4KT2A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
404
structure length
384
Chain Sequence
SLKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and glycerol
rcsb
source organism Chromohalobacter salexigens
molecule tags Hydrolase
molecule keywords D-mannonate dehydratase
total genus 150
structure length 384
sequence length 404
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2013-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4kt2A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4kt2A01
4K2SA 3R11A 2OLAA 3DGBA 2XH4A 3I4KA 3DG7A 4IL2A 4GYPC 3CXOA 2QJJA 2OZ3A 3MWCA 2QJNA 2GL5A 2PP0A 3OPSA 3QKEA 2OQHA 3U9IA 3MQTA 3NO1A 2AKMA 1KCZA 3K1GA 4K1WA 2PTYA 3FVDA 1PDYA 3DDMA 4JN7A 2QDDA 4M0XA 4KT2A 3OTRA 3DG6A 3R0KA 4H83A 2OZ8A 2HZGA 3N6JA 2RDXA 3H70A 4E5TA 3UJRA 1BKHA 2QDEA 1EC7A 4HPNA 4Z1YA 3ZLFA 2PTZA 4HYRA 2P8CA 2P8BA 4HNLA 3IJQA 2ZC8A 2QQ6A 2ZADA 2GGIA 7ENLA 3ENLA 3UJEA 3H12A 3CAWA 3U4FA 3VC5A 5EU9A 1SJAA 4ROPA 2HXUA 2PPGA 3OZYA 4FI4A 3JW7A 3I6TA 3TQPA 1OEPA 2GGEA 2P3ZA 3GC2A 1ELSA 3CB3A 3MKCA 3T4WA 3TJ4A 5J04A 1WUEA 2XSXA 3D46A 4IP5A 3JVAA 4H19A 2QGYA 4IZGA 3FV9A 3T8QA 3QTPA 4JN8A 1WUFA 3TOYA 3UCDA 5BOEA 4K8GA 3DIPA 3UGVA 5FJTA 4HCDA 3ZVHB 4MMWA 2AL1A 3SQSA 3T9PA 3TWBA 2PCEA 2ONEA 3TJIA 3TTEA 2DW6A 4H2HA 2AKZA 2PTWA 1SJBA 4GGBA 4FP1A 3QN3A 1EC8A 4GFIA 4EWJA 1EBGA 1XS2A 4E4FA 3N6HA 3DFHA 2CHRA 6ENLA 2PA6A 3VCNA 1SJDA 2P88A 3DESA 4A6GA 1NELA 3R10A 2DW7A 3MSYA 1YEYA 1SJCA 1E9IA 3FCPA 2QVHA 2OO6A 1W6TA 1NU5A 3OZMA 3TCSA 2POZA 2XH7A 4GYPA 4DX3A 1PDZA 3V5FA 2HNEA 2PSNA 2PMQA 3VC6A 3ZVIA 5FJOA 2MNRA 2AL2B 2OKTA 1JPMA 2MUCA 3NXLA 3UJFA 3ES8A 3BJSA 2XGZA 1JCTA 3SN4A 4G8TA 2PGWA 3PFRA 2OVLA 3TWAA 1TKKA 3DFYA 3ES7A 2PS2A 2GDQA 3RR1A 3VCCA 3RITA 4GIRA 2PU0A 1DTNA 3B97A 1P48A 4ENLA 3JZUA 3R25A 2PP3A 3CK5A 3TW9A 1F9CA 3ZVHA 3H8AA 1MDRA 2OFJA 2AL2A 3T6CA 3R1ZA 1R6WA 3GO2A 3VFCA 1KKRA 1RVKA 2GGJA 2GSHA 2OPJA 4GMEA 3NFUA 4Z17A 4ZA0A 1FHUA 3V4BA 2OX4A 3OP2A 3ZLHA 3CT2A 3OW1A 2OG9A 3RRAA 3P3BA 3QPEA 3STPA 3N4FA 4MGGA 3SN1A 4DXKA 2PGEA 5FJPA 1TZZA 1P43A 4KWSA 5BOFA 3SJNA 3RCYA 2OQYA 1ECQA 4JHMA 4YWSA 3S47A 4E6MA 3R0UA 3BSMA 3CYJA 3UJSA 1L8PA 3V5CA 3V3WA 4KEMA 1MRAA 3NZGA 3FYYA 4HN8A 3D47A 1XPYA 3PWGA 4KPLA 4E4UA 1ONEA 4GGHA 3SN0A 3H7VA 1IYXA 1FHVA 1JDFA 3SSZA 4A35A 3UXLA 4ZCWA 3S5SA 3IJLA 3FJ4A 1MNSA 4MKSA 3DERA 4HNCA 1EBHA 4IHCA 3EEZA 1TE6A 3QLDA 3KUMA 3P0WA 3PK7A 3RO6A 1EC9A 2QJMA 2PU1A 4DYEA 1MUCA 4H1ZA 4E8GA 4DHGA 2GGHA 3SBFA 4GISA 5FJUA 2PP1A 2NQLA 3DG3A 3MY9A 5ENLA 3P93A 2FKPA 4M6UA 1KKOA 3I6EA 5IDZA 4G7FA 4J1OA 3RGTA 3THUA 1KD0A 4IL0A 3UXKA 2PTXA 4HCLA 3ZLGA 2FYMA 3BOXA 3GD6A 3UCCA 4IT1A 2HXTA 4HCHA 4X2PA 2OZTA 3MZNA 2P0IA 1JPDX 3IJIA 4IP4A 3UJ2A 3VA8A 3FXGA 4J3ZA 3PWIA 4DN1A 1MDLA 2O56A 3HPFA 1R0MA 4DWDA 3GY1A 5FJRA 3N4EA 3MUCA 3DEQA 4A3RA 3VDGA 3EKGA 3Q4DA 1BQGA 3IK4A 2XH0A 2GGGA 2PODA 3Q45A 2I5QA 4F4RA 2XH2A
chains in the Genus database with same CATH superfamily
3CB8A 2OLAA 2ZZ5A 3KE0A 3GG1A 1JF6A 4ORIA 3L66A 2O92A 1FA2A 1KO0A 3HPAA 3O6DA 2JKEA 2WMFA 3U5UA 1XYFA 1XLLA 1IWPA 2JKPA 2Y24A 3RX4A 4QDMA 3TH6A 2DUZA 4NNAA 1OADA 4O54A 3UZWA 3LMYA 4K1WA 1H63A 1N63C 1T5AA 3T2OA 3H2MA 1KNWA 1HKJA 1Q6RA 1HG3A 4MZYA 3L2IA 3GR7A 5BYWA 3WLNA 3N1AA 2BVYA 2WPBA 1DJGA 2WZHA 4F40A 7REQB 3H55A 4D8AA 1PBGA 4FNQA 4Y9PA 1XPGA 3CMFA 1E9YB 4TVDA 1PYFA 3WNNA 1VH7A 1GRHA 4XO7A 4WR3A 2YQUA 6REQA 4YVVA 4PB4A 3N9RA 3AIVA 5CPQA 3GFXA 3WLTA 2A3EA 1RY0A 1DEDA 3FOKA 4US5A 2GR3A 4A8LA 1SO5A 3W1XA 3P82A 2Q71A 1WKYA 2YLAA 2WMGA 1EJWC 3C6CA 3GNPA 3R79A 3T0BA 3WLJA 2ODOA 3CNYA 3QPZA 6TIMA 1J9YA 3PPGA 4AB4A 1R7AA 1HVXA 4O1AA 1C8QA 3KRSA 4U28A 2A85A 3AIRA 3VPLA 3EA1A 1GW9A 2VC6A 3FV9A 3W7GA 1LDCA 4Z42C 4DVOA 2WV8A 1DHKA 2I5IA 3UWWA 3H4WA 4K8GA 1HJVA 1TFVA 3ZOAA 1I8JA 4E4PA 5HK4A 2AQOA 1P6BA 2WLYA 1RY8A 2QCNA 3SQSA 2ZRYA 1NFBA 3KL0A 3GFZA 1MVYA 3GBEA 3T78A 1OBAA 1PHQA 3KP0A 1ONFA 3WQCA 1QPQA 1BF2A 5CZJA 3BLEA 4UMBA 3LENA 4E4FA 5LIKX 3G3DA 2X1SA 4ZE4A 2OLHA 4PMVA 2W61A 4JX6A 1ZP4A 1N8IA 2PC8A 5U25A 1OB0A 2PA6A 3PBMA 4MWAE 3VCNA 4LWWA 2EKGA 2WC7A 4XZBA 5KZEA 4ICMA 3IRDA 1BEUA 1VPQA 2EG8A 3SDOA 6PTDA 5CSYA 4YXGA 3AU6A 3TKFA 3IGSA 3W6YA 3RNMA 3UY7A 3LADA 1FVPA 4CNUA 3BGAA 4OBTA 1SGJA 4PB5A 1PSCA 5BXPA 3ES8A 1GYNA 3NQ7A 2F6UA 3P0XA 2VVSA 4C7GA 2OZ0A 3HGRA 2O9RA 1VYRA 2IQ0A 3ES7A 2GDQA 3S9ZA 2ZRXA 4ALDA 2G3JA 1HGWA 3MUXA 2E1DA 1QU4A 2H8XA 4ADWA 4BQ4A 2C0AA 1QXLA 4LSBA 1YKWA 5DF0A 3C86A 5E0CA 1NDVA 1UR0A 2FVLA 3WUEA 3Q94A 5FMHA 3ZO9A 3JR2A 1X8CA 4JDYA 1W2PA 1WOAA 3O1NA 4XD4A 3NG3A 5HNNA 5DMYA 2XVNA 1TV5A 3CZLA 4ERGA 3N9KA 3QV9A 2GVYA 3D0CA 3T0CA 5C7HA 1SR0A 2XPKA 1FFVC 6ALDA 4GJJA 4B3ZA 2QIIA 2PDWA 3MI2A 5C71A 3P84A 1DJWA 3TIMA 4RPQA 5CEWA 2FDMA 4IGNA 5C2GA 3REQA 5C9ZA 1EP2A 3ABZA 3A6OA 4L1GA 1YTDA 4O11A 1XRVA 5DMMA 1OT2A 1HJSA 2NQHA 1IQ8A 4H8VA 4AW7A 2O7SA 2J13A 7TAAA 2QT3A 1PEZA 4FLRA 2EPKX 3KRUA 5HDRA 2FDSA 3QR0A 4N9BA 3CWNA 4NJKA 1QK2A 3QV8A 1FXPA 2P0OA 4HBKA 1RQHA 1QPOA 3KTXA 1ONEA 3SN0A 2FGLA 3S5YA 4FDCB 4KESA 4HA4A 4W4QA 3QF0A 4W9TA 1QAPA 3BG5A 1KQYA 3E0WA 1JQVA 1DE5A 2Y2WA 4XVEA 1RBAA 3A5FA 4EK7A 5DQPA 3DERA 4NEVA 2CU0A 5D9PA 3WBWA 2E68A 1IT0A 2HWGA 4CNNA 3EYPA 5ABEA 2W5FA 4WIWA 4K8HA 1FWBC 3WD2A 4CKQA 2AAAA 4LH8A 3T1GA 1PO9A 1JGIA 4E8GA 1ISWA 1AD1A 2EPLX 1UD8A 2PDLA 5HMEA 5TIMA 2CLIA 3W72A 2PP1A 3CU2A 1V0MA 2PZ0A 3AS2A 5CJNA 2HS8A 1T3QC 4LY8A 3KOXA 3A9IA 4J2MA 2XUCA 1SB3B 1VCFA 1DJNA 4L4OA 1GTEA 2W66A 2YBUA 4UTHA 4ZR8A 1JPHA 3HO8A 2PBGA 4XD3A 5D9MA 3ZJKA 1O68A 1YPFA 4FA3A 4CD7A 1C93A 2BGSA 3LCXA 3G8EA 2R9RA 1Q65A 3BLFA 2ZXAA 4MPQA 3C5QA 4DF0A 4IQJA 1KGUA 1XW8A 3GY1A 3CHFA 4ZXOA 4YTUA 4HNOA 2ZTKA 3AN1A 5H8MA 1VRDA 3U3HA 1UWSA 4LW7A 1FWSA 1Q7ZA 3LDVA 4ZEPA 3PAJA 3RO8A 1SW3A 4FX7A 1MOKA 3WDRA 2C15A 2DH3A 1Z6KA 2PDYA 4XWUA 1YDOA 2WZEA 5FEZA 1AK5A 2C91A 4XKMA 4ZO8A 2ATMA 3N15A 3SM0A 2OSXA 5DEZA 1ZJAA 2YL6A 2ZWZA 3GR8A 2DIEA 3W2NA 2Z1WA 1STZA 2ZZ2A 3CXOA 4DYKA 1F61A 3F2DA 4QRNA 2OZ3A 1HP5A 5KZ6A 4B5XA 4H4WA 1IEQA 4DWSD 3U9IA 2Z1XA 5BWFA 1REQB 3N25A 3K1GA 1TSIA 1UR1A 3PTKA 4WY0B 5M1TA 2J62A 3WQ5A 3M1ZA 3FN9A 1N5WC 2WK2A 2CLPA 4OWGA 3TC6A 1GZJA 1QVBA 4XO6A 3VOJA 1RJQA 2ZFAA 1Q1WA 1WBHA 4XZNX 2XIQA 3T40A 1TIMA 5HNRA 2PWEA 2ZZCA 1YTEA 4XG1A 4Q22A 2H9AB 5A6TC 1TPVA 3SUUA 3RF9A 3ZWSA 2W79A 4J5NA 1HJXA 2BVWA 4AZBA 3ANVA 2WKLA 3UESA 1KGXA 1SZGA 1KBJA 3M0JA 1ADSA 1D7FA 2P8BA 2CWXA 4HNLA 4K8DA 3GW3A 2GUBA 2ZC8A 2VCBA 2GGIA 4QITA 1EB3A 3ENLA 4H7CA 4L65A 3H12A 2BZNA 4QG6A 3GBDA 3WK0A 1OEPA 3M5ZA 3PBWA 1ELSA 4HP5A 5HWMA 3BLOA 8A3HA 4JDRA 2X0SA 3QBUA 3S2LA 4Q8WA 4LVDA 2V38A 3DFQA 5HR7A 1TPUA 3CLMA 2GR2A 1HGYA 4EXBA 3TOYA 4CGTA 1QI4A 3W83A 2PGRA 1S2TA 4KWWA 3ARQA 4A2RA 2AL1A 1ADDA 3BJFA 1H41A 2NWRA 2A21A 3TJIA 3O6CA 1SO3A 2CEQA 3VABA 1IXOA 4FP1A 2O55A 1UA7A 4XIAA 3FDKA 3BARA 2TPRA 4GI6A 1CBGA 1WKEA 1XQLA 2DY3A 2CLEA 3QY8A 4HYVA 3B3DA 4JHOA 1GK8A 3WLIA 1VFMA 4G2DA 4J3UA 1XUZA 4D1JA 2PTDA 5CZKA 2DW7A 5SWUA 4HGXA 1CGXA 3T8LA 1N61C 3LBOA 4C1NA 4EXAA 1NU5A 2RFGA 2QJIA 3IJ6A 1ZFJA 3VGEA 1XLJA 3SY8A 4ATDA 2E28A 1OZMA 3S4TA 1HIZA 1FHLA 2VDGA 4C6EA 3GFYA 1YLVA 3GSMA 1EX5A 3TA9A 3UGRA 3U2ZA 1J0ZA 2W62A 5F7UA 1GESA 5FS6A 5MKGB 4KWOA 3GVGA 4AY8A 4TMCA 3A3XA 4BFAA 2Q8XA 1B9ZA 4ZQMA 1BGGA 4O16A 4N4PA 4A2SA 1X7FA 3HM7A 2P3EA 5B80A 4LF2A 1ADOA 2PU0A 5HQLA 2D20A 3GTHA 3W1LA 3HV9A 4JEJA 2FVMA 3KLJA 1UB3A 5XIMA 1XQKA 4ICCX 4JTJA 4E3TA 4AISA 2EBNA 3K46A 1FTXA 2OPJA 4CNPA 3WF3A 3DUGA 3CQJA 1QHPA 3OP2A 5REQB 1EQCA 3AYSA 2NV9A 4L61A 3B0UX 3DFOA 3NOYA 4JY9A 5CPOA 2WWCA 3F7JA 3MV11 3W1AA 2BXYA 4C1KA 1QRQA 4Y8EA 2VDHA 1XDLA 1EOKA 4LC8A 1P43A 2VOTA 1ZGDA 2Y5SA 3UY8A 3V16A 4R7OA 1S1RA 3RCYA 3B8UA 1G01A 1KCKA 1QBBA 1OFRA 2V3BA 4HNTA 5DT5A 3WQ4A 2BS9A 1X38A 2CZFA 4Q6XA 4ROQA 3W73A 5CCZA 4QG9A 3UJSA 1NTHA 1XD1A 1XRFA 1H2JA 3CUGA 1BWLA 3G1FA 1J0HA 4ZOAA 2JALA 1OINA 1Z32X 4RL3A 4O1FA 2V5DA 2RHGA 4K3ZA 2V5CA 3VZXA 1TV3A 1O6IA 3TYCA 3EDEA 4ZCWA 3V5OA 5CC6A 2ZUVA 2X1UA 4QCEA 4IQDA 3ANYA 1MZHA 4G1NA 3J7HA 1N62C 1WDQA 3AWOA 3WUFA 5F2LA 1EC9A 1GTHA 5AHIA 4UTWA 3HFTA 2J7HA 1BSLA 4EPBC 4PCNA 5BU9A 3QV6A 2WKGA 2I5GA 3ABRA 1U2YA 5A6AA 1YXYA 3NYZA 1F6YA 4LGXA 5BCAA 2J6VA 3IGHX 5DANA 2F2KA 5I09A 5HXMA 1XKJA 1A0CA 1JJKA 3FJ6A 4TIMA 4MY8A 1KFWA 2OOGA 1ZUAX 3OG2A 3E6EA 5I06A 3BAXA 3SQMA 3ABQA 2EHHA 1EPXA 5AFDA 1WDPA 3ARVA 3KBVA 3FLUA 5F4XA 3CL8A 4JQ4A 1V0NA 3KP1A 5DRIA 3RLHA 3REQB 2ZX7A 3LI0A 7CGTA 3A7RA 1IR1A 3GC4A 1H11A 3LG3A 4AG0A 3GDTA 6A3HA 4PE8A 1Q8AA 1A3WA 4N7QA 4H6EA 4RNIA 3M5VA 4GZJA 2YXGA 2A79A 4JKKA 1HJQA 3EDDA 4W89A 5G5IA 4N2YA 4AWUA 3CAVA 2CHOA 4EQXA 5TQLA 1XLCA 1GOQA 5FD0A 3H54A 3B9OA 2IQDA 1UQZA 4AUBA 3LXAA 3DGBA 3UWVA 1GXFA 3HIJA 2DIKA 5AHEA 1XLDA 5EPDA 2GLKA 3BAYA 3CGDA 3AWNA 4O1EA 4M3PA 3OA3A 4LQ1A 3HG3A 4PC8A 3DKJA 5HA7A 3QHMA 3MWCA 4LRTA 1RHCA 5A2CA 4DLFA 4I9AA 5IFPA 4XD5A 4M52A 5AC7A 3NXFA 3CAQA 1G0CA 1F7BA 1O95A 2ANUA 3ARYA 1A47A 2GUYA 1W3NA 2PTYA 1E6PA 2I1OA 1E0UA 4IWWA 1QI0A 1H49A 2ZUNA 2JEQA 1V6UA 2XWDA 3KBMA 4DF2A 4FO4A 2BGQA 4NZJA 1Q5MA 1UR9A 2V3AA 1XP3A 3GW0A 3N6JA 3MUY1 2W4XA 1FWAC 3DHDA 3DAQA 3HA1A 2RABA 5A95A 4MM1A 4HKPA 3UG8A 1XLKA 3W27A 3ZLFA 1RK5A 3PP7A 4NZCA 5AZ1A 1NIUA 1W3LA 1UD4A 3PJUA 3USBA 1G1YA 5HBFA 4HK7A 3GD3A 1VJIA 4W87A 1XH0A 1NDYA 3M0YA 4AIBA 1MQRA 1NVMA 3P74A 1A5CA 4N9EA 4TMBA 3ZMRA 4F48A 2Q01A 3W22A 4CLMA 1P5BA 4H01A 3AZRA 5LHEA 1GG0A 5MF5A 2DZXA 5LNUA 1SMDA 1IXPA 1G5AA 1WUEA 3CQIA 3SAZA 1S2UA 5KZMA 3AQUA 2QAEA 1SU5A 2A3AA 2BVDA 3EB3A 3SQLA 1RZMA 3DX5A 1QNQA 5A5WA 2ZTJA 5JIWA 1WUFA 4N6EA 3U2EA 1UPPA 4HQVA 4NI3A 4O0KA 1W9BM 1W5QA 4HA1A 6REQB 3VMNA 3H4GA 5F1UA 1X96A 3OBAA 2E5AA 3RJXA 3AJXA 4DB7A 2ONEA 4Q8TA 4NZFA 4C90A 4GLEA 1B3YA 1OSEA 3BAKA 1CWYA 3LY0A 3GS6A 2BOEX 4LUTB 4N42A 3L23A 2PDPA 2V3GA 2PLCA 2WVTA 3N9SA 2XGIA 1KXQA 4C91A 5K2ZA 3C52A 2OKOA 9RUBA 3EZ4A 2HK1A 1HKMA 3A4WA 5EA9A 3W7MA 1QOQA 1FWNA 5ABFA 2BWGA 2R6OA 2DUAA 1A5MC 1SJCA 4TV5A 1W6TA 1KV8A 5DY3A 1G6CA 4GYPA 2QAPA 3EDFA 4IIFA 3DECA 3O06A 5EBAA 3AXHA 4AU0A 3CH0A 2X8HA 2OT1A 4WUIA 1PKMA 4NG3A 3CZ8A 2MUCA 4JTGA 3O9NA 1UR8A 4BI7A 1E40A 4G8TA 3ZT7A 1B4EA 3C0SA 4FEZA 3TTQA 2WC4A 3FXYA 4C6PA 2EF9A 3ZZ1A 4I8YA 1NHPA 3GNOA 3EOUA 1DTNA 2YW3A 3FAWA 3K4AA 3GIYA 3JU2A 3TN4A 4Z2JA 3F5KA 2PF0A 1JAKA 3H8AA 1ZX9A 1P0NA 1S5TA 1R3QA 1QOPA 1PWLA 4FSAA 5GJPA 1R6WA 4UQEA 1CLVA 3W76A 2BG5A 3W86A 3ZWTA 4QP0A 4GQGA 3MP3A 1EA9C 3EXRA 4R5EA 1TELA 3ZSSA 2DSUA 1XIFA 1OG0A 2TODA 2ZRUA 2HEJA 4I9MA 3AXMA 1XLIA 2DVUA 2FGBA 3EX6A 3RRXA 3N4FA 1GRGA 2WMIB 1IWAA 1DWAM 5A2AA 4WGHA 3PSVA 1JUEA 3D9XA 3LQLA 5BOFA 1U1JA 3NQVA 2FZBA 5AC8A 4ADUA 4I7WA 4PTXA 3WMCA 2XM1A 4MOZA 5IOBA 1KTCA 1BYCA 4GABA 2NSOA 2BCPA 3TYZA 3OODA 1C3FA 4C6BA 1JF5A 2O9OA 3W2UA 2Z24A 1OD0A 2Y5JA 1WQ5A 2PWVA 1Q6QA 1OF6A 4UBPC 1G7UA 1XSKA 2NX9A 4B9YA 4FNSA 4CCDA 1X1NA 1KC7A 3LM7A 3LXDA 4KRUA 1TV8A 1CDGA 3MMWA 1ZK7A 4RJEA 1RSCA 5C8BB 2I57A 3LB0A 3MU7A 3WH7A 3KUMA 3P0WA 5K9DA 3RJYA 5EMLA 4ZFMA 1I1XA 4R53A 4ATWA 1Y65A 3RLUA 3W7HA 3AMCA 4ECLA 1EIBA 4YHEA 1GQJA 2TAAA 1RUSA 3QQ0A 4J56A 5FJUA 3M5YA 2I14A 1AUSL 2G97A 1BQCA 1GREA 3W7JA 3QPYA 1V59A 3THUA 4BJHA 3TZFA 2PDBA 8TIMA 1SYTA 1MMFA 3W87A 4BKNA 1JI2A 1GQLA 2Z4GA 2HXTA 2NVAA 2F61A 4HCHA 4HA0A 3BCJA 3MZNA 2E8YA 2E4TA 3GNXA 3SRFA 2D22A 4IISA 5E9AA 3EA3A 1LTDA 3WH6A 4GQRA 3FXGA 5D33A 3TQVA 2CYGA 1W56A 2B7NA 3P14A 4UFMA 1BRLA 3F5JA 2XIBA 3HPFA 3M46A 5D04C 4MG4A 3VI2A 5MKGA 3TEVA 4UTJA 3WYZA 1W1A1 1U5JA 3DK9A 5J8LA 4PFHA 3IK4A 3BV7A 1ZLPA 2G50A 2PZNA 4MB1A 1HVQA 3P67A 1ODUA 3UQNA 4FLSA 4UCGA 5A6BA 4AX7A 1WXYA 4UFIA 2IUZA 4TX8A 1I6NA 4TO8A 3P2VA 2OODA 2WP5A 3BLPX 4E2VA 2YVFA 3NPWA 4Q8PA 4W93A 4JOMA 2F38A 2XZ9A 2VEIA 3V1PA 3LGDA 4NJJA 3APTA 4PUJA 3W7IA 1FOBA 3T2PA 4UR9A 3BJTA 4O10A 4G7EA 4IMAA 3XIMA 5EMYA 3T44A 3FVDA 1UWTA 1R86A 1QUMA 3UR8A 1E43A 2BXZA 2QDDA 3EX4A 4M0XA 3A4JA 4JTHA 4PUMA 3TFCA 1Y7VA 2VZUA 1BVZA 1ZQ5A 3CJPA 4QE5A 2PRHA 1DE6A 2BXVA 4Z0JA 1P0EA 2WMHA 1OCBA 1FO4A 3KBSA 1TMQA 5I3JA 2RDUA 4LYRA 1BZLA 2ZZ6A 1XIIA 3CHEA 1TB3A 3K4DA 3G6LA 1GOOA 1K4HA 3I6TA 2WZTA 4EAYA 3T4WA 4HN4A 3CZGA 1RCXB 4I5UA 2Z2BA 1DJXA 4AHOA 3S8HA 2G4FA 1UMYA 3IEBA 5TF0A 1Q2SA 2D0FA 1XIEA 3AFBA 5LNVA 4W5ZA 4DXXA 2YA2A 4YTTA 3NDYA 3WNPA 4YVPA 4W88A 1J96A 4QIUA 3AXIA 1PHWA 4A3QA 1BVNP 3TWBA 1XC6A 5H6HA 1R87A 3KFTA 5A1AA 3ZSTA 3C2OA 2QUNA 3I3BA 2V3EA 4H4SA 1A4LA 5G4WA 3Q2DA 1F6PA 4W7UA 3E2SA 1QASA 4IFRA 4NKCA 1XWYA 2WHKA 2GJLA 3W26A 4J3VA 2PB1A 5JXQA 3VD9A 3WLRA 4B16A 4KEZA 3VNLA 4D6CA 1ALDA 1FWEC 3R10A 1O5RA 1XI3A 3NZ1A 3SI9A 1GT8A 3UCQA 2E25A 1XYMA 5BWAA 5C0QA 4FX9A 3OZMA 4JTDA 2QCGA 1Z8AA 1VLWA 4C6DA 4HOZA 3BE7A 4PMRA 4RZ4A 1H7OA 2EJ1A 2V3FA 2MNRA 4JX5A 3ITGA 3E0FA 1AMYA 3W75A 3RPDA 4Q4KA 3NQCA 1AQMA 4F2BA 3PN8A 1SM9A 2R1KA 1QNSA 1Y5VA 1AW2A 1NHRA 3TYEA 3AO0A 4Y6GA 1NHSA 4JQ9A 5DRCA 3N11A 3NDOA 4Z1CA 4QE1A 5C9UA 3DFYA 1E6RA 3LS9A 1JROA 3L4VA 8XIAA 1CCWB 2O9TA 4IMGA 3VCCA 1DVJA 4H9UA 2XJ7A 1V3KA 2PLMA 3WQPA 1XM3A 1P48A 3WLHA 1FP9A 3DOPA 4Q8NA 3TTOA 4LBUA 4U10A 2YB1A 3LN3A 5CLWA 1O1ZA 1HZYA 4J3WA 4AWEA 2C14A 1R5YA 2A3BA 1V8EA 4FIQA 4DM2A 2EKCA 5KZDA 3IK2A 1U1HA 4BQ3A 1MEIA 4QSHA 4EQRA 3FX4A 3EWUA 3PB2A 4O53A 1V02E 3A5VA 1EX1A 1OK6A 3ITCA 3R7MA 1KW1A 4CN4A 4XUYA 4LPCA 4DNAA 3GK0A 1ZXIC 3CT2A 4C65A 1H7XA 3W01A 4GNVA 2X99A 3MDWA 5C54A 1MUMA 3QZAA 4EQSA 3GKAA 1CGYA 1D3HA 4ZSUA 1VFHA 1QJWA 3ORWA 1W9DM 3HPXA 1TYGA 3OOQA 1XYLA 2V6AA 3WLQA 1KFEA 1ZPTA 3H2FA 1ECQA 1KM4A 1POKA 1RP9A 1C8VA 4F2TA 3GLCA 2XFRA 3I4EA 3L2LA 1IHIA 3VIGA 4UOJA 1ONXA 1O12A 3D47A 5DO8A 2X05A 3SGUA 4S3DA 2HK0A 4Z1DA 2BFGA 1E9ZB 2GK1B 3LNPA 1J2BA 4D1IA 1IYXA 1TVPA 3V18A 3HGSA 4GVIA 1VYSX 2REQA 3R07C 1F4HA 3QZEA 1EQPA 2DJXA 5DCDA 1W8GA 2IXUA 4S2CA 4P7NA 1SR9A 4HNCA 1OIMA 4AC7C 3K30A 1K8XA 4LRSA 3ITXA 1I45A 1JULA 3L7RA 1AMKA 2XVLA 2V6OA 1N82A 4DELA 4PB3A 3S5OA 1EOMA 3RHGA 3DGZA 4OJYA 4QROA 2VR4A 4ZOEA 5AVNA 4DZHA 4NQ1A 4FOJA 4GINA 2ZUMA 3WD4A 1DIEA 4PCFA 4IL0A 3N18A 1FX6A 1RQEA 3U7BA 2FYMA 2ZRVA 5I7GA 1W2VA 3VAVA 3IUHA 2VEKA 1P0BA 5I5RA 4H4RA 4X2PA 3M41A 1X6NA 1B1YA 4Z0SA 1WZLA 2NQZA 8XIMA 2DDXA 4AD0A 3G3MA 3NQGA 3W24A 2OEKA 1O4UA 1UIPA 3VKAA 1RCQA 3MP5A 3MCMA 4AEOA 3L65A 3GZAA 1MW2A 1UR2A 4YYCA 3MUCA 4WY0A 2ZYFA 2ZZ3A 3H4XA 4EPKA 2ABBA 2EPNA 2YCJA 4X61A 3N2XA 3TCEA 1UZ1A 1TRIA 1BVWA 4LUSB 3RFAA 1QBAA 1IEXA 2VT0A 4XSMA 1PWMA 2XH2A 3W74A 3CTTA 3LB8A 2B4GA 1OCNA 4PMDA 4IFKA 2YL8A 3LV5A 1C92A 4M51A 3RX3A 3ATZA 3SGZA 4KF1A 1WZKA 3WNOA 5C2XA 4P8VA 1LWHA 4OUIA 2C3CA 2OU4A 4GI8A 4W5UA 3TLQA 3S2MA 1W1IE 3C3NA 1OCJA 2CLKA 3KVMA 1LWIA 1AZ1A 3UXAA 4QAWA 2FVKA 4KT2A 2ZXBA 4QXIA 2EGZA 5FS8A 1VIZA 1OFAA 1OX5A 1UR3M 3M0HA 4BQ5A 4GO9A 5GPRA 1M7PA 1BXBA 2XINA 1EF2A 3L4YA 1X39A 4MZ1A 1T99A 1A3HA 4DNMA 1VQZA 1V77A 1NARA 2EEXA 2P8CA 5LYRA 3SQPA 1JOAA 4MJZA 2XVGA 4RNHA 3WMLA 2BC1A 4MDOA 1TV4A 2Q09A 2Y85A 4NSBA 2QNEA 4JNMA 3PS7A 1AH3A 1B30A 3NVZB 1TA3B 3JW7A 1GCYA 1TMHA 3NL5A 4GZEA 1GORA 1XYBA 4NXKA 1E0VA 2GK1A 1HL9A 1XIGA 1MQQA 3CL7A 5FCZA 3O6YX 2VC7A 3TW6A 3OYXA 3BW4A 3BPWA 2ZUSA 3W1PA 2NLYA 4P7QA 1L8NA 1LOSA 1F3EA 4DUVA 4KIRA 4DUXA 4FNUA 1UHVA 4D71A 4QNEA 1D7YA 2WOIA 1CTNA 4ZQCA 3TSMA 4R7JA 2FPVA 4WQ6A 1FDJA 5A8NA 4AZ7A 1KWGA 3TTEA 1J0JA 3OYZA 1XX1A 3NUKA 2PTWA 5I0DA 2D69A 3AYVA 3PUOA 2CXGA 1GVEA 4OFCA 2Y89A 3RU8X 4DLMA 4ZB5A 1Q6FA 2D2OA 4DWSB 4GXWA 3UP8A 1HX0A 2J74A 4IMEA 1NELA 1I2NA 1L6YA 2WSKA 1YEYA 1VJZA 1E9IA 1S5NA 1LVLA 4AZCA 1TZ9A 4RV8A 4IGHA 3KVKA 2AQWA 1XV8A 2F2HA 1O60A 4WXZA 5A6KA 1ZS2A 3ZVIA 3EOEA 3E49A 4D6FA 1TPFA 1W91A 2AL2B 4UNIA 3S2CA 1UWUA 3FGCA 3QOMA 3MYPA 4HOXA 1V7AA 3NXLA 3W4RA 1B0IA 2DVXA 2ZDSA 3MZ2A 2WQPA 1J8VA 1JZ7A 1YPIA 4A8NA 1LROA 3SN4A 3EX3A 1MXDA 2ABAA 1TQXA 2A4AA 2WQDA 5H1WA 4GVFA 3ZM8A 3RR1A 3IVUA 3QW3A 4DZAA 4LVFA 3VOHA 2QUUA 1H1YA 3GR4A 4FPSA 4IFKB 1E3XA 1FCQA 1UC4A 3JZUA 3MB9A 2QCEA 1M9HA 1JPIA 2OFJA 2XIIA 4DBWA 4RPPA 3SR6B 3VKJA 3F2CA 4I90A 1ISYA 1JD7A 3H26A 2J7GA 1UKOA 5EL1A 2QULA 3CGTA 4ZTXA 3EUB3 4KMQA 2WOVA 1E9LA 4B5WA 2V5LA 4WDWA 1FP8A 1LBFA 4B5SA 4NJIA 4ZOCA 3LSCA 4B3KA 2CZVA 2Z25A 1EJ7L 2EG6A 2R24A 3NEVA 3PZTA 4O18A 4B91A 3AOFA 5EBUA 4WSHA 3EWXA 2ZIDA 4CN6A 5DN1A 1O1HA 3LGEA 2A2IA 4JHMA 3RILA 1H60A 5G1YA 1E4LA 4JFVA 3BSMA 5JU6A 1FH8A 1OQFA 2VRQA 4S3EA 1JYNA 3V5CA 5G1TA 4IPNB 5CH9A 3NZGA 5DBTA 4AHQA 1UC5A 4QEHA 2VENA 3BW3A 1BTCA 2H3DA 3LHUA 4WY0F 4IH3A 2QIWA 3WF2A 1S5MA 3GU1A 3SCOA 4H4YA 1G4EA 3S5NA 4GCAA 3WMSA 3S5SA 4OECA 3SB0A 1V03A 1MNSA 4MKSA 4CUCA 2OXNA 4QSFA 3THQA 1ZU8A 1GONA 1EBHA 3HZ3A 2X1TA 3UR2A 2Y8KA 3VINA 2YBTA 3L0NA 3M0LA 4QEEA 4XISA 5GNXA 4BWLA 1BF6A 4MHBA 1AG1O 2VXNA 4IF2A 4Q4PA 4IUOA 4LS1A 5I3IA 1TPB1 4EX4A 3DFSA 4I3GA 2VFFA 1NDZA 1NOUA 1JRCA 4FR6A 2WAGA 2X40A 2Z1SA 3URHA 1W1PA 4WSJA 2D2HA 4UTLA 3TYUA 2OYKA 3UNTA 3GAYA 5HWJA 3UXKA 4HHPA 1MUWA 3TJXA 1O66A 2YLLA 5FF2A 1WZMA 3ALFA 1AA1B 3VVGA 3PPHA 5JUVA 3OIXA 1CLKA 3FJNA 4IP4A 1EHNA 2VDIA 5EY5A 1XLEA 3O0HA 4QAIA 2Y6ZA 5IFTA 2AAMA 4GNJA 4UTUA 3NNTA 3W6MA 4PBEA 4EMWA 1UOKA 4X0VA 1MI3A 3AISA 4ADSA 3F5LA 2GJXB 3B8SA 4Y2WA 1F05A 3D3FA 3Q45A 1BXCA 2PDXA 2X8RA 5LXXA 3R11A 3BW2A 3TU9A 1OZQA 2XWEA 1IEIA 2X2GA 1LCOA 1A80A 4PBGA 5F2MA 3FYOA 4AIOA 3BQ5A 4JNZA 3T09A 5ER0A 3AHTA 4QJ5B 2JIEA 5BROA 1RCOB 3KTCA 2W9MA 4IMCA 1H7NA 2GL5A 4BK9A 1U5VA 5JH2A 3UXDA 1MXSA 4RZ6A 5FF4A 1RJPA 3WNKA 5EGRA 5GJNA 3GNDA 2SFPA 2QDHA 1F07A 2GR0A 2IKHA 1PDYA 4HU0A 3OLEA 1OX4B 2QCLA 2W92A 3OVRA 4GCXA 1DQXA 1UD3A 4GRSA 3MA8A 4LUIA 3TN6A 3M9YA 3VNKA 4ZB0A 5CPTA 3LU2A 2MANA 3M0VA 1XHGA 2ACUA 3ICJA 2NVDA 3IIXA 5AC4A 2W54A 4HSNA 3O6AA 2QQ6A 9XIAA 3W00A 4DJDA 5CPNA 3HW2A 1VHNA 3SCWA 1EKOA 3W28A 3PY2A 3UW6A 1XCFA 1UKSA 4IPJA 3EXTA 5CBIA 2VWTA 3TQPA 2DFAA 4YL2A 2GGEA 4V2XA 3G0SA 1S39A 1LJYA 4HIBA 4CD5A 2OB3A 1OF8A 1QCWA 3ZJ8A 2YL5A 2FTWA 4IZGA 3O3RA 4TQTA 2PCQA 1ONRA 5LNWA 2Z1BA 2ALDA 4FOKA 2RDWA 3H2NA 3PFMA 2GOUA 3S9IA 3G5EA 3P6LA 4EMIA 3H6OA 1W1TA 3R94A 3WJYA 4TVUA 1SJBA 1LUCB 3WMBA 1FFRA 1L2UA 3EX2A 5K3VA 3GHUA 2WMJA 5EB8A 3DI1A 4Q4QA 2YDQA 2IKJA 1DWIM 3N6HA 4TXEA 2V67A 2ALRA 4K7YA 2V81A 1K7FA 4GACA 1AODA 1ZRQA 4D2JA 4TX9A 3TSBA 2C1IA 2J8FA 2A6LA 1ZB5A 2CC0A 4ZVJA 1H7RA 1E70M 4C6MA 5CKSA 3WQFA 4EOUA 2X30A 3T7VA 4KEVA 1KFJA 2OO6A 3QOKA 5DCEA 3QC0A 3TCSA 3NQAA 5CG7A 4DX3A 2ZX9A 1YE6A 5FESA 2Z7KA 3WNMA 3V1HA 2EQ7A 3VD5A 3G6MA 5D03A 4H4UA 2PLKA 3GQYA 1A4MA 1CGUA 5E93A 1JPMA 5KTLA 1G4PA 1BD0A 1A50A 1X2HA 1MRQA 3STGA 3C0JA 4LAZA 1VHCA 3BG3A 5I77A 2VUNA 3FVMA 4LUSA 2CLMA 2CZ5A 3TWAA 3SECA 3UWZA 4KPRA 1GRBA 3EKZA 2X8GA 4H9VA 4O8RA 4WGXA 3P5ZA 5HQMA 5K9CA 3F4CA 3A4XA 4HJWA 1NOWA 3HJZA 5HWNA 2VR5A 3TW9A 3E02A 4JL1A 4AVOA 4WSKA 4CCEA 8CGTA 3MUZ1 2CBJA 3FA3A 4MUZA 1BTMA 1VB9A 4AD2A 4QDPA 4H8HA 1UWRA 3E0VA 2PRMA 4V15A 5LIYX 2QCHA 3HRDC 1ODZA 3NL2A 3RRAA 4DWSA 4XBSA 3CUZA 1B3VA 3QPEA 4HK6A 4NRSA 3L0KA 3C8FA 2RAGA 4LNYA 4PH6A 3IV3A 2YBVA 4MWAB 3SJNA 2YJQA 3NCOA 1LLWA 1ZBVA 4MLRA 4Q7IA 1XF0A 3KBNA 4AWTA 4D8ZA 3A7AA 3FSTA 4HPXA 3XISA 5CSUA 2CITA 3MMDA 3S47A 4E6MA 3I3DA 3EMZA 2YW4A 1DPMA 4WDXA 2VQTA 3SUSA 1TA3A 1GYLA 3GRIA 3UWEA 2C6QA 4LJ3A 3T0TA 4X22A 2QW5A 5ABGA 4O4VA 2XYLA 2FFCA 1R3WA 1GVIA 4MDPA 1Q7QA 4K6AA 1VFSA 2WLZA 2V8ZA 2J24A 4BZYA 1XHCA 1AW1A 3CUIA 4U2YA 4E3VA 2R82A 1GVSA 3EMCA 4GC3A 2E8ZA 1HL2A 3E2RA 1JG9A 4URIA 3VIIA 2DEPA 3PZOA 3NDZA 4F0RA 4NP7A 4F3HA 1YNYA 3VKDA 4Z2LA 1E0TA 1K4QA 3LM3A 2J79A 5HQEA 2NV2A 1K8YA 4WKHA 1TWWA 4QS6A 3ARWA 3MWAA 3SBFA 3U57A 4GISA 3K5XA 1UOZA 2NQLA 2YCEA 3TLLA 1UG6A 4MNMA 6XIMA 4GY0A 4G56A 2PD5A 2WM0A 1GOMA 4H7ZA 4PBFA 1ZJBA 2EXOA 2REQB 1MW1A 1G4SA 1LLZA 3BOXA 2NZLA 3B05A 2J6XA 3UCCA 1F3TA 3K1DA 2YB4A 5CGTA 1K9EA 4AZGA 3QHNA 4O57A 4F0LA 1IZKA 2Y61A 2CZEA 3URQA 1YPXA 3VA8A 1B3OA 3S6OA 4S3JA 5DY2A 4MKVA 5A3HA 2G41A 3UPMA 1PVNA 3ARRA 2XIMA 4ACYA 5DCBA 4FMVA 1QHOA 3L5LA 3QY6A 4MWAD 3CV1A 4OHQA 2YDAA 3VDGA 3CTLA 1QO5A 1PKNA 2E7FA 1FECA 3SY1A 2XH0A 1LL4A 2XFYA 4MY9A 1J01A 2PDQA 2GVLA 3WJXA 3EOLA 1FWCC 3LQGA 3AS3A 4B4HA 2FHCA 3VKKA 3U2OA 2ADAA 1F74A 4GYPC 3MUAA 2ZZ4A 2X1IA 3VIPA 4HYWA 4PMJA 4YIWA 3LRKA 4AXNA 1FWHC 5BW6A 4O28A 3EWYA 3NQMA 3PWAA 1W3HA 1Z9AA 2WOQA 1PB0A 1XBVA 4H2CA 1WZAA 1KFLA 5DMNA 4JN7A 2CBUA 3WL0A 2CW6A 3EBVA 5A8MA 4UTWC 2FHFA 2CETA 1DP0A 3VGGA 4DJDD 3DG6A 4EXQA 3CGCA 2DORA 1TV7A 4WEVX 2KZHA 3AC0A 4US6A 3QRHA 3UJRA 3NZRA 4G6CA 4ZQRA 3AHZA 1M03A 1O5KA 3GTFA 3EPMA 3AICA 3LZ5A 1SFLA 1V51A 2QUMA 4N02A 3O16A 4Y9MA 3W1UA 3VDAA 1FQ0A 3M0MA 2PDJA 2HVMA 2BV9A 2W6RA 4AQLA 1Q7MA 2B7QA 1A5UA 4UFKA 2OSWA 5AN7A 3H2CA 3B9DA 4XK2A 3LI1A 5LNRA 3E2QA 2PPGA 4GUGA 2BNJA 3FIGA 4C1LA 4RR4A 4NILA 3F4NA 2Q02A 4NZ1A 3VOCA 3VKBA 3UWYA 1JFXA 3EOSA 1V3LA 3U0HA 2AMXA 4KEUA 1SQ7A 1US3A 2GSJA 1QWGA 4R88A 1V4YA 3JVAA 4H19A 1HP4A 2OWXA 3QTPA 3URBA 2NV1A 5BOEA 4RK8A 1QT1A 3GX9A 1GV4A 3DIPA 1N8FA 5GNYA 2UY4A 1UIOA 1S2WA 4R33A 5M03A 4CD8A 3GXDA 1IZCA 3PUGA 3DGHA 3IPWA 1SPQA 2R1LA 3B0YA 3LXCA 2R1MA 2VMFA 4GQ0A 4AYSA 2J3NA 4JQ3A 3OVGA 2BX7A 3AHVA 4GFIA 2JEPA 4Y96A 1THFD 3MVIA 3L9CA 2YCLA 3WY1A 2X8CA 3WLLA 1P1MA 3M4HA 4MKNA 4GQBA 3PM6A 4ACZB 3L8KA 3OLDA 4H3DA 2QF8A 1X1ZA 3NQ2A 4WKAA 2TYSA 4M7SA 3TR2A 4JNYA 2QMJA 3BLIA 2VC9A 1EJTC 3AI0A 3O63A 1A5KC 3B9EA 3OB8A 4DJEC 5C9RA 5KMYA 4GA8A 3C2RA 1PDZA 1K77A 2NX3A 2J7EA 1TE1A 2IQTA 3U4AA 1JYXA 1E56A 1WNOA 2OKTA 1EWEA 3ECQA 3WN6A 4ASTA 4C5ZA 2PE4A 5A8PA 3AHYA 3BUVA 2WVVA 4WDUA 4AZIA 3BGGA 4LUTA 2Y0FA 2C13A 3UD6A 1NPXA 1WDDA 3BTNA 2VZVA 4L64A 1PIGA 4PFMA 2PGWA 4L9XA 3RNDA 3NO5A 2XSBA 1G94A 5TNVA 3F4DA 2HV5A 1EJRC 5FKYA 3I7SA 2IPWA 1FWRA 3OHIA 1Q4WA 4XKYB 1TJPA 3IJ9A 3C3UA 4HMEA 3R25A 5IHRA 1RLDA 2XHYA 3B8IA 2OLSA 4UTTA 3LV6A 2P50A 5FS7A 3QEZA 1GYMA 3T6CA 1WKFA 5JQ9A 3R1ZA 1ZL1A 3IJ8A 3V0SA 1K4GA 1XD0A 1UWQA 3IV8A 4G9PA 2ZRZA 3NFUA 2INEA 1XDIA 4XVDA 4ZA0A 3AIEA 3BURA 1CXIA 1HW6A 3OW1A 2E9LA 4BEUA 3ZIZA 5A94A 4P8XA 1UH3A 4JTIA 3RCMA 4DJED 2A8XA 3WO8A 1A53A 4LVGA 1Q66A 4JKMA 1FDYA 1UZ4A 3NVWB 5T8GA 1W9VA 1UROA 3I10A 1O5XA 4W8LA 4RNFA 4Z08A 1S7MA 3M6DA 4DBDA 3GDMA 4J35A 3N19B 2FPYA 4GC4A 2E0PA 1L8PA 1MEHA 1T40A 5AYIA 5T9BG 1E3ZA 4OBRA 1TWSA 1LPFA 3V0UA 3P8JA 3UYCA 3WLSA 4MAZA 2E6AA 4NRRA 1FHVA 2PWGA 4RDYA 4UNLA 7TIMA 4BF7A 4A35A 5FI8A 1KFBA 3V0TA 2C19A 4JYEA 1VKFA 4DO7A 4E2OA 1H4PA 2WBGA 3ARPA 2VFEA 3SZ8A 1OABA 1A0EA 4GY7A 4Y9OA 3PK7A 4Q4MA 2DT0A 2WOWA 3N4AA 4EVZA 1Z48A 1VP5A 4KCUA 3W82A 1MUCA 3M5XA 3H2AA 3HFYA 2QEZA 3PUDA 4F8XA 1UR4A 4JN6A 4BV6A 3VIHA 4PMQA 1K70A 1LBMA 2ASHA 1UASA 3O0FA 3WK2A 1KBLA 3HQ1A 3VKCA 1KD0A 3ZLGA 3A21A 2JIWA 3TMQA 4MWAA 3E1F1 1ZZMA 2OZTA 3Q37A 4JIHA 2AGTA 3IJIA 3S6DA 1UJPA 1DOSA 3B4UA 1POJA 2J27A 1GOKA 5J5RA 2V69A 4IJBA 2DSWA 4A3HA 4M24A 3CQHA 5C5YA 4PMXA 3OBKA 3VGFA 4DWDA 4GR1A 3ATYA 3EOOA 5H8UA 4PTDA 1KB3A 3ITLA 4O50A 2H6RA 2GWNA 2X42A 3URAA 4CEXC 4XB3A 3LCFA 3OVPA 1UUMA 3LHTA 4PN2A 3R2GA 1UW9A 1UYQA 3B04A 3WDJA 3GG7A 3WF1A 2AGKA 3U7VA 1AL7A 1AVAA 1OCQA 2QJJA 4L80A 4Q8QA 2J78A 5FOOA 3G1SA 1EEPA 1VEOA 1P6CA 3MQTA 4A22A 1GKQA 3RYSA 4MJMA 1B9BA 4GUHA 1ITXA 4AEFA 1ZSXA 3PZUA 1M68A 4TU1A 2WJDA 3ONCA 3VGHA 2Q3RA 3NPXA 3ZS4A 4UQCA 4JAWA 4ZODA 5G4HC 3TTSA 3BWWA 3BLLA 3PJWA 1MEWA 1QW9A 3HG2A 1JCJA 3SGGA 1OYBA 2FZ8A 1HO4A 2VD9A 4CQBA 3VX0A 3MC5A 4CU6A 1RALA 1V6XA 4A8IA 1H1ZA 7ENLA 3CS2A 1WKDA 4M6QA 4NX0A 1AJ2A 3TROA 1F8WA 4WK9A 2HXUA 5EMUA 4ORMA 3OZYA 3FKRA 3SCRA 3S83A 1LLOA 5I6SA 5CLTA 4FX8A 4PL1A 1IXQA 1RLCL 2J9ZA 4NASA 3A47A 1ENUA 3NAVA 3QY7A 5JMUA 3W7LA 4IQEA 1YDVA 5G1MA 1JCLA 2QGYA 4P7LA 4OE7A 3GNNA 3JUGA 2PI6A 3RX2A 3O8AA 1C9WA 5H8PA 1TX2A 3SFWA 1N55A 4IICA 3W81A 4FLOA 4O4WA 1EJVC 3VMOA 1Y5WA 1WYIA 1EPVA 5TD4A 3U48A 1DJIA 4GQQA 1XG4A 2PWDA 1KWKA 2X7VA 4HTYA 4EWJA 4TVWA 3OC4A 1EGZA 1CXHA 1ZY9A 3C2YA 3CIVA 3NVDA 4OZOA 2CHRA 1W5MA 3UA3A 4QLKA 5AKQA 3VDBA 3W02A 3WENA 5M3WA 2BVTA 3B8WA 5DELA 4BF9A 2ISDA 2CDUA 3DYPA 3MSRA 3WBXA 1C9DA 4PMUA 5G5HB 4NUWA 4C5YA 1YDNA 1XINA 3BLDA 4O19A 2A3HA 5CZ0A 1ZDLA 3AYRA 1DTUA 3PB0A 1T8XA 3PTMA 2W3SA 1VPYA 2ZKMX 1DXLA 3EANA 2GQ3A 3EB2A 3NGFA 4RZBA 3IAQA 2WVSA 3LLDA 1RXOB 3B06A 4I7VA 1QK0A 1X97A 3N2OA 3VM7A 5CBBA 3G24A 2H3BA 4H00A 4L9YA 1XGDA 5XINA 3WQEA 1N5XA 3P61A 5KVIA 3MS8A 5JH1A 4QJ4B 2VZTA 1F9CA 4MY1A 4WF7A 1ECEA 4J9JA 4K7ZA 4PZVA 3PC0A 2ACRA 2WBAA 1GVRA 4JKLA 2NXIA 4KERA 3TC7A 2PFHA 2TRSA 5K9XA 1E4MM 3COTA 1SFJA 2W3RA 4F2UA 1LZOA 4JFTA 4X3ZA 4AIUA 4J7RA 3O07A 1GZGA 2NQ5A 2PDMA 1NJJA 3DC0A 1B2YA 5FJPA 1T7LA 3RM9A 5C55A 4JICA 4KWSA 3PUEA 3OEXA 3PZVA 4DJDC 2Y7GA 1W9XA 1I0BA 3KBWA 3QZ6A 3GU9A 2X2YA 5C9XA 4HTBA 2VGIA 3P7YA 4ILSA 2WB5A 4PUDA 2EAWA 5CSSA 3ZJ7A 4ML4A 1W3KA 2GQAA 1DYSA 1XIHA 5F4SA 6TAAA 2D1ZA 4ML9A 3F03K 2X0HA 1WCGA 4CVWA 4JIRA 1KCXA 5JBFA 2B0MA 3W1NA 4B90A 4WKFA 1RD5A 4IOTA 1CXEA 5HATA 4FALA 4UR7A 2VOMA 2QUVA 4A05A 2RGMA 1GQKA 3NOEA 1JDFA 1BHGA 2BHYA 3BZJA 2P53A 5D37A 3EX1A 4Q32A 1QPKA 3MJMA 4PUUA 3H4KA 1SZRA 4DI9A 3A13A 3L4UA 4PTNA 1MSSA 2OGJA 4ZZ9A 3FG2P 4LCSA 4APNA 3POCA 4EE9A 3UYIA 1ICPA 2IPGA 3UETA 3WLPA 5BRPA 3QLLA 4I9JA 1JCXA 4H50A 5LIUX 1RQBA 4O52A 1KRMA 3AM9A 4FNRA 4DQWA 4JCLA 2DV0A 3LCWA 3WJWA 4WX2A 4ACZA 2A1YA 3CUXA 2YSWA 4GXPA 1KCLA 3SUWA 4QTGA 2GDVA 4NAEA 1SZEA 5LIXX 3DKLA 5LZLA 1V02A 1D8CA 2VX4A 1T0OA 1E1EA 5FS9A 1JPDX 5DBUA 3UZJA 3VOIA 5JVLA 3W7DA 2RJGA 1DNCA 7XIMA 3HU7A 2EQ9A 3FFSA 3CHCA 5I78A 1UUQA 3M0IA 1S2AA 2XVKA 1NOFA 1IR2A 2EPMX 4X2RA 4OV9A 3ZJ6A 3QFAA 3VILA 3ARUA 3KWSA 1RK6A 1R3RA 1RVGA 3OG3A 4GZIA 3GTNA 3CL6A 1TJ0A 1R7OA 3LSBA 3VIKA 1DIDA 1D3GA 2GSEA 2PODA 3VOGA 1D7KA 3KXQA 4WD0A 1J5SA 3M0XA 3PG9A 1BSIA 2F7FA 1VLIA 2OOFA 3I4KA 5EMMA 1EDTA 3S1GA 1XDMA 4IL2A 3ELFA 2ZUUA 4O17A 2C1GA 3TXVA 4L4PA 2Y7DA 2RJHA 4KBXA 2A6NA 3DH7A 4D6EA 3GG0A 3QKEA 2LLEA 2PC4A 5I07A 3N2BA 2ZWYA 4J27A 3OVQA 1AQ0A 4GYJA 3SEPA 3VZYA 2QMKA 5JCLA 2ISSA 2EG7A 2QV5A 3OTRA 1EZWA 1HT6A 4AVFA 1CGVA 2XTKA 3H70A 3IC9A 3PAOA 2DP3A 3RM4A 3OIHA 2VO5A 4PGLA 3EWBX 4G5DA 3QMTA 1ONWA 3TYDA 1L9WA 3DCPA 1LQ0A 4GWEA 3GH4A 1LRQA 3N34A 4FF7A 3TYBA 4L9ZA 1X8FA 4OOZA 4HMCA 4O14A 4ZO9A 4EM3A 3I3EA 4LIIA 3E0IA 2D3NA 3GDKA 3WD3A 2Z7GA 2XZ7A 4GI9A 2NQJA 2AQVA 4MPKA 2W0UA 1VQTA 3STEA 3TJ4A 1KM6A 4S3FA 2O4MA 4PEEA 4BURA 4ATLA 4OOUA 3ZR6A 2FJKA 2OYLA 3T4CA 2YYTA 4CCCA 1DXFA 3RK8A 3UCDA 1LWJA 2VCCA 4R3UA 5FJTA 2HPIA 1OFPA 1BAGA 4UQAA 3KLLA 3WLMA 2XGBA 4GHRA 4LA1A 1FH7A 1FWFC 3GD4A 2HJPA 3PG8A 1U33A 2J9YA 1KXTA 5AYYA 4TVYA 3AJ7A 2ZCGA 1PL9A 3P62A 1GOWA 1XIMA 1MO0A 1GKPA 1YMYA 1QTWA 1XS2A 1TTQA 3STFA 1B3XA 1OFQA 3UNDA 3NPUA 3W29A 4ZL1A 2ISVA 3SW6A 2P10A 4GJIA 2QJGA 4AC1X 1HL8A 1Y0EA 3MSYA 1TJ2A 3VNDA 2VUYA 1MW3A 1QMLA 1O5QA 3PZQA 4GFSA 3DK8A 1DJYA 5DMLA 1ZHAA 3N12A 5ECVA 3PHAA 3LK6A 4A29A 3R8GA 5D38A 4YTSA 4FXRA 3G1AA 2WZIA 4BWLC 2UWFA 2Z6IA 1LT8A 2ZRWA 2XDFA 1E6XM 4Y9AA 1UH2A 1UD2A 4HU8A 1AQFA 4Z2HA 1LP6A 1VBHA 1V6TA 2EPHA 4H9ZA 4PRRA 4PUWA 3VZZA 2F9RA 3QYSA 3FHAA 4DJFA 1YNPA 2PS2A 1CECA 3APGA 3CIXA 2NX1A 3DYOA 3S2NA 3E96A 4JTRA 1XUUA 3MPGA 4KFPA 3CK5A 1M41A 4EPEC 4CNOA 1K9DA 4RV3A 1B3WA 1X6UA 3HB9A 4M6PA 5K7JA 3THCA 3GO2A 2ZZ0A 1M53A 4H7VA 4N6FA 1RVKA 1Z89A 2QYGA 1JCNA 3HTWA 1FHUA 2DQXA 3VUSA 3SRHA 2VRJA 4NVTA 1VC4A 2GJRA 1XGEA 4LNCA 2W3ZA 5DLCA 4AD1A 1W31A 4IIEA 3MUIA 4MJ4A 3KOYA 3Q65A 4NAEB 3CWHA 3F2BA 4FB7A 1W1YA 4QNWA 1PKYA 2GFTA 2CKRA 3EPNA 5FIPA 3QV7A 2C0HA 1GWJA 3CQ0A 1E15A 1CLXA 2V68A 5BRBA 3LYEA 5EBKA 1VR6A 3VD7A 3L12A 4H6RA 5A8QA 5M5DA 3THAA 2NLIA 3Q6JA 1NH6A 1NFPA 2GZXA 2VM8A 4Q8OA 3M43A 2OGYA 4KQNA 5A6BD 1UJQA 4GI4A 1YRRA 4LAMA 4X60A 4E4UA 2YAUA 3EMQA 3QFWA 3PPCA 3ETRB 3CV2A 3EWCA 2QAFA 4U33A 3NQFA 4S3CA 3SSZA 4KW2A 4AH7A 4NAFB 4S2BA 1ZAJA 2ZICA 4DWSC 1NM9A 4INFA 4YCPA 3ISIX 4QJ1A 3QW4B 3AXXA 2J75A 3AU2A 3KHDA 3SIZA 3HQPA 3L5AA 3EEZA 1TE6A 2ZE0A 3CC1A 1W1B1 4NJGA 2NUYA 5IBXA 2I16A 1R2TA 4UFLA 4H9XA 4B2DA 3WFLA 4OTKA 5F1VA 3MP4A 3GHRA 3H22A 3EEGA 1A5LC 1VFUA 3E9AA 1W8SA 4LB3A 3N04A 3EA2A 4GG9A 4QM1A 3WUGA 4O0ZA 1AJ0A 3ERPA 3GHTA 4G7FA 3GXTA 1JIBA 2I7GA 1FKXA 3B9AA 2J9XA 1NQ6A 3NGJA 2V2HA 3KZSA 3O7UA 1J0KA 4EAMA 4Q33A 4ONVA 1QNOA 2QCDA 1IXNA 2DZPA 3GIPA 2Z6JA 1RJRA 3H21A 1FDZA 3N6QA 1CW2A 1PX8A 2Y1HA 1VENA 1XLAA 3A12A 1EBDA 4WDTA 4J3ZA 1PTDA 1LL7A 1NQKA 4IG2A 4MFEA 5FEXA 3R12A 5AHFA 5LA1A 3LBMA 4MYAA 1S2CA 1GQIA 3T42A 4QFUA 4RKAA 1ME8A 1SVDA 2WVUA 1G69A 4HK5A 1YADA 5I79A 2G95A 3UG5A 2D2GA 3WBYA 3PZMA 1KXVA 4NT0A 1KBBA 1Z41A 4S23A 3Q4DA 4WJXA 3A9BA 1J2WA 3GH5A 4N9DA 3TDFA 1XLBA 2ZBTA 3GZ3A 1GZ1A 3G22A 3H2OA 1O7AA 2VFGA 3EWDA 5I03A 4LEQA 4G1KA 2XH4A 3WX7A 5HNTA 2CKSA 4TUFA 1IEWA 2PWFA 1D8WA 3QH2A 3QQ1A 4IFOA 3DFPA 1A5SA 3E2VA 3DI0A 3IVTA 4TOQA 1G4TA 3MW7A 3WQGA 2BBFA 4LBRA 3NA8A 2H90A 4XBKA 5EMJA 3PANA 1GVFA 4FK9A 4XAPA 3KS5A 4IIBA 4QG8A 3UEQA 2ZC1A 2E9BA 4AIEA 6CGTA 1OY0A 3OU8A 4GX8A 5TAOA 2HZGA 2HRWA 1GW1A 3BL3A 2NUWA 1CGWA 4JIIX 2CLOA 1YDYA 1XICA 3UU0A 3ZT6A 5A6MA 3AS0A 3PTDA 4CVUA 2ZADA 1JDCA 2ZA2A 3PBYA 2VHLA 4JIQA 3UJEA 3ZXWA 5EU9A 3DHUA 1GVYA 4FI4A 5HAOA 5CC7A 1DQUA 3GVQA 1I4NA 3B4YA 5F4WA 2YA1A 4AF0B 3MKCA 4JY8A 3BO9A 1NWRA 5J04A 1F73A 4F0HA 1FH9A 3KCLA 3BZGA 5A6SA 1TWZA 4JFWA 2V9DA 2Z00A 3U2CA 4NXSA 3KX6A 2PDFA 3ALGA 1AFSA 3FS2A 4GNKB 2VNCA 3P5YA 4Y90A 4O1DA 3QMRA 1V3IA 1TR9A 3MCNA 4MYXA 2PCEA 5D9NA 3CIWA 2DW6A 3PF3A 1NP0A 3MBDA 5CC5A 1F8IA 1EBGA 2WHJA 3CBWA 4FIRA 1K8ZA 1R3TA 4AZ5A 4Q8MA 1C8XA 4P7RA 4B5TA 1P0DA 3NEHA 3TMLA 1Y5XA 1PCWA 4BHYA 3GTIA 5BOOA 1R9XA 5LXEA 4K68A 1HFBA 2G3NA 1BG9A 2PDGA 3EDKA 5FAGA 3FCPA 2R94A 4DAIA 1LYXA 1E0WA 1TMLA 2H8ZA 4ZB2A 4FLQA 3UR5A 3HMCA 2PMQA 1JZ5A 1SZNA 3LZ3A 2F5ZA 4DBSA 2VX6A 4O13A 2YR1A 3W84A 2IPFA 1FWWA 2FH6A 4JQAA 3QJAA 3O05A 4OQVA 1LUCA 3NR0A 4EM4A 3AHXA 2D0GA 4P8UA 4UNKA 3CWOX 1SFSA 4IM4A 1W9PA 1Q1RA 3QTGA 2XG9A 3PFRA 4LAUA 5I23A 3GE7A 4Q7NA 2OVLA 4Q4OA 5AHLA 5A8GA 1GG1A 1M7XA 1VBRA 1KGWA 2GUUA 5I3HA 2UBPC 3RR4A 3B40A 2WBKA 1VD6A 4O12A 3B97A 4HOWA 1UMLA 2PRLA 5DT7A 3PNZA 3TTYA 5G5GB 5DX7A 1ZMCA 1WO2A 5T91A 4UQBA 3W88A 2PDNA 5CQ1A 2DGAA 2AL2A 1Z69A 3E5BA 4DJEA 4XV0A 3E74A 1CXFA 4Q7BA 3SUVA 1TVNA 1K1DA 5I2UA 4GRTA 3VYLA 3EF6A 4H41A 3M6YA 4QDWA 3QVQA 4V1YA 1REQA 3FA4A 1KR0A 5EKYA 4IJRA 4H8UA 4MNLA 3RM8A 1Q63A 4UOZA 1HQTA 3FY1A 3P3BA 4JL2A 3MO4A 1EL3A 3VGDA 2GJNA 7REQA 4DZIA 1VFTA 3A24A 3NSXA 1Z42A 3GRTA 5JCIA 1PIFA 1UKTA 2WJZA 1TZZA 2V3DA 1WBJA 3M0ZA 3MJYA 4FNTA 2ZZ1A 2OQYA 1W3IA 1Q3NA 2J7BA 3PG6A 3CGBA 1V6WA 3IANA 4NZ4A 1D2KA 1V6VA 1SW0A 2CLFA 2B7OA 2VELA 4IQLA 1UZHA 4C60A 3GDLA 3UT0A 5CG0A 4E38A 1UPMB 3DN5A 3S6TA 3UWQA 3B8TA 5IRPA 1JYWA 3SCNA 3CV7A 3BXWA 2ATSA 3WQVA 3ZR4A 4JTLA 4I9TA 4JHZA 2WHMA 4LEFA 3IJLA 3QGKC 4MUPA 4LX4A 3L0GA 4C6KA 3AROA 2C3DA 1AJZA 3OO2A 4DXVA 4RW3A 5BRQA 2GYIA 1NHQA 2TMDA 3B0XA 2VEMA 4LAKA 4IIHA 5HJXA 2RGLA 1JQXA 3T55A 2E67A 4G7EB 2FH8A 4FS9A 4QR6A 1XXXA 3POHA 1M3UA 3R43A 5E9XA 2EPOA 2VGBA 5ABHA 1KBKA 5E0FA 2TSYA 3SCSA 2FPTA 3TVAA 2FKPA 4ZMGA 2QR6A 5I02A 1PKLA 4MNKA 2VFDA 3SCVA 2VEFA 3RGTA 4B5UA 1DIKA 2VVNA 3ONBA 4C7FA 4EKJA 4YHGA 3B9JB 4LALA 4BS0A 4M5PA 5KINA 1VCGA 4NL1A 2HBVA 2F84A 1IIHA 1EHAA 1VEMA 3BQ6A 4U3CA 4LCQA 2P76A 1B3ZA 4UCFA 3S1UA 1J10A 4IX0A 2PDCA 3CXBA 3BVJA 5T26A 2X7WA 4L1XA 5D8WA 4CQ9A 3NZPA 4WHBA 3WH8A 1H09A 3N4EA 3VIFA 2J77A 4CCZA 1MFVA 4DUOA 3LCHA 3UG3A 4F66A 3FKKA 1ME7A 1BQGA 1OX4A 2PDIA 4IPPA 4MZ8A 2HQMA 4H4TA 1GEHA 4LBSA 3HQNA 5HJLA 1XCWA 1J18A 1TR1A 3DG7A 2OWWA 2JF6A 1QNPA 5BNKA 2VR2A 2GVJA 1H3GA 1A5NC 2OEJA 3IIVA 2HROA 1EIXA 1J11A 1W9UA 3DC8A 1HUVA 2YPIA 3BG9A 3OPSA 4DEFA 2BY3A 3PTQA 4I8DA 3WZ0E 3CZEA 3KVLA 3E38A 3L5MA 4MAVA 3VX1A 1TTJA 3HOJA 3QMSA 4JIEA 3DDMA 1JXJA 2XSAA 4E0CA 2WWDA 1JYVA 5HULA 3WCZA 2OYMA 1QI5A 2PWUA 4HZ6A 2JQXA 3LPGA 4NEWA 1LG2A 3QFBA 4BF5A 3CEPA 1H62A 4FAMA 2R14A 4NHVA 1JUBA 3RLGA 4H83A 1ITQA 4UB9A 7ODCA 1RA0A 5TBOA 3W7QA 1BYDA 3LHWA 4HPNA 1XYCA 4Z1YA 1DJQA 2G0WA 2PTZA 4GIYA 1ISZA 1BWCA 2WP6A 3IJQA 1K8CA 1I75A 5D8ZA 3ITVA 4I5RA 1E71M 3VD3A 3AIUA 4HVXA 1KLZA 3OGVA 1YBQA 3P60A 3DBNA 2QPUA 2PAJA 2DZWA 5AC6A 3BH4A 4KKXA 1N7KA 3MVTA 3C4UA 2P3ZA 4Z2GA 2DH2A 1TVLA 1WX0A 5HOSA 4ZXLA 3NRZB 2V0TA 3TXZA 4DI8A 1BLIA 3L4WA 4L7ZA 5CJ5A 3VIMA 1EJSC 4PSPA 4JN8A 3OQ8A 1CI1A 1F3WA 3ZR5A 1K3UA 3R6IA 2PWHA 3G8RA 4HHHA 3SR7A 1XYAA 1FCBA 1VFOA 4RZ5A 5D2YA 2R1PA 3E0LA 3W7NA 3VIJA 3EKLA 5AECA 3I6RA 2OWCA 2FTYA 3GXFA 3WQ6A 5REQA 2NVKX 4HHLA 5D4YA 1ISXA 2WNNA 2VQUA 4V1XA 5RUBA 4KIEA 2WZMA 4U31A 5B7ZA 3LTPA 4P7OA 3DFHA 3OGRA 1R3SA 5LGZA 3C2FA 4EP8C 3KTSA 4NU7A 1WDWA 4LXFA 2QCFA 2ZVRA 2V2DA 1W17A 4RDZA 4LB4A 5FL0A 1FCVA 1MZRA 1KM2A 1X6LA 2YL9A 1IZJA 1KRCC 2CXEA 4D6GA 4S3GA 3K8KA 5K4XA 2DSKA 1E6ZA 3KCOA 1ZAHA 1W3TA 4H9TA 3C2VA 5C6MA 3IIOA 5AB3A 2G37A 2ZX5A 5JRBA 5A8OA 3W2JA 3MBFA 3IARA 3KS6A 1OG6A 3NQ8A 1J12A 3FEQA 3WF4A 3NIYA 3W70A 2HTMA 4DY1A 2VFIA 1Q6DA 5AYBA 4BEQA 1P4CA 1EF3A 2VD8A 5C70A 2YCLB 5GRTA 4B15A 2YDSA 1UP2A 4UXDA 4KS0A 4NZ5A 2D24A 4WOZA 3W7RA 1TTPA 5LNSA 1IWBA 1ZBWA 4WVXA 1KV5A 4RCXA 3ME3A 1Y8BA 3UZZA 3GKFA 4HPGA 5ABTA 2C18A 3R8HA 1CB2A 1HNYA 2PP3A 3KOWA 1E0XA 3LCGA 3T08A 1E5JA 3WLOA 4K7VA 4CQDA 1LL6A 3RG6A 1TPH1 4WZHA 1GKRA 3KRBA 4H4VA 2GGJA 3VFLA 2E1WA 2JF7A 2C3ZA 4DBUA 1E4NA 4UTKA 1NDWA 1E6SM 4DUWA 5FJJA 1KN0A 1GETA 1XH2A 3MV01 1RBOB 4GIAA 4PEKA 1UD6A 1XCXA 3CT7A 4DZ5A 1JEZA 2C79A 5CAHA 3FJLA 4WLCA 1YYAA 3N13A 4EPDC 4HPHA 3P80A 1EEXA 3DZ1A 2W27A 1T6MA 1K03A 3TUUA 2OEMA 2GR1A 4YWSA 3CMGA 3GAKA 4GOAA 1EJXC 4XZWA 3HGOA 1R38A 4HA3A 3BCFA 2DZSA 5E6YA 3EAUA 1MRAA 4DF1A 4HB7A 3FYYA 4Z1AA 4JTSA 1GGOA 2V30A 2VX7A 2J7CA 1M04A 1S3HA 1VEPA 1OM0A 1HKIA 3GXIA 4WXYA 3FJ4A 3GVRA 1SO4A 2IPJA 5LA2A 1ZTVA 1O94A 2DT3A 3YPIA 2OX1A 1GPFA 2J25A 5ECUA 2QJMA 4A3UA 4PSRA 1HJWA 5TR3A 4PMYA 2NPXA 1ZJHA 2ZDRA 1F3XA 4M81A 4JBRA 4QLJA 2BTMA 2Z29A 4JTQA 4BQ2A 3WH9A 1B54A 3U8GA 3DG3A 3G77A 5ENLA 3P93A 4J3TA 2PGFA 3WUBA 4M6UA 4PR4A 1PIIA 4Q8VA 2Y4SA 3TA6A 1US0A 3NZQA 2PTXA 3VE9A 3LEPA 3VTRA 3GD6A 1WAWA 4A4AA 1RPKA 4XD6A 3Q67A 1NY1A 2G5WA 3AMDA 3HN3A 5DXYA 1JVNA 4AWSA 5CJMA 3M07A 3GUWA 4D6DA 3CM4A 2O56A 2YX0A 1YBQB 3TK7A 5K4ZA 3HGJA 2EO7A 1FY6A 3DEQA 5U4NA 1I60A 2HDJA 4POCA 3AS1A 3S3GA 2R91A 1H61A 1PZ2A 1UBPC 3N2CA 2FLIA 2JGYA 3AMGA 1BWKA 3FDGA 2Z26A 3UWUA 4DPPA 4R27A 1VDVA 4YVXA 3W3OA 5FSEC 3HF3A 2JKAA 2YKKA 3JRKA 2PDUA 1QW8A 1FWGC 1X1OA 3UZ5A 3XINA 4AX6A 4XTDA 1F2JA 3CHDA 4LCRA 1JDAA 4Q4RA 3APYA 3WFAA 1XL9A 1PXGA 4O0QA 1U30A 1GRTA 2PP0A 2L5HA 3LNMA 1XLMA 5I3KA 2HQAA 4QBXA 3NO1A 2QCMA 4UTFA 2E6DA 1B57A 3B9NA 3GC5A 9CGTA 4XZHA 3SCTA 2DZVA 3L4TA 4H9MA 4C6LA 5G2HA 1ZBKA 4REQB 2FFIA 2IW0A 1XRSA 4OU1A 4YYFA 3RAOA 2O9PA 4LVAA 3C61A 1JI1A 1M65A 1VFFA 3MI3A 1IV8A 3QHOA 1XLGA 3AMLA 2Q6ZA 2FGZA 2EQDA 2RDXA 4Q4SA 1DJHA 3PBGA 2F8QA 1DV7A 4GH3A 1W1VA 3RMJA 3TOPA 4Z1BA 2DT2A 4X9SA 1DQWA 2BLEA 1UZDA 5I24A 4M56A 2WO5A 1GEQA 4V27A 1JD9A 5LHFA 4MWAC 3ZQ9A 5IM51 3L68A 5BU6A 4QQ3A 2E5CA 4R34A 5KSWA 1OIFA 3CB3A 1M6JA 2Q3OA 3DXIA 3NYDA 4LVBA 3VMPA 3S5ZA 1S5WA 1YQZA 2OTDA 5HMSA 4OBSA 4CN1A 3LCIA 1YNQA 4P61A 1KRBC 3I65A 1K9TA 3W37A 4S1FA 2AAQA 4DBEA 1H7PA 1N8WA 2VURA 5LGXA 4HU4A 3UGVA 4K36A 5IXEA 3KZPA 4M82A 1G7VA 1UD5A 4FR1A 4P2VA 2FQIA 3T9PA 1J0IA 4JZ5A 1TCDA 4U2ZA 4MIMA 2D2JA 3BICA 1YQ2A 4H2HA 2AKZA 3TONA 2WXDM 1EC8A 3MT1A 2WANA 4CD6A 4U4MA 3RU6A 1YW1A 1V7YA 3IS4A 4ZQOA 5LSMA 1G67A 1X2GA 1CXLA 1ITUA 3QXBA 3L4XA 4KRTA 4H4QA 3SUTA 1XSIA 4K37A 4A6GA 1T96A 5EFFA 4WCJA 1VJSA 2OR2A 4RE3A 2DZBA 2FZ9A 4PUEA 3DH9A 2BGNE 3WEOA 3V5FA 3KM8A 3U5YA 4N9CA 2E6YA 1PZ0A 2RDTA 1EO7A 2VWSA 1RH9A 1TIWA 4OV4A 3VUPA 1VBGA 3TQ0A 1EJUC 4J28A 5B7YA 3CZJA 1TPWA 3GG8A 4UMAA 4PUNA 3KW3A 1JCTA 2I17A 2VKZG 5DFAA 1UP3A 3WL1A 4P5UA 1YTKA 4YJ5A 5D2WA 4DJFD 3KHJA 4C6OA 2GJXA 4L6DA 1FCUA 2VGFA 3SIMA 4UZUA 1NWUA 2DU2A 2ZQ0A 1H2IA 3LMZA 2OJPA 1V3JA 1PTAA 4S3KA 4UQ9A 1MW0A 1ISVA 4XSLA 5C9WA 5AVHA 3WEMA 3BV4A 1W54A 3N17A 3HG4A 3IJ7A 1WPCA 3TE9A 4PCPA 3V35A 2ZXDA 4PCTA 3TP4A 4Q3MA 2ZUWA 1GSNA 2NSXA 5G2IA 4WRHA 1L6SA 3Q58A 4IX2A 2GQ8A 2WPGA 1L6GA 2ON3A 3V7PA 4BY3A 1N60C 3BAJA 4EF9A 3UVAA 2ZE3A 4S3BA 4IP7A 4UIOA 3T0AA 4JTAA 4DXKA 1L0PA 1R8LA 3VNIA 3IAPA 4DPQA 4D6JA 1GERA 2G8ZA 2DPEA 2QCCA 3TN5A 3SSJA 4MSSA 2I9EA 3LXBA 4F0KA 5HANA 4LU0A 1AQHA 4LYQA 3SFKA 6XIAA 4HZ7A 3HG5A 4XIMA 1KFKA 4R85A 4H04A 2DZUA 1YHTA 4FHAA 3CASA 4Y9NA 5CGMA 1XIJA 3C56A 3QR1A 5FEWA 1QR7A 4M6VA 3UPBA 2PDHA 2IXVA 1AW5A 3TJLA 3G1DA 2GDUA 1DKWA 2VEPA 3KDNA 2XN2A 4IUGA 3N73A 2FMNA 2R1NA 4XZMX 1R9YA 2Z1KA 1MO9A 1EFZA 5KITA 2E09A 2X16A 4EACA 3E12A 1J6OA 3W85A 3C0LA 1JDEA 3QYQA 3N2TA 3RO6A 2YZRA 3VNMA 1NFGA 3W1TA 1XRTA 1R2SA 3ABSA 4DYEA 1OX6A 2JE8A 2GGHA 2Q8ZA 4HZ8A 1A5AA 4DM1A 4NI8A 1EGVA 4LF1A 2VL4A 4YWOA 4TV6A 2BB0A 2Q8LA 1KKOA 2NUXA 4HNUA 3URNA 5D09A 2V5KA 3O15A 3NQEA 3GH7A 3FK4A 2HSAA 3T2QA 2ICSA 4Y7EA 1OHLA 4NYUA 2QS8A 3LCLA 4GIEA 2CESA 1XFCA 4NNCA 3KWXA 5HINA 3LPPA 1V97A 5BXSA 2BY2A 1P0KA 1KFCA 4KETA 3INPA 4MF4A 1EZ2A 4DN1A 2GQ9A 1LQAA 1ESWA 4GX9A 3L2MA 1GHRA 3SCQA 2QPSA 2WSQA 2RKXA 4W85A 2DSVA 4A3RA 3ITYA 1V6YA 3ARSA 3CLWA 1F3PA 1UBSA 3F4WA 2GGGA 4H4XA 4S38A 3WDHA 1DXEA 4C6FA 1DL3A 4F4RA 1CPUA 2QCDB 1QNVA 1W5PA 1UKPA 1L2QA 1AH4A 1U22A 1GHSA 1Z44A 4LTSA 3R5EA 5AC5A 2BP1A 1ZENA 4IG2B 5I3GA 3ABOA 4MNJA 2YZ5A 3GB6A 2OQHA 2FB2A 2AMGA 2G3IA 1KCZA 2A3CA 1SSGA 1TWIA 2DZAA 2XFFA 1I1WA 5H91A 3MHUA 3EXSA 3VD4A 1GRAA 1CX9A 3H7RA 3K13A 4O15A 1PX4A 1W1ZA 4DJFC 3E5PA 4AF0A 1JFHA 2BHZA 1E1CA 3GRSA 4KFOA 2OSYA 1WV2A 1H1NA 2CERA 1RV8A 1G9HA 4YCOA 1PPIA 2VZOA 3LRLA 4JPGA 4RXGA 1H6VA 4J57A 3K8MA 3OLIA 1LG1A 1XIDA 1JNEA 1FWIC 3TZNA 4LAOA 3PSWA 1XLFA 5CPMA 3EWZA 4GH1A 4IXHA 1V3HA 3EGJA 4O1BA 1VRXA 2CIPA 3W71A 2WCGA 1TWDA 4M19A 3ARXA 1LF1A 4D6IA 4JTUA 1I2QA 3AUOA 1HKKA 2ESCA 4ROPA 4D8LA 4F79A 4JGDA 4K8EA 4ZO7A 2XFWA 2F6XA 2FJUB 3F4VA 3LLXA 3VU2A 3C0QA 4C6NA 4C7DA 2Z2UA 3LA4A 4KCTA 5AZ0A 1OJTA 2CLHA 1EXPA 2Z27A 3V75A 4QJ3B 1FEAA 3WQ8A 1KXHA 2XSXA 4IP5A 2G4JA 3GXNA 4OIFA 1WXJA 1OD8A 1DWJM 4OVXA 1KM3A 3I7QA 3WNLA 1OGGA 1VAHA 3C8NA 5FF7A 2VCAA 3LBCA 3GTXA 4X63A 2VFHA 3ZFHA 3AYTA 1C29A 4MVAA 2JK2A 4GYKA 1BG4A 1E72M 4AFYA 4CQAA 2RUSA 2NT0A 3MKKA 5T9CE 3CPRA 2XVPA 2ZA3A 4O8AA 4OGZA 2GRTA 4X0NA 3A7UA 1JEHA 3MHGA 1PX3A 4YN5A 3DYMA 1MWOA 4KGJA 2VEGA 1R47A 5E09A 1F8MA 3CYVA 3UF9A 4EWND 3FNDA 1PAMA 2QVHA 1GJWA 1A5OC 3O2LA 1J6PA 2WM1A 1WYGA 2HNEA 2PSNA 5HR6A 3EAOA 3VC6A 1BRLB 5CPLA 1WB0A 3TW7A 3ZYZA 1JRBA 3TYAA 1UP0A 4RXFA 2OCZA 3W7PA 3VK5A 1CIUA 4AVNA 4JYFA 4XZIA 4BCEA 2XGZA 3UA4A 4I6VA 4AYGA 4EMJA 4PMNA 3CPUA 5EYWA 1TKKA 1PCKA 4U5KA 2E40A 4C6IA 2YCIX 4XTIA 3EDJA 3ARTA 1SW7A 4J2PA 5A6LA 3W7CA 5CZTA 1HKWA 2WNWA 3B8DA 4ENLA 4M29A 4PL2A 4MJ2A 2Y5EA 3WK1A 1Q6EA 2YFOA 3VNJA 4CQCA 3R89A 4K39A 1MXGA 4JQ2A 4ZE5A 1XBYA 2FIQA 2DIJA 4I6KA 1GOXA 1JNDA 2YDRA 5AYXA 2POTA 3VFCA 4IJCA 1JL8A 4V33A 3P81A 1K7XA 2R9ZA 2OX4A 4PUKA 1KBIA 3A3HA 1JZ8A 4TX6A 2G3FA 2OG9A 1ITCA 3I7RA 3RMEA 1JZ3A 1C90A 1SSDA 1PS9A 1Z3NA 2OQLA 3GWQA 4R9OA 4XZ9A 3TSDA 1VCVA 3CO8A 2B81A 2QUTA 1YE4A 4IPIA 5MHBA 3VIOA 4FZIA 2CFYA 1R30A 5JCNA 3WDIA 1CXKA 3RLVA 1QWKA 1TTIA 3CZKA 2VRKA 3W25A 4EQWA 3WF0A 4KWUA 2PEVA 2IS7A 4MB3A 1OC5A 4DRSA 4KEMA 1KM1A 4HN8A 3K2GA 4LOCA 5F2GA 4UQDA 2CWNA 3W2LA 1H5VA 2QZRA 1DWGM 2NXHA 1YXDA 3H7VA 1GJPA 3C2EA 3THDA 4LUYA 4RE4A 1ZP3A 5HMDA 4QISA 2NVCA 2WKJA 5JCMA 1XYZA 4JD4A 3T0DA 3SURA 3DU0A 3LOTA 4GVGA 4GBDA 4OKDA 2Y8VA 1IT7A 1UCWA 3HURA 5D32A 4NJHA 3WBEA 1NWSA 1XIBA 3VXGA 1VZWA 3N3MA 1FBAA 3TC3A 4RDWA 4ZQPA 2DT1A 5KETA 4H1ZA 1Q4NX 2RH9A 2OO0A 3IIZA 4DHGA 2Y7FA 1J93A 3NQBA 2BMBA 3M44A 1B5TA 1XKYA 1EDGA 3MY9A 3ABXA 2Y88A 1EUAA 4J1OA 2QLYA 1TX0A 3B0VC 1PE1A 4FF5A 4IT1A 1XG3A 4WJEA 1WOBA 1AZ2A 3FEMA 2P0IA 3GHSA 1M1BA 1XANA 3OZOA 5FA5A 1C8YA 5E6ZA 4L6OA 1MDLA 3N3TA 4V28A 4N4QA 3QSRA 2NXGA 2V5BA 5JCKA 5FJRA 1S5VA 3SJ3A 1YXCA 3PJXA 5AHMA 3MI6A 1US2A 3UXIA 2J8TA 4B3LA 1NF0A 5JBDA 2FHBA 2NQ9A 3WJZA 3BAWA 4J3SA 3HJEA 1NSJA 3NPVA 4DNHA 2W0HA 4CQ8A 1V5XA 2YIHA 4LYKA 1OYCA 4N0RA 2WSYA 4XUGA 2YVJA 1K6AA 4MB5A 1ICSA 3UR7A 4D72A 3W6LA 1R3VA 4GE8A 5AY7A 3IGUA 4E8CA 3ANUA 1A0DA 3LTSA 2QJNA 5HUPA 3CGEA 1IE7C 1EGMA 2X41A 1ICQA 1SUXA 5H2ZA 1EP3A 4Q6JA 1OVDA 1LOQA 4PMOA 1M7OA 2UY2A 1H0GA 4L1WA 1EA0A 3IUIA 1TPC1 1NDAA 4JR5A 2BHUA 1WDRA 3N2MA 2BDQA 3MMUA 2VYOA 5IBXC 2OT0A 2VX5A 4ICNA 4JXCA 2VC5A 3NS1B 1Q13A 3CUFA 1UA3A 3R0KA 3KEHA 3BMWA 1OK4A 1XBZA 1Q6LA 1EC7A 2E77A 4AD3A 1HJUA 1CT5A 1KRAC 4U3AA 1B31A 1P1XA 3CEUA 4DAFA 4RE0A 2TPSA 4KCVA 4Z2KA 2WJEA 3TFXA 1HXJA 4M7TA 3VC5A 4JTCA 1GOIA 1KQZA 3QR3A 1DORA 4AD5A 1ME9A 2VI0A 3GM8A 1AL8A 1S38A 1VPXA 4UWMA 3VDCA 3GC2A 4REQA 3WQWA 2WPCA 2ZVIA 2VZSA 3N29A 2CLLA 1DWFM 1RD6A 1C7SA 1EUNA 5L9FA 3T8QA 1EDQA 3M16A 1OGBA 3KLKA 5CPSA 4GVHA 1EYEA 1R85A 4HCDA 3LGGA 3WJSA 1DIOA 3WDPP 5LIWX 1WXZA 1HTIA 1C7TA 3IGXA 1FIQB 1EWDA 4UFHA 4M1BA 3S1WA 2HE5A 3QN3A 4CU8A 1FHDA 4UMCA 3WKZA 2Y7EA 2WCSA 2JGQA 2HNHA 2YGYA 5LKYA 4J40A 4OT7A 1UUOA 1M01A 1EXBA 4L56A 2INFA 2CBIA 1NEYA 2C1HA 5M17A 1RM6B 1SJDA 3AMKA 2E9MA 2WC3A 2J8GA 7PTDA 2GOKA 1AOGA 2ZXQA 3M64A 1U1UA 4AZ6A 1NF7A 1NWTA 1VFLA 3UG4A 1XR2A 3WK3A 2DVTA 2POZA 5BMWA 1H50A 4H4IA 3CUJA 3VOFA 5FJOA 2INZA 3R58A 1ZMDA 3UERA 3PJTA