3KUMA

Crystal structure of dipeptide epimerase from enterococcus faecalis v583 complexed with mg and dipeptide l-arg-l-tyr
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
354
structure length
354
Chain Sequence
b'MKIKQVHVRASKIKLKETFTIALGTIESADSAIVEIETEEGLVGYGEGGPGIFITGETLAGTLETIELFGQAIIGLNPFNIEKIHEVMDKISAFAPAAKAAIDIACYDLMGQKAQLPLYQLLGGYDNQVITDITLGIDEPNVMAQKAVEKVKLGFDTLKIKVGTGIEADIARVKAIREAVGFDIKLRLDANQAWTPKDAVKAIQALADYQIELVEQPVKRRDLEGLKYVTSQVNTTIMADESCFDAQDALELVKKGTVDVINIKLMKCGGIHEALKINQICETAGIECMIGCMAEETTIGITAAAHLAAAQKNITRADLDATFGLETAPVTGGVSLEAKPLLELGEAAGLGISH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptide Epimerase
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Isomerase
total genus 123
structure length 354
sequence length 354
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3kumA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3kumA01
3KUMA 3DDMA 3CXOA 3TOYA 3ZLHA 4G8TA 1TE6A 2POZA 3PWGA 3SN1A 3CB3A 4DXKA 3DIPA 3JVAA 4IL2A 1FHVA 2QVHA 1P48A 3TWBA 3P3BA 3MUCA 2GGIA 3MZNA 2ONEA 3STPA 5BOFA 3FXGA 3SJNA 1W6TA 2PGEA 3DFHA 2GGHA 1EBGA 2PP3A 3GD6A 1E9IA 3MWCA 3IJLA 2PU1A 2QJMA 2DW7A 2OLAA 3RRAA 3H8AA 4KEMA 4DHGA 2P8CA 4IP5A 3T4WA 2AL1A 3H12A 4MKSA 1JDFA 3DGBA 7ENLA 4HCLA 3UJEA 3SBFA 4X2PA 2AKZA 1KCZA 2OQYA 2PTXA 3SN0A 2DW6A 3V5CA 4J3ZA 2QGYA 3TWAA 3JZUA 2PTWA 2PS2A 2PMQA 4E6MA 2HZGA 3UCCA 3THUA 2NQLA 3UJSA 3VC5A 3V5FA 3H7VA 2GSHA 1OEPA 2PP1A 4H83A 3R25A 4F4RA 3RR1A 4DN1A 2HXTA 4J1OA 3I6TA 4FP1A 2FKPA 3SN4A 1BKHA 3UXKA 3SQSA 3NO1A 1NELA 3ZVIA 3V4BA 3ES7A 4EWJA 3D46A 2PODA 3MSYA 2OX4A 2XH0A 1EC9A 3OZYA 1MNSA 4KT2A 4JN7A 3CAWA 4GFIA 4E5TA 2PP0A 1SJDA 3FVDA 4K1WA 3NZGA 1EC8A 3QLDA 3I4KA 2OPJA 4H1ZA 4JN8A 1MUCA 4HCDA 3DG6A 4FI4A 2PPGA 4GIRA 3N4EA 1NU5A 3CT2A 1YEYA 3OTRA 3UJ2A 3EEZA 3UJFA 3VA8A 3BJSA 3MKCA 4MGGA 3R0UA 3VC6A 1DTNA 1R6WA 3VDGA 3T6CA 5IDZA 4Z17A 4ZCWA 3FYYA 2MUCA 5FJOA 3DG7A 3TQPA 4IZGA 3CYJA 3TJ4A 4ENLA 3IK4A 1KKRA 3UJRA 2CHRA 2AL2B 3FJ4A 3PFRA 3RO6A 2GL5A 4DYEA 3N6HA 4JHMA 3D47A 5ENLA 2XH4A 3T8QA 3R1ZA 3GY1A 4HNCA 4A6GA 3GC2A 3UGVA 1ONEA 3VCCA 1F9CA 4HNLA 2OKTA 1ELSA 2QDDA 2XH2A 2P8BA 1EC7A 2AL2A 4HN8A 2P88A 3DEQA 3FV9A 3DESA 3UCDA 3BSMA 1XPYA 5FJTA 2OO6A 1FHUA 3BOXA 4HCHA 3HPFA 2ZC8A 4M6UA 2XGZA 2O56A 3Q4DA 3QTPA 4IP4A 2OZ8A 1EBHA 4IL0A 3CK5A 4KWSA 1MDLA 3OW1A 2GGEA 2QJJA 3QN3A 3U4FA 3P0WA 3V3WA 3DFYA 3TCSA 2OVLA 3JW7A 3N4FA 4E8GA 2PA6A 3NFUA 4G7FA 2QDEA 3PK7A 2GGGA 4E4FA 3MQTA 4A3RA 2GDQA 3OZMA 1L8PA 2OZTA 3FCPA 4GMEA 3RGTA 3RCYA 3MY9A 3U9IA 3ZVHA 2P0IA 4YWSA 2PSNA 2OZ3A 1PDZA 1PDYA 4ZA0A 1R0MA 4GYPC 3I6EA 1KKOA 5J04A 3OPSA 1XS2A 6ENLA 1TKKA 2QJNA 3P93A 4HPNA 3DG3A 4H19A 1IYXA 4E4UA 2OG9A 1MDRA 2QQ6A 1SJAA 3ZLFA 1TZZA 4DWDA 3RITA 2GGJA 3R10A 3S5SA 1WUFA 5BOEA 3N6JA 3R11A 1WUEA 2PTZA 2AKMA 4ROPA 4HYRA 4IT1A 4GGBA 4K8GA 4A35A 3TJIA 5EU9A 3H70A 5FJUA 4KPLA 3B97A 1JPDX 4GYPA 1JCTA 3S47A 1KD0A 4K2SA 4H2HA 4M0XA 3EKGA 2XH7A 2OFJA 2PGWA 2RDXA 3T9PA 3DERA 2P3ZA 3K1GA 4Z1YA 3VCNA 3VFCA 1MRAA 3Q45A 4GISA 2PTYA 1ECQA 2HNEA 2FYMA 5FJPA 3GO2A 3IJIA 2XSXA 3PWIA 3ZVHB 2MNRA 3R0KA 1P43A 2PU0A 3TTEA 3ZLGA 4IHCA 2OQHA 1SJCA 3SSZA 2I5QA 1BQGA 3IJQA 3ENLA 3NXLA 5FJRA 3QKEA 3UXLA 2HXUA 3QPEA 3TW9A 1SJBA 1JPMA 4MMWA 1RVKA 3OP2A 2PCEA 2ZADA 4DX3A 3ES8A 4GGHA
chains in the Genus database with same CATH superfamily
4NZ4A 3BPWA 3WK1A 1MOKA 3AICA 1LRNA 1POKA 3NGFA 4Q33A 1WAWA 4O18A 4R85A 1TVNA 3CXOA 5A2CA 5HDRA 3FAWA 2IKGA 4BEUA 3TXZA 3EWXA 3ARUA 2E5AA 3SN1A 2PTDA 2E6YA 1CXHA 4LRTA 5TAOA 3QPZA 4URIA 1EO7A 2CZFA 4IF2A 3WK3A 4ACYA 3F4NA 3G0UA 1FOBA 2PDWA 1HP5A 1PIGA 4LAUA 1EX5A 1UASA 4O0QA 4PSPA 2RDWA 1EPVA 3B4YA 4EQRA 1E6XM 1QCWA 4YVPA 3F5KA 4A8IA 1QO5A 2YPIA 1HFBA 2V3BA 4YJ5A 4V1YA 3WBAA 2GGHA 4QTGA 1NHRA 3GDBA 3UZJA 2VVNA 1GVQA 2DJLA 2D2GA 4XAZA 1XCXA 2V3GA 4Y6GA 3RU6A 1YNQA 1IR1A 4ZQPA 3CLMA 4IP7A 2WVVB 3N2MA 1WP6A 1G4TA 3W75A 3HB9A 4KIEA 1B5TA 3EPNA 1DQXA 4DO7A 1VRDA 3SY8A 1V3MA 1AMYA 4JTQA 1JXJA 2H8XA 1CGWA 1SZFA 3MA8A 4RJEA 5BMWA 1JDFA 3RUBL 4E3TA 2UY2A 1NFBA 4MTVA 2PRMA 5K9CA 3GD4A 1OC6A 1TCDA 1W9PA 4J3ZA 3BOLA 3AZTA 4AVOA 1XIFA 1EF2A 2QYGA 4JTRA 4QG6A 1X1OA 4JTDA 3E2QA 2VZVA 1EP2A 1TYGA 1C93A 2X40A 4LUTA 5JCMA 1J0YA 5FD0A 4AY1A 3N9RA 4KFNA 3PZIA 1FWAC 1FFQA 4H8HA 2ZX7A 3BURA 1JQXA 1XG3A 4GCXA 4PSRA 4GVFA 4GO8A 4GBUA 5CZ0A 1J9YA 3HPAA 4HPXA 3W6LA 1SQ7A 4JDBA 2XIIA 2BOGX 1KA9F 2C91A 3FYOA 3H2FA 1GQNA 5JRBA 1BTCA 3V0UA 1VLWA 4BI5A 2V3FA 4PE8A 2CBVA 3FA5A 3MHFA 1VFMA 2HVOA 2Y5JA 2ISWA 1WDPA 5EYWA 1E43A 4QJ1A 1HF6A 1UKQA 2FFIA 1OT1A 3AQUA 1A53A 4KT2A 1UKPA 3EOOA 3ZIZA 4GFIA 3MV01 2PDLA 3AM9A 2CZVA 2WJZA 1GZJA 5FACA 5HQMA 4HCDA 1M7OA 2J79A 3DG6A 2P0OA 1P1MA 1YDNA 4ALDA 3QGKC 2TSYA 1ZCOA 2W79A 3IGSA 4PTWA 4UNIA 3W1PA 1NP2A 4D6CA 4DF0A 3FY1A 3CGEA 1W56A 1XP3A 4DXVA 4PUWA 4Z17A 2W4XA 4N6FA 3M0XA 3VX1A 3W82A 5BU6A 3TJ4A 1TWZA 4PYSA 1KKRA 3A4AA 1TJPA 2VZSA 3W74A 2ZICA 1E1FA 1JDAA 3PFRA 4LU0A 2X1IA 1RJPA 1ALDA 2QCGA 1PIFA 1PYFA 1KM6A 5HATA 3UWQA 4KRZA 2GYIA 3B0XA 1DPMA 5E9XA 4JQ9A 4MDOA 1M01A 1AODA 2ISFA 3BSGA 3WF4A 2A2IA 4HHPA 4MWAE 3LA4A 4NASA 4UFKA 1QVBA 2Z1KA 3PSWA 2YFNA 4IMFA 2NXHA 3NVWB 2INZA 3SQMA 2F7FA 2WSPA 3RILA 4S3FA 3LX9A 2QDDA 4KWVA 3ANUA 2HK1A 1S2UA 1XPGA 1XYCA 1EP3A 2JEPA 3C2VA 2V2HA 1V5XA 2CLPA 3E2VA 3OG2A 3BOXA 1EQCA 1Q7MA 2FDSA 1KWGA 2BX7A 3GYEA 4IFOA 2YVJA 5FEZA 1PSCA 4JEJA 3THQA 2R91A 5DELA 3DKJA 4B9ZA 3P14A 1F5ZA 3CK5A 3QOMA 2X8RA 2GGEA 1K02A 4H00A 4M6QA 1AUSL 4GXWA 3ZR4A 3HU7A 3KP0A 4HOZA 3CO8A 2Z7GA 2E09A 4ZGYA 4HHHA 4MZ8A 4UQAA 1QW7A 3GKAA 2GWNA 3EXSA 2NV1A 1JRCA 4PRWA 3BW3A 1YQ2A 4GMEA 3HPZA 4DPQA 1CW2A 3ETRB 1R9YA 4GLEA 3TONA 1R0MA 5G4EA 2Z28A 5DBUA 2O4QA 3QXBA 1VYPX 2DVTA 4L7ZA 4HPNA 3LY0A 2PI6A 3NTYA 2FB3A 2J7HA 3RG6A 1CTNA 3WF3A 3QEZA 1GOIA 1QJWA 1Q6FA 1T99A 4V1XA 2Q8XA 3QZ6A 4W7UA 1EEPA 1YTKA 2Z26A 1M04A 1K3UA 4DB7A 3APTA 1WUFA 2Z0IA 3GTNA 3GU9A 4MAZA 3AXXA 3NQEA 1JROA 4QDMA 2ACSA 1FUYA 1EGZA 2OEMA 3E0VA 3AMLA 1XYAA 3SGUA 4QAIA 3QRHA 2QW5A 5EU9A 1VQZA 1E0WA 1TTQA 2NX3A 4FOUA 1KM2A 4GYPA 1JCTA 1LOLA 3GE7A 1M1BA 4ZOHB 1UH2A 2D0FA 3PZGA 4QM1A 4NY2A 2ZCGA 2G3MA 2QAPA 3VK5A 2NQHA 1R30A 5FOOA 3OA5A 5DBTA 4N9BA 1U33A 3P60A 3AHYA 1Q13A 4JNYA 1XLGA 1JZ4A 1M03A 3TTEA 3IC9A 2NLIA 4YHGA 1WKYA 3BL3A 3QHMA 2OB3A 4XZNX 3VILA 1KRMA 3T07A 1MFUA 2YBUA 1C8VA 3KL3A 2GUYA 4UZSA 4LEFA 4B9YA 6TAAA 3QPEA 4XKYB 3T40A 3TQ0A 1R86A 4QCFA 5EMYA 2CLFA 4TVDA 4IFRA 3H54A 2Y2WA 3GZAA 4AG0A 1B0IA 2PLMA 4HOWA 2XJ7A 1EHAA 3EX6A 4QSHA 4B3KA 3W72A 2HTMA 4S3BA 2WOQA 4JL2A 3HGJA 3A4WA 3PBUA 4H4WA 2J66A 4RZ5A 4HA3A 2IMRA 5A2AA 4ZMGA 2WPFA 3CZGA 3C0JA 2VR2A 3EPOA 1KM1A 1E1EA 3WLSA 1QATA 3JVAA 4AAJA 5XIAA 4MJ2A 4IIBA 1JNDA 2WMGA 3AN1A 2QCDA 5CKSA 3MKKA 1CYGA 4ONVA 2NQ9A 2C1IA 1J2BA 4W7WA 2D24A 1SFJA 4MVAA 4PTVA 1ZBCA 5D8ZA 1G69A 3VM7A 3UNTA 3HQPA 4LYPA 1TPEA 1V4YA 2J7EA 1N5WC 1QNRA 1OFRA 2V5CA 3QQWA 2QDGA 1GJUA 1PX4A 1KFBA 5KZ6A 4GX8A 5D38A 4GYFA 4PMUA 3NDZA 1ZUAX 3N04A 1JPKA 4DJDC 1S3TC 2HNHA 2WBAA 4MM1A 4FSAA 3G3MA 3G1XA 3EA3A 3CEUA 3N12A 2C3CA 3L2LA 1FWEC 2W62A 4GYJA 3WUEA 3V5CA 1SB3B 4I9TA 1VJSA 4OT7A 5DEZA 4FZIA 3CZ8A 3GFZA 2VEGA 1E6RA 1V6UA 2NQLA 2VI0A 3WLLA 3ALGA 2HVMA 3AS0A 1EGMA 3ZJ7A 1EBDA 4AY7A 5HWMA 3LPPA 1P7TA 4AHOA 2V82A 5DT7A 4JDRA 1I2OA 2YW4A 3ZYZA 3FFSA 1Q63A 2VRJA 1GVFA 1XDIA 1X98A 5CPOA 3E49A 3BWWA 3ITGA 4DJFA 4GNVA 5FF0A 2XVLA 2EG6A 4MY8A 4PL1A 4QIUA 2J3NA 3EWZA 4DIAA 2QJHA 1GZGA 2A3AA 3WD2A 3R8RA 2I1OA 1W8GA 3WDRA 3GRTA 1J12A 3I4EA 4KS0A 1P6CA 1QK2A 5E09A 4MWAC 1OX6A 4GUHA 3NVDA 4DNHA 2XIBA 4ROQA 1RBAA 2ZZBA 1TV8A 1EC8A 1KLYA 3I4KA 2H8ZA 1YBQA 4XD3A 2E28A 1SYTA 1VYRA 3UPBA 5IBXC 4UQBA 3HPSA 1LZOA 3EB2A 4WKFA 2NV2A 5MKGA 2OGJA 2W67A 4DJED 3DCPA 3QY6A 4F0MA 3FHAA 2FJUB 2ZRXA 3GKFA 4EMWA 2QIIA 3ZSSA 5G2IA 1F6KA 4N4QA 4HK6A 1MW0A 3C2FA 3B8SA 5JCIA 4MNLA 2GUUA 3AUJA 3WLQA 2E6AA 2Q8ZA 2HE5A 2PD9A 4GQGA 5EBUA 1XLEA 2B4GA 3D47A 4TV5A 1EOMA 5J5DA 5J8LA 4NXSA 5EMUA 5EFDA 4J2MA 5DFAA 3PJTA 1CXIA 3R6IA 4JL1A 1QI2A 2Z29A 2DVXA 3OU8A 1TREA 4BR1A 4M81A 2UBPC 1OFPA 3DHFA 3EB3A 3LCGA 3WNNA 1FO4A 5KSWA 2OLHA 4QISA 2V68A 3L4WA 3PC0A 4IG2B 3AYTA 4O14A 4UIOA 3TE9A 1ME8A 2OOGA 1CGTA 1EC7A 3U57A 4FXJA 2OYLA 4UQDA 3C3NA 4IH3A 4GRSA 2WHKA 1L6SA 1YLVA 4U5KA 3USZA 3I7QA 3N6QA 3VKDA 1FRBA 1TYPA 3B8UA 3O7UA 3A4XA 2C0HA 1XFCA 5LXXA 4JY9A 3HQ1A 1X6NA 2Y4SA 1W8SA 4GUGA 5M5DA 3CZLA 2E8ZA 4E4FA 3W4RA 1FCVA 3IWPA 3DZ1A 1DNCA 3PG6A 2DSWA 5EL1A 4YN5A 3IJ7A 3TYAA 5LA2A 3W07A 3ARXA 3TW6A 3MO7A 1PDYA 4K38A 3I6EA 4JGDA 2R1NA 2A0NA 1M68A 1ME9A 2BDQA 2FFCA 4QR6A 1M41A 4GJJA 4KCTA 3NSMA 4UBPC 1EWDA 6REQB 4GKLA 1F6PA 2QQ6A 3AHZA 1R7AA 4DWDA 4PULA 4EIVA 4JCMA 5BNKA 2QPUA 2GGJA 5E5CA 2DZUA 4BF7A 4J3TA 5CPNA 1ML1A 3TA6A 5DMLA 3RJYA 3E0WA 2VGIA 3W23A 1O95A 4PMQA 4U4MA 3WNMA 1KWKA 2QLYA 5JH1A 3ORWA 5AHFA 1TPC1 4LOCA 3SSJA 1S2WA 3W2LA 2DJXA 1B3ZA 2VENA 3N3MA 3KHJA 3M5ZA 3NO3A 4CNSA 1FWRA 1R9XA 4NKCA 4WDUA 1BAGA 4M5PA 5LIUX 2HE8A 1U5HA 3OBEA 2C7FA 3U2OA 2WANA 3NIYA 1MW1A 1TELA 4HHMA 5JBEA 1XGEA 1VRXA 3FSTA 1MXGA 2BLEA 3W7IA 5BXSA 4APNA 3GW0A 4PB5A 3A7AA 2WHJA 3VFCA 2ZA3A 2XSAA 4PUKA 4ZO6A 1U1HA 2ZRYA 3F2CA 4TV6A 3ZVHB 5I23A 2I5IA 4MADA 3U6WA 3G1SA 1TZ9A 4WJ8A 4O4VA 5C2XA 2PLJA 3ENLA 3GVGA 1JJKA 3RJXA 2GR1A 2A85A 4IISA 1XLLA 4ZOEA 4W4QA 3BSHA 3GB6A 4CVWA 3FKRA 2V0TA 1N5XA 4H6RA 4IMDA 3V36A 3STGA 1RP9A 3GRIA 2E25A 1AQ0A 4J3SA 1UMYA 3O05A 3G1FA 5C5YA 4IPLA 5G2HA 3UNDA 2GQ3A 3M16A 3W0KA 3CASA 2R9ZA 4G2DA 3WEMA 3B0YA 3GAYA 4CNOA 3NG3A 1FWSA 1V08A 3EB4A 2SFPA 2GUBA 5I06A 4H04A 3KVMA 3LCHA 3UWZA 7REQB 3KOZA 1KBLA 3IGHX 4U3CA 2GWGA 4D6EA 4EWND 4KPRA 5BYWA 1BD0A 1WZKA 4M82A 4K1GA 2YX0A 3PBYA 1KW1A 5A8OA 4L1XA 3QM3A 1AH0A 3GDLA 3VIHA 3RN6A 3SUWA 2NLYA 2UY4A 1A5KC 3GD6A 1E9IA 5CLTA 3R5EA 4O53A 1A3WA 1KBIA 2O55A 3K4AA 1Z8AA 3A6OA 3I10A 3I68A 4BEQA 3WNPA 3PG8A 3LQLA 2X8GA 4A8LA 2P8CA 3H7RA 1J0ZA 1D3HA 2X0YA 4JS3A 2ZZ6A 3W7OA 3CMFA 4JQ3A 4LY8A 4HJFA 5TBOA 4AZCB 4XO6A 5U4NA 5ABGA 1DXLA 1I2NA 2PTXA 1V51A 3WQCA 1QPQA 1SM9A 3LV5A 1W37A 1LLWA 2QGYA 4G7EA 3WQ6A 3R4IA 3JZUA 2WC7A 4DQWA 2QCEA 4EM3A 4E4PA 4Z08A 1BG9A 1M9HA 2YXXA 3W7QA 3E3HA 2PS2A 4C6EA 5M2FX 3IUHA 4KEZA 4ZENA 2YBVA 1BVNP 4ZL1A 1OBAA 4EP8C 1TPFA 5ABFB 4B3LA 3TR9A 2VGFA 4LUYA 4LXFA 4ERGA 3W6MA 3U7BA 4GY1A 3AMKA 2EQ6A 2ZE0A 3E5BA 4MSSA 3TMQA 1GCYA 4IMGA 4BWLA 3KOWA 3WNLA 2AAMA 1C8XA 2GJPA 1O4UA 4LYRA 3M4HA 2FH8A 3MKVA 1KV5A 2OX4A 1H5VA 1NP0A 2I7GA 1KXTA 2E40A 4WZHA 1DIKA 4O54A 1QTWA 1ZNNA 2J13A 1XINA 4XZ9A 5I5RA 1UWTA 4HYWA 3CAWA 1I2RA 1WDRA 3AS2A 4PMYA 2EG7A 2ZX6A 1GQIA 1FWWA 3LPGA 5EA9A 4C6MA 2ZRVA 1AZ1A 4GPNA 2OPJA 3A9IA 1BF2A 3FEQA 3CQHA 2R24A 3CO4A 2ZTJA 1F8WA 1NAL1 3BLIA 5I7GA 3SDOA 3VKCA 3NJ3A 2VEMA 3WY1A 3T0DA 4H9YA 3E2RA 1MW2A 3AXMA 1XXXA 2LLEA 1IGSA 1ZBVA 1T0OA 2CHRA 5ECUA 4GIEA 3N6HA 4AF0B 1HTIA 3WQOA 2UV8G 1LUCA 2AMGA 3W7KA 1EDQA 2OX1A 4GR1A 3R1ZA 4IFKA 1OCQA 2BMBA 1UD4A 1RALA 1AMKA 4BFAA 3W6YA 5HXMA 3SR6B 4MKNA 3TTQA 1Q6QA 2WZHA 3W7MA 3VDBA 2XIMA 2C8NA 1TCMA 3KBSA 5BW6A 3A3XA 1J4EA 1EJRC 4HTBA 2NXIA 5A94A 2PCQA 4D1IA 5DRIA 3LNPA 5JBDA 4H8UA 4NJJA 3LUTA 4CQAA 3NNTA 1RJRA 4M80A 4B5NA 4P5UA 3WEOA 3C3UA 3PBWA 2CKRA 3V1HA 2FB2A 3IARA 3N2TA 3AXKA 3ZT5A 2G3IA 1UWSA 3OW1A 4QG9A 1Q4WA 1E0VA 3N4AA 5I3IA 3PJWA 3DFYA 3WF0A 2NT0A 1E1CB 3COTA 3S2JA 1B3WA 3P84A 4XIMA 5LA1A 1V7AA 3QSTA 3NO5A 4J27A 3O63A 3OBAA 3CWHA 3VOIA 1KM4A 3LI0A 4IUGA 1I45A 3WEZA 1K70A 2MANA 1MQPA 2CLMA 2WOIA 1NH6A 3ATYA 5SWUA 1ADOA 2XSBA 4QS6A 2OZ0A 2GJXA 3G1RA 4PBEA 3QR1A 4ZFCA 4W87A 3IJ8A 3BW4A 2XWDA 3B9NA 1ZCCA 6ENLA 1TKKA 3GXPA 2QJNA 2I9UA 3P93A 4JHZA 1M53A 3W7GA 3VD3A 5F4WA 1K9TA 3N3TA 3UU0A 4BQ3A 2PDUA 1H1YA 3CGBA 3QY7A 2FZMA 2F6UA 4GYKA 4O17A 4PTNA 3AIVA 5HNRA 1SFLA 5A8GA 2EQ9A 3WQPA 2A5HA 5JVLA 2ZWYA 3W87A 3VIGA 2EF9A 4ZXOA 1N8IA 3RPMA 4FXFA 3CPRA 2XIQA 1GRBA 1GVIA 1V6XA 1XBVA 4AIEA 1I4NA 5LA0A 2KX9A 1IWAA 5D03A 1A4LA 4FS9A 1UR1A 1Z3NA 4XB3A 2CHNA 3H2MA 4G1NA 5JQ9A 1JDDA 4M0XA 1GVYA 4ICNA 3GM8A 3W37A 3PS7A 1OF6A 3NPWA 3AMZA 1PEZA 4EPEC 1A0EA 3REQB 5FKYA 1G0CA 3P67A 4H8VA 3VNZA 2Y70A 3O16A 4O57A 4LAKA 4D8AA 4LC8A 2CLKA 3PWIA 1FWTA 1K4QA 2R6OA 2WCSA 4UMAA 4YHEA 5A6BA 1XICA 2OELA 1OG0A 1AJZA 3NZQA 5A95A 2Q09A 4GABA 4XUGA 1CB7B 1RPKA 1NY1A 1LWJA 3A13A 3SRHA 1P6WA 3HW2A 1GRTA 1JAEA 3W84A 5D2YA 2Q71A 1IEQA 3NAVA 1HL9A 4LPCA 2ZXDA 3L12A 3S3GA 1YXYA 2QV4A 3EWWA 4P7LA 1B4EA 1IEVA 1UPMB 4TX8A 3TN6A 1TZ7A 3WDJA 1Z9AA 3W7PA 1FY6A 2XGBA 2XHYA 1UD3A 2VQUA 3N19B 1ZP4A 1ZK7A 3PN8A 1NDAA 2IQ0A 3P3BA 1J01A 4J2PA 3MUCA 1AW2A 2FPYA 3TV8A 2BS9A 5M3WA 4JX4A 1ONXA 2BNJA 4Q4MA 1S5NA 1EUNA 4FMVA 3QZAA 1HKVA 1R3TA 3O6CA 4YL2A 5DO8A 4QGCA 4JQAA 1W6TA 4FA3A 3DFHA 1W1A1 1CPUA 3RR4A 1P0EA 5AHIA 2AAAA 4LVFA 2EPKX 4MPQA 3VOGA 1V6VA 1EIXA 3CGDA 1FWDC 4PN2A 4TXEA 3VGEA 4LV9A 3H8AA 3CUGA 1XG4A 4RX0A 3STFA 1Q3NA 3LHUA 2GDVA 4YTUA 2VCCA 3KOYA 4IMEA 4X2PA 1KCZA 4EMIA 3NQAA 3U5YA 2CLEA 3P5ZA 3G1DA 4H9MA 1R8LA 4XWUA 1GVSA 2V3EA 2W3RA 3FIGA 3EX1A 3UG5A 2Z24A 3UJSA 3IVSA 4GVIA 1NDYA 1VP5A 3EX2A 2GSHA 4ZTYA 2IS7A 1ZGDA 3UETA 4MF4A 4U5IA 1LRQA 1H0IA 3O15A 3ITXA 4YCPA 4FP1A 4BF5A 1O60A 3VI2A 3LS9A 4EF8A 1FFRA 4LNYA 4E8CA 4O1BA 3MSDA 1HN1A 4AIUA 1EWEA 1ZALA 4DUWA 4TVUA 4EM4A 3A4JA 2NX1A 4PMOA 4HNNA 2F6KA 1V6WA 3CAVA 3BG5A 4XAGA 2GK1B 3G77A 2RGLA 2IPGA 3EMQA 3F4WA 3LPFA 1QI3A 4F40A 3G1VA 4RR4A 1H7PA 2WNZA 4L5ZA 1M7PA 3C56A 3W1AA 4YTSA 3B8WA 3M9YA 4FB7A 3HZ3A 3FJNA 5DMMA 1CXKA 4B15A 1ODZA 4US5D 3G8EA 4ORIA 5D2XA 2QF7A 3KX6A 5PTDA 4O16A 1F61A 3OO2A 4LVDA 1U2YA 4BI7A 1H3GA 3K8LA 3BCFA 1JCYA 1VBRA 1VHCA 4C1KA 4HNTA 3AIEA 5GNXA 4UTTA 4DNMA 5DQPA 1W5PA 2MUCA 5FJOA 2OJPA 1W3KA 3WJSA 1WDQA 2AL2B 4CGTA 1O5XA 2GL5A 3J7HA 2FHFA 4DRSA 4L6DA 4ZSTA 3B8VA 3VKJA 1FX6A 1ZS2A 2DT0A 4NQ1A 1YNYA 4RXFA 1YE4A 1ZENA 3AI0A 3TK7A 4QJ4B 2FLIA 2I9EA 1E71M 2Q01A 3T8QA 4NT0A 1S1PA 4HD5A 3C8NA 3SUVA 3LRKA 2DSZA 1J0HA 1JDCA 1GOWA 1J93A 4W85A 5BCAA 3E1F1 4NX5A 1FXPA 3GVRA 3ITOA 2WKJA 4BA0A 2YR1A 4LTSA 1OJXA 1CLKA 3FV9A 1BPLB 2GR0A 4AZ5A 5AYZA 3MUAA 3KHDA 1MRQA 3HN3A 2J8GA 3NZ1A 3RLVA 3YPIA 4K7YA 3EX4A 1H11A 1REQB 4RL3A 3UZ5A 1KB3A 2XFYA 4QS5A 3GXMA 3W00A 1H09A 4H4YA 4KWSA 1OGGA 1WE5A 1PHQA 1BKSA 5DCDA 2ACRA 1MUWA 2CITA 2ZA1A 4AXNA 2J7FA 1S5VA 3CL8A 2QF8A 4LALA 2DU2A 3UZXA 3MO4A 3BAKA 1JUKA 3UESA 4AZGA 2CERA 4YXGA 3W38A 3WQVA 4CU8A 1XM3A 2VC5A 4XISA 1B9ZA 2XTKA 3W1NA 2GDQA 2J47A 3M7WA 4V27A 3GIYA 5D9NA 3OGSA 1UW9A 2PSNA 2OOFA 1EX1A 1KTCA 3CTLA 1ZY9A 1XRVA 1RZMA 1LQAA 3W7DA 3MI6A 3BQ5A 3WUGA 3IEBA 3WLPA 2REQB 1IZJA 4GI4A 4H4XA 3AYSA 4DUXA 3ANVA 1A5UA 3OQ8A 4E4UA 5C7VA 1VR6A 3HMJG 2HQMA 2VDIA 1RHCA 4DJEC 3UERA 2QIWA 3S2MA 4D6DA 4L1WA 2PDKA 2G4JA 3WH9A 3MI3A 3THCA 1DJGA 2NXGA 3GR8A 3DN5A 1ADDA 1WUEA 1W9XA 2OXNA 2BZNA 1ZJBA 1I0BA 4U2ZA 4WY0A 1DQWA 1OX4B 4RE4A 3N25A 4MOZA 2PZNA 3S2LA 5C9XA 1E73M 1IT8A 1JI1A 2JKPA 2JK2A 3PPFA 1OF8A 1ODUA 1SU5A 1GYLA 1E6NA 3F5LA 1HGWA 1BHGA 1L2QA 2EAWA 1HQTA 2JKAA 5CSRA 3AXIA 3NZRA 2WPBA 3VD9A 2YB4A 2YA0A 3A22A 3WBEA 1TE1A 2Z1XA 3W7CA 1D7YA 3OQEA 5AVHA 3TYEA 1ZMDA 5ABHA 4L4MA 1TV3A 5FJPA 3LHYA 4L6OA 4UFIA 2NUXA 5LNSA 2OCZA 3TW7A 3UGRA 2PDCA 3KFTA 1VBUA 3TYCA 3MP3A 3NXLA 4F0SA 1UH3A 3GHRA 2VWSA 1GG1A 4HSHA 5I3JA 5CBIA 1NHQA 1THFD 4DPPA 3VAVA 4A05A 1VBJA 1HIZA 1FDYA 1OYBA 5LHEA 4C7FA 4NU7A 1GERA 3LRLA 4G8TA 4R53A 4BY3A 2QCFA 1KXHA 1QK0A 3PB2A 3M64A 3WBXA 4IJRA 3OVGA 3KVLA 1NWSA 1P1XA 3P0XA 1NFPA 1KFKA 1NDVA 3NQDA 3GXTA 3UWEA 3MZNA 2EO7A 2ONEA 3STPA 2NQ5A 5K4XA 2WNNA 3W7RA 2P50A 3RHGA 2C1GA 4JFUA 1ZSXA 3H23A 4NAEB 3WLRA 2QJMA 1M3UA 1LYXA 4LCRA 1K7EA 2NWSA 2DSUA 3RRAA 1VFLA 4WY0F 3SCOA 2BY2A 4MNMA 2CFFA 3LMZA 4J56A 2QXWA 1J6PA 4DHGA 1V03A 3F5JA 3PAJA 5G5HB 2C18A 3MMUA 4H4UA 1GOOA 2W6RA 1QHZA 3EAUA 5GJPA 3U8GA 1GUVA 4D9PA 3V75A 4EE9A 2VX5A 1CGVA 2ZRWA 2A6NA 5K3VA 3KLLA 1GQLA 2W54A 4M1BA 3NVYB 2QAFA 4G56A 2IW0A 3ZR5A 3EDFA 4L64A 1O7AA 1WZLA 3SURA 3HFYA 3O1NA 3FG2P 4O10A 4OZOA 3V35A 3VNMA 1JFXA 3BLKA 4C6PA 3F03K 4N0RA 1ITQA 2CESA 3IIPA 3ARQA 3T0TA 4V2XA 4AZ6A 4CU7A 4GI9A 1UG6A 4A22A 1O5KA 2WWDA 5HPCA 2VZUA 1AD1A 3D46A 3ME3A 1XSKA 5JXQA 3EOEA 2IXUA 1A0DA 3UZZA 4X9YA 1DYSA 2XH0A 1RK6A 2Y0FA 3ARRA 3M43A 5I77A 5BZAA 3ITYA 3ZWSA 3QW3A 1JYXA 1X6UA 1Q6GA 3W1UA 1TPWA 1KBBA 3OLDA 1OX5A 4LANA 1VIWA 3QLDA 1NARA 2A8XA 3P5YA 4WXYA 3QQ0A 1W32A 2Y61A 3GS6A 3DYMA 3QV8A 1F07A 1L8NA 3MBFA 3PG9A 2Z2AA 1OCNA 4B2DA 4R9XA 2W66A 1TJ1A 1BWVA 4I5RA 3W25A 3BJSA 4AEEA 4MWAB 1EL3A 1Y7VA 1VBHA 3L21A 4FLRA 2VX6A 2JBMA 3CXBA 2FZDA 6TIMA 3CYJA 5DMNA 1TIMA 1F4AA 4K8EA 4BWLC 1Q85A 2WVSA 3PZ9A 1UWUA 4DZ5A 4E3VA 1UP3A 3KZSA 1E0XA 4JYFA 1UUOA 3FJLA 5DCBA 3BANA 4HOXA 3LQGA 1SW0A 3K13A 4Q4RA 3SCQA 2QMKA 1TV5A 2Z4GA 3SFKA 1UA3A 2QJGA 2XUCA 2ACQA 1DIEA 5H91A 2B7PA 3GY1A 1TVLA 1BSIA 3UGVA 3WMBA 4D2JA 3UP8A 1V3KA 3FJ6A 1W5NA 1JD9A 2YDRA 5CPQA 1UOKA 1F3WA 4N9CA 2GVLA 2ODOA 3RDKA 1DBTA 2FVMA 4DUOA 1V93A 4XQ6A 3TC3A 5JU6A 3VOHA 3V0TA 2O7SA 1L9WA 2ZUMA 2VC7A 5AYBA 3CUZA 4QSFA 1LRTA 3P82A 3NL3A 1FHUA 1YXDA 3IUIA 4XTDA 3NR0A 4M6UA 2NVKX 1ZL1A 4IP4A 5CJMA 4LQ1A 1XIIA 2XIOA 3AZRA 3EMZA 4LAZA 1B3OA 2GVEA 3W7JA 3QN3A 4I7WA 1NSJA 2YA2A 3N73A 5ABEA 3JW7A 2JK6A 2CZDA 4E8GA 2ZVRA 4IGMA 3N34A 4IX2A 1BG4A 4H3DA 4W8AA 5EBAA 2QDEA 4MNKA 2ZKMX 4CN4A 3SCRA 1GT8A 3LHWA 1A3XA 1LL6A 5FS8A 4N02A 4D6JA 4JEQA 5CBJA 4MG4A 1ISWA 2CLOA 3UW6A 4KGJA 4AVFA 3AJ7A 2WOVA 2Z1BA 1OFEA 3M7SA 3LRMA 1VCFA 1LF1A 4EF9A 3GD3A 3POCA 1FIQB 1ESWA 4I8YA 5CZSA 1KGUA 1ZBWA 4NIRA 1XLFA 1MQQA 5FS6A 3ZLFA 5E1QA 3WJXA 1D3CA 1G67A 4OHQA 2Y88A 3DJJA 2V30A 1YPXA 1V97A 3GIQA 4AD0A 2R1LA 4FNPA 3R11A 5H6HA 4IT1A 2WJDA 3MU7A 1GRAA 3UEQA 3BICA 2NW0A 3KDOA 3W2NA 1AD4A 3DBPA 3SEPA 3GNNA 5CPLA 3HM7A 4MAVA 2ZX8A 2J4GA 1HGYA 1XYZA 2E5DA 5DANA 2VM8A 1FWGC 1U5VA 4MYAA 3GG8A 3PZQA 1IXQA 5A1AA 4KETA 4A3UA 4J40A 2IXVA 4RLIA 1KFCA 4MJMA 3MCMA 2G95A 4C6JA 3GH7A 2NUYA 3VE9A 2DGAA 2J78A 3CH0A 2XFFA 1Y8BA 2DZAA 2XSXA 2ZZ1A 3MMDA 4XD4A 8XIAA 3MUIA 3WLJA 4NNCA 2PFHA 4DZHA 1SJCA 2E9MA 3E5PA 3DAQA 3ALFA 5CZTA 1T7LA 3PHAA 3UD6A 1Q6CA 5FJRA 4C6KA 1SJBA 4F0KA 4PEKA 4QE5A 4MMWA 4LUSB 4JIQA 1PX3A 3VGGA 2VQTA 4XZHA 4ERIA 3WL1A 3TUUA 1RQEA 1Z32X 5H8PA 4PCPA 3BV4A 2WSQA 4GE8A 4NAFB 3DDMA 6CGTA 3KRSA 4UFLA 3ZLHA 5A6AA 4H9ZA 4FR1A 5HJXA 3DC0A 3LG3A 2VXNA 1PWLA 4Q32A 3DIPA 2NT1A 4ACZB 4XKYA 3SUUA 3WF2A 4UOZA 3LM3A 1TA3B 4HP5A 3A12A 1RY8A 4JIIX 1UHVA 2PGFA 3EUB3 1GEQA 3MDUA 4QHRA 5BROA 2ZBTA 4GJIA 4RK8A 4NZ5A 4CCDA 2WHMA 8TIMA 2OSYA 1R7OA 1DWGM 3SJNA 4O8AA 3AXHA 3E38A 3EX3A 1DHKA 4TR9A 4RE3A 3H7UA 1O66A 4PMJA 3QTGA 4A29A 1DORA 4HU8A 2BWGA 1U1JA 2VCAA 3PJUA 5IFTA 3FAXA 3F4CA 3MUXA 2VFEA 3PZNA 4N7QA 5G1TA 4YS1A 1KQYA 4LWWA 4I5XA 2YVFA 4XG1A 4TVWA 1GPFA 3VGBA 3UJEA 3MWAA 4UTUA 1TQXA 4GQQA 4U3AA 4QROA 1XLJA 3H2NA 2Q8LA 4AY8A 1TWDA 2X8CA 5I78A 4WOQA 3NA8A 5BRPA 2VZTA 3HIJA 3UCCA 1WCGA 3M5XA 3U4AA 1A50A 4LAMA 1XD0A 3P6LA 3QFBA 2DP3A 3V5FA 3W7EA 3WQ4A 1FWBC 5LIXX 3SIMA 2QDHA 1TJ0A 2GPTA 1JPHA 2HWGA 1R46A 3MS8A 4Q4PA 5D02A 4J1OA 3BAWA 2OYMA 3UWVA 3UXKA 3TTYA 4KKXA 4BCEA 3ZVIA 4QNWA 3TYUA 1LBFA 3ONCA 3C52A 3R89A 1OINA 3NYZA 4C6NA 2NVDA 1JG9A 2QUUA 3BCJA 1GRHA 4O1AA 5T8GA 4D71A 1O68A 4ZOBA 2G37A 3OLIA 1W2PA 3DENA 1PL9A 3DHPA 1VBGA 4PUMA 4CD4A 5I02A 1M7XA 2PP0A 3B8TA 3FDKA 3QHNA 3QMSA 4GA8A 3M0JA 4OOUA 1XKYA 1G7VA 4NRSA 1KR0A 3INPA 4ZR8A 4W89A 5GRTA 5A3HA 5I3KA 4ERAA 2PPGA 1GPWA 2Y85A 3W88A 3TQKA 2VEPA 1N60C 5IRPA 2W3SA 4ZQCA 3NEVA 4PTMA 1OYAA 3OBKA 4NRRA 2J7DA 1BRLB 1HVXA 4D72A 3KL0A 5HQEA 1AJ0A 1YDOA 1ZAJA 3BH4A 1YTEA 3TTOA 1UMLA 2PLCA 3T7VA 4ENLA 2ATMA 1HJVA 2I57A 3LTPA 2PUZA 1JGMA 1E6ZA 3RO6A 2BGNE 2W5FA 2GJLA 4UR9A 4XZMX 3NURA 4FX7A 3OVPA 5REQB 5ENLA 1ITCA 1XLCA 4LFYA 3UY8A 1C9DA 1GOMA 3G8RA 5IDIA 3WDIA 1NDZA 3M0HA 8RUCA 4V33A 5CAHA 4S3AA 2WXDM 4A3HA 2ZUUA 2YLLA 5A8PA 1UWRA 4Q7NA 5FL1A 4BV6A 4M24A 1C91A 3NOEA 3LBOA 2GQWA 1E3ZA 3PR2A 3CYVA 3VZXA 3DESA 3VDCA 2OO6A 1HKIA 2FZ8A 1OZMA 1TWSA 3HPFA 3PUDA 4AXKA 2JALA 1AG1O 1B2YA 1TYTA 4CKQA 1UWIA 3VZZA 4ATDA 3AMCA 4WDWA 4IG2A 4AC1X 3VINA 2OVLA 1EFZA 2HPIA 2VR4A 5TD4A 4XTIA 5M17A 4LYQA 5LIKX 2Z1VA 1S2TA 4YWIA 3PFMA 1F74A 1OT2A 2WPGA 3V16A 3S2CA 2OZTA 3RIKA 2EQ7A 2HJPA 4YWSA 2WCAA 1QPOA 3B04A 1BGGA 4OV4A 4I9JA 4K8DA 3L65A 3M0VA 2YVGA 3KL5A 3ZJ6A 4TVCA 2D0HA 2PC4A 5FEPA 2B7OA 3TAKA 1J2WA 1W2VA 4I5UA 3DK9A 4LF2A 3L4XA 4O52A 1NFGA 2ZXAA 3C2EA 2WO5A 7A3HA 3QV6A 3S5SA 4GVGA 4B5WA 2ZRUA 3L0NA 4RZBA 5CGQA 1EJ7L 2DZPA 4IOTA 2AQOA 3KWSA 4PUUA 1B4KA 3S5YA 3O07A 4PUNA 3QOKA 4MZYA 1DXIA 3E6EA 2C19A 3L68A 2J8FA 3O3RA 2H3DA 1C90A 4O50A 1CB2A 4Q22A 1KM3A 1MEIA 4R7JA 4M19A 4RE0A 3WQGA 3K1DA 4JICA 1CDGA 4XBJA 4X63A 3SR7A 5CGMA 4EMJA 1GSNA 1E40A 4FK9A 4NUWA 1XLDA 1O1HA 2JIWA 2IKIA 2WCGA 1C92A 5C2GA 3CIWA 4H7CA 4UQ9A 3MHGA 4X60A 3WFZA 3WLIA 4Z0JA 2ZUNA 1DXFA 2JFEX 1LP6A 1LDCA 1LJYA 4P7NA 5FMHA 3SRKA 3PUGA 1RA0A 2QEZA 4GI6A 1LBMA 2PF0A 3W1RA 4L6HA 2ZE3A 4H4ZA 4Z2HA 1TB3A 2QS8A 3CLWA 4M1RA 4Y9MA 1PS9A 6PTDA 1XHGA 2VGBA 1RBLA 3O8AA 4INFA 2OR2A 4PC8A 4PFMA 1DWFM 7ODCA 4RNIA 4CD8A 4L80A 2D22A 3A3WA 5AECA 1JXKA 3TOYA 2C1HA 3L67A 1Z48A 1AW1A 4IIGA 1UC4A 3MC5A 4WKAA 3QFEA 2L5HA 4LH8A 1ONFA 2YJQA 1FHVA 2Z7KA 1YPIA 3TJLA 4H41A 1AOGA 1VDVA 5AVNA 1ONRA 4PCFA 4R7OA 1JGIA 1OSEA 1OVDA 3VOJA 2QCCA 1RA5A 1OY0A 2NVCA 5CJNA 4OFCA 1VH7A 2E67A 1JIBA 2BVYA 4QCEA 2FZBA 4QDWA 1EDTA 1FA2A 1NOFA 2VT0A 7REQA 4MYXA 2HRWA 3UPWA 3ZM8A 3WH8A 4GD0A 1B3XA 3QFWA 3DXIA 4OV9A 1YNPA 1I2PA 3W22A 4O1CA 3B0PA 4NXKA 2V81A 2AKZA 4HU3A 3KXQA 4NEWA 3R58A 3SN0A 4Q3MA 3H53A 3GNDA 3TWAA 1FDJA 3WQFA 1IXNA 4FIRA 2WSYA 1V3IA 3WDHA 4FLSA 4AMAA 2PMQA 2D3NA 3OIXA 5AC8A 4TMCA 3THUA 1W3TA 3W2MA 5JCLA 1AVAA 3H7VA 4WXZA 3OZOA 4W5UA 4NSBA 3LCLA 4AZCA 4EQWA 2ZFAA 4AFYA 4H6QA 3TQVA 2BGSA 2Y6ZA 4DN1A 3TOPA 1H51A 4WR3A 3RRXA 3N17A 5K7JA 3SQSA 3VO0A 1GREA 1ISYA 4AD2A 1MZHA 4YYCA 3HV9A 3AUOA 2PODA 3PBMA 4C5ZA 2KAUC 1IIGA 3WKZA 4JTFA 1JZ7A 4FXSA 3H2EA 5HAOA 5A2BA 1O94A 5FL0A 4BJHA 3IAQA 3LGGA 3L4TA 5ABFA 1UBSA 4EANA 4RDWA 3V0SA 4REQB 1V8EA 3MSRA 2A3EA 1RK5A 4UFHA 3OYZA 3VUSA 4DBUA 4H1ZA 4FI4A 3EYPA 3CT2A 3UJ2A 3EEZA 1E4MM 1RV8A 1WNOA 4AD5A 4C1NB 4LA1A 3ISIX 2JGQA 2G3NA 1QDSA 3UVIA 5M1TA 2WW5A 4PMZA 2PDJA 4QNEA 5FS9A 3TYZA 1WOAA 2YXOA 1NOUA 1S2VA 5DY3A 3TQPA 3BZJA 4KMQA 1MWOA 4NZJA 3GC5A 3AHXA 2J74A 3CTTA 5DN1A 3ZR6A 1W3NA 1EP1A 4FDCB 3S5OA 3LDVA 4QX4A 3UXAA 2PDGA 3SGZA 1QI4A 2CETA 3GHUA 3KM8A 5C70A 1LBLA 1TMHA 2OODA 2EQ8A 4HK5A 3AWNA 3CV7A 1T41A 3ZO9A 3M0IA 1EXPA 3QV9A 5CBBA 1QPRA 4AF0A 1BF6A 1WXYA 1QBAA 3DEQA 2WHLA 3AOFA 2F6XA 1H7WA 4A4AA 4M52A 1A49A 3JR2A 1K8CA 1ITUA 3KOFA 1J0JA 3LI1A 1GRGA 2VX4A 3Q4DA 2IKJA 4FPSA 2DZTA 3K2GA 3WENA 3ZT6A 4GY0A 1Q6EA 2X2YA 4BURA 2QJJA 1GW9A 3M44A 1RCQA 4FX8A 3N4FA 1XRSA 4PTDA 2INEA 2IPFA 5M03A 3AWOA 4RDZA 2GGGA 2V67A 3GXDA 3SM0A 4YYFA 1BZLA 3WD3A 3B0UX 1R3VA 3ID7A 3KCJA 2D2OA 3IRDA 4AEFA 3ABZA 1T5AA 4YWOA 2ZVIA 4XZBA 2XU2A 2FZ9A 3W70A 4E0CA 3HQNA 3TFXA 3E2SA 4AIOA 1FKWA 1W54A 2VTFA 1HT6A 1DOSA 4JTAA 4H19A 3G0XA 1W1PA 4J3UA 1C7TA 2OLSA 4J7RA 3W7HA 2XFWA 4ZB5A 2YKKA 1H2JA 3D9XA 3T09A 2FMOA 5AHLA 5L9FA 2E3TA 3GIPA 4UOQA 1N7KA 3RLHA 4A3YA 4UTWC 5C6MA 2E3ZA 1MZRA 1N63C 1S2CA 3NL5A 4ROPA 3F1QA 3WLOA 1NVMA 3GVWA 1Q1WA 1JF5A 3NDOA 1J11A 2EHHA 3GFYA 3WN6A 5G4WA 1BWCA 4O4WA 3OODA 1UQZA 4NJIA 1MNZA 5I79A 2QVNA 5C0QA 4RW5A 3CGCA 1US3A 4OBSA 4J28A 1H2IA 1GHRA 5G5IA 1NWRA 3UG3A 1PZ0A 2XH7A 1OFAA 2BTMA 1PTDA 5LIWX 1IWBA 1BSLA 2A3LA 1ZJAA 3M5YA 2D69A 1BFNA 5TR3A 4PMRA 1PZ2A 3CS2A 3NQCA 4UTMA 2VFGA 4S39A 1OJTA 5E6ZA 3FKKA 1UR0A 2DORA 1BVZA 1GJPA 3HG5A 3CQJA 2ZXBA 1YADA 2VC9A 3NQ8A 3UVAA 4HA4A 1VENA 1E51A 1PKNA 3GFXA 4RNJA 5FESA 2TRSA 1LPFA 1MVYA 3LADA 2F2KA 3E02A 4KF1A 3REQA 3W2UA 1PV8A 2X8HA 2QUVA 3RYSA 3KUMA 1J5TA 4EOUA 5I3GA 3N2BA 4FLQA 4RDVA 4QDPA 5HBFA 1UYQA 3L5OA 1VEPA 4LVAA 2DIJA 4AISA 4S3GA 1Q45A 3GR7A 4DXKA 3P8JA 1F6YA 1UKSA 4DF2A 2BV9A 4GXMA 2I16A 1MSSA 5TQLA 1WKFA 4I6VA 3DOPA 5LNWA 3O6AA 2V3DA 1M6IA 3AIUA 5CSSA 5D05A 3ZSTA 2ADAA 5F4SA 3NUKA 3G1HA 3BLOA 1TIWA 2WQPA 4R34A 4UTIA 1D9EA 2PP3A 1KRCC 5KINA 1N61C 3PY2A 3OHMB 3LCFA 2R1PA 2ISDA 4GXPA 3EWUA 4JKLA 1B3YA 4S3KA 1AL8A 1D8WA 4F2UA 2FTPA 1RH9A 1HX0A 4KCWA 1E0TA 1E5NA 5IFPA 4IP5A 1HJUA 3IAPA 1QFEA 3G3DA 3CV2A 5AYIA 3G6MA 1UD8A 4F79A 1UR8A 2WP5A 4HCLA 2VWTA 2CDUA 1EH9A 3TSBA 4TTGA 2DW6A 4X9SA 1GYMA 2NQZA 4EQSA 3THDA 4HVXA 3APYA 3RU8X 5C54A 1LT8A 5LNUA 4Y96A 2IQDA 2XVGA 4UFJA 2BB0A 1QI0A 2V8ZA 1Y5WA 3CWOX 1Q2SA 3LTSA 4N42A 1NM9A 3N2OA 1JYWA 2PP1A 2TPRA 3VDHA 1LG1A 4CVUA 2OEKA 4XUYA 1VS1A 2FKPA 3WD0A 3NO1A 4ZBCA 1Q7ZA 3MSYA 1TWWA 1PZ3A 3H22A 1RP8A 4CQDA 2YW3A 4J57A 3EOSA 3BK0A 2B31A 5KZMA 3OA3A 4JNMA 4JN7A 1BYBA 3TN5A 1X1ZA 1HW6A 2YZRA 3QF0A 3RX4A 3MB9A 3LYEA 4ZOAA 3NDYA 4M8UA 1V7YA 3DUGA 2ABAA 4K7VA 3ZOAA 3W86A 2VX7A 3W81A 3R0UA 3VDGA 2DIKA 2OQLA 3S4TA 5G1MA 2GK1A 2FVLA 4G7EB 2J7GA 3O2LA 4U10A 3WLTA 4L61A 1W1VA 2C16A 2YQUA 1OYCA 3QW4B 1TUXA 4TMBA 3HJZA 3CV1A 1FWIC 3R7MA 2EPNA 3LXDA 1EJUC 3BO9A 1BGAA 2XH4A 1HJWA 4L4LA 3W53A 4Z1CA 5EMJA 3MMTA 2IKHA 5DCEA 3C61A 3L0KA 2X7WA 4BHYA 1ONEA 1H7NA 5I3DA 3UBPC 2VR5A 1T8XA 2NV9A 1GTHA 2OKTA 4GWEA 5AZ1A 1TPDA 1ELSA 4XX6A 3RAOA 1Q6RA 2AL2A 3CMJA 3CL6A 3IJDA 1ZJHA 3PTQA 5BWAA 2VOTA 4Z0SA 5A6MA 2J9ZA 4JPGA 1XPYA 3LLXA 1FCUA 4ADUA 4HCHA 4GUFA 1OGBA 4GINA 1JRBA 4NP7A 4CQBA 3K4WA 4WUIA 6A3HA 1Q6DA 4ATLA 4JTHA 3SGGA 1MDLA 1YIXA 3KBVA 3OVRA 3EOUA 4K37A 4LVGA 1ISVA 4GNJA 5DXYA 2GRTA 4N9DA 5I00A 2HBVA 1Q7QA 5D30A 3L4ZA 3DFPA 4CN1A 4QAWA 2WZIA 3URNA 3TXVA 4JFSA 4NZ3A 1E9ZB 2AGKA 3AIBA 3PANA 3VXGA 1REQA 4Y9OA 4F2BA 3RCYA 5HWJA 3JZEA 4Q4SA 3RK8A 4O19A 1U1UA 1E0UA 3LK6A 3OPSA 5K2ZA 2RJGA 3ITLA 4IFKB 4QLLA 2WKGA 4GQBA 4IX0A 1V02A 4LCQA 3URQA 1W91A 4EPKA 4ZODA 3PUEA 1BTMA 2GDUA 1XLIA 3TMLA 3TNBA 4D6HA 3E12A 5CXPA 4HJWA 2Y1HA 3GAKA 1J96A 2PDXA 1G4EA 4AZHA 5F2IA 4UMCA 3EDJA 3B0VC 4A35A 2REQA 3WLHA 4AX7A 1SO4A 4POCA 3UZYA 3ABOA 2Y7FA 5ABTA 1RPXA 4O0KA 3D5HA 1H0GA 3APGA 3UR2A 3LOTA 3II4A 4JBRA 3HGRA 2WOWA 2KZHA 2WBKA 3DGHA 3EKGA 1O12A 4MY1A 2H9AB 2CHOA 3F4DA 2JF7A 3P8IA 4QEHA 5EFFA 3M6DA 1B9BA 4DO5A 3T44A 4IUOA 1OX4A 3QYQA 4UTLA 1V0LA 2R94A 5BRQA 3GO2A 3IJIA 5CZJA 4ZFMA 2DPEA 1WO2A 3N9SA 1MXDA 5CCZA 5FF4A 4CQ8A 2OQHA 2J77A 3CJPA 1X96A 3SCNA 1IZKA 4JX5A 2FHBA 2DV0A 1Q6OA 4NG3A 5U25A 4Y90A 2QCHA 4YVVA 1TR1A 2YAUA 1GQJA 4B4FA 3S1XA 3IIZA 1US2A 1G94A 4H50A 4JFVA 5CPMA 3VVGA 5KETA 3AIQA 4HK7A 5T9CE 4LW7A 3U5UA 1XRTA 1RAKA 5A6SA 3OHIA 2ZDRA 2GGIA 1WZMA 2ZZ5A 1SGJA 1VHNA 3IANA 1J0IA 3OYXA 3TCEA 1QU4A 1NF7A 4PCNA 3LGEA 3W01A 3SCPA 1KM0A 3N2CA 5I03A 3LU2A 3IPWA 1EBGA 2Q3OA 3NPVA 5LGZA 3O0KA 1G1YA 1U30A 1KM5A 3GHTA 2DSKA 1UR3M 4KEMA 2J9XA 2HISA 2QT3A 3SQPA 1RD6A 2PDFA 3CM4A 4JKKA 1XI3A 3AHTA 3SQLA 1UR4A 2UZ9A 3WIJA 1Y65A 3OGRA 1R9ZA 3N15A 1ZAHA 4LAOA 4QFUA 3I3BA 3MP4A 3P7YA 1SSGA 1PZ1A 3BCDA 3SUSA 4GIAA 3LZ5A 4XSMA 4H7ZA 2ZYFA 4LB3A 1F8IA 1K6AA 4BZYA 2GSJA 1GEUA 1CT5A 3W73A 1E6PA 5KVHA 3LXAA 2PWVA 3OEXA 2GH5A 1ENUA 3VX0A 1W1ZA 4LB4A 2C71A 1XGDA 1VYSX 3GSMA 1RQHA 3PBVA 1ZLPA 4GOAA 3MTWA 4ZQNA 3VKAA 1XUUA 3GQYA 4GIYA 2CWNA 4ICCX 5KZDA 2G5WA 4NYYA 4HKPA 4DJDA 1VEMA 2X1TA 1N55A 3I3EA 1GVOA 1X7FA 5D4YA 4IIHA 1DJYA 1VEOA 4PTXA 1NPXA 5H8MA 1YDVA 2ZUSA 4XD6A 1WPCA 5CJ5A 5C7HA 5FF3A 4Y9PA 2Y8VA 5FF7A 1F2JA 4ADWA 1W9BM 1K8XA 1FFVC 1GYNA 1LQ2A 3O0HA 4O8RA 4NJKA 3AZSA 3UY7A 3VC6A 5HNNA 1R2SA 5DMYA 4UMBA 5HJYA 1JRPA 1TTPA 2Y62A 2YDAA 2R1KA 4O12A 1FQ0A 4H6EA 3JU2A 2PC8A 1FVPA 2J7CA 4FNQA 1SFTA 1XLAA 3IK4A 1XIMA 4K8HA 3FJ4A 4NNAA 3AMGA 4X3ZA 1NOWA 4GK8A 4K39A 5FCZA 2Y7DA 3AO0A 3AAMA 5A69A 3GNPA 4QJ3B 4X22A 3NS1B 1HNYA 4LYKA 4MWAA 3AYVA 1DJIA 4W86A 3HQOA 5FSEC 4TQTA 2V5LA 2PLKA 3N9KA 3L5AA 4Z42C 4EQXA 5IBXA 1AH3A 3WLNA 1BWKA 1JNEA 3W02A 3VGDA 1IT7A 1QBBA 2CWXA 4GC3A 4MUZA 1IEXA 1PUDA 1XYMA 2XH2A 2QCLA 3EXTA 5FEXA 1T6MA 2BVWA 3W3OA 1XIGA 2Z2UA 2RAGA 4PUEA 3UA4A 1ZXIC 5D2WA 3O6YX 4Y9AA 2H90A 2WJEA 3ZFHA 3OIHA 1QNOA 9XIAA 4NZFA 3WH5A 1W5MA 5BXPA 4JIEA 1WDDA 2YCIX 3MHUA 2BC0A 3ABSA 2YCLB 3IS4A 2G41A 4B5SA 1FTXA 5GVJA 1W9VA 3DJGX 3FYPA 1JAKA 2VD9A 4IWWA 3HA1A 1NIUA 3URHA 4FOKA 4XD5A 3BC9A 3T2PA 1QPKA 4JOMA 2QULA 4A3RA 4GRTA 3W1QA 2QV5A 3FA4A 1XDLA 4EXAA 4K68A 2OZ3A 4LS0A 1K7FA 5DRCA 5GNZA 5JIPA 2XZ9A 3POHA 2XVPA 2TPSA 3PZOA 3TX9A 1KKOA 3CUHA 4I9MA 5I3FA 3KVJA 5HR6A 1R3WA 3WBYA 3R79A 4MNJA 3TFCA 1SJAA 3PWAA 4IIEA 4N2YA 1VF8A 2WJFA 4EXBA 1F7BA 4J3XA 4JIRA 4RE2A 3CC1A 1PXGA 3BW2A 1JDEA 3MDWA 3HFTA 2IPJA 1EHNA 4HMCA 1PO9A 1PAMA 2QR6A 3CZKA 1IWPA 3N6JA 1HO4A 3RM4A 4GGBA 1MI3A 3PNZA 2A79A 1DJWA 2YCJA 5D9MA 4QE1A 1H62A 1JOAA 1O1ZA 2I5GA 2W27A 3II1A 2PDPA 4J4KA 1D2KA 3RNDA 3Q94A 5FF2A 3B40A 3ABRA 2RDXA 5AN7A 1V0NA 3DERA 2GVJA 4LBRA 1XISA 4P8WA 3AS1A 4EPDC 1TPVA 1GG0A 3EWCA 1S39A 3S9ZA 5HUOA 1GETA 4NEVA 5C55A 1CBGA 4JX6A 1E70M 5F2MA 1G9HA 1K6WA 3KRBA 1PE1A 3WUFA 5AKQA 1GTEA 1KTNA 4JTEA 4JXCA 9XIMA 3LERA 5HMFA 3T0CA 4M7SA 3P62A 3KTCA 4A2RA 1ISZA 5CSYA 4ZO9A 2HSAA 1FHDA 3W29A 3CHFA 5DF0A 5C71A 3LGDA 3C5QA 4S1FA 3QBUA 2J24A 1J8VA 3ARVA 2VEIA 1C8QA 2RJHA 3IV8A 4PBFA 3VD4A 1FHLA 3SW6A 3UFYA 3S8HA 3BV7A 3GC4A 3IIXA 4KQNA 5D33A 2QJIA 3W9ZA 4H8NA 2PWDA 1K4HA 1F05A 1P0KA 4GQ0A 4GX9A 2YCEA 1L2UA 4Q8QA 2C6QA 1SFSA 2C15A 1C7SA 4LUSA 1NQKA 1MYRA 2QNEA 2X41A 2CBJA 4OJYA 1YPFA 3C0SA 2EQDA 4QG8A 4H4IA 1FH8A 2Y5EA 3ZT7A 3FXGA 4NAFA 4B91A 1YMYA 4OQVA 4GZ7A 4HA0A 3K8MA 1XLMA 1QOPA 3H26A 4ACZA 4CNPA 1TA3A 3M6YA 3LCXA 4ZZ9A 2OLAA 2EPOA 1BEUA 2DUXA 1XSIA 4RXGA 1D7KA 3BAXA 4TO8A 1KFJA 3QC0A 1K8YA 1I2QA 3GYCA 3C86A 3C2OA 5AOUA 4NNBA 4MB1A 3W1MA 1OCBA 4HPJA 3AU2A 5E70A 2DUZA 4G5DA 3QMRA 2YYTA 2A7RA 1IXOA 2VDGA 3GG0A 1PKMA 2W61A 4M3PA 2ZUTA 3NXFA 3TNOA 1T8QA 3SZ8A 3WJZA 2O9OA 3HTWA 1A0CA 5JMUA 2ZZ0A 1GONA 4N4PA 2VO5A 4GUIA 4E6MA 2HZGA 1SUXA 2F61A 5G1YA 1GEHA 4H4PA 5DT5A 2PDYA 3B8IA 3EWBX 4HPGA 3BUVA 3PF3A 3IACA 4JAWA 1OZQA 4D6FA 4DWSA 4TX9A 3URAA 3EDDA 1SSDA 5BRBA 5CC6A 4O15A 4PGLA 3DGRA 1XDMA 1K4GA 4JN6A 4DUVA 3NM3A 1I8JA 4AHPA 5C9ZA 5TF0A 1CXFA 1K03A 3MZ2A 2WSKA 3CUXA 5HULA 1IR2A 4PUDA 3T0AA 4A21A 5KITA 1N8FA 4FF7A 1MNSA 1VFFA 1JULA 2XN1A 3KTSA 1DP0A 3BXWA 1XC4A 4F2TA 3OZPA 1WKEA 4MB5A 4HMNA 9CGTA 1AZ2A 3UQNA 4MFDA 3TLLA 3LN3A 1IT0A 4AWUA 4CCZA 5D9PA 4N9EA 1QNQA 1UIPA 1UZ4A 3SADA 2HV5A 2X1RA 5A6BD 8XIMA 3HO8A 2WC3A 1UC5A 3BGGA 1QR7A 2D3LA 1IE7C 4B5XA 5CH9A 4ZCWA 3FYYA 1WQ5A 4P8XA 3EGJA 3GTHA 1V3LA 1U83A 2QGHA 1TSIA 4WEVX 4JNZA 1Q65A 4GVHA 1EYEA 2WPEA 3FNDA 2O0TA 3FSUA 2XM2A 1BYAA 5CAKA 4DZAA 2V63A 1X2GA 3GDMA 4YPJA 3VIKA 3NM1A 4WOZA 5IXEA 1BRLA 3TAOA 1DL3A 1XIDA 4NVTA 1E3XA 1F9CA 2P1FA 3S6TA 3CUFA 4PFHA 1TWIA 1VPQA 2YOCA 4WSJA 2CFYA 4H4TA 3RMEA 5A8MA 2ZUWA 3AMDA 1OG6A 3KBMA 2DFAA 1YTDA 5CC7A 2HBXA 4IIFA 3JUGA 4M6VA 5REQA 1GVRA 3L8KA 1RUSA 5G2WA 4DBSA 2XGZA 4RNHA 2O56A 3ZJ8A 4FNRA 4P2VA 3IIVA 4MB3A 1AL7A 2F5ZA 1EIBA 3A64A 5AC7A 1HKWA 2WV8A 1UJQA 2QHAA 4AUBA 1WA3A 3H55A 3WDPP 2BOEX 2A7NA 1S38A 3G6LA 3RLUA 3BLFA 1QPNA 3O9NA 1KQZA 5L6UA 4MJZA 3MJYA 1Q8JA 4JTIA 2H3BA 3R2GA 2X0HA 4OBRA 5HR7A 4L65A 1GKQA 4UUIA 2X42A 2R14A 4HMDA 4X61A 4DBDA 2FGBA 1TUFA 2Y7EA 4GYPC 1P4CA 2G4FA 4H01A 1VQTA 1UPPA 3B03A 1V3JA 4PMVA 1H4PA 1VFHA 1AQHA 4E2BA 3M41A 2EBNA 1IYXA 4O0ZA 3NVVB 4D1JA 1MO0A 4DLFA 4DO6A 2Q02A 4EXQA 5HUPA 1WX0A 4MLJA 1R3YA 4LS1A 4RPQA 1I0DA 3VNDA 1I1WA 2BVDA 3T2OA 1VFUA 2J8TA 1W1TA 3LB8A 3H4KA 3PTMA 1EQPA 1K9FA 1NHSA 1JR1A 3R0DA 4Q8VA 4XO7A 3EANA 3DFOA 1V0KA 4K8GA 4Q4OA 4JIPA 3AROA 1IHIA 5GQBA 3ARZA 1KV8A 1SR0A 5A5WA 4MIMA 1LORA 4KPLA 1WBHA 4OBTA 5D8WA 4Z1BA 3S47A 1GW1A 1KD0A 1VJZA 4ZO8A 3UR7A 4DY1A 2BXYA 5T9BG 1CZ1A 5C9RA 3ABXA 1RCOB 1Z42A 3NGJA 3OGVA 3PULA 1GHSA 1Q8AA 3WD4A 2NWRA 3TROA 3BOFA 3FX4A 1E4NA 4CD7A 4J9JA 3Q45A 4B4HA 5FJJA 4P7QA 4XIAA 2I14A 1FDZA 4AZIA 3NQ7A 4AYSA 1EA0A 2B0MA 3TJXA 2E9LA 2CLIA 3OLGA 3VZYA 3ZS4A 3IJQA 4WGXA 1SR9A 4O13A 1EF3A 1GOKA 4AX6A 3N29A 2Y24A 3TYDA 4PODA 3M46A 5K4ZA 4QLJA 1JPIA 1JF6A 3KZPA 3UWYA 3KS6A 4A2SA 5LIYX 5EMLA 2IPWA 1S2AA 1BLIA 3G22A 2PDIA 3CIVA 1GKRA 1KXVA 2O9PA 4LRSA 1WAUA 1SPQA 3TEVA 2DZWA 2AMXA 4PA8A 1NTHA 3PZUA 3NOYA 2HEJA 4Q8WA 4TTUA 1WZAA 2CYGA 2GR3A 3UR5A 2BY1A 3CQ0A 3R8HA 2PWGA 3BMVA 1DXEA 1UR2A 2ANUA 1FWNA 2ZX9A 2YIHA 3W1LA 1UCWA 3FOKA 3KBWA 2A7PA 3TZFA 2G0WA 3TDFA 2O4MA 4KFOA 1V77A 4Q6XA 4I90A 1VD6A 2QZRA 2WMIA 3OVQA 1QUMA 4DJFC 3CZJA 4HN4A 1LT7A 3T4WA 1PX8A 3CBWA 3H12A 4MKSA 4JTTA 1C29A 1DVJA 2I56A 4I9AA 5JUVA 1Q5MA 5BMXA 2DT2A 3DGBA 1UUQA 1KN0A 1XIJA 3NRZB 1V79A 5BWFA 2CBUA 2NSOA 1XL9A 4O1EA 4BKNA 2XFRA 4H6KA 5I3HA 1DJZA 2J6VA 2FH6A 3Q67A 1UKOA 2Z6IA 3BLEA 3WBWA 3IGUA 4ZSUA 1EEXA 1F73A 2J62A 3CL7A 3WMSA 2X7VA 3VM5A 1XR2A 2G3FA 1FWFC 4F4RA 3QMTA 2W0HA 3STCA 1FP8A 2HXTA 3I65A 3V5OA 3I6TA 5AZ0A 2ACUA 3OG3A 4HQVA 1XBXA 3TR2A 3EDEA 3ES7A 4I3GA 4F3HA 1MFVA 4D6IA 1O5QA 2OTDA 2PD5A 4RPPA 1BQCA 4H4QA 1EC9A 4IQEA 1G4PA 3RO8A 3GK0A 3OZYA 2G96A 1XWYA 2F84A 2CC0A 3AIRA 3ATZA 1G01A 1LM1A 2X99A 5AY7A 3HBLA 4H9TA 2HROA 3MVIA 1QW8A 1JZ6A 3AFBA 1AK5A 2D2JA 1JCLA 2TAAA 4YMZA 5B7ZA 1F3PA 2JKEA 3N4EA 3C4UA 3UJFA 3QJAA 3MKCA 4UB9A 1W1B1 4WK9A 5CGTA 4EX4A 5HINA 5IHSA 1XX1A 2A6LA 1XCFA 2OWWA 3M0YA 3FGCB 4AB4A 2INFA 4REQA 1HXJA 2YDQA 3VNYA 4IZGA 4A3QA 1H60A 3C0QA 1I60A 1NJJA 3DU0A 1F76A 2WMFA 3E9AA 1R2TA 4DYEA 2DY3A 3TSDA 4HNUA 2FPVA 4C1NA 3ARWA 3NZPA 4WIWA 3GTFA 3MCOA 3ZZ1A 4IJBA 4A6GA 3WYZA 1YYAA 1TPUA 3VOFA 2ZOXA 2VFHA 2PDQA 4MZ1A 3LD5A 1GKPA 3VCCA 4FO4A 4RW3A 3RCNA 4KEUA 3NCOA 1Z44A 1ZBKA 2HCVA 3WQ5A 4LVBA 4QP0A 3DFSA 3SUTA 3SB0A 2PRLA 1EJXC 2P53A 2Y63A 3UCDA 3KCOA 3QGVA 4KBXA 1CLVA 3W76A 1TV4A 1HJQA 4YNGA 1Q66A 1R2RA 1ZX9A 4KEVA 5AC4A 3BDKA 3USBA 5EY5A 3M0ZA 4C60A 4IMAA 3GZ3A 3UWWA 5FEWA 4XKMA 1K7XA 3MYOA 4NJHA 4AD1A 2WBGA 5FSDC 2F38A 1BYCA 3SJ3A 1YXCA 4XAPA 3I7RA 2GSEA 3AISA 3MQTA 4WRHA 2VGGA 3K4DA 2ZZ3A 2NVAA 3A23A 1YQZA 4C6FA 1GGOA 3OZMA 4S23A 2OT0A 5KMYA 2R1MA 2V5DA 3QY8A 5LZLA 1XYLA 2E1WA 4IPJA 4L9YA 5D9OA 1XQLA 4ZQMA 3XIMA 3W27A 3BLDA 2FJKA 2EJAA 4HT3A 5D09A 1U22A 4UTFA 3EMCA 4R27A 5E93A 3PPHA 3QYSA 4Q7BA 4H9UA 1UJPA 3ICJA 1EJTC 4K7ZA 2AQVA 1XLBA 2WM0A 4QQUA 2AGTA 2YA1A 1IXPA 3I3DA 1N2VA 2JGYA 1WKDA 1E9LA 4X0VA 2WSRA 4B5TA 1F3TA 1KLZA 1VB9A 2PTZA 1PB0A 4B16A 2AKMA 3KTXA 1D3GA 2D2HA 4B3ZA 1TJ2A 3H2CA 3TA9A 4KCVA 3BJFA 1TTJA 1XIBA 4XK2A 5HANA 3H70A 3HG2A 2FIQA 5A6KA 4ML9A 5FJUA 3CMGA 3PZVA 2XN2A 1JPDX 3U2EA 4K2SA 3CZEA 2QCNA 3WJYA 4Q6JA 3WK0A 3S2NA 2HDJA 3M47A 3C0LA 4B2DD 5HQLA 3VCNA 4LY4A 4U28A 2PTYA 4DJEA 4WQ6A 2WVVA 1RD5A 2PDNA 3DI1A 3KEHA 1DV7A 4RZ4A 4IHCA 4JQ1A 2PB1A 3FN9A 1TPH1 4UTKA 3T0BA 1BQGA 2Q3RA 3Q2DA 2WMJA 4H4VA 3PPGA 1E15A 1E4IA 2VEKA 3BLLA 2HXUA 4JYDA 3PZTA 1DIOA 1G4SA 1JPMA 3EWYA 3HRDC 2PGRA 2PCEA 3BGJA 3ES8A 4HGXA 3NSNA 2NUWA 4KWWA 4PRTA 3T8LA 1ECEA 3RFAA 1TE6A 5E9AA 3PWGA 3H4WA 3CT7A 2FMNA 2JQXA 2WYSA 5GPRA 4B90A 4IL2A 3MT1A 3CB8A 3TWBA 2A3CA 3LM7A 3U7VA 3KBNA 3KDNA 2Z6JA 1HJSA 1ZHAA 3ZQ9A 4DAFA 1DEDA 5H1WA 3DH9A 4JTKA 2OU4A 1LLZA 4L4PA 5JIWA 3PJXA 2BHYA 4R33A 3QZEA 4KFPA 4IIDA 2PU1A 4RDYA 4QLKA 1SZRA 1W31A 4IXHA 3PBGA 3LHVA 4Z2GA 3LCIA 4IXXA 1XH2A 5LKYA 1WYGA 2D0GA 1OC7A 2PBGA 3TU9A 4IGNA 1V59A 3NQMA 1DTUA 3DBNA 1SO3A 3LXCA 2VC6A 3CHVA 4YVXA 1EJWC 3QH2A 3M0LA 3R43A 4KERA 1KBJA 4ADSA 4AHQA 3VIIA 3GU2A 2FDMA 1SMAA 3V18A 3S0CA 1OK6A 3G18A 5HK4A 4JKMA 4R7WA 4PMDA 1HJXA 2BODX 4AIBA 1ADSA 2AAQA 4KH2A 5AYYA 1HKJA 4IM4A 3VNKA 1J10A 2VP8A 3WQWA 2ZRZA 4KRUA 1LOQA 3U2ZA 4F66A 4C6OA 4DEFA 1OFQA 3R25A 4LCSA 5A8QA 1J5SA 4R5EA 1JI2A 1JCNA 1TR9A 1R47A 3V4BA 2GVYA 3IJ9A 2EG8A 4RUBA 5HMDA 2X2GA 1RSCA 4AVNA 4KRTA 5HNTA 2Y8KA 2QUTA 1FCQA 5FS7A 4AQLA 4G6CA 1F3EA 3T4CA 2ESCA 5EB8A 5XINA 4QQ3A 4FALA 3NYDA 2OWCA 4H7VA 3GH5A 2W63A 3B9DA 4F9DA 3GG7A 2BC1A 4CUCA 4AZBA 1XRFA 1S1RA 5A8NA 3TYBA 3CHEA 3M0MA 4J35A 1M6JA 4E38A 1H5YA 3EKLA 5B80A 4BQ2A 3EDKA 3A7UA 1YEYA 3GTXA 1I1XA 2CXGA 3OTRA 2XVKA 3VA8A 4YCOA 3QC3A 1R6WA 5HJLA 4EACA 1SW7A 2O9TA 4DWSC 2Z1WA 4W88A 4W7VA 3I6RA 3IV3A 1UWQA 3S83A 1OFDA 3DG7A 4H2CA 3P80A 3SI9A 3UR8A 3XISA 1MEWA 1D7FA 5I0DA 1DWHM 2VL4A 3GUGA 1LQ0A 5CEWA 1AJ2A 4C5YA 1L0PA 3H4GA 4GCAA 1GVEA 3NL2A 2YBTA 1WDSA 3WQDA 2X1UA 4KCUA 1HL8A 1QHPA 1HO1A 3IJ6A 1TV7A 5D37A 3GXIA 2GR2A 3GC2A 3EA2A 2BHUA 1JEHA 3B9JB 4H9XA 3VIFA 4HTYA 2PZ0A 3LENA 1RLDA 4LT9A 5H2ZA 3GHSA 3GBEA 1X8CA 5DY2A 2FTYA 5MF5A 4F0HA 1X97A 4P61A 2XGIA 3ARSA 3UT0A 2YL8A 4I8DA 4W9TA 1QT1A 5I6SA 3SCTA 3MUZ1 3TC7A 1ZZMA 4J3VA 1QASA 4CQ9A 1E72M 2IUZA 3SCVA 4ICMA 4J3WA 3LV6A 2EJ1A 3NL6A 3OB8A 2ZC8A 1LCOA 3EZ4A 1KFWA 3WL0A 2V3AA 2X09A 2YDSA 4YTRA 4JR5A 4C6LA 5KZEA 5FAGA 3V3WA 1QWKA 5F4XA 2GOKA 2VKZG 2ZZ7A 1SZNA 1O5RA 1F4HA 2V5KA 3S1VA 2X50A 1UOZA 1XUZA 3LTYA 4GNKB 3ONBA 3BMXA 1L8PA 4XZWA 2WM1A 3MY9A 4PUJA 4DZIA 2P0IA 1EA9C 3KRUA 1OABA 2QPXA 2Z1SA 1UROA 1Y5XA 3IIOA 3LPOA 3WUBA 2QKFA 1XYBA 2J25A 2PE4A 2YCKX 4K36A 1H63A 3TKFA 1K9EA 3HJEA 4UCFA 3MPGA 1R5YA 4UC5A 1HKMA 1OFBA 3HOJA 2EKGA 1XBYA 5CG7A 2VOMA 4JHOA 4F48A 1GJWA 2OG9A 1G7UA 2J7BA 2V6AA 1CXLA 5B7YA 3QKZA 3KAOA 2GVGA 2F8QA 5D2TA 4UXDA 1DIDA 1J0KA 2ON3A 3I7SA 1HZYA 1JYVA 1DE6A 3WDQA 3MCNA 2PURA 3MP5A 2PWHA 4HHLA 3BVJA 3LNMA 3QR3A 4HYRA 4GKTA 4Q7IA 1WBJA 2YL5A 1FEAA 4US6A 3QHOA 4HZ8A 1UZ1A 2YFOA 1UD6A 3RM8A 1GWJA 1QO2A 2NPXA 3NPXA 3GDTA 3FLUA 5HPOA 3CNYA 4YTTA 1B57A 4AW7A 1US0A 1W1IE 3BAJA 2CXEA 2NX9A 1FBAA 4FXRA 5BOOA 3E96A 1OD0A 7CGTA 1PWMA 1F3XA 4UQEA 1BWLA 3L2IA 4TOQA 1ECQA 4WJEA 2FYMA 2VMFA 2J75A 5BU9A 4E2OA 2WLZA 1P43A 2PU0A 4Z1AA 2RH9A 4LBUA 5BXTA 2J27A 4MFEA 4TU1A 3MANA 3NQFA 5MHBA 2V38A 3QSRA 4LV4A 3UXLA 1R3QA 3T1GA 2H9AA 2E6FA 3SY1A 1W3IA 2FQIA 3P61A 3N18A 3BAYA 1XD1A 4MKVA 1TFVA 3UG4A 3LSBA 2ISVA 3B3DA 1XANA 1AW5A 4C65A 1VFTA 3F7JA 3LCWA 2Y7GA 1UD5A 1XC6A 3KCLA 4O1FA 2D20A 2GZXA 3U3HA 4GZEA 4PMNA 1FFUC 4ILSA 1EB3A 2CCRA 2TODA 2J88A 3GWQA 3A21A 3AYRA 3IK2A 4AWTA 1GOQA 1UUMA 2XYLA 3CU2A 3GX9A 2ZWZA 5LNVA 3VMNA 1DHPA 3K8KA 4L9XA 4WDXA 2WVTA 2CBIA 4LBSA 1XBZA 3DH7A 2EPMX 3WH6A 2XIJA 4K3ZA 1GNXA 5AHNA 3PPCA 3E0IA 1EXBA 1WV2A 4ZB2A 1KFLA 3CUIA 3SIZA 3BQ6A 1V6TA 4HZMA 4UTJA 2VFDA 1XCWA 4LUTB 4ZO7A 1LTDA 2FPTA 3FA3A 1RJQA 1NWUA 3VD5A 2QUNA 3DK4A 3CQIA 2ZZ2A 3ARPA 4NF7A 4Y2WA 1S46A 1U5JA 2Y89A 1GORA 3HMCA 2VUYA 4MLRA 3MVTA 2YB1A 5AHEA 3G24A 3C2RA 5GNYA 3S1WA 2VFIA 3QV7A 2E1DA 1ME7A 1S3HA 4H83A 1A47A 3BLPX 2PF8A 4S3JA 4WHBA 3WK2A 1UP0A 2OO0A 4DM2A 1VZWA 2F9RA 3SN4A 3NQBA 3TC6A 1NELA 5HMSA 2HS8A 4UTTC 3IVUA 4A8NA 3QQ1A 3SY5A 5CSUA 4Z2KA 1G6CA 2TMDA 3W83A 3P81A 5E0CA 4WD0A 2ZZCA 2DUAA 2YL9A 1E4LA 2XVNA 3MYPA 1KXQA 5IM51 1SJDA 3DX5A 4BF9A 4K1WA 5HNUA 1XGZA 4IGSA 4PB4A 2BY0A 4FR6A 4L9ZA 5U1OA 1FWCC 2DH2A 1OGSA 4JN8A 1MUCA 3ARYA 4GIRA 1PVNA 5ECVA 5AHMA 4FHAA 1NU5A 3HGOA 3T55A 7TIMA 1VCGA 2ZUVA 4MGGA 4B92A 4UR8A 1B90A 1XH0A 2ZZ4A 1SW3A 4GQRA 3HG4A 3T6CA 1JCJA 4O11A 1LOSA 4ASTA 4HNVA 4CEXC 2PWUA 1RM6B 1V6YA 3KWXA 3H2AA 2VEFA 1A5OC 4D8ZA 2VELA 1HVQA 2JF6A 1KBKA 4PEEA 4F9JA 3H21A 4F0RA 2Z25A 2OMAA 1CGUA 2RDTA 1P0DA 3DK8A 4J5NA 2CIPA 3SRDA 1M65A 5JCKA 4DF1A 4WX2A 3T2QA 3F4VA 3OOQA 6REQA 3DKLA 1YDYA 3PTKA 1DWJM 3DHDA 4RKAA 4WGHA 2WC4A 3RPDA 3S46A 3VIPA 3WO8A 4OTKA 1FCBA 3GBDA 1W1YA 1ONWA 2XDFA 1KRAC 2BG5A 2CLLA 1P6BA 5GJNA 2EPHA 4OECA 2DSVA 5EPDA 4BS0A 4XAYA 2D73A 1HUVA 2FTWA 3BSMA 1UA7A 2E5CA 1TV2A 3CEPA 1FWHC 3A3HA 3FDGA 2YLAA 2WQDA 4RV3A 4FAMA 1WYIA 3QTPA 3EPMA 4DYJA 4S3CA 5KTLA 2OZ8A 4HSOA 1XQKA 4S3EA 3CV6A 3WELA 3QFAA 3AC0A 3WG6A 3G5EA 3NQVA 3JS3A 3VMPA 3TCSA 4QEEA 1MQRA 5I09A 1UIOA 2XM1A 1JCXA 3ZXWA 1NF0A 2DZXA 4G7FA 1GQKA 4GFSA 1OC5A 5RUBA 4GHRA 1NHPA 1HL2A 1WXZA 5LNRA 5LHFA 1SZEA 4LEQA 2CNCA 3FCPA 3TLQA 3XINA 3ZVHA 1YX1A 2VYOA 4GZJA 3Q37A 2YYUA 4ZA0A 2YCLA 4C7DA 3R13A 4PRRA 3HPXA 4CD6A 2XG9A 5J04A 3WNOA 4UWMA 2WLYA 3L9CA 4H4RA 4EK7A 5HMEA 3S6OA 1QOXA 3WMLA 1ZTVA 2XWEA 3AJXA 3W26A 5F2LA 1W9UA 4YU1A 1V3HA 3LSCA 4PMXA 3GNOA 1DQUA 2Z00A 4S2BA 4IQLA 3W24A 1OHLA 3TH6A 4NI8A 5D04C 3WQ8A 1XV8A 3TN3A 1EGVA 1VGAA 3MW7A 3VGHA 5FA5A 1JD7A 3IGXA 1MW3A 3G1AA 4CQCA 4LIIA 4DELA 2VVSA 3O0FA 1SO5A 3B97A 2J6XA 2ZXQA 3IRSA 2F2HA 2HK0A 4XV0A 3W7LA 2IQTA 2GLKA 3A24A 5F2GA 1A5CA 7XIMA 2OFJA 4EVZA 4DBWA 2E5BA 3WLMA 3STEA 3VIJA 2FGLA 5CZKA 1BVWA 1IV8A 3DI0A 4US5A 1DJQA 3PTDA 4GZIA 3T08A 1KGWA 1ICPA 3NSXA 3DECA 3QR0A 1RVGA 4DM1A 1SZGA 4IICA 3QKEA 8CGTA 1VPYA 1TRIA 4PR4A 2EPLX 2ZTKA 2EEXA 5FAJA 1UP2A 2X0SA 4Q8NA 2QCDB 1CLXA 1TQJA 4L4OA 4ZEPA 2OWXA 4FNTA 3TSMA 2VURA 1FKXA 1KCLA 3NQGA 2DZBA 4I7VA 3GG1A 2ALDA 2ABBA 2ZIDA 3B9AA 3CB3A 3L0GA 4NI3A 1A4MA 1BXCA 4HU0A 3WLKX 2QVHA 1STZA 1TX0A 4IMCA 3S9YA 2EGZA 2OKOA 4KW2A 2VDHA 1VCVA 1AA1B 1EJVC 1UBPC 4EAYA 1ZY8A 4HBKA 2DQXA 3S42A 2WP6A 4HZ7A 1Q4NX 1H7OA 5CC3A 3RX2A 2C3DA 2RUSA 4LF1A 7TAAA 1AH4A 1FH9A 4I7UA 2BBFA 1XDJA 4JTJA 5J5RA 3GXNA 4UNKA 2WAGA 4DLMA 4YTQA 2BOFX 3CH9A 3L5LA 1CNVA 3ERPA 3G2GA 3WFAA 1TTIA 2OEJA 2X1SA 2Z2BA 3UF9A 4NJGA 3CWNA 1GOXA 5C9WA 2XPKA 1P7TB 4EKJA 2C13A 3PUOA 1JZ5A 1VKFA 1M7JA 1EOKA 3DYPA 3SBFA 3B9EA 4YIWA 4PCTA 4H9VA 5T26A 2HMCA 5I07A 4KIRA 2OT1A 2B81A 3W2JA 2W9MA 2X30A 4PH6A 2Q6ZA 1PKLA 4ZQOA 4XVDA 1QXLA 1XYFA 4WF7A 1MUMA 3BE7A 1E6QM 4AYGA 4E2DA 5F1UA 2CZ5A 3HF3A 1QRQA 4ZXLA 1ZAIA 2RHGA 3GDRA 1A5NC 1H1NA 2VHLA 2PEVA 1XH1A 4O1DA 3ITTA 3RR1A 1YBQB 4JQ4A 4DVOA 1J6OA 4LS2A 4EWJA 2RGMA 2DZSA 2A1YA 4Y8FA 5MKGB 2BXVA 2E9BA 5JH2A 1W3LA 3HGSA 2WNWA 2I17A 4GH1A 4MDPA 1W3HA 2DT3A 4E2VA 4Q8UA 5AB3A 3T78A 4Q8TA 1ISXA 1LWIA 2E0PA 4E5TA 4P8VA