2GGEA

Crystal structure of mandelate racemase/muconate lactonizing enzyme from bacillus subtilis complexed with mg++ at 1.8 a
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
373
structure length
373
Chain Sequence
LVKIVRIETFPLFHRLEKPYGDANGFKRYRTCYLIRIITESGIDGWGECVDWLPALHVGFTKRIIPFLLGKQAGSRLSLVRTIQKWHQRAASAVSMALTEIAAKAADCSVCELWGGRYREEIPVYASFQSYSDSPQWISRSVSNVEAQLKKGFEQIKVKIGGTSFKEDVRHINALQHTAGSSITMILDANQSYDAAAAFKWERYFSEWTNIGWLEEPLPFDQPQDYAMLRSRLSVPVAGGENMKGPAQYVPLLSQRCLDIIQPDVMHVNGIDEFRDCLQLARYFGVRASAHAYDGSLSRLYALFAQACLPPWSKMKNDHIEPIEWDVMENPFTDLVSLQPSKGMVHIPKGKGIGTEINMEIVNRYKWDGSAYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords yitF
publication title Crystal Structure of Mandelate Racemase/Muconate Lactonizing Enzyme from Bacillus Subtilis complexed with MG++ at 1.8 A
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 128
structure length 373
sequence length 373
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2ggeA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2ggeA01
3DGBA 3PWIA 3R0UA 4H2HA 2PSNA 1SJBA 3D47A 4F4RA 3DFHA 3TOYA 3UJ2A 3CB3A 3T4WA 1ECQA 2ZADA 4DWDA 3Q45A 3H12A 4HCDA 5ENLA 2HNEA 3JW7A 3U4FA 4ZCWA 2PA6A 2HXTA 4MKSA 4FP1A 3OTRA 3PK7A 3STPA 1EC8A 1FHVA 3SSZA 1SJDA 3RCYA 1SJAA 2DW7A 3GD6A 2PP1A 4YWSA 3VA8A 5IDZA 2MNRA 2PTWA 3JZUA 1NELA 3VDGA 3BJSA 3R25A 4IT1A 3MWCA 2AL2A 1ELSA 2I5QA 3ES8A 1SJCA 3T8QA 4G8TA 4JHMA 7ENLA 3FXGA 4K2SA 1TE6A 2OFJA 4A6GA 2GL5A 2PPGA 1PDYA 4E8GA 2O56A 3CYJA 2OG9A 4DXKA 3FYYA 3T9PA 2QGYA 4DX3A 3RITA 1EBHA 1KKRA 4KWSA 3MUCA 1BKHA 1FHUA 3N4EA 1P43A 3ZVHB 1E9IA 3NXLA 3DESA 3VC6A 3PFRA 4E6MA 3NO1A 4DN1A 4GMEA 2CHRA 2OLAA 2OZ3A 3SN4A 3OZMA 3V4BA 3T6CA 4GGBA 3DG3A 3UJRA 3OW1A 1TKKA 2PP0A 2ZC8A 3N6HA 3BSMA 2PTXA 3RO6A 3SN0A 4ENLA 4J1OA 2AKZA 2PTYA 3U9IA 2MUCA 4E5TA 2PCEA 2FKPA 3ZLHA 4GIRA 3FV9A 2OPJA 2PGWA 4GGHA 2XH4A 3BOXA 3ES7A 3DIPA 3QKEA 3V5CA 1WUFA 2XH2A 2RDXA 2HXUA 3GO2A 2GGEA 3I6EA 4DHGA 2QDEA 4FI4A 3NZGA 1JPDX 3QLDA 3IK4A 3R1ZA 2AKMA 3ZLFA 4Z17A 3D46A 4X2PA 2QJNA 2PTZA 5EU9A 3SJNA 1XS2A 3MZNA 4ZA0A 2OZTA 3IJQA 3K1GA 3N4FA 5FJPA 3ZVHA 3KUMA 3IJIA 4E4UA 2PGEA 3TCSA 2P0IA 3FVDA 4IL0A 3RRAA 1JPMA 4G7FA 4IZGA 3ENLA 4KEMA 2GGGA 5FJOA 4IL2A 3DDMA 1RVKA 2OQHA 3UJEA 3B97A 3VC5A 3UCCA 4IP4A 1BQGA 2PMQA 3P0WA 2QJJA 1R0MA 4A3RA 3DG7A 3TWBA 3QN3A 1XPYA 1KKOA 3SN1A 4HCLA 3GC2A 3Q4DA 3N6JA 2XH0A 4KPLA 1IYXA 3CAWA 3SQSA 1PDZA 1F9CA 2PP3A 1MDRA 2AL1A 4HCHA 4M0XA 3TWAA 3V3WA 3SBFA 1L8PA 2GGHA 1MUCA 4M6UA 2PODA 3DG6A 4JN8A 3CXOA 5FJUA 3R0KA 3TTEA 2OX4A 2OO6A 3DFYA 3H8AA 1OEPA 4J3ZA 4MGGA 1MRAA 2ONEA 3UXKA 1YEYA 1NU5A 3P93A 3QPEA 1ONEA 2PS2A 3TW9A 3TJIA 2QQ6A 1R6WA 4H83A 1JDFA 4MMWA 2DW6A 2OZ8A 2OQYA 1KD0A 4GYPA 2PU1A 3S5SA 4DYEA 1EC9A 3CK5A 3HPFA 6ENLA 3VCCA 5FJTA 3H70A 3PWGA 3RR1A 2P3ZA 2QVHA 2PU0A 3VCNA 4H19A 2GGIA 3H7VA 4IP5A 3QTPA 4HN8A 2HZGA 4ROPA 4H1ZA 2GGJA 4HYRA 4KT2A 1WUEA 3FCPA 4EWJA 3THUA 3I6TA 3UCDA 3VFCA 3MSYA 1TZZA 1DTNA 3NFUA 3JVAA 4Z1YA 3UGVA 3P3BA 2P88A 3I4KA 3ZLGA 2NQLA 2XSXA 2P8BA 3TJ4A 4A35A 3DEQA 3OZYA 3CT2A 3S47A 3RGTA 4IHCA 1EBGA 2XH7A 3EEZA 3UJFA 3MY9A 2XGZA 1KCZA 2POZA 1JCTA 1P48A 2QDDA 3TQPA 3MQTA 4JN7A 3GY1A 1W6TA 2AL2B 2OVLA 3OP2A 5J04A 3R11A 2OKTA 2P8CA 3MKCA 4E4FA 3IJLA 3UJSA 1MNSA 3V5FA 4GISA 1EC7A 4HNCA 5FJRA 2FYMA 4K1WA 2GSHA 1MDLA 3ZVIA 3DERA 3R10A 3UXLA 5BOFA 2GDQA 4HPNA 3OPSA 2QJMA 3FJ4A 4GFIA 3EKGA 4HNLA 4GYPC 4K8GA 5BOEA
chains in the Genus database with same CATH superfamily
3R0UA 2F6UA 4IQLA 1W9VA 3NQ6A 4F8XA 1QUMA 2WQDA 1RD5A 3LDVA 2TRSA 3T78A 3NZPA 1Y0EA 2ZZ1A 5A5WA 1PHWA 3U4FA 2PA6A 1WYGA 4FP1A 1CBGA 1UKOA 1CENA 3AMCA 3E2RA 3BG3A 1CDGA 4F40A 4YWIA 3UG3A 1TFVA 1FHVA 1CB2A 3IVSA 1VBUA 4MOZA 4BY3A 3WLJA 4O18A 3VIGA 5CJMA 3FIGA 1Q1WA 2IKGA 4BFAA 4YVPA 2ZX7A 3VDGA 3LM3A 4NJHA 4KWVA 4FZIA 2G4JA 1OC7A 4ZVJA 2CEQA 2DFAA 1CXKA 3A13A 3O2LA 1OYBA 2Y5JA 3LU2A 3AHTA 5E0KA 5IM51 1VYRA 3LOTA 1AZ1A 1PWMA 1JI2A 1ME7A 3RR4A 3W7IA 2BFGA 2KAUC 4DEFA 3V16A 1KN0A 1KKRA 4H6RA 3C0JA 4DQWA 4AB4A 1S2TA 4NF7A 5KEZA 3HU7A 3U0HA 4E3TA 1IQ8A 4FXSA 5M5DA 4DN1A 1GNXA 5H6HA 2QPSA 4UTWA 3OZMA 4NZ3A 2NQZA 4L6DA 2PDGA 3GVGA 2D2JA 1TCDA 1EKOA 3SUVA 3KL5A 4UFLA 3OVQA 5I07A 1H11A 3P61A 2CCRA 3IIZA 1GEQA 5CJ5A 3BSMA 5D2TA 2ZXAA 3VYLA 1MXDA 1PX8A 4PE8A 4GI4A 3ABOA 2O92A 3A4AA 4XZHA 3FV9A 1UB3A 3UF9A 3W2MA 2IQTA 3M0LA 3WLRA 2GJNA 3POCA 4Q32A 3B9JB 1K8XA 4HYVA 1NQ6A 1W3IA 1E6QM 3AAMA 3CB8A 1GUVA 4UQAA 3LK6A 1NHSA 4DWSD 1VDVA 5HQLA 3B06A 1GW1A 4QQ3A 1Q1RA 1BQCA 4H50A 3C0QA 3LN3A 4PMXA 3QQWA 1GTHA 5D33A 1MWOA 4JFVA 4DJFA 1TMLA 1A5OC 3KS6A 4HU8A 1UYQA 4L64A 3ZVHA 3S5NA 4PMVA 1RD6A 3UWUA 4H6KA 3S2MA 3BXWA 3EPNA 4YYCA 3DFOA 3PSVA 2P0IA 2PDFA 2YL5A 3ARYA 1ITCA 4S3KA 4B15A 1T41A 3M0HA 4ZO7A 3FHQA 3TH6A 4E2DA 1KR0A 1PKMA 4DF2A 4JTFA 3SGGA 4FNTA 2BS9A 1YNYA 5F4WA 1HQTA 1NWTA 1X96A 4ZB5A 4LSBA 1L0PA 1SW0A 2WXDM 4IIHA 1J0HA 1HW6A 4HOWA 1JCYA 1V79A 3WBXA 1W1A1 4GQQA 3PPGA 1BQGA 3BSGA 4RUBA 3H54A 4UFKA 2GSJA 3AMDA 2J7DA 1A3HA 1S2WA 4DJED 5CXPA 3R8RA 2ZCGA 1DJYA 1GOKA 4Z2KA 1QW8A 4M0XA 3A9BA 1X7IA 1ZMDA 4AMCA 1BG4A 5JBDA 1ITQA 3AJXA 4K7VA 3EMQA 4YN5A 1PVNA 1NDZA 3F2BA 3IAQA 2IXUA 5A2AA 2YBVA 4KW2A 4N4PA 4FNPA 4AVFA 1VPQA 2OQLA 4K3ZA 4UQ9A 2BOEX 5LHEA 1WOAA 4MGGA 3IGUA 2F5ZA 2V69A 4PUWA 4S2BA 5AHIA 4LVDA 3APYA 1R6WA 4ASTA 3QPYA 3L0NA 4HNUA 4FX9A 3HOJA 4NASA 2Y24A 3MI6A 3U2EA 1AH4A 3AN1A 3AICA 5AC4A 3DX5A 4WXYA 3EYPA 2IPJA 3KP1A 1ZU8A 3GBEA 3CLMA 1GRAA 3N73A 3FA4A 1R3QA 4XSMA 5CZ0A 4J3VA 2Z26A 4CN6A 2WSRA 2NSOA 4MNJA 3KRUA 1X1OA 5U25A 4YIWA 4LA1A 1UD4A 4HYRA 3K2GA 3T2OA 1JDDA 3OZOA 1E0TA 3W1PA 2DU2A 2VFIA 4W93A 4PTMA 3GM8A 3UWQA 1ZRQA 3HQNA 4GZ7A 5F4SA 4U33A 3W7RA 4YTSA 5I0DA 4EACA 3PAJA 4GLEA 1TYTA 3EPMA 1PWLA 2XIIA 5AYYA 2VZUA 5BW6A 1Q13A 5CPMA 3B8SA 3QKZA 1WE5A 2GUYA 3S47A 1E0VA 4W7WA 1EBGA 4GKTA 3SUUA 2ZX9A 3PJXA 1PTDA 1B31A 1Z69A 3MY9A 5FS9A 2F8QA 4OT7A 1YLVA 3MMDA 4B4HA 3GLCA 4WLCA 1Z41A 1BSIA 3PAOA 4LS1A 3CUZA 1LUCB 1KFKA 4LYPA 2ZYFA 1W3LA 2EO7A 5H8MA 3W7HA 1KM3A 4DO4A 1X6UA 4Y9MA 1QNPA 2FYMA 1IEVA 2WMFA 2QDHA 3GXFA 4GZEA 3WUEA 3S6DA 4QJ4B 2J4GA 3UXLA 1TV5A 2OT0A 2ZA1A 4DYJA 1VFHA 4MADA 5D4YA 1W1PA 3P14A 4J56A 1U30A 3MP5A 1SM9A 1SJBA 1ZUAX 2REQA 4Z0JA 4JTEA 1FWAC 3H12A 3RMEA 2ZIDA 1VYPX 4M8UA 4K8DA 1EDGA 2WJDA 1OG6A 1KV8A 2W61A 3QRHA 3V0SA 3TMLA 4FPSA 2PEVA 1R3WA 3KBMA 1TYPA 1Y65A 1EXBA 2RAGA 4ZB0A 1EC8A 3HURA 5HATA 3SGUA 3GNNA 2QUMA 1EXPA 2DUZA 3RCYA 3PTDA 3M46A 4DJDD 2Y1HA 5DBUA 5CGMA 2R1LA 4E2VA 2VVSA 3ARSA 3CMGA 1S2AA 2PI6A 3OYXA 5A8MA 1XV8A 1FVPA 4CD5A 3QHMA 1UOZA 1Q8JA 3BANA 4M52A 4KEZA 1SJCA 1SZGA 3NEHA 4XZBA 4ZSTA 1GVSA 3MI2A 2ZXBA 5KZMA 4NVTA 1J2WA 3NZRA 5ABHA 2EQ6A 1R3TA 4J35A 1TV3A 1XINA 3H21A 5G4HC 4LB3A 2E67A 1E1CA 3S3GA 2V3AA 2WMGA 5TR3A 1NHPA 4DLFA 1S39A 3GAYA 3WLMA 3M1ZA 1EIBA 3UG4A 3NQ8A 1W8GA 4DBSA 4BV6A 3DESA 5HNNA 1ZJIA 4H8HA 3OGSA 4TOQA 2CHRA 1RJPA 3LMZA 1O5XA 3OLIA 4ORMA 1RQEA 3IJ6A 3LPGA 3DHUA 2VEGA 2A3CA 1LQ0A 1LOLA 4IQEA 3LLXA 3OW1A 1ALDA 2G97A 1TA3B 3NQFA 2UY5A 1D8CA 4HQVA 1DXIA 1L2UA 1VCVA 2OEJA 1WAUA 3CM4A 3S9YA 5L9FA 1F6YA 3LBCA 4AU0A 1P4CA 4AXNA 3D5HA 2CLEA 4XAPA 2FJUB 3PVFA 3U4AA 1XSIA 4MB3A 5G2HA 4OWGA 3ZLHA 3ORWA 3TR2A 2WJFA 3NM3A 4Q4QA 1OFRA 5C7HA 3GNOA 5AY7A 1YX1A 4PA8A 1AFSA 4DHGA 1XANA 2Y61A 3UY7A 3UZJA 4CUCA 1JZ4A 3B9AA 3W83A 5HPCA 5HMDA 1EGMA 4GE8A 2VDHA 3EA1A 1RM6B 2J66A 5K7JA 1VLWA 3CU2A 2TSYA 2JE8A 2NX1A 3DZ1A 4CCZA 1YNPA 1XDIA 3WK1A 2WMJA 1TTPA 4REQA 1E3ZA 1CGTA 3V0TA 1EJSC 4LF2A 3QGVA 1JPMA 1N55A 4GR1A 1ZQ5A 1E73M 5FIPA 7CGTA 4OUIA 3AQUA 2R1NA 5E93A 4EWND 2INEA 2DDXA 1BYCA 4G9PA 1M9HA 1MMFA 3E1F1 5KZEA 2J7HA 4XTIA 1JYXA 1C9WA 4LUSA 4RW3A 3N6JA 4F48A 1IXQA 1RA0A 4AWSA 2XN1A 1R9ZA 4ACZA 4DXXA 1H1NA 5TIMA 1OFPA 2HE8A 3L4TA 2BMBA 3CIXA 3DG6A 3VD4A 3MZ2A 4CEXC 4FR6A 2H6RA 3F2DA 5DT5A 1Z42A 2PC4A 6TIMA 2DORA 1HJWA 4PEEA 3VKCA 5CGQA 2YIHA 4WSKA 1U2YA 5HK4A 1KM1A 2XM1A 3CO4A 3P5ZA 3NCOA 3G18A 3AIVA 4Q7IA 5I03A 4PYSA 1KBLA 4DWSB 1UW9A 4JHOA 5G1YA 2WZEA 4H83A 3IIOA 2PC8A 1GPWA 3L67A 4BEQA 4P5UA 2J13A 5JU6A 2PU1A 3WMBA 2WSKA 1F8MA 3TDFA 3U7VA 4IIFA 1T0OA 5AKQA 1V3KA 1FWHC 5BXRA 1LDCA 3MWAA 1W9PA 3H70A 1M7JA 4NJGA 5I3JA 2Q8XA 2PDXA 4Q33A 4QNEA 4OTKA 2PLKA 4IF2A 4RDYA 4FLSA 2GWGA 1WP6A 3N1AA 1HKJA 1DE5A 3A24A 1K02A 7REQA 4H4RA 1UR8A 2H8XA 2OWWA 1SFSA 4Q4OA 3ZS4A 1IEXA 3QLLA 1XUUA 1E1EA 1JUEA 4J3SA 5JCKA 1HJXA 1LT7A 2WC4A 4EPKA 4PMOA 3FSUA 1DTNA 1BG9A 2ZVIA 1FXPA 2DT2A 1I1WA 2WJEA 5H1WA 3MSDA 3F4WA 2YCJA 4AY8A 4C6JA 1VBRA 4EAYA 1FHLA 5GVJA 4GNKB 3WH8A 5CJNA 3WLHA 1MO9A 4JDYA 2WZMA 1E6ZA 4FOUA 4BS0A 3W1TA 1N2VA 5ABGA 3PBUA 1NP2A 5RUBA 1BFNA 1O60A 2J25A 3ZWSA 3OP2A 3DFNA 2OKTA 4KWWA 2QR6A 1DWFM 1V03A 5FJRA 3QFBA 4WR3A 2NQJA 2B81A 2W91A 3KOWA 3NYZA 2YGYA 3CZKA 4CD8A 3O8AA 4AEEA 3HV9A 3S42A 2E77A 4GYPC 1R3VA 1UZHA 4UB9A 3RM4A 4Q8OA 1Q2SA 1TPDA 3BO9A 4QS6A 1F3TA 3MCNA 3R79A 3T4WA 1XCWA 3NJ3A 3COTA 1PIGA 2WM1A 4E2BA 3W7NA 1QI3A 1G94A 2ZBTA 3PUEA 2ZA2A 4NAFB 4PRTA 1TTQA 1DIDA 5G2IA 5C9ZA 3MUXA 1XKYA 1XRVA 5DMYA 1UP0A 2WOWA 4R88A 3WCZA 1EP2A 1WX0A 3B8TA 2PDHA 1GONA 3SSJA 4GRTA 4Q8PA 1UPMB 3L4YA 3OHMB 3WJZA 3U5UA 4Q8TA 2VUYA 4DVOA 1FCBA 3BLLA 3OA3A 1AW1A 4OVXA 2FFIA 2R94A 2IPFA 3M6DA 3V35A 1E6RA 1A4LA 2VYOA 3I7QA 2D20A 4K68A 5A8GA 2WSQA 3DOPA 4L9YA 3A4WA 4Q6JA 3CYJA 1PX4A 2OG9A 4O57A 4EQXA 3T9PA 1QK0A 4QE5A 4I7VA 4GYFA 3FDGA 3CMFA 2XGIA 3N4EA 4PCTA 4GY7A 5AOUA 1FWEC 4JFSA 2QHAA 4HK7A 1B3YA 3VC6A 3NPUA 1XYFA 4GOAA 3TC3A 3G5EA 1NFPA 4L4LA 4S3BA 4B5TA 4IX0A 3W71A 4PBEA 3L5AA 1W9XA 3GKFA 3KLLA 4ZR8A 3DGRA 3FJNA 2JK6A 3L5OA 1GOWA 3PP7A 1LG1A 1R5YA 3SN0A 4QG8A 4H4UA 4J1OA 1GT8A 3QC0A 3RPDA 1JPKA 1W3JA 3L4XA 2D2HA 4JNZA 1QNVA 2OXNA 1TYGA 2PGWA 1KM0A 4GK8A 2OU4A 3O05A 1NHRA 4YTUA 1DIEA 3CGBA 3G0XA 4NILA 4LEQA 1NJJA 4IQJA 1TQJA 3VGEA 2D23A 4CU8A 3AO0A 3VOJA 3NQ2A 4O0QA 2WPCA 5FOOA 4D71A 1XBYA 4JYDA 5D02A 1YDVA 2ACRA 1GSNA 4OBTA 4DAFA 2QJNA 3TLQA 1S5VA 4MAZA 3QGAC 4RE3A 3VINA 2DVTA 4H9ZA 4AZGA 4NZ4A 4PFHA 3VOGA 4B9YA 2RJHA 3N4FA 3IJ7A 2FQIA 3NGJA 1KBKA 3A3HA 4IMGA 2GVYA 3TCSA 1PZ3A 2SFPA 3UERA 4A8LA 2X99A 3BVJA 1VLIA 1WDSA 3F7JA 3CUXA 1H7XA 4EQRA 3OGRA 2QXWA 2DQWA 3OO2A 3DDMA 2QMKA 1RVKA 1A0DA 3M0MA 5I02A 3I6RA 3VKJA 3WEZA 4FX8A 1EPXA 4US6A 4LU0A 1I60A 1FX6A 3H4WA 4AX7A 1QU4A 3EDKA 4KH2A 1UIOA 3N14A 3KDNA 4WCJA 1KCKA 3CAWA 3PBGA 3WLIA 1DJGA 1R9YA 3H7UA 4MHBA 5MKGA 1DPMA 4O1EA 5A94A 5A6BA 5G4EA 1N8IA 3D3FA 3KOXA 1YTEA 2EG7A 3UFYA 2VMFA 5AVNA 4MYXA 4AWEA 1O6IA 4IG2B 4MKVA 3GXPA 2PUZA 1T5AA 3SCTA 2CLIA 5E1QA 2QAFA 3URHA 4G1NA 1MZRA 4ZOEA 1O7AA 1OCNA 1DORA 1XIMA 3CPRA 3G1HA 3GNRA 3GD4A 4UOZA 2O0TA 1VFFA 3E0IA 4W5ZA 2ISSA 1MEWA 5CBIA 1PKYA 1OT2A 1POKA 4RX0A 2DJXA 3ONBA 3QPEA 2ON3A 3VGDA 4MDOA 3TW9A 2VR4A 1XLJA 1PSCA 1XLMA 3L0KA 3GG1A 1B3ZA 6ALDA 3BW3A 1F61A 2ABAA 3TYUA 3CEUA 1EBDA 2YPIA 3OQEA 3LHVA 1TB3A 3QSTA 3KRZA 2J7GA 4WJXA 3I68A 4JYFA 3DXIA 2WK2A 4P8UA 4L1WA 1X1NA 5B7YA 4U2ZA 2YKKA 2I16A 1AL7A 4IP5A 1DXEA 3C0LA 1GORA 2HZGA 3THCA 4DPPA 4LFYA 3UA4A 1K4GA 1XDLA 4O8RA 4KMQA 4E4PA 5GNYA 3MHUA 5HMSA 2HEJA 4W88A 5AHEA 3VFCA 2HQAA 4PRWA 1VKFA 3ZYZA 3JVAA 3DFTA 2XTKA 2PDWA 1E56A 4HHMA 4A35A 3VTRA 1YDNA 3GFZA 4PBGA 4ZTXA 3QXBA 2ICSA 3WUGA 4V1XA 1I6NA 1O5QA 4K7ZA 2HCVA 3SJ3A 1KGXA 3QW4B 3OZPA 1TWDA 3PUGA 4UXDA 3UD6A 4KERA 3IANA 3STEA 3BAWA 3WLSA 4E8CA 1RBOB 3W7KA 4LAUA 3KZSA 3MQTA 5A8NA 3GHRA 2CPUA 3WNOA 3BZJA 2DUXA 3SCRA 2YXGA 4ZL1A 5BNKA 3WMSA 4M1BA 3NURA 1LL6A 1ITUA 4F0HA 1TVPA 2E6YA 4OJYA 5AHNA 3EB3A 1YBQB 2XWDA 3HO8A 4AC1X 3PZTA 4ERIA 1EJTC 3WFLA 3LXCA 3U2ZA 5BOEA 3R89A 1UP2A 3PANA 3PWIA 1OD8A 1MVYA 3CGCA 3OBAA 4AVOA 1PKNA 4EQWA 4GX9A 3LNPA 1EL3A 3Q45A 3UWWA 3SEPA 3W7DA 2PGRA 1IZJA 4L1XA 1DXLA 4Q8NA 3AXMA 3CTTA 3WD0A 3VE9A 3GH5A 3U6WA 1Z8AA 4ZE5A 1M01A 4I9TA 1RA5A 4NSBA 4S39A 2F2KA 2CZDA 4Z1BA 2CZFA 3TSBA 3QEZA 4KWOA 4PB4A 1KTCA 4DF1A 3AIEA 3WG6A 1ZP3A 1VFOA 2Z1BA 4IJRA 4CQCA 2E1DA 4WF7A 3WMLA 3GW3A 3BJSA 1I8JA 4H41A 3AUJA 4HZ7A 3M6YA 3RLVA 2A85A 2YDRA 3GYCA 2AL2A 3ES8A 2WHJA 3FA5A 3VNLA 1YQZA 4OOUA 2HK0A 4RCXA 4GCXA 4NNBA 3B8VA 1FOBA 3BDKA 3BW2A 4MB5A 1D9EA 1K77A 1TE6A 1JG9A 5TF0A 2GL5A 2P10A 4KRUA 2H90A 4CCCA 3CZJA 4UMAA 2B7OA 1H51A 4CQBA 4EMWA 2ZZ6A 2FJKA 3CHFA 4X0NA 5D2YA 2DSUA 3TK7A 2BGQA 2C16A 5AECA 3SRKA 1SVDA 2Z1KA 3K13A 3R0DA 3TA9A 4H9YA 1ZFJA 1OGGA 3N2CA 2D0GA 1SW3A 2P3EA 5AC7A 1QBAA 1HP5A 1R46A 1J6OA 2XG9A 4GMEA 2ZUNA 4UTTC 4PUEA 3WBAA 1W3NA 1YYAA 4UFMA 2AQOA 2CZVA 4IMDA 1I2NA 1J0IA 4C6EA 1EOMA 3N6HA 3N19B 4LUTB 3QBUA 1EO7A 4DNAA 4W8BA 1WDQA 3VDAA 4MM1A 1CXIA 1S3TC 1YMYA 2E3ZA 3FFSA 1AK5A 4J7RA 4EAMA 1SZFA 2FH8A 3C3UA 3NQVA 4BJHA 1JL8A 5TAOA 5D8WA 4JTCA 4A3YA 4BCEA 3TTSA 1BPLB 1TX0A 1EEPA 4F3HA 5BU9A 1SYTA 1G6CA 3V5CA 4R33A 2D0FA 2XGBA 1MRQA 1B0IA 1BSLA 3VE7A 2NQHA 1TWZA 4R34A 4IGSA 3AHYA 2VO5A 4ZQCA 3D46A 2D3LA 5I3KA 3W29A 1F8IA 1HNYA 2ZRXA 4WX2A 2YVFA 3IJQA 3M16A 4AZ5A 3NTYA 2FH6A 3ICJA 3UPWA 3N6QA 1AA1B 5FS7A 4GI8A 4JTRA 4NI3A 1UWQA 1XBVA 2ZZ0A 5D9NA 4H00A 4JYEA 4TUFA 5FJOA 2YB1A 4FEZA 2G41A 1RJRA 1DJWA 1KBIA 4Y6GA 3DK9A 1PTGA 2DZVA 3O0KA 4AMAA 3INPA 3WBYA 4XTDA 4M51A 4LT9A 4A3UA 5LGZA 1K03A 3M0VA 1D2KA 4KFNA 3MT1A 3M5XA 2DGAA 3P2VA 1QVBA 1RBLA 5G5GB 2AL1A 4UR7A 1MW1A 2ZE0A 4K8EA 2VGFA 2IQ0A 1MUCA 4EF9A 3NL6A 1OIFA 1NHQA 1FEBA 1TPEA 4HZ6A 1XW8A 3W7OA 1XLKA 1EDTA 2Z7KA 2OX4A 3VI2A 4UQEA 3AM9A 2ZDSA 2A3AA 2ZX6A 3VPLA 1XCXA 4MWAD 1OEPA 4C6MA 3Q65A 4P2VA 3W6MA 4NXKA 5T8GA 2ACQA 3NGFA 3LTSA 5I3GA 4BWLC 5FMHA 3NWRA 4IPLA 2WBAA 2BY1A 1TV8A 1AMYA 1UJQA 2EQ7A 4EP8C 1XX1A 2A6LA 4JTSA 1ZCCA 1Q6GA 5C54A 4AD1A 1JGMA 1ZZMA 5A6KA 1TPH1 1ZX9A 5F2LA 2WBGA 4DYEA 3CIVA 2FZNA 1T99A 3VAVA 3SADA 1TTJA 3AI0A 4LNYA 3RR1A 1A5SA 4ZOCA 1A50A 2AQWA 5JBEA 3FY1A 2HJPA 3LZ5A 3AJ7A 3VIJA 1MNZA 1XC6A 2V82A 1MQPA 3NVTA 4HU4A 2FPYA 3LY0A 3VNDA 1OBAA 2ZX5A 3GC4A 1RK6A 3MSYA 2VCAA 2VRJA 3GU1A 4D6IA 1E6SM 3RUBL 1HJSA 1U22A 1XLFA 3NUKA 1F5ZA 3THAA 4Q7NA 3ATZA 3AYTA 1V6TA 1TVLA 4KIRA 3S2CA 2XVKA 3W2LA 3F03K 3B0VC 2VXNA 4PULA 1V6UA 3O0HA 1PB0A 3T0DA 1VZWA 2NVDA 4J3XA 1W8SA 4RE2A 1PX3A 1EEXA 1FKXA 4NXSA 4C5ZA 3MANA 3C5QA 1H49A 2FHFA 1JCJA 2VQUA 4A29A 2X8RA 1MNSA 3DBNA 4KRZA 5HA7A 2ZZ4A 4GISA 2ZWZA 3SY1A 4H4PA 4K1WA 4L1GA 3H2EA 3BOLA 5A6AA 3WQFA 3QZAA 3S9ZA 1OIMA 5EMKA 4WVXA 4LIIA 2DIKA 4HSHA 4O11A 4BI7A 1I2PA 2QZRA 4XZNX 5FF0A 1W5NA 4JKKA 3DC0A 2PSNA 4OFCA 4X3ZA 1ZB5A 1AJ0A 1RY8A 2RHGA 1H63A 1KTNA 1TVNA 4UTJA 2BWGA 2ZADA 2GQWA 4MYAA 1FBAA 5AB3A 2D24A 4HCDA 2VZVA 1KWKA 2PDPA 3TSMA 4X9YA 3OB8A 4IIBA 3STGA 3WNKA 1UUMA 2VCBA 2ZRZA 3UVIA 2XN0A 1GGOA 2PDJA 4KKXA 4JIIX 3L2LA 1JEHA 6A3HA 2OB3A 5FEZA 5FD0A 1TRIA 4N9BA 1GRHA 1YPFA 2EQ8A 3LCHA 1PUDA 3LRLA 4RPPA 5I6SA 4OU1A 2MNRA 2OWCA 1JROA 3WQ6A 2VHLA 1ELSA 1LUCA 3BK0A 4NHVA 4YYFA 2BC1A 4O12A 4V1YA 3W87A 3QFAA 2WC7A 1SO3A 3ECQA 4XWUA 3VIHA 1VCGA 3H22A 4J3WA 3I4EA 2ZVRA 2CBUA 4N0RA 1FTXA 1ZP4A 4DXKA 1RR2A 3APTA 1W2VA 5HMEA 3W7EA 4Q4SA 5I7GA 1QASA 2YZ5A 2QGYA 3S5ZA 3KRBA 5K9DA 3CWNA 1TPWA 2VNCA 3NO5A 3G1XA 3MUCA 4JICA 4J2PA 3EB4A 2W54A 1XR2A 1P43A 3HPSA 4MWAE 4PRRA 1B57A 5D30A 3L2IA 1UWRA 3RCNA 2W6RA 3KBVA 4NRSA 2QJGA 3GU9A 5DMNA 3K4WA 1UKQA 1UR1A 5K2ZA 2I9UA 2CHNA 2Z0IA 5JCLA 2Z28A 3G6MA 4ZFMA 1REQA 4PUJA 3EKZA 2ZRYA 1US2A 3IK2A 5E6YA 3OGVA 3DK8A 1VC4A 3RO6A 1DQWA 2FPTA 5HBFA 5H8PA 3M41A 2FGZA 3CAVA 3BLFA 1XBZA 2OKOA 3IGSA 5E70A 2PCEA 4FXRA 4FSAA 1LLOA 1Q4NX 5FF2A 3BMWA 3V75A 1B3WA 3N12A 4XIAA 4US5A 2Q3RA 4I90A 2BCPA 4WJ8A 4NT0A 5E0CA 2NX9A 1CGYA 4D1IA 2OELA 3QHNA 2OODA 2GGEA 4XBSA 3NZGA 3SAZA 5LA2A 1UD5A 4GQBA 2NT0A 1ONRA 2V0TA 4LWWA 1AG1O 5EMLA 3EXTA 3CASA 2ZZBA 2YL6A 1E5NA 4UMCA 3QV7A 3ANUA 3IIXA 4UQCA 4F79A 2WHLA 5DBTA 1XP3A 2JIWA 1HL8A 1A5CA 1UA7A 1RSCA 4GWEA 2I7GA 3CZEA 2AAAA 8XIMA 3W1MA 3VZZA 5EKYA 2FZBA 2HVNA 2OWXA 4G7FA 2F6KA 1JI1A 4RZ5A 3B8IA 3EX1A 1LG2A 5HINA 5KETA 1PHQA 5EBUA 1XLCA 4GJIA 2EPHA 3E6EA 1TA3A 3LNMA 2BODX 1MEIA 1LBFA 5DRIA 1IXPA 1E40A 1QR7A 1RZMA 3T81A 4H4IA 1UD8A 1VPXA 2B0MA 5HWMA 3OQ8A 3QN3A 5D2VA 2EJ1A 3Q4DA 1NDVA 3VD3A 4KPLA 4XQ6A 1IYXA 3MCOA 1PCKA 4B16A 2C1GA 4NZ1A 1IXNA 1GVFA 1YXDA 4AWTA 4JTAA 3CZ8A 1JR1A 3AC0A 3H2MA 4RR4A 2DT1A 2PODA 3DN5A 5EY5A 1JIBA 2HTMA 4HVXA 4C65A 1LWIA 2D1ZA 3IAPA 4UFIA 1IV8A 3SECA 1QPOA 1N82A 1KGWA 2AGTA 1MUMA 1LOSA 3LB0A 3WDPP 5IOBA 2D22A 1K1DA 3OG3A 2ISWA 3WQ5A 3M0KA 1RPXA 2ZUWA 1XIEA 4RDZA 1WB0A 4XSLA 4K7YA 1A5LC 3SR6B 2ISVA 1Q85A 1Q8AA 1GKRA 4J3UA 2YDSA 1SO4A 4IX2A 4B3ZA 1DWAM 1BGAA 2PWUA 2TPRA 3N9RA 3ZZ1A 1W3TA 4IPNB 3MS8A 3A23A 7TAAA 3DHDA 1M3UA 4HOXA 4PTNA 4ALDA 4H04A 3NNTA 4S2CA 3EWBX 1BRLA 5IXEA 2PBOA 4IUOA 5GNZA 1CXHA 4ROPA 4JQ3A 3LBOA 2DT3A 1WZKA 5TNVA 3MMWA 4AEFA 3THUA 3PFMA 1H50A 4HMEA 2CKRA 2W0UA 3UGVA 3P3BA 1JNEA 3GXIA 1AD4A 4Y90A 3IS4A 2P8BA 2CLFA 3SO7A 4QJ3B 3DEQA 2E5AA 3ITYA 4PUNA 2GQAA 4RXGA 4GYJA 1FCVA 5FF7A 4NL1A 2Z1XA 5D2WA 2D69A 5JH2A 1SZNA 4N9EA 4BHYA 3SQPA 2R1MA 2BVDA 2CZ5A 3TYEA 1JD9A 3PZOA 2PFHA 2J8FA 9XIAA 1RLDA 2QDGA 2P8CA 3IJLA 1W1IE 4BK9A 4LYKA 1TJ2A 2GJLA 1UWIA 5HPOA 1WAWA 3OIHA 4CN4A 1JDAA 1FWCC 2GSHA 5EBAA 3R10A 3WQGA 1L2QA 3CV7A 2PF8A 3NAVA 4OKDA 1V02E 1W5PA 4UNLA 3RNDA 4ACYA 4EXBA 5M03A 3ITGA 3D47A 2CETA 1WDRA 3BAYA 1IZKA 4C6IA 3WH6A 1XH1A 1XIGA 3OLGA 4DWDA 1B3XA 4ZO9A 3KTXA 3PPFA 2OT1A 1XC4A 1GOQA 3R4IA 4ZCWA 3TFCA 2V38A 1VIZA 5DT7A 1BVZA 4IMFA 3VOIA 2JF7A 4XBJA 4MAVA 4JTQA 3EKLA 1EA9C 3FLUA 1TWWA 2JEQA 3UG8A 2VFFA 4K8HA 2J7BA 4ZQNA 4LNCA 1GHRA 1ZAJA 2VQTA 3UY8A 1H2IA 2PTWA 5CPQA 4C90A 1FP9A 3G3DA 1DJNA 1VJZA 3LCIA 4QNWA 1JZ2A 1E5JA 3TONA 2YJQA 3TN5A 3QTGA 2ZZ3A 4JR5A 2VC5A 4RNJA 1T8XA 4FALA 5D37A 3S1UA 1MXSA 5CZJA 3UWEA 4AZ6A 5FF3A 4U5KA 4PGLA 3W4RA 1XI3A 1TQXA 1XXXA 4HK6A 3GH4A 3O7UA 5H91A 1V6YA 2WKLA 1W5QA 3TROA 1WZLA 3LRKA 1IWBA 1CGUA 2R8WA 3UNTA 1XIJA 3GE7A 2AQVA 2OLSA 4GKLA 2ANUA 4Q8MA 3T09A 2VFHA 1JPHA 7A3HA 2YX0A 4HA3A 3LEPA 3V4BA 1RCOB 3T6CA 4C1NB 2UY2A 3E12A 1ONFA 2WCAA 4H9UA 5LNUA 2XJ7A 3RFAA 2XVGA 4NAFA 2XISA 1ISZA 4GH3A 2X8HA 1QBBA 3QMRA 3MMTA 2OYKA 3A5VA 1A5AA 1JAEA 3MV01 5BCAA 4JTIA 2BHYA 2C1IA 1TR9A 3NDOA 3VIOA 4BQ3A 1UR3M 3ME3A 4NZCA 3SM0A 4CU6A 3T2QA 3KDOA 4LV4A 2FMOA 3B9NA 1YW1A 3UYCA 1US3A 2O4QA 1ZS2A 1DHKA 2XN2A 1G4TA 1ZALA 1TPVA 3H4GA 3BLPX 3OA5A 5IFTA 1XLAA 1O95A 3VGBA 5E5CA 5XIMA 1IHIA 2CBIA 2WOVA 4Y2WA 1PAMA 3P80A 1GRFA 1JDEA 2RDXA 3GO2A 3SY8A 1V7AA 2QDEA 2WMIB 2VEPA 1NOWA 4EPDC 3TNOA 2VC7A 2IQDA 4GVGA 3L9CA 2FB2A 3AHZA 2UY3A 2QJIA 4I8YA 1EGVA 2A6NA 4J4KA 1K4HA 1CLVA 3KL3A 1LVLA 1XS2A 2OZTA 4AHQA 5FJPA 4ZGYA 3KUMA 1KW1A 3NSMA 2PDKA 1IGWA 3DFPA 4L61A 1EWEA 1LRTA 4H9MA 4O17A 1HO1A 2GUUA 4HU0A 1W9BM 2EG8A 5CKSA 3BWWA 1K4QA 3DC8A 4KEMA 4NZ5A 4RV3A 3L4VA 3WN6A 3AYVA 3QH2A 4FK9A 2OQHA 5PTDA 2EKGA 2WPBA 3BAIA 4BI6A 4F0SA 1HJUA 3DG7A 1S5TA 4ES4A 2V67A 4H8VA 1YRRA 3OC4A 1RQHA 1QMLA 3DKLA 2W0HA 5LZLA 2YVJA 5XIAA 3MVTA 3WSUA 1TPC1 1WPCA 1ZTVA 4JNMA 2NVCA 2Y5EA 3QFWA 4GVIA 4NG3A 3AMKA 5JRBA 1QOPA 4JS3A 5FJUA 4EM4A 4YTRA 1IGSA 3G1YA 3F4VA 2Y89A 4YHGA 3VMPA 3TVAA 4X9SA 3Q58A 1MUWA 4HJFA 3ARWA 1KLZA 3BLIA 3VXGA 1FWFC 5DF0A 3H55A 4W4QA 1MEHA 2X2YA 4P7LA 4UFJA 1FUYA 2E9LA 3M44A 2R1KA 1TTIA 4PMJA 1E0UA 1EH9A 1J96A 1PIFA 2V63A 3CV1A 5CSRA 1BZLA 3FAWA 3TJIA 5CZTA 1K9EA 3G8RA 3EX2A 1HIZA 3E5PA 4HN4A 3TC7A 1E9LA 4DJEC 4O1AA 5TD4A 4RZ6A 2IPWA 4MJZA 5HR6A 3BQ5A 3BAXA 2QVHA 4PUDA 4ZQMA 2QMJA 4IPJA 3S1XA 3PZIA 2OYLA 5F7UA 1VGAA 2E6DA 5AFDA 3KBJA 3MW7A 4C6FA 3QV9A 2EPNA 4MJ4A 2VGIA 4QROA 4CN1A 1LL4A 4TR9A 1V3JA 4AVNA 5BXPA 4C6OA 4M80A 1TJ1A 3HBLA 3PNZA 4PMUA 4Z42C 3LI0A 2XIBA 5LA0A 3H24A 3SUTA 4ZO8A 1EZWA 2Z2AA 5CPOA 3KS5A 1OABA 3W28A 1LROA 4BF9A 4ERGA 1J5TA 4LEFA 4H8NA 2ZUVA 1E1FA 3CUIA 3BTNA 1FDYA 3GNXA 5EMJA 4XAYA 3UG5A 2VRKA 3ITVA 4GUFA 3ZM8A 2GJXB 4JFTA 2WNZA 5BWFA 4PUMA 2WV8A 1Z48A 4M19A 4FIQA 1OFEA 2B7PA 2J8GA 1TUFA 4PTWA 1DKWA 1R47A 2OGJA 1HX0A 3GY1A 1F3EA 1FIQB 2OVLA 2PDCA 3SI9A 3QYSA 3H6OA 1EJXC 1ZNNA 1UD3A 2VM8A 3QY6A 1HZYA 2VEMA 4KRTA 3SUSA 5TQLA 2J6XA 1LWHA 4Y9NA 5I3FA 4AHPA 4C7FA 4I8DA 1UBPC 3ZSSA 1FCUA 1IWAA 4PTVA 3TAOA 2YW4A 4O10A 2GR2A 2POTA 4JQ9A 3EX3A 4EKJA 5XINA 3M5ZA 3TTYA 1K7XA 1RAKA 4DBUA 4KEUA 4HK5A 5ABFB 4DXVA 1PYFA 3NEVA 4JIRA 1LF1A 3C0SA 3TKFA 1FP8A 1J01A 2V5CA 1MOKA 1MI3A 4F0KA 5CQ1A 3VNZA 2X30A 3CHVA 2WQPA 5I23A 2RDUA 3GXDA 1W1YA 3UWZA 1KV5A 4LXFA 3GVQA 1JCNA 3IUDA 2ZZ2A 3WQPA 2CLMA 2PDMA 2VUNA 1QO2A 3UETA 4DPQA 3E0LA 2J9XA 3TZFA 1UUOA 2D2OA 4JXCA 4TX9A 3M9YA 4B4FA 3H26A 3HRDC 3RJXA 2FZ8A 2UY4A 2HS8A 3VO0A 1DQUA 3W6LA 3EGJA 2C3CA 3N2TA 2NLIA 5U4NA 3MWCA 5HMFA 5DCEA 3K4DA 4N9DA 3UZXA 3DGHA 3BURA 1OX6A 3N3MA 4MNMA 1GKPA 2E5BA 3WLNA 2XYLA 1YBQA 3KVKA 3CYVA 1BYAA 3EAOA 3GNPA 3OEXA 2QCEA 4YTQA 1YPIA 5JBFA 1G5AA 4KWSA 3HM7A 4L5ZA 1BKHA 1H41A 5D38A 3GXNA 4GIYA 2VWSA 4QR6A 4AX6A 2NX3A 1OCQA 3EX6A 4DJDC 3HV8A 3KAOA 4O52A 1XHCA 3GTNA 3EOUA 3SDOA 3S5YA 2BZNA 1XSJA 1XIFA 1MO0A 1TKKA 2XIQA 5C71A 4NKCA 1GKQA 4E38A 3NPWA 3S1GA 4D9PA 4MY1A 2P0OA 4H01A 4HYWA 1PV8A 5BMXA 5AYIA 3WJYA 4GHRA 5U1OA 3VM5A 3N2OA 1UMYA 4GIRA 4H4XA 3RN6A 3PULA 3FGCB 2QNEA 3UWVA 4HHPA 3FOKA 2QIIA 4IOTA 1B4EA 2QGHA 4FO4A 1WZAA 2YXOA 3N3TA 2WOIA 3OU8A 3T1GA 1B54A 1VHNA 2GFTA 4RZBA 1BHGA 4YHEA 5CZSA 3RU6A 2R24A 4Z2JA 1AZ2A 4WKAA 1J6PA 1ZJBA 2IPGA 3GTFA 2OMAA 4TV5A 5KZDA 1TE1A 4BF7A 3PY2A 4GD0A 4O1CA 2DVXA 4BI5A 4DBEA 2W66A 3W2KA 3GR8A 3SGZA 1UWAA 2NXIA 1V59A 1C8YA 2YB4A 3VKDA 4HPGA 2J3NA 3J7HA 1X8FA 1AODA 1H7PA 4H6QA 2OOFA 1KRAC 5I78A 5LIXX 4WY0B 4KWUA 1BWVA 7PTDA 4NNCA 4YJ5A 3L8KA 3CZLA 3NXFA 4QTGA 3OVRA 1M53A 3CGTA 1JRCA 4Q6XA 4DZHA 5T26A 4LUTA 2VZTA 1E43A 1HFBA 1M7OA 2WPFA 3AS2A 3TXZA 3C52A 2PWFA 3WF1A 4E8DA 3KCOA 1BXBA 3HJZA 3ZFHA 1DWGM 1KFEA 4IIEA 4PCFA 4QRNA 3KCJA 3AXIA 1LJYA 5GRTA 3WD3A 4GUJA 3TIMA 2PP3A 3QGKC 1GRTA 3IJ8A 4NQ1A 3TWAA 1XUZA 2J8TA 3W1RA 4EF8A 3O16A 2E68A 3MO4A 1UD2A 3FXYA 3C6CA 4LUIA 1VR6A 3R12A 2PDNA 3M0JA 1R87A 1C93A 3ANVA 1OZMA 3WUBA 5DLCA 3RLUA 5EB8A 4M24A 3TMQA 1O12A 1WDDA 1ENUA 3APGA 1V3HA 5K4ZA 3UU0A 4LRSA 1VYSX 2QF8A 4LVGA 3VGFA 4B2DA 3CQKA 5I79A 1ONEA 1ZMCA 3FW6A 1Q4WA 4MZ8A 1AJ2A 2O7SA 1N5XA 3N2XA 3PNUA 4P7RA 2C91A 5FF4A 3B8UA 1VFUA 1F76A 1ZKQA 4O15A 1KD0A 4DYKA 4P7QA 1YE6A 4IISA 1Z6KA 3ITLA 1JZ6A 3N18A 2E8YA 4UNKA 1CTNA 3A6OA 1F07A 4GIAA 4JOMA 4F0MA 5FJTA 3SIZA 3KX6A 2P3ZA 5BXTA 3VIFA 3GDLA 3ATYA 2PU0A 3UPMA 1WNOA 4DF0A 2V5BA 5JMUA 5CSUA 1AH3A 5LKYA 1R2RA 1FXQA 2BP1A 4B5SA 3NVVB 2YL8A 3PZNA 4X22A 3DH9A 2QCCA 3W1UA 1KRBC 5D03A 4LAKA 4FA3A 1LQ2A 3MCMA 5TBOA 4RE4A 4YMZA 1QOXA 3PZQA 3A12A 1DQXA 3E74A 4HNOA 4PZVA 1RQBA 4D8ZA 4LTSA 2NV9A 2P88A 1S5WA 1WV2A 3I4KA 3UCQA 4NYUA 3ZLGA 5BXSA 2XSXA 5BRBA 3AISA 1PEZA 3P8JA 2QCDA 4C7GA 1NWUA 1MW0A 3FK4A 3VNMA 3GTXA 4KIEA 1ZXIC 1XSKA 1E71M 1G0CA 4W9TA 3W81A 1OSEA 3GD3A 5FKYA 4GABA 1QI2A 1ODUA 1VEOA 5G4WA 1P48A 1V3IA 1UKPA 3LV5A 1ME8A 4EXAA 1QT1A 3FAXA 3O6DA 2Z1VA 2PAJA 3GRIA 3U48A 3W7PA 2J7FA 4J40A 1VCFA 1Q5MA 2IMRA 3D6NA 3KVLA 5HQMA 4AXKA 3QV8A 4B9ZA 3B4UA 2X42A 3TX9A 5CEWA 2XZ9A 2EGZA 1Y7VA 4MJMA 2O9TA 3DERA 4C1LA 1GRGA 1RUSA 2JKPA 4JDRA 2GVJA 3Q2DA 1M7PA 5GNXA 1XFBA 4CCEA 2CIPA 3AYSA 1H4PA 3F2CA 1FWDC 2A79A 2BVTA 5JIPA 4UR9A 2WBKA 4F4RA 2CITA 4A4AA 3DFHA 4MZ1A 3UJ2A 3SCWA 4UTUA 3G1DA 3LCWA 1TCMA 3N29A 1I1XA 2PDQA 2XDFA 3WDIA 2HNEA 1UKSA 3LPFA 3M7WA 5AZ0A 2G3FA 4MF4A 5I5RA 3LMYA 4IPIA 2YQUA 4D2JA 2AMXA 3CAKA 2X16A 1DOSA 2WWCA 2V81A 5G5IA 3SZ8A 3SSZA 1V5XA 1DXFA 4OBSA 2IXVA 4YS1A 2FDMA 1KNWA 2A3LA 1WKEA 2O4MA 2G95A 4D6JA 4ZQRA 1K7EA 4ZXLA 2CLHA 4S1FA 5CPNA 1J0JA 2AMGA 1IXOA 2ISDA 5JCMA 2I5QA 3T8QA 4ECLA 3PS7A 1EQCA 3G24A 3CEPA 1QTWA 5DFAA 2HVMA 4QG6A 4BR1A 2QKFA 5I09A 2DP3A 3B4YA 4D6GA 1JXKA 3S6TA 1JZ5A 2Y0FA 1EHAA 4FOKA 4QS5A 1X7FA 4UOQA 3ID7A 1XIBA 3DJJA 2TODA 4NY2A 3A21A 4DX3A 3LUTA 2INFA 4DAIA 8XIAA 1P1XA 2G5WA 1A3XA 4ICCX 2WSPA 4KCWA 1F74A 3PTKA 3WLQA 1M41A 4CNTA 4GUHA 2OZ3A 4LY4A 2FHBA 4GY0A 2PD9A 1H3GA 1TZ9A 3H53A 1V8EA 3LGEA 1G4EA 3NL5A 3DG3A 1XF0A 3GVVA 1EPVA 2NT1A 1Q45A 4JEQA 4DUOA 3WQOA 3LHUA 3BC9A 3CL7A 1HXJA 4FF7A 4OQVA 2NVKX 1OB0A 3MBDA 2BX7A 3S9IA 3U9IA 3AFBA 2ALRA 2CWXA 2E5CA 3UA3A 1GQKA 1A49A 3AMZA 2A7PA 5I24A 3KVMA 3ZJ7A 4IQDA 3RNMA 4K1GA 2ATSA 3PPHA 2IKJA 2Q71A 3FVMA 2WANA 1P1MA 2PRLA 3DKJA 1QHPA 1OJXA 3QKEA 5KZ6A 5LIYX 1X38A 2YLAA 2CERA 3IWPA 4POCA 1EFZA 2F38A 3W23A 3CUFA 1B9ZA 1SFJA 3WENA 5A6BD 5M2FX 1GZJA 3G2GA 3B03A 3W7GA 1N8WA 1M65A 2UV8G 1B30A 3RIKA 3PB2A 4C91A 1VBGA 1G7VA 1Q6CA 4TVCA 1NF7A 5LA1A 1KBJA 1TWSA 1V77A 1ZJAA 3NG3A 1NWSA 4JTUA 3S8HA 4G7EB 3R8GA 2J88A 1X6LA 3E02A 4AWUA 1TELA 3GB6A 4JY8A 2YA1A 4ZBCA 1CXLA 2BV9A 3C2EA 4NZJA 3M0YA 2J24A 4EM3A 4IZGA 4G5DA 2Y4SA 3P82A 3UVAA 2GGGA 2VFGA 2PLCA 2ZFAA 4PUUA 3UJEA 3VC5A 4XV0A 1QATA 2VURA 4JTJA 4OGZA 3PZUA 1XRTA 2V2DA 4A3RA 3K5XA 3TWBA 4JTKA 1NOFA 1FEAA 1R3YA 3SN1A 4HCLA 2PBGA 1DIOA 3G0UA 3PZGA 2NUWA 1GEUA 1PDZA 1W5MA 1VS1A 4Y9PA 3B0UX 4LGXA 1P0BA 3WL0A 4LAOA 4QBXA 4ZZ9A 2X1UA 2DZTA 4Q4MA 1HJVA 3G8EA 4ATDA 1UZ1A 1UZ4A 1WA3A 2NQ5A 4QXIA 4CU7A 8RUCA 3AIQA 3W00A 3VDBA 2AOSA 4HZ8A 4LUSB 2CESA 3TYBA 1GVQA 5LIUX 2ZUSA 1DJQA 2W62A 3E0VA 1FKWA 3ARRA 1NSJA 3GBDA 1MRAA 3NDZA 1KA9F 3S1WA 1Q7ZA 4IIGA 2ZICA 2Q02A 4CNPA 4P8WA 2VEFA 4U3AA 1ICSA 2EXOA 2HPIA 5LNWA 4N02A 1UQYA 1FFQA 3CWOX 1YNQA 3S5SA 1LBLA 1EC9A 1DBTA 3HPFA 4C6CA 3JRKA 3B05A 3WIJA 1QPRA 1SMAA 4ERAA 4IUGA 1AUSL 5A6TC 1KFCA 4HN8A 1JDCA 4O4WA 5D9OA 1G69A 3GX9A 2O9OA 4V15A 3FEQA 2I5IA 2YOCA 4D72A 1ECEA 3QF0A 1GVEA 2ZZ7A 3E38A 3A64A 1XQKA 1K8YA 3IVUA 4MVAA 4PSRA 1TR1A 4EK7A 1GOOA 4MLRA 2HV5A 1CLKA 4MNKA 3SR7A 3HGSA 1YADA 4O0ZA 3RGTA 3QR1A 1JD7A 1T96A 2F84A 3R94A 3KHDA 3UXIA 5F1UA 2QCNA 9RUBA 4AIUA 4N4QA 1SR0A 3TQPA 3P6LA 1PE1A 3I3DA 4CD7A 3QR0A 2G3IA 1DVJA 5BWAA 5FEXA 2P1FA 4KCUA 1RVGA 4HTBA 3AZTA 3HG4A 1K7FA 3IRSA 1UHVA 5BOFA 3CC1A 3OPSA 4TVDA 3WJSA 3CL6A 3LI1A 2BTMA 2BXZA 1N7KA 3EKGA 3NVYB 4AW7A 4GG9A 4GXWA 5HWNA 3OBKA 3WZ0E 4FB7A 3VK5A 4QEEA 3W0KA 3SW6A 2Z1SA 2IS7A 1X39A 1SGJA 4GJ1A 4Z2LA 1KQZA 2JIEA 1Q65A 2PRMA 2Z7GA 4S3JA 3V1PA 1UUQA 3KWSA 3URQA 1WCGA 3A3WA 5SWUA 3KOZA 1VF8A 2G3NA 1D3HA 3EDFA 4IP7A 4IXHA 2A3BA 4AF0B 2QIWA 2ZRVA 2WNWA 3CV2A 4R7JA 4MG4A 2BY3A 3TUUA 2I17A 5JQ9A 4QISA 1T6MA 3WK3A 1H62A 3WQ4A 3SCQA 4DBDA 3R58A 4B91A 4HNVA 2HVOA 4QAWA 4AG0A 6XIAA 3E49A 1GQNA 5CPLA 1QI4A 2NQ9A 1PS9A 1JAKA 4L6OA 3VKKA 1W91A 4PMQA 5IDZA 3JZUA 4NX5A 2BXVA 2B4GA 3A9IA 3L65A 3XIMA 2I57A 4AFYA 5C55A 7ENLA 2C19A 2E6AA 5CC7A 2X1TA 1KC7A 1EOKA 4EQSA 4JTTA 3RO8A 1W9UA 1FWRA 3SURA 5HJXA 3W22A 4LV9A 2QUTA 2WKJA 1GQLA 3PBVA 2Y7GA 3ETRB 3ZQ9A 1TMHA 3R8HA 2ZOXA 3M0ZA 5HNRA 2VZSA 1JCXA 4INFA 3F4CA 4I5RA 4BEUA 1EBHA 1US0A 5LNSA 4F9JA 4XD5A 1LOQA 2YFNA 1MW2A 1Y5WA 3KBSA 3KW3A 1FHDA 1Q7QA 4M82A 2DV0A 1H1ZA 4RL3A 1V08A 1FFUC 2GOUA 4EE9A 4GGBA 2WOQA 3N25A 4HA4A 3VU2A 1R2TA 3M7SA 4OUEA 1E72M 4JD4A 1P7TB 4HBKA 2Z25A 1VBJA 3GG8A 1RP9A 1Z3NA 3ALFA 3VOCA 3KWXA 3RMJA 1QI5A 4Y8FA 3DYPA 4LW7A 1Y5XA 3WD1A 2H9AB 3VNYA 4A3QA 4H7VA 4E5TA 5I3HA 2C71A 2OYMA 3E9AA 5GJPA 2B7NA 2V5JA 3CUGA 2WLYA 5JCIA 2Z2BA 2EJAA 3VNIA 4OECA 1C8QA 1WO2A 4IWWA 4XZ9A 3UW6A 2ACSA 3SFWA 4I5XA 2BBFA 1K9DA 1CGXA 1B90A 1PZ1A 2VL4A 4IFKB 5BMWA 3UYIA 3MYOA 2FTPA 3LPOA 2A4AA 5FS8A 3TQ0A 4YNGA 3HFYA 1QDSA 2W27A 1QNSA 3MZNA 4FF5A 3EXSA 2MANA 2ZC1A 4FX6M 3SQLA 1ZSXA 3IJ9A 1X2GA 1SQ7A 3U5YA 4GFSA 4C1NA 3LA4A 2XU2A 2Y85A 3W84A 3E5BA 5I3IA 2FVKA 2EQ9A 1XPGA 4Y96A 3URAA 4WDTA 4GXMA 4NP7A 3W86A 4Y8EA 1E15A 5AN7A 1EGZA 2HROA 1JF5A 1V6XA 4HMCA 4FAMA 3FSTA 2ZXQA 1FDZA 3ARUA 1PYMA 5FA5A 3UR5A 1J8VA 2GR0A 4MY8A 5J8LA 1XYCA 4GC3A 3AMGA 2QULA 1JFHA 5REQB 5I77A 4I9AA 1L8PA 2CU0A 4GY1A 1ICQA 2VX7A 4LH8A 1VQZA 1QAPA 1FH8A 3PG6A 4JN8A 1Z32X 2PLMA 1OG0A 2Y7DA 1OC6A 4IH3A 3V18A 2WMIA 4A8IA 1R86A 2VI0A 1ZJHA 2XIJA 5DXXA 3MUZ1 3P84A 5K3VA 2Y63A 3WDQA 4FNQA 3AUOA 3WF3A 5H8UA 4R85A 3IC9A 2WC3A 1XCFA 5T9CE 2E4TA 2PS2A 3UT0A 5A6MA 4R9XA 1JDFA 3VKAA 1EF2A 3CH9A 1CWYA 1KWGA 2V3GA 3URBA 5EMYA 1RY0A 3HF3A 1B2YA 2GR1A 1EJRC 4LBUA 1YTKA 2PDIA 4J27A 4UTMA 4TTUA 2OEKA 1T40A 3WLPA 2H8ZA 3O63A 3GKAA 4XD4A 4HD5A 3EDEA 8CGTA 3N2MA 2QS8A 4O50A 1RK5A 3PZ9A 3CAQA 4MWAC 3UEQA 5FSDC 1H6VA 3FCPA 3P74A 3W24A 1UZDA 4EVZA 3CH0A 1BKSA 3NO3A 4UR8A 4NU7A 3F5KA 5BRQA 2PLJA 4K38A 3BCDA 2A1YA 3NFUA 3HG2A 1PKLA 4PR4A 5ECVA 4O19A 1OY0A 5AHLA 3WK0A 2XFRA 1W1TA 3W74A 5IHSA 5F2MA 3CUJA 4IIDA 1S5NA 2NV2A 4JX5A 4PMZA 3DFQA 3P81A 2E3TA 5EMMA 3B04A 3NA8A 5CPTA 4ZFCA 3QHOA 3AS3A 3EEZA 2PTDA 3W27A 3V0UA 1HJQA 4GUGA 2J7EA 4IJBA 3EWZA 2PWEA 3K8LA 3MKCA 4QDMA 3CWHA 1PL9A 4HNCA 4Z2GA 1JCMP 2OSWA 4APNA 5DEZA 2GR3A 3S2JA 1LPFA 1ZGDA 5HOSA 4ADTA 3AHXA 3TV8A 2YFOA 3C86A 2C13A 3DYMA 1H7WA 4H4WA 2PRHA 1ZCOA 1EJWC 1IF2A 6PTDA 3PN8A 3C2YA 3ZR6A 2CLPA 3T42A 3DGBA 1ZL1A 3TOPA 4B5UA 1G4SA 2B31A 1RPKA 4ZSUA 1R85A 1NWRA 5T9BG 4FNRA 3AS0A 4FXFA 4ICMA 2FHCA 1LRNA 1V0MA 3MPGA 5T91A 2OEMA 5HJLA 1M68A 4PSPA 3MUAA 3ARQA 4HMDA 1BEUA 4M7TA 4AY1A 3KBNA 5DELA 1GTEA 2OGYA 3LD5A 4NX0A 5IFPA 4NJIA 5FJIA 3N9KA 3ITTA 4X60A 1UWUA 1D3GA 3WQCA 2X05A 3PJUA 4I6KA 1SU5A 5L6UA 4A3HA 2GJXA 1TIWA 4IM4A 4I6VA 3ZT7A 3W07A 9XIMA 2PP1A 2D3NA 3DH7A 3QVQA 1UMLA 2YLLA 1HF6A 1POJA 4WUIA 3MUY1 3L21A 4IMCA 5EL1A 1S46A 1BVWA 1BYBA 2OR2A 1SFTA 1YE4A 6REQB 2PE4A 1HL2A 2BASA 4IT1A 3BMVA 3W88A 4B5VA 3TE9A 1PJ9A 5CAKA 4AD4A 1OVDA 4A6GA 2WHKA 3V36A 3GH7A 4R7WA 4ATLA 5CC5A 4US5D 2C6QA 4N9CA 4KESA 4XAFA 1XGEA 1H7OA 4DZ5A 1CGVA 3P8IA 4GQ0A 2W3SA 4CKQA 2QW5A 2YZRA 3BV4A 1XG4A 5HNUA 4TVYA 4OV4A 1PZ2A 4XD3A 2XM2A 5LSMA 5ABFA 4QFUA 3IPWA 3BMXA 3NXLA 2EHHA 3GRTA 5D32A 3SRHA 4CCDA 3PFRA 5DCDA 1JPIA 3NO1A 2OLAA 5D2XA 3GR7A 2X1SA 1AQHA 4K6AA 1XHGA 1HKWA 1CT5A 4D8LA 3MP3A 1VFSA 1ZHAA 4GI9A 2YL9A 2V2HA 2ZC8A 3GWQA 2IKIA 1MYRA 2R91A 4UTTA 1FWIC 3WNLA 1AL8A 3FJ6A 1YDOA 4ENLA 4MB1A 1EHNA 3U3HA 3LQGA 4WGHA 2BVYA 1VFLA 4KQNA 2FFCA 2WMKA 1TG7A 1QW9A 4JL2A 4O1DA 3VIMA 3K8MA 1EYWA 4QLJA 4RW5A 2BHZA 4ZQPA 3N13A 1C7TA 3GIPA 2X41A 2NXGA 5I3DA 4W7VA 3LSCA 4IFRA 4PUKA 2OZ0A 1JJKA 3OBEA 4GGHA 4JPGA 2XH4A 1N8FA 3DIPA 1NPXA 1IT0A 4O16A 4J9JA 4H9TA 3S1VA 3T08A 3WO8A 4PTXA 2ZRUA 4CLMA 2CFFA 3C2FA 4RV8A 1XLIA 1H7RA 2W79A 3SJNA 5K9CA 4FLOA 1O4UA 4ZA0A 1OCBA 4L7ZA 1GW9A 2C0AA 3N15A 3H4XA 4Y9AA 4AAJA 4Y7EA 1MXGA 1GYLA 4JIEA 3V5OA 3ZWTA 4AEOA 2DSKA 1HP4A 3MBFA 1GVIA 3N04A 1KM4A 2XIOA 5M17A 3RRAA 1V97A 1NFBA 2J77A 1J12A 3ENLA 4PEKA 3M64A 1OT1A 4S3DA 4FNSA 4QJ1A 3NQ7A 4JIHA 1ZPTA 5LIKX 3USBA 3VX1A 4DUWA 2VX4A 3AXHA 1Q66A 1E6NA 1H2JA 3W1LA 3QJAA 2CWNA 1TPB1 4U28A 1FCQA 2J79A 3BJFA 2Y62A 1XPYA 2E28A 3M47A 1XYMA 4QM1A 1XKJA 4LUYA 4N7QA 4Z2HA 4PB3A 3SQSA 5CC3A 3OLEA 3W38A 4NNAA 5HUOA 3V3WA 3FGCA 4RDWA 4Y9OA 5ABEA 3LBMA 6XIMA 3EANA 3V7PA 3DI0A 4C6DA 1QI0A 2R9RA 5AVHA 6CGTA 4YVVA 1OFDA 4C6BA 3DFYA 1S2UA 4J57A 4M6VA 2HBVA 3H8AA 2KX9A 2ONEA 4F2BA 3EA3A 3NQBA 2BVWA 3QFEA 4AZBA 2G50A 2HBXA 3CS2A 1Y8BA 4TMCA 4KGJA 1XYBA 2E7FA 3LGDA 4D8AA 4MMWA 4WY0A 2VENA 3BW4A 3R43A 4MKNA 1W3HA 3AYRA 4BWLA 4XUYA 4RK8A 3U2OA 3A22A 3G1AA 4WSJA 1BAGA 1F8WA 2A5HA 3NL2A 1N62C 1IZCA 3GVRA 4MFDA 6ENLA 3VCCA 2DZSA 4BURA 3WD2A 3NL3A 1UIPA 2YCKX 3LCLA 2XUCA 1HGYA 3TSDA 4UIOA 4I7WA 2F61A 3RLHA 4QITA 3C2VA 2PWGA 5A2BA 3QQ1A 8A3HA 1M5WA 5JXQA 2C14A 1XD1A 5JH1A 2FTYA 3G77A 3NZQA 3E0WA 1UA3A 1NDAA 1FH7A 2IKHA 5HQEA 4QAIA 2YCEA 4JKMA 3UR2A 3NSXA 5AC5A 3CJPA 5HAOA 1W56A 3HQPA 3ZJ8A 3IACA 4C7DA 2QUUA 3KZPA 4IHCA 1O94A 2ACUA 2O9RA 1DWJM 5EGRA 3EMCA 3VD7A 3MYPA 1KCZA 1XICA 4P8XA 3LERA 3LLFA 3CHCA 4QP0A 4HA1A 3HMJG 4S3FA 4ZOHB 2X0YA 1ZDLA 3HG3A 4HPJA 1AD1A 2Y88A 3GTIA 3UJSA 5KTLA 1EYEA 2XSAA 3HMCA 3GVWA 4I9MA 4QE1A 2WHMA 1KRMA 2HS6A 2F2HA 4EIVA 3FG2P 4JFWA 4O0KA 1C91A 1F05A 3TYAA 1OGSA 4GC4A 2WPGA 3ONCA 1OX4B 1F4HA 3F4DA 3TN4A 1FO4A 1QK2A 1BLIA 3VD9A 3NVZB 3FJLA 3H2CA 5ENLA 1CCWB 2O9PA 3C4UA 3PM6A 2QCHA 3P0XA 4GJJA 3EBVA 1E0WA 2QUNA 3SFKA 2CXGA 3VMOA 1UD6A 2GK1B 3K4AA 1XLHA 1A4MA 3W73A 4XZWA 3W02A 5C6MA 1JYVA 3RJYA 1V51A 3GSMA 4O54A 3PG8A 3QQ0A 3CMJA 4HJWA 4JNYA 3ZR4A 1FFRA 4L4MA 2JEPA 3GZAA 3K8KA 1XG3A 4JQ1A 2BB0A 3QM3A 4WD0A 1EP3A 2DZPA 3C8FA 1JQVA 1NELA 3S0CA 4HT3A 3ZO9A 2A21A 1CZ1A 4JHMA 2INZA 3UXDA 1GZ1A 5CC6A 2Y8VA 4CD4A 7XIMA 3HJEA 1NM9A 3WUFA 3SCPA 5FS6A 2HPMA 2YBTA 3RLGA 1OGBA 1EJ7L 4E8GA 3TU9A 3BUVA 3IUIA 3CQIA 3I7RA 1UOKA 1W1VA 1DJZA 2V30A 1B3OA 3JR2A 3RITA 3BAKA 4UTWC 2QEZA 1JUKA 3WNNA 3OIXA 1OINA 2WB5A 3HZ3A 3WF0A 3PF3A 3LHTA 1E9IA 1UG6A 2DSZA 2FPVA 3O6YX 1E3XA 1SPQA 3QZ6A 4S3CA 1OHLA 2C7FA 2X0SA 4DO5A 2Y70A 1WKDA 3AIBA 4WIWA 4LS2A 1VQTA 2NZLA 3UJRA 4HNNA 1ZBKA 4DI9A 4AZCB 4O14A 2G4FA 3E2SA 4ZB2A 4UOJA 1Q3NA 1D3CA 5C8BB 1BWCA 2C3DA 1VENA 1BWKA 1TRDA 4PFMA 3G1RA 2WVUA 3MO7A 2FZMA 5BYWA 3FS2A 3JZEA 4W7UA 5LGXA 1N63C 2QJHA 8TIMA 1REQB 1E4NA 3CPUA 2L5HA 4HHHA 1OZQA 4H9VA 5AYBA 1WXZA 1M03A 2GOKA 3NRZB 3PTQA 1XWYA 3EOEA 1CLXA 1C29A 3N17A 3AROA 4G1KA 1JF6A 1IEWA 4IMEA 5CGTA 4DJFC 2ODOA 3N4AA 1ZBVA 4Q22A 5F2GA 3A7RA 3QLDA 2AKMA 4DBWA 1UJPA 3VNJA 2FZ9A 4X2PA 2RDTA 5EU9A 3UZWA 4DRSA 4GQGA 1T7LA 4CVUA 3W37A 1A0EA 2D2GA 1H60A 5AYXA 3VZYA 1SZRA 1FWGC 1NIUA 1TJ0A 3WQEA 1QO5A 5ER0A 4HHLA 2GDUA 4DO6A 3TTOA 3M0XA 2YAUA 1TPUA 2ZX8A 3QV6A 3B0YA 4IL2A 2BG5A 2NUXA 4ZE4A 2WJZA 1EJVC 1MQRA 4K37A 2QF7A 4NJKA 2VRQA 3B40A 1V0NA 3KEHA 5CSYA 2PMQA 2QJJA 1YHTA 4Q4PA 3DU0A 1Q6FA 3Q94A 3UZZA 2DSWA 1P6CA 1CECA 1XRFA 1IR2A 5JCNA 3QYQA 2BNJA 2YXXA 3PG9A 1XDJA 2I56A 3POHA 2JALA 5HXMA 1ZY9A 3U8GA 1I2QA 4ICNA 2OX1A 1E6PA 3KTSA 2GGHA 4QCFA 1VRDA 4OE7A 2DZWA 3CHEA 2ADAA 4IXXA 3GG0A 1C8VA 3EOLA 4MFEA 4W8AA 5U7SA 3AMLA 1HT6A 3TR9A 3G1SA 5LHFA 4IFOA 2UZ9A 1S5MA 1BF6A 3P93A 1W3KA 4U3CA 1OK6A 1IE7C 4AHOA 1UC5A 3BICA 5AYZA 1LLZA 4G7EA 3URNA 2VP8A 2CXEA 3E3HA 4NJJA 4C60A 1QW7A 2NXHA 1I9CB 3IGXA 2OZ8A 3RM8A 4EXQA 4UTFA 4A21A 1DWHM 2EQDA 1O5KA 4TVUA 1JNDA 4WDUA 3GDKA 1L8NA 2X7VA 1CXFA 1VPYA 4XKMA 3T8LA 3OLDA 1RBAA 4BKNA 2PF0A 1QWGA 4EOUA 4M1RA 1TJRA 3O6AA 1UH4A 1WYIA 3OHIA 4H19A 1SSGA 1ONXA 2Z6JA 5FACA 2VVNA 2WSYA 1R9XA 4B3LA 4WHBA 4DY1A 2CBVA 4XKYB 3RDKA 4PCNA 1WUEA 3W75A 4O1BA 1RLCL 3W7CA 3GFXA 3I6TA 1FWSA 1JXJA 4CD6A 5ECUA 4Z1YA 5CLWA 1UKTA 4QE4A 2PURA 1WDPA 4ZTYA 3LX9A 1BRLB 1Q6LA 1HG3A 3VD5A 3NPXA 3V1HA 4LUJA 4C6NA 2JQXA 3R5EA 3UPBA 5C9WA 2CFYA 3UJFA 1JEZA 5A2CA 3LCFA 4L56A 1S2VA 4JN7A 2Q8ZA 2TMDA 3O07A 3WLLA 4AUBA 5J04A 3CQHA 4E4FA 1E9YB 3ARZA 3GW0A 3I3BA 4GQRA 3K30A 4JQ2A 2J78A 2NWRA 1V7YA 2HE5A 1JRBA 3QSRA 4QEHA 4AC7C 3BLOA 2HMCA 2DEPA 4RDVA 3EA2A 4H4TA 4TMBA 3M0IA 3SRFA 4GFIA 3YPIA 3HB9A 4H8UA 2GZXA 2VX6A 3QY7A 3UWYA 1ONWA 1RV8A 4U2YA 3WH7A 4TX8A 4C1KA 4EPBC 1VJIA 3KFTA 3M5YA 1NAL1 3SB0A 3NS1B 2G8ZA 3VNKA 3REQB 4LVFA 4GO8A 3TC6A 5F2IA 1OX5A 1W5OA 4F0RA 3ZR5A 3ZIZA 2VKZG 2E5DA 3NSNA 1DIKA 2Z27A 4LOCA 2C1HA 3UESA 3KLKA 3LXAA 4JKLA 2R9ZA 1SJDA 1YTDA 5DY3A 5IBXA 3G22A 4L6HA 1W1B1 3NYDA 3GAKA 1P6WA 3U7BA 4B3KA 1V0LA 1H09A 1XYLA 4EMIA 2YCLB 3ITOA 2ZXDA 3PC0A 1EUAA 4RNHA 4KETA 4ROQA 3DHFA 5IRPA 4LJ3A 1ML1A 1K6WA 1GVRA 3EOOA 5E6ZA 3UQNA 5D9PA 4AIOA 4ONVA 3F4NA 5E09A 3UGRA 4FLRA 3T2PA 5CAHA 2PPGA 5F4XA 1O66A 3LLDA 4ADWA 1KFLA 2FZDA 3BQ6A 2YYUA 2V2CA 3THQA 4U4MA 5C70A 1YXYA 1N5WC 4UCFA 4QHRA 3IEBA 4FXJA 4NEVA 3OODA 2E09A 3OG2A 2AAQA 1CI1A 3AU2A 1F3XA 1KTBA 4Q4KA 4J3TA 3BLKA 2OSXA 4GRSA 4JL1A 3LCXA 4H4SA 4N42A 1LP6A 4AF0A 2EPOA 2RUSA 1S1PA 4LCRA 3GDBA 2Z4GA 1TV4A 3WF2A 4JTHA 3WDRA 1KLYA 3IV3A 1ITXA 1K9FA 2X09A 4FMVA 4A2RA 4DELA 2X50A 5H2ZA 1NP0A 1NQKA 1I4NA 4PTDA 1MFVA 3WBWA 3ARVA 4YWOA 4W5UA 3FDKA 4MY9A 2OPJA 3RPTA 4HP5A 4WDXA 4HSOA 1Q6QA 1DHPA 4I5UA 3DBPA 1EUNA 2YDAA 3G0SA 2RGMA 3MHFA 1I0DA 1RALA 5G1MA 1TIMA 3S46A 4TXEA 1JCLA 2RH9A 3R07C 3WDHA 1GV4A 3W53A 2QCLA 4NZFA 1IEQA 1ME9A 4CNSA 2HWGA 1U1HA 3HPZA 3WK2A 3MSRA 3QMTA 4FHAA 5HJYA 1IWPA 3TN3A 1VAHA 5LYRA 1FFVC 4HMNA 3F5JA 3I7SA 5K4XA 1C90A 2Y7FA 3QZEA 3WEMA 1GXFA 1G1YA 1X6NA 4MIMA 3VKBA 3VUPA 3L4UA 4B2DD 1FWTA 2FVMA 1PXGA 2Q01A 3GZ3A 2W92A 1P7TA 1VBHA 3O06A 1ISXA 2O55A 2IW0A 1G01A 2E25A 3NQDA 1VFMA 4WJEA 4URIA 1H5VA 3UCCA 3WKZA 2BY2A 2JBMA 4J28A 3RX4A 2ZDRA 3NR0A 1Z89A 3GUWA 4H7CA 2R14A 1R3RA 4LS0A 2H9AA 4HSNA 5C0QA 4AD3A 3GC2A 3TN6A 2G37A 3TW7A 2CLOA 4MLJA 1Q6RA 1L9WA 1F9CA 1MDRA 3ERPA 4KGLA 4HCHA 4RLIA 3UR7A 4DWSA 2JGYA 3G1FA 3T0BA 4MWAB 4CGTA 1LBMA 4A2SA 2Z24A 5G5HB 2JGQA 4QCEA 3W9ZA 3H2AA 5BU6A 5HUPA 3HGRA 4XIMA 2CHOA 4IFKA 1C8XA 4XAZA 2W67A 5EPDA 1A5BA 1J9YA 4RPQA 1KRCC 1J4EA 5B80A 3CL8A 1VB9A 1V3MA 2WAGA 2ZWYA 4S3EA 1V6WA 3NOYA 4KBXA 3L68A 2VDGA 4UWMA 3LM7A 3H4KA 4AZHA 3ZMRA 1EDQA 2QYGA 4LQ1A 4LAMA 1L6FA 5A8OA 1KR1A 4JIQA 2OQYA 3W01A 4WQ6A 1YDYA 1C3FA 3CGDA 3A4JA 1OFBA 1OQFA 4LRTA 2OTDA 3XINA 4O4VA 2XVPA 4DJEA 1L6SA 2FB3A 2CZEA 3G3MA 4XUGA 1TV2A 4YU1A 5C9XA 1XL9A 3MJYA 4OBRA 3QTPA 2WVTA 3LHWA 2ZTKA 5C2XA 4XD6A 2GH5A 3OVPA 5FJJA 3ARTA 3DYOA 4C6PA 1KXQA 4JN6A 5REQA 4A8RA 3K46A 3THDA 2JFEX 4ADUA 1NEYA 1UR9A 5DANA 3KBWA 3FKKA 3EWCA 4ZXOA 4QSHA 1KXVA 1SSDA 3TJ4A 2VELA 4CQ9A 1P0KA 1EIXA 1D7KA 1IIGA 4Q7BA 1CEOA 3ZXWA 2Y2WA 2P5NA 4LC6A 3AIWA 2XPKA 1VEMA 1SZEA 1GOIA 4P8VA 2E9BA 4UTKA 3L23A 3RX3A 1BTMA 3VIIA 2X7WA 1N60C 3UR8A 1UH3A 4U10A 4KCVA 2HQMA 2XGZA 1JOAA 1ZLPA 5KINA 3PZVA 1W54A 4QG9A 1PIIA 2NLYA 2VR5A 3Q37A 4LB4A 2VFDA 2BDQA 2D0HA 4GCAA 1X8CA 2WPEA 4IPPA 1EC7A 4PMRA 1EJUC 5D8ZA 4NEWA 2EF9A 4M29A 2GLKA 4DJFD 3LXBA 3W7MA 1UWTA 2JKEA 4MPKA 1MDLA 1M6JA 6TAAA 3ZVIA 3GXTA 1NFGA 5EFFA 2GDQA 1UC4A 4KPRA 1RXOB 3H7RA 1R30A 3CLWA 2GQ9A 1A3WA 4LANA 3AU6A 4H2HA 3S6OA 2WM0A 1SMDA 1H0GA 1NTHA 3NPVA 3IVTA 2FTWA 3H2OA 1DJIA 1ECQA 3GDRA 1B4KA 3FYPA 1LM1A 4AYGA 2PGFA 1I2RA 4MUZA 3T40A 1DNCA 1XD0A 1QPNA 4B5WA 3GDTA 4MKSA 3DGZA 1VHCA 4F0LA 3BCJA 4X0VA 1HVQA 2E0PA 3QC3A 2NW0A 3HFTA 3E2VA 2OLHA 3PK7A 4CNOA 3ABQA 3STPA 3NQGA 1J0ZA 4PB5A 3SUWA 5FL0A 4EMJA 1C9DA 2DW7A 3ISIX 3G1VA 3C3NA 3MDWA 2QPUA 3LHYA 1BWLA 2WO5A 1I45A 3R6IA 2LLEA 5BZAA 3FYOA 4NIRA 4XZIA 4GIEA 1XIIA 4JQ4A 2V3EA 1BXNA 5FAJA 1TO3A 2WVSA 2YA0A 2OFJA 2XZ7A 4AIBA 4CEUC 3DI1A 5FEPA 3PJWA 2GUBA 2XFWA 4LCQA 4UC5A 1RCXB 4DZIA 2HNHA 2EPKX 1D7FA 1H61A 2V5DA 4H9XA 3BGGA 4HTYA 2CLKA 4GBUA 4KF1A 3I10A 4Z08A 2VT0A 3O0FA 3LYEA 2VC6A 5CG0A 2GQ3A 1HO4A 3EWWA 2J47A 4GZIA 2GQ8A 4JCLA 4H6EA 2GJRA 3ZT6A 4TTGA 4LBRA 4JY9A 1DL3A 2BXYA 2HISA 2GSEA 4KFPA 4NAEB 2FGBA 3KE0A 4PL2A 1K3UA 1UH2A 4DJDA 5D04C 2ZE3A 1XM3A 4LF1A 3TA6A 4MDPA 1A47A 3JU2A 3DHPA 3TQVA 5CCZA 2H3BA 2ZA3A 3TFXA 1W0MA 4XO7A 2AKZA 3BZGA 4GACA 3W1NA 1B1YA 1T3QC 1DJXA 1DP0A 1WOBA 4LALA 3S2LA 4TVWA 2MUCA 3PB0A 1KM2A 2FKPA 3LGGA 1LWJA 3VGGA 2G0WA 4IJCA 1A53A 4OOZA 6REQA 2VWTA 1N61C 3MKVA 3M5VA 2QAEA 3EEGA 3O3RA 5DRCA 3LG3A 4TQTA 1WUFA 4FS9A 2C18A 3AWOA 1M04A 2HXUA 5F1VA 3CGEA 5A8PA 2QAPA 4PN2A 3I6EA 4UQBA 1Q7MA 4GUIA 1LLWA 4JDBA 4LX4A 5JIWA 3WQ8A 3IK4A 3R1ZA 1BYDA 2QCGA 1NY1A 4I7UA 1DTUA 1H7NA 1RCQA 1GZGA 3QY8A 2WWDA 4JZ5A 4XG1A 3KCLA 1GRBA 3B9OA 2PTZA 1WKFA 4QSFA 3FNDA 3EF6A 2XVNA 2J27A 2DT0A 2Q6ZA 1G9HA 3DCPA 4UZSA 3RILA 4B92A 4E4UA 3II4A 1HTIA 4WGXA 1QFEA 2PDUA 2PGEA 2Z6IA 3W82A 2NUYA 4IL0A 3TJXA 4CQDA 2BC0A 3L0GA 4LC8A 3RYSA 4J5NA 1KFBA 1GVOA 5EMUA 1JFXA 1LL7A 1Q6EA 4JTGA 3WQVA 2C0HA 4IG2A 3B97A 3B3DA 3TP4A 3TZNA 3TXVA 3VMNA 2KZHA 5FL1A 1PCWA 4Z1CA 3XISA 2VD8A 1AOGA 3CBWA 2EEXA 2PZNA 1GK8A 1GJWA 1K9TA 1S38A 5K9XA 3WNMA 4W84A 2A8XA 1EWDA 1YQ2A 3WFZA 1Z44A 1OF8A 5HWJA 1HVXA 3SRDA 1J0KA 4DNMA 2J75A 3BJTA 4M6UA 3MHGA 1TX2A 1R2SA 3N11A 3CXOA 4DI8A 1M1BA 5AC8A 3R0KA 3TTEA 2GWNA 3CUHA 1ZAHA 1QXLA 4TV6A 1KM5A 3BV7A 9CGTA 2OO6A 3ARPA 3PWAA 2YW3A 4L9XA 2OSYA 2TPSA 1QCWA 3UZYA 2BOGX 3C61A 3RU8X 2UBPC 1V93A 4L4PA 4A8NA 5FESA 2WYSA 1FQ0A 4IICA 3W70A 3TQKA 4WY0F 3SCOA 1XBXA 5E9AA 2QQ6A 4GX8A 5CH9A 3T55A 3A7AA 4QLLA 3JS3A 2DW6A 2DQXA 2W55A 2Q09A 2BHUA 5DMMA 5A8QA 3M4HA 2FGLA 2OCZA 4DNHA 2TAAA 4HA0A 1K6AA 4LBSA 3L5MA 1AVAA 2WZTA 4IMAA 3PWGA 1X97A 1FA2A 4JHZA 3GQYA 2GGIA 3OYZA 4W86A 1GHSA 3EWYA 3H7VA 3L4ZA 2WVVB 3VZXA 1HKKA 4JQAA 1GG1A 1AW2A 1J18A 1YKWA 4YTTA 3MSGA 3UP8A 2DZAA 5JVLA 4MPQA 5BOOA 3LQLA 4ORIA 1Q6DA 2WCSA 3II1A 1WBJA 3QW3A 4ADSA 3GXMA 2J74A 3VOFA 1M6IA 3SCNA 5HANA 3EXRA 5I2UA 5C5YA 5CG7A 4UBPC 3OZYA 4NYYA 2AAMA 5A6SA 1AH0A 3GS6A 2CLLA 2XWEA 5I00A 1D8WA 2QPXA 1XH0A 1LORA 1W17A 1XLDA 3RPMA 2VGGA 4LYRA 3HG5A 3DFSA 4FNUA 2DVUA 4HPXA 1W9DM 3VX0A 3Q6JA 2BGNE 2QDDA 4HZMA 1LT8A 4U5IA 5LNRA 1W6TA 4Q4RA 4O13A 4C6QA 3NDYA 2CKSA 2QCDB 2VTFA 4K36A 4M6QA 1SO6A 1IR1A 3TYZA 4N2YA 3STFA 3KHJA 1UASA 1QJWA 1S7MA 4JAWA 2DPEA 2J9YA 4RJEA 7ODCA 4MTVA 2VD9A 5B7ZA 2YCIX 4K8GA 1AMKA 4ZQOA 4BF5A 1F6PA 3CT7A 1CYGA 3LTPA 3TOYA 1XDMA 3CB3A 3IJDA 3B0XA 4R27A 1NDWA 3H2FA 2DH3A 1SO5A 3T07A 3WYZA 1DYSA 3T05A 3VCRA 3BAJA 2ISFA 1XLBA 1F3PA 1WXYA 2E8ZA 1Y5VA 4H4QA 1E6XM 2Y8KA 1CXEA 1GJUA 4IGNA 1PBGA 1K70A 4C6KA 3D3AA 1U5JA 1ISVA 1R3SA 4PCPA 2X2GA 2DH2A 3CHDA 5EA9A 4DIAA 1YIXA 1YXCA 2GVLA 1ZY8A 1Z9AA 2V3FA 3MC5A 4AIEA 4YWSA 2G3JA 4JX6A 1NARA 1KCLA 4ATWA 3H23A 2A3EA 3VA8A 5FCZA 4UNIA 3GTHA 2R82A 3TW6A 3F5LA 3A5FA 1EO5A 3G6LA 4G8TA 4OV9A 4ZOAA 4K2SA 1GESA 1NDYA 4LAZA 3NVWB 4N6EA 3VUSA 2VFEA 4OIFA 1PDYA 2O56A 1OJTA 3FYYA 4RKAA 1D7YA 3T0TA 4YL2A 2CYGA 3KP0A 4ZMGA 4C6LA 2P50A 1S2CA 1GWJA 3RX2A 4BQ5A 5DMLA 3ZVHB 2DUAA 1OX4A 5CPSA 1EX5A 4JBRA 1LTDA 3ZJ6A 4UMBA 3R13A 2NPXA 3WLOA 1CW2A 4FR1A 3NQAA 4Z1AA 2X8CA 3P62A 3EAUA 4U31A 3I65A 5KITA 2GK1A 3L2MA 2VOTA 1H1YA 2VX5A 2Z00A 4WSHA 1AW5A 1EZ2A 4DM2A 5C7VA 4GNJA 4JCMA 3LB8A 3RHGA 5LXXA 3GNDA 3MU7A 2Y7EA 5CSSA 3R7MA 2XFFA 1ZK7A 5EBKA 3C2RA 2JF6A 3RCMA 2VDIA 3WQDA 1ADOA 3P5YA 4XO6A 2VJXA 1GREA 5D05A 3VOHA 4S3AA 2XH2A 3BGAA 1IIHA 1B5TA 4Z1DA 3T44A 4D1JA 3LENA 1QHZA 3S4TA 1F7BA 3U57A 1ODZA