2GGEA

Crystal structure of mandelate racemase/muconate lactonizing enzyme from bacillus subtilis complexed with mg++ at 1.8 a
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
373
structure length
373
Chain Sequence
LVKIVRIETFPLFHRLEKPYGDANGFKRYRTCYLIRIITESGIDGWGECVDWLPALHVGFTKRIIPFLLGKQAGSRLSLVRTIQKWHQRAASAVSMALTEIAAKAADCSVCELWGGRYREEIPVYASFQSYSDSPQWISRSVSNVEAQLKKGFEQIKVKIGGTSFKEDVRHINALQHTAGSSITMILDANQSYDAAAAFKWERYFSEWTNIGWLEEPLPFDQPQDYAMLRSRLSVPVAGGENMKGPAQYVPLLSQRCLDIIQPDVMHVNGIDEFRDCLQLARYFGVRASAHAYDGSLSRLYALFAQACLPPWSKMKNDHIEPIEWDVMENPFTDLVSLQPSKGMVHIPKGKGIGTEINMEIVNRYKWDGSAYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords yitF
publication title Crystal Structure of Mandelate Racemase/Muconate Lactonizing Enzyme from Bacillus Subtilis complexed with MG++ at 1.8 A
rcsb
source organism Bacillus subtilis
total genus 128
structure length 373
sequence length 373
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 2ggeA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 2ggeA01
2PA6A 1OEPA 3QN3A 4GGBA 4HCLA 1JPDX 2OVLA 3BSMA 3Q4DA 3BJSA 2MNRA 3I6EA 5FJOA 4EWJA 3PK7A 3N4FA 3UJSA 1BKHA 4E5TA 3QPEA 1JPMA 3OPSA 2PS2A 4HNCA 1P48A 2XSXA 3VFCA 3BOXA 4DHGA 1EBGA 3R0KA 3UJFA 4H19A 2P8BA 4FI4A 2XH2A 2DW6A 2AL2B 3MWCA 3VCNA 3UCCA 3ES8A 3IJQA 1ONEA 3N4EA 4DXKA 1R0MA 3SSZA 1P43A 1ELSA 3SQSA 1DTNA 2PPGA 4GMEA 2QDDA 4J3ZA 4HN8A 3H12A 3ZLHA 6ENLA 3N6HA 2I5QA 2PTYA 3RCYA 4E4UA 3I6TA 3TW9A 2DW7A 3I4KA 3RITA 2P0IA 3CYJA 3U9IA 5BOEA 3CAWA 1MDRA 4Z17A 3T4WA 4KWSA 3DEQA 3H7VA 3PWIA 2QGYA 2PODA 5J04A 5EU9A 5FJPA 3VC5A 3T9PA 2OPJA 2PU0A 3P93A 2PU1A 3EEZA 3FJ4A 4K8GA 2PP3A 4HCDA 4F4RA 1TZZA 1BQGA 2XH4A 1IYXA 4MKSA 4IT1A 4ENLA 3RR1A 2P8CA 4J1OA 3K1GA 3FCPA 3SN1A 4A35A 2AL1A 2GGHA 3CK5A 1EC7A 3UXLA 3FVDA 2OZ3A 3VA8A 2HNEA 3D46A 2QJJA 3GD6A 3DFYA 4E6MA 4MGGA 3QLDA 3OZYA 3CXOA 3R1ZA 4IHCA 2PGEA 1EBHA 4H83A 1WUFA 3DDMA 4KPLA 3Q45A 1KD0A 3R11A 3VDGA 2QQ6A 2PTZA 4GYPA 4HPNA 2ONEA 3MQTA 2HXUA 1F9CA 3OTRA 5FJTA 4JN8A 3TJ4A 3DGBA 4DN1A 4IP4A 5IDZA 4FP1A 3CB3A 4E8GA 2PCEA 2GGIA 3TOYA 3DERA 2XGZA 2GL5A 4A3RA 3V5CA 4H1ZA 2AL2A 1YEYA 3MKCA 3R25A 1L8PA 3FYYA 3VC6A 2QJNA 3UCDA 4YWSA 1E9IA 3V3WA 3ENLA 3MSYA 4GYPC 7ENLA 3STPA 5FJUA 4HCHA 4DYEA 3CT2A 3DESA 3SBFA 2FYMA 3UXKA 3UGVA 4GFIA 3DIPA 3NFUA 4M6UA 1TKKA 3UJ2A 3RRAA 3DFHA 3H70A 3IJLA 1WUEA 4ZA0A 4H2HA 2QDEA 1SJBA 2XH7A 3EKGA 3VCCA 1XS2A 3IK4A 1NU5A 1TE6A 3N6JA 1ECQA 3TQPA 1SJDA 2O56A 2PTXA 3U4FA 3NO1A 4E4FA 4KEMA 3D47A 2FKPA 4MMWA 3ES7A 1FHUA 4DWDA 2PTWA 2P88A 2OZTA 2PMQA 3GO2A 3SN4A 3FV9A 4Z1YA 2GGGA 3TCSA 2OFJA 4HYRA 2GGJA 1R6WA 3FXGA 4IP5A 3T6CA 1PDZA 3KUMA 1FHVA 2XH0A 2GDQA 1KCZA 2OLAA 3V5FA 4DX3A 4HNLA 3S5SA 4A6GA 4G8TA 2HXTA 4K1WA 3JZUA 3V4BA 2HZGA 3TWAA 3H8AA 4M0XA 3QTPA 4G7FA 3R0UA 3ZVIA 2OZ8A 3NXLA 3HPFA 4JN7A 3OP2A 1KKRA 1NELA 3S47A 3JVAA 1KKOA 3P3BA 3QKEA 2GGEA 3PWGA 3OZMA 4GGHA 2MUCA 2PP0A 2ZADA 1MDLA 2OX4A 4IZGA 2QVHA 1W6TA 4IL2A 4K2SA 3OW1A 4X2PA 3RGTA 4KT2A 1RVKA 3ZVHB 1MRAA 1SJCA 2NQLA 2QJMA 1SJAA 3B97A 3SN0A 4ROPA 1XPYA 4GIRA 1EC9A 3ZLGA 2PSNA 3DG7A 5BOFA 1PDYA 4ZCWA 3SJNA 3T8QA 2ZC8A 1MUCA 3TTEA 5ENLA 3NZGA 4GISA 2OQHA 2PP1A 4JHMA 2AKMA 3ZVHA 1JCTA 2RDXA 1MNSA 3P0WA 1JDFA 2CHRA 3THUA 5FJRA 3ZLFA 4IL0A 3DG6A 2GSHA 3RO6A 3TWBA 3MUCA 2PGWA 2OG9A 3DG3A 3GY1A 3UJEA 3R10A 3PFRA 3MY9A 3UJRA 2POZA 3JW7A 3TJIA 2OO6A 3IJIA 3GC2A 2OQYA 2P3ZA 2OKTA 3MZNA 2AKZA 1EC8A
chains in the Genus database with same CATH superfamily
4MKNA 1RLCL 2PDQA 1S38A 1OFRA 3W7MA 2B7OA 2YCEA 1PCKA 2Y8KA 1A49A 2VGFA 3I6EA 5D04C 3LUTA 3BG3A 2V38A 3PTDA 5J5RA 1V3LA 3M1ZA 1Q85A 4UXDA 2C14A 4IFRA 3WUEA 1GESA 2CU0A 3SJ3A 2NPXA 2PDIA 1UH4A 5HPCA 2XH2A 2V2CA 2XFFA 2WPCA 2Z2UA 1KRAC 2DW6A 1HO1A 2BV9A 3OQEA 1WXJA 2YDQA 4YTRA 1XLKA 1XYBA 3H23A 1ONEA 3KOWA 3REQA 1VFTA 4W7WA 1R0MA 4O19A 4DJED 1P43A 2D1ZA 4MWAE 3ZJ6A 5MHBA 6XIAA 4DI8A 5CGTA 3ZOAA 4C91A 4ZO9A 1KRCC 2XM1A 4CNOA 1UG6A 4MB1A 2ZRWA 3B8IA 2UBPC 3KBWA 1MW1A 1Y65A 5AYYA 4FLRA 4XB3A 4K38A 2ZZCA 1R85A 1S46A 1W3KA 1W1A1 2J79A 3CQJA 3OLDA 3ZR4A 1XR2A 3CUFA 4Q8UA 4PYSA 2JEQA 4M82A 3EF6A 3ZJKA 2GVEA 3L21A 1X1NA 3CYJA 3TNOA 5EMUA 1EJ7L 5EBAA 4BZYA 3FG2P 2WOWA 5DELA 1VLWA 2WWCA 4C7GA 1U2YA 2NVAA 3K46A 4EK7A 2CITA 1HXJA 1BVZA 3N9RA 4GI4A 3PB0A 3FJ4A 4UQDA 3TFXA 1XL9A 4F4RA 3C56A 3N12A 4GUJA 5CZTA 4H9YA 4IMEA 1RQHA 2QCDA 3GC5A 1SR0A 3KRSA 3BO9A 3N9KA 4CQCA 4WVXA 2CKSA 1LLZA 2GGHA 2QV4A 2YA1A 1QNRA 1BRLB 4JX6A 1C8VA 3WNNA 2NQ9A 1GNXA 1J10A 5G2IA 2BOFX 2QJGA 4EANA 2WZTA 1Q63A 3IK2A 4GOAA 1AVAA 4BI7A 3W7EA 3URQA 3KCLA 1WE5A 2ALRA 3DBPA 3EWDA 3VNJA 4A29A 2YW4A 4NRSA 4F0KA 1XDIA 3BAWA 5T9BG 4HPNA 1TVLA 1XRVA 2J25A 3IRDA 3EOEA 4MYAA 3AUJA 5A3HA 2QKFA 3FFSA 3WEZA 1Q6DA 1UUOA 4H6KA 1CX9A 2Y85A 1E3XA 1C7TA 3RPDA 2YBUA 1TYTA 3VK5A 3MV01 4M29A 4HD5A 3RUBL 3VM7A 3SCTA 2ZWZA 3IIVA 1B4EA 3PWAA 2GL5A 3GDLA 3W7CA 1GW9A 1W31A 2FHBA 1H6VA 2XWDA 5CCZA 4P8XA 4Q4RA 4JNMA 6TAAA 2QJNA 1FWFC 2PD9A 2E3ZA 1MXSA 4UR9A 3MSYA 4GY7A 5KSWA 4RZ4A 3CUJA 1QOXA 3CMGA 1N55A 1LF1A 4FNSA 1EL3A 2PDHA 2ZUTA 1HKVA 3CLMA 2PC8A 2JGQA 1EUAA 3DYPA 3EKLA 4MZ8A 5HJYA 5D9PA 3EA3A 4Z2JA 1H7XA 2VWSA 4NF7A 5D03A 3B0VC 1T6MA 5CAHA 1BKSA 2NX9A 1SMDA 1BFNA 3MHUA 4N0RA 1ME8A 3BDKA 2W4XA 1RK5A 4RDWA 4GZ7A 1ZAJA 3QR1A 1JYWA 3AALA 1GOQA 1LZOA 2A2IA 5K9XA 2VR5A 4OBRA 2WBKA 2OR2A 1XLJA 5TD4A 1A5AA 4QITA 3QGVA 1QPQA 3TEVA 3O6AA 3TCSA 1YXDA 1NVMA 3H54A 5JH2A 3MYOA 2J7DA 3RPTA 3AUOA 4B3KA 1A50A 3T81A 4YWIA 4GK8A 1U5JA 2ACUA 2XGIA 1PZ2A 4RZBA 4HNLA 2F8QA 1BG9A 3THDA 3NGJA 1OFEA 3T1GA 3QZAA 8RUCA 3V0TA 4XV0A 2H9AB 4HA4A 4HPJA 1WYGA 4D6HA 2CHOA 2OZ8A 1H50A 1VKFA 4UZUA 4XTIA 3I10A 3DH9A 1M03A 1WBHA 2C0AA 4KRTA 1A4LA 2DJLA 1LJYA 2PFHA 4EF8A 4MPKA 2TRSA 4XIMA 2PP0A 3TK7A 4PTNA 5BXPA 3ALFA 4IUOA 4KGJA 3SY1A 3P61A 2QVHA 2W63A 3HG4A 1BWLA 1QPRA 2I9UA 1H62A 3FA5A 3UPBA 4DBWA 1EZ2A 3MP4A 3IGHX 4NYYA 1XLBA 2WVSA 3GFZA 3CHDA 1AH4A 5AECA 4HZ7A 1G01A 1GPWA 2FDMA 4TO8A 2XN1A 5HQLA 3JUGA 3WL1A 3B8TA 3XIMA 1VBUA 2L5HA 4HNNA 1I2OA 3LSBA 4CNUA 3LZ3A 2V82A 3VNLA 2OYMA 1FWWA 3S2CA 2ZCGA 1YIXA 4IPNB 2YB4A 5LNRA 4X63A 1N8IA 3KEHA 1G1YA 4PULA 4JNZA 1VLIA 3WQOA 3FGCB 3R8HA 5EBKA 5M5DA 5E0KA 3TQKA 3C2RA 2GSHA 3SRHA 4L80A 2WM0A 1O5RA 3MUCA 3R79A 3GY1A 3HW2A 2BHYA 3VDBA 2CLOA 2WVTA 5KETA 3WDJA 3MI3A 1CENA 4DZIA 4CVUA 4ZOAA 4HZ8A 4DPQA 1ZJHA 3QF0A 1REQA 2OQYA 4I9AA 1K9TA 4K36A 3TN5A 3WY1A 3BSMA 1QNPA 1UR9A 5FJOA 1P0KA 2ZE3A 3H24A 4E8DA 4R7WA 3K4DA 4UUIA 3KWSA 4UFMA 4E2VA 1JXJA 1FO4A 2PWEA 3W1TA 3OPSA 3UGRA 2PS2A 1FP8A 1E71M 1P48A 1ZENA 4GI6A 4PUDA 5HPOA 4J5NA 3CUZA 4OJYA 4E4PA 4J3TA 1TELA 3ITCA 3EMZA 4ZB0A 2X0SA 2WWDA 1DJXA 3VNZA 1JEZA 2DZTA 4AG0A 1YNYA 3ES8A 2VX5A 2NX1A 1Q7MA 3WD2A 1K03A 4DXKA 2CESA 1AL7A 1VB9A 1KW1A 1OVDA 1R9ZA 1WV2A 1H7RA 5M1TA 2Y7GA 1YW1A 3W76A 4M8UA 1Y0EA 2X8HA 4EX4A 1RBAA 4QNEA 2BLEA 5JUVA 3WUBA 1TV2A 4FIQA 2PBOA 2DZSA 5C7HA 4BQ3A 1ZFJA 3L4VA 3M0XA 1ZS2A 3NL3A 2OJPA 3OIXA 1IXNA 2DW7A 5CLWA 3AIQA 3W75A 3SGZA 1W2VA 3M46A 1CIUA 4WCJA 2HDJA 5BOEA 2EJ1A 1W1VA 5J04A 5FJPA 3LCWA 3W2LA 3L5MA 4Y9AA 3H4GA 2A6NA 3PZ9A 3FW6A 3PPFA 3MWAA 5A1AA 2QS8A 3WDRA 4GHRA 1D3HA 2Y63A 3RM4A 4YVVA 2J47A 4GZEA 3EUB3 3TP4A 1ONXA 1CPUA 1YTKA 3LRMA 4OHQA 1OX4B 1G69A 1ZU8A 2P3EA 3SGUA 1PUDA 3K8LA 3WH9A 1R3QA 4PCFA 3B05A 3RLGA 1EIBA 4UTTA 1T41A 1UYQA 3SM0A 3M44A 1Q65A 2VEGA 3G1VA 1Q4NX 3T09A 4C1NA 3HV9A 1XSKA 4EM4A 4HMNA 3AIEA 3IGXA 3QQWA 1UC4A 2Z2BA 1BPLB 1KTBA 3AROA 2O92A 5KVIA 5FF3A 1HZYA 4B3LA 5K4ZA 2KX9A 4J57A 4UQAA 5E70A 3TC6A 1HIZA 2ZXQA 1RXOB 4B5TA 4GINA 1XANA 2BY2A 1Z48A 2VFDA 1WKEA 3W27A 3GUGA 4C1KA 3VOHA 2RAGA 1JDCA 3TOYA 1AJ0A 3M0YA 1EWDA 4M6PA 2RUSA 2J8TA 2ZUVA 4PE8A 3V5CA 4DRSA 1GVSA 2Y70A 2B81A 1XV8A 1I2QA 5C70A 4H1ZA 5CEWA 2E5CA 3M0KA 3MKCA 4Z2KA 4FHAA 3W26A 4KFNA 3N1AA 4GXPA 2VVNA 1JXKA 3U2OA 1MEHA 4OGZA 2QCLA 2PDLA 4DO7A 3RF9A 3TDFA 2DVUA 3FLUA 3IRSA 4AMAA 4TU1A 2P5NA 3UJ2A 3LDVA 5DY2A 2X8GA 1E4NA 1US3A 3BK0A 4MZ1A 1V0KA 3WJSA 1FCUA 4QAIA 3FEQA 4HPGA 3T0AA 3WF4A 3NCOA 4PMZA 2V0TA 4GC4A 4YTQA 4WDUA 1XCFA 1C7SA 1UP3A 1GEHA 3LCIA 4B91A 3BJFA 2V6OA 1H3GA 3LI0A 6TIMA 1E1FA 2OFJA 3L7RA 3VDAA 4UTFA 1SSGA 2WPBA 3EDEA 3B9OA 4HHMA 4W84A 1I4NA 4WY0F 3S46A 4H4IA 1JZ3A 4LC6A 3T8LA 3EX4A 3PZIA 4P8WA 4XSMA 3ZT7A 3ZYZA 1SO5A 2HZGA 2E1DA 4Y9PA 4CNNA 1Z42A 4JL1A 3KZPA 3S3GA 1TPUA 4OECA 3WLSA 4GQQA 2WJZA 2J6XA 3ZSTA 4J2MA 1W5NA 1RP9A 1ZZMA 3PANA 5DCBA 2E5AA 1HKJA 1KFWA 4D72A 1KM6A 4IMDA 4GVIA 3VZYA 5HWJA 5KZEA 3CUXA 3H2EA 4WXYA 4NT0A 1VJZA 4AXNA 2C18A 2QUMA 3AMDA 2NV9A 3GVGA 2H8XA 2BG5A 5H8PA 5DMMA 3KW3A 2J27A 1G5AA 5C0QA 1O5XA 1XIFA 2YGYA 3DHFA 5CSUA 2INEA 1RBLA 2H90A 4TX9A 1JQXA 1WKDA 2NQLA 1V03A 4JS3A 1H2JA 4ZR8A 5CBIA 4NEVA 1B4KA 2QCHA 3HB9A 4M7TA 3LQLA 3UR5A 2XN2A 4GUIA 3ZLGA 3Q94A 5E93A 4ZCWA 4NI8A 3O05A 2QPXA 4JTAA 2GK1B 2PE4A 4MB5A 1R86A 4ML9A 2GVJA 4OU1A 4PUWA 4QHRA 4CQ9A 1H11A 1RP8A 2WC4A 2GJXB 1AK5A 4LBSA 1TPB1 4O13A 4LBRA 5E1QA 4JIIX 1CZ1A 3DG6A 5A5WA 2BVTA 4D1IA 2O9TA 1C90A 2WK2A 2I56A 3U57A 1ECEA 1E0WA 3V7PA 1A0CA 4D6EA 3LB8A 4XX6A 4B4FA 4L6HA 4N42A 3H4WA 2POZA 4QJ5B 1WYIA 3WD1A 3NWRA 4C6EA 1MSSA 3AHZA 4NI3A 4HJWA 2AQVA 4N9CA 1O60A 1IEIA 3ONBA 1TKKA 1OFAA 4EQSA 4CCCA 4LCQA 4LUTA 4US5A 5BWAA 2VRQA 3GVRA 3OA3A 3CM4A 4FALA 6ALDA 4UFIA 3HGRA 2J7EA 3HIJA 3XINA 3LK6A 3PK7A 9RUBA 5HQEA 1FEAA 4I7UA 4DUOA 3BLPX 2X1IA 4ERIA 5M03A 5EGRA 4X22A 3RU8X 3WLQA 5A6KA 4H4WA 3N3TA 3UR2A 4NHVA 3ZJ7A 3LGEA 1E40A 5ABFA 1FKXA 5I6SA 1DJHA 3IC9A 2Y61A 3U4AA 3V36A 3WJYA 3ARPA 3N4EA 1XQLA 1O1ZA 3FOKA 2F9RA 4I7WA 4J27A 1HKKA 5HULA 3OBAA 2C1HA 5E09A 1OT2A 1W8GA 2OGJA 1JF5A 1K9DA 4TOQA 1R9XA 3P67A 3DYMA 3OVQA 1BTCA 1ADSA 3D0CA 3CUHA 2PDXA 4P2VA 2BVDA 4MIMA 3RCYA 4Y90A 5I0DA 3CV1A 1Q6OA 3A5FA 5L6UA 3V5OA 2J75A 2W27A 3ZXWA 3RX2A 3PTKA 3I4KA 3P14A 4NJJA 4GQGA 3TN6A 1UD5A 3NQBA 4UTWA 2QDGA 2FZ9A 1E6NA 1KGXA 1MZRA 4H4PA 3EYPA 2C19A 1MZHA 3S9IA 1VZWA 3NSXA 1KFBA 5F4XA 2Q02A 2RJGA 3E6EA 1PE1A 4HHPA 3VC5A 3VOGA 1E1CA 2ISWA 2XG9A 2E9BA 4PUUA 1X6UA 2CKRA 5HWMA 1GQLA 3T0BA 3WBAA 1NHPA 2V30A 4MWAA 4IFKA 3WLOA 3IJDA 3WEOA 4QS5A 3HZ3A 4AISA 3SN1A 2HNHA 3DH7A 3W1LA 3W1XA 3T05A 4FIRA 5ABEA 1F7BA 3I3EA 2OZ3A 4E38A 4MJ4A 1Z3NA 3T08A 3N15A 2VZTA 3D46A 2BY3A 4D2JA 1TTPA 3PTQA 4DLFA 1R3YA 5IBXA 4F0SA 3AHTA 1QNOA 3WD3A 3W29A 3VX0A 5I2UA 2WVVB 2V3DA 5IFPA 3MMTA 3O6CA 2NQ5A 3WJZA 3GU1A 3GSMA 1SQ7A 3BG5A 4O8AA 3GD4A 1I0DA 1AODA 1QDSA 1QR7A 3S1GA 2PCQA 3ID7A 2GJRA 4OV4A 4OKDA 2D2GA 2PRLA 4H9MA 4N6FA 3M6YA 1GKQA 4Q4QA 4G9PA 4QR6A 2JIEA 4IMCA 2W9MA 4DJDC 8XIAA 2FH8A 4E8GA 2PCEA 3GZAA 4M52A 3N3MA 2NWRA 4AZ5A 4DBUA 4ERAA 4PMOA 4D6CA 4I3GA 2IQ0A 3T0CA 3CMFA 2V3EA 1TIMA 1QHOA 3BH4A 4XKMA 3W1MA 1TQJA 2ZRYA 4ATWA 1RPKA 3W2KA 1ISZA 2ZOXA 4J3UA 2C8NA 2XVPA 5T9CE 1US0A 1SZEA 2HPMA 1A0EA 4DAFA 3ENLA 2JKEA 2R94A 2YIHA 4AD1A 1S5MA 4RW5A 3STPA 4IQDA 4W9TA 1NEYA 3NIYA 5BCAA 1W54A 2P76A 4AMCA 2WQPA 1I9CB 4DZ5A 4L6OA 1VRDA 3TN3A 1VH7A 5CH9A 3M64A 5TBOA 3K8MA 3LNPA 3DFHA 3UF9A 4RE0A 2OLHA 1UR4A 2C1GA 2JKAA 3DOPA 3BTNA 1X1OA 3NZRA 2BHUA 4B90A 1QW9A 3MKKA 3S0CA 4KESA 4G56A 2G4JA 3FA4A 1OZMA 3UWEA 4YHEA 3KL0A 1PWMA 4ZOHB 1JYXA 5C8BB 2D0HA 2V69A 4MPQA 4KWVA 3NGFA 1Z32X 3HQNA 3ITYA 3CV6A 3VD4A 2W3SA 1YTEA 5G4EA 3BG9A 4V15A 5I5RA 4ZB5A 4IXHA 5K4XA 5H91A 3BMXA 5D09A 4O0ZA 4A2SA 3NL2A 4F2TA 4PFHA 3W2MA 1TX2A 1V7AA 4G8TA 4MJZA 4W89A 4FF5A 2VURA 3S2MA 1QNVA 1TJ2A 3VZZA 1KCKA 1B3WA 2YL9A 4LY8A 1L6SA 4JN7A 3T0TA 2VCCA 2VZUA 1O7AA 4LWWA 2BDQA 3OP2A 2NSOA 4LA1A 1Q6GA 1K8ZA 4QSFA 4EMIA 2A0NA 3P74A 1U5HA 4I5XA 3QV9A 3WNOA 1ZCOA 3N11A 5F4SA 4C6NA 2DPEA 1M04A 3WH8A 5FEWA 3EAOA 5DXXA 1TR9A 2OX4A 4HNTA 4PBFA 3C2EA 3FYOA 4FOUA 2QV5A 3MP3A 4IL2A 2X30A 2GUUA 2V3AA 4PMJA 5K9CA 3KXQA 4D6JA 4GO8A 5HK4A 3GXIA 1TPH1 3SN0A 2WVUA 3LOTA 3WK1A 5AC6A 4C7DA 3NYDA 3LPPA 4J3SA 1Q5MA 1XF0A 3EWYA 2PSNA 2YW3A 1UPPA 4FB7A 2KAUC 4JFVA 7CGTA 1LBLA 1ZPTA 4X2RA 3TTEA 1LCOA 5KTLA 3I7RA 1S2UA 2D69A 3POHA 2I16A 3MO7A 2WC3A 4OOUA 3LXBA 4Z2HA 3RM8A 1MO9A 1F5ZA 1UROA 4GNJA 4ZE4A 1V6VA 2HSAA 2WMJA 3O16A 2OTDA 1NDZA 1KM5A 1V02E 3W4RA 2AGTA 1A47A 1JAKA 3OZPA 5C2XA 3AYVA 2UWFA 2CHNA 3CJPA 4AWEA 3PFRA 2NVKX 4W85A 5JBDA 3VD9A 1TJ1A 3MY9A 4LAKA 4OV9A 3ABSA 4JIQA 1W3IA 2ZA2A 4Y6GA 1J0IA 5AOUA 1SPQA 3W71A 1O95A 4KWUA 5ABGA 3NS1B 4M1BA 4UCFA 3PTMA 2XN0A 4BWLA 3LCGA 2BS9A 5ABHA 4Q4MA 3CHVA 2UV8G 3F4CA 2EF9A 4AH7A 1P0EA 3I4EA 1R2TA 4N9DA 2GRTA 1TVPA 3PG9A 2Y8VA 4WJEA 1CB7B 4P7NA 3B0PA 1C92A 5D32A 4JD4A 1E9ZB 1CI1A 2YBTA 2XU2A 4A8RA 5FAGA 5FAJA 1GG0A 1OINA 2JALA 4K7YA 3DK9A 1QBBA 2WP6A 1LOSA 4NRRA 2I17A 2W61A 3W87A 1ZBKA 3TE9A 1FWRA 1XFBA 2ZX9A 5ECVA 3ERPA 1E9YB 2Y89A 3V0SA 2POTA 3IJ9A 4JTQA 4BF5A 2BXYA 1SW7A 1F61A 4UTHA 4PUKA 5A6AA 3M0VA 1TV5A 4CN1A 4DF1A 3G1RA 1G94A 3VOIA 4WIWA 1KBJA 1YNPA 4ZO6A 3PWIA 2DT3A 3O0HA 3S5ZA 4JCLA 2E7FA 2IPGA 2WZMA 3CQIA 3LCHA 2FHFA 4Q33A 4AEOA 4EQRA 4S1FA 4CQDA 4GVGA 1TZZA 2ATSA 5HMSA 5EBUA 1P0BA 5HNRA 2QAFA 3WLPA 2P8CA 1VS1A 5BMWA 3NXFA 4PB3A 9XIAA 3CK5A 5BU6A 5B7YA 1WA3A 2RDTA 3O6DA 1J11A 3DGRA 2CPUA 4JYEA 5AYXA 3TROA 4BK9A 1H1ZA 3QLDA 4QLLA 1AQHA 1OD8A 1QCWA 4YU1A 2VQUA 5HA7A 4FOKA 5LNWA 3NVDA 3H4KA 4WJ8A 3DDMA 4AC1X 2AQOA 3S5NA 1QI5A 2YA0A 2PZ0A 4NVTA 8TIMA 1ZDLA 1FH9A 3LEPA 3LGDA 5D33A 1QOQA 4E3TA 3BMWA 4FPSA 3ZJ8A 1V6XA 3W7IA 3IJ7A 4N9EA 2WZIA 4JR5A 2YVJA 4KRUA 1BGGA 3LENA 3EOLA 3OLGA 4DJFD 3PULA 1XDLA 4DN1A 1E6SM 4IPPA 3CB3A 5KZ6A 4TVYA 5EFDA 1ME9A 5KEZA 4JX5A 2V3BA 2VL4A 3G1DA 4ZTXA 3W28A 2FZDA 4RZ5A 1GVOA 1IT8A 5DRCA 3AIUA 3EX2A 5A6MA 1FXPA 3R8GA 3WEMA 2X7VA 3B0YA 1XG4A 1X8CA 2G3NA 1OFBA 4DWSB 2VGIA 1GKRA 2YZRA 1GXFA 4MOZA 1TSIA 4CNSA 3GH7A 4XG1A 2XUCA 1LRTA 2X99A 4S3CA 1T40A 3F4NA 3EBVA 3MUZ1 3ZO9A 4AYSA 5JRBA 1B9ZA 1MW0A 2ATMA 1DE6A 2E40A 3VCCA 4EMWA 1E9LA 4Y9OA 3N6JA 3U4FA 4DIAA 3W7KA 4RLIA 1RA0A 3L2LA 1QUMA 4TV6A 3U6WA 1X6LA 5FJIA 2IQTA 1M68A 1YDOA 1CLXA 4P7QA 1FDJA 2CBIA 3AS3A 3FV9A 3L2IA 3G1YA 4O12A 2PRHA 4GX9A 4HTYA 1UZHA 1XH1A 2DP3A 2GGJA 2W62A 5HMFA 3LNMA 4IP5A 1S3HA 4XZ9A 3R8RA 4IGHA 3WQ8A 1FHVA 2GDQA 2OLAA 2G4FA 2E6AA 4FR1A 2B4GA 1JCNA 1OC5A 3HPZA 1FWGC 3N04A 3QW4B 1FP9A 4IQEA 5HUPA 1DE5A 2A4AA 1TV3A 3J7HA 2PLCA 4M0XA 5A8PA 4NY2A 1KQYA 1BRLA 5TIMA 3M0ZA 2F2HA 3HPFA 2XFRA 1JVNA 2YLAA 1NJJA 2BP1A 3OGSA 3TA9A 1TMHA 1KR1A 4NJGA 4FX6M 3RR4A 3DHUA 3G0SA 3HPAA 3M4HA 1CDGA 4GIAA 3GDBA 5JVLA 4HU8A 3AO0A 3L0GA 1BF2A 3WCZA 1RPXA 1Q6RA 3OGRA 1QTWA 4UTJA 4PTWA 4JICA 3VD5A 5BMXA 1U5VA 1GVRA 2BGNE 1NDVA 3SDOA 3CH0A 1G4SA 1RVKA 1MEWA 2IKIA 1A5KC 2CC0A 1EYWA 3NQFA 4TVDA 2PAJA 4IGMA 1AD4A 4GZJA 2C13A 3BUVA 4GIRA 1QJWA 3G1AA 1XGEA 1TRIA 2GR1A 1EC9A 4WQ6A 3GD3A 5I24A 2XVLA 1ZY9A 3GU9A 1HO4A 4DELA 4ZE5A 4O10A 3MUXA 1K3UA 4R5EA 1H7PA 3IVUA 4FSAA 1IZKA 1QHZA 4RPPA 5CPTA 3ZVHA 4PMXA 1JUKA 1JCTA 1U1JA 1QXLA 2OX1A 2NVCA 5MF5A 1B3YA 4MLJA 3ZLFA 1ZHAA 3SIMA 3ARVA 1A5OC 3JRKA 4RR4A 3PNZA 1Z6KA 4WLCA 5DO8A 1VD6A 2AAAA 3SCRA 4A22A 3SECA 3JW7A 1VBRA 4NZ1A 1WDDA 1SZRA 2V67A 3GC2A 5E0FA 1E4MM 1XX1A 1FWSA 3FNDA 5AHFA 3U5YA 3WDIA 1QPOA 4NAFB 1JPDX 1MQRA 1GRGA 3QC0A 3WKZA 3W84A 4EWJA 1UKPA 2IXUA 3HBLA 2B31A 3QYQA 3QPEA 3II4A 2CDUA 3BMVA 1HJXA 4UTKA 7REQB 1F07A 1Q7ZA 2ZWYA 3FHAA 3MVTA 2INFA 2AL2B 4LC8A 1ZB5A 1XRFA 2VNCA 2VFIA 1QW7A 1ONWA 1T96A 2H9AA 3VKDA 4A8IA 3GNDA 4M5PA 5DY3A 3RILA 3WG6A 2QJIA 2VHLA 4M6VA 4C65A 3UESA 2HQAA 4YTSA 3TMQA 1CW2A 2JIWA 2ZZ6A 1W1B1 3DCPA 3C5QA 2G0WA 3H12A 1E6XM 3W1QA 4IPLA 5CAKA 1YKWA 3C2FA 3V18A 3BLEA 3ITVA 1OM0A 2A79A 5JCKA 4E4UA 2PWGA 2WKGA 1H51A 4O16A 1BYDA 2ANUA 2IW0A 4YPJA 1ZNNA 1JCXA 5FS8A 3G3MA 4DAIA 1KV8A 3OHIA 4PUEA 1XLLA 4KIRA 3NTYA 2OELA 2BTMA 1A53A 1XKJA 2NX3A 2PODA 4KGLA 5EU9A 3VKAA 1F6PA 3P60A 3WQWA 1CLKA 3I3BA 2FIQA 3UWQA 2DSZA 1UA7A 4AZ7A 2PP3A 2WKJA 5I00A 4XZNX 2E28A 4UR7A 1F4AA 4GY0A 4QEHA 3K1GA 5JXQA 3UCQA 1EDQA 4ML4A 3NSMA 2WAGA 1EX5A 1J5TA 4XAGA 4JKMA 3UT0A 2QR6A 5EFFA 2WC7A 3FGCA 4UR8A 1WAUA 3QFEA 4PL2A 4LY4A 4XBKA 5E5CA 4LUJA 2DV0A 3QM3A 1PSCA 5LA0A 4EF9A 1V79A 4QQ3A 3HF3A 2CEQA 1N61C 3WN6A 3RK8A 2BOEX 3VDGA 1K7FA 4H8VA 4I8DA 4AHQA 4DYJA 3MB9A 1P6BA 1ZLPA 1R47A 1XYFA 2ONEA 3HQOA 1MXDA 2ZVRA 4H4RA 5CJ5A 3WF3A 3PBMA 1LL7A 3C4UA 1OJTA 3A7AA 5IDZA 3N2BA 4R7JA 4UNKA 3NM1A 4XUYA 4ALDA 4QBXA 3CGDA 3AIWA 1GRBA 2HK1A 2OODA 1IIGA 4J35A 1YE6A 2PLJA 4QDPA 5BXSA 4MM1A 1AL8A 5D8ZA 3JU2A 2XWEA 1XKYA 2HJPA 4F9DA 2ZVIA 1SW3A 3AMCA 3KWXA 1XJBA 4YWSA 3KFTA 3I65A 1XHGA 3PUGA 2ZZ2A 3E0FA 2PDFA 3NEVA 2VX4A 1ZBVA 2V8ZA 1Y5XA 1QI3A 2YDAA 3NEHA 3THQA 4DUWA 2FYMA 1KXQA 1PJ9A 2Z4GA 3GBEA 3BL3A 4CU8A 4H2HA 4X60A 4ZL1A 3P0XA 4LVBA 5E6ZA 2XH7A 2J7GA 1VIWA 3R07C 5CZKA 2X42A 5HINA 1RAKA 1UH3A 4WGHA 2WCSA 2ZXAA 4C5YA 4MDOA 1HX0A 3ALGA 1T0OA 4L4LA 4B2DD 3SAZA 1GVQA 1FHUA 5HXMA 3UR7A 5HUOA 3L0KA 4DPPA 3GFYA 1G6CA 3EKZA 3W82A 5PTDA 4BQ2A 2V5DA 1E6ZA 1KRMA 3KS6A 5FACA 1JCLA 4JY9A 2D2OA 1MFVA 4H3DA 2CFFA 2XH0A 1VFUA 3CZJA 5K7JA 3ZMRA 1FTXA 3UWUA 1CLVA 4PH6A 4RNJA 4L9ZA 1KA9F 3K4WA 1EGMA 1NAL1 2VM8A 2W55A 1KTCA 1X38A 4YCOA 3BW4A 4IX0A 4IPJA 3ZVIA 1VJSA 1OGSA 2ICSA 1OX4A 1OB0A 4QISA 2XIQA 3WD0A 1J93A 3F5KA 3DI0A 3JVAA 4XSLA 1F3WA 1H41A 3NQAA 3P3BA 4XZHA 2EPMX 2IKGA 3E3HA 1VAHA 1DWAM 3VD3A 3WO8A 1G7VA 4RE2A 4MY8A 3OBKA 2OLSA 3BW2A 2I1OA 1FFRA 5GPRA 4EAYA 4KIEA 5HOSA 2J9XA 2G96A 4ZQNA 5AYZA 1CGXA 5H1WA 5A6SA 1RSCA 1DJZA 1VHCA 1VBHA 2YDSA 5IDIA 5I3FA 1NY1A 3AHXA 1C29A 2DQXA 4XKYB 3N2TA 2DDXA 4QJ4B 1WXZA 2WPFA 1IT7A 2EHHA 1T99A 5TQLA 3S1WA 3WH6A 2YLLA 3CH9A 4PTMA 2VTFA 3BSHA 1TG7A 4KW2A 3W1RA 2X40A 1YLVA 3WLNA 3RG6A 4KH2A 1HNYA 3OLEA 2PDJA 3SO7A 1ZSXA 4UTIA 1W9VA 1XSJA 1ONFA 1UKTA 6CGTA 5CPLA 2PWVA 3HURA 3MSDA 3PAOA 3QV8A 3T2PA 1HL8A 2C3ZA 3AZSA 1DJNA 1YDNA 5M2FX 4I9TA 4M24A 1J0JA 2QPSA 3E49A 3FDGA 3USZA 1EP3A 3LXDA 3O1NA 2D0FA 1VEPA 1OYCA 1VHNA 2ZA3A 3VKCA 1IZCA 4GA8A 1R38A 1J9YA 2E0PA 4EXBA 2CLMA 4HVXA 2IKJA 1ISWA 3DGZA 3OG2A 4HA0A 2KZHA 1UR2A 4B92A 2J3NA 3O0FA 3L23A 4NU7A 2WO5A 3GR4A 4IM4A 1GG1A 4RXFA 1JDDA 2CZDA 4XVDA 3VFCA 2HVMA 3APTA 4H6EA 4J3XA 2YYUA 5C2CA 2WQDA 3UCCA 1V02A 2FPTA 3W00A 1NIUA 3FX4A 3VYLA 1A5SA 3KRZA 5AVNA 3VE9A 3BSGA 3LV6A 3QW3A 2VEIA 4C1LA 3SQSA 1GRHA 2VEFA 4IOTA 4V27A 2GFTA 3KTCA 4G1KA 5FL0A 3W24A 5FS9A 3W53A 1RJQA 4BF7A 5IOBA 1N8WA 3C86A 1KR0A 4HT3A 1CGWA 1NHRA 3HGSA 1SYTA 4G1NA 4K3ZA 1J01A 4D6DA 1LVLA 3GTHA 3UVIA 3RAOA 2GJNA 3QGAC 4IIDA 3TR9A 5E9AA 1EEXA 4Y8FA 2PDUA 3VNDA 3G6MA 1V4YA 4R53A 3EXRA 1OCNA 2VCBA 3GH5A 1MDRA 4S3GA 1FKWA 1XW8A 1FWJC 2IPFA 1YTDA 3FA3A 5C6MA 4NXKA 1J0YA 4APNA 1ITQA 2IPJA 3EWCA 3S2JA 1GZJA 1NOUA 3KVMA 4W5UA 2Z27A 1SM9A 4GXMA 1CXIA 3AN1A 2B7PA 2VEKA 2VVSA 4KKXA 1TMQA 5G1MA 8A3HA 3AOFA 3WMBA 5A6BA 3FSUA 2GJXA 3CZGA 2R9ZA 1KNWA 4PGLA 3EB4A 4O1BA 4L9YA 2OOFA 3PM6A 3LV5A 3IARA 9XIMA 4LRSA 1ITXA 1JZ7A 5CLTA 2C79A 2X09A 3R1ZA 1XLEA 4O11A 2QYGA 2PGEA 3IAQA 4FX8A 2BCPA 3HFTA 2X1TA 4PMUA 4LF1A 1FEBA 1DWGM 4XO6A 5CSYA 3UVAA 4ZO8A 1UKQA 2E8ZA 2VFEA 2VXNA 4KRZA 3LHZA 5GJPA 3ZFHA 1J0HA 3LA4A 4O52A 3GW3A 4YIWA 4LS0A 4JN8A 5I3HA 3ABOA 2QCNA 1KM3A 1VBJA 4Q4KA 3A4AA 3K4AA 1GJUA 1NDYA 3HMJG 3SRDA 4UTTC 4V33A 2NQHA 3H2MA 1H63A 1P5BA 3UCDA 3B9EA 3T2QA 4NJHA 3S6OA 1XINA 2PWFA 3CUIA 1GW1A 3R6IA 2CWXA 4KMQA 4HCHA 1OFPA 3H2NA 3KVJA 4JTCA 4JTIA 2ZQ0A 3MKVA 4GFIA 1AH0A 4RL3A 2XINA 3GG0A 1WUEA 1OFQA 2GSJA 1XLFA 1VR6A 1OG6A 1QAPA 3ZSSA 1TZ7A 2QW5A 2O56A 5E6YA 1MQPA 2FKPA 4EMJA 4NASA 1M5WA 2F6XA 3G77A 2YA2A 3F2BA 3G18A 4RNFA 2QUNA 1HKWA 1JI1A 2PZNA 3VDHA 1A3HA 3VNYA 4JTKA 4HYRA 3ZR5A 1KM1A 1JZ4A 5FOOA 1G9HA 3UBPC 1DIKA 1S2AA 1CTNA 1K77A 3AIRA 3GBDA 4GR1A 4ACZA 1GHSA 1TV4A 5I78A 3AYSA 2E3TA 3LRLA 1P4CA 5GNXA 4BFAA 2B7NA 2XIJA 3THAA 1RALA 1NP2A 3VKKA 2ACQA 3TYBA 5JH1A 4K6AA 2DEPA 4A3HA 2J7CA 5CPQA 2Q01A 2PF8A 3C52A 1AQ0A 1XIMA 4F40A 1PYMA 4QNWA 3QSRA 1BWKA 1BXNA 1N2VA 3WZ0E 1GOXA 2V3FA 4JHOA 2EG8A 3XISA 3LB0A 2R1LA 1QI2A 4X9YA 2PI6A 2YDRA 3CLWA 1QNQA 2XZ7A 2BB0A 4H9XA 4MFEA 3W37A 3B9NA 3ETRB 3UNTA 1TQXA 3GZ3A 4Z2IA 4BS0A 3H7RA 5BW6A 1FHLA 2C91A 3V0UA 4ZQCA 1UP2A 3O9NA 4C6OA 3KRBA 4JTLA 2VKZG 2NUWA 1WDSA 1VYSX 3RCMA 5BRPA 4MUZA 3W72A 4PBGA 2Q8LA 4AYGA 2R6OA 1MRAA 4D6IA 1XIEA 2GQ9A 2X1SA 2YVGA 1V6YA 4ICNA 3GKFA 4GY1A 4LGXA 3SW6A 4GYKA 1BGAA 1UPMB 5G5HB 1PDYA 4XO7A 1L6WA 2XVKA 1LUCB 5F4WA 2EQ8A 3VIPA 3NZGA 4LH8A 2EPNA 3FKKA 4HNVA 1M01A 3UYCA 2OGYA 1P1MA 4M19A 1YDVA 1IWAA 3UY8A 1JDFA 2ZUNA 3QR0A 3THUA 3O15A 1B1YA 1UD6A 3KOZA 5EPDA 5FEZA 2WHJA 2WNWA 5LA1A 4HOXA 1JYNA 1LQ0A 3PJWA 3MANA 3GDKA 3Q65A 1F76A 3ARWA 1KXVA 4J3VA 3OEXA 4H9UA 4LVDA 1VPYA 3UJRA 5JBEA 4RDZA 4FNUA 3SRKA 1K6AA 4UOQA 3I68A 1YHTA 4MZYA 1EC8A 3UG3A 1OCBA 2WNQA 1PZ1A 1XYAA 3QN3A 4WSKA 3R13A 4QG8A 4UTUA 2QCGA 4W8BA 1PB0A 2WMIA 1CCWB 3NDYA 3Q4DA 1KLYA 1L9WA 5I3DA 3RNMA 3UA4A 3GFXA 5IRPA 3WFAA 1X1ZA 5C9XA 1ADDA 4Y9NA 3C3NA 1IEWA 4AF0B 2H3BA 3TTSA 3E74A 1KGUA 3R0KA 3URBA 3MV11 2YXGA 3AXHA 3TSDA 4B5XA 1H49A 1B2YA 1DV7A 3SURA 1OQFA 5FSDC 2YBVA 4C6CA 1I2RA 3QBUA 3VO0A 3QV6A 3PZGA 2TODA 4D6GA 5GNZA 3PJTA 4EXQA 4JKKA 1EEPA 3AMKA 3DFQA 3W7QA 5T26A 3EB3A 1DORA 5D9OA 3E12A 1OGGA 1TE1A 3LHWA 3OA5A 4KEVA 4DBSA 4H4UA 3C0QA 4PCTA 3W81A 1W3TA 4BI6A 1F74A 1Y8BA 2P0IA 4L7ZA 4LAUA 3C8FA 4AZIA 5I07A 1J96A 3G2GA 4PBEA 5I77A 1DQUA 3DEQA 2BZNA 1JEHA 3ITGA 1TPEA 3T9PA 4S3DA 1GQJA 1DNCA 1OYAA 2E67A 4LX4A 5LA2A 1AJZA 1XIBA 3EEZA 1IR1A 1I75A 2E5BA 3HV8A 4HCDA 5A6JA 1UCWA 1TVNA 4NNAA 3GQYA 3VVGA 3DU0A 2Y4SA 3CHCA 2HVOA 3MBFA 2AL1A 3TONA 3DKLA 3QFBA 1IGWA 6A3HA 4D9PA 4NAEB 4WSJA 1MW2A 5F1VA 2X41A 3VTRA 1BD0A 3WF2A 2PDMA 4WKFA 1HGYA 5CG7A 3L4UA 4BA0A 1ICPA 1TPFA 4UTWC 3N25A 4C7FA 2B0MA 1F8IA 3EXTA 2XIOA 4WRHA 2XIBA 2F6KA 1K4QA 1YADA 2WLYA 1AG1O 3B8SA 1LBFA 4FX9A 3EWUA 5LXXA 1CT5A 2VC7A 3MQTA 1LM1A 4MWAC 3ZWTA 1CXLA 3BAIA 4ACYA 3BAJA 4PMRA 5FJTA 3TJ4A 3R12A 1W1YA 4IP4A 5I06A 1NOWA 3IUDA 4XISA 3VABA 2VGGA 1YDYA 3HJEA 4POCA 5AYBA 3CTTA 1B3OA 3NURA 4Z1DA 3WIJA 2HEJA 4DJDD 3G22A 4DO4A 5BOOA 2HQMA 1VGAA 1H0IA 5FEPA 3MC5A 5FESA 4TTUA 5I03A 3CXBA 3BLDA 2Y7EA 1ZMCA 2J62A 1K9EA 3ARSA 3CGBA 2A1YA 3GDMA 4XAZA 7ENLA 4LVGA 4GQRA 4Q8VA 1M6JA 4A8NA 1BWVA 3KOFA 1DOSA 4L56A 3K2GA 1K8XA 4MNLA 4C6LA 2BMBA 1D8WA 4PCSA 2J24A 1TE6A 4BV6A 1SJDA 3UZWA 2XYLA 3SCOA 1A5LC 3BLIA 5C9RA 1WZAA 4FXSA 2Z1XA 2VEMA 4HYVA 6XIMA 2QUTA 1V77A 4L6DA 1YQ2A 2GGGA 2OB3A 1R6WA 3MA8A 4PCPA 4WZHA 3LM3A 2ZBTA 3UWVA 2DSUA 5CSSA 3N13A 5FEXA 4KERA 1KM0A 4DX3A 2XM2A 3T0DA 3VIIA 1K7EA 1RUSA 1KC7A 2VFGA 1ML1A 1V6UA 2VR4A 4G6CA 3BJTA 1EX1A 3QQ1A 2VOMA 1JUBA 3LRKA 2QNEA 1GVEA 2PWDA 3IVTA 1JD9A 3L4TA 4N6EA 3NXLA 4ICMA 4GH3A 1D2KA 3N19B 2FMNA 4C6BA 3ARRA 1WXYA 1Q6CA 4H7VA 2Z1BA 1NELA 1ICQA 1OC6A 2YOCA 4DYKA 1HVXA 3PFMA 3G8EA 1ZJAA 2QMJA 1R3VA 1FCBA 2W67A 1EFZA 2ZADA 3MSGA 1RCXB 5CZJA 4N9BA 5U4NA 2OT0A 1FBAA 1A5CA 2GWGA 1KM2A 2I5GA 3B8VA 4MYXA 5CZSA 6REQB 3L65A 2FDSA 4OQVA 4OWGA 3PPCA 1LL6A 1SJCA 2QJMA 2VP8A 1I2PA 3GUWA 3DFNA 1Q6FA 1UW9A 3AICA 3SZ8A 3AM9A 5AZ1A 1EHAA 4G7EB 3TYEA 1L6GA 5J8LA 1W9BM 5LSMA 1VQZA 2PBGA 1VCGA 2H6RA 4M7SA 2FHCA 4XZBA 3WF0A 2ASHA 3F2CA 3WJWA 2W92A 4Z08A 3CL7A 3WSUA 3VGBA 5GQBA 1G4PA 1YX1A 2CLKA 4AZCB 1EJTC 1QI4A 3RLVA 4N4PA 2ZTKA 5DANA 2AAMA 4EVZA 4DWSA 4IFOA 5LXEA 1Q2RA 5HNTA 4ZSUA 3CASA 4FMVA 5A8MA 5DT5A 1E15A 1V0MA 5HAOA 3TWBA 3FIGA 3E0IA 1NFGA 4Q8TA 3IPWA 4QX4A 3EPMA 3P8IA 5C54A 2ON3A 3CZKA 4K7VA 5JCNA 3T2OA 3CQHA 1OWQA 1LORA 1CGVA 2OO6A 3GTFA 4AY8A 3MUY1 5G1YA 2Q09A 3TMLA 1K70A 3ZS4A 2AKZA 4ECLA 2Z29A 3A5VA 3FXYA 1D8CA 1JQVA 5LNVA 1IWPA 3F7JA 4ZSTA 3UEQA 4IWWA 1V51A 2J13A 3L2MA 1DYSA 3W7HA 3W23A 4JAWA 3W7OA 3TFCA 4H7CA 3O7UA 1OIFA 1U22A 5AHMA 4B15A 1KFCA 2GVYA 4Z0SA 1P6WA 3PZUA 5H2ZA 3EAUA 4LNCA 3TCEA 3I7QA 3VGFA 3MHGA 5I3JA 2H3DA 1F3TA 3O06A 2WHKA 4H9VA 1N63C 2ZKMX 2ISVA 4N02A 1GREA 4GJJA 3ZLHA 2XTKA 4BWLC 4OT7A 3C0JA 2Y1HA 3IWPA 3RYSA 3WLIA 2PTYA 1ZMDA 1FWDC 4E2DA 3VD7A 5ABTA 1U83A 4ZQPA 3GRSA 4B5VA 3N29A 4FOJA 4JTHA 1VDVA 3KTSA 1E3ZA 3BWWA 3UPMA 2OU4A 3SEPA 3VIKA 4B16A 2J66A 4H4QA 4OTKA 5CXPA 1MXGA 3ANYA 2Y7DA 3CPGA 4MTVA 4AU0A 5LGZA 1WAWA 2JBMA 4EPDC 4O4VA 4DXVA 4JIPA 2DT0A 4C6KA 3T4CA 8XIMA 5LIXX 1GVYA 2X2GA 2ZIDA 2X8CA 1PTDA 4O8RA 3QLLA 5FMHA 3W02A 2Y0FA 4O28A 4XTDA 5CJMA 2HBVA 1DXLA 3II1A 3UXLA 2FVLA 3QVQA 4B9YA 1GJWA 3GXDA 2EG6A 2NUYA 3H2CA 3ARXA 4XD5A 1ZTVA 3S2NA 3P84A 4BURA 3SQMA 3CXOA 2CWNA 2ZTJA 3NVZB 1GRFA 4A8LA 4Z1CA 4HA3A 1GPFA 4K37A 3U7VA 4OVXA 4ZFCA 2TSYA 4LCRA 2J7HA 4BQ4A 4BCEA 3KZSA 1EF2A 1X7FA 5C9UA 3C0LA 3M5VA 4GWEA 3GE7A 2DUXA 1MW3A 2Z1SA 4P7RA 1W3HA 3W74A 4O18A 1R7AA 4NAFA 4B5SA 5DBTA 2PDYA 4RV3A 3BW3A 1NFPA 3NO3A 1CBGA 2BXZA 2O4MA 1MWOA 3B8WA 3LCXA 1WDRA 3GG8A 4LAZA 1XIJA 4M56A 1SUXA 4A3RA 3POCA 1NARA 4J28A 7REQA 2Y88A 4GBUA 5AC7A 2HE5A 2QULA 1OK6A 3UWZA 4YHGA 3F5JA 2AL2A 2J74A 5LNUA 2CZ5A 1GOMA 2C3DA 3QJAA 3OVRA 3VC6A 3VI2A 1ODZA 4MVAA 2ZZBA 1UMYA 3G3DA 4JTSA 1JCMP 1ZBWA 3PZNA 3BCFA 2GJLA 3CT2A 2DSWA 5FA5A 3SUTA 4IJRA 1DQWA 2WSQA 3RRAA 4LBUA 4UTLA 1BYCA 4DM1A 1W1IE 3F4DA 3LADA 1QWGA 3LLFA 4P7LA 3EDJA 3IK4A 1HFBA 1SFTA 2PTXA 1E72M 4HGXA 3NO1A 4JHZA 4WR3A 4DI9A 3CYVA 3LGGA 2Z1KA 1WKYA 3DAQA 4HPXA 2Q3OA 4PA8A 2VWTA 2A7RA 5HMDA 4PTVA 3UWWA 3GG1A 2O55A 4CD6A 1JFXA 4V28A 3S8HA 1E4IA 2G8ZA 1AH3A 2XIIA 3E9AA 1VCFA 3A7UA 2RFGA 3AZRA 2Z2AA 3NQCA 1MI3A 3CPUA 5G2HA 5DCDA 3BAXA 3IJ6A 1Q6LA 4UMCA 4WD0A 4JTUA 2VC9A 3WUFA 3SB0A 4NL1A 3MMDA 3QZEA 2VT0A 3SY5A 1EQCA 1D9EA 4JQ1A 4U33A 3H8AA 4REQB 4UFHA 4WOQA 4G7FA 3R0UA 3GTIA 5E0CA 1YPFA 3GXMA 5TF0A 2NQJA 3WX7A 1IE7C 2VFFA 4ZOEA 2CNCA 4PMNA 4L61A 1D7KA 1HKMA 1QO2A 2O0TA 1JPHA 3FHQA 3KBVA 3U0HA 2AMXA 2BSLA 1LLOA 2ZZ5A 1TX0A 3N2XA 2FFCA 4GGHA 4UOJA 3KHDA 1EYEA 4ES4A 1X2GA 3MMWA 1TPDA 2J7BA 4IZGA 2VD9A 5D9NA 3Q67A 1ZJBA 4D6FA 3OW1A 4PRWA 3QH2A 4H4YA 2ACSA 4IGNA 1N5WC 3N18A 2NQZA 4AZBA 4LANA 5FL1A 3W1PA 1PX3A 1AUSL 1HN1A 4KS0A 4RK8A 3WNLA 4ZGYA 3CIWA 4HSOA 3KL3A 5F1UA 2WLZA 1PVNA 4W7VA 1RM6B 4H4XA 4NZFA 4K39A 2WMKA 4U2YA 1OX5A 4FO4A 3D9XA 3MP5A 5M3WA 1S1RA 3SUVA 3C61A 1KRBC 4IF2A 1GQNA 3AIBA 4JIEA 1NSJA 1FX6A 4EXAA 2P1FA 4RDVA 3SCPA 3GNNA 3KBJA 4EQWA 4LALA 2O9RA 2TPSA 2FZBA 3FJ6A 4NUWA 5HNUA 1G67A 1H5VA 2ADAA 1EGZA 3O8AA 1CXKA 3V75A 1PAMA 2EKGA 5D4YA 4I6VA 3IJ8A 4LYKA 2IKHA 2EBNA 1YYAA 3WBXA 4DJEA 4C60A 2W79A 2QHAA 2VZVA 2O4QA 2HWGA 1UC5A 2VEPA 2TMDA 3GNRA 3WD4A 1D7FA 3APGA 2SFPA 3GHRA 4I90A 4AHOA 6PTDA 4X9SA 1UUMA 1S2WA 4O15A 1GOKA 2ZFAA 3E0LA 3BJSA 3L9CA 5BZAA 4QJ1A 3L12A 3VNMA 3TKFA 5EMYA 1RLDA 4WDTA 4HHLA 4O1AA 1UR1A 2HVNA 4L1WA 4JKLA 3UJFA 1FDYA 4GABA 1TWIA 3P5ZA 1Z7AA 1DPMA 4OFCA 3BE7A 1TWZA 4NIRA 5F2GA 4NNBA 4Y96A 4YN5A 4GFSA 3VUSA 1JI2A 3TYUA 5EYWA 3L8KA 3S6TA 4N7QA 1PKNA 2X0HA 4HN8A 3URHA 3CL6A 3QC3A 3VUPA 1Z69A 3Q2DA 4KCWA 5CZ0A 2O7SA 4FK9A 3OVPA 4TVUA 3TSMA 3DZ1A 1P7TB 4B5WA 3STEA 2REQA 3G0XA 3G5EA 2R1KA 4RPQA 2GZXA 3EA1A 1ODUA 3OOQA 4NX0A 4C6IA 4B3ZA 4GCXA 3VE7A 3WDPP 5BYWA 3SY8A 1C93A 3T4WA 3R43A 4EAMA 5C7VA 3O07A 4GACA 1YMYA 3VGHA 2P53A 4GX8A 1GYLA 4XKYA 3TVAA 1XIIA 4C6PA 2CFYA 1FH8A 2XVGA 1OFOA 1PZ3A 3W25A 4AIOA 4DBEA 5FSEC 1XBVA 1ADOA 1H2IA 2F6UA 1MVYA 3AC0A 4MKSA 4DEFA 4IT1A 3AJXA 4Y2WA 4Z2GA 2V5CA 3B03A 3OIHA 4CLMA 3UZXA 3TU9A 5EMMA 1W5PA 2A7PA 1XHCA 3FVDA 2ACRA 3NVWB 1KCLA 2PB1A 4QLJA 3ITXA 3R7MA 1O94A 5I3IA 5HWNA 3I7SA 1Y5VA 4WJXA 4DZHA 1VEOA 3SR7A 2ABBA 3OZYA 1V3KA 4ZODA 3ORWA 1EBHA 3WQDA 4PUJA 2YCIX 1S5NA 3VGDA 2WNZA 2QUVA 1R7OA 4U3AA 2OMAA 1V6TA 2TPRA 4L65A 4JTRA 3M0IA 4GYFA 3CWHA 2CIPA 3NPUA 4JXCA 2NLIA 3BGGA 2HXUA 3AS2A 4EE9A 1PKLA 4IP7A 1AA1B 4UOZA 1NP0A 4ZO7A 5K9DA 1JGIA 4PMYA 4Q22A 1BYAA 3D3FA 3UXAA 2BFGA 3WMCA 5B80A 3D6NA 1FH7A 2GGIA 5IFTA 4IIEA 2XGZA 4IUGA 5H8UA 3AI0A 3QXBA 3AS1A 1JCYA 3VOJA 1B57A 4Q3MA 4FDCB 4I6KA 1XYMA 4QDWA 3GC4A 5I02A 3U8GA 4J2PA 1AMYA 5A8QA 2DU2A 3FYYA 3AXIA 1T3QC 1R2RA 3IIXA 3H22A 3EX6A 1EHNA 1A3XA 3HJZA 3M0LA 1UQYA 1F6YA 4DYEA 5FIPA 1Q4WA 3SBFA 4QGCA 3UXKA 3WMLA 3W1NA 1STZA 1S5VA 2TYSA 4H00A 4H01A 1F8MA 4GO9A 4XWUA 1A5UA 2D3NA 1XS2A 1LYXA 1ECQA 1RCOB 3ZM8A 4ZZ9A 3W73A 1U1UA 3VNKA 1PHQA 1RJRA 2CBJA 1DJIA 4O53A 1WB0A 4ONVA 4PRTA 1KBKA 1L8NA 2AQWA 4S2CA 4U4MA 3SI9A 4Z1YA 4H2CA 4X3ZA 2VCAA 4URIA 2OO0A 3VIOA 3L4XA 4TXEA 4FS9A 2ZDSA 5GNYA 4EP8C 1NQKA 3FDKA 3HQPA 2VOTA 5AKQA 3CGTA 1XLAA 1WBJA 2OYLA 3WYZA 1W0MA 3USBA 3PC0A 1VFOA 3KHJA 4JNYA 2Y5EA 3JZUA 4DM2A 3S9YA 4O0QA 2D0GA 2YB1A 1Q1WA 3TYZA 4IGSA 4PTDA 4HA1A 3UP8A 1F2JA 3GM8A 1ISVA 1I45A 2GUYA 3N6QA 3RHGA 2E6DA 2YL5A 3P62A 1DHKA 5DT7A 1OCQA 3B4UA 4JN6A 3W7JA 1J5SA 2R24A 1A5NC 1LLWA 1GTHA 1CXFA 4ADUA 2GDVA 1M9HA 2ZX6A 1BXBA 2WOIA 1GEQA 3EPOA 4Y9MA 4FF7A 2V68A 4MAVA 2BVWA 1X7IA 1K8CA 1S1PA 3BOLA 1BZLA 1NH6A 3NPWA 3UU0A 3UWYA 1ZP3A 3ANUA 3BC9A 2YSWA 2ZZ3A 1XGDA 4AEFA 2DORA 2ZRXA 2ZE0A 1OSEA 2NLYA 4ROPA 1LDCA 1BXCA 1E4LA 1V0NA 3AFBA 3QOMA 5BOFA 3H55A 2GQ3A 4U5KA 3NRZB 1ME7A 3B3DA 4HSHA 3W6YA 4J7RA 1TA3B 4GISA 1W9XA 4NZ4A 3SUSA 2Q71A 1FFQA 3H2FA 4JHMA 5FF0A 3HM7A 4LW7A 2Q6ZA 1N60C 2OKOA 5U25A 2VRJA 1V93A 2V5BA 3VIGA 3O3RA 5FJRA 1PTAA 5CC6A 1DIOA 3W1AA 4PUNA 2VRKA 3K1DA 1DIEA 1MQQA 3RIKA 1OYBA 1EZWA 5CPMA 5KMYA 3RO6A 3MUAA 1W3JA 2OG9A 1O5QA 3W0KA 2WPEA 3MO4A 2C7FA 3O2LA 1RV8A 2F84A 4H6RA 4Q8WA 4XZLX 4WF7A 4GCAA 5KZMA 2OXNA 2QIWA 3AMGA 4YNGA 1FWIC 4FEZA 3E38A 3CZLA 1JJKA 2P3ZA 1SO6A 3V35A 7ODCA 4NZJA 2NW0A 2FJKA 1D7YA 3UD6A 3FSTA 2CYGA 1JZ8A 1QU4A 4ZQRA 1ZXIC 3E96A 3LHVA 4UC5A 4O54A 1EGVA 4CKQA 4YVPA 3N4FA 1DKWA 2I7GA 3NQVA 2R1PA 1GHRA 4M1RA 2FH6A 3MJYA 2DFAA 2J8GA 5ECUA 2FLIA 2Q8XA 2NWSA 3ME3A 3DYOA 4I9MA 4J40A 2VO5A 1ZP4A 3GHTA 2ZZ0A 2DZVA 1IEXA 2QMKA 4AWUA 1NDWA 1UWIA 1C8YA 2W3ZA 2WJDA 1NF7A 2CLPA 4W86A 1DTNA 4R9XA 4GMEA 2CLIA 3AMLA 1GZGA 3W2JA 5A2AA 3IAPA 4RNHA 3S6DA 1ZGDA 3LS9A 4FNPA 4IICA 2G3FA 3BV4A 1PL9A 4JTEA 1V6WA 2NUXA 1V0LA 2W0UA 4R33A 4HTBA 3LXCA 3TYAA 3TLLA 3VIJA 3MYPA 2EQDA 1CEOA 2W6RA 3ABQA 4US6A 2A8XA 4O1DA 4W8AA 4V2XA 1DBTA 4QS6A 3NA8A 2JF7A 4LFYA 3DXIA 4H9TA 4Z17A 1GYNA 2EQ9A 2VDGA 4UQ9A 1Q6EA 4XD3A 5EMLA 1FCVA 5I7GA 4U5IA 3CAVA 2PU0A 3P93A 3WBWA 4K8GA 2F5ZA 2GSEA 1EBDA 1LUCA 2OSWA 4F9JA 3B06A 1B31A 4I5UA 5F7UA 3RR1A 1CYGA 4J1OA 2WJEA 4BKNA 3QKZA 2GR2A 5DXYA 4GXWA 4TX6A 3CV7A 3FVMA 3W1UA 2PDGA 3WK2A 2H8ZA 1XPGA 1XIHA 3WJXA 1V3IA 2A3AA 3LX9A 3DFPA 4FR6A 4NNCA 3QHNA 4Q6JA 4H4SA 1FA2A 3GLCA 3QR3A 2FB2A 3R11A 2Z0IA 4AAJA 1SZNA 3C2VA 4O17A 3PN8A 4LQ1A 3N14A 4GYPA 2QCCA 1WZMA 3ECQA 4ZOCA 1QI0A 1TUXA 1HGWA 5IHSA 2YVFA 4U31A 4I8YA 3OTRA 3TR2A 4BI5A 1LROA 1Z9AA 3PZTA 4LS1A 3AJ7A 4ZFMA 4TUFA 3DGBA 4BF9A 1TWWA 2Z6JA 4F79A 1MUMA 1SR9A 2QCEA 4UNIA 5FCZA 1SGJA 4IJBA 2X2YA 4F2UA 4PUMA 5DFAA 4AF0A 3M0MA 3L4ZA 1OIMA 3NQEA 2OZ0A 3NVTA 4AC7C 1LG2A 1UD4A 1UWQA 2RGLA 3AXKA 4S3BA 1HJWA 4MY9A 4GRTA 1TUFA 1HQTA 2QGHA 4CN6A 3B0XA 1OK4A 2VZSA 5D2VA 4BHYA 3CHEA 5LHEA 3PZVA 3BICA 3PS7A 3LPOA 1TYPA 1EKOA 1I8JA 4JL2A 1TREA 3UYIA 2DGAA 3WFLA 4GNVA 2G5WA 4GG9A 1H1NA 1NU5A 3E0VA 5I3KA 3VFLA 3ABRA 3CU2A 3PJUA 1ISYA 4Q8MA 3UZYA 3ES7A 3SADA 1L2UA 1GCYA 2D2HA 1IEQA 1QBAA 5A8NA 3VXGA 4D71A 4NZ3A 3DI1A 3SN4A 1AQMA 1IGSA 3ARTA 3PAJA 1XLGA 1C91A 1SVDA 4E0CA 1UWUA 1SO4A 3C3UA 3KUMA 1UKSA 4P7OA 3FJNA 4LOCA 2ZRUA 3RMEA 2V3GA 1JFHA 3KLJA 2YL8A 4J3WA 1RBOB 3WQ4A 1RCQA 1W9PA 4QP0A 3EX3A 4A6GA 2ZX8A 3N73A 1BSLA 2C1IA 2BY1A 2HXTA 1IV8A 4K1WA 1JZ5A 3GVWA 3YPIA 3QTPA 1UIOA 4YLWA 2D3LA 5CKSA 4CVWA 3RJYA 4IPIA 3KAOA 4NAEA 4EPBC 1VFSA 3A6OA 1QOPA 1PV8A 4YYCA 3AISA 4U3CA 1KKRA 3GDTA 3S47A 4FXJA 1RH9A 3UXIA 3A3XA 3UERA 3F4VA 4L5ZA 5MKGB 3W2NA 3M9YA 2X16A 2CZEA 2V2HA 3GAYA 4MFDA 1ZL1A 4B9ZA 1LWIA 1X8FA 3G24A 1WX0A 2X1RA 5SWUA 3W2UA 2VZOA 2C15A 5D9MA 3B40A 3UY7A 1TPC1 2QCFA 2CETA 5TNVA 3GAKA 5KVHA 2ZUUA 1F6KA 3KVKA 1ALDA 3ZVHB 2XGBA 1PYFA 3VPLA 4JQ4A 3P7YA 5LIKX 4U2ZA 1NQ6A 1UASA 3W7GA 3EWZA 4XZIA 3LHUA 3PNUA 1OGBA 2DIJA 4NQ1A 3CB8A 3TTYA 2F2KA 2Z7KA 1EQPA 5FJJA 2BC0A 1I2NA 2ZC8A 2Z24A 1MUCA 2ZC1A 5JIWA 1Z44A 2E8YA 2WYSA 3MU7A 2G95A 2V5JA 4YWOA 4F0HA 3KP1A 1XYLA 3HTWA 3MVIA 4U28A 1Q8JA 1M7XA 3BCDA 1HF6A 1UJQA 4RZ6A 5I79A 3HO8A 4JTTA 3HOJA 1CXEA 1W2PA 3DKJA 3NPVA 2JF6A 3A12A 1DJGA 2BODX 3F5LA 4ADSA 3AMZA 3EPNA 3DC8A 2ZRZA 3E2SA 4BR1A 1ZJIA 3BGJA 1UZ4A 2JEPA 1IR2A 3IJIA 1EOKA 1Q7QA 4BEQA 1FFVC 5BRQA 2OKTA 3WLLA 2VUYA 4GQ0A 2WKLA 2XDFA 3MUIA 1NOFA 3WLMA 1T7LA 1WZLA 3MTWA 4H41A 1Z41A 2OVLA 1VJIA 4FX7A 1GWJA 3TW7A 1V3MA 3PBVA 3CO8A 2OSXA 2OWWA 1JPMA 4ADTA 1S5TA 2BWGA 3SFWA 2XSXA 1JUEA 3EWXA 1HW6A 1EBGA 2PLMA 1JULA 2G3JA 2OQLA 3QY6A 3PVFA 3UFYA 3QMTA 4ATLA 4TIMA 3MWCA 4QE4A 4R85A 4F66A 2Z28A 1NM9A 2QAPA 1YNQA 5AYIA 4MJ2A 2ZYFA 3LTYA 1DJWA 5LYRA 3UG5A 1GJPA 2UY5A 3SCQA 4LF2A 1Q8AA 3RX3A 2PPGA 1KCXA 1B3VA 3SUWA 4XUGA 4IQJA 1ESWA 4AD3A 1US2A 1HL2A 4US5D 2GVLA 3PUEA 3MJMA 1VF8A 4CCEA 3QV7A 2HS6A 2IMRA 4OUIA 3BANA 5DCEA 6REQA 1L6FA 2NT1A 1GONA 2GVGA 4H9ZA 4KCTA 4KWSA 3H7VA 4LV4A 1AFSA 3TC3A 3IV3A 2QGYA 1B3XA 4G7EA 2C16A 2ODOA 4CUCA 1V59A 5FI8A 4BY3A 4IMAA 2D73A 3QSTA 3WQFA 1UR3M 1XLCA 4I7VA 3LBCA 2CW6A 2XH4A 3TA6A 3UZ5A 1ZALA 2F61A 1N8FA 1ZBCA 3LHTA 4TVWA 1XCWA 3ABXA 3OYXA 3LBMA 2Z1VA 2W0HA 2Y8UA 4QIUA 1H4PA 1JPIA 1ZK7A 4TVCA 3GNOA 4R88A 3UZZA 3SCWA 5DMLA 4AZCA 1UP0A 4AVFA 4AIUA 5AC5A 1EOMA 3VA8A 1YQZA 2W5FA 2PDKA 1B90A 3GD6A 3GU2A 4MGGA 2WW5A 4MG4A 2C3CA 5HQMA 1PZ0A 2A3BA 1WUFA 4AW7A 4PEKA 4I5RA 5H8MA 4F0LA 2J78A 4F3HA 2LLEA 2RH9A 1Y5WA 4ZXLA 2G50A 3CMJA 3OG3A 1HJVA 3ZT6A 4F8XA 3WBEA 2RABA 3KS5A 4UNLA 3A9IA 4GPNA 4Z1BA 4JDRA 3NL5A 2JK6A 1KFEA 1FECA 4MWAD 5D05A 1XC4A 3CUGA 4B4HA 3GIYA 3QPYA 4WGXA 3DHPA 1VENA 3VMOA 5JCLA 5CQ1A 3BQ6A 3Q6JA 1AZ2A 4L1XA 2XSBA 4WK9A 1LL4A 3VZXA 2QZRA 1YEYA 4XIAA 4UFLA 3SR6B 3L0NA 5EY5A 3DK8A 1QK2A 1FWTA 3VGGA 2WOVA 2XJ7A 1QO5A 2QPUA 4JGDA 1HG3A 3A23A 4CD8A 4O1CA 2QCMA 2WM1A 4M6UA 3DIPA 3LLDA 5GVJA 3NQ7A 1C8QA 4OIFA 1E0XA 5KITA 2VENA 3SSJA 3IJLA 2P0OA 3KCJA 4PODA 3WLRA 5DEZA 4CD4A 4JOMA 1UA3A 1YBQB 3P5YA 2E6FA 2CZVA 1A5BA 3D47A 1BHGA 5KINA 3FAXA 3OZOA 4PEEA 2OWXA 3BZJA 4NEWA 2P88A 4EPEC 5REQB 2PMQA 3HQ1A 1IQ8A 3DN5A 3PPHA 3KRUA 3TXZA 2CXGA 3SCUA 3EANA 1VPXA 4IIGA 4FLOA 1EB3A 1JF6A 2W91A 4D8ZA 5LGXA 2D22A 3M5XA 1OFDA 3M0JA 1CGTA 3DFOA 3V5FA 1K1DA 2HK0A 4RKAA 1Q3NA 1R46A 2YCJA 2QT3A 2EGZA 5FF7A 4RV8A 1ZCCA 1EXPA 1SU5A 2BASA 4IH3A 1P6CA 2QF8A 2J6VA 4HQVA 4LIIA 4QM1A 4HKPA 4WEVX 1AW5A 1YE4A 4CD5A 3H21A 3VGEA 4AWSA 4LUSB 3SCNA 4GUGA 5G4WA 3KVLA 3GW0A 3VMNA 4FAMA 3QOKA 4IX2A 3WBYA 1OC7A 3HGJA 3WLTA 2FB3A 4WHBA 2E77A 3W83A 2D2JA 2Z26A 5EL1A 3RGTA 4GVHA 1F4HA 3C0SA 2IS7A 3F1QA 1IHIA 5CC7A 3STCA 2YR1A 4AQLA 4RE4A 1XLHA 1H7OA 1SFJA 2GDUA 2RGMA 2X8RA 4XBJA 1XCXA 3GKAA 2V5KA 1QW8A 3U5UA 4RNIA 2PGFA 1HJUA 3OO2A 3LG3A 1N82A 4GLEA 3CBWA 2GR3A 3M07A 1X2HA 1GOOA 3VU2A 2E4TA 4ILSA 1HL9A 1PX4A 2JQXA 1E0TA 1AQFA 3SFKA 1IIHA 1ZRQA 1G4TA 1XSIA 3G1HA 3LMZA 4K1GA 1IEVA 4HU3A 1NWTA 1XUZA 4IL0A 3E02A 2WANA 3WENA 5EMJA 5JBFA 4Z0JA 3UNDA 4MLRA 2UY3A 3DG3A 3S4TA 3OU8A 3GX9A 1XIGA 2VI0A 4S38A 4HOZA 1E6QM 1GVFA 3R58A 2PD5A 5T91A 4TMBA 2GPTA 4GI8A 4GJIA 3CV2A 3WLHA 1OEPA 4GGBA 1GT8A 1VRXA 3NQ2A 4DNAA 1I1XA 4JX4A 2D20A 4D8AA 3LLXA 1B3ZA 3BZGA 4JQ9A 3WL0A 4DWSC 3E2QA 4JFWA 4KWOA 4KWWA 5EA9A 3AHYA 4HZMA 1TYGA 3P8JA 3PZMA 1XBXA 5HJLA 4DHGA 4ZQOA 3STFA 1CWYA 3LPGA 2J9YA 4DNMA 2P8BA 2TAAA 4YCPA 4IMGA 1W9DM 1B54A 1F73A 2XZ9A 4REQA 3KOYA 5IM51 4JDBA 1GYMA 4QRNA 3CEUA 1UWTA 2EQ7A 2DH3A 3ARUA 3DJGX 3LQGA 3KTXA 3RMJA 4W87A 3V1PA 1A5MC 3LCLA 2QDDA 4J3ZA 1W1ZA 1KWKA 2EKCA 1UD2A 2GYIA 4H6QA 3BLKA 3OB8A 1KFJA 4HN4A 3S1VA 1FQ0A 4UMBA 3EZ4A 4IIBA 3GIQA 4H4ZA 1OABA 4GYJA 2UY4A 3RITA 4HSNA 1E5NA 3A24A 3COTA 1NFBA 2V2DA 2HPIA 2YZ5A 4LVFA 2CCRA 5D2XA 4R3UA 1XQKA 3M6DA 1H0GA 5AC4A 2OEJA 3LMYA 4UBPC 3ABZA 2W66A 5HR6A 4DJFA 4Q8PA 4WDXA 3M47A 1A4MA 3EMCA 1DJYA 2R9RA 1NDAA 2WOQA 3P6LA 2X7WA 3IVSA 1U30A 3FCPA 4ICCX 5HNNA 5DMNA 3PF3A 4Q4SA 1Y7VA 4IJCA 2WCAA 1A80A 1GQKA 4OBTA 1EP2A 1AD1A 3GYEA 1KGWA 2RDUA 4NXSA 2QJJA 3IGSA 2RHGA 1J4EA 2VJXA 3FJLA 2A7NA 4NZCA 4IHCA 4LEFA 4Q4PA 1ZX9A 1UD8A 2PDBA 1GOWA 4HK6A 2PUZA 3ZZ1A 2EPOA 1QHPA 2QQ6A 1S2TA 4RX0A 1LRQA 5A2BA 5C9WA 1B30A 1O12A 2WB5A 1UOZA 3LSCA 2OYKA 4H8UA 1BEUA 1AZ1A 1TPVA 1I6NA 2DY3A 3E2VA 1TWDA 1XRTA 1SFLA 2G3IA 1JDEA 3M5ZA 3ITOA 3PZOA 4G5DA 3DFTA 4FP1A 5BROA 4JEJA 4JPGA 2C0HA 3ITTA 3DERA 5CPOA 1Q66A 4AY1A 1ZQ5A 2YPIA 3PHAA 2NT0A 4CQAA 1HVQA 3T7VA 3U48A 1W5QA 3AU2A 5A6LA 3V16A 1J0KA 1O5KA 5TAOA 2A85A 3R25A 4LEQA 3CHFA 4NJKA 5BRBA 1E9IA 1Z89A 3H2OA 2OWCA 2J9ZA 3L67A 4INFA 3AU6A 2PGRA 1KXTA 3GNXA 3SRFA 3Q37A 4GIEA 5J5DA 1A3WA 3LY0A 4MY1A 3EA2A 1F3XA 5FF4A 2DZWA 1S2CA 1BF6A 3O63A 1B9BA 3WQ6A 4QTGA 3FN9A 3M41A 4LAMA 1P7TA 2HRWA 1WOBA 1NWUA 4ACZB 2Y24A 2QLYA 3GHUA 4O4WA 2X0YA 3NNTA 3KP0A 3W22A 3AWNA 3CWNA 1RK6A 3M43A 4K8HA 1VIZA 4Q7NA 3VINA 3U7BA 3GNPA 3AYTA 3H2AA 1DHPA 3FXGA 4X0VA 2BBFA 2ESCA 4A3YA 1T8XA 3T6CA 1TJPA 4QCFA 2CERA 3KM8A 3TOPA 3RPMA 4Q7IA 4XVEA 1K7XA 3L4YA 1R3RA 1GVIA 4AZGA 1S2VA 3LM7A 5FKYA 4XZWA 1SMAA 4GJ1A 1QASA 3UG4A 5DLCA 4BJHA 4JQAA 2WNNA 4WY0B 4MKVA 5FS7A 1JRBA 4ZQMA 2PF0A 1Q13A 1T8QA 7PTDA 2HS8A 1YXCA 2VFHA 4S3EA 3NQ8A 2ZX5A 1Q1RA 5D2TA 3K8KA 3NO5A 2X50A 1ZKQA 5DN1A 1XRSA 4YTTA 4OZOA 1SO3A 4HJFA 1KBBA 2PLKA 2HV5A 4LB3A 4V1XA 1XBZA 4C6QA 4E2OA 3W7DA 1MDLA 4JQ3A 1LOQA 3A9BA 3GDRA 1W6TA 4K2SA 4X2PA 5FF2A 1WO2A 5D38A 2WXDM 1E51A 1KN0A 4L9XA 1X96A 2GOUA 5AHIA 4LAOA 2WZEA 3URNA 3ATYA 4H8NA 2VDHA 5CJNA 1H09A 1FUYA 1TIWA 2D23A 2A21A 3G1SA 4IG2B 2WBAA 3GXNA 4PZVA 4O1EA 1J18A 3GRTA 4O57A 1IXOA 1BTMA 5XIAA 1BG4A 2Z00A 3PJXA 3LHYA 4HOWA 2B7QA 2G3MA 3URAA 4AXKA 3ARYA 1R3SA 4L64A 4RDYA 3RFAA 3KDOA 2WMIB 1OF8A 1VFFA 4Q8NA 4YVXA 4ATDA 1XGZA 2YCLB 2GK1A 3UJEA 5AFDA 4CQ8A 3K13A 3L4WA 1DXEA 1KM4A 4QG6A 1VYPX 3QGKC 5IXEA 3SQLA 1WDPA 4WKAA 1XDMA 1KFLA 1X98A 3HN3A 1NTHA 4NX5A 4HCLA 3TAOA 4QAWA 3VIMA 1EH9A 3HGOA 1AW1A 3W6MA 1FIQB 3MW7A 4LUIA 2WJFA 4UFKA 2FQIA 3S5OA 3G6LA 3A4XA 3TUUA 4GVFA 1BYBA 3M7SA 1JGMA 3TZFA 2O9OA 3HMCA 4ZOBA 3VNIA 1ITUA 4FXFA 3TQVA 2YYTA 2A3EA 4DJEC 4S3JA 1L6YA 3STGA 1ZAIA 1VEMA 3L5OA 1UZ1A 1E55A 4ASTA 3NQ6A 1XFCA 3GTNA 1GRAA 1G0CA 2VMFA 3KBNA 3GG7A 2PC4A 1B5TA 1FVPA 1EDTA 2UY2A 3QYSA 3DX5A 4ZMGA 5LZLA 1WDQA 1OCJA 6ENLA 3M5YA 1UKOA 1KB3A 1FHDA 1A0DA 3BVJA 3AZTA 1EO7A 4ZEPA 2DUAA 4B5NA 1AW2A 5T8GA 3RM9A 5EMKA 2DVTA 4D1JA 2PTDA 2OEMA 4U10A 5CG0A 1DJQA 3R5EA 2O9PA 1JG9A 3LBOA 7TIMA 3CO4A 2WSPA 3WMSA 3GIPA 3U9IA 3MCNA 3MS8A 3WQPA 2CLHA 1KFKA 2DZBA 2IQDA 3PR2A 1GRTA 3QMRA 4OUEA 4ZB2A 1X6NA 3WELA 3HPXA 1TCDA 4QCEA 4LYRA 2AOSA 3LD5A 4IISA 4AEEA 3AXXA 3PZQA 5CBBA 1H60A 4J4KA 1TA3A 3G1FA 4ENLA 4CU7A 1EA9C 2WCGA 4C6FA 2Z6IA 5CSRA 3NQGA 1UB3A 2NZLA 1E0VA 2V63A 1XI3A 1W3NA 5C2GA 4MNKA 4M81A 4LT9A 1M41A 1DWHM 3DFYA 2ZUMA 4E2BA 3U3HA 1EUNA 4AY7A 3F03K 3NAVA 3S42A 4WDWA 2QAEA 3EWWA 1OX6A 1V08A 2ISFA 3M16A 4F0MA 1VPQA 3IIPA 2FZMA 3WQVA 2CXEA 2A3CA 3WQEA 5DMYA 1EF3A 2C71A 5AC8A 1Q2SA 2ZXDA 4Z2LA 4ADWA 4Z42C 5A2CA 4PCNA 4CQBA 2GOKA 1EJUC 2WVVA 4M51A 4K8EA 1PXGA 4YTUA 4ZENA 4B2DA 5HBFA 3UG8A 1SFSA 2QUUA 1M1BA 3LTSA 3H4XA 1NWSA 2WSYA 4A05A 5DX7A 3WK3A 1AOGA 1GV4A 2E9MA 4MDPA 2I5IA 2ZRVA 5LIWX 1EJVC 2E09A 2Q8ZA 5HR7A 3VX1A 3UR8A 1C8XA 4LV9A 1BSIA 5A6TC 4RW3A 2YXOA 2R14A 1W9UA 2CZFA 3IGUA 4KFPA 2VQTA 3GB6A 1GK8A 3NOEA 3UGVA 1FWNA 4QLKA 4AUBA 3H70A 3E5PA 1EPXA 2ZX7A 4KCVA 1LBMA 5RUBA 3RLHA 1VQTA 4UQEA 5H6HA 3PBUA 3CAKA 3TQPA 4W93A 3WFZA 1N5XA 1DQXA 4PB5A 1Q6QA 1E56A 3N2MA 4KFOA 4KEMA 3TXVA 2FZ8A 1CGYA 5U7SA 2GQAA 4CCZA 4MMWA 5GJNA 1R30A 3LI1A 1H7NA 2GUBA 2PTWA 3PSVA 3T40A 4L1GA 2YJQA 4H7ZA 3RNDA 4TQTA 4BEUA 4GKTA 1UUQA 3H53A 2YCKX 4PB4A 2ISSA 2EXOA 5CGQA 1LRNA 3ZWSA 5D30A 4PMDA 1L2QA 3WNMA 3WH5A 3PBYA 3MMUA 5AN7A 1S7MA 2A3LA 4HNOA 3TWAA 1X97A 3ISIX 3APYA 3CPRA 3MBDA 1IZJA 3REQB 4AZ6A 4O1FA 1CGUA 3AAMA 3S5YA 3K5XA 3N2OA 2NV2A 4LRTA 2F7FA 4WUIA 4PTXA 2OT1A 1TPWA 3QY8A 3HA1A 2OOGA 4DB7A 3QY7A 1QPNA 1M53A 3GTXA 2FPVA 1U33A 1EP1A 4HYWA 2BHZA 1V7YA 1R5YA 3PY2A 3R0DA 3EDDA 3WLJA 1WZKA 2ZXBA 1XH2A 4UB9A 1H61A 2FVKA 3B97A 3OGVA 1DXIA 4LSBA 1XPYA 1R9YA 3AIVA 3FY1A 2I14A 3BPWA 3C8NA 2NXHA 2VD8A 1R2SA 4EWND 5ENLA 1L0PA 2QCDB 3GWQA 2IXVA 3PUDA 1LPFA 1OG0A 3CIVA 2CLEA 5M17A 1RHCA 3OVGA 4LNYA 5F2IA 5C71A 3VIHA 4E3VA 3P0WA 3N9SA 3UA3A 1M6IA 4AIEA 3CTLA 5HJXA 1DL3A 1OD0A 1S5WA 4ZXOA 3GXTA 3R2GA 1F3PA 3TZNA 2WMGA 2CLLA 3I6RA 4FNTA 1V5XA 4CN4A 1GTEA 2AAQA 3CQKA 2EPKX 3BAKA 5I3GA 2EEXA 2PDPA 3FS2A 1RR2A 3W7LA 2RJHA 2PA6A 3IIOA 5A8GA 3V1HA 2WV8A 1J6OA 1FRBA 3A4JA 3MDUA 3MT1A 4JEQA 4AD0A 3P2VA 2WSKA 1LQ2A 1IT0A 1XYZA 1LP6A 1UD3A 3TYDA 1W8SA 1RVGA 2FGZA 3KCOA 2E5DA 4FI4A 3TLQA 4XQ6A 4Q7BA 1QATA 2VC6A 4F2BA 1PX8A 2WHMA 5BNKA 2I57A 3GVQA 4NP7A 3SSZA 1ELSA 3F2DA 1V97A 1AMKA 1XM3A 1W1TA 1KBLA 3JR2A 3IANA 4JTJA 2A5HA 5IBXC 3RX4A 5MKGA 1J6PA 1K9FA 2ISDA 2BGSA 4I9JA 3NZQA 3OODA 1VYRA 1CXHA 1M7JA 1O68A 3GH4A 4LCSA 2GR0A 3I6TA 3MHFA 3B9JB 1XLDA 2PDNA 3EOOA 1TV7A 4EM3A 3CAQA 1FCQA 3Q58A 3OJGA 4TV5A 5DQPA 4JCMA 2E25A 1THFD 4K68A 3TQ0A 3RDKA 4YYFA 1QMLA 3UW6A 4S23A 5L9FA 1AJ2A 1EWEA 2PWUA 3QHOA 2OPJA 2PU1A 4LUYA 4JIRA 4RCXA 4BQ5A 1UIPA 3D3AA 3U2ZA 3BARA 3CEPA 4MNMA 1QPKA 3O0KA 3VCRA 4PFMA 1RZMA 4DF2A 1RQEA 2E1WA 1CB2A 3VKBA 1E70M 3VDCA 3UXDA 2Z7GA 2R8WA 1GKPA 2UZ9A 5AHLA 2NXIA 2R82A 5CPSA 1M7PA 3L66A 4C6MA 3Q45A 2VGBA 4ZVJA 2XIMA 3TNBA 4L4PA 3C2YA 1W32A 3DC0A 1Q45A 1EJXC 3CGEA 1UWSA 2W3RA 4NSBA 1GORA 2ZZ1A 3BLFA 2Y5JA 2YQUA 3CZEA 4UFJA 2XVNA 1LWHA 3MZ2A 3PG6A 1ZUAX 3CL8A 2HISA 2RKXA 3SUUA 1T5AA 3WH7A 3NR0A 4YS1A 5FD0A 1PS9A 4KEZA 1OHLA 4YJ5A 1UWAA 4OBSA 1OADA 4CD7A 1LQAA 4H04A 5A6BD 3HU7A 1VFHA 3LYEA 2YX0A 3T42A 3W3OA 4MADA 2MANA 1VC4A 1HJQA 3V3WA 3NSNA 2QIIA 4FNQA 3EX1A 3LPFA 2EAWA