4KT2A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
404
structure length
384
Chain Sequence
SLKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-mannonate dehydratase
publication title Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
rcsb
source organism Chromohalobacter salexigens
molecule tags Hydrolase
total genus 150
structure length 384
sequence length 404
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2013-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4kt2A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4kt2A01
4H19A 3UJSA 4JHMA 3D47A 3GD6A 3H12A 1TKKA 4F4RA 4IL2A 1EC8A 1PDYA 2OKTA 2I5QA 1EC9A 1L8PA 4G7FA 5J04A 3CYJA 4IT1A 4DX3A 3SBFA 3CK5A 4H1ZA 3I4KA 3VFCA 3UXLA 2AKMA 1IYXA 3TOYA 2OO6A 3ZVIA 2OLAA 1YEYA 2P3ZA 3ES8A 3OZYA 2PTXA 4MMWA 3QPEA 4FP1A 3SN4A 3THUA 2OFJA 4HCDA 4ZCWA 4J3ZA 2PS2A 4DYEA 4HYRA 3TTEA 4E4FA 3IJQA 3DFHA 4Z1YA 3RCYA 3JW7A 3N4EA 4YWSA 1JPDX 4GGBA 3RGTA 3VC5A 3ZVHA 4GISA 4KWSA 3TQPA 3QLDA 3CAWA 3BJSA 4E4UA 2OZTA 1MDRA 3N4FA 3U9IA 3OP2A 3DERA 4IP4A 1W6TA 2ONEA 3EKGA 1NU5A 4GGHA 4IP5A 2QVHA 5FJRA 5IDZA 2HXUA 1SJDA 4ROPA 2AL2A 3GC2A 3T4WA 2AL1A 1BKHA 7ENLA 3UJEA 3RRAA 3S47A 2GSHA 3BSMA 4Z17A 4H2HA 4HPNA 3D46A 3MY9A 2QDEA 5BOFA 3R0UA 2OX4A 2PP3A 2HZGA 3T9PA 4GYPA 5FJOA 4KPLA 3R1ZA 4E5TA 2PTYA 3PWGA 3MUCA 2P8CA 3VCCA 1MUCA 3ZVHB 4HCHA 3IJLA 1MDLA 3DG6A 5EU9A 3PWIA 4E6MA 3EEZA 2AKZA 2HNEA 5BOEA 1WUEA 3B97A 2OZ3A 4ENLA 4GMEA 3JVAA 2XH7A 3QKEA 3DGBA 1P48A 3VC6A 3UJRA 3TJIA 1SJAA 2OG9A 2PTZA 3R0KA 2PU0A 5FJUA 2PODA 2AL2B 2GGGA 2PSNA 3FXGA 3OPSA 2CHRA 3SSZA 3DG7A 3FV9A 2GDQA 3ZLFA 4A3RA 4MGGA 2P8BA 3UJ2A 2O56A 4K8GA 4HNCA 1BQGA 3DFYA 2PP1A 2OPJA 5FJPA 2PCEA 3OZMA 2FKPA 4IHCA 3QN3A 3RITA 3CXOA 4DN1A 4GFIA 2GGHA 3ES7A 3BOXA 4G8TA 3IJIA 3UXKA 2OZ8A 1JPMA 2OQHA 3H70A 3MKCA 4DWDA 2QGYA 3T6CA 1FHVA 1KD0A 3VCNA 4HN8A 3SN0A 3RR1A 3V3WA 2POZA 2ZC8A 4J1OA 3NFUA 4IZGA 3SQSA 2QJNA 3V4BA 4EWJA 3V5FA 4GIRA 3UCDA 4M0XA 3U4FA 2PTWA 3TCSA 2XH4A 3H7VA 2ZADA 1P43A 3DESA 3P93A 3P0WA 2P88A 3NO1A 4A6GA 6ENLA 3DDMA 2P0IA 3QTPA 3VA8A 2GGEA 2QJJA 4K2SA 1KKRA 3P3BA 1EBHA 2QDDA 3N6JA 4E8GA 4JN7A 3N6HA 1MRAA 2PGEA 3KUMA 1R0MA 3K1GA 4IL0A 1KCZA 3UCCA 3OTRA 3UGVA 2OVLA 1OEPA 2DW7A 2XH0A 1SJBA 1MNSA 3GO2A 2PMQA 2DW6A 3I6TA 3R10A 3ZLHA 1FHUA 2PP0A 1EBGA 3CB3A 3R11A 1SJCA 4M6UA 2GL5A 1RVKA 4MKSA 3Q45A 2NQLA 3FVDA 3HPFA 2OQYA 3DEQA 3Q4DA 3TWAA 2PGWA 3CT2A 1XS2A 2QJMA 3DG3A 4K1WA 1WUFA 3MQTA 2MUCA 2MNRA 4ZA0A 4KEMA 3JZUA 1DTNA 3I6EA 3FYYA 3H8AA 3IK4A 3OW1A 2GGIA 3ENLA 1ONEA 5FJTA 3ZLGA 3S5SA 1E9IA 1ELSA 3T8QA 2XGZA 3FCPA 3R25A 1TZZA 4DHGA 3SN1A 2PU1A 3SJNA 3GY1A 2RDXA 3MZNA 1NELA 4X2PA 5ENLA 4A35A 2PA6A 2PPGA 3NXLA 1EC7A 4JN8A 3STPA 1PDZA 1KKOA 4HNLA 3TJ4A 1ECQA 1TE6A 2QQ6A 3TW9A 3V5CA 3VDGA 1F9CA 4FI4A 1R6WA 1XPYA 3NZGA 3TWBA 2XSXA 2XH2A 4GYPC 3PFRA 1JCTA 2GGJA 2FYMA 4H83A 3DIPA 4KT2A 4DXKA 3UJFA 3RO6A 2HXTA 4HCLA 3MWCA 1JDFA 3PK7A 3MSYA 3FJ4A
chains in the Genus database with same CATH superfamily
5DELA 4XSMA 2R94A 4O10A 4Z1DA 4JHMA 3W7MA 2OCZA 2E6AA 1Q8AA 5DRCA 1KTBA 2V5DA 1OF8A 1RD6A 3VGEA 3UF9A 1QCWA 3PG8A 3VGFA 1K4QA 3HMJG 4HN4A 3BV4A 3UBPC 3DCPA 3O3RA 1RPXA 4FX6M 2WWCA 3NGJA 1TB3A 5F2MA 2POTA 2P3ZA 3ES8A 4AXKA 3CLMA 3D3AA 4IJCA 1I6NA 2PTXA 1SZFA 3UU0A 4H4PA 3RCNA 2QGHA 4NJHA 4K8EA 2FFIA 1OYCA 3E96A 3EGJA 4A8IA 3DJGX 1XSKA 5HUOA 1XLHA 4LA1A 4RDZA 4IPNB 2Z00A 3F4VA 2QT3A 4JTIA 3GNPA 2YR1A 5CKSA 4KW2A 3B8UA 4K3ZA 3OYZA 3NVWB 3SGUA 1QOQA 2J7BA 4Z1YA 4P7NA 3AIBA 1T8XA 1DL3A 1IGWA 1R87A 2Z6IA 3HPSA 1JIBA 1FCQA 3IUDA 4Q32A 2VKZG 4OUEA 1RHCA 1VIZA 3BJSA 1XXXA 4E4UA 1BEUA 1W1ZA 5JBDA 2QUUA 2A79A 2VEIA 3B4UA 3CZLA 2XSAA 3S5NA 3WDIA 4W89A 4LQ1A 4BI6A 4FXJA 2OWWA 4DYKA 2IQTA 3GC2A 1E0XA 3BSMA 2WMJA 4O50A 3U2EA 3PNUA 4MYXA 1ONFA 4Z17A 3WUFA 4DLMA 2Z7GA 4PUEA 4QG9A 1BRLB 4NAFB 3T8LA 3R0UA 3TN5A 1I2OA 4JTQA 3WENA 4LTSA 1CWYA 3RU8X 3OO2A 4KRZA 1DJZA 1VENA 3URAA 1K70A 1ZP4A 4RXGA 3L65A 4WK9A 2WM1A 4DWSD 1ZJIA 1OZMA 4D6DA 3WQWA 3O07A 1LROA 3PVFA 3KOFA 1PX8A 3DH7A 1P48A 3W24A 3SGGA 1KNWA 3C8FA 3SGZA 2NUWA 4JBRA 4O1AA 2WM0A 3QRHA 3S1UA 3CV7A 3HG5A 2WSQA 2J88A 5A2CA 5I3HA 3AWNA 3BCDA 3W07A 3KTSA 3S1VA 3NQDA 3V35A 3SR6B 1OGSA 4MGGA 4AWEA 1WYGA 3M6YA 5B80A 1Q2RA 2P76A 2O4MA 5H8PA 1WE5A 1OG6A 3AI0A 1B30A 4POCA 4ZE4A 3K30A 3CXOA 4NVTA 1A3WA 1FFQA 1JCNA 4O0KA 3U57A 1Q6OA 2EKCA 1U33A 4G8TA 3IJIA 3MMDA 4HHPA 1J0KA 1FCVA 2ZXQA 1W3LA 4UFMA 1GJUA 2HCVA 2XM2A 1TWIA 2DDXA 1HXJA 3KAOA 2QNEA 4ICNA 3PG6A 1UWAA 4HPJA 3VCNA 2DT0A 4O14A 4F0HA 1WZKA 2Z25A 3OBAA 2H9AB 4NXKA 5AYIA 1TTQA 5HMDA 4U2YA 4J1OA 2J9XA 3SQSA 2X40A 2CKSA 2JF7A 4J5NA 4L6DA 1GK8A 4MF4A 3W1UA 5C9UA 3PZNA 1ZBVA 2WBAA 4RR4A 2OB3A 3CNYA 1P43A 1DWJM 4P8WA 3MUY1 4JQ4A 3W81A 4O13A 1GKRA 2I7GA 5FL0A 3LS9A 4PMDA 1NOUA 2GR2A 3N6JA 2HEJA 1TPH1 1P1MA 4IF2A 1EJWC 5CG0A 3ABXA 3E0VA 2XFYA 5EBUA 4HVXA 3TYZA 4JEJA 3W70A 1B4EA 2GSJA 3SB0A 3OOQA 4NAEA 2J78A 1V97A 1WDWA 1UH3A 4CU8A 1A5AA 1VBRA 4QSFA 2OT1A 2W92A 1WP6A 1E0VA 3AM9A 2X42A 3T0BA 1X97A 2DIEA 2FGZA 4EWND 5K9DA 2WBGA 4MZ1A 4FXSA 1J0JA 1IR2A 1MXGA 1VQZA 1T41A 3N73A 1GOMA 4K1WA 3OVQA 3N17A 2V69A 3GYEA 1LOSA 3CGEA 1CECA 2GR3A 8TIMA 1S7MA 4Q7NA 1S2CA 3TOPA 4GI9A 4MB4A 3MKVA 1XDIA 1DTNA 3NQ8A 2CKRA 1XWYA 3DZ1A 2GDUA 2XN0A 1T8QA 4W8AA 3FYPA 4S3FA 3WF2A 4BF7A 1K1DA 1V4YA 1NHQA 2ZZ1A 3IRSA 5IFTA 4JNYA 1JUKA 3AXXA 3RM8A 1W5OA 3S5OA 5T8GA 1RY0A 4AX6A 4NIRA 4HOZA 3PM6A 1V79A 4H4RA 2VZOA 3CUXA 1GVFA 4X22A 8CGTA 4QEEA 2HS8A 1VPYA 4BCEA 5HJLA 3N2CA 2V3AA 2X41A 3SQMA 4UR7A 2PWGA 5IHSA 2P1FA 4GJ1A 3V5CA 1R3RA 3KEHA 3WDJA 4I7WA 2C71A 4YLWA 4MUPA 2G95A 4G1KA 1O5QA 1R6WA 3L5AA 3WG6A 1Y5VA 1B9BA 3QV8A 4F40A 1NDVA 2OX1A 4GYPC 1KM6A 3TONA 3NYDA 4DWSC 4ZOHB 2YXOA 3O1NA 7REQB 2GGJA 3DIPA 4A2SA 3EUB3 1TX0A 5DMNA 1TCDA 2IQ0A 1QOPA 1BVNP 1NH6A 1XLMA 4BF5A 1JCYA 1K9TA 2DH3A 4PBFA 4H4WA 4ZODA 1RR2A 3K4WA 4JYFA 1H0IA 1Q6LA 4XD5A 4XZ9A 1BGGA 1YX1A 5ABFB 2G3JA 1OYBA 1GQIA 2GQAA 4R3UA 4BQ2A 4APNA 4B5TA 4PZVA 3S6DA 4LAOA 1GPFA 5CZSA 3P67A 4HHLA 3O6CA 4IT1A 4QAWA 4Q6JA 1GOKA 1VBUA 3B06A 1EF2A 1NHRA 3PAOA 5F4SA 1FH8A 2Y4SA 2OLAA 1YEYA 5I00A 5HXMA 1E4MM 4IGMA 4PUNA 5C7VA 3CQHA 4K38A 3FYOA 1XYLA 1J12A 1ZFJA 4UQEA 1WQ5A 5A6SA 4NZ5A 3UA4A 4YVVA 3RRXA 1AJZA 3KCLA 4M6PA 4FX9A 4KESA 4MWAB 3MI3A 4WKHA 5AHFA 3VUSA 3H2EA 5K2ZA 4L1WA 4LX4A 1R38A 3E0FA 4E4FA 2I17A 4QM1A 3GNOA 1K4HA 2VFGA 2QIIA 3LCLA 4I6VA 1W1TA 5IHRA 1BWCA 1RBLA 3VDBA 3L66A 2EJAA 1OZQA 2BY0A 6TAAA 4YTRA 4XKYA 3EA1A 5CJMA 1FDYA 4WSKA 4FX8A 4WGXA 4DM2A 5GRTA 3OGRA 2OO0A 1R5YA 3GH4A 5EGRA 4KPRA 3PPHA 1X96A 1L6WA 1BSLA 3OGVA 3LPFA 5CG7A 1ZDLA 3MY9A 2X1RA 4KCUA 5BOFA 1FXQA 2BWGA 3MYOA 4NZCA 2OX4A 1MQRA 1LLWA 2WVSA 5FJOA 4CCCA 4L4OA 1Z69A 4PMJA 4YIWA 3PG9A 1QWKA 4AU0A 3DFNA 4AZGA 1VFLA 2JKAA 3T09A 2ESCA 3AXKA 3UNDA 5HUPA 4OE7A 4O15A 3QPYA 1UZ4A 4GZ7A 1LWJA 4S3JA 1XUZA 1UG6A 4GY1A 1BF6A 2HNEA 2QJIA 3NPWA 3UCQA 2CEQA 2PWEA 2XH7A 3NA8A 1ADOA 1YBQA 2E7FA 6REQA 5AN7A 1Q66A 5FA5A 2WNWA 1R46A 4ES4A 3CC1A 1C8XA 4UC5A 1UHVA 3QW4B 4Y8FA 1VJZA 5EBKA 4HPXA 3FXGA 2Y24A 5KETA 1JDAA 2YYTA 4QJ3B 3URBA 3S0CA 1MI3A 2WYSA 4Q8WA 1FY6A 4QROA 5E9AA 4IMAA 1XLGA 1F76A 3TUUA 3DK4A 2I5GA 2O56A 3GKFA 4C1NB 4P7RA 5AZ1A 4Q4PA 4DBDA 2PP1A 3OJGA 2WCAA 3A4XA 4YTQA 2CXEA 4H9UA 1E70M 3GFZA 2G96A 3LCGA 2V3BA 1MZRA 1A4MA 4IHCA 2PDBA 4M81A 3OC4A 2A0NA 2GGHA 3PTDA 4EMIA 2VVSA 2EG7A 5CSSA 3TZNA 2P53A 5FEZA 3LRKA 3WK2A 4C6KA 3PBVA 1EEXA 2PLMA 2GQWA 3H55A 3DFSA 2Y5SA 4MLJA 1HJQA 3TH6A 2FH8A 1JCMP 4AF0B 2CHOA 4ZVJA 3ARXA 2Y7EA 1WOBA 4JNMA 4JR5A 3W83A 2EHHA 4DYJA 3ME3A 4K8DA 3HRDC 3W7NA 2ZOXA 1EGZA 1PX4A 3BV7A 4GUHA 3XIMA 4M80A 3S5ZA 2HV5A 3B0UX 4YS1A 3UR7A 1TV3A 2P0IA 3PULA 5D9MA 3FA3A 3OIHA 1VLWA 3OODA 2GGEA 3H2MA 3GR7A 1P0BA 3CU2A 3NO3A 4ERGA 1M7JA 2PDWA 1QHPA 2WPFA 4IL0A 3N13A 1V6WA 4PE8A 3EOSA 2GSEA 4GI4A 7TAAA 3LBCA 2HRWA 4PFHA 1MWOA 5IDIA 5BXPA 5DY2A 2XGIA 3KRZA 2WPGA 2XVNA 3VM7A 3HV9A 1TZ9A 4ROQA 1K7XA 2IKJA 4TUFA 2WJZA 3AIEA 4AC1X 3LEPA 5HK4A 1W9PA 3WYZA 3T42A 3MSRA 2G5WA 4CU7A 4QTGA 2NT0A 4FHAA 3KBVA 3VNLA 4LBSA 4YMZA 3TN6A 1QI4A 1YNYA 7CGTA 3E1F1 5ABHA 2A4AA 5C6MA 1QU4A 4WZHA 4CU6A 3ZFHA 3H8AA 2YB1A 1SFTA 1C7TA 5FF0A 4GVHA 3VIMA 4E8CA 1RCOB 4GKTA 1OX6A 2XGZA 3FCPA 2X99A 2ZZ2A 4PMQA 4PUMA 2PURA 5CSRA 5H1WA 1UA3A 3EX1A 3SCRA 2UV8G 2PPGA 1MUMA 3NPUA 1M04A 3MC5A 1EC7A 3M0HA 3PBWA 4C6JA 4Q8TA 5DANA 3VZZA 4RZ4A 4RZ5A 5JRBA 1X6NA 1PDZA 1P7TA 5HQLA 1LRNA 1OGBA 1NP0A 4DI8A 2QF8A 1PHQA 2RGMA 3VGHA 1GEHA 2NVKX 1C3FA 1XIEA 2G8ZA 1NOFA 2AOSA 3IGXA 3AIWA 4IPJA 2PDCA 1K77A 2ZICA 5DBTA 4C5YA 3AWOA 3VMPA 4X9SA 2BOGX 2ISDA 5CZ0A 1RVGA 3UNTA 1JD7A 1V6YA 2DVXA 3ID7A 2GVLA 2O0TA 4PTDA 2QCLA 2WB5A 4FK9A 3HURA 3PPGA 4PBEA 3DHPA 4BKNA 5LNVA 5FMHA 4JQ3A 1ZLPA 3M44A 2RABA 1PWLA 1I2PA 3M0XA 5LZLA 2XSBA 3DHDA 2QCDB 3VGBA 3WLKX 5IFPA 2FLIA 4E2DA 3R5EA 1OBAA 4FDCB 1Y5XA 3LTPA 4BY3A 2CETA 1EC9A 1Z41A 2Z1SA 1A0DA 2CC0A 2FHBA 4XVEA 2E40A 3TA9A 1EA9C 1W3JA 4W7UA 4H50A 1YQ2A 5EBAA 3UXLA 3WQPA 3HGJA 2RKXA 4HK5A 2BC1A 3QPEA 4BS0A 3G3DA 4H9VA 2PF8A 3GLCA 2L5HA 3FHQA 1GVOA 1OT2A 1HJWA 4MB3A 4XIAA 3UPWA 1XIDA 1IIGA 2X1TA 4ZBCA 5HPCA 4K6AA 3UQNA 3L0GA 2PWHA 3HIJA 1EJSC 3IJQA 4WDTA 1GRBA 1EUAA 4LW7A 2CERA 1LBMA 4UTKA 3OZOA 1D8CA 4CN6A 5M03A 2H90A 4J3TA 4CNNA 2DIKA 5BYWA 3RCMA 2WP6A 4HBKA 5BU9A 3WQDA 4Z2HA 1V59A 1X39A 4JFTA 2ONEA 4HYVA 4TU1A 3MJMA 2CLMA 1PTAA 4QIUA 4Y6GA 4D2JA 1QPQA 3C0LA 1Q4WA 2GR0A 2IKGA 3FIGA 3KDNA 3HFTA 2PLCA 3QR3A 5REQA 4MUZA 4AHQA 1E72M 2D0GA 3U4AA 4H7CA 2Y85A 1JGIA 3T2PA 2E5BA 4U5IA 4NX5A 3AU2A 3S9YA 3NL3A 3KP1A 2Q71A 4J4KA 4X63A 4GNKB 3RMEA 1QOXA 1D3GA 1UROA 4LRTA 4JTFA 4NXSA 3EXTA 3ARUA 5CGMA 3B8SA 1W54A 3P6LA 1MQPA 3LENA 4AFYA 2ZX7A 1A49A 1KM5A 1FWNA 1Q8JA 1NSJA 3G1FA 2OG9A 2NSOA 3LV6A 5EFFA 5AC5A 3N25A 1WDRA 3DXIA 5BRQA 1J5SA 4M56A 3CH0A 4DVOA 5D09A 4JEQA 1JFXA 2QR6A 4YXGA 1YW1A 1KV8A 3GSMA 2E5DA 3MO4A 2RHGA 1FWTA 2Y62A 4EOUA 4DI9A 4QITA 2EEXA 3M5VA 1WCGA 1AH3A 3NSNA 3W1NA 1UD3A 4O12A 4FXRA 4NEVA 4PL1A 1US2A 3KLJA 3W1MA 1DOSA 3HN3A 3QN3A 9XIAA 4B16A 1NPXA 3LXDA 3QV6A 4NT0A 4ZB2A 3ZZ1A 1FWGC 5CZTA 3L5OA 1H60A 3HMCA 1S5TA 5CC6A 1PIFA 2H8XA 3H70A 3ALFA 2INEA 1H1NA 2XIJA 1AW2A 2IPGA 3KVKA 4XD3A 4YWOA 1HKWA 3GVQA 3ZS4A 2VR4A 1PL9A 2VEFA 2ACUA 5MKGB 5G1MA 1PX3A 2PDLA 1M7PA 3RDKA 5DT7A 1TPWA 2GRTA 3B4YA 1EGVA 1O7AA 1IE7C 4L1XA 4KQNA 5AHLA 5BZAA 1TELA 4L9XA 4HA3A 1U1JA 1OADA 3DKJA 1A3HA 4B5VA 1JZ5A 2YFOA 3DK9A 3W6LA 3HJEA 3P93A 3B3DA 1QW8A 2C1HA 1VR6A 3APGA 4PUKA 5CJNA 1W3IA 3TZFA 3HG4A 2F8QA 4REQA 2WPBA 3AQUA 2E3TA 2ZE3A 1XBVA 1N55A 5M1TA 4UFHA 4RL3A 2HVOA 3LM7A 4FLOA 3UGVA 4F0KA 4V1YA 3NDYA 2DW6A 1XKJA 4O8RA 1V08A 3FDKA 1JNEA 3LN3A 3USBA 2VFFA 3I6TA 3MYPA 3QEZA 2C0HA 1Z48A 1AVAA 3A4WA 3A22A 3G0XA 1D2KA 2B31A 1TPDA 1YTDA 4QGCA 3CV6A 2WVVA 4ORIA 2GL5A 2W66A 2VGGA 3NM1A 3AXIA 2IPWA 2XWEA 2OLSA 1PCKA 3NVYB 4LAKA 2PGWA 3POCA 1Y0EA 1R3YA 4J57A 1E6NA 3CASA 4K39A 1XH2A 4JIIX 3D6NA 2CFFA 1ICQA 3A47A 2MNRA 4LUTB 1GG0A 1ZAJA 3JZUA 4IPIA 2WJFA 1E5JA 4FR1A 4D6GA 4K1GA 1QWGA 5U25A 3CUFA 3WQCA 3GBDA 3B0PA 1IXNA 1Q3NA 1TYGA 4PB4A 3WLHA 3ZT7A 2DZXA 3BOLA 4HP5A 3EYPA 2OSWA 4C6NA 2JKEA 4L65A 3SJNA 4UCGA 1WKEA 3BW2A 2YPIA 2WCGA 4GIAA 4H4TA 1N7KA 5LNRA 3NL6A 3MJYA 3URNA 1U5JA 3NZQA 1TVLA 3TMLA 1KXTA 5AY7A 1CXHA 3DGRA 2EPHA 2RH9A 3AO0A 4MNKA 2WMKA 1E1CA 4RDYA 4NEWA 2J9ZA 3KS6A 3FAWA 2Y8KA 4NJJA 4AY1A 4DO5A 3VGDA 1GUVA 1KRCC 1VBHA 2C16A 1X8CA 4EQXA 4JZ5A 1XYAA 4OOZA 1UP0A 4Q22A 5T9CE 1XPYA 3SUVA 1WA3A 1KBKA 4EPBC 2QDGA 1ZGDA 3WUGA 3O06A 4LVDA 1RPKA 3EDKA 3L4TA 2UBPC 3P62A 1K8YA 3ZJ7A 1LQ2A 2ALDA 1H5YA 3WUEA 1F3TA 4O52A 1ZU8A 4O4VA 5D30A 1E5NA 4D6CA 1JDFA 5A2AA 3DBPA 1QASA 1VF8A 3PJUA 1VFUA 4O1DA 5CSUA 1E55A 2G37A 2XU2A 1E3ZA 3WD3A 5I3IA 2V3DA 3CZ8A 1W91A 3IANA 2A7NA 4DX3A 5C0QA 1TTJA 3W37A 4V33A 4DUXA 4K36A 1TQXA 2V67A 3OZYA 2A6NA 5C71A 3GIPA 1GREA 3L5MA 2CNCA 2XJ7A 3PS7A 3GTXA 1UCWA 1TJ0A 4WEVX 3IJ6A 5HJYA 1WDQA 4DYEA 2CITA 4NZJA 3VGGA 1XINA 2VURA 4DY1A 4TQTA 3JW7A 5DY3A 3NEHA 4G7EA 3EWZA 4IIFA 4WY0B 5GQBA 1US0A 2G3FA 2PDIA 3PB2A 3B8TA 1ZBCA 1DNCA 3M0LA 3TYUA 4Q8UA 2W61A 3PWAA 5AKQA 5CLWA 2WJDA 3CHVA 3AS2A 4H01A 4X61A 3RLHA 4GBDA 4JPGA 4Z2GA 3RNDA 3KOWA 5IDZA 3IV8A 4EPKA 1LBLA 1AD1A 3BUVA 3BLFA 4HJFA 1OD8A 1MXDA 1CGUA 2JGYA 4XKMA 3IIPA 4DRSA 2J8FA 5G5GB 2YXGA 2BFGA 1ODZA 3BZGA 4NZ3A 2QHAA 4ONVA 1FWFC 3U7BA 4JXCA 4R34A 3MKKA 3RM9A 1S3TC 2VVNA 3WUBA 3WSUA 1CCWB 3V18A 3VOJA 1V3HA 1G67A 3BVJA 3E2RA 2J25A 3GG7A 3IJLA 1E51A 2QIWA 3QHNA 3DG6A 4MWAE 3G18A 3QYQA 4A4AA 5XIAA 2ZUSA 1LLOA 4ZENA 5BROA 4YU1A 4QX4A 4CNUA 2FVLA 3QW3A 4PCPA 1IHIA 1YQZA 2VC6A 3I7SA 2INFA 3U5UA 2DUXA 4AIBA 3CL6A 4C6DA 4FNSA 2ZCGA 3REQB 1C90A 3W84A 1TMLA 3RG6A 5G1TA 2P8BA 4BURA 2W54A 4M3PA 1R3QA 3TW6A 3DFYA 4HOXA 3ITTA 1SM9A 4CN1A 2WC4A 3DYMA 2VMFA 4XAYA 1CXKA 2XUCA 2YSWA 3QGAC 5KVHA 1R3TA 5I06A 1GONA 3CS2A 3H2FA 3S2NA 5E1QA 3SIZA 4OT7A 4J27A 5JMUA 1UP2A 4GYJA 4PUJA 3R89A 2V5JA 1AODA 4WXZA 3WFAA 5I3DA 5HWNA 1MZHA 4PYSA 3IGHX 4JTHA 3SFKA 2ZUUA 4S2BA 3H7RA 3ONBA 4HN8A 2J6XA 3WBXA 3AIRA 1UKQA 3GM8A 3V4BA 1EDQA 3VNIA 5AVNA 2Z29A 3QY7A 2EPNA 3TCSA 3ARVA 4WOQA 1LCOA 4PEEA 4TVDA 3S42A 4Q8PA 3KRSA 4S2CA 5CBIA 6ENLA 3C2OA 3CHEA 3NPVA 3QTPA 4M6QA 3NQ2A 1IGSA 1UP3A 3CGCA 2QJJA 3TAKA 3P3BA 2QDDA 2G41A 3W9ZA 2FGLA 1B2YA 3LHYA 3HQOA 3GFXA 1EOMA 3RR4A 4TV6A 7ODCA 3KUMA 3VNYA 4FIQA 1NHSA 1OHLA 4P8UA 2YLAA 3L23A 5EB8A 4GZJA 5I7GA 3W1QA 1EA0A 5ER0A 3LCFA 4HK7A 4IUGA 1CB2A 3MHGA 4N4QA 5A6MA 3TJLA 1EBGA 5XIMA 1OX5A 3V0TA 4GX8A 3ERPA 1JYVA 2NVAA 1QW7A 5F1VA 2HE5A 4LXFA 3MDWA 4DUVA 1X2GA 2A5HA 5I02A 4WIWA 5D2VA 3CPRA 2D20A 3CT2A 1DWHM 2DVTA 4O8AA 3EDEA 1WUFA 1D8WA 1NQ6A 3UG4A 2Z0IA 1DE5A 3W1XA 5D38A 1NWUA 4I9TA 3GVVA 3IIVA 2Y7GA 3GB6A 3RPMA 4LS0A 5FS7A 1NWTA 3KHJA 1EP2A 3W7QA 4MY1A 3VZYA 2H3DA 1ELSA 5FSDC 4M19A 1VHNA 3VKKA 1TZZA 1XH1A 3HPAA 1GV4A 3WJZA 4X3ZA 3W1LA 1U1UA 5LNSA 3VNJA 2I5IA 4OWGA 1NF0A 3NQMA 1VCGA 4HKPA 1YTEA 3EX3A 3E5PA 1JPHA 3KS5A 4NZFA 4D6IA 4XWUA 3WEMA 4L4LA 1ZENA 1S5VA 2ZX9A 1FIQB 4AUBA 4JDYA 1Q6QA 5KZDA 1DIDA 1A4LA 1HUVA 4LS1A 2RDWA 4ACYA 4B5XA 3AUJA 4MKNA 2JIEA 4WR3A 1OD0A 3KTXA 3C6CA 4MB1A 1JDCA 2A3LA 1SO5A 1N8IA 3C2FA 2X05A 4Y96A 1VEMA 2YA2A 4PTNA 4CD5A 3LXBA 1YHTA 3WMCA 2V5KA 1SZGA 1CT5A 1I2RA 2IPJA 3TNOA 3CO4A 3HG3A 1GOIA 4KEUA 1TWSA 1DJQA 1DXLA 1T40A 1B57A 2WOQA 4H1ZA 3WJXA 1PYFA 1XLBA 4XISA 3A21A 3P0XA 1TWZA 3G1XA 2XWDA 4AVNA 2VD8A 4F0RA 4KMQA 1I2NA 1E6SM 1HO1A 2V6OA 3EX2A 2TYSA 5PTDA 4J3WA 5DFAA 4HNOA 1NWSA 3M0VA 1BYCA 1K8XA 3WKZA 2VEMA 4GINA 3UZJA 4XBSA 2PDMA 1XSIA 3LU2A 3M07A 4W88A 2F6UA 3F2DA 1O66A 4GISA 1JUEA 1EUNA 4AW7A 4JY9A 2OZTA 1V0KA 3GHUA 4GC4A 4KWOA 4MY8A 2R82A 3GRTA 1E1FA 1SJDA 3WD4A 3UXDA 1UPPA 2J7EA 3RRAA 3S47A 7XIMA 3ARTA 4MFDA 2DSUA 2GVGA 1MYRA 3A23A 2QDEA 3BQ5A 3P61A 1I1WA 1PB0A 3O7UA 3QSTA 1EDTA 5D2WA 5T91A 4UTFA 2X30A 3GXIA 1SU5A 1UC5A 1PS9A 4ZQPA 1RJPA 2ALRA 3ZSTA 1BVZA 2XISA 2PTYA 2HROA 2NV1A 3TTQA 2E5AA 2QPUA 4C91A 4QE5A 5E70A 4XBJA 2QPSA 3VDAA 2EPKX 1PJ9A 1VRDA 1GORA 1JXKA 1LRQA 2TPRA 3QOKA 1GQKA 1XLLA 2C8NA 5LXXA 2DT3A 2AKZA 3B9JB 1XBXA 1GZ1A 2HWGA 5CPQA 2X50A 3CGDA 3I6RA 3ZYZA 2Q02A 3VDHA 1JF5A 4JTCA 3BWWA 3FY1A 3KVLA 3WDRA 1ZJAA 4GG9A 4LY4A 1XIBA 3KCOA 4J3XA 4HTYA 4HSOA 3GRIA 2HBXA 3LK6A 2EQ8A 3LMZA 4ZB0A 4ZGYA 1K7FA 4PR4A 2GDQA 3QGVA 4ASTA 1KFKA 4M5PA 5LXEA 2CLOA 3C3UA 4DWSB 2J7DA 3OG2A 3Q6JA 1MO0A 1UWQA 3U6WA 2XIOA 1GVYA 1UJQA 2PDPA 1I9CB 1VZWA 1ZXIC 5HMFA 4H7ZA 2O7QA 1UZ1A 5IBXC 3SW6A 2DV0A 3L2LA 3W74A 4DN1A 1GNXA 3S83A 3ZR6A 1FEAA 2AAQA 1HVQA 1UB3A 3MMWA 1AOGA 4OTKA 2ODOA 3VKCA 5C2GA 4WF7A 1P6BA 4WX2A 1BYAA 3VD3A 4W5ZA 3ARSA 3ZJ6A 3W87A 3N9SA 1ITXA 3RR1A 4CCZA 3AAMA 1SYTA 3NFUA 4IZGA 3GDRA 5K7JA 4MPQA 3PJTA 1XGEA 1VJIA 2NQZA 4O0ZA 1Z8AA 2DH2A 3DKLA 1OM0A 3IVTA 3RYSA 4Y8EA 4HB7A 3GR4A 4LYQA 2P88A 4A6GA 3AFBA 2NUYA 1FWBC 2GDVA 4MAVA 3FN9A 4A22A 1GTHA 2Q8LA 3GXDA 4XVDA 4AZBA 2J77A 3PZMA 4XZIA 1F05A 5F2GA 1P0KA 1Y8BA 2QDHA 3CHDA 1DJWA 1G4PA 5H2ZA 1R0MA 1O94A 2ZIDA 3M46A 4IJRA 2GQ3A 5FEWA 4F2UA 3ARYA 2CFYA 2REQA 3JU2A 2TSYA 5A6JA 1QPNA 1H5VA 3DK8A 2VFIA 2X2YA 2J74A 2ZZ6A 1SW3A 3S2JA 1JF6A 1G4SA 2CZFA 3KP0A 1FHUA 3LXAA 4DF0A 3WNOA 3AHZA 1UD2A 2EQ9A 1CZ1A 4M29A 4JKKA 1XCXA 3YPIA 2CLPA 3UVAA 3GTIA 1XF0A 4WDXA 1CNVA 4CQDA 3NJ3A 3QR1A 4JQ9A 1IEQA 1ZSXA 5FIPA 3H7UA 4UNKA 1E3XA 2CWXA 2CBUA 1DWIM 2WZTA 2I14A 3C2EA 4LEQA 4ZA0A 3W2JA 2ON3A 2PRMA 2A7PA 4H6EA 1IQ8A 3GNRA 3B8VA 3NUKA 1QK2A 1Q1WA 4XB3A 4IJBA 4V15A 4YJ5A 4LUIA 2AQWA 4ZL1A 1YNQA 3CUJA 1GYNA 1A5MC 4QG6A 1HIZA 2J24A 1KCLA 3HO8A 2C3ZA 1M41A 2CPUA 5KSWA 4A35A 1KFBA 2PA6A 1FWHC 4Q8MA 4D71A 3DU0A 2VR2A 4JD4A 4FS9A 4C6OA 1ZKQA 2EKGA 1RA0A 1ML1A 4I5RA 4GD0A 4GY7A 1TE6A 3TMQA 4US5A 5E0CA 3K46A 4NNAA 1KWGA 3M5XA 3ABQA 2WZMA 1Y5WA 4WXYA 1V3KA 3HU7A 2NXGA 2OKOA 4Q33A 1V3IA 4O17A 3TWBA 1XIHA 3CXBA 3ARQA 4D6FA 1DJXA 5A2BA 5FF2A 1GRGA 4PTXA 4WSHA 2IXUA 1XIIA 3W28A 1V3MA 3QMTA 4OKDA 3NPXA 3IJDA 4L6HA 4N0RA 2HBVA 1ZS2A 3T2QA 2G50A 2PDGA 2VOMA 4QRNA 1ZALA 3KOYA 3UJSA 4TMCA 3HA1A 3CIWA 4C1LA 4IMGA 3BJFA 4RZBA 3PB0A 3R0DA 2A8XA 3MMUA 4F4RA 1IIHA 4U4MA 4ERAA 4UFIA 3WNPA 3LGGA 3UG5A 3WQVA 3A7RA 2TPSA 3DH9A 3G6LA 2OO6A 4GWEA 3UESA 5C8BB 4S3CA 2GK1B 1K8ZA 4LBRA 2WKLA 4FP1A 5JH1A 2CLIA 3C2VA 3QPZA 1EB3A 5DCDA 1PO9A 1ZAIA 1NDZA 3E74A 1GOOA 4JCLA 3ABOA 3PY2A 2D3NA 4HYRA 4E2VA 4TTGA 3KVJA 1V0NA 2R9RA 2BY1A 4CQAA 4LYRA 2E8YA 2ZVIA 3QZAA 3IAQA 1R3VA 3ORWA 1SO6A 1X6LA 4I90A 1X1NA 2FQIA 3N4EA 1JPDX 3M4HA 1ISXA 1V8EA 2TAAA 1HGYA 2PDNA 4LOCA 4L4MA 1AW1A 1FTXA 1JZ7A 3XINA 3CM4A 3C5QA 3GC4A 4U31A 1EJVC 3M0IA 4S23A 4AXNA 4UIOA 1DWAM 1F3WA 1EYEA 3AXHA 3LM3A 4U2ZA 3ARZA 2YBTA 4ROPA 1H1YA 1C29A 1KBIA 3QV7A 1LDCA 3M64A 3PUDA 3HPZA 4AWSA 2CYGA 3LD5A 1FDJA 2VJXA 1Z42A 1CPUA 1M53A 1JAEA 3ZQ9A 2WHLA 4TVWA 3KBNA 4E2OA 1HJUA 1NHPA 4ZE5A 1QDSA 2PLJA 4GABA 4LVFA 2IMRA 4LUYA 2WHJA 4Z1AA 3GG1A 5K9XA 3KBSA 4ZZ9A 4WDWA 3RJXA 5HANA 3V1HA 3GNDA 5K9CA 4PSPA 2X7WA 5BOEA 4J9JA 4XK2A 4G1NA 3IGUA 3JVAA 3VC6A 2YW3A 1SJAA 2QMKA 4DUOA 2C3CA 1ZJBA 1QBAA 1NWRA 3V0UA 2HVMA 3IUIA 3ICJA 3QFEA 4ATWA 4UR8A 1NDYA 1XLKA 4H9XA 1IZCA 3R43A 4GC3A 3SR7A 1ZPTA 1V93A 1N2VA 4J2PA 2C14A 1YKWA 3KLLA 5K4ZA 1W32A 1JCXA 5A3HA 3GC5A 1JCLA 5B7ZA 2ZX8A 1SMDA 3I7RA 3AIQA 3RITA 2X2GA 2KAUC 1EP3A 2WSKA 3LTSA 5J5RA 5BU6A 4QE4A 4N6EA 2YXXA 3WK1A 2XYLA 2HDJA 3QZ6A 2V5BA 4KCVA 5FOOA 1E4NA 2PDFA 1KD0A 3C8NA 4F3HA 3UZWA 2DZSA 2ZA1A 4UMBA 2CLEA 3R13A 1JQVA 1E71M 1XR2A 1P0DA 2WLYA 4Z0JA 1JULA 3NQ6A 2Y70A 5LSMA 4F0SA 4S3EA 5JVLA 4JTEA 3MHFA 3P14A 3AALA 4TTUA 2BVYA 3CWHA 3F4CA 1B31A 4MVAA 4QDMA 1PKLA 3BAWA 3F03K 3SY1A 3B9AA 3WF3A 1J79A 4OHQA 4B4HA 1KM3A 3NNTA 3B9NA 5JIWA 4P7QA 1W9VA 1A5UA 2YOCA 4DELA 1WO2A 3GXMA 5G2HA 2WLZA 1MUWA 2WBKA 2NWRA 3NQVA 3BAKA 5BWAA 1QJWA 1HW6A 1UD8A 4N2YA 4U3AA 1IEVA 5I3JA 5JU6A 5D02A 1V3JA 5ABTA 5BRPA 5FJIA 1B3VA 1KCXA 3AMDA 5CPTA 3KOXA 2QAPA 4L4PA 4LBUA 1G1YA 1EL3A 1TTIA 1NARA 3NVVB 2XVGA 1GOQA 2QJHA 2WKJA 1RUSA 2YCIX 1QMLA 1V6XA 4Q4RA 3DEQA 3W7DA 3H6OA 3TSDA 1O6IA 3BLKA 3SI9A 1QBBA 2W91A 2YQUA 3PTQA 4R33A 4CQCA 5FKYA 4JS3A 3GH5A 1DHPA 1GTEA 3BO9A 1WKDA 1OCJA 1K6WA 4KBXA 3IS4A 1PCWA 4IFOA 4WGHA 5CXPA 1OFPA 2QAFA 2Z1WA 4NAEB 5CPMA 1I0BA 3EOUA 3BG5A 1YDYA 1K9DA 4DHGA 5DXYA 1H41A 4FLQA 1W5MA 4O16A 2WCSA 3HW2A 2ZRXA 3CWNA 2FMNA 1DHKA 3AIVA 3AYSA 1SO4A 4XZNX 1PVNA 4C6IA 3WLOA 4LFYA 2WXDM 2DZTA 4KIEA 4PRWA 3E49A 1C9DA 4R9OA 1MQQA 3NG3A 4HA4A 5D9NA 1B3ZA 5AYXA 2YJQA 1B54A 2QQ6A 1XUUA 4F2BA 1ME8A 4CCDA 2X1UA 2EPMX 1XISA 5LKYA 4FI4A 1E6RA 3U3HA 2FB2A 3T0AA 1A5BA 5BRBA 5CH9A 2AMGA 2XSXA 2R91A 4US5D 4ZQRA 3PFRA 3DGHA 3BJTA 4LYPA 2VGBA 1V0MA 2EPLX 1MEWA 3CV2A 4GK8A 1EXPA 4QXIA 5B7YA 2XFWA 4CNPA 4YHEA 1BTCA 3A12A 1DXFA 1F8WA 4H19A 3W2KA 2Z2UA 4B3KA 4BFAA 4GJJA 3H12A 1S2TA 4PMUA 1C91A 3QFAA 4L9YA 4XSLA 5HR6A 1PDYA 5RUBA 3KBMA 3AHVA 3QMRA 4H9TA 4M82A 4H3DA 3SJ3A 3SBFA 1QPRA 3GDMA 8RUCA 1ZAHA 3L4WA 4NF7A 5IRPA 1UUOA 1PYMA 3WLTA 2FHFA 3GBEA 1WPCA 2DUZA 2FTYA 1FH9A 4DO7A 3HQPA 2YL5A 1GVQA 2OFJA 1V02E 5LIWX 2BY3A 1KFEA 3DJJA 3FFSA 1K02A 2E5CA 2ZWZA 4C6FA 1XLEA 2TRSA 4QBXA 3CJPA 4LB3A 1ISZA 1C92A 4ZB5A 2OXNA 4UTMA 4R7WA 1FXPA 2PB1A 2ABBA 1DJYA 4GVFA 4ECLA 2ZRUA 5HQEA 1AMKA 4H8VA 1XLDA 4QE1A 2JK6A 4U10A 1F8MA 2VR5A 2EGZA 2PE4A 3VKDA 4GNJA 2H8ZA 4UTIA 4AH7A 1U5VA 4GLEA 3PBYA 1H4PA 3DERA 3G77A 1GSNA 1E9YB 2QVHA 2XFRA 4Q8QA 3ITYA 4Q7IA 3VABA 1BVWA 1VJSA 1JRBA 3FEMA 4BQ4A 2JKPA 1FP8A 1HQTA 2AQVA 3DUGA 1FWIC 5CZJA 3Q2DA 1J0YA 3N04A 4ICMA 2O9PA 4EVZA 4Z1BA 1WZAA 3MT1A 2JE8A 2ZZ0A 2PUZA 3QTGA 5AC7A 9CGTA 1EP1A 2PTDA 4DXXA 3O6YX 1JI2A 1S1RA 3ALGA 3VX1A 4OFCA 4H8NA 1V6VA 4XKYB 5I78A 1MDLA 1KBBA 1XC4A 3VMNA 4CD7A 1Y7VA 3GTHA 3OLGA 3OVRA 1L6FA 1THFD 3DYOA 3G1VA 3T07A 1UD5A 4I3GA 2ICSA 2OR2A 1D3HA 1UWSA 3DENA 1PV8A 4JQ1A 1FHLA 4JTSA 3OPSA 3PSWA 1BG4A 2IW0A 4Q3MA 3LYEA 1UKSA 3CLWA 4F9DA 4MOZA 1VIWA 2ZZ4A 3VIKA 1G0CA 1RP9A 3ITLA 2GOKA 5F2IA 3W7EA 2DT2A 2YGYA 1WKFA 3SQPA 3OA3A 2PCEA 1IR1A 3L0NA 5CSYA 1Q85A 3SY5A 4XAZA 2PFHA 4JTAA 4D9PA 1P0EA 2AAMA 3GDTA 5EYWA 3WX7A 3T05A 1I4NA 3ES7A 4B9YA 3WJYA 1FRBA 1L6GA 2Y5EA 3CTLA 2E77A 2VZTA 4UOZA 5HBFA 3THDA 4GI8A 3K4AA 1YBQB 5HJXA 6REQB 2VM8A 2QGYA 4FIRA 2E28A 1FBAA 4BK9A 3MU7A 1YDOA 4IWWA 3E0LA 5E5CA 2ZX6A 4GQQA 4I6KA 3U2ZA 1QI3A 3C4UA 3NDZA 4N02A 3EZ4A 4EF8A 4AD2A 4DPQA 3BXWA 2ZADA 1JL8A 2GJLA 4M6VA 3BE7A 2F7FA 4UZSA 1JNDA 2JK2A 3LZ3A 5D2XA 1J96A 4IGHA 1I60A 4S3DA 1KKRA 2GYIA 1TR1A 1B3WA 5DF0A 3V5OA 1JUBA 3LRLA 4GXWA 3B03A 4HZ8A 1TVPA 2DJLA 1RK5A 3S2CA 4FO4A 1PHWA 4AHPA 4PMYA 1OX4A 3UR8A 3UCCA 1ONXA 1DXEA 3OTRA 1E15A 1OEPA 4TVCA 2JEPA 3MHUA 1W1IE 4AEOA 2FFCA 1POKA 6ALDA 6XIMA 3H54A 3NCOA 3POHA 5A6TC 2WV8A 6PTDA 4MKVA 4JQAA 3UWUA 2RFGA 4O19A 3V75A 4DJDA 3Q45A 4BEUA 4F9JA 3AS1A 4HMCA 1YDVA 2DQWA 1HX0A 5EMLA 2YVFA 3FX4A 2DJXA 3DYPA 5FF4A 2R9ZA 5D03A 4H4UA 3UPBA 5E0FA 5F1UA 2V9DA 1OT1A 3CEUA 3M0KA 1F07A 2NV9A 3VIIA 2E6DA 4BJHA 2J4GA 4HMEA 4JFUA 3ZJ8A 1W17A 1OY0A 3BL3A 5A8OA 1OFOA 3E6EA 1J11A 3L4YA 1K9EA 1ZMDA 2FZ8A 1UBSA 4BWLA 3WZ0E 2IPFA 3G0UA 4QJ5B 1R2TA 3M0ZA 2C79A 3FSTA 5LNUA 3NZRA 1P1XA 3T8QA 4PMZA 3WLRA 3ZR5A 4IMEA 2Y7DA 3WJWA 5EL1A 5D4YA 2WNZA 1HJSA 3ECQA 4PB5A 2OMAA 1C8QA 1QI2A 3WNKA 4FLRA 3TC3A 1EEPA 1ISWA 2QKFA 3RN6A 3NQ7A 3UZXA 1G7VA 3EF6A 4GQRA 5D37A 3KTCA 3A5VA 3CIXA 5CC5A 3WK3A 2PZNA 3SRDA 3SCOA 1EJTC 2HVNA 4KFPA 3LB0A 3WBWA 2V82A 4LC8A 2PLKA 2WMFA 1IF2A 1N8WA 4I7VA 2FYMA 2W27A 3EPOA 3VKBA 3QOMA 1VGAA 3M5YA 2RJGA 4P61A 5BMWA 4QJ4B 1I8JA 2GJNA 1VQTA 2B81A 1XYMA 3AS0A 3GIQA 3TK7A 1J18A 1A3XA 2XIQA 2UY2A 1FX6A 2WQPA 1VAHA 1P7TB 3FJLA 4DM1A 3SM0A 4R53A 1F74A 1S5NA 4CCEA 2V6AA 3CL7A 3IEBA 1B1YA 3QHMA 1XRVA 4H41A 2FPVA 1W9XA 2H3BA 3VPLA 1JG9A 2J8GA 4LB4A 3VFCA 3RILA 1N5XA 1LWIA 2AKMA 1TREA 4MMWA 1DWGM 4PB3A 1F7BA 3E02A 3BPWA 1KO0A 2KX9A 2AMXA 3WH8A 4C60A 1QHOA 3W1TA 4V1XA 2J27A 4CGTA 2B4GA 4C6MA 4INFA 4RKAA 4PTMA 3MVIA 3W25A 3E0WA 2FJKA 4DBWA 1FKXA 3B40A 2YCJA 8XIMA 1TPFA 3M0YA 3RGTA 3OB8A 2VCCA 1T3QC 4LT9A 4YYCA 3CYVA 3ZVHA 4AD1A 3TQPA 1W5PA 1NOWA 1XLCA 2CCRA 4OV9A 4JX5A 1HL8A 1QO2A 2E6FA 4I9JA 3BSGA 2FIQA 3OP2A 1LTDA 3VNDA 3G8RA 1ZCCA 4ZQNA 2J13A 1YLVA 1Z7AA 3WF0A 1LRTA 2EBNA 4F79A 1NTHA 1V77A 2W3RA 1OFDA 3D5HA 4YTSA 2CZ5A 2AL1A 3RFAA 4GVGA 3PZUA 2E0PA 2RJHA 4YTUA 4H2HA 4JIQA 2VRJA 3LNPA 1QNQA 1ZY8A 2WC3A 1FCUA 1JXJA 3ONCA 2EQ6A 4E2BA 1QK0A 1JQXA 3CHFA 1V03A 1MEHA 1OGGA 3R1ZA 4GOAA 2WK2A 1J9YA 3MUCA 2P8CA 2WMHA 3T44A 4UR9A 4Y9PA 2E6YA 3WD1A 4RNIA 4N9CA 2VFDA 4C7GA 2PDXA 5TIMA 1DVJA 3ARWA 3QM3A 1UKTA 2BCPA 1XI3A 4URIA 3VOFA 2HQAA 3DGBA 5HOSA 1JZ8A 3MTWA 1N63C 1R9YA 3LQGA 1JD9A 3LLFA 4RNJA 1KXVA 1S1PA 3GHSA 1R2RA 3OLDA 2P50A 2PCQA 2PSNA 1UQYA 3GD4A 3GW0A 1UR4A 4A05A 4XAGA 4O11A 5EMMA 5DMMA 5I5RA 4JKLA 1XYFA 4OV4A 3WLSA 1KR0A 2ISSA 2B7OA 5REQB 1TUXA 1M6JA 1GVIA 3AMKA 2Q3RA 4PUWA 3FG2P 4H4XA 4FNQA 2DSWA 2YZ5A 1RZMA 3LUTA 3WIJA 5LIYX 3A13A 2VZUA 4B92A 5I09A 3N2OA 1M01A 1B9ZA 4LV9A 2NLIA 4XG1A 2V30A 3BOXA 5JXQA 3UXKA 2PZ0A 1UOZA 1VYRA 3BANA 2WW5A 4UQBA 1UWUA 2DSVA 3QXBA 5SWUA 5G5HB 3EKZA 2DZUA 1EH9A 4TV5A 5AOUA 3V16A 4DWDA 1MW3A 2ZDSA 3T6CA 2WVUA 1PZ2A 4GH1A 5ECUA 4PCTA 5I0DA 3SCPA 2A85A 3AJ7A 4Q4QA 4NNBA 2BHUA 1LG1A 2C15A 3RUBL 3BCFA 3AU6A 2E4TA 5BXSA 1ZB5A 2NXIA 2YDQA 2GUBA 3U48A 1G6CA 2DEPA 3L68A 3DDMA 3TQKA 3WF1A 3VA8A 3H2CA 5CC7A 3LLDA 3TYAA 1TJ1A 1FH7A 1WAWA 3LI1A 1W2VA 4GZIA 3R7MA 3BMVA 4AZCA 1D7KA 1J10A 3OQEA 2F61A 3SEPA 5U7SA 2DW7A 1XQLA 2RDTA 4D72A 2BC0A 3GO2A 5AC6A 4J56A 1KXHA 3AOFA 4AIUA 1SGJA 1L8NA 4Q7BA 2YL9A 1PBGA 3UZ5A 1TCMA 1RCXB 1Q4NX 1HL2A 1TV4A 3N12A 4WRHA 3IUHA 1UC4A 4ML9A 4C5ZA 4CNOA 3H2AA 3L2IA 3SRKA 4A3QA 2WKGA 1HGWA 1HKKA 5JCLA 3B0XA 1DQXA 1PIIA 1ZUAX 4X2RA 2J7HA 1FWJC 3RO8A 2WZHA 4DJDD 4REQB 3NRZB 1KRAC 5D9OA 4LVAA 5D05A 4UFKA 3WDQA 2Y61A 4FF5A 2BVTA 1GRTA 1DBTA 2V5CA 3ITVA 1PPIA 1KCKA 1DXIA 3WMBA 5FJTA 3NZPA 5E9XA 1GVRA 2ZUVA 2PU1A 1REQA 3BAJA 2IS7A 1UWTA 9RUBA 4RW5A 4PMVA 1GOXA 5ENLA 2YCKX 1AZ2A 2WVVB 1IV8A 1SSDA 4WKFA 1M7OA 3NXLA 4ZEPA 1CGYA 1FDZA 2ZQ0A 3S4TA 1E4LA 4E0CA 3GU2A 3G6MA 2D0HA 2FDMA 3FNDA 4AD0A 2PDKA 1BWLA 3TW9A 1SO3A 3W1AA 2Y7FA 4KWWA 3KZPA 2ACQA 3LG3A 2QCMA 1EX1A 1AJ0A 3ZIZA 4MZYA 3IACA 1Q6GA 2YW4A 4LU0A 2VX4A 2XG9A 2CW6A 1FVPA 1I45A 4NHVA 4CKQA 2ZTKA 3SIMA 2RGLA 1PKNA 1JPIA 5MF5A 1Z6KA 4B4FA 1D9EA 4LH8A 1QR7A 2XVKA 4JAWA 2UWFA 4C7DA 4EXBA 4HZ7A 4K8HA 2VZSA 2X0SA 2DZAA 3B8DA 3MWCA 3PK7A 4JICA 3KL0A 4UTJA 2IQDA 1E1CB 4OQVA 3BC9A 3KXQA 4Z42C 4GJIA 2W63A 1WZLA 2DP3A 3CYJA 1W56A 2ZRVA 1TMHA 1FWWA 4KH2A 1T5AA 4HSNA 1HO4A 2ZC1A 5CPLA 2ISFA 1I75A 4BQ3A 3N29A 3O2LA 4PMNA 3C0JA 1GETA 4QNEA 4QLLA 2JALA 4IMFA 1A5CA 4LCQA 4O28A 3BG9A 2E8ZA 3SURA 3CZGA 4XUGA 3B9DA 4N7QA 2PD5A 2YDSA 1XDLA 1TPVA 2YKKA 1J2WA 4JNZA 3RCYA 3QGKC 3NAVA 4RCXA 4AX7A 1JFHA 4HGXA 2ZUNA 1H61A 5I23A 3WD2A 1VFSA 4KWSA 1Y65A 3VM5A 3QLDA 4GBUA 3NM3A 1IT8A 4EQWA 2OZ0A 4XBKA 5A8MA 4PULA 4FAMA 1NFPA 3M41A 1WB0A 3RU6A 3CT7A 4LPCA 2Y8UA 5CPNA 4HU3A 2W0HA 2ACSA 2D2OA 4NSBA 2QAEA 1DYSA 3KL5A 3TEVA 1UKOA 1W0MA 3VAVA 4US6A 1RLCL 3B8WA 4P2VA 1GQLA 1EJUC 4CEXC 4CQ9A 2PWFA 2WVTA 3G1AA 5EPDA 3RNMA 2INZA 2C1GA 3V7PA 1ZJHA 4S3KA 3VO0A 2R1KA 5DCBA 4E4PA 1YNPA 4NRRA 1FQ0A 1UR1A 1KRMA 3SADA 1LPFA 1GJWA 2D1ZA 4G7EB 3DAQA 3G22A 3FVMA 1XHGA 2OWXA 4TVYA 5I07A 1O1HA 1QNSA 5D2YA 3L12A 1RQBA 5LHEA 3PWIA 2B7NA 4KERA 1H6VA 4JTJA 2VENA 4JQ2A 2P3EA 1BD0A 2O9TA 1BYDA 2BZNA 1WKYA 5CQ1A 3TFXA 3TJIA 2PDJA 5FJUA 4DJDC 3MWAA 3H53A 2GGGA 3OLIA 3PNZA 4IH3A 1C7SA 2WZEA 3AHTA 1S5WA 4F0LA 2BV9A 1XFBA 3SSZA 2EJ1A 3FV9A 4PODA 1QNOA 1E6ZA 1PZ1A 1F61A 1NY1A 3ZLFA 2CLHA 4A3RA 4K8GA 3RPDA 1K03A 3TCEA 3W0KA 3EA3A 4E8DA 4BWLC 1KBJA 7A3HA 3WEOA 2W79A 3WH5A 1ISVA 2VC7A 1C8VA 2C7FA 1OQFA 1AG1O 3TC7A 1ADSA 4GFIA 2C13A 1TV8A 1O60A 5CLTA 4PC8A 4GE8A 2BP1A 1O5XA 2I57A 4MYAA 5DCEA 3A64A 5DLCA 1RJRA 2BGSA 3UVIA 1IWAA 1TUFA 1FHVA 2BSLA 3THCA 3H4KA 4LVGA 1M68A 4FNPA 5BCAA 3OA5A 3BMXA 4IFRA 1VEOA 2QEZA 3CZJA 3NSXA 4UUIA 2PTWA 1C93A 1PEZA 3VOCA 1HKVA 3WELA 3WH9A 4QCEA 1NQKA 4KRTA 4MJ2A 3B9OA 2QPXA 1AL7A 4AEFA 3MDUA 2UY3A 4GZEA 4OUIA 3NIYA 3NQGA 3CWOX 5HDRA 3C61A 4YVPA 2XIBA 1DJIA 1ZMCA 1XYCA 3PAJA 2FZBA 4J2MA 1W3NA 4LSBA 1QW9A 1GG1A 4JFVA 3VCRA 1E73M 2ZBTA 1CDGA 1LYXA 1HNYA 4LIIA 2NVCA 1F73A 4IP7A 2OVLA 2I1OA 1MNSA 1ZQ5A 3S3GA 4JKMA 2Z2AA 3M6DA 3EB2A 3WFLA 3VU2A 1DIOA 3UPMA 4DQWA 4NUWA 1T99A 2Z1KA 3B05A 7PTDA 3L4XA 1L2QA 2VNCA 3LCWA 3AROA 1A5KC 3TTYA 2V2DA 3OBEA 1BZLA 2QS8A 4MY9A 3WF4A 3KW3A 1LOLA 3DC8A 3HV8A 2Y1HA 1XLJA 2F6KA 3DI1A 1LF1A 1XH0A 2NQLA 3FVDA 3AJXA 3JZEA 4JOMA 1MNZA 2YX0A 2ZTJA 2Z28A 2YAUA 2GJRA 1EKOA 3WQEA 4BI5A 2F38A 4YYFA 4UBPC 5A8PA 1AW5A 1ONWA 1LUCA 2QCEA 5C70A 5KITA 1TMQA 3BMWA 1N5WC 3EA2A 3OW1A 3PANA 4BA0A 3GG8A 1OC7A 2GGIA 3K1DA 4M1BA 3PPFA 4IUOA 3UETA 2Z6JA 4I8DA 3A3HA 1E9IA 3SUWA 2XZ9A 3E5BA 1GESA 3GAKA 5D8WA 3W7PA 3M16A 1NFBA 1R2SA 4W84A 4L64A 4GO9A 2CXGA 2X1IA 1OIMA 2QUTA 3WLNA 4IX0A 2NUXA 5G4WA 3D3FA 4HNLA 1G4EA 3GU1A 3N4AA 4JFSA 4MLRA 3BDKA 1CXIA 3CQKA 1A50A 1YXDA 3T2OA 4H9YA 4KEVA 3TYDA 1Z89A 4EPEC 1F9CA 1F6YA 4RPPA 3TYEA 2GQ9A 4W9TA 4R85A 5GVJA 4U28A 5AYYA 3EEGA 1VFOA 3A4JA 4DXKA 1A5LC 3AZSA 2VTFA 2VWSA 4RLIA 2NT1A 2HQMA 3WLMA 2VOTA 2OOGA 3SRFA 4HCLA 3TJXA 2XINA 1JYWA 1S2VA 3CMGA 3S5YA 4KCWA 1Q6EA 2CBIA 1UR3M 1UA7A 3S1GA 3MBDA 3VXGA 4TXEA 4UZUA 2HE8A 3L4UA 2XVLA 2OKTA 2DVUA 5D32A 2GQ8A 3W27A 3BAXA 1WX0A 4EK7A 5J04A 4XX6A 5DX7A 3QBUA 1XKYA 3GTFA 4TX8A 4LUSA 3CK5A 3W7HA 1A0CA 3I4KA 3BOFA 4AB4A 3CZKA 4WKAA 1JR1A 3PR2A 3T1GA 2NQ5A 3DECA 4Z08A 3UWVA 5G2WA 3K13A 1NP2A 4HCDA 2YA0A 2XZ7A 4HQVA 4HPGA 2CIPA 4AVFA 4Q4KA 3SCSA 5BW6A 1V0LA 3EB3A 5FEPA 3WDHA 5D2TA 4D8ZA 3ELFA 2V2HA 4XAFA 3BLIA 1JYNA 3DFHA 1L2UA 3E2QA 3RLUA 3D0CA 4DNMA 2ZWYA 4N4PA 1OB0A 3DHFA 1MO9A 2IXVA 1ZK7A 4UNLA 4L7ZA 3VUPA 1IT0A 1CX9A 5CAHA 1MDRA 4F2TA 3F5JA 4TR9A 3U9IA 2J62A 4IP4A 1QHZA 1W6TA 1NU5A 5J5DA 3N2MA 3WL0A 1E0TA 4ACZA 2AL2A 1BXCA 2C3DA 1UUQA 1XYBA 4A8NA 3NOYA 3FS2A 2KZHA 4R9XA 1I2QA 3UGRA 2OELA 3RF9A 4HPNA 3N14A 4G5DA 1XHCA 2J47A 4S38A 3CPUA 4RV3A 4GACA 2DZPA 3W3OA 3IRDA 1VEPA 3EANA 3T9PA 4MPKA 3FW6A 2BTMA 3PBMA 2Z7KA 5AHEA 2C91A 2VDIA 3LXCA 3GDBA 1MFUA 2WWDA 1PIGA 1OINA 3NYZA 4M7TA 3GFYA 3ABRA 3FAXA 1XM3A 4L9ZA 1S3HA 1CEOA 4GUGA 4MG4A 2PBOA 5J8LA 5LA2A 4ENLA 1RY8A 2ZZ3A 4AZHA 3LHWA 4M24A 1E9ZB 1VFHA 5CZKA 2WPCA 2VO5A 2PODA 2DZWA 4Q8VA 3TYCA 4FPSA 1JOAA 2QUNA 5C55A 2V2CA 2ZKMX 1EZ2A 1BWVA 1K4GA 1SUXA 1IXPA 1J8VA 4UNIA 3DFOA 4CNSA 8XIAA 1J0ZA 2OSYA 5E09A 3LTYA 3UJ2A 2EQ7A 3L7RA 2QULA 2PWUA 1ZBWA 2X09A 3ABZA 1P0NA 2OPJA 4AWUA 1SZRA 4FMVA 1X7IA 3P81A 2F6XA 4GCAA 1CLKA 4ZTYA 2FKPA 2O7SA 2YFNA 4U5KA 3MI6A 4R5EA 1XGDA 4NJGA 1SFLA 2G3NA 3I7QA 1GRAA 1PTGA 5IBXA 4LEFA 2E1WA 2VGIA 2Z24A 4JTGA 2YCEA 4Y9OA 5BXRA 1O4UA 3N34A 3UG8A 3IVSA 4WQ6A 3SN0A 1XRSA 5A6LA 5FF3A 1YRRA 3PZTA 3FHAA 1W9UA 1UASA 2WJEA 1AQ0A 3AIUA 4AIEA 4JDBA 1XD1A 2TMDA 3MUAA 2BY2A 2JIWA 1VPQA 1GVEA 1FO4A 1TPB1 3NO1A 3QC3A 3FGCA 3VOIA 1RSCA 1XIFA 1TX2A 4K2SA 3TXVA 3MVTA 3L2MA 1KC7A 2YL8A 2W9MA 3TW7A 3HB9A 4W87A 3W73A 3AS3A 4B90A 5TR3A 1L6YA 3GUGA 3HQNA 3LOTA 4LF1A 3WDPP 3CPGA 2BB0A 4LNYA 2ZYFA 2BOEX 4DNAA 4AD3A 3N15A 5AFDA 4HU4A 2A7RA 2R1NA 5D33A 4DO6A 4CEUC 3O05A 3CUIA 3KOZA 1B3OA 3E3HA 2PP0A 2YB4A 1OK4A 4JN6A 2OT0A 3DN5A 2XIMA 3AMLA 3E38A 3EX4A 3OVGA 3GXNA 2R1LA 4UWMA 1TIWA 1CGWA 3OVPA 1VPXA 4IIBA 2WMIA 3Q4DA 3SY8A 3AMCA 4N9BA 3AMZA 2GR1A 4YN5A 2D2JA 1AH4A 1S38A 1NM9A 4GO8A 3PBGA 1E56A 4TVUA 4ZQCA 1H51A 1EJRC 1TA3A 3TR2A 2CBVA 3KVMA 4PUUA 1KM1A 3GK0A 2REQB 4HNUA 4WJ8A 3THAA 1CW2A 2YCLB 3CMJA 3T08A 4NI8A 1POJA 2BDQA 3U8GA 4WDUA 4J28A 2Z27A 4X2PA 3GWQA 4LCSA 4B5UA 2NQJA 2VL4A 4ZO8A 3PZVA 3ARRA 2HMCA 3A9IA 2Q01A 4KFNA 4H9ZA 5TAOA 3W75A 4FNRA 1QT1A 3VNKA 4ZSUA 1VFFA 2QF7A 1N62C 1JROA 4QLKA 4UCFA 4AC7C 1XICA 4AWTA 2JBMA 4PUDA 3O63A 5LA0A 3COTA 4F66A 4XZBA 4KCTA 2QCGA 2VC5A 1XIJA 5HNRA 1AQFA 2WZIA 4ADWA 2PDHA 3WQGA 1AK5A 1M03A 2F2HA 3GYCA 2FJUB 3T0DA 3UZYA 1AD4A 1VCVA 3OGSA 2GJXA 2JF6A 4JY8A 2CBJA 4W7VA 2G0WA 4XAPA 3VD9A 4DAIA 2W3ZA 1K7EA 1WBJA 4C65A 4LAZA 4RK8A 5U1OA 1TPEA 4M51A 2NX9A 5EFDA 3TN4A 3TTOA 4M7SA 3W26A 4UTUA 3VTRA 2VXNA 8A3HA 5HATA 3TA6A 3EDDA 4NG3A 1E9LA 2X0HA 1AA1B 4UTTC 5BOOA 5EA9A 3VCCA 3PHAA 3L67A 2PRHA 4LALA 4NJKA 4GRTA 1UD4A 2XN2A 4GFSA 4AZ6A 3MUIA 3AYVA 2OTDA 3G3MA 2OYLA 3S6TA 2CDUA 4MJ4A 1L8PA 4N42A 3W7LA 4GXMA 1H7OA 3AYRA 1JRPA 4FB7A 3CEPA 1W3HA 2OODA 1XD0A 2FPTA 2V0TA 1U22A 3FK4A 4QLJA 9XIMA 1IEIA 1FUYA 4V28A 3UD6A 3O0FA 1A5NC 2FVKA 3E9AA 1MVYA 4UQDA 2R8WA 1IT7A 1L9WA 3CMFA 1GERA 3PJWA 1OSEA 1HG3A 7TIMA 4M1RA 3MBFA 4JTDA 1JJKA 4C6CA 1SSGA 2PS2A 4DZIA 1SFJA 3ZWTA 1VYPX 4R27A 3DOPA 1SW0A 5H91A 4O1CA 3UXAA 5DRIA 3BW4A 1Q6CA 4GYKA 1WXZA 4B9ZA 3EMCA 2ZDRA 1XDJA 1X2HA 4HD5A 4E3VA 3F5LA 1O1ZA 3VX0A 4IMCA 2VZVA 5CGQA 2X8RA 2ZRWA 1Q2SA 5G4HC 4B15A 2VHLA 5AHIA 2D73A 3W88A 5C2CA 3VVGA 5FS8A 1XV8A 1MW0A 3Q37A 4H8HA 2GVEA 1XX1A 1F3PA 3UJEA 1JI1A 2D3LA 3URHA 1M7XA 3MW7A 3DFTA 3ITCA 2QW5A 1Z44A 3AHXA 2F84A 3WLIA 3MP3A 2QLYA 3VD7A 1ZBKA 3I3DA 3TQ0A 5IXEA 3SUUA 3HJZA 1LQ0A 2HS6A 3ITXA 4W5UA 1O68A 5E93A 1NVMA 3AMGA 1GKPA 5E0KA 4E5TA 4MAZA 3A7UA 1KLYA 1S39A 2BHZA 4QSHA 1DEDA 1XBYA 3A3XA 4AD5A 1ECEA 2NW0A 3CAKA 3M0MA 3FA4A 3EEZA 1DJHA 3H22A 4H4SA 1SPQA 2OSXA 4EMJA 1AMYA 4DZHA 1R7OA 2DFAA 1CENA 4RNFA 2PI6A 1EOKA 3ANYA 3CQ0A 2GOUA 2PU0A 1UIPA 4EQRA 2E25A 1GEQA 5M5DA 4IFKA 1ITCA 2CZVA 4Y9NA 1GRFA 1W37A 3GXFA 1RXOB 5CAKA 2CHRA 1BTMA 1PZ3A 2E68A 1GEUA 1RP8A 3V1PA 3CTTA 3S9ZA 1NDWA 4R88A 1VC4A 1LORA 3M47A 4QHRA 5FAGA 1OCBA 4IXXA 1GQNA 2PD9A 2ZE0A 1W3KA 3VIPA 2XFFA 4C6BA 1Q5MA 3WQFA 3KWXA 5JCMA 4PGLA 1JPMA 4NZ1A 3S2MA 1XW8A 3UP8A 1ESWA 4IG2A 4GIEA 2NV2A 2W4XA 5AHMA 3F4NA 3DC0A 4JIEA 2HK1A 3WEZA 2RUSA 4W8LA 2OQLA 4H4IA 1VBGA 4FLSA 4QJ1A 4PTWA 2YVJA 4AZIA 3MANA 1A5OC 4S3AA 3WBAA 1DIEA 3BGJA 4GIRA 3W86A 4D1JA 4C90A 3UXIA 1UJPA 1LP6A 3GDLA 4XUYA 2WAGA 2XVPA 1PUDA 3RLGA 3II1A 1XC6A 3H7VA 2HTMA 4EM4A 3G1HA 3H23A 1R9XA 2QJGA 1LL7A 3UT0A 4HTBA 2VEKA 3LHZA 3NQFA 5M3WA 4O54A 4QQ3A 4QFUA 1E1EA 3W23A 4ZOBA 1OJXA 4IX2A 3F7JA 3NTYA 2E67A 2VQUA 2V8ZA 2C19A 4JHOA 2X8HA 3C0QA 4PSRA 1JEHA 4LWWA 5K3VA 1ZNNA 5G1YA 2CLFA 3JUGA 3NVZB 4AZ5A 3NQEA 4K7YA 4BF9A 1Q7QA 2XH0A 4O53A 2O4QA 2PMQA 1V3LA 2J66A 4RPQA 5D04C 1UH4A 3ZLHA 2B0MA 3W76A 3C2YA 2OOFA 1SJCA 1EQPA 3EXRA 4HIBA 1H0GA 3LGDA 3KDOA 3ATYA 1S46A 5C2XA 3AN1A 1M6IA 1ENUA 1G69A 4KIRA 4OBTA 3TROA 1F8IA 1VD6A 1EJ7L 3FJ6A 1XS2A 1YADA 1JAKA 3DG3A 4EXAA 3ETRB 1D7YA 3KZSA 4YNGA 5F4WA 1RBOB 1TTPA 3IV3A 1HP4A 2C6QA 1KGWA 3SDOA 3PUGA 1F4HA 3B9EA 4XD6A 5I2UA 1EIXA 4KEMA 5KTLA 3I6EA 1GZGA 2BVDA 4NRSA 3TYBA 4XO7A 1N8FA 3SCTA 3N9RA 3N2BA 3R25A 3QHOA 4U3CA 3AHYA 3NVTA 5BWFA 2CZEA 3GY1A 3P5ZA 3Q67A 2A1YA 3P8JA 1OABA 3P7YA 5FEXA 3VIJA 3QFWA 5A6KA 1G9HA 3K4DA 2DY3A 1UZDA 5FESA 1MW1A 1GW9A 1STZA 4HSHA 2E3ZA 2ZFAA 3BSHA 2BVWA 2Y0FA 1TPUA 1TWWA 1KB3A 4U33A 4J3SA 2W67A 1RD5A 1UD6A 2R6OA 2HNHA 1GPWA 1JDDA 4A2RA 3LBOA 1FFUC 3A5FA 1HP5A 4DJFA 2ZX5A 2XH2A 4OJYA 1JCTA 1CGTA 4Z2JA 3RJYA 4IIGA 4KT2A 2QYGA 4EE9A 5E6ZA 3K5XA 4TO8A 4YTTA 3EB4A 5I24A 2HSAA 4AY8A 3K8KA 3GIYA 1PKMA 1RA5A 3TDFA 5KZMA 1VLIA 1EO7A 3L21A 2GWNA 3B8IA 5JBFA 5JCIA 3D47A 4ADUA 4L80A 4XZHA 4HU8A 2GPTA 1R8LA 1AZ1A 5GJPA 3T0TA 3E12A 3HPXA 3U5YA 4NJIA 2J7GA 2OGJA 4LY8A 2X0YA 4KKXA 3XISA 3GE7A 4Y7EA 4GR1A 3CUHA 4PRTA 4MSSA 3QH2A 3TLQA 1BWKA 1TRIA 1V5XA 4L61A 2PBGA 3EMQA 5C9WA 1UBPC 3OU8A 3EAOA 1HKIA 2ZZ5A 1LT7A 4J3ZA 3W7GA 5A6BA 1Z3NA 1T6MA 3P5YA 1BRLA 3J7HA 1ALDA 4NAFA 3OLEA 3WQ6A 1VBJA 2FTWA 3UWWA 1S2AA 4FOKA 4ILSA 2MANA 1OCNA 1H09A 4H4YA 2A3EA 4MDPA 1UR8A 3TFCA 4MNJA 3W7CA 5CJ5A 3U2OA 5EY5A 3GUWA 3V36A 5A1AA 2B7QA 5C9XA 3KFTA 5HMSA 1JZ4A 3TR9A 3VIFA 1HN1A 2NXHA 4W7WA 1VFTA 2FGBA 4LJ3A 1ADDA 1CGVA 4UXDA 3E2VA 2JFEX 5EMUA 5FF7A 3D46A 1H7RA 4O1EA 2GFTA 4GNVA 5LIXX 1TYPA 1R30A 2OEJA 3C3NA 1H7PA 5KVIA 3S2LA 1SVDA 3GG0A 4PMRA 3WQ8A 3VIOA 1TQJA 3FKRA 3WNMA 2JQXA 1ISYA 3N18A 2V5LA 1F3EA 4AVOA 4GVIA 4F0MA 1EJXC 2V63A 4LCRA 4B3LA 3ZSSA 3EPMA 3N2TA 1YPXA 3TQVA 3WN6A 3TAOA 1XL9A 3B97A 2OZ3A 4GMEA 2YCLA 2Q09A 1HVXA 4WLCA 4CVUA 2NPXA 2UY4A 5F4XA 4BQ5A 2PTZA 3EKLA 4J40A 4NZ4A 1KGUA 4MTVA 5HAOA 1RM6B 2H9AA 3LA4A 3PZ9A 1F2JA 3WJSA 2D23A 3HG2A 1GKQA 2W5FA 2FZ9A 3L8KA 1B3YA 1PKYA 3AC0A 1FWDC 2FMOA 1U83A 4YCPA 3NQAA 4HNCA 1BQGA 1W1VA 2FB3A 3VNZA 4RE3A 5AZ0A 3OZMA 2OYMA 5CBBA 3G2GA 4J35A 2P5NA 3C52A 4HNNA 5KZEA 4Z2IA 5JCNA 3IAPA 5XINA 4AYGA 1IEWA 1A53A 3G5EA 3GVRA 1FFVC 1N61C 3IVUA 1LVLA 3LI0A 4D8LA 2WC7A 2XM1A 3BURA 1DQWA 1QATA 1RJQA 3QLLA 2P10A 2FZDA 2OLHA 1WXJA 1D7FA 1DQUA 2ZC8A 1J0IA 2W55A 4XZWA 1X8FA 3IK2A 4AY7A 5JUVA 5LNWA 4N9DA 1BYBA 3TV8A 5TBOA 3UR2A 2FDSA 1VRXA 1FWSA 3VILA 1Q6RA 1UYQA 3BZJA 5DO8A 3ZT5A 4I9AA 1J2BA 1H7XA 3VE9A 4XO6A 2ZUTA 3CUGA 3UWZA 1EBHA 2VELA 3S8HA 4LGXA 2PDQA 1MRAA 2PGEA 4MM1A 4TMBA 2QCCA 4NI3A 1CB7B 3HQ1A 3KCJA 4BEQA 1PZ0A 5GNYA 4O1BA 1KFJA 3EPNA 3ZWSA 1CI1A 4W8BA 5ABEA 3LCIA 1CXEA 1WBHA 4DO4A 5I79A 1H1ZA 2BLEA 1W1PA 2PGRA 3IWPA 1QRQA 2F9RA 5A6AA 2VGFA 6TIMA 1XDMA 3LSCA 1U5HA 3W1PA 4AD4A 4JDRA 4D6JA 4LAMA 1B3XA 2VWTA 4M52A 1GGOA 1YYAA 1UPMB 4PH6A 2BOFX 1RVKA 4JTTA 4I8YA 1DJGA 5AC8A 1A0EA 4I9MA 3BGGA 3ZJKA 5LHFA 1EWDA 2UZ9A 4WJXA 1HJXA 3GXTA 4OOUA 2E9BA 2DT1A 1QNRA 2A3CA 3GW3A 2PDYA 2BGNE 1WAUA 4S3GA 4IIEA 3N1AA 3IC9A 1G4TA 4RNHA 1OX4B 1DWFM 3FYYA 3T0CA 3FJNA 1YDNA 3APYA 2DU2A 2NLYA 4FA3A 7REQA 4DIAA 3KBWA 4JTLA 5A5WA 3LPOA 1KXQA 2WO5A 3ISIX 1AFSA 4BZYA 4V27A 1XPGA 3VFLA 4JFWA 4WCJA 5TNVA 2AAAA 4PFMA 1Q45A 3P8IA 1WV2A 4B5SA 5G4EA 1P5BA 5ABFA 5C9RA 1KKOA 2DGAA 3UW6A 1V7YA 3CQIA 1O12A 4ZO9A 4JCMA 4NX0A 1O5KA 3MMTA 1ZX9A 1OFRA 2PRLA 3UWYA 4X0NA 1GRHA 4IIHA 1IXOA 3VDGA 1KV5A 3KM8A 3GX9A 3NGFA 4QQUA 1E6PA 1Q6FA 3UR5A 1F6KA 2EAWA 4B5WA 2GVYA 4NNCA 3SQLA 2NSXA 4DF1A 3UY8A 3TSMA 4H2CA 4CD8A 1FWAC 2WNQA 5CPOA 1P6WA 4H83A 4C6QA 1BFNA 1VDVA 4HHHA 5D9PA 1FWEC 1G01A 4DJFD 4MWAA 3AISA 3EX6A 1SR0A 3LNMA 1FA2A 4QDPA 4M8UA 3H4XA 1ONRA 1AJ2A 1EPVA 3IJ8A 2DPEA 4A8LA 4GH3A 4C6PA 1LOQA 5CEWA 1V6TA 1TKKA 1XP3A 1M65A 4IL2A 4Z0SA 4ERIA 1IZKA 2V3GA 5I77A 3TKFA 1OFBA 3SECA 4GX9A 2I5QA 4G7FA 1OG0A 1Q6DA 1ZL1A 3NZ1A 3PZGA 3VYLA 1H2IA 1XYZA 1XQKA 4CUCA 3UEQA 3S6OA 3LHTA 3WH6A 4D8AA 4CQ8A 5C7HA 3SO7A 1PWMA 1H11A 1YXYA 2EG6A 1VH7A 4Z2KA 4JIHA 4EXQA 1NEYA 4MZ8A 1CLXA 3SN4A 3Q58A 3HZ3A 2OWCA 3O9NA 2VX5A 3MUXA 3BK0A 2D24A 3VOGA 3IJ9A 4H6KA 3WQOA 4IISA 1EIBA 3H26A 3I68A 3QKZA 4GRSA 3HGOA 5HNTA 3DI0A 3IJ7A 4NASA 3SSJA 1UUMA 2FVMA 5K4XA 1F5ZA 4GGBA 5A6BD 3QQWA 4OECA 3W00A 3A6OA 3VC5A 4DEFA 3LY0A 3QQ1A 4AIOA 1EWEA 4IQDA 3TLLA 1J6OA 3LDVA 4KFOA 1CIUA 2GUUA 2YYUA 4ZSTA 3PF3A 1XRTA 2ZZBA 2GLKA 3FLUA 4UTLA 4RE0A 4IIDA 3EKGA 4TIMA 3MV11 2BX7A 4MDOA 4DBEA 3RHGA 3R4IA 1IXQA 1KQZA 3AYTA 1W8SA 4QEHA 3I4EA 3RLVA 4LS2A 4DJEA 2W0UA 3WD0A 3BLLA 3VNMA 2PP3A 3KLKA 3EOLA 1FFRA 1KW1A 1G5AA 4JX6A 3PZQA 4C1NA 1TV5A 4QDWA 1OFAA 2I9EA 1TJPA 1KFLA 1PTDA 1K6AA 3NQCA 2C1IA 3INPA 3ZVHB 4L5ZA 3F4WA 4A3YA 4GKLA 3SCNA 1TV7A 4EPDC 3R8HA 2YVGA 4NY2A 3DHUA 1JEZA 1YE4A 2FTPA 3LPGA 1T7LA 5C9ZA 4XIMA 2Q8ZA 1MSSA 2HJPA 1TRDA 4IQLA 3TSBA 4QP0A 1NDAA 4AF0A 1RALA 1F3XA 3FXYA 2D2HA 4UB9A 1YIXA 4Z2LA 1IWPA 1JZ2A 5A95A 2WHKA 2WOVA 3ITOA 2A21A 5DBUA 1M9HA 1UOKA 3NVDA 1UKPA 5EKYA 3QYSA 4KGJA 1X38A 3K8MA 2FZMA 2VI0A 4MHBA 2OU4A 4Y9MA 1SR9A 1EXBA 4MNLA 4GIYA 4KETA 3WCZA 5JBEA 4DBUA 4ZOEA 4K37A 1H62A 1IWBA 1TO3A 2WOIA 2FHCA 4H04A 3I3EA 1VP5A 4CLMA 4WHBA 1TYTA 5LA1A 2A6LA 3HF3A 4RE2A 2QXWA 4NYYA 3LCHA 4IPPA 5T9BG 3CIVA 3IIOA 1E40A 4HYWA 4EWJA 3IIZA 2QJNA 3ABSA 3V5FA 2D0FA 1TZ7A 1RBAA 3VK5A 2ADAA 2A3AA 3GAYA 6A3HA 2CU0A 5H6HA 3P2VA 4R7OA 3DESA 1Q13A 3MA8A 2ISWA 4DJFC 3TU9A 2VCBA 1SB3B 3WLJA 4QNWA 2J7FA 4RX0A 5KMYA 3LGEA 3B0YA 3ATZA 1OFEA 4G9PA 5AB3A 3KX6A 5HQMA 3QV9A 3EWCA 2DORA 3W7KA 2BASA 3W7JA 4OZOA 2DSZA 3EAUA 3NL2A 4MJZA 3EWBX 3R10A 4OU1A 3CGBA 4E3TA 1UMYA 1WDDA 1DIKA 2WMGA 5F2LA 3W6YA 1FCBA 3MB9A 2EXOA 3FDGA 3LZ5A 1NF7A 2SFPA 1ICPA 3QMSA 2P0OA 3HBLA 2CZDA 4EIVA 3EOEA 1J93A 2OQYA 4FX7A 2PC4A 3TWAA 2Z1BA 3GNXA 5MHBA 5FSEC 4RJEA 4O0QA 4UFLA 1WZMA 2VEPA 4RDWA 3STEA 1OCQA 3MCMA 4AZCB 4I7UA 4ZO6A 4OVXA 3P74A 4W4QA 3ZMRA 1YXCA 3ENLA 3W2NA 5G2IA 3LHUA 5TQLA 2I9UA 2ZXDA 3UG3A 1GVSA 4C7FA 3NDOA 5JIPA 4FALA 5LGZA 3JR2A 3W7IA 3SN1A 4K7VA 1D3CA 3WQ4A 2OYKA 3L5LA 3BLPX 4XD4A 3LLXA 3USZA 2FPYA 1FWRA 2QCDA 3BAIA 3P80A 2DZVA 1UR9A 4ATLA 4ML4A 4C1KA 3VINA 5DQPA 2YA1A 1KN0A 2VX7A 4UTHA 4CVWA 1MW2A 5HMEA 2Y8VA 2YDAA 1ZZMA 4GY0A 4FOJA 4H8UA 5CPSA 1WOAA 2EPOA 2O92A 2XIIA 3W82A 3MO7A 4CD6A 2HPIA 3RPTA 3H2OA 3BAYA 3H21A 4ALDA 3NQBA 1YTKA 3WMSA 1G94A 2HISA 1REQB 2QCHA 2AGTA 2J7CA 1FHDA 1ZRQA 4NP7A 3PUOA 1XSJA 4HJWA 3S46A 1H50A 2DUAA 5HA7A 3W72A 2G3IA 4NU7A 2JEQA 4KGLA 4DBSA 3M0JA 1BQCA 4MWAD 4GUJA 2X16A 1EC8A 3EDFA 2I56A 1UR2A 4D1IA 1R85A 3OZPA 2PWDA 2I16A 4HNVA 4RV8A 3KE0A 4Y9AA 4OGZA 2BGQA 3VMOA 1Q7ZA 1HT6A 4MNMA 1IYXA 3TOYA 1HFBA 3CUZA 3W38A 2BXVA 4ORMA 4LNCA 3VOHA 4PCNA 4IXHA 1TSIA 3CBWA 2NQ9A 3G1YA 4DPPA 5JH2A 1W8GA 4P7LA 1V51A 4EACA 1BG9A 3NR0A 1PE1A 3RXZA 2Z1VA 5EMJA 1K8CA 1T96A 5AC4A 1JCJA 5I3FA 4YWSA 1EX5A 3LRMA 4A21A 4YL2A 1EDGA 4O57A 4ZQOA 3D9XA 3NURA 5D8ZA 3QQ0A 3TXZA 5L6UA 1HL9A 1VCFA 2J6VA 3CB8A 2VT0A 1NIUA 3G8EA 1XLAA 2A3HA 4J3UA 5BMXA 3WLLA 3N6QA 3A4AA 3VDCA 1A47A 5A8NA 2WSYA 2GH5A 2WOWA 1KFWA 2VRQA 4IGSA 4GGHA 3P82A 2HXUA 1BKHA 7ENLA 2GSHA 1RK6A 1GHSA 4EANA 1Q1RA 2AGKA 4P7OA 2UY5A 4UTWA 2PAJA 3A3WA 4NQ1A 2XTKA 3EWXA 4YHGA 4PCSA 3NWRA 5EMKA 5LYRA 3H4WA 3FOKA 5T26A 3B0VC 1CXLA 2G4FA 5I3KA 1CXFA 3PWGA 1W31A 2Z26A 4DJED 3M43A 4O4WA 5H8UA 1W9BM 1JYXA 3LBMA 1H2JA 4H4QA 4EKJA 2VQTA 1EGMA 1QI0A 1LG2A 5DT5A 2X8CA 3KHDA 1RH9A 1TVNA 5AYBA 1S2WA 3OBKA 3PJXA 3MS8A 3GRSA 1EZWA 4IOTA 4PA8A 3QKEA 3T4CA 1KTCA 4FNTA 3PBUA 3HGSA 1KRBC 4R7JA 5F7UA 2XHYA 1BXNA 1BF2A 4WSJA 5MKGA 1BXBA 1QAPA 2GWGA 5ECVA 4WOZA 3EWUA 4KS0A 4AQLA 1XLIA 4D6HA 1YMYA 1SW7A 3L9CA 1ZHAA 4Y2WA 3E2SA 3GHRA 3HM7A 4EAMA 1DKWA 1E0WA