3ZVIA

Methylaspartate ammonia lyase from clostridium tetanomorphum mutant l384a
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
415
structure length
415
Chain Sequence
MKIVDVLCTPGLTGFYFDDQRAIKKGAGHDGFTYTGSTVTEGFTQVRQKGESISVLLVLEDGQVAHGDCAAVQYSGAGGRDPLFLAKDFIPVIEKEIAPKLIGREITNFKPMAEEFDKMTVNGNRLHTAIRYGITQAILDAVAKTRKVTMAEVIRDEYNPGAEINAVPVFAQSGDDRYDNVDKMIIKEADVLPHALINNVEEKLGLKGEKLLEYVKWLRDRIIKLRVREDYAPIFHIDVYGTIGAAFDVDIKAMADYIQTLAEAAKPFHLRIEGPMDVEDRQKQMEAMRDLRAELDGRGVDAELVADEWCNTVEDVKFFTDNKAGHMVQIKTPDLGGVNNIADAIMYCKANGMGAYCGGTCNETNRSAEVTTNIGMACGARQVAAKPGMGVDEGMMIVKNEMNRVLALVGRRKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords METHYLASPARTATE AMMONIA-LYASE
publication title Engineering Methylaspartate Ammonia Lyase for the Asymmetric Synthesis of Unnatural Amino Acids.
pubmed doi rcsb
source organism Clostridium tetanomorphum
total genus 164
structure length 415
sequence length 415
chains with identical sequence B
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
A PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3zviA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3zviA01
2PP3A 1L8PA 3DG3A 3R0KA 4MGGA 1KKOA 2PPGA 3MY9A 3UJEA 2HXTA 1ELSA 1EBGA 1KKRA 3PK7A 1DTNA 3FVDA 2OLAA 1TZZA 4G8TA 3RR1A 3DEQA 1XS2A 3VA8A 4ZA0A 3BJSA 1P43A 3RGTA 3I4KA 3K1GA 3U4FA 2PTZA 4A35A 3VCNA 2P88A 2PA6A 2PP1A 2MUCA 4E5TA 2AKMA 4JN8A 1FHUA 3STPA 2RDXA 3T4WA 3ZVIA 1BKHA 3CXOA 1WUEA 3SSZA 3I6EA 3TQPA 4HCHA 4K1WA 2PTWA 2XH7A 2DW7A 3VDGA 2P8CA 3OP2A 4GGBA 3H8AA 1IYXA 2HXUA 3N6JA 4DYEA 2XSXA 3DESA 2QJJA 3DFHA 1EC7A 3ES8A 3FJ4A 2P0IA 2AL2B 1MUCA 2GSHA 3R1ZA 3IJLA 3NO1A 3CT2A 2GGIA 2QDDA 3T8QA 4MMWA 6ENLA 3BSMA 2OFJA 3EKGA 4H2HA 4JHMA 7ENLA 1KD0A 1PDZA 3FCPA 4X2PA 3B97A 3ZLHA 3DFYA 5FJRA 2OX4A 1YEYA 3DERA 2OKTA 2MNRA 1P48A 2GGJA 2XH0A 3BOXA 3UJ2A 4H1ZA 1MDRA 4H83A 2GGGA 2GL5A 3RCYA 3H70A 5FJUA 4YWSA 4HNLA 1ECQA 1PDYA 3RRAA 3DGBA 3UJFA 4E6MA 2QGYA 1R6WA 3ZVHA 4ROPA 4K2SA 2OPJA 4FP1A 1W6TA 1NELA 3UCDA 4ZCWA 3H12A 2QJNA 4EWJA 3R11A 1MDLA 2ONEA 3I6TA 3ZLGA 3FXGA 1SJDA 4IT1A 3HPFA 3KUMA 3JVAA 1SJAA 4IL0A 2PTXA 3R25A 3SBFA 3T6CA 3DG6A 4E4UA 4J1OA 2QJMA 2PGWA 2OVLA 4E4FA 4IP5A 5ENLA 2PSNA 1BQGA 2PTYA 3SJNA 4M6UA 1TE6A 3UJSA 1WUFA 3H7VA 4F4RA 3GY1A 1MRAA 2ZC8A 3TCSA 1FHVA 2POZA 4M0XA 3Q45A 3PFRA 2P8BA 2PP0A 2PU1A 3DIPA 1EC8A 3IK4A 3MZNA 2GGHA 2NQLA 3UXLA 3CB3A 5FJPA 2FYMA 5IDZA 3U9IA 2XGZA 5FJOA 3PWIA 3P3BA 3THUA 5BOEA 2O56A 3QPEA 3OTRA 4HN8A 1R0MA 3TOYA 5J04A 1ONEA 3UGVA 3JW7A 2AL2A 3SQSA 4HYRA 3EEZA 2CHRA 4IL2A 4GYPC 2OO6A 1EBHA 3OZMA 2AKZA 3OW1A 2OZ3A 3SN0A 3V5FA 3VC5A 3T9PA 3QLDA 2HNEA 4MKSA 3UJRA 2XH2A 3RITA 3TW9A 2XH4A 4KT2A 3SN4A 1JPDX 5BOFA 1SJCA 5EU9A 3ENLA 3TWBA 3NXLA 3MWCA 4IHCA 2PGEA 2OZ8A 3P0WA 2PCEA 4GFIA 4GYPA 4Z1YA 4G7FA 3R10A 4JN7A 4HPNA 2PODA 2PU0A 4E8GA 4A6GA 4KEMA 2OQYA 3S47A 2OQHA 3TWAA 3OPSA 3V3WA 3DG7A 3FYYA 4Z17A 3GC2A 3P93A 2P3ZA 4HCLA 3IJQA 3SN1A 1OEPA 3ZLFA 4IP4A 4KWSA 1F9CA 3N6HA 2DW6A 4GISA 3DDMA 3MSYA 4KPLA 4HNCA 5FJTA 4GMEA 1JDFA 4DN1A 4GGHA 3NFUA 2QDEA 2PS2A 1MNSA 3UXKA 1NU5A 1TKKA 2QVHA 1E9IA 3FV9A 4J3ZA 1JPMA 4DWDA 1JCTA 3TJ4A 2PMQA 3QN3A 3RO6A 2OG9A 1EC9A 4GIRA 3N4FA 4K8GA 2ZADA 3V5CA 2FKPA 3MQTA 3V4BA 2QQ6A 4DHGA 3CYJA 3MKCA 3CAWA 1KCZA 4DX3A 3TJIA 3Q4DA 3JZUA 2HZGA 3D46A 4DXKA 2OZTA 3IJIA 3GO2A 3CK5A 3VCCA 3NZGA 3TTEA 4IZGA 3ZVHB 3D47A 3OZYA 3MUCA 1RVKA 4H19A 4FI4A 3VFCA 3UCCA 4HCDA 1XPYA 2GGEA 1SJBA 3QKEA 3QTPA 4A3RA 3ES7A 3S5SA 3VC6A 2AL1A 3N4EA 3R0UA 2I5QA 3GD6A 3PWGA 4ENLA 2GDQA
chains in the Genus database with same CATH superfamily
1TCMA 1TWZA 3T0BA 3IAPA 3TKFA 3LSBA 1XYLA 3SSJA 4NZ5A 3K5XA 1GQJA 4TVCA 3EPNA 4X0VA 3F7JA 3R2GA 2PRLA 3UQNA 3CM4A 5F2MA 4DB7A 2X05A 4ZB5A 3EAUA 1D8CA 1XS2A 1P6BA 3TA6A 1FWBC 1GRAA 5C54A 1T96A 1EJTC 5LNVA 1MVYA 1OYAA 1E4LA 3U4FA 3U4AA 3GU9A 4LANA 1GERA 1CXKA 4GOAA 3GNXA 4UFMA 1PTDA 1UHVA 4IMCA 3G6LA 4CNOA 2V81A 2PD9A 2Q3OA 4KRZA 2G3IA 2AKMA 1WDPA 3A13A 1O95A 2ZRYA 1LLWA 2VXNA 1BKHA 4UQCA 2CU0A 3LRKA 3BG5A 4FLOA 1NHSA 3TYCA 1XISA 2XH7A 1W5NA 4AD4A 2ZXQA 1K8YA 3W82A 3AZRA 1FECA 3MJYA 2XIQA 3BAYA 4CQ8A 3GAKA 4CKQA 2ACQA 3PZIA 3HURA 1JZ4A 3TR2A 3CPRA 1EC7A 1IT0A 3SUSA 1EOMA 5CBJA 1W0MA 3JR2A 2GSHA 5JU6A 1UD6A 1O1ZA 4O1AA 1PVNA 1F07A 3L5MA 4L5ZA 1B2YA 3WFLA 3EOUA 3RX2A 1R87A 2IQDA 4UTHA 3ARUA 3KWSA 1K8CA 4X2PA 5I78A 1UZ4A 3EX1A 4AY1A 3IIZA 3EEGA 3H7UA 4L9YA 3DYOA 4CCZA 5A8PA 1MW3A 1FP9A 2C91A 4H41A 5CBBA 2DZVA 5K2ZA 3VDCA 5I77A 2CHOA 1R8LA 2ZZCA 3E2SA 4R7JA 1B30A 3A3HA 4H1ZA 3Q67A 3RLVA 2YXGA 5G4EA 5KINA 1IGWA 1XW8A 4BQ3A 1MDRA 3PZQA 4D9PA 4EIVA 4NAEB 2C79A 1G6CA 3GIYA 3LNMA 2GQ3A 1B3XA 2ZQ0A 1R3VA 1SPQA 4B91A 2GVGA 2WOQA 3K8MA 5F2IA 1CPUA 1ONFA 1MW0A 2WQDA 4B4FA 2OPJA 3WD3A 4H3DA 3OGVA 5MHBA 2RDUA 3K4DA 1UYQA 3R11A 2NT0A 5D32A 4OT7A 1XGDA 2YZ5A 5LA1A 4X3ZA 4MZ8A 1HUVA 1VQZA 1P6CA 4ILSA 4IPIA 8CGTA 1UBPC 1E4MM 2D69A 4LB4A 1QAPA 4H4WA 4XD3A 5CCZA 4WXZA 3SRHA 2X8CA 3WZ0E 5I02A 4ZSTA 3RHGA 1U5VA 4KFPA 4ZB2A 3B9DA 1YXYA 2ZC8A 1XH2A 2C1GA 3M0HA 1DQWA 1QI4A 3MZNA 3W1NA 4A8LA 3N3MA 3BLFA 2NQLA 1WKFA 5A8GA 4R33A 2FYMA 1YTDA 3UZYA 3SFWA 3VD3A 3BCFA 5IDZA 4MLRA 2X16A 3MMDA 1GWJA 3VABA 3CMJA 2ZWZA 1N82A 1JD9A 5K9DA 3BANA 1AQFA 4PCNA 4PSPA 3N2TA 3GX9A 2J79A 3DBNA 4KCTA 3TN6A 1YPFA 1I2PA 1C29A 1GVEA 2G97A 1W2VA 1R9ZA 3ZMRA 4KWWA 3WDQA 2AL2A 3ERPA 3L4YA 4CQ9A 1GVFA 3IRDA 4C91A 1W8SA 1IZJA 4TX8A 2ZICA 1EDQA 2VEIA 1OJTA 1WZLA 1DWHM 3CUGA 5FAJA 4AVNA 2EKGA 4FF5A 5XIAA 4XUYA 3ZR4A 3E74A 3UZJA 1RPXA 4NJKA 4ZL1A 2BTMA 1H7PA 1ONWA 1HP4A 2BWGA 4U3AA 2PURA 3C2OA 1CGYA 3NURA 4LV4A 1JXJA 4DF2A 3WJYA 5AECA 4W88A 2PF8A 5DFAA 3GXMA 1WDRA 2AQWA 3MSGA 3BZGA 4U3CA 1BLIA 3MJMA 1CNVA 3IJ6A 4J2MA 4PB5A 2ZBTA 5U7SA 5JCKA 2VWSA 3UR5A 3GFXA 4QITA 1JRPA 2NT1A 4JN7A 2GVLA 2CITA 1PKMA 4PMQA 3SDOA 4R7OA 1WZMA 3NQAA 4RCXA 4QROA 2TODA 4HNOA 3C2EA 4LU0A 3ARYA 3KOZA 2NUXA 3W1TA 4XTIA 5AHNA 2E77A 4HPGA 3OG2A 1RCOB 3HQPA 2QMKA 1BQCA 3LCGA 5AHFA 3VIPA 4Z42C 2E5AA 3PBWA 3DYMA 3SN1A 1FFQA 3NDZA 4HK5A 1X7FA 3H4WA 2DW6A 4AEEA 3W37A 3W1LA 3WKZA 2CWNA 2R1NA 4GMEA 3T09A 3BMVA 2A6LA 3GSMA 1DBTA 1VHNA 3U8GA 2A21A 4JX6A 4C6BA 1JPMA 1XUZA 1XDJA 2A79A 2VX5A 4CUCA 3IGSA 4HZMA 3MYOA 1TE1A 2WK2A 3PN8A 4P8UA 5AYBA 3RO6A 4AZCB 1MWOA 3TTYA 4DUOA 4B9YA 3FA4A 2OU4A 4LTSA 3VMOA 5H91A 4DHGA 2DJLA 1K03A 1G4EA 4DX3A 1IEVA 3CZGA 2P76A 2F2KA 4Z0SA 3NPXA 1EYEA 4S3DA 5A6BA 1H62A 1BEUA 4XBSA 1U30A 3B0UX 1YDYA 2I7GA 3NGJA 4GXMA 1RUSA 1YXDA 4NAFA 1ME9A 4C6PA 1H51A 3NA8A 2XN2A 2W3ZA 2F84A 2ZZ4A 8A3HA 4I90A 3GDKA 3PZ9A 4NKCA 4UFJA 1L8PA 3PF3A 1XUUA 3AIVA 2C1HA 3IEBA 4HYWA 3VGDA 5H2ZA 1VAHA 1IXOA 1VLWA 4ZO8A 1QHPA 4JQ3A 2FZNA 4YL2A 4F2TA 3A24A 3VKDA 2VC7A 4G8TA 4O4WA 1FWGC 3DEQA 3GDMA 4RKAA 4LCQA 3NDOA 4FLSA 3KBVA 1P7TA 2JIWA 3N3TA 1TV3A 1LWJA 2E6YA 2O0TA 1JL8A 3HGJA 4I9TA 1ZBCA 1W5OA 4HHMA 4H8VA 4Z1CA 3ELFA 3EWBX 2C3CA 4RV8A 4DJDD 4HMDA 2P10A 1X1NA 2CBJA 3WL1A 4ERAA 4UMAA 3CIWA 2VVSA 5I7GA 4NXKA 3PB0A 4CQCA 3NL6A 1TTJA 5MKGA 1DWGM 1RR2A 1I0DA 3A3XA 4TUFA 3K8LA 3W9ZA 3M44A 3IJ7A 1J12A 1KW1A 1UKTA 3TONA 1XJBA 1GQLA 2Z6IA 3FVMA 2A1YA 3UPWA 1E3ZA 4DUWA 2PGRA 3WFAA 5DANA 4UNKA 4H4SA 4I9AA 3UG3A 3IJLA 2GJRA 4HTBA 3NO1A 2PDJA 2A3BA 2YCLA 2ZE3A 3L4WA 2FJKA 4HT3A 5G4HC 2B0MA 1Q6EA 1PKNA 1JCLA 4P8WA 3LPGA 3VFLA 2AMGA 2YVJA 2QCDB 2OX4A 2Z28A 1QI3A 5DRIA 4M82A 3RUBL 1JGMA 4O57A 1HJUA 2G95A 2INFA 5DXXA 1TIMA 3C5QA 1JZ7A 4S3KA 3KRZA 2NVAA 4HU4A 2E25A 3PG8A 4BF9A 4UTIA 5CG0A 4YPJA 1HL9A 4BWLA 1ECQA 3NQDA 4WSHA 4ADWA 4A22A 5FF7A 4M7SA 1G94A 4FK9A 3SCTA 3UNTA 3RNMA 3RU8X 2W67A 4ZQMA 4BKNA 1S2VA 4N0RA 1Z41A 3WL0A 1W1A1 1ESWA 4XAZA 2GJXA 3WSUA 3E3HA 2DQWA 2Y7DA 2I14A 1XLMA 2JEPA 3E38A 4CD6A 4EWJA 4ZO9A 1V03A 2MANA 3EDKA 4E3VA 4GNVA 2Q02A 1HJWA 2V5BA 3PNZA 4XD4A 2J8TA 5H8UA 3D5HA 4HP5A 4KBXA 1TVLA 1AMKA 5BRQA 1KTNA 4LYRA 3SGGA 3VPLA 1V3MA 4UCGA 4MWAB 2WWDA 4C7GA 2E9BA 2QLYA 3W7KA 3AMKA 4HHHA 1W9XA 3TCSA 1JCMP 4XBJA 2VWTA 2PP0A 2BVTA 4XQ6A 2A0NA 2REQB 5I3DA 5HANA 4FHAA 3W38A 3SIZA 4O1DA 4PMYA 4GR1A 5HWJA 5MF5A 3M16A 1J6PA 3WELA 5IM51 1VYSX 3W01A 4DJED 1UWUA 3ZSSA 4FAMA 3KBWA 2YVFA 2BGQA 4LH8A 1J11A 1VCGA 3DN5A 1QO5A 4FOUA 1Y5WA 2QAFA 4AZBA 4UQEA 3TMLA 1E1CB 3ZT7A 2E68A 1WKYA 1A5AA 4HBKA 5J04A 2VP8A 3CPGA 2FB3A 3KOXA 2PDCA 3AM9A 5A5WA 3WK3A 2F5ZA 4DO5A 5D9PA 4ZZ9A 3STGA 3MU7A 1BG9A 3UR2A 2BXYA 1VBHA 3S9ZA 5CKSA 3T44A 1GKPA 1RP8A 4XAYA 3W7OA 4YWOA 1JAKA 2OYMA 2V3GA 1X1OA 3BJTA 1K1DA 4NQ1A 3NYZA 2OO0A 3DHDA 1V7YA 3APYA 7ODCA 1ZNNA 3IJDA 3VO0A 3RX4A 4O17A 1JDEA 4JEQA 2VCCA 4JZ5A 1G0CA 2OB3A 1MXSA 2CERA 3GR8A 1VBGA 3IIVA 3CWOX 3NM3A 1L2UA 1OG6A 3L2IA 3NSMA 4BS0A 1XLFA 1LBLA 4G7FA 4IXXA 3TC3A 1TWDA 1SFLA 1EUAA 4O13A 4OUEA 2GWGA 3PBMA 3UR7A 4JIEA 4PB4A 5AZ1A 2EPHA 3NXFA 1F4AA 3OPSA 1UR3M 4XKYB 4LBRA 2GVYA 1A47A 3GC2A 2WSPA 1M3UA 1IQ8A 3GUGA 1ICQA 2I9EA 4MKVA 4I6KA 1CECA 4AZ6A 4IP4A 2A2IA 1XP3A 3SEPA 3ZR6A 4QS6A 2HE8A 5EMUA 3HRDC 4JYEA 2P0OA 4KIRA 1EZWA 1QUMA 1EJUC 4EF8A 4GGHA 2GJLA 1O4UA 1MNSA 4WVXA 1TKKA 4C5YA 4LFYA 2XFFA 3EOLA 2VO5A 4I5RA 5C70A 2PWDA 1SGJA 1MEIA 1XRFA 2ZX8A 1L0PA 5D2WA 2BOGX 5H6HA 3GG8A 5LNRA 3O15A 3MW7A 4MWAE 3WLQA 2E5DA 2CXGA 1ZJBA 5FACA 3RFAA 1FWTA 2DZAA 3MI6A 3MUAA 3JZUA 4PUUA 4X0NA 1Q65A 3VNYA 2VEFA 1RJPA 1E1FA 4J2PA 5C7HA 4P7OA 3VIKA 1A5CA 1YKWA 3PSVA 4C6OA 3SZ8A 5JMUA 3W7HA 3MUCA 5HPOA 1GKQA 3W7MA 3QVQA 3W29A 4XWUA 5AC8A 3WLSA 4LSBA 3NO3A 3OVRA 1ZUAX 1F73A 3FK4A 4MGGA 5XIMA 1V6TA 3O6CA 3KCOA 1NOWA 4PMDA 1V0MA 3CL7A 2HXTA 1EBGA 1YE4A 1A3WA 4IPLA 4Q22A 2CIPA 3BAXA 4AIBA 1US3A 5DCEA 1J01A 2VEGA 4B15A 1UKPA 2YCJA 5A8MA 2ZRZA 4GCXA 5LA2A 1O5XA 3D6NA 4JY9A 3DHUA 2VR4A 2NXIA 1MXGA 4OVXA 2XUCA 3ZYZA 4IIEA 3GDRA 1ZALA 5JBFA 1E0XA 3E0WA 4AYSA 3CUXA 3NPUA 4XVDA 3FEQA 3HO8A 4E5TA 2VRQA 2TRSA 2ZUSA 4ZODA 2RDXA 4B3ZA 4S3BA 4H9TA 1GJPA 3TQPA 2CLPA 3MUY1 4IH3A 2XTKA 5HR6A 1WBHA 3DI0A 1FY6A 3WF0A 3GW0A 4O1EA 4Z2IA 4FX8A 5I3JA 3DENA 3ES8A 5TQLA 4ADSA 5J8LA 1IF2A 4ERGA 4TMBA 2G3JA 3PBGA 5JH2A 1LLOA 1X2GA 2Y63A 2YGYA 2NWRA 1YDNA 1B1YA 1X97A 4PYSA 1EP1A 4FLQA 4L4PA 4QR6A 3WLLA 2OFJA 2BLEA 3BTNA 1JI2A 4XAFA 2ZCGA 1JZ6A 4LIIA 2WVVA 3CZKA 1BPLB 2OODA 5HMEA 5KVHA 1OX4B 1LOLA 1J93A 1RD6A 2GUYA 2YLLA 2XIMA 4MLJA 4B3LA 3C86A 3CV7A 3PUDA 4CLMA 1AH0A 3MBDA 4JTDA 3GDLA 4HNTA 3F4WA 2GK1B 4WSJA 4LUSA 1SZNA 1N62C 4C5ZA 4PBEA 3UWZA 1PJ9A 3RCYA 3W84A 3BW4A 5FJUA 3LQGA 2JK2A 3AMLA 4PSRA 1SZEA 2Z1BA 4W8LA 3W27A 3WNMA 5A8OA 3KZSA 2F38A 2CEQA 3A4WA 2W92A 4AZ5A 3W53A 3WQ8A 3C52A 2VDGA 3QQ0A 5U1OA 1FOBA 3TTQA 1JZ3A 3OIHA 4LUIA 1W5QA 3SCUA 3H21A 1T3QC 5A1AA 3H22A 2UY2A 3R6IA 1EEXA 3U7BA 2GQ9A 2V8ZA 1JCJA 4Q8TA 3ZWTA 4H00A 4AH7A 2E6AA 3EXRA 4MUPA 1NFPA 3W00A 1X2HA 1FXQA 3WBEA 2QJMA 3T8LA 3NQCA 2PGWA 1YTKA 3AO0A 3WQVA 4IP5A 3M43A 1XR2A 4ICNA 2VCAA 4IQJA 3DX5A 1J96A 2Y24A 5KVIA 3GVVA 3UJSA 2I57A 1JNDA 1F3PA 2WV8A 1H61A 3QMRA 2X99A 4XZMX 1BXNA 2GGHA 4AF0B 1F2JA 5F2GA 4RW3A 3GXTA 3W75A 3VDBA 3RILA 3KCLA 1LP6A 3JRKA 2ZC1A 1ONRA 3KWXA 3G1VA 3NM1A 4JTFA 2B7NA 2EXOA 3LCFA 3QF0A 5IOBA 3H2FA 5I2UA 5LZLA 1M03A 2W61A 3SB0A 1AH3A 4FO4A 4B5NA 4BY3A 1LDCA 2VGIA 4UQ9A 1OX5A 4F0SA 3WNLA 4NI8A 3QR0A 2GPTA 1H6VA 3UW6A 4IL2A 4I8YA 4O4VA 3QJAA 3B8UA 3TXVA 1X38A 4PRWA 2Z4GA 1EQCA 1ZP4A 2Z24A 1ZAJA 1FCVA 5E70A 1Q4NX 3POCA 3STCA 2Z1XA 3O8AA 1Q2SA 4DEFA 5I3KA 4PULA 4A8NA 2VEMA 3NYDA 1QNRA 1K4GA 3R8GA 3TTOA 3WH8A 1NP2A 3ONCA 2VZUA 1JUKA 3CTTA 3M0ZA 3PJUA 2PGEA 3GNOA 1W56A 4YTQA 2PWGA 3OLGA 3TK7A 4CCEA 5BW6A 1ZMCA 1BVNP 3TXZA 4DM2A 1GZ1A 1E6XM 3P8JA 5EPDA 3MSDA 5IFPA 1SM9A 3NZ1A 4HMEA 5HA7A 5G1MA 4DXVA 4XVEA 1V6UA 5AC4A 3DG7A 3GXDA 3BJFA 5CGQA 1CGXA 5CPOA 5BWAA 4UOQA 3O0HA 2P3ZA 4N4PA 1BD0A 1Q6LA 4XSLA 4QE1A 4DWSC 2OSXA 3M7WA 1OQFA 4LF1A 4ASTA 1H5YA 3LPPA 3W87A 3G77A 4CNUA 1BHGA 4Q8OA 4U4MA 3G3MA 2YBTA 2PEVA 2QXWA 3QMSA 2VEPA 3MUIA 4L9ZA 1JCYA 3NVZB 1D7KA 1XWYA 1JULA 2ZYFA 1XYAA 3UXKA 3LN3A 4DO6A 4FALA 4ZGYA 4I5UA 3RLHA 5EKYA 3FSUA 4H7CA 5K9XA 3CZJA 1QBAA 3W2LA 1FFVC 3L5OA 3WIJA 3W7NA 3LS9A 4Q4KA 1OJXA 2CXEA 4RZ6A 2HBVA 1TRDA 3MKCA 3UZWA 4IFKA 5J5DA 3AS2A 3W07A 3T42A 3I3EA 4GKTA 4PGLA 3IJIA 2XIJA 3WUFA 2PWVA 3FEMA 2V3DA 1DXFA 4IZGA 4DZHA 3O06A 2QPXA 3VUSA 5E5CA 1DIDA 3E1F1 1SZFA 1FBAA 3MBFA 4NG3A 3I7QA 3RU6A 2FHCA 4CNTA 2ZZ3A 3QFWA 1LF1A 2BHZA 3QZEA 1V0NA 4ZSUA 2YDRA 1TFVA 3NAVA 4O8RA 3F4DA 1QK0A 1JR1A 2NW0A 1VP5A 3NS1B 3NZRA 1PBGA 4IGNA 4UOJA 3VNMA 4GYKA 2E9MA 4LAUA 2WBAA 3GXFA 4RNJA 2GUBA 3VIIA 3LCIA 3WLJA 3M7SA 3CL6A 4W8BA 3ATYA 2PTZA 1EH9A 4JTLA 4U2YA 2WPEA 4JQ4A 3TX9A 4AX6A 5IBXC 1PWLA 2WMGA 3SADA 1P0BA 3V35A 1AJ0A 3O63A 3REQB 3BAIA 4YTRA 4AW7A 1AFSA 3CWNA 4REQA 2WLYA 3T4WA 1ITUA 1UZ1A 4LX4A 1H4PA 5I23A 1DWAM 1EJSC 1KBLA 3S1VA 1GEUA 1J6OA 3WN6A 1WO2A 3FJ6A 1PZ1A 3N6JA 2XVNA 3VU2A 1KBKA 2QJJA 1O66A 3P84A 3DFHA 4J28A 2DFAA 1LL7A 1O60A 4PFMA 1GOWA 3VOHA 4BFAA 1BWKA 2V5LA 1A3XA 4NEVA 3PPHA 3S83A 3T78A 3CT2A 1JOAA 3N17A 1DJHA 4DZIA 1LUCB 4IXHA 5FEXA 1A0CA 2BS9A 5EBAA 3JU2A 4O28A 4B2DA 4MY8A 2VHLA 5E6YA 2XFRA 1VIZA 4L1XA 3V1HA 1CBGA 1YBQB 3W7GA 3S9IA 1FCUA 3CQJA 9XIMA 2HK0A 3P8IA 4PB3A 4WXYA 2O9RA 2X1RA 2OELA 3TLQA 4LYKA 1LL4A 3H53A 4GVGA 4XSMA 1HKIA 3B8TA 3PPCA 3OBAA 2Q8LA 3UYCA 4HNLA 1ME7A 2J7BA 2VZTA 4M51A 4LBUA 1UD4A 3O0KA 1UP0A 4PTNA 2WKJA 1QNOA 3SURA 3ALFA 1ZB5A 2XU2A 4CGTA 4I3GA 4RR4A 1P0NA 2O9TA 1X6NA 4NRRA 2QCLA 1XRVA 1VFFA 4OWGA 5BNKA 4ZQOA 3TAKA 1GSNA 1J0YA 1QATA 1MQPA 1E6PA 4OGZA 2CZVA 3CHDA 1XIDA 1UR8A 1ICSA 5JCIA 3R12A 3PUGA 4DY1A 2I5GA 2HVNA 4E4FA 3RMEA 3WQPA 5HJYA 3A12A 1G4PA 1W3KA 1UMYA 1HL2A 1PL9A 1G1YA 1AUSL 4XIMA 3OZOA 4HN4A 3QFEA 3AS1A 4YVXA 3GVGA 4MVAA 3KZPA 2PLMA 1OC5A 4Z2KA 4RK8A 1TRIA 3VOIA 3W1MA 3WMLA 2J7GA 4MY1A 1FX6A 4GIYA 4LB3A 3M64A 2Y89A 4O1CA 5FSDC 2OJPA 1V6WA 4P7NA 4E8CA 3S2NA 1R38A 4US6A 3AJ7A 3BE7A 3M0KA 4BI5A 5HBFA 1OFPA 1WKDA 3IUDA 1T6MA 3G0UA 3SQLA 3TOYA 1NDYA 3T0CA 2V2CA 3RPMA 4DIAA 5IFTA 4XAGA 3AWOA 1W3HA 3VKBA 3VDAA 3KVJA 3GRSA 3CHEA 4HYRA 4PE8A 4QFUA 3RMJA 3VXGA 3CT7A 2R82A 1I6NA 3GU1A 3V5FA 1VJZA 3VC5A 1XSKA 2PCQA 3WLTA 1GVOA 3B05A 3G18A 1ZL1A 2A3HA 2V5JA 4GC4A 4QRNA 1XFCA 1QO2A 4JTQA 2DIKA 2ODOA 3B9NA 3FDKA 1V02E 1O5QA 1SJCA 2VD8A 4K39A 1ZBVA 2E6FA 4EPDC 5K3VA 4GBDA 4C1KA 2B81A 1DYSA 3P61A 1TA3A 5D2XA 3B9JB 5T91A 4E2VA 2XVKA 3R10A 4H9UA 1OWQA 2PODA 3TZFA 3LXAA 3ORWA 1NAL1 4A6GA 2OQYA 3NL3A 3LGDA 3SW6A 5LIYX 5AYIA 1KA9F 3S5NA 4WY0A 5FJIA 1TPVA 2Y5EA 4P5UA 1A50A 2V2DA 1RZMA 4Q8NA 2BASA 3EMQA 3LV5A 2OCZA 3P93A 1JD7A 4M29A 2CKSA 2QUNA 2ZZ2A 1FFRA 2NWSA 1TPC1 3QHNA 1B90A 4GH1A 1OY0A 3WD0A 3WNNA 1IXNA 2C0AA 4JTUA 5G1YA 2WMHA 5D9MA 1J0IA 3PZNA 1E9IA 4NASA 2W0UA 1OZQA 2YL5A 3WUGA 1RA5A 3IV3A 2O4QA 3AYSA 4JTAA 3PVFA 3E0IA 1DQXA 2UV8G 2Z0IA 1E9LA 4P8VA 2VMFA 3N1AA 1XLHA 1IEXA 3ZFHA 3K13A 3DH9A 1U5JA 1S2CA 2HPMA 2HZGA 3URQA 3WNKA 4Y7EA 4P7LA 2X09A 3TN3A 2EQ6A 4ZTYA 5H8MA 1H60A 4W86A 1VYRA 4YHEA 1HO1A 4MPKA 4QJ5B 2OEJA 5FEWA 2E3ZA 1TMQA 2O92A 1UUQA 2IPWA 4QHRA 3IGHX 1TV8A 2XJ7A 2XVLA 3N4EA 4AZIA 2J8GA 4H4IA 3BW3A 3DFTA 2WZMA 4AMAA 2H8XA 1F3EA 1QCWA 4PUJA 4PZVA 2OGJA 3AJXA 3EOSA 3VOFA 1TX2A 2QPSA 3G6MA 3W73A 1W3IA 4XTDA 5FJJA 3HV9A 4MDPA 4ATDA 1JPIA 3EOEA 3RR1A 5HDRA 3VGEA 1YX1A 3QFAA 1OK6A 1U83A 3UXIA 1GOQA 1DTUA 1ZK7A 1U1HA 3PJXA 4DUXA 5HMFA 3T4CA 3C2RA 4EXQA 2P88A 4JTEA 4O10A 2J88A 3G8EA 2WP5A 1E6ZA 2PA6A 2FDMA 1KFWA 5JIWA 3P0XA 2VYOA 4IMFA 1H2JA 1W9BM 2V2HA 1XHCA 5E93A 2BVWA 1X39A 4Q3MA 1MNZA 3CJPA 3QOMA 3CUIA 4LA1A 4UB9A 4WX2A 3TLLA 1UR4A 3CZ8A 1LRTA 1G7UA 2BGNE 4HK7A 2V3FA 5SWUA 4PN2A 1KRCC 3B03A 5J5RA 7A3HA 1ZZMA 3BGGA 2AL2B 5GJMA 4TXEA 1UD8A 4FNTA 3VMNA 1KM6A 3WMCA 3GVRA 3LZ3A 3OQEA 3GC5A 4IQEA 2P53A 3NOEA 1P0EA 2R1LA 3AICA 1XDLA 5BU6A 1B3OA 2D3LA 3WQ5A 3FAWA 3PULA 1K4QA 3MO4A 1PWMA 2VZVA 3LB0A 4UTTA 3MCOA 2XH0A 1OC7A 3CZLA 3KVMA 3AHVA 3G3DA 4YS1A 1OFEA 1BRLB 1XIEA 4YWSA 2FFIA 1GG1A 1Z3NA 1T8XA 2CNCA 4H4ZA 1ITCA 2D1ZA 3ZVHA 3EMZA 2DH3A 3CPUA 3CGCA 1V77A 1NELA 1VEMA 2X42A 3PBUA 2OZ0A 5E09A 5GPRA 1A0DA 4Q4PA 2VFHA 3NPVA 2X8GA 4L6OA 4YYCA 1RV8A 4PMOA 3A7AA 1BYDA 4Y9OA 3R25A 1VFMA 2WNWA 3N9RA 4KH2A 3QQ1A 1OX6A 5AC5A 1KGXA 2ACRA 3IVTA 3DBPA 1GG0A 4XBKA 2P3EA 4AVOA 2CWXA 1WUFA 2X30A 1JRBA 2AOSA 1VBUA 3UA4A 2BHUA 1K6WA 2PDNA 2P1FA 1QW9A 4GQGA 1QWKA 1MO0A 3GWQA 1MO9A 4JBRA 3NQEA 3UG4A 2NVDA 1GUVA 3GZ3A 4B2DD 2VR5A 3ID7A 1R3YA 4JXCA 3SCRA 1VYPX 3KDOA 3JZEA 3E2VA 4QLKA 2VGGA 3THDA 2JEQA 3Q65A 3P3BA 5H1WA 1VKFA 3WFZA 3B3DA 2VVNA 1RJQA 3D9XA 2Z1WA 4DLMA 1R0MA 2D2HA 4TTUA 4NAFB 3QHMA 1Z69A 1OHLA 3JW7A 3UPMA 1JPKA 3B0VC 3S1UA 4ML9A 5DBUA 1XLJA 1QPNA 1H49A 3BLOA 2WAGA 4DO7A 1PB0A 3N2BA 2YL9A 5AHMA 2YBVA 1CLVA 5HMSA 4AMCA 2WHLA 2TAAA 1WXJA 2DSUA 1N8IA 4S3JA 3DC0A 3AXKA 1KBIA 3SN4A 4K37A 3NQFA 4O54A 3UZ5A 1B4EA 4ZE4A 1M7XA 2Q3RA 3UNDA 3EDDA 4IMGA 4GWEA 4RNFA 1MUWA 3TTSA 4LYQA 1QDSA 1MUMA 3KBSA 2EQ9A 5LYRA 5MKGB 3E6EA 1EQPA 1QI0A 2EG6A 4KEMA 3U2ZA 5KSWA 4G2DA 3S47A 1GRTA 1S46A 4H4UA 1BF6A 1QMLA 3FYOA 3LRMA 4KIEA 2CBIA 4NNCA 4F3HA 3EWCA 4Z17A 4Q8WA 1KR1A 3S3GA 4K68A 2GUUA 3VGHA 5LIUX 4QQUA 3DJGX 1Q45A 4LS1A 1JFHA 3ZLFA 2PFHA 2W54A 4RE4A 1DWJM 3ABZA 4LUTB 1J8VA 1S2WA 3DU0A 3RM8A 3OU8A 1M53A 4HNCA 3APTA 2NV1A 4R88A 2YCLB 1VFOA 5D05A 2BVDA 2HRWA 3AFBA 4H7VA 4OFCA 3DYPA 1QPKA 2DUAA 1UOKA 3GIPA 3VMPA 3WK1A 1LYXA 3FHAA 2ZZBA 3QV8A 4Z2HA 2PMQA 1K02A 4AHOA 3L23A 1FFUC 1E43A 4M3PA 4F48A 1XCWA 3V5CA 1ZRQA 4K38A 1CWYA 3ARQA 3F4VA 3UVAA 3V4BA 2QQ6A 1AK5A 2J66A 3BOLA 4TU1A 1U2YA 5GJNA 1FCBA 1OFOA 2FHFA 3L0NA 4IQLA 4PCFA 3TNBA 4MB4A 1AH4A 4EMJA 4J5NA 4Q4RA 2YBUA 1TV5A 3TQKA 1HT6A 4O1FA 2ESCA 4IIFA 1H7WA 3BG3A 4NY2A 1Q5MA 4BV6A 2B4GA 5A8QA 1VJIA 1W1ZA 4QAIA 1EO5A 2I5QA 2WQPA 2GQWA 2JALA 3EDEA 2HEJA 3GNPA 3TYZA 1L6FA 2DJXA 3QTGA 1SU5A 3MS8A 4OKDA 1I9CB 4WDXA 3CUJA 3UWQA 4HD5A 1VBRA 4GJIA 1J5TA 5ABEA 2Z27A 1FDJA 1ZAIA 1Y5VA 1THFD 2R24A 2I17A 1BGGA 3DK9A 1IZKA 5KZMA 3HMJG 1YW1A 4OOUA 5C9RA 1KGWA 3WNPA 1CT5A 1ZFJA 1TVNA 1TELA 2YIHA 3H2MA 4US5D 3CGTA 5FAGA 1R2RA 3WYZA 4QSHA 5GNYA 2GDVA 3OYXA 3AZSA 1WUEA 3LYEA 1DIOA 3SSZA 2VRKA 1KCXA 5CC3A 3BWWA 4MB3A 2PTWA 4PBGA 1NIUA 1PV8A 5GQBA 4WR3A 3EWXA 3CWHA 3GTXA 4QAWA 3MHGA 4XB3A 4LAKA 4O12A 2B31A 2FH6A 3PAOA 4FOJA 5FESA 3AOFA 1UPPA 4TOQA 3VIHA 2EPNA 1L6WA 3C3NA 3RJXA 4UTWC 1TR1A 4MJZA 3FJ4A 4HZ6A 5U25A 4UR9A 3T7VA 2QMJA 2YQUA 1PUDA 3OLEA 2QULA 4XKMA 3TW7A 3LHWA 2TPRA 1S5MA 4RLIA 3NQVA 2Z25A 1E5NA 2WC4A 1PS9A 5HPCA 3QY7A 2IKHA 3CEUA 1KR0A 3GS6A 3EKGA 1EF2A 2EQDA 5I3FA 1XI3A 3UWWA 2VX4A 3OB8A 2DZBA 2WHMA 1IWAA 4NL1A 1R9XA 4JN6A 3KL0A 1Q85A 4AWEA 2J7CA 1SW7A 2X0SA 4KQNA 4CU8A 1XGEA 2TYSA 4C6KA 2MNRA 2X1IA 3A22A 4OTKA 4WJXA 5F1VA 1OCBA 3AAMA 1IZCA 3OIXA 3EX2A 3L12A 2CLFA 2G0WA 3WDIA 2EF9A 1KWKA 3HOJA 2OR2A 1DOSA 4JFUA 4E6MA 1SW3A 1R6WA 2PDUA 3EAOA 1MXDA 3U48A 3U2OA 1XKJA 2GDUA 1S2AA 3T1GA 3QKZA 3W88A 1NTHA 3OG3A 4PMNA 4IG2A 1U22A 1ZY8A 2WVSA 2DT2A 3TA9A 1ADSA 2YA0A 3JVAA 1RXOB 4MAVA 3EWDA 4CN4A 3GD3A 2PWHA 1RA0A 4HYVA 4J1OA 1V51A 1J9YA 5HNTA 1W9DM 2PTDA 1U33A 1QVBA 2ISDA 5JBDA 2C3ZA 1AQHA 5DMMA 2PI6A 3N2OA 3VE7A 2DUZA 2OKOA 2PU1A 2QHAA 3IK4A 4R5EA 3QY8A 3R4IA 3SQPA 1FQ0A 3HV8A 4JY8A 4ZBCA 4D1IA 2ANUA 4Q4SA 3TOPA 2VGBA 4UOZA 2XG9A 1XBYA 4YMZA 5HR7A 3IJ9A 4QE5A 1F8MA 3FIGA 3HPXA 3CBWA 3OTRA 3WY1A 3CL8A 2Y7FA 3IGXA 4JCMA 5EMLA 1BSIA 4F9DA 3ZZ1A 1VLIA 4DNAA 3UXDA 3ZS4A 3QV7A 4TMCA 3PUOA 1WBJA 4S2CA 2X50A 5CSUA 4OUIA 4TQTA 1Q7ZA 5F4SA 4BCEA 1OB0A 5LXEA 2J27A 1ZKQA 3TYUA 4ORIA 1RLDA 2ZX6A 1W3LA 3SRDA 2FFCA 1XLIA 5BXRA 3RPDA 5FEZA 4O0QA 4D6HA 3UVIA 3PTKA 3DK4A 5JCNA 3MI3A 5K7JA 1TJ0A 3WBWA 3QMTA 4GZJA 2J8FA 2ZA3A 3S4TA 1DWIM 3MWAA 1GEQA 1Q63A 1C3FA 1NDVA 4R53A 4L56A 1LL6A 2XSBA 2YW4A 5G2HA 1VQTA 3COTA 1R3QA 3W1XA 3WK0A 1GW1A 2CZEA 4O14A 3ZT5A 3A5FA 4HMCA 1V6VA 3AIEA 2H3BA 4S3GA 2VD9A 1EA0A 1LVLA 1UR1A 4KCUA 2CZ5A 1EGMA 2Y8UA 1BFNA 3VILA 2V3AA 1D2KA 1QJWA 3QPZA 3GUWA 4L65A 4QXIA 3TYBA 1D8WA 2BXZA 4J7RA 3W02A 3GC4A 4WQ6A 2OYLA 1ZPTA 2H6RA 4RDYA 1OEPA 5D03A 4A8RA 5LHEA 2DV0A 4M1BA 3LDVA 3WX7A 3KRSA 1GZGA 1FWJC 1JVNA 7XIMA 1IHIA 3OA5A 4IM4A 4Z0JA 4L7ZA 4Y8EA 2PS2A 4JAWA 4E38A 1CEOA 3NR0A 3BZJA 5M5DA 4ZFMA 4IJRA 2ZFAA 3M0YA 3T81A 1K9FA 2ZVIA 2ZUVA 3UESA 4ZOEA 4PUMA 1H7RA 1CENA 3N12A 1SQ7A 1HQTA 3BPWA 3DKLA 3FGCB 2FZBA 4PTXA 3C8NA 2DT1A 1UCWA 2HROA 4OV9A 3HGSA 2V5CA 3H23A 2XVPA 1BSLA 1WOAA 4AZHA 3C0JA 4ZE5A 3ARWA 3QHOA 2ZRXA 1EPXA 5BXPA 3RG6A 1GT8A 1V3HA 3CUFA 3MZ2A 2PDPA 4L64A 5IDIA 3R94A 1TJPA 1EIXA 3AUOA 5G5GB 2IXUA 3OC4A 3VNZA 2XFYA 2WVUA 5FI8A 4KETA 2EG7A 4MZYA 2JF7A 4JQ9A 3LUTA 3LCXA 4IPNB 1TUXA 2O7QA 5BU9A 3S8HA 4K36A 4O11A 1IEQA 3F2DA 2QV5A 1PHQA 1R30A 3EMCA 4S3EA 1ZMDA 4GXPA 3DFQA 1XLLA 2C16A 4EOUA 3W3OA 1V3KA 2AMXA 3MY9A 3L0KA 2QIIA 2RJGA 4NAEA 2X0YA 3QPYA 4DZAA 1KM4A 4B5VA 3ARPA 3IIXA 5C71A 1WKEA 1LLZA 3RR4A 3HU7A 3RGTA 3N11A 4MJMA 4R9OA 2XIOA 1UH3A 2RHGA 4O52A 4QGCA 3GXIA 1V3LA 3LXDA 1T0OA 4C1LA 1ZJIA 2JKAA 1SZGA 5D2YA 2HWGA 4GXWA 2GR1A 3WQ4A 1S2TA 4WKHA 3F4CA 4QJ3B 1Q7QA 3DUGA 3ZVIA 4GNJA 1BWCA 1H50A 4F8XA 1VEOA 4AY7A 2OWXA 3S0CA 5BYWA 7REQA 1Z6KA 1BWLA 1W5MA 4NF7A 4CU6A 4A3UA 3FHQA 1AJZA 1XDIA 1XM3A 4G7EB 4A2SA 1KM1A 2FPTA 1C9WA 1U1JA 3A7RA 4XZHA 1H7NA 4HJFA 1GOKA 2BSLA 3VM7A 5HNNA 1CXFA 1GCYA 4G9PA 4CQAA 2Z1VA 1QBBA 1GGOA 1X1ZA 1TV2A 2V6AA 3P81A 9RUBA 4YCPA 4MMWA 4DYKA 6ENLA 1V08A 1ZAHA 1GONA 7ENLA 1OADA 4S2BA 3BQ6A 1EYWA 2PDIA 3CMFA 1LRNA 2V0TA 2PDKA 1KFKA 1KBBA 3MANA 2PDHA 4FS9A 4TX9A 3RPTA 2D2OA 1HZYA 3PWAA 3WH7A 1SR0A 1NOFA 4BA0A 1SFTA 1XF0A 2FGZA 1T8QA 1H1NA 1S1PA 3HQ1A 3NEHA 1EX5A 3VGGA 1JUEA 5D2VA 3NVDA 1MEHA 1SFSA 5FF0A 3WH5A 5I0DA 4ZVJA 4GUJA 4HU0A 3QXBA 1REQB 3RRAA 1V6XA 4EM4A 2CFYA 2WCAA 3KS5A 3TW6A 3K4WA 4FP1A 2FTPA 2PF0A 5BRPA 3SCSA 4UTFA 1VPYA 1Z8AA 3AYVA 1J79A 2CLMA 5B7YA 3QM3A 3GG1A 1TYGA 4I7WA 4AHPA 3UZZA 3KUMA 1R2SA 4X61A 1PKYA 1ONXA 2PTXA 2IMRA 1DORA 4MHBA 1DJGA 3L5AA 3M9YA 1NF7A 5BZAA 3A23A 3IIPA 2C3DA 4JX5A 2VFIA 5T8GA 2PSNA 2H9AB 5I09A 4N9EA 5K4XA 1XINA 3ITLA 2ZIDA 1EJXC 1KFLA 4F4RA 2EKCA 3ITYA 4XK2A 1JI1A 1KNWA 3H6OA 3PC0A 3QSRA 1K8ZA 5AC7A 5FJPA 1A5SA 3IAQA 3B9EA 1CLKA 1S1RA 5EMMA 4IFKB 5XINA 2QJHA 5DMNA 4P8XA 5K4ZA 3AI0A 2G3NA 3EX3A 3TQVA 1XDMA 4EPKA 5TIMA 2O56A 1TPB1 1W1YA 2A85A 3C0LA 2R6OA 3SUTA 4JIQA 1XIFA 4GVHA 3UGVA 2R1KA 3QW3A 1HJSA 1DHPA 1H41A 3T07A 3TYEA 3SQSA 3TCEA 2PBOA 3VDHA 1WZAA 3ZXWA 5ER0A 1ISYA 3GHTA 3R0DA 3CASA 1NDAA 3WF4A 4M56A 4DAFA 4C60A 5F4XA 2V9DA 5HOSA 3O2LA 3SY5A 3UJRA 3CUHA 1P0KA 3LI1A 2CESA 2YCKX 3QH2A 3W24A 3PZMA 4FX9A 1WXZA 2VJXA 4GNKB 5AC6A 3E0VA 3WNOA 1GRBA 4IPJA 5CZJA 2W55A 2E9LA 2VUYA 2J47A 3KTXA 3ENLA 3TWBA 3MTWA 4YNGA 1UA7A 1ZBKA 4REQB 4MADA 1V7AA 2PD5A 3UZXA 4PCPA 2WXDM 1Z42A 5HAOA 4AU0A 1XQKA 4MWAC 4QJ1A 4IQDA 5CZSA 3VZYA 2QCNA 3PUEA 3M6YA 3EX6A 4GIEA 1GXFA 4O0ZA 1PAMA 1EJWC 4FXRA 3APGA 5T9CE 1L9WA 2QVNA 3SI9A 2PBGA 4G1KA 1E40A 1NF0A 2Q71A 1E71M 3KLKA 1E4IA 1NWTA 3AUJA 3M0JA 4I5XA 5BOOA 4FXFA 2G5WA 4INFA 3W2MA 2KZHA 2ADAA 2BODX 4H2CA 3L21A 3CHCA 1S3TC 5FD0A 1GJUA 1F7BA 4EX4A 4UBPC 4LRTA 4UWMA 5GVJA 4DXXA 5DN1A 1E0WA 4J3ZA 4WLCA 2ZE0A 1JCTA 4J35A 1E0UA 5A6MA 3W85A 2OG9A 5A6KA 3RX3A 4YWIA 1B54A 4C7DA 2E7FA 1IXQA 2ZADA 3GZAA 4I8DA 4L4LA 2JBMA 4W84A 8XIAA 1BG4A 2WKLA 3T55A 3CYJA 4ALDA 1K9TA 4NZ3A 5AHIA 2GJPA 4S3FA 2OWCA 3M41A 4OE7A 2QF8A 3AISA 3PBVA 4TVUA 3LNPA 4ML4A 4RPQA 4DO4A 3VX0A 3NG3A 4PTWA 4DJEA 1UJPA 5EBUA 3GH5A 2WO5A 4EPBC 4NX5A 1NPXA 1H0IA 1AODA 4LGXA 3VFCA 3WO8A 4AEOA 5C9UA 4K8HA 4RXFA 2OX1A 4DPQA 2AL1A 4RW5A 3VVGA 2OOGA 2V82A 4F79A 1DJZA 4PBFA 3DG3A 4D6FA 1ELSA 3G1XA 1Q2RA 1DTNA 2FGLA 1VRXA 2X1TA 3TU9A 1LPFA 4APNA 4N9BA 5FS7A 4FB7A 4ZA0A 3MT1A 1I45A 2CKRA 2J3NA 1YPIA 3I4KA 3XIMA 3K1GA 4H04A 4ECLA 3F2CA 3VCNA 1X8CA 2OWWA 1LBMA 3WEMA 1WB0A 3IACA 2I56A 3PNUA 3V1PA 1IT8A 2WJZA 3GRTA 4WIWA 2WNZA 3W23A 4LEQA 1UW9A 5A69A 5D30A 1ODUA 1V93A 4FXJA 3KP0A 2Z2UA 5FS9A 2PAJA 4GGBA 3URBA 2JQXA 3C0QA 3MC5A 5I6SA 4XO6A 3QLLA 3SAZA 4DYEA 2CLKA 2QEZA 1Q6DA 1G4TA 3KLLA 1HKJA 4PUKA 4W4QA 4FIRA 4G5DA 2A6NA 1ME8A 5HUPA 1ISWA 2RH9A 4UUIA 3T08A 4LRSA 2DT0A 1NP0A 5BCAA 4W85A 2GZXA 4JHMA 3FAXA 3II4A 3L4XA 3FCPA 4JFTA 3SUUA 1X98A 3UPBA 3A9IA 4H4YA 2EJ1A 1POJA 3FY1A 4F66A 2V6OA 2ICSA 1UWAA 1XFBA 4UFLA 2NQZA 2NXGA 2EJAA 1TA3B 3EZ4A 1OGBA 3H70A 4W7WA 1IEWA 2PWFA 2DP3A 3D0CA 2W79A 1GTHA 4QEEA 3O0FA 4N7QA 4ROQA 2Y6ZA 2NVKX 4IP7A 1UP2A 1E72M 1UJQA 1FHLA 4KS0A 1YQ2A 3QGVA 1NOUA 3BLKA 4H9VA 1JPHA 1CB2A 4LVDA 1GYNA 4WY0B 4M5PA 5LSMA 1LROA 1CIUA 2CFFA 3LHVA 3VKCA 3GNNA 2ONEA 2GOKA 1FDYA 3BLIA 4G56A 3HPSA 4HA1A 3I3BA 5AN7A 1MZRA 4FNUA 4LS2A 4IL0A 4NJGA 1BGAA 3T6CA 4QLLA 1XXXA 2ZUWA 3PJTA 1IR2A 1HKWA 5I3HA 1EUNA 2ZRVA 4HQVA 4NX0A 4ZXLA 1B0IA 1TIWA 1LG1A 3PFMA 1BQGA 3CHVA 4XD6A 1N61C 5AYZA 3ABOA 4UTKA 5AB3A 1HN1A 2POZA 4H8UA 1XG4A 4BEQA 1C9DA 1RBOB 5HULA 1BYAA 2OLSA 2PDLA 3W7EA 4PRTA 4V33A 2FMOA 1UKOA 3WLOA 4M8UA 3C2FA 4HGXA 3HM7A 1ICPA 1VZWA 3PTDA 3O1NA 3U9IA 1V6YA 1GOIA 4ES4A 3O6YX 2WMJA 1OVDA 3IVUA 3UYIA 3CB8A 2BY1A 1LG2A 3HTWA 2YYTA 4PUWA 1MZHA 5A6JA 1NEYA 1RCQA 2PUZA 3EPOA 1GZJA 1OFBA 2GR0A 1XIJA 1ITQA 2YA2A 4RV3A 3I65A 5AHEA 4H50A 1OCJA 1XIBA 1W17A 3EEZA 1BAGA 1JNEA 3SY1A 2NSXA 1EJ7L 1FWIC 5D8WA 3W1QA 1XLDA 4KGLA 3EWYA 3LRLA 4GA8A 1B3YA 3NIYA 2G4JA 1GRFA 2FJUB 4MFEA 5JH1A 5LXXA 1SB3B 3LZ5A 3WH9A 5KMYA 5D9NA 1XLBA 3EKZA 3GYCA 4JQ2A 2D3NA 1P6WA 3RXZA 2BC0A 2JFEX 4C1NB 4NRSA 1D3CA 1JPDX 1H2IA 3NSNA 5ECUA 5BXTA 1B5TA 1C92A 3M5YA 3KBNA 2G41A 1H1ZA 2DU2A 2A4AA 3LBOA 3AS3A 4WDWA 5DMYA 1XGZA 1H1YA 3XINA 7PTDA 2B7OA 4AIOA 5DY3A 3HQOA 5M3WA 3KRBA 4TV5A 2WSRA 1F4HA 2EPKX 5A6TC 5EGRA 5HWMA 3USBA 2WMFA 5FF3A 1GVYA 3NWRA 1N60C 1JYWA 3RCMA 3K4AA 1TG7A 3HJZA 2C19A 4GJ1A 2B7QA 3D3AA 1Q7MA 1U1UA 3GRIA 3RLUA 1FA2A 1EKOA 1OIMA 3TUUA 4NZ4A 4KWSA 4WY0F 3LMYA 4GISA 1FWHC 3MB9A 4KPLA 1XYFA 2J74A 4FXSA 1RBAA 3QC3A 4CEXC 5C0QA 1SMDA 1A3HA 4IGHA 2L5HA 2ALDA 2TSYA 4DWDA 2FVKA 3TJ4A 4P7QA 1ALDA 4H9XA 1J2BA 2BOEX 3GH7A 3WQDA 4HA3A 2HS8A 4C6FA 3UXAA 5FKYA 5JUVA 2YFOA 4U2ZA 2NX9A 1A5KC 2WJDA 4KCWA 3TYDA 1V3IA 2YLAA 3PB2A 3K8KA 2X2GA 5KEZA 3DFPA 1BVWA 4QIUA 2OEMA 3NVYB 1AG1O 2QPUA 4QNWA 3CK5A 1C8QA 4GO8A 1PYMA 1WOBA 3LQLA 3ZVHB 4GH3A 2V3BA 1OIFA 5C7VA 2G4FA 4U31A 2DZPA 4H19A 1ZGDA 2A3CA 1JDCA 3BO9A 2GGEA 2VFEA 4A3RA 1Y5XA 1OX4A 2Y62A 4BURA 4NZFA 1VIWA 1R9YA 3AHZA 4OIFA 3W72A 5B80A 4ADTA 2HVOA 2GDQA 2PP3A 4NUWA 5CBIA 3W70A 1DP0A 2QCCA 1T41A 2WMKA 2P50A 4A21A 4X9YA 1QR7A 2VDIA 3CAQA 3IV8A 3I7RA 3PJWA 3ARVA 3SCVA 3FLUA 4JIRA 4X22A 3CLMA 2V38A 2EG8A 1G4SA 1F3XA 3BMWA 5CG7A 2BCPA 8XIMA 2QV4A 1OGSA 1EHAA 2BOFX 1KRBC 2A8XA 4HOWA 3JUGA 1NWSA 2XWDA 3GTHA 1UOZA 3KDNA 3OZPA 3HG3A 1GKRA 1G7VA 2QUVA 1LWIA 3EA3A 4NJIA 1XD1A 3PHAA 2WZTA 3VYLA 1VPXA 3EDFA 2BC1A 2JIEA 4D6EA 2BGSA 3F2BA 2VGFA 1IYXA 4CD7A 2HXUA 2RFGA 1MW1A 2BBFA 1D3GA 1M68A 3GW3A 2XSXA 1CXHA 2DY3A 4MSSA 3A4AA 1XCXA 1IXPA 4GJJA 1KV8A 1NVMA 3IUIA 1UKSA 1SO6A 4AF0A 2POTA 2F8QA 2WCGA 4AXNA 3OVQA 1ZLPA 4PMUA 3UGRA 1EDTA 1KD0A 3G22A 3SCPA 4H7ZA 3R7MA 3GTFA 3VD4A 5LNWA 1CGVA 2BB0A 4F0RA 1B3VA 3AYTA 3S2CA 4A29A 1C8XA 4AD1A 3MVIA 4GY0A 3EXSA 3S1GA 1H7XA 2XIIA 1VFTA 2QDHA 1EWDA 2GGGA 4KCVA 3LX9A 1CGWA 2OOFA 1CDGA 1US0A 2QUMA 3ARRA 1JQXA 4GIAA 5I00A 4FX7A 2D0GA 3MP4A 4QBXA 3FA5A 4MF4A 2WOWA 4YJ5A 3QFBA 2FVLA 4R34A 3D3FA 3UCDA 4GQBA 1WE5A 2OSWA 4LV9A 2FB2A 5EMYA 2NV9A 3LM3A 2DPEA 1BXBA 3SO7A 4Q6XA 5G4WA 4AB4A 1O5RA 1XIIA 5CLTA 4ACZB 3N15A 1A49A 4MAZA 1TPEA 2CHNA 4E4UA 4MWAD 4RZBA 3V16A 1S5TA 4GE8A 5I06A 1C8YA 2ZUMA 1HGWA 1FWEC 3TAOA 2ZUUA 4JNMA 4HA0A 3K46A 3ARSA 1KV5A 4OBRA 4IX2A 3DCPA 1N2VA 2GQAA 4N02A 1Q6CA 4RNHA 1P1MA 2Q6ZA 4TTGA 1GOOA 3BLEA 3KL3A 3ZQ9A 4DJFC 2RDTA 4D2JA 3PZGA 5CC5A 5D09A 1V5XA 3LPOA 1MOKA 3VI2A 3ZSTA 2EHHA 3M4HA 2ZZ6A 3AMDA 5HJLA 1E5JA 5DT5A 3SY8A 4GQ0A 4AG0A 1YXCA 2VENA 3URAA 5BOEA 1DHKA 3WLNA 4HK6A 4BQ4A 3G0XA 2ZZ7A 4R27A 2QUUA 4F0MA 2D20A 1F61A 3HZ3A 5REQA 4XISA 3W7RA 3BV7A 3RNDA 2W5FA 4MUZA 1TPWA 1K7XA 5CPQA 3WQ6A 2HV5A 2ATSA 3LHYA 1LORA 4S23A 3ITVA 4GYPC 1EBHA 2QJIA 3EOOA 3H55A 1NARA 1Z89A 3LXCA 3GXNA 3P5YA 2Y8VA 3WQWA 3NVTA 2D73A 1TV4A 4EXAA 4RE2A 3EA1A 4LVGA 3VD9A 2YJQA 1J0JA 1R47A 2D22A 3PSWA 2UY4A 2FZ8A 4X60A 3L9CA 2W63A 3GVWA 2QR6A 3WEOA 4ZFCA 4IHCA 2ABAA 4HU3A 1D7FA 2LLEA 3M0VA 3LCWA 1T40A 4UNLA 1DJYA 3F5KA 4GRTA 2I1OA 2Y85A 1F6YA 2WHJA 4DJDC 5BRBA 3KP1A 1K7EA 2WM1A 3GDBA 4M6VA 3CH9A 1L6GA 3T2PA 4J40A 3BCDA 3EUB3 3UD6A 3CLWA 3NUKA 4UR8A 3WDRA 2NUYA 2IKJA 4GVFA 1UIPA 3WBYA 1R46A 1MQQA 3GKAA 1DV7A 2YB1A 1MMFA 1WP6A 3UY7A 4LPCA 2C7FA 1N8FA 1JAEA 2HDJA 4LCSA 4DN1A 2Y5SA 3L2MA 4BF5A 1NU5A 2X1SA 2C18A 2UY5A 4J3TA 1JDDA 3BLPX 3RN6A 3TEVA 5KITA 5GNXA 1EB3A 1L8NA 3B06A 1JEZA 1R2TA 5DLCA 4FDCB 2O9OA 3N4FA 4FF7A 3LV6A 4JHOA 1UG6A 1YRRA 3GFYA 3CV2A 3LERA 1H09A 4H6KA 5KTLA 1TCDA 2E1DA 1M04A 1M41A 1WYGA 1ADOA 3UETA 4Y2WA 5C9XA 3INPA 2YXXA 1AL8A 1M7OA 1O5KA 2E5CA 1J2WA 4DXKA 3DGHA 1STZA 3GO2A 4B5WA 4Q7BA 4E2BA 3R8RA 5A8NA 1LUCA 1R3WA 4Q4OA 1E1EA 4FI4A 3ABRA 3NNTA 4UZUA 1NHRA 3V18A 1PZ3A 3QKEA 2WSYA 3SIMA 5EY5A 3P2VA 1FTXA 2GQ8A 3H24A 3W83A 5TR3A 1PIGA 4V28A 2NXHA 2Q8XA 2RKXA 1TMLA 1J0ZA 2WC7A 3NQMA 1FWWA 1FWAC 2Y2WA 1UH4A 3ABQA 3U5YA 1SR9A 3W28A 4YVPA 5L6UA 4EMIA 3PK7A 2QCFA 5CJ5A 3FVDA 2EBNA 1UWTA 1TTQA 4Q6JA 3IIOA 4ZQNA 4LOCA 2WVTA 4JX4A 4QDPA 2RGLA 3HFTA 4W5ZA 4J3XA 1P43A 3BV4A 1H63A 1YIXA 2J7DA 6TAAA 1JRCA 4PCTA 4A2RA 4L80A 3B0XA 1QOQA 2J62A 5CAKA 2BP1A 3RM9A 2GVEA 4N4QA 1CLXA 1XRSA 3N4AA 1NQKA 3CQIA 5I3IA 3V0TA 3P60A 1L6YA 2VOTA 4PTVA 3K30A 1C91A 5HQMA 3BMXA 4PUEA 1ZS2A 2F61A 2Q09A 3CO4A 4UMCA 3QQWA 3VDGA 1TJRA 3C61A 3DH7A 1QRQA 4L4OA 3PTMA 3BLLA 1XICA 4EAYA 4D6CA 3QSTA 3WK2A 1DNCA 4AZGA 2XM2A 3THCA 5K9CA 1RH9A 4UQDA 3R8HA 4C6CA 1ZQ5A 2HMCA 4DVOA 1Z9AA 4ZXOA 4GX9A 5KZ6A 2W4XA 1MUCA 3WF2A 3G1AA 4A3YA 1K7FA 2X7WA 2FH8A 1KM2A 4DRSA 1Z44A 5EFDA 1SMAA 3BSHA 4H4XA 1PDZA 5ABFB 4UZSA 3LENA 5LKYA 2WSKA 3WJZA 1ZCOA 3ETRB 1MRQA 3FYPA 3FN9A 1J5SA 1KXTA 5I24A 1OYBA 3W0KA 3V36A 1QK2A 1D9EA 1VB9A 2WMIA 1KN0A 4XO7A 3T2QA 1OG0A 1IIGA 1OFDA 2H90A 4Y6GA 1N7KA 1GPFA 1EHNA 3MCMA 3E96A 3EB2A 3IRSA 2Y88A 1TSIA 4RJEA 3DGRA 2FZDA 2PB1A 3UJFA 3N04A 3STEA 3QZAA 4LNYA 4DM1A 1UR0A 2Z2BA 1XH1A 1UKQA 2HPIA 4MNMA 1TPDA 4KF1A 4QX4A 2ASHA 4TVDA 2QJNA 4F0LA 4ONVA 3ZR5A 4H8HA 1A5MC 5PTDA 1CXEA 1SJDA 4BHYA 3ZJ6A 3IGUA 4N42A 3P62A 3T40A 4HPJA 4BI7A 4PL1A 2WYSA 1LOSA 2VURA 4PUDA 3KL5A 3DG6A 4A3QA 1BKSA 1I0BA 4YVVA 3WMSA 3RK8A 4MJ4A 1V3JA 5A2CA 4MB5A 2WPBA 4NVTA 1R86A 6REQA 3P6LA 3L8KA 3U5UA 5EYWA 4J57A 2YSWA 1TE6A 4UR7A 3U3HA 1EDGA 1BF2A 1GRHA 3UG8A 3PFRA 1HNYA 2NLYA 1EC8A 3Q37A 4PCSA 3T0AA 2VC5A 5FL1A 4R9XA 3IPWA 2VZSA 2DZWA 4WRHA 3NJ3A 1TV7A 5AFDA 4LVAA 3BW2A 3LHZA 3VCRA 2CLHA 1AL7A 2DIJA 1VFHA 1K9DA 5LIKX 1UA3A 4IUGA 3QPEA 4XZBA 3I7SA 4MKNA 1FDZA 5F1UA 1IT7A 1FEAA 2HS6A 2J7FA 3W76A 4GUFA 4E4PA 3SCNA 1AZ2A 3MP5A 1YQZA 1GHRA 3UA3A 2VX7A 4U28A 4JCLA 2QCEA 1F6PA 4C6JA 4K8DA 4Y9AA 1RVGA 4DF1A 1M7PA 4LXFA 1TZ7A 3TW9A 3S1WA 3GG7A 4GI6A 3N18A 4KERA 3ME3A 1W1B1 3K2GA 5F7UA 3Q58A 5C5YA 4I6VA 4J3WA 4GQRA 1TWIA 2I5IA 4YIWA 5EU9A 5TF0A 2Y7EA 1OM0A 4IPPA 3AXXA 1N5WC 4DUVA 5JCLA 4V15A 5CGTA 3WG6A 4GFIA 4IFRA 1CTNA 1K9EA 4GUHA 3W2UA 1ZDLA 5TD4A 1QW8A 1LCOA 4JTIA 1C7TA 4KFOA 1DJNA 2R1PA 7REQB 4PMJA 2W91A 4IJBA 3M0LA 4Q4QA 1SW0A 3V3WA 4P2VA 3CH0A 3FYYA 4I7UA 4OOZA 1WXYA 3EPMA 3NO5A 1XBZA 2A7NA 3L4VA 1TTIA 3C4UA 2YFNA 3DDMA 3MSYA 4D6GA 2QCMA 5G5IA 3GR7A 1E6RA 1HVQA 3IK2A 3WUBA 4Y90A 3FFSA 2PGFA 5FF4A 5HWNA 2QVHA 3N19B 1FWCC 4KGJA 1AOGA 3QR3A 3FV9A 4QG8A 1VPQA 1GVQA 1M01A 1WZKA 2EPMX 2Z2AA 3B8IA 3WDPP 1DXIA 2PDWA 4RDZA 1D7YA 3AS0A 4DWSA 3ZT6A 1KXHA 3ONBA 6ALDA 1BTMA 3M07A 3BLDA 1DIKA 3TE9A 3TJIA 2GRTA 4C6DA 3TC6A 3VNKA 1K3UA 4FR6A 2CPUA 2NX3A 4U5IA 5DCBA 3VCCA 3NZGA 1NY1A 4DI8A 1I1XA 1LT7A 5A2AA 1QPRA 3KM8A 3G1SA 3UT0A 3KHDA 3LOTA 1YHTA 1NWUA 3GD6A 4ENLA 3L4TA 3UERA 1IEIA 1K4HA 1WCGA 4ZB0A 1Q13A 2ACSA 3ARZA 3A21A 2WBKA 2PPGA 2E28A 1BRLA 4V2XA 3SJ3A 3QV9A 2OLAA 2DSZA 3VOJA 2E0PA 1X6UA 3WH6A 2PDYA 1Q1WA 4PTMA 1YLVA 5ABTA 4CU7A 1OT2A 4GC3A 4FNQA 4Y9NA 4UXDA 3EKLA 3G2GA 4WOQA 2QCHA 1TJ1A 1FP8A 2WSQA 4J3UA 1TWWA 4E0CA 3FA3A 2C1IA 2ZX9A 4KPRA 2J13A 3KAOA 1KQYA 1R7OA 1GYLA 5IXEA 4MG4A 3MDWA 5C2CA 5H8PA 5AYYA 1O12A 4D6DA 1PTAA 2YVGA 1ML1A 3G1YA 3E9AA 2OYKA 4NILA 1QTWA 4DJFD 3P14A 2IUZA 1HL8A 2QT3A 3W6YA 3VIJA 1R85A 5IBXA 3S6DA 2J6VA 2P0IA 1NWRA 4B5UA 2DVXA 4K7VA 4JL2A 3VIMA 1U5HA 3CC1A 1HP5A 4XZNX 2I16A 4BWLC 1CX9A 2PDFA 3VD5A 2VCBA 3T8QA 2CW6A 2D2GA 3V0SA 4B5XA 4C7FA 1B4KA 1IE7C 1VHCA 4ZO6A 2CLEA 3CU2A 1HKMA 1PXGA 2JGYA 1QT1A 4GVIA 1YMYA 4MYXA 3C0SA 1CGTA 3AHYA 2AAMA 3L68A 3TYAA 1RQBA 3WEZA 3VGFA 3GXPA 1ZU8A 3BL3A 2OKTA 4HNUA 2GGJA 3LTSA 4NNAA 5T9BG 5CPMA 4YLWA 3FKKA 3UU0A 3WQEA 3N29A 3WLKX 4IMEA 3SQMA 4HSOA 2EQ7A 1EFZA 1GVSA 1GETA 2QS8A 4Q33A 3M1ZA 1LQAA 4QNEA 1Q8JA 2IQTA 4LWWA 1I60A 5FMHA 2E09A 3RRXA 5BROA 2XFWA 4KFNA 3TZNA 4R7WA 3WJWA 1MDLA 1JYNA 1DL3A 3M5XA 4J4KA 4CCDA 5JRBA 4LY4A 1JCNA 4AC7C 2ISVA 3H26A 2WJEA 1HTIA 2DZTA 4WDUA 3M47A 3GE7A 4AD2A 4RE0A 3VX1A 3VOGA 4K1GA 4IMAA 3L67A 3HF3A 3SM0A 3V0UA 4PFHA 2PTYA 1KM5A 1Z32X 3LCLA 4H4RA 3ITTA 1KXQA 1F8IA 3B8DA 1KM3A 3UXLA 5CPSA 1E70M 2CZFA 3G1RA 1YE6A 4LUTA 3LADA 5E9XA 4US5A 1KFCA 4ZQCA 3VIFA 3B0YA 1XH0A 3E49A 4H6QA 2IPGA 1XC4A 3L4UA 1GQKA 4BQ5A 2IQ0A 1Z48A 4IMDA 2JGQA 1EPVA 5CC6A 4EMWA 4ZTXA 4L6HA 1CYGA 1OK4A 3OGRA 4FSAA 3MKVA 2A3EA 3UG5A 4H4VA 4AC1X 4F0HA 1XKYA 1WAWA 2WPFA 1F05A 2DGAA 1W1PA 5HUOA 3O6DA 3KBJA 1ZXIC 2OO6A 3FS2A 4M19A 3OZMA 4Q4MA 3OW1A 1KFBA 2ALRA 1HKVA 3T9PA 3OBEA 4A8IA 4CNPA 3IWPA 3CMGA 2XH2A 2V30A 1GHSA 3RITA 3TH6A 2QGHA 1WNOA 1R3SA 3KOYA 4NNBA 3I3DA 2KAUC 4HZ7A 4DQWA 2J24A 3SECA 1RM6B 1S5NA 3EDJA 4H6RA 4JFVA 2VZOA 4YHGA 3YPIA 2DDXA 3DFNA 1S3HA 4XAPA 1F5ZA 3ZJ7A 5CC7A 3RLGA 4IICA 4GZ7A 3LHUA 4DBSA 4KRTA 4J3VA 1VH7A 4HPNA 4DNMA 2PU0A 2FDSA 5G1TA 2EQ8A 3LPFA 3TNOA 4QSFA 4AD0A 4AWUA 5CEWA 1GRGA 3P67A 3S2JA 2W3SA 5HK4A 4E2OA 1PPIA 2HCVA 3VNDA 4C6NA 1SUXA 2A3LA 3Q2DA 2EO7A 4Z2LA 1Y7VA 1AQMA 3W7CA 1VGAA 2BMBA 1MQRA 3O7UA 5LNUA 1QU4A 3E5PA 1VCVA 3TR9A 1FUYA 3ITOA 5D8ZA 2QDEA 1QPQA 3ABXA 4M6PA 3FDGA 4GYFA 4JICA 1UBSA 3RM4A 1M9HA 1QHZA 3POHA 3TN5A 3WDJA 3A4XA 2QUTA 4GFSA 1EC9A 3OGSA 4RZ4A 2C14A 3CXBA 4LAOA 3MQTA 4WZHA 1QASA 4PC8A 4CCCA 3KEHA 4PR4A 4MNLA 1KRMA 1H7OA 3NSXA 1KCZA 2CZDA 3W86A 4AIUA 3OA3A 1M7JA 3RF9A 3W1RA 1PYFA 2QCGA 5RUBA 1M6IA 2DVTA 4XZ9A 5GNZA 2ZZ0A 2INEA 4HPHA 2WNQA 3DI1A 1HXJA 5AKQA 1DJWA 3P74A 3QGKC 3CQHA 2GVJA 4AD5A 4EQXA 4HNNA 4JQAA 1E3XA 3VC6A 1UWRA 3WJXA 4WCJA 3KVKA 3RYSA 3T05A 3ABSA 3H2NA 1UQYA 4IOTA 3W1PA 4W7UA 1C8VA 1HF6A 2VI0A 3H2CA 4B5SA 3UJEA 2ACUA 3VE9A 3ANVA 3THAA 1E55A 3TN4A 4QCEA 2A7PA 1VF8A 4EXBA 4JYFA 4WSKA 3PR2A 3PANA 1E9YB 1GOMA 3FSTA 2WB5A 3EX4A 1JFXA 1AZ1A 3R13A 3FKRA 3KX6A 4C6QA 2ZX5A 3HGRA 4AUBA 2WPCA 1E51A 1ZENA 1UZDA 2RAGA 5FOOA 4BI6A 1EJRC 4RX0A 3MUXA 1QFEA 3URNA 1O68A 4QDMA 3TJLA 1YDOA 3TSMA 1KB3A 3F5JA 3W1UA 1TR9A 4DWSD 3BURA 4HOXA 1YADA 2W27A 3N13A 1HJQA 4E8DA 2BG5A 2Y70A 4CD4A 3WLIA 3P80A 2VRJA 1QHOA 2XISA 4WUIA 4JQ1A 4JTKA 4O0KA 1G01A 4WKFA 4CEUC 4FNPA 2XPKA 1AMYA 3GB6A 4NEWA 4J9JA 1JCXA 1ZJAA 4LC8A 3BAWA 2Z6JA 2FHBA 1NDZA 1O94A 2GGIA 1ADDA 1M1BA 1OT1A 3LM7A 2BZNA 2FQIA 6PTDA 4N9DA 4GLEA 2ZRWA 5D2TA 2ZXDA 4OBSA 4QQ3A 1LQ2A 3PM6A 1R3TA 3B97A 4MZ1A 4GZIA 4JTHA 5DEZA 3DERA 4AZ7A 1AA1B 4NT0A 5AVNA 1H0GA 3UJ2A 4JKLA 2A5HA 4O18A 4YU1A 5F2LA 4W93A 1H5VA 2F7FA 3E2RA 3HPAA 3EWWA 5B7ZA 4RZ5A 2Y1HA 2ZXAA 2V68A 1YYAA 1HO4A 3DGBA 1KO0A 1GQIA 2QGYA 2VQUA 2GJNA 4JD4A 1P7TB 1ENUA 2DIEA 1IWBA 4M80A 1W6TA 4HB7A 4EM3A 1CCWB 5EB8A 3R43A 4ZCWA 4GHRA 1QOXA 4Q8QA 3VINA 4IIGA 5IHRA 2D0FA 4B9ZA 1SJAA 2E8ZA 1F8WA 3GTIA 1VFSA 4RNIA 1UP3A 1FWFC 4LBSA 3S5OA 1JYXA 4H01A 1VDVA 5I79A 4MIMA 4CD8A 3ITGA 3GQYA 3VZZA 4CN1A 1GVRA 4UNIA 1CZ1A 5DXYA 3PZVA 3MI2A 3XISA 5KZEA 5ABHA 1FHVA 3BDKA 1UUMA 4JGDA 1EEPA 1B3ZA 4TR9A 1X6LA 1LTDA 2X1UA 2AAAA 1QXLA 3GU2A 1TQXA 5A6BD 2AQOA 4ADUA 3WBAA 4CVUA 2BXVA 3THUA 3U0HA 1XLEA 4ZOCA 2Z26A 5E0CA 2WANA 4Q8PA 4H4PA 1FH7A 2QAEA 3HBLA 5A6AA 4KEZA 1TZ9A 4BK9A 3DFOA 2ZKMX 4U5KA 2RJHA 1S38A 3FGCA 1PZ0A 1PX3A 1SO3A 2J75A 3WD2A 4JTCA 1PEZA 3AQUA 1UD5A 4C6EA 2OZ3A 3FG2P 1JZ8A 2FPYA 3ARTA 2GJXB 1TB3A 3GIQA 4XIAA 1KM0A 3LMZA 1QOPA 3NQ7A 5I5RA 3R58A 4G6CA 5BOFA 3CAVA 3GTNA 5HNUA 2OTDA 2IPJA 4GABA 4BQ2A 3W6MA 4QDWA 1HJXA 3NXLA 4MY9A 2EAWA 4FX6M 1AVAA 3O9NA 4PMXA 2PCEA 3LLFA 5CSSA 1LT8A 2XSAA 5E6ZA 4ZO7A 1UD3A 2OQHA 5FSEC 3BOFA 2GOUA 3PP7A 1UR9A 2E67A 2YXOA 4GZEA 1FVPA 1W54A 5C9ZA 1TWSA 4U10A 4UFIA 3IJQA 5E9AA 4JPGA 4LW7A 4M81A 4AY8A 3HMCA 4AHQA 4GO9A 2XZ9A 2NSOA 1AW5A 5FJTA 4NYUA 6CGTA 2C15A 2GFTA 3VK5A 1RD5A 3NFUA 2TMDA 3OYZA 1KCKA 1RK6A 2G96A 2PC4A 3OHMB 4QG9A 5FS8A 4TV6A 4W9TA 1EP3A 4JTGA 5CLWA 2HSAA 3WLPA 4S3AA 3A6OA 2Y0FA 4N2YA 2ZTKA 3W7PA 4GIRA 3UF9A 2RDWA 4C90A 4G7EA 4EPEC 2XGBA 1ZP3A 1HGYA 2DZXA 3SCWA 1E9ZB 1G5AA 1FIQB 2FZ9A 3CAWA 4GPNA 3EB3A 2V3EA 1A53A 1K8XA 1R3RA 2OT1A 1EJVC 3W2KA 3MMWA 4IJCA 4L1GA 3NQBA 4E2DA 3GKFA 1W9VA 4DBUA 4LC6A 3S5ZA 4LQ1A 3TTEA 3RCNA 1T99A 3VAVA 2BFGA 4CVWA 1KXVA 4FMVA 3UCCA 3BARA 4FR1A 1WDDA 1DXEA 3VNLA 1E56A 3S5SA 4BF7A 3VKAA 3LBMA 4D8ZA 2C71A 4N9CA 3G1FA 3G1DA 2CDUA 1V8EA 4QCFA 1KKOA 2ZA1A 3WQFA 4OU1A 5T26A 2WW5A 4GG9A 3VGBA 4L6DA 1GYMA 1KKRA 3CUZA 2G50A 1UWIA 3CYVA 4E3TA 4DPPA 1RK5A 1EX1A 1GPWA 3W74A 4D8LA 8TIMA 1REQA 3PG9A 3AXMA 1C90A 3VA8A 2G3FA 3BJSA 2JF6A 4Y9PA 3H2AA 4YXGA 4MM1A 3LI0A 3UBPC 3WF1A 5M1TA 1WPCA 1RY8A 4DAIA 1FH9A 4GD0A 4XX6A 2R14A 1VFLA 2ZVRA 4XG1A 4WJ8A 2F6UA 2MUCA 3LGEA 1PHWA 4HSNA 2INZA 4CQDA 1HG3A 2V5DA 5LA0A 1A5OC 1JZ2A 2QJGA 5CPTA 1B9ZA 1OFRA 3S2MA 5C6MA 4MDOA 5BMWA 4K1WA 7TIMA 4D8AA 1JEHA 4U33A 1RJRA 4AQLA 3BAKA 2H9AA 1ZSXA 3NPWA 2ZX7A 1XV8A 1SZRA 2WJFA 4DYJA 5REQB 3PPFA 4EWND 2HBXA 4Q8VA 4WHBA 4QJ4B 1MFUA 2XN0A 2XM1A 2ZDSA 5DQPA 2O9PA 5JBEA 3QC0A 4KWOA 2WLZA 2CBVA 2Y5JA 2AQVA 2QDDA 2Z7GA 1PZ2A 3NCOA 1PX4A 1XCFA 3P82A 4N6EA 1EP2A 3W6LA 3EWZA 3WJSA 1FWDC 2OGYA 3PBYA 2VL4A 3DECA 3ZLHA 3DFYA 3U2EA 1YEYA 3THQA 5AVHA 1W32A 1LBFA 2YAUA 4UTWA 3NZQA 4HZ8A 5TBOA 3WENA 1EL3A 3A7UA 3GYEA 4JNYA 4BR1A 2X2YA 4EP8C 2A3AA 1TQJA 1J10A 1PDYA 5A6LA 2HK1A 4M52A 1CGUA 2NV2A 2SFPA 3MO7A 1T7LA 3LLXA 1PKLA 5E0KA 1I8JA 3CNYA 4S3CA 3LEPA 2J9ZA 3V75A 4PL2A 4ORMA 3STFA 2FMNA 5DRCA 1RHCA 4AX7A 3N25A 1EO7A 2CBUA 1AD1A 3FXGA 4IT1A 3PZUA 3GG0A 4URIA 4C6IA 2WBGA 1BWVA 1Q6GA 3DOPA 1SO4A 4EKJA 4NZCA 3SCOA 2WZEA 1UASA 2O55A 3V7PA 4JDYA 3LXBA 5KETA 3AU2A 4AWTA 3FXYA 3ITXA 1W9UA 3TROA 3N6QA 1B31A 1NFGA 4B92A 3VIOA 3B8WA 1FRBA 2BHYA 1OABA 1TO3A 2Z1KA 3GD4A 1UIOA 3KRUA 1EIBA 1I1WA 4PUNA 4M0XA 1NDWA 1OZMA 4D6IA 1GTEA 3OLIA 3DK8A 1GEHA 4KKXA 4L9XA 4BZYA 3HGOA 1ZX9A 1QW7A 1FHDA 3VM5A 4Z1BA 4AVFA 3OJGA 3IS4A 4K3ZA 2XGZA 4FA3A 1S39A 2H3DA 4JTTA 4V27A 3MV11 3GLCA 3PWIA 2WVVB 2H8ZA 2VFDA 4NU7A 1DVJA 2E40A 4JNZA 1SSDA 3MYPA 4LAMA 2J7HA 3ZWSA 1CXLA 1KFJA 1UPMB 2RGMA 3T0TA 3AN1A 4JHZA 4LUSB 1L2QA 3UR8A 3E0LA 3B0PA 3CV6A 2NZLA 3CV1A 4EF9A 5FS6A 3KVLA 3SGUA 3T0DA 4UTJA 4MNKA 4P7RA 2Z7KA 2AKZA 1PO9A 3RO8A 5LHFA 3SN0A 2PDGA 2E6DA 1Q8AA 3QZ6A 4KEUA 3ISIX 4X9SA 2J77A 3N2CA 3UY8A 1TX0A 4FEZA 1R7AA 4MKSA 4KWVA 4W5UA 4F9JA 2FGBA 4XV0A 4KRUA 1E6NA 5DT7A 4KT2A 4XUGA 1OF6A 4DI9A 1KQZA 3AIRA 1XYZA 3QGAC 1I75A 3J7HA 4W8AA 3AROA 3DKJA 3MWCA 5C9WA 4IIDA 1SSGA 1BZLA 3WF3A 3TVAA 2OZ8A 3P0WA 1CB7B 5L9FA 1MYRA 1I2NA 2QNEA 2V63A 3P7YA 4Z08A 1GW9A 2VX6A 4HPXA 1FWSA 4EE9A 1H11A 4CD5A 4B3KA 2R1MA 3IVSA 1WA3A 4O1BA 4UMBA 2O7SA 2QIWA 5C2GA 1E6QM 1PX8A 3EBVA 5AHLA 4XD5A 1EZ2A 3VUPA 4TVYA 2ON3A 1FEBA 4W7VA 3VTRA 4F2UA 2R9ZA 3NL5A 9XIAA 5HXMA 2C6QA 3N34A 4I9MA 2PZ0A 3URHA 1JDFA 4H9MA 3LTPA 1KGUA 3B4UA 4IUOA 3FW6A 1MW2A 2DORA 4QP0A 4ACYA 1VD6A 3MP3A 3TJXA 4ICCX 1ZCCA 2NVCA 2IKIA 1BTCA 4GACA 4RDWA 3QN3A 3OLDA 2ZDRA 4JKKA 1A5LC 4K8GA 4V1XA 1DWFM 1SO5A 3F03K 2WMIB 1TPFA 3NQ8A 8RUCA 4M7TA 1FWNA 3LCHA 4V1YA 1I2OA 2CCRA 2GR3A 5I3GA 4K7ZA 3D46A 1CI1A 2C0HA 3CEPA 2BDQA 4YTSA 2AGKA 3VOCA 4DNHA 2WM0A 2Y4SA 1YDVA 4AAJA 2IS7A 3B8SA 1Q6QA 3USZA 1RVKA 1A80A 1JIBA 1E0VA 1XIGA 3BH4A 3V5OA 1SJBA 1WDWA 4GINA 3Q6JA 3OHIA 1NJJA 3M46A 1TMHA 4MTVA 1UB3A 1A5NC 1JQVA 3DHPA 1WAUA 4NZ1A 5CH9A 3R0KA 1XLAA 2E8YA 5FL0A 1NM9A 4O16A 1UWSA 3HB9A 3EGJA 1W91A 2FTYA 1TZZA 1V59A 6REQB 2XGIA 3W7JA 3HN3A 4PMZA 4YTTA 2ATMA 1VEPA 3MKKA 4QS5A 3M6DA 1I2QA 4XZLX 3LGGA 3NTYA 1XX1A 4JEJA 2F6XA 1JROA 4JTJA 4A35A 2YA1A 2UWFA 3SR7A 4WD0A 1W1TA 3L2LA 2Y8KA 5M2FX 1HX0A 3FX4A 3HQNA 4LALA 3NDYA 1X8FA 3CXOA 4M6QA 4Y9MA 4GI9A 1OGGA 1GNXA 4I9JA 4IF2A 2WWCA 3FJNA 1P4CA 4D1JA 4X2RA 3ZJKA 1K70A 3EWUA 1AJ2A 1JYVA 2A7RA 3R79A 1A5UA 1S2UA 5LIWX 3JS3A 4Y8FA 3CAKA 3TFXA 5A6SA 3CGBA 1YPXA 4UQAA 4UTTC 4CNNA 1J0KA 2NLIA 1PE1A 4IWWA 5CSRA 1GV4A 3FNDA 3R1ZA 4MJ2A 4OBTA 1DXLA 1IR1A 5KZDA 6XIMA 4NI3A 4R85A 1NHPA 2AGTA 1KWGA 4H9YA 3QEZA 2VEKA 1POKA 1RBLA 3TMQA 4QLJA 3L65A 5FJRA 5BMXA 2BY3A 4JIHA 2PDMA 3AYRA 2XHYA 1W3TA 2C13A 2NQHA 3KS6A 4M1RA 1RP9A 4WEVX 4AZCA 5G2WA 1P48A 1CW2A 3BOXA 1G9HA 4ZOBA 2P5NA 4ZOAA 2GL5A 2EPOA 2J9YA 3BUVA 3A64A 3C8FA 3NZPA 4A05A 2VC6A 4IGMA 1VFUA 1ZBWA 4HHLA 4K7YA 2PWEA 1WDSA 2FPVA 2VUNA 5I03A 4PH6A 2OQLA 4O15A 1AQ0A 2UBPC 4NXSA 3HG5A 1F76A 2E1WA 1W37A 4Y96A 3E12A 4OQVA 4LVBA 3I10A 1NSJA 4GYJA 4C1NA 1VCFA 4OV4A 7CGTA 3G24A 4GBUA 3A9BA 3A5VA 4O8AA 4QEHA 3HPFA 3L4ZA 1UZHA 2QF7A 1B9BA 1E15A 4ICMA 1QNQA 4WGHA 4IISA 1O6IA 4XZWA 3H2OA 4N6FA 1WX0A 4C6MA 3ARXA 3GBEA 5GRTA 3U6WA 4JYDA 2VQTA 3I4EA 1PTGA 6XIAA 4AFYA 2FZMA 3N2XA 1RCXB 1MRAA 2ZZ1A 3B9OA 3GM8A 1RQHA 4DWSB 3IC9A 1FO4A 1VR6A 3W7DA 2PDBA 4WKAA 4ATLA 3S1XA 1S7MA 3CQ0A 4LF2A 1GVIA 5CJMA