3N4FA

Crystal structure of mandelate racemase/muconate lactonizing protein from geobacillus sp. y412mc10
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
390
structure length
390
Chain Sequence
SLNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title CRYSTAL STRUCTURE OF Mandelate racemase/muconate lactonizing protein from Geobacillus sp. Y412MC10
rcsb
source organism Geobacillus sp.
molecule tags Isomerase
total genus 127
structure length 390
sequence length 390
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3n4fA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3n4fA01
2OX4A 4K8GA 1BKHA 1R0MA 3SQSA 2P8BA 3OTRA 3UJFA 3V4BA 5EU9A 2OLAA 3H12A 3K1GA 3FV9A 1YEYA 3DG6A 2GGJA 3CAWA 2NQLA 1SJAA 2OZTA 3MZNA 1P43A 3OZYA 2P3ZA 4KWSA 3P93A 3BJSA 3PWIA 1RVKA 4K2SA 3TQPA 2XH7A 2FYMA 4IHCA 4HNCA 4JN8A 3SN0A 2OFJA 3TWAA 4HNLA 3N6JA 1SJBA 4GYPC 2QJMA 3TCSA 2PSNA 4H2HA 2FKPA 4H19A 3EKGA 3CXOA 3FXGA 3VCNA 2PP3A 3BSMA 4IL2A 4DXKA 5J04A 2GDQA 3MY9A 7ENLA 4G8TA 3NO1A 4GISA 3RR1A 3MQTA 3GD6A 3Q45A 3UCCA 1EC7A 3JVAA 3UXLA 2HXUA 2HNEA 1SJDA 1KCZA 1TKKA 2MUCA 2CHRA 3DESA 3DGBA 1TZZA 1P48A 2GGIA 1MDRA 4E4UA 1FHUA 4F4RA 3EEZA 1EC8A 3T6CA 1KKOA 6ENLA 3H70A 1WUEA 2OG9A 4M6UA 1R6WA 3OPSA 3SN1A 1EBHA 4DYEA 3D47A 1F9CA 4A6GA 5BOFA 3UJSA 2AL2A 1PDZA 2O56A 3T9PA 2PGEA 3PK7A 1WUFA 2PP1A 1EC9A 3ZVHA 3ZLGA 3DIPA 4DN1A 4IP5A 2I5QA 4GMEA 3KUMA 5FJRA 4A3RA 1ECQA 2PU0A 2MNRA 2DW6A 5FJOA 3NZGA 4JN7A 2PTWA 2PGWA 1IYXA 3ES7A 3PFRA 4DHGA 1ONEA 4HCHA 1DTNA 3RGTA 3CB3A 4MGGA 3TJ4A 4Z1YA 3TWBA 3MWCA 1SJCA 2ZC8A 3R1ZA 3SBFA 1BQGA 3H7VA 2AL1A 3UXKA 2OZ8A 2XH2A 4HN8A 3FCPA 3VDGA 2P0IA 4MMWA 4KPLA 4ENLA 4J1OA 3RO6A 2GGGA 2PMQA 5BOEA 2ZADA 3GC2A 3RRAA 3ES8A 4IP4A 3I6EA 3QKEA 2XSXA 3QTPA 3VFCA 5FJPA 3DG3A 4ZCWA 3S47A 3SN4A 4J3ZA 2OQYA 3THUA 3V3WA 4EWJA 4Z17A 3OW1A 2PU1A 2OKTA 2XH4A 3VCCA 3T4WA 3MSYA 1JPDX 3IK4A 4GIRA 2PODA 2QJJA 3IJQA 2GGHA 3JZUA 2AKMA 4ZA0A 3ZLFA 2PTZA 1FHVA 3UGVA 2OQHA 4E6MA 2GSHA 3Q4DA 4HCDA 3TOYA 3CYJA 4ROPA 4DWDA 3UJEA 2AL2B 2DW7A 2GL5A 5FJTA 3GO2A 3DG7A 3H8AA 3N4FA 3IJLA 4H1ZA 3D46A 2HXTA 4IZGA 3CT2A 4FI4A 2AKZA 1MNSA 3U9IA 3PWGA 3UJRA 3P3BA 1XS2A 2PA6A 2PTYA 1TE6A 2XGZA 3R10A 2XH0A 1KD0A 3R0UA 2POZA 3R11A 4IL0A 4HPNA 3UJ2A 4DX3A 3P0WA 2ONEA 1L8PA 2PP0A 3I4KA 3V5FA 1OEPA 4E5TA 3RCYA 3HPFA 5FJUA 1MRAA 2PTXA 2QDDA 2OZ3A 3MKCA 4KEMA 1NELA 3DERA 4K1WA 4IT1A 1ELSA 4GGHA 3TW9A 1MUCA 4MKSA 3VC5A 2OVLA 1JPMA 3T8QA 2QVHA 2RDXA 3QN3A 3IJIA 3ZLHA 3ZVIA 2OPJA 3FJ4A 4A35A 3ENLA 3STPA 3DEQA 3OP2A 1EBGA 1W6TA 4GGBA 3U4FA 3V5CA 3FVDA 3RITA 3FYYA 2PCEA 2QJNA 1XPYA 3R25A 3OZMA 2OO6A 4HYRA 3SJNA 2HZGA 4GFIA 4E4FA 2P8CA 3TTEA 4M0XA 2QQ6A 4KT2A 3UCDA 3MUCA 2QGYA 3B97A 3DFYA 4G7FA 4JHMA 3QLDA 3QPEA 4HCLA 3ZVHB 1MDLA 3JW7A 3GY1A 1E9IA 2P88A 3BOXA 1JCTA 3CK5A 3VA8A 4YWSA 3TJIA 3DFHA 2GGEA 4GYPA 3S5SA 4FP1A 4E8GA 3R0KA 3NFUA 1NU5A 1PDYA 4H83A 3DDMA 2PPGA 3N4EA 3NXLA 2PS2A 5ENLA 1KKRA 3SSZA 3VC6A 4X2PA 3N6HA 1JDFA 2QDEA 5IDZA 3I6TA
chains in the Genus database with same CATH superfamily
1XGEA 1OFAA 1A3HA 3CYVA 3QJAA 3E0IA 1YX1A 3POHA 4JKKA 1W1ZA 1Q6DA 3PUDA 3N25A 4GNJA 2PDNA 4GZJA 3W81A 2FHBA 2ATMA 3GVRA 4YTQA 2EHHA 2IPJA 4M29A 4DZ5A 2QF8A 3FYOA 1LUCA 4UR7A 5CPOA 5CBIA 1EF2A 1LT8A 2W55A 3NQCA 5I3KA 4GNVA 1KQYA 3RM9A 4WZHA 1GEQA 3M0ZA 4IUGA 6ALDA 3N6JA 2BZNA 1W54A 1PV8A 3NG3A 4ACZB 2QJMA 4NEVA 3TTOA 3UNDA 2E25A 8TIMA 2AAAA 3NL6A 3BSMA 5DY3A 2VZVA 1D7YA 4XZWA 4LAUA 5CXPA 1PYMA 2FVLA 1G6CA 3O7UA 4BQ3A 1QNQA 3MTWA 4LALA 3TXVA 3SEPA 3ZQ9A 3GRTA 5CPSA 2MUCA 3DESA 4F0KA 1P1MA 3BCFA 3TV8A 1FHUA 1KXHA 4Y2WA 3N2CA 1E70M 2X1RA 4GE8A 3CQIA 5C7HA 3B3DA 4GI9A 4K38A 4FO4A 1E3XA 3WL0A 1FBAA 2Z1VA 3M6DA 5DCBA 3WN6A 3W6YA 5C2CA 2Z1SA 4IJBA 3UETA 1U5JA 1DL3A 3UJSA 3VD5A 4QG9A 4OE7A 1FFRA 3W2NA 5I3GA 2NQ5A 2CFYA 4LUTB 2QPXA 3L0GA 2FDMA 3DIPA 4MAZA 2ESCA 3EWDA 3B9NA 4I7WA 1JXJA 3JRKA 1G67A 1RLDA 4JEQA 7REQB 5JVLA 1WDDA 3VOHA 4JIHA 1KWKA 3P5ZA 2D3NA 3RGTA 2E8YA 4OUIA 4LOCA 5E1QA 3AYTA 3PP7A 3UZWA 5DEZA 1RQEA 1EXBA 1F73A 3NRZB 4IGNA 3VKBA 1XLKA 3RPMA 3P2VA 3HA1A 1NQKA 4HZ8A 4R5EA 2VR5A 4M6QA 2YAUA 2QVNA 3N9RA 3NQ8A 2NQJA 1UR3M 4ZB0A 3MMDA 3RU6A 3GW3A 1OK6A 2WMFA 4KRZA 1E51A 3W72A 5BYWA 2QIWA 1FA2A 4C6CA 4MKNA 4D6GA 1BYDA 3V0TA 1FWSA 4XVEA 4NAEB 2ATSA 1AW5A 4X3ZA 2JIWA 3ABQA 2B0MA 4GQBA 4QP0A 3W0KA 3N73A 3MHUA 4DNHA 5F2MA 4C6EA 4AYGA 1FO4A 1MEIA 3ZOAA 5HJLA 5BCAA 2ZKMX 2G3NA 1TRDA 4H9XA 3APYA 4JDRA 1DJIA 1GUVA 3TU9A 4BQ5A 4XAPA 2Y24A 4AD4A 5MHBA 1N8IA 4XAFA 5CBJA 4JFWA 4EVZA 3C2OA 4CGTA 5ABEA 3DHUA 2X99A 4ZE5A 1M04A 1QHOA 5LNRA 1DE6A 1SZGA 4AU0A 2GUUA 4IZGA 1Q6EA 1KA9F 5IOBA 2JGQA 1GERA 2FVMA 3GZ3A 3W26A 4OT7A 1S5WA 6REQB 5AZ0A 3NA8A 1US3A 1C8VA 4CQCA 2XGZA 3ZT7A 2OOGA 1GTEA 1UKTA 3W7OA 4MZ8A 1K7EA 3WEOA 2OOFA 2QW5A 3UR8A 1QR7A 1TWIA 1W56A 2PDWA 1UD6A 2YDRA 4KCVA 2J78A 1AUSL 1CXIA 3I3EA 2R9RA 2ZE0A 3V5FA 3NQ2A 2PWUA 3PSWA 4RUBA 4S3AA 5GNYA 1C91A 1ODZA 3DI1A 3TUUA 1J93A 4L61A 3GBEA 4MWAB 4J5NA 4J3UA 4B5XA 2QDDA 1KB3A 3FGCB 4GVHA 1O1HA 1XIJA 3BAIA 3IJ6A 4UMAA 1WQ5A 2E5AA 2CERA 4GGHA 3I7RA 4HQVA 1YXDA 3TW9A 3G2GA 3SR6B 4ERIA 1NF0A 3GHUA 1JPMA 3MZ2A 4H4ZA 2QVHA 4U31A 4O15A 4AZHA 2BTMA 1H7OA 1S5VA 5FS8A 3ENLA 1E0TA 3UWZA 1YTDA 2OEKA 3SY1A 1VEMA 4JQ3A 3COTA 4ZXLA 3UEQA 3BG5A 2A4AA 4DWSD 4GUFA 4V33A 2DY3A 4AIEA 8XIAA 2WMJA 4MVAA 3OLIA 5E5CA 1W2VA 5I02A 4MDOA 5MF5A 2P8CA 4PE8A 2ZX7A 4EMWA 1NHRA 3W1LA 3SCOA 2WNQA 1E73M 5AC6A 1KCKA 3P62A 1QK2A 2PEVA 4W7UA 4CEXC 3S2NA 4FNRA 1UUQA 2Y85A 2V3BA 3OLEA 3CK5A 1EUNA 4XV0A 5U4NA 1S39A 1UR8A 3LADA 3BW4A 4BF5A 3S5SA 1DORA 3D6NA 3DBPA 4Y9AA 5TR3A 1LG2A 2HWGA 4G5DA 1VRDA 5F4WA 1I6NA 5AC5A 4IMFA 1UH3A 2XFYA 3S5ZA 1RLCL 4EQXA 4A2SA 2BOFX 3CV6A 4DM1A 4DJED 1P6CA 4LU0A 1ZX9A 3W1RA 1IIHA 3ZR4A 4J28A 3R07C 4N2YA 4QDWA 4NZ1A 1UW9A 1D3GA 1EOKA 1WBHA 3GVWA 1BTMA 3DYPA 5TF0A 2R91A 3L67A 1ITCA 3CUJA 3GR4A 1VRXA 1XINA 2WMGA 2PLJA 1YNQA 5D9MA 1ZJBA 1RVKA 3BJFA 1SUXA 3QY6A 4OFCA 2VX7A 1OCQA 2GR2A 4JN8A 3CZLA 1OADA 1FWEC 3BMVA 1EGZA 1GQNA 3FLUA 2QT3A 4GYPC 2OYKA 3N14A 4WD0A 4LYPA 1ALDA 3CBWA 3KW3A 4LT9A 2QYGA 3BGJA 1VFSA 1B3XA 4PTNA 3BLKA 3C86A 4AZ6A 3ANYA 2BX7A 4DBWA 1FWJC 2FDSA 2EQ7A 4W93A 4AW7A 5RUBA 3I4EA 3UCCA 1DJZA 1FRBA 2WKGA 3WMCA 2QGHA 3WH7A 4IX2A 3NQ7A 1J0HA 2E0PA 4PB3A 3TTYA 3F5KA 3EEZA 4YJ5A 4D8AA 1UOZA 3QKZA 1M41A 3LS9A 1EP1A 3EDJA 2G3IA 1WA3A 3N2TA 2D2JA 1GJWA 4MB5A 4EM3A 3UP8A 3EANA 2FZDA 1TA3B 1Q6FA 4IGMA 3NS1B 3TN4A 1Y0EA 4E8CA 1SO6A 2G3JA 3AUOA 3RX4A 4QCEA 3LCHA 1G5AA 3F5LA 3SGGA 3E2SA 2J88A 2VCBA 5CBBA 4IM4A 3W38A 5HMDA 3LTPA 1IE7C 3GDRA 1XYBA 3TTSA 4QAIA 1HKIA 1N62C 1XIHA 3BZGA 3ITCA 2YDQA 2VEIA 1E0VA 2HQMA 1O5RA 4NJJA 2GWNA 3OVPA 1SJCA 3MW7A 4ATLA 3GXTA 3GNNA 1MXDA 3R1ZA 2XDFA 4KW2A 4HU8A 1I1WA 2PCQA 4F2TA 3UXKA 1XH1A 2BHUA 5CG0A 3URBA 4URIA 1RJQA 3HG2A 1FP9A 3VDGA 3IAPA 5FEPA 4YU1A 3EWWA 1YE4A 2CZFA 2YZ5A 3F4NA 2WC3A 1CXLA 3EB2A 2ZADA 2VM8A 3BCDA 4DZHA 2C7FA 3GH7A 4AIBA 1UWRA 1TPVA 4R88A 1DJNA 3CZ8A 3T4CA 3VMPA 4UTMA 3CAVA 4PTDA 3TN3A 3VD3A 4BS0A 3LK6A 4QE4A 1E72M 4FK9A 3W01A 5BWAA 3HV8A 1Q8JA 3MP4A 3H2NA 4PSRA 1UH4A 1NFGA 1JVNA 5JXQA 1DQXA 3DBNA 2J8TA 1J8VA 4FNPA 4GVIA 3K8KA 3S9YA 1ZY8A 4FXJA 1FDJA 3ETRB 3LY0A 5A8GA 4M82A 3L4VA 3E0FA 4XX6A 4E6MA 3QFEA 4ERAA 2QUUA 2ZA2A 4JN6A 4CVWA 2Z6JA 2PWEA 1CXFA 4K7YA 1GKRA 4I9JA 2ALRA 1HGYA 4Q4KA 1NSJA 3HGOA 5AN7A 3CT2A 3MC5A 4REQB 1SFTA 3BCJA 3SCRA 1JUKA 4ZTYA 4NSBA 3W7EA 1GCYA 4DAIA 5C9ZA 4AQLA 1HZYA 2IUZA 2ZX9A 3R0DA 4ZFMA 1ZBWA 3Q58A 4I5XA 2WJZA 4GO9A 4MSSA 1OFDA 2AGKA 2J4GA 3R10A 4J4KA 3CJPA 3TA6A 4B4HA 4C5YA 4UXDA 2VHLA 1KN0A 3PBWA 3MS8A 4JL1A 3K5XA 3LZ5A 4BQ4A 4DX3A 2Y6ZA 3B4YA 2NUWA 4NIRA 2ZUUA 1BD0A 4I8YA 4YVPA 2I5IA 2XU2A 4ERGA 1W0MA 3CQHA 4LBRA 5BRPA 4UNLA 3N19B 3LPGA 3WQFA 1TV7A 4ZOCA 4RZ4A 3REQA 3TIMA 3R7MA 3GBDA 1TPDA 4YTTA 4IF2A 1MFUA 3QZAA 4YS1A 2VD8A 4UNIA 1UR4A 1JCNA 1W1IE 3VC5A 3AWNA 3W7IA 2DZTA 1XL9A 1UP2A 3AYSA 1Z8AA 1ONXA 4E8DA 4GKTA 3IJIA 4D1JA 5KSWA 3QYSA 1JZ7A 6A3HA 1SGJA 1XPGA 4PUWA 1Q6LA 4PCFA 1Z32X 4JKLA 1J01A 3R8RA 3ORWA 4KEUA 3VX1A 2OYLA 2Z6IA 3GAYA 4A3HA 4CNTA 1FFQA 1MXGA 2HVNA 1LF1A 3MBFA 4NZCA 3EXTA 9RUBA 5BRBA 1F74A 3NTYA 2X09A 1BFNA 1H2JA 2ISSA 1TPFA 3OZMA 5TD4A 2GJXA 3MCOA 2VEMA 1WX0A 3A3XA 4NRSA 4H4YA 3R89A 5M03A 2R1NA 4R53A 3VIOA 3IIPA 3KTSA 1VENA 1PKYA 1KFJA 2POTA 4M51A 2G0WA 2TAAA 3OEXA 4E38A 1PBGA 5IM51 2W66A 2A3CA 5HR6A 1QBBA 3BLPX 4Q4RA 5I3FA 1Y5WA 3LEPA 2B7PA 1FCUA 3DX5A 1CLXA 4H4XA 4A2RA 3TSMA 1H7RA 4DJDD 2WNZA 1YBQA 5CGQA 4DF2A 2WPFA 1MRQA 3FA5A 4LUYA 3UR2A 1PWLA 1D7FA 4UTTC 1LWHA 3ARYA 1CNVA 3AM9A 3O3RA 4RDYA 3UU0A 5FS9A 1JL8A 4NNAA 7A3HA 2XVGA 2EPOA 2YCLB 3QZ6A 4FR6A 1PX8A 1ICQA 3UZ5A 1UBSA 1NEYA 3KDNA 4CD4A 2P8BA 2WVTA 1BRLB 3AZTA 4MJZA 3ARXA 6PTDA 4XISA 4C6LA 4NAFA 2YW4A 1D3HA 2HCVA 4OVXA 3OG3A 5HUPA 1TR1A 3DI0A 2EQ6A 1B54A 3KZSA 4IP7A 3O2LA 3UW6A 3THQA 4PZVA 3USZA 2DSWA 5HMFA 4Q8VA 3L5MA 1TE1A 1YTKA 3G6MA 3KL5A 3T7VA 2VQTA 3PAOA 3WQ6A 5ABGA 3AI0A 2WBGA 1FWNA 4L64A 3TC3A 1E1CA 1CW2A 2A2IA 4QEHA 4UMBA 1X6UA 4AZ7A 3CXOA 1DV7A 3FXGA 3H4KA 4OWGA 2NWRA 4IFKA 2ZRXA 3MBDA 1X98A 4CQ8A 3F4VA 2VUYA 2PDXA 3PZNA 3LHWA 4US5D 5AHIA 4M52A 1H3GA 2Z24A 5A5WA 2XIMA 5I03A 1DKWA 4E4UA 2J7BA 3WDPP 3WNPA 4UOZA 3SUTA 4GC4A 2ZOXA 4FNTA 2NV9A 1WYIA 2W9MA 1EPXA 1LCOA 1E0WA 3VVGA 2Y70A 4R9XA 3WQ4A 1R7AA 4P5UA 1EIXA 1L2UA 1W5QA 3PZTA 3W07A 2WMIB 3BG9A 4JDBA 4W84A 4JTSA 1P0EA 5A6BD 2Z7KA 4INFA 1SU5A 3QMRA 5CZTA 3EXRA 4D8LA 3SCNA 3L7RA 1UASA 1E0UA 3LM3A 1UJQA 4JBRA 3OU8A 1XWYA 2ZRYA 2FHFA 3WBXA 4K8HA 1KGWA 4LPCA 1VBRA 1PZ2A 3FW6A 3WQEA 3BAYA 2PGWA 4L9XA 2PRHA 1GOQA 4PCPA 1EJXC 4PUMA 4GA8A 4DHGA 3O1NA 4C91A 1QXLA 1RQHA 1BWKA 3TYEA 2X8CA 3P8JA 1RQBA 5HMSA 1IV8A 3EB4A 5EMJA 2JKAA 3WLJA 5FESA 3WEZA 1AJZA 4HSNA 3VD7A 4GVFA 5DCDA 3VNKA 4ZSTA 4JTUA 4BI5A 4QHRA 1F6PA 4UIOA 3TX9A 1ZPTA 4DRSA 3PNUA 4JIPA 1GQKA 4MLRA 3RU8X 4QBXA 5I0DA 2RFGA 4LFYA 4ZQOA 3ID7A 2VC6A 2D1ZA 2FZBA 3VX0A 2JGYA 3B9EA 3UZYA 5PTDA 3OIHA 5FJPA 1YNYA 3BLLA 1PZ3A 3A7UA 4JCMA 1E55A 5G1YA 2WVUA 3H6OA 1QBAA 5AB3A 2RGLA 5A94A 1EA9C 3G1HA 3PG9A 1DNCA 3S9ZA 1CIUA 3DFQA 1LQ2A 2E9LA 4KQNA 5DT5A 4KBXA 2WWDA 2YXXA 2VYOA 3CUGA 5AHNA 1OSEA 1NHSA 4WXYA 3UXIA 4KKXA 2HE8A 2QR6A 3W1AA 1CGYA 2RGMA 3VE9A 1GNXA 4DB7A 1R3VA 5I6SA 1TPUA 3MHGA 3FHAA 4MWAC 4HCDA 3CYJA 3UJEA 4TVDA 3QM3A 4PUKA 2AL2B 3EYPA 2D22A 2GSJA 1VIWA 4S3BA 1AVAA 2SFPA 3FAXA 1D8WA 1KRBC 2BSLA 3LCWA 3S2LA 3M5ZA 4GRTA 2AKZA 1ZL1A 1EKOA 3RJXA 2WP6A 3S6TA 3WKZA 3NURA 5LHFA 3IV8A 4DO6A 4FNQA 2GJRA 3KOXA 2NZLA 1RXOB 2OSYA 1TE6A 2PTYA 4R34A 2I57A 5C54A 3BWWA 2YFOA 4J3VA 3AS2A 1EGMA 2BXVA 3ARSA 5BXTA 3VZZA 1QNPA 1JZ6A 4O1FA 1LUCB 1JDDA 2PDBA 2PP0A 3R4IA 5KINA 2BMBA 4QITA 5CZSA 5HANA 3VYLA 2GZXA 3U7BA 1V5XA 2V2DA 1ZHAA 3G18A 1H60A 5TQLA 1GPWA 2GVGA 2DH3A 1GRFA 1NELA 4YCPA 2Y4SA 4J40A 5FL1A 3TE9A 4F0RA 4QFUA 1E43A 2HNHA 4FXFA 3VM5A 3M5YA 2Z2AA 1ITQA 3LQGA 4PBGA 7XIMA 1PZ1A 3MANA 5JCNA 5K3VA 5FF4A 1RJPA 5KMYA 3S1XA 4MPQA 5FF3A 1BGAA 3DC0A 3TNOA 5I3JA 3CT7A 1JI2A 4AAJA 1CWYA 1OHLA 4RDWA 1OIMA 1UR0A 4U2ZA 1IWBA 2Y7FA 2NV2A 2ZZCA 4UMCA 1Z44A 4AZ5A 4J9JA 3OIXA 5CAKA 3WO8A 2ZZ1A 3GUWA 1V08A 2ZBTA 4I7VA 1VFUA 3TTEA 1JUBA 3M0IA 4O4WA 1UD2A 4AZBA 3MUCA 3DFYA 2GQAA 4ZVJA 5GPRA 2QF7A 3LLFA 2TYSA 2ZZBA 3HMCA 2XFFA 3MMTA 1F4HA 2QZRA 2YL8A 2WSRA 1BG4A 4YWSA 3MKKA 2GGEA 1WZLA 4UOJA 4C6DA 4GYKA 1AQHA 3QHNA 1TV5A 2YCJA 1G4PA 3P61A 4H83A 3NVTA 4NG3A 1JDFA 2ZXDA 3WLQA 3TYAA 4QM1A 1SMAA 4BJHA 4DPPA 4O8RA 1DE5A 3DOPA 2X2YA 3S1WA 2QPSA 1UZHA 4BFAA 1GRTA 1PHWA 5EBUA 1SZNA 3UF9A 3Q37A 1FUYA 2NQLA 2A3HA 4GUIA 3A5FA 1F5ZA 4CU6A 4G2DA 3WMLA 3OZYA 1YLVA 4JTGA 3B9JB 3L66A 3WQPA 1XX1A 4D6IA 1KM4A 3IGXA 4H8VA 4ZQMA 2UY3A 2OFJA 1MQQA 3TWAA 2JE8A 3AZSA 3D3AA 2XUCA 4BK9A 3IIXA 1UD3A 1OJTA 3VILA 4JHZA 2DUAA 4Y9NA 1XQKA 1EYEA 1GT8A 1C29A 3BC9A 4H6QA 2YCEA 3LM7A 3URQA 3B0XA 1ZP4A 1TJ1A 3XIMA 2YA1A 2CZ5A 4OQVA 4WGHA 1FWAC 4KETA 4NRRA 1VD6A 1Z7AA 1XSIA 1EO7A 1QPKA 3OOQA 4TVUA 2RKXA 4IXHA 2DQXA 5FJIA 2D24A 1TKKA 1GVSA 3WQOA 3C52A 2Y7DA 4NVTA 4XTIA 1PCWA 5GVJA 3GIYA 3NUKA 3OBAA 3SZ8A 2WPEA 3H70A 3W84A 1IGWA 5H8PA 1R6WA 4QGCA 4DYEA 3TLQA 1XIEA 4NHVA 4RPQA 2PWGA 4GUHA 4HA1A 5IBXC 3QHOA 5HWJA 4XAZA 3WK0A 3FDKA 3KRBA 3DKLA 2ZRWA 1QI0A 2V5JA 3HQNA 3QR3A 4P8XA 3PJXA 4PMDA 4TO8A 2QCFA 3ZVHA 4LYRA 1EC9A 1E9ZB 3O0KA 2PDLA 1K8ZA 3ABXA 4I7UA 4GZEA 1FFVC 3SCPA 4GIEA 3HQPA 4O57A 3G3MA 1CX9A 1F3XA 1WDPA 1PHQA 3B06A 3NGFA 5FJOA 2O55A 3BLIA 2EG7A 4UFLA 1OIFA 4NU7A 3WUBA 1AD1A 3PULA 3VIJA 4HCHA 3LTYA 1O5XA 4FOKA 4M7TA 3CB3A 3O6YX 4O0QA 4Z0JA 4B2DA 4W8AA 3H53A 5LGZA 3GKAA 1GOOA 2VFEA 2AL1A 2YLAA 3O9NA 1FWRA 1Q6OA 3WIJA 2BVTA 5DRCA 3CWNA 7TIMA 4LNCA 4QISA 1MWOA 3AYRA 3QV7A 3GKFA 4QS5A 2EJ1A 4WKFA 1OJXA 5EMYA 2A21A 5HQEA 3TN5A 1R38A 2AMGA 2DEPA 2YA2A 3RRAA 1XH0A 3FFSA 5BU6A 3H2CA 4XBKA 3NVWB 4X22A 2PDFA 4ROQA 1DYSA 3WJWA 3S47A 2VUNA 4WOQA 4N4QA 3PZOA 5DANA 3A64A 2OQYA 1ME8A 3IGUA 4ILSA 3V3WA 2DJXA 2PU1A 5E6ZA 3K13A 1RP9A 1PL9A 4N9BA 2W0UA 1NDWA 5AZ1A 4Q33A 4EQRA 3W4RA 4O0KA 2JKEA 2BGSA 4WKHA 3GFXA 5CC3A 1QOQA 5KZ6A 2Z0IA 3PBGA 2OTDA 3EOOA 4DNMA 3PF3A 3H26A 3ERPA 4PC8A 3GS6A 3M5XA 4QJ3B 1GVOA 1UIPA 5U25A 4XZMX 1HFBA 5A6TC 4TX8A 2HBVA 4P7OA 3U5UA 1SQ7A 3G1XA 1J0ZA 1PIGA 3QQWA 1SZEA 2E1DA 5AHEA 3DFTA 1WDSA 4A8RA 1DP0A 3CHCA 1TPEA 3LTSA 3MYOA 3SGZA 1X1ZA 2GOKA 2QULA 5I77A 1WZMA 3QBUA 1XGDA 4GWEA 5HA7A 2GFTA 4L7ZA 4GKLA 4PODA 4K37A 1QWGA 1AJ2A 4MWAD 3I3DA 2VC9A 3GG0A 4FPSA 3VDCA 5LKYA 4IISA 2YJQA 1KD0A 4JTFA 1XYFA 3PZ9A 3RPDA 4H6KA 5AHLA 5A2AA 5DRIA 1N8WA 2BXZA 3R43A 3FEQA 3W86A 3CAQA 1QRQA 2P1FA 2Y5EA 2TPSA 3P0WA 1TREA 4ML9A 4C1LA 3B8WA 1RD5A 1HN1A 1EJSC 2WNWA 3RCYA 1KRAC 4W7VA 4WRHA 1H7NA 5HPOA 4RDVA 4GRSA 5FAGA 2VDHA 5G4WA 2XGBA 3SCWA 4QNEA 1M01A 2BGQA 2ISFA 3FX4A 2ZQ0A 1XLDA 1EZ2A 4BHYA 1XLGA 4GH1A 1PAMA 4XZIA 3ZYZA 4W5ZA 3L65A 2DP3A 1EJVC 4A35A 2JF7A 4Q4MA 3WQ5A 1OWQA 4QJ5B 2V5KA 5T91A 1LBMA 2ZVIA 4B9ZA 3O16A 3NXFA 4CQDA 3IUIA 5T9CE 2VT0A 3GDLA 2UY5A 3C56A 3DK9A 4O17A 2ZUTA 1GKQA 1H7WA 3TMQA 2YVGA 5E0KA 2V68A 4MB4A 2IKJA 3K46A 3SJNA 2GK1B 1LOSA 2FJUB 4JOMA 2X0YA 5EYWA 1GORA 4JTAA 1K7XA 2ACQA 2QLYA 1X7FA 5LIWX 1KLYA 1ZENA 1GW1A 1V0LA 4GIAA 1U5HA 4HCLA 2GR0A 2GQ9A 4KIRA 1H11A 2P88A 3K8MA 2DSZA 4KWOA 4YYFA 1M03A 2J25A 3EDFA 3GXIA 5HWMA 1E9LA 1ZJAA 1NU5A 1KBBA 1PDYA 3A4JA 5LIYX 3DDMA 2BY0A 4R7OA 1XBXA 4QDMA 4GX8A 3SSZA 4QS6A 3ATYA 2E8ZA 2O7QA 1JFHA 3I6TA 5EY5A 2O0TA 1XM3A 5I5RA 2VC7A 3WUGA 2VR2A 4BI7A 3ONCA 1JCXA 1HL9A 3HM7A 4OKDA 3SUUA 2H6RA 3DHDA 2EQ9A 3KM8A 2WSQA 3IJ8A 1SJAA 3GFZA 2XVNA 5I09A 2IPGA 2HMCA 5DLCA 3EEGA 1GJUA 4DIAA 5JCMA 3GDMA 4CQ9A 2YBVA 3N04A 4JHOA 1FWGC 3PJWA 4UQCA 4F48A 2BXYA 3FJ6A 3CS2A 1T7LA 5L6UA 3EKGA 3V35A 2V3GA 4ZOEA 1PTAA 3QW3A 5AVNA 2FQIA 3FKKA 4JIEA 4RV8A 2FPVA 4UC5A 3V36A 1F8IA 3OVGA 4Y7EA 1XYMA 1EC7A 3PB2A 1N5XA 2CWNA 2GVEA 3E2RA 2BY2A 1TX0A 4Z2JA 5LNSA 4GJJA 1MEHA 1ZMDA 1IR2A 5CPMA 1ISZA 3HURA 2IXVA 3AMGA 4J3WA 1TV3A 4D1IA 5A2CA 4QIUA 5BXRA 2WLYA 5CAHA 3EX4A 1WUEA 4ADUA 3URAA 3MI3A 4FF7A 5DN1A 3V1PA 5EGRA 1NAL1 4GY7A 1E9YB 1TWSA 2WOWA 5BNKA 4BA0A 3HV9A 3FSUA 5G4EA 1U83A 4UZSA 3TW6A 2XM1A 2ZFAA 1W1TA 2ZDRA 5D4YA 4DNAA 3WDQA 3ZLGA 1WKDA 3TLLA 2FGLA 2I56A 5H2ZA 1LWIA 3M07A 3N34A 1Z42A 4M6VA 2MNRA 3K4DA 1AD4A 5FF7A 2ZX5A 3BPWA 1R2RA 3S83A 2JBMA 1O68A 1VEPA 4GZ7A 4DBDA 2BASA 1NOUA 4B4FA 2V38A 5CSRA 4V1YA 3W1UA 3EDKA 3TTQA 2VZTA 4HZMA 1CXHA 1XIIA 1BYCA 5A6MA 4GG9A 4PN2A 2IPWA 1W3IA 3T0TA 1L6SA 3JS3A 4S3FA 4LNYA 1B4KA 1TYGA 4UFJA 3WNKA 1JQXA 3WD0A 4NJIA 2GRTA 3VNDA 4O4VA 3W9ZA 3OZPA 1OD8A 3H7UA 3G0SA 3CGEA 2WM0A 3TMLA 3H21A 4ZCWA 1W5MA 1KCXA 2NVAA 3ELFA 3NSXA 3EKLA 4ICCX 3VNJA 3MDWA 3W3OA 3DAQA 3TAKA 5H91A 4MY1A 1VYRA 3SCQA 3WDRA 3ZJ8A 3CUXA 3QYQA 5EMLA 4IMAA 3HRDC 2GJXB 1R2SA 3R79A 1W1PA 5G5GB 3IS4A 3E96A 4ZA0A 1CB7B 4CD6A 2Y5SA 1XSKA 4UR9A 1E6XM 2CCRA 2PZ0A 1DHKA 1E1FA 1B3YA 2ZTJA 3WF2A 2GSHA 3Q4DA 4LA1A 4DUVA 3PS7A 4ICMA 3Q65A 1XLHA 3ITGA 1ADSA 5A6LA 5H1WA 1U22A 1VJSA 1YBQB 3WMSA 3DG7A 4DWSA 3GNOA 5FL0A 1PJ9A 3ATZA 2ALDA 3UPWA 4WJXA 3U9IA 3WX7A 9XIMA 2HK0A 1PUDA 4GZIA 1EQCA 1WPCA 2ABBA 4WJ8A 1F3PA 1VQTA 1J2WA 3B0VC 1J11A 4IIFA 5ABFA 3EZ4A 4FF5A 1ONFA 4NAFB 4GACA 2X0HA 5AC8A 2BP1A 3DECA 1ZCCA 1L8PA 1LL6A 1TUXA 3CV1A 5HQLA 1NWSA 4LCRA 3FEMA 2OX1A 4HKPA 3OBEA 5A1AA 4ZB5A 1KO0A 2Y89A 3M4HA 3LI0A 2OODA 2XTKA 4P8VA 5HNUA 4Q8QA 3OHIA 1FECA 1IHIA 1QPOA 4W88A 2E3TA 4X61A 1DHPA 1ZQ5A 4TXEA 5C9XA 4HHLA 4KERA 1BZLA 1WE5A 2C15A 4IT1A 1LOLA 1RPXA 2NQHA 1E71M 2P50A 5XIAA 1OYCA 3WBAA 3UWYA 1NP2A 2YGYA 3CIXA 3W1QA 1W1B1 1RCOB 1F8MA 4Y9PA 1E6RA 3T8QA 4H4IA 4C7DA 3AAMA 4D9PA 3EPOA 2PRLA 5FD0A 1JROA 4CNPA 3C0LA 3WLIA 1UUOA 1B5TA 2O9RA 3DEQA 3U8GA 3VMNA 3TEVA 1L6YA 3DUGA 5CSYA 2VQUA 1HX0A 3FS2A 2CDUA 4DEFA 2ADAA 3RITA 4LB3A 5I3IA 2KAUC 1EA0A 3VKAA 4QAWA 2WKJA 1TPH1 4NX0A 3S46A 1XBVA 3BXWA 3C3NA 2OO6A 2Z7GA 2V5BA 3CC1A 5FF2A 1Q5MA 2DZAA 3SR7A 1Y65A 4KT2A 1TQJA 3EGJA 2X1UA 4PMUA 3ALFA 2VRQA 3URHA 1B90A 3AMZA 3TZNA 4X0NA 4AZCB 3AIBA 3TQ0A 1UZDA 2PWHA 4IOTA 2PBGA 4EWND 3PTDA 3TN6A 2DZUA 1P6BA 3P14A 2Z1XA 3NFUA 4ZQPA 4WXZA 2W79A 4LH8A 4B9YA 1JAEA 3NXLA 5EKYA 3SO7A 5FS6A 2QDEA 5B7YA 4BI6A 3CHDA 2KZHA 4GXMA 2GH5A 1KM2A 1SVDA 3NL3A 3C6CA 3QC0A 1FDZA 2QMKA 2PD9A 1E5JA 4NXSA 1JZ3A 1K8YA 2QXWA 4JIQA 3TP4A 3NL5A 2OLAA 4A22A 3N4AA 1EOMA 4IIHA 2XSBA 3BH4A 4D6HA 2AQWA 5AKQA 1JI1A 1BQCA 2PB1A 1JCJA 2P3ZA 4KWSA 2BGNE 2J66A 1JYXA 4NZJA 1OD0A 4AF0A 1BWVA 3KVJA 3LDVA 5CLTA 1RBLA 1D8CA 1H63A 4JQ1A 4AMAA 4AEFA 3WF1A 4RXFA 3ZJ6A 4H2HA 2CKSA 1PCKA 3KL3A 2VVNA 3IRSA 1QASA 3LD5A 1KFLA 1QMLA 1CGXA 1J9YA 3A4AA 3KVKA 4YXGA 2HISA 4S3GA 4ZOBA 3P67A 1DPMA 3AIRA 1Q1RA 3L8KA 4LX4A 2GDUA 3P82A 5E6YA 5BXSA 1A5OC 4S3JA 4Y6GA 4GI4A 1XBZA 4GJIA 3AISA 3BMXA 4QLLA 1LLOA 4X9YA 2P10A 1ZBVA 1VLIA 1GHRA 1CBGA 3CASA 4AD3A 4YVXA 2VMFA 2HVMA 3BICA 1EWEA 3W6MA 1VFHA 1Q3NA 1DIDA 1EX1A 4AD1A 2NLYA 1H62A 3ISIX 5DMLA 2XJ7A 5D2YA 1LJYA 2X1IA 3N2XA 3IC9A 4ZEPA 4ZO9A 2Y5JA 9XIAA 1CXEA 4A3YA 4GXWA 3NQFA 2C3DA 1RA0A 3AMKA 3L12A 3NZGA 1TCMA 4F0HA 1FHDA 4N9EA 3ES7A 1LLZA 1FOBA 4PTWA 4F8XA 4YPJA 4AIUA 4JX6A 2FH8A 1W5OA 5FEWA 3CPUA 2PURA 2XIIA 1IGSA 4EAYA 3QGVA 4JYFA 2WQPA 3B8UA 3GTIA 1YYAA 3DGZA 5A6KA 1D2KA 1P1XA 6TIMA 1ONRA 1SFSA 3BLFA 3T07A 2BODX 3CQJA 2A5HA 2VXNA 3PPHA 2ZUVA 1TTJA 1W3HA 1H41A 4JQ2A 1R3TA 3TROA 3G0XA 1BF6A 2WWCA 1XDIA 2WZIA 2ON3A 3WQ8A 5CLWA 5LIKX 1R7OA 2ZDSA 1H7XA 3RDKA 4AIOA 2PI6A 2VX6A 3I6EA 2Z00A 4JDYA 4D6FA 2QKFA 2XSXA 5CZJA 3VFCA 1XYZA 2QUMA 2PUZA 4NZ5A 4IUOA 3VABA 4Z2IA 2R82A 4YL2A 1VBHA 1E3ZA 3IRDA 1R9ZA 2P0OA 2FVKA 1W9BM 1XDJA 1VBUA 1JF5A 2Z27A 4H41A 5AVHA 3PBYA 1R3RA 3KHDA 1PKMA 3SAZA 1NY1A 3WLSA 3KVMA 1A5KC 3UWEA 4B16A 1HL8A 2AKMA 1ME9A 4JPGA 3F1QA 4H9TA 1FHVA 2V5LA 3E74A 4HBKA 2GQ8A 3EA2A 5D9NA 1OFRA 1EBDA 2VWSA 1IT8A 3B04A 1SFJA 4HPGA 1KXTA 4O19A 1TRIA 4WSKA 3MVIA 3CM4A 2J47A 4DUXA 3SIMA 3NQBA 4HHMA 4HNTA 1QJWA 3FA4A 2GUYA 2HXTA 4D8ZA 2V63A 2YR1A 5C9UA 5KZMA 4N42A 3L21A 3LNMA 1OABA 3G22A 4F0LA 7PTDA 2VEFA 5GQBA 3ZWSA 3M0JA 1HKWA 3KAOA 3KLJA 3BTNA 2G41A 4D6CA 1ENUA 1XQLA 3U2ZA 3QR1A 2EPMX 3AXXA 3LQLA 3VGHA 2E09A 4HOXA 1N8FA 2V9DA 2PTXA 1IWPA 1A4MA 2E67A 5G2HA 1EYWA 2OWXA 2J8FA 3L68A 2HS8A 4HMCA 3DENA 3RCNA 3IUDA 4YHEA 3S5OA 3NZ1A 2W54A 3UYCA 4Q6JA 3SADA 1NFBA 3KLLA 3TYZA 4ZO6A 5H8MA 3N9SA 2FB3A 3CO4A 3ALGA 3G8RA 5F1UA 3WBEA 1VPYA 3VGDA 1XJBA 3STPA 3LX9A 5JCLA 4AC7C 1ICPA 3EX3A 2QEZA 3W53A 1AK5A 4TU1A 4Z1DA 5FOOA 4XD3A 1HVXA 2ZZ0A 3DN5A 3FYYA 4P8UA 1O6IA 2VDIA 1HVQA 4DM2A 3KBJA 3IVSA 3CEPA 4N6FA 4GC3A 1ZJIA 1AH4A 4DLFA 5TNVA 2J62A 3ZT6A 3GRSA 3Q94A 2FZ8A 3MI2A 4QCFA 4US5A 3ZVHB 1S2AA 2QJHA 4HIBA 1TYTA 3FXYA 3TR2A 3TJIA 5E70A 3C8FA 1QUMA 3S1VA 1GRAA 4U10A 4GYPA 4EPEC 1PIFA 3LHTA 1E6QM 3GK0A 2CXEA 5LSMA 4X9SA 4LANA 4CCZA 5G4HC 2XG9A 1X96A 3PZUA 1OFQA 2W67A 3EF6A 3WENA 4K8GA 3RLGA 4DJFC 2NX3A 4LY4A 4MTVA 1GOWA 4QR6A 4N9DA 3BL3A 3H54A 4AVOA 5A6BA 1DJYA 1KGUA 2OSXA 3DG6A 3FIGA 3CAWA 5M17A 1UBPC 2EEXA 2ZCGA 1SO3A 4XBSA 2NUYA 3W73A 1TFVA 2V67A 2J7DA 1QAPA 3K30A 1IZJA 1WB0A 2WHMA 4YTSA 4K36A 5HJYA 1QNSA 1TV4A 1RK5A 5KTLA 3ZJKA 1XYAA 1UD5A 3SFWA 4AXKA 1LBLA 2PGFA 1UUMA 2V0TA 4K39A 3VOJA 3F2CA 4U5KA 3WNLA 3B0PA 3W2MA 3VIPA 1K4GA 4RZ5A 3M6YA 4GQQA 1A47A 1Z89A 4P8WA 5HULA 3U7VA 4PYSA 2GR3A 4L9ZA 3Q45A 4KF1A 3FVMA 4DYKA 1H1ZA 2C91A 5LIUX 1C3FA 2VOTA 6TAAA 5C9RA 1JPKA 4U33A 1UC5A 2EJAA 3BVJA 5HWNA 2GGIA 1HJVA 4ZB2A 4DO7A 4HOWA 4N6EA 1K02A 1H7PA 3W2JA 3ANVA 1GV4A 3KBWA 3U3HA 1WXYA 2XYLA 2A7PA 4ZOAA 4RE0A 2FJKA 3CUZA 3N2MA 3LERA 2C0HA 4LC8A 4J35A 3B4UA 3L5LA 1Y8BA 1W3NA 1G9HA 4A6GA 2C13A 1Q6QA 2XVPA 1FWTA 1Q45A 2WSPA 3UGRA 4FHAA 2PGEA 1L8NA 3KS5A 3WMBA 4AH7A 3P84A 4FNSA 3QEZA 2X05A 3O06A 2GJNA 1FEAA 3WELA 3CPRA 5K4XA 1JDAA 4AWTA 1SSGA 2XIQA 5BW6A 2E9MA 4MAVA 4F0MA 3HQOA 4GH3A 3EOEA 3QQ0A 4Y9MA 1ZJHA 2HDJA 5C2XA 2F6UA 3LG3A 3AS0A 5AHMA 3WLNA 5DQPA 4NF7A 4KFOA 3KCLA 1FWFC 1W3JA 1JJKA 2WC4A 4Z1YA 3U6WA 4F3HA 5A8PA 1MVYA 2NLIA 2X50A 3W25A 3NSMA 1KBLA 1S2CA 4KCUA 1K3UA 4JTKA 2NW0A 4PTXA 3P0XA 4D6DA 1RBAA 3RLHA 3QW4B 3E5BA 2PRMA 4Z2KA 4YWIA 3VUPA 2A0NA 1SW0A 1C92A 1H61A 2PC4A 3BLEA 5FJJA 3V5OA 3PBUA 3EWCA 4NJGA 1K6WA 2QUTA 1DVJA 1MEWA 3HTWA 1JEHA 3DYOA 5AC4A 3WBWA 1Y5XA 3GG7A 1UQZA 4HB7A 1GOXA 4U2YA 2GPTA 5HJXA 4X63A 2PF8A 3QHMA 3R12A 4B3KA 3CH0A 1YXYA 4AC1X 1A50A 1PTDA 4H4VA 1E0XA 3CPGA 3UNTA 2DIJA 3VIHA 5FA5A 3NO5A 2V2CA 4GYFA 2B4GA 4LV9A 1UP0A 4UZUA 4GY0A 5E0CA 3VZXA 5ABTA 4AHPA 1JULA 3PPGA 4ROPA 1LBFA 2CBVA 1ZRQA 3UESA 3BOFA 2PD5A 1K4QA 4NX5A 4H6RA 3OLGA 1Q66A 2HTMA 1RALA 1ZXIC 3P7YA 2O4QA 3NM3A 3D46A 4W85A 3FY1A 3NVZB 1C93A 4Z2LA 1R3QA 4CU8A 3A12A 3BW2A 3PWGA 2W0HA 1QW8A 1AMKA 4IMDA 3AUJA 3P74A 2AGTA 4GOAA 1FDYA 5AY7A 4PMJA 4JX4A 2YCKX 2RUSA 3TKFA 3ITLA 2Q8LA 1A3WA 2XIBA 2XZ9A 2YIHA 3LLDA 4OOZA 3V1HA 4L1WA 4IL0A 4UQEA 3HBLA 4HMEA 2Y62A 5CKSA 4MZYA 2D2GA 3UJ2A 1J6PA 2A3EA 3W7LA 4TUFA 3T55A 1UQYA 4DO5A 2XSAA 5DMYA 3T78A 4RNFA 4FIRA 4QSFA 1SR0A 2J79A 4MFEA 4LIIA 1FTXA 3BOLA 3HPFA 2PLKA 3IJDA 1VDVA 3WD1A 3LXBA 2PDMA 4X0VA 3WLHA 5T9BG 5JCKA 3B8SA 4MFDA 1TIMA 3U2EA 3AIUA 4TR9A 5CSSA 4W9TA 5JQ9A 2ZRVA 2YA0A 2FPTA 3MUAA 1M1BA 4Q8UA 2OVLA 1L2QA 2XN1A 3PY2A 1XCFA 1XICA 1F6YA 1BLIA 2C71A 4R33A 3MUIA 3DC8A 4LEQA 3LYEA 1RVGA 2ABAA 5TAOA 4UFHA 3H4GA 1ZSXA 1P0NA 4Q32A 3JUGA 5JH1A 1CYGA 4K8EA 4P7RA 2NVKX 1HKVA 3TCEA 4EK7A 4ORIA 3VD9A 3S2JA 3NZPA 3VKKA 5EPDA 1KGXA 1MMFA 3R8GA 3MCNA 1TPC1 5G1TA 1XIFA 2OGJA 1GREA 3RILA 4GINA 3H2MA 1OT2A 2YL5A 1G1YA 2DQWA 2C18A 2BOEX 3LLXA 3OYZA 2FTWA 2O9PA 4LYKA 3OVRA 1PKNA 2PE4A 3GFYA 2CLOA 3UVIA 2WV8A 4CU7A 2YXGA 4LUTA 3W6LA 1K9EA 3CTLA 2YDAA 3W7RA 4PUUA 3H2FA 2PGRA 3DH7A 1R3YA 1JCYA 3LXAA 3QZEA 4O1BA 3QOMA 3QFAA 2QCDA 2OX4A 2CZVA 1W32A 1HJWA 1MXSA 4JTEA 4DPQA 2HE5A 1EGVA 1Q1WA 1YPIA 3WL1A 3V18A 2BOGX 1Z69A 2OXNA 1GYNA 1CLKA 1OC7A 1X2GA 2YFNA 3W22A 2O4MA 1EDQA 1V3IA 1V3JA 1X1NA 3W7JA 4IHCA 1G4TA 1N55A 4DJFD 3WFZA 4E2OA 1VKFA 3M41A 3KP1A 2VZOA 4IMCA 1LZOA 3CIWA 2VCAA 3VCNA 1WZKA 3OG2A 4G56A 3RFAA 4A8IA 1ICSA 3MJYA 1BVNP 3A7AA 2A7NA 4NAEA 4C6JA 1JRCA 1XHCA 2QCLA 4MHBA 3AMCA 3KOWA 3S8HA 1KCZA 2DIKA 1Q85A 1RH9A 2VWTA 4WK9A 2CHRA 1TJ0A 2VFDA 3GNPA 4Z1AA 2X41A 2CIPA 4DXXA 4CCCA 1YDNA 1S2TA 6ENLA 3M46A 4MIMA 4MOZA 3BGGA 2R8WA 5HPCA 3W7KA 1LOQA 3WK3A 2XZ7A 2J77A 1GVRA 3A47A 1AL7A 4I9TA 3G6LA 5IXEA 4DWSB 4XKMA 3P81A 1N5WC 3PC0A 1I2RA 4IJCA 4DF1A 3WQWA 4WCJA 5FSDC 3KWSA 4AX7A 4R27A 2Y8VA 1JCMP 3NCOA 2EG8A 3RM4A 1QPNA 1ECQA 1O7AA 3NDOA 4PTVA 1NM9A 2ISDA 5ABFB 2QDGA 1ITUA 1OX4B 2VC5A 1BAGA 3CZGA 4AMCA 1MI3A 2PDUA 2E5BA 4PMRA 1H5YA 1DTNA 2I1OA 1XANA 3RYSA 3QPZA 3TONA 1OYBA 4MGGA 1BWCA 3TQKA 1NHPA 4E0CA 2XWDA 2W92A 2YLLA 5K9CA 1UR2A 3EXSA 2VFIA 2ZUSA 1XLEA 2G3MA 2GVJA 3PTKA 4PA8A 3LGDA 4ZO7A 4ATWA 2J7CA 3THDA 4ENLA 1RPKA 4MWAA 3FGCA 4XKYA 4LAZA 3GYEA 1JUEA 2NSXA 3W1PA 2RDUA 2IKIA 4AX6A 3S5YA 1TTQA 4O50A 2ZRUA 3M5VA 1TV8A 1XDMA 3AOFA 4J3XA 3RMEA 4E3TA 5CEWA 5CPLA 1HP5A 1FH9A 3FJLA 3W02A 1S5TA 5AYBA 1GSNA 4Y9OA 4LV4A 5I07A 4IGSA 4JYEA 2W3SA 5AHFA 4RE2A 3R2GA 3QFBA 3WUEA 3B8DA 1EEPA 3B8IA 3MPGA 2KX9A 2OO0A 1KFCA 1JG9A 2W91A 3ANUA 2P53A 4QTGA 2ZX8A 3N15A 4MZ1A 3FN9A 2CESA 1FEBA 1HO4A 4S39A 3AMLA 2REQA 3AIVA 1EJRC 1ZGDA 2WJDA 4MDPA 3C4UA 3K1DA 2YBUA 3ZLFA 3RX3A 4Q7BA 4DJDC 2OQHA 3BE7A 1KXQA 3GDKA 4HHHA 3TOYA 2I9UA 3BAKA 1UD8A 5A6AA 1XC4A 2NVCA 2V3AA 1WOAA 3W7QA 5GNZA 2BVDA 3ABSA 2E9BA 2DZBA 3BGAA 3K4AA 3KX6A 4BWLC 1TVLA 4UFMA 2RDWA 2FTPA 2D2HA 3HJEA 2G3FA 5B7ZA 3L5OA 2INEA 3SFKA 4O54A 1M6IA 2WM1A 3IANA 3QGAC 1QATA 4EF8A 2QDHA 1O94A 2E68A 3R0UA 3FJNA 2EPKX 1XIMA 3R11A 1S7MA 5FMHA 4TVCA 3OVQA 4H6EA 4W8BA 4PMZA 1WBJA 4XB3A 1GQJA 1I2OA 3VOIA 1OBAA 1WCGA 2CBIA 1EWDA 3THCA 1PZ0A 2I17A 4HHPA 1J0IA 4IIDA 3TYUA 1QDSA 3LENA 1QW7A 1F6KA 5DX7A 4K1WA 4D71A 2ZZ2A 1ELSA 4S38A 3KP0A 1JCLA 2BHYA 5KVIA 1VH7A 3NWRA 2FMOA 3M0HA 2WBAA 1VEOA 5AYZA 3U2CA 3GH4A 2YB1A 4GCXA 1O4UA 4L9YA 2D2OA 2VFGA 1FKXA 1PSCA 4HU0A 1ITXA 1OF6A 4FSAA 3W1TA 4K8DA 4FR1A 1F05A 3ITXA 1HJUA 1HKKA 3T2OA 1A5LC 1HTIA 1DJGA 3FG2P 3U2OA 2JALA 2XFRA 1KBIA 3CHVA 4HD5A 1TG7A 3O6CA 2Z2BA 5CGMA 2E7FA 2B7NA 1BYAA 1IIGA 1RUSA 4E4FA 1ZAJA 4UCGA 1Q4WA 2V6OA 3GM8A 5FI8A 1XKJA 2CWXA 3EWYA 4I5RA 3E9AA 3R6IA 1MOKA 4G7FA 2W6RA 3L23A 1VHCA 1J4EA 3QR0A 3HMJG 1TA3A 1X39A 3GVGA 2VX4A 4H4QA 1JCTA 3CQ0A 1UMLA 3S2MA 1FWIC 4CNOA 1US2A 1C90A 3U57A 4F40A 5TBOA 4QEEA 3A7RA 2WVVB 4Q8TA 1XW8A 1O5QA 3ZJ7A 1VB9A 1JDCA 3MV01 3J7HA 2C19A 4OV4A 1POJA 3NEHA 1IEIA 2EKGA 4KGLA 1XP3A 1J5SA 4L4OA 5DELA 4C6OA 1UD4A 3JU2A 2FFIA 3VK5A 3P5YA 3MMUA 3PJUA 2NXIA 1DWIM 2PTDA 1P0KA 4Q4SA 3VGBA 1R87A 1XCXA 1F3TA 3H12A 2QCEA 4O11A 1B3VA 2WZTA 3TOPA 4KRTA 2OZTA 3MZNA 3B40A 3UERA 1I9CB 2HPMA 1OCBA 2J75A 3BJSA 3P93A 5LNUA 2PFHA 3BLDA 4I9AA 3ABOA 2L5HA 3RO8A 1H51A 5AECA 1LLWA 4TVYA 4N02A 3CLMA 5T26A 2I14A 3NJ3A 1SJBA 2CITA 2FMNA 2QCMA 2J9XA 3E49A 3GXPA 3TH6A 2IQDA 3V16A 1DWFM 4Z2HA 3VIKA 1M7PA 1XUUA 4LQ1A 5LXXA 3GD6A 4GX9A 5I2UA 5C7VA 3UG3A 2CLKA 2VEPA 1DWAM 4JTQA 3VD4A 1CPUA 4TTGA 3W37A 3QY7A 4IIGA 1O60A 4MB3A 4MYXA 3HG3A 1CTNA 3MV11 2NX1A 1RY8A 4RXGA 3PPCA 1P48A 4TV6A 3OA5A 1V6VA 1QO2A 4YYCA 5FCZA 1DQUA 6XIMA 1X6LA 4IJRA 1EC8A 1OFBA 3T0DA 1QI3A 1YPFA 4RL3A 4NYUA 1NWTA 4O1EA 4FX6M 3GU9A 2YXOA 4ZODA 4EXAA 1BTCA 3BV7A 1K6AA 2F61A 1ZBCA 1A0EA 4J2PA 1XGZA 1YDYA 2PP1A 2BVWA 3DHFA 2C16A 3B0UX 4GNKB 3KUMA 3ARQA 3R5EA 3EOSA 3E3HA 1U1UA 3FKRA 1K9TA 1KC7A 1W1VA 2WVSA 5ER0A 1E56A 1US0A 1ONEA 3GZAA 5C70A 1UZ4A 2VZUA 3EWUA 3KBMA 2V82A 3LSCA 3HF3A 1QHZA 3SBFA 4PULA 3DH9A 3MVTA 5F4SA 5F2GA 4GI8A 2GQ3A 3B8VA 4JQAA 1ZUAX 4QXIA 5JUVA 2JEPA 1W2PA 1PVNA 1OC5A 3DKJA 3L0KA 4H2CA 4PRWA 4FEZA 4KPLA 4HU4A 3OGVA 4IFRA 4C6FA 3NPUA 4XBJA 3N2BA 3KTXA 4Z08A 1GRBA 4QDPA 2Y8UA 4V1XA 3GC2A 3G24A 3TVAA 4W86A 4IP4A 4C6BA 2C1GA 5GJMA 1NOFA 1XV8A 2WAGA 3UWUA 4ZGYA 1T0OA 1HL2A 4GVGA 3D5HA 1EF3A 4L5ZA 5HNNA 3OQ8A 4P7LA 5CZ0A 3LBOA 2BS9A 3RLVA 3S2CA 4J27A 2INZA 3HOJA 4J56A 2R9ZA 4O8AA 2IXUA 3WLMA 1JRBA 1X8CA 2CZEA 4CNNA 1MW3A 4Z0SA 3WQDA 2VX5A 1XLCA 3HU7A 3EPMA 4AB4A 2PODA 4NI3A 4LS2A 1V51A 2DJLA 2WMHA 2A3AA 4ZENA 3OQEA 1EHNA 2I7GA 3E0VA 1I1XA 2TPRA 3Q6JA 4AYSA 4NNBA 1IWAA 4H9UA 4KWUA 1U5VA 1DWGM 1Q2SA 4RJEA 3LV5A 4JIRA 4XIMA 1GVIA 3ITOA 4LRTA 4JFUA 4PCTA 4XO7A 3WD2A 5I3HA 3CH9A 1SB3B 1VPXA 2YBTA 1UJPA 3WK2A 3C2VA 5D03A 3A4WA 5A8MA 2A7RA 3G1FA 1KM5A 1S2WA 2PF0A 4YHGA 1ODUA 1QFEA 4GY1A 3WNMA 4JD4A 4YTUA 3KOYA 1OG0A 1VFFA 1V03A 3II4A 1NTHA 2YCLA 4M5PA 1WDWA 1W91A 4DVOA 4HPNA 5FACA 1EIBA 4C6PA 3W74A 5D2VA 4AWUA 1GQLA 1EHAA 1PO9A 1DIKA 2Q01A 1UCWA 1Q2RA 4GQ0A 5FJUA 3UWWA 2V3EA 2DVUA 1W3LA 4H7ZA 4KEMA 4XZ9A 3IVUA 1GVQA 4RR4A 4JS3A 3T05A 3BJTA 4GBUA 3LRMA 3BLOA 2O92A 2EPNA 3IPWA 4R85A 5KZDA 1XDLA 1PWMA 2X1SA 1ZU8A 5G2IA 1DJQA 2OPJA 3BQ6A 4EAMA 3GIQA 1AQ0A 3A24A 3T40A 2VDGA 2OWCA 1V59A 5AYYA 1M53A 2V8ZA 3RF9A 4JTHA 3FA3A 4CD7A 3II1A 4HK7A 1L9WA 4EXQA 4O12A 2DT2A 3C0QA 1K77A 1UC4A 2WANA 3SRKA 2VVSA 4M0XA 1TJPA 1LM1A 1U33A 1N63C 1TWZA 1VR6A 4PMNA 4TX9A 3SIZA 4QE5A 5HNTA 2OELA 2WMIA 3VAVA 4BCEA 4KH2A 5D38A 4OBRA 4XVDA 1GVYA 1THFD 4V15A 1YMYA 3SUWA 1L0PA 1R85A 3EX1A 4C6MA 5JCIA 3SRDA 4F2BA 1EPVA 3KBSA 1R5YA 3LPOA 1EH9A 4CN1A 2EQ8A 2Z28A 1OYAA 2C14A 1UKSA 4IPLA 1V7AA 3AIEA 4BR1A 3CGBA 5GRTA 3WF4A 4UCFA 1DJHA 1N82A 1RCXB 4FX8A 4A4AA 1M7XA 1QOXA 3UR7A 1XLIA 1SZFA 3IAQA 3SCSA 2DZSA 5LA0A 2H3BA 3OJGA 2YYTA 4UTIA 1ZZMA 2Y61A 1ISVA 2O7SA 3NNTA 4LF2A 1NJJA 3VCRA 3VNMA 4DUWA 2RJHA 5G1MA 3L4XA 4N0RA 8RUCA 2ACRA 4OGZA 3M7WA 4IFOA 2EO7A 3N1AA 5LNVA 4DELA 3KE0A 4PFMA 3AHTA 2FKPA 3ZIZA 3UWVA 2J24A 4LYQA 1XD1A 4H4UA 3SRHA 1I2PA 3WLOA 1VFMA 2H8XA 4HMNA 3DJJA 4LS0A 3UWQA 3ZZ1A 2V5CA 3CZJA 4HPXA 4O13A 3UT0A 2HXUA 4GO8A 4HK6A 4WHBA 1SJDA 1GTHA 2VEGA 3NQMA 3NPXA 1E6PA 1TZ9A 2QNEA 3CL7A 4F4RA 3KVLA 1W1A1 1QCWA 1KKOA 4FALA 1SPQA 1VIZA 1S38A 3OPSA 5DY2A 1AG1O 3IJ7A 4KEVA 4ZR8A 4E2VA 2HPIA 3A21A 5AYXA 1V0MA 3BAWA 2INFA 1DXIA 4I6VA 3VFLA 3T2PA 2C8NA 2AL2A 1EJTC 1PDZA 3T9PA 1L6GA 3LRLA 1AA1B 3AALA 3M0KA 4HZ6A 3N9KA 2GR1A 1B2YA 1WUFA 4GFSA 4C65A 3LCIA 1Q6CA 4C1KA 3A23A 3ITTA 3PUGA 2ZE3A 2ZUMA 3OGRA 3SCVA 4EXBA 3HGRA 1Z41A 3SY5A 3NVYB 3GG8A 1NP0A 1GG1A 3KDOA 1WYGA 3TJ4A 3I7SA 2OZ0A 2A85A 3MWCA 5I7GA 1J10A 5C71A 3G1YA 5IDIA 5MKGA 3MP5A 3M0MA 1WKYA 2CU0A 1SFLA 2QJGA 3E02A 2XH2A 4WQ6A 4HP5A 4MJ2A 4AWEA 2A6NA 3AJ7A 4MMWA 4UTFA 1KR1A 2EKCA 4MWAE 3PZGA 2YL6A 4AD5A 2RAGA 4ZBCA 1HW6A 1DEDA 3QTPA 2OYMA 3WH9A 4Y8FA 3F4WA 5CPTA 1JPHA 3HPZA 8A3HA 3VIIA 3OW1A 2OKTA 5T8GA 1YKWA 1E1EA 3EA1A 3EAOA 1FWBC 3W7DA 1K4HA 4BEUA 4JGDA 2F5ZA 3GC4A 3UXAA 4FA3A 2C3ZA 3GDTA 4UTWC 3GE7A 3VKDA 2HROA 4XD6A 3LI1A 2E6FA 4WSHA 3S6DA 1O95A 3GUGA 4JL2A 4LGXA 4FMVA 3LUTA 3LSBA 4WLCA 3UFYA 4I8DA 4TMBA 4L6HA 3LBMA 3MI6A 3WH6A 3NDYA 4ZSUA 5LXEA 5HK4A 3CTTA 3H8AA 1P0DA 2D0FA 4MPKA 4MLJA 3IJLA 1E4NA 3I7QA 4C6IA 1GW9A 1EQPA 3UD6A 1F8WA 1OZMA 4H9YA 1Q4NX 4WGXA 2QCDB 3LXCA 3IGHX 1RJRA 1XKYA 1GEHA 4G1KA 2DUZA 4CQBA 3O07A 1VGAA 1QNVA 1ADOA 3ZS4A 2J7EA 1CB2A 1C7TA 1J18A 4PGLA 3MUXA 3IUHA 1HF6A 2PDGA 3IWPA 4KCWA 1IEQA 4AG0A 4KESA 2I9EA 2BCPA 4D2JA 3C2FA 4L4LA 3I4KA 3M0XA 1CZ1A 2Y2WA 3BW3A 5H8UA 2R1LA 3VOGA 3S5NA 2PDYA 3OZOA 3S4TA 3W24A 4W7WA 1RCQA 1XFCA 5F4XA 4U3CA 2X40A 2VO5A 2VRKA 4UOQA 3CNYA 4I5UA 4O28A 3AYVA 4EP8C 4IGHA 4XSMA 2ZA1A 1H4PA 4MYAA 2PAJA 1ZS2A 4GCAA 2V69A 4LUJA 3W2KA 4PMVA 3QN3A 1UWQA 2D0GA 1T8QA 1V77A 4BF7A 1FXPA 3EOLA 3LGGA 4M80A 3WH8A 3RAOA 5A6SA 3L4TA 4QQUA 4NI8A 2Q6ZA 4ML4A 5CG7A 4QX4A 3U4FA 3V5CA 4JEJA 2OJPA 4AHOA 5A8NA 1UYQA 4M6PA 1OFPA 4O1DA 4V28A 1E6ZA 3QMSA 4H4PA 3UG8A 5BU9A 1V3KA 3PWAA 4O16A 1FWCC 3CMGA 1YNPA 3G0UA 2RDTA 4S3DA 3MHFA 2PDHA 1BKSA 2X30A 2Y7GA 3TQVA 3GY1A 3G1DA 2XM2A 2J3NA 4UTHA 2WPBA 1PX3A 2HJPA 1OCJA 3AIQA 3ITYA 3AROA 3D0CA 3VA8A 4ZE4A 3BARA 1VFTA 3LCXA 1BHGA 4O18A 4E8GA 1ESWA 4GR1A 2DT1A 1GK8A 3A13A 5K4ZA 5D2XA 2XFWA 3W1NA 4W4QA 2G5WA 1B3ZA 2VFFA 2V5DA 4H4WA 5E93A 1E4MM 4H8NA 2E40A 1T8XA 4H4TA 3MSGA 1FX6A 1R0MA 4RE4A 4R7WA 4W89A 5J8LA 1G01A 1M65A 3L0NA 1N60C 4K7VA 2BBFA 3VPLA 3VDBA 3WJXA 1YIXA 1JRPA 1VQZA 1CECA 2OEMA 3K1GA 3FV9A 5U1OA 2YCIX 3MSRA 4ADSA 1OFOA 2GGJA 1LVLA 2ZX6A 3M44A 1U30A 2ZXBA 5F7UA 1TTIA 3GG1A 2XGIA 4XKYB 1EUAA 4BURA 1ME7A 3TQPA 4UTUA 2VRJA 4HNCA 5LGXA 1GZ1A 3W1XA 4PB5A 2F9RA 1C9DA 2NVDA 3KLKA 2JF6A 2Y7EA 3KHJA 3VM7A 1HT6A 2OU4A 1TR9A 3TK7A 1P6WA 5DBUA 4DXKA 1J0YA 3OGSA 5AFDA 1GKPA 1IEVA 3WY1A 3WFAA 3NO1A 1OB0A 1J6OA 4E2DA 1TMHA 2HV5A 1SR9A 2REQB 3JVAA 1R8LA 3ONBA 3TZFA 4MKVA 4GHRA 3EDDA 3AXKA 2EAWA 3GRIA 3VNLA 1TZZA 2X16A 2E6YA 4GPNA 3MWAA 2CPUA 1NHQA 2R1PA 1UG6A 5C2GA 5HUOA 3ECQA 1CLVA 3CB8A 4CNSA 1JIBA 2H90A 4XZHA 3D9XA 3LU2A 1PTGA 4B92A 3R58A 2V3DA 1C8YA 3BG3A 1ZDLA 4RE3A 2CHOA 1QPRA 5LYRA 3AIWA 3MP3A 4JY8A 3C2YA 3RX2A 1F4AA 1VHNA 2J9YA 1VLWA 3PK7A 2DPEA 4Q22A 3RG6A 4AXNA 2IW0A 5JU6A 3F4DA 1Q6RA 2X8HA 2B81A 1VP5A 5I24A 1UMYA 4A3RA 1PEZA 2Y8KA 1EP3A 2PTWA 1EO5A 4L6OA 1IYXA 3LNPA 1QOPA 3GXFA 4DBUA 4U5IA 1XLLA 3H2EA 4NUWA 4JTIA 4L56A 4MUZA 3NQEA 1ZFJA 2OR2A 4NJKA 4Z1CA 1BQGA 4OTKA 4HA4A 1EB3A 1QI2A 2Q3RA 1AJ0A 2R1KA 2YB4A 2XINA 2OZ8A 4UBPC 4PBFA 5CSUA 4F2UA 1R30A 5D2TA 8CGTA 1TYPA 3BDKA 4IPNB 1MNZA 2J6VA 4BEQA 3H23A 4ZQRA 2VGBA 9CGTA 2GGGA 2Q3OA 3WLPA 1UWAA 1V0NA 4QE1A 5D09A 4LBSA 1ISXA 3PTQA 1NDVA 1GGOA 2D69A 2C79A 3SN4A 1GONA 2XPKA 1IXQA 4LUSA 4EMJA 1TWDA 3RNDA 4GLEA 1KRMA 4C60A 4DBSA 3U5YA 3U48A 3LPFA 2Q8ZA 1Q7MA 3A3WA 1J2BA 4C6QA 4MADA 4DYJA 3QSRA 4F9JA 4FLQA 4OBSA 1EXPA 1FH8A 2BV9A 4XQ6A 4F9DA 2GK1A 3FHQA 4PL1A 1FCVA 2FGZA 1LRQA 1W9XA 4GYJA 4TOQA 3WFLA 2Q71A 2QV4A 4DO4A 3UPBA 4EQSA 3S9IA 3SJ3A 1KNWA 3C0JA 4IMEA 2ZZ6A 5FJTA 1QTWA 2CBUA 1PX4A 1VF8A 4LAMA 2E4TA 1J0JA 3GNDA 3TA9A 1FQ0A 3F4CA 3G1SA 3PN8A 1OX6A 1BPLB 3P3BA 5CGTA 2PA6A 2D23A 1WKFA 1M9HA 1JYWA 3EWBX 5BROA 5K2ZA 3TYCA 1RP8A 1E15A 4HNNA 1B0IA 4UTKA 5HXMA 3VOFA 4WY0F 2WSYA 3PUOA 5ECVA 1LP6A 1O5KA 5K9DA 1G4SA 5JBDA 1IZKA 1G0CA 3INPA 4ZOHB 1XLAA 1EJ7L 1PB0A 1UR1A 3NGJA 4JTRA 3QV6A 1BWLA 4JQ4A 4LWWA 2W4XA 1K70A 5KETA 3H55A 1TTPA 4XD5A 4RZBA 1HNYA 4ASTA 4XK2A 4JY9A 3GDBA 4S3KA 1SMDA 3GVQA 2W63A 1SM9A 4LVAA 3TYDA 3UA3A 2J6XA 3QTGA 4A29A 2QUNA 3GC5A 4AFYA 2ANUA 5J5DA 3LPPA 1OFEA 4YMZA 1OM0A 5M5DA 4DJFA 3UZJA 2ZC1A 4IX0A 3AJXA 4IWWA 2WCGA 5EFFA 4NL1A 1V6XA 4MJ4A 4LS1A 4PEEA 3W76A 3AU6A 3ZXWA 2FFCA 2QGYA 3WD3A 3O0FA 1JEZA 2CHNA 3QPEA 1PS9A 2WHJA 4PR4A 1IT0A 1OGGA 4HNUA 3PG8A 2DUXA 2X1TA 1VCVA 2EXOA 2FZNA 3DK4A 1G4EA 2F84A 4MNLA 4FP1A 1S2VA 5D02A 3ARPA 5CPNA 2JIEA 3HO8A 3N13A 1N2VA 2XN2A 4I9MA 4I3GA 3CLWA 7ODCA 2IKHA 1TB3A 1TMLA 5BMWA 2C3CA 3WNOA 3W2LA 3M47A 3ZR6A 1BYBA 1KV5A 4ZMGA 3VIGA 2W3ZA 4EF9A 1L6WA 3P6LA 3NQAA 2EPLX 5GNXA 1B9BA 1SSDA 4IMGA 3SQPA 1EEXA 4H8HA 2EPHA 3N17A 4EQWA 1A4LA 3QFWA 2PDQA 1JXKA 3OYXA 3IGSA 1P43A 3L5AA 3M9YA 1KR0A 2YVJA 3AWOA 1M5WA 1HXJA 1YRRA 3REQB 1IEXA 1W3KA 3K4WA 1T99A 2ZRZA 4RZ6A 5D9OA 3T44A 1M6JA 1AQMA 4F79A 1PIIA 4RNIA 1V3HA 1H5VA 4H19A 3VMOA 2CC0A 4M19A 2X8GA 2PP3A 5J04A 1GYMA 1MW2A 3RJYA 1J12A 2NQ9A 3I65A 3W7CA 3TXZA 2F6KA 2OMAA 1KBJA 4EPKA 3UXLA 4H3DA 4PUJA 3L2IA 2HNEA 2VGFA 4CD8A 2HK1A 3SCUA 4S1FA 1E6SM 1GZJA 5A69A 4WVXA 4Q4QA 1QNOA 1UB3A 3T6CA 2Z4GA 4NYYA 2RJGA 4CLMA 1DXEA 1MUWA 3NVVB 1OGSA 1TPB1 3RK8A 4A8LA 5LIXX 4RW3A 5D32A 5BOFA 2BWGA 4EPDC 5A2BA 1VFLA 2GJLA 3KOZA 3RLUA 4S3EA 1GETA 4IPJA 5F1VA 3AS1A 5DFAA 3UPMA 3CV2A 3CL6A 3CHFA 5D8WA 2X0SA 4IP5A 1CXKA 3FDGA 4AVFA 1W8SA 4H8UA 1GPFA 3ZT5A 3N3TA 2DSUA 1BVZA 2DW6A 3M0YA 2BVYA 4P2VA 2DVTA 4CNUA 4PMQA 3PFRA 3O15A 2F38A 1FWHC 1H09A 3UA4A 4M56A 2B31A 1R3SA 1UWSA 8XIMA 1POKA 4L65A 2VD9A 2I16A 1ZK7A 5HMEA 2WXDM 1EZWA 3RXZA 1AH0A 3WYZA 5I00A 2CYGA 3L9CA 1OX5A 3UZXA 3HZ3A 5A6JA 1X2HA 3PUEA 4DXVA 1B9ZA 4XZBA 3W7MA 2UBPC 3TR9A 3PBVA 2FZ9A 4JIIX 5TIMA 4JTCA 3VNYA 1G69A 5I3DA 3QPYA 1E1CB 3WUFA 3A5VA 4DI9A 4S2BA 3DFOA 1WO2A 1OINA 2GYIA 4DJEA 2CLFA 4ADTA 2WPCA 1AZ1A 3SW6A 1R3WA 3NPWA 4IFKB 4QG6A 3THUA 2J9ZA 2WHLA 4LVBA 3WCZA 2PLCA 3NZQA 3GWQA 1WP6A 5XINA 3TC7A 3I6RA 2RHGA 3GXNA 1F3EA 1FCQA 3NQ6A 3CUIA 3NVDA 1V8EA 3IK4A 1HIZA 3WDHA 1W9PA 3PNZA 5HAOA 4B5UA 3A9BA 4FAMA 3EPNA 2QJJA 3UR5A 1A3XA 3L2MA 2CLPA 2WSKA 1S1PA 3T2QA 2DH2A 3JZUA 3ICJA 4RDZA 3OA3A 1EL3A 2G96A 1VJZA 4ZO8A 1JFXA 2R94A 4H9ZA 1BSLA 4L1XA 1CGTA 3NM1A 1HKJA 1UWTA 1XF0A 1KM6A 4DWDA 1GRHA 2WCAA 2XHYA 5M1TA 1I0DA 4H7VA 2GLKA 1V6YA 4TTUA 3W29A 2F2KA 4AZCA 4PBEA 4HYVA 2QAFA 3VXGA 5IHSA 1XIGA 4YN5A 1DIEA 4ADWA 1EJWC 4IPPA 1LT7A 1EFZA 1DWHM 5I06A 1UIOA 3EA3A 2Z1BA 3AHZA 3ARZA 3EX6A 3KS6A 2VTFA 2Z1KA 3A3HA 4G7EA 1S3TC 1FCBA 1TIWA 2HEJA 1TV2A 4RCXA 4WSJA 2JK6A 4XZNX 2CBJA 3TFCA 1TJ2A 3LCGA 2I5GA 1R86A 5D04C 2VL4A 2QJIA 3O63A 1A49A 2YX0A 3AS3A 4ATDA 1XLFA 3Q2DA 3DFNA 4DF0A 1A5NC 2P3EA 2OB3A 3W87A 1JAKA 3MUY1 3BAJA 4IIEA 3M7SA 2PDCA 1TO3A 1G94A 3T42A 1C8XA 2HSAA 2OZ3A 4N9CA 4M1RA 5IFTA 3N6QA 4DZIA 2OGYA 5C8BB 2Q8XA 3LA4A 1H6VA 1RK6A 1GYLA 1JYVA 3NYDA 2RH9A 4F0SA 1HJSA 4MKSA 2ICSA 1I0BA 2EBNA 3JZEA 1MFVA 1C8QA 2UZ9A 4L6DA 1JPIA 3T08A 1JZ2A 3EAUA 3ZFHA 3KBNA 3OP2A 1JGMA 4A05A 2F7FA 4GGBA 2CLMA 3T8LA 4HA0A 2PLMA 3FVDA 2ZYFA 3A22A 1P7TA 1MUMA 3BANA 3QC3A 2QJNA 1ISYA 1UWUA 2OKOA 4XG1A 3PANA 4APNA 3K2GA 3SB0A 3OBKA 4FIQA 2A8XA 1DXFA 1VFOA 2E6DA 2FHCA 3HPSA 4W8LA 3AICA 5HNRA 4KRUA 4TV5A 3QLDA 2X42A 2Y1HA 3N12A 1KTCA 3O6AA 3E1F1 4PSPA 4B3LA 3EX2A 4Y96A 1MO9A 2ISWA 2PWFA 1GESA 2W27A 4L80A 1BXBA 1D9EA 2J7GA 3R0KA 3M43A 2G4JA 2OT0A 3WD4A 1HJXA 3ZR5A 3EMCA 1D7KA 2PS2A 1H0IA 1V02A 1K9FA 3WJYA 5KZEA 3GHSA 2XIJA 3EMZA 1A5AA 4PTMA 4HJWA 2FB2A 1FHLA 1TWWA 4D72A 5E09A 4MF4A 3PZIA 1V6WA 1BKHA 4J3TA 5MKGB 1K8CA 4KFPA 4IQDA 1AODA 1YE6A 3ARVA 4FXRA 4ZQNA 3PZQA 5A8OA 4L4MA 3ARUA 1HUVA 1A5MC 1T96A 3DJGX 3CUHA 5EMKA 2R1MA 4AD2A 2XISA 5LHEA 2EF9A 1XISA 3TDFA 4PCSA 1AQFA 5JMUA 4CVUA 3MDUA 3PWIA 3V0SA 4K2SA 1H2IA 3BAXA 1ISWA 2FYMA 2D0HA 1H0GA 1DXLA 4UFKA 2TSYA 4HNLA 4IG2A 5E9AA 4EACA 1AL8A 1Q63A 5D05A 3AHVA 4HMDA 3GLCA 3RRXA 2WHKA 1LTDA 4AEOA 4ICNA 3L4YA 2Y88A 7ENLA 2J27A 3HFYA 3SSJA 3PSVA 3L4WA 1JD7A 1YQ2A 4DLMA 5BWFA 2OSWA 4ALDA 3AQUA 1JNDA 3R8HA 1A5BA 3W7NA 1GWJA 1ECEA 3B8TA 3WG6A 4LF1A 3HPAA 1P4CA 1RR2A 4LVFA 3DGBA 1MDRA 3AXHA 3LMYA 3ABZA 2VI0A 1KW1A 4CQAA 2CW6A 1P5BA 1OVDA 4FDCB 4M6UA 2A3LA 2R6OA 2X2GA 1G7UA 1UKPA 1C9WA 2DORA 2FIQA 3NOEA 2CLHA 3LCFA 3D47A 4X60A 1M68A 1F9CA 1UWIA 5DXXA 1V0KA 1E4IA 3IJ9A 3VINA 3W7GA 4DI8A 2O56A 4WDXA 5HQMA 2TRSA 2YZRA 3MYPA 3HGSA 3SUVA 4DN1A 3KFTA 3BMWA 4W87A 2XWEA 5E0FA 4JTTA 3QQ1A 4UR8A 3BSHA 4JXCA 4M7SA 4ZTXA 1GJPA 3WF0A 1BXNA 2X7VA 1RHCA 2J8GA 2XVKA 3NEVA 3UCQA 5BMXA 1DIOA 1A0CA 1J0KA 1V79A 4M81A 1LRTA 3EBVA 4OIFA 1W9DM 2CETA 7CGTA 2ZC8A 1HG3A 1LL7A 4B90A 3W2UA 4DBEA 1P0BA 5L9FA 1X97A 4TVWA 1ADDA 4GQGA 4UWMA 1J5TA 2NV1A 1XUZA 3FCPA 2H8ZA 2P0IA 4DJDA 3CGDA 1XBYA 4MY8A 5FEZA 4JFVA 3RO6A 2EG6A 4V27A 1K7FA 2CNCA 3HIJA 4EPBC 1ZTVA 1VCGA 2MANA 1V3MA 3APGA 3IACA 1WOBA 1LQAA 4J3ZA 2OLSA 1RSCA 3LHUA 4HPHA 2V81A 4JX5A 4BWLA 4NQ1A 4EWJA 1I8JA 1JGIA 1PE1A 4Z17A 5I23A 3KZPA 4PRRA 2XH4A 1XRFA 4ECLA 3T4WA 2RABA 1O66A 1PXGA 4QLKA 1JDEA 3C2EA 1JPDX 2J13A 3HJZA 2Z29A 4JNZA 3UXDA 3GIPA 4N7QA 4NJHA 3DFSA 3N2OA 3NIYA 3EWZA 3TNBA 4WF7A 1GEUA 4K1GA 3W1MA 3W70A 1OF8A 3GSMA 4KMQA 5CCZA 3E0LA 4IICA 5EMUA 1WAWA 3ME3A 5KITA 1WXJA 3UGVA 3WQVA 3SURA 3P60A 4RKAA 4QG8A 2GUBA 3FAWA 3MO4A 1KFBA 3YPIA 4CKQA 3QY8A 4Z2GA 1UH2A 1XSJA 4BY3A 2QCCA 3N4FA 4H1ZA 2IQTA 3VIMA 2QHAA 1NDZA 2E28A 3BV4A 1MNSA 1XIBA 3R13A 3N3MA 2PBOA 2WMKA 3TYBA 4P61A 4WEVX 5EL1A 1TX2A 3RM8A 4P7NA 5FIPA 2PDJA 4GQRA 1GZGA 2ZXAA 4YVVA 4E4PA 3EWXA 1KM0A 3M0LA 1XCWA 2DT3A 3MU7A 3PZMA 3PTMA 1NARA 1JZ4A 4EIVA 3ARRA 1XLMA 1B31A 2DT0A 3TJXA 3C61A 4HZ7A 3PPFA 3NPVA 4LAOA 4QJ4B 5K7JA 1XH2A 3DFPA 1TSIA 2AAMA 4NASA 1S5NA 1W17A 2GJPA 3MKCA 4HVXA 4AY8A 1C7SA 1OK4A 2VENA 3DERA 4I6KA 4OU1A 1B30A 1H1YA 4NY2A 3AFBA 4U3AA 1WAUA 1V7YA 1VS1A 3G3DA 4J3SA 1JZ8A 1OGBA 2F6XA 2WLZA 3WJZA 1FVPA 3FJ4A 2PWDA 3KRUA 1BF2A 4BZYA 3T0AA 3W88A 1VJIA 3GHTA 3H7RA 2JFEX 5G2WA 4C5ZA 2E1WA 2V2HA 5FSEC 2XVLA 3D3FA 4XIAA 4ACYA 3CQKA 1NH6A 5H6HA 1UHVA 4DY1A 5A8QA 3LN3A 1VYPX 2PDIA 3UCDA 3G1AA 3NZRA 4JHMA 5EMMA 1YXCA 2UWFA 3NSNA 1YPXA 4BQ2A 3JW7A 3QSTA 5F2LA 3GNXA 1XI3A 1E9IA 2CFFA 3LHZA 1WKEA 2QS8A 3DFHA 1MZHA 1UZ1A 2H9AA 3KRSA 4NP7A 5BXPA 1CGUA 3RN6A 3PBMA 4HSHA 3KEHA 4FX7A 5CJNA 3TC6A 5SWUA 2WB5A 1T5AA 4J7RA 4AZGA 4TMCA 4KCTA 2IKGA 1PYFA 2W5FA 4QRNA 1DBTA 4KWWA 3OTRA 4WDTA 2OEJA 1I60A 2BNJA 5HATA 1OC6A 4MM1A 1YEYA 2ZZ7A 5LNWA 2ZICA 2QUVA 4LY8A 4C1NA 4AVNA 3WBYA 4POCA 3WK1A 1NF7A 2V3FA 2ZIDA 3HGJA 4UUIA 2B7OA 2C1HA 2QCGA 4MUPA 1XYCA 2A3BA 1HGWA 2XH7A 3MSDA 5FS7A 4NXKA 4O0ZA 2PZNA 4TX6A 3SN0A 4O1CA 4RV3A 2UY2A 3BZJA 4W5UA 1D3CA 1JQVA 3LHYA 1A5SA 4X2RA 3E6EA 3TCSA 4LUSB 1EP2A 4FXSA 1DWJM 1XXXA 2Y63A 3PR2A 3S6OA 3MY9A 4YWOA 1QI4A 4G8TA 3DZ1A 3UG4A 2WOVA 3VO0A 1REQA 3P8IA 3MQTA 5IHRA 2O9TA 4WY0A 3OO2A 1RZMA 4GUJA 3VGGA 5DT7A 2HVOA 1BG9A 3H24A 4OOUA 1VZWA 1RD6A 4AY7A 3UZZA 4AHQA 3N11A 3IIZA 4UQBA 3QRHA 3C2RA 4QQ3A 2TODA 4GIYA 3QLLA 3U4AA 1LROA 5M2FX 5A3HA 2QCHA 1NDAA 3MJMA 3NO3A 3AXMA 3IK2A 4CCEA 3WLKX 1SYTA 2ACUA 3HFTA 6XIAA 4K68A 1UA7A 4LBUA 1GHSA 2WCSA 1KTNA 1BXCA 1W31A 3F2BA 3SCTA 5IRPA 5REQA 1OCNA 1K9DA 4B15A 2AMXA 3KCJA 4DQWA 1OT1A 1IT7A 1NIUA 3CHEA 1W9UA 4IQLA 3V0UA 4PB4A 1GVFA 2QIIA 1KFWA 2HQAA 2GSEA 4ZFCA 4EANA 4JQ9A 1I2NA 4JTJA 1ZAHA 1MQPA 3PAJA 2WO5A 5FEXA 2C0AA 3F03K 4WJEA 4S23A 3DXIA 1X38A 1KBKA 3HQ1A 4IH3A 1ZNNA 1K8XA 2QAEA 4C6NA 5HDRA 1TVPA 2QPUA 2CLEA 1ZAIA 1MYRA 4XO6A 3F7JA 1QT1A 4HGXA 1KM3A 5CC6A 4OHQA 3GTXA 3SQLA 1HKMA 1I4NA 1F61A 4LVGA 2AOSA 3KL0A 1W5NA 2D3LA 3TSBA 3GTFA 3ES8A 2NSOA 3MCMA 4B5WA 4Y8EA 2ZUNA 1TELA 3AHYA 1W8GA 2DSVA 1Y5VA 3DG3A 4JFTA 4OJYA 2BC1A 4ACZA 1IXPA 4DAFA 4AD0A 3I68A 4R9OA 2A6LA 2VURA 2J74A 1XLBA 1W37A 3R94A 2PDKA 3ABRA 1XRSA 3MSYA 1M7JA 4UTTA 1H1NA 2DIEA 3UG5A 2ZXQA 5LZLA 1XG4A 4GIRA 2GDVA 1T41A 4PUNA 4WUIA 3ZSSA 1DJXA 1O1ZA 2ZA3A 3T81A 4BF9A 4O53A 2QV5A 3SM0A 2GOUA 1A80A 1H50A 1N7KA 3E2VA 2WZHA 4L1GA 3WNNA 3DU0A 1KCLA 1FFUC 3VIFA 4B91A 2BFGA 2R14A 1R46A