3KUMA

Crystal structure of dipeptide epimerase from enterococcus faecalis v583 complexed with mg and dipeptide l-arg-l-tyr
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
354
structure length
354
Chain Sequence
MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGEGGPGIFITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKISAFAPAAKAAIDIACYDLMGQKAQLPLYQLLGGYDNQVITDITLGIDEPNVMAQKAVEKVKLGFDTLKIKVGTGIEADIARVKAIREAVGFDIKLRLDANQAWTPKDAVKAIQALADYQIELVEQPVKRRDLEGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAEETTIGITAAAHLAAAQKNITRADLDATFGLETAPVTGGVSLEAKPLLELGEAAGLGISH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Dipeptide Epimerase
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 123
structure length 354
sequence length 354
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3kumA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3kumA01
1EC7A 3P93A 3GO2A 3QPEA 3DESA 2PCEA 3NO1A 3VDGA 3VC6A 4HNCA 4J1OA 3BOXA 3DEQA 4IP4A 3BSMA 4G8TA 4GMEA 2ZADA 2OZ8A 3T8QA 1MDLA 1R6WA 3MKCA 4IT1A 3FJ4A 3N6HA 2QJJA 2GGEA 2PGEA 3DDMA 1JPMA 3Q45A 1EC9A 3TJIA 2QDDA 3QKEA 3IJIA 3OW1A 2AL1A 2NQLA 1MUCA 4GISA 3UXLA 4GIRA 3PK7A 4MKSA 2PTYA 1TZZA 2CHRA 3QLDA 4E4FA 3NZGA 3OPSA 5BOEA 5IDZA 5BOFA 4H19A 3RCYA 2AKMA 1DTNA 3HPFA 2PP1A 2PTWA 4IL2A 3V3WA 3SBFA 2HXUA 3SN1A 4J3ZA 2XH7A 4H83A 3U4FA 2ZC8A 3UCCA 2P8CA 4E4UA 3R10A 3R0KA 4E5TA 4JHMA 3JZUA 1JCTA 2MNRA 2XSXA 4MMWA 1SJBA 2XGZA 4M6UA 3UJFA 3V5FA 4H1ZA 1P43A 3OZYA 1W6TA 4K2SA 1KKRA 3ZLFA 3JVAA 3FXGA 2XH4A 7ENLA 3FYYA 4DXKA 3DGBA 1EBHA 4JN7A 4EWJA 3GC2A 1TKKA 3MSYA 3CAWA 3JW7A 4GGBA 2GSHA 2ONEA 2OX4A 3VCNA 3FV9A 4HN8A 1ONEA 4KPLA 1XPYA 2QGYA 3OZMA 4ENLA 1KKOA 3UJSA 5FJTA 3MWCA 3DFHA 4E8GA 2OQHA 3N6JA 1WUFA 2FYMA 3VA8A 3ENLA 3SSZA 4FI4A 1L8PA 5EU9A 4ZCWA 3TOYA 1BKHA 3SQSA 3NXLA 3IJLA 3BJSA 4DWDA 3ZVIA 2QJMA 3GD6A 3MZNA 2OZTA 5ENLA 3N4EA 2PS2A 3I6TA 3FCPA 4KT2A 3Q4DA 1ELSA 3UJ2A 4A6GA 4HNLA 3T9PA 1NU5A 3DFYA 3V5CA 1MDRA 3FVDA 3DG6A 2QDEA 6ENLA 3CT2A 3OP2A 2PP0A 3CK5A 1PDYA 3DIPA 1TE6A 3CB3A 3T6CA 2PMQA 3DERA 3MUCA 4DHGA 4IL0A 3MQTA 3TWBA 3RITA 3TCSA 1F9CA 3VC5A 2AL2B 2PTXA 3S47A 2HZGA 4K8GA 2PP3A 2HNEA 1JDFA 2QQ6A 2GL5A 2PGWA 3P3BA 1EC8A 3H8AA 3R1ZA 2P3ZA 3ZVHB 3UJRA 3ZLGA 3TWAA 1JPDX 1SJCA 3ES8A 2DW6A 3RRAA 4DYEA 3RO6A 1R0MA 3K1GA 3PWIA 3I4KA 2GGJA 1FHUA 2PU1A 3SN0A 4H2HA 2P8BA 2XH0A 2AL2A 1RVKA 3B97A 3EEZA 2OVLA 2PPGA 3QTPA 5J04A 2RDXA 1XS2A 3STPA 5FJRA 3P0WA 3ZVHA 3IJQA 1PDZA 2GDQA 3H12A 3T4WA 4E6MA 3VCCA 1WUEA 3UCDA 2OO6A 3QN3A 2HXTA 4GYPC 3R25A 2OLAA 3ES7A 1ECQA 2AKZA 5FJPA 3DG3A 3OTRA 3UGVA 3IK4A 1FHVA 1BQGA 4ROPA 3TJ4A 3I6EA 1NELA 2XH2A 3MY9A 2PU0A 2OG9A 4FP1A 2POZA 3V4BA 1SJAA 2OZ3A 4IHCA 3RR1A 3H70A 3TW9A 3RGTA 1OEPA 3PWGA 3CXOA 2GGGA 3R0UA 1MRAA 3TTEA 4HPNA 3N4FA 3ZLHA 4DX3A 2PSNA 4GYPA 2DW7A 4GFIA 1KD0A 2P88A 4A3RA 4HCLA 4Z1YA 4GGHA 5FJOA 3D46A 3H7VA 3R11A 3UJEA 4JN8A 4KEMA 4F4RA 4X2PA 4MGGA 3THUA 4G7FA 4HYRA 3SJNA 2OKTA 3TQPA 2OPJA 4ZA0A 3D47A 2GGIA 4KWSA 3CYJA 3KUMA 2P0IA 2GGHA 3DG7A 1EBGA 2PTZA 2O56A 3S5SA 2PODA 3UXKA 4A35A 3VFCA 1SJDA 5FJUA 3SN4A 2OQYA 1KCZA 4HCDA 4HCHA 2QJNA 1YEYA 3EKGA 1MNSA 2MUCA 4DN1A 3U9IA 2PA6A 4M0XA 2I5QA 3PFRA 4IP5A 1P48A 2QVHA 3GY1A 2FKPA 4Z17A 3NFUA 1IYXA 2OFJA 1E9IA 4IZGA 4K1WA 4YWSA
chains in the Genus database with same CATH superfamily
1GTHA 2ACUA 2YA1A 3H4XA 2BFGA 2QUUA 4CEXC 1F4HA 4PGLA 5E09A 2IPGA 1X6NA 4YTQA 5C9XA 2NPXA 4PUNA 2I17A 3UETA 3W23A 4NX0A 3T8QA 1MDLA 1QNRA 5HWNA 2GVLA 1WDDA 1ZB5A 5KZMA 4QDPA 4UFMA 4O0KA 1S5TA 1F6KA 3O15A 1EJSC 3V0SA 3GG8A 3VIHA 1TIMA 4GZ7A 4JEQA 2VRQA 1G4TA 1N63C 3PZTA 1HL2A 1PYMA 4UQDA 5HPCA 3J7HA 1QW7A 4LJ3A 1F6PA 3BLEA 3K8LA 3LRLA 1R3SA 3M5ZA 5BOFA 3O6DA 4S2BA 4JR5A 3RFAA 5CBJA 1WXYA 3MDWA 3B9OA 4U2YA 3NOYA 2GVJA 2WPCA 1P0DA 4HJFA 1XRTA 3KRSA 3W7HA 4FO4A 2W62A 3QOMA 1BF6A 1UC4A 3ABRA 4XUYA 1Q6LA 4YWIA 1LLZA 2V5JA 3L2LA 1XH2A 1LCOA 3R0KA 1TMLA 1OABA 1QOQA 1RHCA 2QHAA 4JL1A 1FWJC 3G1DA 1SJBA 3NWRA 4JX4A 1ISYA 1YBQB 2E8ZA 4CQBA 4Z2GA 2B7NA 4XAPA 4K2SA 4O0ZA 2YSWA 1K4GA 1SMDA 1D3HA 1KLZA 1VBHA 2DP3A 5FSEC 1WDQA 3O05A 3QC0A 2ADAA 4B3ZA 2OYMA 4TO8A 1E71M 3HU7A 5LIYX 2GSHA 4RXGA 3CH9A 1XGZA 4QE5A 1VZWA 5BYWA 4ICMA 4QDWA 1K7XA 5DXYA 2DORA 4J56A 2V2HA 1JR1A 2A3HA 3W82A 2GQ9A 3NQ7A 1IGWA 3UJSA 2PDGA 1CXFA 3MSGA 4V2XA 1JZ6A 1TVLA 3BW4A 4AISA 4FDCB 2ACQA 2G3NA 4R85A 4Y9OA 4O57A 4UTKA 4QE4A 4UZUA 3MZNA 2AQOA 3P67A 3N4EA 4AYSA 4UR7A 2Z00A 4URIA 2VM8A 3P84A 2B31A 4MAZA 1JFXA 4LALA 3GDBA 1A4LA 2BVYA 1KB3A 2UY4A 3L4VA 3FA5A 4IWWA 3IJ8A 1HFBA 4EIVA 4U3CA 5KEZA 4JQ4A 3SCRA 2QF7A 3GVVA 1K9TA 4LUSA 5A6MA 4GQQA 4G2DA 2WVSA 1Y5WA 4DYKA 4P8VA 5F1UA 2G97A 2VDHA 1JZ7A 2VFHA 5AYBA 1W5PA 2ICSA 4Q8UA 3B04A 4UFKA 2YA2A 2AGKA 5A8PA 4DIAA 1RQBA 3W76A 1UW9A 3LN3A 3A21A 4TVYA 4C1NA 1R85A 2FB2A 4AF0A 1I2OA 2L5HA 1NFPA 4AZCA 5REQB 3SRHA 3HQ1A 3F1QA 4PMXA 1J5SA 1K4QA 1OY0A 1EP3A 4WZHA 1TRIA 2H3DA 3UY7A 5FEWA 2GVEA 4GXWA 5D9MA 3P14A 2FMOA 5JBEA 5IRPA 1WP6A 1FDZA 2W92A 1H7OA 4WXYA 1EHNA 1V0MA 4R88A 3F7JA 1C9WA 5K2ZA 5T9BG 2E5AA 4DO5A 4GZJA 2WZTA 3GSMA 1XG3A 4Z1DA 5CH9A 1FWHC 1A47A 1KXHA 3HFTA 1WA3A 2YCLA 4ZOHB 1PIFA 3GHUA 1OGSA 2GVGA 1Q7QA 2PDYA 5IHRA 2YX0A 3RMEA 3IUIA 5LKYA 4C6FA 5A1AA 3OVPA 3POHA 3W2JA 2V3GA 1VB9A 1PKNA 1FQ0A 2XH2A 3BLFA 3CJPA 1DWFM 3WL0A 5JMUA 3MY9A 4KESA 1US0A 1PCWA 4XD5A 2DQWA 2NUXA 5BXTA 1W3IA 4RE4A 2OZ3A 4GYKA 3E0IA 5FSDC 1UUOA 4U28A 4OE7A 4UTTC 1WV2A 3LEPA 3KOWA 2VYOA 4NAEB 3CU2A 1FX6A 4NZCA 2GJNA 1KV8A 2NX3A 1P6WA 3U4AA 4CEUC 3C8FA 3TU9A 2PGFA 5HWMA 3BLIA 3D46A 4PTVA 2YB1A 3RILA 2KAUC 1EJXC 1UZ1A 4ZOBA 1VH7A 4Y9MA 4QTGA 3VOCA 1NP0A 2GR0A 4WY0A 2VD9A 3TW7A 4LYQA 4UOQA 1IQ8A 1NSJA 4H3DA 5E5CA 5IHSA 3VUSA 3SECA 1NOUA 1PX8A 3E38A 3UXKA 2WAGA 1T7LA 2V6OA 3FDGA 3O07A 1LL4A 3GYCA 4XZBA 5HXMA 4XUGA 3LGGA 2PRHA 1XYBA 2X09A 3GKAA 4K39A 4IX2A 1JXJA 3BAWA 2PCQA 2MUCA 2F7FA 4PUWA 3U9IA 1QCWA 8TIMA 1NOFA 1A0CA 5C54A 3Q58A 2QVHA 1DIOA 5FF2A 1E9IA 1PHWA 1IIGA 3AQUA 4LY4A 5ABHA 3R8RA 4QEHA 3EX6A 4Q8MA 1UZHA 4K8EA 4MYXA 1W37A 1J10A 1Z42A 1TFVA 1JRBA 3CZJA 1CX9A 4JKLA 1Q5MA 4G8TA 2GYIA 1KM6A 1ONRA 4AWEA 4OZOA 4D72A 3RU8X 2OMAA 3E0LA 4P61A 2Y1HA 2QDDA 2VZOA 3WQ8A 1R47A 4N4PA 2DUXA 3FDKA 3ZSSA 4QNEA 2FJKA 4E4FA 3A12A 3PWAA 1BFNA 4MWAA 3DHFA 5FF4A 3SZ8A 3KRZA 2AKMA 4Y9PA 4HPXA 4NZ4A 1SZRA 4O1CA 3L21A 5BWFA 4ZBCA 1KFCA 5IDIA 1BXNA 2CXGA 1UD3A 3M44A 1M7JA 5CEWA 3PPHA 4F9DA 2P10A 2YL5A 2J77A 4L65A 3KL5A 1O60A 3AYTA 2QS8A 3LCGA 5CZJA 3H53A 4FK9A 1IXPA 1GOOA 3TC7A 4N0RA 1TB3A 1J0HA 3M0HA 4HU0A 4GY1A 1V02E 3W24A 3CQIA 4IX0A 4J3XA 1ICSA 2GDVA 3GVGA 4HOWA 3IUHA 1UQYA 1SW7A 2BBFA 3FN9A 5K7JA 4GABA 1D2KA 2R6OA 2HTMA 1QR7A 4JX6A 3PBWA 5KZ6A 3VDHA 3LK6A 8XIMA 3S1WA 2W3ZA 4TUFA 2BY3A 2CWXA 3LRKA 5AC6A 4AB4A 4PUMA 5GQBA 1UASA 4HT3A 2XZ7A 4EOUA 4A2RA 4DAIA 2E5CA 1EGZA 4JTTA 3QKZA 1FXQA 5DMYA 3MCMA 1F3XA 2Q6ZA 5M5DA 2VKZG 5B7ZA 2OX4A 3WJXA 2E40A 1P7TA 1E40A 1QTWA 4H8UA 2O4QA 5CZSA 3LM7A 4N9CA 4LNCA 3HIJA 4IQDA 5TR3A 2NLYA 3II1A 4HHPA 3W9ZA 4L80A 4LVGA 2HJPA 3N6JA 1XLCA 4C6OA 4DJFA 1DPMA 2IQTA 4MZ1A 2QCHA 4WUIA 2YB4A 4ZTYA 1CENA 4UOJA 1DIKA 1OD8A 4GLEA 5IBXA 2GSJA 3CUZA 3W86A 4ZCWA 1KO0A 1BKHA 1WCGA 5CG7A 2OX1A 2ATMA 4M29A 4MG4A 2CLOA 1QMLA 5E1QA 3BGAA 4M7TA 3SM0A 1TVPA 2GUUA 3UFYA 4JIRA 4JTLA 1NWTA 2GLKA 3W1QA 2W54A 1PTAA 3NQMA 3OOQA 2EG7A 2ZZ4A 4HNLA 5C5YA 3B0PA 4B5WA 1R46A 6REQA 1XLDA 4IG2A 3DG6A 3QPYA 1DXFA 4O12A 5HNTA 4UZSA 4MDPA 5JU6A 5JQ9A 3LSCA 2Y0FA 1D8WA 4OHQA 4XQ6A 1GRFA 1MVYA 4ASTA 2XZ9A 2J88A 2VCCA 5A6LA 2J7GA 3CUXA 3KOFA 1REQB 4XTDA 5JCIA 1FFRA 1SO4A 3CHCA 3GXDA 3H6OA 3A47A 3KVLA 1TMHA 2VI0A 3KOXA 1X97A 1E5NA 2XIQA 4B3LA 1Q2RA 1G6CA 2BG5A 3S47A 4AY8A 3SUTA 1AJZA 4UBPC 3C0SA 5F2MA 4QG8A 2OGJA 5FA5A 3VI2A 2X1RA 3H8AA 1Q6FA 1H7PA 1JPDX 4UCFA 2EG8A 3E6EA 3T0CA 1KFJA 4GI4A 2X0HA 3S6DA 1KCLA 2WMFA 1R0MA 1W91A 2H9AA 3KLLA 3GNPA 3LBCA 3P2VA 2OTDA 1I6NA 3EPNA 2E28A 1F07A 2ACRA 4D6IA 1V51A 2GK1B 5J8LA 3GG1A 2HBVA 2F2HA 1ESWA 4F40A 2W61A 1SFLA 4CVWA 3GFXA 1E6SM 1KTBA 3R13A 3FNDA 2HE5A 1BVWA 4UWMA 2VWTA 1E1EA 2J24A 1JYXA 3MV11 1EGVA 4PUUA 4H9XA 1H7WA 2D1ZA 3IWPA 3EAUA 3AHVA 1TO3A 4H4ZA 3REQA 3VE9A 2AKZA 3UPWA 3WO8A 4CU7A 3FSUA 1SR9A 3WBYA 3PG6A 1NELA 1UWAA 5C71A 3F5JA 2V3AA 4RNHA 1UBSA 4IMDA 3ARPA 3G1HA 4PR4A 1OEPA 2ZKMX 4ERAA 2QCCA 2VC9A 4TMBA 2BDQA 4FX6M 2FVKA 2ZXDA 2PDHA 4F3HA 3GDRA 2WP6A 1Z89A 3MT1A 3L12A 2O7SA 2TODA 3W3OA 3M0MA 1B57A 1AFSA 2WV8A 1BG9A 4M6QA 3NGFA 3WF2A 2WBKA 4HCLA 5BU9A 3BMVA 4XZMX 1G4PA 2BHYA 4PCNA 1AODA 3VABA 2FZMA 3ITXA 3NEHA 1JRPA 4H9UA 4DAFA 1M7OA 4CNUA 4HB7A 5HR6A 3LCHA 4DUOA 2HS6A 1OF8A 4HZ6A 3WQGA 4LVDA 4GE8A 2UY3A 3AXKA 1VFTA 3BO9A 3SUUA 3CTTA 4HMEA 3GUWA 3QLLA 2FZDA 4H4VA 4A35A 3L65A 3T44A 1ZDLA 3CV2A 4Q33A 4ZL1A 3N2CA 3KEHA 4A2SA 3VINA 4EQRA 4HCDA 1XINA 2J9YA 4AY1A 4CD5A 4NXSA 4JL2A 4DN1A 2VFFA 2V63A 5D2VA 3RPTA 2G0WA 4IP5A 4XTIA 4Y6GA 5A69A 4IZGA 3SRFA 3EOOA 5CBBA 3N4AA 3SQMA 3P93A 2AQWA 3BG5A 3B8VA 2VZTA 4Z0SA 2WSRA 3VAVA 1Q8JA 2ABBA 2E1WA 1GRHA 2ZVIA 1PB0A 4NRRA 1E6ZA 4E0CA 1DJIA 3NQFA 2OZ8A 2O92A 5BXRA 1VR6A 2RJGA 2V0TA 4M24A 1GKQA 4TQTA 1J6OA 2E9MA 4ML4A 3O8AA 1YDNA 3CMFA 4Y8FA 3OGSA 2EPOA 2WMHA 4R53A 3WLTA 5EGRA 4AD0A 1FWTA 4LAMA 4E3VA 4HPGA 1B3VA 4ZZ9A 3LCIA 5EBUA 5AC4A 2ZZCA 1K9FA 3HV9A 3VD5A 3H2NA 3A64A 2NWSA 1H63A 1NOWA 1UOKA 4QLKA 1ZL1A 2YGYA 2Z1XA 4O28A 3W2KA 1GVFA 4JQAA 4OFCA 4MJMA 2J7EA 4ZXLA 3WK2A 4AEEA 3PJTA 3TLQA 2ZZ5A 1JG9A 2YPIA 3DHPA 3JZUA 3UXAA 1VJIA 2MANA 3BDKA 1Y65A 4GOAA 5JXQA 4ZQRA 1N82A 2JF6A 1X96A 2ZCGA 4RW5A 5FEZA 4DJDC 3VNZA 1JVNA 4IGHA 3QR3A 3A7RA 4JTAA 2NSXA 2O9PA 2HROA 1W54A 2WPBA 1YPIA 2NQJA 4ZOCA 2PDPA 3E96A 1TJ1A 2VEMA 2BXZA 2QV4A 3CZEA 5HQEA 1RAKA 1XLKA 1QI5A 1EQCA 2ZIDA 5D30A 2ZA1A 3NYDA 4RE2A 1SSDA 2PDUA 3EKLA 3XINA 1UWRA 3E5PA 3IVUA 4PTMA 3CUIA 3UBPC 2ONEA 3S5NA 1WDPA 5DO8A 5ER0A 1FY6A 5AHEA 3DAQA 4NI8A 2QGYA 3M47A 2RJHA 3B4UA 1SZNA 3M0YA 4QSFA 3L2IA 4WGHA 4WD0A 1KKOA 3WG6A 3LLXA 1N5XA 3A22A 3TTYA 3TCEA 1J11A 3NPVA 1A3HA 1QK0A 3N25A 4H9MA 2GDUA 4MWAE 2YW4A 3OODA 5FCZA 3VZZA 3VNMA 1SO6A 2E7FA 3NQAA 4RX0A 4XBSA 3CWOX 3DFPA 3BE7A 4G6CA 1KWGA 5GPRA 1ZU8A 3LA4A 1ITXA 1ISZA 2X99A 4QAIA 4O4VA 3DFSA 3WD1A 2RDWA 3OLEA 2CZFA 4LPCA 4RXFA 1E0VA 3Q37A 2HBXA 3PP7A 2BY2A 3AIBA 1DHKA 4JFSA 4V15A 5CC6A 2HK1A 1HJXA 1NVMA 3DERA 4DY1A 1UWSA 1YXDA 4J3TA 4WHBA 4S2CA 5LZLA 3QJAA 3TFXA 1DEDA 3ABOA 3GNRA 4ZGYA 3TWBA 1E51A 3SCOA 4D9PA 3AXXA 3W2NA 3F03K 4S3DA 4B2DA 1XX1A 4GUHA 2HZGA 5EB8A 2ZYFA 1OB0A 5PTDA 1OIMA 4N9DA 3KCJA 3BJTA 2J8FA 5M2FX 3WH9A 4H6QA 3CASA 3ES8A 5FACA 1DJXA 2W3RA 4X2RA 2G96A 1H1ZA 4AG0A 3ZOAA 3NM1A 3T2QA 3UA4A 3U0HA 4W8BA 1EWDA 4POCA 1FWGC 4UFJA 1XLAA 1TJRA 1OSEA 1C90A 1VKFA 4IUGA 3G1YA 4AWTA 3N13A 1ITQA 4X9YA 4B5VA 1XBZA 5K4ZA 1OK4A 4MB3A 3SN0A 2WO5A 2ZUVA 4IF2A 4A8LA 3KZSA 3S9ZA 2DVUA 1I0BA 4JY9A 3MUZ1 3WNPA 1NHSA 2RDXA 1E0XA 3SCTA 4L4PA 1FIQB 1A5UA 1V3HA 1BGGA 3H7RA 1W8GA 1GW9A 2YCEA 2CDUA 4ZENA 3KFTA 3NL2A 5HQMA 3TJXA 1M7PA 1MFVA 3P6LA 2Y8UA 3B4YA 2PF8A 3L7RA 2CYGA 2VGIA 2VCBA 3GXPA 3UPBA 4LTSA 1LPFA 3WF4A 5HJXA 3DG3A 3OTRA 1X2GA 1YKWA 5A6SA 3M07A 1FO4A 2GOKA 1FHVA 3QBUA 4OJYA 3KVKA 2VGGA 3GNOA 2PU0A 4Q7NA 1TWZA 3L5OA 3N19B 2D2HA 4CNOA 4WKHA 1KC7A 1EJWC 1HVQA 2GGGA 1TMQA 4PSRA 3ZIZA 1S5WA 1OC6A 3UG3A 5JIWA 1XDMA 3KVMA 1UR8A 4TTGA 3OVRA 1RR2A 2QCDA 1NWSA 2Y89A 1CXLA 4OECA 4NL1A 1EGMA 3ETRB 3SCUA 1WZLA 1KGXA 4G7FA 4R27A 3AWNA 1DIDA 5CPTA 3UG5A 2OOFA 5CC5A 1NWRA 5B80A 1ZY8A 3L0KA 4WGXA 5HINA 2EXOA 2C1HA 9CGTA 1RPXA 7TAAA 1SJDA 3B9DA 1LBMA 3NTYA 4PMOA 1HKKA 3SJ3A 4DJDD 4TMCA 3AN1A 3B0XA 1LOSA 2O4MA 2NUWA 4CN6A 4J4KA 4PCPA 3PF3A 3UR8A 1X7FA 4W7WA 1AG1O 3DYMA 4JBRA 1FH7A 5JCNA 3BLOA 1VD6A 4JTIA 3GKFA 4HP5A 4B91A 3SRKA 1LBLA 2BVTA 4YWSA 4LV9A 4RZ4A 3UF9A 3BV7A 1MW1A 3AMLA 1GYLA 2D0GA 4Z2JA 1R2RA 5JCKA 3DH7A 1JIBA 3P5YA 2PDMA 3SGGA 1A5NC 4LEQA 2WJZA 4CD8A 1XGDA 2V8ZA 1NM9A 1PTDA 4ZFCA 1P1XA 1W9DM 2NVAA 3YPIA 5HJYA 5AY7A 4A22A 3ZJ7A 4HBKA 1QHZA 1J01A 1AUSL 3BCDA 3ZR5A 1ZBKA 5H6HA 4M7SA 4C6MA 4NIRA 1TPDA 1MXGA 3OYZA 3RPMA 2X8CA 2Y63A 3IIVA 2XIJA 3FOKA 5JH2A 5KETA 4IL2A 3LM3A 3CLMA 4ZSTA 2QIWA 3EDDA 3MU7A 3FXYA 7A3HA 4I9MA 2WC4A 2TPSA 1CIUA 2PBGA 3CL6A 5CSUA 3SQLA 2C79A 4AF0B 3LCWA 1FCQA 3WUBA 3MBDA 1EZ2A 2QF8A 4GH1A 4IJRA 4NJGA 2C18A 1E3XA 5BNKA 3MUAA 1DXLA 2DIEA 3T4CA 3CPRA 3GG0A 3M7WA 4M6UA 5EFDA 1YHTA 1EA0A 3N2OA 2BZNA 1EUNA 1VQZA 4EVZA 3JS3A 3TYZA 2GH5A 1IEWA 4JKMA 1BEUA 2VUYA 3TYUA 4PODA 5A8QA 2D2GA 1J96A 5D2TA 3QR1A 4N9EA 1ISWA 4Q8TA 3M0VA 4DXXA 1EBHA 2E0PA 2ISSA 4Z2IA 3CXBA 4RDWA 4XISA 3ARWA 5I6SA 3HJEA 2YCLB 3GC2A 4NSBA 4JZ5A 4MJZA 4DNMA 4AY7A 4QEEA 3S2LA 3CAWA 2X41A 3U5YA 5KVHA 1T96A 1XLFA 3W29A 4I5XA 3WH6A 2PDLA 3NSMA 3POCA 1TELA 2VL4A 2ABAA 1G01A 1E6XM 3N14A 4PCTA 1G9HA 4LVAA 3FHQA 1XLIA 1DWAM 4AZ5A 4FZIA 1TV4A 4EXBA 4KETA 2EO7A 4GQRA 4ACYA 1T40A 3N34A 1PUDA 3E1F1 3RU6A 4IPIA 3ENLA 2PDIA 2DEPA 1H4PA 4GO8A 4B5UA 3DKLA 2YXGA 4UTWA 4CNPA 5BW6A 4MUZA 3E74A 3S2JA 3OHMB 4GNJA 3UWVA 3WLKX 2Y5SA 2XTKA 1FUYA 2G41A 3RNDA 1GRTA 2NQHA 4HU3A 3DI0A 4MYAA 3FCPA 3QFWA 4WCJA 4A3UA 3Q4DA 3HTWA 3R12A 5I3IA 4WRHA 3ARZA 2NV2A 2B7PA 4UFHA 4GJ1A 1LTDA 5T91A 3GHRA 4MNJA 2ZVRA 4L7ZA 3NIYA 2O9OA 4BK9A 3N9RA 3LY0A 3S5YA 3WD4A 5LSMA 2D69A 1Z8AA 3A6OA 3CH0A 3EEGA 2CLFA 1EEPA 1XHCA 1UH3A 1UQZA 2WNQA 3VU2A 4JXCA 3AHZA 1F8IA 2TMDA 4NNAA 2YL9A 1OJTA 5DBUA 1TWSA 4G5DA 5I0DA 4ZOEA 1XIFA 4JDRA 5BZAA 4GC4A 3GK0A 1FTXA 1VJZA 1AH0A 3A24A 3N18A 4DJFC 1W3NA 3VOIA 4ZVJA 5D8WA 3HG3A 4IXXA 3GZ3A 3F2DA 1TYPA 2UY2A 4PH6A 2PZNA 3UR7A 3WMCA 3MANA 1YTKA 3AISA 5I79A 2YVGA 3WUGA 2E09A 4IM4A 4AIEA 3LV5A 5ABFA 4LAZA 5FIPA 1KN0A 3H22A 1GUVA 4LT9A 1W32A 3PPGA 1M5WA 2IQDA 4IMGA 4MWAB 4US5A 1VJSA 1EKOA 3P60A 1SUXA 4Z2HA 3M0IA 5FJRA 5G5HB 5HMSA 1EXBA 4GBUA 5A3HA 3LD5A 4K38A 4E6MA 5I23A 2AAAA 3ZJ6A 2ZZ3A 4I3GA 4JTQA 3QTGA 2XPKA 2O9TA 3R25A 3ZWSA 3R2GA 1R5YA 4GZIA 1CGWA 1A5MC 3ITYA 1ME8A 5EY5A 1TTQA 2RHGA 3EOLA 2ZWZA 4W89A 3DC8A 4IGMA 3ZMRA 2PWUA 4BFAA 4S39A 5G4EA 2DQXA 1TQXA 2OB3A 1GT8A 2BASA 2BOFX 3BANA 3G1RA 4LQ1A 1XYCA 3UZWA 5U4NA 3KWSA 1DJHA 1WZKA 5HNRA 3E0WA 1V3JA 1K6AA 3ITVA 1NQKA 4JTHA 4MB1A 4DZIA 4ICCX 3IAQA 3PSVA 3TYDA 1NDYA 4EM3A 1WNOA 4GQGA 3UJEA 3QZAA 3WEOA 4IQJA 5JUVA 3ZWTA 2WZIA 3M0JA 4PB3A 1P7TB 2ZRVA 3M6YA 1XIHA 1AW5A 1OCQA 3LHUA 4I7VA 3DFNA 2W79A 4QBXA 4PEKA 1Z69A 3CYJA 4LXFA 3PB0A 3EB4A 3DG7A 4B3KA 4BZYA 1S39A 1AZ1A 3GNNA 4Z2KA 3VGDA 2XIOA 2FIQA 1LDCA 3HPZA 1UPMB 3I6RA 3W4RA 4LNYA 1Q6QA 3PB2A 2BC0A 3VYLA 1OM0A 3EX4A 3WSUA 2J47A 5BRBA 3RCNA 3AU2A 3AZTA 1IR2A 3PFRA 1ENUA 3GY1A 1B5TA 4LUJA 3QMTA 4XAFA 1H7NA 3HW2A 4AZ6A 4B5SA 2DUZA 4W7UA 4O14A 4RNFA 2E9BA 3O9NA 3BOXA 1LG1A 2XYLA 3HM7A 1PWMA 2B81A 4TIMA 4X3ZA 6REQB 1S3TC 1QW9A 4IG2B 3WQVA 2J7CA 3B8UA 4V27A 1TPUA 1Q65A 1V6TA 1MUMA 1XUUA 1JPMA 4A3YA 2X0SA 4Z0JA 3SIMA 2Y62A 3VGBA 1A0DA 1O94A 1EWEA 1DOSA 1VC4A 3K8KA 3VVGA 4JIHA 3OIXA 1H51A 4K68A 3U5UA 3AMKA 3NQBA 3THAA 2PTWA 1HZYA 4F0HA 1OD0A 1JPHA 4H9YA 4M6VA 4U2ZA 2FTPA 4L6DA 1QK2A 3WQ5A 3N2XA 3OZPA 1UKPA 1B0IA 3L0GA 1OQFA 2C0HA 2QPSA 3D5HA 5C55A 1K7FA 4ADSA 4H4UA 1QNQA 3QSTA 3N9KA 4H4XA 1IEXA 3QYQA 3MW7A 4AEOA 3VMOA 1RCXB 1XCWA 1EBDA 3GVRA 1FEAA 3MBFA 3TTSA 2XH4A 3CLWA 4DXKA 1DQXA 3DGBA 4UTMA 4LANA 2VGFA 1GVSA 2OCZA 2PDWA 3BW2A 4WJ8A 1B30A 3VOFA 4EPKA 3E2VA 4I9AA 3A3HA 1AZ2A 3B40A 3PBGA 1TKKA 2ZXAA 3IVSA 2HVOA 2YR1A 4DJEA 4YVPA 3HQPA 1JUEA 3VIKA 4AIUA 2E25A 4Q4PA 2DZXA 4DJFD 3CB8A 4E38A 2CBVA 4FLRA 3ZO9A 3UP8A 3PG9A 5A94A 3KXQA 4QROA 2D24A 4H01A 4C6EA 5AB3A 4X60A 1GJPA 4DUWA 3QOKA 1LWHA 4GACA 3GDMA 4Y8EA 1BYCA 1EF2A 2NQ5A 3VIFA 2FYMA 5FJIA 3LBMA 5D9OA 2ESCA 4M19A 1YMYA 4H8HA 3MI2A 1W5MA 1WZMA 4C1LA 3O6YX 2CFFA 3U48A 3H4GA 1DP0A 4PMRA 3PZOA 2DDXA 1MW2A 3L23A 4QGCA 2OWWA 3ZVIA 1Q63A 1XM3A 2DIKA 4QX4A 1ZJAA 1M6JA 4K3ZA 1W0MA 3ONBA 3KL3A 4QITA 1TJ0A 1XIJA 1AMKA 1XW8A 3L2MA 2Z6IA 4LC8A 1XJBA 4JX5A 5TF0A 4OBTA 2VEFA 1WYIA 4S3KA 3T9PA 1ZALA 1OG0A 4RNIA 4AC1X 3FVDA 1GK8A 3APTA 2CLIA 3TE9A 2PWDA 4KQNA 3P8JA 1TE1A 4GI9A 1XD1A 1RQHA 2A7RA 4BY3A 1GESA 2PEVA 1CLKA 1IHIA 4IL0A 4KCUA 1IXQA 2TSYA 4TX6A 3RITA 4W88A 4YN5A 4N42A 1EIBA 3UNTA 2AL2B 1TYGA 1I45A 3FSTA 4D6FA 1RK5A 3GDTA 2P76A 4O11A 5JBFA 1JJKA 3P74A 4BF5A 2P3ZA 4EX4A 3ZVHB 3I3DA 2A0NA 1OFAA 4HSHA 3WBEA 3QZEA 3IIXA 1EB3A 3PZMA 5CXPA 4TVDA 2RGLA 1KXVA 4YCOA 3GB6A 1YNQA 4RDYA 2Z2BA 4Y9NA 1T0OA 2DZBA 5T8GA 2A8XA 1CB2A 4TXEA 2GGJA 1XFCA 1R8LA 2ZX9A 4TVCA 4D6JA 5AFDA 1GW1A 4Z1CA 3EWWA 1HVXA 4JTDA 3M0ZA 1EYWA 3CQKA 1QVBA 3UWWA 5D03A 3VKKA 2FGBA 1F74A 2ZBTA 3KRBA 1ZFJA 3QHMA 5I7GA 4K8DA 1KRAC 1N62C 2XIMA 4RLIA 4BWLC 4Q22A 2HNHA 3VMPA 3M1ZA 2GJXB 4DO7A 4C5ZA 4WDXA 7REQB 4B4FA 4DLMA 4S38A 3IK4A 1DJWA 1E5JA 1W5QA 4M8UA 1J0ZA 3QV6A 3LI0A 3GBDA 5FOOA 1J6PA 4D2JA 2Z25A 1ZP3A 1DV7A 5HDRA 2J62A 2NV1A 2FVLA 1CTNA 2OT0A 4H50A 3DXIA 3A23A 1RD6A 1N2VA 4KCTA 2OSYA 1E56A 2YXOA 2VX4A 3NQDA 5I3GA 3IJ9A 3WIJA 5IXEA 3CNYA 1C8XA 1OGBA 3N4FA 1K02A 3R43A 1L6WA 3WQPA 3KCLA 4AD2A 1U5JA 4XZIA 4Y2WA 3MJYA 5AECA 3OLDA 1U2YA 2V5LA 1HUVA 3G22A 3CZGA 2O9RA 1JAEA 3Q6JA 1NARA 3R7MA 3W72A 3GU2A 4LCRA 7TIMA 3SI9A 3W1NA 3SJNA 2OKTA 1UHVA 2OPJA 4ZA0A 3UZZA 1NHQA 1JYWA 2FPYA 5AYYA 3OHIA 3W74A 5HULA 2QUTA 2W4XA 4H4IA 2ZRYA 5BRPA 1F2JA 4GVIA 4NAEA 4CNSA 4JTKA 5L6UA 4C91A 3BJFA 1UWIA 1M7XA 3CWHA 1E0TA 2VEIA 3V35A 1XCXA 1JULA 2D23A 4RR4A 5CPLA 1UG6A 4MFEA 1UR1A 3JR2A 3M0LA 4TVUA 1JZ3A 3OJGA 4LB4A 1E0UA 1TV3A 3N3MA 3GO2A 3AXMA 1UUMA 3GTNA 4IOTA 1V6WA 1VEOA 1HQTA 3TSBA 4IGSA 3TMLA 4E2OA 2WNWA 3A4AA 4OIFA 2R1KA 3N11A 4ORIA 1R6WA 1AQ0A 2B7QA 1S46A 4OQVA 1VGAA 2WC7A 3GU1A 3O0KA 4MZ8A 2PI6A 3S5OA 3W7JA 1YIXA 4PMZA 3Q45A 2QZRA 1ZAHA 1WXJA 2ZZBA 3W6MA 4MDOA 2CPUA 4GA8A 1U22A 4RV3A 2ZUUA 3NZGA 2VX6A 3GM8A 2PP1A 2YJQA 1QATA 3V3WA 4ZO7A 3WFLA 4GYJA 4E2VA 1UROA 1US2A 5I78A 1A5OC 4DBEA 3C2OA 3V36A 3EWYA 3EAOA 3OLIA 7CGTA 4PRRA 2PWHA 5IFPA 2R91A 5M17A 1QOPA 2WVVB 4ZQNA 1R7OA 3FIGA 4HJWA 1W1A1 3HG4A 5EKYA 5H2ZA 3DGRA 3PZUA 2R1LA 1I1XA 2DZVA 3VDCA 5D33A 2OWCA 2XGZA 3N2TA 5DCBA 3RIKA 1HKJA 4D1JA 2C13A 1EFZA 4WKFA 2WJDA 1GRGA 1TRDA 4B9ZA 1W56A 1D7FA 4EE9A 2PDBA 4IICA 5E93A 3TYEA 4W7VA 1MZRA 4Y96A 4KW2A 5EBAA 5C9UA 1RP9A 1XRVA 4HD5A 2EEXA 3Q65A 3FV9A 4W8AA 1JUBA 3GAKA 5AYIA 1PXGA 1IT0A 1EXPA 2ZE3A 1J0IA 4HA0A 1FWBC 2X0YA 3GR7A 3VNDA 3WLQA 3OZMA 4XD6A 4MKVA 3AM9A 3NUKA 2DVXA 4L1WA 2CITA 5LHEA 1K1DA 1UUQA 1WUFA 1I8JA 2FGLA 2BGNE 2P5NA 1AVAA 4JNZA 3W00A 5KVIA 2QJIA 3WLOA 2Q01A 3Q94A 3NXLA 2VWSA 2QV5A 2UY5A 2QCDB 2QJMA 1SQ7A 2YDQA 2R9ZA 1F8MA 3FHAA 3LGDA 3A4WA 1OFEA 1B4EA 2A7NA 2XVPA 1OYCA 1XRFA 1RBLA 1YADA 1Q2SA 2YCJA 1KFLA 3URBA 1EJUC 4HHMA 3UJ2A 1E3ZA 5AHMA 4NJHA 3CO4A 1EO5A 3DFYA 3C0QA 3DU0A 3TAKA 1MDRA 1O5KA 5I24A 1XP3A 3WUEA 1F7BA 1I9CB 4CQ8A 1UR2A 3OP2A 1UB3A 2BGQA 4B2DD 2QUVA 4J28A 3NL6A 3ZQ9A 4C5YA 1V6XA 2YCKX 3UG8A 5EMYA 1Q66A 1TPB1 2YDAA 2W27A 4BKNA 1QO2A 4PSPA 1I1WA 1XIGA 3VC5A 4IIDA 3DC0A 2GQ8A 2R94A 3ATYA 4GX9A 3GXIA 2BVWA 1NWUA 1GEQA 3BURA 2EKCA 2A2IA 2OWXA 4ZTXA 3ZT6A 4F2UA 5F1VA 5D04C 2HCVA 1SO3A 3LG3A 1RBOB 3W2MA 3TWAA 3S0CA 4PMUA 4ILSA 4O54A 4JDBA 2ZZ6A 5G4HC 4FNUA 1NFBA 4W93A 1HJSA 3LSBA 1J12A 3T09A 4M56A 4UNKA 4OBRA 1A80A 3CMJA 3UYIA 2YOCA 1N8WA 3HGSA 3BZGA 4UMCA 1G4SA 2OKOA 1FDJA 4JFUA 1RVKA 5CPMA 2JE8A 1WAUA 2YBTA 1VFFA 2CBUA 3A4JA 3U2CA 3KRUA 1J5TA 3STPA 4ONVA 2XN1A 5RUBA 4QISA 3T0TA 5DT5A 3WY1A 4O16A 2CZDA 1JGIA 5F4XA 5D32A 3AMGA 3EDJA 4JIQA 1WUEA 1YQ2A 5FMHA 1W9PA 3ERPA 1IT8A 1DBTA 1V6YA 3AI0A 3O06A 1XBYA 1B31A 1RP8A 3LX9A 3UGVA 3DKJA 3G1SA 1QHPA 3CPGA 2KZHA 2J66A 4MNLA 2QKFA 1IR1A 3I7SA 2OG9A 2GK1A 1V0KA 4PL1A 4AZ7A 4H7VA 4NEVA 2VRJA 4NZ1A 3EMQA 3UESA 3QY7A 3CXOA 3K13A 3S1GA 4PFHA 1XL9A 3VM5A 3EZ4A 2J75A 2OR2A 2DGAA 1IT7A 2VNCA 1JYVA 4Z1YA 2HSAA 3W7QA 1SZFA 4UTJA 4J3SA 1JGMA 1Y0EA 4KEMA 2FDMA 1ME9A 2XIBA 5FJJA 1R9XA 3H24A 5A5WA 3R8HA 3NDZA 3EA3A 1VHCA 3RF9A 5AVNA 2ZUWA 1R3WA 3WYZA 3W71A 4AHQA 4ROQA 3RAOA 3OG2A 3GDKA 4O19A 3N73A 1HTIA 5FL1A 1EBGA 1E0WA 4U31A 4LSBA 5TD4A 1GRBA 4HQVA 1GRAA 4ML9A 3VFCA 4GNKB 5A8GA 5FJUA 1XSJA 4EP8C 5CZTA 3SUWA 4BURA 3LTPA 4MB4A 3E0FA 4N2YA 4OWGA 4XBKA 1WZAA 3OB8A 1U30A 2W0HA 1KFBA 3ABZA 3B9NA 1OFRA 5AKQA 1P48A 1W1ZA 4W85A 4FAMA 1SR0A 4S3EA 4ES4A 4HYVA 3CGDA 4OGZA 3NPUA 2ZDRA 4JPGA 1J79A 5FD0A 2R9RA 4H9VA 3P80A 5MF5A 4J3VA 5I5RA 1HJVA 3GXFA 2ZOXA 3C2EA 1L2UA 4GMEA 4MLRA 1QPNA 5C9RA 4GFSA 4WDWA 3TOPA 1FFVC 4DF0A 2J4GA 1F73A 4GJIA 4S3CA 4UFIA 1TQJA 3U2ZA 1E1CB 2TAAA 5JCLA 2NQLA 3VNYA 3DN5A 3ABQA 4FF7A 4H7CA 1HP5A 5JCMA 3B06A 1LZOA 2CHRA 5CJ5A 1WXZA 1BWLA 1JNEA 1DHPA 4ACZA 3O6CA 1NPXA 5HBFA 1OYAA 3SCVA 1AJ2A 3HGOA 3MHUA 1EUAA 4LCSA 1GONA 2Y24A 6XIMA 2FZBA 3THCA 2W91A 2BWGA 1A5BA 3UCCA 2ZUNA 3CEUA 5D09A 4E4UA 4XK2A 1Q6RA 3W2UA 3F5KA 1X6LA 3HOJA 1DE5A 4C6KA 4L9YA 5D37A 1VIWA 2Z26A 2ZUSA 4L6OA 3TZNA 1JCLA 1AA1B 3VO0A 3GVWA 5ABFB 2BXYA 2VR4A 4H4RA 2V3EA 2JBMA 3U3HA 4HKPA 3II4A 1GWJA 3LQLA 3UVAA 2GWGA 3K46A 3PZNA 4W9TA 2HV5A 1Z6KA 2Q3RA 2Y85A 2BCPA 4M52A 3KM8A 4YIWA 4NZFA 2FZNA 1JDEA 3GIQA 3PZVA 2QJHA 3CIWA 4JY8A 2FPVA 4KWWA 5DRIA 3WELA 5HNNA 5K4XA 3CQ0A 3MP5A 5HK4A 3EOUA 3LCXA 1H0GA 4PRWA 2DV0A 1R9ZA 4E2DA 2V9DA 3E9AA 4MPQA 3V1PA 1B90A 4XIAA 1UWTA 1FKXA 1DXIA 2PAJA 1E70M 4FXRA 3TXZA 3AHXA 1XIEA 3QXBA 1GEUA 1BVZA 2WPGA 4ORMA 1NIUA 3ARSA 4S3GA 3SQSA 3GG7A 2VTFA 4AVFA 1EA9C 3W28A 2QIIA 1MW0A 1PSCA 2Z27A 1F4AA 3S2NA 2BS9A 3C4UA 3WJWA 4A3QA 4C6DA 2PB1A 4YMZA 5GJPA 4KT2A 3K8MA 2CNCA 1CXEA 1RQEA 1UMLA 4QP0A 1BGAA 5E6YA 4N4QA 3V5CA 4UNLA 3BAKA 1UKOA 3VX0A 1GNXA 1V8EA 1KM4A 2NW0A 4GCAA 3ITGA 4R7WA 3AIVA 1XLMA 4PUEA 1UZDA 1KFEA 4WSKA 3LENA 3ISIX 3TR2A 1NDZA 2PMQA 1JQXA 3HQNA 4PUDA 3MQTA 2W66A 3SR7A 2WKJA 3IARA 3DI1A 4D71A 1I0DA 4BHYA 2NT1A 3GBEA 3M41A 2VX7A 4D6CA 1SM9A 2EAWA 5CLWA 3O7UA 2BHUA 4KKXA 1XANA 2HNEA 4UB9A 2X1SA 5ECUA 3R1ZA 3SUSA 4PB5A 1CGTA 4C6CA 2PBOA 4TU1A 3R4IA 4HTBA 1QOXA 4Z42C 4XWUA 2C0AA 3CUGA 4NZ5A 4LYKA 5TBOA 3G1VA 3PNUA 1GJWA 5LHFA 3KDNA 3RX2A 2C3DA 4I6KA 3QV7A 3K1GA 3WNKA 2P50A 3CGBA 1Z9AA 3GFYA 3IUDA 4JNMA 1Z7AA 1FHUA 3DBPA 2VFIA 1ITUA 4Z08A 4D8AA 3T42A 2B7OA 2GUBA 4H4SA 2JALA 4Q8NA 2VVNA 3S2MA 4O52A 1VF8A 4ZOAA 2OYLA 1LQ2A 2W9MA 3UWEA 4AD3A 5IOBA 4IUOA 1I75A 2OO0A 4NF7A 1VEMA 1NTHA 2BC1A 3PM6A 3TC6A 2QDHA 1PZ2A 3F4CA 4N6FA 1BWCA 4EPEC 3UCDA 4PULA 3P7YA 2Y2WA 3IS4A 4GYPC 1FBAA 4HU8A 3MUIA 2Z4GA 3MS8A 1LROA 1U5HA 1MFUA 3N29A 2ZFAA 4KWOA 4B5NA 3OVGA 2YVJA 1BQGA 3IGUA 5DMMA 1V7AA 4FNPA 1B1YA 2HVNA 3QYSA 4UOZA 1ZUAX 1DWJM 4ERGA 4CVUA 3BTNA 5I3KA 1GQIA 3DFOA 1JI2A 1XICA 3R94A 1TSIA 3T7VA 3I10A 2HWGA 2XSAA 3MO4A 3VPLA 3MMDA 3ZLHA 5KTLA 4OUEA 1JOAA 1E6QM 5F2LA 4JN6A 1UR3M 3HPXA 4MY8A 4B92A 3H7VA 1WQ5A 4JN8A 5BMXA 1MXDA 4X2PA 4LY8A 3EX2A 3XIMA 1U83A 1QI4A 1GOXA 1FECA 1R86A 1XXXA 3S42A 3PAOA 4BEQA 3QGAC 1VYSX 3E0VA 3WDRA 1P6CA 4QLLA 3AOFA 4Q8WA 1CDGA 1Q7ZA 4J7RA 4KGJA 4EXAA 3NPWA 1YNPA 4XKMA 1XI3A 1ZAIA 3ELFA 1TG7A 1KCKA 2OT1A 4E4PA 2R8WA 2VDIA 4FX8A 3BL3A 3GDLA 1W2VA 1GQLA 1UJQA 2DJXA 5CAKA 3UWQA 2JF7A 4H8VA 3GWQA 4Y90A 3W1UA 4F66A 2QCNA 4A21A 4FX7A 2NXIA 3W01A 3KDOA 1GOMA 4NZJA 1VLWA 4Z1AA 1P5BA 3W07A 3PPFA 4K1WA 3EOSA 4AHOA 2EPLX 3U8GA 1TV8A 2CKSA 2O0TA 1YYAA 1US3A 3HGRA 3AS0A 2A1YA 9XIMA 4S3BA 4AWSA 3ZYZA 2G95A 4PL2A 5HNUA 5CC3A 1JZ5A 2QJJA 4DRSA 4AUBA 1EC9A 1UR0A 1Q7MA 4QQ3A 3IJIA 3OW1A 3PFMA 4GIAA 2F5ZA 3SCQA 3W1AA 4GISA 3PBYA 3H21A 3DK4A 4ZFMA 2J78A 3OGVA 1CBGA 1V4YA 4M1RA 3WJYA 3APGA 3BPWA 3NVDA 5BOEA 1EP1A 5CKSA 3CQJA 3HPFA 4UCGA 3BH4A 3H2FA 1Y5VA 3FG2P 2QYGA 3LCLA 3WLHA 1KV5A 4DZHA 4IFKA 2XM2A 2INFA 2PWEA 3CWNA 4J3WA 3W22A 1QBBA 1UMYA 3GUGA 3KTXA 1Q6CA 3R07C 2CW6A 2J7HA 4LYPA 3NQGA 1U33A 3QM3A 3WLPA 1LLWA 1ZRQA 2C3CA 3DJJA 2RKXA 2I14A 1TZ9A 1GEHA 4QDMA 4RZ6A 5AHFA 4HNUA 3MI3A 2EQDA 3QHOA 2QDGA 3TZFA 4YYFA 3V5FA 3WDHA 1AD4A 2HQMA 3OZYA 2YW3A 4CNNA 1QNOA 3S2CA 3WK1A 3ZLFA 3MVIA 2BV9A 4UTLA 3PTKA 2WNNA 2IPJA 3IJ6A 1HO4A 2RH9A 4D6DA 2OODA 2A79A 4WR3A 1E6RA 2WJFA 2CZ5A 3TYAA 2DT0A 4IIBA 5EMKA 1UWQA 3STFA 4QSHA 4Y7EA 3W7EA 3WMBA 2PTDA 5KINA 2WHMA 3JW7A 4GGBA 1FP9A 2H8ZA 1ODUA 2ZX6A 4C6BA 4IXHA 3VCNA 1QWKA 3MYOA 2ZRXA 4FALA 3LUTA 3IJDA 1PWLA 5KZEA 1BLIA 3K30A 2WJEA 6CGTA 3R79A 1XBVA 3FK4A 3RCMA 4PMJA 2X40A 3VGHA 2OEKA 4P7OA 4H4YA 3NM3A 4C1KA 3DFHA 3KHDA 4YU1A 1OFOA 1S2WA 2V68A 1JZ2A 4PFMA 3AJ7A 4KS0A 4BF9A 4IIFA 5C2CA 5I3DA 4J57A 1FRBA 4WDTA 5FS7A 2DUAA 3KBWA 3AZRA 1KLYA 3OBAA 4UNIA 4HMNA 2FFCA 4P8UA 4YCPA 5LXXA 5D9NA 1UIOA 5IM51 2VOTA 4LS1A 5CSYA 1S5VA 1GZGA 2A3BA 1BTMA 4NNCA 4E2BA 1DIEA 4GPNA 1KR0A 4TX9A 5ENLA 5KSWA 4NNBA 3TP4A 4NI3A 4C7DA 1KM5A 1YDYA 1OT1A 5D2YA 1DTUA 1PX3A 2J8TA 1JPIA 1X7IA 1VBUA 5DMLA 1J2WA 4DBWA 2DZSA 3LI1A 1ZCOA 2CLLA 1Y7VA 2YKKA 3SGUA 3CT2A 1KXQA 3QY6A 5CJNA 4FNRA 3LQGA 1ADSA 4WF7A 4A8RA 3DGHA 2V2CA 2OGYA 1O7AA 2RGMA 4BQ4A 1UD6A 4G56A 3HMJG 3TCSA 3KBMA 3WNNA 4GC3A 2FZ9A 3RRXA 4H4WA 4K8GA 1S5MA 3TK7A 4JS3A 4DF2A 2QQ6A 4H6KA 3LB8A 2IXVA 1ADDA 2GRTA 4QR6A 3MTWA 4CGTA 3TYBA 1LBFA 4FX9A 3BVJA 4K37A 3UU0A 4LB3A 1LORA 1MNZA 5FI8A 1FHDA 1DJNA 2DZWA 3T2OA 2V5KA 2E68A 3C5QA 4QXIA 4KCWA 3TUUA 4EF8A 3ID7A 5AYZA 1HJQA 4KGLA 2BY1A 1TJ2A 3C2YA 2IPFA 1H7RA 1V6VA 1ZGDA 1IZCA 2XH0A 4MNMA 4IPNB 3ZS4A 2WOVA 4C6QA 2XU2A 3L0NA 3U6WA 1VQTA 3K4DA 1GVEA 1IWBA 2R1NA 4IQLA 3T0DA 2BOEX 2ISDA 1FCVA 4DBDA 2CESA 3W6LA 4CKQA 2C1GA 2V81A 3ANUA 4BI5A 1XLJA 1GVRA 2QUNA 1WE5A 4XAZA 4KEZA 1RBAA 3OC4A 4PYSA 1O12A 3TJ4A 4GKLA 3AROA 4MUPA 5EMJA 2BHZA 1PKMA 4C6JA 1HT6A 3G24A 1W1IE 3T40A 2ZICA 3KP0A 1SU5A 4IHCA 3RGTA 3PBVA 2YXXA 3PUDA 2VQTA 4GIEA 2WMJA 4XZWA 3HN3A 4F8XA 4WSHA 1X6UA 5D38A 4A3RA 2YBVA 1MO9A 2CIPA 5HMDA 5BXSA 3WNLA 3GVQA 1WB0A 4XD3A 1W17A 7XIMA 4O1FA 1DJQA 1ML1A 1NF0A 4BQ5A 2F6XA 4FIQA 3D47A 4HZ8A 3GE7A 4UC5A 1GERA 4FXFA 4UTTA 2Y61A 3KUMA 3GAYA 5ABEA 2GGHA 3LMYA 4N9BA 3LADA 2XJ7A 3IGHX 1HJUA 1LWJA 4AZHA 4KEVA 4JTSA 4XSLA 4LEFA 3M5VA 3AIQA 3OQEA 3FGCB 3PHAA 4OVXA 3SN4A 2YFOA 2ZZ2A 1PZ3A 2ZX5A 2V30A 1MNSA 3E3HA 3CIXA 5DLCA 5LA1A 2W3SA 3GRSA 3BAJA 1EPVA 4TR9A 1FWNA 2VOMA 5A8MA 5K9XA 4Z17A 4A29A 1TVNA 2J74A 3V0UA 3RM4A 3RG6A 1EX5A 1J18A 3QQ0A 2JGQA 3QPEA 3DESA 3WJZA 2PCEA 4HNOA 2WW5A 3FW6A 4JCMA 3CT7A 2OU4A 3AXIA 1UA3A 2WMKA 1OF6A 2ZADA 1N7KA 3WQWA 4PUJA 3TN3A 3F5LA 4GQBA 5D02A 2XSBA 3RN6A 3VKDA 3ALFA 4PC8A 4CD6A 4GRTA 1EJRC 2JGYA 4JIPA 5FKYA 3LRMA 2Z1BA 5K9DA 4DWSC 3SUVA 1NQ6A 3L5LA 1JCXA 5I3HA 1MUCA 3M5YA 4D8LA 3STEA 1A5SA 3UXLA 3Q67A 3M9YA 4PZVA 4K1GA 4OUIA 3WFAA 1K8ZA 4MTVA 4XAYA 1G69A 2OOGA 3AUOA 1FWFC 2HXUA 1J93A 3FYPA 3EB2A 1TUXA 3W7KA 4JHZA 3USBA 4DPQA 4KPRA 2G37A 5DEZA 4PTXA 1KRMA 3GW3A 4X0VA 1I2QA 4H41A 1J0YA 1RUSA 5G4WA 2PDJA 4CQ9A 2NUYA 3XISA 4DZAA 2PDXA 3KP1A 4JHMA 3NAVA 2VO5A 3U2OA 4LRSA 3VZXA 1JEHA 3AYRA 2A85A 3C8NA 3OA5A 4FA3A 1ZMDA 2JKAA 4IH3A 5G2HA 3CPUA 2PWGA 1S1PA 4GIYA 3D6NA 4M81A 4NXKA 1VCVA 2J79A 1UR4A 1OVDA 2FH8A 4AVOA 3QMRA 1OADA 4IPJA 4RUBA 3NQVA 4AU0A 1H7XA 1QWGA 4GWEA 3RYSA 3WLIA 3BC9A 1T3QC 3NQEA 1MOKA 4B15A 2OSWA 1W3HA 4JN7A 1W2PA 3LU2A 3UT0A 4EWJA 2NLIA 5HPOA 3WDQA 3KLKA 1LRNA 1F3EA 3VGGA 3SW6A 1JFHA 2FTYA 1UYQA 3GIYA 5F2IA 2ANUA 4EXQA 2ZUTA 4KPLA 4L9ZA 2DPEA 3BG9A 3WD3A 1Q4NX 4RJEA 4ENLA 2AMXA 4L4OA 1E6PA 4OOZA 1WPCA 2X8HA 3FX4A 3NL3A 2OXNA 1YDVA 4AC7C 3BOFA 3HPAA 1TCDA 1E15A 3AFBA 3PUOA 1R3YA 1T5AA 2G4FA 2NXGA 4J40A 2O55A 5EU9A 1BYBA 3CQHA 1EYEA 1GZJA 4DNAA 1C8QA 1V77A 3BK0A 4DWDA 2QT3A 2CZVA 3TEVA 1WAWA 2Y5EA 3URNA 3NGJA 2WMGA 3LTYA 2GJLA 2J9ZA 2GOUA 2VCAA 1BYDA 3F2CA 3I6TA 1RJQA 1ELSA 1ITCA 3E2RA 4G1NA 2OELA 4JIIX 4ADTA 4A6GA 1Q3NA 2OEMA 7PTDA 3S9IA 1FFUC 3R6IA 1S2CA 3MZ2A 1L6YA 1TPFA 2QDEA 2B0MA 4W86A 5C7VA 3H4KA 3W38A 3O3RA 5BMWA 3SFKA 2CWNA 1XC6A 4HOXA 1PDYA 3U2EA 4BCEA 2D22A 3WMSA 1XLEA 1JEZA 4EANA 4HMCA 3GC4A 4MM1A 3H7UA 3QPZA 3NPXA 3C0LA 5LNWA 5BOOA 3GHSA 3UWZA 1K9EA 1OT2A 2Y6ZA 1UP0A 2PDKA 3OA3A 1HX0A 1DJYA 1A5AA 4MOZA 1R3TA 4CNTA 1UC5A 2HEJA 4ALDA 3W75A 3GH4A 2YDRA 2WBAA 1I2RA 1IWPA 3VMNA 3ZLGA 1IE7C 3RLUA 4BV6A 3GH5A 4HPHA 2YFNA 2VRKA 3RUBL 3NVYB 2DSWA 4DYEA 5BWAA 3C0JA 4I5RA 4K6AA 3D9XA 3O1NA 1HXJA 2J7BA 4RL3A 2QCGA 4MB5A 5DELA 1BSIA 1CXKA 4PMDA 5JBDA 1XKJA 3SY8A 3W7NA 3V1HA 2AL2A 3B97A 3EEZA 5FF7A 2PPGA 3AYVA 4ACZB 1UH4A 2PURA 4XZHA 2BMBA 3GRTA 4H6RA 3P0WA 5CC7A 3ZVHA 4K7VA 1TPH1 4LVFA 3GTFA 4S1FA 2HRWA 1G7VA 3HRDC 1EOMA 2D3NA 4OOUA 4R5EA 3F2BA 1FEBA 1GQJA 1WBHA 3VUPA 2PC4A 1X2HA 5M03A 3ES7A 1ECQA 1DJZA 5FF3A 5GNZA 4CD7A 4NQ1A 3S6TA 1BXBA 3ECQA 2P1FA 3SB0A 2Y7GA 1M01A 2W6RA 3OEXA 4QHRA 4HHHA 4A4AA 1CGXA 4QNWA 2Q8ZA 2PFHA 2ISFA 2EPNA 4DWSD 5LNVA 1WDRA 3FJLA 4P7RA 3PG8A 3S5ZA 3AO0A 1MRAA 3KX6A 2V6AA 3RX4A 4ZMGA 2QAFA 1GVYA 2V82A 3E2SA 1XIDA 1E43A 1MZHA 3HG5A 4GUIA 4JD4A 2GJXA 3G1FA 7REQA 1FP8A 4EQXA 4YHEA 1HKWA 4O8AA 3WJSA 3WLRA 1SSGA 5L9FA 4IJCA 1RV8A 1GHSA 3GR4A 5TQLA 2WCSA 1EX1A 3B8DA 2O56A 1BSLA 2RUSA 3C3NA 4IFRA 3M6DA 1MMFA 5G2IA 5MHBA 3WN6A 4O53A 1ZJBA 3QEZA 1I4NA 2INEA 1KCZA 1ZBVA 4REQA 3EA1A 3TN5A 2XWDA 1G94A 3B0UX 4X9SA 3VOJA 1JCJA 4R7OA 4QCFA 1A0EA 1IEIA 1IWAA 1QW8A 4ZR8A 4JDYA 4MNKA 1Q13A 2AOSA 5I06A 4MHBA 2FZ8A 2DH2A 2FQIA 4I90A 1OZQA 3DZ1A 1Q85A 1NF7A 1X1OA 1RD5A 4AD5A 4MJ2A 4IIEA 3MDUA 4LUYA 1CXIA 3NSNA 3MCNA 3I3BA 4HNCA 2WZMA 3AMCA 4GBDA 5XINA 1B3WA 4L56A 1THFD 3IGSA 1JDCA 1FH9A 1W1B1 2DSUA 5AHNA 4EAYA 1TV7A 3MKCA 3PY2A 2PD5A 4HNTA 4YXGA 1QDSA 4EQSA 3KCOA 3TN6A 4JTUA 2FDSA 2V2DA 5A6BD 1TR9A 3M64A 4HU4A 3C61A 1LWIA 4LC6A 5CPQA 3C52A 3VIPA 4GIRA 4A8IA 4ADUA 3CUFA 3H2CA 3GR8A 1AH3A 2OJPA 3FAXA 3KE0A 3PNZA 1M1BA 3IC9A 1TCMA 4IIHA 1M6IA 2JIWA 1YE6A 3GXMA 2WXDM 6PTDA 2QGHA 2WKGA 2Q8XA 5A8OA 2DSKA 1KM0A 2D20A 1RLDA 3INPA 3H2MA 3ALGA 3CZKA 4GUFA 3TLLA 3WDJA 3M5XA 4ICNA 1HN1A 1ZHAA 2P8CA 5B7YA 2HVMA 1XLBA 3IGXA 2I5IA 4O0QA 3CTLA 4JAWA 2MNRA 2G50A 8XIAA 1RJRA 2CERA 4LBRA 1WYGA 1XR2A 2QMJA 3ZJKA 3OLGA 2XGIA 1XC4A 4GX8A 3P82A 1QJWA 3RLGA 2PDQA 1GJUA 7ENLA 2V3FA 2WLZA 4DPPA 1SFTA 3LPOA 3L66A 3W84A 4FNSA 1FDYA 2NX9A 3DBNA 4ZE4A 4FR1A 2WVVA 3M4HA 3SO7A 1QPRA 1TPC1 5KZDA 1ZTVA 3ICJA 2CXEA 5H8PA 1FXPA 4YHGA 3W85A 5C2GA 4DJDA 1VPYA 1R9YA 3FA4A 2CBIA 4J27A 2VQUA 1XRSA 3OG3A 2WM1A 2IKIA 3W7LA 5CSRA 1AQFA 1G1YA 3NXFA 3VM7A 4TOQA 3MKVA 2OQLA 1NDWA 5JRBA 1NEYA 4KWVA 2ALDA 3AIUA 4P7QA 1N61C 3O2LA 2FPTA 1NY1A 3I68A 3UR5A 3RLVA 2BXVA 4RV8A 5XIMA 2JEQA 2WOQA 3M0KA 1J2BA 1KA9F 3IJLA 3TIMA 3BJSA 4P2VA 1G7UA 3M16A 1J0JA 1L8NA 1LM1A 2NQ9A 1ONXA 1Q6OA 1MEIA 1GREA 2PWFA 1WBJA 1F3PA 1CEOA 4WKAA 1YQZA 2VC7A 4AH7A 2C14A 3MCOA 3N2MA 5F7UA 1ZJHA 3T55A 1QU4A 3AMZA 4ZEPA 2G4JA 3UG4A 2OLSA 1PO9A 4XZLX 5D4YA 5GNXA 4UMBA 3KOZA 3B9EA 1D8CA 1W3TA 1KQYA 4UR9A 4FS9A 2DH3A 3WLMA 2ZC1A 4X0NA 3O6AA 4H4TA 3LOTA 5E9XA 1EL3A 2BLEA 2YA0A 4AEFA 1VBGA 2E1DA 4MF4A 3LHYA 4HK5A 3W83A 2IUZA 5HMEA 1CGUA 1TV2A 4M1BA 1QUMA 4HMDA 3HG2A 3TDFA 1CWYA 1QI0A 4J5NA 4PBFA 4LRTA 1FWRA 5HUPA 4HTYA 2DW6A 3FLUA 3MVTA 4DLFA 3WQOA 1UD5A 3NQ6A 3QMSA 3WLNA 2J7FA 3BLDA 5AOUA 5G5GB 2PU1A 2EF9A 4FXSA 1LF1A 3LHWA 4JTEA 4I9TA 1ADOA 1OZMA 3PZIA 1OCJA 2BTMA 5MKGA 1UP2A 4MFDA 5I2UA 5GRTA 1B9ZA 1ZCCA 5LA0A 1Q1WA 4IFKB 1P0BA 1FWDC 3FKKA 3W70A 3H12A 3T81A 2J25A 3QH2A 4O1EA 4CQDA 3QN3A 4LA1A 4HIBA 5HMFA 5CAHA 1VYRA 2Z24A 3AYSA 1IEQA 3VNIA 3L4YA 2XUCA 4O4WA 2Z2UA 3NVTA 4DBUA 4YTUA 3D3AA 2V5CA 4JCLA 3URHA 3HFYA 1BD0A 4FP1A 2POZA 4HN4A 3V4BA 2EG6A 3R5EA 4EMWA 3TMQA 3QVQA 3EPOA 2F84A 1V3KA 3TA9A 3HB9A 3NG3A 1VP5A 2WK2A 3NQCA 2P53A 1ECEA 1XLHA 4GD0A 1TPVA 4DX3A 2WCGA 3L4TA 4QRNA 3UXIA 3A3WA 5A95A 3QW4B 3F4VA 2CC0A 1F05A 4EPBC 2GJRA 2IXUA 4ZQMA 1MXSA 2QVNA 4RK8A 4Q8PA 3TQPA 3W1XA 3BWWA 1EDQA 4RZBA 5LIUX 2NVCA 3IIPA 1OYBA 2EKGA 3LZ3A 4FEZA 3W02A 1VLIA 5EFFA 3S5SA 4BQ2A 2G3JA 3W2LA 4M3PA 5AZ0A 1X38A 3PTMA 1QT1A 3CZ8A 4JTJA 2OQYA 4X22A 3GU9A 1C7TA 1QNVA 1ZPTA 2YLAA 4Z2LA 2C16A 5E9AA 3WX7A 4EM4A 3LV6A 2WMIB 1IYXA 4LUTB 1EHAA 1YRRA 3WQDA 1K4HA 2HS8A 1QHOA 1GG0A 3UVIA 4LUIA 2YZRA 2JFEX 2GR2A 3GNDA 1W1TA 3S83A 4MWAC 2CLHA 8A3HA 3UY8A 4J1OA 2PWVA 2WPFA 3QQWA 2C71A 2HISA 1UPPA 1KBJA 3WF1A 2Q09A 3PSWA 1SZEA 2OZ0A 2QXWA 3DYPA 1A3WA 1C9DA 2AL1A 2E77A 1XISA 4BJHA 5K9CA 1HNYA 2BX7A 3PK7A 4MKSA 1XDIA 1QXLA 3NVZB 1LL6A 3K5XA 3NNTA 3TVAA 4XB3A 2FMNA 1FA2A 1SW0A 4UQ9A 1RALA 5IDZA 5GJMA 3E12A 1H60A 1IV8A 1TTJA 3M43A 3EWCA 1DXEA 4WDUA 4J3ZA 5E6ZA 2XH7A 4QS6A 1V3IA 1H09A 1L6SA 3O16A 1B4KA 1RLCL 1FWAC 3STGA 5A6TC 1UJPA 2RDUA 3IIOA 4YPJA 1OFBA 2ZZ0A 3PVFA 1BYAA 2E6DA 2Y4SA 4QG6A 3F4DA 3VIMA 4MMWA 1E1CA 5LIXX 3BAXA 2DFAA 1Z48A 1N5WC 3VILA 3W7IA 4PTDA 1TTPA 4GNVA 5T26A 4DM1A 1IIHA 5LYRA 1A50A 1K8XA 4H1ZA 1OX6A 1JYNA 4WX2A 1KKRA 4U5IA 2J3NA 3PN8A 4GVFA 2DVTA 4Q4KA 2PZ0A 5CG0A 4AD4A 2TPRA 5H8MA 3QGKC 2CEQA 1S7MA 1V6UA 4JKKA 1XCFA 3ZJ8A 1R38A 1GPWA 2V69A 3QC3A 4QJ1A 2GWNA 3QHNA 5IBXC 4L9XA 4UTFA 4CCZA 3QQ1A 3W7CA 4C60A 1EJVC 1W3JA 4H4PA 1T8QA 1KQZA 2XDFA 3ATZA 3BZJA 1OFPA 2X2GA 3WF3A 3ABSA 2WB5A 3B0YA 4GXPA 2NVKX 4JTGA 3DOPA 4V33A 3UEQA 2OEJA 3OGRA 1E1FA 2YL6A 6A3HA 1KM1A 3BV4A 4UQEA 1TA3A 1GVQA 3MWCA 3TROA 2PLCA 1N55A 3LDVA 1UIPA 2BP1A 1UP3A 1XLLA 4Q4MA 3LERA 2YVFA 2VDGA 4H8NA 3VA8A 5E70A 4YWOA 3EUB3 4NX5A 2HE8A 1FWCC 1JZ4A 3NVVB 4KRTA 4BI7A 4DNHA 2DZAA 4GY7A 2IQ0A 3QY8A 4FOJA 6ALDA 2KX9A 1VENA 1YPFA 3L4XA 4C65A 4O8RA 1LQ0A 3CV1A 3RNMA 1QPQA 3KOYA 4PUKA 3LB0A 3FJ6A 1C8YA 1BZLA 1NU5A 3K4WA 1IF2A 4JICA 3O0FA 4Y9AA 3ARRA 1ZX9A 1OINA 3S6OA 3GXTA 3FEMA 3UWUA 4KEUA 1T41A 4AWUA 5LNSA 3LXCA 5FEXA 3MJMA 1XQLA 4HNNA 1UWUA 1W8SA 3L4UA 1Y8BA 1IZJA 1R2TA 1H0IA 3RMJA 2PE4A 3PZ9A 4WOQA 4DUXA 3LXAA 2POTA 1DL3A 1E9LA 5JVLA 5CPOA 1ME7A 1WOBA 2VXNA 1XG4A 3DECA 3FFSA 4Q6JA 4WJEA 3R8GA 2YL8A 2Z2AA 2I5GA 3B9JB 1EC8A 3GX9A 3G8RA 2ZZ7A 1KCXA 5BCAA 2XFRA 2JKPA 3LHZA 3BCJA 1SJCA 1P4CA 1YX1A 4H2CA 3PZQA 4ZB2A 3RRAA 2QAPA 4G7EB 2ZQ0A 1FWIC 3KWXA 1VRXA 3MI6A 1JL8A 1XHGA 3K4AA 2GJPA 2A5HA 3A7AA 3MKKA 5FS6A 3CEPA 2CU0A 2P8BA 3DHDA 2BOGX 3Q2DA 4LWWA 1A3XA 1XD0A 2OVLA 3EA2A 3QTPA 1XYFA 3LGEA 3W25A 1W5NA 1KTNA 1Q1RA 4WQ6A 3I7QA 1ZQ5A 2E5DA 4P5UA 2Q3OA 3W1TA 4MWAD 4RPPA 1ZK7A 2Z7KA 4XO7A 3R0DA 4JYEA 3W1LA 3R89A 5C2XA 2F6UA 4HSNA 4UR8A 3WK3A 3OBEA 1F3WA 2ZX8A 1LJYA 2VVSA 2Y70A 3E49A 1Z41A 4R7JA 3GNXA 3EB3A 4ZODA 4DYJA 4HZMA 2XWEA 3SY1A 1L9WA 4W84A 4F9JA 1B9BA 3WEMA 4APNA 4AZIA 1BAGA 4BF7A 1YW1A 1ZP4A 4HPNA 4PE8A 3N6QA 2H3BA 4GYFA 2J8GA 3S9YA 2WSKA 2DW7A 4GFIA 3WQCA 4XSMA 5FJOA 4I5UA 4F4RA 1BWVA 1D9EA 1Q6DA 1G5AA 5LNUA 4I8DA 1OFQA 3BAYA 1YTDA 5I3FA 3TSMA 3LNMA 3L68A 4YNGA 3EWBX 4RZ5A 2NXHA 5HR7A 3WH8A 1FOBA 3E2QA 3VNKA 3EWUA 3MMUA 2PC8A 5EL1A 2Z0IA 2QPXA 5CJMA 1LYXA 4EAMA 2OSXA 3AIRA 2VFEA 3N3TA 3ZSTA 4HCHA 3DYOA 4FLOA 1KWKA 2BY0A 1GCYA 3CGEA 2YQUA 3ANVA 3K2GA 2I5QA 3TV8A 3STCA 2FKPA 1BHGA 3NFUA 2FHCA 3KS6A 1V03A 1S3HA 1M41A 4G9PA 3OO2A 4FPSA 1GV4A 3P5ZA 3VC6A 4MJ4A 1YLVA 3OVQA 1GSNA 1BRLB 1D3GA 2WOIA 3WDIA 2HPMA 1VFHA 3BSMA 4NILA 1X8CA 4NAFA 1PV8A 4DWSB 2AAMA 4JFWA 1DQUA 4UQCA 2UBPC 2GGEA 5DQPA 1DORA 4YTRA 2E6YA 3EOEA 5LIKX 5E0FA 3TONA 3TJIA 3W87A 3ZR6A 3WBAA 4O10A 3N2BA 3NZRA 4GI8A 1GQNA 2Z1KA 1J0KA 1XWYA 3OPSA 3H26A 2E3TA 2WQPA 2WM0A 1EEXA 1XYZA 2PRMA 4OKDA 3U4FA 2EGZA 1J4EA 2Z1VA 2XVNA 4IGNA 2EJ1A 4J3UA 3E5BA 2ZE0A 1O6IA 2FTWA 3RR4A 4E5TA 5A2AA 3VNLA 1CGYA 3ZZ1A 4C6LA 3B0VC 4YS1A 2F61A 6TIMA 1ZNNA 3CHFA 3NZ1A 1QFEA 4UFLA 5E0CA 3A9BA 1RSCA 2VR2A 2X1UA 1HW6A 3VE7A 1W6TA 3G0UA 3IAPA 5AC7A 3D0CA 3JVAA 4XX6A 5CCZA 4MY1A 1CCWB 3PS7A 5KMYA 4C6NA 2ZZ1A 1N8IA 4S3AA 1JDDA 3A13A 1W9UA 1V08A 4ZO9A 3NO3A 3AIWA 2W5FA 3QF0A 1LOQA 2XISA 4JFVA 3ORWA 1VFSA 3WQ4A 3KTSA 4XKYB 1K8YA 2DZUA 3VTRA 2ATSA 4AQLA 2FLIA 4LBUA 2NX1A 4F2BA 4PA8A 3LBOA 2VFGA 4RPQA 3BW3A 3LTSA 3DJGX 3W7RA 1B3XA 5I00A 1XPYA 3BARA 3I65A 2CBJA 3THDA 1A53A 4HNVA 4XZNX 3BG3A 4FR6A 4NYYA 1EPXA 4E8DA 1RZMA 4EMIA 4NY2A 1NAL1 2W67A 2D2OA 1EJ7L 1EO7A 2REQA 1VS1A 3AMDA 3G3DA 4NVTA 3WLJA 2WPEA 3SSZA 2OYKA 1CPUA 4PEEA 4FI4A 4HYWA 1JNDA 1L8PA 4JFTA 1FWEC 3RM9A 3W1PA 3G0SA 4O50A 3T08A 3VOHA 1TWDA 3P81A 4XG1A 3V75A 3G1AA 4MAVA 2X1IA 2GVYA 4CU6A 2OZTA 4UIOA 3WL1A 2VHLA 1GG1A 2FB3A 4U4MA 4AYGA 3S3GA 5CGQA 1JCNA 2XN2A 5FF0A 1H6VA 2SFPA 1VIZA 5DCDA 1G67A 2DT1A 3UCQA 3A5VA 4NRSA 5A8NA 1C8VA 1MYRA 2I9UA 4JIEA 1OX4A 5I03A 3UR2A 2W63A 3RLHA 2XVLA 4P7NA 4MLJA 1PPIA 2V67A 3CK5A 4REQB 1TE6A 1OC7A 1EP2A 1ICPA 1OG6A 5J5DA 2QULA 5J5RA 1EDGA 1GORA 3WNMA 4PN2A 3VXGA 1JXKA 4I8YA 2UV8G 3PTQA 1R7AA 1DWHM 2IMRA 4XD4A 2Z29A 2GL5A 3ITTA 5AC8A 2VD8A 2UZ9A 3B05A 5AZ1A 3EWXA 4GVGA 1GQKA 2D2JA 4EK7A 2XIIA 3VX1A 3IRDA 9XIAA 1C7SA 3NZPA 1GVOA 3LZ5A 2TRSA 1ZXIC 4AIOA 2GR3A 3AC0A 3ARVA 2AGTA 3PWIA 3EMCA 4O1DA 3EWDA 3VIOA 4I6VA 1NHRA 3W7DA 3A4XA 1RA0A 4F0RA 2X7VA 4RW3A 1MEHA 1YXCA 1IXOA 4BI6A 1WX0A 3BLKA 1QPKA 4N6EA 4PBEA 4XVEA 2WVTA 3UZXA 1ZJIA 5U1OA 3A9IA 1RY0A 4QJ4B 2RDTA 3C2FA 3WQ6A 1B3OA 2QW5A 3EX3A 3T4WA 2WOWA 5HA7A 5A6AA 4U5KA 2OO6A 3T1GA 2X50A 5DF0A 2VR5A 3QFEA 3WFZA 1R87A 3TR9A 5CPSA 4GRSA 3AU6A 4KFNA 1HKIA 2LLEA 3GTIA 2IPWA 1KXTA 3JZEA 1RM6B 1K03A 2X2YA 4Q4SA 1D7KA 2WBGA 3G5EA 2WWCA 5D2XA 1SJAA 5FL0A 4DI8A 4L6HA 3QSRA 4NKCA 2J6VA 2YDSA 5H8UA 4NT0A 4GHRA 4FF5A 4BWLA 3RM8A 2PDFA 3AWOA 1YPXA 3G8EA 4CN4A 4M51A 2DIJA 2ZWYA 4FOUA 1V79A 3RJYA 1JF6A 4AX6A 4GGHA 3B3DA 4MZYA 2VEPA 4JGDA 4WIWA 3VD4A 3RDKA 4HYRA 5CSSA 3KL0A 1UKTA 1TX0A 4PCSA 1HP4A 4MPKA 1B54A 2GGIA 1BPLB 1HKMA 4AMAA 2RABA 4CD4A 2ZRWA 3VK5A 1RCQA 4HSOA 1XIIA 5DANA 3TSDA 5EYWA 2BNJA 4FOKA 1HL9A 2Y5JA 1KFWA 3FYOA 5JH1A 3TX9A 1DWGM 2R1PA 3B03A 3WZ0E 1LUCA 4I7UA 1CT5A 3VFLA 4UQAA 1E6NA 1QASA 2PUZA 4B9YA 4LIIA 4F2TA 3NDOA 1Z44A 1FKWA 1PTGA 4XVDA 4DO6A 4Q8VA 3MMTA 1VFLA 1I2PA 4TTUA 4DF1A 1XF0A 1K77A 2CZEA 2ZDSA 3FEQA 3FY1A 5FESA 1T99A 1Z32X 2FFIA 5BXPA 4O1AA 2XN0A 3DH9A 1OHLA 1OFDA 1A5CA 1S2VA 1P0EA 3UWYA 4MADA 3CGCA 5ABTA 2CKRA 4YLWA 1E55A 4DB7A 1SB3B 1QI3A 1FWSA 4AD1A 4IP4A 3ARXA 1TWWA 4P8XA 4CU8A 4PTWA 4WOZA 4WVXA 3FGCA 2EPHA 5AVHA 4F0MA 2GQWA 2DU2A 2XVKA 5DBTA 1B3ZA 5BROA 4QAWA 3DDMA 4LOCA 3GIPA 1A4MA 1L6FA 3H4WA 2BSLA 4AAJA 3VCRA 4GUGA 2C1IA 5BU6A 2YYUA 4YVXA 1VFOA 3W6YA 1HKVA 4OT7A 4GVHA 1JUKA 1XUZA 1EF3A 3QLDA 1WDSA 3CHDA 4AVNA 2C19A 3IIZA 4AW7A 3LLDA 4O15A 1H1NA 2Y7FA 3PPCA 1ZKQA 1SYTA 2ZA2A 1QI2A 3TC3A 5EA9A 3NRZB 1FHLA 4PMQA 2C91A 5G1TA 1W1VA 1TJPA 1CLVA 5KITA 2XSXA 2X16A 2V38A 1CYGA 4ERIA 5C9ZA 3WCZA 2NV9A 3VGFA 1UA7A 2YLLA 4ZSUA 2CLEA 4ADWA 2QMKA 4R3UA 4MKNA 1SPQA 1A5LC 5GVJA 4JHOA 2GPTA 4H7ZA 3TQ0A 3L8KA 1ZENA 2F2KA 1XGEA 3LYEA 1YE4A 3IANA 1TPWA 3CZLA 1F8WA 5MKGB 3SADA 4XIMA 5AN7A 4P8WA 3VNJA 3BQ5A 3PTDA 2PF0A 3SAZA 3CS2A 2Q8LA 2DSZA 4UTWC 3JRKA 1UD2A 2ZRUA 2E5BA 3UERA 2I16A 1GOQA 4LX4A 1E4MM 1FCUA 3G0XA 2EQ9A 3VD3A 3WF0A 5DRCA 4ZXOA 1H1YA 4F0KA 1I60A 2DT3A 4CLMA 3PANA 2IS7A 3MSDA 5U25A 1W3LA 3NSXA 1GYMA 4E8GA 1XH0A 1OIFA 4OV4A 1HGWA 1LRTA 4Q8QA 1GGOA 1BVNP 1X98A 2XFFA 3L9CA 3QFAA 1K70A 4RCXA 4LUSB 2VT0A 4ATWA 2JKEA 3N12A 4EWND 1GYNA 1EZWA 3NURA 1Q4WA 5I07A 4PB4A 1TPEA 1CECA 1WDWA 3TTQA 1JRCA 1WKFA 3AHTA 1OK6A 2PS2A 4ZE5A 1SGJA 2P0OA 4NJKA 3GD3A 3GXNA 2NWRA 1M04A 4N02A 4C1NB 4O13A 3CMGA 4CCCA 4L61A 4OTKA 3NCOA 4AZCB 4C90A 3EDKA 3E02A 3B8WA 3UZ5A 1NP2A 5TAOA 1ZAJA 2PP0A 4HGXA 4HVXA 3TNBA 1RK6A 5HUOA 4HK6A 1SZGA 4LVBA 3TTOA 2VENA 1OCBA 1H49A 1TUFA 2QEZA 2ZA3A 1GOWA 2CFYA 4DELA 1ZS2A 2V3DA 3N9SA 2WVUA 2BODX 2GQAA 3NJ3A 2ISWA 2ODOA 5I77A 1A49A 1XDJA 3NQ2A 3TW6A 4Q8OA 3HURA 1AL8A 2W55A 1STZA 1N8FA 3UW6A 3H2EA 3BQ6A 1IEVA 2WC3A 3P8IA 4ZB5A 3S4TA 3UJRA 4B4HA 4QG9A 4KH2A 1J8VA 2D73A 1O66A 1H11A 2X1TA 3VD7A 1PJ9A 4PBGA 1BWKA 1F3TA 5AYXA 2WP5A 3PZGA 2CHOA 4AMCA 1CI1A 4WK9A 4PMNA 1KR1A 1YDOA 2I7GA 2QLYA 1VPQA 1KM2A 2VFDA 1R30A 3CC1A 4K8HA 1PEZA 4Q6XA 4NG3A 4L5ZA 5J04A 2X8RA 1OJXA 5H91A 4NJJA 1YTEA 4UMAA 3S1UA 5TNVA 1ZMCA 3P61A 3IJQA 3GS6A 5C0QA 4LCQA 2R82A 3ZXWA 3IPWA 2HXTA 3ARUA 3I7RA 2OLAA 3H2OA 3CUJA 4GINA 1H61A 1WKYA 3W7MA 2F38A 4DO4A 2DJLA 4WY0B 3LXDA 1E9YB 4AX7A 3CUHA 4QLJA 1VBRA 5G5IA 3DCPA 5IFTA 2UWFA 4R33A 1YNYA 2GR1A 2R14A 2IKGA 3UZYA 1NH6A 2F9RA 4AHPA 1S2TA 1RA5A 1PYFA 2A3EA 3TH6A 2A6LA 1IXNA 2PDNA 1UH2A 4YTTA 7ODCA 5CGTA 4KF1A 4TX8A 1RH9A 1R3QA 2ISVA 1W1YA 3GFZA 1VPXA 3ARTA 3OZOA 5C8BB 3QRHA 5DY3A 3G6MA 3JU2A 4FXJA 2WHLA 3WUFA 1MI3A 4JTFA 1RXOB 3PUEA 3KS5A 4XBJA 4IFOA 4LGXA 1P0KA 1H50A 3B8SA 3EXTA 3C3UA 1TA3B 2PODA 3WENA 1C29A 2Y8KA 3EGJA 1KW1A 3H54A 5TIMA 3W53A 3BMXA 3WH7A 1H5YA 1B3YA 3EBVA 1M68A 1O4UA 1YEYA 4LYRA 4NASA 2QUMA 1C91A 1V0LA 2PLKA 5I02A 5G1YA 3ITOA 3ZM8A 5A2CA 3BXWA 3ARQA 1KBLA 3NA8A 1TTIA 4HHLA 1EC7A 1TV5A 1BXCA 3W7GA 3H55A 1R2SA 1U1HA 3CAQA 4WXZA 5HJLA 3NYZA 3DHUA 2I9EA 3CO8A 3SDOA 2BB0A 2HMCA 2Z6JA 3UD6A 1OGGA 3N6HA 3RX3A 1PS9A 3QW3A 2YBUA 4GCXA 3DX5A 3V18A 1X1NA 3GH7A 1FFQA 3VOGA 2PTYA 2FGZA 1JF5A 4DQWA 5GNYA 2VC5A 3RCYA 1GETA 4HK7A 2C6QA 4RDZA 2G8ZA 3BGJA 1PKYA 1X8FA 3VD9A 2RAGA 4GXMA 4H83A 3KBVA 4BA0A 1P6BA 1RJPA 3HMCA 1V3LA 1EJTC 4CCDA 3ITLA 2F8QA 3WNOA 4E8CA 4M80A 1QBAA 3MA8A 3R10A 3OIHA 3BGGA 1JCTA 5FAGA 1O5XA 3TN4A 3VKCA 1XSKA 4FSAA 3VKJA 4DJEC 1TREA 4IMCA 3KBNA 4LF2A 3UJFA 2EQ6A 5U7SA 3CGTA 2JQXA 1PHQA 3AZSA 3GHTA 4WSJA 3FXGA 1MO0A 1XYLA 3COTA 4GI6A 3FYYA 4A8NA 4W5ZA 1H3GA 1XPGA 2WLYA 1TIWA 1T8XA 1V0NA 1AQMA 3EWZA 3U7BA 3B8IA 3MSYA 3EDEA 1C3FA 3PJWA 4H04A 2J13A 4US5D 4LAKA 1ONEA 2VURA 1VEPA 3CM4A 1SMAA 2E4TA 5I09A 3FAWA 3RK8A 3SRDA 2ZTKA 1JCYA 3O63A 2QCFA 4DUVA 3GTHA 3UA3A 4X63A 3C86A 2FVMA 4B90A 3WD0A 4EPDC 3NQ8A 1JQVA 1CW2A 1KBKA 1E4LA 2A6NA 2GFTA 3SCWA