3R10A

Crystal structure of nysgrc enolase target 200555, a putative dipeptide epimerase from francisella philomiragia : mg complex
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
362
structure length
362
Chain Sequence
VSKIIDIKTSIIKIPLKRTFITAVRSTNHIDSLAVELTLDNGVKGYGVAPATTAITGDTLQGMQYIIREIFAPVILGSDLSDYKQTLELAFKKVMFNSAAKMAIDLAYHDLLAKEQDISVAKLLGAKANSIVTDVSISCGNVAETIQNIQNGVEANFTAIKVKTGADFNRDIQLLKALDNEFSKNIKFRFDANQGWNLAQTKQFIEEINKYSLNVEIIEQPVKYYDIKAMAEITKFSNIPVVADESVFDAKDAERVIDEQACNMINIKLAKTGGILEAQKIKKLADSAGISCMVGCMMESPAGILATASFALAEDITVADLDPLDWVAKDLYSDYITFNEPNIILKDNLKGFGFNLAENLYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enzyme of enolase superfamily
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Francisella philomiragia subsp. philomiragia
molecule tags Lyase
total genus 118
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3r10A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3r10A01
2PCEA 2QDDA 2HZGA 2OLAA 1W6TA 3SSZA 3P3BA 3TWAA 3GO2A 4GISA 3DERA 3T4WA 2CHRA 1IYXA 4M0XA 1XS2A 3UCCA 3OZYA 1FHVA 3UXLA 3VA8A 3R11A 2DW7A 2XH7A 1RVKA 1SJBA 2NQLA 1KKOA 3PK7A 3CT2A 4FI4A 4IP4A 3RO6A 5BOEA 3IJIA 2OZTA 4GIRA 2FKPA 2OVLA 5J04A 2QVHA 3V5FA 3BOXA 3OP2A 4HCDA 5FJRA 2PP0A 3DDMA 2XH2A 5FJUA 1XPYA 3N6HA 5FJOA 3CYJA 1MDLA 1MRAA 4MMWA 3TWBA 3OZMA 1ECQA 3RCYA 4E6MA 1NU5A 3Q4DA 2PS2A 2PP1A 3FCPA 3BSMA 3HPFA 3UJ2A 2OPJA 2OKTA 2PTYA 1WUEA 1P43A 3ZLFA 4DWDA 3N4EA 3N6JA 3N4FA 4IL2A 3JZUA 4E5TA 3U9IA 4MKSA 3MY9A 3PWIA 2ZC8A 4HCHA 2OZ3A 2PGWA 3VFCA 2GGHA 4DHGA 1JPDX 1JDFA 2PU0A 1P48A 3EEZA 1R6WA 2AL2B 4M6UA 2GDQA 4ENLA 4E4UA 2P3ZA 2PTZA 1TKKA 3JVAA 3K1GA 3TW9A 2AKZA 4IP5A 3VCNA 4Z1YA 2P8CA 4KEMA 4X2PA 5ENLA 3JW7A 2PTWA 3MZNA 2PU1A 4HCLA 2P8BA 3TOYA 1WUFA 3DG6A 3H7VA 3GC2A 2GGGA 4JHMA 2OO6A 1F9CA 4DYEA 4KWSA 2HXTA 4DX3A 3MWCA 3STPA 3ES8A 3Q45A 3R1ZA 3I6EA 3QLDA 2HXUA 4H83A 3UJFA 2OZ8A 1DTNA 1EC9A 3UJSA 1R0MA 3ENLA 3DGBA 1SJDA 5EU9A 3EKGA 3DEQA 2AL2A 4HNLA 2QDEA 3R0KA 1MUCA 3THUA 2OQHA 4JN8A 3MUCA 2P0IA 3RGTA 3OPSA 2RDXA 3H12A 5IDZA 3UXKA 1ELSA 3ZLGA 1ONEA 2POZA 6ENLA 4MGGA 3S47A 3MQTA 4H2HA 4K2SA 2AL1A 3R25A 4ROPA 4ZA0A 3VDGA 3UJRA 3VCCA 5FJPA 3FV9A 2OG9A 2GGIA 4ZCWA 4E8GA 1PDZA 1EBHA 3P0WA 1TZZA 3RR1A 1EC8A 2QQ6A 2AKMA 2PSNA 3QTPA 4IL0A 3S5SA 4JN7A 4HN8A 2O56A 3IK4A 2PMQA 3RRAA 1BQGA 3DFHA 3TCSA 3SJNA 3OTRA 3NXLA 4K8GA 2DW6A 4GYPA 3BJSA 4Z17A 1EC7A 3DG3A 3FXGA 4E4FA 4GYPC 4DXKA 3R10A 2XH4A 1MDRA 2QJMA 3DIPA 3FVDA 3CXOA 2HNEA 4F4RA 4G8TA 3T9PA 3ZVIA 4HYRA 3KUMA 1PDYA 3QKEA 3ZLHA 3CAWA 4HPNA 2PTXA 4GGBA 2MUCA 2PA6A 3H70A 1KD0A 3H8AA 5FJTA 2ONEA 2GGJA 3T6CA 3DESA 1L8PA 3MSYA 3T8QA 1EBGA 3I4KA 4J3ZA 1BKHA 4KPLA 4IZGA 3IJQA 3V5CA 2OQYA 3OW1A 3MKCA 3PFRA 2GL5A 3SN4A 4GFIA 1OEPA 3TJ4A 3UJEA 3B97A 3ES7A 3NZGA 2ZADA 4GMEA 1JPMA 3ZVHB 3DG7A 2QJNA 3NO1A 3QN3A 3V4BA 2OX4A 3D47A 3SBFA 3TJIA 4A35A 4K1WA 1SJAA 2GGEA 4IT1A 2GSHA 2MNRA 4A3RA 4A6GA 1KCZA 4KT2A 2PPGA 3RITA 2QJJA 1FHUA 3GD6A 4J1OA 3SN1A 3D46A 3SN0A 1E9IA 3NFUA 2FYMA 3FYYA 1YEYA 3QPEA 4IHCA 3I6TA 4HNCA 3V3WA 2PP3A 3TTEA 1SJCA 4FP1A 2P88A 2QGYA 5BOFA 3VC6A 4DN1A 4EWJA 1JCTA 1TE6A 3ZVHA 4H19A 3TQPA 4GGHA 3CB3A 3U4FA 7ENLA 2XSXA 2XGZA 3DFYA 4YWSA 3P93A 4G7FA 1KKRA 2I5QA 3FJ4A 2OFJA 2XH0A 3PWGA 3CK5A 2PODA 1MNSA 3IJLA 3R0UA 3SQSA 4H1ZA 2PGEA 3UGVA 3GY1A 3VC5A 1NELA 3UCDA
chains in the Genus database with same CATH superfamily
2QAPA 1R9YA 2EG8A 1O95A 3NQ7A 3RPDA 2PLJA 1LL7A 1HGWA 3F2BA 3U57A 3NTYA 3W88A 4WXZA 1F3XA 2R8WA 1XM3A 3BL3A 4IMDA 1W1VA 3UCCA 2WSRA 2VRJA 1UJPA 2GJLA 1TG7A 2J66A 2J25A 2FTYA 2YR1A 2ZUUA 5D33A 3EOEA 3E38A 3GTFA 1DQUA 1QDSA 1BKSA 1S2VA 3VIGA 3VD5A 1JCMP 4Q32A 3EB3A 3N1AA 2G4JA 3ITCA 5I3KA 5CXPA 1Q5MA 1ME8A 3FXYA 1FKXA 2ZVIA 1WZKA 4GI4A 3DDMA 5IBXA 2OZ0A 2CYGA 4CN1A 1OX5A 3PBMA 2DZUA 1HO1A 3TSDA 1Y7VA 2J74A 4PFHA 2JGYA 3FA4A 1VBHA 2O9PA 5FESA 3NA8A 3Q6JA 1W91A 3QF0A 4LGXA 3U2EA 4M7SA 2PTYA 1XIIA 4P7NA 1TX2A 1GJWA 4FPSA 1OFBA 2XSBA 2F84A 1KWKA 1Y5WA 2WJDA 3M0XA 1XLBA 1Z89A 3EWZA 1UJQA 2RJGA 2OZ3A 1FH7A 4GC3A 4H6QA 1V3IA 1JAKA 4HPJA 1PTDA 2ADAA 4Z2JA 4TO8A 1BVZA 3NGJA 4HPHA 3H54A 1H51A 2RKXA 1B5TA 1PB0A 2G97A 1RY0A 3TW9A 3WFLA 1TX0A 4CQDA 1XKJA 2P8CA 1PHWA 3ZJ7A 3MO4A 2ON3A 2PDYA 3IV8A 2PTWA 1VFHA 4Z2KA 2A85A 2NXGA 1H7XA 4AG0A 2QV5A 3GC4A 4OZOA 4MNKA 2YL8A 5JCMA 3QZEA 4PE8A 5DRIA 4JTRA 3CQIA 1J0JA 1I2NA 3WK2A 2YLAA 4DYEA 3KOXA 1GEHA 3WN6A 2QUNA 3I6EA 1E6XM 1CBGA 2EG7A 5A6MA 1PUDA 4JXCA 5FKYA 2WBGA 4NNCA 3EKGA 2RDTA 2RDUA 1JZ6A 4JQAA 3DEQA 3O16A 3H22A 3AJ7A 4J40A 3MTWA 5C6MA 2OQHA 3QTGA 4FX6M 1SZFA 2PFHA 5LGXA 3BW4A 3AS2A 1W3IA 1DVJA 1ONEA 1SO5A 1IE7C 3UY8A 1K9DA 3JR2A 5GNYA 1FEBA 1DQXA 1JJKA 4JTLA 3GUGA 3S6TA 3N04A 3TP4A 5AECA 4ECLA 1UYQA 3WF1A 4WZHA 4DRSA 5C2GA 3T2QA 1EYEA 2OQLA 1A47A 4ERAA 4Q8QA 1TJ2A 3AHZA 4GNKB 3NO3A 1O1HA 3W6YA 1H7NA 3B03A 3CYVA 3TTOA 3S4TA 2O56A 4O8RA 4US5A 2YZRA 1PZ3A 4GR1A 1E4IA 1LBFA 4AZCA 3FNDA 3FG2P 1PYFA 1VFSA 5FF4A 1F6KA 1WYIA 1BD0A 1EA9C 1R8LA 1N62C 2DZPA 2H3DA 2D2OA 3DYMA 1J2BA 4C1KA 3TLLA 3VOFA 3CHVA 4FXJA 4P5UA 1F8IA 1OD8A 4D6GA 3RX2A 3P60A 1F4HA 4YTSA 4JCMA 3FW6A 4J56A 5FS8A 4H4RA 1QPKA 3P5YA 4ZE4A 2X05A 4RR4A 4PBEA 4JFVA 1ML1A 1SU5A 1O68A 3M7SA 4HPNA 2F6UA 1NWTA 1W9VA 2QCDA 3WENA 3PZTA 4HNTA 4ONVA 5AYBA 3BLFA 5G2WA 3H24A 2J62A 3CH0A 4GQGA 2QDHA 1S2UA 1VBUA 3PFMA 4U2ZA 5I00A 3CO8A 2E9MA 3W7PA 2J77A 3QFAA 4HA4A 4BWLC 2ZRYA 4CQBA 3KCLA 2C0HA 3UZ5A 2KAUC 3B97A 4L1GA 4F0SA 2NQZA 4R5EA 1YX1A 3R43A 1UP3A 2TPRA 2WZMA 4NYUA 1C8QA 2BG5A 2YCKX 2W92A 5HR6A 4A35A 2GGEA 1TCMA 2CHOA 2JKPA 4HA3A 1PKMA 3ORWA 4KT2A 2WLZA 1TMHA 3IVUA 5C8BB 1GKPA 1E3ZA 2Q09A 4NQ1A 2DIEA 4MYXA 3H26A 2EHHA 3O0FA 3QPEA 4IFOA 4IIDA 1KXVA 3NL6A 3GK0A 2XFYA 4W7UA 1SJCA 1GRHA 4Y8FA 2Y1HA 2C71A 1VFTA 5CG0A 3SIZA 3O15A 1WBJA 1HF6A 1EJUC 4UQEA 1LRNA 3RJXA 3TXVA 3UG4A 4D6JA 4QP0A 4DO6A 1FTXA 1XDJA 1W1A1 5DQPA 2C91A 3AIBA 4EXBA 4IMAA 2PDKA 4WQ6A 4MUPA 3FJ4A 5E1QA 3PWGA 4PBGA 4JTIA 5BU9A 1SFLA 3ZWSA 2ZBTA 3RFAA 2R82A 1KGUA 1T7LA 4AYSA 1N63C 3VVGA 3N9KA 1HJWA 1VEOA 3VK5A 5HUOA 3KBNA 3AS3A 4MAVA 4X61A 3BAIA 3TWAA 3WKZA 1QPRA 3TMLA 2DH2A 2VDGA 3FVMA 4R53A 1KC7A 5C7HA 4O53A 1AW2A 1UR2A 3A5VA 1EZ2A 3W7RA 1UD4A 3LN3A 1FHVA 4KQNA 1O1ZA 1QPOA 1X97A 3VNLA 4KEUA 1IEWA 3NCOA 4NJKA 1IWBA 1QI4A 3ZXWA 4JIIX 3CT2A 3W1XA 2QF8A 2GR0A 4O4VA 2O92A 2QMKA 3UNTA 1TVPA 4PGLA 4TU1A 4R88A 1W3LA 1ZCCA 3CWHA 1UD6A 3OIHA 3KZSA 4MB5A 1C91A 2HEJA 4C65A 3WQ6A 1BVWA 4RZ5A 3AZRA 4YHGA 2HJPA 3R8GA 4CNTA 1KFKA 4XB3A 3B04A 4DWSD 3ISIX 3UJ2A 3NQCA 4H6RA 3AICA 4ZTXA 5AYIA 1LBMA 5H6HA 1S5MA 4L9XA 1XX1A 5JH1A 1E0VA 1SZEA 2UY2A 3BE7A 3WQ5A 1CI1A 5J5DA 4I5RA 2F5ZA 2GRTA 2QF7A 2WSQA 5LSMA 3ALFA 5CBIA 1GOXA 3ITGA 3Q2DA 3R79A 3LQLA 2J7HA 4NT0A 4L1XA 1UD5A 3MP3A 3LLXA 1SO4A 1JDFA 3LCIA 3WLNA 1VEMA 3PPHA 4YTRA 4ZZ9A 5AVNA 2UY3A 3S83A 2XVLA 1DEDA 1G69A 3DFTA 4ENLA 3TTSA 1TKKA 1G7UA 1LQAA 2EQ9A 1EDGA 1F05A 2G96A 4XIMA 1QATA 1EIBA 5DMLA 2PU1A 5BXSA 3HMJG 4HCLA 3W26A 3V0UA 2WJEA 1PTAA 3URQA 4DJDA 2VUNA 3BG3A 4GFSA 5AYYA 1ZBCA 1Q2SA 1W2PA 3BAWA 3EXTA 1B30A 4QQUA 4EE9A 1PJ9A 1ZCOA 4AZGA 2XWDA 3KL5A 3E0IA 1EYWA 4XO7A 1JDCA 3RAOA 3P84A 1DJNA 3TNBA 2P76A 2GFTA 2WHJA 3UYIA 1RJRA 3N25A 4DBDA 2C7FA 3BK0A 4XD3A 4HNLA 2QDEA 1LUCA 4KERA 2DU2A 3DYOA 3MUCA 2OSWA 1ISXA 3S0CA 2V3GA 3JZEA 1S2CA 1W8GA 1ZRQA 5I2UA 5IDZA 2O0TA 1NOWA 3L2IA 2BY3A 3ALGA 3H4XA 2YZ5A 3PPCA 4CQ8A 4UNIA 2VXNA 4FNPA 5HJXA 3T0AA 2OKOA 3NAVA 1KBKA 1XHGA 1LQ2A 2WZTA 4NZFA 4JAWA 3VDGA 3NZPA 3HQNA 5M03A 2X41A 4F9JA 1QNSA 1EHAA 3BZGA 3FV9A 1WKFA 3LCGA 1V08A 2WQPA 3ANUA 4QITA 2OG9A 2GGIA 4A4AA 5I78A 2FZ9A 3CV6A 3W75A 1I9CB 3GH5A 2W61A 3E5BA 2ALRA 2QCCA 2CC0A 3PBGA 4XZMX 5LZLA 3R07C 3AXKA 3HGRA 1CGYA 3A3XA 2G3NA 1XRSA 3GTNA 2DSZA 1BQGA 2NV9A 3RCNA 4FLRA 1JQVA 1OYBA 2AAQA 2DIJA 4LA1A 2W79A 3ARRA 1F6PA 2WVUA 3LHZA 3VNMA 3EWYA 4RNJA 3CEPA 3AYTA 1K4GA 1WKYA 4UFJA 3FN9A 3O2LA 3PUEA 1UKPA 3QEZA 3W25A 3LUTA 3FXGA 2QPSA 2GLKA 4B2DD 4NI3A 4U3AA 3CB8A 3QW4B 3G24A 2RHGA 4R7JA 1LLOA 1MXGA 4H8VA 3WK0A 4YS1A 4LEFA 4PCFA 2FMOA 2GVYA 3CAWA 3W1MA 1NM9A 4ZO7A 4PMDA 3HFTA 4MWAC 5D37A 1JZ8A 1BRLA 4GY1A 1PV8A 2QDGA 1B9BA 1XBXA 3G22A 1ZX9A 1OEPA 3FSUA 1UC5A 1RM6B 1J93A 3ES7A 1PIIA 4G6CA 3STGA 5F2LA 8XIMA 3QHNA 2QJNA 1TPWA 1Q6DA 3UWVA 2GQWA 1H0IA 3V4BA 3NZQA 1LLWA 5LIXX 1BVNP 1AVAA 1EFZA 3T07A 3VD7A 4MHBA 3GDRA 2ZZ2A 4U5IA 1TPEA 3UPBA 1T6MA 2HSAA 1GRTA 2VD8A 4XD4A 2WB5A 1AOGA 4NAFA 4LYRA 1DXEA 3C5QA 1HTIA 3RPMA 3BUVA 3SURA 3KTXA 1RVGA 4ZFCA 3NNTA 5AZ0A 2WPCA 3U4AA 4LTSA 5A2CA 4A8IA 2V5KA 3W7NA 4JQ2A 1YEYA 1MRQA 1N7KA 5IHSA 2W55A 1F8MA 4IJBA 5CH9A 2ESCA 1LT7A 2P88A 4E8CA 5DFAA 4LVDA 3QC0A 3I6RA 1ME9A 1JFXA 6REQA 2GR2A 1AW1A 4LV4A 2ZC1A 3W70A 3P14A 1GVEA 2Z28A 4PN2A 2HVMA 3A64A 3K30A 3OG2A 3GVVA 1E55A 3CQKA 4QE4A 4HU3A 5GVJA 1TYPA 4Q8NA 1IEIA 4RW5A 4GQRA 4TUFA 1EOMA 2IPFA 2ZRXA 4DZ5A 1A3HA 3O0HA 2QDDA 2ZUWA 1H49A 2QUVA 4GCXA 2Y6ZA 1XLFA 4HOWA 4HN4A 1VR6A 1Q6GA 4RJEA 3QVQA 5TF0A 3W38A 3CZJA 3KBMA 1AQHA 4C6BA 3TLQA 1GOMA 2TAAA 4PMYA 3T7VA 3W7OA 3BGGA 3GNRA 3IPWA 4QS6A 2NQ9A 4O8AA 3A4WA 5HMFA 3DZ1A 4UTTA 1MWOA 1KCXA 2ZIDA 2VD9A 4UTIA 3LZ3A 4L4OA 1UBPC 2CERA 2G3FA 1UR1A 4D6EA 1B0IA 4CNOA 2ZE0A 3M0YA 3EOSA 4DBWA 2VEPA 2VZUA 4IPNB 1GZ1A 2VP8A 4ZMGA 2XH2A 1TFVA 5EBKA 4L6HA 2HWGA 2CZFA 4XUYA 3SJ3A 3SB0A 4KF1A 2H9AA 3ARWA 4ZQMA 1KGWA 1GRGA 5D32A 2WSPA 5H8MA 3V0SA 2GK1A 2Z25A 3DBNA 3ZLFA 2A6NA 2CITA 1Z9AA 3N6JA 1GHRA 4HMCA 4E5TA 4YU1A 4HHPA 4IP7A 4HMEA 5D05A 3PZIA 3W7CA 4GKTA 2OYKA 5HWMA 1XIBA 1UB3A 3T05A 4POCA 1XI3A 1R3TA 1J0HA 3CXBA 1A5SA 4YYFA 4S23A 3DK4A 1MMFA 3TVAA 1J12A 2V8ZA 1R87A 3PVFA 3AS0A 1YXCA 3BG5A 3WQ8A 2WM1A 3W1RA 2PTZA 5F1UA 2PDMA 1U30A 5HMSA 2PBOA 1EZWA 1XISA 3LPGA 3WQEA 3VIIA 3BMWA 2DGAA 4F2UA 1K8CA 5A2BA 4KRUA 1R9XA 5BWAA 4XZNX 1ZLPA 4LS0A 3TOPA 4EOUA 7REQA 1LVLA 2DDXA 3SCUA 3EOOA 3BAYA 4N4QA 3MWCA 4HZ6A 1ZZMA 1DNCA 1GK8A 1JCLA 3UJFA 1XLDA 2CZDA 5BCAA 3GSMA 2QLYA 2R1LA 4QHRA 3R8RA 5H8PA 3ONCA 3PZNA 3UWUA 3VIFA 3MVIA 5DEZA 1ZXIC 1AQFA 1UKTA 1O12A 4XKMA 8XIAA 1LG2A 4D8AA 1YPXA 4D6CA 3KOFA 3RGTA 3TJXA 1LCOA 1RCQA 3RX4A 1PS9A 3CMJA 4XAPA 2NLYA 4E2BA 5IFPA 1DE5A 3W71A 3VX1A 4DI8A 3WFZA 4AIUA 2P5NA 1I60A 3CV1A 2DP3A 3T0TA 1GQKA 1V77A 3A9IA 3HJZA 1CIUA 4YMZA 1XYBA 2DT3A 3AIRA 4V27A 4HSOA 1DWGM 3O6CA 2W54A 1F3PA 3CC1A 3ZJKA 2AOSA 3KVKA 1TCDA 5FL1A 3BCDA 3NVWB 3R7MA 3VGDA 2PMQA 1DJGA 2FPVA 2QJIA 3LPFA 4IX2A 3GDTA 4JGDA 1VIZA 1AQMA 1S5NA 2PGRA 3M0HA 3NOEA 5REQA 1M03A 2YFOA 3BJSA 3W6MA 1E71M 4J27A 4Z17A 1YNQA 7TAAA 4K38A 1IR2A 1KXQA 1HKIA 2Z24A 1J10A 1H60A 2PBGA 2QJMA 3CZGA 3SDOA 3S2NA 3AHVA 1VJZA 3M0VA 2VT0A 2IPGA 1GOWA 3WMLA 3RF9A 3W82A 1Q13A 1K9TA 3R4IA 4MM1A 4NJIA 4CCZA 3LI1A 4Y7EA 1ISZA 4Q22A 2BVTA 1R3SA 4B3LA 3W7HA 1KR0A 2E68A 3CL8A 4E2OA 2FHFA 2WPFA 2WNNA 3RU8X 1NHRA 4DLMA 5M5DA 3EX6A 3W7QA 4PRRA 3LS9A 3OW1A 4AD1A 4NZCA 1QJWA 2UV8G 1QPQA 2R24A 2XN1A 3NXFA 1QW8A 3PNZA 4ZOAA 3UJEA 5JMUA 4DBEA 1PPIA 4AIOA 5D9PA 3SIMA 3UWYA 1A0CA 1WDSA 4IJRA 3GNDA 4FAMA 1OC6A 3CEUA 2ZXDA 2WMIB 4FXFA 1SW7A 4WOQA 1CGXA 3LRLA 4HYWA 1PHQA 3A22A 4GZIA 4CEUC 4N9CA 2P1FA 2BVYA 1ONXA 3UWEA 3REQA 4CU7A 1UP0A 4N6FA 3R8HA 1B1YA 1FCBA 3F4VA 3RITA 1LZOA 1QNRA 2VX5A 4EMWA 4H41A 3MV11 1NOUA 4OGZA 2PP3A 2PDPA 4H4IA 1JRPA 3IUDA 2X1SA 3L5MA 3M0IA 3VKBA 2Q8ZA 3MUXA 1HN1A 1NP0A 5TD4A 4GCAA 3P74A 4Y9MA 1E9LA 6XIAA 1I8JA 4LC8A 5ABHA 7XIMA 1L2UA 4KCUA 4IIEA 4OBTA 2XN2A 3AXHA 4PMVA 1D2KA 4OIFA 1UIPA 3BV7A 3VOJA 4C1NA 4CLMA 5BWFA 1X96A 2DJLA 4IMFA 4DNHA 1W9XA 5E0CA 3NUKA 3AXXA 4WLCA 4PYSA 2DORA 1LWHA 4NYYA 4ZEPA 1BYAA 4NL1A 1EKOA 4X9SA 3P3BA 4JTAA 4NASA 3CL7A 3PG9A 5DT5A 1F73A 4AVNA 2F6XA 1IYXA 1JZ3A 3K2GA 3ICJA 1QFEA 4C6DA 2OWXA 2RDWA 5AC6A 2OOFA 4D9PA 2R6OA 4UTJA 1KTCA 3VIOA 1KM0A 6REQB 3STEA 1EQPA 1KA9F 1VBGA 3NQGA 3E2SA 2D69A 1D7FA 4QSHA 1UBSA 3RILA 4BF9A 4MG4A 3OLDA 2GOKA 4GZJA 5FL0A 2AAMA 5FJOA 1OGSA 3PY2A 1B2YA 3DFQA 1BXCA 5CCZA 3VI2A 1LWJA 4I7WA 3TA9A 1X1NA 3RCYA 1PWLA 1Z69A 2WNZA 3VZZA 1O5XA 3OLGA 3FCPA 1U83A 2G50A 4FLQA 2QZRA 2XTKA 4XKYA 1THFD 3O06A 1OBAA 2Z1WA 5CBJA 3NPUA 3LI0A 1CECA 3ZSTA 1IQ8A 5U4NA 2FZNA 3VFCA 4L61A 3VDBA 1OIMA 2WMGA 1SZNA 1H11A 2G8ZA 5DY2A 4HYVA 4ML4A 3ME3A 4OJYA 1M3UA 4ZSTA 2PLCA 5U25A 1TRDA 2AL2B 3CO4A 2OWWA 1S1RA 1F2JA 4I9AA 1JYNA 2QIWA 4CD5A 5AHFA 3SUVA 3LCXA 1FWDC 4DXVA 4IUOA 3B8TA 3UPMA 3WEZA 3EDEA 4HK5A 4U31A 2BTMA 2HE8A 4HMDA 1KXTA 4QS5A 2E7FA 1A5MC 1GZJA 3B8SA 1ZENA 5L9FA 3QFEA 3TOYA 5FS6A 2V5JA 4KFOA 4PUWA 3KOYA 4XQ6A 1ZS2A 2B7PA 5AC5A 2PDCA 4QBXA 3VIKA 4HHLA 3TDFA 1XGDA 4IMEA 2GK1B 4BR1A 1CPUA 2TODA 4O11A 1VBJA 2XWEA 1AODA 1FOBA 4GQQA 1GESA 1XLJA 3WYZA 4JQ9A 4YCOA 4TVWA 1HP4A 3QZ6A 4GY7A 2BOGX 2D73A 1NEYA 1H7WA 3UJSA 4QSFA 1OGGA 2DZAA 1C8XA 4HZ7A 4UNKA 1IXOA 4PFMA 4Q7BA 1A4MA 3TR9A 4JPGA 3G2GA 3WQWA 3MU7A 4IIFA 1AK5A 2HMCA 1EF3A 1V93A 3MDWA 1OCNA 1EX1A 1JI1A 4ZGYA 3N73A 4DEFA 1EBDA 4IM4A 4DELA 1RLCL 3SR6B 4C6FA 2DUZA 1EJVC 4UTKA 4W89A 3OQEA 4AD3A 3PZUA 3S47A 3QV9A 3PG6A 1GT8A 1DL3A 3O8AA 1ZBKA 4LAOA 1AFSA 5I07A 3ECQA 5GNXA 3W6LA 1TWSA 1M7XA 7REQB 4GZ7A 4XUGA 4GH1A 3H2FA 2CLIA 3LYEA 1TV4A 5AY7A 3QMSA 3PJWA 4RV8A 4QIUA 2AKMA 4FSAA 4B5WA 3H6OA 2ISDA 2FH6A 2NSXA 5A8MA 1M7OA 3SRHA 4RLIA 4GJJA 4KCWA 4D6DA 3MSRA 4MNLA 4B5VA 4GYFA 4JTCA 3TCSA 3NZ1A 3EWCA 4IJCA 4PUNA 4KIRA 3QYQA 4YLWA 3UVIA 5A8OA 1C7TA 5MHBA 3TYZA 1B3OA 3SUSA 3HBLA 2Y70A 4I9MA 3CQJA 4GYPC 4N6EA 3ABZA 1RUSA 3HOJA 4NSBA 1N82A 4H6EA 4HJWA 3VCRA 4O1CA 4O18A 1VCFA 5CBBA 3TYBA 3C3UA 3MO7A 3M5VA 3QHMA 2OELA 1CXHA 1WDWA 5I3HA 1IXNA 1VFLA 1UUMA 2NV1A 3WJYA 3GIPA 1GOKA 2PDIA 2CFFA 2DZTA 2YX0A 2ZUSA 5KETA 1A0EA 4YPJA 3H4KA 3T4CA 5F4WA 3QY7A 1V6TA 3DHFA 4DNMA 3SN4A 3AU6A 4GFIA 3BQ5A 3ATZA 3LX9A 1XC4A 5KEZA 1EUAA 7A3HA 3LM3A 3ZO9A 3APTA 1JPMA 1MZHA 3MYOA 2H3BA 3GG7A 3I3EA 1R47A 1TSIA 4BEUA 1RBOB 3VMPA 4GVIA 4K1WA 4MWAD 2WJZA 4V15A 4A3UA 2GSHA 1ZUAX 1X2GA 4BFAA 2WZIA 5FCZA 3DJGX 2PWFA 5K4XA 1QO2A 1I2QA 5AC7A 1A5BA 2DSWA 4DYJA 2E1WA 4ORMA 3R58A 3G1XA 4B4FA 2PPGA 2QJJA 2YCLB 3I3DA 4AWTA 4H4PA 1MEWA 4W84A 2V63A 2Q8LA 1F4AA 4AHPA 5CC6A 1BSIA 3AYVA 4D71A 3ANVA 2XFRA 4OU1A 4DNAA 1SPQA 2C1IA 3NVZB 4GVFA 4QG6A 1V97A 1GONA 1OX4A 2VTFA 4JKKA 2BXYA 1BZLA 3M0MA 4M29A 1P7TB 3OODA 4QE5A 4KFNA 3C4UA 4FXSA 4Q4QA 1WKDA 3S9IA 4WVXA 3VDAA 1F3TA 1V5XA 1MNSA 4GINA 1FO4A 3QMRA 3M0LA 3ARSA 4H1ZA 2MANA 4PMOA 4S3JA 4X22A 3GY1A 4ZTYA 4EPDC 2GJRA 1AD1A 4ILSA 1A5OC 3VNJA 3NVDA 4UZUA 4Y90A 1OJXA 4H4ZA 3WF3A 3T78A 2QCGA 3R0DA 2CXGA 3L67A 4B3KA 4LVBA 2HRWA 2Y89A 5D9NA 3SECA 3BOFA 2HQMA 5AOUA 4Z1DA 2B7OA 4CN4A 1B57A 4GI9A 3NS1B 4RNIA 4MY8A 3DGHA 3WDRA 2OCZA 4PB4A 1GEQA 2B7QA 4Y96A 3IEBA 3LTPA 3IARA 1DXLA 4FI4A 5BOEA 4IPIA 3W2LA 5CGMA 5GPRA 2PRMA 1E5NA 4C1NB 4KKXA 3C8FA 5CZTA 1Y0EA 4JQ4A 3N19B 3THQA 1NDWA 1S5WA 3SUUA 3WLHA 3A9BA 4ROQA 2OSXA 3WD2A 1H7PA 2NX1A 3LHWA 4EPEC 3N2BA 1CXFA 3IRSA 5LNUA 3AIQA 1GTHA 2X0SA 1YDOA 2Z1KA 3WUBA 3W00A 4IFRA 4KWWA 4LFYA 3WLOA 1N61C 1IT7A 4DF2A 1W5PA 4C7FA 1CXEA 4F48A 2R9ZA 3WDQA 2J9YA 2XVGA 4TOQA 4ZE5A 1JULA 1V51A 4XBSA 5MKGA 1TQJA 2D24A 3UR7A 5KMYA 2PZ0A 4O1AA 3O7UA 1FWSA 1ZQ5A 3GH4A 2GUUA 1K8XA 2OB3A 1OCJA 3S46A 4GHRA 2IQ0A 1U22A 1HJXA 1DBTA 2OMAA 4LRTA 2GSJA 2XJ7A 3GG0A 3R12A 4NNAA 2QVNA 1NFPA 3LV6A 2V5DA 3KTSA 1DJZA 1IEQA 2J75A 4HZMA 2P3ZA 3L23A 1Y8BA 1KM2A 1SSDA 1G9HA 2UBPC 2A5HA 2Y2WA 3WH6A 4UTWC 1XD0A 3BMXA 3VNZA 4FIRA 2P8BA 1TPH1 3NURA 3U3HA 4A8NA 2DSUA 4J3TA 2GGGA 4BQ2A 1C8YA 4GK8A 2OO6A 3WLPA 1J01A 2YB4A 1I1WA 3CS2A 1V6UA 1GVQA 3FKRA 1SZGA 3CUGA 2X8CA 2E09A 2F6KA 5D03A 4M52A 3NYDA 3LLFA 3N6QA 4QEHA 1UR4A 4DQWA 5EU9A 5AYZA 2FTPA 1FIQB 4HA1A 4LXFA 1IWAA 3H2CA 3GFZA 1TELA 4C5YA 3NQDA 3BTNA 1YNPA 4MJMA 1FCQA 3LRMA 4UOJA 3Q94A 2B0MA 4J3SA 2G0WA 3UA4A 1O4UA 1ZJBA 2BY0A 1UG6A 3U2CA 3CZKA 1R38A 3HV8A 3E3HA 1AL8A 1KFEA 5IHRA 2NZLA 3HGJA 3TONA 1PKNA 3QR1A 4A3YA 2DV0A 2BXZA 5BRBA 1EPXA 1K4QA 1N8WA 1P0KA 2VMFA 4AD2A 5A95A 2NX9A 3ZT7A 4QDMA 1TVLA 3W7KA 5DRCA 1SO6A 2VENA 2O4QA 3SEPA 4M56A 4O16A 5FF3A 1PSCA 3TAOA 4REQA 3OZPA 2XIMA 1Q6OA 3ZR5A 2NV2A 4Z1BA 4NX0A 4WCJA 1CLVA 2PGFA 1KB3A 4TV6A 1NFGA 1U5VA 2ZQ0A 3QKZA 3OTRA 5KVIA 2W0UA 3SY1A 4R3UA 3LGDA 3H7RA 4AIBA 3H7UA 2CZEA 4W8BA 2F38A 3R10A 2Z2UA 1S7MA 1R7AA 3HFYA 5E6YA 3WLIA 1V3KA 3W3OA 1AH4A 3V16A 2OR2A 2BASA 1O5QA 1VRDA 3QW3A 3KUMA 4FO4A 3LXCA 4LU0A 3CTTA 1FDJA 2FIQA 4CU6A 2MUCA 4D6IA 3H70A 3THCA 3I7SA 3LY0A 1ZP3A 1SFTA 4O0ZA 1QHPA 1W8SA 1TJPA 4KPLA 4BWLA 1HW6A 4JTQA 2Y8UA 1CT5A 2OQYA 1YTKA 3LG3A 5F1VA 3NYZA 4XAYA 4F0LA 2DQWA 4KWVA 3FY1A 5KVHA 4HMNA 4S38A 1RJPA 2WKLA 1RZMA 3RM9A 4CEXC 2YJQA 3CWNA 3B8UA 1TIWA 4JOMA 3C0JA 4FMVA 5U1OA 2TPSA 1ZBVA 3C2RA 1OM0A 1RH9A 1GVYA 4JIRA 3V35A 4IT1A 5JQ9A 4N9EA 3B9DA 4A6GA 2XIIA 3OO2A 3DUGA 3NIYA 4NHVA 4YIWA 2PF0A 2ZFAA 1X6LA 2CBVA 5LHFA 3GTHA 3W07A 4J1OA 4HQVA 1LJYA 2DT1A 3SN1A 4L7ZA 2VQUA 5FMHA 4JQ3A 1Q6CA 3PTQA 3S6OA 4C90A 1TJ0A 3EB2A 1ZBWA 4IHCA 3FSTA 2XIOA 2Q01A 1FHLA 3AU2A 4C6KA 3OGVA 3G0XA 4LNCA 4Q4KA 4EWJA 5JBFA 1Q1WA 3CV2A 4ZOCA 1RY8A 1I2RA 1ODUA 1KM1A 2FDMA 3KAOA 3OG3A 4P7LA 5GJNA 1RCXB 1E6QM 1K77A 3PWAA 2ZDSA 1R30A 1GVFA 3CU2A 5K7JA 4R33A 2A7PA 3EPNA 1H0GA 3R6IA 2REQB 3QPZA 4P8UA 2W5FA 3H4WA 3EMZA 1OWQA 2C13A 2DSVA 3W9ZA 4B15A 4WF7A 3F1QA 2HBXA 1W2VA 1U1HA 3UCDA 4RDYA 1FP9A 2PDUA 4NIRA 5G1MA 4LUYA 1U1UA 1D3HA 1GYMA 1KBIA 1JPHA 1F74A 1MEIA 1S38A 3APYA 1GHSA 4IICA 3WJWA 1SYTA 5LNVA 2ZX6A 3N12A 3RX3A 3GG1A 1OINA 3K5XA 1RHCA 3GZAA 2V81A 1E6ZA 5BRQA 4IOTA 4IPPA 2QR6A 1OFAA 1W1TA 1OK6A 1M7JA 3QFWA 2V5CA 1FFQA 1K9FA 3W74A 2XH7A 3UQNA 1UD8A 3SGUA 4HNNA 2XISA 1I6NA 1R2RA 3HGSA 3M46A 4UTUA 1OFPA 4MLJA 2YXGA 1WXYA 3NO5A 4UXDA 1HVQA 1XFCA 2OEMA 1H5YA 2VFGA 1W9DM 5FJIA 3R13A 3CM4A 2E28A 1H7OA 1FXPA 3WH8A 1WOAA 3P82A 5DBUA 2OLSA 4QXIA 2YL5A 3DFOA 5EBUA 2I17A 5HJLA 3T0BA 4NP7A 1JDAA 4GRTA 5G4EA 2D3LA 4KCVA 1VFOA 1R7OA 3VIPA 4O14A 1E6RA 1IGWA 4ZODA 3SR7A 3HPFA 5PTDA 2CKRA 2OKTA 2BGQA 4H7CA 4WY0A 3CUJA 3SCWA 1XJBA 1NJJA 5B7ZA 4DPQA 1P6CA 1QWKA 3CZEA 4Y6GA 5CPLA 5FSDC 1ZAHA 1TWZA 4NRRA 4UQCA 4AXKA 4AFYA 5EB8A 2FGBA 1LPFA 3OOQA 3OZOA 3CUXA 4DZAA 2IW0A 2Z0IA 2WOWA 4P8VA 3T09A 4DHGA 2ZA3A 3HZ3A 3RLHA 2D3NA 5CAKA 4XZBA 3VDHA 2Z29A 4HPGA 2DT0A 1JCNA 2BNJA 3LCWA 4QE1A 3HG3A 4U4MA 1XYZA 3AXIA 3VDCA 5ECVA 3PB0A 1ADDA 1YKWA 1PAMA 3AWNA 3GXPA 4IQLA 1VHCA 1AJZA 4DJEC 4PUMA 4I7VA 3BURA 4I3GA 3HB9A 1B3YA 1NDVA 3GKFA 3U6WA 2DEPA 1AA1B 1RQHA 3MUAA 2I1OA 3S2JA 1FECA 3DHDA 3PM6A 4P7RA 1J18A 5XIAA 3KEHA 1HO4A 3TSBA 3HGOA 4UQ9A 3KOWA 1YTEA 1WXJA 3QLDA 5MKGB 1H1ZA 2F7FA 1OJTA 1I1XA 2QYGA 3URNA 4ZO8A 3BLPX 1L2QA 1SW0A 2CBUA 2D0FA 4CCCA 3A4XA 3RDKA 1V6YA 3BDKA 5F4SA 3EMCA 2RGMA 2XIBA 3ZSSA 4YWOA 4ZO6A 3AISA 3QM3A 3W83A 4JTJA 3ONBA 3HMCA 5AHNA 5IBXC 4RXGA 3TA6A 4A05A 2Y0FA 3NDOA 4MGGA 4S2CA 2E77A 5HULA 1E73M 1E43A 5AHEA 4XO6A 5I6SA 3SAZA 1L6YA 1JF5A 1AQ0A 1JCJA 1JRBA 3W7EA 1X6NA 2EPKX 5KTLA 4NX5A 1K8ZA 2WVSA 3VGHA 1BHGA 1A5LC 3VMNA 5E9XA 4HTYA 2POTA 3CUFA 4E8GA 1BG4A 5CZKA 4EF9A 2BVWA 2WCAA 1JIBA 1CXLA 5JBEA 2XM2A 5J5RA 3LMYA 3DC0A 4WDWA 4X60A 1BWKA 4I5UA 1K9EA 3RRAA 5TNVA 2BSLA 4XVEA 1JRCA 1ADSA 4PTWA 5CPNA 2NXIA 4OE7A 4H00A 1L6SA 5BXRA 5I24A 2D2HA 1KTNA 1T0OA 4PUKA 2HISA 2PDGA 5CC3A 3M5YA 1DPMA 1GUVA 3EF6A 3WG6A 5LIYX 3T9PA 1CB2A 4N2YA 1TMLA 3ZLHA 1ECEA 1XKYA 1C7SA 2ONEA 1OFOA 2ZTJA 4XAZA 2I5IA 1S5TA 3J7HA 1E1CB 4OBSA 4JCLA 4BURA 1YDVA 1TV7A 5BZAA 3RMEA 3IAQA 3O07A 1X38A 4EP8C 3NZRA 5JIWA 1T8QA 1CZ1A 4UFKA 3SSJA 4DF1A 4EQWA 4IGNA 3USBA 4KH2A 1FA2A 1SW3A 3BO9A 3TZNA 3ZVHB 1Z8AA 2X40A 3O6DA 4LY8A 3CIWA 1JGIA 3SRKA 3LHYA 1YXYA 1AL7A 3VKDA 2IUZA 3XISA 2GWGA 1Z42A 3UERA 5I3IA 1FKWA 3VM5A 4UFHA 1UH3A 1IGSA 1SO3A 3UZZA 2E0PA 1UZ4A 4TMBA 1H41A 3MMUA 4Q8OA 1DIDA 3K8MA 2XVPA 1V3HA 3NL5A 3DENA 5HNUA 2QUMA 3T0CA 3VNIA 4J3XA 3GU9A 4GVGA 1SFJA 2DVUA 2VO5A 2FYMA 5LXEA 3B4YA 3TKFA 2PTDA 3I6TA 4XZ9A 2E5DA 3M07A 2GJNA 4DZIA 1ZDLA 5LIWX 1GVRA 2O9RA 3W22A 3NL2A 4YTUA 3VGFA 1UMLA 4DIAA 1TV5A 1UPMB 3EEGA 3M5ZA 4PCPA 4CGTA 1GRFA 1J96A 3F7JA 3PG8A 1JEZA 3ZM8A 4EPBC 2ODOA 3MCOA 2VZVA 6A3HA 3OGSA 1DQWA 4TTGA 5E6ZA 3O9NA 1KW1A 1NSJA 3VOGA 1BF2A 2I57A 2VRQA 5D09A 1L9WA 4G9PA 1IZCA 2XH0A 1H09A 2XZ7A 3MWAA 1ODZA 1OSEA 4EXAA 3TYUA 1FVPA 1CNVA 3K4DA 1SUXA 1MFUA 1OABA 4H8HA 3BH4A 3UGVA 3IANA 3DXIA 3GW3A 5FAGA 4R34A 1FCVA 3RLVA 3QQ0A 3KRUA 4M5PA 3KL0A 3WEMA 1JXKA 2WMHA 3RIKA 2ZX5A 1E6PA 5JCLA 3H2NA 3QV8A 2BCPA 2YKKA 1EEXA 1S5VA 3SCTA 1BSLA 3VOCA 4PEEA 5DN1A 3SQPA 1S2WA 4HK7A 1XBYA 2VVNA 4LYQA 2FVLA 2DZWA 1GERA 1EO5A 3F5LA 2GVJA 4HHHA 2QCLA 2ZUMA 1ICSA 1DJWA 1WDRA 2ZZ7A 1WX0A 1HKVA 4EK7A 1Y5XA 4MY1A 1ZU8A 3WNNA 4ZSUA 3L0KA 2Y7EA 1IEXA 5AKQA 3M43A 9XIMA 1QCWA 1QK2A 3OP2A 3MHFA 3ZQ9A 1EF2A 1RPXA 5FD0A 2AMXA 5DLCA 3KWXA 4HSNA 3ZS4A 4MMWA 3HV9A 2FVMA 4YNGA 1BWCA 2OGYA 2FMNA 3AHYA 2PWUA 3HURA 3UXIA 2Q3OA 1M7PA 1KM4A 2WKGA 1XG3A 2VFEA 4KGLA 1E51A 1JZ5A 2W3SA 2YA2A 3HG2A 2Q6ZA 3GNNA 4ATLA 4A8RA 4F0MA 3UCQA 1S3HA 3L9CA 4JTEA 2HNHA 3VE9A 4URIA 1NDAA 1LOSA 1US0A 3QPYA 1MO9A 3WK3A 3MY9A 3N2OA 2WVVB 4HCHA 1BFNA 1MYRA 4JEQA 1V6VA 4L1WA 2R1NA 2PURA 3R5EA 2PU0A 2R9RA 1Q85A 1XIJA 1OF8A 4E4UA 2ZE3A 4IH3A 4O4WA 1K8YA 4Y8EA 3K1GA 3GR4A 1BTCA 4A22A 4Z1YA 3QHOA 4ZQOA 5I77A 4PMNA 7CGTA 2V3FA 2YL9A 4KETA 4GE8A 1VKFA 5C9UA 1JOAA 4LVAA 3G3DA 4WJXA 5CC5A 1T96A 3H7VA 3CAVA 4Q8PA 1V0LA 3LQGA 4WY0B 4AZHA 3HN3A 2YVFA 3ES8A 3I4EA 1OK4A 3VZYA 1Q7ZA 3DGBA 3FKKA 5D2TA 5D8WA 5HQLA 4GVHA 4M6PA 4IIBA 1GETA 4CUCA 2QNEA 3I7RA 4EVZA 3FGCB 3LCHA 3O63A 1FRBA 2GVLA 1KTBA 4M3PA 5AYXA 3CGTA 1GW9A 3KDOA 4I9TA 4D8LA 1GKQA 3EDJA 3RN6A 5C5YA 1AH0A 4H2HA 3BWWA 2AL1A 2X1RA 2RGLA 3WLLA 1EUNA 3IVSA 3R25A 1B3ZA 1AD4A 4ERIA 3UG3A 4ZA0A 2V2CA 2WPBA 2FZDA 4FOKA 2FJKA 5JCNA 2J78A 4NZ3A 1ZNNA 3FLUA 3T2PA 4GXPA 1X98A 3TFCA 5EY5A 4PUJA 1TYGA 1UOZA 5CZSA 3NWRA 3ITXA 3KCJA 4M19A 1JZ7A 3UZWA 1KGXA 4PA8A 4PCTA 2QUUA 1QASA 1VBRA 1J6PA 3OLEA 4H4YA 4LBRA 3TR2A 4HNVA 2XFFA 3LB8A 2BB0A 1LBLA 3GUWA 1TIMA 3S42A 3W1LA 2E6YA 3GRTA 4E3VA 1TB3A 1J0YA 8RUCA 2ZWYA 5KSWA 3TYAA 3DG3A 4FDCB 4HOXA 3V7PA 3N2MA 1QXLA 3LTYA 2JF6A 3WH5A 1REQB 1F6YA 3CQHA 3PZOA 4Z2HA 1PXGA 1A5KC 1B4KA 4YTTA 3ARYA 2X2YA 4MPQA 3OA3A 3ZVIA 4S1FA 1FDYA 1JL8A 2Z7GA 1KO0A 1RBLA 3RXZA 4AF0A 2PTXA 2VX7A 4ZFMA 3NQ6A 4R7WA 3S1WA 3AOFA 3POHA 3W72A 5EYWA 2OU4A 2HVOA 3T6CA 4D6FA 3QOMA 3GS6A 4IMGA 4JHZA 4FIQA 2L5HA 1WNOA 3TC3A 3L21A 2VWSA 2JK2A 1FCUA 2X16A 2P53A 3MKCA 3UETA 6TAAA 1DKWA 2GL5A 1G4TA 3CL6A 1P1XA 5EL1A 4JFSA 2BZNA 3QYSA 1FX6A 1FXQA 1XCXA 2VCCA 2C16A 1AG1O 5EPDA 3RM4A 2PWHA 2ABAA 4YHEA 4MOZA 1ZMCA 3QN3A 3E12A 2HTMA 4EAYA 3UU0A 5E0KA 4ADSA 1WZLA 1UQZA 5D2VA 2X2GA 3HRDC 2BLEA 4WSHA 2QAFA 5E5CA 2V5BA 1UUQA 4O50A 4J9JA 1Q6QA 1KLYA 2W9MA 2ZZ4A 3INPA 4NNBA 4UQAA 5LHEA 3I7QA 4Q4MA 4MFDA 3C52A 3PS7A 1XRTA 3WLTA 4RDWA 3WH7A 3N34A 2Y7GA 4AX7A 2GZXA 5DT7A 3EANA 1QW9A 1UD3A 5BNKA 1UQYA 3UF9A 2GJXB 4F8XA 2FGZA 3PUGA 1FWAC 1RP8A 1JCTA 4LUTA 3ABSA 3C2EA 5EA9A 4C6IA 1E70M 3UR8A 3LSBA 3NM1A 1EWDA 4YWSA 3TIMA 4XTDA 5CZJA 4F3HA 1NWUA 2WC3A 2D0HA 1XLLA 4W9TA 3UY7A 5JIPA 1RD6A 2ABBA 3W01A 2C3ZA 1ITXA 5DF0A 4UCFA 5E9AA 3K4AA 3GHUA 2ZZCA 4GYJA 1K03A 3L65A 3PC0A 1BTMA 2F8QA 3A3WA 2WKJA 3D9XA 4ZR8A 1NY1A 3MA8A 2XSAA 2OYLA 4DBUA 3P7YA 4WGHA 2WCSA 2QPXA 3IWPA 4IPJA 3A7RA 2RH9A 1OZQA 4Q7IA 5DMNA 3HG4A 1SJBA 1VDVA 2EEXA 1DJYA 1PKYA 3RU6A 4HB7A 1XV8A 2EO7A 3O6AA 4GX8A 3R94A 5I3DA 3L7RA 2FKPA 3RR4A 3OVRA 1VF8A 2E25A 5D30A 5DXYA 3LHUA 2J24A 4D1IA 4OTKA 3P67A 2EQ7A 1QMLA 1POKA 4GXWA 2V3AA 5FAJA 3F4DA 3KLKA 1GOQA 2EPHA 4FNQA 4PTXA 1J8VA 2INEA 3EX3A 4B92A 3CTLA 3ZWTA 2IXUA 1OIFA 2J88A 1HT6A 4OUEA 1TR9A 2Q8XA 4H7ZA 3PPFA 3OC4A 2OPJA 3HPZA 1MO0A 4MNMA 1HKJA 2CHNA 3MHGA 1UW9A 1I45A 4BKNA 3M64A 3JZUA 1OZMA 2QEZA 3B3DA 5FS7A 1UA3A 2WOQA 3W29A 2ZC8A 1NQ6A 4AZBA 3EOLA 1GV4A 1EP3A 1D9EA 3AWOA 4EMJA 2VEGA 1UWSA 3UYCA 3FA5A 2WJFA 3FOKA 2AGKA 2WMFA 2ZRUA 3NQ8A 3GVWA 3UPWA 5LNWA 5L6UA 1PIFA 5HBFA 3I10A 2YCJA 2UZ9A 2YPIA 3QMTA 3T40A 4KEMA 2YDSA 3USZA 1BXNA 4AW7A 1MXDA 4GJ1A 4JYFA 4Z2GA 1HNYA 1WUFA 1V0MA 2XIQA 3L68A 2DIKA 2OYMA 4IFKA 2OT1A 3TNOA 4MKVA 2RFGA 5B7YA 2Z26A 3GDLA 3B9JB 1PE1A 1LOQA 4LW7A 1I0DA 3LB0A 1LQ0A 3TQKA 1DTNA 1RR2A 1XUZA 1YBQA 1ESWA 4FOJA 1JAEA 3GNXA 4Z2LA 2CESA 2EPOA 1QI3A 5LNSA 3IGUA 1XPGA 2CBIA 4JX4A 4EIVA 1Q8JA 4DJED 1S1PA 3PJUA 4AEFA 1MUCA 3THUA 5G1YA 3IJ8A 4XZLX 5AC8A 1R3QA 5C9WA 1TV8A 1JVNA 4ZXOA 1ITUA 3NVYB 4PTVA 1DV7A 3H12A 4JNYA 1ELSA 2QKFA 2Z1SA 1XYLA 1H7RA 3ARTA 3TJLA 1BYCA 2INFA 5F2MA 1FQ0A 2VOTA 2FB3A 1K4HA 1PZ0A 4M7TA 4LB4A 3SY5A 3ZYZA 4XX6A 1QO5A 3QZAA 4OV9A 4GABA 4FOUA 4K3ZA 3IJ7A 1QOPA 4BF7A 2ZZ3A 1CGTA 2BY1A 1MQQA 4K7VA 1XCWA 2Z2BA 1EC8A 2GPTA 3C8NA 3DGRA 2UWFA 3ERPA 1Z48A 2DSKA 3WMSA 1X39A 3UXAA 3VD3A 3NRZB 4WR3A 2W67A 3EWXA 4DPPA 1X8FA 4BQ5A 5DX7A 1QHZA 3D3FA 1EJSC 3GBEA 4C6OA 3MVTA 2CPUA 5IOBA 3VOHA 4RZBA 2VJXA 4IGMA 3B9NA 4GYPA 4E2VA 4LUSA 2PE4A 1XF0A 5CPSA 3BGJA 1TTJA 3TN4A 3BANA 3VXGA 2Y62A 2EJ1A 3KZPA 2J6VA 4PTDA 3DIPA 1M6IA 3NEHA 1Q6EA 3BLKA 5FJJA 1K7EA 1JF6A 1XH2A 3M1ZA 3OA5A 1A5NC 3OYZA 3AIUA 3KX6A 3HQOA 1KCKA 3GYEA 3MMTA 1EHNA 4TVCA 5FJTA 2X8RA 5G4WA 5AHLA 1SR9A 1XLMA 1XWYA 1F3WA 3QGAC 3C0QA 2B81A 4L64A 3LHTA 8CGTA 4NKCA 3RK8A 2R91A 1EX5A 3V5CA 3IIVA 1FWIC 2G95A 1GJUA 3GH7A 1VH7A 2I9UA 3W85A 4HD5A 2NQJA 2NPXA 3ZMRA 1LP6A 1JPIA 1UZDA 3S1VA 4PRWA 4LRSA 3SCRA 1KV8A 3D47A 3BAXA 4AHQA 1XIMA 3EDFA 5A6LA 3VILA 1S2TA 2ZRVA 1OY0A 1DJIA 4C6EA 3B9AA 1Z6KA 2WHLA 4DJFC 2MNRA 1NF0A 1LDCA 2RABA 1ITCA 1WZAA 4FLOA 2P3EA 2EQ8A 1Y65A 4PMQA 2W0HA 2FFCA 1WXZA 4OHQA 2VFIA 2WC7A 1J5SA 3LK6A 3D46A 3BJTA 4QDWA 1E9IA 4G1KA 3WNPA 4W8LA 1O94A 4GIEA 3V3WA 2Y4SA 5G5HB 5JBDA 2PLKA 4RE0A 3ARQA 4QGCA 3CH9A 1H3GA 2V6AA 4F0KA 5T9CE 3EA1A 2OOGA 5T8GA 3LGGA 2XSXA 7ENLA 3IGXA 5AZ1A 5C2XA 2J8TA 2IKJA 1UIOA 3W2KA 3N9RA 4JR5A 2V69A 2BV9A 5LA0A 3WF2A 3WDJA 5C70A 1D3GA 1DORA 3N17A 3CPUA 3QV6A 4DO7A 3SQSA 3ZR4A 3VC5A 3G1DA 5A3HA 3H2MA 1M04A 2WWCA 4GI6A 2V2DA 1W0MA 1TTPA 3KW3A 3L8KA 2EGZA 2DUAA 3T4WA 2CETA 2VR5A 4I8YA 3ARVA 1RA0A 3UZYA 4PSPA 1E15A 4WDXA 4EQXA 2Y7DA 4US6A 3F4NA 4BV6A 3ZZ1A 3UXLA 4JDYA 5D38A 2DW7A 4H9UA 1OC7A 1YDNA 2P10A 4PB3A 2YVGA 4FX9A 3BOLA 1UR9A 5IRPA 1QI5A 1JYVA 2PDQA 1UOKA 2BODX 3N15A 3LEPA 1BPLB 3AJXA 3EKLA 3QXBA 1GVIA 3A13A 1R86A 4FZIA 4IIGA 9CGTA 4UFIA 3ARZA 4RPQA 5I02A 3G6LA 1B54A 1FWBC 1XLCA 1XXXA 3PB2A 1M65A 3CPRA 3OZMA 2FPYA 3VKCA 3MJYA 1OYCA 3F4CA 2PAJA 4E6MA 3Q4DA 4H8UA 2KX9A 4IIHA 1ZKQA 2F61A 2WK2A 4RXFA 4WKHA 3L0GA 2GVEA 3B0YA 2HQAA 1LYXA 3QGKC 5ECUA 5BMXA 4ZENA 2ISFA 1RSCA 4O28A 3OBEA 1ISVA 3CV7A 4Z1CA 1EOKA 4IL2A 4XD5A 3SGGA 3TC7A 3KBJA 4KEVA 3RG6A 1TUXA 2HPIA 3N29A 3MPGA 3NR0A 1FWNA 3ZOAA 3VYLA 3H23A 1XBVA 4U33A 1GJPA 2VZTA 1KXHA 3SCSA 1E9ZB 4FF7A 3QRHA 4BHYA 4NAEA 4DAIA 4PSRA 2VX6A 2HS8A 3ZT5A 4JIQA 2BHUA 3L12A 4DB7A 2BDQA 4C6NA 3WQVA 2NWRA 3E1F1 4HNUA 5C71A 1FWWA 5A6JA 2AQWA 5JU6A 4UTWA 1XRFA 2WLYA 1HKWA 1LWIA 4X2PA 3L66A 1YHTA 4BK9A 4RV3A 3GVGA 3QOKA 1JYXA 1VJIA 5DY3A 1E4MM 1BAGA 1F9CA 1XHCA 1GW1A 4J2PA 1DXFA 1P4CA 2FVKA 1Q2RA 2VC7A 1V6XA 1YPFA 1VEPA 2JGQA 4H83A 1VENA 3MUY1 4QTGA 4A29A 4W7VA 4O54A 2CWXA 1ISYA 2J7EA 4R9XA 1US2A 2HVNA 2VC6A 4Q8MA 1TWIA 5CLWA 4ZOHB 1O66A 5CSRA 3V75A 3URHA 4AC1X 5FI8A 2YLLA 4JN8A 3EDKA 2P0IA 4AZCB 2ISVA 4D72A 5C0QA 3I68A 4JTHA 5CPTA 3W1UA 4JS3A 1XQKA 2CLFA 4LVFA 3ITVA 1RQBA 1TR1A 4H2CA 3ZLGA 3CLWA 4AWUA 3CGDA 2ISSA 1NHQA 2J3NA 1WB0A 5K2ZA 3M7WA 2Z4GA 1EXBA 4P7QA 3VCCA 4Q4RA 5EKYA 2CLHA 1P0DA 3KRZA 2WO5A 1TTQA 2QCDB 5CPMA 5AHMA 5A6TC 4C91A 2WNWA 4EWND 3W53A 2A2IA 1ZAIA 5CSYA 2QT3A 1W17A 3RR1A 3EX2A 1QR7A 1XLGA 3VX0A 4MDOA 1V6WA 4IL0A 1X7FA 2X30A 1TPDA 2X0YA 4B16A 5CPQA 4UOQA 1XCFA 3OB8A 4W88A 4AEOA 3E9AA 2Z00A 1X2HA 1MW0A 1OHLA 4OBRA 4TVUA 3RRXA 4HKPA 3LV5A 3VGGA 1Q6LA 4HU4A 1OGBA 2CDUA 1C90A 5GJMA 3EGJA 1G7VA 3GFYA 3QC3A 3A3HA 1DWJM 2Y24A 3C61A 1KRCC 4S3CA 1KLZA 2Y7FA 4X0NA 2WOIA 4JTUA 1QNQA 1I75A 3P6LA 4J3ZA 4RE4A 5C9RA 2VEFA 3IIPA 4O17A 4UFMA 1XR2A 5JUVA 3NQMA 3T0DA 2NUYA 4JEJA 3KS6A 1XDLA 2A79A 9RUBA 4Y9AA 2EKGA 4HVXA 2YIHA 1FFVC 1EJWC 3PAOA 3VGBA 1M6JA 3ARPA 5CSSA 1EPVA 3GG8A 4M24A 2YXOA 2QIIA 1XLEA 4IPLA 1L0PA 4BZYA 1HL9A 3NQAA 3PBUA 3HM7A 3MUIA 3TYCA 3B40A 4LS2A 1GSNA 1NWRA 2R1PA 4Z42C 3GHTA 3K46A 2ZX7A 4Q6XA 1ZB5A 3MT1A 3GQYA 4APNA 1JD7A 3NEVA 4UQBA 5KZMA 3JUGA 2C1GA 1SVDA 3TU9A 3V36A 2VEMA 4AD0A 3ABQA 3CIVA 1UH4A 3GDBA 1PTGA 1TPB1 3QJAA 4H19A 4GY0A 5AC4A 5SWUA 2ZA2A 3TQPA 3GTIA 3N9SA 4ES4A 3WBWA 1ENUA 2Z6IA 2CZ5A 3ABOA 4W5UA 1HKKA 1OX6A 2TMDA 1MZRA 1NDYA 2EJAA 1KFLA 1Q63A 4IQEA 4WKFA 2V38A 8A3HA 1JDEA 3HPAA 3UBPC 7PTDA 3NQEA 4NXKA 2HZGA 5G1TA 3FA3A 2A0NA 1C8VA 1D7KA 3UG8A 2A1YA 3RMJA 3WQFA 2QPUA 3O05A 3SFWA 4LBSA 1UR8A 4C6LA 2J8GA 1ONFA 3MMDA 3W1QA 3W28A 2A3BA 1LRQA 5LGZA 4GQBA 4H4VA 1KRMA 4DYKA 4NUWA 1XL9A 3WL0A 2XVKA 1C9WA 3AIVA 3BLIA 1RVKA 3WJZA 2NQLA 1KRAC 2CIPA 1RCOB 2BY2A 4N42A 5I3GA 1ADOA 4K8HA 1E4LA 4K39A 1W31A 3IJIA 3A5FA 5H2ZA 3AMCA 2WYSA 4Q33A 5FF7A 1VAHA 4XK2A 1DJQA 3ID7A 3WLKX 3TE9A 2ZRZA 1E40A 3EXRA 3EPOA 1UUOA 2JIWA 4F66A 2Z27A 2QJHA 4GUHA 3L2LA 1QNVA 3BLDA 2QGHA 4J5NA 3CQ0A 3TH6A 5U7SA 1TJRA 4ZB2A 3WLQA 3SY8A 1J0IA 1EGZA 3DH7A 1R9ZA 3LZ5A 5HUPA 3ATYA 3OGRA 5GJPA 3CNYA 5A94A 3KTCA 3KVLA 2BBFA 3GVQA 5K9CA 1XD1A 4ERGA 3PZ9A 4DY1A 4WSJA 5JVLA 4J3VA 1ZALA 2DH3A 2ZRWA 1ZJIA 2YYUA 4K8EA 3IJDA 2V82A 4GUJA 4H9VA 1LUCB 3JVAA 1QNPA 2AKZA 4IP5A 2JEQA 4DJEA 3AXMA 1XIHA 1FDZA 1FP8A 3BJFA 3B8DA 2ZXQA 4JDBA 4EMIA 2X7WA 4UZSA 5TQLA 3S2CA 4CCEA 4JD4A 1JI2A 3VE7A 3NGFA 2R1MA 1PIGA 3VUPA 1HZYA 3STCA 3PF3A 2V30A 3WMBA 4C6QA 5HNNA 2HK0A 5DMMA 2OXNA 3WZ0E 1B3XA 1R0MA 5H1WA 4TX6A 4Y9PA 3VPLA 3PHAA 2XM1A 1CGVA 3AM9A 2NQ5A 2EPNA 2ACQA 2FDSA 2XIJA 1STZA 1TA3A 2BC1A 1MVYA 4NAEB 1K70A 4RNFA 4XZWA 4G5DA 2FJUB 1N2VA 3AZTA 3S2LA 3WDHA 3W24A 4W8AA 1T8XA 4Y9NA 3UP8A 4F79A 1JZ2A 3LXDA 6ENLA 3DX5A 4QG9A 5G2IA 2FZ8A 4K2SA 2YSWA 1KBJA 1H61A 5T26A 4BI6A 3GBDA 4UR8A 3TYEA 1UASA 4Q6JA 2A3HA 4XAFA 3B0VC 3QY8A 3M44A 5ABGA 3LCFA 4MJ2A 4X63A 4ZCWA 1BRLB 1PDZA 2BS9A 1WDPA 2PEVA 3TAKA 3LNPA 5HQMA 4EACA 1YQ2A 1GGOA 5CZ0A 1FBAA 2PSNA 3W27A 2TRSA 3SUWA 4UTLA 3LCLA 1FWFC 1B9ZA 2JFEX 3DFHA 2GUYA 3TSMA 1ZY9A 1OT2A 1RALA 2IKIA 3W4RA 3B0UX 3VINA 2VC9A 2CU0A 3AMLA 2ZUVA 3WQPA 1NFBA 1D7YA 2ZX9A 3DN5A 4E3TA 1DIKA 4AWSA 2C18A 2PDHA 3EA3A 2VNCA 4MB1A 3SCOA 3U5YA 4G8TA 1MUMA 1EEPA 2YDRA 1PDYA 2PWDA 1ZMDA 2ZVRA 3QKEA 3RJYA 2ZUTA 4DUOA 3GXFA 1T40A 4K37A 4NAFB 2ZA1A 4FEZA 1JR1A 4LIIA 2PA6A 3CJPA 1B31A 5TR3A 1NARA 1KFWA 4OVXA 4MWAE 4DO5A 1K1DA 4F2BA 3APGA 5AFDA 4TQTA 1E1FA 3I4KA 5JCIA 4TVYA 2BWGA 5EMYA 3SM0A 3SADA 2GH5A 4ZVJA 3IJQA 1HKMA 4J7RA 1X7IA 2W62A 4OECA 4BQ4A 1MFVA 2PD9A 3RLUA 2JIEA 4LX4A 2EXOA 4DWSA 2TYSA 4O1FA 3EXSA 3BPWA 3VMOA 3W1TA 1VS1A 3ITTA 5BXPA 4HTBA 3PUOA 4GMEA 3VKKA 1W1IE 2YA1A 3MS8A 1F61A 2EKCA 2BGNE 4Z08A 3MSGA 4QISA 2F9RA 1YE4A 2WP6A 2FB2A 5D8ZA 4O1EA 2HROA 2VURA 1DP0A 3P8IA 1CYGA 4H7VA 4N9BA 1ZJAA 2IPJA 1OB0A 3EB4A 5CGTA 3NDYA 4NZ5A 2GUBA 4O13A 1OVDA 1DE6A 3G6MA 3W7MA 1QK0A 3IACA 1MSSA 1GVOA 4WHBA 2CLPA 4HNCA 3WUGA 3QFBA 3IIXA 1MXSA 1HVXA 1FH8A 1R3YA 1B3WA 4OQVA 4EF8A 5FEWA 2YBUA 1MW2A 1B90A 1SFSA 2E3ZA 4LAMA 5CEWA 5K4ZA 1ZJHA 2D23A 4Y2WA 4DJFD 1UZ1A 5FF2A 3BAJA 4KESA 3ITYA 3VFLA 2XGZA 4B9ZA 3N3MA 1RAKA 1V03A 3DKJA 4KCTA 2ACRA 4DZHA 1MEHA 1FY6A 2J7BA 2X7VA 3S6DA 1UMYA 3R0UA 4JY8A 3SQLA 2VUYA 2B31A 4PH6A 1VYPX 5EMUA 5LA1A 1U5HA 1IXQA 5FACA 5HJYA 2PLMA 2VYOA 1W3HA 3CUHA 1JQXA 4WOZA 1CB7B 5B80A 4LH8A 4EQRA 5BW6A 1K02A 4DUXA 3SSZA 3EYPA 4G7EA 3S9YA 2H9AB 3VIMA 1TUFA 2WSYA 3MZ2A 4AXNA 1IWPA 1DWHM 1G01A 2V67A 2NW0A 3LHVA 4FALA 2RAGA 2IQDA 2NX3A 3LLDA 4AU0A 3WX7A 1LORA 3WUFA 2QCMA 3WL1A 4UBPC 2DVXA 1FWEC 4NJGA 5A6BD 4OWGA 1ZL1A 3H2EA 3GWQA 1XG4A 5GNZA 3VM7A 4W86A 3NQ2A 4ICMA 4LVGA 4O19A 3V5FA 1NAL1 4GBUA 4AD4A 3IC9A 2IKHA 1MDLA 1MRAA 3G0UA 1TPC1 3C2FA 2NT1A 2VVSA 3P5ZA 4S3AA 4P8WA 4WY0F 1MQRA 1VYSX 3W23A 4YYCA 3M41A 4ICCX 3CLMA 3CMGA 4S2BA 2CEQA 4H04A 4LV9A 2XN0A 4B2DA 4L9ZA 3E2VA 5HPCA 2J6XA 4GX9A 3HO8A 3RNMA 4U3CA 2CLKA 3N4FA 2NWSA 1XYMA 3W76A 1QW7A 1TQXA 2BOEX 2SFPA 1C93A 4GJIA 2PGWA 2OTDA 2WWDA 4DO4A 2GGHA 4YL2A 3DFSA 3EX1A 4PTNA 3LRKA 3GR7A 1VLIA 1K3UA 1R6WA 1US3A 4KWUA 2PCQA 3T08A 3GU1A 3AIWA 4JTTA 1YYAA 3AQUA 1JYWA 3VCNA 4K8DA 4Q3MA 2JKAA 3GIYA 2WMKA 4CCDA 1TZ7A 3GTXA 4MKNA 4WJ8A 3DG6A 5IM51 4CNSA 4EM4A 3IS4A 4PBFA 2VCAA 3U8GA 5ABFA 1GNXA 3CGBA 3FEMA 1E56A 3KVMA 2X8GA 2HXTA 3K8LA 1WPCA 4NZ1A 1T99A 3VABA 5D02A 4NXSA 3TMQA 3PBWA 2YBTA 4IGHA 3FHQA 4AZ6A 4GUGA 1PVNA 2W3ZA 4AD5A 3PJTA 2C3DA 1C92A 3GB6A 1BLIA 4O57A 4CVUA 1JCYA 2OODA 3GLCA 3U2OA 2O9OA 3II1A 5M1TA 3KLLA 4E2DA 5HOSA 4C7GA 4LEQA 3STFA 4QCFA 1Q4WA 4AYGA 1TPUA 1LROA 2VGIA 1BF6A 1W9BM 3FHAA 5REQB 3UXKA 1Q1RA 1GRAA 1BGAA 5HNRA 1V79A 5XINA 3EA2A 4A8LA 3P2VA 2OSYA 3EWBX 3CASA 2DY3A 3VKAA 5C55A 5I3JA 4V28A 1TV2A 3WLMA 1NHPA 1VB9A 5LYRA 2C3CA 4J57A 1PCKA 3DU0A 3B4UA 2CXEA 4H3DA 2VKZG 2JBMA 2J9XA 3CHDA 4GD0A 2A4AA 3UG5A 1E9YB 1EBHA 2VR4A 2QS8A 1I2OA 3YPIA 3ZJ8A 2XHYA 4PB5A 4UWMA 3QGVA 2E6DA 4HN8A 3MI6A 1CENA 1W37A 4GH3A 2A7RA 2XUCA 2C15A 4NEWA 1IXPA 1TA3B 1QOXA 1LOLA 1YADA 1MW3A 5A8GA 3TK7A 2QAEA 4K8GA 2DW6A 1RQEA 3U7BA 4Z1AA 2C0AA 1C9DA 3HA1A 2XU2A 3MMWA 1N8FA 4IGSA 3B0XA 3N14A 4RNHA 2DJXA 1H1YA 4XIAA 4QNWA 1N60C 1E0XA 3ITLA 2VZOA 4EKJA 4KWOA 4QR6A 1CX9A 2ALDA 3REQB 6ALDA 3QQ1A 2JKEA 3DAQA 4BA0A 4K1GA 3H8AA 2VGFA 5FIPA 5CG7A 4CD6A 2ZOXA 1EGVA 4XZHA 2V0TA 5HATA 2WCGA 4GWEA 3DYPA 3WD0A 4GLEA 4UFLA 3PFRA 4RDZA 1JCXA 4MNJA 3M0KA 3WBYA 4JKLA 3VU2A 3VIHA 4CD4A 3FAWA 3KE0A 4EX4A 1EXPA 2GDVA 4CVWA 1FUYA 4FX7A 2BOFX 4C6PA 5HR7A 3NO1A 5G2HA 2QMJA 3F5JA 1A4LA 3AYRA 2VEIA 1ZSXA 4GZEA 1GQNA 1TRIA 2NT0A 2ZTKA 3OVPA 1UPPA 2CLLA 3BXWA 3KVJA 4A3RA 1HJSA 4YVXA 1E6SM 3DFPA 3N2TA 3S1UA 1RLDA 3CUIA 1SM9A 2YW3A 3QSRA 3BW3A 5A6SA 3DI0A 3RLGA 4H9MA 3SRDA 3OVQA 4LOCA 2YFNA 3RUBL 3CZ8A 2QJGA 1G94A 5IDIA 3WNOA 5GRTA 5BOFA 1TTIA 3VC6A 4DN1A 4QLLA 4PTMA 3V0TA 3TCEA 2EPMX 5D04C 4DWSB 3AMGA 3WJSA 3OBAA 4ADUA 2CLMA 3GX9A 3E5PA 3W1NA 1QRQA 3WY1A 4UC5A 2WMIA 4XTIA 1M68A 2R94A 3T8LA 4WDTA 1E4NA 1XGZA 4FNRA 1M5WA 2WPGA 3TV8A 2BFGA 2DPEA 1F3EA 3M16A 3HG5A 3SUTA 3W84A 1SSGA 2WOVA 5DCBA 3IUHA 1Q65A 2FZMA 3D6NA 1QBBA 1W3TA 1R3VA 3FK4A 2G3JA 4JYEA 2QCEA 2WC4A 1HFBA 1N8IA 1V4YA 4FNSA 5HXMA 3S1XA 4PCNA 2O7SA 3NQBA 4V33A 2QUTA 3OZYA 2E67A 4XKYB 3A21A 4DI9A 4WKAA 5MF5A 2YB1A 4B5NA 5EGRA 4FNUA 4LWWA 4QJ1A 1XYAA 4GIRA 4FB7A 1IT0A 4G2DA 5CJNA 5FSEC 2Q02A 3B0PA 5HANA 4QNEA 3N6HA 1YRRA 1B4EA 3RYSA 1OFEA 3SW6A 4JL2A 4LS1A 4RW3A 1OF6A 1VPXA 2X8HA 1VYRA 4MUZA 4PRTA 3KP0A 3AROA 2I16A 1Q3NA 4DM2A 1ECQA 1FHDA 1TJ1A 3PAJA 1AZ2A 4A2SA 4G7EB 1ONRA 2PP1A 3PNUA 2BP1A 2CW6A 1V3JA 1P43A 2FH8A 3HJEA 1ZHAA 1DXIA 3GE7A 1N55A 4DWDA 4DBSA 1F5ZA 3EWUA 4W5ZA 2Z1VA 3B9EA 3G5EA 3GD3A 2YYTA 2VFFA 2QCHA 4JIHA 3PWIA 1XP3A 1P6WA 4K68A 4WX2A 1AUSL 3GAKA 4IX0A 3QR3A 1J0KA 4JX5A 2Y5EA 1PYMA 2BHZA 1DJHA 2O7QA 1VLWA 4IQJA 2GYIA 2PZNA 1P48A 2GVGA 2VQTA 3EEZA 1BQCA 3QLLA 4OUIA 4RKAA 2I9EA 3KXQA 5BMWA 3P80A 3BVJA 5D2XA 3LPOA 3F2DA 4S3BA 5DXXA 1OFRA 3RNDA 4KGJA 3CIXA 2O9TA 3SCPA 1E0TA 2W27A 5D2WA 3L2MA 2BMBA 5ENLA 5D2YA 4FXRA 3MZNA 3ABXA 2A3CA 4LC6A 4N02A 2W91A 3G8RA 4AC7C 3B06A 4UTHA 4UOZA 1SMAA 2E8YA 2ZKMX 1W1PA 5D4YA 1NDZA 3CZLA 3KBWA 3BSGA 1YTDA 2VFDA 3BC9A 3WF4A 1A5AA 2A21A 1LM1A 4ZXLA 1XIEA 1EC9A 3QH2A 1POJA 4XISA 4XBJA 3JS3A 1IIGA 2ACSA 1AMKA 3S5NA 2IKGA 4Z0SA 4K36A 3BV4A 5A2AA 5AB3A 3AMDA 2XG9A 1NIUA 4GXMA 2AL2A 2IQTA 4WXYA 3PZGA 5C2CA 1PX4A 2VFHA 3EMQA 4FS9A 3VUSA 5A8PA 5EBAA 3VZXA 1YE6A 4W93A 4NVTA 5D9OA 3DFNA 5DCDA 3MQTA 2HBVA 4C5ZA 4I5XA 3TN6A 5CJMA 1R2TA 3ZFHA 2PDLA 1CDGA 1XYFA 4S39A 2V2HA 2CCRA 5ABFB 4AY7A 3AZSA 1WAUA 2HE5A 4OT7A 4AUBA 1A3WA 2PI6A 3NL3A 4JTFA 2C6QA 1H6VA 5M2FX 1EQCA 3OHIA 5KINA 1TZZA 4AH7A 2QQ6A 1EDQA 3G18A 4JFUA 1GCYA 4UUIA 4CNNA 4NI8A 1V59A 6TIMA 3MJMA 1XIGA 2WZEA 1Q66A 3AN1A 1RXOB 4KPRA 3BLOA 2YL6A 3PN8A 1L6WA 3NVTA 4M6VA 4RX0A 4H9ZA 1EC7A 3GR8A 3LBMA 1NP2A 3PTMA 3BMVA 2FFIA 5FEXA 3W02A 2YOCA 3WQ4A 4RL3A 2IS7A 1OD0A 3DC8A 2OLHA 4F9DA 4BY3A 4W87A 4PZVA 4J35A 3R89A 1A53A 1HJQA 1WKEA 4MYAA 1XSIA 1KD0A 4D1JA 2VHLA 4LCQA 3XIMA 2GGJA 4FNTA 3NOYA 2F2HA 3CHCA 1B3VA 2DQXA 2NVCA 3PULA 4LYKA 4ZBCA 3QY6A 4KBXA 4ZQNA 1H62A 4M1BA 1MUWA 1E3XA 3FYPA 3WLRA 3O0KA 1D8CA 4O15A 5IXEA 3TJ4A 3AI0A 1Q6FA 3M5XA 4K7YA 1V3MA 1OX4B 4JBRA 4HHMA 1MW1A 3WMCA 1XC6A 1ZTVA 4INFA 4QJ4B 1VIWA 1LL6A 4E0CA 1W1ZA 3WD4A 6PTDA 4H4SA 3CT7A 3KP1A 1YMYA 1VFFA 2G4FA 4JNZA 4MFEA 4UIOA 3DCPA 4DJFA 1T3QC 4TX9A 3TJIA 1CGWA 3OLIA 4C1LA 5HA7A 2VRKA 2YVJA 1ALDA 1G5AA 1XUUA 1G67A 4FR6A 4ZB0A 1KCZA 2J79A 3L4UA 4GPNA 1KR1A 4QROA 2B7NA 3THAA 3K4WA 4IUGA 3IUIA 4ZO9A 2DUXA 1GYNA 4Z2IA 5I0DA 4J28A 4DUWA 4AY1A 3E02A 4KRZA 4Q8WA 2Z7KA 4I6KA 5FEPA 4GKLA 4PUDA 5FA5A 4LAZA 2WM0A 2ZXBA 2WV8A 2WZHA 3VAVA 4FP1A 1NVMA 3G1YA 1IIHA 5E09A 2XGIA 4WJEA 1QVBA 5I23A 4AQLA 4GNJA 4M51A 1TE6A 1EL3A 5EMLA 2J9ZA 4DXXA 4M1RA 3CWOX 4I6VA 3UR2A 1KQZA 1V02E 5A8NA 3LBOA 4G7FA 4Q8TA 1QI0A 2AGTA 3E2QA 3BLLA 5A6BA 5G4HC 2W3RA 3Q65A 4WK9A 1Z32X 2GR3A 4FHAA 4LY4A 2Z1BA 4KFPA 2YCLA 3IJ9A 3EKZA 3E0WA 3N2XA 3A23A 3DK9A 2F2KA 2D1ZA 2EG6A 1D8WA 1IR1A 3PR2A 3TX9A 3F5KA 1IV8A 1HP5A 2AAAA 1YXDA 1V0KA 1P0NA 4OOUA 1QTWA 2WANA 3Q67A 4MTVA 1XS2A 1N5XA 5KZEA 2W63A 1P7TA 3GXIA 3R11A 4GIAA 4JX6A 3GXMA 5TIMA 1KKOA 2D0GA 4E4PA 4IP4A 4WUIA 3G1SA 5I79A 1UP2A 5I5RA 3NPXA 2VDHA 1YQZA 2VDIA 1R2SA 4GBDA 1V7YA 4R27A 4DAFA 3VD9A 3ZIZA 2DFAA 1I4NA 3EZ4A 2QVHA 3SFKA 4X3ZA 4AZIA 5FJRA 1EJ7L 3ABRA 3G1HA 1WBHA 4OFCA 3NSXA 1GYLA 3WQDA 1H4PA 2JQXA 5BOOA 3E2RA 3E0VA 3E6EA 4S3DA 4TR9A 5E93A 4I8DA 4OV4A 1SZRA 1RA5A 3UW6A 3GHSA 3L4YA 4JICA 1S3TC 1W5MA 3UA3A 4LCRA 5BYWA 3BSMA 1Z41A 2E5AA 4ATDA 1J6OA 3FFSA 4GO8A 4AEEA 4LAUA 3D3AA 4DVOA 1OFQA 4RE3A 1K6WA 3WJXA 4B3ZA 1E72M 4GG9A 2Z2AA 4WRHA 1M41A 5CSUA 4O1BA 1PBGA 2I5GA 2RUSA 4Y9OA 3E49A 3NSMA 2H6RA 4JZ5A 3M6YA 4WDUA 2YCIX 3VNYA 1GG0A 3AMKA 4EQSA 3GNOA 1JFHA 4QDPA 1WZMA 2QULA 5E0FA 2ANUA 4HPXA 4ZOEA 3PUDA 5F7UA 5I03A 3OEXA 3AALA 1VQZA 3GNPA 2IPWA 4JNMA 1J11A 1FFUC 2JK6A 3H55A 2CKSA 3BGAA 4LQ1A 4PCSA 1J5TA 3GD4A 1QPNA 1W5NA 2FHBA 2PF8A 2YQUA 2YAUA 2WQDA 1PKLA 1XLIA 2C1HA 2PWEA 1BGGA 1CLXA 1ME7A 1BWLA 3HPSA 7TIMA 4MWAA 2VM8A 4FR1A 2NLIA 4F0HA 3IIZA 1OG6A 4W7WA 4RPPA 5HINA 1D3CA 3STPA 4B9YA 3W1AA 4H4XA 3R1ZA 4EM3A 3KDNA 2E40A 3M6DA 3NM3A 4A3HA 3C3NA 2OZ8A 4QFUA 2OEKA 2G41A 3VIJA 1SJDA 2CLOA 4REQB 3L4VA 2VELA 3JRKA 4WGXA 4MZ1A 2FLIA 1VPYA 3KM8A 1KFJA 5LIUX 3K1DA 4CD7A 4L6DA 3C2VA 3MUZ1 1E0WA 2POZA 4JTGA 4YWIA 4PUEA 4TVDA 5EMKA 3NSNA 3NDZA 1OT1A 3BCFA 4JHOA 1KM5A 3GAYA 3MSDA 5RUBA 3IGSA 4ADTA 2FTWA 3DKLA 2WPEA 1FWRA 6XIMA 3M4HA 5DCEA 2E3TA 1TV3A 5M3WA 4B91A 1KFBA 3PSWA 3II4A 1V7AA 5DBTA 3P0WA 1DIEA 3FJ6A 1FWCC 2QCNA 3TYDA 1XLKA 5IFTA 1GORA 1OADA 4FX8A 3I65A 4X0VA 3M0JA 3C56A 2J47A 1S39A 3GXTA 5DMYA 1TWDA 3NXLA 4ML9A 4PODA 3SI9A 4LB3A 4FLSA 3MB9A 3W7GA 1HGYA 2Y61A 3AHXA 4RZ4A 2XH4A 1MDRA 1GWJA 2EBNA 2I56A 3UESA 4BEQA 3O6YX 3LBCA 2EQ6A 4NF7A 3S5OA 2WNQA 3VTRA 5HMEA 4KRTA 4XBKA 5JH2A 1HJUA 4HYRA 3BICA 3TTQA 1R5YA 1UROA 2OX1A 2FGLA 1Z44A 2VOMA 5KZDA 4AWEA 3QSTA 2V68A 5CGQA 2GSEA 5BROA 5AVHA 3DESA 2TSYA 1L8PA 2EF9A 3WCZA 3UEQA 4QM1A 5CJ5A 3E74A 4H6KA 2IXVA 4R9OA 1TE1A 2Y8KA 3CAQA 1XYCA 3DG7A 3IIOA 1W5QA 1G4EA 4HP5A 1JG9A 3QR0A 3TC6A 4AVFA 1GRBA 4S3FA 4AZ5A 5HNTA 3COTA 3DHUA 5K9XA 1W9PA 2EAWA 4CKQA 2ICSA 2ASHA 5A6KA 1GXFA 4LF2A 1L6GA 1OCBA 1H50A 1A3XA 1J9YA 4MF4A 3L4WA 4A2RA 3EUB3 1DOSA 3BARA 4YN5A 2PRHA 1XINA 3UWQA 2GOUA 3GD6A 4FF5A 1OG0A 3BQ6A 4RZ6A 4GI8A 1WP6A 3WFAA 4L4PA 1AW5A 4IMCA 4PEKA 2Z1XA 1AJ2A 3F03K 1R85A 2ZUNA 1YLVA 4AY8A 1TO3A 1N5WC 2E8ZA 4NZ4A 5M17A 3V1PA 1RD5A 2WMJA 4PUUA 2E6AA 3TQ0A 1GPFA 2ATSA 5JCKA 1JUKA 3GW0A 4GGHA 4EPKA 3PJXA 2CWNA 3IGHX 1FWGC 1BYDA 3IV3A 3C2YA 1X1OA 1XIDA 4C6JA 1FEAA 1GZGA 1HIZA 3G1AA 3MW7A 3XINA 4YTQA 5BRPA 1FWTA 4GA8A 1CCWB 4PR4A 3OVGA 1XSKA 4JTDA 1VD6A 3KBSA 3KL3A 4RDVA 2PDXA 4LYPA 2G5WA 2ZX8A 2AQVA 2D20A 3GO2A 3E96A 1ZFJA 1QOQA 1WV2A 1ICPA 2CBJA 4BS0A 5I09A 4GO9A 3A24A 2ISWA 4S3KA 1YIXA 4M8UA 4N7QA 3H2AA 4D8ZA 2VCBA 1QI2A 4HA0A 4DLFA 4GYKA 5LA2A 2J8FA 1O7AA 2AQOA 2REQA 4PL1A 2PC4A 1W32A 5K3VA 3BG9A 1EIXA 3AAMA 4HCDA 5HAOA 1C3FA 3CYJA 3EBVA 3RPTA 1WOBA 5F2GA 1UHVA 3WQCA 1LTDA 1ZY8A 1W1YA 3R2GA 4UR7A 3B9OA 3TWBA 4J3WA 3IAPA 4C6MA 4BQ3A 3MV01 3P0XA 4TIMA 3GRIA 2E5BA 3A6OA 4RUBA 2PS2A 1HX0A 2VR2A 2WP5A 4TV5A 2E4TA 2J4GA 2IMRA 1P0EA 3B05A 1IZJA 3MKKA 1NQKA 3N4EA 1WDDA 4MAZA 3I3BA 3KHJA 3LPPA 1J79A 3PTDA 5C9XA 1DIOA 2J7CA 2YDAA 1XIFA 5LIKX 1JPDX 1BWVA 3WLSA 1IZKA 3MDUA 2DVTA 3AFBA 3A4AA 2GDQA 4BJHA 1GQJA 2UY4A 2OGJA 1GOIA 4GIYA 4AB4A 4MJ4A 3S8HA 3WNLA 5HMDA 4PMRA 2ZDRA 3B8WA 4D6HA 3KLJA 1QHOA 4RCXA 3PANA 3OQ8A 3RM8A 1MOKA 1GPWA 4CQAA 1JDDA 3OJGA 4V1XA 3W7JA 4G1NA 3G8EA 3SCVA 2A3LA 4DJDC 4KWSA 3CHEA 4DX3A 2DZBA 4AMCA 2VZSA 2Y63A 1M53A 2LLEA 3IRDA 4NY2A 1VJSA 4HBKA 2OT0A 3W7DA 4LPCA 3ENLA 4GUFA 4ORIA 4ZOBA 2P50A 4QCEA 1R3WA 3T44A 3HW2A 3SCQA 1MQPA 3SGZA 4M82A 3WNKA 3BZJA 1SR0A 5A5WA 2DZVA 3NQVA 3G77A 1W3KA 1YPIA 4A21A 4QJ3B 3H21A 1ZP4A 3KOZA 1W56A 3T81A 5ER0A 1PO9A 4QX4A 4B4HA 4J3UA 3W2MA 1HL8A 1K7XA 2D22A 1TREA 1BEUA 3N4AA 3O1NA 3Q58A 4AX6A 4YXGA 1H5VA 1U2YA 2KZHA 1S2AA 1RPKA 3MHUA 4X2RA 3NG3A 1J0ZA 1PX8A 2PRLA 3MCMA 5A69A 2JEPA 4MWAB 4MSSA 1CW2A 3M47A 1EWEA 4Z0JA 1XBZA 4OKDA 1VC4A 2A6L