3IJIA

Structure of dipeptide epimerase from bacteroides thetaiotaomicron complexed with l-ala-d-glu; nonproductive substrate binding.
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
336
structure length
336
Chain Sequence
KMTFFPYELKLRHVFTVATYSRTTTPDVQVEIEYEGVTGYGEASMPPYLGETVESVMNFLKKVNLEQFSDPFQLEDILSYVDSLSPKDTAAKAAVDIALHDLVGKLLGAPWYKIWGLNKEKTPSTTFTIGIDTPDVVRAKTKECAGLFNILKVKLGRDNDKEMIETIRSVTDLPIAVDANQGWKDRQYALDMIHWLKEKGIVMIEQPMPKEQLDDIAWVTQQSPLPVFADESLQRLGDVAALKGAFTGINIKLMKCTGMREAWKMVTLAHALGMRVMVGCMTETSCAISAASQFSPAVDFADLDGNLLISNDRFKGVEVVNGKITLNDLPGIGVMKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Muconate cycloisomerase
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Isomerase
total genus 120
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 5.1.1.20: L-Ala-D/L-Glu epimerase.
pdb deposition date 2009-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ijiA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ijiA01
1IYXA 4GISA 3PWIA 1SJBA 2GDQA 1W6TA 2O56A 3OP2A 3UCDA 3ZVHB 2OLAA 3I6TA 1SJDA 2POZA 4E4UA 3SBFA 4E5TA 3H12A 2GGHA 3CAWA 1MDRA 1EC7A 3OZYA 2OZTA 3CB3A 3PK7A 5BOFA 3CXOA 2PS2A 1WUFA 5FJUA 4IP5A 4DXKA 3OW1A 2HXTA 2QGYA 3SN4A 2PSNA 5IDZA 1TZZA 2GGEA 4MGGA 3P93A 1RVKA 3EEZA 3JW7A 2RDXA 7ENLA 2MUCA 3ZVHA 3KUMA 3OPSA 1TE6A 2OZ8A 2OZ3A 3I4KA 5ENLA 2PTXA 2XSXA 4EWJA 2P8BA 1DTNA 4ZA0A 4HCDA 4G7FA 3THUA 3TWBA 3V5FA 3OTRA 3S5SA 3DG7A 4KT2A 3PWGA 3UJSA 2HXUA 3JVAA 3UXKA 1TKKA 3N4EA 1EBHA 3N6JA 2P8CA 4DN1A 3D47A 4IT1A 4E4FA 4X2PA 1XS2A 2PODA 2FYMA 3BSMA 4GIRA 3TW9A 3SJNA 3MZNA 2OG9A 1MDLA 4A35A 3FCPA 4H19A 2AL2B 3PFRA 1SJAA 3DFHA 3VCNA 1WUEA 3UXLA 5J04A 3SQSA 1JPMA 3NFUA 3ES7A 4HNLA 3QKEA 3K1GA 2OKTA 3ENLA 3T6CA 1P48A 1KKRA 2QDDA 4H1ZA 4K2SA 4DYEA 4KWSA 1BKHA 4IZGA 1JDFA 3T8QA 1YEYA 3JZUA 2FKPA 2QDEA 1E9IA 4DWDA 2DW6A 4G8TA 1MRAA 1ECQA 2PU1A 2XH4A 2PCEA 3ZLFA 4K8GA 3RITA 3DDMA 1OEPA 2AL2A 5FJPA 3T4WA 4JN7A 1MUCA 1ONEA 2QJNA 1FHVA 2MNRA 2PP1A 5FJOA 3SN1A 1NU5A 3FV9A 3R25A 3MWCA 3N6HA 5EU9A 3HPFA 2XH0A 3SN0A 2QJJA 3Q4DA 2ZADA 3VDGA 3DEQA 3RR1A 2PTWA 4J1OA 2PP0A 4M6UA 2OO6A 2PGEA 3UCCA 4E6MA 3TJ4A 4A3RA 3H8AA 5FJRA 4GGHA 4JN8A 3MQTA 2DW7A 3Q45A 4GFIA 3R0KA 2OVLA 3TOYA 3TQPA 3ZLHA 2GL5A 4K1WA 3TWAA 4GYPA 3VA8A 3T9PA 3TJIA 4M0XA 4H83A 3DGBA 2PA6A 2XGZA 3BOXA 3DFYA 3RGTA 1EBGA 2PU0A 3H70A 2QVHA 2OFJA 3UJRA 3VC6A 3RRAA 2OX4A 2P0IA 2PTZA 1PDYA 1JCTA 6ENLA 2PTYA 2I5QA 3NXLA 4HCHA 3P0WA 3CT2A 3UJFA 3DESA 4ENLA 3D46A 2OQHA 3H7VA 4GYPC 4GMEA 2HNEA 3CK5A 2QJMA 4Z17A 1KD0A 1KCZA 3DERA 3R0UA 2PPGA 1EC9A 3FVDA 3V3WA 3TTEA 3R10A 3IK4A 4HCLA 3MUCA 3UJEA 1F9CA 4DHGA 3QN3A 2PGWA 3ES8A 1R6WA 5BOEA 4KEMA 3I6EA 2AL1A 3FXGA 1FHUA 3R11A 3EKGA 4YWSA 2P3ZA 3V4BA 1SJCA 1XPYA 4IL0A 3MSYA 4MKSA 2GGIA 3VC5A 4HPNA 3TCSA 4MMWA 3STPA 3NO1A 3IJLA 3UJ2A 1R0MA 1ELSA 2OQYA 4GGBA 2XH7A 1NELA 3DIPA 4F4RA 2GGGA 1PDZA 2AKZA 2OPJA 4E8GA 1KKOA 3FYYA 3GC2A 4DX3A 3B97A 3NZGA 2GSHA 3RO6A 2HZGA 3VCCA 3SSZA 4HN8A 2PMQA 1MNSA 4JHMA 2NQLA 3UGVA 3U9IA 4ROPA 2P88A 1P43A 4Z1YA 3IJIA 4FI4A 3N4FA 3ZVIA 4FP1A 3VFCA 1BQGA 4HNCA 3GO2A 3DG3A 3CYJA 4ZCWA 2PP3A 2XH2A 4HYRA 2ZC8A 3U4FA 4KPLA 5FJTA 3QTPA 1JPDX 3R1ZA 2GGJA 1L8PA 3MKCA 3MY9A 4A6GA 3ZLGA 3QPEA 2CHRA 2ONEA 3RCYA 4IL2A 4H2HA 3GD6A 2QQ6A 3FJ4A 4J3ZA 3IJQA 3QLDA 3OZMA 3GY1A 3V5CA 4IHCA 3S47A 3P3BA 3DG6A 3BJSA 1EC8A 4IP4A 2AKMA
chains in the Genus database with same CATH superfamily
2AGTA 5FD0A 3B0PA 1TMHA 4G7EB 3QRHA 1GW9A 3IIPA 1B0IA 2VM8A 4IPNB 1D3HA 3SBFA 4JNMA 4A05A 8CGTA 3KLKA 2XGIA 3ARXA 3ZS4A 5I3KA 4HZ8A 3EMQA 2PC8A 4MB5A 5IRPA 1W5QA 4JTLA 4I7UA 2XZ9A 3HV8A 2V67A 4ERAA 2DH3A 1IHIA 1O95A 1UWTA 4AD0A 3K46A 1HVQA 3P93A 3NDZA 3STFA 4ZFCA 1ISWA 3CPUA 3CO8A 3FHQA 4CD4A 5A5WA 4AD2A 1WX0A 4YN5A 1TMQA 1RD6A 2XJ7A 3KRSA 2CZ5A 1GV4A 5E93A 1WZAA 3IVSA 3IUHA 3TWBA 5JH1A 4BEUA 1KM6A 1K6AA 4UQ9A 3ANUA 2HXUA 5TF0A 5A3HA 3NPUA 2GQ9A 4XKYA 3N4EA 1EBHA 4P7RA 1GJPA 3A5VA 5I06A 1A49A 1XS2A 4NAEB 2QZRA 4LIIA 2FTYA 1UD8A 5C70A 4PL2A 1GOOA 4AIUA 5KETA 4O16A 4AWUA 4Y9OA 5T9CE 4B3ZA 1TV2A 4BS0A 1FBAA 2ZOXA 4JIRA 4P8VA 1X8CA 4A3QA 1PHQA 3QV8A 4ZO6A 1LT7A 3PFRA 4EF8A 2WNQA 4Z1AA 3W00A 3I3EA 4GBDA 1F7BA 1RJRA 4FR1A 3MP4A 1MSSA 2YYTA 7REQB 3C52A 3F1QA 3OVGA 4XZLX 2YW4A 2BLEA 2D1ZA 1J01A 4TU1A 3GXNA 3VO0A 1BKHA 3W38A 1XKYA 1V02A 4HU3A 4MWAE 5KVIA 4TXEA 3SM0A 1X2GA 3F2DA 1HVXA 1FRBA 3VK5A 1CXLA 4JTUA 2FJUB 3RITA 2NSOA 1ZZMA 2PWEA 4H4UA 3CTLA 1OZQA 3BAWA 1TPVA 1QJWA 4DRSA 2EQ8A 3ISIX 5AVNA 4H4YA 2CKSA 4LV4A 5DY2A 1LRTA 8A3HA 5FIPA 4Z0SA 3RX3A 5FOOA 1R3TA 1RAKA 4HA3A 1XRVA 1KFLA 3R6IA 4AWTA 1AH4A 4K38A 2ZZ5A 4TMCA 1NM9A 3TLQA 1V6UA 1U2YA 2ZXAA 5CPMA 4AXKA 2PDMA 3RILA 4R7JA 4K7VA 1J4EA 5FJRA 2R82A 4GGHA 1UZDA 5B7ZA 1C8VA 1FQ0A 3UZWA 3G0UA 3KDOA 4JTDA 4N4PA 4A3HA 1VFUA 2FGBA 3HIJA 3TOYA 5AC5A 1OGBA 3BLFA 4U28A 3S0CA 5FMHA 3UZ5A 5BWFA 1BSIA 3EBVA 5U4NA 3W26A 4BK9A 1B31A 3A13A 2I9EA 3BLEA 4XIAA 3L4ZA 4RV3A 2G3IA 4KEZA 1BEUA 3WDHA 1GQKA 1YW1A 1KBLA 1YXYA 3ZT7A 1XIMA 2NVKX 4XV0A 2ZUVA 1ZS2A 3NQ2A 1A0DA 1PKMA 2GVYA 3T2PA 3VD3A 4ATDA 1ZTVA 1HQTA 3EX1A 3E0LA 1G4TA 4F2UA 3AISA 1BWKA 3EGJA 3IJ6A 1JYWA 1CWYA 2CERA 2F9RA 4KBXA 3GFXA 1W8GA 3AICA 3VINA 3BUVA 3VKDA 5CJMA 1XLEA 1RY8A 4I6KA 4KQNA 3W2NA 4RDWA 1XDLA 2HPIA 2J7EA 4GMEA 4WGXA 4MNLA 3RU6A 4P5UA 4K3ZA 4AZBA 4KWOA 4TX9A 3AALA 4QNEA 4R7WA 4R5EA 4OIFA 3ZXWA 3AC0A 4W85A 2O0TA 2BC1A 4JEQA 2Y62A 1MI3A 2YBUA 2IS7A 2Y5JA 1NP2A 3IEBA 3AYVA 1ZPTA 4L1GA 1NHQA 4JAWA 4DXVA 3V0TA 1E43A 4WY0F 4HU0A 3R11A 4B5UA 4UTMA 3V4BA 1PZ2A 2DZWA 4UQBA 3LRKA 3BLPX 4GC4A 3TTYA 2YCIX 4A8IA 4ZMGA 5DRCA 1OY0A 4MMWA 4PUDA 4ATWA 1DBTA 4Q8QA 3UJ2A 1FO4A 3VE7A 3E74A 2BGNE 2XH7A 1NELA 3DIPA 4AZGA 4C6OA 1FWCC 5DMMA 3DGRA 5CSYA 2F5ZA 3CL7A 4QDWA 1ZHAA 4QEEA 3W7QA 3SCUA 1MUMA 2Y61A 1RQEA 3VDAA 4IGNA 4U2YA 4CUCA 1NWTA 4B3LA 2Y24A 3VXGA 3OBKA 3N2XA 3DGHA 5I3FA 4DZ5A 2W63A 1UZHA 3UVAA 4PTXA 5C54A 3O0FA 3CWHA 4NIRA 3QQ0A 3PNUA 4EMJA 1W1ZA 4JS3A 4NQ1A 2V2DA 2NQJA 2WSPA 1XX1A 1G67A 2RKXA 1RLDA 3Q67A 3GXFA 2VFDA 1EL3A 1JDEA 2X16A 2ZE0A 2R1LA 1VFTA 3R1ZA 4J3VA 1FWDC 2GOUA 2PI6A 5CLTA 4NAFA 2B31A 1F76A 2NX1A 2QQ6A 3BLKA 1XYLA 1C90A 4NXSA 1JPHA 1M7OA 2DIKA 3TFXA 1UUMA 1S5WA 3AMZA 4AD5A 1XLGA 5HMEA 4DNAA 1C93A 3LRLA 4GY0A 4XX6A 2J88A 2F2KA 3V5CA 2KAUC 4FLOA 1PYMA 2XIIA 4LEFA 4H9VA 3CHDA 2YCKX 2DU2A 4BKNA 3WL0A 2WMGA 3OEXA 4ZQOA 3OO2A 1VRDA 1SJDA 1ISVA 3ABZA 1VIWA 2Z4GA 1E9YB 1QRQA 3WQFA 3L8KA 5GQBA 1Z69A 3LM3A 2XTKA 2J75A 1NEYA 3NQ6A 4IGSA 4LUIA 2UBPC 3GH5A 3V16A 2FB3A 3KBNA 4D6CA 2Z1XA 2Z28A 5AC8A 1P0NA 3SN4A 1JJKA 3GKFA 3W7RA 1G4EA 4LS2A 1ADOA 1B3XA 4MIMA 2RDXA 4QG6A 2TPRA 4IPJA 1B3YA 4FNQA 1WDPA 4QE1A 4G2DA 2PTXA 1CDGA 1DTNA 2DZPA 2Y8VA 1R46A 3H53A 1H1ZA 3NQFA 3VGHA 1RLCL 3S5SA 3REQA 3R58A 5LIWX 1Q7MA 4UOZA 1T0OA 4BI6A 1LM1A 4ZB2A 2CITA 3ATYA 4DLFA 4EVZA 1OGSA 2P1FA 4UNIA 1JGIA 1A5CA 1QOPA 4W84A 3EWWA 4LB4A 1GJWA 4IMGA 1UC4A 3IJ7A 5XIAA 3HG4A 3W1MA 1CXIA 1KN0A 2NPXA 1PSCA 1W54A 4NZJA 3AZRA 1DNCA 4Z1DA 4UCFA 3BG5A 2F6XA 5ABFA 3VDBA 3ME3A 4B4HA 5KZEA 3CAVA 4IOTA 4PE8A 1XSKA 4XUGA 4D6HA 1H09A 3I3DA 3GYEA 4OWGA 5CXPA 1YXDA 3P74A 3SQSA 4MYAA 1YPXA 1XGZA 1GGOA 4YYCA 2PDUA 2PTDA 3SUUA 1V0LA 3UW6A 1XYCA 3IANA 4W88A 4H9ZA 2IMRA 1KM1A 1PZ1A 3KHJA 3JZUA 1LP6A 1TCDA 2FKPA 5D02A 1JZ3A 2DT0A 4JFWA 5F4SA 3IRDA 4RDYA 2OZ0A 4AZ6A 2OGYA 4AMCA 4DWSC 1DTUA 3VIMA 2VURA 1DOSA 1XQLA 2REQA 3UNDA 3BLOA 4ORMA 3BTNA 2D73A 1VYSX 1DHPA 1K3UA 4O1AA 4TVCA 5I6SA 2YCLA 2ESCA 4UMAA 3RR1A 4JNZA 3EWXA 1UASA 3SAZA 3NSXA 4QJ5B 4L4OA 3TJ4A 4MPKA 1FA2A 4MSSA 3EDDA 1GVIA 3C2EA 1IWAA 1K8XA 2DZAA 3W72A 4EP8C 3WQ6A 1XCFA 3WLMA 1Q7QA 5GPRA 1H7NA 1CT5A 1UR3M 4RJEA 5TAOA 4UTWC 1T8QA 4PMUA 2PA6A 3SR6B 1JFHA 1OYCA 4JTGA 5BZAA 1EH9A 3OZPA 5C6MA 2J4GA 1N2VA 3JZEA 2YYUA 3KVKA 5D09A 1W5PA 3ITYA 4HCHA 4XIMA 2PDXA 2HE5A 4JICA 3KX6A 3R8GA 1UB3A 4QX4A 2VOTA 5K4ZA 1Q1RA 1JDCA 5LNRA 2DZUA 4CN1A 5CBJA 1SFJA 4PMOA 4Y8EA 5I2UA 3DXIA 1OCJA 2P0OA 4K6AA 2Y88A 4XD4A 3ELFA 2ZWZA 2OMAA 4YPJA 4JTEA 4NRRA 3ARVA 1VHNA 3CGEA 1BG4A 4AZHA 3MUCA 1WDSA 3ZR4A 4D8ZA 1BSLA 3MPGA 1TIWA 3BARA 4QG8A 3C6CA 1TV5A 3NQDA 4ILSA 4PBGA 1ZGDA 3QMSA 3GDBA 5G2IA 1LWJA 2G37A 2OOGA 4KFNA 2OWXA 3SSJA 2EQ6A 2D2JA 3OC4A 3LB8A 1G5AA 1V6XA 1DJIA 3IJ9A 4D6EA 4K1GA 3PZMA 4HHPA 1CEOA 1J0ZA 1ML1A 2WVVB 2QAPA 3URHA 3RLHA 3POCA 2PWDA 3LV5A 3BQ5A 4F4RA 1H11A 3QJAA 5D37A 2PF8A 5FS7A 4WSJA 3KOYA 3N2BA 3AS2A 3NQAA 3M5XA 1ZSXA 3PTKA 4AVOA 4HPXA 3T40A 4LW7A 1WYGA 2E3TA 3AM9A 3QZAA 3UWUA 1R9YA 3U9IA 3H2CA 2VZSA 3V0SA 4FEZA 3CAQA 3WNOA 1R2SA 3GC5A 3M0YA 2DZXA 3C4UA 2V82A 4CCCA 3N9RA 2BV9A 4FB7A 3KHDA 3NDYA 3CYJA 4GC3A 1BWLA 1JDDA 5KZDA 3M0IA 3U4FA 4FLSA 4Q4SA 4QDMA 1MMFA 3ITVA 2ACQA 3HJZA 3T05A 4LUSB 3W07A 3TK7A 3P5ZA 5G5HB 1TQXA 2CHRA 1HG3A 4C60A 4X22A 2VDHA 4K36A 4F48A 2ABAA 2HMCA 3QQWA 5F2IA 1IEQA 1V79A 4DBWA 1KBKA 3BW3A 4QITA 4S3AA 4M7SA 4URIA 1I0BA 1XC4A 4E2OA 2R9ZA 4Q8UA 3HMJG 4QIUA 4GKTA 1PX3A 4DPPA 3N6QA 1PKYA 4HTYA 3WK2A 3T2OA 4H4QA 1F73A 1TFVA 3UPWA 1VFHA 1NSJA 3DJJA 4IH3A 4XVDA 3EB2A 2PGRA 1W6TA 2C1GA 1V7AA 1Q1WA 1C29A 2A7PA 3HA1A 3ZVHB 5FESA 1XYZA 2DSWA 2Z25A 2WKJA 3B04A 3TC3A 2CZDA 4L4MA 2XVLA 4AB4A 1QDSA 2YSWA 2HDJA 2E6AA 1YTDA 5L9FA 1WUFA 3ZZ1A 3UXAA 1KB3A 1Z32X 2QJIA 2BOEX 3P61A 3USBA 4DLMA 3JW7A 5AHFA 1F2JA 4LVFA 3CTTA 4YJ5A 1AFSA 1VD6A 5ABHA 1W17A 3PUEA 3WQVA 4G7EA 3AXIA 4NU7A 5DY3A 1MFVA 4TVWA 4ZO9A 3SY1A 3WLJA 2OYKA 1K9DA 1TZ7A 4UUIA 4LFYA 4Q8OA 1V59A 4C7GA 4F0SA 4UTUA 2WQDA 2WO5A 1RBOB 3MHFA 3W01A 2ICSA 3L21A 3PWGA 4Q4KA 4IIEA 1W56A 2E09A 3SQLA 3JVAA 3SRDA 1JPIA 3FAXA 1DWAM 1CGXA 4MB3A 3M47A 3PBUA 3BG9A 3LMZA 3VKCA 4J5NA 4E4FA 5B80A 3NVDA 2VDGA 2WMHA 4ADUA 4US6A 5AC7A 1F4HA 1OIFA 3DKLA 3G22A 1R9ZA 2VC6A 3EPMA 3AO0A 3TIMA 5FS8A 3RCNA 4HYVA 1O66A 3VCNA 2B4GA 4U2ZA 5EMUA 4AVFA 3G8EA 3NFUA 2W0HA 2G3NA 2XWEA 1LG2A 3GVRA 1DJGA 4JDBA 4JTKA 4L6HA 2Y7GA 2FTWA 3A4WA 4JQ1A 4ATLA 3KOXA 3M6DA 1KKRA 2V6AA 5IFPA 1OBAA 4H4SA 2Q71A 3PHAA 2OLHA 5BXTA 3OB8A 4LVGA 3W7MA 4AWSA 3T8QA 4DBDA 3UERA 1E9IA 2WZTA 1UR2A 4X60A 3A47A 2HBXA 4KF1A 4IX2A 3RLGA 1GZJA 4MLRA 5BRPA 4L9ZA 4H4ZA 1PEZA 3OHIA 4WLCA 1Q6CA 2PZNA 1RM6B 4QM1A 4S3DA 1N82A 4XG1A 7REQA 4AUBA 1SMAA 1W1YA 3ITGA 3K13A 1IEVA 1AJ0A 3ETRB 4IMAA 4H6KA 3EA1A 1AG1O 3CZ8A 1I9CB 2WMFA 3TTSA 4QAWA 3VILA 5I78A 4KH2A 5IOBA 5K9CA 3QV6A 4E6MA 3T4CA 2WCAA 4ZSTA 2J9XA 1UH3A 2J78A 3GXTA 4JIPA 2NWRA 5AHMA 1JZ6A 3MQTA 2ZDSA 3M7WA 1W9UA 1XYMA 2ALRA 3R8HA 4BCEA 2GJRA 4IMFA 3N9KA 1RA0A 4DELA 1QMLA 1PIIA 3RCMA 5DBUA 3HV9A 3VZYA 4M8UA 2VR5A 1QU4A 2VUNA 5LIXX 2CLFA 3LNPA 4AHPA 4O1EA 1AW1A 2XGZA 4XZIA 3RFAA 2QVHA 5AHEA 3WX7A 1PTAA 1QI2A 3WY1A 3DN5A 2HROA 4HPGA 1U22A 2JQXA 1CGTA 3SCRA 4IPIA 1K70A 2W3RA 2ZX6A 2WHJA 3LXBA 2E6FA 3WH8A 5CCZA 1HKKA 3RRXA 4OOUA 5HBFA 4DZAA 1V3HA 3H55A 3TVAA 2PWGA 1TYPA 3MS8A 2BXZA 3HBLA 1ZBCA 4LYKA 5EB8A 2R91A 4CCDA 3CAKA 1IWBA 1MFUA 2WJEA 4M82A 4BF9A 4CNNA 4C5YA 1W1B1 1BGAA 4BWLC 1FP8A 1U1JA 4W87A 1XIBA 3THCA 3VNLA 2C1IA 3L2MA 1U33A 2VZTA 4UMBA 1WOAA 4GQQA 1GOMA 5JRBA 5GJMA 1QWGA 4QJ4B 2DUZA 4HSNA 2L5HA 4BA0A 3RXZA 4J57A 1MEIA 5U1OA 3GNXA 1U1UA 1CB7B 3YPIA 4CLMA 3GVQA 1W9BM 4PN2A 3RO8A 3E02A 5FEZA 2WKGA 2FGLA 2V38A 3F4CA 2BP1A 4RZ6A 5HPOA 4JBRA 2NUXA 4I7WA 5C7HA 1W2VA 2NLIA 5LKYA 4H4IA 1V93A 5IFTA 1C3FA 2EJ1A 1VKFA 4O1BA 2PUZA 1X39A 4DO7A 4MWAB 2QMJA 1TCMA 1WPCA 4S1FA 4KPLA 4O50A 5LSMA 1PYFA 1KRMA 3I68A 3LTSA 2BSLA 4UR9A 1R9XA 3QV9A 2QCNA 1E0WA 1DXEA 1TV8A 3KL0A 2WMJA 1QPOA 2RAGA 2FZMA 1FP9A 4E38A 3MA8A 4ZTYA 4B16A 1JI1A 3QYQA 4FNRA 2CBIA 1MZRA 2RDUA 4E2BA 1V03A 3TEVA 4IGHA 4QTGA 1C92A 2VRKA 4PCPA 3CB8A 1OYAA 2OLAA 4ML4A 3VZZA 3M0JA 1CBGA 4UTKA 3AIWA 4IX0A 3A22A 1Z44A 2V0TA 2WOQA 4ACZB 4NP7A 1JUBA 1MDRA 4AVNA 1DJNA 2OZTA 3AXHA 2AAAA 2C3ZA 1J79A 1Z8AA 3G8RA 3ARPA 3QR0A 4AEEA 4JKKA 2PLJA 1Z89A 1C7TA 2E8ZA 1UJQA 1YLVA 4MGGA 4N42A 2H3DA 3LQLA 3UYIA 1H7WA 2ZX9A 1VEMA 4NZCA 1HKIA 3IAPA 5ENLA 5KVHA 4QS5A 3WKZA 3WLOA 1YBQA 3EOEA 3R12A 4PEEA 1HUVA 2IQ0A 3CUZA 5HNTA 3EX3A 3ALFA 2E4TA 3IGSA 1O5XA 3THUA 2VVSA 3TU9A 1N62C 1GEHA 3T44A 1Y0EA 1W37A 4AYSA 2RJGA 3KVJA 4JX5A 1O1ZA 3EOSA 1PUDA 2VFHA 4WUIA 2ASHA 4HYWA 4UFIA 2VI0A 1JEHA 3WFLA 3OQEA 4LA1A 1B30A 2OCZA 4HNVA 1CYGA 4Q8TA 2NLYA 5HUOA 3E5PA 5RUBA 1JCLA 1WXYA 2ZWYA 3MBDA 4GIRA 4HOWA 1VS1A 2CLPA 2W79A 3G18A 1JD9A 3TNOA 2VR2A 4DQWA 1A5MC 1S5MA 1OX5A 1TZ9A 1MDLA 3U8GA 3SUTA 4LC8A 4H19A 3M5ZA 2AL2B 3O9NA 4W89A 3TAOA 1Q2RA 3RPMA 2E5BA 4MTVA 1ADDA 2R24A 3WDJA 3A64A 4LUTA 4AX7A 1VZWA 3PUGA 4W8BA 1E6RA 1EJ7L 3EDJA 2CLHA 3NQGA 1VAHA 3AYTA 2HQMA 4LB3A 3PBYA 5E0FA 1ZALA 3ENLA 4KEVA 2Z7GA 2GUUA 4K2SA 1UP2A 3IGXA 3WD3A 4FAMA 3U7VA 4DYJA 3AHVA 4ZEPA 3ITLA 4RZBA 1WKDA 2E40A 1TR1A 1XP3A 2PU1A 5FS9A 1VJSA 4IIHA 2GWGA 1NDVA 4I9AA 3DDMA 3TN5A 4J40A 5LIKX 4LNYA 1MXDA 3EWUA 2YW3A 3CGBA 2MNRA 3DCPA 1XLFA 5H6HA 1RY0A 3FV9A 1V0KA 4GZ7A 1LYXA 2RDWA 1JYVA 1O12A 4LX4A 4JFVA 1US3A 4UB9A 1X38A 3WFZA 3TMLA 1S5VA 1QPRA 3WNNA 3MP3A 3KVLA 3HFTA 3PF3A 1W5NA 3AZSA 1J10A 3NNTA 1XFBA 1IXOA 3W70A 5M5DA 4GFIA 1ODUA 4J56A 4Z1BA 4HPHA 4UR8A 4JTJA 3L4UA 4GNKB 4JQ9A 4GJ1A 1JXJA 3VD7A 2X1UA 4LAMA 3T9PA 2O9PA 3SURA 2FMOA 1W9XA 4RE4A 3G3MA 1HN1A 1ZUAX 4KETA 3SB0A 5G5IA 3H4KA 1ZCOA 3BGGA 3W87A 4E3VA 1EDQA 2OFJA 4PUJA 3UZYA 1B3OA 3VC6A 3CL6A 4CD7A 2BZNA 2TPSA 2XN1A 3BL3A 2JGYA 3BJFA 2P0IA 4JYEA 4WDTA 3O0KA 2VRJA 1C9DA 4PUMA 4NI8A 1ONXA 1VH7A 4LGXA 1UJPA 4TMBA 1TG7A 2GZXA 4GI9A 2QDHA 2X30A 3HPZA 3UJFA 3DESA 4BJHA 1AODA 2CWXA 4QJ3B 3NL5A 2Q01A 5KTLA 4CD8A 5TQLA 5F4XA 1TTIA 3NQCA 4GZIA 3I4EA 3W02A 4M1RA 4GRSA 5D9OA 3VAVA 2EQ7A 2XM1A 2PPGA 1V08A 3L4WA 4ADWA 1HIZA 2Q3OA 4N2YA 1ZBKA 4Q6XA 4CNUA 4MAVA 1W3TA 1K4HA 4JKLA 1MEHA 1VCFA 3LRMA 2X8CA 2IPGA 3KOWA 3T0AA 1VBHA 4OV4A 4KEMA 2IPJA 1X6NA 1IT0A 1POKA 5CZJA 1S2VA 1H6VA 4XBSA 1WDWA 3C0LA 4IP7A 1JZ4A 4PUEA 2DIJA 2INFA 4UFLA 4Q4PA 4MJ2A 1UW9A 1GQNA 1GOWA 1M9HA 5FAGA 1H7RA 2OTDA 1EIXA 3DKJA 1P0KA 4QXIA 1MYRA 1PDZA 1JVNA 3PJXA 4K68A 1W3JA 1EO5A 5AYIA 4K8EA 2QF7A 3APTA 1Q6QA 2W61A 4ORIA 3TQVA 4GABA 1XLLA 2PBGA 3TCEA 3WNMA 3ZO9A 5C0QA 3PBMA 1ZY9A 4R33A 2FH8A 5EYWA 3WELA 4EQRA 2V3EA 4C5ZA 2E5CA 2PLMA 3RK8A 5H2ZA 4JL1A 2VFIA 2ZA3A 1FWAC 3U7BA 1HKWA 5A1AA 3T0BA 1Q8AA 1IF2A 5LGZA 1X97A 2AQVA 4Z2IA 1E1EA 2NXHA 2X09A 1CCWB 4S2CA 4R3UA 3ZFHA 1JRBA 4CCEA 5FJTA 1MUWA 5A6KA 1GJUA 1V3KA 4NXKA 4GE8A 2WLYA 2GGJA 5EMMA 3MKCA 1FWGC 1JF6A 3CMFA 1US2A 3G6LA 1UKTA 5DFAA 1NWUA 3IJQA 3KBJA 1D2KA 2BY2A 4O1CA 2VWTA 1DJYA 1X6LA 2XZ7A 1X1OA 2A1YA 5B7YA 4AMAA 1M3UA 1VENA 1BXNA 1YE4A 3H24A 3WJXA 1SVDA 4ROQA 3O8AA 1IT8A 1FDYA 5K3VA 3PWIA 4WKAA 3SZ8A 1ZJHA 3LHYA 3OP2A 3GVGA 5FF2A 4NUWA 2C1HA 1TO3A 3G1AA 1FWBC 1KFKA 2VTFA 2WCGA 3MI2A 1LORA 1Z6KA 4A2RA 2WLZA 2QPSA 4IGMA 1F5ZA 3CM4A 3PK7A 2DZSA 3WD2A 2XM2A 5SWUA 4PYSA 2ZX5A 5FF4A 2GR1A 3EA2A 3SY5A 3LBCA 4LYRA 1J8VA 3S4TA 2GGEA 1KGXA 3A9IA 1VIZA 1V77A 2GJPA 3ZVHA 4AXNA 2QGHA 2EHHA 4JTRA 2F6UA 3R79A 3VGBA 4EMIA 1XIFA 4JQ2A 4EWJA 3CXBA 3AIBA 1RXOB 4FALA 3TKFA 3RYSA 4LUYA 4NI3A 3GR4A 1RALA 3VVGA 2PDBA 1GOKA 3QFAA 1C91A 1GYNA 1SR9A 3FDGA 4M19A 4NJHA 4C6MA 4DI9A 3LTPA 3PS7A 3WF4A 4Z1CA 1XDJA 2OU4A 2RH9A 5JCNA 5CPTA 4DWSD 3GHUA 4NKCA 4JD4A 5JVLA 4JTTA 3LBOA 2DP3A 5I09A 2ACUA 1EF2A 4O8RA 2PWVA 4M80A 1HP4A 1ONWA 3DOPA 3BGJA 4X0NA 4PCFA 1W3NA 1WDQA 4OECA 3AUJA 4LBSA 4HNLA 3W6MA 2YA2A 4F9JA 1EP1A 2GYIA 1DE5A 2PF0A 5H8PA 4QROA 1XISA 3DX5A 5M03A 3GQYA 2X0SA 2AAQA 1JDFA 3UWZA 4CVUA 3WJYA 3MCMA 2WANA 3O3RA 1W2PA 2V69A 3WK3A 1BVWA 4CNOA 2IPWA 3FKKA 3ICJA 3HQPA 3NXFA 4GVFA 1IXNA 3UPBA 1BYBA 4B5WA 1JZ8A 3W7HA 4J3TA 4WKFA 1GWJA 2A3CA 4W9TA 3WQWA 3LZ5A 3N6HA 3OG3A 3G24A 5FEWA 1VCVA 4L9XA 3S1GA 2ZTKA 1HGYA 3O07A 3WUEA 2V68A 3ECQA 3Q4DA 2YL8A 1SFLA 3BGAA 3H7RA 2PE4A 1FEAA 2BB0A 4UOQA 2PB1A 4GVIA 4DAFA 3UR2A 5I00A 2XSBA 3ID7A 2CLLA 3W7JA 1VYRA 1DKWA 4DM2A 4U3AA 4AG0A 1P7TA 4ASTA 5K4XA 5DT5A 2O9RA 4GYPA 1RBLA 2ZYFA 2BFGA 3QY6A 2P3EA 3AIQA 4GIEA 3PULA 3WENA 3TJIA 2EKCA 2PEVA 1SW3A 3DK9A 4IJRA 4QRNA 5EL1A 3PG8A 4NZ4A 2YDSA 3EWCA 3H70A 2CXGA 2E6DA 1TVPA 3QW4B 3RG6A 1EGZA 4IMDA 1UC5A 1UH2A 2OSXA 2ZCGA 3IRSA 1EDTA 4DWSA 3VCRA 5HQLA 1PDYA 2Z00A 3H2AA 4G5DA 1S38A 3M7SA 2YB4A 1RSCA 5JH2A 4C6NA 3OVRA 3VU2A 4MY8A 5CPSA 3VOFA 1UKSA 4DBUA 5JUVA 2WAGA 2ZKMX 3M44A 4ENLA 3H2NA 4JZ5A 3AS0A 2V5KA 3AS3A 2OQHA 3CQJA 3PZUA 3NOEA 1XLKA 4BQ3A 1OFDA 2CLOA 5I5RA 1P0BA 2CWNA 1UIPA 1S46A 4J3UA 3B40A 1XLMA 4XO6A 3WBXA 3AMDA 3MO7A 4MWAD 2OR2A 1PAMA 3CUXA 3IK4A 3KP0A 3U6WA 4QJ1A 5AC4A 2WP6A 1JRPA 2AGKA 3KS5A 5A2BA 4JIQA 3LTYA 2E9MA 3WLTA 4DJFC 3SGZA 4FLQA 1L6FA 1CECA 1JAKA 1UP0A 3Q65A 3SRKA 3LV6A 4MFEA 1WB0A 3R8RA 3XINA 2DVTA 3OA3A 3W2MA 1UWRA 3NCOA 2ZVIA 4YHEA 4JN6A 4D8AA 1L9WA 2VC7A 3TXZA 3AIVA 3TYCA 4OGZA 3ARUA 2Y85A 2XFRA 1JQXA 4BFAA 2ZUNA 2WM0A 2DPEA 3H23A 4INFA 4XD3A 3ZJ7A 3THQA 1SMDA 4DX3A 1BZLA 4UQDA 3RO6A 2I57A 3HB9A 1CZ1A 4GYJA 1TV3A 4X0VA 2DSUA 1I2NA 4YCPA 1VC4A 1GVRA 3T8LA 3W4RA 2XN2A 2H90A 4E2VA 4DUXA 4NX0A 4RKAA 2FHFA 2QCEA 3E96A 1O4UA 1PPIA 4FP1A 5DCEA 3F7JA 3V18A 3GO2A 1BXBA 3B9OA 4UXDA 1KBBA 4HMDA 4GG9A 1Z9AA 1W91A 1L0PA 3SR7A 1DJZA 3MY9A 4DY1A 4C91A 5FJJA 3UWVA 4LOCA 1R8LA 1UD3A 1UUQA 2I17A 2CKRA 4LYPA 4U10A 3TONA 5JQ9A 3ABQA 4KWWA 3KBMA 5DLCA 4IHCA 4FX7A 3ZYZA 1OD0A 4Q8WA 5I3GA 4MWAA 4FX9A 4IQDA 1SW7A 3UR5A 5KITA 3PJTA 1P1XA 2O55A 4E4UA 3C0JA 4AU0A 3F5LA 3ERPA 1FWWA 3UQNA 2Y70A 3CB3A 4NZFA 3V75A 2PS2A 4BF5A 3FGCA 2V2HA 3C2OA 3RNMA 3IIZA 3OVPA 5HAOA 3A12A 3DGZA 3N9SA 2BX7A 5AHIA 3VDHA 1MRQA 2X05A 4HZMA 3L5OA 4GIYA 3VIPA 4ZQPA 4RPQA 1FWSA 1KA9F 3PPCA 5C9ZA 4ACZA 3F5KA 5JBEA 1G0CA 3A9BA 1FCUA 3T07A 1OADA 4LVDA 3APGA 3TUUA 2QF8A 1ZRQA 1RD5A 2G96A 3QEZA 2PDQA 2Q8ZA 1D3GA 4UTFA 3HF3A 3V5FA 1QUMA 3OTRA 3B9DA 3W7IA 2B0MA 1KTBA 4C6BA 2A8XA 3VIOA 1ICQA 1Q8JA 3LHVA 3NYZA 4CNSA 4IIBA 1CENA 3S2CA 4HOZA 1GTHA 3CV2A 1GW1A 1DXFA 5FEPA 4OU1A 1K02A 1KCKA 4WVXA 2BY1A 1K8CA 2Z1BA 1QOQA 1FEBA 2GK1B 5A8NA 4JGDA 1WP6A 1XGDA 2PURA 1AD1A 1GK8A 4XKMA 1M53A 1EJSC 1HGWA 2VO5A 4DJDC 1JYXA 4IF2A 1U5VA 1L6SA 3WD1A 5EBKA 1OFAA 4G6CA 3BW4A 1HP5A 3KE0A 2PRHA 2DDXA 4W93A 4A21A 3TA6A 2WV8A 1AOGA 5AYXA 1K03A 1DQUA 2J8GA 2BXVA 2PDYA 3IWPA 4PTNA 4XBJA 2D3LA 1RR2A 4LAUA 2FVMA 1BFNA 1W31A 4YIWA 2JEQA 4JFTA 4XZ9A 2PDWA 3GU1A 5EMJA 3O05A 1QNOA 4C1NB 1V6VA 2BDQA 5A8QA 1SU5A 1R3YA 5FF7A 2AL2A 4F0KA 1J18A 1PJ9A 3PZOA 4ADSA 1VDVA 1EJWC 3MJMA 3QHMA 3H22A 2ACSA 3RUBL 5I3IA 1DWFM 1AQFA 1ZX9A 3AJ7A 4MZ1A 2FDMA 2QCGA 1XXXA 3WQOA 1I75A 3G1HA 3WQGA 4FDCB 1K9EA 4E2DA 2WVUA 1G7UA 2PTWA 2W62A 3QZEA 1A4MA 2GJLA 1I1XA 5A6TC 4R9XA 5AC6A 3VOIA 4A3RA 4EPBC 3LLXA 3GXIA 2OB3A 2DW7A 1EPXA 4O4VA 3CL8A 1S7MA 3A3WA 1KCXA 2VC9A 1V97A 4O18A 1JUKA 2JIEA 3DFQA 2HE8A 3A7UA 3LPPA 2YPIA 3UGRA 3M64A 3EEGA 1J9YA 3O6DA 3W53A 4H4RA 5BNKA 3CU2A 5EFDA 1A0CA 4QFUA 5AHNA 1FFUC 2ZRZA 4ZR8A 3PN8A 3BURA 4DM1A 4Z2KA 2VYOA 5HR7A 3RN6A 3KCOA 1OCQA 4P8UA 4PTDA 1EIBA 3MBFA 3P0WA 1PKNA 2YAUA 3FHAA 4L64A 1IQ8A 4X61A 4ZFMA 1GQLA 4LNCA 3H7VA 2ZUWA 1K7FA 2B7OA 4L1XA 3INPA 3AXMA 4GKLA 2HNEA 4C6CA 2WK2A 3MHGA 2V63A 3QR3A 2FLIA 3F4WA 4DO6A 1EC9A 1PTDA 2VR4A 1PE1A 3NVVB 3TC7A 3F5JA 3SY8A 1NARA 1J0HA 5LXXA 3CUFA 4F3HA 3EKLA 2G0WA 1JCMP 5U7SA 4IM4A 2W0UA 3PVFA 1A5UA 1F9CA 3QN3A 1B9ZA 1EYEA 2J13A 4EXBA 3GRIA 4H7ZA 5HA7A 3W0KA 4GA8A 1FCQA 3GRSA 1L2UA 2FTPA 3L5AA 2WHMA 2G4FA 4YWSA 2VFFA 1PO9A 4IPLA 3QSRA 1RUSA 3REQB 3SQPA 4MKSA 3CGDA 3Q37A 4NVTA 5DXYA 3EWZA 3UG8A 1CLVA 1XLJA 4N9CA 4Q8MA 3MMDA 2AMXA 1JL8A 4XZWA 2WP5A 2W66A 5MHBA 3ZT5A 1XD1A 1TB3A 5ABFB 1QO5A 2WC7A 3SSZA 2TMDA 5AKQA 6XIAA 3GG0A 4GX9A 1YQ2A 2PZ0A 3C61A 1OJXA 3RM9A 4F0LA 4CVWA 1ZB5A 3G0SA 3C0SA 5T8GA 3GDMA 2GRTA 4HNCA 4GI6A 3DG3A 1E40A 4DXXA 1LL7A 3N34A 2BOGX 4BWLA 4GXMA 2C91A 1JZ5A 2JBMA 1I8JA 3AIEA 1NAL1 1V3IA 2I5GA 3UA4A 4WJ8A 3GNOA 4CQAA 2NZLA 1FKWA 2WWDA 2GH5A 4YL2A 1VGAA 1VBGA 3EAOA 1VYPX 1UKOA 7TIMA 3EB3A 4DNHA 4H7CA 3W1AA 5D2VA 1OZMA 3M46A 3A7AA 4NASA 2EEXA 3WIJA 2REQB 3B05A 4BQ4A 1E72M 4RLIA 3QFEA 4FA3A 5EBUA 5KINA 3Q94A 4HMEA 4ERIA 4M56A 2GVLA 1EO7A 3I6TA 4ZVJA 4ZXLA 5A8MA 4FSAA 1H1YA 3KP1A 2JIWA 2QIIA 3VOHA 3VIJA 4IUGA 1EYWA 1ALDA 1AMYA 4S3EA 1ZL1A 2ZUTA 2WYSA 4TVYA 2J6VA 4R34A 3VOCA 4DXKA 2J77A 4ZOEA 1FFVC 3JS3A 2YBVA 2JKAA 4NG3A 2CCRA 1VBRA 2OSYA 2PSNA 2DSVA 3QY7A 1LJYA 1G94A 3KWXA 4IXHA 4I90A 3FFSA 3AN1A 3W1TA 2YVFA 1AL7A 5DO8A 3UWWA 1W1TA 2QV4A 1RPKA 4UTJA 3OPSA 2QXWA 3NG3A 1JGMA 4XSLA 1GOXA 3AXXA 1XCWA 1LCOA 1SW0A 4HK6A 1IZKA 3ARQA 3L5MA 3CUHA 3F4NA 3QPYA 2CZVA 2WNNA 3MSDA 5ABEA 4I7VA 5JCKA 1JPKA 4J28A 3QTGA 2EPKX 3IACA 4CU8A 3UXKA 1XSJA 3QM3A 4GY1A 5E9AA 5BRBA 3TROA 1YX1A 5DMLA 1ZDLA 1W9PA 3GTIA 1NDWA 2PODA 2EPOA 4I5RA 4AISA 2VP8A 3EMCA 3SJNA 3LCWA 3IVTA 1ZXIC 3U3HA 1TVNA 3H54A 3LMYA 5A8GA 4PMVA 4BI7A 3I7SA 1OFBA 1UR1A 4AY7A 1ZK7A 1SZRA 3RPDA 2GVEA 3CHEA 1FH8A 4NJKA 2QCFA 1UD4A 1EZ2A 2J8TA 3JR2A 4JY9A 4LU0A 2VEIA 2ZZ6A 1H61A 4YCOA 1A5AA 3HZ3A 1RPXA 3NZPA 1M6IA 3VTRA 3L23A 3UCQA 1WXJA 3GBEA 1EJRC 2WCSA 3IUIA 4LEQA 1BWVA 4M5PA 4U33A 2RJHA 5CZSA 1SGJA 2I16A 4UZUA 3L4XA 1GRGA 3CZEA 4LBUA 3T1GA 2J25A 4KIEA 3P8JA 2QCDA 1KV8A 1PZ0A 3CGCA 1FHVA 4IXXA 5CC7A 3W1NA 3GXMA 4YTTA 1N61C 4H9XA 2G8ZA 2G5WA 2VC5A 1IZCA 1CXEA 4L80A 1V3MA 4DI8A 5F7UA 1QBAA 4ZQRA 1N7KA 3U5YA 4R85A 2P76A 3BSGA 1JI2A 2QUMA 1EDGA 2WZIA 5ECVA 2P50A 3SECA 3C8NA 2PGFA 3STEA 1HKJA 3WD4A 2X42A 3R0KA 3MYPA 3FN9A 1KLZA 2GUBA 1VFSA 1RJQA 2C3CA 1H60A 1M41A 3DC0A 1B4EA 3WL1A 3KEHA 1JDAA 2FDSA 5DXXA 1JRCA 1VP5A 2ATMA 2ZA2A 1BRLA 2A3BA 1QWKA 1TVLA 1DWIM 2BVYA 2VFGA 1TTQA 4P7NA 1S2UA 4GUGA 3V35A 3S2LA 4EE9A 5LHFA 3NGFA 2D0GA 2A3EA 5M1TA 2QHAA 3HGSA 3Q2DA 1HF6A 1KFJA 4GUFA 4Y96A 3VMPA 3VABA 5IDIA 5M3WA 3RLVA 4HJWA 1H5VA 1KD0A 3QH2A 3NZ1A 2WHKA 3A23A 2RDTA 3FVDA 3V3WA 3TTEA 3MZ2A 1DYSA 2VRQA 2OSWA 2EG7A 3CHVA 4I9JA 2XIBA 3NZQA 3COTA 4WXYA 3LD5A 2WVTA 1IZJA 4UIOA 2FFIA 1LLZA 4UC5A 3S5OA 2HJPA 2ISDA 4GXWA 3PPHA 3V7PA 1RP9A 4I3GA 3EKGA 4NNCA 2R1NA 3UZJA 3QQ1A 1ITXA 3FDKA 5DT7A 2XYLA 4WX2A 4Y90A 4V28A 1XLDA 4JQ3A 5M2FX 4LJ3A 3ABXA 4LAKA 1GCYA 1ZAHA 4GO9A 1AW2A 2UZ9A 3NQ7A 4JQAA 1ELSA 1LVLA 2DVUA 2GVGA 2PDKA 5CPOA 4E8DA 5J5RA 4ICMA 4O53A 4MG4A 4ZQNA 4DAIA 4E8GA 1Z41A 2G4JA 3AJXA 1BVNP 4I5XA 4X9SA 2GPTA 5F2LA 1KXVA 3B8SA 3N2CA 3T09A 5C2CA 2BHUA 4XVEA 1V51A 2PMQA 1CNVA 5BMWA 1TQJA 3WJZA 3B0YA 4O0KA 4FI4A 5EMLA 2QEZA 4M6PA 4N6EA 1BQGA 1F3WA 3OJGA 1I0DA 1E5JA 3MTWA 1HO1A 2OQLA 2PWHA 2CEQA 2VHLA 3LXCA 3KCJA 2XGBA 3IUDA 3QZ6A 2POTA 3OGVA 3BWWA 4YTRA 1ITUA 4FMVA 4NJGA 5C9WA 5AZ0A 2OT1A 3MI6A 5LIUX 3KTSA 4IL2A 2PCQA 3AAMA 4EQWA 3L65A 3DK8A 3CT7A 2FIQA 2Z7KA 4MB1A 1FH9A 1OHLA 3WF0A 5GJPA 5MKGB 3HPAA 4QE5A 3WQ8A 3U57A 3IPWA 4NF7A 1RVGA 3P3BA 4B15A 4MOZA 3FEMA 1F8WA 1K1DA 3K1DA 4YU1A 1KM0A 4BURA 1KV5A 1F6PA 2VELA 3N18A 4FS9A 5AZ1A 4HNTA 4AW7A 3E9AA 2GGHA 4ZBCA 4GBUA 3EOUA 1RK5A 4B2DD 3QF0A 1YTEA 3W83A 3SEPA 3SUWA 4RNJA 2OYMA 1AUSL 3T0CA 4DO5A 2Z24A 1GKPA 3WQ5A 3D6NA 3CXOA 2X8GA 4PRRA 5CSRA 3GZAA 1ZQ5A 3HFYA 5HPCA 3EMZA 2O4MA 2G41A 3HG2A 3NPWA 2HSAA 2EPLX 4J3XA 1V6TA 1FCBA 4HNNA 1E6XM 1X6UA 3W7PA 3SI9A 1OSEA 1N60C 3E1F1 4RDVA 1WV2A 1TE6A 2NVDA 3NVWB 1UR4A 3MB9A 1BF2A 5CGTA 1FWRA 4FNUA 5AN7A 4AFYA 4S2BA 5I3DA 3DG7A 1UBSA 3VNDA 1R2RA 1XM3A 3S5YA 4QNWA 4ZOHB 2A21A 2V5LA 4DB7A 2W55A 1TPFA 3L66A 1F8IA 3H21A 4DN1A 1Q2SA 1ZP3A 2J74A 1OF8A 1YPFA 3KXQA 3UYCA 4O54A 2YCEA 1XCXA 3BSMA 3PZIA 2W5FA 4GRTA 3N2TA 1QK2A 1D7KA 2Y5EA 2VD8A 2XVNA 4MNMA 1UZ1A 1QNVA 3IIVA 1WUEA 5A95A 1KLYA 2AAMA 4OBSA 1GKRA 5J04A 4JDRA 1IWPA 2DT2A 4IPPA 5HXMA 3G1SA 1O6IA 1GHSA 4L61A 4O1DA 2GR0A 1Q63A 1EKOA 2QDDA 1CXHA 2PDIA 1VCGA 1BTMA 5G1MA 1T96A 2ADAA 4EWND 3DFSA 2GK1A 2C79A 1UOZA 4UFHA 1RQHA 2I14A 2V2CA 4EACA 1XYFA 1ZMCA 2PCEA 3GTFA 4UTHA 4H9MA 3RNDA 4B2DA 1OT1A 5CAHA 1MUCA 4NNAA 4GUIA 1NOFA 3PR2A 2IQTA 1NQ6A 3QOKA 5LNUA 1O7AA 1E6ZA 3AZTA 4O19A 4UZSA 3B9NA 4ZOCA 1SB3B 2QNEA 3AIUA 3NQ8A 4K39A 4IIDA 5LA2A 2XHYA 4K8DA 1TELA 1EP2A 2R1MA 3ARRA 3VDGA 3B8IA 3N19B 3N15A 3TXVA 3QSTA 3KLLA 1NH6A 4C1NA 3CLMA 3L68A 3WLPA 3W1PA 1DPMA 4GY7A 2A3HA 1TRDA 2QCMA 1E6SM 4F0RA 1PWMA 1WKFA 2OVLA 1C7SA 3VNMA 1Q66A 3ITTA 2WQPA 3LPFA 3S46A 1GZGA 2Z6IA 1E5NA 3CWOX 4WK9A 1OFQA 1QNQA 2Y2WA 2YGYA 3W29A 4KRTA 2OT0A 4LCQA 2QDGA 2WMKA 2X8HA 1P5BA 2ZRWA 1SSGA 4DJFD 1KM2A 3NAVA 5D03A 3W28A 4PCNA 5LIYX 4DF0A 1R85A 4FXJA 2GJNA 4FLRA 5EFFA 2FQIA 4KS0A 2Q8XA 3MVIA 1NDYA 5H91A 2ZZBA 3D46A 3EB4A 4D71A 1GTEA 2E25A 2F6KA 4F9DA 4JYFA 4Y9NA 4JY8A 1DXLA 3G3DA 1XL9A 3LLDA 1W3IA 1B2YA 1W3HA 1GRAA 1BLIA 3GHSA 1NPXA 3H6OA 1TX0A 4F0MA 1KR0A 4HT3A 4HCLA 2DIEA 2WBGA 3TTQA 4LUJA 3VMOA 1V3LA 3GTXA 1E3XA 3EZ4A 1XHCA 3KBVA 3KZPA 5G2WA 4KERA 3ES8A 2CC0A 3OZOA 4F66A 1DWGM 4OQVA 4EXAA 3MUAA 2FZ9A 1YBQB 1IT7A 2XFFA 4S38A 1EF3A 2VCAA 2IXVA 2HEJA 3ONCA 3U2CA 4KGJA 4RK8A 3TQ0A 1E6NA 3SGUA 5GNXA 2XIQA 2ZZ3A 3P8IA 3PBVA 3N3TA 2VEGA 3RM8A 3K8MA 3CHCA 4GH3A 1SO5A 2Z2UA 2BVDA 4DJEC 4F2BA 1LLOA 3EPNA 4HPNA 3PZVA 3B0VC 2JKPA 1A80A 2CLIA 3ITCA 1JCXA 4GD0A 1DVJA 3KW3A 4CCZA 1D7FA 3DFNA 3A7RA 4LC6A 3PG6A 4YVPA 4QLKA 3CQKA 1NIUA 4GNVA 3G6MA 4DZIA 1TPWA 2HK0A 1S5NA 2ZVRA 3VCCA 2BG5A 2BY0A 1EJUC 3TYUA 3H26A 2DUAA 3NL2A 1NY1A 3KM8A 4A2SA 2HPMA 3P67A 4LUTB 2XG9A 1FVPA 4IG2B 2FPVA 1DJXA 3IK2A 3M0ZA 5T91A 1WCGA 2I1OA 3LY0A 3OGRA 3U2ZA 6PTDA 2BOFX 3VIKA 4DJFA 2X99A 4PC8A 1HZYA 1ENUA 4HU4A 3BAXA 3N73A 2CLKA 1ZJIA 4C6DA 1HJSA 4A6GA 3LENA 4X63A 3SIMA 4CNTA 3BCJA 4O17A 1T5AA 3FLUA 3VIFA 1QNRA 2QLYA 1HT6A 3MC5A 3DYMA 1BYDA 1GQIA 3QPZA 4Q8NA 2PLKA 1EJTC 1SZEA 3S47A 3EXRA 2Z0IA 3DG6A 1YDOA 1EC8A 2J7CA 1IYXA 1M7PA 1FWJC 3WBWA 3WDPP 2VMFA 4HVXA 3WG6A 5FF0A 3MT1A 3PJUA 4GI8A 4JIIX 3BLLA 3VKBA 2NXGA 2Z1KA 3I3BA 1VBUA 5FAJA 2V5CA 4B5VA 5BOFA 2NT0A 5FJUA 1WKYA 5JBFA 4XZBA 5DMNA 5C9UA 3FSTA 3NM1A 4RNIA 3W9ZA 1XUUA 5H8MA 2W54A 1S5TA 4IQJA 2F61A 3S5ZA 4PMRA 3ZMRA 4ZXOA 1HKMA 1H0GA 1GREA 3C2RA 1XINA 2VZOA 3IVUA 1GVSA 4FO4A 4XZMX 5GNYA 4PB3A 3OLEA 3S2NA 2MUCA 5ABGA 3MV01 3V1HA 1UD6A 3DHUA 3DAQA 2NX9A 1STZA 4MUZA 1I1WA 3GKAA 3GG7A 4NHVA 2BNJA 1DIDA 2OEMA 5CAKA 3N04A 1LT8A 4CN4A 3MDUA 1YPIA 3C3NA 2A85A 1EGVA 3DZ1A 2GLKA 4YTQA 1XLBA 7TAAA 4DZHA 5EA9A 4LF1A 3W27A 2EPHA 1LG1A 1OABA 1P0EA 1V3JA 1FXPA 4ML9A 4H9YA 5FL0A 3NS1B 3QV7A 3HGRA 3TP4A 3C3UA 1TWSA 1LRNA 4C90A 4F8XA 4P7LA 1JEZA 1TPB1 3NA8A 4ZB0A 1E4NA 1R86A 4M3PA 3KTXA 5J5DA 2G3MA 2C16A 4A22A 1J6OA 2VX4A 3FS2A 4ZTXA 3UXLA 1KCLA 3CYVA 3QGKC 3DI0A 3ES7A 3N12A 3PB0A 3S6TA 1KWKA 4ICNA 3E12A 4B9ZA 3T0DA 3H4WA 4TR9A 5IM51 2CBVA 1O94A 1EOMA 3WF1A 1T7LA 1FWHC 4U5KA 1A5KC 5EY5A 1G7VA 1GOQA 3A3XA 2BHYA 5EMYA 1AMKA 4QEHA 1ECQA 1LL4A 2CU0A 2A6NA 2VNCA 2XH4A 2R8WA 1A5BA 2WVSA 1ME9A 3UVIA 5CZ0A 3NQVA 2PDPA 3UY8A 1XSIA 4J27A 2V3BA 4GUHA 2YA0A 1ZP4A 1GHRA 2W92A 2BHZA 3MWCA 4YWOA 4U3CA 4LSBA 2B81A 2BXYA 2Q3RA 2Z1VA 3WQPA 3T81A 4WJEA 3VI2A 2H8XA 1TMLA 3KBSA 3O15A 4ES4A 2HS6A 5E6YA 2GJXB 1TIMA 3BAIA 1QI3A 5I3JA 1YQZA 3NL6A 3WJWA 3H8AA 3W75A 5E9XA 2J7GA 2VCBA 4QR6A 3CH9A 4LVAA 3W24A 2V6OA 5FA5A 3LCGA 4J3WA 4U4MA 5AYYA 1EOKA 3VZXA 2HRWA 4P7OA 4UWMA 1N8WA 2VL4A 7CGTA 3WYZA 1F74A 4H8VA 2WB5A 3VA8A 3GDKA 3AQUA 1XBVA 3W25A 1UWSA 2VQUA 4IJBA 4M0XA 1E4IA 1JCYA 1QO2A 1CGWA 3PTQA 3TW6A 2DEPA 1Q6EA 4FF5A 4IFRA 3SGGA 1EA9C 3EPOA 3LYEA 1GG0A 2PTYA 1TPH1 3GG1A 3NR0A 3BZGA 1GT8A 3Q6JA 2DZTA 3DFPA 2WSRA 5IBXA 4R88A 1F3XA 3A6OA 5F4WA 4A8RA 2ACRA 4I9MA 4EPDC 4NEVA 3A4AA 2WJZA 4XAGA 4MY9A 1SPQA 3KL5A 3S1WA 3RF9A 5D8WA 2EGZA 1JCNA 4RE3A 1JXKA 1T6MA 1HJQA 1LLWA 1GRFA 1TYTA 4HU8A 4REQA 3DYPA 3E38A 1ODZA 1FX6A 3BVJA 2Q09A 4O0ZA 4O13A 4JTIA 5EKYA 3RIKA 3EWDA 3QVQA 2W91A 2PGWA 1XIJA 3KCLA 1P0DA 1PL9A 2WXDM 1UG6A 4U31A 5F2MA 3GDLA 1B57A 3I6EA 1N8IA 1FHUA 3HN3A 2RFGA 1NFBA 4V2XA 4ZO7A 3GZ3A 2JGQA 4PA8A 1M68A 2X1IA 3TQKA 2J6XA 5AOUA 2LLEA 1JROA 3M9YA 1M7JA 3CJPA 3PFMA 5HATA 2PDGA 4E3TA 3FKRA 1W0MA 5TD4A 3W2KA 4TVDA 1L6WA 2C13A 1H5YA 1HNYA 2QCHA 4QSHA 2IQDA 1KKOA 3B97A 3NZGA 1GEQA 2GSHA 1PX8A 3LXAA 2XIMA 1EHNA 2X41A 4HN8A 4HB7A 4WY0B 4JTAA 1Q3NA 4J7RA 1RHCA 2XVPA 3CPRA 1FUYA 1VRXA 4ONVA 1W9VA 2GWNA 4CEUC 2CFFA 5HJXA 3WLRA 1TE1A 4AF0A 3UP8A 4F79A 3PZNA 3KOFA 3VKJA 4HZ7A 2Z2AA 4HYRA 3PAOA 4PGLA 3V1PA 1K4GA 1VF8A 2XIOA 4H4VA 2DZVA 2A3AA 3C2YA 1OG6A 3II4A 1L8PA 3WQCA 4AC7C 4FOUA 4YTSA 4DO4A 3I7RA 1BKSA 1OJTA 1R47A 1MW2A 5AB3A 3GD6A 1ZCCA 4O1FA 4WXZA 4IWWA 3D9XA 5REQB 1T40A 3PTMA 2ZUMA 4HP5A 3UWEA 3W2JA 1SFSA 1WBHA 1VEPA 3UZXA 1P1MA 3BJSA 2AOSA 4H9TA 2BODX 4QG9A 3OBEA 3WLHA 2NT1A 4LRTA 2O56A 4W5ZA 3UCDA 3GDRA 1AK5A 1W5OA 1M5WA 3W84A 3M5VA 4RNHA 4C1LA 1J12A 4JCLA 1OC5A 3STGA 3PAJA 4P7QA 3SQMA 2I9UA 3P62A 5CC3A 3LGDA 1P7TB 4DNMA 5EBAA 4JYDA 1C9WA 2CIPA 2KX9A 3ABOA 1M03A 3NGJA 1BG9A 5BW6A 2Y89A 1I2PA 4LVBA 5MKGA 2VFEA 3WMSA 2QYGA 4PH6A 3VM7A 1N5XA 2IPFA 4MY1A 3ANVA 3O7UA 4PB4A 4PTMA 4MDOA 3I4KA 3GU2A 2YDRA 5U25A 2P8BA 2GUYA 4ZA0A 5JIWA 2CXEA 3PNZA 3W3OA 3C56A 4DWSB 3PZGA 2DT1A 1KC7A 2C8NA 3DFTA 2WMIA 1UR0A 4AD4A 3AWOA 4UTLA 4H8NA 2YFOA 3ARYA 4YHGA 1EZWA 1OCBA 3W37A 1RBAA 3K2GA 1QPKA 3SW6A 4YWIA 2V8ZA 5LZLA 1OYBA 4PRTA 5DCBA 4CD6A 1UWQA 4PMYA 3MV11 3WLKX 4P8WA 1PZ3A 1A4LA 1Y8BA 1ZENA 4QSFA 3FCPA 1J0IA 3W7LA 1MXSA 2IW0A 3N29A 3L4TA 5BOOA 4QISA 4P61A 1S39A 3P14A 3MMTA 3NUKA 3GD4A 1EX1A 1GVYA 2ALDA 4JQ4A 2Q6ZA 4K8HA 3NTYA 3U2OA 3PSWA 3ZR5A 5A69A 2WJDA 1ESWA 3P80A 1H1NA 4KRUA 5JCMA 3DECA 5CBBA 4BQ2A 2DH2A 3N11A 1TPUA 3C8FA 2DW6A 2VOMA 5BU6A 3MANA 3DI1A 4GK8A 2Y63A 5BU9A 3N3MA 5CC6A 1OEPA 3VPLA 4MYXA 1AH0A 1NJJA 1GRHA 3GFZA 1YE6A 1NU5A 3R25A 2DT3A 1GOIA 2FVKA 5FACA 1GQJA 2J66A 4HN4A 4UQCA 2D20A 1E4LA 4NYUA 2EPNA 2WNZA 3B3DA 2QJJA 2X7VA 4MZ8A 1NOUA 1ZAJA 4OFCA 1XDIA 2PP0A 8TIMA 3CZLA 2C0AA 1BAGA 1KQZA 2INZA 2X7WA 5I24A 1A5SA 4KW2A 5CKSA 1IR2A 4UNLA 1TPDA 4NEWA 1ISZA 1A3XA 4Q4OA 3NSMA 4L6DA 1CLXA 1AZ1A 1KO0A 3LGEA 2G3FA 2GL5A 4H4TA 1L8NA 2HQAA 4N6FA 3QMRA 4EK7A 1YXCA 4NYYA 1KWGA 3ONBA 6XIMA 3AYRA 3TSMA 2D24A 1CW2A 3UD6A 2YBTA 2CW6A 3W6LA 3KRUA 3DGBA 1UPMB 4GNJA 1VLWA 4Q7NA 3LHZA 4MUPA 7ODCA 3TAKA 3APYA 5BYWA 2IKGA 1YDYA 1Y5XA 2P53A 2OLSA 1KM3A 5AYBA 2WJFA 4EIVA 3VDCA 2G95A 3E0FA 1TV4A 3BLDA 4H41A 3DBNA 1X1ZA 4NT0A 4PMQA 2PLCA 1M65A 3E5BA 1DEDA 4L4LA 2YJQA 4ZOAA 3W1UA 1WO2A 5KZ6A 3FGCB 3DH7A 4L6OA 3LPGA 3DERA 3WSUA 1I4NA 2WPBA 3NVYB 3OIHA 4RCXA 1QOXA 4AD1A 3M0LA 1VJIA 4ZZ9A 3VIIA 3D3AA 5E5CA 1KBJA 3QXBA 4ZB5A 2Y6ZA 1TJRA 2FZ8A 3UJEA 1YNYA 2QUNA 4M51A 2I7GA 3NQMA 4H4WA 4FPSA 4DPQA 1R6WA 4H4XA 4IQLA 2NW0A 1R3VA 5BOEA 5I07A 1FCVA 3AHZA 3VOJA 4K7ZA 1FDZA 2D3NA 4WDXA 5A94A 3W7GA 1AVAA 1M01A 4LY8A 1HO4A 2XDFA 1YYAA 1W3LA 3OIXA 3LM7A 3VFLA 1XRFA 3CO4A 2HNHA 2F2HA 4GI4A 1S1PA 1J2WA 2OYLA 4LALA 4F0HA 5C2XA 2HVOA 1QNPA 3VC5A 4AZCB 3CQ0A 4CD5A 1FHDA 3IJLA 1ZLPA 3TNBA 1QW9A 3WO8A 3CQIA 1ZBWA 3EX2A 3LB0A 2X0HA 3VUSA 3TN4A 3SCQA 3GLCA 1XIGA 3SUSA 3WDIA 1UBPC 1ICPA 2GDVA 1MNSA 2H8ZA 4LCRA 4NILA 5FL1A 2Q8LA 1M7XA 1J93A 3WF2A 4TV5A 2P5NA 3IJ8A 3TC6A 2XUCA 2E3ZA 1CGYA 2ZX7A 3CQHA 5HJLA 2J79A 2YL6A 4PTWA 4S3GA 4B4FA 5BXPA 2OJPA 1OX4B 5HNRA 1LOSA 2ZZ7A 3C86A 3TYEA 5KEZA 3DBPA 1E1CB 1YIXA 1TUFA 2DJXA 1HJWA 3CIVA 3GS6A 1ZKQA 1E55A 1Q4WA 3MU7A 1Y5WA 3HQOA 3BDKA 1F8MA 2DSZA 4EKJA 2MANA 3GIYA 4CU7A 2YXGA 2WPGA 4WHBA 2WC4A 1CGVA 3E2RA 3QLDA 3N13A 2WM1A 4JXCA 3R07C 4FOKA 3B8UA 5CC5A 4IG2A 1WAWA 5BMXA 3GR7A 3ALGA 3W2LA 1Y5VA 5JIPA 5A6LA 1YDVA 4WSHA 3PWAA 3ZQ9A 4ZSUA 3CBWA 3PZQA 2TSYA 3GNRA 1A0EA 1OC7A 4A29A 1EEPA 2KZHA 2Q02A 1SJBA 2ZIDA 3WQDA 4B91A 5FS6A 4QS6A 1E15A 2POZA 3RJYA 4NRSA 1TYGA 4DF2A 1XIIA 3W71A 3E6EA 3WLSA 4XD5A 4KKXA 3OZYA 2VVNA 4LWWA 1GONA 2ISSA 2DVXA 3IS4A 5HJYA 3AFBA 2ON3A 2HXTA 2ISWA 3B8TA 3D5HA 1TZZA 5CG7A 1UA3A 1RVKA 3EEZA 5AY7A 1HJUA 4OTKA 1JULA 3BANA 3GXDA 4UR7A 1ZMDA 1KRCC 2ABBA 2VZUA 4PSPA 4DF1A 3FG2P 5BRQA 5LNSA 1MQPA 4D6JA 4HCDA 4HK7A 1BQCA 3R89A 2CNCA 3WBAA 4IFKA 4UMCA 3R5EA 3O06A 1XH1A 4XISA 3I6RA 3KRBA 4CN6A 4M6VA 3UJSA 2YKKA 4Q8VA 1GORA 1XW8A 3FXYA 3MJYA 3TSBA 4BV6A 2NSXA 1TKKA 3T08A 3UA3A 1GUVA 3RHGA 3CZJA 3S3GA 5K9XA 1K4QA 1Z3NA 2OO0A 4MDPA 3B8WA 3PC0A 3P84A 5E09A 2FYMA 3LZ3A 4JTCA 2CETA 2VJXA 4ERGA 4WSKA 4MJMA 4W8AA 3BG3A 4MNJA 5FJIA 1J0YA 4CQBA 2EKGA 2C19A 5DRIA 2YVGA 2BBFA 1MWOA 2NWSA 2DGAA 3KVMA 3THAA 1XYAA 2VKZG 1JUEA 4LRSA 1PV8A 3PM6A 4O8AA 1WZMA 1FFRA 3W7CA 1REQB 3WLIA 1S2TA 3DENA 2NQ5A 2W9MA 1F05A 3LNMA 4H1ZA 4Y2WA 5C7VA 4GQGA 1GG1A 1X1NA 1Q5MA 4Q3MA 3D3FA 5CGQA 1XJBA 1FH7A 5GJNA 1YEYA 1NWRA 2UY4A 5D9PA 3CWNA 1MRAA 2CDUA 3BICA 1YRRA 4J2PA 1WOBA 1YADA 2ZXDA 3UG4A 4AZIA 1R3SA 3WCZA 3U0HA 2RUSA 4JN7A 2VX7A 1DQWA 5FJOA 3BO9A 2CHOA 1QAPA 5PTDA 4HHHA 4RXFA 3A21A 3ZIZA 4O4WA 3AUOA 1QFEA 5CSUA 3D0CA 1XRTA 2E1DA 3BW2A 3WQ4A 4H6RA 5I23A 1R38A 1TJ1A 4LTSA 2Y4SA 1TA3B 1BHGA 3EUB3 5JCLA 4H8HA 4LH8A 2PGEA 3HG5A 4WIWA 4XBKA 3VM5A 5LNWA 1AH3A 3OU8A 4YYFA 3RMJA 4XZHA 3B4UA 3AU2A 3WH5A 3CNYA 3DYOA 3TR9A 3NVZB 1ISXA 1KXTA 3E3HA 1XICA 1EP3A 2W27A 2QKFA 3IC9A 3TR2A 3VD5A 4H83A 3PY2A 3BOXA 2J3NA 3OQ8A 4PR4A 2GJXA 3O6AA 4AHOA 4J4KA 3AYSA 4PB5A 4W7WA 3UJRA 1P4CA 3G1FA 2V5BA 1IXQA 3M43A 3WZ0E 2E67A 4HA0A 5HK4A 1E0TA 3LADA 2J7FA 1LF1A 3FY1A 1JCTA 1D3CA 1QVBA 3GBDA 2VX5A 4JX4A 1IE7C 4B3KA 5G4HC 2I5QA 4OHQA 1WNOA 3GRTA 4U5IA 1OVDA 7A3HA 4MJ4A 1RK6A 3LLFA 3VNYA 4DJED 4GYPC 2YVJA 3V0UA 2PDFA 3MCOA 5BCAA 3QC3A 3UR8A 5D33A 3PANA 4KPRA 1C8XA 2E5AA 1TJPA 1H63A 1NFGA 2CZFA 4B9YA 4QQUA 2FPYA 2YOCA 3UY7A 3F2CA 4TV6A 3EDEA 1KM5A 5GVJA 1KBIA 1H62A 4H01A 2O92A 4DHGA 4YMZA 1V0MA 1T3QC 4V1YA 4F2TA 4L56A 3BAYA 2FVLA 5K9DA 4E0CA 4OVXA 3ZWSA 1BTCA 1R87A 4QBXA 1PIFA 2EPMX 1H4PA 5LA1A 1J0JA 4OKDA 1EXBA 3QMTA 4WOZA 1D9EA 1OGGA 3TCSA 2WOVA 2JEPA 4MFDA 3WBEA 1VB9A 2H6RA 5CJNA 4UFKA 1OD8A 3TYBA 2YIHA 4HSOA 3VX0A 3F4DA 3GC2A 1XF0A 5D9MA 3HM7A 1PIGA 2A2IA 3M1ZA 1DJHA 2YZ5A 2HZGA 4LT9A 3W76A 3UNTA 1B4KA 1IGSA 2NX3A 1BYCA 2NQLA 4O52A 1XLAA 2QPXA 4V1XA 3FA4A 2CBJA 5A6JA 4Q4MA 3G2GA 1AJZA 3N4FA 1Q6LA 3VFCA 3GIPA 1OK6A 2WC3A 1LQ2A 3GX9A 2IXUA 5I77A 1LZOA 3CS2A 3A24A 3ZJ8A 5LNVA 1N55A 4FX6M 2NV1A 2J9ZA 3LHWA 4C6FA 4C6KA 3POHA 3G77A 4KMQA 3PP7A 2ZC1A 3MVTA 1SFTA 2NQHA 4AEFA 3UWQA 3RCYA 4H2HA 3IJDA 2NV9A 4WY0A 2RGMA 2QCDB 2VT0A 3GD3A 1K7EA 3FIGA 3GW3A 1VHCA 1QCWA 1O5RA 4DJEA 2FHBA 1SO3A 4KFOA 4KCVA 4A4AA 4TX8A 3IARA 5DBTA 1H50A 3LSCA 1TX2A 1Q13A 3TFCA 2VGIA 3QYSA 2A0NA 4PL1A 4AC1X 2FGZA 3BMWA 3P81A 4Z08A 2PDJA 3CAWA 4XAZA 3T2QA 5I0DA 4GACA 5EPDA 2E6YA 1U1HA 1DORA 4GQRA 3C2VA 2HWGA 3NL3A 1PCKA 3PBWA 5REQA 3OYZA 2YLAA 3ZOAA 4HNUA 2C6QA 1IEIA 3FVMA 3DFOA 5A6MA 4DYKA 2QUUA 3WDQA 2FB2A 3SDOA 3T42A 1KR1A 3KDNA 1NHSA 4B5XA 4N0RA 3W7EA 4Y9AA 4MWAC 7ENLA 3BXWA 1Q85A 1F4AA 2YXXA 2WBKA 4KIRA 3R0DA 1BRLB 3LQGA 1J11A 4NX5A 4WR3A 1UQZA 1TTJA 5AECA 3MW7A 3CUJA 3ANYA 2PC4A 2YCJA 1H7OA 3M16A 3FSUA 4B5NA 3KTCA 1A47A 4RXGA 1E1FA 4UBPC 4B90A 1RP8A 4E8CA 3HGOA 3UXIA 4CQ8A 3CMGA 3VNJA 3DUGA 1J5TA 3D47A 4IT1A 5HWJA 1Q45A 3VX1A 2GQAA 4W86A 5CPQA 1FIQB 2QIWA 3L0GA 5DMYA 2D22A 2VUYA 2R14A 4AY1A 1NQKA 3GVWA 4CGTA 1K6WA 1H41A 2J27A 2DY3A 3W1XA 4ZO8A 5I02A 5D04C 4LF2A 1XBXA 3P5YA 4GHRA 4LBRA 4M1BA 1UKQA 4S3JA 3WDRA 2ISFA 5BXSA 1E6PA 2HVMA 4H04A 2TODA 1JQVA 3WNPA 1UROA 3VE9A 3H4GA 4MM1A 3QKEA 5HULA 1L2QA 3VNKA 1ZJAA 5KSWA 5ECUA 1GSNA 3SUVA 2HVNA 4DYEA 3K30A 2XU2A 4KWSA 2JK6A 5T26A 3CUIA 2OX1A 4IZGA 1XYBA 2V3AA 2Z6JA 3SRFA 3N2OA 4Q33A 5FI8A 3A4JA 3W74A 4S3CA 1GNXA 1Q7ZA 1KGUA 2J7DA 2A79A 1SM9A 3W1RA 1SZGA 4B5TA 1O68A 3HQ1A 2QJNA 3EAUA 2PP1A 2SFPA 4PODA 1DV7A 4EANA 2AQWA 2JE8A 2TRSA 1UP3A 3H2OA 4OBRA 1JZ2A 1GVQA 3GK0A 2BCPA 4H3DA 1MW1A 4UTWA 4WRHA 1JF5A 2ZUSA 2XWDA 3K5XA 1XH2A 4BZYA 3ARWA 3DEQA 2JF7A 3AOFA 1W1IE 4J1OA 4M6UA 4L4PA 3SO7A 4NY2A 3MI3A 1OG0A 2GSJA 4EPKA 5CZKA 4OT7A 1OB0A 2GVJA 2C0HA 3AI0A 5G4WA 4TUFA 4ZOBA 1EUAA 3AWNA 3ZLHA 4FIRA 3B8VA 1XWYA 3NYDA 3UG5A 3TWAA 3M0VA 4PULA 4BY3A 4GXPA 3RJXA 1XBYA 1ME7A 3WN6A 2FPTA 2PU0A 5FKYA 3TE9A 4ACYA 1UWUA 1E71M 4JIHA 4C6PA 3BCFA 4OOZA 1K8ZA 4TTGA 4HHLA 1UMLA 3WJSA 4DUVA 3RPTA 2QV5A 1LOQA 4N7QA 4JHZA 1DL3A 1PKLA 1UHVA 4RZ4A 3I10A 4PMXA 5KMYA 2I5IA 1A3HA 4X9YA 2NXIA 3ZJ6A 4CEXC 2Y1HA 2IKIA 1OIMA 3K4AA 1QI5A 3G1XA 3N14A 4NAEA 2DQXA 3MP5A 2QPUA 2YL9A 1V02E 4M24A 1J0KA 5DN1A 1US0A 4D8LA 3R10A 1LWIA 5AHLA 3R2GA 6TIMA 4E4PA 1XLHA 2EAWA 2XSAA 2JFEX 2ZZCA 3FA5A 1AA1B 1JD7A 1O5KA 3BV4A 1QPNA 4W7UA 5BXRA 3ZR6A 4UNKA 3FXGA 2HK1A 3FJNA 5HINA 2P3ZA 4I6VA 1WKEA 3TMQA 1IEWA 4A8NA 5FF3A 2QUVA 4CQCA 4UTTC 3GNDA 1B90A 2R1KA 4LYQA 5I7GA 5E0KA 1ITQA 3P0XA 4PBEA 3HG3A 1E9LA 5TIMA 4GZJA 1PVNA 1YKWA 3P7YA 1X8FA 3EOOA 4GGBA 4QAIA 1PTGA 1AL8A 3R43A 1XV8A 3FW6A 3UR7A 5CSSA 1V6YA 4CU6A 3FYYA 3IGUA 4WZHA 4XQ6A 4XWUA 4IMEA 1SQ7A 2PWFA 4GJIA 4JHMA 4MHBA 2YDAA 1YNQA 4EPEC 1LDCA 3PUDA 1HJVA 1OF6A 1PCWA 4UFMA 3WEZA 3CV6A 4UCGA 4ADTA 4AZCA 4GIAA 2UWFA 3HPSA 2DJLA 1G01A 1G4SA 4L7ZA 2V9DA 3PBGA 4TIMA 3PSVA 3UWYA 1FOBA 3W81A 1UWIA 4PFMA 2QULA 4KEUA 1HFBA 3WBYA 2PFHA 3CZKA 2UY3A 3L67A 3QY8A 3EYPA 2D2GA 3B9EA 1AQMA 4HA4A 3CH0A 1QI4A 1F6KA 1R7AA 1HKVA 2J47A 3O2LA 5CG0A 3W7DA 3OZMA 4LS1A 4Q6JA 4WF7A 3BPWA 1TJ2A 3QKZA 1LTDA 5G5GB 1OX4A 3RX2A 3BE7A 2GDQA 3LBMA 1XIDA 4GPNA 2OKOA 3DU0A 5CZTA 4A3UA 1KM4A 2P10A 3E0WA 1E1CA 3WEOA 1YHTA 1XFCA 4RPPA 4NJJA 1LUCB 2G3JA 3VD9A 3NVTA 1E56A 1RCOB 4Z2HA 4PSRA 3W7NA 1POJA 2R1PA 5DQPA 4PUWA 4TO8A 4FZIA 4X3ZA 3VIGA 3FYPA 4W5UA 1FWFC 4JTSA 3T7VA 3HTWA 3LCLA 4IIFA 3BZJA 1C8QA 4MLJA 3T55A 1GERA 4RDZA 1S1RA 1QBBA 1WXZA 4KGLA 4H8UA 2OZ8A 2OZ3A 4DUWA 4NL1A 3CEPA 1HL2A 3S42A 4XTDA 2CLEA 5DELA 1Z42A 3MCNA 3BOFA 3FA3A 3EX6A 1DHKA 3I65A 3M07A 4B5SA 2VXNA 2VEFA 1GVOA 3F4VA 5HUPA 1X2HA 1FWEC 1QW7A 1YDNA 4J2MA 2BTMA 2YQUA 4KCWA 4ALDA 3GB6A 4FF7A 3N6JA 1RJPA 4HJFA 4GCXA 4KCTA 3GNNA 5G2HA 2CZEA 2P8CA 3IIXA 3LDVA 2RGLA 3W73A 3UU0A 3W23A 4C1KA 3LCXA 4IFOA 2WPFA 2YZRA 6A3HA 3HMCA 4POCA 2XN0A 2QR6A 4S39A 3J7HA 4A35A 3L5LA 2XVGA 4RE0A 4OUIA 3UF9A 2GFTA 3S83A 5J8LA 3OA5A 3QHNA 2XISA 8XIMA 3AMLA 2CESA 3AHTA 4QLJA 1WAUA 2Y0FA 3G5EA 1TWDA 3XIMA 1UOKA 3TH6A 1UR9A 4JKMA 1OCNA 4PMZA 1SSDA 3K4DA 1KGWA 1A5OC 2INEA 4KWUA 1CI1A 1NDAA 2YFNA 1GVFA 4K8GA 4O14A 3QGAC 3NIYA 4MNKA 4GCAA 1RV8A 1B3VA 3S1VA 3B8DA 1XI3A 3T4WA 4GZEA 5JXQA 4IQEA 2O9OA 3CMJA 4L9YA 4R27A 6REQB 3TSDA 3OBAA 1REQA 1M1BA 1V6WA 3SN1A 4HMCA 4Z0JA 3TLLA 2EBNA 4L65A 1L6GA 4HSHA 4Y9MA 5EU9A 4J3SA 4JPGA 1GPWA 4MKVA 1ZJBA 2VZVA 1LRQA 3L0KA 5HWNA 4N9DA 3CHFA 1H3GA 1VFLA 2VX6A 3NO5A 3WUGA 2JKEA 3OLDA 2ZZ4A 3S1XA 4C6QA 4P8XA 2ZICA 3JU2A 3PJWA 1XR2A 1KXHA 4LCSA 3Q45A 2FZBA 1G9HA 1SZNA 4XB3A 3BK0A 3PPGA 3GW0A 4JTHA 1ZU8A 1BF6A 3O6YX 2XPKA 2YLLA 4R9OA 1CIUA 1QXLA 4IMCA 2Z2BA 5XIMA 4WGHA 1HL8A 3AMCA 4RNFA 3ZJKA 3S2MA 2XFWA 4MJZA 4GVHA 3NWRA 4APNA 1Y7VA 4FNTA 3TW7A 1XKJA 1TA3A 4JHOA 5L6UA 3TJXA 5D4YA 3DFYA 4LAOA 1D7YA 2QUTA 1UKPA 3G0XA 2PD9A 3BOLA 3A3HA 1AQ0A 1EJVC 4P2VA 4TX6A 3FYOA 1EWEA 1KTCA 2J7HA 2ANUA 1E0UA 2J24A 2W4XA 1MO0A 4HPJA 1PBGA 4MB4A 4Y6GA 3LN3A 5HWMA 4Q8PA 1LROA 2ZZ1A 1E0XA 4AH7A 1Q6OA 4V33A 3L2IA 2VGBA 3ARZA 3TX9A 1GYMA 1KCZA 1WBJA 2H3BA 3UXDA 4S3KA 3R0UA 3LEPA 3TTOA 1CB2A 2V3FA 2F38A 3BCDA 3W1QA 2V5JA 1JOAA 3RM4A 4A3YA 3R4IA 5D05A 3BAKA 3SCPA 4RL3A 3AHXA 2E0PA 3MO4A 3UFYA 4EM4A 4XO7A 1OFEA 3ABSA 4Z42C 4QGCA 2OODA 2E7FA 4WJXA 3R7MA 2YA1A 5HANA 1FWTA 3UZZA 3GTHA 3NQEA 3W22A 2WBAA 1TR9A 1I45A 1TRIA 1XPYA 4IL0A 2JF6A 3KAOA 3F2BA 4PUNA 5HNUA 3W88A 4FNSA 4NZ3A 3VUPA 3EKZA 3SCSA 1HL9A 2ZRUA 1NHRA 2OQYA 4XAFA 3FJ6A 1T99A 3USZA 1HJXA 4NZ1A 2Z27A 1S2AA 2D69A 3FK4A 2OPJA 1QASA 3WEMA 2WSQA 1XBZA 2CLMA 1VPXA 4D2JA 3A4XA 1QHZA 3V36A 4XK2A 4UQAA 2A5HA 2B7PA 5E1QA 2D2HA 4PZVA 4OV9A 2P88A 5LYRA 3NQBA 3VGFA 5XINA 4OE7A 3UBPC 4GVGA 8RUCA 1K77A 1EXPA 1OC6A 3U5UA 2JALA 3GAKA 4CQ9A 4ZCWA 4PUUA 1O1HA 1TJ0A 2E28A 2PP3A 1EX5A 2I56A 4GR1A 2ODOA 1F07A 2FZDA 3BLIA 3PPFA 1JPDX 3GAYA 4FR6A 3E2QA 4M7TA 2A7RA 1UA7A 1QI0A 1JAEA 3MUY1 5F2GA 3C5QA 2O9TA 4F40A 2QAFA 3OOQA 5A8OA 4ICCX 1SYTA 5DF0A 1FDJA 1HTIA 7PTDA 2WHLA 5C9RA 4BF7A 3R94A 1H51A 3EOLA 3GY1A 4QCEA 1OINA 5HMFA 5E70A 3WUBA 4C6JA 4AZ5A 3G1YA 3G1VA 2VENA 3ORWA 3T0TA 3GVVA 1B3ZA 3SRHA 3BMVA 2UY5A 1KQYA 4W7VA 1F3EA 2Y7DA 3B06A 4XAPA 4I5UA 1C8YA 3S6OA 3BH4A 4L1WA 3W7KA 1NP0A 1U5JA 4AIEA 5CLWA 5DX7A 5D8ZA 3H2EA 2PRLA 1I6NA 3JUGA 3OW1A 2F84A 1B9BA 2ZFAA 2FZNA 3H2FA 2ZTJA 4WD0A 5A6SA 2BS9A 2ZA1A 3OLGA 3E2SA 1QPQA 4O12A 3O63A 5HMDA 2FHCA 5D2WA 3M0XA 1VQZA 4EMWA 9XIAA 3A5FA 3KFTA 4OZOA 3KBWA 3I7QA 2AQOA 3SIZA 3H7UA 4XSMA 4IJCA 1KFEA 1R30A 3OLIA 3W6YA 1EFZA 3O1NA 2C7FA 3L7RA 1KXQA 4KT2A 2X8RA 4XD6A 2ZUUA 2A6LA 2WOIA 2YX0A 3AS1A 3LK6A 5CPLA 5G1YA 3DH9A 2WVVA 1EEXA 3DJGX 1WZLA 1W8SA 1X96A 2NUYA 5CQ1A 2V3GA 2XINA 4X2PA 4HK5A 1FWNA 1UWAA 3EX4A 4QE4A 2WZMA 2W67A 1AW5A 9XIMA 1KFCA 1FECA 4REQB 4C6EA 4HQVA 4XTIA 2QS8A 4QQ3A 1JCJA 1V4YA 1A53A 3HJEA 1BD0A 5DEZA 4NSBA 5FSEC 2GQWA 5D32A 3OG2A 1ZY8A 3M0HA 4DIAA 1YMYA 2GR2A 1JPMA 2Y8UA 3K1GA 3FX4A 5JBDA 3UPMA 1VFMA 1XANA 4N4QA 3MSGA 1CXKA 2IKJA 3DHDA 3T6CA 1H0IA 2UY2A 2R94A 4EQSA 3PUOA 3WK0A 1TV7A 3N25A 3VGEA 4H7VA 3CIXA 4LUSA 1TWIA 1CGUA 3VIHA 4Z2JA 6TAAA 4PEKA 3B0XA 3L2LA 3GFYA 1DJWA 1K8YA 1S2WA 1A50A 2CPUA 2GQ3A 1H7XA 3DK4A 3E2VA 3GC4A 2FFCA 3GNPA 5IXEA 2VCCA 1EQCA 1I2QA 2HTMA 4C65A 4DEFA 1F61A 4I9TA 1F3TA 4TOQA 3LS9A 2Z29A 4H6EA 4EXQA 1X7IA 5ER0A 4O28A 1XRSA 5F1VA 4H4PA 5K7JA 2A4AA 3MWAA 2OO6A 4AF0B 1TUXA 1HW6A 1O5QA 4PMNA 4LANA 3EA3A 3H4XA 3WH7A 4D1IA 1P6CA 1RH9A 1MXGA 3URAA 3K4WA 1EHAA 3TYDA 2PDCA 1G4PA 2J9YA 1EA0A 2QJGA 3QLLA 4AZ7A 3WLNA 1DXIA 2HBVA 1UCWA 1ZAIA 2ZRXA 4DUOA 2D23A 3M41A 1Q6RA 2TYSA