5JCMA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
432
structure length
429
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFFSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Oxidoreductase
total genus 140
structure length 429
sequence length 432
chains with identical sequence B
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jcmA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcmA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcmA02
5DBJA 4AOXA 3CIRA 2IVEA 4TLZA 4MJWA 4UDQA 2JKCA 3AEFA 3S5WA 3T37A 4H2NA 2R0GA 3IHGA 4U2SA 3QJ4A 1NHPA 1KNPA 5KXJA 2WQYA 1ZK7A 4X4JA 2WEUA 2VVMA 3CNSA 4GDEA 3ICSA 4C5OA 4YKGA 2Q6UA 3LADA 2VQ7A 4LIIA 3LZWA 3NYEA 3BI2A 2YWLA 1OJCA 1EBDA 3CGBA 1DNCA 1GEUA 2GR0A 1OJTA 3UKPA 2BACA 4Z25A 2C64A 5KWFA 2C72A 1V59A 2C73A 1KSSA 3DGHA 1TYPA 2X3NA 3H4KA 1PHHA 2X99A 4LA1A 4EMIA 4Y4LA 3NTDA 3NIXA 1E1NA 1W4XA 1Y56B 3NG7X 4TM0A 3ITJA 4NTDA 4O5QA 2V3AA 3UOXA 4B1BA 1IJHA 3AE2A 3KVEA 4IVMB 4AT0A 2NVKX 3FG2P 2BK3A 1KSUA 3ATQA 3NLCA 4C3YA 2E5VA 3CNTA 4YSXA 3PS9A 2BXRA 3BNMA 2XVEA 2XYOA 3UP5A 3FPZA 3ALLA 3C4NA 3VR8A 4AP3A 4B67A 2FJDA 2A89A 3EF6A 5EB4A 3ALMA 3K7QX 2UZZA 5GSNA 4DSGA 2QAEA 4H4WA 1GRTA 4B66A 4APNA 1ZMCA 1JOAA 2YLSA 3P4RA 2XVIA 1OJ9A 3ALJA 3NYFA 1GXFA 2OAMA 1GTEA 3RHAA 3LZXA 2Z5XA 1QLBA 1D7YA 3LXDA 3D8XA 3NN6X 3DA1A 2WOIA 2WS3A 4JY2A 2WDVA 2TPRA 3L8KA 4ZCDA 2WP6A 4YTMA 2ZZ0A 4Z26A 3AEBA 3O0HA 4Z44A 1B4VA 4H4XA 4EM4A 1Z6LA 1CJ2A 1VQWA 2YLZA 1CF3A 3AE6A 4H4TA 1IUUA 5FS9A 2C70A 3C4AA 3H8IA 4XWRA 3K7TA 2GR1A 1NENA 3NTAA 1GT8A 2PYXA 4EM3A 2Y6RA 2X8CA 5JCMA 4K2XA 3UTFA 3LJPA 3K30A 4C77A 1H7XA 1NHRA 3NRNA 3DK9A 2BS2A 2R45A 4HB9A 3CNJA 3SQPA 5JCLA 3ICTA 1LQTA 1B37A 3WE0A 4DSHA 1K0JA 1CHUA 1N4VA 3GRTA 1ZP0A 2A87A 3ABVA 3KPFA 4OPCA 2AQJA 1S2QA 1BGNA 1JU2A 1Y56A 1GNDA 4K5SA 3FBSA 4Z43A 2JB3A 4YWOA 4TM4A 3KLJA 4OPGA 2YLWA 3AXBA 1TDFA 3UOYA 1N4UA 2XLSA 1KNRA 1F8WA 2VVLA 3BHFA 1CJCA 3FMWA 3P1WA 5GRTA 5LV9A 2R0PA 1BWCA 4GF7A 3HZLA 4USRA 3UKAA 4EQSA 1EL7A 1CC4A 3C96A 3CN8A 1H83A 3AYLA 4Y4NA 1PS9A 4JN9A 2BS3A 1NHQA 2R9ZA 1QO8A 2XLPA 1FEAA 2I0ZA 2ACZA 2TMDA 3AD8B 2YM1A 2YG5A 2YQUA 3AEDA 4NEWA 3GDPA 1NDAA 1LVLA 1PBDA 3Q6JA 2R0CA 1REOA 1DXLA 1GRAA 2YAUA 2QA2A 3B3RA 1ZMDA 3DJDA 1E39A 3S61A 1TDKA 3LB8A 4A6NB 3NK1X 4OVIA 3P4PA 3CNDA 1K4QA 2R4JA 5EBKA 1JEHA 4A7AA 3UKFA 1GPEA 3SM8A 2XFPA 1P2HA 4H4UA 1B8SA 1PJ6A 3BHKA 3IF9A 2IVDA 1ZOYA 1BZLA 4J57A 2XVFA 3D1CA 4U8KA 4U8OA 2YR5A 1NPXA 2GRTA 1O94A 4D03A 2YLTA 2GR2A 4XWZA 1ZY8A 4XXGA 3QFAA 2OLOA 2XLTA 2BC1A 5HHFA 3IC9A 1XHCA 2WETA 3VRAA 1FOHA 5KOXA 4U8NA 4HA6A 1F6MA 3AEEA 3BI5A 4JNAA 4JNQA 3CPJG 5FS6A 3UKKA 2JAEA 1GSNA 1TRBA 1B5QA 3PVCA 4I59A 4ADWA 2NPXA 3CTYA 4A5LA 4NTEA 4E0VA 5IQ4A 3L1RA 4GR1A 3UOVA 4H4PA 4U2LA 5JCKA 5KVHA 4J56A 2VRLA 4OPIA 4TM1A 1BKWA 3G5QA 3NT6A 4REKA 2Q7VA 1YY5A 2F5ZA 1PXAA 1MOKA 4PAAA 1D7LA 3AD9B 4BK2A 2C3DA 2APGA 1Q1RA 4H4VA 4P9SA 3Q9TA 1CC2A 4GCMA 1GRBA 1K0IA 5FS8A 2WHDA 1QJDA 2YVFA 1GETA 3V3NA 2WPCA 2V5ZA 4YKFA 4BJZA 1H84A 1IUTA 4YXDA 1PBEA 5U25A 2C7GA 3NHOX 2YG4A 4CCRA 3EPTA 5U1OA 2JK6A 1ZOVA 5FMHA 1CC6A 1TDOA 5J60A 3CNPA 4KX6A 4KPRA 2XLUA 4YSZA 4LU6A 1K0LA 4H4RA 2BK4A 1ZKQA 4B64A 4WX1A 4BV6A 5BRTA 1JNZA 3CGDA 3RNMA 4A6NA 2C3CA 1H82A 1E7PA 4DGKA 3NN0X 2YVGA 4UDPA 1KF6A 1ONFA 1LV0A 2C66A 2VVLG 3I3LA 1LQUA 2BC0A 2YG3A 3B6DA 3F8PA 3DH9A 4H2QA 4IVOB 2X50A 1DJNA 2C67A 3URHA 4CNKA 3II4A 3DK4A 1SEZA 2PHHA 4RSLA 4A99A 4B63A 5FS7A 2E4GA 1PJ7A 4H7UA 4J2WA 3SFEA 4D04A 4ECHA 4CRTA 3KU9A 4OPUA 2RGJA 2Z5YA 4YSYA 2VOUA 2XDOA 2VQBA 1H86A 2B7SA 1LJ1A 1TDEA 1PBFA 3AE3A 2BK5A 2XCGA 2Y6QA 3UTEA 2XVHA 1RYIA 3GD4A 4FK1C 1BGJA 3GWFA 3IWAA 4USQA 3P4QA 4YTPA 4H4SA 2BCGG 3LOVA 4GUVA 4EIPA 3SFDA 2YR6A 2E1MA 2WPEA 4BJYA 5JCNA 2WDRA 2ZZCA 3ISHA 5IQ1A 5U63A 3QFBA 1RP0A 3VRBA 2YG6A 4Y4MA 3AE4A 2CDUA 4JY3A 4ZCCA 3VR9A 1LTXR 3GDNA 1H7WA 1COYA 3V3OA 3UP4A 3F8DA 2C76A 4WCTA 4Z2UA 5BVAA 1MO9A 2WOVA 4K8DA 1M64A 4FDCB 1PBCA 1RSGA 4H2RA 3G5SA 4O5UA 4U2TA 3CPHG 1N1PA 1VDCA 3AE1A 3E1TA 3AYJA 3GYIA 1UKVG 2X8GA 2WU2A 4X9NA 2GQFA 2GVCA 2V60A 2WP9A 2EQ8A 1PXBA 2H88A 4ICYA 4U8IA 3GWDA 1XDIA 3REDA 4CY8A 1X31B 1YKJA 2XFNA 4BK1A 5L46A 4J31A 2WOWA 3VRDB 2BA9A 2DKHA 3GRSA 4CBQA 4YSHA 1F3PA 2Q0LA 1O5WA 4RG3A 1FECA 2YVJA 1TDNA 2VZ2A 3NGCX 1VG9A 4K5RA 4OPTA 1M6IA 1L9EA 1PN0A 1BF3A 3I6DA 3ZYXA 5BULA 1Y0PA 3M13A 1OJAA 2B76A 3AE7A 5HY5A 2AR8A 3CPIG 4B68A 2H89A 1GALA 1TYTA 3QSEA 3QSSA 2GAGB 3P4SA 2GAHB 3SGLA 4JQ9A 4K7ZA 4H2PA 4YT0A 2R46A 3ATRA 4EQXA 3AWIA 4K22A 3P9UA 3RP8A 2O9ZA 3OZ2A 4AP1A 4AOSA 1H81A 1DOCA 1Q1WA 2WBAA 1MXTA 2B9WA 2B7RA 1YQ4A 5TR3A 4EQWA 3KKJA 2JB1A 4X9MA 2BCPA 1NG4A 5J7XA 2WDQA 3G5RA 3COXA 3NKSA 1CBOA 2ZBWA 1IUXA 4NTCA 2C65A 2Q0KA 1F8SA 2JBVA 2BXSA 4J34A 1NG3A 4J33A 4H4QA 1DOEA 3DMEA 3AYIA 3GMCA 3UTGA 1E6EA 1VRQB 2C75A 4A79A 5KRQA 3GMBA 4H50A 3QSMA 2YG7A 1FEBA 2XVJA 4GRTA 4B69A 1H6VA 5KOWA 3UCLA 2AAQA 2QCUA 4GDPA 2HQMA 1ELIA 3UKHA 5HYMA 5C3JA 2ARDA 4H4ZA 3CGEA 1D4CA 4A9WA 2EQ9A 2YLXA 4TLXA 2FJAA 3RP7A 1LPFA 2WP5A 2B9XA 2V61A 3AEGA 1GERA 3M12A 1NEKA 1GRFA 1CJ4A 1EL8A 1Q9IA 1GRGA 1JRXA 1GOSA 1VG0A 4J36A 2B9YA 4BK3A 1AOGA 3JSKA 1GESA 1NHSA 2ZZBA 2XFQA 3AD7B 3OC4A 4FK1A 3QVRA 3NK0X 3V76A 1YQ3A 2DKIA 4EMJA 1FL2A 5BUKA 2A8XA 5ER0A 2GEWA 2FJBA 2GH5A 1S2YA 4AT2A 1JRZA 1D5TA 1PBBA 2GMJA 2OALA 4N9XA 4ZN0A 3NK2X 2RGOA 4U8LA 1IUVA 5EOWA 2JB2A 5CKUA 4OPDA 3AE9A 2GQWA 4JDRA 1E1MA 2OLNA 2X8HA 3QVPA 2FBWA 2BYBA 4RG4A 1GRHA 4UP3A 1DJQA 1L9CA 2J3NA 2OA1A 2BABA 4Z2TA 3R9UA 3AE5A 1GREA 2V6OA 4I58A 1O95A 1PDHA 1GV4A 5KVIA 2WESA 3GYJA 3M0OA 2W0HA 3NH3X 1F8RA 2CULA 4H4YA 3NYCA 1YQZA 4IA5A 5CQFA 5M10A 3DGZA 3DJJA 1S3BA 4OCGA 1E1LA 3UOZA 1ZX9A 3BNUA 2CFYA 4EQRA 5M0ZA 4BURA 1L9DA 3RP6A 1CJ3A 5JCIA 1IUWA 4NZHA 4U8JA 5C2TA 2EQ6A 3GD3A 4M52A 1XANA 4NEVA 1JNRA 1GTHA 1D4DA 2BS4A 1KDGA 3K7MX 4IV9A 2R4EA 4B65A 2FJEA 1EL9A 2YLRA 4C74A 3AB1A 4Z24A 4YTNA 2VRMA 3IHMA 1CL0A 3FIMB 2GMHA 5HXIA 2RABA 2IIDA 3DJEA 3DJGX 1NAAA 3CGCA 1D4EA 1PJ5A 3AECA 3NNEA 3UKLA 1FCDA 2GV8A 5IPYA 1HYUA 3PO7A 2XLRA 4EIQA 3GSIA 2RGHA 3BI4A 2GF3A 4A65A 4CY6A 4TM3A 3H8LA 1KFYA 1OJDA 1S3EA 2XFUA 1DODA 2GR3A 4C3XA 4UDRA 2XFOA 3KA7A 2V3BA 4PABA 1L0VA 4CNJA 5EB5A 1DOBA 2WPFA 2QA1A 4OPLA 3KD9A 3AE8A 3EAOA 4IA6A 4FX9A 4EMWA 1ZDLA 3ICRA 1E1KA 2CVJA 2EQ7A 1XPQA 2YM2A 2GB0A 4Z2RA 3UKQA 3DK8A 3ADAB 1JRYA 1P2EA 4U8MA 4CCQA 4U8PA 3AEAA 1N4WA 2YR4A 1IUSA 3EANA 4DNAA 1EL5A 3F8RA 3UTHA 3ZDNA 3VQRA 2WU5A 1PXCA
chains in the Genus database with same CATH superfamily
2IVEA 3S5WA 3T37A 3QJ4A 1NHPA 3TCSA 2VVMA 4GDEA 3ICSA 2VQ7A 3NYEA 3U4FA 1DNCA 1OJTA 4Z25A 2BACA 2C73A 3DGHA 1TYPA 1ONEA 3NIXA 1KN0A 4TM0A 3ITJA 1N63C 4B1BA 4IVMB 2BK3A 2W3RA 2BXRA 4DWDA 2XYOA 4AP3A 2FJDA 2UZZA 5GSNA 4DSGA 1GRTA 1OEPA 4B66A 3P4RA 1N60C 3RHAA 3LZXA 2ONEA 3DA1A 4ZCDA 2WP6A 4NNJA 3O0HA 3CMMA 4Z44A 4H4XA 3CK5A 3DGBA 4EM4A 3AE6A 1NENA 4EM3A 3FXGA 3FCPA 2OPJA 3DK9A 3PFRA 4H2HA 3CNJA 1LQTA 1B37A 4DSHA 1K0JA 1N4VA 3ABVA 3KPFA 3D46A 2AQJA 4IZGA 1Y56A 4DXKA 3SN1A 1GNDA 1TDFA 1F8WA 5LV9A 2AL2B 1BWCA 1CC4A 4Y4NA 4GIRA 1PS9A 4JN9A 2BS3A 3I4KA 1FEAA 2OG9A 2YG5A 1L8PA 4NEWA 2R0CA 1DXLA 2QA2A 3T0KA 1ZMDA 3P4PA 1K4QA 1JEHA 3HYXA 3AMZA 4E5TA 4J57A 1RVKA 3PK7A 5HHFA 3TOYA 3IC9A 5KOXA 1FOHA 2HXTA 1F6MA 4II3A 3T2ZA 2JAEA 1GSNA 4IHCA 3CTYA 4NTEA 3OW1A 4E0VA 5IQ4A 3MKCA 3NZGA 4H4PA 3MZNA 3T8QA 2F5ZA 1MOKA 3NXLA 4M6UA 1Q1RA 4P9SA 3Q9TA 1CC2A 4GCMA 1GRBA 1GETA 4HYRA 3HPFA 2V5ZA 4BJZA 4TVYA 5U25A 3OZYA 3N4EA 5U1OA 4B64A 4BV6A 3CXOA 2C66A 3MY9A 3B6DA 4H2QA 2X50A 2I5QA 3URHA 3CT2A 2PHHA 5FS7A 4D04A 1EBGA 4CRTA 3TTEA 3DIPA 1LJ1A 3AE3A 2Y6QA 3UTEA 1BGJA 4USQA 4K1WA 2BCGG 4EIPA 5FJPA 4BJYA 3UJSA 3ISHA 4Y4MA 3AE4A 4ZCCA 3VR9A 4ZOHB 1H7WA 1COYA 3F8DA 4II2A 1RSGA 1PBCA 4U2TA 2OFJA 3E1TA 3AYJA 2NQLA 1P43A 2GVCA 3NS1B 2WP9A 1XDIA 4CY8A 5L46A 4IL2A 3P0WA 3VRDB 2DKHA 1F3PA 3SZ0A 1FECA 3ZVHA 4JN7A 1TDNA 2VZ2A 3NGCX 1PN0A 1Y0PA 4HCHA 3GO2A 3IJQA 1GALA 3QSEA 1EBHA 2GAGB 4K7ZA 4H2PA 2R46A 2B9WA 2PCEA 3V4BA 4KPLA 3SN4A 4EQWA 3H70A 3A7RA 3R10A 5J7XA 2FYMA 2OLAA 1CBOA 3R07C 1IUXA 4NTCA 1NG3A 4J33A 3K1GA 5KRQA 2YG7A 1FEBA 5KOWA 2PTYA 5G5GB 5C3JA 4H4ZA 1D4CA 3QTPA 3DG3A 2B9XA 1EL8A 1JRXA 1AOGA 3JSKA 4G6HA 3AD7B 1KKRA 5ER0A 1D5TA 4N9XA 3NK2X 4RG4A 2FBWA 1GRHA 3SYIA 2OA1A 2HXUA 1GREA 1O95A 1F8RA 2CULA 2GSHA 4IA5A 5M10A 3ES7A 5M0ZA 3GD3A 2PA6A 1D4DA 1KDGA 2XSXA 4E4UA 2FJEA 1EL9A 3I6EA 3UJ2A 4H1ZA 2VRMA 1DTNA 5HXIA 3VA8A 1PJ5A 3AECA 3NNEA 3V3WA 2GF3A 3I6TA 1JCTA 1TE6A 3VCNA 2GGIA 2XFOA 3KA7A 4CNJA 2PTXA 5EB5A 3SJNA 3KD9A 4FX9A 3CAWA 3T6CA 3ADAB 1N4WA 1IUSA 3EANA 1PDZA 3UTHA 3VQRA 2WU5A 1PXCA 3DFHA 4TLZA 4MJWA 2JKCA 4X4JA 3THUA 3CNSA 3LZWA 2YWLA 1EBDA 4G74A 3SZCA 3UKPA 2XGZA 2X99A 1E1NA 3NG7X 2V3AA 3UOXA 1IJHA 3AE2A 3KVEA 4AT0A 3FYYA 3V5FA 3ATQA 2E3TA 2XVEA 3C4NA 2A89A 2QAEA 1VDVA 2XVIA 1OJ9A 3NYFA 1GXFA 4HNLA 3H8AA 1D7YA 3D8XA 4JY2A 2WS3A 2WDVA 1IYXA 2TPRA 3L8KA 4DYEA 3R11A 3ES8A 1VQWA 2POZA 2YLZA 4H4TA 1IUUA 3C4AA 3Q4DA 3NTAA 5JCMA 3UTFA 3LJPA 1H7XA 4GAPA 2BS2A 1CHUA 3IJLA 3TWAA 3VCCA 1JU2A 1JRPA 3KLJA 3EEZA 3UOYA 1CJCA 4GYPC 2R0PA 3UKAA 3C96A 3CN8A 3AYLA 2PP3A 3SX6A 1NHQA 1QO8A 2I0ZA 2YM1A 1FHUA 3AEDA 1LVLA 1PBDA 2OKTA 3Q6JA 1GRAA 2PGEA 1SJCA 3TW9A 1E39A 1TDKA 2OQYA 3NK1X 2ZADA 4A7AA 3UKFA 1GPEA 3SM8A 1MUCA 2XFPA 1P2HA 1B8SA 3IF9A 1BZLA 4U8OA 3D1CA 4HCDA 2YR5A 5KMQA 1W6TA 2GR2A 3DESA 4YWSA 2OLOA 1XHCA 2WETA 3VFCA 4U8NA 1EC9A 4HA6A 3AEEA 5FS6A 1B5QA 4A5LA 4U2LA 1BKWA 3NT6A 1R6WA 1PXAA 3DFYA 3AD9B 1WUFA 4JN8A 2C3DA 4H4VA 3MQTA 2WHDA 2YVFA 3V3NA 2WPCA 4YXDA 1PBEA 3NHOX 3EPTA 2XH0A 5FMHA 1TDOA 3D47A 4YSZA 1K0LA 4HCLA 3CGDA 3RNMA 4A6NA 1E7PA 3NN0X 4UDPA 1LV0A 2VVLG 3PG6A 2BC0A 4IVOB 1DJNA 3DK4A 4EWJA 3RGTA 3KU9A 2RGJA 2XDOA 2PU1A 2B7SA 1TDEA 4HNCA 1RM6B 3OZMA 2XVHA 1RYIA 4FK1C 4YTPA 4H4SA 1N5WC 3T31A 1JROA 2WDRA 3U9IA 3VRBA 3V3OA 4Z2UA 4A35A 2C76A 5BVAA 4H2RA 3IK4A 3GY1A 3UJRA 3CPHG 3AE1A 3A7UA 1V97A 2WU2A 2GQFA 2V60A 3P3BA 2H88A 4U8IA 4J31A 3N6JA 2WOWA 4YSHA 2PS2A 3S5SA 1VG9A 4DX3A 3ZYXA 3S47A 2B76A 5HY5A 1TYTA 4A3RA 3L5OA 5FJUA 3P4SA 2OZ3A 2GAHB 4JQ9A 1NELA 1XPYA 3ATRA 3KPKA 4K22A 3P9UA 3RP8A 3OZ2A 5KMSA 1MXTA 4KWSA 2JB1A 4X9MA 1ECQA 2HZGA 2C65A 2JBVA 2BXSA 3DMEA 3AYIA 1VRQB 4A79A 3GMBA 4H50A 3QSMA 4GRTA 4B69A 4G6GA 3UCLA 2AAQA 2QCUA 2ARDA 3DDMA 3RP7A 2WP5A 2V61A 3AEGA 3OPSA 1Q9IA 1FFUC 1GOSA 1VG0A 2B9YA 2ZZBA 3NK0X 3V76A 2DKIA 2E5AA 2FJBA 2GH5A 2GMJA 2OALA 1IUVA 5CKUA 4OPDA 2OLNA 2BYBA 1L9CA 2J3NA 3AE5A 4HN8A 2WESA 3GYJA 4H4YA 5CQFA 3DGZA 3DJJA 1S3BA 2GL5A 4OCGA 3STPA 4IP5A 3BNUA 1X2GA 1CJ3A 1IUWA 2EQ6A 1XANA 3RITA 3K7MX 4IV9A 4B65A 1T3QC 4C74A 1SB3B 3D9XA 3IHMA 2PP0A 1VQZA 2AKMA 3AM9A 4HPNA 2RABA 2XH4A 3CGCA 1D4EA 3UKLA 1FCDA 3IJIA 5IPYA 4EIQA 2RGHA 4CY6A 1S3EA 3PWGA 4Z17A 4PABA 1DOBA 4G9KA 2QA1A 2FKPA 3AE8A 3EAOA 1FIQB 1ZDLA 3ICRA 2XH2A 1XPQA 1MDLA 6ENLA 2GB0A 3FVDA 3ZLGA 1P2EA 4U8MA 4U8PA 3AEAA 4DNAA 4AOXA 3T2YA 3AEFA 3SXIA 4H2NA 1NU5A 5KXJA 3VDGA 2WQYA 1ZK7A 2WEUA 4LIIA 1OJCA 3CGBA 1GEUA 3R0UA 2GR0A 4E4FA 2C64A 2C72A 1V59A 3H4KA 4LA1A 4EMIA 2OX4A 1W4XA 1Y56B 3EKGA 4O5QA 3NVWB 3ENLA 3NO1A 2NVKX 3OP2A 3CNTA 4ROPA 3BNMA 3HW2A 3UP5A 3ALLA 4B67A 3ALMA 2PMQA 1EC7A 3T9PA 5FJRA 4APNA 4X2PA 3ALJA 5BOEA 3UGVA 1QLBA 3LXDA 3NN6X 2WOIA 3NVVB 1JPMA 3GD6A 4YTMA 1B4VA 4MKSA 1CF3A 2C70A 5FS9A 3H8IA 4XWRA 3K7TA 2GR1A 4GYPA 1SJDA 2X8CA 2OZTA 4C77A 1NHRA 1ELSA 3NRNA 3SQPA 5JCLA 1ZP0A 4OPCA 1BGNA 4K5SA 4Z43A 3FBSA 2YLWA 2XLSA 2VVLA 3FMWA 3P1WA 5GRTA 1PDYA 4GF7A 3BSMA 2R9ZA 2XLPA 2ACZA 1NDAA 1REOA 2YAUA 2DW6A 1FO4A 3RO6A 4GGHA 3BHKA 2HNEA 1ZOYA 2XVFA 3EUB3 1NPXA 1KCZA 2YLTA 3R0KA 2BC1A 7ENLA 3H12A 4JNQA 3DG6A 2NPXA 1BKHA 2CHRA 3ZLFA 3L1RA 2P3ZA 4GR1A 3UOVA 5KVHA 4TM1A 1MRAA 4ZA0A 4REKA 4PAAA 1D7LA 2GGJA 5EU9A 2APGA 2AL2A 2QJJA 1K0IA 3T14A 4G73A 4YKFA 1H84A 1IUTA 3CYJA 2YG4A 4CCRA 2JK6A 1CC6A 5J60A 4H4RA 3UJEA 1JNZA 1H82A 3NVZB 2ZC8A 1ONFA 3PWIA 3I3LA 1LQUA 3ZVHB 2YG3A 3DH9A 4KEMA 2OZ8A 2C67A 4CNKA 1EC8A 1SEZA 1ZXIC 4RSLA 4A99A 4B63A 2E4GA 1PJ7A 3SFEA 4H83A 4OPUA 2VOUA 2OVLA 4A6GA 2XCGA 3GD4A 2PGWA 3VC6A 3IWAA 3P4QA 1F9CA 2GGEA 3UXLA 2E1MA 1WYGA 5IQ1A 4JY3A 2CDUA 3HYWA 3NVYB 3GDNA 5KMRA 1MO9A 3MUCA 4FDCB 4E8GA 3G5SA 1N1PA 1VDCA 3GYIA 1UKVG 2X8GA 4X9NA 1PXBA 3GWDA 3REDA 1X31B 4BK1A 1WUEA 2BA9A 3GRSA 4CBQA 3TJ4A 1TKKA 3SZWA 4K5RA 5BULA 1BF3A 3M13A 3AE7A 2AR8A 4B68A 2H89A 5FJTA 4K8GA 3QSSA 3SGLA 3RCYA 3SZFA 4MGGA 4GFIA 2QDDA 4YT0A 4GISA 4EQXA 2O9ZA 4AP1A 3QKEA 4AOSA 1DOCA 4J1OA 1H81A 2WBAA 2B7RA 4Z1YA 1YQ4A 3KKJA 1X2HA 1NG4A 2WDQA 3NKSA 2ZBWA 2GGHA 2Q0KA 1F8SA 1DOEA 3SR6B 3UTGA 2XVJA 1H6VA 4GDPA 1ELIA 3HRDC 2OQHA 2FJAA 1LPFA 2P8BA 3M12A 1GERA 1CJ4A 1KKOA 4BK3A 1GRGA 1GESA 1NHSA 3QVRA 2MNRA 4EMJA 3RR1A 2GEWA 1S2YA 1BQGA 4ZN0A 2W54A 2X8HA 4UP3A 4Z2TA 3R9UA 2V6OA 4I58A 1GV4A 3M0OA 2W0HA 3NYCA 1YQZA 5J04A 1E1LA 1ZX9A 4BURA 3QLDA 4U8JA 4M52A 4NEVA 1GTHA 2R4EA 2YLRA 2C4CA 3AB1A 4Z24A 3FIMB 2GMHA 3DJEA 3DJGX 1NAAA 2GV8A 3PO7A 2XLRA 3B97A 4A65A 4FI4A 3H8LA 2XFUA 1DODA 4C3XA 2V3BA 1L0VA 1E1KA 2DW7A 3SQSA 3ETRB 3JW7A 2W3SA 3TJIA 3UKQA 4CCQA 3AN1A 2YR4A 1EL5A 3DEQA 2P88A 5DBJA 3CIRA 4UDQA 2R0GA 3IHGA 4G7FA 4U2SA 3QN3A 3VC5A 1KNPA 3UCCA 4NWZA 4C5OA 5KNLA 4YKGA 2Q6UA 3LADA 3BI2A 3SY4A 5IDZA 5KWFA 1KSSA 2X3NA 1PHHA 4Y4LA 3NTDA 1STZA 4NTDA 1SJBA 3FG2P 1KSUA 4YSXA 3NLCA 4C3YA 2QJNA 2P8CA 2E5VA 3PS9A 3FPZA 4IT1A 3VR8A 3EF6A 5EB4A 3K7QX 4H4WA 2PU0A 1ZMCA 1JOAA 2YLSA 3DG7A 2OAMA 3NRZB 1GTEA 2Z5XA 4J3ZA 1FFVC 2ZZ0A 4Z26A 1N62C 3AEBA 1Z6LA 1CJ2A 4K2SA 3GC2A 2GDQA 4K2XA 1GT8A 2PYXA 2Y6RA 4M0XA 4IL0A 3K30A 2R45A 4HB9A 3ICTA 3WE0A 3GRTA 2A87A 2PPGA 3MSYA 3TWBA 1S2QA 2JB3A 4YWOA 1YEYA 4TM4A 4OPGA 3V5CA 3AXBA 1R0MA 1N4UA 1KNRA 3BHFA 3HZLA 4USRA 4EQSA 1EL7A 1H83A 3BOXA 2TMDA 3AD8B 3HYVA 2YQUA 3GDPA 3ZLHA 2PODA 3B3RA 3DJDA 3S61A 3LB8A 4A6NB 4OVIA 3CNDA 2R4JA 5EBKA 1MDRA 3QPEA 4H4UA 2PTZA 1PJ6A 2RDXA 2IVDA 4U8KA 2GRTA 1O94A 4D03A 4XWZA 1ZY8A 4XXGA 3QFAA 2XLTA 3VRAA 4JNAA 3BI5A 3CPJG 3UKKA 1TRBA 3PVCA 1P48A 3Q45A 4ADWA 4I59A 3B9JB 5JCKA 4J56A 2VRLA 4OPIA 3G5QA 2Q7VA 1YY5A 4G8TA 3OTRA 4BK2A 5FS8A 1QJDA 2C7GA 1ZOVA 3CNPA 4KX6A 4KPRA 2XLUA 4LU6A 3CXBA 2BK4A 1ZKQA 4WX1A 2OO6A 5BRTA 3R1ZA 2C3CA 3TQPA 4DGKA 2YVGA 3ZVIA 5JRBA 1KF6A 2AL1A 3F8PA 3UJFA 3II4A 1N5XA 1E9IA 3MWCA 4H7UA 4J2WA 4ECHA 2Z5YA 4YSYA 2VQBA 1H86A 1PBFA 2BK5A 3GWFA 4FP1A 4GMEA 1JPDX 3LOVA 4GUVA 3SFDA 2YR6A 2WPEA 5JCNA 2ZZCA 1N61C 5U63A 3QFBA 1RP0A 4DN1A 2YG6A 1LTXR 3UP4A 4WCTA 2WOVA 3JZUA 4K8DA 1M64A 4O5UA 4ENLA 5BOFA 1H2IA 5G5HB 2EQ8A 2P0IA 4ICYA 2W55A 1YKJA 2XFNA 2PSNA 3RRAA 3A7AA 2AKZA 5ENLA 4GAVA 4ZCWA 4KT2A 2Q0LA 1O5WA 4RG3A 3FJ4A 2YVJA 4OPTA 1M6IA 1L9EA 3I6DA 1OJAA 1FHVA 3CPIG 5FJOA 3P93A 2BRYA 3DERA 3AWIA 2GGGA 1Q1WA 1KD0A 3JVAA 3CB3A 3R25A 5TR3A 2BCPA 3G5RA 3COXA 3UCDA 4J34A 2QGYA 4H4QA 2PTWA 3GMCA 1E6EA 2C75A 3SN0A 4H19A 2HQMA 3UKHA 3N4FA 1JDFA 5HYMA 1XS2A 3CGEA 4A9WA 2EQ9A 2YLXA 4TLXA 2PP1A 4JHMA 1NEKA 1GRFA 4J36A 2MUCA 2XFQA 3OC4A 4FK1A 1YQ3A 1FL2A 5BUKA 2A8XA 1MNSA 3FV9A 2BRAA 4AT2A 1JRZA 1PBBA 2RGOA 4U8LA 5EOWA 2JB2A 3AE9A 2GQWA 4JDRA 1E1MA 3QVPA 4F4RA 4IP4A 1DJQA 1S7MA 2BABA 1PDHA 2QQ6A 5KVIA 1SJAA 3NH3X 4TVWA 3SSZA 3UOZA 2CFYA 4EQRA 2XH7A 1L9DA 3RP6A 5JCIA 4NZHA 5C2TA 4E6MA 1JNRA 2BS4A 3H7VA 2QVHA 2O56A 5KMPA 4YTNA 3GYXA 1CL0A 4DHGA 2IIDA 3UXKA 1HYUA 2QJMA 4MMWA 3GSIA 3BI4A 2QDEA 3NFUA 4GGBA 4TM3A 1KFYA 1OJDA 2GR3A 3SBFA 4UDRA 4OPLA 2WPFA 4IA6A 4EMWA 1TZZA 2CVJA 3N6HA 2EQ7A 2YM2A 3BJSA 3T2KA 4Z2RA 3KUMA 3T4WA 3DK8A 1JRYA 3F8RA 3ZDNA
chains in the Genus database with same CATH topology
5DBJA 4AOXA 3CIRA 2IVEA 4TLZA 3T2YA 4MJWA 4UDQA 2JKCA 3AEFA 3S5WA 3T37A 3SXIA 4H2NA 2R0GA 3IHGA 4U2SA 3QJ4A 1NHPA 1KNPA 5KXJA 2WQYA 1ZK7A 4X4JA 2WEUA 2VVMA 3CNSA 4GDEA 4NWZA 3ICSA 4C5OA 5KNLA 4YKGA 2Q6UA 3LADA 2VQ7A 4LIIA 3LZWA 3NYEA 3BI2A 2YWLA 1OJCA 3SY4A 1EBDA 3CGBA 4G74A 3SZCA 1DNCA 1GEUA 2GR0A 1OJTA 3UKPA 2BACA 4Z25A 2C64A 5KWFA 2C72A 1V59A 2C73A 1KSSA 3DGHA 1TYPA 2X3NA 3H4KA 1PHHA 2X99A 4LA1A 4EMIA 4Y4LA 3NTDA 3NIXA 1KN0A 1E1NA 1W4XA 1Y56B 3NG7X 4TM0A 3ITJA 4NTDA 4O5QA 2V3AA 3UOXA 4B1BA 1IJHA 3AE2A 3KVEA 4IVMB 4AT0A 2NVKX 3FG2P 2BK3A 1KSUA 3ATQA 3NLCA 4C3YA 2E5VA 3CNTA 4YSXA 3PS9A 2BXRA 3BNMA 2XVEA 2XYOA 3UP5A 3FPZA 3ALLA 3C4NA 3VR8A 4AP3A 4B67A 2FJDA 2A89A 3EF6A 5EB4A 3ALMA 3K7QX 2UZZA 5GSNA 4DSGA 2QAEA 4H4WA 1GRTA 4B66A 4APNA 1ZMCA 1JOAA 2YLSA 3P4RA 2XVIA 1OJ9A 3ALJA 3NYFA 1GXFA 2OAMA 1GTEA 3RHAA 3LZXA 2Z5XA 1QLBA 1D7YA 3LXDA 3D8XA 3NN6X 3DA1A 2WOIA 2WS3A 4JY2A 2WDVA 2TPRA 3L8KA 4ZCDA 2WP6A 4NNJA 2ZZ0A 4YTMA 4Z26A 3AEBA 3O0HA 3CMMA 4Z44A 1B4VA 4H4XA 4EM4A 1Z6LA 1CJ2A 1VQWA 2YLZA 1CF3A 3AE6A 4H4TA 1IUUA 5FS9A 2C70A 3C4AA 3H8IA 4XWRA 3K7TA 2GR1A 1NENA 3NTAA 1GT8A 2PYXA 4EM3A 2Y6RA 2X8CA 5JCMA 4K2XA 3UTFA 3LJPA 3K30A 4C77A 1H7XA 4GAPA 1NHRA 3NRNA 3DK9A 2BS2A 2R45A 4HB9A 3CNJA 3SQPA 5JCLA 3ICTA 1LQTA 1B37A 3WE0A 4DSHA 1K0JA 1CHUA 1N4VA 3GRTA 1ZP0A 2A87A 3ABVA 3KPFA 4OPCA 2AQJA 1S2QA 1BGNA 1JU2A 1Y56A 1GNDA 4K5SA 3FBSA 4Z43A 2JB3A 4YWOA 4TM4A 3KLJA 4OPGA 2YLWA 3AXBA 1TDFA 3UOYA 1N4UA 2XLSA 1KNRA 1F8WA 2VVLA 3BHFA 1CJCA 3FMWA 3P1WA 5GRTA 5LV9A 2R0PA 1BWCA 4GF7A 3HZLA 4USRA 3UKAA 4EQSA 1EL7A 1CC4A 3C96A 3CN8A 1H83A 3AYLA 4Y4NA 1PS9A 3SX6A 4JN9A 2BS3A 1NHQA 2R9ZA 1QO8A 2XLPA 1FEAA 2I0ZA 2ACZA 2TMDA 3AD8B 2YM1A 3HYVA 2YG5A 2YQUA 3AEDA 4NEWA 3GDPA 1NDAA 1LVLA 1PBDA 3Q6JA 2R0CA 1REOA 1DXLA 1GRAA 2YAUA 2QA2A 3B3RA 3T0KA 1ZMDA 3DJDA 1E39A 3S61A 1TDKA 3LB8A 4A6NB 3NK1X 4OVIA 3P4PA 3CNDA 1K4QA 2R4JA 5EBKA 1JEHA 3HYXA 3UKFA 4A7AA 1GPEA 3SM8A 2XFPA 1P2HA 4H4UA 1B8SA 1PJ6A 3BHKA 3IF9A 2IVDA 1ZOYA 1BZLA 4J57A 2XVFA 3D1CA 4U8KA 4U8OA 2YR5A 5KMQA 1NPXA 2GRTA 1O94A 4D03A 2YLTA 2GR2A 4XWZA 1ZY8A 4XXGA 3QFAA 2OLOA 2XLTA 2BC1A 5HHFA 3IC9A 1XHCA 2WETA 3VRAA 1FOHA 5KOXA 4U8NA 4HA6A 1F6MA 4II3A 3AEEA 3BI5A 4JNAA 4JNQA 3T2ZA 3CPJG 5FS6A 3UKKA 2JAEA 1GSNA 1TRBA 1B5QA 3PVCA 4I59A 4ADWA 2NPXA 3CTYA 4A5LA 4NTEA 4E0VA 5IQ4A 3L1RA 4GR1A 3UOVA 4H4PA 4U2LA 5JCKA 5KVHA 4J56A 2VRLA 4OPIA 4TM1A 1BKWA 3G5QA 3NT6A 4REKA 2Q7VA 1YY5A 2F5ZA 1PXAA 1MOKA 4PAAA 1D7LA 3AD9B 4BK2A 2C3DA 2APGA 1Q1RA 4H4VA 4P9SA 3Q9TA 1CC2A 4GCMA 1GRBA 1K0IA 3T14A 5FS8A 2WHDA 1QJDA 2YVFA 1GETA 4G73A 2WPCA 2V5ZA 4YKFA 3V3NA 4BJZA 1H84A 1IUTA 4YXDA 1PBEA 5U25A 2C7GA 3NHOX 2YG4A 4CCRA 3EPTA 5U1OA 2JK6A 1ZOVA 5FMHA 1CC6A 1TDOA 5J60A 3CNPA 4KX6A 4KPRA 2XLUA 4YSZA 4LU6A 1K0LA 4H4RA 2BK4A 1ZKQA 4B64A 4WX1A 4BV6A 5BRTA 1JNZA 3CGDA 3RNMA 4A6NA 2C3CA 1H82A 1E7PA 4DGKA 3NN0X 2YVGA 4UDPA 5JRBA 1KF6A 1ONFA 1LV0A 2C66A 2VVLG 3I3LA 3PG6A 2BC0A 1LQUA 2YG3A 3B6DA 3DH9A 3F8PA 4H2QA 2X50A 1DJNA 2C67A 4IVOB 3URHA 4CNKA 3II4A 3DK4A 1SEZA 2PHHA 4RSLA 4A99A 4B63A 5FS7A 2E4GA 1PJ7A 4H7UA 4J2WA 3SFEA 4D04A 4ECHA 4CRTA 3KU9A 4OPUA 2RGJA 2Z5YA 4YSYA 2VOUA 2XDOA 2VQBA 1H86A 2B7SA 1LJ1A 1TDEA 1PBFA 3AE3A 2BK5A 2XCGA 2Y6QA 3UTEA 2XVHA 1RYIA 3GD4A 4FK1C 1BGJA 3GWFA 3IWAA 4USQA 3P4QA 4YTPA 4H4SA 2BCGG 3LOVA 3T31A 4GUVA 4EIPA 3SFDA 2YR6A 2E1MA 2WPEA 4BJYA 5JCNA 2WDRA 2ZZCA 3ISHA 5IQ1A 5U63A 3QFBA 1RP0A 3VRBA 2YG6A 4Y4MA 3AE4A 2CDUA 4JY3A 4ZCCA 3VR9A 1LTXR 3HYWA 3GDNA 1H7WA 1COYA 3V3OA 3UP4A 3F8DA 2C76A 4WCTA 4Z2UA 5BVAA 5KMRA 1MO9A 4II2A 2WOVA 4K8DA 1M64A 4FDCB 1PBCA 1RSGA 4H2RA 3G5SA 4O5UA 1H2IA 4U2TA 3CPHG 1N1PA 1VDCA 3AE1A 3E1TA 3AYJA 3GYIA 1UKVG 2X8GA 2WU2A 4X9NA 2GQFA 2GVCA 2V60A 2WP9A 2EQ8A 1PXBA 2H88A 4ICYA 4U8IA 3GWDA 1XDIA 3REDA 4CY8A 1X31B 1YKJA 2XFNA 4BK1A 5L46A 4J31A 2WOWA 3VRDB 2BA9A 2DKHA 3GRSA 4GAVA 4CBQA 4YSHA 1F3PA 2Q0LA 1O5WA 3SZ0A 4RG3A 1FECA 3SZWA 2YVJA 1TDNA 2VZ2A 3NGCX 1VG9A 4K5RA 4OPTA 1M6IA 1L9EA 1PN0A 1BF3A 3I6DA 3ZYXA 5BULA 1Y0PA 3M13A 1OJAA 2B76A 3AE7A 5HY5A 2AR8A 3CPIG 4B68A 2H89A 1GALA 1TYTA 3QSEA 3L5OA 3QSSA 2GAGB 3P4SA 2GAHB 3SGLA 4JQ9A 4K7ZA 3SZFA 2BRYA 4H2PA 4YT0A 2R46A 3ATRA 4EQXA 3KPKA 3AWIA 4K22A 3P9UA 3RP8A 2O9ZA 3OZ2A 4AP1A 4AOSA 5KMSA 1H81A 1DOCA 1Q1WA 2WBAA 1MXTA 2B9WA 2B7RA 1YQ4A 5TR3A 4EQWA 3KKJA 2JB1A 4X9MA 2BCPA 1NG4A 5J7XA 2WDQA 3G5RA 3COXA 3NKSA 1CBOA 2ZBWA 1IUXA 4NTCA 2C65A 2Q0KA 1F8SA 2JBVA 2BXSA 4J34A 1NG3A 4J33A 4H4QA 1DOEA 3DMEA 3AYIA 3GMCA 3UTGA 1E6EA 1VRQB 2C75A 4A79A 5KRQA 3GMBA 4H50A 3QSMA 2YG7A 1FEBA 2XVJA 4GRTA 4B69A 1H6VA 4G6GA 5KOWA 3UCLA 2AAQA 2QCUA 4GDPA 2HQMA 1ELIA 3UKHA 5HYMA 5C3JA 2ARDA 4H4ZA 3CGEA 1D4CA 4A9WA 2EQ9A 2YLXA 4TLXA 2FJAA 3RP7A 1LPFA 2WP5A 2B9XA 2V61A 3AEGA 1GERA 3M12A 1NEKA 1GRFA 1CJ4A 1EL8A 1Q9IA 1GRGA 1JRXA 1GOSA 1VG0A 4J36A 2B9YA 4BK3A 1AOGA 3JSKA 4G6HA 1GESA 1NHSA 2ZZBA 2XFQA 3AD7B 3OC4A 4FK1A 3QVRA 3NK0X 3V76A 1YQ3A 2DKIA 4EMJA 1FL2A 5BUKA 2A8XA 5ER0A 2GEWA 2FJBA 2GH5A 1S2YA 2BRAA 4AT2A 1JRZA 1D5TA 1PBBA 2GMJA 2OALA 4N9XA 4ZN0A 3NK2X 2RGOA 4U8LA 1IUVA 5EOWA 2JB2A 5CKUA 4OPDA 3AE9A 2GQWA 4JDRA 1E1MA 2OLNA 2X8HA 3QVPA 2FBWA 2BYBA 4RG4A 1GRHA 3SYIA 4UP3A 1DJQA 1L9CA 2J3NA 1S7MA 2BABA 2OA1A 4Z2TA 3R9UA 3AE5A 1GREA 2V6OA 4I58A 1O95A 1PDHA 1GV4A 5KVIA 2WESA 3GYJA 3M0OA 2W0HA 3NH3X 1F8RA 2CULA 4H4YA 3NYCA 1YQZA 4IA5A 5CQFA 5M10A 3DGZA 3DJJA 1S3BA 4OCGA 1E1LA 3UOZA 1ZX9A 3BNUA 2CFYA 4EQRA 5M0ZA 4BURA 1L9DA 3RP6A 1CJ3A 5JCIA 1IUWA 4NZHA 4U8JA 5C2TA 2EQ6A 3GD3A 4M52A 1XANA 4NEVA 1JNRA 1GTHA 1D4DA 2BS4A 1KDGA 3K7MX 4IV9A 2R4EA 4B65A 2FJEA 1EL9A 2YLRA 4C74A 2C4CA 3AB1A 4Z24A 5KMPA 4YTNA 3D9XA 2VRMA 3GYXA 3IHMA 1CL0A 3FIMB 2GMHA 5HXIA 2RABA 2IIDA 3DJEA 3DJGX 1NAAA 3CGCA 1D4EA 1PJ5A 3AECA 3NNEA 3UKLA 1FCDA 2GV8A 5IPYA 1HYUA 3PO7A 2XLRA 4EIQA 3GSIA 2RGHA 3BI4A 2GF3A 4A65A 4CY6A 4TM3A 3H8LA 1KFYA 1OJDA 1S3EA 2XFUA 1DODA 2GR3A 4C3XA 4UDRA 2XFOA 3KA7A 2V3BA 4PABA 1L0VA 4CNJA 5EB5A 1DOBA 4G9KA 2WPFA 2QA1A 4OPLA 3KD9A 3AE8A 3EAOA 4IA6A 4FX9A 4EMWA 1ZDLA 3ICRA 1E1KA 2CVJA 2EQ7A 1XPQA 2YM2A 3T2KA 2GB0A 4Z2RA 3UKQA 3DK8A 3ADAB 1JRYA 1P2EA 4U8MA 4CCQA 4U8PA 3AEAA 1N4WA 2YR4A 1IUSA 3EANA 4DNAA 1EL5A 3F8RA 3UTHA 3ZDNA 3VQRA 2WU5A 1PXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DBJ A;  4AOX A;  3CIR A;  2IVE A;  4TLZ A;  4MJW A;  4UDQ A;  2JKC A;  3AEF A;  3S5W A;  3T37 A;  4H2N A;  2R0G A;  3IHG A;  4U2S A;  3QJ4 A;  1NHP A;  1KNP A;  5KXJ A;  2WQY A;  1ZK7 A;  4X4J A;  2WEU A;  2VVM A;  3CNS A;  4GDE A;  3ICS A;  4C5O A;  4YKG A;  2Q6U A;  3LAD A;  2VQ7 A;  4LII A;  3LZW A;  3NYE A;  3BI2 A;  2YWL A;  1OJC A;  1EBD A;  3CGB A;  1DNC A;  1GEU A;  2GR0 A;  1OJT A;  3UKP A;  2BAC A;  4Z25 A;  2C64 A;  5KWF A;  2C72 A;  1V59 A;  2C73 A;  1KSS A;  3DGH A;  1TYP A;  2X3N A;  3H4K A;  1PHH A;  2X99 A;  4LA1 A;  4EMI A;  4Y4L A;  3NTD A;  3NIX A;  1E1N A;  1W4X A;  1Y56 B;  3NG7 X;  4TM0 A;  3ITJ A;  4NTD A;  4O5Q A;  2V3A A;  3UOX A;  4B1B A;  1IJH A;  3AE2 A;  3KVE A;  4IVM B;  4AT0 A;  2NVK X;  3FG2 P;  2BK3 A;  1KSU A;  3ATQ A;  3NLC A;  4C3Y A;  2E5V A;  3CNT A;  4YSX A;  3PS9 A;  2BXR A;  3BNM A;  2XVE A;  2XYO A;  3UP5 A;  3FPZ A;  3ALL A;  3C4N A;  3VR8 A;  4AP3 A;  4B67 A;  2FJD A;  2A89 A;  3EF6 A;  5EB4 A;  3ALM A;  3K7Q X;  2UZZ A;  5GSN A;  4DSG A;  2QAE A;  4H4W A;  1GRT A;  4B66 A;  4APN A;  1ZMC A;  1JOA A;  2YLS A;  3P4R A;  2XVI A;  1OJ9 A;  3ALJ A;  3NYF A;  1GXF A;  2OAM A;  1GTE A;  3RHA A;  3LZX A;  2Z5X A;  1QLB A;  1D7Y A;  3LXD A;  3D8X A;  3NN6 X;  3DA1 A;  2WOI A;  2WS3 A;  4JY2 A;  2WDV A;  2TPR A;  3L8K A;  4ZCD A;  2WP6 A;  4YTM A;  2ZZ0 A;  4Z26 A;  3AEB A;  3O0H A;  4Z44 A;  1B4V A;  4H4X A;  4EM4 A;  1Z6L A;  1CJ2 A;  1VQW A;  2YLZ A;  1CF3 A;  3AE6 A;  4H4T A;  1IUU A;  5FS9 A;  2C70 A;  3C4A A;  3H8I A;  4XWR A;  3K7T A;  2GR1 A;  1NEN A;  3NTA A;  1GT8 A;  2PYX A;  4EM3 A;  2Y6R A;  2X8C A;  5JCM A;  4K2X A;  3UTF A;  3LJP A;  3K30 A;  4C77 A;  1H7X A;  1NHR A;  3NRN A;  3DK9 A;  2BS2 A;  2R45 A;  4HB9 A;  3CNJ A;  3SQP A;  5JCL A;  3ICT A;  1LQT A;  1B37 A;  3WE0 A;  4DSH A;  1K0J A;  1CHU A;  1N4V A;  3GRT A;  1ZP0 A;  2A87 A;  3ABV A;  3KPF A;  4OPC A;  2AQJ A;  1S2Q A;  1BGN A;  1JU2 A;  1Y56 A;  1GND A;  4K5S A;  3FBS A;  4Z43 A;  2JB3 A;  4YWO A;  4TM4 A;  3KLJ A;  4OPG A;  2YLW A;  3AXB A;  1TDF A;  3UOY A;  1N4U A;  2XLS A;  1KNR A;  1F8W A;  2VVL A;  3BHF A;  1CJC A;  3FMW A;  3P1W A;  5GRT A;  5LV9 A;  2R0P A;  1BWC A;  4GF7 A;  3HZL A;  4USR A;  3UKA A;  4EQS A;  1EL7 A;  1CC4 A;  3C96 A;  3CN8 A;  1H83 A;  3AYL A;  4Y4N A;  1PS9 A;  4JN9 A;  2BS3 A;  1NHQ A;  2R9Z A;  1QO8 A;  2XLP A;  1FEA A;  2I0Z A;  2ACZ A;  2TMD A;  3AD8 B;  2YM1 A;  2YG5 A;  2YQU A;  3AED A;  4NEW A;  3GDP A;  1NDA A;  1LVL A;  1PBD A;  3Q6J A;  2R0C A;  1REO A;  1DXL A;  1GRA A;  2YAU A;  2QA2 A;  3B3R A;  1ZMD A;  3DJD A;  1E39 A;  3S61 A;  1TDK A;  3LB8 A;  4A6N B;  3NK1 X;  4OVI A;  3P4P A;  3CND A;  1K4Q A;  2R4J A;  5EBK A;  1JEH A;  4A7A A;  3UKF A;  1GPE A;  3SM8 A;  2XFP A;  1P2H A;  4H4U A;  1B8S A;  1PJ6 A;  3BHK A;  3IF9 A;  2IVD A;  1ZOY A;  1BZL A;  4J57 A;  2XVF A;  3D1C A;  4U8K A;  4U8O A;  2YR5 A;  1NPX A;  2GRT A;  1O94 A;  4D03 A;  2YLT A;  2GR2 A;  4XWZ A;  1ZY8 A;  4XXG A;  3QFA A;  2OLO A;  2XLT A;  2BC1 A;  5HHF A;  3IC9 A;  1XHC A;  2WET A;  3VRA A;  1FOH A;  5KOX A;  4U8N A;  4HA6 A;  1F6M A;  3AEE A;  3BI5 A;  4JNA A;  4JNQ A;  3CPJ G;  5FS6 A;  3UKK A;  2JAE A;  1GSN A;  1TRB A;  1B5Q A;  3PVC A;  4I59 A;  4ADW A;  2NPX A;  3CTY A;  4A5L A;  4NTE A;  4E0V A;  5IQ4 A;  3L1R A;  4GR1 A;  3UOV A;  4H4P A;  4U2L A;  5JCK A;  5KVH A;  4J56 A;  2VRL A;  4OPI A;  4TM1 A;  1BKW A;  3G5Q A;  3NT6 A;  4REK A;  2Q7V A;  1YY5 A;  2F5Z A;  1PXA A;  1MOK A;  4PAA A;  1D7L A;  3AD9 B;  4BK2 A;  2C3D A;  2APG A;  1Q1R A;  4H4V A;  4P9S A;  3Q9T A;  1CC2 A;  4GCM A;  1GRB A;  1K0I A;  5FS8 A;  2WHD A;  1QJD A;  2YVF A;  1GET A;  3V3N A;  2WPC A;  2V5Z A;  4YKF A;  4BJZ A;  1H84 A;  1IUT A;  4YXD A;  1PBE A;  5U25 A;  2C7G A;  3NHO X;  2YG4 A;  4CCR A;  3EPT A;  5U1O A;  2JK6 A;  1ZOV A;  5FMH A;  1CC6 A;  1TDO A;  5J60 A;  3CNP A;  4KX6 A;  4KPR A;  2XLU A;  4YSZ A;  4LU6 A;  1K0L A;  4H4R A;  2BK4 A;  1ZKQ A;  4B64 A;  4WX1 A;  4BV6 A;  5BRT A;  1JNZ A;  3CGD A;  3RNM A;  4A6N A;  2C3C A;  1H82 A;  1E7P A;  4DGK A;  3NN0 X;  2YVG A;  4UDP A;  1KF6 A;  1ONF A;  1LV0 A;  2C66 A;  2VVL G;  3I3L A;  1LQU A;  2BC0 A;  2YG3 A;  3B6D A;  3F8P A;  3DH9 A;  4H2Q A;  4IVO B;  2X50 A;  1DJN A;  2C67 A;  3URH A;  4CNK A;  3II4 A;  3DK4 A;  1SEZ A;  2PHH A;  4RSL A;  4A99 A;  4B63 A;  5FS7 A;  2E4G A;  1PJ7 A;  4H7U A;  4J2W A;  3SFE A;  4D04 A;  4ECH A;  4CRT A;  3KU9 A;  4OPU A;  2RGJ A;  2Z5Y A;  4YSY A;  2VOU A;  2XDO A;  2VQB A;  1H86 A;  2B7S A;  1LJ1 A;  1TDE A;  1PBF A;  3AE3 A;  2BK5 A;  2XCG A;  2Y6Q A;  3UTE A;  2XVH A;  1RYI A;  3GD4 A;  4FK1 C;  1BGJ A;  3GWF A;  3IWA A;  4USQ A;  3P4Q A;  4YTP A;  4H4S A;  2BCG G;  3LOV A;  4GUV A;  4EIP A;  3SFD A;  2YR6 A;  2E1M A;  2WPE A;  4BJY A;  5JCN A;  2WDR A;  2ZZC A;  3ISH A;  5IQ1 A;  5U63 A;  3QFB A;  1RP0 A;  3VRB A;  2YG6 A;  4Y4M A;  3AE4 A;  2CDU A;  4JY3 A;  4ZCC A;  3VR9 A;  1LTX R;  3GDN A;  1H7W A;  1COY A;  3V3O A;  3UP4 A;  3F8D A;  2C76 A;  4WCT A;  4Z2U A;  5BVA A;  1MO9 A;  2WOV A;  4K8D A;  1M64 A;  4FDC B;  1PBC A;  1RSG A;  4H2R A;  3G5S A;  4O5U A;  4U2T A;  3CPH G;  1N1P A;  1VDC A;  3AE1 A;  3E1T A;  3AYJ A;  3GYI A;  1UKV G;  2X8G A;  2WU2 A;  4X9N A;  2GQF A;  2GVC A;  2V60 A;  2WP9 A;  2EQ8 A;  1PXB A;  2H88 A;  4ICY A;  4U8I A;  3GWD A;  1XDI A;  3RED A;  4CY8 A;  1X31 B;  1YKJ A;  2XFN A;  4BK1 A;  5L46 A;  4J31 A;  2WOW A;  3VRD B;  2BA9 A;  2DKH A;  3GRS A;  4CBQ A;  4YSH A;  1F3P A;  2Q0L A;  1O5W A;  4RG3 A;  1FEC A;  2YVJ A;  1TDN A;  2VZ2 A;  3NGC X;  1VG9 A;  4K5R A;  4OPT A;  1M6I A;  1L9E A;  1PN0 A;  1BF3 A;  3I6D A;  3ZYX A;  5BUL A;  1Y0P A;  3M13 A;  1OJA A;  2B76 A;  3AE7 A;  5HY5 A;  2AR8 A;  3CPI G;  4B68 A;  2H89 A;  1GAL A;  1TYT A;  3QSE A;  3QSS A;  2GAG B;  3P4S A;  2GAH B;  3SGL A;  4JQ9 A;  4K7Z A;  4H2P A;  4YT0 A;  2R46 A;  3ATR A;  4EQX A;  3AWI A;  4K22 A;  3P9U A;  3RP8 A;  2O9Z A;  3OZ2 A;  4AP1 A;  4AOS A;  1H81 A;  1DOC A;  1Q1W A;  2WBA A;  1MXT A;  2B9W A;  2B7R A;  1YQ4 A;  5TR3 A;  4EQW A;  3KKJ A;  2JB1 A;  4X9M A;  2BCP A;  1NG4 A;  5J7X A;  2WDQ A;  3G5R A;  3COX A;  3NKS A;  1CBO A;  2ZBW A;  1IUX A;  4NTC A;  2C65 A;  2Q0K A;  1F8S A;  2JBV A;  2BXS A;  4J34 A;  1NG3 A;  4J33 A;  4H4Q A;  1DOE A;  3DME A;  3AYI A;  3GMC A;  3UTG A;  1E6E A;  1VRQ B;  2C75 A;  4A79 A;  5KRQ A;  3GMB A;  4H50 A;  3QSM A;  2YG7 A;  1FEB A;  2XVJ A;  4GRT A;  4B69 A;  1H6V A;  5KOW A;  3UCL A;  2AAQ A;  2QCU A;  4GDP A;  2HQM A;  1ELI A;  3UKH A;  5HYM A;  5C3J A;  2ARD A;  4H4Z A;  3CGE A;  1D4C A;  4A9W A;  2EQ9 A;  2YLX A;  4TLX A;  2FJA A;  3RP7 A;  1LPF A;  2WP5 A;  2B9X A;  2V61 A;  3AEG A;  1GER A;  3M12 A;  1NEK A;  1GRF A;  1CJ4 A;  1EL8 A;  1Q9I A;  1GRG A;  1JRX A;  1GOS A;  1VG0 A;  4J36 A;  2B9Y A;  4BK3 A;  1AOG A;  3JSK A;  1GES A;  1NHS A;  2ZZB A;  2XFQ A;  3AD7 B;  3OC4 A;  4FK1 A;  3QVR A;  3NK0 X;  3V76 A;  1YQ3 A;  2DKI A;  4EMJ A;  1FL2 A;  5BUK A;  2A8X A;  5ER0 A;  2GEW A;  2FJB A;  2GH5 A;  1S2Y A;  4AT2 A;  1JRZ A;  1D5T A;  1PBB A;  2GMJ A;  2OAL A;  4N9X A;  4ZN0 A;  3NK2 X;  2RGO A;  4U8L A;  1IUV A;  5EOW A;  2JB2 A;  5CKU A;  4OPD A;  3AE9 A;  2GQW A;  4JDR A;  1E1M A;  2OLN A;  2X8H A;  3QVP A;  2FBW A;  2BYB A;  4RG4 A;  1GRH A;  4UP3 A;  1DJQ A;  1L9C A;  2J3N A;  2OA1 A;  2BAB A;  4Z2T A;  3R9U A;  3AE5 A;  1GRE A;  2V6O A;  4I58 A;  1O95 A;  1PDH A;  1GV4 A;  5KVI A;  2WES A;  3GYJ A;  3M0O A;  2W0H A;  3NH3 X;  1F8R A;  2CUL A;  4H4Y A;  3NYC A;  1YQZ A;  4IA5 A;  5CQF A;  5M10 A;  3DGZ A;  3DJJ A;  1S3B A;  4OCG A;  1E1L A;  3UOZ A;  1ZX9 A;  3BNU A;  2CFY A;  4EQR A;  5M0Z A;  4BUR A;  1L9D A;  3RP6 A;  1CJ3 A;  5JCI A;  1IUW A;  4NZH A;  4U8J A;  5C2T A;  2EQ6 A;  3GD3 A;  4M52 A;  1XAN A;  4NEV A;  1JNR A;  1GTH A;  1D4D A;  2BS4 A;  1KDG A;  3K7M X;  4IV9 A;  2R4E A;  4B65 A;  2FJE A;  1EL9 A;  2YLR A;  4C74 A;  3AB1 A;  4Z24 A;  4YTN A;  2VRM A;  3IHM A;  1CL0 A;  3FIM B;  2GMH A;  5HXI A;  2RAB A;  2IID A;  3DJE A;  3DJG X;  1NAA A;  3CGC A;  1D4E A;  1PJ5 A;  3AEC A;  3NNE A;  3UKL A;  1FCD A;  2GV8 A;  5IPY A;  1HYU A;  3PO7 A;  2XLR A;  4EIQ A;  3GSI A;  2RGH A;  3BI4 A;  2GF3 A;  4A65 A;  4CY6 A;  4TM3 A;  3H8L A;  1KFY A;  1OJD A;  1S3E A;  2XFU A;  1DOD A;  2GR3 A;  4C3X A;  4UDR A;  2XFO A;  3KA7 A;  2V3B A;  4PAB A;  1L0V A;  4CNJ A;  5EB5 A;  1DOB A;  2WPF A;  2QA1 A;  4OPL A;  3KD9 A;  3AE8 A;  3EAO A;  4IA6 A;  4FX9 A;  4EMW A;  1ZDL A;  3ICR A;  1E1K A;  2CVJ A;  2EQ7 A;  1XPQ A;  2YM2 A;  2GB0 A;  4Z2R A;  3UKQ A;  3DK8 A;  3ADA B;  1JRY A;  1P2E A;  4U8M A;  4CCQ A;  4U8P A;  3AEA A;  1N4W A;  2YR4 A;  1IUS A;  3EAN A;  4DNA A;  1EL5 A;  3F8R A;  3UTH A;  3ZDN A;  3VQR A;  2WU5 A;  1PXC A; 
#chains in the Genus database with same CATH topology
 2IVE A;  3S5W A;  3T37 A;  3QJ4 A;  1NHP A;  3TCS A;  2VVM A;  4GDE A;  3ICS A;  2VQ7 A;  3NYE A;  3U4F A;  1DNC A;  1OJT A;  4Z25 A;  2BAC A;  2C73 A;  3DGH A;  1TYP A;  1ONE A;  3NIX A;  1KN0 A;  4TM0 A;  3ITJ A;  1N63 C;  4B1B A;  4IVM B;  2BK3 A;  2W3R A;  2BXR A;  4DWD A;  2XYO A;  4AP3 A;  2FJD A;  2UZZ A;  5GSN A;  4DSG A;  1GRT A;  1OEP A;  4B66 A;  3P4R A;  1N60 C;  3RHA A;  3LZX A;  2ONE A;  3DA1 A;  4ZCD A;  2WP6 A;  4NNJ A;  3O0H A;  3CMM A;  4Z44 A;  4H4X A;  3CK5 A;  3DGB A;  4EM4 A;  3AE6 A;  1NEN A;  4EM3 A;  3FXG A;  3FCP A;  2OPJ A;  3DK9 A;  3PFR A;  4H2H A;  3CNJ A;  1LQT A;  1B37 A;  4DSH A;  1K0J A;  1N4V A;  3ABV A;  3KPF A;  3D46 A;  2AQJ A;  4IZG A;  1Y56 A;  4DXK A;  3SN1 A;  1GND A;  1TDF A;  1F8W A;  5LV9 A;  2AL2 B;  1BWC A;  1CC4 A;  4Y4N A;  4GIR A;  1PS9 A;  4JN9 A;  2BS3 A;  3I4K A;  1FEA A;  2OG9 A;  2YG5 A;  1L8P A;  4NEW A;  2R0C A;  1DXL A;  2QA2 A;  3T0K A;  1ZMD A;  3P4P A;  1K4Q A;  1JEH A;  3HYX A;  3AMZ A;  4E5T A;  4J57 A;  1RVK A;  3PK7 A;  5HHF A;  3TOY A;  3IC9 A;  5KOX A;  1FOH A;  2HXT A;  1F6M A;  4II3 A;  3T2Z A;  2JAE A;  1GSN A;  4IHC A;  3CTY A;  4NTE A;  3OW1 A;  4E0V A;  5IQ4 A;  3MKC A;  3NZG A;  4H4P A;  3MZN A;  3T8Q A;  2F5Z A;  1MOK A;  3NXL A;  4M6U A;  1Q1R A;  4P9S A;  3Q9T A;  1CC2 A;  4GCM A;  1GRB A;  1GET A;  4HYR A;  3HPF A;  2V5Z A;  4BJZ A;  4TVY A;  5U25 A;  3OZY A;  3N4E A;  5U1O A;  4B64 A;  4BV6 A;  3CXO A;  2C66 A;  3MY9 A;  3B6D A;  4H2Q A;  2X50 A;  2I5Q A;  3URH A;  3CT2 A;  2PHH A;  5FS7 A;  4D04 A;  1EBG A;  4CRT A;  3TTE A;  3DIP A;  1LJ1 A;  3AE3 A;  2Y6Q A;  3UTE A;  1BGJ A;  4USQ A;  4K1W A;  2BCG G;  4EIP A;  5FJP A;  4BJY A;  3UJS A;  3ISH A;  4Y4M A;  3AE4 A;  4ZCC A;  3VR9 A;  4ZOH B;  1H7W A;  1COY A;  3F8D A;  4II2 A;  1RSG A;  1PBC A;  4U2T A;  2OFJ A;  3E1T A;  3AYJ A;  2NQL A;  1P43 A;  2GVC A;  3NS1 B;  2WP9 A;  1XDI A;  4CY8 A;  5L46 A;  4IL2 A;  3P0W A;  3VRD B;  2DKH A;  1F3P A;  3SZ0 A;  1FEC A;  3ZVH A;  4JN7 A;  1TDN A;  2VZ2 A;  3NGC X;  1PN0 A;  1Y0P A;  4HCH A;  3GO2 A;  3IJQ A;  1GAL A;  3QSE A;  1EBH A;  2GAG B;  4K7Z A;  4H2P A;  2R46 A;  2B9W A;  2PCE A;  3V4B A;  4KPL A;  3SN4 A;  4EQW A;  3H70 A;  3A7R A;  3R10 A;  5J7X A;  2FYM A;  2OLA A;  1CBO A;  3R07 C;  1IUX A;  4NTC A;  1NG3 A;  4J33 A;  3K1G A;  5KRQ A;  2YG7 A;  1FEB A;  5KOW A;  2PTY A;  5G5G B;  5C3J A;  4H4Z A;  1D4C A;  3QTP A;  3DG3 A;  2B9X A;  1EL8 A;  1JRX A;  1AOG A;  3JSK A;  4G6H A;  3AD7 B;  1KKR A;  5ER0 A;  1D5T A;  4N9X A;  3NK2 X;  4RG4 A;  2FBW A;  1GRH A;  3SYI A;  2OA1 A;  2HXU A;  1GRE A;  1O95 A;  1F8R A;  2CUL A;  2GSH A;  4IA5 A;  5M10 A;  3ES7 A;  5M0Z A;  3GD3 A;  2PA6 A;  1D4D A;  1KDG A;  2XSX A;  4E4U A;  2FJE A;  1EL9 A;  3I6E A;  3UJ2 A;  4H1Z A;  2VRM A;  1DTN A;  5HXI A;  3VA8 A;  1PJ5 A;  3AEC A;  3NNE A;  3V3W A;  2GF3 A;  3I6T A;  1JCT A;  1TE6 A;  3VCN A;  2GGI A;  2XFO A;  3KA7 A;  4CNJ A;  2PTX A;  5EB5 A;  3SJN A;  3KD9 A;  4FX9 A;  3CAW A;  3T6C A;  3ADA B;  1N4W A;  1IUS A;  3EAN A;  1PDZ A;  3UTH A;  3VQR A;  2WU5 A;  1PXC A;  3DFH A;  4TLZ A;  4MJW A;  2JKC A;  4X4J A;  3THU A;  3CNS A;  3LZW A;  2YWL A;  1EBD A;  4G74 A;  3SZC A;  3UKP A;  2XGZ A;  2X99 A;  1E1N A;  3NG7 X;  2V3A A;  3UOX A;  1IJH A;  3AE2 A;  3KVE A;  4AT0 A;  3FYY A;  3V5F A;  3ATQ A;  2E3T A;  2XVE A;  3C4N A;  2A89 A;  2QAE A;  1VDV A;  2XVI A;  1OJ9 A;  3NYF A;  1GXF A;  4HNL A;  3H8A A;  1D7Y A;  3D8X A;  4JY2 A;  2WS3 A;  2WDV A;  1IYX A;  2TPR A;  3L8K A;  4DYE A;  3R11 A;  3ES8 A;  1VQW A;  2POZ A;  2YLZ A;  4H4T A;  1IUU A;  3C4A A;  3Q4D A;  3NTA A;  5JCM A;  3UTF A;  3LJP A;  1H7X A;  4GAP A;  2BS2 A;  1CHU A;  3IJL A;  3TWA A;  3VCC A;  1JU2 A;  1JRP A;  3KLJ A;  3EEZ A;  3UOY A;  1CJC A;  4GYP C;  2R0P A;  3UKA A;  3C96 A;  3CN8 A;  3AYL A;  2PP3 A;  3SX6 A;  1NHQ A;  1QO8 A;  2I0Z A;  2YM1 A;  1FHU A;  3AED A;  1LVL A;  1PBD A;  2OKT A;  3Q6J A;  1GRA A;  2PGE A;  1SJC A;  3TW9 A;  1E39 A;  1TDK A;  2OQY A;  3NK1 X;  2ZAD A;  4A7A A;  3UKF A;  1GPE A;  3SM8 A;  1MUC A;  2XFP A;  1P2H A;  1B8S A;  3IF9 A;  1BZL A;  4U8O A;  3D1C A;  4HCD A;  2YR5 A;  5KMQ A;  1W6T A;  2GR2 A;  3DES A;  4YWS A;  2OLO A;  1XHC A;  2WET A;  3VFC A;  4U8N A;  1EC9 A;  4HA6 A;  3AEE A;  5FS6 A;  1B5Q A;  4A5L A;  4U2L A;  1BKW A;  3NT6 A;  1R6W A;  1PXA A;  3DFY A;  3AD9 B;  1WUF A;  4JN8 A;  2C3D A;  4H4V A;  3MQT A;  2WHD A;  2YVF A;  3V3N A;  2WPC A;  4YXD A;  1PBE A;  3NHO X;  3EPT A;  2XH0 A;  5FMH A;  1TDO A;  3D47 A;  4YSZ A;  1K0L A;  4HCL A;  3CGD A;  3RNM A;  4A6N A;  1E7P A;  3NN0 X;  4UDP A;  1LV0 A;  2VVL G;  3PG6 A;  2BC0 A;  4IVO B;  1DJN A;  3DK4 A;  4EWJ A;  3RGT A;  3KU9 A;  2RGJ A;  2XDO A;  2PU1 A;  2B7S A;  1TDE A;  4HNC A;  1RM6 B;  3OZM A;  2XVH A;  1RYI A;  4FK1 C;  4YTP A;  4H4S A;  1N5W C;  3T31 A;  1JRO A;  2WDR A;  3U9I A;  3VRB A;  3V3O A;  4Z2U A;  4A35 A;  2C76 A;  5BVA A;  4H2R A;  3IK4 A;  3GY1 A;  3UJR A;  3CPH G;  3AE1 A;  3A7U A;  1V97 A;  2WU2 A;  2GQF A;  2V60 A;  3P3B A;  2H88 A;  4U8I A;  4J31 A;  3N6J A;  2WOW A;  4YSH A;  2PS2 A;  3S5S A;  1VG9 A;  4DX3 A;  3ZYX A;  3S47 A;  2B76 A;  5HY5 A;  1TYT A;  4A3R A;  3L5O A;  5FJU A;  3P4S A;  2OZ3 A;  2GAH B;  4JQ9 A;  1NEL A;  1XPY A;  3ATR A;  3KPK A;  4K22 A;  3P9U A;  3RP8 A;  3OZ2 A;  5KMS A;  1MXT A;  4KWS A;  2JB1 A;  4X9M A;  1ECQ A;  2HZG A;  2C65 A;  2JBV A;  2BXS A;  3DME A;  3AYI A;  1VRQ B;  4A79 A;  3GMB A;  4H50 A;  3QSM A;  4GRT A;  4B69 A;  4G6G A;  3UCL A;  2AAQ A;  2QCU A;  2ARD A;  3DDM A;  3RP7 A;  2WP5 A;  2V61 A;  3AEG A;  3OPS A;  1Q9I A;  1FFU C;  1GOS A;  1VG0 A;  2B9Y A;  2ZZB A;  3NK0 X;  3V76 A;  2DKI A;  2E5A A;  2FJB A;  2GH5 A;  2GMJ A;  2OAL A;  1IUV A;  5CKU A;  4OPD A;  2OLN A;  2BYB A;  1L9C A;  2J3N A;  3AE5 A;  4HN8 A;  2WES A;  3GYJ A;  4H4Y A;  5CQF A;  3DGZ A;  3DJJ A;  1S3B A;  2GL5 A;  4OCG A;  3STP A;  4IP5 A;  3BNU A;  1X2G A;  1CJ3 A;  1IUW A;  2EQ6 A;  1XAN A;  3RIT A;  3K7M X;  4IV9 A;  4B65 A;  1T3Q C;  4C74 A;  1SB3 B;  3D9X A;  3IHM A;  2PP0 A;  1VQZ A;  2AKM A;  3AM9 A;  4HPN A;  2RAB A;  2XH4 A;  3CGC A;  1D4E A;  3UKL A;  1FCD A;  3IJI A;  5IPY A;  4EIQ A;  2RGH A;  4CY6 A;  1S3E A;  3PWG A;  4Z17 A;  4PAB A;  1DOB A;  4G9K A;  2QA1 A;  2FKP A;  3AE8 A;  3EAO A;  1FIQ B;  1ZDL A;  3ICR A;  2XH2 A;  1XPQ A;  1MDL A;  6ENL A;  2GB0 A;  3FVD A;  3ZLG A;  1P2E A;  4U8M A;  4U8P A;  3AEA A;  4DNA A;  4AOX A;  3T2Y A;  3AEF A;  3SXI A;  4H2N A;  1NU5 A;  5KXJ A;  3VDG A;  2WQY A;  1ZK7 A;  2WEU A;  4LII A;  1OJC A;  3CGB A;  1GEU A;  3R0U A;  2GR0 A;  4E4F A;  2C64 A;  2C72 A;  1V59 A;  3H4K A;  4LA1 A;  4EMI A;  2OX4 A;  1W4X A;  1Y56 B;  3EKG A;  4O5Q A;  3NVW B;  3ENL A;  3NO1 A;  2NVK X;  3OP2 A;  3CNT A;  4ROP A;  3BNM A;  3HW2 A;  3UP5 A;  3ALL A;  4B67 A;  3ALM A;  2PMQ A;  1EC7 A;  3T9P A;  5FJR A;  4APN A;  4X2P A;  3ALJ A;  5BOE A;  3UGV A;  1QLB A;  3LXD A;  3NN6 X;  2WOI A;  3NVV B;  1JPM A;  3GD6 A;  4YTM A;  1B4V A;  4MKS A;  1CF3 A;  2C70 A;  5FS9 A;  3H8I A;  4XWR A;  3K7T A;  2GR1 A;  4GYP A;  1SJD A;  2X8C A;  2OZT A;  4C77 A;  1NHR A;  1ELS A;  3NRN A;  3SQP A;  5JCL A;  1ZP0 A;  4OPC A;  1BGN A;  4K5S A;  4Z43 A;  3FBS A;  2YLW A;  2XLS A;  2VVL A;  3FMW A;  3P1W A;  5GRT A;  1PDY A;  4GF7 A;  3BSM A;  2R9Z A;  2XLP A;  2ACZ A;  1NDA A;  1REO A;  2YAU A;  2DW6 A;  1FO4 A;  3RO6 A;  4GGH A;  3BHK A;  2HNE A;  1ZOY A;  2XVF A;  3EUB 3;  1NPX A;  1KCZ A;  2YLT A;  3R0K A;  2BC1 A;  7ENL A;  3H12 A;  4JNQ A;  3DG6 A;  2NPX A;  1BKH A;  2CHR A;  3ZLF A;  3L1R A;  2P3Z A;  4GR1 A;  3UOV A;  5KVH A;  4TM1 A;  1MRA A;  4ZA0 A;  4REK A;  4PAA A;  1D7L A;  2GGJ A;  5EU9 A;  2APG A;  2AL2 A;  2QJJ A;  1K0I A;  3T14 A;  4G73 A;  4YKF A;  1H84 A;  1IUT A;  3CYJ A;  2YG4 A;  4CCR A;  2JK6 A;  1CC6 A;  5J60 A;  4H4R A;  3UJE A;  1JNZ A;  1H82 A;  3NVZ B;  2ZC8 A;  1ONF A;  3PWI A;  3I3L A;  1LQU A;  3ZVH B;  2YG3 A;  3DH9 A;  4KEM A;  2OZ8 A;  2C67 A;  4CNK A;  1EC8 A;  1SEZ A;  1ZXI C;  4RSL A;  4A99 A;  4B63 A;  2E4G A;  1PJ7 A;  3SFE A;  4H83 A;  4OPU A;  2VOU A;  2OVL A;  4A6G A;  2XCG A;  3GD4 A;  2PGW A;  3VC6 A;  3IWA A;  3P4Q A;  1F9C A;  2GGE A;  3UXL A;  2E1M A;  1WYG A;  5IQ1 A;  4JY3 A;  2CDU A;  3HYW A;  3NVY B;  3GDN A;  5KMR A;  1MO9 A;  3MUC A;  4FDC B;  4E8G A;  3G5S A;  1N1P A;  1VDC A;  3GYI A;  1UKV G;  2X8G A;  4X9N A;  1PXB A;  3GWD A;  3RED A;  1X31 B;  4BK1 A;  1WUE A;  2BA9 A;  3GRS A;  4CBQ A;  3TJ4 A;  1TKK A;  3SZW A;  4K5R A;  5BUL A;  1BF3 A;  3M13 A;  3AE7 A;  2AR8 A;  4B68 A;  2H89 A;  5FJT A;  4K8G A;  3QSS A;  3SGL A;  3RCY A;  3SZF A;  4MGG A;  4GFI A;  2QDD A;  4YT0 A;  4GIS A;  4EQX A;  2O9Z A;  4AP1 A;  3QKE A;  4AOS A;  1DOC A;  4J1O A;  1H81 A;  2WBA A;  2B7R A;  4Z1Y A;  1YQ4 A;  3KKJ A;  1X2H A;  1NG4 A;  2WDQ A;  3NKS A;  2ZBW A;  2GGH A;  2Q0K A;  1F8S A;  1DOE A;  3SR6 B;  3UTG A;  2XVJ A;  1H6V A;  4GDP A;  1ELI A;  3HRD C;  2OQH A;  2FJA A;  1LPF A;  2P8B A;  3M12 A;  1GER A;  1CJ4 A;  1KKO A;  4BK3 A;  1GRG A;  1GES A;  1NHS A;  3QVR A;  2MNR A;  4EMJ A;  3RR1 A;  2GEW A;  1S2Y A;  1BQG A;  4ZN0 A;  2W54 A;  2X8H A;  4UP3 A;  4Z2T A;  3R9U A;  2V6O A;  4I58 A;  1GV4 A;  3M0O A;  2W0H A;  3NYC A;  1YQZ A;  5J04 A;  1E1L A;  1ZX9 A;  4BUR A;  3QLD A;  4U8J A;  4M52 A;  4NEV A;  1GTH A;  2R4E A;  2YLR A;  2C4C A;  3AB1 A;  4Z24 A;  3FIM B;  2GMH A;  3DJE A;  3DJG X;  1NAA A;  2GV8 A;  3PO7 A;  2XLR A;  3B97 A;  4A65 A;  4FI4 A;  3H8L A;  2XFU A;  1DOD A;  4C3X A;  2V3B A;  1L0V A;  1E1K A;  2DW7 A;  3SQS A;  3ETR B;  3JW7 A;  2W3S A;  3TJI A;  3UKQ A;  4CCQ A;  3AN1 A;  2YR4 A;  1EL5 A;  3DEQ A;  2P88 A;  5DBJ A;  3CIR A;  4UDQ A;  2R0G A;  3IHG A;  4G7F A;  4U2S A;  3QN3 A;  3VC5 A;  1KNP A;  3UCC A;  4NWZ A;  4C5O A;  5KNL A;  4YKG A;  2Q6U A;  3LAD A;  3BI2 A;  3SY4 A;  5IDZ A;  5KWF A;  1KSS A;  2X3N A;  1PHH A;  4Y4L A;  3NTD A;  1STZ A;  4NTD A;  1SJB A;  3FG2 P;  1KSU A;  4YSX A;  3NLC A;  4C3Y A;  2QJN A;  2P8C A;  2E5V A;  3PS9 A;  3FPZ A;  4IT1 A;  3VR8 A;  3EF6 A;  5EB4 A;  3K7Q X;  4H4W A;  2PU0 A;  1ZMC A;  1JOA A;  2YLS A;  3DG7 A;  2OAM A;  3NRZ B;  1GTE A;  2Z5X A;  4J3Z A;  1FFV C;  2ZZ0 A;  4Z26 A;  1N62 C;  3AEB A;  1Z6L A;  1CJ2 A;  4K2S A;  3GC2 A;  2GDQ A;  4K2X A;  1GT8 A;  2PYX A;  2Y6R A;  4M0X A;  4IL0 A;  3K30 A;  2R45 A;  4HB9 A;  3ICT A;  3WE0 A;  3GRT A;  2A87 A;  2PPG A;  3MSY A;  3TWB A;  1S2Q A;  2JB3 A;  4YWO A;  1YEY A;  4TM4 A;  4OPG A;  3V5C A;  3AXB A;  1R0M A;  1N4U A;  1KNR A;  3BHF A;  3HZL A;  4USR A;  4EQS A;  1EL7 A;  1H83 A;  3BOX A;  2TMD A;  3AD8 B;  3HYV A;  2YQU A;  3GDP A;  3ZLH A;  2POD A;  3B3R A;  3DJD A;  3S61 A;  3LB8 A;  4A6N B;  4OVI A;  3CND A;  2R4J A;  5EBK A;  1MDR A;  3QPE A;  4H4U A;  2PTZ A;  1PJ6 A;  2RDX A;  2IVD A;  4U8K A;  2GRT A;  1O94 A;  4D03 A;  4XWZ A;  1ZY8 A;  4XXG A;  3QFA A;  2XLT A;  3VRA A;  4JNA A;  3BI5 A;  3CPJ G;  3UKK A;  1TRB A;  3PVC A;  1P48 A;  3Q45 A;  4ADW A;  4I59 A;  3B9J B;  5JCK A;  4J56 A;  2VRL A;  4OPI A;  3G5Q A;  2Q7V A;  1YY5 A;  4G8T A;  3OTR A;  4BK2 A;  5FS8 A;  1QJD A;  2C7G A;  1ZOV A;  3CNP A;  4KX6 A;  4KPR A;  2XLU A;  4LU6 A;  3CXB A;  2BK4 A;  1ZKQ A;  4WX1 A;  2OO6 A;  5BRT A;  3R1Z A;  2C3C A;  3TQP A;  4DGK A;  2YVG A;  3ZVI A;  5JRB A;  1KF6 A;  2AL1 A;  3F8P A;  3UJF A;  3II4 A;  1N5X A;  1E9I A;  3MWC A;  4H7U A;  4J2W A;  4ECH A;  2Z5Y A;  4YSY A;  2VQB A;  1H86 A;  1PBF A;  2BK5 A;  3GWF A;  4FP1 A;  4GME A;  1JPD X;  3LOV A;  4GUV A;  3SFD A;  2YR6 A;  2WPE A;  5JCN A;  2ZZC A;  1N61 C;  5U63 A;  3QFB A;  1RP0 A;  4DN1 A;  2YG6 A;  1LTX R;  3UP4 A;  4WCT A;  2WOV A;  3JZU A;  4K8D A;  1M64 A;  4O5U A;  4ENL A;  5BOF A;  1H2I A;  5G5H B;  2EQ8 A;  2P0I A;  4ICY A;  2W55 A;  1YKJ A;  2XFN A;  2PSN A;  3RRA A;  3A7A A;  2AKZ A;  5ENL A;  4GAV A;  4ZCW A;  4KT2 A;  2Q0L A;  1O5W A;  4RG3 A;  3FJ4 A;  2YVJ A;  4OPT A;  1M6I A;  1L9E A;  3I6D A;  1OJA A;  1FHV A;  3CPI G;  5FJO A;  3P93 A;  2BRY A;  3DER A;  3AWI A;  2GGG A;  1Q1W A;  1KD0 A;  3JVA A;  3CB3 A;  3R25 A;  5TR3 A;  2BCP A;  3G5R A;  3COX A;  3UCD A;  4J34 A;  2QGY A;  4H4Q A;  2PTW A;  3GMC A;  1E6E A;  2C75 A;  3SN0 A;  4H19 A;  2HQM A;  3UKH A;  3N4F A;  1JDF A;  5HYM A;  1XS2 A;  3CGE A;  4A9W A;  2EQ9 A;  2YLX A;  4TLX A;  2PP1 A;  4JHM A;  1NEK A;  1GRF A;  4J36 A;  2MUC A;  2XFQ A;  3OC4 A;  4FK1 A;  1YQ3 A;  1FL2 A;  5BUK A;  2A8X A;  1MNS A;  3FV9 A;  2BRA A;  4AT2 A;  1JRZ A;  1PBB A;  2RGO A;  4U8L A;  5EOW A;  2JB2 A;  3AE9 A;  2GQW A;  4JDR A;  1E1M A;  3QVP A;  4F4R A;  4IP4 A;  1DJQ A;  1S7M A;  2BAB A;  1PDH A;  2QQ6 A;  5KVI A;  1SJA A;  3NH3 X;  4TVW A;  3SSZ A;  3UOZ A;  2CFY A;  4EQR A;  2XH7 A;  1L9D A;  3RP6 A;  5JCI A;  4NZH A;  5C2T A;  4E6M A;  1JNR A;  2BS4 A;  3H7V A;  2QVH A;  2O56 A;  5KMP A;  4YTN A;  3GYX A;  1CL0 A;  4DHG A;  2IID A;  3UXK A;  1HYU A;  2QJM A;  4MMW A;  3GSI A;  3BI4 A;  2QDE A;  3NFU A;  4GGB A;  4TM3 A;  1KFY A;  1OJD A;  2GR3 A;  3SBF A;  4UDR A;  4OPL A;  2WPF A;  4IA6 A;  4EMW A;  1TZZ A;  2CVJ A;  3N6H A;  2EQ7 A;  2YM2 A;  3BJS A;  3T2K A;  4Z2R A;  3KUM A;  3T4W A;  3DK8 A;  1JRY A;  3F8R A;  3ZDN A; 
#chains in the Genus database with same CATH homology
 5DBJ A;  4AOX A;  3CIR A;  2IVE A;  4TLZ A;  3T2Y A;  4MJW A;  4UDQ A;  2JKC A;  3AEF A;  3S5W A;  3T37 A;  3SXI A;  4H2N A;  2R0G A;  3IHG A;  4U2S A;  3QJ4 A;  1NHP A;  1KNP A;  5KXJ A;  2WQY A;  1ZK7 A;  4X4J A;  2WEU A;  2VVM A;  3CNS A;  4GDE A;  4NWZ A;  3ICS A;  4C5O A;  5KNL A;  4YKG A;  2Q6U A;  3LAD A;  2VQ7 A;  4LII A;  3LZW A;  3NYE A;  3BI2 A;  2YWL A;  1OJC A;  3SY4 A;  1EBD A;  3CGB A;  4G74 A;  3SZC A;  1DNC A;  1GEU A;  2GR0 A;  1OJT A;  3UKP A;  2BAC A;  4Z25 A;  2C64 A;  5KWF A;  2C72 A;  1V59 A;  2C73 A;  1KSS A;  3DGH A;  1TYP A;  2X3N A;  3H4K A;  1PHH A;  2X99 A;  4LA1 A;  4EMI A;  4Y4L A;  3NTD A;  3NIX A;  1KN0 A;  1E1N A;  1W4X A;  1Y56 B;  3NG7 X;  4TM0 A;  3ITJ A;  4NTD A;  4O5Q A;  2V3A A;  3UOX A;  4B1B A;  1IJH A;  3AE2 A;  3KVE A;  4IVM B;  4AT0 A;  2NVK X;  3FG2 P;  2BK3 A;  1KSU A;  3ATQ A;  3NLC A;  4C3Y A;  2E5V A;  3CNT A;  4YSX A;  3PS9 A;  2BXR A;  3BNM A;  2XVE A;  2XYO A;  3UP5 A;  3FPZ A;  3ALL A;  3C4N A;  3VR8 A;  4AP3 A;  4B67 A;  2FJD A;  2A89 A;  3EF6 A;  5EB4 A;  3ALM A;  3K7Q X;  2UZZ A;  5GSN A;  4DSG A;  2QAE A;  4H4W A;  1GRT A;  4B66 A;  4APN A;  1ZMC A;  1JOA A;  2YLS A;  3P4R A;  2XVI A;  1OJ9 A;  3ALJ A;  3NYF A;  1GXF A;  2OAM A;  1GTE A;  3RHA A;  3LZX A;  2Z5X A;  1QLB A;  1D7Y A;  3LXD A;  3D8X A;  3NN6 X;  3DA1 A;  2WOI A;  2WS3 A;  4JY2 A;  2WDV A;  2TPR A;  3L8K A;  4ZCD A;  2WP6 A;  4NNJ A;  2ZZ0 A;  4YTM A;  4Z26 A;  3AEB A;  3O0H A;  3CMM A;  4Z44 A;  1B4V A;  4H4X A;  4EM4 A;  1Z6L A;  1CJ2 A;  1VQW A;  2YLZ A;  1CF3 A;  3AE6 A;  4H4T A;  1IUU A;  5FS9 A;  2C70 A;  3C4A A;  3H8I A;  4XWR A;  3K7T A;  2GR1 A;  1NEN A;  3NTA A;  1GT8 A;  2PYX A;  4EM3 A;  2Y6R A;  2X8C A;  5JCM A;  4K2X A;  3UTF A;  3LJP A;  3K30 A;  4C77 A;  1H7X A;  4GAP A;  1NHR A;  3NRN A;  3DK9 A;  2BS2 A;  2R45 A;  4HB9 A;  3CNJ A;  3SQP A;  5JCL A;  3ICT A;  1LQT A;  1B37 A;  3WE0 A;  4DSH A;  1K0J A;  1CHU A;  1N4V A;  3GRT A;  1ZP0 A;  2A87 A;  3ABV A;  3KPF A;  4OPC A;  2AQJ A;  1S2Q A;  1BGN A;  1JU2 A;  1Y56 A;  1GND A;  4K5S A;  3FBS A;  4Z43 A;  2JB3 A;  4YWO A;  4TM4 A;  3KLJ A;  4OPG A;  2YLW A;  3AXB A;  1TDF A;  3UOY A;  1N4U A;  2XLS A;  1KNR A;  1F8W A;  2VVL A;  3BHF A;  1CJC A;  3FMW A;  3P1W A;  5GRT A;  5LV9 A;  2R0P A;  1BWC A;  4GF7 A;  3HZL A;  4USR A;  3UKA A;  4EQS A;  1EL7 A;  1CC4 A;  3C96 A;  3CN8 A;  1H83 A;  3AYL A;  4Y4N A;  1PS9 A;  3SX6 A;  4JN9 A;  2BS3 A;  1NHQ A;  2R9Z A;  1QO8 A;  2XLP A;  1FEA A;  2I0Z A;  2ACZ A;  2TMD A;  3AD8 B;  2YM1 A;  3HYV A;  2YG5 A;  2YQU A;  3AED A;  4NEW A;  3GDP A;  1NDA A;  1LVL A;  1PBD A;  3Q6J A;  2R0C A;  1REO A;  1DXL A;  1GRA A;  2YAU A;  2QA2 A;  3B3R A;  3T0K A;  1ZMD A;  3DJD A;  1E39 A;  3S61 A;  1TDK A;  3LB8 A;  4A6N B;  3NK1 X;  4OVI A;  3P4P A;  3CND A;  1K4Q A;  2R4J A;  5EBK A;  1JEH A;  3HYX A;  3UKF A;  4A7A A;  1GPE A;  3SM8 A;  2XFP A;  1P2H A;  4H4U A;  1B8S A;  1PJ6 A;  3BHK A;  3IF9 A;  2IVD A;  1ZOY A;  1BZL A;  4J57 A;  2XVF A;  3D1C A;  4U8K A;  4U8O A;  2YR5 A;  5KMQ A;  1NPX A;  2GRT A;  1O94 A;  4D03 A;  2YLT A;  2GR2 A;  4XWZ A;  1ZY8 A;  4XXG A;  3QFA A;  2OLO A;  2XLT A;  2BC1 A;  5HHF A;  3IC9 A;  1XHC A;  2WET A;  3VRA A;  1FOH A;  5KOX A;  4U8N A;  4HA6 A;  1F6M A;  4II3 A;  3AEE A;  3BI5 A;  4JNA A;  4JNQ A;  3T2Z A;  3CPJ G;  5FS6 A;  3UKK A;  2JAE A;  1GSN A;  1TRB A;  1B5Q A;  3PVC A;  4I59 A;  4ADW A;  2NPX A;  3CTY A;  4A5L A;  4NTE A;  4E0V A;  5IQ4 A;  3L1R A;  4GR1 A;  3UOV A;  4H4P A;  4U2L A;  5JCK A;  5KVH A;  4J56 A;  2VRL A;  4OPI A;  4TM1 A;  1BKW A;  3G5Q A;  3NT6 A;  4REK A;  2Q7V A;  1YY5 A;  2F5Z A;  1PXA A;  1MOK A;  4PAA A;  1D7L A;  3AD9 B;  4BK2 A;  2C3D A;  2APG A;  1Q1R A;  4H4V A;  4P9S A;  3Q9T A;  1CC2 A;  4GCM A;  1GRB A;  1K0I A;  3T14 A;  5FS8 A;  2WHD A;  1QJD A;  2YVF A;  1GET A;  4G73 A;  2WPC A;  2V5Z A;  4YKF A;  3V3N A;  4BJZ A;  1H84 A;  1IUT A;  4YXD A;  1PBE A;  5U25 A;  2C7G A;  3NHO X;  2YG4 A;  4CCR A;  3EPT A;  5U1O A;  2JK6 A;  1ZOV A;  5FMH A;  1CC6 A;  1TDO A;  5J60 A;  3CNP A;  4KX6 A;  4KPR A;  2XLU A;  4YSZ A;  4LU6 A;  1K0L A;  4H4R A;  2BK4 A;  1ZKQ A;  4B64 A;  4WX1 A;  4BV6 A;  5BRT A;  1JNZ A;  3CGD A;  3RNM A;  4A6N A;  2C3C A;  1H82 A;  1E7P A;  4DGK A;  3NN0 X;  2YVG A;  4UDP A;  5JRB A;  1KF6 A;  1ONF A;  1LV0 A;  2C66 A;  2VVL G;  3I3L A;  3PG6 A;  2BC0 A;  1LQU A;  2YG3 A;  3B6D A;  3DH9 A;  3F8P A;  4H2Q A;  2X50 A;  1DJN A;  2C67 A;  4IVO B;  3URH A;  4CNK A;  3II4 A;  3DK4 A;  1SEZ A;  2PHH A;  4RSL A;  4A99 A;  4B63 A;  5FS7 A;  2E4G A;  1PJ7 A;  4H7U A;  4J2W A;  3SFE A;  4D04 A;  4ECH A;  4CRT A;  3KU9 A;  4OPU A;  2RGJ A;  2Z5Y A;  4YSY A;  2VOU A;  2XDO A;  2VQB A;  1H86 A;  2B7S A;  1LJ1 A;  1TDE A;  1PBF A;  3AE3 A;  2BK5 A;  2XCG A;  2Y6Q A;  3UTE A;  2XVH A;  1RYI A;  3GD4 A;  4FK1 C;  1BGJ A;  3GWF A;  3IWA A;  4USQ A;  3P4Q A;  4YTP A;  4H4S A;  2BCG G;  3LOV A;  3T31 A;  4GUV A;  4EIP A;  3SFD A;  2YR6 A;  2E1M A;  2WPE A;  4BJY A;  5JCN A;  2WDR A;  2ZZC A;  3ISH A;  5IQ1 A;  5U63 A;  3QFB A;  1RP0 A;  3VRB A;  2YG6 A;  4Y4M A;  3AE4 A;  2CDU A;  4JY3 A;  4ZCC A;  3VR9 A;  1LTX R;  3HYW A;  3GDN A;  1H7W A;  1COY A;  3V3O A;  3UP4 A;  3F8D A;  2C76 A;  4WCT A;  4Z2U A;  5BVA A;  5KMR A;  1MO9 A;  4II2 A;  2WOV A;  4K8D A;  1M64 A;  4FDC B;  1PBC A;  1RSG A;  4H2R A;  3G5S A;  4O5U A;  1H2I A;  4U2T A;  3CPH G;  1N1P A;  1VDC A;  3AE1 A;  3E1T A;  3AYJ A;  3GYI A;  1UKV G;  2X8G A;  2WU2 A;  4X9N A;  2GQF A;  2GVC A;  2V60 A;  2WP9 A;  2EQ8 A;  1PXB A;  2H88 A;  4ICY A;  4U8I A;  3GWD A;  1XDI A;  3RED A;  4CY8 A;  1X31 B;  1YKJ A;  2XFN A;  4BK1 A;  5L46 A;  4J31 A;  2WOW A;  3VRD B;  2BA9 A;  2DKH A;  3GRS A;  4GAV A;  4CBQ A;  4YSH A;  1F3P A;  2Q0L A;  1O5W A;  3SZ0 A;  4RG3 A;  1FEC A;  3SZW A;  2YVJ A;  1TDN A;  2VZ2 A;  3NGC X;  1VG9 A;  4K5R A;  4OPT A;  1M6I A;  1L9E A;  1PN0 A;  1BF3 A;  3I6D A;  3ZYX A;  5BUL A;  1Y0P A;  3M13 A;  1OJA A;  2B76 A;  3AE7 A;  5HY5 A;  2AR8 A;  3CPI G;  4B68 A;  2H89 A;  1GAL A;  1TYT A;  3QSE A;  3L5O A;  3QSS A;  2GAG B;  3P4S A;  2GAH B;  3SGL A;  4JQ9 A;  4K7Z A;  3SZF A;  2BRY A;  4H2P A;  4YT0 A;  2R46 A;  3ATR A;  4EQX A;  3KPK A;  3AWI A;  4K22 A;  3P9U A;  3RP8 A;  2O9Z A;  3OZ2 A;  4AP1 A;  4AOS A;  5KMS A;  1H81 A;  1DOC A;  1Q1W A;  2WBA A;  1MXT A;  2B9W A;  2B7R A;  1YQ4 A;  5TR3 A;  4EQW A;  3KKJ A;  2JB1 A;  4X9M A;  2BCP A;  1NG4 A;  5J7X A;  2WDQ A;  3G5R A;  3COX A;  3NKS A;  1CBO A;  2ZBW A;  1IUX A;  4NTC A;  2C65 A;  2Q0K A;  1F8S A;  2JBV A;  2BXS A;  4J34 A;  1NG3 A;  4J33 A;  4H4Q A;  1DOE A;  3DME A;  3AYI A;  3GMC A;  3UTG A;  1E6E A;  1VRQ B;  2C75 A;  4A79 A;  5KRQ A;  3GMB A;  4H50 A;  3QSM A;  2YG7 A;  1FEB A;  2XVJ A;  4GRT A;  4B69 A;  1H6V A;  4G6G A;  5KOW A;  3UCL A;  2AAQ A;  2QCU A;  4GDP A;  2HQM A;  1ELI A;  3UKH A;  5HYM A;  5C3J A;  2ARD A;  4H4Z A;  3CGE A;  1D4C A;  4A9W A;  2EQ9 A;  2YLX A;  4TLX A;  2FJA A;  3RP7 A;  1LPF A;  2WP5 A;  2B9X A;  2V61 A;  3AEG A;  1GER A;  3M12 A;  1NEK A;  1GRF A;  1CJ4 A;  1EL8 A;  1Q9I A;  1GRG A;  1JRX A;  1GOS A;  1VG0 A;  4J36 A;  2B9Y A;  4BK3 A;  1AOG A;  3JSK A;  4G6H A;  1GES A;  1NHS A;  2ZZB A;  2XFQ A;  3AD7 B;  3OC4 A;  4FK1 A;  3QVR A;  3NK0 X;  3V76 A;  1YQ3 A;  2DKI A;  4EMJ A;  1FL2 A;  5BUK A;  2A8X A;  5ER0 A;  2GEW A;  2FJB A;  2GH5 A;  1S2Y A;  2BRA A;  4AT2 A;  1JRZ A;  1D5T A;  1PBB A;  2GMJ A;  2OAL A;  4N9X A;  4ZN0 A;  3NK2 X;  2RGO A;  4U8L A;  1IUV A;  5EOW A;  2JB2 A;  5CKU A;  4OPD A;  3AE9 A;  2GQW A;  4JDR A;  1E1M A;  2OLN A;  2X8H A;  3QVP A;  2FBW A;  2BYB A;  4RG4 A;  1GRH A;  3SYI A;  4UP3 A;  1DJQ A;  1L9C A;  2J3N A;  1S7M A;  2BAB A;  2OA1 A;  4Z2T A;  3R9U A;  3AE5 A;  1GRE A;  2V6O A;  4I58 A;  1O95 A;  1PDH A;  1GV4 A;  5KVI A;  2WES A;  3GYJ A;  3M0O A;  2W0H A;  3NH3 X;  1F8R A;  2CUL A;  4H4Y A;  3NYC A;  1YQZ A;  4IA5 A;  5CQF A;  5M10 A;  3DGZ A;  3DJJ A;  1S3B A;  4OCG A;  1E1L A;  3UOZ A;  1ZX9 A;  3BNU A;  2CFY A;  4EQR A;  5M0Z A;  4BUR A;  1L9D A;  3RP6 A;  1CJ3 A;  5JCI A;  1IUW A;  4NZH A;  4U8J A;  5C2T A;  2EQ6 A;  3GD3 A;  4M52 A;  1XAN A;  4NEV A;  1JNR A;  1GTH A;  1D4D A;  2BS4 A;  1KDG A;  3K7M X;  4IV9 A;  2R4E A;  4B65 A;  2FJE A;  1EL9 A;  2YLR A;  4C74 A;  2C4C A;  3AB1 A;  4Z24 A;  5KMP A;  4YTN A;  3D9X A;  2VRM A;  3GYX A;  3IHM A;  1CL0 A;  3FIM B;  2GMH A;  5HXI A;  2RAB A;  2IID A;  3DJE A;  3DJG X;  1NAA A;  3CGC A;  1D4E A;  1PJ5 A;  3AEC A;  3NNE A;  3UKL A;  1FCD A;  2GV8 A;  5IPY A;  1HYU A;  3PO7 A;  2XLR A;  4EIQ A;  3GSI A;  2RGH A;  3BI4 A;  2GF3 A;  4A65 A;  4CY6 A;  4TM3 A;  3H8L A;  1KFY A;  1OJD A;  1S3E A;  2XFU A;  1DOD A;  2GR3 A;  4C3X A;  4UDR A;  2XFO A;  3KA7 A;  2V3B A;  4PAB A;  1L0V A;  4CNJ A;  5EB5 A;  1DOB A;  4G9K A;  2WPF A;  2QA1 A;  4OPL A;  3KD9 A;  3AE8 A;  3EAO A;  4IA6 A;  4FX9 A;  4EMW A;  1ZDL A;  3ICR A;  1E1K A;  2CVJ A;  2EQ7 A;  1XPQ A;  2YM2 A;  3T2K A;  2GB0 A;  4Z2R A;  3UKQ A;  3DK8 A;  3ADA B;  1JRY A;  1P2E A;  4U8M A;  4CCQ A;  4U8P A;  3AEA A;  1N4W A;  2YR4 A;  1IUS A;  3EAN A;  4DNA A;  1EL5 A;  3F8R A;  3UTH A;  3ZDN A;  3VQR A;  2WU5 A;  1PXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...