3PK7A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens with mg and glycerol bound in the active site
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
403
structure length
396
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVYEPADSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens with MG and Glycerol bound in the active site
rcsb
source organism Chromohalobacter salexigens
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
total genus 150
structure length 396
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2010-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3pk7A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3pk7A01
4KPLA 3FCPA 4Z17A 3QPEA 2POZA 4Z1YA 2QQ6A 3R0UA 3ZVHB 3FVDA 3N6JA 3H70A 3T9PA 1PDYA 1EC9A 1SJAA 1P43A 1R6WA 3NZGA 3UJFA 1JDFA 3TCSA 3TQPA 1FHUA 3VFCA 1ONEA 4H1ZA 2CHRA 3ZLFA 2FKPA 4EWJA 1EC7A 3MUCA 4HNCA 3V5CA 1YEYA 2AL1A 3H12A 4F4RA 3GD6A 3SQSA 3DFHA 3T4WA 4E4UA 5FJPA 1MDRA 3RO6A 1EC8A 3OZMA 3RITA 3SSZA 3P0WA 4M6UA 4ZA0A 2QVHA 1JPMA 3SJNA 3VC6A 4A6GA 3JW7A 3OPSA 2XSXA 3PWIA 3NFUA 2ZADA 3P93A 1ELSA 2PGEA 2P8BA 3JZUA 4HCHA 2MNRA 2PA6A 1R0MA 3PK7A 4A3RA 4HPNA 4KWSA 3ES8A 2QJNA 1E9IA 3UCDA 3IJLA 4KEMA 3ES7A 2PP3A 2PP0A 2AKZA 2PU1A 3UJSA 1TKKA 4DYEA 3OZYA 2QDDA 3V4BA 2PGWA 2PPGA 3JVAA 4DXKA 5FJUA 2OFJA 3CT2A 2HZGA 2QGYA 5FJOA 3TWBA 5BOFA 2PTWA 3N4FA 3DG7A 4IT1A 1MUCA 4E8GA 1NU5A 3H8AA 3SN0A 3D46A 3GO2A 4E5TA 4J1OA 3Q45A 2DW7A 4MMWA 3DERA 3QLDA 4M0XA 2HNEA 3R11A 3BOXA 1EBHA 2AL2B 3PWGA 2OPJA 1KCZA 4G7FA 4HCLA 2HXUA 2XH0A 4JN8A 2NQLA 3DESA 2OZ3A 1XS2A 1WUFA 7ENLA 4DN1A 3SN1A 4ROPA 3R1ZA 1OEPA 3EKGA 3UXLA 3STPA 3U4FA 3V3WA 3TJ4A 4YWSA 1PDZA 3FYYA 5IDZA 4JHMA 3I6TA 3NO1A 4DWDA 4E4FA 3VDGA 2AKMA 3DIPA 1JCTA 2PODA 1MDLA 3N4EA 4HNLA 3KUMA 2PTXA 3IK4A 3IJIA 3TW9A 3RRAA 1SJDA 4HN8A 2GL5A 3VCCA 4E6MA 2I5QA 1BQGA 1TE6A 3IJQA 3PFRA 2GGJA 2RDXA 3SBFA 3UJ2A 2GGIA 4DX3A 1DTNA 3NXLA 3UCCA 2OX4A 2PTZA 4FP1A 3T8QA 3OTRA 3CYJA 3BSMA 3DEQA 4H2HA 3B97A 3TOYA 2OO6A 4IL2A 2PP1A 3QKEA 3N6HA 3I6EA 5J04A 2P8CA 2OG9A 3THUA 3MKCA 3ZLGA 1SJBA 5FJTA 4MKSA 3QN3A 4K8GA 2PMQA 3RGTA 3CAWA 4GIRA 3CXOA 3QTPA 3GY1A 3T6CA 3OP2A 2MUCA 1XPYA 3VCNA 3I4KA 4J3ZA 1BKHA 1NELA 2PSNA 3U9IA 4HYRA 3D47A 3MQTA 3S5SA 2OQHA 2OQYA 3ENLA 3ZVHA 4ENLA 3RR1A 3R25A 3DGBA 4GYPA 5FJRA 2PU0A 2PCEA 4HCDA 4MGGA 3OW1A 3ZLHA 3MWCA 3EEZA 4IL0A 4H83A 1WUEA 2XH4A 2OKTA 2P88A 4KT2A 4DHGA 3TWAA 3S47A 3UGVA 3CK5A 3DFYA 2O56A 2XH2A 4IHCA 2OVLA 1W6TA 3DG6A 4GGBA 1RVKA 3V5FA 1KD0A 4X2PA 1F9CA 3R10A 3K1GA 2QJJA 2GGEA 3R0KA 1TZZA 1IYXA 2GDQA 2GGHA 2OLAA 3VC5A 3DDMA 4FI4A 1KKOA 1JPDX 3UJRA 2GSHA 3FXGA 2DW6A 1EBGA 4H19A 4GISA 4ZCWA 4IP5A 1SJCA 3FJ4A 3P3BA 3TJIA 2GGGA 3UJEA 3TTEA 1FHVA 1P48A 3SN4A 4G8TA 4IP4A 2P3ZA 5EU9A 2QDEA 4K1WA 2PS2A 1KKRA 2ONEA 2P0IA 3BJSA 4IZGA 1MNSA 3VA8A 1MRAA 1ECQA 2XH7A 3MY9A 4GFIA 5BOEA 5ENLA 2ZC8A 4GMEA 2OZ8A 3Q4DA 3H7VA 4GGHA 1L8PA 3RCYA 2OZTA 3CB3A 2QJMA 4K2SA 3ZVIA 2FYMA 3GC2A 4GYPC 3FV9A 2AL2A 3HPFA 2PTYA 2HXTA 3UXKA 4JN7A 3MSYA 2XGZA 6ENLA 3DG3A 4A35A 3MZNA
chains in the Genus database with same CATH superfamily
1K4QA 3R8GA 2CYGA 4PH6A 3TYDA 4A2RA 4TUFA 1E0UA 3QPEA 3KTCA 1ZXIC 4IFRA 1UBPC 1DTUA 3ITXA 2WMIA 1ZAJA 1MWOA 2PWFA 3R2GA 3RAOA 1P43A 5G1MA 3C0SA 3LERA 4J40A 3VFCA 1J2BA 3GXFA 3LPPA 1Q6RA 3TSDA 4Z0SA 1EP1A 3TMQA 1HKWA 4UOQA 3Q58A 1EX1A 1I2RA 2IPWA 1M1BA 4ACYA 3KRUA 1UH3A 3GFZA 4XVDA 3FJ6A 1PHWA 3S5ZA 3ZZ1A 3ARPA 4LYKA 1KR1A 3S2NA 1AJZA 3R6IA 2I7GA 3EMZA 1Z44A 5AHEA 4GYFA 1AD1A 1TPWA 4OGZA 4FLRA 5A8PA 1XSKA 1YQ2A 1V3LA 4F79A 2YVJA 3VM7A 3H2OA 2PGEA 4GZEA 1IXOA 1QAPA 4WY0A 5DEZA 3AOFA 4I7WA 1S1RA 1I6NA 4DUWA 1JXKA 4QE1A 1OY0A 1FFVC 1LRQA 1LOQA 3GDRA 4QEEA 3TU9A 1A0DA 1PCKA 3AQUA 4DBSA 2PP0A 2XGIA 3B8VA 3CIWA 3GZ3A 3WSUA 2ALDA 1QHPA 1UZ4A 1VPYA 4N7QA 4OUIA 3N14A 3S9IA 2DVUA 4OVXA 3GRSA 4PB3A 3HU7A 4UIOA 1JZ5A 4AIOA 2VI0A 2X1UA 3V4BA 4AD4A 4DXKA 3G24A 2X7WA 1JYVA 2DUXA 2YGYA 3QV8A 1XR2A 1TUFA 4YS1A 4YYFA 2WSKA 3DX5A 1LWIA 1NHRA 2V5KA 9RUBA 4FXFA 4AVNA 3CU2A 3LBMA 3MWAA 1JZ6A 2BBFA 4XZLX 1QATA 2AQVA 3U57A 1HKKA 4Q32A 4QXIA 3JS3A 3M5YA 3UGRA 2VRKA 1J0IA 3EX1A 1LPFA 1WXZA 3WQWA 3KWXA 1Q4WA 4Y2WA 1BSIA 1FWFC 1MYRA 3RLGA 4J2PA 4B91A 3F2DA 4PSPA 4BWLC 5CC6A 4FEZA 2DY3A 1FWEC 1KRCC 4Q33A 2CLKA 1A3HA 2NT0A 1W1YA 3AIBA 3VGDA 1VEPA 2ASHA 3HFTA 4DN1A 5CPSA 1F74A 5BU9A 3B03A 1QK2A 1OCBA 3OZPA 1WDQA 1JQVA 3WLKX 4BF9A 3V1PA 4ZQCA 1QUMA 3DGZA 3EKLA 1NWUA 4UCFA 1YX1A 2VZUA 4DPPA 3F4WA 1O1HA 4GLEA 3DCPA 4LUIA 3GH5A 4KH2A 4QJ4B 3QSTA 2QUMA 1W3HA 4Q8TA 2QF8A 2UY2A 4WY0F 4J4KA 2WZMA 2GFTA 1PTGA 4GZJA 1FFQA 4WXZA 5GQBA 2VL4A 5BMXA 1CDGA 3W6LA 4DX3A 3BLIA 4ZE4A 1VYSX 1KGWA 4XUYA 1Y8BA 4LC8A 3UCCA 3FIGA 3MUAA 1L2UA 1EA9C 2Y7GA 4GBUA 3OTRA 2QR6A 4EE9A 4V2XA 3CWNA 2DZBA 1I8JA 4KRTA 3FA5A 4IIFA 1XC6A 4HHPA 1E1FA 1TA3B 1Z42A 5BRQA 1OIFA 5JCNA 1RJPA 2CIPA 3M4HA 3TJXA 2PRMA 1W5PA 3UNDA 1QOQA 3IJ8A 2YCIX 2FZNA 4I3GA 2CBVA 2WLZA 3ITOA 4FR1A 2PMQA 2YBUA 1ITQA 5I3JA 1XUUA 2WPFA 3IGHX 2MUCA 2VFEA 1ZFJA 4W8BA 4J3ZA 1JZ4A 1EF2A 1YPFA 1FXPA 2I5GA 5G4WA 1R87A 4H8HA 3QYQA 4Q4OA 2P10A 4XUGA 6ALDA 2OQYA 3ENLA 3KE0A 2QKFA 3A7RA 3G3DA 3DGBA 2Q09A 2ZA2A 5CLTA 4HU3A 4MZ8A 1BVZA 4IUGA 4G2DA 3K1DA 2X8HA 3OW1A 3VMNA 2J8FA 1AH0A 3GTHA 1W3TA 4KT2A 1XH2A 3VE7A 4LRSA 4ICNA 1GONA 3S1WA 1OX4B 3QF0A 1Z89A 1ONFA 1ADSA 3PAJA 4JTQA 1KM2A 3DFTA 3AUOA 3H6OA 2XIOA 3GYCA 3L4YA 2VDHA 2O4QA 3IJDA 3PY2A 4LT9A 1N8FA 2CERA 1DJHA 2VRQA 1MEHA 4HTYA 3DDMA 3CJPA 1LRTA 3T2OA 2YOCA 3GM8A 1EBGA 1JAKA 5BWAA 1TTIA 3PG6A 1XGEA 2XJ7A 3H4WA 2IQTA 5A5WA 3S5OA 2V2HA 4AWUA 1FWCC 1LWJA 4JR5A 3LD5A 5CC3A 3ITTA 4M24A 4IP4A 1HJUA 1KW1A 2J25A 4JX5A 1QFEA 1EYEA 1W5QA 4C6JA 3NTYA 1KBJA 1WOAA 3L5LA 1YNPA 3CLMA 3U0HA 4C1KA 5BZAA 5BOEA 4QIUA 1SGJA 2BASA 5RUBA 3EDFA 2OZ8A 3QRHA 5AYZA 2ADAA 1H49A 5BNKA 1F4AA 2PURA 3AIEA 3I7QA 2CETA 4JOMA 1YXYA 4NZFA 4Q4PA 3U2EA 2Q8LA 2GRTA 1BYDA 1E0WA 5LXXA 5JCIA 1ONWA 2E8YA 3GG7A 5HUOA 1X39A 3O63A 3ANVA 2CFFA 3KFTA 4Y9PA 1ZTVA 3FX4A 3FXYA 1A80A 1KCKA 3SCPA 1LBFA 3K13A 4MOZA 3FJLA 3AJXA 4JTFA 3PJXA 2FFIA 2YB1A 2POZA 2GLKA 2EQ8A 3R0UA 3HRDC 2QIWA 3UPMA 3PUGA 1SZGA 5LIWX 2Y24A 2BVTA 4FHAA 4DWSC 1MI3A 2GSEA 3BZJA 2VZSA 4KPRA 1TCMA 1JCNA 2FH8A 3RX4A 2FKPA 4HHLA 3W07A 3WQGA 7XIMA 8XIMA 4RZ4A 4RV3A 2PWUA 1XG4A 3SM0A 3M0YA 2H3DA 3CUXA 4XQ6A 1XIJA 2NV9A 3WENA 1V7YA 4NZ1A 3L66A 2ZX9A 3CTTA 4MUZA 4V1YA 5AZ0A 3NR0A 2J77A 3FNDA 3URQA 1MZHA 1KTNA 1ZHAA 4NJJA 3KTXA 2EF9A 3JZUA 1TV4A 1KA9F 1L2QA 4XK2A 7PTDA 1E9ZB 2YBVA 4CN6A 3MCNA 3G1YA 2V3BA 1W1VA 4IPIA 4NKCA 4OT7A 2ISDA 4H01A 1E9IA 1AVAA 3UY7A 2A7PA 1ICPA 2VZVA 4NZJA 3IGSA 1CX9A 2XFFA 1GRGA 3ZS4A 2E68A 2FVMA 2XVLA 1MVYA 1YHTA 3LTSA 1FY6A 3UWYA 4RE0A 2YQUA 3QHMA 2ODOA 1Q63A 3PR2A 2Y61A 4H6EA 4H9UA 4FSAA 3EWDA 3KX6A 2FTWA 2VC7A 2Y2WA 2PDYA 2X05A 3SZ8A 2FZ8A 1KN0A 2YW4A 4MPKA 1EUAA 1VEOA 4CNSA 3MO4A 1R3QA 1EH9A 1BYCA 4MJ2A 4HOXA 3SN0A 4IQJA 4ZOBA 2YFNA 1SZRA 1Z48A 5D9OA 3SRKA 2F84A 1RM6B 1J18A 1BEUA 1Y5VA 2PWGA 3GXTA 1EGZA 2BY2A 5KINA 2ZBTA 3DERA 4BI6A 1FP9A 4IX2A 1DIOA 3GHTA 4UWMA 1KCLA 2JF7A 1F6YA 3A5FA 1SO5A 2DUAA 1W9VA 4WDTA 3KDNA 4BQ4A 5JBFA 3TTOA 4TOQA 3GKFA 2W55A 1GOKA 4HA1A 5EB8A 1UP2A 3T81A 1XQLA 3URAA 3QW3A 4C1NB 3GWQA 2OSXA 4LANA 1OEPA 4Z1AA 5F4XA 2D0HA 2X1TA 5D38A 2F9RA 1TVNA 1W37A 4TV5A 2JK2A 1WNOA 3F5LA 1JDEA 5KVHA 4KCVA 3I6TA 5CPLA 3W9ZA 3GR4A 1OFQA 4NX5A 4RE3A 2WHLA 1NH6A 3OGSA 1ITXA 3AS1A 3PPCA 1PZ2A 3GDTA 1J79A 3TIMA 2BDQA 3MVIA 2AKMA 2PF0A 2WVUA 2Y85A 5D2TA 3RJXA 5HNNA 2ACSA 3A23A 3DC8A 4XWUA 5A95A 4A05A 3XIMA 1TV7A 3F5KA 3KBSA 2QAEA 3TW9A 2PBOA 5AVNA 3H26A 1E6PA 2WMIB 4XAYA 1V6VA 4LGXA 5F2MA 3N04A 2NLIA 1FX6A 1PHQA 2IPJA 5H2ZA 4OV9A 1G7UA 5GVJA 5I23A 4N4QA 3NVVB 3HGOA 2J88A 2WVSA 4LBSA 1GOIA 3R58A 4BI7A 4HZ8A 2HWGA 1Q7MA 2OU4A 3VKJA 3QPZA 1OFEA 5TNVA 1GESA 4WKFA 2GQWA 3IPWA 2DPEA 4DIAA 4L1XA 5HMSA 1E70M 4IL2A 1X1NA 3OLIA 4XZNX 4N4PA 3R79A 3N17A 3I6EA 1YTKA 2G41A 2GOKA 1MQRA 3G0UA 1IEIA 4UTHA 1XRSA 4QRNA 4UBPC 3SIZA 2V82A 2YKKA 4OU1A 1HKJA 4D6JA 3EXRA 4ZTXA 4H4UA 4AWTA 3LG3A 1UOKA 3PBUA 1BRLB 1ITUA 5I06A 3SUSA 1SZNA 4IIEA 3L4VA 5D04C 3NQMA 1EQPA 4JQ1A 5JMUA 6REQA 2BHYA 2YL6A 1JOAA 3DKJA 1UR2A 2QF7A 3M16A 3OQEA 3IWPA 5D05A 2WSPA 1T0OA 4UTWA 1J2WA 3AXKA 3TVAA 2Q02A 2XIJA 1XPGA 4J57A 3DFPA 4RXGA 3P60A 1A5OC 4HCDA 1WAWA 1MO0A 1GKQA 1VBHA 4RZ5A 4QAWA 1ISYA 4AZ6A 4C1LA 1G4PA 3UBPC 2W0HA 2W54A 4M3PA 3A9IA 4JQAA 2Z1VA 3DFYA 3ITGA 3VOHA 3CTLA 1F76A 1PJ9A 4DPQA 3GKAA 3UZ5A 1E3ZA 1LYXA 2RDUA 3DUGA 2B81A 4S3CA 3URHA 1MMFA 3B40A 4GG9A 4WJEA 3TDFA 2C0HA 2RGLA 4MB3A 3K1GA 3S5NA 4AXNA 1T41A 4PCPA 4DVOA 1GKPA 4U2YA 3FEMA 2QVNA 1UP0A 4RNJA 3VAVA 1K8YA 3VIFA 2RHGA 1RCQA 3JU2A 3UJRA 1WDDA 3INPA 2HTMA 3EPMA 2D2GA 1W56A 5FS7A 3GIQA 1NVMA 4F3HA 1XLKA 2ZDRA 4I5XA 3VGEA 3ITLA 3S2LA 4AX6A 3CPGA 4QEHA 3SAZA 5AC5A 4O1BA 2PEVA 2REQB 1YXCA 3GRTA 3U2ZA 4ACZA 4GI9A 3WMCA 2WWCA 3UR2A 5FF4A 2E8ZA 1KBIA 2G3IA 2PDFA 3CL8A 1WYGA 5AYIA 2JK6A 5DMNA 3QOMA 2IKJA 3H7VA 1C8YA 1OC5A 1RLDA 1NTHA 3BLKA 4HD5A 4ZZ9A 1QPNA 1BWVA 1GEUA 4PULA 4I9JA 4GYPC 4CU8A 1ZENA 4WSHA 5F2GA 3HPFA 4PMXA 1VKFA 1QNVA 3OVRA 4WR3A 5AHMA 3P62A 3DG3A 1KTCA 2B7OA 1CB2A 4J3TA 1FWDC 3FCPA 4MB1A 1ZP3A 4MY9A 5K7JA 5AC8A 1R3SA 4FS9A 1EOKA 4L7ZA 2OTDA 4JX6A 1PDYA 1FEBA 1ZRQA 3G1XA 1R6WA 4FNQA 5HINA 1E9YB 1OF6A 3K4AA 4FXJA 1UIOA 2NVDA 4UQ9A 3WUEA 3WZ0E 3LHTA 3TKFA 1XDIA 2AL1A 3L12A 4O10A 2VMFA 3VPLA 2BG5A 2ZYFA 3RO6A 3W2NA 1L6GA 3H24A 3ZR5A 5A6SA 1BTMA 3R12A 4WDUA 5EGRA 1S5WA 1CXIA 2FDMA 5GNXA 5HA7A 4IIHA 5AB3A 4Z2LA 1Q6QA 5M1TA 3UVAA 1PV8A 1X1ZA 1ZJAA 3PK7A 3F4DA 3EX2A 4R7WA 1AW5A 3TQKA 4B3ZA 1B4KA 2QJNA 3BICA 3PULA 1ZJIA 1R7OA 1NPXA 1DHKA 2NV2A 2PU1A 3ONBA 1TPC1 1RY8A 4Q4MA 2X1SA 4X0VA 3TH6A 5G2HA 4XIMA 3WL1A 4C6EA 4PFHA 1MNZA 1KM0A 3AS0A 1TV2A 3DHPA 3PUEA 1VGAA 3WJYA 5C55A 3LCWA 4I8YA 3AXXA 2VCAA 4DY1A 2XZ9A 2OOFA 3BARA 3H8AA 1E6ZA 4WCJA 3NDYA 3CHFA 4JIPA 3NL3A 4GFSA 3KM8A 1S2CA 3CLWA 5CZ0A 1W9UA 4U33A 2FTYA 4M7SA 1QW9A 2EPKX 2ZVIA 3ME3A 1RPXA 5EKYA 2QUVA 3PJWA 3U5YA 4JYFA 1QVBA 3A24A 3VIKA 3VKKA 1AODA 5HWNA 4BKNA 1TB3A 1IR2A 3E0FA 2BHUA 4U5KA 3WQ6A 3ZJ6A 5AVHA 3I7SA 3UXLA 5LGZA 2OSYA 3ZWTA 3FA4A 3STPA 2G95A 1UD5A 3V3WA 1TWZA 4YWSA 1NHPA 1PDZA 3VGFA 3EMQA 8CGTA 1TQXA 1OWQA 3NO3A 2I57A 3IJ6A 3V35A 3OU8A 2V5CA 3MUXA 3KBJA 4AUBA 5I00A 1XFCA 3NZQA 4XAPA 2X41A 3M5XA 4MY1A 1FWTA 1JNDA 4W8AA 3SFKA 1KB3A 2QIIA 3GC4A 2VELA 1KC7A 1AUSL 3MU7A 3THAA 2A3BA 2ZIDA 1GT8A 2GGJA 4P8WA 1L8NA 4J3XA 5HWJA 3LBCA 4HMNA 1QPRA 1VJZA 3UT0A 1Q6EA 1DXLA 4AHQA 1F3TA 3TYBA 5FSDC 4FDCB 1V6TA 4H7ZA 3HPAA 3L0KA 4W9TA 4M5PA 3TA9A 4CNPA 2VEKA 1UR1A 2YXOA 2ZUNA 2UV8G 3SCVA 3L68A 3WBYA 3R8RA 1EWEA 3NOYA 3MMDA 4EPDC 3ZR6A 2YL9A 2P8CA 2HVMA 1TTJA 5D2WA 3ZLGA 3BV7A 3ZXWA 1FCVA 4MKSA 3VOCA 2PWHA 2Z27A 2Z0IA 4Y96A 1TVPA 3GUWA 4HA4A 1IWAA 3ABOA 3WDHA 3ZM8A 3W4RA 5G5GB 3GHRA 2F6KA 1QI4A 3RPMA 1EQCA 4HHMA 4C60A 2ZXDA 2Z29A 4LV9A 5DMMA 4G7EB 1N7KA 3HF3A 1ZJHA 5LYRA 3UCQA 4MAVA 3LRLA 4TV6A 3F2BA 5BXRA 2Z6JA 4MGGA 1OK6A 1DOSA 2CXGA 1JYNA 3DXIA 3CEPA 1DWJM 3EZ4A 1P6BA 4R27A 1JYWA 3M41A 2XVGA 4OZOA 5DBTA 4PCNA 2A3AA 4MFEA 4N42A 4UR7A 2XDFA 1OFBA 5D32A 1H1YA 3LXBA 4JL2A 3NZRA 1XISA 4QG9A 4B5UA 3F2CA 3N2MA 1S2TA 3CV1A 3QV6A 1QPQA 2FPYA 1HN1A 1WKFA 2YFOA 3NG3A 4IPJA 4HNTA 4GISA 3R5EA 3FYOA 1XIHA 1PB0A 1UA3A 2GGGA 1CGXA 2D0GA 4PBFA 1AW2A 3EWZA 4JKLA 4JHOA 4Z2GA 4YHEA 2QCDB 2DZXA 2EPNA 2FB3A 5C7VA 1XIFA 2QDEA 1V3KA 5DQPA 2E77A 1J11A 2YX0A 1WZKA 2Z24A 1YE4A 3MO7A 4AH7A 1TZ9A 4WZHA 3F7JA 3W1PA 3WMLA 4NNAA 3NQBA 3VMOA 3H4KA 2PE4A 4AZCA 4IH3A 5I24A 3W22A 4AC1X 3HG2A 2FYMA 1RAKA 1E6RA 4A2SA 3VDBA 2AL2A 3CQ0A 1H7PA 3B8SA 5G5HB 4NAEA 4JN7A 4C6LA 1KLZA 4TX6A 3HPSA 3QV9A 2VFGA 4AZGA 3DI0A 1DEDA 2J24A 1K9EA 1A0CA 3LI1A 2G8ZA 3LSCA 2Z7GA 2JKEA 2C0AA 5JVLA 1GRTA 4O54A 4CNOA 3G6MA 4DAFA 3SR7A 1ZJBA 5F2IA 1SJAA 3FLUA 2XSAA 3L2IA 3SIMA 4UC5A 4PR4A 3VOFA 1YTEA 3NVWB 2WPBA 1M3UA 2DSUA 1ZBKA 3NPWA 5DO8A 4EOUA 1YPXA 3ECQA 4US6A 4M7TA 2FFCA 4ZBCA 3CWOX 2WMHA 2J7FA 4PMUA 4DO6A 3M0VA 3I3EA 2CLIA 3MMWA 3S1UA 4R3UA 4XG1A 5LIXX 3PBWA 3OPSA 3QQ0A 3PWIA 1WKEA 2VVSA 2ZZ1A 3UR7A 1Z32X 3JZEA 3P2VA 1TREA 3CAKA 4GUHA 4GHRA 1CNVA 4WQ6A 1RQEA 4PMQA 1D9EA 4JIIX 3L5AA 1GOQA 5CSRA 3AN1A 4KWVA 4CKQA 3GH7A 5D03A 3REQA 3UJSA 1GPFA 1NAL1 5F1VA 3M46A 4XSLA 1AL7A 1LP6A 3AS3A 3UG3A 3NPVA 3AIQA 4HMDA 1KRBC 2NX9A 2XWEA 1RD5A 2PGWA 5I77A 1AJ0A 4JTUA 4LC6A 3TWBA 1JZ7A 3GNDA 2W63A 4FX9A 3QQWA 2D69A 4IT1A 1UJPA 3H22A 4R5EA 4E5TA 1O60A 1OINA 3KOWA 3LCLA 2Y70A 4J1OA 1F2JA 3G8RA 3TP4A 3SUTA 4W7UA 3IARA 1IEQA 3DOPA 4KIEA 3QZAA 2E67A 4JICA 3UPBA 1JFHA 2VZTA 3CQHA 3GNPA 2YCLB 4H4QA 4RPPA 1H62A 5CC7A 3CQJA 1XIBA 1LL4A 4PMYA 3VCRA 4AY1A 1EJWC 3PB2A 2YCEA 1YDYA 1C3FA 4CVUA 5C2XA 3A3WA 3FA3A 3V0SA 4DWDA 2PBGA 3FDKA 3O06A 3PTMA 1UC5A 2BS9A 5A2AA 1IXQA 3GW3A 4QLKA 3BAIA 4ZOEA 1EGVA 3L4TA 1D3CA 5CSSA 3L0NA 2YCKX 3IJIA 1VFFA 4JDYA 3VIJA 3RX3A 2J6XA 3VOJA 1BQGA 1PUDA 3CH0A 2W6RA 2EPLX 5DELA 3M0XA 2QCLA 3QY6A 2QXWA 1MW1A 3WJWA 2ATSA 4JIEA 1UB3A 1VBUA 3BQ6A 4OTKA 1I1XA 1H7NA 5E93A 2ZICA 2OX4A 1XRVA 4D6CA 4KRZA 3F03K 4YLWA 4XD3A 1GOMA 3EPNA 3B8IA 3T2PA 4PTMA 4IIBA 1VJIA 3GXIA 4IMDA 3W29A 3UZZA 1BAGA 2ISVA 2NQ9A 3LB8A 4J28A 4EAYA 1RSCA 4B3LA 1OC6A 1ISVA 3DFOA 3ATYA 4FX6M 4FIQA 4XKYB 1A5SA 4QNWA 4GIRA 5I3KA 2ZUMA 4KQNA 3UYCA 3OP2A 4I6VA 4ZQPA 1KGXA 1UP3A 1ZALA 1QMLA 1UUMA 4A8RA 2CZFA 3N2CA 5LNUA 3KZPA 2NZLA 5EMKA 2FJUB 5CH9A 2WOQA 4GVGA 5A8GA 1ICQA 2VGBA 5FL0A 2W3ZA 2PLJA 2WVVA 1VRXA 3L7RA 2V8ZA 4PUWA 2GK1B 1JULA 4H83A 1K4HA 3I3BA 5T9BG 5C9WA 5BCAA 2WKJA 2P88A 1L6SA 1V5XA 2X2GA 1EDGA 3SW6A 1X2GA 4W89A 3VD5A 2OGJA 2XH2A 4PMNA 3T0TA 3P5YA 4L61A 1KFBA 4KIRA 5HDRA 4E2VA 1FFUC 2A3CA 4X2PA 2OEMA 2YA2A 4R85A 3T1GA 4B5SA 1M03A 4JFWA 1UR0A 4US5A 2PDNA 4D8LA 4YWOA 1CEOA 4JAWA 3H53A 4DBWA 4ZO6A 1D7KA 3CGDA 3S5YA 3CB8A 2ACUA 3A21A 3MI2A 2KAUC 1WP6A 2Q01A 3S1XA 4CN1A 3PG8A 3DBNA 2P76A 4IP5A 3WD2A 1F3WA 1IR1A 3USZA 1YMYA 1AMKA 1KXQA 1JDDA 1UG6A 3E9AA 1Z6KA 3QBUA 4LW7A 1UWSA 3BSGA 3N4AA 3L5OA 4CQ8A 1C91A 2F6XA 2P3ZA 1YNQA 5BXSA 3GW0A 4DO5A 3WQVA 2P0IA 4A3UA 3VX0A 1P6WA 3GVRA 1ECQA 3RNDA 4GFIA 1GVFA 1Q8JA 3M6DA 5EA9A 3VOIA 1TQJA 4FOKA 2UY4A 4F0SA 5BMWA 5DY2A 2GQ9A 2O9RA 4ZXLA 9XIMA 4UOZA 1ITCA 1Q2SA 2WBKA 2ISFA 3GC2A 2PTDA 3TCEA 4NL1A 4EKJA 4XZIA 1NDAA 1H3GA 1EIXA 2G3JA 1VP5A 1S5VA 4CCDA 4TQTA 3WJZA 3B8WA 4MVAA 3TR2A 2HPIA 4JTDA 3ARVA 4Z17A 3LOTA 4CLMA 3ZVHB 3FVDA 4BURA 3TTSA 1WQ5A 2IPFA 2IQ0A 2UWFA 3NEHA 1POJA 4YPJA 2P1FA 2RDWA 3O07A 1W9PA 4YTUA 3M5ZA 2DFAA 1DQWA 1SUXA 1ZK7A 1YEYA 3L4WA 2V69A 3WF2A 2C15A 4JQ2A 3GD3A 4JTRA 3AMDA 2WC7A 3PBGA 5MKGB 1N63C 1X98A 2ZX6A 1B31A 4PUEA 1F6KA 3SJNA 1R3RA 1DWFM 1H5YA 1O12A 5KZEA 4HP5A 2DEPA 3Q67A 3II4A 3DJJA 1W9XA 2OT1A 3CC1A 1AW1A 1ELSA 3I4EA 3TYZA 5K2ZA 2VGIA 2YDAA 4YVPA 2A6NA 1XJBA 4A3RA 3G2GA 4Z08A 3W74A 2D2HA 1JCXA 3N2TA 3H7UA 1MRQA 3KL5A 5M2FX 3PM6A 4QTGA 5HOSA 4AZ7A 3VKAA 4PRRA 5BROA 2FDSA 2BXZA 2QDDA 2VR2A 1P0DA 4P7RA 1JUKA 2XIIA 3RM8A 3QMTA 2FB2A 3NL5A 5EBAA 4K7VA 4DI9A 4GNJA 2YYUA 2A5HA 5IRPA 2P50A 3W7HA 2QCGA 4AISA 3VD4A 2DZTA 2ZUSA 4QJ5B 4GH1A 3OBKA 5C7HA 3DFSA 1FXQA 2VOMA 3CEUA 2ANUA 1R2TA 1RALA 3U2CA 1I1WA 4AW7A 1TPDA 3VNMA 3BDKA 4AZIA 3IIPA 3OG3A 2V3AA 1M04A 4UFLA 4Q8VA 2HVNA 2FMNA 4NT0A 3OA5A 4GABA 4C6QA 2WMJA 4S3KA 5K9CA 5HK4A 1UJQA 1EJTC 2QNEA 1ONXA 4NZ3A 2DGAA 3A9BA 1EP3A 4UQEA 2XH0A 8XIAA 4DWSB 2WJZA 4NAFA 1DJIA 3QEZA 2WO5A 1HT6A 2Y88A 3PZNA 3PPFA 3WDIA 2GUUA 4I9TA 5T8GA 3C0LA 3AYTA 3MCOA 3MA8A 4W93A 3DJGX 4PMZA 1FH7A 4IFKB 3GTXA 3W7RA 3MUIA 3VX1A 1EGMA 3GU2A 3V5OA 3EA3A 4JDBA 2JQXA 1XCFA 4WF7A 1JCTA 3EXSA 1FDZA 2Z7KA 2RJGA 3KUMA 3RXZA 4PODA 2VGFA 1P4CA 1KGUA 5HJLA 1EO5A 2V6OA 1XYBA 4KGJA 3FVMA 1WCGA 3GXPA 1TE6A 3CT7A 3E12A 3BLDA 5AFDA 2HBVA 5EFFA 3WFAA 3BGJA 3W82A 3K4WA 4KFOA 3TW7A 4PL1A 3NAVA 1GOWA 1JUEA 3H2EA 2RKXA 3CQKA 3VUPA 4XO7A 4QLLA 1HTIA 4GIEA 2W92A 4IPNB 1IIHA 3T8QA 1EJRC 3VD3A 5CPTA 1UD8A 4LH8A 1DKWA 2CZVA 3KW3A 1H60A 2RGMA 1MXGA 2TRSA 4XD4A 1WO2A 2HBXA 5BXPA 1FQ0A 3N6HA 2G0WA 1HGYA 1MSSA 3BUVA 4M6PA 2WXDM 3UG4A 1OABA 4ORIA 1BWKA 1B57A 1L6FA 3SSJA 5JCKA 2YA0A 5ER0A 3A5VA 4JNYA 3QN3A 3CHCA 4HHHA 3C2YA 1W32A 4YTTA 1QOXA 3T6CA 3PWAA 2HISA 4M1BA 4M51A 3W7JA 4H8NA 4TVDA 3H2CA 3KHDA 2X50A 4MB5A 4BHYA 4S3AA 3QFBA 4C6DA 3TFXA 2Y62A 5K3VA 3W75A 1LL6A 3QC3A 3W7MA 5A8MA 4GA8A 5HXMA 1WXYA 3MWCA 4G9PA 5IDIA 3VD7A 3TC6A 2BTMA 1HJWA 4E2OA 1GEQA 1TJ1A 2XM2A 3ZMRA 3TWAA 2B31A 3G8EA 4NI3A 2A3HA 1Z3NA 3N34A 4OJYA 1XYAA 3KOYA 2YSWA 4GX9A 1QR7A 1KD0A 4UQBA 3ZO9A 1KFWA 1FWSA 1RR2A 1M7JA 3VDAA 3RX2A 5DN1A 3OO2A 4JFSA 1X7FA 3SCWA 4FI4A 2O0TA 3UZXA 1Z41A 2JE8A 1I9CB 3EXTA 4S3GA 2DW6A 4GC3A 4MFDA 4AIEA 3BSHA 2J47A 3B05A 3M7WA 3B0UX 1VFOA 3AFBA 5DCEA 2QJHA 3E0IA 4WGHA 2DT3A 5D30A 3OVPA 1VIZA 3DU0A 1W1ZA 4PE8A 3QM3A 4I9MA 5A3HA 5CAKA 4JDRA 5G4EA 3BJSA 1QI3A 2BVYA 4K36A 2AAQA 2R91A 2Q8ZA 1BVNP 4JD4A 4PTDA 1UYQA 3XINA 3W7DA 4CD5A 5K9XA 3Q4DA 3BPWA 1S2AA 4JTSA 3ALGA 4PRWA 5U7SA 4A29A 1L8PA 3VMPA 2MANA 2E0PA 2QJMA 4K2SA 4MIMA 4Q6JA 1IWPA 3NEVA 4H9YA 3WJSA 1KM1A 1HL9A 1MW2A 3F4CA 1EB3A 3GVQA 4IMGA 3LCXA 2HK0A 4CU6A 2W4XA 3E2RA 3TYCA 2GK1A 1IEVA 3GU9A 1GWJA 5F4WA 1JCLA 4B4HA 2W3RA 3MJYA 1JFXA 3WEOA 1UZDA 2G4FA 3LQLA 2AMXA 2B4GA 4GC4A 5DMYA 5IHRA 4IMCA 1V8EA 4H1ZA 5FAGA 1BRLA 5LA0A 1WXJA 1BPLB 4AIBA 4ZXOA 3MKKA 4HNCA 4UUIA 5BW6A 2CESA 4F4RA 4IM4A 4KERA 1J6OA 3UWWA 1E4NA 3TOPA 4JGDA 3WBXA 1U2YA 3P0WA 1QOPA 2OQLA 4O53A 1HJQA 2EEXA 4REQB 3JW7A 3MI6A 4A8IA 3M9YA 3IIVA 1V3IA 3FW6A 5CJMA 1W1PA 5JQ9A 2VX6A 3NVDA 5A6JA 3M6YA 5FACA 1EOMA 1REQA 2TYSA 1PZ3A 5HJXA 3AMCA 4BEQA 2CKRA 3MSGA 2NWSA 4MWAD 4LUTA 3W84A 4KWSA 1V0LA 2V3GA 4J56A 4NILA 4H4VA 5CG0A 2D3LA 3LK6A 1MW0A 1GJWA 2WP6A 3VO0A 1CGWA 2A7NA 4NG3A 5AN7A 3AIVA 1GXFA 4OECA 1TRDA 2O9OA 4GI4A 4CQ9A 1B5TA 3GK0A 2A7RA 2QPSA 3MMTA 3KTSA 1X6NA 5BWFA 2WOIA 4IGHA 4HYVA 3VINA 4B92A 3BG5A 3ELFA 1XLBA 2E25A 2NW0A 3Q2DA 3AXHA 2VEIA 3AROA 3L67A 1V7AA 1FBAA 2XFRA 3DHDA 4S23A 4C1NA 4GIYA 4LY8A 4RK8A 2C19A 4W85A 5J5RA 4WOZA 1TX2A 3H55A 1CXHA 2O7SA 3BCDA 4Y9AA 3W7GA 3EX6A 4IMAA 1EHNA 4EP8C 3RN6A 4M6VA 3WMSA 2V6AA 4H4TA 4U10A 3BMXA 3AYSA 4BQ5A 4G5DA 3QW4B 4FF7A 4L6HA 4QITA 1V97A 1KV5A 3R07C 1AOGA 3P8JA 1EBDA 1F5ZA 1S5MA 4LCRA 5FF0A 2VR4A 3NO1A 6PTDA 1B3OA 6TAAA 2PDBA 3DENA 2ZDSA 3WQFA 1OQFA 4KCWA 4N9EA 3MKVA 3QR0A 4IQLA 3STGA 1S2UA 4E0CA 3HQNA 3CL7A 1NFBA 2OODA 3CZEA 4GYKA 4M52A 3UZWA 2PTXA 3T4CA 3UEQA 2GUYA 3IRDA 5TQLA 4W5UA 2DT1A 3HN3A 2X8RA 3RCMA 2GVYA 3BV4A 1ZNNA 3EB4A 3VABA 1K77A 1T3QC 1LBLA 1EDTA 1XSIA 3NXLA 5IFTA 1UKOA 1OBAA 2J27A 2VOTA 3UVIA 4AYGA 3AHYA 2PTZA 2WZTA 4DZ5A 2VQUA 3MVTA 3TTQA 1OYCA 2DV0A 4Q8NA 1GJUA 3VIGA 4HA0A 2NSOA 1EO7A 1UA7A 2R9RA 4M29A 4PMVA 1MZRA 4U5IA 3NPUA 2C7FA 3WD4A 2EKCA 3J7HA 3LTYA 4LTSA 3WQ4A 3KOXA 3WF1A 4LCSA 3LA4A 4NRSA 5L6UA 4RE4A 4JEJA 3TZNA 3OIXA 3H23A 1PIIA 3NQCA 4KFNA 1LOSA 5AKQA 5A6BD 3FAWA 2E28A 2JIEA 1GRHA 1S2VA 7REQA 3HA1A 4PL2A 1UROA 4NX0A 3M1ZA 2Y5JA 3I10A 4B5WA 3R25A 2ZZ4A 3MYPA 3URNA 3ZJKA 3W7KA 3FDGA 4O19A 3APYA 3LRMA 5GJPA 4AB4A 2GDVA 1PIFA 4DQWA 1QI5A 3UGVA 3CK5A 3TC7A 2O56A 4KS0A 1QNQA 4N9CA 1Z7AA 4DYKA 4QS5A 3WNKA 2OEJA 1E6QM 3WO8A 4BQ3A 1JZ3A 4HBKA 1KV8A 5LNSA 2XU2A 1BG4A 4DJDC 5A6AA 1J6PA 3S2CA 3S46A 3RHGA 4ZMGA 3BAWA 4RNHA 4A3YA 4PUJA 4L5ZA 1X8FA 3BGAA 3NXFA 1F3EA 2BOEX 1W54A 4INFA 4KGLA 1VBRA 3NS1B 2R8WA 1FECA 2VFDA 2WYSA 1XD1A 1O1ZA 4RW3A 3TYUA 3W2UA 2JKAA 2OMAA 1X97A 1XX1A 1NHSA 1P1MA 3EDDA 3VKCA 3CHDA 3TTEA 3ITVA 4PCSA 1UKSA 1V0MA 4KCUA 3TN4A 2PS2A 1ZPTA 3FGCB 3KCOA 3FFSA 4P7NA 3LENA 5HR6A 4ICCX 1GKRA 2NSXA 2WMFA 1YIXA 4QHRA 5AYYA 4AD0A 2OYKA 6TIMA 1GQLA 1RH9A 4GOAA 1DQXA 1TPFA 3K2GA 3VFLA 1E0XA 2BC0A 1VFTA 2VTFA 2OKOA 4URIA 2F61A 2OR2A 4XKMA 5BRBA 4WY0B 4YWIA 3WH8A 1GVIA 3GB6A 3UXKA 3L4XA 1S39A 1GVRA 5CZKA 4L56A 1UC4A 1H1NA 3GDBA 3POHA 3GUGA 1BVWA 3PZTA 4A35A 1Q85A 4NHVA 1EF3A 4Q8MA 1RA0A 4O8AA 4HJFA 2PDCA 4UTFA 2J3NA 1E72M 1H7XA 1AA1B 1XIEA 1W5MA 2Y6ZA 2WKGA 2ZTKA 3UJFA 2VEGA 5AC6A 5EY5A 1JI2A 1W3KA 2VEPA 3MPGA 4KWOA 4MJ4A 1D2KA 1I75A 3ZLFA 1QNOA 1YKWA 4XB3A 1TV5A 5GPRA 3WH6A 3V5CA 1YYAA 4PRTA 3SQSA 2D0FA 3DECA 3ISIX 3PSWA 4AIUA 1U1UA 3D0CA 1MDRA 2DT2A 5E0CA 1UWQA 2VWTA 3VC6A 2PC4A 4BK9A 4ADWA 1VIWA 4O57A 1B4EA 4F9JA 3LB0A 2DQXA 2PWEA 3GRIA 2G50A 3C6CA 3SURA 1S7MA 3CWHA 4ASTA 4K37A 3ZR4A 4PBEA 3ES8A 3AC0A 3W01A 3O15A 2VP8A 2YR1A 1JCYA 3AZTA 3K5XA 1FTXA 1G69A 1JRCA 1FUYA 4FB7A 3VI2A 4ATLA 4DELA 4YCPA 4U28A 4AXKA 2CKSA 3AO0A 1BF6A 2PDXA 3IK2A 3W7IA 3EMCA 1K8ZA 4G1NA 1DNCA 2WAGA 3KVJA 3LXCA 5DRCA 5FS9A 5LA1A 1Z69A 5CBIA 4GO9A 1P6CA 1XRTA 4PCFA 1LT8A 2CLLA 2Z28A 1ZBWA 3AICA 1BFNA 2PDGA 4H6QA 2YL8A 4O0ZA 2CPUA 2WNQA 1Q45A 1NF7A 2E9MA 3EWCA 2B7QA 3QLDA 5C71A 1R8LA 1EBHA 1N8WA 1QO2A 1UMLA 1VLWA 2VURA 5D8ZA 2GPTA 1WZLA 4UCGA 3IVSA 4JN8A 3SUUA 4D1IA 1LJYA 3DESA 1J10A 4YMZA 1GYNA 4GBDA 4Q7NA 2DIEA 5CEWA 4ROPA 3B0VC 3KAOA 1BGGA 1GQIA 4PUMA 3KL3A 1XGZA 1OFOA 2QMKA 5CPQA 4RX0A 3FYYA 3VE9A 4EWND 1KFKA 1IT0A 1Q65A 3OB8A 1DL3A 4E4FA 4UTIA 3ABSA 4LUJA 5CSUA 1SW3A 3PTQA 3RLHA 1M9HA 3LADA 1EX5A 3GXNA 1XICA 4JTGA 1Q2RA 1V03A 1UHVA 4D71A 1H09A 5B80A 1KQYA 1SMAA 3W26A 5KETA 1LLZA 4K8EA 2V5JA 1NWSA 3WDRA 1S3TC 3L23A 3WF3A 1QO5A 3ATZA 4P8UA 1K9TA 3EPOA 4DJDA 3RG6A 2OWWA 3EX3A 4PUDA 1SPQA 5CQ1A 3W6YA 2QAFA 1CGTA 1UWUA 1SMDA 3BG9A 1W9BM 2VYOA 3GX9A 3OHMB 1HP4A 1RV8A 4I8DA 1E6NA 1U33A 2X0HA 2VUYA 5CAHA 1OHLA 1OVDA 1VQTA 2OB3A 1RLCL 3ZT7A 4CNUA 4FX7A 1FWHC 4C6BA 3OVQA 2HDJA 1E5JA 1VPXA 2ATMA 3OBEA 3REQB 4PYSA 5J04A 1C8XA 1OD0A 5LNRA 2HQMA 3O6AA 4GQQA 4HSNA 3ZJ7A 5I2UA 1B9BA 2XN2A 3VKDA 4B9YA 1QASA 1XKYA 4FK9A 5KZ6A 3C3UA 4RE2A 3PZVA 2ZZ7A 3W3OA 3MBDA 2ZRVA 3AWNA 3AYRA 4X9SA 1I45A 4ECLA 3NVZB 2E6DA 5HR7A 1XPYA 5M3WA 1DWGM 2W91A 5FIPA 2VFFA 4IQDA 3B9NA 3OBAA 2IKHA 3NCOA 3NM1A 3E0LA 1ZP4A 2NUWA 3SDOA 4O1CA 4GNVA 3PANA 2ZXAA 3GAYA 5REQB 3UXDA 1OF8A 3QPYA 2L5HA 4CVWA 4ERGA 3RDKA 2P0OA 4GD0A 2XH4A 2J8GA 4V15A 2OKTA 1BTCA 4K8DA 1JNEA 5A2CA 3IV3A 1W3NA 2IUZA 3ARWA 1TCDA 1ZS2A 1XH1A 2E3ZA 4QDWA 3WNOA 1H51A 2NLYA 4MPQA 1W6TA 3NGJA 1H7OA 2BV9A 5I6SA 2CLOA 1VB9A 5CBBA 1C9WA 1UD2A 4LJ3A 4XV0A 4FOJA 4LBUA 1IYXA 3TFCA 3Q6JA 3CGEA 3BLOA 2B0MA 2QJGA 4OOZA 3E49A 4NY2A 2GSHA 3W02A 4O4WA 5U25A 4GY7A 4QCEA 2GZXA 4ES4A 4H19A 1IZKA 4HN4A 1LOLA 2J7DA 1SJCA 4JHZA 1BKSA 4CGTA 3AI0A 3NA8A 3SGGA 4HSHA 4QJ3B 4HKPA 1EDQA 1VCFA 1LUCB 3V18A 5D9PA 5EU9A 3W37A 1LG2A 5DBUA 4K1WA 3HGSA 2ONEA 1Q7QA 3PJTA 2Y89A 4IZGA 4GRTA 1XLJA 3MY9A 1FWJC 2QCDA 2AAAA 3CUGA 4E4PA 5FJIA 3DH7A 3NVTA 2OZTA 1QRQA 1W1IE 3T0AA 4BFAA 3AYVA 3FV9A 3OGRA 4UMBA 3VD9A 1K8XA 1AFSA 3LYEA 3WD3A 3U2OA 3UYIA 3WQ8A 3II1A 4W5ZA 1NDZA 1RP9A 5KSWA 2IMRA 2KZHA 3EDEA 4OUEA 1KFLA 4QSHA 4LAKA 4EAMA 3T9PA 4I90A 3RLVA 3CO8A 4TTUA 3WQ5A 2ZRUA 4IIDA 4B2DD 4ZSUA 3TQPA 1XHCA 3PF3A 1ZX9A 3CBWA 3EAUA 2JKPA 1AZ2A 2ISSA 4GY0A 1EC7A 4EF9A 1E4LA 1A5MC 2Z1WA 1RQBA 1EEXA 1MEWA 1Q1WA 1E15A 3T4WA 5LHEA 3BW4A 3OZMA 2D20A 3GVVA 2EO7A 2X8GA 1XLCA 3NFUA 1R7AA 3T0BA 4A8LA 2ZZCA 5FAJA 4H9MA 2ZADA 1OCJA 3NO5A 1D8WA 5EPDA 3UG5A 4AD2A 1O7AA 1MUMA 3N19B 3SUVA 2EHHA 2GH5A 3NSNA 1A49A 5HWMA 1J0YA 4GCAA 2Z6IA 2Z26A 1GOOA 5CZSA 4ACZB 2VEMA 4HPNA 1CIUA 2A79A 3W25A 3W7LA 1ZY9A 1XBXA 1GSNA 2Y5EA 4Q4QA 4UR8A 1PKYA 3UFYA 2E9LA 3C56A 3M64A 2GWGA 3PFMA 1Z9AA 3DK4A 1QCWA 1WAUA 3PJUA 2B7NA 5EYWA 4X2RA 4JY8A 3L5MA 2Y5SA 1B3YA 3W00A 3VZXA 5AZ1A 3K30A 1SYTA 4PMOA 3RM9A 1OG0A 3FOKA 3N4FA 5ABFB 1PYMA 1MW3A 1XLLA 5IM51 5AHFA 5I5RA 3NZPA 1DE6A 3D46A 4NJGA 5I79A 3N9KA 3WK1A 2RUSA 4WK9A 2ZRYA 1Q6LA 2IKIA 4DO4A 3RU6A 1NWRA 3ZSTA 1TE1A 2QCCA 4ZQMA 4V1XA 3R11A 2XFYA 3BOXA 5A6LA 4M81A 2AL2B 3PWGA 1T8QA 4AD3A 4HCLA 2NVCA 4I7UA 4QNEA 2HE5A 1CB7B 2HXUA 1FWBC 1O68A 2EPMX 1N5XA 2X0SA 3W27A 1K7FA 5TR3A 1P0KA 1BYBA 3SN1A 1JCMP 4WVXA 1FRBA 5DT7A 1XLAA 2GVJA 1I2QA 1KRMA 2PDJA 4I9AA 2QCFA 1V6WA 1F61A 3AXMA 1LBMA 1E73M 4HYWA 4V27A 2BX7A 5KZDA 4PFMA 4WXYA 1ME8A 1VBJA 2C79A 4DNMA 4CUCA 3UWUA 3WQCA 4R53A 5T26A 3HPXA 3QZEA 5H8PA 1MDLA 5E09A 5M5DA 5J8LA 1NY1A 3TV8A 3S9ZA 2VKZG 3G6LA 5EBUA 1US0A 1R47A 3BGGA 3P5ZA 2C16A 1W9DM 1NWTA 3TLLA 3LU2A 3BAKA 1F4HA 2WNZA 5TF0A 2J13A 3PNZA 4Y8EA 3N25A 1LF1A 3O2LA 5C2CA 1YPIA 2XSBA 3KBNA 2UZ9A 2XVKA 1VFSA 2C8NA 4DLFA 3VDHA 4GPNA 3WY1A 1SFLA 4G6CA 1OT2A 3U7VA 3GYEA 4AEFA 4D6HA 2RH9A 1LZOA 3U4AA 4IFKA 1KWKA 1QI2A 4RR4A 3IIXA 3VNJA 3VUSA 4HPJA 3MDUA 3P0XA 2BB0A 4NASA 1CENA 4B5NA 4UOJA 1HG3A 4UQCA 1GYLA 5KITA 4Z2HA 1V77A 1C92A 4JFTA 3CIVA 1GQNA 1NARA 1YNYA 3TW6A 3FKRA 4LOCA 5C9RA 2WJDA 4BA0A 1R46A 5HMFA 1RZMA 3G5EA 2X1RA 3EWXA 4LV4A 2QEZA 2Z1SA 4KETA 1E40A 1RY0A 1BYAA 4LCQA 4IJRA 4Q4KA 3FY1A 1J9YA 1UOZA 5IBXC 7TAAA 4CQDA 1MFVA 4OKDA 2DH2A 1T7LA 1J4EA 1TR9A 4JCMA 4R7OA 2XIBA 2E5CA 1V6YA 3PN8A 4LU0A 2J78A 1GRBA 3KOFA 3GG1A 7A3HA 2PU0A 2PCEA 1TMQA 3O3RA 3EEZA 1V02E 2E6AA 4LNCA 5K4XA 4Q8QA 2WVTA 4KWUA 1LROA 3ABXA 3KLJA 4DHGA 3C0JA 4GX8A 4FR6A 2V0TA 4PZVA 2FZDA 3IGXA 1D3GA 1KBKA 1ISWA 2GJRA 2J9YA 4YHGA 4DJDD 1GTEA 4EMWA 3UA3A 3SR6B 4FMVA 3PG9A 3A3XA 4L4LA 1QXLA 5JIPA 1JDAA 3GE7A 1NDWA 1PZ0A 4NJHA 7REQB 5CG7A 5I07A 1ZSXA 2ZE0A 3MP3A 5EBKA 3K8LA 4J35A 1JPDX 2ZXQA 3QR1A 1WOBA 4GY1A 2CU0A 3BJFA 4FF5A 1ODUA 1OZQA 3TJIA 3QFWA 2XUCA 1FHVA 1STZA 3EBVA 5CC5A 1GZJA 5ABTA 3SN4A 1BLIA 4RZBA 4ALDA 4GI6A 2E1DA 4AC7C 2QS8A 2HQAA 1B90A 1QT1A 4UZSA 1N61C 4IP7A 3VA8A 5REQA 4DXVA 3SCSA 3T2QA 3SCNA 3IS4A 1PYFA 3KS5A 4W4QA 1J0HA 3G1FA 3CV7A 1I2NA 3GS6A 4MKNA 3LCFA 3EB3A 1FWAC 1VZWA 4RW5A 3PSVA 1RHCA 4UXDA 1YE6A 3MZ2A 4QQUA 4IMEA 4F48A 5DY3A 2ZWZA 3TQ0A 2FZMA 1ZAIA 4PMRA 1CI1A 4F2TA 5BYWA 3KRBA 2X7VA 3M07A 4L4MA 4KPLA 1T6MA 2OEKA 4S3JA 3BLFA 4RNFA 1OCNA 3T8LA 2DSKA 4CQAA 4JNMA 5IHSA 2O9PA 1FH9A 3S2JA 3E38A 4EX4A 4C6MA 1UUOA 1JDFA 1QDSA 5ECUA 5HANA 1FHUA 2A3EA 5TAOA 1NHQA 1ONEA 3G1AA 1QNSA 1UWIA 3WUBA 2IW0A 1K03A 3O0KA 3I6RA 2WVVB 4GVIA 5CJ5A 1RBAA 1HVQA 5K9DA 1EC8A 4IWWA 2WCSA 1H50A 2QVHA 2ZX7A 1A0EA 4A6GA 4O28A 1BG9A 2XISA 4NYYA 5A69A 4NIRA 1SFSA 5LGXA 4ZOHB 2BY3A 2P8BA 4GI8A 1HP5A 4Y7EA 3WLIA 2BHZA 2J8TA 1C29A 1YADA 2VR5A 1R0MA 3I65A 3DGRA 2GSJA 3IRSA 3WQPA 2DSWA 1JDCA 2DORA 2YJQA 3U8GA 1VFLA 4TTGA 1DYSA 1WBJA 2VFHA 5LSMA 1GUVA 3WK0A 2VD8A 4IICA 1UQZA 2OLSA 1E6XM 1BWLA 3SCOA 4D6DA 1TKKA 4JFUA 3AJ7A 5HMEA 5E5CA 3W7EA 4A22A 3URBA 2J75A 1JD9A 1ZKQA 5GNYA 3W1NA 3MP5A 1ZCCA 1CTNA 3GTFA 3NSXA 3FG2P 3W70A 1FCQA 4RDZA 3LXDA 4HA3A 1TIWA 4NP7A 3A4WA 4D6FA 2GJXA 1GHSA 1O95A 2QGHA 3W87A 4GRSA 1BF2A 4XISA 1C8VA 4HGXA 5T91A 1FHDA 5AYBA 3F4VA 3BAXA 1O66A 1IZCA 3K8MA 5CPOA 4BWLA 5EFDA 2P3EA 1NP2A 4MADA 3MTWA 3T07A 1MFUA 3EWUA 5EMMA 1RK6A 3SGUA 4BR1A 4EK7A 4GXWA 1B2YA 5I02A 3DN5A 1NOWA 4XZHA 3A13A 3A7UA 3FS2A 4DJEC 5H6HA 3AS2A 5EMYA 3SCRA 1CXLA 4DNAA 4GZ7A 4JFVA 3N9SA 3IEBA 1LORA 3W2LA 1GPWA 4IG2B 4DJEA 1GVOA 2UBPC 2E7FA 2NQ5A 4PTXA 2OJPA 2BXVA 2WHJA 3LCIA 1WYIA 2H9AA 4PUKA 2BWGA 3N4EA 3HB9A 4LF1A 1PKNA 1TG7A 3BZGA 4AU0A 4ERAA 3ZYZA 4UTTA 4DAIA 1U1HA 1ZMDA 4GWEA 4QCFA 5ECVA 1DIEA 3NQAA 4B2DA 2BY1A 3NJ3A 2GYIA 1ZMCA 3UWEA 3CIXA 3QV7A 4HOWA 1VEMA 3PFRA 3S6TA 1XSJA 3UJ2A 1CXEA 1VYPX 1RCXB 2DDXA 1JQXA 2GGIA 3ZQ9A 2ZRXA 3SY1A 4BEUA 4MJZA 2Q8XA 3BTNA 1W1A1 4L6OA 3W2MA 1H6VA 4MKVA 1XL9A 3LX9A 3DK8A 1E9LA 5DXYA 4ZB2A 3NDOA 3H2NA 3G1VA 2HJPA 3N6QA 4H4IA 4MAZA 2WJEA 3DEQA 4HMEA 4KF1A 5FL1A 2TAAA 1XBYA 4QISA 4CCEA 1XIMA 2R1MA 3TONA 2EQDA 1TO3A 3MYOA 2PP1A 3STCA 3G1DA 3TSMA 5F4SA 2YDQA 2BSLA 4JQ3A 2V5LA 3VIHA 1XLIA 4HZMA 2WPEA 3GNNA 1UKQA 4W86A 4XZWA 2VDGA 2GVLA 4Q7BA 2Y0FA 3UY8A 3B9OA 2WHKA 1ESWA 1PS9A 1G4SA 3N1AA 3QGAC 1KQZA 3CXOA 1DQUA 1JL8A 1W8SA 3NQGA 2VX7A 3RIKA 4E2BA 3W1LA 1IT8A 4S1FA 3VCNA 4LEFA 4MM1A 1LTDA 4PB5A 1KR0A 2OGYA 3WNLA 4KEVA 2CHOA 3QKZA 4HYRA 1X6LA 3D47A 5FS6A 5H1WA 4FOUA 2HS8A 1KCXA 1OFPA 2OO0A 3TN3A 2QMJA 1QBAA 1WKYA 4GINA 3G22A 1NQKA 2WCAA 4UZUA 5DXXA 4B3KA 3NL6A 3WBEA 2OWXA 1XYCA 4ZO8A 2DVTA 3W7QA 3EOUA 4XBSA 2OVLA 1J93A 3DG6A 3VNYA 4LX4A 1PX8A 2WOWA 3EYPA 2XYLA 1F9CA 3OIHA 2H8XA 2CLFA 2QDHA 1EJXC 1TELA 4LQ1A 2NWRA 2NX1A 2V3EA 4EQXA 1V93A 1VCVA 4CD6A 4G7EA 2TMDA 3NQ8A 2E40A 4ZCWA 3W7PA 3W7NA 1H7RA 3SFWA 4QQ3A 2X2YA 3NQFA 4ZOAA 4YU1A 1UUQA 4LS0A 5CBJA 4FIRA 1ENUA 3TZFA 4UTMA 3WUFA 2X1IA 3H54A 1C7SA 1Z8AA 2TPSA 2R94A 4Q7IA 4JXCA 1UKPA 4W84A 5DX7A 1E51A 3DAQA 4PSRA 3MCMA 1BXBA 1EPXA 1TWIA 4ZFMA 2V3DA 1E4IA 3UF9A 4AZ5A 3QLLA 3AAMA 2XFWA 1TA3A 4L80A 2V68A 3WLLA 1FKWA 2WP5A 1OC7A 1RPKA 4L4OA 4XTDA 3OGVA 1X8CA 3OOQA 7TIMA 2C6QA 2ZRZA 1XQKA 4L1GA 2PTYA 1NOUA 1UR9A 3VZZA 2E5DA 4PA8A 2YZRA 2EAWA 3E0WA 3N2OA 3O6DA 5D2YA 1PCWA 4JS3A 1TYPA 3S83A 2E6YA 4OBTA 2QQ6A 2E5BA 2F2HA 2HMCA 3C2VA 5ABHA 1DJQA 2GQ8A 4POCA 2XWDA 3O1NA 4L4PA 4QR6A 1WA3A 3PPHA 5M17A 1YDOA 4Q3MA 3ABZA 3MUCA 3JR2A 3PP7A 5FEXA 1OX5A 2BLEA 3N15A 3GD6A 2RABA 1E5NA 3DFHA 1C93A 1KM6A 5DF0A 2J9XA 2F8QA 1XP3A 4HNNA 3WDPP 2D24A 1JPHA 4Q8WA 3AIUA 3APGA 2R1KA 3G18A 4CD8A 1VD6A 4U3CA 3KCLA 3WF0A 2WMKA 3G77A 1JCJA 1RVGA 3Q37A 1RQHA 2MNRA 3C4UA 4TO8A 1RXOB 4GCXA 4NVTA 3N3MA 4EXBA 3RMJA 4A3HA 3M0HA 3BVJA 2O4MA 3W1TA 1W5OA 3RO8A 3R94A 1OADA 4LSBA 3WLHA 1KXTA 3GIYA 4O1EA 4AAJA 4A8NA 4Z42C 3VNLA 4AY8A 1GOXA 1GERA 3CUZA 2C71A 4JKMA 3W28A 2W66A 4C6FA 2NXHA 4IUOA 3T09A 2PPGA 3JVAA 3PZ9A 2XN0A 3HGRA 3CT2A 1W3JA 2AGKA 1GNXA 4TXEA 5LHFA 4ONVA 4W87A 3EEGA 1LQAA 3LZ5A 4E8GA 3QY8A 3WJXA 3HQ1A 4AMCA 3DH9A 3GO2A 4UTJA 2Z2UA 1O5KA 1US2A 2A6LA 4TR9A 2CITA 3TNOA 2CBJA 5G2IA 1VHNA 4S2CA 1UR3M 4C65A 1GRAA 3U3HA 5C5YA 2Q3RA 4B15A 1OZMA 3N29A 3MUY1 5FD0A 2PLMA 2YXXA 3CHEA 3PTKA 1V6XA 3M43A 3LPOA 2WM0A 3AMLA 4JZ5A 4FNRA 3KEHA 1N8IA 1VJSA 1A3XA 4JTEA 5C9ZA 3RUBL 3SI9A 4ZVJA 1TZ7A 3E2VA 3ABRA 3WELA 5FJJA 1TR1A 1OJXA 4NZ5A 3HQPA 1H0GA 2OZ3A 2VD9A 5HPOA 1DJYA 2VO5A 3KP1A 1DWAM 4F0MA 3R1ZA 3UP8A 4EF8A 1WDRA 3YPIA 3ONCA 3TJ4A 1RBOB 3UWZA 4EQWA 3SO7A 1XLEA 3WLSA 3B8DA 1KM5A 3WLMA 2VUNA 2XIQA 3K4DA 3SGZA 2WSRA 2C18A 3NZ1A 2V5BA 4JIHA 3LZ3A 2BGQA 4I5UA 8TIMA 4HNLA 2BXYA 2YL5A 1S1PA 4DXXA 1EXBA 1XYZA 3IK4A 4DJFD 1DIKA 1ZBCA 4FZIA 1XWYA 1EHAA 5BXTA 4HN8A 3R4IA 4K38A 1EYWA 2BGNE 3G0SA 3S4TA 4C6NA 2WB5A 1KFCA 2UY3A 4QG6A 2X0YA 2OYLA 4JTHA 4P8VA 2D23A 4P5UA 3GFYA 3UG8A 3RU8X 1OX6A 6XIAA 1HW6A 4LNYA 5HJYA 1IGWA 2VCBA 1O4UA 4LY4A 1R3TA 4K68A 3CPUA 1BXCA 5EL1A 3NNTA 5CPNA 2YIHA 1D7YA 5C2GA 1DJXA 5LIUX 1JUBA 4KWWA 4AZBA 3UETA 1FH8A 4MWAC 1KBBA 1YBQB 1GW9A 1S2WA 5XINA 3NL2A 3NGFA 1U5JA 1PAMA 2R1LA 2ABAA 3UQNA 2WCGA 4ILSA 1H2IA 1RA5A 3MKCA 3W85A 1VBGA 1CGUA 1Y5WA 2VEFA 4QP0A 4XD5A 1UWRA 4K8GA 3NVYB 2DZPA 2TSYA 4NJIA 3CAWA 3L2MA 1CXFA 1V59A 4QS6A 2WKLA 3VGBA 4DF1A 1XANA 1PX4A 4DRSA 4WGXA 4GQBA 5GNZA 5SWUA 1FDYA 3M0IA 3U9IA 1JPKA 3DC0A 4DUXA 1H5VA 2Z2AA 4K8HA 4O1FA 2OQHA 4HNOA 4XZ9A 4DBDA 3SY8A 3LEPA 4GVHA 3KCJA 4B16A 5FJRA 5HNUA 3KVMA 4QROA 1G01A 1F3XA 1M68A 3S6DA 2AAMA 1QK0A 1VQZA 1GK8A 4GK8A 5I3IA 3WQEA 4HU4A 4C6CA 5JBEA 1THFD 1OK4A 4MHBA 1QHOA 3B0YA 3AHXA 3EA1A 1A5CA 2ZZBA 4H4ZA 1ML1A 1I60A 1EL3A 1HXJA 4XZMX 4EQRA 4UTWC 1Q3NA 1X2HA 4RDYA 3R10A 4EIVA 2ACQA 2F5ZA 2BVDA 5HAOA 2GDQA 3GC5A 5CZJA 1K6WA 1OD8A 2OLAA 4HK7A 4X9YA 5MF5A 2O9TA 1XCWA 1GVSA 1SQ7A 2WSQA 3TAOA 1H2JA 6XIMA 5A2BA 3R7MA 5GRTA 1W91A 4L6DA 3FJ4A 1U22A 3V16A 1O5QA 5I7GA 2VGGA 4HOZA 2OCZA 4O13A 3UXAA 2EJAA 3LGEA 3WCZA 2PRHA 3GAKA 2VWSA 2GVEA 5E9AA 1VFMA 4GVFA 1K8CA 3DYPA 3B06A 3UWVA 4Y9MA 3I68A 1SO3A 2ZX5A 3FGCA 2Y8KA 3BAYA 3MHGA 2C13A 1QHZA 1GJPA 1NQ6A 2JALA 1W31A 2GUBA 1N5WC 4IJBA 1SO6A 3WK2A 1VFUA 1M7PA 3V0TA 4UNLA 4N0RA 2ZTJA 4PMDA 1OX4A 3M44A 4GKTA 1WE5A 2A4AA 2XG9A 4W7WA 4Z1YA 3SQLA 1WDWA 1CGVA 4K39A 3H70A 3P14A 1GW1A 3UXIA 2D73A 2E3TA 2C14A 5D8WA 3LGGA 3VIOA 3C2RA 1CT5A 3IGUA 3C2EA 2CLHA 1P0NA 4GE8A 3VXGA 5E70A 1TWWA 5FOOA 3SSZA 4C90A 4ML4A 4M6UA 1WV2A 1T5AA 2IXVA 5KVIA 2X99A 1ALDA 1EJVC 2AOSA 3QQ1A 2VVNA 3P93A 4FPSA 2PZ0A 2ALRA 3P8IA 1TRIA 4EMJA 1LLWA 4KRUA 3B04A 4WEVX 1UZ1A 1HL8A 4XTIA 1T8XA 3SRFA 4KEMA 4UQDA 3QMRA 2A21A 3WMBA 2D1ZA 1LLOA 4D8ZA 2D22A 2WQDA 4DYEA 2RFGA 3GH4A 1Q66A 1E71M 1CLXA 3EWWA 5KMYA 4ZENA 5FJUA 4DUVA 3ORWA 4LWWA 5AHLA 2V2CA 3SRHA 1PO9A 8RUCA 1DJWA 3PBYA 3GVGA 4ZO9A 1ICSA 1A5KC 2JEQA 4E3TA 5C9UA 3EDJA 4LF2A 2EQ9A 4M56A 3S6OA 1DJGA 1VRDA 2D3NA 4LPCA 5JH2A 1GRFA 2YVFA 3GZAA 2QPUA 5LXEA 1NDYA 3U6WA 4BQ2A 5J5DA 1FOBA 2OPJA 3MC5A 2CBIA 1JEHA 4N6FA 4G7FA 4JTLA 1DWHM 4LS2A 2REQA 2O7QA 4ZGYA 1XC4A 2CZ5A 1HKIA 4JCLA 2J79A 4R33A 1XS2A 7ENLA 1EJSC 4WKAA 1M01A 6A3HA 3O16A 4B5XA 2SFPA 1W1TA 3W1AA 4O12A 2VENA 1IWBA 2ZA1A 3HM7A 3SRDA 1RK5A 4D6IA 1AMYA 3QHOA 1JIBA 4X60A 4XZBA 4QX4A 3ID7A 4FNTA 3WG6A 4K7ZA 1W17A 3QHNA 3H2FA 3M0MA 3CV2A 2PDIA 3PZOA 3GDMA 2PWVA 1P1XA 4Q8OA 3WNNA 1B54A 2YCJA 3B8TA 2CWNA 3CS2A 2J6VA 1SJDA 1Y0EA 2GL5A 1D3HA 3L9CA 3S0CA 2I5QA 3KRSA 1HF6A 3SBFA 4Z1CA 3FHAA 2BY0A 2TPRA 2E6FA 1M5WA 1V08A 8A3HA 4DM1A 4WIWA 4LIIA 1G7VA 4NZ4A 5GJMA 1OM0A 1RUSA 1IIGA 4H3DA 3R89A 4AMAA 1XDLA 4K7YA 1W2PA 2C1IA 4IGMA 2Z1BA 3ARSA 4L9XA 4XSMA 3TOYA 4TVUA 4IISA 1TPB1 4O4VA 2W61A 1AH4A 1CCWB 3WDQA 5HNTA 3ICJA 4V33A 3WDJA 2YAUA 1A53A 1JGMA 3VM5A 2PLKA 4Y90A 3LPFA 3OA3A 4J27A 1ME9A 2ZVRA 3RGTA 1Q6FA 3CMJA 3QTPA 1JRPA 1EPVA 3TQVA 3NRZB 1ZAHA 4RCXA 5CSYA 5LIKX 4FA3A 4DJFA 3ZVHA 4RNIA 4F2BA 1TJ2A 1X1OA 1GGOA 1OSEA 4YTRA 4GQGA 1GYMA 3JUGA 3KS6A 5HQEA 3PUOA 5HMDA 2X16A 4C6PA 3CUHA 1VH7A 5U1OA 1EIBA 1HJXA 3W1UA 1C90A 3P82A 1ZUAX 3U5UA 5A94A 1L6WA 4IPPA 3VNZA 2G5WA 1K4GA 2EJ1A 1IV8A 3AU6A 3WN6A 1YW1A 4ORMA 3NYZA 2G96A 4UR9A 1Q4NX 5IBXA 2C3ZA 4GIAA 1DXFA 2HVOA 4IX0A 4LB3A 4Q8UA 3F5JA 4AF0A 2WZEA 1U5HA 3HG4A 5AECA 4XBJA 4V28A 2W27A 3KVLA 4EQSA 5I03A 2J9ZA 5KEZA 3POCA 1PKLA 3S8HA 4UNKA 5HQMA 4LUSB 4XD6A 5A8NA 3KOZA 2QW5A 4S38A 1MNSA 4NRRA 2I9UA 4F8XA 4GMEA 2BVWA 2JBMA 2DZAA 1K7XA 1DV7A 1XGDA 2O55A 1E1CB 4S2BA 5FF7A 4TVCA 5JU6A 4ZEPA 2OELA 1YQZA 5JBDA 1JEZA 5D9NA 4LBRA 3E2SA 2X42A 1TV3A 1KXVA 3V36A 1REQB 3CH9A 3NSMA 4AQLA 1R3WA 3FEQA 3IUDA 2DZUA 3WH9A 2CBUA 2A1YA 4E2DA 1H41A 4NU7A 2ZUVA 2YDSA 3IUHA 4JTAA 3G1SA 2FGLA 2LLEA 3E1F1 1GQJA 3CUFA 1AD4A 1ZGDA 1L9WA 2X40A 3LTPA 4ZTYA 1FDJA 3FJNA 2NUXA 3NPXA 3NZGA 1VFHA 5U4NA 4E8DA 1XLMA 2DZVA 4X61A 1Y7VA 3TCSA 1XUZA 4EACA 4EMIA 1SSGA 1IGSA 5JUVA 5AOUA 3O6YX 1WBHA 1CW2A 2NV1A 4YN5A 4R7JA 2BC1A 2D2JA 2W62A 2B7PA 5AHIA 1XKJA 1VC4A 2CXEA 2PCQA 3RM4A 2W67A 3N13A 1DBTA 1E0TA 4H8VA 1JPMA 4N02A 2Z00A 1M7XA 3MJMA 1J0ZA 4ZQRA 2ESCA 2NX3A 3W2JA 2AQOA 2YZ5A 4NAEB 4Z2JA 3TROA 2WBAA 1KWGA 3BC9A 4PGLA 3L8KA 3NQDA 4BCEA 2PDMA 3UZYA 2BMBA 4ATDA 1PVNA 3T42A 3EOEA 1OYAA 3ES7A 1IEXA 2ABBA 2FHFA 2PP3A 2BOGX 3MSDA 2QUTA 5EMJA 5D2VA 2BCPA 4LVGA 1TPH1 1A50A 4UFMA 5DFAA 3AXIA 2XINA 1SO4A 2ZCGA 1UMYA 1XIIA 2EQ7A 4YTSA 1XLHA 1P0EA 2QCMA 5FJOA 2FHBA 5BOFA 1M6JA 4LRTA 5T9CE 2C91A 3WNMA 5I0DA 1ZZMA 3MSRA 3S9YA 4KESA 2PDQA 4GYJA 1NM9A 4HTBA 4YIWA 1NU5A 2Z25A 1LT7A 1VS1A 4MYAA 2R9ZA 3UA4A 1XCXA 1XYLA 4MJMA 2DW7A 2PF8A 1G94A 1U5VA 5ABFA 4MMWA 3QOKA 4S3DA 3C8NA 3ZFHA 4KMQA 1AQ0A 1ISZA 1PSCA 4RPQA 4QGCA 3DBPA 3SQPA 4YXGA 3NWRA 4FXSA 4Y9OA 3TYEA 1G9HA 1SVDA 4JQ4A 4M1RA 1WB0A 5JCLA 4PBGA 5AYXA 1DORA 3NUKA 5AC4A 5PTDA 1TWDA 4LYQA 4TMCA 2DH3A 2V67A 4Z1DA 3BOFA 3LSBA 3R8HA 2I17A 3W1XA 1G6CA 4DM2A 3GDKA 1BWCA 4KW2A 3MUZ1 4IQEA 3SJ3A 3D5HA 2YLLA 1K3UA 4F2UA 2QAPA 3PZGA 2PAJA 3WK3A 4LXFA 2GR0A 3VDGA 2FH6A 3LQGA 4J3VA 3W53A 5G5IA 1IXNA 4O8RA 5DT5A 3ARQA 2NVKX 4BV6A 4L1WA 1A4LA 1TYTA 4RDWA 4ML9A 3RJYA 3H4GA 3ARRA 1PKMA 2G97A 4C6IA 2OXNA 1X96A 4R9OA 3VCCA 4E6MA 4H9ZA 2DJLA 3FSTA 4UTTC 2PDKA 2FZ9A 3N2XA 4DJED 5F7UA 3EOSA 3PPGA 1W8GA 4JTKA 4C7FA 1ZL1A 1E6SM 2XN1A 3WEMA 2GJXB 4PTNA 5TIMA 3ZT5A 2PD5A 1XYFA 2JGYA 1NIUA 3OC4A 1B3ZA 2BOFX 3LHYA 1M65A 4OHQA 3V7PA 3W1RA 2BODX 2VNCA 3B9DA 3OJGA 3CQIA 2VT0A 1CECA 4NNCA 2GWNA 3UW6A 1VYRA 1JZ2A 5A1AA 5I3HA 3WBWA 4Z0JA 4H4PA 2V63A 1ECEA 4NEWA 5DRIA 4PB4A 3E02A 3LMYA 3CZKA 1NSJA 4NQ1A 1FCUA 3WLQA 3BLLA 2W5FA 3G3MA 4M82A 2QDGA 5FEZA 1J5SA 4AHOA 3M0JA 1S5NA 2W0UA 4OBRA 4DI8A 5M03A 1SB3B 3P81A 2FLIA 3AHZA 3O9NA 4O50A 2GQ3A 1JGIA 4RLIA 1EJUC 2VFIA 1HKMA 4IPLA 4E38A 4GKLA 5F1UA 4D1JA 1B3XA 2VX4A 3B4YA 1B0IA 4DO7A 3S3GA 3LDVA 3GXMA 4OQVA 2V2DA 3H21A 1QU4A 2OYMA 4MNKA 1PWMA 1SW0A 3BO9A 4DF0A 3ZLHA 1YTDA 5LKYA 2GOUA 2XVPA 3CZ8A 3KBVA 4MNJA 5E6YA 3P74A 1S3HA 1LVLA 1X38A 3T0DA 1F73A 2VJXA 3VGGA 4F0LA 4JQ9A 2IKGA 1J0KA 4GUFA 1R2RA 3R43A 4GO8A 4A21A 1K02A 2YXGA 3QJAA 3C3NA 1JI1A 3S1VA 1V79A 5G1TA 2PB1A 1JJKA 3IACA 3B9EA 4OE7A 2RDTA 3VTRA 4PTVA 3I7RA 3VC5A 2ZUUA 5EMLA 3W7OA 2QULA 3OLGA 1I0BA 2CLMA 3ARZA 3T05A 2QCHA 3IJ9A 3GLCA 2E1WA 4ERIA 1TJ0A 3ZJ8A 3A12A 1G5AA 1LUCA 4FLQA 4LVDA 4YTQA 4E8CA 1OB0A 3BQ5A 4NSBA 5AY7A 5AHNA 1P48A 2EXOA 3H4XA 3IAPA 2V38A 5F2LA 4KEUA 1GVEA 2A0NA 4RV8A 1AQMA 1MRAA 4OV4A 2NUYA 4L9ZA 5ENLA 3CL6A 4BF5A 2CNCA 1PL9A 3NQEA 4H4SA 1V6UA 4DWSA 3OQ8A 3DHUA 4YNGA 4GGHA 2EQ6A 4WLCA 1DJZA 4O14A 2YA1A 3RCYA 2E09A 4RL3A 2DZWA 3AWOA 2ZUTA 3ZVIA 3KP0A 4HU0A 2ZA3A 1FKXA 3ERPA 2R1PA 4F40A 4JIRA 2HXTA 1EA0A 3M7SA 5HULA 4QSFA 5EMUA 1GZGA 2QUNA 3HIJA 1FP8A 5FEWA 1R86A 2ON3A 3T78A 1AJ2A 3GNOA 3NDZA 4R88A 1JG9A 3HBLA 4X3ZA 3MBFA 1EC9A 4FLOA 4NYUA 1QPOA 3SUWA 2QUUA 3M0LA 1N55A 1XD0A 4ICMA 5ABGA 3L0GA 2V5DA 3U7BA 3IVUA 3T0CA 3SADA 2PDLA 5C54A 2PDWA 5I78A 1A5UA 4K1GA 5G4HC 2GDUA 4GR1A 1E1EA 1D8CA 4E4UA 5FJPA 1FWWA 3TAKA 2WNNA 4QE5A 3MW7A 4R34A 3GIPA 5B7ZA 4GUIA 4CCCA 1TWSA 2WNWA 3IANA 2R82A 3USBA 3GQYA 2XSXA 5LNWA 3PB0A 3EDKA 4U3AA 3DGHA 2BZNA 3Q94A 1OT1A 3WX7A 3O05A 1E1CA 1JAEA 4HCHA 2PA6A 1I0DA 3HG3A 3HV8A 1J96A 3PNUA 3PBVA 3GD4A 1IQ8A 4J9JA 3NQ2A 3KDOA 3M0ZA 1ODZA 4NJKA 4OFCA 3IJLA 2FGBA 2AKZA 1Q6DA 1WKDA 2I1OA 4LFYA 3UERA 5A6BA 1E56A 2ZZ5A 4TU1A 3ZOAA 1K1DA 3W1QA 3UR5A 2VDIA 4ZFCA 3ZSSA 1XDJA 4HB7A 4ROQA 2C3DA 1GG1A 1YBQA 2WQPA 2WWDA 2PTWA 3QXBA 4JYDA 4K6AA 3WUGA 3FSUA 3E5PA 3H2AA 3TTYA 4Y6GA 2QV4A 4H7VA 4UMAA 2GJPA 1QBBA 2G3FA 4QDPA 5CLWA 1HJSA 1BGAA 3L4UA 3IC9A 4PUUA 1EFZA 1JZ8A 1Q7ZA 4MG4A 4H7CA 2AMGA 3GTIA 3PAOA 3AMZA 3RPTA 5C8BB 4UMCA 4G56A 4LUTB 3PZQA 4F9DA 5K4ZA 2BNJA 5FEPA 5MHBA 3CGCA 4EPKA 1E4MM 1QNPA 5D02A 4HMCA 1UD6A 5D2XA 3WLRA 3VIIA 4HNUA 3U4FA 3KWSA 3S1GA 2WV8A 3L2LA 1POKA 4M8UA 5E0KA 1WPCA 3LLFA 1PWLA 1XDMA 4ZOCA 1FVPA 4P7OA 3PBMA 3CYVA 4DBUA 1DVJA 2Q71A 4GUGA 1XLFA 4U31A 4K3ZA 1S5TA 4N9BA 3CMGA 2IQDA 2PZNA 1PEZA 2ACRA 1J12A 3IJQA 5L9FA 3D9XA 5CGMA 2X8CA 4JNZA 1WDSA 4PCTA 3OZOA 4H04A 4HPHA 1SFJA 2DT0A 2QLYA 2F6UA 3GG8A 3CXBA 4AZCB 4O11A 4KKXA 4CNNA 4WDXA 1LWHA 3QY7A 2NQZA 3HPZA 3HURA 3HV9A 3PS7A 3T40A 3BJTA 3SQMA 3QKEA 3LLDA 7CGTA 4XVEA 3OYZA 2J7BA 2WPGA 3TJLA 2FVKA 4AEOA 4GJJA 1XLGA 1M7OA 1BQCA 3AISA 4XAGA 3TXZA 5LZLA 1SFTA 3PHAA 3W24A 1ZCOA 4IXHA 2Z1KA 3CUIA 4EM4A 1N62C 1OCQA 3GTNA 1UPPA 3OVGA 1A3WA 5A8OA 1JF5A 3MMUA 5CJNA 3TUUA 1PIGA 3RK8A 1BKHA 4OBSA 3WD1A 1KFJA 1NELA 3BWWA 4FLSA 4O15A 4REQA 2W79A 4NXSA 2C3CA 2FTPA 3MDWA 4O1AA 1HKVA 1A5BA 3DI1A 2QHAA 5JIWA 5GJNA 4MLRA 3DYOA 1SR9A 1TMHA 4H4XA 2GJNA 1PXGA 4IL0A 2FQIA 3LXAA 3TNBA 2UY5A 3W71A 1CPUA 1YXDA 4PEEA 3LPGA 5FCZA 4ZO7A 1GEHA 4WJXA 4S39A 3S47A 2EPHA 2J66A 2JFEX 2I9EA 1SW7A 5IFPA 4L64A 1W3LA 4IHCA 3BL3A 1JYXA 2XM1A 3VKBA 1KBLA 4WHBA 3WL0A 4HPXA 1K9DA 2WANA 3NQVA 1SSDA 3STFA 1ONRA 1T96A 4JX4A 4PMJA 2CLEA 5C0QA 1UWAA 3GFXA 2OLHA 1HX0A 1P0BA 3UU0A 4PTWA 3WFZA 4QM1A 4IXXA 1R2SA 3A22A 1WDPA 2YBTA 4Q6XA 3CHVA 1QWKA 1ADOA 1O5RA 3MHFA 1F8WA 1G1YA 1DHPA 2QCEA 3KLLA 1T40A 1H11A 5KZMA 1KKRA 4IOTA 2RAGA 1S38A 4LB4A 2Z2BA 3H2MA 3AMKA 3PVFA 3C61A 3TLQA 3RRXA 3PZUA 4EANA 3WQOA 2ZC8A 3MHUA 1TYGA 1VF8A 1JRBA 3HFYA 1R85A 3P6LA 4H9TA 1UH2A 6REQB 2HV5A 4XKYA 1QTWA 3BLEA 2PLCA 5FKYA 1NFGA 1TTQA 1WZAA 4Q4RA 4O0QA 1ZB5A 1V0NA 1RBLA 3QYSA 1J8VA 2FMOA 4GUJA 1Q1RA 2YLAA 1TVLA 4A4AA 4UFIA 3EA2A 3OEXA 4LAMA 1HZYA 2HK1A 4H00A 1QI0A 2IPGA 2FIQA 4KEZA 2CCRA 4ATWA 1A5NC 4M6QA 1J5TA 3LY0A 2V81A 1DE5A 4QDMA 2C1GA 3CGBA 2VXNA 4J3UA 2R6OA 4HVXA 5C9XA 3VIMA 3TMLA 3LBOA 3SEPA 2Y8VA 5JCMA 3E6EA 3L4ZA 2FPVA 4DUOA 4GQRA 1TV8A 4L65A 4WSJA 5FA5A 4NF7A 4TVWA 3T08A 4HSOA 2G37A 2ZQ0A 3NIYA 4DEFA 3LNMA 1TPVA 4N9DA 3M47A 2ZKMX 3HTWA 1NFPA 2ZXBA 3UESA 3DK9A 2ZFAA 1OFDA 2I56A 3CZGA 2FPTA 3E2QA 3EX4A 4MUPA 5CPMA 1ISXA 4CEUC 1S46A 2F38A 4Y8FA 1PE1A 4F66A 3MANA 2Y7DA 4MWAB 1GORA 1V3JA 1HGWA 4ZB0A 4IMFA 2P53A 1EEPA 3LHWA 2QYGA 1KTBA 2RJHA 4J3WA 2KX9A 2P5NA 4HIBA 1XXXA 4JTCA 3G1RA 1GV4A 3MV01 1KNWA 2EG8A 2HZGA 2CWXA 2FVLA 3STEA 2QJIA 2DSVA 4EM3A 3ARXA 1MUCA 3TE9A 3B8UA 3OHIA 2EGZA 3WF4A 4OOUA 4JL1A 1IE7C 2ZOXA 3DFNA 3C8FA 3SY5A 3W88A 3Q45A 1CBGA 3TYAA 3IIOA 3WIJA 3LS9A 1AQFA 1F3PA 3EB2A 1E43A 3HW2A 3QR3A 2NVAA 3IVTA 3P84A 4NNBA 2JEPA 1W5NA 4B4FA 3BCFA 4QJ1A 1O5XA 2YB4A 4Z2IA 4LVAA 2HRWA 2BGSA 2ZZ2A 4AX7A 3TSBA 1GZ1A 4H41A 2FHCA 1GHRA 2F2KA 3NOEA 3B0PA 1Q5MA 2VX5A 4MWAA 5TBOA 1Q6OA 2CC0A 3VZYA 1CWYA 5BRPA 1VHCA 2OZ0A 3KBWA 2V9DA 5IDZA 3QZ6A 2WC3A 4LUSA 3GNRA 4JHMA 4D2JA 1DPMA 3WLJA 4ZQNA 1XH0A 1BXNA 1AQHA 1K9FA 4GJ1A 1IHIA 1UQYA 1E0VA 2JGQA 4QG8A 1A5AA 1GG0A 4ZE5A 4C7DA 2PODA 1AZ1A 1PTAA 3ANUA 4X0NA 3VDCA 3QTGA 4AVFA 5H91A 3AZSA 4LYRA 1NOFA 7ODCA 1F07A 3RRAA 3N2BA 2PRLA 3ARYA 3TX9A 1UPMB 1HO1A 1GVQA 4AWEA 1E55A 1CZ1A 1HNYA 4O17A