3IJIA

Structure of dipeptide epimerase from bacteroides thetaiotaomicron complexed with l-ala-d-glu; nonproductive substrate binding.
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
336
structure length
336
Chain Sequence
b'KMTFFPYELKLRHVFTVATYSRTTTPDVQVEIEYEGVTGYGEASMPPYLGETVESVMNFLKKVNLEQFSDPFQLEDILSYVDSLSPKDTAAKAAVDIALHDLVGKLLGAPWYKIWGLNKEKTPSTTFTIGIDTPDVVRAKTKECAGLFNILKVKLGRDNDKEMIETIRSVTDLPIAVDANQGWKDRQYALDMIHWLKEKGIVMIEQPMPKEQLDDIAWVTQQSPLPVFADESLQRLGDVAALKGAFTGINIKLMKCTGMREAWKMVTLAHALGMRVMVGCMTETSCAISAASQFSPAVDFADLDGNLLISNDRFKGVEVVNGKITLNDLPGIGVMKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Muconate cycloisomerase
molecule tags Isomerase
source organism Bacteroides thetaiotaomicron
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
total genus 120
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 5.1.1.20: L-Ala-D/L-Glu epimerase.
pdb deposition date 2009-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ijiA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ijiA01
3OP2A 4ZCWA 4K8GA 4GMEA 3B97A 5FJRA 3K1GA 5EU9A 3QLDA 3UGVA 3DESA 3DDMA 1TE6A 3DEQA 1MNSA 3NFUA 3RITA 4MMWA 4GFIA 2AL2B 5FJPA 4IT1A 4GYPA 5BOEA 3KUMA 2MNRA 4M6UA 3GO2A 3R11A 2XH7A 3UXLA 2OLAA 7ENLA 2HNEA 1KD0A 3I6TA 2GGIA 3R0UA 3T8QA 4Z1YA 4FP1A 4H83A 3PFRA 3R0KA 3GY1A 2QDDA 3IJLA 3GC2A 1WUEA 4GYPC 1MDRA 2PMQA 2OZTA 4DYEA 2PCEA 5J04A 3S47A 2PTZA 1F9CA 2QJMA 3FCPA 3QPEA 2QQ6A 3MZNA 2OQHA 4E5TA 2FKPA 3EKGA 3V5FA 3HPFA 3TTEA 3CYJA 3BSMA 1NELA 4KT2A 4IP4A 3THUA 2HXUA 3DFHA 1E9IA 4GIRA 1EC9A 3SQSA 1MDLA 3I6EA 3P93A 3DERA 3P0WA 3U9IA 3TOYA 4MKSA 2HXTA 4K2SA 1ECQA 4J3ZA 4A6GA 1KKRA 4IZGA 1SJBA 2PP0A 3FYYA 3CXOA 4IL0A 3FJ4A 2POZA 3N6JA 3SN0A 3N4EA 5FJTA 2XH0A 1NU5A 3U4FA 2PTYA 4KWSA 4HCLA 3UXKA 2P88A 1WUFA 1TZZA 2AL2A 4F4RA 3R25A 3IJQA 3MQTA 3ENLA 1BKHA 3VC5A 3ZLGA 3IJIA 1SJAA 1OEPA 3CT2A 1PDZA 4DHGA 3H8AA 4H19A 1JCTA 1YEYA 4HCDA 3MSYA 3RCYA 4IP5A 2NQLA 4A3RA 3TW9A 2ONEA 2XH2A 2OQYA 3GD6A 3UJSA 4K1WA 3MWCA 1RVKA 3H70A 1P43A 3N4FA 2PTXA 3Q45A 3OTRA 2GGJA 2AKZA 4ENLA 3T6CA 1R6WA 1PDYA 3BJSA 4G8TA 3FV9A 2PODA 1MRAA 4JN7A 2P8BA 3R1ZA 2QJNA 1ELSA 1P48A 3V3WA 3VA8A 4DXKA 2OVLA 4HCHA 4IHCA 2QVHA 2GL5A 1W6TA 2XH4A 2PS2A 3CB3A 4GGHA 2RDXA 3JW7A 3P3BA 3TWBA 2P8CA 3ZLHA 1SJCA 2P3ZA 2GGEA 3H12A 4ZA0A 3PWIA 2ZC8A 3S5SA 2O56A 4YWSA 3D47A 2AL1A 4DX3A 2PA6A 4E4FA 1KCZA 3OW1A 1TKKA 2GGHA 3JVAA 4Z17A 5ENLA 4HNLA 3ES8A 2QJJA 4H2HA 3DGBA 3NXLA 1KKOA 2I5QA 1JPMA 3QTPA 4KPLA 2DW7A 3NO1A 3SJNA 3FVDA 4HPNA 1EBHA 2PU1A 4HNCA 2MUCA 3MUCA 3TJ4A 3QN3A 3TQPA 2OG9A 1IYXA 3DG3A 2OFJA 2XSXA 1EC8A 4JHMA 3MKCA 4KEMA 6ENLA 4IL2A 2CHRA 3BOXA 3TJIA 3PK7A 3DFYA 4H1ZA 4JN8A 4J1OA 4EWJA 1SJDA 3RGTA 1XPYA 2DW6A 3T4WA 1EBGA 2PU0A 1EC7A 4DWDA 3D46A 3V5CA 5BOFA 2PP3A 3RR1A 4E4UA 3DIPA 2HZGA 1DTNA 2OZ3A 2QGYA 3ZLFA 2FYMA 3RRAA 3ZVHA 5IDZA 3UJFA 3IK4A 4FI4A 3FXGA 2XGZA 3NZGA 3ZVHB 2PTWA 2GSHA 3ZVIA 3OZYA 3TCSA 3STPA 4E8GA 2OZ8A 1XS2A 3Q4DA 3PWGA 3VC6A 2OKTA 3OZMA 1ONEA 3H7VA 3ES7A 1FHVA 2PP1A 2QDEA 3SN4A 3VFCA 2P0IA 2OO6A 3UJRA 2PSNA 2GGGA 3TWAA 3R10A 5FJOA 3N6HA 3UJ2A 3EEZA 1R0MA 3DG6A 4X2PA 4MGGA 2OX4A 5FJUA 2PGEA 3SN1A 4GISA 4E6MA 3RO6A 4HN8A 3I4KA 4GGBA 3V4BA 3CK5A 4ROPA 1BQGA 3DG7A 3SSZA 1FHUA 3UJEA 2OPJA 3VCNA 4HYRA 4M0XA 2GDQA 1L8PA 4A35A 2AKMA 1JPDX 2ZADA 1JDFA 3VCCA 2PPGA 3SBFA 3T9PA 4DN1A 4G7FA 3OPSA 3JZUA 3MY9A 3UCDA 3CAWA 3QKEA 3UCCA 2PGWA 3VDGA 1MUCA
chains in the Genus database with same CATH superfamily
2ZX5A 2VEKA 4HHLA 3B97A 4DVOA 3TROA 4GI4A 4JDYA 3RLUA 1MNSA 4L4PA 3RITA 4RX0A 3RAOA 1R3RA 5FJPA 3W81A 4N0RA 1W9VA 2GJPA 1N8IA 3NQ6A 4YVVA 4FIQA 3QKZA 1QNRA 4ZQCA 1GVOA 1UWQA 1WZKA 2AQWA 4DF1A 2REQB 1GNXA 1NOFA 3WMBA 4DLFA 1M01A 3VIFA 5CPLA 4BI7A 4EPKA 3I7RA 3OQEA 1KLZA 3GK0A 4CQCA 3DFOA 4APNA 5XIMA 2V3AA 1LLZA 2V2HA 4QQ3A 3DJGX 2QDDA 2VC7A 3GC5A 2NVAA 3W28A 4PUMA 1XBVA 1HP5A 2XN0A 4K7ZA 5K9XA 1X98A 4W8BA 1MDRA 4YVPA 5I79A 4HA4A 3N3MA 3AXIA 2DSWA 4TUFA 3AZSA 2HS6A 1QT1A 4ZE5A 1CYGA 3HPFA 2GJXA 5D2XA 5H2ZA 2OXNA 3V36A 3T0TA 1OADA 4LUIA 4HSOA 2QCGA 3NPUA 4Z1CA 4HP5A 4J3SA 3W2NA 3DFQA 1TV8A 3U9IA 1L8NA 2YCEA 4JNMA 4JQ2A 4JTSA 1CDGA 2WCSA 3H22A 4GKLA 2D3NA 3O6CA 5A8NA 4L4OA 3GIYA 3AISA 4Q4RA 4GY7A 5HULA 3V35A 1DJHA 3BGGA 3AI0A 4QAIA 1EB3A 3KLJA 1NFBA 3RLVA 1S5VA 3SUTA 3S42A 4WJXA 3PBVA 3CLMA 3LBCA 2BOEX 3GC4A 1LQ0A 3MQTA 1I6NA 3RU6A 2I1OA 5AVNA 2D0GA 2P1FA 4I90A 1V5XA 2VO5A 1W2VA 3OIHA 1U5VA 1EP3A 2QJIA 4O13A 3L21A 3BTNA 4PB3A 3PULA 4R33A 2XH2A 1UD6A 2OQYA 1KFCA 3C8FA 4EKJA 4E2BA 5FF2A 3N4FA 1IEQA 1ZJBA 3V0UA 4DWSD 1XF0A 1RJPA 4GIYA 1K02A 4LAMA 3VE7A 3CUJA 3MC5A 4PMVA 3W6LA 5HXMA 4U3CA 4S3CA 2WCGA 1IWAA 3CH9A 3SURA 2BFGA 4XAPA 3M0KA 3CAQA 1W5NA 3KBWA 4B5UA 1ZAIA 3E0WA 3WN6A 1VIWA 2ZUUA 4P7NA 4OIFA 2OVLA 4PTDA 2W3SA 1H7WA 4ZB2A 4BFAA 2W27A 4EACA 1QDSA 1VENA 4M6VA 3IVTA 2ZZ1A 4O8AA 4PFMA 1XD0A 2JEPA 2XVNA 2XVKA 3TSDA 2NX1A 3L4UA 1KRBC 4QE5A 2DZBA 3AXXA 1I2PA 2GVYA 3KL0A 4MIMA 4AD0A 2E77A 2DORA 2YXOA 3AUJA 3S5SA 1QU4A 3HB9A 2EG6A 3QFEA 1U1UA 4WUIA 3SY8A 3SW6A 4ATLA 4BA0A 4MKVA 1S2CA 3MJMA 4WXYA 4P7RA 3BQ6A 1US3A 1KTBA 4JKMA 1PS9A 5AHNA 3IGUA 1QO5A 2INZA 2WKLA 2ZRWA 1KWGA 4WXZA 3BGJA 1GT8A 1HFBA 1OHLA 3A47A 4AD3A 2A6NA 4XKYA 1IGWA 2J6VA 3QQ0A 1EX5A 4D6DA 4GIAA 3CWNA 3FVDA 3PBMA 4JTCA 4QJ1A 1Q6RA 3TAKA 4UTTA 4JTRA 1T0OA 1VFTA 1UG6A 3PC0A 4JS3A 4Q8WA 3B9DA 3PP7A 3GNNA 5HUPA 3RX4A 2P53A 5CJMA 3MI6A 4WOQA 3I68A 3TK7A 4KEMA 1XYBA 2GSJA 2VEFA 3ITLA 3MP5A 1S3HA 3VM7A 4H1ZA 3ZT6A 2J7HA 3O1NA 3HMJG 3M7SA 3I3BA 1F6KA 1B2YA 1FWNA 3U3HA 3KFTA 2W66A 3W0KA 2BXZA 2OCZA 1W2PA 3SR7A 3HM7A 1E4IA 3TOPA 5HWNA 4LRTA 4AZCB 2WBAA 1EPXA 3BJFA 1KM0A 4ORIA 1U30A 3EWWA 3IIOA 3HN3A 2GR3A 4BEQA 3KRSA 2JF7A 1CXKA 3NZGA 4GJIA 2V6AA 1YTDA 3TLLA 5G1TA 1K9EA 3TSMA 4V33A 2TSYA 3H4KA 3HFTA 5JH2A 1TV4A 2Q8LA 4DF2A 1EDQA 5CC3A 1K6AA 1DVJA 1VFSA 2IPWA 3PBWA 3L4WA 2PLKA 1V79A 2ABBA 3QF0A 3EWUA 7A3HA 1Z44A 3AIVA 3EB2A 1DXFA 1XRVA 1YKWA 3DZ1A 1UYQA 1AOGA 1E9LA 3GFYA 4F2BA 2FTYA 5HQLA 2VXNA 3P61A 4AX6A 3NQMA 1V97A 3AMDA 4C6CA 2NQ5A 1D8WA 3GU1A 4LW7A 4Q6JA 4WJEA 3VGGA 3M0JA 2IXVA 1AD4A 4D6GA 3FG2P 3TONA 3UY7A 4TV5A 3NA8A 4WIWA 1XYMA 1K3UA 2R24A 3I4KA 1WXZA 3PNUA 1C9WA 5ABFA 4ATDA 2PDUA 4H7ZA 3F03K 1W8SA 3TN5A 4ZOHB 1OG0A 4H50A 2YCIX 3FXYA 5D9PA 1J6OA 2GDQA 3WJSA 3QSRA 4J35A 5G4HC 3G18A 4JR5A 2FZ9A 2PCQA 3B8DA 1UR3M 3P0XA 1MW3A 4DJEC 3WO8A 1JZ7A 5KZEA 1PZ1A 4ZB0A 5CGQA 5A8PA 3B9EA 1PTDA 1DQWA 1A4MA 1OCBA 1S46A 1BPLB 1P0KA 4XVDA 1UUMA 3WH9A 3MUAA 3ABQA 2IS7A 2J9YA 1E51A 3MDUA 1KFLA 1XV8A 1KFKA 4GZIA 3TTQA 3GU9A 3KOYA 1XBXA 1WDQA 3WK0A 2VCCA 4ECLA 1OFQA 3ITYA 3C52A 4NAFB 2DSUA 4M6UA 1EJXC 4DJFC 2G97A 4PZVA 2ISDA 4GK8A 3OQ8A 2I17A 4O54A 3O7UA 2XVPA 2QPUA 1PWLA 2Y6ZA 4ICCX 2J25A 1FXQA 4TMCA 3T0BA 4PC8A 3RX2A 4AG0A 4Q32A 4CN6A 4MFDA 3WNNA 3F1QA 1TX2A 2HS8A 1IEIA 2C1HA 2YCJA 1G7UA 5REQA 3AALA 1JG9A 2NSOA 2D24A 3IIVA 3ARVA 4FSAA 3RIKA 1F9CA 2Y8KA 4NEVA 3AIBA 2NXHA 2QJMA 4D6CA 3QW4B 3R8HA 1NHSA 1O12A 2PURA 3UWYA 2IKHA 4HZ6A 3T81A 5I5RA 1E0VA 3KBSA 1N62C 5U25A 4KT2A 4PUWA 2H8XA 3WX7A 3T42A 2W6RA 4HT3A 3PAOA 1M68A 3U6WA 3KE0A 1PTAA 3WJZA 3SQSA 5TQLA 4O19A 2V8ZA 2ESCA 2OT0A 3WQOA 3WDJA 4JYEA 1AMYA 4LJ3A 1A0DA 5FSEC 4Z2LA 4NJJA 3KVMA 5CPMA 1IXPA 3W2LA 4CQAA 4K38A 5CKSA 4D6IA 5G2HA 3H2AA 3M16A 1ZY9A 1X6NA 1DYSA 1Q13A 2VZSA 1PIIA 4KWSA 1JDEA 3WNKA 1XIHA 3G1SA 2C0AA 3WBEA 5LXXA 1R3YA 1NHPA 3XISA 1NWSA 3IGHX 1GQLA 4XSLA 4GUIA 4BURA 5H8PA 1XIMA 1WKFA 2Z28A 3EX2A 3C2EA 3SCQA 2PWUA 3WD0A 1JCTA 1KFJA 1YBQA 2XDFA 3M0XA 4IIBA 3O8AA 9CGTA 2ONEA 1JGIA 4XUGA 3RF9A 5ECVA 3UEQA 3QPZA 1DJQA 5EFDA 1C3FA 3A7AA 2C71A 4ZXLA 1Q63A 4H9TA 4JZ5A 1J79A 4S2CA 5M3WA 4KKXA 3L4XA 1UCWA 3V3WA 3TNBA 3U48A 3WQ6A 3CUIA 3W07A 1SFJA 2WYSA 1VB9A 1W3JA 4PE8A 2PDJA 4PTVA 2R94A 1K7EA 3BPWA 4RNIA 4P7QA 3CB3A 3QY6A 1RY0A 2HNHA 4C65A 4HVXA 1FDYA 2BASA 4UQAA 1DWFM 3HBLA 3ZLHA 1N5XA 4HZMA 3KZSA 3L68A 3URHA 2XJ7A 5FF7A 3GHSA 2I5IA 4M8UA 1JI2A 4RKAA 4CU6A 1UKPA 4PCFA 4H01A 3RM4A 2QIWA 2E1WA 4P5UA 4E4FA 2G3MA 3CJPA 3JS3A 4NAEA 3VGFA 1BHGA 3R94A 4HPHA 3UVAA 4DNHA 2E6YA 4GQ0A 5EB8A 4MWAA 4PTXA 1H1YA 3BDKA 3B8TA 4C6LA 1TB3A 2IPJA 3AICA 5JU6A 3LTYA 4JPGA 4ZL1A 3FGCB 2V3FA 2E5BA 2X99A 1U22A 3GRSA 2CLOA 4DZAA 3GHRA 4US6A 1WCGA 3F4DA 3IV8A 5DQPA 2CERA 5AYZA 1WNOA 5CSRA 2ZCGA 4MTVA 4N42A 3OBKA 7XIMA 2NUXA 4IF2A 4JL1A 3LQGA 2REQA 2EPHA 3MDWA 3HJZA 1W37A 4FO4A 1EGVA 1YX1A 3TLQA 3INPA 1TJ1A 4GIEA 5PTDA 4KWVA 4L4LA 4ATWA 4I9MA 4R27A 3QY7A 4OOZA 5I23A 1QW9A 1RBOB 3C0LA 3T0CA 3VOGA 3W24A 1EC7A 1GTHA 4JIRA 3DHFA 3TZNA 5ABTA 4AHQA 2NQZA 2GK1A 4NG3A 3SR6B 4DNMA 1W3KA 4LUYA 4FAMA 1DXLA 4A22A 1CGWA 1UPMB 1R46A 2PLJA 2FYMA 1ENUA 3QYQA 5HA7A 4BK9A 3ZWTA 3II4A 3ZVIA 4FLQA 5H1WA 2HQAA 5FS8A 5GNZA 4CD5A 3GZAA 3F4VA 4WY0F 3WD1A 3H2EA 3LZ3A 1TZ7A 2RABA 1R3VA 5ABEA 2OOFA 2I5GA 4ZB5A 4DO6A 3FSUA 1QHOA 2PDIA 1P1MA 2J62A 2P0IA 2Y1HA 5JQ9A 4DEFA 1LOSA 1W5QA 3L0GA 4A2SA 1ONXA 4ZO8A 2BVDA 1O95A 1U2YA 2HSAA 3SQPA 1OX5A 1OJTA 3B9OA 2E5AA 4D9PA 4YTQA 3OLIA 4EQWA 3NXFA 2E1DA 2G4JA 3PFMA 4AZCA 2JKEA 3CZEA 5LGXA 3O0HA 4PGLA 2WQDA 3VIPA 4FB7A 3TDFA 3IJ9A 2TPSA 3TJLA 5HJLA 4WDTA 1H09A 2VFDA 3STGA 1GVYA 2W3ZA 4IPIA 1JRBA 2ZDSA 4BF9A 2BWGA 2WMGA 3C0JA 3WFLA 4GISA 4LVFA 4LOCA 3IEBA 1BXCA 4HN8A 2CBUA 3S2MA 2DQWA 4UMAA 1CPUA 4AZ6A 1R2RA 4EK7A 1UROA 2WSQA 1ADOA 2YL8A 4K39A 2OPJA 5HATA 4GUGA 2Z1VA 2BG5A 4MZ8A 3I7QA 2IKIA 3EF6A 2X1UA 4W84A 4V28A 3H2CA 1CCWB 4DJDD 4CD7A 3VOHA 1TFVA 3NL5A 2W63A 1F3XA 2GDVA 3IVSA 4NI8A 4I6VA 2HVNA 1S1RA 3ARXA 3DI1A 4C6JA 1JXJA 3ZSTA 4O11A 4DAFA 3TYEA 1EUAA 3OP2A 5LXEA 1I4NA 3PVFA 2YDRA 2YL6A 2YA1A 3ITOA 3T78A 2NQ9A 1ZJIA 3WD3A 4GOAA 3P67A 1UWRA 4CQ9A 3SFWA 3WQCA 2Z4GA 3P5YA 3G8RA 4Z2KA 4IT1A 2PDNA 2AAQA 1PHWA 3GR8A 4H4YA 3AHVA 5IFPA 4B5WA 4H9XA 1P7TA 2ANUA 2QUMA 2P50A 1Q1RA 3T8QA 3BW2A 3E96A 4AISA 3IK2A 1GOKA 3H54A 2FFCA 3N9KA 4EAYA 4BQ5A 4C6EA 3NQCA 1WUEA 4NAEB 3SQLA 2CXEA 1I2OA 2OELA 4S3BA 5MF5A 3UNDA 4FMVA 3KP0A 2OWCA 3APGA 3VNKA 4FLRA 3TE9A 4IMCA 4AZGA 4KEUA 2QEZA 2G8ZA 3A7UA 1U83A 4DM1A 4M3PA 2VUNA 3O15A 4NILA 5I0DA 1RVGA 4B4FA 1TWZA 4WZHA 3MHFA 1UA3A 2CHOA 4YN5A 5FF0A 3GUWA 5A6LA 4AZIA 4GVFA 1TTIA 2XFYA 4QEEA 2BHUA 4AMAA 4F8XA 1Q3NA 2YB1A 3CASA 4O1AA 1XD1A 1QNOA 4J3ZA 5HK4A 1E73M 4GQQA 3NPVA 1ZALA 5BXRA 1JEZA 1QI2A 1VPXA 2NW0A 3GDTA 3U2EA 4GE8A 3WQFA 5HPOA 3N6JA 1GYMA 1V0KA 4I8YA 1XIIA 5LNVA 3UBPC 4MLJA 1CX9A 3WUGA 4HCLA 3WMSA 1W1VA 4MPKA 1BVWA 2HWGA 2AL2A 2R8WA 5JBFA 1XDLA 3A3WA 4BI6A 5T26A 1H0GA 1O7AA 3GB6A 4NIRA 3RCYA 4WDWA 3CL7A 3UJSA 3CGTA 4UWMA 3OTRA 4OECA 1Y7VA 1NPXA 3T6CA 2C16A 2I9EA 4QLLA 4HK5A 3NZPA 3UZJA 3QFBA 3M44A 3G1YA 2VJXA 2Z0IA 2XVGA 4N7QA 4FF7A 1MRAA 3WBWA 1L6SA 1SYTA 3OVRA 1P48A 4XAYA 3PZNA 1SO5A 2RFGA 1UA7A 4PN2A 3G6MA 2GPTA 3D0CA 4OGZA 1GRAA 5IM51 2QPSA 3EAUA 2XSAA 3WLRA 2XH4A 2AQVA 5LHEA 3UT0A 3CUGA 1TUXA 4M6QA 2WHKA 3LLFA 2IKJA 1V3MA 1UOZA 3IV3A 4IIDA 3LV5A 1OK6A 1MQRA 1QNPA 2W54A 4CD4A 4ZA0A 4R7OA 2NUYA 3WQ5A 3APYA 3VKKA 1HKMA 4DUWA 3QEZA 5CBBA 3TU9A 2L5HA 3BZJA 1AW2A 1E0WA 2DY3A 2VR4A 3PBUA 3AHZA 2QV5A 3PHAA 3ARYA 3ALGA 2FH8A 4NUWA 4ZOEA 4WF7A 1XWYA 4PCSA 3AOFA 1KKOA 1XLDA 2FLIA 5HNRA 3GDKA 4DJFD 3QTPA 1OC6A 1VCVA 2DQXA 4XBKA 1AG1O 1JDAA 2J7CA 5LZLA 3BOLA 1UP0A 1L6WA 2QCCA 4K8HA 3QQWA 3QMRA 1ZY8A 3TQVA 4MY8A 4WCJA 4AH7A 4P8XA 2ASHA 3ECQA 4CNSA 3GE7A 1LT7A 2P76A 2CFYA 3UR7A 1LBMA 2ON3A 1JROA 4Z2HA 1AA1B 6ENLA 2CHRA 3KRUA 5FD0A 2CBIA 2PD5A 1B3XA 4J3UA 3DFYA 3WH8A 3PPFA 4KW2A 4AHPA 1WV2A 3BW4A 3QHMA 1O66A 3N73A 4LRSA 1OGSA 5DMNA 5AY7A 4AYGA 4DWDA 2EKCA 2WPGA 4QDWA 4U31A 2ZRYA 4EANA 1N5WC 3LXDA 2IXUA 1R2TA 1DTNA 5H8UA 3CL6A 3LCHA 1IWPA 2FPTA 3KBVA 5G5HB 4LB3A 3JRKA 1I45A 4AD1A 1JPIA 1UC5A 2PF8A 3QW3A 5H6HA 3ZVHB 3LMZA 1KGUA 5DO8A 2I56A 3OA5A 3N18A 6XIAA 3QZEA 2EG7A 2PZNA 3BURA 3W2JA 3ITCA 5LA1A 4Y9OA 2OO6A 2Y4SA 1JUKA 3AU2A 3HMCA 3E2QA 2DIEA 4UOQA 4LCSA 4JEQA 3DGRA 3LBOA 1QRQA 1V4YA 4YHEA 4IIHA 3COTA 4B3ZA 2DZWA 2YSWA 2VX7A 1RBAA 4ES4A 1QOXA 2DUXA 3NO3A 3VDBA 1GPWA 4XQ6A 2F7FA 3NOEA 1O94A 4UOJA 5F7UA 3VKDA 3K13A 5AHIA 1UWAA 2VVNA 5ECUA 3B0YA 4AB4A 3V7PA 4MADA 3RO6A 1CLKA 3P6LA 3B8UA 2QULA 4NP7A 3SRKA 2Y5JA 3VMPA 4HHMA 4W9TA 3UJEA 4BQ2A 4GH1A 5D9NA 1BTMA 3AZTA 2BY2A 1KCXA 1C8XA 3CWHA 2WJFA 3QHNA 5A2CA 2VD9A 5C6MA 5A2BA 1ZTVA 3VCCA 1ZGDA 4QFUA 3NVDA 5EGRA 4OT7A 1R2SA 2A3LA 3FK4A 1X2HA 4NNCA 2FJKA 4F3HA 5F2GA 3KM8A 5D37A 4QR6A 5EMUA 1BKSA 2J75A 2A3BA 1MUCA 5HANA 4OQVA 2AQOA 1OF6A 4FX6M 3FDGA 4WVXA 1UR0A 1M6IA 1E9ZB 4WOZA 3UGVA 4W8AA 3SIZA 3I3DA 4XAZA 3KL3A 4F9JA 1X8FA 3OLDA 3WNMA 3NQDA 1E56A 3LADA 1QCWA 2D20A 1XPGA 2F2KA 4GYPA 4F2UA 2VWTA 3RLGA 2DFAA 4HNTA 2XH7A 2DH3A 1UR1A 3N9SA 1XIEA 3VOJA 3RLHA 5F4WA 2PC4A 2VHLA 3I6TA 2V3EA 3R0UA 4C1LA 3C4UA 1EEPA 4RPQA 2WNWA 1FRBA 2Z1XA 4JX5A 4H6RA 3J7HA 1XLMA 1KWKA 2E25A 2WOQA 3A22A 1ZENA 5HDRA 1J2BA 3SJ3A 1H1ZA 2NPXA 1HO4A 2VQUA 1IV8A 2G95A 3VNLA 3FCPA 3QPEA 4W7WA 2NXGA 3CB8A 3CV6A 3NPXA 3EKGA 4F0MA 1LCOA 3BSMA 5E5CA 3P80A 4IP4A 2A6LA 2ZUVA 4LUSB 3WENA 1RP8A 1RBLA 3LGEA 2POTA 3AIUA 2OWWA 1J0HA 1XDIA 1JPHA 2ZFAA 5AECA 4TU1A 2EJ1A 1JDDA 3H55A 1PL9A 2VFGA 3CUFA 4ZTYA 4FF5A 4NZJA 5DT5A 4MZ1A 2A7RA 3LNPA 4ZO9A 1LUCA 2Q6ZA 2WK2A 2R1PA 1NJJA 2PWHA 4AHOA 3U4FA 4CNUA 1W91A 2BB0A 1P0NA 1DXIA 1W17A 4FXSA 2A4AA 2PD9A 4FNPA 1A50A 1L0PA 4IUOA 1NHQA 1ONFA 3HQOA 2G37A 1TJ0A 4OV4A 1E40A 1ZZMA 5CJNA 3VNZA 3KDOA 2X16A 1I2QA 4NQ1A 4AW7A 1SJAA 4H4PA 4H19A 3RMJA 3G2GA 4IP5A 1DJIA 1POJA 1W9XA 1ADSA 2B4GA 1H50A 4D6EA 4Q4QA 4WKHA 2NT1A 2X7VA 1K03A 5D32A 4B90A 1EJTC 3GKFA 3BCJA 4AEFA 3HA1A 2DZSA 3HU7A 1C90A 4C7FA 1TJ2A 4GCAA 3B0UX 1HUVA 4PUJA 1KXQA 1GSNA 3QSTA 2WJEA 5K4ZA 3DU0A 2BOFX 3VIJA 6CGTA 3WQ4A 3VA8A 1FWAC 1LJYA 1P0EA 2G41A 3EUB3 4RNHA 4MY1A 3B8WA 3IS4A 1BVZA 2FTWA 2VT0A 1X8CA 1TIWA 1GK8A 4IGMA 5GVJA 4DNAA 4PCTA 4LEFA 4IGSA 5KZMA 2GUYA 4PMYA 5CBJA 2ZA1A 6TAAA 5LA0A 2BGSA 4HIBA 3KRZA 2XG9A 1EL3A 1PCKA 2DGAA 1W1PA 3RJYA 3E5PA 1W1TA 3POHA 4L4MA 4KPRA 2A79A 4GVGA 1I60A 5EMMA 2ZZCA 1XYZA 4LEQA 3EKLA 4PBEA 4LV4A 1GOIA 1DIEA 3CMFA 1T6MA 5EKYA 3PB2A 4GLEA 4KIEA 4AUBA 1JFXA 2FZMA 1KQZA 3FDKA 2C3DA 4XBSA 5MKGB 3UG8A 3VGBA 2X7WA 4MB3A 3L5OA 1E0UA 4GZEA 2PDXA 5LIWX 3QGKC 4IFKB 4XZIA 3LNMA 2VFEA 1HJSA 1OFBA 3BAKA 3NO1A 4EPDC 1V6XA 4LUJA 3NSNA 1L6YA 5BXTA 3ERPA 1W32A 1GVIA 3VNYA 3B4YA 2VFIA 6REQA 2Z1SA 3EYPA 5HJXA 3PJTA 1BWKA 1PBGA 1OVDA 1IYXA 1NIUA 1TRIA 3TC6A 1G5AA 2PC8A 3EOOA 3BMVA 3UG4A 3VO0A 5D02A 1LP6A 3WCZA 2FHFA 1K8ZA 3TC3A 1ZSXA 4IIGA 3GH7A 5D2YA 4IL2A 1LTDA 4KEZA 5HMEA 1RQEA 4N4PA 2DT2A 1HGYA 2ZX8A 1LWJA 3N13A 4DY1A 1JUEA 1W3IA 4H3DA 1E5NA 2PU0A 4JIPA 3BAWA 1H3GA 1LRTA 4AZ5A 3CQKA 3UPWA 2VGFA 4E4UA 3GW3A 5A3HA 2HZGA 3EMZA 2QS8A 2Y7DA 3BG3A 1K7FA 2PE4A 3OG2A 3PS7A 3EA1A 1W1ZA 4UQCA 2FZBA 3ZLFA 2VI0A 3LGDA 3RYSA 3NEHA 3ZZ1A 1Z9AA 3CZJA 4CQBA 2PTWA 4L6OA 1HVXA 2GVLA 3VX0A 1LROA 3KLLA 2O7SA 1R5YA 3OZMA 3AHYA 2OTDA 4QM1A 3NL6A 3LRLA 3ES7A 2X50A 4AWSA 5AYIA 4UTHA 5BRBA 3HPZA 3I3EA 4Y9NA 5G1YA 3RN6A 3VKCA 4A3YA 5CSYA 3M0HA 4HU3A 1TV7A 3N6HA 1FVPA 1R7OA 1GEQA 4NRSA 2PDPA 5D9MA 3W84A 1HX0A 2ACQA 4S39A 1K1DA 3GVVA 4H4VA 2VCBA 3A12A 1MW2A 3C2VA 3SFKA 5FJUA 1V6UA 2AMGA 2D2HA 5DY3A 3B9NA 3T40A 4WY0A 2FVLA 2D2GA 3QZAA 3NL2A 4JKKA 1W9DM 2EPNA 1EA9C 4DO4A 1W3HA 5C71A 5LNSA 3OA3A 4H4RA 1OJXA 1FHUA 3E0LA 5CC7A 5JCNA 1J0KA 2J47A 4GJ1A 4O10A 1A5UA 1J5TA 2R1MA 3A4AA 3T1GA 5I3KA 3UZYA 4DELA 1LF1A 1F7BA 2ZZ5A 1K4HA 3JZEA 2BC1A 2WP6A 1CGXA 2B7PA 2X0SA 5B7YA 2QT3A 3C56A 2GQWA 3NNTA 3B8IA 3ARQA 1TPH1 2PGWA 3UCCA 4UZUA 5A6MA 4G1KA 3PZIA 3KTSA 3A4XA 3PAJA 1ZPTA 1NF7A 3HPXA 3UU0A 3L5LA 5EU9A 4W8LA 1BYDA 4FNUA 5HR7A 1T3QC 3MU7A 3GIPA 2WNNA 3AYSA 4KERA 1B31A 1Z7AA 2EHHA 1FBAA 3NQVA 4X0NA 2WVVB 3EAOA 3R11A 5G2WA 2OLAA 3C0SA 2CLFA 3S6TA 3MUIA 3VKAA 3EWYA 4Z1YA 2QF7A 3DH9A 5KTLA 1JCNA 5KEZA 3NTYA 3E6EA 2VURA 3KOXA 3WFZA 2A3CA 3OHMB 1CTNA 3LY0A 2PMQA 4HOWA 3WDQA 1Q7MA 1TPDA 1U5JA 2X1TA 3MA8A 1AH3A 3E49A 3E74A 4AX7A 3HURA 4LTSA 1M03A 4RE4A 4PR4A 1RZMA 3GBEA 2BNJA 2VOTA 3MSDA 3R8RA 1XYLA 1PV8A 5DF0A 3BL3A 5DRIA 4ZR8A 4CCDA 3AO0A 1F3PA 2WSRA 1E9IA 3M5ZA 1YDYA 2JBMA 3DFNA 3G1AA 3P0WA 4LAUA 3TOYA 2V81A 6XIMA 1ZMCA 2GRTA 1EIBA 1IR1A 3VUSA 1ECQA 3C2RA 1Y5XA 4E2VA 5F2IA 3BAJA 4W5UA 4QGCA 5C7HA 2YXGA 4JQ1A 4K6AA 5BU9A 1W9PA 5I7GA 4RXGA 3K30A 3A3XA 1TX0A 4GD0A 1TZZA 4F4RA 3S46A 3AWNA 3BV4A 4LQ1A 3KVJA 1F2JA 1OEPA 2O9TA 5F1UA 2GK1B 4JDBA 1R9XA 4PEKA 1RCXB 3D3FA 2YYUA 3TW9A 3NIYA 1Z89A 2R91A 4FNQA 4ICMA 1P43A 5IDIA 4C6KA 3HFYA 4N6FA 2FIQA 8TIMA 1OIMA 4HOZA 3W25A 3V1HA 2PDBA 1VBGA 2EO7A 2CIPA 4PMQA 3WL0A 3EX3A 4H8NA 2CWNA 5U4NA 1NTHA 3AHXA 1TTPA 4MFEA 2NVDA 4HCHA 5A8MA 2QVHA 2GL5A 1UBSA 3MKVA 2PS2A 2DIJA 2GOUA 3WK3A 4DZ5A 2EQ7A 1UH3A 4GQRA 3VXGA 1TIMA 4GNKB 2HBXA 4JX4A 3TWBA 3PG9A 4PTMA 1PX3A 2O9PA 5LIUX 1O5KA 5HQMA 3II1A 2WLZA 2X1SA 3NYZA 4YTTA 3ARTA 3N17A 2FGLA 3B0PA 1FDJA 1XH2A 3GG7A 3RNMA 5LA2A 3OW1A 4X60A 3GIQA 1BFNA 1S2AA 3BLDA 3FA5A 3SAZA 4JFWA 3SEPA 1TV5A 4GPNA 2X41A 5BWFA 2ZUTA 1CXIA 2BY3A 2XWDA 4HJWA 1QASA 4OBSA 1QHZA 3UZZA 4AD2A 1K8YA 1PX4A 2XN2A 2GR0A 5CPTA 1LM1A 4IH3A 4REQA 2VELA 3QLLA 1T8XA 3L4ZA 1NHRA 3EWDA 3PUOA 4UTJA 3IPWA 3BC9A 1XC4A 4EMJA 4S38A 1HL2A 4X9SA 3OLGA 2GVEA 2PDWA 4XO6A 4AIUA 4O17A 2BMBA 4DJDC 5DMLA 1Y0EA 3WJXA 4JIQA 2OFJA 4GUFA 3W1MA 3M1ZA 1A3XA 4L1WA 1EQCA 1TCDA 4Q4KA 2G0WA 2X42A 1GHRA 2Y7GA 2RHGA 4GXWA 3LHYA 1JFHA 1FUYA 4C5YA 3ID7A 2D2JA 4OOUA 1B3OA 2BLEA 3NQAA 3ZM8A 5ABHA 4I9JA 5K9CA 2GLKA 1V6WA 3T4WA 5CLWA 3TUUA 3VMOA 4O0KA 1NP2A 3MMWA 1KRAC 3HJEA 4WKAA 3TEVA 2J6XA 1R86A 1EHNA 1A53A 1GJPA 3GBDA 2GVJA 3UJFA 4F0RA 3LM7A 3UWWA 3JR2A 4O28A 2GYIA 1C29A 4X22A 4WJ8A 2H9AB 1X6UA 4C91A 2WZHA 4ZEPA 2WMHA 4JNYA 1IT8A 2EJAA 4YXGA 3W02A 5F2MA 4AAJA 1QW8A 3DH7A 3ZR4A 1A5MC 4CNNA 2E9BA 1RHCA 2NVKX 3ITGA 4B2DA 3NL3A 4LPCA 1TE1A 1M41A 3DG6A 3ICJA 2J24A 2NZLA 4G5DA 1T41A 5I09A 1XJBA 4IGNA 1BEUA 1LRQA 2DT0A 3V0TA 2GJNA 4GG9A 3GFZA 1PCWA 4Y7EA 3N14A 3WH6A 3O3RA 1REQA 1Y5WA 4LANA 3LXBA 4PMRA 4E6MA 1QR7A 4IXXA 4H8HA 3W7EA 1ZNNA 3SUWA 4U28A 3REQB 4ML4A 4IQDA 1BQGA 2FZ8A 3G24A 3FKKA 2WHMA 5CZJA 3VCNA 5HNTA 3P8JA 3ELFA 4M19A 3R58A 1ZBCA 2JIEA 1E6XM 2P5NA 4QHRA 4NU7A 1VIZA 3BZGA 4IMEA 3E12A 3PZMA 3FAWA 4KFOA 4CN1A 3QOMA 2GQAA 5E70A 2XHYA 1SMAA 2RDTA 1UR4A 1DL3A 1FP8A 2QCDB 2Q02A 4GRTA 4PCNA 3GD4A 3C0QA 3N34A 4WX2A 3CIWA 4K8GA 3DXIA 1QI4A 1ITUA 3KX6A 4EF9A 2WLYA 1NY1A 1NAL1 8XIMA 4MMWA 1UD5A 4R7WA 4YYFA 1E3XA 3WF0A 5C2CA 3BXWA 3FN9A 2D22A 1EP1A 3FLUA 5K4XA 4HNVA 5BYWA 1ODUA 3W01A 4MJ2A 2DP3A 1VC4A 4JTGA 4QAWA 5DBTA 3TC7A 3G3MA 4JY8A 3THQA 2WNQA 1RR2A 4E8DA 2WOVA 4H6QA 3UXDA 3NDZA 3PZGA 1KV5A 3CGEA 1GZ1A 1KNWA 5CC5A 1LVLA 1YYAA 2HK0A 1Q6DA 4B91A 3S1UA 1QAPA 2D73A 1RCOB 3MBFA 2ZZ4A 1RY8A 1EP2A 2H90A 3VAVA 3W1QA 1JDCA 1EJSC 3WDPP 2BTMA 4GVIA 3LCGA 1TTQA 2WPEA 1JCXA 1KFWA 1IEVA 3OODA 4EM3A 2Z2AA 1SZGA 3EDEA 5JBEA 1FX6A 5AHFA 1CXLA 3CNYA 5I3DA 2ZQ0A 1OFOA 2OLHA 3SUVA 2QMKA 4IWWA 1D3CA 2GWGA 1ME9A 3STFA 1V6YA 4O0ZA 1PWMA 4XAFA 2PTYA 1GVQA 3W6YA 4OUEA 1D7FA 2DZUA 4TVCA 2HVMA 3GM8A 2P88A 3EMQA 3UERA 3CUHA 3WF2A 5AZ0A 2XM2A 3FHAA 4JHZA 1I8JA 1JI1A 1H11A 3MSYA 2BVYA 4LB4A 4XD6A 4A3RA 4FR1A 3AU6A 1PYFA 1RVKA 1SSDA 4JL2A 1T40A 3STEA 3GXPA 1DHPA 1FWDC 3TYDA 5B7ZA 4AC7C 3LI1A 4Q3MA 1Q6OA 4NY2A 4LCQA 1C91A 2HV5A 4QX4A 2QAPA 3WMLA 2PODA 4QTGA 4Z2IA 1PTGA 3BQ5A 4YCOA 1XLLA 4L6HA 4A3HA 5CBIA 3OBAA 2PDMA 3FKRA 2YBUA 4KWOA 1NDVA 4S3FA 5D03A 2F5ZA 5J5DA 1QTWA 1GJUA 5D8ZA 2E6FA 4BCEA 2HCVA 4IFOA 5BRQA 2RKXA 4A21A 3K4AA 1LPFA 2J7DA 1XGDA 3VDAA 5C55A 2RDXA 1F5ZA 4FNSA 2B7QA 1LWHA 2J8GA 3BK0A 3APTA 2EEXA 3WLQA 1M7JA 3RJXA 1SM9A 4UNIA 2D0FA 1UJQA 1NOWA 2HVOA 4Y8EA 1BWLA 3O07A 3TXZA 2Q3OA 1YE4A 2VM8A 3GAYA 3WLSA 2E5DA 3H4GA 4ADWA 4KRUA 3LB0A 4MB1A 3URQA 3WK2A 3KHJA 3UW6A 3WLHA 2PU1A 1O5XA 4HNCA 5D04C 2ZUNA 3ITXA 2DZXA 3GLCA 3IRSA 4KCUA 3THDA 2F2HA 2CBJA 4MJZA 3VNMA 2W5FA 4IG2B 1OINA 8A3HA 1TA3A 5FOOA 1TPWA 1EC8A 1JD7A 1UJPA 4JHMA 1EJWC 1QWKA 4HSHA 4WQ6A 3BICA 1EYEA 1YPIA 3BOXA 2GUBA 3AN1A 5HPCA 3DBNA 4IM4A 3KVLA 4B2DD 1J96A 1YNPA 4J3TA 5LKYA 1SJDA 3GR7A 3ARUA 4WEVX 3TH6A 4L6DA 1J0ZA 2V2CA 3WIJA 1AQMA 3D46A 1HJXA 1MW0A 1J6PA 2Q09A 2QGHA 4CGTA 3SY1A 4L80A 4LVDA 2DVTA 1GVEA 2VZVA 3NVWB 3BMXA 4ZO6A 3WLPA 3ZVHA 3CXBA 4TMBA 3ZWSA 2DSZA 4PH6A 1XC6A 4KGJA 1XIBA 4PCPA 5A6BD 4UFHA 1H0IA 1K9FA 4KRTA 3VFLA 1A5AA 3TCSA 2VCAA 3VDHA 1SVDA 3N2XA 3VNJA 1VFOA 2ZTJA 3LUTA 5D9OA 5AHEA 1UKTA 1KM3A 4JFTA 3T7VA 1UP2A 2QCMA 2PDHA 3MMTA 2TAAA 2VNCA 2QW5A 3L12A 2RGLA 3HG2A 1XDMA 3MCOA 3M43A 3WFAA 3OB8A 4H9MA 4Q4OA 1BYAA 3NO5A 1R0MA 2QLYA 4BS0A 1Q1WA 1ONRA 3VM5A 3PZQA 3GXDA 3H53A 2Y5EA 1WKYA 3LLXA 1FFQA 2PFHA 3MO7A 2R6OA 1AK5A 4W85A 1FKXA 3GNDA 2VRJA 3AYVA 4Y9MA 3IUIA 3THAA 1DORA 5GNXA 1DP0A 3W7IA 1FFRA 5JIPA 2PWGA 1TSIA 3WNLA 1FWWA 3TV8A 1XLIA 4A35A 4O1FA 1CXEA 2X30A 3PZ9A 3MYPA 3B40A 3SGGA 1N8FA 4QLKA 3B8VA 5FCZA 1PZ2A 3BLKA 5FAGA 4TQTA 4C1KA 2VGIA 3B06A 2V9DA 3L67A 5I07A 1BGGA 3BSHA 1TJRA 5EMKA 3O6AA 3CAWA 4AD5A 4Q7IA 4UCFA 3L2LA 5M1TA 2CKRA 1FWBC 1TQJA 3BGAA 1I2RA 3GW0A 4K8DA 1OGGA 1R3SA 1QPOA 4X61A 3VNDA 4JIHA 2VGBA 5I2UA 1SW0A 1E6RA 3HG4A 2W9MA 1HNYA 3RG6A 1WXJA 4CCCA 1BG9A 5FSDC 3QM3A 2PGRA 1HF6A 1W0MA 3PG6A 3UXLA 1H4PA 3C86A 1ZP3A 2UZ9A 2GGIA 1MRQA 5LIYX 5DCDA 1WOAA 4C1NA 4YMZA 2R82A 1IT7A 5CPQA 3WLKX 3RPDA 1GRHA 2XWEA 4UNLA 4GQGA 2V5KA 2QPXA 3CMJA 2CPUA 2OZTA 4DO5A 3B03A 3QBUA 2YBVA 3HTWA 1EO7A 1TWDA 1QPRA 3BANA 2FZDA 4U10A 4LAOA 5AYYA 2G3IA 3GXNA 3V5FA 2KX9A 5LGZA 4NZCA 1EZ2A 1JRCA 3FFSA 5C2XA 1BWCA 2PBOA 1RA0A 2EXOA 5AC8A 4C6BA 1R38A 1NDAA 2PTDA 2IMRA 1GVFA 1MQQA 3WEMA 1UB3A 5GJPA 1Z41A 4QJ3B 2VX4A 1OCQA 4FX8A 4MVAA 1G9HA 1XCWA 4UXDA 2O7QA 3FYOA 1OFEA 3BH4A 4V2XA 1Z69A 2XH0A 4IQLA 4JTLA 5CZKA 1VFUA 1QI5A 3UP8A 1M65A 3E0VA 3LYEA 1YXCA 1M7PA 1LT8A 4M7SA 3S2LA 4Y2WA 2ZE0A 3PTKA 4JFSA 1MUWA 3IJQA 1OFAA 3PJUA 2ZZBA 1N63C 3KL5A 1HZYA 1N7KA 5DY2A 3RCNA 3U2CA 3GD6A 3DC8A 3M0VA 3ATZA 3HPAA 3IACA 3GKAA 4HTYA 2FJUB 3P84A 3N2TA 1YQ2A 2CC0A 4TV6A 3FY1A 1KM4A 5BMWA 1TYGA 5JIWA 5A69A 1UC4A 3NJ3A 3HF3A 4L5ZA 1ZS2A 1XQLA 4LCRA 1IXNA 1M7XA 3CHVA 4RE3A 4WSJA 3W22A 2VDGA 4DXKA 1AJ2A 4A2RA 4YS1A 1RLCL 2E3ZA 3M0LA 4ZGYA 2G50A 1H51A 4D2JA 1BYCA 3B3DA 5KZ6A 3SCOA 3TCEA 1R9YA 3GFXA 5AC5A 2DJLA 3CV1A 1VFLA 1BQCA 4XD3A 2W79A 2OEJA 3PTMA 4UC5A 1VJIA 3S6OA 3BG5A 1JL8A 1H5YA 4GY1A 2FPYA 4JFUA 3S5YA 3D47A 1UKQA 4LNCA 3TIMA 2PDQA 4Z17A 1CWYA 3VIHA 4HA0A 3CGBA 1UR9A 3T09A 3QJAA 1GRTA 4Z0JA 1HT6A 8CGTA 5LNRA 1WDDA 1XLJA 2NUWA 5IRPA 2WP5A 3PZVA 3W7NA 3KZPA 3NGFA 1N8WA 1BWVA 1G69A 5CPNA 4PL2A 3H4WA 3NEVA 1F74A 2UY3A 1EBHA 3M0IA 2EF9A 3PUEA 1WX0A 4JBRA 4GHRA 1NM9A 2MANA 2OZ0A 3TQPA 3AROA 3D6NA 1KXVA 4LBRA 1DE6A 4EXQA 4KMQA 2VDIA 1XYAA 3VGHA 2PLCA 4FXRA 1ODZA 4LVBA 2J66A 2OX1A 3W7LA 3BAXA 3W73A 3E9AA 2NQJA 5F4SA 5TAOA 1ZLPA 2Z1BA 4X2RA 3U5UA 2QJHA 3O63A 3LHTA 5C54A 3VD3A 3URAA 2FVMA 1XQKA 1UHVA 2YXXA 1TPB1 1MXSA 2C15A 1VLWA 1TTJA 4RR4A 2YZRA 4DPQA 4WK9A 1Q85A 1SMDA 1HGWA 4UFJA 1A0CA 3CIXA 3T2PA 1NWUA 3RRAA 5CG0A 4Q33A 2IQDA 5T9CE 1HW6A 1XW8A 3L4TA 5JRBA 2VRQA 4X63A 3OZYA 2BHZA 3AS1A 3WJWA 1GQJA 2X40A 4E8GA 1KM2A 2WZEA 1XS2A 1AVAA 3LU2A 1GKQA 4MUPA 5EMYA 2IPGA 2WM1A 2QDEA 1GRGA 1OCJA 3W4RA 1VHNA 4XZMX 3OZPA 5FJOA 1GHSA 1Q45A 3UESA 1HJQA 1DIOA 3TN6A 4UFLA 4NJKA 2AGKA 4JTJA 1HP4A 3PR2A 3FAXA 1LOLA 1JQVA 3TSBA 3M6YA 2OX4A 3TYUA 3WZ0E 3OYXA 1KTCA 1RJRA 4H41A 1IHIA 3RM9A 7TIMA 4Q4PA 5J5RA 2X8CA 1VGAA 2GR1A 4FX7A 1MWOA 3WDHA 2C1GA 4XD5A 2E09A 2PI6A 4RXFA 3QV9A 1VP5A 5JMUA 4HYVA 4XB3A 3QGVA 3S9ZA 2ZADA 1M1BA 1RQHA 1U5HA 3WLLA 1F4HA 4MNMA 3OZOA 3RO8A 4Q8MA 4JX6A 1LG2A 1E70M 1BG4A 1KTNA 1M7OA 1V3KA 2YAUA 1W3LA 2QAFA 1GPFA 3MY9A 1XL9A 4AIOA 3N3TA 2UY5A 1FWSA 3KCOA 1FWCC 2QR6A 1AJ0A 1H60A 4TVUA 1VH7A 2UBPC 9XIMA 4ZQOA 1OGBA 3ITVA 4P7OA 4NZ5A 4LS0A 5MKGA 4W7UA 1EWEA 3QYSA 5AHLA 1I75A 3PTQA 4ZVJA 2WM0A 3K2GA 3L7RA 1UD2A 2YA2A 4CEUC 4MSSA 1JAEA 2MNRA 3E2SA 1XLKA 4REQB 2GFTA 4I3GA 3G0UA 4RZ5A 3DUGA 3AFBA 3SUSA 4MLRA 3M0YA 2V5JA 4FA3A 2PDFA 2ZBTA 4Q8PA 2C18A 2YDSA 3PZUA 1C8YA 1JRPA 4IMDA 1DHKA 1UD4A 3OBEA 4LNYA 1J0JA 4HPJA 3BV7A 3HQPA 3VNIA 2Z2UA 1DJWA 2GJXB 2ISWA 3SUUA 4QITA 3A21A 1UWIA 2VENA 4LT9A 4M7TA 3HPSA 4RV3A 4QE4A 1YBQB 1GEHA 3KCLA 2E5CA 2OQHA 2FKPA 3EGJA 2JGYA 3CYJA 1NELA 2R9ZA 3ZYZA 1GKPA 4MYXA 3W7RA 1JCMP 3UG3A 3ZJ6A 2VC5A 1CENA 2XN1A 5CSUA 3P93A 3G1FA 1ZUAX 4U33A 3C5QA 1K6WA 1TUFA 4N9BA 1KBKA 4HMNA 4UTWA 4IFKA 1WOBA 2E3TA 2H8ZA 2VC6A 3DK8A 4BZYA 2PRHA 5HBFA 1G1YA 5LNWA 1FWJC 1ZDLA 3LA4A 3LXAA 2ABAA 4JN6A 4C5ZA 4O12A 2QNEA 5LHFA 2ZOXA 3DHPA 4HZ8A 3MPGA 4AYSA 1D7KA 1PDZA 1UMYA 2CZ5A 1KA9F 1J0YA 2DVXA 2ZDRA 2Y85A 4WRHA 3KEHA 1XINA 4UR8A 3P8IA 5EBUA 1GTEA 4HSNA 1CNVA 2VL4A 3M5YA 4GYKA 4QS6A 3CYVA 3DYPA 2VFFA 1DJNA 3HGRA 3ONCA 2QIIA 1I1XA 1F6YA 4RL3A 5KINA 4I7UA 1EWDA 1ICQA 3DFTA 3SGUA 6ALDA 1OB0A 3M4HA 1ZBVA 4ZBCA 4RK8A 3MCMA 1HKJA 1K70A 3G1RA 1OYAA 4F9DA 1Q2RA 4G7EB 1SFTA 1SB3B 3F4CA 5CLTA 3W70A 1QFEA 1NVMA 3ZMRA 3JW7A 1GREA 4UR7A 3GDBA 3Q65A 1JAKA 5FL1A 1CBGA 3DYOA 1B30A 3SO7A 4ZQPA 1DBTA 5B80A 1FFVC 1WQ5A 4DBWA 2XUCA 4K3ZA 1SPQA 3VD4A 4H7CA 1UWUA 2VZTA 1EOKA 2Y0FA 3JVAA 1RD6A 4LVGA 1NARA 1H7XA 4WSHA 4YNGA 2BP1A 2VEMA 2GQ9A 1R7AA 5DLCA 3K8MA 4HNNA 4O16A 2I5QA 2PGFA 2PF0A 1PO9A 3PF3A 4ZOAA 1W3TA 3OHIA 3DAQA 1VFHA 1BAGA 1IWBA 3MV01 4A29A 5K2ZA 4X0VA 4LVAA 5AN7A 2J9ZA 4FXFA 3VIGA 1XGEA 5BNKA 1C9DA 4D1IA 1MI3A 1E4NA 4LF2A 3DG3A 2V82A 2OYKA 4PULA 3W88A 3S83A 3L2IA 3PG8A 1IE7C 4LF1A 5E0FA 1DIKA 3HV8A 3Q67A 3T8LA 2VKZG 2WMJA 3CMGA 5EA9A 4DB7A 1E1FA 3H24A 4IICA 3G3DA 2V5CA 2V69A 1KRMA 4F0LA 1SO3A 4EF8A 3QZ6A 3DK4A 3KOZA 3P5ZA 3DIPA 3IARA 2EAWA 3H21A 2OZ3A 1AQFA 4EX4A 1N60C 1HG3A 5IDZA 4JIEA 5C7VA 3UWEA 4Q4MA 1HN1A 2XGZA 1ITQA 5E9AA 4UTLA 1IZKA 1IZCA 1OT2A 2QHAA 1B9BA 1DQUA 3Q4DA 2FHCA 4FXJA 4FR6A 4NX5A 4BY3A 2RH9A 1ONEA 5D33A 1OCNA 2DH2A 1HTIA 3EX4A 1X96A 3GVWA 2WWDA 2ZXAA 5E1QA 4GR1A 3E5BA 4XTIA 2QCDA 1GJWA 3M6DA 2HPMA 3USZA 3O6YX 1BF6A 3EZ4A 3B04A 5EPDA 3WD4A 4XG1A 3NQBA 2V38A 1JF5A 1PKYA 2ZYFA 1F6PA 2IKGA 1XKYA 3D9XA 3W1AA 4S23A 1WO2A 1NOUA 4C6QA 4RE2A 1OK4A 4NNBA 1FWHC 1GW1A 3BSGA 1AUSL 3VKJA 4G7EA 1WAWA 1XG4A 2ZUSA 5EY5A 1REQB 4HK7A 1VR6A 3CK5A 5DX7A 4D8LA 4JTTA 1OX4A 3LHZA 3FHQA 5I3IA 1X1OA 3IJ8A 2Z1WA 1GRFA 4KETA 4WD0A 1I9CB 1JPDX 1TPC1 3K8LA 2YVFA 3M0ZA 2ICSA 3PUGA 2PPGA 3SBFA 3T9PA 4AEOA 4DJED 4H4UA 1JXKA 3LCXA 2J78A 4IPJA 1XFBA 1WYIA 2HMCA 1A5KC 1IIGA 1G0CA 4O14A 2I7GA 2VEPA 2FMNA 3H2FA 3SCPA 1SUXA 3FX4A 4GMEA 3LB8A 2C13A 4TVWA 1MEIA 2J74A 1VBUA 4RPPA 4AZBA 1TE6A 3MBDA 3AS0A 1AMKA 3TX9A 4IX0A 1P0BA 3DX5A 3G77A 4M51A 5I3GA 1JOAA 3E02A 4PUNA 3VD5A 3ARRA 2AAMA 1QPKA 3FEMA 1XM3A 3GO2A 1RPXA 3W1TA 3UG5A 1X1ZA 4TO8A 1OFDA 1Q7QA 2X05A 2KZHA 1JYNA 4Q8TA 1OYBA 4UTIA 2B7NA 1JZ8A 6REQB 1MYRA 2G3JA 3O06A 3MMDA 4MAVA 3OEXA 3SRDA 1VHCA 3QC3A 4FOJA 1ONWA 2OYMA 3SDOA 2WC3A 5D2TA 2O4MA 3U8GA 3UVIA 3ZJKA 2YKKA 1LL7A 1FXPA 5A6SA 4O52A 5BMXA 4W89A 3VZZA 4PMZA 1P4CA 3SCWA 3I6EA 3VZXA 3W9ZA 3WLOA 4MYAA 2HXTA 3WH7A 3B05A 1KQYA 4FOUA 1F4AA 1JULA 4MWAE 3V5OA 4WGXA 4PMJA 1WXYA 3WLIA 3FJ4A 4NXKA 4US5A 1TMHA 3N4EA 3HG3A 2Z6JA 1NU5A 3VIMA 4ICNA 3PN8A 4XZNX 3MZ2A 3VKBA 1OYCA 2QYGA 3G5EA 4R88A 1ISWA 3VABA 1VBRA 3WH5A 1U1HA 2O55A 3R25A 4I9AA 1VEPA 2PDKA 3SCUA 3CUZA 3S5ZA 1KBJA 3PSVA 5KSWA 1VYRA 1WBHA 2HEJA 3MUZ1 4HCDA 5AYBA 4IMFA 1SZRA 1LOQA 3CV7A 3G6LA 3SM0A 1MFVA 2YFNA 4PEEA 3WF4A 2D2OA 3TYCA 3UWUA 3QRHA 3NRZB 5FAJA 6TIMA 3N29A 1FCVA 4JN7A 5C9WA 1HL9A 5FA5A 1U1JA 3DOPA 1GERA 3C3UA 4M1BA 3BVJA 4OKDA 4U5IA 1Y5VA 2A3HA 3AYTA 2HE8A 5I06A 2V30A 3BWWA 4TOQA 4ZE4A 4GNVA 4BWLC 5E0CA 1V02A 5JCIA 2CW6A 2BGQA 3CLWA 3W7KA 3L0KA 3N15A 3L9CA 1VCGA 1E4LA 2QV4A 3G0SA 2FDMA 3RMEA 3DFPA 5DN1A 4AWUA 5TNVA 5I00A 3TFXA 1ZRQA 1E6NA 3AJ7A 1FKWA 2W0UA 1GYLA 1P6CA 1RALA 5KZDA 1AH0A 4XZWA 3WF1A 4LUSA 4HU0A 4TTUA 2J8FA 2ISSA 1FEAA 1THFD 4IX2A 4GI6A 5DFAA 4K37A 1IEXA 1SO4A 1V77A 4DJDA 4NSBA 4CNTA 1B4EA 3VGDA 3WUFA 1L6FA 5CQ1A 2C3ZA 3GR4A 4MNKA 3N4AA 1ZB5A 1I2NA 4PB4A 3V18A 3KXQA 4DI9A 1JYVA 3D5HA 1ZBWA 4NI3A 1JCLA 2XTKA 1XISA 2XISA 3W7QA 4BR1A 1A5CA 4J7RA 5AYXA 2VGGA 4ZSTA 4LYKA 5D8WA 2UWFA 3IAQA 4M81A 3ARZA 3RXZA 3VVGA 5L9FA 1XHGA 3K4WA 3VCRA 3AMCA 4B5XA 4PSRA 1B3YA 3W26A 1YDOA 2Q71A 3MMUA 1H7PA 4D8ZA 3DGZA 1TQXA 3CM4A 1XPYA 1UPPA 1SZFA 4DBUA 1QXLA 4CN4A 3N2BA 4HA1A 4MPQA 1XLFA 1EO5A 5BOFA 3TQKA 4JGDA 4H6KA 1NDYA 4AY7A 2DSKA 3K5XA 4PSPA 3G1XA 2EPLX 1EHAA 1Y65A 1DOSA 4GACA 3B9AA 2DT3A 2H3BA 3UY8A 4IJBA 5D38A 4M1RA 1UR8A 7CGTA 3VC6A 1J8VA 4QJ5B 5GJNA 3I7SA 1G4EA 4NRRA 4Y9AA 1FHVA 1TV2A 3L23A 3WELA 1NSJA 3ABXA 5A95A 1A4LA 3LCIA 4WR3A 3VUPA 1MFUA 2WVVA 3LRMA 3PB0A 4H4IA 1QOQA 4OHQA 2GVGA 3UJ2A 2NX9A 3EWBX 4NEWA 3UXAA 1V3LA 1ZU8A 4C7GA 5BOOA 3I4EA 2JK2A 3GSMA 4MM1A 9RUBA 4CD8A 3M7WA 2X0YA 4QG6A 1TYTA 3LM3A 3AIWA 4CVUA 2EPMX 5C9UA 3IJ6A 4OWGA 3SN1A 4FK9A 1ESWA 1XANA 4ILSA 4O18A 4S3DA 2DZTA 1B3ZA 5IXEA 1Q8JA 4LALA 4XX6A 2Z26A 3N1AA 3ZJ7A 5G4WA 3WMCA 1GRBA 2XGBA 4O53A 3WBXA 5CGTA 1EJ7L 4HYRA 4A4AA 1L8PA 1RK5A 2OWXA 4L9XA 1H2JA 3ZIZA 2DUAA 3GTXA 1E71M 4HN4A 4UTKA 3KW3A 4IMGA 3DENA 4AXKA 1HVQA 4PTWA 4Q7BA 1IIHA 3CHEA 4XISA 4HD5A 4IIEA 1A5BA 3YPIA 1XLGA 1EDTA 5DBUA 2X8GA 2C14A 2ZC1A 5FEZA 1G6CA 1WZMA 3RK8A 4YYCA 2XPKA 1T99A 2VMFA 4KBXA 3MUY1 1Q66A 1SZEA 3WUBA 5FJRA 3C61A 3DESA 2GQ8A 3TR2A 5I6SA 1AZ2A 1SO6A 4HJFA 1DQXA 5E0KA 3KHDA 4TXEA 5BRPA 1ZCCA 4M52A 1UZ4A 5BOEA 4Y6GA 1B9ZA 2PWFA 4AZ7A 2OEKA 4J2PA 4QE1A 2HNEA 4HHHA 4XZHA 1GOWA 1KD0A 3NYDA 3OLEA 1HKIA 4E2DA 3LTSA 2TODA 3HQNA 4CKQA 4YPJA 2VX6A 5KVIA 3EXSA 2V63A 2VX5A 5RUBA 4ERGA 3C3NA 1EOMA 3S9IA 1V93A 2CEQA 3V1PA 4DYEA 3ARPA 1KBBA 2EBNA 5G2IA 3S47A 2XM1A 2PTZA 1CGYA 3AJXA 3ZR5A 4ADTA 3PBYA 4N2YA 3GDLA 2WCAA 3WL1A 4XZBA 2PBGA 3WEZA 3HGSA 4IIFA 3L4YA 1O4UA 5D2VA 5IHRA 4IJCA 4HYWA 3ZOAA 3AIRA 4AEEA 3DKLA 5LNUA 5HR6A 3EB3A 4PL1A 3RM8A 4K2SA 1ECEA 4C1NB 4UIOA 2NLIA 1QI3A 4Z1BA 5CAKA 4MJMA 3EOEA 2PRMA 2ZUWA 1G4TA 4Q22A 3CQJA 4KCVA 1P6WA 4Z1DA 3ZFHA 3LSBA 5FJTA 5F4XA 4D6JA 5A6KA 1JF6A 5I02A 1QI0A 3KWXA 3IGSA 2X2YA 3THCA 4H8UA 4D8AA 4LIIA 4QXIA 3EDKA 4U4MA 1V3JA 3D3AA 1CEOA 3ABZA 4CU8A 1WA3A 3OJGA 3ISIX 2BBFA 4G56A 1MZHA 1ISVA 1VJSA 3BLEA 3N2CA 4LA1A 3RNDA 4H9UA 1DE5A 3S2NA 2V68A 4J57A 3H2MA 1YE6A 3LENA 4OJYA 4A8IA 3L5AA 2Z6IA 4RDWA 2OEMA 2XFWA 2P8BA 3IANA 3S1VA 4MKNA 2BC0A 4NASA 3W85A 4PBFA 1J18A 3LCLA 2CKSA 4BF7A 2CDUA 5REQB 3O6DA 2F38A 1Q6EA 3LCWA 2Z7KA 4KRZA 3R79A 5FEXA 5BCAA 4XIMA 5FEPA 4ORMA 1LBFA 3GYCA 3AQUA 2G3NA 1AQ0A 4J28A 2QCEA 3NURA 4GC3A 2C19A 4MDOA 1KCKA 2ZC8A 4YIWA 3GH4A 1DV7A 4YWSA 3BLFA 2H6RA 3NPWA 4O1CA 4GBUA 4IUGA 2PA6A 2C7FA 1GZGA 3LDVA 1ZHAA 1H6VA 3VOIA 3ETRB 1E5JA 4QG8A 4RV8A 1FHDA 5I78A 4JNZA 3QFWA 5KETA 1FWTA 4Q8QA 1DTUA 1FFUC 5TIMA 2OJPA 2ZA3A 1D9EA 3EOUA 3R07C 3K8KA 1QHPA 1LRNA 4HMCA 1UWTA 4CVWA 4KPLA 1RH9A 4FALA 2VR2A 2DW7A 1O1ZA 1V7YA 3E0FA 3QR3A 4B3LA 5L6UA 3QV8A 2WKGA 1RV8A 3R8GA 5A8GA 3AXHA 3KOFA 2Y2WA 4FDCB 1PEZA 3QR1A 1R3TA 3TNOA 3CPUA 2XIMA 3H4XA 4YU1A 1CIUA 2BGNE 3EOSA 1OY0A 2CITA 4HA3A 3G1HA 3R6IA 1A3HA 1O6IA 4I6KA 1E15A 5A6BA 3NQEA 2RJHA 4G6CA 2BS9A 4PMDA 4CEXC 3GXMA 1ME8A 1MEHA 3PPGA 5CZTA 5LIXX 4E2OA 4AIBA 2ACRA 1CZ1A 5T91A 4Q8NA 7REQB 4JTFA 1EGZA 2F6XA 3WDIA 1D7YA 3BLIA 4HOXA 4S3GA 3M46A 3LTPA 3R13A 3ZQ9A 2ZX7A 3LPOA 1LL6A 1X6LA 3NS1B 4PMOA 3BAYA 4GJJA 3TAOA 3MP3A 4A3UA 2GSHA 5FMHA 2ZZ6A 4YTRA 4AD4A 4MUZA 4K8EA 4M80A 4AXNA 5FF4A 3PUDA 4GO8A 3T2QA 4MHBA 4OBRA 3VI2A 3C2FA 3VFCA 4LXFA 4B9YA 2YFOA 1YPFA 3UJRA 4NAFA 2FTPA 4HGXA 3TN4A 3W7CA 4YVXA 5C9XA 1WZAA 3VOFA 1PIFA 4O4VA 5T8GA 4ROQA 1RUSA 5JCMA 4HPXA 3VU2A 5DCEA 2V3BA 4X2PA 1CI1A 1FOBA 1M3UA 3CQHA 5AKQA 1A47A 4A8LA 4K1GA 3EX6A 4JICA 1TREA 3GTNA 1EA0A 5SWUA 4GX8A 1VD6A 5U1OA 5TR3A 1CT5A 4Q6XA 2OOGA 4XAGA 1DWAM 4ZOCA 1UH4A 4C6MA 2WXDM 3DG7A 1LDCA 1PKNA 1EXBA 3EX1A 5IOBA 3PANA 2NV9A 3W72A 4XKMA 2VTFA 2ZUMA 3NGJA 1TRDA 5CGMA 2Y7EA 3A13A 3EMCA 3QHOA 3VIIA 2WMIB 1ISXA 2VOMA 2NV2A 5IFTA 2CWXA 1RAKA 1LLOA 3WD2A 4K68A 4RNJA 2CCRA 3WLMA 3IIZA 3VDCA 1GOMA 2HQMA 2YZ5A 3F2BA 1DWHM 3LHVA 4LS2A 3TJXA 1E0TA 3V75A 1D8CA 2GQ3A 1E0XA 1H49A 2PZ0A 3DDMA 3DEQA 3BJTA 2ZVIA 2AGTA 2W62A 2I9UA 3PWAA 4QS5A 3VX1A 3T0DA 1VS1A 1NWTA 3ZT5A 4N9CA 3LEPA 3W71A 4J3XA 4C6OA 1TPUA 4AWEA 3SY5A 5CG7A 2QCLA 1VDVA 2CZEA 3F5KA 2D23A 2WPFA 2WAGA 2F84A 1WYGA 3M47A 5AC4A 4QNWA 1NQKA 1XYFA 2J8TA 1ISYA 2HPIA 3CTTA 5FACA 2WZIA 4QSFA 3R4IA 5D2WA 2ZWYA 3ANUA 3NVTA 3S2CA 1S3TC 2JALA 1UOKA 4QCFA 1J2WA 4PFHA 4XVEA 2TPRA 1TMQA 4JD4A 4PMXA 3LGGA 2NLYA 3NZQA 1EYWA 1PJ9A 3B0XA 1GG0A 3I6RA 3DFHA 2QUTA 3QXBA 4L9YA 4UTUA 3NQ7A 2C79A 1KFBA 1VZWA 4GZ7A 4RDZA 2JF6A 3GXTA 3W1RA 3ONBA 3PZTA 1F8MA 1XICA 3LI0A 3MUXA 3QY8A 4PTNA 3WJYA 3CZGA 3NM1A 3FYYA 3M64A 2POZA 3L66A 3FYPA 3NVYB 1F8WA 1W1A1 4R9XA 2Q8XA 3S0CA 3QPYA 1ML1A 1VBHA 1EJVC 2Z2BA 3UXKA 4AQLA 2BSLA 1WUFA 1EZWA 1ZP4A 4INFA 4KCTA 3CEUA 1JZ5A 3ZLGA 1XXXA 3MVIA 1H2IA 4PA8A 3CT2A 1EUNA 1OD8A 4EMWA 4MF4A 3TP4A 1MXDA 3VILA 1AL7A 4TTGA 1KO0A 1NDWA 4K1WA 1L9WA 4C6DA 2A5HA 1NFGA 1TVPA 2AKZA 4ENLA 3PPCA 4GRSA 5I3FA 4G8TA 3H7RA 3C2OA 1UQZA 2D1ZA 1ZKQA 2XU2A 1QO2A 3CBWA 4QP0A 1XGZA 5DXYA 1WZLA 3AXMA 2WC4A 2DZPA 2W91A 1XUUA 2ADAA 1VQZA 4RJEA 1LYXA 1N55A 3WY1A 3CAVA 1V3IA 3F4WA 1B1YA 3CHFA 1YPXA 4UNKA 3DK9A 1QUMA 1JZ3A 3FGCA 4HBKA 3HW2A 4GUJA 3TW6A 4QNEA 5I3HA 3KBJA 4NZ3A 2NVCA 4EIVA 2D69A 3FJNA 3H26A 3AS2A 4K7YA 1XLHA 2ZRVA 3VTRA 3P3BA 3O9NA 2JE8A 4KGLA 2JKAA 4DAIA 1JUBA 3H12A 1WAUA 3FEQA 4LFYA 1TMLA 4JTKA 2WHLA 2OQLA 1O60A 3PWIA 1Q8AA 1PX8A 2O56A 1XIGA 1KGXA 4BWLA 3S6DA 1MO0A 1V7AA 3T2OA 4DX3A 4UMCA 1H7RA 1BXBA 2ZRUA 5I24A 4QQUA 3L0NA 4HNLA 4LV9A 4RW5A 4KFPA 1V0LA 5AZ1A 5M17A 3U2OA 5HWJA 4H2HA 3KOWA 3MI3A 3L5MA 4V27A 3W87A 5DELA 3TA9A 3SJNA 3GNPA 1K9DA 1DPMA 7PTDA 2RUSA 4LYQA 5M2FX 2Z27A 1E55A 3MUCA 4US5D 3QN3A 4FX9A 4B5NA 4QCEA 2WB5A 1JYXA 3AM9A 1TELA 5EYWA 2IW0A 1PHQA 2CLIA 3GDMA 2XSXA 3KS5A 1DJXA 2A3EA 1LQAA 2O0TA 1A5OC 4R53A 4F0HA 3NQFA 3FSTA 1RM6B 4EXBA 3WSUA 4IQEA 1KGWA 5E93A 3EWZA 1FWFC 4EWJA 4AZHA 4B3KA 2O9RA 3HQ1A 3U7VA 4XSMA 3RGTA 1F73A 4MB4A 1RQBA 3W00A 3W3OA 3W2MA 4GQBA 1HO1A 1W3NA 2DV0A 2ZZ7A 1F3EA 3KCJA 3OO2A 2HK1A 1HKKA 5FJJA 5CPOA 2DSVA 3PSWA 4LBUA 3V5CA 3ZO9A 4U2ZA 1GQNA 4P2VA 1VPQA 4B16A 3OVQA 4PMUA 1TVLA 1W5OA 2QGYA 5M5DA 5TF0A 4XBJA 5IHSA 4FI4A 3O0KA 1WDWA 1XCXA 3SQMA 3TTOA 1QWGA 4WLCA 1Z6KA 2VZUA 3P2VA 2NSXA 3WF3A 4LSBA 1OC5A 4YL2A 1P1XA 1P7TB 3N2MA 2Z00A 3SN4A 1VYPX 3SGZA 5C9ZA 4NHVA 3ZJ8A 2EQDA 1YNQA 1DWGM 5JXQA 1K7XA 1TPFA 4QEHA 1JGMA 5KMYA 2EPOA 3FNDA 4EQRA 3E0IA 1S5NA 2KAUC 4ZFCA 1VFFA 2XFRA 3CL8A 2QKFA 3E38A 1JJKA 4ZFMA 4GY0A 1ADDA 1S5TA 1NF0A 4JQ9A 4AVNA 3TYZA 4IG2A 3KBMA 1JCYA 5GRTA 4GFSA 1AZ1A 4ONVA 4HPGA 4LY4A 3QOKA 3U2ZA 3A9BA 1PAMA 4IPNB 1JZ2A 1NWRA 1J93A 3WQWA 4FZIA 2XIOA 4J4KA 3LOTA 4OVXA 5CC6A 3UYCA 1C7TA 2Z1KA 3T07A 4P7LA 3N12A 4JQ4A 3N11A 1ISZA 2INFA 3PPHA 4YCPA 3CT7A 1B0IA 1KV8A 2AOSA 2ZICA 4G7FA 1Z8AA 2J7BA 2F6UA 1YNYA 1E1EA 1GOQA 2DZAA 3RILA 3UZXA 1RJQA 2X09A 1JR1A 3P7YA 3EANA 4LC6A 1FH8A 4JQAA 4Z0SA 1AH4A 3OGSA 5HQEA 3GD3A 2C3CA 2RDWA 1L6GA 3CEPA 3NFUA 1CXFA 1YADA 4YLWA 1P6BA 4IP7A 4AMCA 2A7PA 3M07A 3WBAA 3WNPA 4TVYA 3UD6A 4GZJA 2Y24A 3DHDA 3WQDA 3ATYA 7ENLA 1WP6A 2SFPA 2YPIA 3BW3A 3HOJA 3FIGA 4LC8A 3A4WA 4BI5A 9XIAA 1NDZA 2G3FA 3S1GA 3R0KA 1RPKA 4JDRA 1A5SA 4FLSA 1JYWA 3T44A 1ICSA 1IF2A 3KRBA 1MNZA 4AFYA 3EKZA 4JTUA 3MB9A 2DZVA 4KF1A 5LIKX 5CXPA 3GU2A 3IGXA 1C8VA 2AAAA 2CESA 3U7BA 5FJIA 2E0PA 1HL8A 2ODOA 3LPFA 4UTWC 2QQ6A 1HIZA 4OFCA 3MZNA 4FNTA 2XIQA 2C0HA 3QR0A 4WGHA 5KVHA 3TTEA 2BXVA 1XRTA 4F0SA 1ICPA 2A7NA 2E8YA 4AVOA 1T8QA 4L64A 2FDSA 3A5VA 4H4XA 1WKDA 3KVKA 1R30A 3SCRA 3G1VA 1GVSA 4IPPA 2BX7A 1KW1A 2D3LA 2NQHA 5GNYA 4RE0A 2W3RA 2J77A 3GTFA 3OYZA 4C6IA 1KKRA 3SRFA 3WYZA 1X7IA 1VRXA 3AYRA 1N82A 4FS9A 4UBPC 1JVNA 4KWUA 3MANA 4J9JA 4ZQMA 2CLEA 3IAPA 4X3ZA 2ZXQA 1EQPA 1E72M 1VRDA 3QC0A 3N04A 3TMQA 2TMDA 3EXTA 4CU7A 4C60A 1TPVA 4FNRA 1K8CA 1UWSA 4NZ1A 3DJJA 1BF2A 2VVSA 1YEYA 1W1B1 3MHUA 2BZNA 1OFRA 5D4YA 1XX1A 1YXDA 3UETA 1SW3A 4TX8A 3Q45A 1GQIA 3CZKA 3GXFA 3UA4A 1XFCA 1V6VA 1VEMA 3ZXWA 2A8XA 3FV9A 4GKTA 4MNLA 4WSKA 1QPQA 1S38A 2J4GA 4YTUA 3DECA 2CETA 1X38A 4NYYA 4QDPA 1OX6A 3QV6A 1H7OA 4IOTA 2QDHA 3NQ8A 4Y8FA 4XKYB 5LYRA 2YX0A 4UFIA 3GTHA 2OO0A 3HO8A 1Q65A 4DZHA 5E09A 1SJCA 2P3ZA 1G67A 1JEHA 4BF5A 3GG8A 4BJHA 4EPEC 3ABSA 3CZ8A 2WC7A 4I5RA 4W87A 3LXCA 2HDJA 1YRRA 3R5EA 1OWQA 3CH0A 2HRWA 1S7MA 4S3JA 2E9MA 3V0SA 4MB5A 4GNJA 3DGBA 4KWWA 2PDCA 4JAWA 1KM6A 4CD6A 1CXHA 1QBBA 4TX6A 2CLHA 4EXAA 1XDJA 1TPEA 2WPBA 4XWUA 1UP3A 4LUTB 3TXVA 1RD5A 2B7OA 2RAGA 2J79A 4NF7A 4DBEA 1UIOA 3S5OA 2E6DA 4AY1A 3EPNA 3SB0A 1XCFA 3GHTA 1F8IA 2YQUA 3G8EA 4QJ4B 3W2UA 3VD9A 3QFAA 1UQYA 4XZ9A 2WPCA 1F76A 1VYSX 5ER0A 2OLSA 3PJWA 1GV4A 3UR8A 4MAZA 2JQXA 3MO4A 4URIA 2CYGA 3LPGA 4J1OA 3G1DA 1QMLA 5DEZA 3C8NA 1O5RA 4RNFA 2Y88A 3P82A 2OMAA 1STZA 1EBGA 1OF8A 2R9RA 4EMIA 1DWIM 1FWGC 4Z08A 4HU8A 1O1HA 2I16A 1GKRA 4V1YA 2YCLB 1OX4B 1R87A 1I0DA 1SFLA 4PRWA 3URNA 1ITCA 3Q94A 4HZ7A 4JKLA 2QVNA 4I5XA 1KCLA 4GINA 1TCMA 2OKTA 2HJPA 1Y8BA 2RDUA 2YDAA 4O0QA 3H7VA 1UMLA 1GQKA 1JZ4A 2CXGA 2PSNA 2CBVA 3R10A 3W23A 3Q58A 1SU5A 1GXFA 1WB0A 2J13A 1OZQA 1Q7ZA 5I3JA 1R9ZA 3EEZA 1SSGA 8RUCA 1B3VA 4YJ5A 4Y90A 2E9LA 3BLPX 1EGMA 5CSSA 3DBPA 1YW1A 3QTGA 4J56A 5FF3A 2YR1A 1N2VA 2TRSA 3EXRA 3A7RA 1XLCA 3WDRA 3PJXA 2ZRXA 3EBVA 2XYLA 2PGEA 4W93A 7ODCA 1VAHA 2PDGA 1MEWA 2G96A 4W88A 1OG6A 4GGBA 3NAVA 3W82A 3GRTA 1OFPA 3GVGA 1YIXA 3NM3A 1QNSA 4Q8OA 3GWQA 3FS2A 5D09A 2XIBA 1Q5MA 3HV9A 3F4NA 4H4SA 1YLVA 1GGOA 3N6QA 2ACUA 5ABFB 1F05A 4L9ZA 1KXTA 1V3HA 4DN1A 4UQ9A 4TIMA 5FL0A 1O5QA 4N4QA 3NWRA 2YLLA 4IISA 1FWRA 1LL4A 3DKJA 4R7JA 2FVKA 2ATMA 2PUZA 2W61A 2WVUA 3PM6A 5I03A 1DNCA 2A21A 1GW9A 3A6OA 3WQEA 2EQ8A 4CUCA 4V15A 1TA3B 5D05A 4AF0A 3S1WA 5K3VA 3WEOA 2V0TA 3NSXA 3R2GA 2CNCA 4KIRA 2WJDA 4LS1A 3M0MA 1FP9A 2F61A 4UZSA 5FKYA 4CNOA 5EBKA 1GWJA 3OVPA 3MHGA 2ISVA 4RLIA 2X1IA 3GUGA 1SQ7A 4RW3A 4F2TA 2CZVA 4GCXA 1H63A 3PFRA 4H83A 3GX9A 2E40A 4Q8VA 4UQEA 1DIDA 2VR5A 5JBDA 1DJYA 1V02E 5E9XA 4JTIA 4N6EA 1KRCC 1GG1A 5J04A 4DF0A 4DUXA 4HQVA 3MW7A 5J8LA 2RJGA 1J9YA 1TYPA 1YDVA 1JCJA 1JNEA 4OE7A 1UZHA 3S8HA 4W5ZA 3CQ0A 1OM0A 1FCBA 5IBXC 1B4KA 1KC7A 2WKJA 3E2RA 1I1WA 1JPKA 2HXUA 2I14A 4E3TA 2QXWA 4EQXA 3W1XA 2GUUA 3Q2DA 3SSJA 1PYMA 1G7VA 4ZXOA 1KM5A 2EQ9A 1RCQA 4JFVA 4IZGA 1PUDA 1W1YA 5G4EA 3V16A 1LQ2A 3E2VA 4IL0A 2CU0A 5JCKA 3VGEA 3TN3A 1OBAA 3MSRA 3ALFA 4HHPA 4PUKA 4O8RA 1ZBKA 2E28A 4K36A 1ZK7A 2ZXBA 3GVRA 3MWAA 1LWIA 3IJIA 5FI8A 3VK5A 7REQA 4DHGA 1JZ6A 1QATA 4O50A 3WQGA 1MW1A 1QNQA 3WK1A 1EFZA 5G1MA 1KXHA 1E6ZA 1Q6GA 1HJUA 4OUIA 4HMDA 1W54A 2E6AA 1PDYA 2PDLA 2W4XA 1W31A 1NFPA 4KQNA 1KBIA 1MXGA 3LCFA 4OV9A 3WLTA 3R43A 2VQTA 3R1ZA 3ZS4A 4KESA 1MMFA 2EPKX 3EDFA 4DYKA 1WPCA 8XIAA 1JNDA 4RCXA 3LSCA 3UR5A 5CPSA 1K77A 3PY2A 4S3EA 1MSSA 2HBVA 4JTDA 3SCTA 1GOOA 4LYRA 1XSIA 1PXGA 4W86A 2NXIA 2HE5A 4C6FA 5HINA 1MVYA 3DHUA 4JYFA 1VQTA 3OU8A 2EG8A 3A4JA 2VP8A 3OOQA 3GYEA 2B31A 3W27A 3UA3A 1XIDA 3A9IA 2LLEA 2DU2A 4J27A 4RZBA 2YJQA 1S2UA 2Z24A 4NT0A 2VEGA 4PRRA 3I65A 1ME7A 2ZRZA 5A6AA 1G01A 4UFMA 3L2MA 1D3GA 1KCZA 3TMLA 2QZRA 1YTEA 2FQIA 5E6ZA 4QROA 4EQSA 1TV3A 3ES8A 2QJJA 5H91A 2BDQA 2VFHA 5DCBA 3VYLA 3MI2A 4ALDA 1ZJAA 1S5MA 1LLWA 2BVWA 5BW6A 1WDRA 3C6CA 3HZ3A 4CNPA 4W7VA 3RPTA 4WY0B 3WLJA 2WSYA 2YB4A 1K4GA 1LG1A 1EF2A 2OG9A 2PWDA 1VPYA 2F6KA 5CAHA 3PNZA 1HKVA 5TD4A 4C7DA 3M5VA 3RRXA 3W2KA 1PSCA 2V5LA 3KTXA 3UWZA 3W7PA 3BCFA 2QUUA 1QK0A 1CLXA 3GRIA 3R0DA 1GESA 5C8BB 4HK6A 1J5SA 5HUOA 1TWSA 4C6PA 1OIFA 4I7VA 3F2CA 2PWEA 4H04A 1Q4WA 3RX3A 4XIAA 4ACZB 3WLNA 3RR1A 1RLDA 1V08A 1XRFA 4L61A 4K7VA 1ZCOA 4MY9A 3S3GA 1R8LA 1TO3A 1ZAJA 1ZXIC 3GTIA 4V1XA 5G5GB 4RDVA 1V03A 2OZ8A 3LX9A 2WBGA 3LG3A 1A3WA 1XLBA 4JCMA 1V8EA 5CH9A 3TWAA 3W75A 3VIKA 3AMLA 3IJ7A 5DRCA 1FQ0A 4I8DA 3U4AA 4Y9PA 4ZTXA 5AHMA 4O4WA 1CB7B 1FY6A 1BRLB 3EDJA 3W1LA 3SECA 2WW5A 1E9YB 4QBXA 3VD7A 1AQHA 5HNUA 3W7HA 4F79A 3H7UA 2OYLA 3UWVA 4FIRA 4C6NA 4HKPA 3OC4A 4LUTA 3H6OA 1BTCA 3AC0A 2YW3A 4LU0A 1DJZA 1FA2A 3FJ6A 1O68A 4PRTA 1Q4NX 3LQLA 4GC4A 3O16A 3TKFA 1BLIA 2AKMA 1JDFA 1X2GA 3P81A 2OR2A 3VINA 1YMYA 4NZFA 1E3ZA 3BLLA 1EPVA 4KFNA 1GZJA 1X1NA 2G5WA 3JZUA 3K1DA 4KH2A 2HISA 5C2GA 4B5VA 4BEUA 3QKEA 1GONA 4Z2GA 3MYOA 2R1NA 4GXMA 3BAIA 3BOFA 3EB4A 4G9PA 3HGJA 4NYUA 3LS9A 2YIHA 3TA6A 1BXNA 4MNJA 1ZX9A 3QLDA 4FOKA 4H4TA 3G22A 3UCQA 2CZFA 4JTHA 3DYMA 2WVTA 2AL2B 1T96A 5JCLA 4BHYA 4DM2A 5ABGA 3BMWA 4JIIX 3NVVB 1UD8A 1JQXA 2Y89A 2EKGA 4JTQA 5GJMA 1BD0A 4B4HA 4IQJA 3C2YA 2Z25A 2VRKA 1Q6QA 3GY1A 4U3AA 1IR2A 3KP1A 3TYBA 3VIOA 3GC2A 2QCHA 3QQ1A 2TYSA 2GOKA 2CHNA 4P61A 4UR9A 3QVQA 4ZENA 5AVHA 1Z42A 1XUZA 2E67A 2JKPA 4B5TA 1E6PA 3EOLA 5G5IA 3CQIA 3GNOA 2QJGA 1BZLA 5A6TC 4H7VA 1F3TA 4AWTA 4B9ZA 5A5WA 4R9OA 2QUVA 3W7OA 3KLKA 3THUA 3W76A 2JFEX 2V6OA 1DKWA 1DXEA 3U57A 1FWIC 4GI9A 3NVZB 2YVJA 4M24A 3LPPA 1MDLA 5T9BG 1OD0A 1CLVA 4MKSA 5DXXA 5A8QA 2A1YA 4G2DA 4H6EA 1LUCB 1VJZA 3QH2A 2R1LA 3G0XA 1HKWA 4H2CA 3WUEA 3CXOA 3AIEA 3CUXA 4UFKA 3FW6A 3BARA 2PB1A 1PE1A 3IWPA 4LX4A 4WKFA 4ZOBA 4JQ3A 2BOGX 4POCA 3BCDA 3TR9A 5JUVA 1B90A 3CC1A 3GZ3A 2Y62A 1H7NA 1BSIA 1US2A 2R14A 3KDNA 4H9ZA 1BVNP 3CZLA 3UZ5A 3AXKA 5FS6A 1AW5A 2CLLA 1HXJA 4I5UA 4NJGA 4Z1AA 1NEYA 2X2GA 3Q37A 1WKEA 4D6FA 5LSMA 2ALRA 2WOIA 2WZTA 3IJDA 3VE9A 1ZJHA 5JVLA 2IUZA 1KBLA 3MWCA 2WMKA 4ML9A