5JCMA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
432
structure length
429
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFFSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Os09g0567300 protein
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
total genus 140
structure length 429
sequence length 432
chains with identical sequence B
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jcmA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcmA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcmA02
4C5OA 1N4WA 3BI4A 4H4QA 4H2RA 3FPZA 4OPIA 4TM4A 1H86A 1UKVG 4JN9A 2OAMA 4H2NA 2VQ7A 2IVEA 3NNEA 2WU5A 2BK4A 5JCIA 3BNMA 1CC2A 2GR0A 2OA1A 1TDKA 1KSSA 1NAAA 4JQ9A 3CIRA 4K5SA 1F8RA 4YT0A 4GDPA 4D03A 1HYUA 2GAGB 4YXDA 2YM2A 4MJWA 4OCGA 1P2EA 4TM0A 5C3JA 1L9DA 3RP6A 3AE8A 4EQSA 1VG0A 2XFPA 3VRBA 5L46A 3CPIG 3SFDA 4H2PA 2BCPA 1CC6A 4FK1C 4EM3A 4HB9A 3NTAA 3KA7A 3QFBA 1VQWA 2BABA 3F8PA 1BF3A 3RNMA 5JCLA 4A6NB 4Z25A 2WDVA 2YR6A 3BHKA 4CY6A 1PJ5A 3P4RA 4TM1A 3UKQA 2E1MA 4CRTA 1CL0A 1E1MA 1KFYA 2E5VA 3ALJA 2AQJA 4B1BA 2GR1A 1RYIA 1D4DA 1B8SA 4H4UA 3NT6A 4GR1A 1GRAA 2B7RA 2A89A 3AE7A 2GF3A 1GXFA 1LQUA 1B4VA 3V76A 2X99A 2C73A 3ADAB 3KLJA 3KU9A 3VR9A 1O95A 2VOUA 3DJDA 4C77A 3B6DA 4H4SA 1MXTA 3VR8A 4J57A 4CCQA 4J56A 5EB4A 2C64A 2YLSA 2ZZBA 3AE4A 3NK0X 4Z2TA 4B67A 2YLWA 5JCMA 4EQRA 1JNRA 3GD3A 1D4EA 4H4RA 2YVGA 1GERA 2AAQA 2EQ7A 2ZZCA 1PBEA 1TRBA 2XLSA 3GRTA 3DA1A 3AEDA 2YG6A 2RABA 1KNRA 1S2QA 1CF3A 2ZBWA 2WEUA 2XFNA 2XVFA 3S61A 3CN8A 3EPTA 1PDHA 2VRMA 2TMDA 2Y6RA 3LZXA 4ZCCA 4H4TA 1SEZA 1DJNA 2GQWA 4K7ZA 4Y4MA 2WDQA 2FBWA 5J60A 1NHRA 1TDEA 4Z43A 3V3NA 1FCDA 4AP3A 4JDRA 2OLOA 1LJ1A 2C67A 2X8HA 2GVCA 3OC4A 2DKHA 1H81A 1DOEA 1ELIA 2XVHA 4HA6A 1ONFA 1NENA 1NEKA 1TDFA 2A87A 3ICRA 3NG7X 2WOIA 3GRSA 3QSMA 4TLXA 1IUSA 2C75A 1JEHA 4UDRA 1DOBA 2RGJA 1JRXA 1VRQB 2GAHB 3Q6JA 3AE5A 2WPFA 1OJAA 5FS9A 3M13A 3UOYA 2YWLA 2BXRA 4EMWA 5LV9A 1TYPA 4K22A 1CC4A 4YTMA 3DGHA 4ADWA 1LPFA 3KKJA 4A79A 1GALA 3K7TA 4FDCB 1DOCA 5BRTA 2R46A 1KSUA 2GMHA 1FL2A 3AYLA 3LOVA 4Y4NA 2PYXA 1YKJA 3ALLA 3GMBA 1MOKA 5KVHA 3G5RA 1E7PA 5JCNA 1IUXA 3M12A 3P4PA 1H83A 2FJDA 1GRGA 2JB2A 3V3OA 4CY8A 4LIIA 1COYA 2A8XA 2C3DA 1CJ3A 1ZX9A 5CQFA 1OJTA 2AR8A 3AEBA 1S3EA 1GREA 3BI5A 1H84A 1F8WA 3GDPA 4U8OA 4ZCDA 5KOWA 5C2TA 2B9YA 1GESA 3GMCA 1BZLA 2YR4A 4A65A 4JNQA 2XFQA 2FJAA 4NTCA 1E39A 4YSXA 1GSNA 1ZMDA 1BKWA 3ABVA 2BK5A 5M10A 2FJEA 3T37A 1EL9A 4BK1A 4CNJA 2YG4A 2XFUA 3URHA 1PXBA 1PJ7A 2GR3A 2JB1A 2XVEA 3AD9B 1IUUA 4C3YA 3NGCX 3II4A 3K7MX 3S5WA 2DKIA 3P1WA 2WP5A 3AE3A 4P9SA 1AOGA 5KRQA 2R9ZA 1IJHA 1RSGA 5EB5A 1LQTA 1Y56B 2XCGA 4OPCA 3NN0X 4YSZA 3D1CA 4IA5A 1K4QA 2QA2A 2XLUA 4U2LA 4XXGA 4YSHA 4Z2RA 4IA6A 2VVMA 1LVLA 3DGZA 3B3RA 4H4ZA 1PBCA 2BCGG 2VVLG 1MO9A 2V3BA 2WDRA 1OJCA 2CVJA 3NIXA 2F5ZA 1IUVA 3IC9A 4OPGA 5HHFA 2YG3A 3KD9A 4APNA 4RG3A 1CJ2A 4A9WA 3UP4A 1N4VA 2V61A 4B63A 4K8DA 3BNUA 5U63A 2C66A 1GT8A 3I6DA 4B69A 4CNKA 3RP7A 1ZOVA 2BS3A 2O9ZA 1EL7A 3G5QA 1GNDA 3AWIA 3LZWA 1NDAA 3GWFA 4TM3A 4GUVA 4U2TA 3NN6X 3GD4A 1FOHA 2OALA 4YWOA 4U8PA 5FS8A 1NG4A 2ACZA 2YR5A 2B76A 4H4XA 1QJDA 1YQ4A 1JRYA 1ZY8A 3DJGX 1NHSA 2R0CA 2RGHA 3AEGA 3ISHA 4H7UA 4JY2A 4H2QA 1FEBA 4UP3A 4I58A 1GTHA 3UKFA 2X8CA 2CDUA 1OJ9A 1W4XA 2GV8A 4LA1A 2BYBA 5FS6A 4PAAA 5FMHA 3Q9TA 4Z44A 1FECA 3DK9A 2C65A 3QJ4A 4U8KA 4YKGA 3NK2X 5U25A 4X9MA 3H4KA 3UTHA 4EIQA 3AEEA 2NPXA 1BGNA 4B66A 3UOXA 4M52A 4EQWA 3AE9A 4H50A 3AB1A 4H4YA 3ICSA 3IHMA 2B7SA 3QSSA 3UKKA 1E1NA 2BK3A 4WCTA 5ER0A 5KOXA 2WPCA 4REKA 2QCUA 2R45A 2Z5XA 3NYFA 4AT0A 1CBOA 3FMWA 4GRTA 1PXCA 2YG5A 4B64A 2C72A 2HQMA 2VQBA 3NH3X 4AT2A 3L8KA 1V59A 5BULA 2XDOA 1QLBA 2CULA 2R0PA 1S3BA 3DJEA 2APGA 2ARDA 3OZ2A 3FG2P 4I59A 4BK3A 3VQRA 3CGBA 2R0GA 2YQUA 4OPTA 2JK6A 2VZ2A 3LJPA 1Q1WA 4AOXA 3BHFA 3REDA 3CNDA 3BI2A 4KX6A 5J7XA 3UOZA 2FJBA 1ZDLA 4A7AA 1ZP0A 3AEFA 4ZN0A 4A5LA 3R9UA 4NZHA 1PBFA 4NEVA 3CGEA 5GRTA 2WHDA 3IHGA 2EQ9A 3G5SA 4U8JA 1KF6A 4O5QA 3CGCA 1E6EA 4GF7A 4TLZA 4Z2UA 3NYCA 4U8MA 5FS7A 1CHUA 1F6MA 3UOVA 3I3LA 2E4GA 3VRAA 1REOA 1NPXA 2VVLA 3UP5A 3LXDA 1XANA 3AE2A 3NHOX 1PHHA 2TPRA 4C3XA 1DNCA 4B68A 1GRBA 1GRTA 4J36A 3GYJA 5M0ZA 1XDIA 3DJJA 1VDCA 2GH5A 3F8RA 1N1PA 4X9NA 4U8IA 4J31A 2OLNA 2Q0LA 3AYJA 3CNJA 3PS9A 3SQPA 2C7GA 4UDPA 1Z6LA 1PN0A 3GYIA 4J34A 1TYTA 1S2YA 4LU6A 1ZOYA 3RP8A 2UZZA 3AD8B 4NEWA 3O0HA 1QO8A 3WE0A 2WU2A 1PJ6A 2X50A 1M64A 3L1RA 1RP0A 3CPHG 2C3CA 2IIDA 1KNPA 3LADA 5KWFA 2GQFA 1CJCA 2XLTA 2BC0A 3K7QX 1D7LA 2WESA 4WX1A 4BV6A 1E1LA 1H7XA 3PVCA 5IQ4A 4N9XA 3QVRA 5HYMA 3AXBA 4EQXA 1H6VA 3UKPA 1GOSA 3RHAA 2I0ZA 2X3NA 1M6IA 2YLXA 2JB3A 1TDNA 2V5ZA 3K30A 3UTEA 2XYOA 2JAEA 1L0VA 4EIPA 1K0IA 3NK1X 3C96A 3UKLA 3ZYXA 3AEAA 3NYEA 4BURA 5DBJA 1EBDA 4XWZA 2Y6QA 3ICTA 3HZLA 1ZKQA 2VRLA 4NTEA 2CFYA 2BA9A 2BACA 1PBBA 4ECHA 2WQYA 4A6NA 4YKFA 2GMJA 1D7YA 4EMJA 1H7WA 2EQ6A 1L9EA 3ATQA 3AYIA 2V3AA 3CNSA 4K2XA 4J33A 4PABA 5IPYA 2Z5YA 3H8LA 3DH9A 2V60A 1DJQA 2H89A 3GSIA 3E1TA 4DGKA 2NVKX 2GRTA 3QSEA 4FK1A 3UKHA 4U8LA 5BUKA 2YG7A 3NTDA 3LB8A 2RGOA 3ITJA 1F3PA 1Q1RA 3CGDA 4USRA 1GPEA 2Q7VA 4X4JA 3CPJG 1XPQA 2WOVA 1K0JA 3P4SA 3DK4A 4IVMB 3VRDB 4UDQA 3UKAA 4AOSA 3AD7B 1FEAA 5KVIA 3SFEA 4EMIA 4DNAA 4CCRA 3CNTA 4YSYA 2GB0A 4FX9A 4C74A 1EL8A 1PXAA 3AE6A 4O5UA 1CJ4A 3CNPA 2EQ8A 1K0LA 4Y4LA 5U1OA 4U8NA 1E1KA 1PS9A 3IF9A 3FBSA 5TR3A 2W0HA 1GEUA 3FIMB 4DSHA 1ZMCA 2YLRA 2X8GA 2XFOA 2WP9A 1H82A 3C4AA 3GDNA 1YQ3A 5BVAA 1YY5A 4H4VA 4H4WA 2XLRA 2WPEA 4IV9A 1JU2A 1TDOA 1XHCA 1NHPA 5IQ1A 4OPDA 4JY3A 1LTXR 2Q0KA 3EAOA 1OJDA 2GEWA 2YLZA 4RSLA 1D5TA 1B37A 1BGJA 3UTGA 2V6OA 3COXA 2Q6UA 2PHHA 5EOWA 3SGLA 3NLCA 2QAEA 3P9UA 4KPRA 3KPFA 3PO7A 2XVIA 4EM4A 3EANA 2H88A 2R4EA 4OVIA 2XLPA 4J2WA 1BWCA 1LV0A 4YTPA 1GRHA 1JRZA 1X31B 4XWRA 2J3NA 1D4CA 1GETA 5KXJA 3H8IA 2YVFA 3M0OA 1GRFA 4OPUA 2YAUA 1NG3A 3ATRA 1P2HA 3NKSA 1Y0PA 1JOAA 2YLTA 1PBDA 1GTEA 3ALMA 2BS2A 1N4UA 3DMEA 5CKUA 4DSGA 4NTDA 4AP1A 3DK8A 4E0VA 2C70A 1O5WA 4YTNA 5GSNA 5EBKA 1EL5A 5JCKA 3EF6A 2YM1A 3UCLA 4D04A 3AE1A 2BXSA 4RG4A 3D8XA 3F8DA 2C76A 2QA1A 1NHQA 3QFAA 3SM8A 4GDEA 3JSKA 3ZDNA 4A99A 2XVJA 4ICYA 2R4JA 2BS4A 3KVEA 1DXLA 4Z24A 5HXIA 1F8SA 1ZK7A 1GV4A 1VG9A 2WS3A 2JBVA 3C4NA 5HY5A 3P4QA 4USQA 4H4PA 4IVOB 1IUTA 2YVJA 3CTYA 2B9WA 2JKCA 1L9CA 2WP6A 4BJZA 1Q9IA 2ZZ0A 2WETA 2GR2A 1IUWA 2WOWA 1KDGA 1O94A 4Z26A 3AECA 3UTFA 3IWAA 2WBAA 3QVPA 2IVDA 4CBQA 4BK2A 4JNAA 4OPLA 4B65A 2BC1A 1DODA 2B9XA 1B5QA 1YQZA 3GWDA 4U2SA 4K5RA 3NRNA 4BJYA 1Y56A 1JNZA 4GCMA
chains in the Genus database with same CATH superfamily
1N4WA 4OPIA 4H2RA 4TM4A 1H86A 1UKVG 4Z1YA 3DIPA 3BNMA 1TDKA 4K5SA 3R10A 4D03A 1S7MA 1HYUA 4YXDA 2YM2A 3P93A 1KKOA 5L46A 4FK1C 4KEMA 5JCLA 2YR6A 4GFIA 4IP5A 4GISA 2E1MA 4CRTA 2OZTA 3ALJA 1KFYA 2GR1A 4GR1A 1GRAA 1LQUA 1EBGA 3V76A 2C73A 3TJ4A 2POZA 3AN1A 2VOUA 2PTWA 4J57A 4J56A 3AE4A 3NK0X 2XH7A 3GD3A 2AAQA 3GRTA 3AEDA 2E5AA 2ZBWA 2VRMA 4GAPA 1SEZA 4K7ZA 2FBWA 5J60A 1NHRA 1TDEA 4JDRA 2C67A 1DTNA 3PWGA 2A87A 3GYXA 4TLXA 1JEHA 3V4BA 1VRQB 2GAHB 3AE5A 3UOYA 4EMWA 4YTMA 2PSNA 1LPFA 4A79A 3DG6A 3UGVA 5KMRA 4A35A 2QDEA 2R46A 2GMHA 3AYLA 3ALLA 1MOKA 5KVHA 3G5RA 1IUXA 4IHCA 3OZYA 2FJDA 4GMEA 4CY8A 2A8XA 3DFYA 3T31A 2PTYA 2I5QA 3VC6A 5BOEA 1ZMDA 2BK5A 3IJQA 4CNJA 2GR3A 2XVEA 3HYXA 3NGCX 3H70A 3S5WA 3I6TA 2DKIA 5KRQA 1AOGA 1RSGA 3SY4A 1WUEA 3BSMA 4XXGA 4IA6A 2BCGG 1MO9A 2V3BA 2WDRA 3SBFA 2PPGA 3KD9A 5U63A 4B69A 3RP7A 4NNJA 3G5QA 1GNDA 3AWIA 3LZWA 4U2TA 1N62C 1NG4A 1ZY8A 1NHSA 4GYPA 2W55A 2PTZA 4I58A 4MKSA 1OJ9A 2CDUA 2OZ8A 2GV8A 4LA1A 4PAAA 1FECA 3NK2X 2NPXA 1V97A 3MQTA 3S47A 3D47A 1E1NA 3HPFA 3NYFA 2YG5A 4B64A 3ENLA 3NH3X 3L8KA 3FG2P 4BK3A 3BHFA 3VFCA 4KX6A 5J7XA 3L5OA 3NXLA 4NZHA 3CGEA 3IHGA 3G5SA 4U8JA 4O5QA 4GF7A 4U8MA 1CHUA 4ZCWA 2E4GA 4JN8A 4C3XA 1PHHA 2TPRA 1GRBA 4U8IA 2Q0LA 2XSXA 4TVWA 1Z6LA 3TWAA 1FIQB 1TYTA 3DEQA 4LU6A 3AD8B 3O0HA 1RP0A 3CPHG 3ZVHB 3LADA 3K7QX 3FV9A 3QVRA 2PS2A 3UKPA 1GOSA 5G5GB 3OW1A 2V5ZA 2BRYA 2FKPA 1L0VA 3C96A 1EBDA 4XWZA 3U9IA 2BACA 1PBBA 1EC7A 1D7YA 2EQ6A 3AYIA 2V3AA 2OPJA 4J33A 4PABA 2Z5YA 3DH9A 2P0IA 1DJQA 3GSIA 2GRTA 3UKHA 3HRDC 4J1OA 2RGOA 1F3PA 4K2SA 2Q7VA 3CPJG 2GGEA 3K1GA 3VRDB 4AOSA 4E6MA 4FX9A 4C74A 3I6EA 3HYVA 1E1KA 3IF9A 1GEUA 3FIMB 4DSHA 1ZMCA 2YLRA 3V3WA 2X8GA 3GDNA 3C4AA 3RR1A 2XLRA 2WPEA 4IV9A 2QJMA 2GEWA 5EOWA 4KPRA 3PO7A 3CMMA 2XVIA 3A7RA 3EANA 4OVIA 3RCYA 4FP1A 1X31B 5KXJA 1NG3A 1P2HA 3H12A 1W6TA 5EBKA 3N4FA 4IZGA 3D8XA 2ONEA 2PU1A 2R4JA 3KVEA 4HNCA 3UXKA 1F8SA 1ZK7A 1VG9A 5HY5A 3P4QA 4H4PA 2PCEA 2YVJA 1L9CA 2WP6A 2HXUA 3IWAA 2WBAA 3QVPA 3NVYB 4BK2A 1DODA 3GWDA 1SJCA 4HCDA 4H4QA 3SZ0A 4JN9A 2VQ7A 2IVEA 1FHVA 1CC2A 2OA1A 1VQZA 1NAAA 3CIRA 4YT0A 1F8RA 5J04A 2GAGB 3TWBA 4TM0A 2QJNA 4EQSA 1VG0A 2MNRA 3Q4DA 2BCPA 1CC6A 4K8GA 3NTAA 3QFBA 2AL2B 1VQWA 2BABA 1BF3A 3RNMA 3NZGA 3FXGA 3BHKA 4CY6A 1PJ5A 3P4RA 3UKQA 4II2A 3GO2A 3NT6A 1B4VA 3ADAB 3NFUA 3KU9A 3TTEA 1VDVA 4H4SA 3SQSA 1MXTA 4HCLA 2C64A 4M6UA 4B67A 5KNLA 1JNRA 2EQ7A 3DA1A 4A6GA 3DGBA 1S2QA 2WEUA 4H19A 2QJJA 4HCHA 3VCCA 1KCZA 3CAWA 3V3NA 1FCDA 1LJ1A 2X8HA 3OC4A 2DKHA 1H81A 1DOEA 3IJLA 4HA6A 1JPDX 1NENA 1TDFA 6ENLA 1IUSA 4UDRA 2W3RA 1MRAA 3KPKA 4ZA0A 5FS9A 4K22A 1CC4A 4ADWA 4KT2A 3K7TA 4FDCB 1FL2A 4Y4NA 2PP1A 3P4PA 3SX6A 2PGEA 3VA8A 4GGBA 4LIIA 1CJ3A 1OJTA 1S3EA 3BI5A 4G7FA 3GDPA 4ZCDA 3HW2A 5G5HB 3B9JB 1BKWA 5M10A 3T37A 2HZGA 1EL9A 1ECQA 2YG4A 1PXBA 2GGGA 3AD9B 4E5TA 3K7MX 3U4FA 3P1WA 3AE3A 1IJHA 1LQTA 2XCGA 1K4QA 4Z2RA 2GSHA 3DGZA 5HHFA 1MUCA 5EU9A 4HYRA 1N4VA 4B63A 3PWIA 2C66A 1GT8A 3I6DA 4CNKA 4HNLA 3NO1A 1NDAA 3GWFA 3MWCA 4GUVA 1H2IA 2OALA 4U8PA 5FS8A 2YR5A 2B76A 4H4XA 3ISHA 1YQ4A 4H7UA 4E4UA 2RGHA 3THUA 1GTHA 1W4XA 1TZZA 3AMZA 4ROPA 4Z44A 3DK9A 2C65A 4YKGA 2AKZA 5U25A 4EIQA 3AEEA 4M52A 3UJEA 4EQWA 4H4YA 3CK5A 2BK3A 4WCTA 5ER0A 5KOXA 4REKA 4AT0A 1CBOA 1PXCA 2C72A 2HQMA 2PA6A 1QLBA 4HPNA 3ETRB 3DJEA 3OZ2A 4OPTA 2YQUA 2VZ2A 3LJPA 3REDA 3N6JA 3CNDA 3SZCA 4A5LA 3R9UA 1FFVC 3UJFA 2OX4A 4NEVA 1FFUC 3CGCA 1E6EA 4Z2UA 3NYCA 3TJIA 1F6MA 3PG6A 1NPXA 3UP5A 4J36A 3GYJA 3CXBA 4F4RA 2PGWA 3F8RA 3CT2A 4J31A 3CNJA 1PN0A 1ELSA 2XH2A 1QO8A 5KMPA 2WU2A 1PJ6A 1N61C 3NVVB 2IIDA 1R6WA 2XLTA 5FJTA 2QGYA 3PVCA 5IQ4A 5HYMA 3RGTA 2X3NA 2XYOA 3NK1X 4BURA 5DBJA 4DXKA 1ZKQA 1L9EA 3RITA 3ZLGA 3CNSA 2H89A 3E1TA 3V5FA 4FK1A 2ZADA 2DW6A 3QPEA 3SSZA 3LB8A 2P8CA 1GPEA 3DG7A 3UCDA 3P4SA 3DK4A 4IVMB 3UKAA 3AD7B 3FJ4A 4DX3A 4CCRA 3CNTA 1TKKA 2GB0A 1EL8A 4G73A 5FJOA 3FVDA 4O5UA 2EQ8A 1K0LA 4Y4LA 2GDQA 5U1OA 1PS9A 3FBSA 2W0HA 1YQ3A 1YY5A 1ONEA 1FHUA 2E3TA 3A7AA 4DN1A 4OPDA 4JY3A 2Q0KA 2YLZA 1D5TA 1BGJA 4DYEA 3SGLA 3NLCA 4JN7A 4EM4A 2R4EA 1BWCA 2J3NA 1D4CA 1GETA 3M0OA 4OPUA 3SXIA 2PP3A 2OQHA 4DSGA 1STZA 3DMEA 3DK8A 2C70A 3T0KA 4D04A 3UCLA 3EF6A 3F8DA 1NHQA 3SM8A 3NVZB 4A99A 4ZOHB 4ICYA 2GGJA 2BS4A 1DXLA 5HXIA 2JBVA 1SB3B 4IVOB 1IUTA 2P8BA 2ZZ0A 2GR2A 4TVYA 2WOWA 4Z26A 3SZWA 4JNAA 2B9XA 4U2SA 1B5QA 1RM6B 1BKHA 3UJ2A 3FPZA 1ZXIC 3R0UA 2GR0A 1KSSA 4JQ9A 4A3RA 4MJWA 4OCGA 5ENLA 3AE8A 2XFPA 3SYIA 1X2HA 3CPIG 3SFDA 4H2PA 3UXLA 3B97A 4EM3A 4HB9A 4A6NB 3F8PA 3TOYA 2WDVA 3S5SA 2DW7A 4IP4A 2AQJA 4B1BA 1D4DA 1B8SA 4G9KA 4H4UA 4II3A 2B7RA 3AE7A 2GF3A 3KLJA 3VR9A 1O95A 1RVKA 3VR8A 4CCQA 5EB4A 2YLSA 3VCNA 5JRBA 5JCMA 4EQRA 4H4RA 2YVGA 3SN1A 1PBEA 2XLSA 2YG6A 2RABA 1KNRA 3MZNA 3S61A 3EPTA 2TMDA 4GAVA 3VDGA 2Y6RA 4ZCCA 4H4TA 3R1ZA 2GQWA 4Y4MA 4J3ZA 3T4WA 4Z43A 4AP3A 2OLOA 3TW9A 1ELIA 1ONFA 2OG9A 1NEKA 3QSMA 2WOIA 2C75A 4E4FA 1JRXA 3Q6JA 2C4CA 3N6HA 2YWLA 1NELA 3KKJA 1GALA 1DOCA 3UJRA 3LOVA 2PYXA 1YKJA 1E7PA 5JCNA 3M12A 2OO6A 1H83A 1COYA 2RDXA 5CQFA 2AR8A 3AEBA 1GREA 1H84A 4U8OA 3ZVHA 1GESA 1L8PA 1BZLA 1JRPA 4A65A 4JNQA 2XFQA 2FJAA 3FCPA 1E39A 1GSNA 2FJEA 4BK1A 3FYYA 3PK7A 2JB1A 1IUUA 4P9SA 2HNEA 2XH4A 1Y56B 3NN0X 4YSZA 3V5CA 3D1CA 4IA5A 2XLUA 4U2LA 2VVMA 3B3RA 4H4ZA 2W3SA 1OJCA 2F5ZA 2YG3A 3GD6A 1CJ2A 1MDLA 3BJSA 4K8DA 4TM3A 2CHRA 1FOHA 4IT1A 2ACZA 1QJDA 4JY2A 1JCTA 3EKGA 1FEBA 4UP3A 5KMQA 3UKFA 2BYBA 5FS6A 5FMHA 3Q9TA 3QJ4A 4U8KA 4X9MA 3UTHA 3H4KA 3EUB3 1BGNA 3DG3A 3AE9A 2P3ZA 3AB1A 3ICSA 3RRAA 3IHMA 2B7SA 3QSSA 3UKKA 2WPCA 2QCUA 2GGHA 3FMWA 2VQBA 4AT2A 1V59A 5BULA 2XDOA 1S3BA 2QDDA 2APGA 3VQRA 3CGBA 4AOXA 4H2HA 3UOZA 4DWDA 4A7AA 1WUFA 4ZN0A 1PBFA 4Z17A 2WHDA 2EQ9A 1KF6A 3SJNA 5FS7A 3SN0A 3GC2A 3T9PA 1R0MA 3VRAA 3LXDA 3CB3A 3NHOX 4B68A 1GRTA 4IL2A 1BQGA 5M0ZA 3DJJA 2GH5A 2AL1A 2OLNA 3AYJA 3PS9A 3SQPA 4UDPA 3GYIA 4J34A 1S2YA 1ZOYA 3DDMA 2UZZA 4NEWA 3WE0A 2XGZA 2X50A 1KNPA 3P3BA 2GQFA 3NVWB 2OFJA 1D7LA 4WX1A 3T2ZA 1H7XA 3AXBA 3H7VA 1H6VA 3GY1A 3RHAA 2GGIA 3HYWA 1M6IA 2YLXA 4E8GA 3K30A 3UTEA 2JAEA 1IYXA 2NQLA 3JW7A 3UKLA 3AEAA 3JVAA 2CFYA 3T6CA 2AL2A 2GMJA 4EMJA 3ATQA 1E9IA 5IPYA 3H8LA 2NVKX 4GYPC 4G6HA 5BUKA 3ITJA 1Q1RA 5FJPA 4DHGA 4X4JA 3RO6A 1K0JA 4YSYA 7ENLA 3ZLFA 1YEYA 3AE6A 5IDZA 2W54A 4U8NA 3OTRA 2WP9A 1H82A 1TDOA 1XHCA 1NHPA 1LTXR 1OJDA 4RSLA 3COXA 2Q6UA 2PHHA 2QAEA 3P9UA 3KPFA 2XLPA 1LV0A 4YTPA 1JRZA 1P43A 4XWRA 2PP0A 3QTPA 3H8IA 2YVFA 1GRFA 3ATRA 4H83A 3NKSA 1Y0PA 1JOAA 2YLTA 1GTEA 3ALMA 2BS2A 2OQYA 4AP1A 3ES8A 5GSNA 5JCKA 2YM1A 3SR6B 4ENLA 3AE1A 4RG4A 2C76A 2QA1A 3BOXA 3JSKA 4YWSA 3JZUA 4KWSA 1GV4A 4USQA 2B9WA 2JKCA 2QQ6A 1O94A 2IVDA 4OPLA 4B65A 2BC1A 1JNZA 4GCMA 1EBHA 4C5OA 1PDYA 3BI4A 2OAMA 2O56A 4H2NA 3NNEA 2WU5A 2BK4A 5JCIA 3UCCA 4GDPA 3OPSA 1P2EA 5C3JA 1L9DA 3RP6A 3ZVIA 1SJDA 1JDFA 3KA7A 3SN4A 4Z25A 4TM1A 1CL0A 1E1MA 2E5VA 3NRZB 1RYIA 3TQPA 2A89A 1GXFA 3I4KA 3T14A 2X99A 3DJDA 4C77A 3B6DA 2ZZBA 4Z2TA 2YLWA 1D4EA 1NU5A 1GERA 2ZZCA 1N63C 1TRBA 1SJBA 3D46A 3R0KA 2OVLA 3N4EA 1CF3A 3QN3A 2XFNA 2XVFA 3CN8A 1PDHA 3LZXA 1DJNA 2WDQA 1SJAA 2GVCA 2XVHA 1KKRA 3ICRA 3NG7X 3GRSA 1DOBA 2RGJA 1KN0A 2WPFA 1OJAA 1OEPA 1FO4A 3R25A 3M13A 2BXRA 5LV9A 1TYPA 1MDRA 3DGHA 3IJIA 5BRTA 3ES7A 3H8AA 1KSUA 3GMBA 1EC8A 1GRGA 4GGHA 2JB2A 3V3OA 2C3DA 1ZX9A 3T2KA 1F8WA 5KOWA 4G6GA 5C2TA 2B9YA 3GMCA 2YR4A 1F9CA 4NTCA 4YSXA 3ABVA 2XH0A 2XFUA 3URHA 1PJ7A 4C3YA 3II4A 2WP5A 2R9ZA 5EB5A 4OPCA 3VC5A 2QA2A 4YSHA 1LVLA 1PBCA 2VVLG 2CVJA 4MGGA 3NIXA 1IUVA 3IC9A 4OPGA 4APNA 4RG3A 4A9WA 3UP4A 2V61A 1TE6A 1N5XA 3BNUA 3R07C 4NWZA 4MMWA 1ZOVA 2BS3A 2O9ZA 1EL7A 1JPMA 3NN6X 3GD4A 5BOFA 4YWOA 3VRBA 3A7UA 1JRYA 3DJGX 2R0CA 3OZMA 3AEGA 4H2QA 2X8CA 2OLAA 1T3QC 3KUMA 4B66A 3UOXA 4H50A 3UJSA 5KMSA 5FJRA 2R45A 2Z5XA 3P0WA 3QKEA 4GRTA 5FJUA 1XS2A 2CULA 2R0PA 2ARDA 3EEZA 4I59A 2R0GA 2JK6A 2OKTA 1Q1WA 3T2YA 3Q45A 1EC9A 4M0XA 3BI2A 2FJBA 1ZDLA 1ZP0A 3AEFA 5GRTA 3MUCA 3STPA 2AKMA 4TLZA 1JROA 4GIRA 3UOVA 3I3LA 1REOA 2VVLA 1XANA 3AE2A 1DNCA 4H1ZA 3NS1B 1XDIA 1VDCA 1N1PA 4X9NA 2ZC8A 4FI4A 4EWJA 2C7GA 3ZLHA 3RP8A 2MUCA 3R11A 1M64A 3L1RA 2C3CA 3D9XA 5KWFA 1CJCA 3QLDA 2BC0A 2WESA 4BV6A 1E1LA 1N60C 4N9XA 3CYJA 4HN8A 4EQXA 3T8QA 2I0ZA 2GL5A 2JB3A 1TDNA 2P88A 4K1WA 4EIPA 1K0IA 3CXOA 3ZYXA 3NYEA 2PODA 2Y6QA 3ICTA 3HZLA 2VRLA 4NTEA 2BA9A 1N5WC 3DERA 4ECHA 2WQYA 4A6NA 4YKFA 1H7WA 4K2XA 2V60A 3OP2A 4DGKA 3QSEA 4U8LA 2YG7A 3NTDA 4USRA 3CGDA 2PTXA 3DESA 2HXTA 1XPQA 2WOVA 4IL0A 4UDQA 1FEAA 5KVIA 3SFEA 4EMIA 4DNAA 1KD0A 3IK4A 1PXAA 2PU0A 1PDZA 1CJ4A 3CNPA 3MKCA 5TR3A 3MSYA 2XFOA 2FYMA 5BVAA 4H4VA 4H4WA 1JU2A 2BRAA 5IQ1A 2QVHA 3EAOA 3AM9A 1B37A 3UTGA 2V6OA 1WYGA 3DFHA 3MY9A 2H88A 4J2WA 3TCSA 1GRHA 3SZFA 4G8TA 4KPLA 2YAUA 3PFRA 2PMQA 1PBDA 5CKUA 4E0VA 1N4UA 4NTDA 1X2GA 1O5WA 4YTNA 1EL5A 1XPYA 2BXSA 3QFAA 4GDEA 4G74A 3ZDNA 2XVJA 2OZ3A 4Z24A 2WS3A 3C4NA 1P48A 3CTYA 4BJZA 1Q9IA 2WETA 1IUWA 1KDGA 3AECA 3UTFA 4JHMA 4CBQA 4BJYA 1YQZA 4K5RA 3NRNA 1Y56A 1MNSA 4X2PA
chains in the Genus database with same CATH topology
4C5OA 1N4WA 3BI4A 4H4QA 4H2RA 3FPZA 4OPIA 4TM4A 1H86A 3SZ0A 1UKVG 4JN9A 2OAMA 4H2NA 2VQ7A 2IVEA 3NNEA 2WU5A 2BK4A 5JCIA 3BNMA 1CC2A 2GR0A 2OA1A 1TDKA 1KSSA 1NAAA 4JQ9A 3CIRA 4K5SA 1F8RA 4YT0A 4GDPA 4D03A 1S7MA 1HYUA 2GAGB 4YXDA 2YM2A 4MJWA 4OCGA 1P2EA 4TM0A 5C3JA 1L9DA 3RP6A 3AE8A 4EQSA 1VG0A 2XFPA 3SYIA 3VRBA 5L46A 3CPIG 3SFDA 4H2PA 2BCPA 1CC6A 4FK1C 4EM3A 4HB9A 3NTAA 3KA7A 3QFBA 1VQWA 2BABA 3F8PA 1BF3A 3RNMA 5JCLA 4A6NB 4Z25A 2WDVA 2YR6A 3BHKA 4CY6A 1PJ5A 3P4RA 4TM1A 3UKQA 2E1MA 4CRTA 4II2A 1CL0A 1E1MA 1KFYA 2E5VA 3ALJA 2AQJA 4B1BA 2GR1A 1RYIA 1D4DA 1B8SA 4G9KA 4H4UA 3NT6A 4GR1A 4II3A 1GRAA 2B7RA 2A89A 3AE7A 2GF3A 1GXFA 1LQUA 1B4VA 3T14A 3V76A 2X99A 2C73A 3ADAB 3KLJA 3KU9A 3VR9A 1O95A 2VOUA 3DJDA 4C77A 3B6DA 4H4SA 1MXTA 3VR8A 4J57A 4CCQA 4J56A 5EB4A 2C64A 2YLSA 2ZZBA 3AE4A 3NK0X 4Z2TA 5JRBA 4B67A 2YLWA 5JCMA 5KNLA 4EQRA 1JNRA 3GD3A 1D4EA 4H4RA 2YVGA 1GERA 2AAQA 2EQ7A 2ZZCA 1PBEA 1TRBA 2XLSA 3GRTA 3DA1A 3AEDA 2YG6A 2RABA 1KNRA 1S2QA 1CF3A 2ZBWA 2WEUA 2XFNA 2XVFA 3S61A 3CN8A 3EPTA 1PDHA 2VRMA 2TMDA 4GAVA 2Y6RA 3LZXA 4GAPA 4ZCCA 4H4TA 1SEZA 1DJNA 2GQWA 4K7ZA 4Y4MA 2WDQA 2FBWA 5J60A 1NHRA 1TDEA 4Z43A 3V3NA 1FCDA 4AP3A 4JDRA 2OLOA 1LJ1A 2C67A 2X8HA 2GVCA 3OC4A 2DKHA 1H81A 1DOEA 1ELIA 2XVHA 4HA6A 1ONFA 1NENA 1NEKA 1TDFA 2A87A 3GYXA 3ICRA 2WOIA 3GRSA 3NG7X 3QSMA 1IUSA 2C75A 1JEHA 4TLXA 4UDRA 1DOBA 2RGJA 1JRXA 1VRQB 2GAHB 3Q6JA 1KN0A 3AE5A 2WPFA 2C4CA 1OJAA 3KPKA 5FS9A 3M13A 3UOYA 2YWLA 2BXRA 4EMWA 5LV9A 1TYPA 4K22A 1CC4A 4YTMA 3DGHA 4ADWA 1LPFA 3KKJA 4A79A 1GALA 3K7TA 5KMRA 4FDCB 1DOCA 5BRTA 2R46A 1KSUA 2GMHA 1FL2A 3AYLA 3LOVA 4Y4NA 2PYXA 1YKJA 3ALLA 3GMBA 1MOKA 5KVHA 3G5RA 1E7PA 5JCNA 1IUXA 3M12A 3P4PA 3SX6A 1H83A 2FJDA 1GRGA 2JB2A 3V3OA 4CY8A 4LIIA 1COYA 2A8XA 2C3DA 1CJ3A 1ZX9A 5CQFA 1OJTA 2AR8A 3AEBA 3T2KA 1S3EA 1GREA 3BI5A 1H84A 1F8WA 3T31A 3GDPA 4U8OA 4ZCDA 5KOWA 4G6GA 5C2TA 2B9YA 1GESA 3GMCA 1BZLA 2YR4A 4A65A 4JNQA 2XFQA 2FJAA 4NTCA 1E39A 4YSXA 1GSNA 1ZMDA 1BKWA 3ABVA 2BK5A 5M10A 2FJEA 3T37A 1EL9A 4BK1A 4CNJA 2YG4A 2XFUA 3URHA 1PXBA 1PJ7A 2GR3A 2JB1A 2XVEA 3AD9B 1IUUA 4C3YA 3HYXA 3II4A 3NGCX 3K7MX 3S5WA 2DKIA 3P1WA 2WP5A 3AE3A 4P9SA 1AOGA 5KRQA 2R9ZA 1IJHA 1RSGA 5EB5A 1LQTA 3SY4A 1Y56B 2XCGA 4OPCA 3NN0X 4YSZA 3D1CA 4IA5A 1K4QA 2QA2A 2XLUA 4U2LA 4XXGA 4YSHA 4Z2RA 4IA6A 2VVMA 1LVLA 3DGZA 3B3RA 4H4ZA 1PBCA 2BCGG 2VVLG 1MO9A 2V3BA 2WDRA 1OJCA 2CVJA 3NIXA 2F5ZA 1IUVA 3IC9A 4OPGA 5HHFA 2YG3A 3KD9A 4APNA 4RG3A 1CJ2A 4A9WA 3UP4A 1N4VA 2V61A 4B63A 4K8DA 3BNUA 5U63A 2C66A 1GT8A 3I6DA 4B69A 4NWZA 4CNKA 3RP7A 4NNJA 1ZOVA 2BS3A 2O9ZA 1EL7A 3G5QA 1GNDA 3AWIA 3LZWA 1NDAA 3GWFA 4TM3A 4GUVA 4U2TA 3NN6X 3GD4A 1H2IA 1FOHA 2OALA 4YWOA 4U8PA 5FS8A 1NG4A 2ACZA 2YR5A 2B76A 4H4XA 1QJDA 1YQ4A 1JRYA 1ZY8A 3DJGX 1NHSA 2R0CA 2RGHA 3AEGA 3ISHA 4H7UA 4JY2A 4H2QA 1FEBA 4UP3A 4I58A 5KMQA 1GTHA 3UKFA 2X8CA 2CDUA 1OJ9A 1W4XA 2GV8A 4LA1A 2BYBA 5FS6A 4PAAA 5FMHA 3Q9TA 4Z44A 1FECA 3DK9A 2C65A 3QJ4A 4U8KA 4YKGA 3NK2X 5U25A 4X9MA 3H4KA 3UTHA 4EIQA 3AEEA 2NPXA 1BGNA 4B66A 3UOXA 4M52A 4EQWA 3AE9A 4H50A 3AB1A 4H4YA 3ICSA 5KMSA 3IHMA 2B7SA 3QSSA 3UKKA 1E1NA 2BK3A 4WCTA 5ER0A 5KOXA 2WPCA 4REKA 2QCUA 2R45A 2Z5XA 3NYFA 4AT0A 1CBOA 3FMWA 4GRTA 1PXCA 2YG5A 4B64A 2C72A 2HQMA 2VQBA 3NH3X 4AT2A 3L8KA 1V59A 5BULA 2XDOA 1QLBA 2CULA 2R0PA 1S3BA 3DJEA 2APGA 2ARDA 3OZ2A 3FG2P 4I59A 4BK3A 3VQRA 3CGBA 2R0GA 2YQUA 4OPTA 2JK6A 2VZ2A 3LJPA 1Q1WA 4AOXA 3BHFA 3T2YA 3REDA 3CNDA 3SZCA 3BI2A 4KX6A 5J7XA 3UOZA 2FJBA 1ZDLA 4A7AA 1ZP0A 3L5OA 3AEFA 4ZN0A 4A5LA 3R9UA 4NZHA 1PBFA 4NEVA 3CGEA 5GRTA 2WHDA 3IHGA 2EQ9A 3G5SA 4U8JA 1KF6A 4O5QA 3CGCA 1E6EA 4GF7A 4TLZA 4Z2UA 3NYCA 4U8MA 5FS7A 1CHUA 1F6MA 3PG6A 3UOVA 3I3LA 2E4GA 3VRAA 1REOA 1NPXA 2VVLA 3UP5A 3LXDA 1XANA 3AE2A 3NHOX 1PHHA 2TPRA 4C3XA 1DNCA 4B68A 1GRBA 1GRTA 4J36A 3GYJA 5M0ZA 1XDIA 3DJJA 1VDCA 2GH5A 3F8RA 1N1PA 4X9NA 4U8IA 4J31A 2OLNA 2Q0LA 3AYJA 3CNJA 3PS9A 3SQPA 2C7GA 4UDPA 1Z6LA 1PN0A 3GYIA 4J34A 1TYTA 1S2YA 4LU6A 1ZOYA 3RP8A 2UZZA 3AD8B 4NEWA 3O0HA 1QO8A 5KMPA 3WE0A 2WU2A 1PJ6A 2X50A 1M64A 3L1RA 1RP0A 3CPHG 2C3CA 2IIDA 1KNPA 3D9XA 3LADA 5KWFA 2GQFA 1CJCA 2XLTA 2BC0A 3K7QX 1D7LA 2WESA 4WX1A 4BV6A 1E1LA 3T2ZA 1H7XA 3PVCA 5IQ4A 4N9XA 3QVRA 5HYMA 3AXBA 4EQXA 1H6VA 3UKPA 1GOSA 3RHAA 2I0ZA 3HYWA 2X3NA 1M6IA 2YLXA 2JB3A 1TDNA 2V5ZA 2BRYA 3K30A 3UTEA 2XYOA 2JAEA 1L0VA 4EIPA 1K0IA 3NK1X 3C96A 3UKLA 3ZYXA 3AEAA 3NYEA 4BURA 5DBJA 1EBDA 4XWZA 2Y6QA 3ICTA 3HZLA 1ZKQA 2VRLA 4NTEA 2CFYA 2BA9A 2BACA 1PBBA 4ECHA 2WQYA 4A6NA 4YKFA 2GMJA 1D7YA 4EMJA 1H7WA 2EQ6A 1L9EA 3ATQA 3AYIA 2V3AA 3CNSA 4K2XA 4J33A 4PABA 5IPYA 2Z5YA 3H8LA 3DH9A 2V60A 1DJQA 2H89A 3GSIA 3E1TA 4DGKA 2NVKX 2GRTA 3QSEA 4FK1A 3UKHA 4U8LA 4G6HA 5BUKA 2YG7A 3NTDA 3LB8A 2RGOA 3ITJA 1F3PA 1Q1RA 3CGDA 4USRA 1GPEA 2Q7VA 4X4JA 3CPJG 1XPQA 2WOVA 1K0JA 3P4SA 3DK4A 4IVMB 3VRDB 4UDQA 3UKAA 4AOSA 3AD7B 1FEAA 5KVIA 3SFEA 4EMIA 4DNAA 4CCRA 3CNTA 4YSYA 2GB0A 4FX9A 4C74A 1EL8A 4G73A 1PXAA 3AE6A 4O5UA 1CJ4A 3CNPA 3HYVA 2EQ8A 1K0LA 4Y4LA 5U1OA 4U8NA 1E1KA 1PS9A 3IF9A 3FBSA 5TR3A 2W0HA 1GEUA 3FIMB 4DSHA 1ZMCA 2YLRA 2X8GA 2XFOA 2WP9A 1H82A 3C4AA 3GDNA 1YQ3A 5BVAA 1YY5A 4H4VA 4H4WA 2XLRA 2WPEA 4IV9A 1JU2A 1TDOA 1XHCA 1NHPA 2BRAA 5IQ1A 4OPDA 4JY3A 1LTXR 2Q0KA 3EAOA 1OJDA 2GEWA 2YLZA 4RSLA 1D5TA 1B37A 1BGJA 3UTGA 2V6OA 3COXA 2Q6UA 2PHHA 5EOWA 3SGLA 3NLCA 2QAEA 3P9UA 4KPRA 3KPFA 3PO7A 3CMMA 2XVIA 4EM4A 3EANA 2H88A 2R4EA 4OVIA 2XLPA 4J2WA 1BWCA 1LV0A 4YTPA 1GRHA 1JRZA 1X31B 4XWRA 2J3NA 1D4CA 1GETA 5KXJA 3H8IA 2YVFA 3M0OA 1GRFA 4OPUA 3SZFA 2YAUA 1NG3A 3SXIA 3ATRA 1P2HA 3NKSA 1Y0PA 1JOAA 2YLTA 1PBDA 1GTEA 3ALMA 2BS2A 1N4UA 3DMEA 5CKUA 4DSGA 4NTDA 4AP1A 3DK8A 4E0VA 2C70A 1O5WA 3T0KA 4YTNA 5GSNA 5EBKA 1EL5A 5JCKA 3EF6A 2YM1A 3UCLA 4D04A 3AE1A 2BXSA 4RG4A 3D8XA 3F8DA 2C76A 2QA1A 1NHQA 3QFAA 3SM8A 4GDEA 3JSKA 4G74A 3ZDNA 4A99A 2XVJA 4ICYA 2R4JA 2BS4A 3KVEA 1DXLA 4Z24A 5HXIA 1F8SA 1ZK7A 1GV4A 1VG9A 2WS3A 2JBVA 3C4NA 5HY5A 3P4QA 4USQA 4H4PA 4IVOB 1IUTA 2YVJA 3CTYA 2B9WA 2JKCA 1L9CA 2WP6A 4BJZA 1Q9IA 2ZZ0A 2WETA 2GR2A 1IUWA 2WOWA 1KDGA 1O94A 4Z26A 3AECA 3UTFA 3IWAA 2WBAA 3QVPA 2IVDA 3SZWA 4CBQA 4BK2A 4JNAA 4OPLA 4B65A 2BC1A 1DODA 2B9XA 1B5QA 1YQZA 3GWDA 4U2SA 4K5RA 3NRNA 4BJYA 1Y56A 1JNZA 4GCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C5O A;  1N4W A;  3BI4 A;  4H4Q A;  4H2R A;  3FPZ A;  4OPI A;  4TM4 A;  1H86 A;  1UKV G;  4JN9 A;  2OAM A;  4H2N A;  2VQ7 A;  2IVE A;  3NNE A;  2WU5 A;  2BK4 A;  5JCI A;  3BNM A;  1CC2 A;  2GR0 A;  2OA1 A;  1TDK A;  1KSS A;  1NAA A;  4JQ9 A;  3CIR A;  4K5S A;  1F8R A;  4YT0 A;  4GDP A;  4D03 A;  1HYU A;  2GAG B;  4YXD A;  2YM2 A;  4MJW A;  4OCG A;  1P2E A;  4TM0 A;  5C3J A;  1L9D A;  3RP6 A;  3AE8 A;  4EQS A;  1VG0 A;  2XFP A;  3VRB A;  5L46 A;  3CPI G;  3SFD A;  4H2P A;  2BCP A;  1CC6 A;  4FK1 C;  4EM3 A;  4HB9 A;  3NTA A;  3KA7 A;  3QFB A;  1VQW A;  2BAB A;  3F8P A;  1BF3 A;  3RNM A;  5JCL A;  4A6N B;  4Z25 A;  2WDV A;  2YR6 A;  3BHK A;  4CY6 A;  1PJ5 A;  3P4R A;  4TM1 A;  3UKQ A;  2E1M A;  4CRT A;  1CL0 A;  1E1M A;  1KFY A;  2E5V A;  3ALJ A;  2AQJ A;  4B1B A;  2GR1 A;  1RYI A;  1D4D A;  1B8S A;  4H4U A;  3NT6 A;  4GR1 A;  1GRA A;  2B7R A;  2A89 A;  3AE7 A;  2GF3 A;  1GXF A;  1LQU A;  1B4V A;  3V76 A;  2X99 A;  2C73 A;  3ADA B;  3KLJ A;  3KU9 A;  3VR9 A;  1O95 A;  2VOU A;  3DJD A;  4C77 A;  3B6D A;  4H4S A;  1MXT A;  3VR8 A;  4J57 A;  4CCQ A;  4J56 A;  5EB4 A;  2C64 A;  2YLS A;  2ZZB A;  3AE4 A;  3NK0 X;  4Z2T A;  4B67 A;  2YLW A;  5JCM A;  4EQR A;  1JNR A;  3GD3 A;  1D4E A;  4H4R A;  2YVG A;  1GER A;  2AAQ A;  2EQ7 A;  2ZZC A;  1PBE A;  1TRB A;  2XLS A;  3GRT A;  3DA1 A;  3AED A;  2YG6 A;  2RAB A;  1KNR A;  1S2Q A;  1CF3 A;  2ZBW A;  2WEU A;  2XFN A;  2XVF A;  3S61 A;  3CN8 A;  3EPT A;  1PDH A;  2VRM A;  2TMD A;  2Y6R A;  3LZX A;  4ZCC A;  4H4T A;  1SEZ A;  1DJN A;  2GQW A;  4K7Z A;  4Y4M A;  2WDQ A;  2FBW A;  5J60 A;  1NHR A;  1TDE A;  4Z43 A;  3V3N A;  1FCD A;  4AP3 A;  4JDR A;  2OLO A;  1LJ1 A;  2C67 A;  2X8H A;  2GVC A;  3OC4 A;  2DKH A;  1H81 A;  1DOE A;  1ELI A;  2XVH A;  4HA6 A;  1ONF A;  1NEN A;  1NEK A;  1TDF A;  2A87 A;  3ICR A;  3NG7 X;  2WOI A;  3GRS A;  3QSM A;  4TLX A;  1IUS A;  2C75 A;  1JEH A;  4UDR A;  1DOB A;  2RGJ A;  1JRX A;  1VRQ B;  2GAH B;  3Q6J A;  3AE5 A;  2WPF A;  1OJA A;  5FS9 A;  3M13 A;  3UOY A;  2YWL A;  2BXR A;  4EMW A;  5LV9 A;  1TYP A;  4K22 A;  1CC4 A;  4YTM A;  3DGH A;  4ADW A;  1LPF A;  3KKJ A;  4A79 A;  1GAL A;  3K7T A;  4FDC B;  1DOC A;  5BRT A;  2R46 A;  1KSU A;  2GMH A;  1FL2 A;  3AYL A;  3LOV A;  4Y4N A;  2PYX A;  1YKJ A;  3ALL A;  3GMB A;  1MOK A;  5KVH A;  3G5R A;  1E7P A;  5JCN A;  1IUX A;  3M12 A;  3P4P A;  1H83 A;  2FJD A;  1GRG A;  2JB2 A;  3V3O A;  4CY8 A;  4LII A;  1COY A;  2A8X A;  2C3D A;  1CJ3 A;  1ZX9 A;  5CQF A;  1OJT A;  2AR8 A;  3AEB A;  1S3E A;  1GRE A;  3BI5 A;  1H84 A;  1F8W A;  3GDP A;  4U8O A;  4ZCD A;  5KOW A;  5C2T A;  2B9Y A;  1GES A;  3GMC A;  1BZL A;  2YR4 A;  4A65 A;  4JNQ A;  2XFQ A;  2FJA A;  4NTC A;  1E39 A;  4YSX A;  1GSN A;  1ZMD A;  1BKW A;  3ABV A;  2BK5 A;  5M10 A;  2FJE A;  3T37 A;  1EL9 A;  4BK1 A;  4CNJ A;  2YG4 A;  2XFU A;  3URH A;  1PXB A;  1PJ7 A;  2GR3 A;  2JB1 A;  2XVE A;  3AD9 B;  1IUU A;  4C3Y A;  3NGC X;  3II4 A;  3K7M X;  3S5W A;  2DKI A;  3P1W A;  2WP5 A;  3AE3 A;  4P9S A;  1AOG A;  5KRQ A;  2R9Z A;  1IJH A;  1RSG A;  5EB5 A;  1LQT A;  1Y56 B;  2XCG A;  4OPC A;  3NN0 X;  4YSZ A;  3D1C A;  4IA5 A;  1K4Q A;  2QA2 A;  2XLU A;  4U2L A;  4XXG A;  4YSH A;  4Z2R A;  4IA6 A;  2VVM A;  1LVL A;  3DGZ A;  3B3R A;  4H4Z A;  1PBC A;  2BCG G;  2VVL G;  1MO9 A;  2V3B A;  2WDR A;  1OJC A;  2CVJ A;  3NIX A;  2F5Z A;  1IUV A;  3IC9 A;  4OPG A;  5HHF A;  2YG3 A;  3KD9 A;  4APN A;  4RG3 A;  1CJ2 A;  4A9W A;  3UP4 A;  1N4V A;  2V61 A;  4B63 A;  4K8D A;  3BNU A;  5U63 A;  2C66 A;  1GT8 A;  3I6D A;  4B69 A;  4CNK A;  3RP7 A;  1ZOV A;  2BS3 A;  2O9Z A;  1EL7 A;  3G5Q A;  1GND A;  3AWI A;  3LZW A;  1NDA A;  3GWF A;  4TM3 A;  4GUV A;  4U2T A;  3NN6 X;  3GD4 A;  1FOH A;  2OAL A;  4YWO A;  4U8P A;  5FS8 A;  1NG4 A;  2ACZ A;  2YR5 A;  2B76 A;  4H4X A;  1QJD A;  1YQ4 A;  1JRY A;  1ZY8 A;  3DJG X;  1NHS A;  2R0C A;  2RGH A;  3AEG A;  3ISH A;  4H7U A;  4JY2 A;  4H2Q A;  1FEB A;  4UP3 A;  4I58 A;  1GTH A;  3UKF A;  2X8C A;  2CDU A;  1OJ9 A;  1W4X A;  2GV8 A;  4LA1 A;  2BYB A;  5FS6 A;  4PAA A;  5FMH A;  3Q9T A;  4Z44 A;  1FEC A;  3DK9 A;  2C65 A;  3QJ4 A;  4U8K A;  4YKG A;  3NK2 X;  5U25 A;  4X9M A;  3H4K A;  3UTH A;  4EIQ A;  3AEE A;  2NPX A;  1BGN A;  4B66 A;  3UOX A;  4M52 A;  4EQW A;  3AE9 A;  4H50 A;  3AB1 A;  4H4Y A;  3ICS A;  3IHM A;  2B7S A;  3QSS A;  3UKK A;  1E1N A;  2BK3 A;  4WCT A;  5ER0 A;  5KOX A;  2WPC A;  4REK A;  2QCU A;  2R45 A;  2Z5X A;  3NYF A;  4AT0 A;  1CBO A;  3FMW A;  4GRT A;  1PXC A;  2YG5 A;  4B64 A;  2C72 A;  2HQM A;  2VQB A;  3NH3 X;  4AT2 A;  3L8K A;  1V59 A;  5BUL A;  2XDO A;  1QLB A;  2CUL A;  2R0P A;  1S3B A;  3DJE A;  2APG A;  2ARD A;  3OZ2 A;  3FG2 P;  4I59 A;  4BK3 A;  3VQR A;  3CGB A;  2R0G A;  2YQU A;  4OPT A;  2JK6 A;  2VZ2 A;  3LJP A;  1Q1W A;  4AOX A;  3BHF A;  3RED A;  3CND A;  3BI2 A;  4KX6 A;  5J7X A;  3UOZ A;  2FJB A;  1ZDL A;  4A7A A;  1ZP0 A;  3AEF A;  4ZN0 A;  4A5L A;  3R9U A;  4NZH A;  1PBF A;  4NEV A;  3CGE A;  5GRT A;  2WHD A;  3IHG A;  2EQ9 A;  3G5S A;  4U8J A;  1KF6 A;  4O5Q A;  3CGC A;  1E6E A;  4GF7 A;  4TLZ A;  4Z2U A;  3NYC A;  4U8M A;  5FS7 A;  1CHU A;  1F6M A;  3UOV A;  3I3L A;  2E4G A;  3VRA A;  1REO A;  1NPX A;  2VVL A;  3UP5 A;  3LXD A;  1XAN A;  3AE2 A;  3NHO X;  1PHH A;  2TPR A;  4C3X A;  1DNC A;  4B68 A;  1GRB A;  1GRT A;  4J36 A;  3GYJ A;  5M0Z A;  1XDI A;  3DJJ A;  1VDC A;  2GH5 A;  3F8R A;  1N1P A;  4X9N A;  4U8I A;  4J31 A;  2OLN A;  2Q0L A;  3AYJ A;  3CNJ A;  3PS9 A;  3SQP A;  2C7G A;  4UDP A;  1Z6L A;  1PN0 A;  3GYI A;  4J34 A;  1TYT A;  1S2Y A;  4LU6 A;  1ZOY A;  3RP8 A;  2UZZ A;  3AD8 B;  4NEW A;  3O0H A;  1QO8 A;  3WE0 A;  2WU2 A;  1PJ6 A;  2X50 A;  1M64 A;  3L1R A;  1RP0 A;  3CPH G;  2C3C A;  2IID A;  1KNP A;  3LAD A;  5KWF A;  2GQF A;  1CJC A;  2XLT A;  2BC0 A;  3K7Q X;  1D7L A;  2WES A;  4WX1 A;  4BV6 A;  1E1L A;  1H7X A;  3PVC A;  5IQ4 A;  4N9X A;  3QVR A;  5HYM A;  3AXB A;  4EQX A;  1H6V A;  3UKP A;  1GOS A;  3RHA A;  2I0Z A;  2X3N A;  1M6I A;  2YLX A;  2JB3 A;  1TDN A;  2V5Z A;  3K30 A;  3UTE A;  2XYO A;  2JAE A;  1L0V A;  4EIP A;  1K0I A;  3NK1 X;  3C96 A;  3UKL A;  3ZYX A;  3AEA A;  3NYE A;  4BUR A;  5DBJ A;  1EBD A;  4XWZ A;  2Y6Q A;  3ICT A;  3HZL A;  1ZKQ A;  2VRL A;  4NTE A;  2CFY A;  2BA9 A;  2BAC A;  1PBB A;  4ECH A;  2WQY A;  4A6N A;  4YKF A;  2GMJ A;  1D7Y A;  4EMJ A;  1H7W A;  2EQ6 A;  1L9E A;  3ATQ A;  3AYI A;  2V3A A;  3CNS A;  4K2X A;  4J33 A;  4PAB A;  5IPY A;  2Z5Y A;  3H8L A;  3DH9 A;  2V60 A;  1DJQ A;  2H89 A;  3GSI A;  3E1T A;  4DGK A;  2NVK X;  2GRT A;  3QSE A;  4FK1 A;  3UKH A;  4U8L A;  5BUK A;  2YG7 A;  3NTD A;  3LB8 A;  2RGO A;  3ITJ A;  1F3P A;  1Q1R A;  3CGD A;  4USR A;  1GPE A;  2Q7V A;  4X4J A;  3CPJ G;  1XPQ A;  2WOV A;  1K0J A;  3P4S A;  3DK4 A;  4IVM B;  3VRD B;  4UDQ A;  3UKA A;  4AOS A;  3AD7 B;  1FEA A;  5KVI A;  3SFE A;  4EMI A;  4DNA A;  4CCR A;  3CNT A;  4YSY A;  2GB0 A;  4FX9 A;  4C74 A;  1EL8 A;  1PXA A;  3AE6 A;  4O5U A;  1CJ4 A;  3CNP A;  2EQ8 A;  1K0L A;  4Y4L A;  5U1O A;  4U8N A;  1E1K A;  1PS9 A;  3IF9 A;  3FBS A;  5TR3 A;  2W0H A;  1GEU A;  3FIM B;  4DSH A;  1ZMC A;  2YLR A;  2X8G A;  2XFO A;  2WP9 A;  1H82 A;  3C4A A;  3GDN A;  1YQ3 A;  5BVA A;  1YY5 A;  4H4V A;  4H4W A;  2XLR A;  2WPE A;  4IV9 A;  1JU2 A;  1TDO A;  1XHC A;  1NHP A;  5IQ1 A;  4OPD A;  4JY3 A;  1LTX R;  2Q0K A;  3EAO A;  1OJD A;  2GEW A;  2YLZ A;  4RSL A;  1D5T A;  1B37 A;  1BGJ A;  3UTG A;  2V6O A;  3COX A;  2Q6U A;  2PHH A;  5EOW A;  3SGL A;  3NLC A;  2QAE A;  3P9U A;  4KPR A;  3KPF A;  3PO7 A;  2XVI A;  4EM4 A;  3EAN A;  2H88 A;  2R4E A;  4OVI A;  2XLP A;  4J2W A;  1BWC A;  1LV0 A;  4YTP A;  1GRH A;  1JRZ A;  1X31 B;  4XWR A;  2J3N A;  1D4C A;  1GET A;  5KXJ A;  3H8I A;  2YVF A;  3M0O A;  1GRF A;  4OPU A;  2YAU A;  1NG3 A;  3ATR A;  1P2H A;  3NKS A;  1Y0P A;  1JOA A;  2YLT A;  1PBD A;  1GTE A;  3ALM A;  2BS2 A;  1N4U A;  3DME A;  5CKU A;  4DSG A;  4NTD A;  4AP1 A;  3DK8 A;  4E0V A;  2C70 A;  1O5W A;  4YTN A;  5GSN A;  5EBK A;  1EL5 A;  5JCK A;  3EF6 A;  2YM1 A;  3UCL A;  4D04 A;  3AE1 A;  2BXS A;  4RG4 A;  3D8X A;  3F8D A;  2C76 A;  2QA1 A;  1NHQ A;  3QFA A;  3SM8 A;  4GDE A;  3JSK A;  3ZDN A;  4A99 A;  2XVJ A;  4ICY A;  2R4J A;  2BS4 A;  3KVE A;  1DXL A;  4Z24 A;  5HXI A;  1F8S A;  1ZK7 A;  1GV4 A;  1VG9 A;  2WS3 A;  2JBV A;  3C4N A;  5HY5 A;  3P4Q A;  4USQ A;  4H4P A;  4IVO B;  1IUT A;  2YVJ A;  3CTY A;  2B9W A;  2JKC A;  1L9C A;  2WP6 A;  4BJZ A;  1Q9I A;  2ZZ0 A;  2WET A;  2GR2 A;  1IUW A;  2WOW A;  1KDG A;  1O94 A;  4Z26 A;  3AEC A;  3UTF A;  3IWA A;  2WBA A;  3QVP A;  2IVD A;  4CBQ A;  4BK2 A;  4JNA A;  4OPL A;  4B65 A;  2BC1 A;  1DOD A;  2B9X A;  1B5Q A;  1YQZ A;  3GWD A;  4U2S A;  4K5R A;  3NRN A;  4BJY A;  1Y56 A;  1JNZ A;  4GCM A; 
#chains in the Genus database with same CATH topology
 1N4W A;  4OPI A;  4H2R A;  4TM4 A;  1H86 A;  1UKV G;  4Z1Y A;  3DIP A;  3BNM A;  1TDK A;  4K5S A;  3R10 A;  4D03 A;  1S7M A;  1HYU A;  4YXD A;  2YM2 A;  3P93 A;  1KKO A;  5L46 A;  4FK1 C;  4KEM A;  5JCL A;  2YR6 A;  4GFI A;  4IP5 A;  4GIS A;  2E1M A;  4CRT A;  2OZT A;  3ALJ A;  1KFY A;  2GR1 A;  4GR1 A;  1GRA A;  1LQU A;  1EBG A;  3V76 A;  2C73 A;  3TJ4 A;  2POZ A;  3AN1 A;  2VOU A;  2PTW A;  4J57 A;  4J56 A;  3AE4 A;  3NK0 X;  2XH7 A;  3GD3 A;  2AAQ A;  3GRT A;  3AED A;  2E5A A;  2ZBW A;  2VRM A;  4GAP A;  1SEZ A;  4K7Z A;  2FBW A;  5J60 A;  1NHR A;  1TDE A;  4JDR A;  2C67 A;  1DTN A;  3PWG A;  2A87 A;  3GYX A;  4TLX A;  1JEH A;  3V4B A;  1VRQ B;  2GAH B;  3AE5 A;  3UOY A;  4EMW A;  4YTM A;  2PSN A;  1LPF A;  4A79 A;  3DG6 A;  3UGV A;  5KMR A;  4A35 A;  2QDE A;  2R46 A;  2GMH A;  3AYL A;  3ALL A;  1MOK A;  5KVH A;  3G5R A;  1IUX A;  4IHC A;  3OZY A;  2FJD A;  4GME A;  4CY8 A;  2A8X A;  3DFY A;  3T31 A;  2PTY A;  2I5Q A;  3VC6 A;  5BOE A;  1ZMD A;  2BK5 A;  3IJQ A;  4CNJ A;  2GR3 A;  2XVE A;  3HYX A;  3NGC X;  3H70 A;  3S5W A;  3I6T A;  2DKI A;  5KRQ A;  1AOG A;  1RSG A;  3SY4 A;  1WUE A;  3BSM A;  4XXG A;  4IA6 A;  2BCG G;  1MO9 A;  2V3B A;  2WDR A;  3SBF A;  2PPG A;  3KD9 A;  5U63 A;  4B69 A;  3RP7 A;  4NNJ A;  3G5Q A;  1GND A;  3AWI A;  3LZW A;  4U2T A;  1N62 C;  1NG4 A;  1ZY8 A;  1NHS A;  4GYP A;  2W55 A;  2PTZ A;  4I58 A;  4MKS A;  1OJ9 A;  2CDU A;  2OZ8 A;  2GV8 A;  4LA1 A;  4PAA A;  1FEC A;  3NK2 X;  2NPX A;  1V97 A;  3MQT A;  3S47 A;  3D47 A;  1E1N A;  3HPF A;  3NYF A;  2YG5 A;  4B64 A;  3ENL A;  3NH3 X;  3L8K A;  3FG2 P;  4BK3 A;  3BHF A;  3VFC A;  4KX6 A;  5J7X A;  3L5O A;  3NXL A;  4NZH A;  3CGE A;  3IHG A;  3G5S A;  4U8J A;  4O5Q A;  4GF7 A;  4U8M A;  1CHU A;  4ZCW A;  2E4G A;  4JN8 A;  4C3X A;  1PHH A;  2TPR A;  1GRB A;  4U8I A;  2Q0L A;  2XSX A;  4TVW A;  1Z6L A;  3TWA A;  1FIQ B;  1TYT A;  3DEQ A;  4LU6 A;  3AD8 B;  3O0H A;  1RP0 A;  3CPH G;  3ZVH B;  3LAD A;  3K7Q X;  3FV9 A;  3QVR A;  2PS2 A;  3UKP A;  1GOS A;  5G5G B;  3OW1 A;  2V5Z A;  2BRY A;  2FKP A;  1L0V A;  3C96 A;  1EBD A;  4XWZ A;  3U9I A;  2BAC A;  1PBB A;  1EC7 A;  1D7Y A;  2EQ6 A;  3AYI A;  2V3A A;  2OPJ A;  4J33 A;  4PAB A;  2Z5Y A;  3DH9 A;  2P0I A;  1DJQ A;  3GSI A;  2GRT A;  3UKH A;  3HRD C;  4J1O A;  2RGO A;  1F3P A;  4K2S A;  2Q7V A;  3CPJ G;  2GGE A;  3K1G A;  3VRD B;  4AOS A;  4E6M A;  4FX9 A;  4C74 A;  3I6E A;  3HYV A;  1E1K A;  3IF9 A;  1GEU A;  3FIM B;  4DSH A;  1ZMC A;  2YLR A;  3V3W A;  2X8G A;  3GDN A;  3C4A A;  3RR1 A;  2XLR A;  2WPE A;  4IV9 A;  2QJM A;  2GEW A;  5EOW A;  4KPR A;  3PO7 A;  3CMM A;  2XVI A;  3A7R A;  3EAN A;  4OVI A;  3RCY A;  4FP1 A;  1X31 B;  5KXJ A;  1NG3 A;  1P2H A;  3H12 A;  1W6T A;  5EBK A;  3N4F A;  4IZG A;  3D8X A;  2ONE A;  2PU1 A;  2R4J A;  3KVE A;  4HNC A;  3UXK A;  1F8S A;  1ZK7 A;  1VG9 A;  5HY5 A;  3P4Q A;  4H4P A;  2PCE A;  2YVJ A;  1L9C A;  2WP6 A;  2HXU A;  3IWA A;  2WBA A;  3QVP A;  3NVY B;  4BK2 A;  1DOD A;  3GWD A;  1SJC A;  4HCD A;  4H4Q A;  3SZ0 A;  4JN9 A;  2VQ7 A;  2IVE A;  1FHV A;  1CC2 A;  2OA1 A;  1VQZ A;  1NAA A;  3CIR A;  4YT0 A;  1F8R A;  5J04 A;  2GAG B;  3TWB A;  4TM0 A;  2QJN A;  4EQS A;  1VG0 A;  2MNR A;  3Q4D A;  2BCP A;  1CC6 A;  4K8G A;  3NTA A;  3QFB A;  2AL2 B;  1VQW A;  2BAB A;  1BF3 A;  3RNM A;  3NZG A;  3FXG A;  3BHK A;  4CY6 A;  1PJ5 A;  3P4R A;  3UKQ A;  4II2 A;  3GO2 A;  3NT6 A;  1B4V A;  3ADA B;  3NFU A;  3KU9 A;  3TTE A;  1VDV A;  4H4S A;  3SQS A;  1MXT A;  4HCL A;  2C64 A;  4M6U A;  4B67 A;  5KNL A;  1JNR A;  2EQ7 A;  3DA1 A;  4A6G A;  3DGB A;  1S2Q A;  2WEU A;  4H19 A;  2QJJ A;  4HCH A;  3VCC A;  1KCZ A;  3CAW A;  3V3N A;  1FCD A;  1LJ1 A;  2X8H A;  3OC4 A;  2DKH A;  1H81 A;  1DOE A;  3IJL A;  4HA6 A;  1JPD X;  1NEN A;  1TDF A;  6ENL A;  1IUS A;  4UDR A;  2W3R A;  1MRA A;  3KPK A;  4ZA0 A;  5FS9 A;  4K22 A;  1CC4 A;  4ADW A;  4KT2 A;  3K7T A;  4FDC B;  1FL2 A;  4Y4N A;  2PP1 A;  3P4P A;  3SX6 A;  2PGE A;  3VA8 A;  4GGB A;  4LII A;  1CJ3 A;  1OJT A;  1S3E A;  3BI5 A;  4G7F A;  3GDP A;  4ZCD A;  3HW2 A;  5G5H B;  3B9J B;  1BKW A;  5M10 A;  3T37 A;  2HZG A;  1EL9 A;  1ECQ A;  2YG4 A;  1PXB A;  2GGG A;  3AD9 B;  4E5T A;  3K7M X;  3U4F A;  3P1W A;  3AE3 A;  1IJH A;  1LQT A;  2XCG A;  1K4Q A;  4Z2R A;  2GSH A;  3DGZ A;  5HHF A;  1MUC A;  5EU9 A;  4HYR A;  1N4V A;  4B63 A;  3PWI A;  2C66 A;  1GT8 A;  3I6D A;  4CNK A;  4HNL A;  3NO1 A;  1NDA A;  3GWF A;  3MWC A;  4GUV A;  1H2I A;  2OAL A;  4U8P A;  5FS8 A;  2YR5 A;  2B76 A;  4H4X A;  3ISH A;  1YQ4 A;  4H7U A;  4E4U A;  2RGH A;  3THU A;  1GTH A;  1W4X A;  1TZZ A;  3AMZ A;  4ROP A;  4Z44 A;  3DK9 A;  2C65 A;  4YKG A;  2AKZ A;  5U25 A;  4EIQ A;  3AEE A;  4M52 A;  3UJE A;  4EQW A;  4H4Y A;  3CK5 A;  2BK3 A;  4WCT A;  5ER0 A;  5KOX A;  4REK A;  4AT0 A;  1CBO A;  1PXC A;  2C72 A;  2HQM A;  2PA6 A;  1QLB A;  4HPN A;  3ETR B;  3DJE A;  3OZ2 A;  4OPT A;  2YQU A;  2VZ2 A;  3LJP A;  3RED A;  3N6J A;  3CND A;  3SZC A;  4A5L A;  3R9U A;  1FFV C;  3UJF A;  2OX4 A;  4NEV A;  1FFU C;  3CGC A;  1E6E A;  4Z2U A;  3NYC A;  3TJI A;  1F6M A;  3PG6 A;  1NPX A;  3UP5 A;  4J36 A;  3GYJ A;  3CXB A;  4F4R A;  2PGW A;  3F8R A;  3CT2 A;  4J31 A;  3CNJ A;  1PN0 A;  1ELS A;  2XH2 A;  1QO8 A;  5KMP A;  2WU2 A;  1PJ6 A;  1N61 C;  3NVV B;  2IID A;  1R6W A;  2XLT A;  5FJT A;  2QGY A;  3PVC A;  5IQ4 A;  5HYM A;  3RGT A;  2X3N A;  2XYO A;  3NK1 X;  4BUR A;  5DBJ A;  4DXK A;  1ZKQ A;  1L9E A;  3RIT A;  3ZLG A;  3CNS A;  2H89 A;  3E1T A;  3V5F A;  4FK1 A;  2ZAD A;  2DW6 A;  3QPE A;  3SSZ A;  3LB8 A;  2P8C A;  1GPE A;  3DG7 A;  3UCD A;  3P4S A;  3DK4 A;  4IVM B;  3UKA A;  3AD7 B;  3FJ4 A;  4DX3 A;  4CCR A;  3CNT A;  1TKK A;  2GB0 A;  1EL8 A;  4G73 A;  5FJO A;  3FVD A;  4O5U A;  2EQ8 A;  1K0L A;  4Y4L A;  2GDQ A;  5U1O A;  1PS9 A;  3FBS A;  2W0H A;  1YQ3 A;  1YY5 A;  1ONE A;  1FHU A;  2E3T A;  3A7A A;  4DN1 A;  4OPD A;  4JY3 A;  2Q0K A;  2YLZ A;  1D5T A;  1BGJ A;  4DYE A;  3SGL A;  3NLC A;  4JN7 A;  4EM4 A;  2R4E A;  1BWC A;  2J3N A;  1D4C A;  1GET A;  3M0O A;  4OPU A;  3SXI A;  2PP3 A;  2OQH A;  4DSG A;  1STZ A;  3DME A;  3DK8 A;  2C70 A;  3T0K A;  4D04 A;  3UCL A;  3EF6 A;  3F8D A;  1NHQ A;  3SM8 A;  3NVZ B;  4A99 A;  4ZOH B;  4ICY A;  2GGJ A;  2BS4 A;  1DXL A;  5HXI A;  2JBV A;  1SB3 B;  4IVO B;  1IUT A;  2P8B A;  2ZZ0 A;  2GR2 A;  4TVY A;  2WOW A;  4Z26 A;  3SZW A;  4JNA A;  2B9X A;  4U2S A;  1B5Q A;  1RM6 B;  1BKH A;  3UJ2 A;  3FPZ A;  1ZXI C;  3R0U A;  2GR0 A;  1KSS A;  4JQ9 A;  4A3R A;  4MJW A;  4OCG A;  5ENL A;  3AE8 A;  2XFP A;  3SYI A;  1X2H A;  3CPI G;  3SFD A;  4H2P A;  3UXL A;  3B97 A;  4EM3 A;  4HB9 A;  4A6N B;  3F8P A;  3TOY A;  2WDV A;  3S5S A;  2DW7 A;  4IP4 A;  2AQJ A;  4B1B A;  1D4D A;  1B8S A;  4G9K A;  4H4U A;  4II3 A;  2B7R A;  3AE7 A;  2GF3 A;  3KLJ A;  3VR9 A;  1O95 A;  1RVK A;  3VR8 A;  4CCQ A;  5EB4 A;  2YLS A;  3VCN A;  5JRB A;  5JCM A;  4EQR A;  4H4R A;  2YVG A;  3SN1 A;  1PBE A;  2XLS A;  2YG6 A;  2RAB A;  1KNR A;  3MZN A;  3S61 A;  3EPT A;  2TMD A;  4GAV A;  3VDG A;  2Y6R A;  4ZCC A;  4H4T A;  3R1Z A;  2GQW A;  4Y4M A;  4J3Z A;  3T4W A;  4Z43 A;  4AP3 A;  2OLO A;  3TW9 A;  1ELI A;  1ONF A;  2OG9 A;  1NEK A;  3QSM A;  2WOI A;  2C75 A;  4E4F A;  1JRX A;  3Q6J A;  2C4C A;  3N6H A;  2YWL A;  1NEL A;  3KKJ A;  1GAL A;  1DOC A;  3UJR A;  3LOV A;  2PYX A;  1YKJ A;  1E7P A;  5JCN A;  3M12 A;  2OO6 A;  1H83 A;  1COY A;  2RDX A;  5CQF A;  2AR8 A;  3AEB A;  1GRE A;  1H84 A;  4U8O A;  3ZVH A;  1GES A;  1L8P A;  1BZL A;  1JRP A;  4A65 A;  4JNQ A;  2XFQ A;  2FJA A;  3FCP A;  1E39 A;  1GSN A;  2FJE A;  4BK1 A;  3FYY A;  3PK7 A;  2JB1 A;  1IUU A;  4P9S A;  2HNE A;  2XH4 A;  1Y56 B;  3NN0 X;  4YSZ A;  3V5C A;  3D1C A;  4IA5 A;  2XLU A;  4U2L A;  2VVM A;  3B3R A;  4H4Z A;  2W3S A;  1OJC A;  2F5Z A;  2YG3 A;  3GD6 A;  1CJ2 A;  1MDL A;  3BJS A;  4K8D A;  4TM3 A;  2CHR A;  1FOH A;  4IT1 A;  2ACZ A;  1QJD A;  4JY2 A;  1JCT A;  3EKG A;  1FEB A;  4UP3 A;  5KMQ A;  3UKF A;  2BYB A;  5FS6 A;  5FMH A;  3Q9T A;  3QJ4 A;  4U8K A;  4X9M A;  3UTH A;  3H4K A;  3EUB 3;  1BGN A;  3DG3 A;  3AE9 A;  2P3Z A;  3AB1 A;  3ICS A;  3RRA A;  3IHM A;  2B7S A;  3QSS A;  3UKK A;  2WPC A;  2QCU A;  2GGH A;  3FMW A;  2VQB A;  4AT2 A;  1V59 A;  5BUL A;  2XDO A;  1S3B A;  2QDD A;  2APG A;  3VQR A;  3CGB A;  4AOX A;  4H2H A;  3UOZ A;  4DWD A;  4A7A A;  1WUF A;  4ZN0 A;  1PBF A;  4Z17 A;  2WHD A;  2EQ9 A;  1KF6 A;  3SJN A;  5FS7 A;  3SN0 A;  3GC2 A;  3T9P A;  1R0M A;  3VRA A;  3LXD A;  3CB3 A;  3NHO X;  4B68 A;  1GRT A;  4IL2 A;  1BQG A;  5M0Z A;  3DJJ A;  2GH5 A;  2AL1 A;  2OLN A;  3AYJ A;  3PS9 A;  3SQP A;  4UDP A;  3GYI A;  4J34 A;  1S2Y A;  1ZOY A;  3DDM A;  2UZZ A;  4NEW A;  3WE0 A;  2XGZ A;  2X50 A;  1KNP A;  3P3B A;  2GQF A;  3NVW B;  2OFJ A;  1D7L A;  4WX1 A;  3T2Z A;  1H7X A;  3AXB A;  3H7V A;  1H6V A;  3GY1 A;  3RHA A;  2GGI A;  3HYW A;  1M6I A;  2YLX A;  4E8G A;  3K30 A;  3UTE A;  2JAE A;  1IYX A;  2NQL A;  3JW7 A;  3UKL A;  3AEA A;  3JVA A;  2CFY A;  3T6C A;  2AL2 A;  2GMJ A;  4EMJ A;  3ATQ A;  1E9I A;  5IPY A;  3H8L A;  2NVK X;  4GYP C;  4G6H A;  5BUK A;  3ITJ A;  1Q1R A;  5FJP A;  4DHG A;  4X4J A;  3RO6 A;  1K0J A;  4YSY A;  7ENL A;  3ZLF A;  1YEY A;  3AE6 A;  5IDZ A;  2W54 A;  4U8N A;  3OTR A;  2WP9 A;  1H82 A;  1TDO A;  1XHC A;  1NHP A;  1LTX R;  1OJD A;  4RSL A;  3COX A;  2Q6U A;  2PHH A;  2QAE A;  3P9U A;  3KPF A;  2XLP A;  1LV0 A;  4YTP A;  1JRZ A;  1P43 A;  4XWR A;  2PP0 A;  3QTP A;  3H8I A;  2YVF A;  1GRF A;  3ATR A;  4H83 A;  3NKS A;  1Y0P A;  1JOA A;  2YLT A;  1GTE A;  3ALM A;  2BS2 A;  2OQY A;  4AP1 A;  3ES8 A;  5GSN A;  5JCK A;  2YM1 A;  3SR6 B;  4ENL A;  3AE1 A;  4RG4 A;  2C76 A;  2QA1 A;  3BOX A;  3JSK A;  4YWS A;  3JZU A;  4KWS A;  1GV4 A;  4USQ A;  2B9W A;  2JKC A;  2QQ6 A;  1O94 A;  2IVD A;  4OPL A;  4B65 A;  2BC1 A;  1JNZ A;  4GCM A;  1EBH A;  4C5O A;  1PDY A;  3BI4 A;  2OAM A;  2O56 A;  4H2N A;  3NNE A;  2WU5 A;  2BK4 A;  5JCI A;  3UCC A;  4GDP A;  3OPS A;  1P2E A;  5C3J A;  1L9D A;  3RP6 A;  3ZVI A;  1SJD A;  1JDF A;  3KA7 A;  3SN4 A;  4Z25 A;  4TM1 A;  1CL0 A;  1E1M A;  2E5V A;  3NRZ B;  1RYI A;  3TQP A;  2A89 A;  1GXF A;  3I4K A;  3T14 A;  2X99 A;  3DJD A;  4C77 A;  3B6D A;  2ZZB A;  4Z2T A;  2YLW A;  1D4E A;  1NU5 A;  1GER A;  2ZZC A;  1N63 C;  1TRB A;  1SJB A;  3D46 A;  3R0K A;  2OVL A;  3N4E A;  1CF3 A;  3QN3 A;  2XFN A;  2XVF A;  3CN8 A;  1PDH A;  3LZX A;  1DJN A;  2WDQ A;  1SJA A;  2GVC A;  2XVH A;  1KKR A;  3ICR A;  3NG7 X;  3GRS A;  1DOB A;  2RGJ A;  1KN0 A;  2WPF A;  1OJA A;  1OEP A;  1FO4 A;  3R25 A;  3M13 A;  2BXR A;  5LV9 A;  1TYP A;  1MDR A;  3DGH A;  3IJI A;  5BRT A;  3ES7 A;  3H8A A;  1KSU A;  3GMB A;  1EC8 A;  1GRG A;  4GGH A;  2JB2 A;  3V3O A;  2C3D A;  1ZX9 A;  3T2K A;  1F8W A;  5KOW A;  4G6G A;  5C2T A;  2B9Y A;  3GMC A;  2YR4 A;  1F9C A;  4NTC A;  4YSX A;  3ABV A;  2XH0 A;  2XFU A;  3URH A;  1PJ7 A;  4C3Y A;  3II4 A;  2WP5 A;  2R9Z A;  5EB5 A;  4OPC A;  3VC5 A;  2QA2 A;  4YSH A;  1LVL A;  1PBC A;  2VVL G;  2CVJ A;  4MGG A;  3NIX A;  1IUV A;  3IC9 A;  4OPG A;  4APN A;  4RG3 A;  4A9W A;  3UP4 A;  2V61 A;  1TE6 A;  1N5X A;  3BNU A;  3R07 C;  4NWZ A;  4MMW A;  1ZOV A;  2BS3 A;  2O9Z A;  1EL7 A;  1JPM A;  3NN6 X;  3GD4 A;  5BOF A;  4YWO A;  3VRB A;  3A7U A;  1JRY A;  3DJG X;  2R0C A;  3OZM A;  3AEG A;  4H2Q A;  2X8C A;  2OLA A;  1T3Q C;  3KUM A;  4B66 A;  3UOX A;  4H50 A;  3UJS A;  5KMS A;  5FJR A;  2R45 A;  2Z5X A;  3P0W A;  3QKE A;  4GRT A;  5FJU A;  1XS2 A;  2CUL A;  2R0P A;  2ARD A;  3EEZ A;  4I59 A;  2R0G A;  2JK6 A;  2OKT A;  1Q1W A;  3T2Y A;  3Q45 A;  1EC9 A;  4M0X A;  3BI2 A;  2FJB A;  1ZDL A;  1ZP0 A;  3AEF A;  5GRT A;  3MUC A;  3STP A;  2AKM A;  4TLZ A;  1JRO A;  4GIR A;  3UOV A;  3I3L A;  1REO A;  2VVL A;  1XAN A;  3AE2 A;  1DNC A;  4H1Z A;  3NS1 B;  1XDI A;  1VDC A;  1N1P A;  4X9N A;  2ZC8 A;  4FI4 A;  4EWJ A;  2C7G A;  3ZLH A;  3RP8 A;  2MUC A;  3R11 A;  1M64 A;  3L1R A;  2C3C A;  3D9X A;  5KWF A;  1CJC A;  3QLD A;  2BC0 A;  2WES A;  4BV6 A;  1E1L A;  1N60 C;  4N9X A;  3CYJ A;  4HN8 A;  4EQX A;  3T8Q A;  2I0Z A;  2GL5 A;  2JB3 A;  1TDN A;  2P88 A;  4K1W A;  4EIP A;  1K0I A;  3CXO A;  3ZYX A;  3NYE A;  2POD A;  2Y6Q A;  3ICT A;  3HZL A;  2VRL A;  4NTE A;  2BA9 A;  1N5W C;  3DER A;  4ECH A;  2WQY A;  4A6N A;  4YKF A;  1H7W A;  4K2X A;  2V60 A;  3OP2 A;  4DGK A;  3QSE A;  4U8L A;  2YG7 A;  3NTD A;  4USR A;  3CGD A;  2PTX A;  3DES A;  2HXT A;  1XPQ A;  2WOV A;  4IL0 A;  4UDQ A;  1FEA A;  5KVI A;  3SFE A;  4EMI A;  4DNA A;  1KD0 A;  3IK4 A;  1PXA A;  2PU0 A;  1PDZ A;  1CJ4 A;  3CNP A;  3MKC A;  5TR3 A;  3MSY A;  2XFO A;  2FYM A;  5BVA A;  4H4V A;  4H4W A;  1JU2 A;  2BRA A;  5IQ1 A;  2QVH A;  3EAO A;  3AM9 A;  1B37 A;  3UTG A;  2V6O A;  1WYG A;  3DFH A;  3MY9 A;  2H88 A;  4J2W A;  3TCS A;  1GRH A;  3SZF A;  4G8T A;  4KPL A;  2YAU A;  3PFR A;  2PMQ A;  1PBD A;  5CKU A;  4E0V A;  1N4U A;  4NTD A;  1X2G A;  1O5W A;  4YTN A;  1EL5 A;  1XPY A;  2BXS A;  3QFA A;  4GDE A;  4G74 A;  3ZDN A;  2XVJ A;  2OZ3 A;  4Z24 A;  2WS3 A;  3C4N A;  1P48 A;  3CTY A;  4BJZ A;  1Q9I A;  2WET A;  1IUW A;  1KDG A;  3AEC A;  3UTF A;  4JHM A;  4CBQ A;  4BJY A;  1YQZ A;  4K5R A;  3NRN A;  1Y56 A;  1MNS A;  4X2P A; 
#chains in the Genus database with same CATH homology
 4C5O A;  1N4W A;  3BI4 A;  4H4Q A;  4H2R A;  3FPZ A;  4OPI A;  4TM4 A;  1H86 A;  3SZ0 A;  1UKV G;  4JN9 A;  2OAM A;  4H2N A;  2VQ7 A;  2IVE A;  3NNE A;  2WU5 A;  2BK4 A;  5JCI A;  3BNM A;  1CC2 A;  2GR0 A;  2OA1 A;  1TDK A;  1KSS A;  1NAA A;  4JQ9 A;  3CIR A;  4K5S A;  1F8R A;  4YT0 A;  4GDP A;  4D03 A;  1S7M A;  1HYU A;  2GAG B;  4YXD A;  2YM2 A;  4MJW A;  4OCG A;  1P2E A;  4TM0 A;  5C3J A;  1L9D A;  3RP6 A;  3AE8 A;  4EQS A;  1VG0 A;  2XFP A;  3SYI A;  3VRB A;  5L46 A;  3CPI G;  3SFD A;  4H2P A;  2BCP A;  1CC6 A;  4FK1 C;  4EM3 A;  4HB9 A;  3NTA A;  3KA7 A;  3QFB A;  1VQW A;  2BAB A;  3F8P A;  1BF3 A;  3RNM A;  5JCL A;  4A6N B;  4Z25 A;  2WDV A;  2YR6 A;  3BHK A;  4CY6 A;  1PJ5 A;  3P4R A;  4TM1 A;  3UKQ A;  2E1M A;  4CRT A;  4II2 A;  1CL0 A;  1E1M A;  1KFY A;  2E5V A;  3ALJ A;  2AQJ A;  4B1B A;  2GR1 A;  1RYI A;  1D4D A;  1B8S A;  4G9K A;  4H4U A;  3NT6 A;  4GR1 A;  4II3 A;  1GRA A;  2B7R A;  2A89 A;  3AE7 A;  2GF3 A;  1GXF A;  1LQU A;  1B4V A;  3T14 A;  3V76 A;  2X99 A;  2C73 A;  3ADA B;  3KLJ A;  3KU9 A;  3VR9 A;  1O95 A;  2VOU A;  3DJD A;  4C77 A;  3B6D A;  4H4S A;  1MXT A;  3VR8 A;  4J57 A;  4CCQ A;  4J56 A;  5EB4 A;  2C64 A;  2YLS A;  2ZZB A;  3AE4 A;  3NK0 X;  4Z2T A;  5JRB A;  4B67 A;  2YLW A;  5JCM A;  5KNL A;  4EQR A;  1JNR A;  3GD3 A;  1D4E A;  4H4R A;  2YVG A;  1GER A;  2AAQ A;  2EQ7 A;  2ZZC A;  1PBE A;  1TRB A;  2XLS A;  3GRT A;  3DA1 A;  3AED A;  2YG6 A;  2RAB A;  1KNR A;  1S2Q A;  1CF3 A;  2ZBW A;  2WEU A;  2XFN A;  2XVF A;  3S61 A;  3CN8 A;  3EPT A;  1PDH A;  2VRM A;  2TMD A;  4GAV A;  2Y6R A;  3LZX A;  4GAP A;  4ZCC A;  4H4T A;  1SEZ A;  1DJN A;  2GQW A;  4K7Z A;  4Y4M A;  2WDQ A;  2FBW A;  5J60 A;  1NHR A;  1TDE A;  4Z43 A;  3V3N A;  1FCD A;  4AP3 A;  4JDR A;  2OLO A;  1LJ1 A;  2C67 A;  2X8H A;  2GVC A;  3OC4 A;  2DKH A;  1H81 A;  1DOE A;  1ELI A;  2XVH A;  4HA6 A;  1ONF A;  1NEN A;  1NEK A;  1TDF A;  2A87 A;  3GYX A;  3ICR A;  2WOI A;  3GRS A;  3NG7 X;  3QSM A;  1IUS A;  2C75 A;  1JEH A;  4TLX A;  4UDR A;  1DOB A;  2RGJ A;  1JRX A;  1VRQ B;  2GAH B;  3Q6J A;  1KN0 A;  3AE5 A;  2WPF A;  2C4C A;  1OJA A;  3KPK A;  5FS9 A;  3M13 A;  3UOY A;  2YWL A;  2BXR A;  4EMW A;  5LV9 A;  1TYP A;  4K22 A;  1CC4 A;  4YTM A;  3DGH A;  4ADW A;  1LPF A;  3KKJ A;  4A79 A;  1GAL A;  3K7T A;  5KMR A;  4FDC B;  1DOC A;  5BRT A;  2R46 A;  1KSU A;  2GMH A;  1FL2 A;  3AYL A;  3LOV A;  4Y4N A;  2PYX A;  1YKJ A;  3ALL A;  3GMB A;  1MOK A;  5KVH A;  3G5R A;  1E7P A;  5JCN A;  1IUX A;  3M12 A;  3P4P A;  3SX6 A;  1H83 A;  2FJD A;  1GRG A;  2JB2 A;  3V3O A;  4CY8 A;  4LII A;  1COY A;  2A8X A;  2C3D A;  1CJ3 A;  1ZX9 A;  5CQF A;  1OJT A;  2AR8 A;  3AEB A;  3T2K A;  1S3E A;  1GRE A;  3BI5 A;  1H84 A;  1F8W A;  3T31 A;  3GDP A;  4U8O A;  4ZCD A;  5KOW A;  4G6G A;  5C2T A;  2B9Y A;  1GES A;  3GMC A;  1BZL A;  2YR4 A;  4A65 A;  4JNQ A;  2XFQ A;  2FJA A;  4NTC A;  1E39 A;  4YSX A;  1GSN A;  1ZMD A;  1BKW A;  3ABV A;  2BK5 A;  5M10 A;  2FJE A;  3T37 A;  1EL9 A;  4BK1 A;  4CNJ A;  2YG4 A;  2XFU A;  3URH A;  1PXB A;  1PJ7 A;  2GR3 A;  2JB1 A;  2XVE A;  3AD9 B;  1IUU A;  4C3Y A;  3HYX A;  3II4 A;  3NGC X;  3K7M X;  3S5W A;  2DKI A;  3P1W A;  2WP5 A;  3AE3 A;  4P9S A;  1AOG A;  5KRQ A;  2R9Z A;  1IJH A;  1RSG A;  5EB5 A;  1LQT A;  3SY4 A;  1Y56 B;  2XCG A;  4OPC A;  3NN0 X;  4YSZ A;  3D1C A;  4IA5 A;  1K4Q A;  2QA2 A;  2XLU A;  4U2L A;  4XXG A;  4YSH A;  4Z2R A;  4IA6 A;  2VVM A;  1LVL A;  3DGZ A;  3B3R A;  4H4Z A;  1PBC A;  2BCG G;  2VVL G;  1MO9 A;  2V3B A;  2WDR A;  1OJC A;  2CVJ A;  3NIX A;  2F5Z A;  1IUV A;  3IC9 A;  4OPG A;  5HHF A;  2YG3 A;  3KD9 A;  4APN A;  4RG3 A;  1CJ2 A;  4A9W A;  3UP4 A;  1N4V A;  2V61 A;  4B63 A;  4K8D A;  3BNU A;  5U63 A;  2C66 A;  1GT8 A;  3I6D A;  4B69 A;  4NWZ A;  4CNK A;  3RP7 A;  4NNJ A;  1ZOV A;  2BS3 A;  2O9Z A;  1EL7 A;  3G5Q A;  1GND A;  3AWI A;  3LZW A;  1NDA A;  3GWF A;  4TM3 A;  4GUV A;  4U2T A;  3NN6 X;  3GD4 A;  1H2I A;  1FOH A;  2OAL A;  4YWO A;  4U8P A;  5FS8 A;  1NG4 A;  2ACZ A;  2YR5 A;  2B76 A;  4H4X A;  1QJD A;  1YQ4 A;  1JRY A;  1ZY8 A;  3DJG X;  1NHS A;  2R0C A;  2RGH A;  3AEG A;  3ISH A;  4H7U A;  4JY2 A;  4H2Q A;  1FEB A;  4UP3 A;  4I58 A;  5KMQ A;  1GTH A;  3UKF A;  2X8C A;  2CDU A;  1OJ9 A;  1W4X A;  2GV8 A;  4LA1 A;  2BYB A;  5FS6 A;  4PAA A;  5FMH A;  3Q9T A;  4Z44 A;  1FEC A;  3DK9 A;  2C65 A;  3QJ4 A;  4U8K A;  4YKG A;  3NK2 X;  5U25 A;  4X9M A;  3H4K A;  3UTH A;  4EIQ A;  3AEE A;  2NPX A;  1BGN A;  4B66 A;  3UOX A;  4M52 A;  4EQW A;  3AE9 A;  4H50 A;  3AB1 A;  4H4Y A;  3ICS A;  5KMS A;  3IHM A;  2B7S A;  3QSS A;  3UKK A;  1E1N A;  2BK3 A;  4WCT A;  5ER0 A;  5KOX A;  2WPC A;  4REK A;  2QCU A;  2R45 A;  2Z5X A;  3NYF A;  4AT0 A;  1CBO A;  3FMW A;  4GRT A;  1PXC A;  2YG5 A;  4B64 A;  2C72 A;  2HQM A;  2VQB A;  3NH3 X;  4AT2 A;  3L8K A;  1V59 A;  5BUL A;  2XDO A;  1QLB A;  2CUL A;  2R0P A;  1S3B A;  3DJE A;  2APG A;  2ARD A;  3OZ2 A;  3FG2 P;  4I59 A;  4BK3 A;  3VQR A;  3CGB A;  2R0G A;  2YQU A;  4OPT A;  2JK6 A;  2VZ2 A;  3LJP A;  1Q1W A;  4AOX A;  3BHF A;  3T2Y A;  3RED A;  3CND A;  3SZC A;  3BI2 A;  4KX6 A;  5J7X A;  3UOZ A;  2FJB A;  1ZDL A;  4A7A A;  1ZP0 A;  3L5O A;  3AEF A;  4ZN0 A;  4A5L A;  3R9U A;  4NZH A;  1PBF A;  4NEV A;  3CGE A;  5GRT A;  2WHD A;  3IHG A;  2EQ9 A;  3G5S A;  4U8J A;  1KF6 A;  4O5Q A;  3CGC A;  1E6E A;  4GF7 A;  4TLZ A;  4Z2U A;  3NYC A;  4U8M A;  5FS7 A;  1CHU A;  1F6M A;  3PG6 A;  3UOV A;  3I3L A;  2E4G A;  3VRA A;  1REO A;  1NPX A;  2VVL A;  3UP5 A;  3LXD A;  1XAN A;  3AE2 A;  3NHO X;  1PHH A;  2TPR A;  4C3X A;  1DNC A;  4B68 A;  1GRB A;  1GRT A;  4J36 A;  3GYJ A;  5M0Z A;  1XDI A;  3DJJ A;  1VDC A;  2GH5 A;  3F8R A;  1N1P A;  4X9N A;  4U8I A;  4J31 A;  2OLN A;  2Q0L A;  3AYJ A;  3CNJ A;  3PS9 A;  3SQP A;  2C7G A;  4UDP A;  1Z6L A;  1PN0 A;  3GYI A;  4J34 A;  1TYT A;  1S2Y A;  4LU6 A;  1ZOY A;  3RP8 A;  2UZZ A;  3AD8 B;  4NEW A;  3O0H A;  1QO8 A;  5KMP A;  3WE0 A;  2WU2 A;  1PJ6 A;  2X50 A;  1M64 A;  3L1R A;  1RP0 A;  3CPH G;  2C3C A;  2IID A;  1KNP A;  3D9X A;  3LAD A;  5KWF A;  2GQF A;  1CJC A;  2XLT A;  2BC0 A;  3K7Q X;  1D7L A;  2WES A;  4WX1 A;  4BV6 A;  1E1L A;  3T2Z A;  1H7X A;  3PVC A;  5IQ4 A;  4N9X A;  3QVR A;  5HYM A;  3AXB A;  4EQX A;  1H6V A;  3UKP A;  1GOS A;  3RHA A;  2I0Z A;  3HYW A;  2X3N A;  1M6I A;  2YLX A;  2JB3 A;  1TDN A;  2V5Z A;  2BRY A;  3K30 A;  3UTE A;  2XYO A;  2JAE A;  1L0V A;  4EIP A;  1K0I A;  3NK1 X;  3C96 A;  3UKL A;  3ZYX A;  3AEA A;  3NYE A;  4BUR A;  5DBJ A;  1EBD A;  4XWZ A;  2Y6Q A;  3ICT A;  3HZL A;  1ZKQ A;  2VRL A;  4NTE A;  2CFY A;  2BA9 A;  2BAC A;  1PBB A;  4ECH A;  2WQY A;  4A6N A;  4YKF A;  2GMJ A;  1D7Y A;  4EMJ A;  1H7W A;  2EQ6 A;  1L9E A;  3ATQ A;  3AYI A;  2V3A A;  3CNS A;  4K2X A;  4J33 A;  4PAB A;  5IPY A;  2Z5Y A;  3H8L A;  3DH9 A;  2V60 A;  1DJQ A;  2H89 A;  3GSI A;  3E1T A;  4DGK A;  2NVK X;  2GRT A;  3QSE A;  4FK1 A;  3UKH A;  4U8L A;  4G6H A;  5BUK A;  2YG7 A;  3NTD A;  3LB8 A;  2RGO A;  3ITJ A;  1F3P A;  1Q1R A;  3CGD A;  4USR A;  1GPE A;  2Q7V A;  4X4J A;  3CPJ G;  1XPQ A;  2WOV A;  1K0J A;  3P4S A;  3DK4 A;  4IVM B;  3VRD B;  4UDQ A;  3UKA A;  4AOS A;  3AD7 B;  1FEA A;  5KVI A;  3SFE A;  4EMI A;  4DNA A;  4CCR A;  3CNT A;  4YSY A;  2GB0 A;  4FX9 A;  4C74 A;  1EL8 A;  4G73 A;  1PXA A;  3AE6 A;  4O5U A;  1CJ4 A;  3CNP A;  3HYV A;  2EQ8 A;  1K0L A;  4Y4L A;  5U1O A;  4U8N A;  1E1K A;  1PS9 A;  3IF9 A;  3FBS A;  5TR3 A;  2W0H A;  1GEU A;  3FIM B;  4DSH A;  1ZMC A;  2YLR A;  2X8G A;  2XFO A;  2WP9 A;  1H82 A;  3C4A A;  3GDN A;  1YQ3 A;  5BVA A;  1YY5 A;  4H4V A;  4H4W A;  2XLR A;  2WPE A;  4IV9 A;  1JU2 A;  1TDO A;  1XHC A;  1NHP A;  2BRA A;  5IQ1 A;  4OPD A;  4JY3 A;  1LTX R;  2Q0K A;  3EAO A;  1OJD A;  2GEW A;  2YLZ A;  4RSL A;  1D5T A;  1B37 A;  1BGJ A;  3UTG A;  2V6O A;  3COX A;  2Q6U A;  2PHH A;  5EOW A;  3SGL A;  3NLC A;  2QAE A;  3P9U A;  4KPR A;  3KPF A;  3PO7 A;  3CMM A;  2XVI A;  4EM4 A;  3EAN A;  2H88 A;  2R4E A;  4OVI A;  2XLP A;  4J2W A;  1BWC A;  1LV0 A;  4YTP A;  1GRH A;  1JRZ A;  1X31 B;  4XWR A;  2J3N A;  1D4C A;  1GET A;  5KXJ A;  3H8I A;  2YVF A;  3M0O A;  1GRF A;  4OPU A;  3SZF A;  2YAU A;  1NG3 A;  3SXI A;  3ATR A;  1P2H A;  3NKS A;  1Y0P A;  1JOA A;  2YLT A;  1PBD A;  1GTE A;  3ALM A;  2BS2 A;  1N4U A;  3DME A;  5CKU A;  4DSG A;  4NTD A;  4AP1 A;  3DK8 A;  4E0V A;  2C70 A;  1O5W A;  3T0K A;  4YTN A;  5GSN A;  5EBK A;  1EL5 A;  5JCK A;  3EF6 A;  2YM1 A;  3UCL A;  4D04 A;  3AE1 A;  2BXS A;  4RG4 A;  3D8X A;  3F8D A;  2C76 A;  2QA1 A;  1NHQ A;  3QFA A;  3SM8 A;  4GDE A;  3JSK A;  4G74 A;  3ZDN A;  4A99 A;  2XVJ A;  4ICY A;  2R4J A;  2BS4 A;  3KVE A;  1DXL A;  4Z24 A;  5HXI A;  1F8S A;  1ZK7 A;  1GV4 A;  1VG9 A;  2WS3 A;  2JBV A;  3C4N A;  5HY5 A;  3P4Q A;  4USQ A;  4H4P A;  4IVO B;  1IUT A;  2YVJ A;  3CTY A;  2B9W A;  2JKC A;  1L9C A;  2WP6 A;  4BJZ A;  1Q9I A;  2ZZ0 A;  2WET A;  2GR2 A;  1IUW A;  2WOW A;  1KDG A;  1O94 A;  4Z26 A;  3AEC A;  3UTF A;  3IWA A;  2WBA A;  3QVP A;  2IVD A;  3SZW A;  4CBQ A;  4BK2 A;  4JNA A;  4OPL A;  4B65 A;  2BC1 A;  1DOD A;  2B9X A;  1B5Q A;  1YQZ A;  3GWD A;  4U2S A;  4K5R A;  3NRN A;  4BJY A;  1Y56 A;  1JNZ A;  4GCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...