4KT2A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
404
structure length
384
Chain Sequence
SLKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords D-mannonate dehydratase
publication title Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
rcsb
source organism Chromohalobacter salexigens
total genus 150
structure length 384
sequence length 404
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2013-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4kt2A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4kt2A01
3H8AA 3ENLA 1TZZA 2OO6A 3FCPA 4ZCWA 4A35A 4H2HA 2PTZA 3DERA 3VFCA 3TOYA 5FJTA 3UXLA 3PWGA 1MRAA 1KKOA 3H7VA 1EBHA 3DFYA 3H70A 4MMWA 4GMEA 3ZLHA 1XPYA 1EC7A 1YEYA 3P3BA 2OFJA 2GGHA 3CK5A 7ENLA 1EBGA 2GGJA 4DXKA 1MDLA 3TWAA 4IHCA 1OEPA 4HNCA 5ENLA 3CXOA 4J1OA 3HPFA 3QKEA 1W6TA 2HXUA 4E6MA 1KCZA 2PGWA 3VC5A 2QQ6A 2OPJA 4ZA0A 1FHUA 2XH4A 3TQPA 4IL0A 3DG7A 3GC2A 4K1WA 3R0UA 4GGBA 3TWBA 4GYPC 2QJNA 3ES8A 2OVLA 3FVDA 2XGZA 2P3ZA 4IP4A 3UGVA 5BOFA 2OKTA 1P43A 3IK4A 2I5QA 4IZGA 4DWDA 3RRAA 4JHMA 2XH0A 1SJCA 4EWJA 4ROPA 1FHVA 3K1GA 3GD6A 3U4FA 5FJOA 3RITA 3QTPA 4E5TA 3VCNA 3TJ4A 4Z17A 3GO2A 3UJ2A 4FP1A 2AKMA 2QJMA 3R0KA 3MQTA 3TTEA 5EU9A 1MNSA 2GGIA 3QN3A 4KT2A 3GY1A 3TW9A 1TE6A 3N4FA 4KPLA 2HNEA 3DG3A 2GDQA 3VDGA 3UXKA 1SJBA 3RCYA 3N4EA 3SN4A 2PS2A 2P8BA 1L8PA 1TKKA 3PK7A 2PP1A 4GFIA 3I6EA 3T4WA 3ES7A 3U9IA 3MWCA 3NXLA 3MY9A 4M0XA 2GGEA 4F4RA 2PGEA 2PPGA 1R6WA 3TJIA 1DTNA 3V5FA 3CT2A 3SBFA 2AL2A 3ZLGA 2ZADA 3EKGA 4HCLA 1PDYA 4HCDA 3CB3A 3UCDA 2PSNA 3I6TA 2AL2B 3N6JA 2PA6A 2RDXA 3VCCA 3NO1A 4JN7A 1IYXA 3DDMA 4G8TA 4X2PA 3R1ZA 4GISA 1SJAA 1RVKA 2PCEA 4JN8A 4H83A 1P48A 2OG9A 4YWSA 3CYJA 2POZA 4HN8A 2DW7A 1WUEA 1SJDA 3Q4DA 3ZLFA 2P88A 4HYRA 3FYYA 4IL2A 2PMQA 2MUCA 3ZVHA 3UJRA 3T6CA 4IP5A 3S5SA 4E4FA 3PFRA 3H12A 2AKZA 2PP3A 3NFUA 3UCCA 3V4BA 4J3ZA 5IDZA 3V5CA 2PP0A 3UJFA 3OP2A 4M6UA 4KEMA 3B97A 1BQGA 4G7FA 2GSHA 5BOEA 1NELA 3SJNA 3QPEA 3S47A 3FJ4A 3RGTA 1JCTA 4HNLA 4GYPA 1R0MA 2PU1A 3OTRA 3DESA 2OZTA 3IJQA 3OZMA 3MUCA 4DX3A 3IJLA 3QLDA 2GGGA 3Q45A 3TCSA 3CAWA 3PWIA 3D47A 1NU5A 3BJSA 1JPDX 4K8GA 4DHGA 3JW7A 2QDEA 3DFHA 3MKCA 3BSMA 3VA8A 2P0IA 1F9CA 3RR1A 1ONEA 2XH7A 1JPMA 3SN0A 3SN1A 3T9PA 3T8QA 3KUMA 2OLAA 3JZUA 2ZC8A 2P8CA 1BKHA 4A6GA 2FYMA 4FI4A 3P93A 2ONEA 2CHRA 1WUFA 2QVHA 3R25A 4A3RA 3MSYA 4DYEA 2QJJA 4H1ZA 2PTWA 3MZNA 4GGHA 4MGGA 1ECQA 5FJPA 3RO6A 1EC8A 1XS2A 3BOXA 1ELSA 4ENLA 1JDFA 3DEQA 2PODA 2XSXA 3NZGA 3IJIA 3THUA 3ZVIA 2XH2A 3R11A 3R10A 3V3WA 3EEZA 4K2SA 5FJRA 4GIRA 2HXTA 3STPA 3DIPA 4E8GA 2PTYA 6ENLA 2OZ8A 1MDRA 3OZYA 2NQLA 2OZ3A 1EC9A 4MKSA 2PU0A 2OQHA 2QDDA 3N6HA 2OQYA 3ZVHB 4Z1YA 2PTXA 4H19A 4IT1A 3DG6A 3I4KA 3P0WA 3UJSA 3OPSA 3FXGA 2MNRA 4E4UA 3DGBA 2OX4A 3FV9A 4HCHA 5FJUA 3SQSA 4KWSA 2FKPA 5J04A 2AL1A 2GL5A 3UJEA 1MUCA 2O56A 3SSZA 2HZGA 3JVAA 4DN1A 1PDZA 2DW6A 4HPNA 1KD0A 3VC6A 2QGYA 1E9IA 3OW1A 1KKRA 3D46A
chains in the Genus database with same CATH superfamily
2VMFA 4E8DA 4ES4A 4JIHA 1KXHA 1FWTA 2FTWA 4HHPA 1WPCA 2A3CA 2C3ZA 1I0DA 5C9ZA 4BF7A 3BZGA 4QITA 4W8AA 2EEXA 2YBUA 3LU2A 3U2CA 4K68A 5CGQA 4JKMA 3WNLA 2V3AA 4LAZA 3U5YA 1TTIA 4J9JA 1HVXA 3VNDA 4CD8A 3N2XA 1ALDA 2X50A 2VQTA 1K9EA 1CB7B 2R6OA 3TN3A 3QMRA 3S8HA 2Y85A 2QS8A 2WJDA 1W2VA 4UXDA 5ECVA 1GVSA 4I8YA 3N25A 4IMAA 1LRTA 3QGAC 3W25A 2WPCA 5JH2A 1R86A 3W7RA 3PUDA 3RF9A 3W1MA 3AAMA 3HA1A 3BXWA 3WG6A 3BJTA 3IGUA 4GK8A 2CLOA 3W7HA 4IL0A 4LRTA 2FLIA 1Q6CA 3A4XA 5DY3A 5IBXA 1NF0A 3NUKA 1JNEA 5LA1A 2HSAA 3W1TA 2GJRA 1IEWA 1XANA 4G6CA 4LTSA 4YIWA 1D2KA 5EGRA 4AIBA 1T3QC 2PZNA 3H2OA 3C0QA 2E8YA 4OQVA 1QWGA 1FIQB 3RCMA 4KIEA 3AIUA 5CC6A 2QJMA 3R0KA 3TUUA 4O11A 2WSRA 1PS9A 5EU9A 3WD1A 2PAJA 4JTRA 4I6KA 4I7WA 4AXNA 3WF3A 1XFBA 4NRSA 3UNDA 5G4WA 2O9OA 3N4FA 1CLVA 3N4EA 2WHKA 5FIPA 1S5NA 2B4GA 3OA3A 3LOTA 2WMKA 3MMTA 1UQYA 3NGFA 2ZUSA 4Q33A 3DGRA 2QPXA 3U9IA 3W1NA 3DI1A 3S5OA 4KWOA 3SAZA 3F5KA 2PGEA 1K9TA 1GRBA 3L4WA 1ONXA 2OSWA 3BW2A 2NWRA 1XYMA 1REQA 2EHHA 4CQDA 2PRHA 4X0NA 4HCLA 4KRUA 3INPA 4HYWA 5AHIA 2CESA 3OZOA 4PMRA 2BXZA 3I6TA 4BZYA 1JYWA 3PHAA 5U7SA 3E6EA 1FWEC 4QNWA 3OOQA 3N13A 3H26A 3MUXA 1OADA 1AQFA 2WXDM 3PAOA 1FWRA 1VFTA 2Q3OA 1KRMA 5BWAA 1S3TC 4QE4A 4PB3A 3ZWSA 3CXBA 1JDAA 2V5JA 3FK4A 2EF9A 2PDFA 3N3TA 1SO4A 2OSYA 2P0OA 4ZZ9A 3KBNA 4H4YA 3E74A 3PBWA 3WKZA 4ERIA 3PSWA 3ZO9A 4ERAA 4M8UA 1ZY9A 4IL2A 5LSMA 2JGYA 2R14A 2ZUVA 1I8JA 4D8LA 5HATA 3S5SA 4H2CA 3OGSA 4GPNA 3M5YA 1I0BA 2GQWA 3URQA 4AU0A 1TIWA 4CQAA 1ADSA 9CGTA 1W5QA 1SO5A 2GOUA 1V6TA 1Q4NX 2PP0A 3HPSA 3W84A 3W28A 3BAIA 1JI2A 1NQ6A 3C0LA 4YN5A 3VIFA 4C6FA 5BOEA 1VAHA 3RPDA 3H6OA 3GR4A 4JIEA 2Z28A 3HBLA 2GJPA 3CHFA 4U5IA 3E1F1 3W37A 4NILA 2GQ9A 1V6XA 2W79A 2EJAA 4O16A 3AXHA 1HKWA 1OFPA 3BGGA 1SZGA 3AXXA 1PZ1A 1B3YA 2HDJA 1FUYA 1P6CA 3BGJA 4HMEA 5HAOA 1W56A 3GYEA 4RZBA 2GFTA 4XWUA 4F2UA 5G1TA 2WSYA 4QDWA 3U4AA 3LB8A 4MWAD 2FPYA 3G1FA 1X7FA 2C19A 2WLYA 3V35A 3S2LA 1IEQA 2NQ9A 3L8KA 2ONEA 3S1GA 3PTMA 5D2TA 4YVXA 4MPKA 5HOSA 3CJPA 3GS6A 1UROA 1XM3A 4QROA 1VH7A 1TV4A 4WX2A 2DSVA 1EX5A 1G4PA 2OMAA 2ZUNA 4GIYA 1I75A 1LG1A 4A21A 1UR0A 1U1HA 5KETA 3DEQA 3EDJA 5LYRA 3EPMA 2PE4A 1WKEA 2DEPA 4H8UA 5CAKA 5AC4A 5LNWA 4PCSA 3A13A 4PZVA 2EJ1A 5I3DA 4AHQA 2I56A 4D6FA 1GEUA 2XIJA 4Z1AA 4G5DA 1XLJA 3ABZA 1PHWA 1VFMA 1IZCA 4AD1A 4W85A 2W6RA 2DVUA 3LNPA 4CVUA 3BLEA 1VYSX 1QOPA 3VGGA 5L9FA 4DO7A 4NZJA 4O0ZA 1CB2A 1V0KA 1UBSA 5H6HA 4ATDA 3QRHA 3N6HA 3MUY1 2ZX9A 4H19A 2QDGA 5TAOA 4ACZB 3UYCA 4FX8A 2HK1A 2NX3A 1QT1A 1W5PA 3A5VA 1JZ5A 5J04A 3NVVB 4RDVA 2CC0A 1PCWA 3EB4A 4NRRA 3HG5A 2VVNA 3LDVA 5AHNA 1VBGA 1B3OA 4REQB 5C9WA 1EIBA 3EEGA 4Y96A 1Y8BA 4H9XA 4IIEA 3KBMA 2DIJA 9RUBA 1KTBA 1FO4A 1E3ZA 3LXAA 3IIPA 1J0KA 3PZQA 5LA2A 1J79A 4B3ZA 1NDAA 1BTCA 4M6QA 4ZO8A 3GM8A 3QHNA 4ZEPA 4GUIA 2VENA 1XF0A 4OHQA 1MW0A 3TJXA 1TPWA 2V82A 1J01A 3QPZA 4H9MA 2VEMA 1EA9C 4DNMA 2ON3A 2DT1A 3AYTA 5E93A 4EAYA 1EBHA 3DFYA 1I2RA 3CL8A 4C91A 1FWSA 1MI3A 5J5DA 2VEKA 3AS2A 1M6JA 1J11A 4AY1A 2WWDA 3L9CA 4UQCA 2I5GA 3P8IA 2IQDA 4L1GA 2ZX7A 4AG0A 2E6DA 1KWGA 4HNCA 3S46A 2E6YA 2NQ5A 4WRHA 1GG1A 2HXUA 3NOYA 3VC5A 5D9MA 4KEVA 1MOKA 3UG8A 1B9ZA 4ZXOA 2BGNE 1US2A 4LWWA 1J5TA 2HISA 1P0DA 1H7OA 1GXFA 3KRBA 1NWTA 1PE1A 3E3HA 1VBHA 3N2MA 4UIOA 1RUSA 1GRFA 3E5BA 4L1WA 1TUFA 5F7UA 3ITXA 4XAPA 1EX1A 4CN4A 3B3DA 3S5ZA 5DXYA 4AB4A 1UUQA 3VDAA 1CGTA 1LBLA 3U4FA 5I24A 2OEMA 3MW7A 5AC7A 3GH4A 3IACA 3AOFA 1E55A 4LOCA 4P8UA 3YPIA 1GOIA 4QISA 2DVTA 1FP9A 2ZOXA 3EWZA 2VD8A 2O55A 4BQ2A 1ONRA 3NQFA 5BW6A 5DN1A 4QJ3B 3G1HA 4L6HA 3THDA 3V18A 1BLIA 1K03A 3P6LA 3FN9A 3PSVA 1K8ZA 5K7JA 3GIPA 2EPLX 1I9CB 3KVMA 4Y9AA 1C90A 3CUJA 5A8OA 2Y70A 3RNDA 4U2ZA 3UZZA 1H0IA 3S2NA 3GRIA 1FFRA 1WZAA 4IUOA 3W7QA 2DZXA 3VKJA 2CETA 4AISA 5AVHA 1AZ1A 3AYVA 1TYGA 1IGWA 3OHMB 1DHPA 3D3AA 3WMBA 3DCPA 2OTDA 1IYXA 3KS6A 4G8TA 2Y1HA 3MMWA 2QULA 2VX4A 3GIYA 2TSYA 1KGXA 4B5SA 5E9XA 4UFHA 1E9YB 3GW3A 2REQA 2W27A 4F0SA 4HN8A 1ZKQA 4DUXA 3QW3A 3CGCA 2HNHA 4DB7A 1LDCA 5GQBA 2W3SA 2I9EA 2VC5A 2PFHA 2WHMA 4LV4A 5HPOA 2KZHA 3L0KA 3CGEA 1B31A 4S3DA 2IW0A 3DX5A 3M0KA 1OF6A 2G97A 5H2ZA 1OCQA 3UJRA 1W2PA 3L23A 5K3VA 4X9SA 4E4FA 1CCWB 5C6MA 4RDZA 2E3ZA 4O0QA 4M51A 1L9WA 4ZOAA 3MO7A 3ZM8A 3I65A 3S3GA 3QLLA 4JS3A 1N62C 4S2BA 2XN2A 4H04A 3VD7A 4X22A 1HKVA 5BRBA 1SFSA 3WBWA 4RX0A 1NM9A 2WNNA 4E2OA 3L4TA 5C7HA 3I3BA 1Y5XA 3D3FA 3C8NA 5LGXA 2J3NA 3TSMA 3NQBA 4PTVA 1RD5A 4AWEA 4P7RA 1SM9A 1CGXA 2HVMA 2DT2A 1MMFA 2ZA2A 1DIDA 4D6JA 3RMEA 1J9YA 2W55A 1K8YA 3SN1A 2VRQA 4CNSA 3SGUA 2ZE3A 1Q6RA 4H4SA 2A3EA 1H60A 4H4UA 3LERA 1PL9A 1Q85A 3N29A 3R25A 2NQZA 1XLLA 4HP5A 4IX2A 4MNKA 2ZRVA 4V1XA 4C5ZA 5B7YA 4AIOA 3OHIA 4NNAA 3MZNA 1ZS2A 1F73A 2IMRA 4RJEA 4GACA 3QR0A 1UCWA 3G8EA 4XD3A 2FPVA 1V4YA 2VR2A 4AEEA 3NOEA 1L6WA 1WYGA 3NZGA 3IS4A 2C6QA 1LUCA 3S5NA 1L8NA 1KGWA 4ZOCA 3KP1A 1DQUA 3F1QA 1JPHA 5FF0A 2YVGA 1RY8A 3VNMA 4FOJA 4GYFA 1KB3A 1V0MA 4PYSA 3LLDA 1XYLA 4RDYA 4AW7A 1GUVA 3VDCA 1XUZA 1GOXA 3B9JB 1GG0A 4UMCA 2OZ8A 4AC1X 3DHFA 2F9RA 2NQLA 3GHUA 3WBEA 4MFDA 3NQMA 5G5HB 2ZWZA 3K8KA 5H8UA 5JU6A 3BQ5A 2HJPA 2ZE0A 1X1ZA 4JFSA 3I4KA 1S46A 3ETRB 5EMMA 3WELA 4C1LA 5FJUA 4QLKA 4ZFCA 3HM7A 4YYFA 3VZXA 2I1OA 4UOJA 2YDRA 2AL1A 3M44A 3NXFA 2WWCA 5IRPA 2B0MA 2E7FA 1WYIA 5AOUA 1F8IA 4LVDA 4C6MA 1UBPC 1FWHC 3JVAA 3PZGA 1YMYA 2BSLA 4HPNA 5T91A 4HU8A 3W87A 3O2LA 1N82A 3KDNA 1ZBVA 3KHDA 1H50A 4IMCA 4F79A 3D0CA 1DQWA 1XRFA 3JR2A 1TZZA 3G2GA 4W5UA 3EBVA 4MZYA 3LRKA 1X6UA 1H5VA 3ARXA 1ZENA 4KFPA 2Y8VA 4MF4A 1BXCA 3TOYA 3VUPA 4NUWA 2GUYA 1YDVA 1K6WA 1D8WA 1GRAA 3TQ0A 4HBKA 4J40A 1VPQA 2INFA 4Q8NA 1V5XA 2E1WA 1VGAA 4F0KA 3SCUA 2F2KA 2FDSA 1FWWA 4AZHA 7ENLA 3NQDA 2GGJA 4HIBA 4JFTA 2NVCA 3UXIA 3WUBA 4IHCA 2BFGA 3VXGA 4PCPA 1XI3A 1IXOA 1TV5A 1QHZA 3DK9A 2DZUA 4J1OA 1PSCA 1JZ8A 3HPFA 3NNTA 2A3AA 3WD4A 2PGWA 4MNMA 4US5A 1XYCA 1HKIA 3H2EA 3PULA 3SR7A 5D9PA 3DG7A 3EB3A 3W01A 4LAUA 3KOFA 2TYSA 4WSHA 2PC4A 5CJMA 3TWBA 1A5OC 3W7KA 1M7JA 3CQIA 3SB0A 5CQ1A 1K6AA 2ZRXA 4O13A 2GPTA 3IUDA 4PMXA 1O6IA 3AHVA 2V8ZA 3QR1A 3SUUA 2DVXA 3WMLA 4F48A 1RCQA 1IZKA 1XGZA 3FYOA 4GBUA 3QZAA 2FH8A 3L4XA 3CS2A 3ELFA 1GERA 3R58A 1QDSA 4ZOEA 3OVRA 1EEXA 1R46A 2VX5A 4LH8A 3JS3A 1JZ4A 3SN4A 2A79A 4LW7A 2V68A 2DJXA 4Q6JA 1XLMA 1BZLA 3MWCA 4MY9A 4PFMA 4P5UA 2POTA 1KV5A 1Q1RA 2WZTA 6CGTA 3W1UA 4D6IA 4ROQA 3UY7A 1KCXA 1TPEA 4FNQA 5DMYA 4APNA 4OV4A 1JDDA 4TXEA 5ABEA 4HCDA 4FX6M 1F5ZA 1IIGA 3SSJA 1XCXA 4HT3A 3VKAA 2PUZA 1UWIA 4K7ZA 1XLIA 4EAMA 1N5XA 2A5HA 4HHMA 3NCOA 3IV3A 2J4GA 2UY4A 5A6MA 4J56A 5CBBA 1P1MA 2VFGA 3WQPA 1QNQA 3TN4A 2VGFA 3RM4A 2UBPC 3FJ6A 1JXJA 1IHIA 4MDOA 4N6FA 1P48A 4YWSA 2PRLA 2ZDRA 3CAKA 5K2ZA 4H4TA 2BB0A 1AFSA 3B8SA 1LYXA 2Z2UA 6XIAA 4DM1A 2G50A 1QHPA 4Q4OA 1V8EA 3W75A 1E56A 3M0VA 3L21A 3T6CA 5LHEA 3LPFA 3KLJA 1XW8A 3V4BA 1UZDA 3DFSA 3RX2A 1BHGA 1J2WA 4AHOA 2VL4A 4MUPA 4C7DA 2F6UA 2GSHA 4NZ1A 1TRDA 4Y90A 1ZHAA 3FJ4A 1XGEA 5T8GA 5DMLA 1KR1A 1H2JA 5CEWA 3BV4A 5GJNA 3R07C 3DESA 1H7PA 1YKWA 3C56A 5I3HA 3OZMA 5CGMA 4AZ5A 2DZTA 2QV4A 2TAAA 1ZL1A 2WOWA 1H09A 3KBVA 2ZRUA 2O7SA 4GZEA 1RK6A 4WDTA 1KV8A 4TVYA 2PDIA 1VJZA 2WM0A 5D2VA 4MUZA 1BG4A 1CGWA 3F5LA 1S1RA 2QHAA 1DJNA 3JW7A 4UCGA 2WKLA 1B9BA 1U1JA 2VC9A 2YDAA 5CCZA 3W83A 2XH7A 3QZ6A 5FF4A 1VZWA 7XIMA 4M1BA 4KIRA 1VENA 1UIPA 2QEZA 4PL1A 2QUTA 4XZIA 4GUHA 1RP8A 4PMQA 5D4YA 4DAIA 1LLOA 2YL5A 2VKZG 4C6CA 4F2TA 1GQLA 1BWKA 3M16A 2R82A 1Q6EA 2PRMA 3FA4A 4F9JA 3CL7A 3TAKA 3QQ0A 2GLKA 3SFWA 3C8FA 1XLDA 2BBFA 2YDQA 4JIPA 1K7EA 3BK0A 3S6DA 2F6KA 2YLLA 4Y6GA 1TTPA 1OK6A 5EB8A 5G2WA 3LBMA 4LY4A 3PBVA 3QH2A 5A2AA 3NQCA 3DKLA 3VABA 1HT6A 4RNJA 2CWXA 4B9YA 4OJYA 4AMCA 1KXVA 5KZEA 1Z7AA 5EMJA 4UFIA 4TV5A 2YFNA 3Q6JA 1P7TB 3W2LA 4F3HA 3OQEA 4H9TA 3EWUA 4GI9A 2ISVA 3R6IA 4BR1A 5FF2A 3HB9A 4F9DA 1GOOA 3LHYA 2Y7FA 3PB0A 1JXKA 2CLMA 4IT1A 2WC4A 1EB3A 3WQWA 3K46A 1MNZA 4V33A 2MNRA 1HO4A 4ONVA 1FBAA 3LGDA 1EJSC 3AMZA 3DYMA 3LY0A 1C8XA 3M0JA 5C9RA 3W70A 2AOSA 3QTGA 4Q4MA 3NZ1A 4FA3A 3EKLA 2YCKX 3RX4A 4W88A 5D33A 1R87A 2ZFAA 2QGYA 1E9IA 2XN1A 1WE5A 1N55A 1JG9A 3KRSA 4PULA 3N9SA 4V2XA 4QQ3A 1VIWA 3GNOA 3AFBA 5KINA 5G4HC 1V3HA 3WEOA 3O16A 1VDVA 2R24A 1W3KA 5JBEA 1W1B1 3K8LA 2X2YA 3NVYB 3KWSA 3DC8A 3H24A 1DXLA 1YTDA 3AHZA 1G4SA 4EACA 1JFHA 4ZQMA 3N2CA 3WL1A 5FJTA 1UC4A 2HQMA 4BKNA 4PUWA 2JF7A 3CZJA 4BQ4A 3AZSA 1UZHA 3L0GA 4IPJA 4EANA 3MPGA 4MKVA 5A8GA 4LUJA 2VGBA 1J0IA 2QMKA 1OCNA 4M81A 2PTDA 1W9XA 1F8WA 3QFEA 1PWMA 1M03A 4XUYA 2PWHA 3CHEA 4Q8UA 1IE7C 1XDJA 4P8VA 4H41A 4IUGA 1KCZA 3E5PA 1QPRA 2OPJA 2BY0A 3RMJA 4WY0B 3N3MA 5JUVA 1E6ZA 4LPCA 3IVSA 1QI0A 4IIGA 4M56A 2NZLA 3JU2A 2WJEA 4RW5A 1EJ7L 3E0LA 3V1HA 3ZR5A 3AMKA 1EJXC 2XGZA 4LFYA 2OKTA 5EBAA 2ATSA 5BXSA 1Q6DA 1XISA 2WMIA 1TQXA 4ROPA 3VD9A 3WK3A 4LF2A 2DU2A 2QT3A 3IGXA 1I2NA 4Z17A 4MPQA 4JIIX 3SUTA 4Y9MA 1GEQA 1Q66A 3LM3A 4IG2B 2BCPA 3SY5A 3AIEA 3KTCA 3OVQA 2OEKA 1W9UA 1BF2A 1XLGA 4ZO7A 3LG3A 1QAPA 3F4NA 3M64A 3CV2A 3KEHA 3BAXA 2D3LA 4FAMA 3HU7A 3WQ5A 3WL0A 4GFIA 2H9AA 3QYSA 3ES7A 1BQCA 4XVDA 1KR0A 4UFKA 1EL3A 3H22A 1TVNA 1P6WA 2EG8A 3QGKC 1A4MA 2CCRA 4L7ZA 4Q8OA 1UD2A 4HZ7A 1EXPA 3CHCA 3ZMRA 4AMAA 5DXXA 1EDTA 3CLWA 3OIHA 3TZFA 3UCDA 1GZ1A 2GQ8A 1X8CA 5K9XA 4GXWA 1N8FA 3FKRA 1VJSA 4J5NA 4O1DA 2IKJA 2DIEA 4HKPA 4GCAA 4JN7A 3TOPA 1YNQA 4D6CA 5CZTA 1TREA 1JDEA 4ZB2A 4DJED 2PCEA 3UZYA 4CKQA 3N18A 5I09A 4UNKA 3PBMA 3DXIA 4MM1A 3Q4DA 4IMFA 5HJYA 1VJIA 1NARA 1W1A1 3EPOA 4FOUA 1G0CA 4LVGA 4Q7BA 5A6BD 3MYPA 1LOSA 1XDIA 5FS6A 4JCMA 3RLGA 3IAPA 3KVKA 1FDJA 3PN8A 3P84A 4UMAA 3C2FA 4CEUC 3THAA 2TRSA 4IFRA 1KRAC 2Y6ZA 4PBGA 1Z6KA 1E0WA 3SQMA 4UNLA 2Q8ZA 3NEVA 4TQTA 2A7NA 5A8PA 2I9UA 5JIWA 3VINA 1EPXA 2ZUUA 4C6JA 2Q8LA 3RGTA 2JK2A 4RDWA 2OZTA 3GG7A 4KQNA 5CPNA 4M1RA 1GOWA 2WOVA 3PC0A 4PUEA 2BV9A 3Q45A 4NZ3A 4FK9A 4H8VA 1CTNA 2YBTA 4C6BA 1GVIA 2QYGA 3GHTA 1YYAA 4LVFA 5EBKA 2YCEA 3QZEA 1JZ6A 2QDEA 3DFHA 4RW3A 2OLHA 1XDMA 2NX1A 3OBKA 1UYQA 2BDQA 3SM0A 1ONEA 2OKOA 3SN0A 3FFSA 4P7OA 2WNQA 2ZC8A 3L5AA 1RZMA 2CNCA 5XIAA 5RUBA 2Z26A 1AA1B 3GX9A 1Q4WA 3PZVA 1ZUAX 4NHVA 1J93A 1CZ1A 1O12A 1VHNA 1H1YA 4RE4A 4C6IA 3ALFA 3LV5A 3T2OA 4XSMA 1RQBA 4KERA 1NHQA 2BY1A 5KTLA 1IR2A 1U5VA 3CGDA 2XSBA 2OXNA 1MQRA 1TJPA 2PF0A 1DE5A 3R11A 5JCNA 1MUWA 3ABQA 1H49A 1NAL1 3BW4A 3M5VA 4A3YA 1A3WA 2HXTA 1TV8A 3T09A 3V16A 4S23A 4S3AA 1GQNA 1PKNA 4Q4SA 3DIPA 4KRTA 1XX1A 1YQ2A 3URAA 3G1AA 4LCRA 1TMHA 4ZO9A 1G7UA 2W9MA 3WEMA 2J75A 4CNNA 2ZWYA 2QDHA 1TPDA 2WAGA 3BAJA 5CAHA 3GVVA 2A4AA 3LA4A 2YIHA 4L4LA 4UZSA 5C2GA 2PTXA 4BEQA 3NM3A 1VPYA 2PDHA 4CQBA 1U22A 4ACYA 2C8NA 2XIMA 2CIPA 4TOQA 5B80A 4IICA 2WVVA 3VTRA 1WXYA 2QKFA 3W27A 3UQNA 4CD5A 2EKGA 2HS6A 1BWVA 2NV9A 4XIMA 3HGOA 2E9LA 2IS7A 3LI0A 3NSMA 1V3KA 1YPXA 4B5WA 4OKDA 3BANA 1ISWA 1AJZA 3PTQA 3PUOA 3IJ7A 5EPDA 3VOJA 3AIBA 3ENLA 3AMDA 1C92A 2ZICA 3WDPP 3UWZA 4HSNA 4A05A 4HA4A 3CPUA 5FS9A 1GKPA 1TVPA 4OVXA 3T08A 2EQ9A 4P8XA 3T2PA 5GVJA 4C6PA 1L2UA 3ZZ1A 4LNCA 2PWFA 3DZ1A 4ZVJA 4LBSA 1UR2A 1KKOA 4J3VA 2D20A 3F4CA 4Q8WA 4NSBA 1LBFA 4F2BA 1KBBA 1N7KA 3UNTA 3NQAA 1QXLA 4UZUA 2GGHA 3W82A 1THFD 3HURA 1S2WA 4DXKA 1KBLA 3CLMA 1UA3A 2JEQA 1X7IA 3GDBA 3AWOA 5I5RA 3LXCA 4QGCA 4LB4A 1P6BA 3TQPA 3W6LA 3ARRA 1WCGA 2C13A 6REQB 2PCQA 5LNRA 1UC5A 3UR7A 1RPKA 3RILA 4RCXA 2VO5A 3ORWA 2ICSA 4BF9A 3ZJ6A 2E6AA 1KFBA 1M65A 3AIRA 1V3LA 5EA9A 3LM7A 1A3XA 4B5VA 3RAOA 3ZWTA 2GWNA 3WH8A 3UR5A 3GD6A 3A3XA 1NWUA 3TJLA 2WVUA 4DBUA 7REQA 3G77A 3KCOA 3VCNA 1Q65A 3TYZA 3POCA 4LVBA 3OO2A 5JMUA 1W32A 3CIWA 1L0PA 2PDPA 1F61A 3QN3A 4NG3A 3TMQA 3GY1A 3TFXA 1TE6A 4B3LA 1JF6A 1R9ZA 3KBWA 3CQJA 4ZL1A 4TIMA 2WW5A 3RCYA 1ZY8A 5I23A 2C79A 1BSLA 3AZRA 1BYAA 3UWUA 1BGGA 4LQ1A 1M7OA 4AYSA 2G3JA 3I6EA 3WQEA 4K38A 3IJ9A 1IZJA 5H8MA 4TMBA 1DTUA 1XRSA 3EAUA 5FESA 3W3OA 3RPMA 1TMLA 4EK7A 3H55A 4AD5A 1UWUA 3CB8A 1DNCA 4LC6A 1F8MA 2GGEA 1T41A 2IQTA 1KFLA 3GYCA 1B3XA 2NUYA 3NL5A 1DTNA 2FTPA 1GYMA 1R38A 4UOZA 1EHAA 2FVMA 4DY1A 3ME3A 4LC8A 4JYEA 4PL2A 1H4PA 2GVJA 3CTLA 1DJZA 5TR3A 1OC5A 4TU1A 4QJ1A 2DZSA 4CNOA 3O6AA 4KWVA 3APGA 3QMTA 4D8AA 3AI0A 1WZMA 2XM1A 1NWRA 4CQ8A 3IWPA 3ZYZA 2Z27A 3WFLA 4LV9A 2DZWA 4LF1A 1KO0A 2D1ZA 1W54A 4PMJA 1H6VA 3P60A 3R0DA 4KPRA 1DJIA 3GBEA 1WAWA 2J7CA 1ODUA 4PTMA 1FFQA 1Z8AA 3WD2A 4GYJA 4AZCA 1YBQA 1FWAC 3QFBA 1F05A 1R3SA 1X96A 5A6JA 1WO2A 1SW3A 1SMAA 1TB3A 5GNXA 3VE9A 4AVFA 2Z7KA 5EFDA 4GRSA 5FA5A 1A5AA 1J6PA 3U0HA 4K8DA 1XIEA 2J78A 3UEQA 3MMDA 3LRMA 2PP3A 1C91A 1EZ2A 1LL4A 1ISXA 1PB0A 1BYDA 2BHZA 1VYRA 3O06A 1W91A 3A4JA 3SJNA 2PI6A 2ZXAA 3S47A 3OBEA 2WC3A 1JCNA 2PU1A 4IPLA 2VUYA 3EZ4A 4N42A 4BCEA 3B9NA 3CV6A 2OT0A 3B8VA 4FO4A 1GONA 4V28A 4WJ8A 1YLVA 3GU9A 2ISSA 3HZ3A 2W0UA 1A3HA 1ECEA 3CV7A 5GPRA 4N4PA 1EPVA 4Y9OA 5CSRA 3CWNA 4NJIA 1UR9A 2XIQA 1AUSL 1WXZA 1HFBA 3QY8A 3T9PA 2WJFA 4GH1A 3M0XA 1KM6A 3O6CA 4QFUA 4I7VA 4JIQA 2BASA 2IXVA 3UR8A 3VGHA 1ZSXA 3N2TA 1GYNA 2PLKA 4HA0A 1DIOA 3RO6A 3AYSA 4NZCA 2WBGA 2NT1A 4NT0A 1XBYA 4K8EA 3PJTA 1HJUA 3J7HA 3FYPA 1M6IA 4F0MA 5E6YA 1TRIA 4G2DA 3PFMA 1DVJA 1M9HA 2Z29A 2Z2AA 1A5KC 4QX4A 3KLKA 1R3RA 3CAVA 5HINA 2RGMA 1UR8A 4OUIA 2XFRA 4O54A 5E0FA 4XVEA 1NVMA 1MDRA 1H7WA 1OG0A 2H3DA 1Z42A 4QS6A 3S2MA 4BQ3A 1FEBA 2OELA 4ZSUA 1CXFA 1FWDC 3A7RA 4PODA 2PU0A 1T6MA 2NUWA 1GZGA 3I6RA 1FWBC 4BI6A 5B7ZA 2VFIA 3DH9A 2Y5SA 1E1CA 2D0FA 2VDIA 3S9IA 3AXKA 5ABGA 5LGZA 4DPPA 1SW7A 4S3EA 3T44A 1S2TA 2GL5A 4RR4A 3WQFA 3MUAA 1Q6QA 3PJWA 1GPFA 3O05A 3K4DA 4FX9A 3NVWB 3AHYA 1GRTA 3K13A 3CIXA 4W9TA 1FCVA 4LYRA 4EQWA 3OG3A 1E0VA 3D6NA 1JIBA 4OFCA 4JXCA 2HMCA 4MG4A 4BEUA 4B5UA 4Q32A 3M43A 2XUCA 2FB2A 1UR1A 4YJ5A 1QI2A 1SO6A 2D2JA 1NF7A 1LWIA 1DV7A 4MY8A 4UWMA 2WC7A 3LN3A 4JPGA 2I57A 4QEEA 1WV2A 3CZKA 3EMQA 4KFOA 4EOUA 3ITYA 1NFGA 4ZO6A 1ESWA 1ADDA 3P3BA 5CLWA 1S2VA 4R53A 5LXEA 5FSDC 3W7OA 3H2FA 3RFAA 1S5MA 3MI2A 1UW9A 3GDKA 3QJAA 3PJXA 2FVLA 4IISA 5LNSA 2NLIA 4LGXA 5A8MA 3IC9A 2C3CA 5FCZA 5JH1A 3W02A 3W9ZA 4ZA0A 4PC8A 5AYYA 5JQ9A 3N19B 2V5KA 1Q13A 2X1SA 4UNIA 2OX1A 4D72A 1XRVA 5ABHA 5AHEA 3GE7A 3GC2A 5DCBA 4AZ7A 4GVHA 3N9RA 4UUIA 3OEXA 4TX9A 3B9DA 1NOFA 5BOFA 1OSEA 4NX0A 3DGZA 2CKSA 3Q65A 1MQQA 3GIQA 3NQ6A 5HJLA 2AQVA 2VEIA 3C0JA 3GVQA 1SJCA 3L5OA 2ZZ1A 1ZBWA 4C5YA 4MAVA 2WB5A 2Z1XA 4YTSA 2D2HA 1UUMA 4JEQA 2EG7A 3QTPA 3M7WA 2DZAA 2XSAA 2XINA 3IANA 4Y2WA 3U2OA 3MSDA 1VHCA 3ATZA 1HGWA 4CU8A 1AVAA 1ZALA 3NVZB 2GH5A 4TVWA 2GGIA 1W9PA 3FLUA 1E70M 2P5NA 3W0KA 4FIRA 1FWGC 3EKZA 4FNPA 3PTKA 3NL3A 1GW1A 2P53A 3FEQA 3KOYA 4MWAC 2PP1A 4KESA 2PDKA 4F0RA 1FRBA 2V69A 1DL3A 2NV1A 1PTGA 1QNRA 5JCIA 3EXRA 1VFHA 1MRQA 1EQCA 4F4RA 1K7XA 3ZT7A 3TJIA 3KOXA 2PGRA 4DF2A 1VFUA 4GQGA 5ER0A 1E6XM 1EGVA 3HTWA 3OGRA 1TPFA 3TXVA 4IM4A 2RJGA 3OZPA 1MSSA 1VQZA 2QNEA 2BVTA 3GG1A 1OCBA 4B9ZA 1DJYA 1E6PA 2QXWA 1JPIA 1NFBA 4O10A 1ZX9A 1V3MA 1R3WA 4J3WA 4J2MA 4Z1BA 1BXBA 1VBRA 1PIFA 3AS3A 1B0IA 4C65A 2OQLA 4DZAA 3KXQA 3WO8A 1ZMCA 3NURA 3B9EA 1JCJA 5FACA 3U7BA 2OG9A 3RO8A 3MA8A 2POZA 5I02A 5HMSA 2J62A 4WDUA 3CQ0A 5I79A 1RBLA 1NWSA 4GG9A 3NQVA 2EPOA 5DMNA 1OGGA 4Q8MA 2ABAA 3M4HA 2QUUA 2IPJA 3BLDA 2X1TA 1Q7MA 5HR7A 2GJXA 1G7VA 8XIMA 5FKYA 3SO7A 1G1YA 4GCXA 4C1NA 1O5RA 6TAAA 2CZEA 1HJWA 1NQKA 1ISZA 1VFLA 3IJ8A 2YA2A 4M6UA 2CLIA 1Q8AA 2OEJA 4MY1A 1UPMB 3HG4A 3N9KA 1TSIA 1UR4A 2R94A 2XFFA 4H9ZA 3SUVA 5FL1A 4J27A 2J8FA 2E1DA 2WMGA 1TPVA 1JCTA 4GOAA 2UY5A 1F2JA 1B3WA 3Q94A 2WPBA 5C2XA 4E0CA 2O4MA 2J9XA 3PY2A 1E6NA 4M29A 1UD5A 1EO7A 4B5NA 3SUWA 1OG6A 4F0HA 4L4OA 2GGGA 5CSYA 1POKA 4KEZA 2PDBA 2J8TA 1FVPA 3TC3A 4K8GA 3F5JA 3VNLA 4LA1A 3CMJA 3RPTA 5D9NA 4AIEA 4Y8FA 3WLNA 3ZSSA 1STZA 1GESA 3UF9A 4CQCA 4GE8A 4GQRA 1XYAA 4Z2JA 2OCZA 3G1RA 1U83A 1O95A 2QCMA 5C0QA 1GORA 1MFVA 2OGYA 3ABRA 1H2IA 1B3VA 5AVNA 2DUXA 4WSKA 6ALDA 1AQHA 2QVNA 4XZBA 4CCZA 3F4WA 3VIGA 4DYEA 5HJXA 4V1YA 3PUGA 1ECQA 4PMNA 2H3BA 2RUSA 1BGAA 2YX0A 3BQ6A 1N60C 1V77A 1W9VA 2YL9A 9XIAA 4GZ7A 1PPIA 1S7MA 5D2YA 1I2PA 3CIVA 2IPGA 5D05A 3NDZA 3AUOA 4BY3A 2DP3A 4ZSTA 1EOMA 3I4EA 3R8GA 2YYTA 2ZTKA 3L5LA 5HMEA 3CGTA 4H01A 3RRXA 4HK6A 2REQB 3FHQA 1GOKA 3B4YA 3SRDA 3B8TA 1G67A 4U3AA 3OLIA 3MV01 2WYSA 3NZPA 5G2HA 3BPWA 3S5YA 1TYTA 3EXSA 1EFZA 4IF2A 2MANA 2A6NA 4DEFA 3LGGA 1POJA 4JTFA 4H4XA 2VURA 4REQA 4I5UA 3E0VA 1XIJA 2E8ZA 1FH8A 5EFFA 2IKIA 4JX4A 5JCLA 2UY2A 3SADA 1TJ1A 4AVOA 3CZLA 3SIMA 3W7DA 6XIMA 4FNUA 1KKRA 3MDWA 2PDQA 1TX0A 3D46A 1TTJA 4QTGA 3QEZA 1P5BA 1LL6A 5TD4A 4Q8QA 3W2KA 3IUHA 5T9BG 2FZ9A 1V6UA 3QMSA 3W1XA 5CG0A 3E2QA 5AHLA 3QW4B 3A22A 3RR4A 3KL3A 2FIQA 5F2IA 3TTSA 3W53A 1LRNA 2QCDA 1E5NA 2TMDA 4L56A 3LXDA 3SCSA 4LSBA 2X8RA 1ZJIA 3AN1A 2CXGA 1V79A 2Q09A 3GH7A 2QIIA 1FECA 1NDVA 5DQPA 2C1GA 3EX1A 1JUEA 1YHTA 2YLAA 1YEYA 3DFQA 3LUTA 4ZB0A 4PCNA 4LAKA 2CLLA 4ML4A 3GW0A 3TWAA 4E2BA 1RQEA 4B2DA 3VILA 1UOZA 4D6EA 3HG2A 1H61A 1K4GA 3CNYA 1BVZA 1HO1A 2XGIA 1PYFA 3MWAA 4F40A 3UESA 1LUCB 1FHUA 1TJ2A 4AF0A 2Z1BA 4GX8A 4A29A 3CWOX 4EXAA 3H54A 3S1WA 4FR1A 4AUBA 3W86A 4A3HA 4IP4A 3W7LA 1KTNA 2E68A 3VOFA 3H7UA 3RRAA 1IT8A 2FMNA 1UD4A 1E4IA 2OU4A 1F74A 5KZDA 3BLFA 1XIDA 4N2YA 4U10A 1RLDA 4CLMA 3DK8A 4WOZA 1HKKA 5TIMA 3EDKA 5T26A 1CYGA 4UFJA 3LBOA 2C0AA 3BGAA 3KBJA 1FHLA 5AB3A 4Q3MA 3BLOA 4KEUA 1H3GA 3UXKA 1SJBA 3HQPA 4XZNX 4UQAA 1ME9A 2FGLA 3B8IA 1L8PA 1TJRA 4YTQA 4G1KA 3RJXA 1LQ0A 4DF0A 3OBAA 3UU0A 2PEVA 3FOKA 2VEFA 3HPZA 1JFXA 4I6VA 3WENA 2BODX 5KZMA 4DM2A 1WB0A 3S1XA 3UZWA 4S39A 3MY9A 3TXZA 4CVWA 3WQ6A 1JAKA 3UPWA 1R6WA 2V5BA 5D2XA 3U57A 2ZADA 3E2SA 1R47A 4IMDA 1W37A 3FGCA 3ARVA 4QQUA 1OY0A 3ZSTA 2W66A 4L9ZA 3BAWA 2PWVA 4TO8A 1OIFA 4MB5A 3FEMA 3G8RA 1AJ0A 1CXEA 4RKAA 3CL6A 3LRLA 3FA3A 4DYJA 4JR5A 1XL9A 4H4WA 3IVUA 5FEPA 4J35A 4QNEA 4KH2A 1J0YA 2ZXQA 4Q8VA 3MUZ1 2FB3A 3KVLA 1HW6A 1JD7A 3H2CA 4EF9A 3C52A 2CFFA 2ZA3A 4HQVA 4ZTXA 5F1UA 2JKPA 3W7CA 1Q7QA 2ZKMX 5EMYA 4FIQA 4EE9A 4UTWC 1SJDA 2VP8A 4JDBA 2PDMA 1DXIA 2VC6A 4XBSA 4FMVA 2J13A 5C55A 1H63A 3T2QA 4GNVA 3DU0A 4EMJA 4P7LA 2MUCA 1C8QA 4JTLA 4R33A 4HHHA 3CTTA 3GRTA 3F4DA 1E51A 5AY7A 2QR6A 1VLIA 3CMGA 3EOSA 3H12A 3WQOA 3CYVA 4DZIA 4R34A 4OWGA 5LNVA 3L4ZA 4W5ZA 4M7TA 4I7UA 2UY3A 3IPWA 1XKJA 3OYZA 3QY6A 1E1EA 4A8RA 5IXEA 2OOFA 3RG6A 3SGZA 2PWDA 2OR2A 1VEPA 2G0WA 1E6SM 5ABTA 1QHOA 4BF5A 4JX5A 3TROA 1K77A 2VCBA 4IJRA 5HK4A 2WLZA 4C6LA 3CEPA 3NQEA 4K39A 4PBFA 2OLSA 2VQUA 1VBUA 3M7SA 3QLDA 1X39A 1QOXA 1T96A 3CAWA 3NJ3A 4Z2HA 2CYGA 2V9DA 1UP2A 4AYGA 5CZ0A 4XKYA 2OT1A 3W6YA 5JCKA 4GNKB 4RE3A 1XG4A 2A7PA 1DJGA 3RNMA 3AC0A 1K4QA 2ZDSA 5CZJA 1BSIA 3VIIA 3CPRA 4JY8A 1YTKA 2YXGA 3R4IA 2WHJA 4FI4A 3OVPA 2C1IA 4I3GA 1OF8A 4KCWA 4FHAA 3ITCA 2HPIA 4NI3A 1EEPA 4W7UA 4I8DA 4PTNA 3Q58A 2J88A 2QJJA 1FDYA 1KFWA 2E5DA 1EJUC 5HXMA 4MGGA 1K02A 4DLMA 3KM8A 3FG2P 1EC8A 2EPHA 3DI0A 2Q02A 4B15A 4AZGA 3BOXA 1UQZA 2CLPA 3VGEA 5CPTA 4MFEA 3GB6A 2X05A 1ZZMA 4K37A 1PO9A 3VMOA 2QAFA 2QPSA 2BXVA 3W26A 2XTKA 4IP7A 4IQEA 3MVTA 5MKGA 2WMHA 1UG6A 1WAUA 4K2SA 3SW6A 1UIOA 1Z41A 2WANA 5A6SA 2C16A 3IK2A 3STPA 3GZ3A 2GYIA 1KM3A 1TE1A 1SGJA 2PTYA 3KTSA 1X38A 4JQ1A 2DJLA 1IR1A 5C9UA 3GDLA 1VC4A 4OT7A 1QW7A 4WZHA 2ZVRA 3A24A 5FS7A 1UZ4A 1A5LC 4MKSA 3GKAA 1MEIA 1JRCA 1H5YA 2ACUA 2WPFA 3KDOA 1GRGA 4XAFA 7CGTA 2WP5A 3BSHA 1ZQ5A 3ABXA 2FGZA 5EY5A 3H4GA 3HMCA 4JTSA 2XGBA 5BZAA 1XLBA 4Q4PA 2R1MA 3WJXA 5SWUA 2FHBA 1VB9A 3GXNA 3Q67A 4UTHA 2OGJA 4L65A 2NX9A 2VC7A 5G1MA 4YPJA 3B4UA 2ZCGA 3SFKA 1G4EA 4A8NA 3W7NA 1RV8A 3VC6A 5D02A 3LMZA 3SI9A 2RJHA 1RBOB 2GVEA 4MB4A 4ML9A 4OECA 4WCJA 1K9FA 3L65A 2XVNA 2J25A 4NL1A 2I17A 3T81A 4DJFD 3SZ8A 2ZQ0A 2VFEA 4O1EA 1B57A 3CASA 3N34A 1T7LA 3CZGA 3UERA 3RU8X 1RALA 1EP3A 3LCWA 3UG4A 4GZIA 1JGMA 3H7VA 3DYPA 1UA7A 3POHA 5BCAA 4QRNA 1FWJC 3VGBA 2GWGA 3UWWA 1W3TA 5XINA 2VGIA 2R91A 4JD4A 4JQ2A 1V02A 2WBAA 2YDSA 3AUJA 3P8JA 1EJWC 1JROA 3GTNA 4NF7A 1NHSA 1ONWA 1S2CA 4ZQPA 3TNOA 3UZ5A 2XIIA 1OD0A 3KAOA 1EJTC 2XWDA 1XLFA 3VX1A 5C9XA 4U3CA 3LV6A 2E3TA 1I1XA 5FS8A 1KM2A 4GH3A 5D32A 4K1WA 3VIKA 2JK6A 2R9ZA 1WNOA 5M3WA 4AX7A 2PDXA 4I9MA 1O1HA 5JBDA 4JTCA 5FJOA 1A49A 4X9YA 3WQDA 2D2GA 3A21A 3WNMA 3VE7A 3GXIA 5LXXA 3TTEA 3OJGA 1MNSA 1OCJA 1P4CA 3G3MA 3BTNA 1IV8A 4WOQA 4JFVA 2CERA 2QCEA 2GDQA 1LPFA 3FS2A 4NIRA 1GRHA 2WJZA 4R27A 1YDYA 3BLIA 1E43A 5KITA 1E4NA 5LKYA 1RD6A 3SURA 4Z2KA 4UMBA 1F4AA 2O0TA 4C6DA 1XSIA 1NDWA 3W29A 2ZUTA 1ZP4A 3TA9A 1QBAA 1TR9A 1A4LA 3TTQA 4TX6A 4LALA 2ZXDA 1HX0A 1ZLPA 3P62A 4NJHA 2F2HA 1HJQA 3NGJA 1TTQA 1UP3A 1Y5VA 2X40A 2G3NA 2G4JA 1ZAHA 3N6JA 3VCCA 1ITQA 1LOLA 2UZ9A 4NYYA 4YS1A 4QXIA 3W88A 4UTTC 1IXQA 2CHNA 4JICA 2A3BA 4JTAA 1Q6LA 2X7WA 1QASA 3NVTA 1SJAA 1LT8A 1R85A 4L9XA 1IT0A 3G0XA 1F76A 5G4EA 1W3JA 4QM1A 1OFRA 2QV5A 3WFZA 2YVFA 4IXHA 1J18A 2ASHA 3ZJ7A 5CC3A 4FDCB 1TIMA 4AWTA 5DRCA 1H11A 3PPFA 3H4XA 2I14A 2HBXA 2WSQA 2A7RA 2ZZ3A 3W24A 4HYVA 1P0KA 5D9OA 4ZFMA 3WDRA 1W1VA 1FCQA 4H50A 3OP2A 4FLQA 2WMIB 4H7ZA 4FR6A 4WEVX 3M5ZA 1B1YA 5BROA 3NPXA 4RZ6A 3EDDA 4JL1A 2DZBA 4YXGA 3PS7A 2QCNA 1J96A 3BLKA 3QFWA 3OTRA 4S3KA 1RJRA 2Y5JA 2DSWA 4GKTA 2VEGA 2CWNA 2HE8A 3W1PA 2V63A 1BKSA 2WOIA 3USBA 4E3VA 3TCSA 1W17A 4QIUA 5I3GA 3PB2A 1IXPA 3HMJG 1OFOA 1JPDX 4I9TA 5CPQA 4Q4RA 3GTIA 3SECA 2H9AB 3NR0A 2VEPA 1AH4A 4KCTA 1GVFA 4R85A 4NX5A 5KEZA 4WXYA 1Q8JA 2NVDA 4ZB5A 3IIOA 2YW4A 3W1AA 3LHVA 5G2IA 3NYZA 4CD7A 1EDQA 4MWAA 1UOKA 2J7EA 1A5MC 4BI5A 1QUMA 3REQB 3B0XA 3GD4A 1MWOA 5CG7A 3V0TA 5IOBA 2X30A 2OB3A 4S3JA 4Z0JA 2P10A 1TWIA 4PH6A 1GETA 4QAIA 3ARZA 3ZXWA 3VAVA 3SCNA 4NAFA 2DZVA 2TODA 1Q1WA 3PZOA 3WUEA 5FJRA 3ARUA 3V0UA 3M9YA 4K1GA 5EL1A 1DQXA 4IGMA 4FLRA 2EO7A 2JKAA 3GVRA 2G8ZA 1NHPA 3TZNA 6ENLA 3SIZA 2WOQA 1LQAA 4HMDA 1ISYA 4FB7A 4EF8A 1R9XA 5BNKA 1GVQA 3B40A 4UR8A 2G3MA 1RVGA 2QDDA 5CPLA 1LTDA 1I45A 4AZIA 2XM2A 1XCWA 4M82A 3W07A 3N4AA 4ORMA 1K8XA 3MI6A 1GCYA 1Q2RA 5A69A 2D69A 1CLKA 1M68A 1NEYA 1B4EA 3V1PA 3IARA 3FHAA 2O56A 2J66A 1OYAA 3TYDA 3ZJ8A 2VI0A 1OQFA 3LI1A 1OGBA 1TPC1 3JUGA 5GJPA 2DW6A 4NJGA 2X8CA 2DQXA 3M0MA 4U5KA 8TIMA 2VFFA 2Z6JA 3T8LA 2IKHA 3B8UA 4N0RA 1LVLA 2C0HA 1PVNA 2W0HA 3FXYA 2W91A 4GUJA 3THQA 2CLEA 2PTZA 2BMBA 1U33A 3LCIA 3MC5A 2RABA 1HJVA 2PLCA 4HMCA 1R3YA 1CT5A 4QJ5B 3HPAA 2DV0A 3CZ8A 1YRRA 2E9BA 3AO0A 4IMEA 4NYUA 2PC8A 4DJEC 2J47A 2PURA 3T4CA 2PGFA 2QAEA 2J77A 3IUIA 3RX3A 4GMEA 4QG6A 5FJJA 3LADA 4ZQOA 1JEZA 4N02A 1OIMA 3K30A 2Y8KA 4LS0A 1EBGA 3UPBA 4GXMA 4EPDC 4IGHA 1A5SA 3DGHA 1MDLA 2CDUA 2EG6A 4JGDA 3CXOA 3QM3A 1XINA 4JL2A 1DYSA 3T05A 2XVLA 1W6TA 4MZ1A 2BTMA 2QQ6A 4A22A 3GRSA 4OBRA 1MZRA 3RJYA 3RN6A 1MUMA 3L2MA 3NDOA 4RE2A 4X63A 3TQKA 1XWYA 2VXNA 4ASTA 2DPEA 4KW2A 4AXKA 3UGVA 3A5FA 1IWPA 1XPGA 3AROA 3MKKA 2Z2BA 3R43A 1DIEA 4ICMA 1O5XA 1QNSA 1XIFA 4NAEB 1JYXA 2D23A 4JFUA 2XWEA 3H4KA 1WOAA 3EPNA 3U5UA 3W1LA 2ATMA 2V38A 3N04A 1R30A 3LHTA 3RIKA 3W1QA 1R2TA 4PTWA 3AU2A 3OLDA 4XISA 6TIMA 1VEMA 1TPB1 1UKPA 1V0LA 1SZRA 2WVVB 3HFTA 3EOLA 3SUSA 3S4TA 4BS0A 4GYKA 2XJ7A 1PTDA 4L61A 4DNHA 3DAQA 4CD4A 1EBDA 2BXYA 2WZIA 1W31A 3OODA 1V02E 1EXBA 4JTKA 1PAMA 3BV7A 3GZAA 1XBZA 5EMKA 3LSCA 4AD3A 3LCXA 4IJCA 3WLSA 4UQDA 1JOAA 3ZLGA 2BZNA 4AD2A 3SRHA 5A8QA 5REQA 1PDYA 2PDWA 1KTCA 1K4HA 3CB3A 1AG1O 3TYCA 5DBUA 3GC4A 4O18A 4NI8A 3QQWA 1R5YA 3R94A 4PTXA 2DZPA 3QVQA 2BHYA 4HU3A 1V7YA 2ZUMA 5HQMA 1HG3A 3WF2A 1ICPA 3O6YX 3A9BA 3QSTA 4RV8A 4URIA 1T5AA 4JNMA 5D03A 4Q4KA 4B92A 2XIOA 1Z3NA 2Y62A 1RK5A 1T99A 5AHMA 1KBIA 3UA4A 2VRKA 1BRLA 2E28A 3W7IA 3SQPA 4Z2GA 4US6A 2O7QA 6A3HA 3TW6A 1D9EA 5EBUA 1BPLB 1D3GA 2BVWA 3BE7A 1R2SA 5BU6A 4CNTA 4NJKA 1IWAA 4E2DA 3FYYA 1LROA 3VNZA 4JNYA 3DJJA 3W71A 5HNUA 3KCLA 5I6SA 3WDIA 2AGKA 2C14A 4ICNA 3TKFA 3IIXA 2J8GA 4UTJA 2FZ8A 2EQDA 1L2QA 2CPUA 2PLMA 3MSRA 5AKQA 4DO5A 5IDZA 2J74A 1IT7A 1EWEA 4EQXA 2O9TA 3M0LA 5GNZA 3UWYA 1XP3A 2ZZ6A 3B97A 3IGSA 1XLCA 1E71M 1I60A 4BV6A 4DYKA 2Z1WA 7REQB 4POCA 5FAJA 1OX4A 3NDYA 2WCGA 3OU8A 5BU9A 4QS5A 4J4KA 3TW7A 3EWYA 4CN1A 5FF3A 4IMGA 1S38A 1KM4A 4FXJA 4GY0A 3PWIA 1I2OA 3XISA 2JFEX 4HTBA 4WDXA 1YADA 1QVBA 1FOBA 2BY3A 4C7FA 3CH9A 1DEDA 4WVXA 4PMOA 3EOEA 4N4QA 2ZRYA 5HUPA 1UPPA 1A0DA 1H51A 1ME8A 3VA8A 4FEZA 4ECLA 3V36A 3L12A 1ODZA 4H7VA 1KM5A 2X0SA 5JXQA 4O8RA 2ZX5A 5JCMA 1O94A 1TWWA 3VIJA 2GVYA 3KW3A 1UKQA 2CHRA 1WUFA 1A80A 2QVHA 4GRTA 3TC6A 3SEPA 1P0NA 3LQGA 3LZ5A 1AMKA 4RK8A 1VBJA 3LCGA 3IAQA 3W73A 1EYEA 3M47A 3HGRA 3P80A 3OA5A 3QV8A 5BXPA 1ELSA 2PD9A 2P76A 4ZR8A 3HQNA 4XZWA 1VEOA 3U2EA 3SQLA 3WJZA 2PF8A 1JUKA 1UKSA 2VM8A 3G6MA 5HA7A 4NEWA 4JBRA 5CJNA 1NHRA 2VUNA 3DHDA 3HRDC 1Q6FA 3LPPA 3DC0A 1HTIA 1VRXA 3QXBA 4TMCA 5K4XA 3TC7A 4C6KA 3ATYA 3UG3A 4AZCB 1V93A 3C3UA 1YBQB 5GNYA 1V59A 3UZJA 2Z6IA 2EQ8A 2O9PA 4IGSA 4QSHA 2IUZA 1H1NA 4QE5A 2G37A 1QJWA 4S3CA 2HBVA 1O60A 1EO5A 1KWKA 3WZ0E 4QAWA 4C6OA 4P2VA 3P0XA 2R8WA 3TR2A 1R7AA 2FVKA 4UTWA 1XD1A 3OPSA 3CHDA 3FXGA 2WZHA 5ABFA 4O52A 3FV9A 1XXXA 1YPIA 1MXDA 4C60A 3MV11 3UJEA 4PEKA 4MWAE 2BS9A 2GUUA 3FX4A 1F07A 2CFYA 4CCCA 2ZX8A 1OBAA 1DWIM 5HANA 4GBDA 5AYXA 1UUOA 2FJUB 2ZZ4A 1VP5A 3VDBA 1UWAA 4XQ6A 3LZ3A 2GOKA 4A3UA 1C9WA 3S42A 1LRQA 1UKOA 2ALRA 3W7JA 1PYMA 3VU2A 1N5WC 5AYZA 3HV9A 4JTEA 4A35A 3R8HA 4UOQA 3WLOA 4FX7A 1PIGA 4FALA 4FXSA 1SFJA 3VOCA 1TQJA 3KZSA 3LB0A 3E12A 3PWGA 3PBYA 3QV7A 1HJXA 3VKDA 3W23A 3HPXA 3B0VC 4GVIA 4AX6A 3E0FA 1V03A 4DAFA 2QJGA 1XPYA 2HROA 1Q6GA 4HNVA 1DXFA 3XINA 3CAQA 4RNHA 4XKMA 5AHFA 5E0KA 4NY2A 1GREA 2J7GA 3QC3A 4GC4A 3MT1A 2WKGA 1IQ8A 1OEPA 3A7AA 4O4VA 1SMDA 3WIJA 4DWSC 4IXXA 3UPMA 4S1FA 1PBGA 2XH4A 3GQYA 1GWJA 2Q6ZA 3IRSA 3M6DA 4ATLA 1SB3B 1YQZA 3RLUA 2IPFA 4GGBA 4GYPC 4DBEA 1D8CA 4RE0A 3EX6A 1XD0A 4O14A 2ZX6A 5I78A 5DFAA 4W89A 3EOUA 1XYZA 4H8NA 3E2VA 3W22A 3MS8A 3TTOA 3FDGA 3VNJA 3QFAA 1WDPA 5I2UA 4DUWA 2FZNA 4LB3A 2EQ7A 1X97A 4EIVA 1Q63A 2CZDA 2FFIA 3LCLA 1QNVA 1WKDA 3L67A 4JHZA 3WLQA 3DECA 4EKJA 1RCOB 3GU1A 3MHGA 3VDGA 1EF3A 1OJTA 5AFDA 5F4WA 4BFAA 3UD6A 2GVGA 2P8BA 3SCOA 4EM4A 5BXTA 2I7GA 1S5WA 1FCUA 3MP5A 4BA0A 3HIJA 2W62A 4FZIA 2VT0A 5A6KA 1AK5A 5G5IA 2Q3RA 4M52A 4ADWA 1HKMA 1RR2A 3TN5A 4MAZA 3NXLA 4PUNA 1UWRA 3WUFA 2XVGA 2C91A 1DWGM 5FD0A 3SBFA 5I3IA 4NZ5A 1Q2SA 1PV8A 3O1NA 2RGLA 1W8SA 4GY7A 2OWXA 3WBAA 4WKAA 3PBUA 3M0HA 1X98A 2G96A 3FSTA 3HJEA 3UBPC 4AWSA 4ALDA 3Q2DA 2AL2B 3APTA 4QCEA 1EYWA 1IEIA 1MEHA 3SCTA 4GR1A 4H8HA 2RAGA 1OHLA 4W7WA 1EP1A 5TF0A 1GNXA 2ZXBA 1NSJA 3HN3A 1XIGA 4HJWA 2XIBA 3G1SA 3TYBA 2NT0A 3ISIX 3GC5A 4YNGA 2V3EA 4YHGA 1OC7A 1JR1A 3GNRA 4V27A 2F8QA 2KAUC 3L5MA 1DWJM 3WH5A 2XHYA 1YNPA 2QAPA 2GK1B 5CC7A 2ZBTA 3NO5A 8RUCA 8A3HA 1PCKA 1U30A 3BLLA 4ZODA 1GQJA 1MVYA 1EHNA 4IGNA 1TA3A 3VO0A 5AC6A 2ZZ5A 1KFKA 3CC1A 1TWDA 2DSZA 4YYCA 3GVGA 1MXGA 1FH9A 1SR0A 4PRRA 2H6RA 3UJFA 2INZA 3KWXA 1X6NA 4IQDA 4DUOA 2DFAA 1FDZA 1A5BA 4GJIA 2HEJA 2I16A 3EB2A 3P81A 5TQLA 2V3BA 3OLGA 4O50A 5A2BA 3B0PA 4P7NA 4HNLA 3GXMA 4DXXA 4O28A 3TX9A 2EQ6A 3IJQA 4OUEA 5JVLA 1ZB5A 4WK9A 1MW3A 3IJLA 3T55A 3MBDA 3TE9A 1S5TA 3PBGA 1KNWA 1RA0A 2A2IA 3K2GA 4PUJA 2TPRA 2JBMA 4YTUA 3QHOA 4N7QA 5HMFA 4TTGA 4BURA 1XBXA 4L80A 3S9YA 5A94A 4HPJA 3BSMA 4H6EA 2P0IA 1FQ0A 1F9CA 1S39A 5LIXX 4JTUA 3ZIZA 3VM7A 1VKFA 1C93A 1FFUC 3DKJA 2JKEA 2D2OA 2P8CA 3L4UA 2G5WA 2XFYA 2ZZCA 4C90A 4ERGA 5E5CA 1RJPA 3G6LA 5FMHA 2OO0A 4WF7A 5F2LA 3LCFA 1VFOA 1QPNA 2UWFA 4AEFA 2YAUA 3G0SA 1RA5A 2JQXA 1T8QA 2WVSA 4LVAA 3UFYA 1EKOA 2PODA 1XQLA 1XR2A 2CU0A 3UP8A 4CNUA 3NA8A 3V3WA 3EWXA 4NASA 1JQXA 3GU2A 2W3ZA 1EUNA 3SR6B 2PWGA 4I5XA 1UJPA 1D7KA 3ERPA 3QF0A 4UTTA 1Q5MA 1ONFA 2F6XA 3ITLA 5BRPA 4KWWA 4PA8A 5F2GA 1VCVA 4X2RA 1J6OA 3TMLA 3UXAA 3MVIA 3C2YA 2OQYA 3D9XA 4LUYA 2Z24A 2GJXB 2DT0A 1SYTA 1EGZA 3U48A 4QLJA 1TCDA 1WX0A 1PHQA 1YX1A 2VZTA 1TR1A 1EUAA 4C1NB 1WXJA 1UR3M 3HO8A 3RDKA 1CW2A 5CGTA 2CBIA 3RCNA 1SVDA 2B31A 1QW9A 4MJMA 5FEXA 3B06A 1PX8A 4C6NA 2PWUA 3SSZA 2VDHA 4F0LA 4GQQA 4JYDA 2OWCA 3BW3A 1ENUA 5AC8A 5MHBA 4ZXLA 4OZOA 2INEA 1UZ1A 3G1VA 1F7BA 1NDZA 3GXTA 1K7FA 1F3WA 2VYOA 4U4MA 3VNYA 1M5WA 1H62A 1ZAJA 4WIWA 4EXBA 3N2OA 2X99A 4X61A 3FJNA 1XICA 4ADTA 4H4PA 4AC7C 1RJQA 4FF7A 1QI4A 2ISWA 1YPFA 3PAJA 3VK5A 5HMDA 3EX2A 4KGJA 4G7EA 1G01A 4G1NA 4HSHA 2BVYA 4GIEA 3M5XA 4ATWA 3P61A 1EF2A 1HQTA 2ISFA 1EQPA 2YPIA 3CK5A 2YCJA 3GG0A 1SO3A 1JGIA 3LX9A 1YXYA 3QV6A 3ZQ9A 4B16A 2H90A 1V0NA 4KF1A 1YE6A 3QKEA 4E6MA 2PD5A 2RDUA 3GXFA 3U6WA 3C86A 2E77A 3NVDA 1S1PA 5LIUX 1WQ5A 1OFDA 1XGDA 4HK7A 3VDHA 2WV8A 5CXPA 2EAWA 3R0UA 2VELA 1FP8A 3URNA 3ITGA 4L1XA 3ZT5A 4DWDA 4LUSA 3GFXA 3RHGA 1W9DM 3T40A 1V7AA 2A0NA 1V97A 4Z1CA 2NWSA 1BFNA 4RZ5A 1X8FA 3RLHA 3BL3A 3B9AA 5A1AA 1E6RA 3AMGA 4GVFA 3VFLA 4HD5A 1IF2A 4WGHA 4IPPA 4JKKA 1W0MA 3WQVA 4KKXA 4Y7EA 2V67A 3FA5A 4XTDA 1XQKA 3NO3A 2XDFA 4DI8A 2EPNA 2J9YA 1RSCA 1E4LA 1H7NA 3NEHA 1JCXA 5LZLA 3N17A 5IHSA 2D0GA 5CBJA 2DH3A 1AH3A 3T4WA 2Y61A 5GJMA 3UGRA 4MYXA 1YTEA 5AECA 1U1UA 2XG9A 5HQLA 1KC7A 2DSUA 4DF1A 3W7PA 3VKCA 1BAGA 3VKKA 1C8YA 4AFYA 1OFBA 2GR1A 2YCLA 3EKGA 1QRQA 4H9UA 1A0EA 3B8DA 2QMJA 2GR2A 1GVOA 3C2VA 3LLFA 4Z42C 3G18A 3HQOA 2QF7A 4OGZA 3CUFA 2QCDB 2ZZ7A 2YB1A 3UVIA 2EPKX 4RV3A 4F66A 3O0HA 4D2JA 1XLEA 2F38A 2BOEX 3TLLA 2VZOA 2JEPA 3BICA 1VCGA 2X1IA 5CZSA 3SCQA 1YIXA 1OFQA 4FPSA 5H91A 5CJ5A 2VWSA 5FEWA 4GISA 2QCCA 3EX3A 4AIUA 2Y7EA 3PUEA 3LHUA 4M7SA 4DJEA 4GY1A 3VIMA 1ZXIC 4KCUA 2BGSA 1RP9A 4OV9A 3EA1A 3NPVA 3N15A 1XLAA 4HA1A 3FW6A 4AF0B 1VYPX 5I3FA 1OJXA 1TWSA 1G9HA 2V3FA 5DLCA 3HG3A 1RLCL 3M0ZA 1CXLA 5A6BA 1J0JA 1PZ2A 4GINA 2J24A 4H4VA 1UMLA 4GQBA 3R2GA 3TNBA 1FWIC 3QSRA 4H4IA 4UFMA 5AYIA 2OOGA 2QGHA 1NELA 4JTTA 3QPEA 3C2RA 4PGLA 1RHCA 5A6AA 4Z0SA 4O4WA 4YCPA 2YGYA 4H7CA 2VOTA 4IQJA 1FTXA 3BMWA 2V2DA 1A47A 1TZ7A 4I5RA 4EXQA 1JYNA 1CECA 3A9IA 1ZBKA 2WHLA 2GJLA 4D9PA 2DDXA 3GD3A 4QCFA 2WK2A 2WSPA 2H8XA 4JY9A 3WEZA 1VD6A 3AHTA 4KWUA 4XZMX 3B05A 1UD8A 3LTYA 3W81A 3ITTA 2E67A 2FHFA 3MHUA 3WUGA 1HJSA 4FNSA 2OLAA 4IJBA 1CWYA 1V08A 2YYUA 1QR7A 4A6GA 1W1TA 2FYMA 3LHWA 1XKYA 5EYWA 3WH6A 4A3RA 3FKKA 1E1FA 3L66A 2Y88A 3MP3A 3EAOA 3WDJA 3PNUA 2GDUA 3MSYA 3FGCB 2BOGX 2ZVIA 2JF6A 4YLWA 4GLEA 1TZ9A 2QIWA 2GQAA 1GHSA 2WQPA 1JZ3A 1EJRC 2PZ0A 1IXNA 4P8WA 4KS0A 3ZT6A 2FJKA 4DNAA 3W7MA 4Q8PA 3IJIA 5E9AA 4EP8C 3EUB3 1VFSA 2Y8UA 3ZVIA 4GJJA 2CHOA 3L4VA 3PF3A 5I3KA 1QPOA 4PMUA 3AJXA 3CGBA 4UTFA 3KS5A 1CIUA 3WNKA 2HPMA 3PPGA 1WDWA 2W54A 1RBAA 2JALA 2E09A 4GABA 3A4WA 3C2OA 4DJDD 2D22A 3TR9A 2Q71A 3TSBA 1O66A 2ZZ2A 2NQJA 3R8RA 2G3FA 3LCHA 4N6EA 3MHFA 2CW6A 3WN6A 1SZEA 3STCA 3EWCA 4R7OA 1VF8A 3PZMA 4W87A 4JYFA 4R7JA 1B90A 2G3IA 1Z44A 1XLKA 3WLHA 4B91A 3ARWA 3RU6A 2HV5A 1C29A 4XD4A 4P7QA 4JOMA 2E0PA 4MLJA 1MO0A 4WKHA 4QG9A 1BYBA 1NIUA 4LY8A 2VDGA 2HE5A 1EP2A 1HVQA 5I03A 1ZCOA 2D24A 2PWEA 3GDMA 3CEUA 3N1AA 1H7XA 4GFSA 4UFLA 2VVSA 3NTYA 3OW1A 1LQ2A 5HDRA 2QJHA 4TR9A 1JJKA 1PX4A 3TIMA 4PCFA 3W76A 2L5HA 2OO6A 3FCPA 4HJFA 1XC4A 4XKYB 2IXUA 1PXGA 1DP0A 3U3HA 3LPOA 1PWLA 4S3GA 1HF6A 3USZA 1Z69A 1AL8A 2FHCA 4XK2A 5I77A 4W84A 1ZJBA 1BG9A 3NQ7A 1N61C 2YSWA 4LANA 2VZSA 3GNXA 1UWTA 4W4QA 3PZIA 1KRCC 3ARTA 3KRZA 1KFEA 4GI4A 4XZHA 4O1AA 5C5YA 4Q8TA 4GD0A 1UWSA 4QE1A 4TX8A 3ZLHA 4JCLA 2VZUA 4ZQCA 3C3NA 1SZFA 5DT7A 3VCRA 2HWGA 1MYRA 4QSFA 5BMXA 2J79A 1ZJAA 4LAOA 4US5D 3FVMA 1NY1A 4PB5A 1R8LA 3R79A 5I3JA 5LHFA 4M6PA 1FWFC 4FOKA 2ACQA 5MKGB 5D04C 2V5LA 3PM6A 5DELA 4DJDA 4D6GA 3LENA 2OVLA 3FVDA 5L6UA 3BZJA 2RHGA 3K5XA 2P3ZA 3VI2A 5I0DA 4A8IA 1Q45A 2BVDA 4IZGA 4DELA 4E3TA 4WXZA 4EWJA 2J6VA 3EMZA 3QOKA 2PBGA 4DWSD 2WPGA 5HWNA 5U1OA 1SW0A 3MKVA 3PVFA 5CSUA 1OC6A 3QKZA 3QHMA 3OGVA 4U33A 1Q6OA 5I07A 2WVTA 1XIIA 3WX7A 1XFCA 3T0AA 2QW5A 3BG3A 2EXOA 2JIWA 3W1RA 1J12A 3EWWA 1LBMA 3WLTA 4QP0A 1PKLA 4KPLA 1LLWA 4RLIA 4LNYA 4AD4A 3LLXA 3GXPA 3AYRA 1NOUA 4I90A 4LYKA 1RM6B 4NQ1A 4A4AA 3SY1A 2ACRA 1OYCA 2WQDA 4FS9A 4OE7A 1SSGA 3ONCA 2V6AA 3TSDA 3GTFA 3P5YA 1MO9A 3BH4A 1EA0A 3C5QA 1O7AA 2YA1A 1J2BA 4IFKA 4AEOA 3C2EA 2YR1A 4D6DA 1PEZA 4KETA 3CPGA 2R1PA 3W7EA 2RDXA 4FXFA 2CBJA 1REQB 1WDQA 3AS1A 4LBUA 1KM1A 4ZQRA 4HZMA 1VIZA 1SZNA 1VR6A 4QJ4B 2ESCA 1GHRA 1XC6A 3BVJA 4UQ9A 4JKLA 3WLJA 2Y0FA 3R1ZA 5D38A 2VFDA 4EMWA 4N9EA 1GTHA 3CZEA 1F6KA 3G1DA 3E9AA 4H83A 1FXPA 3GLCA 1OT1A 4LUTA 1XIMA 3ITOA 1DHKA 4YWIA 4DVOA 4JIRA 2JE8A 1PZ0A 1TPH1 1FHDA 1VQTA 3QGVA 4L6DA 1QNPA 3TH6A 2P88A 2XN0A 3CO4A 1F3EA 2R1LA 2XPKA 3FAXA 4Z1DA 2GR3A 4J2PA 1QMLA 3SJ3A 1CDGA 3LTPA 1JZ2A 2EGZA 1J4EA 1GVEA 2NSOA 3ZS4A 3ZVHA 2J7FA 3S6TA 1CGYA 2BC1A 3PFRA 3M46A 3N73A 3IVTA 1VLWA 3H2MA 2G4FA 1CENA 4DWSA 1J0HA 1TVLA 1LM1A 2W5FA 3M0IA 4LYQA 4HNUA 1BQGA 4UQBA 1XH0A 1B54A 1W3HA 3I7RA 4E8CA 1XDLA 3FNDA 3LYEA 4DBWA 4GNJA 4GYPA 3B8WA 5E1QA 1R0MA 3OLEA 2AQWA 3EYPA 1R7OA 2BLEA 4J7RA 3E38A 5DANA 4S2CA 4DJFC 4NXSA 4JTQA 1M01A 4WD0A 5AZ0A 5JIPA 1DJHA 3D47A 4XB3A 1XJBA 4D1IA 1P0EA 1GGOA 3K4WA 4YL2A 4XUGA 2OJPA 3L2IA 1QI3A 4XAZA 3HGSA 1T0OA 3R5EA 3LXBA 1JUBA 4OTKA 2FTYA 4UQEA 1Y7VA 4E2VA 1WKFA 3W6MA 3BC9A 2BX7A 1JYVA 4JEJA 2QUNA 1KBKA 2XZ7A 4MNJA 4ZQNA 3HF3A 2V5CA 3VVGA 3VIHA 3G24A 4GGHA 4HK5A 4INFA 2C18A 2HVNA 3H7RA 4WQ6A 3PP7A 1QU4A 3NPWA 4UTMA 4HSOA 5BRQA 3LBCA 4XO6A 3RUBL 3HW2A 3UWQA 3N12A 4QEHA 4OIFA 3WH9A 2WO5A 4DO4A 1JRPA 1W1IE 4D8ZA 1IEXA 4S3BA 1WBJA 2ABBA 3H23A 3QPYA 2WP6A 1QTWA 3NM1A 1XHCA 2P1FA 3RM9A 3EGJA 4LIIA 1G69A 5C2CA 3PG9A 3WK1A 1U5HA 1KGUA 4FXRA 3M41A 4V15A 1K1DA 1ITUA 1NFPA 4EM3A 3PPCA 2FZBA 4WKFA 2A6LA 5J5RA 3FJLA 4JDRA 2XFWA 1DE6A 1XYBA 4P61A 1E6QM 4CNPA 3CBWA 2E5BA 1Y5WA 1ZDLA 2GVLA 3LQLA 5GRTA 4ZGYA 3QC0A 4PBEA 3R7MA 2IKGA 1OYBA 2QUMA 4HCHA 2F7FA 1HZYA 1ME7A 3I7QA 4XSLA 1LORA 5EKYA 1E5JA 1LL7A 3VUSA 3GAYA 2YVJA 3O8AA 1X6LA 1BWLA 3LD5A 1EWDA 1TG7A 1GK8A 4DN1A 3QV9A 1PKMA 4HU4A 1HP4A 1KD0A 2Y89A 3W2UA 2NSXA 5CLTA 3T07A 2YB4A 3KP0A 3GSMA 3WFAA 3TDFA 2NUXA 2HQAA 1JULA 3H8AA 3GDTA 4JTDA 3II4A 4XD6A 5TNVA 3LPGA 3WD0A 5DX7A 1QO5A 1FWCC 3TP4A 1TELA 4O15A 3WK2A 3EXTA 4B4FA 1FXQA 2ANUA 3ARPA 4QLLA 5A95A 1QO2A 5FF7A 3W74A 1GQKA 3UXLA 3W2NA 4S38A 1W1PA 2BGQA 4ADSA 3EDFA 1Q3NA 5K9DA 1QK0A 3WF4A 1O68A 2HCVA 3H70A 4YTTA 2CLHA 3PPHA 5EMUA 4MWAB 3UCQA 3SDOA 1EC7A 4A8LA 5I7GA 3H53A 3TA6A 5CBIA 1QPQA 1X1NA 1JVNA 2NVAA 3W4RA 3GK0A 2VTFA 3A3WA 2AMGA 1KFJA 4F8XA 4LYPA 4Q6XA 1HIZA 2XISA 4NAFB 3JRKA 1W5MA 3HFYA 1YE4A 5DF0A 3NYDA 3RLVA 5TBOA 3P67A 1RH9A 3BLPX 4JQ9A 4EX4A 4R9OA 2QCFA 1U2YA 4GZJA 4JHMA 5G1YA 3PG6A 2V6OA 1OM0A 2YFOA 3JZEA 5IFTA 1EH9A 4QDMA 1JEHA 3RM8A 1KFCA 4PSRA 4PUUA 2QCLA 2B81A 2PB1A 1GSNA 5FEZA 3H4WA 1XRTA 3P82A 4K7VA 1JD9A 5DT5A 3VIOA 4L4PA 8XIAA 3TW9A 3AXMA 3T42A 3DG3A 2OZ0A 3AISA 1DWAM 2PDYA 1TMQA 3GAKA 4MJ2A 3ARYA 2ZRZA 4QHRA 5KZ6A 3NL2A 3T0DA 2FFCA 4GC3A 3ZR6A 3EWBX 4XTIA 4ADUA 4Z08A 1XG3A 4WLCA 1E72M 2J7BA 4BWLC 4DUVA 3GFZA 4UTKA 2PPGA 4XBJA 1AL7A 3W7GA 3S0CA 3V5FA 4RNFA 1E3XA 3A6OA 3CT7A 1R3VA 1LG2A 4MSSA 1V6WA 4W8BA 2WCAA 4PRWA 1BXNA 3UWEA 1GVYA 3HQ1A 3L4YA 2E25A 2Z0IA 3A64A 2JGQA 5G5GB 3KOZA 1E9LA 1L6SA 4J28A 4O0KA 4UTUA 5E09A 3DDMA 3G5EA 3I3EA 2GZXA 4LRSA 3WK0A 2X7VA 3N2BA 1SUXA 4MYAA 4CU6A 4E4PA 4K6AA 1DJXA 1BVNP 4D71A 1WZKA 3AXIA 3ABOA 3NSNA 1XV8A 1LLZA 2FZDA 1DWFM 3WLIA 3T0BA 4NZFA 1D3CA 1C7TA 1HL8A 1PUDA 1W9BM 1G4TA 1J10A 7TAAA 5A6TC 1N2VA 4HYRA 1FKXA 4TV6A 5F4XA 3STGA 5FOOA 3P7YA 3VZZA 4GVGA 3STEA 4TUFA 3WMCA 3LNMA 3CUHA 3DBPA 4ACZA 4IP5A 2CEQA 2ALDA 5BOOA 3UR2A 5A5WA 3V5CA 3CMFA 3BAKA 2GR0A 4H3DA 4UR7A 3DJGX 4KEMA 1OZMA 3H2AA 1TWZA 2X09A 3B03A 3GUGA 2QZRA 4OU1A 3PANA 1W5OA 2SFPA 3MU7A 4BHYA 2ODOA 3MANA 3F2BA 3W00A 2ACSA 4TVCA 4H00A 4PUMA 1Z48A 3U2ZA 3TLQA 1F6PA 1NU5A 3BMVA 2EBNA 2D0HA 1BWCA 4LAMA 1Q7ZA 4MB3A 4EPEC 5C54A 1O4UA 4OOUA 4GXPA 1DOSA 2B7PA 2FDMA 1QW8A 3ANUA 1LZOA 1C9DA 4B90A 3TCEA 4NNBA 3ABSA 3BARA 3GUWA 4R88A 1LT7A 1V3JA 4JTGA 3Q37A 3BWWA 3KVJA 3KUMA 3REQA 1ZPTA 3NWRA 1KCKA 4LCQA 4XX6A 1ZP3A 3U8GA 4EWND 4KGLA 5M03A 3AQUA 5REQB 4Z2LA 4C7GA 1NP0A 2GUBA 4JN6A 3HGJA 1AMYA 4JX6A 4O19A 4D6HA 3VX0A 3MMUA 3UT0A 3GBDA 3OYXA 2YW3A 5JRBA 2VRJA 1CXKA 3IJDA 4PTDA 2J7DA 2V3DA 3VPLA 4H4QA 2HVOA 4LCSA 3BCFA 3ANVA 2P50A 3WQ8A 1NP2A 2AGTA 1FH7A 1WOBA 3MTWA 1YNYA 3KLLA 3LGEA 1KLZA 1BRLB 2VJXA 3NQGA 4EPKA 3LS9A 2GSJA 4N9CA 4YMZA 2RKXA 1Z9AA 3GTHA 3PJUA 2RFGA 3OZYA 4H6KA 4XV0A 4CUCA 4B4HA 2OZ3A 3DK4A 3MCNA 1SR9A 5IHRA 4MJ4A 2OQHA 2E9MA 5F1VA 3LHZA 5HNRA 3WCZA 3CQKA 3DG6A 4QR6A 1E73M 3NZQA 3VMPA 3VYLA 1AQ0A 4TVDA 3MJYA 4IIFA 4GQ0A 1K3UA 4IIHA 1JF5A 4AZBA 4HOWA 2HK0A 3N11A 1DWHM 1EZWA 2CLKA 5CKSA 5M5DA 2ZRWA 2FPTA 1OX4B 3GG8A 5IFPA 2HZGA 3F7JA 4CQ9A 3VNKA 4LJ3A 1AD1A 3U7VA 3SCRA 2X41A 2BG5A 2VR4A 1E15A 2CZFA 3CO8A 1OZQA 4HTYA 3NQ2A 1C3FA 2VCAA 5CPMA 4A3QA 1XLHA 1VFFA 4B5XA 3ID7A 4H2HA 4MNLA 3PZUA 1ZGDA 2A21A 2Z25A 4DPQA 1OVDA 3OIXA 1WA3A 4IPNB 1RAKA 3SRKA 4IIDA 2IPWA 2PDLA 4A2SA 3WJSA 5D2WA 2Z1KA 4LBRA 1MRAA 3ONBA 1LF1A 4WDWA 1CX9A 2E4TA 3KZPA 4IWWA 4MMWA 3TFCA 1SU5A 4L4MA 3V0SA 4ZENA 2R9RA 1LWJA 3DFTA 4YU1A 2X0YA 3W2JA 2OFJA 3GFYA 1TX2A 4MB1A 3DHPA 3MJMA 4U31A 5LIKX 4H6RA 3IIVA 4W86A 1H41A 1ADOA 1N8WA 1V6YA 1BVWA 5T9CE 4N9BA 3IEBA 3PR2A 2WKJA 3KE0A 3KL5A 4PE8A 2BC0A 3WH7A 1TV7A 5LIWX 4EQSA 1WDDA 5F2MA 3WYZA 1H0GA 4NAEA 1AW2A 2RDTA 3BOFA 2J7HA 2PDJA 3DBNA 5A2CA 3ES8A 3A3HA 3AIVA 5C7VA 3QR3A 5I06A 1XSKA 1TV3A 2I5QA 3CU2A 4DO6A 3OVGA 5BXRA 2C15A 3VGDA 2CKRA 4UCFA 3NSXA 3VGFA 3O6DA 3K1GA 3ZFHA 3WDQA 3B0UX 3DFOA 1UP0A 4E5TA 1EGMA 2X0HA 3VD3A 2FGBA 3TJ4A 2XZ9A 3GO2A 4E38A 2XVKA 3A4AA 4FLOA 3UJ2A 3H21A 2AKMA 4ZE5A 2QPUA 3IJ6A 3VZYA 2PDUA 5ABFB 1Z32X 1QNOA 4KT2A 1GKQA 2ZC1A 4O53A 2HNEA 2F84A 1A5NC 5ECUA 1AW5A 5KMYA 2OWWA 4HN4A 3I3DA 2WNWA 1CGUA 4GWEA 4BQ5A 2W67A 3MP4A 1ISVA 4M24A 1I4NA 1QOQA 1L6GA 2QCGA 1I2QA 4U28A 5CZKA 4YHEA 1PJ9A 5F4SA 3NZRA 1AOGA 3LTSA 3SRFA 3AICA 2WBKA 1W3LA 2AQOA 2G41A 1J5SA 5DBTA 1RCXB 4IPIA 2GRTA 1MFUA 3NIYA 1ZAIA 1PZ3A 1XUUA 3EOOA 4AVNA 1AH0A 2VOMA 2PSNA 4XO7A 3LEPA 2ZIDA 3D5HA 1Y0EA 4H9VA 3WLKX 3EANA 2PA6A 3BJFA 4XIAA 3TYAA 3SY8A 2QLYA 4FNRA 3BG9A 1GQIA 1XHGA 1DJWA 1WZLA 1OB0A 4OBSA 3WMSA 1U5JA 3APYA 4LUIA 5M1TA 4NP7A 4MJZA 4MHBA 4JN8A 2Y24A 3E0WA 3E0IA 3DENA 3KBSA 4GJ1A 4RNIA 2NQHA 2V2HA 1H7RA 1JQVA 2OODA 3II1A 4CGTA 2YA0A 3ZLFA 4GO9A 1UWQA 1A5CA 3BCJA 4H9YA 3MCMA 4CU7A