3R10A

Crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : mg complex
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
362
structure length
362
Chain Sequence
VSKIIDIKTSIIKIPLKRTFITAVRSTNHIDSLAVELTLDNGVKGYGVAPATTAITGDTLQGMQYIIREIFAPVILGSDLSDYKQTLELAFKKVMFNSAAKMAIDLAYHDLLAKEQDISVAKLLGAKANSIVTDVSISCGNVAETIQNIQNGVEANFTAIKVKTGADFNRDIQLLKALDNEFSKNIKFRFDANQGWNLAQTKQFIEEINKYSLNVEIIEQPVKYYDIKAMAEITKFSNIPVVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMESPAGILATASFALAEDITVADLDPLDWVAKDLYSDYITFNEPNIILKDNLKGFGFNLAENLYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Enzyme of enolase superfamily
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Francisella philomiragia subsp. philomiragia
total genus 118
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3r10A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3r10A01
3QLDA 3PWIA 3QPEA 3UCCA 3U9IA 2OQHA 3RCYA 4ZCWA 4ENLA 1TE6A 4G7FA 4E5TA 4GGHA 3FXGA 4GYPA 1WUFA 3T9PA 3SSZA 2GGGA 1PDZA 3EKGA 3RR1A 3OZMA 4FP1A 3TQPA 4DYEA 1JPMA 2AKZA 4GFIA 3TTEA 4F4RA 3H7VA 1MDRA 2PTXA 3FCPA 3CXOA 3NXLA 1P48A 3H70A 2QJJA 2XH2A 3QKEA 3OPSA 3BSMA 2GGHA 2OVLA 2PTYA 1KD0A 3I4KA 3UJ2A 3MSYA 5EU9A 3VFCA 4IP4A 1EBHA 3DFYA 3NFUA 2OZ8A 2PGWA 2QDEA 1ONEA 2QQ6A 3ZVIA 3IK4A 3S5SA 3BOXA 1NELA 3DIPA 3R0UA 3TJ4A 3ZLGA 4HNCA 3OP2A 2PSNA 3FYYA 1P43A 3Q45A 2QGYA 4K8GA 2P88A 2GL5A 3DDMA 4DXKA 3RO6A 2P8BA 3UXLA 4IZGA 3EEZA 3OZYA 1F9CA 1KKOA 2XH4A 3QN3A 3GO2A 3K1GA 4MMWA 1KKRA 1NU5A 4MGGA 1FHVA 3VC6A 3MWCA 2AL2B 4ZA0A 3MKCA 3GD6A 4Z1YA 3FJ4A 3STPA 2PP1A 6ENLA 4H83A 3CK5A 3SN0A 2HXTA 4GYPC 2QDDA 4IT1A 3TWBA 2GGIA 3DEQA 3RRAA 4E4FA 3D46A 4HCHA 4JN7A 2POZA 3JW7A 2GGJA 4G8TA 4X2PA 4FI4A 2P0IA 4KEMA 1ELSA 3DGBA 4H2HA 3T8QA 3ZLFA 3DG7A 2OLAA 4Z17A 3TJIA 2PTWA 3UJSA 2GGEA 5FJOA 4DX3A 4JN8A 1WUEA 1YEYA 1DTNA 2MUCA 4IL0A 3V3WA 3VDGA 1MUCA 4JHMA 4H19A 2OFJA 2FKPA 4DHGA 2PTZA 1MDLA 2AL2A 3UJEA 4H1ZA 3T6CA 1JDFA 1L8PA 3RGTA 4HN8A 3UXKA 3TOYA 4DWDA 4K2SA 3GC2A 4DN1A 3P0WA 3V4BA 1R6WA 4HCDA 4K1WA 3VCNA 2OKTA 2ZADA 4KPLA 4HPNA 1R0MA 3CB3A 2OX4A 3FVDA 2DW7A 7ENLA 1PDYA 3FV9A 1W6TA 4E4UA 4HYRA 5FJUA 3N6JA 3DG3A 2P8CA 4MKSA 3OTRA 3RITA 2PU0A 2O56A 3DERA 3PK7A 5BOEA 1ECQA 2PGEA 3THUA 3VCCA 3QTPA 2OO6A 3Q4DA 3I6EA 4A35A 1KCZA 3U4FA 4HCLA 4IP5A 3IJLA 3GY1A 4GGBA 4HNLA 2XGZA 1EC8A 1EBGA 2QVHA 4YWSA 4GIRA 3SQSA 2AL1A 3V5CA 3PFRA 3H12A 4GISA 2PCEA 1XS2A 4IHCA 2GDQA 5J04A 3ZLHA 2HZGA 4ROPA 3KUMA 3MZNA 3N6HA 5ENLA 1JCTA 2PMQA 1EC9A 3IJIA 3IJQA 2OPJA 4M0XA 3SN1A 1OEPA 3V5FA 2XSXA 3DESA 2DW6A 2PP0A 2PU1A 3JZUA 2I5QA 3VC5A 3S47A 3TWAA 4E8GA 3NZGA 1EC7A 2PODA 3MUCA 2FYMA 2ZC8A 1SJBA 3MQTA 3T4WA 2ONEA 3P3BA 2NQLA 1XPYA 2MNRA 1FHUA 2RDXA 5FJRA 2P3ZA 2PPGA 3R1ZA 3ZVHB 3I6TA 1JPDX 3DFHA 4EWJA 3SBFA 3UJFA 1RVKA 3CYJA 3R10A 3R11A 2AKMA 5FJTA 3R0KA 3ES7A 3BJSA 3H8AA 3VA8A 2PP3A 1MNSA 3B97A 4IL2A 2OZTA 3PWGA 3ENLA 2CHRA 2PA6A 3N4EA 2HNEA 1IYXA 3UGVA 2PS2A 1SJDA 3SN4A 3NO1A 3D47A 2OG9A 3HPFA 3P93A 2OQYA 2XH0A 1BQGA 4KT2A 1E9IA 4GMEA 4J3ZA 3MY9A 4A6GA 1MRAA 2GSHA 3ZVHA 1TZZA 1BKHA 5BOFA 3JVAA 3OW1A 3ES8A 3UJRA 3TCSA 4E6MA 1SJAA 3DG6A 4J1OA 3R25A 4M6UA 5IDZA 3SJNA 5FJPA 1TKKA 3N4FA 2QJMA 3TW9A 4KWSA 2XH7A 1SJCA 3CAWA 2OZ3A 3CT2A 3UCDA 2HXUA 4A3RA 2QJNA
chains in the Genus database with same CATH superfamily
1TVNA 2HS6A 4DUVA 4UFLA 1PX3A 4ENLA 2UWFA 4REQB 2PGFA 3GB6A 4LY4A 3WQEA 1JPKA 4UC5A 1FWJC 4GYPA 3KBVA 2HTMA 4O28A 4NG3A 4L5ZA 3OZMA 3AOFA 5EPDA 5BXTA 1EP1A 4OZOA 1ZNNA 5K9XA 3TTEA 4F4RA 3H2OA 2YCKX 4ZO9A 4BA0A 1AZ2A 4N9CA 2G4JA 4JQ1A 4NILA 5C9XA 2NW0A 5I79A 1K8ZA 2W54A 3TN5A 4IFKA 5C2XA 4B9ZA 1M7JA 2IXUA 2VP8A 4MB3A 1J01A 1HTIA 5A6MA 2CZFA 2OVLA 3HIJA 3DJGX 1UG6A 3C0SA 3U48A 4M6PA 3EB3A 4LJ3A 1TZ7A 4XVEA 1E15A 1KA9F 4H4VA 1XD1A 1JCMP 5CXPA 1BAGA 1TE1A 1A3WA 1V77A 3R0UA 4GI6A 2J8GA 4O16A 1TTJA 2XIIA 1E72M 2CC0A 2VM8A 2QGYA 3H24A 3S3GA 2OWWA 3AO0A 4GKLA 3I3DA 2Y24A 3WQ4A 3ZR6A 4QJ3B 3EDKA 4B5TA 2EG6A 3NURA 3IIZA 4KCUA 4PE8A 1XM3A 1KKRA 4MGGA 3WLRA 1XSKA 1EEXA 2GQAA 4Z1YA 3B4UA 3FJ4A 3W6YA 3STGA 1KCXA 5FF4A 3PNZA 3FHAA 2R9RA 3DI0A 1XW8A 4LFYA 3ZMRA 3NXFA 2PZNA 1DL3A 1ZGDA 3SUUA 5DN1A 3OQ8A 3D46A 3GNOA 2G3FA 1WDPA 4AIBA 4Z1BA 4GNKB 3SY1A 3EB4A 5I07A 2WBAA 5D2YA 2IKHA 3W72A 4GKTA 3VGFA 2BTMA 3T8QA 3LPFA 3VIIA 2ACSA 2GR0A 2X50A 3HN3A 4S3EA 2OYLA 3V7PA 2PTWA 1G5AA 1MXSA 3SQLA 1HG3A 2MUCA 2O9PA 3AICA 4DWSC 2VELA 1K7EA 4OTKA 1W1TA 1ML1A 4YIWA 1MXGA 3WH9A 2HQMA 3A13A 3MMTA 4AF0B 3DC0A 4NZCA 1IZJA 1M53A 4H1ZA 2GR2A 3S5ZA 1NP2A 3VKDA 1NOUA 2PURA 4NHVA 4PUKA 4K38A 3QZEA 4H7CA 1I6NA 1Y5XA 4PEKA 4LU0A 1YRRA 2PRHA 4IPLA 1M68A 1XLMA 3VM7A 2DGAA 3QV6A 3PPGA 5CPSA 1ADDA 5CSYA 1R8LA 2X8CA 2WSKA 4XD3A 3ITVA 3S0CA 4L9ZA 3C2EA 9XIAA 4IICA 4KEZA 3FFSA 4IM4A 4QISA 3IPWA 4NVTA 4PRWA 4HYRA 3S46A 3QV8A 3RO8A 1AUSL 3GFXA 1N82A 4BFAA 3OTRA 3GK0A 4H4SA 1S2VA 1EHNA 1D3HA 3BZJA 3MV11 2WJEA 3PK7A 3H6OA 3W2UA 3TTQA 2WB5A 2PGEA 4D6FA 5BMWA 3B9JB 2BGNE 2PDBA 1QOXA 2Z29A 4FLSA 3XIMA 3BV7A 3U4FA 5AHIA 2J9YA 4HNLA 4CCCA 4DUOA 3PZOA 3CEUA 1V6WA 1OZQA 1RUSA 3MI2A 3WNMA 4MY9A 3PZTA 3AXHA 1XH2A 1MW0A 1KRMA 4JTSA 5JVLA 1US3A 3GRTA 4X2RA 5EMKA 1QCWA 5A5WA 2GR3A 2HZGA 1ME9A 4GH1A 2BGQA 2EPKX 5ENLA 1JF5A 3K5XA 5D2TA 1QVBA 4FX7A 3UWYA 3N12A 1TWIA 4M0XA 5A8OA 3TTYA 1QNPA 1B57A 1XBZA 4XKYA 5DT7A 3JZUA 2PRLA 3LNMA 4E8GA 3H2NA 3MZ2A 1GJUA 4ACZB 2W27A 2YQUA 5I7GA 4WSHA 1WP6A 4GXMA 4WUIA 2CKSA 2XISA 4EQWA 3TIMA 3BARA 3P3BA 5CAHA 3CPGA 1G4TA 5JBDA 1CGUA 3O0HA 2IQTA 1H1ZA 3HG5A 3E96A 1LYXA 4CNSA 2V9DA 2YAUA 2INFA 3NCOA 2P3ZA 3W53A 4CNOA 1TPC1 1GKPA 2Z1SA 1A50A 3BGAA 3HG4A 4F2UA 2ZX6A 2BV9A 3DCPA 4ORIA 3SBFA 2J7EA 2OWXA 1TO3A 1UR3M 2XINA 4US5D 2YCLB 3QRHA 3LI1A 4CD7A 5DY3A 1VYSX 3G1SA 1TR1A 3TW6A 3ES7A 4GRSA 4EKJA 2VT0A 3B97A 7TIMA 2X2YA 3AYTA 4JTRA 3C5QA 3QGKC 2HBXA 1C92A 2EJ1A 4WQ6A 4JX6A 4XAZA 3GTHA 4OOZA 3NZRA 3DK4A 3W1QA 3WFZA 4KGJA 2ZFAA 3SUVA 2PS2A 1CLVA 2YPIA 5DCDA 1JI1A 2RH9A 5TR3A 2OQYA 1XDJA 1EOKA 3CGBA 3ZIZA 4UIOA 2J24A 2ZXAA 1KQYA 1Q6EA 3LS9A 1GYMA 4GYKA 1A4MA 5LA2A 5T9CE 5IHRA 2VR2A 3L68A 3QPYA 2CLHA 4YCPA 1QPQA 3BQ6A 2X7WA 2V3EA 4M6UA 1TKKA 4FXSA 2ISWA 1YDOA 4BS0A 3P5ZA 1B0IA 4PBEA 1JZ8A 2HXUA 1FWHC 3W88A 3UCCA 1UC4A 5CPOA 2ZUSA 5D37A 4HTBA 1KM1A 3A3WA 1RALA 1WUFA 3SSZA 2A3CA 4HMNA 1OZMA 4W9TA 1NFGA 2TMDA 2QXWA 3MSGA 3IJ8A 3S2LA 1GJPA 4UTJA 3BSGA 2RUSA 4AWTA 5I3KA 1OYAA 2FTYA 2WMKA 3M0LA 4GC4A 4AC1X 2J6VA 3GS6A 2Y8UA 1GVIA 5FSEC 5LHFA 3CHEA 1FWNA 1QO2A 1WAWA 3ARSA 4FXJA 3BDKA 1UMLA 1H5YA 3VFCA 3DFYA 3EWZA 3SAZA 1TFVA 3ZJ7A 5JIPA 4ZGYA 2WVVB 4GOAA 1GRHA 3ZLGA 4NI8A 4LH8A 4OBRA 2V3BA 1NJJA 2ISVA 4LXFA 1BWKA 5LNRA 4GNJA 3QFAA 3RX3A 4PN2A 3DECA 5IFTA 2JFEX 4F0RA 3B9EA 3AUJA 2ZA1A 4M1BA 3N1AA 3RO6A 3WDPP 1NF7A 3CQIA 1I0DA 3LHZA 2A1YA 1OHLA 1PHWA 2OB3A 3KBWA 5C7HA 1N61C 1REQA 2PLKA 4QJ1A 1TJ1A 3EANA 2A3LA 1W9DM 3EA1A 5BMXA 1O5QA 3STPA 5JCNA 3MV01 2PWEA 1GKQA 4ZQOA 3C2RA 4YN5A 3C0QA 2YXGA 4NASA 4JN7A 1QASA 1XXXA 2GGJA 1NTHA 4E0CA 1QAPA 3LRLA 3A47A 5KVIA 1C91A 3AZSA 3WF1A 4JGDA 2CNCA 5MKGB 4Z17A 4Z2IA 1A47A 5KMYA 5JCLA 2FTPA 4R53A 4J3VA 2J9ZA 4GJJA 1MUCA 4CN4A 1LRQA 5AOUA 4WVXA 4S3FA 3DH7A 4DYJA 5J5RA 2XFWA 3W7QA 1WDWA 2OGYA 3CWHA 4PFHA 4B5SA 4QTGA 3CPRA 1PS9A 1MI3A 3NVDA 5HUPA 2VOMA 1NHRA 3P0WA 4US5A 1GJWA 3G8RA 3S6DA 5I3GA 3NSMA 3VNZA 4XAYA 4JTGA 4OIFA 3VCNA 2OKTA 2QR6A 3FGCB 1DXLA 1P0EA 1BGGA 3UG3A 3GW3A 1GZGA 4B5XA 1VCGA 3GNNA 3L0GA 3L4ZA 3G3MA 2VX6A 4RNFA 1KFWA 1QK2A 5FJUA 1BFNA 4U2YA 5A6BD 4AY8A 2FTWA 2GUUA 2PGRA 1L6GA 4EF9A 2CBUA 1H7WA 4MWAB 3VNKA 3KRUA 5HQLA 3S6TA 4F0LA 1FWTA 1ECQA 3O1NA 3DKLA 4E8DA 1AL7A 1KB3A 3PZNA 1UOKA 3U0HA 1BQCA 1H7NA 5CJMA 1Q5MA 1LL4A 2W91A 4BZYA 1KGWA 1V51A 5GNYA 2XIQA 3TN3A 1R38A 2PFHA 4C6OA 3HA1A 3O16A 5HMSA 3RLHA 1BVWA 1TPUA 3K13A 3PZIA 4EPDC 4R3UA 4Y96A 3CIWA 3QEZA 3SRFA 4HMCA 3PANA 1GCYA 4Z08A 3PFRA 4YYFA 3A24A 3T0TA 5CPLA 2VX4A 5LA0A 5CLWA 2YFOA 1RSCA 4BQ2A 3T40A 1WXYA 2D2HA 1P1XA 2ACRA 2NWRA 3SIMA 4MZYA 3DHPA 2AAQA 2WCGA 4IWWA 4MUZA 4ZQCA 1KFKA 1E6NA 2PP0A 3E0VA 1FKWA 3BOFA 2VD8A 1PZ0A 3EBVA 5AC5A 3FNDA 4OE7A 2VOTA 2Z0IA 3GKAA 1V4YA 1MW2A 3L4WA 4NSBA 2ZKMX 1LOSA 1MWOA 3QR1A 4JNZA 2BGSA 2Z27A 1VCFA 4QG9A 2W66A 3B04A 3PG9A 3EMZA 3W1LA 3WNOA 1W5PA 2O9OA 2X0HA 2XSBA 1BG9A 2PDGA 3LCWA 3NQVA 3NQFA 2RDXA 1VQTA 3E1F1 1SO6A 1FCQA 3ECQA 1H09A 4Q8PA 3C2OA 4EPKA 3V0TA 2P3EA 2QAEA 3UZZA 3GFYA 1TQJA 1A49A 4NAFB 5ECUA 3GG0A 4MAZA 1JF6A 4EVZA 4AY7A 4DYKA 4YTQA 2ZWYA 1FWCC 4PSPA 1UYQA 3QY6A 3R11A 2AKMA 2CLEA 3WD3A 2VNCA 1RZMA 2JIEA 2W4XA 4H4RA 4UFMA 2DSVA 3TU9A 4F40A 1NDYA 3B3DA 2Q3RA 1P0BA 2ZX5A 1XRVA 8TIMA 4FO4A 1GETA 4AVOA 1VRXA 4GO8A 3WBYA 4JTTA 2Z6JA 5A8GA 3E2QA 4LRTA 3MMUA 2CLLA 3UGVA 3EDDA 3O07A 4HPXA 1HP5A 1Y8BA 4AIOA 4LANA 1RJRA 4AG0A 4FIRA 3WNPA 4R9OA 5HWJA 3ANUA 2ZRXA 3RILA 3DXIA 3WDQA 1BQGA 5FI8A 2J7CA 1OK4A 4CCZA 2ZZ6A 3BO9A 2NX1A 1QWKA 5H8MA 2WJDA 3CZLA 2EG7A 2XDFA 1BRLB 4PMYA 4F9JA 1BKHA 3L0NA 3PBGA 2D69A 2LLEA 2A7NA 1M3UA 2Y7EA 2ZTJA 1B3WA 2ZUMA 5IDZA 1W1IE 3W00A 2DJXA 2GR1A 3N4FA 2CLPA 3QZ6A 2XH7A 2REQB 3P62A 3K8MA 1OGBA 1D3GA 2BFGA 2H6RA 1C7TA 3APYA 4CNPA 3PWIA 2C3ZA 4IX0A 3LPOA 3EOSA 4G2DA 4LUYA 3C2YA 3IJDA 3M0KA 1PX8A 3VAVA 2FLIA 2ATSA 2RDTA 3EKGA 4UNKA 3RR1A 2ZC1A 4DPQA 4IQDA 3WJSA 1ZTVA 2I57A 3N2OA 4I9TA 3KVJA 5BROA 3WK3A 3UA3A 2KZHA 1Q63A 1V6YA 5JQ9A 1AW2A 5LNSA 1FH7A 3MYOA 1IXNA 4ADSA 4IMEA 2YLAA 4M29A 2VR5A 2V38A 1YQ2A 1TJ0A 3EX1A 4W8BA 3SY8A 1YBQA 1SB3B 3VNJA 2QDHA 4UCGA 4ILSA 3MSYA 3TQKA 4ZVJA 1ZX9A 1DJWA 2OKOA 3LXAA 3E0FA 4EWND 1Q8JA 2E3TA 2I1OA 4KWOA 4JQAA 5AB3A 3LZ3A 3TV8A 2E6YA 3BAKA 1MQQA 1H11A 3B8DA 1VLIA 1IE7C 1O95A 1VJSA 1W3TA 1L6YA 4B5NA 1KXHA 3THAA 5D9NA 1H51A 1JQVA 2XH4A 1OCJA 4C1NB 4A3UA 4J7RA 2TPSA 3TCEA 4H4YA 4GPNA 2J7HA 3FXYA 1JYNA 1F8MA 3E49A 4ROQA 1O1ZA 4OHQA 2A0NA 1EZWA 3NQEA 3W4RA 3QQ0A 5I03A 5I5RA 1A0CA 3D0CA 4FPSA 4UTIA 4DVOA 2ABAA 2CZVA 1VENA 4NEWA 3EXSA 2VZOA 1S5WA 4S3JA 4MG4A 2QUTA 5AC6A 3EX2A 1JG9A 4N9EA 3W71A 1ENUA 2ZUNA 5D9OA 3W76A 2X09A 1DWAM 1DTUA 3AMGA 3OJGA 4PCFA 4C60A 4XAPA 2OMAA 4XUGA 1EUNA 3M0XA 1TTQA 3QGVA 5DXYA 4TTUA 3LOTA 4QNWA 1CXEA 4DELA 4DX3A 2HMCA 4FNRA 1HQTA 4KGLA 1DTNA 3HMCA 3PJUA 3I3EA 5I3FA 4F0HA 3OGRA 2A3EA 2YSWA 1KM4A 2GK1B 3MCMA 5EFDA 1IF2A 2PDUA 2PF0A 4L56A 1K4GA 3BL3A 4LCQA 1QI0A 4TVCA 3UXKA 3FKRA 1EPXA 2VGBA 1UR0A 1KTBA 4AD3A 3VZZA 1TR9A 3IACA 1PYMA 3VM5A 4H7VA 3TYAA 3URBA 3CV7A 4DJFD 1W5MA 4Q6JA 4WLCA 3W81A 1J10A 3W73A 2A6NA 1SZEA 2ISSA 5D33A 1JDEA 2IKJA 4EQRA 3O8AA 5M17A 5CJNA 1M6IA 2E68A 4XZLX 3EUB3 3BK0A 2PU0A 2E6FA 3TFXA 4A29A 4L1XA 3CUFA 3THUA 3VCCA 2AMXA 3Q4DA 4A35A 1KC7A 5G2HA 3G6LA 1KXTA 2NZLA 4IP5A 4UR8A 1EKOA 2YBUA 4B91A 2C6QA 1M01A 3WLOA 3GTXA 2NV2A 4R9XA 2JGYA 5AHFA 2WV8A 2JIWA 2QCNA 2J7DA 1VFHA 3R6IA 1ZQ5A 1BHGA 1FIQB 4GIRA 3B0UX 2AL1A 1KCKA 1QNRA 1J0IA 4KCWA 1ITCA 1ZP4A 2RFGA 2VI0A 2O0TA 3RMJA 3GNPA 4L4MA 3UEQA 2I14A 2QF7A 4C6MA 4UFHA 4MADA 1K02A 3KCOA 5E9AA 3V5OA 4BKNA 3TNOA 3LENA 4XV0A 5CKSA 1W3HA 2KAUC 3RRXA 2HBVA 2ZBTA 1LVLA 3SCRA 1O68A 3VUPA 3W1AA 1S5MA 1V0NA 1IQ8A 3CHCA 1DWHM 4JOMA 3SQMA 3WH6A 2PODA 2PDYA 4AW7A 2FYMA 4E3VA 3PBYA 4LNYA 3M47A 1O94A 2CZEA 1SJBA 2WVUA 4ZR8A 1DEDA 2O55A 3T4WA 1FWSA 8CGTA 3W7CA 3P0XA 3A12A 3BG3A 3QLLA 5HUOA 4I3GA 3QHMA 2W3SA 4YCOA 1OADA 3PPHA 1QWGA 4H4PA 1FRBA 3OLDA 4JNMA 4URIA 4JDBA 1AK5A 1RBLA 4HNNA 3U3HA 4LAKA 4UZSA 2E09A 3A5FA 5HA7A 4LUIA 2R94A 3WENA 1XHGA 2GDVA 5ABTA 2G8ZA 3WNLA 5G5GB 4NAEB 4A4AA 4LYRA 2BXVA 3CL7A 4GZIA 2E3ZA 2VQTA 3KLJA 2PDIA 1EJWC 2ZZ7A 2VFDA 4BF5A 1K3UA 1R46A 1R3TA 1CXHA 4WEVX 1BSLA 5A6AA 4N0RA 3QC0A 3POCA 1X6LA 1EOMA 2PDJA 2JF6A 4W86A 2ZZ4A 5LNVA 1V6XA 1E6PA 5K4ZA 4K7ZA 1GQLA 4A6GA 3KOWA 1QHOA 1UD8A 3HV9A 1MO0A 2HCVA 3F7JA 1JUKA 1LOQA 3CQ0A 3E2VA 1WXJA 3ARVA 2QVNA 3N9SA 4Q7BA 3B8VA 4UR7A 1V0MA 1IT7A 2C18A 4O18A 3W82A 1C9DA 3P74A 1Y65A 3K4WA 1H1YA 2AGTA 1Z44A 3UWEA 4A3RA 5I3HA 2BWGA 2PLJA 4DUWA 5HJYA 2EPHA 2W61A 3KBMA 4WIWA 4HSHA 1TE6A 5HULA 1TZ9A 4PUMA 3IGXA 3G3DA 5D04C 2X1RA 3DX5A 3CUGA 4KFOA 1GRTA 1PYFA 5JXQA 2QV4A 4DYEA 3C8FA 3LCXA 1GSNA 5BZAA 3C2VA 3GHRA 2Z1KA 3LRMA 2V5CA 4R88A 1VFFA 2WWDA 3KBNA 4JCLA 3UU0A 1G6CA 4UQEA 1JUEA 4GK8A 2W5FA 3VIFA 3U5YA 4LBRA 3PBWA 1EJTC 2D20A 2VUYA 3OPSA 1PB0A 4WKHA 3GIYA 4DJFA 2GGHA 1EJXC 1VBGA 1PCKA 4IP4A 3LN3A 4LC6A 1LBLA 3O7UA 1ONEA 3STCA 4REQA 4EF8A 1JROA 3QY8A 5CPQA 1DIDA 1XIBA 1FKXA 4Q4PA 2DIEA 3A22A 3GDMA 3GZ3A 2V2CA 2X0SA 3BCFA 5L6UA 1DJXA 4S3AA 1JZ7A 4G1NA 4CLMA 1M7XA 4P8WA 4JR5A 5D02A 1KKOA 1F2JA 1UIOA 2C19A 3GO2A 3LGGA 1NSJA 4PBFA 2AL2B 3UWVA 1YNYA 3GD6A 5DBTA 3DHDA 3W6LA 1BXNA 2CLKA 1OC7A 3ONCA 2PB1A 4JKMA 4HPJA 6PTDA 2OYMA 3OZOA 1EJRC 4KEUA 1WDQA 3P67A 4RKAA 3GXTA 2PLCA 1Q85A 2G96A 3UPWA 2CITA 3N14A 1GOXA 3JW7A 4QDWA 4K8EA 2JKAA 2R24A 4A3HA 5AC7A 3T0AA 4FI4A 3KM8A 2O7QA 3TZNA 3CUJA 5HOSA 1TJRA 2CLFA 4QDMA 2C0AA 3TJIA 3GH7A 3WIJA 2Z1WA 1XRFA 1WUEA 3RR4A 5FS8A 3PJXA 2UY4A 3WF4A 3P8JA 4H8VA 1EF2A 4G5DA 3HFYA 3HJEA 1GQIA 3CV1A 2C71A 3THDA 4NY2A 5HAOA 1V7YA 4C6DA 1GORA 4KPRA 4CVWA 1GPFA 4C6IA 2WPFA 4NNBA 5D9MA 1VR6A 1YTKA 4OBTA 4K39A 3GU2A 1KCLA 3INPA 3TVAA 2PC4A 2CHOA 3I7RA 4ZOBA 7REQA 3CB3A 3DC8A 3DENA 1HJQA 5AHEA 1KWGA 1NARA 5JH1A 3ZJ6A 4BI6A 2E40A 4TQTA 4B3LA 2J7GA 1FH9A 4WZHA 5TNVA 2OEJA 3W2JA 4F8XA 3WBEA 1O6IA 2VEMA 3GBEA 4LV9A 4BI7A 4HK7A 2VKZG 4I6VA 4UQAA 3N2CA 2ZICA 2VEGA 3HURA 5EA9A 1XYMA 2VX5A 4AF0A 1Q3NA 3LLDA 3JRKA 5KINA 3LSCA 4XK2A 3WDJA 3F4DA 2D0GA 3U7BA 2PC8A 1EJSC 1HKWA 2ANUA 2QVHA 3M0VA 4UOQA 3BLDA 3NEVA 1O60A 1HL2A 4QG6A 1RCQA 3G1AA 1F7BA 4H00A 5U1OA 3N73A 1KWKA 3SCTA 4XD4A 5M2FX 1E73M 4BV6A 1EA0A 1JCTA 3IJ9A 5TD4A 1QI2A 3WD0A 1HJWA 3OVPA 3PY2A 2FHCA 1UKSA 4E2OA 3M5ZA 3USZA 4P61A 1LF1A 3WLLA 4YVPA 1E5NA 3B4YA 2BHYA 5JU6A 1U1JA 1H61A 3BE7A 4IMDA 1A5BA 4DLFA 4R5EA 2E1DA 3CGTA 1DORA 4AQLA 1JPIA 1SFTA 3LK6A 4ATLA 1ONXA 2X16A 1QO5A 1Y5VA 4HA3A 3N15A 2ABBA 2QJHA 4HOZA 2NV9A 3SGUA 3ZVHB 3XINA 4WR3A 1ZJBA 1SO3A 3UJFA 1NDWA 3ZT5A 1GK8A 1JGIA 1NQ6A 3HV8A 2PWVA 1XYLA 1CZ1A 3L12A 4Z0SA 1UR8A 1DWIM 5HMDA 5FL0A 3S6OA 2L5HA 3GIQA 2OZTA 4P2VA 3TR9A 3BLFA 1JQXA 4JTLA 2CHRA 3L4XA 4J3UA 1JR1A 2HNEA 4XKMA 2EPOA 5EBKA 2GQWA 3W1PA 2BP1A 3AMLA 3TH6A 3TC3A 4MDOA 4HA0A 2Y62A 1WDDA 3RF9A 3RJYA 4AH7A 3NQGA 5FOOA 3JVAA 1Q6OA 3GTNA 3TCSA 1YE4A 4C7GA 2XG9A 2YCLA 1Z69A 3HM7A 3NEHA 1IWPA 4OV4A 3G0UA 3TW9A 3TSDA 3QMSA 3O06A 4HIBA 3MSDA 1XCWA 4GIEA 5ABFB 3ARXA 1QNSA 3IJ6A 2XIJA 5H6HA 3WUGA 1HIZA 3QLDA 2EGZA 3U9IA 3C56A 2OT1A 1HKMA 1UWTA 3MHFA 4JIPA 1GVEA 1BLIA 1XD0A 1ADSA 2NQHA 2R1KA 1DNCA 1LLZA 2C1GA 2C91A 3FXGA 4G6CA 3LMZA 3R2GA 2VTFA 4IFOA 3KBJA 4G7EB 1PDZA 3CYVA 5KEZA 3B0XA 1EPVA 1WOAA 2E8YA 4GFIA 4W87A 3H7VA 1DIOA 2R6OA 3PPCA 2PDKA 1H2IA 3H2AA 1VFSA 3EGJA 4GE8A 4RE4A 1ZDLA 2Y70A 3STEA 3W7IA 3F1QA 1GXFA 5BCAA 2YL5A 3GTIA 1TA3B 3N9RA 4INFA 4JTFA 4QSHA 1UJPA 1TELA 4XZBA 2CZDA 3G22A 2Y6ZA 4JX4A 3I4KA 4KWUA 5D8ZA 2VGFA 4TVUA 1H63A 2DQXA 3NZQA 1CGTA 2QCLA 3WLJA 4G56A 1IV8A 4W4QA 3CC1A 4PTNA 1XISA 4ZFCA 2ODOA 3HQNA 4MF4A 4XQ6A 4NUWA 4EOUA 5G2IA 2ZRYA 3ZYZA 2DZXA 1P43A 1ITQA 1X2GA 3SI9A 4N6FA 3W2NA 4K8GA 2XVLA 4L6DA 3A3HA 2A3BA 4TVDA 1W2PA 4XAFA 3U8GA 1S5VA 1S7MA 1H4PA 4WXYA 5EFFA 2P8BA 3DBPA 3USBA 4BWLA 3BLOA 2NQZA 2VRQA 2YW4A 5DELA 1LQ2A 1CI1A 2ZZ3A 1HGWA 1PCWA 1GONA 2O4QA 2NX3A 5F2MA 1B2YA 5CEWA 4JDRA 2GQ3A 4DF2A 3VIOA 1PTGA 3KVMA 1MVYA 1K4HA 2CETA 4PUUA 1AL8A 1CCWB 1H0IA 3TJLA 3H7UA 1GEQA 3PB2A 2G37A 4F3HA 1VB9A 3UERA 4IQEA 1VD6A 3WELA 4FOKA 5CZSA 2BVTA 3E2RA 1LLOA 3NWRA 4U3CA 4V15A 1TWWA 5BXSA 3D3FA 3RK8A 3GXPA 4WDXA 5I02A 3A4WA 1GOWA 1V5XA 1AW5A 3DG7A 3QPZA 1P7TB 5A6KA 4M51A 1XRTA 4XTDA 1YEYA 2QCDA 3I6RA 2Q71A 4RX0A 3UR5A 1AMYA 2PF8A 3TJXA 4ZO7A 2IW0A 5CSRA 4YPJA 1VJZA 1W3NA 2D0HA 1GQJA 3AIUA 1OC5A 3LEPA 1EL3A 4NYYA 2P1FA 4MY1A 1QI4A 3OO2A 4DWDA 1DYSA 4I5UA 4K7YA 2XTKA 4O53A 4OKDA 4Y2WA 4D72A 3DGRA 1ZY8A 3GRSA 3QYQA 1SFJA 1US0A 3NQ6A 2WOQA 2GJPA 3W70A 5C9ZA 4YHEA 5MKGA 2VCCA 5GRTA 2GOUA 3VOCA 1WNOA 4HK5A 2O56A 2WQPA 1WBHA 4R7WA 4W85A 2YIHA 1Q6QA 1G1YA 3HJZA 2EF9A 1HXJA 3GY1A 5C7VA 1FHLA 4GGBA 3E74A 1EC8A 3WMCA 1IT0A 2PWHA 4RDWA 5CC6A 1S38A 1UH3A 2PDQA 4PTVA 4X3ZA 4MNMA 4WJEA 5K2ZA 4LSBA 1EQCA 4V2XA 3OA3A 4FF5A 3ZSSA 3TLQA 3SRDA 4AUBA 3RFAA 5HMEA 3IIXA 3GXIA 4EX4A 1OCNA 3NQMA 4U3AA 4MB1A 1YMYA 4HPHA 1VKFA 3N6HA 5GVJA 4NEVA 4QBXA 3A7RA 4JAWA 4C6PA 2J6XA 1Q6FA 1BVZA 3BJFA 3PM6A 2YBVA 3LCHA 4MWAA 3E5PA 4F0SA 2OEKA 1F6YA 4XISA 3VX1A 3W7OA 2FVLA 2WSYA 3WQWA 1TV7A 4UNIA 4ZO6A 2XVPA 2ZXQA 3MVTA 4LY8A 4O4WA 2WLZA 1VYPX 4Q8OA 2B7PA 4DJDC 1CXKA 4CQDA 1HFBA 1X1NA 1TPEA 5A8MA 5GQBA 3MUAA 2Z2UA 5FS6A 1EWDA 3UBPC 1NHSA 4H4WA 5K9CA 3NPUA 1S5NA 3G1HA 3QW3A 4MLRA 1OGSA 3LGDA 1FH8A 2WO5A 2B7NA 2J7FA 2B7OA 2XYLA 4J3WA 3RLUA 2VENA 3W7JA 3OLEA 3PB0A 1W1PA 1Z32X 3THQA 4XO6A 3AWNA 1PO9A 1XCXA 4DNMA 1BF2A 4PB5A 3DU0A 1QNQA 2JK2A 1WZLA 3UD6A 5FEPA 3NJ3A 3REQA 1BF6A 3RLGA 2ZDSA 3R8GA 4JPGA 5I24A 1JDDA 5HNNA 2DZPA 2P76A 1KM5A 5AFDA 2QJGA 3MY9A 4AD1A 2GSHA 5BOFA 4Z1AA 4RZ6A 3UG8A 3M16A 2PZ0A 2DZBA 3SJNA 2WVTA 1OF6A 1I2QA 4PMUA 1QOPA 3E02A 2VWTA 1BVNP 2HVOA 3G8EA 3QR0A 1R2RA 1V93A 1GVFA 1EDTA 2GFTA 2ZWZA 3TYEA 3QPEA 4XVDA 1GYLA 1LT8A 3LHVA 1RD6A 4I7WA 4D2JA 5FIPA 1S2CA 3MPGA 2VZTA 4E38A 4LYPA 1GREA 1K6AA 4NNAA 5JBEA 2XFYA 1I2OA 1TSIA 4FP1A 4AD0A 1G4PA 1J4EA 5AY7A 4IIDA 2OTDA 3SECA 4O0ZA 4PC8A 4TV5A 2G3NA 3CHFA 4L4OA 3HOJA 3TYZA 1T0OA 1O1HA 2X99A 3BTNA 1AH0A 3WSUA 4IMAA 4FEZA 1XLHA 3BGGA 4EQSA 1AH4A 1C3FA 1WDRA 4MIMA 4H3DA 4UQ9A 2REQA 1FDYA 2VGIA 2ZUTA 5JUVA 1E9LA 3WJXA 3LADA 3OHMB 2WNNA 4KBXA 1CECA 5E09A 4NZFA 4A8IA 5KZMA 4FNUA 3EPNA 4OFCA 3Q37A 3AMCA 5C55A 5EMJA 2XVGA 3TJ4A 1FWBC 4HNCA 3LA4A 4YJ5A 3AHYA 3IRDA 3S9YA 2YXXA 4YMZA 2C3DA 3W7KA 1UWSA 1FVPA 3PZGA 3WO8A 2XWDA 3NQBA 1VZWA 2VEKA 4JIRA 4UTKA 3HGOA 3DDMA 3KL3A 3THCA 4JTHA 1KM3A 1Q65A 4NZ4A 4RUBA 3CUZA 3W01A 2XFFA 1S2UA 3DFNA 4FDCB 3VC6A 3DUGA 4ZOEA 3BC9A 5T9BG 1U33A 2J66A 1PVNA 3RIKA 4K68A 1IGSA 2HXTA 3UPBA 4GYPC 3U2CA 3ERPA 1I75A 3EF6A 3K1DA 1CGXA 2XGIA 1EUAA 1FWIC 1ZENA 3GUGA 4ML9A 4IX2A 4HCHA 2POZA 4EE9A 4P7RA 2VUNA 5M3WA 4X2PA 4DY1A 1H41A 3LGEA 4JL2A 1YNQA 2FZ9A 4RV3A 3FDKA 3UWQA 1ZHAA 3O9NA 2H90A 5F1UA 1FP8A 4IPPA 4JN8A 3TQVA 3ZFHA 1XH1A 3R4IA 1HKJA 2VC6A 3CUXA 4WSKA 4C1NA 3TOPA 3BSHA 1UKOA 2BXZA 5LGZA 1GG0A 5HJLA 4B4FA 2PDCA 4DJED 1GVQA 5AVNA 2EKGA 3AMKA 3LTSA 4R34A 1HL8A 3LLXA 1F3EA 4HSNA 2UZ9A 4YU1A 1XYFA 2NVKX 3CAVA 4YTRA 3LBOA 3LCIA 4L6HA 3GFZA 1JYWA 3R8RA 1GWJA 1CNVA 3K8LA 3CZ8A 3PP7A 4AHPA 4HMDA 2SFPA 2W0UA 2ZCGA 3FVDA 3VIJA 2DW7A 2E8ZA 2GYIA 4CEUC 1E6QM 4JHOA 1AQ0A 2DUAA 3OVGA 2YR1A 1HZYA 4DJDD 1FEBA 4MKSA 1W32A 2VJXA 5BWFA 1PEZA 3G5EA 3ABRA 1DJNA 2X1UA 2JEPA 3LV6A 2R91A 1HKIA 1OC6A 4PYSA 2DIKA 3GLCA 3MKKA 4NZ5A 3DI1A 3RG6A 5CH9A 4QRNA 1OX4B 1Q1RA 1VC4A 4O50A 3ZOAA 1UWUA 3MP5A 3A21A 2XVKA 2W55A 4GYFA 1XANA 1XYAA 3PSWA 3RPDA 3FG2P 3LHTA 1N2VA 2C13A 1QHZA 5FAGA 2TYSA 1L9WA 1NWUA 2ZE3A 4Q4KA 4GA8A 4EQXA 3WLNA 4AZCB 1J93A 1EB3A 1I1XA 6A3HA 3VOHA 3T44A 3LQGA 1SZRA 3KP0A 1C29A 3TYDA 3V5FA 1LTDA 4GJIA 4X60A 4TV6A 2DW6A 3HGSA 2HPIA 4XSMA 3EWBX 3CQHA 2C1IA 4O13A 3UETA 4DI9A 4LUSB 2ONEA 4ONVA 2OO0A 3R13A 1SM9A 3SCWA 3URAA 2MNRA 4MUPA 2WKGA 1UR9A 3CS2A 3WQ5A 4WKAA 3VGBA 3F5JA 2XM1A 1E1EA 1MQRA 1OD8A 3AIQA 3CASA 3C52A 3UXAA 3IAQA 3W29A 4WY0F 2Y89A 3O15A 4JICA 5DEZA 3SRHA 1GVYA 3VOIA 2Q8ZA 4UOZA 6ALDA 2V5JA 3T2PA 2HWGA 3IIPA 1GKRA 5CJ5A 1K9TA 3VXGA 3APGA 1CENA 3W85A 4DXXA 4IOTA 3AHXA 5DBUA 4GLEA 3VA8A 1VPYA 4YWIA 4GACA 4CN6A 1AQFA 4ZODA 4DBWA 2ZX8A 3O6DA 4GYJA 1HX0A 1DV7A 4GINA 1LWIA 1TWZA 3IWPA 1W56A 1DVJA 2ZTKA 4LBUA 2OXNA 2VVNA 1CPUA 3EB2A 3YPIA 3MU7A 3PZ9A 5CZTA 5FF2A 1W9PA 4I90A 2XH0A 3M0JA 1EZ2A 3OHIA 4HHLA 4JIHA 4OJYA 4CQAA 3MW7A 2I16A 4HHPA 1A53A 3T09A 3NDOA 2YB4A 2A4AA 3B8UA 1S2TA 3FJNA 4KRZA 1WKDA 3W6MA 2R8WA 3B0YA 1QW8A 1US2A 3BG9A 2EPLX 2AQOA 1KV8A 4QE1A 3DG6A 2ICSA 2V5KA 3N2MA 2E1WA 2YL9A 3VD4A 4NAEA 3UG5A 4ECLA 3KZPA 1QXLA 3AS0A 1DHKA 3WK1A 2QJNA 3WL1A 1EGVA 3TW7A 3O0KA 4P7OA 1VP5A 2HDJA 3QOKA 1FFUC 1JNEA 1FWGC 2BY1A 2GPTA 4QE4A 3UNTA 1AQMA 4PRRA 1W9UA 4DO5A 2ZZ2A 2B7QA 3EA2A 3BCDA 3BH4A 1ZCCA 2VMFA 2YB1A 2NQ9A 1B3VA 3DFSA 1N5WC 2BY2A 2OWCA 3KDOA 1K1DA 3TONA 1UKQA 3HTWA 1Z41A 3MBDA 4QITA 4DJEA 3CXOA 3H53A 4Q3MA 4EMWA 3NS1B 4H4XA 4GUHA 5GJMA 2QJJA 6XIMA 4F2BA 1OF8A 1Q13A 2J27A 2ZOXA 2XIOA 4C91A 3ZJKA 1KD0A 4JY9A 3VPLA 3M5XA 2XSAA 3W7NA 1F6KA 4JIIX 2E9MA 6TIMA 2A2IA 2E5BA 1ZMCA 4V33A 3RM8A 3IARA 3BOXA 4H2CA 4Y9NA 4C1KA 1NELA 3T1GA 5G5IA 1F8IA 4HTYA 2PSNA 4LTSA 5BU9A 5HDRA 3UNDA 1T99A 2P88A 3UZXA 5XINA 3LPPA 2OELA 1JVNA 2NSXA 3RU8X 3R0DA 2YDRA 1D3CA 3HFTA 3SCNA 2HE5A 3SCPA 1BPLB 4AHOA 3L4TA 3VE9A 1Z89A 3A9IA 5KITA 2Z1BA 2CCRA 5FJJA 4NJHA 2AOSA 2WHJA 4Y8EA 1XLFA 1XLDA 3VZYA 4IFKB 4H83A 5D4YA 3C3NA 3OYZA 1RBAA 5K9DA 3GNRA 3LHUA 3TWBA 4LRSA 1XGZA 3OBAA 3MBFA 3LERA 4PFMA 4ORMA 2WAGA 3S1XA 3WD4A 1KTCA 1W5OA 4X0NA 3IGHX 1SGJA 3AIBA 3WBAA 5LZLA 1FCBA 1J6OA 1V3KA 3DGBA 4K8DA 3I10A 3II4A 4Q4QA 2E77A 3H26A 1KFEA 4H6QA 3I68A 1HF6A 4Q8TA 2TAAA 5EMUA 3BVJA 3NIYA 1TRIA 3ONBA 3G1XA 4GQQA 1QT1A 1L2UA 2TRSA 3A64A 1MRQA 3FEQA 4DHGA 3HPZA 3CZGA 2WQDA 3ZT6A 2AL2A 5KZDA 1R3VA 1EJ7L 1Q7QA 1K8CA 4ZENA 4CQCA 1GG1A 4RK8A 1RQEA 1RJPA 5E9XA 4R7OA 1R6WA 4IJRA 5TAOA 4L4PA 3PBMA 3LUTA 5BU6A 1W8SA 2ZZ5A 3M4HA 3CQJA 1LBMA 4F9DA 1XLEA 1MW3A 4IIHA 1FCVA 4ZE5A 1POKA 5DF0A 3VDCA 4UQCA 3LDVA 4GI4A 1XIJA 1VPQA 3W02A 5J5DA 3AMDA 1N8WA 3OG2A 3PUEA 3CBWA 1P6BA 4HU4A 3FAXA 2IQ0A 4A3YA 1EO5A 5EGRA 3AJXA 2A3AA 2HV5A 4S3BA 4ZB0A 3DN5A 2X1IA 2FGBA 3QHOA 4E2VA 3MKVA 3SM0A 4IIBA 4W7WA 3B40A 4YTTA 5H1WA 4NRRA 4J57A 3ITCA 3P81A 3M5YA 4UCFA 3SQSA 4UTTA 1Z42A 2NUYA 4H9YA 1ECEA 1SYTA 3H12A 4LB4A 4Q6XA 1RJQA 2CPUA 2VZSA 4TMCA 2ZQ0A 2FVKA 1QFEA 3CV6A 3HW2A 2GSJA 4IGNA 1BTMA 2QCFA 4PEEA 2PU1A 1BEUA 4LX4A 4FF7A 3M7WA 1WB0A 4FOJA 4UTFA 3CIVA 1XYZA 3NZGA 2VL4A 3ARPA 3VU2A 1XBVA 4EXAA 4RZBA 4Q8MA 1D2KA 1J0JA 5EBUA 2BDQA 1PBGA 4RV8A 2EQ8A 3UESA 1VCVA 1XPYA 5I77A 4J5NA 3M0ZA 1UPPA 4XO7A 3WZ0E 4LS1A 3OYXA 1V02A 2PPGA 3RM4A 2F38A 1H7OA 1E9YB 1S1PA 3CMFA 4ZOHB 3I6TA 1FWWA 4J35A 1Q4WA 5U4NA 2DJLA 3DYMA 1IGWA 1LUCB 5DMYA 3MTWA 4PBGA 1KNWA 4F79A 4O54A 2UY3A 4H6RA 4W8AA 4JFSA 4BQ5A 1G67A 3W7LA 4IQLA 3GWQA 1UZ1A 1KGXA 3PVFA 3PTQA 1OIMA 3V36A 1MYRA 4NL1A 1OGGA 2DIJA 1GV4A 1WDSA 3NVYB 8RUCA 4XKYB 4DZIA 4D8LA 2PWFA 3SDOA 2E9LA 2XJ7A 3WMBA 1W5QA 1WYIA 2WBGA 4YS1A 4XX6A 5G4EA 4ZO8A 5D2VA 2FDMA 3TROA 3U4AA 4TXEA 3G2GA 3ABSA 1KFLA 2FZMA 1E9IA 2J79A 1H3GA 2ZUVA 4AZIA 3L4VA 1E0UA 1YE6A 2VRJA 3ZVHA 3SB0A 4M6QA 1EBDA 3L9CA 1ME8A 2D2JA 3FLUA 3UJRA 5I6SA 1VEPA 4TO8A 1UKTA 2NT0A 3CB8A 5IFPA 1TV8A 1BD0A 4JQ3A 4A2RA 4O0QA 3L2LA 3OB8A 5BXRA 4GI9A 2X42A 1IZKA 4GXWA 2V3FA 4KIRA 2C0HA 4FS9A 3ZS4A 3ZJ8A 1JZ5A 1ZBKA 2YBTA 3OLGA 5A6JA 3RU6A 3WLSA 1Q6RA 2IS7A 4US6A 1JCYA 4ZCWA 3OA5A 4AHQA 2J77A 2Z2AA 1FWAC 1F73A 4JDYA 1W1A1 4K3ZA 3IGSA 2WP6A 4IG2B 3MVIA 1IEQA 4OVXA 4A8RA 4HVXA 2E25A 1Y0EA 4I5XA 4OBSA 1GYNA 3PAJA 1Z3NA 1OX6A 1JPMA 1K4QA 3G18A 4MSSA 4HU8A 3RM9A 1YIXA 3VGHA 3A5VA 4FK9A 4RE3A 2BODX 1SU5A 2HSAA 5F1VA 1QRQA 2AMGA 4LEFA 1UR1A 1Z7AA 3GVWA 5REQB 3WK0A 4EPEC 2INZA 2ZUWA 1N7KA 1UJQA 3TDFA 4ICNA 2HS8A 3DGHA 4JHZA 5HNTA 3GNXA 1BXCA 2FJUB 3MANA 3I7QA 1ICPA 2F61A 5ABFA 2WMIB 1DJGA 1H50A 2PTYA 4QLJA 4EM3A 3GUWA 4B9YA 5HK4A 3L4UA 1ONWA 1YNPA 3MP4A 2QDEA 4DPPA 1E9ZB 2PBOA 1M9HA 5GNXA 3SCQA 4M80A 4NX0A 5M5DA 1T40A 2PDNA 3FYYA 1E0WA 3AROA 2QMKA 3HZ3A 2JBMA 1UMYA 4AB4A 2WBKA 1RY8A 5HR7A 3B03A 3NM1A 4GC3A 2KX9A 4JYFA 3PTMA 3QVQA 3TXZA 4O1BA 3DJJA 2R82A 2VXNA 4H6KA 4IFRA 4L80A 4MMWA 4UXDA 3WQVA 1TA3A 2R14A 1TWDA 3AIVA 1W1YA 1OFRA 1EGMA 3CK5A 2QDDA 2QDGA 5CCZA 3CMJA 2W3ZA 3PZQA 2WSRA 3KTXA 1HJUA 3VO0A 3FN9A 1OFAA 3FKKA 1TPWA 3PN8A 5LKYA 4RLIA 3LTYA 4G8TA 4JIQA 1PWMA 2BOEX 4BK9A 4KEMA 1UC5A 3G1VA 1B3OA 4H2HA 2C8NA 2OLAA 4RW5A 3TYCA 1A5SA 2WHKA 1XFBA 3BAJA 3MO4A 2XVNA 1DQWA 3ZM8A 4J40A 4K8HA 3WF2A 2QCMA 4C7DA 4HPGA 2OFJA 4FSAA 4JFUA 3LCFA 4M3PA 1Y5WA 1FUYA 1OY0A 3ANYA 4C6BA 5A94A 2G97A 3SZ8A 1GRFA 3RXZA 3RGTA 1REQB 3BLLA 2X2GA 1CLXA 3ATYA 4DN1A 4MB4A 1XLKA 1TVPA 1RQHA 3WQ8A 5F4XA 1TRDA 4GVIA 4W7UA 2E67A 1M5WA 1KRBC 1XR2A 3W2MA 3AZTA 1VIWA 3W84A 1I9CB 3TC7A 5C2GA 4WY0A 1JFHA 1ZY9A 3APTA 2ZRVA 1P7TA 1MZRA 1PZ2A 5D2XA 1CWYA 1VGAA 2YXOA 3ARQA 4PTWA 1IXOA 2QHAA 1H49A 1AJ2A 3EKZA 3LLFA 3MMWA 4ES4A 3S1UA 4HJWA 3M0YA 1KRAC 4MKVA 1FBAA 4O10A 2Y0FA 3LTPA 4HOWA 1WAUA 3Q67A 4XIMA 4GXPA 5DT5A 4U2ZA 3WCZA 6TAAA 1X7FA 1HVQA 3AI0A 1GVRA 2EPNA 4EPBC 4YWSA 4EMJA 1S3TC 2ZXBA 2RJGA 3A3XA 3AIRA 3DOPA 4HYWA 3M5VA 1LZOA 3OIXA 3MHGA 4WCJA 2CFFA 4M81A 4KCTA 3B0PA 3CAKA 4CD5A 3NZ1A 3H4WA 3BMXA 2PUZA 1WE5A 1JFXA 4R7JA 4KESA 1QATA 3KVKA 4LUJA 2BX7A 1LPFA 1EC9A 3IJIA 3L2IA 4LIIA 1J0ZA 2OPJA 3C2FA 3SN1A 4H8HA 3T4CA 1F74A 3DESA 3VIHA 3Q2DA 1FA2A 4JS3A 4RDVA 3CT7A 3GG1A 4UTWA 4LS0A 2V3AA 1C8XA 1EC7A 5FA5A 4B2DA 2OLHA 4MNJA 4DF1A 4GNVA 5H2ZA 2VRKA 1Z9AA 2VFHA 1RHCA 4CU6A 1ITXA 3W9ZA 4F2TA 2A21A 4LUTA 1XLCA 1KR0A 4RL3A 3R8HA 5FJRA 4NKCA 2EEXA 4WXZA 3GU9A 3NDYA 5AYYA 5HQEA 2E7FA 2YKKA 1L2QA 1A5MC 4ZMGA 3CGEA 1K8XA 4K1GA 3WNNA 3QC3A 2IXVA 1MMFA 1KXVA 5A3HA 4JEQA 1L8NA 1JCLA 4KKXA 1XDMA 3EPMA 2XN0A 5U25A 3H8AA 3VOFA 2YCIX 3LYEA 2F5ZA 1ZLPA 2CWXA 4IL2A 3EWDA 3ABZA 1VHNA 4D6EA 1ME7A 2PDHA 3TA9A 1VFMA 2YL6A 3N2XA 1RPKA 2D2OA 3GC4A 5AC4A 1YDVA 2HISA 2PWUA 3MDWA 3JUGA 4QGCA 4E8CA 5CPNA 1PKMA 4J27A 2ZIDA 1F3TA 1ZUAX 2WMHA 4J3ZA 1N60C 4AVFA 3W1RA 3RHGA 2DVUA 2ZVIA 3OW1A 3ORWA 1OBAA 1NAL1 3N3MA 4X22A 4KWSA 3VFLA 1L0PA 2WSQA 1ZAIA 3RCMA 4CN1A 2OZ3A 1XRSA 1VFTA 2E5DA 4DWSB 1NFBA 1A5AA 1B90A 2CEQA 3ABQA 1ZMDA 5JCIA 1FP9A 1A4LA 3FSUA 3SJ3A 2DV0A 4C5YA 1A5CA 3T78A 1JZ3A 2D24A 2FGLA 3WL0A 3CO8A 4AWSA 1QK0A 3VKKA 2DZUA 4UOJA 1HJXA 2VCAA 1KV5A 5K7JA 2NLIA 1UBPC 1ZPTA 4AEOA 1MEIA 3NVWB 4JNYA 1MDRA 1UWQA 3QH2A 3KE0A 4AWUA 3M44A 4QQUA 1E51A 2EG8A 1XHCA 2WZMA 3DAQA 2DT3A 3EEGA 3CZKA 2XH2A 1JGMA 3EDFA 3QKEA 5IBXA 4GR1A 2D22A 1W9BM 2E6AA 3PJTA 4EAMA 5JCKA 2IQDA 3COTA 3GRIA 4X9SA 3L5MA 5EU9A 1JAEA 5C2CA 4AZ5A 1R30A 3RCNA 3F4WA 1VIZA 5L9FA 4XZHA 2VWSA 4C6EA 1SZGA 1WBJA 4Z1CA 3S5SA 3QV9A 1RR2A 4KH2A 1V3LA 3EKLA 1KGUA 4NX5A 1GOIA 1CTNA 2X05A 1PZ3A 1TPB1 4IGHA 2NXHA 1TB3A 5BYWA 1ZBWA 4FNQA 1W3JA 1CXFA 5DXXA 4MNLA 4Z1DA 1UPMB 2PD5A 2NT1A 3WLMA 3BW2A 3VCRA 4S1FA 3LB8A 2EQ7A 3K1GA 4QEEA 4ERGA 5TBOA 2WJFA 3CQKA 4IGSA 4Q33A 4OU1A 2PWGA 3VD7A 2V2DA 4A05A 4O14A 4GI8A 5TQLA 4ATWA 4FMVA 2PAJA 5GJNA 1H60A 3L5OA 4JEJA 1L6SA 4IUOA 1P0NA 2NUWA 2J62A 2YDSA 4C7FA 3JR2A 3W75A 8XIMA 1MEWA 1EDQA 4ZZ9A 4PMNA 4FNTA 3LNPA 4FALA 1R9ZA 1UQZA 4DLMA 1EGZA 2RGLA 2H9AA 2P10A 4H4UA 1C8VA 2F6KA 4DJFC 2DZSA 2DH3A 1R3RA 1CBGA 1UQYA 1IEVA 5A2CA 3B8TA 4KRTA 2FZNA 3WG6A 3WF3A 4FNSA 3AM9A 3JU2A 1KBLA 3FJLA 3QOMA 2IKGA 3BLIA 4FZIA 1XUUA 2YLLA 3KRZA 4ZSUA 3VGEA 2PDPA 5FS7A 4TMBA 5DCEA 2C1HA 2YGYA 4QE5A 1I0BA 3OGSA 4KERA 1OT2A 4O19A 1Q66A 3C0JA 4HPNA 4MZ8A 2GUBA 2YA2A 4LCRA 3AFBA 3B9DA 2FIQA 3GNDA 2WM1A 4E2DA 4CKQA 3PG8A 4TVYA 2JALA 2QPSA 4IIFA 1G7VA 1N8FA 5DANA 2IPWA 4QJ4B 2Z7KA 1PWLA 1XF0A 3WJYA 1KN0A 3N25A 1HT6A 3E9AA 4U4MA 1WZKA 2PEVA 3QR3A 3WQ6A 2OO6A 1R3YA 1E4IA 1G4SA 1XIFA 3SURA 3UXDA 3W25A 1G4EA 1SW3A 4ASTA 2XGZA 1HKKA 2Y7GA 3VIGA 5A8QA 1OM0A 3CAQA 1F5ZA 3EXTA 2WHLA 1TX0A 2W3RA 3D6NA 3CGDA 5BNKA 3V5CA 1PE1A 1Q6CA 4CGTA 3LU2A 4LYKA 5G2WA 4O1FA 4AZHA 3CH0A 3WQFA 1C7SA 4IXHA 1ZZMA 4LQ1A 4H4TA 5HANA 3B8IA 3MZNA 2XIBA 5E5CA 3AN1A 3NM3A 1IWBA 1AD4A 1QBBA 6CGTA 3ZZ1A 2ZA2A 4PCNA 3CM4A 3TA6A 4FNPA 2YFNA 3B05A 1XSIA 3TZFA 3VKCA 1JL8A 4GBDA 3PTDA 5D32A 3F5KA 1XICA 1OX4A 4E4PA 2YZ5A 2A85A 3A6OA 4N2YA 2XIMA 3OLIA 2DSZA 2GVYA 1FDZA 2DVTA 2Z24A 2NQLA 3RDKA 1RH9A 4AXKA 1FHUA 2O9RA 1A3XA 5C54A 4JQ9A 3IUDA 1JJKA 3KP1A 5EMMA 3UP8A 4G9PA 5H91A 1JCNA 1ONFA 2POTA 4NI3A 1JPDX 4XZMX 2FVMA 4D6IA 3EAOA 1C9WA 4AZCA 1W3IA 4YVXA 1UOZA 1FFVC 1H2JA 4Q32A 3OVQA 4GZ7A 1IEWA 3R0KA 4FR1A 2QUMA 5E0FA 3P2VA 4OUIA 2PP3A 2GWGA 2B81A 1EJVC 4BJHA 3ARYA 2QMJA 5D30A 5LHEA 3W2KA 4NQ1A 1KBKA 5ABHA 3ETRB 3PBVA 3UR8A 1XDLA 1M6JA 4AEEA 3B9AA 2HVNA 1J9YA 5LIYX 1Z6KA 3N4EA 1V6UA 4LUSA 3SN4A 2X0YA 2CESA 3SY5A 4HYVA 2OG9A 2F2KA 5FACA 1KQZA 3P93A 1OSEA 4Z42C 2PDMA 2C7FA 3WF0A 1UWIA 1J79A 2EPMX 4D71A 4KF1A 1KW1A 7TAAA 1VBUA 4U5IA 1EHAA 4Y9OA 3PZVA 2VC5A 1KO0A 4TTGA 4NZJA 3IS4A 2W6RA 4U5KA 4KRUA 3PULA 5G5HB 2BS9A 1FXQA 1UASA 6REQA 2D3LA 2DH2A 5XIAA 4AISA 3RPTA 4OECA 1BYBA 3WFLA 1DE5A 1PJ9A 1RCOB 1BGAA 3NVZB 5AYZA 4EK7A 4MYAA 2ZDRA 1KM6A 2UY2A 2XZ9A 4JIEA 3W1XA 4A8NA 5F7UA 1IIGA 1AJ0A 4C6QA 2YL8A 1A5UA 1GOKA 3EWUA 5CPMA 1DWGM 3T9PA 3KCLA 3NO5A 1GT8A 2V82A 3W7PA 3TQPA 3MJYA 3IK2A 2OZ0A 5AHMA 2OOGA 3SUSA 2QKFA 2O9TA 3F4VA 2RAGA 4WD0A 5CZJA 2J25A 2PTXA 2WC7A 1Z48A 2FJKA 4KWWA 4PUWA 3WEMA 1NFPA 1P48A 3SQPA 3H70A 2NQ5A 2HPMA 5KETA 5DX7A 1W2VA 3BG5A 5DRCA 2BBFA 3E2SA 4JTCA 2TSYA 4EACA 1P4CA 4H6EA 1JD7A 1LL7A 2WHMA 5TF0A 3R94A 1WKFA 2WXDM 2P50A 1X6NA 5AZ1A 2WPGA 2PGWA 4GIYA 4FIQA 3KVLA 2QQ6A 4ML4A 1FEAA 3U2EA 4AMAA 2RGMA 1UZ4A 3ABXA 4BQ3A 3S1GA 5M1TA 4P7NA 1MOKA 4CD6A 2ZZ0A 2GWNA 4HZ6A 1B54A 4PMRA 2Y4SA 2BSLA 1GERA 1K7XA 1OYBA 3F5LA 2J3NA 2DT1A 1ADOA 3SCSA 1BG4A 1KR1A 1JI2A 4WK9A 1V0LA 1Q2RA 5B80A 3V16A 3WLTA 1IR1A 2BXYA 1XINA 3G1YA 4ICCX 3UXLA 4WDUA 4M6VA 1IWAA 4AYGA 3CJPA 2F2HA 3OEXA 1O5XA 5CC3A 1AMKA 1X97A 3AIEA 5G4HC 1ZK7A 3MHUA 3EDEA 5IDIA 3V0SA 4XAGA 1BXBA 4CQBA 7XIMA 1R2TA 4B3KA 2F9RA 3WJZA 1IXQA 2HK0A 2AQWA 3FYPA 1ESWA 1S3HA 1LP6A 3BW3A 4EIVA 4L61A 2BVDA 1D7KA 1UUOA 4M19A 4I9JA 4BY3A 4QSFA 3N9KA 3NDZA 1MEHA 4QLKA 1AW1A 4P8XA 3FDGA 2FDSA 1K70A 5FMHA 2QT3A 1NDVA 4M5PA 2QS8A 2X40A 4LPCA 3MCNA 2V5DA 4AZ7A 4F0MA 4W5UA 1UKPA 3S1WA 4HNTA 1FWFC 4RNHA 3PFMA 2INEA 4IMCA 4MFDA 3MMDA 4O57A 4YXGA 3H22A 1DJZA 4AXNA 1XLGA 3QJAA 5EKYA 1JDFA 4HN8A 1I60A 3TOYA 3HQOA 5LNUA 1G94A 5JH2A 1ZXIC 3NYZA 3GC2A 1ZKQA 4ZQPA 3VGGA 2G41A 2GZXA 2GRTA 3W0KA 1ISXA 3VD5A 1B9BA 3AHZA 1F61A 2ZZCA 2VDIA 3EX4A 1YXDA 4C65A 3CO4A 4BWLC 4QCFA 1E71M 1NIUA 2QV5A 3KRBA 2J75A 5DFAA 1EH9A 5A2AA 4RNIA 1S2AA 4V28A 4R33A 2WKLA 4Q8UA 4KQNA 2WVSA 5XIMA 3H23A 1TV3A 1EF3A 2XPKA 2WKJA 1T3QC 2EQDA 2HE8A 4HCLA 3IJLA 4GH3A 1E1CA 4PMXA 1DXFA 2OR2A 4OQVA 5DY2A 3ZXWA 1GRBA 3PSVA 2D73A 4CUCA 5AN7A 5CPTA 1TV2A 4NZ3A 4PULA 1QW9A 4LA1A 3WDRA 4XZ9A 3B0VC 3W2LA 1EA9C 1TCMA 4OOUA 4GRTA 4C6NA 2Y8KA 2GH5A 7REQB 1A5KC 1CGVA 2WNQA 2CLIA 4OT7A 4ROPA 2VHLA 3NAVA 1V3HA 1W31A 2ZRUA 3M07A 3II1A 5J8LA 3CUIA 5KSWA 3N3TA 2W63A 4DAFA 2XSXA 4QS6A 4Z2LA 3OG3A 2FZDA 2VD9A 4P5UA 3S2JA 1I1WA 3UZWA 3T0BA 2QPUA 5I3IA 1OJXA 4QX4A 4IISA 3L4YA 1A0EA 4ICMA 1KFBA 3UT0A 4AD5A 2CERA 1TYGA 3VVGA 1BSIA 4DXVA 5A1AA 3G1RA 3WLQA 1TWSA 2JKPA 3GDTA 7ODCA 1DJYA 2D3NA 3W87A 3U5UA 1QNOA 3VABA 3R5EA 3VIMA 4AWEA 1R87A 3UZ5A 1XGDA 4GFSA 4ZL1A 2YYUA 4UMCA 1L6WA 3GXFA 3H4KA 4TIMA 2FMOA 2XFRA 2IUZA 3L67A 4RE2A 1OFDA 4HZMA 3AYVA 2WPCA 2BZNA 3M7SA 1TTPA 4NZ1A 5F2IA 4LB3A 5BOOA 1N62C 5CLTA 1SMAA 2JEQA 1X38A 2H3DA 3KS5A 3L66A 1I2PA 1W9XA 1JXKA 5G1YA 1GNXA 2A7PA 2G3JA 4U33A 2PA6A 2R1MA 4V1XA 4AZ6A 3RMEA 2Q8XA 3NYDA 2CDUA 1I4NA 2DQWA 1OFPA 5H8PA 2V3DA 3NOYA 4O52A 4KT2A 3AIWA 1MXDA 5HR6A 1B9ZA 3QHNA 4IMFA 3A9BA 1QDSA 1J6PA 4HGXA 2QUVA 4FLOA 1PV8A 3D9XA 1FECA 1YQZA 2J47A 3OOQA 4MWAC 2GJXB 1LUCA 3TXVA 1Z8AA 4BEQA 3P84A 3VIPA 4PGLA 1R47A 3AYRA 1NDAA 4XUYA 4FA3A 2Q6ZA 3P82A 5JIWA 1AQHA 5E70A 3HRDC 2PCQA 1IIHA 4F48A 4PR4A 3DH9A 2GVEA 1AVAA 4M24A 3WY1A 4I9AA 4IPNB 2GVGA 4GCAA 4AVNA 3PNUA 1FY6A 3H7RA 4PODA 4S2BA 2Y7DA 4G7FA 1NDZA 1TIWA 4KMQA 1ZB5A 1VBRA 1LORA 1F6PA 3RX2A 2YVGA 3N2TA 1OFQA 3MI6A 1ISVA 2CWNA 4TOQA 1FQ0A 4K6AA 1I2NA 1N63C 4NF7A 2FFIA 1GGOA 4ATDA 3VNDA 3S5OA 3R79A 4WJXA 1Q4NX 3ITGA 3LI0A 4GD0A 2QIWA 3KDNA 1SR9A 1BWCA 3N29A 4JYDA 1KM2A 1C8QA 1R9XA 1NHPA 1HO4A 2E28A 3ABOA 3OQEA 2VX7A 3L0KA 3KFTA 3ALFA 3NFUA 5G4WA 1BTCA 1THFD 3LQLA 1J11A 1JEZA 3QM3A 3WMLA 3OP2A 4IG2A 4JTAA 3NRZB 1LJYA 4Q4SA 2DSWA 2RJHA 2PBGA 1O5KA 3PR2A 1XC6A 4I8DA 1CXIA 2GL5A 1J0HA 1WPCA 4GVHA 3MUZ1 3EEZA 3OZYA 2GJRA 4ZOAA 1GRAA 3WLIA 3F03K 3DK9A 2DSKA 1CGWA 5REQA 1XPGA 2EBNA 4O1AA 3TKFA 1Q1WA 1DHPA 4PH6A 3TAKA 1M04A 2WOVA 4AD4A 1TPH1 1FHVA 1DPMA 3D5HA 3QF0A 3N34A 3POHA 3ALGA 1E4NA 3S2CA 3MKCA 2OODA 5F2LA 1ZS2A 2QGHA 6ENLA 2WMIA 4DO6A 1V0KA 4RJEA 5ECVA 3CHDA 4GABA 1EP2A 3E12A 5I23A 5C70A 3EMCA 3S42A 4P8VA 2Y63A 3T0DA 1RPXA 2I5GA 3C8NA 4G1KA 4ERIA 4XSLA 4UFKA 4QCEA 2QCGA 1MZHA 1E6SM 4ZXLA 3KEHA 2BLEA 3CLWA 2ISFA 2P0IA 2QNEA 5EB8A 3T05A 2R1LA 5AVHA 3W1TA 2X8HA 4PMVA 5FJOA 5FSDC 3UWWA 2FQIA 4JHMA 2QCEA 2ACQA 1U2YA 5K4XA 5C71A 1EX1A 3WKZA 3F2DA 3S5NA 1E1FA 3GVRA 4JFWA 4Q8QA 2PLMA 3O6AA 3PJWA 3ITXA 4C6LA 4GQGA 1QJWA 2Z00A 1GRGA 2DT2A 3V35A 1RLCL 1FWDC 4K1WA 1UR4A 3HQ1A 3BPWA 2NXIA 4DWSD 4M7TA 5HWNA 1ZAHA 2OX4A 3W22A 2Y5SA 1J8VA 3AMZA 4JQ4A 5B7ZA 7ENLA 1LROA 4D6GA 5HXMA 3N6QA 5KZ6A 3IVUA 3N04A 3M43A 4LS2A 2P8CA 1QHPA 5FKYA 3IV8A 2YA0A 3H4XA 3VUSA 4BR1A 4Y9PA 3WYZA 2WCSA 1RK6A 1S46A 2JQXA 4ACZA 2QCDB 4LW7A 2PE4A 4LVBA 1JZ2A 4X9YA 4MWAE 4QAIA 1B31A 5D09A 2Y7FA 4JD4A 1GZ1A 5JRBA 4AX7A 2VQUA 1EYWA 3IGUA 4HZ8A 1ODUA 4DBDA 4WJ8A 3AXKA 4S39A 2X30A 3M1ZA 1TG7A 3Q6JA 3M0MA 1UP3A 1B4EA 1R3WA 4GISA 1TV5A 1YTEA 3LPGA 4PB4A 1XS2A 1H62A 3GVVA 5FF7A 5FJIA 3CXBA 5BWAA 2XN1A 1VRDA 4H8UA 1UR2A 3QQWA 1CB2A 1V7AA 5T91A 4JFVA 1PUDA 1XYCA 3TWAA 3B8SA 2X41A 3IIOA 4LVGA 2V68A 4C6KA 4HJFA 4DM1A 5E0KA 4MWAD 3T42A 1X1OA 4H4ZA 1BYDA 4QJ5B 4FLQA 3MQTA 5AYIA 3L5AA 2ZRZA 4I9MA 3C86A 5D2WA 1IEXA 3ID7A 4RDZA 4H9MA 5KTLA 2CLOA 3W74A 3BAWA 3K2GA 4KS0A 1RAKA 3K4AA 3M64A 3ZT7A 1UWAA 1DJHA 2CXGA 3IEBA 4HN4A 5GJPA 2E0PA 3GIPA 4A8LA 1OG0A 2E5CA 1NPXA 1T7LA 3AJ7A 2VFFA 3N4AA 2HRWA 2V67A 3QQ1A 4KEVA 3QZAA 1SW7A 1SFLA 3NL3A 1OJTA 3F2CA 3R58A 4HNUA 1OG6A 4GVGA 4UTMA 3L7RA 1XSJA 2V30A 3NSXA 1AD1A 3OODA 1BWLA 3BJSA 4GUGA 1GEUA 1E3ZA 1MNSA 4PZVA 4GZEA 3S4TA 2CBJA 5MHBA 4GY1A 1JAKA 3PPFA 1V79A 3KS6A 3PS7A 4TX8A 3VOGA 3NVVB 2Y5JA 3NG3A 3NUKA 3WLHA 4WDTA 1V59A 3W27A 2TPRA 3D47A 5AC8A 3F4CA 4MKNA 5A69A 2B4GA 1UCWA 2W62A 1TCDA 2NXGA 1YPIA 3T2QA 3H2FA 5JCMA 1XBXA 3VINA 1JIBA 3R89A 3TAOA 2CLMA 3WEOA 4PTMA 3IJ7A 4Q8WA 1WOBA 1WKEA 2C79A 4W7VA 4XD6A 1JRBA 5HWMA 1QU4A 1XLAA 5FJPA 2ADAA 3LRKA 1QW7A 3K30A 1G69A 3A4JA 3CAWA 1RD5A 2YCEA 4RR4A 1JPHA 1DIKA 3HGRA 2XUCA 1F76A 3EOUA 4M56A 1XIGA 2WMFA 2NVCA 1XIDA 3FIGA 1AZ1A 4GQRA 1NF0A 4C6JA 2WVVA 3QGAC 3RCYA 4MJ2A 4E5TA 2F8QA 4YHGA 3O6CA 1OK6A 3LM3A 3ITTA 2QW5A 4YTSA 4PB3A 3KOZA 4Y7EA 2ZUUA 3REQB 4WOZA 5BRQA 1XDIA 5I00A 1P6WA 1W3LA 5CZ0A 3PTKA 3AXXA 4RXFA 3KZSA 4H04A 3S8HA 4KIEA 1LCOA 3MUY1 4DI8A 3GC5A 1GTHA 1W3KA 1MFUA 3OC4A 2VEIA 4MM1A 4U31A 1TMHA 3HU7A 3EZ4A 2RDWA 2DT0A 1Q2SA 2VC7A 2OYKA 5DMLA 3GDRA 4GY7A 4YYCA 2CXEA 3UYIA 1T8QA 4WGHA 4DWSA 1LRNA 2EJAA 4CU7A 2ZXDA 2I17A 3VD9A 5C9UA 4HNOA 2OLSA 5CBJA 2OZ8A 2D23A 4GWEA 4MJ4A 2J78A 1KLZA 1ICQA 2VYOA 3FA4A 3DIPA 1VDVA 3NQAA 4CNNA 3C61A 3Q45A 1E4LA 1VYRA 3R7MA 4D1JA 1E43A 1NWSA 4MHBA 4N02A 1Q45A 3VMOA 3BJTA 3WH8A 2WZIA 3SADA 1GOMA 1W91A 3GG8A 3S2MA 1A5NC 3W28A 4H7ZA 4WRHA 3KOYA 4N42A 3RNMA 1SMDA 2OSYA 3UW6A 1RA0A 2J74A 3BAXA 3NTYA 5I09A 4WDWA 2QIIA 2VEFA 1YW1A 3S83A 3WDIA 4BURA 4JL1A 3DEQA 2BMBA 4HK6A 1UUQA 5HMFA 3FGCA 3KAOA 4N9DA 1S39A 2R1NA 1ZAJA 1ZSXA 4RPQA 4H8NA 3G1DA 5A95A 1ZBCA 3J7HA 1XKYA 1UHVA 4DJEC 2O92A 3P8IA 3PZUA 3U2ZA 2D2GA 4LVFA 3AU2A 1AODA 4GHRA 2YA1A 5LIXX 1G9HA 3VDGA 4RE0A 2WZHA 2FHFA 3IVSA 1F07A 3O63A 4MOZA 3UWUA 1H7XA 2JF7A 4Z2KA 4P8UA 3UF9A 1E5JA 3V75A 2V69A 3NPXA 4LT9A 5D05A 1PKYA 3TYUA 5KZEA 2GSEA 1K9EA 3HPXA 2Z6IA 4H9ZA 4LF1A 5EMLA 3RNDA 1UW9A 3OBKA 1XLBA 4B5UA 1X2HA 4B16A 3TMQA 3MC5A 5LGXA 1POJA 2BHUA 3UG4A 1IZCA 3WDHA 3QV7A 5ER0A 4U28A 2ZX7A 3GDBA 1H7RA 3I65A 4LF2A 1V03A 5A6BA 4GUJA 4UMBA 1NOWA 1UD6A 1OD0A 3GD4A 1PIGA 3SR6B 1W1VA 4ADTA 1EXBA 1RP8A 1C93A 2CHNA 4UFJA 2WW5A 4GY0A 1G0CA 1QR7A 3RITA 4FX6M 1XP3A 3CUHA 4JYEA 2YVJA 5KVHA 1HNYA 1X6UA 1KCZA 4W84A 2DUZA 2VDGA 4B90A 2OU4A 1CYGA 1EEPA 1A5LC 2GVJA 2ZX9A 4UTLA 3BXWA 3ZSTA 3ICJA 4Y6GA 5HBFA 1YXYA 3BAIA 5F2GA 1D9EA 1O5RA 3E0IA 1KBJA 2D1ZA 4AIUA 3OU8A 2V63A 4NAFA 1XFCA 5J04A 4K7VA 3FVMA 3KXQA 2F6XA 4J3SA 4YL2A 4GJ1A 4DEFA 2PMQA 2RKXA 3CTTA 2DDXA 5CGQA 3CV2A 4PL1A 3SIZA 3WLKX 1XCFA 1ZCOA 1X8CA 1OX5A 5CGMA 3GXMA 4AFYA 3GM8A 3CL6A 8XIAA 3MUCA 1WV2A 4H9VA 4GZJA 3VMNA 4B5WA 1DOSA 2GQ9A 4KFNA 4GQBA 5AYBA 3ZQ9A 2CIPA 2J88A 4LGXA 3URHA 1XG4A 1B4KA 2G4FA 3A23A 1BRLA 1LM1A 1HUVA 4YLWA 4J28A 3FEMA 2ZVRA 1MFVA 1C8YA 2DUXA 4Y9AA 4P7QA 1W54A 3GDLA 1VJIA 4EWJA 1CX9A 1B5TA 4POCA 4J2PA 3CMGA 3CYJA 3WLPA 5LIWX 1OT1A 1ZJIA 3CZJA 5AHLA 2W0HA 3TC6A 1HL9A 3W24A 3DZ1A 3W7MA 3BLPX 2BC0A 1U83A 3LMYA 4B92A 4FR6A 3S5YA 2FGZA 5G1TA 4RDYA 5M03A 1Y7VA 1F05A 1NVMA 4R27A 5FCZA 4PA8A 1J5SA 1R9YA 2FHBA 3TTSA 3M0IA 4AEFA 3GR8A 1GW9A 1V3MA 1PKLA 4UTTC 1IYXA 2CKRA 5B7YA 1PZ1A 1DQXA 1YPFA 1SZFA 4QLLA 4NYUA 2MANA 2Q09A 4I8YA 1IEIA 3TR2A 4MYXA 1LT7A 4IF2A 3VNYA 1XLJA 1MRAA 1W1ZA 1TZZA 3OGVA 4EAYA 4E6MA 5C9WA 4ZQMA 4CEXC 4ZEPA 4QP0A 3CIXA 3RLVA 1JNDA 3AHTA 3WH7A 4TUFA 3UXIA 3CWOX 1SJCA 5IHSA 1JDCA 3FSTA 1E6XM 2VCBA 4DZ5A 1M41A 5C9RA 2UV8G 4X63A 1K7FA 3ARTA 1E6RA 1GVSA 2XM2A 4HQVA 3NOEA 4FOUA 3I4EA 1S1RA 3VKJA 4GGHA 3H55A 1WZMA 4FX9A 2XWEA 4ZFMA 3EWXA 5FL1A 2VURA 2I7GA 2CFYA 4H41A 2GGGA 5I2UA 1U5VA 3DHFA 5E93A 2DZAA 3ME3A 3GAKA 3WEZA 1Q7MA 1QI5A 1V3IA 4PUEA 2QPXA 3SSJA 4QIUA 2QF8A 4Q4MA 3TP4A 4N4PA 4PTDA 4O4VA 4L64A 4RZ4A 1NQKA 1OINA 3GVQA 2F6UA 3JZEA 3ARZA 3VTRA 5EYWA 1VAHA 4JY8A 1QTWA 1OIFA 4TR9A 3UY7A 3QMTA 8A3HA 3E38A 3UJ2A 1O66A 3PBUA 1Q6DA 2ALDA 2UY5A 2ZE0A 4M7SA 3WUFA 1MO9A 4PUDA 4OWGA 2G95A 3W83A 3ZVIA 5FEZA 1NHQA 4IP7A 2PDFA 5HPCA 2W92A 3LSBA 4YWOA 4QEHA 1TVLA 3FS2A 3NGJA 3ANVA 2XN2A 5DCBA 3P80A 2GLKA 1F8WA 1X98A 3F2BA 3W7DA 3BURA 4BF7A 2IPFA 5AZ0A 1E0VA 3BANA 5LNWA 4RCXA 1OABA 1GQKA 4QXIA 3PHAA 5EL1A 2GK1A 3G6MA 5D38A 1NU5A 2CBVA 1SR0A 5D03A 1H5VA 2I5IA 3MWCA 1XGEA 3ITYA 1ISYA 1XV8A 2WJZA 4A22A 1EDGA 3DGZA 3ZWTA 3BV4A 2HVMA 3V18A 1F4AA 3HG2A 2GGIA 3HPAA 3KX6A 3RRAA 4V27A 3NO3A 4GQ0A 4IXXA 3GBDA 1FFQA 5LIKX 2F84A 2FPVA 4MLJA 4V1YA 4LYQA 4Q7IA 4DZAA 4XG1A 4CQ8A 4MPQA 1PIIA 1R3QA 1RCXB 1MSSA 2WC4A 3VE7A 4DNAA 2C16A 3MYPA 3M9YA 3GYCA 1DE6A 4FLRA 1RBOB 2BHZA 1XYBA 1GZJA 1P0KA 3T55A 5GPRA 2G3MA 1GHSA 3UA4A 1V97A 3QFEA 3WNKA 3DFOA 2XGBA 4O15A 4DF0A 3KHDA 4K2SA 3BWWA 5EY5A 3T8LA 1EWEA 1IHIA 3C4UA 4HCDA 2CW6A 2Y8VA 4IPJA 1SFSA 2BVWA 3UCQA 4M52A 1R0MA 3QSRA 2ATMA 1RM6B 1DXIA 3UFYA 3NQ2A 1PDYA 5CG7A 2FPYA 3A4AA 4HB7A 3RJXA 9RUBA 3KRSA 3GR7A 2Z28A 3N2BA 3N6JA 1HJVA 3FA3A 2OGJA 3GH5A 3G1FA 4PMZA 3BOLA 3MA8A 3I7SA 4N7QA 1R5YA 1RXOB 4NP7A 4XWUA 2I56A 3FW6A 3UYCA 1JYXA 4TU1A 1AOGA 1E0XA 1J5TA 1MW1A 1NWRA 3V1HA 4LVDA 3GQYA 5FAJA 3W7HA 5E6ZA 4E3TA 3LY0A 1GHRA 2DVXA 1RP9A 5ABEA 3DFQA 4ZB5A 4O1DA 4IHCA 4DIAA 2GDQA 2YOCA 1V02E 2FPTA 4J2MA 2OSXA 3T0CA 3KWXA 3KUMA 4H50A 3OZPA 2G3IA 1GEHA 4ACYA 1QBAA 4LC8A 1TYPA 1UP0A 3LV5A 5LIUX 1O4UA 4DO7A 5FEXA 3E3HA 3CTLA 1HVXA 3S47A 1XIMA 5G1MA 4S3GA 4Q4RA 3AXMA 4AD2A 1A80A 2H8ZA 4K37A 4UQBA 3G77A 4UUIA 3UGRA 1WZAA 2J4GA 1DP0A 2ZC8A 3KOFA 2FH6A 2G0WA 2RDUA 4LV4A 4Q7NA 3SO7A 3LM7A 2EXOA 4QG8A 3FK4A 1R7OA 1VEMA 3Q94A 4Y90A 3TSBA 3R1ZA 3STFA 1XLLA 2WNWA 3ITLA 4M1RA 3T07A 3P7YA 1F3PA 3P61A 1XH0A 3R12A 3BLEA 4YNGA 4FHAA 4IIGA 4ZXOA 5FJTA 1HGYA 1D7FA 2E9BA 2Q01A 2Z26A 3GYEA 4HP5A 5C6MA 1CEOA 1OFBA 3FJ6A 1FOBA 2GQ8A 3SRKA 4BF9A 1XQLA 3NL5A 1MUMA 1B3YA 3PWGA 2VFIA 2O4MA 2WOIA 2A6LA 4JFTA 4ZBCA 4AY1A 5FF0A 1RY0A 5DMNA 1JRCA 4QFUA 4TX6A 1OB0A 1GPWA 3P60A 4QROA 3SW6A 1P6CA 1D8CA 4IQJA 2YDAA 1UA3A 4JZ5A 3CHVA 5I78A 1Q6LA 1VHCA 1TV4A 4QAWA 3ES8A 4IIEA 2NX9A 5AKQA 4UTWC 3R25A 4JTIA 4YVVA 4O8RA 2WZEA 1UD2A 3H2MA 3WUBA 3ARUA 5HJXA 1ONRA 1O7AA 3UCDA 5HQMA 2EKCA 1YXCA 1V3JA 4NJIA 5A8NA 3UR2A 1B30A 1EFZA 4GIAA 3TN4A 1U5HA 1OCBA 7A3HA 1WYGA 3W23A 3EX3A 4HSOA 1LQ0A 2QEZA 4WOQA 1UZDA 3CLMA 4IH3A 4FX8A 3FYOA 1HO1A 5IXEA 4AMCA 1FHDA 5K3VA 2OQLA 2V81A 1IR2A 3UQNA 3BCJA 2GVLA 2AAAA 3CPUA 4DO4A 1W1B1 3ZWSA 4JTUA 3TE9A 3NL2A 2GJXA 1W17A 1LG2A 3S1VA 4KWVA 2ISDA 5T26A 4MY8A 3GHUA 2ON3A 3M6DA 5H8UA 2O7SA 1P1MA 2DZTA 1D8WA 2FMNA 2PDLA 3QKZA 4YTUA 4O17A 2EQ6A 2E4TA 3TN6A 4OUEA 1JXJA 2DZWA 3IC9A 5CBIA 4AZBA 2HK1A 4L1GA 3H2CA 4H9UA 3EOOA 2HQAA 1PTDA 5DMMA 3R43A 2A7RA 1XQKA 4CNTA 4JTEA 1R7AA 3TK7A 1PHQA 3GD3A 3VNMA 2FFCA 4IZGA 2VO5A 5LXEA 5AECA 3QN3A 5DQPA 1PTAA 4UMAA 3WMSA 3GZAA 1KFCA 1ZFJA 4EXQA 3W07A 3AHVA 3GG7A 3U7VA 2PDXA 4CNUA 2DORA 4DBUA 4DM2A 4O11A 4N6EA 1XBYA 3UZJA 2PP1A 2P53A 2VGGA 3W3OA 3UVIA 2FZ8A 2YVFA 2AQVA 3CH9A 4C90A 3IUIA 4XTIA 4A3QA 4JN6A 1HJSA 1K9DA 4AIEA 4AU0A 1AG1O 2BVYA 1UD3A 3KCJA 4WKFA 5AYXA 5CBBA 5A8PA 1BWVA 1OFEA 3VYLA 5F4WA 1L6FA 1XKJA 2Z1XA 5I0DA 3UJSA 1YDYA 5IBXC 4WSJA 3MO7A 1YYAA 1GVOA 3SCUA 2DEPA 3VKAA 2Z1VA 1E40A 1TIMA 3TMLA 2W67A 3FOKA 3AS1A 1KTNA 3LBCA 4L9XA 3KTCA 1EYEA 2PTZA 1FWRA 3FX4A 2WSPA 2QCHA 3KTSA 4JBRA 1S2WA 3C6CA 1L8PA 2CU0A 1JRPA 2NQJA 4Y9MA 3GE7A 1VS1A 3IANA 4L1WA 1N5XA 2B0MA 3MJMA 3KLKA 4MB5A 3LXBA 3P14A 3L5LA 3TYBA 3CEPA 3NL6A 1LRTA 1XUZA 5C0QA 1GUVA 2PTDA 1NOFA 3H54A 1GOQA 4JCMA 2NSOA 4U10A 4IGMA 1ISZA 1Q8AA 1VF8A 2QCCA 1LL6A 2QAPA 3KOXA 1XL9A 1C90A 4IUGA 1HP4A 3VKBA 2WC3A 4ZQNA 3N18A 3VD3A 1NP0A 1QPNA 3KBSA 4M8UA 3N17A 3VNLA 3HF3A 4E4UA 4DQWA 1VFOA 5C5YA