2GGEA

Crystal structure of mandelate racemase/muconate lactonizing enzyme from bacillus subtilis complexed with mg++ at 1.8 a
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
373
structure length
373
Chain Sequence
b'LVKIVRIETFPLFHRLEKPYGDANGFKRYRTCYLIRIITESGIDGWGECVDWLPALHVGFTKRIIPFLLGKQAGSRLSLVRTIQKWHQRAASAVSMALTEIAAKAADCSVCELWGGRYREEIPVYASFQSYSDSPQWISRSVSNVEAQLKKGFEQIKVKIGGTSFKEDVRHINALQHTAGSSITMILDANQSYDAAAAFKWERYFSEWTNIGWLEEPLPFDQPQDYAMLRSRLSVPVAGGENMKGPAQYVPLLSQRCLDIIQPDVMHVNGIDEFRDCLQLARYFGVRASAHAYDGSLSRLYALFAQACLPPWSKMKNDHIEPIEWDVMENPFTDLVSLQPSKGMVHIPKGKGIGTEINMEIVNRYKWDGSAYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Mandelate Racemase/Muconate Lactonizing Enzyme from Bacillus Subtilis complexed with MG++ at 1.8 A
rcsb
molecule keywords yitF
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 128
structure length 373
sequence length 373
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2ggeA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2ggeA01
3QKEA 3FVDA 3CB3A 4DHGA 4ZCWA 2MUCA 2MNRA 2XH2A 1ECQA 3B97A 1EBHA 1FHVA 4GISA 3CT2A 2XGZA 1MRAA 1WUEA 5FJOA 4Z17A 1BKHA 1JDFA 2OG9A 1NU5A 4ROPA 2PGWA 1RVKA 3UJ2A 3DFYA 2ONEA 1W6TA 4X2PA 2ZC8A 1ELSA 1KKOA 3T4WA 1YEYA 3N6JA 3I4KA 3SN1A 3V5FA 3NO1A 2PCEA 1EBGA 6ENLA 3TQPA 4MGGA 4ZA0A 5EU9A 3D47A 2GGHA 3JVAA 4IZGA 3V3WA 1KD0A 2OZ3A 1MNSA 3QN3A 2PPGA 2XH7A 3P93A 2PU0A 2PTXA 4JN8A 3VC6A 3KUMA 2PU1A 3FCPA 3FJ4A 3I6EA 2PP1A 2AKZA 4FI4A 4GYPA 2P88A 3TWAA 3UGVA 5FJRA 4KWSA 3DG3A 2GGIA 3DESA 3TJ4A 2GSHA 2QJMA 1KKRA 2P3ZA 4KPLA 1ONEA 4IP5A 3HPFA 2QJJA 3ZVHB 5ENLA 1E9IA 2FYMA 4IL0A 3T8QA 3I6TA 5FJTA 3TTEA 3H70A 3ENLA 3NXLA 3BJSA 3H12A 3R0UA 3RRAA 1SJBA 2P8BA 4A35A 3UXLA 4H1ZA 1P48A 2GGJA 3RCYA 2AKMA 1MUCA 2QJNA 4MMWA 3FXGA 4J3ZA 4HCLA 4GGHA 2CHRA 3PWGA 1JCTA 1EC7A 2PMQA 4IL2A 3UCCA 3TCSA 4E5TA 3K1GA 3DG6A 2P0IA 2RDXA 3BOXA 4K1WA 3VFCA 5BOEA 1SJDA 3UJFA 3JZUA 2PP0A 4A6GA 1DTNA 3IK4A 3D46A 2QVHA 3QPEA 4KT2A 3DFHA 1IYXA 7ENLA 2GL5A 3R1ZA 4J1OA 3P3BA 3UJRA 4GYPC 3CAWA 2OFJA 2HNEA 3S5SA 3NFUA 4DX3A 2XH4A 3STPA 2DW7A 4FP1A 3FYYA 1TE6A 4HCDA 4MKSA 2QGYA 4DWDA 4GIRA 3PFRA 2I5QA 3UCDA 2OQYA 4K8GA 3NZGA 1XPYA 3RO6A 1BQGA 1MDLA 1WUFA 2OZ8A 3N6HA 3IJQA 4HPNA 3VC5A 3T6CA 3SSZA 3R25A 1P43A 2OO6A 2PTWA 3GY1A 3QLDA 3RGTA 3MZNA 4G7FA 2AL2B 2POZA 2OKTA 4EWJA 3MKCA 4IHCA 3QTPA 3OZMA 3UJSA 4E4FA 3CK5A 1FHUA 3UJEA 3ZLHA 1JPDX 3RITA 1F9CA 4KEMA 4H83A 2OPJA 5IDZA 3GC2A 3MQTA 1TZZA 3Q4DA 4IT1A 3H7VA 3U4FA 3SN0A 3RR1A 3MWCA 5J04A 3R0KA 3ZLGA 3Q45A 2XH0A 3H8AA 4DN1A 3EKGA 2HXTA 3DGBA 3V5CA 3ZVIA 2NQLA 3DIPA 5BOFA 3PK7A 3GD6A 1L8PA 3N4FA 3CYJA 3BSMA 2P8CA 1XS2A 3VCNA 4DXKA 3GO2A 2ZADA 3ZVHA 2PGEA 3SJNA 3SBFA 2PSNA 3MSYA 2HXUA 4K2SA 4E8GA 3U9IA 3SN4A 3OPSA 4DYEA 3EEZA 2XSXA 2PTZA 2QDEA 3UXKA 3MUCA 3MY9A 2OVLA 4IP4A 3T9PA 3IJLA 4HNLA 4HNCA 4HCHA 3JW7A 4HN8A 3VDGA 4E4UA 3OP2A 4GMEA 2OQHA 3ZLFA 1PDZA 2OX4A 3ES7A 5FJPA 2HZGA 1OEPA 2GGGA 4Z1YA 3OZYA 5FJUA 3TOYA 3VCCA 3DERA 4G8TA 1PDYA 2PS2A 3R10A 2GGEA 4GFIA 3N4EA 3OTRA 4GGBA 3P0WA 2DW6A 2PP3A 4M0XA 1SJAA 3DEQA 3THUA 4F4RA 4E6MA 3S47A 1R6WA 2OLAA 2PODA 1EC9A 2FKPA 4HYRA 2AL1A 3VA8A 3OW1A 3R11A 3DDMA 3TWBA 2QQ6A 4YWSA 4ENLA 2O56A 3FV9A 2OZTA 4JHMA 1MDRA 1JPMA 1SJCA 1KCZA 2PTYA 1R0MA 4H19A 2PA6A 3V4BA 3TW9A 3PWIA 2QDDA 4A3RA 1TKKA 4H2HA 3DG7A 2AL2A 1NELA 3CXOA 1EC8A 3SQSA 3ES8A 3IJIA 2GDQA 4JN7A 3TJIA 4M6UA
chains in the Genus database with same CATH superfamily
2CERA 4NP7A 2UV8G 3MYOA 3TAKA 4JX5A 4KCTA 1E1CB 1TREA 4LBSA 4TX6A 1FBAA 3LY0A 2FHFA 1ISYA 1WYIA 4G9PA 1KBLA 1PX4A 7A3HA 1V5XA 3LX9A 2ZZ3A 3QSTA 3CXBA 3M41A 1K70A 5FCZA 3QF0A 4ICMA 2PZNA 1FWEC 1YX1A 3P5YA 4CQBA 3FKRA 1M1BA 4D6IA 4A3QA 3WJSA 4WR3A 5B7ZA 3L68A 5CC6A 1JCYA 1XLLA 4XAGA 1FWSA 3GDBA 3H2EA 5JUVA 5CPLA 1R9YA 4KEUA 5HWJA 4OQVA 4V33A 3E2VA 5A6BA 1LPFA 4PUKA 1LP6A 4QLKA 1GSNA 6A3HA 2ZXBA 4GACA 5G4WA 1GOXA 1DEDA 1KM4A 4HZ7A 2E68A 4PUNA 4TXEA 3V3WA 5JIWA 1KD0A 3O7UA 4QS6A 2QAEA 1D2KA 3SDOA 2WMKA 1ME8A 3VOIA 5CSYA 3URHA 1O68A 1MMFA 1HFBA 2DPEA 3CNYA 4G5DA 5IDIA 3I6EA 5LGZA 4NI8A 3U2ZA 3VE7A 5EMUA 1UOKA 4L65A 3WQWA 3E6EA 2GGIA 4CNSA 3W7QA 1ZU8A 3NQMA 4K3ZA 2E3TA 3AYVA 1Q66A 4NZ3A 4TV5A 1E72M 4IP5A 5HBFA 2VI0A 1L6GA 2YYUA 3UR2A 4CUCA 5FJTA 4NHVA 4I8DA 5C9XA 3WLNA 2JQXA 4PMUA 4XZLX 4U3AA 3FJLA 1UKTA 1JXJA 4HTYA 4A8IA 2UY4A 1XINA 3CAQA 1VFSA 2IKJA 1P5BA 3CB8A 1FH7A 3ANVA 3MI2A 3OJGA 2HNHA 4H04A 4KERA 5FJJA 3AU6A 1Z89A 3UCCA 4AD5A 3GVWA 1LT7A 1LCOA 4JQ9A 1MO9A 2QUMA 3NO5A 2EGZA 4LRTA 3GG0A 5LKYA 4QE1A 1XIDA 3TYCA 4Q7BA 3RU6A 1YMYA 3L9CA 2WHLA 1A49A 4ORMA 2BFGA 2QVHA 3D3FA 3R1ZA 2A3CA 4QTGA 3BDKA 3R07C 1PS9A 4GYPC 5E93A 4EANA 4U5KA 4DWSC 2G3JA 2BBFA 1LL6A 4JDBA 4FP1A 4UNIA 1PKNA 1K9DA 1WDQA 3FJ6A 3QY8A 3CQ0A 1BG4A 2H3DA 4DWSB 1YRRA 2O9TA 4LXFA 2EG8A 3PG6A 2G4JA 3BPWA 1H63A 4PMZA 1BXNA 2YCLB 3DHDA 4O54A 3ARXA 3NG3A 2G4FA 2QT3A 3M0ZA 1WUFA 4PBGA 3CO4A 2YAUA 1ZPTA 3UYCA 3GD4A 4WY0A 4G7EA 1F74A 2QW5A 4Z08A 4MZ8A 4IMFA 3RIKA 3F2BA 1NTHA 1XGDA 2QNEA 4W85A 3CUZA 3KL0A 4KEVA 4HNVA 5D2WA 1E6ZA 1KRMA 4GY7A 1LJYA 1X98A 3LHTA 1X2GA 2OSWA 3LM7A 3ZOAA 1ADOA 4IHCA 3EOOA 5D4YA 3RX3A 3WNOA 1UWUA 3G1VA 3LSBA 3L7RA 4MFEA 4U5IA 3U7VA 2G96A 2CZFA 4RW5A 2ISDA 3PANA 4FX6M 3FLUA 4IFKB 2ZWYA 3OU8A 5LIKX 3H4WA 3PG8A 3UERA 3UNDA 1S2UA 2J74A 1B3OA 2WZIA 4TMCA 1GRBA 1WDWA 3QBUA 3L12A 1ONWA 2ZZ2A 2Y0FA 4IUGA 3E96A 3E0WA 1B30A 2PWUA 1C93A 3DJJA 1CX9A 1YXCA 4DN1A 2OX1A 2XIJA 3W82A 3O6DA 1WXYA 3TN3A 2BODX 2ZICA 3S9IA 3ARZA 2QIWA 3AYRA 5BXTA 1NP0A 4BKNA 1BVZA 3WMSA 1I75A 1LOQA 6TIMA 3ZVHA 4GY0A 4QDMA 2Z00A 4M80A 1C8VA 1TZ7A 2ISFA 1Q6LA 5D30A 3F5LA 1BLIA 2AGKA 3U9IA 2BASA 4DYEA 3IANA 1KLZA 3VNDA 2PTZA 2Z29A 3K1DA 3M0IA 1Q5MA 2ZUNA 4AHPA 4IP4A 5CCZA 1KCLA 3GQYA 1KR1A 3WD1A 3MT1A 1X97A 1Y5XA 3CQHA 2PDGA 4N9BA 1XJBA 3FHAA 1G7UA 3UVAA 1OEPA 4PA8A 4ZB5A 3TW6A 4AW7A 2GQWA 5CG7A 4JHOA 4D1JA 2OGJA 4C60A 2Y24A 2ZTJA 3SCQA 3W7CA 5A1AA 2X8RA 2PWDA 1ZNNA 3GTXA 3PUGA 1CGYA 4HA4A 2Q09A 2QKFA 4FXSA 4AY8A 4INFA 3F5JA 4F40A 1VBHA 2I57A 3GRIA 1XKJA 4PCNA 3L4WA 3W27A 4WKAA 6CGTA 3O6CA 1U2YA 1HUVA 4Q4QA 1SUXA 4ADWA 1V51A 3DHFA 3NQVA 2YL5A 4MZYA 3WUFA 5JBEA 2BHUA 4Q8UA 1F73A 3GDMA 3QMRA 3GXFA 3WNNA 5CPTA 2J7DA 2WMGA 3K46A 2J47A 3MHUA 1HT6A 1UZDA 3KVMA 2OKOA 3VD9A 8A3HA 5I5RA 2VGGA 3DN5A 2PTYA 3FN9A 1KM1A 1R2SA 3DOPA 4PTMA 3LBOA 3S2NA 1SMDA 1SYTA 4DZAA 2VR2A 3UY7A 1JD9A 2E6DA 3FAWA 4IIFA 4F0SA 3PWIA 1YBQB 4QS5A 1ADSA 3NL3A 3WN6A 3ZZ1A 1IR2A 3SY1A 2PDIA 3SQSA 1BHGA 2XWDA 4K38A 3IJIA 3EX1A 1PKMA 1K7XA 1XBXA 4JTEA 1G4EA 2CKRA 2BLEA 2MNRA 4B5SA 4X2RA 2ZA1A 4AZHA 3IJ9A 1FHVA 1RPKA 3CUGA 3GHSA 3N73A 2VR5A 1DYSA 4U2ZA 4JTUA 4J2MA 5FJOA 1GCYA 5BOOA 5EBAA 5TQLA 2A2IA 3GXMA 3WL1A 4OKDA 1NU5A 7PTDA 4MYXA 2GJPA 2DVXA 2E6YA 1E0XA 3WD2A 1KXQA 1QI0A 4UTWC 3FYPA 3B03A 2LLEA 1VLWA 2V2DA 3WDQA 2RJHA 2ZRXA 3AROA 3C0JA 4PMVA 2C1GA 3LEPA 1AJ2A 2PCEA 1UR9A 4GI4A 3F7JA 3EB2A 4MHBA 1Q7QA 3G24A 2V6OA 4GZJA 2DUAA 3G0XA 4N9CA 3N9SA 3QN3A 4ZB2A 2J24A 3QR3A 4GABA 1EH9A 5LZLA 2Z1BA 1TTQA 5A8PA 4FMVA 4ZSUA 2PTXA 4HMEA 1ECEA 5DRIA 4P5UA 4JL1A 2ZTKA 1V6VA 1GQLA 1E55A 3VGDA 5BCAA 2RHGA 3MCNA 3GH7A 3QC0A 3WEZA 3TFCA 3TVAA 3NQEA 2HROA 1Y0EA 3BXWA 4O57A 3SCTA 4UWMA 2BOGX 3GNOA 4JGDA 1YDVA 1E9IA 1N82A 1V3IA 1UZ1A 2ZZ1A 4Z0JA 4JIHA 4HZ6A 4QX4A 3S5ZA 1PHWA 2X09A 4LYRA 1UR3M 3BG9A 4HU8A 1HJQA 1DQWA 1JR1A 2INFA 4P8VA 2O4MA 4YS1A 2AKMA 1B31A 1J12A 1EIXA 1HGYA 3F1QA 1ENUA 2D0HA 4GGHA 3GU2A 3UW6A 4NZCA 1MSSA 2IMRA 1EZWA 4WOQA 3MUZ1 3HGOA 2E6AA 3P62A 3VGGA 3W26A 4AD4A 3FIGA 3WJYA 3PG9A 3WCZA 5CPMA 1E9ZB 1I1XA 1GVEA 4RDYA 4H41A 4O17A 1M7JA 3NWRA 1UROA 2PLCA 1QK2A 2E1WA 3CWNA 3MUY1 5HK4A 2G97A 4LB3A 3F5KA 5HOSA 4O1BA 2OFJA 1P1XA 3ARWA 3C2FA 4Q8TA 2OEKA 4UTUA 2OYMA 2P76A 1V6YA 3NQ6A 2EEXA 4XZNX 1OG6A 4DWDA 2VELA 1ZALA 3GHRA 4FOUA 3WQDA 5CPQA 4JAWA 1LBLA 4RPQA 1M9HA 3V0SA 4LCRA 2PI6A 2P10A 1ZY9A 4DQWA 3GY1A 4IXXA 3T0BA 4NY2A 4PE8A 2DSWA 3GR7A 4AAJA 2OWWA 4DAFA 4PUUA 5FS6A 5LA0A 3HG5A 2POZA 4J27A 4LAMA 1RD5A 4X9SA 1KRBC 3QTPA 3MCMA 2VC9A 4I8YA 4K7ZA 2G41A 5HMEA 4W4QA 2D24A 2PLKA 3STFA 3WF2A 2HS6A 3NSNA 3AXMA 5IDZA 3S1VA 3SURA 3L8KA 3T78A 3TYEA 4QQ3A 4HU0A 5GNZA 4AB4A 1J2BA 3QZ6A 1PX8A 2WO5A 4ACZA 1NWSA 3OHMB 3WQFA 5J04A 3ZLGA 4BWLC 1Q6CA 1V7AA 3EKGA 3MKVA 3RNMA 2CXGA 3BSHA 2DIKA 4XAZA 1LM1A 3OVQA 4M24A 2BC1A 1RJPA 3B3DA 2E9MA 4EPBC 1RD6A 4WQ6A 4UOQA 3CYJA 4AEOA 4F66A 1XIGA 4DXKA 4XV0A 5BU9A 5G5IA 1XYBA 3SBFA 2PSNA 3GG7A 5DY2A 4E8GA 4L4OA 2J7CA 2WOQA 7ODCA 3PF3A 3T40A 3HG2A 3DH7A 2V82A 1IGSA 3QQWA 1E1FA 1TJPA 4RZ5A 2QUTA 1FH9A 3M6DA 3MI6A 2WKGA 3CM4A 5GQBA 1MUMA 3WLPA 1J5SA 3C2RA 3SCRA 5JBDA 2D69A 2VHLA 3QMTA 3EMZA 2G3NA 4NZJA 1A5MC 2ASHA 5FF4A 4DUVA 4ZQPA 2YA1A 1RY0A 1RZMA 4LY8A 1XLBA 1W3HA 2GOUA 3F4NA 4LF2A 5AECA 3VCCA 3GK0A 1CXHA 1UZ4A 3DHUA 5EPDA 2FZMA 3M5XA 3TIMA 3UZYA 1DBTA 1H3GA 4Q4RA 4C6KA 2V5LA 1PEZA 3G1XA 3LLFA 2A7RA 2C1HA 4WF7A 3M46A 2HTMA 5HPCA 3ALGA 1WXJA 3HV9A 5A94A 4FS9A 1CXKA 3I7SA 5JCMA 4LVBA 1RH9A 4J9JA 1EC9A 4V27A 1VRDA 1XIJA 4GIAA 3VO0A 1V3MA 3DDMA 3G3MA 3FXYA 4REQB 3VD5A 4D71A 1C91A 2ZRWA 2GVLA 5AFDA 1GERA 2WVVA 3NVWB 2CFYA 3N15A 3GS6A 3U8GA 3UF9A 1LTDA 3CL7A 3T8LA 3ARPA 3S9YA 3OVRA 4XQ6A 1ZCCA 1VIZA 3UR5A 3TNOA 3D5HA 2XN0A 3DG7A 2YCIX 3QHMA 2KAUC 3TSBA 2XFFA 1NDAA 1FKXA 5E9AA 2PDBA 3ITCA 5FD0A 1QATA 1ISZA 3SW6A 1TCMA 4ORIA 2FZ9A 3W2LA 1U5JA 4H9ZA 5FSDC 4KKXA 1T8XA 1D7KA 3UWEA 1S2WA 3PHAA 4HA3A 1F7BA 1HJWA 3WK0A 3LPOA 4R7JA 4MADA 2PGWA 1EPVA 1RVKA 3S2JA 3DFQA 3S0CA 4QG6A 4OU1A 3ANUA 2EG7A 2FJKA 1W6TA 1ELSA 1M41A 3J7HA 1E40A 1ZQ5A 3QQ0A 1JRCA 4MZ1A 4HU3A 4OOUA 5C2GA 1FP8A 3KTXA 3L5OA 1XCXA 2ZDRA 5HQLA 2JEPA 3NO1A 4ACYA 1XLFA 4ZZ9A 3LRLA 1M6JA 4CNUA 4K8DA 3MHFA 1ZAJA 4Q8NA 3DC0A 3EPMA 2D3LA 2PPGA 3GFXA 4Q22A 2OCZA 4JN8A 2EAWA 3MP3A 1SB3B 2DZAA 4KW2A 1G5AA 3QVQA 4ES4A 4S3JA 4ZFMA 5ECVA 2C3ZA 1TZ9A 4O10A 5I23A 4AY7A 3N3MA 2VX6A 3HGJA 3CQKA 4RE3A 1ML1A 3WBEA 2GUYA 2PFHA 2VEFA 1ONXA 1CYGA 1XYMA 4ATWA 3BAJA 3B0VC 4PFMA 3QW3A 2P53A 3QY6A 2J3NA 3L4TA 3THCA 2CLLA 2VX4A 4JY9A 4U3CA 3W37A 1P48A 1OB0A 2SFPA 4ZQRA 3DUGA 4WEVX 2ZUUA 1FCBA 1GQKA 3IAQA 5HMSA 2QJNA 5EKYA 4RKAA 1OGSA 3RR4A 1H11A 4X61A 2OT0A 5C6MA 5CPSA 5DBUA 2TMDA 4IL2A 1Q6OA 2C15A 2GVJA 3QV7A 3BANA 2BVDA 1QAPA 3UZXA 2Y5SA 1A5LC 1RQEA 2QDHA 1W1YA 2ACQA 3M1ZA 3D3AA 2QCEA 2QYGA 2GQAA 4UTTC 3TZNA 2X1UA 3ZSSA 2GL5A 4OUEA 3VUPA 3KVKA 5KZDA 3L5AA 3P3BA 4Z2HA 5HULA 3NM3A 1MW1A 2IQDA 3IIPA 3GBEA 2X2YA 2X1RA 3F4VA 1JDAA 2FGBA 3CZKA 4LVDA 2O9OA 1T7LA 4JTKA 3W1AA 2E77A 1GVRA 5LSMA 1REQA 2E6FA 5DT5A 4I7WA 3AAMA 1R2RA 2D23A 2A3LA 2RDUA 3RO6A 4ADSA 1B5TA 4UFHA 2YOCA 1MDLA 4Q4MA 1TJ2A 2ON3A 3VE9A 2OZ8A 3PZ9A 2HQMA 4E3TA 2PLMA 4AQLA 3W07A 4BZYA 3DK4A 5E09A 1VB9A 3IJQA 4HPNA 1AA1B 3W1LA 3QV8A 2PWEA 4RZ4A 3WELA 1QW9A 3QLDA 1SZGA 4U2YA 1X38A 3BG5A 3P84A 1BWLA 4G6CA 3B8UA 4S3KA 4EWJA 5LXEA 3TV8A 2BY0A 4Y96A 3HTWA 3RJYA 1VLIA 3G22A 2EJAA 1YDYA 2GJXA 3UJSA 4Q32A 1DE5A 4LUTA 1QI3A 3E74A 1WYGA 2FZDA 2YX0A 2QMJA 3UR8A 3AIRA 5F1VA 2XDFA 4GYFA 1WDRA 1EQCA 3MWAA 1DIDA 4OHQA 3CYVA 1JCJA 3EOEA 3E0FA 1XD0A 4DELA 4LUJA 1RPXA 4AY1A 5J8LA 4GI6A 4V1YA 1I1WA 4ZL1A 3H4KA 5IOBA 1SPQA 3PPCA 2OWCA 1E6SM 1UA3A 2FGLA 5A6JA 2J7FA 1H0IA 1AQMA 2V63A 2VX5A 3GRTA 2VCAA 3DBNA 1W1PA 1H0GA 3H26A 4UBPC 1JEZA 5A8NA 3ABSA 3KOFA 4JNMA 5F7UA 4QG8A 3SRFA 1XLGA 3AHXA 3P2VA 5C8BB 2Z0IA 5I09A 4LJ3A 3MBDA 3ZT7A 2CCRA 3U57A 3UWZA 1HKVA 2WBGA 3LI0A 3B0PA 1XH0A 4OIFA 1EQPA 4G2DA 4B2DA 2GK1B 1QJWA 3BV7A 3CL8A 3HGRA 1N8FA 2C8NA 1O95A 1KGWA 3PNUA 5CXPA 1PDZA 4GX9A 1XKYA 1S5WA 4L6HA 1D3CA 5A8MA 1GVFA 3WH9A 2R24A 5L9FA 2VFGA 2V9DA 2EJ1A 4HPHA 2D0GA 1JI2A 5FS7A 1T8QA 1OJTA 3WLJA 4W7UA 3ELFA 4AHOA 4P8WA 2Z6JA 2IKGA 2PDNA 4POCA 2QS8A 1F4AA 2PP3A 4K36A 1DIEA 4ASTA 3UXIA 3AM9A 2J27A 2I5GA 4O11A 4AG0A 1C29A 3NVZB 3LTPA 4LGXA 1KV8A 2YYTA 3E0LA 1L9WA 2WWCA 3I7QA 4AXNA 5FS8A 5AC4A 1QMLA 2CBJA 4GJIA 3QPZA 2X8HA 3D9XA 2PCQA 3W7HA 1L2UA 2ABAA 4I9JA 1O94A 2QQ6A 4YWSA 3SCVA 4DUWA 4JHMA 5C9RA 4Q4SA 4CQCA 3WG6A 3O9NA 2VOTA 3F03K 1VBUA 7TIMA 3B9NA 4JFTA 2ZRUA 4KMQA 2PA6A 1AH3A 5C71A 4DI8A 2G50A 5LIYX 3VIIA 3BOFA 1BWVA 1K02A 3PVFA 4TOQA 3P61A 1KO0A 4M6VA 2QLYA 3SUWA 1EHAA 3GVVA 2E9LA 3WLQA 1J11A 2AL2A 3KOZA 1TWDA 2HBVA 4B5UA 2Y62A 1FECA 4N0RA 3N3TA 4LX4A 1KBKA 2C71A 1ZMDA 1VJIA 4GFSA 4GI8A 2MUCA 2J7EA 5CLWA 3L4YA 1EBHA 1E1EA 4UQDA 4XZ9A 4XD3A 2J7BA 3CT2A 4W86A 4F3HA 1WUEA 1VQTA 3RMJA 1D8CA 5G4HC 3E12A 4XAFA 4PYSA 1BYDA 4DRSA 1R30A 3EKLA 1ZUAX 2VUYA 1PZ2A 1HZYA 1M04A 2PB1A 1O1ZA 3IAPA 4KRUA 3VD3A 2ZE3A 3ICJA 1W5PA 4QDPA 4RDVA 5I0DA 3SAZA 5ER0A 4IQEA 4M81A 1E4MM 2HRWA 5DBTA 3UT0A 1Q6EA 2DGAA 3TYAA 4XBJA 3L4ZA 1FQ0A 2VENA 1NHRA 4LC6A 3EPOA 3CBWA 1CT5A 2YLLA 4LEQA 3LBMA 2DT1A 5AYYA 3NDYA 3VC6A 4QBXA 1R3TA 4MB1A 5GJMA 1C7TA 2V5CA 3TP4A 4YMZA 1T5AA 3WH8A 5TIMA 4YTRA 1KKRA 3G8RA 4LNYA 1H09A 4E4PA 2FYMA 2IW0A 2X40A 4JIEA 1JAKA 4Q4OA 5H8UA 2TPSA 5JH1A 4UR7A 1MUWA 3NCOA 3FA4A 3H12A 5FEPA 2B7NA 3A9IA 3PZNA 4KBXA 1KFLA 4YVXA 2EQ6A 1LQAA 2IKIA 3GDTA 1VJSA 3WD3A 5A69A 3KL5A 1US3A 2PRMA 2HBXA 2VVSA 2HPIA 3W7IA 2Q71A 6ALDA 5I24A 2WQPA 1K4QA 3R4IA 2B4GA 2XYLA 3O1NA 4HN4A 1A47A 4M6PA 3VIHA 3UQNA 4QLLA 1IWPA 4MLJA 1XISA 3LN3A 4H4XA 1K6WA 3QQ1A 4EMJA 4DF1A 7REQB 2R9RA 2O7SA 4RLIA 4MF4A 5CAKA 4GNJA 4MWAC 2ZBTA 2HNEA 4FO4A 4JTQA 4WGHA 3II4A 5A3HA 4QEHA 5E0KA 5LIXX 1GVOA 1OFRA 4UIOA 3UGRA 1WQ5A 4MWAB 1TYGA 3CV7A 1TE6A 4J40A 1S5MA 4EIVA 3LCWA 2PZ0A 5ABEA 3BTNA 1QDSA 1N62C 3I3EA 5C2XA 4AYSA 2J8GA 1I4NA 4YHGA 3VOCA 3MSDA 3EOUA 2ZXQA 5I02A 1FDJA 1RJRA 4DAIA 3LQGA 3H2NA 2VO5A 3IGUA 4P7OA 1SZRA 3TQVA 2BX7A 1MW2A 1LG2A 2NV9A 1XQLA 1KW1A 3PTDA 2ISWA 2V67A 4PSRA 1EA0A 3BC9A 1BTCA 1TRDA 2WK2A 5EMLA 3P14A 3G1HA 4KEMA 4BEQA 4B90A 3ZR5A 3O2LA 5U7SA 4P8XA 4U31A 1RCXB 2NWRA 1RA0A 3L66A 2TODA 3H7VA 5M3WA 3N11A 2XVLA 2WPCA 3V5CA 3DK9A 2POTA 3DIPA 3W7KA 3FX4A 4S3AA 3TXZA 4C90A 3K5XA 3N4FA 2NZLA 3RU8X 3S1GA 2CLKA 4O12A 3DJGX 2VNCA 4J3XA 3KBSA 1CXFA 4O53A 1EDQA 1JQXA 1I45A 3N13A 1FWCC 3LDVA 5D37A 1TA3B 2XSXA 5C70A 2Y70A 2INEA 4W87A 4DJDC 4RV8A 2FH8A 2Y4SA 1TV4A 1YLVA 2OVLA 4B5VA 2CLOA 3ARVA 3LHYA 3UR7A 2GFTA 2PDLA 2WPGA 5DELA 3N2OA 4H2CA 2ZE0A 3T2QA 2X41A 4AD2A 3TU9A 1MQPA 3VDGA 2Y6ZA 4W9TA 1E4IA 1EO5A 4KIRA 1JZ4A 2V5BA 3LOTA 1I6NA 4GYJA 4GCAA 4QRNA 1CENA 2QPSA 2VWSA 3TC7A 1FEBA 2HZGA 1V6WA 1EYEA 2TRSA 3GHUA 4C6OA 5T9BG 4KETA 1Q6QA 1XDMA 3XIMA 4O1FA 1W91A 2DZBA 3W71A 1NQ6A 4FNRA 5DY3A 1P6CA 5BWAA 4O16A 2XIQA 1LLOA 8RUCA 2OYKA 1J10A 3COTA 2HISA 3TFXA 3PM6A 3PZIA 4NASA 1W3IA 1LRTA 2WP5A 3QY7A 1YKWA 1WZLA 5EA9A 4RXFA 1EA9C 1V3LA 3THUA 4DLMA 4V28A 1JUBA 1K8ZA 3B0UX 3S47A 2DH2A 3ABZA 1Z9AA 3DFSA 5I3GA 1CLVA 5AVNA 3PN8A 3TEVA 4C65A 3ARUA 2ZDSA 3P80A 4RZ6A 2O56A 1LT8A 3HFYA 3UZ5A 1N63C 4LH8A 4NJJA 4EQSA 2FMNA 3UZWA 3QGKC 3BW4A 1KCZA 3UESA 2IQTA 4H7VA 3VOFA 1LQ2A 3XISA 4N6EA 4DBEA 4YHEA 3VMPA 3PBWA 3BAKA 2QDDA 3TLQA 2WCGA 3MVTA 2V0TA 3AIUA 4OOZA 1LRQA 3N2XA 5AC7A 3QRHA 4BF7A 4M6UA 4BHYA 4DBDA 4B3ZA 1CXEA 3CGEA 2A6LA 3V5OA 2VDGA 1G4PA 3C6CA 4WY0B 4B5WA 3ARQA 4G7EB 2OO0A 3UPMA 1I60A 4IXHA 4ZOHB 2X0HA 3W1MA 4B3KA 2DORA 4IPJA 4MJ2A 3PAJA 3HW2A 5HPOA 3DU0A 4W7WA 1J9YA 1KWKA 2ONEA 3IACA 1LWJA 2ISVA 3WO8A 2R1LA 1VFUA 2CHOA 3KZSA 3I4KA 1EWDA 3ZQ9A 2DIJA 1IT8A 3C5QA 3T08A 1EJ7L 1NHPA 1ITXA 4WGXA 4KGJA 1OT1A 3NZQA 4XUYA 1W17A 3BK0A 4ZOAA 3BOLA 1ZJIA 2DP3A 5M1TA 2XTKA 1PZ3A 4M56A 1E0WA 2XH7A 3KDNA 4P2VA 2FPVA 4L6DA 2PU1A 2C19A 4QCEA 4PBEA 1NDZA 3FAXA 2QAPA 1QWKA 1E9YB 1GWJA 4EE9A 4JQ1A 2P88A 4PCSA 3UGVA 3HOJA 3NYDA 1E6RA 5FA5A 2P3ZA 3OC4A 2X7VA 1XC4A 3CU2A 4P7LA 4F0MA 4LALA 4K7VA 3ZVHB 3NQGA 1NFGA 2D2OA 3OIHA 3FSTA 4DJEA 4RNFA 5IBXA 1HIZA 3WF0A 5C55A 2Q01A 1K03A 2VRKA 1ICPA 2F84A 2Z1KA 1E71M 3KDOA 1RA5A 2YIHA 3KWSA 1YTEA 1F8MA 4E3VA 3CV6A 1HKMA 2ICSA 4FNQA 4I5UA 1P4CA 1AMYA 1XX1A 1DTUA 4E5TA 1KA9F 2J62A 1DORA 5GNYA 4K7YA 1YXYA 2WLZA 4MUZA 3GAYA 2I17A 1GEUA 2PP0A 1GNXA 3G2GA 1DXIA 5IRPA 4MSSA 4IX0A 1K9FA 3BAIA 3PS7A 3ZJ6A 4JY8A 4DXXA 2WHMA 3CTTA 3R79A 4OE7A 1TJ0A 4NX5A 4C6JA 1FCVA 2EQ8A 1IXNA 4Y9MA 5EMYA 2PDYA 2BV9A 1FEAA 3UCDA 4E2VA 1WOBA 5E70A 3UFYA 4PFHA 3QOMA 3W2MA 3W7PA 3SUSA 4WXYA 1GKPA 4NEVA 3AS0A 3CWOX 5EY5A 4DI9A 2W0UA 3LBCA 3WEOA 4FXRA 4DJDD 1HVXA 4LV4A 4AD3A 2Z26A 3EPNA 4ZB0A 4YWOA 3T0DA 1MXGA 2H8ZA 1P7TA 4JTAA 1DQXA 4I9MA 2YJQA 1EDTA 3A23A 1W1A1 2YDSA 3CHCA 3W76A 4EOUA 1XLHA 3DFOA 2R8WA 3WNKA 3QR0A 4MJZA 1MW0A 1BKSA 4KS0A 1QO5A 4UTMA 2QEZA 4Y9NA 1QOPA 5AC8A 5AHFA 5AHEA 4CLMA 3UD6A 3MKKA 1T96A 3SN0A 3MO4A 3RUBL 1JCXA 3OBEA 1JCNA 2R1KA 3DGBA 4PMDA 1XIIA 3JR2A 5EMMA 4MKNA 4MOZA 4PMRA 1PKLA 1NDVA 3URNA 1VF8A 1GONA 1TO3A 1WKFA 3KS5A 3ZO9A 4DBWA 1QI2A 1XS2A 1RUSA 4AEEA 1J0YA 4MLRA 3NPUA 3C2VA 1XLEA 1QBBA 4NIRA 4K37A 4XO7A 4UFMA 3VGBA 4PMYA 4W5ZA 2QDEA 2J9XA 4JZ5A 5C54A 4YCPA 2XHYA 4IGNA 4LBUA 3UY8A 3T9PA 3IJLA 1JG9A 3BVJA 2BVWA 3QV6A 1S1PA 4HNCA 3WDIA 3AMZA 4DZHA 1BRLA 2CETA 1PAMA 1DWHM 2QV5A 3ZS4A 3HN3A 3M7SA 2XINA 1IHIA 3AIEA 2A8XA 3W24A 4BI7A 1CLXA 3UG4A 2WJFA 4WD0A 5JCIA 1R7AA 5G1MA 1J01A 5C0QA 4EAYA 4AIUA 2BDQA 1H7WA 3GU1A 1EZ2A 1W3JA 3M0LA 5CZKA 1GVYA 3KRUA 3T4CA 1YTKA 1GQIA 4L7ZA 1Z32X 3P0WA 5K7JA 4JTHA 5FEZA 1PSCA 4F79A 1EEXA 3VKCA 3BJTA 5LIWX 1F61A 3ABXA 4UTJA 5I3IA 4R88A 4XKMA 3CZEA 3VDCA 1G7VA 3THAA 4K6AA 2QIIA 4GRSA 4HMNA 1PE1A 3QFAA 3M0YA 1UMYA 2RGLA 4GY1A 5DN1A 3PBYA 3W6LA 4US5A 3G8EA 1RK5A 1KRCC 4WKFA 3B4YA 5I3KA 1NDYA 1UR0A 3VIFA 4UR8A 4UQ9A 3BZGA 3STCA 4HOXA 1HVQA 4MB4A 5JU6A 3PZTA 3W1RA 1TVLA 4H2HA 4A05A 1YHTA 4H8VA 4AWSA 4FR6A 1VD6A 3TJIA 1STZA 4BQ5A 2RJGA 2VEIA 3OGVA 1M03A 4O52A 3TQKA 4PH6A 4IUOA 4IJRA 5DXYA 5EYWA 3NEVA 1SM9A 1I2RA 4W84A 3GDRA 3HGSA 1KGXA 4QNWA 3T7VA 1A50A 3RM8A 4IIGA 4CEXC 3GXIA 3CZLA 2YFNA 5K4ZA 8TIMA 4O50A 2WMHA 1AD1A 4GK8A 1R47A 4PUJA 6REQA 2FTWA 1DWIM 3MMUA 2QCCA 3HU7A 2V3FA 1YEYA 4ZO9A 3STEA 3N6JA 1OC6A 2FZNA 4EVZA 3SGZA 3W7EA 3QKZA 3DBPA 2OLSA 1W5OA 3WMCA 3B0YA 2OQLA 4IZGA 4N42A 1QR7A 2OZ3A 1F3PA 4B4HA 4ACZB 2AGTA 2Y7EA 3OYZA 4XO6A 1A5NC 1B9ZA 4R53A 2ZVRA 2R1PA 3TWAA 3AWNA 3NQDA 2PD5A 5RUBA 3UWWA 1JXKA 4NL1A 5I06A 3SUUA 1KLYA 4H9UA 2GRTA 2BGNE 3O3RA 5MHBA 1PTAA 4Q6XA 2VJXA 1E0TA 4M51A 2HDJA 3TYDA 3W74A 3DXIA 3H4GA 3ZT6A 4L1XA 1EWEA 1MYRA 1UA7A 4H4IA 2BGQA 3ID7A 1FP9A 1JD7A 4H1ZA 3WJWA 2CXEA 3VNZA 5CAHA 5HXMA 3VKDA 3BAYA 3BLFA 3AFBA 3E02A 1EJUC 3PB2A 1LOSA 2B7QA 4NZFA 1JDEA 5DO8A 3SQPA 1LORA 4W8LA 5CGMA 1JCTA 4JEQA 4HGXA 1F4HA 2ZX5A 3C8NA 2NLYA 2V81A 3K1GA 2VRJA 3BJFA 1FY6A 4J57A 1XSJA 2NUXA 4FAMA 3ZT5A 4MWAE 2X0SA 5J5DA 1ICSA 1K3UA 2VFIA 1OIMA 2Q8XA 4PUEA 2OB3A 1HGWA 2AAAA 1XXXA 1XDJA 3ITOA 3CZ8A 2QUNA 5AC6A 1VRXA 2NSOA 3PC0A 4FOJA 3VKAA 1PO9A 2WZTA 3TTOA 3I6RA 3KCJA 1T6MA 3EB4A 1KBBA 1DL3A 1H7XA 5A6KA 1W3NA 3GIPA 3OLGA 3NZ1A 4TR9A 2WVVB 2QPXA 4IPIA 2EQ9A 4IOTA 4N4PA 3IUHA 3EUB3 3GC4A 1XRFA 1JF6A 4NEWA 3EX2A 5U25A 3RPMA 3M0VA 3RGTA 3W02A 3FA3A 2G8ZA 4NZ4A 2V38A 4Z1AA 3CT7A 5BYWA 5C5YA 1H41A 2DQXA 4GHRA 4N02A 1W56A 2BB0A 3OZMA 3E9AA 2XGBA 3USZA 1JGIA 1JPDX 1NIUA 1HJSA 3WK2A 1DWJM 1SFTA 5CC5A 2EO7A 4YYCA 5FEWA 3PTQA 4FXJA 1AODA 2BCPA 3Q4DA 1RJQA 4IFOA 1JZ3A 3WLOA 1JCMP 1MEWA 3ECQA 3TUUA 2JKAA 1OZMA 1QT1A 4AZCA 1IF2A 3VNKA 1YIXA 3HRDC 3B8IA 5K2ZA 3GO2A 3TN5A 4CN6A 4GXPA 1B2YA 4NUWA 2Q02A 4S38A 3M6YA 4QXIA 2NXGA 4KPRA 3SECA 3ZSTA 4AZ6A 2ACSA 2BOFX 2XPKA 1AFSA 1OG0A 2RH9A 3AWOA 3B9EA 2I14A 3H53A 3S4TA 2CZDA 2ESCA 3TZFA 4ZFCA 4O4WA 4NAEA 3U5UA 1OFAA 1FWGC 3A22A 2QZRA 3WZ0E 3WF3A 2JFEX 2EG6A 3W0KA 2E1DA 3W84A 1TV8A 3T1GA 4Z0SA 3WH7A 4NX0A 1M5WA 3BLEA 1FIQB 2V30A 3PR2A 1C8XA 3UWYA 2XIIA 2PBOA 1O5XA 3CTLA 5EGRA 2H9AA 2VZSA 3S6TA 4OWGA 5FF3A 3BGAA 2B7OA 1RCQA 4UTKA 2XFYA 3KBWA 3B06A 4F8XA 4NYYA 4J2PA 2PWHA 1M6IA 2C13A 3WX7A 2FB3A 4M1BA 3OTRA 3UPWA 3TW7A 3KRSA 1ZL1A 1SJAA 2PWFA 2OYLA 1TR9A 4MDPA 1V97A 3N34A 4E6MA 1KCKA 4QNEA 3HF3A 2GK1A 4I7VA 4NU7A 5HA7A 1VS1A 4MB3A 4MAVA 4WSHA 4O0ZA 1Q6GA 2EQDA 3AOFA 3N19B 3CUXA 1OYAA 2VEMA 3ME3A 4Q4PA 1BFNA 1TB3A 3ONCA 1HL8A 2R9ZA 3P7YA 2C6QA 1ISWA 1HP5A 3C86A 3TSDA 1YTDA 5D09A 3GKAA 2QPUA 4UB9A 3LV6A 3CEUA 3GNPA 1M3UA 2VWTA 3DFPA 1BPLB 3VIKA 1ESWA 3BL3A 3CXOA 1EC8A 3ES8A 1REQB 2WSPA 3H4XA 3W01A 2GDQA 2NW0A 1U1HA 1PPIA 1GPFA 2V2CA 4ERGA 4HMDA 4ZCWA 1ECQA 3TC6A 4H8UA 3LCIA 3SCPA 4GIYA 3P60A 1XLIA 1ODZA 2DIEA 2I16A 1CGXA 4O1EA 2BVYA 1UH2A 1EUAA 1JAEA 1W5MA 3RRXA 5AOUA 3VGHA 5KMYA 2GJRA 4H4RA 3AMLA 1GVSA 1OJXA 3W7JA 4GVGA 4PTWA 3RHGA 3GUWA 2W3RA 2A4AA 1ZB5A 3B40A 1AW5A 2PEVA 4LUTB 4O15A 5TF0A 1DJGA 6ENLA 1SFJA 1OFPA 2FB2A 3NR0A 4D9PA 4D6HA 3TR9A 1AQ0A 2ZVIA 1W0MA 3ZXWA 1GJUA 3G6LA 4WVXA 4XBSA 2ZA3A 2DT0A 1DKWA 1GT8A 1JUKA 2PP1A 3GW3A 2E7FA 3LRKA 1DXEA 1OCQA 4GYPA 2WXDM 5FJRA 2O92A 5BXRA 3DESA 3TQ0A 1XH1A 1S2AA 1XFBA 3RM9A 3W1XA 4O4VA 4ML9A 4JTRA 4GJ1A 5GRTA 3BW3A 4TIMA 1ONEA 1AL7A 3H55A 4PCPA 5T9CE 3DKLA 4GJJA 2F6XA 5ENLA 1TYPA 4IL0A 3KHJA 3CQIA 3CUFA 3NXLA 1VPYA 4XZHA 1TPWA 3BZJA 1XSIA 3HBLA 1GG1A 4A35A 1DXFA 2ACUA 1E6XM 4Q8VA 1MVYA 1T40A 4QSHA 1LWHA 3KE0A 4HK6A 2WOWA 1JYWA 5LHFA 3CMGA 3L0GA 4J3ZA 5D04C 3S1XA 3MBFA 1F6PA 3IRSA 3ARRA 2CHRA 3KLKA 4W5UA 3JS3A 3EWXA 1E73M 1PUDA 4GI9A 1V3JA 1XYCA 4D6CA 3VDBA 1ZJAA 2ZUTA 1C9DA 4GKTA 3T0CA 1HL2A 1WA3A 2GH5A 5SWUA 1X96A 3NRZB 2QUUA 3FDGA 2FFCA 1VIWA 2GVYA 4KT2A 3SB0A 1Q85A 1KM6A 4HYWA 3GYEA 5FAGA 1QPNA 2WVUA 3CAVA 4Y8FA 2VURA 4R7WA 1BF2A 4LVFA 3ETRB 5ABHA 2WANA 1R46A 3LXCA 1GHSA 1PWMA 1VCVA 3W1QA 2G0WA 4GIRA 1D3GA 2I5QA 4K8GA 2W62A 4N4QA 1ISVA 1BQGA 2DQWA 5AZ0A 3VNYA 5FACA 2QXWA 3CWHA 3PPFA 3IIVA 4BQ4A 5JRBA 3OGRA 3IRDA 4IPNB 2OO6A 3M16A 8XIAA 4TVCA 1GOWA 2PTWA 2VVNA 4OUIA 1XWYA 5HR7A 5EBKA 3AJXA 2AL2B 1HG3A 3PZUA 1T3QC 1TWZA 4C6BA 5JVLA 4XAPA 3F2DA 1EP3A 4YN5A 4LYPA 1OK4A 3B9OA 5JCLA 3N2TA 2Y8UA 3WQCA 3TOPA 1RHCA 3M47A 1T0OA 1UOZA 4QEEA 4GR1A 3W2KA 1AL8A 3BLLA 1R87A 2BNJA 1OBAA 1SO4A 3Q45A 3S2CA 2CBUA 4CD7A 3IJDA 3REQA 5LNRA 4EM3A 4JFWA 3NPVA 1AH4A 5F2IA 2CWXA 3VABA 5HNNA 4U10A 4AVOA 4D6DA 2NQHA 2GQ8A 1BYCA 3OPSA 1VEOA 3AQUA 1PIGA 2P0OA 3WQOA 5D03A 4K68A 1O6IA 4Z2GA 4DJFD 5E9XA 1WP6A 5HAOA 1VHCA 3LZ5A 4PEEA 3P82A 2YA0A 3SY5A 3DKJA 1DE6A 2PUZA 1HKWA 4PUMA 2FDSA 3ZLFA 1XM3A 1FWNA 1XRTA 4XISA 1IZJA 4FF5A 1LLWA 2GGGA 4H9YA 4AVFA 2XFWA 3AZRA 2BXVA 3NQAA 1US0A 1IWBA 4GQGA 4FNPA 4AZ7A 4G8TA 1PDYA 4LUSA 1Z7AA 4GX8A 4OECA 1LROA 2GUUA 4KCVA 1PZ1A 4UTLA 1EP1A 4WJ8A 4Y8EA 2FH6A 1HX0A 1TA3A 4C6QA 2GWGA 3U0HA 3BAXA 2QMKA 1JPHA 4NNCA 2IPGA 4WJXA 3W70A 4F0RA 4IGSA 5CH9A 4QJ1A 1JROA 3PBVA 1R6WA 1O5KA 5M17A 1OGGA 4X60A 5CEWA 4RXGA 4IF2A 4UTWA 3GXNA 3BWWA 4AC1X 3GAKA 3KBJA 3SCOA 1SO6A 2E0PA 2BMBA 2YL9A 2RAGA 2X42A 4Z1BA 3MUAA 4JXCA 4PZVA 3EMCA 3L5LA 5CZTA 4WY0F 4DUOA 2F7FA 4DLFA 4F0KA 2FHBA 4CNPA 4XAYA 3LGEA 3A4AA 3MB9A 3I68A 3QJAA 4TVUA 3G18A 3W7MA 4JX6A 3R13A 1J0HA 1SU5A 1GRAA 3EWZA 1H49A 2XGIA 2EXOA 1KFWA 4FX9A 5J5RA 3ABRA 5DEZA 9CGTA 4OTKA 2C1IA 4F9DA 3O8AA 2WB5A 3W83A 4HPJA 1GVQA 3WLSA 4U4MA 3OLIA 4W93A 3CUJA 1Z8AA 2ZUMA 4YVPA 1EF2A 1ZTVA 3R5EA 2UY3A 1PIIA 3DFNA 4DF0A 1JDFA 4PRRA 1GETA 3VM5A 4MNKA 1UKSA 3V7PA 2D2HA 3TA9A 4KCWA 1A5BA 2PGRA 5CZ0A 5A2BA 1N8IA 1LRNA 3NSXA 3SCSA 5G5HB 2CBIA 3T4WA 1B3XA 3LMZA 2BY2A 1L6WA 4J56A 3LNMA 3V5FA 2J66A 4UTHA 1AW1A 3VNJA 2IPFA 1XIBA 2DZWA 1Q6RA 1X7IA 4FIQA 5D8WA 3NUKA 2PC8A 3NL6A 5C9ZA 1NOFA 2YL8A 3IGSA 4XZBA 1PXGA 1BQCA 1SFSA 1W3LA 4BFAA 4WOZA 1JVNA 2QVNA 3N6QA 4H3DA 2WHJA 4OVXA 4XVEA 5A5WA 1JYNA 1FDYA 2HSAA 3RCMA 3T44A 4E8CA 1JQVA 1KFCA 2X7WA 1R3QA 5IFPA 2WSYA 4LC8A 5G4EA 4Y9PA 3FVMA 3PJWA 3QTGA 1FTXA 4Q8PA 1TR1A 2VZOA 1ZXIC 3FY1A 3I6TA 4S39A 3RRAA 2P8BA 4OFCA 4PULA 1RBAA 3B8DA 2HJPA 1Q13A 3OEXA 4PN2A 1GJPA 2YXXA 1VAHA 4HCLA 2V3DA 3UZJA 3EGJA 2XFRA 3TN4A 3VYLA 3C0SA 3S8HA 1H1ZA 4WSJA 1SO3A 3UG8A 2CIPA 1TPEA 2G37A 1LG1A 4DO4A 4YTSA 1ZLPA 4WDWA 4C1LA 1XGEA 1X6NA 4YTQA 1A5SA 2JBMA 2OT1A 2WW5A 3FW6A 3VPLA 4FALA 5M5DA 3OB8A 2UY2A 5K3VA 1TIMA 3CZGA 1VPXA 1JFXA 3ERPA 4C7GA 4J7RA 4FX7A 2ZFAA 4DZIA 4LY4A 3GNXA 3GWQA 3Q67A 4IIEA 3VMNA 4BWLA 3UA4A 3W1UA 3FGCA 4RK8A 1EJVC 2JGQA 5FF2A 1NP2A 1CZ1A 4GE8A 2G5WA 2QGYA 3WLTA 4IMDA 2YXGA 2NQZA 4JQ4A 5F2LA 5HDRA 1XPYA 4ADUA 1HO1A 1QNSA 2WSKA 2REQA 1NWTA 2ADAA 4PUDA 3PUOA 1ODUA 4G1KA 1MI3A 3GE7A 1TV2A 4PMOA 2PWGA 1P43A 3TROA 5FIPA 4FB7A 3KLLA 2D22A 5REQA 3BG3A 2JK6A 2VCCA 5HJYA 4DY1A 1QVBA 2A0NA 2DZSA 2BWGA 3AZTA 3NA8A 3LCHA 4AD0A 3AIWA 2P1FA 4ZMGA 4W8BA 4JCLA 2OU4A 3ZLHA 2FTYA 3CJPA 2C14A 1QPOA 3NVDA 4N7QA 5HNUA 1OX6A 4JTJA 2XIMA 4UQCA 4N9EA 4QHRA 2INZA 3W6YA 2E5BA 1H5VA 1XYLA 1GESA 4M6QA 4H6EA 3MWCA 2J9YA 1ME9A 3T09A 3C0LA 4CKQA 3UXDA 1ONRA 4L64A 1F8WA 3LPPA 1F3TA 1ITUA 3UG3A 3L23A 1FKWA 2ZADA 3KEHA 1U5VA 4DEFA 1WAWA 3RPTA 4IISA 2DSZA 4A2RA 1R2TA 2QCNA 3ZWTA 3ZIZA 3VUSA 1Q7ZA 1VFMA 3NQFA 5BZAA 3MUCA 4NT0A 3MY9A 3HMJG 1B3ZA 5XIMA 2DZUA 2DJXA 4QIUA 4PCTA 2Z7GA 1JEHA 2NPXA 3W7GA 2B31A 1MFVA 3AIBA 3MSGA 2A3AA 1UZHA 2CDUA 1B57A 4E0CA 5IBXC 1TPVA 1GORA 4Z1YA 4EKJA 3H24A 4RPPA 3TOYA 3NO3A 3IV8A 3C2YA 1ZCOA 4H01A 1FXQA 3PZMA 2YBUA 2HE5A 5AZ1A 4Z2KA 3LENA 1JULA 4NXKA 2DW6A 2HVNA 1WDDA 1EFZA 1PTGA 3C2OA 2NX1A 1TV7A 2XVGA 2NV1A 1DJZA 3MUXA 3CUIA 1EJSC 2WAGA 2PODA 1UD8A 1S5VA 2AL1A 2FPTA 4DWSD 4JIQA 3JRKA 4IMGA 3TWBA 4DNAA 3V1PA 3IV3A 3WQ5A 2HK0A 4C6DA 2ISSA 2QCHA 2WJZA 2E5DA 3BLKA 1L6FA 1XGZA 3A7UA 1SJCA 3OQEA 4M1RA 1GOIA 3TCEA 4Z2IA 5C9UA 4JTSA 3CIVA 3N1AA 1P0DA 1V7YA 3LLXA 1DIOA 1KFJA 1YDNA 4MB5A 3CHFA 1H1YA 3BW2A 1B3VA 1A5CA 1Q3NA 5I3HA 4E38A 3KOXA 3HQOA 2HS8A 2J79A 4GH1A 4Q7IA 4GINA 1ICQA 4UQEA 5FMHA 1W32A 3N12A 5CSRA 3ONBA 3EYPA 1HL9A 2IPJA 2J6VA 1E0VA 1W2PA 2YW4A 1W5NA 1IXQA 1PL9A 4AZIA 1QTWA 2Q8ZA 3I7RA 2QULA 1KGUA 5A6SA 1BKHA 1X8CA 3WFZA 3HZ3A 5HUOA 1H60A 1IEQA 4HTBA 5I6SA 3A13A 3WL0A 4EQWA 3DFYA 1P7TB 4EXQA 4PBFA 3QPYA 2HEJA 1AQFA 4AWEA 2XVNA 3ZM8A 2FHCA 4QJ4B 3GDLA 1SR0A 3RJXA 4D6JA 1TTIA 1O5RA 1UJPA 3VZXA 3WQ6A 2HPMA 1W1TA 3SCWA 1XHCA 1EXPA 4R9OA 2C0HA 1E0UA 4EM4A 1JRBA 4ZA0A 5HJXA 4GXWA 2OSXA 3CASA 3MZ2A 4EQRA 3UWVA 3RAOA 4L9YA 4JNYA 4AF0A 2OOGA 4WXZA 1UIOA 1RQBA 2J8TA 4UTTA 1RBLA 1WBJA 4PTDA 4H7ZA 1T99A 1GZGA 3QXBA 3GC5A 3NGFA 1UR2A 4JEJA 3MPGA 1IEVA 1KFBA 2ZZ4A 3AJ7A 2GSHA 3LCXA 1TV3A 5HMDA 4HPXA 3QFEA 1B9BA 2AQVA 3EDDA 3HPFA 1MXSA 2NVKX 4HMCA 2E67A 2DSKA 2OSYA 3RDKA 1ONFA 3EANA 3BJSA 1NDWA 1X6LA 4M5PA 2J7HA 4B92A 4AMCA 3W87A 3TK7A 3CZJA 4R85A 1BRLB 4NJKA 4H4UA 3VOGA 2NWSA 4XTIA 1TMQA 2XZ7A 4KCUA 1UHVA 2NQ5A 1XC6A 5I77A 4IIDA 3N2BA 3TCSA 4BQ3A 1XR2A 3BCDA 3KW3A 3VFCA 3WK1A 3TNBA 3GNNA 2ZX6A 3UJFA 3V35A 4MNMA 4YJ5A 1VEMA 1K8XA 2VZVA 1OSEA 4JTCA 5XIAA 1K9TA 2VT0A 3H7UA 3PZQA 1EP2A 3S6DA 3QZAA 1MFUA 4GQ0A 2QCGA 4FZIA 3APGA 5LA1A 5FL0A 3SFWA 2EQ7A 3MW7A 3VCRA 4UFJA 5GNXA 3S5SA 1EEPA 1TPH1 2XH4A 1QI5A 3STPA 2DW7A 2B0MA 3CUHA 1WOAA 4RX0A 1DJNA 4HHHA 2V5KA 1KFEA 3HQNA 4JD4A 3DZ1A 1UJQA 4RCXA 4HVXA 4ZR8A 3FDKA 4HJWA 1F8IA 1NWRA 3IIOA 4GZ7A 2FDMA 2QJHA 1VCFA 3RFAA 3U48A 2EPNA 3WLIA 4US6A 2HVOA 3OYXA 1X8FA 3NQ8A 5I07A 3GNRA 3MYPA 4HHMA 4Q3MA 3VC5A 3KBNA 2DU2A 2D0FA 1D9EA 3HJEA 4PTNA 2Y5JA 4U28A 4IWWA 2YKKA 1OFDA 2NXIA 4UMCA 3VD7A 1J0KA 2OGYA 2EHHA 1L2QA 5E6YA 2V3BA 4FXFA 5MF5A 1JRPA 1Q2RA 2NUYA 1S3HA 1JFHA 4GO9A 4QAWA 1JIBA 4XX6A 3L4XA 4DNHA 1OC5A 3A9BA 1TZZA 5K9CA 1ZBCA 2ZXDA 4QJ3B 1FVPA 3U4FA 4AVNA 3R0KA 4Y90A 1XRVA 4TU1A 3E3HA 2XM2A 1OX4A 2WLYA 3ZVIA 6REQB 2NQLA 1YPXA 3TDFA 4ALDA 3LU2A 3HV8A 1NM9A 1OCBA 2XJ7A 5G2IA 2WVTA 2VFDA 5EL1A 2Y7FA 4EX4A 1HKKA 4D8LA 5HNTA 2F9RA 2J25A 3A6OA 4JOMA 5LIUX 4GYKA 4I6VA 4BI5A 4K2SA 3C0QA 3C56A 5HQEA 1LVLA 3GTHA 4Z2LA 4JKLA 1H62A 1QOQA 5LNVA 3UXKA 4W89A 2PC4A 2C18A 3TAOA 1FFQA 1BSLA 1NWUA 1V3KA 3LK6A 3UWUA 3UVIA 5JIPA 1YNPA 2R6OA 2A3BA 5AN7A 4RE2A 4GZIA 1NOUA 3LPGA 1WV2A 1IE7C 1WKYA 4BY3A 2A7PA 1Y5WA 1OABA 2QDGA 3NPWA 3GTNA 3KX6A 4ZQCA 1I2OA 3LM3A 2D73A 3QYQA 4EP8C 4TQTA 4NRSA 1FCQA 3CEPA 1XD1A 3KVLA 3TH6A 1XLCA 3TYZA 3HPAA 3PY2A 4OGZA 2DZPA 2JIWA 1W8GA 1ADDA 1L6SA 2PD9A 5HANA 4RUBA 3VNMA 5DLCA 3TTQA 5IXEA 3T0TA 1N7KA 3VFLA 4DO7A 2GWNA 1UP0A 4H9MA 2AAMA 4YYFA 4GBUA 3SR6B 4C7DA 4S2BA 4F0HA 1E3XA 2YVGA 1RCOB 4F4RA 4J3TA 4LFYA 1XL9A 2X99A 4EACA 1V0KA 2VZTA 3W2UA 4JIIX 2PBGA 4HYRA 1VZWA 1XV8A 1YPFA 5B80A 2PDWA 1E3ZA 4DYJA 2OOFA 4JYEA 1IXOA 4LNCA 3W75A 4JICA 1PYFA 4S1FA 4C6CA 1XLKA 2VMFA 4NVTA 2CLPA 1UB3A 1AUSL 3RG6A 1A3XA 3IARA 2GDUA 4NZ1A 5TBOA 4H19A 1Y8BA 2YCEA 4BURA 3S9ZA 1S7MA 1TKKA 1OFQA 4LCQA 4KF1A 3LSCA 3HA1A 4FR1A 4FA3A 3EXSA 3UWQA 4UFLA 2G3FA 4HU4A 3GKFA 3CHDA 3S5OA 3CB3A 3CLWA 1U30A 2XH2A 3MVIA 3GR4A 4Y6GA 3TMLA 1KNWA 1F3XA 1THFD 4YIWA 3EZ4A 3WF4A 4U33A 2O7QA 1R9XA 4MJ4A 1ZBKA 3HFTA 5HWMA 4QROA 3O0KA 5CGTA 2QF8A 2A79A 4HQVA 1V77A 4WSKA 3VILA 3EDFA 3MMWA 2FZBA 3GG8A 3A5VA 1I8JA 5GPRA 5EFFA 4JR5A 2C16A 3M4HA 3SQLA 4JFVA 1K4HA 5DMYA 4X2PA 4O0KA 1VENA 3TA6A 2WBAA 3L4UA 2WCSA 3WK3A 1QHOA 5DF0A 2PURA 3T0AA 3M0MA 4KESA 1DJIA 1C92A 1OD8A 1EBGA 3CH0A 3NDZA 4IG2A 4UNLA 2GGHA 3HB9A 1PVNA 3JVAA 5FSEC 2F2KA 1DPMA 3AS2A 3OIXA 3CC1A 2WPBA 9RUBA 3YPIA 3KUMA 1CB2A 4BS0A 2WMFA 3FCPA 3FJ4A 1YYAA 2W4XA 1JDDA 2QV4A 4IPPA 4K39A 3H54A 1UD5A 2VEGA 4AZCB 3MC5A 3VOJA 4QM1A 3GXDA 2BZNA 2X1SA 4URIA 2DFAA 1G0CA 1FWTA 5XINA 1FO4A 4XD5A 3F4WA 1IGWA 1VJZA 3V18A 1A3WA 4M82A 2P3EA 4RDZA 2FGZA 1IZCA 1BYBA 3RLHA 3V0UA 4C91A 1ZZMA 1A0DA 1EKOA 2GOKA 3H70A 4NYUA 1CLKA 2W3SA 2GR3A 1SJBA 2WNZA 4HB7A 3W7OA 5K4XA 1P0KA 3L0NA 3A3WA 3TX9A 4NAEB 4JTDA 1N8WA 3W6MA 3GX9A 2VXNA 1HF6A 1DJXA 1P1MA 3V75A 4S3DA 3EKZA 5D05A 5TD4A 1OF8A 3NQBA 3E1F1 1R3YA 3PP7A 1HKJA 3GIQA 4H4ZA 2HWGA 2BHYA 1IXPA 3DG6A 3GDKA 5FL1A 5MKGA 2H9AB 5BOEA 1SJDA 3LCFA 1E4LA 1OM0A 5G2WA 3C3NA 3LQLA 2WQDA 3LA4A 3WFLA 3EA1A 3KVJA 4LYKA 1SQ7A 1IV8A 1TJRA 1KWGA 3DFHA 2NV2A 1KTCA 2QCLA 4YPJA 1J6PA 3NFUA 3PFMA 4JQAA 2E28A 2O9PA 3WIJA 5DXXA 3FYYA 3R0DA 3TLLA 1UUQA 1AJ0A 2RKXA 3W81A 2CHNA 3G1AA 2HMCA 1EHNA 3PFRA 1PJ9A 2OQYA 1R38A 3NZGA 3QFBA 2GVGA 3NDOA 2W9MA 4I9TA 4IFRA 1KXHA 4HNUA 1POKA 5F2GA 3SIMA 1TIWA 1VHNA 4DO5A 4RL3A 1CTNA 4DJDA 4AZGA 3R25A 4EMIA 4UUIA 1ZJHA 2J75A 2J13A 3DYPA 1BTMA 1ZJBA 1H61A 4H4TA 1GK8A 5BRBA 2ZXAA 4GPNA 4HIBA 4JBRA 5U1OA 5KZ6A 3CK5A 5AB3A 4MUPA 2V8ZA 1V6TA 4IQLA 1N61C 1R85A 1GG0A 3WMBA 1DHKA 4C5ZA 5D38A 4H83A 1G4TA 3PUEA 1AVAA 1RP8A 2WZEA 1CNVA 1CWYA 4IT1A 4NI3A 3WQVA 3V0TA 1NAL1 1X7FA 2B7PA 3AHTA 3LNPA 3O07A 1BWKA 4HJFA 3NAVA 4WK9A 5PTDA 4UC5A 2WC3A 4QR6A 1Q2SA 1G4SA 2C79A 1F76A 5AYXA 1FX6A 3Q37A 4UZSA 1YPIA 2WC7A 1UPPA 3AS3A 3BO9A 4MDOA 1IIHA 3SR7A 3M7WA 4NAFA 3VKJA 3MANA 1V4YA 3ZMRA 4J3VA 7XIMA 5DCBA 2HXUA 3SO7A 1MOKA 4Q8QA 3SN4A 3N9RA 2WNNA 5DCEA 2TAAA 2Z4GA 4HOWA 5I2UA 2YR1A 1TVPA 4B5NA 1H7NA 1TSIA 3C4UA 1W9PA 3SCNA 1XI3A 1JUEA 5T26A 2GQ9A 1UP2A 1QW8A 3WQPA 3ORWA 4KWWA 1GREA 3EDKA 4ZENA 1QRQA 3NL2A 4HCHA 3GM8A 3OLDA 2Z1XA 3O16A 3KRBA 1MO0A 4GMEA 1YW1A 3URBA 1UR8A 1NFPA 1LOLA 3S46A 1RM6B 4E2BA 1E5NA 3PSWA 1N5XA 2L5HA 1UD2A 1RY8A 3EWWA 1GTHA 3LTYA 2QF7A 4JDYA 3C2EA 5KVHA 4HA0A 4HA1A 2PS2A 3OOQA 2R1MA 5TR3A 2V2HA 5HATA 2CZVA 4LCSA 2XN1A 1KRAC 1U33A 3QZEA 4O13A 4QP0A 4PRWA 5BMXA 4N6FA 2VR4A 4GG9A 3GU9A 1RSCA 3BE7A 4H9TA 3NZRA 2VFFA 4Y7EA 5D8ZA 1AMKA 1JYXA 4FOKA 1NARA 3T55A 1ZS2A 1E70M 5CPOA 5CKSA 1Q4NX 3NIYA 4ENLA 2WPFA 2OWXA 3NGJA 3EOSA 3RYSA 4BV6A 4LB4A 2ATMA 2W27A 1Q8AA 4LBRA 2BS9A 4CD4A 3QV9A 2J6XA 2DT3A 4G1NA 3IJ7A 3CIXA 4FNTA 1DHPA 3FNDA 4L4PA 6TAAA 1N55A 3QEZA 3ZJ8A 2YA2A 2V68A 3WH5A 2VOMA 2Z1VA 3AHVA 4RNJA 4I90A 2W79A 3R43A 2E5AA 4KFOA 1A5OC 1UBPC 1M7PA 4RV3A 4K8EA 4NJGA 1EF3A 4I5RA 4XIAA 3VIMA 2YGYA 4DO6A 3FVDA 4UR9A 1B4KA 1SZFA 1EB3A 1E6QM 2Y5EA 1RALA 5CPNA 1S2TA 3GBDA 4YVVA 5D9OA 2ZX8A 2F38A 4UOJA 1GGOA 2GPTA 2YDAA 5A2CA 5AC5A 4AU0A 4TO8A 3VMOA 1A0CA 3QGAC 4ROPA 5HJLA 4GCXA 1HTIA 5D2TA 3NS1B 7TAAA 2EKCA 1XPGA 2ZC8A 1LQ0A 2CBVA 5U4NA 2NVDA 2PTDA 5AKQA 3GW0A 1C90A 2J77A 3MS8A 5I3JA 2O4QA 1US2A 4LWWA 5G1TA 4XKYA 3B8VA 3VTRA 2BSLA 4EXBA 3VD4A 4GC3A 4D72A 4HSNA 2Y7DA 2CZ5A 2EPOA 1R7OA 2GQ3A 1IR1A 4MGGA 3N14A 3H6OA 4W7VA 5CLTA 4GBDA 1XSKA 1K9EA 4L9ZA 1QPRA 4LANA 1J0JA 1X1NA 3IEBA 1P0EA 3TSMA 4ZVJA 3P93A 1JZ2A 1GOQA 3OG3A 1M7XA 1JI1A 3WNLA 2ZRVA 3HIJA 1MW3A 3OVPA 4H6RA 2AKZA 3REQB 4WKHA 3PZVA 2A85A 2PDKA 3U6WA 4GIEA 3BARA 2PGFA 2Q6ZA 2O9RA 3E38A 3GTFA 8CGTA 2QJJA 1JZ7A 1Q6FA 3VDHA 2P5NA 4EPKA 3M44A 1L0PA 3T8QA 4S3CA 3VZZA 2DZXA 1XRSA 3P8JA 1DXLA 4AX7A 2VTFA 3TJLA 4Q8WA 4YTUA 1EOKA 3PWAA 3RF9A 4MY8A 4LAOA 5CJMA 3DAQA 2JGYA 5BMWA 3A21A 1O12A 4IM4A 2Q3OA 3EA2A 1J8VA 2WM1A 3PZOA 5KSWA 3CAKA 4F48A 4XK2A 4B5TA 3VIJA 1UR4A 3NVTA 5LYRA 3QHOA 3DCPA 3LHVA 3SY8A 1UUMA 1U22A 5T91A 3LGGA 3R12A 2VUNA 2X2GA 4BF5A 2P0IA 2ZRYA 2C0AA 5DMNA 5D9PA 1KXTA 3PAOA 4ONVA 2BTMA 1M7OA 1TCDA 4IQJA 4LUSB 1IWAA 3TXVA 3G0SA 2F61A 1DV7A 3MU7A 4FLRA 1GPWA 3BGGA 2OXNA 1SR9A 3MDUA 2YBTA 3G1YA 4L9XA 3QMSA 1CXLA 3KLJA 4JX4A 1PWLA 1YDOA 3TYBA 1ZBVA 2DV0A 4C6NA 4JKKA 3B8TA 4D8ZA 1KM0A 2RDWA 3PBMA 4PMJA 3XINA 3K4AA 2I9UA 4D6GA 1RQHA 3S2LA 2W0HA 5A8QA 2ZZ5A 5DMMA 1CB7B 3W86A 4GQRA 3OZPA 3WFAA 2HQAA 3UPBA 1XCWA 5E0CA 4WJEA 1X6UA 4TVWA 2H8XA 4F0LA 3T6CA 1P6WA 3B4UA 5ABTA 3MDWA 3FA5A 3RX2A 3AYSA 2FJUB 2WNQA 3MZNA 3RN6A 4LAUA 4CCZA 2OKTA 2WJEA 3H7RA 4PCFA 1GYLA 3W23A 1HKIA 2W66A 1W1B1 2R94A 5BXSA 2PDCA 2ZZCA 3IUIA 3WDJA 1XLMA 4PEKA 3QOKA 4PUWA 2FFIA 2ZOXA 1FFVC 1AOGA 1MEIA 4AMAA 2TPRA 2NQ9A 1NF0A 4OV4A 4PTXA 1Z3NA 4AYGA 3MQTA 4ZE4A 1LL7A 3EMQA 3PUDA 1TTJA 1WDPA 3LZ3A 1C9WA 3RR1A 1UWAA 2ABBA 1GV4A 1P6BA 1V0MA 1MEHA 2HXTA 4GXMA 1X1ZA 3PK7A 3GR8A 2J7GA 1RP9A 3GFZA 4HNNA 4IJBA 1WPCA 4AISA 2OJPA 1VGAA 2FMOA 2EPMX 1W1VA 4CQDA 1R3VA 4GLEA 5F4WA 3F4CA 4FF7A 3TTYA 2ZZ7A 2PE4A 2FQIA 3SGGA 1HP4A 4JYDA 1G94A 5FOOA 2D1ZA 1XG3A 3FEMA 2A5HA 4IMAA 5EBUA 4KGLA 2VGFA 1BVWA 1K1DA 1B90A 3FK4A 4HK5A 1QPKA 1YNQA 4CVWA 4B15A 4JKMA 1ZHAA 2ATSA 4FX8A 4ATDA 1TWWA 3CV1A 4HBKA 3GVRA 2WC4A 3SI9A 3BCFA 3M07A 3OA3A 4XB3A 2OLHA 3GUGA 1UKQA 4Y9AA 4CN1A 1HXJA 4R9XA 5BRQA 4PSPA 4AH7A 3ES7A 4EMWA 3B8SA 1ZK7A 4UFKA 4ICNA 5FJUA 2JF6A 3CPGA 3LMYA 1Z69A 3DERA 1FWBC 2WBKA 1H7RA 3R10A 4OV9A 1G9HA 3O6YX 4GFIA 3BSGA 4R33A 3V16A 1KXVA 3ITTA 4FPSA 4YXGA 5G1YA 2DVTA 4PB4A 4ZTYA 3VX1A 2YCJA 1V08A 1I2NA 4L1WA 4MWAD 3U3HA 3MJYA 2J9ZA 1K8CA 3M0JA 2WP6A 1ME7A 3OVGA 1G01A 1YADA 4WHBA 6PTDA 4H4SA 4H6KA 1W3KA 3B9DA 3GHTA 1TJ1A 1DWAM 1QXLA 3IK2A 1JPMA 4ERIA 3AICA 1LF1A 2FPYA 4QLJA 4DUXA 1WZMA 1KM5A 2DEPA 3EA3A 3TW9A 3LHZA 1FWAC 2D3NA 3FJNA 3H2MA 3WENA 3FGCB 4E2DA 1Q6DA 3G3DA 2BY3A 4ERAA 1WKEA 4FEZA 2F2HA 2UY5A 3DGHA 1MZHA 4ATLA 2R14A 1LZOA 2DH3A 3CO8A 1H7OA 3QKEA 3EX6A 2GUBA 2EPKX 1TWSA 2VEKA 2REQB 1B1YA 2CKSA 5I3DA 4TTGA 3WJXA 3B9JB 2XUCA 1EOMA 2PDJA 3MMDA 1NY1A 4GVHA 1M65A 5H91A 3MA8A 1SZNA 4RE0A 1X39A 5CBIA 3LI1A 2NUWA 3E49A 5REQB 4FDCB 4XZWA 1I9CB 5LNUA 2FTPA 1KFKA 4A8RA 2CWNA 1OFEA 3BQ5A 4CD8A 1CCWB 1FWFC 1WX0A 3W22A 5IHSA 5CZSA 3W7LA 5HMFA 1S46A 1CIUA 5A6BD 1TRIA 2X1TA 4PB3A 2ALDA 1D3HA 1RK6A 2IKHA 5D32A 2WZMA 3A3XA 5F1UA 5EMKA 4CCCA 1OCNA 1DVJA 2CFFA 1UASA 4MPKA 2GVEA 4HHLA 4FIRA 5I3FA 1WKDA 5A6LA 1D7YA 3EF6A 3CS2A 2F6KA 1FDZA 2QUVA 3KAOA 3PTMA 4B91A 4R7OA 1KN0A 1EX5A 2C91A 3TJ4A 2PLJA 4NNAA 3GSMA 2QJMA 2JF7A 1JJKA 4CN4A 3LG3A 4DXVA 1XIFA 4PL1A 5AHLA 3SUTA 2BGSA 4H6QA 2VDHA 4ICCX 4DIAA 4XBKA 1JCLA 1C8QA 4LAZA 1UD3A 2ZZ0A 2VX7A 3TTEA 1EYWA 3NL5A 1XCFA 1O66A 3G1RA 2GR2A 4O14A 1VR6A 1GW1A 4CQAA 5AY7A 2FLIA 3NTYA 4FSAA 2NT1A 3O06A 1J96A 3ZJKA 1MUCA 3NQ2A 5BWFA 1G67A 1GKQA 1Z42A 2W63A 3OBKA 3EEGA 1W5QA 4KEZA 3U7BA 3K13A 4M19A 1V3HA 3IJ8A 4M8UA 3BOXA 2ZUSA 4NF7A 5FI8A 1GRHA 4Q8MA 1KCXA 1XUZA 1E6PA 3BGJA 4BI6A 3M5YA 4A6GA 1DTNA 4QQUA 3VIOA 1FWJC 2V5DA 3KRZA 4H8NA 2YFOA 4J1OA 2CW6A 2CLEA 4TV6A 1OIFA 1FA2A 3GLCA 4EF8A 3C52A 4DX3A 2XIBA 4C7FA 1N60C 1XF0A 1VFLA 1W9XA 3PBUA 3S1UA 3GG1A 1J79A 4HCDA 1HW6A 4CCEA 3WBWA 1UH4A 2WWDA 1JZ5A 4JTIA 2TSYA 1AK5A 4HZMA 1R5YA 3CHVA 2RUSA 3Q6JA 2YVJA 3EXTA 4XG1A 5BXPA 4GOAA 1KC7A 1LL4A 3AIVA 1GOMA 1YQZA 3KZPA 3R89A 4NXSA 3T42A 1JNDA 3BURA 4QJ5B 4UOZA 3PSVA 2E3ZA 1W9UA 3R58A 5GJNA 2XIOA 4PMXA 3A7RA 1FXPA 4H4YA 2WMIA 4GH3A 1U1UA 3DYOA 4K8HA 3TMQA 1F9CA 4OBRA 2OPJA 3A7AA 2RFGA 2W91A 3FG2P 1HJVA 4LF1A 3GC2A 1NQKA 4HNTA 4GA8A 4J35A 2VL4A 4XD6A 4EF9A 3W38A 3AHYA 3LADA 4O1CA 4H4VA 2VEPA 5K9DA 4JNZA 3GD6A 3B8WA 4LU0A 2NT0A 4IIBA 3KTCA 3BSMA 3E0IA 5CBBA 1N5WC 2ZIDA 1DJWA 2DJLA 2EPLX 2CYGA 2VP8A 4QGCA 1IZKA 5A95A 3MSYA 3ZFHA 2DSUA 4OBTA 3TTSA 4HYVA 5AVHA 1JPIA 1VFOA 3W1PA 1KM2A 1XANA 1U1JA 1UWSA 3S6OA 4AF0B 1E15A 4DJFA 4Z2JA 4LYQA 3K8KA 4FK9A 4S23A 2Z7KA 1I2QA 3ITYA 5D33A 2GR1A 3W4RA 4JPGA 1E43A 3OO2A 1H7PA 3AUOA 1W3TA 5CQ1A 1J5TA 4DNMA 4B9ZA 5M03A 1DP0A 4LS2A 2O55A 5D02A 2D2JA 4A21A 5HR6A 2OEMA 4K1GA 2QCMA 1GYNA 4ZO7A 2VM8A 5EFDA 3D6NA 3A4WA 4HSHA 3N25A 3TE9A 1OY0A 1LUCA 4KFPA 4S3BA 1MZRA 3W00A 1A5KC 1XLAA 3EWUA 5AHNA 1E56A 3APTA 5TAOA 3AN1A 3EXRA 1GTEA 3EOLA 3HG4A 2Y88A 4ZBCA 1F05A 2BXYA 2HVMA 3S3GA 1L6YA 3N9KA 1X1OA 2CESA 3ARSA 3SJ3A 4R5EA 4TX9A 1H51A 2FKPA 4P7RA 5IM51 2XU2A 3VA8A 1NJJA 2X50A 3UZZA 2QJGA 4I9AA 1M53A 4A2SA 1FH8A 3K8MA 4DBUA 3WBXA 2IS7A 3WLLA 3VNIA 1DNCA 2AQOA 5CSUA 3FHQA 1R0MA 2AAQA 3MJMA 2WJDA 4X22A 1J18A 1XIEA 3LCLA 3O05A 4P7QA 5G5GB 1QU4A 4MY1A 2H6RA 4Y9OA 1RR2A 2I56A 4C6LA 3ABOA 1G69A 3WEMA 5FESA 2XZ9A 2R91A 5K9XA 1DOSA 2ZRZA 1Z44A 2XVPA 4YLWA 1BVNP 3M0HA 1IT7A 4UNKA 1QNOA 3GNDA 4UCFA 3FS2A 3URQA 3CMJA 4MG4A 3KCOA 4B9YA 1V03A 4Z17A 4GO8A 1UG6A 3P81A 1I0BA 3WD0A 3LS9A 5H8PA 1J0ZA 2PDHA 2QCDA 2VQTA 3UJ2A 4OT7A 2YB4A 4N2YA 3UA3A 4LUIA 2I7GA 3B04A 5BNKA 4C6FA 3WDRA 1KKOA 1BSIA 4KWUA 4OJYA 3HPXA 4WRHA 1WDSA 4F9JA 1VBJA 2XWEA 1D7FA 4HKPA 3APYA 4KH2A 4X0VA 1EGVA 9XIAA 4TTUA 1XHGA 2OMAA 3TQPA 3CGTA 1OINA 1QFEA 5A6TC 5DQPA 4HNOA 4CCDA 4AUBA 2UWFA 5CG0A 4MTVA 3U5YA 2VD8A 1MXDA 5T8GA 4Y2WA 1UMLA 4F2BA 2V3GA 3BLDA 1OX4B 4A3YA 2QCFA 2A7NA 1B4EA 1HN1A 4PGLA 2PF8A 2PF0A 3BUVA 1O60A 3RLGA 2FVLA 4C1KA 1NHSA 1TMHA 3GFYA 3MV11 5HQMA 5LXXA 1Q1WA 3WMLA 2CPUA 5KZEA 1R3SA 1QI4A 3ENLA 4AWUA 1DWGM 2TYSA 3LPFA 3L2LA 3QHNA 1XBVA 2Y7GA 4HD5A 1V0NA 2ZUVA 4WIWA 3CQJA 3UXLA 1W9DM 3GRSA 2E4TA 4O18A 3DHPA 1DWFM 1JPKA 1S1RA 4QG9A 1IEXA 3RCYA 3EWBX 5FKYA 3QH2A 3G1FA 1J0IA 2YLAA 1V8EA 2VFHA 5M2FX 1EC7A 1IIGA 4ZEPA 4DM1A 4LS1A 4AHQA 2RDXA 4DF2A 4XSLA 1VBGA 1TV5A 3UU0A 3JZUA 3E2QA 1O4UA 3BAWA 4PB5A 4A8NA 4EAMA 3IK4A 3EX3A 3D46A 1NEYA 2W3ZA 1S5NA 2I1OA 1TYTA 4ADTA 4AEFA 1HJUA 3HG3A 4C1NB 1ZGDA 4MFDA 2FZ8A 5FEXA 4BA0A 2CITA 3SFKA 2B81A 1AZ1A 1XFCA 3UETA 4QISA 3WD4A 2VC6A 3OODA 4LSBA 3MP5A 4CNOA 4MKSA 2QHAA 4J5NA 5JCNA 1ZP3A 3B05A 5CGQA 4LIIA 3G1SA 3QC3A 2AMXA 1E1CA 1DIKA 1UWRA 5LGXA 3BLIA 4HPGA 4UZUA 1TUFA 1NOWA 2CNCA 4RNHA 5AHIA 3W53A 5ABFB 5KETA 1DJQA 3C61A 1R3RA 3G6MA 1RLCL 2YSWA 4GC4A 4DPQA 4ZO6A 3LXDA 1FUYA 4UQAA 4CD5A 1A0EA 5LHEA 3HO8A 1QNQA 4LVGA 3C8FA 4IMEA 3VI2A 1PIFA 2WOIA 2HCVA 1QHZA 2E5CA 7CGTA 2WM0A 3VAVA 2NVCA 2X05A 3GXTA 4B5XA 1R8LA 4GUJA 1I0DA 2Z2UA 1QASA 1UWIA 2FVKA 2QAFA 1FHDA 4GNKB 4D6EA 4UMAA 3EB3A 4IH3A 4CU6A 3ZWSA 2ZX7A 5F2MA 3O63A 2YPIA 2Y2WA 4RW3A 2YVFA 4DPPA 2XM1A 3GXPA 3KP0A 3SRKA 3O6AA 3A4XA 3SCUA 2NVAA 3VCNA 4ZQMA 1S2CA 4IPLA 4PC8A 3NVVB 3H22A 4XSMA 4CD6A 3KBMA 4D1IA 1RXOB 4H9VA 2I5IA 4IG2B 4QITA 1OHLA 4JFSA 4QSFA 1ZY8A 3SEPA 2C7FA 1VCGA 1SZEA 1V6XA 2ACRA 2YBVA 1K4GA 3W73A 2WOVA 2G3IA 2WNWA 1GQJA 1EGZA 3O0FA 4LT9A 3U2OA 1ZAIA 3DI1A 3AXHA 4B4FA 3L2MA 3R8GA 3T07A 1ZKQA 3R8RA 2OX4A 4CVUA 1JZ6A 1XIHA 3EAUA 1Z41A 2H3BA 4S2CA 3DFTA 4EPDC 1P0NA 1JNEA 2XISA 5E0FA 3Q2DA 1V6UA 1ITCA 3AYTA 5FAJA 1KTNA 1OADA 1C3FA 1TQXA 2BP1A 4IP7A 5JQ9A 4GGBA 2ODOA 1TELA 3R2GA 3GVQA 1OQFA 4FLOA 4QE5A 4IQDA 1AQHA 1QNRA 1YE4A 1W1ZA 1O5QA 2V3EA 4WZHA 1SFLA 1BGAA 3W28A 3PPHA 4XTDA 2Y1HA 3NURA 1WXZA 4CNTA 3NSMA 4DWSA 5MKGB 2ZX9A 3FV9A 3D0CA 2YCLA 2WSRA 3VKKA 2KX9A 1BYAA 4AIEA 2X0YA 4Q7NA 1A4LA 3UNTA 1J2WA 3RILA 1Q63A 3LTSA 3A24A 1XICA 2V5JA 2JIEA 4GUIA 2PDPA 3W9ZA 1CBGA 1HNYA 3B9AA 4FHAA 2QR6A 3E5BA 2EPHA 1PCKA 3ANYA 4FLSA 2Z25A 3W88A 3W7DA 1I2PA 4IFKA 5CC3A 2ALRA 2YCKX 2X16A 4DHGA 4GKLA 5JXQA 1A53A 2VDIA 3B97A 3MI3A 2JKEA 3VVGA 3U2EA 4X63A 4M29A 1MRAA 4MY9A 1VP5A 1FFUC 3AUJA 3JUGA 1H6VA 3BMWA 3WNMA 4DB7A 1WO2A 2Z27A 4ZE5A 2ZA2A 3WQ4A 3RXZA 2FIQA 1VFTA 2YZRA 2Q8LA 3P67A 1H50A 1KQZA 3OZOA 2G3MA 1F6YA 1Q7MA 3M64A 3FKKA 3TONA 1EXBA 5H8MA 3FOKA 1GEHA 4N9DA 3II1A 4KFNA 1ITQA 3MCOA 3WBAA 4NQ1A 1EJWC 2CEQA 3SRHA 1GRGA 5EU9A 1BGGA 1B0IA 1AD4A 2E09A 1E9LA 4Q6JA 4GD0A 2VC7A 3G1DA 6XIMA 1BEUA 3GB6A 9XIMA 1GVIA 2AMGA 1OD0A 2A6NA 2Z6IA 3E5PA 4TMBA 1X2HA 5C7HA 4FI4A 3I65A 3W85A 3M0XA 4GNVA 4LTSA 4AD1A 4KWSA 3N29A 5C2CA 3M9YA 4HZ8A 5ECUA 4H7CA 1UYQA 4NAFB 1NSJA 4XZIA 1TFVA 5B7YA 4DVOA 2YXOA 3INPA 2D20A 4QAIA 1TWIA 3QFWA 3WDPP 5JCKA 4R3UA 2CU0A 1OWQA 5D2XA 1CXIA 1EPXA 3N18A 3CHEA 1VFHA 4UXDA 2GGJA 3KFTA 5BRPA 2DY3A 1OFBA 2BHZA 2VZUA 2Q3RA 1KV5A 2Y89A 2BG5A 4Q8OA 1FRBA 2Y63A 1RLDA 2YB1A 1CI1A 1K7EA 4BQ2A 1IQ8A 3KP1A 1Q65A 4M52A 1WZKA 1S3TC 3NQ7A 5FJIA 4MKVA 2DT2A 3LV5A 1W31A 1FWIC 1QBAA 1VYPX 1J93A 1HO4A 1S2VA 4O8RA 2W54A 4C5YA 3P74A 3P5ZA 5I78A 4JHZA 3QPEA 1IYXA 7ENLA 4YWIA 1GXFA 2AOSA 2GYIA 2PDXA 3A3HA 3AXXA 2IXVA 3CAWA 2R82A 1YBQA 4PR4A 4L80A 3BLOA 4GQBA 3T05A 1PKYA 3HURA 3PBGA 1F07A 1IEIA 5F4XA 4JDRA 2WZHA 3GD3A 1JL8A 2C3CA 4L5ZA 1B54A 4JFUA 3MV01 1UBSA 3VKBA 1UPMB 1ZX9A 2WPEA 3SQMA 3LB8A 1NPXA 3POHA 1CGUA 3N6HA 4LV9A 4I3GA 4WX2A 2GSJA 1UIPA 1V02E 3AISA 1A5AA 2VYOA 3SSZA 3THQA 2YDRA 5AHMA 1B3YA 4EPEC 2IXUA 1EJTC 1NH6A 1QW7A 3W72A 4G7FA 1UWTA 1EUNA 3Q94A 3MKCA 1EL3A 2MANA 4FNUA 8XIMA 4JIRA 5E5CA 3SADA 3DH9A 3IVSA 3RITA 1Y65A