3N4FA

Crystal structure of mandelate racemase/muconate lactonizing protein from geobacillus sp. y412mc10
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
390
structure length
390
Chain Sequence
SLNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title CRYSTAL STRUCTURE OF Mandelate racemase/muconate lactonizing protein from Geobacillus sp. Y412MC10
rcsb
source organism Geobacillus sp.
total genus 127
structure length 390
sequence length 390
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3n4fA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3n4fA01
2HZGA 2MNRA 1XS2A 3SSZA 4KPLA 3R11A 4DX3A 3ES7A 3FYYA 3TTEA 2DW7A 3UXLA 1F9CA 3Q4DA 4GMEA 3UJFA 2GGHA 3UCDA 4DWDA 2OQYA 1PDYA 3ZVHB 2OZTA 2P3ZA 1SJDA 4K1WA 3OTRA 3RGTA 5FJPA 2PPGA 2QGYA 1MRAA 3S47A 1E9IA 1MNSA 2PGWA 3NO1A 2GGJA 3H12A 5FJUA 1KKOA 2ONEA 3V5CA 2AL1A 4J3ZA 3CB3A 1WUEA 3VCNA 2XGZA 3DESA 3P0WA 4E5TA 1BKHA 3N4EA 3SJNA 1OEPA 4IT1A 3EEZA 4E4UA 2PODA 4DXKA 3D46A 3RCYA 2O56A 2QJNA 3TJ4A 4ENLA 1EBGA 4Z1YA 1TZZA 3BOXA 4KWSA 3BJSA 1PDZA 6ENLA 4M6UA 1P48A 1MDLA 1XPYA 1TE6A 3UJSA 3U9IA 3CK5A 4DHGA 3FCPA 4H19A 2OPJA 2OO6A 2FKPA 3QKEA 4YWSA 1MDRA 3FXGA 4ZA0A 3GD6A 3ZLGA 3JZUA 2PCEA 2AL2A 5ENLA 3TOYA 4E8GA 3SN4A 3TQPA 3VA8A 3TW9A 3ZVIA 2HXTA 2GGEA 2ZADA 5BOEA 5J04A 3ZLFA 3PWGA 7ENLA 1JPMA 1NELA 2OQHA 4DN1A 4MKSA 3VFCA 4E6MA 3RRAA 2AKZA 4HNCA 3CXOA 3DG3A 4DYEA 2AL2B 3OPSA 3R10A 1BQGA 2OZ8A 1JDFA 1EBHA 3DG7A 1EC7A 3UJEA 4ROPA 1KD0A 3T9PA 2GDQA 2P88A 4H1ZA 2ZC8A 3THUA 4HCDA 3UXKA 2PSNA 1SJBA 3DEQA 3GC2A 3R1ZA 4G8TA 3H7VA 2OZ3A 4IZGA 3H8AA 4M0XA 2PTWA 3ENLA 3CAWA 4J1OA 3SBFA 2NQLA 4KT2A 3DG6A 2FYMA 2XH4A 3QN3A 2GSHA 3QTPA 4GYPA 3R25A 3D47A 3IJLA 1IYXA 1FHVA 2XSXA 3N6HA 3P93A 1TKKA 3N6JA 3MWCA 3U4FA 2HNEA 3R0UA 4JHMA 2PTZA 1KCZA 3HPFA 2PU1A 5IDZA 4IL0A 3P3BA 5FJRA 1R6WA 2QDDA 1W6TA 2PGEA 3DDMA 4H2HA 3DERA 2PTYA 3BSMA 2PMQA 3FJ4A 3ES8A 1NU5A 4HCLA 2AKMA 1SJAA 1YEYA 3STPA 1L8PA 3MQTA 1DTNA 1RVKA 4GFIA 2XH0A 3I4KA 2CHRA 3UJRA 4EWJA 4FI4A 2PU0A 4KEMA 4X2PA 3IJQA 1EC8A 4HNLA 4E4FA 3IK4A 1P43A 3OP2A 4A35A 5FJTA 3V5FA 3T6CA 4IHCA 1R0MA 4ZCWA 3UJ2A 3UCCA 2MUCA 3PFRA 4MGGA 3FVDA 2PA6A 3DFHA 3IJIA 2PTXA 2GL5A 2OFJA 2OX4A 4H83A 1ECQA 4GIRA 3I6TA 2PS2A 3T8QA 2P8BA 2QJJA 3R0KA 2QQ6A 3DFYA 4K8GA 5BOFA 2P0IA 4MMWA 3UGVA 3SQSA 3OW1A 1FHUA 2PP1A 4GISA 3GO2A 1ELSA 3DIPA 2QDEA 3VCCA 3FV9A 4G7FA 3NFUA 3ZLHA 1EC9A 3PWIA 3MSYA 2POZA 3CT2A 2GGIA 2XH7A 4A6GA 3VC6A 4IP5A 3MUCA 3CYJA 5EU9A 2OKTA 2OLAA 3TWAA 4F4RA 2PP3A 3Q45A 3KUMA 3SN0A 1SJCA 3TCSA 3MZNA 4GYPC 4JN8A 4A3RA 3JW7A 3RO6A 2HXUA 3VDGA 3H70A 1WUFA 3OZMA 4HN8A 3I6EA 1JCTA 2DW6A 3SN1A 3N4FA 3RR1A 2GGGA 4HPNA 2QVHA 3TWBA 2P8CA 4HCHA 3VC5A 2OVLA 4GGHA 3PK7A 4JN7A 1KKRA 3DGBA 3NZGA 2OG9A 3K1GA 3QPEA 2XH2A 3GY1A 4K2SA 3RITA 4FP1A 3V4BA 3JVAA 3NXLA 2QJMA 1ONEA 1MUCA 3S5SA 4HYRA 3EKGA 3QLDA 3MKCA 1JPDX 3MY9A 2PP0A 5FJOA 3T4WA 4IL2A 3TJIA 3B97A 3ZVHA 4Z17A 2RDXA 4IP4A 3OZYA 3V3WA 2I5QA 4GGBA
chains in the Genus database with same CATH superfamily
4ACYA 1OD0A 3VMOA 4AF0B 1ZFJA 3EWWA 4NRSA 3SSZA 1ZP3A 4Q6JA 2Z6IA 3H2NA 1MZHA 4M6PA 4Q8VA 2HJPA 4J40A 4BCEA 1XRVA 3PVFA 3GM8A 3O6DA 3W70A 3WLKX 4DWDA 3W1LA 3NPVA 4OFCA 4H6KA 7A3HA 1QT1A 3KWXA 1MUMA 1GREA 5FS8A 4NJHA 3MW7A 1MQQA 1Z7AA 1C8VA 4WF7A 4ZL1A 4GYFA 2A7RA 2YDAA 3OEXA 2J47A 4XB3A 3BC9A 4DLMA 3EDFA 1V0KA 4DM2A 4L7ZA 2CNCA 4YMZA 5FF3A 2FVMA 4BWLA 2J9YA 5CGMA 4RPPA 3W7LA 3SJNA 1ZNNA 4CNNA 2RHGA 1V3LA 4FK9A 4YVXA 2QAPA 1XIGA 3PPGA 2D1ZA 4EE9A 1SW7A 5LYRA 3LLXA 1R30A 3TQ0A 4H4XA 4PRRA 5C2CA 3TQVA 2C1HA 2WMGA 5FF0A 4GZ7A 3RHGA 1E4NA 1XH0A 2JE8A 3T0CA 1ESWA 3FCPA 4JQAA 1CXKA 1S5TA 3BLOA 1GVRA 3N13A 4XO7A 4QJ5B 1UC5A 1WAWA 3APYA 2F84A 4A22A 2VR2A 2Z24A 3L2LA 3TW9A 1TCMA 3KCLA 3E9AA 2OELA 4C6KA 4UZUA 1JPMA 1H4PA 1EP2A 2YSWA 3IJ9A 1JZ8A 3RJXA 4JIPA 4MKSA 3SI9A 3VFCA 1V6VA 4W8LA 3LQLA 2BDQA 4RNHA 1HUVA 2GJRA 1AQMA 2AKZA 1JCJA 1DIKA 4C6QA 1KBBA 1TZ9A 1G69A 5LZLA 3PBMA 5CBIA 5AFDA 1B9BA 2J78A 3WQDA 3ABZA 1X39A 1UZDA 3T44A 2W79A 1ONRA 3GFYA 1GOWA 1TB3A 3GDRA 1KD0A 2B0MA 1E9ZB 5A6LA 1SFJA 4DJED 2XWEA 1B3XA 7REQB 2ZCGA 4AVFA 1E1CB 1J0YA 1BWVA 3DEQA 3CZJA 2FZDA 1YDYA 1H7NA 1GVOA 2WVUA 1OFBA 3WKZA 1TWWA 1FVPA 3P61A 2E9LA 2QCCA 3AS1A 3WF2A 3OIHA 3TX9A 3KOXA 2W54A 1JGIA 5BMWA 5ABFA 3CIWA 1JYNA 3QHNA 3WIJA 1C9DA 1EO5A 2ZRVA 1E0TA 2QCHA 4LYRA 5LGXA 5HMDA 5AC6A 3RFAA 3D47A 3RM9A 2PWGA 4Z1BA 4ORIA 3KCOA 4IMCA 4GY1A 3EPMA 3QYQA 4QBXA 2VFHA 4HNTA 3PB0A 3N2TA 4UNLA 1IHIA 4X9SA 1XJBA 2INZA 3U4FA 4F2UA 4YLWA 2Y85A 3DHDA 5IBXC 1JL8A 3G1HA 3WD3A 2DZBA 1JOAA 1K8CA 2VJXA 3MKVA 1SZRA 1UR1A 4Z1CA 2GDVA 2AMGA 1VLWA 1RQBA 1TX0A 1T41A 1PX8A 4KEUA 3BSMA 1XCWA 2ZKMX 2ZE3A 4MNJA 3FX4A 3W7PA 2ZZ5A 2RDUA 1GGOA 4GFIA 4LUIA 1KM0A 1EXBA 2TRSA 2F9RA 2ZRXA 3DKLA 3MS8A 1EL3A 1FFRA 3QPYA 1K9DA 4IMAA 4E4FA 3TLLA 4RW3A 4DJFD 1S2VA 1HJWA 3VNDA 4BF7A 3SEPA 3R43A 1MVYA 3UCCA 3AOFA 3KAOA 1XYCA 2CCRA 1BF2A 1KFWA 3STEA 1K70A 2GQ3A 4JQ9A 2GL5A 4OKDA 5A5WA 4XVEA 1NEYA 2J6XA 2NZLA 4GIRA 3WK0A 3I6TA 4JFVA 1J6OA 1B31A 2P8BA 2PS2A 3OLEA 4GXWA 3MHFA 4OZOA 1KV5A 4O50A 1DOSA 4XZMX 1TELA 2BXVA 1XDLA 3O1NA 1O66A 1UJQA 3V0UA 3SCWA 1Q65A 3WK3A 1JUBA 2QIIA 4DI9A 5BMXA 4CQAA 4AYGA 1XLMA 1BRLA 2UY4A 4IFOA 1BKSA 1TPH1 1K1DA 3IRDA 3VGDA 3U2OA 3RNMA 4DNMA 3F4DA 3B8TA 2DH3A 2WZIA 1ZTVA 4X60A 3QVQA 1TQJA 3TN3A 4IM4A 5FS6A 4W8BA 2A1YA 3IVTA 2CLIA 3EPNA 4YTTA 3WUEA 3SN0A 3GXIA 4CNTA 3NDOA 3MZNA 2C91A 2E77A 2INFA 1OY0A 2ZX6A 1UD6A 4EQXA 4KPRA 4GI8A 4KH2A 2OGYA 4KFNA 2QMJA 1UD3A 3GS6A 4A3YA 3LZ5A 3SQLA 3GG0A 1PV8A 1IQ8A 4NRRA 5LKYA 4DWSA 4I3GA 3S3GA 3WLQA 3KL3A 1E6ZA 3L5AA 4AX7A 2NXGA 3ITCA 1TREA 3Q94A 2NT1A 1I0BA 2JIWA 4IICA 1JNDA 2VYOA 4KWWA 1EDGA 1JRCA 4RDYA 1O68A 4UZSA 1OK4A 4W86A 1MUCA 2E68A 1I8JA 4XVDA 3PHAA 1U22A 4JFWA 3OIXA 3HMCA 1V0LA 3W2LA 1PTAA 4QG8A 3BG9A 4DELA 1T6MA 1GOXA 5I24A 1SO3A 4Q4RA 3ICJA 1CECA 3QV8A 3QZ6A 3ZVHA 1EB3A 4MYAA 1CBGA 2X0YA 1QNQA 2WAGA 3VD7A 1GQLA 5AN7A 2GSEA 3L0KA 4FX8A 5IHSA 1GW1A 2V3EA 1TPDA 3TTQA 2J88A 1X7IA 3OHMB 5LHFA 4ERIA 5C2GA 4CNUA 4R53A 4E8DA 2WM0A 2GGHA 4AQLA 1CLKA 3C8NA 4LRTA 1B30A 4GABA 4S3EA 2VOTA 4N4QA 4JKMA 2WZMA 2PWHA 4D8AA 4Q8NA 2XN2A 1HJVA 4RKAA 3K8MA 3NG3A 4L9XA 1MO9A 3UWYA 2VGFA 4C6EA 4EF8A 2QYGA 4GCXA 3VCNA 3N2MA 1OZQA 4DZHA 5D4YA 3JUGA 3NQ7A 4J3WA 2DUZA 3NL6A 4IQLA 2UWFA 2C3CA 2QS8A 1D3HA 4E3VA 3P2VA 9XIAA 5JH1A 1UOZA 1GVYA 4DLFA 3EBVA 1DJYA 1R86A 4B5TA 1TZZA 4F9DA 1PCWA 5CG0A 1NOUA 1V93A 3HF3A 4HK6A 2DSUA 4WDTA 1EIXA 3KCJA 1JAEA 3HG2A 3MYOA 3UJSA 1AQHA 1I2RA 2R1PA 2QCDA 4O12A 2CLOA 3W9ZA 1MDRA 3GD6A 1VYRA 4RNFA 3ZLGA 5FA5A 4JX6A 2VELA 2AL2A 3LLFA 4E8GA 2FGBA 3HPAA 1YHTA 3BAXA 2XM2A 3SGZA 1VPXA 2FZMA 4IMEA 1KB3A 4IGMA 5U1OA 1E43A 1KM4A 4IP7A 4N6EA 1O5RA 4ORMA 4C1LA 3PZVA 3ARSA 7TIMA 5F4WA 2WKJA 2HS6A 1VEMA 3N9KA 1OJTA 1MMFA 1WQ5A 1BXBA 3K5XA 1YXDA 3DG3A 4ACZB 4B9YA 1C8XA 5BZAA 4PA8A 2WLYA 1C8QA 2EPHA 4HMCA 3C0LA 2HBXA 4HIBA 1J5SA 3XINA 1TPFA 3WUBA 1M9HA 2J62A 3APGA 1PZ3A 1MXDA 1ZUAX 3UJEA 1EEPA 4LGXA 1NIUA 5EBKA 2V9DA 5HUPA 4QP0A 2V5JA 3LHWA 4JPGA 3AMCA 4WLCA 5E1QA 4PUEA 3NQCA 3AMLA 3H2EA 1Q2SA 1Q85A 1AZ2A 2PWFA 3IAQA 2ATMA 1PPIA 4RE3A 4KEZA 4XZWA 2GJNA 1GOIA 1XG3A 4UOZA 2PUZA 3ZJKA 4GHRA 2ZUTA 1QWGA 4UTTC 5EKYA 2YCIX 2DY3A 1VPQA 4QNWA 3W01A 3CAKA 2GUBA 3AIEA 4V33A 1HP4A 1W1VA 3PZMA 4MNLA 3RPTA 1RM6B 1SB3B 4GJ1A 3ZFHA 3BANA 3KW3A 4P8VA 3E3HA 3UPMA 4PBFA 4N0RA 4PEKA 4Z2LA 4LF2A 2IXVA 1VBJA 3WBWA 4Q6XA 2PU1A 5U7SA 2OGJA 1RY0A 3ANYA 1VBGA 2X7VA 4GRTA 2DUAA 4JEQA 4JTFA 4JQ2A 3LADA 4YCPA 3B05A 2QF7A 2XG9A 1JXKA 4ZFCA 3NGFA 2TSYA 3V7PA 5EMMA 4PRTA 1TCDA 4H4TA 5LSMA 3DGZA 4J3XA 3FNDA 4ONVA 4J3SA 3DC0A 1ZHAA 2RFGA 1QBBA 4XZ9A 1A4LA 3IK4A 1E6SM 3RR4A 3IEBA 3V5FA 4LIIA 2D0HA 4R9OA 1XGZA 1Q4WA 3B06A 4IG2B 2FB3A 1FDJA 2PWEA 3SUVA 2ZZBA 3V75A 3E2VA 3CIVA 4EMIA 5LNSA 4TV6A 2NQHA 3ZJ8A 2VR5A 1RD6A 1NFPA 6XIAA 3R0KA 3K8KA 1ZDLA 3CT7A 4ADUA 4B9ZA 4AIBA 2EPOA 1G4PA 1SR0A 4JHZA 2V69A 1P7TB 3S6DA 4J2PA 2UV8G 5HMSA 4TX6A 1WXZA 4PODA 4J57A 3ANVA 3P81A 3PULA 1ZJBA 2R9RA 4K39A 2QUUA 2JQXA 3TYDA 3SCTA 2FZ9A 4O1EA 4REQA 4AD5A 3SCVA 3NFUA 3ZLHA 3M0KA 5J5DA 2YYTA 5FD0A 4G6CA 3E0WA 4HHHA 4F3HA 5BNKA 4NXKA 3I68A 3UR5A 4JDBA 3MO4A 2ZZ1A 5CAKA 2FTWA 3T2OA 2POTA 3QYSA 4DO6A 1P5BA 1L0PA 3N2CA 2EF9A 2OKTA 2WO5A 1AA1B 4NHVA 4F4RA 3AC0A 3PN8A 3ZOAA 1W1B1 1RA0A 5C8BB 1U30A 4RXFA 5DF0A 3BG5A 5A8OA 4B5XA 3JRKA 3TMLA 3KVJA 4A3RA 1NDYA 1FH8A 3CASA 2GQWA 4LTSA 3KL0A 3IANA 3U57A 1T99A 2D24A 5EMJA 2RUSA 1TFVA 1A4MA 4P7LA 2HK1A 1TG7A 1M1BA 1NDAA 4AB4A 2Z28A 4ZOCA 2X09A 4CCZA 4Z2JA 4U10A 2A3BA 3UYCA 1CB2A 4LW7A 1RJQA 3C3UA 1JF6A 4FXJA 2P50A 3OOQA 4XISA 4R33A 3A23A 5EGRA 3ZSSA 2CXGA 1M01A 1YXCA 2NSXA 1E4IA 1Z89A 3WQFA 1IEWA 1ICQA 4AF0A 2P5NA 3E6EA 3AIRA 3TC7A 3MBDA 2G4FA 1JI2A 1ZL1A 2DSVA 3SFKA 3H2AA 3FHAA 2BS9A 4JXCA 3QRHA 3VKCA 3SIMA 3HFTA 1W1IE 5AZ0A 4H7CA 1W17A 4A05A 1I2NA 3AYTA 2RABA 1PL9A 2QJGA 4LAMA 5CZTA 4DUVA 4KPLA 4ECLA 4KEVA 1UR2A 4UTFA 1BAGA 1PSCA 2BODX 1E40A 1ZJIA 2HS8A 3WMBA 5MHBA 1P6BA 4NJIA 2PD9A 2DSZA 3TVAA 1RP9A 1W37A 5T8GA 1A0EA 3VD3A 1MRAA 5G4EA 1DHKA 3H12A 4DPPA 4FPSA 4GIEA 3O6CA 4GH3A 4DJDC 3SCRA 3HBLA 3ABXA 2PDHA 4Q32A 1L6YA 1ENUA 3A3XA 2GH5A 1F05A 3S1GA 1GKQA 5A8QA 3KP1A 2YVFA 2ABBA 4F48A 3B9AA 3FHQA 5CBJA 2QJNA 4C7GA 4LSBA 4KWSA 4IIGA 2UY5A 4GVHA 2EJ1A 1XUUA 1XF0A 2P53A 1WKYA 3M46A 3U9IA 5JBFA 3VZYA 4WVXA 3CK5A 4HYWA 3E5PA 4OUIA 3LMYA 4PMJA 3CGDA 3JZUA 1W1TA 5ENLA 3TOYA 1WXYA 4UNIA 3NL3A 1LP6A 1GYMA 4LEFA 1X1NA 5A6SA 2A3LA 4MJ4A 3PZQA 2X8GA 4PTMA 1ECEA 5HR6A 1ISVA 5IRPA 4DRSA 3NXFA 4G2DA 1QPOA 1TV3A 2X7WA 4APNA 1E6NA 2GVGA 7REQA 4Q4QA 1E1CA 2FGLA 1XINA 4ZB0A 3N17A 4QTGA 3OPSA 1VENA 3QQ1A 2XISA 2NT0A 1S46A 2JGQA 2WANA 1JEZA 3NDZA 4Y9OA 1HKKA 3O8AA 4UOQA 4JYFA 1V0NA 3MUY1 4OQVA 1C92A 2YW4A 3BPWA 1WKDA 5G4HC 2Y5SA 3GBEA 4B16A 1X6NA 2NVCA 4L9ZA 5GJMA 4CD5A 2G4JA 1V0MA 3CGEA 1SJBA 4FR1A 1GJUA 3RUBL 3GC2A 2X05A 3E49A 3S46A 3DHFA 3ANUA 2CZVA 4IZGA 2PTWA 4PB5A 4CN4A 4RNJA 4QE5A 2VRQA 2ALDA 1V51A 2VC5A 1FBAA 1ZB5A 3THQA 4K37A 1X6LA 4TV5A 1H2IA 4Q8MA 3S6OA 1YW1A 1PXGA 4ZZ9A 2E0PA 3N6HA 4NAFB 1C7TA 3BJTA 3CMGA 3EOUA 1BGAA 1EHAA 1PIFA 1NHRA 1H1NA 1YDNA 1V6YA 2BFGA 3UEQA 1WE5A 2HNEA 3VX0A 2YFOA 4W7VA 2XN0A 1T3QC 4H4RA 1O1HA 3STGA 3BSHA 1OX4B 1AL7A 3KOWA 3DBPA 4YS1A 3FGCB 2YL9A 1ZP4A 2YJQA 2PGEA 3DDMA 5JMUA 4XSLA 1WOAA 2O9RA 5D05A 3QLLA 4JD4A 4N7QA 2W66A 2WYSA 3SJ3A 1FIQB 4TMBA 3ABOA 4QDWA 3A13A 4A8LA 1UR3M 4NU7A 2GYIA 3KRZA 4S3CA 3CWNA 4O1BA 1MQPA 2CHRA 3E2RA 2ZX9A 1ZMCA 3AN1A 1SZFA 2QPUA 1K6AA 5JXQA 3RJYA 4TOQA 4JIIX 1SU5A 3LENA 4NNBA 3UVIA 1XH1A 1EC8A 3BDKA 2VEGA 4PCNA 1KW1A 4V1YA 5FF7A 2EJAA 3LHUA 3IWPA 4ZCWA 4HNUA 4PUJA 3N2XA 1PB0A 3O2LA 4GZJA 3NZ1A 2XZ9A 1HKMA 1J0KA 2PA6A 5CAHA 4GJIA 1Z69A 1ZAHA 3VZXA 1VFLA 2OX4A 4H83A 3L4YA 3GXDA 5LIUX 1TJRA 1ZY9A 2FTYA 1A5OC 4GI6A 1EF2A 1Y8BA 2HQAA 2W3RA 1VFOA 2EHHA 3NQAA 2E9BA 3CBWA 1JIBA 1MO0A 2R9ZA 4NJGA 2BVDA 4W9TA 3SQSA 3OGVA 1PIGA 3MUZ1 1U1JA 3ARZA 3BZGA 3S1WA 4ICMA 4C6CA 4UB9A 2QDEA 3OVPA 3BAKA 3VGHA 3MSYA 4Q7BA 1KM5A 3DFPA 3L4XA 3UWQA 4O19A 2CIPA 1BZLA 4I7UA 3NIYA 3N19B 3XIMA 3F4WA 1WZAA 3EA3A 1ME7A 3CWHA 5I03A 5F2IA 1I2QA 1WCGA 3VK5A 1AG1O 1FTXA 1QCWA 2NWSA 4D2JA 5JCMA 4M1BA 3O0HA 1NWRA 3W37A 1TA3B 3AXIA 1A50A 3H70A 4PTDA 2J27A 1LPFA 4AZ5A 2OB3A 3TSBA 3LI1A 5A3HA 2VMFA 2J79A 3TTYA 2FMNA 1ISZA 3RMEA 1FWFC 1IR2A 4BI7A 3LB8A 3PC0A 3SY8A 4H4WA 3W22A 4FA3A 5C0QA 5DXXA 3CZGA 3CH0A 5KETA 3G5EA 3HQPA 1X38A 2J4GA 4E2DA 3WNOA 4XBKA 1FWNA 2GVEA 1UB3A 1J6PA 1H41A 1N63C 1VCVA 3NVYB 2XYLA 4RE2A 3DK4A 2P3EA 2GUYA 4C6IA 4LA1A 3LBCA 4I9TA 1UWRA 1NY1A 3MVIA 1XS2A 2NQZA 1RJRA 2J25A 3VGFA 3VPLA 1OYAA 1DJXA 1EHNA 1F9CA 2F8QA 1UR8A 4DJEA 5J8LA 3BG3A 4GMEA 2VCAA 4P7OA 1PWMA 3GVQA 4PYSA 4QISA 3PWAA 1J9YA 1A5KC 4JQ1A 3FYOA 3KS5A 4B92A 5D2WA 2BY1A 2YL8A 1W3HA 4L80A 1BLIA 5AHNA 2FJKA 5HULA 3C0JA 3H2CA 4J4KA 4CD6A 1OZMA 3GC5A 4WOQA 3B0VC 3QC0A 4U5KA 3CMFA 4J3ZA 4NYYA 1EJXC 4CNSA 2BOFX 1XLHA 5DBUA 2V82A 1EO7A 4O17A 1GOOA 4DB7A 3LSBA 2NQ9A 2PODA 4AMAA 4EXQA 3W7NA 4AZIA 4L65A 1KFJA 1I2OA 2RJGA 5DRCA 4KFOA 4Z1YA 4L61A 3NO5A 1F8IA 4UTHA 1TX2A 3LGEA 4LFYA 1I1WA 3S2LA 4JIRA 3TN6A 1FEBA 2NUXA 3VINA 5CPLA 4O14A 3MT1A 2J74A 3NEHA 4PMRA 3WH7A 1CGTA 3M5XA 4ACZA 4ZODA 4FX7A 4UMCA 2ZRZA 4P7RA 1M03A 2PCQA 4TIMA 1EJVC 2CHNA 3EUB3 4IFKB 2HXTA 5J04A 1TJPA 3M6YA 5I2UA 4I9JA 1YPXA 1GJPA 4R34A 4DN1A 4QAIA 1V77A 3WQEA 4ES4A 3RCMA 3ERPA 4B15A 1JUEA 1BQCA 1KQYA 1Y5XA 4CNOA 2WWCA 3AJ7A 1KGWA 3M0YA 3U48A 4DJFA 3OHIA 3RYSA 2X0SA 3MUXA 4NZ3A 1R3YA 1XLCA 2D0GA 1RY8A 1TE1A 4RNIA 1FKWA 3G1DA 5H6HA 2VD9A 4ML4A 3CMJA 4JFTA 2TPSA 1MXSA 4OUEA 2PLMA 3T0DA 5HPOA 4AD0A 2ZA2A 1NDZA 5KZMA 2RAGA 3W1MA 5ABEA 3S5OA 2E6YA 1KXQA 1EJSC 2Z7GA 4QCFA 3WD1A 3ITXA 3KBNA 3LV5A 3FK4A 2RGMA 3M64A 2OZ3A 4UTLA 1VC4A 4H9MA 6TIMA 1E5JA 3TYCA 2YL5A 1UPPA 3MJMA 3W28A 2WOQA 2UY3A 2VWTA 3DG6A 3VGEA 2FYMA 2QUNA 3GDMA 4Q33A 3ME3A 2GSHA 2WP6A 3TA9A 4UNKA 4HP5A 1V79A 3K4WA 1F3XA 2QZRA 4KKXA 1UW9A 3SO7A 3GXMA 3QFBA 1GCYA 1EF3A 1TTJA 5BU9A 2WJEA 3WLNA 1LWHA 3EOSA 4E0CA 1CXLA 4QLLA 5HMEA 3G0UA 4PMYA 4C6BA 2CEQA 3LCWA 1VYPX 4NY2A 1MYRA 2W27A 4HTBA 5CKSA 1IXNA 1E9YB 1ZAIA 4H4SA 4LBSA 2J9ZA 3TYAA 4S39A 2QDDA 1GONA 1O1ZA 3ITVA 1SQ7A 3N73A 3TYZA 1W56A 3EAOA 4O8RA 3WQCA 3H7UA 4Z08A 1XI3A 3MCOA 2QAFA 1LLWA 1RVKA 4IG2A 4EIVA 3THDA 1X97A 3IACA 2ZZ0A 1F3TA 1AOGA 1K8XA 3UJRA 3GR7A 2WZEA 3C8FA 3IJQA 2V5LA 5BCAA 3VIOA 3TYBA 1JCXA 3OYZA 3DOPA 1IEQA 3V1HA 1QHZA 2NQ5A 3UG3A 1EJ7L 3FA4A 6PTDA 3S9YA 1PBGA 1P7TA 4HMNA 4MFDA 3QV9A 4D1JA 3CZKA 2O92A 5HK4A 2DVXA 4B2DD 3GFZA 1BYAA 2PDKA 4WRHA 1VHCA 3NL5A 1QDSA 4CCEA 1EA0A 2J8GA 4XZNX 4GVGA 1FFVC 2QQ6A 2VGGA 3T0TA 1VDVA 4FNRA 2Z0IA 1E55A 3EYPA 4AZ6A 4XD5A 1D7YA 2XFWA 1W5QA 1SO5A 5D37A 2Y7FA 3L4ZA 4HBKA 2EQ8A 1SMDA 1ZK7A 3OW1A 4PUMA 3H7RA 3AISA 5FEZA 1YPIA 3U5UA 4N9CA 3PWIA 4O54A 4RW5A 3TC6A 2VDHA 1IEVA 1XIJA 3S42A 4KCUA 4IP5A 4L56A 3DU0A 5DLCA 1OGGA 1GTEA 4PFMA 4P8UA 2OSYA 3PBVA 4PUKA 3TKFA 4E2BA 1OGBA 2IKGA 3HG5A 3VOCA 3IIXA 2I1OA 4ICCX 3QY8A 3GUWA 2XVPA 3GVGA 2F6UA 3HIJA 2W61A 1WUFA 1N8IA 4LYQA 4LVAA 2CBJA 3T7VA 1Q6OA 3S1XA 1KFCA 3G6LA 4GUJA 4HT3A 4U31A 1F6KA 3WMCA 4RE0A 4AY1A 4HK5A 2OX1A 4NI3A 4O28A 4JTSA 1MSSA 4LALA 1NWTA 2VCCA 1P1MA 4ATWA 4MWAA 5LA0A 1EEXA 1WZMA 3GY1A 3P7YA 4K2SA 1CB7B 2V5KA 1QNSA 1EBDA 3HTWA 4PTXA 4DPQA 3KLKA 8XIMA 5JRBA 3AO0A 4MKNA 2GR2A 5LIWX 3F5KA 4EWND 4JQ4A 4JDYA 1KCLA 4WIWA 3S5SA 4DVOA 2Y8KA 2GRTA 2GVJA 5A6JA 3HV8A 3H2MA 4H8UA 3FG2P 1HFBA 1BVZA 4LT9A 3VIJA 4W5ZA 4UBPC 3VM5A 5J5RA 5DY2A 2FHCA 1LRNA 4GXMA 4YPJA 2HZGA 1YE4A 3ZM8A 4PMZA 1V6TA 2I7GA 2HTMA 2HQMA 1GRHA 1GVEA 2VFIA 4H7ZA 4HTYA 1WXJA 1FCUA 2H9AB 2CU0A 3DFQA 3IPWA 3P62A 3PBUA 5JIWA 3AHZA 2OOGA 1X1OA 1J0ZA 3DC8A 3GD4A 2F61A 4S38A 1XBZA 2ANUA 1BWLA 1Q7QA 2VQTA 1FCBA 3DESA 1UH2A 3L65A 3IGUA 2VC6A 4OBTA 3W1QA 1OEPA 4HYVA 1PYFA 4DXVA 2C71A 2Y5EA 4S3DA 1QNRA 1PHWA 3C3NA 4GVFA 1U83A 2OEMA 4KFPA 1W9DM 1FWEC 4ENLA 2OOFA 4IX0A 1H0IA 1XX1A 1V4YA 2GOUA 5M17A 3T0AA 3NQMA 5I78A 1GTHA 2ZXQA 1TV2A 2F5ZA 3H4WA 5AVNA 1NSJA 3KZSA 1X8CA 4ATLA 4BR1A 2FKPA 3QKEA 1NWUA 3BUVA 2B81A 4HPXA 3T2PA 2EEXA 1FFUC 2ZX8A 3AI0A 1KWKA 4AZGA 2R91A 3MV11 2V67A 4CN1A 4JGDA 4GUGA 3Q67A 1EDTA 4EQWA 3E02A 1A5BA 2JEQA 5DCEA 1H62A 1L2UA 1Q8AA 5G1TA 3W7HA 5HWMA 2AMXA 1DXLA 4MWAC 2BASA 3SM0A 3NJ3A 2E6DA 4AEEA 1XBYA 3SCPA 3LM7A 2A4AA 3GIQA 3BW3A 2D23A 4TR9A 3B04A 4XD6A 8TIMA 2QV4A 3RF9A 1TPC1 4WSHA 2PI6A 3WDQA 1VP5A 2PE4A 5MF5A 4EXAA 3LTSA 1J18A 5FSDC 4A29A 3EZ4A 2QMKA 3TONA 6CGTA 4XAGA 3C2VA 3KX6A 1VS1A 3H7VA 2DUXA 3RILA 4NAFA 3PAOA 2Q8LA 3II1A 3SBFA 2VX4A 4UTWC 1S3HA 3WK2A 4LAZA 4GZEA 2XZ7A 1K8ZA 1PCKA 3G1RA 5LXEA 2CXEA 3LRMA 1X2GA 1EWDA 4D6JA 2TYSA 2VFFA 3FGCA 3W7MA 3CZEA 4NG3A 4EM3A 3WBYA 1XYZA 4JX4A 2UZ9A 3WNPA 3LPOA 1S3TC 2XSBA 1I4NA 4GUFA 3WK1A 3AXKA 2E1WA 2ON3A 4BI5A 1FP8A 3WH5A 1DL3A 2Z1VA 3HJEA 5CH9A 3KBMA 4A4AA 1LL6A 1B3OA 2W9MA 1OB0A 3ZS4A 2PRHA 2PTZA 2Z00A 2ICSA 3TLQA 2PRLA 2VGBA 1Y65A 3EX3A 2R1MA 3O0FA 1KRBC 5FJRA 1UD5A 1T8QA 1CXFA 4GD0A 3LLDA 3CEUA 4KRTA 4CU8A 2X8CA 4F8XA 4J28A 2VD8A 4XKYB 3LXCA 1EWEA 5D38A 3MQTA 2NVDA 4PULA 4DZAA 3EDKA 3IV8A 5RUBA 4C6NA 4KW2A 4WCJA 7PTDA 8RUCA 5TR3A 4X9YA 5HQEA 3WFAA 4Q8TA 3GLCA 3DN5A 1TYPA 1XUZA 4NKCA 1OCJA 3V16A 1NF0A 4B4FA 1AZ1A 4BQ4A 2PF0A 3B9DA 4JQ3A 5GQBA 3TMQA 1TV5A 2GJXB 1BSLA 4HMEA 3BOFA 4W4QA 4Z0SA 3E0IA 4H01A 1W8GA 4GG9A 1IE7C 3A7AA 2WZTA 2NV1A 1QMLA 2Z7KA 4AU0A 1KBJA 4S2BA 1GORA 3T8QA 1QPNA 4MF4A 3FVMA 1KRAC 4ZO6A 4QE4A 2WKGA 4D8LA 2OSXA 2FH6A 2GZXA 3B0XA 3G1VA 4HNVA 5D2YA 1X6UA 3R5EA 3UWVA 2ZX7A 2CKSA 2O9TA 4OBSA 3S83A 2I14A 3GB6A 1KFEA 3SCQA 1HT6A 4C7FA 2ZZ4A 2OWXA 3SR6B 1EJRC 5E6ZA 2WBAA 2D2JA 3NOYA 1G4SA 4I6VA 4HZ8A 1UROA 3FV9A 4ZXOA 1IT0A 3K1DA 2PDPA 2HISA 1G4EA 1TA3A 2AAQA 5KTLA 4J2MA 3FS2A 4J5NA 1DPMA 3T78A 1PIIA 3CPGA 1C7SA 4LANA 3E38A 4NP7A 4OWGA 3WJSA 3KLJA 4C60A 5ER0A 3Q65A 3W2JA 3UPWA 2OEJA 1AVAA 1PYMA 4UR8A 4NX0A 3JW7A 3F4CA 3UXIA 2C18A 5A6TC 5FAJA 2CZEA 3NVVB 3A3HA 3I6EA 5GNYA 1O5XA 5JUVA 3A9BA 1UMYA 2J24A 3RR1A 5G2HA 2TODA 4ZGYA 4H6EA 2Z2AA 4IIDA 2WVSA 2BG5A 3HURA 1WBJA 5DMMA 1S2UA 4L4PA 1J93A 4LS0A 3QFAA 4NIRA 2ZIDA 1EJTC 2QCEA 4U3AA 3L2IA 4QQ3A 3WX7A 1N55A 2VX5A 2XVKA 2ACRA 3W3OA 3TC3A 1VCGA 1XRFA 4F0RA 1LM1A 2EPNA 9CGTA 2G3NA 4URIA 1CEOA 5FJOA 5FEPA 5G4WA 3PPHA 3TJIA 4HZ7A 4NZ5A 3BJFA 4R5EA 3BICA 3GDLA 2J7GA 1YE6A 1RUSA 5JBDA 2X40A 1VBUA 1HG3A 5A6AA 3ZJ6A 5A8NA 4AHQA 1CXEA 1GVFA 3GG7A 4B5NA 2BGQA 1XKYA 1MEHA 2PDJA 2WKLA 3UJFA 3LSCA 5E9XA 3CL8A 1E3XA 4DXXA 4ZBCA 1PJ9A 3BLLA 2V3DA 4FHAA 3TUUA 1VR6A 4RPQA 5BWAA 2DZPA 1UKQA 1H1ZA 3BQ5A 2P10A 2ZZ6A 3L68A 1E0XA 2DT1A 4PSPA 1F07A 4CLMA 1E6XM 4TX8A 2XGZA 4QS6A 1B3VA 1XLKA 2WVVA 4H4PA 3ELFA 4GIAA 4PCTA 2HE8A 4UQCA 3RCYA 5C70A 2O56A 5CPQA 1W8SA 2GLKA 4GFSA 4GI9A 1UWAA 4NX5A 3BJSA 4IFKA 4M6UA 1XIFA 4CQDA 5HINA 3RK8A 1IZJA 4C1NB 3LK6A 3CGCA 3W1NA 1W32A 1BVNP 3WJXA 1PS9A 4DHGA 3G3DA 2H6RA 3PUDA 1BWKA 4LUSB 3BTNA 3MCNA 4ZXLA 3EB2A 1FHDA 4GA8A 3EA2A 2W67A 1HGWA 3ZVIA 3CV7A 3B9JB 4XUGA 3M47A 3ZLFA 3PWGA 2XGBA 4JHOA 4K8DA 4O52A 2NLYA 1KLYA 2YBTA 1UIOA 2BNJA 3VKAA 4OV9A 3OJGA 3ARXA 5ABGA 4EKJA 3WJYA 5M5DA 4HNCA 3H4XA 5D2XA 2BV9A 2PDGA 1H51A 3A4XA 1VH7A 4L4MA 4IGHA 1DIOA 2X50A 1V08A 2HVNA 5K9CA 1CXHA 3BWWA 3DHUA 1QI4A 4GH1A 2NW0A 3QPZA 3R12A 1Z48A 1UD4A 5AHLA 3FJ6A 1UR0A 1JZ4A 3H22A 3PS7A 2RJHA 5AHEA 1FXPA 1RP8A 1K77A 1S1PA 1UP3A 3TA6A 3RX3A 3R1ZA 4JOMA 5I09A 4DZIA 3E0VA 1GKPA 1QI3A 3TW7A 3E1F1 3QHMA 3RXZA 1W2VA 1RH9A 3AIUA 5E5CA 2R82A 1FKXA 4FS9A 2JK6A 4F0SA 4NZJA 3U5YA 3R07C 4GYPA 3R8HA 1LVLA 3PJWA 3EKLA 3L23A 4HOWA 1JRPA 1K4GA 1XIDA 3SY5A 2X2YA 3W1RA 1NOWA 4ZB5A 1B3YA 3M0IA 3AAMA 4Y9PA 3QBUA 1IEXA 1YXYA 3INPA 3A22A 3MWCA 1O4UA 2BOEX 2HWGA 2EG8A 5HANA 1KFBA 3IAPA 3VIHA 5FEWA 2DFAA 4CKQA 2R1KA 1JR1A 3OO2A 2DT0A 1E9LA 4Q4MA 2P0OA 3HPFA 3VOHA 1AJ2A 5HNTA 1E4LA 3AYRA 1ALDA 2Q71A 4W89A 5H91A 4JTCA 5AB3A 5T9BG 3CUIA 4JAWA 2PMQA 1BEUA 4GLEA 2GR3A 5I5RA 1KR0A 4HSNA 4AD4A 4LYPA 1EP3A 3ARPA 1DV7A 3W29A 2WZHA 3WELA 4TU1A 4NI8A 3FOKA 1S38A 5I23A 1ZCOA 1W5OA 2VXNA 1P43A 3IARA 4Y90A 3VI2A 4TQTA 4W93A 5FJTA 3URHA 4HD5A 1A53A 1A5AA 5LA2A 5HBFA 1EX5A 2I17A 1CDGA 3DFHA 1X98A 2PDYA 3MBFA 5BW6A 4QITA 3G8EA 3AHXA 3NTYA 3BAWA 3VNLA 1ZS2A 2YAUA 1AW1A 1DE6A 1LRQA 2XINA 2JK2A 4GIYA 4MPKA 2P0IA 7CGTA 1ME9A 2WVTA 3CUXA 5LIYX 3PBWA 2H3DA 3VIFA 2OWCA 1ZKQA 5LNRA 3LI0A 2MANA 2AAAA 3UG4A 5I3JA 1VAHA 3H6OA 3HZ3A 1KA9F 4ZB2A 1TQXA 3POCA 1C8YA 5FAGA 1YDOA 3DJJA 2XIBA 5CSSA 2NQJA 4EPBC 1WPCA 3VC6A 1IEIA 2WK2A 5EU9A 4Q8PA 3ARUA 4ZFMA 4RV3A 1QATA 3KRBA 3LOTA 2Z27A 2Z1KA 1Q4NX 4Y2WA 4ZVJA 4LWWA 1H7PA 4GYPC 2J77A 2H8XA 2QAEA 4HK7A 1A47A 1A5SA 4JN6A 5H8PA 2W62A 3W82A 2OMAA 1MWOA 5TAOA 4P8WA 3TSDA 3A4AA 3OZOA 3M44A 1GRFA 1E4MM 2CZ5A 2CLHA 2YA2A 2ZUNA 4S1FA 1UYQA 2CFFA 3LQGA 5AECA 4KWVA 4JTDA 4IQDA 1UH4A 1CYGA 3JU2A 3T4CA 2J75A 1Q6GA 2ZICA 4JN7A 4X2RA 1KKRA 3MYPA 1EYWA 1GOMA 2OYLA 2VDGA 4I9MA 5BXTA 4I7WA 3GH7A 1I75A 3AFBA 3GAKA 4RZ5A 2I16A 3KRSA 3UZYA 2HVMA 1QI2A 4QCEA 4WJ8A 3W2UA 3K2GA 3EKGA 1WDPA 1JD9A 2H9AA 4CQBA 4LBUA 4PBEA 3I7QA 4FF7A 4IL2A 1OWQA 1EPXA 4UQDA 5EL1A 3AU6A 2RDXA 5AHMA 5FL0A 2A8XA 1SMAA 3HQOA 4GKLA 4JTTA 3W7GA 1M7XA 1W3IA 1JZ5A 4RCXA 1W3NA 4TVWA 4JNZA 1GRGA 3CHEA 2CITA 5XIAA 4LQ1A 4AIEA 2G96A 4ILSA 2Q01A 4F2BA 1DEDA 4BEUA 2ZWZA 2EBNA 3RGTA 1QW9A 2O9OA 5HWNA 2HPIA 1D3CA 1UD2A 1JAKA 4ML9A 1MNSA 3W81A 1KKOA 2REQB 4FR6A 3OGSA 4UTJA 2HNHA 3WNNA 5I3GA 3GU9A 1HX0A 3P0WA 3LRLA 1EYEA 4AVOA 4PB3A 4IT1A 4PTNA 3SUSA 3PZOA 2Y7DA 5K4XA 3WQGA 4MZ1A 4UQBA 1Q1RA 1M41A 3MMDA 2Q3OA 3TYEA 4WY0B 1XM3A 1RD5A 1HTIA 3WN6A 3BGJA 3M4HA 2PEVA 2BLEA 3AXHA 2WCSA 6ENLA 3BGAA 3FY1A 2YB1A 3PUEA 5G5HB 1HIZA 2AQWA 2YL6A 3GW3A 3GDTA 2WC7A 2WHMA 4ZQNA 2VOMA 2CWNA 3WMSA 1J12A 2VC7A 3TXZA 1L6WA 4H9VA 3FXGA 3OG3A 2YFNA 4TMCA 4OV4A 2G5WA 1WZLA 3O6YX 3ZT6A 4F0MA 3WD4A 1TIWA 2ZXAA 3UZJA 4N42A 2H90A 3VIMA 2WSRA 4BHYA 3BSGA 3NQ6A 1H49A 4LS2A 1HVQA 3W2MA 3P60A 4FXFA 3VNJA 1RCXB 2ACSA 3GHRA 2Q8ZA 4GQQA 4UR7A 3MU7A 3BLFA 3W75A 3CU2A 2E7FA 1X8FA 2GFTA 5E70A 3W27A 1XLAA 4G9PA 2F38A 2VL4A 4XG1A 3DFSA 1Q6LA 3S1UA 4UTIA 1V8EA 4MOZA 4OGZA 1V02A 3LHYA 2PSNA 4EPDC 1KWGA 1R2TA 1IIHA 2PC8A 3FJNA 1Q7MA 2WPFA 5E0FA 1X1ZA 1GHSA 3M0XA 5GVJA 1QUMA 2DORA 4RDVA 3L9CA 1Z9AA 3VIGA 1K03A 3S6TA 3TYUA 4D6GA 2W0HA 4WKFA 3VOFA 2I57A 2ACQA 3VAVA 3W88A 4A8RA 3OC4A 2R24A 2NWRA 3R25A 1QRQA 4ZO7A 1IYXA 4IIBA 1XRTA 1F74A 1W3JA 1HJXA 2W3ZA 1M6JA 2W91A 2Z2UA 5D9NA 3UNDA 4XKYA 5DMYA 1E0UA 3TXVA 3CL7A 4UQAA 3R4IA 2FHBA 1RXOB 1K8YA 1N8WA 3GE7A 3VE9A 2OKOA 5TD4A 3W72A 1NARA 4BK9A 3BAJA 4ZQRA 2Y6ZA 4O18A 2EPMX 2PLKA 3VKJA 3W00A 3NZRA 5CSYA 2BZNA 3AYVA 1GK8A 1KM3A 1T40A 5KZEA 3ES8A 3OVRA 1Q66A 1YEYA 2GJXA 3O3RA 4W7WA 2DEPA 2WHKA 2YBVA 3DX5A 2DZUA 4I5XA 1NHPA 2ZUVA 3H53A 2BOGX 3GHSA 1OYBA 5FOOA 2A2IA 1OC7A 3HQNA 4NVTA 1NDWA 2C3ZA 4FI4A 1FQ0A 1O7AA 3QW3A 3AIVA 1JJKA 4D9PA 4H4VA 4W5UA 5PTDA 1IXQA 3I7SA 1YX1A 1KTCA 3PPCA 2PDMA 3LDVA 3FVDA 3WLLA 1NQKA 3GVRA 4AAJA 1XQKA 1N62C 2F7FA 3BMVA 2VVNA 4RDZA 5HWJA 4DAFA 4MY1A 2B7NA 2WHJA 1EQPA 1GZGA 1DP0A 3WDRA 1OINA 1S7MA 2VEKA 4BV6A 4MVAA 3RPMA 1YIXA 3PJXA 2E25A 3GHUA 1F76A 1TZ7A 5A1AA 3H23A 2H8ZA 3ARYA 4IIFA 4R7OA 4MWAE 1B3ZA 4A8NA 4ALDA 4MMWA 4GX9A 2QDHA 2BXZA 3UERA 4Z1DA 4DO4A 1BXCA 2GK1B 2CBUA 2VM8A 1BF6A 4D72A 3CZ8A 5FS7A 3T2QA 3UP8A 1J2WA 1NQ6A 3EB3A 3EDJA 3CT2A 2V3AA 2CPUA 3BL3A 4J3UA 4P61A 2QCFA 3M5ZA 1R2SA 3B0YA 1DIEA 1RLDA 1SO6A 4CQ8A 3NSMA 1W1YA 1EUNA 1YTDA 3BV7A 1SJCA 3LGDA 1ZBCA 4YU1A 4JN8A 3WEOA 1Q2RA 1XHGA 2BWGA 4JEJA 1TO3A 1LLOA 3N18A 3VNZA 4HN8A 4GNKB 7ODCA 3OODA 5DT5A 4IUOA 3SY1A 3AM9A 4Q7NA 2CLLA 2A85A 4FOKA 3T81A 2Y61A 3TAKA 3M0JA 4UIOA 1OBAA 3CTTA 1TPVA 2E6FA 2WBGA 4M3PA 5F2GA 1L6GA 1DQUA 2ISFA 3DK9A 3W6MA 3K1GA 1XLLA 3WDHA 1BVWA 3EMQA 1LROA 5HQLA 3QTGA 2Y8VA 2QCLA 4R3UA 4FZIA 3ITYA 4NJKA 3SQMA 4LUYA 3ITGA 4DO7A 4WKHA 4ZSUA 4D8ZA 5BXRA 1J0HA 2Q3RA 1JPDX 3M6DA 1D2KA 4Y9NA 2ZVIA 5CGQA 1FWBC 1ADDA 4QJ4B 1WB0A 1TUFA 4Z17A 3BAIA 3W86A 4UMBA 4AW7A 1EGVA 4DNHA 1VIWA 4AVNA 3UESA 2OODA 5JCKA 4N6FA 2D3NA 3KRUA 4P5UA 3R58A 3M0MA 3K8LA 4TVCA 4YCOA 4JTGA 2ZA1A 3FAXA 3Q4DA 1K9TA 1L6FA 3AQUA 4WJXA 4XIMA 1PDYA 1QR7A 4JFSA 1FWJC 1Z3NA 3WO8A 1ISXA 1V7AA 3EANA 5FJUA 3GXFA 3W53A 1KTBA 2JKAA 4MADA 3WLIA 1BWCA 2UY2A 3V5CA 2I5IA 1LQ2A 4RJEA 3ZMRA 2EKGA 4PCFA 4CD8A 3P8IA 3W85A 1EPVA 4L1XA 4C1NA 2X8RA 1LT8A 2E4TA 1Q6CA 1I6NA 4ZO9A 1MFVA 3QKZA 4EPKA 8XIAA 4GBDA 3N04A 4LX4A 4LUSA 3UWEA 5U25A 4S3FA 3TJ4A 3YPIA 2YDQA 4MYXA 3D9XA 2ISWA 1PZ0A 3UVAA 4BWLC 3GSMA 4K68A 3F2DA 5A95A 4MIMA 4H3DA 4EACA 1F61A 1DQXA 3OGRA 4CVWA 2V5CA 4GPNA 1QW8A 1XV8A 3LMZA 5BU6A 3NM1A 1QO2A 5AVHA 2XIQA 1KN0A 2DIEA 1UZ1A 1KXHA 3CQ0A 4IXHA 1GSNA 3GTFA 2YGYA 2OYKA 2ZADA 3T40A 2QCMA 2D2HA 2CLPA 3IGHX 2Z1BA 3CJPA 1RQHA 3PSVA 5K2ZA 2V2DA 3FN9A 3TR9A 1X96A 1SFLA 3CGTA 1JROA 4DYEA 3GG1A 4NNAA 1A5LC 5BROA 4MAZA 2J7CA 1AD4A 3VOJA 4MB1A 1JNEA 3TSMA 4QGCA 4G1KA 4GUIA 4IUGA 4F40A 3WMLA 3S2JA 1DWJM 4O1DA 1MFUA 4B5SA 1VGAA 2YW3A 1UH3A 3NVTA 3B8VA 1UZHA 4M8UA 3BLPX 3M7SA 4MUZA 1D9EA 1GG0A 3F1QA 4RR4A 2V2HA 3G0XA 3MUIA 1E0WA 4PUDA 2WNZA 3AHTA 5CZSA 4B5VA 1TPUA 1FEAA 3ZWTA 1TVPA 3KEHA 3VO0A 1J11A 4V2XA 1UKOA 2XSXA 3OLGA 4G5DA 1HXJA 2W0UA 1NPXA 3CL6A 2FVLA 1KGUA 1B54A 3I4EA 3WLRA 4I8YA 2CKRA 3TROA 3URAA 4XTDA 2WOWA 5C55A 2YCEA 3NQ8A 3O16A 3W76A 1VBHA 1SFSA 4MLJA 1P0NA 1JDAA 2V6OA 1RA5A 2PDLA 1XICA 1KCKA 4YYCA 2ZUSA 1Q8JA 3LEPA 5FCZA 4QQUA 4V27A 1FWSA 3BOLA 5DELA 2GQ8A 3L5MA 1LBMA 1PVNA 4H4QA 2A7NA 1TIMA 2AGTA 3DYPA 4IIHA 2INEA 4JKKA 3NR0A 4AWUA 3T42A 4KWUA 4YYFA 2R8WA 3W1UA 1GEQA 3P8JA 3W6YA 3M0LA 4GC4A 3IRSA 4A35A 4PUNA 4RE4A 3T6CA 1FA2A 1NWSA 1XGEA 4ADSA 4MLRA 5CJMA 4CEUC 3HOJA 1OCBA 1QVBA 2W4XA 1M53A 3W7KA 1ECQA 1TYGA 3WQWA 3SCSA 2DZWA 4NZFA 3CQKA 2WB5A 2R6OA 1FWAC 2QUTA 2R94A 3ARRA 1J5TA 1Q6QA 3WL0A 1FHUA 1W5PA 4GISA 1OJXA 1RALA 4L6HA 2NPXA 3LUTA 3BCFA 4M6QA 1RPXA 2V63A 1GYNA 4A6GA 1ITUA 3AROA 2X99A 4Y96A 3MUCA 4YHEA 1SPQA 2D22A 1Z6KA 3G6MA 4QSHA 1HO4A 1DVJA 1XW8A 5ABFB 2RGLA 1V03A 2EPLX 4GOAA 2OXNA 2X42A 2DP3A 4J9JA 5B7YA 3AS2A 3RO6A 4JBRA 4AYSA 1F4HA 3RPDA 4CQ9A 1A0CA 4IGSA 3UXAA 3LV6A 1U5HA 3FXYA 4O1AA 4Y8EA 4UMAA 1S2TA 1H11A 2ZUWA 1YLVA 3G1FA 2XIMA 1JF5A 3MC5A 2X0HA 4O0KA 3C0SA 3U2CA 1XSJA 3T1GA 1KM6A 4LU0A 3ATYA 4FNPA 3BVJA 1Q6EA 3EWYA 4PL2A 3UD6A 3GXPA 3VVGA 1YYAA 3ONBA 2Q8XA 3UR8A 3WLSA 3GIYA 2WJFA 3W73A 4JL2A 4DWSC 3C2RA 2DVTA 1TWSA 2W55A 2QIWA 4DZ5A 2OR2A 1GQJA 5KINA 1XLFA 1AMKA 2F6KA 1NFGA 4AC7C 3WLPA 4GYKA 3SGGA 4MJZA 1KCXA 5AC7A 4P7QA 3ARQA 1S2CA 3EOOA 3V3WA 3GFXA 3LBOA 2AAMA 1AH4A 1PAMA 4BQ5A 3R11A 2REQA 3W24A 2Q02A 3TZNA 1AJZA 2JEPA 1KRMA 3DGHA 1JULA 4N2YA 3P5ZA 3HGRA 1US0A 3L21A 2OQYA 1A5NC 4JS3A 4FIQA 5A2CA 1J4EA 3GRIA 2OZTA 5CJ5A 2P3ZA 3CHVA 3S2NA 1LOQA 3QV6A 4QHRA 4WY0A 1P6WA 2PGWA 4EXBA 3GC4A 3WH9A 3QQWA 2PDIA 1TWDA 3XISA 2ONEA 2XSAA 1A80A 1JZ2A 1SW0A 2PWVA 3NUKA 3BE7A 2E67A 3G24A 2VEIA 2V5BA 3GU2A 1BRLB 1CXIA 4O15A 3W1AA 4US5A 1HKVA 4ZE5A 2X8HA 3KBJA 1TRDA 2ZXDA 1DWGM 3LPFA 3HU7A 3IC9A 5A2BA 1HF6A 3DH7A 3KBWA 3LHTA 5EMYA 4H9UA 3NVZB 4MPQA 3PZUA 3RLGA 2BY2A 1CTNA 3CAQA 3I6RA 1REQB 1IV8A 3OVQA 1TPB1 4ADWA 2PAJA 2EAWA 1RHCA 5DCBA 3QR0A 2CBIA 3A5FA 4LRSA 3MZ2A 5E9AA 3KVMA 1K6WA 4KCVA 4ZSTA 2IPGA 1XLEA 2YCLB 4ZTYA 4R27A 3PNZA 4OVXA 2J66A 1LOLA 2O7QA 4F66A 1GQNA 4BQ2A 3RU6A 2O9PA 2C13A 2VHLA 3QC3A 4HA4A 1R5YA 3GZAA 4UTMA 3AMGA 3R10A 2J9XA 1H61A 1J96A 4JTEA 1W9XA 1FWRA 2YZ5A 4DJDD 1RLCL 2XFFA 2BP1A 3U8GA 4Q8WA 3GKAA 4XSMA 5A6MA 5CG7A 1K7EA 2YLAA 1ZJHA 4I6KA 2VUYA 3Q6JA 1Y7VA 4JTQA 2PURA 1FOBA 4X63A 1XGDA 1OF6A 3OYXA 4PRWA 2IPFA 3VMPA 1BYDA 2X1RA 2G50A 4HZMA 1DXEA 1GJWA 1CGVA 3EWCA 1LG2A 2IQ0A 4KRZA 3IJDA 2XGIA 4GC3A 1L8NA 4NT0A 2JBMA 4L9YA 3BAYA 2VFGA 3L4UA 3NZQA 3VCRA 3WNMA 2X2GA 4FEZA 3WJWA 1R3QA 2AQOA 1E1EA 2PZNA 5IHRA 2NSOA 3DXIA 3QM3A 4IMGA 3U2EA 5KITA 2EG7A 3N6JA 3RRXA 1XWYA 1LTDA 3NPWA 5REQA 4WHBA 1Y0EA 3N12A 3VKBA 5E93A 1CNVA 2A3HA 3G1SA 3H26A 4NASA 4GY0A 1ISYA 1POKA 1Z32X 3W1XA 1E6QM 2I5GA 3ITOA 1W9BM 1ZJAA 4HU4A 4DUOA 1RCOB 3QZAA 3REQB 1QJWA 4O1FA 4DIAA 1W9UA 2PDNA 4H6RA 2YA1A 4HCLA 4PUWA 1UHVA 1XCFA 1NTHA 1MNZA 1PKYA 3IV3A 3PR2A 1VZWA 5D2TA 3FDKA 4GY7A 5AYBA 3LTPA 1UUQA 5EA9A 1OFPA 4EWJA 3F5LA 1I2PA 2GSJA 1DWAM 4Q4SA 4HNLA 3U6WA 4HN4A 2G3MA 2DV0A 3DCPA 3DH9A 3IIPA 3FFSA 3UJ2A 4NL1A 4CU7A 3NYDA 5BRQA 5HDRA 1NFBA 3ZR5A 1GRAA 4XAFA 1OF8A 3SECA 5CLTA 2GK1A 3UW6A 2GR0A 1Z41A 1MEIA 2FFIA 1AL8A 2NLIA 4A3UA 2J13A 1IWBA 3ZIZA 2QJJA 5L9FA 4ZENA 3ALGA 3NNTA 2IKHA 1EGZA 1R9XA 4IQJA 4MB3A 4M56A 3A47A 5FJIA 3D5HA 3QR1A 3O15A 3FJLA 1DXFA 2VZOA 3QJAA 3GO2A 4OOZA 4JTHA 3VCCA 2YCKX 1OVDA 1UP0A 5AYZA 2Y5JA 4AWEA 3CEPA 2C19A 3MPGA 5D9MA 1Q63A 1XYLA 1WDSA 3V1PA 3WH8A 1OK6A 2YLLA 1PZ2A 4WKAA 4DF0A 4Z2GA 3UYIA 1R3TA 2BGNE 2OLAA 4H6QA 2EPKX 3B9NA 3T8LA 4JYEA 4EVZA 2E5CA 1D8WA 4MHBA 4AZCB 4MZYA 3W87A 1OIFA 4F0LA 1QK0A 3VIKA 2CLKA 4IPIA 1KO0A 1KM1A 3DFNA 3TP4A 4PUUA 1FWIC 2KX9A 4O53A 5D9OA 2ISDA 5C9XA 4GKTA 1OT2A 1LQ0A 1MXGA 3OZPA 4AWTA 3LPGA 8CGTA 4EOUA 2EQ6A 3LPPA 3QFEA 1XRSA 4XX6A 1OD8A 3RITA 3LCXA 3CM4A 4FOUA 1DJGA 3KHDA 4KGLA 2VQUA 3BMXA 3HG4A 1I0DA 3MSDA 1EQCA 3LRKA 4GVIA 1R7AA 1MEWA 2PLJA 1CCWB 3KVLA 3EWZA 3B97A 1MW3A 2PZ0A 4GO9A 4WDXA 3HRDC 3OZYA 4K36A 2J8TA 5I3IA 4NILA 4QJ1A 4WDWA 1H09A 3G1XA 4LVFA 2NUWA 4XKMA 4DX3A 3L66A 4WK9A 2FVKA 3N6QA 1LBLA 5CZJA 3RM4A 1TJ1A 3BMWA 1O94A 5HNRA 5JBEA 2FH8A 1GEUA 1X2HA 5EBAA 4DAIA 4GRSA 4F0HA 4Q8OA 3C52A 1J0IA 1OG0A 3WCZA 3LCHA 3K13A 1PHQA 1D3GA 5DQPA 5FJPA 1CGXA 3C5QA 3SZ8A 2PDQA 5EY5A 2OJPA 3ZWSA 5HPCA 1EOMA 3L5LA 3M43A 1NJJA 4PE8A 2E3ZA 4JIEA 3KDOA 4RLIA 4UTUA 2ISSA 3EEZA 5CPTA 1Q3NA 4FF5A 2C1IA 3U3HA 5HQMA 3IJ6A 3RAOA 1BG9A 2VI0A 5LNUA 3RLHA 5T26A 2V5DA 4CUCA 4UOJA 4CVUA 1V02E 1Q5MA 4NAEB 2ZTKA 1DQWA 2VEMA 3MI3A 3QGAC 4Q7IA 1DXIA 1QPKA 3EXRA 2FTPA 1GPFA 3UQNA 2BTMA 1VF8A 1RR2A 1S5VA 5TF0A 1DORA 5CC7A 3RX2A 4QE1A 3OLIA 4FX9A 1H6VA 2CBVA 4B5WA 4ICNA 4U3CA 4QNEA 4L5ZA 3JZEA 3DGRA 4OU1A 3VA8A 3GYEA 1H7RA 4OIFA 3WQ5A 1JYVA 4BS0A 5AOUA 2OQLA 3GTXA 2EGZA 3TNOA 4E6MA 3C86A 1C9WA 3IS4A 3LXAA 3VD5A 4BZYA 3RRAA 5LGZA 5A8GA 3WBXA 2WQPA 1H5VA 2VEFA 3QV7A 4H9YA 2YX0A 3QOMA 2YVGA 3WBAA 3N15A 2O55A 1GOKA 1BQGA 4K8EA 3VIPA 3H2FA 3UWZA 4ZQMA 1VQZA 1EP1A 4QROA 1ICSA 2VZUA 5DO8A 1C90A 3WL1A 3CZLA 4DNAA 4QX4A 2VKZG 3LZ3A 3RIKA 3UXKA 3WQ8A 1OFRA 3O9NA 3NS1B 1AJ0A 3ZXWA 4G8TA 3OVGA 3SIZA 1DJQA 2F6XA 2V0TA 3H8AA 1O60A 4DO5A 3ENLA 4DBEA 5C7HA 3VUPA 3V5OA 4LVBA 1NHSA 1PKLA 5CEWA 4KT2A 1LUCB 4MG4A 1XD0A 3QN3A 5K9DA 1BFNA 4KBXA 5IBXA 3L2MA 4KIEA 3GTHA 4PTVA 2IPJA 1XLIA 2ZDRA 1M5WA 1QWKA 2JF7A 4O8AA 3DFTA 4TVDA 1PTDA 4MFEA 3B9EA 4HQVA 3QHOA 3SRKA 1TPEA 3AMZA 1J01A 3LCFA 1Q1WA 3PG9A 3W26A 2QGHA 4Q4PA 3W1TA 1UWIA 3P82A 3W7CA 4LJ3A 3PUOA 3ZZ1A 5IDZA 3NRZB 2WMHA 5C9WA 4PL1A 1MW0A 1UBSA 4AD1A 4LAUA 4DYKA 1NF7A 1AQFA 3A6OA 4O1CA 2A7PA 3MUAA 5AC8A 3PSWA 1SJAA 2GVLA 3STPA 3IGXA 3N9RA 1G01A 3W7QA 2XH0A 3WLOA 1ITQA 3I4KA 1FY6A 2QDGA 4O10A 4R7JA 3R8GA 4C5YA 4TTUA 3SRDA 3WF3A 3E5BA 2DH2A 5A2AA 5FS9A 4N4PA 4EX4A 4YTSA 4PC8A 6ALDA 3O07A 1JDDA 3DYOA 3ZT7A 3BLKA 3CV2A 5GNZA 4PMUA 4IMFA 1SGJA 5D8ZA 1GETA 5FI8A 4K7YA 2FIQA 3EPOA 4K7ZA 1NM9A 3H54A 1XPGA 3S4TA 5CZKA 3N9SA 4O57A 3AUJA 3AXMA 1YBQB 5ECUA 2C7FA 3A4JA 3FSTA 4BY3A 4Y6GA 4AISA 3UF9A 5AC4A 2XIOA 5A94A 1ML1A 1TJ2A 5LNVA 4H4IA 4KCTA 1W91A 1W2PA 4Y9MA 2CW6A 2IUZA 2JKEA 3GG8A 3UWUA 2A3AA 3DIPA 1E51A 2WPCA 4S3JA 4NEVA 1B1YA 2J7FA 1QHPA 1S5NA 2GGIA 3AIQA 3QSTA 3STFA 2ABAA 3BCDA 1WNOA 3EWXA 1DIDA 3GKFA 3MWAA 1SR9A 3KE0A 3KWSA 1LRTA 1EKOA 4HA1A 1K4HA 3NCOA 2PP3A 1HL9A 3GWQA 3VOGA 1GNXA 2X1IA 1E5NA 2QT3A 5HJXA 5LIKX 3WNKA 2NUYA 3CLMA 3DECA 2FB2A 2P1FA 2VWSA 3SB0A 3B0PA 1GEHA 3BH4A 3N4FA 4IPNB 3D0CA 1QFEA 4C5ZA 2GGGA 5EB8A 3IK2A 4H8VA 4AEFA 2P8CA 3WDJA 3WJZA 4Z2HA 1KGXA 4PCSA 4UUIA 1GVQA 1GWJA 1TV8A 4AH7A 1JXJA 1ADSA 2DJLA 3NDYA 3WG6A 2C6QA 4P8XA 3J7HA 2QKFA 3ATZA 4QG9A 5D09A 1OFOA 4QS5A 4TO8A 4C6MA 4LB3A 2E5BA 2X1TA 4WQ6A 3EMCA 3DFOA 1GZ1A 1M7JA 1R7OA 3DI1A 4BJHA 2X1SA 1DWFM 4PMNA 3RMJA 3GR8A 4LXFA 1E71M 3PG8A 1W54A 1UC4A 3S5YA 4UFMA 4IOTA 4C90A 2WHLA 8A3HA 1VYSX 4L64A 1XDMA 2IPWA 1V6WA 4JTRA 3TJLA 1CIUA 4YXGA 3NO1A 4DBDA 4I8DA 3CUZA 2ZRUA 1OFDA 3CB3A 5FL1A 2WNNA 3GNDA 3AZRA 4DJEC 5BRPA 2F2HA 2CZFA 1UWTA 3NSNA 4W8AA 3F7JA 1H2JA 1JPHA 2HROA 3LU2A 4H9TA 3SRFA 1REQA 3RCNA 4UFLA 2PDXA 3VD4A 2XPKA 5CC5A 4XV0A 4QSFA 4LNYA 1PDZA 3VNIA 4O4VA 1UR9A 1MDLA 3BW2A 3W74A 1PKMA 3CLWA 1JCMP 1E3ZA 4FB7A 5HR7A 2OO6A 4PGLA 3W6LA 2YCLA 3PG6A 4JIHA 2NV9A 2JALA 5DMNA 2BCPA 4H8NA 1KXTA 1ZY8A 3R79A 3E74A 3EWBX 1H5YA 1WAUA 4Q22A 1KTNA 1FXQA 3MB9A 4CCCA 3NURA 4FNUA 2YKKA 1QXLA 2J7HA 3CTLA 1VFHA 4TUFA 4JTLA 4J3TA 4WDUA 4PMDA 1NHQA 3TCEA 1I45A 4M5PA 4WX2A 3KTCA 1UZ4A 1RZMA 2QVNA 1QNPA 1XC4A 1O5QA 5DT7A 3HQ1A 3QMTA 2GWNA 2WC3A 3H24A 3KS6A 4IWWA 4LBRA 3W25A 2GDUA 1V3KA 3UNTA 1EBHA 4DY1A 4B90A 1UBPC 3VDCA 1ZZMA 5EBUA 1T5AA 1FDYA 2WMJA 3E96A 3JS3A 2ADAA 3T9PA 2GDQA 3NEVA 2P88A 3HO8A 3ZJ7A 4WZHA 4GUHA 4ZTXA 4DJFC 1AW5A 4UTTA 1TRIA 1QOXA 2ATSA 3B3DA 1ZGDA 1HKIA 2WNQA 3EWUA 5GNXA 3BQ6A 3Q58A 4U2YA 3PZ9A 1Z44A 4F0KA 1Z8AA 4M19A 1ADOA 1LJYA 1EZWA 1SZEA 4HU3A 4Q4OA 4YN5A 1W5NA 2XH4A 4PR4A 4HU0A 1QOQA 5FF4A 4K6AA 3GNRA 3KDNA 3M0HA 1CW2A 4CCDA 5IOBA 2XHYA 2Z1WA 1PKNA 3P84A 5D8WA 3KM8A 3CGBA 2OEKA 3K46A 1K4QA 3REQA 5JCNA 3MHUA 3KXQA 1D7FA 2VC9A 2QW5A 2QULA 4LV4A 2R1LA 4HHLA 3GNNA 3SGUA 2WQDA 3CC1A 2XIIA 3HJZA 3G8RA 3A24A 4YNGA 5ABTA 5I00A 1XIBA 5CGTA 2O0TA 1ZRQA 3A64A 3WY1A 1EGMA 5A6BD 2Z1SA 4C91A 4DEFA 1XBXA 4G1NA 4HHPA 4AD2A 3PZTA 3GK0A 4MWAD 5H2ZA 3FJ4A 4QIUA 2AKMA 4MNMA 3N1AA 1L8PA 1TTPA 1ZBWA 1ZPTA 5HNNA 1QTWA 1M65A 3WQOA 1RVGA 5AZ1A 1UR4A 3ABSA 1LQAA 1SVDA 1UG6A 3MP5A 4JX5A 3A7UA 3GD3A 2CWXA 2VFDA 5EMUA 5KMYA 4I7VA 1R0MA 2ZZ2A 3AMDA 2IKIA 3CPUA 3BGGA 2V3FA 4LNCA 5FMHA 4O11A 1OFEA 1MOKA 4JCMA 1P0DA 1W1ZA 4S2CA 3CAVA 2EKCA 1OSEA 4X61A 3W07A 3STCA 2BC0A 1Q6RA 3N2OA 1AD1A 3B03A 3OG2A 4I9AA 1CI1A 3R8RA 5C9ZA 3ZR4A 4ZOBA 5BOFA 1XYFA 3MJYA 2OTDA 3TZFA 1G7UA 3BXWA 3W02A 5I6SA 3VGBA 2ZC1A 5C54A 3AWOA 3RDKA 5TQLA 3FYPA 2VZTA 3CXBA 1W9PA 2Y88A 3S9IA 1Y5WA 3C0QA 2XM1A 3B8SA 1HP5A 1RJPA 5D30A 4AZBA 1OYCA 4AZCA 4QJ3B 2XH7A 1TWZA 4G7EB 2W5FA 2PWUA 1V3JA 2GR1A 2WSQA 2FPYA 2OYMA 3NVDA 4WJEA 1LWJA 2DZXA 4XAZA 4L1WA 2BBFA 1U5VA 3SCOA 2HEJA 2B7OA 4AIUA 2DU2A 5BXPA 4GR1A 1FCVA 3NAVA 4DBWA 2G37A 3ZQ9A 5M3WA 2FGZA 2YOCA 5K3VA 3DYMA 3TN4A 5D32A 4HSHA 2E8ZA 2WPBA 4KCWA 4O0ZA 2XFYA 2SFPA 2IQDA 3TWBA 4LOCA 2R14A 1YQ2A 3LBMA 3VC5A 3FA3A 3OLDA 2Y24A 1R46A 3QMRA 1BGGA 3DI0A 1F3PA 1TR1A 2A79A 3FDGA 4AXKA 3GVWA 3WYZA 1T8XA 2FPVA 4Y8FA 2A21A 4FP1A 4US6A 3WF1A 4IF2A 3MA8A 3HB9A 3MV01 3UA3A 2GPTA 1E70M 5G5GB 2VR4A 1WDWA 1XISA 5GPRA 2XUCA 1PZ1A 3ITTA 1OT1A 1XG4A 3QGVA 3UG8A 4EK7A 2YYUA 1H1YA 3BZJA 1Q7ZA 3ONCA 4YTQA 2VGIA 3UZ5A 3MY9A 4C6PA 2ZXBA 1Q13A 5D04C 4DUXA 1A0DA 1XCXA 3CS2A 2A3CA 4WR3A 3VE7A 3D6NA 1FUYA 4MDOA 2GJPA 3VYLA 1ICPA 1SM9A 3ZR6A 1HO1A 5EFFA 4Z2KA 1HZYA 1M3UA 1C29A 1HL8A 4DJDA 3H55A 1XYMA 2DW7A 2WPEA 2VRJA 4GBUA 1KFKA 3QR3A 5F4XA 4NZ4A 7XIMA 5DFAA 4EMJA 1GT8A 2NXIA 2D3LA 4MDPA 5FESA 4JCLA 3LNPA 4GX8A 2QGYA 1Q45A 3FKRA 5BXSA 3VGGA 4NAEA 4Z42C 2AL1A 4HOZA 3L12A 5CLWA 4ATDA 3AZSA 1OX4A 2CC0A 2WMKA 2ZRWA 3E0LA 4E4UA 4DXKA 4PEEA 1HVXA 3NOEA 3WNLA 1G94A 1H7WA 2Y7GA 4WY0F 1F3EA 3B8UA 1K02A 2PLCA 2X41A 1QPRA 4D6FA 4AXNA 4AHOA 1EBGA 3PTKA 3QY7A 3GIPA 3EA1A 2GWGA 2IQTA 3TDFA 4ADTA 1EXPA 4MM1A 1QNVA 3O06A 1TE6A 4PH6A 3LNMA 4WXZA 2BHZA 2E28A 4ERGA 4H19A 4YWSA 2JGYA 1DE5A 3AICA 1P6CA 3LS9A 3NO3A 1KM2A 3C56A 1R87A 1UOKA 1ZSXA 2W92A 2Y8UA 2UBPC 4NJJA 1PTGA 1KR1A 1IZCA 1FDZA 3GDKA 4BF5A 1I1XA 1H7OA 2GGEA 5BOEA 4XZIA 4AUBA 1YNQA 4M51A 3W83A 3G3MA 3MDWA 2PDCA 4UFIA 5K9XA 2KZHA 4MUPA 1OC6A 4MWAB 5CCZA 4YJ5A 1LT7A 4W85A 3UWWA 3M07A 5I02A 3DG7A 4JNYA 2DSKA 3R7MA 5A8PA 5CC3A 5G5IA 1LUCA 1H3GA 3CV6A 4WSJA 1S2WA 3A9IA 1GQIA 5HXMA 1GVSA 3R6IA 3THUA 4D6IA 2VNCA 4IPJA 1F3WA 3P74A 4GNVA 4UC5A 4RZBA 4FLOA 4QM1A 2RH9A 4M24A 1GV4A 1U1UA 4IPLA 2KAUC 4RXGA 1T7LA 4RZ6A 3VKDA 3SRHA 4ZEPA 2JKPA 1UWUA 4PCPA 1XLDA 3GNXA 5DXYA 3QTPA 3VXGA 3EMZA 3U2ZA 1AH3A 2DGAA 1DJNA 2FQIA 4XWUA 4UFJA 3KFTA 4R88A 1WZKA 3F03K 4C6JA 1XYBA 1OCQA 5I3DA 3MSRA 4ZMGA 1K9EA 4BEQA 3IGSA 2PC4A 1ZLPA 3UBPC 2DQXA 3TE9A 4EP8C 1GRTA 4YVPA 3HV9A 1XLGA 5AKQA 1GXFA 4MSSA 3N29A 2FFCA 2VO5A 3L4WA 1QI5A 3ABQA 3ECQA 3B40A 4IL0A 2G41A 3B8IA 1VCFA 5JCLA 2E5AA 1GQKA 1W3TA 1EDQA 5GJNA 5HNUA 3DERA 1A5MC 1BPLB 1U1HA 1LBFA 4TVUA 5DN1A 4PMQA 3PAJA 4B91A 5DANA 3P5YA 4LY8A 3S2MA 5G1MA 1N8FA 2J3NA 3EWDA 2CFYA 1SYTA 2OLHA 2VZVA 3GHTA 3POHA 4NUWA 3BARA 2ZOXA 1US3A 1YBQA 3FW6A 2BMBA 2YA0A 3NQBA 3HGSA 1E56A 2HK0A 4IHCA 5L6UA 1K7FA 1W0MA 2GVYA 2D2GA 2YXOA 4JTKA 4IFRA 1B57A 4ZR8A 3UPBA 3GTNA 4E2VA 1JD7A 2QCGA 1O95A 1LYXA 3VUSA 4JNMA 2YR1A 4FDCB 3L7RA 5BOOA 4LCRA 1O6IA 1CPUA 3NL2A 4GJJA 1F8MA 3LD5A 4CD4A 3IIOA 3WQ6A 1GHRA 1UASA 4FNTA 3G1YA 3GW0A 2J8FA 2PDFA 3NSXA 2A0NA 3UR7A 5K4ZA 2WW5A 2FPTA 1ELSA 4DF2A 4G7FA 5BWFA 4AD3A 4H4YA 2VDIA 1R47A 2E3TA 2WSKA 2VZSA 2WC4A 3HGJA 3DKJA 4H7VA 4BFAA 2DIJA 4TXEA 5E09A 1N7KA 3TH6A 1LZOA 3UG5A 3L0GA 2GOKA 4PFHA 4FLSA 5ABHA 3ITLA 4XBSA 1JFXA 1IWAA 2NVKX 4JY8A 1IWPA 1WYIA 2Y1HA 3FIGA 3NQEA 1P1XA 1R38A 3VDGA 1WO2A 1TVNA 3TTOA 3OA3A 2QR6A 2YCJA 4ZE4A 3GNPA 3G77A 3PBGA 4O4WA 4FO4A 3GUGA 1JPIA 3IVUA 4HCHA 1CLXA 4JTAA 3EGJA 3CUJA 4H8HA 4GGHA 3WEZA 3SQPA 3TAOA 2HVOA 2BHYA 2AOSA 2OG9A 3IVSA 9XIMA 2Y4SA 2EG6A 3G22A 4LF1A 1W3LA 3VTRA 1CENA 3N4AA 3N3MA 3GQYA 3URNA 4MJMA 4HYRA 1SO4A 1V3IA 2E8YA 1BSIA 3CHFA 4XK2A 3KTSA 1JDEA 3T4WA 2CYGA 2D73A 2D2OA 4H00A 5I77A 3WEMA 5CPNA 3F4NA 3GX9A 3C2EA 2BX7A 4EQSA 1G7VA 3WLMA 1UQZA 4DYJA 1GKRA 4FMVA 4M52A 3SFWA 2ASHA 2QLYA 3SR7A 4M1RA 1W31A 1JCNA 4IJCA 4NZ1A 5JCIA 1CT5A 2XVNA 4U2ZA 1LL4A 1YRRA 2B31A 3VKKA 5KSWA 4WEVX 4KQNA 1XXXA 3EXSA 3UY7A 2PPGA 3Q2DA 4F9JA 3ABRA 2PFHA 2V81A 4L6OA 1DNCA 2X30A 2ZDSA 3VZZA 2GGJA 4XO6A 4A2SA 3UA4A 3K30A 2GUUA 4IX2A 1G6CA 3PJUA 1JZ3A 3NQ2A 1W1A1 1M6IA 3B4UA 3PZGA 4M7TA 4GNJA 5JU6A 2L5HA 4EMWA 5I3KA 3WQPA 3M1ZA 5EYWA 2WXDM 6REQB 1VD6A 1I9CB 2WSYA 4L4OA 5CZ0A 4ASTA 3AS0A 1JZ7A 3I3DA 5KVHA 2CLFA 1P48A 1G67A 1YPFA 4Z2IA 3GNOA 3ALFA 3W71A 4IXXA 5CBBA 1JRBA 4M82A 3WDIA 3PM6A 3QY6A 3QMSA 2EXOA 3C4UA 4KS0A 4CU6A 3V35A 4A3HA 1UUMA 1Q6DA 1F73A 3RM8A 4DI8A 5JVLA 3D3FA 3EXTA 7ENLA 5BYWA 1GESA 3ZO9A 1NELA 1BYBA 3QW4B 3H2OA 1WKEA 4FXRA 3L0NA 2TAAA 5BRBA 2VCBA 2B7QA 2V3BA 1GRBA 3C2OA 5CJNA 3LERA 5TBOA 4HU8A 4GK8A 6A3HA 3V0TA 3OQ8A 3GRTA 5EPDA 2OZ8A 3C61A 2WV8A 3QF0A 5JIPA 5I7GA 1EC7A 3VABA 5AHIA 4LS1A 4ROPA 4F79A 2E40A 4NF7A 3MMUA 4FLQA 3VMNA 4H2CA 2PGFA 1JVNA 1QO5A 1OGSA 5HAOA 5MKGB 3IIZA 1T0OA 4FNQA 1YNPA 3OQEA 3LX9A 3A5VA 1VEPA 1KNWA 3V18A 4M0XA 4KETA 2WCGA 3CAWA 4JTJA 3S5NA 3I3EA 3WZ0E 2NQLA 4YTRA 5KEZA 5T9CE 4U5IA 4ROQA 2FDMA 3NPUA 3DHPA 3CNYA 1GUVA 3MO7A 4IJRA 3KOFA 3PPFA 5CC6A 1KLZA 4OTKA 3IJLA 1FHVA 3LA4A 1B9ZA 3O0KA 5F4SA 1PEZA 1IR1A 4Q3MA 3P93A 1DKWA 1R2RA 3ARVA 1KRCC 1G0CA 4IIEA 1RV8A 4NSBA 4U4MA 3I10A 3ORWA 1U2YA 1BTMA 2EQ9A 1VFSA 2IMRA 1SUXA 4N9BA 3R0UA 3EKZA 4ZQPA 4JHMA 3B4YA 1MW1A 3RNDA 4LCQA 2WVVB 1QW7A 1KBKA 2WMIB 5AYYA 3UT0A 1E73M 3P3BA 4HHMA 2HV5A 3WFZA 2QXWA 5CQ1A 4BQ3A 3LCGA 4JICA 1R6WA 3QZEA 3AS3A 4L1GA 3P14A 2ESCA 4DBSA 2WLZA 1LWIA 4EAMA 5C6MA 3IJ8A 4UCFA 1EJWC 3TNBA 1NU5A 2V3GA 2Z4GA 3FEQA 3BLEA 4FLRA 3A4WA 2E09A 1NVMA 2QHAA 1R3SA 2W63A 3W23A 1VFTA 4RZ4A 1VRDA 1GZJA 2QJIA 2TPRA 3P80A 4KEMA 4JL1A 4PMXA 1B0IA 2VP8A 3W7EA 3KLLA 4YIWA 3TK7A 3M41A 3OP2A 4B4HA 2PRMA 1TYTA 4N02A 1WP6A 3EOLA 5D02A 3SURA 1WX0A 3EX2A 2YPIA 4Q8UA 3ZYZA 3OBEA 3O05A 3SDOA 5G2WA 2J7EA 2VT0A 4K8GA 5AY7A 3EX1A 4CQCA 4KRUA 3HPZA 4G7EA 3WBEA 4LPCA 1LF1A 4I5RA 3UZZA 2DZSA 1RQEA 4HJFA 4A8IA 1XP3A 5DMLA 3SSJA 2WOVA 1ONWA 3NYZA 3O6AA 3VX1A 3VFLA 3FA5A 3LXDA 3BV4A 2XJ7A 4JFUA 2WP5A 3QQ0A 2FZNA 4DBUA 3PUGA 4NQ1A 5FKYA 1UWQA 1KFLA 4EAYA 4OBRA 5HOSA 1VFMA 4UWMA 3BW4A 4D6DA 2DZTA 1OX6A 4Q4KA 3U7BA 4NNCA 5SWUA 1JYXA 2Y7EA 4FALA 2IKJA 1DYSA 3CQIA 3E12A 4NZCA 3MP4A 1J0JA 1TWIA 2JF6A 4BI6A 1RPKA 2BVTA 1B5TA 1LDCA 3U0HA 4H4UA 1OCNA 2PBGA 5C9RA 7TAAA 3W7OA 2C14A 2QVHA 5KZ6A 1JQVA 5AYIA 1LLZA 1AMYA 2WOIA 2G3FA 3DK8A 1E0VA 2OZ0A 5G2IA 1FX6A 1HL2A 2PD5A 4QRNA 3NM3A 1V97A 3E2SA 4O13A 4B5UA 3G1AA 3HA1A 3NZGA 1N5XA 1MZRA 3T09A 4LCSA 3SAZA 4H41A 1Y5VA 2B7PA 1R3WA 1FECA 4ZOEA 2WSPA 1NP0A 3M5YA 1H60A 2PWDA 3L8KA 3AYSA 2QJMA 3R13A 4HA3A 2CZDA 3C2FA 1QNOA 2CDUA 2WJZA 3QLDA 4U33A 1WA3A 1A3WA 1DBTA 1V3MA 4WGXA 4IP4A 1KV8A 3V0SA 2YXGA 1LCOA 3MVTA 2PB1A 3P6LA 2Z26A 4YVVA 1AK5A 2I9EA 5IXEA 1XKJA 1RK6A 4B2DA 3CYVA 4QDPA 4AMCA 3ES7A 3TTEA 3CH9A 2WCAA 3IUDA 1J2BA 3UXLA 2J6VA 3HM7A 1OFQA 4C65A 4OJYA 3KOYA 3W4RA 1FWWA 2I56A 4XAYA 4PN2A 1F4AA 1TVLA 4DUWA 3THAA 4QG6A 3CQJA 2HE5A 1QHOA 1ZBVA 3SW6A 3PZIA 2CESA 3E2QA 4E2OA 1QASA 4CN6A 2DJXA 5DRIA 1OX5A 1RSCA 4E5TA 1BKHA 1AUSL 4A21A 1V6UA 2C15A 2QUMA 3D46A 2GQ9A 3N2BA 4U28A 1TSIA 1FCQA 1PWLA 1XIHA 4B3ZA 5EMKA 2OSWA 2B4GA 4LEQA 5EFDA 4M7SA 4J3VA 2A3EA 3N11A 5JH2A 3NWRA 4E8CA 3HN3A 2DVUA 1Q6FA 1R9YA 3EB4A 1JQXA 1P0BA 5CPOA 1W3KA 3PTMA 4LVDA 4N9EA 1P4CA 1XD1A 1XLJA 4E38A 4M29A 1G4TA 1VFFA 3VU2A 1TV7A 3RLUA 2YB4A 5A6BA 4UXDA 4AFYA 2ZWYA 4M6VA 1X7FA 3MSGA 3QXBA 1UD8A 3USZA 1HGYA 2DIKA 1IIGA 2VURA 2HCVA 4W88A 4JR5A 3SN4A 3TIMA 3TQPA 3F2BA 1L6SA 2JIEA 3MMWA 1LL7A 5I06A 2ZTJA 5LNWA 4HPJA 1PX3A 2V68A 5IFPA 1HJSA 4GQ0A 1F6PA 4XQ6A 3BLIA 3T08A 1FH9A 3EDDA 4HKPA 4AC1X 4X0NA 3CXOA 3PJTA 1IXPA 2X1UA 2CLEA 3QH2A 3H21A 3T05A 1YKWA 2PBOA 1GG1A 2BGSA 2JFEX 3SUWA 5C71A 2XWDA 3LHVA 2YDSA 1SZGA 1O12A 1IF2A 1T96A 1V3HA 1XQLA 3N3TA 5A6KA 1LOSA 2A5HA 4UTWA 2QCNA 1STZA 2C16A 5F7UA 4H1ZA 4YWIA 4LC6A 5XIMA 4XAPA 2QPXA 4QDMA 2ZZ3A 4GACA 1DJIA 2XU2A 5I79A 4S3AA 1ZQ5A 3A21A 4UQ9A 4RV8A 4D6EA 1OM0A 4KGJA 1TTQA 2F2KA 3Q37A 1XFCA 4W84A 4RK8A 4CD7A 4J7RA 4ZOHB 5FEXA 4MY8A 3SUUA 2CETA 2ZA3A