5JCMA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
432
structure length
429
Chain Sequence
b'EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFFSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVEELKKEGLQFASKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Oxidoreductase
total genus 140
structure length 429
sequence length 432
chains with identical sequence B
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jcmA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcmA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcmA02
3CN8A 3QFBA 4BK1A 3PVCA 4Y4MA 1FECA 1XHCA 4EQXA 1EL7A 2B9XA 4JN9A 4U2SA 3DJJA 1YQ3A 2BXSA 1OJCA 3ISHA 5M0ZA 2YM1A 2GV8A 3KKJA 4A9WA 4CNKA 1FOHA 4ZN0A 1PXBA 3SGLA 3AE8A 2JK6A 2V3BA 3F8DA 5IPYA 4H4ZA 4Z24A 2BXRA 1TDOA 1GETA 2EQ8A 1IUWA 3GMBA 4J31A 1TDKA 2R0CA 1GRTA 4U2TA 5CKUA 1NPXA 3QSMA 4CBQA 1D4DA 2Y6RA 3NRNA 1LQTA 3ADAB 2TPRA 2BK3A 1H6VA 3CNTA 2BS2A 2BCPA 1D4EA 2WQYA 2XFNA 1GESA 2QAEA 2YQUA 1REOA 1LTXR 3D8XA 4JDRA 3BHKA 3IHMA 3LOVA 4K5SA 4XWZA 2FJEA 4K2XA 2BCGG 1CL0A 2XVJA 5C3JA 1B8SA 3QVPA 3C4AA 4BK2A 2AAQA 2GQFA 2GMHA 3AYLA 4H2QA 5CQFA 1PXAA 1FEBA 3KVEA 3AE1A 3FBSA 1F3PA 4J34A 5J60A 1NG3A 2C72A 4PAAA 2WETA 3ALJA 2QCUA 3CGDA 4C3YA 4CRTA 1EBDA 2WDRA 2YVJA 1JEHA 2GR3A 1XDIA 3NK1X 1F8SA 4AOXA 4OPIA 3CNJA 3CTYA 3UKKA 2C3CA 1MXTA 1VG9A 3AEEA 3REDA 4H4XA 1PBFA 1O5WA 3AWIA 2A8XA 2BC1A 3EAOA 2JAEA 4N9XA 4B1BA 1M6IA 4H4VA 1XPQA 1GPEA 3UKFA 2BA9A 3AXBA 3P4PA 1ZOVA 5KOXA 4DNAA 1KNPA 1TDFA 2GRTA 4UP3A 2C65A 4EMWA 4FK1C 2WU2A 2WBAA 2IIDA 3AE5A 1E1NA 3ALLA 3JSKA 3NH3X 3NT6A 1NHSA 4H4WA 4X9MA 4H50A 3ITJA 2YVFA 3RP6A 1YY5A 3ICTA 1JRXA 2YR5A 1HYUA 4D04A 2GEWA 1P2EA 3D1CA 4BK3A 3CNDA 4YXDA 4UDRA 4B66A 1JRYA 3IF9A 3K30A 3NN6X 1B37A 1E1LA 2BS3A 4C74A 2C70A 2CDUA 1JRZA 2ACZA 1M64A 5EB4A 5U25A 3GSIA 2X99A 1H84A 3GYIA 2O9ZA 4YSHA 1S3BA 2WDQA 3UCLA 1ZMDA 4YTPA 3CNSA 3P1WA 4APNA 3DA1A 4OPGA 1GTHA 4ZCDA 3EANA 3UKPA 4DSHA 3ICRA 4NEVA 2JBVA 3AE3A 3GYJA 4B63A 1COYA 2WPFA 4ECHA 1LV0A 1TDEA 2YG7A 2E1MA 5HY5A 3ALMA 3H8IA 1FCDA 2CULA 1RP0A 5KWFA 3AE2A 2C73A 2CVJA 3QSEA 4DGKA 1NAAA 3DJEA 2AR8A 4EM3A 4YTMA 1X31B 1PS9A 1LQUA 3GDPA 2XDOA 4RSLA 5U63A 2ZZCA 3FIMB 3V3NA 3C4NA 1IUSA 2B7SA 4WX1A 3OC4A 4EMJA 3NYEA 4ICYA 3RP7A 2Z5XA 2JKCA 1NG4A 2WEUA 4J33A 2WDVA 5IQ1A 1H83A 3ZYXA 3B3RA 2J3NA 5JCKA 2Q6UA 5JCNA 1P2HA 4YSYA 2WOVA 3UKLA 5BVAA 2A87A 3DH9A 2XVHA 5U1OA 1CJ3A 1KDGA 1CC6A 3NGCX 4FK1A 1VDCA 4NTCA 3BI5A 3PS9A 3UTEA 4CCRA 2FJAA 3G5QA 1D5TA 4Z2UA 4HB9A 2VRMA 2X3NA 3UKAA 2OALA 3EPTA 4XWRA 2X8HA 1KF6A 2BS4A 2YR6A 1KNRA 4WCTA 2BC0A 4B69A 1LPFA 4H4YA 1PXCA 3AEGA 1N1PA 2VVLA 3M0OA 2VOUA 4OPLA 4GCMA 1K0LA 3BI4A 2ZZ0A 2YLSA 1K0IA 2WP9A 4IVOB 4U8IA 2WOIA 3AE4A 1NDAA 2YLWA 2GAGB 2GR0A 3VR9A 1DNCA 3CGCA 1BZLA 3II4A 2APGA 4FDCB 1IUTA 2YLXA 4XXGA 1LJ1A 1ZP0A 1PN0A 4EQRA 3SFEA 3AE9A 2C67A 2E5VA 2FBWA 4NEWA 3NG7X 4RG3A 3T37A 4I59A 2WP6A 1ZMCA 4OPTA 4OPUA 2WPCA 3AEFA 3VRAA 4CNJA 2BYBA 3NYFA 4IA6A 4H7UA 2GQWA 5BULA 1MOKA 3UTFA 3CPJG 2JB2A 3F8PA 3UKHA 1IUVA 1VRQB 2GMJA 3P9UA 2IVDA 2IVEA 3F8RA 3FG2P 5DBJA 4USQA 1B5QA 4AT0A 3S61A 4AT2A 2GR1A 3V76A 3V3OA 1Q1WA 2ZBWA 3VRBA 3NIXA 2C3DA 1YQZA 1Y56A 3AYJA 4P9SA 3ATQA 4K22A 1KSUA 4YSXA 4CCQA 2UZZA 4TM3A 2C7GA 1CC4A 3AEDA 4H2RA 5BRTA 2YLRA 1BKWA 3AD9B 2RGOA 2X50A 3UTGA 5TR3A 1OJTA 4EM4A 2FJDA 2OAMA 1TRBA 3VQRA 1DOEA 2YG5A 2F5ZA 4Z43A 3AE7A 1L9DA 3R9UA 2WP5A 3NK2X 1Y0PA 4AP1A 3P4QA 1DODA 1NEKA 1KFYA 5HXIA 4KPRA 4EMIA 2Q7VA 2EQ6A 4H2NA 3SFDA 3ZDNA 4B67A 1N4VA 4ADWA 2BACA 2DKIA 5KVIA 1TDNA 2Q0LA 2A89A 1F8WA 1ZX9A 2XLRA 3K7MX 3NNEA 4C3XA 5IQ4A 3DJGX 3GDNA 3LADA 3Q6JA 2WESA 2Y6QA 1RSGA 4GDEA 3DGZA 3ICSA 3AEBA 2XFOA 3BHFA 4REKA 3KA7A 4RG4A 3IWAA 1GRGA 3GMCA 3SM8A 2BK5A 4JQ9A 1CJCA 2DKHA 3H8LA 1IUXA 1H7WA 1KSSA 5EOWA 1TYPA 2XLTA 3DMEA 2XFUA 4J36A 4NZHA 2VQBA 4BV6A 1ZDLA 4A5LA 3CPIG 3CGBA 1GRBA 3QFAA 1SEZA 4Y4NA 1CF3A 3RP8A 2QA1A 4GUVA 3AD7B 4YSZA 5FS7A 5KXJA 4H4RA 4YKFA 4TM4A 1E1MA 1CJ2A 2YG3A 1B4VA 3NTAA 1GREA 4USRA 2B76A 1UKVG 3GWFA 4LIIA 1PBDA 4Z44A 1GRAA 3DK9A 1PBBA 3L8KA 4H4TA 2C66A 4BJYA 3GRTA 3NTDA 4Z26A 1CHUA 3QJ4A 2PHHA 4H4UA 1TYTA 1DOCA 3CIRA 5JCMA 4M52A 1E39A 4TLZA 4DSGA 1DJQA 1S2YA 1IUUA 1Y56B 1S2QA 1GSNA 2WOWA 1GERA 1CC2A 1PHHA 4U2LA 5HHFA 2NPXA 2B9WA 1Q9IA 3CPHG 4AOSA 3AECA 4K5RA 3EF6A 1EL9A 4NTDA 1PBEA 2CFYA 2QA2A 2I0ZA 2C76A 4J57A 1AOGA 3LZWA 2W0HA 4O5QA 4Z2TA 3M13A 4BURA 4K7ZA 5HYMA 1GRFA 3FPZA 2E4GA 3NN0X 4GF7A 3UOXA 4A65A 2B7RA 3RNMA 1K0JA 1F6MA 2R46A 1L9EA 1N4UA 2XLUA 3LJPA 1MO9A 4U8LA 3QVRA 2H89A 5BUKA 2XFQA 3KPFA 4CY8A 1GOSA 1L9CA 2PYXA 1L0VA 4U8PA 4KX6A 4U8JA 4Z25A 2H88A 4UDPA 3RHAA 3OZ2A 3AYIA 1ZK7A 2GH5A 2XCGA 4X4JA 4EQSA 3KD9A 1GT8A 4PABA 2R4EA 2X8GA 1BWCA 4U8OA 3UKQA 2YLZA 4O5UA 4TLXA 3C96A 2YAUA 4Z2RA 5KOWA 3AD8B 3VRDB 2NVKX 5FS6A 4YWOA 3K7TA 4OPDA 4U8NA 2YR4A 1PJ5A 3ATRA 3B6DA 3PO7A 1QO8A 1DOBA 5EBKA 1O94A 1W4XA 2VRLA 1QLBA 1FL2A 4I58A 2XLPA 4H4SA 2FJBA 2XYOA 1DJNA 2C75A 4TM1A 3NK0X 2EQ9A 4A79A 3G5RA 5FMHA 2OLNA 3Q9TA 4ZCCA 1IJHA 3S5WA 4JNAA 1FEAA 1K4QA 3CNPA 2XVIA 2YG6A 2V6OA 4TM0A 4B68A 1GNDA 1JNRA 4JY2A 2AQJA 4A99A 3GWDA 4IVMB 2XLSA 1BF3A 2R0PA 1LVLA 2V3AA 3P4SA 2HQMA 3DK8A 4EQWA 1GRHA 3SQPA 1D7LA 2C64A 3GD4A 1O95A 3VR8A 4E0VA 4C77A 3IC9A 2WS3A 2EQ7A 4IV9A 4H4QA 4A6NA 4UDQA 4JNQA 1ZOYA 1N4WA 3BNUA 4H4PA 2VQ7A 3H4KA 1PBCA 4OPCA 1VQWA 4J2WA 4X9NA 3KLJA 2R45A 3K7QX 2RABA 1NHQA 3AEAA 1GALA 1E6EA 1RYIA 2OLOA 1NHRA 3NHOX 1H7XA 3O0HA 1D4CA 5FS9A 3DJDA 1GXFA 4GRTA 1BGNA 1YKJA 4MJWA 4CY6A 1H86A 4BJZA 3GD3A 2B9YA 1PJ6A 3NKSA 4OCGA 5GRTA 5J7XA 5LV9A 5M10A 2WU5A 2YWLA 4GDPA 4NTEA 4JY3A 2BK4A 2R0GA 4Y4LA 4K8DA 1H81A 2GAHB 1QJDA 2JB3A 3L1RA 4YKGA 1PJ7A 2ZZBA 4U8KA 1VG0A 4U8MA 4H2PA 3GRSA 3ABVA 2GF3A 3LXDA 1CBOA 2GB0A 4OVIA 2R9ZA 5EB5A 3I6DA 1DXLA 4YT0A 5FS8A 1JU2A 1S3EA 1XANA 2XVFA 2Q0KA 5ER0A 1JOAA 2VVLG 1PDHA 1ELIA 3UOVA 3DGHA 2GR2A 3BNMA 5KRQA 1OJ9A 3COXA 3UOYA 5GSNA 5KVHA 2TMDA 4IA5A 1GTEA 3WE0A 4LA1A 3BI2A 2X8CA 1GEUA 5JCLA 2XFPA 4HA6A 2Z5YA 3UP5A 1D7YA 2YVGA 3DK4A 4FX9A 1EL8A 1JNZA 4LU6A 3P4RA 3UOZA 4B64A 1ZKQA 1YQ4A 1BGJA 2V5ZA 4B65A 2V60A 3URHA 2VVMA 1Z6LA 1NHPA 3AE6A 3I3LA 3KU9A 5JCIA 3FMWA 2XVEA 3NLCA 4C5OA 2RGHA 1ONFA 2GVCA 1Q1RA 3UP4A 3LB8A 1CJ4A 4A7AA 3QSSA 3UTHA 2WHDA 2YLTA 3AB1A 4A6NB 4J56A 1NENA 3CGEA 2R4JA 1H82A 1EL5A 4AP3A 5C2TA 2V61A 3E1TA 2WPEA 3G5SA 2JB1A 2ARDA 1E7PA 3M12A 1OJDA 1OJAA 2RGJA 4D03A 2YG4A 4GR1A 1F8RA 2BABA 3LZXA 4EIPA 3HZLA 4YTNA 1ZY8A 1V59A 5L46A 2VZ2A 4EIQA 2OA1A 3NYCA 2YM2A 1GV4A 1E1KA 3IHGA
chains in the Genus database with same CATH superfamily
3QFBA 4BK1A 1TZZA 1YEYA 3S47A 4JN9A 4U2SA 3DJJA 3ISHA 2YM1A 2AL2A 2GV8A 4CNKA 3CAWA 1PXBA 3AE8A 2JK6A 2V3BA 3F8DA 2BXRA 1GETA 3UCDA 1IUWA 3GMBA 4J31A 1TDKA 4U2TA 1GRTA 4ZOHB 2Y6RA 3NRNA 1LQTA 3UJFA 3N6HA 4ROPA 3N6JA 3CNTA 3UJSA 1D4EA 2WQYA 1GESA 3BHKA 2FJEA 3ENLA 2P88A 1B8SA 2AAQA 2GMHA 1DTNA 3CXOA 3SSZA 3FBSA 1F3PA 2WETA 4IHCA 4CRTA 2OPJA 5G5HB 2GR3A 4AOXA 3CNJA 3REDA 4H4XA 1PBFA 3GO2A 2BC1A 2HXUA 2JAEA 4H4VA 3P4PA 4UP3A 3MY9A 2AKZA 4EMWA 4FK1C 4X9MA 2YVFA 1YY5A 1HYUA 4D04A 3B9JB 1P2EA 1JRYA 3DEQA 4DXKA 2BS3A 2C70A 5EB4A 1H84A 4E4UA 4YTPA 3CNSA 4E4FA 3DA1A 3TWBA 1WUEA 4IP5A 2JBVA 1COYA 3RRAA 3H8IA 2CULA 2CVJA 3QSEA 3KUMA 3N4EA 4MKSA 1X2HA 3DJEA 1F9CA 4RSLA 5U63A 3MUCA 5BOEA 3C4NA 4EMJA 2JKCA 1NG4A 2WDVA 3SXIA 5JCKA 4ZCWA 3DH9A 2XVHA 5U1OA 6ENLA 1CJ3A 1CC6A 4NTCA 1VDCA 3BI5A 3UTEA 3SYIA 3T4WA 1NELA 4HB9A 2OALA 3RO6A 1KNRA 2BC0A 1N62C 2PGEA 2VVLA 2YLSA 4G8TA 3AE4A 1NDAA 3CGCA 1BZLA 2APGA 4FDCB 3V4BA 4XXGA 2HXTA 4IL0A 2E5VA 3FVDA 4RG3A 4NEWA 4G7FA 4OPTA 1ZMCA 4OPUA 3RITA 1MOKA 2PTXA 4IL2A 1KKOA 3UKHA 2IVEA 1BKHA 3FG2P 5DBJA 4HCHA 2GR1A 1BQGA 1YQZA 1Y56A 1KSUA 4YSXA 4CCQA 5BRTA 5TR3A 1OJTA 3VDGA 2FJDA 1TRBA 3R1ZA 2YG5A 4Z43A 3AE7A 1L9DA 4A35A 4GYPC 3S5SA 1DODA 2ZC8A 2Q7VA 3SFDA 4B67A 2DKIA 1F8WA 1JCTA 3UXKA 2OZ8A 3DJGX 5KMRA 3LADA 2WESA 1FHUA 3DESA 4REKA 3KA7A 1GRGA 3H8LA 3R10A 1TYPA 3EUB3 4J36A 3CPIG 1N61C 1GRBA 4IT1A 4GUVA 3AD7B 3FYYA 3UCCA 2YG3A 1B4VA 4USRA 4LIIA 1GRAA 3GRTA 1CHUA 1DOCA 4M52A 3PFRA 5HHFA 2QDDA 4IZGA 3AECA 3EF6A 1AOGA 1MDRA 4K7ZA 2E4GA 3UOXA 2B7RA 2XLUA 3QVRA 2H89A 3NS1B 2XFQA 3KPFA 1GOSA 1L9CA 1L0VA 4KX6A 3AYIA 1ZK7A 4EQSA 2DW7A 4PABA 4U8OA 2YLZA 4TLXA 2POZA 3VRDB 2VRLA 4I58A 4JHMA 4H4SA 2FJBA 3NVYB 2PA6A 4ZCCA 5KNLA 3CNPA 2YG6A 4B68A 1GNDA 4JY2A 2OLAA 4IVMB 1KD0A 2XLSA 1N5WC 4IV9A 4A6NA 4JNQA 3I6TA 1N4WA 3BNUA 4H4PA 2VQ7A 4J2WA 4X9NA 2R45A 1NHQA 1GALA 5ENLA 3NHOX 3O0HA 4GRTA 2C4CA 3R11A 4MJWA 1H86A 3GD3A 3Q45A 5M10A 4NTEA 2BK4A 2GAHB 1H81A 1QJDA 4YKGA 4U8KA 3T6CA 3ETRB 3DFHA 2W3RA 2XVFA 3CMMA 3UOVA 2TMDA 3WE0A 1GEUA 3UP5A 2Z5YA 4FX9A 4B64A 4Z1YA 1BGJA 1ELSA 2OX4A 3OW1A 1NHPA 3AE6A 5JCIA 2GVCA 2BRAA 3AB1A 2V61A 2JB1A 2ARDA 1E7PA 2DW6A 3LZXA 3HZLA 4YTNA 4K8GA 4GAVA 4GYPA 2MNRA 3NYCA 4AOSA 4H2HA 1FECA 4EQXA 1SJBA 2BXSA 1OJCA 3KKJA 4ZN0A 2PP1A 5KMPA 3UXLA 4Z24A 4DHGA 3GD6A 3TOYA 2R0CA 1NPXA 4IP4A 4J1OA 3ADAB 2TPRA 4KT2A 2P3ZA 5FJRA 3FXGA 3TCSA 3SZ0A 2YQUA 4H1ZA 4K5SA 1CL0A 1V97A 3QVPA 3BJSA 4H2QA 2ONEA 2PP3A 4PAAA 4C3YA 3QKEA 3H7VA 1EBDA 2WDRA 1XDIA 3NK1X 3UKKA 2C3CA 1MXTA 3AEEA 4II3A 1O5WA 4B1BA 1M6IA 3EEZA 1TDFA 2C65A 1E1NA 3NH3X 2AL2B 4H50A 3ICTA 1R6WA 1N60C 3STPA 3IF9A 2XSXA 1JRZA 2ACZA 1M64A 3GSIA 4YSHA 3TWAA 4OPGA 2OQYA 4ZCDA 3HYVA 3UKPA 3ICRA 3MKCA 3AE3A 3GYJA 3P93A 3FCPA 3ZVHA 1LV0A 3BOXA 2YG7A 2E1MA 5HY5A 1FCDA 3AE2A 1NAAA 2AR8A 4GISA 4DYEA 4KWSA 2B7SA 4WX1A 3FV9A 3OC4A 3NYEA 3KPKA 2Z5XA 5IQ1A 1H83A 3T14A 3ZYXA 2Q6UA 3OZYA 1XS2A 2QGYA 1P2HA 4YSYA 1VDVA 3UKLA 3NGCX 5J7XA 1KDGA 3PS9A 3G5QA 1D5TA 3T9PA 4Z17A 3DFYA 2VRMA 3CT2A 1KF6A 2YR6A 1PXCA 3AEGA 4GMEA 3BI4A 3TJ4A 4IVOB 2WOIA 3NO1A 1FIQB 4NNJA 3TJIA 4DWDA 1PN0A 4EQRA 2FBWA 1T3QC 3NG7X 3PG6A 4GFIA 3VRAA 3AEFA 2W3SA 3NYFA 4IA6A 4H7UA 3PWIA 3CPJG 1VRQB 3P9UA 2OVLA 1B5QA 2E5AA 4AT0A 3S61A 5FJTA 2ZBWA 3NIXA 1TE6A 4G74A 2C3DA 4K22A 4TM3A 3AEDA 2QJMA 3AD9B 1BKWA 3UTGA 4M0XA 4J3ZA 2XH2A 3NK2X 4NWZA 4KPRA 3ZDNA 4ADWA 2Q0LA 1ZX9A 3NNEA 4C3XA 3GDNA 3U4FA 4GDEA 4G9KA 4JQ9A 1H7WA 1KSSA 2VQBA 4BV6A 3QFAA 2XH4A 1CF3A 1P43A 4H4RA 4YKFA 3H8AA 2B76A 1RVKA 3ES8A 1PBDA 3V3WA 3DK9A 3L8KA 4BJYA 4HNLA 3RR1A 2XGZA 3VFCA 2PHHA 4H4UA 1EBHA 1E39A 4TLZA 1Y56B 1GERA 1PHHA 4U2LA 3NVVB 1Q9IA 3CPHG 5FJPA 1EL9A 1PBEA 3MQTA 4K1WA 2C76A 2W0HA 3M13A 3IK4A 4BURA 3FPZA 4A65A 1K0JA 1N4UA 4U8JA 4UDPA 3OZ2A 3CXBA 2GH5A 2OZTA 3KD9A 2R4EA 1BWCA 3FJ4A 3C96A 5KOWA 3AD8B 4YWOA 1FFVC 1QO8A 3AM9A 1QLBA 1FL2A 3DG6A 1KN0A 3HPFA 3OPSA 2XLPA 2XYOA 2C75A 4TM1A 3NK0X 4JNAA 1FEAA 2XVIA 4TM0A 1JNRA 3IJIA 3A7AA 4A99A 1EC8A 3ZVIA 2V3AA 3DK8A 1GRHA 2C64A 3VR8A 4C77A 2EQ7A 1ZOYA 3H4KA 1PBCA 3K7QX 2RABA 2XH7A 3AEAA 3D46A 1E6EA 3DJDA 1GXFA 1YKJA 3NKSA 1PJ6A 3AMZA 5GRTA 3MZNA 3GYXA 4GDPA 4K8DA 2ZZBA 3GRSA 3ABVA 2GF3A 3LXDA 1CBOA 4OVIA 2R9ZA 3QPEA 1JU2A 3D47A 2OG9A 1XANA 5ER0A 3T8QA 1JOAA 1IYXA 1OEPA 1OJ9A 4II2A 3SN0A 4IA5A 3H70A 2X8CA 5JCLA 4HNCA 1D7YA 1FO4A 3P4RA 3UOZA 1YQ4A 2V60A 2VVMA 1Z6LA 2RGHA 3P3BA 3Q4DA 1Q1RA 2PPGA 3LB8A 1CJ4A 4A6NB 3VCNA 1NENA 2OO6A 3CGEA 2GL5A 5C2TA 4AP3A 2WPEA 3G5SA 3U9IA 2ZADA 4D03A 3CB3A 1ONEA 1F8RA 2BABA 2FKPA 1ZY8A 5L46A 4EIQA 3HYXA 3DG7A 3CN8A 3JZUA 1EL7A 1YQ3A 2PMQA 4A9WA 1FOHA 3SGLA 5IPYA 2EQ8A 2CHRA 4CBQA 1D4DA 2OZ3A 1JRPA 3VA8A 2NQLA 2BS2A 2BCPA 4E8GA 2QAEA 1REOA 1KCZA 1LTXR 4JDRA 4K2XA 2XVJA 5C3JA 3SZCA 4K2SA 5CQFA 1EC9A 3NZGA 1PXAA 1S7MA 5J60A 1NG3A 1JEHA 1F8SA 3CTYA 1VG9A 1SB3B 5FJOA 1WYGA 2A8XA 3VCCA 2P0IA 3EAOA 4N9XA 1RM6B 1GPEA 2BA9A 2GGIA 3IJLA 2WU2A 2IIDA 3NT6A 3HYWA 1JRXA 2O56A 3D1CA 4BK3A 3CNDA 1R0MA 3K30A 3NN6X 4C74A 2CDUA 5U25A 1S3BA 3UCLA 4APNA 3T0KA 4DSHA 4NEVA 2WPFA 2PP0A 1TDEA 5KWFA 2C73A 4A6GA 1PS9A 3DG3A 2XDOA 2ZZCA 3V3NA 4TVYA 3RP7A 3V5FA 2WEUA 3B3RA 2QJNA 2QVHA 5JCNA 3A7UA 4HN8A 2QQ6A 5BVAA 3A7RA 1X2GA 4CCRA 2OKTA 2FJAA 3UGVA 3EKGA 2X3NA 1SJCA 4DN1A 1ECQA 4XWRA 2OQHA 2X8HA 4WCTA 2GGEA 4H4YA 4A3RA 4OPLA 3M0OA 3TTEA 4GCMA 1K0LA 2WP9A 3IJQA 4U8IA 2GAGB 2GR0A 3K1GA 3VR9A 4HCDA 3II4A 1ZP0A 3ZVHB 2C67A 2WPCA 2BYBA 2GQWA 5BULA 3SJNA 1IUVA 2IVDA 3F8RA 5KMQA 3V3OA 1Q1WA 4E6MA 7ENLA 3AYJA 4P9SA 3R25A 1CC4A 4H2RA 2YLRA 4G6HA 2OAMA 3VQRA 2PTZA 2FYMA 2XH0A 4AP1A 1Y0PA 3P4QA 1NEKA 1KFYA 3SY4A 4EMIA 4BK2A 5KVIA 2PTYA 2XLRA 3I4KA 5IQ4A 3Q6JA 4ZA0A 2PS2A 3L5OA 3DGZA 4HPNA 3RGTA 3BHFA 3IWAA 2BK5A 1N5XA 2GGHA 3HW2A 1CJCA 2XLTA 3DMEA 5G5GB 2XFUA 4NZHA 3CGBA 3SR6B 1SEZA 4Y4NA 2QA1A 4YSZA 4TM4A 1E1MA 3R07C 3PK7A 3SZWA 1UKVG 4Z44A 1PBBA 3NTDA 1TYTA 3UJ2A 3UJEA 1S2YA 1CC2A 3SN1A 2NPXA 2B9WA 5J04A 4NTDA 4J57A 4O5QA 1GRFA 3NN0X 3RNMA 1F6MA 3I6EA 1MO9A 5BUKA 4U8PA 4Z25A 2H88A 2XCGA 4X4JA 2YAUA 5FS6A 3K7TA 3TW9A 4OPDA 3ATRA 5EBKA 1O94A 1PDZA 4TVWA 1DJNA 2EQ9A 3G5RA 2OLNA 1IJHA 4HYRA 1K4QA 2V6OA 2AQJA 3R0KA 3GWDA 4FI4A 3SX6A 1BF3A 3P4SA 1LVLA 4EQWA 3SQPA 4E0VA 3GC2A 1O95A 3IC9A 2WS3A 3B97A 1VQWA 3KLJA 3QTPA 1RYIA 1NHRA 1H7XA 5EU9A 3PWGA 1STZA 1D4CA 1BGNA 4BJZA 2B9YA 5JRBA 2PU1A 5LV9A 2WU5A 2YWLA 2E3TA 4HCLA 2MUCA 1E9IA 2R0GA 3L1RA 1PJ7A 4U8MA 4H2PA 2I5QA 3QLDA 5EB5A 2GB0A 3I6DA 2PCEA 5FS8A 1S3EA 2VVLG 1PDHA 1ELIA 3COXA 1PDYA 5GSNA 5KVHA 1KKRA 1GTEA 4LA1A 4HA6A 2XFPA 1JNZA 4LU6A 1ZKQA 3SZFA 2V5ZA 3CK5A 3URHA 2AL1A 3NLCA 3FMWA 4X2PA 4GGBA 1ONFA 3QSSA 3UTHA 2WHDA 2YLTA 2W54A 1XPYA 2R4JA 1EL5A 5FJUA 3E1TA 1OJAA 4GR1A 1JPDX 1SJAA 1SJDA 1JPMA 1V59A 3JW7A 2OA1A 2YM2A 4B66A 3ZLGA 3PVCA 4Y4MA 1XHCA 2B9XA 5M0ZA 2QJJA 4H4ZA 1TDOA 5CKUA 3QSMA 1VQZA 2BK3A 1H6VA 2XFNA 3D8XA 3IHMA 3LOVA 4XWZA 2BCGG 5KMSA 5IDZA 3C4AA 2GQFA 3AYLA 1FEBA 3KVEA 3AE1A 3NVWB 4J34A 2C72A 3ALJA 2QCUA 3CGDA 2YVJA 4OPIA 4GIRA 3D9XA 4MGGA 3SBFA 3AWIA 1XPQA 3UKFA 3AXBA 1ZOVA 5KOXA 4DNAA 1KNPA 2GRTA 2PTWA 2WBAA 3AE5A 3ALLA 3JSKA 1NHSA 4H4WA 3ITJA 3RP6A 2YR5A 3SQSA 2GEWA 4YXDA 4UDRA 3R0UA 1B37A 1E1LA 1NU5A 3SN4A 2QDEA 2X99A 3GYIA 2O9ZA 2WDQA 1ZMDA 3P1WA 1GTHA 3TQPA 3EANA 1MNSA 1JROA 4B63A 4ECHA 1FHVA 3VC5A 3ALMA 3QN3A 1RP0A 4JN8A 4DGKA 3AN1A 4EM3A 4YTMA 1X31B 1LQUA 3GDPA 3H12A 3FIMB 1IUSA 4ICYA 4KEMA 2GSHA 3ZLFA 4J33A 2J3NA 2WOVA 2A87A 3P0WA 4GAPA 4FK1A 4Z2UA 3UKAA 3MSYA 3EPTA 2BS4A 1JDFA 2RDXA 4B69A 1LPFA 3JVAA 1N1PA 2GGGA 2VOUA 4E5TA 4MMWA 2ZZ0A 1K0IA 2AKMA 2HZGA 3N4FA 1N63C 2YLWA 1EBGA 1DNCA 1MUCA 3NFUA 1IUTA 1W6TA 2YLXA 1LJ1A 4G73A 3DERA 3SFEA 3AE9A 2W55A 3OZMA 3T37A 4I59A 2WP6A 4DSGA 4CNJA 1WUFA 3OP2A 3UTFA 4KPLA 2JB2A 3F8PA 3NVZB 2GMJA 3T2KA 4USQA 3NXLA 4AT2A 3V76A 3VRBA 1P48A 1MRAA 3ATQA 3V5CA 4EWJA 2UZZA 2C7GA 2OFJA 3T31A 1H2IA 2RGOA 2X50A 4EM4A 1DOEA 2F5ZA 3DDMA 3R9UA 2WP5A 5HXIA 4H2NA 2EQ6A 1N4VA 2BACA 1TDNA 3K7MX 2A89A 3THUA 4F4RA 1TKKA 2Y6QA 1RSGA 3ICSA 3AEBA 2XFOA 3ZLHA 4RG4A 3GMCA 3SM8A 2DKHA 1IUXA 5EOWA 4A5LA 1ZDLA 3RP8A 5FS7A 5KXJA 1CJ2A 3NTAA 3BSMA 1GREA 3DIPA 2PSNA 3GWFA 4H4TA 3MWCA 2C66A 3CYJA 4Z26A 3QJ4A 3CIRA 5JCMA 3OTRA 1DJQA 1IUUA 1S2QA 1GSNA 2WOWA 4K5RA 4ENLA 2CFYA 2QA2A 2I0ZA 3HRDC 3LZWA 4Z2TA 5HYMA 4GF7A 2R46A 3NRZB 1L9EA 2HNEA 4H19A 3LJPA 4U8LA 3RCYA 1L8PA 4CY8A 2PYXA 3RHAA 2PU0A 3ES7A 5BOFA 1GT8A 2X8GA 4Z2RA 3UKQA 4O5UA 2NVKX 4U8NA 2YR4A 1PJ5A 3B6DA 3PO7A 1DOBA 1W4XA 4JN7A 1EC7A 4A79A 5FMHA 3Q9TA 3S5WA 3DGBA 2P8BA 2R0PA 2HQMA 1D7LA 3GD4A 3UJRA 4H4QA 4UDQA 4OPCA 1FFUC 2OLOA 2BRYA 5FS9A 4CY6A 4DX3A 4OCGA 4JY3A 4Y4LA 2JB3A 1VG0A 4GGHA 1DXLA 4YT0A 3GY1A 2Q0KA 1ZXIC 1MDLA 3DGHA 4M6UA 2GR2A 3BNMA 2PGWA 5KRQA 3UOYA 2GDQA 4YWSA 4G6GA 3BI2A 2YVGA 3DK4A 1EL8A 4FP1A 4H83A 4B65A 3I3LA 3KU9A 2XVEA 4C5OA 2GGJA 3T2ZA 3UP4A 4A7AA 4J56A 3VC6A 1H82A 2P8CA 3M12A 3T2YA 1OJDA 2RGJA 2YG4A 2PODA 4EIPA 2VZ2A 1GV4A 1E1KA 3IHGA
chains in the Genus database with same CATH topology
3CN8A 3QFBA 4BK1A 3PVCA 4Y4MA 1FECA 1XHCA 4EQXA 1EL7A 2B9XA 4JN9A 4U2SA 3DJJA 1YQ3A 2BXSA 1OJCA 3ISHA 5M0ZA 2YM1A 2GV8A 3KKJA 4A9WA 4CNKA 1FOHA 4ZN0A 1PXBA 5KMPA 3SGLA 3AE8A 2JK6A 2V3BA 3F8DA 5IPYA 4H4ZA 4Z24A 2BXRA 1TDOA 1GETA 2EQ8A 1IUWA 3GMBA 4J31A 1TDKA 2R0CA 1GRTA 4U2TA 5CKUA 1NPXA 3QSMA 4CBQA 1D4DA 2Y6RA 3NRNA 1LQTA 3ADAB 2TPRA 2BK3A 1H6VA 3CNTA 2BS2A 2BCPA 1D4EA 2WQYA 2XFNA 1GESA 2QAEA 3SZ0A 2YQUA 1REOA 1LTXR 3D8XA 4JDRA 3BHKA 3IHMA 3LOVA 4K5SA 4XWZA 2FJEA 4K2XA 2BCGG 1CL0A 2XVJA 5C3JA 5KMSA 1B8SA 3QVPA 3C4AA 3SZCA 2AAQA 4BK2A 2GQFA 2GMHA 3AYLA 4H2QA 5CQFA 1PXAA 1FEBA 3KVEA 3AE1A 3FBSA 1F3PA 4J34A 1S7MA 5J60A 1NG3A 2C72A 4PAAA 2WETA 3ALJA 2QCUA 3CGDA 4C3YA 4CRTA 1EBDA 2WDRA 2YVJA 1JEHA 2GR3A 1XDIA 3NK1X 1F8SA 4AOXA 4OPIA 3CNJA 3CTYA 3UKKA 2C3CA 3D9XA 1MXTA 1VG9A 3AEEA 3REDA 4H4XA 4II3A 1PBFA 1O5WA 3AWIA 2A8XA 2BC1A 3EAOA 2JAEA 4N9XA 4B1BA 1M6IA 4H4VA 1XPQA 1GPEA 3UKFA 2BA9A 3AXBA 3P4PA 1ZOVA 5KOXA 4DNAA 1KNPA 1TDFA 2GRTA 4UP3A 2C65A 4EMWA 4FK1C 2WU2A 2WBAA 2IIDA 3AE5A 1E1NA 3ALLA 3JSKA 3NH3X 3NT6A 1NHSA 4H4WA 4X9MA 4H50A 3HYWA 3ITJA 2YVFA 3RP6A 1YY5A 3ICTA 1JRXA 2YR5A 1HYUA 4D04A 2GEWA 1P2EA 3D1CA 4BK3A 3CNDA 4YXDA 4UDRA 4B66A 1JRYA 3IF9A 3K30A 3NN6X 1B37A 1E1LA 2BS3A 4C74A 2C70A 2CDUA 1JRZA 2ACZA 1M64A 5EB4A 5U25A 3GSIA 2X99A 1H84A 3GYIA 2O9ZA 4YSHA 1S3BA 2WDQA 3UCLA 1ZMDA 4YTPA 3CNSA 3P1WA 4APNA 3DA1A 4OPGA 1GTHA 4ZCDA 3EANA 3T0KA 3HYVA 3UKPA 4DSHA 3ICRA 4NEVA 2JBVA 3AE3A 3GYJA 4B63A 1COYA 2WPFA 4ECHA 1LV0A 1TDEA 2YG7A 2E1MA 5HY5A 3ALMA 3H8IA 1FCDA 2CULA 1RP0A 5KWFA 3AE2A 2C73A 2CVJA 3QSEA 4DGKA 1NAAA 3DJEA 2AR8A 4EM3A 4YTMA 1X31B 1PS9A 1LQUA 3GDPA 2XDOA 4RSLA 5U63A 2ZZCA 3FIMB 3V3NA 3C4NA 1IUSA 2B7SA 4WX1A 3OC4A 4EMJA 3NYEA 3KPKA 4ICYA 3RP7A 2Z5XA 2JKCA 1NG4A 2WEUA 4J33A 2WDVA 5IQ1A 1H83A 3SXIA 3B3RA 2J3NA 3T14A 3ZYXA 5JCKA 2Q6UA 5JCNA 1P2HA 4YSYA 2WOVA 3UKLA 5BVAA 2A87A 3DH9A 2XVHA 5U1OA 1CJ3A 1KDGA 1CC6A 3NGCX 4FK1A 1VDCA 4GAPA 3BI5A 3PS9A 4NTCA 3SYIA 3UTEA 2FJAA 3G5QA 1D5TA 4Z2UA 4HB9A 2VRMA 2X3NA 3UKAA 2OALA 3EPTA 4XWRA 2X8HA 1KF6A 2BS4A 2YR6A 1KNRA 4WCTA 2BC0A 4B69A 1LPFA 4H4YA 1PXCA 3AEGA 1N1PA 2VVLA 3M0OA 2VOUA 4OPLA 4GCMA 1K0LA 3BI4A 2ZZ0A 2YLSA 1K0IA 2WP9A 4IVOB 4U8IA 2WOIA 3AE4A 1NDAA 2YLWA 2GAGB 2GR0A 4NNJA 3VR9A 1DNCA 3CGCA 1BZLA 3II4A 2APGA 4FDCB 1IUTA 2YLXA 4XXGA 1LJ1A 1ZP0A 1PN0A 4G73A 4EQRA 3SFEA 3AE9A 2C67A 2E5VA 2FBWA 4NEWA 3NG7X 4RG3A 3T37A 4I59A 2WP6A 1ZMCA 3PG6A 4OPTA 2WPCA 3AEFA 4OPUA 3VRAA 2BYBA 3NYFA 4IA6A 4CNJA 4H7UA 2GQWA 5BULA 1MOKA 3UTFA 3CPJG 2JB2A 3F8PA 3UKHA 1IUVA 1VRQB 2GMJA 3P9UA 2IVDA 2IVEA 3F8RA 3FG2P 3T2KA 5DBJA 4USQA 5KMQA 1B5QA 4AT0A 3S61A 4AT2A 2GR1A 3V76A 3V3OA 1Q1WA 2ZBWA 3VRBA 3NIXA 4G74A 2C3DA 1YQZA 1Y56A 3AYJA 4P9SA 3ATQA 4K22A 1KSUA 4YSXA 4CCQA 2UZZA 4TM3A 2C7GA 1CC4A 3AEDA 4H2RA 5BRTA 2YLRA 1BKWA 3AD9B 1H2IA 2RGOA 2X50A 4G6HA 3T31A 5TR3A 1OJTA 4EM4A 2FJDA 2OAMA 3UTGA 1TRBA 3VQRA 1DOEA 2YG5A 4CCRA 2F5ZA 4Z43A 3AE7A 1L9DA 3R9UA 2WP5A 3NK2X 1Y0PA 4AP1A 3P4QA 1DODA 1NEKA 1KFYA 4NWZA 5HXIA 4KPRA 3SY4A 4EMIA 2Q7VA 2EQ6A 4H2NA 3SFDA 3ZDNA 4B67A 1N4VA 4ADWA 2BACA 2DKIA 5KVIA 1TDNA 2Q0LA 2A89A 1F8WA 1ZX9A 2XLRA 3K7MX 3NNEA 4C3XA 5IQ4A 3DJGX 5KMRA 3GDNA 3LADA 3Q6JA 2WESA 2Y6QA 1RSGA 4GDEA 3L5OA 3DGZA 3ICSA 3AEBA 2XFOA 3BHFA 4REKA 3KA7A 4G9KA 4RG4A 3IWAA 1GRGA 3GMCA 3SM8A 2BK5A 4JQ9A 1CJCA 2DKHA 3H8LA 1IUXA 1H7WA 1KSSA 5EOWA 1TYPA 2XLTA 3DMEA 2XFUA 4J36A 4NZHA 2VQBA 4BV6A 1ZDLA 4A5LA 3CPIG 3CGBA 1GRBA 3QFAA 1SEZA 4Y4NA 1CF3A 3RP8A 2QA1A 4GUVA 3AD7B 4YSZA 5FS7A 5KXJA 4H4RA 4YKFA 4TM4A 1E1MA 1CJ2A 2YG3A 1B4VA 3NTAA 1GREA 4USRA 3SZWA 2B76A 1UKVG 3GWFA 4LIIA 1PBDA 4Z44A 1GRAA 3DK9A 1PBBA 3L8KA 4H4TA 2C66A 4BJYA 3GRTA 3NTDA 4Z26A 1CHUA 3QJ4A 2PHHA 4H4UA 1TYTA 1DOCA 3CIRA 5JCMA 4M52A 1E39A 4TLZA 4DSGA 1DJQA 1S2YA 1IUUA 1Y56B 1S2QA 1GSNA 2WOWA 1GERA 1CC2A 1PHHA 4U2LA 5HHFA 2NPXA 2B9WA 1Q9IA 3CPHG 4AOSA 3AECA 4K5RA 3EF6A 1EL9A 4NTDA 1PBEA 2CFYA 2QA2A 2I0ZA 2C76A 4J57A 1AOGA 3LZWA 2W0HA 4O5QA 4Z2TA 3M13A 4BURA 4K7ZA 5HYMA 1GRFA 3FPZA 2E4GA 3NN0X 4GF7A 3UOXA 4A65A 2B7RA 3RNMA 1K0JA 1F6MA 2R46A 1L9EA 1N4UA 2XLUA 3LJPA 1MO9A 4U8LA 3QVRA 2H89A 5BUKA 2XFQA 3KPFA 4CY8A 1GOSA 1L9CA 2PYXA 1L0VA 4U8PA 4KX6A 4U8JA 4Z25A 2H88A 4UDPA 3RHAA 3OZ2A 3AYIA 1ZK7A 2GH5A 2XCGA 4X4JA 4EQSA 3KD9A 1GT8A 4PABA 2R4EA 2X8GA 1BWCA 4U8OA 3UKQA 2YLZA 4O5UA 4TLXA 3C96A 2YAUA 4Z2RA 5KOWA 3AD8B 3VRDB 2NVKX 5FS6A 4YWOA 3K7TA 4OPDA 4U8NA 2YR4A 1PJ5A 3ATRA 3B6DA 3PO7A 1QO8A 1DOBA 5EBKA 1O94A 1W4XA 2VRLA 1QLBA 1FL2A 1KN0A 4I58A 2XLPA 4H4SA 2FJBA 2XYOA 1DJNA 2C75A 4TM1A 3NK0X 2EQ9A 4A79A 3G5RA 5FMHA 2OLNA 3Q9TA 4ZCCA 1IJHA 3S5WA 4JNAA 1FEAA 5KNLA 1K4QA 3CNPA 2XVIA 2YG6A 2V6OA 4TM0A 4B68A 1GNDA 1JNRA 4JY2A 2AQJA 4A99A 3GWDA 4IVMB 3SX6A 2XLSA 1BF3A 2R0PA 1LVLA 2V3AA 3P4SA 2HQMA 3DK8A 4EQWA 1GRHA 3SQPA 1D7LA 2C64A 3GD4A 1O95A 3VR8A 4E0VA 4C77A 3IC9A 2WS3A 2EQ7A 4IV9A 4H4QA 4A6NA 4UDQA 4JNQA 1ZOYA 1N4WA 3BNUA 4H4PA 2VQ7A 3H4KA 1PBCA 4OPCA 1VQWA 4J2WA 4X9NA 3KLJA 2R45A 3K7QX 2RABA 1NHQA 3AEAA 1GALA 1E6EA 1RYIA 2OLOA 2BRYA 1NHRA 3NHOX 1H7XA 3O0HA 1D4CA 5FS9A 3DJDA 1GXFA 4GRTA 1BGNA 3WE0A 1YKJA 2C4CA 4MJWA 4CY6A 1H86A 4BJZA 3GD3A 5JRBA 1PJ6A 2B9YA 3NKSA 4OCGA 5GRTA 5J7XA 5LV9A 5M10A 3GYXA 2WU5A 2YWLA 4GDPA 4NTEA 4JY3A 2BK4A 2R0GA 4Y4LA 4K8DA 1H81A 2GAHB 1QJDA 2JB3A 3L1RA 4YKGA 1PJ7A 2ZZBA 4U8KA 1VG0A 4U8MA 4H2PA 3GRSA 3ABVA 2GF3A 3LXDA 1CBOA 2GB0A 4OVIA 2R9ZA 5EB5A 3I6DA 1DXLA 4YT0A 5FS8A 1JU2A 1S3EA 1XANA 2XVFA 2Q0KA 5ER0A 1JOAA 2VVLG 1PDHA 1ELIA 3CMMA 3UOVA 3DGHA 2GR2A 3BNMA 5KRQA 1OJ9A 3COXA 4II2A 5GSNA 3UOYA 5KVHA 2TMDA 4IA5A 1GTEA 4G6GA 4LA1A 3BI2A 2X8CA 1GEUA 5JCLA 2XFPA 4HA6A 2Z5YA 3UP5A 1D7YA 2YVGA 3DK4A 4FX9A 1EL8A 1JNZA 4LU6A 3P4RA 3UOZA 4B64A 1ZKQA 3SZFA 1YQ4A 1BGJA 2V5ZA 4B65A 2V60A 3URHA 2VVMA 1Z6LA 1NHPA 3AE6A 3I3LA 3KU9A 5JCIA 3FMWA 2XVEA 3NLCA 4C5OA 2RGHA 3T2ZA 1ONFA 2GVCA 1Q1RA 3UP4A 3LB8A 1CJ4A 4A7AA 2BRAA 3QSSA 3UTHA 2WHDA 2YLTA 3AB1A 4A6NB 4J56A 1NENA 3CGEA 2R4JA 1H82A 1EL5A 4AP3A 5C2TA 2V61A 3E1TA 2WPEA 3G5SA 2JB1A 2ARDA 1E7PA 3M12A 3T2YA 1OJDA 1OJAA 2RGJA 4D03A 2YG4A 4GR1A 1F8RA 2BABA 3LZXA 4EIPA 3HZLA 4YTNA 1ZY8A 1V59A 5L46A 4GAVA 2VZ2A 4EIQA 2OA1A 3HYXA 3NYCA 2YM2A 1GV4A 1E1KA 3IHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CN8 A;  3QFB A;  4BK1 A;  3PVC A;  4Y4M A;  1FEC A;  1XHC A;  4EQX A;  1EL7 A;  2B9X A;  4JN9 A;  4U2S A;  3DJJ A;  1YQ3 A;  2BXS A;  1OJC A;  3ISH A;  5M0Z A;  2YM1 A;  2GV8 A;  3KKJ A;  4A9W A;  4CNK A;  1FOH A;  4ZN0 A;  1PXB A;  3SGL A;  3AE8 A;  2JK6 A;  2V3B A;  3F8D A;  5IPY A;  4H4Z A;  4Z24 A;  2BXR A;  1TDO A;  1GET A;  2EQ8 A;  1IUW A;  3GMB A;  4J31 A;  1TDK A;  2R0C A;  1GRT A;  4U2T A;  5CKU A;  1NPX A;  3QSM A;  4CBQ A;  1D4D A;  2Y6R A;  3NRN A;  1LQT A;  3ADA B;  2TPR A;  2BK3 A;  1H6V A;  3CNT A;  2BS2 A;  2BCP A;  1D4E A;  2WQY A;  2XFN A;  1GES A;  2QAE A;  2YQU A;  1REO A;  1LTX R;  3D8X A;  4JDR A;  3BHK A;  3IHM A;  3LOV A;  4K5S A;  4XWZ A;  2FJE A;  4K2X A;  2BCG G;  1CL0 A;  2XVJ A;  5C3J A;  1B8S A;  3QVP A;  3C4A A;  4BK2 A;  2AAQ A;  2GQF A;  2GMH A;  3AYL A;  4H2Q A;  5CQF A;  1PXA A;  1FEB A;  3KVE A;  3AE1 A;  3FBS A;  1F3P A;  4J34 A;  5J60 A;  1NG3 A;  2C72 A;  4PAA A;  2WET A;  3ALJ A;  2QCU A;  3CGD A;  4C3Y A;  4CRT A;  1EBD A;  2WDR A;  2YVJ A;  1JEH A;  2GR3 A;  1XDI A;  3NK1 X;  1F8S A;  4AOX A;  4OPI A;  3CNJ A;  3CTY A;  3UKK A;  2C3C A;  1MXT A;  1VG9 A;  3AEE A;  3RED A;  4H4X A;  1PBF A;  1O5W A;  3AWI A;  2A8X A;  2BC1 A;  3EAO A;  2JAE A;  4N9X A;  4B1B A;  1M6I A;  4H4V A;  1XPQ A;  1GPE A;  3UKF A;  2BA9 A;  3AXB A;  3P4P A;  1ZOV A;  5KOX A;  4DNA A;  1KNP A;  1TDF A;  2GRT A;  4UP3 A;  2C65 A;  4EMW A;  4FK1 C;  2WU2 A;  2WBA A;  2IID A;  3AE5 A;  1E1N A;  3ALL A;  3JSK A;  3NH3 X;  3NT6 A;  1NHS A;  4H4W A;  4X9M A;  4H50 A;  3ITJ A;  2YVF A;  3RP6 A;  1YY5 A;  3ICT A;  1JRX A;  2YR5 A;  1HYU A;  4D04 A;  2GEW A;  1P2E A;  3D1C A;  4BK3 A;  3CND A;  4YXD A;  4UDR A;  4B66 A;  1JRY A;  3IF9 A;  3K30 A;  3NN6 X;  1B37 A;  1E1L A;  2BS3 A;  4C74 A;  2C70 A;  2CDU A;  1JRZ A;  2ACZ A;  1M64 A;  5EB4 A;  5U25 A;  3GSI A;  2X99 A;  1H84 A;  3GYI A;  2O9Z A;  4YSH A;  1S3B A;  2WDQ A;  3UCL A;  1ZMD A;  4YTP A;  3CNS A;  3P1W A;  4APN A;  3DA1 A;  4OPG A;  1GTH A;  4ZCD A;  3EAN A;  3UKP A;  4DSH A;  3ICR A;  4NEV A;  2JBV A;  3AE3 A;  3GYJ A;  4B63 A;  1COY A;  2WPF A;  4ECH A;  1LV0 A;  1TDE A;  2YG7 A;  2E1M A;  5HY5 A;  3ALM A;  3H8I A;  1FCD A;  2CUL A;  1RP0 A;  5KWF A;  3AE2 A;  2C73 A;  2CVJ A;  3QSE A;  4DGK A;  1NAA A;  3DJE A;  2AR8 A;  4EM3 A;  4YTM A;  1X31 B;  1PS9 A;  1LQU A;  3GDP A;  2XDO A;  4RSL A;  5U63 A;  2ZZC A;  3FIM B;  3V3N A;  3C4N A;  1IUS A;  2B7S A;  4WX1 A;  3OC4 A;  4EMJ A;  3NYE A;  4ICY A;  3RP7 A;  2Z5X A;  2JKC A;  1NG4 A;  2WEU A;  4J33 A;  2WDV A;  5IQ1 A;  1H83 A;  3ZYX A;  3B3R A;  2J3N A;  5JCK A;  2Q6U A;  5JCN A;  1P2H A;  4YSY A;  2WOV A;  3UKL A;  5BVA A;  2A87 A;  3DH9 A;  2XVH A;  5U1O A;  1CJ3 A;  1KDG A;  1CC6 A;  3NGC X;  4FK1 A;  1VDC A;  4NTC A;  3BI5 A;  3PS9 A;  3UTE A;  4CCR A;  2FJA A;  3G5Q A;  1D5T A;  4Z2U A;  4HB9 A;  2VRM A;  2X3N A;  3UKA A;  2OAL A;  3EPT A;  4XWR A;  2X8H A;  1KF6 A;  2BS4 A;  2YR6 A;  1KNR A;  4WCT A;  2BC0 A;  4B69 A;  1LPF A;  4H4Y A;  1PXC A;  3AEG A;  1N1P A;  2VVL A;  3M0O A;  2VOU A;  4OPL A;  4GCM A;  1K0L A;  3BI4 A;  2ZZ0 A;  2YLS A;  1K0I A;  2WP9 A;  4IVO B;  4U8I A;  2WOI A;  3AE4 A;  1NDA A;  2YLW A;  2GAG B;  2GR0 A;  3VR9 A;  1DNC A;  3CGC A;  1BZL A;  3II4 A;  2APG A;  4FDC B;  1IUT A;  2YLX A;  4XXG A;  1LJ1 A;  1ZP0 A;  1PN0 A;  4EQR A;  3SFE A;  3AE9 A;  2C67 A;  2E5V A;  2FBW A;  4NEW A;  3NG7 X;  4RG3 A;  3T37 A;  4I59 A;  2WP6 A;  1ZMC A;  4OPT A;  4OPU A;  2WPC A;  3AEF A;  3VRA A;  4CNJ A;  2BYB A;  3NYF A;  4IA6 A;  4H7U A;  2GQW A;  5BUL A;  1MOK A;  3UTF A;  3CPJ G;  2JB2 A;  3F8P A;  3UKH A;  1IUV A;  1VRQ B;  2GMJ A;  3P9U A;  2IVD A;  2IVE A;  3F8R A;  3FG2 P;  5DBJ A;  4USQ A;  1B5Q A;  4AT0 A;  3S61 A;  4AT2 A;  2GR1 A;  3V76 A;  3V3O A;  1Q1W A;  2ZBW A;  3VRB A;  3NIX A;  2C3D A;  1YQZ A;  1Y56 A;  3AYJ A;  4P9S A;  3ATQ A;  4K22 A;  1KSU A;  4YSX A;  4CCQ A;  2UZZ A;  4TM3 A;  2C7G A;  1CC4 A;  3AED A;  4H2R A;  5BRT A;  2YLR A;  1BKW A;  3AD9 B;  2RGO A;  2X50 A;  3UTG A;  5TR3 A;  1OJT A;  4EM4 A;  2FJD A;  2OAM A;  1TRB A;  3VQR A;  1DOE A;  2YG5 A;  2F5Z A;  4Z43 A;  3AE7 A;  1L9D A;  3R9U A;  2WP5 A;  3NK2 X;  1Y0P A;  4AP1 A;  3P4Q A;  1DOD A;  1NEK A;  1KFY A;  5HXI A;  4KPR A;  4EMI A;  2Q7V A;  2EQ6 A;  4H2N A;  3SFD A;  3ZDN A;  4B67 A;  1N4V A;  4ADW A;  2BAC A;  2DKI A;  5KVI A;  1TDN A;  2Q0L A;  2A89 A;  1F8W A;  1ZX9 A;  2XLR A;  3K7M X;  3NNE A;  4C3X A;  5IQ4 A;  3DJG X;  3GDN A;  3LAD A;  3Q6J A;  2WES A;  2Y6Q A;  1RSG A;  4GDE A;  3DGZ A;  3ICS A;  3AEB A;  2XFO A;  3BHF A;  4REK A;  3KA7 A;  4RG4 A;  3IWA A;  1GRG A;  3GMC A;  3SM8 A;  2BK5 A;  4JQ9 A;  1CJC A;  2DKH A;  3H8L A;  1IUX A;  1H7W A;  1KSS A;  5EOW A;  1TYP A;  2XLT A;  3DME A;  2XFU A;  4J36 A;  4NZH A;  2VQB A;  4BV6 A;  1ZDL A;  4A5L A;  3CPI G;  3CGB A;  1GRB A;  3QFA A;  1SEZ A;  4Y4N A;  1CF3 A;  3RP8 A;  2QA1 A;  4GUV A;  3AD7 B;  4YSZ A;  5FS7 A;  5KXJ A;  4H4R A;  4YKF A;  4TM4 A;  1E1M A;  1CJ2 A;  2YG3 A;  1B4V A;  3NTA A;  1GRE A;  4USR A;  2B76 A;  1UKV G;  3GWF A;  4LII A;  1PBD A;  4Z44 A;  1GRA A;  3DK9 A;  1PBB A;  3L8K A;  4H4T A;  2C66 A;  4BJY A;  3GRT A;  3NTD A;  4Z26 A;  1CHU A;  3QJ4 A;  2PHH A;  4H4U A;  1TYT A;  1DOC A;  3CIR A;  5JCM A;  4M52 A;  1E39 A;  4TLZ A;  4DSG A;  1DJQ A;  1S2Y A;  1IUU A;  1Y56 B;  1S2Q A;  1GSN A;  2WOW A;  1GER A;  1CC2 A;  1PHH A;  4U2L A;  5HHF A;  2NPX A;  2B9W A;  1Q9I A;  3CPH G;  4AOS A;  3AEC A;  4K5R A;  3EF6 A;  1EL9 A;  4NTD A;  1PBE A;  2CFY A;  2QA2 A;  2I0Z A;  2C76 A;  4J57 A;  1AOG A;  3LZW A;  2W0H A;  4O5Q A;  4Z2T A;  3M13 A;  4BUR A;  4K7Z A;  5HYM A;  1GRF A;  3FPZ A;  2E4G A;  3NN0 X;  4GF7 A;  3UOX A;  4A65 A;  2B7R A;  3RNM A;  1K0J A;  1F6M A;  2R46 A;  1L9E A;  1N4U A;  2XLU A;  3LJP A;  1MO9 A;  4U8L A;  3QVR A;  2H89 A;  5BUK A;  2XFQ A;  3KPF A;  4CY8 A;  1GOS A;  1L9C A;  2PYX A;  1L0V A;  4U8P A;  4KX6 A;  4U8J A;  4Z25 A;  2H88 A;  4UDP A;  3RHA A;  3OZ2 A;  3AYI A;  1ZK7 A;  2GH5 A;  2XCG A;  4X4J A;  4EQS A;  3KD9 A;  1GT8 A;  4PAB A;  2R4E A;  2X8G A;  1BWC A;  4U8O A;  3UKQ A;  2YLZ A;  4O5U A;  4TLX A;  3C96 A;  2YAU A;  4Z2R A;  5KOW A;  3AD8 B;  3VRD B;  2NVK X;  5FS6 A;  4YWO A;  3K7T A;  4OPD A;  4U8N A;  2YR4 A;  1PJ5 A;  3ATR A;  3B6D A;  3PO7 A;  1QO8 A;  1DOB A;  5EBK A;  1O94 A;  1W4X A;  2VRL A;  1QLB A;  1FL2 A;  4I58 A;  2XLP A;  4H4S A;  2FJB A;  2XYO A;  1DJN A;  2C75 A;  4TM1 A;  3NK0 X;  2EQ9 A;  4A79 A;  3G5R A;  5FMH A;  2OLN A;  3Q9T A;  4ZCC A;  1IJH A;  3S5W A;  4JNA A;  1FEA A;  1K4Q A;  3CNP A;  2XVI A;  2YG6 A;  2V6O A;  4TM0 A;  4B68 A;  1GND A;  1JNR A;  4JY2 A;  2AQJ A;  4A99 A;  3GWD A;  4IVM B;  2XLS A;  1BF3 A;  2R0P A;  1LVL A;  2V3A A;  3P4S A;  2HQM A;  3DK8 A;  4EQW A;  1GRH A;  3SQP A;  1D7L A;  2C64 A;  3GD4 A;  1O95 A;  3VR8 A;  4E0V A;  4C77 A;  3IC9 A;  2WS3 A;  2EQ7 A;  4IV9 A;  4H4Q A;  4A6N A;  4UDQ A;  4JNQ A;  1ZOY A;  1N4W A;  3BNU A;  4H4P A;  2VQ7 A;  3H4K A;  1PBC A;  4OPC A;  1VQW A;  4J2W A;  4X9N A;  3KLJ A;  2R45 A;  3K7Q X;  2RAB A;  1NHQ A;  3AEA A;  1GAL A;  1E6E A;  1RYI A;  2OLO A;  1NHR A;  3NHO X;  1H7X A;  3O0H A;  1D4C A;  5FS9 A;  3DJD A;  1GXF A;  4GRT A;  1BGN A;  1YKJ A;  4MJW A;  4CY6 A;  1H86 A;  4BJZ A;  3GD3 A;  2B9Y A;  1PJ6 A;  3NKS A;  4OCG A;  5GRT A;  5J7X A;  5LV9 A;  5M10 A;  2WU5 A;  2YWL A;  4GDP A;  4NTE A;  4JY3 A;  2BK4 A;  2R0G A;  4Y4L A;  4K8D A;  1H81 A;  2GAH B;  1QJD A;  2JB3 A;  3L1R A;  4YKG A;  1PJ7 A;  2ZZB A;  4U8K A;  1VG0 A;  4U8M A;  4H2P A;  3GRS A;  3ABV A;  2GF3 A;  3LXD A;  1CBO A;  2GB0 A;  4OVI A;  2R9Z A;  5EB5 A;  3I6D A;  1DXL A;  4YT0 A;  5FS8 A;  1JU2 A;  1S3E A;  1XAN A;  2XVF A;  2Q0K A;  5ER0 A;  1JOA A;  2VVL G;  1PDH A;  1ELI A;  3UOV A;  3DGH A;  2GR2 A;  3BNM A;  5KRQ A;  1OJ9 A;  3COX A;  3UOY A;  5GSN A;  5KVH A;  2TMD A;  4IA5 A;  1GTE A;  3WE0 A;  4LA1 A;  3BI2 A;  2X8C A;  1GEU A;  5JCL A;  2XFP A;  4HA6 A;  2Z5Y A;  3UP5 A;  1D7Y A;  2YVG A;  3DK4 A;  4FX9 A;  1EL8 A;  1JNZ A;  4LU6 A;  3P4R A;  3UOZ A;  4B64 A;  1ZKQ A;  1YQ4 A;  1BGJ A;  2V5Z A;  4B65 A;  2V60 A;  3URH A;  2VVM A;  1Z6L A;  1NHP A;  3AE6 A;  3I3L A;  3KU9 A;  5JCI A;  3FMW A;  2XVE A;  3NLC A;  4C5O A;  2RGH A;  1ONF A;  2GVC A;  1Q1R A;  3UP4 A;  3LB8 A;  1CJ4 A;  4A7A A;  3QSS A;  3UTH A;  2WHD A;  2YLT A;  3AB1 A;  4A6N B;  4J56 A;  1NEN A;  3CGE A;  2R4J A;  1H82 A;  1EL5 A;  4AP3 A;  5C2T A;  2V61 A;  3E1T A;  2WPE A;  3G5S A;  2JB1 A;  2ARD A;  1E7P A;  3M12 A;  1OJD A;  1OJA A;  2RGJ A;  4D03 A;  2YG4 A;  4GR1 A;  1F8R A;  2BAB A;  3LZX A;  4EIP A;  3HZL A;  4YTN A;  1ZY8 A;  1V59 A;  5L46 A;  2VZ2 A;  4EIQ A;  2OA1 A;  3NYC A;  2YM2 A;  1GV4 A;  1E1K A;  3IHG A; 
#chains in the Genus database with same CATH topology
 3QFB A;  4BK1 A;  1TZZ A;  1YEY A;  3S47 A;  4JN9 A;  4U2S A;  3DJJ A;  3ISH A;  2YM1 A;  2AL2 A;  2GV8 A;  4CNK A;  3CAW A;  1PXB A;  3AE8 A;  2JK6 A;  2V3B A;  3F8D A;  2BXR A;  1GET A;  3UCD A;  1IUW A;  3GMB A;  4J31 A;  1TDK A;  4U2T A;  1GRT A;  4ZOH B;  2Y6R A;  3NRN A;  1LQT A;  3UJF A;  3N6H A;  4ROP A;  3N6J A;  3CNT A;  3UJS A;  1D4E A;  2WQY A;  1GES A;  3BHK A;  2FJE A;  3ENL A;  2P88 A;  1B8S A;  2AAQ A;  2GMH A;  1DTN A;  3CXO A;  3SSZ A;  3FBS A;  1F3P A;  2WET A;  4IHC A;  4CRT A;  2OPJ A;  5G5H B;  2GR3 A;  4AOX A;  3CNJ A;  3RED A;  4H4X A;  1PBF A;  3GO2 A;  2BC1 A;  2HXU A;  2JAE A;  4H4V A;  3P4P A;  4UP3 A;  3MY9 A;  2AKZ A;  4EMW A;  4FK1 C;  4X9M A;  2YVF A;  1YY5 A;  1HYU A;  4D04 A;  3B9J B;  1P2E A;  1JRY A;  3DEQ A;  4DXK A;  2BS3 A;  2C70 A;  5EB4 A;  1H84 A;  4E4U A;  4YTP A;  3CNS A;  4E4F A;  3DA1 A;  3TWB A;  1WUE A;  4IP5 A;  2JBV A;  1COY A;  3RRA A;  3H8I A;  2CUL A;  2CVJ A;  3QSE A;  3KUM A;  3N4E A;  4MKS A;  1X2H A;  3DJE A;  1F9C A;  4RSL A;  5U63 A;  3MUC A;  5BOE A;  3C4N A;  4EMJ A;  2JKC A;  1NG4 A;  2WDV A;  3SXI A;  5JCK A;  4ZCW A;  3DH9 A;  2XVH A;  5U1O A;  6ENL A;  1CJ3 A;  1CC6 A;  4NTC A;  1VDC A;  3BI5 A;  3UTE A;  3SYI A;  3T4W A;  1NEL A;  4HB9 A;  2OAL A;  3RO6 A;  1KNR A;  2BC0 A;  1N62 C;  2PGE A;  2VVL A;  2YLS A;  4G8T A;  3AE4 A;  1NDA A;  3CGC A;  1BZL A;  2APG A;  4FDC B;  3V4B A;  4XXG A;  2HXT A;  4IL0 A;  2E5V A;  3FVD A;  4RG3 A;  4NEW A;  4G7F A;  4OPT A;  1ZMC A;  4OPU A;  3RIT A;  1MOK A;  2PTX A;  4IL2 A;  1KKO A;  3UKH A;  2IVE A;  1BKH A;  3FG2 P;  5DBJ A;  4HCH A;  2GR1 A;  1BQG A;  1YQZ A;  1Y56 A;  1KSU A;  4YSX A;  4CCQ A;  5BRT A;  5TR3 A;  1OJT A;  3VDG A;  2FJD A;  1TRB A;  3R1Z A;  2YG5 A;  4Z43 A;  3AE7 A;  1L9D A;  4A35 A;  4GYP C;  3S5S A;  1DOD A;  2ZC8 A;  2Q7V A;  3SFD A;  4B67 A;  2DKI A;  1F8W A;  1JCT A;  3UXK A;  2OZ8 A;  3DJG X;  5KMR A;  3LAD A;  2WES A;  1FHU A;  3DES A;  4REK A;  3KA7 A;  1GRG A;  3H8L A;  3R10 A;  1TYP A;  3EUB 3;  4J36 A;  3CPI G;  1N61 C;  1GRB A;  4IT1 A;  4GUV A;  3AD7 B;  3FYY A;  3UCC A;  2YG3 A;  1B4V A;  4USR A;  4LII A;  1GRA A;  3GRT A;  1CHU A;  1DOC A;  4M52 A;  3PFR A;  5HHF A;  2QDD A;  4IZG A;  3AEC A;  3EF6 A;  1AOG A;  1MDR A;  4K7Z A;  2E4G A;  3UOX A;  2B7R A;  2XLU A;  3QVR A;  2H89 A;  3NS1 B;  2XFQ A;  3KPF A;  1GOS A;  1L9C A;  1L0V A;  4KX6 A;  3AYI A;  1ZK7 A;  4EQS A;  2DW7 A;  4PAB A;  4U8O A;  2YLZ A;  4TLX A;  2POZ A;  3VRD B;  2VRL A;  4I58 A;  4JHM A;  4H4S A;  2FJB A;  3NVY B;  2PA6 A;  4ZCC A;  5KNL A;  3CNP A;  2YG6 A;  4B68 A;  1GND A;  4JY2 A;  2OLA A;  4IVM B;  1KD0 A;  2XLS A;  1N5W C;  4IV9 A;  4A6N A;  4JNQ A;  3I6T A;  1N4W A;  3BNU A;  4H4P A;  2VQ7 A;  4J2W A;  4X9N A;  2R45 A;  1NHQ A;  1GAL A;  5ENL A;  3NHO X;  3O0H A;  4GRT A;  2C4C A;  3R11 A;  4MJW A;  1H86 A;  3GD3 A;  3Q45 A;  5M10 A;  4NTE A;  2BK4 A;  2GAH B;  1H81 A;  1QJD A;  4YKG A;  4U8K A;  3T6C A;  3ETR B;  3DFH A;  2W3R A;  2XVF A;  3CMM A;  3UOV A;  2TMD A;  3WE0 A;  1GEU A;  3UP5 A;  2Z5Y A;  4FX9 A;  4B64 A;  4Z1Y A;  1BGJ A;  1ELS A;  2OX4 A;  3OW1 A;  1NHP A;  3AE6 A;  5JCI A;  2GVC A;  2BRA A;  3AB1 A;  2V61 A;  2JB1 A;  2ARD A;  1E7P A;  2DW6 A;  3LZX A;  3HZL A;  4YTN A;  4K8G A;  4GAV A;  4GYP A;  2MNR A;  3NYC A;  4AOS A;  4H2H A;  1FEC A;  4EQX A;  1SJB A;  2BXS A;  1OJC A;  3KKJ A;  4ZN0 A;  2PP1 A;  5KMP A;  3UXL A;  4Z24 A;  4DHG A;  3GD6 A;  3TOY A;  2R0C A;  1NPX A;  4IP4 A;  4J1O A;  3ADA B;  2TPR A;  4KT2 A;  2P3Z A;  5FJR A;  3FXG A;  3TCS A;  3SZ0 A;  2YQU A;  4H1Z A;  4K5S A;  1CL0 A;  1V97 A;  3QVP A;  3BJS A;  4H2Q A;  2ONE A;  2PP3 A;  4PAA A;  4C3Y A;  3QKE A;  3H7V A;  1EBD A;  2WDR A;  1XDI A;  3NK1 X;  3UKK A;  2C3C A;  1MXT A;  3AEE A;  4II3 A;  1O5W A;  4B1B A;  1M6I A;  3EEZ A;  1TDF A;  2C65 A;  1E1N A;  3NH3 X;  2AL2 B;  4H50 A;  3ICT A;  1R6W A;  1N60 C;  3STP A;  3IF9 A;  2XSX A;  1JRZ A;  2ACZ A;  1M64 A;  3GSI A;  4YSH A;  3TWA A;  4OPG A;  2OQY A;  4ZCD A;  3HYV A;  3UKP A;  3ICR A;  3MKC A;  3AE3 A;  3GYJ A;  3P93 A;  3FCP A;  3ZVH A;  1LV0 A;  3BOX A;  2YG7 A;  2E1M A;  5HY5 A;  1FCD A;  3AE2 A;  1NAA A;  2AR8 A;  4GIS A;  4DYE A;  4KWS A;  2B7S A;  4WX1 A;  3FV9 A;  3OC4 A;  3NYE A;  3KPK A;  2Z5X A;  5IQ1 A;  1H83 A;  3T14 A;  3ZYX A;  2Q6U A;  3OZY A;  1XS2 A;  2QGY A;  1P2H A;  4YSY A;  1VDV A;  3UKL A;  3NGC X;  5J7X A;  1KDG A;  3PS9 A;  3G5Q A;  1D5T A;  3T9P A;  4Z17 A;  3DFY A;  2VRM A;  3CT2 A;  1KF6 A;  2YR6 A;  1PXC A;  3AEG A;  4GME A;  3BI4 A;  3TJ4 A;  4IVO B;  2WOI A;  3NO1 A;  1FIQ B;  4NNJ A;  3TJI A;  4DWD A;  1PN0 A;  4EQR A;  2FBW A;  1T3Q C;  3NG7 X;  3PG6 A;  4GFI A;  3VRA A;  3AEF A;  2W3S A;  3NYF A;  4IA6 A;  4H7U A;  3PWI A;  3CPJ G;  1VRQ B;  3P9U A;  2OVL A;  1B5Q A;  2E5A A;  4AT0 A;  3S61 A;  5FJT A;  2ZBW A;  3NIX A;  1TE6 A;  4G74 A;  2C3D A;  4K22 A;  4TM3 A;  3AED A;  2QJM A;  3AD9 B;  1BKW A;  3UTG A;  4M0X A;  4J3Z A;  2XH2 A;  3NK2 X;  4NWZ A;  4KPR A;  3ZDN A;  4ADW A;  2Q0L A;  1ZX9 A;  3NNE A;  4C3X A;  3GDN A;  3U4F A;  4GDE A;  4G9K A;  4JQ9 A;  1H7W A;  1KSS A;  2VQB A;  4BV6 A;  3QFA A;  2XH4 A;  1CF3 A;  1P43 A;  4H4R A;  4YKF A;  3H8A A;  2B76 A;  1RVK A;  3ES8 A;  1PBD A;  3V3W A;  3DK9 A;  3L8K A;  4BJY A;  4HNL A;  3RR1 A;  2XGZ A;  3VFC A;  2PHH A;  4H4U A;  1EBH A;  1E39 A;  4TLZ A;  1Y56 B;  1GER A;  1PHH A;  4U2L A;  3NVV B;  1Q9I A;  3CPH G;  5FJP A;  1EL9 A;  1PBE A;  3MQT A;  4K1W A;  2C76 A;  2W0H A;  3M13 A;  3IK4 A;  4BUR A;  3FPZ A;  4A65 A;  1K0J A;  1N4U A;  4U8J A;  4UDP A;  3OZ2 A;  3CXB A;  2GH5 A;  2OZT A;  3KD9 A;  2R4E A;  1BWC A;  3FJ4 A;  3C96 A;  5KOW A;  3AD8 B;  4YWO A;  1FFV C;  1QO8 A;  3AM9 A;  1QLB A;  1FL2 A;  3DG6 A;  1KN0 A;  3HPF A;  3OPS A;  2XLP A;  2XYO A;  2C75 A;  4TM1 A;  3NK0 X;  4JNA A;  1FEA A;  2XVI A;  4TM0 A;  1JNR A;  3IJI A;  3A7A A;  4A99 A;  1EC8 A;  3ZVI A;  2V3A A;  3DK8 A;  1GRH A;  2C64 A;  3VR8 A;  4C77 A;  2EQ7 A;  1ZOY A;  3H4K A;  1PBC A;  3K7Q X;  2RAB A;  2XH7 A;  3AEA A;  3D46 A;  1E6E A;  3DJD A;  1GXF A;  1YKJ A;  3NKS A;  1PJ6 A;  3AMZ A;  5GRT A;  3MZN A;  3GYX A;  4GDP A;  4K8D A;  2ZZB A;  3GRS A;  3ABV A;  2GF3 A;  3LXD A;  1CBO A;  4OVI A;  2R9Z A;  3QPE A;  1JU2 A;  3D47 A;  2OG9 A;  1XAN A;  5ER0 A;  3T8Q A;  1JOA A;  1IYX A;  1OEP A;  1OJ9 A;  4II2 A;  3SN0 A;  4IA5 A;  3H70 A;  2X8C A;  5JCL A;  4HNC A;  1D7Y A;  1FO4 A;  3P4R A;  3UOZ A;  1YQ4 A;  2V60 A;  2VVM A;  1Z6L A;  2RGH A;  3P3B A;  3Q4D A;  1Q1R A;  2PPG A;  3LB8 A;  1CJ4 A;  4A6N B;  3VCN A;  1NEN A;  2OO6 A;  3CGE A;  2GL5 A;  5C2T A;  4AP3 A;  2WPE A;  3G5S A;  3U9I A;  2ZAD A;  4D03 A;  3CB3 A;  1ONE A;  1F8R A;  2BAB A;  2FKP A;  1ZY8 A;  5L46 A;  4EIQ A;  3HYX A;  3DG7 A;  3CN8 A;  3JZU A;  1EL7 A;  1YQ3 A;  2PMQ A;  4A9W A;  1FOH A;  3SGL A;  5IPY A;  2EQ8 A;  2CHR A;  4CBQ A;  1D4D A;  2OZ3 A;  1JRP A;  3VA8 A;  2NQL A;  2BS2 A;  2BCP A;  4E8G A;  2QAE A;  1REO A;  1KCZ A;  1LTX R;  4JDR A;  4K2X A;  2XVJ A;  5C3J A;  3SZC A;  4K2S A;  5CQF A;  1EC9 A;  3NZG A;  1PXA A;  1S7M A;  5J60 A;  1NG3 A;  1JEH A;  1F8S A;  3CTY A;  1VG9 A;  1SB3 B;  5FJO A;  1WYG A;  2A8X A;  3VCC A;  2P0I A;  3EAO A;  4N9X A;  1RM6 B;  1GPE A;  2BA9 A;  2GGI A;  3IJL A;  2WU2 A;  2IID A;  3NT6 A;  3HYW A;  1JRX A;  2O56 A;  3D1C A;  4BK3 A;  3CND A;  1R0M A;  3K30 A;  3NN6 X;  4C74 A;  2CDU A;  5U25 A;  1S3B A;  3UCL A;  4APN A;  3T0K A;  4DSH A;  4NEV A;  2WPF A;  2PP0 A;  1TDE A;  5KWF A;  2C73 A;  4A6G A;  1PS9 A;  3DG3 A;  2XDO A;  2ZZC A;  3V3N A;  4TVY A;  3RP7 A;  3V5F A;  2WEU A;  3B3R A;  2QJN A;  2QVH A;  5JCN A;  3A7U A;  4HN8 A;  2QQ6 A;  5BVA A;  3A7R A;  1X2G A;  4CCR A;  2OKT A;  2FJA A;  3UGV A;  3EKG A;  2X3N A;  1SJC A;  4DN1 A;  1ECQ A;  4XWR A;  2OQH A;  2X8H A;  4WCT A;  2GGE A;  4H4Y A;  4A3R A;  4OPL A;  3M0O A;  3TTE A;  4GCM A;  1K0L A;  2WP9 A;  3IJQ A;  4U8I A;  2GAG B;  2GR0 A;  3K1G A;  3VR9 A;  4HCD A;  3II4 A;  1ZP0 A;  3ZVH B;  2C67 A;  2WPC A;  2BYB A;  2GQW A;  5BUL A;  3SJN A;  1IUV A;  2IVD A;  3F8R A;  5KMQ A;  3V3O A;  1Q1W A;  4E6M A;  7ENL A;  3AYJ A;  4P9S A;  3R25 A;  1CC4 A;  4H2R A;  2YLR A;  4G6H A;  2OAM A;  3VQR A;  2PTZ A;  2FYM A;  2XH0 A;  4AP1 A;  1Y0P A;  3P4Q A;  1NEK A;  1KFY A;  3SY4 A;  4EMI A;  4BK2 A;  5KVI A;  2PTY A;  2XLR A;  3I4K A;  5IQ4 A;  3Q6J A;  4ZA0 A;  2PS2 A;  3L5O A;  3DGZ A;  4HPN A;  3RGT A;  3BHF A;  3IWA A;  2BK5 A;  1N5X A;  2GGH A;  3HW2 A;  1CJC A;  2XLT A;  3DME A;  5G5G B;  2XFU A;  4NZH A;  3CGB A;  3SR6 B;  1SEZ A;  4Y4N A;  2QA1 A;  4YSZ A;  4TM4 A;  1E1M A;  3R07 C;  3PK7 A;  3SZW A;  1UKV G;  4Z44 A;  1PBB A;  3NTD A;  1TYT A;  3UJ2 A;  3UJE A;  1S2Y A;  1CC2 A;  3SN1 A;  2NPX A;  2B9W A;  5J04 A;  4NTD A;  4J57 A;  4O5Q A;  1GRF A;  3NN0 X;  3RNM A;  1F6M A;  3I6E A;  1MO9 A;  5BUK A;  4U8P A;  4Z25 A;  2H88 A;  2XCG A;  4X4J A;  2YAU A;  5FS6 A;  3K7T A;  3TW9 A;  4OPD A;  3ATR A;  5EBK A;  1O94 A;  1PDZ A;  4TVW A;  1DJN A;  2EQ9 A;  3G5R A;  2OLN A;  1IJH A;  4HYR A;  1K4Q A;  2V6O A;  2AQJ A;  3R0K A;  3GWD A;  4FI4 A;  3SX6 A;  1BF3 A;  3P4S A;  1LVL A;  4EQW A;  3SQP A;  4E0V A;  3GC2 A;  1O95 A;  3IC9 A;  2WS3 A;  3B97 A;  1VQW A;  3KLJ A;  3QTP A;  1RYI A;  1NHR A;  1H7X A;  5EU9 A;  3PWG A;  1STZ A;  1D4C A;  1BGN A;  4BJZ A;  2B9Y A;  5JRB A;  2PU1 A;  5LV9 A;  2WU5 A;  2YWL A;  2E3T A;  4HCL A;  2MUC A;  1E9I A;  2R0G A;  3L1R A;  1PJ7 A;  4U8M A;  4H2P A;  2I5Q A;  3QLD A;  5EB5 A;  2GB0 A;  3I6D A;  2PCE A;  5FS8 A;  1S3E A;  2VVL G;  1PDH A;  1ELI A;  3COX A;  1PDY A;  5GSN A;  5KVH A;  1KKR A;  1GTE A;  4LA1 A;  4HA6 A;  2XFP A;  1JNZ A;  4LU6 A;  1ZKQ A;  3SZF A;  2V5Z A;  3CK5 A;  3URH A;  2AL1 A;  3NLC A;  3FMW A;  4X2P A;  4GGB A;  1ONF A;  3QSS A;  3UTH A;  2WHD A;  2YLT A;  2W54 A;  1XPY A;  2R4J A;  1EL5 A;  5FJU A;  3E1T A;  1OJA A;  4GR1 A;  1JPD X;  1SJA A;  1SJD A;  1JPM A;  1V59 A;  3JW7 A;  2OA1 A;  2YM2 A;  4B66 A;  3ZLG A;  3PVC A;  4Y4M A;  1XHC A;  2B9X A;  5M0Z A;  2QJJ A;  4H4Z A;  1TDO A;  5CKU A;  3QSM A;  1VQZ A;  2BK3 A;  1H6V A;  2XFN A;  3D8X A;  3IHM A;  3LOV A;  4XWZ A;  2BCG G;  5KMS A;  5IDZ A;  3C4A A;  2GQF A;  3AYL A;  1FEB A;  3KVE A;  3AE1 A;  3NVW B;  4J34 A;  2C72 A;  3ALJ A;  2QCU A;  3CGD A;  2YVJ A;  4OPI A;  4GIR A;  3D9X A;  4MGG A;  3SBF A;  3AWI A;  1XPQ A;  3UKF A;  3AXB A;  1ZOV A;  5KOX A;  4DNA A;  1KNP A;  2GRT A;  2PTW A;  2WBA A;  3AE5 A;  3ALL A;  3JSK A;  1NHS A;  4H4W A;  3ITJ A;  3RP6 A;  2YR5 A;  3SQS A;  2GEW A;  4YXD A;  4UDR A;  3R0U A;  1B37 A;  1E1L A;  1NU5 A;  3SN4 A;  2QDE A;  2X99 A;  3GYI A;  2O9Z A;  2WDQ A;  1ZMD A;  3P1W A;  1GTH A;  3TQP A;  3EAN A;  1MNS A;  1JRO A;  4B63 A;  4ECH A;  1FHV A;  3VC5 A;  3ALM A;  3QN3 A;  1RP0 A;  4JN8 A;  4DGK A;  3AN1 A;  4EM3 A;  4YTM A;  1X31 B;  1LQU A;  3GDP A;  3H12 A;  3FIM B;  1IUS A;  4ICY A;  4KEM A;  2GSH A;  3ZLF A;  4J33 A;  2J3N A;  2WOV A;  2A87 A;  3P0W A;  4GAP A;  4FK1 A;  4Z2U A;  3UKA A;  3MSY A;  3EPT A;  2BS4 A;  1JDF A;  2RDX A;  4B69 A;  1LPF A;  3JVA A;  1N1P A;  2GGG A;  2VOU A;  4E5T A;  4MMW A;  2ZZ0 A;  1K0I A;  2AKM A;  2HZG A;  3N4F A;  1N63 C;  2YLW A;  1EBG A;  1DNC A;  1MUC A;  3NFU A;  1IUT A;  1W6T A;  2YLX A;  1LJ1 A;  4G73 A;  3DER A;  3SFE A;  3AE9 A;  2W55 A;  3OZM A;  3T37 A;  4I59 A;  2WP6 A;  4DSG A;  4CNJ A;  1WUF A;  3OP2 A;  3UTF A;  4KPL A;  2JB2 A;  3F8P A;  3NVZ B;  2GMJ A;  3T2K A;  4USQ A;  3NXL A;  4AT2 A;  3V76 A;  3VRB A;  1P48 A;  1MRA A;  3ATQ A;  3V5C A;  4EWJ A;  2UZZ A;  2C7G A;  2OFJ A;  3T31 A;  1H2I A;  2RGO A;  2X50 A;  4EM4 A;  1DOE A;  2F5Z A;  3DDM A;  3R9U A;  2WP5 A;  5HXI A;  4H2N A;  2EQ6 A;  1N4V A;  2BAC A;  1TDN A;  3K7M X;  2A89 A;  3THU A;  4F4R A;  1TKK A;  2Y6Q A;  1RSG A;  3ICS A;  3AEB A;  2XFO A;  3ZLH A;  4RG4 A;  3GMC A;  3SM8 A;  2DKH A;  1IUX A;  5EOW A;  4A5L A;  1ZDL A;  3RP8 A;  5FS7 A;  5KXJ A;  1CJ2 A;  3NTA A;  3BSM A;  1GRE A;  3DIP A;  2PSN A;  3GWF A;  4H4T A;  3MWC A;  2C66 A;  3CYJ A;  4Z26 A;  3QJ4 A;  3CIR A;  5JCM A;  3OTR A;  1DJQ A;  1IUU A;  1S2Q A;  1GSN A;  2WOW A;  4K5R A;  4ENL A;  2CFY A;  2QA2 A;  2I0Z A;  3HRD C;  3LZW A;  4Z2T A;  5HYM A;  4GF7 A;  2R46 A;  3NRZ B;  1L9E A;  2HNE A;  4H19 A;  3LJP A;  4U8L A;  3RCY A;  1L8P A;  4CY8 A;  2PYX A;  3RHA A;  2PU0 A;  3ES7 A;  5BOF A;  1GT8 A;  2X8G A;  4Z2R A;  3UKQ A;  4O5U A;  2NVK X;  4U8N A;  2YR4 A;  1PJ5 A;  3B6D A;  3PO7 A;  1DOB A;  1W4X A;  4JN7 A;  1EC7 A;  4A79 A;  5FMH A;  3Q9T A;  3S5W A;  3DGB A;  2P8B A;  2R0P A;  2HQM A;  1D7L A;  3GD4 A;  3UJR A;  4H4Q A;  4UDQ A;  4OPC A;  1FFU C;  2OLO A;  2BRY A;  5FS9 A;  4CY6 A;  4DX3 A;  4OCG A;  4JY3 A;  4Y4L A;  2JB3 A;  1VG0 A;  4GGH A;  1DXL A;  4YT0 A;  3GY1 A;  2Q0K A;  1ZXI C;  1MDL A;  3DGH A;  4M6U A;  2GR2 A;  3BNM A;  2PGW A;  5KRQ A;  3UOY A;  2GDQ A;  4YWS A;  4G6G A;  3BI2 A;  2YVG A;  3DK4 A;  1EL8 A;  4FP1 A;  4H83 A;  4B65 A;  3I3L A;  3KU9 A;  2XVE A;  4C5O A;  2GGJ A;  3T2Z A;  3UP4 A;  4A7A A;  4J56 A;  3VC6 A;  1H82 A;  2P8C A;  3M12 A;  3T2Y A;  1OJD A;  2RGJ A;  2YG4 A;  2POD A;  4EIP A;  2VZ2 A;  1GV4 A;  1E1K A;  3IHG A; 
#chains in the Genus database with same CATH homology
 3CN8 A;  3QFB A;  4BK1 A;  3PVC A;  4Y4M A;  1FEC A;  1XHC A;  4EQX A;  1EL7 A;  2B9X A;  4JN9 A;  4U2S A;  3DJJ A;  1YQ3 A;  2BXS A;  1OJC A;  3ISH A;  5M0Z A;  2YM1 A;  2GV8 A;  3KKJ A;  4A9W A;  4CNK A;  1FOH A;  4ZN0 A;  1PXB A;  5KMP A;  3SGL A;  3AE8 A;  2JK6 A;  2V3B A;  3F8D A;  5IPY A;  4H4Z A;  4Z24 A;  2BXR A;  1TDO A;  1GET A;  2EQ8 A;  1IUW A;  3GMB A;  4J31 A;  1TDK A;  2R0C A;  1GRT A;  4U2T A;  5CKU A;  1NPX A;  3QSM A;  4CBQ A;  1D4D A;  2Y6R A;  3NRN A;  1LQT A;  3ADA B;  2TPR A;  2BK3 A;  1H6V A;  3CNT A;  2BS2 A;  2BCP A;  1D4E A;  2WQY A;  2XFN A;  1GES A;  2QAE A;  3SZ0 A;  2YQU A;  1REO A;  1LTX R;  3D8X A;  4JDR A;  3BHK A;  3IHM A;  3LOV A;  4K5S A;  4XWZ A;  2FJE A;  4K2X A;  2BCG G;  1CL0 A;  2XVJ A;  5C3J A;  5KMS A;  1B8S A;  3QVP A;  3C4A A;  3SZC A;  2AAQ A;  4BK2 A;  2GQF A;  2GMH A;  3AYL A;  4H2Q A;  5CQF A;  1PXA A;  1FEB A;  3KVE A;  3AE1 A;  3FBS A;  1F3P A;  4J34 A;  1S7M A;  5J60 A;  1NG3 A;  2C72 A;  4PAA A;  2WET A;  3ALJ A;  2QCU A;  3CGD A;  4C3Y A;  4CRT A;  1EBD A;  2WDR A;  2YVJ A;  1JEH A;  2GR3 A;  1XDI A;  3NK1 X;  1F8S A;  4AOX A;  4OPI A;  3CNJ A;  3CTY A;  3UKK A;  2C3C A;  3D9X A;  1MXT A;  1VG9 A;  3AEE A;  3RED A;  4H4X A;  4II3 A;  1PBF A;  1O5W A;  3AWI A;  2A8X A;  2BC1 A;  3EAO A;  2JAE A;  4N9X A;  4B1B A;  1M6I A;  4H4V A;  1XPQ A;  1GPE A;  3UKF A;  2BA9 A;  3AXB A;  3P4P A;  1ZOV A;  5KOX A;  4DNA A;  1KNP A;  1TDF A;  2GRT A;  4UP3 A;  2C65 A;  4EMW A;  4FK1 C;  2WU2 A;  2WBA A;  2IID A;  3AE5 A;  1E1N A;  3ALL A;  3JSK A;  3NH3 X;  3NT6 A;  1NHS A;  4H4W A;  4X9M A;  4H50 A;  3HYW A;  3ITJ A;  2YVF A;  3RP6 A;  1YY5 A;  3ICT A;  1JRX A;  2YR5 A;  1HYU A;  4D04 A;  2GEW A;  1P2E A;  3D1C A;  4BK3 A;  3CND A;  4YXD A;  4UDR A;  4B66 A;  1JRY A;  3IF9 A;  3K30 A;  3NN6 X;  1B37 A;  1E1L A;  2BS3 A;  4C74 A;  2C70 A;  2CDU A;  1JRZ A;  2ACZ A;  1M64 A;  5EB4 A;  5U25 A;  3GSI A;  2X99 A;  1H84 A;  3GYI A;  2O9Z A;  4YSH A;  1S3B A;  2WDQ A;  3UCL A;  1ZMD A;  4YTP A;  3CNS A;  3P1W A;  4APN A;  3DA1 A;  4OPG A;  1GTH A;  4ZCD A;  3EAN A;  3T0K A;  3HYV A;  3UKP A;  4DSH A;  3ICR A;  4NEV A;  2JBV A;  3AE3 A;  3GYJ A;  4B63 A;  1COY A;  2WPF A;  4ECH A;  1LV0 A;  1TDE A;  2YG7 A;  2E1M A;  5HY5 A;  3ALM A;  3H8I A;  1FCD A;  2CUL A;  1RP0 A;  5KWF A;  3AE2 A;  2C73 A;  2CVJ A;  3QSE A;  4DGK A;  1NAA A;  3DJE A;  2AR8 A;  4EM3 A;  4YTM A;  1X31 B;  1PS9 A;  1LQU A;  3GDP A;  2XDO A;  4RSL A;  5U63 A;  2ZZC A;  3FIM B;  3V3N A;  3C4N A;  1IUS A;  2B7S A;  4WX1 A;  3OC4 A;  4EMJ A;  3NYE A;  3KPK A;  4ICY A;  3RP7 A;  2Z5X A;  2JKC A;  1NG4 A;  2WEU A;  4J33 A;  2WDV A;  5IQ1 A;  1H83 A;  3SXI A;  3B3R A;  2J3N A;  3T14 A;  3ZYX A;  5JCK A;  2Q6U A;  5JCN A;  1P2H A;  4YSY A;  2WOV A;  3UKL A;  5BVA A;  2A87 A;  3DH9 A;  2XVH A;  5U1O A;  1CJ3 A;  1KDG A;  1CC6 A;  3NGC X;  4FK1 A;  1VDC A;  4GAP A;  3BI5 A;  3PS9 A;  4NTC A;  3SYI A;  3UTE A;  2FJA A;  3G5Q A;  1D5T A;  4Z2U A;  4HB9 A;  2VRM A;  2X3N A;  3UKA A;  2OAL A;  3EPT A;  4XWR A;  2X8H A;  1KF6 A;  2BS4 A;  2YR6 A;  1KNR A;  4WCT A;  2BC0 A;  4B69 A;  1LPF A;  4H4Y A;  1PXC A;  3AEG A;  1N1P A;  2VVL A;  3M0O A;  2VOU A;  4OPL A;  4GCM A;  1K0L A;  3BI4 A;  2ZZ0 A;  2YLS A;  1K0I A;  2WP9 A;  4IVO B;  4U8I A;  2WOI A;  3AE4 A;  1NDA A;  2YLW A;  2GAG B;  2GR0 A;  4NNJ A;  3VR9 A;  1DNC A;  3CGC A;  1BZL A;  3II4 A;  2APG A;  4FDC B;  1IUT A;  2YLX A;  4XXG A;  1LJ1 A;  1ZP0 A;  1PN0 A;  4G73 A;  4EQR A;  3SFE A;  3AE9 A;  2C67 A;  2E5V A;  2FBW A;  4NEW A;  3NG7 X;  4RG3 A;  3T37 A;  4I59 A;  2WP6 A;  1ZMC A;  3PG6 A;  4OPT A;  2WPC A;  3AEF A;  4OPU A;  3VRA A;  2BYB A;  3NYF A;  4IA6 A;  4CNJ A;  4H7U A;  2GQW A;  5BUL A;  1MOK A;  3UTF A;  3CPJ G;  2JB2 A;  3F8P A;  3UKH A;  1IUV A;  1VRQ B;  2GMJ A;  3P9U A;  2IVD A;  2IVE A;  3F8R A;  3FG2 P;  3T2K A;  5DBJ A;  4USQ A;  5KMQ A;  1B5Q A;  4AT0 A;  3S61 A;  4AT2 A;  2GR1 A;  3V76 A;  3V3O A;  1Q1W A;  2ZBW A;  3VRB A;  3NIX A;  4G74 A;  2C3D A;  1YQZ A;  1Y56 A;  3AYJ A;  4P9S A;  3ATQ A;  4K22 A;  1KSU A;  4YSX A;  4CCQ A;  2UZZ A;  4TM3 A;  2C7G A;  1CC4 A;  3AED A;  4H2R A;  5BRT A;  2YLR A;  1BKW A;  3AD9 B;  1H2I A;  2RGO A;  2X50 A;  4G6H A;  3T31 A;  5TR3 A;  1OJT A;  4EM4 A;  2FJD A;  2OAM A;  3UTG A;  1TRB A;  3VQR A;  1DOE A;  2YG5 A;  4CCR A;  2F5Z A;  4Z43 A;  3AE7 A;  1L9D A;  3R9U A;  2WP5 A;  3NK2 X;  1Y0P A;  4AP1 A;  3P4Q A;  1DOD A;  1NEK A;  1KFY A;  4NWZ A;  5HXI A;  4KPR A;  3SY4 A;  4EMI A;  2Q7V A;  2EQ6 A;  4H2N A;  3SFD A;  3ZDN A;  4B67 A;  1N4V A;  4ADW A;  2BAC A;  2DKI A;  5KVI A;  1TDN A;  2Q0L A;  2A89 A;  1F8W A;  1ZX9 A;  2XLR A;  3K7M X;  3NNE A;  4C3X A;  5IQ4 A;  3DJG X;  5KMR A;  3GDN A;  3LAD A;  3Q6J A;  2WES A;  2Y6Q A;  1RSG A;  4GDE A;  3L5O A;  3DGZ A;  3ICS A;  3AEB A;  2XFO A;  3BHF A;  4REK A;  3KA7 A;  4G9K A;  4RG4 A;  3IWA A;  1GRG A;  3GMC A;  3SM8 A;  2BK5 A;  4JQ9 A;  1CJC A;  2DKH A;  3H8L A;  1IUX A;  1H7W A;  1KSS A;  5EOW A;  1TYP A;  2XLT A;  3DME A;  2XFU A;  4J36 A;  4NZH A;  2VQB A;  4BV6 A;  1ZDL A;  4A5L A;  3CPI G;  3CGB A;  1GRB A;  3QFA A;  1SEZ A;  4Y4N A;  1CF3 A;  3RP8 A;  2QA1 A;  4GUV A;  3AD7 B;  4YSZ A;  5FS7 A;  5KXJ A;  4H4R A;  4YKF A;  4TM4 A;  1E1M A;  1CJ2 A;  2YG3 A;  1B4V A;  3NTA A;  1GRE A;  4USR A;  3SZW A;  2B76 A;  1UKV G;  3GWF A;  4LII A;  1PBD A;  4Z44 A;  1GRA A;  3DK9 A;  1PBB A;  3L8K A;  4H4T A;  2C66 A;  4BJY A;  3GRT A;  3NTD A;  4Z26 A;  1CHU A;  3QJ4 A;  2PHH A;  4H4U A;  1TYT A;  1DOC A;  3CIR A;  5JCM A;  4M52 A;  1E39 A;  4TLZ A;  4DSG A;  1DJQ A;  1S2Y A;  1IUU A;  1Y56 B;  1S2Q A;  1GSN A;  2WOW A;  1GER A;  1CC2 A;  1PHH A;  4U2L A;  5HHF A;  2NPX A;  2B9W A;  1Q9I A;  3CPH G;  4AOS A;  3AEC A;  4K5R A;  3EF6 A;  1EL9 A;  4NTD A;  1PBE A;  2CFY A;  2QA2 A;  2I0Z A;  2C76 A;  4J57 A;  1AOG A;  3LZW A;  2W0H A;  4O5Q A;  4Z2T A;  3M13 A;  4BUR A;  4K7Z A;  5HYM A;  1GRF A;  3FPZ A;  2E4G A;  3NN0 X;  4GF7 A;  3UOX A;  4A65 A;  2B7R A;  3RNM A;  1K0J A;  1F6M A;  2R46 A;  1L9E A;  1N4U A;  2XLU A;  3LJP A;  1MO9 A;  4U8L A;  3QVR A;  2H89 A;  5BUK A;  2XFQ A;  3KPF A;  4CY8 A;  1GOS A;  1L9C A;  2PYX A;  1L0V A;  4U8P A;  4KX6 A;  4U8J A;  4Z25 A;  2H88 A;  4UDP A;  3RHA A;  3OZ2 A;  3AYI A;  1ZK7 A;  2GH5 A;  2XCG A;  4X4J A;  4EQS A;  3KD9 A;  1GT8 A;  4PAB A;  2R4E A;  2X8G A;  1BWC A;  4U8O A;  3UKQ A;  2YLZ A;  4O5U A;  4TLX A;  3C96 A;  2YAU A;  4Z2R A;  5KOW A;  3AD8 B;  3VRD B;  2NVK X;  5FS6 A;  4YWO A;  3K7T A;  4OPD A;  4U8N A;  2YR4 A;  1PJ5 A;  3ATR A;  3B6D A;  3PO7 A;  1QO8 A;  1DOB A;  5EBK A;  1O94 A;  1W4X A;  2VRL A;  1QLB A;  1FL2 A;  1KN0 A;  4I58 A;  2XLP A;  4H4S A;  2FJB A;  2XYO A;  1DJN A;  2C75 A;  4TM1 A;  3NK0 X;  2EQ9 A;  4A79 A;  3G5R A;  5FMH A;  2OLN A;  3Q9T A;  4ZCC A;  1IJH A;  3S5W A;  4JNA A;  1FEA A;  5KNL A;  1K4Q A;  3CNP A;  2XVI A;  2YG6 A;  2V6O A;  4TM0 A;  4B68 A;  1GND A;  1JNR A;  4JY2 A;  2AQJ A;  4A99 A;  3GWD A;  4IVM B;  3SX6 A;  2XLS A;  1BF3 A;  2R0P A;  1LVL A;  2V3A A;  3P4S A;  2HQM A;  3DK8 A;  4EQW A;  1GRH A;  3SQP A;  1D7L A;  2C64 A;  3GD4 A;  1O95 A;  3VR8 A;  4E0V A;  4C77 A;  3IC9 A;  2WS3 A;  2EQ7 A;  4IV9 A;  4H4Q A;  4A6N A;  4UDQ A;  4JNQ A;  1ZOY A;  1N4W A;  3BNU A;  4H4P A;  2VQ7 A;  3H4K A;  1PBC A;  4OPC A;  1VQW A;  4J2W A;  4X9N A;  3KLJ A;  2R45 A;  3K7Q X;  2RAB A;  1NHQ A;  3AEA A;  1GAL A;  1E6E A;  1RYI A;  2OLO A;  2BRY A;  1NHR A;  3NHO X;  1H7X A;  3O0H A;  1D4C A;  5FS9 A;  3DJD A;  1GXF A;  4GRT A;  1BGN A;  3WE0 A;  1YKJ A;  2C4C A;  4MJW A;  4CY6 A;  1H86 A;  4BJZ A;  3GD3 A;  5JRB A;  1PJ6 A;  2B9Y A;  3NKS A;  4OCG A;  5GRT A;  5J7X A;  5LV9 A;  5M10 A;  3GYX A;  2WU5 A;  2YWL A;  4GDP A;  4NTE A;  4JY3 A;  2BK4 A;  2R0G A;  4Y4L A;  4K8D A;  1H81 A;  2GAH B;  1QJD A;  2JB3 A;  3L1R A;  4YKG A;  1PJ7 A;  2ZZB A;  4U8K A;  1VG0 A;  4U8M A;  4H2P A;  3GRS A;  3ABV A;  2GF3 A;  3LXD A;  1CBO A;  2GB0 A;  4OVI A;  2R9Z A;  5EB5 A;  3I6D A;  1DXL A;  4YT0 A;  5FS8 A;  1JU2 A;  1S3E A;  1XAN A;  2XVF A;  2Q0K A;  5ER0 A;  1JOA A;  2VVL G;  1PDH A;  1ELI A;  3CMM A;  3UOV A;  3DGH A;  2GR2 A;  3BNM A;  5KRQ A;  1OJ9 A;  3COX A;  4II2 A;  5GSN A;  3UOY A;  5KVH A;  2TMD A;  4IA5 A;  1GTE A;  4G6G A;  4LA1 A;  3BI2 A;  2X8C A;  1GEU A;  5JCL A;  2XFP A;  4HA6 A;  2Z5Y A;  3UP5 A;  1D7Y A;  2YVG A;  3DK4 A;  4FX9 A;  1EL8 A;  1JNZ A;  4LU6 A;  3P4R A;  3UOZ A;  4B64 A;  1ZKQ A;  3SZF A;  1YQ4 A;  1BGJ A;  2V5Z A;  4B65 A;  2V60 A;  3URH A;  2VVM A;  1Z6L A;  1NHP A;  3AE6 A;  3I3L A;  3KU9 A;  5JCI A;  3FMW A;  2XVE A;  3NLC A;  4C5O A;  2RGH A;  3T2Z A;  1ONF A;  2GVC A;  1Q1R A;  3UP4 A;  3LB8 A;  1CJ4 A;  4A7A A;  2BRA A;  3QSS A;  3UTH A;  2WHD A;  2YLT A;  3AB1 A;  4A6N B;  4J56 A;  1NEN A;  3CGE A;  2R4J A;  1H82 A;  1EL5 A;  4AP3 A;  5C2T A;  2V61 A;  3E1T A;  2WPE A;  3G5S A;  2JB1 A;  2ARD A;  1E7P A;  3M12 A;  3T2Y A;  1OJD A;  1OJA A;  2RGJ A;  4D03 A;  2YG4 A;  4GR1 A;  1F8R A;  2BAB A;  3LZX A;  4EIP A;  3HZL A;  4YTN A;  1ZY8 A;  1V59 A;  5L46 A;  4GAV A;  2VZ2 A;  4EIQ A;  2OA1 A;  3HYX A;  3NYC A;  2YM2 A;  1GV4 A;  1E1K A;  3IHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...