2GGEA

Crystal structure of mandelate racemase/muconate lactonizing enzyme from bacillus subtilis complexed with mg++ at 1.8 a
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
373
structure length
373
Chain Sequence
b'LVKIVRIETFPLFHRLEKPYGDANGFKRYRTCYLIRIITESGIDGWGECVDWLPALHVGFTKRIIPFLLGKQAGSRLSLVRTIQKWHQRAASAVSMALTEIAAKAADCSVCELWGGRYREEIPVYASFQSYSDSPQWISRSVSNVEAQLKKGFEQIKVKIGGTSFKEDVRHINALQHTAGSSITMILDANQSYDAAAAFKWERYFSEWTNIGWLEEPLPFDQPQDYAMLRSRLSVPVAGGENMKGPAQYVPLLSQRCLDIIQPDVMHVNGIDEFRDCLQLARYFGVRASAHAYDGSLSRLYALFAQACLPPWSKMKNDHIEPIEWDVMENPFTDLVSLQPSKGMVHIPKGKGIGTEINMEIVNRYKWDGSAYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords yitF
molecule tags Structural genomics, unknown function
source organism Bacillus subtilis
publication title Crystal Structure of Mandelate Racemase/Muconate Lactonizing Enzyme from Bacillus Subtilis complexed with MG++ at 1.8 A
rcsb
total genus 128
structure length 373
sequence length 373
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2ggeA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2ggeA01
3RRAA 2OQYA 2PU1A 3BJSA 4EWJA 2OPJA 2PTXA 4J3ZA 3FYYA 4G8TA 2XH4A 3I6EA 2AL1A 4IHCA 3THUA 3OP2A 3DG7A 3DESA 2PTZA 3CYJA 2ZADA 2PPGA 1PDYA 3ENLA 4M0XA 2GDQA 3BOXA 4A35A 2XSXA 4A3RA 1BKHA 4MMWA 3FXGA 2PODA 4GIRA 2OO6A 4K1WA 1WUEA 4IP4A 1F9CA 2GGJA 3ES8A 3N4FA 1FHUA 3OZYA 3FJ4A 3ZLHA 1EBGA 4H2HA 4GGHA 3MKCA 3VDGA 2OVLA 3EKGA 4IT1A 3R1ZA 3UXKA 4JHMA 4JN7A 3JZUA 1KCZA 2XGZA 3DIPA 1R6WA 3RR1A 3IJLA 3GO2A 3TWBA 3TJIA 3JW7A 4DX3A 3MWCA 3I4KA 3K1GA 4DXKA 3ZLGA 4E4FA 3PK7A 5BOEA 1ECQA 3PWIA 4Z1YA 5FJOA 4GMEA 3RO6A 3OW1A 3TTEA 3CAWA 3T4WA 3STPA 4DYEA 2DW7A 3OPSA 3VA8A 1SJBA 1JPDX 3IK4A 2OZ3A 3BSMA 3U9IA 2FKPA 3CB3A 3VCCA 4YWSA 5ENLA 2PGEA 3S5SA 3R0UA 4KPLA 1P48A 4GYPC 4ROPA 3I6TA 3NO1A 1RVKA 3D47A 3TOYA 4KWSA 2PA6A 2OZ8A 1KD0A 1IYXA 4F4RA 4HN8A 2QJNA 1R0MA 2GSHA 2I5QA 2AKZA 1YEYA 2MUCA 2P88A 3NXLA 3UGVA 3GY1A 3JVAA 1E9IA 1EC9A 3RCYA 3PWGA 1MDLA 4ZCWA 2PCEA 1MDRA 3SSZA 4FP1A 2QJJA 2QJMA 3HPFA 3MSYA 4HCDA 3UJEA 3QPEA 4IP5A 2PP0A 3DFYA 4IL0A 2PGWA 1P43A 3DDMA 2XH0A 3MUCA 2QDEA 1NELA 2PP3A 3T9PA 2HXTA 1MRAA 3GC2A 4J1OA 4X2PA 3MY9A 4HNCA 2GL5A 2QVHA 1DTNA 2FYMA 3FVDA 3ES7A 4K8GA 4E6MA 1W6TA 2GGHA 2GGGA 3DG6A 3TW9A 1SJAA 1PDZA 3OTRA 3FV9A 2RDXA 4HCHA 3R0KA 4K2SA 4FI4A 3UJFA 3H7VA 3SN0A 1MNSA 1TE6A 1XPYA 3UJRA 4HNLA 2HXUA 3SN4A 3R11A 4ZA0A 2PTYA 2PS2A 3SBFA 4GISA 4A6GA 1OEPA 1JDFA 3P0WA 3DFHA 3H70A 3H12A 2GGEA 3KUMA 3NFUA 3CXOA 4H1ZA 5J04A 3UCDA 3RITA 3P93A 5FJUA 4E8GA 3T8QA 3CT2A 1WUFA 1FHVA 3QLDA 3R25A 3RGTA 1XS2A 1L8PA 3GD6A 1SJDA 4MGGA 2AL2B 4ENLA 3FCPA 2QGYA 3D46A 2PSNA 2O56A 1EC7A 3QTPA 4IZGA 3IJQA 3IJIA 4HCLA 2OKTA 1TKKA 3DERA 5BOFA 2P8CA 6ENLA 3N4EA 1BQGA 2AL2A 2MNRA 2P0IA 3QN3A 3B97A 3PFRA 3MZNA 2CHRA 5FJRA 1KKRA 3CK5A 4HPNA 1JPMA 2ZC8A 2AKMA 4H83A 1ELSA 5IDZA 4HYRA 3ZLFA 4G7FA 3N6HA 3V3WA 3DGBA 3VFCA 1TZZA 3DG3A 2OZTA 1NU5A 3VC6A 2XH7A 4E5TA 4DHGA 3H8AA 3SQSA 3T6CA 3VCNA 3SN1A 2HNEA 3V4BA 3NZGA 3QKEA 4IL2A 3TQPA 2OLAA 3VC5A 3V5CA 3UXLA 4DWDA 1KKOA 3P3BA 4GFIA 2P3ZA 2PTWA 3U4FA 4DN1A 3UJSA 5FJPA 2DW6A 2ONEA 3DEQA 2PMQA 4MKSA 3TWAA 3TCSA 1SJCA 2OFJA 2HZGA 2OG9A 4Z17A 3ZVHA 4GGBA 5FJTA 5EU9A 3N6JA 2NQLA 1EBHA 3V5FA 3OZMA 1MUCA 3Q4DA 2POZA 3UCCA 3SJNA 1ONEA 2OQHA 2QDDA 3Q45A 4M6UA 3R10A 4JN8A 3EEZA 2GGIA 1JCTA 4KEMA 2PP1A 2P8BA 2QQ6A 1EC8A 3UJ2A 3S47A 3MQTA 4KT2A 3TJ4A 4GYPA 4E4UA 2OX4A 2XH2A 4H19A 7ENLA 3ZVHB 2PU0A 3ZVIA
chains in the Genus database with same CATH superfamily
1OJTA 4KRTA 5CJ5A 4V33A 4FXSA 3UR2A 3NNTA 1M04A 3C61A 3T42A 5IHSA 1LDCA 1LORA 2D2JA 3B4YA 5A2CA 2ZXAA 1VBRA 3SCVA 4F40A 3Q67A 3HOJA 2ZZ5A 3DESA 4HHMA 2X99A 1TRDA 1UKPA 3C0SA 2CZ5A 1V6TA 1GKPA 3FVMA 1L2UA 2J7EA 1OIMA 1GVFA 2TMDA 1POKA 3TTSA 1RBAA 1GEUA 4DO4A 1CGWA 2BB0A 3OZYA 2HISA 4NILA 3AALA 4OUEA 4XVEA 1KM3A 1RUSA 3QV8A 4QE1A 1TR9A 3EKGA 3MBDA 2W9MA 3VD5A 3MB9A 3M7WA 4AHQA 3F1QA 3PTDA 3WQOA 3I6RA 1HW6A 2QDHA 3TYAA 3RLGA 4ZR8A 2ZDRA 3W83A 5I03A 3GO2A 4LC6A 3AXKA 4QX4A 4MOZA 3GDKA 2FHCA 4EM4A 4J5NA 2GJXB 2WK2A 1EJTC 2QIIA 5K9CA 1PSCA 1KFKA 3PK7A 1YTKA 1EIXA 5DO8A 3DFOA 3FN9A 4FOKA 5I0DA 1BVNP 2G3MA 4MAZA 1REQA 5IBXC 3EWBX 3FGCA 1NH6A 4TO8A 3CAWA 4Z2KA 3B0YA 5TQLA 1I4NA 4KCVA 4X0VA 5HWJA 4DJDC 1PKLA 3SR7A 4WGXA 1TCDA 2F9RA 3FLUA 4YWIA 4AZ5A 3W7LA 1U22A 3LI1A 1W9UA 5A2BA 2BXYA 4WHBA 2PDCA 2V38A 1UH4A 3M5VA 4QIUA 5LIWX 2W4XA 2CETA 2AAQA 1LWIA 3RK8A 3FA4A 1XJBA 3VPLA 1WXZA 2PDUA 1LL7A 1QBAA 4RE4A 3MO4A 3KS5A 4W86A 3TA6A 3MMWA 4O8RA 4LY8A 3EB2A 3NQVA 4S3JA 2X16A 2CHNA 2EHHA 1CCWB 4UFJA 5HR7A 5FF0A 2IXUA 4ADWA 3KM8A 2X42A 4IH3A 1RD6A 1E3ZA 1VLWA 1VFMA 2WJEA 1PL9A 2BSLA 1QW7A 4WF7A 3A13A 1E6ZA 5FS6A 4RDWA 2GWNA 3T81A 5F7UA 3HQ1A 4GJ1A 2W0UA 2VCBA 3ATYA 3IUDA 3KHDA 4JTAA 2XIIA 3WD3A 5GNXA 4AD4A 1DBTA 3SI9A 4DNMA 4YPJA 2EKCA 1FQ0A 3LV6A 4UNKA 2W6RA 5EB8A 4EM3A 1RLCL 4C7GA 3HN3A 1S2CA 4W8BA 4EQSA 2F6XA 2Y2WA 1FECA 3WX7A 4K8GA 1FP8A 1K1DA 3TW9A 4PMDA 2NXGA 1DXLA 2E3ZA 1LL4A 4GJIA 4NXKA 3WLLA 1W1ZA 1J0KA 1KGWA 3UT0A 3Q58A 2CEQA 1M41A 2FPYA 4I9TA 1TWSA 3MP5A 3PZTA 4B5XA 1FWIC 1ME7A 4Q8UA 4UTHA 3RPTA 4HNLA 2O4QA 5BWAA 2TRSA 1ONXA 2J62A 1AL7A 3H4KA 3ARWA 3B0XA 2JGYA 3BAWA 1OEPA 1O4UA 2BY2A 2CLFA 8A3HA 2X41A 4H4ZA 2XIMA 3H12A 4HMCA 2C15A 2DFAA 2EAWA 2BBFA 5JH2A 1DYSA 3NZPA 3VKJA 1ZPTA 1LROA 4DELA 1FHVA 3PVFA 3AUOA 1BXNA 4WDXA 4XTIA 2ZTKA 3GD6A 5E0KA 3M0JA 3O63A 4PUKA 4RX0A 3A7RA 1F4HA 5EBKA 3ZT7A 2TYSA 3O6YX 5TBOA 2FB3A 5D2YA 3LHWA 3V0TA 4AB4A 1R7AA 2GUUA 1PZ1A 5KZMA 1W5NA 4V27A 1NWSA 2CLEA 4N4QA 1UROA 1NQ6A 3UXIA 4E0CA 1RCQA 2J47A 3SUSA 2F7FA 4HBKA 3ETRB 2FHBA 2VQUA 5TR3A 2VDIA 2ABAA 4PMUA 1W1PA 3CK5A 3GKFA 3SY1A 2YDQA 3GNDA 3VM5A 3BPWA 1AD1A 2RKXA 3K8MA 1GHSA 2A4AA 4IPIA 2G0WA 4P7LA 2FMNA 1AH3A 3S5ZA 3CMJA 1M7XA 3LCGA 2GVYA 1K77A 2YGYA 1Q6DA 4XZNX 3EX1A 1XCFA 1X6LA 1VBJA 3E49A 4KETA 3L4VA 4KFOA 4YYFA 1FWJC 2WCGA 1AG1O 3LHUA 4K36A 1BYCA 1XC6A 4CCEA 3T0AA 3SRFA 3GIPA 2CLMA 2PGFA 3QH2A 2ZUNA 3PP7A 3F5LA 4AD5A 1L6SA 3UXLA 5H1WA 4Q33A 1Q6GA 2V30A 1YHTA 1VPXA 5HNTA 3KBWA 1FWSA 4EMWA 2V3BA 2W5FA 2C3DA 1U5VA 4IMCA 3TR9A 3EEGA 2Z2BA 4EPDC 1BSIA 4INFA 1BSLA 2W92A 3O15A 5FA5A 1DKWA 4KS0A 5HMDA 4DAFA 5DCBA 5AHIA 5I3HA 4JTQA 4I9JA 3CV7A 4U28A 2NQZA 1DJZA 3NQGA 6ALDA 4LB4A 4MADA 2XYLA 3AIEA 1GRFA 2GFTA 2VOTA 1PWMA 3BGGA 2GR1A 4HNVA 2V3GA 5IXEA 1FXQA 1P7TB 1KR0A 1ZB5A 4JX6A 3WY1A 1K9EA 1AODA 1UWRA 1KN0A 3NJ3A 4JTHA 5FCZA 3PANA 5BCAA 4WJ8A 3FSUA 3AU6A 2JEPA 1FFRA 4GO8A 2ISSA 3R7MA 2PU1A 4EWJA 4F0MA 2WO5A 2HS6A 3VNMA 3KBJA 3VIJA 1J6OA 4XZMX 1MEHA 3B0UX 2FH8A 2QYGA 3QC0A 4L56A 3EOEA 2GJXA 4Q8PA 5LA2A 1MFUA 3WQ5A 1MO0A 3W75A 4A35A 5CBJA 5A2AA 4A3RA 1EHAA 4IUOA 5LHFA 3K46A 4ML9A 3GE7A 2IQDA 4KFPA 3AIRA 1JUEA 2FVLA 1XLLA 3WLMA 2ISFA 3MPGA 2J8TA 3ERPA 4NHVA 5FESA 3CMGA 4AD1A 3W2LA 3OYZA 2R1LA 1QFEA 5KZEA 2CNCA 2V5LA 1VCVA 4LAOA 1O95A 4MAVA 4PFHA 1KM5A 2OLHA 2ZUSA 4J3SA 4JIPA 1LOLA 4UMBA 3D3FA 1DJNA 1UOKA 3VMOA 2ZKMX 3TYDA 2HTMA 3MVTA 3TWBA 1A53A 3M0LA 1OFQA 4B90A 4Z2HA 1UR0A 4AY1A 4MKVA 1CGTA 3VDHA 2I7GA 1EJVC 4IPJA 3HF3A 4QBXA 3ZLGA 1Q4NX 1R9ZA 2ACRA 1ZDLA 3HM7A 4C6FA 4TQTA 3RNDA 2RH9A 4PUNA 1WQ5A 4W8LA 4PBGA 2AQWA 4NZ5A 5M1TA 1TJ0A 3VAVA 3INPA 3CV2A 4AIUA 3PFMA 2ZRXA 3WLNA 2CIPA 2O55A 3NL2A 3TX9A 2GVJA 3AHVA 4Z08A 1HO4A 4YL2A 3G3DA 1XH1A 2HS8A 1QPOA 2WLZA 3MI6A 5D4YA 3S6OA 2YFNA 2J7GA 3GBDA 1YQ2A 3W73A 4XVDA 3KWSA 3I6TA 1DTUA 1XXXA 4H9XA 1M68A 3LCIA 3D47A 1OGBA 4GH1A 3K4DA 3FIGA 4TMCA 1LLZA 4CD7A 1YNQA 2E5AA 1I60A 4FEZA 3DC8A 1QHPA 4LJ3A 3W1AA 3N25A 3QGAC 3ITVA 5LIXX 3MP4A 1K8YA 4FF7A 3P5YA 4BKNA 3PR2A 4D8LA 4TX9A 2WKGA 4FLQA 4D72A 2Y0FA 3SFWA 2VJXA 3P82A 5T26A 2X1SA 3BMWA 1PB0A 3IWPA 3WBYA 3W7QA 5E9AA 1KC7A 1IZCA 1XBVA 1N61C 2ANUA 2QJMA 4JFVA 2IUZA 4IL0A 2QUVA 3GG0A 3DDMA 3CAQA 1QASA 4ZOHB 1GW1A 3FJNA 3GVGA 2PP3A 3IACA 4GUHA 2Y7FA 4MB5A 3BW4A 5ABEA 3W7HA 5BWFA 3LLDA 2W91A 4GACA 1JCNA 3ITLA 2ZTJA 2PWVA 3MY9A 2PE4A 1EA9C 1PIFA 2QVHA 3W22A 3LLXA 3NVDA 1HTIA 1IT7A 5BU9A 4ADSA 1W6TA 1I75A 3VU2A 4LIIA 1W9VA 3L5OA 4Z42C 4GCAA 1C8VA 1XIBA 2ZXDA 2PDXA 4DM1A 2VZOA 3AHTA 2PC8A 4J35A 4MWAE 3UJFA 1BZLA 4XD6A 4RLIA 3WH5A 1NVMA 2G3FA 1WP6A 1XRSA 4D6IA 4QLLA 3WLRA 3ZFHA 3SIZA 1JZ3A 3UQNA 5KMYA 4IIDA 1W3JA 2ON3A 4WK9A 1WUFA 4M81A 4K39A 2QMJA 5LNSA 2Q3RA 1S3HA 3RGTA 4HMDA 3WMBA 3W1NA 3WD2A 4UNIA 3LCWA 4D6GA 2NXIA 1AZ1A 3PZNA 1MFVA 3B0PA 2BY3A 1B0IA 4S3GA 4E38A 3CHFA 3TK7A 3EMCA 3K4AA 3WBEA 1CXHA 1EP2A 1E9YB 3N4EA 2YA1A 3CV1A 1LP6A 3R79A 1EYEA 1LT7A 4NI8A 3UVIA 4GKLA 1AH0A 3WQWA 4TU1A 3V0SA 1I2OA 2QUUA 4MLRA 4G7FA 3N6HA 2EPNA 4D1JA 4O1FA 3DG3A 1BVWA 3R58A 1EJSC 4GUJA 3VUPA 1LQAA 1FX6A 4HHLA 1IEWA 3KP0A 2DT0A 3H53A 2OEJA 2PZ0A 4PCTA 5LKYA 4DLFA 1RJQA 1C29A 3VIPA 4E2DA 2PZNA 1IXPA 1R2RA 1EO7A 3M0MA 1GZGA 1TYGA 3EWYA 4LUSA 4QP0A 3TC6A 3LERA 3IIOA 4A4AA 1X38A 2BCPA 1RPXA 1B4EA 2PMQA 3BXWA 1NOFA 2XWDA 3MTWA 4MG4A 5AC6A 2AAAA 1XBXA 1DIEA 3WH8A 3CLMA 5H8PA 1VC4A 3FYPA 3BOFA 1FCUA 1PIGA 6REQA 1B3ZA 4I6KA 1P7TA 1SR0A 1RSCA 1K8ZA 1US2A 3GNRA 3SJNA 1D2KA 4JIIX 1MXGA 3H2MA 3Q45A 1H4PA 2O92A 1KXTA 1MW1A 5HXMA 4EPEC 3M0ZA 2CLIA 2XIQA 1XLIA 5L6UA 1UR8A 2PRMA 3MCMA 3POCA 4NYYA 2HV5A 3CC1A 4JFTA 3ZVIA 3W86A 3CU2A 2WJDA 2G41A 4FDCB 2R1NA 4Q4PA 4LU0A 3VDAA 1IEVA 2XIJA 3ZJ8A 4OV9A 5E1QA 3CUHA 1AJ2A 1ENUA 1SU5A 3T0BA 2DH3A 4F9DA 1GZ1A 4J56A 2I14A 4F48A 4Y96A 2HRWA 3URBA 1Z7AA 1XH2A 1W31A 4BY3A 4C60A 3LY0A 3QZEA 2DJLA 2WKLA 1PCKA 1UP3A 4ACZB 4MMWA 4UC5A 3OVPA 4AISA 2PODA 4B3KA 1ZGDA 3C2OA 3S2LA 4BQ3A 1EP3A 3A4WA 1AD4A 1KTCA 4MSSA 3WJWA 1F9CA 3QR1A 3UXDA 2HBVA 1ITUA 3M41A 2PWFA 1HT6A 3G1XA 2CZEA 3E02A 1ESWA 4LEFA 1TREA 5BRBA 3EX3A 3PZVA 2OO0A 3HJEA 4Q8NA 3TQ0A 1JJKA 1E0UA 3JZUA 1D8CA 4RE3A 4A8LA 1XD1A 3I3BA 1EDQA 4Q4RA 2QCHA 3G24A 3VCRA 4ZQOA 1E6QM 5I3GA 3HU7A 5GRTA 5CZTA 5AY7A 1RR2A 3EPOA 5PTDA 8RUCA 2RDTA 2D20A 4HOXA 1VPYA 3S1WA 5JCIA 3AMCA 1OYCA 5BOEA 3PWIA 4HJFA 5FSDC 2DEPA 2O9TA 3RPMA 1UQZA 1G4SA 3ZT6A 2DVXA 3KFTA 3DGHA 2Y7DA 1GK8A 1XYBA 1P5BA 1LRNA 1SJBA 2WZMA 5KVIA 3WL0A 4L9XA 3CEUA 4FALA 2Z1SA 3BURA 3KCLA 6TIMA 1PTAA 1TTJA 1JGIA 1EPXA 4CNOA 2JEQA 4JS3A 4CN6A 1MUWA 3ARSA 1TV4A 4NU7A 5CZKA 4EK7A 3GXDA 2WJFA 3R0DA 3GXNA 2BC1A 1UB3A 1V6YA 4ICNA 4KWSA 1XD0A 4GNJA 3SY5A 4DPPA 1FTXA 1NDYA 1J2WA 5JCKA 1STZA 2ZYFA 3CQJA 5C9ZA 2VD9A 3N3TA 4PUUA 3MMUA 4HZMA 2R14A 4TVWA 4H8HA 1MW0A 4QNWA 3WF1A 3G5EA 2CU0A 2X30A 4KCUA 3UGVA 3VGFA 4Q4OA 1GT8A 3RCYA 2V81A 2VZSA 1KQZA 2D3LA 5M17A 2FJKA 4MZ1A 3O9NA 4MLJA 1F76A 5C71A 4ZQCA 1GJUA 1KRMA 1XLFA 2XH0A 2QDEA 1V93A 5DMMA 1L6FA 2DZTA 2VFFA 2DDXA 5AVHA 2BDQA 5JUVA 2J7FA 5AC4A 1JRBA 1ONWA 3GG8A 1W1B1 1AMKA 1FWBC 4QROA 3GTIA 3NPUA 2BVYA 3NDOA 5ABHA 3DYMA 4ICMA 2PDFA 1MEWA 3TXZA 4D6FA 5G5HB 3S9YA 4YVVA 4N9DA 4Q3MA 4CNUA 1GJWA 1QBBA 4HN4A 7PTDA 1YKWA 1T8XA 1UYQA 2NWSA 2WW5A 4H4IA 4HK5A 5LA0A 2YZ5A 2BMBA 4IIEA 1CLVA 4CU8A 4YLWA 1XP3A 3CH9A 1TJPA 2Z2AA 4JGDA 1XINA 4PTXA 1KM4A 1TE6A 3UJRA 3W71A 4O18A 4U31A 3A7AA 2G3NA 3ARPA 3GFZA 4ONVA 2F61A 4AD0A 5EPDA 4U2YA 1F4AA 4GHRA 4FLOA 3LXCA 3VVGA 2J3NA 4X22A 4WD0A 2GGEA 3MUXA 1JAKA 3P93A 3E5BA 1T7LA 3E1F1 2J78A 4YCOA 3PS7A 3AMZA 1ISZA 4XUGA 4GIEA 3PZOA 3G0XA 4DXXA 1SPQA 4XAYA 2UY4A 3LLFA 4WGHA 4QJ3B 3UFYA 3WQFA 3GHRA 3L0GA 3UNTA 2WSQA 3W7RA 1T6MA 1EC7A 3QTPA 1GZJA 3W23A 2OKTA 3DERA 5BU6A 1QI3A 3LPGA 1R87A 2A85A 4GR1A 1UWSA 4M5PA 3GTXA 2NT0A 3R94A 2Y24A 1JPMA 5GQBA 2AKMA 1OFDA 3II1A 3PC0A 4GE8A 3SCNA 4PUEA 4GA8A 1TV5A 1VAHA 2CC0A 4K8EA 4J3UA 2OZTA 1TPDA 2E8ZA 1NJJA 1PBGA 3ZZ1A 3PPHA 2PWDA 3R5EA 2CXEA 1GQNA 3A4JA 4Q6XA 5AC7A 1S5NA 3RM9A 3GW0A 4ILSA 4O13A 2XFFA 3AZRA 5EKYA 2PUZA 3NZGA 3PG9A 1GETA 5AB3A 5CSSA 3UWVA 3Q94A 1S2VA 3O6DA 1NWTA 2PD5A 5DT7A 1KR1A 5GJPA 1X8CA 3AOFA 1YTDA 2ZICA 3ONBA 5JQ9A 2XTKA 4UQCA 2WWDA 3NR0A 2BLEA 4AY7A 3W02A 1E73M 2IKHA 3P81A 1J0IA 1S46A 1V08A 1W5QA 1JPKA 1UMLA 2NVKX 3LRLA 3QY6A 2ZXBA 1E4IA 1VENA 4H9VA 1I2QA 1N7KA 1EBHA 3GDBA 2Z6IA 1B5TA 3WQ6A 4M6QA 3C8NA 2G3IA 2TPRA 3T1GA 4AYSA 4YYCA 5I3IA 3UVAA 1OZMA 4Q6JA 3W6LA 1JR1A 4LS0A 2PBOA 1OX6A 3ABRA 4XKYB 1FWRA 4RNJA 2GUYA 4GXMA 3SGGA 1V03A 3GXTA 3OLGA 4C6PA 3ZWSA 3M5ZA 3RX3A 3T55A 4WY0A 3RM8A 3TVAA 3HQNA 4FNTA 1TQJA 1EJUC 3S2MA 1F8WA 3ZT5A 1RP8A 2FGLA 4RZ4A 3O7UA 1IGSA 5AHNA 3RCNA 4EMJA 2J7DA 3ORWA 3TCEA 1X1ZA 4X9YA 2I16A 1AW1A 1TMQA 1ICPA 4PTNA 1VDVA 3NQ7A 3W2NA 2PAJA 3W2MA 5C2GA 4FF5A 3GLCA 1QPKA 1MWOA 4NUWA 2YXOA 4UFIA 2JK6A 4GZEA 4NP7A 1TV8A 3G3MA 3WG6A 1BQCA 3R8RA 3PPCA 4BA0A 1FIQB 5C5YA 2VUNA 1TB3A 2X1TA 4XSMA 1CEOA 3DCPA 1ZY9A 2XZ7A 4L4LA 1HZYA 2XN0A 4QCFA 1UWTA 4LC8A 3STFA 3B9AA 3GNOA 3CWOX 5D2TA 1R6WA 3L0KA 3TJXA 4K6AA 1O5XA 3RDKA 3RCMA 4HMEA 5D2VA 3CZEA 1HN1A 3KDOA 1HUVA 2VT0A 4O15A 2OELA 4IJRA 5FS8A 5DX7A 2F38A 3NL5A 4QRNA 3NTYA 3EGJA 4L5ZA 1AL8A 2CWXA 4Y7EA 3QFAA 3GAKA 4AZCA 4NZCA 3RO6A 1ZBCA 5LIKX 4PB4A 4IF2A 4I7WA 5IDIA 2DW7A 2FQIA 4IM4A 3S9IA 2W55A 3IAPA 5D04C 2DY3A 4RDYA 4MZ8A 3DGZA 3AIQA 4ZQMA 3K4WA 1VLIA 1M1BA 3CQ0A 1FWHC 4GH3A 3EUB3 2DUZA 1FDZA 3IUIA 1KV8A 3KOFA 4FZIA 4JTLA 2XFWA 3TA9A 3CWNA 1ZCOA 1O1ZA 1TIMA 1I8JA 3T09A 4JDYA 4FLSA 3KZPA 5FEWA 4XZLX 4N9BA 2WHJA 1MQPA 1R0MA 4FK9A 3QOMA 1FCVA 4C65A 3LPPA 3NQEA 3NVTA 3KEHA 2I5QA 3APTA 1MO9A 1RQEA 4LALA 4RXFA 4KPRA 6A3HA 3RNMA 1O6IA 3WF4A 3W9ZA 1R2TA 3EDEA 3TXVA 1SO3A 9XIAA 3IRSA 2GQWA 4RZ6A 4X61A 1MDLA 2EO7A 3MSYA 2QV4A 3WNPA 1QHOA 4GVIA 4RV3A 2W62A 3GZAA 1J5TA 2XVPA 1W5PA 4YWOA 2FFIA 5E5CA 3BAXA 3GQYA 1IIHA 4I6VA 4UTUA 2C6QA 3P8IA 5A3HA 2NQJA 4S3FA 1ZU8A 2XVNA 3QV9A 2QPUA 3KS6A 3GD3A 5CSYA 3B05A 1T3QC 1IR2A 3W2JA 4ZO8A 4KCTA 1OT1A 1VJZA 2QCFA 3W7GA 1S5VA 4LUSB 2GOUA 4GXWA 2VVSA 1OABA 3CS2A 4K3ZA 3T0CA 1ZENA 1CXEA 2V63A 1XPYA 1JYNA 3SZ8A 5T8GA 3B9JB 3ARQA 3SBFA 4M6VA 1QRQA 3G1SA 1ZZMA 4LANA 5DXYA 1W32A 1RCOB 2NQ9A 4UMAA 1J6PA 2WB5A 5DMYA 3CAKA 1AQHA 1A5NC 1H1NA 1SW3A 1IHIA 1E72M 1P6WA 3H2NA 4H6QA 4UR7A 1XRVA 1EX1A 5DFAA 1E6SM 3IVTA 2CCRA 4FIQA 2NUWA 3THCA 1A3XA 1UPMB 2H9AA 3FCPA 1A0DA 4C6DA 4W88A 4H4TA 3D46A 5A6BD 4B9ZA 2R1KA 2OGYA 3UZWA 2VXNA 3QV6A 3G18A 2Q8XA 1Z69A 4H6EA 5ABGA 1E6PA 1G4PA 2WZEA 1K4GA 3ANYA 1BF6A 2FZ8A 5FJIA 4PB5A 4AMCA 3URNA 4DWSB 3ZLFA 2Y61A 3LD5A 1KXVA 1L0PA 3H26A 3ARTA 3VKDA 4XAGA 3HG5A 4HU0A 3DGBA 4IGMA 1GG1A 1E0WA 4AMAA 1NU5A 3LS9A 4LUJA 3BO9A 2Z1KA 2G95A 1V6UA 1KQYA 4RDVA 3IGXA 1IZJA 3MA8A 1F6PA 4US5A 2PEVA 2YLLA 1ZBWA 3BJTA 4AF0B 3CHCA 1QR7A 5A6SA 2VHLA 3KW3A 3AS0A 1PX8A 3VC5A 1HP5A 3FHAA 1YPIA 2CLHA 3CT7A 2XM2A 1KKOA 3ZR6A 2GH5A 4ZZ9A 1QAPA 4C7DA 3O0FA 3GFYA 4WSKA 3L2MA 4LXFA 2ZZ7A 1TVNA 2PDJA 4MDPA 5AC8A 5XIMA 1OINA 4B3LA 1SJCA 5EMLA 4R7JA 1W37A 2BGSA 1CXLA 4O1EA 4O28A 2WP6A 1RQHA 2GUBA 4B3ZA 5C9WA 4O0ZA 4H01A 4XKYA 3RM4A 1BGAA 1JNEA 1JROA 4I90A 4JD4A 3AN1A 5BXTA 3D9XA 1QCWA 3IVUA 1GJPA 4LF1A 5CPNA 1SVDA 1ONEA 5BXPA 1GVQA 4F79A 2INZA 2WQDA 1GVEA 1BLIA 4JN8A 3M4HA 4O57A 4DPQA 2PP1A 1U1JA 1B3VA 3ABOA 1BTCA 4OBSA 2CBUA 3GRTA 1A3HA 3W29A 4ZO6A 1NHSA 2FHFA 4HYVA 5GNYA 4H8NA 2W3RA 3EDKA 1OX5A 3VYLA 4CN1A 1XYCA 3VOGA 1HJWA 3OIHA 2G4FA 1VHNA 4NJGA 3A4AA 3OP2A 3TU9A 3K5XA 3LB8A 4TV5A 1WXYA 4A29A 4Q8TA 3TYBA 5EY5A 4LBRA 3STEA 2XSXA 4Z2JA 1A4LA 2ZDSA 3R8HA 1GEHA 3NYDA 4K7VA 3WDPP 4NZ1A 4RNFA 4CU7A 1UG6A 1WYIA 1UKSA 2OO6A 2GJPA 2WVVA 4DUOA 1GQLA 1PVNA 1X6NA 1Y5VA 2C19A 2TAAA 3GYCA 4MTVA 1EUAA 2NX3A 1FDYA 4CNSA 5F2LA 1DJHA 3QHNA 4QE4A 4EQRA 3ZIZA 1JL8A 2NX9A 1THFD 1JEHA 3N9KA 3AO0A 5I24A 3GTNA 2PWUA 3EOSA 1OC7A 3OLEA 2RFGA 5I09A 1QNSA 4WCJA 2XGZA 2V3DA 4AZ6A 2BVWA 3RR1A 1XIDA 1QO5A 4ZQPA 3F2BA 4HYWA 1H5YA 3LZ3A 2JGQA 5DANA 1E51A 1J96A 2WM0A 3N9SA 2EG6A 3CUIA 4LQ1A 3PZMA 4FNSA 4RE0A 1F7BA 5F2GA 3F5KA 3SDOA 3TEVA 4Z1YA 4FMVA 4GMEA 2I17A 1FWWA 3WH6A 4DRSA 2XIBA 5DCEA 4HIBA 4XAZA 2JF7A 4KF1A 4HMNA 1XGDA 3PN8A 2XHYA 1XDMA 4H6KA 4J40A 5C8BB 3TLQA 1XIGA 1YBQA 1IXQA 1QI5A 1CTNA 3GC5A 1R2SA 4JIQA 3M0XA 1E15A 1V3MA 3BAKA 1BWKA 3T07A 4AVNA 4ATDA 3KL0A 1P0BA 1H1YA 2FZDA 2WPFA 3CASA 4DF2A 4H4XA 3BG9A 4JYEA 1OBAA 2BOFX 1WA3A 2ZWZA 4Y6GA 3W07A 4PUMA 2GQ8A 1WXJA 3HFYA 2FFCA 4LFYA 5CC5A 1DE5A 3L0NA 2Y7GA 1QOQA 4Y9AA 1WDWA 5A6JA 4IGNA 3PWGA 3L4UA 4ZCWA 4WOZA 3NDYA 4XBSA 5ECUA 4FP1A 2E1WA 3O16A 4WQ6A 2VGGA 4ZTYA 5CAKA 1R3QA 4NEVA 2XINA 3C8FA 4FR6A 5FL1A 2C3CA 1O66A 1N62C 2FZNA 1WPCA 4ALDA 3T9PA 1K02A 1KRCC 3WNLA 4DZHA 1UIOA 1DTNA 3ZSSA 4JTTA 1QNPA 1CXFA 4C6MA 2VMFA 3HPAA 2OZ0A 2GGGA 5T9BG 4Q8OA 1B1YA 3V75A 1L6YA 3QSTA 3TW7A 2YBTA 4C1LA 2UY5A 2F2KA 2ZRYA 1JZ6A 1HVXA 4KW2A 4IMAA 2QLYA 5MKGB 1U1HA 2PDWA 3EX6A 3UWWA 1V3KA 2PS2A 1TMHA 3VDCA 4YNGA 2D69A 4L80A 5CGQA 2ZC1A 4LPCA 2EBNA 4CCDA 4BV6A 3QLDA 2IS7A 1SFJA 2WMHA 2HPIA 4JFUA 3GS6A 5CEWA 4ZE4A 5CSUA 4KIEA 5JBFA 3D5HA 3D3AA 5I3KA 5D33A 3A9BA 1QXLA 4REQB 4JIHA 3VGBA 4JBRA 5I06A 2QGYA 1HJVA 5A8MA 5XIAA 2PDYA 2WHLA 1GKRA 2C1IA 3MSRA 3NQBA 1Q63A 3URAA 1BGGA 2VWTA 1BQGA 2CZVA 4AQLA 2J27A 1TPEA 5I5RA 1RXOB 4DBEA 4A21A 3E2SA 1X2GA 4BQ5A 2O9OA 5AECA 1UZHA 4H7CA 3WLKX 3NVWB 5EA9A 2HWGA 3BUVA 1Q6OA 2WPCA 4JDRA 4AWEA 1Y5WA 3AIBA 4MFDA 3WUFA 5BXRA 2O0TA 4F2BA 1V79A 4LBSA 3REQB 4G1NA 4PR4A 3NSNA 2OOGA 3O6AA 2V3AA 3GD4A 4R34A 3B03A 3S4TA 1UC4A 4A2RA 4IL2A 2ZFAA 3AJXA 3WEZA 3FW6A 3VMNA 1SSDA 3QY7A 4MY9A 5I77A 4LT9A 2G4JA 2IPWA 4R33A 2A3AA 3ZO9A 2GDUA 5FIPA 1X6UA 2JKAA 4PEEA 1V51A 2AGKA 3SUTA 2HVNA 3L2LA 3I7SA 3BLKA 5KITA 2E77A 1E1FA 3ZVHA 2I5GA 4IFOA 4CNPA 3T78A 1B9ZA 1EP1A 3N6JA 1DWFM 1TSIA 3ITCA 2OQLA 3KVJA 3IV3A 1Z89A 5HAOA 3Q4DA 2CLPA 4H7ZA 2KZHA 2X2GA 2PTDA 4AVFA 4ZB2A 2V5DA 4FSAA 4M6UA 3ARVA 1S39A 1X1NA 3VE7A 2PCQA 1TQXA 4B5VA 2A6NA 2CZDA 5EYWA 3NM3A 3AAMA 1CXKA 2QJHA 1CGVA 4Y8FA 1IIGA 4ZSUA 1Q2RA 1SW7A 2Z1VA 3M5YA 3N13A 5CPLA 4G56A 3ME3A 4QHRA 2QCNA 5I23A 3O3RA 3QLLA 3NO3A 3WUGA 1I1XA 1G6CA 1Q1WA 2VC6A 4QM1A 3SRKA 4J3ZA 1R3RA 2AL1A 5HANA 3DAQA 4Y9PA 4H50A 1U30A 2ZCGA 1PX3A 4N6FA 3GYEA 5AYXA 1QPQA 3MYPA 3IJ8A 1R3WA 1WZAA 4S3KA 1XISA 5G5IA 3CMFA 3RU6A 3PZIA 2YCLB 3H2AA 1EUNA 3CWHA 3FXGA 1NARA 3FYOA 4QSHA 3E2QA 2W3ZA 1Z48A 1B3OA 5D9OA 3A9IA 1UWIA 5XINA 3SADA 1TPWA 5FF7A 2GJRA 3ALFA 1JFXA 1CPUA 2QV5A 4H2HA 2C0AA 1KFBA 2ASHA 1EQCA 4IQEA 3A5FA 2X2YA 2GVGA 4MWAB 4QG9A 1FKWA 4UXDA 2W61A 3TYUA 3EMZA 3EKZA 4KQNA 3HBLA 1EYWA 3LTPA 1TMLA 1NHQA 4YTSA 3S0CA 1H62A 3W1TA 1B31A 4DI9A 1UP2A 4NI3A 3Q37A 3BMVA 1JVNA 3G8EA 1T99A 3AI0A 1JG9A 4NRRA 4HHHA 3A47A 5LXEA 4MJ4A 3I4EA 3K8KA 4EKJA 1FWFC 2DZUA 4CQ9A 2VRQA 4FHAA 4LGXA 3EKLA 1XLDA 3GH5A 1NWRA 1C7TA 4CEUC 5FAJA 3WJSA 5C9XA 1UH3A 4KWWA 1LG2A 2OOFA 3AU2A 2OGJA 4K37A 4UTJA 4DJDD 2RDWA 4JQ3A 1E70M 4WX2A 1DIKA 3JU2A 4WKFA 1F2JA 1F8MA 5GJMA 3FDKA 3OG2A 5TF0A 1P48A 2Y1HA 3NO1A 4QR6A 2YDAA 5JBEA 4B9YA 2XZ9A 3CLWA 4E8CA 3HV9A 1T5AA 2IPGA 4LV4A 1YE4A 1XV8A 3CTLA 3SCSA 1F6YA 3EF6A 1T8QA 2AKZA 2H3BA 1GORA 4PTWA 3C2VA 3ABXA 3GRIA 1PCWA 4PMQA 4FX7A 1H41A 2EPOA 4RW3A 2DZPA 3CHDA 4F3HA 3VIFA 5IFTA 5HA7A 1H2IA 4EE9A 1QOXA 4PRWA 3FEQA 4AEEA 4B2DD 4H4SA 3SSZA 1SFLA 2YXXA 2FGBA 3VMPA 1ZK7A 1FRBA 3WLHA 2JE8A 4BR1A 1YX1A 1Q5MA 1KFJA 4GIAA 4NZ3A 2WP5A 5IM51 1NELA 4PMYA 2WC4A 1EH9A 3B9NA 1E55A 4D2JA 1AH4A 1E40A 2A7RA 3FA5A 3RFAA 4FNQA 1JIBA 4Z2LA 3ARUA 3QVQA 1EB3A 4FX8A 4QCEA 1HKKA 1IWBA 3KRBA 4E6MA 1UD4A 2FPTA 3MHUA 2E4TA 2DT1A 2XVGA 3QXBA 2QDGA 4HD5A 2GRTA 3FV9A 2CBVA 1X8FA 1FUYA 4HCHA 3UR5A 4K2SA 5TAOA 1P0EA 4FI4A 1UA3A 1RPKA 4H00A 3SN0A 4C90A 1MXDA 4D6CA 5B80A 2GK1B 3R11A 3QMRA 3C2YA 5AYZA 2ADAA 4PMJA 3NVYB 3MJYA 1SZEA 4B5NA 3IEBA 4J9JA 3OQ8A 2ZVIA 1DWGM 5A8GA 4MNJA 3T2QA 1GWJA 3VUSA 1M7JA 1MI3A 3MSGA 1X2HA 1YIXA 4K1GA 4HZ7A 2XGBA 3QKZA 4LAZA 1TPUA 4OGZA 2VNCA 4P7QA 3AIVA 4L1XA 5IOBA 2E6AA 3MDWA 5BOFA 1ITXA 3B8WA 1MEIA 1OF6A 1FEAA 2VX7A 3CQHA 2GJLA 4ZMGA 1OFBA 4JICA 2R9ZA 1H2JA 3TZFA 4F0SA 3SSJA 4ZSTA 1PJ9A 4PMOA 3W81A 4UTWA 5FJRA 3QY8A 2FZ9A 1IR1A 5JCNA 4M8UA 1TWDA 4GJJA 1I2PA 3NEVA 2Q6ZA 3SO7A 4HU4A 2ZUVA 3TC3A 4U10A 2Y63A 3V3WA 3RLHA 3KLLA 1FH7A 2E5DA 2JBMA 1S2TA 5AC5A 1OWQA 3DK4A 1YW1A 5FF3A 2FLIA 2BHZA 5KINA 4LCSA 1HKVA 3LHYA 7REQB 1RAKA 1S5TA 1ZMDA 4XB3A 4U5KA 2IKJA 5EBAA 1O68A 3QQ0A 3RX2A 1QK0A 1KCXA 4NX0A 1WZLA 1VFOA 4Z1BA 3BAIA 3P3BA 2PTWA 5E6YA 3S42A 1J93A 5CXPA 3PAOA 2A3CA 1X96A 1UCWA 3PF3A 2GWGA 1WDRA 1A5LC 5H91A 3L9CA 5DCDA 2DUXA 3EXSA 4Z17A 1LG1A 2Y8UA 1XM3A 5ABTA 1UH2A 5CLTA 4UNLA 3OG3A 3OBAA 3OZPA 2P3EA 1HL2A 1W9PA 2POZA 3GXPA 2GPTA 3E0FA 3LADA 1CDGA 2FGZA 4A3HA 4FNPA 4JFSA 1Y0EA 2X7WA 4D8AA 4IFRA 1AW2A 3PBUA 3WQDA 4LRSA 4QEEA 4XV0A 1EWEA 2PLCA 3KXQA 4E4PA 5DMNA 4IQLA 3QBUA 1FKXA 1BAGA 2QCGA 2GDVA 1OCQA 1R3VA 3G1VA 4MWAA 3PWAA 1EZWA 3W76A 3F5JA 3QPZA 1NOWA 2PTXA 2B4GA 4RUBA 2BX7A 1AA1B 1QNRA 2A8XA 4FR1A 4U3CA 3EPNA 4H9TA 1W5OA 3EAOA 4UQBA 1K8CA 3L4YA 4ZOBA 4GIRA 1WUEA 4ZOAA 3N4FA 3C2EA 4PRRA 3MANA 1REQB 3WDIA 2WMGA 2OVLA 2E25A 1XPGA 3U48A 3IV8A 3C2FA 4KESA 3AISA 2V67A 3WMSA 4MJZA 3DK8A 3NOEA 4EOUA 3USBA 5LIUX 3TJIA 4DX3A 1O5KA 1OK6A 1R9XA 1CT5A 5AFDA 4TX6A 3XISA 1MUMA 5I2UA 4UQAA 3TSBA 3UZ5A 1YPXA 2GR3A 2C16A 4Z1CA 3B9DA 4GUGA 1DQXA 3WBAA 2UY2A 4L6DA 3VA8A 1DIOA 3W1PA 1QMLA 3ELFA 3OJGA 1VYPX 3NIYA 3QW4B 4Q8MA 3W7KA 3U9IA 2FKPA 3C6CA 3MW7A 1XLJA 2DORA 3W1QA 2YX0A 2BHYA 3JZEA 3V36A 1AQMA 1GKQA 4GYPC 1SQ7A 2B7PA 2H8XA 4Z2GA 2YLAA 1VQTA 3LQLA 4OKDA 4DB7A 4ZFMA 2PA6A 4BWLC 4P7OA 2OZ8A 4J3XA 1HO1A 1XR2A 3UWEA 3C3UA 3LMYA 1DWAM 1W54A 3RRXA 5A8QA 5MHBA 1XLCA 1XLBA 2MUCA 2P88A 4TVDA 3NXLA 1SW0A 2ZX8A 4S1FA 4LVGA 4DF1A 2VCAA 2XVKA 4HNUA 1EC9A 1H49A 2VO5A 2VZUA 5AVNA 4MY8A 1BEUA 3GW3A 3L2IA 3LM7A 4HCDA 4M3PA 1MYRA 1H7PA 1VJSA 2PGWA 4ZBCA 1WDPA 3PUDA 1G69A 1J0HA 1X97A 3AXHA 2ZUTA 4NXSA 1VIZA 4IICA 4W87A 3CPGA 2HE8A 3NL3A 2C1HA 2AGTA 3DYOA 5E09A 4P7NA 3M0IA 5TD4A 3NGJA 1KWGA 1EGZA 3NQCA 3UBPC 5I00A 5FS7A 2V5BA 4R7OA 2OSWA 2PDNA 1U2YA 1AUSL 3EA1A 2OODA 1A4MA 4EF9A 3L5LA 3U2OA 4D1IA 4KRZA 3V7PA 3M5XA 1MNSA 1JUKA 3C52A 3W7DA 5HWNA 3PPFA 4MJMA 7A3HA 4ZA0A 4JY9A 4GISA 4N4PA 1KM6A 1YNPA 4XAFA 4PCNA 4RK8A 4O19A 4CNTA 2BOGX 1ZFJA 3WLSA 5FJUA 4NAFA 5A6BA 4QDWA 2X1RA 4M29A 1ZAJA 1HKJA 1AMYA 1NEYA 3QYQA 4FIRA 4B16A 2QAPA 4CD4A 3QMSA 2OSXA 3MUIA 3R12A 1R86A 4ADUA 3ZOAA 1N8IA 3MHGA 3UWZA 1IXOA 3BCJA 4GD0A 4GUFA 3UZJA 5DF0A 4O4WA 1AQFA 1WYGA 5EMYA 1FOBA 4PMNA 4PTMA 3G1FA 4H9ZA 4W8AA 4WDWA 4LYQA 3H24A 3AHYA 3PY2A 4IJBA 3S5NA 3UR7A 4BJHA 3CH0A 1IEQA 4FA3A 1DWHM 2HBXA 3LZ5A 1A5AA 4DQWA 1WKFA 4IWWA 2C1GA 2EGZA 2UZ9A 1UR9A 2ZA1A 3GUWA 3DFSA 3ARXA 5E0FA 2A0NA 1F74A 2HE5A 1C91A 3WDJA 4E5TA 5E6ZA 2OWWA 3S2NA 3M9YA 2R6OA 3H55A 3VNZA 1Z42A 4JQAA 4XZHA 1L9WA 1SZGA 4W5ZA 1Z3NA 3UY8A 1BG9A 1F07A 3TQPA 3TR2A 3L8KA 4S2CA 2IMRA 2Y85A 3W7IA 3GVRA 3EWWA 2XISA 2WOIA 4OHQA 2OWCA 1XWYA 1QW9A 2DW6A 2ONEA 2F5ZA 2DSWA 1BVZA 2SFPA 3WKZA 1ZNNA 4UQDA 2OFJA 2WNQA 3CL6A 1GRTA 2Z26A 4CGTA 4EMIA 3N14A 3TTOA 2OEMA 3QJAA 4JTFA 5FJTA 2XU2A 4LNYA 5J8LA 2G37A 1GOXA 4PC8A 4CD5A 3NZ1A 3IS4A 3IAQA 1OCNA 4GI9A 5I7GA 3KDNA 4RNIA 4F2UA 3R2GA 1LOQA 3IJ6A 3W37A 1RBOB 3CO4A 1WE5A 4ERAA 2GGIA 4H4UA 2VEGA 3DXIA 4JY8A 3CTTA 1QI2A 4IG2B 3W28A 3LYEA 3W1LA 5FS9A 4GZ7A 3QR0A 1XL9A 4O50A 4TX8A 4UCGA 2ZUUA 4JKKA 3GVWA 3BW2A 3TLLA 4BI6A 1EOKA 5A8NA 2ZADA 2F2HA 3T8LA 5DT5A 1A47A 5BMWA 1LRQA 4A8RA 2QPXA 3TN5A 4WVXA 4M1RA 4K1WA 3B8TA 4H8UA 4CLMA 1X7FA 3RIKA 2VL4A 4C6LA 4GXPA 2X0SA 4B5UA 4N9EA 3TV8A 1DOSA 2X0YA 3G0UA 1EBGA 4Z2IA 4JTJA 4PEKA 4IMEA 3BGAA 3OLIA 4JNYA 3S46A 1J0YA 3KOXA 1ONRA 2Z25A 2FH6A 1TX2A 5L9FA 2EQ6A 1AJ0A 1J0JA 1V5XA 1EEPA 1I0DA 1JZ7A 2NQHA 4MPQA 4N42A 4QLKA 2J66A 1YDVA 4O0KA 1N55A 5C2CA 4UZUA 1H11A 1U1UA 1WOAA 2PDHA 4JZ5A 1CI1A 4HNOA 4S23A 5JMUA 1B57A 2HK1A 4H9YA 3A5VA 3NURA 3S6DA 5I02A 2HSAA 5REQB 4U33A 4S2BA 2WNWA 3KE0A 4TV6A 3MUAA 3STPA 1RCXB 4RW5A 2VVNA 4H6RA 3R89A 1NFBA 2Q8ZA 2PURA 1EQPA 3E3HA 1BKSA 3BWWA 3N2OA 1FA2A 3VNIA 1K7FA 1S1RA 2GOKA 3T40A 5AHEA 2X8RA 5K9DA 4AU0A 4GVHA 2J13A 3LRMA 3F4NA 3TOPA 2FVMA 4JHOA 3GWQA 1JULA 5T91A 1GONA 3BLEA 3MUZ1 2NSXA 4NY2A 6XIAA 5JCMA 3II4A 5REQA 1ZJHA 4GC4A 2VURA 5LSMA 4TTGA 1PO9A 1WKYA 3AZTA 2E9BA 3BANA 3OODA 1VBGA 3GNXA 1NY1A 3W7MA 1OGSA 2GR2A 2Q3OA 1UJPA 3WDRA 1AVAA 1VP5A 3GY1A 2WLYA 3GR8A 3A6OA 3ZJ7A 4HA3A 4F9JA 1NDZA 3VNLA 4NNBA 4E2OA 4BI5A 5CC6A 1IZKA 3S6TA 3OZOA 1PYFA 3I3EA 1V3LA 3TQVA 2JFEX 5HBFA 2VZTA 3OQEA 1UD8A 4M24A 4W93A 4P8UA 4WOQA 3K13A 4L65A 4JTSA 4TVYA 1W8SA 4GY0A 1F61A 3QZAA 4B5WA 4KEVA 2GR0A 4QJ1A 1OADA 4ECLA 3WQ4A 3WJXA 2A79A 3GR4A 3B8UA 1ZTVA 4NSBA 4R88A 4S3EA 3LOTA 2NZLA 3ES7A 3GB6A 3T05A 3KX6A 5B7YA 2DZAA 2GGHA 4PTDA 3O0HA 3WDHA 2WWCA 5FMHA 1WBJA 1ITQA 5CQ1A 5HMSA 4C6BA 2YZRA 5D02A 2B7NA 3U2ZA 4AX7A 2I56A 1JDDA 1O1HA 5EL1A 2ALRA 4JDBA 1KNWA 1SMAA 5GPRA 2ISVA 4IQDA 1CXIA 2GQ9A 3TFXA 4MM1A 4LUYA 2QKFA 3WK3A 3HV8A 1FWGC 3TJLA 4MKNA 1S7MA 3GDMA 2ZZ0A 2QJGA 1GGOA 5DEZA 3ARZA 1L8NA 1JDCA 3NFUA 3KUMA 2HQMA 2ALDA 4AAJA 1FEBA 3UCDA 1TV2A 4BF9A 3NL6A 4US5D 3XIMA 1L8PA 2W66A 1G01A 4DUWA 3BG5A 1D3GA 5D8WA 4LVBA 1I6NA 1AK5A 4TVUA 1EJ7L 3W72A 4LNCA 1E5NA 1J01A 4AXNA 1KXHA 3L5MA 3DFTA 4G7EA 4MNLA 4MB1A 3HPZA 3IJIA 4GZIA 4UCFA 1OYAA 1GYMA 1XFCA 2WCAA 1EBDA 2J8GA 1T41A 1KFEA 2AL2A 1JCLA 3WDQA 4KMQA 4MIMA 3H21A 3UD6A 4EAYA 5LNWA 2WBGA 3MZNA 3W1XA 4DBSA 3WLOA 2GLKA 4JYFA 3G6MA 3BAYA 4AHOA 2YKKA 4F0RA 1POJA 1ZRQA 4S3BA 3URQA 1H0IA 4J7RA 4GNKB 4AH7A 4ES4A 4EP8C 3I3DA 4A2SA 4C6JA 4DHGA 2BC0A 3BSGA 1CECA 2Y5JA 2DSUA 3PSVA 5ABFB 4IX0A 2FDSA 4JNMA 5BMXA 4HPGA 5CH9A 5DY2A 3MKKA 4GFIA 3W26A 1FWCC 2ZZ3A 3IIVA 1RQBA 4DJEC 3MBFA 4WSJA 1LZOA 4UWMA 4XBKA 3K2GA 3BE7A 4HTBA 4BI7A 2J9YA 1GCYA 2O9PA 1Q6LA 4HP5A 3AUJA 3S1VA 4NIRA 4GRSA 4FB7A 4AWSA 1W3TA 3DHDA 2QF7A 3QTGA 4FXJA 3ANUA 1NM9A 1E4LA 1IQ8A 3GM8A 1OJXA 2QCDA 4O10A 4QDMA 1BYDA 1PUDA 1T0OA 4HA0A 4OU1A 1HJQA 6TAAA 1UR4A 4PL1A 1Q7MA 4DJED 4EQXA 1S5MA 4L4OA 3VTRA 3GG1A 1B3YA 1EKOA 2J7BA 3LX9A 2P8BA 3KRZA 3ABZA 4QEHA 4BEUA 1BFNA 3MQTA 4G7EB 3PG8A 4WEVX 2OX4A 1KW1A 3THDA 3TQKA 4U4MA 2TSYA 1EEXA 3UWUA 3PBVA 3G1AA 3SEPA 2QCEA 5DRCA 1RY0A 2D24A 4F0KA 4LUIA 2WSKA 2A1YA 4G8TA 3LHZA 3TNBA 3I6EA 3IK2A 2Z24A 4IHCA 3THUA 1BPLB 3LCFA 5E70A 1Z44A 2B0MA 3VZYA 3VGHA 4GBDA 1ZX9A 3LK6A 3GTFA 4NJJA 2OLSA 2NLIA 1HJSA 5B7ZA 2EJ1A 2RAGA 4MFEA 1JYWA 1UWAA 4W7VA 3OVQA 4IXXA 3VZZA 2DV0A 1Q8AA 4HPXA 4DWSD 2QCCA 5CGMA 3MJMA 4LAKA 4BWLA 4ZXLA 2W63A 1BWLA 4EAMA 5G1MA 4C5YA 2ESCA 1TVLA 3MKCA 4XIAA 3R1ZA 1HGWA 1MZRA 5DLCA 1QPNA 3CPRA 4A3UA 1QJWA 1W1YA 4CVWA 1PWLA 3EA3A 1YE6A 1NQKA 3U2EA 3LB0A 5EMKA 1SFSA 1VEMA 4IJCA 1R8LA 2FMOA 3I4KA 1WZMA 1GQJA 1ZKQA 1V02E 1JD9A 1TPVA 1NF0A 2V5KA 1UKOA 3NQ6A 1UPPA 4L61A 1MXSA 2REQA 1XSKA 3VD9A 3S8HA 3W0KA 3IIXA 1DXIA 2D22A 4JFWA 1XSJA 2OB3A 3CZLA 4AZGA 1JPDX 2ZZ4A 4OBTA 4CVUA 1XBYA 2XVLA 4FOUA 4N7QA 1MQRA 3A4XA 1VFTA 3UF9A 4YWSA 5EFFA 2P1FA 4CQBA 1ZBKA 3UY7A 1W2VA 4RPQA 1UJQA 4O14A 1RBLA 4JQ2A 3W70A 4ROPA 3L21A 5A69A 2UWFA 3CUJA 1Q66A 1QHZA 1I2RA 2OJPA 4O8AA 4UQEA 2VGFA 2VDGA 4Z0SA 4GRTA 2PDIA 3L65A 3G22A 3ZR5A 4U5IA 1I45A 4F4RA 4B4HA 1ME9A 3H2CA 4HN8A 4HU8A 3PZGA 2WM1A 4FLRA 1GVSA 3V1PA 3MVIA 3TYEA 4B2DA 1W0MA 1JYVA 4DY1A 3QOKA 2VFIA 2ATSA 4N2YA 3DFPA 2ZE0A 1NFPA 1OZQA 2LLEA 4LSBA 3WFLA 4WY0F 4F0HA 1FWEC 1Q6QA 1CB7B 3BOLA 3Q6JA 1VEPA 4UMCA 5JU6A 2VGIA 3SW6A 3GC4A 1ZP4A 4L9YA 4GI6A 1VFLA 3UJEA 4DM2A 2PP0A 3DFYA 5U1OA 2DSVA 5HPOA 1WX0A 5A6TC 1VZWA 4G2DA 2BY0A 1Z9AA 3AFBA 3OBEA 4TUFA 1K6AA 4AUBA 5JXQA 1H6VA 1NPXA 3PTQA 5IBXA 4GVGA 3GC2A 4PRTA 4L64A 3RXZA 1LYXA 3GXFA 4J1OA 4JHZA 4JKMA 3GU1A 4XAPA 4H4RA 5HATA 3NM1A 5DXXA 2WNNA 3A3WA 2PF8A 3FY1A 3F4CA 3NPWA 4RKAA 3TH6A 1LLWA 3MDUA 2C13A 3FGCB 1H60A 1Y8BA 4NT0A 1G9HA 5HNUA 1ZQ5A 2YIHA 3W82A 3UG8A 1VYRA 1DHPA 1NDAA 4CQCA 1ZJAA 3CGEA 1FWDC 2E40A 1UWQA 3KTCA 1KRBC 1RP9A 1S2AA 1RM6B 1TV3A 3FJLA 1L6GA 4ML4A 1GESA 5A94A 3M44A 1IV8A 1Q65A 4MDOA 1P6BA 2OWXA 2OXNA 1IEXA 3OIXA 3SJ3A 1HX0A 2VRJA 3CUZA 1GRBA 4PMXA 3RJYA 4ZO9A 2ACQA 3R25A 4R9OA 4POCA 1K4QA 3CUFA 1PHWA 3NYZA 5FSEC 1D7FA 1G7VA 3L4TA 5A8PA 2DIJA 2Z6JA 1UUOA 1S5WA 4FOJA 4M51A 4LF2A 4JTKA 4MGGA 1XYZA 3WLQA 1VQZA 2Y8KA 2AL2B 4HK6A 4IISA 1H7WA 1H7XA 1F8IA 1OD0A 2YJQA 4IZGA 4LRTA 2CYGA 3ZR4A 3NSXA 1SZNA 2GVEA 5CAHA 3BDKA 1VBUA 3MKVA 5AYIA 5AOUA 5D03A 1SR9A 4KEZA 2NVDA 2YYTA 4JX4A 4PTVA 4PUDA 1QUMA 3B3DA 4D6DA 3W84A 5M5DA 1HKWA 4WLCA 4HNTA 5I3DA 3GDTA 3NPXA 1GVOA 5K2ZA 3PULA 3HO8A 3VKBA 3MP3A 3UA4A 3QHOA 3PNUA 3VCNA 3SN1A 2QZRA 4GFSA 1RALA 1F3WA 2ZX5A 3BARA 1MW2A 2I1OA 1CZ1A 2HVOA 2YBUA 4DWDA 3PPGA 3N1AA 4C6IA 3P74A 1XIJA 2P3ZA 1HF6A 4X63A 3BLDA 4WIWA 2WZIA 3BCDA 3GHUA 3PTMA 1V0KA 1I9CB 2XM1A 4PA8A 1GRGA 4QISA 4Y2WA 2OG9A 4O12A 4IXHA 5AZ0A 5A6LA 4CEXC 4DWSA 3HQPA 4YVPA 1LTDA 5AKQA 4KKXA 2VX6A 3I10A 5BRPA 1KTBA 1B90A 2BXZA 1E0TA 3BC9A 4I8YA 2WOVA 3EYPA 1VRXA 4LCRA 1JCTA 1Z8AA 3QGKC 2EPKX 1R9YA 3KVLA 2DZXA 1DXFA 1NF7A 1W1IE 1N63C 3UWQA 2VRKA 4LUTA 5JIWA 1TPH1 3UG3A 3A24A 4H19A 1XLEA 3T2OA 4HVXA 1ISVA 3SURA 2VR2A 1DEDA 3OOQA 3GR7A 2OQYA 1E6XM 4MVAA 1F5ZA 3M46A 4QLJA 2RJGA 3R6IA 5AHMA 2VEPA 3TTYA 4OUIA 3LPFA 8CGTA 3JUGA 2XFYA 1ADOA 2J7CA 2Z0IA 1UBSA 2WQPA 4ZOEA 1KBBA 4QAIA 3FAWA 3OLDA 1K9DA 1CIUA 1GQKA 3MC5A 3N3MA 2NXHA 2QW5A 2WKJA 2X8HA 3LGGA 3BOXA 4K68A 1JDAA 1O7AA 3ZXWA 2WZHA 1EIBA 1MRQA 3QF0A 2WMFA 2RDUA 3G1HA 3AWNA 4GZJA 2VR5A 4DJDA 1GRAA 4ZXOA 3W01A 2GSEA 4ZODA 4AC7C 2PLKA 4KFNA 4QS6A 2CPUA 3POHA 5F4WA 5KETA 4OT7A 1ICSA 2XSAA 2OYLA 4JR5A 2D2OA 3K1DA 3LPOA 4PE8A 3CEPA 3VOHA 2RGLA 3WNKA 1N2VA 3N2CA 2V5JA 4MUZA 4MNKA 3WF3A 1D7YA 2C91A 1E43A 4S3CA 5LXXA 4QITA 4AG0A 5A1AA 1FH8A 3AQUA 2VYOA 4IIGA 2F8QA 2QR6A 4DYEA 2X7VA 3UESA 1RA0A 2PDQA 3SY8A 5FAGA 1P0KA 1WOBA 2OZ3A 3KCJA 1WB0A 2UBPC 2WBKA 3W7JA 3VO0A 3PSWA 3MI3A 4WDTA 1C8QA 3GHTA 3VKKA 2WANA 1JRCA 1WV2A 4JQ1A 3FX4A 5A95A 4ERGA 1L2QA 3SCUA 1RLDA 2CZFA 1QOPA 2XG9A 1ZBVA 4YTRA 2ZXQA 3EOUA 3WQEA 4NF7A 3OHMB 1KD0A 2OTDA 4ZOCA 3TZNA 4LH8A 3N15A 4QQ3A 1J12A 2PD9A 2DIKA 1H5VA 3WQGA 3WEMA 4H04A 4CCZA 1A5CA 5KSWA 4PBFA 2E67A 2DSZA 3LTYA 2D0HA 1JFHA 1M5WA 2PC4A 3S3GA 2WSPA 1Q8JA 2ZZCA 1XG4A 5F2MA 1MDRA 1TX0A 3TAKA 5I6SA 3L4WA 3XINA 4OECA 3VOCA 3DGRA 2WVTA 3S9ZA 1C8YA 4V15A 1EGMA 2BNJA 3QEZA 4Z1DA 4NAEA 4Q8QA 1XH0A 4CN4A 1K4HA 4QS5A 3WSUA 1UOZA 3ZM8A 2RJHA 1XRFA 4XO6A 2ZUWA 3O05A 1NSJA 2GL5A 3PAJA 2G50A 1NOUA 2D1ZA 1GNXA 3FVDA 4Y90A 3NWRA 2CWNA 1Z32X 5RUBA 2BY1A 2ZRVA 4XG1A 4M7SA 1KTNA 3GX9A 2BXVA 1GQIA 4MJ2A 4JL2A 1KGUA 4HPJA 1Q7ZA 1JD7A 1XGZA 4AZCB 3HA1A 5KZ6A 2WVUA 3ARRA 5F4XA 5HUOA 1HQTA 1XX1A 1N8FA 3DENA 3U6WA 3AYSA 1DWIM 1Q4WA 4NEWA 1XYAA 2VUYA 3B8DA 4EVZA 3NS1B 1XRTA 3DJJA 1M01A 2YDRA 2QUTA 4ATLA 1ZUAX 2QT3A 3AWOA 1VKFA 5FACA 3DHFA 4HOWA 1H61A 5H8UA 1M7OA 4WJXA 3CXOA 3A23A 4D6JA 1TELA 1VFSA 1V4YA 3B4UA 3KVKA 1XYLA 2QCDB 3B9OA 5HQMA 2YVFA 3UEQA 4L1GA 1E1CB 1SZFA 3GTHA 4GK8A 4UFHA 5D37A 3FEMA 3O6CA 2WPGA 1O12A 4EF8A 3VGEA 3URHA 3QSRA 2C18A 3KZSA 1N60C 1HKMA 3EOOA 5KZDA 1UW9A 2X8GA 2QAFA 2D2GA 1YXYA 2C14A 4DI8A 4MYXA 4IPLA 1TKKA 5C9RA 4W7UA 1KCKA 3OYXA 3UZZA 3HGJA 5JRBA 4J27A 2NV1A 1OIFA 2DZVA 1VYSX 3WF0A 2Z28A 3DYPA 3WMLA 4HKPA 4OE7A 1E1CA 1UWUA 3TFCA 4TIMA 4YCPA 1OSEA 4NAEB 2J7HA 2BGNE 1Q1RA 3ONCA 4O17A 2W79A 2GSJA 4AIOA 1KGXA 3KRUA 4CQ8A 5AYYA 3C2RA 2EEXA 2BASA 3NQMA 2C8NA 1W1A1 2GQ3A 3KTXA 1BF2A 2I57A 3OVRA 3RPDA 3WH9A 3N6QA 4IOTA 4O53A 5K3VA 4US6A 3GXIA 3KL5A 1WBHA 3VXGA 4G5DA 1GV4A 4HZ6A 3ZJ6A 2YR1A 1JDEA 4CQAA 4YU1A 4DN1A 4PUJA 1Z41A 3L23A 1Y5XA 3L4XA 2C3ZA 3LTSA 2J9ZA 4C1NA 3HG4A 1MZHA 4KRUA 2VX4A 2QCMA 3WF2A 3FG2P 3IIZA 1ADSA 4JTRA 1R30A 3TUUA 4PN2A 4P61A 2FZMA 5CBIA 4D6HA 1EGVA 4E8DA 3CYVA 3SCRA 1DJQA 1JF5A 3FNDA 1ZS2A 4O1DA 3UCCA 4PMRA 4K8HA 1BG4A 2CFFA 4C6QA 1QWKA 1RZMA 1G1YA 5JVLA 3EDJA 5I3FA 4C1NB 1M6IA 4KT2A 4QXIA 3BSHA 4MYAA 4OWGA 3OA5A 3AXMA 3R8GA 4TOQA 4ERIA 1WZKA 3LUTA 4OOZA 5LZLA 3RF9A 3SCWA 4LVAA 3SUUA 1RJPA 2HPMA 1HVQA 1RVGA 2VFGA 3NCOA 3VDBA 2YAUA 2OPJA 4MUPA 1PKMA 3V5OA 3WLJA 3T2PA 1TWZA 3V1HA 3O8AA 3VKCA 1NHPA 1XUUA 2V0TA 2E5CA 4LV9A 1TE1A 2WC3A 4B4FA 3CYJA 2GQAA 3K8LA 3M16A 1AJZA 3BGJA 3VGGA 2AQOA 2V5CA 3TNOA 2GDQA 3BLIA 5BROA 2W0HA 3WN6A 3E5PA 5KEZA 3TSDA 3T44A 4S39A 3W6MA 4ZFCA 3W1RA 1GREA 2DQXA 4Q22A 2IQTA 3ID7A 2GGJA 3ES8A 4LYRA 5BXSA 2EQ7A 3BK0A 1KFWA 4RZ5A 4DVOA 3M07A 4I7UA 2QS8A 4IT1A 4YTUA 2BODX 1OG0A 3QV7A 3WUEA 2F6KA 4LAMA 1XICA 3CQIA 3SQLA 1LT8A 2CITA 3IJLA 3R07C 1OM0A 2GJNA 4XD3A 1A5MC 2ISDA 3SUWA 1YXCA 3H4WA 3LHVA 2HMCA 1FWTA 6REQB 1YLVA 1VJIA 4XIMA 4CU6A 3UP8A 1ECQA 4GWEA 3E0VA 4KGLA 5FJOA 1XLGA 3HQOA 3S1UA 2V6OA 2Q71A 2MANA 4RL3A 2V2DA 3P80A 5I79A 4JL1A 1A0EA 3CZ8A 3SGUA 1MNZA 4DZ5A 4M7TA 5HDRA 2WVSA 3WD0A 3FFSA 2GZXA 5FF2A 4NZJA 1SZRA 5ENLA 2PGEA 4XZBA 1A3WA 3R0UA 4Q7BA 1BD0A 1CWYA 2ZA2A 1JRPA 2Q02A 4S3AA 3AS1A 3THAA 5F2IA 3NZRA 1RVKA 4DO7A 3FJ6A 4KERA 3W7NA 3E0WA 4CD6A 4FXRA 3CHVA 2YCKX 3GNPA 3IJ9A 2B81A 3B06A 4KCWA 3IRDA 1UMYA 5HJYA 3ZYZA 5HPCA 4YHGA 5KVHA 5A6AA 4DIAA 1DIDA 5CPOA 3TN4A 3CAVA 4UTLA 3VFLA 1C90A 1JI1A 2VFDA 4MHBA 4ZQNA 1M9HA 4M52A 2DPEA 1U83A 4N6EA 1DP0A 3G77A 1E9IA 1P1XA 3EZ4A 3OU8A 4HHPA 2RHGA 4M19A 1QTWA 4P8XA 4A22A 4H2CA 7ODCA 1CGUA 2PCEA 4H4WA 2OU4A 4IIFA 1QNOA 2JALA 4PYSA 1W8GA 4IP5A 3QPEA 4TXEA 1PKNA 5HMEA 1GSNA 4B92A 4GIYA 4XD4A 1KLZA 3MSDA 1P43A 3QR3A 4UR9A 3RMEA 3NZQA 2VM8A 4QTGA 3W1MA 3IUHA 4J3TA 3W2UA 3LGDA 1N82A 5KTLA 3A12A 3NVVB 2PBGA 2NWRA 1B2YA 3WBXA 5D30A 3YPIA 3OGVA 3ISIX 1W1TA 4IUGA 3VINA 4YIWA 5LYRA 3H7UA 1R3SA 1LWJA 4K8DA 3WCZA 4RCXA 4HA4A 4F2TA 1K8XA 3M1ZA 5C0QA 1XUZA 3KLKA 3U57A 1FY6A 1XANA 1NAL1 3W87A 3R0KA 2TODA 4NNCA 4JEJA 5G4EA 2PWGA 2HXUA 2YDSA 4V1YA 1U5JA 4M6PA 4HPHA 1ZY8A 1EZ2A 1ZJBA 1UIPA 3H70A 4AY8A 3N34A 3A3XA 1OQFA 3CZJA 1IWAA 1PKYA 1DPMA 3B8IA 3CT2A 4FX6M 1V7AA 2YB4A 1C93A 2A3LA 3FK4A 1TA3B 5CPTA 3EDDA 4B5TA 4ZB5A 1C9DA 4P7RA 4ENLA 1B3XA 3KOZA 3EX2A 4RPPA 2QMKA 4AVOA 4X3ZA 1LUCB 3O2LA 3P7YA 3U7BA 1VFUA 3M0KA 4NX5A 4HCLA 1FVPA 1R5YA 3OB8A 3F4WA 6ENLA 5M3WA 4YXGA 1KWKA 1LF1A 1EHNA 4R53A 4LYPA 1Q6FA 2CHRA 2ZZ2A 3TW6A 3QQ1A 5FEZA 3BCFA 4HPNA 2R1MA 2V2CA 1V3HA 3T0TA 5G2IA 2OT0A 2OT1A 4AF0A 5E9XA 2J9XA 4RDZA 3ANVA 3VC6A 3LXBA 2F84A 3T0DA 2YB1A 3GBEA 4NYUA 2FTPA 3T6CA 1CX9A 4GNVA 5T9CE 4BK9A 4NJHA 4KEUA 3D6NA 3DECA 1AQ0A 1HJXA 3DH7A 3QKEA 4GY1A 3W6YA 3BLFA 1B54A 1Q13A 2YL9A 3AMLA 3AIWA 3LNPA 4JYDA 3MV11 1PAMA 1KM0A 1HL9A 5H8MA 3DEQA 3CO8A 2VC7A 3LG3A 1SM9A 3SRDA 1UUQA 4AC1X 3H54A 1OCBA 3VIMA 4KIRA 1KB3A 1LQ0A 2Y70A 1KA9F 1ISWA 5GNZA 4RNHA 2KAUC 3B9EA 5FEXA 4YVXA 1TVPA 2QXWA 3KAOA 4YS1A 1DXEA 4EXQA 2OQHA 3MT1A 5DMLA 3PUOA 1H1ZA 3LBCA 4E2VA 1HG3A 4H7VA 3SCTA 4Z1AA 1TZ9A 1CB2A 2IPJA 3QPYA 4KEMA 3LV5A 4DUXA 3AS3A 3C3NA 1OC5A 1PEZA 1VH7A 2QQ6A 1EC8A 3MMDA 1NWUA 3G1YA 2A3EA 3FKRA 2PDLA 4Q8WA 4J2PA 3PTKA 4ZE5A 1HKIA 1BXBA 1XIFA 4BCEA 4JIRA 3H22A 4DF0A 3FSTA 3KHJA 3GDRA 3GAYA 3G8RA 4EIVA 3VD4A 3GIQA 1EJWC 2BOEX 3PB2A 4GI8A 1WDSA 1NFGA 5E0CA 1I2NA 4O0QA 4XQ6A 1PDYA 2VEKA 4R7WA 4APNA 1IEIA 2Z1WA 4WXYA 1JYXA 4YTQA 1EDTA 3VIKA 1BKHA 4O16A 2CBJA 4H4VA 4WY0B 2IPFA 1TPC1 2YW3A 5HR6A 3MV01 1DJWA 3EAUA 3GNNA 4G9PA 2DH2A 4H8VA 2C71A 4HSOA 3FHQA 4GOAA 1FCBA 1FHUA 4HU3A 3ZLHA 3NQFA 2HJPA 5LA1A 5E93A 4IGHA 4WUIA 1KLYA 3VDGA 2CKRA 1GW9A 2D3NA 3NQAA 4WRHA 2A7NA 2WVVB 4PCPA 1WAWA 4EXAA 1YADA 1SYTA 1U5HA 2ZOXA 3DIPA 4J28A 4V2XA 3QFWA 4KWVA 3UG5A 3L66A 1DQUA 3UW6A 3WYZA 4DJEA 1JUBA 3RLUA 1E5JA 3MWCA 2B31A 2E6FA 4PH6A 3LNMA 3W7CA 4DXKA 4AIBA 1DQWA 2WV8A 2QGHA 1M53A 4DYJA 4EACA 5C6MA 3WH7A 1DORA 3O06A 4DBDA 3PBMA 4ADTA 3GFXA 2ZZBA 2QPSA 1VFHA 4AIEA 1W9BM 1GOKA 2VZVA 4HB7A 3DKJA 3T4WA 2NT1A 1ITCA 1ECEA 5IRPA 2CLOA 4H4QA 3IK4A 3TONA 2QVNA 4D9PA 4NRSA 3EWZA 2Z7GA 4LVDA 3RILA 1W3NA 3A22A 4ZTXA 2YOCA 5J5RA 1GYLA 2CW6A 5J5DA 2PRHA 3S5OA 4W7WA 4BZYA 1E9LA 3BICA 1KXQA 2OR2A 3BH4A 3TOYA 1HNYA 4ZB0A 1BYBA 1UUMA 5LGXA 1XSIA 2HQAA 4B91A 4C91A 3PJTA 1G4EA 3WJZA 3DI0A 2QJNA 1RJRA 3PB0A 2H9AB 3PUGA 4NZFA 2Y62A 1FHDA 1KBJA 1DWJM 4LS2A 3SQMA 2DQWA 1V6VA 1ISYA 4MZYA 1C9WA 2YCLA 3LM3A 3WMCA 1LOSA 3PNZA 1PXGA 3BAJA 4IIBA 5D9MA 3GDLA 2B7QA 1PTDA 1YRRA 1XCXA 2WHKA 1X39A 2WHMA 3DBPA 3UCQA 2X40A 1TTPA 3QZ6A 1QW8A 1YBQB 2G3JA 4GYKA 2PDPA 5DQPA 3SECA 2NUXA 5C2XA 2BG5A 2F6UA 4NNAA 3OA3A 4UB9A 2QUMA 2GK1A 1W3IA 3SCOA 2BTMA 4PMVA 2QEZA 3GH4A 4PBEA 3TN6A 2WMIB 2NPXA 2ZBTA 3AXXA 4TTUA 1MW3A 2QULA 4UUIA 5FL0A 3VIOA 4UTWC 2V3FA 1XLAA 1JZ2A 3KOWA 1L6WA 2QUNA 1PDZA 1XLHA 4XX6A 1ZMCA 2FIQA 3ICJA 4PB3A 2ZZ1A 3RHGA 5CPSA 4F0LA 1EF2A 3E74A 1W3LA 2JF6A 4R9XA 3L4ZA 1NTHA 1NP0A 1EA0A 1QO2A 3VOIA 3NQDA 3F4DA 1XKYA 2OSYA 1UASA 3UPMA 4OV4A 5DRIA 1J0ZA 2PWEA 6PTDA 2ZRWA 3GVQA 3WUBA 3RITA 5CPMA 2ODOA 1JXJA 4L6OA 3BMXA 1XG3A 3O07A 1E56A 2NW0A 1GTEA 1J18A 1FFVC 4KWUA 2CDUA 2XN2A 2PFHA 1ZL1A 5U7SA 4B15A 3J7HA 2WZTA 1TFVA 1EWDA 4W84A 2R8WA 3BL3A 1PX4A 2IW0A 3GKAA 3N2MA 4LEQA 4O54A 2PSNA 2NVCA 3UYCA 2BVDA 4Q4SA 1FFUC 2W27A 4U3AA 4PODA 2VD8A 4ROQA 1W9DM 4IX2A 1UA7A 2X09A 1IT8A 1GTHA 2P50A 3MMTA 4UTIA 3QN3A 1WKEA 3DU0A 1P4CA 5EMMA 3B97A 5ER0A 1D3CA 3HTWA 3CB8A 4UTTA 6CGTA 1LUCA 3JS3A 3UXAA 1GVRA 2PWHA 3RMJA 3M64A 1SO5A 4H83A 3S2CA 1Z6KA 4FAMA 3HGOA 5DY3A 4BQ2A 3VFCA 4UBPC 1S2WA 4UIOA 3H6OA 3P14A 4GQGA 3AROA 4XO7A 4KBXA 4M1BA 2R82A 2R9RA 1SO6A 2BHUA 2P5NA 2NV2A 1KBLA 3ABSA 1OGGA 1PZ2A 4MNMA 1FFQA 2J75A 1UD6A 2E0PA 4V1XA 2XJ7A 2EG8A 3U3HA 1FDJA 2Y7EA 5CC3A 1DL3A 2C7FA 4AEOA 4DAIA 4UTFA 3UNDA 1OFRA 2OMAA 3U5YA 4AD3A 5FJPA 1S2UA 4URIA 1EJRC 3WFAA 1FO4A 4MKSA 3TCSA 4HT3A 3DI1A 2E9MA 1M7PA 4TMBA 2PLJA 1BXCA 1XDJA 5CBBA 3VX1A 5LNVA 2A5HA 3RJXA 5BYWA 4JPGA 1HP4A 2CFYA 4Q32A 3VIIA 5D9PA 4MY1A 4DYKA 1C7SA 4BFAA 1IE7C 2I5IA 2NQLA 2WMKA 3ITYA 1MUCA 3TIMA 1AZ2A 2ZE3A 4GABA 3H23A 3W85A 1UD2A 1M3UA 1IGWA 3A3HA 1LRTA 3R10A 4LW7A 4R85A 1FXPA 1G94A 1IXNA 5D2WA 2FDMA 3A64A 2WSYA 2FZBA 1LM1A 3EA2A 7ENLA 1F3EA 3SQPA 1N5XA 1LBMA 2D0GA 2WOWA 1Y7VA 2E7FA 3VGDA 3UGRA 3TMQA 3LEPA 3I7RA 1TJ1A 5D2XA 1F6KA 4WZHA 1AFSA 2BP1A 1F3XA 3ALGA 1G7UA 1XHGA 2XH4A 3G1DA 2EJAA 4DXVA 3PBWA 3MUY1 1ZXIC 3MWAA 3DHUA 3DG7A 2PTZA 3VK5A 1EDGA 4GLEA 5DBTA 4TVCA 1SB3B 1EOMA 5G4HC 3ITTA 4WJEA 2D2HA 2GVLA 1GXFA 1TWIA 5CGTA 2HK0A 4JTEA 1QATA 3NAVA 1JXKA 2FB2A 3N29A 4NJIA 1KFLA 3N18A 4O52A 4Q4KA 4OQVA 1AW5A 4Y9NA 3UWYA 4GG9A 4JTUA 4AZIA 4X60A 3IC9A 1W3HA 4XISA 1IWPA 7XIMA 4HK7A 3F2CA 2VCCA 1OFAA 4ACZA 2J77A 1X1OA 4JOMA 1XFBA 2VDHA 1VF8A 3CQKA 4CCCA 3EDFA 5I3JA 4LY4A 3N2XA 4NJKA 5HQEA 2DSKA 4AZ7A 1J4EA 1VGAA 3P61A 2YXGA 2WSRA 4I5UA 1E1EA 1ADDA 5LIYX 1T96A 3TTEA 4EPBC 1G5AA 1JGMA 4WKAA 1XCWA 1MOKA 4IQJA 4KH2A 3PBGA 4Y8EA 4U2ZA 4ICCX 1O94A 3CB3A 3IPWA 4GYFA 4UOJA 3VNYA 4C1KA 3AIUA 2J6XA 3E96A 1V77A 4AW7A 4EANA 1GPFA 3O0KA 3LBOA 3WK1A 3B04A 1QT1A 4GX9A 2Y88A 2DJXA 4I5XA 4MF4A 1JCMP 3T08A 4DZAA 4JQ4A 2Z7KA 2YA0A 2WMIA 4PL2A 1TA3A 4GO9A 1V02A 3VOJA 3ZS4A 1ZHAA 2XN1A 4DJFD 3LCHA 3P84A 3KL3A 4O1CA 2J8FA 1GOIA 2RGMA 1YEYA 3PZ9A 3FDGA 1DE6A 1V0NA 3IJDA 5SWUA 1PZ3A 3BG3A 3BQ6A 5FOOA 4CUCA 3QC3A 2VEIA 1JPIA 2WXDM 3UA3A 1H50A 2PRLA 3G6LA 3CUGA 4UFMA 2QJIA 1V97A 2WOQA 1FP9A 4R27A 3LXDA 1H7NA 2ZRZA 4NASA 2FJUB 4DBUA 4C6NA 3APYA 4XUYA 1WDDA 4BS0A 4DLMA 5HNRA 4DO6A 2YCIX 4G1KA 2YVJA 3GH7A 4BURA 3CIXA 3ZQ9A 1JZ5A 1UR3M 4JXCA 4UZSA 5D09A 3EWXA 5G1YA 1KV5A 1VR6A 3ZSTA 4LBUA 2YL6A 2ZWYA 1EXPA 2A6LA 1H0GA 4W89A 3W4RA 4UOQA 1GOMA 4UTKA 1V7YA 3EX4A 1UC5A 1F3PA 1P0NA 1YDYA 1UBPC 3UU0A 4O1BA 3IIPA 4AHPA 2X05A 1SJAA 2YW4A 3LXAA 3OTRA 1DNCA 4X2RA 1B4KA 5LGZA 3M47A 2RDXA 4D8ZA 3H7VA 5HUPA 1NIUA 4UQ9A 1N8WA 5HJXA 1TR1A 1CYGA 3SN4A 3W7OA 2NUYA 2H8ZA 3F7JA 5AHFA 2PDKA 4LYKA 1XQKA 2PTYA 3A21A 4I3GA 3P0WA 2V69A 3C56A 3LHTA 9CGTA 3QM3A 3GIYA 1Q6EA 3MO7A 1JNDA 1OFOA 4IPNB 3CJPA 5LNUA 3T8QA 5C7VA 3NG3A 4E3TA 2O7SA 3EMQA 2BS9A 2E28A 2J6VA 1SO4A 1R47A 4QJ5B 1B3WA 3UG4A 1V0LA 3WNNA 4OZOA 1D3HA 4ZVJA 1E0VA 3TDFA 3PG6A 4QE5A 3W38A 3W2KA 3U0HA 1E6RA 3N17A 3W24A 3LI0A 1YPFA 1VHCA 2VP8A 3AHZA 2P8CA 3M43A 3ZJKA 1T40A 1VRDA 1QVBA 2H90A 3PJXA 3NO5A 1E0XA 3BTNA 1JAEA 3OC4A 5M03A 3P5ZA 3ZWTA 3AZSA 3WJYA 2EPLX 3OVGA 3QGVA 1OT2A 4W9TA 4PGLA 7REQA 3M6YA 4REQA 5CG0A 3VIHA 2DZWA 3W1UA 4A05A 3IGUA 4J4KA 2WBAA 1M6JA 1QU4A 3M6DA 2E3TA 5AYBA 1B9BA 3SQSA 2L5HA 1ZSXA 3GK0A 5BOOA 4AFYA 4OOUA 2PDMA 3CHEA 3QHMA 2BZNA 2VFEA 3KCOA 3TP4A 3EBVA 3BV4A 3P6LA 2XGIA 2Q09A 3HGSA 4H3DA 1HGYA 3H4XA 1XW8A 3UJSA 2TPSA 3N19B 5TNVA 4QJ4B 3V0UA 3WLTA 4XD5A 3ATZA 5GJNA 3FOKA 5U25A 3BZJA 3CM4A 5EU9A 1SMDA 3S83A 2WCSA 5K9XA 3L7RA 1K9FA 1ODZA 2WYSA 1BRLB 2BGQA 2HNHA 4M82A 2BVTA 3RO8A 4WR3A 3QW3A 3VD3A 3G1RA 3WQVA 3SIMA 3SB0A 3P0XA 3HPXA 3NQ8A 1GG0A 3RYSA 4GY7A 2VTFA 4GYPA 1V6WA 3U5UA 4NQ1A 1GVIA 3FA3A 1FBAA 1EX5A 3ZVHB 2PU0A 2VR4A 4HGXA 1LQ2A 3RRAA 1P1MA 2JK2A 1DV7A 2QIWA 4F66A 3NOYA 4DBWA 3I7QA 1JCXA 2FTWA 3T7VA 1ODUA 2J79A 3TSMA 5ECVA 2DGAA 3DK9A 2OCZA 4LCQA 2WNZA 3FS2A 4JEQA 3WIJA 1VFFA 4GQRA 3CL8A 2DU2A 1UZ1A 2ZX6A 1R7OA 2AQVA 3CPUA 3KBMA 4W5UA 1HIZA 2E68A 3MCOA 2PPGA 1D7KA 3SFKA 3U7VA 5F4SA 2DT3A 3E0LA 4M0XA 2WPBA 3AJ7A 4GYJA 1U33A 4HOZA 3VI2A 1UR1A 2CBIA 2ATMA 4JNZA 3DFQA 4FS9A 1KBKA 3SM0A 2EXOA 5A5WA 1WKDA 4HA1A 4JN6A 4JTDA 2OYMA 4IP4A 4ZEPA 1G0CA 3FJ4A 1RY8A 5CZJA 4PULA 3OO2A 3M0YA 3P8JA 5AHLA 3GXMA 2E09A 4P8WA 1LWHA 4D71A 7TAAA 4JHMA 4JN7A 1PV8A 1YTEA 1ZP3A 3WL1A 2R91A 4OIFA 3A7UA 4IP7A 1TCMA 1H51A 3P62A 3CZKA 1A0CA 3JW7A 2WMJA 3K1GA 1K7XA 3R13A 3VZXA 1E6NA 3WBWA 8XIMA 1QWGA 3BLOA 2R24A 1H7RA 4TR9A 3B0VC 5M2FX 2VENA 4IPPA 2YCJA 2A21A 1CGYA 3PJUA 3GHSA 2A3HA 4GQQA 3ABQA 3OW1A 3PZQA 2ZZ6A 1HFBA 1IF2A 1JQVA 4IMFA 3CBWA 3OPSA 1H3GA 3V18A 4P2VA 4ATWA 3BSMA 2BWGA 3BLLA 1JF6A 4QG8A 2G8ZA 3U2CA 4CQDA 3VCCA 1LVLA 4MWAC 2YL8A 1OX4B 2EG7A 1XF0A 3S5SA 1CGXA 1TO3A 1UR2A 1SGJA 4Y9OA 3MYOA 4W85A 3WQCA 1G4TA 4QSFA 3CGCA 3KVMA 4QG6A 3S2JA 4JAWA 3HURA 3I68A 4HZ8A