3R10A

Crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : mg complex
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
362
structure length
362
Chain Sequence
VSKIIDIKTSIIKIPLKRTFITAVRSTNHIDSLAVELTLDNGVKGYGVAPATTAITGDTLQGMQYIIREIFAPVILGSDLSDYKQTLELAFKKVMFNSAAKMAIDLAYHDLLAKEQDISVAKLLGAKANSIVTDVSISCGNVAETIQNIQNGVEANFTAIKVKTGADFNRDIQLLKALDNEFSKNIKFRFDANQGWNLAQTKQFIEEINKYSLNVEIIEQPVKYYDIKAMAEITKFSNIPVVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMESPAGILATASFALAEDITVADLDPLDWVAKDLYSDYITFNEPNIILKDNLKGFGFNLAENLYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enzyme of enolase superfamily
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Francisella philomiragia subsp. philomiragia
molecule tags Lyase
total genus 118
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3r10A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3r10A01
3K1GA 4GFIA 5EU9A 4J1OA 3ES8A 1BKHA 4DHGA 3H8AA 2PGWA 2PCEA 4K1WA 3KUMA 1IYXA 3I6TA 3DESA 5IDZA 7ENLA 3UJSA 2ZC8A 1YEYA 2PS2A 2P0IA 3SN1A 3MSYA 3FVDA 3B97A 3N6JA 3UXLA 2CHRA 3DDMA 3T8QA 3JW7A 3ES7A 2HNEA 3JVAA 3MQTA 4DX3A 4G7FA 1OEPA 3RO6A 3QN3A 1KKOA 2RDXA 1ELSA 3T9PA 2QDEA 1JPMA 1ECQA 3UJRA 3VDGA 2ONEA 3UJ2A 3PWGA 4A3RA 4ZCWA 3CXOA 3RCYA 4F4RA 3UCDA 4H83A 5BOFA 3R11A 4X2PA 2GGIA 2GGHA 4H19A 3EEZA 1EC9A 4DYEA 3P0WA 2QJMA 3STPA 3DG6A 3RITA 3S47A 3H7VA 2P3ZA 3SJNA 2O56A 3THUA 3SN0A 1JDFA 3FXGA 2AKMA 5FJTA 3U4FA 1MDRA 3VFCA 3VA8A 2AKZA 2PU1A 3NO1A 3OPSA 2OQYA 3CT2A 3BJSA 2QJJA 3IJLA 2OFJA 3GD6A 1WUFA 4GYPC 3FV9A 2PTZA 3R0UA 3MZNA 3I4KA 4MMWA 1XS2A 3CAWA 3R1ZA 4JHMA 1SJAA 2QGYA 3FJ4A 3BSMA 3P3BA 5J04A 3DIPA 3TWBA 3IJIA 1TE6A 2P8CA 1KKRA 2XH4A 4HCDA 3RRAA 3OP2A 4IP5A 4Z1YA 3RR1A 1NELA 3P93A 5FJRA 3N4EA 1XPYA 3R25A 4JN7A 4GMEA 3SQSA 2I5QA 2QVHA 3CB3A 3MY9A 4FI4A 3I6EA 2PMQA 3UJEA 2AL2B 1TKKA 4MGGA 3H70A 4GGBA 4H1ZA 3R0KA 3Q4DA 3GC2A 3MUCA 2P8BA 3PFRA 3TOYA 2GGJA 3VC5A 2OZTA 4Z17A 1EC7A 3ZVHB 3FYYA 2OPJA 3ZLFA 5FJPA 5BOEA 3DFYA 2PTYA 3QLDA 1WUEA 4ENLA 3NZGA 4GYPA 3JZUA 2XH7A 1R0MA 3TTEA 3UGVA 3IK4A 2GSHA 3DERA 3MWCA 2MNRA 1KCZA 4E4UA 4H2HA 5FJUA 3N6HA 2PP0A 3ENLA 2ZADA 2PP1A 1MRAA 1SJDA 2PP3A 1KD0A 3SN4A 2PU0A 4J3ZA 4FP1A 5ENLA 2FYMA 2OZ8A 4E4FA 4ZA0A 2P88A 1FHVA 3IJQA 3EKGA 3SSZA 3RGTA 4E5TA 4GIRA 1DTNA 2PSNA 4HCLA 1FHUA 2DW6A 4YWSA 4IHCA 4MKSA 4IL0A 4HYRA 3DG3A 1P43A 2HZGA 3V3WA 4GGHA 4JN8A 1JCTA 4M0XA 3QKEA 4KEMA 3H12A 3DEQA 2HXTA 4IP4A 3ZLGA 1W6TA 1ONEA 3UXKA 3VC6A 5FJOA 1EBHA 3OW1A 3PK7A 2NQLA 3S5SA 2HXUA 3QTPA 2QQ6A 1P48A 3CK5A 1L8PA 3ZVHA 2XSXA 3Q45A 3QPEA 1PDZA 3UJFA 1SJBA 3MKCA 3HPFA 3TWAA 3DG7A 1F9CA 4A6GA 3TCSA 2QDDA 3N4FA 4IZGA 3SBFA 6ENLA 2OZ3A 3D46A 3D47A 3TJ4A 2GDQA 3NXLA 4DN1A 4ROPA 1RVKA 2XH2A 3V4BA 3ZVIA 2POZA 2MUCA 2OQHA 4HNLA 3T4WA 3VCCA 1MNSA 4HPNA 2OG9A 3OTRA 1SJCA 4E8GA 1TZZA 3U9IA 2OKTA 3FCPA 3T6CA 1PDYA 3DFHA 4HN8A 1MUCA 3DGBA 3PWIA 4IT1A 3BOXA 4KPLA 2PPGA 1MDLA 3R10A 1E9IA 3UCCA 1EC8A 2XGZA 2OX4A 4E6MA 2DW7A 2PA6A 2PTWA 2PGEA 3TJIA 3VCNA 2PTXA 4G8TA 4HCHA 2GL5A 3OZMA 4GISA 4KWSA 1NU5A 3V5FA 4KT2A 2OLAA 3TQPA 4M6UA 4A35A 1EBGA 4EWJA 3GY1A 2AL1A 2OO6A 3GO2A 3ZLHA 3TW9A 2AL2A 2QJNA 3V5CA 2GGGA 4IL2A 1BQGA 4K2SA 2GGEA 4DWDA 2XH0A 3CYJA 2FKPA 1R6WA 4HNCA 2PODA 1JPDX 2OVLA 4DXKA 3OZYA 4K8GA 3NFUA
chains in the Genus database with same CATH superfamily
3F4VA 3WH9A 1GRHA 2E5AA 3NQAA 4DLFA 1VGAA 3ZT5A 2V67A 2QZRA 3VIHA 3ZJ6A 4ATDA 2QDHA 5A6MA 4K1WA 1XISA 3PJUA 5AYBA 8A3HA 1MUMA 2DZVA 3PM6A 2NLIA 4GI6A 2ZC8A 2VUYA 3HW2A 5A5WA 2PS2A 1FFQA 3NQGA 1SZRA 2WNQA 4S3DA 1QUMA 4LAMA 3D3FA 5CGMA 5FOOA 1V6TA 3BH4A 5HPOA 2DT1A 2HNEA 3GH5A 2XSBA 4CD4A 2DSWA 4YHGA 3NS1B 1XKJA 1L6SA 1WV2A 3K4AA 4MWAE 1BAGA 2JE8A 3L2IA 4ZQMA 1TUFA 4KF1A 2VOTA 1I6NA 3VDGA 2GJXB 2RGLA 4UQAA 4X9SA 4DYKA 4WGHA 5CQ1A 4NVTA 3WNMA 3CUXA 4Q8PA 4F4RA 1C8XA 2J78A 1IXPA 4S39A 5DT5A 3AIUA 4G7EB 3IIVA 2QJMA 1IV8A 2E5BA 2P3ZA 3SJNA 1OWQA 2F84A 1ME7A 1MDRA 2YYTA 3GE7A 1VBJA 1OINA 4AWTA 1WQ5A 3KBNA 1O95A 2YA0A 3O07A 5HNNA 1WO2A 1EA9C 2PC8A 3EDFA 5HJXA 2Q01A 4IPJA 1DPMA 2A7PA 3GU1A 1ZJAA 2V2HA 4WKAA 5FS6A 2X1SA 3G77A 3AMKA 3TC6A 1A4LA 3II1A 4O1AA 4PUWA 4MB5A 3IJIA 4GO9A 3BC9A 4D6DA 5LNVA 1D8CA 2ZZ0A 1AG1O 1DYSA 3AROA 1NY1A 2KX9A 3P93A 3M44A 2VFHA 3UR7A 4DBUA 1AZ1A 1XDJA 1ZK7A 4PBGA 4NJHA 3MP3A 1VKFA 1E0XA 3SJ3A 1ZP4A 1W0MA 1XLMA 3UJEA 2I16A 4N9CA 4GNKB 3LXAA 3PZGA 5EA9A 1KRAC 3TTQA 4AIEA 1UUOA 4WOZA 3H70A 3VIFA 3R43A 3DFPA 4O10A 1GVQA 4MJ2A 1OK4A 1J12A 2C3DA 3GM8A 2BY0A 4GZ7A 3NOYA 1EC7A 2AAMA 2NQ9A 1IWPA 3KDOA 2VCCA 1FWEC 5GRTA 1O5QA 1WZAA 3O0HA 2A3EA 2Y61A 3CUHA 1HKIA 1WUEA 4XISA 1REQA 3GXMA 3NZGA 3LPOA 1DE6A 4F79A 1G7VA 1TZ7A 1T40A 1XL9A 1JQXA 3DKJA 2HROA 3TKFA 4DBWA 2VFFA 3GNXA 5HNUA 3OYXA 5E1QA 4L9YA 1R47A 2O7SA 1G9HA 4C90A 4BQ3A 4OU1A 2ZADA 1F3TA 4RR4A 4PTVA 3SCTA 4XUYA 1TWDA 2ZIDA 3WK3A 3GC5A 3WQEA 1FWHC 5IHSA 3RILA 3DYOA 3CS2A 1ZENA 1CIUA 4XB3A 7CGTA 5AN7A 1QATA 1KRCC 2INFA 3TTYA 3KVKA 4DYJA 2PWHA 2Z1SA 1Y0EA 3HGOA 3H4WA 3G1RA 3LXDA 1E72M 1QNRA 2VTFA 1XBYA 1CLVA 3JS3A 2BOGX 2O7QA 2PRLA 2G37A 1P0EA 1KM6A 1PL9A 3DI1A 5CPTA 1HQTA 3U7BA 2V2DA 4UBPC 1F2JA 2YCLA 4QNWA 1IZJA 5FS9A 3SB0A 2CLOA 3R8HA 3G6LA 4FXSA 1GW9A 4YTSA 3EX3A 4ZB0A 3TUUA 3B05A 4ZFMA 1I2QA 2GRTA 3PBUA 1DJXA 3KZPA 4AZGA 4EK7A 3SSJA 1KTBA 3OBKA 4PEKA 1XHCA 3GFYA 4GFSA 4I90A 2YIHA 1UH3A 3LHZA 1LL7A 3NPWA 3JR2A 4DZHA 3ELFA 3LY0A 1OYBA 3NGJA 2G41A 2FMNA 4DNAA 1QVBA 3FOKA 3B03A 5FEXA 5DRCA 2XH2A 1AJ2A 3NYDA 1VQZA 1TJ0A 1G4TA 1UASA 3WJYA 2Z0IA 1RLCL 2G4JA 3WO8A 1K6WA 3QSRA 4ZBCA 3GKFA 1LOLA 1GNXA 3F2DA 3JRKA 3LENA 4M51A 3GRTA 2PGFA 5I00A 1VC4A 2Y63A 3AU2A 4DWSD 2WMIB 2PURA 3BLIA 1XIGA 4S3EA 3GBDA 4WDTA 1UKSA 2G96A 2HEJA 3W7PA 4PCPA 3G1DA 3L2LA 1H0IA 1W56A 2OWCA 4G8TA 1U5JA 2BNJA 3C2FA 1JYXA 3S9YA 2AMGA 2WHKA 5E0FA 2BXYA 3V5FA 1QJWA 1GSNA 4F2TA 1TV2A 2CETA 2IW0A 4WZHA 1EEXA 3E0VA 4ZZ9A 4OJYA 4A3YA 3AALA 3L68A 4R9OA 2V63A 1NP2A 1Z8AA 2BZNA 4JFTA 4JTJA 1GPFA 5BXSA 3S2CA 1T96A 3ARWA 2AL2A 2IS7A 5HOSA 3W1MA 4IWWA 3STFA 5I3IA 5G5GB 3T0DA 1BSLA 1FECA 4K2SA 4IUGA 1A5BA 3GDMA 3ID7A 3W1RA 3TYBA 1ONXA 4JGDA 2Z2AA 4WCJA 3TXZA 4TVYA 4M6QA 4B9ZA 1KRMA 4MYAA 3GXPA 2WLYA 3KRZA 4JIQA 5HQMA 1P1MA 4UTLA 3LMYA 2CLEA 3ETRB 4V28A 3SIZA 3BMWA 1IEWA 4LAOA 1OD8A 3L0GA 5F1VA 2XM2A 3O0FA 3K1GA 2MANA 3WQDA 3NJ3A 2PLKA 3WIJA 4BA0A 1FWTA 3HG5A 5ABFB 2DQXA 4I9MA 2ZRWA 5EKYA 3K1DA 1QR7A 1G67A 2Z29A 1WKYA 5A6AA 1VRDA 3KBSA 3U6WA 3VIGA 1XRTA 3UJSA 1BWLA 3M0MA 3B8TA 5F2MA 4XSLA 5CSUA 3QMTA 1LL6A 1SZFA 4DX3A 1Y65A 4KH2A 1MXSA 1OX6A 1RH9A 1K8YA 3CQIA 3UJ2A 2V5CA 4WVXA 3CJPA 3LM7A 2HVMA 1BTMA 3NL6A 3WDRA 3WF1A 1CBGA 2CW6A 3FAWA 3EOLA 3M0VA 1XLLA 3LHYA 1N5WC 4JKKA 3VOHA 2F8QA 1Z9AA 2V6OA 5I77A 1E9YB 1VH7A 3GBEA 2WBAA 4GUJA 3DZ1A 4JL2A 3LQGA 3W7EA 4ZTYA 4ZOHB 3FXGA 3NRZB 2PU1A 4IMDA 2ZUWA 4QJ3B 3M0KA 3UG4A 4I9AA 1GEHA 1FWNA 1W1A1 3W1NA 4QCFA 4GYPC 4Z0SA 4UR8A 1UUMA 4WKFA 5G4HC 1SMDA 1B3VA 4QQ3A 2VC7A 2W63A 2Q02A 3NQ6A 1A53A 4PEEA 4KWWA 1VHNA 1ZJIA 3D5HA 2OGYA 1EGVA 1PB0A 1TE6A 4H4YA 3DYMA 4GC4A 4IP5A 3OEXA 5AVNA 4Q4SA 3RO8A 1GRGA 1H1NA 1FBAA 3PBGA 1OG0A 1V0KA 4WHBA 1OYAA 1XG4A 3U8GA 1MW2A 4C6KA 5REQA 1W91A 4QXIA 3CPGA 4A3UA 2GR0A 1XR2A 3GWQA 3RPTA 4O53A 1UWUA 4UTFA 4QE5A 3DK8A 2PMQA 4ACZA 5DY2A 2Z2UA 2EAWA 3FAXA 2XHYA 2FH6A 2C1HA 1XIMA 3AXXA 4MAZA 1EQCA 4AVFA 4KESA 1W3JA 3Q4DA 1OYCA 5I3HA 3VINA 3GC2A 4KETA 2P8BA 3GTIA 4W7UA 3TOYA 3G3MA 1LT8A 4XD6A 4LF2A 1N2VA 2QT3A 3H2NA 3HQNA 3L5MA 3IAQA 1EZWA 1XYLA 3UA3A 4JNMA 4R88A 3W7JA 3BV4A 1DWAM 1NDYA 1NQKA 3RX2A 4GC3A 3T1GA 3W02A 1V79A 3IJ9A 2J74A 4UB9A 4AZIA 2QCEA 3QPZA 3TFCA 1MXGA 2JIWA 3W74A 2GWNA 3UGVA 4K68A 2W0UA 3BG9A 1YNYA 3IK4A 3MCMA 4H9VA 3GFZA 2MNRA 1KCZA 2FFCA 3NDOA 3G1SA 2FLIA 3LX9A 3CL8A 2PP1A 2O4QA 1WAWA 3IPWA 3MBFA 1KD0A 4FR1A 4NT0A 3TYAA 2VX5A 1CZ1A 3TW7A 3I7QA 2FPVA 3V0SA 3SI9A 1CPUA 4ZA0A 1GHRA 1FWAC 4GXWA 2P88A 1NHRA 3KTCA 2HE5A 1FHVA 3EX1A 2QAPA 3WBEA 4ADTA 3EKGA 3MPGA 4GIRA 3GUGA 1DWHM 2EPKX 3VDAA 4DJDD 5IFTA 2GQ3A 3PBMA 1P43A 4YNGA 3K30A 3A24A 2IPFA 3Q37A 2NQ5A 1SMAA 5CLWA 4KKXA 2BHYA 2DZXA 3T2PA 1YE4A 1KGUA 4IP4A 4UNLA 2CBJA 2GQAA 4NNAA 4O15A 4KRZA 1S5WA 1EOMA 1TWZA 2QAEA 3QR1A 2DT0A 4TX9A 1NARA 3M4HA 3DHDA 1OABA 5G1TA 1A3HA 1K77A 3KE0A 3M0YA 4EXBA 3KTSA 2VEPA 1LQAA 5JCNA 1GW1A 2ESCA 3CV2A 1UR8A 4POCA 1X1NA 4A8LA 2J8FA 5K9CA 1AW2A 4UTUA 3DJJA 4MLRA 3CZGA 5CZKA 1I2PA 1QPQA 3A7UA 2HWGA 2BASA 2YX0A 4BZYA 3T4WA 3BAKA 7A3HA 4XZMX 2OGJA 2HS6A 1A49A 3W3OA 2ATSA 1MNSA 3TQVA 5BXRA 4KQNA 2J6VA 3GNNA 3GU2A 3NL5A 1O68A 4O1BA 1PWMA 5ECUA 1V3JA 3DGBA 3BOXA 1UKQA 3DFTA 4FNSA 2HPMA 1EB3A 1NIUA 3VABA 3R10A 4Z2JA 2Y1HA 1UD5A 3W28A 1GEUA 2XGZA 1XH1A 1AA1B 3VDBA 1HIZA 4NILA 3NZPA 2C3CA 1XDLA 4JTRA 4DM1A 2FB3A 3ZWTA 1MFUA 2QCLA 4FNTA 4KWSA 5E9XA 1V0NA 2J66A 2FPTA 4RE2A 1XM3A 4MUPA 2ZX8A 4ERIA 3A4XA 1QNQA 2QJGA 1PX4A 3VD5A 3RAOA 3ARXA 3WKZA 3WF3A 3KWXA 3OA3A 4HN4A 2OO6A 5EFFA 5DF0A 1NHSA 3ZLHA 4H3DA 3OHMB 1EHNA 2TPSA 4PZVA 4WY0F 1W9BM 3C0LA 3A12A 4RDYA 4MG4A 4JOMA 1JDDA 3CYJA 4ZL1A 1GG1A 3VIKA 1TWWA 4M6PA 2ACQA 3H26A 4B90A 4RE4A 4K8GA 3A47A 5GNZA 3MJYA 4WSHA 2CDUA 4RE0A 4UMBA 5C0QA 2E3TA 3GVRA 4Z2LA 4XV0A 4QHRA 1E71M 4E2BA 3PR2A 2PGWA 1OCQA 5MF5A 1KN0A 2L5HA 4WSKA 4M1BA 1IYXA 1OHLA 1Q2RA 1PPIA 4PBFA 3W7MA 3ANYA 3CGTA 3DK4A 1BVWA 1DXEA 1BHGA 4GXPA 3LBOA 1YEYA 1GQNA 2YCLB 3IIZA 1NF0A 4DUVA 2BVTA 3BOLA 2IKJA 1MYRA 1Q4NX 2W91A 4ZB2A 2XVLA 1M6JA 1WBHA 1EYEA 3MQTA 5G2HA 1XGZA 4IMGA 2NVAA 2XSAA 4FX8A 4IPPA 4PMQA 2DT3A 2RDXA 1I45A 4PUUA 2ONEA 3KEHA 4C6FA 4XKYB 1J2BA 3G8RA 2OWXA 4ALDA 3EWZA 2ZUUA 3WDPP 4WJ8A 3VI2A 4DM2A 1SR9A 3U4AA 3WDIA 2ZFAA 2Z00A 3S5YA 1QPOA 1UR0A 4TXEA 3B9JB 9CGTA 1LRQA 1DNCA 4X2PA 3GTNA 4H19A 5CBBA 3GVQA 3STPA 4RX0A 4C6JA 1EZ2A 5HWJA 1X7FA 3H7VA 3KCOA 2V82A 3UD6A 2P76A 3NPVA 1FXQA 1LUCB 4PRWA 3BZGA 3P67A 4PMNA 2ZYFA 3STEA 4XVDA 1S2CA 2WPEA 3KRBA 1HJSA 4XO6A 2AMXA 2EJ1A 4AUBA 3WJSA 3MBDA 4F40A 4JEQA 3S2MA 3T2OA 3WK0A 5D32A 3SGGA 4LV4A 4H8NA 4F2UA 3GRIA 1EF2A 3AICA 4KBXA 5DXXA 3NDZA 2Y0FA 1XS2A 4HGXA 3F4CA 3BSMA 5D4YA 1B9ZA 2JEPA 1Y8BA 3G5EA 1QI4A 3WDJA 3L4YA 2FMOA 2XVNA 1U33A 2WC3A 1X2GA 4RV8A 1RD5A 2G3MA 1GZ1A 4DUWA 6ALDA 2INZA 4TX8A 4AD0A 2I5QA 3T08A 3IACA 4IX0A 2YBVA 2XIQA 3ONCA 4Q8OA 3C61A 4H01A 1GRTA 2AL2B 8XIAA 2WHMA 3NO3A 4KCVA 1S2VA 4H1ZA 1AJ0A 1PZ0A 1UB3A 3O06A 3PFRA 3W23A 4MDOA 2EPLX 1V3LA 2E77A 4LB4A 2OZTA 2FPYA 2WNNA 3UXAA 4UQEA 3C8NA 1GVSA 5I5RA 3I6RA 3OVPA 3GZ3A 4GNVA 1IXOA 3OYZA 2J7BA 4AG0A 4YHEA 3WG6A 2DQWA 1F8IA 5A69A 5FJUA 4ACYA 1QHPA 5LNUA 3CGBA 2V5DA 4QQUA 3GNPA 2HBVA 4FOUA 1G4SA 2I56A 1HVQA 4ML4A 3NGFA 3M5XA 3N73A 3QR3A 1P0KA 2J25A 3RHGA 4I3GA 3GX9A 1ZKQA 2W0HA 1QO2A 1B2YA 5U4NA 4NAEA 5T9CE 4XAZA 3LCIA 2P3EA 4R3UA 4XD3A 4C1LA 3HN3A 3WCZA 1FP8A 1WXZA 1U22A 5KITA 3SGZA 4GI9A 4K8DA 4Y9AA 4QAIA 3H12A 1Q63A 2DSVA 1P0BA 1V97A 1C9DA 3EWUA 3RR4A 3SY5A 3TVAA 1HNYA 2BFGA 2XFRA 3HMCA 4JQAA 2DVTA 1ECEA 3VKDA 1GUVA 3VNLA 5HQEA 1RD6A 3SIMA 1WAUA 4PGLA 1KXHA 1XLFA 1GKRA 3TN3A 4AISA 3DG7A 2YZ5A 3VNZA 1TTIA 3N4FA 4IZGA 1OFRA 1BSIA 2GDQA 2O92A 4B9YA 2W3RA 1K9EA 2OQHA 1OF6A 5HPCA 4IFKA 3UGRA 1AMKA 5IBXA 5A6JA 2QCMA 5I3GA 1IF2A 2VHLA 1W1VA 3FN9A 2JKAA 3CV7A 4L9ZA 5FAJA 1EWDA 5FEPA 1VFHA 3EDEA 4BR1A 4ACZB 5HK4A 3WJWA 1DV7A 4JIHA 3H2OA 1K9TA 1NWUA 3KP1A 4NU7A 2QCDB 1O1HA 4WGXA 4IMAA 3GYEA 4PUKA 1SFSA 3LHVA 3KCLA 3F4WA 5FL0A 2HK0A 1KQZA 8CGTA 4HOZA 4FX6M 3AMLA 4R85A 4RLIA 5C55A 3CL7A 4EF8A 4MPKA 2DEPA 2PAJA 4GVIA 1ZJBA 4HCHA 1BF2A 1OFEA 4O0KA 2WVVA 2XINA 4HNTA 4BJHA 5EBAA 3TTSA 2DSKA 3V75A 1E0UA 3V7PA 2ABBA 4NZFA 2ZOXA 1SO3A 1T41A 4D1JA 1B3OA 4AD3A 3BZJA 3AUJA 3HV9A 4S38A 3T55A 2VMFA 1RALA 3CEPA 3ABQA 3QSTA 4G6CA 4NAFA 2X30A 4A21A 4DRSA 2V3BA 4N0RA 2AAQA 4JFUA 4MKVA 5GPRA 2V3FA 3GAYA 4GVHA 1XANA 1ODUA 1C93A 2IPWA 4A05A 4JQ3A 1R3YA 4N2YA 1FWDC 1R85A 5CZSA 5JIPA 3WLPA 1S2TA 5FF3A 2WO5A 1EJVC 2Z24A 3NVDA 4CLMA 1Q6RA 4UTHA 4HP5A 3WLIA 4H7ZA 1WKEA 1NF7A 3STCA 1BG4A 4U28A 4K36A 3W1AA 1ZCCA 1CXKA 3L66A 1HZYA 1UWTA 2VWTA 4JAWA 3BO9A 1UH2A 1OD0A 3W6LA 3MUXA 2UWFA 5G1YA 5AHMA 3UWWA 3APGA 2OU4A 1RBAA 3S3GA 3Q94A 4W93A 3CH9A 2UY2A 4DXXA 2O0TA 3T9PA 2QDEA 1WX0A 3A13A 4UTIA 1B3WA 2GQ8A 3K8MA 1WB0A 2ZX7A 1ONFA 3I3EA 1EGMA 2ANUA 3UQNA 4ZEPA 1YPXA 1VZWA 5BOFA 3TP4A 1B3ZA 1BLIA 1JFXA 1NFBA 1H7WA 3ITTA 4NZ1A 4DYEA 2OB3A 3M46A 4JTUA 3ZMRA 4JL1A 5CAHA 4EM4A 4JEJA 3BE7A 3SN0A 3M0IA 2AKMA 2PDHA 2UY3A 1HJXA 2QPUA 3WJZA 3NO1A 2XIOA 3UXDA 3PB0A 4HK5A 4DZ5A 2J7GA 4XZLX 4W7VA 2XIIA 1D7YA 2BSLA 3HF3A 3BLDA 4AMAA 4UR9A 2D22A 3B8DA 2HV5A 5KZMA 4H8HA 1YYAA 2VKZG 4WF7A 2QGYA 3M6DA 3CQ0A 3GNRA 1UUQA 1KKRA 1OC5A 3WUFA 4AF0A 2UV8G 4UOQA 1W1PA 1ZBKA 2WVUA 5FJRA 4JNYA 2P10A 3LA4A 3OZPA 1GOWA 3VDHA 4GLEA 3R25A 1DJWA 4NKCA 1M7OA 3CPRA 5DCEA 3IJ6A 3ARUA 2PE4A 4TVDA 2OZ0A 1UBSA 1XRSA 3RMEA 3HPXA 4Q8QA 2B81A 3TN6A 3GVWA 3ORWA 4CEXC 1KLYA 4LXFA 1TYTA 1JPIA 1KBIA 1PXGA 1V08A 2GGJA 4RNFA 4GA8A 2OODA 4LEFA 1UKOA 3IS4A 1JUKA 3L5LA 5HAOA 2WV8A 1XKYA 3BAWA 5LHFA 4Q4RA 2E4TA 3W7CA 1A5NC 4DWSC 1UD4A 3L67A 4ADUA 3LB0A 1W3LA 1SU5A 4B15A 3MO4A 1LWIA 4NG3A 2WMKA 3R2GA 1OZMA 3EA2A 1TB3A 2CZDA 1MRAA 2XN1A 1LLOA 4ADSA 3PC0A 4UNIA 1H60A 5D2VA 4FXRA 1A5LC 2OZ8A 3MUIA 3RF9A 2WMHA 3QY6A 4GABA 1AH4A 4JX6A 2Z26A 2GVLA 2YQUA 1BYCA 9RUBA 4B16A 4U2ZA 2QJHA 4RNHA 1DTNA 2CPUA 3CZEA 3EB4A 3P81A 4WD0A 4KCUA 3LM3A 3DFSA 4PL2A 4HYRA 1KWKA 2H8XA 2X0HA 3TDFA 1W3NA 1GGOA 4GGHA 5I07A 5LGZA 2D2HA 1IE7C 1Y5WA 1US2A 4J3WA 2PRHA 1V7AA 4GH3A 1TV3A 4UQBA 3A4JA 3HPAA 1OX4A 4F9JA 4JIRA 5LIUX 3W7GA 4U10A 3GB6A 4PMVA 1PE1A 4ICCX 5C9XA 4JY8A 2HCVA 3AYRA 1C7SA 2E25A 1KCLA 5DRIA 3TONA 4JTTA 2B4GA 3CUIA 1FTXA 3LI1A 4O50A 5CJNA 2AGKA 3G24A 4KIEA 4L4LA 1E6RA 2Q71A 5J8LA 4OVXA 2OZ3A 3D46A 1XPGA 3PJXA 4QG9A 3NVTA 2ACSA 3TJ4A 5H8PA 4A22A 4EX4A 2QEZA 2DORA 3MSDA 4QROA 1FVPA 3C2EA 4OOUA 3APYA 4CCEA 1AQ0A 5CPLA 1AL8A 2NQZA 4E3TA 4AZ7A 3VCCA 4IH3A 1FHLA 2GOUA 2FH8A 1DXLA 2GJPA 2EQ9A 5FI8A 1MO9A 4J2PA 1PTGA 1E1FA 4RZ6A 3RLGA 1J4EA 4RZBA 3EWXA 3R89A 4C6NA 2WZMA 3AISA 4CU8A 4QIUA 2D0FA 3HZ3A 2Y7GA 1RCXB 1W31A 4CD6A 2OYKA 3KBVA 1ICSA 3PZIA 4LYKA 2VO5A 5BYWA 3CC1A 4I5RA 2FHFA 2PTWA 3CASA 3L4WA 1EEPA 3TJIA 1T3QC 4ONVA 4KWUA 5XIMA 3UU0A 3CH0A 1F05A 1EPXA 1W54A 1YMYA 2OT0A 2A5HA 1GK8A 2DUAA 4XZHA 5I02A 1ZS2A 1BXNA 3AC0A 4GBDA 4GHRA 1M5WA 1QI5A 3RCNA 3W07A 3GY1A 3HFYA 3IUHA 5AHNA 1JCNA 1NDAA 3IV3A 1JAEA 1FDZA 4IJCA 5A8GA 1PHQA 1EF3A 1TVLA 3NZQA 2WSKA 1BQGA 4RV3A 4LC8A 5LNSA 1E9LA 1KBLA 1GZJA 5BMWA 1VBUA 3WQ6A 4CU6A 3KLKA 4QGCA 3SRHA 2I1OA 3T2QA 4NAEB 3NFUA 1MQQA 5FCZA 3URHA 3B4UA 3B8IA 3ITCA 4P8VA 4Q8WA 1DORA 1T5AA 4W87A 1AVAA 2C79A 4YTRA 1LTDA 1BZLA 2WCGA 2XYLA 1LT7A 2PCEA 1RK5A 1XICA 2IQDA 4Z2HA 1HTIA 1N55A 4ZOAA 2EQ8A 3GHTA 7ENLA 4RUBA 3CV6A 1X98A 2CYGA 1V02E 2VEMA 1VJSA 3UYIA 1C9WA 4NJIA 3MSYA 1N5XA 3UG5A 4MKNA 1YXDA 5LHEA 1J10A 1C91A 5BXPA 3K8KA 3L4ZA 3NM3A 2X8GA 3HBLA 3VZYA 2GSEA 4CGTA 1JPMA 3NZ1A 2VX4A 1M7PA 2PDFA 1X1ZA 4BQ4A 2VDGA 3JUGA 1MVYA 1EP3A 3C8FA 3J7HA 7REQA 1SUXA 1QOQA 1YXCA 3MYPA 1W5MA 1V3HA 4H9XA 1XLDA 3CQJA 2FGLA 5CPOA 2B7QA 5K9XA 1ISXA 4ERAA 1TPUA 1IIHA 5PTDA 4ROQA 3R6IA 3PUEA 3CU2A 3VNJA 2PDQA 2F2HA 2VEIA 4DJDC 2EPMX 2D20A 1F8WA 1I4NA 5AVHA 4C1NA 3N25A 3KFTA 4B3LA 1K03A 3R13A 1JDAA 3MVIA 3H23A 1RA0A 1AW5A 3GD6A 2DUXA 5HJYA 3A5FA 4HMNA 3VUPA 2WK2A 2PTZA 2ALDA 3R0UA 4MMWA 4FNUA 3BQ5A 4H4VA 2CLLA 4QEHA 3LBMA 1ODZA 2BWGA 3PPCA 4OZOA 3NSNA 4N9EA 4AD4A 1UR1A 3NL2A 2YL9A 1XPYA 2HSAA 4H00A 4H50A 5TQLA 3TFXA 5CBIA 2WM0A 1EPVA 4E4PA 4EVZA 3W2JA 4NAFB 1P0NA 1V3IA 1ICPA 1KFKA 1TG7A 1NDVA 2X8RA 3B9EA 5JXQA 1DIOA 1ZP3A 4JDYA 1E55A 4C91A 5IOBA 1ZMDA 5FJIA 4GRTA 2BVWA 3VM7A 3W1XA 4GXMA 4GUHA 4PE8A 2IXUA 4H9TA 4JKLA 4ZENA 1EDQA 3H2EA 5A8NA 5LNRA 5G1MA 4ZGYA 4MY9A 3WK1A 5ABTA 1FQ0A 1ML1A 4MDPA 1LWJA 1HP4A 3GD3A 4FNQA 4W5UA 4X2RA 1Q45A 2EG8A 3CNYA 3RG6A 3KLLA 3K5XA 3SGUA 3UCQA 1AH3A 2EBNA 3M41A 4J35A 4LS0A 4HBKA 5A6TC 3OC4A 3LB8A 1W32A 3O16A 3EMQA 2C7FA 1SR0A 3MI3A 3KRUA 4F2BA 4OECA 3RMJA 5F2IA 1HO1A 5CSRA 2R82A 4IMCA 2QIIA 3B3DA 4DJEA 5K9DA 3RM4A 3A4WA 1NHQA 3TYCA 3DG3A 3W73A 2ZXQA 1W8GA 1ZPTA 3C2VA 2XVGA 1MEHA 5CCZA 1TQJA 2ZTKA 1A0DA 2OXNA 1ISVA 4QLLA 2WJDA 1QO5A 1W6TA 3CPUA 4G9PA 1K4GA 1BWKA 2IUZA 3A6OA 3AOFA 2I17A 3L21A 4HYWA 1EBHA 8RUCA 1W9UA 4CNOA 4DEFA 4PRTA 4C1KA 3F4DA 4GKLA 2XVPA 5A8MA 3QHOA 4JBRA 3WMLA 3MC5A 5C8BB 1QBBA 3UJFA 1O5XA 3GU9A 4X61A 3L12A 4YJ5A 1QOXA 1I1WA 1TWIA 3IJDA 4TU1A 3Q67A 4ADWA 1GG0A 1VEOA 3M0LA 4XD5A 1K9FA 2TODA 2QDDA 4PYSA 3H24A 4JTFA 5G4WA 3AYSA 1ZFJA 3JZEA 3IAPA 4A4AA 4MNMA 3EA1A 1S5NA 2O9PA 1UIOA 3WD2A 1CXLA 1YQZA 1YIXA 4TO8A 3G8EA 2WP5A 4AF0B 1KXTA 1SW0A 3RPDA 2F6KA 3K46A 1RHCA 5L9FA 3DFOA 1Z89A 1XLJA 5JUVA 2VYOA 4KCTA 4YIWA 5A94A 1JZ8A 5EBUA 2NT0A 5AHFA 2WLZA 1GKQA 3EWYA 1LP6A 1J18A 1QBAA 2CXEA 2FHCA 3QQ1A 1LORA 2R24A 3SFWA 2D0GA 1MDLA 3PB2A 3CWHA 2CLHA 3UCCA 4ECLA 1VBHA 3KVJA 4UTJA 4OOZA 1WXYA 1LVLA 3E02A 2FJUB 2EPNA 3KCJA 4S3CA 4OFCA 1I0DA 4CQAA 1H7PA 4DPPA 1JZ6A 3B8SA 1J5SA 4LUTB 2ZWZA 1UA7A 3FW6A 2ZRZA 3ANUA 1XXXA 1SQ7A 1BGAA 4UQDA 1XGDA 4FDCB 3EX4A 3MYOA 1I75A 4HPGA 4I7WA 1PJ9A 2D3NA 2AL1A 3WLQA 2J9XA 2QJNA 3HJZA 3N3MA 4IMFA 4IF2A 1QRQA 5AOUA 2X0YA 3THCA 2GUUA 4CN1A 3KM8A 1RA5A 5D9OA 4GCXA 1OC6A 1W3TA 3P6LA 4DXKA 3MUAA 2XZ7A 1VJZA 1ISWA 3MT1A 1E56A 4ZODA 1G69A 4C6QA 3ES8A 4HIBA 5JCLA 5JBFA 3GHSA 1MW3A 3XINA 4D6FA 3K4DA 4RNJA 1O4UA 3TA9A 4MLJA 4Z1AA 4WDUA 2X8HA 1FCBA 3N4AA 3VD4A 4GZIA 3IGSA 4LS1A 4Q4KA 4IPIA 4OQVA 4HPJA 4FALA 3E3HA 3KS6A 2QGHA 2Z28A 4TTUA 3N6JA 3M64A 4KW2A 4TR9A 4XTDA 4HPXA 5FS8A 1PIIA 1XLHA 2AQWA 1OM0A 4LVDA 3H4KA 4PULA 4M82A 3VZZA 3EA3A 2FB2A 1CXHA 2OLHA 1R3TA 3QV7A 5FF4A 3BLFA 3NWRA 5JIWA 4C6PA 4UQCA 1TR1A 1CEOA 4GIEA 3QC3A 1TWSA 3QPYA 3S2JA 4FLRA 1E6XM 1YNQA 2Z27A 1PCKA 4PRRA 5AFDA 2GGIA 1A5AA 2GUYA 3WLKX 2GSJA 4ZQRA 3QR0A 1XYCA 1K6AA 1RY0A 4LUJA 2CZEA 1UP2A 3KL0A 3NZRA 2CWXA 2Y5JA 1HL9A 1A3WA 2IXVA 3BJSA 2QJJA 1P6WA 4AH7A 2OO0A 1YPFA 2Z1KA 3B0YA 5M1TA 2E5DA 4PCSA 5MHBA 3PJWA 1E51A 1H2IA 3I4KA 3C4UA 1Q85A 3MSRA 3W7NA 3A5VA 2Y8VA 3FJ4A 4CNTA 3EUB3 5DMNA 4HU8A 2P8CA 2EPOA 3OP2A 1H6VA 1GYNA 3EWBX 3SUWA 2W5FA 1SM9A 1PAMA 1OVDA 4ZO8A 2Z1WA 3L4UA 4DJFA 1W5OA 4R53A 1JXKA 4OTKA 7XIMA 3MY9A 4FI4A 3I6EA 3CZLA 2PF8A 2GH5A 4FS9A 4B4HA 1RQHA 3C86A 3E0LA 2YVJA 1MXDA 2EQDA 2GJXA 4LT9A 1F73A 4L4PA 1SZEA 3PBYA 3KDNA 2B31A 1ME8A 2G3IA 2E09A 4X0VA 1QPNA 3M5YA 4UFLA 2ZBTA 2YXXA 3WQVA 3FYYA 1EO7A 1CB7B 1UYQA 4QG6A 1VPXA 3TSDA 2OCZA 3PZUA 1FIQB 1QASA 1XIJA 3DFNA 4NIRA 3S0CA 3A21A 4GJ1A 4ZSTA 4FNPA 4BHYA 3WBXA 3N6HA 3ENLA 4D71A 1JOAA 4LIIA 4MZ1A 1GOQA 2PWUA 1LM1A 1Q65A 4G56A 3UY7A 3W75A 2PU0A 3EOOA 3N13A 3OG2A 3CHFA 3P0XA 3WN6A 2DVUA 4HA3A 3WJXA 1EXBA 1LLZA 3CMFA 1B90A 4QEEA 1QW8A 4FIQA 3A3XA 1R9ZA 3N17A 3WEZA 1V03A 3E0IA 1R9YA 2DW6A 3VGEA 4HB7A 4KFPA 4O1CA 3W01A 3V3WA 3AHZA 3GR8A 3LMZA 2B7OA 2QVNA 2WVSA 2EQ6A 1F61A 4NI8A 3N2OA 2CLMA 2DT2A 1EX1A 3CQHA 1OK6A 4PMUA 4E2DA 1TA3A 1Q7MA 5FJOA 4QTGA 3QHMA 4R7WA 4H4SA 3GG0A 1TTPA 3FHAA 1SFJA 1RXOB 1RP9A 2Z1VA 1E6ZA 3I7SA 3QPEA 5LKYA 3DC8A 4YVPA 5GJNA 5CBJA 3ITOA 3NL3A 4XZ9A 3AZSA 3V1PA 1UA3A 3VD9A 1E1EA 3ITXA 4J5NA 4R5EA 4XZBA 1VFSA 3KBJA 4UC5A 3S83A 2XIJA 1OT1A 1FWWA 2VP8A 4CN6A 3NSXA 1W3IA 2POZA 4JKMA 2VQTA 4L1WA 4XTIA 4QFUA 3OTRA 3HPZA 2PEVA 4E8GA 4LGXA 2NUXA 1WNOA 4OV4A 2OKTA 3FCPA 2C91A 5I24A 1ITUA 2IPJA 2POTA 3P14A 3N15A 3OIXA 2ZXDA 4O1EA 4BK9A 3PWIA 1ZNNA 4V27A 3W7QA 3BDKA 3PPGA 1SW7A 2ZA1A 3N2TA 3T78A 2C1IA 3VNDA 2QJIA 3S5NA 5DO8A 3PZQA 2VC5A 2BS9A 4US5A 3AWNA 1VAHA 2VD9A 3P2VA 1IT7A 1IQ8A 1QAPA 1W1IE 1EGZA 3Q2DA 3OZMA 4N6EA 4H9MA 4RJEA 2V3AA 1NU5A 2DIEA 4HSHA 5JU6A 1ITQA 4B3KA 1EUAA 2VR5A 2D73A 2QULA 4OE7A 3W00A 1BD0A 3O9NA 4IIEA 1GVEA 5E70A 3BTNA 3G0UA 3UZJA 1XJBA 3S9IA 1EKOA 2WB5A 4JCMA 3NO5A 3KTXA 1DBTA 3OVGA 3V5CA 4LYQA 3UWUA 4IL2A 4K3ZA 3RRXA 4S2CA 1AH0A 4JQ2A 3O6CA 4C6IA 1PKYA 1AUSL 2R1NA 3GQYA 3KW3A 4J3XA 3HIJA 4MIMA 3W87A 4E2OA 4XD4A 1RSCA 2OEMA 1GESA 5CC6A 1IZCA 5L6UA 1V51A 3WLHA 5BRBA 2Y85A 5DMLA 2J8TA 3NOEA 1Q8AA 3LPPA 1Z3NA 2Y24A 3WQGA 3WY1A 1MSSA 3E6EA 3W37A 3LRMA 2GZXA 1VFTA 2J7CA 4UFIA 2Z4GA 4F0HA 1DQXA 3F7JA 2YGYA 4QCEA 1KM2A 1C8YA 3NPXA 2A2IA 3B40A 3CQKA 1SGJA 4QJ5B 3C5QA 4ZQOA 1AQHA 4RK8A 4LAUA 2HISA 3ZJ7A 3G1VA 3OGSA 5FF2A 3FKKA 2QCCA 4IGHA 1EIXA 2GYIA 2W92A 1UZ4A 4GRSA 3Q65A 5EGRA 3LCLA 1FRBA 2ZE0A 3TQ0A 5FKYA 1J2WA 1XD0A 2R94A 3IGHX 2XIBA 4LTSA 1V93A 1H61A 3RLVA 3CHCA 3E12A 1ZLPA 1H63A 4AY8A 4M1RA 2VRKA 1SB3B 1A80A 2X2GA 4F9DA 1VCFA 3W7DA 4RKAA 4Y9PA 4X22A 3NVZB 3W83A 1EO5A 1G4EA 3DKLA 1QNPA 4O1FA 3CT2A 1VJIA 3SUTA 2YDSA 4EF9A 3W26A 1WUFA 1I9CB 2Q8LA 3FV9A 3II4A 4H9UA 5A2AA 4XQ6A 2BXZA 2GVYA 1HW6A 5F1UA 4JHMA 2OEJA 1I2RA 3QF0A 1CLKA 3DU0A 4GX9A 4NJJA 4U4MA 3EXSA 4Q32A 1AQMA 1ZBVA 1GVFA 4LSBA 2DIJA 2J4GA 3BARA 3DYPA 2BXVA 4Z1YA 1O66A 5E5CA 1THFD 2RJGA 3RJYA 3U0HA 3T0AA 4YMZA 2ISVA 1XBXA 1KRBC 2UBPC 4MADA 3TYUA 4F0KA 5LIWX 1JR1A 1XIHA 3M47A 2ALRA 5CG7A 4AWUA 3GLCA 3CIXA 1X8FA 2JK6A 2WPGA 2JF6A 4PTNA 2VFGA 4JDBA 1TKKA 3W84A 5A8QA 3PULA 3UWVA 4HHHA 2WOQA 4LY8A 1CWYA 2JK2A 3UR8A 4OIFA 3TOPA 1G7UA 4JCLA 3T7VA 4YCPA 3KWSA 1XD1A 2OPJA 3AXIA 4B5TA 3AZRA 2C1GA 1XLAA 4R9XA 4B5UA 4GI4A 1EFZA 3B4YA 4LYRA 4M7TA 1Q7ZA 3JZUA 3TTEA 1R0MA 3FA3A 3M7WA 2F6XA 4Y9OA 1EP1A 3TV8A 3DERA 1PO9A 4MZYA 4O8RA 2EQ7A 4C7DA 2EEXA 2P5NA 2WJEA 4ZO6A 5A6SA 1SZNA 3BWWA 3IIPA 2PP3A 3CUGA 3S1WA 2VNCA 3HV8A 2G0WA 2H3DA 3PPFA 5XINA 2PWGA 5FA5A 2ZX9A 2YAUA 1TCDA 2E6FA 5I6SA 1Q8JA 2NW0A 2GUBA 4JHOA 4H41A 5FJJA 3ZSSA 4HVXA 1KTCA 3SFKA 3VILA 4IHCA 4Q8TA 1UH4A 1WDQA 4X60A 5BOOA 1LCOA 2QCGA 4JN8A 2XFFA 3QKEA 3LSBA 3U5UA 3NPUA 1FCUA 2E1DA 1VFLA 3UXKA 1AODA 3VE9A 4ERGA 3W7OA 3S5SA 1A4MA 2D2OA 4R33A 2QQ6A 2CU0A 3CK5A 3QV8A 2FDSA 3E2RA 2QHAA 3LLFA 1XG3A 1TSIA 1GYLA 3HOJA 5I78A 3E5PA 1KBJA 4L80A 4ZO7A 1M41A 4EAYA 4XZIA 4Q7BA 1EJUC 4YU1A 4O4WA 1U5VA 4WIWA 3W25A 5C5YA 1JRBA 5GJPA 3LLXA 4OBSA 1BGGA 3BCJA 1T0OA 1ZQ5A 4Q8MA 4DN1A 4DJED 1S3TC 3O8AA 3QFWA 5IFPA 4J9JA 5EMJA 4MOZA 1KM5A 3HA1A 4WDWA 1PYFA 4IP7A 3M0XA 4L4MA 1QXLA 2HBXA 4LFYA 1GHSA 1U1HA 4CQBA 2EO7A 2HDJA 3LXBA 1S46A 3G1XA 3W82A 3ZSTA 2WNZA 4TVCA 3HGJA 1IZKA 2PPGA 3FS2A 4P61A 2C13A 2X05A 1LWHA 4LNCA 2AOSA 1QI2A 2W67A 2WMJA 3L8KA 2Y7EA 3QJAA 1HT6A 4QX4A 3ZXWA 3PSVA 2PA6A 4EE9A 1K7XA 4QLKA 3W86A 3W1QA 4UTTA 1XIBA 2ZUVA 3CHVA 4RE3A 4HMCA 3TNOA 4BCEA 5C71A 2DP3A 2J77A 4AD5A 1UWSA 2OLAA 1TUXA 4K7YA 4LWWA 1QW9A 1TO3A 3BW4A 4QISA 2GJLA 4ORMA 2QV4A 1U5HA 2VGBA 4EWJA 4PR4A 3MANA 2VUNA 1W2VA 1M65A 1H62A 3BG3A 4UFJA 4AIOA 2UZ9A 3HQ1A 1DQWA 5D05A 1K8ZA 1KBBA 2GJNA 4B3ZA 3GXNA 1CB2A 4MNLA 2C18A 2E67A 1XCFA 2RDWA 1XYFA 3U7VA 3LGDA 4PMRA 3GG7A 1JI2A 5FL1A 1V6YA 4K7ZA 4DHGA 1XC4A 3R5EA 2ZC1A 3WNLA 2J8GA 2YDQA 1ZGDA 4RXGA 2X99A 3QKZA 1KXVA 1EJRC 3W6MA 3D3AA 5FSDC 3WL1A 4W4QA 3WYZA 3AI0A 3H7RA 5JCKA 2R1LA 3UWYA 3LBCA 3VAVA 2W3SA 4N9DA 3IIOA 1MW1A 3RX4A 3SAZA 1TA3B 4EPBC 2WSRA 3G2GA 2GR3A 1QWKA 1XBVA 1O5RA 4M6VA 3LCHA 3AHXA 1A5UA 4XZWA 1PWLA 3L4VA 2RUSA 1QTWA 4KPRA 1ZB5A 4AX6A 2ZZ7A 5ABGA 1OEPA 1L6YA 4TX6A 1NJJA 3TYDA 3S6OA 3IIXA 1A5CA 1K02A 3VX1A 3NQ8A 2G97A 4GE8A 1XF0A 1TIMA 4CUCA 5I3DA 3RCYA 1NOFA 4J56A 1RPXA 3KS5A 4ICMA 4H83A 1F3WA 2E6DA 4TMCA 5TAOA 3A9IA 2GGHA 4LC6A 4LCRA 4D6HA 3WQ8A 4N6FA 2ZRUA 1NSJA 1EYWA 2F6UA 4FOKA 4NNBA 2RJHA 1ADOA 4BF9A 1V0LA 3PBVA 3N9SA 4BWLA 1LROA 4MZ8A 4D6GA 3OPSA 3W2MA 3GTXA 3IJLA 3SECA 5CZTA 1JYNA 4Z1BA 2PBGA 2R8WA 2ZCGA 1R7OA 4PL1A 2X2YA 2YA2A 3TWBA 2ZTJA 2XH4A 3W2NA 3ARTA 2A6LA 3B04A 3VOFA 1PIFA 3UXIA 3RR1A 2R9RA 1QPKA 3C2OA 5EMUA 2J3NA 1A0EA 1HF6A 2Y62A 1AL7A 1F4HA 3GNOA 1BVNP 1V77A 2V5BA 1QCWA 4GINA 5FF7A 5HWNA 3H7UA 1SO6A 4U3AA 1OGSA 4DBEA 1XLKA 3MKKA 3CZJA 3RCMA 4MGGA 3WBWA 4XKYA 4GGBA 4FEZA 3QFAA 1Q6EA 3WD0A 1JCLA 1WE5A 6REQA 2WMGA 2ISSA 5DN1A 4HJFA 5HATA 4MWAC 2F61A 2PWVA 4H4QA 1OCBA 1RBOB 3WZ0E 3YPIA 3JU2A 1D7KA 1W37A 3QRHA 4O57A 5BOEA 3OLIA 3TA6A 3VMPA 2ZZBA 2PGRA 1LUCA 1RJQA 3EEGA 1RZMA 2XH7A 1UD6A 3VIJA 3TW6A 3SQPA 3NQCA 4D8LA 4GOAA 1W1B1 3EDDA 4XBSA 4WUIA 5EBKA 4M80A 3WF2A 1JEHA 3LPFA 1VLIA 4Q3MA 4NHVA 4DJFD 3PAJA 1JYVA 2DSZA 2NQHA 5KETA 3VGHA 5ENLA 4B4FA 2WOVA 1V3KA 1H2JA 4N4PA 5HJLA 1UP3A 4EXAA 2PRMA 4OBTA 3LYEA 3IEBA 3SCQA 3W7RA 1DXIA 4Z1CA 3RGTA 1IR1A 3TK7A 4B5XA 2ZZ1A 3VMNA 3ARZA 2QLYA 2PSNA 3LCWA 5ECVA 5IBXC 1F3PA 3LHUA 3MMUA 5EMKA 3C56A 2INEA 5DANA 2CBUA 5DMMA 2RABA 4Q8UA 2E7FA 1WZMA 3O7UA 4KGLA 5CH9A 5D9MA 4S3JA 4GQRA 3F5KA 2EGZA 1EUNA 2NLYA 2VX7A 4P7QA 2YYUA 3SDOA 2Y88A 5HMSA 2VFEA 4B5NA 5I3FA 2R9ZA 3WNPA 2VGFA 4GJIA 2PF0A 3M0ZA 2ATMA 2Z7GA 4J57A 1Z42A 2DZPA 4O4VA 1JL8A 3AXKA 2EG6A 3SBFA 1GCYA 3FHQA 4NYYA 3CIWA 1OZQA 2OEKA 2YZRA 2CBVA 5KSWA 4YVVA 2A7RA 1RVKA 1JZ4A 1E1CB 3EZ4A 1XIDA 3S9ZA 4A3HA 4NX5A 1UHVA 1E4NA 4GIYA 3WLLA 4M52A 1ISYA 5CJMA 4EKJA 3E0FA 1RAKA 1TZZA 2WMFA 2WZIA 4KEZA 2E6YA 1PZ1A 3UPBA 4EMJA 1K8CA 3B8UA 1V8EA 3NM1A 5CLTA 5K2ZA 2PB1A 5HDRA 1JIBA 3ICJA 2BC1A 4AQLA 2D23A 1ZAHA 2PWEA 2VGIA 4HNVA 5CPMA 3M16A 3QH2A 5C2GA 1CYGA 2PGEA 3VIOA 3VKCA 1ZBCA 2VR4A 1BKSA 3WMSA 4KERA 3UYCA 1B5TA 3EX2A 3STGA 5JQ9A 3MB9A 3ZM8A 2H3BA 4QS6A 1E40A 3SCRA 4UTMA 1HO4A 2X0SA 1UZHA 2ISFA 4PCNA 5HMDA 3HU7A 4M56A 4XIMA 5BMXA 2HK1A 3QMSA 3AHVA 4HYVA 4C7GA 1EBGA 2CCRA 1ESWA 1E6SM 5EPDA 4BEUA 2GR1A 2C15A 4IISA 4XG1A 3QGKC 5BU9A 2GGGA 3EAOA 1S3HA 3TR2A 4WX2A 1ZHAA 3VOJA 1PS9A 5A1AA 2YJQA 1TYGA 1Q6OA 4QM1A 1FEBA 4PUNA 5C70A 4NEVA 3PZVA 3QXBA 5GNXA 4IG2A 4BF7A 2VC9A 4JQ9A 4EOUA 4AEEA 4C6BA 2OSYA 5EU9A 4HTBA 4W89A 3T07A 4US5D 4ZQNA 3CM4A 3M0JA 2FVLA 1BKHA 1B4KA 4GQQA 2Q8XA 3LTSA 3N6QA 3QTGA 1JXJA 4TMBA 3OLDA 1G6CA 1XLBA 3AU6A 5HUOA 1JRPA 3E74A 3OA5A 2W79A 3MHGA 3WH6A 1S5MA 1K7FA 3M1ZA 4PTMA 3QZ6A 4FLQA 3H2CA 4PTDA 2CHNA 2JKPA 1R86A 2QCDA 2P0IA 3I68A 4JTLA 4HPHA 2NVKX 4AVNA 3W6YA 1NOWA 5BNKA 3LGEA 2QCNA 3GSMA 3N1AA 3WF0A 1U83A 1WYIA 3R58A 2XM1A 1HKWA 4W8BA 1J0JA 4X63A 5DCDA 4A8NA 4HZ8A 1BFNA 1JVNA 1AD4A 1I0BA 2PDXA 1JULA 3KX6A 2BY3A 3W38A 5C7HA 4O19A 3AUOA 4UTWA 5IDIA 3PF3A 3MU7A 3ZO9A 2VX6A 3RM9A 3UCDA 3BGGA 2FVKA 1QNVA 3WFZA 1DL3A 4PB3A 3NDYA 3S47A 3N9KA 3PS7A 2FVMA 4MY8A 4JYEA 3IGXA 1JDFA 3POHA 3AS1A 3P8IA 3REQB 1OFPA 4QDPA 4J27A 1F76A 4MPQA 3W72A 2XWDA 1CI1A 3TCEA 1OX5A 5TIMA 3L5OA 1QNSA 5CC7A 4M24A 1I2NA 1W5NA 1VP5A 4DY1A 2JKEA 3KVLA 4CEUC 5LXEA 1NHPA 1RR2A 5EMMA 1DKWA 3F5JA 4Y96A 5HUPA 3L9CA 4LS2A 3ZJKA 4CNSA 5I06A 1CGTA 2BGQA 2PWFA 4L6DA 3FX4A 4TVUA 5M03A 5ABHA 3F03K 4AEFA 5C2XA 4PB4A 3ZR4A 5LZLA 3FNDA 4CVUA 3HM7A 4GQBA 3SQSA 1XH2A 3CAQA 3SO7A 5D30A 2PWDA 4PBEA 2QVHA 1P4CA 2E8YA 3W71A 2WHLA 3S1UA 4IFRA 4L1XA 2BDQA 2DDXA 4CD7A 1E43A 3ZYZA 2CWNA 4HA1A 3R0KA 4MB4A 4HTYA 1RPKA 1Z69A 1F6YA 3MUZ1 3UWQA 3OJGA 5HULA 3FJ6A 4UFHA 3OLEA 3ZVHB 1E0WA 3W53A 1GVYA 4DB7A 4FX9A 3V36A 2YXGA 2FJKA 1M3UA 5FS7A 3EWDA 5CZ0A 2YFOA 3NVYB 1H0GA 1O60A 2GQWA 4R7OA 4AD1A 4CQ8A 4L61A 2ASHA 4HSNA 2PP0A 4HMDA 4LX4A 1IXQA 5AHIA 3ARPA 1TIWA 4XAYA 5T9BG 4AIUA 3EANA 1A5MC 3LD5A 6A3HA 3NQ7A 1EQPA 4KWOA 5EMYA 1LDCA 3DK9A 3NSMA 5KINA 2V30A 2WCAA 3HTWA 4DBSA 1UZ1A 3OZOA 1QWGA 3BG5A 2GK1A 2V3GA 4O16A 2QF8A 3IJ7A 1MUWA 3M43A 4LUYA 3TZFA 3S2NA 2XJ7A 2DPEA 2X50A 1FUYA 2WW5A 4GK8A 4I5UA 4LRTA 5E6ZA 1WYGA 1UKTA 2ON3A 1N63C 1HG3A 5BXTA 5AECA 3QOMA 2W6RA 3A23A 2F5ZA 3BAXA 4GD0A 4WOQA 2PDMA 2V5LA 4K6AA 4LOCA 1JCTA 3VKKA 4GG9A 3VOCA 1MEWA 2QUUA 3SCWA 4GUFA 3ZT7A 4MB3A 1KWGA 2GJRA 5F7UA 5H1WA 3TYZA 2XIMA 3OGVA 3SQMA 4MY1A 2REQB 3DHPA 1DOSA 1XFBA 1HN1A 2J79A 4P7OA 5CGQA 3C0SA 1TX2A 4ZSUA 1XI3A 4NZ5A 5FSEC 1JZ7A 1PDZA 1CGYA 3UZZA 2H90A 3DCPA 4AC1X 1SJBA 3MKCA 3HPFA 1UP0A 4A6GA 2E40A 4LUSB 1ME9A 3ITYA 5D2WA 3LNMA 3VD7A 3HURA 1X39A 1VFFA 4WY0A 1XH0A 3SRKA 3UVIA 1PKNA 1UPPA 3NQMA 5J5RA 2YCEA 3NXLA 1LPFA 4LYPA 1WBJA 3A7RA 4PMJA 2HVNA 4U3CA 2XPKA 1H7NA 1GV4A 1DJGA 4LY4A 3GDLA 1UWAA 4O18A 3FJLA 6XIMA 1LQ2A 4ZQCA 1UR9A 3WQCA 1O1ZA 2Y70A 4W9TA 4YTUA 3ABZA 1JCMP 4Y8EA 1E6QM 3UF9A 1EDGA 2UY4A 3T0CA 4US6A 1UZDA 1FDYA 4H6RA 2TMDA 1FFUC 4RXFA 2NVDA 4YS1A 6REQB 3OQEA 1GERA 3VKBA 1XIFA 1E15A 2FFIA 3FDGA 2DW7A 4WJEA 4O8AA 2YL8A 1PIGA 4IGMA 4DNMA 5A2BA 2GDVA 3S4TA 4XAGA 5AC6A 3RYSA 4QE1A 1WXJA 2FTPA 1A5OC 4YWIA 2VZTA 5AC8A 4HU0A 3G3DA 1XC6A 4H4RA 3ARQA 4NXKA 5I3JA 3S5OA 4I7UA 1OC7A 1XRVA 4MB1A 2I57A 1X6NA 2HJPA 1YKWA 2X42A 3NR0A 3S46A 4JYFA 3R4IA 1LG2A 1PKLA 1EOKA 4P2VA 2GGEA 4DWDA 2YW3A 4FPSA 3IWPA 3EOEA 1BYDA 2NV1A 3OHIA 4NEWA 2CEQA 4CCDA 3MI6A 4I5XA 5CXPA 1B9BA 4A2RA 2PDNA 1N82A 3VNYA 4Q8VA 3M5ZA 1R46A 1W2PA 3B8VA 4J1OA 5G4EA 1C8VA 2PLJA 3S6TA 1O7AA 1W1ZA 4W84A 5EMLA 1P7TA 3W2KA 4JTSA 3EOUA 4IGSA 5T91A 3DESA 1EP2A 1MO0A 1DWGM 3E38A 4IIHA 3UW6A 1US0A 2BCPA 4AZHA 1LOSA 4UZUA 3EB2A 3D0CA 3SN1A 2PD9A 3IRSA 3USZA 3WH5A 1FCQA 1VEMA 4NZCA 1GTEA 3B0UX 4LVGA 4K39A 2IPGA 4GJJA 1VFUA 4AFYA 1M03A 3CAKA 1ZX9A 1YE6A 3ITVA 1TR9A 3QZAA 4L64A 3KL3A 4WKHA 2ACUA 2J7EA 1CLXA 3P84A 2J75A 3DX5A 1YDVA 2YKKA 3KXQA 3WBYA 4N42A 2FZDA 1HKMA 2BOFX 1NFGA 2WM1A 3R11A 4UWMA 1GQJA 1KTNA 2JGYA 4DZIA 2HE8A 2PZ0A 3TSMA 5KVHA 2X1RA 3WQFA 4DQWA 1DQUA 3DOPA 5GQBA 3GXIA 3UR5A 3VFCA 2AKZA 2YDAA 3LUTA 5ER0A 3N34A 1YW1A 1UR3M 1YXYA 2QAFA 5CEWA 4LA1A 3ZR5A 3TU9A 2J7DA 1FA2A 1M01A 1AOGA 3W0KA 1B31A 3VE7A 4IMEA 8XIMA 1UROA 4GYKA 5EYWA 2GVEA 3H55A 2VRJA 3GIYA 1Q6LA 1POJA 4W88A 4ZOCA 1XUZA 1GOMA 2G3NA 2GLKA 4H8VA 3DH7A 4R34A 3RPMA 3CIVA 4PUMA 8TIMA 3P3BA 1V6XA 1H4PA 2Y8UA 1VDVA 1MNZA 3CL6A 2JFEX 4L5ZA 4U31A 3RIKA 1I2OA 3G1FA 1FWGC 4L6HA 3HGRA 4Z1DA 3MVTA 3VXGA 4REQA 4DELA 3AWOA 4XX6A 2ZUMA 2OMAA 5D9NA 4PMOA 4DJEC 2AGTA 3IVTA 3WQPA 3CHDA 5TBOA 1CXFA 4S3KA 1MZRA 4Y2WA 3TJLA 3URNA 2PC4A 2QPXA 1GKPA 4NF7A 1RCOB 4IG2B 1C8QA 4DWSB 1HJWA 2IQTA 5I7GA 4JIEA 4APNA 3QC0A 1DIDA 3CHEA 1RY8A 1JEZA 3OU8A 3W1TA 4N9BA 3B9NA 1M7XA 3I65A 3BK0A 3FVMA 4UXDA 4TUFA 4Y7EA 2AQOA 2ABAA 2OSWA 3DN5A 4J28A 1C7TA 4DZAA 2DZAA 1SJDA 1MQPA 3TYEA 4HHMA 2OLSA 4V2XA 1FWFC 1MQRA 2RDTA 1O94A 1LYXA 4O11A 3P8JA 3N19B 3FYOA 1A47A 1KFWA 4QE4A 2WOIA 2VURA 1L0PA 1P0DA 1JJKA 2GQ9A 1MEIA 5FESA 4J7RA 4O52A 3VKJA 4HA4A 1OADA 4E5TA 5CG0A 4EPEC 4DAFA 1F7BA 4H7CA 4YPJA 4WXZA 3I10A 3PTKA 4ZVJA 3D9XA 4RCXA 1SW3A 4LAKA 4HQVA 4PMDA 1PCWA 5C7VA 2XTKA 4YYCA 3M9YA 3GIQA 1QU4A 2UY5A 5KEZA 3CO4A 2ZDSA 2BY2A 1X96A 3UWZA 3A22A 1JG9A 2W62A 3KAOA 3N11A 1UC5A 5DXYA 2E3ZA 1DHKA 5LA2A 3UA4A 3W76A 3W7HA 1EJWC 4F0RA 1WDRA 4HD5A 3IGUA 3LTPA 4ZB5A 3T40A 3VGBA 1WCGA 1X8CA 2VDHA 1NH6A 3RXZA 3L0KA 5LYRA 3CMGA 4B92A 2FZ9A 2VDIA 4PSPA 2VFDA 1O5KA 3VOIA 1N8WA 3CO8A 2ZX5A 3H2AA 3WLOA 4GX8A 4BV6A 5KMYA 4ORIA 4K38A 4PB5A 2RFGA 4GCAA 1CX9A 3FEMA 4HNOA 3IRDA 3PWAA 3S1GA 3NEVA 3WNKA 4JY9A 2EHHA 2O4MA 4Q7NA 3V16A 1TV5A 1GTHA 2BLEA 4MTVA 4H6EA 2DFAA 4O0ZA 3BJFA 1HGYA 4Q4MA 3MJMA 3BLLA 3B9AA 1RVGA 1TMHA 1FEAA 1OIFA 1XLEA 2DIKA 2Y89A 3T44A 3BVJA 3P5YA 1CDGA 3FK4A 3WQ4A 3HG4A 1B1YA 4FAMA 2PD5A 3DAQA 3N12A 5AC7A 3EPNA 3WLRA 1WKDA 3LV6A 3AS3A 5CPNA 5LIYX 3AYVA 4H4XA 1CCWB 3FEQA 3O0KA 1S2WA 4H8UA 5HINA 1UWRA 2P53A 1XBZA 1LG1A 1UJPA 1UR4A 1M9HA 1YX1A 3V0UA 3GHUA 3BL3A 1LOQA 2EKGA 3NQFA 3ZWSA 4N4QA 4JS3A 3WUGA 4M5PA 3H22A 5E0CA 3G1AA 4BI7A 5XIAA 5EL1A 2BP1A 3FDKA 2QCFA 1YPIA 5D9PA 4AC7C 2GK1B 4N7QA 1BF6A 3OZYA 3DECA 1K3UA 4DUXA 1CNVA 1BRLB 5C9WA 1AZ2A 2ZXBA 4OT7A 4RW3A 1PEZA 1PX3A 2VVSA 4OWGA 4ZOEA 3APTA 3PTMA 4NUWA 1UG6A 1T7LA 4IIDA 3AFBA 4L1GA 5EFDA 5IXEA 1XWYA 2XUCA 4W85A 3SY8A 4YXGA 5C54A 3MHUA 4DVOA 2ODOA 3VKAA 3UXLA 3QVQA 2NXIA 3FY1A 4L6OA 3DDMA 2GFTA 5D2XA 1OG6A 1R3SA 3ES7A 2VCAA 3I3DA 3UFYA 3G22A 1OIMA 3P62A 3GTHA 3AN1A 1V3MA 4DI9A 2JQXA 3QW4B 4H6KA 4YWOA 4DJFC 4O1DA 4LUTA 3COTA 2C16A 2VEKA 1RQEA 3PZMA 4L4OA 2Y5SA 3ZFHA 4WY0B 1FFVC 1V0MA 4HOXA 2Z7KA 2VGGA 1GWJA 1GT8A 1XV8A 1YBQB 1TVPA 4DF2A 1JZ5A 3DJGX 1K4HA 3PP7A 4IPLA 3U48A 2O56A 2ZWYA 4EQWA 2A3BA 4K8EA 1H3GA 4MUZA 1PYMA 3VIMA 1RK6A 3W2UA 4Y6GA 2OQYA 2WWDA 3G1HA 2QPSA 2GVGA 3RDKA 4LPCA 3C0JA 1ADSA 2JIEA 4Q4OA 1IHIA 1NEYA 2ZRYA 3ALGA 1LJYA 5MKGB 3CAWA 2J6XA 4AVOA 2I7GA 1M7JA 5I2UA 2G95A 1M53A 1XSIA 1TZ9A 1NTHA 2YLAA 2Q3OA 4H4WA 1F74A 5G5IA 4XO7A 3LGGA 5M17A 4NRRA 3KOWA 3VGDA 5DBTA 4GUIA 4ATWA 1RCQA 2VM8A 3NQDA 1TQXA 2EJAA 4JQ1A 1W9VA 4Z0JA 2VI0A 4JN7A 5HMEA 1TRDA 3QYSA 2OOFA 2YBTA 1SFTA 4ES4A 3CB3A 3N2BA 1BVZA 2X40A 5F4WA 4FZIA 2OQLA 4E8DA 3O6AA 1HKVA 1JRCA 3EOSA 2Z25A 4QITA 1HP5A 3OBEA 3VGGA 4RPPA 2ZZ5A 4IIFA 4DO6A 1LRNA 3BGJA 3PG8A 2JF7A 2NXHA 5DEZA 2PDUA 4MVAA 3CTTA 2ZZCA 3WFAA 4PMXA 3WSUA 3T81A 4HNNA 3WDHA 1TMQA 3BCDA 1P7TB 1OF8A 1FHDA 1H49A 1GOXA 2GSHA 3RLHA 5AC5A 4GIAA 1EA0A 4U5IA 1D9EA 1F07A 1NWRA 3LV5A 3QV6A 1DE5A 1J8VA 5DMYA 4TVWA 2CIPA 2EG7A 1Z48A 2NUWA 4I8YA 2A79A 2V68A 3RUBL 1ZY8A 4PUDA 2NUYA 4J3SA 2D24A 4YN5A 2I14A 1OFDA 3LZ5A 3SSZA 2QXWA 4J40A 3CTLA 3PANA 1KB3A 1YQ2A 4E2VA 1VIZA 1FKWA 4BQ2A 3QW3A 2V69A 2NQJA 1UD3A 2YXOA 2ZA2A 4P8WA 1DVJA 3HJEA 5H8UA 3EF6A 4ILSA 4XAPA 1QDSA 5HMFA 1BEUA 2YCJA 3W1LA 1BYAA 2HXTA 1WOBA 4GVGA 1FY6A 1ZJHA 1Q1WA 4F8XA 4HJWA 1TV4A 4V15A 1DJZA 4KRUA 3VC6A 2QW5A 3GUWA 4RZ5A 3PK7A 1KV8A 1TFVA 1UR2A 2XISA 4C60A 4GQGA 4TTGA 3LK6A 3O1NA 1A5SA 1HXJA 2RKXA 3F1QA 3U3HA 4GZJA 4AHOA 2XU2A 4EWND 1XQKA 3AXHA 5HWMA 3WLJA 1DEDA 1FP9A 3VDCA 1S1PA 1TPWA 3DI0A 2C3ZA 3R12A 1D3GA 3P7YA 4NNCA 2X1IA 3MV11 3FSUA 1BYBA 3IV8A 2VZVA 3PTQA 2XDFA 5D33A 3VCRA 2GOKA 1PV8A 4ROPA 2MUCA 3T0TA 4QJ4B 4MSSA 2CBIA 3GZAA 4ICNA 1ZALA 1B54A 2OG9A 4H9ZA 4REQB 3T4CA 3U9IA 4JTGA 1PDYA 3E5BA 1JUBA 1M68A 2J88A 1AMYA 4P8UA 1GXFA 3THAA 2DH3A 4Z2KA 2WAGA 1P6BA 3TAKA 2PCQA 4EXQA 1ICQA 4AHQA 4E6MA 5CKSA 2WPCA 1KFBA 4ZFCA 3ZT6A 1L2QA 1PZ2A 2J27A 3SADA 1TV8A 2A3AA 3LDVA 3QM3A 1S5TA 1YDYA 3OLGA 1WP6A 5AHEA 1GZGA 1E5JA 1Y5XA 2Z6IA 4L56A 4J2MA 3W29A 5A8OA 1UC4A 2HRWA 1AK5A 1AFSA 1CGXA 2E9BA 4AHPA 3P80A 4I7VA 3AYTA 1VBGA 3ISIX 5BRQA 5DT7A 2BODX 1EBDA 4QSFA 1STZA 1WDPA 1YADA 1VCVA 2BC0A 2V2CA 4P7LA 4RZ4A 2KAUC 3QQ0A 3P5ZA 2F9RA 4FR6A 3QY8A 1L6GA 1VR6A 3EDJA 5U25A 3BLPX 4DIAA 3UP8A 3RK8A 1VENA 1GJUA 5B80A 1R6WA 3K2GA 4V1YA 4AIBA 2ZVRA 3PVFA 2C0AA 5C2CA 4TOQA 3PZNA 4DPQA 3VVGA 1BXBA 2E5CA 3DC0A 3THDA 1GONA 3HG3A 5DBUA 4X9YA 3TZNA 5A6KA 4NP7A 1YLVA 1K7EA 5FF0A 1L9WA 4IIGA 4AW7A 4C5YA 5CGTA 5BWFA 2QYGA 4RDVA 3I6TA 2YB1A 3OOQA 5IDZA 3TMQA 2H8ZA 1YTDA 3TX9A 1H50A 1H7OA 2DVXA 1ZRQA 1K9DA 2OJPA 3ABOA 4HHPA 2B0MA 4CU7A 1PZ3A 1ONRA 1IEQA 2I5GA 4C6DA 3NUKA 1W5QA 3RLUA 4G7FA 1R30A 3SCPA 3QN3A 1R2RA 1ZAJA 4LVFA 4MAVA 3QQWA 2V8ZA 5A6BA 3O6YX 5AYXA 3WD1A 3VU2A 3WELA 4AZ5A 4ZCWA 1CT5A 3SM0A 4AZBA 1UOKA 4NSBA 3CB8A 1QNOA 2CHOA 3UZXA 1FDJA 3UPWA 5D2YA 1H5VA 1XQLA 2OKOA 1KQYA 3SCNA 4FX7A 1SVDA 4X0NA 3P0WA 3N29A 1IEIA 4NRSA 1REQB 6TIMA 3PFMA 4EIVA 2ZA3A 4AXKA 3W85A 2CKSA 1XYBA 1OT2A 5TNVA 1DJYA 2WJZA 1E4LA 5B7ZA 4ZXLA 3CGCA 2TRSA 3W1PA 5JH1A 2DU2A 1H11A 2C71A 2DUZA 4CVWA 2XN2A 2O9RA 3GW3A 1ONWA 4XSMA 4GVFA 2Z1BA 1F5ZA 2YR1A 3BV7A 1H7XA 4CN4A 3GKAA 1R2TA 4GBUA 3AQUA 1IWAA 4LCQA 1N60C 4JR5A 1SJAA 5HR7A 5J04A 1UPMB 3DIPA 2YLLA 2FIQA 4HK7A 3RRAA 1L8NA 4YTTA 3WX7A 3DBNA 3E96A 3R8GA 4MHBA 1E9ZB 1VYPX 4INFA 1FKXA 5F4SA 1BWVA 5SWUA 3M6YA 4GMEA 4UCGA 1TPDA 2VRQA 4EANA 2FGZA 4H2CA 1QK0A 3GD4A 1GETA 4GR1A 2B7PA 2CLKA 3K4WA 4JNZA 4XVEA 3PUDA 4V1XA 3VNIA 4CQDA 4YYFA 4F3HA 1SO4A 4EQXA 1UJQA 3MUCA 1C3FA 4LBSA 2Y6ZA 1CGVA 2ZDRA 4IIBA 4JXCA 1X97A 4Z17A 3POCA 1S1RA 2V9DA 4DI8A 4H4PA 1IXNA 1UWIA 2VR2A 5E9AA 1A50A 1J9YA 4FIRA 2PTYA 2PFHA 4F48A 3UBPC 4ENLA 3SY1A 4UZSA 1OGGA 3KVMA 1RBLA 1LZOA 4S3BA 1I1XA 4C6OA 2WBGA 2DGAA 4IICA 3W70A 3KHDA 3N9RA 1FH9A 5CJ5A 4H2HA 4C7FA 2Q09A 4HZMA 4QJ1A 3VIIA 1MMFA 2W3ZA 3DGRA 2QUMA 2YOCA 1SZGA 2HMCA 1Q6FA 3BW3A 3VX0A 4PA8A 4M8UA 4HU4A 3A3WA 4E38A 2VELA 4IQLA 3GXFA 4J3TA 3T42A 4WDXA 1DJQA 4AY1A 3CWNA 4IGNA 6XIAA 1EJ7L 3V1HA 3RNMA 3CMJA 3GW0A 5TD4A 6TAAA 4HCLA 3VNKA 3FSTA 4JD4A 4DO5A 3QOKA 3THQA 3FLUA 2WC7A 2P1FA 3S5ZA 3NVVB 1JUEA 2IKHA 4UQ9A 4XBJA 3AJ7A 3AHYA 4H7VA 2PDJA 1CXEA 3HB9A 1W1TA 3AIQA 4QR6A 4EQRA 4D6JA 1VFMA 1UWQA 1CTNA 3ZLGA 4W8AA 1ONEA 2HS8A 1DIKA 2ACRA 3ZS4A 2NQLA 1XYZA 3F2CA 4UTTC 1W17A 2CERA 3Q45A 1XINA 4LNYA 3FYPA 4XKMA 1PTAA 3N2MA 3MDWA 1Q7QA 4Z2IA 4K8HA 2WKGA 2CLIA 3V35A 1Q6CA 1EXPA 3D47A 4W8LA 2X1UA 3W24A 2IQ0A 4LAZA 4WK9A 4PMZA 3U2ZA 4WLCA 1C29A 3UY8A 3OO2A 3MDUA 2FZ8A 2BTMA 1G0CA 2XGBA 9XIMA 2OT1A 3G1YA 3AS0A 3N2XA 4PH6A 4I6VA 3MKVA 3W7KA 4TV6A 4HPNA 3HQOA 1GVIA 3UG8A 1DJHA 1PSCA 3PNZA 1TMLA 3M07A 4H4UA 3ERPA 1J6PA 3URQA 5LSMA 1BWCA 3PN8A 2FZNA 2RDUA 3PZTA 1GJPA 4HN8A 3KOFA 4DXVA 3LOTA 4HK6A 4QAWA 2D2JA 3RX3A 3DBPA 5FD0A 2X16A 1B3YA 4BF5A 3NQEA 3OIHA 3S8HA 2ZZ6A 5M2FX 2QUTA 2WWCA 3GYCA 2CLFA 2R1MA 2CFYA 3RM8A 3U2OA 1VS1A 4LV9A 2AQVA 4KT2A 5H8MA 1TV7A 3IK2A 4XWUA 5CAKA 2XFWA 3ME3A 2ZUTA 2I5IA 3LRKA 1TPC1 2W55A 2WC4A 1XSKA 3BPWA 3URBA 1GEQA 3SQLA 2CXGA 4MWAA 5IHRA 1Q1RA 4MJMA 2BOEX 3TW9A 1KBKA 3UPMA 4PCTA 1PUDA 1SSDA 4O17A 3DXIA 3QFEA 3KOYA 3HGSA 2C19A 1LQ0A 1GQLA 3WF4A 7TIMA 1W9XA 4ATLA 3SCOA 2FKPA 4Y9MA 4ZE5A 4PUEA 4D8AA 3RU8X 1ZUAX 1K4QA 2X8CA 2DZUA 2XVKA 3B9OA 1NM9A 4K7VA 1NP0A 3UWEA 2NSXA 1VFOA 4RNIA 3M7SA 3ABSA 3N3TA 4ZXOA 1YDOA 4BWLC 3GG8A 3VNMA 1L6WA 2V5JA 4MYXA 3WBAA 1JQVA 1EJSC 2NXGA 2ZZ2A 1ITXA 2NWSA 5LNWA 3EXTA 2WYSA 1BQCA 4PUJA 4MJ4A 5EB8A 5H2ZA 2E68A 3L4TA 4FOJA 1WDWA 3GNDA 3JW7A 5REQB 5AB3A 3SEPA 1ZSXA 3UZYA 2XFYA 3NG3A 3SUVA 2X1TA 1R3VA 4JTKA 2VZUA 1J0IA 3H4GA 3QBUA 1RUSA 1S39A 3RO6A 5A95A 4AYGA 1ELSA 4JN6A 2NX9A 5CPSA 3UJRA 1QW7A 5HQLA 2PLMA 3W1UA 1WKFA 1NDWA 1UD8A 4DUOA 1F6KA 2W66A 1D2KA 4BEQA 3LS9A 4G1KA 2B7NA 4KS0A 2YDRA 1OY0A 3ABRA 3I4EA 3HRDC 4PSRA 1WZLA 1NDZA 1UOZA 5FAGA 4M7SA 2YA1A 2A0NA 1XLCA 1XDMA 1TCMA 1FWCC 1YHTA 2YSWA 4QSHA 5FEZA 5A8PA 4K1GA 2V0TA 2E6AA 4AU0A 1H09A 3FJNA 2YFNA 1N8FA 2BX7A 4GNJA 2VC6A 4LBUA 3HFTA 4LH8A 2TYSA 1P5BA 2BG5A 1XSJA 2YL5A 4GUGA 4Y90A 5U7SA 3TLQA 3MZNA 3N2CA 1X1OA 1XLIA 4JPGA 1HUVA 3R1ZA 5BWAA 4Q4QA 2PDIA 3A4AA 3L5AA 3LG3A 1E4IA 3CWOX 9XIAA 5G2WA 4XK2A 1SFLA 1YTEA 5C9UA 4LRSA 3MSGA 3NURA 4FHAA 4RW5A 4NXSA 4A8RA 5A2CA 1E6PA 3N4EA 4OV9A 3NA8A 3MMWA 4FNRA 2Y4SA 2Y7DA 5D8ZA 2W4XA 2YBUA 2J47A 1TPH1 1DXFA 1F3EA 3KBWA 1ENUA 3EKZA 3VUSA 2BVDA 4CCZA 4XBKA 3GIPA 1AD1A 5AZ0A 2NSOA 1DTUA 1TJRA 3TNBA 2NVCA 4WEVX 3GXTA 3G0SA 1GJWA 4HOWA 3QMRA 4HU3A 4W86A 3BLOA 3H2FA 3R94A 1G1YA 5E0KA 4BI6A 2X41A 3AO0A 2VZSA 3DGHA 3FG2P 3QLDA 3GTFA 1UW9A 3C2RA 1NWTA 3FA4A 3FXYA 2VWSA 4D72A 4GYPA 1HVXA 4QBXA 2VVNA 4NY2A 4ZOBA 3BCFA 4QLJA 1IIGA 1R87A 2BV9A 4LEQA 4E4UA 4O12A 2JGQA 4F66A 5HNRA 1IGWA 5GJMA 2RGMA 4LU0A 4HA0A 4IJBA 4Y9NA 2ZRXA 4OGZA 3SN4A 2QR6A 5DELA 3UT0A 5KZEA 4AZ6A 2YW4A 3HPSA 2VT0A 3L0NA 1Q66A 1HKJA 1VYRA 3ECQA 3AMZA 3BAYA 3MA8A 5D03A 3SRFA 4H4ZA 3NCOA 2AAAA 2F2KA 4O28A 4B5VA 4LANA 3IJQA 3TC3A 1ZTVA 5D02A 3EYPA 5M5DA 1GVRA 4MNKA 4E8CA 2J7HA 5JMUA 1JFHA 3P74A 1D3CA 4S23A 3NNTA 4IL0A 1IT8A 6PTDA 3U2CA 2W61A 3ATZA 1U1UA 4UFMA 1AJZA 5IRPA 3ANVA 1X7IA 4DO4A 4KEMA 4IQJA 3N18A 4DBDA 4PODA 1T6MA 1XX1A 1FX6A 2LLEA 3ITLA 3CLWA 3CT7A 2R6OA 5D38A 2QNEA 3ATYA 3N14A 4WRHA 1GOKA 4AWSA 4NZJA 1OFAA 1L8PA 4DO7A 5D8WA 4J3VA 3EKLA 1SSGA 4ML9A 4GYJA 2ISDA 1N62C 1XP3A 3LERA 3KOZA 3C2YA 3AIEA 2NX3A 1ZY9A 4FF7A 4NZ3A 5JCMA 4GY1A 2GR2A 1EWEA 2SFPA 3BLEA 2E28A 3QGAC 1QI3A 3CUFA 3R79A 3ABXA 4KFOA 1J79A 4L65A 2VENA 4S3FA 2JALA 3BXWA 1UD2A 1S5VA 2PUZA 1TVNA 3LLDA 1CECA 3E0WA 3EB3A 1JCJA 4EQSA 4IJRA 4OHQA 4AD2A 5CZJA 3PPHA 1SJCA 3QLLA 1S7MA 1Q5MA 4HSOA 1DP0A 1RP8A 1XLGA 2ZX6A 4UNKA 3XISA 4O14A 3AM9A 5JVLA 5KVIA 4IT1A 1QHOA 4KIRA 1QPRA 1E70M 1BTCA 2WZEA 4EPDC 2IKGA 4CNUA 1A0CA 4O54A 2FQIA 2VEGA 3GDRA 3BSGA 4PCFA 1J0KA 3A9BA 2QIWA 2PTXA 4ZR8A 2G8ZA 1D8WA 4A8IA 3BICA 5T26A 1UMLA 3WEMA 1HL8A 3B0VC 3E1F1 4M6UA 1UQZA 1EHAA 4A3QA 2KZHA 3KHJA 1WDDA 3OBAA 1Z32X 4MFDA 4JIIX 1JDCA 4L9XA 4F0LA 2WBKA 4FB7A 4UTWC 3IARA 2YL6A 2X09A 3SZ8A 4AWEA 3TH6A 3GG1A 4AYSA 3TROA 2WSQA 2Y7FA 1R5YA 1RV8A 1Z41A 2YCIX 3EBVA 1JPDX 4KFNA 1NAL1 3LPGA 3R07C 2WKLA 4I6KA 3XIMA 3ZZ1A 1D7FA 2TAAA 1E1CA 2PDLA 3MW7A 4KEUA 1CENA 5AHLA 3USBA 3W9ZA 3T05A 3GK0A 1LBMA 1XW8A 3OB8A 2BB0A 1DJNA 2NWRA 3GHRA 3WH8A 1GRFA 1QMLA 1XHGA 2P50A 2ZUSA 1PVNA 4WR3A 3GC4A 5JCIA 3FVDA 3BW2A 1WDSA 3B97A 3PG6A 3AZTA 1ZXIC 2CHRA 5FEWA 1KW1A 3H53A 4WXYA 4FXJA 3MS8A 4FMVA 1KCXA 1LBLA 3NVWB 1M6IA 1NQ6A 1JF6A 4FLSA 2WOWA 1EDTA 3CAVA 4AZCA 3B9DA 4FF5A 3PWGA 3LTYA 2F38A 3FKRA 3TE9A 5BZAA 5AZ1A 2QUNA 4JFVA 1E3ZA 1H1YA 3IJ8A 1UBPC 3HO8A 3QYQA 5LIXX 2WZTA 1G4PA 4UTKA 1J0ZA 5HANA 4DF1A 3L65A 1TPEA 1SYTA 2PDPA 3INPA 3DG6A 4AXNA 3ARSA 4WJXA 4JQ4A 1E3XA 5FJTA 1OFOA 4DAIA 2ZQ0A 2DZBA 2NV2A 2VL4A 2PDGA 1WPCA 4XZNX 3PAOA 4HHLA 3AS2A 2BVYA 5FIPA 1E6NA 1XUUA 2OFJA 2A8XA 1KGXA 5I09A 4I9TA 1P1XA 2ADAA 5BU6A 1JDEA 4UOZA 3UZWA 2E8ZA 4JTEA 4GY0A 1FH7A 1TTQA 2DJLA 1OJTA 3ALFA 1X2HA 2D0HA 4GWEA 4KWVA 5AYIA 1PX8A 5M3WA 3LEPA 5A6BD 3WLTA 3TC7A 4HCDA 1T8QA 4JTHA 2JEQA 4MJZA 1OJXA 1U1JA 4H04A 2CZ5A 3LADA 3F2BA 1E0TA 2V5KA 4UR7A 3SCVA 2R91A 2QF7A 2A3HA 4MWAB 3A64A 1DIEA 3QV9A 4P7NA 1X38A 1Q6QA 3VPLA 3E2QA 4KEVA 4QS5A 2WQDA 2V81A 1MZHA 4GO8A 1H41A 3PY2A 3BMVA 2A7NA 3ITGA 2ICSA 4CNPA 4Y8FA 4UOJA 3BMXA 2E1WA 3T8LA 4B5WA 4YL2A 4OUIA 1E73M 1S2UA 1POKA 4H6QA 5JBDA 2DH2A 1V4YA 1IEVA 5C9RA 3W27A 5FJPA 4IFOA 3URAA 3UVAA 4XUGA 1D3HA 1FO4A 7ODCA 1X6LA 3DUGA 2W9MA 1ALDA 5KZ6A 3REQA 3MI2A 3TEVA 4DNHA 1IGSA 3WD4A 3WMBA 3TSBA 3M5VA 3UG3A 2I9UA 4QDMA 1B30A 5F2GA 3WUBA 2RH9A 4Q7IA 1DWFM 3QGVA 3EWWA 4J3ZA 4IFK