3ZVIA

Methylaspartate ammonia lyase from clostridium tetanomorphum mutant l384a
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
415
structure length
415
Chain Sequence
b'MKIVDVLCTPGLTGFYFDDQRAIKKGAGHDGFTYTGSTVTEGFTQVRQKGESISVLLVLEDGQVAHGDCAAVQYSGAGGRDPLFLAKDFIPVIEKEIAPKLIGREITNFKPMAEEFDKMTVNGNRLHTAIRYGITQAILDAVAKTRKVTMAEVIRDEYNPGAEINAVPVFAQSGDDRYDNVDKMIIKEADVLPHALINNVEEKLGLKGEKLLEYVKWLRDRIIKLRVREDYAPIFHIDVYGTIGAAFDVDIKAMADYIQTLAEAAKPFHLRIEGPMDVEDRQKQMEAMRDLRAELDGRGVDAELVADEWCNTVEDVKFFTDNKAGHMVQIKTPDLGGVNNIADAIMYCKANGMGAYCGGTCNETNRSAEVTTNIGMACGARQVAAKPGMGVDEGMMIVKNEMNRVLALVGRRKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLASPARTATE AMMONIA-LYASE
publication title Engineering Methylaspartate Ammonia Lyase for the Asymmetric Synthesis of Unnatural Amino Acids.
pubmed doi rcsb
source organism Clostridium tetanomorphum
molecule tags Lyase
total genus 164
structure length 415
sequence length 415
chains with identical sequence B
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
A PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3zviA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3zviA01
3VA8A 1SJCA 2QJMA 1SJAA 3NXLA 3STPA 3S5SA 2OFJA 2ZC8A 3UJEA 3D46A 3UJRA 1KCZA 1XS2A 1IYXA 1TKKA 3SBFA 2GGEA 3NFUA 2P8BA 2AKMA 5FJOA 3N6JA 2NQLA 2HXTA 2HZGA 2PTYA 3B97A 3BOXA 3MWCA 4JN7A 3H12A 3TCSA 4HCLA 2AL1A 1JCTA 4HN8A 1EBGA 1BQGA 1KD0A 4ZA0A 3UCDA 3P0WA 2OG9A 3DESA 2OVLA 4HCHA 3OZYA 5FJRA 3CB3A 3P3BA 2QJJA 4GIRA 3UGVA 1MUCA 2PU1A 3DG6A 1JPDX 3T6CA 4GYPA 4JHMA 4E4FA 2GGJA 3UJSA 3K1GA 1ELSA 5IDZA 1ECQA 3RR1A 4DN1A 4A6GA 3PWIA 4HNCA 3FYYA 2XH2A 5FJTA 3FXGA 3CXOA 3V3WA 1FHUA 2QVHA 2OKTA 2GDQA 2MUCA 2GL5A 2XH0A 2MNRA 3MQTA 3PK7A 3TQPA 4J1OA 4HPNA 3DG7A 3D47A 3DIPA 3CK5A 3QN3A 1MNSA 4K8GA 3ZVHB 3MZNA 1W6TA 2FKPA 3OP2A 2POZA 3SQSA 4X2PA 1MDLA 3JVAA 3H8AA 2OPJA 3I4KA 3ENLA 2PU0A 3I6EA 4H83A 3RGTA 1ONEA 3TJ4A 3NO1A 3I6TA 1SJBA 4IT1A 3V4BA 3CAWA 2PSNA 1YEYA 3FVDA 1EBHA 2PTZA 2FYMA 3DFHA 1MRAA 3TWBA 3R11A 2DW6A 2XGZA 2P0IA 3N4EA 3Q4DA 2P3ZA 4M0XA 3S47A 2OZ8A 3TTEA 4GYPC 2QJNA 4KEMA 4KPLA 2OQYA 5J04A 4E8GA 3H7VA 4HNLA 3VCCA 4Z1YA 4IP5A 2GGHA 3QTPA 4IL0A 7ENLA 3GC2A 3GY1A 4J3ZA 3ZLFA 3UXKA 4ENLA 4ROPA 3FV9A 1KKRA 1WUEA 4H1ZA 2PP1A 4GMEA 4DHGA 1RVKA 1OEPA 3DGBA 4KWSA 3N6HA 1EC9A 3JW7A 3UJFA 3V5FA 3BJSA 3P93A 1JPMA 2AL2B 2ONEA 1MDRA 3BSMA 4IZGA 1R0MA 2OO6A 3R0KA 2QQ6A 3SJNA 3VDGA 3UXLA 3MSYA 1EC8A 2O56A 2GGIA 3SN0A 2CHRA 3PFRA 4IL2A 3R25A 4GFIA 4MGGA 4H2HA 1SJDA 1P48A 4K2SA 1TE6A 1F9CA 4JN8A 3UCCA 2AL2A 2PP0A 3CT2A 4YWSA 5BOEA 1KKOA 3GD6A 3OPSA 1E9IA 2I5QA 5FJUA 5EU9A 3RO6A 3ES8A 3SN1A 5BOFA 3ZLHA 4HCDA 1TZZA 3VC6A 1XPYA 4GGBA 4G8TA 2PS2A 3QKEA 2AKZA 1BKHA 2RDXA 3TWAA 3Q45A 1EC7A 4IP4A 3TW9A 3ZVHA 4E4UA 1R6WA 3GO2A 4K1WA 4IHCA 3RRAA 1NU5A 4DYEA 3EKGA 2PA6A 3DG3A 3OW1A 3NZGA 3QPEA 4E5TA 2PGEA 4DX3A 2XSXA 2XH4A 3ZLGA 3JZUA 4A3RA 3H70A 2PGWA 3T9PA 3R1ZA 3RITA 4EWJA 2QDEA 3VCNA 1P43A 2ZADA 2GGGA 2PPGA 4FP1A 4GISA 4G7FA 1PDZA 4M6UA 3N4FA 4FI4A 3IJLA 1NELA 4H19A 4KT2A 2OX4A 2PP3A 2OLAA 5FJPA 3FJ4A 3DFYA 3FCPA 3U4FA 3R10A 5ENLA 2PODA 2PTXA 3SN4A 1PDYA 3U9IA 4E6MA 3MY9A 3VFCA 2P88A 3PWGA 4ZCWA 3TJIA 3VC5A 2OZTA 3DEQA 3UJ2A 4MKSA 6ENLA 3V5CA 2QGYA 2OZ3A 3KUMA 1WUFA 4GGHA 2DW7A 2HNEA 3RCYA 3DERA 4F4RA 3THUA 2P8CA 3CYJA 3IJQA 3HPFA 3SSZA 2QDDA 1FHVA 3R0UA 3OZMA 1JDFA 3MKCA 2GSHA 4MMWA 3ZVIA 3QLDA 2HXUA 3EEZA 2PTWA 3OTRA 4DXKA 4Z17A 3T8QA 2PMQA 3T4WA 4HYRA 2XH7A 3IK4A 3ES7A 1DTNA 1L8PA 2PCEA 4DWDA 2OQHA 4A35A 3TOYA 3DDMA 3IJIA 3MUCA
chains in the Genus database with same CATH superfamily
3CH0A 2Z2BA 3U6WA 2PI6A 3PJXA 1E3ZA 3CV2A 4MVAA 3NEHA 3CQHA 4HB7A 4WRHA 3LYEA 1XDMA 1RA5A 3MO7A 2DJLA 6CGTA 4LW7A 4IICA 1OFOA 3W07A 4PBEA 4AIBA 5KZMA 4H7CA 5FJOA 5AN7A 3M0MA 4A2RA 3L2IA 2XPKA 5EMKA 2FJKA 3U8GA 1GV4A 3KBMA 3HMCA 1Q1RA 2DSVA 4WX2A 1PCWA 3TQ0A 2GK1B 4FZIA 1TX0A 4ZA0A 1DWJM 3EX4A 4ZL1A 2OG9A 3OZYA 2W54A 1XH2A 4O50A 1BYBA 4LYPA 3A4JA 3P3BA 1EDTA 1O4UA 1Z44A 1BTMA 5T91A 1KR0A 3GDBA 4AD4A 1T5AA 2QJHA 3H53A 2C3CA 1QPRA 3LQGA 5FL0A 1B3WA 2YDQA 1MUCA 1G5AA 3DGRA 4PC8A 3L5LA 4QCFA 2YVJA 3PB0A 8TIMA 4FEZA 5F2GA 3LHTA 3GFXA 2VEFA 2DJXA 1UPPA 4H9MA 5FL1A 4R9XA 2JF7A 2WM0A 5KZDA 3HG3A 4I9TA 2VEGA 4FR1A 4B92A 3EX6A 3BAJA 1KFBA 1NAL1 3AXIA 1X2GA 4PTWA 2Z6IA 2EG8A 3SY1A 1ZK7A 1T3QC 2UY2A 1H0IA 3MU7A 3EWCA 4OBTA 4FLOA 3NQVA 1KWGA 5EYWA 1RQBA 4RXGA 2GQWA 3EWZA 2QF8A 3IWPA 1LLOA 1WZAA 4XUGA 2OLSA 1R9ZA 3S5YA 1O1HA 1LOQA 1PX8A 3ENLA 1E6PA 4FNUA 3GH4A 4R85A 1YIXA 4O53A 3NG3A 4GE8A 2H8ZA 2VT0A 4TX6A 4UQBA 4MJZA 1CYGA 1S5WA 3RXZA 3OBKA 1A50A 5FESA 1KTCA 3TWBA 1VENA 1WYGA 4H41A 5A69A 3S2CA 1GEUA 5A1AA 5XIAA 3II4A 3Q4DA 2IKJA 4GYPC 2HISA 2P5NA 2WJDA 4W84A 6REQA 3SGUA 4HNTA 2J24A 4IIEA 3N2MA 2DY3A 3QPYA 5EY5A 1W37A 2WSYA 5IFPA 4Q8UA 2YPIA 3ZLFA 3EKLA 1XLIA 4PH6A 2A3AA 4HNVA 3W74A 3PANA 4GMEA 1VPXA 1ODUA 2WPEA 1RVKA 3PWAA 4M6VA 2E67A 5B7YA 3K8LA 4KWSA 3FXYA 2NLYA 2FZ8A 2HJPA 4FK9A 3HW2A 3BJSA 2VR4A 4PCPA 1EQCA 3CNYA 4PUDA 3S5ZA 3WK3A 4WJ8A 3ARXA 1NOWA 5LSMA 3FKRA 3NCOA 1HKIA 1M7JA 3GR4A 4LX4A 3TTQA 5CBBA 1HZYA 1XYAA 4UMCA 1F5ZA 1EF3A 3SDOA 4R3UA 3KVMA 1S5MA 3M0IA 5FIPA 3TK7A 4FB7A 1W9PA 2IXUA 1BYDA 3CH9A 5CZJA 2J3NA 4GUGA 2B7NA 3PTKA 5EL1A 4AY7A 3LI0A 1QI2A 1ONFA 4DJFD 3B0XA 2ZXDA 1W3NA 4XO6A 4S3KA 1KKOA 4FA3A 1I60A 4DJDD 1VBRA 2G95A 4K8HA 4IM4A 4MADA 1FOBA 2ZRWA 1RCOB 5CG0A 2A7NA 4TV5A 3CUJA 1GEQA 4JIIX 4C6KA 1XPYA 2BVDA 8XIAA 3TJXA 1E9YB 2ABBA 5JRBA 3GH7A 2V6AA 2NPXA 1GZJA 2A3HA 1IT8A 4AWSA 1CXLA 4ZMGA 4QJ1A 3DHUA 4IFRA 5D9OA 2G5WA 5DXYA 3EWXA 4O0ZA 4O12A 2X2GA 4D72A 1B0IA 5HWNA 4JY8A 2V2HA 4NL1A 4J28A 3VOFA 1VJSA 4AUBA 1TV4A 4HBKA 1I8JA 1WDRA 3SZ8A 1XKYA 3B9JB 4LNCA 1WXYA 5IFTA 3TZNA 1OD0A 4MB3A 4QQUA 3QFEA 1U22A 3AZRA 1WKEA 4XIAA 2PPGA 3C2RA 2GR2A 5HOSA 1IE7C 3GG7A 3ARQA 4F9DA 3AYVA 3CS2A 5K9XA 4PMOA 3CHFA 4IMCA 3IS4A 4RZ4A 1W8SA 2FZNA 3VIMA 1FBAA 3M0ZA 3ZOAA 1W1A1 1NY1A 2F6XA 3FCPA 5LNUA 3UXIA 2AQVA 3HA1A 3GIQA 5A3HA 2XIIA 4GQGA 4MZYA 5BRBA 2GRTA 5GNZA 3AIUA 3QY7A 2Y8VA 4DF2A 4GY1A 4MFEA 1BF6A 2VVNA 4W93A 4NT0A 3CMGA 2CEQA 5I00A 2OGYA 2OZ3A 1H61A 3THQA 2DZAA 4ADUA 1IEWA 2XZ7A 5EFFA 4UIOA 3VDAA 4PMZA 3W7CA 3K46A 5C0QA 3GC5A 5E6YA 2DP3A 3PG9A 2VDGA 3G6LA 5I3DA 5SWUA 3R8GA 4D6JA 2Y7GA 4AZ6A 2BDQA 2WJZA 3UD6A 3MBFA 3W71A 1JZ7A 4C7FA 3VAVA 1FHVA 3N9KA 3WNOA 2NLIA 4J40A 3DZ1A 2OEJA 3ZVIA 4MB4A 1BVWA 2PTWA 3QR1A 4GUFA 2QYGA 5I3JA 3ICJA 3C3UA 5LXXA 2CNCA 1RJRA 4H00A 2G50A 2XH7A 4H9VA 3FSTA 3VO0A 1A5OC 1V0LA 1V3JA 5HNUA 3NSNA 3NM3A 3E38A 3IJ7A 1PIGA 3S5SA 5C70A 1XIIA 1SYTA 3QEZA 1GXFA 1FUYA 1O95A 3W2KA 1J0JA 1D3CA 1EJVC 2XM2A 4C91A 1G6CA 1E55A 2OR2A 3MSGA 3O0FA 1W8GA 3B8SA 3MWCA 3WLKX 1MW3A 1PWMA 4ZO8A 1TPWA 4HCLA 1E4LA 3TN4A 3W6YA 3WQ5A 4EM3A 4L5ZA 3NVYB 3ME3A 2XJ7A 1CZ1A 1S2TA 4HPGA 3LBMA 2DZSA 1AW5A 3ETRB 3LDVA 1OX4A 1A5MC 2XVKA 2OO0A 4L7ZA 4HK5A 3A3WA 1VP5A 3UETA 2W67A 1XLAA 4NZ3A 2A85A 1YDNA 3APGA 4AZCA 1S3TC 2Z29A 5D03A 4LVAA 3CIWA 1LWJA 3FYYA 3W37A 4LJ3A 2VX6A 1K1DA 1K8YA 5D9NA 1DXLA 1XHGA 1YXDA 4RCXA 3DENA 2ZKMX 2ZWYA 3WG6A 2FMOA 2VC7A 4LAUA 2POTA 4GNVA 3BJTA 1DHKA 2GL5A 2Y61A 4J4KA 1JNDA 2YYTA 1BWCA 2EGZA 1ZXIC 1SO5A 4N9DA 1G0CA 3O8AA 1J2BA 5F4XA 2BB0A 4GBDA 1UD6A 5GVJA 4MIMA 3K4WA 1P0EA 3ZIZA 1PWLA 3GNRA 3QOMA 4EQXA 3MHGA 2X30A 2XVPA 1PTDA 4CQ9A 3M0XA 4INFA 4X2PA 4C6BA 2ZZ0A 3HN3A 1QVBA 3RUBL 1T41A 1GYNA 1I75A 4MUPA 3EOSA 5CC7A 3EDFA 3MW7A 1YE4A 1XG4A 4TX8A 1BD0A 3W1AA 5HNRA 1B4EA 3QF0A 3BAWA 1GOIA 3VINA 5JCLA 4WSJA 5DRIA 1VCVA 1JPKA 2JGYA 4CU7A 2WVVA 4ZR8A 1OFBA 1XLCA 4H4QA 4Q7BA 2XN0A 4E8GA 3QMRA 2X50A 1XIBA 3CHDA 3BW3A 2WSRA 2FPVA 1V08A 4NUWA 1W1YA 4ZOAA 1UQZA 4CGTA 3SB0A 3VKAA 3KLLA 4GI8A 1UZDA 1W56A 4O8RA 3AICA 4V1XA 1Q8AA 4NSBA 3QV9A 2IMRA 2Q02A 4DQWA 3HB9A 3OBAA 3CO8A 4NYUA 1LOSA 3W82A 2NQ9A 1N5WC 3R07C 3WH7A 4C1NB 4N6EA 4Q4PA 3AI0A 3ITOA 2V6OA 1UD8A 4NXSA 3W1NA 2GUBA 3VX1A 1IEQA 5F1UA 2ZVIA 3E2QA 4QEHA 2GJNA 2J7BA 1TG7A 2EQ7A 5F2IA 1QFEA 3OJGA 1K4HA 3W1MA 5CZKA 1RY0A 4WCJA 1GT8A 4F0LA 1AJ2A 1RHCA 1M03A 2PBOA 3B4YA 1EBDA 4QP0A 3FG2P 2G3IA 3T55A 5KTLA 3T0AA 2BG5A 5I07A 4MJMA 3F4CA 4ILSA 2YZRA 1RQEA 1EH9A 4Q4QA 4C6OA 3AWOA 4C6IA 1R3RA 2VENA 1ZQ5A 3DAQA 4G8TA 3E6EA 1VYPX 4H4IA 2IKHA 3MP3A 3NOEA 2V63A 1HNYA 1YX1A 2O4QA 4WVXA 2B0MA 1DORA 4UTUA 1NFPA 2PLMA 1EP1A 5M3WA 1ESWA 3EKGA 4IP7A 3O3RA 4IFOA 4J3SA 3IV8A 3GTXA 3H2AA 3V16A 3RO8A 4WY0F 3E2SA 1W3TA 4JX5A 4WLCA 4IFKA 2XN1A 1O68A 4KWUA 3TP4A 3R1ZA 4E38A 1LQ0A 3RITA 1Z32X 4O19A 3UVIA 2XSAA 1ONRA 5H8PA 2IPJA 4Y9PA 4XQ6A 1PZ1A 5G2WA 4CU8A 2XWDA 5L6UA 1FP8A 1OG0A 9CGTA 5GJNA 3VGEA 3A6OA 4JIHA 1UH4A 2Z24A 3VPLA 3IIOA 1A53A 1Y5VA 2NV2A 5H8UA 3SCQA 3TQKA 1FVPA 3ZT5A 2WP5A 1BVZA 1HKWA 1RD5A 1AL7A 1FHDA 4LOCA 4BF9A 2NT1A 1DPMA 5EGRA 1NP2A 1DWAM 2UY3A 1ADDA 3NQBA 3BLKA 3MP5A 4IXXA 1XIEA 3KBJA 3UY7A 5FS6A 2C16A 4LYKA 6ENLA 2WM1A 1NIUA 3R6IA 3KAOA 7TAAA 4DJFA 2GOUA 4GBUA 2ZXAA 3E49A 1AH0A 3SCNA 2VQTA 1OGGA 1U30A 4GGHA 1JXJA 6PTDA 2DUZA 1W5OA 5HUOA 3BGJA 4C6LA 4OWGA 3CL6A 4DJDA 1PVNA 3HV8A 1JEZA 1G7UA 4LV9A 3K8MA 4CEXC 1GCYA 5GNXA 4K3ZA 5I3IA 4HQVA 3EDJA 3EWUA 1T8QA 1M68A 5D2VA 1V5XA 3F2DA 3AIWA 4DXKA 3GB6A 2QPSA 1W9XA 4QLKA 2R1KA 4Z17A 3DK8A 3AMLA 4UR8A 1HL9A 4E2OA 4PODA 3FKKA 1WKDA 2DT0A 4NZ1A 2PDGA 2DVTA 3G18A 4H2CA 2HK0A 3EF6A 2Z2UA 4TOQA 4IOTA 1E0XA 3BW4A 1RCXB 3T42A 2VJXA 2E5CA 1OT1A 2Q3RA 4UXDA 1ADSA 3EDDA 2ZRVA 3UJRA 2QHAA 3ZT6A 1O1ZA 4AMCA 5D37A 3SCUA 3GAYA 2GFTA 4DBWA 1E1CA 3OLDA 5MF5A 1Z3NA 1C8VA 4AF0B 2NVCA 1PIFA 1TV8A 1NARA 4AIUA 2JALA 4A8RA 1F4AA 4YNGA 4HN8A 4O8AA 3B9AA 2BS9A 4U5KA 1IZJA 2I17A 1E4NA 1R87A 4KFOA 3R94A 1E70M 3G1HA 2WBKA 1S2AA 3BURA 2VDHA 4UBPC 3FJ6A 2QV5A 1EXBA 4GHRA 2QCGA 2GSJA 3AIEA 1SZRA 2PTDA 4HHLA 4F8XA 4NJHA 3CGBA 1TYTA 1IZCA 3O0HA 2V38A 2PU1A 1JPDX 3P60A 2FFCA 4DXXA 4TTUA 3ZSTA 2OCZA 2BXYA 3NDOA 3THDA 3W7DA 1VBUA 4FOKA 1J5SA 4NNAA 4QHRA 3FDKA 1YKWA 4JFSA 2EJ1A 4Z2IA 3H26A 2PDYA 2XH2A 2NQJA 4YXGA 3LZ5A 1U1UA 4Z1AA 3B40A 2WNWA 4C7GA 2CWNA 3NQMA 3PS7A 4JL2A 2VRKA 3B0VC 3NL6A 2XFRA 4EKJA 3GDTA 4EVZA 1ZAJA 4JY9A 3W7LA 1MFVA 1QHPA 3MUIA 2WNZA 1PX3A 3D47A 4NU7A 4NRSA 3XINA 3RPDA 2Y8UA 2VX5A 1OT2A 4ERIA 2C14A 2D0FA 1F3WA 2VTFA 4JIRA 1M41A 4JDYA 4CEUC 4XD5A 3WEMA 1JFXA 3S8HA 3VIFA 1E51A 3KOYA 3I4KA 1Q65A 1MOKA 3KLJA 4EM4A 4GQQA 4PMRA 3PM6A 3VUPA 4AYSA 5H2ZA 4CD8A 4PL2A 2O9TA 2CFYA 2C13A 1LRNA 3E74A 2RAGA 1X1ZA 5BRQA 1IZKA 1CTNA 4JNYA 1GETA 3GZAA 2XGZA 3RLGA 3N4EA 1UP0A 5C7VA 3S47A 1MXGA 1OYBA 3RN6A 3TTEA 4L64A 2ZUWA 1GESA 5AHEA 3AYTA 1WDPA 5HATA 3IVSA 3BDKA 1XIDA 3TYBA 4Z1YA 4EPBC 3EGJA 2ZZ7A 3AJXA 3LGDA 5A8MA 3QTPA 1UBSA 3WH9A 4BCEA 5FA5A 4B16A 2DSUA 1US2A 2WLZA 2FH8A 3W2NA 4PBFA 3LEPA 4O28A 2RUSA 2V82A 3VKDA 3E0FA 1GQIA 4CUCA 2BX7A 1XBYA 4PRTA 1OC6A 5I23A 3BSGA 1C92A 3TC7A 1QNQA 3KCLA 3GVRA 3IUDA 4RDWA 3RF9A 3GW0A 1S3HA 3VIIA 2D2GA 1PKNA 5C9RA 4B5SA 2W92A 4CD6A 4N7QA 4DF1A 3M1ZA 3QKZA 1DJGA 1JCYA 3ZFHA 2WCGA 2Y5SA 2W63A 1OZQA 1QUMA 1XYLA 3AIQA 2HPMA 1ME8A 4K2SA 3FIGA 5D09A 1TQJA 2X1RA 1I6NA 1F3XA 3BL3A 3N2OA 3W6LA 2AL2A 1KWKA 1VPYA 4MDOA 4UC5A 2FPYA 3O16A 1JR1A 1AODA 4QRNA 3SR6B 2C1GA 5BROA 1AD4A 1EJTC 3GG0A 2PWDA 2CXEA 3CPUA 3VNYA 4OVXA 3DC0A 1MXSA 2TAAA 4PTXA 3IGXA 3WF0A 2GJRA 4ZXLA 3KHDA 1P6CA 4AD2A 4GX9A 4J27A 3CT7A 2IKIA 5ABGA 3MZ2A 4UFHA 1R3VA 1XSKA 1E6SM 2OTDA 6ALDA 3IARA 4CQAA 4K1WA 4PMUA 3RRAA 5A2CA 2ZE0A 5IHSA 3W1LA 3BARA 1OYAA 2Y5JA 3SCPA 3HGJA 2QGHA 2XH4A 1GOWA 3JZUA 3TAOA 4MSSA 3R5EA 1O5KA 1GG0A 3GD4A 4OUIA 3KBNA 4JQ1A 3AFBA 4GISA 1FWJC 1T96A 4ONVA 2NWRA 1O94A 1YBQB 1FCBA 3VILA 3QW4B 2XDFA 1NHRA 2H9AA 4PB3A 2WWDA 3I4EA 2EAWA 2OEMA 3IJLA 5BWFA 4I5RA 3R4IA 4Y7EA 1BAGA 4HMCA 4AD1A 4C5ZA 1GJWA 3E96A 1UROA 4Y2WA 2E5DA 3L5AA 8A3HA 3QLLA 2DZPA 2YA0A 3TFCA 3VE9A 4IH3A 4OIFA 5HQMA 1KQZA 2ZZ6A 1GSNA 1R7AA 4ZCWA 1VQZA 4OOZA 1GEHA 1XANA 4NZFA 1XIFA 5I24A 1NHSA 4NZCA 3UPMA 3OG2A 5JCNA 2E3ZA 2WNNA 4LEQA 6XIAA 2CLIA 5G1TA 2EO7A 4D8LA 1K9DA 2YBVA 4P8XA 5JH1A 1Z89A 3PZ9A 3HIJA 4PRRA 4YTTA 2XVGA 1J8VA 3WQ4A 4QGCA 4FOJA 1VJIA 3T0BA 5CGQA 3GBEA 5DEZA 3AMCA 4AW7A 3N19B 1FKXA 1LT8A 4AB4A 1VLIA 3BOFA 4KWVA 3VOJA 1WV2A 4JHZA 4GZ7A 1Q5MA 4QISA 1S5VA 1N82A 4EWND 1F8IA 3OIHA 4HYRA 3EOLA 4XVDA 3QGVA 3AXXA 5HJLA 4P7NA 3UESA 1SVDA 3DDMA 4A3QA 3QGAC 2QAFA 3TN3A 5TQLA 4WSHA 2YVGA 3LM3A 2J78A 1A5NC 4Y9MA 3M0LA 1NWTA 3GTNA 3AS3A 1AFSA 3VKBA 3C0QA 4DZIA 1MQRA 2VR2A 2NWSA 3EEGA 1J0IA 4AYGA 2J7CA 2X09A 3UFYA 4H8HA 2YSWA 4JN7A 2WPGA 4P7OA 1ZMCA 2X8RA 1VYSX 3L9CA 1TELA 4C90A 3KP1A 2VEMA 4JTTA 1H1NA 3V1PA 1C29A 1KM5A 1N8FA 3ARRA 4HCHA 1LUCB 3W2LA 1VZWA 5BZAA 2YA1A 4L6OA 1Q2SA 3T4CA 2FDMA 3WY1A 3LCIA 5A94A 5CKSA 3U57A 1HX0A 2BHUA 5HUPA 1GYMA 3W81A 4ACZB 3PP7A 4HYVA 3TNOA 1HVQA 5KINA 2D73A 4QDPA 4JHMA 1SFJA 2OWXA 2PDKA 3SUTA 4J7RA 4A6GA 3ERPA 1I45A 3UWZA 1FFVC 3DGHA 4CQDA 1NWSA 3ATZA 2CFFA 4F0HA 1QBAA 1RPKA 2IUZA 3L0NA 1AK5A 3LNMA 4P8VA 4L56A 1FHUA 3CTLA 1GQKA 1XQLA 3WLSA 4YL2A 3VNIA 5FD0A 1GVYA 2MNRA 2WYSA 1B54A 2YL9A 3GIYA 4C6MA 3TONA 1F05A 3C52A 4S23A 3WJZA 1SR9A 2GOKA 4IMDA 1DE5A 2HVNA 4Q8NA 3S5NA 4W7WA 1NQKA 1QHOA 4F0RA 3CM4A 3ITTA 1SSDA 3F2BA 4KRUA 3BV7A 1TQXA 3QFBA 1HKVA 5TNVA 3KBWA 3CMFA 1LRTA 4X0VA 3KL5A 4OECA 2VR5A 2Q6ZA 3LXBA 4NJKA 1NDVA 3RGTA 1VRDA 3M0VA 4WJEA 2FH6A 3IV3A 3CAWA 4GA8A 5HMDA 5FF0A 1CT5A 4AWTA 4JTKA 3BVJA 1ALDA 2BY0A 2R91A 5LNWA 3PAOA 4YTUA 3GQYA 4M0XA 3N13A 3G8EA 2YB4A 4MJ4A 4H4VA 3S2JA 3EUB3 4UUIA 4KEMA 3WELA 3MUZ1 4QROA 4GD0A 2V5JA 3PN8A 3PFMA 1WUEA 2HPIA 4ICNA 1P0BA 2NUWA 3N3MA 3SY8A 1AG1O 1H0GA 3YPIA 1W5QA 3ITXA 1Y5WA 4BEUA 1VHNA 1QASA 4RR4A 2ZUTA 1WDWA 3HPXA 3N9SA 1OFQA 4POCA 1K4QA 3CGCA 3W1PA 1MDRA 4ORIA 3M43A 4JD4A 1M5WA 4HNNA 3DBNA 4PZVA 2QQ6A 3DK9A 4TV6A 1OHLA 2BZNA 4WKFA 2EPNA 3G1AA 4QNWA 3LV5A 4NAFA 4OT7A 3NXFA 1JCLA 4R34A 1FWCC 5E1QA 1GHSA 3S6DA 1UR0A 2OXNA 3NZPA 4ZQCA 1F9CA 1KV5A 4JN8A 3NJ3A 3VCRA 1EJSC 3W7RA 1QO5A 3WK0A 2CLKA 1B3VA 4IJRA 1ZLPA 1O66A 1GK8A 4E2DA 2HBVA 5FJUA 3CEPA 1T7LA 3I3BA 3UW6A 3N34A 2G4JA 1PHWA 3U2ZA 3W7QA 1JI2A 1VD6A 3LB0A 4LT9A 1OJXA 3CV6A 3ZYZA 1TZZA 1BWLA 3HQNA 2W3ZA 4GGBA 4N4PA 1B1YA 1IIGA 2XGIA 2YR1A 4LALA 2PDBA 2OKOA 3ARYA 4XIMA 2YIHA 3RMEA 1CXEA 5EBKA 1FWHC 1WKYA 1S1PA 3CAVA 1AL8A 4IHCA 1ZJAA 1ONXA 4V28A 4HU0A 4LVFA 3G1YA 1Q1WA 4HKPA 2PAJA 1AD1A 2JIWA 3TMQA 1W5PA 2PB1A 1W1TA 4J9JA 2PGEA 1LL7A 4LV4A 1SZFA 1P0NA 2NZLA 5MKGB 5AHLA 1LQAA 4EANA 3BLLA 4Q4OA 2VOMA 4ZO6A 5KVHA 1RCQA 2C0AA 3WLRA 1JF6A 1XRSA 1JD9A 4O4WA 4TVDA 5F2LA 4G7FA 1A47A 4FPSA 1HJQA 1PUDA 3EMCA 1JDAA 2ABAA 3BLEA 3W2UA 5H6HA 2UBPC 5KZ6A 3FS2A 3AUOA 4OHQA 4CKQA 4UOZA 2BC0A 3WO8A 3CMJA 4CNUA 3TYDA 2ZZ5A 5C2GA 2PZ0A 2CLHA 3RMJA 5AHIA 3O6AA 3UY8A 2VFDA 2A0NA 2IQ0A 4IIGA 2H3DA 1C90A 1S5NA 2ACSA 3PZNA 4H4SA 4CU6A 3WL1A 4MNMA 3QR3A 2FTPA 3WH8A 4B4HA 1LM1A 3ABXA 4LUTB 2BTMA 5AC4A 4HVXA 5F7UA 2WWCA 2YVFA 3LY0A 3UZXA 2QR6A 3RYSA 3F4DA 4LC6A 1K8ZA 3DYPA 2PWHA 1R3SA 1RK5A 2VFEA 4GFSA 1NPXA 5A6LA 3VIGA 2F7FA 3IJQA 4M51A 3EDKA 2H90A 1E1EA 3GLCA 5D4YA 1AQMA 4KFPA 4M7SA 4ZOCA 3VM7A 4OKDA 2BP1A 2I5GA 1K77A 5I06A 4PYSA 3H7RA 1TIWA 2GJPA 4AFYA 2X0YA 3RNDA 1TVLA 3T4WA 2G3FA 3ES7A 5BWAA 3CYVA 2AOSA 3KE0A 3L0GA 4Z2LA 1GPWA 4LS2A 4I7WA 4TVUA 4A35A 3MVIA 1N2VA 1X38A 4WY0B 1XIGA 3WFAA 1UCWA 4HOZA 1X7IA 1G4EA 1H62A 4IQEA 3GC4A 2D0GA 4QSHA 3KFTA 1OVDA 2QCLA 3B9NA 4JN6A 1S5TA 3GU9A 4HTYA 2D3NA 3IUHA 4W85A 3N2TA 4AVNA 1NDAA 1ZBCA 4IQDA 1XLFA 1RK6A 4HNOA 4GG9A 1E43A 4PMDA 2G0WA 2AL1A 1K8XA 1OF8A 4OJYA 1H7WA 3LV6A 2QKFA 1EPVA 4C7DA 4PCSA 2ZX5A 3WBEA 4DYKA 3RILA 4JNMA 4K7ZA 4JTJA 4NY2A 3DJGX 1A0EA 3BE7A 1BEUA 4BA0A 1N62C 3EOUA 4KKXA 5FF4A 2A3EA 2P0OA 3ABQA 4C6CA 3T7VA 5I3KA 4Z1DA 4U5IA 4QITA 1OG6A 3KBVA 1F6PA 3K1GA 1JCXA 1D7FA 1ELSA 1YRRA 3EX2A 4D6EA 3KXQA 5H8MA 3GXFA 2X16A 3A13A 4A05A 1CGTA 3SR7A 3NSXA 2PC8A 3KZSA 1OFRA 1UWSA 3CHEA 2QVHA 3W70A 3TAKA 2O9OA 3POCA 3HM7A 3G1VA 4YVVA 1EGMA 2VRQA 3KEHA 1DWGM 4FF7A 4UTJA 1VEPA 3UERA 2CLFA 3VKCA 2VNCA 3BO9A 4LS1A 1J6PA 3F7JA 4M80A 3RX3A 1JYWA 3ZVHB 1GRFA 4HOWA 3HPZA 2ATSA 3TSDA 1N7KA 1EDGA 2P3EA 1VKFA 4B3LA 4F48A 1CWYA 1WDSA 4HTBA 4ZQNA 2E9MA 1REQB 1K03A 5I0DA 3HV9A 1SUXA 1NOUA 4KESA 4H9YA 2X40A 2PSNA 2C0HA 5M17A 3G3DA 1EBHA 2CHOA 4X9YA 4BI6A 2VQUA 1X1OA 4V33A 3G1RA 4CNNA 1F61A 4KGJA 1XR2A 3WF2A 1QO2A 4UNLA 4D6IA 2FVMA 5J04A 2VC6A 1TPB1 1QPQA 5T8GA 1AMYA 3TYAA 1E5JA 3OHIA 4HPXA 4TUFA 1S2WA 4DJED 5DO8A 3EWBX 4JAWA 4U28A 3LXDA 5T9BG 2ZX6A 4O0KA 1Q4WA 1JIBA 2VZUA 4IIHA 1W1VA 4UMAA 2CPUA 4D9PA 1BFNA 2DIKA 1T99A 1WBHA 1OINA 1JPMA 1AH3A 1DVJA 3APYA 3PUGA 3LB8A 4MZ8A 1L9WA 1YW1A 3V18A 2Y0FA 4ZO9A 3WUGA 3L4UA 5I78A 4IGSA 4MWAB 3QYQA 2BHYA 1R5YA 4EPKA 2GGIA 1DXEA 3K4DA 2X1TA 1ZPTA 1XUZA 4IL2A 4DUWA 2DT1A 4GZEA 3COTA 4JCLA 1KRAC 5E09A 1K3UA 1E6ZA 4BQ2A 2W91A 5D38A 3KOWA 3WQGA 5HJYA 1JD7A 3G24A 3GD6A 1UUMA 3O1NA 3OPSA 7CGTA 3ZZ1A 5LGXA 3EWDA 3R0DA 3TKFA 3VM5A 1OB0A 3QY6A 3ANYA 2F2HA 4B9YA 3E2RA 3B8VA 3IVTA 3EX3A 4I7VA 4O18A 1PKLA 1WXZA 1I0DA 3PJUA 3DKLA 2GVYA 1J0YA 4QM1A 2WV8A 3EPMA 1RP8A 5HR7A 4AZ7A 1WOBA 3ZJ6A 2XM1A 3BZGA 4XG1A 3MA8A 5REQA 2ZOXA 2J25A 3NWRA 4G1KA 3A21A 1I1WA 2DH3A 1GWJA 1TA3B 5CXPA 3O0KA 1KCLA 3W1QA 3QQWA 4KQNA 4NX0A 3VTRA 4UZUA 4PUNA 1TSIA 3MDUA 1KRMA 3H2FA 3IRDA 4LCSA 4AXKA 4GINA 3KDOA 3VNKA 2AMXA 1KXHA 4DBEA 3P8JA 2E6YA 4HPHA 4FOUA 4H19A 3ZT7A 1ISZA 4KT2A 3ZSSA 3KRUA 3E5PA 1VAHA 3SQLA 1WAWA 2C71A 3W7EA 3LLFA 2ISVA 1DYSA 1SPQA 2H3BA 5AVHA 1ZJBA 3TJIA 3WLHA 3CZ8A 3GU1A 1QOXA 1ZUAX 1OK4A 3LXCA 3A9BA 1N63C 3NL3A 1O12A 3WJSA 4YLWA 3VGDA 2QUTA 3UP8A 2VM8A 2YL5A 2ADAA 4B5TA 4G7EA 2BCPA 4GJJA 4C1NA 5TAOA 3N11A 4XBSA 4DVOA 4QE1A 3NPXA 3LLDA 4ICCX 2WOQA 1G69A 3O05A 3B9OA 4NP7A 4N42A 1A4LA 3OZMA 1F8WA 3T2QA 1GOMA 3FOKA 3N6QA 3P8IA 3MMTA 1X8CA 1D9EA 5CAKA 3OVPA 2C79A 2Z00A 2Z1XA 1UWRA 2FZMA 2ZQ0A 3AXKA 4GKLA 3RFAA 4PFHA 4BF7A 3IJIA 2OT1A 1UWAA 3VA8A 3EWYA 3GXPA 1GQNA 3LS9A 1GORA 2ZXBA 4GVHA 4DM1A 3LPFA 5DN1A 1XJBA 3WLMA 2WJFA 3DK4A 3ABSA 1TJPA 3UR7A 1B3XA 3RJYA 1TKKA 2XIOA 3G5EA 3VNMA 2QT3A 3L66A 4YCOA 5JBEA 1DQWA 3P2VA 1CGVA 2PTYA 3B97A 4RDVA 3S2LA 4GUHA 4LBRA 4JQ9A 1VBJA 1JCTA 1V0NA 3PZQA 3PTDA 1NWUA 2VEPA 3P0WA 2YCLB 2OVLA 4CNTA 1MNZA 3BICA 5HJXA 3LHZA 2ANUA 5FJRA 1UBPC 2FZBA 1S39A 3GYCA 1M65A 3AJ7A 2DZVA 3SRDA 2NSOA 4JTGA 3B4UA 4NZ5A 2QJJA 3IACA 3IUIA 2WC4A 2XTKA 3C2VA 2F2KA 2OMAA 2WHJA 4XKYA 3FGCA 3G2GA 2QCNA 2X0HA 3LHWA 3BLDA 3CQIA 5C7HA 4GUJA 1MUMA 2J27A 5J5RA 1W31A 3UYCA 1SGJA 1CBGA 3RM8A 2ZZ2A 1G9HA 2ZA1A 1EJRC 2E1WA 3PZOA 3TFXA 4DPPA 5HPCA 1WZMA 1T8XA 3UNDA 1VFOA 4L65A 2B7PA 3M16A 1ISWA 1JROA 3HGRA 2J9YA 3CLMA 1MNSA 3CWOX 3W0KA 4GACA 4BV6A 3K8KA 1UR3M 4X60A 5C55A 4LB3A 1PL9A 3D3FA 4I3GA 1IXNA 3AYSA 3W2JA 2QEZA 4KWWA 4GJIA 2GJLA 3CWHA 3CZGA 1RP9A 3NQAA 1Y65A 1CLKA 3F4WA 2WQDA 2YJQA 4X22A 1AQFA 3LD5A 1ZP3A 2J8FA 2QPUA 3PY2A 1ZALA 3BW2A 3BG5A 1SJBA 2FVLA 4XSMA 1I2OA 3EAOA 1TJ1A 2PTZA 1OC7A 1FH8A 4LAZA 5TR3A 2HQAA 4PTVA 1XISA 1AOGA 2BY2A 3NQFA 1JCNA 1QPOA 1KQYA 2V0TA 2WVSA 7TIMA 2YZ5A 1CXHA 2EQ9A 3H7VA 1QBBA 1J2WA 1W5MA 2WCAA 3KRSA 4QX4A 4EMJA 4DZAA 3VFLA 3M44A 1OJTA 1KFJA 2IXVA 4S1FA 4I7UA 4DHGA 3NQ8A 4PUMA 3QQ1A 3BWWA 4LBUA 2VEKA 5CSYA 1RH9A 5FJJA 5C9ZA 1EC9A 2E09A 2CBVA 4PB4A 3WD4A 1A3XA 3N4AA 5CSSA 1J0KA 1K6WA 5D33A 1JRPA 3NNTA 4LRTA 2GYIA 2AAAA 3S1XA 4CVWA 2R24A 5HWMA 1B3YA 1QI5A 4MNJA 2DSKA 2O56A 2BGNE 2YCJA 3W86A 3PBYA 3AIVA 2X8CA 5XIMA 2OB3A 1BYCA 1F74A 1ZB5A 4XAZA 3HPAA 1WA3A 3GM8A 3P67A 4H8UA 2C8NA 3UCCA 3IJ9A 4Y9NA 3G6MA 3WQDA 2O7SA 3P74A 1EX1A 2REQB 2GR1A 4PRWA 4IX0A 1UUOA 1YE6A 4M8UA 5FSDC 4LPCA 1XHCA 2JIEA 1H1YA 1Q6GA 3QSTA 4Z1CA 3APTA 2E77A 3EA2A 2WAGA 4EQWA 3LTYA 2VWTA 2HRWA 1W54A 4XWUA 1WNOA 4GX8A 3TWAA 1UWIA 1OX6A 5C54A 3N3TA 1DTUA 3SEPA 2NV9A 4Z42C 5AHMA 3MSRA 5JCIA 1PPIA 3GUGA 1TJRA 1RQHA 1P0KA 1PX4A 1EYWA 3S5OA 3IJ8A 4BR1A 1AZ2A 4DJEA 1EF2A 2QULA 3OG3A 4LUJA 5AYYA 3ABZA 4I8YA 1EB3A 3T9PA 5E93A 2NXHA 4NF7A 4L4MA 3PZGA 4UR7A 4QBXA 4G5DA 2EPMX 2ZADA 1QW9A 3W02A 3VMPA 3PVFA 1TRIA 4IG2A 4ZQMA 4WQ6A 3LK6A 3REQB 3QC0A 3ZS4A 1SO4A 3LGGA 2WKGA 4W87A 4EIVA 4C6FA 4QAWA 3SCTA 3Q94A 3T78A 3N15A 3WDPP 4KPRA 3UU0A 3ALFA 2AGKA 4Y9AA 4M82A 4EPDC 1BSIA 1B3OA 2O92A 4H4UA 4HU3A 5DFAA 2E7FA 5CCZA 4ZZ9A 5CEWA 1EDQA 2VL4A 1V6YA 4XKMA 3EBVA 3C8NA 3PBWA 4ZODA 3F5KA 4QLJA 4KMQA 2V2CA 1L2QA 2HROA 1B4KA 2WZMA 2AAMA 2HNEA 5J5DA 4N9EA 2X1UA 1V8EA 3SIMA 3A64A 1HKJA 5CPQA 5DRCA 3GH5A 2Y7EA 1BGAA 1E0VA 1JDFA 5GNYA 4FDCB 2QS8A 3MHFA 3WQEA 4PFMA 1H7PA 5IBXC 3QW3A 3M07A 3FA5A 1TWSA 2YCEA 1RR2A 3CUZA 4MNLA 4MZ1A 4DUOA 1Y7VA 2WPFA 4KEVA 1XDIA 2E40A 5U25A 4JX4A 2HBXA 4XZ9A 3DBPA 3GDKA 3UWQA 4LB4A 4W5ZA 3A4XA 4BI5A 4HMEA 4S3EA 3L4XA 3BOLA 4PMVA 3ABRA 3G0XA 2ZX7A 2DU2A 2F9RA 4AEEA 4AIOA 4J3XA 2P8BA 2NSXA 3VGBA 1JPIA 1JYNA 1VC4A 3W23A 4J57A 3URQA 4DI9A 1MW2A 2BOGX 3CU2A 4E3TA 3A5FA 5I02A 2E9BA 1AJZA 1UR2A 3DXIA 1TZ7A 4A21A 4ZENA 3K4AA 3H4GA 2NQHA 2ACUA 3K30A 2Z1KA 2VX4A 4PSRA 2GJXA 3LTPA 4F0MA 3M4HA 3V5OA 2J7FA 4F2TA 4GZJA 2GDVA 2V3AA 5EMUA 1YBQA 4HNCA 3OLIA 1E0WA 3MANA 5BRPA 2IPGA 3M64A 1Q7MA 4QE4A 3GVQA 5EMMA 4KERA 8XIMA 4Z08A 2PDXA 1OCNA 1E4MM 4H6QA 1N61C 3V0UA 3CLWA 1UR8A 3R89A 2BGSA 4YHGA 4EMIA 3TTYA 1FWTA 3L0KA 2J62A 2O55A 3GKFA 4XTDA 3GHRA 3PK7A 4NX5A 4FX7A 4CQ8A 1KV8A 1E6QM 3H4KA 2A79A 3D0CA 1B9ZA 3QN3A 2X42A 3PBVA 4K8GA 3G1XA 2GPTA 2CZ5A 1Z42A 2WMGA 3SQSA 4M1RA 4U31A 2RJGA 5KSWA 2OPJA 5CPSA 4Q8TA 4IMEA 4H83A 3AHZA 2E9LA 2WHMA 2HV5A 3E9AA 2YDAA 1ZX9A 4IT1A 2KAUC 3FVDA 4DM2A 1SZNA 3W00A 4EXBA 4W89A 3CPGA 5LGZA 1IT0A 2FYMA 3UF9A 4GOAA 1KRBC 4GXPA 1XRTA 1QTWA 5A6MA 4KRZA 1H1ZA 2ZXQA 5EBUA 4YTSA 2ICSA 1QHZA 2V69A 3V75A 3OC4A 7XIMA 1Q6OA 3E0VA 3CGTA 2DT3A 4TMBA 1MXDA 5AC6A 3SADA 3MJMA 1G4SA 2OEKA 3IJDA 4H1ZA 5FF3A 5C2CA 1IXOA 2JEPA 4A3HA 3CEUA 1UA3A 3VOHA 1VFHA 1XGZA 4GK8A 1LWIA 1K8CA 5A6KA 4K39A 1R30A 4DO4A 1I2NA 1CGWA 1AZ1A 3N1AA 4APNA 1IR2A 3SJNA 4O13A 3QGKC 2Y89A 1W1IE 4B5WA 3VDGA 3G1FA 1LUCA 4J3TA 3MSYA 3WSUA 2BWGA 1M6JA 1SFTA 1TVPA 4TMCA 1VBGA 1MVYA 3PPCA 3HTWA 1LCOA 1KBLA 3W53A 4AX7A 3PFRA 4G6CA 3R25A 3GNDA 4R9OA 4AZ5A 4ZE4A 1UD4A 4BS0A 4X63A 1ZAHA 1HJVA 4LUYA 3DGZA 4Y90A 1JJKA 3V35A 1TPEA 5JVLA 2Y24A 3LUTA 1VLWA 5I03A 1PYMA 1NF7A 2JKPA 3ZMRA 2OSWA 1XDLA 1V79A 4WDXA 2VCCA 2V81A 2VC9A 2WNQA 3AALA 1LYXA 1TWWA 2FJUB 1DP0A 4DRSA 8CGTA 1V59A 4ZO7A 3SFWA 4B4FA 2AQOA 4UQDA 4K1GA 3W4RA 4OU1A 3M47A 3H55A 1HFBA 5LKYA 1ZJHA 1R6WA 2EG6A 2O7QA 2EBNA 4MAVA 4JDRA 3EOOA 4QDMA 3PUDA 4KCUA 2WZEA 3JUGA 2PA6A 3Q37A 2D69A 3HG2A 2IQTA 4UFJA 3WBXA 3QYSA 1UKTA 5DLCA 1PO9A 3VUSA 4DNHA 3VU2A 4CQBA 2XIQA 4HJFA 4KW2A 4IQJA 2UY5A 3AMDA 1OM0A 4L9YA 2PGWA 3GFYA 2WW5A 3M6YA 3UWYA 5CC6A 1ZMDA 1V97A 4GQRA 5EMLA 2R1LA 5GQBA 4K68A 4F40A 2NX9A 2VRJA 1V3HA 4LCQA 4MTVA 2OELA 4XSLA 1V51A 1VFLA 2CCRA 2AQWA 4ZTYA 1M7XA 2CLLA 1UZ1A 4FI4A 1D8CA 4XZBA 3VX0A 3WZ0E 4CN6A 1BF2A 2PP3A 4TU1A 2QCDA 3OGRA 4ZFMA 1LBFA 5FJPA 4BWLC 3I7RA 6TAAA 3AXMA 3TR2A 1VCGA 2PWEA 4M19A 1UHVA 3CIVA 3E0LA 4IWWA 3G8RA 3PWGA 2OZTA 3TNBA 5CC3A 1BGGA 4RDYA 1NFBA 2XUCA 5U4NA 1V4YA 4G9PA 3Q6JA 1H7XA 3FX4A 1W3HA 3NUKA 2FTYA 4GI9A 1WPCA 2XIBA 1VQTA 1WAUA 5G5GB 2P8CA 3H2CA 2QIWA 4PTNA 3R0UA 4GR1A 4P7LA 3WH5A 3MKCA 4IPJA 3WDJA 2OSXA 2DZTA 4OE7A 3WDRA 1XINA 1GVQA 1HJWA 2HVMA 2E5AA 2PMQA 3GX9A 2VKZG 1XGEA 3N2CA 1TPFA 1K4GA 1XGDA 1LF1A 3G0UA 3LSBA 3WFZA 3L4YA 1TVNA 3U5YA 4HZ6A 3NPWA 2CLOA 1XDJA 2NT0A 3I68A 3GRSA 3UG5A 7REQB 4L4PA 4FNTA 3SAZA 2OOGA 1OX4B 1HT6A 1F6YA 3W1XA 3GDRA 2J75A 3QOKA 3KOZA 2NQLA 2IPWA 3KM8A 2YW3A 4FSAA 1IHIA 5LNSA 5LA0A 1N8WA 4XVEA 1GRHA 4GUIA 1NQ6A 3VD9A 4AH7A 4RJEA 1ITUA 2G37A 1EGVA 3ZWSA 3GSMA 2NW0A 3OVGA 4H6KA 4UNKA 3BC9A 5BYWA 1GYLA 3MVTA 3CB3A 5F2MA 3TDFA 1AA1B 2YA2A 1YPFA 1S2UA 3W24A 5AZ0A 2Y5EA 3EMZA 5MKGA 5EA9A 3CUXA 4GIRA 4XZHA 2YKKA 1UKQA 5C9XA 4GYPA 4WR3A 4ALDA 2EQ8A 3PZMA 4F79A 3KZPA 4EACA 4JFWA 3TC3A 4LYQA 2XGBA 3MI3A 3IAPA 2EJAA 4C5YA 1H50A 2NUYA 4WXZA 3VKKA 1KA9F 2J88A 5DMMA 4UTIA 4A8LA 1GVOA 1W1ZA 2GDQA 4HK6A 3IRSA 3KBSA 5LNRA 3SUUA 2G4FA 3RDKA 4IJBA 3WLLA 2QLYA 3C5QA 2RDUA 4HPNA 2Y88A 2ON3A 4ZB0A 1OFDA 1TO3A 1MEWA 3PPHA 4EPEC 2WXDM 1A80A 1KLZA 4M52A 1F3TA 4JQ4A 1CEOA 2WVVB 3UVAA 1SO3A 2ZTKA 4F9JA 1NEYA 3JVAA 5ECVA 4XV0A 1S46A 2HK1A 4PUEA 3EWWA 3B05A 5FS8A 1H4PA 2P10A 3GG8A 3TA6A 1GGOA 5CPOA 5AYIA 1ISXA 2VZTA 3ZJ8A 1TTPA 1XC4A 4ICMA 1EWDA 3LXAA 4GXWA 1DIKA 3C0JA 1DL3A 2CYGA 1YDOA 4OTKA 2QAEA 3WBYA 2J74A 1VB9A 2EHHA 4KPLA 4JTHA 1WYIA 2XVNA 3HJEA 1QU4A 4WY0A 3SQMA 2OYMA 4QJ4B 2HNHA 1Q85A 4J3VA 1LQ2A 3MTWA 4AC7C 2VUYA 2Q3OA 4XAPA 3A4AA 5DT7A 3FHQA 1KKRA 4G1NA 1QOQA 2E5BA 3C56A 1YXCA 3C2OA 4IMFA 2PP1A 4DI8A 1ICQA 1P1MA 3GNPA 4JZ5A 5HXMA 2GSEA 3TN6A 2W3SA 2CZDA 4YMZA 1WCGA 3A7RA 3T2OA 4FXRA 1V6XA 2BGQA 2V5DA 4EOUA 2WLYA 4UTLA 5G1YA 3PBGA 4R7OA 4CLMA 5A8NA 1V3IA 4HYWA 3PSWA 1UR9A 4FR6A 3WD1A 4HSOA 5JUVA 3WQPA 3W7GA 2I14A 5I3FA 3EA3A 2VEIA 1JDEA 4RLIA 1MRQA 1HL2A 5MHBA 5FEPA 4MKVA 1XYZA 4WSKA 4C1LA 1HO1A 2ZZ1A 2E6AA 1KFCA 2QDGA 4Q22A 4DWSC 4IIBA 4FXJA 3M7SA 1H2JA 1ZDLA 1U5VA 2I56A 2HQMA 3GVVA 5C9UA 4RPQA 2W3RA 3W7OA 2WO5A 1PBGA 3J7HA 3VZXA 1H7OA 2XWEA 3TVAA 1HIZA 5CQ1A 2QV4A 2Y8KA 4L80A 3GNNA 3LCHA 4IFKB 5IXEA 2JEQA 1V93A 4XISA 3QVQA 2TPSA 4XAYA 4KFNA 2MANA 1XLBA 4WGHA 3TW9A 2C18A 1VDVA 3ZVHA 3SGZA 1WXJA 3B04A 5A8GA 3U3HA 3M5YA 1YDYA 1ISVA 1UASA 1XQKA 3BLPX 1EIBA 5FSEC 2E25A 3WUEA 5E9XA 4YCPA 5TF0A 1JULA 1HXJA 1ZL1A 2CWXA 3OU8A 1SZEA 3VZYA 2DVXA 2VMFA 3LHUA 1E9ZB 4KIEA 1REQA 1E6RA 1M53A 3UCQA 1J01A 4WOQA 2YLAA 3H70A 4HZ8A 3QHOA 3S4TA 1XSJA 3MUY1 4I9JA 3RRXA 3KVJA 2NV1A 1PTGA 1J0HA 2GGGA 2YFOA 1LPFA 4JQ2A 1A5AA 5DCEA 2WSPA 1PXGA 1E5NA 1E4IA 2PF8A 3BH4A 4L6HA 2W61A 5AFDA 3FA3A 3THAA 3O9NA 4GYKA 4DAIA 4EX4A 1YTKA 1EO7A 1GRAA 4ATLA 2QPXA 3PJWA 1Z6KA 2Y7FA 4LWWA 2VOTA 3L5MA 4JQ3A 4MWAC 2WZIA 5CPMA 5DQPA 1MI3A 3HOJA 1ZY9A 1SFLA 4YS1A 4WOZA 4O52A 3MY9A 2BLEA 4L61A 1R2SA 3R12A 3URHA 4MKSA 1GRBA 3T08A 4DO7A 1B57A 2PDIA 3V5CA 3RCNA 1MEIA 1HN1A 1Y5XA 2WC3A 5FF7A 1BXBA 5BNKA 3GAKA 3UEQA 3RCYA 1UZ4A 1SQ7A 1XUUA 1KBBA 2GQ8A 1J4EA 2XINA 2C19A 3SFKA 5E0KA 1QJWA 2W62A 4IIFA 3GXTA 4D8AA 4RW3A 2J7EA 4UFKA 5HMFA 1RPXA 1XRVA 1QR7A 1QWKA 1LROA 4AZBA 1GVSA 1KXVA 3QSRA 3PR2A 1E1CB 3T8QA 1JEHA 4FLSA 4Q4MA 4XZMX 3NQ6A 1GTEA 3F5JA 4RNJA 1HW6A 1Q6DA 1S1RA 3MUCA 4UTWC 3GHUA 1SJCA 5JQ9A 4D6GA 2Q71A 2OFJA 1L6SA 1J6OA 3EDEA 3HZ3A 1K7EA 1OADA 3URNA 2E68A 3C2YA 4P5UA 2FGZA 5LIWX 4D2JA 1ME7A 2OYKA 2GGEA 4K38A 3RJXA 4HOXA 3BAXA 3NFUA 3TYEA 3CQJA 5LIKX 4BJHA 5LA2A 3HURA 3TH6A 2WP6A 3NYZA 3TCSA 3G1SA 3WIJA 3F5LA 2CHNA 3QJAA 3UWUA 4S3DA 3UCDA 5E9AA 1U5JA 2NQZA 2FGLA 4JTQA 2QW5A 3GS6A 3NS1B 3T81A 1CB2A 4UTMA 1YPXA 4LUSA 4Y8FA 4P2VA 1QNOA 1JQVA 4QTGA 3A7UA 3DG6A 4FALA 1LBMA 3CIXA 2VCBA 2W27A 3URAA 2ODOA 4O0QA 4H6RA 1UA7A 3AZSA 2FB2A 2QIIA 2EKGA 2J6XA 5GJPA 3DFOA 4DNAA 1EJUC 2Z0IA 5CZ0A 3FDGA 3T2PA 3WQ6A 5DANA 5EBAA 2V5KA 1TMHA 1UPMB 2C1HA 3O6YX 3FK4A 3R13A 1UYQA 4O11A 2X1IA 2X05A 1YNQA 3TQPA 2W66A 3CK5A 3VD4A 1NVMA 2E6DA 4JTIA 3AHXA 1EFZA 2YBUA 2ZRXA 4MHBA 2ZRYA 3MPGA 3NEVA 2VHLA 4DLMA 5K2ZA 4YJ5A 3W01A 3QM3A 1GQLA 3A47A 3N29A 4UFLA 1FWBC 4U2YA 3ABOA 3RLVA 1JCMP 3SUVA 4J5NA 4I90A 1UW9A 1QRQA 3INPA 4AXNA 1X2HA 4Q8VA 4RW5A 3O7UA 2DW6A 1GKRA 1D3GA 4GIYA 4AHPA 4LAKA 3WMLA 5FEXA 3KL0A 1VFTA 2PFHA 4EF9A 5HMSA 1GZ1A 4A3UA 4H4ZA 1WO2A 3QFWA 4Y6GA 1BXCA 1MW0A 4IP5A 2INZA 1KFKA 5CZTA 3GY1A 3DYOA 3AHVA 1IWAA 1R3WA 1ICPA 6XIMA 3NZRA 2Z2AA 1YHTA 1MQPA 5FEWA 5G2IA 2V5CA 4S2CA 7A3HA 4AWUA 4MLRA 3W7HA 2XVLA 2VO5A 3EPNA 1P5BA 1ODZA 2O9RA 3AXHA 4HSNA 2VZSA 2AL2B 3EXSA 1J10A 4FS9A 3KW3A 5KZEA 1QW8A 5HQLA 4ROQA 2PWUA 3TLQA 2ZIDA 2YX0A 4PCTA 4AVFA 4EK7A 1OYCA 5G4EA 2YCLA 4NG3A 3W85A 3H2NA 1EGZA 5ABHA 2X7VA 3SCOA 4ZOEA 1NTHA 3STCA 1XM3A 3P80A 3MT1A 3LU2A 4MGGA 1KCKA 3KTCA 1VBHA 1SJDA 1BG9A 4LGXA 4LRSA 5DBTA 4Q8PA 3ZXWA 3TSMA 4ECLA 2BODX 4BHYA 1FRBA 5U1OA 4HA0A 1IEXA 3N04A 3MYPA 1P1XA 3CT2A 3I6RA 5BOEA 3NIYA 2VFIA 4H04A 2YCKX 1KCXA 1XYFA 2D0HA 2G97A 1OGSA 3DI1A 2XISA 3DI0A 2HSAA 4CNSA 3TIMA 3VYLA 3IIVA 2QZRA 5BOFA 3S0CA 3IVUA 1CLVA 4OQVA 1RAKA 2BSLA 3VC6A 1KM3A 3HG5A 2AKZA 2WMIA 4B5NA 2VD9A 4EP8C 4GCAA 4IPNB 1EC7A 1V3LA 3S9ZA 4N9BA 5KEZA 3EB2A 2EKCA 1XI3A 1JUKA 1UWUA 2DVUA 4C6JA 1Q45A 2H9AB 3CV1A 2TRSA 1YPIA 1XLLA 4CCCA 3NZGA 2QCMA 3CXBA 1DJWA 2FZ9A 2EF9A 3GNXA 3ARPA 3LA4A 4WKAA 4A3RA 3QV7A 1FHLA 1UP2A 3LG3A 4FX6M 3WQVA 4MY1A 5D2YA 1EHAA 2DQWA 2SFPA 2QDEA 1H7NA 4N9CA 3BLFA 4IGHA 4JHOA 5EB8A 3U5UA 2CZFA 4CCEA 3GXNA 4ZBCA 1QPKA 1NF0A 1TMQA 4B15A 1JRBA 1GUVA 3VE7A 2Z7KA 1ITXA 4NZJA 3UZ5A 2AGTA 1J5TA 4W86A 2QCFA 3CGDA 3U2CA 1XLHA 4I6VA 2FLIA 3IPWA 5KVIA 2JGQA 4H7VA 1Q6EA 2BY3A 1POKA 2PWFA 4K7VA 3UPBA 1RY8A 2PODA 2R9RA 4M24A 1DJZA 3AS0A 3TU9A 5JU6A 4C6NA 4HA1A 5LIYX 2DGAA 4H4RA 1US0A 1TCMA 4AVOA 1JYVA 3NYDA 2Q8LA 3KUMA 1VCFA 3PG8A 2GVLA 5JXQA 1XICA 3DFTA 3M5VA 3A4WA 4HHMA 1TPC1 1CLXA 3W26A 3II1A 3WF4A 5JMUA 2GZXA 3WQ8A 4GVIA 3VI2A 3GWQA 2UWFA 4EF8A 2E1DA 3M5XA 2F8QA 4V15A 2F84A 2WPBA 3OTRA 4QJ3B 3TX9A 3CHCA 4MWAE 2PDUA 1AVAA 2BMBA 3H7UA 4ZE5A 2Z25A 5A6SA 4DIAA 1OCJA 5C2XA 3OA3A 3PPGA 1ML1A 4HD5A 2QJMA 2Y7DA 5DX7A 4EAMA 3F1QA 5LNVA 2I16A 5LYRA 3URBA 3D46A 1KCZA 2P53A 1F7BA 3ID7A 3MHUA 4PUUA 1TJ0A 3V7PA 3UT0A 3NOYA 3NRZB 1KW1A 1F3EA 1POJA 3RX4A 3WLJA 1JVNA 3QZEA 4CCZA 4GYJA 2I9EA 4NQ1A 5IOBA 2O4MA 1BQGA 3HQOA 5G4HC 5TBOA 2PGFA 1H49A 2IKGA 3SGGA 2CLMA 5FCZA 4JTUA 3S2MA 3T1GA 2ZDRA 4ERGA 3GDMA 3GVGA 4IUOA 3MB9A 4REQA 2CKRA 1H2IA 5J8LA 4DYJA 5EFDA 1CGUA 4JX6A 3CZJA 3NZ1A 3LHYA 1GKQA 4S3FA 4UCFA 3S9YA 5CGMA 4X3ZA 3GW3A 1YQZA 3LHVA 1EUAA 2Q8ZA 2NXGA 1ZTVA 1WX0A 2WCSA 1FCQA 5D32A 3DU0A 1JYXA 2PLJA 3POHA 1UR1A 1KBJA 1GNXA 1U1JA 3CUFA 3HBLA 2H6RA 3V3WA 3TYZA 1OCQA 2VD8A 1GG1A 4P8UA 4AQLA 1FWEC 2MUCA 1OIMA 5FEZA 4D1JA 3G77A 3MQTA 3ORWA 3TCEA 5B80A 4A22A 1PS9A 3DUGA 1EJWC 2PF0A 4RNFA 2BOEX 2PE4A 3UZJA 3WNLA 2V3DA 2XIMA 1K7FA 3PB2A 4ERAA 4G56A 3H2OA 1TZ9A 1Q66A 1OX5A 2HTMA 4ZSTA 4KGLA 4PCFA 3VABA 3SRHA 5G5IA 2DUXA 3TOPA 3CV7A 1P7TA 3NQ2A 4F0KA 3AAMA 3LBCA 1UKSA 4CNPA 1W9UA 1CIUA 3M0HA 1Q4NX 3DFHA 4QXIA 1ZU8A 2G3NA 1UJQA 1O5QA 3SM0A 3THCA 3WJXA 1WP6A 2V5BA 2W79A 5G5HB 1UWTA 1PHQA 1F3PA 4H4YA 3UG4A 3E3HA 3QH2A 2PD9A 4GJ1A 1ZS2A 4BQ4A 4ENLA 4MB1A 3SI9A 4NAEB 1DWIM 1P0DA 1US3A 4NAFB 3OHMB 2FHCA 2PLCA 2DFAA 3GE7A 3HFTA 5D2XA 3TYCA 2ZUNA 1T40A 3FEQA 1MZHA 3QR0A 1GW9A 1JNEA 3JW7A 3L4ZA 3P93A 1E1FA 3V1HA 2TODA 3AS2A 1V0MA 1HKMA 4Q8MA 4ZOBA 3T0TA 1A5CA 3N12A 4DUVA 3STFA 1R47A 4AZHA 3R0KA 3VGHA 2B7QA 1YTDA 3C2EA 1JI1A 4IGNA 4LTSA 1IQ8A 3IIPA 1L6YA 1X1NA 5ABFA 4LF1A 3OYZA 4L1GA 3MWAA 4DBDA 4W88A 3FHAA 1FWGC 1P48A 5FJIA 4B90A 2X0SA 3PNUA 4W8LA 4ZXOA 1KM4A 2J77A 5A8QA 3SCSA 1PZ3A 1DWFM 4YPJA 3SECA 1I0BA 2E6FA 4BI7A 1V7YA 2VXNA 3A24A 2VVSA 1HP4A 3FW6A 1H60A 6A3HA 2ATMA 4LS0A 3W6MA 1XYBA 3LRKA 1E71M 2A2IA 4R53A 3RPTA 1BKHA 3WJYA 3A3XA 4IP4A 1LTDA 1RM6B 2V3GA 2OZ0A 2R8WA 3S83A 1U33A 2D20A 3A23A 3CAKA 3I3DA 4IISA 4ZEPA 1ECEA 4EAYA 2X99A 5C5YA 1A5LC 4UQ9A 1OSEA 3E5BA 1VPQA 1R46A 4KCVA 3OW1A 2NX1A 2YGYA 2ZX8A 1LORA 2ZBTA 1T0OA 3GXMA 3CUIA 5KITA 2DT2A 3PJTA 3ZLGA 4QFUA 1XWYA 2AAQA 3NVZB 3T8LA 5FMHA 3OO2A 4GCXA 3MCOA 3WUFA 4O1BA 1RVGA 3BMXA 4QG8A 2CZEA 3WENA 1HJUA 1AH4A 1LL6A 1JGIA 1ZFJA 3T44A 2OX4A 2VCAA 4B91A 3MV01 1FFQA 3NPUA 2V30A 4QJ5B 3C86A 4ZB5A 5FS9A 4PBGA 3PUEA 4RZBA 1NDZA 3OGSA 2P50A 5FS7A 3USBA 3UJ2A 3LQLA 4JKKA 1F07A 1NJJA 7ODCA 4HT3A 8RUCA 2OSYA 4BFAA 4NEWA 4TVCA 1CI1A 1EKOA 1JRCA 1RBOB 3BSHA 3JRKA 1NHQA 3VOIA 1N60C 2GR3A 1HG3A 4F4RA 4EQRA 2QDDA 4WK9A 1HTIA 3K1DA 1FH9A 4ES4A 4H9UA 3UWEA 2DZXA 2V3EA 3EEZA 1UC4A 1BVNP 1JZ3A 2O0TA 1W17A 3EX1A 3UZYA 4R7JA 1TV7A 4YWOA 5ABEA 2F38A 3LM7A 2QXWA 2WOWA 1DTNA 1TYGA 1JZ6A 1VYRA 5D02A 4NJJA 4LNYA 1UH2A 1SJAA 1ZKQA 3NXLA 2KX9A 5AZ1A 2VI0A 1VFFA 4NASA 4DF0A 3T07A 2ZC8A 4RE2A 4O1DA 4IPIA 4HIBA 4PUKA 3NDYA 2X8HA 3R79A 3WBAA 1N5XA 3FN9A 3L4VA 1HO4A 3G1DA 5DMLA 3GK0A 4ZQPA 2VGIA 3BOXA 1UJPA 2CBIA 4LBSA 4AEOA 2PDFA 2FPTA 4H8VA 1XBXA 3OEXA 1Z7AA 3LCXA 3DFPA 4PULA 3DESA 1M7PA 4Q6JA 1T6MA 4DAFA 2ZA2A 4AD0A 1RBAA 1W9BM 3D5HA 1X6NA 3M0JA 4G2DA 3D6NA 1XP3A 4XTIA 1AMKA 1XIHA 4JKLA 3UGVA 3DYMA 3HF3A 4B3KA 2VP8A 4AISA 4JTEA 3T6CA 4E4FA 4H9ZA 4EMWA 4PMJA 2GK1A 3WLNA 2R82A 3EPOA 3WNPA 1QCWA 4M56A 5ER0A 4B2DD 2WMFA 3PWIA 1XBZA 4ZFCA 3P7YA 4YVPA 3NL2A 3ZWTA 1C8XA 3BANA 4H9XA 1F2JA 1NFGA 1KM6A 5CH9A 3B8DA 1JZ4A 2CXGA 3Q58A 4I6KA 3P62A 5BXPA 4DNMA 2XH0A 3WBWA 1XXXA 4J1OA 1W5NA 3JS3A 4GYFA 1E0TA 3MZNA 1MDLA 4WZHA 2QMKA 4S39A 2YQUA 4MKNA 1EEXA 3EXRA 4JGDA 3PZUA 3GXIA 1E56A 3NO1A 1KB3A 4Q3MA 3P61A 4FNRA 4LEFA 4K8EA 3HRDC 1YEYA 3LADA 4GPNA 5CGTA 1N55A 1LDCA 1MRAA 3G22A 1V6VA 3KHJA 3NO3A 4PMYA 3S9IA 2ZZCA 1IEIA 3BJFA 3PZTA 3TN5A 4JOMA 2BASA 4MDPA 2PDQA 3D9XA 2QJNA 5AKQA 1XV8A 4NNBA 4KS0A 3TTOA 3BTNA 2GGHA 1BHGA 4L4OA 1CDGA 3NDZA 1JDCA 4MYAA 1TWZA 4QEEA 1GZGA 3NL5A 4MNKA 4HU8A 1XLGA 4TVYA 1SW0A 3P5ZA 7REQA 3SW6A 4YTQA 4CNOA 3CZKA 2E8ZA 3I10A 4Q7IA 4RDZA 1GKPA 5E6ZA 3V5FA 5CPTA 4JIPA 3AUJA 4O14A 5HAOA 2BNJA 5CPNA 2XN2A 1AUSL 5FF2A 5A2AA 3VGGA 2OO6A 5I3HA 3NVWB 3FNDA 2C3DA 1ZP4A 2VC5A 1FXQA 5D9PA 3TLLA 1LL4A 4UTTA 3USZA 3SN0A 4JR5A 1KTNA 4O10A 4LCRA 3BG3A 1R2RA 1R3TA 4Q4RA 2QCCA 5DMNA 1RJPA 2XIJA 4JFTA 3VDCA 2IS7A 4FMVA 1LG2A 2HMCA 3WEOA 1W0MA 1J79A 1C93A 1EYEA 3KS5A 3TUUA 1G1YA 1Q8JA 2CKSA 1QPNA 4JFUA 3AMZA 1DOSA 4ZGYA 4MY8A 2WZTA 5REQB 4AU0A 1DJNA 2CLEA 4D6FA 2OX1A 3ITYA 3PPFA 3LI1A 2BVWA 4PEKA 2CBUA 3QMTA 4NIRA 5JH2A 2CBJA 4H4PA 1TPVA 4C1KA 3S1VA 1VS1A 4DZ5A 3N9RA 1TUXA 3QKEA 2D24A 3H4WA 3HU7A 4Q32A 3CO4A 1H09A 4L9XA 9XIAA 1AJ0A 2EPKX 1J9YA 3OYXA 3CUHA 3KLKA 2CDUA 4AD5A 1CECA 1TV5A 1ZNNA 5FOOA 1G7VA 4XAGA 4Q33A 4IPPA 3PUOA 4JTRA 4NVTA 3QHMA 4I8DA 4DBUA 4L1XA 2V9DA 2DPEA 4E5TA 3PNZA 3RM4A 4DX3A 2A3BA 1ZBVA 1E0UA 3PHAA 3AU6A 4JEQA 2R1MA 1QNPA 3SURA 2Z1BA 3W7KA 1U83A 1ZY8A 2UZ9A 3GIPA 1TE1A 1ZGDA 1UG6A 4RXFA 3MYOA 4Z2JA 1WDQA 3L2MA 3FY1A 2ZRZA 2GUUA 4N02A 1VFUA 1HQTA 4BQ3A 3K5XA 1D2KA 1SW3A 1SB3B 1PZ2A 2BFGA 3Q2DA 4FX9A 2OU4A 4G7EB 2FB3A 3H22A 2PDWA 3ELFA 3W7JA 4FXFA 3U4FA 3W7NA 3VGFA 2RABA 3RPMA 1HP5A 3GYEA 3VVGA 3SN4A 3ANUA 3OB8A 4GI6A 4J56A 5F1VA 4EXAA 1XYCA 1QT1A 3LCWA 4LVGA 4LYRA 2J8GA 3CWNA 3OVRA 4Y8EA 3W7MA 5DXXA 3KX6A 4LFYA 1QNRA 5D9MA 2X2YA 5M03A 3OQ8A 5D8ZA 1W2PA 1J18A 5T26A 1BXNA 4YVXA 3R8HA 2DSWA 2WHKA 2WMKA 3HPFA 2RGMA 1LOLA 3ZJ7A 4GZIA 3AZTA 3QLDA 1UIPA 4S2BA 4X9SA 3V0SA 4KEUA 5E5CA 4DWSB 1A3HA 5D8WA 4S3CA 3U7VA 2E0PA 1KC7A 3W27A 2QUNA 3WH6A 1ZJIA 4ZQRA 4LAMA 1BRLB 1TV2A 5A8PA 3B8WA 1BWKA 5CPLA 4D6DA 4S38A 2UV8G 1E6XM 1V7AA 1BYAA 4GY7A 3ZJKA 4MY9A 1YNYA 1IYXA 4GVGA 2ZZ4A 1DEDA 5I79A 4NXKA 3W83A 3N6JA 1O6IA 3TW6A 4PMNA 2HZGA 1I9CB 3VDHA 1PTAA 1FWFC 2P1FA 4XD4A 4XKYB 3FGCB 5CBIA 4ML9A 3WQWA 4FO4A 3FYPA 2VELA 4DJFC 1H5VA 3W9ZA 3C6CA 3DHDA 1NP0A 4GQ0A 1EUNA 3P6LA 2QNEA 3VOGA 3DECA 4N4QA 2IW0A 2DH2A 1KGWA 3O6CA 4DJDC 1HVXA 3M5ZA 1E9LA 4EE9A 2CLPA 1XYMA 3QV6A 1STZA 2OWCA 1EJ7L 2E28A 4D6CA 1TIMA 1E6NA 1PKMA 3T09A 1VEOA 4HN4A 2GGJA 1O60A 3DCPA 2A4AA 3FLUA 4AC1X 1ECQA 1TTJA 4DZHA 4DN1A 3W7IA 3OZPA 3WL0A 3TA9A 1D3HA 4XZNX 3GRTA 1Q7QA 2Z1VA 1JXKA 3GNOA 4FIQA 2FQIA 1GVRA 1QMLA 3E1F1 1VEMA 4GXMA 2D2OA 4RUBA 2RKXA 3F4VA 1K9EA 1DWHM 3DFQA 2XFFA 3B8TA 2X41A 4E2VA 4UZSA 2YB1A 4ACYA 1OC5A 1H3GA 1LLZA 2C15A 4TIMA 2B4GA 4MPQA 1ISYA 1S2CA 1Z8AA 3LCGA 3KTXA 1QAPA 2FHFA 5AYZA 4BEQA 1W6TA 2FKPA 1FWAC 1XF0A 4LU0A 1JAEA 3FJNA 1RD6A 4S3JA 2BC1A 1W91A 1LVLA 3T40A 4ZB2A 3RCMA 3I6EA 3WMBA 3EA1A 1XBVA 1DKWA 1R9XA 3ARSA 1QDSA 1J96A 1FTXA 4PTMA 4A29A 4BKNA 2NVDA 3R11A 5AHNA 4TTGA 2BXVA 4LAOA 1MSSA 1UP3A 2OLHA 2GQAA 1WQ5A 3ZM8A 4S3BA 3SSJA 4IIDA 1FWWA 7ENLA 3GC2A 4CD4A 4QAIA 3BXWA 4HU4A 1D8WA 4FLQA 5CAHA 4XZLX 5M1TA 3MMDA 3TE9A 2GR0A 3GU2A 4NI3A 3UNTA 1XC6A 1NH6A 4AD3A 4E0CA 5XINA 1FWNA 1XH0A 3HG4A 3QTGA 3EANA 1MFUA 2Y2WA 3CC1A 1K02A 1D7YA 1OCBA 3F4NA 2J79A 4MLJA 2ZUMA 3P5YA 2YDSA 4UQCA 3W1UA 4B2DA 4WJXA 2Q01A 4UQAA 4NNCA 5A6BD 3QV8A 1SO6A 2NQ5A 4BY3A 5CC5A 3UXLA 1QNSA 5DMYA 2ISSA 4AY1A 3ARVA 4LH8A 5CZSA 3NM1A 3NSMA 4I9MA 5A6AA 4ZSUA 2IQDA 4DO5A 2EG7A 2Y4SA 2D2HA 1EO5A 2WC7A 3NQCA 4M6PA 2DZBA 3LX9A 2XYLA 1BSLA 4IPLA 1EOKA 4OBSA 1DE6A 1R8LA 4BURA 4YYCA 2GVEA 3BGAA 3H21A 4NKCA 2JE8A 4QE5A 1G67A 1UKPA 2CERA 4Q7NA 2RHGA 3BGGA 4Q6XA 4HCDA 3W29A 3PAJA 3UPWA 3WQCA 3BCJA 3WLOA 4W5UA 5BXRA 1OZMA 1VIWA 4CCDA 3BLIA 4HPJA 1TREA 1WZLA 4QS5A 3C3NA 3GO2A 2GH5A 2YCIX 4TR9A 2PURA 3RIKA 4IG2B 2R9ZA 4O1FA 2W0HA 1DIDA 2EQDA 1XLKA 1XLEA 4MG4A 1X97A 3M46A 4JFVA 3W2MA 4YU1A 3QBUA 4MAZA 3AMGA 1X6LA 4CQCA 2A3CA 3HQ1A 3PC0A 4LVDA 5KETA 2GVGA 2E8YA 3O63A 1QXLA 1UUQA 2B31A 1P43A 1SSGA 1PDZA 2HE5A 2HCVA 3SJ3A 3L5OA 4R33A 1TPH1 3GTHA 2C1IA 4FF5A 4E3VA 3AU2A 4MF4A 3VIOA 4PL1A 4PB5A 4GO8A 2KZHA 2D22A 3BPWA 3FJ4A 2WOVA 2OWWA 3WK1A 2ZZBA 2DZWA 4O57A 2PTXA 2V2DA 3B9DA 4DLFA 3U9IA 1X8FA 2PRHA 5LZLA 2BXZA 5L9FA 2P88A 1XLMA 2PZNA 1GOQA 1NHPA 1SZGA 3A7AA 1JAKA 4FNQA 2QGYA 4Q4SA 4US5D 1H7RA 3U2EA 1WBJA 5HINA 3R43A 1WUFA 3AMKA 1OWQA 4JL1A 3NVVB 1KO0A 3QC3A 2RFGA 3DERA 4LY8A 3QY8A 1FXPA 3TZFA 4OZOA 1UOZA 1NSJA 3WJWA 3B8IA 3H2MA 3UWWA 3MC5A 1R85A 2I7GA 1P4CA 1LLWA 1GJPA 1DNCA 1EX5A 2HXUA 3Q67A 2JK2A 3LBOA 2QCHA 1ZZMA 3GFZA 5EMYA 3UGRA 4L9ZA 1DJHA 3WDQA 2C6QA 3S3GA 1AQHA 1SM9A 3L68A 4JICA 1LRQA 2OT0A 3ITVA 1Q6LA 2IPFA 2EPLX 1B2YA 1X6UA 3NQ7A 4AZIA 3TR9A 4DB7A 1LWHA 1KGUA 5A95A 2Y63A 3MO4A 2ALRA 3AHYA 4C6QA 3STPA 4GKTA 1HUVA 3P82A 3B8UA 3RHGA 3RNMA 2FGBA 2B7OA 1XS2A 2CITA 3OZOA 2FFIA 4FNPA 1JOAA 3T05A 4FAMA 1EHNA 1R2TA 1HGWA 3VD7A 4M81A 2GLKA 1ZBKA 2YYUA 3BAYA 4U3CA 2J4GA 2GJXB 1WB0A 2ZZ3A 4NJGA 5JIPA 4HHHA 3WMSA 3RG6A 4RPPA 4QDWA 4JDBA 4W8BA 1FDJA 2GVJA 3XIMA 1EBGA 4LVBA 1GOKA 3AROA 4K36A 4ATDA 4XO7A 1DV7A 1L8NA 3WEZA 3C61A 1VFSA 1W32A 2Z28A 2RJHA 2YXGA 4XUYA 1XG3A 1JPHA 3ECQA 3B0PA 3N17A 4QNEA 3WQOA 1A0DA 1KBKA 1W3JA 4AF0A 1JZ2A 3VIKA 3DH9A 3G3MA 5I77A 3KRZA 3N14A 3SO7A 3GBDA 4U33A 3WNKA 1DHPA 4JS3A 5TD4A 4C6DA 1TTIA 4JYEA 1XFBA 2Z7GA 4HMNA 1TPDA 2Z1WA 3VD5A 1R86A 5CJMA 1DIOA 4KCTA 4J35A 2A1YA 3BAKA 3O07A 3S6OA 2E3TA 2BVTA 2PDMA 1JFHA 2TMDA 3DG7A 4GIAA 2OODA 4GABA 1V6UA 3S1WA 2DIJA 1HGYA 4KEZA 2FHBA 1B90A 3OP2A 2POZA 1CXKA 1TR1A 4DBSA 5A2BA 3LGEA 4LY4A 3VKJA 2J7DA 2PU0A 3NVDA 3GKAA 1ONEA 2I5IA 1OFEA 4DEFA 2Y6ZA 4CN4A 5I5RA 2BBFA 3AO0A 3ITGA 3EYPA 1OD8A 2TSYA 3CASA 2P3ZA 3G0SA 3W28A 3KCOA 1JZ5A 3CTTA 1IIHA 1FIQB 5AC5A 3R8RA 4HNLA 3CJPA 2PUZA 3UXDA 2HVOA 5E0CA 3UBPC 4IL0A 3BV4A 3UXKA 3N2BA 3FV9A 4A3YA 2PC4A 2QJIA 4HZ7A 5D2WA 3LPPA 1UR4A 1ZRQA 3UZWA 5M5DA 3MBDA 2WQPA 2Y70A 1L0PA 3UA3A 1OEPA 3DGBA 4TXEA 5JBDA 2ZFAA 4E4PA 1GERA 3DJJA 1G4PA 2O9PA 1G01A 3ISIX 3CB8A 1JGMA 1H63A 2BHZA 1S7MA 3IGSA 1VFMA 3O6DA 1UMLA 2ONEA 3IANA 3AISA 4IZGA 3STGA 1FX6A 5K9CA 5CLTA 3ONCA 1L6GA 2A8XA 2XZ9A 3U0HA 1SFSA 3M0KA 4PGLA 4TQTA 1R3QA 4R7WA 1WDDA 1Z48A 5K4ZA 1U2YA 3FVMA 4UMBA 4GFIA 2P76A 4HGXA 2WHLA 2ZDSA 2J9ZA 1GRGA 2CU0A 3UR2A 1Q6CA 4E8CA 3H4XA 4RV8A 4XX6A 4ASTA 3P84A 5HBFA 4L4LA 3KP0A 3L4WA 2D3LA 5FKYA 1E9IA 3SRKA 1EPXA 5JIWA 3GR8A 4RKAA 3HJZA 4H3DA 1CNVA 1SR0A 2YDRA 4M1BA 4DXVA 4F0SA 2D2JA 2ALDA 4F66A 1QK2A 2FDSA 5C6MA 1XRFA 3NQGA 3PZVA 2Z6JA 2ZA3A 2ZRUA 2DZUA 3LMZA 1AQ0A 3ZQ9A 4UOQA 2PBGA 3IJ6A 1E3XA 3ONBA 3R7MA 2FMNA 4M7TA 1ITQA 4NZ4A 2JF6A 1V03A 2DQXA 3QMSA 1O5RA 3KWSA 4DUXA 1RA0A 3L12A 1PEZA 3IIZA 2QCEA 3NVTA 3SUWA 3BMVA 3DG3A 3S1UA 3IGHX 5BOOA 2W9MA 3H6OA 5A8OA 4M3PA 2QCDB 1UD5A 5IBXA 1Z9AA 5C71A 3IK2A 4GIEA 5CSRA 3OVQA 3SQPA 4KF1A 2XSXA 4HSHA 3L23A 1YXYA 2A21A 1Y0EA 5K4XA 2WPCA 3WN6A 4I5XA 1XCFA 3N2XA 3CHVA 1NOFA 5HNTA 1UB3A 3GXDA 3TC6A 4IQLA 2Z26A 2QUUA 2ZCGA 4JKMA 1GOXA 3N4FA 1A0CA 3L21A 1UC5A 2G41A 3LLXA 1ZSXA 1QNVA 3HGSA 1BWVA 3OODA 3IIXA 5A6BA 2OOFA 4XD3A 4HNUA 3UQNA 3I3EA 4JTCA 1KLYA 3KS6A 1XPGA 5LA1A 3P81A 2EEXA 5HK4A 3W72A 1MO9A 1A5KC 4AMAA 3V0TA 3AC0A 1W3IA 5LIXX 2CETA 4RL3A 4E8DA 4NAEA 3MCNA 4KWOA 5D05A 3CZLA 1H51A 2EPHA 3VNLA 1MYRA 2ESCA 4U4MA 2R1PA 2PGRA 2GWNA 1PB0A 3WCZA 4WDUA 4PMXA 2YXXA 5HR6A 4NI8A 1FY6A 5C9WA 4GNKB 1FFRA 4L6DA 3M6DA 3MS8A 3QQ0A 1Q6QA 5D2TA 3W38A 3MI6A 3ATYA 2GSHA 2JK6A 4MMWA 1IXQA 4JYDA 3S42A 4ZQOA 3C0LA 1GVEA 2QF7A 2XHYA 1VRXA 1TPUA 9XIMA 4JXCA 3U4AA 5IRPA 3CL7A 2ISWA 3IK4A 1CX9A 3KL3A 6REQB 1PAMA 4MPKA 4QCEA 4AEFA 1DIEA 1P6BA 3U7BA 1V6TA 1OFPA 1O7AA 4WGXA 3UA4A 3FYOA 4LIIA 1TR9A 2CW6A 3NR0A 4W7VA 1TWIA 1PSCA 1EA0A 2J7GA 2VFHA 1JDDA 1E40A 1KR1A 3UZZA 1FEBA 1XKJA 1EZ2A 4BF5A 4LUIA 3FA4A 5CJ5A 1QI3A 3A12A 4UTKA 4UTTC 4DWSD 1TRDA 2PDJA 3SUSA 2YL6A 3AWNA 4JIEA 2WANA 4V1YA 4UWMA 2VDIA 2XSBA 5A6TC 3B06A 3TMLA 3VD3A 3N18A 1S38A 2ISFA 3LPOA 4XAFA 4JYFA 1Y8BA 4XZWA 1VIZA 5CLWA 2GQ3A 3GRIA 1QWGA 4UFMA 3VNZA 3WD0A 3LN3A 3WLQA 3WLPA 2J7HA 4AIEA 1TB3A 4JTAA 1FWSA 1VGAA 4GI4A 1OF6A 1IXPA 4US5A 3RR1A 4LSBA 4M5PA 2DDXA 2X1SA 3E0IA 3TSBA 2WVUA 1GRTA 3CZEA 2RH9A 5I6SA 3KOFA 3L4TA 5TIMA 4UQEA 2EPOA 1FA2A 4ACZA 1H6VA 5U7SA 2QUMA 3AS1A 1FKWA 3A9IA 2GWGA 2QVNA 3NA8A 4Z0SA 1GVFA 3FFSA 1LBLA 3CQKA 3VDBA 2W55A 3BUVA 2J66A 2PEVA 5KMYA 3L8KA 1Q3NA 3NTYA 4LF2A 2DUAA 4MWAD 4TO8A 2GUYA 3LMYA 3W1TA 1KNWA 1FH7A 1GOOA 3TJ4A 3FSUA 1XCXA 1GQJA 3LRMA 1YQ2A 2V3BA 1PCKA 5F4SA 1M7OA 2HS8A 2C7FA 1C8YA 1XH1A 1KXTA 2WBGA 2P0IA 4GO9A 1FECA 5IHRA 1Z41A 2OZ8A 2QJGA 3L7RA 1P6WA 1BZLA 2WKJA 2OQYA 4DELA 1D7KA 5AVNA 1CENA 4O1AA 1K7XA 2VURA 1TFVA 4GRSA 5HA7A 1EP3A 4QG9A 1XIMA 4UR9A 3W84A 1EIXA 1VHCA 4Q8QA 3AHTA 2DEPA 3S2NA 5BW6A 3C4UA 3QPZA 1UWQA 2A6LA 4O15A 3B0YA 4XB3A 1PIIA 1W3LA 4JIQA 1C7SA 2HWGA 3UJFA 3WNNA 5BXSA 5GPRA 1B30A 4EQSA 1CXIA 2YW4A 3LOTA 1W1B1 1R0MA 1BPLB 1TTQA 4N2YA 2V68A 2J13A 1EC8A