4KT2A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
404
structure length
384
Chain Sequence
b'SLKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-mannonate dehydratase
publication title Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
rcsb
source organism Chromohalobacter salexigens
molecule tags Hydrolase
total genus 150
structure length 384
sequence length 404
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2013-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4kt2A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4kt2A01
2PPGA 3PK7A 3I6TA 1XPYA 3RITA 2AKMA 2OQYA 4ROPA 2PU0A 3TJ4A 1MDLA 3PWIA 1TKKA 4HNLA 1R6WA 3GY1A 3DG3A 4JHMA 4MMWA 1BKHA 2P3ZA 4IL0A 2HNEA 1SJCA 2P0IA 4HCHA 4KWSA 3VC5A 2QDDA 3B97A 2PSNA 3MQTA 3N4FA 1DTNA 3ENLA 3SQSA 1PDYA 4DXKA 1TE6A 3CAWA 5IDZA 1PDZA 3VCCA 2PGEA 3ES7A 2PP1A 5FJPA 4KEMA 2MUCA 2POZA 4HNCA 2MNRA 2QJNA 3RCYA 1P43A 4E4UA 2AL2B 3PFRA 4M0XA 3QTPA 3MKCA 3N6JA 1WUFA 2P8BA 1BQGA 3T6CA 3ZLGA 4G7FA 3MSYA 3GD6A 2AL1A 1F9CA 3T9PA 4G8TA 3TOYA 5EU9A 4M6UA 2ZC8A 4IP5A 3DDMA 3ZVHA 4K8GA 4IHCA 4A35A 3OW1A 3UJ2A 3T8QA 3BSMA 3Q45A 5BOFA 6ENLA 3RR1A 2PS2A 1E9IA 2QQ6A 4ZCWA 3S47A 3VA8A 3TTEA 1FHVA 2HZGA 2AL2A 2QDEA 4FI4A 3RRAA 4HYRA 4E4FA 2PU1A 1JPDX 3DERA 3JVAA 3R0KA 2QGYA 4A3RA 3IJQA 3SBFA 4HN8A 3TQPA 3H70A 3VC6A 1MDRA 1KKRA 4EWJA 3IK4A 2PTXA 2XSXA 3SN1A 3NFUA 1EBGA 4DWDA 3THUA 1YEYA 5FJOA 2OZ3A 1EC7A 3VCNA 2OKTA 3QPEA 2HXTA 4J3ZA 3D46A 3VDGA 4E6MA 2OX4A 2PP3A 1FHUA 4IZGA 2XH4A 3P3BA 3DGBA 3SJNA 2GSHA 3TWBA 3FJ4A 3N4EA 3UCCA 3DEQA 1JCTA 2PTZA 2QJJA 2OO6A 3V5FA 4H2HA 1NELA 3TWAA 3CYJA 3RO6A 3OTRA 1KKOA 4IP4A 3DIPA 2I5QA 3BJSA 3ZVIA 2PMQA 1SJDA 3UXKA 2O56A 3UJFA 2QVHA 3H12A 3QKEA 4IT1A 3GO2A 2GL5A 2GGJA 3FYYA 1WUEA 2OZTA 3CXOA 2CHRA 5FJRA 3NXLA 4HPNA 3RGTA 3FV9A 2NQLA 3R11A 3KUMA 3MWCA 5J04A 4KPLA 3NO1A 3P93A 4GGHA 3V3WA 2XH2A 4HCDA 3TCSA 2OLAA 3FXGA 4A6GA 3N6HA 1SJBA 3H8AA 3STPA 2HXUA 2OFJA 3DG6A 4GGBA 2PTYA 3MZNA 4X2PA 3UJRA 2RDXA 3EEZA 1EBHA 1RVKA 3BOXA 3DESA 2FKPA 3H7VA 2GGGA 2OPJA 3UGVA 1OEPA 3ES8A 2OVLA 4JN8A 3JW7A 3PWGA 4DN1A 3FCPA 1W6TA 3R25A 4ZA0A 3JZUA 4GFIA 3UCDA 3SN4A 3NZGA 2XGZA 4GYPA 5FJTA 4GYPC 3S5SA 3UJEA 1JDFA 1KD0A 4IL2A 1L8PA 3IJLA 3TJIA 5ENLA 3SN0A 1P48A 2OZ8A 3DG7A 3DFYA 2P88A 2FYMA 1IYXA 2AKZA 3Q4DA 3T4WA 3VFCA 2GGEA 5BOEA 3UXLA 2DW7A 3EKGA 3MUCA 3QLDA 2ONEA 2P8CA 1MUCA 3D47A 1TZZA 1EC9A 4K1WA 2QJMA 4GISA 3CB3A 3DFHA 1XS2A 4GIRA 3ZLFA 3ZVHB 4DX3A 1R0MA 3MY9A 3OZYA 1SJAA 3I4KA 2PGWA 1KCZA 4FP1A 1MNSA 3OPSA 2GGIA 4KT2A 3ZLHA 4H19A 3SSZA 3GC2A 2PCEA 2GDQA 4MGGA 3OP2A 3UJSA 3R0UA 1ECQA 4F4RA 3CT2A 1ONEA 2PTWA 3HPFA 3IJIA 2OQHA 7ENLA 4HCLA 3P0WA 2GGHA 2PA6A 2XH7A 3OZMA 4DYEA 4ENLA 4H1ZA 3I6EA 1MRAA 4E5TA 4K2SA 2OG9A 4DHGA 2PP0A 4E8GA 3V4BA 4GMEA 3QN3A 4MKSA 4H83A 3FVDA 5FJUA 4Z17A 3V5CA 3TW9A 3K1GA 4YWSA 2DW6A 3U4FA 4Z1YA 4JN7A 3R10A 1EC8A 3R1ZA 2ZADA 3U9IA 1JPMA 2XH0A 4J1OA 2PODA 1NU5A 1ELSA 3CK5A
chains in the Genus database with same CATH superfamily
1ODUA 2VUNA 3SRFA 3LQGA 3NQ8A 3WQVA 1BHGA 4AXKA 2OT1A 2QDGA 2IKIA 3MS8A 3PPCA 5AC5A 1BQCA 3Q6JA 3RR4A 2ACSA 1JXJA 1I2OA 3QVQA 3WNMA 1NARA 1MDLA 4CEUC 4WSHA 1JR1A 4LUYA 2ASHA 3LHTA 3FJNA 1Q2RA 4UQAA 3E6EA 4XUGA 4DPPA 2G3MA 4KWSA 4QLLA 3PM6A 5A8QA 3OYZA 1UKQA 5FA5A 1ZY9A 3PJWA 1EJ7L 3VVGA 4F0LA 5AYYA 3WNKA 3QF0A 5CZ0A 3LRLA 3LZ3A 4PE8A 2BXYA 3AUOA 4C65A 2CC0A 3BQ5A 3AICA 1B90A 2VD9A 3UU0A 3L4VA 4QHRA 2MUCA 1JYWA 1DWJM 2Z27A 4JL1A 1VBJA 3VNJA 3W6YA 2J77A 4ONVA 2DQWA 4M7SA 4KCVA 2AAAA 5AYZA 1EJTC 2Q8XA 4LH8A 1R2SA 2ZVRA 4PRWA 1N7KA 3DKJA 2AL1A 3B04A 1U5HA 4M81A 3D3AA 2VQTA 3H4XA 1DJIA 3Q65A 3WD1A 3CASA 3IC9A 4FX8A 1DQUA 1EP2A 4D2JA 1J18A 3E5PA 4H8UA 3SY8A 2V5KA 2V3AA 2DT1A 1IWBA 3BV4A 2JKPA 3EANA 1V93A 3GRIA 2WOWA 3S1VA 3WFLA 4DF2A 3AIEA 5A8GA 2BY2A 3DZ1A 2VOTA 3GW0A 3PZTA 1NTHA 4M6VA 3S5NA 4PFHA 2R82A 4HYVA 1OC7A 4L6DA 1AFSA 3T42A 4K1GA 3KBNA 1WYGA 3L68A 2AQWA 3SN1A 1I6NA 3LV5A 1LRQA 5CZSA 4YLWA 1KM1A 3N19B 2ZRUA 2XWEA 1MSSA 1DQWA 1M01A 4ZTXA 3OLEA 3GC5A 1AH4A 2F9RA 1K70A 1RA5A 4AVFA 4N9DA 4RK8A 1BWVA 5IBXC 4WDWA 4G2DA 3ICJA 3PG9A 1Q7ZA 3TFCA 2I1OA 3VNKA 3NL6A 3NTYA 3WLTA 3P80A 4G9PA 2VJXA 4FXJA 3W84A 2WW5A 2A6NA 2OTDA 5A95A 4H4IA 5C71A 3RO6A 3W2LA 4PTDA 3W2NA 3GKFA 1KQYA 3RLHA 3A3WA 4HT3A 3AZTA 1KQZA 4N6FA 3OEXA 3GIPA 3ARYA 2HSAA 4JTSA 4MKVA 1C29A 1QW7A 1GCYA 1TMHA 3NOEA 1FWSA 5GNXA 1JZ3A 5EL1A 3NVWB 2XFWA 3KOZA 1O5RA 2WC4A 3DAQA 5DT5A 2DSKA 3AJ7A 3IJ7A 4XVDA 1EPVA 1XCXA 2DY3A 3EKLA 4K36A 3TCSA 3ARVA 2J8TA 1PHQA 4A8RA 2CBIA 3A7RA 7TAAA 4CU8A 1XGDA 4AIUA 2W63A 1CGVA 2OEKA 4LX4A 1OK6A 1GORA 1IT0A 1IIHA 3AHVA 4GIAA 1HO4A 1XF0A 1Q45A 4A2SA 4Z42C 2CZ5A 2G96A 2XN0A 2QUTA 3MW7A 2J7DA 3R4IA 4RZ5A 1A5MC 1ME8A 4D6JA 4EF8A 4AVNA 3A4XA 3R6IA 2J88A 3WDIA 1E40A 2VEKA 3MVIA 4L7ZA 1LRNA 3BW3A 5FF4A 2OOFA 1XYBA 2J47A 3VPLA 3UVAA 1MW0A 1GRTA 3LGEA 4MYXA 4HOWA 5REQA 2R9RA 1W54A 2DVTA 3CZGA 4HOZA 2P5NA 1IT7A 2AMXA 1A5LC 4KFPA 2VL4A 4Q4MA 3EKGA 3PJUA 1EGZA 5JH1A 3E38A 6XIMA 1JROA 2A7PA 3I7QA 1FXQA 4NZCA 2E3ZA 3KCJA 4HU3A 5I24A 4GIRA 3E2RA 4PTXA 2VZSA 1SYTA 1SFTA 4DX3A 4D1IA 3OZYA 3IARA 1SJAA 3HO8A 2YYTA 1BGAA 1T6MA 1F3PA 3PJXA 4AMCA 4F4RA 2D2GA 3TVAA 3EUB3 4MUZA 3WSUA 4FAMA 1LBFA 7ENLA 4HCLA 1BXNA 4PR4A 3SEPA 4FXFA 4XAYA 3C2VA 4DYKA 3GH4A 2NVKX 1I8JA 1LP6A 4E8GA 3CPGA 4HNTA 2HK1A 3P82A 4NQ1A 3W1TA 1UH4A 4JYFA 3P8JA 3WF2A 1LL6A 4I6KA 2YR1A 5F4XA 2GRTA 3GNNA 3HM7A 3W82A 2EG8A 3QJAA 3H2NA 1ZALA 5HPOA 3AMGA 4NAFA 4IXXA 1V77A 2YDQA 3LCXA 3PUOA 1OY0A 4FO4A 4IX2A 2P3EA 2G3JA 5HAOA 5G4WA 1E55A 1H4PA 4XO7A 3CK5A 4O1CA 2XISA 1PZ0A 2R24A 3UD6A 2EQ6A 5HQLA 5JU6A 1HJXA 3IIOA 3IJ6A 1AG1O 4P7NA 4JIHA 4LPCA 1N5WC 4HZ7A 3S1XA 3EPNA 1KN0A 1CXHA 3WG6A 1E70M 1QVBA 2FPVA 2IW0A 3APYA 4YXGA 1WOBA 3FW6A 2WO5A 3UGRA 5K7JA 1EUAA 1Q5MA 1EF3A 1JZ2A 3LV6A 3VIKA 4GIYA 3BGGA 5TD4A 4CQBA 1ADOA 4J3TA 1UZ1A 4ML9A 4RNIA 1H0GA 3CAQA 3UWZA 3KTSA 3MBFA 3PR2A 3B0YA 3TKFA 3H2AA 4C7FA 1E56A 2ZZ0A 4AD1A 4RNHA 5JBEA 2GR1A 3B8DA 1YE6A 1V51A 1TE6A 4UZSA 4PULA 4KESA 4F0SA 1SMDA 1EHNA 1EL3A 1YDNA 1X6LA 1TWZA 5FKYA 4XD5A 4HU4A 5K4XA 4MJMA 1JAEA 4BEUA 4D6IA 4Y2WA 2H9AB 2ZUTA 1O95A 3C0JA 3PUDA 4UQEA 4G7FA 3TTOA 2J7CA 4EIVA 1OYBA 4TX8A 2V5CA 4AD4A 3LCWA 4OE7A 3CHVA 3STGA 3VZYA 1H50A 2OLSA 4IHCA 3PZQA 4I9TA 1V6VA 1A3HA 4PRRA 1XUUA 1LUCB 3M0VA 3UJ2A 4HBKA 2GVEA 1REQA 1YNYA 3KS5A 4AF0B 3QC3A 4NYUA 4OHQA 3VILA 1KFKA 3UWUA 2F7FA 1OBAA 4FI4A 2EPMX 2I56A 3WH7A 4HJWA 3R43A 2TMDA 3IK2A 3U8GA 1W8SA 3G0UA 1XHCA 3WLPA 3I4EA 1P0BA 1F74A 4FZIA 4LUSB 3AU6A 4PZVA 3CV1A 3C61A 3IK4A 5F2MA 2XSXA 4FK9A 4DWDA 3KL0A 3H55A 4UFLA 4UR7A 4LAZA 3M44A 2XIJA 3GD4A 2WKLA 5JCKA 5E6YA 4NJHA 3TUUA 7REQA 4UTTA 2WVTA 2XZ9A 1GKPA 3HG2A 4WKFA 2YSWA 3DGBA 3M7WA 1H5YA 5KZDA 4AZCA 2PF8A 4Z1BA 3ARSA 3P2VA 2PTZA 1F05A 5CGQA 4O8RA 3STCA 7A3HA 3QV8A 1XBYA 2ON3A 1PAMA 4W87A 1FKWA 3URAA 3A22A 4JFVA 2BVWA 3H6OA 3MANA 3P14A 2OSXA 3GW3A 4IT1A 2PC4A 2GL5A 5I02A 4BA0A 2V9DA 1NM9A 1TPH1 3FAWA 5DELA 3FYYA 4KBXA 1VEMA 1M7OA 1VB9A 1E72M 3AIBA 1XPGA 1NOUA 3OBEA 4D8AA 1KTCA 3U7BA 1W3LA 1OX6A 2RGLA 1XFCA 3ABZA 1Z41A 1ITUA 2PAJA 4FNTA 1XLCA 4PMYA 4HZ6A 3RX3A 3NL2A 3NO1A 1XBXA 1K3UA 2YVJA 3N6HA 2HVMA 1XP3A 3IJ9A 3STPA 3VGDA 2CHNA 2ZWYA 1B2YA 3UJRA 1XIEA 2J7FA 3U4AA 2V3DA 1RVKA 4B5TA 2WZHA 4L80A 4OUEA 1NY1A 4D1JA 1MYRA 4R5EA 1J11A 4ML4A 3VOFA 2OWXA 3S2LA 1JZ6A 4LIIA 4EPKA 2W66A 1XD1A 3EWXA 4XKYA 3DFOA 3HQ1A 4GYPA 3N2CA 2PDPA 1S5WA 1KRAC 1JDFA 5A2CA 2WJZA 2PCQA 4XD4A 3W1RA 3E0FA 1MEHA 4Y9MA 2WNZA 3ISIX 4JL2A 4JKLA 1GQKA 2GDVA 3SUSA 5CC3A 2VWSA 3MBDA 1GWJA 3G8EA 3M5ZA 1ZRQA 1GRFA 1A80A 1AQHA 3PZ9A 4RZ6A 3DGRA 1JPIA 2X1UA 3CH0A 3A3HA 1WDQA 2VZTA 5CZTA 5DX7A 3W24A 3GHRA 4K1WA 4IQJA 1UKSA 3TMQA 3NQMA 3CQ0A 1V3MA 3WQ5A 1UA7A 4DZAA 4WEVX 2YQUA 4OTKA 4PUDA 2ZE0A 4V1XA 4XIAA 3KBVA 3I4KA 5I07A 3CEPA 3T0CA 3ETRB 3M4HA 3QGAC 4R7WA 3LDVA 5C8BB 2X0SA 4LWWA 4DO7A 1M68A 3QSRA 2GOKA 1RD5A 4KPRA 4GG9A 1NDYA 1T40A 5C5YA 1HL2A 1AZ2A 1G1YA 4IFKA 3W07A 4C6NA 3CAVA 2X8HA 4FMVA 3ONCA 3OZMA 4CU6A 1CW2A 3VNLA 4AD5A 3DI0A 1CZ1A 2CBUA 4NSBA 4UQ9A 4MZYA 3UPBA 1X2GA 4DQWA 3MKKA 3MT1A 3QKZA 3KL3A 1R87A 2YZRA 3QC0A 3S46A 4M29A 3BOFA 5F1UA 4AQLA 3IUDA 1LBMA 3KCOA 4C5YA 4DNMA 4ORMA 1HJUA 4KWWA 3IIPA 1N8WA 3HG3A 3MUZ1 2GLKA 3W7GA 2J74A 2VI0A 3M0XA 3KVMA 3RIKA 5I78A 2Q8LA 2CCRA 4QXIA 1F4AA 3W7QA 2VFGA 3BAKA 1LG2A 3PK7A 4C7GA 1N62C 2G4FA 2JALA 3LS9A 4G7EA 4NJJA 2EKGA 1GUVA 5E6ZA 4ACZA 1FDJA 2R14A 1OT2A 3WMBA 4PCPA 1GRHA 1ONFA 3HA1A 5E9XA 5K9XA 3GY1A 4QDMA 4TVCA 3HGJA 1OFQA 2P0IA 4NF7A 3PBGA 3QYSA 1E9ZB 2V81A 3NOYA 3E5BA 4IIGA 3GTHA 9RUBA 4H4ZA 3ABSA 4HMDA 5I3GA 4IGSA 4H9VA 1IWAA 4NI3A 3G1VA 4BI6A 1Y5VA 5IFPA 4W86A 2C7FA 3O15A 3T40A 3RCYA 4AUBA 2XVPA 4MY8A 2Y8UA 3QY6A 3MCNA 2JIEA 2Z7KA 3QTPA 3GHSA 3MKCA 2VURA 1Y0EA 3GBEA 3NQBA 4AD0A 4NL1A 5ABGA 1C7SA 4LNCA 1ZAHA 1F9CA 1PO9A 3RN6A 4IMAA 1JDDA 3EYPA 3NM1A 3GXMA 3WH8A 1HX0A 1UJPA 3HG4A 4S3DA 1E6XM 4UMCA 5TBOA 5KMYA 3WQWA 1AH0A 3CNYA 2YDRA 2ZUSA 3GDLA 3PB0A 1FDYA 1UC4A 4GABA 2E6YA 2C0HA 3ZS4A 3V7PA 1JPDX 5AZ1A 1ONWA 4J2MA 1TWDA 2QEZA 4QG6A 5HNUA 4Q8WA 1LORA 2FHBA 3G6MA 3KRZA 4JFSA 2J25A 2XJ7A 2R8WA 4GCAA 3UG4A 2YPIA 1DIOA 1J0YA 1YPFA 4CNPA 3OVGA 4AY7A 4QLJA 1NAL1 3KXQA 2Z25A 1RZMA 4H3DA 4W5ZA 2WMFA 1CECA 3CQJA 5J5DA 2NXIA 4HZMA 4E6MA 4RW5A 4WZHA 8A3HA 1QFEA 4ZB2A 3NG3A 3HJZA 4UCFA 5ER0A 3N4EA 4J57A 1TPVA 3M5XA 1VPYA 3EOSA 4NNCA 1W1B1 4IUOA 5G5GB 3DFNA 4WGXA 4J40A 4L9ZA 1LOLA 4NI8A 2IPJA 4Q6XA 1NP2A 3POCA 5ECUA 2WSQA 4PTVA 1W1TA 1B3VA 2CLFA 4WR3A 3WK2A 4MY9A 1BSLA 2NV1A 1OC5A 2J7BA 3GIYA 4CU7A 3DJJA 3B06A 3MUY1 1V3LA 2OZTA 3RU8X 4Z2KA 4UFKA 4M3PA 3DFTA 4BHYA 3G1HA 5IRPA 3W76A 3AS0A 1CWYA 6PTDA 4MSSA 2R1PA 1J8VA 2P0OA 4CQDA 5J04A 3MUIA 4LQ1A 4GINA 2J9ZA 1OGBA 1H1NA 1US0A 1LWIA 1GPFA 1E6ZA 4RDVA 4RE0A 2WV8A 1UR0A 1Y7VA 4TVUA 2HTMA 2YBVA 1J96A 1PZ2A 1QBAA 2NUYA 3VI2A 3WK3A 1KM3A 2XYLA 3ITCA 5ABTA 1N63C 1ECEA 4KIRA 1GXFA 4IMGA 3AMDA 4XSLA 1T0OA 3TOPA 1XKJA 4GI6A 2ZRVA 5A6TC 3TC7A 3W1PA 4NXSA 2YCKX 5FD0A 3BSGA 1POJA 5I3KA 4CEXC 5M3WA 2UY3A 3PBVA 1JCYA 2EJ1A 3ZWSA 3CHDA 4ZQPA 2R1LA 4O1DA 4Q7BA 3A21A 2BASA 1E1EA 3C4UA 2FZMA 3WUBA 1TIMA 1HG3A 1TE1A 4QJ5B 4YTRA 1P48A 3PAOA 4NP7A 2DT2A 5A6SA 2DJLA 3TYEA 3IAPA 4PODA 2XSAA 1JI1A 1M03A 1IQ8A 4QJ1A 1XLMA 4J5NA 2I5GA 3AJXA 5AHLA 3RMEA 9XIAA 4YMZA 2YJQA 1KR0A 2VWTA 5DMNA 3PG8A 4LBRA 4QG8A 1CXEA 3LRKA 5E0FA 2BS9A 3S9ZA 1K8YA 3AYRA 1YMYA 2HMCA 1CGYA 4CNSA 4KRTA 1L6GA 5LNUA 2VM8A 1QI5A 4LS2A 4Z1CA 3UWWA 5DXYA 1D8WA 2ZDRA 4PMZA 4QQUA 4BKNA 1NFPA 1JCMP 4CNNA 4W8AA 3OP2A 2VUYA 4LFYA 3B9AA 3KAOA 3OLIA 2QT3A 2D24A 2RUSA 1J9YA 3LPOA 3WL0A 1M7XA 3BTNA 5CC6A 1JCJA 3IJIA 1PBGA 1UB3A 3PZVA 2QPXA 3W38A 4M6QA 4MJ4A 1YYAA 3PTMA 2DSUA 1OCJA 3ITYA 2Y63A 1AMYA 2QCEA 4C6CA 3RPTA 1VFFA 1UD2A 1XJBA 3SCUA 1P6WA 1LLZA 1HF6A 1AL7A 3R2GA 1P1XA 3L12A 4JICA 3EPOA 1W3KA 1EXBA 3NZRA 4NT0A 3P84A 4YNGA 2AAMA 3KTCA 4HK6A 1BPLB 1PKMA 5F2GA 3WLHA 2CKRA 3EX6A 5A6AA 2YVFA 2C18A 4CD6A 4J3SA 4H41A 3DI1A 3KOFA 3VDHA 2HS8A 1UPMB 3LQLA 4ZQNA 2PRMA 1JZ5A 3WCZA 4AZCB 4B4HA 1NDVA 2DJXA 4LYQA 1K8CA 2A3HA 1XYAA 3AXXA 2PDWA 4Z2GA 5KZ6A 2VRQA 3MWAA 2OYLA 3NURA 2PU0A 1IT8A 3NPXA 5BRQA 3SUVA 3W88A 3MC5A 1IIGA 4AC7C 3N9RA 1TWSA 3ELFA 1K02A 1Q63A 2XIMA 1S1PA 1WXYA 5DCEA 5FSDC 4F79A 2PLMA 1OT1A 1GJPA 2BMBA 1OCBA 2V38A 1TX2A 1Q6FA 2E28A 1ODZA 1G01A 3W1UA 4Y90A 3TC3A 4HHMA 1UH2A 1F3XA 3GX9A 1X1NA 3CAWA 4V2XA 1FVPA 1S2CA 1NEYA 3SQLA 1RQHA 1QXLA 4JQ3A 3GK0A 1XL9A 2D3NA 1XC4A 2EGZA 2CLHA 4LCSA 3LB8A 4E4UA 4A3QA 5A2BA 4YVPA 3F2DA 4WUIA 3QV6A 2QCDB 3V16A 5A5WA 1TWIA 3CZ8A 3W1NA 4RXGA 4K8GA 3ARWA 3UZJA 4W88A 3AS3A 4KCUA 2Z1SA 1K7XA 1V7AA 1US3A 3VABA 4XKYB 3TH6A 1E9IA 1W3JA 2ZCGA 3TSBA 2C91A 5CLTA 2AL2A 3BH4A 1KBIA 3C6CA 1FFQA 3N12A 4NAEA 4F2BA 4PUWA 3N9KA 1KM4A 1UWRA 2VVSA 4L1WA 4S3FA 1PEZA 4WDXA 1GYNA 3HMJG 3VKCA 4LRTA 3CHFA 1UPPA 3UPWA 3P67A 3H4GA 2PTXA 3QHOA 3RAOA 2X09A 3HMCA 1XHGA 3GNOA 4TR9A 3K4AA 2OXNA 1C9DA 3HQNA 3PC0A 1VBHA 4AZBA 3EB2A 1SO6A 4YJ5A 1TYGA 1F8IA 5D38A 2OX4A 3GDTA 4GQRA 1M3UA 3WD2A 2UZ9A 3TQVA 1RK5A 4ZO8A 3FVMA 3T0BA 3CZLA 4BJHA 3AYVA 3I3EA 3VD9A 1CYGA 4DB7A 1HNYA 1M5WA 2YCLA 3BLPX 1X1ZA 4BQ3A 1M53A 3CPUA 1OWQA 5JBFA 4IFKB 1TUXA 1H7NA 1V6XA 2H6RA 1WV2A 1T99A 3UXKA 4Y8FA 1M7JA 1JI2A 3EXTA 3OQ8A 1OD0A 3UJFA 4CD8A 2QVHA 3VZXA 3F2BA 4MZ8A 1DXLA 3IJ8A 3CO4A 4F2TA 2OOGA 4JEQA 1Q6OA 2XFRA 2VMFA 3GD3A 1MQQA 5I7GA 1V6YA 4ZSTA 3NXLA 2E6FA 1GW9A 1GVIA 3A3XA 2NQLA 2ZUVA 4M56A 3FK4A 3THQA 5HXMA 1KFEA 2GSJA 1W8GA 3WBXA 3WLJA 2ZRWA 4GJIA 4UFIA 2BZNA 4PBFA 4HMNA 4EQXA 3O6CA 2GR0A 1QRQA 3A4WA 4LYRA 1IXQA 2OEMA 5AC6A 4G7EB 3E2QA 4JTEA 2ZUUA 1FEBA 3LB0A 4ACZB 1QO5A 4ERAA 1PKYA 3AS1A 1KGUA 2NWRA 1TRIA 2DGAA 2Z6JA 1PTAA 1ME7A 3GVGA 4JNZA 3JUGA 1BF6A 3CUIA 4KEZA 3N15A 4Q4OA 5D04C 1VBGA 3BL3A 2DFAA 1A5KC 1E0UA 1FBAA 2Y6ZA 3IUHA 1RY8A 4IJBA 2UWFA 5HATA 5EMYA 2ISWA 3FYOA 5CZJA 1CI1A 3AHYA 1RY0A 2PB1A 5IHRA 1H63A 3IVUA 4NNBA 4ATLA 4P7OA 5CC7A 4XD3A 4P8VA 3LSCA 4EXAA 1S5VA 1GEHA 4C60A 1Q2SA 1C7TA 2DW7A 4C7DA 1CGTA 3MP5A 2HVNA 1C90A 4QGCA 1W9XA 1DIEA 1A0CA 2VZVA 1OJXA 3GE7A 3HBLA 3VD7A 3WQ4A 4D8LA 3SRKA 1Z69A 1KFWA 1UCWA 4NJIA 1DWIM 4IJRA 1Z42A 3VD5A 3OVQA 3TLQA 4ALDA 3FJLA 1QWKA 3QGVA 3IGUA 1R0MA 4B91A 1ISZA 2HS6A 2GQ8A 5D03A 2AQOA 3OPSA 3T81A 2HE5A 1LDCA 3NZ1A 5BXTA 3R0UA 4AFYA 4W7VA 4DM2A 1TV5A 5CSSA 2QUVA 4X0NA 1ONEA 2WMHA 5TR3A 3NQVA 1HFBA 1VEOA 3KWXA 1TMLA 4JOMA 2WP6A 3C0LA 3MI6A 2EBNA 4OUIA 4GWEA 2X8RA 4N02A 3I6EA 4C6PA 2YW4A 2B7QA 2QCNA 2Y7FA 1H7WA 3URBA 2A3LA 4J3WA 3RJXA 4OECA 3FDGA 2A7RA 4M82A 1ITXA 4H4PA 3S2NA 1RLCL 5FJUA 3TW9A 4L1XA 3BLDA 4QEEA 4IMFA 3CZKA 2WNNA 5LGZA 3UFYA 1R86A 2DPEA 4O1EA 3SI9A 5I79A 2VELA 3IVTA 3MKVA 2ODOA 2PDHA 3L2LA 4U3AA 3EWDA 3ONBA 3U9IA 4J1OA 1LOQA 3Q58A 1NU5A 4IM4A 4GACA 2DIEA 3BUVA 5E1QA 4O0QA 3BMVA 2AKMA 2GVLA 2ZTJA 1J79A 1E0VA 4M80A 5CJMA 3F5LA 4IIEA 1Q8JA 1L6YA 1NQ6A 1B0IA 2XIQA 4DWSA 3HF3A 2TRSA 3PNUA 1EJWC 1CEOA 1KXVA 5AC8A 4G5DA 5HUOA 2D73A 1CIUA 1GZ1A 5FIPA 1NFBA 1YXCA 3L5OA 1GQLA 2RFGA 3N4FA 2W27A 3IWPA 2UY2A 4BI5A 3WEOA 5LGXA 1U22A 3A4AA 2WLZA 2C16A 3F2CA 6REQA 2WCAA 5T91A 3TYAA 4IFRA 3TTSA 2AQVA 3WH6A 4CGTA 5HA7A 1FWNA 1N61C 2POZA 1QNQA 2DZXA 2FMNA 1AMKA 1ADDA 2BDQA 1BYCA 2VDGA 4XAZA 3QQ1A 3ID7A 4JIQA 2VEGA 1OFPA 3IANA 3MSYA 1ENUA 4EF9A 4DZ5A 4GO9A 3WELA 2BC1A 3UG5A 1E51A 3LHUA 4EX4A 3SGZA 1UZHA 1TTJA 3G22A 3L2MA 3NS1B 2HK0A 2XU2A 3NSMA 5H91A 1FO4A 3WIJA 1Q6GA 2WC3A 4B5VA 4AIOA 3QGKC 4ZCWA 3W7EA 3S47A 2CU0A 3GR4A 3BSHA 1CGUA 1QHOA 3GHUA 3TTEA 3RRAA 4DJDD 4E4FA 1DV7A 1QI2A 1EDQA 5HWMA 2ATSA 4LEFA 1THFD 1JIBA 3MZ2A 4B5UA 1VDVA 1CCWB 3SCOA 4GUFA 1Y8BA 2CZVA 5C0QA 2E1WA 1LQ0A 1XGZA 2PDKA 1FWBC 2GJNA 5JVLA 4U3CA 3EOOA 2FIQA 3GTIA 5M1TA 4H9UA 1XH1A 3FA4A 5FF2A 2H90A 2ZE3A 5LSMA 5LIWX 3QR1A 6CGTA 4GX8A 2JK6A 2HROA 3WBWA 5AECA 1DVJA 3PTKA 5C9XA 4DJFC 3PTQA 1OYAA 5T9BG 1KWGA 3XISA 1GVOA 3BJFA 4W84A 3TWBA 3MA8A 3B40A 4ICMA 1AK5A 3IVSA 3NSXA 5ABFB 3WZ0E 5JRBA 3N13A 1ZXIC 1XLEA 3NO3A 1H2JA 3M7SA 4FR1A 5C7HA 2VT0A 3CMFA 3KS6A 4PUMA 2X50A 3ZWTA 1EJSC 1EX1A 1KCLA 2FTPA 3QRHA 4HPGA 4LBUA 1X7FA 1G7VA 1XIIA 3PB2A 2I5QA 3DC8A 3BJSA 1VC4A 2O56A 2PDMA 1XBVA 4XB3A 3WQ6A 2WM1A 1XG4A 4WX2A 2DZUA 4RNJA 2QXWA 4FOKA 5CH9A 3F7JA 2OT0A 4MWAE 2WZIA 3CXBA 3V35A 4NHVA 5FJRA 1E4LA 3RGTA 2GQ9A 2PTDA 3E0IA 3GNPA 4ZXLA 3REQB 4NILA 3T1GA 1QOQA 1U83A 4F2UA 3OU8A 1OF6A 1XH2A 1Q6LA 3K8KA 5DEZA 3UERA 1YTEA 3V3WA 4JDRA 3VDBA 3R12A 4TV6A 4GJ1A 3H8AA 2W9MA 2ZA3A 2YGYA 4MWAD 2ATMA 3WDQA 4PMNA 3AZSA 1EP3A 1NFGA 3QLLA 5MF5A 3GXDA 2YCEA 2BP1A 4XWUA 1KM5A 2QS8A 3LHZA 4DO6A 1UW9A 3APGA 1SZGA 1QHZA 1DTUA 1HT6A 3UZWA 1BGGA 4AAJA 3SUWA 1XV8A 2ZICA 5AVNA 2YA2A 2J8FA 2X0YA 4V28A 3FCPA 3L4UA 1UP2A 3C2RA 2IXUA 1TWWA 1XDLA 1D3GA 4ERIA 4JZ5A 3WH9A 5KEZA 1A50A 5FJTA 3GG7A 2VFEA 1CGWA 3W6MA 3WEZA 4LS1A 1STZA 5I0DA 4IL2A 1IF2A 1OM0A 4BZYA 3DGZA 1PIFA 2Z1KA 2DIKA 4UTTC 2VEFA 3FYPA 3O2LA 1VBUA 3B8VA 1PX3A 4I6VA 6TAAA 3U57A 5I5RA 2O55A 2VC6A 3UZXA 3MV01 1UIOA 4MB3A 3QLDA 5D8ZA 4NX0A 1OX4B 4CUCA 2BGQA 4LYPA 1WDWA 1ZBCA 3DK9A 3N04A 2QJMA 1W9BM 4YWIA 1SZNA 2Y5EA 4DYJA 4DM1A 4HA1A 8XIAA 3K2GA 1XYCA 3DFHA 4JTQA 1PPIA 5DN1A 3L66A 1OG6A 1DWAM 4JTRA 1QO2A 1YADA 3W87A 3PBMA 4EAMA 4OT7A 2C1GA 5DBTA 1X97A 4E0CA 4JFTA 4BWLA 2XN1A 2PCEA 1XI3A 3W2MA 2HV5A 4H04A 2YFOA 3EXRA 3CIVA 1AA1B 2VX6A 1K6WA 3W7MA 5AN7A 1B30A 2OQHA 1SW7A 5FL1A 4Z0JA 4IMCA 3VM7A 1G0CA 4NAEB 4FNQA 3GU9A 4O28A 2IS7A 2ZXBA 2OSWA 4KF1A 4TV5A 1QI0A 1J4EA 1MZRA 1AJZA 4K2SA 4G6CA 2NLIA 3ZT5A 3U48A 2DV0A 2FFIA 3CMGA 1I2PA 1TJ2A 3T7VA 4NRSA 3YPIA 1XLHA 4C6BA 1GQIA 3K1GA 2IQ0A 2XDFA 3W1MA 4C6IA 4F9DA 3WL1A 4BEQA 4C6JA 2X0HA 4FXSA 4JN7A 1RPKA 1ZBVA 1IXOA 3C8NA 4Y9OA 1SO4A 3EB4A 1ONXA 1BYAA 3AHTA 4BS0A 1B54A 1S2VA 2V3BA 4JQ4A 4I7UA 2YCLB 1T7LA 3W7HA 2V69A 4OV4A 2DVUA 4CQAA 1CXIA 1HGWA 2NT0A 3W02A 2B7OA 1BKHA 1WKFA 3HPAA 2NW0A 1EIXA 1XG3A 1ISVA 3B0VC 1OADA 1N60C 4BFAA 3L65A 3QW4B 1F5ZA 3K8MA 3TN4A 1KV5A 2QAPA 1JEHA 3KBMA 2UY5A 1QHPA 2R91A 3GFYA 3ALGA 2QPUA 4YHEA 2CESA 4LAOA 2ZBTA 2BSLA 3CEUA 4Z2LA 3AHXA 3OO2A 5AYIA 1S39A 3M0ZA 1GYLA 1IEXA 3PZGA 4EMIA 4U33A 1S3TC 1CGXA 1TVNA 2O4MA 3OHMB 2POTA 2BFGA 3AS2A 1PB0A 1YTKA 2J3NA 4HHLA 1K77A 4JHZA 3AAMA 4LUJA 1Z3NA 4TO8A 2VGFA 3QMRA 1KRCC 1PTGA 1M04A 1I60A 1S38A 2QKFA 3EDEA 3KVJA 4G8TA 2Y62A 5EU9A 5I77A 4DBDA 1O1HA 3W1AA 4WXZA 1R9ZA 3U2EA 4TOQA 4RDZA 4H8VA 5AC4A 3BCJA 3KP0A 4AZGA 3BAIA 3V0UA 3DCPA 4M51A 1XLLA 5HINA 2RH9A 1UBSA 1ZJAA 4UQCA 2FZ9A 1HN1A 1W5PA 1A3XA 2XTKA 2FGZA 4HPJA 3DERA 1RBLA 1TR1A 1QNRA 4PMVA 4FOJA 2W79A 5EA9A 2H8XA 2BOGX 4ZEPA 1NOWA 3AIUA 1OX5A 4OIFA 3ZM8A 4FB7A 1GOQA 2VCBA 1LVLA 4I5XA 1KW1A 1ZPTA 1QCWA 4GE8A 3N6QA 4RE3A 1O6IA 1QW9A 1EEXA 2J75A 3RF9A 2HXTA 3M46A 3S1GA 4JCLA 3ARTA 3HPXA 3MSDA 1PYFA 1GZGA 2ZZCA 4TVDA 3GH7A 2F84A 4FOUA 4HTBA 1FFVC 1KTNA 1E3XA 1GVFA 1LQAA 2VKZG 4NJKA 5EMJA 5BMWA 3M9YA 1AVAA 4QDWA 4NZ3A 3TWAA 1XH0A 1G4TA 2JQXA 4ZQRA 5EYWA 3GTXA 3DIPA 1IV8A 1P6CA 4BF7A 4DXVA 2FJKA 5A69A 3N18A 1QI4A 5A8NA 4FLRA 3EA1A 1M7PA 3NIYA 1CENA 2WLYA 3HB9A 3P60A 3HGRA 4NX5A 4X9YA 2VR5A 3NAVA 3VX0A 1V7YA 3EDFA 2OWCA 1VBRA 2F61A 3VOIA 4O8AA 4RE4A 4OBRA 2I14A 1B9BA 2WJDA 3PNZA 4A8LA 1IEWA 2VC5A 1EFZA 2ABAA 1EO5A 1O5XA 1W1IE 1DHPA 3PTDA 2D3LA 1KC7A 2WMKA 2Q71A 2VRKA 5T26A 1ONRA 1ICSA 4WHBA 1L6SA 4W9TA 5D9OA 3SCPA 2XFYA 3C2YA 3BOLA 2OPJA 5ABHA 3GQYA 2PEVA 4MKNA 2HE8A 3DH9A 1IE7C 4ZFCA 4X22A 1W3TA 5JQ9A 5I3IA 5HWNA 1TA3B 1N8IA 1BF2A 1BLIA 4EMWA 3C56A 4QE5A 4I8YA 4Q4RA 3SN4A 4AW7A 1A4MA 2D0FA 4GHRA 3W81A 1IR2A 1XLJA 1FQ0A 2VGIA 5C9RA 4XZLX 2BXZA 1TPFA 1D3CA 2V3EA 4PL1A 1RP8A 1ZKQA 3SQPA 3RCMA 3VE7A 3W7OA 2P88A 2V2HA 5IM51 3FHAA 1OFDA 1MW3A 3AZRA 2BVYA 1O60A 4J9JA 4JFWA 1H09A 5KSWA 1Z89A 3TROA 3M47A 2ZRXA 4F0MA 3HQOA 1CTNA 4NZ1A 3FY1A 1ALDA 2Y61A 1W9DM 6A3HA 2WVVB 1KGWA 2WSKA 1LJYA 4GKLA 3UT0A 5C54A 2CDUA 4C6KA 4KGLA 1UIPA 3L2IA 4BV6A 3O9NA 1P0EA 2WQDA 1W91A 1WAUA 3TLLA 1XW8A 1MMFA 1V0LA 2GDQA 4Q4KA 1FCQA 2DZPA 2Y0FA 2CIPA 5HANA 3CU2A 4XG1A 1W17A 5C9WA 3ITGA 4GRTA 1SPQA 1W31A 2J9YA 1IR1A 2CLIA 5HNNA 4ZB0A 3WBEA 3BO9A 2EPHA 3B8SA 3K4WA 4MB4A 3DGHA 2OG9A 4B15A 3L4TA 2PP0A 3N73A 1EB3A 2WP5A 2QULA 3BQ6A 3VO0A 4AZ7A 1EQPA 4KGJA 3OGSA 3W9ZA 4JTDA 2EQ9A 3B05A 1BWCA 2V5LA 4HNUA 3TDFA 4F40A 3EMQA 4GYFA 1XLBA 4IWWA 4HNNA 1XQLA 1VAHA 1TSIA 4PB3A 4RPPA 4KQNA 3OZPA 2FZNA 1KBJA 2QCMA 1L2QA 2XH0A 1QATA 1Z6KA 2GQAA 1XLDA 4KRUA 1C8QA 1JULA 3N11A 1RJQA 1WKYA 4J27A 2Q8ZA 1GRGA 1KCXA 3HPZA 2OQYA 1ZUAX 2YYUA 4D6DA 2D2OA 1NH6A 3FOKA 3PWIA 3LZ5A 1KFJA 1QASA 1RCXB 2WKJA 5CCZA 5A2AA 1ZX9A 3PZNA 4HNLA 3LX9A 3G2GA 1FWJC 1WBHA 3LI0A 4JKMA 3AXHA 4LVFA 4Y7EA 2W0UA 4EMJA 3G1SA 1UWAA 4S2BA 3HN3A 3UG3A 4IQDA 1SU5A 1TMQA 4N4PA 1TJPA 1ZFJA 3ANYA 3VIIA 3WNOA 5CLWA 2ZVIA 3H2EA 4W8LA 1UKOA 5F4WA 2E77A 4MLRA 4PUUA 2WSYA 2Y7GA 4QISA 4JS3A 2DT3A 4YN5A 3BURA 5EMUA 4GUIA 3QBUA 3GVRA 1X8FA 2PDLA 5JBDA 1LLWA 4ZE4A 3MUAA 5G1YA 1DWFM 5HMFA 1I0DA 2CWXA 3BW2A 3ALFA 3GD6A 5LHEA 4GBDA 4K3ZA 5EB8A 5AKQA 3C3NA 3TX9A 3GUWA 1W1PA 4S39A 3DDMA 3CL8A 4GYJA 1C91A 1LWJA 3NQ6A 5DANA 2J6XA 1NWUA 2DEPA 6ENLA 4KETA 4KIEA 4N2YA 4GXWA 1WQ5A 3KRSA 3SAZA 3UXAA 3VGEA 1I2RA 1GG1A 1TUFA 1U5JA 2GVJA 5M03A 3FA3A 2H9AA 2QCHA 3EDDA 2QAEA 3GH5A 2ZWZA 3R5EA 4QAWA 3VCRA 3RM4A 1V79A 3IV3A 3O63A 3DBNA 1CB7B 1ZDLA 1TV2A 3L0KA 4PYSA 4A05A 3GR7A 4MUPA 1LUCA 4JTCA 1O5QA 4UNLA 1TV8A 3W1QA 1W1YA 3ABOA 3HJEA 5HWJA 1CNVA 3TA6A 4PB5A 5FJOA 4AEFA 1YX1A 1RH9A 4L5ZA 1E71M 2DUXA 3FGCA 1UR9A 2P1FA 2Q02A 3UR5A 1UWTA 4HQVA 5FF0A 1K9DA 1Q13A 1RQEA 3TW7A 1ME9A 3PF3A 1ZGDA 4HZ8A 2Z28A 4QLKA 3QEZA 5FJIA 1UD4A 3LPPA 5IBXA 3C0QA 1US2A 2XH4A 4H4TA 3AWOA 3TZNA 1UP0A 3SJNA 2XVNA 3S5ZA 1UD3A 1FECA 4CN6A 5F2IA 5TAOA 1HJSA 1AJ2A 4MJ2A 1Z7AA 1K8XA 4GZIA 4ZOBA 1OB0A 4WJ8A 3GG0A 4PCNA 1GONA 2FVKA 4ROQA 4UTFA 1ITCA 2YDAA 1VH7A 5KINA 4FSAA 4ADTA 1VIWA 4GPNA 2WHMA 3GO2A 5GRTA 3TC6A 4AY8A 3AN1A 2E1DA 3DENA 1XRFA 1WXZA 4AMAA 3DUGA 1SSGA 3W53A 4JIPA 2QF8A 2OR2A 3VKKA 4J56A 4HD5A 1EA0A 2WB5A 1QT1A 2PE4A 3V36A 3MCMA 2JF7A 2KZHA 2E5CA 4NXKA 3UXDA 3NDOA 4WOQA 3W7LA 3PWAA 2JEQA 1E3ZA 1W1ZA 1LCOA 1TG7A 1IXPA 2IPGA 4EWND 2A4AA 2Y88A 1PKLA 3GR8A 2OX1A 1BXBA 4IISA 3W83A 3M6YA 3EXSA 1TPC1 4BCEA 3L5MA 1RBOB 4OZOA 1BZLA 1NSJA 2G97A 2BVDA 2DIJA 3EMCA 5CPTA 3CTLA 3UCDA 3THAA 2GJRA 2V2CA 4B3ZA 2ZXDA 1AD4A 2O4QA 3SO7A 3S5SA 3NUKA 2V3FA 4X60A 2Y5SA 2E6AA 1GOMA 1BWLA 4ZE5A 1P0KA 3TCEA 1UD6A 2UBPC 3TTQA 4R9XA 4JTHA 2W3RA 4B5NA 3EX1A 4P8UA 4XISA 1KB3A 3OQEA 4W89A 3THDA 4QNWA 1OQFA 1HL9A 2BV9A 1HW6A 3IS4A 4Q7IA 3NYDA 3KDOA 3H23A 4U5IA 4CCZA 4UQBA 3UXLA 1OFEA 2IKJA 3GNXA 4M19A 2W4XA 4KS0A 4DAIA 3O07A 2VYOA 1PZ3A 1RJRA 4LCRA 3RDKA 3D47A 1HJWA 2V82A 3HRDC 1PZ1A 5MHBA 4MYAA 3I7SA 4J3VA 4DF1A 2GH5A 1DEDA 1FX6A 1XSKA 3S8HA 5BROA 4MWAB 4LU0A 4TTUA 3H4KA 2WSPA 4GC3A 4IX0A 3W27A 4GKTA 5D9NA 1KCZA 4P7QA 4FP1A 4DUWA 4A8IA 1UR4A 3KWSA 2BBFA 4MGGA 3W25A 3CZJA 1H61A 2B31A 1W3HA 2ABBA 2R1NA 3PZIA 4AX6A 3ZJ7A 1XXXA 1G9HA 2QF7A 1ZK7A 2JFEX 1UR8A 4AWEA 4DRSA 3RILA 1DBTA 1BEUA 2GGHA 2PA6A 2I57A 3VK5A 1FWGC 1MO0A 3GXPA 3RLGA 3OZOA 4IOTA 1JD7A 4GNVA 1GVEA 1FWAC 1MRAA 4J3XA 1KWKA 3I65A 4P7LA 3G1AA 1JGMA 1PX4A 3FX4A 1MXGA 1EOMA 1SFJA 3NZPA 3QZAA 3QN3A 3V18A 4C90A 1VF8A 5C9UA 3W0KA 1SB3B 4D6FA 5AYXA 4IGNA 3VKAA 5AHIA 1BD0A 3AYTA 5CC5A 3WF4A 4AVOA 2PLKA 2WBKA 5LHFA 2VDIA 4K7YA 3GS6A 3LK6A 4QJ3B 2PUZA 1FWWA 2RJGA 1BVWA 3NQDA 3MVTA 3EGJA 3NWRA 2BOEX 3W75A 4IQLA 1A5CA 3M16A 4QQ3A 3VYLA 4X9SA 7XIMA 4L4LA 2X8CA 4GUHA 1EGVA 3WK1A 3E96A 2WJEA 3SCNA 3BLIA 4ROPA 5AZ0A 5U4NA 1C92A 2NWSA 1FP8A 1ESWA 4GUGA 2OMAA 4ICCX 1AZ1A 3FJ6A 1EDGA 1GK8A 4EVZA 1UD5A 3FG2P 3O1NA 1G5AA 1QR7A 1V0MA 1XIMA 2F5ZA 5M17A 3LOTA 2ICSA 3EOEA 3RO8A 1X1OA 2E5BA 2NPXA 1A3WA 4HCHA 3WBAA 1ISYA 1KBKA 2QDDA 2VXNA 3WF1A 1OINA 2VX4A 3SRHA 3V0TA 4EKJA 1B3OA 3NNTA 2YL9A 3F1QA 2DVXA 2D2JA 4PTMA 3SQSA 3TQ0A 3CLWA 2YL6A 4WXYA 2YVGA 4IG2B 3ZJKA 4XBJA 2PP1A 5HNRA 5CSYA 1AW2A 1G67A 2QIIA 5U7SA 3RNDA 2XVGA 1OZMA 4ECLA 1QOXA 4GJJA 4CD5A 3VOCA 2IQTA 3EB3A 1ITQA 3FFSA 3U0HA 3T0DA 3LGDA 2RDWA 4DPQA 1E1FA 3ZSTA 2F38A 5DT7A 2QCLA 2VTFA 1UQZA 4ILSA 3XINA 1EDTA 2BTMA 3N34A 4S3BA 4US5A 3N29A 1WNOA 1WKDA 1CLVA 4TMBA 5D2XA 1K03A 3GAKA 4QSHA 1E73M 4IPJA 1ZQ5A 1VCFA 4WKHA 2FVLA 4ZB5A 1QNVA 1VQTA 3UXIA 4AWTA 5I23A 2QR6A 4HSOA 4ZGYA 3CM4A 4D8ZA 2E8ZA 2E40A 3P62A 1E0WA 1JUKA 3ZJ8A 1Q7MA 2MANA 1XM3A 4XAGA 3IRSA 3M64A 3TQPA 3ITXA 3T2QA 1QPRA 1QMLA 2WWDA 3TK7A 2HBVA 1GETA 4KRZA 1V02A 3PANA 3E0VA 1FFUC 4XZHA 1TYPA 1EBGA 4UCGA 3EAUA 3ATYA 4XBSA 3BK0A 5H8MA 3AOFA 4M1RA 3VCNA 3NYZA 1X8CA 1OVDA 3QPEA 4DO5A 3DK8A 5K3VA 4PEEA 3ARUA 3O05A 1MQPA 3HZ3A 4AU0A 3BAWA 3R79A 3MB9A 2C79A 1GESA 4DWSC 4AZHA 3AIWA 4Q32A 2X7VA 1OJTA 5BXRA 2NX3A 4JN6A 3L4YA 5I00A 4CVUA 2Y7DA 1Q4WA 1OZQA 1S7MA 1D7YA 4KKXA 1MFUA 4K8HA 4H2HA 1C8VA 2RGMA 4QG9A 4BQ4A 2PDCA 4GO8A 4QSFA 1ZJBA 2WWCA 5BNKA 1H1ZA 5BZAA 1W5NA 2WPCA 3PZMA 4PSRA 2PDJA 4ADUA 1ZENA 1Q7QA 2NVCA 4KCWA 1KO0A 2PURA 4Q8QA 3OVPA 2Z26A 4FIQA 3HW2A 3CXOA 3EDKA 3OBKA 4E4PA 2WYSA 2ZZ6A 3L0GA 2BVTA 2VENA 3IUIA 1SFSA 3A4JA 3ARQA 1RD6A 3WBYA 2R1MA 6XIAA 4RJEA 2BNJA 2ALRA 2EAWA 3MDUA 3R07C 5MKGA 4HCDA 4N42A 2OFJA 3DG6A 4W93A 5FACA 3URHA 1FWTA 2I17A 1C9WA 3G1FA 4A8NA 2GWNA 3N2BA 3VUPA 2IMRA 1G4SA 4K8DA 3PHAA 4FNUA 3WJWA 3UGVA 3P6LA 1GOXA 2OVLA 3W28A 4Q4QA 2VEMA 2X99A 2IPWA 4DN1A 4Q8TA 1J2BA 5E9AA 3C2OA 4LC8A 1Q66A 5I3JA 1ZMDA 1W1A1 3TN3A 3GZ3A 5DY3A 5IFTA 5IHSA 5GJNA 5AVHA 3W4RA 3BLKA 5LXXA 5D32A 4O54A 4JR5A 1GEQA 1H7XA 3LTPA 1GG0A 1L8PA 3IJLA 1SVDA 2V6OA 1VQZA 2BGNE 3C86A 4O17A 3VOJA 3EKZA 4EM4A 1U1UA 3GTFA 2C1IA 3N2MA 2E67A 1Q85A 3RM9A 3GVQA 3SDOA 3KM8A 1I2NA 7TIMA 1OIFA 5C7VA 3W7RA 4DZIA 2X7WA 3TYDA 3WH5A 5JMUA 3NEHA 4MM1A 2ZX7A 1FWFC 4O52A 3H24A 2RABA 1TVPA 4PBEA 3DXIA 4X61A 4Y9PA 1O68A 3ZLFA 4LB4A 3WDRA 4YS1A 3R8RA 5G1MA 5JIWA 1XLGA 4AISA 2QJGA 1TB3A 3GC2A 2C0AA 1R3VA 3R8GA 1KBLA 3UJSA 4I7WA 1J01A 1FP9A 1GTHA 1QNSA 3GU1A 3WMLA 3MI3A 5TIMA 1JF6A 4N6EA 2RJHA 3K4DA 3LCGA 2VEPA 1XRVA 3N2XA 3NVTA 1VLIA 1WOAA 4XTIA 5BXPA 4TX9A 1ZCOA 3BE7A 2PDGA 5C6MA 3Q94A 1R7AA 4DYEA 4ENLA 1HL8A 1EKOA 4DBEA 4E5TA 1HTIA 3T2OA 4H4QA 1Q6EA 5AOUA 3V4BA 2Z29A 1QPOA 2QJIA 3ZO9A 4Q33A 1MWOA 4Q22A 3GVVA 1QOPA 1XRTA 3FVDA 2HPMA 2D0GA 3FGCB 1R5YA 1YRRA 4W85A 2YB1A 1ZJIA 4WKAA 3WQDA 4HNOA 4Z1YA 5A6MA 2REQA 1EIBA 2B7PA 2QCFA 1TCDA 5CBBA 4EM3A 2VFIA 1T41A 4RDYA 2PWGA 3KFTA 1EA9C 1SZEA 5C70A 3MJYA 1ZS2A 3JU2A 2BG5A 4H00A 1FEAA 1YLVA 4AZ6A 4J2PA 4WSKA 4AEEA 1KFBA 1JYVA 4O19A 4JIIX 4UC5A 1VFOA 3L67A 1TTPA 1TX0A 4UR8A 4JHMA 2WOQA 4HU0A 4ZODA 2FMOA 3GYEA 4C6MA 5FI8A 1XIDA 4G1NA 3B9OA 1PWMA 3M0IA 4GFSA 3BW4A 5CPLA 1FWEC 3BG5A 4XX6A 1XC6A 1UC5A 4GRSA 2W3ZA 1OCNA 2ZA1A 3BV7A 4KMQA 4OVXA 4R3UA 5IDZA 1UH3A 4I9JA 3CUXA 4Y8EA 1V3HA 4I8DA 1VFTA 2PWDA 2Y5JA 1OIMA 1XLKA 4I9AA 3A7AA 1ZCCA 4DY1A 3CC1A 3WJZA 2CZFA 2PBOA 3UETA 1Z44A 1ML1A 1MW1A 4DI9A 1EJRC 2VP8A 2D23A 4W5UA 3O6AA 4S38A 4XV0A 2FH8A 3AWNA 2BX7A 3NQGA 3CTTA 4JTGA 2P76A 5CJ5A 2J62A 4RPQA 2CFFA 3GDRA 4WSJA 3RR1A 1LROA 4R85A 1BYBA 3SIMA 2QUUA 2P10A 4PA8A 2F6KA 4C6DA 2PU1A 3HV8A 3CV6A 4AX7A 2QCDA 3WQPA 3WFZA 3HU7A 3S42A 4NRRA 4AXNA 3V1PA 1H41A 2FJUB 4JQAA 3M0KA 3W7KA 3S6TA 5B80A 4XTDA 3B8TA 1F6KA 2XFFA 4NNAA 1EWDA 2W92A 5AB3A 3TONA 2WPEA 3THUA 3DOPA 3PG6A 3D6NA 4IH3A 2VVNA 3LGGA 1DIDA 2VFHA 5CPMA 4S2CA 3P7YA 1DJNA 4LSBA 4XD6A 2Z1VA 1E5JA 4ZL1A 2G3FA 2X1RA 2PGFA 4X0VA 3G3DA 4QEHA 2XIOA 3VDGA 1J93A 5CGTA 1VCGA 3ECQA 1N2VA 3QZ6A 5FF3A 1AQMA 1FHUA 3T55A 3QR3A 4ZVJA 4QAIA 5LA0A 2SFPA 1DJGA 3KZPA 1FHDA 3FJ4A 4HPXA 1DYSA 2QUNA 3DEQA 3Q2DA 1XWYA 4IP7A 3NGJA 2CXGA 4BI7A 4WJEA 5C2CA 3LM3A 1JCNA 3M41A 4OQVA 1JL8A 2FZDA 1MW2A 4AH7A 2Y85A 3GLCA 3L0NA 3R13A 4LGXA 1H60A 1GVYA 2A3AA 3FLUA 5FAJA 4QRNA 1BFNA 3CJPA 3DK4A 1HVQA 3R0DA 5AHFA 1PVNA 4TX6A 1Y5XA 3LY0A 2O9RA 2DT0A 1KRMA 1WZLA 3P8IA 4GNKB 1EXPA 1C93A 4LALA 3U5UA 1NWTA 3QZEA 4MOZA 2WHKA 1RBAA 3DYOA 4QROA 3URNA 4PUKA 4HTYA 3MSGA 5D2TA 2Y24A 1LG1A 1YQZA 3SURA 4H7VA 4PMXA 4WF7A 3SM0A 4HGXA 2YA0A 2WZMA 3MU7A 4LS0A 4AG0A 3UR2A 4MAZA 1R3RA 4CNUA 1UA3A 1XDIA 3TZFA 1JRBA 1ZB5A 3CPRA 2PTYA 3LTSA 4R27A 4G56A 3CV7A 2UY4A 2ZZ1A 3LERA 4PCSA 2Q6ZA 2Y70A 1OEPA 3K13A 5DQPA 1GVSA 2CZDA 3ES8A 3HGOA 4B2DD 4BK9A 3FSUA 3SCSA 3OBAA 1JUBA 1XGEA 5GPRA 3R25A 2XSBA 2NLYA 5CSUA 1V03A 1WCGA 2GUBA 5DBUA 3AM9A 2XM1A 1H49A 3W7PA 3HIJA 4DUOA 5FESA 3TR9A 3E2VA 3UPMA 1XDMA 4UMBA 3B9NA 2WQPA 3AQUA 3WJSA 2OZ8A 3DFYA 2A1YA 3KOWA 2C14A 1SQ7A 4A21A 5BWAA 2YZ5A 3VFCA 3MO4A 3VMNA 1J0ZA 1RVGA 4PMQA 2GYIA 3KHDA 1SGJA 1S5TA 1OC6A 3CUZA 4QE4A 3ABXA 3KBWA 4GD0A 2I5IA 1E9YB 4HA0A 3BG9A 2P53A 1B4EA 4MB5A 1WBJA 4GISA 2XIIA 4IQEA 5ECVA 4WLCA 4M1BA 3BZJA 1S2UA 1U33A 4PEKA 4HVXA 1M41A 5D2VA 3MY9A 4QP0A 1UASA 4KWUA 1BVZA 4UNIA 2GOUA 4O1FA 5FS7A 3PULA 2V3GA 5DCDA 3N4AA 1H7PA 3SSZA 3LLFA 2QZRA 2ACRA 2P50A 3OLDA 2WVUA 2CFYA 4HSNA 2OGYA 4CN4A 1Y5WA 1OYCA 4V27A 2XIBA 1IHIA 2JGYA 3SZ8A 3H2OA 4DO4A 1JXKA 2FFCA 2CITA 3VMOA 2ZOXA 3MYPA 4N0RA 5I6SA 3QH2A 1AW5A 4JD4A 5H6HA 2J13A 4GMEA 1GV4A 4AY1A 1LL4A 1RXOB 1YQ2A 2Y2WA 4W8BA 4Z17A 3BGJA 2QIWA 1YBQB 5LIYX 3S2MA 4O53A 1VRDA 1G4EA 4A3HA 3U4FA 4TTGA 4EQWA 1R8LA 3KLKA 3R1ZA 4AZIA 1E6RA 2ZX6A 1T3QC 3KTXA 1HGYA 2HISA 2DSWA 1POKA 3RPMA 3NQCA 1DHKA 2OODA 2OZ0A 5A94A 3A9IA 3TJ4A 1EZ2A 3WLNA 3HQPA 2ZA2A 1ADSA 3BLEA 2CYGA 5LIUX 4S3CA 3C8FA 4GI4A 3UR8A 3PZOA 1QTWA 1JVNA 3LMZA 1K1DA 4O1BA 3T0AA 1XSJA 4Q8NA 4ZMGA 1UOZA 2O9PA 3CGBA 2ZUWA 2D2HA 1Q6QA 4O0KA 4E3TA 1AW1A 5T9CE 1TPWA 2ZZBA 3NJ3A 3L5LA 4YL2A 3RFAA 1RP9A 1JFXA 3CV2A 2JGQA 4XK2A 4ZOHB 4U10A 4NUWA 1N82A 3T09A 3RYSA 2PGEA 5FJPA 5KITA 4CQCA 5EFFA 4GCXA 4AC1X 5MKGB 4NU7A 4E38A 4O57A 3KCLA 4ADSA 2CLEA 3B9DA 5HR7A 3UQNA 3TFXA 2YW3A 1BQGA 4K39A 4O16A 3E49A 4L61A 3SR6B 1S5MA 1L2UA 4M6UA 4H9ZA 3ZVHA 1N5XA 2KAUC 4EANA 3N17A 1GHSA 2C3ZA 3OW1A 1GKRA 4UR9A 1H0IA 1NHSA 4A22A 2PS2A 4NZJA 1G7UA 1XCFA 1ZAJA 1BXCA 5LA1A 5C2GA 4JNYA 4HJFA 3OODA 3WNNA 3VOGA 2BB0A 4LB3A 3ZIZA 3AALA 3USBA 3I10A 3GNRA 2YL8A 4YVVA 3R0KA 5IDIA 2QGYA 3IJQA 4MADA 4BF5A 5EKYA 3PSWA 1PHWA 4HK7A 2IQDA 3VC6A 4UWMA 3A5VA 4EWJA 1P4CA 1PWLA 1JPKA 2X40A 4XKMA 2YX0A 4GH1A 4EPBC 4IICA 1YEYA 1OSEA 5I03A 1DL3A 2GQ3A 4LCQA 2PD5A 1S3HA 2W91A 3GG1A 3AMKA 4MIMA 4BR1A 1QBBA 3H53A 5B7ZA 2JEPA 4J4KA 1VFHA 4E8CA 4XZNX 3QFEA 4JDBA 2ISVA 3CMJA 1V08A 2V67A 1G4PA 5D4YA 5EY5A 3ZQ9A 3P0XA 1OG0A 1VD6A 4PSPA 3E12A 4W7UA 4PB4A 1NELA 3ANUA 2GJXA 1YE4A 1PCWA 4M6PA 4DNHA 1X7IA 3H26A 2AOSA 3GFZA 2O92A 5D05A 4H4UA 1XUZA 4NJGA 2QCGA 1HP5A 5T8GA 4ATWA 2EJAA 3M0LA 4ZZ9A 1TPDA 2WOVA 1J0KA 1R3SA 1CLXA 2CHRA 5ABFA 3EZ4A 3KRBA 3CQKA 3A7UA 3UY7A 3WENA 1Q1WA 1OFOA 1PXGA 4B5XA 2PWUA 2ZRYA 3Q37A 1F7BA 1TPUA 5AYBA 2REQB 4KPLA 5DLCA 2DZAA 1Z48A 3G5EA 3WQCA 5G1TA 3NPWA 3MV11 3E74A 2C13A 2NXHA 4YCPA 3RX2A 1NDAA 2ZFAA 3NXFA 3TYUA 3I7RA 2YXOA 5EBKA 4LAMA 4PFMA 1OK4A 2PI6A 2C3DA 3DKLA 4C6LA 1A47A 3LI1A 1NOFA 2WSRA 3KBSA 4KEVA 3REQA 2QPSA 4MB1A 2O9TA 2QAFA 4O18A 2XINA 5LYRA 1UP3A 3R8HA 4UFHA 3SCTA 3B8UA 2CLMA 4ZA0A 4GFIA 4LAUA 4H2CA 1L8NA 2CETA 3B3DA 2Q09A 3C5QA 3NM3A 1SO5A 4IUGA 4PUEA 3MO7A 4UTLA 1K8ZA 4HP5A 4LF2A 2A85A 1EYEA 3VINA 3ARRA 1W37A 4FF7A 3DG7A 3CQIA 5EMMA 5A3HA 3LSBA 1HKJA 4XSMA 4AWUA 4LY4A 3IGHX 3LM7A 1EPXA 5BOEA 4LC6A 2CLLA 2R9ZA 4RDWA 1A53A 5LIKX 1PIIA 3H7UA 3M5VA 1MUCA 1CPUA 3CQHA 4DJFD 3BC9A 1C8YA 4DUVA 2GJLA 3CB3A 3BLOA 4JGDA 1PE1A 4UIOA 4RKAA 1NPXA 4W7WA 3VNYA 2HRWA 3UZYA 1AD1A 3TIMA 3W1XA 1D7FA 3ARPA 4NKCA 2PWVA 4RZ4A 2GGIA 2JIWA 4D6GA 2G95A 1F07A 3BZGA 4B5WA 3IJDA 4HA4A 1XISA 4GA8A 5TQLA 2VGBA 1FKXA 1OX4A 4DELA 3B9EA 2R6OA 1KA9F 4DJEC 2TPRA 3SCWA 1LZOA 3W72A 3SIZA 1EJUC 3KLLA 5EMLA 3W29A 2X2YA 3TA9A 2OLHA 4O10A 1QNOA 1VEPA 2H3BA 5U25A 3UNDA 1FWHC 1ZU8A 3B4UA 3MYOA 1PYMA 2ADAA 5DRIA 3SY1A 4M8UA 4DLMA 2CLOA 4GQ0A 3LEPA 3K8LA 3FHQA 2QJHA 4IPPA 2DZVA 3FKRA 2B81A 2WMIB 3EA2A 3T0TA 2XZ7A 4QS5A 5FJJA 5E93A 1H51A 1XICA 2A3CA 3FEQA 2E5AA 8TIMA 3KDNA 4YTTA 3D5HA 2WPFA 4PMUA 1S2TA 3QHNA 3WN6A 4B90A 1JDAA 3PN8A 1J6OA 5JXQA 2ESCA 2OU4A 4XBKA 5D33A 1X38A 2ZC1A 3TYZA 1IZJA 3MJMA 3UBPC 1MOKA 1WAWA 5HMEA 1DJXA 2Z0IA 3EWBX 2NX9A 5A6LA 1LM1A 3IIVA 3ERPA 3IRDA 4DAFA 3PPFA 1R6WA 4POCA 2IKHA 2P3ZA 4IL0A 4LTSA 3M0HA 1SJCA 3A24A 4CLMA 3G18A 2J27A 1RM6B 5CZKA 4R7JA 2XPKA 3KW3A 3N9SA 1UQYA 1NHRA 1VS1A 1DTNA 4F0HA 3CWOX 3D3FA 3MMTA 1PDZA 3OHIA 2Y8VA 1KGXA 1VIZA 1OHLA 2E4TA 4QCEA 4DBSA 4XZIA 3W85A 3VDAA 3P5ZA 1TV4A 3TYCA 2WM0A 1WZAA 1ZL1A 5D37A 1WE5A 4M0XA 3LNPA 3GYCA 3O7UA 3O6DA 2RDUA 1DJQA 1V0KA 3H2MA 4ICNA 1WUFA 4UOJA 3M5YA 5F4SA 4HHHA 3QQWA 2P8BA 2V8ZA 3ZLGA 1CXFA 4DIAA 1GJUA 4GUJA 1DQXA 2GK1B 3W2JA 1I1WA 4Z08A 3G1YA 2Z2BA 4UOZA 3IACA 3UNTA 2ZRZA 3WO8A 3TAKA 3NDYA 3E0LA 3T8QA 4AB4A 3VIJA 5D2YA 1W5OA 2G37A 2GSEA 4WRHA 3VTRA 2X1TA 3GAYA 3DN5A 4HYRA 4MPKA 1B3ZA 4LBSA 1H11A 4UOQA 2YBTA 4JAWA 1G6CA 4A3RA 3W2UA 1R9YA 5E09A 2HPIA 1KLZA 1L0PA 4C1KA 3U2OA 3QFAA 1F6YA 4FPSA 2OCZA 3KHJA 4RR4A 4Z1DA 1NDZA 2ALDA 3QYQA 1XKYA 3A64A 4S3AA 3AU2A 2A79A 3W22A 4GH3A 3EX4A 1R3TA 4AIBA 4JXCA 3WDJA 2VR4A 1BG9A 1RALA 3KX6A 1VPQA 3NSNA 3ABRA 1KXHA 1XINA 2OZ3A 1LT8A 2BY3A 2Q01A 4GYKA 3TTYA 1GERA 3OG3A 2PRLA 3VM5A 4J3ZA 1W0MA 2FPTA 2HEJA 1EF2A 3D46A 3TXVA 4WGHA 3UZZA 3LBCA 1WPCA 1O66A 4DJFA 1LWHA 4LXFA 4WQ6A 2NUXA 2F2KA 2IKGA 3RM8A 1YXYA 4ERGA 2PGRA 4H8NA 2WZTA 1O12A 1BKSA 4IPIA 3LXAA 4D6HA 3QSTA 3UCCA 4MAVA 1CXKA 4OKDA 4EQRA 3LBMA 1T5AA 1W5MA 4F66A 4EPEC 1W9VA 2OO6A 4IPNB 1MO9A 3PPHA 4JY8A 3WMSA 2NUWA 1TJRA 2NQ5A 1EEPA 1I1XA 4O4WA 1XIBA 3ZVIA 2Y89A 4WY0A 1I9CB 2AGTA 5CQ1A 3HPSA 2EG7A 4GXMA 3O8AA 4HKPA 3C2FA 4H4SA 1EZWA 1WUEA 1VFUA 5E70A 4YPJA 4R9OA 4EXBA 1H3GA 3U6WA 4QTGA 1LL7A 3WLOA 3EX2A 3PFMA 5I3DA 3WLIA 5F2LA 3MWCA 1UMYA 3I6RA 2W0HA 5HPCA 1MQRA 2YA1A 5GJPA 4C6EA 3L23A 4WD0A 4LV9A 3VGBA 4XUYA 3EPMA 1B4KA 1S2AA 2HXUA 3GZAA 3QXBA 4W4QA 4JQ2A 1FIQB 3PUEA 3AFBA 1TZ9A 4RCXA 3GG8A 3DESA 3N2TA 3H7VA 1H6VA 2Y7EA 1A49A 3RLVA 5DMYA 5G2IA 1Y65A 4KFOA 4PH6A 3E1F1 4C5ZA 1R46A 1DKWA 3H22A 4TQTA 1H62A 3VKBA 4P2VA 4CCCA 4CQ8A 2R1KA 1GPWA 5CBIA 1U1HA 1Q65A 4JCMA 2QVNA 4NYYA 3O16A 3C3UA 5ENLA 1HKIA 1DJHA 2EHHA 2TSYA 3W7JA 3Q4DA 1R47A 1CBGA 2PF0A 2XM2A 5CBJA 4MJZA 5TF0A 4GZJA 2J8GA 4ZO9A 1TA3A 4ES4A 3BMWA 2X30A 1RPXA 4OGZA 4UTIA 4AEOA 7PTDA 5CPQA 4YTQA 2J4GA 2DUAA 4UTMA 1K9EA 1CX9A 2EXOA 3WLSA 2BXVA 4F3HA 2PLJA 3GNDA 4QITA 1EGMA 5BU6A 2INZA 2X2GA 3ZVHB 4QS6A 2E68A 1B1YA 4L9XA 1OFBA 3IGXA 3CWNA 2W54A 3OG2A 1P7TB 3LRMA 1SW3A 3H7RA 3VKDA 2WCGA 4LEQA 3WLLA 4H4WA 4DUXA 4JY9A 4UXDA 5FCZA 1VENA 3WJYA 5BRPA 2C19A 3VIMA 4H4XA 3A13A 3S6DA 3UF9A 4YVXA 5EFDA 3EX3A 4FX7A 1EOKA 3OVRA 5A8PA 1Q4NX 2WVVA 2VEIA 4HOXA 4GVGA 4QE1A 3EOUA 3T2PA 5LZLA 2VX7A 4PRTA 4GIEA 5FEXA 1KM2A 4C1LA 2YCJA 3JRKA 3G0XA 5HJXA 3ITVA 2OB3A 5L6UA 4H83A 4EXQA 3LU2A 3WD3A 3SUUA 2YB4A 4RXFA 1VYRA 5KZEA 2NQZA 3M43A 3L8KA 3BJTA 1TO3A 4Y9NA 3T05A 5GQBA 2DSZA 2HDJA 5A6KA 1KXQA 1V3IA 3M6DA 1C8XA 4MY1A 3NL3A 1XPYA 3DHUA 1P6BA 4KFNA 3RITA 1E6QM 1V3KA 2J7GA 3EWWA 4FEZA 4QJ4B 2GJXB 4DBWA 2JKAA 1HZYA 3N3TA 3W23A 1UG6A 3BPWA 1E15A 3KP1A 1YDOA 3GC4A 1MEIA 4F8XA 2NV9A 4N9CA 1J2WA 3HFYA 1E4IA 1BAGA 3HFTA 3CGEA 4UB9A 3ZR4A 3EAOA 2TODA 8CGTA 2CKSA 3DYPA 4JTIA 1TIWA 3EA3A 4EP8C 4UTJA 4QCFA 2ZZ2A 3GXFA 2PDIA 3WF0A 3NDZA 1V3JA 3LD5A 3II1A 5CJNA 4GBUA 3ES7A 1DE5A 5DFAA 3MTWA 4HNCA 3T4CA 4CNTA 1BSIA 2MNRA 2EPOA 5J8LA 1E4MM 4GC4A 4ZXOA 4C1NA 3UYIA 4K68A 2C15A 4WIWA 1OF8A 5CXPA 2ZIDA 4MNMA 5DY2A 2QDHA 3QY7A 1U1JA 2C6QA 3ZYZA 1MRQA 2ACUA 2NSXA 3D9XA 3U5YA 1NHQA 3W73A 1SR0A 2VHLA 3CO8A 3OIHA 3WYZA 2OSYA 3BSMA 1LYXA 5H8UA 2OKOA 1DWGM 4CNOA 3TEVA 2QQ6A 1Q6CA 1TV7A 2DH2A 4R33A 4C6FA 3EWUA 2HZGA 1WDDA 1TQJA 4UTUA 1A4LA 3MCOA 1HKVA 3GRTA 3CUJA 1W3NA 3WK0A 1QW8A 1XIHA 3R7MA 1FCVA 2CXEA 3VGHA 2Y1HA 1MZHA 1IZCA 1I0BA 1JYNA 1MI3A 1QU4A 4R53A 1KKRA 4NIRA 3NPVA 3WD0A 1F6PA 3L21A 2ZZ5A 4O50A 3KEHA 4HIBA 2E8YA 3W70A 1W1VA 4H7ZA 4BQ2A 4LUTA 2D0HA 2QGHA 3MP3A 3HGSA 1ZTVA 1FWDC 3P5YA 1XFBA 3I3DA 4GLEA 3WF3A 2E0PA 4JTFA 1V8EA 3IV8A 4MHBA 3VU2A 2DH3A 1WKEA 3S3GA 1GJWA 1JCTA 3LN3A 3A47A 4MFDA 2V5DA 3V5FA 4H6EA 2OO0A 2CEQA 1T96A 3K5XA 3LXCA 3HURA 1NF7A 5D2WA 1UJQA 1KKOA 1Z9AA 2X41A 1RCQA 2CBJA 3ME3A 2PZ0A 4K37A 4Q8OA 4MLJA 2VCCA 4I7VA 2E7FA 1HO1A 5M2FX 4FNSA 2VNCA 1GTEA 5L9FA 1H2IA 1DJYA 4YCOA 3SY5A 4S3KA 1WZMA 1FCUA 1P1MA 2QCCA 4HPNA 3U2CA 1XQKA 3R94A 1XLFA 5I2UA 3FDKA 2ZUNA 3HG5A 5IXEA 1R3WA 5EGRA 3NVDA 3QMSA 4J35A 3KUMA 3BG3A 2FDSA 3AIVA 4NEVA 4U2YA 1K4GA 5KVHA 4RUBA 3S83A 1WXJA 3S9IA 3P93A 4JTJA 2C1HA 2XH2A 1BG4A 4DJDA 2CW6A 3O6YX 3S5YA 1WA3A 4DXXA 3OJGA 1WZKA 4GGBA 2OYKA 3CUHA 3GSMA 3EEZA 5AC7A 2XGIA 3S0CA 3TE9A 3VIOA 2VRJA 1JCXA 2GGGA 2EQ7A 2FQIA 5REQB 5DXXA 1VZWA 3JW7A 1CT5A 2NXGA 4RLIA 1F76A 3QHMA 4GX9A 1DNCA 1NF0A 5HUPA 3MI2A 1M6IA 2NT1A 3FS2A 1PCKA 4KW2A 3NZGA 4Q8UA 4F0RA 1K4HA 3NL5A 1JNEA 4INFA 4GYPC 1PS9A 2FVMA 2C8NA 1S46A 1UZ4A 3GTNA 3LG3A 3RG6A 4Z0SA 3DFSA 3TJIA 1GEUA 4U31A 1W5QA 2A5HA 1V97A 2JK2A 1MXSA 1GREA 2F8QA 1IYXA 2AMGA 3VZZA 1EJXC 1IEIA 2J7HA 4Y96A 1QJWA 4JKKA 7CGTA 1LQ2A 3SFWA 3MUCA 2I16A 1JJKA 1LOSA 1ZBKA 3LUTA 4JTLA 1UUMA 4IIFA 5LNWA 1GHRA 4E8DA 1XS2A 3ZSSA 3VNZA 4OOUA 1ZMCA 3S5OA 2FHCA 2ZX5A 2WZEA 1OD8A 5DMMA 3CIXA 2CZEA 4CD7A 1A5BA 3BDKA 4WJXA 4M52A 1ICPA 1FWRA 3W6LA 3ZLHA 4H6KA 1UHVA 3LCHA 1QI3A 1YKWA 3TP4A 2PWFA 2WKGA 4NAFB 4M7TA 1RAKA 2NSOA 1GKQA 3P0WA 5HOSA 1D9EA 1KCKA 1JG9A 3STFA 5AHEA 3V5OA 3FEMA 4NY2A 1H1YA 2XH7A 1U2YA 3R58A 3E02A 4H50A 2X8GA 1TR9A 3AXKA 1B3YA 3B0PA 4MWAA 2TYSA 1TJ0A 4DHGA 1ZP3A 5FSEC 4J28A 3KVKA 2NQ9A 1PX8A 4H9YA 1KM6A 4Q8MA 2B0MA 3VGGA 1HJVA 4Q4SA 5FEZA 4E2BA 3COTA 4YWSA 1MEWA 1EUNA 5C9ZA 1PKNA 3L7RA 1NIUA 4GY7A 3R10A 3S9YA 3C2EA 4UQDA 2PZNA 4PMRA 1UWIA 1D8CA 3UVIA 3DC0A 4Z1AA 4D71A 4K8EA 1JDEA 3G0SA 1Q6RA 1AH3A 3L4XA 4EQSA 2HQAA 2DZTA 3NQFA 1PJ9A 1YTDA 1DXFA 1GOWA 1KRBC 4S3EA 3WQGA 1V6WA 3PSVA 2CWNA 4AWSA 3UR7A 1JZ4A 1L9WA 4HMCA 4KWVA 5CEWA 4V15A 1SUXA 2EPNA 3DX5A 4TXEA 4HSHA 5CPNA 2IUZA 3CBWA 3LCFA 4IIDA 3DG3A 4HPHA 2YCIX 4WY0B 3VD3A 3CIWA 3UESA 2PDQA 1MFVA 2HNEA 3ANVA 2J9XA 2W62A 3MUXA 3FSTA 1WP6A 3KOXA 4J3UA 3UY8A 1K6AA 3W37A 1NVMA 2PSNA 4X3ZA 1Z32X 3BAYA 1P0DA 3P81A 3O0FA 3J7HA 2ZZ3A 2WPBA 1P5BA 4DXKA 1CXLA 3LXBA 3WLMA 5JH2A 2NVDA 1REQB 3F4NA 4EK7A 3TV8A 3UZ5A 1FRBA 4KEMA 4AYSA 2NVAA 1VYPX 3EEGA 4U28A 3S2CA 1JRPA 2EG6A 2V30A 2HWGA 1P43A 1HQTA 3PFRA 1F8MA 3IIXA 1E0XA 2V0TA 5A8MA 1R3QA 1X39A 4B3KA 3NVZB 2HJPA 4UTWA 1FDZA 2B4GA 1S1RA 1K4QA 1RLDA 3LPFA 3BMXA 2YBUA 1DPMA 5DRCA 5CAHA 3QPZA 4IG2A 2E9BA 1FXPA 3Q45A 5BOFA 5IOBA 2XVLA 3QFBA 4H6RA 4L64A 4APNA 4ZO6A 3I68A 4PN2A 2GVGA 2IXVA 4LNYA 1TQXA 2ACQA 3QM3A 4MNLA 1UUQA 1KNWA 4XIMA 4DVOA 1MNZA 3HV9A 3K46A 2J79A 3EWZA 4S23A 7REQB 5H1WA 4XQ6A 4JFUA 2VDHA 3BGAA 5J5RA 4EPDC 4HMEA 1HKMA 4YTUA 3ZMRA 3RHGA 4YTSA 5LNVA 1ZY8A 2WPGA 1WDSA 1SZRA 2YLAA 4FX9A 5LIXX 2QMJA 3DYMA 3NFUA 1ZJHA 2RDTA 2WBAA 1EC7A 4DF0A 3G1DA 2W67A 2D1ZA 2EQDA 4Q7NA 4B3LA 3SSJA 1O4UA 1VKFA 2YXXA 3BANA 3RX4A 2PLCA 2PP3A 3GBDA 3W74A 2GJPA 3VE9A 3VNIA 1SM9A 2OYMA 4JTKA 4JTTA 1X2HA 2RAGA 4L9YA 2ZTKA 1GOKA 4UZUA 3DHFA 1UZDA 5A6JA 1EP1A 3B03A 2OJPA 5GJMA 4GI9A 2Z24A 2PDNA 2W3SA 1MXDA 1B3WA 2PWEA 2WNWA 1XLIA 4V33A 4P5UA 4ZOCA 1SJDA 3F4WA 3WUFA 2OGJA 3CYVA 1LF1A 3QV7A 3QKEA 2XWDA 4NVTA 1RR2A 2GGJA 4JYDA 4N9EA 1O1ZA 3AI0A 4WY0F 1XIFA 1YHTA 1QK0A 4ZQOA 3LLXA 4LVAA 3FIGA 3AUJA 2YKKA 3F5JA 2C3CA 1F3TA 2AGKA 4K7VA 1CDGA 5XINA 1SW0A 3GXNA 1J0HA 5HR6A 4GVIA 4CKQA 3SECA 3FAXA 4IIHA 3VAVA 4GZ7A 2GR3A 5GVJA 2Y4SA 3ZZ1A 1VYSX 5F1VA 5I3HA 3QTGA 4X2PA 1J12A 2FDMA 2BY0A 2DORA 2EKCA 4ZENA 3GXTA 2X42A 5FF7A 1TTQA 2WOIA 3SR7A 3APTA 1ZP4A 4BQ5A 1TCMA 3GRSA 4GXPA 3LXDA 2E9MA 4JIRA 4O15A 4JN8A 3W26A 2CHOA 4EACA 1J0JA 2Z2UA 4GNJA 3W86A 4KEUA 2YL5A 2F2HA 2QV4A 5FS9A 2O0TA 2BODX 2VD8A 2YLLA 4X63A 4XZ9A 3G8RA 3UJEA 1TYTA 3LLDA 1Q8AA 1KD0A 1S2WA 4HB7A 2I9EA 2J7EA 5B7YA 4REQA 3TU9A 1UWQA 2X1SA 1KFCA 1FH9A 1WDRA 4H4RA 1I75A 1SR9A 4E2OA 2AKZA 1XX1A 1JF5A 4C1NB 4N4QA 3AO0A 4DWSD 4UNKA 1ISWA 3NR0A 1LTDA 4LT9A 4ZBCA 1AODA 4YHGA 4B4FA 1AJ0A 3M1ZA 2AAQA 3O3RA 5KVIA 4WDUA 3TXZA 1H7OA 5K9CA 5FEWA 2ZQ0A 1FOBA 3IPWA 4NEWA 2E3TA 3PPGA 4LF1A 4KT2A 3ITTA 4OU1A 1GRAA 1KLYA 3C52A 1ECQA 3W00A 1EJVC 3CH9A 3CT7A 2PDYA 2PTWA 3HOJA 1X98A 2WCSA 1LLOA 2TPSA 4MPQA 1CLKA 2DSVA 2Q3OA 3NZQA 2Q3RA 3NPUA 1GOOA 4JEJA 4DZHA 5BOOA 2X1IA 3Q67A 3PY2A 1OGSA 4BY3A 5KZMA 3KL5A 4YIWA 2JE8A 4JHOA 1I4NA 2O9OA 3MPGA 3FKKA 3EF6A 1ZLPA 3TW6A 4XZWA 1GT8A 3GUGA 4LUTB 3DH7A 2XHYA 2V63A 8RUCA 4FLQA 4GQGA 4K6AA 3USZA 5A6BD 1ICQA 3VGFA 1EC8A 3TNOA 1H7RA 3CS2A 4ZSUA 2QW5A 2PODA 3W71A 5HQMA 2E6DA 1PUDA 2QNEA 3P61A 4S1FA 4ORIA 1GSNA 4TMCA 1Q1RA 2PPGA 3PP7A 3I6TA 2VCAA 4MTVA 4YYCA 3LMYA 2PRHA 4C6OA 2BLEA 3SCQA 3WNPA 4F48A 1JEZA 4GY1A 3URQA 3WQ8A 1QAPA 3BCDA 1VJZA 3TSMA 2ANUA 4HU8A 3ARXA 4K7ZA 4DEFA 4CN1A 3UG8A 3A5FA 3PBWA 1AQFA 3WLQA 1R2RA 5HJLA 2OELA 2G8ZA 3N2OA 2KX9A 4WVXA 7ODCA 1XSIA 4IGHA 4LV4A 2TAAA 3TR2A 3CAKA 3CUFA 2EQ8A 1U5VA 2JF6A 2Z2AA 5BYWA 1T8XA 1LBLA 3ZR6A 2OEJA 3PVFA 1V6TA 1LT7A 3RCNA 4PGLA 5TNVA 2XVKA 4GZEA 1IWPA 3LBOA 3QW3A 2QV5A 2YOCA 1GQJA 3L4WA 5LNSA 3TJLA 4CCDA 4FALA 2ZXAA 5EBUA 4A29A 3DFPA 1BTMA 1X6UA 2A3BA 3N14A 3GXIA 4F0KA 4KCTA 4OFCA 2CNCA 1PSCA 1RA0A 1JCLA 5HBFA 2GUUA 3H2FA 4IPLA 4AZ5A 4GVFA 3THCA 4PL2A 3CHCA 1F4HA 3T8LA 1NWRA 3LTYA 3JR2A 4N7QA 4AHPA 2NZLA 3NEVA 4RW3A 4IMDA 3QQ0A 5DO8A 4A3YA 2ZZ7A 3N1AA 1XIGA 4AHOA 2VFDA 4FIRA 4CQ9A 5XIAA 3S4TA 2Y8KA 3TNBA 9CGTA 2VC9A 3MMWA 3DHPA 5EPDA 3V0SA 3H70A 3B4YA 3QFWA 3F03K 4O1AA 1HIZA 4H8HA 1UBPC 1ZBWA 4IXHA 4ZFMA 1GOIA 4DI8A 3W1LA 2NQJA 4U4MA 1GGOA 2BHYA 4JX4A 1DOSA 3STEA 2OKTA 4OJYA 4ZQCA 4DLFA 1I2QA 4H9XA 5JUVA 1A0EA 3S1WA 2WBGA 4JTAA 4A4AA 5HDRA 3DJGX 5HMDA 2BHUA 2W5FA 1JNDA 1FTXA 1SZFA 5SWUA 3IIZA 3F4VA 2F6UA 3BXWA 4NZ4A 4UFJA 5FS8A 3SGGA 5H8PA 3D0CA 4LJ3A 4MFEA 4OBTA 3WMCA 1ZHAA 3TQKA 3K30A 2VGGA 3JS3A 4ZR8A 2QJJA 3WDPP 5CG0A 2EPKX 3GB6A 2GFTA