4KT2A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
404
structure length
384
Chain Sequence
SLKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-mannonate dehydratase
publication title Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
rcsb
source organism Chromohalobacter salexigens
molecule tags Hydrolase
total genus 150
structure length 384
sequence length 404
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2013-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4kt2A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4kt2A01
2OO6A 3NFUA 4GGHA 2MUCA 2PODA 1F9CA 3CYJA 4GMEA 3GD6A 3MWCA 4HN8A 4DYEA 1SJBA 1ONEA 3MUCA 3TJ4A 3GC2A 4MMWA 3I6TA 3UGVA 3V3WA 2DW7A 3HPFA 4JHMA 3ZVHA 1E9IA 3TQPA 2FKPA 4H83A 3UJ2A 3CT2A 5IDZA 4A35A 1NU5A 1EC8A 1SJDA 2DW6A 5FJPA 3PFRA 3U4FA 1IYXA 4FI4A 3TCSA 3UCDA 3JZUA 4F4RA 3DFYA 3VA8A 3T9PA 3MZNA 3NZGA 3DG7A 4KEMA 1KD0A 4DN1A 3I4KA 4ZA0A 6ENLA 1P48A 4DWDA 3DG3A 1DTNA 3Q4DA 3TTEA 2OQYA 4M6UA 2OKTA 3OP2A 4IP4A 1EC7A 3JW7A 4GIRA 4A3RA 1FHVA 1KKRA 2GDQA 4JN8A 3N4EA 3QLDA 4GGBA 4ENLA 3N6HA 3T4WA 3NO1A 3DG6A 4YWSA 4KPLA 2P8CA 4GYPC 2OG9A 3QTPA 1EBGA 3P0WA 2OZTA 3ES7A 3R0KA 3VDGA 3TWBA 4HYRA 4HNCA 3R0UA 3ZVHB 1W6TA 3MSYA 3MY9A 2QJMA 5J04A 3FXGA 4HNLA 3FCPA 3TWAA 1KCZA 4H1ZA 3DFHA 4H2HA 3PWIA 1JDFA 3IJLA 3RITA 3R11A 3DGBA 3NXLA 5FJOA 2NQLA 2P0IA 5EU9A 4M0XA 3UXKA 3CAWA 3EKGA 3BSMA 4ZCWA 2AKMA 1SJAA 2AKZA 2QDEA 5FJTA 2POZA 2PP0A 2GSHA 5BOFA 2XSXA 3FVDA 3UXLA 3R25A 4FP1A 4GFIA 2ZADA 2PCEA 3K1GA 4K8GA 3OTRA 2PS2A 3THUA 3TW9A 2OPJA 3TJIA 1MDLA 2PP3A 1PDYA 3VC6A 2XGZA 3SN1A 2PU1A 3EEZA 3FV9A 4IL0A 3IK4A 2HNEA 3DDMA 3FYYA 3H70A 2GGJA 5FJRA 3IJIA 4Z1YA 1FHUA 1NELA 4IT1A 3PWGA 4K1WA 2I5QA 4HPNA 4IP5A 3MKCA 3PK7A 4JN7A 2AL1A 2OZ3A 5ENLA 3SSZA 2GGIA 1R0MA 2ZC8A 3R10A 3Q45A 4IL2A 3UCCA 2PU0A 3CB3A 3SQSA 3S5SA 3DERA 3U9IA 4MGGA 2OFJA 4A6GA 3B97A 3SN0A 3D46A 3STPA 3V5FA 4HCDA 3P3BA 3JVAA 2OVLA 2HXTA 2P8BA 1SJCA 3OZYA 2OZ8A 4X2PA 4GISA 2FYMA 2PGEA 2GGEA 1ELSA 1JPDX 2QQ6A 1P43A 1MRAA 5BOEA 2RDXA 3V5CA 5FJUA 3OW1A 2CHRA 4H19A 3VCNA 2P3ZA 3ZVIA 1RVKA 3MQTA 1MUCA 2PTYA 2PTXA 3BJSA 3R1ZA 2QVHA 3UJEA 3SBFA 3RGTA 4HCHA 3T6CA 1WUFA 3H12A 3VFCA 2P88A 3UJRA 3T8QA 4E6MA 2GL5A 3N6JA 4J3ZA 3ZLGA 4E8GA 4G7FA 1EC9A 3V4BA 4IZGA 1L8PA 1OEPA 2PMQA 3TOYA 2XH2A 2HZGA 1BKHA 2GGGA 4GYPA 3BOXA 3QN3A 3CXOA 3I6EA 3S47A 4Z17A 1JCTA 3ENLA 2QJJA 3RRAA 2PTZA 4ROPA 3H8AA 3H7VA 3P93A 2PP1A 3ES8A 2PGWA 1TE6A 4EWJA 4KT2A 2PPGA 3ZLFA 2O56A 2QDDA 3IJQA 1YEYA 1TZZA 2PSNA 2PA6A 2QGYA 2XH7A 7ENLA 1XPYA 4IHCA 2OQHA 2AL2A 3OPSA 3QPEA 2PTWA 3DIPA 3DEQA 1PDZA 1XS2A 4E5TA 4K2SA 2HXUA 1WUEA 4DXKA 2MNRA 4DX3A 3UJFA 3SN4A 3VCCA 1TKKA 3GY1A 4E4UA 1ECQA 4MKSA 3VC5A 4G8TA 3RCYA 4J1OA 3KUMA 3DESA 2OX4A 2OLAA 3UJSA 4HCLA 2ONEA 3RR1A 3N4FA 3ZLHA 3CK5A 3FJ4A 1JPMA 1MDRA 2XH0A 1EBHA 2QJNA 3GO2A 3OZMA 4DHGA 4KWSA 3D47A 1MNSA 2XH4A 4E4FA 1BQGA 3SJNA 1KKOA 2GGHA 3QKEA 3RO6A 2AL2B 1R6WA
chains in the Genus database with same CATH superfamily
4IM4A 5D9MA 3JR2A 1N7KA 4GMEA 4F2UA 4JDYA 3WENA 4OZOA 2IW0A 3QHNA 4HA3A 5A8MA 3WF2A 1BLIA 2DW7A 4LB4A 1S1PA 5U4NA 2BP1A 1F8IA 3EDJA 3CXBA 2NX3A 4ZQRA 3EANA 1BSIA 2GSEA 3BOFA 4E3TA 4NUWA 4HOZA 3TTOA 1QO2A 3E02A 1OFRA 3TJLA 3W7EA 2PDCA 1Q63A 1RCXB 3QV8A 2V63A 1ZNNA 2YL8A 3U7VA 1O94A 1B4EA 1AVAA 1JFXA 1NH6A 4DN1A 3V0TA 2VWTA 4LALA 1W8SA 1HL9A 1UKSA 2FDMA 5CBJA 1QATA 4DI8A 2BY2A 2VC5A 4CCEA 4BI5A 3QMRA 3CWHA 3H4GA 4M80A 4MPQA 1ZZMA 4MF4A 4AIBA 3WDQA 4FIQA 3H2OA 3RNDA 4JTAA 1UOKA 3Q58A 3CWNA 1H41A 3E2VA 4JL2A 3TSMA 4L9XA 3QTPA 1BD0A 3B06A 5BXPA 2JIEA 1LBMA 1ZBKA 3OGSA 4C65A 4NY2A 2XTKA 2YL6A 1BWCA 1D3HA 3AIVA 2C16A 2ZKMX 4PB4A 3LHZA 4HMNA 3EDDA 1UUOA 4P7OA 2WJZA 1V6UA 1WOBA 3QZEA 4LUSB 1QPNA 1XLAA 3BJFA 1P0NA 4RKAA 4AFYA 1KCXA 4WKHA 1RBOB 3OODA 4QP0A 4YXGA 1GUVA 3NL6A 5FJTA 5BNKA 5IFPA 2RDUA 1UKTA 2JEQA 4LXFA 5KZEA 5D09A 5AB3A 2QULA 2VGBA 1W3TA 5A8NA 1YDOA 2RKXA 2BWGA 3II4A 1HKVA 1KBKA 1W0MA 1XSIA 2VD8A 1F6PA 1L9WA 1U30A 1KM4A 4R7OA 2Y70A 3VFLA 3VUSA 3I10A 1CZ1A 1K7XA 3FYYA 3L23A 4HJFA 3OLEA 3WUEA 1FWRA 5DCEA 5C7VA 1WZKA 1V5XA 4AZCB 3T07A 5C0QA 3NL2A 4TVYA 2PZNA 4H9UA 2RABA 3MBDA 1S38A 1SVDA 1VYPX 3A4XA 4W7UA 1E6XM 1KXQA 6TIMA 2E5BA 2P53A 3DC8A 4HSOA 1TPC1 5I09A 4ICMA 1A49A 3RPMA 1OFPA 3CUHA 2A7PA 3VNKA 5AZ1A 1PB0A 4UB9A 1MVYA 3N6QA 3TYEA 4BF9A 5T91A 3FS2A 3O63A 2ON3A 2BC0A 2DH3A 4MPKA 4EQWA 3QR0A 4B16A 4XD4A 3WJSA 2QS8A 3PAJA 1W5QA 4DJEC 4NI3A 4G1KA 1LLOA 3AYSA 3GRTA 2CLOA 1F05A 1S5NA 5FL1A 3CV7A 1XSJA 4Q22A 3WF1A 2VRJA 5E0FA 4IX0A 3A23A 1FTXA 1LBFA 2E67A 3LSBA 3SRKA 4Y9OA 5HATA 2X0HA 4M7TA 4NRSA 3N29A 2ZBTA 1AW5A 1J5SA 5B7YA 5AC7A 4Y8FA 2ZWZA 5HULA 4A29A 3NQCA 3SGGA 1T0OA 1M68A 1GZ1A 3HQPA 4LVGA 2J7EA 3P0XA 3DH7A 2IUZA 4Z08A 3WNMA 3OG3A 1L6FA 2OJPA 2D2HA 4PMQA 3OOQA 3NM3A 4WVXA 4DI9A 3S9ZA 3I6EA 4O4WA 5JCIA 1TO3A 2BHUA 4EQXA 3RRAA 4H4IA 1KO0A 3CGTA 5D4YA 2W61A 4ZO6A 1ADDA 4KT2A 1YEYA 3AWNA 1PHQA 1IGWA 4JQ1A 2DZAA 4HNOA 1WAWA 1XLJA 4CD5A 2CERA 3HGJA 2BX7A 3CUZA 1OFDA 5HJXA 1FWAC 4S3KA 5I23A 2J78A 2FFCA 4QS6A 2E3ZA 4Q4QA 4CD4A 3ABQA 2MANA 3C8FA 3WH9A 1UR4A 2HROA 1V6XA 4UOJA 4MDPA 2BOFX 1CXHA 3U3HA 3K4DA 1CYGA 1XFCA 4TQTA 4DJDD 1UYQA 4O4VA 3KVKA 3PB0A 1VJZA 1XUUA 4CN1A 3OQEA 2PWFA 1GYLA 1O5RA 1H6VA 1W9BM 2VD9A 2Z4GA 1KRBC 1XIFA 5FMHA 4HHLA 1UKPA 2E68A 2FHBA 1E4MM 4LYPA 2ZRWA 2GJNA 1GVFA 5BZAA 4E2DA 4OBRA 2YOCA 4AIOA 3BUVA 3BW2A 2D0GA 4ACYA 4QQ3A 4F9JA 2EQ6A 1BVZA 3DI0A 3I4EA 1XLKA 2A5HA 2GR0A 4NAFA 1VBHA 1TIWA 4F79A 5J5RA 1TJPA 3CHDA 3ABZA 1PIFA 4I90A 4YMZA 1YNQA 3F2BA 4XAFA 1K3UA 2VDIA 3BCDA 1QOXA 1I2NA 3PZOA 5DY3A 3ANVA 2QNEA 4GH1A 2PDUA 1NWSA 2J77A 3GNRA 3W6LA 1A4MA 4ZODA 1M7PA 1XIHA 4K8DA 1WBHA 4D6EA 1CLXA 1XH0A 4IPIA 3B8DA 2BZNA 2BVTA 2Y7GA 3CM4A 4WY0F 3N9KA 1GEHA 4ZBCA 4PB3A 5GVJA 2BXZA 1WZLA 1J0HA 1KXVA 3V0SA 4AEFA 3S2NA 3IRDA 3CAQA 3KLJA 4D72A 1NDYA 1U5VA 4W93A 4IGHA 3HN3A 4P8WA 4ZGYA 3PSVA 1LORA 1VBUA 1H5YA 3UYCA 3QVQA 3RUBL 4QX4A 1OK6A 1FOBA 4PMVA 3PHAA 1ZMDA 4RW5A 2EPHA 5CJ5A 5AHFA 5I3FA 5REQB 2A0NA 3AISA 3ONBA 1KWGA 4RR4A 1W1YA 1M9HA 2I56A 4GUJA 1E1CB 1XINA 1CBGA 2NUXA 2CITA 3CYVA 2KZHA 1QNPA 3Q4DA 5HBFA 4WGXA 1AK5A 2VC9A 3AYRA 4L4PA 1FY6A 3GXMA 4H6EA 4ROQA 4UFJA 1IV8A 2ALDA 1GJPA 3H55A 1JRPA 4GUIA 4QJ4B 4Q8PA 3BL3A 3RM9A 4KPLA 4A8LA 2BHYA 1SO4A 4D1IA 2Z2UA 1YPXA 4CKQA 1WYGA 1HN1A 3ES7A 1FQ0A 1QAPA 1Z8AA 1J4EA 1MO9A 2FVLA 3LQGA 2Q8LA 3ABXA 1Z69A 1Q13A 1IZKA 5BOOA 5LA0A 4L56A 1MUWA 1OADA 2A7RA 4LVDA 1C29A 4F9DA 3L4UA 4RXGA 3MDUA 4MFDA 1JDFA 4IQJA 4KFOA 4OWGA 1UMYA 2ATMA 1UP2A 2P0IA 3LGDA 2NWRA 3B8UA 3KOZA 1TE1A 4JS3A 4PRRA 2QDEA 1QBAA 4M1RA 5CJMA 3SCWA 3WBAA 1XLCA 3NUKA 3N14A 3SDOA 2PCEA 2V0TA 3WJWA 1EQPA 3NRZB 2GR3A 3M9YA 3EEZA 3CGBA 5CCZA 2NQZA 1H7OA 2F5ZA 1W31A 1ZSXA 1SFTA 2NVDA 3CC1A 3IARA 5CAKA 1H51A 3P8IA 1OJTA 1XLMA 1PTDA 3IV3A 4IMEA 4H8UA 3DI1A 3IK4A 2GUYA 2WKGA 4C5ZA 1MW0A 1DJZA 4IICA 5BROA 1XIGA 2BV9A 4L64A 3AZSA 1OYCA 3WEZA 3PZMA 3E38A 2ZZCA 1ISYA 2Y5SA 3W6YA 4LQ1A 3LNPA 1IEWA 4DAIA 3WLQA 1VPXA 4W8BA 3AALA 2W55A 4WJEA 2AL1A 3AMDA 4NILA 3SCNA 1QFEA 5FCZA 4DLMA 4AISA 4I7WA 4AD3A 3QXBA 4FZIA 1H0GA 4UFLA 4CEXC 1V6VA 3N1AA 3S5SA 3WFLA 4YTTA 1H7RA 1C8QA 4O16A 1J0IA 4AY8A 1V4YA 4DUWA 2I5GA 1KGXA 4Q7NA 3OVQA 2VRKA 3URQA 3V5FA 1HT6A 3H7UA 4CN6A 3PZUA 2CKRA 1P6BA 1UPMB 3UXAA 1EZWA 3CZLA 4F48A 1KTCA 4J4KA 3UY8A 2O7QA 4F2TA 1C93A 1RV8A 3M0LA 1UW9A 4CQ9A 4WK9A 4E0CA 2ZZ5A 3BGAA 5FJUA 3VD5A 1ZENA 3PBWA 3UA3A 4C1NA 3V16A 3LLDA 4H19A 2H90A 3ABSA 1HJSA 3MV01 4YHEA 1K7EA 1OX6A 5ABFB 1GRHA 2QVHA 5T9CE 4KRZA 3H12A 1GHRA 4QDWA 3T8QA 1TJ2A 1H3GA 4PUJA 3MKKA 4ERIA 2WWCA 5DT7A 4HYVA 5BXRA 1Y5VA 1ZBVA 2GVLA 3H2CA 4I5UA 2XU2A 5FF4A 2WOVA 1NQ6A 2XN1A 1YQ2A 1YPFA 3ARQA 3NQGA 1NFPA 4Q8MA 4YTSA 5M1TA 4YCOA 3QN3A 1UZHA 4LVAA 1NDZA 3VNZA 4UWMA 2JKPA 3WLKX 5CG0A 5CXPA 3NQ8A 2BASA 1C3FA 3FJLA 2CLKA 2PGWA 3VX1A 4EWJA 4JN6A 4AEOA 4BEUA 2PDGA 4PSRA 4JTHA 3R8GA 3IVUA 3UR5A 2XH7A 4JKLA 1TYGA 2CZDA 5FJIA 2ATSA 2FPYA 5C2GA 4I8YA 5I7GA 3EB3A 3OPSA 4XZIA 3W70A 1GVRA 4AD4A 3HV9A 2NXIA 4B5SA 1RZMA 1UJPA 2FPVA 1EXPA 4L1GA 4GX9A 3AIBA 4D1JA 3DBNA 1TV5A 1PCWA 3WDIA 4EACA 1GKRA 4US6A 4FNTA 4ATWA 1ECQA 3QGVA 4KCVA 1VYRA 4WF7A 4YCPA 1AL7A 2OLAA 1DQUA 5JUVA 4EQSA 1UIPA 5AHLA 1Q4WA 5FF3A 4MNLA 1PL9A 3PY2A 3WLLA 4O1AA 5A6JA 1KBBA 1S5VA 1O12A 1KBIA 2JFEX 5A8PA 3N25A 4CCCA 3CS2A 4QBXA 3VIOA 2BDQA 1LQ2A 1JPIA 3QSTA 1A5KC 2VT0A 1JROA 4DHGA 3G0UA 3B4YA 2G0WA 3GVVA 5BMWA 1LPFA 3VIIA 1VFOA 1DIKA 4FOKA 4UTWA 1QBBA 4UIOA 1FFRA 1IWPA 2O4QA 3W26A 3WF0A 1OFOA 5LZLA 4JR5A 3AICA 2RDTA 3N12A 1NQKA 1LL6A 3IIPA 5AHNA 2NVCA 3NQMA 4HN8A 3GD6A 2OT0A 3RLHA 3OGRA 4PUNA 3G8EA 3GC2A 3NEHA 2C1IA 2WLZA 3W81A 3IIOA 3NQ2A 3ZIZA 1E9IA 4PMNA 4ZE4A 3AMLA 2OWWA 3P67A 1F3TA 2VZSA 4H6KA 5G2WA 2YZ5A 2YIHA 2WSQA 3EGJA 4F4RA 1EEXA 4DJFC 4ICCX 5IHSA 4GRSA 4Q4OA 1NSJA 1V51A 2Z24A 4FLRA 4MUZA 5K9DA 5HNUA 2LLEA 2ZZ7A 4BCEA 3ME3A 1XI3A 1JI1A 2XVPA 1O6IA 3DK8A 4NAFB 3T0BA 4CVWA 5AHMA 3DG3A 4LBSA 1FIQB 1OGSA 1OC6A 1FA2A 1IEIA 3REQA 4C6LA 1GG0A 4AZ5A 2OQYA 1F7BA 4M6UA 3LU2A 4W8AA 3EDKA 1XLLA 4CLMA 2XZ7A 3KTSA 5D2TA 5C8BB 5E70A 1DXEA 3A21A 3GXTA 1AG1O 2C15A 4ERAA 1DE5A 1ML1A 4QCEA 4H01A 4JIRA 3H6OA 4QAIA 3G24A 1IEXA 3OU8A 2ZZ0A 2GK1A 5A5WA 1OD8A 2VHLA 5GQBA 3P8JA 1ZXIC 4AWEA 1BVWA 1CI1A 1ZALA 3FAWA 1SZEA 1XCXA 1S46A 4H2HA 2HMCA 1ISXA 3IJLA 3VGHA 3W2JA 1KC7A 3MP3A 3W2LA 4MADA 4EE9A 2H9AB 2NQLA 2XN2A 2PCQA 3CAWA 1LP6A 3U5UA 1CIUA 2AKMA 3UR2A 4PCTA 2QPSA 4QLKA 3FHQA 6ALDA 3BW4A 2WBKA 5CZJA 4DQWA 5CAHA 3W38A 2VEFA 4NIRA 1ISVA 2ISWA 1M01A 4NQ1A 1TVLA 1PZ0A 5G5HB 3T0DA 1HW6A 4MB4A 4PUEA 1TCDA 6A3HA 3ZFHA 1A5LC 3PJWA 4X63A 3RU8X 2EEXA 3AOFA 3DDMA 2IQ0A 4Z1YA 4A22A 2IXVA 4OECA 3GKAA 1RP9A 4BHYA 1IWBA 4AIEA 4XZMX 4MDOA 2WSPA 5E9AA 4KFPA 4JNMA 3FIGA 1ZJHA 1JJKA 3V1PA 4A8NA 2POTA 6REQA 4QDPA 4H4UA 4IP5A 3L0GA 4YWIA 4D6IA 2A3AA 1EX5A 1N8FA 3QMTA 3L2MA 1MWOA 3E2QA 5D33A 2EO7A 4OKDA 1UC5A 2YCLA 4QJ1A 1KFBA 4A8RA 2WQDA 3H2NA 1C9DA 3U0HA 3LCGA 5CSUA 2Q71A 2DZUA 2HEJA 3U9IA 1AQMA 4HNTA 1XRFA 2W79A 3QY6A 4MGGA 4MLJA 1EH9A 5A2CA 4P7QA 1U1HA 4J57A 2DIEA 4NYUA 1XYCA 1K4HA 3KVMA 2D3LA 1B1YA 5T8GA 2YVGA 1KXHA 2R1KA 2PGEA 1NDAA 4GACA 2NXGA 5EY5A 5EPDA 3HBLA 4PE8A 4IH3A 2OCZA 4HA0A 5IRPA 3GTFA 3A4WA 4EXAA 1BXCA 3EA3A 2CHRA 4HPJA 1FWNA 1E73M 4N4QA 1HXJA 5GNYA 3ITYA 4C6DA 1V3HA 2QCFA 1RBAA 3MQTA 4NEWA 1K8ZA 3MW7A 3CTLA 4GOAA 3SBFA 1O5XA 1VLWA 1ZS2A 3ZWSA 4IISA 5LNRA 4AD2A 4CQAA 1A5SA 3BGJA 1FX6A 1XXXA 1VRXA 1JFHA 2ZZ4A 4F0KA 3GVRA 1XQKA 4H7ZA 4PMYA 3WLOA 3L5OA 4FR6A 2FZNA 3COTA 1L8PA 4KRTA 3ITXA 4HYWA 3TV8A 3S5OA 2VP8A 2FGZA 5FEPA 1BKHA 2PWGA 2ZRYA 1Q6LA 3KAOA 3GU1A 4IMGA 1F74A 1PX3A 4YTQA 4HKPA 4PUWA 2J79A 2BOEX 4M3PA 4O57A 1TWDA 2QJJA 1DIOA 3IIVA 2QIIA 1MNZA 4RZ4A 2CLEA 4ROPA 1NWTA 1GEQA 1UUMA 2H8ZA 2O56A 1ZBWA 3KCOA 4IIGA 1SUXA 1N8IA 2PUZA 4K8EA 4IPNB 4XZLX 5FSDC 1BEUA 3PZIA 3OIXA 2ZWYA 4UTMA 3VINA 4OVXA 2J74A 3E3HA 2EBNA 4NG3A 4E5TA 1RLCL 2Z26A 3LRKA 3B0PA 4C1NB 5C5YA 1V3KA 2W3SA 4JY8A 2PZ0A 3SN4A 4M81A 4YVPA 1K8YA 3KRZA 1K4GA 3W75A 5G2HA 2C19A 2C71A 4ZOEA 1BYBA 3DHPA 4IJBA 1VFHA 4PGLA 3APTA 3ZR5A 1XC6A 5CKSA 3BLPX 3TC6A 2ZUTA 3ZYZA 1F8WA 5GJNA 3AM9A 2PD5A 2TPSA 1JYNA 2X40A 4EM3A 4FNQA 3SQMA 3CJPA 3EYPA 4IIBA 3DCPA 3LHWA 3S5ZA 2YCEA 4V27A 1LOQA 1VAHA 3CH0A 2VENA 3NYDA 4S39A 4KWWA 4N6EA 2Y62A 1RXOB 3AMKA 4JL1A 2PWDA 2W63A 4GZ7A 1KKOA 4O1EA 1SM9A 4HN4A 1U22A 2QUUA 3WNPA 3A4JA 3VOGA 1OQFA 2VQTA 5D2WA 5LYRA 1AQHA 4MG4A 1AFSA 3NO3A 5G4WA 5FKYA 3N18A 4BQ3A 3M5XA 4LEQA 1H63A 2OGJA 3MV11 2WPCA 3W7GA 2F6XA 4FNSA 3NXFA 3ARRA 4Z2HA 1OINA 5FS6A 4J9JA 3QF0A 3LB8A 1Q6EA 3S1VA 4QEEA 4JHMA 4XAPA 2V3EA 3H2MA 4D6JA 2REQA 1ZY9A 5I3IA 5K2ZA 5E6YA 1DJYA 1EKOA 4L61A 5FEZA 4W85A 1EJRC 3QR1A 4U3CA 1WCGA 1SJDA 5FJPA 1MEIA 1OYBA 3VIFA 2PDXA 1KGUA 1H50A 4HHHA 2V5LA 4W7VA 2NUYA 1BGGA 3DFYA 3LRMA 3P2VA 2R1NA 2WVUA 3VE9A 3NZGA 1NHRA 1BKSA 4HOXA 4DIAA 1T8QA 3QFWA 5J8LA 4O1CA 3QJAA 3K4WA 1D3CA 3LGGA 3HPSA 1DJXA 2VFFA 1CEOA 4AU0A 3B8VA 1XDLA 2GDVA 1UD4A 1TTIA 2ZA1A 2IQTA 3C8NA 3V5OA 5I2UA 4IJRA 4H2CA 2H8XA 4NZ1A 3N4EA 1CWYA 3EPOA 3PTMA 2ODOA 3N6HA 3NO1A 4GX8A 3DG6A 3NYZA 5GJPA 4WJ8A 3PZVA 3SGZA 3UU0A 1A50A 2QAEA 3PBMA 2FDSA 4KKXA 1W37A 1W1B1 4DZHA 1F73A 1GRTA 1ZB5A 3GVWA 3R0KA 3VDGA 4HU8A 1EJXC 2O9OA 1CCWB 4O10A 3TK7A 3R0UA 1Q8AA 4KERA 3OVGA 2ACSA 4UTUA 4Y2WA 3ZQ9A 4GXWA 2Z7GA 3EWZA 4U5IA 5BXSA 1AJZA 1KCZA 3LCIA 1A5UA 1EWDA 3CUFA 5C7HA 2V30A 2ESCA 4HD5A 3DU0A 5FJOA 4GVIA 3C6CA 3Q65A 3RFAA 2VEGA 1ISWA 2AKZA 4J5NA 3W7DA 4CU6A 3WQ5A 5BOFA 1TSIA 4TOQA 1OABA 3A64A 1LT7A 1JR1A 1W17A 3AJ7A 4OU1A 3PPCA 1GT8A 4PMUA 2BMBA 1MDLA 3REQB 1B3WA 3VKJA 1UC4A 3W7CA 4LYRA 4P2VA 3VU2A 2Z2BA 1E5JA 1PZ1A 2E9BA 3WDRA 4Q8UA 1WV2A 3HZ3A 4FIRA 5CJNA 4BWLC 4V1YA 2PBGA 2G3MA 1H7XA 4UNLA 3GU2A 1RJRA 4MB1A 3CHCA 2BG5A 4JIHA 4UTJA 4MYAA 4LTSA 1GV4A 4TTUA 4RXFA 1M7XA 3VDAA 4LNYA 3HO8A 1R2SA 3CPRA 4MNKA 3RX3A 2GK1B 4OUEA 1D3GA 3AMZA 1TPWA 3QGKC 3SQLA 2OZ3A 4GABA 3MB9A 4CD8A 4JEJA 3UCCA 1Q6DA 4WDXA 2JGYA 3SQSA 1IT7A 2X50A 3OA3A 4IMCA 1TZ7A 4G56A 4TMBA 3L65A 4FXRA 1EYWA 4MNJA 1XDJA 4KGJA 3FHAA 3SN0A 5XIAA 2YDSA 4HK5A 4MJZA 2Z27A 4YYCA 3JVAA 1EOMA 3P5ZA 3M0HA 4MUPA 3DH9A 1XG4A 2RFGA 1A5BA 3L8KA 2DSUA 1EO5A 1R9XA 2VOMA 3GDBA 1XGDA 3WO8A 2B7QA 2QHAA 2G3NA 1ZLPA 1BQCA 4DJFA 3SFKA 3OZPA 4ZTYA 1DXIA 4W7WA 3NG3A 1E56A 1RUSA 1K70A 3HMCA 2ZX9A 3WNNA 1NJJA 5FS7A 5AYXA 2Y88A 3WLSA 3B4UA 1MW2A 1W3JA 3ITCA 4KS0A 2D1ZA 6REQB 4ADTA 2X1SA 3MCMA 2R1LA 2JEPA 1QI2A 2PLKA 5IFTA 1KFLA 3BMWA 3GX9A 2A21A 4O1DA 2YCLB 5HAOA 1WZMA 4K36A 4PR4A 1JCXA 1K6AA 2R24A 5F2IA 5DQPA 5A8GA 2J3NA 3OJGA 4JQ2A 3H26A 3LMZA 1AA1B 5CZ0A 1VBRA 1KM2A 4W89A 4L80A 1OBAA 4X22A 4QG6A 2YX0A 3IJQA 3U2ZA 4DJDC 1TZZA 3TTQA 1F8MA 4HTBA 3TZNA 3DFOA 3NSNA 3RMEA 5DN1A 3WMLA 2OQHA 1GOIA 1YKWA 5ABTA 2PDIA 5JCMA 4AWTA 3KOFA 3BICA 2FZBA 4QG8A 1Q45A 1ZY8A 1ZJAA 3IJ6A 2NX1A 3H7RA 5LNUA 1TTQA 3SO7A 4UZUA 3DX5A 1M03A 3P14A 1TX0A 3VCCA 3SB0A 4XAZA 1XRTA 3W71A 3VC5A 2WANA 4WGHA 1UHVA 3S9IA 2YFNA 2YA2A 2YDRA 5TR3A 2PDFA 4LX4A 1GNXA 1HNYA 4O50A 4GRTA 3TUUA 1V02A 2QIWA 3MI3A 3FSTA 4LAZA 3N4FA 1EGMA 1L2QA 3CK5A 4NU7A 1POKA 3LY0A 2VC6A 3TLQA 1JVNA 3CNYA 4YTUA 3IWPA 1EL3A 5DRCA 4GXMA 2UY3A 1TVNA 2QCHA 3SCTA 3SY8A 2WW5A 3GVGA 4M1BA 3MTWA 4PTNA 4EKJA 4IG2A 3GG7A 3ITLA 1R8LA 3LTSA 3TLLA 1LVLA 1ZPTA 3W1QA 4OJYA 1GZGA 3EOSA 5HMEA 2BCPA 3BXWA 3KP1A 2OZ0A 4GD0A 4G1NA 1C7TA 3CZGA 1ZL1A 4F0RA 2A7NA 4BKNA 3E0FA 4Y9MA 3S1UA 3CB8A 1PPIA 1ZAIA 1EEPA 4QSFA 3RLGA 5EFFA 3TQPA 2FKPA 1HZYA 4ZXOA 1ZAHA 4J27A 1PKLA 5JXQA 4LNCA 3N2XA 2VEIA 4A35A 3R6IA 4LEFA 3DUGA 3U4FA 3VUPA 3ERPA 1N8WA 3HPZA 4GJIA 4R85A 3NTYA 2R82A 4ML9A 1JCJA 3UCDA 4OOZA 1DWAM 1A0CA 2BS9A 1H1ZA 2PDKA 4LV4A 3RDKA 3I6RA 5KITA 4AVNA 1E70M 1I0DA 1HG3A 2WHLA 3W7PA 1LROA 5H1WA 4XD5A 3CPUA 2DFAA 3GUGA 1FHLA 4ONVA 3LMYA 4MWAD 1PX4A 2NX9A 3G3MA 3H53A 4EMWA 4IPJA 1GOKA 3ITOA 4EF8A 3NOYA 5U1OA 3CTTA 1U2YA 2X1IA 3VIGA 4IP4A 3PFMA 3HMJG 1XIJA 2AQWA 4LT9A 4Z42C 2PE4A 3VDCA 2Y8UA 4Q8OA 1WZAA 3WBYA 2JBMA 3CZKA 2TPRA 1GQJA 1RJQA 1KM3A 2V5DA 5C71A 3MMWA 3M0IA 1EBGA 3DYOA 4PODA 5I3KA 4GUGA 2BNJA 4ZO9A 2AGTA 3CAKA 4ADSA 1D9EA 1Q3NA 3MSRA 3GHTA 2FH6A 1MW3A 4GVHA 4IPPA 1W32A 2REQB 1L2UA 1JNEA 2VI0A 2VOTA 1J2WA 3VAVA 5CH9A 3CUIA 2WWDA 3WNOA 8XIAA 4BY3A 2BSLA 4A8IA 1XYFA 4B5VA 3OA5A 3B05A 4M29A 1GESA 1UQZA 1TPVA 2AMXA 4GJJA 3WQ6A 3FYOA 1SJAA 1FWIC 1YTEA 3AS0A 3SRDA 2QCMA 4WSKA 1A4LA 3VD3A 3CUJA 2XWDA 4PUMA 3R25A 5IOBA 3KHDA 4K8GA 2RHGA 3M4HA 3A5VA 5CPTA 3W7QA 3GG1A 1R5YA 3SCUA 1OD0A 4QITA 1PDYA 1HKIA 3M0JA 3NWRA 2CHNA 5IDIA 3MBFA 3N19B 2HBXA 4LWWA 1I75A 3LCFA 2PURA 3MMDA 1V3IA 1H2IA 2ZDSA 3E1F1 4GH3A 3TQVA 4L1WA 4UTTA 5FJRA 2WPBA 1O1ZA 3C0JA 4IFRA 1X7FA 3FDKA 1FRBA 3EUB3 5I0DA 3I7SA 1N61C 4A4AA 3QM3A 2I5QA 2BGQA 3PPHA 4CEUC 1G4PA 3W6MA 1TA3A 4XO7A 2QVNA 4AX7A 1MW1A 3BGGA 3G2GA 1MFUA 2XSBA 4Y8EA 2PU0A 2BBFA 3M1ZA 1RBLA 3C2YA 3HIJA 1EJ7L 4QGCA 1GQNA 2PWUA 2HVNA 3ARZA 4NJGA 1MOKA 5LXXA 1IR1A 3ZOAA 4WY0A 1W3LA 1OYAA 4QSHA 2CLPA 2O55A 3MHFA 4GIAA 1C8VA 2BB0A 2HXTA 5A6AA 4K39A 2WM0A 3D0CA 3PUEA 1W2VA 4EMIA 4Q7BA 3GG0A 4N7QA 2OTDA 5IBXA 2Y7FA 4PL1A 3GW3A 1B54A 4JIEA 3LM7A 3CZJA 2HSAA 1LJYA 3PJXA 4D6FA 2VVNA 1DJIA 1U5HA 1PJ9A 3SY1A 1OSEA 5CPQA 4DBSA 3H21A 1FWDC 4C6FA 3W2MA 3W29A 3EF6A 2X7VA 3PAOA 1R2RA 2WXDM 2A6NA 3BLDA 3O6CA 5EMLA 1XLIA 1DBTA 1RD6A 1W5PA 3FYPA 3T55A 4QG9A 1X8FA 1WDRA 3EOEA 2WMIA 2A3EA 3W7RA 5AYYA 3BC9A 3AIEA 1UB3A 2VJXA 3DK4A 2DUXA 3T7VA 4B90A 4H7CA 3S0CA 3ZLFA 4J3VA 3LPFA 1B90A 3SCOA 3IS4A 4LY8A 2CFYA 3DBPA 1O5KA 4IXHA 4XD6A 2AL2A 1UKQA 4GINA 3II1A 4XZBA 4B9YA 3QPEA 1JZ7A 3I3EA 2VURA 4XBKA 2CPUA 4TVCA 2DP3A 2RJGA 3EX4A 3P84A 4PEKA 4UTIA 1UP3A 1XPGA 3E49A 4L6DA 4JGDA 3LUTA 2EPMX 2V5CA 3S83A 3E12A 4TMCA 4H9XA 1RQBA 1CB2A 4J1OA 5I00A 4Z0SA 5T9BG 3URAA 4Z1AA 6CGTA 4ILSA 2D20A 1LF1A 4YYFA 1DJHA 5EMKA 2AAAA 2V5KA 4QRNA 3M5ZA 4EQRA 2OSXA 1OZMA 1IWAA 5HOSA 1JPMA 4Q4MA 3UNDA 2Z25A 5AOUA 1P0DA 2OYKA 2AMGA 1RA5A 5EGRA 3DFSA 5DXYA 2VEMA 4MKNA 1PO9A 2A2IA 3G1XA 3MUAA 3WK0A 2X0YA 2HPMA 2J62A 2IKHA 3G5EA 1QASA 3S2CA 3FFSA 3AAMA 5D2YA 4H04A 1FEBA 5DMYA 3S9YA 7REQA 4AVOA 1TG7A 1F2JA 1HJQA 3P62A 3E9AA 5FJJA 2DT2A 1MQQA 4Q4PA 1BGAA 2FTWA 5DXXA 3WQWA 3U8GA 5FACA 4LUYA 1BZLA 1CGWA 2VFGA 3HPFA 1QWGA 4OV4A 4IX2A 3B9DA 4HGXA 4FR1A 2GJXA 3AC0A 3LG3A 1XF0A 4H4SA 3KVLA 2Z00A 5KZ6A 6PTDA 2WMGA 4DYJA 1BWVA 3KXQA 2QPUA 1QNQA 2EG8A 2QAFA 3W9ZA 2A3BA 3TYZA 4O11A 2DPEA 1OT1A 4NRRA 4MM1A 4HOWA 1DXFA 4ZA0A 3BW3A 2CWXA 3BOLA 1YYAA 2Z28A 1U1UA 4D8LA 3ITGA 2AGKA 4A05A 3IVSA 3TC7A 1VCFA 4JCMA 2VC7A 3U48A 3F03K 1AD4A 4GG9A 4JN8A 1J12A 2DJLA 3MYOA 1ZDLA 4X61A 5K7JA 3ZJ7A 1XLHA 3O15A 4PB5A 4PSPA 4LGXA 3AMCA 4H9YA 3UETA 3HTWA 1HGWA 1I6NA 4DJDA 3O05A 4H6RA 4U3AA 2GRTA 5JRBA 4NVTA 5H6HA 3H23A 4AC7C 3C2RA 3GXDA 3VMOA 3EWYA 1SO3A 5LA1A 2ACUA 3CT7A 4M8UA 3D5HA 1A5AA 1SMAA 3FLUA 3MY9A 3WDPP 2PDYA 1QUMA 4Z2GA 1VJSA 1WAUA 3FCPA 4AHPA 1DWJM 3AFBA 3PWIA 3NM1A 4V33A 3PZ9A 4JDRA 5AY7A 2X8HA 5EU9A 2HCVA 2ALRA 5D8ZA 3EKGA 2C79A 5GPRA 3SR6B 2PP0A 1TTPA 3VKAA 3CHEA 3NJ3A 1FWJC 3KBSA 2FHCA 1HP4A 1UR0A 4GA8A 2FTYA 3THUA 3UZYA 4E4PA 2OKOA 4QXIA 5BRQA 4AD5A 4K3ZA 1G7VA 3PNUA 4M6QA 1ADSA 3LRLA 2BODX 3EEGA 1H1YA 4QROA 3QV9A 4G7EA 2GQ8A 1FHUA 3VOIA 4AZIA 1Y5WA 1UR1A 4HA4A 3KHJA 3SCVA 4O53A 3RPDA 3S2LA 1L8NA 4BI7A 2VM8A 4HU3A 2NQ5A 1DHKA 1PTAA 2V5BA 4MZ1A 3NCOA 4HU4A 3RXZA 3H4WA 2W3ZA 5HUPA 1JZ2A 3GDLA 4LBUA 1MUMA 3NA8A 1J96A 4O12A 3EWDA 3T42A 4ZR8A 3S1GA 4WOQA 2F84A 1JRBA 5DBTA 4C90A 2QKFA 4MTVA 4ZOAA 4GE8A 4AWUA 1JAEA 3JUGA 5AECA 2HE8A 4JFUA 1HL8A 1J01A 2QV4A 3IANA 5KVHA 3KDNA 4HJWA 1CT5A 3GD3A 3D3FA 2GGEA 1N5XA 3NQDA 5K9XA 1XV8A 3UG5A 4JTEA 1LQAA 4H6QA 1MRAA 2NQHA 5KINA 2EQDA 1ZTVA 3OW1A 3JRKA 1TTJA 1UD3A 4B5NA 1XUZA 1RVKA 4YJ5A 3WX7A 3WY1A 4GC3A 4L5ZA 3ABOA 2TRSA 1CGYA 3VOJA 4QE1A 2HPIA 2R8WA 2ZZ6A 4XO6A 3VIPA 2E6AA 4G9PA 3RX2A 2X2YA 3L21A 1JGMA 3B3DA 4KCUA 2Z7KA 1YTDA 4GNKB 3M0XA 3N4AA 3N9SA 5LSMA 2R91A 1Q7ZA 1KBLA 4E8GA 1FH7A 1JXKA 4CNPA 3VNDA 4OHQA 2ZICA 3E2RA 4U33A 3BOXA 3TYUA 5E5CA 3WLPA 1J93A 3S47A 4Z17A 3W24A 2JK6A 4C6NA 2PTZA 4WY0B 5MF5A 3WFAA 1EUAA 3NVYB 2EKGA 7ODCA 2PPGA 3OVPA 3UNTA 2QDDA 2ZFAA 1Y8BA 3BTNA 3MVTA 1W9XA 3TFXA 4EANA 3EOLA 3BANA 1IQ8A 3GTXA 1W5NA 4HVXA 4MJ2A 4TVUA 3PBGA 2QMJA 4R9OA 1IHIA 4O8AA 6XIAA 2PF0A 3P82A 3RPTA 3A24A 3V7PA 8RUCA 3TFCA 4O0ZA 5F1UA 1FUYA 3GZAA 1PEZA 5HQEA 1XDIA 3WNKA 1LM1A 4E4UA 1XBZA 4GWEA 3M0KA 3SIZA 1NDVA 3RF9A 3ZJKA 3HGOA 3EXTA 3BK0A 4PMJA 2NLIA 2J8GA 3HQ1A 3UVIA 4DBUA 2RGMA 3EWUA 5EKYA 5A94A 2WMIB 4K1GA 1WBJA 3STEA 2QUNA 5C9ZA 3EKLA 3L4WA 4LF1A 4KEUA 1UD6A 3KTCA 1U83A 3OYXA 3OHMB 1Q1WA 3RO6A 5AFDA 4FLSA 1XRSA 1R86A 3PPGA 5M03A 2AL2B 4ERGA 1R6WA 1TR9A 1K6WA 3NFUA 3AS2A 4MSSA 3NZ1A 1WA3A 2PODA 4GO8A 3BDKA 3MWCA 2DIJA 3ZR4A 5T26A 3TJ4A 1O66A 3O8AA 3QW4B 2PRLA 3BV7A 4DM1A 4XUGA 5A2AA 1YADA 1LOLA 3O0HA 3W7HA 4QQUA 1KTBA 1V02E 2QCLA 4X3ZA 4NNAA 3ZVHA 3PP7A 1YBQA 2ZRVA 1B4KA 3PUGA 3PG9A 4M5PA 1V77A 3C0SA 5CC7A 1J0KA 3FN9A 1XIMA 3LLXA 1BF6A 3TC3A 3UWUA 3AHXA 4GYFA 2BFGA 3N04A 2FB2A 3NVVB 1Y7VA 1JQXA 4DEFA 1FFUC 2Y61A 2E9MA 3OHIA 1XYAA 1XM3A 1N62C 1EP1A 2CYGA 1I2RA 1BYDA 3B40A 2VX5A 1KFJA 3M16A 3SY5A 1VH7A 3NQFA 2OELA 2VEKA 2B31A 1HQTA 2C6QA 1H62A 5CLTA 2H3BA 1ALDA 4RDZA 3N17A 3UG3A 1UASA 5H8MA 3EMCA 3LV6A 2W9MA 7REQB 1JXJA 4YWSA 1TCMA 1CDGA 2V3BA 2QJHA 1J0YA 3MKVA 3IJ8A 3P0WA 1QHPA 3K8MA 1HKWA 4BR1A 3ZT7A 1FWCC 1XLDA 2ZOXA 1K9TA 3VYLA 5F4SA 3WK1A 4UFHA 4FNUA 3DJJA 1DPMA 3FY1A 2XIIA 3Q2DA 3C3NA 3ZSTA 2WHMA 3E0WA 4GUFA 2JF7A 2YZRA 1YQZA 5I3DA 2GJXB 3U7BA 1UWQA 2E5DA 3RITA 1EPVA 3A9BA 3N2TA 2J47A 3O6DA 1E5NA 1XBXA 3MSDA 4M0XA 3W2UA 1ADOA 5LIWX 4JTKA 2DT3A 4GY7A 1Q6CA 2BXYA 4H50A 2PDMA 3R58A 2OSWA 2GDUA 1FCBA 4OBSA 1EXBA 1NAL1 4AIUA 1JYWA 1P0KA 1R7AA 4QNWA 4LS1A 4BV6A 3UWVA 2J88A 4UQBA 3DYMA 3PR2A 1QI3A 2F9RA 3LTYA 1VPQA 3M0VA 3WDJA 4JYFA 1TPH1 1ONXA 1ZP3A 1J79A 2OEJA 2GH5A 1W1PA 3TZFA 5IM51 3WMCA 1OGGA 1HKKA 4HHMA 4IT1A 2CETA 1T40A 2ZDRA 1DE6A 3CGEA 4H9MA 2OB3A 1GETA 3KBVA 2DY3A 4X0VA 1E15A 2GPTA 1JEHA 1SSDA 1VBGA 2FPTA 4S3FA 2V9DA 4POCA 1VGAA 2I5IA 2DZWA 4UMAA 4PMRA 1M5WA 1B3YA 1GOOA 5CBBA 1FVPA 2I17A 1VQZA 3GC5A 4AY7A 1CXFA 3AWOA 5A69A 2OFJA 4JFTA 5BWAA 2XSAA 3WLHA 5JCKA 3MMUA 4P7RA 1E1FA 3LXCA 4PULA 1F3EA 2W91A 1YW1A 1IF2A 1PKMA 3K8KA 2XIBA 5DF0A 1DJWA 2I9EA 2NZLA 5FEXA 3ID7A 1JPKA 4RDYA 4IGMA 3R13A 1GERA 3RIKA 3QGAC 4PFHA 2E28A 3FEMA 1ZJBA 4JKMA 1UQYA 3UPWA 1DWGM 1VIZA 3WQPA 2CLHA 3WLRA 3SRFA 2WMKA 2ZTKA 1W91A 1LZOA 4J3SA 3GIQA 1TPDA 4JX4A 1MFVA 1AZ1A 1HO1A 4AZBA 1J2BA 1MUCA 3LTPA 4G7EB 2PTXA 1F6KA 1O7AA 3Q6JA 4LUJA 1WUFA 5A95A 2P88A 1UWTA 4GPNA 4KCWA 2D73A 4E6MA 4GC4A 3F5LA 3WD3A 3DZ1A 1BXNA 2YVFA 1TJ0A 3KL3A 1EC9A 3CQIA 1QW7A 2INEA 1OEPA 2CZEA 2CZVA 4DB7A 4LUTA 3NPWA 1R3QA 4AHOA 2FZ9A 2GOUA 1GOQA 3GH5A 4AZ7A 4A2RA 7XIMA 3R07C 4JXCA 4ZQPA 3EDEA 5HWJA 4PTVA 2Z6IA 1DXLA 2GJRA 4ASTA 4E8DA 3HA1A 3HPAA 2EGZA 4JZ5A 2PA6A 4JOMA 4HZ8A 4JIPA 1PWMA 2INZA 3L9CA 1WOAA 2WJEA 2HNHA 4P7LA 2ZZBA 1KRCC 4K2SA 3BLOA 5B7ZA 4RE0A 2HE5A 2IS7A 1LG1A 5D02A 3BPWA 3E0LA 3WJYA 4C6EA 7PTDA 2WVVA 5IXEA 3OLIA 1AQ0A 1TWIA 5CC6A 3R12A 5MHBA 4MY9A 1LQ0A 3MDWA 4XIAA 1XSKA 3CBWA 3UT0A 3I3DA 3UZJA 4QISA 1DP0A 4IF2A 1JGIA 2HS6A 3GNNA 1ITQA 5D03A 2BVWA 5C9XA 3BVJA 1TV3A 2Y1HA 3NDYA 3ABRA 1VRDA 3M0ZA 1W2PA 1JPHA 3ETRB 2KX9A 3BAKA 1E4NA 1EJWC 1MMFA 3F7JA 3WQDA 4F66A 4EPKA 3CMJA 2QPXA 1DTUA 3UPMA 1PZ2A 4UUIA 4GGHA 4GI8A 3A7AA 2DGAA 1DWIM 1TV8A 2NLYA 3A7UA 4PMXA 1ENUA 3WYZA 1CTNA 3AXHA 3UZ5A 4MZYA 4MWAC 3UGVA 4TXEA 3GS6A 2DSKA 3V3WA 1OIFA 1FP8A 4WZHA 4AG0A 2ADAA 2WOQA 1WKFA 5FESA 1BWLA 5JH2A 1PTGA 4KWVA 1UR2A 1W1TA 3QQ0A 4JPGA 4JHOA 3GXIA 3OO2A 3A47A 5LIUX 1RALA 2OOGA 1UA3A 3W01A 2VX7A 5I07A 3F4WA 4MIMA 3BQ6A 4IMAA 1S2CA 1TVPA 3C56A 1P5BA 3F4VA 1L6GA 4ECLA 5HJLA 2J9ZA 1U5JA 2WNZA 1KFKA 4KEMA 5AC5A 2ZX5A 2DVTA 2VMFA 4DWDA 1ONWA 2H3DA 2V67A 3QSRA 2A3CA 3IGSA 3OLDA 3PG8A 4UTWC 4JTFA 1MO0A 1O68A 2XINA 4A3RA 3DGHA 4TV6A 4FA3A 3L0NA 1NM9A 3CQKA 3FDGA 4RV8A 1UH4A 2VEPA 4QAWA 2VGGA 2XYLA 1UPPA 1K4QA 3NQAA 2PLJA 3NO5A 3GE7A 2QV5A 3I65A 1EB3A 3BAWA 4KEZA 3TWBA 4C6CA 4B9ZA 3MUY1 1J10A 2AOSA 1NIUA 2PDQA 5C9UA 2C1GA 3ZVHB 1YBQB 4PZVA 5G1YA 1Q7MA 3BG3A 1R3VA 4LFYA 3U2EA 2ABAA 2RH9A 2WC3A 4H1ZA 3G22A 4N42A 1VLIA 1S5WA 3MHUA 4ZB2A 1CLKA 2Y5EA 3N9RA 2INFA 5BU6A 1R87A 1S2VA 5DCDA 4YPJA 4O1FA 3E74A 2G8ZA 3WK3A 1MQRA 3LX9A 3GHSA 1GRFA 2VUNA 5JCLA 5HXMA 1NHPA 1XRVA 3AUOA 2OO0A 3ZWTA 3SADA 1SZRA 5AHEA 3OTRA 1NWRA 2OPJA 2OX1A 1OC5A 4Q8TA 5MKGA 4YWOA 1TJ1A 2EJAA 1GZJA 5HPCA 3CLWA 2ZIDA 2YBVA 3MI2A 2GVEA 2F6UA 3H24A 1IR2A 2QJGA 1G4EA 2WJFA 4YVVA 1V97A 3WF4A 3WQEA 4RLIA 2XJ7A 3E96A 3WCZA 5KTLA 3GAYA 3VGBA 4O17A 1NELA 3WF3A 1XLEA 4WJXA 4PTWA 1E3ZA 1VFFA 1YE6A 3QTGA 3EPNA 4RJEA 3EX6A 5HNTA 1B2YA 2TODA 3ARPA 4XZNX 2V3FA 4B2DA 3G1FA 5E93A 2EQ9A 1XCFA 3FW6A 3QW3A 2FGLA 3GFZA 1SQ7A 4HIBA 4UQEA 3BH4A 1LCOA 4AC1X 4PTMA 1SW3A 3DOPA 1A3XA 4WOZA 1XH1A 3B03A 2B4GA 3ZT6A 1Q7QA 4XTIA 1Y5XA 3B97A 4A6GA 1DYSA 1AH3A 3IVTA 1BYCA 3WLTA 2YQUA 4S3AA 1H4PA 1X2GA 2Y24A 3THDA 1NPXA 3SQPA 5F2LA 4Y96A 2NV2A 2ZA2A 3OLGA 1HF6A 1PAMA 2OZ8A 7TAAA 5BWFA 5EMJA 3LQLA 2J8FA 3O2LA 3GR8A 4XB3A 4YVXA 3DKJA 1ZKQA 4R34A 4LCQA 4RW3A 1OCJA 3SCSA 3B9OA 2G4JA 1KXTA 3A12A 2OWXA 2P3ZA 4KESA 3LBMA 3UR7A 3GD4A 1A5MC 4KEVA 1T6MA 2GQ3A 5EBUA 4HCHA 3WEOA 1KM1A 3M0YA 1TX2A 3UJRA 3N6JA 3OYZA 3GG8A 1K9FA 4LYKA 2YVJA 1V8EA 3WLMA 1JZ4A 2IKGA 4KMQA 2XH2A 4LV9A 2GLKA 4J3XA 3LOTA 1WNOA 2DSWA 3DHDA 3CXOA 5LKYA 3IACA 4HTYA 4ZSUA 2UWFA 1GPWA 3CH9A 1QR7A 4XBSA 5CPNA 3K2GA 4DNAA 2B7NA 1EYEA 4JTLA 1TE6A 4E2OA 4Y9AA 1FBAA 4IGSA 4WSJA 1GHSA 2RUSA 3W7JA 3O07A 3RMJA 1XPYA 2QCEA 1W1A1 3THQA 4P8XA 2F2KA 3PTKA 5XINA 4PUDA 1GVYA 1K8XA 5LIKX 1LRTA 5E6ZA 3LCHA 4LH8A 3CQHA 4DPPA 3H2AA 4U31A 1V03A 1JDEA 4O19A 3UD6A 2NT1A 3DAQA 1WYIA 3ZJ8A 1HUVA 3M41A 4DO7A 4DF2A 1DJGA 4PL2A 3W1AA 3CEPA 2J75A 4JTUA 1X6NA 2I57A 2CXEA 4D8AA 4LUTB 3ZLHA 4FHAA 3IAPA 4LC8A 1C7SA 2H6RA 1QU4A 1J8VA 3ARXA 4GIEA 3FGCA 4F3HA 4PCFA 4NF7A 1DKWA 4HA1A 3H2FA 2VXNA 1LBLA 1TFVA 3BAIA 3BSHA 3C61A 2DDXA 1DQWA 4BURA 4LYQA 3GH7A 4TR9A 2GGHA 3NDOA 1E0UA 4KPRA 1JD9A 4E2VA 4L9ZA 1CGUA 1EWEA 1H7NA 2DT0A 4H7VA 1PS9A 2HJPA 1B9BA 2OO6A 1GPFA 4CNNA 2WB5A 2MUCA 1KTNA 2J27A 3WN6A 3DXIA 3NEVA 5I6SA 5I77A 2DQWA 2PC4A 1UWSA 4Q4SA 1C92A 2IPWA 3NVDA 5FSEC 4ZSTA 4QLLA 3RLVA 1TPFA 4OQVA 3TR9A 5AKQA 2WVVB 9XIMA 4GI4A 4CQDA 3ITVA 4XK2A 2V6OA 2ASHA 1GRBA 5JIWA 3APYA 2CFFA 1A5OC 1V0MA 2NV9A 3VA8A 2V2CA 2VR4A 3CGCA 2W67A 3B0UX 1FDYA 1M65A 1KD0A 4LCRA 2CNCA 3W27A 3TKFA 4GR1A 2WM1A 4XKMA 4S38A 2RJHA 4W86A 2OLSA 2ZVIA 3TTEA 1JNDA 1JCMP 1HP5A 1KLZA 4U28A 4QEHA 1RAKA 3RLUA 1SW0A 1F3PA 5F2GA 4H41A 4OFCA 3MJMA 2GDQA 3VCRA 1GOMA 5HMSA 3LPPA 1GYNA 2W6RA 3SCPA 3L66A 5H8UA 5HA7A 1IT8A 2P8CA 1DVJA 4QJ5B 2ZE0A 2V8ZA 3V18A 3UESA 5EBKA 1AODA 1K77A 5FAJA 3O7UA 3CO8A 2FFIA 3M07A 2Q02A 1P4CA 1J6PA 4QM1A 2ZUVA 3QC3A 3AHTA 3N73A 3EMQA 5AC8A 1EQCA 1W6TA 4EM4A 7TIMA 1CXEA 1E6QM 3P80A 1KV8A 5BCAA 3QRHA 1P1MA 4ATLA 4D71A 2R9ZA 1FKXA 4BEQA 1DWFM 1ITXA 2GJPA 5K9CA 4GBDA 3TTSA 3DGBA 3VILA 1T8XA 4DXXA 4TX9A 4UR7A 1AMYA 4FX6M 2ABBA 4WSHA 4ZCWA 2X1UA 1GJWA 3GDKA 3G0XA 1XKJA 1BHGA 2ZRUA 1CGXA 1I2QA 4H9TA 3IJ9A 1RA0A 2QDHA 5JBFA 2ISDA 1K9EA 2FIQA 4I9MA 1GK8A 1YPIA 2V68A 4GO9A 3S3GA 5G4EA 5FS8A 1NP2A 2PU1A 3POCA 3TIMA 1DIDA 4CUCA 5CPMA 1JYVA 3N2MA 4LUIA 2PAJA 4AF0A 4IL0A 5KETA 2W4XA 1QI5A 5AC4A 2OWCA 5KMYA 2DZXA 3MJYA 1T5AA 2I16A 1SYTA 5FF2A 3QKZA 3CV6A 2Q3RA 1MQPA 3ANYA 1GONA 1VHCA 3N13A 3WSUA 3GBDA 3LXAA 2J7GA 1YNPA 3HG4A 1JULA 3K30A 1KGWA 4R53A 3KM8A 3G0SA 3W23A 3CO4A 3NVWB 5HNRA 2O9PA 2BTMA 4H4RA 3RCNA 4S2BA 2W3RA 1MYRA 1CNVA 3Q45A 3R10A 4QCFA 5HWNA 3W3OA 3T78A 2A85A 2WC7A 3CB3A 3S4TA 3TCEA 1VC4A 1G4SA 1DJNA 3K4AA 4IXXA 1HO4A 4MWAA 3SUTA 2F61A 1RJPA 5HANA 3QFAA 1Z7AA 1WKYA 1BG9A 2V82A 1QWKA 4TX8A 4Z2IA 3LERA 1FEAA 4REQA 3VIHA 1EOKA 1ZGDA 2NQJA 1SJCA 4H4VA 1FFVC 2XZ9A 2PFHA 4GI6A 1X96A 4P5UA 3GUWA 3IJ7A 2R1MA 4H8HA 4PH6A 2CEQA 1VFTA 3VGFA 5C9WA 5C54A 4R33A 3FA4A 1E6RA 4HQVA 4FO4A 1A5CA 2ANUA 4J3WA 1QJWA 3IEBA 2CLLA 2XIOA 4C7GA 3VM7A 2WCGA 3VFCA 5CPOA 4C91A 1Q6RA 3CLMA 3HG3A 3E0IA 3TTYA 5LHEA 1XG3A 4C6KA 4QE4A 2G3JA 1XWYA 2DZVA 2ZX6A 4MJ4A 1ME9A 3AHYA 4GIYA 4IOTA 4GFSA 3WUGA 4F2BA 5I3JA 3WJXA 4UTHA 3WG6A 3WH8A 3RYSA 2W92A 1JI2A 1H09A 2PTDA 3H8AA 3QYQA 1K02A 4EK7A 1KRAC 3S2MA 3BMXA 1I0BA 1XR2A 1Z42A 4GQBA 1SFLA 4B15A 1CGVA 2WKJA 2PSNA 4I7UA 2Q8ZA 1Q85A 2YPIA 4Q6XA 4GNVA 2V6AA 1X98A 1ESWA 1UWRA 3CGDA 4O13A 2E1WA 4OOUA 3UFYA 1XANA 2HXUA 3CU2A 2YKKA 4CQBA 4N9DA 1Q6FA 4YN5A 1QK2A 5HINA 5F4WA 3WNLA 2ZXDA 1L6WA 5CZTA 1DV7A 4DUVA 1XQLA 3GY1A 3IUHA 1HFBA 1V7AA 2J7HA 2DORA 4QTGA 3T40A 1X6UA 2UBPC 1JDDA 1FP9A 1LTDA 3E6EA 3CV1A 3B04A 1N55A 1Q6OA 2FTPA 1JD7A 3MSGA 1T41A 3W7NA 3W83A 2QCNA 1RR2A 2OYMA 1GVOA 4GUHA 1C8YA 3SGUA 2DV0A 1ICSA 1GJUA 1KM5A 2Z1KA 4PCPA 5M2FX 3HPXA 2I7GA 3LPOA 3VKDA 3BV4A 3PZNA 1DQXA 3WD4A 2ZZ3A 3OBEA 5FF0A 4EVZA 3AHZA 3NOEA 1OCBA 1X1ZA 4GYKA 4NL1A 2Y8VA 4B91A 1XC4A 2ZUUA 3VD9A 3CIXA 1OVDA 1MZRA 2WMHA 2VZTA 2PDJA 3BARA 3C0LA 4MY8A 5HK4A 4G2DA 3IGHX 4LCSA 3T0CA 3ATZA 2HQMA 2W0HA 4EMJA 3O3RA 3NIYA 1MXGA 3NZRA 3WK2A 1X39A 3DKLA 1ONFA 1TREA 1FCVA 3ZZ1A 3C0QA 3MVIA 5FEWA 1Q2SA 3LHUA 3TYAA 4RE4A 5IDZA 1REQA 2DVUA 1OC7A 4LSBA 2DW6A 2YLAA 3R8HA 3SEPA 8TIMA 5CC3A 5A6BA 5HR6A 2VYOA 3O0FA 1BXBA 4AAJA 3U57A 4ZL1A 3R8RA 3FGCB 3AQUA 3P5YA 4PYSA 3TYDA 3VKCA 2G4FA 1E4IA 2NVKX 4FNRA 1DORA 4RV3A 3BQ5A 1F5ZA 2WSRA 4S3CA 3SUSA 3SAZA 4GQGA 2O9TA 3ZM8A 1EC7A 3DFNA 1MXSA 4O0KA 4AHQA 2ZUWA 1XIDA 3L4TA 5G2IA 4J40A 3ORWA 1TZ9A 3T4WA 3VDHA 4WR3A 3R7MA 3AYTA 1R46A 3AXXA 4BF7A 2Y8KA 1XICA 1EF3A 5RUBA 3GRSA 2FZDA 2FLIA 1Z9AA 5D8WA 3SURA 3BMVA 1JDCA 2QCDA 4XG1A 1LWIA 1THFD 4FF7A 1KR1A 1XLBA 1E1CA 3IGUA 1DIEA 2Z2AA 1Q6GA 3DFPA 2D2GA 4H4ZA 4LBRA 2Z1XA 2QJMA 3OVRA 4HZMA 1W8GA 2VNCA 1J5TA 2GR2A 4PFMA 3NXLA 3Q37A 3W1PA 1TPUA 1WB0A 4HNNA 1F07A 2OGYA 3I7RA 3M5VA 3NPVA 3F1QA 4JQAA 3BAXA 1E6SM 3R79A 3A5FA 3PANA 3R89A 4M82A 3A9IA 1QW9A 3LI1A 3NNTA 3A4AA 3TW6A 4NX5A 1M7JA 1F6YA 1NF7A 1LDCA 4XZHA 4E3VA 1RH9A 3WUBA 3QZAA 2F38A 3LSCA 3BZGA 4CN4A 3DFTA 4NNBA 1X97A 2DU2A 3HJZA 1VJIA 1VEOA 2CDUA 2HNEA 1PKNA 2OR2A 1QPQA 3S5YA 3H70A 3GNDA 1ZMCA 2Y6ZA 3I68A 1J9YA 2PB1A 1RD5A 4RUBA 3PWGA 1POJA 1H11A 4O28A 4H9ZA 4UBPC 1HL2A 1KB3A 1S1RA 3TNOA 5DRIA 5D05A 2VZVA 2IKIA 3CL6A 1E0WA 3MP5A 4US5D 5LNSA 1DOSA 1LG2A 4ZQOA 4IL2A 3PVFA 3MUIA 3IUDA 1EUNA 1HIZA 4QDMA 1VFSA 3T81A 1QI4A 3C4UA 1K03A 1IXOA 1OF8A 1V93A 2VELA 3UWZA 2WCAA 3P3BA 3RHGA 1VQTA 3UG4A 3PUOA 3RM8A 1W5MA 4HPHA 5FS9A 5GNXA 2P8BA 2W27A 4WHBA 2P50A 3DECA 4I9AA 5HQMA 4TVDA 3KE0A 2D2JA 2WNNA 4DZIA 1IXNA 4LVBA 2RGLA 4AF0B 1UCWA 2XM2A 4UTTC 3KBWA 2PC8A 2QLYA 3GBEA 4S3JA 3VX0A 3G1HA 1P6CA 4WUIA 5A6MA 2EXOA 3AIQA 1Z41A 4DZAA 1R2TA 4HMEA 4O1BA 4DAFA 3PBVA 2PGFA 2GL5A 4AXKA 4DXVA 1OB0A 2QW5A 2ZZ1A 5I03A 2HRWA 3FKKA 4BF5A 2XIJA 1IZJA 5FAGA 2FB3A 3UA4A 4NZFA 1K8CA 3LCLA 1V0LA 1RCOB 2DIKA 3THAA 4Z0JA 4MWAB 3L4VA 3NQ6A 5CLWA 2E4TA 5ABFA 1DHPA 5G1TA 4HSNA 4AWSA 2JF6A 3AIWA 1OFEA 1E1EA 1GKPA 1VEPA 1OFQA 2QF8A 3WMSA 4REQB 4B2DD 2QGYA 5FL0A 1HGYA 1V6WA 3VZXA 2QEZA 3GXNA 1AL8A 2X1RA 4BQ2A 2C8NA 2WSYA 4Q8WA 3VZZA 5SWUA 1JZ8A 1Q6QA 2CCRA 1JCYA 4HNUA 4NZ3A 3HOJA 5IBXC 5JBDA 1W54A 1OM0A 3MO4A 4ZE5A 3A6OA 1H61A 1FFQA 4GVGA 3W2KA 1PBGA 4JTQA 4I3GA 4WCJA 1U1JA 1E6ZA 3QPZA 4GY0A 3KCJA 4G6CA 1J18A 5D9NA 3GVQA 3PULA 4G8TA 3RCYA 3WH7A 3ARSA 3WQOA 4IIHA 4K8HA 2PEVA 3KUMA 5DEZA 4ZO8A 2QT3A 3AIRA 2GFTA 4J7RA 3SR7A 2ONEA 3WL0A 3LENA 1FCQA 4XKYA 4NJKA 4D2JA 1NTHA 4JTDA 4HP5A 2NQ9A 1N5WC 2G3IA 3C2VA 3WKZA 3I7QA 4AYGA 4PCSA 5I02A 1ZP4A 5A6KA 2QJNA 3VNIA 2QUMA 1KM6A 1V7YA 2YA0A 2X8RA 1JYXA 3P60A 3O16A 3D47A 3L4ZA 3P74A 1NWUA 4J35A 3T2QA 5E9XA 1XL9A 9XIAA 1Q5MA 1J11A 3W22A 1LL7A 3QKEA 3EB2A 5K3VA 3W1TA 4JEQA 3M0MA 5A2BA 5AVNA 2WBGA 4NJHA 5KSWA 3W1NA 4NXKA 2Y7DA 3CYJA 3R94A 1I8JA 3D9XA 3FA5A 3L2IA 4O8RA 1RVGA 4GLEA 3SCQA 3GIPA 5FD0A 1CXIA 4Z2LA 3VE7A 3QQWA 2VKZG 3HG2A 3QFEA 1OK4A 5DCBA 3F4CA 4DRSA 2WAGA 3E0VA 1H49A 1QNVA 5D38A 5TQLA 3RM4A 1JL8A 2FVMA 1GKQA 3CT2A 2AQVA 3XISA 1LOSA 3QH2A 3PFRA 4I6KA 1F76A 3JZUA 3VGDA 3TR2A 3CMFA 1HVQA 4GXPA 4L9YA 2ZXBA 2YCKX 2Y4SA 5CSSA 1PVNA 2EF9A 1F3WA 1TV2A 1VHNA 2TYSA 2VGIA 4CGTA 3S6DA 4L6OA 4U4MA 3LEPA 2C91A 3PTQA 1V6TA 1TMHA 2C3CA 3VOHA 2WV8A 1BWKA 3K5XA 5J5DA 3OP2A 3JW7A 1YDVA 1AUSL 1KRMA 1OZQA 3GFYA 4MAVA 4CNSA 1BRLA 1WX0A 3LHVA 2X8CA 5AYZA 3BCFA 3PN8A 1W9VA 1GRAA 3RILA 4GYPC 2A4AA 3PNZA 1XJBA 4AD1A 1QRQA 5ECVA 1V6YA 1FWFC 4FXJA 4PMOA 4X9SA 5FIPA 2WP6A 4HNCA 1FWTA 2IPFA 3LZ5A 3BLFA 4URIA 1RQEA 4U2ZA 3GW0A 1NP0A 3W7LA 3HF3A 4JICA 4E8CA 3H2EA 4AZHA 4J3UA 1REQB 1X6LA 4XUYA 3QC0A 1KFWA 4B5TA 3W07A 3W88A 3VABA 3KOYA 4DF1A 4BA0A 2QR6A 3WFZA 3L5AA 3UXKA 1XIBA 2EKCA 3AMGA 3VNLA 4IIEA 4JX6A 4WDWA 4XVEA 2GSHA 1PHWA 4FLQA 1RHCA 3KZPA 4Q3MA 3UXLA 1A5NC 4GFIA 4S3BA 3WUFA 4MAZA 1TJRA 1H7WA 5GRTA 3EBVA 2PP3A 5CC5A 3B8IA 5G1MA 3UP8A 1W9UA 3EMZA 2YR1A 1EO7A 4S3DA 2WOIA 1V0KA 1W3NA 2EJ1A 2QXWA 4N4PA 3K8LA 2JQXA 4JBRA 4KWUA 2GGJA 2H9AA 1XIIA 2XN0A 1EZ2A 4AVFA 4AW7A 3QEZA 4B5WA 1SR9A 5I24A 4WXZA 3W7MA 5E0KA 2CXGA 3MANA 2QCDB 3OBAA 4QLJA 1W3KA 5C9RA 5M5DA 2WVSA 1GWJA 3S1WA 4HPNA 1AW1A 3T09A 4DWSA 1M6JA 1QPKA 4KW2A 3KWXA 3MKCA 5GNZA 3ATYA 4ZOBA 3SSZA 4RDVA 5LNVA 2ZC8A 5C6MA 1X8CA 2X41A 4LJ3A 3KL5A 3OG2A 3MT1A 4I6VA 5AHIA 1P7TA 2WK2A 4RZBA 2QCCA 3DENA 1UD8A 3H54A 3RG6A 2CESA 2GWNA 1A3HA 2WVTA 1V3LA 3E5PA 4AD0A 3W7OA 5ABHA 3VD4A 3TN4A 3L7RA 2R94A 1UH2A 1I45A 5EYWA 3NQVA 1E0VA 1EJSC 5TIMA 3LBCA 2ZRZA 2UY4A 1JCLA 3P61A 2FYMA 2OQLA 4O15A 4I9JA 2X05A 1TRIA 1O5QA 1D7FA 2QQ6A 2IKJA 4DZ5A 4IWWA 3N3TA 3QV6A 3QYSA 4TO8A 3ZVIA 3LN3A 1SZGA 3QLLA 2X99A 1E40A 3EB4A 1EJVC 3O06A 3RO8A 3W7KA 1TYPA 3EAUA 1VPYA 3V75A 4N6FA 4M51A 3HFTA 1WDQA 2E5AA 4CU8A 4JTSA 2XDFA 3NURA 1VD6A 4EX4A 3GSMA 1TIMA 4ZQCA 4D8ZA 2A3HA 1ZHAA 1AMKA 2A79A 1QHZA 2O7SA 5IHRA 4MWAE 2VR2A 3PBUA 4NZJA 3CWOX 3M7WA 5JU6A 1XD0A 2HS8A 3SFWA 2RDWA 2WBAA 3ITTA 3KZSA 3MPGA 1SPQA 2PP1A 1QHOA 1SMDA 2QCGA 4WX2A 3ZJ6A 2YYTA 5G4HC 1UR9A 2L5HA 2WMJA 4FOJA 4IHCA 3MZ2A 2VCCA 3GYEA 2QUTA 5FA5A 1DEDA 1CLVA 4DLFA 3EWCA 1ICPA 4IFOA 3KLKA 1F4HA 9CGTA 3L68A 4NZCA 2DVXA 1US2A 5U7SA 4R7WA 1TKKA 2W0UA 1XBVA 3FXYA 1OFBA 2VCBA 2YL5A 1SGJA 4ADWA 3GU9A 2VRQA 1PX8A 1M3UA 2PRMA 2DUAA 2WHKA 5CG7A 3VDBA 3PTDA 3UJSA 4IQDA 5FOOA 3UZXA 4AQLA 2A3LA 1GYMA 3G6LA 1CENA 3TN5A 3KBMA 3WELA 1VCVA 2PD9A 1TQXA 4Q8VA 4GY1A 4ZQNA 1CXKA 2R9RA 2JIWA 3W00A 2FJUB 1C9WA 2WZHA 5KZDA 4L4MA 5G5GB 3T8LA 3LBOA 3KOXA 1R3WA 2ZUSA 3L4YA 3NDZA 4GYJA 3WJZA 1UKOA 3IC9A 4HK6A 3WQCA 3QPYA 4NSBA 3AXKA 1WDDA 2CZ5A 2X2GA 3GTIA 3UWEA 4H8VA 3LXDA 2X09A 4Q8QA 2JE8A 5G5IA 1US0A 4E2BA 3C86A 2BXVA 5LHFA 2EAWA 3W73A 2CW6A 4CNUA 3S46A 3VMPA 2X1TA 4IQEA 1RK6A 2PLCA 1F9CA 1XFBA 4Y9NA 3QOMA 4KQNA 4F0HA 1UWIA 1ZRQA 2D22A 3MUCA 3SCRA 3BLLA 2FJKA 1BTMA 1DJQA 3NL3A 3B9EA 3I6TA 1WO2A 3E5BA 3UR8A 1OWQA 3HFYA 3ISIX 4N0RA 1BFNA 3BLEA 3AN1A 1AW2A 3URBA 3JS3A 3OQ8A 4CCDA 3W1MA 3W76A 1TYTA 3TVAA 5C2CA 3VPLA 3K1DA 4K7VA 1HKMA 3PS7A 3MMTA 4CCZA 2YXXA 1W1ZA 1TRDA 4XKYB 3MS8A 4H4XA 3GRIA 1EIBA 2BLEA 2VX6A 3DHUA 2YBUA 3KRSA 3T9PA 2E9LA 3MZNA 4IUGA 3UGRA 1V3JA 3ARYA 5I78A 1PZ3A 1YDYA 1YTKA 3G8RA 2W54A 2HK0A 3PUDA 6ENLA 4JDBA 1NDWA 1QTWA 3SUWA 1FHDA 4LA1A 2DJXA 2OT1A 2XFFA 3S2JA 2KAUC 4PBFA 1TV7A 3BURA 1QCWA 2FVKA 3CQ0A 2WNQA 3EX1A 1B30A 1UOZA 3DK9A 2CHOA 2CBVA 4MLRA 1LLWA 1IGSA 2OZTA 1LWHA 2J4GA 1RM6B 1ODZA 3TJXA 4ZOCA 4ZFMA 3IPWA 2C0HA 4GQRA 4O18A 3GQYA 1LWJA 1R3YA 1KW1A 4M6PA 5J04A 4INFA 3HJEA 1KV5A 4OE7A 6TAAA 1N82A 3CUXA 3QR3A 2QAPA 3SJ3A 1NY1A 3R11A 1OX4A 2VL4A 4IJCA 1RSCA 3M47A 3LI0A 5DFAA 3KOWA 3N2BA 1JEZA 1YDNA 2XVNA 1R9YA 2B0MA 1US3A 2BY1A 4DJEA 2PS2A 1IT0A 1JUKA 4PEEA 4NZ5A 3TW9A 1BSLA 1S5TA 3UQNA 4UQAA 1R85A 2ISVA 4FX8A 2ZVRA 1G1YA 3W1XA 2CBJA 2Z1SA 4MJMA 2V3DA 3H4XA 3TYBA 3GAKA 5EB8A 5A6BD 2V38A 1BRLB 3URNA 2Z1VA 3IJIA 1G4TA 2BVDA 4RNFA 3SZ8A 3C2FA 3AU2A 4GNJA 4JTJA 3UZWA 2DH2A 4M24A 1EIXA 5CGQA 4M7SA 3TXZA 3PF3A 4PMZA 1FO4A 4FLOA 2G41A 1XISA 5DMNA 1FWWA 4DO6A 4PBEA 4PMDA 2D23A 5ENLA 3AYVA 2GGIA 2HK1A 5CPSA 2PWHA 3NSXA 3GKFA 4O0QA 1SFSA 2XGBA 2Z1BA 2Q09A 3R5EA 1R3RA 4WQ6A 3DERA 4AYSA 8CGTA 2EPKX 2VFIA 2BC1A 1XX1A 3OBKA 4Y6GA 3O6AA 4I5RA 3BAJA 4JTTA 1XCWA 3FEQA 2YSWA 1QOPA 4UR9A 5HWMA 3NS1B 1E55A 2EQ7A 3OZYA 4QE5A 4GI9A 4NJIA 1ZUAX 1FDJA 4D6GA 5ECUA 5LXEA 1I9CB 1P43A 2ZE3A 1IIGA 3M46A 1KCLA 2X30A 1AQFA 1E9ZB 3U2CA 1STZA 1GORA 3RAOA 3K13A 2YW4A 4GCXA 5DMMA 1E9YB 2TMDA 2ZZ2A 4W88A 2PF8A 1HJWA 2TAAA 1M6IA 4A2SA 3W84A 1B31A 1O95A 2PRHA 4DWSB 4Q32A 1LRQA 2DZSA 2ZYFA 2FH8A 5TD4A 1H2JA 2Y63A 2E5CA 5LIYX 4GYPA 4UNIA 1OCQA 4V15A 4IUOA 4XBJA 1N60C 3G1RA 3TA9A 5HNNA 5D37A 3AXIA 4ZQMA 1P7TB 3LA4A 5H8PA 2QUVA 1EGVA 2WMFA 3IGXA 3ZXWA 3T4CA 3P93A 3ES8A 4YIWA 5A3HA 1OX5A 3WD0A 1XDMA 1RY0A 3BAYA 2ACRA 1M04A 4KF1A 1VYSX 3TONA 1KBJA 6XIMA 7ENLA 4R3UA 4OTKA 2WQPA 3VKKA 3A3WA 5A8QA 4XX6A 4FS9A 3PC0A 4W87A 3RN6A 1KCKA 1PDZA 3MU7A 3B9AA 4F8XA 1EBDA 3EXRA 5F1VA 4DXKA 1WUEA 2MNRA 3N34A 2NW0A 2QGHA 3A22A 4UZSA 3W86A 2VX4A 4XQ6A 2YA1A 2YAUA 2GSJA 4P61A 1KNWA 4MKSA 3W72A 4UQ9A 4LB3A 4WKAA 3Q67A 5EMYA 3M7SA 2DZPA 4IG2B 2OODA 4QS5A 5BXTA 2ZUNA 1UZDA 4KRUA 3WZ0E 4HCLA 3KS5A 2QDGA 3MUZ1 4FXSA 2ACQA 4JHZA 2JGQA 1TB3A 4AB4A 4UOQA 2XH0A 4LY4A 2E3TA 2XUCA 3GO2A 2GQWA 2J6XA 4AZ6A 4MOZA 4A3UA 1AZ2A 4S1FA 2IMRA 1FH8A 2XFWA 1V79A 3ELFA 4H3DA 3FSUA 1TELA 3SJNA 1NOUA 1TV4A 2OEMA 4JYDA 3SW6A 5LA2A 3DC0A 1KR0A 5A8OA 3KEHA 3EZ4A 4HHPA 1ZJIA 4IGNA 3IJDA 1E43A 8A3HA 3VVGA 4AY1A 3PJUA 1UZ4A 1SJBA 3STGA 2A1YA 1RPXA 5CSRA 4MMWA 3NGFA 2V3AA 5CQ1A 1ZBCA 2F7FA 1GVIA 3VKBA 3FVMA 4JYEA 4C5YA 4TU1A 4H83A 3G1YA 4C1LA 1NU5A 2XHYA 4UNKA 3H4KA 3BLIA 3QBUA 1S3HA 5U25A 4FI4A 2VFHA 1VR6A 2YFOA 3TCSA 4Q4RA 2YCIX 2VVSA 4H4WA 3WDHA 1ONRA 3AZRA 3AROA 4B3LA 4WXYA 2D0FA 4D6HA 2NSXA 2Y5JA 4J2MA 4WKFA 1UR3M 2UY5A 3BWWA 3STCA 1S39A 4PTDA 4C7FA 5ER0A 1E71M 3ZSSA 2ZQ0A 1P48A 1DTNA 2DEPA 5H91A 1XYZA 1M53A 2FHFA 3TOPA 1YXYA 2NT0A 2OKTA 1R30A 1YLVA 1GTHA 3NVZB 4Q33A 4JAWA 3B0XA 5D9OA 4KH2A 4IMDA 1NVMA 3BZJA 4ENLA 3E2SA 2PGRA 4LRTA 4S23A 3LADA 3L4XA 5CBIA 2VQUA 3G3DA 4I7VA 1FWSA 4RNJA 1FWEC 3VD7A 2OG9A 2J66A 3SUUA 2PDWA 4HPXA 4B5XA 3GDRA 2P3EA 3KWSA 1IEVA 2OMAA 1YE4A 3BLKA 2E09A 3AHVA 2YW3A 1TMQA 1CECA 4S2CA 1Q65A 2WP5A 1WPCA 2A6LA 2GQAA 3L0KA 3BO9A 3C5QA 4IFKA 5A6TC 2G95A 2XWEA 1XBYA 3LXBA 3HW2A 1M7OA 1O60A 1O4UA 2XM1A 4W5ZA 4FDCB 1ZQ5A 3RK8A 2BY0A 2Q3OA 2NPXA 4LAMA 1VFMA 4LW7A 4NZ4A 3G1AA 5A6SA 1Q8JA 4IP7A 4M56A 2C14A 4C6QA 4OUIA 3KW3A 5I79A 5B80A 3B8SA 4RNIA 3W25A 2ZADA 3UPBA 2DSVA 1YRRA 4AMAA 2EHHA 4S3EA 3GK0A 5TNVA 1TA3B 3TJIA 1C8XA 1FCUA 4DY1A 4ZB5A 2EG7A 3SN1A 1ITUA 1C90A 3MUXA 3INPA 4L6HA 3FV9A 3IIXA 2F6KA 3W7IA 1W3HA 3TQ0A 2CU0A 3FNDA 4C6OA 4OIFA 3AS3A 4ATDA 1D7YA 2XFYA 4HT3A 3GNOA 3W0KA 4JY9A 1B0IA 3GYCA 1G67A 1UWUA 3GHRA 3U4AA 2XISA 3WMBA 2VDHA 2CZFA 2WZMA 3CZ8A 3LHTA 1I2OA 3GTHA 4ZENA 1KN0A 1H7PA 4K68A 2GVYA 2UZ9A 4YU1A 2YB4A 3S6TA 5KVIA 3VTRA 3ZT5A 3S8HA 1R0MA 3MI6A 1RY8A 3EPMA 2IPGA 4YHGA 3RNMA 3DFQA 3FA3A 1X1NA 2WLYA 1QNRA 1GREA 1OX4B 2BVYA 3MA8A 4XAYA 1QNOA 3TSBA 1XW8A 4FF5A 1H1NA 1R3TA 4GQ0A 3ARWA 1F61A 4Q4KA 1DL3A 3VNJA 3LLFA 4UCGA 3F4NA 1VIWA 5F4XA 4X2PA 4PRWA 3XIMA 2EPOA 5JVLA 4PUKA 3UBPC 2PBOA 4C6IA 1NOWA 3V5CA 3FX4A 4ZVJA 1VENA 4B92A 1IXPA 1FDZA 2JKAA 3QHMA 1OIMA 3UVAA 4W5UA 1FWBC 1HKJA 1NOFA 3M6YA 2PDNA 1WQ5A 3R1ZA 3UJEA 1Y65A 1OY0A 4P8VA 2WPGA 1MXDA 3GWQA 1IEQA 1XYMA 3GFXA 1QPOA 3ANUA 1B3VA 4BQ4A 3R2GA 4H4PA 1EJTC 4FSAA 2ISSA 4N9EA 3VI2A 3HQNA 3WQFA 1SR0A 3CEUA 3KP0A 4CNOA 4I5XA 3TXVA 3V4BA 3LZ3A 3QQ1A 3SECA 5DX7A 4S3GA 4KBXA 3TOYA 1UJQA 4KWOA 2B81A 3WL1A 1OGBA 3GHUA 5KEZA 2GUBA 1XYBA 3VOFA 3PZQA 1JG9A 1TPEA 1F3XA 1Q4NX 2HBVA 4MY1A 1QI0A 3H7VA 3QMSA 2WPEA 3TN3A 3MO7A 4GVFA 4PA8A 1MI3A 2NV1A 5FF7A 4YL2A 1E0XA 4DWSD 5BRPA 4D9PA 5LNWA 1EPXA 3GIYA 1AJ0A 3G1VA 5LGXA 3TU9A 1TWZA 1E3XA 1EDQA 5ABEA 3ARTA 3HQOA 1XS2A 3A3HA 3RRXA 4WD0A 1E0TA 4B4HA 1S7MA 2BOGX 3EOOA 2XG9A 3AO0A 3WBWA 3LS9A 1SSGA 3NZPA 2NSOA 5C70A 3JU2A 1QOQA 1E51A 2PLMA 4HPGA 5EMUA 1J6OA 3A7RA 5AYIA 1QW8A 4X9YA 4ACZA 2QYGA 2CIPA 3GXPA 3J7HA 4JFWA 1GCYA 1H5VA 2OX4A 1R38A 1RCQA 3MCOA 2OU4A 3C3UA 3ONCA 3LM3A 5EMMA 3FJ4A 4HZ7A 3ZR6A 3OZOA 3EX3A 2CLIA 4AXNA 3KBJA 3CPGA 4GKTA 1W1VA 2GQ9A 1R9ZA 3GR4A 1NF0A 2NUWA 5TAOA 1GVSA 3KBNA 1GW9A 4JTGA 2XH4A 1Z89A 5JBEA 1WP6A 1AH4A 1YXDA 3L5MA 9RUBA 3G1SA 1I1XA 4FEZA 3SIMA 1OCNA 2I9UA 3EA2A 3HM7A 5PTDA 3W1LA 4AX6A 1PV8A 4TV5A 2VZUA 1B5TA 4PC8A 3F2DA 1G94A 4KIEA 1WKDA 1WXJA 3KCLA 1GSNA 4NAEA 3MP4A 5HPOA 4J2PA 3WD1A 3T05A 5HMDA 2TSYA 4UQCA 3F2CA 3AS1A 4J56A 2PWVA 3GZ3A 4H4YA 3W02A 4GZEA 4LS2A 1BYAA 2P0OA 1I60A 3UJ2A 1JAKA 4TTGA 4AZGA 1CXLA 4EAYA 4FAMA 2SFPA 1IYXA 1UG6A 3MYPA 3PPFA 4R5EA 2Y89A 2Q6ZA 1PYMA 4YTRA 2HV5A 4IQLA 3W87A 1OHLA 4V2XA 3W1RA 4NKCA 1E72M 1ITCA 3O9NA 3DG7A 4A3QA 1A3WA 3G77A 3RCMA 1X7IA 4ES4A 4JKKA 3ALFA 1GOWA 1V08A 2ISFA 3VXGA 2C0AA 2Z1WA 3VZYA 3PZGA 2GVJA 3PWAA 3DGRA 3SRHA 5CZKA 2WZTA 2GWGA 4GIRA 1A80A 1Z44A 1FHVA 5JMUA 1KKRA 2HQAA 1LL4A 4GGBA 4ZTXA 4XISA 2VDGA 3M43A 1SFJA 1KWKA 2OOFA 4RZ6A 3CMGA 5CGTA 2PDBA 4BZYA 4OBTA 1Z6KA 1GVEA 2HTMA 3W2NA 4RPQA 3AU6A 3PB2A 3P81A 1QVBA 2CLMA 4BFAA 1A0DA 2R6OA 2DZTA 4LC6A 4JFSA 4JTIA 2VR5A 3UCQA 3GM8A 4HNLA 3TWAA 1FECA 3UXIA 4GHRA 3NPUA 4FXFA 1VFUA 4JTRA 1RP8A 2ZTJA 3U6WA 4M6VA 4UC5A 4HMDA 4F0LA 2BY3A 1E6PA 1J0JA 1GGOA 2V3GA 2GZXA 4Z2JA 2D2OA 1VZWA 3CV2A 3KFTA 2YGYA 1OG6A 3VMNA 4WIWA 4DM2A 4A21A 3ZS4A 2X0SA 2J25A 3PM6A 1PIIA 3LDVA 2I1OA 4FP1A 5HMFA 1Q1RA 5M3WA 4LU0A 1A53A 1O1HA 1GEUA 3VC6A 3UF9A 2E8YA 1RK5A 4H00A 1S2UA 2PDLA 3IRSA 3G1DA 4JFVA 4ZZ9A 3RJXA 4BS0A 2E40A 1S2WA 1NHSA 5A6LA 4OGZA 4TIMA 2OEKA 4GKLA 4GZJA 3RJYA 5TF0A 3NAVA 2R1PA 3NGJA 4GJ1A 4EOUA 1R47A 1ZK7A 2PWEA