5JCMA

Structure and catalytic mechanism of monodehydroascorbate reductase, mdhar, from oryza sativa l. japonica
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
432
structure length
429
Chain Sequence
EKHFKYVILGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKGYLFPQNAARLPGFHVCVGSGGERLLPEWYSEKGIELILSTEIVKADLASKTLTSAVGATFTYEILIIATGSSVIKLSDFGTQGADSNNILYLREVDDADKLVAAIQAKKGGKAVIVGGGYIGLELSAALKINDFDVTMVFPEPWCMPRLFTADIAAFYESYYTNKGVKIVKGTVAVGFDADANGDVTAVNLKNGSVLEADIVVVGVGGRPLTTLFKGQVAEEKGGIKTDAFFETSVPGVYAVGDVATFPMKMYNELRRVEHVDHARKSAEQAVKAIKGKESGESVVEYDYLPYFFSRSFDLGWQFYGDNVGDTILFGDSDPTSAKPKFGSYWIKDGKVLGAFLEGGSPDENKAIAKVAKTQPPVEELKKEGLQFASKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and catalytic mechanism of monodehydroascorbate reductase, MDHAR, from Oryza sativa L. japonica
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Oxidoreductase
molecule keywords Os09g0567300 protein
total genus 140
structure length 429
sequence length 432
chains with identical sequence B
ec nomenclature ec 1.6.5.4: Monodehydroascorbate reductase (NADH).
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 5jcmA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcmA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5jcmA02
1E1KA 2YLZA 1PBEA 4H4YA 2YG4A 2YM2A 1ZX9A 4EM3A 2JK6A 1PN0A 3GD3A 3BHFA 2C3DA 2IVEA 3UOZA 4B67A 5U1OA 3CNTA 3NK1X 2Y6QA 3ITJA 3CPHG 4TM0A 3NKSA 4H2RA 4Y4LA 3GMCA 3CN8A 4AOSA 2BACA 2Z5YA 1H84A 2OALA 4EIQA 4EMJA 3IC9A 4FX9A 1NENA 2B9XA 2QA1A 3KU9A 3GSIA 3NIXA 3EANA 4Z26A 4OCGA 2YLSA 2FJEA 3FPZA 4EQXA 4Z44A 2PYXA 4C77A 2BS2A 2WPFA 3AEAA 1H83A 2CULA 4KPRA 2ZBWA 1XANA 1O94A 2VVMA 3V76A 2GMJA 1CC6A 4OVIA 1FEAA 5BULA 2YLTA 4H7UA 1FL2A 3AE4A 3UP5A 3Q9TA 4EMIA 2AAQA 5FMHA 1E7PA 2DKHA 4OPTA 4U8IA 5GRTA 1P2HA 3RHAA 2E4GA 3F8DA 3GDNA 1ZMDA 1DOEA 1ZK7A 2Q0LA 5BVAA 3KLJA 2E1MA 1N4VA 2BCPA 4DSGA 2WOVA 4A6NB 1PBBA 2X3NA 4Z24A 3S61A 1JEHA 1CJCA 1CF3A 2PHHA 4Z43A 1JRYA 2C66A 4P9SA 3IWAA 3DK8A 1BKWA 1CBOA 3AD7B 1ZDLA 3WE0A 3SGLA 3P9UA 1Q9IA 1GALA 3BI2A 4H4PA 3REDA 2BYBA 3CNPA 2X8GA 5KVIA 1GRAA 2YG7A 4O5UA 4ECHA 4JQ9A 2XYOA 3SM8A 3FMWA 3UKFA 3SQPA 1LJ1A 3NYFA 2XFUA 2BABA 3NHOX 4AT2A 4O5QA 4EQSA 4B69A 1S2YA 1MXTA 4BJZA 3DMEA 3GRSA 2XFQA 2X8HA 3GRTA 2B9WA 4JDRA 1OJTA 2ZZ0A 1XPQA 3K30A 1NEKA 1IUSA 1PBCA 1S3EA 1O5WA 2GR3A 1Z6LA 2XVHA 3GYJA 2RABA 5HYMA 2BK4A 2BC0A 4JNAA 5ER0A 2ACZA 3GYIA 4EMWA 1D4EA 3UTFA 4YWOA 1F8RA 2C67A 2C76A 3BI4A 3AEGA 2C70A 5FS6A 2VVLG 1NHSA 1UKVG 5HY5A 5IPYA 1K0IA 1DJQA 4X9NA 3GD4A 1YY5A 1DOBA 1GTEA 2C73A 1PJ6A 2WEUA 3M0OA 1KNRA 1E39A 2VQBA 3NRNA 2V60A 3UOYA 2JB3A 3L8KA 3CGCA 4N9XA 3K7MX 4IVMB 2NVKX 2AQJA 4BURA 3F8PA 3QSMA 4UDPA 3AD9B 4LA1A 2CVJA 4PABA 1GEUA 2Q0KA 2WESA 4J57A 3CNJA 4OPGA 1TDOA 2GAGB 3B3RA 3LXDA 4Z25A 4GDEA 3NYCA 3D8XA 2YLWA 1BWCA 4U2TA 1E1LA 2YLXA 3H8LA 3VQRA 2C65A 5M10A 2JBVA 5EB4A 5HHFA 2WOWA 1GV4A 2X99A 1COYA 3DJJA 4K5SA 4K5RA 4UDQA 5KOWA 1PXAA 2XFPA 4FDCB 3AE2A 3Q6JA 3P4QA 3NN0X 1RSGA 2VVLA 2WU5A 5KOXA 1PXBA 4GF7A 4CRTA 2XFOA 4C74A 2GQFA 3VRDB 3R9UA 1XHCA 3DJGX 1PS9A 5GSNA 2JB1A 4YSZA 4TM1A 2EQ8A 3QVPA 1PBFA 3ATRA 3DJDA 3AE9A 3LJPA 3M13A 4FK1A 2GQWA 4YKFA 2ARDA 3AE8A 5BRTA 2VRMA 3NTAA 4HA6A 1IUVA 4WX1A 1K4QA 2EQ9A 4UDRA 4I58A 2XLSA 2XFNA 1BZLA 2BK3A 1TRBA 3ICRA 4H2PA 1DOCA 1GRTA 5FS9A 1CHUA 4H4UA 4H4WA 1BF3A 2YVJA 5JCNA 3UOXA 4TM3A 4OPDA 4H2NA 4RG3A 4U2SA 3IHMA 2E5VA 2OLOA 4AP1A 4I59A 5LV9A 3JSKA 1KFYA 2QA2A 4AT0A 3V3NA 5L46A 4GDPA 3BI5A 3CGBA 2TMDA 2Y6RA 3KPFA 1EBDA 1PJ7A 4USQA 4CNKA 3DK4A 1N4WA 4ADWA 4GR1A 1K0LA 1L0VA 4KX6A 4B65A 3I3LA 2GR1A 4GCMA 2CFYA 1D4CA 2BA9A 1BGJA 1LPFA 4DGKA 4REKA 4JNQA 4J56A 4LIIA 4APNA 4K22A 4AP3A 3KD9A 1VRQB 3UTEA 1NAAA 2C75A 2XLTA 1Y56A 3CPJG 3P1WA 1TDFA 1GSNA 1JRXA 1PDHA 3DGHA 2YWLA 2W0HA 4BJYA 1GOSA 2GB0A 4YXDA 3FIMB 3AWIA 1FOHA 1SEZA 3GWFA 4NTDA 2A87A 2Q6UA 3C4NA 2WDRA 1CC2A 3V3OA 2GR0A 2XCGA 4K8DA 4A9WA 1NHRA 3EPTA 3RP7A 2XVEA 1TDEA 3DJEA 2X8CA 2WQYA 5J60A 2R0GA 3VRBA 4K7ZA 2C64A 3LZXA 4TLZA 1H7WA 3URHA 1L9DA 1TYTA 1IUWA 4A5LA 1ZKQA 2IVDA 1CL0A 2FJBA 1Q1RA 4U8JA 4U8NA 5EB5A 4J36A 4B1BA 3LZWA 2BXRA 2C3CA 4JY2A 3ZDNA 1QJDA 3AYJA 2WETA 5DBJA 4Z2UA 3VR8A 1NG3A 3ALLA 3AE7A 1H82A 4E0VA 1JU2A 1L9CA 2VRLA 1YQ3A 2WDVA 2YR5A 2VOUA 3DA1A 3UP4A 4A6NA 1FECA 4B63A 1LQTA 4B66A 1KSUA 2WBAA 4Y4NA 3P4RA 5J7XA 2CDUA 1LQUA 1DNCA 1EL7A 1VG9A 4XXGA 2QCUA 3ADAB 4FK1C 3CTYA 3G5QA 4DSHA 2TPRA 3UTGA 1NPXA 3DH9A 1CJ2A 1NHPA 3S5WA 2YVFA 1PXCA 3QJ4A 4IA5A 2I0ZA 3BNMA 4GUVA 2NPXA 1OJAA 3PO7A 3LB8A 3UKAA 3AEBA 5BUKA 2X50A 1PHHA 2IIDA 5C2TA 4H4ZA 1RYIA 3F8RA 1OJDA 3CNSA 3SFDA 3NK0X 5CKUA 3E1TA 1KDGA 4H4QA 4H4SA 4BK3A 4J2WA 5FS7A 1E6EA 5EOWA 3DK9A 2YG3A 1GXFA 3NNEA 2BC1A 4XWRA 1GT8A 4CCRA 2YAUA 1N1PA 2V3AA 2BXSA 3H4KA 3UKLA 2GEWA 1H7XA 3AYIA 1O95A 2O9ZA 2R4EA 2WU2A 1JNRA 3H8IA 2WPCA 1ONFA 1GPEA 2OAMA 3P4SA 2FJAA 3UKKA 2ZZCA 4BV6A 2GVCA 3G5RA 3VRAA 1GRGA 4IVOB 2EQ6A 1ZOVA 1D7LA 4U8OA 2WP9A 1LTXR 2RGHA 3AE3A 3COXA 1LV0A 1ZMCA 3B6DA 4Z2RA 1H81A 1N4UA 1PBDA 2JB2A 3AYLA 3L1RA 4ZCDA 4D03A 4TM4A 1DODA 1YQ4A 2WS3A 1QLBA 2QAEA 4BK1A 3NGCX 1L9EA 1NG4A 1QO8A 1AOGA 4ICYA 2GRTA 1IUUA 1D4DA 1TDNA 1IJHA 2BK5A 4XWZA 2YG5A 2YLRA 4NTEA 2BCGG 5KRQA 4J31A 4A7AA 1NDAA 4B64A 1JOAA 3KA7A 4YKGA 4YSXA 3GMBA 2APGA 3LOVA 3AE1A 1ZP0A 1ZOYA 3NN6X 4X9MA 4EIPA 3D1CA 2JAEA 2GR2A 1JNZA 3NLCA 4NEVA 2YR4A 1HYUA 5C3JA 2F5ZA 1GNDA 1GTHA 4A65A 1GREA 2RGJA 4CY8A 3ICTA 2C7GA 4UP3A 3CGDA 5CQFA 2XLUA 2R0CA 4ZCCA 1XDIA 3QFAA 4WCTA 3UKPA 4JY3A 1M6IA 2FJDA 3CIRA 1GRFA 1MO9A 1EL5A 1KF6A 1E1MA 1PJ5A 4EQWA 1GERA 4B68A 3LADA 1GRHA 2GH5A 2OA1A 2VZ2A 2GV8A 1EL8A 3AXBA 3QFBA 1MOKA 1F8SA 2B7RA 2H88A 4H4RA 2VQ7A 4OPUA 4TLXA 1BGNA 4YT0A 2Q7VA 5U25A 4A99A 3C96A 4CBQA 4H4TA 2WHDA 4YTNA 3FBSA 1YQZA 1VG0A 4CNJA 4NTCA 2DKIA 4C3YA 2AR8A 1CC4A 4CY6A 2GMHA 3BHKA 3AEDA 2GF3A 4Y4MA 1F6MA 1B4VA 1B8SA 4OPCA 2FBWA 4ZN0A 2WPEA 2HQMA 1CJ4A 3ABVA 3I6DA 3AB1A 4NEWA 4H4XA 3ZYXA 2V5ZA 1JRZA 1CJ3A 2B9YA 2V61A 3II4A 4AOXA 3SFEA 2YQUA 2BS3A 1KSSA 1W4XA 3EF6A 3AD8B 1VDCA 4OPLA 2YM1A 1TDKA 3C4AA 4NZHA 5TR3A 2R45A 3CPIG 3EAOA 3IF9A 3ALMA 2GAHB 5IQ1A 1LVLA 3RNMA 3ICSA 3QVRA 5IQ4A 3ALJA 3GDPA 3KKJA 4D04A 2XLRA 3AE5A 5FS8A 1RP0A 1GRBA 3IHGA 3CGEA 2YG6A 1F3PA 4EM4A 1GESA 5KXJA 2XDOA 4X4JA 3OC4A 2R0PA 3UOVA 3CNDA 2YR6A 3K7TA 1K0JA 3QSEA 3ISHA 4C5OA 1H6VA 3BNUA 3G5SA 5JCIA 4A79A 1TYPA 1GETA 2XVFA 2ZZBA 4CCQA 1NHQA 5KVHA 4EQRA 2C72A 3RP8A 3K7QX 3AEFA 3VR9A 2OLNA 3UKHA 3ATQA 4M52A 1IUXA 1KNPA 1DJNA 4U2LA 1VQWA 4YTPA 3NYEA 3P4PA 4HB9A 5EBKA 1FEBA 5JCKA 1D5TA 4U8KA 3UCLA 3NK2X 3PVCA 3UKQA 3KVEA 1DXLA 4H2QA 3FG2P 2H89A 2A8XA 3QSSA 4J34A 1B37A 4PAAA 5U63A 3UTHA 2J3NA 2XLPA 3AE6A 4MJWA 1ZY8A 3OZ2A 3T37A 5JCMA 1V59A 1S2QA 4U8MA 4USRA 1Q1WA 2WP5A 1B5QA 1OJCA 4YSYA 2UZZA 2XVJA 1Y0PA 4OPIA 4H50A 1E1NA 4K2XA 5KWFA 2Z5XA 4DNAA 4Z2TA 4IA6A 1F8WA 2JKCA 4H4VA 5HXIA 4U8LA 3NT6A 3O0HA 2XVIA 1OJ9A 3NH3X 1M64A 1IUTA 2RGOA 2R9ZA 4J33A 4YTMA 1YKJA 2WP6A 3AEEA 3AECA 2WDQA 1P2EA 3PS9A 4U8PA 2EQ7A 4LU6A 4IV9A 5JCLA 3M12A 1Y56B 4RG4A 5M0ZA 3HZLA 2B7SA 2BS4A 4YSHA 1FCDA 3GWDA 3DGZA 4C3XA 1H86A 2WOIA 1REOA 3RP6A 2V3BA 1D7YA 1EL9A 4JN9A 2YVGA 1S3BA 3NG7X 4RSLA 4BK2A 1X31B 2R46A 2B76A 3NTDA 2V6OA 2A89A 2R4JA 1ELIA 4GRTA
chains in the Genus database with same CATH superfamily
1E1KA 1JROA 2YG4A 1OEPA 2P8BA 4EM3A 2C3DA 4KWSA 2IVEA 4IZGA 3UOZA 2FYMA 2DW7A 2BACA 1H84A 2OFJA 2W3RA 2OLAA 4OCGA 3CYJA 2FJEA 2WPFA 3UXKA 4KPRA 4ZOHB 3UCDA 1CC6A 4OVIA 3DFHA 3UP5A 4OPTA 1E7PA 3RHAA 2PTWA 3DERA 2Q0LA 1N4VA 2BCPA 3S61A 2PHHA 3T31A 4P9SA 3DK8A 3I6TA 4H4PA 3CNPA 2QJMA 4ECHA 3UKFA 3NYFA 2BABA 4O5QA 2X8HA 2B9WA 1NEKA 1IUSA 1S3EA 1Z6LA 2RABA 1D4EA 3UTFA 5G5GB 2C76A 3AEGA 3UGVA 1KCZA 5HY5A 1F9CA 5KNLA 2AL1A 1DJQA 2C73A 1KKRA 2XH0A 2PP1A 3JZUA 1GEUA 4J57A 4OPGA 1TDOA 3LXDA 1BWCA 1S7MA 3OTRA 1E1LA 3RR1A 5EB4A 1GV4A 1COYA 4UDQA 3UJEA 4FDCB 3AE2A 3Q45A 3RITA 1PXBA 4C74A 5GSNA 3T8QA 3M13A 3LJPA 3AE9A 3HYWA 2O56A 3ICRA 1DOCA 1EC8A 5FS9A 1CHUA 4H4UA 5JCNA 3UOXA 4OPDA 4H2NA 3IHMA 3VFCA 5LV9A 1EBGA 3JSKA 2QA2A 4AT0A 1JDFA 3BI5A 2TMDA 2E5AA 1EBDA 1PJ7A 3KPFA 4CNKA 3DK4A 4ADWA 1TKKA 4KX6A 4HCLA 2BA9A 4JNQA 3KD9A 3UTEA 1TDFA 2YWLA 2W0HA 4YXDA 4IP4A 1N62C 3GWFA 4IL2A 2A87A 2GR0A 1N5XA 2XVEA 3B97A 1TDEA 1N5WC 4K8GA 2R0GA 2W3SA 1MDRA 3LZXA 1IUWA 2XH4A 2GGIA 2DW6A 3T14A 4U8JA 4U8NA 4B1BA 4J36A 3VR8A 1NG3A 2PTZA 1H82A 1JU2A 2PODA 2VRLA 2YR5A 4A6NA 5J7XA 2CDUA 1DNCA 4XXGA 4ENLA 2P3ZA 3G5QA 1BQGA 4DSHA 3PWIA 4IA5A 3QJ4A 2I0ZA 2NPXA 3UKAA 5C2TA 4H4ZA 1RYIA 2AL2B 3E1TA 4H4QA 3NXLA 4H4SA 4J2WA 5FS7A 1MNSA 2YG3A 4XWRA 1GXFA 1GT8A 2BXSA 5KMRA 3UKLA 3T6CA 3KPKA 1ONFA 3UKKA 4BV6A 4GYPC 2WP9A 1LTXR 3AE3A 1LV0A 4Z2RA 1H81A 3AYLA 3R10A 3L1RA 4ZCDA 3T2YA 1DODA 3P0WA 1YQ4A 3NGCX 2GRTA 4NTEA 2BCGG 5KRQA 1JOAA 3QPEA 3LOVA 4IP5A 1ZP0A 3IK4A 2GR2A 4NEVA 2RGJA 1BKHA 2OG9A 3HRDC 4ZCCA 3QFAA 3CIRA 1GRFA 1MO9A 4EQWA 4B68A 1GRHA 4JN8A 4MGGA 2GV8A 4OPUA 5U25A 3N6JA 4CBQA 4H4TA 1VG0A 4H83A 3GD6A 3D46A 4Y4MA 4OPCA 2MNRA 3JVAA 4ZN0A 2WPEA 1CJ4A 3AB1A 4H4XA 2B9YA 2V61A 3PFRA 2GGGA 3DESA 2BS3A 3AD8B 4OPLA 2XH7A 1TDKA 2OQYA 3C4AA 2BRAA 3EAOA 3IF9A 1LVLA 4E6MA 5IQ4A 3ALJA 4D04A 2PTYA 3N6HA 4JHMA 3H8AA 1N63C 2XDOA 4TVWA 3OC4A 3ISHA 3BNUA 3UJRA 5JCIA 1TYPA 4CCQA 1NHQA 2QGYA 3QTPA 2C72A 2W54A 3VR9A 1WUEA 1KNPA 1DJNA 3H12A 4YTPA 2PGEA 5JCKA 3UCLA 1NELA 3UTHA 3QSSA 3OZ2A 1S2QA 4USRA 3U4FA 4YSYA 1SJCA 1OJ9A 3NH3X 1M64A 4G6GA 4J33A 2OZ8A 1YKJA 3AEEA 3N4FA 2P8CA 3M12A 4YSHA 1FCDA 3DGZA 1REOA 3NG7X 1S3BA 4RSLA 1X31B 3IWAA 4KEMA 4J3ZA 3P93A 2YM2A 2JK6A 3GD3A 4DXKA 4B67A 4M6UA 3VDGA 3NK1X 2Y6QA 3ITJA 3SZCA 5J04A 3CN8A 4Z1YA 2Z5YA 2OALA 1X2GA 4EMJA 4FX9A 3KU9A 3MUCA 2YLSA 4EQXA 2BS2A 3AEAA 1H83A 1O94A 3T0KA 5BULA 4H7UA 1FL2A 4EMIA 2NQLA 3GDNA 1DOEA 4DSGA 4A6NB 1PBBA 2X3NA 1CJCA 1CF3A 3Q4DA 3AD7B 1CBOA 3SY4A 3SGLA 2GGHA 1MUCA 3OW1A 2BYBA 2YG7A 3FMWA 3SQPA 3TWBA 4AT2A 4EQSA 2OVLA 4B69A 3T2ZA 4BJZA 3GRSA 3NVYB 3GRTA 1OJTA 3FXGA 5ENLA 3GYJA 3TCSA 5ER0A 2ACZA 4HCHA 4GGBA 3GYIA 4HNLA 1WUFA 1F8RA 3SX6A 2GSHA 3DDMA 1RVKA 2C70A 1NHSA 1K0IA 1YY5A 1GTEA 4HN8A 1PJ6A 3DG7A 2OQHA 4N9XA 3K7MX 2AQJA 3AD9B 2Q0KA 2GAGB 3D8XA 2YLWA 3TJ4A 2YLXA 3H8LA 3VQRA 2JBVA 2X99A 4K5SA 4K5RA 5KOWA 1PXAA 3NN0X 1RSGA 5KOXA 4GF7A 1MDLA 2I5QA 4G74A 4II2A 3QVPA 3DJDA 1WYGA 5BRTA 4G7FA 1FHVA 1K4QA 4UDRA 2XLSA 2BK3A 1TRBA 3VC6A 3MY9A 1BF3A 2ONEA 2E5VA 4F4RA 4AP1A 3V3NA 3DFYA 5L46A 1MRAA 3CGBA 4EWJA 2Y6RA 1N4WA 1K0LA 4B65A 3I3LA 2GR1A 4GCMA 2CFYA 1NAAA 2XLTA 3DGHA 2GB0A 1FOHA 1SEZA 2Q6UA 3V3OA 1CC2A 4K8DA 2QQ6A 1L8PA 1ONEA 1H7WA 3IJLA 4DN1A 1P48A 3NVZB 5EB5A 3LZWA 2C3CA 4JY2A 1QJDA 3AE7A 4E0VA 1EC9A 1L9CA 2WDVA 2VOUA 4B63A 1FECA 1LQTA 5FJPA 2WBAA 4GFIA 3P4RA 1EL7A 1VG9A 3I4KA 3DH9A 1NHPA 1PXCA 3PK7A 3CK5A 3BNMA 3PO7A 3AEBA 3F8RA 1OJDA 3CNSA 3SFDA 3NK0X 3FYYA 3NNEA 2BC1A 3B9JB 3H4KA 2GEWA 3AYIA 1JNRA 3H8IA 3P4SA 3VRAA 2XSXA 2GVCA 3G5RA 4IVOB 2EQ6A 3COXA 4E5TA 1PBDA 1QLBA 1NG4A 1AOGA 1IUUA 3DG6A 3TOYA 1TDNA 3AMZA 4XWZA 2YG5A 2YLRA 4A7AA 3ENLA 1E9IA 3GMBA 2APGA 1ZOYA 3NN6X 3RO6A 3H70A 3NLCA 2E3TA 2YR4A 1HYUA 4A65A 4CY8A 2C7GA 3CGDA 2PU0A 1XDIA 4E4FA 7ENLA 1M6IA 2FJDA 1EL5A 2GH5A 2OA1A 3ES8A 4H4RA 2Q7VA 4A99A 3C96A 4CNJA 4CY6A 2AR8A 4GGHA 3AEDA 2GF3A 2QDDA 1JCTA 2FBWA 3BOXA 2HQMA 3I6DA 2V5ZA 1JRZA 1CJ3A 3CXBA 3AN1A 1W4XA 3EF6A 5IQ1A 3ALMA 3KKJA 1XS2A 3NZGA 4IL0A 2BRYA 1F3PA 2HXUA 4EM4A 3HW2A 2POZA 4NWZA 2R0PA 3UOVA 3CNDA 3GO2A 3QSEA 1GETA 2HXTA 4EQRA 3RP8A 3AEFA 3A7RA 3ATQA 4M52A 1IUXA 4U2LA 1VQWA 4Z17A 1SB3B 3SJNA 3P4PA 1FEBA 4A6GA 3ES7A 3NRZB 3NK2X 3PVCA 3UKQA 3KVEA 1DXLA 3FG2P 2H89A 4PAAA 3SR6B 4MJWA 3T37A 1ZY8A 4TVYA 1V59A 4J1OA 4U8MA 2WP5A 1Y0PA 1VDVA 2Z5XA 4DNAA 4Z2TA 2QJNA 3O0HA 3R07C 3GC2A 2R9ZA 3PS9A 4U8PA 2EQ7A 4GAPA 5BOFA 3HZLA 2BS4A 1JPDX 2B76A 4G6HA 3NTDA 2V6OA 3MWCA 1DTNA 1ZX9A 1PN0A 5U1OA 3CPHG 4TM0A 3NKSA 4IHCA 3GMCA 4GMEA 2OO6A 3NIXA 1NENA 3EANA 4Z44A 3FVDA 2PYXA 4C77A 3CXOA 1ECQA 1XANA 2GMJA 4DX3A 3SQSA 2YLTA 4U8IA 5FMHA 2DKHA 2W55A 1P2HA 2PP3A 1ZMDA 2E1MA 4Z24A 1JEHA 1ELSA 3OZMA 3WE0A 4JN7A 3P9UA 1Q9IA 1GALA 3BI2A 3REDA 2HNEA 2X8GA 4JQ9A 2XYOA 1LJ1A 5EU9A 2XFUA 3THUA 3NHOX 3SN4A 3SN0A 1S2YA 3ZLGA 3DMEA 4NNJA 2XFQA 3K30A 1XPQA 4H2HA 1PBCA 1O5WA 2GR3A 2BK4A 4JNAA 4IT1A 4EMWA 6ENLA 3BJSA 4YWOA 2C67A 4M0XA 5IPYA 4X9NA 3GD4A 2WEUA 1KNRA 2VQBA 3NRNA 2V60A 3CGCA 1NU5A 3F8PA 4BURA 3QSMA 4LA1A 4PABA 2WESA 3B3RA 4H1ZA 3K1GA 4Z25A 4U2TA 2C65A 4HCDA 5HHFA 3DJJA 3EKGA 3A7AA 4K1WA 3ZVHB 3Q6JA 3RRAA 4CRTA 3V5CA 2XFOA 2GQFA 3VRDB 3R9UA 3MZNA 4YSZA 1FFUC 3QLDA 3ATRA 4YKFA 2FKPA 1FHUA 2ARDA 2MUCA 4HA6A 3SBFA 1IUVA 4WX1A 2EQ9A 3VC5A 4H2PA 1BZLA 4H4WA 2YVJA 1R0MA 5BOEA 4RG3A 4GAVA 2OLOA 3QN3A 1KFYA 4GDPA 4GR1A 5FJTA 3UJFA 1D4CA 1LPFA 4DGKA 4REKA 4J56A 4APNA 4K22A 4AP3A 1VRQB 2C75A 3P1WA 1Y56A 1JRXA 1PDHA 3D9XA 1GOSA 3FIMB 2PMQA 3C4NA 2WDRA 3VCCA 3EPTA 2WQYA 3SZWA 1T3QC 3VRBA 4K7ZA 4TLZA 1L9DA 3URHA 4A5LA 1ZKQA 1CL0A 3DG3A 2FJBA 1Q1RA 2GGJA 2BXRA 3ZDNA 5DBJA 2WETA 3ALLA 3BSMA 3DA1A 1KSUA 3NVWB 1LQUA 3ADAB 1YEYA 1CJ2A 1OJAA 3SN1A 5BUKA 1SJBA 2IIDA 4ZA0A 1KDGA 3JW7A 3T2KA 4BK3A 1E6EA 5EOWA 1H2IA 3FJ4A 2YAUA 1N1PA 2V3AA 1H7XA 3HYXA 4MKSA 2R4EA 2WU2A 2OAMA 2ZZCA 1ZOVA 1D7LA 2RGHA 5FJOA 2JB2A 3PWGA 4HYRA 4GYPA 2WS3A 4MMWA 2QAEA 3VCNA 1L9EA 3DIPA 4ICYA 4KPLA 2BK5A 2PPGA 1D4DA 4B64A 2ZADA 4YKGA 5IDZA 1JNZA 2AKZA 3A7UA 1GTHA 1GREA 3ICTA 4UP3A 5CQFA 2XLUA 1V97A 1ZXIC 4WCTA 4JY3A 1PJ5A 1N60C 1GERA 1JRPA 3RCYA 2VZ2A 3QKEA 3AXBA 3P3BA 4TLXA 3QFBA 1F8SA 2B7RA 2H88A 3EEZA 3TWAA 1YQZA 4NTCA 2DKIA 3BHKA 1B4VA 3ZVIA 4A35A 3ABVA 3N4EA 3ZYXA 3MQTA 3IJQA 3R0KA 3II4A 4AOXA 3SFEA 3UJSA 2YQUA 4NZHA 5TR3A 3CMMA 3NVVB 3CPIG 4X2PA 2GAHB 4ROPA 3QVRA 1EBHA 2CHRA 3L5OA 5FS8A 1RP0A 3IHGA 3CGEA 2YG6A 1GESA 5KXJA 4X4JA 1W6TA 3R1ZA 3V3WA 2YR6A 1K0JA 1KKOA 4C5OA 3G5SA 4A79A 2XVFA 5KVHA 1PDYA 3K7QX 1PDZA 4DWDA 1XPYA 2HZGA 4DHGA 3NYEA 4HB9A 5FJRA 1D5TA 3ZVHA 1FIQB 4H2QA 4A3RA 2XLPA 3CB3A 1Q1WA 1B5QA 1E1NA 5KWFA 2JKCA 4GIRA 5HXIA 3NT6A 3KUMA 3S47A 2WDQA 4LU6A 4IV9A 2AKMA 1Y56B 5M0ZA 2B7SA 3TW9A 3IJIA 3RP6A 3H7VA 4JN9A 2YVGA 4BK2A 3SZFA 2A89A 2R4JA 1ELIA 4GRTA 4E8GA 3HPFA 2YLZA 3R0UA 1PBEA 4H4YA 1SJDA 3BHFA 3CNTA 3NFUA 2ZC8A 4Y4LA 4II3A 4H2RA 1KD0A 4AOSA 1IYXA 2PP0A 4EIQA 2B9XA 3IC9A 2QA1A 3GSIA 4Z26A 3FPZA 2CULA 3ZLFA 2AL2A 2ZBWA 2VVMA 3CT2A 3V76A 1FEAA 3AE4A 3STPA 3Q9TA 2AAQA 3UXLA 4GISA 5GRTA 2E4GA 3F8DA 2PCEA 1ZK7A 3FV9A 5BVAA 3MKCA 3KLJA 3UJ2A 2WOVA 2P88A 3RGTA 4Z43A 1JRYA 2OZ3A 2C66A 4K2SA 2QVHA 3OPSA 1BKWA 1ZDLA 5KVIA 1GRAA 4O5UA 3SM8A 4KT2A 2RDXA 2PTXA 4FI4A 1MXTA 1FO4A 4JDRA 2ZZ0A 2XVHA 5HYMA 2BC0A 2PGWA 3UCCA 3BI4A 5FS6A 2VVLG 3TQPA 1UKVG 1DOBA 5KMSA 3M0OA 1E39A 3UOYA 2JB3A 3L8KA 4IVMB 2NVKX 4HPNA 4UDPA 4E4UA 2CVJA 3CNJA 3R11A 4GDEA 3NYCA 5M10A 5G5HB 2WOWA 2XFPA 3P4QA 2VVLA 2WU5A 1STZA 2GL5A 1XHCA 3DJGX 1PS9A 2JB1A 1X2HA 4TM1A 2EQ8A 1PBFA 4FK1A 2GQWA 2PS2A 3AE8A 2VRMA 3NTAA 3NO1A 2GDQA 4I58A 2XFNA 1GRTA 2OKTA 4TM3A 3T9PA 4U2SA 1N61C 4I59A 1VQZA 4USQA 5KMQA 2C4CA 1L0VA 5JRBA 1BGJA 4LIIA 3CPJG 1GSNA 4BJYA 3D47A 3T4WA 3AWIA 5KMPA 4NTDA 2XCGA 4A9WA 1NHRA 3RP7A 3CAWA 3DJEA 2X8CA 5J60A 3SYIA 3ETRB 2C64A 1TYTA 2IVDA 2OX4A 3AYJA 4Z2UA 3AM9A 2PA6A 1YQ3A 3UP4A 1FFVC 4B66A 3EUB3 4Y4NA 3PG6A 2QCUA 4FK1C 3CTYA 2TPRA 3TJIA 1NPXA 3UTGA 3S5WA 2YVFA 4GUVA 3LB8A 2X50A 1PHHA 5CKUA 3ZLHA 1KN0A 3DK9A 3OP2A 4CCRA 2PSNA 2GGEA 1O95A 2O9ZA 2WPCA 1GPEA 2FJAA 4DYEA 1GRGA 4U8OA 1ZMCA 3B6DA 3I6EA 4YWSA 3V5FA 1N4UA 4D03A 4TM4A 5FJUA 4BK1A 1QO8A 3DEQA 1IJHA 3HYVA 4J31A 1NDAA 3SZ0A 3KA7A 4YSXA 2P0IA 3AE1A 4X9MA 4EIPA 3D1CA 2JAEA 5C3JA 2F5ZA 1GNDA 4FP1A 3SXIA 2R0CA 3V4BA 3UKPA 1KF6A 1E1MA 3LADA 3S5SA 1EL8A 1MOKA 2XH2A 4G8TA 2VQ7A 1BGNA 4YT0A 2WHDA 4YTNA 3FBSA 4C3YA 1CC4A 2GMHA 1F6MA 1B8SA 1EC7A 4NEWA 3MSYA 2XGZA 3SSZA 1KSSA 1VDCA 2YM1A 2R45A 3R25A 3RNMA 3ICSA 2QJJA 2OZTA 3GDPA 2XLRA 4HNCA 3AE5A 1GRBA 1P43A 3TTEA 3K7TA 1H6VA 2PU1A 3NS1B 2ZZBA 1RM6B 2OPJA 3OZYA 2OLNA 3UKHA 1SJAA 5EBKA 1R6WA 4U8KA 3FCPA 4H19A 4J34A 5U63A 2A8XA 1B37A 2J3NA 3AE6A 5JCMA 4ZCWA 1OJCA 2UZZA 2XVJA 4OPIA 4H50A 1TZZA 4K2XA 1JPMA 4IA6A 1F8WA 4H4VA 4U8LA 2XVIA 3GYXA 4G9KA 1IUTA 2RGOA 4G73A 4YTMA 3GY1A 2WP6A 3VA8A 3AECA 1P2EA 3DGBA 5JCLA 4RG4A 1TE6A 3U9IA 3GWDA 4C3XA 1H86A 2WOIA 2QDEA 2V3BA 1D7YA 1EL9A 2R46A
chains in the Genus database with same CATH topology
1E1KA 2YLZA 1PBEA 4H4YA 2YG4A 2YM2A 1ZX9A 4EM3A 2JK6A 1PN0A 3GD3A 3BHFA 2C3DA 2IVEA 3UOZA 4B67A 5U1OA 3CNTA 3NK1X 2Y6QA 3ITJA 3CPHG 4TM0A 3NKSA 4H2RA 4II3A 4Y4LA 3SZCA 3GMCA 3CN8A 4AOSA 2BACA 2Z5YA 1H84A 2OALA 4EIQA 4EMJA 3IC9A 4FX9A 1NENA 2B9XA 2QA1A 3KU9A 3GSIA 3NIXA 3EANA 4Z26A 4OCGA 2YLSA 2FJEA 3FPZA 4EQXA 4Z44A 2PYXA 4C77A 2BS2A 2WPFA 3AEAA 1H83A 2CULA 4KPRA 2ZBWA 1XANA 1O94A 2VVMA 3T0KA 3V76A 2GMJA 1CC6A 4OVIA 1FEAA 5BULA 2YLTA 4H7UA 1FL2A 3AE4A 3UP5A 3Q9TA 4EMIA 2AAQA 5FMHA 1E7PA 2DKHA 4OPTA 4U8IA 5GRTA 1P2HA 3RHAA 2E4GA 3F8DA 3GDNA 1ZMDA 1DOEA 1ZK7A 2Q0LA 5BVAA 3KLJA 2E1MA 1N4VA 2BCPA 4DSGA 2WOVA 4A6NB 1PBBA 2X3NA 4Z24A 3S61A 1JEHA 1CJCA 1CF3A 2PHHA 4Z43A 1JRYA 3T31A 2C66A 4P9SA 3IWAA 3DK8A 1BKWA 1CBOA 3AD7B 1ZDLA 3SY4A 3WE0A 3SGLA 3P9UA 1Q9IA 1GALA 3BI2A 4H4PA 3REDA 2BYBA 3CNPA 2X8GA 5KVIA 1GRAA 2YG7A 4O5UA 4ECHA 4JQ9A 2XYOA 3SM8A 3FMWA 3UKFA 3SQPA 1LJ1A 3NYFA 2XFUA 2BABA 3NHOX 4AT2A 4O5QA 4EQSA 4B69A 1S2YA 1MXTA 3T2ZA 4BJZA 3DMEA 3GRSA 4NNJA 2XFQA 2X8HA 3GRTA 2B9WA 4JDRA 1OJTA 2ZZ0A 1XPQA 3K30A 1NEKA 1IUSA 1PBCA 1S3EA 1O5WA 2GR3A 1Z6LA 2XVHA 3GYJA 2RABA 5HYMA 2BK4A 2BC0A 4JNAA 5ER0A 2ACZA 3GYIA 4EMWA 1D4EA 3UTFA 4YWOA 1F8RA 2C67A 2C76A 3SX6A 3BI4A 3AEGA 2C70A 5FS6A 2VVLG 1NHSA 1UKVG 5HY5A 5IPYA 5KNLA 1K0IA 1DJQA 4X9NA 3GD4A 1YY5A 1DOBA 1GTEA 2C73A 1PJ6A 2WEUA 5KMSA 3M0OA 1KNRA 1E39A 2VQBA 3NRNA 2V60A 3UOYA 2JB3A 3L8KA 3CGCA 4N9XA 3K7MX 4IVMB 2NVKX 2AQJA 4BURA 3F8PA 3QSMA 4UDPA 3AD9B 4LA1A 2CVJA 4PABA 1GEUA 2Q0KA 2WESA 4J57A 3CNJA 4OPGA 1TDOA 2GAGB 3B3RA 3LXDA 4Z25A 4GDEA 3NYCA 3D8XA 2YLWA 1BWCA 4U2TA 1S7MA 1E1LA 2YLXA 3H8LA 3VQRA 2C65A 5M10A 2JBVA 5EB4A 5HHFA 2WOWA 1GV4A 2X99A 1COYA 3DJJA 4K5SA 4K5RA 4UDQA 5KOWA 1PXAA 2XFPA 4FDCB 3AE2A 3Q6JA 3P4QA 3NN0X 1RSGA 2VVLA 2WU5A 5KOXA 1PXBA 4GF7A 4CRTA 2XFOA 4C74A 2GQFA 3VRDB 3R9UA 1XHCA 3DJGX 1PS9A 5GSNA 2JB1A 4G74A 4YSZA 4II2A 4TM1A 2EQ8A 3QVPA 1PBFA 3ATRA 3DJDA 3AE9A 3HYWA 3LJPA 3M13A 2GQWA 4FK1A 4YKFA 2ARDA 3AE8A 5BRTA 2VRMA 3NTAA 4HA6A 1IUVA 4WX1A 1K4QA 2EQ9A 4UDRA 4I58A 2XLSA 2XFNA 1BZLA 2BK3A 1TRBA 3ICRA 4H2PA 1DOCA 1GRTA 5FS9A 1CHUA 4H4UA 4H4WA 1BF3A 2YVJA 5JCNA 3UOXA 4TM3A 4OPDA 4H2NA 4RG3A 4U2SA 3IHMA 2E5VA 4GAVA 2OLOA 4AP1A 4I59A 5LV9A 3JSKA 1KFYA 2QA2A 4AT0A 3V3NA 5L46A 4GDPA 3BI5A 3CGBA 2TMDA 2Y6RA 3KPFA 1EBDA 1PJ7A 4USQA 4CNKA 5KMQA 3DK4A 1N4WA 4ADWA 4GR1A 1K0LA 2C4CA 1L0VA 4KX6A 4B65A 3I3LA 2GR1A 4GCMA 2CFYA 1D4CA 2BA9A 5JRBA 1BGJA 1LPFA 4DGKA 4REKA 4JNQA 4J56A 4LIIA 4APNA 4K22A 4AP3A 3KD9A 1VRQB 3UTEA 1NAAA 2C75A 2XLTA 1Y56A 3CPJG 3P1WA 1TDFA 1GSNA 1JRXA 1PDHA 3DGHA 2YWLA 2W0HA 4BJYA 3D9XA 1GOSA 2GB0A 4YXDA 3FIMB 3AWIA 5KMPA 1FOHA 1SEZA 3GWFA 4NTDA 2A87A 2Q6UA 3C4NA 2WDRA 1CC2A 3V3OA 2GR0A 2XCGA 4K8DA 4A9WA 1NHRA 3EPTA 3RP7A 2XVEA 1TDEA 3DJEA 2X8CA 2WQYA 5J60A 3SYIA 3SZWA 2R0GA 3VRBA 4K7ZA 2C64A 3LZXA 4TLZA 1H7WA 3URHA 1L9DA 1TYTA 1IUWA 4A5LA 1ZKQA 2IVDA 1CL0A 2FJBA 1Q1RA 3T14A 4U8JA 4U8NA 5EB5A 4J36A 4B1BA 3LZWA 2BXRA 2C3CA 4JY2A 3ZDNA 1QJDA 3AYJA 2WETA 5DBJA 4Z2UA 3VR8A 1NG3A 3ALLA 3AE7A 1H82A 4E0VA 1JU2A 1L9CA 2VRLA 1YQ3A 2WDVA 2YR5A 2VOUA 3DA1A 3UP4A 4A6NA 1FECA 4B63A 1LQTA 4B66A 1KSUA 2WBAA 4Y4NA 3P4RA 5J7XA 2CDUA 1LQUA 3PG6A 1DNCA 1EL7A 1VG9A 4XXGA 2QCUA 3ADAB 4FK1C 3CTYA 3G5QA 4DSHA 2TPRA 3UTGA 1NPXA 3DH9A 1CJ2A 1NHPA 3S5WA 2YVFA 1PXCA 3QJ4A 4IA5A 2I0ZA 3BNMA 4GUVA 2NPXA 1OJAA 3PO7A 3LB8A 3UKAA 3AEBA 5BUKA 2X50A 1PHHA 2IIDA 5C2TA 4H4ZA 1RYIA 3F8RA 1OJDA 3CNSA 3SFDA 3NK0X 5CKUA 3E1TA 1KDGA 4H4QA 3T2KA 4H4SA 4BK3A 1KN0A 5FS7A 1E6EA 4J2WA 1H2IA 3DK9A 2YG3A 1GXFA 3NNEA 2BC1A 4XWRA 5EOWA 1GT8A 4CCRA 2YAUA 1N1PA 2V3AA 2BXSA 5KMRA 3H4KA 3UKLA 2GEWA 1H7XA 3HYXA 3AYIA 1O95A 2O9ZA 2R4EA 2WU2A 1JNRA 3H8IA 2WPCA 1ONFA 1GPEA 2OAMA 3KPKA 2FJAA 3P4SA 2ZZCA 4BV6A 2GVCA 3G5RA 3UKKA 1GRGA 4IVOB 2EQ6A 1ZOVA 1D7LA 4U8OA 2WP9A 1LTXR 2RGHA 3AE3A 3COXA 1LV0A 1ZMCA 3B6DA 4Z2RA 1H81A 1N4UA 1PBDA 2JB2A 3AYLA 3L1RA 4ZCDA 4D03A 3T2YA 4TM4A 1DODA 1YQ4A 2WS3A 1QLBA 2QAEA 4BK1A 3NGCX 1L9EA 1NG4A 1QO8A 1AOGA 4ICYA 2GRTA 1IUUA 1D4DA 1TDNA 1IJHA 2BK5A 3HYVA 4XWZA 2YG5A 2YLRA 4NTEA 2BCGG 5KRQA 4J31A 4A7AA 1NDAA 4B64A 3SZ0A 1JOAA 3KA7A 4YKGA 4YSXA 3GMBA 2APGA 3LOVA 3AE1A 1ZP0A 1ZOYA 3NN6X 4X9MA 4EIPA 3VRAA 3D1CA 2JAEA 2GR2A 1JNZA 3NLCA 4NEVA 2YR4A 1HYUA 5C3JA 2F5ZA 1GNDA 1GTHA 4A65A 1GREA 2RGJA 4CY8A 3ICTA 2C7GA 4UP3A 3CGDA 3SXIA 5CQFA 2XLUA 2R0CA 4ZCCA 1XDIA 3QFAA 4WCTA 3UKPA 4JY3A 1M6IA 2FJDA 3CIRA 1GRFA 1MO9A 1EL5A 1KF6A 1E1MA 1PJ5A 4EQWA 1GERA 4B68A 3LADA 1GRHA 2GH5A 2OA1A 2VZ2A 2GV8A 1EL8A 3AXBA 3QFBA 1MOKA 1F8SA 2B7RA 2H88A 4H4RA 2VQ7A 4OPUA 4TLXA 1BGNA 4YT0A 2Q7VA 5U25A 4A99A 3C96A 4CBQA 4H4TA 2WHDA 4YTNA 3FBSA 1YQZA 1VG0A 4CNJA 4NTCA 2DKIA 4C3YA 2AR8A 1CC4A 4CY6A 2GMHA 3BHKA 3AEDA 2GF3A 4Y4MA 1F6MA 1B4VA 1B8SA 4OPCA 2FBWA 4ZN0A 2WPEA 2HQMA 1CJ4A 3ABVA 3I6DA 3AB1A 4NEWA 4H4XA 3ZYXA 2V5ZA 1JRZA 1CJ3A 2B9YA 2V61A 3II4A 4AOXA 3SFEA 2YQUA 2BS3A 1KSSA 1W4XA 3EF6A 3AD8B 1VDCA 4OPLA 2YM1A 1TDKA 3C4AA 4NZHA 2BRAA 5TR3A 2R45A 3CMMA 3CPIG 3EAOA 3IF9A 3ALMA 2GAHB 5IQ1A 1LVLA 3RNMA 3ICSA 3QVRA 5IQ4A 3ALJA 3GDPA 3KKJA 4D04A 2XLRA 3L5OA 3AE5A 5FS8A 1RP0A 1GRBA 3IHGA 3CGEA 2BRYA 2YG6A 1F3PA 4EM4A 1GESA 5KXJA 2XDOA 4X4JA 4NWZA 3OC4A 2R0PA 3UOVA 3CNDA 2YR6A 3K7TA 1K0JA 3QSEA 3ISHA 4C5OA 1H6VA 3BNUA 3G5SA 5JCIA 4A79A 1TYPA 1GETA 2XVFA 2ZZBA 4CCQA 1NHQA 5KVHA 4EQRA 2C72A 3RP8A 3K7QX 3AEFA 3VR9A 2OLNA 3UKHA 3ATQA 4M52A 1IUXA 1KNPA 1DJNA 4U2LA 1VQWA 4YTPA 3NYEA 3P4PA 4HB9A 5EBKA 1FEBA 5JCKA 1D5TA 4U8KA 3UCLA 3NK2X 3PVCA 3UKQA 3KVEA 1DXLA 4H2QA 3FG2P 2H89A 2A8XA 3QSSA 4J34A 1B37A 4PAAA 5U63A 3UTHA 2J3NA 2XLPA 3AE6A 4MJWA 1ZY8A 3OZ2A 3T37A 5JCMA 1V59A 1S2QA 4U8MA 4USRA 1Q1WA 2WP5A 1B5QA 1OJCA 4YSYA 2UZZA 2XVJA 1Y0PA 4OPIA 4H50A 1E1NA 4K2XA 5KWFA 2Z5XA 4DNAA 4Z2TA 4IA6A 1F8WA 2JKCA 4H4VA 5HXIA 4U8LA 3NT6A 3O0HA 2XVIA 1OJ9A 3NH3X 3GYXA 1M64A 4G9KA 1IUTA 2RGOA 2R9ZA 4G6GA 4G73A 4J33A 4YTMA 1YKJA 2WP6A 3AEEA 3AECA 2WDQA 1P2EA 3PS9A 4U8PA 2EQ7A 4LU6A 4GAPA 4IV9A 5JCLA 3M12A 1Y56B 4RG4A 5M0ZA 3HZLA 2B7SA 2BS4A 4YSHA 1FCDA 3GWDA 3DGZA 4C3XA 1H86A 2WOIA 1REOA 3RP6A 2V3BA 1D7YA 1EL9A 4JN9A 2YVGA 1S3BA 3NG7X 4RSLA 3SZFA 4BK2A 1X31B 2R46A 2B76A 4G6HA 3NTDA 2V6OA 2A89A 2R4JA 1ELIA 4GRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1K A;  2YLZ A;  1PBE A;  4H4Y A;  2YG4 A;  2YM2 A;  1ZX9 A;  4EM3 A;  2JK6 A;  1PN0 A;  3GD3 A;  3BHF A;  2C3D A;  2IVE A;  3UOZ A;  4B67 A;  5U1O A;  3CNT A;  3NK1 X;  2Y6Q A;  3ITJ A;  3CPH G;  4TM0 A;  3NKS A;  4H2R A;  4Y4L A;  3GMC A;  3CN8 A;  4AOS A;  2BAC A;  2Z5Y A;  1H84 A;  2OAL A;  4EIQ A;  4EMJ A;  3IC9 A;  4FX9 A;  1NEN A;  2B9X A;  2QA1 A;  3KU9 A;  3GSI A;  3NIX A;  3EAN A;  4Z26 A;  4OCG A;  2YLS A;  2FJE A;  3FPZ A;  4EQX A;  4Z44 A;  2PYX A;  4C77 A;  2BS2 A;  2WPF A;  3AEA A;  1H83 A;  2CUL A;  4KPR A;  2ZBW A;  1XAN A;  1O94 A;  2VVM A;  3V76 A;  2GMJ A;  1CC6 A;  4OVI A;  1FEA A;  5BUL A;  2YLT A;  4H7U A;  1FL2 A;  3AE4 A;  3UP5 A;  3Q9T A;  4EMI A;  2AAQ A;  5FMH A;  1E7P A;  2DKH A;  4OPT A;  4U8I A;  5GRT A;  1P2H A;  3RHA A;  2E4G A;  3F8D A;  3GDN A;  1ZMD A;  1DOE A;  1ZK7 A;  2Q0L A;  5BVA A;  3KLJ A;  2E1M A;  1N4V A;  2BCP A;  4DSG A;  2WOV A;  4A6N B;  1PBB A;  2X3N A;  4Z24 A;  3S61 A;  1JEH A;  1CJC A;  1CF3 A;  2PHH A;  4Z43 A;  1JRY A;  2C66 A;  4P9S A;  3IWA A;  3DK8 A;  1BKW A;  1CBO A;  3AD7 B;  1ZDL A;  3WE0 A;  3SGL A;  3P9U A;  1Q9I A;  1GAL A;  3BI2 A;  4H4P A;  3RED A;  2BYB A;  3CNP A;  2X8G A;  5KVI A;  1GRA A;  2YG7 A;  4O5U A;  4ECH A;  4JQ9 A;  2XYO A;  3SM8 A;  3FMW A;  3UKF A;  3SQP A;  1LJ1 A;  3NYF A;  2XFU A;  2BAB A;  3NHO X;  4AT2 A;  4O5Q A;  4EQS A;  4B69 A;  1S2Y A;  1MXT A;  4BJZ A;  3DME A;  3GRS A;  2XFQ A;  2X8H A;  3GRT A;  2B9W A;  4JDR A;  1OJT A;  2ZZ0 A;  1XPQ A;  3K30 A;  1NEK A;  1IUS A;  1PBC A;  1S3E A;  1O5W A;  2GR3 A;  1Z6L A;  2XVH A;  3GYJ A;  2RAB A;  5HYM A;  2BK4 A;  2BC0 A;  4JNA A;  5ER0 A;  2ACZ A;  3GYI A;  4EMW A;  1D4E A;  3UTF A;  4YWO A;  1F8R A;  2C67 A;  2C76 A;  3BI4 A;  3AEG A;  2C70 A;  5FS6 A;  2VVL G;  1NHS A;  1UKV G;  5HY5 A;  5IPY A;  1K0I A;  1DJQ A;  4X9N A;  3GD4 A;  1YY5 A;  1DOB A;  1GTE A;  2C73 A;  1PJ6 A;  2WEU A;  3M0O A;  1KNR A;  1E39 A;  2VQB A;  3NRN A;  2V60 A;  3UOY A;  2JB3 A;  3L8K A;  3CGC A;  4N9X A;  3K7M X;  4IVM B;  2NVK X;  2AQJ A;  4BUR A;  3F8P A;  3QSM A;  4UDP A;  3AD9 B;  4LA1 A;  2CVJ A;  4PAB A;  1GEU A;  2Q0K A;  2WES A;  4J57 A;  3CNJ A;  4OPG A;  1TDO A;  2GAG B;  3B3R A;  3LXD A;  4Z25 A;  4GDE A;  3NYC A;  3D8X A;  2YLW A;  1BWC A;  4U2T A;  1E1L A;  2YLX A;  3H8L A;  3VQR A;  2C65 A;  5M10 A;  2JBV A;  5EB4 A;  5HHF A;  2WOW A;  1GV4 A;  2X99 A;  1COY A;  3DJJ A;  4K5S A;  4K5R A;  4UDQ A;  5KOW A;  1PXA A;  2XFP A;  4FDC B;  3AE2 A;  3Q6J A;  3P4Q A;  3NN0 X;  1RSG A;  2VVL A;  2WU5 A;  5KOX A;  1PXB A;  4GF7 A;  4CRT A;  2XFO A;  4C74 A;  2GQF A;  3VRD B;  3R9U A;  1XHC A;  3DJG X;  1PS9 A;  5GSN A;  2JB1 A;  4YSZ A;  4TM1 A;  2EQ8 A;  3QVP A;  1PBF A;  3ATR A;  3DJD A;  3AE9 A;  3LJP A;  3M13 A;  4FK1 A;  2GQW A;  4YKF A;  2ARD A;  3AE8 A;  5BRT A;  2VRM A;  3NTA A;  4HA6 A;  1IUV A;  4WX1 A;  1K4Q A;  2EQ9 A;  4UDR A;  4I58 A;  2XLS A;  2XFN A;  1BZL A;  2BK3 A;  1TRB A;  3ICR A;  4H2P A;  1DOC A;  1GRT A;  5FS9 A;  1CHU A;  4H4U A;  4H4W A;  1BF3 A;  2YVJ A;  5JCN A;  3UOX A;  4TM3 A;  4OPD A;  4H2N A;  4RG3 A;  4U2S A;  3IHM A;  2E5V A;  2OLO A;  4AP1 A;  4I59 A;  5LV9 A;  3JSK A;  1KFY A;  2QA2 A;  4AT0 A;  3V3N A;  5L46 A;  4GDP A;  3BI5 A;  3CGB A;  2TMD A;  2Y6R A;  3KPF A;  1EBD A;  1PJ7 A;  4USQ A;  4CNK A;  3DK4 A;  1N4W A;  4ADW A;  4GR1 A;  1K0L A;  1L0V A;  4KX6 A;  4B65 A;  3I3L A;  2GR1 A;  4GCM A;  2CFY A;  1D4C A;  2BA9 A;  1BGJ A;  1LPF A;  4DGK A;  4REK A;  4JNQ A;  4J56 A;  4LII A;  4APN A;  4K22 A;  4AP3 A;  3KD9 A;  1VRQ B;  3UTE A;  1NAA A;  2C75 A;  2XLT A;  1Y56 A;  3CPJ G;  3P1W A;  1TDF A;  1GSN A;  1JRX A;  1PDH A;  3DGH A;  2YWL A;  2W0H A;  4BJY A;  1GOS A;  2GB0 A;  4YXD A;  3FIM B;  3AWI A;  1FOH A;  1SEZ A;  3GWF A;  4NTD A;  2A87 A;  2Q6U A;  3C4N A;  2WDR A;  1CC2 A;  3V3O A;  2GR0 A;  2XCG A;  4K8D A;  4A9W A;  1NHR A;  3EPT A;  3RP7 A;  2XVE A;  1TDE A;  3DJE A;  2X8C A;  2WQY A;  5J60 A;  2R0G A;  3VRB A;  4K7Z A;  2C64 A;  3LZX A;  4TLZ A;  1H7W A;  3URH A;  1L9D A;  1TYT A;  1IUW A;  4A5L A;  1ZKQ A;  2IVD A;  1CL0 A;  2FJB A;  1Q1R A;  4U8J A;  4U8N A;  5EB5 A;  4J36 A;  4B1B A;  3LZW A;  2BXR A;  2C3C A;  4JY2 A;  3ZDN A;  1QJD A;  3AYJ A;  2WET A;  5DBJ A;  4Z2U A;  3VR8 A;  1NG3 A;  3ALL A;  3AE7 A;  1H82 A;  4E0V A;  1JU2 A;  1L9C A;  2VRL A;  1YQ3 A;  2WDV A;  2YR5 A;  2VOU A;  3DA1 A;  3UP4 A;  4A6N A;  1FEC A;  4B63 A;  1LQT A;  4B66 A;  1KSU A;  2WBA A;  4Y4N A;  3P4R A;  5J7X A;  2CDU A;  1LQU A;  1DNC A;  1EL7 A;  1VG9 A;  4XXG A;  2QCU A;  3ADA B;  4FK1 C;  3CTY A;  3G5Q A;  4DSH A;  2TPR A;  3UTG A;  1NPX A;  3DH9 A;  1CJ2 A;  1NHP A;  3S5W A;  2YVF A;  1PXC A;  3QJ4 A;  4IA5 A;  2I0Z A;  3BNM A;  4GUV A;  2NPX A;  1OJA A;  3PO7 A;  3LB8 A;  3UKA A;  3AEB A;  5BUK A;  2X50 A;  1PHH A;  2IID A;  5C2T A;  4H4Z A;  1RYI A;  3F8R A;  1OJD A;  3CNS A;  3SFD A;  3NK0 X;  5CKU A;  3E1T A;  1KDG A;  4H4Q A;  4H4S A;  4BK3 A;  4J2W A;  5FS7 A;  1E6E A;  5EOW A;  3DK9 A;  2YG3 A;  1GXF A;  3NNE A;  2BC1 A;  4XWR A;  1GT8 A;  4CCR A;  2YAU A;  1N1P A;  2V3A A;  2BXS A;  3H4K A;  3UKL A;  2GEW A;  1H7X A;  3AYI A;  1O95 A;  2O9Z A;  2R4E A;  2WU2 A;  1JNR A;  3H8I A;  2WPC A;  1ONF A;  1GPE A;  2OAM A;  3P4S A;  2FJA A;  3UKK A;  2ZZC A;  4BV6 A;  2GVC A;  3G5R A;  3VRA A;  1GRG A;  4IVO B;  2EQ6 A;  1ZOV A;  1D7L A;  4U8O A;  2WP9 A;  1LTX R;  2RGH A;  3AE3 A;  3COX A;  1LV0 A;  1ZMC A;  3B6D A;  4Z2R A;  1H81 A;  1N4U A;  1PBD A;  2JB2 A;  3AYL A;  3L1R A;  4ZCD A;  4D03 A;  4TM4 A;  1DOD A;  1YQ4 A;  2WS3 A;  1QLB A;  2QAE A;  4BK1 A;  3NGC X;  1L9E A;  1NG4 A;  1QO8 A;  1AOG A;  4ICY A;  2GRT A;  1IUU A;  1D4D A;  1TDN A;  1IJH A;  2BK5 A;  4XWZ A;  2YG5 A;  2YLR A;  4NTE A;  2BCG G;  5KRQ A;  4J31 A;  4A7A A;  1NDA A;  4B64 A;  1JOA A;  3KA7 A;  4YKG A;  4YSX A;  3GMB A;  2APG A;  3LOV A;  3AE1 A;  1ZP0 A;  1ZOY A;  3NN6 X;  4X9M A;  4EIP A;  3D1C A;  2JAE A;  2GR2 A;  1JNZ A;  3NLC A;  4NEV A;  2YR4 A;  1HYU A;  5C3J A;  2F5Z A;  1GND A;  1GTH A;  4A65 A;  1GRE A;  2RGJ A;  4CY8 A;  3ICT A;  2C7G A;  4UP3 A;  3CGD A;  5CQF A;  2XLU A;  2R0C A;  4ZCC A;  1XDI A;  3QFA A;  4WCT A;  3UKP A;  4JY3 A;  1M6I A;  2FJD A;  3CIR A;  1GRF A;  1MO9 A;  1EL5 A;  1KF6 A;  1E1M A;  1PJ5 A;  4EQW A;  1GER A;  4B68 A;  3LAD A;  1GRH A;  2GH5 A;  2OA1 A;  2VZ2 A;  2GV8 A;  1EL8 A;  3AXB A;  3QFB A;  1MOK A;  1F8S A;  2B7R A;  2H88 A;  4H4R A;  2VQ7 A;  4OPU A;  4TLX A;  1BGN A;  4YT0 A;  2Q7V A;  5U25 A;  4A99 A;  3C96 A;  4CBQ A;  4H4T A;  2WHD A;  4YTN A;  3FBS A;  1YQZ A;  1VG0 A;  4CNJ A;  4NTC A;  2DKI A;  4C3Y A;  2AR8 A;  1CC4 A;  4CY6 A;  2GMH A;  3BHK A;  3AED A;  2GF3 A;  4Y4M A;  1F6M A;  1B4V A;  1B8S A;  4OPC A;  2FBW A;  4ZN0 A;  2WPE A;  2HQM A;  1CJ4 A;  3ABV A;  3I6D A;  3AB1 A;  4NEW A;  4H4X A;  3ZYX A;  2V5Z A;  1JRZ A;  1CJ3 A;  2B9Y A;  2V61 A;  3II4 A;  4AOX A;  3SFE A;  2YQU A;  2BS3 A;  1KSS A;  1W4X A;  3EF6 A;  3AD8 B;  1VDC A;  4OPL A;  2YM1 A;  1TDK A;  3C4A A;  4NZH A;  5TR3 A;  2R45 A;  3CPI G;  3EAO A;  3IF9 A;  3ALM A;  2GAH B;  5IQ1 A;  1LVL A;  3RNM A;  3ICS A;  3QVR A;  5IQ4 A;  3ALJ A;  3GDP A;  3KKJ A;  4D04 A;  2XLR A;  3AE5 A;  5FS8 A;  1RP0 A;  1GRB A;  3IHG A;  3CGE A;  2YG6 A;  1F3P A;  4EM4 A;  1GES A;  5KXJ A;  2XDO A;  4X4J A;  3OC4 A;  2R0P A;  3UOV A;  3CND A;  2YR6 A;  3K7T A;  1K0J A;  3QSE A;  3ISH A;  4C5O A;  1H6V A;  3BNU A;  3G5S A;  5JCI A;  4A79 A;  1TYP A;  1GET A;  2XVF A;  2ZZB A;  4CCQ A;  1NHQ A;  5KVH A;  4EQR A;  2C72 A;  3RP8 A;  3K7Q X;  3AEF A;  3VR9 A;  2OLN A;  3UKH A;  3ATQ A;  4M52 A;  1IUX A;  1KNP A;  1DJN A;  4U2L A;  1VQW A;  4YTP A;  3NYE A;  3P4P A;  4HB9 A;  5EBK A;  1FEB A;  5JCK A;  1D5T A;  4U8K A;  3UCL A;  3NK2 X;  3PVC A;  3UKQ A;  3KVE A;  1DXL A;  4H2Q A;  3FG2 P;  2H89 A;  2A8X A;  3QSS A;  4J34 A;  1B37 A;  4PAA A;  5U63 A;  3UTH A;  2J3N A;  2XLP A;  3AE6 A;  4MJW A;  1ZY8 A;  3OZ2 A;  3T37 A;  5JCM A;  1V59 A;  1S2Q A;  4U8M A;  4USR A;  1Q1W A;  2WP5 A;  1B5Q A;  1OJC A;  4YSY A;  2UZZ A;  2XVJ A;  1Y0P A;  4OPI A;  4H50 A;  1E1N A;  4K2X A;  5KWF A;  2Z5X A;  4DNA A;  4Z2T A;  4IA6 A;  1F8W A;  2JKC A;  4H4V A;  5HXI A;  4U8L A;  3NT6 A;  3O0H A;  2XVI A;  1OJ9 A;  3NH3 X;  1M64 A;  1IUT A;  2RGO A;  2R9Z A;  4J33 A;  4YTM A;  1YKJ A;  2WP6 A;  3AEE A;  3AEC A;  2WDQ A;  1P2E A;  3PS9 A;  4U8P A;  2EQ7 A;  4LU6 A;  4IV9 A;  5JCL A;  3M12 A;  1Y56 B;  4RG4 A;  5M0Z A;  3HZL A;  2B7S A;  2BS4 A;  4YSH A;  1FCD A;  3GWD A;  3DGZ A;  4C3X A;  1H86 A;  2WOI A;  1REO A;  3RP6 A;  2V3B A;  1D7Y A;  1EL9 A;  4JN9 A;  2YVG A;  1S3B A;  3NG7 X;  4RSL A;  4BK2 A;  1X31 B;  2R46 A;  2B76 A;  3NTD A;  2V6O A;  2A89 A;  2R4J A;  1ELI A;  4GRT A; 
#chains in the Genus database with same CATH topology
 1E1K A;  1JRO A;  2YG4 A;  1OEP A;  2P8B A;  4EM3 A;  2C3D A;  4KWS A;  2IVE A;  4IZG A;  3UOZ A;  2FYM A;  2DW7 A;  2BAC A;  1H84 A;  2OFJ A;  2W3R A;  2OLA A;  4OCG A;  3CYJ A;  2FJE A;  2WPF A;  3UXK A;  4KPR A;  4ZOH B;  3UCD A;  1CC6 A;  4OVI A;  3DFH A;  3UP5 A;  4OPT A;  1E7P A;  3RHA A;  2PTW A;  3DER A;  2Q0L A;  1N4V A;  2BCP A;  3S61 A;  2PHH A;  3T31 A;  4P9S A;  3DK8 A;  3I6T A;  4H4P A;  3CNP A;  2QJM A;  4ECH A;  3UKF A;  3NYF A;  2BAB A;  4O5Q A;  2X8H A;  2B9W A;  1NEK A;  1IUS A;  1S3E A;  1Z6L A;  2RAB A;  1D4E A;  3UTF A;  5G5G B;  2C76 A;  3AEG A;  3UGV A;  1KCZ A;  5HY5 A;  1F9C A;  5KNL A;  2AL1 A;  1DJQ A;  2C73 A;  1KKR A;  2XH0 A;  2PP1 A;  3JZU A;  1GEU A;  4J57 A;  4OPG A;  1TDO A;  3LXD A;  1BWC A;  1S7M A;  3OTR A;  1E1L A;  3RR1 A;  5EB4 A;  1GV4 A;  1COY A;  4UDQ A;  3UJE A;  4FDC B;  3AE2 A;  3Q45 A;  3RIT A;  1PXB A;  4C74 A;  5GSN A;  3T8Q A;  3M13 A;  3LJP A;  3AE9 A;  3HYW A;  2O56 A;  3ICR A;  1DOC A;  1EC8 A;  5FS9 A;  1CHU A;  4H4U A;  5JCN A;  3UOX A;  4OPD A;  4H2N A;  3IHM A;  3VFC A;  5LV9 A;  1EBG A;  3JSK A;  2QA2 A;  4AT0 A;  1JDF A;  3BI5 A;  2TMD A;  2E5A A;  1EBD A;  1PJ7 A;  3KPF A;  4CNK A;  3DK4 A;  4ADW A;  1TKK A;  4KX6 A;  4HCL A;  2BA9 A;  4JNQ A;  3KD9 A;  3UTE A;  1TDF A;  2YWL A;  2W0H A;  4YXD A;  4IP4 A;  1N62 C;  3GWF A;  4IL2 A;  2A87 A;  2GR0 A;  1N5X A;  2XVE A;  3B97 A;  1TDE A;  1N5W C;  4K8G A;  2R0G A;  2W3S A;  1MDR A;  3LZX A;  1IUW A;  2XH4 A;  2GGI A;  2DW6 A;  3T14 A;  4U8J A;  4U8N A;  4B1B A;  4J36 A;  3VR8 A;  1NG3 A;  2PTZ A;  1H82 A;  1JU2 A;  2POD A;  2VRL A;  2YR5 A;  4A6N A;  5J7X A;  2CDU A;  1DNC A;  4XXG A;  4ENL A;  2P3Z A;  3G5Q A;  1BQG A;  4DSH A;  3PWI A;  4IA5 A;  3QJ4 A;  2I0Z A;  2NPX A;  3UKA A;  5C2T A;  4H4Z A;  1RYI A;  2AL2 B;  3E1T A;  4H4Q A;  3NXL A;  4H4S A;  4J2W A;  5FS7 A;  1MNS A;  2YG3 A;  4XWR A;  1GXF A;  1GT8 A;  2BXS A;  5KMR A;  3UKL A;  3T6C A;  3KPK A;  1ONF A;  3UKK A;  4BV6 A;  4GYP C;  2WP9 A;  1LTX R;  3AE3 A;  1LV0 A;  4Z2R A;  1H81 A;  3AYL A;  3R10 A;  3L1R A;  4ZCD A;  3T2Y A;  1DOD A;  3P0W A;  1YQ4 A;  3NGC X;  2GRT A;  4NTE A;  2BCG G;  5KRQ A;  1JOA A;  3QPE A;  3LOV A;  4IP5 A;  1ZP0 A;  3IK4 A;  2GR2 A;  4NEV A;  2RGJ A;  1BKH A;  2OG9 A;  3HRD C;  4ZCC A;  3QFA A;  3CIR A;  1GRF A;  1MO9 A;  4EQW A;  4B68 A;  1GRH A;  4JN8 A;  4MGG A;  2GV8 A;  4OPU A;  5U25 A;  3N6J A;  4CBQ A;  4H4T A;  1VG0 A;  4H83 A;  3GD6 A;  3D46 A;  4Y4M A;  4OPC A;  2MNR A;  3JVA A;  4ZN0 A;  2WPE A;  1CJ4 A;  3AB1 A;  4H4X A;  2B9Y A;  2V61 A;  3PFR A;  2GGG A;  3DES A;  2BS3 A;  3AD8 B;  4OPL A;  2XH7 A;  1TDK A;  2OQY A;  3C4A A;  2BRA A;  3EAO A;  3IF9 A;  1LVL A;  4E6M A;  5IQ4 A;  3ALJ A;  4D04 A;  2PTY A;  3N6H A;  4JHM A;  3H8A A;  1N63 C;  2XDO A;  4TVW A;  3OC4 A;  3ISH A;  3BNU A;  3UJR A;  5JCI A;  1TYP A;  4CCQ A;  1NHQ A;  2QGY A;  3QTP A;  2C72 A;  2W54 A;  3VR9 A;  1WUE A;  1KNP A;  1DJN A;  3H12 A;  4YTP A;  2PGE A;  5JCK A;  3UCL A;  1NEL A;  3UTH A;  3QSS A;  3OZ2 A;  1S2Q A;  4USR A;  3U4F A;  4YSY A;  1SJC A;  1OJ9 A;  3NH3 X;  1M64 A;  4G6G A;  4J33 A;  2OZ8 A;  1YKJ A;  3AEE A;  3N4F A;  2P8C A;  3M12 A;  4YSH A;  1FCD A;  3DGZ A;  1REO A;  3NG7 X;  1S3B A;  4RSL A;  1X31 B;  3IWA A;  4KEM A;  4J3Z A;  3P93 A;  2YM2 A;  2JK6 A;  3GD3 A;  4DXK A;  4B67 A;  4M6U A;  3VDG A;  3NK1 X;  2Y6Q A;  3ITJ A;  3SZC A;  5J04 A;  3CN8 A;  4Z1Y A;  2Z5Y A;  2OAL A;  1X2G A;  4EMJ A;  4FX9 A;  3KU9 A;  3MUC A;  2YLS A;  4EQX A;  2BS2 A;  3AEA A;  1H83 A;  1O94 A;  3T0K A;  5BUL A;  4H7U A;  1FL2 A;  4EMI A;  2NQL A;  3GDN A;  1DOE A;  4DSG A;  4A6N B;  1PBB A;  2X3N A;  1CJC A;  1CF3 A;  3Q4D A;  3AD7 B;  1CBO A;  3SY4 A;  3SGL A;  2GGH A;  1MUC A;  3OW1 A;  2BYB A;  2YG7 A;  3FMW A;  3SQP A;  3TWB A;  4AT2 A;  4EQS A;  2OVL A;  4B69 A;  3T2Z A;  4BJZ A;  3GRS A;  3NVY B;  3GRT A;  1OJT A;  3FXG A;  5ENL A;  3GYJ A;  3TCS A;  5ER0 A;  2ACZ A;  4HCH A;  4GGB A;  3GYI A;  4HNL A;  1WUF A;  1F8R A;  3SX6 A;  2GSH A;  3DDM A;  1RVK A;  2C70 A;  1NHS A;  1K0I A;  1YY5 A;  1GTE A;  4HN8 A;  1PJ6 A;  3DG7 A;  2OQH A;  4N9X A;  3K7M X;  2AQJ A;  3AD9 B;  2Q0K A;  2GAG B;  3D8X A;  2YLW A;  3TJ4 A;  2YLX A;  3H8L A;  3VQR A;  2JBV A;  2X99 A;  4K5S A;  4K5R A;  5KOW A;  1PXA A;  3NN0 X;  1RSG A;  5KOX A;  4GF7 A;  1MDL A;  2I5Q A;  4G74 A;  4II2 A;  3QVP A;  3DJD A;  1WYG A;  5BRT A;  4G7F A;  1FHV A;  1K4Q A;  4UDR A;  2XLS A;  2BK3 A;  1TRB A;  3VC6 A;  3MY9 A;  1BF3 A;  2ONE A;  2E5V A;  4F4R A;  4AP1 A;  3V3N A;  3DFY A;  5L46 A;  1MRA A;  3CGB A;  4EWJ A;  2Y6R A;  1N4W A;  1K0L A;  4B65 A;  3I3L A;  2GR1 A;  4GCM A;  2CFY A;  1NAA A;  2XLT A;  3DGH A;  2GB0 A;  1FOH A;  1SEZ A;  2Q6U A;  3V3O A;  1CC2 A;  4K8D A;  2QQ6 A;  1L8P A;  1ONE A;  1H7W A;  3IJL A;  4DN1 A;  1P48 A;  3NVZ B;  5EB5 A;  3LZW A;  2C3C A;  4JY2 A;  1QJD A;  3AE7 A;  4E0V A;  1EC9 A;  1L9C A;  2WDV A;  2VOU A;  4B63 A;  1FEC A;  1LQT A;  5FJP A;  2WBA A;  4GFI A;  3P4R A;  1EL7 A;  1VG9 A;  3I4K A;  3DH9 A;  1NHP A;  1PXC A;  3PK7 A;  3CK5 A;  3BNM A;  3PO7 A;  3AEB A;  3F8R A;  1OJD A;  3CNS A;  3SFD A;  3NK0 X;  3FYY A;  3NNE A;  2BC1 A;  3B9J B;  3H4K A;  2GEW A;  3AYI A;  1JNR A;  3H8I A;  3P4S A;  3VRA A;  2XSX A;  2GVC A;  3G5R A;  4IVO B;  2EQ6 A;  3COX A;  4E5T A;  1PBD A;  1QLB A;  1NG4 A;  1AOG A;  1IUU A;  3DG6 A;  3TOY A;  1TDN A;  3AMZ A;  4XWZ A;  2YG5 A;  2YLR A;  4A7A A;  3ENL A;  1E9I A;  3GMB A;  2APG A;  1ZOY A;  3NN6 X;  3RO6 A;  3H70 A;  3NLC A;  2E3T A;  2YR4 A;  1HYU A;  4A65 A;  4CY8 A;  2C7G A;  3CGD A;  2PU0 A;  1XDI A;  4E4F A;  7ENL A;  1M6I A;  2FJD A;  1EL5 A;  2GH5 A;  2OA1 A;  3ES8 A;  4H4R A;  2Q7V A;  4A99 A;  3C96 A;  4CNJ A;  4CY6 A;  2AR8 A;  4GGH A;  3AED A;  2GF3 A;  2QDD A;  1JCT A;  2FBW A;  3BOX A;  2HQM A;  3I6D A;  2V5Z A;  1JRZ A;  1CJ3 A;  3CXB A;  3AN1 A;  1W4X A;  3EF6 A;  5IQ1 A;  3ALM A;  3KKJ A;  1XS2 A;  3NZG A;  4IL0 A;  2BRY A;  1F3P A;  2HXU A;  4EM4 A;  3HW2 A;  2POZ A;  4NWZ A;  2R0P A;  3UOV A;  3CND A;  3GO2 A;  3QSE A;  1GET A;  2HXT A;  4EQR A;  3RP8 A;  3AEF A;  3A7R A;  3ATQ A;  4M52 A;  1IUX A;  4U2L A;  1VQW A;  4Z17 A;  1SB3 B;  3SJN A;  3P4P A;  1FEB A;  4A6G A;  3ES7 A;  3NRZ B;  3NK2 X;  3PVC A;  3UKQ A;  3KVE A;  1DXL A;  3FG2 P;  2H89 A;  4PAA A;  3SR6 B;  4MJW A;  3T37 A;  1ZY8 A;  4TVY A;  1V59 A;  4J1O A;  4U8M A;  2WP5 A;  1Y0P A;  1VDV A;  2Z5X A;  4DNA A;  4Z2T A;  2QJN A;  3O0H A;  3R07 C;  3GC2 A;  2R9Z A;  3PS9 A;  4U8P A;  2EQ7 A;  4GAP A;  5BOF A;  3HZL A;  2BS4 A;  1JPD X;  2B76 A;  4G6H A;  3NTD A;  2V6O A;  3MWC A;  1DTN A;  1ZX9 A;  1PN0 A;  5U1O A;  3CPH G;  4TM0 A;  3NKS A;  4IHC A;  3GMC A;  4GME A;  2OO6 A;  3NIX A;  1NEN A;  3EAN A;  4Z44 A;  3FVD A;  2PYX A;  4C77 A;  3CXO A;  1ECQ A;  1XAN A;  2GMJ A;  4DX3 A;  3SQS A;  2YLT A;  4U8I A;  5FMH A;  2DKH A;  2W55 A;  1P2H A;  2PP3 A;  1ZMD A;  2E1M A;  4Z24 A;  1JEH A;  1ELS A;  3OZM A;  3WE0 A;  4JN7 A;  3P9U A;  1Q9I A;  1GAL A;  3BI2 A;  3RED A;  2HNE A;  2X8G A;  4JQ9 A;  2XYO A;  1LJ1 A;  5EU9 A;  2XFU A;  3THU A;  3NHO X;  3SN4 A;  3SN0 A;  1S2Y A;  3ZLG A;  3DME A;  4NNJ A;  2XFQ A;  3K30 A;  1XPQ A;  4H2H A;  1PBC A;  1O5W A;  2GR3 A;  2BK4 A;  4JNA A;  4IT1 A;  4EMW A;  6ENL A;  3BJS A;  4YWO A;  2C67 A;  4M0X A;  5IPY A;  4X9N A;  3GD4 A;  2WEU A;  1KNR A;  2VQB A;  3NRN A;  2V60 A;  3CGC A;  1NU5 A;  3F8P A;  4BUR A;  3QSM A;  4LA1 A;  4PAB A;  2WES A;  3B3R A;  4H1Z A;  3K1G A;  4Z25 A;  4U2T A;  2C65 A;  4HCD A;  5HHF A;  3DJJ A;  3EKG A;  3A7A A;  4K1W A;  3ZVH B;  3Q6J A;  3RRA A;  4CRT A;  3V5C A;  2XFO A;  2GQF A;  3VRD B;  3R9U A;  3MZN A;  4YSZ A;  1FFU C;  3QLD A;  3ATR A;  4YKF A;  2FKP A;  1FHU A;  2ARD A;  2MUC A;  4HA6 A;  3SBF A;  1IUV A;  4WX1 A;  2EQ9 A;  3VC5 A;  4H2P A;  1BZL A;  4H4W A;  2YVJ A;  1R0M A;  5BOE A;  4RG3 A;  4GAV A;  2OLO A;  3QN3 A;  1KFY A;  4GDP A;  4GR1 A;  5FJT A;  3UJF A;  1D4C A;  1LPF A;  4DGK A;  4REK A;  4J56 A;  4APN A;  4K22 A;  4AP3 A;  1VRQ B;  2C75 A;  3P1W A;  1Y56 A;  1JRX A;  1PDH A;  3D9X A;  1GOS A;  3FIM B;  2PMQ A;  3C4N A;  2WDR A;  3VCC A;  3EPT A;  2WQY A;  3SZW A;  1T3Q C;  3VRB A;  4K7Z A;  4TLZ A;  1L9D A;  3URH A;  4A5L A;  1ZKQ A;  1CL0 A;  3DG3 A;  2FJB A;  1Q1R A;  2GGJ A;  2BXR A;  3ZDN A;  5DBJ A;  2WET A;  3ALL A;  3BSM A;  3DA1 A;  1KSU A;  3NVW B;  1LQU A;  3ADA B;  1YEY A;  1CJ2 A;  1OJA A;  3SN1 A;  5BUK A;  1SJB A;  2IID A;  4ZA0 A;  1KDG A;  3JW7 A;  3T2K A;  4BK3 A;  1E6E A;  5EOW A;  1H2I A;  3FJ4 A;  2YAU A;  1N1P A;  2V3A A;  1H7X A;  3HYX A;  4MKS A;  2R4E A;  2WU2 A;  2OAM A;  2ZZC A;  1ZOV A;  1D7L A;  2RGH A;  5FJO A;  2JB2 A;  3PWG A;  4HYR A;  4GYP A;  2WS3 A;  4MMW A;  2QAE A;  3VCN A;  1L9E A;  3DIP A;  4ICY A;  4KPL A;  2BK5 A;  2PPG A;  1D4D A;  4B64 A;  2ZAD A;  4YKG A;  5IDZ A;  1JNZ A;  2AKZ A;  3A7U A;  1GTH A;  1GRE A;  3ICT A;  4UP3 A;  5CQF A;  2XLU A;  1V97 A;  1ZXI C;  4WCT A;  4JY3 A;  1PJ5 A;  1N60 C;  1GER A;  1JRP A;  3RCY A;  2VZ2 A;  3QKE A;  3AXB A;  3P3B A;  4TLX A;  3QFB A;  1F8S A;  2B7R A;  2H88 A;  3EEZ A;  3TWA A;  1YQZ A;  4NTC A;  2DKI A;  3BHK A;  1B4V A;  3ZVI A;  4A35 A;  3ABV A;  3N4E A;  3ZYX A;  3MQT A;  3IJQ A;  3R0K A;  3II4 A;  4AOX A;  3SFE A;  3UJS A;  2YQU A;  4NZH A;  5TR3 A;  3CMM A;  3NVV B;  3CPI G;  4X2P A;  2GAH B;  4ROP A;  3QVR A;  1EBH A;  2CHR A;  3L5O A;  5FS8 A;  1RP0 A;  3IHG A;  3CGE A;  2YG6 A;  1GES A;  5KXJ A;  4X4J A;  1W6T A;  3R1Z A;  3V3W A;  2YR6 A;  1K0J A;  1KKO A;  4C5O A;  3G5S A;  4A79 A;  2XVF A;  5KVH A;  1PDY A;  3K7Q X;  1PDZ A;  4DWD A;  1XPY A;  2HZG A;  4DHG A;  3NYE A;  4HB9 A;  5FJR A;  1D5T A;  3ZVH A;  1FIQ B;  4H2Q A;  4A3R A;  2XLP A;  3CB3 A;  1Q1W A;  1B5Q A;  1E1N A;  5KWF A;  2JKC A;  4GIR A;  5HXI A;  3NT6 A;  3KUM A;  3S47 A;  2WDQ A;  4LU6 A;  4IV9 A;  2AKM A;  1Y56 B;  5M0Z A;  2B7S A;  3TW9 A;  3IJI A;  3RP6 A;  3H7V A;  4JN9 A;  2YVG A;  4BK2 A;  3SZF A;  2A89 A;  2R4J A;  1ELI A;  4GRT A;  4E8G A;  3HPF A;  2YLZ A;  3R0U A;  1PBE A;  4H4Y A;  1SJD A;  3BHF A;  3CNT A;  3NFU A;  2ZC8 A;  4Y4L A;  4II3 A;  4H2R A;  1KD0 A;  4AOS A;  1IYX A;  2PP0 A;  4EIQ A;  2B9X A;  3IC9 A;  2QA1 A;  3GSI A;  4Z26 A;  3FPZ A;  2CUL A;  3ZLF A;  2AL2 A;  2ZBW A;  2VVM A;  3CT2 A;  3V76 A;  1FEA A;  3AE4 A;  3STP A;  3Q9T A;  2AAQ A;  3UXL A;  4GIS A;  5GRT A;  2E4G A;  3F8D A;  2PCE A;  1ZK7 A;  3FV9 A;  5BVA A;  3MKC A;  3KLJ A;  3UJ2 A;  2WOV A;  2P88 A;  3RGT A;  4Z43 A;  1JRY A;  2OZ3 A;  2C66 A;  4K2S A;  2QVH A;  3OPS A;  1BKW A;  1ZDL A;  5KVI A;  1GRA A;  4O5U A;  3SM8 A;  4KT2 A;  2RDX A;  2PTX A;  4FI4 A;  1MXT A;  1FO4 A;  4JDR A;  2ZZ0 A;  2XVH A;  5HYM A;  2BC0 A;  2PGW A;  3UCC A;  3BI4 A;  5FS6 A;  2VVL G;  3TQP A;  1UKV G;  1DOB A;  5KMS A;  3M0O A;  1E39 A;  3UOY A;  2JB3 A;  3L8K A;  4IVM B;  2NVK X;  4HPN A;  4UDP A;  4E4U A;  2CVJ A;  3CNJ A;  3R11 A;  4GDE A;  3NYC A;  5M10 A;  5G5H B;  2WOW A;  2XFP A;  3P4Q A;  2VVL A;  2WU5 A;  1STZ A;  2GL5 A;  1XHC A;  3DJG X;  1PS9 A;  2JB1 A;  1X2H A;  4TM1 A;  2EQ8 A;  1PBF A;  4FK1 A;  2GQW A;  2PS2 A;  3AE8 A;  2VRM A;  3NTA A;  3NO1 A;  2GDQ A;  4I58 A;  2XFN A;  1GRT A;  2OKT A;  4TM3 A;  3T9P A;  4U2S A;  1N61 C;  4I59 A;  1VQZ A;  4USQ A;  5KMQ A;  2C4C A;  1L0V A;  5JRB A;  1BGJ A;  4LII A;  3CPJ G;  1GSN A;  4BJY A;  3D47 A;  3T4W A;  3AWI A;  5KMP A;  4NTD A;  2XCG A;  4A9W A;  1NHR A;  3RP7 A;  3CAW A;  3DJE A;  2X8C A;  5J60 A;  3SYI A;  3ETR B;  2C64 A;  1TYT A;  2IVD A;  2OX4 A;  3AYJ A;  4Z2U A;  3AM9 A;  2PA6 A;  1YQ3 A;  3UP4 A;  1FFV C;  4B66 A;  3EUB 3;  4Y4N A;  3PG6 A;  2QCU A;  4FK1 C;  3CTY A;  2TPR A;  3TJI A;  1NPX A;  3UTG A;  3S5W A;  2YVF A;  4GUV A;  3LB8 A;  2X50 A;  1PHH A;  5CKU A;  3ZLH A;  1KN0 A;  3DK9 A;  3OP2 A;  4CCR A;  2PSN A;  2GGE A;  1O95 A;  2O9Z A;  2WPC A;  1GPE A;  2FJA A;  4DYE A;  1GRG A;  4U8O A;  1ZMC A;  3B6D A;  3I6E A;  4YWS A;  3V5F A;  1N4U A;  4D03 A;  4TM4 A;  5FJU A;  4BK1 A;  1QO8 A;  3DEQ A;  1IJH A;  3HYV A;  4J31 A;  1NDA A;  3SZ0 A;  3KA7 A;  4YSX A;  2P0I A;  3AE1 A;  4X9M A;  4EIP A;  3D1C A;  2JAE A;  5C3J A;  2F5Z A;  1GND A;  4FP1 A;  3SXI A;  2R0C A;  3V4B A;  3UKP A;  1KF6 A;  1E1M A;  3LAD A;  3S5S A;  1EL8 A;  1MOK A;  2XH2 A;  4G8T A;  2VQ7 A;  1BGN A;  4YT0 A;  2WHD A;  4YTN A;  3FBS A;  4C3Y A;  1CC4 A;  2GMH A;  1F6M A;  1B8S A;  1EC7 A;  4NEW A;  3MSY A;  2XGZ A;  3SSZ A;  1KSS A;  1VDC A;  2YM1 A;  2R45 A;  3R25 A;  3RNM A;  3ICS A;  2QJJ A;  2OZT A;  3GDP A;  2XLR A;  4HNC A;  3AE5 A;  1GRB A;  1P43 A;  3TTE A;  3K7T A;  1H6V A;  2PU1 A;  3NS1 B;  2ZZB A;  1RM6 B;  2OPJ A;  3OZY A;  2OLN A;  3UKH A;  1SJA A;  5EBK A;  1R6W A;  4U8K A;  3FCP A;  4H19 A;  4J34 A;  5U63 A;  2A8X A;  1B37 A;  2J3N A;  3AE6 A;  5JCM A;  4ZCW A;  1OJC A;  2UZZ A;  2XVJ A;  4OPI A;  4H50 A;  1TZZ A;  4K2X A;  1JPM A;  4IA6 A;  1F8W A;  4H4V A;  4U8L A;  2XVI A;  3GYX A;  4G9K A;  1IUT A;  2RGO A;  4G73 A;  4YTM A;  3GY1 A;  2WP6 A;  3VA8 A;  3AEC A;  1P2E A;  3DGB A;  5JCL A;  4RG4 A;  1TE6 A;  3U9I A;  3GWD A;  4C3X A;  1H86 A;  2WOI A;  2QDE A;  2V3B A;  1D7Y A;  1EL9 A;  2R46 A; 
#chains in the Genus database with same CATH homology
 1E1K A;  2YLZ A;  1PBE A;  4H4Y A;  2YG4 A;  2YM2 A;  1ZX9 A;  4EM3 A;  2JK6 A;  1PN0 A;  3GD3 A;  3BHF A;  2C3D A;  2IVE A;  3UOZ A;  4B67 A;  5U1O A;  3CNT A;  3NK1 X;  2Y6Q A;  3ITJ A;  3CPH G;  4TM0 A;  3NKS A;  4H2R A;  4II3 A;  4Y4L A;  3SZC A;  3GMC A;  3CN8 A;  4AOS A;  2BAC A;  2Z5Y A;  1H84 A;  2OAL A;  4EIQ A;  4EMJ A;  3IC9 A;  4FX9 A;  1NEN A;  2B9X A;  2QA1 A;  3KU9 A;  3GSI A;  3NIX A;  3EAN A;  4Z26 A;  4OCG A;  2YLS A;  2FJE A;  3FPZ A;  4EQX A;  4Z44 A;  2PYX A;  4C77 A;  2BS2 A;  2WPF A;  3AEA A;  1H83 A;  2CUL A;  4KPR A;  2ZBW A;  1XAN A;  1O94 A;  2VVM A;  3T0K A;  3V76 A;  2GMJ A;  1CC6 A;  4OVI A;  1FEA A;  5BUL A;  2YLT A;  4H7U A;  1FL2 A;  3AE4 A;  3UP5 A;  3Q9T A;  4EMI A;  2AAQ A;  5FMH A;  1E7P A;  2DKH A;  4OPT A;  4U8I A;  5GRT A;  1P2H A;  3RHA A;  2E4G A;  3F8D A;  3GDN A;  1ZMD A;  1DOE A;  1ZK7 A;  2Q0L A;  5BVA A;  3KLJ A;  2E1M A;  1N4V A;  2BCP A;  4DSG A;  2WOV A;  4A6N B;  1PBB A;  2X3N A;  4Z24 A;  3S61 A;  1JEH A;  1CJC A;  1CF3 A;  2PHH A;  4Z43 A;  1JRY A;  3T31 A;  2C66 A;  4P9S A;  3IWA A;  3DK8 A;  1BKW A;  1CBO A;  3AD7 B;  1ZDL A;  3SY4 A;  3WE0 A;  3SGL A;  3P9U A;  1Q9I A;  1GAL A;  3BI2 A;  4H4P A;  3RED A;  2BYB A;  3CNP A;  2X8G A;  5KVI A;  1GRA A;  2YG7 A;  4O5U A;  4ECH A;  4JQ9 A;  2XYO A;  3SM8 A;  3FMW A;  3UKF A;  3SQP A;  1LJ1 A;  3NYF A;  2XFU A;  2BAB A;  3NHO X;  4AT2 A;  4O5Q A;  4EQS A;  4B69 A;  1S2Y A;  1MXT A;  3T2Z A;  4BJZ A;  3DME A;  3GRS A;  4NNJ A;  2XFQ A;  2X8H A;  3GRT A;  2B9W A;  4JDR A;  1OJT A;  2ZZ0 A;  1XPQ A;  3K30 A;  1NEK A;  1IUS A;  1PBC A;  1S3E A;  1O5W A;  2GR3 A;  1Z6L A;  2XVH A;  3GYJ A;  2RAB A;  5HYM A;  2BK4 A;  2BC0 A;  4JNA A;  5ER0 A;  2ACZ A;  3GYI A;  4EMW A;  1D4E A;  3UTF A;  4YWO A;  1F8R A;  2C67 A;  2C76 A;  3SX6 A;  3BI4 A;  3AEG A;  2C70 A;  5FS6 A;  2VVL G;  1NHS A;  1UKV G;  5HY5 A;  5IPY A;  5KNL A;  1K0I A;  1DJQ A;  4X9N A;  3GD4 A;  1YY5 A;  1DOB A;  1GTE A;  2C73 A;  1PJ6 A;  2WEU A;  5KMS A;  3M0O A;  1KNR A;  1E39 A;  2VQB A;  3NRN A;  2V60 A;  3UOY A;  2JB3 A;  3L8K A;  3CGC A;  4N9X A;  3K7M X;  4IVM B;  2NVK X;  2AQJ A;  4BUR A;  3F8P A;  3QSM A;  4UDP A;  3AD9 B;  4LA1 A;  2CVJ A;  4PAB A;  1GEU A;  2Q0K A;  2WES A;  4J57 A;  3CNJ A;  4OPG A;  1TDO A;  2GAG B;  3B3R A;  3LXD A;  4Z25 A;  4GDE A;  3NYC A;  3D8X A;  2YLW A;  1BWC A;  4U2T A;  1S7M A;  1E1L A;  2YLX A;  3H8L A;  3VQR A;  2C65 A;  5M10 A;  2JBV A;  5EB4 A;  5HHF A;  2WOW A;  1GV4 A;  2X99 A;  1COY A;  3DJJ A;  4K5S A;  4K5R A;  4UDQ A;  5KOW A;  1PXA A;  2XFP A;  4FDC B;  3AE2 A;  3Q6J A;  3P4Q A;  3NN0 X;  1RSG A;  2VVL A;  2WU5 A;  5KOX A;  1PXB A;  4GF7 A;  4CRT A;  2XFO A;  4C74 A;  2GQF A;  3VRD B;  3R9U A;  1XHC A;  3DJG X;  1PS9 A;  5GSN A;  2JB1 A;  4G74 A;  4YSZ A;  4II2 A;  4TM1 A;  2EQ8 A;  3QVP A;  1PBF A;  3ATR A;  3DJD A;  3AE9 A;  3HYW A;  3LJP A;  3M13 A;  2GQW A;  4FK1 A;  4YKF A;  2ARD A;  3AE8 A;  5BRT A;  2VRM A;  3NTA A;  4HA6 A;  1IUV A;  4WX1 A;  1K4Q A;  2EQ9 A;  4UDR A;  4I58 A;  2XLS A;  2XFN A;  1BZL A;  2BK3 A;  1TRB A;  3ICR A;  4H2P A;  1DOC A;  1GRT A;  5FS9 A;  1CHU A;  4H4U A;  4H4W A;  1BF3 A;  2YVJ A;  5JCN A;  3UOX A;  4TM3 A;  4OPD A;  4H2N A;  4RG3 A;  4U2S A;  3IHM A;  2E5V A;  4GAV A;  2OLO A;  4AP1 A;  4I59 A;  5LV9 A;  3JSK A;  1KFY A;  2QA2 A;  4AT0 A;  3V3N A;  5L46 A;  4GDP A;  3BI5 A;  3CGB A;  2TMD A;  2Y6R A;  3KPF A;  1EBD A;  1PJ7 A;  4USQ A;  4CNK A;  5KMQ A;  3DK4 A;  1N4W A;  4ADW A;  4GR1 A;  1K0L A;  2C4C A;  1L0V A;  4KX6 A;  4B65 A;  3I3L A;  2GR1 A;  4GCM A;  2CFY A;  1D4C A;  2BA9 A;  5JRB A;  1BGJ A;  1LPF A;  4DGK A;  4REK A;  4JNQ A;  4J56 A;  4LII A;  4APN A;  4K22 A;  4AP3 A;  3KD9 A;  1VRQ B;  3UTE A;  1NAA A;  2C75 A;  2XLT A;  1Y56 A;  3CPJ G;  3P1W A;  1TDF A;  1GSN A;  1JRX A;  1PDH A;  3DGH A;  2YWL A;  2W0H A;  4BJY A;  3D9X A;  1GOS A;  2GB0 A;  4YXD A;  3FIM B;  3AWI A;  5KMP A;  1FOH A;  1SEZ A;  3GWF A;  4NTD A;  2A87 A;  2Q6U A;  3C4N A;  2WDR A;  1CC2 A;  3V3O A;  2GR0 A;  2XCG A;  4K8D A;  4A9W A;  1NHR A;  3EPT A;  3RP7 A;  2XVE A;  1TDE A;  3DJE A;  2X8C A;  2WQY A;  5J60 A;  3SYI A;  3SZW A;  2R0G A;  3VRB A;  4K7Z A;  2C64 A;  3LZX A;  4TLZ A;  1H7W A;  3URH A;  1L9D A;  1TYT A;  1IUW A;  4A5L A;  1ZKQ A;  2IVD A;  1CL0 A;  2FJB A;  1Q1R A;  3T14 A;  4U8J A;  4U8N A;  5EB5 A;  4J36 A;  4B1B A;  3LZW A;  2BXR A;  2C3C A;  4JY2 A;  3ZDN A;  1QJD A;  3AYJ A;  2WET A;  5DBJ A;  4Z2U A;  3VR8 A;  1NG3 A;  3ALL A;  3AE7 A;  1H82 A;  4E0V A;  1JU2 A;  1L9C A;  2VRL A;  1YQ3 A;  2WDV A;  2YR5 A;  2VOU A;  3DA1 A;  3UP4 A;  4A6N A;  1FEC A;  4B63 A;  1LQT A;  4B66 A;  1KSU A;  2WBA A;  4Y4N A;  3P4R A;  5J7X A;  2CDU A;  1LQU A;  3PG6 A;  1DNC A;  1EL7 A;  1VG9 A;  4XXG A;  2QCU A;  3ADA B;  4FK1 C;  3CTY A;  3G5Q A;  4DSH A;  2TPR A;  3UTG A;  1NPX A;  3DH9 A;  1CJ2 A;  1NHP A;  3S5W A;  2YVF A;  1PXC A;  3QJ4 A;  4IA5 A;  2I0Z A;  3BNM A;  4GUV A;  2NPX A;  1OJA A;  3PO7 A;  3LB8 A;  3UKA A;  3AEB A;  5BUK A;  2X50 A;  1PHH A;  2IID A;  5C2T A;  4H4Z A;  1RYI A;  3F8R A;  1OJD A;  3CNS A;  3SFD A;  3NK0 X;  5CKU A;  3E1T A;  1KDG A;  4H4Q A;  3T2K A;  4H4S A;  4BK3 A;  1KN0 A;  5FS7 A;  1E6E A;  4J2W A;  1H2I A;  3DK9 A;  2YG3 A;  1GXF A;  3NNE A;  2BC1 A;  4XWR A;  5EOW A;  1GT8 A;  4CCR A;  2YAU A;  1N1P A;  2V3A A;  2BXS A;  5KMR A;  3H4K A;  3UKL A;  2GEW A;  1H7X A;  3HYX A;  3AYI A;  1O95 A;  2O9Z A;  2R4E A;  2WU2 A;  1JNR A;  3H8I A;  2WPC A;  1ONF A;  1GPE A;  2OAM A;  3KPK A;  2FJA A;  3P4S A;  2ZZC A;  4BV6 A;  2GVC A;  3G5R A;  3UKK A;  1GRG A;  4IVO B;  2EQ6 A;  1ZOV A;  1D7L A;  4U8O A;  2WP9 A;  1LTX R;  2RGH A;  3AE3 A;  3COX A;  1LV0 A;  1ZMC A;  3B6D A;  4Z2R A;  1H81 A;  1N4U A;  1PBD A;  2JB2 A;  3AYL A;  3L1R A;  4ZCD A;  4D03 A;  3T2Y A;  4TM4 A;  1DOD A;  1YQ4 A;  2WS3 A;  1QLB A;  2QAE A;  4BK1 A;  3NGC X;  1L9E A;  1NG4 A;  1QO8 A;  1AOG A;  4ICY A;  2GRT A;  1IUU A;  1D4D A;  1TDN A;  1IJH A;  2BK5 A;  3HYV A;  4XWZ A;  2YG5 A;  2YLR A;  4NTE A;  2BCG G;  5KRQ A;  4J31 A;  4A7A A;  1NDA A;  4B64 A;  3SZ0 A;  1JOA A;  3KA7 A;  4YKG A;  4YSX A;  3GMB A;  2APG A;  3LOV A;  3AE1 A;  1ZP0 A;  1ZOY A;  3NN6 X;  4X9M A;  4EIP A;  3VRA A;  3D1C A;  2JAE A;  2GR2 A;  1JNZ A;  3NLC A;  4NEV A;  2YR4 A;  1HYU A;  5C3J A;  2F5Z A;  1GND A;  1GTH A;  4A65 A;  1GRE A;  2RGJ A;  4CY8 A;  3ICT A;  2C7G A;  4UP3 A;  3CGD A;  3SXI A;  5CQF A;  2XLU A;  2R0C A;  4ZCC A;  1XDI A;  3QFA A;  4WCT A;  3UKP A;  4JY3 A;  1M6I A;  2FJD A;  3CIR A;  1GRF A;  1MO9 A;  1EL5 A;  1KF6 A;  1E1M A;  1PJ5 A;  4EQW A;  1GER A;  4B68 A;  3LAD A;  1GRH A;  2GH5 A;  2OA1 A;  2VZ2 A;  2GV8 A;  1EL8 A;  3AXB A;  3QFB A;  1MOK A;  1F8S A;  2B7R A;  2H88 A;  4H4R A;  2VQ7 A;  4OPU A;  4TLX A;  1BGN A;  4YT0 A;  2Q7V A;  5U25 A;  4A99 A;  3C96 A;  4CBQ A;  4H4T A;  2WHD A;  4YTN A;  3FBS A;  1YQZ A;  1VG0 A;  4CNJ A;  4NTC A;  2DKI A;  4C3Y A;  2AR8 A;  1CC4 A;  4CY6 A;  2GMH A;  3BHK A;  3AED A;  2GF3 A;  4Y4M A;  1F6M A;  1B4V A;  1B8S A;  4OPC A;  2FBW A;  4ZN0 A;  2WPE A;  2HQM A;  1CJ4 A;  3ABV A;  3I6D A;  3AB1 A;  4NEW A;  4H4X A;  3ZYX A;  2V5Z A;  1JRZ A;  1CJ3 A;  2B9Y A;  2V61 A;  3II4 A;  4AOX A;  3SFE A;  2YQU A;  2BS3 A;  1KSS A;  1W4X A;  3EF6 A;  3AD8 B;  1VDC A;  4OPL A;  2YM1 A;  1TDK A;  3C4A A;  4NZH A;  2BRA A;  5TR3 A;  2R45 A;  3CMM A;  3CPI G;  3EAO A;  3IF9 A;  3ALM A;  2GAH B;  5IQ1 A;  1LVL A;  3RNM A;  3ICS A;  3QVR A;  5IQ4 A;  3ALJ A;  3GDP A;  3KKJ A;  4D04 A;  2XLR A;  3L5O A;  3AE5 A;  5FS8 A;  1RP0 A;  1GRB A;  3IHG A;  3CGE A;  2BRY A;  2YG6 A;  1F3P A;  4EM4 A;  1GES A;  5KXJ A;  2XDO A;  4X4J A;  4NWZ A;  3OC4 A;  2R0P A;  3UOV A;  3CND A;  2YR6 A;  3K7T A;  1K0J A;  3QSE A;  3ISH A;  4C5O A;  1H6V A;  3BNU A;  3G5S A;  5JCI A;  4A79 A;  1TYP A;  1GET A;  2XVF A;  2ZZB A;  4CCQ A;  1NHQ A;  5KVH A;  4EQR A;  2C72 A;  3RP8 A;  3K7Q X;  3AEF A;  3VR9 A;  2OLN A;  3UKH A;  3ATQ A;  4M52 A;  1IUX A;  1KNP A;  1DJN A;  4U2L A;  1VQW A;  4YTP A;  3NYE A;  3P4P A;  4HB9 A;  5EBK A;  1FEB A;  5JCK A;  1D5T A;  4U8K A;  3UCL A;  3NK2 X;  3PVC A;  3UKQ A;  3KVE A;  1DXL A;  4H2Q A;  3FG2 P;  2H89 A;  2A8X A;  3QSS A;  4J34 A;  1B37 A;  4PAA A;  5U63 A;  3UTH A;  2J3N A;  2XLP A;  3AE6 A;  4MJW A;  1ZY8 A;  3OZ2 A;  3T37 A;  5JCM A;  1V59 A;  1S2Q A;  4U8M A;  4USR A;  1Q1W A;  2WP5 A;  1B5Q A;  1OJC A;  4YSY A;  2UZZ A;  2XVJ A;  1Y0P A;  4OPI A;  4H50 A;  1E1N A;  4K2X A;  5KWF A;  2Z5X A;  4DNA A;  4Z2T A;  4IA6 A;  1F8W A;  2JKC A;  4H4V A;  5HXI A;  4U8L A;  3NT6 A;  3O0H A;  2XVI A;  1OJ9 A;  3NH3 X;  3GYX A;  1M64 A;  4G9K A;  1IUT A;  2RGO A;  2R9Z A;  4G6G A;  4G73 A;  4J33 A;  4YTM A;  1YKJ A;  2WP6 A;  3AEE A;  3AEC A;  2WDQ A;  1P2E A;  3PS9 A;  4U8P A;  2EQ7 A;  4LU6 A;  4GAP A;  4IV9 A;  5JCL A;  3M12 A;  1Y56 B;  4RG4 A;  5M0Z A;  3HZL A;  2B7S A;  2BS4 A;  4YSH A;  1FCD A;  3GWD A;  3DGZ A;  4C3X A;  1H86 A;  2WOI A;  1REO A;  3RP6 A;  2V3B A;  1D7Y A;  1EL9 A;  4JN9 A;  2YVG A;  1S3B A;  3NG7 X;  4RSL A;  3SZF A;  4BK2 A;  1X31 B;  2R46 A;  2B76 A;  4G6H A;  3NTD A;  2V6O A;  2A89 A;  2R4J A;  1ELI A;  4GRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...