGA 3U4FA 1KD0A 3ZLFA 1W6TA 4DHGA 2PODA 4IP5A 1SJDA 3ES8A 1RVKA 3R1ZA 4G8TA 4A35A 1R0MA 4GISA 3QPEA 4H83A 3R11A 1SJBA 4ROPA 4K8GA 3HPFA 4MMWA 2PMQA 3VCNA 4EWJA 1F9CA 2XSXA 4FI4A 3PWIA 4GYPC 4HN8A 1MDRA 1FHVA 3UCCA 1MUCA 3K1GA 1JDFA 2OO6A 3BJSA 4G7FA 1MNSA 3THUA 1EC8A 3V5CA 1MDLA 3H70A 1TKKA 3SJNA 2XH0A 3IK4A 3OZMA 2RDXA 3MQTA 2AL1A 1TE6A 3RO6A 3GO2A 2O56A 2PTWA 2OZTA 3FVDA 3VDGA 3RRAA 4H1ZA 2ZC8A 3TOYA 4DX3A 1KKRA 2XH4A 1DTNA 3TCSA 4F4RA 3RR1A 3STPA 3RITA 3U9IA 3VC6A 3BSMA 2QDDA 5EU9A 4K1WA 3UJEA 3JW7A 1YEYA 3EEZA 3TWAA 3NZGA 4KWSA 2PP0A 3FV9A 3DIPA 3JZUA 2HXUA 2OX4A 3OTRA 2P88A 3EKGA 3SSZA 3UGVA 3R25A 4MKSA 2OVLA 4KEMA 3R10A 3T8QA 2OLAA 3ZVIA 7ENLA 4DXKA 1TZZA 2OZ3A 3PWGA 4E4UA 3RCYA 3UJ2A 3SN4A 1P43A 2GL5A 3SN1A 4HNCA 3D46A 1L8PA 4GGBA 4JHMA 2MUCA 3GC2A 4FP1A 2QJNA 1JPDX 3QTPA 5FJUA 3T6CA 3DERA 4H2HA 3R0KA 3V5FA 2ONEA 4IHCA 1EC9A 2QQ6A 4J3ZA 3NO1A 5FJTA 2PS2A 3JVAA 1BKHA 4M6UA 3FYYA 1ONEA 4ENLA 2GGGA 2FYMA 2OQYA 3RGTA 3I4KA 4HCLA 4DWDA 2PGWA 1KKOA 4HNLA 3TQPA 1SJAA 4Z17A 3CK5A 3DDMA 3S5SA 3UJRA 3OPSA 3DEQA 4DYEA 2CHRA 2OQHA 3UXKA 2PGEA 3QLDA 3CYJA 4HYRA 3MWCA 2HXTA 4GGHA 3TWBA 5IDZA 3GD6A 4IZGA 2AKZA 3MSYA 1XS2A 2XGZA 2PA6A 5FJOA 1NU5A 4JN8A 4GYPA 3Q4DA 2GSHA 3T9PA 3ZVHA 4KT2A 4HCDA 2PP1A 3R0UA 3SN0A 5FJRA 2XH7A 2FKPA 3KUMA 2PU1A 2OZ8A 2GGHA 4IP4A 2HZGA 3N6JA 3DGBA 2ZADA 1XPYA 2AL2A 2PTXA 3H12A 4IL2A 3SQSA 5BOFA 3PK7A 4E8GA 2GDQA 2HNEA 2PSNA 3DG3A 4GMEA 2PTYA 3MY9A 1NELA 3VCCA 3P3BA 3VC5A 4ZA0A 1R6WA 3DG7A 3I6TA 3CAWA 3UJFA 3N4EA 4DN1A 1ELSA 1PDZA 2P8BA 3V3WA 3SBFA 3NFUA 3OP2A 2MNRA 5BOEA 3TW9A 4ZCWA 4IT1A 1OEPA 2POZA 3ENLA 5ENLA 4M0XA 4E4FA 1EBHA 3FJ4A 2OFJA 3B97A 3UXLA 4KPLA 3CXOA 4YWSA 1FHUA 2PTZA 3TJ4A 2PP3A 2AKMA 3H8AA 2P8CA 1E9IA 1EC7A 3N6HA 1WUFA 1MRAA 1SJCA 4GIRA 3IJLA 3H7VA 1JPMA 3T4WA 3CT2A 2QVHA 3I6EA 1KCZA 2OPJA 2GGEA 3UCDA 3DESA 2OG9A 3ZLGA 4E5TA 3P93A 1PDYA 3ZLHA 3DFYA 1IYXA 4A6GA 2PCEA 3S47A 2DW6A 2PU0A 4J1OA 3TJIA 2OKTA 4MGGA 3N4FA 2GGJA 3OW1A 3P0WA 4GFIA 3QKEA 2QGYA 2NQLA 3IJIA 3BOXA 3MZNA 1EBGA 4HCHA 2XH2A 3NXLA 4E6MA 3FCPA 3MKCA 1JCTA 1BQGA 3TTEA 4X2PA
chains in the Genus database with same CATH superfamily
3QRHA 1QBBA 1J96A 1OY0A 3WY1A 1XLJA 3AFBA 3QTGA 4Q8UA 2GSJA 1KQZA 4NJIA 5FS9A 4Z2LA 2P0IA 4Y2WA 4AB4A 3OGVA 4IFKB 3Q45A 2GGIA 1TYPA 3EDKA 1GRBA 2BGQA 3PFRA 2ZUUA 2H9AB 1XPGA 2GRTA 6CGTA 1YHTA 3H2NA 5A8NA 1T8XA 2BB0A 4RPQA 3RM4A 1TQJA 1ZQ5A 3HGJA 3SURA 3EYPA 3L0KA 1KD0A 1TTPA 1JDEA 3CGCA 1UZHA 4HNTA 1YXDA 2Z0IA 4M7TA 2ZA3A 4MPKA 4BA0A 4DWSB 1TV4A 4MIMA 3QPEA 3TJLA 1H2IA 1Q2SA 2J7BA 2C91A 4GUFA 4K8GA 2WMIB 1NQ6A 3HPFA 1UIOA 4GY1A 4IGSA 3GQYA 3WL1A 2DQXA 5LHEA 1P7TB 1Y65A 3VNIA 3FOKA 3PWIA 3HPXA 4WDWA 3K8KA 3L7RA 1QATA 4ZTYA 1WP6A 4C91A 1F3WA 3DI1A 2ZX9A 1JDAA 5DQPA 4GZEA 1W9DM 4RE2A 1XYMA 3A4JA 1NFBA 1S2VA 3O0KA 3O05A 2ZRUA 4YWOA 3VNYA 4OBSA 4W7VA 1PIIA 3VU2A 3WLMA 1TJ0A 3B03A 2YBUA 3TW6A 5D8ZA 1DBTA 3MCNA 7TAAA 4IUOA 1KKRA 2JF7A 3W2UA 3B8VA 4GIAA 2VX7A 3BW2A 5MKGB 4BQ2A 4KBXA 1S5TA 2HRWA 4H41A 4C6NA 1G4EA 5U25A 3S5NA 3SIZA 3FEMA 4R33A 3KOXA 4ES4A 4O1BA 3R25A 1H63A 4JD4A 4QEHA 1N55A 2PCQA 1U33A 3MUY1 1SFJA 3QKZA 3TZFA 1XLAA 2FB3A 1QWKA 3AJ7A 2V6AA 3C5QA 2X41A 3GU2A 1FFQA 2REQA 5D04C 1CBGA 4UTHA 4UQEA 3UPWA 1JZ3A 4INFA 2GOKA 2ZE3A 4CNOA 3CM4A 4FXRA 3USBA 5EFFA 2J74A 1XFCA 2C19A 4QHRA 1E1CA 3ANVA 3GX9A 2G4JA 3GC5A 2ONEA 5FS8A 2DQWA 2PF0A 4JY9A 2WVVB 4MWAC 3T2PA 3GZ3A 1ZBVA 1A0EA 2CU0A 4HJFA 3VO0A 3EOLA 1GRGA 3SRHA 3EX2A 4DI8A 1I2OA 1M9HA 1CYGA 3VGEA 2GVJA 4A8RA 1FWWA 4F2BA 2PBGA 5JCMA 3URAA 1TWSA 4JTGA 2CKSA 3MA8A 1BFNA 3TTOA 3H55A 1FHLA 1MFUA 4GH1A 4HHLA 2Y89A 3OO2A 3S9IA 3NQ7A 4O0KA 1R3WA 4AD5A 5FI8A 2OLSA 2CLLA 2R14A 1FECA 2GQ3A 4AD2A 4NAFB 3SY5A 4O12A 3NQDA 2ZUNA 4NT0A 3GVQA 1A5UA 1V7YA 4HU4A 5TQLA 4L65A 4AWTA 1TPDA 1XSKA 1JCYA 5HJLA 1AODA 1QOPA 1B9BA 2VZSA 4IF2A 3ZT5A 1XBZA 4MDOA 2PDIA 1UWIA 1E0UA 1R87A 1TZ7A 4NAEA 2VGGA 3FGCA 1XYLA 5HINA 3GFZA 3NNTA 4KGLA 4P5UA 1MW0A 1W5NA 2XN2A 1VRXA 2WNZA 1KRCC 2VT0A 4IP7A 5BOFA 3PK7A 2PFHA 2O9RA 2VUYA 3LI0A 1JCNA 2GJNA 1W3IA 4ZSUA 4POCA 1RQEA 1GOOA 3GE7A 5DY3A 2PDNA 4JZ5A 3B8DA 1YMYA 3V36A 3VXGA 1R6WA 2W62A 2GDVA 1ZDLA 3GG0A 2WJZA 2NSOA 4BURA 3SCTA 2YVFA 5FESA 3TYUA 3LXDA 4O10A 3NFUA 3PUGA 2MNRA 3OP2A 5DRCA 2CBUA 2V8ZA 2YZ5A 1R9YA 1VJSA 5MHBA 1V6TA 2BVWA 3WNLA 3ARSA 2ZZ3A 4AF0A 2QCEA 3WMLA 5EGRA 1JI1A 4UFLA 1EBHA 1W9XA 5GJNA 2I16A 2P5NA 2B0MA 3REQB 4O50A 3W7PA 3HJEA 3PNUA 1IT8A 1L6WA 4MY8A 4OOUA 4NZCA 1HNYA 4GABA 1BTCA 1FCBA 2YCIX 3AYRA 3QM3A 3CUZA 1GQJA 5I3FA 4X9SA 3VX1A 1Q6FA 4NNCA 1MRAA 1SJCA 2XVKA 3WLOA 1NJJA 4CQCA 1B3OA 1JXKA 2ACSA 3F4NA 4JNZA 4O8AA 1GVYA 1LRNA 1JYVA 3UZ5A 1WQ5A 3TN6A 1KXTA 4A4AA 2CWXA 3CWHA 4DBSA 1O68A 3BLLA 3EWZA 2VEKA 4GFIA 3APGA 4KEVA 3VOCA 1UKTA 1GTEA 2ZUWA 4XD5A 1T5AA 1JCTA 4UTJA 1N60C 4X2PA 3GY1A 1RBOB 1AQ0A 1B57A 2RDUA 4B3KA 3B9AA 4L4LA 2W27A 4IIBA 4DY1A 3OQEA 3U3HA 2HV5A 1ZCCA 4A8IA 2DJXA 1LUCA 4HA4A 1OK4A 1P6CA 3GTNA 3N6QA 1VBJA 3AISA 4J2MA 3VMOA 1P48A 4HD5A 1UCWA 2GR2A 1WPCA 1WUEA 3OEXA 5D2TA 1I9CB 4NZ1A 1KM0A 2VR2A 2OX1A 4Q33A 2W0UA 1BEUA 4PEEA 3SCUA 2R9RA 3WK2A 3W2LA 1W6TA 4NI3A 1J0IA 1VB9A 3GBEA 2Z1WA 4FX8A 4IIEA 3UWEA 2IPFA 1RVKA 3GG7A 3U7VA 2PWVA 2GR1A 1IIHA 1U30A 4TTUA 4NF7A 3U2OA 2PDMA 3NURA 3RIKA 3VYLA 3H22A 3GU1A 4NJJA 4ROPA 1RBAA 3GLCA 4RR4A 3UT0A 3KP1A 3AZSA 6ALDA 1QNQA 4O0ZA 3E2VA 5KEZA 4UQCA 1QPOA 2ISSA 2XSXA 3WKZA 2ZZ4A 5C54A 1HO1A 3NQFA 1KGXA 1MUCA 4X0NA 3TYDA 4BV6A 2QXWA 3W88A 2QUUA 2QCLA 3CMGA 5JRBA 3A9IA 1AW5A 3OZMA 1C91A 2RDXA 2WKJA 4AVNA 2WKLA 3WUBA 3M6YA 4DJEC 3W1MA 1TE6A 3GAKA 3TC7A 4AZIA 2PTWA 4MDPA 2D3LA 3NDOA 3S2LA 4H1ZA 2BZNA 1E51A 3JRKA 3WD3A 1A4MA 3W6YA 5I0DA 2YQUA 1E72M 3SO7A 2VZOA 1C3FA 1K8YA 2E4TA 3PTQA 3PBUA 1XBYA 4JYDA 4IIDA 2HXUA 1BRLB 3U5UA 3VMNA 3WFLA 4OU1A 1F4AA 1HG3A 3D3FA 4YHGA 4FLSA 1QI4A 3UR8A 2D2JA 4DAIA 4YS1A 2OVLA 1F3EA 3T8QA 1STZA 2BXYA 3ZVIA 1OF8A 4QX4A 4PUWA 1EP2A 3C4UA 4ACZB 2WBAA 4NKCA 1MZHA 1X6LA 2VCBA 3S5YA 2QIWA 2P0OA 1L8PA 5DCEA 1W0MA 1ITUA 3L67A 4H2HA 1DWHM 4M3PA 4PB3A 3VKKA 9RUBA 3S2JA 2WJFA 3LQGA 4GG9A 2YZRA 3BICA 3WMSA 4M6UA 4F0KA 3GG1A 1JAEA 4GACA 1RJQA 4C6QA 1MQRA 3I3EA 4B90A 2XHYA 2OQYA 1CGTA 1Q6OA 2FH6A 3CBWA 5CPQA 3W7OA 2X7VA 4MJZA 1Q8JA 3O7UA 4HHHA 3VIMA 3NQMA 1EZ2A 1SJAA 3ZO9A 4ADWA 4J3TA 5BRBA 4GC4A 2GVLA 3UXKA 3GNRA 3RLVA 1JXJA 4KCTA 2EQ8A 3PSWA 1S46A 1V3MA 1UIPA 1R2RA 1FOBA 1US3A 4JTAA 3BSHA 2Y6ZA 3AMZA 3T81A 4HU3A 1TJ2A 1FH8A 4GINA 3LM3A 1NP0A 3G1AA 3LPPA 4AD3A 3LA4A 2XDFA 2AGKA 3CUIA 2GSHA 3U4AA 5LXXA 1AL8A 4HCDA 2B7OA 1S38A 1G94A 4GC3A 5AYXA 4PFHA 3LG3A 3VKAA 3IUHA 3WF0A 4GKTA 5AHIA 2Y8VA 2PDBA 3XIMA 2HZGA 2IS7A 3N6JA 2Y2WA 5A8OA 5HWMA 4P8VA 4AX7A 2YAUA 6XIMA 7ODCA 3SY8A 3NPUA 4AYGA 4HOXA 1W5PA 5KVIA 4XSMA 4DXXA 2CWNA 3LB8A 1PKYA 4BWLA 2EG6A 1R86A 1HL9A 3FN9A 1M65A 3G24A 1HJQA 5JCLA 3DGHA 3EUB3 3G3MA 4B4HA 3T0TA 4LJ3A 2YYTA 3V0UA 3ID7A 3QPZA 3IACA 2C3CA 4Q7IA 2UY5A 1UA7A 1Z42A 4FR6A 1UW9A 3QXBA 2HPIA 2PC8A 4LY4A 1IE7C 4QCEA 1WZLA 2PAJA 4QROA 3SGGA 3F7JA 1E73M 3R5EA 3BAJA 1GNXA 3TW9A 3S5OA 3A3WA 1W5MA 3EWUA 5IXEA 7XIMA 3KLJA 4K7VA 1TTQA 1Z9AA 3LV5A 2WVSA 2REQB 3O6CA 2J78A 3AWOA 2I5IA 3MW7A 2DIKA 3K13A 4M7SA 1BTMA 3CC1A 4JFUA 1BG9A 2CLEA 4JYEA 5IBXC 1E1CB 2XSAA 1F3XA 2RGLA 5D8WA 2XGIA 4H4RA 3G0XA 3HG3A 1TG7A 4JFWA 2Z26A 1E6XM 4RCXA 5D2YA 3UZJA 3H8AA 3DN5A 4V15A 3WK0A 4NXSA 4QDPA 2GR3A 4FNSA 1JPMA 1ZB5A 3CT2A 3N2XA 1W8GA 1R3YA 3DESA 4A2RA 4NX0A 1GEQA 1R3VA 2ALRA 2FFIA 1WZAA 3NXFA 4WK9A 1TWDA 4J1OA 4YJ5A 5LGXA 4KRZA 3LEPA 3S0CA 1H7XA 4YWIA 1HN1A 1W56A 4QISA 4DLMA 1QNPA 4WLCA 1W9PA 1W9UA 3BLOA 3WNMA 3HFYA 4HPNA 5H8PA 4GNVA 7TIMA 1E6ZA 2NXGA 1F6PA 3ONBA 3CB3A 4ADTA 3TJXA 4D71A 3WQ8A 1TQXA 3CS2A 3ZFHA 4YTSA 2A8XA 2DSWA 1IZKA 3FGCB 4RDZA 3EGJA 4HP5A 1C9DA 4PMVA 5AYIA 4PCPA 2ZXBA 3DG6A 3QMTA 4R27A 5E9AA 5HMFA 3IJQA 4XBSA 3S9YA 2V5DA 2QJMA 5J04A 1E55A 5HMDA 4JN7A 5D9NA 1T99A 4H6KA 2PODA 4ICMA 3O6YX 4MAZA 3GXMA 1YTDA 3EXTA 5KITA 1OQFA 5C9RA 1AL7A 1ZALA 4PUNA 3RNMA 2GWNA 4OZOA 4Q6JA 1F05A 3EA2A 2Q71A 1EGVA 3NQ8A 1H5YA 1ZCOA 1NM9A 1Q8AA 3T55A 3GDMA 3AIQA 1U5JA 2IKJA 1SFLA 4C7DA 1DE5A 2A85A 2OYMA 1ZMDA 3IV3A 1B9ZA 2VGIA 4NL1A 7PTDA 4G1KA 1DIOA 3W73A 5A6TC 1RK6A 3AUJA 4ZE4A 5LNWA 3DECA 2WB5A 1NWUA 2NVAA 1PE1A 1IF2A 1Q3NA 1XLDA 3UCCA 1LVLA 1KFJA 1U1HA 4LGXA 1LWIA 1DWGM 2ZZ1A 1E4NA 3E0FA 1MDLA 1XIJA 1UROA 1NFPA 3OVGA 1ZJHA 3E1F1 1EA9C 1CI1A 1R46A 3IANA 1VJZA 4ATLA 2OZTA 2J9YA 1D8WA 2IQ0A 2OOFA 3LI1A 3NQBA 3DENA 1CCWB 1AG1O 5C8BB 4F4RA 3RR1A 4BEQA 1OG0A 3GDTA 1H5VA 1N61C 4GUHA 4HN4A 1K02A 4C5ZA 3J7HA 2YA0A 2SFPA 1YEYA 1R5YA 4KWSA 5FKYA 3GDBA 5CC3A 3NVDA 3M41A 1S5NA 4MPQA 2JEQA 3W02A 1HGYA 3FAXA 1T41A 1I0DA 3EKGA 1XL9A 3M47A 2E6YA 3E74A 2W3SA 3HTWA 1BWLA 1PYFA 1FWIC 1T8QA 4GI9A 1UD3A 3B8WA 4GXWA 1CDGA 2CZFA 4C6PA 4GXPA 1UD8A 1LQ2A 3NQ6A 4HNCA 1SMDA 3RN6A 3TMLA 4FZIA 1IT0A 1CT5A 1DQWA 2VEPA 1SVDA 3SZ8A 4C6DA 5HUOA 4B5TA 3GTFA 3R0KA 4GD0A 3LLXA 4OGZA 1X6NA 1C92A 1MUWA 3ITCA 3GDLA 1LUCB 4RV3A 3T05A 3KOFA 4AEFA 4JDBA 4Y96A 2WPCA 5BXTA 3S2NA 1TYTA 1PTDA 3VGBA 2PLJA 4LYQA 1RCOB 2EQ9A 3WD0A 1LWHA 3Q94A 2ZRYA 1ADSA 1W1ZA 3ZM8A 4JIIX 4DWDA 2HROA 2R91A 2PGWA 2ZWZA 1JI2A 1ITQA 2IPWA 1A5MC 2YFOA 4H6RA 2EQ7A 1C29A 3BCDA 4XIAA 3TYCA 3BOLA 1VPYA 5AC5A 2Z1KA 3TNBA 4AXKA 1HFBA 1T3QC 3LCFA 5EKYA 3KOZA 1PZ3A 4V1XA 1A3HA 4FEZA 1SW7A 1EJTC 4UTKA 1XQKA 3VIHA 3GTXA 2E5AA 1BVZA 1PCWA 3NOYA 5J8LA 2PGFA 2NLYA 4NYYA 1E4MM 4GNJA 3R0UA 2X0HA 1JGMA 1GVRA 3HGRA 3KHJA 2W4XA 5CSRA 1EXPA 4JYFA 5HJYA 4XBKA 1VBRA 4IP4A 3GK0A 4W88A 1AH3A 3W29A 4TV5A 1BVWA 2PTXA 2R1KA 1I75A 1B4EA 1N2VA 4FLRA 4WKHA 2J9ZA 2WZTA 3DG3A 4JTLA 3FYOA 1WOAA 1YLVA 2FPTA 1GG0A 1VLWA 1QPRA 2JQXA 2OR2A 2DH2A 3AO0A 4DM2A 1GESA 2GJRA 3GH4A 4UTFA 1YNPA 1TPC1 4CD7A 4JY8A 1XWYA 1ELSA 4S3BA 3PM6A 4M6VA 4PTDA 3WD4A 5T91A 3FAWA 1GOMA 1XDLA 4AVOA 3ABQA 1ZZMA 1NVMA 4HYVA 4K6AA 2PDGA 1EOKA 2VNCA 4LANA 4DJFA 3ZQ9A 3WQGA 2CLPA 1UKQA 2OFJA 3CZ8A 4WSKA 1PO9A 1A80A 3CH9A 3LXCA 4JX6A 3LV6A 3FJNA 1KFKA 1UASA 1XYFA 1YBQA 1KFWA 4EPBC 1TRDA 1FHUA 4K7ZA 3MUAA 1Z41A 1UP0A 1QNVA 2WNNA 2PP3A 4UUIA 3A7UA 3MP5A 3N6HA 2BNJA 1WUFA 4P8UA 2CIPA 3UR7A 3MSDA 3GHSA 4PTWA 1XKJA 3BW4A 5I7GA 1XFBA 3OVQA 3QR1A 3HOJA 2D1ZA 4WHBA 3WJXA 3WQPA 3QSRA 3ONCA 2YSWA 4BJHA 2QHAA 1LF1A 3WCZA 2C15A 3QHOA 3EANA 4ROQA 3LM7A 2C18A 1NDYA 3IVSA 2R1MA 1ZAHA 5A6MA 1GRFA 2PDUA 3MKKA 2XN0A 4MWAD 4YVVA 2B4GA 2WC7A 5FACA 5D2VA 2VDIA 3Q4DA 3NL6A 1N62C 4Z1YA 4EMIA 3GNPA 4ECLA 5AYZA 3GVRA 3QGKC 3DKLA 1W3JA 3H21A 3PG6A 1Q6DA 1ZJBA 4PTVA 1JG9A 1WV2A 2D0GA 3VGFA 2VEMA 1RAKA 4W7UA 4IMAA 3H26A 3WNOA 3A9BA 4B5UA 2JK6A 1U83A 4M8UA 3I10A 3NSXA 4J5NA 1AK5A 1TV8A 3CHEA 3QOKA 1WKDA 1Q1WA 4NIRA 4MJ4A 4U28A 3PAJA 3V1HA 3VOJA 2PZ0A 1VEPA 2X8CA 3HMCA 3SCSA 4HKPA 3L66A 4UCGA 5E9XA 3W3OA 3TQKA 4BF5A 1VHNA 3SUTA 1W1YA 4CVWA 1ZUAX 1TIWA 2WMJA 2ZDSA 3MMWA 4BF7A 1EGZA 3DX5A 1QWGA 4IOTA 3LXBA 4NG3A 1H1YA 4UB9A 5FEWA 4K36A 4D6GA 4HN8A 1E15A 1LJYA 2QCDA 3OBAA 3ATYA 4D6HA 5CGTA 1EHNA 2R82A 4DXVA 3UYIA 1MSSA 4HK7A 3W82A 2QCHA 4UNIA 2VM8A 4QSHA 1CB7B 3EWDA 3URHA 2DPEA 1YPFA 1TPFA 4UTLA 4NX5A 3T0CA 1A3WA 2VQTA 4Y6GA 1Y7VA 2ZYFA 2GOUA 4DAFA 3EDFA 2ISWA 4C1KA 4W5ZA 2QDDA 3F2CA 5CJMA 4G7EB 3ITGA 2J6VA 3GNOA 5D9OA 3FV9A 3SIMA 1I2QA 2DDXA 4JQ4A 2HK0A 4KESA 1RPKA 3K1DA 4B2DA 4H8VA 1T96A 4KEMA 4PMJA 3TAOA 7ENLA 4YYCA 5CBIA 1V02A 3I4EA 2G3JA 4KMQA 2XFYA 3OB8A 5TIMA 2VGFA 2WC3A 4ACYA 3SN1A 3W01A 2X1TA 4GVHA 3THDA 4IMCA 1PX4A 2B81A 4O16A 3ITLA 4GGBA 4FP1A 1EP1A 4TU1A 2WP6A 2A0NA 1IXNA 4IISA 1EC9A 1AH4A 1R85A 4Q8VA 3M0HA 1WKEA 2ZZ7A 3E6EA 2G41A 3C0JA 3NZPA 2NV9A 1J4EA 3OC4A 3HA1A 1Q6QA 3THAA 2FLIA 2UV8G 3ECQA 1TCDA 1KFCA 4LF2A 4GYFA 4UNLA 2CZVA 2X1RA 1R7AA 1F76A 2G3MA 2I56A 3MP3A 4C6BA 2OQLA 3HZ3A 2GJPA 1J2BA 3TQPA 1IEVA 3UJRA 1ZK7A 5E93A 3TSMA 3W26A 2BVYA 3FEQA 4L6HA 1LRTA 3QLDA 3NQCA 3S83A 1EWDA 2OMAA 3MWCA 4A3QA 2E8ZA 4DWSD 4QG6A 1E6QM 2VR4A 4UTUA 2AKZA 3BLDA 2Q8ZA 1K8ZA 4ZGYA 4CD4A 3DFOA 3VKBA 5AHNA 4XKYA 3QH2A 5JIPA 2R8WA 3NM1A 4HIBA 3QFBA 3FLUA 1KTNA 2EQDA 1TUXA 1XW8A 3SM0A 1GQIA 2WSYA 1UG6A 2NWSA 1OADA 1LL6A 3M4HA 2QVNA 4LU0A 3GR4A 2YVGA 4L4PA 5D33A 4CQAA 3SQSA 3UWZA 4B5XA 2FZMA 2INFA 1MQQA 4U4MA 5IFTA 1QCWA 2ZQ0A 2QGHA 4KWOA 2PSNA 3DC8A 2W55A 3AOFA 3UERA 4H9VA 5I3DA 4CD5A 3ANYA 5I06A 1V3IA 3CASA 5I79A 1U1UA 4O4VA 2J3NA 3A64A 3LGDA 4AZCA 5GPRA 3AS0A 2HPMA 1TTJA 1ONXA 3WX7A 2RABA 1QNSA 3A22A 3GNDA 3V3WA 3K4WA 4LBUA 2NQJA 1GTHA 3CH0A 1IR2A 3EPMA 5JCIA 3TZNA 3HB9A 2Z4GA 6PTDA 5HUPA 3ARWA 4WOZA 3ZJKA 2ACRA 3W81A 3ARUA 1SUXA 2HSAA 1LP6A 3HPAA 2D22A 3KFTA 4UOQA 5ENLA 4BKNA 3AUOA 4HMEA 4DJED 4CUCA 3WLTA 4L64A 1LOQA 2OU4A 3K8LA 4A3UA 4UCFA 5A1AA 3LOTA 4WSHA 3P8IA 1XCXA 1H50A 2F2HA 4NEVA 1QFEA 1YPIA 3AS1A 5T26A 3LD5A 2DVXA 1A4LA 3C56A 4YL2A 1OFEA 2QT3A 1ZS2A 3S1VA 3U2CA 4S3GA 3ITVA 1GW9A 1JEZA 1H0IA 1UR1A 3FG2P 1DKWA 4JTCA 2GJXA 1EC7A 1S2CA 5G1YA 3WH7A 3KCOA 3A7RA 2A7PA 3VD4A 5LXEA 3I6EA 5G2HA 1Y0EA 4TIMA 2CITA 2X1IA 2C14A 2YXGA 4CQ8A 4LQ1A 4O18A 3EA3A 2ATMA 2PUZA 4X9YA 1CLVA 4Q3MA 3UP8A 4QG9A 1RY0A 4JXCA 3OG3A 3DUGA 4H00A 5FD0A 3CEUA 3MKCA 1E70M 4I8DA 4JIRA 3DHDA 1GEUA 1E0WA 2V38A 3GHTA 3SJ3A 1UZDA 1XDJA 4WD0A 3W6MA 3TLQA 3O06A 5F2IA 3KWXA 3SCVA 1Q7ZA 1VFOA 1NF7A 1VYRA 3WF3A 2BVDA 2IMRA 3WNPA 2XIIA 1MW2A 1WOBA 4WXYA 2I5QA 2FGBA 3NR0A 3STEA 3UXAA 1D3HA 2ZVIA 2X09A 4I5UA 5BU9A 1RQBA 5FJPA 1Q2RA 3RMEA 1KW1A 3W72A 1AQFA 3HW2A 1XJBA 3FY1A 4DHGA 2AOSA 3ES8A 2AGTA 3MANA 3WLRA 1XSJA 3FS2A 3UCQA 3M16A 4DVOA 1VFMA 1ZNNA 3TYBA 1SR0A 4KWWA 4U2ZA 1YADA 2ICSA 2QPSA 3CZKA 3FDKA 1DHPA 1JD9A 1TJRA 5CBBA 1JDCA 4GISA 1XLHA 1FWAC 4H83A 3W23A 2VP8A 1UP3A 2YL9A 4H50A 1KGUA 2VVSA 1LTDA 5EA9A 2XVLA 4M29A 4MMWA 3MT1A 3I6RA 3SRKA 1FWRA 2BY2A 3BK0A 2E9LA 4K7YA 1M04A 4PMXA 4FI4A 3MTWA 4Q32A 1FWDC 1K9DA 2BODX 4M19A 1O6IA 1THFD 4GUIA 4C6MA 4NUWA 1GCYA 2JIWA 1ALDA 2CLFA 2EKGA 3SJNA 3SRDA 2VO5A 3BH4A 3H7UA 4HSOA 2VFDA 4OVXA 3VD3A 1YBQB 1A5BA 3EOOA 4ZOHB 3IIVA 1XRTA 3G0UA 1I45A 4YLWA 3AIVA 2V67A 1E4LA 4DJDC 1MXDA 3FA4A 1R3RA 5HWNA 4MFEA 4WDXA 2FHCA 3CQHA 4K1WA 4U5KA 1WXYA 3UJEA 1J9YA 1HGWA 3HN3A 5HA7A 4EACA 3QZEA 3QYQA 4P7QA 3RCMA 4Z1CA 3CHDA 2P88A 5FEXA 3KOWA 3SSZA 4A2SA 2O4QA 5C2CA 3R79A 4REQA 4C5YA 4Q4RA 4W8AA 3RO8A 1V0MA 2QCCA 1N7KA 2BGNE 4V33A 1L6FA 5ECVA 1Z48A 2R24A 3FNDA 5I3JA 2DSKA 3RCYA 3ZOAA 2J7HA 1E9LA 2D0FA 4GLEA 1KXVA 2CKRA 2PI6A 2OYKA 4JHMA 3WQ5A 1HL8A 2J8GA 1YXCA 4S3FA 2CLIA 2OXNA 2DZTA 4PMNA 4C6EA 1O4UA 3GXTA 5EY5A 4NILA 4HNNA 1SO4A 3GD3A 4PMUA 4OE7A 1QOQA 3UBPC 5DXXA 3H4WA 4IX2A 3CQ0A 4AYSA 1WZKA 5E0KA 3A23A 1F2JA 3W0KA 1ME8A 3UWVA 4IM4A 5DO8A 4LVFA 3L0GA 3KWSA 4DNAA 3SCRA 3UA3A 3R13A 5HPCA 5CPTA 3OYXA 4LEFA 3MV11 5C6MA 4Z17A 3NRZB 1HJUA 4FLQA 4HNVA 2FMNA 1VFSA 4JFVA 4PCFA 3GH7A 3OIHA 2V5CA 2E09A 4LCSA 3DJGX 2V3BA 1EEXA 1TSIA 3NVZB 4XVEA 3CT7A 3S1UA 1N5WC 4L1GA 2NXIA 1KV8A 2VYOA 4HGXA 2Z2UA 4GR1A 1PAMA 3DGZA 1ZL1A 3TN5A 3R6IA 1EHAA 4ZODA 3AMKA 1C8QA 4LBRA 3W38A 4HHMA 2QUVA 2VFIA 4JDYA 3VZZA 3ALGA 4ZOAA 1K4HA 1KRMA 2QCDB 2X99A 3KZPA 1XANA 4Q4MA 5D32A 4F66A 1DXLA 3D5HA 4XZWA 2XH7A 3ZSSA 3ABOA 3L23A 1P5BA 2AAAA 1PKMA 3VM7A 5HBFA 4RDVA 3NS1B 2YX0A 2OB3A 4IJRA 4LAMA 4IQJA 2PWDA 4NEWA 3V0SA 3EEGA 3QOMA 1B31A 3RX4A 3TYZA 3VIFA 5I3IA 1MXSA 4LTSA 1TX2A 3MU7A 4UR8A 1GORA 1W1TA 3JUGA 1GK8A 3G6LA 3O6AA 3K8MA 3QYSA 1CECA 3QGAC 3VE7A 1MO9A 3LLDA 5DMLA 1NDWA 4LIIA 5HK4A 3QFAA 2JKEA 4ZBCA 2XVNA 1E1EA 3W9ZA 2BS9A 2F61A 5K9CA 3MJMA 3FSTA 1CGYA 2OWXA 3GUGA 3WQOA 5I3HA 3AMCA 1AFSA 2HVOA 3OLEA 4AIUA 5I00A 3GRTA 4PSRA 1E9ZB 4GE8A 3TXZA 1KM1A 4IH3A 2E3TA 4YXGA 1EPXA 2J6XA 3GAYA 1K6AA 2V5KA 4LF1A 1LORA 1UUQA 1GEHA 1RH9A 1K9TA 4MWAA 3GDKA 1HIZA 2A3EA 2G50A 2IUZA 5DEZA 2P3EA 1F6YA 2AKMA 2G96A 1O12A 5LA1A 4MF4A 2ABBA 4GIRA 4WJ8A 3S3GA 1UKSA 3WELA 3PS7A 2UWFA 2Z2AA 2WMHA 3LRMA 3TVAA 4KS0A 1E5JA 2OG9A 3QMRA 3A24A 1DWAM 4JIPA 1TE1A 5G2WA 1ISWA 3S2MA 2BOFX 4ZL1A 3DFYA 4Q8OA 4KEZA 3WN6A 1KBJA 3NZRA 3EDJA 3DH7A 4L5ZA 4CKQA 3I7RA 5T9CE 3VIOA 4L1XA 3IJ9A 2NQLA 3MZNA 4LV9A 4ZEPA 1QAPA 4OBTA 2PWGA 1E3XA 4W7WA 1XD0A 1CXKA 4EQXA 5DMNA 1Z3NA 3AXMA 3EKLA 3AIBA 4XQ6A 4BI5A 4YTUA 4DYJA 5IOBA 3MMUA 4PFMA 2VRQA 3W75A 3OVPA 4HPJA 1DJNA 1H7NA 1P0DA 5D9PA 4H4XA 1B0IA 4Q4SA 1RVGA 2DT2A 4Q8PA 1ENUA 4E2DA 3FIGA 5IFPA 1KRBC 1PTGA 2DW7A 5F1UA 2V5JA 4HSHA 1AH0A 3W2KA 1PL9A 1GOKA 2GUYA 3DI0A 1GJPA 2P3ZA 3MHUA 4EVZA 4GZJA 1V3JA 2P50A 3QV7A 1I4NA 4I90A 5C0QA 4ZO6A 3W2NA 1GOWA 4M52A 4R88A 3AYSA 3KVMA 4ZR8A 3SUSA 3TUUA 3B0YA 1JPKA 5BOOA 3KBMA 1S7MA 2OKOA 3MZ2A 3R8RA 3PUEA 3N4AA 4QM1A 1W5OA 1OX5A 3DGRA 3U7BA 3SR6B 3R94A 1BLIA 3A5VA 5CH9A 1YXYA 4AZCB 2XTKA 2EPNA 1LQ0A 3NWRA 8XIAA 2V2CA 5BROA 1S2AA 1UOKA 3O6DA 4E2VA 4H4SA 1PSCA 3VIJA 4MY1A 1ML1A 3BE7A 1M53A 1JDDA 1O7AA 2V3DA 1O5QA 4DF2A 3P62A 1JQVA 3W1QA 3LS9A 5U7SA 5ER0A 4W85A 1TUFA 1UP2A 1GQLA 3LCHA 4H4PA 3EX6A 3O0HA 4UQBA 2WOIA 4O8RA 2PDCA 1JUKA 3SRFA 4O1DA 3LRKA 5KTLA 3VDGA 2F9RA 4W8LA 4D6DA 3DH9A 4GY7A 1D7YA 1UH3A 2FHBA 1H7WA 3TYEA 1XC4A 4Y9NA 3U9IA 2GJXB 4RZBA 3BSMA 4A22A 2ZCGA 4AD0A 1NWSA 5EU9A 5EMKA 2H3DA 4G2DA 2BX7A 3P67A 3W6LA 5A5WA 3E38A 1GV4A 2WSKA 3K4DA 4WQ6A 4XAFA 4UTWC 1VENA 2UBPC 4C6IA 1F07A 1OFOA 3TSDA 3U5YA 3BAYA 4QE1A 2OZ0A 3BGJA 3UG8A 3LYEA 1XG3A 3P14A 1DXIA 3N13A 3SN4A 1P43A 2Y7EA 3NVYB 2ZTJA 3B9EA 1UZ1A 1OC6A 3IGHX 2P76A 2QJNA 1QI3A 3PTMA 4JTQA 3URNA 1DJHA 1E0TA 4I5XA 2DSVA 1MFVA 3KE0A 4LVDA 4X61A 3WQCA 2YCJA 3ARQA 4JNMA 3WO8A 3V5FA 2V2HA 3GXIA 4HA1A 3ZS4A 5GNXA 3DU0A 2NV1A 1UB3A 3KTSA 2NX1A 3CWNA 2PS2A 3VZYA 1W3TA 1K8XA 4AZGA 1TREA 3W87A 1JD7A 5A6JA 4NRSA 3FX4A 3LCWA 3AHVA 1HO4A 5G4HC 3W1AA 1TZ9A 4J57A 2J25A 3A6OA 4YNGA 4XO6A 1OIMA 1FBAA 1MW3A 1KWGA 5H91A 5IHRA 4TXEA 2VC7A 5LA0A 3BLFA 2CHRA 2B7PA 4PB5A 4CCEA 4WJEA 3W76A 3VDAA 1VP5A 3W7GA 2XN1A 3LHZA 2EJAA 5EBKA 3UPBA 1O5RA 2YVJA 4UFIA 1HKMA 2BWGA 4PRRA 2E6FA 5FJOA 1K7FA 2VD9A 3NEVA 2VI0A 1R3SA 2QYGA 4JFTA 2VVNA 1X7FA 3AIWA 1M01A 2NW0A 2V68A 2W61A 3IPWA 4GI4A 3FA5A 1RM6B 2PP1A 4DZ5A 4ZQCA 5AC4A 4JKLA 3KL0A 3QV8A 4ATDA 3EB4A 4ZO9A 1AZ2A 1XGZA 3KBSA 2POTA 2V5BA 3MO7A 2OZ8A 3ZZ1A 4DJEA 1DQUA 1V6YA 3W7LA 4KKXA 3BLKA 8XIMA 1Q6CA 1KM4A 3LB0A 4EXAA 3SY1A 4YCOA 4IMEA 4R9OA 1EUNA 3BG5A 4PC8A 2HCVA 2YLAA 4RZ6A 1MEIA 3W7HA 3T40A 1NOWA 3W71A 1QHOA 4UR7A 1BD0A 3TFCA 3H54A 1ESWA 2ZX8A 1LWJA 1LOLA 4REQB 1XIGA 3HPZA 1OC7A 3LHTA 2LLEA 2BDQA 2O7QA 4GJJA 3URQA 5AZ1A 4XX6A 3UGRA 4EPEC 1BGGA 1UMYA 1UQZA 1QDSA 2J88A 3NUKA 1X97A 1TVPA 4CGTA 3GVWA 4LV4A 1JEHA 1V0LA 3HFTA 1DJQA 2NUWA 1Q7QA 1HKKA 3UG5A 3GXFA 5F4WA 4ML9A 3S6OA 1ZY8A 1KM5A 3DFTA 4QXIA 4D8AA 3NVWB 5CJNA 5CJ5A 2OO0A 5H6HA 5CZ0A 5M2FX 1M7PA 2FGZA 5AZ0A 4KF1A 1NDAA 4IUGA 1DHKA 4YPJA 4MB1A 4RNFA 3M5VA 1HUVA 4CQ9A 2G37A 5ABHA 1OD8A 3PZTA 2OPJA 3PBGA 1LT7A 1QMLA 3W7MA 3RDKA 1DJXA 2GQ8A 1H09A 1XGEA 5BRQA 4EXBA 1XISA 2XZ9A 1XQLA 4EKJA 3TKFA 3ZR4A 1BF6A 2PCEA 2O9OA 1DXFA 3WD1A 3I3DA 4Z1AA 5FJJA 3N4FA 1IGWA 2BOGX 2QGYA 4IJBA 4YYFA 4Z0SA 4JBRA 1AMKA 1JFHA 1CW2A 3SCWA 3E02A 1IGSA 2WHKA 3CIWA 5DLCA 5HR7A 1YQZA 3P61A 2WPFA 3MI6A 1R3TA 1O94A 5DCBA 1PUDA 4EQRA 4NZJA 3S8HA 2EAWA 4K39A 4IPJA 4C6JA 2YL8A 3VGHA 4N4PA 3OZYA 3OBKA 3AMDA 3EWXA 3DFHA 4FNPA 3HGOA 3ICJA 1OJTA 4CCDA 5BNKA 3UF9A 2R1LA 3C86A 2Y85A 3CAVA 1OYCA 1GRAA 3CEPA 5JH1A 1UR2A 5I6SA 3N9KA 2HE5A 2DUAA 1J5SA 4EK7A 5DMYA 5JCKA 4IMFA 3S6TA 3WK1A 3REQA 2CESA 1Z6KA 1Z44A 3VNJA 4LX4A 1VIZA 5CSUA 2VMFA 3EWYA 4AHQA 1GREA 2X2GA 3UYCA 3CIXA 2VCCA 1BYCA 2D2HA 2WYSA 3OYZA 1FHDA 1V08A 4H7ZA 2ZZ0A 2O55A 3W27A 5LNVA 1TELA 4RX0A 2PMQA 4DNHA 1J8VA 1OFAA 1OGBA 1OX6A 1NARA 1UWRA 4BZYA 5AHFA 1FDYA 4QAWA 4XAZA 1GRHA 4KPRA 4B16A 5IBXA 3QQWA 4DO6A 4H6QA 1CGWA 1ZP4A 3EOEA 1L6YA 4LYKA 3BQ5A 2A3CA 2DUZA 3IGXA 3WEOA 2YYUA 5C9XA 8TIMA 1JOAA 4HA3A 4N0RA 3HG4A 5GJMA 5AOUA 2GR0A 1D7KA 3HPSA 4WOQA 1H6VA 3STPA 1RY8A 3WJSA 1UD4A 1M7JA 1E40A 3KRZA 3T0DA 3UZYA 3MMDA 1EO5A 2BLEA 4W9TA 3DIPA 3GNXA 2XIQA 1CGUA 1CZ1A 2YL6A 4GUGA 3OTRA 4H2CA 2CDUA 5U1OA 4D8LA 1UJQA 1I0BA 1OX4A 3AYTA 4KWUA 5BMWA 1QPQA 1JGIA 3C61A 3GKFA 4GX8A 1AQHA 3AYVA 5G4WA 3VNDA 1JZ4A 4HA0A 3LHWA 1P1MA 1VJIA 2MUCA 2V30A 3T2OA 4JNYA 4NASA 3VNKA 3GVVA 5G1TA 1EPVA 2ZE0A 1OYAA 3UNTA 3BZGA 3Q2DA 1P4CA 3HQNA 5PTDA 2BVTA 1MWOA 1H0GA 4NYUA 3ARYA 2ESCA 2A21A 2D0HA 3UESA 1VLIA 5EBAA 5HPOA 3U57A 4A8NA 4GA8A 1FDJA 5LNRA 2YOCA 3CL7A 1DV7A 3W07A 3CTTA 1CNVA 1QI5A 4NSBA 4U33A 3LBCA 1T6MA 3SUUA 1OCQA 4AWEA 1NDVA 3S5SA 4J56A 3LGEA 3FKKA 2WZEA 4JAWA 4EAMA 3PBYA 4PYSA 3F4CA 3MBDA 2HQMA 3L0NA 3TONA 2IPJA 4UMCA 4PMQA 3S2CA 1XBVA 1UD6A 4GGHA 3VUSA 1GSNA 4L7ZA 1NOUA 3L4UA 3VTRA 1W3KA 4G6CA 4TVWA 2I1OA 4QLKA 2DUXA 4E3VA 1ZBCA 2ZA2A 1GPWA 1XLFA 4HNUA 3F1QA 1LG1A 2BC1A 1GKQA 2WJEA 4FX9A 3CV6A 4ALDA 1YDYA 1OGGA 4FMVA 2PU1A 4EIVA 1YDVA 2CNCA 3DGBA 2QAPA 2PDPA 3HV8A 2FZNA 1P6BA 4IL2A 4GYJA 5I2UA 3SSJA 4HMCA 3BJFA 2ANUA 5A6KA 1LLOA 2J24A 3NL5A 3C8NA 1FCVA 4PRWA 4PTNA 3EB3A 1KCKA 2EPKX 4GMEA 1UBPC 4QNWA 4B15A 3P5ZA 1UJPA 5FEZA 1NELA 1TRIA 3OJGA 3PHAA 2WXDM 3SI9A 4R53A 4ZA0A 1A5SA 5AC6A 3I6TA 1KBLA 5ABFB 5I3GA 1A0CA 4J2PA 2WV8A 4N9DA 4QNEA 1VFUA 3R8HA 1RHCA 3VK5A 2FJUB 3RU6A 3A4WA 4IMDA 4L9ZA 4JICA 2NXHA 4DZAA 1UOZA 2WVTA 3B8UA 1KM6A 3N2BA 4LVAA 3APYA 3W1RA 2A3AA 3RAOA 1TB3A 2YFNA 2XM2A 4IT1A 3UU0A 4N6EA 3CHFA 3ZIZA 4DZIA 1ZMCA 4PCTA 1TV7A 3F4VA 4I5RA 1CPUA 1ZBWA 1BXBA 4DI9A 1NY1A 4HOWA 4IJCA 3XINA 3UXLA 1H49A 3ZXWA 3H7RA 3W1UA 1HJXA 4DJDD 2I17A 4JTUA 4D72A 3CL6A 2QULA 2PURA 4E0CA 1EQCA 5L6UA 5TNVA 1FDZA 4IGHA 3N14A 1EF3A 3RPDA 1FWSA 3THQA 1XKYA 5EMLA 4M1BA 4FA3A 3H7VA 3CO4A 4JFSA 3KOYA 1VD6A 4UTTC 1RD6A 5G5GB 2GVEA 5LIYX 3LUTA 3ZLHA 4LB3A 1S2WA 4UC5A 3N9SA 2OELA 4H9XA 1U5VA 3GD4A 4RE4A 4C6OA 4GHRA 1QASA 5AHMA 3OW1A 4MG4A 1JNDA 2EEXA 1CGVA 3BOXA 5RUBA 3VI2A 1C7SA 2DY3A 5KZMA 1TR1A 4TX9A 3C3UA 1W3LA 4J3VA 1MI3A 1VR6A 1VYSX 4UR9A 1TPWA 3DZ1A 1H61A 1FWNA 4X22A 2YDSA 3L21A 2CBVA 3O8AA 4XTDA 4BEUA 2A7RA 2W54A 4X0VA 4QJ3B 1VCGA 1IIGA 1Q6EA 2CBJA 1PV8A 2NX9A 2HE8A 3EX4A 2ZX6A 4PMOA 3V5OA 3MUCA 4GVIA 3AXKA 3WLPA 1HT6A 3O9NA 3EB2A 3B05A 3V4BA 2TPSA 1RJRA 4KRTA 3UY8A 1OK6A 4IGMA 1A5AA 1GKPA 3FK4A 2WZMA 4Q8NA 1WBHA 3EX3A 2ALDA 4ZE5A 3G2GA 5JVLA 4I3GA 4PODA 1AVAA 4WY0A 1QU4A 3DAQA 3G1SA 3ZLFA 5KETA 1VS1A 4M24A 4MKNA 3RNDA 3LDVA 4FX7A 1PXGA 5L9FA 3H2AA 4LA1A 3WLKX 3R1ZA 3N2OA 3C2OA 3VNZA 3QF0A 3TC6A 4J3UA 4PUDA 3MVIA 4E2OA 2DH3A 3VKCA 4HK5A 3PPHA 4BR1A 2ZRWA 2G8ZA 4PBEA 5BXRA 2QUTA 3SGZA 3UEQA 1JRPA 2HMCA 2W3RA 1WDDA 2PRMA 5LIXX 1ZKQA 4Z08A 4F0RA 1YDNA 2D20A 3ITYA 1FWEC 3QLLA 3WUEA 3SB0A 4PB4A 3AICA 3AWNA 2RGMA 3M5XA 5DT5A 3EPOA 4JL2A 2DEPA 3IK4A 3V7PA 2F7FA 4N2YA 5DY2A 3E2SA 4IIFA 5I78A 1OVDA 1A5OC 2D3NA 3GO2A 3W24A 1UD2A 4GH3A 1G6CA 1Q63A 1W5QA 3TOYA 4H4YA 4DX3A 3N9RA 1E6RA 2ACQA 4AFYA 1B54A 2UY4A 1XC6A 3RF9A 1UC5A 2E1DA 2ZUMA 5BXPA 3TWAA 4WKFA 3TR2A 3PZMA 2GVYA 2PP0A 4Z2KA 3QHNA 2XG9A 1H7PA 3G22A 2X8HA 1DIDA 2E9BA 6XIAA 2DZSA 2FPYA 3ABZA 2OLAA 4D9PA 4TX6A 2AQVA 3PB2A 2DZWA 2OZ3A 1W37A 4MJ2A 1Q6LA 2V81A 5GNYA 5M03A 3BVJA 3D46A 4S38A 4GCAA 5HQLA 5JBDA 1UHVA 1V51A 3E3HA 4LAZA 3E2QA 3DERA 3T78A 3BWWA 2GQAA 3IUDA 3MBFA 3VAVA 5FAGA 3ANUA 4QAIA 1N8IA 1D2KA 2VDGA 5CC7A 4JPGA 2X42A 1BKHA 2BG5A 3QFEA 4GZ7A 4AC7C 3A7AA 3CO8A 3L12A 4EF8A 2WOVA 4ZFCA 1EEPA 3VINA 1TV3A 3E2RA 3P60A 4CNTA 3RGTA 2CFYA 1YKWA 4G5DA 1PZ0A 1I60A 1ZPTA 1RP8A 3CWOX 2FZ8A 4KIRA 4E8DA 1BYDA 3LCGA 1GQNA 1FO4A 4DO5A 2VEFA 3GTIA 2VX5A 4XZMX 5AVNA 3OA5A 3ORWA 5BXSA 2VWSA 2VUNA 2VC9A 2GUUA 4O1AA 1T7LA 3LSBA 1HQTA 4BY3A 3OHMB 2Y7DA 4XZNX 2WSQA 3OHIA 4IIHA 1I2RA 4JTJA 1HJSA 4MLJA 2XGZA 4OUEA 1MNZA 1UH2A 4B4FA 1GYMA 5F1VA 1E3ZA 3L2MA 3T08A 4D2JA 1D8CA 2W67A 1UC4A 2WKGA 4QLJA 1XHCA 2Y63A 3FXYA 3PC0A 1XRVA 2F6XA 5K9XA 3W7NA 4RE3A 4NJHA 4LCQA 3BQ6A 3SGUA 4DJFD 1S5WA 4HTBA 1UD5A 1LL4A 2GGHA 2DVTA 4S3DA 3OBEA 1C9WA 3WH9A 5GNZA 1VCVA 3NIYA 1XPYA 2AL2A 5IRPA 2EJ1A 3ZWTA 4G9PA 1OD0A 4E8GA 1HKVA 1GVIA 1QO2A 2HNEA 4B5VA 4B5WA 3ARRA 2EPHA 1J12A 1MO0A 3OA3A 3VNMA 3THCA 1SZFA 5LIUX 2DFAA 3P3BA 5LZLA 1O5KA 4Z1BA 2F5ZA 1BXCA 5CAKA 3IARA 5LA2A 3CGEA 1OABA 1YNYA 3GBDA 2Q3OA 4IIGA 4IFOA 3SEPA 4X60A 3H6OA 3A12A 3EWCA 5EB8A 4MNLA 3P6LA 1KBIA 3M0ZA 1QPNA 1VH7A 4H8HA 4N6FA 1OX4B 5JU6A 3R07C 1E6NA 3CL8A 4QDWA 2XIBA 3L2IA 1UQYA 2BASA 5BMXA 3ZJ8A 4JTSA 4Q8QA 1PWMA 2XVGA 2R1PA 1UWAA 4I9JA 1F6KA 5A8GA 2X0YA 4BI7A 4ERGA 3PANA 3NZ1A 5CZKA 2WCAA 3BOFA 3G8EA 3DK4A 1J0JA 1TVLA 4BCEA 2VELA 1LCOA 1AQMA 4ZB0A 2J75A 3H4GA 3FKRA 1XR2A 1G4TA 3Q67A 3TH6A 5AHEA 2Z00A 2ZFAA 4S3KA 5CGMA 3M0MA 4LFYA 5CPLA 1SB3B 2QVHA 1DOSA 1KCZA 1N63C 2VC6A 4FO4A 1TPVA 4C65A 2WCSA 4AH7A 4E5TA 3P93A 2XIJA 2B31A 4A6GA 5C70A 6REQA 2JGYA 3G1DA 3S47A 4KW2A 5TR3A 4MGGA 1K4QA 3H2EA 4UTMA 1Q5MA 4RDYA 3K2GA 4RPPA 4RKAA 3UXDA 1FIQB 3E0WA 4XO7A 4BI6A 4AQLA 1Y5XA 1SO5A 2ODOA 2PD5A 3HGSA 1GG1A 5CKSA 4S2CA 5DBUA 4A3RA 4QDMA 3MSRA 4M6PA 1BQCA 3M64A 3FXGA 1P0KA 3T09A 4F3HA 3B8TA 3N17A 2TSYA 3VFCA 3GH5A 1KGWA 1W32A 1SZRA 3G5EA 1LG2A 4P7LA 1BXNA 3DYOA 1F8IA 5FF2A 3NO3A 2XIMA 3VA8A 4GQGA 4HPHA 1M3UA 2R94A 2OJPA 3P2VA 2VZUA 3U4FA 4MB5A 3PZ9A 4XVDA 4H6EA 4DNMA 2OSYA 5CPMA 4WX2A 3H2CA 1VRDA 5C7HA 2CHOA 4NQ1A 4F0MA 4ZB5A 3IK2A 4JTIA 4DLFA 4V27A 4Z2GA 1YX1A 1XH1A 2VGBA 4XZIA 3GW3A 4P2VA 4B2DD 3CUFA 2YBTA 2Y7GA 5G5IA 5I07A 3LTSA 3BGGA 5KMYA 3UWQA 3RLHA 4H8NA 5CEWA 2QS8A 3GIYA 1V4YA 3KLLA 3C2FA 3TW7A 3V18A 1P0BA 3K1GA 3MVTA 4XBJA 2BCPA 2ZTKA 4NZFA 6A3HA 4G7FA 2WOQA 1ME7A 3T07A 2J8FA 2A6LA 1XYZA 1KFLA 4PTXA 1DXEA 3IWPA 3LLFA 4A8LA 1XIFA 3R89A 2QR6A 4HMDA 1I6NA 3WENA 3U2EA 4Z42C 4GBDA 2ZC8A 3XISA 1XGDA 3W28A 2VD8A 5F4XA 4JTFA 2HS6A 4C6FA 1OJXA 1XP3A 1OT1A 1FFUC 1UUMA 1EIXA 2WBGA 1GETA 3JW7A 4J9JA 2NUYA 4W89A 2E6DA 3AIUA 1K7XA 1LBFA 4GQQA 4AVFA 3VCRA 3YPIA 3QR0A 5F2LA 2H6RA 1IEWA 3QW4B 2ZRZA 3W00A 1NOFA 3OZOA 3R10A 4ONVA 1BKSA 2NQ5A 3T0AA 1S1RA 4GYKA 2GL5A 3HURA 2Q09A 3W84A 4G1NA 3W7CA 3GXDA 5D2WA 1XD1A 1Q6RA 2JALA 1XLBA 5SWUA 3WH8A 2OT0A 1QUMA 1RR2A 2GK1A 3M44A 2ZZ6A 3NO1A 4RZ4A 2W6RA 4RNHA 4GOAA 3DHFA 4RV8A 5TF0A 3SR7A 1M6JA 3M9YA 1G7VA 3OIXA 4KIEA 4FOUA 2GGGA 4O1CA 1TWZA 1NF0A 1YQ2A 5HXMA 2QW5A 4X63A 1JZ5A 4EAYA 3GUWA 2E28A 4UQ9A 4QRNA 3MHGA 1GJWA 4KERA 1KR0A 3PJXA 1KKOA 5FAJA 1WO2A 3CZGA 3GB6A 4NHVA 1H11A 4L61A 4WY0B 1ZAJA 4NNBA 1QXLA 4QFUA 3E96A 1IHIA 1CXIA 5AY7A 1J6OA 2DSZA 1BGAA 3CV1A 3OLIA 3TWBA 1FEBA 1FWJC 2PDFA 3KLKA 5IDZA 4G7EA 3MSYA 1XS2A 3TSBA 2GQWA 4MYXA 5CXPA 1P6WA 3GC4A 3FJLA 1QHPA 3C0SA 1OFRA 3SN0A 4DRSA 1BYBA 3KRBA 3CZEA 3DFQA 3VKJA 2X30A 5E0CA 5M3WA 1OIFA 3PPGA 4OBRA 2DP3A 5DXYA 2ADAA 3DHUA 4MFDA 3LZ5A 5CC6A 3LBOA 1P0EA 4HPGA 1GONA 1IZJA 2BV9A 4DJDA 2GDQA 1EDQA 4YVPA 3L5OA 4QG8A 1SZEA 2FZ9A 5D38A 1QT1A 4LCRA 1GVEA 1K03A 3VUPA 4WDUA 1FCQA 4TV6A 3WZ0E 4AC1X 2Q6ZA 4QLLA 4FIQA 3CGBA 4P7OA 5KVHA 1OF6A 1PDZA 1TX0A 1KTBA 3CGTA 3EZ4A 3FA3A 2RDWA 3QHMA 3TCEA 1Q1RA 5EBUA 3N18A 3QW3A 1X6UA 1YPXA 4YMZA 4YU1A 3CIVA 3VFLA 4MNMA 3AS2A 5CC5A 3ENLA 5IM51 2OCZA 3CQIA 4RLIA 4ZOEA 4UWMA 3FJ4A 5E0FA 3N2CA 4I7UA 1C93A 1W1A1 4FNQA 3QC0A 5REQA 1GOIA 1KTCA 1S3TC 1ONFA 4YWSA 4WUIA 1H4PA 4DO7A 1PZ1A 3A3HA 1V7AA 3W53A 3IIOA 4ZTXA 4IPNB 4W4QA 4DBEA 2WP5A 3KBNA 3GDRA 4A3YA 2F6UA 3BARA 3STCA 4LVBA 2BXVA 4GY0A 3IIXA 3KDNA 1ZX9A 3ZMRA 4FPSA 2CYGA 2P8CA 1E9IA 1HZYA 3L8KA 1QVBA 1BYAA 2X1UA 3WQDA 4IXXA 3LMYA 4F9JA 4KQNA 3T4WA 4M80A 4L56A 3UFYA 3IRSA 4OTKA 2NQHA 4H8UA 1WAWA 4L9XA 1EP3A 1PDYA 3VE9A 2ZIDA 1VDVA 2VX4A 3MMTA 1FTXA 1N5XA 1JROA 3FYPA 3N29A 1OCJA 3E0LA 3H53A 3NXLA 4D6JA 3UQNA 4ML4A 4H04A 3GIPA 3BDKA 2E3ZA 1HP4A 1ZY9A 2WJDA 3CUHA 3WBEA 4YVXA 1F61A 4HHPA 1LT8A 4RW5A 3U48A 3TXVA 4HU0A 4K68A 3QEZA 4UOZA 2PDQA 1FH7A 1E0XA 3D47A 3M07A 2OEMA 5A2BA 3SFWA 1NSJA 3CAKA 3CUXA 5E1QA 2ZRVA 1AOGA 3USZA 4EOUA 2C1HA 2W79A 2DZPA 1ECQA 1JCLA 1QK0A 1UR3M 3O16A 2AL2B 3QGVA 5HULA 2QCFA 5M5DA 1FVPA 4AZBA 4OIFA 4WR3A 4AHOA 4BQ3A 1RSCA 4N42A 3RPMA 2EG7A 1TMHA 1CIUA 2XWEA 4O53A 4X3ZA 4DUOA 2EG8A 2EGZA 4TVUA 3SQMA 3HJZA 4DF0A 2FGLA 1ICSA 3R11A 1V8EA 3MYOA 4OUIA 3S42A 3PZUA 3TAKA 3PZNA 1K70A 3CLWA 3FVMA 3EDDA 3WDHA 3EWWA 3V0TA 1CLXA 4W93A 3UG3A 4GO9A 2DZXA 5K4ZA 1ZSXA 1XHGA 4ZOCA 4D6IA 4B3ZA 2DU2A 5AECA 5A8PA 3ITTA 2WZIA 4L4MA 3H70A 2ZWYA 1EFZA 2ATSA 2J7CA 5XIMA 2YJQA 4FK9A 2A6NA 3HM7A 1PIGA 2CLHA 3P7YA 3FFSA 2ZXDA 2OSWA 4DF1A 4JX4A 3A47A 4QITA 3BMXA 2VOMA 1DJZA 3AHTA 2Z29A 3C2EA 4EWND 4W5UA 4LT9A 3E0IA 2H3BA 3PJWA 4HZ7A 4Y9PA 4K38A 1K77A 1XINA 1CXHA 5C9WA 2EBNA 1XBXA 3NZGA 1DWFM 4GWEA 3PJUA 1A0DA 2O92A 2C0AA 1FFVC 1D3CA 3BAWA 3RU8X 5ABEA 4QQ3A 4V1YA 1M68A 1IWBA 1XUUA 1IWAA 6REQB 1PYMA 2NUXA 3AU2A 4RNIA 4PMRA 4N9BA 1ZLPA 3A5FA 1DWIM 4Z2IA 5CPOA 2D69A 4R7JA 3WQFA 1GWJA 2YCKX 3RXZA 4TQTA 3PG8A 1H51A 5TAOA 5HJXA 1F73A 5DT7A 3KRUA 1FUYA 1QNRA 3NQGA 4DB7A 5M17A 1H7OA 1R8LA 3BCFA 4UMAA 3VOFA 1F3TA 3N73A 3GW0A 3EMQA 4BFAA 1ITXA 4F48A 4QCFA 3TU9A 1TPUA 3TP4A 4TX8A 3VD7A 2CPUA 1I8JA 1XIBA 4LS1A 3SW6A 1EBDA 1SYTA 3AS3A 1PB0A 3EXSA 1JQXA 2RH9A 5I02A 4TVYA 1IEXA 2VR5A 2Q02A 5C9UA 3UXIA 4AD1A 3GVGA 3ITXA 2QDGA 3WL0A 2Y24A 2WQPA 1KNWA 1JF5A 1X98A 3S9ZA 4AIOA 4Q6XA 2DGAA 2VFEA 1ICPA 4GQ0A 2QIIA 3K46A 4R9XA 3NL2A 4HQVA 1K9EA 5BCAA 1V3HA 1PEZA 2FDMA 1FKWA 4LS2A 2TAAA 1OCNA 1M1BA 3DFPA 1CXLA 2P10A 5ABGA 5KZ6A 2C6QA 4NU7A 1V0KA 4MNJA 3MB9A 1RUSA 1X1ZA 5FEPA 1EZWA 2ZADA 4XTIA 3PUOA 2J13A 4ORMA 5DELA 3MCMA 1JRBA 1O66A 3A21A 4LW7A 2DIJA 4KCVA 4LUYA 2V63A 3SAZA 2C71A 3M0IA 3E9AA 3VDHA 2OWWA 2YA2A 3VCCA 4TVCA 5C5YA 3PJTA 3EF6A 1BVNP 1UWUA 4JX5A 1OHLA 4NZ4A 2ZC1A 1VFFA 2H8XA 1HP5A 3KXQA 3TA6A 2FB2A 4A3HA 2WLYA 1GXFA 4ZSTA 3C0QA 4UTWA 4MOZA 1JNEA 1UWSA 5E6ZA 1W91A 4GVGA 2NT1A 1V93A 1BSIA 4E38A 5I77A 4WRHA 3DK8A 1W1IE 3WLLA 4DYKA 2POZA 1V3KA 4G56A 4Q8TA 2OWCA 4CNNA 1OZQA 4JQ2A 1BHGA 2C1IA 4HU8A 4H3DA 3GU9A 3B9NA 2QNEA 3I68A 5A95A 1EH9A 3K4AA 4DEFA 2EXOA 4FOJA 3WJWA 3RJXA 1SSGA 2GK1B 1YE4A 3NJ3A 2CW6A 4IG2A 1HL2A 4TO8A 2TYSA 4B91A 2D24A 2P1FA 1QNOA 2NLIA 4IX0A 5DN1A 1G7UA 1XM3A 1EQPA 3G1FA 2QJHA 1S3HA 1BWVA 3LN3A 1FWBC 2Q8LA 3CZJA 1Q13A 2DT3A 3DFSA 5MF5A 5E70A 4H7CA 3CMFA 1M6IA 1R47A 3TC3A 4JKKA 1DE6A 1IYXA 2Y0FA 4M5PA 1FWGC 4YN5A 1DYSA 2DW6A 1C90A 4JN6A 2GGJA 1WNOA 1GZ1A 4Q8MA 3P0WA 5D09A 3LERA 1RK5A 4R85A 1A47A 1WB0A 1R2SA 4D6EA 2BMBA 3M0KA 3AZRA 4OV9A 4PL1A 2XH2A 4V28A 1JR1A 1VZWA 1VYPX 3BSGA 1B3XA 3P0XA 1D3GA 2VZTA 3NQEA 4IMGA 2YLLA 1GJUA 3QN3A 3FHAA 2JK2A 2V3GA 5AYYA 5DFAA 1NHRA 3BMVA 5BZAA 4GIYA 4IWWA 1PKLA 2DZBA 4PUEA 2G3IA 3W86A 2X7WA 3M6DA 2FTWA 2QDEA 4J40A 1HJWA 3E5PA 4EPDC 1JULA 2W3ZA 4IL0A 4XD3A 3MS8A 3LK6A 3H2MA 4I9MA 3MYPA 4GJIA 5EMJA 2HJPA 3B9OA 3E5BA 2DIEA 2WLZA 1SW0A 2A3HA 3M1ZA 2QMJA 3PVFA 1UWQA 1ODUA 3WSUA 3NG3A 2VXNA 1FH9A 3DBPA 2BXZA 5FF3A 3B9DA 1EO7A 4C90A 3EOUA 5DBTA 5HDRA 3TE9A 3BJTA 2NVCA 3R43A 4Q7BA 2IXUA 5FIPA 4APNA 4O1FA 2ZVRA 3F5LA 2TPRA 1RZMA 1W2VA 1MW1A 3QBUA 1Q85A 4LRTA 4UQAA 1A50A 5AVHA 1YIXA 1F9CA 2AQOA 1MDRA 3QQ1A 4AG0A 2WQDA 4Z0JA 4WGXA 1LOSA 1MNSA 3MUIA 1EC8A 3T42A 2Z24A 2VL4A 1XYBA 1SZGA 5REQB 3WYZA 2CLMA 2UY3A 4HT3A 2JIEA 1RLCL 2AL1A 4J3SA 1NQKA 4CU7A 1OSEA 1PIFA 2DT0A 3RRAA 3IGUA 3AC0A 4MZYA 4RNJA 1DTNA 1SFTA 4HSNA 1NPXA 1Y5VA 2FZDA 3CGDA 1JUEA 1QK2A 3UY7A 4FF5A 2DZUA 2C7FA 2QCNA 3MJYA 2Z1VA 1OBAA 4E4PA 2W63A 5EMMA 1VHCA 1ONWA 3PPCA 4DWSC 4I6KA 4F0HA 3MDUA 1LDCA 2XFRA 3F4WA 1LQAA 3BAIA 1M41A 1T0OA 1VPQA 3AXHA 2PE4A 2JGQA 3M7WA 2W9MA 1TYGA 3PWGA 1KLZA 1W1B1 4KFPA 1RQHA 2Z27A 3N34A 3W7RA 3BV7A 3G18A 1KA9F 4X2RA 3AJXA 3CXBA 1GYLA 4LSBA 3QJAA 4XZHA 5FJUA 1EF2A 4ADUA 2BHZA 1A5CA 1FEAA 1EIBA 4Y8FA 5JBEA 1SR9A 1XUZA 2X0SA 5LHFA 5FOOA 1RLDA 1TR9A 2GZXA 4EMWA 2QQ6A 3QSTA 2H90A 3HQOA 2Y88A 3T4CA 3V1PA 5A6LA 4TMCA 5CAHA 4PUKA 1XCFA 2VX6A 1POJA 1V6VA 4ENLA 1LBLA 1KWKA 1FY6A 3LU2A 4O4WA 3W7JA 3BLIA 1TPEA 3WF4A 1V77A 3GIQA 1SSDA 1GZJA 1J0KA 4FXFA 2INZA 5B7ZA 3WBYA 2B7NA 4HNLA 3TTSA 4LYPA 2A79A 2A3LA 3L9CA 4B9ZA 3DDMA 3ZR5A 5G4EA 2CHNA 3KVLA 3RG6A 5DMMA 3O1NA 3S4TA 1TMLA 4HK6A 3H24A 1PWLA 2RHGA 3NM3A 2PC4A 4WDTA 1HXJA 4XAYA 1EJVC 2J7EA 3GFYA 2J77A 1JCMP 1A53A 3NSNA 2W5FA 4CNSA 1JZ6A 3GD6A 3M0VA 4GFSA 3WQ4A 1JZ8A 2PA6A 4LC6A 3G77A 4NY2A 4BQ5A 4AWSA 3APTA 3CTLA 3U6WA 1NP2A 3EBVA 4IQEA 2VRJA 5JUVA 3BXWA 3KVKA 4KT2A 3VD5A 4R7OA 2PDXA 5FS7A 2PDWA 5K3VA 3H4KA 3CPUA 4FNTA 5AC7A 1JZ7A 1VGAA 2Q8XA 4C7GA 3W1TA 1ME9A 2XYLA 4L4OA 3H12A 4J4KA 1DEDA 2NVKX 3TQ0A 4GRTA 2EHHA 1UMLA 2E6AA 5CLWA 1QI2A 4AAJA 7A3HA 1JYWA 3UR5A 3L5AA 4FNUA 1Z7AA 3G0SA 3CMJA 4FXSA 4PE8A 3AMLA 3GS6A 2G4FA 3N4EA 5A6AA 1ICQA 2I9EA 4H9TA 4C1LA 4ERAA 2J47A 2YDAA 4W8BA 3SBFA 4K1GA 4DPQA 2OEJA 5U4NA 1LROA 3AHYA 4H4WA 2FQIA 5A8MA 2J9XA 4XB3A 5K7JA 3MP4A 4V2XA 2VDHA 3AROA 1ZRQA 1E43A 3KCLA 3HG2A 3BCJA 3N1AA 3UD6A 1L0PA 2YCLA 4MHBA 3WJYA 4S3CA 4DIAA 5C9ZA 4FR1A 3NDYA 4JTDA 3CHVA 3H23A 4IFRA 4PH6A 5D37A 1S5MA 3TIMA 3Q6JA 2EO7A 3RPTA 5KZEA 3QVQA 1AD1A 1XLMA 3AU6A 3W1XA 2D73A 4AMCA 3PPFA 1RBLA 2EPOA 2E77A 1DPMA 2FTYA 5I23A 2XM1A 5LNUA 4JEQA 1TCMA 1EUAA 2H8ZA 3PSVA 3P84A 3TDFA 1KLYA 4N9EA 4XUGA 5CZSA 1E6PA 2OSXA 1N82A 4YCPA 4UFHA 1HTIA 4UFJA 3NL3A 3N11A 1MEHA 2WW5A 4XG1A 4JTKA 4L9YA 5LGZA 1ECEA 4KGJA 4O57A 4BS0A 4Z2JA 4QE4A 2V3EA 5D05A 1IEQA 2JKAA 4IPPA 3V16A 3SADA 3WFZA 1I1WA 3JZEA 2V3FA 3L68A 4PBFA 1X2HA 3VGGA 4KWVA 3GXNA 3W7KA 4C6CA 2WWCA 4GIEA 3MI3A 3DC0A 1VFLA 4M6QA 1DORA 4M1RA 3T2QA 4JCMA 2YGYA 2WC4A 2Y1HA 3ETRB 4JIHA 4JTRA 1UH4A 5E5CA 3WMCA 1JAKA 1AD4A 5GRTA 1W8SA 3MKVA 1FA2A 3JR2A 1QW9A 2CZEA 4AZHA 1ZAIA 3M0XA 2YXXA 3C2RA 1DTUA 4D6FA 3AQUA 3IUIA 4QEEA 4F0SA 1S2TA 4US5A 4QR6A 5A69A 1I2PA 1RA5A 4CQBA 3INPA 1R7OA 3ARVA 1YW1A 2GDUA 3NCOA 2HK1A 3VIKA 1GGOA 3W7IA 1SFSA 3ATZA 2FVKA 5EL1A 1FXQA 1F8MA 1GVQA 2RAGA 3EDEA 3MPGA 3GKAA 4PMZA 3RK8A 2QCGA 4W87A 3PZGA 1XIHA 4GYPC 4OT7A 4NI8A 3PR2A 1FHVA 3B40A 4H01A 2NZLA 4FDCB 1R9ZA 3S1WA 3KX6A 4RW3A 5G2IA 1X96A 4HB7A 1J2WA 1V5XA 3IJDA 4UIOA 4H9UA 2X1SA 2YCEA 1TV5A 3QY6A 2E1WA 3RO6A 4YTRA 4N02A 3BUVA 4US6A 5DX7A 4KH2A 4AUBA 3CU2A 1J6PA 2Z28A 2NVDA 2I5GA 3WMBA 4H4UA 4IG2B 3RX2A 4HBKA 5F4SA 3UNDA 4LAKA 1PJ9A 4RK8A 1J0ZA 1ZU8A 1TTIA 2OOGA 3DK9A 1M03A 3IGSA 4UTTA 1WAUA 3DHPA 5C55A 1BSLA 2VC5A 1UA3A 3NDZA 2PTDA 2Y5SA 3HIJA 1PX3A 3UGVA 4ZQNA 5CZTA 3M0YA 1WBJA 3T1GA 4D6CA 5G5HB 2V2DA 4DXKA 1POKA 1EDGA 1FWTA 3C52A 4NAEB 1G0CA 2VEIA 3V75A 4M82A 1EJSC 1ZBKA 1TVNA 4Q7NA 2JBMA 3NPXA 1LBMA 4R7WA 2Z7KA 2ISVA 4PTMA 1JPDX 1XG4A 4WY0F 1UBSA 4U2YA 2Z6IA 1V3LA 1GQKA 3WF1A 4MADA 1SO6A 1LLWA 4QS5A 4YTTA 3BTNA 1JZ2A 1QO5A 4AD4A 1E4IA 3GNNA 2Y8KA 3WD2A 5FJTA 3B0VC 1N8WA 4LYRA 4RZ5A 4QJ1A 3UZZA 1HW6A 1H1NA 2ON3A 5HWJA 5B80A 3VGDA 3N2TA 1HVQA 2OGJA 2ZZ2A 4H7VA 4QSFA 2WCGA 2INEA 4P7RA 1OFBA 5ABTA 1KRAC 1R30A 3MSGA 3Q58A 4HCLA 1OYBA 3G3DA 4FALA 3DYMA 3T7VA 4XUYA 4AF0B 2KAUC 3VKDA 2QEZA 3LCXA 2DZVA 4MVAA 3GSMA 2ZUSA 3TMQA 5GVJA 3QZ6A 3WH5A 2HQAA 1W9BM 4CEXC 1GHSA 1UKOA 5GQBA 4MUZA 4DBWA 2O7SA 4CVUA 3KZSA 3B0PA 3WQ6A 4GPNA 5A2CA 1F3PA 3B3DA 3NQ2A 4RXFA 4FAMA 1UPMB 1RD5A 3KL5A 1NH6A 2FDSA 3WG6A 2GSEA 3ZVHA 2J8TA 1P1XA 2PWUA 4I9AA 1YTKA 3WQEA 1MVYA 4PSPA 2QPXA 3A4AA 1WA3A 1V97A 1DNCA 3B4UA 4DBDA 1B30A 3M46A 1M7XA 3UVIA 1TWWA 4Y7EA 2WO5A 2QJIA 1JYNA 3TLLA 3EX1A 4GRSA 4J27A 1HX0A 4DBUA 1AJ0A 3RX3A 1Z32X 3ARXA 3P74A 4AHPA 4LPCA 1XI3A 2VEGA 3W37A 2RJHA 3VABA 1UZ4A 2WSRA 3OU8A 2Z2BA 1KBKA 3DG7A 4A29A 2A3BA 2QV5A 3TFXA 5BW6A 4TTGA 2Z1BA 1W54A 1UWTA 1CLKA 3UJFA 3CAQA 1ZTVA 2P8BA 3N2MA 4NRRA 2CLOA 2NPXA 3EOSA 4AWUA 1VEMA 3KTCA 3VIPA 2GPTA 4I7VA 5T9BG 4K8DA 5BOEA 2QKFA 4JS3A 1NHPA 5AN7A 3F2BA 1OCBA 1Q4NX 3BLEA 4Q22A 3R0DA 4M0XA 3IIZA 3KL3A 4OOZA 1B90A 1NHSA 2GLKA 4EQSA 3POHA 2V69A 2B7QA 4F40A 3CXOA 2PD9A 3LHVA 3LRLA 5FS6A 4GI8A 3QQ0A 2VRKA 1RV8A 4LBSA 4JIQA 2PTZA 2PLCA 5FL0A 4OECA 1GUVA 1KQYA 3TROA 4ILSA 3FDGA 1G69A 3R12A 3II4A 3O3RA 2Z7GA 1PCKA 5CG0A 3UW6A 4AY1A 1B3VA 1EJ7L 1B3YA 4F8XA 3IJ7A 1KXHA 2GGEA 5HNUA 2TRSA 3C6CA 4MUPA 4FNRA 3S5ZA 1O1ZA 3HQ1A 1WE5A 1KFBA 3GXPA 5CSYA 5IDIA 2PU0A 2IPGA 2NSXA 3B4YA 3ZT7A 5JCNA 2ZXAA 4PL2A 3PZVA 1JPHA 2CBIA 1EJXC 1V6XA 1WDQA 4MLRA 4E6MA 2ZBTA 5ABFA 1GYNA 2C16A 4ZO8A 1XLEA 2PZNA 3U2ZA 4GKLA 1FQ0A 3IC9A 1PVNA 3SFKA 3ZYZA 5EYWA 3UJSA 4ZQOA 4H4VA 4K2SA 4EM4A 2CZ5A 2VFFA 2E40A 1PBGA 5CG7A 3WBWA 2W92A 1X8CA 4GX9A 4Q4QA 4CCZA 1YNQA 1I2NA 4GUJA 1HKJA 4JHOA 4PCNA 1LL7A 2FVMA 2J62A 2YIHA 4WKAA 1UR9A 2G3NA 3LQLA 1QW7A 1GT8A 1W17A 1XV8A 6ENLA 4DUVA 1EOMA 2XSBA 2X16A 2PPGA 4QGCA 2HWGA 5T8GA 4ZQPA 1TJPA 4XIMA 2HNHA 2QAFA 4ORIA 3WNNA 5HQEA 4Q4KA 2VFHA 3NTYA 3RLUA 1TMQA 3DOPA 3AXIA 3R8GA 1R0MA 1US0A 1DIKA 3OZPA 1L6SA 2BC0A 1OG6A 3F4DA 1WCGA 2W66A 2X2YA 5CLTA 4GJ1A 1V0NA 1F4HA 4AY7A 2JF6A 3EPNA 4J28A 2CXGA 2XFWA 2QUNA 4WIWA 2CEQA 2DVUA 1XCWA 1IXOA 1KM3A 2JE8A 4YTQA 5EMYA 3O15A 3THUA 1ADOA 3UWYA 5LIKX 1L6GA 3WBAA 1E0VA 2YCLB 2O9TA 3ISIX 4HZ6A 1JUBA 1KCXA 1SMAA 5JMUA 4CQDA 1K8CA 3BL3A 3HV9A 5FF7A 3LCIA 3ZWSA 3EA1A 2F38A 2FTPA 1CEOA 4ZXOA 5BWAA 3RITA 2WPEA 3NQVA 4PZVA 3CQKA 1FXPA 3ARZA 3VC6A 1XIEA 4RE0A 3TK7A 3GHRA 3NPVA 4OHQA 1RCXB 1GPFA 3L4XA 3HO8A 1H60A 3L5MA 2Z1XA 2FPVA 1VEOA 4CN6A 4I6VA 4MKSA 2YBVA 1JPIA 1OT2A 3KCJA 1FFRA 1WDPA 3B8SA 4LAOA 4E4UA 1EJUC 3SDOA 2OTDA 2R6OA 4U3AA 1FWHC 2DV0A 1JL8A 1G9HA 1WDRA 1QRQA 1G5AA 3PFMA 3FSUA 4BQ4A 3RCNA 2ZICA 2ZX5A 3VOHA 4AXNA 2E68A 3ME3A 3KBVA 3JS3A 3O0FA 3NVVB 3O07A 1Q7MA 5EFDA 3TOPA 5H8MA 2YB1A 1IEIA 2X50A 3ABSA 3STGA 3L2LA 3RM8A 4IHCA 2V82A 3NYDA 4S1FA 4C6LA 1E1FA 4B92A 2QDHA 9CGTA 4IICA 3D6NA 1ONEA 4LY8A 4Q8WA 1H2JA 2I7GA 4LRSA 4HZ8A 2FYMA 1VAHA 2I14A 1WYGA 3CB8A 1Z69A 1L9WA 3W1NA 4EE9A 1J01A 4JCLA 3P81A 4N9CA 1EDTA 3O2LA 2RJGA 4XK2A 4IPLA 1J0YA 5BU6A 1K9FA 4CNPA 3U0HA 3L4WA 2Y7FA 2IW0A 4DQWA 4O11A 2HBVA 4IQDA 3EMZA 3A13A 4ERIA 4ZMGA 1ZXIC 2HXTA 1E71M 1OINA 4QS6A 1HJVA 4PA8A 4XISA 2RKXA 2CCRA 3NGJA 1V6UA 1JYXA 4GBUA 4JKMA 1H1ZA 1DWJM 3IVUA 1SM9A 4B5NA 1DJIA 3PB0A 1AMYA 4O14A 3MV01 2XINA 3G1XA 3PNZA 1B3ZA 1J93A 5I09A 3GRSA 2DT1A 3WDJA 1L2UA 2V6OA 2FKPA 1KC7A 3CJPA 3IVTA 1V02E 4P7NA 2XVPA 3WF2A 4OJYA 3K30A 2GVGA 1EL3A 4XKMA 1C8VA 2PDYA 4RXGA 2WBKA 3M7SA 3ZSTA 3KRSA 4QQUA 2ZZCA 1WDSA 2PTYA 1A3XA 3MY9A 3M5ZA 4PCSA 1SZNA 3VC5A 2HEJA 4PMYA 1DL3A 1CTNA 1Y8BA 3CAWA 4UMBA 4JIEA 4DN1A 2R9ZA 4HJWA 1LPFA 3T44A 3NZQA 4LUJA 4HOZA 1CGXA 4AEOA 4O28A 3QZAA 1OWQA 3KS5A 3UZWA 3F03K 3PF3A 4QP0A 4QTGA 1HKIA 5E6YA 1PHQA 4S3AA 1HVXA 4TMBA 3LPGA 4I8YA 4KPLA 4I7WA 3RRXA 2V5LA 1W31A 5LYRA 3BANA 1A5KC 4TVDA 7CGTA 2YXOA 3B06A 4U10A 2VWTA 1ZFJA 4PMDA 4MSSA 3TJ4A 1SU5A 1FCUA 2BTMA 2WNQA 1Q6GA 4UBPC 1AJ2A 4AIBA 5A3HA 1KR1A 1CENA 3IRDA 2GH5A 3IJ8A 4MZ1A 4AMAA 4XD4A 2I9UA 4EQWA 4H9MA 3II1A 4HTYA 3RJYA 3W1PA 3VD9A 4ASTA 3UCDA 1XLKA 3W7QA 3N15A 1MUMA 1VBGA 3CLMA 4AIEA 1B4KA 1LYXA 1E6SM 2G3FA 4WVXA 3B0XA 3ABRA 4LNYA 1R9XA 3T8LA 2ABAA 1X2GA 3V35A 3GG8A 2YL5A 1SW3A 3TJIA 3VM5A 4HZMA 1AA1B 3TYAA 5AKQA 2O9PA 2WZHA 3IJIA 5D30A 1X8FA 1ISXA 1EGMA 3FCPA 1XLIA 4HPXA 4H9YA 3WLNA 1WZMA 1PPIA 1A49A 4MY9A 1R2TA 4MKVA 4UXDA 2IXVA 3U8GA 1VBHA 4AISA 3UPMA 1NWRA 2YDQA 1D7FA 1FX6A 3ZVHB 5EMUA 3EMCA 3EWBX 5FJIA 1JVNA 1F74A 4WGHA 1FRBA 1XYCA 4GXMA 1J18A 1XH2A 2EQ6A 2QLYA 2UZ9A 1XRSA 3IS4A 4MJMA 5FF4A 1EKOA 4A05A 2CLKA 5TBOA 4H19A 2ISDA 3GYEA 1Q4WA 4D1JA 1EB3A 3N3TA 2PEVA 1VQZA 2HVNA 2Y8UA 3MUZ1 5K9DA 3VVGA 1QPKA 3QPYA 4PR4A 5BWFA 3BURA 2BY1A 2E0PA 4G8TA 4A35A 4GNKB 1BG4A 1EA0A 1MXGA 1XLGA 1SJBA 2VOTA 4WSJA 2X05A 2AMXA 2NWRA 3IIPA 3WQWA 3ZJ7A 3KDOA 3TTQA 1PHWA 3NAVA 2EPLX 3LCLA 3LADA 4UOJA 4EWJA 3KVJA 5XINA 2ACUA 2Z25A 1W1VA 3D0CA 1XYAA 3AIEA 2ZXQA 3WLJA 2WMFA 1JDFA 2Q3RA 1TJ1A 1ISVA 1Z8AA 3VZXA 4K8HA 2TODA 1IT7A 2WM0A 2QCMA 1JCJA 1GKRA 1K1DA 3RHGA 1TKKA 2XH0A 4ZO7A 1EX1A 3RILA 1HF6A 4AZ6A 5AHLA 1B3WA 1XDMA 5K2ZA 5A6BD 3OODA 1QTWA 2Y5EA 2EKCA 5IHSA 4PUUA 3MI2A 4JR5A 3ARPA 3TCSA 4P8WA 4BWLC 3BC9A 4QIUA 1RALA 1QW8A 4JQ3A 2F6KA 1DVJA 3D3AA 5FL1A 3MC5A 1FP9A 3LPOA 1S2UA 5DRIA 4K8EA 1NFGA 2FVLA 3SCPA 1FWFC 2YW3A 4DZHA 5CPNA 4CN4A 3L4TA 4O54A 2IKHA 2XZ7A 1UYQA 1AUSL 2G5WA 3EAUA 2FJKA 3QV9A 9XIAA 4GCXA 1BZLA 4DUXA 2WK2A 4N4QA 4Q4PA 2FZBA 2WHMA 3QV6A 2PDHA 1MYRA 3P80A 3WDQA 3C8FA 5I24A 1BAGA 1NAL1 3STFA 1VIWA 1XIIA 4LUSA 5TD4A 1Q45A 3RR4A 2AQWA 3CQJA 4FS9A 1X38A 3GWQA 1ZJAA 3NEHA 1KBBA 3UG4A 2WMKA 2C3DA 2PRLA 5J5DA