4KT2A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
404
structure length
384
Chain Sequence
SLKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
rcsb
source organism Chromohalobacter salexigens
molecule tags Hydrolase
molecule keywords D-mannonate dehydratase
total genus 150
structure length 384
sequence length 404
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2013-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4kt2A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4kt2A01
2OPJA 2QVHA 3NO1A 4Z17A 4HCHA 3N6JA 2FKPA 5FJTA 4E4FA 3T9PA 2XGZA 4K1WA 3MZNA 2O56A 4HPNA 3KUMA 4DXKA 3MUCA 3ENLA 3TTEA 1P48A 2OQHA 3P93A 3THUA 6ENLA 2PCEA 3SN4A 3DESA 3BJSA 3DDMA 4IHCA 3QPEA 4IT1A 3ZVIA 4YWSA 2GGHA 1W6TA 1MUCA 4ENLA 1SJDA 1YEYA 3SN1A 4E8GA 2OZ3A 2DW6A 3I6EA 3PFRA 3P0WA 4IZGA 4E4UA 4E6MA 3H8AA 3SQSA 4HNCA 4F4RA 4H19A 3RR1A 1ECQA 3UJSA 2GGJA 2P0IA 2OO6A 3ZLGA 3BOXA 2MNRA 2XH4A 4G8TA 2HXTA 2OQYA 4KWSA 3EEZA 4EWJA 3U4FA 4A35A 3T8QA 4HYRA 2QQ6A 3IK4A 2XH7A 3FXGA 3ZLFA 1P43A 4Z1YA 3ZVHA 1L8PA 3T6CA 3MWCA 3GD6A 4KT2A 4M6UA 3DG3A 2QGYA 3MQTA 3V5FA 2PS2A 1EBHA 1KKRA 3H7VA 3MKCA 2P88A 3SN0A 1EBGA 4GGBA 3N4EA 1R6WA 1NELA 4GGHA 1JCTA 3CXOA 1WUFA 2PTXA 3V5CA 4IL0A 3UXLA 1F9CA 1E9IA 3VA8A 4DX3A 3V4BA 2OZTA 3RO6A 2QJMA 3D46A 4KEMA 4MKSA 5FJUA 3TQPA 2QDDA 2OFJA 3IJQA 3I4KA 1MNSA 2AL2A 4GISA 4A6GA 1OEPA 3T4WA 2AKMA 2PODA 2XSXA 4H2HA 3FCPA 4G7FA 4GYPA 1PDYA 2OKTA 3ZVHB 3OZMA 3PWIA 3OPSA 3R25A 1MDRA 4IL2A 3U9IA 4A3RA 3TWAA 5EU9A 4JN7A 3TOYA 3UJRA 3FV9A 3CB3A 4HN8A 7ENLA 4JHMA 2QDEA 4DHGA 3IJLA 4K2SA 1NU5A 2PP3A 2XH2A 2PMQA 3DIPA 2ONEA 3QKEA 4HCDA 3UCDA 1KCZA 1DTNA 4MMWA 4ROPA 3B97A 3R0KA 3SSZA 2I5QA 1MDLA 2P8CA 3I6TA 3STPA 3GY1A 2P3ZA 3OZYA 2PTZA 3EKGA 3CYJA 3VCCA 3OW1A 3V3WA 2PPGA 2PU1A 3CK5A 3DERA 1XS2A 3JVAA 2HXUA 4K8GA 3DFHA 4GMEA 2NQLA 4J3ZA 1RVKA 3PK7A 1R0MA 3RITA 3S47A 5ENLA 3NXLA 3K1GA 4IP5A 2PA6A 4GIRA 3QN3A 4FI4A 4HCLA 3IJIA 1SJCA 1BKHA 1SJBA 3VC6A 3FJ4A 2OVLA 2QJJA 3H12A 3S5SA 3R0UA 1WUEA 5BOFA 2AL2B 3OP2A 4KPLA 1TE6A 4DN1A 1PDZA 4FP1A 3N4FA 3TJIA 3MSYA 3MY9A 2PTYA 4ZA0A 2GGEA 2MUCA 2PGWA 3UJEA 3H70A 3PWGA 3RGTA 4J1OA 3UGVA 4H83A 3DG7A 3R1ZA 3R11A 4X2PA 2FYMA 3GO2A 2XH0A 2GSHA 3JZUA 3R10A 3BSMA 1JPDX 3OTRA 3Q45A 3Q4DA 2AKZA 1JPMA 1KKOA 2OX4A 3ZLHA 2GGGA 3JW7A 4DWDA 2PTWA 2P8BA 1EC9A 3DG6A 3DEQA 3CAWA 3P3BA 3TW9A 3TWBA 3N6HA 2DW7A 2PP1A 2OG9A 4M0XA 3DFYA 2RDXA 1BQGA 2PGEA 3DGBA 3QTPA 1MRAA 1IYXA 2PP0A 2CHRA 2PU0A 3VC5A 3NZGA 4H1ZA 1TKKA 2POZA 2HZGA 3RRAA 2QJNA 4MGGA 3HPFA 4IP4A 2ZC8A 3UJ2A 5FJPA 1FHUA 3TCSA 3VDGA 4DYEA 1TZZA 3CT2A 3FVDA 1JDFA 3VCNA 3UCCA 3UJFA 3NFUA 1ONEA 5FJOA 1EC7A 3ES7A 4GFIA 4E5TA 5J04A 1KD0A 2AL1A 3VFCA 2GGIA 4HNLA 3RCYA 3D47A 1XPYA 1EC8A 3UXKA 3ES8A 3SBFA 5FJRA 1ELSA 1SJAA 2GL5A 4GYPC 3QLDA 1FHVA 3SJNA 5IDZA 3TJ4A 2PSNA 2ZADA 5BOEA 2OLAA 3FYYA 4ZCWA 2OZ8A 2HNEA 3GC2A 4JN8A 2GDQA
chains in the Genus database with same CATH superfamily
2OPJA 2VRQA 2WSQA 1E56A 2OCZA 3WL0A 4DY1A 5HNRA 1J8VA 3O16A 1VYSX 3CL6A 3WFZA 3TAOA 1YNQA 3W71A 4FLRA 2AQOA 5CAKA 4A2SA 3CEUA 1JROA 1JAEA 1LPFA 3EPOA 2VFFA 3STCA 1KFKA 3TNBA 3HGSA 3QV7A 4WF7A 1YHTA 5BU6A 2QKFA 1J0JA 3CIVA 3MPGA 3ABZA 3KZSA 1EHNA 1BG4A 2VJXA 3R7MA 4W5UA 4AD2A 1TJRA 4QXIA 1R2SA 4IIEA 3QPEA 3U7VA 2GJRA 2WZHA 3RX3A 5C9RA 3VKCA 1TSIA 3T7VA 1UYQA 4HOZA 3CBWA 4IZGA 2CERA 4LCSA 1A5LC 1ZKQA 3CZ8A 2YCLA 3OBKA 4NNBA 5GJMA 3UR8A 3TTOA 2MNRA 1BVWA 3TXVA 3ZR6A 2BY1A 1QNVA 3THCA 1XBVA 1H41A 4O4WA 4GLEA 4NG3A 2J9XA 4NILA 4A4AA 3GH7A 1SSDA 2BC1A 3LNPA 1V3JA 3ZVHA 5CPNA 3CASA 5DT5A 3RNMA 2G3JA 4JTEA 2HSAA 4NP7A 2JGYA 2YCLB 2UZ9A 3UNTA 1QNOA 4RX0A 3ABOA 1DOSA 1E6NA 5LHFA 1P6CA 1GG1A 2B7QA 2C18A 3CXOA 3KFTA 5AVNA 2X8HA 4TVWA 2CU0A 4K38A 1PJ9A 3S2NA 4IL0A 2TAAA 3PANA 4OIFA 4FR6A 4HMCA 5JH1A 1A5KC 3CUZA 1V08A 1G69A 4NX5A 1J93A 2C8NA 3W83A 3Q6JA 1JEHA 3FS2A 2GQ3A 1PS9A 1AJ0A 3IAQA 2PBOA 4H2HA 2YLLA 3UT0A 2NXGA 3AZRA 3KM8A 1JAKA 4NZ4A 2WC4A 1B90A 2V5BA 2FGZA 3ANVA 1LG1A 4X2RA 1OCQA 1MDRA 4R7WA 3U9IA 1RQHA 1JCJA 4XSLA 1I1XA 3PBMA 3VNDA 1A4MA 2H9AB 4JN7A 4ATLA 1QW7A 2P5NA 1I8JA 2BGSA 4WQ6A 4AX7A 5I07A 1W2VA 1AL8A 4KIEA 1W2PA 6ALDA 3H4GA 4GI4A 3WEZA 2OYLA 3KWXA 1R9ZA 2INZA 4P7RA 2GSEA 4CVUA 1UD2A 2E6AA 4M8UA 4JFWA 5EGRA 4AZCB 3QVQA 2QCHA 3HQPA 2DIEA 4MMWA 4DBUA 5E9AA 2P8CA 1Y65A 3ARUA 3WY1A 3S8HA 3CYJA 4BF7A 3RLVA 4PMRA 1FVPA 4WR3A 1POJA 3W7QA 3R07C 3WQ6A 1FWAC 2GFTA 2YFOA 3GDMA 5A6SA 3PVFA 4RUBA 2E7FA 3DHUA 3SCVA 4UTWC 2WMGA 4IG2B 3RILA 1LROA 3CUHA 3LSBA 4O0ZA 4N9EA 2NSOA 1UB3A 4IP5A 5HQLA 8RUCA 3PZQA 2UWFA 2FH8A 5J8LA 2ATMA 3SADA 1CGYA 5AC6A 4D6JA 2YBVA 3CO8A 3L8KA 3L68A 3TQVA 2AL2B 2E5CA 5CZTA 4FO4A 4RZ4A 3GZAA 2QPXA 2H6RA 1G5AA 3UF9A 3N4FA 3PZUA 2CBJA 1TELA 3OIXA 4LQ1A 1M04A 1XC6A 3AO0A 2X41A 4W85A 1MXGA 2QJIA 1PXGA 3QHOA 4R5EA 5HWNA 5BXPA 4CNOA 4NAEB 4M24A 5IOBA 3UFYA 4IQDA 4R9OA 2WSKA 5CZ0A 1YIXA 2R14A 3UW6A 4ZFMA 1KFJA 1JIBA 1PEZA 4C91A 1PUDA 5ABFB 2RAGA 4H6KA 4CQ9A 3FJLA 3G1HA 4JTFA 1V6XA 4XBKA 2CKRA 3AIWA 1E6SM 1YXDA 1S2CA 3ARQA 1XLGA 2WYSA 4GY7A 2A4AA 4PTNA 1NWSA 1JRCA 1F07A 3UPBA 4DJEA 3BAYA 1A5BA 3VABA 2C7FA 1B1YA 1IEVA 1Z42A 1TZ9A 3B0PA 1LT8A 4DO6A 2CETA 2O92A 3UZYA 1JZ5A 4JTHA 3QC0A 2PZNA 2WHJA 3PR2A 3L4YA 1M6JA 1FX6A 3WQPA 2YXGA 1TQJA 1XRSA 1JL8A 1Q66A 4HMEA 2NQJA 3PZOA 4AEEA 1XIJA 4C6KA 1GESA 2W54A 2ABBA 2CLLA 1NF7A 4P8UA 2QCDB 3TYEA 3LCLA 5REQB 4XB3A 1XLDA 1HW6A 3XINA 1E1EA 2F6XA 3V0UA 3ZFHA 1HO4A 3P8JA 5KITA 4BF5A 1SPQA 4H9XA 1WBHA 4XBJA 5CC5A 2E9LA 3U2EA 3W7LA 5L6UA 2AQVA 1ISWA 2G5WA 3OODA 5EB8A 5I23A 1ZP4A 3GBEA 1LDCA 3VDBA 2PZ0A 1GW1A 3PUGA 3WUGA 3M0JA 1M7XA 2PSNA 3FKKA 3PY2A 4C6NA 3INPA 3BZGA 4F40A 1XUUA 4IPLA 1ADDA 4ROQA 3THDA 3T2PA 5C5YA 2PE4A 1MVYA 2Z1SA 3ITXA 4C6LA 4H7CA 3GU1A 5BRQA 4RLIA 1F3WA 1M53A 2AGKA 2INEA 4FX8A 3VGFA 2J3NA 1N2VA 2Z7GA 3EWYA 4DJFD 2V5DA 1E5NA 4FIRA 3N2OA 4HNVA 3GAKA 3GNXA 3KP0A 2YBUA 3T1GA 5JH2A 1C8QA 2OQHA 8XIMA 2XUCA 2WM0A 2E6DA 2V3BA 3SIMA 5ECUA 4YU1A 5AZ1A 1O94A 3AC0A 1RD5A 2V3GA 3V18A 4IF2A 3VD4A 2EPKX 3UWYA 1HJUA 3FHQA 2BX7A 3A5VA 4JDRA 3SCNA 2DW6A 3FEQA 3MI3A 4A3YA 3WNMA 3FFSA 4IPPA 4DJFA 3IVTA 4G1NA 4AD3A 3TCEA 5LKYA 1EB3A 2FFCA 4TVYA 4L65A 3KVMA 3W7OA 4NZJA 1W56A 3DECA 3CQKA 1ODUA 1TYGA 3VIFA 4O52A 1CW2A 4D6DA 4MY1A 3CPUA 3OHMB 1RHCA 4C6PA 1T40A 2VURA 3P81A 3QZ6A 4MYAA 5A6JA 2JK6A 1EJWC 2EAWA 1GVQA 1UR4A 3VU2A 4O8AA 4S3DA 3IRDA 1IGSA 2GVEA 1U33A 3MQTA 2PD5A 1TTJA 5I6SA 3MHFA 3LXCA 2VC5A 3K5XA 3SUSA 5EFFA 3GYCA 5FS6A 2HDJA 3EWWA 4WZHA 4QJ4B 3VOFA 4GBUA 4D2JA 1P0EA 4MKNA 4DBEA 3KOZA 4A3QA 4LUSA 1W5NA 4YS1A 1W3NA 3WUFA 3CZGA 3BLFA 1ZAHA 3BVJA 5TNVA 4JR5A 1DHKA 2R9RA 3B9DA 3W23A 3LRMA 3UG4A 3QHMA 3GDRA 5D9PA 4K3ZA 2QMKA 2EKGA 5D2TA 4F48A 1TX0A 3E0FA 1OJXA 2XVLA 3QLLA 1TPUA 2WOVA 1OEPA 3MUY1 4ACYA 2A2IA 4D6FA 1YLVA 2QV5A 1E1CA 3PUDA 4PEEA 2UY5A 1AW5A 4CU6A 1VFTA 1OB0A 5C2CA 3L12A 6A3HA 1DIOA 3EX1A 3OZMA 3U7BA 4DZAA 3TN3A 3AHTA 4MFEA 4IL2A 3NQVA 4ZSUA 1BF2A 4O10A 4A3RA 2V6OA 3E38A 4NNCA 2E5BA 4AIBA 2E67A 2GOKA 4MJ4A 5C9XA 1V59A 4PMJA 5U4NA 1EP3A 4UOQA 3LMYA 3P62A 5I3KA 4G2DA 3E0IA 3AXMA 2WMFA 4ZR8A 3MI2A 1Q7ZA 2KZHA 2PP3A 3RLHA 1Q85A 4J3TA 1F4AA 2IQ0A 1RR2A 4NKCA 3GR7A 2OYKA 5C7HA 4US6A 3B9EA 4I6KA 3L2MA 3ZZ1A 2XHYA 5CPSA 4U28A 2WVSA 2PTZA 5A6TC 3E12A 1V0LA 3BARA 3C5QA 3V3WA 2QAEA 2J66A 5G4EA 4V2XA 4NU7A 3R12A 4H4XA 5A8GA 3NDZA 1RCQA 2F9RA 3CV1A 1UCWA 2PLMA 3QR0A 1DJYA 2XIBA 5CJ5A 5ENLA 1W3TA 1XIIA 3RAOA 4LXFA 1F8IA 2PA6A 4GQ0A 1U83A 4U31A 2HV5A 2A1YA 2F6KA 4FOKA 5F2IA 3VNJA 1ZJAA 4AMAA 3S5SA 3MANA 4OBSA 3EXSA 2BC0A 1IZKA 3SEPA 4FR1A 4XBSA 1GZJA 3W28A 4TQTA 1GRGA 2WMJA 3KL5A 1HQTA 4UQCA 2VGGA 3IPWA 1KV5A 1H7PA 2MUCA 2RABA 1RJQA 3OA5A 1E3ZA 3B8VA 2XVPA 4CCCA 1DE6A 1OC6A 3JZUA 3Q4DA 2ZUNA 2E6YA 5A8MA 4DXVA 1QWKA 4PUJA 3RPDA 4LOCA 4PMXA 1Q6OA 1PWLA 4BEUA 3C3UA 3UYCA 2RUSA 3EA2A 2W0UA 2JE8A 5IM51 1QAPA 2DT3A 2P8BA 3ARXA 3SW6A 3E2RA 4JCLA 1TJPA 3P3BA 4WSKA 2PP1A 2OG9A 5ABFA 2YB4A 1BD0A 3N13A 4RR4A 1H49A 3ABQA 3OOQA 7REQB 2DVUA 4IWWA 3LN3A 3WLPA 1VBGA 1OQFA 2F6UA 1TKKA 5A95A 3LY0A 1ZK7A 3EF6A 5BROA 2E25A 2Z1KA 3K4DA 2QJNA 2JF7A 2VOTA 5LSMA 2WHKA 4R9XA 3IVUA 4FPSA 1K4QA 2WMHA 4AXNA 2XSAA 2YCKX 2ZWYA 1OX5A 4DYEA 3ARSA 3CT2A 4IM4A 4OGZA 1O4UA 4WXYA 1OJTA 3FX4A 4KETA 5BU9A 4JFVA 2YW3A 5AECA 3FKRA 2HQAA 1ZDLA 5I3DA 5TD4A 1W17A 5XIAA 4DUXA 3N9SA 3GDLA 3H6OA 1KW1A 1NHPA 5FJOA 1OX4A 1YX1A 3L23A 2V38A 1F2JA 3EX4A 3LHZA 1NSJA 4O17A 4I3GA 4RDVA 1GORA 5CGQA 4IH3A 1NWTA 3B3DA 4HNTA 4N2YA 4DUVA 1Z3NA 1QO2A 1JUEA 3KOYA 3C86A 3F5KA 3PNUA 3I7QA 3SDOA 5ECVA 2BXVA 1FHVA 4KH2A 2YSWA 4QE5A 1HX0A 4H4ZA 4NX0A 3KVLA 1VP5A 3GXFA 1F5ZA 2RDUA 3GIQA 2FZMA 4UFLA 1OFRA 3S5NA 6REQA 4RV8A 2EQ6A 1EDTA 4C90A 1TR1A 2VI0A 4PMDA 2PF0A 1N62C 2O56A 1YQZA 1NDVA 5HA7A 1B0IA 2PBGA 5FS9A 4XD4A 3L4UA 4XVDA 2B4GA 2WCGA 4ADTA 2V2HA 1BYAA 3UZXA 1WDDA 3MZ2A 2BY2A 3N29A 3OLEA 3EX2A 3GRSA 5D05A 1EO5A 3P5YA 1XKYA 3SO7A 1VIWA 4JHOA 5HUOA 3GDKA 3QFAA 5AY7A 1K9DA 1UH4A 3EOEA 7REQA 4KEVA 5EA9A 5I00A 4E4UA 2B7NA 2VGIA 4PB4A 3VGBA 1REQA 2CLHA 1JZ3A 1FH7A 3AXHA 4GQGA 2OO6A 3N12A 4PULA 5G5IA 1B4EA 4M82A 3UR2A 3WD4A 2W3RA 4UCGA 2WMIA 1BAGA 1XH0A 4Q4QA 4K8DA 4ZO8A 3O3RA 3NL3A 3WX7A 1J12A 3NPUA 3T8QA 3APYA 4KGLA 1K8YA 3V5OA 1S2AA 5LNVA 4M6UA 4PUKA 4AX6A 3N11A 2WXDM 3CQ0A 4D72A 3FGCB 3HZ3A 2X50A 4HN4A 1KWGA 2YXOA 5GRTA 1WDPA 1RBOB 5E0FA 3VXGA 1XH1A 4DAIA 3O0HA 5CBBA 4C1KA 2RDTA 1OZQA 1PX3A 2QUMA 5HPOA 3ICJA 4YL2A 3IGHX 2EJAA 2QJGA 3LX9A 1A3WA 1TWWA 3VNMA 2VVNA 1RP9A 4FNSA 4MWAB 4O18A 3D46A 1H09A 4ZVJA 1V93A 1XQLA 3BW2A 5I2UA 4QRNA 3RX4A 1T3QC 3DXIA 1XGDA 3FGCA 4BQ4A 1S5NA 3CAKA 3TTQA 3F2CA 1EIBA 5F4SA 1R8LA 1TR9A 3F7JA 4GA8A 3URAA 4F2UA 3FAXA 2DZUA 3UG5A 3N15A 2OX1A 3LGGA 4AQLA 3TXZA 2X40A 3KOWA 3SY1A 1YADA 2B0MA 1KB3A 4AWTA 4WK9A 3MKVA 3L5AA 1ZBKA 5E70A 3K2GA 3ZT7A 2Y8KA 4D6HA 3BW4A 3ZM8A 1EPXA 1RQEA 5LNUA 1HP5A 5JBDA 2DSVA 2QDEA 5E5CA 5FAGA 3CH0A 4DHGA 3PZGA 3S1VA 1GOMA 1NY1A 3VDAA 4GQQA 1DYSA 4HU0A 1V03A 4K7VA 1L9WA 1Z89A 3QKEA 1O68A 2HK0A 3ZMRA 3UEQA 1E43A 5EMYA 1ICSA 1AZ2A 4XZ9A 1DIKA 4GK8A 2HE5A 4PUDA 1M6IA 2WHMA 4LF2A 4CD8A 3STPA 3NQGA 2VFDA 5TIMA 3OW1A 1JZ6A 1FECA 2PU1A 2EPHA 4OV4A 3CU2A 3WQFA 1V79A 3N2BA 4AWEA 3C8FA 3B04A 5HNUA 2ISVA 3NOYA 4UUIA 5E09A 3N9RA 1FWCC 3NEHA 5E6ZA 2CIPA 3UERA 3AMKA 5B7YA 1U1HA 2BHZA 2IPFA 1IZCA 1AQMA 5M1TA 1D3HA 3LNMA 4ZXLA 4UNLA 1H6VA 1LP6A 4P8WA 1H2JA 4LCRA 1EEPA 1MQRA 3W7HA 4TMCA 1Q8JA 1W31A 3FG2P 3HG3A 4IIGA 2H90A 3FAWA 4XO6A 1V3IA 3VGEA 2VX5A 3MDWA 1JGMA 3F5JA 4ZA0A 4H9TA 4DAFA 3UJEA 3VOHA 2WLZA 4MLJA 5DXYA 3RU8X 3TYBA 4Y6GA 3UXIA 4QP0A 4JTIA 3GH5A 4JDYA 4KCTA 2X1SA 3VINA 2WNQA 3E1F1 5HQEA 4EQXA 1JPDX 3B8TA 1JPMA 1UIPA 1F7BA 1WYGA 1AOGA 4D1IA 1BXCA 4B3ZA 1M68A 3DG6A 2VKZG 3WG6A 1B3YA 3DEQA 3TW9A 1DWFM 1GOWA 2VM8A 2F2KA 3GUGA 5D2YA 2Y62A 1SZGA 4GUGA 2WANA 1Q6FA 3QGAC 3QTPA 4JXCA 4L9YA 2GYIA 4ZMGA 2GR0A 2W63A 3KZPA 4GC4A 1PIGA 3DYMA 6CGTA 4NJGA 4H7ZA 4J5NA 2G3FA 1DXFA 4FDCB 2GR1A 4RKAA 3SCQA 2Q3OA 3SR6B 1RH9A 2DZAA 4GFSA 2QZRA 2WW5A 4AVNA 2DJXA 2Z1VA 4EPEC 2GWNA 4CEXC 3LTYA 1XRFA 3KEHA 1STZA 3RFAA 1OG0A 3ANUA 4ZFCA 1BXBA 2V30A 3EDEA 4ORMA 3BXWA 4QHRA 1OIMA 3O06A 4XO7A 3HIJA 4GBDA 1TYPA 3HA1A 4W7UA 3O1NA 3ITGA 1YDNA 1GOQA 3PPCA 3WQWA 4FK9A 2Y89A 3DKLA 4KRUA 2X7WA 1H5VA 2XU2A 1GQNA 1TPDA 1R3TA 3U5YA 2XN2A 4PL1A 1H11A 3LPFA 2DVTA 2IKHA 5KZDA 4I9MA 1MOKA 1ADOA 3WD3A 3VFCA 2WSRA 1IXOA 3S1UA 3UXKA 1DBTA 2XGIA 5CZJA 3T55A 1WKFA 4Y9OA 5G2WA 3FYPA 1LBLA 3B0XA 2Z24A 1ZFJA 1IIHA 5G2HA 4GYJA 2WPGA 2WB5A 4QIUA 1PKNA 3NQ6A 2QNEA 3TJ4A 1TMHA 4PCFA 1YPIA 4NEVA 4H2CA 1UKQA 1J4EA 2GUUA 1X1NA 3AJ7A 1W9BM 4L80A 2V5CA 3ALFA 2FPVA 2VDHA 2FKPA 4JHZA 1GOOA 3BGGA 4LNYA 3NPXA 2XGZA 1JDCA 1UZHA 3VZZA 1MMFA 4LYRA 4QITA 2CFYA 2HPIA 4JQ4A 3NL2A 3WLOA 1X38A 3WF2A 1VHCA 2UV8G 4B5XA 1V51A 4I9JA 4O4VA 1FWHC 5BRPA 4F9DA 5G1YA 3NPVA 3GXMA 2NWRA 4AZHA 2DSZA 1H7XA 4E2VA 3GXNA 2ZDRA 3W38A 3WQ8A 1CTNA 4CN6A 4FS9A 1PCWA 2GJPA 4P7QA 3WMSA 3QFWA 1KBBA 4H6RA 1YDYA 3HB9A 4NNAA 2GUBA 3LPOA 1YEYA 1E6XM 4EANA 3DJGX 4DXXA 3RR1A 2R82A 2V5LA 4GZ7A 5REQA 5A8OA 3HQ1A 2Y5JA 4PBGA 2FQIA 3II1A 1LRQA 2D20A 3KCOA 4JIPA 4AW7A 2QUTA 5HNNA 1SZRA 1L6WA 1VFLA 1LQ2A 3TV8A 3UCQA 3BV7A 2CKSA 4TR9A 5FCZA 4JTRA 4W89A 3NVZB 1EJRC 1N5XA 1UQZA 1G1YA 2BLEA 5M3WA 1X2HA 2J6XA 4US5A 3TE9A 2ZUSA 1KR0A 2YL8A 4CEUC 1AZ1A 2OJPA 3N4EA 3VMOA 1JPIA 4L4OA 3BAIA 4H4YA 5JQ9A 4KEUA 2ZTKA 1SZEA 3ARRA 1T5AA 2J47A 1CEOA 1K7EA 1TCMA 1UROA 3W6LA 2F61A 2IPWA 3B8IA 3FYOA 2CLMA 4C6FA 2YDAA 1BYCA 4YXGA 4DI9A 5GNYA 2X05A 3RYSA 2CZEA 3B8SA 3QEZA 2C3ZA 4GISA 2HCVA 3GC5A 1OVDA 4M6QA 3L21A 2W3SA 2W91A 4BKNA 1VCVA 1EUAA 3VZXA 3GLCA 4INFA 4RE2A 1IE7C 4C6QA 2YVGA 2XIIA 2QUUA 5IHSA 2FPYA 1QHOA 4GYPA 3O6AA 1IIGA 3PJTA 5KZ6A 3PBYA 4JQ9A 3IJ9A 2A3AA 1W3HA 3R25A 2QIWA 1F73A 4UQAA 1GKRA 4X63A 3TQKA 1MZRA 2QW5A 2ZUMA 4F0LA 1CT5A 3UWVA 1RPXA 2RGMA 5A69A 2E68A 3W2JA 1C7SA 4JHMA 1Q4NX 3GBDA 3NG3A 3RLGA 1JXJA 3GK0A 2XIMA 1UZ4A 3DFSA 1NU5A 3WLKX 3CXBA 2VFIA 2J78A 1QDSA 5I09A 1JCNA 2Z1WA 4KFOA 2EHHA 1K1DA 3I3BA 1NQ6A 2PDWA 5LIWX 4QX4A 2NT0A 3OZYA 3PG9A 2QPUA 3EKGA 1F4HA 4LS1A 4WKHA 2WJFA 4BEQA 4QR6A 3IJDA 2PB1A 4Q33A 3Q58A 1FCBA 3ARPA 3ITVA 2IXUA 1B3ZA 4EXBA 2D23A 1A5SA 1KXTA 4UTWA 4KCWA 3I3DA 1E70M 5D2XA 4OV9A 1TPVA 2WCAA 2X1UA 1FHLA 3DHPA 3PB2A 3PN8A 2ISFA 1GVYA 4U3CA 4PCTA 4KPLA 4LUTB 1TE6A 2BY3A 1Y5XA 4DN1A 2DZPA 2VMFA 2WPCA 2QF7A 3TZFA 5A6AA 2GGEA 3ZWTA 3MI6A 4BWLC 1FWEC 2PGWA 5CG7A 6PTDA 2XIJA 4LUJA 3UGVA 1OC7A 3C0JA 1W1IE 1WO2A 1PZ0A 4J40A 2Z7KA 3WD1A 3MMTA 3UG8A 2VEPA 1WB0A 4Z1DA 3WLIA 1CX9A 3SFKA 3H2OA 2AKZA 4Q8NA 1N8IA 4ZB2A 4DRSA 3NNTA 3N25A 3BLDA 1X8FA 1AA1B 4B4HA 4X60A 1US0A 2E1WA 3JW7A 4XKYA 4R85A 4KCUA 1V5XA 5DY2A 3STEA 3M64A 2PWUA 3N6HA 1H51A 4H6EA 2D2GA 4FX7A 3CLMA 4X0VA 4PN2A 4ZQCA 2VC9A 2VEFA 1UW9A 4DUOA 1L0PA 1LORA 3I7SA 3DI1A 3TJLA 3M16A 3ITCA 1ZAJA 2WZTA 4F8XA 1JRPA 1RAKA 4AU0A 1JGIA 1ZPTA 4H00A 2QR6A 4A8NA 1MO0A 3R94A 3MJMA 1GT8A 1OCJA 3BC9A 4EPDC 4H4TA 4PUEA 4IFOA 2GRTA 4Y8EA 1TZZA 2IW0A 4O13A 1P0DA 1W1B1 2YDQA 3P2VA 3VCNA 5GVJA 3AAMA 1EGMA 1ZALA 2A3BA 3MP3A 2W61A 4I7WA 3ES7A 3BL3A 5C7VA 1HJVA 1H61A 2WOWA 3SR7A 1XPYA 4UZUA 2NV9A 1E51A 1HP4A 1SO6A 2Q02A 1DIEA 4PMZA 4P8XA 2DFAA 1E5JA 1XD1A 5E9XA 1WP6A 1YYAA 2EO7A 4Q32A 2OLAA 1OD0A 1E71M 2V2CA 4IXXA 3W84A 3A7AA 3HW2A 3C0LA 3W7CA 1NEYA 5HANA 3H55A 1LCOA 4H04A 3S1GA 1RK6A 3LXBA 3G77A 5BOOA 1XYFA 4GNKB 4ZGYA 2ACQA 3R43A 2YBTA 3G1RA 1IXNA 3WLRA 2C1HA 5D9OA 4BA0A 3KBMA 1RY8A 5LGXA 1LOQA 4PRWA 3EMZA 2Z28A 3T09A 1O12A 4O1EA 2XZ9A 2PCEA 4QG6A 1UBPC 3CGCA 3MSRA 4GY0A 1F3XA 3WH9A 3E2QA 1LF1A 1LL4A 1K8XA 1OBAA 1KRMA 3LA4A 4DWSD 3EEGA 3G6LA 3KCJA 3TC6A 2GJLA 3HPZA 3WJXA 3S46A 1ZCCA 2QF8A 4F4RA 4Z1AA 1W5OA 2B7PA 2JGQA 3UQNA 1HO1A 4HJFA 1R7AA 3CEPA 1JYNA 1PSCA 5G5GB 4IFKA 1XG3A 1L6FA 2RHGA 2O0TA 1IEIA 1EXBA 2OQYA 1TRDA 3FNDA 5HUPA 5LHEA 4S3JA 4NQ1A 2JEQA 3IK4A 1H7OA 3TYDA 4JTDA 4XAFA 4Q4MA 1QNPA 5DX7A 1GERA 3WDHA 5HK4A 1FFRA 2NZLA 4V1YA 4EVZA 1SO3A 4PTWA 3LS9A 3T07A 4TV5A 2PS2A 4GI9A 3IK2A 3BANA 1P0NA 2GQ8A 4S3EA 1TPFA 4JQ1A 1JYXA 3AQUA 1VJIA 1S2TA 1THFD 1Z44A 1EPVA 5DRIA 3L9CA 3L4XA 4GJ1A 3MTWA 1JCTA 1R9XA 5CSRA 2VDIA 2XZ7A 5I3FA 2A21A 3W22A 2DORA 1XCWA 3KE0A 1E9IA 2J8TA 4KS0A 1WNOA 1KM3A 3M5ZA 3DFPA 1B3OA 5CEWA 4YVVA 1P6WA 4AD1A 4ZTXA 1IGWA 4LVBA 4UWMA 1W1VA 3VO0A 2F8QA 3T4WA 4MJMA 2AKMA 4W84A 3FXYA 3LTSA 1VR6A 2GDVA 2OYMA 3U2ZA 1TA3B 2DIKA 2DQXA 4XISA 3WCZA 2OR2A 2PDCA 3OPSA 1ZHAA 5FF3A 1KTCA 2BS9A 2WMKA 1CLXA 2PDGA 2V5KA 1XQKA 1KCKA 5FF0A 1TPC1 3UJRA 1S46A 3WF0A 5DO8A 3H2NA 5EBAA 2CNCA 5G5HB 3B05A 1G6CA 1VEMA 3MUXA 4GH3A 3KX6A 3DIPA 3WKZA 5H91A 3I7RA 5IBXC 3VOCA 1W91A 4LEFA 1M41A 3A13A 3LXAA 4RCXA 4WJ8A 2H3DA 3BMWA 3C2FA 3R0KA 4GKTA 1K70A 4NZCA 3LHYA 3AYVA 1O5KA 1IWBA 4MWAA 3TA9A 4NJHA 5CSSA 4X0NA 2CHOA 4LUIA 3CS2A 3G3MA 4JIEA 3VD9A 3TMLA 2AMGA 1ALDA 4D6CA 3DGRA 4LFYA 1HXJA 4Y9NA 3T8LA 3NXFA 1V3MA 4Q8QA 5I3JA 3LGEA 4GIRA 3QN3A 4DEFA 3UWUA 1NARA 1BHGA 1YNPA 1AVAA 3GXTA 3VPLA 1QOPA 4Z2IA 1BSLA 2FZBA 1QFEA 2OVLA 5DN1A 4WY0F 3MMWA 5BCAA 2G0WA 4WSHA 1PCKA 3O0FA 2NVKX 2DUAA 2QUNA 1DJZA 3VOIA 1JQXA 4AD4A 1I2PA 3BMVA 3KBNA 1YTKA 4QM1A 1S2VA 2YL9A 4YTQA 2EQDA 3WNLA 3B4UA 4O28A 5EYWA 3H70A 5IXEA 1OCNA 3PTMA 4WVXA 3WZ0E 3OQ8A 4AZ7A 3L5OA 3CUFA 2Y7GA 4PE8A 3UPMA 1GOIA 3AIVA 3TFXA 4RW5A 3K8MA 3BV4A 3WD2A 3S5YA 4ATDA 2CBVA 1SFTA 2VZUA 3TLQA 3SGGA 4J3WA 3TK7A 1UKSA 4D1JA 1GGOA 5ABTA 5BZAA 4MPKA 3GNOA 4DWDA 1GRAA 2BZNA 3AU2A 3CB8A 2BVYA 1VPXA 3LENA 4ORIA 3K1DA 2P53A 1R2TA 4B9ZA 3NYDA 4AUBA 5HPCA 4B4FA 3OVQA 1TMQA 1JR1A 4N6EA 3FHAA 5JVLA 5TQLA 2O4MA 1EL3A 5FA5A 2CHRA 3L4WA 4A3UA 1R30A 3WELA 4RDYA 3EUB3 5FSDC 3EDJA 4MPQA 4LPCA 1RA0A 4DF1A 1OZMA 1S3HA 5JCLA 3UZWA 2JQXA 3REQA 1PYMA 2VD9A 2D2HA 4ZOEA 1HKIA 4LX4A 4RNFA 4DM1A 3GTXA 1UPMB 1OD8A 1OCBA 1XRTA 5CC6A 2Q6ZA 1TPEA 4FLOA 4S23A 3Q37A 1S5MA 3NZRA 1B3WA 3A3WA 2EPOA 4EK7A 5D9NA 1GHSA 3A12A 3WDRA 3LHWA 1J10A 3F4VA 2XVGA 3TU9A 5IRPA 2ZX5A 3QHNA 1JNDA 4HT3A 5CC3A 4UFIA 5D09A 2Z00A 4M51A 1EHAA 4MWAD 1SYTA 1K3UA 1SMDA 3BOLA 4MYXA 2UY2A 3KTSA 1ADSA 4G56A 2ZKMX 3XISA 1DTUA 5BYWA 1ME9A 2W3ZA 4WEVX 2WVVB 4UR8A 4YLWA 3PTDA 4IMEA 2JK2A 4XIMA 3OYXA 1JRBA 4UTTC 2BGNE 5DY3A 3P60A 4I8DA 3GC2A 4AZBA 1NHRA 4C6BA 1H5YA 3RJYA 4IJRA 3QH2A 4JDBA 4C6OA 3CMJA 1EJVC 2PWHA 4NZ1A 3PF3A 5FS8A 2Y4SA 2YAUA 1KFEA 1UD4A 4J2PA 4HPNA 4JGDA 4CGTA 4IX2A 3AISA 1WDSA 1RBAA 2H8XA 1HT6A 3NSNA 3VTRA 2XFYA 1EKOA 5JBEA 5EFDA 3SN4A 5A6BD 1AODA 4NRSA 3SRKA 2J25A 3OGVA 2GOUA 3CT7A 1WZMA 3ZVIA 2X2YA 3LCWA 1QR7A 3PS7A 5H8UA 2NVAA 5DANA 4IPNB 1DQUA 3GHSA 4OECA 2D2OA 3R89A 3WLQA 4W88A 4GIEA 1V02A 1P1XA 2QXWA 1ECQA 5A2AA 2GGJA 3UWZA 5F4WA 3ZLGA 1XLAA 3KCLA 3I6RA 4Q7NA 3N2TA 2I5GA 3DKJA 3EEZA 1PO9A 1UR0A 1DPMA 1M7JA 1MYRA 4L1WA 4PTVA 3KBJA 3QGKC 4E8DA 3BG3A 4X9YA 1OHLA 3W6YA 3DG3A 2QGYA 2GLKA 2YCJA 4K7YA 4C6DA 2DZBA 3W1RA 4Z08A 3KLJA 4GCAA 3WNOA 2QDHA 3MKCA 3UGRA 4JEQA 2CLIA 4FNQA 3O0KA 4J3VA 4GGBA 1QPNA 2WVTA 5I3IA 2OWWA 2O7SA 4UTTA 4GZJA 2DH3A 1UWIA 4WOQA 1W5QA 1F8MA 1WZLA 2C15A 4GPNA 9XIMA 3WN6A 4S2CA 2Z0IA 4CU8A 2HNHA 3WLMA 5K9CA 1JFXA 1UBSA 3K8KA 1VD6A 3F5LA 1JCYA 4LVAA 5L9FA 1WKYA 2PURA 3EYPA 5F2LA 1MNSA 4XZNX 3VYLA 5GJNA 1E0WA 5SWUA 2C3DA 2XDFA 2D0GA 2WQDA 1FFUC 3E2VA 4H8NA 4G7FA 3RK8A 3IRSA 3P80A 2OSWA 2PLJA 5BXSA 3NGJA 2G4JA 3UY7A 4HYVA 4JICA 3ZOAA 4JIQA 1JVNA 1VENA 4FMVA 1BEUA 1UMYA 1G01A 1Z69A 5HNTA 2PC4A 2BVTA 2WP5A 1UPPA 3D5HA 1ISVA 3SCUA 4GG9A 2WHLA 4IQLA 4IICA 4BQ3A 1FWIC 2PDFA 3FW6A 4F9JA 2VD8A 9RUBA 1VFUA 2H8ZA 2ZRVA 2ANUA 1G4TA 1I2RA 1HTIA 3QV6A 3SSZA 4Y9AA 4NSBA 4QDWA 2J6VA 1DEDA 3UVAA 4LC6A 1OINA 4AZGA 4L61A 3HJZA 2PTDA 3G8EA 3VIKA 3AM9A 2WNWA 3G18A 3E49A 3JZEA 4BI7A 1DJXA 5C54A 3VZYA 2I7GA 4RE0A 3AMZA 4ZXOA 2WVUA 1TX2A 1I2QA 1V77A 1H0GA 4UB9A 1S3TC 4FI4A 1UUOA 3IIXA 1JCLA 1Z6KA 1PIIA 4FHAA 3V0TA 3WO8A 1UJQA 2I1OA 2ZZ7A 3R0UA 3POCA 3SJ3A 1TJ0A 3T44A 3WEOA 5CCZA 4N4QA 2OLSA 2XVNA 5JCIA 2A8XA 1JPHA 4PSRA 3VIOA 5BXRA 1E0UA 1QI2A 3G1YA 1FRBA 2ZRXA 1JUBA 3WIJA 1MEWA 4IPJA 4CN1A 3PWGA 4G7EB 1EGZA 3UD6A 1EWDA 4XQ6A 4X2PA 1N82A 1CGVA 4H8UA 2IKJA 1H50A 3UP8A 3CL7A 3GVGA 4QG9A 3R10A 3BSMA 1GVIA 3ZR5A 1R86A 3Q45A 1UR2A 1W9UA 3P74A 1GQKA 1YE4A 3ZLHA 3MUZ1 5A6MA 2Z6IA 3QTGA 3IJ8A 5CJMA 2QCEA 3NZPA 4EQRA 2C79A 3B0UX 1E72M 3AROA 5J5DA 4L6DA 2FZNA 4PUMA 2WBKA 2SFPA 5G4HC 3LERA 4BWLA 1BQGA 5DBUA 3T2OA 4UIOA 1SU5A 1OG6A 2PP0A 2F5ZA 1MI3A 4GVHA 4H1ZA 3OGSA 4TX8A 2ACRA 4BY3A 5ABHA 4YCOA 3W2UA 1ZTVA 2VYOA 1HL9A 4DJDA 3HPFA 5ABGA 2YDSA 4ERAA 3V0SA 3NQEA 1IR2A 2C0HA 4WRHA 4JIIX 2C0AA 1JNEA 1K7FA 5AN7A 2J75A 4B5TA 1X96A 1QBBA 3W4RA 4XK2A 2Y8VA 2UY4A 1D8WA 1CB2A 3LI1A 4UFMA 3W74A 3ANYA 1E55A 2DZVA 2A7PA 1W5PA 3CHVA 4N4PA 4U2YA 2YA1A 3IV3A 4OBRA 4TX9A 5IFTA 3NQBA 3WBAA 4IQJA 4LYKA 4OOZA 3AUOA 1HUVA 2DVXA 2CITA 4DJDC 1ONFA 2NT1A 4B9YA 4Z42C 1VH7A 2OGYA 3DFNA 2GGIA 1GQIA 4AEFA 4OTKA 4DBDA 5G4WA 2OQLA 3V1HA 1F05A 1YTDA 2ZTJA 4M56A 3M46A 3MCMA 3C2RA 3WSUA 1V6TA 1JQVA 3JUGA 3N9KA 4MDOA 1V7YA 3GNNA 2W0HA 4PTMA 2NX3A 3DGHA 1OABA 4GRSA 3FDKA 1VQTA 1UP2A 1SMAA 1PYFA 2WAGA 4P5UA 1DWGM 1SGJA 3WQOA 1G4EA 3SQLA 4XAGA 4K1WA 3G0UA 3MZNA 3QJAA 1UMLA 4K68A 1V97A 5D37A 1ZL1A 2R1KA 5CG0A 4CQCA 4LT9A 3WLLA 1EYEA 4WDWA 4LANA 3C0QA 5EBKA 1TV4A 2ODOA 4W5ZA 3P93A 3BDKA 2PUZA 4QJ1A 1PB0A 3HFYA 1K8ZA 2VUNA 5F2MA 3SI9A 5DLCA 2EF9A 1QT1A 1TG7A 3SCTA 4C6MA 3S6TA 1ZU8A 4NASA 2D24A 1R87A 5D2WA 4DZ5A 5LIKX 4Q8TA 3IUHA 1F6YA 1UZ1A 3I4EA 1ZJBA 2XYLA 1FWTA 2CHNA 2E5AA 3PFRA 5D30A 4QCEA 5BMWA 4Q8OA 3NUKA 2EG6A 2NUYA 5A1AA 1AUSL 2A3CA 4K39A 4JEJA 4QAWA 3RF9A 1Q6CA 1TZ7A 1MRQA 1RK5A 1GOXA 1TQXA 6TAAA 3BLKA 4EQSA 4J35A 1HIZA 2NQZA 3L2IA 5LA1A 1XCXA 3AS2A 3FY1A 1XLFA 1XW8A 3MV11 4B5UA 4H9YA 3FXGA 5ABEA 1CGUA 2PC8A 5U25A 1E4LA 2QCMA 3KDNA 4GJIA 1KKRA 3MVIA 1EX1A 2NXHA 5FOOA 2IPJA 2O4QA 1ONRA 4H4QA 3KHJA 2J62A 1N7KA 1XDLA 3O6DA 4N9BA 4GC3A 3T0CA 2GQWA 3TZNA 3C2OA 3BLOA 2I57A 4MNKA 2EG7A 5D4YA 2WBGA 3QF0A 1ZZMA 4LBRA 1CIUA 3LPGA 5K7JA 4DX3A 4HQVA 1R5YA 2GWGA 1JXKA 2GVJA 1CECA 3CHEA 3ZR4A 3VE9A 2YYUA 4B90A 1ZNNA 2AL2A 3QW4B 3GXPA 4M6VA 4MZYA 2ZZ3A 2J8GA 4MB3A 3HO8A 2F38A 1KFCA 5AVHA 4LW7A 1SW0A 2PODA 4PRTA 5XIMA 4FXRA 1ZS2A 3ZYZA 2J8FA 1O6IA 3HG4A 2VFHA 3GR8A 3Q65A 4AG0A 4AFYA 3PWIA 1H2IA 4KRTA 1FTXA 2W27A 3G1XA 1W5MA 5HMFA 4GY1A 1KN0A 2X2GA 3RM9A 3AJXA 1A0CA 1RD6A 2QIIA 4S3KA 4Z2KA 5AC7A 3NM3A 1WXYA 2VZOA 4JIRA 3WK2A 3AHZA 1JPKA 2PWVA 1EO7A 5AHEA 1R3YA 3GFYA 1XX1A 1I0BA 2DEPA 3VUSA 2WSPA 1TTQA 2TYSA 4P7NA 1JDEA 4X9SA 2WC3A 5DMNA 1XWYA 3B40A 2BOEX 2BXZA 1QVBA 4DZHA 3UCDA 1CGXA 2QJHA 4W86A 5CBIA 2DDXA 2PRHA 2XN1A 4M1RA 1HVXA 1KBIA 3VCCA 2G8ZA 1ML1A 5KETA 2VCCA 2H9AA 3W2LA 3ZT5A 3AIEA 5HJYA 1WZKA 3N6QA 3ELFA 1NWRA 3NVTA 1V8EA 3K13A 3CIWA 4HYWA 4MUPA 1HKMA 2A7RA 1UKTA 3NVYB 3W7JA 1PZ3A 2DY3A 3KXQA 4B15A 1I0DA 2XG9A 5F1VA 1TJ1A 3UA4A 2ZIDA 1PX8A 2QPSA 3NQ2A 3ABSA 4R53A 1PDZA 3ZJKA 1OFAA 1W37A 4IPIA 2FVKA 3E5BA 4M80A 3NDOA 4N02A 3VGGA 1VYPX 3TH6A 3W1AA 2O9RA 2CLPA 3WUBA 2FHCA 4F0RA 1K8CA 4AH7A 1QW9A 2E4TA 3GO2A 4E38A 1HFBA 4DWSC 1XUZA 1P7TA 4MNLA 3U2CA 2DT2A 4GCXA 2J77A 1TRIA 3ORWA 1XR2A 5M17A 2GGGA 3IS4A 4UTLA 4QDPA 1EC9A 2CCRA 5AKQA 2W62A 4E0CA 2DW7A 2JKPA 5DRCA 1EF2A 4YN5A 3N14A 1QNSA 1SFJA 2G41A 3CHFA 4GKLA 3CWOX 1TV5A 1IYXA 1VBRA 4ZO9A 4S2BA 3NS1B 2FMNA 2BB0A 2RH9A 1XFCA 2WKJA 3FDGA 3R8HA 5FF2A 2IKIA 5JCKA 1OFBA 1WPCA 3A3XA 1V3LA 1GNXA 1AJZA 4FEZA 4PSPA 4M19A 1XYBA 3ECQA 4BF9A 1JF6A 3HBLA 4F0KA 3FVDA 4V28A 3QMSA 3QMTA 2X0YA 2WKLA 3TTYA 4G7EA 3DOPA 3VKBA 1DKWA 3QR3A 3UCCA 1TJ2A 5I5RA 1ONEA 1VQZA 4S3CA 1CDGA 1VJSA 3IC9A 3NRZB 5FKYA 1J0ZA 3H2MA 1ZQ5A 1XL9A 3RX2A 2ZWZA 4W8BA 5KEZA 1TWDA 2QUVA 2WC7A 1MFUA 3GG0A 3UYIA 3ES8A 2QGHA 4KW2A 2J7FA 3OA3A 4I5UA 1B30A 4BJHA 5CGMA 4C7FA 4JS3A 1J6PA 3WQ5A 3QLDA 4XZBA 1P0BA 3SJNA 5CJNA 3URHA 4BS0A 5AYZA 4LRTA 1B4KA 1KGUA 3UXDA 4ICCX 3VX1A 3SUWA 1JF5A 1T6MA 1E0TA 4PB5A 1T7LA 3S5OA 3N6JA 3SY5A 4L1GA 1M7OA 3W7NA 1EQPA 2J7GA 3MC5A 1JZ8A 2A79A 2ZX6A 2ZE0A 2VWSA 3MUCA 1WDQA 3GW3A 5G1TA 1IWPA 3LUTA 2O9OA 1ZCOA 2PDHA 1LG2A 4K6AA 1VRDA 5EMJA 4P61A 2YPIA 3QQ0A 3M9YA 4EACA 1TE1A 4OBTA 2HBVA 4QTGA 2Z27A 4H9MA 4NYUA 4H9VA 1KM0A 4O19A 1ZGDA 3G1AA 4E8GA 4CN4A 4QEEA 3BZJA 4JX4A 3A9BA 3WBWA 4NYYA 1PPIA 4Q3MA 4HB7A 3LHUA 1X7FA 1JZ4A 4JTUA 1SB3B 5M03A 5CQ1A 1J6OA 3C4UA 2V0TA 1UR8A 4ZEPA 1XJBA 3KTCA 4UOZA 2J27A 4M7SA 2GDUA 3TSMA 3CNYA 4XZWA 3L4ZA 5MF5A 3LD5A 2VHLA 4EM3A 4OE7A 1XIDA 1F8WA 1L8PA 4RNJA 2WPBA 4KT2A 2F7FA 1DWJM 4GUJA 4H4RA 1UD5A 4M52A 1Q65A 2E8ZA 2GZXA 3EPMA 1ZLPA 4HNOA 4WY0B 3II4A 1DQWA 1KLZA 2WNZA 2KAUC 4S3GA 3SCPA 2CLEA 3P0XA 2Y7DA 4O8RA 2NVCA 3NTYA 2CXEA 3MUAA 3R79A 3V5CA 4A21A 4N6FA 1L2QA 1XIEA 2V68A 5E93A 2DU2A 4O16A 2QJMA 1S38A 1BFNA 4QLLA 1DJQA 2EPMX 4ICMA 1S7MA 3EX6A 5AB3A 3W6MA 4D8AA 4QCFA 2WJZA 1J01A 1Q6LA 3AHVA 1MNZA 1QHPA 1SR0A 5G1MA 3GQYA 3B9AA 3FCPA 1FWSA 4IGHA 2R91A 5JIPA 2OKTA 4LUSB 3YPIA 2PLCA 2PDPA 1QNRA 1T99A 5D2VA 4HU8A 2VENA 5EBUA 2FVMA 1I2OA 1LOLA 1MW3A 1I4NA 4WKFA 1VEOA 3CWNA 1YXYA 2ZFAA 1HKVA 4QS5A 1X39A 3EKZA 5ER0A 3RCNA 1LJYA 4HN8A 3VOGA 1XIHA 3R8RA 3CMFA 3MBDA 4S3AA 1DJHA 1RM6B 3LRKA 1K9EA 3E0VA 2PMQA 2V9DA 2VFGA 4CNSA 2YIHA 1TVNA 1OX6A 1F76A 1XIFA 3QKZA 5DCEA 5IBXA 1E4MM 4C60A 3MP5A 3R13A 1BGAA 4ROPA 1EBDA 1MDLA 5TR3A 1G0CA 4TIMA 4XD5A 1X6NA 3C61A 3SCOA 1BPLB 1QPRA 2D2JA 4DM2A 2OOFA 4JPGA 4CUCA 2WJDA 2PF8A 3LLDA 1W3JA 3CPRA 4GX9A 1Z32X 1NOUA 5HBFA 4MADA 4HKPA 4TVUA 5I0DA 3IJIA 4MSSA 1HKWA 3RM4A 1HJQA 5GNXA 3VC6A 5E6YA 3FJ4A 4NZFA 3KP1A 3W1PA 2QJJA 4FAMA 2W92A 3NIYA 5C2GA 3H2CA 1CI1A 3VKAA 4J9JA 3KRUA 4L4PA 1GHRA 1Y5VA 3CV2A 2C6QA 5E0CA 3F03K 1KWKA 3P61A 4TTGA 2G96A 3MY9A 2H3BA 4EF8A 1I6NA 4Q7IA 1POKA 2ZUTA 3O05A 1YE6A 3LPPA 2C3CA 4HPHA 2BTMA 2HWGA 5BNKA 3R11A 3UETA 3EOSA 3NO3A 3OG2A 2GSHA 2FB2A 2I5IA 3N2CA 3F2BA 3PB0A 2QAPA 2W67A 2FB3A 1XIMA 4UTJA 2YCIX 3C0SA 3LLFA 1J0KA 1Q2SA 3NA8A 3PPHA 4YHGA 1Q2RA 1MEIA 2CBUA 3TWBA 3GFZA 1V6UA 3DK8A 3TC3A 4M81A 3S2JA 4M3PA 3DFYA 4JTSA 4AHQA 1XD0A 3DZ1A 2PGEA 3MCNA 3KBVA 5FIPA 1OFEA 4NXSA 1TUFA 3OLDA 1U1JA 1QRQA 1RCXB 1LLZA 5GQBA 4FSAA 3W01A 2J7DA 4CNTA 5KMYA 4KBXA 1P1MA 5FS7A 1XLJA 3GXIA 3O63A 1H0IA 5IDIA 3PZNA 3WK3A 3IUIA 1NPXA 1R3VA 2RKXA 3TW7A 4MB5A 4AZ5A 3HF3A 4A22A 1AJ2A 5F2GA 2GSJA 2IUZA 1CPUA 4R27A 4O1FA 3IVSA 1FWJC 4AXKA 3RNDA 1F3EA 3SM0A 1WCGA 4D8LA 3WLNA 2XFWA 2V82A 3TYZA 1KD0A 4H41A 1M9HA 2EG8A 1J18A 1GRTA 4MB4A 1ITUA 1IXQA 5FACA 1PE1A 2P10A 3S4TA 4IUOA 1XSKA 2GL5A 3M44A 1KGWA 4E2DA 4OT7A 1OYCA 4IJCA 2J74A 3GXDA 3F4NA 1AK5A 4LVFA 4S38A 1IZJA 1WDWA 3R6IA 1BWLA 2HS6A 4NJJA 4O57A 5K9DA 3A23A 1CZ1A 4P8VA 1KGXA 2O9TA 1GTEA 2AAAA 3FOKA 1YTEA 1WE5A 4Z17A 1XXXA 4O1CA 4NZ3A 5EY5A 4J28A 2J9ZA 1V7AA 4CD4A 3QMRA 3W2NA 3CZJA 4E4FA 4YHEA 3AI0A 2VR2A 1KM6A 1IXPA 4O1AA 1TV7A 4WOZA 1VHNA 3O15A 1CWYA 3K8LA 3NSXA 3AMLA 1ZY9A 1PL9A 3G22A 4HHMA 1KCXA 1D9EA 2RJHA 7ODCA 3GC4A 4NUWA 3TNOA 2WV8A 1D7YA 1E9YB 4AC7C 4ERIA 4JFTA 4WY0A 3BJSA 3CZEA 1RUSA 3RJXA 4IT1A 2W66A 4YWSA 4AIEA 1W6TA 4ENLA 2YJQA 1BVZA 5CGTA 3TN5A 5FSEC 3DU0A 2NX1A 6XIMA 1KXHA 1XCFA 2R6OA 3GG7A 3H8AA 1F6PA 3RIKA 1VCGA 4RJEA 2ATSA 2Q01A 3BWWA 1LZOA 4Q8UA 3P5ZA 1Q8AA 3NDYA 3W29A 2XH4A 1WKDA 1KLYA 1FXQA 4S3BA 4R3UA 2ZRZA 1EJSC 3NYZA 2FIQA 1GQLA 1S39A 3WQ4A 3QQ1A 3C8NA 2XH7A 4MG4A 2FGBA 2ZXQA 3M7WA 4RDWA 4QQUA 2ZYFA 3DYPA 4JFSA 4LU0A 1U5JA 4C1NB 1QI3A 1SQ7A 3W85A 3PZIA 2G3IA 1AH4A 4TXEA 2W5FA 3LEPA 4D71A 1EFZA 3ARYA 3ITOA 3T08A 5KSWA 4AVFA 3WF1A 2DH2A 2HMCA 2NXIA 1G4PA 1S1PA 4REQA 1UWTA 8CGTA 3BMXA 1PHQA 3GVVA 4J57A 1J9YA 5D03A 3W27A 1FP8A 1H7RA 3ITLA 1F9CA 1SW3A 3RO6A 1DXEA 4GX8A 4KEMA 3L4TA 3GIYA 2O9PA 1XH2A 3CZLA 3HFTA 3QSTA 4XTIA 3HG5A 1S5TA 4KCVA 4C6CA 5FEXA 4Y2WA 3QOMA 7A3HA 2I56A 2YA2A 2G3MA 3UG3A 3AIRA 1Q5MA 3BCFA 4M29A 2XJ7A 3WF3A 2VVSA 1XBZA 3F4WA 3EOOA 1X6UA 2VRKA 4ZODA 2QV4A 4XIAA 4OWGA 4UR9A 1UWRA 4HSNA 1YDVA 2ZE3A 2XISA 2FTPA 3OBEA 3K30A 4XZHA 3AICA 1EZWA 3V75A 3TOYA 4S1FA 4L4MA 4TU1A 3F4DA 4MWAC 1ENUA 3CB3A 1J0YA 4I7VA 2REQA 4JTQA 2ONEA 1ISYA 1EOKA 2A6LA 2ZXDA 1KCZA 3IUDA 1MQQA 3VNIA 3UNDA 3EDFA 4WDXA 1WAUA 2P3ZA 1VFFA 3BOFA 4UFKA 2BBFA 1Q7QA 3W37A 3DFHA 1UD3A 1UA3A 3SCWA 2NQLA 2W4XA 4ZENA 1BTCA 4YJ5A 3S47A 3QW3A 4QE4A 4GNVA 4CD7A 4LSBA 1X2GA 2YQUA 4HCLA 1ZJIA 3HJEA 3EOLA 3G8RA 1SJCA 1JDAA 3TN4A 2IPGA 1SJBA 4H4UA 1RCOB 3LCGA 3D3FA 2WOQA 5CLWA 1UD6A 1F61A 2Y7FA 3M0HA 3NAVA 3W24A 3P8IA 2X8RA 3N73A 2UBPC 3TJIA 2XPKA 3GX9A 1DJWA 4OQVA 1IQ8A 1WXJA 2ZZ4A 3MP4A 3SUVA 1BSIA 1TA3A 4NT0A 3BLEA 3BQ6A 2FMOA 2Q3RA 3DG7A 4AIOA 2GQAA 3UA3A 3MSDA 1DIDA 3GNPA 3CTTA 3LCFA 4I9TA 4RZ5A 3HGJA 1FDJA 3VNZA 4OHQA 4EIVA 4NAEA 4JYEA 1REQB 4ACZA 4F0SA 1PVNA 3I65A 2Z29A 1H3GA 2OSYA 2V2DA 3DYOA 4FNPA 2W55A 3W1QA 3N18A 4Z2HA 5K3VA 3E0WA 3GU2A 4W8LA 4RZ6A 2BODX 4XTDA 1CXHA 3VIJA 4DO7A 1H7WA 4PODA 5EMLA 3MHGA 2HROA 3WL1A 4J56A 3PJWA 1LBFA 3AS1A 3DENA 4N0RA 3D0CA 3W00A 5JXQA 3TLLA 2VT0A 4BQ2A 1BTMA 2GVYA 4YTUA 3VK5A 1RSCA 4BZYA 4M1BA 4ES4A 4PMVA 3DBNA 5CPOA 2ISDA 3TEVA 4DJFC 4ZO7A 2ZC8A 2VDGA 1UP0A 3EWCA 3CGBA 2CC0A 3LRLA 2V5JA 4A05A 3BAKA 2PRMA 4QE1A 1H1ZA 1P4CA 3KS5A 3BSGA 3A3HA 3UJFA 1B5TA 4LYPA 1N61C 3AMCA 4L6HA 2FH6A 4XAZA 1A3HA 1A5AA 1M5WA 4DBSA 3A5FA 1Q6DA 1JI2A 4U2ZA 2GUYA 5CKSA 3WMBA 7TIMA 3KRSA 2Y61A 4OOUA 2FDSA 3PUOA 3DH9A 1M3UA 3A24A 4EX4A 1O5RA 1JYWA 2J24A 3S83A 1GONA 4PUWA 4I7UA 4IIBA 4TVCA 3T4CA 4DO4A 3APGA 3GTHA 2E40A 2G3NA 4GVIA 2QS8A 3FYYA 1UZDA 1Q6RA 2VEMA 4G5DA 2R1NA 2BOGX 5EMUA 5FMHA 1IEWA 2QVHA 3AXXA 3SIZA 4U4MA 3BW3A 3VIGA 4OU1A 4WJXA 4G9PA 4NHVA 4FB7A 2P3EA 1GYNA 1O60A 5FJTA 4ONVA 2OODA 4AB4A 3PSVA 1RBLA 1ZBVA 4GOAA 3NL6A 3W2KA 2P0OA 3W1XA 3HURA 4H01A 3E74A 3VE7A 2BASA 4AF0A 3KRZA 4Q7BA 3LI0A 4JKKA 4ACZB 1W32A 3E02A 3LM7A 4H4WA 3MO7A 3AN1A 3B03A 1F3TA 4MTVA 4U5IA 4WCJA 1K6AA 3E6EA 4B3KA 3WMCA 4AYSA 2NPXA 1SJDA 2QEZA 3OBAA 1J79A 5AC5A 3PZVA 1SUXA 1YMYA 3SQSA 4GIYA 4H19A 1ODZA 1DJIA 1IEXA 4MM1A 2ALRA 3FEMA 1X1OA 3QV9A 4L64A 2J7HA 4EE9A 4ZL1A 3ZSSA 2FLIA 1OM0A 5LIYX 2X30A 4CQ8A 4G8TA 5C6MA 5FEPA 2VGFA 4W93A 3VOJA 3MHUA 3RDKA 3U4FA 2VUYA 4FZIA 1GZ1A 2VZVA 3QQWA 1MW2A 2E9MA 3AXIA 2VCBA 4LAKA 5KINA 4HTBA 3I68A 1UIOA 3MWCA 2DQWA 1E4IA 3V5FA 1Q6GA 3QYSA 3RHGA 3VGHA 1YBQA 1T8XA 1PTDA 5H2ZA 1O1ZA 1GKQA 1G7UA 4UOJA 4PUUA 5CH9A 3QY8A 4O11A 1Q1WA 5HXMA 1TPH1 1TIMA 1UR9A 3SQMA 1QI4A 2CBIA 1HG3A 3TONA 4Y7EA 3WNPA 3EANA 1A47A 4EPKA 3D6NA 1OF8A 1E4NA 2NUXA 4NL1A 3NGFA 4FF5A 4J3XA 6XIAA 1W0MA 5TAOA 4MKSA 5JUVA 1EZ2A 7TAAA 4LC8A 5JRBA 2FDMA 4KQNA 4QSHA 3IJQA 3W82A 4IQEA 4ZO6A 1MUWA 5D38A 3KLLA 6TIMA 4Q8WA 3AIQA 4ILSA 4APNA 2EQ9A 5AYXA 1UR3M 4HA4A 3VILA 5LNWA 2XWDA 1TCDA 3W87A 3KBWA 2A3EA 1LL6A 3W7GA 1AQ0A 1XLCA 1H7NA 2VFEA 2GJXB 3EB3A 3OZOA 2BY0A 1SZFA 3A4XA 1H1YA 2ZXBA 3FV9A 3FN9A 1OY0A 3WLTA 3GFXA 5LYRA 1E6QM 1B9ZA 5AHFA 1NAL1 3I10A 3GR4A 2WCSA 2WVVA 2Z6JA 2XH2A 4ALDA 2YL6A 3VGDA 1V6WA 3D9XA 3WBEA 1F74A 4O0QA 3FA3A 3IAPA 3OHIA 1GW9A 1FH8A 2PAJA 4MZ1A 5AC8A 4JQ2A 3G1VA 3QZEA 4NRRA 3SUTA 4ML9A 2YL5A 3L0NA 2X09A 3URBA 1AD1A 4HOWA 1KXQA 4H3DA 4XUGA 2PDIA 3AU6A 4GMEA 3WQCA 2ZX7A 1UUMA 3RITA 4CU7A 4HZ7A 3TROA 1NDYA 1R7OA 2ZZ1A 4UMBA 1TV2A 4V33A 3CIXA 3CV7A 2HK1A 3CMGA 3VMNA 4XSMA 4AZCA 3OQEA 1TB3A 4WJEA 1FUYA 1HNYA 3IEBA 4UQEA 3PG8A 1U5VA 2ON3A 2ZZCA 1A0DA 1AMYA 4HNNA 2Z1XA 3DUGA 2VX4A 1LYXA 1EJTC 3QV8A 4CQDA 3LHTA 1FEAA 1MQPA 4DBWA 4ZTYA 1GPFA 3F1QA 1EWEA 3GZ3A 4J1OA 4F2BA 3GDTA 4LY4A 4MFDA 4CQAA 3LLXA 3BG9A 2J88A 3PZMA 3QFEA 1KM1A 2X1IA 3O6YX 3W0KA 1MSSA 3W9ZA 1WA3A 1KKOA 1VIZA 1HJSA 3SAZA 1MEHA 2I17A 3TQ0A 4GVGA 2VELA 2GK1A 4IIDA 3E3HA 1SFSA 5HOSA 3GD3A 2FGLA 4Z0SA 1R9YA 1KFBA 1IV8A 4FLSA 3SCSA 1J0IA 5DELA 2AOSA 3EWUA 4LBSA 3IJ6A 3A7RA 3H2FA 4QBXA 3B06A 4WSJA 4HA0A 3W1TA 3WFAA 4BK9A 3NZGA 5A6BA 1FXPA 3QC3A 1V3KA 2HZGA 4HK7A 4BURA 2Q8LA 1O7AA 4MGGA 4F3HA 2EQ7A 1NFBA 1Q45A 3VAVA 5AZ0A 4D8ZA 3QYQA 3LXDA 1X98A 1Z7AA 5I79A 3TSBA 4AF0B 3NZQA 4H4SA 1OT1A 3ITYA 1X1ZA 3FK4A 2Y7EA 4L5ZA 2P76A 3NFUA 1IT0A 3ISIX 3W88A 4E5TA 4ZOBA 2OEMA 4FX9A 4WHBA 3CGDA 1XG4A 2ZOXA 3RCYA 4EWND 2VL4A 1VKFA 3S2MA 4H9ZA 3VMPA 1M1BA 2NQ9A 1O1HA 5IFPA 2DT0A 4AZ6A 3W02A 3LB0A 1YRRA 2V3EA 4C6EA 3CAVA 4K36A 4N7QA 1XDMA 4F0HA 2PDQA 2OZ8A 5FJIA 4BCEA 4H4IA 2DP3A 2FZ8A 4A8IA 4GWEA 1I1WA 4PTXA 3HN3A 3NZ1A 1CB7B 4IX0A 3K46A 4IJBA 1UHVA 1XLEA 2NV2A 1E6PA 4NVTA 3EA3A 1QATA 4DXKA 3NOEA 1NHSA 5CBJA 3SSJA 1NFPA 4NAFA 5H1WA 1V6VA 1X97A 5AC4A 1I45A 1GTHA 1E9ZB 3GRIA 4W7WA 3FLUA 2BSLA 3W25A 1EUNA 1R2RA 2ZUUA 2ZVIA 4L9ZA 4ADWA 5JCMA 1X8CA 4HZ6A 2R24A 1LUCB 3LSCA 1GVRA 3LK6A 4GINA 3MJYA 1I60A 1KFLA 1DWIM 4FALA 3WQDA 1RZMA 2X8CA 4CNUA 3MYOA 3GW0A 3V7PA 3SRHA 3LQGA 4F66A 2V69A 3IGXA 3OGRA 8A3HA 1P6BA 1GXFA 1T96A 1UC4A 3O7UA 2BVDA 4PMQA 3OIHA 4KWSA 2WZMA 3N2XA 4Z2GA 4A35A 3QPYA 4EKJA 1KFWA 4HVXA 3KW3A 1EEXA 4BI5A 4AY7A 1PTGA 1C29A 3W1MA 4JIHA 3TYUA 2NWSA 3URNA 2DSKA 3UWWA 3AOFA 3MU7A 4W4QA 1VCFA 5AOUA 4RXGA 4MNJA 4JY9A 1EBHA 1LWJA 1BG9A 3MMUA 1ITXA 3MWAA 4AY1A 4AD0A 1C90A 4FA3A 3W7PA 1H1NA 3AIUA 2V67A 1T41A 4HIBA 4S39A 3GM8A 1EJ7L 1XIGA 4BR1A 4UTKA 4JFUA 3QY6A 3ERPA 4NJKA 2Y2WA 2RDWA 1L2UA 1HJWA 3PBGA 2YXXA 1LRNA 4M7TA 1XSJA 2Y6ZA 1OK4A 3N17A 4CNNA 5D32A 1RA5A 5A94A 1GJUA 3PG6A 3NO5A 2GJNA 4O54A 4DNMA 2FZ9A 1KBLA 1OGSA 1EGVA 1B31A 4FNRA 1JOAA 1XLIA 4DJEC 5A6KA 1ICPA 3H21A 4J3UA 5JIWA 1A3XA 1QI5A 1SO5A 2XSXA 4UZSA 3H22A 3NQAA 2QCFA 3V16A 3LB8A 1MUMA 4GO9A 1WAWA 4GXPA 3DX5A 4GUIA 1ZB5A 1Z48A 4EQWA 4GXWA 2DUZA 2R9ZA 3QRHA 4LVDA 3DK4A 4AAJA 4MHBA 4RE4A 2ZA2A 1VLWA 3H54A 5C0QA 1FWBC 4C6JA 3IWPA 3F2DA 3RLUA 4QLJA 1DHPA 3TMQA 1GEQA 1TUXA 1JYVA 4K2SA 1UH2A 1RV8A 3SUUA 3ITTA 5DT7A 2GJXA 3O6CA 3USBA 5HULA 1CENA 4D6IA 1A0EA 3TTSA 3KRBA 1Y5WA 1DTNA 1JD7A 3HTWA 4TV6A 4LGXA 1M01A 2O7QA 2E77A 3NVDA 2BG5A 5AHNA 2VR4A 1OFOA 1B2YA 1LQ0A 4Q8PA 4GZEA 4XD3A 2EKCA 2XWEA 5DMMA 3UZ5A 1HL8A 3A21A 4I8YA 4HZ8A 1RVKA 1PKLA 3WFLA 3QPZA 1BZLA 3PTQA 2G50A 4M6PA 4MJZA 3NXLA 1AG1O 4B2DD 3BICA 1OYAA 4GD0A 2HRWA 1VDVA 4LUYA 1MFVA 4WUIA 2XN0A 1TV3A 2B31A 1KO0A 3B8WA 2PLKA 4DLFA 4J27A 4GJJA 2I14A 3CQJA 3BG5A 3NJ3A 4R7OA 3U4AA 5B7ZA 4ZQNA 2PTYA 1IT8A 1BXNA 3ALGA 3LTPA 3A6OA 3EZ4A 1VYRA 3VX0A 4HPJA 4N42A 4RZBA 1KQZA 4ZQRA 2CZFA 2X16A 4PMYA 3SY8A 3ATYA 3M6DA 2WZEA 3CUXA 4UTMA 1XIBA 1VZWA 5HWMA 2PDYA 2LLEA 4JL2A 2ADAA 1NHQA 3UVIA 3VFLA 4PMUA 1YBQB 1C9WA 1QI0A 4H9UA 1UC5A 4JY8A 1GUVA 2YLAA 5JCNA 1UP3A 1KRBC 4HK6A 2TRSA 1T8QA 2DT1A 3CAWA 1LWHA 1QNQA 1ONWA 3MYPA 4D6GA 1BKSA 4DUWA 3E0LA 1KM2A 4HSOA 2ABAA 3GTNA 2D73A 4KWOA 3HPAA 1XBXA 2ZZ2A 3STGA 5CZKA 1OFQA 3JR2A 3V35A 4X61A 1US3A 1HF6A 1QHZA 2AQWA 2PGRA 2Z2BA 1EH9A 1ZJHA 4QJ5B 3M0MA 2DV0A 3HMJG 1EDQA 1RJPA 3UY8A 1GCYA 1LBMA 4UTFA 5HMSA 3FSUA 2B81A 4HZMA 1WDRA 4Y9MA 3GE7A 1BWKA 3AIBA 3SURA 3N19B 3G3DA 2E8YA 1A5CA 3BCDA 3K4AA 3D3AA 1GPWA 1H4PA 3GNDA 1CLKA 3VUPA 3WYZA 3WDIA 1I2NA 3AWOA 8TIMA 4YVXA 3HQNA 4ADUA 1I9CB 2J4GA 1ZMCA 4GFIA 2TPSA 3S1XA 2OEJA 4BI6A 4DF0A 4A3HA 3DHFA 3PPGA 1Q3NA 1FKXA 4IGSA 2VWTA 2CXGA 4RK8A 4YTRA 3WH7A 4PCPA 3A22A 2G4FA 1VGAA 1EP2A 4UTIA 1NVMA 3EWXA 5CPLA 4Q6JA 1ME8A 1XYAA 4I9AA 4O1DA 1A80A 2VCAA 3TSDA 4LYQA 3R58A 3CAQA 1UJPA 4N9DA 2Z4GA 2ZADA 4XWUA 1E0XA 1JG9A 3U6WA 1VC4A 3Q2DA 1CNVA 3EWBX 4IMFA 3PHAA 2V81A 2E0PA 1M03A 3WJYA 1Q6QA 5HR7A 3W81A 4Z0JA 2D3NA 3LZ5A 3KUMA 3NEVA 2QCLA 2OO0A 3BJFA 3DCPA 1W1TA 3W7MA 3ZWSA 3WBXA 3EOUA 2C71A 1GSNA 4HU3A 4BV6A 4PCNA 2TPRA 3DDMA 5I03A 1YNYA 1CXKA 1GRFA 1F6KA 2I16A 4YWOA 5DMLA 1CGWA 1EX5A 3MB9A 3I6EA 3KDOA 5FEZA 2OLHA 1FCVA 3PBWA 3VIMA 4EXAA 4K8EA 3H2AA 1PAMA 2X99A 1VFSA 2D3LA 2C13A 1UD8A 1S2WA 2Y5EA 1DNCA 3R2GA 5TBOA 3TYAA 4AD5A 2DSUA 2A3HA 2C16A 3CH9A 2G95A 4JOMA 2VEIA 1A5OC 4PB3A 4DPPA 4W7VA 2ACUA 4UQBA 3CWHA 2QQ6A 1VLIA 4PA8A 4Q8MA 3OLGA 5H6HA 5E1QA 3GD4A 3NQ7A 1OT2A 3UWEA 5LA2A 3DJJA 3S1WA 3HGRA 1KC7A 1D8CA 3RU6A 2X1RA 2G37A 3L5MA 3TN6A 4JTKA 3A9IA 3HMCA 3GSMA 3LBOA 4R33A 3P82A 1O5QA 2YFNA 5JU6A 1KV8A 1NELA 1JI1A 3RUBL 4OJYA 3WJZA 3WEMA 2MANA 5JBFA 3S0CA 4Q4PA 1WOAA 4QEHA 3VM7A 3W7IA 1IR1A 1WKEA 1XANA 1TTPA 3V4BA 1B54A 1UKOA 5A2BA 1XLMA 1XM3A 3WH5A 1K9TA 1NDZA 4YTSA 4PUNA 3ZQ9A 1HKJA 5HDRA 1C8XA 2CWNA 4MWAE 3EWZA 3M0IA 5FF7A 4W8AA 4L6OA 1VPQA 1QASA 2QDGA 2R8WA 1OFDA 3Q94A 3LBMA 3AZTA 3W7RA 4Z2JA 4CKQA 1NOWA 3MO4A 4IISA 4PCSA 4B5WA 3R8GA 1ECEA 8XIAA 3VNYA 2HVMA 4AIUA 5EU9A 3O9NA 5CPTA 2EGZA 5MKGA 2OT1A 3KOXA 5KZMA 1DXIA 3M07A 2D0HA 4GE8A 5KVIA 3PNZA 5EMKA 3CM4A 7ENLA 1G4SA 1WYIA 4LWWA 3RN6A 2ZZBA 3L66A 3TUUA 4MIMA 5I02A 4O12A 2WWCA 1OWQA 4CD5A 4MZ8A 1N63C 3TR9A 3EBVA 9CGTA 1W1YA 4QISA 5FEWA 1GREA 3I6TA 1V0KA 1RJRA 5FAJA 3ZO9A 2FJUB 2IS7A 3GY1A 4U10A 4UCFA 4QJ3B 1Q1RA 4HK5A 3IIVA 3H53A 5CLTA 4H50A 1AQHA 3B8UA 4GIAA 1MZHA 3IIOA 4K8GA 4YWIA 2D1ZA 5HAOA 2V3FA 1XP3A 2X42A 5FF4A 5A6LA 2CDUA 1YPFA 4DLMA 4ZE4A 2CESA 4GR1A 3DFTA 4XD6A 5HQMA 4A2RA 2D22A 3H24A 1XBYA 2A0NA 5XINA 3AHXA 4HOXA 3MVTA 1ZBCA 5K2ZA 3T2QA 5M2FX 1EXPA 5BOFA 2YDRA 2PEVA 3OVRA 3OP2A 4IMAA 3PBVA 3MCOA 4REQB 4TO8A 2XFFA 4FP1A 4FIQA 4O14A 2VC6A 2I9EA 4EAMA 3GS6A 2DZWA 1O66A 4LUTA 5GPRA 5A8QA 3H26A 1FCUA 1GWJA 3LV6A 3WH8A 1KM4A 1GJWA 2YA0A 3NM1A 2I9UA 2OTDA 2NQHA 4EPBC 3TKFA 3ARVA 4WKAA 2XH0A 4UQDA 1VAHA 3VM5A 1ZX9A 2BNJA 1XPGA 2Y88A 3PULA 1GRBA 1OF6A 3B8DA 1J5TA 3MUIA 2JALA 4FNTA 5U1OA 3MT1A 1UOKA 2ZCGA 3R5EA 5LXEA 3FSTA 3H2EA 4QNWA 2PI6A 4M0XA 3DGBA 1J0HA 3WD0A 4DI8A 1OADA 3ABRA 4UFJA 3ZJ8A 4ZB0A 1FH9A 4LV4A 1PBGA 1GVOA 4MY8A 5EKYA 2GH5A 2PDXA 4GI6A 5IHRA 3U3HA 2POZA 3GRTA 1BLIA 3AYTA 4DYKA 3FJ6A 2VO5A 1QXLA 3T78A 3F4CA 1W3KA 3RRAA 4XAPA 1C8YA 3RPTA 4H8HA 2J7BA 5FL0A 1ONXA 2PDLA 4ZQMA 3DK9A 3UJ2A 5AYBA 2DZTA 5I3GA 4R7JA 3EDDA 2IMRA 1IWAA 2XIQA 1MXSA 5FESA 1MW0A 4XAYA 1TV8A 3WQEA 4C1LA 1KM5A 1GOKA 4JNYA 3VKDA 2C1IA 2FTYA 1EC7A 4JTGA 2PDMA 3DN5A 4IP7A 1A4LA 3SRDA 1WX0A 4LIIA 4HA3A 3BQ5A 1TTIA 4UFHA 3P84A 2BMBA 3NQDA 2KX9A 5T26A 4JL1A 4O1BA 4YTTA 1E6ZA 3FA5A 2OU4A 5FJRA 3WLJA 1VB9A 4OVXA 3VKKA 1YDOA 1FWFC 5FL1A 3LV5A 1XLBA 4ATWA 1W1A1 4JTTA 3TVAA 1A5MC 4FXSA 4FLQA 3ME3A 2Q8ZA 2OT0A 4UQ9A 3CHCA 4WDTA 2PWEA 4B5NA 3PAOA 2ISWA 1H62A 5CSYA 3C3NA 3E96A 3T9PA 4RPQA 1UWQA 3U57A 2RJGA 3CC1A 4WX2A 3I3EA 2Y5SA 1L6SA 3OO2A 1TMLA 3HQOA 4IG2A 1P48A 3QZAA 4HBKA 3UU0A 3HV8A 3WDPP 4LTSA 1GK8A 5T91A 2FVLA 2V6AA 1Z41A 4ICNA 1AL7A 3SRFA 3GNRA 3KVKA 5KVHA 2OGJA 2TSYA 4DNHA 4AWUA 1MUCA 3W7EA 2RGLA 4Q22A 5LNRA 1VFMA 3N04A 4R34A 3KLKA 3BTNA 3BH4A 4HNCA 5AHMA 2C1GA 2VOMA 4Q4SA 3A47A 3TW6A 3W73A 4RE3A 3C2YA 1ME7A 1NH6A 4TUFA 4EOUA 1HN1A 2Y1HA 3MSGA 4C7GA 4ZZ9A 5C55A 4WD0A 5K4XA 1BWCA 2GR2A 4UTHA 1A53A 2J7CA 4C6IA 5I78A 1N55A 4V27A 3C2EA 4Y96A 2ZDSA 1UWUA 5AHIA 4IUGA 4J2MA 2NUWA 1Y7VA 2HTMA 1R85A 4BQ5A 3ZS4A 1TPB1 1TWZA 9XIAA 5M5DA 3ID7A 2UY3A 3WNKA 2P88A 5D04C 1XINA 4Z1CA 5C9ZA 2BP1A 2REQB 1K7XA 3OEXA 4NEWA 4HHLA 3VNKA 3BSHA 2FPTA 4DWSA 4K1GA 1UH3A 1I75A 3RCMA 2P1FA 4B16A 2XTKA 2Q09A 3R4IA 2YB1A 3GG1A 2VQTA 3EAOA 3LU2A 3O07A 5KZEA 5D9MA 2J13A 2Y24A 2WPEA 4D9PA 1B57A 1LTDA 3T81A 1HKKA 3N3TA 1GEUA 4A6GA 4YCPA 1U5HA 3GDBA 4DB7A 3M5VA 5A8NA 5DMYA 1JJKA 3NR0A 2HJPA 3LOTA 4E2BA 2EPLX 3GG8A 1G94A 3UPWA 3KVJA 4Q4RA 1IEQA 3BK0A 5K4ZA 1JD9A 3AZSA 2CFFA 3U48A 3OYZA 4ECLA 1O95A 3JRKA 5DBTA 4A8RA 1YQ2A 2YVFA 4F0MA 4OKDA 4D6EA 2QCCA 1RXOB 4GH1A 2X0HA 3E5PA 3EX3A 1UQYA 1NWUA 3IGSA 3LGDA 2YVJA 3L67A 2PDNA 3M41A 1OX4B 4UNKA 2EJ1A 2CLFA 2NV1A 1B3XA 1PX4A 2WLYA 4KKXA 4HCDA 3ZJ7A 4Y9PA 1BQCA 5C71A 2PRLA 3S2LA 1JEZA 1W9VA 3ARZA 2ZX8A 3U5UA 1Z8AA 1V02E 3EXTA 4ML4A 1Q6EA 3ONCA 4HU4A 2ZX9A 3TP4A 4DVOA 4B2DA 4HHHA 4LS2A 3GHRA 3COTA 4ZQPA 4PMNA 4QS6A 3RR4A 3M0KA 3PJXA 3HG2A 2OSXA 2E09A 2Z2UA 4I5XA 1UASA 4DPQA 1XGZA 5RUBA 1IF2A 4RXFA 4HGXA 3TAKA 1VEPA 3GKAA 4QDMA 2QCDA 2BFGA 2E9BA 2IXVA 4GYFA 3WUEA 3BO9A 1EIXA 3H12A 1WUEA 3C56A 4ZE5A 5CPQA 3BGAA 3DC0A 4KESA 5B80A 4TVDA 5KTLA 1FWDC 3MSYA 1N5WC 1KBJA 1FFVC 2A6NA 4PFMA 1HJXA 4GACA 5DFAA 5LNSA 3BAWA 3S42A 2Q8XA 1PWMA 3M1ZA 4FXJA 1E9LA 3OLIA 1RPKA 4GABA 1ZY8A 2ALDA 1XV8A 2PWGA 1LVLA 2J9YA 3QSRA 4MAZA 2OX4A 3MDUA 3DFQA 4PR4A 3SZ8A 3B9JB 4K37A 4G1KA 2OKOA 2OWXA 4ZOCA 3V1PA 3A7UA 1XDJA 2Y63A 2YCEA 2XFRA 4RPPA 1XSIA 4PGLA 1MRAA 3UR5A 4ZQOA 1J11A 4E3TA 1FIQB 1HVQA 3VC5A 1PV8A 2NLYA 4S3FA 1QK0A 5F7UA 2CZDA 4XZMX 1W54A 3BUVA 7XIMA 3M7SA 1R3SA 3MKKA 4F79A 1L6GA 2E1DA 3IACA 3DHDA 5I24A 1WZAA 1FHUA 1KA9F 3DGZA 4MJ2A 5HMDA 2AAQA 2WNNA 3SECA 3SGUA 3PTKA 4R88A 1NJJA 3NVWB 1QBAA 2YZRA 3O8AA 3VD3A 3GHUA 4XZIA 3PSWA 4PEKA 4LBUA 4JTJA 5J5RA 1MWOA 4JZ5A 3WK0A 1CBGA 1W1PA 4XG1A 1GVSA 4XKYB 2NW0A 5CPMA 4ZOHB 5J04A 3XIMA 1JFHA 2PDJA 1CXIA 2VRJA 4JTAA 3SBFA 3T0BA 2J79A 1ELSA 4E8CA 2ISSA 5GJPA 4AVOA 4GYPC 2X7VA 1CGTA 1C91A 3FA4A 1KRAC 1KNWA 3CHDA 5BOEA 4B5VA 3W2MA 1KCLA 3WENA 1GZGA 2HE8A 3NO1A 2IKGA 2CLOA 2HPMA 1U22A 4K7ZA 2PWFA 3VNLA 5EL1A 1B9BA 1BYBA 1D3GA 4GNJA 2GQ9A 4BHYA 4C65A 3TOPA 2QAFA 2WQPA 1CXFA 3EMQA 3CQIA 3ENLA 3TTEA 1XLHA 3IGUA 4Y8FA 4TOQA 2VR5A 4C5ZA 2XM1A 1BRLA 2YOCA 3PUEA 3DESA 3ARTA 4IHCA 4LAZA 4HNUA 3ONBA 3P7YA 1QOXA 3OZPA 3Q67A 1SFLA 4PL2A 3M6YA 2Y0FA 4JN6A 3ATZA 1GJPA 4AC1X 3KBSA 3P0WA 4LAMA 5FI8A 2ASHA 2ZUWA 5I3HA 2HEJA 1DL3A 3BPWA 2CPUA 3BOXA 1NDAA 4EAYA 1US2A 2GK1B 1AW2A 1QPKA 2NVDA 4W9TA 2EEXA 3QBUA 2VQUA 4FF7A 2VXNA 3LADA 3GKFA 3DC8A 2QVNA 4DYJA 4GO8A 1ZENA 4TX6A 1K9FA 2HVNA 2ZQ0A 1VBHA 1P43A 4MAVA 4Z1YA 1P0KA 4QFUA 4MKVA 2CW6A 2X0SA 3TR2A 1ZRQA 4Y90A 3G0XA 1FP9A 1NFGA 4X22A 1XRVA 1NOFA 3H7VA 2DZSA 4OZOA 1XKJA 4TTUA 2INFA 1OGGA 1R6WA 4CCEA 3STFA 2AMXA 3AUJA 4GGHA 3VKJA 3SB0A 1TO3A 1FEBA 1WUFA 3SGZA 1EF3A 3DBPA 2PTXA 3RMJA 4KFPA 1RLCL 1QOQA 4LVGA 3WLHA 1GV4A 1NP0A 1XFBA 1HGWA 3EXRA 2OZTA 4HMNA 2WSYA 4IMCA 4JAWA 3WJWA 4LCQA 3DAQA 4BFAA 2QDDA 3NQCA 4YYFA 2OFJA 4L7ZA 5G2IA 3IANA 3LG3A 1OSEA 1UKPA 1UG6A 3N1AA 3IIPA 2WMIB 1BF6A 1S2UA 3PC0A 4JTLA 4I6VA 1RY0A 3TA6A 3B0VC 1GVFA 4WGHA 3CQHA 1N8WA 1NM9A 3CYVA 5HJXA 3AS3A 2VZTA 3N34A 2ZRUA 4QGCA 3EKLA 1F3PA 4Q4OA 1TFVA 2L5HA 3QY7A 3C2VA