3PK7A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens with mg and glycerol bound in the active site
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
403
structure length
396
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVYEPADSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens with MG and Glycerol bound in the active site
rcsb
source organism Chromohalobacter salexigens
total genus 150
structure length 396
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2010-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3pk7A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3pk7A01
2POZA 3H12A 2GGGA 3TWAA 3TCSA 2PGWA 2QJJA 2O56A 3FXGA 3K1GA 3P93A 3JVAA 3DESA 3CT2A 1YEYA 3FYYA 1XPYA 2GDQA 4GISA 1WUEA 1FHVA 3V5CA 2NQLA 5BOFA 3NXLA 3V4BA 5BOEA 1PDYA 2DW6A 2ONEA 2PMQA 3S47A 3DG3A 1W6TA 4G7FA 4FI4A 3IJIA 4IP4A 4GYPA 4GIRA 2P88A 2QDDA 1EBHA 3UJSA 4HCDA 3ZLHA 2AL1A 4E6MA 3VC6A 2OO6A 3QPEA 3DDMA 3DGBA 3I6EA 4JN7A 1WUFA 2FKPA 3MWCA 3OW1A 4DX3A 3RO6A 3SJNA 2PTZA 3VCCA 3TJ4A 2OZ8A 3EKGA 3TOYA 3N4EA 3NFUA 3QKEA 2QJMA 4KT2A 3R0KA 4IP5A 1IYXA 3OP2A 3EEZA 3BSMA 4DWDA 4ROPA 2GGIA 4E4FA 3ZVHA 1ONEA 3TWBA 3T6CA 2HNEA 5FJUA 3GO2A 1MNSA 1BQGA 3FJ4A 4K8GA 1TKKA 4HCLA 4MGGA 2I5QA 2P3ZA 3DG6A 1P43A 3S5SA 1JPDX 3TW9A 1ECQA 3VA8A 5FJPA 3H7VA 4E8GA 1PDZA 3SQSA 2QGYA 3QLDA 3DERA 3U9IA 2OLAA 4KWSA 3MY9A 4ZCWA 2OQYA 3TQPA 1JPMA 2AKZA 2PP1A 2PODA 3SBFA 1MUCA 2OFJA 3NZGA 5J04A 3R1ZA 2MNRA 2PU0A 4JHMA 2GGJA 3VC5A 3SN1A 3OPSA 3ZVHB 1XS2A 4J1OA 1NU5A 4DN1A 1E9IA 2QJNA 3T8QA 2QDEA 3DG7A 2P8BA 2QVHA 1KKOA 3ZLGA 3Q4DA 1ELSA 4FP1A 3T9PA 3R25A 3STPA 2HXUA 3JW7A 3QTPA 3MZNA 3OZMA 4H1ZA 4HYRA 1OEPA 4M0XA 1MDRA 4IZGA 3BOXA 3TJIA 4X2PA 4DYEA 2MUCA 3SSZA 3PK7A 4HCHA 3GD6A 4IT1A 3CK5A 1SJBA 2XSXA 3I4KA 2PA6A 3H70A 3VFCA 2OX4A 3IJLA 3U4FA 3SN4A 3PWGA 3D46A 3I6TA 2FYMA 4YWSA 3HPFA 3FV9A 2AKMA 5ENLA 3UJRA 4H19A 3RITA 1R0MA 3FVDA 3IJQA 3N6JA 4A35A 2AL2A 4GYPC 3SN0A 2PP3A 3ES8A 3RGTA 3NO1A 1P48A 2GGEA 2PS2A 4IL2A 4HN8A 3ZVIA 1EBGA 3H8AA 3OTRA 2PPGA 4Z17A 4GMEA 2PTWA 4A3RA 3R11A 5FJOA 3UCDA 2GL5A 3UJFA 4H83A 7ENLA 1EC7A 2DW7A 1TZZA 1JCTA 1JDFA 2XH7A 1NELA 1EC9A 4IHCA 2AL2B 1BKHA 2PTYA 3CYJA 4MMWA 3PFRA 3TTEA 3THUA 3CXOA 5EU9A 3DFYA 2OG9A 1SJAA 3JZUA 4M6UA 1R6WA 4EWJA 1L8PA 1KCZA 3ENLA 5IDZA 1MDLA 3Q45A 5FJRA 2P0IA 3RCYA 2XH2A 6ENLA 2OPJA 4H2HA 2QQ6A 2PSNA 3ZLFA 2XGZA 3MUCA 4HNCA 1DTNA 2XH0A 3P3BA 3MQTA 1KKRA 4HNLA 4IL0A 4F4RA 4GFIA 1F9CA 3T4WA 2XH4A 4E4UA 4KPLA 2P8CA 3UXKA 3B97A 4KEMA 3DIPA 3ES7A 4K2SA 3MKCA 2OKTA 2ZADA 4GGBA 1RVKA 3MSYA 3RR1A 3GY1A 2RDXA 3QN3A 4MKSA 5FJTA 3RRAA 3GC2A 3PWIA 4DXKA 3DEQA 3UJEA 2CHRA 2OQHA 3KUMA 3V5FA 3V3WA 3DFHA 4J3ZA 3UGVA 1MRAA 3CB3A 3UXLA 4DHGA 2ZC8A 3R10A 3VDGA 3OZYA 1TE6A 4HPNA 2PU1A 3N4FA 4JN8A 2PP0A 3BJSA 3CAWA 2HXTA 3FCPA 3VCNA 4Z1YA 2GGHA 3R0UA 1SJCA 3P0WA 2PGEA 2PCEA 2OZTA 4E5TA 2PTXA 4A6GA 3D47A 1EC8A 3UJ2A 4ENLA 4GGHA 3UCCA 2OVLA 3IK4A 4G8TA 1FHUA 2OZ3A 3N6HA 1SJDA 4K1WA 2GSHA 4ZA0A 1KD0A 2HZGA
chains in the Genus database with same CATH superfamily
3QQ1A 3UWEA 3SAZA 1RSCA 3MA8A 3W02A 3ZT5A 2F7FA 4UUIA 3H12A 1VFTA 4BF5A 2PGWA 3GBEA 2O56A 5JU6A 3EDJA 1BWLA 3W87A 1K9EA 3LLFA 3MP5A 2OEKA 1PVNA 1IT0A 1K03A 2IUZA 3SGZA 1W0MA 4GIYA 5HDRA 3GXPA 1LT7A 3TZNA 2DW6A 3HFTA 1GRHA 3S47A 2Z28A 5DBUA 1W6TA 1XGZA 2E1WA 4FHAA 1OJXA 5D02A 1R5YA 5CAKA 1OYCA 3L8KA 2JE8A 1G9HA 1NEYA 2A6NA 5BROA 5M5DA 4DNAA 3NL5A 2PDNA 2O9TA 3AWOA 2I17A 3QRHA 2DUZA 1Z3NA 1A3HA 3QV6A 2EPOA 3F7JA 4EXQA 2QGHA 4QXIA 4AU0A 4BI7A 1O66A 2H3BA 1DTUA 1OY0A 2YCLB 3TIMA 3IVSA 2J3NA 1V6YA 1H0GA 3NFUA 3MVIA 1AODA 4B2DA 4WSKA 3G3MA 1QK2A 1J6PA 3RU6A 3WUFA 3ITXA 3GXDA 3L2IA 1KC7A 3A13A 3MI2A 2VX7A 2GUUA 2VKZG 4US6A 4AZBA 1AQMA 2WYSA 2YOCA 4RX0A 4YTTA 4QX4A 3EPNA 2W5FA 3E2SA 5AC6A 3UY8A 1XC4A 2ZUTA 3VIHA 3EMZA 1TKKA 1DBTA 5SWUA 2P3ZA 3WENA 3S5SA 1JPDX 2DJXA 4BJHA 1M04A 3N13A 7PTDA 3RN6A 5G1TA 3N2OA 8RUCA 3QPZA 1U2YA 1YNYA 3CLWA 4JCLA 1GVEA 3MY9A 1GCYA 2XFYA 3NSMA 1OT1A 5GJMA 4JTKA 2AKZA 3RILA 3AU2A 4GJJA 2X1RA 1NF0A 2OFJA 3R1ZA 1G67A 3GG7A 1GOMA 3OLEA 4P8VA 3NS1B 1XYCA 3BGJA 4XB3A 5FSEC 3CMFA 1TB3A 2FFIA 4FMVA 5I3IA 4FX7A 2OX1A 4C6LA 5DRCA 2HMCA 2VEPA 4A21A 1RD6A 3C0LA 3CQKA 3V7PA 5LNUA 3J7HA 4LEQA 4Y96A 4NZ5A 4DO5A 5AHIA 4PCSA 5ECUA 4AIUA 5ECVA 1OEPA 2NQ5A 3W37A 1L6SA 3R8GA 3VGHA 5HR6A 2ABBA 4G5DA 4RNHA 2WVSA 3W73A 1MYRA 2WCSA 5AC7A 5C7VA 3G1RA 5LIYX 2INEA 1X7FA 4IT1A 2YLAA 1NWSA 3DFPA 2PA6A 3L67A 3B3DA 2ZZ7A 4F0HA 3O05A 3K1DA 4GHRA 1XGEA 3QTGA 4JDBA 3K5XA 4S3EA 1F8IA 1QBAA 3ID7A 3LOTA 5HINA 2ZXDA 3UW6A 4JTCA 3W1UA 3VOIA 4DWSC 1IXNA 4ERAA 3A4WA 4S23A 3CIWA 5CZJA 2Z7GA 3LTYA 3WF4A 3T0BA 7XIMA 5HJYA 3ORWA 3UWWA 1A5UA 3KAOA 2PDYA 3MO7A 4HZ8A 7REQB 1NY1A 2E9BA 4XVEA 3E2RA 3MT1A 3QZAA 4GKTA 2A5HA 3ZT6A 1BQCA 3MU7A 3URBA 4M6PA 4O0QA 1F3WA 3WF3A 3AHZA 1X1ZA 4NT0A 2BWGA 2Z1BA 1F3EA 5LHFA 1X6UA 3RIKA 4JIPA 1DJIA 3RDKA 4LVFA 2OU4A 1J12A 2PD9A 3C0SA 1ZTVA 3WLTA 2VO5A 3ZS4A 3M9YA 1CENA 3KP1A 1CLKA 4GZJA 2Q6ZA 5GVJA 4QP0A 4IIFA 1FCVA 3WH6A 1RCQA 5HMEA 3CHFA 3M0YA 4DJFD 1GEQA 1QU4A 3PZ9A 4J2PA 2OT0A 3LPFA 3QFBA 3B8TA 4L56A 1BGAA 2R1LA 1JVNA 2DUAA 1YPXA 1FFUC 1O12A 3IUHA 3CMJA 3GTIA 4LYRA 3H53A 4KKXA 3VIFA 5KVIA 1WQ5A 5FJIA 1XKJA 2VJXA 4N9EA 1EQPA 4EIVA 4HOXA 2WMKA 4CN6A 2NLIA 3FDKA 5ABEA 5HNTA 1TWSA 4IL0A 2VFDA 1V0MA 2XU2A 4IISA 1PXGA 4KEMA 1QPNA 1XWYA 4CU7A 5REQA 4WCJA 2NUXA 3CQJA 4IIDA 5AVHA 4B5UA 3L68A 3USBA 5HMFA 2YZ5A 3QSRA 4C91A 3FKRA 1FEAA 1FH8A 3SADA 3DU0A 1D3GA 5I24A 2V2DA 3SB0A 2PDXA 1UA7A 2QUMA 1UR8A 3P61A 3NA8A 4S3KA 5GNXA 3DEQA 2ISSA 1KQYA 4C6PA 3UT0A 3SCTA 5AHNA 5A3HA 2O4MA 3QXBA 4F66A 5CBJA 2DORA 1XRFA 2FHFA 4MWAB 2ZICA 2ZUUA 2YBVA 2R82A 2X30A 3W1XA 2HNHA 2HISA 1GW9A 2X41A 3KVLA 2V3DA 1VCVA 5CSSA 5REQB 1A0CA 3P6LA 1P0NA 4CEXC 1EA9C 3NJ3A 4Q3MA 4TX8A 4KGLA 3APTA 4K36A 4ENLA 3B9AA 3CMGA 1W31A 4G8TA 2WC3A 3E02A 2E3ZA 2PDHA 3GU1A 4NILA 3EANA 1NWUA 2PWFA 1W1TA 3LI1A 1EQCA 1NSJA 1JI1A 3WNOA 4INFA 3RRXA 1XRTA 2WZIA 2BG5A 3IUIA 1RALA 3DFQA 1HN1A 3CAQA 1RJRA 3NQGA 4XZMX 5I78A 4O57A 3VUPA 4H4QA 3W7JA 2EG8A 1H62A 4AD3A 1MQPA 1J5SA 4NJJA 2WHMA 2VGBA 1GQIA 3WUEA 5DLCA 2GQ8A 1V79A 1QWKA 3NVZB 1WZKA 2W0UA 2NLYA 4HCDA 3ABXA 3PZTA 4XWUA 2CPUA 1XLCA 2JBMA 4W89A 1RBAA 4DJEC 4JN7A 2CNCA 3ZT7A 2JFEX 1W2VA 4XD4A 3HURA 3NZ1A 1DJHA 2Y8VA 3BANA 4AVNA 1U22A 5BXPA 1KTCA 3HGJA 2CLPA 3BC9A 3FHAA 1F7BA 3M0VA 2YVFA 3PSWA 4N4QA 3KOXA 4Z0JA 1DQUA 5TF0A 3NNTA 3B04A 4KT2A 4L6DA 4AX6A 1OFOA 3HB9A 3S2JA 2E1DA 4PTDA 4AHOA 4FOJA 3A5FA 2WSPA 4Y9NA 2A3BA 4WSHA 3GNNA 4YPJA 3QEZA 5EMLA 4ZMGA 2E5BA 3CHVA 3L5MA 4GR1A 1PDZA 3N18A 1VCFA 5D37A 3T2QA 4JYEA 4N6FA 1PBGA 4I6KA 2A8XA 3W74A 3S5YA 1CXLA 3I6RA 4JX5A 1T99A 4JHMA 4IFKA 1LLZA 3GNDA 4DJDD 2ISWA 3N19B 3ATYA 2Z1SA 2E5AA 4XTDA 3CU2A 4ICNA 1FWRA 1KRBC 2XG9A 1EX1A 1E9IA 1T3QC 3KLJA 3T8QA 1PTAA 2FTWA 3E2QA 3H2OA 2FDSA 3IACA 2VC5A 3EOEA 1MQRA 4P5UA 3RCMA 5JCIA 3PTQA 3VIJA 1EJVC 4DUOA 1MI3A 3H24A 1KRAC 3DHPA 1H7RA 3CZEA 4GC4A 1L2QA 3WLJA 1O60A 1SZRA 3LTPA 3IPWA 2IPFA 3NL2A 4C60A 3OZPA 1CYGA 1TYPA 4H9YA 1KR0A 2FIQA 1RQHA 3TJLA 2GWNA 4AD0A 1WDQA 4RDVA 2XSXA 4W93A 2X8RA 4HJWA 4KPRA 3GKAA 4EANA 2WXDM 4ZQNA 5HXMA 2W6RA 1OK4A 3ABRA 3GNXA 3IV3A 3IARA 4O1AA 1CNVA 5GPRA 1H2IA 2YDQA 1OVDA 4NSBA 4HB7A 1I1WA 4AWEA 3RGTA 3CZLA 2E25A 2C14A 4PRRA 3P74A 3A7RA 5HWJA 4AZCA 5DCDA 1MXGA 4HHPA 4IFRA 2P0OA 5E6YA 2QHAA 2PB1A 4Q4KA 4RL3A 4E3VA 3W22A 3CM4A 4DYKA 1BWKA 4J3WA 2VGIA 3EWDA 1HO1A 4EMIA 1QJWA 2ZRWA 3OVRA 4R9OA 5AC4A 3G6LA 2E6FA 4J5NA 3FEMA 4GUHA 1IR2A 4RE3A 3BW3A 3GVVA 4BCEA 2RUSA 3W25A 3W7KA 1I9CB 3P8JA 2GYIA 2Q3OA 2J66A 1SGJA 1A5AA 2QJHA 1VJZA 2Y7EA 3PFRA 4JZ5A 1XIEA 1HFBA 2VC6A 1P0BA 2YGYA 1X39A 1JCMP 4O28A 4YVPA 3GFZA 2PTDA 3VK5A 2JGQA 2DVXA 2X2GA 1DV7A 2ZX7A 2HVNA 2V3FA 4HHLA 1KBBA 4XZNX 5D03A 4QG9A 3LXBA 3TTQA 5IM51 3DK9A 3TE9A 2E8YA 4GC3A 1YPIA 3HV9A 4H2CA 2PDMA 3TFCA 2YL5A 1JG9A 1IEXA 1Y5XA 4GI4A 5BXTA 1TIMA 5HJXA 4ZQMA 4RXGA 1V3JA 1MXSA 2IS7A 2E3TA 1FCUA 2O55A 1Q7QA 2QV5A 3OLDA 4HNLA 4D72A 2QV4A 5IHRA 3W76A 3DECA 2OB3A 5JVLA 3M64A 3HOJA 3W2LA 4H04A 3ARZA 2IXUA 1AQ0A 4A29A 1K6WA 4NAEA 3LY0A 3VD3A 1H60A 1Z89A 2G3NA 3TTSA 1G01A 3PUOA 1TUFA 2WKJA 4DNMA 4MKSA 3ZZ1A 2DV0A 3V18A 2ADAA 4M6QA 3NR0A 4Z2LA 3EEGA 2MANA 3TNOA 1PYFA 1WKDA 5G2WA 1P6WA 1UR3M 3VOHA 1UOZA 1N5XA 2ZC8A 2VRJA 5CSRA 3VDGA 3LZ5A 2PU1A 3NM3A 1UUMA 5IFPA 1LWIA 1AMKA 4NIRA 3CL8A 4G56A 1EH9A 4MJZA 1XR2A 4H9XA 1ZMCA 3L0GA 4JTGA 5LKYA 1ZPTA 1Q7ZA 3D47A 5U1OA 1Q65A 3GDRA 2OTDA 1R7OA 1ZFJA 3EWWA 3QPYA 1LDCA 1FEBA 3TX9A 1FHDA 3DUGA 3TMQA 2B0MA 1M53A 1I2OA 2VEGA 2GGGA 3LPPA 4XAGA 2QJJA 3OJGA 2R8WA 2BCPA 5CG7A 3P93A 1NP2A 4O0KA 2WLYA 4XUGA 4RUBA 4O19A 2ZRYA 4J35A 1V59A 4OTKA 2GDQA 1H7OA 3OG3A 4TV6A 4UTHA 1QOPA 4H00A 1V02A 3L0NA 4CNUA 5K3VA 3AIWA 1JD9A 4QJ5B 4CN1A 1B3VA 4WZHA 1SZNA 4TX6A 3QMSA 1N60C 4PMJA 3V4BA 1XIMA 3BPWA 5F4SA 1SMDA 1H5YA 4BQ3A 1E4LA 3IJIA 4REQA 2WZEA 3ATZA 5TIMA 1MW1A 3QC0A 1K70A 4EOUA 5FS6A 4DZAA 3KFTA 3ZLHA 2GJLA 3CPRA 3FA5A 2I16A 4MF4A 1ME7A 1JZ6A 1KW1A 3I6EA 1MNZA 5LZLA 2R24A 2Z25A 4QS5A 3KLLA 4HOZA 2EGZA 5A8PA 3ARQA 2A3LA 4YCOA 2YCKX 3QKEA 1M3UA 4UQAA 1TV5A 1S1RA 1UHVA 1HZYA 1EEPA 4LUTB 1K9FA 4PB5A 1K8CA 1WOAA 1FTXA 4IGHA 4W7UA 2QJIA 1V3KA 2CLHA 3UYCA 1BFNA 4D6EA 1DORA 3DENA 3HM7A 4PMXA 2R91A 3LRKA 4IX2A 1AH0A 1FDYA 3PZVA 5JCNA 3GB6A 3NQVA 3CPUA 1OX4A 1XDLA 1EYEA 4EMWA 4ML4A 1XBYA 1QK0A 2XYLA 2D2HA 2HCVA 1M03A 2FB3A 2Z2UA 4OOUA 2F84A 2VCCA 3OVGA 3EX6A 3W7LA 1X98A 3V36A 4JL1A 4MFEA 3QOMA 4N42A 4RE0A 1V7AA 1N5WC 1FX6A 1O7AA 1V6VA 6XIAA 2YA0A 4X0NA 1VYPX 5I02A 1GVIA 4LFYA 1IIGA 2BS9A 3PSVA 4GXWA 1GKPA 3DH9A 4PMRA 1JJKA 3B9EA 4UR9A 1POKA 4H41A 4K7YA 1KKOA 5HQMA 1BSLA 5IRPA 2AAMA 3NVWB 1NARA 1ELSA 1LM1A 3SY8A 1IZCA 3R7MA 1MO0A 2Y61A 3U0HA 3OLIA 3THAA 4DELA 3BXWA 4MUZA 4IGNA 2WSQA 4WJ8A 2YA2A 1UH4A 4JTSA 4NHVA 1W5OA 1TJ0A 3L4ZA 2IKJA 4G6CA 3PJWA 1QDSA 4BQ4A 3MJMA 1QPOA 2WPGA 3FEQA 1MRQA 4MDPA 2VDHA 4BURA 4ZODA 2OOFA 4YWIA 3WJSA 1E9YB 3SCSA 3SN4A 1ZS2A 1LRTA 1ADDA 2OZ0A 4A8NA 3P2VA 1GVSA 4B2DD 2X42A 2AKMA 3E6EA 1I60A 3RITA 1CB7B 3EF6A 3SO7A 4H6EA 2YAUA 2HBVA 3GDTA 1PHQA 4UQCA 5A6AA 1STZA 3C2EA 4P61A 1SMAA 4C6BA 5J5RA 1XIHA 4JEQA 5FSDC 2AQWA 5HWMA 3R07C 4UFHA 3KS5A 3SUWA 4OKDA 4F0LA 2BP1A 1ITXA 2IPGA 5D9NA 3AMKA 1SO3A 5K9CA 1SZEA 2FGLA 3WBYA 3HQOA 2Q01A 3AXXA 1FFRA 2QAFA 2EAWA 3SEPA 1HJXA 5FJOA 1Q1RA 4NQ1A 7ENLA 4B5TA 5HQEA 1K8XA 3NQCA 1T8XA 1F07A 2XVPA 2ZVRA 3WH7A 2JIEA 1VEOA 1UWIA 2F2HA 5G1YA 2HK1A 4D71A 2J24A 4Z1BA 2OODA 1GOXA 1FP8A 5CXPA 1R3QA 3CL7A 4EM4A 1VEMA 4AY8A 4G2DA 4EVZA 4JIRA 2ESCA 3NDYA 1OADA 1B3ZA 3OHIA 1KB3A 1UROA 4OV9A 2BXYA 4F8XA 3C56A 3IGHX 1TIWA 3WDRA 1GRFA 1XH1A 3GFXA 3IRDA 4YYFA 8CGTA 3CZKA 3RCYA 3EKLA 1H11A 2EBNA 1E0UA 3EB3A 3AS3A 5FOOA 4XISA 3V1PA 3LX9A 4AD1A 2BC0A 1XLDA 4H9MA 4XUYA 1DTNA 1N63C 4QR6A 5TNVA 2V63A 3ARUA 4NJHA 3BSGA 3RLUA 3ZFHA 4YHGA 4W5ZA 4RZ5A 3LLXA 1LG2A 3KCJA 4UFLA 2G95A 2CITA 1I2RA 4L5ZA 1Z41A 4HK6A 2Y7DA 4DM1A 4IQEA 2DJLA 2WJZA 2ZA1A 2UV8G 1VBRA 3OIHA 2PDBA 2FZDA 4OBRA 1ADOA 2EPKX 2C13A 3OBAA 2RGLA 4PCFA 2B7QA 2FMOA 3BDKA 1ONWA 4UTWC 1Z8AA 4FDCB 1HJWA 3WDQA 1BG4A 1XIGA 2QR6A 5T26A 4MWAC 1R3RA 3FK4A 4I9TA 4Q6JA 3N4FA 2ZZ4A 3HO8A 3HPAA 3VUSA 2GUBA 3B8IA 1V3MA 3Q2DA 4H4WA 1ZK7A 5HATA 4X9YA 3WZ0E 3TYCA 4H4PA 2W0HA 2DFAA 1W9PA 3F1QA 4JQ3A 3FNDA 1QI4A 1F3TA 3GIYA 1PYMA 1CGTA 1BYBA 4ZO9A 1OFQA 2UY5A 2E77A 1SPQA 1ISXA 5D05A 4V1XA 3C4UA 4ZA0A 5E9XA 4KWOA 3S2NA 1THFD 1V03A 4IPIA 5FF0A 3PM6A 1EF3A 3HPXA 2J7CA 3BLIA 3WLMA 2E09A 3UZWA 2ZA2A 2VUNA 1GWJA 1XBVA 2OLHA 4U5IA 1AQFA 1X38A 3A12A 3LHZA 4M5PA 2V6OA 6REQB 4R3UA 3NXFA 4POCA 3WQ8A 5EPDA 1TPWA 3UR8A 4WQ6A 3KZSA 3P8IA 2J7DA 1PDYA 2X1UA 1ZL1A 4RNFA 4E3TA 4G7FA 5AB3A 1XINA 3RG6A 3G0XA 4MFDA 1ISWA 4JTQA 4E8CA 1WA3A 4IMDA 4J28A 4DAFA 1X96A 2EO7A 1K02A 4CCCA 5CZKA 3C2OA 2EG7A 4KRTA 4OUIA 1ZU8A 1JEZA 1YMYA 4DI9A 3OA3A 1ESWA 4NX5A 1X8CA 4ZSUA 3S6DA 4F2TA 2OYMA 2A21A 1IGWA 3CV7A 1EP1A 5F1UA 2EPNA 1XXXA 3DC0A 1W3TA 3M5VA 5AVNA 1QW9A 4MWAE 4IWWA 1WDPA 3B0YA 2Q09A 3W6YA 5LNSA 2QXWA 4D9PA 4JTRA 1W3KA 4CNSA 3C52A 4ROPA 3G1FA 3MV01 1A4LA 3GKFA 5LIUX 4PUMA 5C9XA 1C90A 1XLGA 3FJ4A 4GQGA 4GVFA 3EOOA 5FJJA 3C2YA 8A3HA 4DO6A 5JBEA 3S83A 3WG6A 5FJPA 1UWUA 1H6VA 2QGYA 2DIKA 3LBCA 4DM2A 1P0DA 1UZ1A 1M6IA 3HTWA 4RNIA 4GNKB 2EF9A 4AYGA 2ZX8A 4WY0B 3MCNA 2EQ9A 3RNMA 2QLYA 2GR3A 1D2KA 4E2VA 3NEVA 2PU0A 4Z2KA 1RZMA 4AWSA 1QHPA 1W2PA 2I5GA 2X8GA 3FFSA 3O15A 1ALDA 3BOFA 4ZB5A 3NQBA 1W5NA 1NVMA 4LUSB 1MW0A 4W4QA 1TPEA 2CZ5A 4YTSA 4WOQA 2QJNA 3B8UA 3EYPA 4HJFA 4QIUA 1HF6A 1GZJA 2B31A 1GOOA 3L4XA 3Q4DA 3LM3A 4FXFA 1G1YA 2G5WA 4CNPA 5KETA 2VC9A 4H01A 5EA9A 5DCEA 4GYKA 2BHZA 3QMTA 3L4UA 4HYRA 1EL3A 3ARXA 1G7UA 3GUWA 4MY8A 4IF2A 4IZGA 1XIJA 3A64A 1TJRA 1P6CA 1EOKA 3KZPA 1X6LA 2PDCA 5EY5A 4DYEA 3CB8A 3BLDA 3BW4A 4LGXA 2SFPA 2J6XA 3I4KA 4FX9A 2QYGA 2V5LA 3JS3A 3F4DA 4CVWA 2B7PA 4C6EA 3FV9A 2CLEA 5EKYA 2GH5A 2A3CA 1JRBA 3KE0A 2E8ZA 1VFFA 1EF2A 3KHDA 4WDTA 1RJPA 1BWCA 3DAQA 1KCLA 4UMCA 4CU6A 3TZFA 4HK5A 3WO8A 1UD5A 4XBSA 1JIBA 5DXYA 4KEZA 4UMAA 3BCDA 3IIXA 1VBJA 3PHAA 1LQ0A 4MNLA 2BY1A 3TQKA 2QAEA 3PZUA 1OG6A 4H9ZA 4HU4A 1S2WA 3VFLA 4O8RA 1UD8A 1TZZA 4UTLA 4JKKA 1NELA 5EBUA 3T0DA 5C2XA 3BTNA 5TBOA 4IHCA 1NDZA 4LXFA 3BARA 3NURA 1BKHA 3NQEA 2X09A 1V7YA 4MAVA 3TJXA 3KOZA 5AYBA 3KDOA 3OU8A 2IQTA 3CYVA 3G1XA 1FKWA 4NJIA 3QYSA 5FD0A 4H7ZA 3TA6A 4HNUA 3UPWA 1SJAA 1KBJA 1WDWA 2X7WA 1K7EA 3U6WA 1B57A 1KR1A 1RCOB 2TMDA 2XDFA 9CGTA 2DZPA 1NPXA 4GYJA 1Q13A 2VI0A 1KM3A 4PSPA 4CD5A 6ENLA 2ZUWA 4CQAA 4YVVA 4JNYA 4JTLA 4DUXA 4AISA 4UQ9A 3CT7A 1REQB 3ZLFA 2W9MA 1YE6A 4M82A 3TK7A 4PTNA 3STCA 4F0RA 1IR1A 4HPJA 3L5LA 4ONVA 2X16A 3KVKA 5E1QA 3P3BA 3AICA 2C3ZA 2TPSA 2C0HA 3L7RA 4TV5A 1TX2A 4IUGA 4ZBCA 3A4AA 4V27A 4JQ1A 4GVHA 2EPHA 3DIPA 3ZSSA 3ABOA 3UWUA 4GX8A 1DJWA 1O68A 4FSAA 1R86A 5GQBA 4UTUA 2D20A 3WNNA 2J6VA 2O92A 3SRHA 3GY1A 2O9RA 3CXBA 5CQ1A 1GW1A 1DQWA 1PKMA 1ZJAA 4XO6A 1XP3A 2ISFA 3B9DA 2CFFA 1UJQA 3CWHA 4O17A 1TE6A 3PUEA 5DY3A 4IPNB 4PMNA 2CKSA 3D3AA 2PBGA 5F4WA 5A94A 1A4MA 3CQHA 1MW3A 4QSFA 2GJXB 4N02A 1XIBA 3P0WA 1SO4A 3GVWA 4QG8A 4B16A 2A0NA 2B7NA 1F61A 3TFXA 1XPGA 4IUOA 4LALA 3VNLA 4H9VA 1YXYA 5HOSA 4LRSA 3HV8A 3QC3A 4B90A 1S2CA 3VI2A 1GONA 3LSBA 1UP3A 1R9XA 1XYZA 3EXTA 2GSHA 4U4MA 2ZTKA 4C6OA 2X0YA 3KHJA 1XIFA 3UFYA 3TWAA 5E5CA 1EBDA 2ZXBA 5F2GA 3R6IA 1YEYA 3DK8A 3O6CA 3WL0A 3GXNA 3ARVA 4ZOEA 2QCFA 4RPQA 4I7WA 1CB2A 1Y7VA 1U1UA 1SSDA 2BMBA 1FH7A 4M8UA 3EXSA 1C91A 1FWTA 1JFHA 2JQXA 2H6RA 1KGWA 2D73A 1H61A 2ZRXA 2G3IA 2DY3A 2R1MA 3URAA 4GUGA 4FK9A 4ZSTA 4E6MA 3PTKA 3M0JA 4CEUC 3IJ9A 4M80A 4EX4A 1E6RA 4PUNA 3E3HA 3ABQA 2FH6A 1X2HA 1S7MA 4GY0A 5AY7A 3G5EA 1E55A 4BA0A 3NQ7A 4S1FA 3KBWA 4GI8A 4AIBA 4NJGA 3TJ4A 3PG6A 1H09A 2PDLA 1M7XA 1OCJA 4LX4A 2C7FA 4JKLA 4NEWA 1A53A 3B40A 1EZ2A 4MM1A 1PIIA 2PBOA 3AS2A 4GNVA 3A9IA 4IH3A 4NUWA 1A5BA 5DX7A 2V5DA 1C7TA 4QHRA 3GH7A 1VQTA 3PR2A 1R47A 3VAVA 3SSJA 3VA8A 1PZ0A 5JH2A 1HL9A 4EK7A 1ZALA 3TA9A 3SCNA 3BH4A 2OWCA 2VGFA 3M0IA 2EPMX 3DERA 3OEXA 4ZCWA 3TQPA 4P8WA 2QCCA 1NHRA 5C0QA 2PODA 2Q02A 2CBJA 1IEVA 2QDHA 1SB3B 4JTIA 4JBRA 1GRAA 4YHEA 3O0HA 3VC5A 2WHKA 3WIJA 2NSOA 4X0VA 4WHBA 3F2DA 3OA5A 1B3YA 3ZLGA 1KLZA 3L65A 2I9EA 1I45A 3QGAC 1A5SA 2WK2A 2OSYA 2F38A 2NWRA 3AFBA 3VDHA 1HKIA 3LCLA 3QTPA 1V6XA 1VFOA 3UWYA 2V6AA 3N9RA 1ZGDA 3QY7A 2IQ0A 1QPRA 2X8HA 1V0NA 4PMOA 4DXVA 3F03K 1PHWA 3LTSA 2QUTA 4RCXA 4UTKA 4GX9A 2WMJA 2GVJA 3C2VA 2EXOA 5EGRA 1WCGA 3IIPA 4AWTA 1W1ZA 2PEVA 5BWAA 1V02E 1LRQA 2INZA 4J9JA 4LQ1A 3OVQA 1YDYA 4IGSA 1TELA 4MKVA 1XI3A 4MLJA 3T1GA 3AIRA 2Y7FA 4AC1X 2F5ZA 3NOYA 3CIVA 3W83A 2XISA 3DBNA 1UP2A 1P0EA 3FSUA 4U31A 3ZIZA 2INFA 3CQIA 3UA4A 5IFTA 4ATDA 2ACSA 4O11A 4LA1A 3EPOA 4IL2A 2QMKA 2HQMA 3PG8A 1LCOA 1RLCL 1A47A 3QFWA 2FJKA 2YDAA 2PPGA 4AZHA 2VDIA 3W7CA 3U48A 1R3WA 4DZIA 4GE8A 2C6QA 5KTLA 2WNWA 4UTTC 5HUOA 3OYZA 1ZBWA 4WDXA 4JR5A 4XAPA 1E15A 1QATA 1JDFA 4O1BA 4H4VA 1H50A 2A1YA 3GHTA 1LBFA 2H90A 3N2TA 1CGUA 1V3LA 2OYKA 4K6AA 4OV4A 2CLIA 3KBNA 1TPFA 2E4TA 4MVAA 3WLRA 1C8VA 2PDFA 2OG9A 2NW0A 1B3XA 3IS4A 3BWWA 4P7LA 1R6WA 3FYPA 2CBIA 4DF2A 3BG3A 5LIKX 3NQAA 2YZRA 4GRSA 3GG0A 1OFPA 4H4SA 5LXEA 5CC6A 3L12A 3WLOA 4OUEA 4MZYA 2WMHA 3VM7A 4DF1A 1H7WA 3GYEA 2EKCA 3WQDA 3H2CA 3GHUA 3G2GA 1NWTA 2BY3A 1E3ZA 5AN7A 4AYSA 2BVTA 1DJZA 4FNPA 4KPLA 2W79A 3MKKA 1DXEA 4QRNA 4KH2A 1TV3A 2V5BA 3QFEA 3EKZA 4A8LA 4Z42C 2QUNA 5HUPA 2ZZ2A 1SSGA 3F4CA 4WX2A 1JPHA 3DYOA 1A5KC 3WEOA 5MKGA 1G5AA 2WQDA 1JCNA 3LD5A 4HT3A 4S3FA 3NAVA 4WLCA 3A4JA 1W3JA 5FJTA 3UWVA 1GPFA 2YDRA 4M56A 4DXKA 4KWVA 3URNA 1N2VA 2D23A 3WEMA 1PWMA 3VIPA 3EZ4A 2H8XA 4B5XA 3EUB3 1J0KA 1GHRA 3CGBA 2GZXA 4HGXA 4ZEPA 3CAWA 3ZJ8A 4CNOA 3VO0A 1I2NA 4JIQA 4QJ1A 1B30A 1XANA 1JOAA 3F5KA 1XDMA 5MKGB 1T5AA 2C0AA 4CQDA 4GGHA 3IK4A 2Y62A 1QFEA 2V0TA 3E1F1 3T2PA 3DGRA 1FDJA 3FX4A 2BXVA 5IBXC 4OBTA 1C3FA 1WX0A 5FF2A 4J27A 2QJGA 2PURA 3VMOA 4TO8A 3NM1A 1BYAA 1IZJA 1U5VA 1VPQA 2WQPA 2WJEA 4XD3A 2ACQA 4IGMA 1ONFA 2CLLA 1KXVA 3A47A 5AC8A 4RR4A 3VM5A 1LOQA 1JUKA 1PZ3A 2HJPA 3KRZA 3KWSA 4R88A 5LA0A 5BYWA 2NQLA 1E6SM 2C8NA 1DWGM 1NFPA 3L0KA 1E0WA 3DG3A 3GR7A 3GC5A 4Q8VA 4CVUA 4LCQA 3ZYZA 1TA3B 4DWSA 1WV2A 3WDHA 3UJSA 2CBUA 3LV5A 3UZXA 2V82A 4PBGA 3W2JA 4QM1A 1WYGA 1VLIA 3S8HA 4XKMA 1ZCCA 3RJXA 3VE9A 2Z6IA 5XINA 4ZL1A 4I7VA 3QKZA 3W81A 1WDDA 3O07A 2DZTA 3NTYA 2G96A 4C6KA 1ZLPA 4X2RA 2NVKX 2OWXA 1HX0A 3EGJA 3UEQA 4XD5A 3O06A 2ZE0A 2FVKA 4US5D 4HNVA 1PUDA 4EPDC 3HPSA 4TXEA 3ETRB 2DZXA 5IHSA 4DWSB 4JY8A 1W17A 3I4EA 2YBTA 3UPBA 4JHOA 2QCGA 4PEKA 3VNIA 1MZHA 4LVGA 1KRCC 3A7UA 1ECQA 3G1DA 3W82A 2F8QA 3GR4A 1I75A 4KWWA 3C0QA 2ZUNA 2YYUA 3N73A 3TU9A 1KRMA 3VIIA 3KL0A 1Q6FA 3PZMA 1EGMA 1ZMDA 2W4XA 1OQFA 3MSDA 1TV8A 1E9LA 5J04A 1TUXA 2GJPA 2CYGA 4GO9A 4O10A 4KBXA 1UKQA 4PE8A 4CNTA 1OHLA 1QI0A 1NHQA 1R2SA 2E7FA 2HSAA 3VOCA 2QDEA 1TWZA 2ZXQA 3NZRA 2AAQA 1UUQA 3P67A 4EMJA 4ERGA 3AIBA 4Q4OA 4H4UA 1JAKA 1W8SA 4Q8QA 4PBEA 2DSUA 2PDQA 1QRQA 2HEJA 2QEZA 5K4ZA 2RGMA 3GIPA 4Y90A 1MDRA 2W3RA 5BZAA 1ISYA 2J8GA 2WNNA 3GVRA 2J7FA 5K4XA 1H7NA 1ZQ5A 5E93A 3GW3A 5AZ0A 1J4EA 3TC7A 3N2MA 4IIGA 3WMLA 2P50A 2BLEA 2TODA 3H70A 2VCAA 2KAUC 3VNZA 2ISDA 1H4PA 4Q22A 1C8YA 3BAIA 3TVAA 3EAOA 1DIKA 2DDXA 4LCRA 2FLIA 1GJWA 3AHVA 4A35A 3QQWA 3S6OA 3H2FA 1VGAA 3BAJA 2X0SA 4DLFA 3N15A 3LBOA 4LAMA 3DXIA 4JAWA 3URQA 5I00A 2BZNA 1Q8AA 3ZXWA 9RUBA 3OTRA 3FW6A 1CTNA 4BEQA 4EM3A 4AB4A 4M1BA 2W63A 3U2EA 1OZQA 1BVZA 3WN6A 2CESA 3MV11 3MZ2A 3GK0A 3BLFA 4LIIA 4O52A 1AW5A 2DW7A 1AG1O 1S1PA 4D1IA 1EC9A 2Q8XA 2NPXA 1NQ6A 1RM6B 2AQOA 5LHEA 3B9NA 5G2HA 1EO5A 2RKXA 3GZAA 5D9MA 3SCWA 2CZVA 2ZX5A 3GDKA 5FEXA 1FDZA 4XKYB 5A2BA 1JNEA 4HA4A 4DJEA 3WDPP 2WMFA 1KCZA 4WKFA 3PPFA 3QGKC 4IP7A 1TJPA 2OJPA 4AX7A 1V97A 4ATLA 1H7XA 1OCQA 2XH2A 1GHSA 5TR3A 5CPTA 1W1VA 1OINA 4M24A 4ZR8A 4AIOA 2WJFA 1L8NA 4NVTA 2QQ6A 1WKFA 4HNOA 3GFYA 5CPNA 4UIOA 4HNCA 1JZ5A 4HOWA 4G1NA 2CHOA 3HZ3A 1EGVA 2D2OA 3ZR5A 3MQTA 4LNCA 3LEPA 3U2ZA 2HQAA 2ALDA 1F9CA 4ZQCA 1YTDA 4XO7A 3K30A 1F4HA 4K2SA 4B3KA 3MKCA 4N6EA 3T78A 5LSMA 1QUMA 4PH6A 1B3WA 4MIMA 3RX3A 3DYMA 1A5CA 1X7IA 4C7FA 3PWIA 1KBLA 4QQ3A 3DHFA 1E1CA 4UNKA 4V1YA 3NIYA 4XBJA 2D69A 1L6YA 5FF4A 2VWTA 4XIMA 2F6XA 3RPTA 3SGUA 4ADUA 5A6BA 3IANA 4UR8A 3VCNA 4IMCA 3GBDA 3U2CA 3KBMA 1BGGA 2J8TA 4A2SA 3N3MA 1OF6A 2J7EA 4YCPA 4QEEA 4OIFA 3PBWA 2WP5A 5FACA 4QLLA 3W4RA 3OVPA 4FR6A 4HIBA 2P5NA 4ICCX 4B5SA 1TJ2A 2ABAA 5H8MA 4K1WA 2GK1B 1KD0A 3KOYA 3GUGA 3LQGA 4DF0A 3WY1A 4W8AA 2J27A 4NL1A 1ITUA 5H91A 4IMGA 1MO9A 5AYXA 1XLEA 5JBDA 3MYPA 1T0OA 2DQWA 4CCZA 3QYQA 4ALDA 2OSWA 1JZ7A 2I5IA 5BOEA 2XWEA 4DBSA 3IAPA 1FUYA 3H22A 3WDIA 5GNYA 4GIRA 4C90A 4LBUA 5D2TA 5TQLA 1VZWA 4MZ1A 1JCXA 1YPFA 4KS0A 1SR9A 2BGSA 4RW3A 3DGBA 2DH3A 5I7GA 4IFOA 1JRPA 4Y9OA 2ATMA 3MWCA 2PWUA 5HNRA 3AI0A 4D6HA 4NASA 3SJNA 2WLZA 1MZRA 2DVUA 3UY7A 4UCFA 3DGZA 3W2KA 1O5XA 3KTXA 3IEBA 1ONRA 5EMUA 2V3EA 5B7ZA 3FJLA 4BKNA 1BF6A 4R7WA 1DWFM 3JR2A 4ZOHB 4XAZA 3PZOA 3B8SA 1Q85A 1IYXA 1TVPA 3EEZA 1U5HA 2GGIA 2GOKA 4TX9A 4EQXA 1HGWA 2W3ZA 1XH2A 4UQBA 2XTKA 1AD1A 3LU2A 4AW7A 1EXBA 3MP4A 1GVRA 3TW9A 2QIWA 4NNCA 3H2EA 4MTVA 3WH9A 3CHCA 4FB7A 2WBGA 4EQSA 4QG6A 4RZBA 1FVPA 3SQSA 2WOQA 2VEKA 4ZO8A 1GRGA 4KWSA 1IHIA 3NEHA 2OQYA 3OGVA 4TR9A 3CUZA 3IUDA 3T42A 1GZ1A 1T8QA 3L9CA 3WJXA 2WWCA 1ZAHA 3WNLA 1M6JA 3II4A 1GREA 3CV1A 3WK0A 2WPCA 1YBQA 3G1HA 3PS7A 3HPZA 4DPQA 1OIFA 5XIMA 3U7VA 1RQBA 4GYFA 4QAWA 5AYYA 4ZXLA 2ZFAA 3KRUA 4J56A 2YW4A 1JQXA 5D4YA 2XM2A 1NHPA 1JYNA 3W85A 3T0CA 3KOWA 4W5UA 1DWAM 5I77A 1HUVA 2ON3A 4QS6A 3STPA 1POJA 4JL2A 2BASA 3JW7A 3QHOA 4LCSA 3CTLA 2PWHA 3S2CA 2NVDA 5GRTA 3TV8A 4HSOA 2Q3RA 3LGGA 5LGXA 3PC0A 4D2JA 3A23A 5BMXA 3UPMA 3RHGA 2WANA 2EPLX 5CPMA 3ARPA 3UWQA 3MUZ1 2J88A 3CK5A 2VQUA 1B9ZA 2V8ZA 3G1AA 3H2MA 4AZGA 4LV9A 5A8GA 1FWFC 1HJVA 2JGYA 1TJ1A 1WBHA 3WNPA 4Z2JA 4X60A 4Y9AA 3UJRA 2WB5A 5AHLA 2G3MA 4HTYA 2Z4GA 4AWUA 3VNJA 4GYPC 3LA4A 4GXPA 3WK1A 5A95A 5G5IA 2YQUA 5FCZA 2Z2BA 3P82A 5L6UA 4PMUA 4IJRA 5BXRA 1RP9A 3SIZA 1RA5A 5U25A 4JHZA 1K77A 1S2AA 1M7JA 3M43A 2J75A 1DKWA 3GTXA 5AOUA 2E67A 4QQUA 1ZX9A 1J0YA 4LOCA 4HHMA 3TSMA 1BTMA 5MF5A 3U8GA 1UG6A 2H8ZA 4A3QA 3MSGA 5I3FA 7ODCA 3TCEA 2W66A 1HGYA 2VTFA 1ZDLA 4OHQA 2HS6A 3B8WA 3LUTA 2A7RA 4OBSA 3S9YA 2HV5A 1OGGA 1J5TA 4JXCA 2VFEA 1XYLA 2VC7A 4UOJA 1SFSA 4H4ZA 3R0DA 3FJNA 4EWJA 3ENLA 4FA3A 2GQ3A 1GXFA 4NZ3A 3Q45A 5FJRA 1ISZA 3ZMRA 3U5UA 2YCLA 4BF9A 3A3HA 3VDAA 2PZNA 1ZAJA 3R4IA 3NQ8A 2RDTA 4RE4A 4H2HA 3VNMA 1OFEA 3BGAA 1OK6A 2VOTA 3CBWA 1S5VA 3CUHA 5M3WA 2VYOA 4ECLA 5DT7A 1VFMA 2BGQA 4TOQA 1CWYA 1EEXA 4KF1A 3EB2A 3MHUA 2V67A 3NPUA 1M9HA 1ZBCA 4GFSA 2RAGA 4PUWA 2J9ZA 2C15A 3OQ8A 3BAXA 1HO4A 1CXHA 4Q7NA 1M41A 3TR2A 3TQ0A 1IEIA 1GKRA 3ARYA 4NXKA 3WF2A 2G97A 3Q58A 3QN3A 3O3RA 5BCAA 1FWAC 4IOTA 5A6JA 4FX6M 1HL8A 1VFLA 2A3HA 2E0PA 3EDKA 1FWHC 2EEXA 3GAKA 2XVLA 3UGVA 3L2LA 3A3WA 2RDWA 5U7SA 5C7HA 1KNWA 1FP9A 3AROA 3NYDA 1XL9A 1GT8A 2YB1A 5KEZA 1R8LA 1CW2A 5I3DA 1C7SA 2OZTA 2WSRA 3RLGA 4Q8MA 4L4PA 1GRTA 4AEOA 3UGRA 1WZLA 1VYSX 1Z6KA 3N6HA 3KOFA 3L5OA 1V6UA 3UR2A 3O6YX 1MEIA 4URIA 4S3AA 5KMYA 5A6SA 2GR2A 4MOZA 1A0DA 4C6JA 5CC3A 5HA7A 3EX3A 4G7EB 3JVAA 5A2CA 4TVUA 2HBXA 2YB4A 4AIEA 1XSKA 3W00A 4XVDA 5TD4A 3VOFA 1UIPA 3B06A 3GDLA 4MNMA 4L1WA 2VZOA 3WX7A 2FZ8A 3GTFA 3P14A 2TAAA 4GISA 1WUEA 3W0KA 3G1VA 5FEZA 2BX7A 5BOFA 3RM9A 1XSJA 3FYOA 2EG6A 1WAUA 3AS1A 3WLKX 2CFYA 1R3SA 1VS1A 3LCGA 1OCNA 1DNCA 1DHPA 3AALA 5GNZA 4LAOA 2VZUA 2H9AA 3DI0A 3BQ5A 3VC6A 3M47A 2OO6A 3LHTA 4V33A 2X0HA 3M0KA 2GDUA 2FKPA 4NZ1A 3OW1A 1IGSA 1AJ2A 3B4UA 7REQA 5E0KA 2YBUA 3PJTA 4BQ5A 2GR1A 4FS9A 1RXOB 3UG4A 1AJZA 5JUVA 4PMVA 2BOEX 4RK8A 1XD1A 3VKBA 3PB2A 1DL3A 3OP2A 4FX8A 5C71A 4DWDA 3AXIA 4O16A 2H9AB 3ABZA 4QAIA 2WMIB 4YL2A 1KWGA 1BYDA 1XG3A 1OBAA 5F1VA 2CXEA 1GYMA 1KXTA 4W86A 2WCGA 4QE5A 1XIDA 3H7VA 2WOIA 3LRMA 1HKWA 4XZ9A 4C5ZA 3QLDA 3BAWA 3WDJA 5EYWA 4WDWA 4Z1DA 3CZ8A 2BXZA 3NGJA 4CU8A 2VNCA 4V28A 1UKPA 1MEWA 4A3UA 2PI6A 4E2BA 4LTSA 3AQUA 1X8FA 2HDJA 1K4GA 1SU5A 1W1A1 3NZGA 1OABA 4GCXA 3VVGA 4TU1A 5DANA 5C2GA 3DGHA 4PMDA 1AVAA 2IKGA 4AZIA 3OPSA 4AMCA 1O94A 4JS3A 2C1GA 3GM8A 4PL2A 4XV0A 3AIEA 3AZRA 3HIJA 5BRBA 1V4YA 3QQ0A 5C55A 2AGTA 3E74A 1WOBA 4KESA 3T9PA 3UCQA 4LYKA 3N11A 1E3XA 4L4OA 2NQZA 2VX4A 4XG1A 3VCRA 1IIHA 3EA1A 2HXUA 4FLRA 4PTVA 3MZNA 5HAOA 1AQHA 3AYTA 4FEZA 1EKOA 4MJMA 3W23A 2C3CA 2Y85A 3WQFA 1ENUA 3LHYA 4DWSD 2AOSA 4N9CA 1E6ZA 3BOXA 1KGXA 1FOBA 1QCWA 5LXXA 4UTWA 4L9XA 1H41A 3EOUA 4XIAA 2XPKA 4WXYA 2X05A 4CCDA 4GZEA 2MUCA 1OB0A 4MWAA 5G4HC 5ER0A 2QPXA 3TN5A 3EOLA 2Y8KA 3MP3A 2NT1A 4PUKA 4ZENA 1CGVA 3B9JB 4GRTA 3PWGA 3CNYA 1ML1A 3I6TA 4OU1A 5CZTA 3FA3A 2BV9A 2WWDA 1UIOA 1L0PA 4QCFA 3T0TA 3VX1A 1HW6A 3ZSTA 1BRLB 1UKOA 2PF8A 4EKJA 1R0MA 2REQB 4UTJA 1E9ZB 3IJ8A 2AL2A 4AVFA 1KBIA 3ES8A 3NVVB 3IJ7A 2BB0A 1XLAA 1LUCA 3UERA 4I9MA 3UU0A 4CNNA 2F6KA 3IV8A 4P8XA 5DQPA 3ME3A 2J62A 2PS2A 4GPNA 4UZUA 3NG3A 1FWGC 4HMDA 3NL3A 5DN1A 4TVWA 3PN8A 1HT6A 4E2OA 2D2GA 2WNZA 3LCFA 1A49A 4RDYA 4LW7A 2ZZBA 2DUXA 4H6QA 3GNRA 1E5NA 1Z42A 2I1OA 1NFBA 5LGZA 4C6IA 1JCTA 3PJXA 5DELA 3GVQA 5M2FX 2O7QA 1I6NA 2DSZA 1Z9AA 3GIQA 1RPXA 3MC5A 3UXIA 2AL2B 2OXNA 4PYSA 2CZFA 1EJXC 1LUCB 3QHNA 2FZNA 3W38A 5G4EA 3THUA 4S2CA 1VRXA 3QHMA 2DEPA 3AMCA 3R5EA 4M51A 5E6ZA 5EU9A 4D8ZA 1QWGA 1TMHA 3FSTA 3QF0A 4C6DA 1VDVA 2PWDA 3EMQA 2F9RA 1R9YA 1VBHA 5JH1A 4KGJA 3NZPA 3W70A 1O95A 3RNDA 4A22A 4LUJA 1GQLA 3N12A 2V30A 1CGYA 4HSHA 2P0IA 1JULA 2JK2A 1JZ8A 1DJYA 4DXXA 2HPMA 1XF0A 4UR7A 3IAQA 1EDQA 3PBGA 4AD2A 3V75A 3FVMA 4XAYA 4R27A 1TV4A 3ARRA 4HD5A 3IVTA 1O5QA 4IIBA 1PWLA 2HTMA 3ECQA 2ZCGA 1N82A 4GUFA 3Q37A 1EJWC 1MW2A 3NWRA 3O8AA 1EJRC 3QZ6A 3H7RA 1PEZA 4K8HA 1BHGA 5CPQA 2CBVA 3W6LA 4JFWA 4H4TA 3BAYA 4LH8A 3MTWA 4JTEA 1WXJA 5BU6A 1UD2A 4X61A 1ZP3A 4ZOCA 5CSYA 2BC1A 3MSYA 1K8ZA 1NM9A 4CD6A 2RDXA 3ZR6A 3GDMA 4YTUA 3WELA 2AMXA 4JD4A 5CEWA 4JYDA 1OD8A 1FKXA 3OYXA 2HE8A 2PLJA 3HFYA 3DFHA 3ZO9A 1ZJIA 1O5KA 3CJPA 1KM4A 3HA1A 5D8ZA 1OC5A 4QDMA 3KVMA 4HPNA 3GD4A 4JQ9A 3LNMA 1QNSA 2PP0A 4HSNA 2PF0A 3PBVA 1HKJA 3UR5A 1QXLA 4Y2WA 4Y7EA 1QNVA 5BXSA 2NQHA 4U3AA 1K8YA 3E49A 3NVYB 1OSEA 4AEFA 4UZSA 3W7OA 3E0WA 5KINA 3ZQ9A 4CQ9A 2RDUA 4V15A 3UCCA 3WD2A 1ZXIC 2W54A 3LV6A 2OZ3A 2OWWA 1PKLA 2IMRA 4IMFA 3WF1A 1FA2A 1LQAA 2RH9A 1VC4A 3UVAA 3H4WA 4L80A 4DJED 2YSWA 5HNNA 1UASA 1DJNA 2X8CA 3FYYA 1EX5A 6PTDA 3SUSA 2ZIDA 1P6BA 3SRDA 4DZ5A 3LG3A 3BZJA 2W91A 4BI5A 2V38A 3LXAA 2VP8A 2JKEA 5CAHA 4LB3A 3DX5A 1L6FA 4GUJA 3WBXA 1UUOA 4UQEA 4Q8NA 1T6MA 3MUY1 4LUYA 2IPJA 4S3BA 1PX3A 2WZHA 2WHJA 5LNVA 1U30A 5I09A 1WUFA 3LS9A 4JTJA 2XHYA 4MZ8A 4OOZA 4GABA 4TVDA 4MSSA 3LCIA 2Y5SA 4RNJA 1QNRA 3CEPA 5H8UA 5T8GA 3EOSA 1TO3A 3VX0A 4QLKA 2CETA 1LT8A 1OYAA 5F4XA 3NSXA 2A4AA 3R0KA 2WPFA 4IXHA 1S5WA 4A8RA 3BO9A 2BNJA 5CBIA 3DC8A 2NQJA 5AECA 3ZVHA 3TWBA 5FJUA 2I7GA 1TMLA 4FF5A 2YCEA 3OGSA 5A6BD 3B0XA 5CBBA 1F8MA 4E2DA 2ISVA 2ANUA 3FG2P 5CGQA 4K39A 1WYIA 2DT3A 1VAHA 1ZSXA 1KM1A 2R94A 1S3TC 1WO2A 2PDUA 1DEDA 3KBVA 4G1KA 4J3UA 1Q4NX 1GOWA 2EKGA 3CAVA 2ZTJA 4KIRA 4ZQRA 2A7PA 1LROA 1G94A 5M1TA 3ZVHB 1LL4A 4UC5A 3L4WA 4IXXA 5D9OA 3LXCA 2POTA 5DXXA 1PIFA 1OC6A 2P8BA 1GK8A 3DG7A 3GXFA 3DBPA 4ZB0A 4LC6A 4K8DA 1OM0A 3VIGA 1KV8A 3ANVA 3M44A 2JF6A 5CG0A 4ORIA 3M0XA 2PRLA 3R25A 4IICA 3GLCA 1DHKA 4UFKA 1Q6LA 1WDRA 4C6QA 3W07A 3AU6A 3MBDA 4M0XA 3DOPA 3HF3A 3TYZA 3SZ8A 2PRMA 1Q6RA 4UFIA 1Q2SA 2J78A 5FF3A 4X2PA 1W9DM 4N4PA 4FNRA 4YVXA 2XJ7A 3HN3A 1HQTA 4Q8PA 5G4WA 5IDIA 4KERA 3VFCA 3CV2A 2OX4A 5LIWX 3K4WA 1GVQA 4NZ4A 4PN2A 4J57A 1Q1WA 3L2MA 1A80A 3L5AA 4OWGA 4CQBA 4HNNA 3IJQA 3P60A 2ZXAA 2PP3A 2YW3A 1IT7A 4LB4A 3VD7A 3NO1A 3P62A 4H6RA 3G0SA 1TZ7A 1XFBA 1OX5A 1YTKA 4XX6A 2OQLA 2ZKMX 3P81A 4EQWA 3T4CA 2YCJA 3SM0A 4JTTA 3VE7A 3BMVA 1FWBC 3R2GA 3DKJA 4MHBA 1X2GA 4PBFA 4AH7A 1SM9A 1UWQA 1E73M 1MWOA 2I56A 1O1ZA 2XFRA 2BVWA 3I65A 2WM0A 4FLQA 4J3SA 3THQA 2D0HA 3GZ3A 4NYYA 4Y8EA 4QNEA 1KFEA 3KCLA 1FWCC 3VOGA 3HGSA 4EPEC 1HNYA 1CLXA 3SUVA 4MB4A 4BV6A 3URHA 4H6KA 3F4VA 1XG4A 2QCMA 1UWRA 4WVXA 1Q5MA 4U10A 2VEIA 3WLPA 3R89A 1VCGA 4JQ2A 4FNSA 3LB8A 3DN5A 4NU7A 3A9BA 1JF5A 1XCWA 3LCXA 1CBGA 2B81A 4LUTA 1BXNA 1E40A 2QCNA 5DF0A 3MKVA 4AG0A 3QLLA 1UR9A 2ZA3A 3AAMA 8TIMA 3TAKA 1NP0A 5FEPA 5JMUA 4BY3A 2P53A 5DCBA 3BLKA 2P8CA 4AF0A 1VHNA 4XAFA 2V81A 2ZZ6A 1RQEA 3M7WA 4NX0A 2ZUMA 4W88A 4OE7A 3M0LA 3SURA 4PTXA 4A2RA 1N8WA 5FEWA 3WFLA 3NO5A 2XFWA 5C6MA 1IZKA 1HP5A 4OZOA 4H4YA 1V77A 1GGOA 1LOLA 3GC2A 5HBFA 2XN2A 2PCQA 1U83A 3UJEA 2ODOA 2IPWA 3KUMA 4LY4A 1EUAA 5DEZA 2XZ7A 3L66A 1YKWA 2VX5A 4KRUA 1QR7A 1J0JA 1ODUA 3AIVA 3GTNA 3W86A 2NXHA 1KWKA 4JTUA 3WLIA 1HIZA 2Z29A 3APYA 1CGWA 2BTMA 1KGUA 2YDSA 5K7JA 3BJSA 1UKSA 4M7TA 4AF0B 5D04C 3RMEA 3Q67A 4H9TA 1F3PA 3C6CA 5DMYA 3W1PA 4AZ6A 5CCZA 3HRDC 3UG5A 3GU2A 3WLQA 1EC8A 4HQVA 5DRIA 1FHUA 3HMCA 1FXPA 4HMEA 4C6FA 4D6DA 2Y24A 2ZUSA 3G18A 1L6GA 3NQDA 1W54A 4EAYA 1HVQA 4DBUA 4O54A 2DZUA 3CH9A 2Q8LA 1G4EA 1RJQA 5CZSA 1RLDA 4N0RA 1JDAA 3USZA 3BCFA 3WQCA 4BZYA 5FS8A 3WMBA 5F2LA 1DIDA 3NSNA 4DBDA 1G7VA 2E5DA 1H1YA 3B4YA 4FXSA 2ZVIA 4WIWA 3M6DA 3W7RA 1US2A 1YDVA 4M29A 2PDKA 5AKQA 4D6CA 2CEQA 3N29A 1VPXA 4BWLC 1TV2A 2BSLA 1LVLA 3SECA 4OQVA 3GRSA 1EJ7L 3AUOA 1ZB5A 3CUFA 2VWSA 2FVMA 4I5RA 1R9ZA 4MKNA 2FPVA 1KFLA 5HANA 4DZHA 1KFCA 2AGKA 3I3EA 4F0KA 2WBAA 4UTTA 1ECEA 3NVTA 3OG2A 5F2MA 3VGFA 3PAJA 2O4QA 4MB5A 2TRSA 3AHTA 5C9UA 3KRSA 3W1TA 1JGMA 4O1DA 4JY9A 4XZBA 1F5ZA 4DUWA 2WC7A 1H51A 1W3LA 2GVEA 2VRKA 3DHUA 2Y89A 4Y9PA 2FTYA 4FXRA 3S4TA 4JFVA 3WQWA 4PZVA 2QKFA 5AZ1A 3PVFA 3DG6A 1P43A 1YXDA 4JDYA 1HL2A 2NQ9A 1L6WA 3UXDA 4NKCA 5C9ZA 2YVJA 5I0DA 1DWJM 1JPMA 2ATSA 3M5ZA 4KRZA 2PP1A 3O63A 3APGA 3GDBA 4CD7A 1EUNA 3LPGA 3M7SA 3IGXA 3MHFA 3ZWSA 3LI0A 1PB0A 2PGRA 2GGJA 1P5BA 1ISVA 4ES4A 1GTEA 2F61A 3BMXA 4JFUA 4Q4MA 1FWSA 1WPCA 1B0IA 4LYQA 3ARSA 3UD6A 1NU5A 3QJAA 3VGGA 1SFJA 3KCOA 4DLMA 3AC0A 4KCUA 4NG3A 3CPGA 4A3YA 1ONXA 5D2VA 2IXVA 2WSKA 4GQBA 1D8CA 1OF8A 5C2CA 2W67A 5F2IA 3EBVA 1SW3A 1VYRA 4MNJA 2GLKA 5T9BG 4W7WA 4AQLA 3MMUA 3VIKA 4N9BA 2VL4A 2J4GA 2CLMA 1JYXA 4QLJA 3TJIA 1TVLA 4JQAA 1WNOA 4GY1A 2D3NA 4ZFMA 5CC5A 4I8YA 4IQDA 3GG1A 1K9TA 3BZGA 2VEFA 5JCMA 4ADSA 2W3SA 2ZYFA 3IJLA 1GKQA 2CDUA 4YIWA 3NZQA 3HGOA 4U33A 3KWXA 3S5NA 2DPEA 2GWGA 4PB3A 1TQXA 1S2TA 3PZIA 3H55A 3FVDA 4Q33A 3MS8A 4GVGA 3N2XA 4WKHA 1P1XA 2Z0IA 3C3UA 3WQ5A 3RMJA 5LA2A 2FQIA 3EMCA 1PAMA 3VD5A 3MMTA 2BODX 5IBXA 1XBZA 4IPLA 3GE7A 5J8LA 4US5A 1M7PA 2BVDA 4H8VA 4HNTA 2BFGA 2WC4A 3H8AA 2JKAA 2OCZA 1KXQA 4A3RA 3K4AA 3WJYA 4DPPA 4S39A 2ZWZA 3E2VA 4QISA 4MB3A 1U1HA 2C3DA 6REQA 2YYTA 3ISIX 4HK7A 3WQOA 1S2VA 1JYVA 4Z2GA 1LP6A 3QR0A 1TCMA 1PSCA 3WLHA 4M52A 3MCOA 1QNQA 2PTYA 4GG9A 3CYJA 5A6MA 2VFHA 4NEVA 3VNYA 3CO4A 4AD4A 2Y5JA 1JDEA 1XDIA 1G0CA 1WBJA 1JZ4A 1MSSA 4KIEA 2YKKA 4EQRA 1BWVA 3KTCA 3GH4A 1WKYA 3CGEA 5JIPA 2XVNA 5H6HA 1IV8A 3PTDA 1E4MM 1LF1A 5TAOA 4R34A 3ITGA 3S1XA 6A3HA 4LJ3A 3DHDA 3PF3A 1QPQA 5C9WA 5BW6A 5A6LA 1S38A 3MYOA 3RJYA 3TXZA 1BYCA 1JCJA 5LYRA 1QO5A 3WMCA 4V2XA 1BEUA 2QT3A 1GYNA 1PO9A 3MMDA 2WMGA 2C1IA 1XHGA 1M68A 5A5WA 1EPVA 2I57A 3CZJA 4L4MA 1KKRA 2NV2A 4MWAD 4HVXA 1XICA 1M7OA 3WMSA 4UTMA 1SFLA 4GUIA 4DBEA 3ZJ7A 1T7LA 3TYAA 4DJFC 3NYZA 2CZDA 3TDFA 3HJZA 1US0A 3CV6A 3LMYA 7A3HA 2OKTA 3VMPA 4ZO6A 4K8EA 2ZADA 2QULA 1PKNA 1FHLA 5EBAA 3REQA 1VF8A 3A6OA 3RRAA 1CIUA 4WY0A 3RO8A 2BY0A 4GIAA 3VYLA 4J3ZA 4HU0A 2YA1A 2ASHA 3TXVA 1QMLA 1ZNNA 1VFHA 1UQZA 3EX2A 1Q6EA 1C9WA 3F5LA 4LUSA 1KM6A 2GGHA 4YYCA 4O4WA 1R7AA 1GV4A 1V5XA 3NDZA 3W28A 2NVCA 1VFSA 2Y7GA 3NUKA 4NI3A 4H7CA 1J96A 1QO2A 3E0FA 4XQ6A 1D7FA 4A6GA 2E9LA 4O8AA 5JIWA 3REQB 1FXQA 4EE9A 4EAMA 4CQCA 4FF7A 5HULA 1R87A 3A22A 3ITLA 4IMEA 3TW6A 4UBPC 3A4XA 4R33A 1WXZA 2HWGA 2XGIA 1LQ2A 4YTQA 3LZ3A 3S0CA 2DQXA 4XZWA 1ITCA 3CQ0A 1JI2A 3IIZA 1M1BA 3S3GA 3N9SA 2NZLA 4RV8A 3H2AA 1R2RA 3CC1A 1XYMA 1RBOB 1FHVA 1JUEA 3F5JA 2YR1A 1I4NA 4IJBA 4LC8A 2B4GA 4D8AA 5I79A 4B9ZA 1S46A 3S46A 4UOQA 2HE5A 5J5DA 4ASTA 1DWHM 5B7YA 2AL1A 1BVNP 3PJUA 3UZYA 4PB4A 3W9ZA 1CECA 4PFMA 1HKVA 5FAJA 3M07A 1PV8A 1EWEA 3M4HA 3U5YA 3LLDA 1W9UA 4LNYA 3KLKA 4MPKA 3ONBA 4H4RA 1YYAA 4PMYA 1DJQA 4DRSA 1JGIA 2QCLA 1CGXA 3N4EA 3WK2A 2ZBTA 1Q6DA 2Z24A 1GNXA 1R38A 3RM4A 3ITOA 2GQAA 5C5YA 2OKOA 1BTCA 3WJWA 4IP5A 2IKIA 1AK5A 1RCXB 1GOKA 3C0JA 1A5MC 3SY1A 2NUYA 3G22A 3S1UA 3T6CA 1TX0A 2HNEA 2VHLA 1GUVA 1MNSA 4MNKA 5C8BB 1D9EA 4K8GA 1OFBA 1SVDA 4NAFA 5KVHA 1AW2A 1XV8A 1W5QA 2VD8A 2EQDA 5GJNA 4IIHA 2OO0A 1Y8BA 2VFGA 3CUIA 3TMLA 3VIOA 3W2NA 1ICQA 4KFOA 3MI6A 1OFAA 1F6YA 4YTRA 2VZSA 2EJ1A 3E12A 4B4HA 3VMNA 2CKRA 4Q8OA 1UC4A 3AHYA 1JR1A 2X40A 2RFGA 1R46A 3L4VA 4J2MA 2Z26A 1REQA 3OOQA 5CPOA 2D2JA 4J1OA 1DQXA 3CH0A 3CUGA 2A85A 1JDDA 4XD6A 4NAFB 4AHPA 1CXEA 1XC6A 1DWIM 2FHBA 2QAPA 1E71M 3I68A 4AMAA 1A5LC 4IG2A 2D0FA 3AJ7A 1UW9A 4TUFA 3G1SA 1KFBA 3TTOA 1ZY9A 5KZ6A 2G41A 1UPMB 6CGTA 1W3HA 2FB2A 2WAGA 3GXMA 5HWNA 4B15A 4WY0F 5FMHA 4BF7A 4DJDC 2NSXA 1J2WA 3MUAA 1OJTA 1ZENA 2JK6A 3VDCA 2PWVA 1HTIA 3EA2A 4HCHA 4MJ4A 1MFVA 1OFRA 3K8LA 1R30A 3G6MA 1UCWA 4LSBA 4L1GA 4LU0A 3U4FA 4IQLA 2WSYA 2FFCA 1XDJA 1KCXA 3D46A 5EB8A 4J3TA 2FYMA 4PA8A 1NAL1 4GOAA 4UMBA 3U2OA 2ZDSA 4IG2B 4B4FA 2GJXA 4I9JA 4M7SA 3EX1A 2VM8A 2OT1A 3H6OA 1JZ3A 1GQKA 4AY1A 2V3GA 4RW5A 5LA1A 1DE5A 4FR1A 3BV7A 2X1SA 2GGEA 2QCDA 5KZMA 1LWJA 1TPB1 4L1XA 3FHQA 3GHSA 4HN8A 4CGTA 1TR1A 3VXGA 5I6SA 1FWDC 3E5BA 1J11A 1NWRA 2FJUB 2YL9A 3G8RA 4GMEA 4A3HA 2HS8A 1DE6A 2OR2A 3SRKA 1LG1A 4JFTA 1TQJA 3UCDA 1F4AA 1BD0A 4OECA 3H7UA 3R13A 1CZ1A 5IOBA 4GVIA 2V3AA 1Y65A 3BE7A 5JCKA 1FWNA 3S1VA 2QCDB 5ABFA 3AXMA 4N9DA 3IVUA 4NZJA 3U7BA 4X63A 3I10A 5AYZA 1FH9A 3JZUA 1IWPA 2JALA 3KS6A 5A8QA 3ONCA 1ME9A 1PKYA 2JIWA 2WO5A 5XIAA 1GJUA 1L8PA 3RLHA 2OOGA 4LT9A 2WBKA 4I90A 4WOZA 3DFNA 4AHQA 2WV8A 4NF7A 2OPJA 5LNRA 4IFKB 4JX6A 1B90A 3BLPX 3SCUA 2VZVA 2JEQA 3RXZA 3SCQA 4A4AA 4LS1A 4JDRA 2O9OA 5ABFB 4LBSA 1LL7A 1VB9A 4O4VA 1W9VA 3KL5A 4H8HA 3QR1A 2D1ZA 3LCWA 2WVVA 2Z1XA 3STGA 2ZC1A 3B97A 4H4IA 5D2XA 1KTNA 3O6DA 4Q6XA 4EXAA 3WUGA 2GR0A 3DI1A 4P8UA 2ZZ5A 1WE5A 3MI3A 4NYUA 3AYRA 2YCIX 1TR9A 1ZBVA 5CPSA 5BRPA 1TTJA 2ALRA 3OHMB 4EPBC 2OQHA 3ALGA 3C61A 2PD5A 4WEVX 2GSEA 3M0ZA 1A0EA 1KQZA 1F73A 4E38A 4ADWA 4I6VA 4IX0A 3MB9A 2ZZCA 1H0IA 4HA0A 4MJ2A 3W6MA 2WVVB 5BOOA 5EMYA 2GQ9A 3H4XA 2YX0A 3SQPA 5DO8A 3H4KA 1W5MA 4K37A 3NRZB 2DIEA 3UP8A 3RX4A 1CDGA 3GW0A 4B3LA 3SR7A 1OC7A 2VR2A 4FNUA 4CCEA 4FNTA 4ZOBA 3K4DA 1N7KA 1Z48A 3RU8X 3IC9A 4BS0A 4CD8A 2OVLA 1AL8A 4FALA 4AZCB 1TMQA 1VPYA 2DIJA 3WBEA 2POZA 3ABSA 3QGVA 3WBWA 4AVOA 3PUGA 1ODZA 3TCSA 1S2UA 1QOXA 3DK4A 1LRNA 3DESA 2OLSA 3MW7A 3TN3A 1LOSA 2VFFA 4K38A 4RJEA 3NQMA 4JCMA 4UFJA 5FL1A 1UPPA 1IXOA 4QE4A 3QVQA 5M17A 3EWZA 2CLFA 2QW5A 3M46A 2WHLA 4LAZA 3W7MA 2XWDA 2PZ0A 4Z1AA 5AFDA 3JZEA 1UJPA 4PRWA 3WSUA 1C9DA 2R1NA 4H7VA 1QASA 4B3ZA 1B3OA 5K9XA 1AH4A 4MYXA 3EAUA 2VR5A 1JEHA 3N6QA 1TFVA 4O1FA 4GYPA 2OEJA 4NZFA 4DNHA 5K2ZA 2QDDA 2VX6A 3RAOA 4TMCA 2PRHA 5CLWA 3KX6A 1V6TA 3QPEA 5FESA 3D3FA 3KBSA 2ZZ3A 3WYZA 2ZDRA 5JRBA 1RY8A 3TNBA 5EBKA 2BGNE 3AMGA 4HA3A 1WXYA 3ANUA 4DX3A 3ZJ6A 4PC8A 1KBKA 3CS2A 3XISA 3EKGA 1I0DA 1XGDA 1TREA 3F4NA 1DJGA 2HVMA 4AZ5A 3VD4A 2PDIA 3IWPA 3QW4B 1GVOA 4HPXA 1EIBA 4GQRA 4R53A 3PP7A 2NVAA 4B91A 1H7PA 2GOUA 1GG1A 1RY0A 4LEFA 1M01A 3UF9A 1V0KA 3BLLA 2FDMA 2WVUA 3L4TA 3V5OA 1QOQA 5M03A 1HJUA 1E51A 4NAEB 4RDWA 1R3YA 1J2BA 1W37A 1XLJA 5D33A 3U9IA 3EWCA 4FOUA 4JNZA 3LCHA 1AZ2A 1DVJA 2C71A 1B1YA 4H50A 4LVAA 4TTGA 2YFOA 3MVTA 1VBUA 3SN1A 1L9WA 4M6VA 3RR4A 3VKJA 2V3BA 4C1LA 1VRDA 1Q6QA 1Q45A 1YRRA 4S3JA 4LAKA 4WRHA 1YADA 3C2FA 2QVHA 3GNPA 5AHEA 2F2KA 4D6IA 2GPTA 3RX2A 3UQNA 3EDDA 1JF6A 3W7GA 3CASA 3QSTA 2CIPA 1VJSA 2FMNA 1QHOA 3G0UA 2J47A 2DZSA 3NPXA 5F7UA 3W7PA 4W85A 1XYAA 4C5YA 1EP2A 3BLEA 3BUVA 2WPBA 2I14A 1H2JA 1NDVA 4IPJA 4C6CA 4CKQA 1XX1A 2EHHA 2QIIA 1MOKA 3M6YA 3W53A 3DYPA 1XW8A 3D5HA 3OO2A 5A6TC 3SSZA 2EQ6A 3UWZA 4FOKA 2D0GA 3MWAA 2YIHA 3M16A 3G24A 1UB3A 4JIIX 5DMMA 4NI8A 1BLIA 1RH9A 3NL6A 4FLOA 4BR1A 3BCJA 4LANA 5ENLA 3VNKA 1GQNA 4TQTA 4J4KA 4GCAA 4REQB 1TTQA 2NX1A 3SN0A 2NX9A 3KP0A 2OYLA 4DUVA 4XZHA 4QDWA 3VKCA 1AJ0A 1UA3A 1P48A 3B03A 1E0XA 4LVDA 3W75A 1I1XA 3S9IA 2OMAA 3ZVIA 2GVGA 1EYWA 2ZWYA 3TLQA 5DMNA 3N1AA 2VQTA 3R12A 2QS8A 1KO0A 1TWIA 2QDGA 4UXDA 1W32A 1QT1A 4QITA 4ICMA 1YQ2A 3HQNA 1JD7A 3BL3A 1PPIA 4L9ZA 5HPOA 3G8EA 5CKSA 4AXNA 3CUJA 2XIIA 4HYVA 3VILA 1TG7A 4LY8A 2XH7A 4HP5A 1CCWB 2XIOA 1PS9A 2G4JA 4Y9MA 3FKKA 4PCPA 2XIQA 4H3DA 3V35A 3TW7A 1NDWA 3O0KA 4EPKA 4R9XA 4DYJA 1RD5A 1FWJC 2ACUA 4O1CA 2NT0A 3JU2A 3TTEA 2PDJA 3GC4A 5I07A 3WCZA 3ANYA 1TA3A 1GTHA 2W61A 2CLOA 5AHMA 3PTMA 3UNDA 1OX4B 1J0ZA 1YQZA 2QUUA 5E0FA 3TQVA 2PDGA 1LZOA 5IDZA 3XINA 3GSMA 3TAOA 1KM5A 1IXQA 4DO7A 4TVCA 4O13A 2P1FA 4J7RA 3RPDA 3RCNA 2PE4A 2VT0A 1BXBA 3LENA 5FI8A 2ZX6A 1Q4WA 4DB7A 4LS0A 4WGXA 1QBBA 3S1WA 3D9XA 3OC4A 1VR6A 4PODA 1FWIC 1T96A 3PPHA 1XCFA 3W2UA 2XINA 2TSYA 2QVNA 3WKZA 2OGYA 2XIBA 1F8WA 3WLLA 3AXHA 4FO4A 1H3GA 1RVKA 3RR1A 3QV7A 3CZGA 2Z1WA 2V5KA 3AIQA 5BRQA 2VELA 4L6HA 3M5XA 2I9UA 3MUIA 3HG3A 1K6AA 2Z1KA 1WAWA 1QHZA 2YXOA 2CHRA 2YXXA 3W1MA 2QF8A 4GA8A 3V5FA 2C19A 4GXMA 2QPSA 4NRSA 1JFXA 4F48A 1GG0A 1FIQB 5D2YA 4M1RA 1J93A 4GJIA 1W1YA 3AMDA 3R58A 2J7GA 3OBEA 3FS2A 4JN8A 2EQ7A 1J0HA 4QNWA 4X22A 4WUIA 4X9SA 5EL1A 4AY7A 3C3NA 1ICSA 3DFOA 3R0UA 1OYBA 4UFMA 1KFJA 1AH3A 2J74A 1WB0A 3LK6A 3R8RA 4BI6A 3T55A 1OIMA 3IIVA 4UNLA 3GHRA 2V69A 5C9RA 5EMMA 5D38A 1E4IA 2R9RA 1XD0A 3VGDA 3ALFA 4B5VA 3VPLA 2G37A 1SUXA 1RHCA 3HG5A 1TPVA 4F0MA 1TZ9A 2G0WA 3BVJA 3QZEA 3S2MA 2D22A 3CT2A 1S5TA 4JNMA 5CSUA 4HZ6A 5CJNA 1PIGA 1ICPA 3R94A 3TYEA 1TSIA 5E09A 4NRRA 3V5CA 3BK0A 3VIMA 2QCEA 1O4UA 3BLOA 1VQZA 1UWAA 1PZ2A 2J8FA 1FQ0A 1G6CA 3AXKA 4PEEA 2PGFA 4GLEA 1OT2A 3UBPC 2WW5A 1RUSA 1Q7MA 2OGJA 1UBSA 3V0TA 4UOZA 5KZEA 4D8LA 3LB0A 1M5WA 1C29A 2FZBA 4YXGA 4HMNA 1X97A 1QAPA 3P80A 1XBXA 1NOWA 3S2LA 1U33A 2WM1A 1CT5A 4GO8A 3H21A 3GX9A 1XFCA 1YNQA 1HJSA 3RLVA 3VCCA 4YLWA 3BJFA 1AW1A 2WZTA 3QOKA 3WL1A 1OCBA 2DVTA 3TOYA 5A1AA 3ZOAA 1ME8A 2ZUVA 4K7ZA 2Y4SA 4Q4SA 1BXCA 3GG8A 3D6NA 4QE1A 4MAZA 2V2HA 1J9YA 2VOMA 1ZHAA 4FXJA 4WD0A 3BURA 2XFFA 1E0TA 3QV9A 4ZXOA 1YIXA 1RPKA 4CQ8A 2G8ZA 4F9DA 4JIEA 1LJYA 3ITTA 3TTYA 1BQGA 2E28A 5EFFA 4HCLA 4XKYA 1XYBA 2YJQA 3LRLA 4CLMA 1J18A 4JICA 4Y8FA 3W2MA 1ZRQA 2OLAA 5A6KA 1GOQA 1GORA 1LORA 1MFUA 1ZUAX 1NJJA 3SBFA 5I2UA 4Z2HA 1MUCA 3EWYA 1W3NA 2W55A 2MNRA 2UBPC 1MEHA 3OZOA 4ZQOA 4HA1A 2ZE3A 1K7FA 3CWOX 4OJYA 2XN1A 1L2UA 1MUWA 3VDBA 3E96A 3T2OA 4S3DA 4UCGA 4RE2A 1HP4A 2Q8ZA 2QMJA 2VEMA 5T9CE 3NPWA 3LQLA 2LLEA 4BEUA 2RHGA 3E5PA 1I2PA 1NFGA 3F4WA 4HHHA 1P7TA 2PFHA 5E9AA 3L4YA 1UP0A 2QCHA 4DEFA 5I3JA 4A05A 1D3HA 1UD3A 3BG9A 1YDNA 4PR4A 1P0KA 1UBPC 3HQPA 3NPVA 1K9DA 2B7OA 1GSNA 1Q6GA 2GVYA 2PWEA 2R6OA 1JCYA 3OIXA 4MDOA 5DFAA 2ZRVA 4AAJA 3FDGA 2FZMA 5FS9A 1SO6A 1CI1A 5A8NA 1SJBA 3WLNA 1C8XA 1P7TB 3SFWA 5DY2A 1S39A 4U28A 3WD1A 3JRKA 3B9OA 8XIAA 3CL6A 1UR2A 1WP6A 3T44A 3RF9A 9XIMA 3NQ6A 3GNOA 2G50A 4M81A 4UNIA 3QM3A 5RUBA 4GZIA 2GK1A 2J13A 4C6NA 1TCDA 3U4AA 4ZE4A 1EBGA 3FIGA 1CLVA 3FAXA 1GEUA 3MPGA 5FKYA 2BOGX 3FAWA 5JBFA 4LYPA 1XUZA 1DJXA 2NWSA 3OGRA 3UVIA 3R11A 1UZHA 4JEJA 2CERA 2Z2AA 3UJFA 4AUBA 2DSKA 4H83A 3WD0A 3KL3A 2JEPA 2O0TA 5CJ5A 1E4NA 4QBXA 4HU3A 2ICSA 3SGGA 1XLHA 4F9JA 3S9ZA 2CC0A 4IM4A 1TRDA 3OBKA 4XZLX 5MHBA 4ORMA 4MMWA 2A79A 4PTWA 4WK9A 1OGSA 3MDUA 4DQWA 3HBLA 4GNJA 3QBUA 3RK8A 2CW6A 3POCA 4HKPA 1BAGA 3LDVA 3SDOA 4H8UA 3DJJA 3AZSA 4FAMA 3MANA 1CXFA 3P0XA 2VURA 1Q3NA 3EXRA 4O50A 1WKEA 3PZGA 3F2BA 2J9XA 3C5QA 3AN1A 4O15A 3OLGA 2VVSA 4W84A 4MY9A 3LHVA 3PNUA 3GU9A 3VINA 3VKKA 1XHCA 1UR4A 3W1RA 1AMYA 4ACZA 2VR4A 4FIRA 4HPHA 5CPLA 3LADA 1ZBKA 4KCWA 4ZTXA 3WF0A 2XGZA 3AYVA 4JN6A 1R3TA 3A24A 1JAEA 3W7HA 2J77A 2YL6A 1YXCA 3LPOA 1XM3A 1E56A 1FBAA 1UD6A 4O14A 3ZJKA 1SZGA 1J10A 3GQYA 4IIEA 4P7RA 3SY5A 5G5GB 3SCVA 3PANA 1Y0EA 4ZB2A 3FJ6A 1VP5A 2V9DA 2Y6ZA 3IRSA 1ZP4A 5FA5A 1MMFA 1TV7A 6TIMA 4K1GA 3MBFA 4FIQA 1JCLA 3E38A 3BV4A 4GGBA 1PCWA 5HK4A 1EOMA 1LL6A 1P4CA 1XSIA 1W56A 3PG9A 4ACZB 1QPKA 1V3IA 4HU8A 5LNWA 1H1NA 2ZOXA 5IXEA 3WFAA 4DI8A 3V16A 1OFDA 2YFNA 1RAKA 1HJQA 3ITCA 3W3OA 4F79A 1RV8A 3ITYA 3DCPA 1MUMA 4HZMA 3GRIA 1UKTA 6ALDA 1XH0A 2VMFA 2VVNA 4J40A 3MCMA 4GIEA 3I3DA 3T08A 2HXTA 3QV8A 1H49A 3H23A 2GJRA 2W62A 1SJCA 1UQYA 2E6DA 4HMCA 2DP3A 5C54A 2HK0A 4ZOAA 1S5MA 3UZZA 4JKMA 4W9TA 3XIMA 1U1JA 1JL8A 1N62C 1TYTA 3WNMA 5HMSA 1HXJA 2WCAA 2F6UA 3ZM8A 1LLOA 2FZ9A 1XLBA 4YMZA 5T91A 3SRFA 3GS6A 4JIHA 3K1GA 4TTUA 2RJHA 4NXSA 1EIXA 1OX6A 2VRQA 3POHA 3Q94A 4ERIA 1V0LA 4NZCA 4GKLA 3TN6A 4GK8A 4XTIA 1CEOA 1J01A 3SCRA 3PPGA 4PUUA 7TAAA 4O12A 1TRIA 3WD4A 4GD0A 1CXIA 2E68A 2OEMA 3S6TA 2P88A 1V08A 4ADTA 1VJIA 2ACRA 4L9YA 3AISA 1EO7A 5FIPA 4OGZA 4R85A 4EP8C 4MLRA 1BPLB 1RVGA 3ZWTA 3GWQA 3WQEA 4GI6A 4NP7A 1EP3A 4WGHA 2OSXA 2Y63A 2AMGA 2DT2A 5D32A 3EDEA 4O53A 2PTZA 4PRTA 1EJSC 4E0CA 1PX4A 2Y0FA 1XQKA 1C92A 7CGTA 3G77A 2D3LA 5JQ9A 1Q6OA 3HG2A 3NGFA 1TTIA 1UR1A 4H4XA 1S3HA 2NUWA 3E0LA 1YW1A 5FL0A 2Z27A 1V8EA 3V1HA 3CHEA 2W92A 4AFYA 1EWDA 2Z1VA 1VKFA 1TWDA 2NV1A 4MPQA 4E4FA 3SUUA 1XLFA 3WEZA 4TMBA 5HQLA 1TYGA 3DKLA 3GO2A 3U3HA 3C2RA 4L65A 2O7SA 5CH9A 3E9AA 3IJDA 4MGGA 2I5QA 3C8FA 3O1NA 1RK5A 3NOEA 4UTIA 3VD9A 2GFTA 1TWWA 4PFHA 1VFUA 1NHSA 5JXQA 3W1AA 1FCQA 4B5WA 2D24A 2ZRZA 4I5UA 3K13A 4F0SA 2RABA 1E6NA 4R5EA 4CUCA 3TEVA 1RP8A 2C1HA 4ROQA 3AYSA 4M3PA 3GXTA 3W01A 2GRTA 1UMYA 4NNBA 1EXPA 4DN1A 1H63A 4P2VA 4Q4QA 3NDOA 1F6PA 1VIZA 3BQ6A 3CTTA 3WFZA 3TOPA 4FP1A 2L5HA 4S3CA 4IJCA 1Q8JA 4L6OA 4KETA 3P5YA 2GUYA 2KZHA 5CC7A 1YX1A 3U57A 1OZMA 4AEEA 3EB4A 3WLSA 4PCTA 4UB9A 4XBKA 4PMZA 4RLIA 4RZ6A 2FVLA 1IT8A 1EDGA 4K3ZA 4D6JA 1RK6A 4CD4A 4GY7A 4AZ7A 4W8LA 4KEVA 3LSCA 3CAKA 4S2BA 4LPCA 2O9PA 2WVTA 1W1B1 3EWUA 4W7VA 4B5NA 2VFIA 3K8KA 4WDUA 1CX9A 3KRBA 1G4TA 4WSJA 1PTGA 3CUXA 4E8DA 1VH7A 2X2YA <