3N4FA

Crystal structure of mandelate racemase/muconate lactonizing protein from geobacillus sp. y412mc10
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
390
structure length
390
Chain Sequence
b'SLNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title CRYSTAL STRUCTURE OF Mandelate racemase/muconate lactonizing protein from Geobacillus sp. Y412MC10
rcsb
source organism Geobacillus sp.
molecule tags Isomerase
total genus 127
structure length 390
sequence length 390
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3n4fA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3n4fA01
4IHCA 3ENLA 2PODA 2PS2A 3N4FA 5FJRA 5J04A 4G7FA 4X2PA 3Q45A 2HZGA 3PWGA 2QGYA 2XH0A 3H8AA 4HN8A 3RO6A 5IDZA 3THUA 3RRAA 2NQLA 3R25A 3NXLA 3CYJA 2PA6A 3T4WA 3OPSA 1BQGA 5EU9A 2XH2A 1EC7A 2OLAA 3N6JA 1FHUA 3OZYA 3VFCA 3SSZA 3TQPA 4A6GA 2DW6A 2PCEA 2PP0A 3SN4A 3SQSA 3ZVHA 1MDLA 3V4BA 2AL1A 3IJIA 3FJ4A 5FJOA 1R0MA 4IP4A 3CAWA 2OFJA 3MSYA 3JVAA 3DESA 3RITA 2OKTA 3H12A 4HCLA 3UCDA 2CHRA 3QTPA 1MDRA 1SJDA 2POZA 3EKGA 2PGEA 4MKSA 2P3ZA 2PU1A 3TWBA 3P93A 4GYPA 3IJQA 3ZLFA 4K2SA 3P3BA 3H70A 2MNRA 2PMQA 4HNCA 3TJ4A 2RDXA 3BOXA 3TOYA 1TKKA 3DERA 4H83A 3FCPA 3CK5A 3OW1A 2AL2B 3IJLA 3FVDA 1R6WA 2I5QA 1EC9A 3UJFA 1JDFA 4M0XA 2OZ8A 1YEYA 4A3RA 3S5SA 2XGZA 3Q4DA 3ZLHA 4FI4A 2ONEA 3R11A 1KKOA 4MMWA 3DGBA 2QJMA 3UXKA 7ENLA 4HCHA 2HNEA 4E8GA 2PSNA 3B97A 3N6HA 2PTZA 3SN1A 5BOEA 2GSHA 4M6UA 4DHGA 1ELSA 1IYXA 3R10A 3FV9A 3QLDA 3D46A 3R0KA 4H1ZA 4KEMA 3UGVA 3ZVHB 1P48A 3MWCA 3DFYA 3ZVIA 1ONEA 3I6EA 3NZGA 1E9IA 3GY1A 2HXTA 3PFRA 4A35A 3V3WA 3VC5A 4GYPC 4GMEA 3OZMA 3TJIA 3BJSA 2OO6A 1PDZA 4GGHA 3KUMA 3VCNA 3N4EA 4ROPA 2ZC8A 1JPDX 1JCTA 1EC8A 1TE6A 4IP5A 3TWAA 2OG9A 3VA8A 4GIRA 3DDMA 2GGEA 4JHMA 3U4FA 3CXOA 4IL2A 1MRAA 4KPLA 1PDYA 3T9PA 3SJNA 1SJBA 4DX3A 3VC6A 4HNLA 2OZTA 1F9CA 2P8CA 3ES7A 3DIPA 4G8TA 4HPNA 2QVHA 3OTRA 3JZUA 4KWSA 4E5TA 4ENLA 3MUCA 2OVLA 3VCCA 1SJCA 2OX4A 1RVKA 3ZLGA 1W6TA 2OZ3A 3SN0A 4GFIA 2GGJA 2OQYA 1P43A 4EWJA 3IK4A 2QDDA 3DG6A 4E4FA 3GD6A 2FKPA 3MZNA 1JPMA 3JW7A 3T8QA 2QJJA 4DWDA 3RR1A 4E4UA 3D47A 3DFHA 3DG3A 4ZCWA 1MUCA 2P8BA 2QDEA 2QQ6A 4Z17A 1FHVA 2HXUA 4MGGA 2ZADA 3GO2A 3K1GA 4J3ZA 3MY9A 2XH7A 1NU5A 3UJEA 6ENLA 2PPGA 1ECQA 4GISA 2AKMA 5FJPA 3PK7A 3QN3A 2GGGA 4HYRA 3V5CA 1NELA 4DXKA 5FJTA 4KT2A 1BKHA 1EBGA 3MKCA 2PP1A 4H19A 4YWSA 3VDGA 3HPFA 3U9IA 2GGIA 2PP3A 1KKRA 3UJRA 1WUEA 4K1WA 2AL2A 2PU0A 1XS2A 4E6MA 1OEPA 2PTWA 4ZA0A 1L8PA 3BSMA 3QKEA 3FYYA 2XH4A 3T6CA 2O56A 3CB3A 3NO1A 2OQHA 1XPYA 3I6TA 2GDQA 3OP2A 4FP1A 2PTXA 3QPEA 3UCCA 3H7VA 4K8GA 2GGHA 3DEQA 1WUFA 3TTEA 4IZGA 3ES8A 3PWIA 3NFUA 3RGTA 1DTNA 2GL5A 2P0IA 3UJ2A 3P0WA 3TW9A 5FJUA 2XSXA 3R1ZA 4J1OA 3MQTA 3FXGA 3UXLA 2OPJA 4JN8A 4DN1A 1EBHA 4IL0A 4JN7A 2AKZA 5BOFA 3UJSA 3V5FA 4IT1A 3GC2A 1KD0A 3S47A 4F4RA 2QJNA 1TZZA 3SBFA 4HCDA 2MUCA 3RCYA 3I4KA 3CT2A 3TCSA 5ENLA 2DW7A 3EEZA 3R0UA 1KCZA 1MNSA 2FYMA 2P88A 2PTYA 4GGBA 4DYEA 4H2HA 3STPA 2PGWA 1SJAA 4Z1YA 3DG7A
chains in the Genus database with same CATH superfamily
3WNPA 4LBUA 4DBSA 2C13A 2DZVA 3M43A 2O92A 4JQ4A 3OLEA 4O16A 4G7FA 4R34A 1KRCC 1GOKA 4A3QA 1UPMB 1A0CA 1FCVA 3MMWA 4NZFA 4NIRA 3RRAA 2WJZA 1SW7A 4B3KA 3UWUA 4BWLC 3OPSA 1TELA 1XIFA 1KFLA 2V9DA 3OIHA 4C7GA 2YJQA 1XH2A 5C9XA 3CHEA 3C2EA 2GQWA 3UWZA 2CLKA 4I5UA 1NFPA 2VUNA 3SSZA 4DLFA 4HHPA 1L6SA 3ABQA 3W7DA 4Z2JA 3MYOA 3SQSA 4NX0A 1CI1A 2Q8LA 4RDWA 4REQA 3VO0A 2DV0A 3SJ3A 2QT3A 3EWYA 3PTMA 3N9RA 4PUNA 2OFJA 4H9UA 1K8XA 2OKTA 2I7GA 1J0JA 1X1OA 1WXZA 4RNFA 4Q4MA 3VM7A 1IEWA 3BAYA 3VIMA 1NIUA 1YADA 4LUSA 1J79A 4RKAA 1V97A 1R7AA 2ZUUA 4DBWA 2X1RA 3AMCA 4MWAA 2CLHA 3TOYA 2AGTA 5DRIA 3FCPA 2Y62A 4BF7A 5KMYA 3FLUA 3HV8A 4F0RA 3B04A 4HYVA 1H1NA 3ARXA 3I3EA 4Z08A 1EC9A 4M24A 5FEXA 2OZ8A 3QSTA 5LSMA 3FDGA 4N9DA 4IIFA 4C65A 3ARRA 3VNLA 1ZPTA 3QW4B 5LIYX 1E6NA 3EMZA 2PWUA 3HPXA 1JFHA 3VIIA 2NXHA 1OFEA 3C86A 4TX9A 4S3AA 2QJIA 2PTZA 1TX0A 3QEZA 1IYXA 4XQ6A 3AIWA 1EGVA 2ZZ1A 1LJYA 2D2OA 3TVAA 3LU2A 1FDJA 4IUGA 5AB3A 1F2JA 2ZUNA 5T9CE 3IAQA 3VAVA 3VZZA 3B8SA 3W2MA 4RZ5A 2QS8A 2FVKA 3GZAA 4HMCA 4QP0A 1T5AA 3TZFA 5CPTA 1UROA 1PIIA 4DQWA 2EXOA 3NG3A 4AIEA 4AF0A 4RL3A 3E74A 3NRZB 4DF0A 2X1TA 2J62A 3WBYA 4GGHA 4X3ZA 3MUAA 1L8NA 1VCFA 4ZBCA 2QDGA 1CGYA 3WMCA 2W3RA 4ATWA 2X2YA 4DBDA 3W7QA 2QR6A 3TROA 2ACRA 1XIHA 4H6EA 3GTIA 3P61A 3TJLA 1A49A 1OWQA 2Z1WA 3DENA 1PL9A 3G1XA 2Z7KA 1LYXA 2PF0A 3C52A 1EYEA 1CGXA 2G4FA 3M07A 2E1WA 2DDXA 2IXVA 3LEPA 4O1DA 1DNCA 1Q2SA 3VNKA 3VINA 4J3UA 1FECA 1UCWA 1IR2A 1OFPA 4Y8EA 2ZXQA 3GR8A 2QXWA 1H4PA 4W9TA 3L9CA 4CNPA 3T2PA 1JD7A 4ZENA 3A3HA 3CO4A 3K8LA 4HPHA 3KRSA 4BQ2A 5ECVA 1J0HA 2QV5A 1RUSA 4GVFA 1E70M 3VIFA 3AUJA 2QJJA 3R79A 2WPFA 4YN5A 3BDKA 4HPJA 4JTQA 1AUSL 4Z17A 4B5TA 1XIMA 4GRTA 2QZRA 4FF5A 2EQ6A 2R1PA 3MYPA 4YLWA 1V59A 1QPKA 1XRVA 1FKWA 3G1DA 3I68A 1PHQA 1X2HA 3DJJA 4IMGA 1YPXA 1ZALA 3POHA 1HKVA 3WLSA 3FEMA 5K9XA 4KT2A 1EBGA 1V7YA 3T0BA 1G7VA 3P82A 2D2GA 1E56A 2AL2A 1X7IA 5BWFA 1W31A 5IHRA 4Y9MA 1GVYA 4XAGA 2PZNA 3KWXA 1NP0A 1E51A 4TR9A 2XM2A 3N2XA 3VZXA 5HQLA 1DYSA 3SW6A 4AEFA 3CB3A 3CGEA 2H9AB 3UA3A 1FDZA 2GDQA 4O1CA 1XV8A 3AUOA 4ADUA 5FACA 4GO8A 5H91A 3UXAA 3RLUA 1TR1A 1W2PA 3WF0A 3WLJA 4JYEA 1TJ0A 2QYGA 1WUFA 5A8PA 3EMQA 1FFUC 1DWJM 3WLNA 3PWIA 3OZOA 1L6YA 1HJWA 2NSXA 3M0XA 1ADDA 5CPOA 3STGA 4E0CA 2P0IA 1XYMA 2IXUA 3O06A 3Q2DA 1Q6RA 4WIWA 2X16A 4GIYA 4GUGA 4DWSD 1AL8A 1VPXA 3NVYB 3UPMA 1B9BA 5C70A 1P7TB 1V5XA 3TN4A 3BAIA 3UXIA 1YX1A 3M0LA 3NZ1A 1Z6KA 1Q3NA 3TR2A 2YA1A 5AC8A 4HBKA 1OF6A 4XZWA 3J7HA 3P60A 3R58A 3NEVA 4IL0A 2ZXDA 3GVQA 4OTKA 1NQ6A 3WDQA 3SRDA 1QO5A 3QQWA 4GI6A 2DFAA 3NSMA 1AW1A 4QDWA 5IBXA 3MCMA 3RX3A 4JQAA 3NGJA 1E15A 3DYOA 4TO8A 5ABHA 1A5SA 4R33A 3I7SA 1CXIA 1NJJA 1R3RA 2VQUA 2OB3A 4R9XA 1WP6A 1UZ1A 1KCZA 1T7LA 1XSJA 3URQA 1BWCA 3EZ4A 4MHBA 3SGGA 4R88A 3STPA 2PGWA 1R9XA 3DG7A 4TV5A 2WCSA 4KWOA 1EOMA 4PR4A 1XG3A 2PODA 2QJGA 1DWGM 3W1UA 5J04A 3T0DA 3PWGA 2F84A 3CMGA 3HQPA 4AX7A 1AK5A 3CWOX 2CEQA 3EUB3 4EKJA 4NX5A 2XIIA 3QH2A 4O0ZA 5F1UA 3CPUA 4K38A 2GLKA 1GTHA 3WZ0E 4GC3A 2D2JA 3M44A 1JZ6A 1JGIA 4PCFA 2AQOA 1K70A 2O4MA 1FY6A 3TH6A 3T8LA 2P53A 3KTCA 1MWOA 1JNEA 3KDNA 3BG3A 1LF1A 1P6BA 2TSYA 1V0LA 4WOZA 1D7YA 3JVAA 3H2FA 3PZ9A 4Q22A 2VEMA 3F4NA 5EL1A 3AMLA 3QTPA 3CJPA 1F6YA 1SJDA 4LX4A 1OBAA 1BVWA 4MUPA 2XIBA 2WVUA 1JF5A 4IXXA 5G5HB 4RE3A 1LLZA 3BLPX 2NUWA 1S1RA 4XO6A 2OCZA 1BFNA 2QAEA 1TCMA 1U5VA 4H83A 3USBA 4O17A 4Q7IA 4LB3A 2F6UA 3BGGA 5AHLA 1ONRA 8RUCA 4CQBA 4O1EA 2YOCA 1R6WA 3E5PA 4GACA 2I57A 3QC0A 4GZ7A 3UJFA 5M17A 3VILA 1VIWA 4DBUA 2NQHA 3CV1A 1DP0A 4XX6A 2D73A 2YZRA 2BOFX 4NQ1A 3K4AA 3C3UA 4Q4SA 3UG8A 1PKNA 1JZ4A 4AD5A 1NOUA 3D9XA 1OCBA 3WNMA 2A8XA 2FZ9A 4W87A 3VOFA 3UR7A 4XZIA 1K02A 1HKMA 1TZ9A 1R87A 4GCXA 2WPEA 1IIGA 3UWWA 3CEUA 4P8VA 5AZ1A 3RILA 3DGZA 2V5DA 4PMDA 5H6HA 3OQ8A 3MWCA 2BHUA 4ZQRA 8TIMA 1HIZA 1H49A 5CAKA 4L1WA 2L5HA 3ZM8A 3D3AA 2YCLB 1PTDA 3EOEA 3N15A 1XW8A 2CKSA 3GTHA 4AISA 3FN9A 2GOKA 2WCAA 4NZ3A 3A7RA 4I6VA 2P5NA 2GJLA 4GVHA 1KTBA 2YA2A 2GOUA 4MF4A 3H7RA 3LPGA 4S1FA 1YXDA 4WD0A 3FYPA 3HPZA 1EC8A 4DI8A 1E0XA 3EOOA 5ER0A 1DJNA 2G3MA 1VYSX 3F7JA 4NNAA 3E0IA 3DDMA 2WCGA 4GBDA 3ISIX 4XD6A 3WSUA 2VX5A 3G3MA 1MRAA 4LAUA 4GJJA 4Z1BA 1YQ2A 1FWJC 2NXGA 4LS0A 1W1A1 4JIQA 5EFFA 1XRFA 1H7PA 2EQ7A 1VKFA 2P8CA 3VIOA 4D8ZA 3W73A 5CAHA 1FKXA 3P84A 4BZYA 3ATYA 4ENLA 3E96A 3GW3A 1VHNA 1GRHA 3CTTA 3S1VA 2PDBA 3WQWA 4K7VA 4MDOA 1LOLA 1GPFA 2O9PA 1M65A 2VFFA 4AY1A 5HPOA 3STFA 1K7FA 4HA4A 4LVGA 1DTUA 4HK5A 2W5FA 2R14A 4X0NA 2TYSA 3Q67A 1VBJA 1UR2A 3T8QA 1Q1WA 3VPLA 2VRKA 2X09A 1SZFA 3D47A 5D2WA 3LNPA 4GK8A 2ZXAA 2PWHA 5BZAA 4CNUA 1DOSA 4FR6A 1ZKQA 3GDBA 3PTKA 1CGUA 1QHOA 4K8DA 4X63A 2NW0A 1LQ2A 2UY5A 3RM9A 2AMXA 1FXQA 2C3ZA 1RBLA 1SQ7A 2YL5A 3V5CA 1WDQA 3EX3A 4GNJA 5FJJA 1XLFA 3THDA 2P10A 1DBTA 1XQKA 4EMJA 4EIVA 3K4DA 2V3FA 3KCLA 2PWFA 1RBOB 3UJRA 4GJ1A 3CBWA 4PCTA 2PU0A 4MDPA 4IG2A 1L6WA 2QCMA 4P7QA 2VT0A 1GGOA 4EPBC 3BSMA 5BRQA 4UOZA 2BVWA 1EWDA 5CLTA 4DO4A 3E2VA 3NPWA 1ZXIC 3KBNA 1PBGA 3L5MA 2DIJA 1R2TA 1XF0A 2PTXA 2FPVA 3MSRA 4MPKA 4E2VA 3EWWA 4O19A 4LEQA 4D6HA 1E1CB 4ZE4A 4JTTA 1A47A 1RA5A 3RJYA 1PTGA 5JBFA 3PVFA 3RU8X 2YKKA 3W1XA 4XTIA 5CKSA 4RX0A 3FVMA 4MSSA 4ZXLA 4TUFA 4B5SA 3NFUA 4U3CA 5D8WA 1TQXA 2J4GA 1CTNA 4U4MA 4UQ9A 5CG7A 4MY8A 4HTBA 4JDRA 3AC0A 4IISA 4LYQA 4ZEPA 3H26A 4S2CA 4FDCB 4ZO7A 3DXIA 3BSGA 1HT6A 5F1VA 1ITXA 4LXFA 2DIEA 3ATZA 2V68A 2VFDA 3GHRA 1QATA 4INFA 1WYGA 4HZMA 1U83A 3EB4A 2WZIA 3V16A 2CBVA 4KGJA 5BU9A 3V5FA 5U1OA 2G37A 4XUGA 3SZ8A 1TWZA 1NQKA 3BXWA 1YPIA 1E6PA 4GH3A 2YXXA 2MUCA 1KV5A 2C1HA 3W84A 2X30A 3TSBA 1F61A 4F9DA 4C6FA 2HBXA 1RH9A 3ZJ6A 4QISA 2J9ZA 3WQOA 2FTWA 3UZWA 2J7CA 3VIKA 4H4PA 4WSJA 1K9EA 4OQVA 1T99A 4ACZA 1ZMDA 3V1PA 2YFOA 1GRFA 4TX8A 1WXJA 2O0TA 2XH0A 4FXRA 3LZ3A 1DXEA 5HXMA 2G8ZA 1TPWA 3H7UA 2W4XA 1OD8A 2QCGA 4ORMA 5CJNA 4JFTA 2HS6A 3ALGA 3RNDA 7ODCA 3TTYA 2ZE0A 4QAWA 3TQPA 5EKYA 1JEZA 3B0YA 3TYCA 3WEZA 4RV8A 2PP0A 1QW9A 1BG4A 5A6LA 3W1MA 5FF3A 1KTNA 4ATDA 2P1FA 3B8DA 2WMFA 1OG0A 4J3XA 1O5XA 3QZAA 3NZPA 4HNNA 1E0TA 1XSKA 3VI2A 1UUOA 4V2XA 2PDGA 4XVDA 3FOKA 5XINA 2EQDA 1AH3A 4K2SA 4LJ3A 3SR6B 2C1GA 4IQJA 3AISA 2H9AA 2G50A 2WNNA 3CK5A 3OW1A 3E2QA 2DZTA 1GCYA 1EX1A 1VRXA 3LTYA 3M6DA 4DELA 3G8EA 5BROA 2QKFA 1XX1A 4PUWA 1FEBA 1RP8A 1FWDC 4IF2A 4Y6GA 5ABEA 1FP9A 2WQDA 4J5NA 5LIUX 3CNYA 4KCTA 4L61A 2E68A 1W9UA 3UVAA 2E6DA 2C15A 3PPCA 4B5WA 1FIQB 1KFJA 3FV9A 4JIRA 3U6WA 3D46A 4L4MA 4FOJA 2OMAA 3KOXA 3NQVA 1YE6A 1OHLA 4GXPA 3R4IA 4XKYA 3VNYA 2NVKX 2FVLA 1H2IA 5D05A 1Q6OA 4MKNA 4D6FA 2PD5A 2VZVA 3WG6A 3FK4A 1TUXA 3N6QA 3AXHA 3G18A 5D9NA 4UQDA 2HXTA 2HE5A 4JBRA 2PDLA 3VNIA 1YPFA 1AZ1A 5D9PA 3MSGA 1GRGA 4YHEA 3KCJA 2Q3RA 3OYXA 1YQZA 3W7NA 3QR3A 4J3WA 1J9YA 1LQAA 3N4EA 1OADA 4IFRA 2X8HA 1LBLA 4W88A 1K7XA 3M41A 2Y63A 4IP5A 3W25A 4MJMA 3C56A 4UQAA 1U5JA 3LV6A 4F8XA 3UG5A 3U4FA 1ONWA 3OYZA 3QVQA 1RAKA 1XYLA 2HPIA 4OOZA 3U3HA 1WE5A 3AU2A 3HM7A 4G8TA 2ASHA 3S1WA 1TPFA 4BI7A 1V3LA 1AQFA 3NDZA 1MEWA 1BG9A 3CT7A 1A5BA 4FPSA 3RCMA 2GVYA 4EQRA 3L2LA 1X7FA 4O18A 2OZ3A 4W86A 1V79A 4K3ZA 1JXKA 1XC6A 3HGJA 4K6AA 1OJXA 1XIJA 3IK4A 3SR7A 1H62A 5AZ0A 1IT7A 1XFCA 4NY2A 3UERA 4P61A 1NWRA 3GG8A 2JEQA 1U1UA 3RR1A 5KVIA 4C6EA 1EPXA 3O07A 3RM8A 2P3EA 1GNXA 2P8BA 1W5PA 1FWRA 1GXFA 1MOKA 3OHIA 3UU0A 3LHYA 1QI4A 1A5CA 1UWQA 2WBGA 4WF7A 1YNPA 3W2UA 2NQJA 1NU5A 3PC0A 1SYTA 1DJHA 4OE7A 3HG5A 4HYRA 3L12A 2HK0A 1NELA 1ZP4A 3NPVA 1DJXA 2QCDA 3W1NA 4M82A 3KVMA 3U9IA 2J7HA 1FWNA 3FKKA 2BGNE 1V6WA 2ALDA 4QBXA 3LD5A 4GNKB 1L8PA 4GX8A 1QNQA 5HQMA 3CIXA 4HZ8A 3TYBA 2XH4A 4L5ZA 4NJIA 3W01A 2ZRWA 2V3GA 3PM6A 1W5QA 2CHOA 2F61A 3G0XA 3CZGA 3DAQA 2WO5A 1PCWA 1W3LA 3NVWB 5IXEA 5CJMA 3F5JA 3LPOA 7REQB 1HP4A 1H11A 4TTUA 3U5UA 4G1KA 3NQCA 3ARSA 3ZYZA 3NDOA 5LA1A 1R9ZA 2QAPA 4W5UA 3TTEA 1XD1A 4KW2A 3NDYA 1MFUA 1HGWA 1XLLA 4AAJA 4FNSA 2GZXA 2ZUVA 3AAMA 4H8VA 2GL5A 4HP5A 1QI2A 1L0PA 1OK4A 4RE2A 3UFYA 1UZHA 3CGCA 3W29A 4YNGA 5ABGA 2D22A 2PLJA 3JRKA 3VDCA 3NIYA 1H7NA 1UHVA 1UD6A 1CEOA 3MQTA 3TJXA 4AD2A 4QIUA 4HZ7A 1QMLA 1RD5A 4NT0A 3GVVA 3WLRA 4DJEC 4N4PA 2R94A 3LBMA 3NQFA 3CV2A 4DN1A 4NYUA 3S8HA 3PNUA 3WF3A 1US3A 2ZZ7A 1PAMA 3FY1A 2J8GA 2YCIX 4MADA 1UZ4A 3NAVA 1CGTA 2DEPA 1P1MA 1W3KA 2EPKX 4PULA 3APGA 3QZ6A 3GR4A 4ML4A 2WC4A 4UFJA 5GNZA 3EKLA 1QHZA 2NV9A 3OO2A 4YTQA 3W70A 3TKFA 2XFYA 1AW5A 3RHGA 1KBIA 1GKQA 2CLLA 1DVJA 5BXSA 1U1HA 3CO8A 3CWNA 4WXYA 1KRAC 1TV3A 3Q37A 4IQEA 4ZFCA 1ISZA 4ASTA 1XINA 2NV1A 2QUMA 3A47A 2WOVA 1FWHC 3NYDA 1I0DA 4GQGA 4IJCA 1CYGA 1XCFA 5CBBA 1GKRA 1EIXA 2RDUA 4Q4PA 4C5ZA 3P81A 1QNOA 1B30A 3H8AA 5HNNA 1W3JA 4KS0A 1YDYA 2ZA2A 1J8VA 1NDZA 2QNEA 3VYLA 1BF2A 1S2WA 1SR0A 3CUHA 1FWTA 5G1YA 2X2GA 2VX4A 2FFIA 4PCNA 4M80A 3P8JA 3SB0A 2R6OA 4LW7A 3HFYA 2OEMA 4B4HA 1OFQA 4LY8A 3IARA 3VOIA 4CVWA 3CH9A 4DB7A 5IBXC 4LBRA 2E5CA 3M5YA 5KZ6A 3PPGA 3UNDA 4AD1A 3C2VA 3EDDA 2Y4SA 4D9PA 2HS8A 4F2BA 4JKKA 3W7CA 5HOSA 3HJEA 1UUMA 1FWAC 3MHGA 4ES4A 4IWWA 1XANA 1TA3A 3WL0A 3MP4A 3L4VA 3N19B 2FQIA 3B0XA 1VIZA 1TKKA 3ARTA 1D2KA 2V63A 3B06A 3WH9A 5DANA 1TV4A 2YW3A 1VDVA 4MB4A 1B5TA 5D04C 4PRTA 2EPNA 3WD3A 1G69A 3EAUA 3ZMRA 1BLIA 2CW6A 4WVXA 1EL3A 3FYOA 3WLOA 2X8RA 3KCOA 4G1NA 3DGBA 1VC4A 3V7PA 1QNPA 5F2GA 2EPMX 2HNEA 4F3HA 3B97A 3BG5A 5LZLA 1BWLA 3SCWA 5DN1A 2WNZA 1GRAA 1NWTA 1RLDA 1RQBA 3HG4A 3WFAA 1MUMA 2W92A 1GOXA 1DWAM 3CPRA 5HMEA 4S2BA 3PBYA 3K8MA 1TFVA 3RPTA 4J40A 3CUGA 2V2HA 4H7CA 4Q8VA 4GY1A 3ZVIA 4AH7A 1R3YA 4ZE5A 1KM3A 5A6BA 3LY0A 5XIAA 4UOJA 3AIUA 3OBAA 3DH9A 2D3NA 3GZ3A 4QG6A 2WP5A 3LCHA 1TTIA 2Y24A 1SVDA 4WDWA 4IMCA 2E25A 1H63A 4PBFA 4NAFB 1SMDA 2INEA 4AIOA 4AG0A 4RPQA 1OIFA 1SFJA 3HFTA 4LVAA 2DP3A 3FGCA 1H09A 4AC1X 1GW1A 4X60A 3NNTA 2OT0A 2E6FA 3WQ6A 2ISDA 4HU0A 3HJZA 1JZ7A 3AYVA 2BX7A 3PUOA 3KS6A 4UCFA 1BVZA 1RCOB 3LCFA 2GK1A 1LWIA 4UQBA 3ERPA 3R8RA 5I78A 2CPUA 3NGFA 3CZLA 2VC7A 1W91A 4WHBA 3UYCA 3ES7A 3QLLA 4MKVA 1V02A 4NKCA 4QHRA 1E6QM 3T0CA 1GOWA 1GONA 4KCWA 4JX6A 3C6CA 1YNYA 4Q6JA 1C9WA 4XD5A 3NVZB 3NVDA 1MXGA 5FCZA 4LC8A 3LGGA 1TJPA 4V1XA 4BY3A 4OV9A 3AIRA 2VJXA 1EGZA 4ZVJA 1F4AA 4HD5A 2DSVA 4EPEC 1GRBA 2QDDA 2E8ZA 1VYRA 1OZMA 1E43A 4LUIA 3WO8A 4WSKA 2WSKA 3JW7A 2IUZA 4DWDA 3NPUA 2WWDA 3GUGA 1Q6EA 1HN1A 1MUCA 5CPNA 3KZPA 5DLCA 3AZTA 2RFGA 1GOQA 1GHSA 3TW6A 3SY5A 2X41A 1OGSA 4IX0A 2R1LA 4Y9AA 3LPPA 2Z26A 3VKCA 5LNSA 3NQDA 3KRZA 1EEPA 1HL8A 1MEIA 5HNUA 4AIUA 1B57A 1CB2A 4QLLA 3CUXA 5GVJA 2DT3A 3PAOA 5EMYA 4DM2A 3L4ZA 3VDGA 2CZVA 1KKRA 5GJNA 3GX9A 4AEOA 1N82A 1O94A 3PSWA 3FJNA 3ME3A 3MI2A 3VIHA 2HV5A 3P5ZA 4RXFA 2IQDA 1EJWC 2BC1A 3WELA 2OQHA 1MXDA 1UB3A 2F8QA 4F48A 3I10A 3W1QA 3KP1A 3CZJA 1ESWA 4H3DA 2O9RA 3H7VA 3D3FA 1J0ZA 7PTDA 4M3PA 1BEUA 2Z24A 3E0VA 3CUZA 1QBAA 3SDOA 3B05A 1CB7B 3EANA 5AC4A 3IV8A 2D23A 1A5UA 1XM3A 4GYJA 1I60A 1T0OA 3COTA 3S1GA 2OLHA 4JZ5A 3NWRA 5CSSA 2YVFA 1V6XA 4UNKA 2IS7A 3B8TA 1KN0A 2WSRA 4A2RA 3QBUA 4PGLA 4PMUA 1D7FA 2CZEA 4FK9A 1Q5MA 1BWVA 1TX2A 3GAKA 4Z2GA 3MI6A 4H41A 2RKXA 3F4WA 2E9MA 5JCIA 1OINA 4QX4A 2DJLA 1KD0A 2J7EA 1W0MA 4C60A 3C4UA 3O6YX 4ROQA 4QE4A 4O54A 4C6PA 1I0BA 4HOZA 1HZYA 3T78A 3UW6A 1H3GA 1RV8A 4DF2A 4Q8OA 2F2KA 3RMJA 3EA1A 2BHYA 4XAZA 3LBOA 2X1SA 3EMCA 3LHWA 4WY0B 3R6IA 3UR8A 1C8QA 2QVNA 1ISYA 5C9WA 2XIQA 2W55A 1OCQA 1R8LA 3ENLA 4MYXA 3LBCA 1K7EA 4DLMA 4NZ1A 5E09A 1I45A 1BRLB 2XIJA 2I5GA 3IVUA 2HZGA 2ISWA 4OFCA 1OFRA 5EY5A 1LL6A 1IZKA 1NDWA 3IPWA 4G5DA 1A0EA 1I2OA 2WMKA 3RR4A 2BODX 2VC9A 1O5QA 3W87A 1GREA 2ZIDA 4C1LA 4Q8TA 3DK4A 1XLAA 4WLCA 3NOYA 4QJ1A 4Q8UA 3NTYA 1VPQA 3SM0A 1S2UA 5CBIA 1H0IA 2RABA 3DJGX 3ARVA 5I3HA 1TVLA 1FWGC 2ACUA 3RX4A 1XL9A 2FJKA 1ZSXA 3ITCA 2FDMA 4ZODA 2XFRA 3M16A 3O9NA 3QR1A 3KBSA 1SO5A 3P2VA 4Z0SA 2PU1A 3CHFA 4LSBA 4C90A 4ZQCA 3OBEA 4C6JA 4G7EB 3BQ6A 4JHZA 3K4WA 3PBMA 1L9WA 7CGTA 3L65A 5E93A 2YVJA 1VFHA 5F4WA 1GW9A 1PJ9A 1PZ3A 1QPRA 4DYKA 3TMLA 7REQA 3BSHA 4M0XA 2A7NA 3UPBA 2Y70A 2VGGA 1R30A 4R7OA 4UTHA 2E5DA 2BMBA 1JFXA 1W5NA 3LADA 4QDMA 2Q8XA 3QPZA 3R10A 4UTWC 4JTRA 4PB3A 3UR2A 3BLOA 2AAQA 2I9EA 1GUVA 4UZSA 1RXOB 1XLEA 4RV3A 4EM4A 1GQIA 4NF7A 1FWEC 4L56A 4UTIA 4IPPA 1TVPA 2WOWA 1PKYA 1K1DA 1SPQA 4A35A 3KZSA 4J56A 1K8CA 1JAKA 1F7BA 4E4PA 3WD1A 4MIMA 1SB3B 1Z41A 1DKWA 1FOBA 3QR0A 4M7SA 4K68A 2UBPC 5EFDA 5H1WA 4Y2WA 4HPXA 5C9ZA 4PUDA 1PHWA 3PJWA 3BJSA 3WQEA 1NHPA 1R5YA 1EHNA 3VCNA 1ADSA 2YYTA 3DUGA 8A3HA 3MJYA 4F0KA 1W1VA 1MSSA 4LVDA 1X98A 1E6RA 4EOUA 3AHXA 2OWWA 2ZUWA 2ZICA 2DH3A 1R9YA 1TYTA 2CHNA 2PDMA 1J6OA 1JDAA 2HMCA 3WJSA 4OUEA 1XLCA 4KIRA 2E4TA 3T9PA 4JOMA 2WC7A 4Q7BA 4CGTA 3MBFA 1VB9A 5DCBA 5I3IA 4BEQA 1FP8A 3EYPA 4HA0A 3NQBA 4QNWA 2BBFA 1EXPA 2QUUA 2ATSA 1C8YA 5HA7A 3G24A 3OLDA 1EKOA 1KCXA 3THQA 5J5DA 1MZHA 4F0SA 4KEUA 4R9OA 4J3VA 1THFD 4LRSA 3ALFA 2OX4A 3SN0A 1ME7A 3W86A 1AJ2A 5MKGA 2QIIA 4HU4A 3EX4A 2RAGA 4TVWA 3BAKA 1W1IE 3C2YA 2TPRA 3QTGA 1KM5A 3G1FA 4FX9A 2R8WA 3MZNA 3S2NA 2OX1A 4MZ1A 3MB9A 4US5A 5LNWA 4EF9A 3ZJ7A 4E4UA 4P8WA 1J0KA 2GFTA 1XI3A 4A8RA 4U2YA 3S6DA 2QPUA 4M19A 3N3MA 2VWSA 1EUNA 3OLGA 1ZS2A 3S1UA 2XH7A 4ZOHB 1NDVA 6ENLA 4C7DA 5FJPA 3TYUA 3ABZA 1RM6B 3CL7A 3KVJA 1TWIA 4HHLA 2GGGA 3W7GA 3PJTA 3ITOA 1F6KA 1GQJA 2VVSA 5D30A 4DXKA 1BKHA 3V18A 1K9DA 4DAFA 3R7MA 2H3BA 5AHFA 3VGDA 4V28A 4H7ZA 1JROA 4L9YA 1XS2A 1E9LA 1EJVC 4F0LA 2V38A 1T96A 5HK4A 4ATLA 1H7WA 4PTNA 3IGUA 2NLIA 3F4CA 1A3XA 2VCCA 2HTMA 2Y7EA 3P8IA 1NOFA 2Y7GA 3L21A 1W9VA 2Z27A 3VTRA 4ECLA 3SFKA 2WMIB 2VVNA 1SO4A 1HVXA 3E49A 5TAOA 5AN7A 3DEQA 4OGZA 4RNJA 1Z32X 1XGEA 4M52A 3EOLA 2WVTA 1DXLA 1WB0A 2DZXA 4UMBA 1AA1B 4IQLA 4BI6A 3BURA 4IP7A 5H8UA 3V75A 1X97A 4MB3A 4EF8A 2C7FA 3W6YA 3PR2A 1QK2A 3NCOA 1NHQA 1VD6A 4E2OA 3T05A 4DWSC 3R1ZA 4FX6M 4J1OA 1W1ZA 4NAFA 1QNRA 4PE8A 4G56A 5G2WA 2XSAA 1JRBA 5IOBA 2YXOA 3G8RA 2NX9A 1ONFA 3DFTA 5LHFA 2Y1HA 1VBRA 4ZOCA 1VYPX 1XC4A 4Q4OA 1UQYA 4O52A 2J78A 2WPBA 4Y90A 4WEVX 1VBUA 3GC2A 3EX6A 3ABOA 3IJDA 3GU2A 3GVGA 1F8IA 4S3BA 3VUPA 3SADA 3O0FA 3N4AA 3ZS4A 2NXIA 3G6LA 5HJLA 3OVGA 1X6NA 1KFCA 3BAXA 4PUJA 2EQ9A 4EX4A 4O8AA 4H4SA 3EWCA 1PIGA 4XZLX 2QHAA 1HJUA 4BR1A 4H2HA 3CH0A 5FF2A 2GJPA 4JKMA 4IHCA 1NTHA 2Y0FA 2A1YA 2ZUSA 3GH4A 3S9YA 2WW5A 5FJRA 3FAXA 3WF4A 3G1VA 3P80A 3TSDA 3VNMA 4RK8A 1S2CA 3MMDA 2X50A 3U2OA 5A1AA 1PWMA 3UT0A 2WMJA 3EWXA 1RHCA 1WNOA 4Y9PA 4KIEA 3NXLA 4FX8A 4WDXA 3TTQA 3T4WA 2VGIA 5I3FA 2CDUA 1UWRA 2D0FA 2FGZA 4AX6A 1J6PA 1ZU8A 5I3KA 3BCFA 1FHUA 1V3JA 4W7WA 3DECA 3LCGA 4QS5A 2FFCA 1UJPA 4U5KA 4EMWA 5T9BG 2O4QA 4PTWA 3S6TA 1TPB1 1ZAHA 2QAFA 2CC0A 2YL8A 2ZVIA 4ZXOA 2WSQA 2ZZBA 1DJWA 2J7FA 4D1IA 3T09A 3QY8A 1LWHA 4XVEA 4P7OA 1YMYA 1FWCC 1FWFC 4OZOA 1LP6A 3NA8A 3VOGA 3LXBA 2BC0A 4YJ5A 3QGVA 4RZ6A 4BQ3A 1S2TA 1OCJA 1PX3A 3P67A 4BEUA 2JEPA 3EDFA 2OZ0A 3VIGA 1MW2A 4DUXA 5DF0A 3NEHA 2VTFA 1V0MA 1N8FA 3A21A 5BYWA 2VFGA 2Z25A 3WLKX 3MO7A 2DVTA 3RLGA 1L2UA 3QMSA 3HMCA 2FDSA 3L4XA 4GVGA 3R0KA 1B4KA 4GHRA 1F73A 4P5UA 4KEMA 4TQTA 3IS4A 3KVLA 3A13A 2V3AA 4EVZA 1TYPA 3NZGA 1E9IA 1MQRA 4PODA 5CXPA 4PMVA 3RM4A 3MU7A 5HUPA 1SO3A 5GQBA 1T8XA 4NUWA 4F0MA 4B91A 1P1XA 1N61C 4LUSB 3DN5A 3EA2A 2OO6A 1OQFA 1PIFA 1L6FA 5I03A 4MWAB 1GVQA 1V03A 2DZAA 3TTOA 3N11A 1JYNA 4HMEA 4WCJA 4HJWA 5I3JA 2HVMA 2V0TA 1PTAA 3DBNA 3TWAA 3FSUA 5CQ1A 3VD5A 5I6SA 4QITA 3FDKA 2ISVA 1S3TC 3F1QA 2YYUA 3V36A 3HG3A 4GPNA 1LM1A 3S9IA 1Y7VA 4DX3A 5BXPA 4I7UA 1BAGA 5CH9A 1E4MM 4KCVA 3SGZA 1KV8A 3U2EA 4QEEA 1M03A 1S5WA 4LFYA 1BRLA 2NT0A 3SUUA 2J7BA 3NQ8A 1ITQA 4YVXA 4LT9A 3W2LA 1GESA 3U7BA 3HV9A 1OT1A 1UR9A 1RVKA 5IFPA 2W3SA 2WJFA 1RCXB 1I1XA 4DJED 2BY0A 4HHMA 5DXYA 1F3XA 1D8CA 3O2LA 2R1KA 1XBXA 4W7VA 1JCNA 1IF2A 1VQTA 2FZBA 4AF0B 1CGWA 1QU4A 4GCAA 1Q45A 3RPDA 3O05A 2DPEA 3PJXA 3QJAA 4AZCB 2QDEA 2A3EA 1SZGA 3WUEA 1FHVA 1F3PA 1X8FA 1OB0A 2ZADA 3TN5A 4MAZA 3T55A 2QCEA 3KVKA 2PDUA 3OVQA 1ZFJA 2GR1A 2BVYA 1EF2A 4S3CA 1C8XA 2C19A 4LAOA 4TVCA 2YBUA 1Z44A 3ETRB 1R47A 1W8SA 2C91A 1TPUA 3B0PA 3TEVA 1GQKA 2C3CA 5A8QA 2YPIA 3PFMA 4X22A 3QFAA 1JEHA 1S5VA 2PDHA 3OEXA 1EJTC 3OHMB 3TCEA 4JYDA 3ZR5A 4B3ZA 3BE7A 3NL2A 3PZNA 2DSKA 3WX7A 3WMBA 3GDKA 1GYMA 2CLFA 2QUVA 3GDTA 4DNAA 2Y85A 1MI3A 3T6CA 4C91A 5AHMA 3NO1A 4PMRA 1H1ZA 3C8FA 1G1YA 4DAIA 4AYGA 4TMBA 3W88A 2JKPA 3IIVA 1ZJHA 4ICNA 2DZUA 4OBTA 2CWXA 2A85A 3BCJA 5A8GA 1ITUA 4M5PA 2D2HA 4UUIA 3WLPA 1GRTA 1X1NA 2FPTA 3M5VA 2GVEA 2TAAA 1VZWA 4A05A 1AJZA 2FGBA 2Y2WA 3BC9A 4O14A 4IFKB 1TPDA 3RUBL 3UJ2A 3TA9A 3PUEA 3EBVA 3N73A 3A22A 2OELA 2D0HA 4WGXA 2VRQA 3FAWA 1TIMA 1XYFA 4GABA 4HQVA 1GEUA 2JALA 2JF7A 1A5LC 3FX4A 1AODA 1AMKA 2J77A 2YB4A 4DPPA 3FFSA 5LGZA 4JN8A 1EOKA 5AHIA 1UD3A 1FA2A 3UZJA 2QCCA 3NQ7A 1Z48A 2OJPA 1ZAJA 2EKCA 1H50A 2VURA 1B90A 1YTKA 2PDIA 4GIAA 3SUSA 4B4FA 3BMVA 4EK7A 5A6SA 2X1UA 4LU0A 4PFMA 2V5CA 3LV5A 1H5YA 2YLAA 3AALA 6CGTA 5JCKA 1NH6A 3M0IA 4NG3A 3W27A 4W5ZA 5GJPA 2ZFAA 5ABFA 5FA5A 5CG0A 4B16A 1XIEA 1ZJIA 3QMTA 3L5OA 3F5LA 3VDBA 4GY0A 2P76A 2P88A 1W5OA 5HJXA 2E6AA 1TCDA 3KLKA 1TJRA 1SJAA 5D2VA 3CYVA 3WNNA 3TC7A 4PUKA 3WF1A 4H4RA 1MYRA 4PBGA 1W1PA 4X2PA 2X42A 2ZZCA 3GYEA 1PYMA 1RA0A 4HN8A 3VE9A 2UV8G 3AICA 4Q4KA 5FI8A 1EJ7L 2ZYFA 4RZBA 3KBWA 1KGWA 3LENA 3N6JA 3H2CA 3AMGA 3WL1A 3TYEA 3TC6A 3LCLA 3LRMA 2OSWA 4M56A 1KWGA 2ABBA 1IXPA 1DQWA 2J74A 3VIJA 4JTDA 2XN0A 1V3IA 1XIGA 1MDLA 5K7JA 1PYFA 4YWOA 4GVIA 5HQEA 2BZNA 2HNHA 4HA1A 2BP1A 3QKZA 4H4IA 1F3WA 2J24A 3WDHA 3NQMA 3CPGA 3TAOA 5G1TA 1MDRA 3W72A 3B9DA 5BCAA 2XISA 4EPDC 4J28A 2A79A 2WANA 1VAHA 1RJQA 1TR9A 3AMKA 4LAZA 2CKRA 4MFDA 5I3GA 3JS3A 2I5IA 5CSYA 1TV8A 3T2QA 4KBXA 1CNVA 3ITVA 1F76A 1I1WA 1FUYA 2F7FA 4O13A 2ACQA 3W28A 3QRHA 1QNSA 1IEIA 1AJ0A 1OGBA 3LXAA 1G5AA 4LF2A 2WMIA 6ALDA 3CLWA 4J2MA 1VJZA 4FI4A 1VFSA 3CLMA 3B0VC 2IQ0A 1JUEA 1V51A 5I06A 2E5AA 1LUCB 1POKA 5GJMA 3HQ1A 2CCRA 3GFZA 2GSHA 2G5WA 1SSGA 1KLYA 2C0AA 3MS8A 4UMAA 3UNTA 1JPIA 3WLQA 3RF9A 3CHDA 2CXGA 5FS8A 1TB3A 2CYGA 3NS1B 3S5OA 3CGBA 1LTDA 4NXSA 1N5WC 1CWYA 5LGXA 2VFIA 3B9JB 3W83A 4P8XA 5A6AA 5D2XA 4O1FA 1R3WA 3LUTA 5HR7A 5I00A 5KSWA 1MW0A 1PWLA 4O10A 1P6WA 3DGRA 8XIAA 1B3OA 1ZQ5A 4GMEA 4NJJA 4W89A 1DQUA 1QPNA 3N2BA 3FHQA 4WR3A 5DT7A 3S3GA 1WV2A 4V33A 1A4MA 4XAYA 1VLIA 1US2A 1JPDX 3W7PA 1LLWA 4NZJA 1LOQA 3CZ8A 2Z2BA 2HVNA 3GBDA 3N9KA 1C93A 4GWEA 3S2LA 3ZT5A 4MY1A 3I6RA 4JTLA 3AJ7A 3G22A 3VA8A 5RUBA 1YRRA 3W7OA 4UFKA 2QDHA 1GVEA 2G97A 4CN6A 5DEZA 3C5QA 4EQXA 1P0BA 4QLJA 3PG9A 1EQPA 3VFLA 1XKJA 1GWJA 2Z6JA 1F3TA 2GYIA 2YLLA 2XTKA 3BANA 4MB1A 1V0NA 4FMVA 4O4WA 1G7UA 1E3XA 2ZZ0A 4GX9A 3IIPA 2C79A 5AHNA 2XU2A 4NRRA 4BF9A 2Y7FA 1CLKA 3AHVA 3KBJA 2HRWA 1V6VA 3QY6A 3UR5A 4QFUA 1RALA 3GD6A 3O7UA 3W2KA 2IPGA 5F4XA 4JDBA 1SW3A 1A4LA 3B8IA 1FWBC 4TVUA 1EPVA 3OVPA 3NYZA 4IJBA 2QQ6A 2PD9A 5AY7A 2HXUA 1DORA 2JE8A 1UC5A 1J11A 5HBFA 4ZOAA 3WFZA 2PPGA 2FMOA 2YCEA 2WLYA 1O60A 4Q6XA 5C2GA 4IUOA 4H4VA 5FJTA 1NSJA 4H01A 1E3ZA 3MKCA 3T7VA 4WQ6A 2DZWA 1UD4A 1BSLA 2VEKA 4NP7A 3RPMA 3LSCA 4K1WA 5FJIA 1TE1A 4YHGA 2GQ9A 4AY7A 1H7RA 9RUBA 4R53A 3QKEA 4XG1A 5CC7A 1IIHA 2PDFA 2RDTA 1CXKA 2ZBTA 3SIMA 5DY2A 1NAL1 1K03A 4IM4A 1YE4A 4V1YA 5A6JA 1QUMA 2BSLA 1QJWA 1HKWA 3EXTA 2VR2A 4QE1A 4BF5A 3AMDA 4XIAA 3AO0A 2GR3A 4D6DA 3HQNA 2CBIA 2YAUA 1TRIA 2PURA 1ME9A 1OT2A 3RO8A 3QHOA 1CX9A 5B80A 4UTLA 1C90A 3AIEA 3MVIA 3GH5A 2DT1A 1UR3M 2YL9A 3CAVA 3VM5A 4I90A 1CLXA 1Z69A 4UIOA 3ITLA 3S6OA 4YYFA 1ZY8A 3T1GA 2IMRA 1AQ0A 2EKGA 4IGNA 1EH9A 2IW0A 4AMCA 4IG2B 5BOFA 1PO9A 3WBEA 3E0LA 2E7FA 3GNRA 4JTFA 4PUEA 1C8VA 3SRFA 1AH4A 4GFSA 4YTTA 4H00A 3AYRA 1FHDA 2PC4A 5FD0A 4CNSA 2QMKA 1V3MA 5F2MA 3G0SA 5MF5A 3SCVA 4FSAA 2DW7A 3LI0A 5AYZA 3TXZA 4KPRA 3M0MA 3WCZA 2QUTA 1EEXA 2JK2A 1Y0EA 2WWCA 1HJXA 4KQNA 4GGBA 3VOCA 1OFAA 2JK6A 1YHTA 2AGKA 2WOQA 4IMFA 1T3QC 3RJXA 3PSVA 4PMJA 4U3AA 4W8LA 4Z0JA 4GUFA 3GC4A 3FS2A 3A9IA 2ZQ0A 3SY8A 2OWXA 2PDXA 1IXNA 4JEJA 3GDMA 3UEQA 3R5EA 4QROA 4PN2A 4ZB5A 2GQ3A 5EMUA 4JTAA 2WC3A 1WKFA 1B3YA 1NDAA 4YTUA 2OOFA 2V6AA 3DYPA 3PBWA 5HMSA 4J57A 3BO9A 2O9TA 5EBKA 5A94A 3POCA 4H8NA 3LXCA 2Z1XA 1J96A 4AZCA 4PTMA 4AD0A 4IPNB 1N8IA 1O5RA 3LCWA 1GOMA 2HSAA 3SY1A 3M7WA 4RXGA 4A6GA 3TZNA 2PCEA 1RD6A 1X39A 1N2VA 2A5HA 3OGSA 3ZVHA 4DYJA 5I0DA 2H8XA 2DVXA 1SGJA 1BVNP 4X61A 1DXIA 2YCJA 4K39A 3HPSA 3SCRA 3DESA 4BQ5A 3MUZ1 3H12A 3UCDA 4FHAA 4ZOBA 3DHDA 1CCWB 2XVKA 2KX9A 3C0JA 4BWLA 1O12A 1FWWA 2J66A 3EGJA 5B7YA 2C1IA 3UZ5A 1DPMA 1LRQA 1VBGA 4HNCA 2IPWA 5I7GA 4M29A 4FOKA 3BOXA 5PTDA 3AQUA 2UY4A 3SRKA 2UWFA 1H0GA 4PMNA 3EOSA 3IJLA 3CEPA 4ACZB 2WBKA 2JGQA 2WHJA 1VP5A 5FEPA 1KQZA 1HO4A 1VCGA 1JCJA 2F2HA 3GIQA 5FAJA 2FH6A 3GIYA 1TTPA 4HMNA 4MMWA 3L4UA 4LS2A 2QJMA 4IFKA 4MNLA 3SCPA 3ANYA 3ANVA 3PY2A 3R12A 4S3FA 4DHGA 1B1YA 4IH3A 4F40A 2SFPA 1PZ2A 4X9YA 1UKTA 3PBVA 1SFSA 2DGAA 4WGHA 3PB2A 3UGVA 4G9PA 1GJWA 1LQ0A 3E1F1 2W62A 3VUSA 3MUXA 5HANA 3GY1A 5B7ZA 2B31A 4HZ6A 2O9OA 2INZA 3PNZA 3C61A 4B5UA 3FA4A 4P7RA 1GEQA 3IUHA 3OZMA 3W7RA 3PTDA 3ITGA 2GRTA 5ABTA 4GKTA 1QTWA 2YIHA 3WIJA 3BPWA 3DFQA 3EWBX 4O4VA 1VFMA 2Y8VA 3BLEA 5G5GB 1MVYA 2YDAA 2W91A 4M81A 3TSMA 4BJHA 4QG8A 5FEZA 4F79A 3UESA 4F0HA 1V6TA 2GVGA 4GZEA 1TO3A 3VU2A 1UKPA 2CNCA 1SJBA 4HNLA 4HK6A 2AAAA 3FNDA 2GPTA 2F6XA 3W74A 1LDCA 4B9ZA 3ARWA 3ZIZA 3GU1A 4AZ7A 3GS6A 4NI3A 4FIRA 1S5TA 3HBLA 2VWTA 2VZOA 4FLQA 2NLYA 3CQIA 2E67A 2WHKA 4XKYB 3W24A 3ZLGA 1YTEA 3I3DA 1SFTA 1FH9A 3QHNA 2PTDA 3ABXA 3WY1A 4JTHA 3SCTA 1XYAA 4MM1A 4AZIA 2YSWA 1H41A 3O6AA 5BMXA 2XDFA 4S3DA 5CZKA 5TIMA 1UR8A 4GBUA 1OX5A 2NVCA 2XSBA 5A95A 2V3EA 3GIPA 4N02A 3NXFA 1IHIA 1VS1A 3WQGA 2EHHA 1PS9A 2XM1A 4WDTA 1CZ1A 2GJRA 2VRJA 5DMLA 2Y89A 3TFXA 1B3VA 3DK9A 4YWSA 2R9ZA 4JQ1A 4B2DD 3BVJA 1F07A 4EACA 1B0IA 1TZ7A 1OEPA 4JAWA 2YR1A 4MYAA 4JFSA 1XD0A 3FYYA 3G2GA 3BK0A 2GR2A 4Z1AA 2VYOA 4LGXA 1AG1O 1C9DA 4BV6A 5F2IA 4CNTA 1LUCA 4HN4A 1OABA 1H1YA 2ACSA 3VGGA 1UP2A 4DZIA 4NSBA 3VABA 3IGHX 3IJ7A 1OFBA 1W56A 1AH0A 4PTDA 1GZ1A 4XZMX 5E5CA 2XVLA 3KS5A 3AWNA 3UWVA 1UQZA 4O12A 5K2ZA 3WJXA 1F8MA 2VX7A 3ARUA 1DTNA 2RJHA 5DCEA 3WLTA 3QGAC 3OA5A 4MFEA 4H2CA 4H9VA 2J6XA 3IUDA 5LNUA 1WA3A 4PFHA 2PUZA 2X40A 1WDWA 5LXXA 2CIPA 3GHUA 3N18A 4P8UA 1ICQA 2XSXA 4UFMA 4ZTXA 2PDQA 2IPJA 1JQXA 5A8NA 3GLCA 2J75A 3MCNA 4GNVA 2O7SA 2QCDB 1KM2A 3NZQA 1J2WA 3H4XA 3CV6A 3M5XA 3BZGA 3QM3A 1OCNA 3SIZA 3E6EA 2J47A 3O0KA 4OKDA 3GXIA 4IIHA 3AYTA 3RU6A 1OZQA 1I9CB 2QJNA 3N9SA 1RCQA 3P7YA 1AMYA 4QTGA 4LPCA 5KTLA 3RX2A 4AQLA 1XG4A 5DT5A 5A6KA 3HURA 3W0KA 3DHPA 3N17A 1Z89A 2JIWA 1MNSA 3DK8A 4WY0F 1Y65A 3W1PA 2H8ZA 2PBOA 1LLOA 5I5RA 2OYKA 4DZAA 1Q7QA 4KRUA 3KOWA 4CU6A 4J3SA 5CLWA 4FNTA 3MO4A 3WDIA 1JVNA 3LS9A 1NY1A 4DNHA 3N13A 2QGYA 4UB9A 4R5EA 2JKEA 4E8CA 3VNZA 1J93A 2V69A 3NQEA 4WXZA 2V6OA 2VMFA 1U30A 3D6NA 1VPYA 1S2AA 5K9DA 2XH2A 1IZCA 1HTIA 2P50A 2NWSA 5HPCA 4HSNA 4M6PA 2EJAA 1D9EA 1R2SA 3NM1A 4B5XA 1OX4A 4C6NA 2C18A 1DWIM 1IEVA 1TYGA 2QW5A 4GZIA 4B90A 5CPQA 1QPQA 4QQ3A 1UIPA 3OU8A 3FJ4A 2V30A 5BNKA 2A3HA 1QHPA 3WQDA 2HDJA 1UWAA 1OC6A 1M68A 4CQ8A 3BJFA 3TDFA 1F8WA 1UMLA 4BHYA 2Z1BA 4MPQA 3UZXA 1DV7A 1ISXA 4JXCA 1DIEA 5AYXA 1M7JA 3IJ8A 3KTXA 3TYDA 3LRKA 4X9SA 4QEHA 2PMQA 3WLLA 3AS2A 1NDYA 2PGFA 2X7VA 4EXBA 3E12A 2CWNA 3PZUA 4EWND 5A6BD 1P0EA 5D9MA 2PBGA 4JNMA 6TAAA 1EZ2A 2I5QA 1TPVA 1YEYA 1RPXA 2CFFA 3UY8A 2XGZA 3ZLHA 5SWUA 2VC5A 2NQZA 3R0DA 3K5XA 6TIMA 2PI6A 1I2PA 4HNOA 3NM3A 3W71A 4RNHA 3R43A 3SCSA 1Q4WA 3EPMA 4M6UA 2JBMA 3GD3A 1BXBA 4ADTA 3R89A 1YKWA 3N3TA 4S3JA 1UP3A 5G1MA 1K4GA 1JRCA 1P48A 3GG0A 4QE5A 2VDGA 4W8BA 5FL1A 4GQRA 3HF3A 2VEGA 4AFYA 3PFRA 4Q33A 4NU7A 4H4QA 4YVVA 5E9XA 3REQA 1LWJA 3H2OA 4IGSA 4K7ZA 3GXTA 1W54A 4I9JA 2XN2A 3RIKA 1TA3B 5HNRA 2V5LA 3BV4A 5L6UA 2PDNA 2WQPA 1N8WA 4BCEA 3IIZA 2ZUTA 3W7EA 3T42A 4WJ8A 3N04A 1TE6A 4RDYA 2PWDA 4HGXA 4ZO8A 4WJEA 1BTMA 4UTUA 2WMGA 3DKLA 1JZ5A 1PSCA 3QMRA 4FNQA 3LLFA 2YXGA 5TR3A 3MP5A 1W9BM 3VMNA 5K4XA 1LT7A 1GK8A 3GU9A 1Q6GA 1IXOA 3VX0A 2VENA 2CZFA 1XDLA 1KQYA 3DIPA 3LZ5A 2HQMA 1A80A 3P5YA 5M2FX 1C7SA 6REQB 4O50A 3BWWA 3W7IA 3W7KA 2TMDA 3SGUA 3W75A 3EOUA 3WDRA 1Q8AA 4JTEA 2Y5SA 4D6IA 4IIBA 2XVNA 4GH1A 3KM8A 5CGTA 4M8UA 3TR9A 5JXQA 2GGJA 3U5YA 1DJZA 1EJSC 3WMSA 2GQ8A 3HGRA 1Q2RA 4Y9NA 2ZX6A 3G1AA 1V8EA 1E4LA 2VCBA 4XSLA 2HROA 3PTQA 5M03A 2VGBA 3NO3A 4LV4A 1C91A 4I5RA 3DFHA 3MZ2A 4GI8A 3SAZA 3LOTA 1E5NA 2FVMA 4IMDA 3FGCB 3IJ9A 3GO2A 3R94A 1IT8A 4PCSA 1K8ZA 1PB0A 3BMWA 1YTDA 4OBSA 2V5KA 2Y6ZA 4EPKA 1Q66A 1BYDA 1HP5A 1QI3A 2GK1B 4OVXA 3UWEA 1EO7A 1UWIA 4H19A 4ZSUA 4DJDC 4M6QA 2CLMA 3PF3A 3WQVA 5I23A 2BDQA 4PMZA 2BY3A 4NXKA 4GY7A 3NR0A 2REQA 2AQWA 5LHEA 1TWWA 3SUVA 3TN6A 1CXFA 2O56A 4DXXA 1M9HA 4LQ1A 3D0CA 1OD0A 1H61A 3VZYA 1TWDA 4G2DA 4FP1A 3LQLA 4H6QA 1XH1A 4GQBA 4URIA 5A2CA 3KOYA 1UJQA 1JQVA 1NF0A 1RY0A 5A69A 2C3DA 1JUKA 4QGCA 4P7LA 5FESA 4PL2A 2ZZ6A 2H90A 4WDUA 1J4EA 2YDRA 1VFLA 1LROA 4OT7A 2D20A 1JULA 4CQ9A 1VH7A 2OWCA 3OVRA 1EJUC 3CUJA 4JTKA 3WEMA 4H4YA 3WD0A 2XIOA 2XFFA 1W8GA 4FNPA 5JCNA 3PZTA 3LLDA 1QDSA 1ICPA 4I7VA 3VKDA 1VBHA 3APYA 3SSJA 4DJFC 4QAIA 2Z4GA 1ZLPA 3UXLA 4DNMA 3UP8A 2HEJA 4H4UA 3E3HA 3C0LA 3E5BA 3N2OA 4LF1A 3TQ0A 2YVGA 2FHBA 4I6KA 2ZVRA 4UCGA 4M6VA 5FAGA 4JN7A 1W3NA 1FQ0A 3EDJA 1XUZA 5G4EA 4LC6A 3HQOA 4PSPA 3LN3A 3UZYA 1XBYA 4ZSTA 4JFVA 4GUHA 1UKQA 4X2RA 3WUFA 1UOKA 3UA4A 5AYBA 5JH2A 3SBFA 5CCZA 1TMQA 4LRTA 3AZSA 4PMOA 1A3WA 3LRLA 3G1RA 3OODA 3E0WA 5F4SA 1GOOA 4HSHA 1MZRA 4NI8A 4AXNA 2Y88A 4PEKA 2I17A 4IPJA 1B9ZA 3U2ZA 3IWPA 2VOTA 2GH5A 1US0A 3CUIA 3FHAA 3LMYA 2BGSA 3S2CA 4AU0A 1D3HA 1RP9A 4QDPA 1KBKA 1WDRA 5FOOA 1GERA 1N62C 3AZRA 1RPKA 3SUTA 3GRSA 2FLIA 1VF8A 4IQDA 4DUOA 2A3CA 4XD3A 1UMYA 3WK0A 1G01A 5LKYA 3R25A 2GUUA 4AYSA 3PZGA 2WHLA 1TPEA 3WQ8A 1UD5A 3L4TA 3AS0A 4ICCX 5I24A 3GH7A 1C92A 3E02A 5C2XA 2WYSA 4MWAC 4RDZA 1JCYA 1XRTA 3K8KA 2EPOA 3UG3A 1Z42A 3ITXA 2E5BA 1V3KA 3AN1A 1RQEA 1EP1A 3INPA 4NL1A 1PKLA 1XPGA 3GR7A 2XIMA 1R0MA 1G4PA 1TPH1 1PUDA 2NUXA 1U33A 4NJGA 2VDIA 4DBEA 2Q8ZA 3WENA 3EKGA 3OG3A 3OLIA 2P3ZA 4WKFA 1K3UA 4GYPA 3IJQA 4BURA 1ML1A 2X8GA 2W54A 1G67A 3AOFA 4J35A 2R82A 1UD2A 1D3GA 2E28A 4WOQA 4GKLA 2BASA 4O0KA 4CD7A 2EF9A 4JNZA 4AWTA 3GUWA 3GC5A 1TG7A 4DM1A 5A2BA 1NF7A 2FH8A 3UXDA 1JDFA 3EXSA 4FIQA 3S5SA 3W6LA 2WZMA 3IIXA 2ONEA 3R11A 4A29A 3A5FA 3AROA 3L5LA 3FA5A 4Y96A 3UXKA 1XGDA 4HCHA 2PDKA 4E8GA 2PSNA 2VEFA 1DE5A 2BV9A 2BS9A 1B54A 1BKSA 3TNOA 5I3DA 2R1NA 4AXKA 5BOEA 1MRQA 3II1A 5LYRA 1E1FA 1X38A 5AVHA 1S39A 4LUJA 3ONBA 4AWEA 3T08A 1WYIA 3W1AA 2V5BA 1DIDA 3LTSA 1Q65A 2CZDA 2P0OA 3WQFA 4V15A 3S2JA 2B7NA 3I6EA 4JHOA 2VZSA 4LNCA 3A4WA 3DFSA 1X6UA 2W9MA 3NPXA 5BOOA 1NHRA 2PB1A 3H4WA 3W7JA 3KAOA 3BW4A 4CN4A 2GDVA 2A2IA 4XIMA 3NQAA 4O53A 5A6TC 2E0PA 3ECQA 1GJPA 1JDCA 1V7AA 2G0WA 4FOUA 1XUUA 4JDYA 1EA0A 2VR5A 2WJEA 1NFGA 2OGYA 4US5D 1R3QA 4RW3A 1J2BA 1GVOA 1RK5A 2R1MA 3L66A 3WQ4A 4L65A 5E0CA 1NOWA 4C6IA 3NSNA 1M7PA 1WZKA 3DFOA 4C6QA 1QVBA 4E5TA 2EBNA 5GNXA 4QJ4B 1U1JA 2EGZA 1TWSA 3B4YA 3RDKA 1OK6A 3BAJA 4MVAA 2R9RA 1V3HA 1UZDA 4PC8A 1SZNA 1JYWA 5JUVA 3GNPA 3DG6A 3STEA 1STZA 1JPMA 3EF6A 2VM8A 4W85A 4CD6A 3NL6A 1GEHA 5GRTA 2WZEA 3GRTA 1AZ2A 2NQ5A 2ZRUA 1Q63A 2DT2A 1J0YA 3QQ0A 7TIMA 3L0NA 1O4UA 4HB7A 5D38A 3ZT6A 1TQJA 1VFTA 1GT8A 2CXEA 2CERA 2XVPA 4B92A 1TREA 1Q6FA 3OIXA 3P62A 5T26A 1TUFA 5D37A 3PZOA 5CC3A 4M51A 3TOPA 2E3TA 3AMZA 3KL3A 4MG4A 2XZ9A 5U25A 4UWMA 4GXWA 3MWAA 4RPPA 4KFOA 3UZZA 3EXRA 3AU6A 4O1BA 4PB5A 1P0KA 1OC7A 3NUKA 5CZTA 4AW7A 4K8HA 2BXVA 4CVUA 4WZHA 3LHUA 3G6MA 3EB2A 3W07A 1H7OA 2V82A 2B7OA 4JL1A 1XHCA 5JU6A 3EB3A 4FLSA 4WX2A 1KBJA 1GVRA 4ONVA 1VENA 3TE9A 5MKGB 3OQEA 1MQPA 1JZ8A 3MMUA 1EQCA 3CS2A 4FNUA 1ZDLA 4NZ4A 5G2IA 4KESA 3LLXA 1BYAA 3URBA 3BMXA 4C6KA 2E1DA 1VJSA 2WVSA 3LM7A 4NRSA 4HNTA 1VEPA 2OT1A 4GYFA 2WHMA 3A7AA 3MMTA 4QJ5B 3H2MA 4YL2A 2WZTA 2ZA3A 1IEXA 4RR4A 3DBPA 1QWGA 3R07C 4XZ9A 2I14A 4Q8QA 4PRWA 4N42A 5LA2A 5HWMA 3ABSA 1VLWA 2VHLA 3KE0A 3MCOA 3UCQA 4IIDA 2HK1A 4HKPA 3WDJA 3KP0A 2PEVA 4H4TA 4I8YA 3TW7A 4F4RA 3WQCA 1WZLA 3LERA 5JBEA 3VNDA 4HCDA 3RCYA 1KA9F 1FWIC 5ENLA 1M1BA 1W2VA 3RFAA 5H8MA 4IPLA 2FHCA 1BF6A 4NYYA 4HYWA 3KWSA 4AWSA 4TMCA 4DJEA 6REQA 5REQB 1J18A 2V81A 3HG2A 3MJMA 1FFVC 3QXBA 4ZL1A 4L64A 1IXQA 1GV4A 3DHFA 1DIKA 3WD4A 3P74A 4CD8A 2Q3OA 3XINA 3OJGA 4Z2KA 2TPSA 2D24A 3G1YA 3KLLA 4FLOA 2NQLA 4IGHA 4MJ2A 3B9AA 2PA6A 3AXXA 3T2OA 2VO5A 3G1SA 1O95A 3TU9A 2ISFA 2ANUA 5EU9A 2XHYA 1EC7A 2OLAA 3TNBA 2E8YA 5JMUA 3N2CA 1I2NA 1ME8A 2Z28A 1V93A 1H51A 2Q02A 2VUYA 1YDNA 3E38A 3EA3A 2I56A 3UVIA 4CCDA 5FJOA 4LVBA 4KEZA 2J6VA 3BLLA 2GWGA 3M0HA 3HZ3A 1A5OC 1EX5A 2QGHA 1JG9A 3GVWA 4JIIX 4D71A 3PJUA 4BQ4A 3NQGA 2YDSA 3VMOA 1W37A 2MNRA 4FALA 3ZJKA 2EAWA 4P7NA 3MANA 2WLZA 1GPWA 2NX1A 5DFAA 2DUXA 1ZENA 3A3XA 3L4YA 3LCXA 3RNMA 1KWKA 3FKRA 2DIKA 1UP0A 3O63A 4ZR8A 1TMHA 5TNVA 2GJXA 4DO5A 4LEFA 3GQYA 4AWUA 1OYCA 1B2YA 4NZ5A 4CKQA 1XGZA 3MPGA 3HA1A 4LV9A 1LBFA 3CXBA 2WP6A 3OBKA 4PUUA 1Z7AA 3O3RA 3L4WA 1W17A 3S5ZA 3ARQA 3KL0A 5CZ0A 3HRDC 3Q6JA 3M64A 1PPIA 3NJ3A 3JUGA 1BXCA 1RJPA 1GHRA 2BHZA 1HGYA 1FXPA 2X0YA 3W1LA 5CPMA 3VGBA 3KRUA 2PAJA 1WAUA 4XK2A 3V3WA 3IGSA 3PN8A 1UD8A 4MLJA 5E6YA 3WNKA 4HHHA 1VJIA 1C29A 1OG6A 4AZ6A 5DBTA 3PG8A 1A5MC 2VXNA 3UD6A 3F4VA 4YVPA 3ITYA 3S1XA 1VFUA 3ABRA 3ZR6A 3LX9A 2OG9A 5K3VA 1UBPC 3PS7A 5DRCA 1KR0A 4GIRA 4TU1A 2BXYA 1R3VA 4U31A 4NJKA 2GGEA 5EGRA 4IL2A 2EG6A 4H6RA 4AHOA 2FB2A 1B3XA 3VC6A 4DWSB 4ZGYA 4RE4A 3MA8A 1F9CA 3XISA 3AJXA 2W61A 4WJXA 5IM51 1HF6A 3WQ5A 4Z2HA 3OTRA 3JZUA 4Q8PA 4KWSA 4QCFA 5FF0A 1H7XA 5HJYA 3MUCA 4XSMA 4BKNA 3VCCA 3JR2A 1SJCA 3I65A 1MQQA 2IKIA 4IIGA 1E6ZA 3GXDA 1RSCA 1HG3A 5EPDA 3HMJG 2NVAA 5CC6A 1XDIA 1YNQA 2ZC1A 1HNYA 3B4UA 3C8NA 1QT1A 1F5ZA 4E4FA 1IEQA 3KFTA 3FA3A 3ORWA 1ZCOA 2C6QA 5AYYA 2PDWA 4H9TA 4A8LA 4ICMA 4Y9OA 3HPAA 2VP8A 5AFDA 1IR1A 2EO7A 4DRSA 5I2UA 4EANA 4LOCA 1K6AA 4LVFA 2J79A 2JFEX 4MGGA 2WM1A 3K1GA 1ZBWA 2ZKMX 3A64A 2Z2UA 4CU8A 4TVDA 1O1ZA 1EJXC 1ZHAA 4N2YA 4JCLA 4O15A 3LSBA 1KBBA 4A3UA 1I6NA 1MW1A 3L5AA 1UA7A 4B9YA 1TV5A 1JXJA 1QCWA 3MC5A 1ADOA 3KRBA 1IWBA 1QW8A 3IACA 2GGIA 1CLVA 4HIBA 3HO8A 5IRPA 1XCWA 3A12A 4N4QA 2HWGA 3TFCA 3M6YA 3C2FA 1N55A 2O55A 2WAGA 3A23A 1MW3A 3BQ5A 7A3HA 4RCXA 3GWQA 3WLMA 5K4ZA 4L1GA 2HVOA 4W8AA 1J12A 4Q7NA 3RK8A 4JQ3A 3WFLA 2B0MA 3PPHA 5GPRA 3QPEA 5DMNA 3U4AA 3T44A 4IX2A 2GGHA 2A6LA 3G77A 4FX7A 4UBPC 2A21A 3C0QA 3TC3A 1GORA 3AWOA 1AVAA 4JY9A 5KETA 3ES8A 1X2GA 3RGTA 1EP3A 3T40A 1KRMA 4FXSA 1UWTA 3TK7A 3IANA 1MFVA 1KTCA 4GXMA 3DHUA 4C6CA 2ALRA 1IV8A 4JX5A 4K37A 3QW3A 3RYSA 5G4WA 1F3EA 4C1NB 1ZAIA 1H6VA 3WMLA 3UQNA 2CU0A 4MTVA 3I7RA 2VD8A 3MUIA 5JIPA 3U48A 1BHGA 3QYSA 1K9TA 1TTQA 2G95A 1S38A 3M0YA 3NOEA 5TQLA 3UY7A 1XLBA 1WBJA 4MOZA 1LVLA 1JZ3A 3CB8A 3UJSA 4A4AA 2ZCGA 1HJSA 4GRSA 3S47A 1XLDA 3N25A 5JRBA 3EPOA 3QSRA 1TZZA 3BTNA 3I4KA 3TCSA 4L4OA 4AZBA 2E6YA 3EEZA 2QCLA 2FZMA 2QIWA 4R3UA 4ERIA 4NEWA 1N7KA 3GAYA 2PTYA 5CSRA 3F2DA 5EA9A 2YL6A 3NO5A 1RZMA 1WOBA 3GG7A 2QMJA 5A8OA 1OF8A 3IEBA 2YA0A 1VFFA 1WKEA 4AC7C 3GSMA 2AOSA 3MBDA 1L2QA 5IDZA 1P4CA 3THUA 4HK7A 1W3HA 3WNOA 4W93A 1V02E 3GK0A 1E0UA 1BQGA 1SZRA 1JRPA 3VD7A 3C0SA 4J7RA 1GZJA 4KGLA 3W02A 3LMZA 3LG3A 2OSXA 4DUWA 2J8TA 3VFCA 2PGRA 2WPGA 1FWSA 4MZYA 3USZA 4O0QA 4A22A 1VR6A 3W2JA 3V4BA 1S2VA 1CXLA 2AL1A 3IJIA 4EE9A 4XISA 1RY8A 1D8WA 3TUUA 3IC9A 1E1EA 1DXFA 4NVTA 2OOGA 2QCNA 2PGEA 3CQHA 3AHTA 5ABFB 5HWNA 3SCQA 2E09A 3C2RA 3MSDA 2BOGX 2J13A 3B9OA 3H70A 1QI0A 2ZTKA 4I5XA 3IUIA 2YCKX 1AW2A 4Q8NA 4M1RA 5KZDA 2J7DA 1YIXA 2WOIA 3W53A 1F4HA 2DZSA 3TN3A 4LTSA 2FHFA 1JCXA 2ZWZA 4CCCA 4N6EA 1QI5A 1DHKA 5HAOA 4PUMA 1UR1A 3A4XA 3QY7A 2NSOA 5D03A 5BU6A 4V27A 1AL7A 3A9BA 1BYCA 1VGAA 3SECA 1OYAA 3URHA 1ELSA 3DX5A 3SRHA 3II4A 5J5RA 3CL6A 5TBOA 3B3DA 4KWVA 2PDYA 1V6YA 1VHCA 4WRHA 3PULA 1W32A 3DFYA 8XIMA 4FB7A 3A24A 2GSJA 2DSWA 4DJDD 1R3TA 4NHVA 1LG1A 1Q7ZA 3BL3A 2UY3A 3ZR4A 1KFKA 5EB8A 4GYPC 3B9EA 5C6MA 3UBPC 4O8RA 3TJIA 1PDZA 3GNDA 1G4SA 4UTWA 5JBDA 4AHQA 4DI9A 2BNJA 1Y5XA 3DZ1A 3WH8A 2WV8A 5FS6A 1EHAA 3ARZA 4AHPA 4GQQA 2E77A 5BRBA 2ZRYA 5H2ZA 4N9EA 4H9XA 3SQLA 3QOMA 3KW3A 3YPIA 3DC8A 2JIEA 5REQA 1UH2A 4PA8A 5T8GA 1U2YA 3O16A 1PDYA 2GR0A 2HBVA 1GYNA 3VGEA 2WKGA 1DJQA 2A3AA 4FLRA 1UUQA 3CM4A 3PUGA 1O66A 4GJIA 1FBAA 5C9UA 2F38A 2Y5JA 1NEYA 3R13A 1R7OA 3TYZA 3OZPA 3W6MA 2EJ1A 3EWUA 1HKJA 2OSYA 4DJFD 1JYXA 2D69A 1UKOA 2WSYA 5FIPA 5DY3A 2BVTA 1BGAA 1OC5A 1QXLA 1XLJA 3QFEA 4EWJA 2VL4A 2PF8A 2HE8A 3QC3A 5G4HC 4EQWA 1X6LA 2FKPA 4UC5A 4BK9A 1OIMA 4AZ5A 1EF3A 4HOWA 3CL8A 2OYMA 3IGXA 4CD5A 3GNOA 4IICA 4JX4A 5BRPA 2ATMA 1LORA 2ZZ4A 4Q8MA 1IGSA 1KFWA 3BG9A 3ZWSA 2EQ8A 2EPLX 3GDRA 4LCSA 4WKHA 3TQVA 4MY9A 4AB4A 3GW0A 4N9BA 1P7TA 1XHGA 4GIEA 2CFYA 1J5TA 3TA6A 4DEFA 3IJ6A 3AI0A 2DJXA 4K8EA 1HW6A 4C7FA 5KINA 1B4EA 2C0HA 1DE6A 1FTXA 5HATA 4I9MA 5EMJA 4EAMA 1BTCA 2PP3A 3VIPA 2ZRZA 1EP2A 4LA1A 4JFUA 2PTWA 1IT0A 2W67A 2ISSA 3BGJA 2EG8A 4Q32A 1W9PA 1ZBVA 2WKLA 2CLIA 1XPYA 3I6TA 1E4IA 4O11A 1JDDA 4PSRA 1WZAA 1W3TA 4L4LA 1YBQB 2V5JA 3ZZ1A 3Q94A 5JIWA 3GE7A 1JZ2A 1B31A 4MWAD 2PLMA 3ZSSA 3W82A 1GYLA 2X1IA 2J9YA 4DIAA 3WYZA 1LBMA 1S5NA 3KTSA 5DXXA 1KRBC 6XIMA 3PZMA 1CPUA 3VDHA 4KFNA 2HISA 2BTMA 1K8YA 1KM4A 4D72A 1XCXA 1SSDA 4JYFA 1V0KA 3KBVA 3P0XA 3DI0A 4UTTA 1EDTA 4PTVA 5FSEC 3OA3A 4UZUA 2YBTA 1VQZA 3K1DA 3E2SA 1LPFA 8CGTA 4WK9A 4I9TA 2Q09A 3HGOA 3STCA 2BY2A 2W6RA 4C1KA 4UTJA 2Z00A 3W1TA 3TXVA 4E2DA 1JPHA 3QFWA 1PXGA 1JCLA 2V2CA 4QCEA 4A3YA 3SCUA 9XIAA 4PCPA 1N63C 2FJUB 4EXAA 1WDPA 3LI1A 2ZUMA 2QLYA 4C6LA 1ZJBA 1DHPA 5CPLA 2CLOA 2DZPA 2FIQA 4DWSA 3L0KA 4DVOA 5EMKA 3S5YA 1ISWA 5JCLA 2FMNA 4O28A 1J5SA 4U33A 4CCZA 2NZLA 5JH1A 5DBUA 1IE7C 2CESA 4YTRA 1OYBA 1ZTVA 2J27A 1VEOA 4W84A 4DYEA 2WBAA 1DWFM 2B4GA 3S2MA 2GVJA 1OJTA 1LRNA 1KGUA 2DUZA 4U2ZA 4R7WA 5EYWA 4BA0A 1UYQA 4DZ5A 4CNNA 4JN6A 6A3HA 1K4HA 4PTXA 1A5NC 4XO7A 3Q45A 4JL2A 4JGDA 1UR4A 1XIDA 4WKAA 5AC6A 4JCMA 3GHSA 2J8FA 3H2AA 2D1ZA 4LIIA 1LRTA 2FZDA 3W2NA 4LUTB 3BCDA 5D2TA 2CLPA 4FR1A 4PL1A 1W9DM 4U5IA 1KGXA 1NFBA 1JGMA 3ZSTA 2YGYA 3RLHA 4RZ4A 3C3NA 5KZEA 4JD4A 4UNIA 3K46A 4B2DA 2ICSA 2RH9A 4B5NA 1BWKA 4UTFA 3IVSA 1D7KA 2BXZA 2YCLA 4XZNX 3VGFA 3B8VA 1GQLA 2X7WA 4HCLA 2CHRA 3HGSA 1HVQA 4HPGA 4DF1A 4TOQA 3P93A 4I8DA 3NSXA 3FEQA 2YX0A 3HW2A 1P5BA 4ZQMA 2YDQA 4GYKA 4S3GA 2VZTA 3HOJA 3DERA 1BZLA 1VEMA 1JR1A 1LL4A 1CW2A 4GUJA 2X05A 2WB5A 1EWEA 2ZE3A 4GR1A 5FS9A 1FHLA 3H4KA 1TJ1A 3FVDA 3KX6A 6XIAA 1DEDA 2FTPA 3M1ZA 1M53A 2FB3A 3XIMA 2CZ5A 2XGIA 1ZZMA 4S3KA 3MKKA 4FA3A 4Q4QA 4ERGA 4OU1A 2G3FA 2RDWA 4N7QA 2F9RA 7ENLA 1YLVA 5J8LA 1UR0A 3O6DA 3L0GA 4HMDA 2CBUA 4OUIA 5EMLA 1HJQA 3SN1A 4LS1A 5AECA 1Q13A 5E0FA 4C1NA 3ZVHB 2YQUA 3W81A 2WVVB 2KAUC 1WDSA 3VGHA 5AC7A 2XZ7A 1DJIA 2V67A 5I79A 1A50A 2ZWYA 1Q1RA 5D32A 1ZCCA 1DIOA 2PCQA 2D0GA 1ITCA 3N12A 1XBVA 5LIKX 2VR4A 3SCOA 2RGMA 5M1TA 4MNMA 3AXIA 4UTMA 1K4QA 1Q85A 3A3WA 3SI9A 2A6NA 4D6CA 4Q3MA 1WCGA 3V0UA 5E1QA 2HQAA 2XINA 1BSIA 1I4NA 2ZC8A 5AKQA 2ZXBA 2Z0IA 1Z9AA 3O0HA 1M7XA 5JQ9A 2FZNA 5DMMA 3IK2A 3L68A 1PZ1A 4JHMA 4OOUA 3CHVA 4CQAA 1FCQA 4JIEA 1YDVA 4KCUA 4JQ9A 2DU2A 1WXYA 1UW9A 4JEQA 3DC0A 4MB5A 2TRSA 2OZTA 4YTSA 4I7WA 4YPJA 3BH4A 3GG1A 2WXDM 3GXFA 2QVHA 4H4XA 1O5KA 3WNLA 1JI2A 3ZWTA 5KZMA 1BYBA 3LM3A 1Q6DA 5A3HA 5A6MA 4DO7A 1WX0A 4KFPA 4YCOA 2ON3A 4IFOA 1OGGA 1GETA 3MDUA 4CEUC 1P43A 4QR6A 5C9RA 1W1B1 4KEVA 3M0KA 1XISA 4HVXA 1E1CA 3TMQA 3QV9A 1G9HA 1QOQA 1RR2A 1PE1A 5I77A 4JTUA 3MV01 3M46A 4MJZA 1E5JA 1EIBA 4NAEB 2DH2A 1Q8JA 4MNKA 6PTDA 4XZBA 4ZCWA 3A4JA 4CNOA 5MHBA 2OODA 1JF6A 5AYIA 4AMAA 4ML9A 1Z3NA 4BI5A 3VKJA 1Y5WA 3W4RA 2CLEA 5D2YA 2OXNA 1S3HA 2PRMA 1OY0A 2A4AA 4YCPA 4AVFA 4GISA 3W76A 1I75A 1DL3A 2J3NA 5G2HA 1X96A 1ZP3A 1E6SM 3PWAA 3N1AA 2PDCA 1TV7A 1E40A 2PFHA 3VD9A 1K6WA 2J25A 1KNWA 2ZRVA 3HPFA 1M04A 1ODZA 4EP8C 1GG1A 1CDGA 1JAEA 3B03A 4J2PA 2QUNA 1FH8A 1GVSA 3IAPA 4DO6A 2BGQA 4K7YA 1W1TA 1KXTA 4RW5A 3WD2A 4UFLA 5G5IA 1KXHA 3EDKA 2VC6A 1TMLA 3LPFA 3LHVA 1HUVA 1S46A 4IIEA 3F03K 1K77A 2BFGA 4H9YA 3GBEA 4L9ZA 2YZ5A 3LB0A 3EDEA 1SM9A 2W0HA 4ZO6A 5C7HA 3BLDA 2E3ZA 1M6JA 2XVGA 1M5WA 1ZNNA 2MANA 2CBJA 3P0WA 1FDYA 1MMFA 2Y8KA 5LXEA 3QFBA 2CETA 5FJUA 5C55A 1CBGA 5C54A 3I4EA 2O7QA 4IJRA 1EA9C 3GKFA 3N2TA 3O15A 2VDHA 4GUIA 4HA3A 3AXMA 3BV7A 4N9CA 2VD9A 3WUBA 3PANA 1NHSA 3TLQA 1MO9A 1H2JA 4B5VA 3GDLA 4TTGA 3AS1A 2AKZA 1HXJA 3RMEA 4IT1A 1CECA 1ECEA 4PMQA 5FMHA 3N14A 4S23A 4BS0A 2BLEA 1YXCA 4KRZA 3KDOA 1CENA 1KB3A 5D33A 1UC4A 2XPKA 5I07A 3N2MA 2WJDA 4UMCA 1EZWA 1GZGA 4GZJA 1V4YA 4ZFMA 3LB8A 1R85A 3HB9A 2PE4A 4TV6A 1M01A 4L1XA 3G3DA 2B81A 5D09A 4D1JA 3W23A 2RGLA 4YS1A 2FTYA 2Z1SA 2OYLA 3H24A 3U8GA 1DQXA 3D5HA 1LZOA 3W3OA 3RO6A 5M5DA 3KXQA 4H6KA 1P0DA 1X1ZA 3UG4A 2XG9A 3CIVA 2NPXA 3SUWA 2Q71A 3L8KA 2NQ9A 4WSHA 3W7MA 3WH6A 3JZEA 4RUBA 5DELA 1XYCA 3CUFA 4U28A 3OOQA 1KM1A 3LYEA 4RLIA 5FKYA 1XP3A 2GDUA 2DW6A 5LA0A 2PLKA 3SN4A 5H8PA 5AC5A 3GXMA 5F2LA 5I02A 4ZO9A 3CAQA 5FL0A 4OECA 3CGTA 2ZDRA 1T8QA 2GSEA 2QPSA 4UXDA 5CEWA 2IKGA 3NZRA 4H04A 3VD4A 1F05A 2I9UA 3TWBA 2NWRA 2UY2A 3H23A 3P3BA 1QNVA 1TVNA 1AQHA 3TJ4A 4APNA 2FZ8A 3T07A 2RDXA 1XLIA 2I1OA 2WMHA 5CPSA 3EPNA 4GQ0A 3URAA 4AZGA 3CZEA 1SUXA 1YBQA 3IVTA 5D8ZA 4F66A 1XSIA 2VOMA 3CZKA 2ZZ3A 1QWKA 1QASA 1EUAA 4A3RA 1M41A 3MP3A 3WBXA 5A5WA 4E3VA 2LLEA 4Z1CA 4JIHA 1KC7A 1I2RA 3URNA 4RJEA 3VOJA 4EM3A 1S1PA 1WQ5A 3EWZA 1E73M 5HNTA 2FGLA 2HJPA 3NURA 4XTDA 1OX4B 1GQNA 5HUOA 1LOSA 1HO1A 1IWPA 3VNJA 1KO0A 4OBRA 1QOXA 3DYMA 3S4TA 4AD4A 3MTWA 1ZJAA 4HJFA 1H5VA 4CLMA 1N60C 5C0QA 2VEIA 4KETA 3CQ0A 1CXEA 2INFA 1ZX9A 2Z29A 1ZB5A 2C16A 2OQLA 3W85A 4YWIA 1KCLA 4HOXA 3QZEA 3R2GA 4TX6A 1DJYA 3WBWA 1AD1A 1RQHA 3QV6A 4MJ4A 2WSPA 2X0SA 3PPFA 3TYAA 3BW3A 4QSFA 3GVRA 3BOLA 2KZHA 4ADSA 1KM0A 3I7QA 3I3BA 1MEHA 1XDJA 4HTYA 1W9XA 3CXOA 1REQB 3RN6A 1FFQA 1ZBKA 2C14A 3BLIA 1R86A 2ZX5A 4DUVA 1WKDA 3UYIA 1UWSA 3AYSA 3V0TA 1K9FA 4JQ2A 4QRNA 4XD4A 3SO7A 4KH2A 2XYLA 2J9XA 3M5ZA 1GOIA 3HN3A 2ZX7A 1XLHA 4JPGA 3O8AA 2OVLA 1KCKA 2VFHA 1O6IA 3ELFA 4J3TA 1ISVA 1RLCL 3E2RA 3ZXWA 3H2NA 1E9ZB 3CWHA 4GFIA 2OQYA 4LUTA 1BPLB 4B15A 3TONA 4AZHA 1QOPA 1WO2A 2JKAA 3DGHA 1XLMA 3UWQA 4OIFA