3R10A

Crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : mg complex
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
362
structure length
362
Chain Sequence
b'VSKIIDIKTSIIKIPLKRTFITAVRSTNHIDSLAVELTLDNGVKGYGVAPATTAITGDTLQGMQYIIREIFAPVILGSDLSDYKQTLELAFKKVMFNSAAKMAIDLAYHDLLAKEQDISVAKLLGAKANSIVTDVSISCGNVAETIQNIQNGVEANFTAIKVKTGADFNRDIQLLKALDNEFSKNIKFRFDANQGWNLAQTKQFIEEINKYSLNVEIIEQPVKYYDIKAMAEITKFSNIPVVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMESPAGILATASFALAEDITVADLDPLDWVAKDLYSDYITFNEPNIILKDNLKGFGFNLAENLYF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enzyme of enolase superfamily
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Francisella philomiragia subsp. philomiragia
molecule tags Lyase
total genus 118
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3r10A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3r10A01
3DESA 1W6TA 1KD0A 3DGBA 4IL2A 1ONEA 3VCNA 2PSNA 3P3BA 4GGBA 2P88A 2OLAA 2HNEA 4DX3A 3BOXA 1FHVA 4K2SA 3NZGA 4J3ZA 3H7VA 3ES8A 3FYYA 2PMQA 3UJFA 3T8QA 1SJCA 4DYEA 1MUCA 3PFRA 3PK7A 3I6EA 1ECQA 7ENLA 1MRAA 2P3ZA 3IK4A 3PWGA 1E9IA 3ZVHB 3RGTA 2PP1A 3TJ4A 2P0IA 1XPYA 4K1WA 4E5TA 4ZA0A 3TW9A 2AL2A 4G8TA 1MDRA 3UJEA 3N6JA 3R10A 1IYXA 3T4WA 3UXLA 1P43A 2OG9A 4GFIA 3VCCA 5FJPA 3NFUA 2PTWA 3P93A 1TE6A 2ONEA 5FJUA 1SJBA 3H12A 4IP4A 2QVHA 3R0KA 2GGEA 2OQYA 5FJTA 3ENLA 5FJRA 2AKMA 2MNRA 2GSHA 3ZLGA 3DIPA 2PGEA 3THUA 2HXTA 4ZCWA 3FV9A 5J04A 4GIRA 3VFCA 2XGZA 3MZNA 4KT2A 3TJIA 2POZA 2XSXA 3CB3A 4JN8A 4HNCA 2MUCA 3OZYA 2OQHA 3VC6A 3BSMA 1F9CA 1NELA 1R0MA 3S5SA 3MSYA 3NXLA 4GYPC 2ZADA 3B97A 1NU5A 2FKPA 4H2HA 4E4FA 4FI4A 4HYRA 3DDMA 3GD6A 3UCCA 1PDYA 3SSZA 1EBHA 3H8AA 4FP1A 1JPDX 3CXOA 3GY1A 2CHRA 3RO6A 4DXKA 1XS2A 3I6TA 3SN0A 4KWSA 1L8PA 2QJNA 4X2PA 2OZ3A 4GISA 4IP5A 1P48A 2OFJA 3Q45A 2XH7A 3TWBA 3U9IA 3D47A 2FYMA 2PP0A 3RRAA 3N4FA 4H83A 2PP3A 1KCZA 2PA6A 3MUCA 3SJNA 4YWSA 3V3WA 3R25A 3FJ4A 3HPFA 2QJJA 2OKTA 3OPSA 4HNLA 1RVKA 3CT2A 4ROPA 3UJSA 4DHGA 2PTYA 3V4BA 4HCHA 2PTXA 3KUMA 3ZVIA 1JCTA 3SBFA 4HCLA 4Z17A 3N4EA 3ES7A 3GC2A 4H19A 1BQGA 3SN4A 3JZUA 2PU0A 3Q4DA 3DG6A 2AL1A 3FCPA 2PTZA 3CK5A 3QLDA 3DEQA 4E4UA 2NQLA 4KPLA 3TWAA 3DERA 4MMWA 3ZVHA 2I5QA 2QJMA 1EC9A 4HCDA 4IZGA 4E6MA 2HXUA 3OTRA 3VC5A 2O56A 2GDQA 3D46A 4EWJA 3RITA 3MQTA 3SQSA 1MNSA 2PCEA 3SN1A 3QTPA 3MY9A 3JW7A 4M6UA 1OEPA 3CAWA 1WUFA 4GMEA 2AKZA 1BKHA 2GGGA 4MGGA 1JDFA 1TKKA 2OPJA 3DG3A 3R1ZA 3QPEA 3GO2A 1FHUA 5BOEA 2QDEA 4Z1YA 3FVDA 4DWDA 2QQ6A 5FJOA 2GL5A 4M0XA 4HPNA 1EC7A 3DFYA 4DN1A 2QDDA 2PS2A 3FXGA 3TCSA 1DTNA 6ENLA 2OO6A 2AL2B 2DW7A 3IJIA 3CYJA 2XH2A 2OX4A 4JN7A 1WUEA 3T9PA 1ELSA 2OZTA 2HZGA 3T6CA 3ZLHA 3V5CA 5IDZA 3UGVA 2PU1A 2DW6A 3OZMA 4F4RA 1MDLA 4GGHA 3DFHA 1TZZA 1KKOA 2PPGA 2ZC8A 3PWIA 2GGHA 1KKRA 3ZLFA 4KEMA 1R6WA 3VDGA 4IT1A 2OVLA 3DG7A 4K8GA 3UCDA 3P0WA 3MWCA 3IJQA 3UJRA 3I4KA 3R11A 1SJAA 2OZ8A 5BOFA 4HN8A 2XH0A 3TQPA 3IJLA 3S47A 4J1OA 2PODA 3NO1A 3R0UA 2RDXA 4GYPA 3VA8A 3RCYA 3EKGA 4IL0A 3UXKA 4G7FA 1JPMA 3OW1A 2XH4A 1SJDA 3EEZA 4A6GA 2GGIA 3UJ2A 4JHMA 2P8CA 3MKCA 3OP2A 1PDZA 3JVAA 3N6HA 4A35A 3RR1A 4ENLA 3STPA 5ENLA 5EU9A 4E8GA 1YEYA 2PGWA 3K1GA 3TOYA 4MKSA 3H70A 3QKEA 1EBGA 3QN3A 4IHCA 3V5FA 3TTEA 3U4FA 3BJSA 2P8BA 1EC8A 2GGJA 4H1ZA 2QGYA 4A3RA
chains in the Genus database with same CATH superfamily
3EOEA 3TNBA 5I3DA 4MY1A 4XAYA 1J96A 2YXOA 1G6CA 1VD6A 3A5VA 2WZHA 3WH5A 3P3BA 1OCNA 5ABTA 1UCWA 1GVOA 1RPKA 3C0LA 3NQ8A 4ASTA 3FIGA 4EMWA 3EWCA 1XQLA 1CGVA 4KERA 4DWSD 1UOZA 3PK7A 4PTDA 4OTKA 4EKJA 4UZSA 1F76A 4RDWA 3WNPA 1NHQA 2IUZA 2V30A 3VXGA 3UWUA 4UMCA 3H54A 3AFBA 4H4RA 3U5YA 1VEOA 1TQXA 4O50A 5A6TC 3QZ6A 4EPEC 1EQCA 1Q6EA 3UJEA 3BWWA 3LN3A 5JRBA 1XBVA 4GFIA 1N8IA 2B7NA 1BTCA 4H4PA 1L8NA 4JKKA 4YTUA 3LADA 1J0JA 5FJUA 3M0MA 4XISA 1AJZA 1SFJA 1TR1A 2Y24A 4IJRA 3M0YA 4C6KA 4GR1A 4L1XA 1CT5A 1VCFA 1E0VA 1HJQA 4Q4OA 3ZYZA 2EGZA 4M6QA 3FV9A 1J5TA 2D23A 1RCOB 1Q8JA 4B91A 4GPNA 4W88A 4CU8A 1FCUA 2ZUTA 3F1QA 1B30A 4BQ3A 4HYWA 1NIUA 4KCVA 4UXDA 3GHTA 2WV8A 3DGHA 3RXZA 6TAAA 4JIEA 4YMZA 4B5XA 3G1XA 3DI1A 3G18A 3T7VA 3WLIA 1OFQA 2G41A 3LB8A 5C8BB 4XIAA 5CLWA 3AYRA 5A95A 4H41A 4LUTA 1ZY8A 5A2BA 3QR1A 3C2YA 4NAFA 2BGNE 3SCUA 3BLIA 3AZRA 4LALA 4DEFA 5EPDA 4I8DA 2F61A 3KWXA 4FLSA 4OECA 2YCLB 1FTXA 5T9BG 1Y5VA 3PBGA 3QFEA 3F5KA 2Z4GA 3STFA 5ABHA 2DZSA 4JCMA 1EJUC 1TIMA 3UXIA 3VNIA 4V15A 1WZKA 1KFKA 1C7TA 4EM4A 3EA3A 3DFOA 4JY9A 1I1XA 4LY4A 2RKXA 4GQBA 1QOXA 3FJ4A 1XI3A 4IMEA 4TOQA 1ZENA 5LNRA 2WYSA 1A5MC 2W9MA 1Q2SA 4Z08A 1C93A 1XR2A 5CEWA 3VK5A 4Z0JA 1GRAA 1HO4A 4HA1A 4OOZA 1Z69A 2X0YA 4OOUA 4Y8EA 3VNLA 4X22A 5DXXA 3PBVA 3EMCA 5CXPA 1WBJA 2Z28A 2RJHA 3TWAA 1KRMA 3HPZA 1U2YA 1F3EA 5I2UA 3OLIA 4DBWA 3GDLA 1DP0A 1EC9A 3S2MA 4GFSA 3T0TA 2O56A 4FF7A 1O66A 3EB3A 4ACZA 1LVLA 1ECEA 2PCEA 1UP0A 2HS6A 3SR6B 1JGMA 1RUSA 4N9BA 3O2LA 1FY6A 1H2IA 1L6WA 3EGJA 2YCEA 3N18A 2V69A 1VJZA 3VAVA 1E1EA 2QULA 3CQIA 2GGGA 3QC0A 4MB4A 4DJEA 1XLCA 1NFBA 3PUGA 1EPXA 4N2YA 1UH3A 3DG3A 2GPTA 3R1ZA 3AJ7A 1E9YB 5CCZA 3QPEA 2DH2A 3GO2A 2BV9A 1HVXA 5GPRA 1J79A 1C8YA 1D3HA 1B54A 2INFA 1Q7QA 4OGZA 5DT5A 3RFAA 1PX3A 2C3ZA 4XD5A 1AH3A 3R13A 3C8FA 1XGEA 1AQ0A 3FXGA 3OLGA 3RX4A 5KVIA 1VFOA 3W85A 1VIWA 4RE4A 1U1JA 1KM0A 2OX4A 3SM0A 1VENA 1BWLA 4W84A 3RUBL 3KL0A 3AU2A 3FOKA 2BY2A 1GEUA 4MNLA 5AFDA 4NYUA 4IQDA 4J9JA 4HNTA 3ARWA 3IVTA 2XGBA 2DEPA 3IGUA 2FZDA 3PAOA 1B3XA 3PWIA 3VOFA 3P67A 4YVVA 4FIQA 4AW7A 4Z2GA 3HN3A 3NSXA 3STEA 2CW6A 1SQ7A 5IOBA 5D2VA 1CENA 4JQ2A 2WQPA 2WWCA 3KS6A 1J5SA 2WP6A 2H6RA 3NJ3A 3KZPA 1Z48A 3B0PA 3TTQA 3P0WA 4C65A 2QJGA 1GVEA 3OVGA 1XGDA 1IXNA 3THCA 1M5WA 3W70A 2BXZA 2FTPA 2F6UA 2CXEA 2OT0A 2RFGA 2PZ0A 3TDFA 3M6YA 4JTHA 4H4VA 1C8VA 4AF0A 4P7RA 3HO8A 1CBGA 2DZBA 4BI7A 1PHWA 3G1HA 4TVUA 2I56A 3UBPC 3W7CA 4LUTB 1OCBA 4OHQA 4W85A 4NAFB 4UFLA 3QYQA 1V4YA 3S6OA 4KESA 1A0DA 3M44A 2Y5EA 3N6HA 2G3NA 3BGAA 4UR7A 4JTUA 1GVRA 2PWGA 1KTCA 3W27A 3WBAA 2E1DA 4CEUC 3RJXA 4EQWA 1VFFA 4S2BA 4JTDA 1ISZA 1ONRA 3MUAA 1EDGA 2E0PA 2J27A 2JIWA 4FR6A 3ECQA 4IJCA 4WQ6A 2PDKA 5AOUA 3CASA 4BEQA 1H51A 3A22A 5CPSA 4MB5A 4Q8OA 2DIKA 1W9DM 4PB3A 1JXKA 1ZCOA 4A3RA 3M5ZA 1KFCA 4K8EA 2J47A 3W07A 3VVGA 4A3UA 4H8UA 1TV3A 3OVQA 3DGBA 2ACQA 3TR2A 4JNMA 4PYSA 5DFAA 4LC8A 3W2LA 2XZ9A 2HNEA 1VFLA 4JOMA 4F9JA 3H7VA 1AJ2A 1T8XA 4JKMA 2QNEA 4IGNA 3V7PA 3I3EA 1AW1A 3DHUA 3IUDA 3PFRA 2VCBA 3EYPA 3H4GA 1V6YA 4FNTA 1SO3A 5I3FA 4X9SA 1UQYA 2RJGA 1GWJA 3N1AA 2Z00A 4AY1A 2RHGA 1I2OA 1AODA 3G1RA 4OKDA 4AH7A 3W75A 4Y90A 2DSWA 1T7LA 4HNNA 1EUAA 4M1RA 3T07A 9XIAA 2BXYA 3POHA 1IYXA 2CZVA 1F7BA 1S3HA 4C60A 1STZA 4WX2A 3AZTA 3HFTA 3NFUA 4EMIA 4S3FA 1KM3A 4I9JA 1K7XA 2FDMA 4F0KA 3PTKA 4IP4A 3TMQA 1MRQA 3E0VA 3M0XA 3ZLGA 2Q8ZA 3VTRA 3I6RA 5H6HA 1KXVA 2ZC1A 1PTAA 1PKYA 2I17A 1J10A 3VFCA 3UNDA 2PE4A 1OCQA 1EHNA 1QNPA 4C1KA 4CN1A 4QQUA 4YLWA 3PSWA 3A21A 1JPKA 2E6YA 5GJNA 4HPGA 3BAYA 4WZHA 1PIFA 2V5BA 3R5EA 4HZMA 3VU2A 1UP2A 3W6MA 3TYAA 2ZXBA 4TMBA 2O4MA 2WC7A 1HL2A 3W26A 1J01A 3HW2A 1M7XA 5HPOA 3SO7A 3EWBX 1RK6A 4N0RA 3E1F1 4D2JA 4WKFA 4GIEA 3EANA 3CBWA 4DM1A 3GZAA 3BJFA 4LA1A 1PBGA 4IIHA 3CXOA 2J9ZA 3EA2A 5C5YA 1KTNA 2QF7A 4POCA 2D1ZA 1SMDA 1TPUA 5JVLA 4UR8A 3CUIA 1WV2A 2I16A 2B7QA 7TIMA 3WQ4A 1JDAA 5DF0A 1X98A 3A3HA 1ZX9A 5MHBA 3KOZA 2E3ZA 4J2PA 1F6PA 1UWSA 1ITCA 4GISA 4TTUA 3CHFA 2ALRA 4BF7A 3REQB 4BWLC 3SRDA 3D47A 5D9OA 3I10A 2PC4A 2ZIDA 4H83A 3RJYA 1KN0A 2YYUA 2XIMA 5HMFA 1UZDA 4JXCA 4AF0B 3Q2DA 3WUFA 4W8AA 3V3WA 4L6OA 3QV7A 1YBQA 5IRPA 2J25A 3NL5A 3QMSA 3PJXA 1IEQA 2OB3A 4DHGA 4QJ5B 1PAMA 1HGYA 2PTYA 2QJIA 3NL3A 1XLEA 5G2HA 4ERAA 5A6SA 2NV1A 3APGA 5CSRA 3GSMA 2FHCA 1E1CA 3F03K 3W71A 2BHZA 1UKOA 3E3HA 3FXYA 1FA2A 2CBJA 1HO1A 1V3KA 4XKYA 3TONA 1GOOA 4EOUA 3AS2A 3MS8A 3T2QA 3CZKA 4E6MA 3AWOA 4UZUA 3LMYA 3D46A 4GI9A 3UWVA 3SW6A 4X63A 4H8VA 4I9AA 1DJWA 1XLMA 1UYQA 2YL8A 3GH5A 5EB8A 3JW7A 2VVNA 3VCRA 3UZJA 1K02A 2QAPA 3W83A 1JRBA 3AYVA 3MDUA 3IJ7A 1R3YA 2YGYA 3IK2A 3G0XA 4P7OA 1GK8A 3L4YA 3AIUA 4FX9A 4MGGA 3ITTA 1UD5A 1WZAA 2ZUUA 3C2EA 1ZQ5A 3RNMA 2HPIA 4XAGA 3DK8A 2J8GA 4OFCA 3PN8A 3FVDA 3SDOA 2FZMA 4GY1A 1RQBA 1OM0A 3IJDA 2QS8A 2PLKA 4Z2JA 1XBYA 3BZGA 2NXIA 3A4WA 1D7KA 4NJKA 8A3HA 1A47A 1BEUA 2XH2A 4A4AA 5FS9A 6ALDA 3AHTA 3SGUA 5BXRA 3EWZA 3FJ6A 1WP6A 1E9ZB 3VNYA 4QBXA 2X1RA 4S3CA 4RZ6A 3THAA 5IDZA 1XKJA 4DZIA 3KBNA 1OGBA 2VUNA 1EJSC 4WKHA 4JY8A 3LHZA 4UTJA 5IDIA 4GH3A 4N9CA 1G4EA 2YL5A 1KM4A 1EX5A 2V6OA 3VIHA 1EKOA 1SYTA 1S2WA 1MO0A 3BK0A 3BSHA 5DRIA 2G3JA 1PJ9A 3FKRA 4NJHA 4S1FA 1AMYA 1BVZA 4BZYA 3VOHA 1H6VA 1DWGM 1A4MA 4BI5A 4EANA 4N4PA 4GNJA 2YCIX 1W9PA 4DRSA 4H4XA 4R85A 1XG4A 1U22A 5BOFA 3QM3A 3PULA 1E5JA 2ZUMA 2J7BA 4Z1AA 3NO1A 3SCPA 3LXBA 1XD1A 4HHPA 1O5RA 4A22A 4XZHA 3G0UA 1UR0A 4B15A 1V08A 1K1DA 4ICNA 2WJEA 4UTIA 1A5KC 1XIIA 4JKLA 3P7YA 1J0ZA 1TZ7A 3UJ2A 3POCA 2P8CA 1AQFA 8XIAA 2GUBA 3PPCA 3SRKA 1JF5A 4CD4A 1RV8A 1KXHA 5A3HA 1NM9A 2PF8A 3BCJA 3OGSA 4BA0A 1MXDA 2I9EA 5ENLA 1VAHA 1PYFA 3M7SA 5LGXA 2OTDA 1QFEA 4DO4A 1UB3A 3B9NA 4UQCA 2ZRVA 4ZXOA 1PTDA 3U4FA 5FS6A 3AIBA 1JGIA 2P8BA 1PWLA 4C6MA 5K9CA 1ZMCA 1H3GA 1YBQB 5M5DA 3UG3A 4BWLA 3PZ9A 5HA7A 3KHDA 2XIBA 5FEXA 1GREA 4QQ3A 5AZ1A 2JKPA 3VKCA 5FJJA 1FHVA 5EY5A 1I6NA 4J3ZA 1E1CB 3FAWA 5IFTA 3FG2P 1GHRA 1JZ6A 1I60A 3E2VA 4HSHA 1SSGA 2DZUA 4GC3A 3OQEA 1TJ2A 3ZSSA 4XKYB 1LJYA 1SW3A 4K37A 1AQHA 1L2QA 3MP4A 4K38A 3VDCA 1X7FA 3SCNA 4O1CA 5LIWX 1OY0A 3AAMA 3IJ6A 1OFOA 2G4FA 2C14A 2TPSA 3LHVA 4Q4KA 3PJWA 3S9YA 2AL2A 4LCQA 3XINA 5CSSA 3R10A 2FVLA 3EX1A 4NU7A 1HW6A 4DPPA 2F9RA 2ZVRA 2JIEA 4UTWA 4MFDA 4JL1A 4AYGA 1JPHA 3RPTA 2WOWA 3NDOA 4RCXA 1KA9F 3QY7A 1D8WA 2YYTA 2WW5A 5XINA 2YA0A 3U57A 4R27A 3VYLA 2FPTA 1AVAA 2GR1A 3PM6A 3UVAA 2YL9A 4J3TA 3OZYA 1YPXA 2QUTA 2XINA 4AZIA 3XIMA 2PDWA 2PWHA 2VELA 3NG3A 3R43A 3UA4A 1F3PA 1PCKA 4O0ZA 2DJXA 4UQBA 3NRZB 4F0LA 1W5PA 5I07A 2GDUA 2FB2A 5DRCA 4JX5A 3M0ZA 1KRAC 3WLLA 1Q66A 2HROA 3UCCA 1BXCA 3AS3A 3PZNA 1QTWA 3ZQ9A 1O1HA 3MBFA 1EBHA 4IIFA 1K9FA 1F07A 4N7QA 3N2OA 4PUJA 3EB2A 3PJTA 1DXEA 2ZUSA 2J79A 4HK7A 4BQ2A 4LXFA 1HJUA 2HJPA 4LUYA 1F61A 3PANA 4PODA 4IIGA 3K1DA 3H7UA 1IV8A 2ZXAA 3DCPA 4B2DD 2QF8A 1XLDA 4W5ZA 4DVOA 3DFTA 1WAWA 2FHFA 3S5OA 2Q09A 2J8FA 2XH7A 4MG4A 1DKWA 4QE4A 4EXQA 2EPNA 3O06A 1MNZA 5K4XA 2PA6A 1TVLA 1PHQA 4DNAA 2ZZ7A 1GYLA 2WM1A 4H3DA 1NP0A 4YWSA 2YX0A 3KAOA 4M24A 3UR8A 4ATLA 3W7OA 4N9DA 1PSCA 5DCDA 3UJSA 1TYPA 3KUMA 2VEMA 2PB1A 5ECUA 3FYPA 4N6FA 3SN4A 1IXOA 2WZEA 3GKFA 5BCAA 1FH8A 1KQYA 1PPIA 3NVVB 1PKMA 4NNCA 1GRHA 2BY0A 1CI1A 1RA5A 5L6UA 3CLMA 3RHGA 2HBVA 2HE5A 3VNJA 2VC7A 3AHYA 4XX6A 4AWUA 3AXXA 2A3BA 3RCMA 1I2PA 2G96A 2QJMA 5LHFA 2G95A 5CZJA 4LYPA 3PUOA 2XJ7A 2XU2A 4JIPA 1WDPA 1K6WA 4I7VA 3EAUA 3ALFA 4Q3MA 3WEZA 4YCOA 1QO5A 1TX2A 1DIDA 3WQCA 1WUFA 1FDJA 5HANA 2CKSA 4U5IA 3DHFA 4Q4SA 3AIEA 2VD9A 1XKYA 1C92A 2NT1A 1JDDA 4NZ3A 1XBXA 3MBDA 1GESA 3O0HA 1XIJA 2J7DA 1E4LA 2E6AA 1O4UA 2KX9A 1AL7A 2YCKX 4W9TA 1WXZA 3VOIA 2Z27A 1RD5A 1WCGA 4D6CA 4ZR8A 5C9WA 1NF7A 4CVUA 1YXDA 3CQKA 1V51A 4V1YA 1S5WA 4C6NA 1PV8A 5A6LA 6XIAA 2NX9A 4MIMA 3W02A 3QHNA 2AL2B 3EF6A 1BVWA 3SCOA 3E49A 1UZ4A 2BVWA 3PTMA 3RMJA 1P5BA 3EKZA 3S2NA 1O6IA 4GUJA 1XUUA 2ICSA 4XIMA 1DXIA 3L12A 1P4CA 3AHXA 3NM1A 1IEVA 3WENA 2D22A 4IUOA 1GGOA 2BNJA 4ZQRA 2OWXA 4HKPA 4UTLA 1RXOB 2ZC8A 3BICA 4NL1A 2OEMA 2A3LA 2J4GA 3BOLA 2C6QA 2WSQA 4JYFA 4ZEPA 4JFVA 3VGHA 5A2AA 3PS7A 4ZSUA 4AUBA 3U7VA 3TLQA 1BWCA 4IT1A 3UU0A 2KAUC 3SY8A 4EF9A 3DG7A 5AN7A 4FX7A 4MY8A 1EO5A 1UA3A 1S2AA 3CYVA 5CJ5A 2WMFA 3KBMA 3HGOA 3PBWA 5M2FX 3R6IA 3MTWA 2Q6ZA 1EJVC 1GZ1A 3W87A 1C7SA 3L0NA 4LH8A 2D3LA 4PCSA 3TQPA 2DSKA 2VO5A 3VX0A 4RXFA 3L4TA 1R46A 1EP1A 1DHKA 1QPQA 3RCYA 1XDLA 3MHGA 2HQMA 4PCTA 1VP5A 3H24A 2P3EA 1EJXC 1LOLA 2X7WA 3ATZA 2W0UA 4ZQMA 2FMNA 2PGFA 2XH4A 3CTTA 4OV4A 1RVGA 3L23A 1XWYA 4C6FA 3V0UA 2DV0A 3E6EA 1U5JA 1JVNA 3VOCA 1NDWA 3MKCA 1TIWA 3WLKX 4DF2A 2A7NA 4U2ZA 3KE0A 3DJJA 4J3WA 4FSAA 5KSWA 2AAMA 3WK2A 1CXHA 1KLYA 3PY2A 1GJPA 3C52A 3JU2A 4LS1A 3KM8A 4IMAA 1DL3A 1VEMA 2C1GA 1LYXA 4E8GA 1JAKA 5C9ZA 3EXTA 3WBXA 4KF1A 4RPQA 5G4HC 3CEPA 2BVYA 2HVNA 1ZBKA 4JQ1A 1HJWA 3AUOA 1EB3A 4LGXA 2Q3RA 3DESA 4QEEA 1VYRA 3UGRA 2QAEA 1GVQA 1R2TA 1TZ9A 1H5YA 1WOBA 2CLKA 2GWGA 3QLLA 2VD8A 3KLLA 2GJLA 2ON3A 3Q37A 4KEVA 4GJJA 4G6CA 3AHZA 2GQ9A 3DN5A 5I09A 1BYDA 4DO6A 4F40A 4S3AA 1UWUA 2P3ZA 1RSCA 2CHNA 3V1HA 1E0XA 1EP3A 2PP1A 2WZIA 1L9WA 2OSYA 1H4PA 4LVDA 3TW9A 1W1ZA 3PBYA 5HR6A 5G2WA 2VCCA 4PMRA 2UZ9A 1NH6A 2VI0A 3WD4A 3FJLA 4PMJA 5TNVA 4TX8A 1NFPA 1R38A 3VZXA 2QCDA 2XVLA 4DF1A 1ME8A 3A13A 5E0CA 3SJ3A 1UH4A 1JRPA 1GYMA 2BB0A 1EEXA 2QXWA 2R1NA 5HNNA 1XX1A 3AICA 1LM1A 3AO0A 2Y7FA 3H2OA 2HXTA 3QBUA 4FNUA 5K9XA 1Q4NX 1WKYA 4YTQA 1JUEA 3B9DA 1W3JA 3B8UA 2R1PA 1QNOA 2OO0A 3ZJ7A 2E7FA 1VLWA 4Q4RA 3TC7A 1JZ8A 1AZ1A 2WLZA 1F9CA 1NELA 2Z1VA 3NO3A 4PMUA 1HQTA 1L6SA 3IAPA 2OSXA 1ZPTA 1TPEA 2V3AA 1NU5A 3L7RA 4OBRA 2NUXA 2J88A 1MUMA 3MI3A 1XLHA 3PPHA 2VGGA 3TE9A 4HMEA 1CXEA 1RK5A 4ZQNA 3DX5A 2J7EA 3O6YX 3GRSA 4WSJA 4FP1A 3F7JA 1OF6A 2CHRA 1N2VA 2BTMA 4CD6A 4S3BA 5AVNA 1NHRA 1FFQA 3VIKA 1OX4A 1JYNA 3COTA 3UP8A 3LLXA 2QMJA 1BTMA 3EDKA 5D8ZA 4H50A 4WF7A 4NJJA 2WP5A 4AY8A 2WNWA 4WJXA 1RLCL 2C3CA 1FWTA 1UZHA 3U9IA 2FYMA 3WF1A 4D8LA 3NVYB 3L5LA 4PUWA 4TX9A 4TVWA 5HINA 4IG2A 5AY7A 3GFZA 2EPLX 3GDBA 1TPWA 1SGJA 3OA5A 4R5EA 3UZWA 4HU3A 3K4DA 5CC5A 3E38A 3SBFA 3BMVA 1UUOA 1BQGA 5D32A 5KEZA 2QUVA 1E1FA 3DI0A 3JZUA 1WKDA 1Q13A 3NQBA 2NVDA 4Q6XA 3THDA 4AAJA 2PTZA 2NZLA 3GH7A 2FGZA 4Q22A 3ELFA 1MEIA 4WXZA 1WDDA 1S46A 5EMJA 3ARPA 4L6DA 3NVWB 2WJFA 3Q58A 4DAFA 5CSYA 3ZVHA 4KFPA 2ZUWA 2O4QA 2XM1A 2PRHA 3UZYA 2PURA 4UUIA 3W7GA 5FL0A 5KZMA 4GH1A 2QCCA 3MUXA 2NX1A 4MTVA 4GO8A 3NTYA 1B4EA 2I5IA 3SQPA 1I4NA 3FK4A 1PO9A 3CTLA 4PTMA 4DUXA 4P2VA 1W9VA 1L0PA 5FL1A 1JEZA 3CAWA 3W2NA 3W53A 2AKZA 3ZT7A 2BVTA 2BGSA 2DSUA 4NRRA 3B06A 4ZZ9A 3WDHA 1R3SA 3AS0A 4EF8A 2V68A 1OJTA 1YDVA 1HKIA 1QNSA 4FX6M 1H1ZA 5BOEA 3WF2A 1E40A 1WX0A 5F2IA 4MJ4A 4RZ5A 3W7PA 3HOJA 1K8YA 4IGHA 4M0XA 4XZNX 3M4HA 3B9OA 4PSRA 5HOSA 3EUB3 6ENLA 1DTNA 3CUXA 2GVEA 3LLDA 5BMXA 1I9CB 4RX0A 5E6YA 3UVIA 3RMEA 4I7UA 5CC6A 5H8UA 4APNA 3OQ8A 1JNEA 2QCDB 4S39A 4L9YA 1KCLA 1C9WA 2DW6A 2V38A 4LUJA 3DGRA 2QIWA 4PMQA 2XFYA 1EZWA 4IMCA 4XB3A 1M41A 3OYZA 1VPQA 5CGQA 1W5QA 3FS2A 4L9XA 4AVOA 1G5AA 4KEMA 3BLFA 4IX2A 3W1TA 4DJED 4KGJA 1JCYA 2CESA 1R3QA 5DMMA 1E6QM 3R11A 3DBNA 4Q8TA 2W6RA 3WQPA 4AD1A 3V5OA 4QM1A 2OODA 4GA8A 3HG2A 1JULA 4LX4A 2VR2A 2VRQA 3IJLA 1EIBA 4WSKA 4C1LA 1T3QC 1UC5A 5CKSA 2QPXA 4PH6A 1ODUA 3OW1A 4R53A 1SJDA 4ES4A 2LLEA 1UUQA 3NQFA 3E2QA 3CLWA 1VB9A 3AS1A 2Z1SA 4MAVA 4JTQA 4QIUA 3S2CA 3JUGA 3V16A 2Y5JA 1TA3A 4QJ1A 4PA8A 2IKJA 3P2VA 4M1BA 1WBHA 4AZHA 1DVJA 4U5KA 4K8HA 3VGGA 3C2FA 3ZWSA 5LXXA 3TOYA 1LPFA 2DT0A 1NQKA 1EBGA 1K70A 5CGTA 4PMVA 2NVKX 4ZL1A 2VOTA 4IG2B 1A0CA 2GGJA 2CWNA 2B0MA 2EJAA 3VILA 4K36A 2ZE3A 1QHZA 1QK0A 4IL2A 4ZO7A 1OIMA 2WNNA 5D2YA 1XL9A 1LRQA 2EJ1A 4XK2A 1MOKA 2HQAA 5AHLA 3UJFA 1PYMA 3EXSA 3T8QA 4XSMA 4QSFA 3WJZA 3KRSA 2Z0IA 3CPRA 3TJXA 1ECQA 3T05A 2X99A 4HNOA 5JH1A 3T42A 2VWTA 2W91A 5EFFA 3ZVHB 2BDQA 3GU1A 3N2TA 4B9ZA 4URIA 2X1UA 1CNVA 1MI3A 1MDRA 1V0NA 2C19A 1J6OA 4CQ8A 4NQ1A 4YCPA 2C1HA 3AM9A 5EYWA 4MSSA 2VQUA 3RF9A 1VS1A 4JTEA 1RALA 2GSJA 2NW0A 1QWGA 3R0KA 4H7CA 2F38A 2F2KA 4EMJA 3DIPA 2CZ5A 3MSDA 3TQVA 2FQIA 2PD5A 4GUIA 3OBAA 2XWEA 5J04A 3BJTA 1GPFA 1XRFA 2BOGX 3RU6A 1TTIA 4BR1A 3HBLA 2D20A 5D38A 4OE7A 2PDUA 2E77A 3URBA 1IQ8A 4RNIA 4C6PA 4YU1A 1QATA 1X2HA 5E0KA 4PB5A 1EL3A 1XINA 4K7VA 5AC4A 3B03A 3LXAA 3CB8A 2GSEA 3PPFA 2BGQA 2JGYA 2IMRA 1H5VA 2QT3A 4DZAA 3N9SA 2I1OA 4FXJA 2BLEA 2PLMA 1BZLA 4J56A 1XRSA 3NQAA 3BG9A 4IX0A 5ABEA 3E96A 2WPCA 4JQAA 1X96A 5FEWA 3LERA 3SCTA 1QOPA 3ZJ8A 3RO6A 1XSJA 4AWSA 3PSVA 2V3FA 3QZEA 3WZ0E 1K4QA 4ZODA 5XIAA 3WFLA 3UY8A 4O1FA 3S42A 1UBSA 4UFIA 1TJ1A 1XH0A 1K9DA 3Q45A 4PL2A 2E6DA 4UC5A 4HMCA 5KZ6A 4KETA 4WOQA 2F5ZA 2G8ZA 3MVIA 5LHEA 1VHCA 1IE7C 3M5VA 4I6KA 1YPIA 2VZOA 4QLLA 1RPXA 4K39A 4HHLA 3H4KA 4XO7A 4CCCA 2D0FA 2EG7A 3OYXA 1E4MM 3WF3A 1HX0A 3O63A 1F05A 4DUVA 1VH7A 3KCLA 1MQRA 3SUTA 3P81A 2O9OA 2J6XA 1Y8BA 2G97A 1UR8A 3G6MA 1F2JA 3BAIA 2PDYA 2ZRUA 1ML1A 5C0QA 4O18A 3VGBA 2JF6A 3U2ZA 1TJPA 5E9XA 4RDYA 5CH9A 4F0MA 2HXUA 5KZEA 3PBMA 4JL2A 4JHZA 4PMZA 4UQ9A 2PDFA 2Q8LA 3U2EA 1ZBCA 1FKXA 3CZGA 3CNYA 3WDPP 3I3DA 1VFMA 2NVAA 3QH2A 2D69A 1EA9C 1DE5A 2YSWA 3W1QA 1H7PA 2VMFA 3QGAC 3JZEA 2VZSA 3B8TA 2ABBA 5CZ0A 2DIEA 5HWJA 4WEVX 3QGKC 1S5NA 1LCOA 1TKKA 1JAEA 1E71M 3LM3A 2HS8A 2J74A 5MF5A 1RP9A 3WBYA 3ABOA 2H3BA 5D8WA 1ZL1A 2ZA2A 2ZZ5A 1GVSA 4AD0A 1LTDA 1XG3A 2QDDA 2PS2A 4DM2A 3M0KA 3S6TA 3G2GA 1TFVA 5E6ZA 4HOZA 1LLWA 1Y5XA 2P76A 3OODA 3KXQA 1P7TA 2O92A 3G1SA 3TZFA 4UNKA 3UR2A 1WUEA 2W63A 4JICA 2CLHA 1R7AA 4QDWA 3H53A 1UR2A 1NTHA 3WMBA 4R7JA 1OYCA 3UGVA 2HISA 8RUCA 3EMZA 1Z89A 3ISIX 4QDPA 4G1KA 3LTPA 4J3UA 4F4RA 3T4CA 2ZX8A 3DFHA 3PTDA 4X0NA 4IUGA 2VEKA 3UY7A 1VFTA 3QSRA 2WC3A 1CTNA 5I3IA 4KW2A 3O0KA 4D6DA 5C7HA 2R24A 3H2AA 1G1YA 4LBSA 4CCDA 1UQZA 3FY1A 2OVLA 1U1UA 2YJQA 3M0VA 3WH7A 3RM8A 1SO6A 1I2NA 3K8KA 2YAUA 3BLEA 1M68A 3NIYA 1O95A 3VMPA 4DAIA 5I7GA 2NT0A 1LBFA 4OZOA 4KS0A 1Z3NA 3AUJA 4F2BA 1IXQA 1H7XA 2XH0A 1GJUA 2X2GA 2GQWA 1DWAM 2E5CA 3VZYA 4XUYA 3WJWA 1FBAA 1VKFA 1LBMA 3RG6A 2PWEA 5FD0A 5K9DA 3UXKA 4MYXA 1UKSA 4L56A 1KGXA 5F4XA 1JCLA 2VURA 3IARA 2A7PA 3CWOX 3EEZA 2O9TA 1RZMA 1TREA 4Q32A 1UD2A 4QSHA 2ZE0A 2P5NA 3HRDC 3RR1A 3KZSA 1TV5A 3N29A 1RY8A 1XHGA 4HBKA 1UJPA 3HFYA 3ARXA 3V36A 1AUSL 3VZZA 4D1IA 1EGMA 4BURA 1DJIA 5T26A 1WPCA 4DZHA 1Z41A 4ORMA 2Z1BA 4YVXA 1WE5A 3E0WA 3VIGA 1LWJA 5CLTA 3PNZA 5I24A 4DBSA 1O60A 3VE9A 5IHRA 3BLLA 3NEHA 5DMLA 3SCSA 1OBAA 1J2WA 3UFYA 4GBDA 4HPXA 2E1WA 1ISWA 2YKKA 2WKLA 2FVMA 5IFPA 4DJFC 1CLXA 2XN2A 2HSAA 4I90A 3CXBA 1YLVA 4AWEA 2DFAA 4GCAA 4F2UA 1CXLA 1VBUA 1DQXA 2ACUA 2X8RA 1JZ2A 3CZ8A 7REQB 2CLOA 1WKEA 5BXSA 1NF0A 4DYKA 4J27A 1QI5A 3FFSA 3HPXA 1ONWA 3TJ4A 4O4VA 5D09A 5HJXA 1Z44A 1KBLA 2NUWA 3GTNA 1HL9A 1YMYA 4FXFA 4NF7A 3QQ0A 5AHNA 4D6JA 5AVHA 3I7RA 4DB7A 5KMYA 5J5RA 5DEZA 1UROA 4I8YA 1QDSA 4MADA 2OWCA 3EZ4A 1J8VA 5FJTA 3ENLA 4OVXA 4ZENA 1ADOA 3KP0A 3W25A 2D2JA 3WQ8A 1SPQA 3VKAA 4DBEA 1E0WA 2OX1A 3TSBA 1UG6A 4ZCWA 1P0NA 5LA0A 3UPBA 2CWXA 1FWNA 1IT0A 3VNKA 3L4ZA 2QCNA 1HKWA 3W1UA 1ZS2A 1Q6RA 1D3CA 2FTWA 5GNZA 4HNCA 3T08A 3CUHA 2X8GA 1DBTA 1GV4A 4LYRA 1IZCA 3SFKA 3BAKA 4ZOEA 5C70A 4GYPC 1E5NA 3EDEA 3B97A 1P7TB 4IIDA 1X97A 4LU0A 3F4CA 1TJRA 2GYIA 1EOMA 1K9TA 1LQ2A 3DDMA 1ME9A 5DX7A 1HZYA 4HOXA 2J7GA 3EOSA 4U3CA 3CV7A 5KETA 3ZOAA 3SSZA 2P10A 4LWWA 4JQ9A 4XSLA 1TV7A 1VFUA 4JS3A 3BW2A 3NZQA 4GZJA 7PTDA 3GY1A 1KR1A 2DSVA 2ZZ4A 2R8WA 3L66A 3BAXA 3GD4A 4A8LA 2EPHA 1F8WA 3GNXA 1O94A 3LTYA 3B0XA 4GLEA 6REQA 4W7UA 4P61A 2OZ3A 3EMQA 5CPQA 5CG7A 1TSIA 5LIUX 2Y8VA 3F2DA 1ESWA 3AU6A 4RW3A 2BC0A 3PBUA 4KPRA 3W01A 1Z42A 2QKFA 2R1LA 4QAIA 3V1PA 3IIZA 4HK5A 5JQ9A 4DZ5A 2VM8A 3SJNA 2Y5SA 1S5MA 1DPMA 2X2YA 1IEWA 3W9ZA 3WUEA 2DZPA 3STCA 2FTYA 1KBJA 1FWDC 1PVNA 3N2CA 4HNLA 4UTTC 5C2CA 5CZTA 5U4NA 2PTXA 3IANA 1VR6A 4HCLA 1T0OA 4QG9A 4FLQA 5BRBA 2F84A 3PF3A 4RPPA 1TUXA 1V6WA 4PUDA 3W23A 1Z8AA 3FW6A 2DT2A 3BDKA 2QVNA 4G2DA 5LYRA 4E4UA 3GYEA 3ABXA 5U25A 4TV6A 5D4YA 3TP4A 2WMJA 4M19A 2I5QA 2WSRA 3G6LA 5JCLA 4J5NA 4M81A 2V5DA 4BKNA 3CWNA 4EIVA 1SVDA 2I5GA 2PDJA 5D9MA 4U33A 5LZLA 3W38A 3SCRA 3MY9A 1JDEA 1UP3A 2JKAA 3CL7A 1DEDA 3A4XA 2BY3A 1UOKA 2EHHA 3BUVA 2ISVA 3AXIA 3IS4A 4CGTA 1W0MA 3PG6A 1FWSA 1JDFA 3CGCA 4LV4A 2OPJA 2Y4SA 3HG3A 4Z1BA 3RR4A 3UF9A 6TIMA 3G3MA 3KTXA 2V67A 5EBAA 3NGJA 3EWUA 5HXMA 4DJFA 3GC4A 4N02A 1A0EA 4Q8PA 2V0TA 1HIZA 2C13A 4PUMA 2GVYA 3DFYA 3GIQA 2H3DA 1GG1A 3MCMA 4ERIA 2J7CA 2V3GA 3PB2A 4XUGA 4S3EA 2E5DA 3IIPA 2QLYA 3NZ1A 4I9MA 4JN7A 2IKGA 2B7OA 4MZ1A 3GDRA 3VIOA 5KVHA 4A2RA 2PU1A 2WBKA 2V5CA 2A0NA 3C61A 1A3WA 1I8JA 1OF8A 4V28A 4B9YA 1RBOB 4PCFA 3KVJA 1AD1A 3MSGA 4U28A 3T09A 4RL3A 3OG2A 2ABAA 5JBFA 1G4PA 3LS9A 4Y9PA 2F6KA 5JXQA 1TV4A 1ZJIA 4WSHA 3UWWA 3H6OA 4UFMA 2R9RA 2CLPA 2BG5A 4UTHA 2C1IA 1TMLA 4L64A 4YTSA 4AC1X 5I0DA 1RCQA 3GNPA 1YNYA 1FH7A 1OD0A 1XDMA 4WDWA 4US5A 4GYPA 1YQ2A 3S9ZA 1JCXA 1PL9A 4JIRA 2EAWA 3IIOA 2FVKA 5M17A 1XHCA 1KXTA 2YA2A 3L9CA 1MW3A 1FWCC 5E5CA 3TQ0A 2WBAA 2J75A 1V6XA 4GKTA 3GXDA 3CHCA 2OEKA 4EVZA 3C8NA 1R3RA 2O9PA 1PS9A 3GG7A 1IF2A 1DE6A 3LTSA 2CU0A 2DUZA 3CU2A 1ZHAA 4AZ6A 2PLCA 1T41A 3STPA 5FS8A 3FA4A 2PI6A 1BYBA 1QWKA 3TC3A 2ALDA 3O05A 4WD0A 3HJZA 5D04C 3MZ2A 3GU9A 2BZNA 1BAGA 4QHRA 3CV1A 4HVXA 1FEBA 1LQAA 3LXCA 1VJIA 2Z26A 3CIWA 3LM7A 3GDMA 5HDRA 4K7YA 1IEIA 1QU4A 3NO5A 2P88A 3WDQA 1XH2A 3B9EA 3AMZA 4UTTA 4CCZA 3E0LA 1X6LA 3PZGA 4X3ZA 3R12A 7ENLA 1P1XA 2WSPA 2GRTA 4E3VA 4CNTA 3QMRA 1TVPA 4BS0A 3MHFA 2CLFA 4IIEA 3U0HA 3CZJA 2TYSA 4TU1A 2RDWA 3QYSA 3DYMA 4LW7A 5G1MA 3EX3A 3QFBA 1W1B1 1GUVA 2YB4A 1OGGA 4E38A 2ZTKA 4JTCA 4S3GA 1K8CA 1N8WA 4V2XA 2ZRWA 3CUGA 4QS5A 4DO7A 1GQIA 3TUUA 2NWRA 1FP9A 5G5HB 1NHSA 2Q71A 2VDHA 1XIDA 2QVHA 2OQYA 2HBXA 3TXZA 3P5YA 5HULA 4P5UA 4Q4QA 4D71A 4ZQCA 3WFAA 5CBBA 3WNKA 1JZ5A 3RNDA 4W4QA 5CPOA 3G0SA 3CL8A 4J35A 3MUZ1 4H01A 1TCDA 2DY3A 4JR5A 1UMLA 1L6GA 1ZMDA 4NG3A 3MSYA 3G1FA 3UR7A 3DUGA 1VQTA 1QI2A 3PUDA 4FXRA 5HUOA 1XDJA 3HG4A 2Q01A 1HF6A 3UG5A 1GW1A 1XIMA 3QR3A 1BSIA 3MU7A 2E9LA 2VTFA 2WK2A 1DWHM 3WK1A 5FOOA 3GW3A 1PDYA 1LT8A 1XXXA 3LRMA 3M1ZA 1UD6A 4RV8A 2VFEA 5RUBA 4E2DA 3WMLA 4W86A 4H9UA 3OO2A 4H9VA 3UESA 1I0DA 2FB3A 2VNCA 2B4GA 3L21A 3N34A 4UQAA 3W7QA 1LUCB 1I75A 1ZNNA 3O9NA 4HHHA 4QCFA 3HG5A 3B3DA 4ILSA 4W7WA 1E43A 3IVSA 3TWBA 1TWDA 3W7HA 3MMTA 3UPMA 4LB3A 4JTGA 2Z7KA 4QS6A 4TTGA 3N2BA 4WK9A 1KCZA 5CG0A 5D33A 2DU2A 4BI6A 2V8ZA 4FXSA 3HPFA 2OKTA 1ICQA 2WC4A 4Y7EA 3H2MA 2QHAA 4HCHA 5LNUA 2WVUA 4C6CA 1JCTA 3M16A 1NDVA 1XH1A 3VMOA 3QVQA 4MOZA 3L4VA 3N9RA 4NVTA 2C0AA 3LGEA 1GOKA 1M01A 4PMXA 2WVTA 1GQLA 1IIHA 1G4SA 5E9AA 4O52A 3KVKA 1UZ1A 4ZB2A 4AD4A 2ATSA 1IEXA 4CNUA 4AEEA 1RBAA 1ZSXA 2VGFA 4MUPA 4QR6A 1LRTA 1K9EA 4GNVA 4YN5A 1Q7MA 4ZB0A 3VDHA 2DSZA 1WDWA 1C29A 3UWZA 1EHAA 2Y7DA 4EXBA 4HJFA 1XGZA 4G5DA 1F3WA 1J0HA 5K2ZA 1W3KA 3WYZA 1VDVA 3TCEA 3FHAA 2C18A 1NOWA 2XVGA 2QMKA 4HU4A 1W1IE 4X0VA 4CCEA 1PKLA 3K2GA 3LSCA 3P8IA 4M6PA 3LCLA 1TPDA 4MB1A 3I3BA 2B81A 5GJMA 3P82A 3RCNA 3R4IA 5C2XA 3WLSA 4DUOA 4AC7C 5BRQA 2EG6A 1GZGA 4LUIA 2R6OA 2R94A 1W3NA 4B3ZA 1HVQA 2QQ6A 4D6HA 1NQ6A 3HA1A 4JTJA 3ETRB 1O5KA 5HJYA 4YTRA 1AMKA 4GI6A 1Q6GA 4C7FA 1QW9A 3GR7A 3UT0A 3VNMA 3DGZA 4DJEC 3LMZA 1C9DA 1L2UA 3RN6A 1EGVA 3EDFA 1YE6A 3CPUA 3IGXA 1GW9A 2CERA 2CLEA 2NQZA 1TPFA 3LA4A 1W5NA 1ELSA 4I7WA 2QUUA 4C6EA 1R5YA 4L9ZA 1OSEA 2H9AA 4IFRA 1GQKA 1AW5A 4OUIA 2Y85A 4BF9A 3WLRA 5AYIA 3A47A 3NEVA 3KDOA 4ZQPA 4YXGA 5C9RA 2WJZA 2YLLA 2IPJA 1OT2A 3ZLFA 1W17A 2VRJA 5H1WA 2EPOA 1WXJA 4MYAA 1R6WA 4E0CA 2W4XA 3VINA 2XVNA 2Y70A 4LEQA 1SR9A 2EKGA 1V3IA 2FFIA 3S46A 4LQ1A 2PD9A 1UR1A 3GUGA 1L6FA 2VCAA 3GB6A 3TXVA 2PC8A 3OZOA 4S3KA 4H4TA 1V5XA 3M47A 3HQ1A 1FWRA 2YL6A 2Y8KA 9CGTA 2CLIA 3WG6A 5BXPA 1YYAA 3BQ6A 1MXSA 2WBGA 1PIGA 1XSIA 2Y6ZA 2DORA 2FGBA 4MF4A 1DHPA 2X42A 2HEJA 4BK9A 2WSYA 5JIPA 4WUIA 1V0MA 4NI8A 1JPMA 2NVCA 2ZTJA 4GACA 4GZ7A 1GORA 4LF1A 1T96A 3B04A 3AMLA 4UMBA 4JHMA 3FAXA 3KRUA 1X2GA 1HKKA 3SR7A 1TE1A 1TCMA 1GOMA 4CU7A 4JGDA 3UCQA 3B8VA 2R14A 4M8UA 3H4XA 3UETA 4TX6A 4S3DA 3TVAA 3N14A 2UY3A 1JIBA 3OIHA 3VOGA 4V1XA 1MW1A 1BXNA 5L9FA 4IHCA 2PDBA 3V5FA 1JROA 1H7WA 2HVMA 2QGYA 2GVLA 1ISXA 1JPIA 3GTFA 2YDRA 4O1AA 3CIXA 3FA3A 2AGTA 2XFWA 3FYYA 3AMGA 4O12A 4OBTA 3BPWA 4DYEA 2XVPA 3W22A 3NWRA 2NPXA 2IW0A 4X61A 3QR0A 4JTSA 4XKMA 2R91A 3PWGA 5EMMA 2PLJA 1GRFA 3B8IA 3Q94A 1XPYA 3FEQA 4RKAA 1SO5A 4X9YA 3NM3A 4EPBC 2YBTA 3KTSA 3T4WA 4RZ4A 3GXTA 4O8RA 2D0HA 4JQ4A 3B8WA 5BYWA 4EPDC 1AD4A 3GVRA 2GVJA 3VCCA 1BFNA 3TAOA 4ZE5A 5I78A 3MPGA 2HE8A 1P0KA 3KOYA 1Q6FA 3THUA 5DBUA 2YQUA 1BSLA 2NXHA 2XGZA 3GH4A 4B90A 2WAGA 2ZKMX 1AFSA 2POZA 1Q2RA 3WN6A 3G8RA 3SIZA 5HR7A 3IPWA 4RNHA 1ZJAA 3BO9A 1XANA 3DFSA 5A6AA 1HJVA 1GRGA 1FFVC 4H2HA 3T55A 1BLIA 4XG1A 3WLTA 2RUSA 4H04A 2Y7EA 2GQ8A 2H9AB 1NY1A 4D72A 5A6BA 2ODOA 3ERPA 1R3TA 1DYSA 1GSNA 1FOBA 1KCKA 4M7SA 5G5IA 5A6KA 2ACSA 3ABRA 5TQLA 1R9YA 3TH6A 4TR9A 3TYDA 2DIJA 7ODCA 1XFBA 4ZOAA 1L8PA 3KOXA 4X2PA 1U30A 4A05A 4H7VA 4FIRA 4BQ5A 4XVDA 3SGGA 1CGTA 2NX3A 2OFJA 1HN1A 3NPUA 2ATMA 4DNHA 3LV6A 3CHEA 1ZUAX 4A2SA 3NSMA 3RRAA 3WCZA 1VF8A 7TAAA 5JU6A 2WO5A 4H4UA 3C56A 2ZZCA 2V5JA 1AK5A 3TAKA 3R25A 3W1PA 3ZMRA 1M3UA 2J7HA 1TMHA 3WBWA 4JEJA 4MWAC 4ROPA 2TODA 3V4BA 1A5LC 2NSOA 2XVKA 3GC2A 2TMDA 1IGSA 1RJQA 4KCTA 2P0OA 5AB3A 2A8XA 4QAWA 3N15A 2J7FA 3W1MA 3GFYA 3TTSA 3DHPA 3QLDA 1W9XA 2G5WA 3V0SA 1K4HA 4H9TA 4L4OA 1Z32X 3J7HA 2ZUNA 4YIWA 1Z9AA 1Q6DA 3CZEA 4LAOA 3QY6A 1FKWA 4P8XA 3MJYA 1BPLB 4AZ7A 1G9HA 3MCOA 3B0UX 1H11A 3TKFA 4HQVA 4IPPA 4Q7BA 7XIMA 1UPMB 2JKEA 1OCJA 3CIVA 4RNJA 3VIPA 2INEA 2ZX5A 2WMKA 1MSSA 2IQ0A 3EX4A 3TU9A 1OX6A 1WAUA 3CQJA 5D30A 3T81A 4RUBA 2QAFA 2PDQA 4UOZA 4NY2A 1ZY9A 2E6FA 1M6JA 1ZJBA 1MZRA 2CPUA 3MV01 4ZB5A 7A3HA 1H61A 2V5LA 4ADUA 4Z1YA 3E9AA 4AX7A 1O5XA 4O19A 5I3KA 4KQNA 3C0QA 1EC7A 3N19B 1R85A 2W62A 3TCSA 3ZS4A 4GK8A 2Z2AA 1XRTA 6XIMA 4D6FA 3CUJA 3CYJA 2PDPA 3WMSA 2GDVA 2J66A 3EWXA 2R1MA 1DJZA 1LP6A 3CJPA 5CSUA 1FCVA 5ECVA 2XDFA 4GWEA 1B57A 1Y0EA 2E25A 4TIMA 3V5CA 2W3RA 2X7VA 1XYLA 4DYJA 5AHMA 3SECA 1EDTA 1SFTA 4B3LA 1UH2A 1X7IA 3GS6A 4QROA 3U48A 1RD6A 4JIHA 1OYAA 2PPGA 3WDJA 2ZZ2A 2E5AA 3S5NA 3BH4A 1W31A 3LEPA 1LDCA 1LOQA 4S23A 2QZRA 3P74A 3GWQA 3M0HA 4ACZB 5IXEA 4RK8A 1OT1A 3LBOA 3KEHA 3IJQA 1GHSA 2OQLA 3TN6A 5M3WA 2A3EA 3AC0A 3WQ6A 1EP2A 2ZX6A 2X50A 2C7FA 4M82A 1UPPA 2QCFA 2VRKA 2V2DA 1EGZA 4PMNA 3GXIA 1BD0A 3GRTA 5FAGA 3ZSTA 1ODZA 1MXGA 1M9HA 3DK9A 5CZKA 2QJHA 2WCAA 4J7RA 2ISWA 2HNHA 4S3JA 2UWFA 1DJYA 4NZCA 3PPGA 2AQVA 3BC9A 2DVTA 3OP2A 1PDZA 1JRCA 4XAFA 1KRCC 3KVMA 2CEQA 5C9UA 1GJWA 1V3JA 3VD9A 3XISA 2VR4A 5HQLA 3KLJA 2WOVA 5EU9A 1KWKA 1C3FA 3R8RA 1TVNA 3GXNA 3QKEA 1XQKA 3QN3A 3N4AA 4X2RA 1W56A 1XYAA 1G7UA 1OFRA 2FZNA 4L4MA 4LAKA 2B7PA 4J2MA 2E4TA 3FDGA 1OJXA 1IHIA 4NT0A 3GQYA 3HQPA 4GGBA 3ME3A 1D3GA 2OLAA 4PMOA 1F6KA 1BQCA 4R88A 1FXPA 2CKRA 4MWAA 1M7JA 2DPEA 4D6GA 2ADAA 1JF6A 1NFGA 3ITCA 5U1OA 1QUMA 4Y2WA 1MRAA 1ZAHA 4GYFA 3T40A 1I0BA 5XIMA 1QAPA 5FAJA 1H7NA 1E9IA 2JALA 4CD7A 4CD8A 4OU1A 2D0GA 4Z2IA 2DGAA 1GRBA 1B9ZA 4MZYA 2AMGA 3S83A 1ISYA 4ZA0A 1KLZA 2VOMA 1YXYA 4QNEA 2FZ9A 4ZO9A 1J18A 1F5ZA 4LT9A 1P43A 4HHMA 1B1YA 2NXGA 1XYZA 4CQCA 1JCJA 4MJMA 3QSTA 1EX1A 2PAJA 5BU6A 4MNMA 1KV5A 4PBFA 3L4WA 1E0TA 4P7QA 4UB9A 3WLOA 1NOUA 1H41A 2MNRA 2R82A 1SW7A 5TF0A 5IM51 2ASHA 3BMXA 5BMWA 4RZBA 4OQVA 4ZVJA 4ML9A 3AYSA 3EPOA 3K5XA 3FLUA 4QCEA 1G94A 5D03A 4Z1CA 4UTWC 4ICMA 1E3ZA 3TYCA 1NP2A 2F2HA 3LNMA 1W1A1 5EBKA 2ZDSA 2ZADA 4MFEA 1EF2A 4IICA 4PGLA 3RLGA 2VL4A 4GY7A 4JHOA 4YYCA 3URNA 1U5VA 4TUFA 3KS5A 2I14A 2YXXA 1FCQA 2DH3A 2CZEA 1BG9A 1Z6KA 3CHVA 3MANA 3F5JA 2YFNA 1IWPA 3AQUA 3TN5A 1CPUA 2CIPA 1UWAA 2XIJA 1NHPA 4O1EA 4FZIA 3BZJA 2OCZA 1KFEA 1V02A 1MW0A 4O53A 3M43A 4KWSA 4V33A 8XIMA 1S2TA 4AISA 1US3A 3UWEA 5F2GA 3K4WA 3VM5A 3GKAA 4EE9A 3FKKA 3KP1A 1XSKA 3LCXA 4HT3A 3IACA 1A5SA 3WD2A 3GHUA 3D9XA 4A8IA 4CQ9A 2RABA 4IMDA 4MDOA 3IIXA 2HMCA 2QJJA 1KQZA 4RLIA 3E2RA 3ZVIA 1AH4A 4LPCA 4WVXA 2PU0A 4IPLA 5A94A 4DQWA 1THFD 1KBIA 1GVYA 2AL1A 4HU8A 5AKQA 3GNNA 3O15A 3CK5A 5AYXA 3DEQA 4GYKA 4P7LA 5JMUA 1CZ1A 1P0EA 1YADA 2V2CA 4FHAA 4Q4MA 4GKLA 4B2DA 5FSEC 4NIRA 1NDYA 4JTIA 4Z2HA 3GD3A 3C5QA 1LG1A 3NAVA 3GNOA 5DN1A 3RITA 4IQJA 1DIKA 2EO7A 4WJEA 3RX2A 5AC5A 2ZZ6A 3WO8A 1A5CA 3MI2A 3TEVA 3GTIA 1W9UA 1SZRA 2YDAA 4L65A 1Q8AA 3VD4A 2FHBA 4B5WA 1CCWB 3UZ5A 4M7TA 4LUSA 2FIQA 3KCJA 3QMTA 2WANA 3UG4A 1RCXB 4MWAB 1SZGA 4JYDA 3NQ7A 3K30A 2YZRA 1J9YA 4J28A 4PULA 2E28A 3CPGA 3CUZA 5GRTA 1TB3A 3NVDA 1XIGA 3P14A 2HK1A 1X39A 4K6AA 2Z25A 4HJWA 1OX5A 5JIWA 1MQPA 3LD5A 4U3AA 1JZ3A 4EK7A 4ZO8A 3HIJA 4C6BA 5B7YA 4GYJA 3TX9A 2H8ZA 4BEUA 4JAWA 1ZALA 1QI4A 1FHLA 4OJYA 1IZKA 1MEWA 2O55A 2GK1A 3FSTA 4IF2A 1UWIA 4AIEA 3CZLA 4O4WA 4HGXA 2FMOA 4FX8A 4AMAA 4NZ4A 3T44A 1PZ0A 3RLVA 2DQWA 1CB2A 1HXJA 5GNYA 1EF3A 1FWGC 4FK9A 5I02A 3BGGA 3VIFA 2GQ3A 2HPMA 3PZMA 4KWWA 4J3VA 1NARA 3OU8A 3GW0A 4XV0A 4TVYA 1SSDA 2QCEA 3DFNA 5EGRA 4GABA 1QMLA 3ARZA 1US2A 1IGWA 4DJFD 1GPWA 3ITVA 4XZBA 3NQGA 3S47A 3G77A 3HU7A 2V9DA 4H6EA 2X30A 1UUMA 3IEBA 4LRSA 3ZIZA 3TJLA 5HNRA 2FZ8A 3GHRA 4B16A 1FQ0A 1S2CA 3C0SA 1J6PA 3HMJG 1SZEA 1QHOA 3W1LA 1TPH1 4UMAA 4XZWA 2YFOA 4FOUA 3E5BA 4RJEA 3LPGA 3B8SA 1LORA 1XLFA 3AIWA 5BW6A 2YA1A 3SURA 4MNJA 1P0DA 4C6LA 1KFJA 3R0DA 1M7PA 4GXPA 1W2PA 2J9YA 3O1NA 1RP8A 4MKSA 1FEAA 1T40A 1TQJA 3LRKA 4J4KA 3S1GA 1T5AA 1EC8A 5AHIA 5I3GA 1ITQA 1ZAIA 4LS0A 3ARRA 1LZOA 2HVOA 5F2MA 4KFNA 4US5D 4CNSA 2QCHA 4ADSA 1V6UA 4HTBA 1F8IA 1DV7A 1NAL1 4H8HA 3DYPA 3QZAA 2CZDA 3ALGA 4Q8UA 3RGTA 2Z24A 2QV5A 3L2MA 1GT8A 2VZVA 2GR0A 1ZBVA 1UD3A 3KHJA 4D9PA 3LI1A 1MQQA 1AA1B 3R79A 3UXLA 3W7LA 3H55A 3AN1A 4KRTA 1NOFA 4F79A 3VGEA 4H00A 1K7EA 4HTYA 3EBVA 4XBJA 1SJBA 3H12A 4OUEA 4H9MA 2E3TA 3S6DA 5D37A 3BV7A 4LUSB 2BFGA 5KZDA 4FEZA 2CLMA 3T0DA 1S5TA 4F0HA 1OABA 1UW9A 2PZNA 1JYWA 3W74A 3EWDA 5AYBA 3WD0A 3NQMA 4YWOA 1V6VA 3QQWA 3QC3A 1E4IA 2D2HA 3K46A 2ZFAA 2PWVA 3ZJ6A 3ARQA 3GG0A 3EOOA 3PC0A 2Y7GA 3CB3A 2OYKA 1YKWA 1FWAC 2VFDA 4XZ9A 3CC1A 3DBPA 1N61C 2OQHA 9XIMA 1GRTA 1QNRA 3QTGA 2DVUA 5A1AA 2PTDA 3NXLA 1BF2A 2WHJA 4Q7NA 3BURA 4CNPA 2VZUA 3KBSA 3WIJA 4A29A 4A3QA 3KX6A 1G69A 1H50A 2DT1A 1AW2A 5A2CA 1TPVA 1DJGA 3ZT6A 3H2NA 3NL6A 4Q4PA 5F4WA 2GK1B 1PB0A 1R47A 4GQGA 3OC4A 1PZ3A 3RK8A 3H8AA 1VGAA 2X1IA 4WHBA 2EPKX 3WJSA 1WZLA 4EQXA 2HK0A 3LCGA 3BAJA 3DZ1A 1KBBA 3LENA 5I23A 2O9RA 1D9EA 2IPGA 3MV11 3EDDA 5A6JA 3W24A 3G8EA 3LQLA 1KFBA 2WQDA 3U8GA 1I1WA 3HB9A 2PUZA 3AMCA 2C0HA 2UBPC 3W29A 2YXGA 3IV8A 5AC8A 4JN6A 1JQXA 4GINA 1J93A 1J0YA 4AVNA 2PP0A 4AIOA 4GRSA 1ZTVA 3ANVA 4DELA 1JJKA 3UNTA 1XD0A 4FNPA 2HTMA 1GETA 3W2JA 3SFWA 5E1QA 3FJNA 4H9ZA 3IWPA 2Z1KA 4Z17A 2EQ9A 2QCGA 3N4EA 3W7RA 1LL4A 2CCRA 3GXPA 3WQFA 1IR2A 2VZTA 4AZBA 1E6RA 4IXHA 3UQNA 1Q4WA 1R86A 4YNGA 2WNQA 3W37A 1IR1A 4O0QA 4KH2A 3HPSA 1A80A 3MJMA 1UIOA 3OTRA 3SUUA 3WNMA 1PWMA 1A5AA 2XZ7A 4W89A 3WD1A 3NR0A 1FP8A 2F8QA 2YDSA 4PE8A 4AZCA 1WQ5A 3AZSA 3E2SA 3T1GA 2OWWA 3G5EA 4GX8A 1K8ZA 1KGWA 4TXEA 3P5ZA 2OSWA 4WIWA 1YTKA 2TRSA 1UASA 3F5LA 5E93A 1S2UA 3GG1A 4RR4A 5CPMA 3URHA 2PFHA 4FALA 3C6CA 5H8PA 1X38A 3TNOA 3ZR6A 5LXEA 1JZ7A 1LT7A 4QITA 3QRHA 1FHUA 3OLEA 3QV9A 3PWAA 4PZVA 2A3HA 3Q67A 4MJ2A 3GM8A 3PHAA 4Y9NA 3SADA 4ALDA 2IXVA 4MUZA 5IHSA 2W0HA 2WPGA 1HTIA 4GHRA 5LIKX 3IRDA 4PEEA 4NEWA 2YVJA 3A9BA 3CGEA 2Q8XA 4AYSA 5EA9A 3ITGA 3ZLHA 4UOQA 3LU2A 3AMKA 4R7OA 5J8LA 2PDIA 5FSDC 5DLCA 3A4AA 2ZVIA 3L4UA 3S1UA 2JBMA 1H7RA 3DC8A 1H63A 3DC0A 1E55A 3DK4A 1VPYA 3GFXA 1ZGDA 2CZFA 3FNDA 2DZAA 4LBUA 3TTYA 5FF0A 3ORWA 1QPOA 4ZQOA 3PG8A 4ZBCA 3DAQA 3UCDA 3EOUA 3AALA 4F0SA 2G0WA 1ZP4A 2BHUA 2Y61A 2QV4A 1ITUA 1SJAA 4NSBA 4ZOHB 1OG6A 3AJXA 4HN8A 1ZXIC 1WOAA 1M65A 1Y65A 1FWEC 2CLLA 2ZBTA 3C86A 3PB0A 3YPIA 4PRRA 3IIVA 2CDUA 3AHVA 3A9IA 3IAQA 4IMGA 1SZFA 1ADSA 1SFLA 3RDKA 1NSJA 1TUFA 2YVGA 1WKFA 3L5OA 4H4SA 1BWKA 5T91A 4LRTA 4A35A 5SWUA 3QF0A 2BSLA 3NGFA 6PTDA 1QJWA 4FMVA 4H4IA 4MKNA 3FHQA 3L4XA 1UIPA 3C3UA 4I5XA 3W1XA 4XTDA 1A5UA 3GXMA 1B3OA 4FB7A 3AXMA 4JDYA 3CGTA 4WJ8A 3BSGA 3P60A 4CQBA 3ZFHA 3SY1A 2OU4A 1RLDA 3A24A 4ERGA 3BJSA 1PKNA 1W91A 2RGMA 3AMDA 3GNRA 4NHVA 3PZIA 1A3XA 2R9ZA 4MJZA 4Y6GA 4G1NA 1NEYA 1KD0A 3W72A 4S2CA 1ONEA 5HAOA 4GI4A 1PX8A 4EWND 2WPEA 4O0KA 1UD4A 3A12A 1FRBA 1JYVA 3UERA 3VUSA 4DO5A 1MUCA 2NLYA 4O14A 3BQ5A 3TN4A 3ANUA 1M1BA 3VGFA 1UWTA 4YPJA 1N62C 4O28A 3IK4A 4GY0A 4BQ4A 1A49A 3H2FA 2FH8A 3IUIA 1SR0A 1XIHA 1I2RA 3IJ9A 3WL1A 4D1JA 4KCUA 5A8PA 3ID7A 3CQ0A 4MPKA 2HRWA 3NQDA 3F2BA 1HGWA 1OFBA 4AZCB 3REQA 4LVAA 5FEPA 4PBEA 3VKDA 1TWIA 3AIQA 4US6A 1QO2A 2GGEA 3VKBA 1GEQA 3LPPA 1WO2A 4P8VA 1R9ZA 2GSHA 4I3GA 3CMFA 5TBOA 1WYIA 4IPNB 3WLPA 1EXBA 3KTCA 2QYGA 4MM1A 4GIRA 1XUZA 4C91A 1HKJA 4XAPA 3MZNA 4PUUA 2E5BA 1R3WA 2YW4A 4KT2A 3TJIA 3W7DA 4J57A 2XSXA 4JN8A 4PFMA 3C0JA 1V8EA 4NJIA 3U2CA 3Q65A 4RXGA 3INPA 3G24A 3A7RA 3GU2A 3MCNA 4P7NA 2WPBA 4LYQA 4LF2A 2H8XA 4A3HA 4PTVA 3WNOA 1E9LA 1Q1WA 3IUHA 2YB1A 1AZ2A 2V81A 1S7MA 2GQAA 1KWGA 3WSUA 4FPSA 1Q6LA 3TYBA 3KL3A 2PRMA 1UD8A 1OC6A 5CAHA 4E4PA 4ZFCA 3VDBA 4LV9A 4I5RA 2BP1A 3BE7A 3B9AA 4ZMGA 1JD7A 3CV2A 4FO4A 3PTQA 4LIIA 1E4NA 1YNPA 2P50A 1GVFA 2DZWA 1LRNA 1EJ7L 1JEHA 3T0CA 4DI9A 5FIPA 5CGMA 3MVTA 4GVFA 4DNMA 1DTUA 3GUWA 2AAAA 2QJNA 3S1XA 3W4RA 2DJLA 4TVDA 4M3PA 2VGIA 1P48A 3D3FA 3HZ3A 3L5AA 4C5ZA 3P62A 2OLHA 4R33A 5BWAA 5I03A 2QDHA 1A5BA 4X60A 3BVJA 3ZZ1A 1G01A 3OPSA 2OKOA 3CT2A 5D05A 4WY0A 3E0IA 2G3MA 3PAJA 5AC7A 1BRLA 4H19A 1BWVA 4GOAA 4HYVA 4K3ZA 2O0TA 4O15A 3PZOA 3I65A 4C6JA 2ZX9A 3PZQA 2TSYA 4TV5A 3FCPA 1VIZA 4O54A 4C5YA 4GVHA 4G9PA 5A6BD 5FCZA 1POJA 4WDUA 2A6NA 1Q5MA 3NPXA 3O16A 1ICSA 1VBRA 4PC8A 4AWTA 2GWNA 1DJXA 2PGRA 1QI3A 3S9IA 2BOFX 2PBGA 1FO4A 4PEKA 4IQEA 2E9BA 4O1BA 5HWMA 4E2OA 3LCFA 1V7AA 4AZGA 2VYOA 4JNZA 4C6QA 1E3XA 2Z2BA 4NX5A 4QTGA 5AZ0A 1CGUA 1RH9A 3EDJA 3MKKA 1TMQA 4DLMA 1OG0A 3T0BA 1KFLA 1C91A 2OOGA 3GC5A 3TN3A 4JX6A 1OX4B 3R89A 4CQDA 5D02A 5LNWA 1WDQA 2G4JA 5GVJA 3MB9A 3FYOA 1JCNA 2XUCA 3GHSA 2BCPA 3MMUA 1CLVA 4EAMA 4H4ZA 2EQ8A 4UFKA 1P1MA 5DMYA 2WVSA 4ZSTA 1LWIA 3V0TA 2YBVA 3ICJA 4NRSA 4UR9A 2ZWYA 3WL0A 2EEXA 2XHYA 3WK0A 1VC4A 3H22A 5HQEA 4XD4A 2XFFA 3I4EA 4HA4A 5H2ZA 5FKYA 2POTA 1EOKA 3SAZA 2HZGA 2ANUA 2ZQ0A 3T6CA 4KWOA 4L5ZA 1UJQA 3NPWA 4CU6A 4TMCA 1TRDA 1BXBA 2YW3A 1PUDA 5EMKA 1CWYA 5EMUA 3TSMA 3NZPA 1X8FA 2F7FA 4JDBA 2EG8A 2DT3A 1KKOA 3N6QA 5HMEA 1EZ2A 1NVMA 4Z1DA 4A8NA 1KKRA 4W8LA 4LAMA 4NJGA 2YIHA 2NUYA 1JZ4A 2A6LA 3W88A 4JFUA 2OXNA 3UPWA 2Y63A 5CJMA 1EJRC 5BRPA 1M04A 2XIOA 3I4KA 1UKPA 4IPIA 4JQ3A 2NQ5A 5D2WA 3GBEA 3FSUA 1MMFA 1NJJA 1Q85A 3EWWA 2JQXA 1T6MA 2PODA 4FAMA 3IGSA 1EWEA 1A3HA 5TD4A 3S1WA 4ICCX 4IIBA 2BOEX 4IH3A 4F48A 4D8AA 4KIRA 4G7FA 3C2RA 4LS2A 4W93A 1DWIM 1F8MA 5JCNA 1XJBA 2PDLA 2A21A 3ZR5A 4QISA 3WLHA 1K8XA 1WZMA 2RAGA 1GONA 5I00A 4IM4A 2V5KA 4GQ0A 5FF4A 3G1AA 4K68A 4KRZA 1Q63A 2E8YA 4HMDA 3B0YA 2VUYA 4NZJA 4D6IA 2AQWA 5G4WA 4HN4A 5EL1A 3CO4A 3GDKA 5A6MA 4IPJA 3W7IA 4M29A 4HZ8A 2GUUA 3ARYA 3RYSA 4C6OA 4UTUA 3CAVA 4OWGA 2WLYA 1U1HA 4O57A 4LY8A 2NQ9A 3PJUA 4WY0B 3TQKA 4BFAA 4QG6A 3BLPX 3MWAA 2OYLA 3SIMA 4GJIA 3VCNA 2PSNA 1OC7A 1BRLB 4MY9A 4K8DA 4WDTA 4DX3A 3BOXA 1VFHA 3S2JA 4INFA 1T99A 2V82A 3EKLA 1SJCA 1XM3A 3W1NA 4F0RA 3LZ3A 1RBLA 4QLJA 2JK2A 1DNCA 1FXQA 1KM1A 2E67A 5BROA 1V59A 1CGXA 1DWJM 2XISA 2PDHA 1FWJC 3WX7A 1W3HA 2FLIA 1YRRA 3VX1A 4JFSA 1QK2A 3OBKA 5TR3A 4G8TA 3M5XA 2BODX 3S5YA 1E73M 1H1YA 1EFZA 5A8QA 2PWDA 2QUNA 2V3EA 1MW2A 1C8QA 2ONEA 2RH9A 1A5OC 1XLLA 2NQHA 3AOFA 5FF7A 2YVFA 1TV8A 3K4AA 4HOWA 2OZ0A 1EPVA 1LROA 2V6AA 1XIFA 3QPZA 3WQEA 4ZOCA 3KFTA 4Z42C 2PEVA 1TA3B 3LHWA 3LCWA 1Z7AA 2GR3A 1Q6CA 1X1OA 4GUHA 3LHYA 3MC5A 5JH2A 4MWAD 1R87A 1W8SA 2X0SA 4WKAA 2JK6A 3I68A 3CH0A 1G4TA 2FKPA 4JTFA 4GRTA 3S4TA 3WKZA 4LEFA 4WY0F 1XLIA 3VOJA 1V0LA 5G1YA 3VABA 3W2UA 1LWHA 4WGHA 4LAUA 4S38A 4H8NA 4IOTA 2O7QA 4XBKA 4YS1A 4AHPA 2VEFA 3ARUA 4PB4A 4Q8VA 5CPTA 5IBXC 3H2EA 4DXKA 3MO4A 1QCWA 2OYMA 1WA3A 4O8AA 4EM3A 4F66A 1RAKA 3SN0A 1VCVA 1A4LA 1L6YA 2PDXA 1BKSA 2WXDM 1TYGA 1XCFA 4KRUA 1B0IA 2Y89A 4JIIX 3VMNA 5H91A 3NQ6A 4Q33A 1J11A 4GC4A 2ZZ0A 1XPGA 3VKKA 3OBEA 4QP0A 3W82A 3R8HA 3M46A 5CC7A 4UNIA 3N3TA 1XV8A 2AAQA 3WY1A 3SUVA 1I45A 2WHLA 3KW3A 3PZVA 3AYTA 3QJAA 4WGXA 1X8CA 1XISA 5G1TA 3WEMA 1FH9A 3BARA 1XYBA 1P6BA 1KM6A 5ABGA 1YX1A 3W84A 4L1GA 1OWQA 4PR4A 1R3VA 2D2GA 5FMHA 5FS7A 2WKJA 1OINA 3BTNA 2NQLA 4KPLA 2J78A 4UFHA 5C7VA 1I2QA 1XLAA 1KFWA 1OD8A 2W5FA 4EQSA 3K8MA 3OB8A 1REQA 1J0IA 1HKMA 4AY7A 2OMAA 2WZMA 3SY5A 2Z6JA 3NNTA 3W28A 4J3XA 5FI8A 1B5TA 4ATWA 3FVMA 2X16A 3K8LA 4C7DA 2GZXA 3C2VA 3DHDA 3IJ8A 5G4EA 3KWSA 1TRIA 4LNYA 2VQTA 5LSMA 5JCMA 1KO0A 4Y9OA 3WLMA 2NWSA 4H6QA 3M6DA 3BXWA 2OR2A 3LG3A 1OEPA 4JTRA 1OZMA 2QPUA 2NQJA 3R8GA 3T2PA 3VKJA 3QKZA 3MYPA 4OIFA 3GLCA 1PE1A 2FH6A 1NDAA 4KWUA 3SRHA 3P80A 1N82A 4IISA 1OGSA 3II4A 3NQCA 4GG9A 4MHBA 4OT7A 3T2OA 1BF6A 2QW5A 2IXUA 4JDRA 3KCOA 4MLRA 4NXSA 4DWDA 1NWTA 3CAQA 2QPSA 1MYRA 3M7WA 1IT7A 3CMGA 1X6NA 1SW0A 4XVEA 1FECA 4O13A 2L5HA 2X41A 3QHMA 3FDKA 1GERA 4HZ6A 3W81A 2GJRA 3G3DA 4NILA 4O10A 3I7QA 4AIBA 1UA7A 1H0GA 3N3MA 3ITXA 3LDVA 3G1DA 4HU0A 4CVWA 4PRWA 1X1NA 1MDLA 3GTHA 1W1TA 4JPGA 1VZWA 1LL7A 3A7AA 3V75A 4LTSA 1MVYA 3SQLA 3HV9A 3TSDA 2HCVA 2VEGA 3RIKA 1FWWA 1B4KA 3PR2A 3RILA 3LUTA 3H21A 2D2OA 3U4AA 4A21A 3ARSA 6A3HA 2HV5A 2YBUA 4Z2KA 1F6YA 3CGDA 5HUPA 3V35A 5I77A 3A7UA 2WCGA 3ONCA 5AECA 5G5GB 1BYCA 3D6NA 2J13A 3OHMB 3EB4A 4DPQA 4J1OA 1W9BM 2RDXA 4BF5A 2ZRXA 4MWAE 2BWGA 2SFPA 3U5UA 5CPLA 3PG9A 4E8DA 4YHEA 3HPAA 3NPVA 3OA3A 4Q7IA 1CX9A 3TFCA 4A6GA 3RO8A 4Y8FA 2YDQA 2DVXA 3SRFA 2GGIA 4TQTA 2FPYA 2Z6IA 3M64A 1F4AA 3KRBA 1WDSA 5F4SA 3WDRA 3BAWA 1XFCA 5CZSA 3UXDA 4AX6A 2VHLA 3H23A 5IBXA 5C2GA 1IWAA 2W3SA 3H2CA 4ZTXA 2GOUA 2IPFA 3BL3A 1YNQA 5EMYA 1SO4A 3H70A 3M41A 4RE2A 3URAA 1O7AA 1QR7A 5BZAA 3S8HA 1B2YA 1DJQA 4CQAA 4D8ZA 4R7WA 2EQ6A 1D8CA 4F3HA 2J3NA 3UWYA 5K7JA 4C1NA 4XZLX 4K2SA 4L80A 2YR1A 4PFHA 3VM7A 4TVCA 1D2KA 4YWIA 3HGJA 3R2GA 3SCVA 3CWHA 2DZXA 3F4VA 2FFCA 5DO8A 1MZHA 1RJRA 3WEOA 2ZRYA 3M0JA 4W5UA 1ME7A 5KTLA 2FZBA 4LVFA 3WELA 2A3CA 1REQB 3STGA 3WLQA 3GVGA 1WNOA 1GNXA 2DQXA 1VJSA 1EWDA 4F9DA 3R07C 2WM0A 1KRBC 3K13A 2W54A 4IWWA 2VC9A 5LNVA 4GVGA 1TX0A 3SQMA 1CDGA 1YQZA 1TWWA 4AHQA 3WH6A 4DJDC 4OV9A 3N73A 5D9PA 1E6NA 2PWFA 1OFDA 4B4FA 3FN9A 2CFYA 5FF3A 2IQDA 2FDSA 5FJRA 2VKZG 1XLGA 1LLZA 4LAZA 1V02E 4LNCA 3E0FA 2PF0A 1GOIA 4QG8A 3H4WA 1CIUA 3CO8A 3FGCA 3BLDA 4LCSA 3L2IA 3CS2A 3L5MA 4GIYA 1KV8A 2CBIA 2C3DA 3N17A 3EAOA 3EPMA 1E6XM 1JL8A 8TIMA 3VC6A 4GXWA 4PUEA 3GVVA 2CETA 2WJDA 2FJUB 4U4MA 3LBMA 2DZVA 4XZMX 3LYEA 2CC0A 5TAOA 4DWSC 4PTXA 1VBHA 2A4AA 3WQVA 3BG5A 3MMDA 2BHYA 3EA1A 4CUCA 1O5QA 3R7MA 4JCLA 3MKVA 2A1YA 4ZE4A 4JTLA 4IMFA 1Y7VA 1ZK7A 4N9EA 3WD3A 2FGLA 1S1RA 5JUVA 1Q6QA 2QIIA 1JOAA 1CLKA 2GLKA 3GG8A 5FEZA 5FESA 3D5HA 1JPDX 3L65A 1N5XA 3CT7A 3A4JA 3O6DA 2WHMA 1TR9A 4QJ3B 1YDOA 1K7FA 4M5PA 4GJ1A 2PDMA 3DKLA 5DBTA 1H7OA 1VPXA 1UKTA 3F4DA 3ZM8A 1OZQA 4XQ6A 1V79A 4R9OA 3ITOA 1JFXA 4H4YA 1EEPA 4CLMA 4HPHA 2C91A 4FNRA 5T9CE 2XM2A 3UD6A 3TW7A 2AMXA 5HJLA 5CBIA 1DXFA 4H4QA 3I7SA 4MZ8A 3MUCA 3R58A 1CECA 2FJKA 1YDNA 2JEQA 3WF0A 5C71A 1GCYA 4GI8A 1JFHA 1GZJA 2QCLA 3NQ2A 2EKCA 1VYPX 1FHDA 2Z7GA 4GUFA 2ZYFA 1RHCA 3W86A 5BOOA 1N8FA 3DG6A 4L61A 1KXQA 1YHTA 4L6HA 5HMDA 2OGJA 1IT8A 3LV5A 5G2IA 1F3XA 3DJGX 1XYFA 1KTBA 2E09A 1SUXA 2A7RA 2WMGA 3CMJA 2ZZ1A 4MMWA 3FA5A 1TPC1 3KL5A 4IZGA 1YE4A 1EJTC 5TIMA 4Q8NA 3T78A 2J62A 4B5VA 4BJHA 1TPB1 3MQTA 1GKPA 2A2IA 1EYWA 5F2LA 1GEHA 1Y5WA 3MUIA 1ENUA 3WMCA 2ISSA 2Y88A 4MVAA 4NEVA 1EDQA 2PBOA 2IKHA 2CXGA 4M51A 4RNFA 5BWFA 2IS7A 4C1NB 5DY2A 1PZ1A 2VDGA 3D3AA 4PRTA 1CGWA 4REQA 1H60A 1BGAA 1AH0A 6REQB 3NSNA 2XPKA 1Q1RA 1DIOA 2IPWA 4F2TA 4QFUA 1W3IA 2X8CA 2EPMX 4XD6A 3GTXA 1QW8A 3TA9A 3TIMA 3CH9A 3M9YA 5DMNA 2WSKA 3LPFA 2BVDA 5LIXX 4O1DA 5PTDA 2WMHA 4H4WA 2VWSA 4HPNA 1RY0A 1W2VA 3THQA 1QT1A 1U83A 1J2BA 4M80A 2OO6A 3LNPA 3IJIA 3OZPA 1LL6A 2UY2A 1FX6A 3WUBA 1EYEA 3SCWA 1TYTA 3T9PA 3M07A 2PWUA 1XIBA 3HURA 2XG9A 3W7EA 5LA2A 4B92A 4I5UA 4EQRA 3BCDA 3CEUA 3WF4A 4H9XA 3WNLA 4XAZA 1ITXA 4DJDA 3HQNA 3HGRA 3BV4A 4UQEA 4MDPA 4Y96A 4GZEA 3FGCB 5AHFA 1UMYA 4CNOA 1BHGA 4FOKA 4E2BA 4AFYA 3QY8A 3RM9A 4AVFA 3MWCA 3ITLA 1QPRA 2ZX7A 1S1PA 2WOIA 5DQPA 4L4PA 5FJIA 4ZTYA 3S3GA 3TZNA 4AHOA 3VA8A 5I3HA 4NZ1A 4HIBA 1OADA 5DY3A 1GTEA 3W00A 4A3YA 4DWSA 2VX4A 1KBKA 4FNQA 4XO6A 3LI0A 4CEXC 2ZZBA 2Q02A 3HM7A 3EWYA 2I9UA 1G0CA 3B4YA 1PIIA 1OFEA 3VGDA 3N13A 4GQRA 2C8NA 1S38A 1YTDA 4EXAA 5HBFA 4KEUA 3CQHA 2WMIA 4H9YA 6CGTA 1BYAA 1F73A 5I06A 5DANA 2G3FA 4M56A 3DKJA 5A8MA 1WYGA 3LZ5A 1YEYA 2ESCA 3K1GA 3O8AA 4NX0A 1TTJA 3HMCA 4NAEA 4N42A 1VFSA 3BMWA 4HMNA 4GBUA 1R30A 4DLFA 1OB0A 1RQEA 3TV8A 4LJ3A 1DQWA 4JEQA 4C90A 3OLDA 3S0CA 5HNTA 2RDUA 3N12A 3TROA 2PMQA 4A8RA 1IXPA 3APYA 5LIYX 1FCBA 3I6EA 2IKIA 4JX4A 2WCSA 1SM9A 4IFOA 1POKA 4FF5A 3MI6A 4PUNA 3EXRA 2VVSA 3UZZA 3VPLA 3DH7A 1JNDA 1YTEA 3OEXA 2ZXQA 4QX4A 3KRZA 1XBZA 3N6JA 2KZHA 3BLKA 2CYGA 2A85A 5C6MA 3ATYA 3NXFA 4FDCB 5I6SA 1HUVA 3KOFA 4GCXA 4PTNA 1OFPA 3P93A 1N55A 4C7GA 3GK0A 1BGGA 1K3UA 4E3TA 2EQ7A 1UWRA 5EBUA 3QFAA 1GYNA 2AKMA 5J5DA 2QDGA 2JE8A 2PGEA 1W5OA 3EX6A 3VNDA 4REQB 3LY0A 1MEHA 5EFDA 4Y9AA 1UKQA 1JI2A 3HF3A 4WXYA 3PZUA 3W1AA 4NP7A 1ZJHA 4RE0A 3JRKA 4Q8QA 3UA3A 1R0MA 4UTFA 3A64A 1HT6A 1XC4A 1HJSA 2C16A 3PVFA 4E4FA 1H62A 1V77A 3GD6A 4ZO6A 1JG9A 5MKGA 4LANA 2ZICA 3CL6A 2W3ZA 3ITYA 3TOPA 4K1GA 4L1WA 4WRHA 1DWFM 1R2SA 2JFEX 1TG7A 1ALDA 3H7RA 4HB7A 3ONBA 1XS2A 1B90A 3I6TA 5LA1A 4AIUA 4LB4A 3PNUA 3L8KA 1OFAA 1B3VA 1RQHA 3UR5A 4B5UA 1A53A 2G50A 3JS3A 4ZOBA 5HMSA 1ADDA 3QW4B 2VP8A 4N6EA 2GFTA 2PDGA 4GE8A 4DF0A 3ABZA 3LLFA 4MNKA 4Y9MA 5D2TA 2ACRA 2XFRA 4EACA 3G1VA 3NL2A 3MO7A 3NYDA 1V93A 3W2MA 1F3TA 4JD4A 4ZGYA 4DWSB 2YCJA 5E70A 3T0AA 2TPRA 3LCHA 4TO8A 1QOQA 3ES7A 3N2MA 3RLUA 4AXNA 2XSAA 3WH8A 5BU9A 4N4QA 1FUYA 5K3VA 1SB3B 4PTWA 5CC3A 5A8GA 5JBDA