3ZVIA

Methylaspartate ammonia lyase from clostridium tetanomorphum mutant l384a
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
415
structure length
415
Chain Sequence
MKIVDVLCTPGLTGFYFDDQRAIKKGAGHDGFTYTGSTVTEGFTQVRQKGESISVLLVLEDGQVAHGDCAAVQYSGAGGRDPLFLAKDFIPVIEKEIAPKLIGREITNFKPMAEEFDKMTVNGNRLHTAIRYGITQAILDAVAKTRKVTMAEVIRDEYNPGAEINAVPVFAQSGDDRYDNVDKMIIKEADVLPHALINNVEEKLGLKGEKLLEYVKWLRDRIIKLRVREDYAPIFHIDVYGTIGAAFDVDIKAMADYIQTLAEAAKPFHLRIEGPMDVEDRQKQMEAMRDLRAELDGRGVDAELVADEWCNTVEDVKFFTDNKAGHMVQIKTPDLGGVNNIADAIMYCKANGMGAYCGGTCNETNRSAEVTTNIGMACGARQVAAKPGMGVDEGMMIVKNEMNRVLALVGRRKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering Methylaspartate Ammonia Lyase for the Asymmetric Synthesis of Unnatural Amino Acids.
pubmed doi rcsb
source organism Clostridium tetanomorphum
molecule tags Lyase
molecule keywords METHYLASPARTATE AMMONIA-LYASE
total genus 164
structure length 415
sequence length 415
chains with identical sequence B
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
A PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3zviA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3zviA01
2OFJA 2QJJA 3PWGA 3SN1A 3N4FA 5BOEA 2OQYA 4IHCA 3Q45A 1KCZA 3RR1A 3FV9A 2QJNA 3P0WA 3VCNA 2OO6A 3VCCA 3HPFA 4MKSA 4H83A 1WUEA 3MSYA 3V3WA 4HCDA 4KPLA 4HN8A 3VDGA 3N4EA 3MZNA 2OZ8A 1MRAA 1NELA 3KUMA 1SJAA 1P48A 3OW1A 2ONEA 3CK5A 2OG9A 3VFCA 3GC2A 3N6JA 3GD6A 1BQGA 3GO2A 1RVKA 4M0XA 2FKPA 3V4BA 3RITA 4KEMA 5IDZA 3IJIA 4HCLA 2PCEA 3Q4DA 3DERA 3CT2A 3IJQA 3DIPA 3OZMA 3ZVHA 2HZGA 3R0KA 2AL2A 4H1ZA 3TJ4A 2QGYA 4KT2A 1ONEA 4GGBA 4E8GA 3ES8A 2PP3A 4HYRA 1MNSA 3H70A 3STPA 3TOYA 2HNEA 1PDZA 4ROPA 1BKHA 4H2HA 1R6WA 2PTZA 2PS2A 2GL5A 3UXKA 1EC7A 1WUFA 3BOXA 1ELSA 3FYYA 4E4FA 4KWSA 1XPYA 3OP2A 2XGZA 2QDDA 4JHMA 4DHGA 2PSNA 5FJTA 3D46A 3TCSA 2QQ6A 2FYMA 1KD0A 1W6TA 4G8TA 2MNRA 2PPGA 4DX3A 4GFIA 3PK7A 3V5FA 2QVHA 3IJLA 3U9IA 3UGVA 2HXTA 2OVLA 2OZ3A 4GGHA 3ZVHB 4IZGA 3TTEA 3R10A 3TQPA 2DW7A 3SSZA 3CXOA 2XSXA 3JVAA 4G7FA 3DG7A 1TZZA 4H19A 2PMQA 1IYXA 1L8PA 1ECQA 3SJNA 1XS2A 3DDMA 3R11A 1F9CA 3UJFA 1DTNA 3MWCA 3TJIA 3DFYA 1EBHA 1YEYA 1SJCA 4FP1A 2XH2A 1TE6A 4E6MA 3ZLFA 3OTRA 4ZA0A 3THUA 2PU1A 4Z17A 4JN7A 3MUCA 3B97A 5BOFA 4K1WA 4MGGA 3SN4A 3ES7A 5EU9A 4IP5A 1MDLA 3BSMA 3P3BA 3QKEA 2AKZA 1TKKA 1FHVA 4ENLA 3TWBA 3VC5A 6ENLA 4GYPA 3DESA 3VC6A 3CB3A 2XH7A 3NZGA 1JPMA 2PGEA 1JCTA 3T4WA 4A6GA 3CAWA 3FVDA 4EWJA 3NXLA 4J1OA 2PTXA 3BJSA 2GGIA 3ZVIA 3R25A 3SQSA 7ENLA 1P43A 4IL0A 5FJRA 3FJ4A 4X2PA 2GGHA 2DW6A 3DG3A 3T8QA 4E4UA 3MQTA 2ZADA 4J3ZA 3ENLA 2OPJA 2P8CA 3UCDA 4HNLA 3RGTA 2AKMA 3R1ZA 3DEQA 4FI4A 3I6EA 4DXKA 2PTYA 3R0UA 2PP1A 2RDXA 1EC9A 2GGJA 4K8GA 1SJDA 2GGGA 2PU0A 1EBGA 3JW7A 2PODA 3OZYA 3QTPA 3S5SA 4DYEA 1KKOA 3UCCA 4DN1A 2HXUA 4M6UA 2PA6A 3I6TA 4JN8A 3PFRA 3UJRA 2OZTA 3FCPA 2PGWA 4Z1YA 3VA8A 2PTWA 3JZUA 4IP4A 4F4RA 3RCYA 2P3ZA 3V5CA 1MDRA 3N6HA 3MY9A 3P93A 1R0MA 2AL2B 4A3RA 1EC8A 4HPNA 3H7VA 5FJUA 1SJBA 3DG6A 2GSHA 3K1GA 5FJPA 3T9PA 5ENLA 2OKTA 2QDEA 5J04A 4IT1A 3SN0A 2P0IA 4HNCA 1PDYA 2QJMA 4IL2A 2POZA 4DWDA 4GYPC 4YWSA 4MMWA 3FXGA 4GIRA 3IK4A 4HCHA 3H8AA 3U4FA 2GDQA 3OPSA 1KKRA 1E9IA 3TW9A 3S47A 3CYJA 2PP0A 3QLDA 1MUCA 2MUCA 4E5TA 3UJSA 3DFHA 3PWIA 2ZC8A 4A35A 3NFUA 2NQLA 4GMEA 3GY1A 3EKGA 3I4KA 2GGEA 2XH0A 4GISA 1JDFA 3TWAA 1NU5A 3QN3A 2AL1A 3UXLA 3QPEA 3H12A 3D47A 2CHRA 2OLAA 2P8BA 4K2SA 3EEZA 2OQHA 3DGBA 4ZCWA 3SBFA 1FHUA 3RRAA 2OX4A 3ZLGA 3T6CA 1OEPA 3MKCA 3NO1A 3ZLHA 5FJOA 3UJEA 2O56A 2I5QA 2XH4A 3RO6A 2P88A 1JPDX 3UJ2A
chains in the Genus database with same CATH superfamily
1J5SA 3BG9A 1O5RA 3ARTA 1I1WA 1X8CA 2WAGA 4GZIA 5A6KA 3AUOA 3BDKA 3BAXA 1K1DA 3CQJA 1ITQA 2ZX8A 4DAFA 3U0HA 1TMHA 3ECQA 1S5TA 4DO4A 4HN8A 2XWDA 1JZ8A 1B3OA 4HD5A 4XQ6A 3CTTA 4IF2A 4LF1A 2REQB 2X40A 3CNYA 3IIVA 2UWFA 1Q4NX 1S38A 2Y7EA 3CAKA 3N6QA 1J12A 3OG2A 2V3DA 4ERGA 2ZX6A 3GVGA 1R9YA 4E2OA 1R85A 3CUHA 3GVRA 2WXDM 2I17A 3IJQA 3SADA 2GDVA 1EJRC 4LVDA 4N4PA 2O7QA 1JEZA 4AISA 3S5ZA 3TROA 5C5YA 4WR3A 3AWOA 2C15A 2XFRA 4S2BA 4TIMA 4Q8QA 4IFKB 4XSMA 3HM7A 3BLPX 4LB3A 5D37A 1VCGA 4HT3A 3EWZA 4PEKA 2Z25A 4ORMA 4GY0A 4ZL1A 2VZTA 2E6FA 5M1TA 2PS2A 1XJBA 4O0ZA 5FEPA 3FYYA 5A6AA 5JCIA 4Q4KA 4G9PA 1GXFA 4AHPA 1CXHA 3LHYA 3IUIA 1KBJA 1RQBA 4XK2A 4Q4SA 3HJZA 1M53A 1X2HA 2FZNA 3PZNA 2QQ6A 5LNRA 1S3TC 3HTWA 2ZUTA 3ITYA 1WNOA 3G18A 4R34A 3NGJA 4YYCA 1JCYA 2PDBA 4IUOA 4Q4OA 3L68A 1Y5XA 3BO9A 1M41A 4I8DA 3WDRA 3SUTA 5LIXX 1EPVA 2WSQA 3CXOA 4H2CA 4BI6A 3TV8A 1YRRA 3A4WA 5F7UA 3GFXA 1OFOA 4KGLA 4JYEA 4MUZA 1ENUA 4A3HA 3I3DA 3T44A 3F2DA 2FQIA 3SJNA 4Q6JA 3K2GA 4CNUA 1LL6A 3GHTA 2ZZ1A 1AQ0A 1UWQA 3UWEA 2CFYA 3RO8A 4C6LA 4ZA0A 1H0IA 1GTHA 3W26A 4M56A 4JEQA 1W5MA 5CC3A 4WKFA 4IXHA 3GLCA 4H4IA 2VDIA 4NASA 4DM2A 3D9XA 4PYSA 2Z26A 2WHLA 5IOBA 3P61A 3EBVA 4DO5A 5FACA 5BRPA 4LT9A 3N14A 6ENLA 5FIPA 4O57A 1EZWA 4C6PA 3MDUA 4ADUA 1KR1A 2V38A 5LYRA 4FLSA 5ABFA 1CW2A 4ADSA 3TR2A 1FWJC 3T4WA 1SR9A 4BKNA 5DCDA 1NDWA 3NTYA 4MDPA 2DDXA 3A23A 2WWCA 1JCLA 3BJSA 5D9NA 1CLXA 5CLTA 3EKZA 3RPMA 3QR1A 1AH4A 5HMSA 1Q3NA 1XV8A 3SECA 1FEBA 2PF0A 4CD5A 1Q6DA 3LHTA 3HA1A 4JQ2A 3G1DA 3O6DA 4UR7A 4DY1A 1P6BA 1A4LA 4PL2A 4O12A 3OODA 3I6EA 4UNKA 3UP8A 1FWFC 3EXSA 3WQVA 5K9CA 4DIAA 4KWWA 1JPKA 5AYBA 2ZZ7A 1VKFA 3LHZA 5EMUA 1EJUC 2E5CA 3QMSA 3N34A 3S2JA 4LYRA 3NEHA 1RK5A 4B5NA 3BLKA 4M7TA 3W4RA 2E77A 1KBKA 2HBXA 1GVFA 4NF7A 3HQPA 4K7YA 3AS1A 3PFRA 1E6RA 1AQFA 4B5TA 1CGVA 3RJXA 4AD5A 4IP4A 3VNZA 1J8VA 3LB0A 1Q1RA 1CGTA 1O6IA 1X1OA 3FIGA 1KRMA 4W7WA 1DORA 4F0SA 4F3HA 3TP4A 1E1EA 2CIPA 1N5WC 2ZZ5A 1ZBVA 4QROA 4ZSTA 2OQLA 4GLEA 3H55A 4URIA 1ISYA 1JR1A 1QPOA 1V02E 2OKTA 4U28A 1E5JA 4QQ3A 5REQA 5CPTA 4ZQPA 2V69A 2P0IA 1G4PA 1G1YA 4KWUA 1DVJA 4MMWA 3MP3A 4OU1A 3IK4A 1ZFJA 1EO5A 2OGJA 5BMXA 5K4XA 2Q8ZA 2OOGA 2E6AA 2P76A 4N02A 4A3YA 2QCLA 2P53A 1O5KA 1TRIA 5G4HC 4N4QA 3QLDA 2XDFA 1MUCA 4JZ5A 1VDVA 2CW6A 1TPB1 3M7SA 3DFHA 3S9YA 1QI2A 3LY0A 5CZKA 4A2SA 4J35A 1V3LA 2IKGA 3TTSA 4A35A 2GVYA 3TTYA 4B9YA 2CLLA 3U5UA 4O13A 2P50A 2ZWZA 4MY1A 3NPXA 1GWJA 3V35A 1ICPA 4K1GA 3STCA 3WQPA 3TEVA 2FMNA 3K1DA 5JIPA 1SFJA 3SZ8A 3WDIA 2OX4A 4YLWA 5KZEA 3NO1A 1XRSA 2ZZ3A 3S6TA 3UJEA 4P61A 3NR0A 4JTLA 3T2PA 1GESA 3WJZA 5REQB 8XIAA 2VEGA 5BCAA 5GNZA 5LA0A 2GQ8A 2FH8A 4EANA 3U4AA 3C2FA 1TPVA 5H2ZA 3HPFA 3P8JA 5EBKA 1VGAA 4HPHA 1KA9F 2Y89A 1UD6A 3ORWA 2ZRVA 4Q4RA 3PUGA 3T2OA 4UTMA 2WCGA 3FEQA 5ECUA 3EWBX 2ISFA 4IICA 3RLUA 3RX2A 2G4FA 4PSRA 3PSVA 3EWCA 1JJKA 3N15A 4CCCA 2PDWA 1JZ2A 1P48A 4PRTA 5A2AA 2XFFA 3WEOA 4C6DA 4U33A 4R53A 1NHSA 3R43A 1KRCC 4WY0F 1DXEA 4DJFA 2CZ5A 1QO2A 5BWFA 3R0DA 3BMVA 3E0LA 3L4YA 3TC3A 3O6AA 3TQVA 3WLMA 1C9DA 2CWNA 5AHLA 1DOSA 4AB4A 1BEUA 3GR8A 1DP0A 1ONEA 3ID7A 1XSKA 5D04C 2DIKA 4E8GA 1HJUA 4L65A 3RNMA 2I7GA 1Z69A 3WJYA 2VX7A 5A5WA 1MFUA 3EKLA 1LRNA 3G2GA 2EO7A 1R6WA 3GSMA 1Q6QA 3R58A 3N29A 2NQHA 3M0ZA 3S1UA 2FB2A 3BOXA 1PX8A 1E1FA 4JTKA 3OP2A 2YDRA 3EANA 5EA9A 1ADDA 3RIKA 6A3HA 3PG6A 3T0TA 1XC6A 1QATA 2HVMA 2VTFA 1SFSA 3HG2A 3BOFA 5CC7A 1EX5A 4UTTA 4F48A 5LNSA 3RMEA 3T0CA 3AHTA 3I3BA 3RM9A 3UGRA 2DT0A 2CKRA 4UNIA 4HPXA 2QVHA 2OZ3A 1QT1A 1VFMA 1K6WA 4S3AA 1KFEA 1ZL1A 4AZHA 3R10A 3LN3A 3XINA 3NVTA 1P0KA 3NVWB 3LCLA 4BQ3A 1V3KA 1FWSA 2IS7A 3S6OA 1EF3A 4XZNX 3GG7A 3GTNA 4PFHA 2Q8LA 2HPIA 1TE1A 4LBSA 2VL4A 4TV6A 4AUBA 1MWOA 2ZX9A 3BL3A 5LIWX 1R3WA 2W3ZA 3ZMRA 3GS6A 2ZRYA 1W9UA 3DKLA 4RZBA 3TZFA 5F4SA 3ZT7A 8TIMA 4EQRA 3G1AA 4C1LA 2O4QA 2X2GA 5CBJA 4F8XA 2GSJA 5DXYA 3OA3A 2XPKA 1OFDA 4QG9A 1OK6A 4XVDA 2QPXA 3AHZA 2NXIA 4GI8A 1S5WA 2CNCA 3SUSA 1W2PA 3P5YA 2C71A 3CQ0A 4RNIA 1E43A 1JNEA 2CETA 1QNQA 2DVTA 5HNNA 4EWND 3NQBA 1XLIA 4XBSA 3TX9A 2VVSA 4IIEA 3WF3A 1C8XA 3TWBA 1JVNA 1Z42A 4BCEA 8XIMA 4TVUA 3VABA 4CN6A 1IXOA 4QR6A 1DJZA 1JCTA 1HNYA 3TMQA 4R88A 4MG4A 3UWUA 1CTNA 1BVWA 4N9DA 7REQA 1U1JA 5CZTA 1V97A 1EGMA 3KLJA 3NZPA 1UC5A 4UTJA 3ZJKA 1R7OA 2TRSA 1TPC1 4M29A 1HL8A 3APYA 3NO3A 1CT5A 5B7ZA 1G69A 4PMJA 3UG5A 3N2OA 4HNLA 1BYAA 4HBKA 1K9FA 3DEQA 4LAOA 3O8AA 3VIMA 3AMDA 4JTTA 4WJ8A 4P7LA 2A85A 5I09A 4CD7A 1LDCA 4WGHA 2R1KA 1S2TA 1EEPA 4HOXA 3WELA 2X30A 3UZYA 4Z42C 3IJDA 1GQJA 3DYMA 2PU0A 3BXWA 4NSBA 1JXJA 3OZYA 3QTPA 1EYWA 1LLZA 3VD4A 2IMRA 4IQDA 5A3HA 1SB3B 3QPZA 1XI3A 3I6TA 1E3ZA 4EQSA 2OSXA 5A8QA 2ZRXA 1E4LA 1M7JA 3HBLA 1R87A 3TYAA 3CGEA 3ZOAA 5IDIA 3G22A 2EG6A 3B0YA 1OGBA 1CI1A 2IUZA 3UA3A 2DZUA 4ADWA 1PEZA 4HA0A 3N2XA 5I6SA 3ARXA 1EC8A 3W87A 1Q6GA 1FFVC 1HKIA 2ZA1A 2GJXB 1GJPA 2FTPA 3M5VA 3T9PA 1M7OA 1Q6OA 5HK4A 5FS8A 4N42A 3LEPA 2WHKA 3MJMA 4O15A 3MANA 3T0BA 3H4KA 1O7AA 3TOPA 3KBWA 1LT8A 4TTGA 4AY7A 1JDCA 3S1WA 2X1RA 4J4KA 4FO4A 3KZSA 5TQLA 1ZBWA 5KEZA 4MNKA 1UW9A 1RJQA 1MOKA 1Q4WA 1XCXA 5DMLA 1FIQB 1D9EA 3TW9A 4EIVA 3PTDA 3KRSA 1EJTC 1FP8A 2FZDA 5FJIA 3QM3A 1YNPA 4GZ7A 3GTHA 4RE0A 2YA1A 3CO4A 5M03A 1UWSA 4GMEA 3S5NA 3SURA 3L4WA 2XH0A 1RY0A 1MO9A 3L4TA 1WB0A 2C6QA 5A8MA 1QK0A 3W1AA 2ZXBA 4DNMA 2C18A 2J25A 3AXIA 4ZCWA 1OT1A 5BRQA 1ZCCA 2YCKX 1DXIA 1I4NA 4US5D 4PEEA 2X16A 3AMLA 4KEZA 3W76A 4WXYA 1YW1A 5DLCA 1C93A 1B5TA 3NQMA 2VURA 4M19A 4J57A 5BNKA 6REQA 4I9MA 2W91A 4AMAA 1Q2SA 1TV2A 1UC4A 4J3SA 1XLAA 2BLEA 3T0DA 2JEPA 2O7SA 2YR1A 4JKMA 4HNOA 1A5SA 3H6OA 5HATA 4KETA 2P0OA 1JROA 4HZ6A 3GWQA 5A8NA 4HCDA 3NVDA 4QNWA 1EF2A 4K8HA 2DT3A 3WBYA 1IGSA 4DO7A 1BG9A 1C8YA 5G1YA 2YPIA 3A3XA 2PDUA 4NNAA 5IHSA 3CK5A 4M82A 2YBVA 4K8EA 4MHBA 3N6JA 2HVNA 1VJIA 3F4NA 1E4IA 3OO2A 2AAMA 3C0JA 3OBEA 5D05A 1TV4A 1N2VA 2XYLA 5IDZA 3BV4A 4HCLA 5CPNA 2BOGX 5CGTA 3UWYA 2BASA 1F3WA 2TSYA 1NAL1 2JQXA 1UP0A 1GOQA 1EO7A 4XO6A 5C2CA 3CGBA 3K13A 4FDCB 1BGGA 4ZOBA 1XXXA 3E2VA 4LFYA 4QITA 2A3HA 3PB2A 5BYWA 3NURA 1JOAA 1BF2A 3WL0A 1P4CA 3WMLA 4E3TA 3MUXA 3QQWA 3ZZ1A 4BK9A 2W61A 2ZCGA 1ZQ5A 3NJ3A 4GXWA 5JBEA 3BE7A 4L5ZA 1UH3A 4ZR8A 2FFCA 4QRNA 1Q65A 2ZE0A 2YIHA 4CU8A 1HGWA 1DWJM 4JTSA 4EMIA 3H2AA 3BTNA 4KWSA 3WLOA 3NL2A 3W85A 4EXBA 4IX2A 2GVEA 4TX8A 4IPJA 3PPFA 4C6QA 2G96A 4EAMA 3W1QA 3QHNA 1PXGA 1H51A 1DIOA 3DUGA 4PTVA 4CQBA 4NJKA 3C8FA 2W3RA 2VR4A 2X0HA 5DT7A 1T6MA 3NUKA 1YLVA 4I5UA 4APNA 2Z2BA 4WJXA 4GNKB 2OVLA 4O16A 1E0WA 4JFSA 2ZZCA 4DBSA 2PCQA 4P8WA 4IIFA 2VENA 1VFUA 2IQDA 3GNNA 3SSZA 5CZ0A 3BJFA 4Z1CA 5CXPA 3S42A 4H7ZA 4XZHA 4QSFA 3IIPA 4HGXA 1FKWA 1KRAC 2F84A 3MKKA 9CGTA 4Z0JA 5JQ9A 4XB3A 1L9WA 4TXEA 1CGYA 1NFBA 1DTNA 3A5VA 3GVWA 2CFFA 1P0DA 3UXAA 4E38A 4R7JA 2Y5JA 2YL5A 5EL1A 3PBUA 3CO8A 4HTBA 4LY4A 4HU8A 4IXXA 1C8VA 3ES7A 1OX6A 1YDVA 3P14A 5A6BD 5H8UA 3ZSSA 1MDLA 5ABGA 1XGEA 1ZY9A 3B03A 1SGJA 2A7PA 4OBRA 3N9SA 4LUSB 4H7VA 3LLXA 4QJ3B 4R9OA 1JUEA 3KM8A 3NQEA 1I2RA 1K8ZA 2G3MA 2ZWYA 4HU4A 5CPLA 4GUIA 4U2ZA 2GR2A 3E0FA 3H2EA 4H4YA 1LBLA 1MW1A 4OBTA 4MZYA 3N13A 4LAKA 5LA1A 1QNPA 1C7TA 4YTRA 1FO4A 4IUGA 3W28A 4IMCA 3FA5A 4I6VA 1E0VA 1WO2A 3VTRA 2DEPA 2IQ0A 4JTIA 3QY8A 4PTMA 3WG6A 3TTOA 3BH4A 4G1KA 4PCTA 5F2IA 4X2PA 4MSSA 4PUKA 1HJXA 4GOAA 1BWVA 2CEQA 1TPWA 1TWSA 3UCDA 3GYEA 4FF7A 4HHPA 3ZO9A 4LX4A 5I3IA 4HNNA 2E40A 3LD5A 4H9YA 4MLRA 1TYGA 4Y7EA 4ZOHB 2QCEA 4ZQOA 5ABHA 4WY0A 3CJPA 1X96A 3W1XA 4JN6A 2VZSA 4AFYA 1GPFA 3ZSTA 5CEWA 3M4HA 1TV5A 2P1FA 3S5SA 3HZ3A 1TIMA 4M6UA 3L4XA 4LUSA 1D2KA 2Y70A 5DY2A 2YZRA 4KWVA 3W72A 3PSWA 2DSUA 5XIAA 4KERA 3DX5A 1CLKA 1XG4A 1DYSA 1Q6FA 4QQUA 3AHYA 3NQVA 4JKKA 3RCYA 1MDRA 4QX4A 1V03A 2J7BA 1GV4A 1S5MA 3P93A 4O1AA 4JPGA 2D0FA 3PJXA 3UYCA 1GEUA 4DNAA 4YTUA 3VGDA 2WJFA 1K4HA 2QDEA 3QMRA 4RZ4A 3WX7A 1DTUA 1KQZA 4C6OA 1RCXB 2YXGA 4JFTA 1ZLPA 3G0XA 2FZMA 5FF3A 2IQTA 2PD9A 4JYDA 1DJQA 1Q5MA 3U4FA 2VFDA 4NUWA 1WDSA 2E5AA 1GRAA 1US3A 4OTKA 3W1UA 3IVTA 4BF7A 1E9ZB 2W54A 3H53A 3THCA 4GZJA 1HG3A 3S1VA 1I2OA 3DFSA 2CDUA 1U83A 3H23A 2DH2A 3VIFA 2BC1A 3T40A 2A3BA 2F6KA 4S3JA 3B0XA 5BXRA 1J10A 2VFHA 4ZTYA 1TPH1 1G5AA 3AS3A 1NF0A 1AH0A 1QO5A 4KEVA 1UOZA 2YZ5A 1QPNA 3SGUA 1F05A 1Z41A 3DC0A 2ACSA 4CGTA 5FMHA 3CQIA 1IXPA 3HV9A 4GY1A 1FXQA 4X22A 1FWNA 1C29A 1OYAA 3WH7A 1IHIA 2F5ZA 5HNRA 1VBJA 1L0PA 1TJ1A 2ICSA 3W00A 1J0HA 5HQEA 1XRVA 3QGAC 3PNZA 3R6IA 1KFBA 1XG3A 3MS8A 4ALDA 3V18A 3W0KA 2YAUA 3UWWA 3P0WA 1F73A 1EZ2A 4IIDA 2G4JA 1PS9A 2CHOA 3QOMA 4AEFA 4LAUA 1H61A 1D8WA 1I2NA 3ITXA 1F3EA 2ALRA 3W6MA 2Z1XA 3BAKA 3N4EA 3KHJA 3MZNA 3M5XA 2OZ8A 3SQLA 1JAEA 1HKMA 1KFCA 3FA3A 2CXEA 1R8LA 4NX5A 4Q7NA 1TQJA 3STEA 3OIXA 3ERPA 3OVRA 1AL8A 3O0FA 3A12A 3G8RA 4AMCA 5C9WA 4K38A 1H3GA 2WMGA 3VU2A 1U1HA 1HJSA 3HPZA 3SUVA 4EF8A 3FW6A 3MO4A 3VKCA 1WXZA 1BGAA 1PTGA 2VELA 1B54A 4WY0B 4H4XA 2ZXQA 4H1ZA 5JCNA 3TK7A 4HHLA 1XKJA 3KTCA 1UASA 2XIIA 2ZTJA 1XYCA 4CEUC 1UB3A 4GIYA 2NXGA 2WSPA 1E6ZA 1V4YA 3E6EA 2QCHA 3NEVA 1VFOA 3OYXA 1BXBA 3Q37A 5RUBA 1OSEA 3I7SA 4MUPA 1Q6LA 3UXKA 2TPSA 1XBZA 4IG2A 2B7NA 3MMWA 4UNLA 5B80A 1FEAA 4EACA 4MZ1A 4N9EA 1XYZA 2QDDA 1QI5A 2WQDA 2VYOA 1DE5A 1D7KA 4UOZA 3NDOA 2V67A 3W83A 1JUKA 3GNPA 1LF1A 1H41A 4PN2A 1W1ZA 2RDWA 4PMVA 3L5OA 1RXOB 1LQ2A 4XAPA 1C90A 3T78A 2F2HA 5FEWA 3NWRA 1ECEA 4NRRA 4OV9A 2GVLA 1A4MA 1JZ6A 3QV7A 4XX6A 1P6WA 4UTUA 5G5GB 4NJIA 2V6OA 4C6MA 1SO5A 4Q8PA 3G0SA 4C7GA 3W75A 3M07A 1Q66A 4NY2A 4WGXA 3GG1A 1H7RA 2QV5A 4EXAA 1E0XA 2PWUA 3MCNA 1WX0A 5E9AA 1J0ZA 2PDPA 1VF8A 4RKAA 1SM9A 4NZ5A 1H6VA 4Y9NA 3CZ8A 4NG3A 1SJCA 1VEMA 3SUUA 4P8UA 4GUGA 4HOWA 4MKNA 1OJTA 1JCXA 4AWUA 1AVAA 5BOFA 3UVIA 3W1NA 4C6NA 1OADA 3EAUA 3N18A 2B7QA 1ZMDA 1R5YA 6CGTA 1OINA 4GVIA 1XF0A 1FRBA 4Q8UA 4LW7A 4PBEA 4OHQA 4MPKA 1C92A 4YN5A 5T91A 3W70A 1G9HA 2VCAA 3B8DA 1XD0A 3W88A 3UY7A 3BLDA 1MQRA 4FXRA 1HP5A 4R7OA 2I9UA 3VC6A 2GUUA 3NQ7A 1NF7A 5I5RA 1JPMA 3L0GA 2E25A 2FJKA 1TFVA 4XAGA 3VIPA 2V2CA 2CZEA 2A8XA 5TIMA 3RDKA 2DU2A 4LVFA 3TC7A 4CD4A 2EBNA 4JFUA 1YMYA 5JRBA 4H4VA 1GVOA 3Q67A 4LA1A 3ABXA 4Z2HA 5I3FA 4LNYA 2DW6A 1GYNA 4N0RA 4LS1A 5I78A 3OHMB 1L6GA 4H4QA 1GVQA 1NOWA 5DT5A 2ZZBA 1GOIA 2Z27A 3RGTA 1IEWA 4XBKA 4PMRA 3GAYA 2POTA 2WCAA 3PN8A 3RUBL 1QHOA 3WNOA 3M0JA 1Q7ZA 3HGJA 1RPXA 3K46A 1EBDA 4GC3A 1DWHM 4LBRA 3EA1A 2X1TA 5A6SA 4M6PA 1GQLA 2GGGA 5XIMA 4K68A 1L6FA 1IR1A 3CHFA 1US0A 3NQAA 1Q6EA 4NRSA 1ZBKA 4XZBA 4DN1A 4C5YA 2HE8A 3AICA 2BY3A 1JI1A 1NWSA 1HL9A 2NX3A 5E6YA 3W29A 3CASA 1EYEA 3TYCA 4REQA 4GI9A 1BD0A 1RAKA 3UR7A 4Q33A 4F4RA 4MKVA 3MUY1 3WJWA 5BXSA 1QBAA 1KWKA 4OUEA 3TFCA 1R0MA 1E0TA 3MWAA 4L4PA 5AHMA 1XHCA 4PTWA 2YYUA 1HO4A 2Y5SA 5DCEA 2WJZA 3ETRB 2V3GA 1YX1A 3GIQA 3LPGA 3URBA 3IC9A 3GIYA 1OCJA 1A49A 4HMDA 3TC6A 3O7UA 2POZA 2VJXA 3FDGA 7PTDA 1VFTA 4YWSA 2QPUA 3CHVA 1FWGC 4FIRA 2J24A 5E5CA 2CBJA 5KETA 4UUIA 1PVNA 1LCOA 1SO3A 4J3XA 4TQTA 2HJPA 5HMEA 3OPSA 3CZJA 1KKRA 3HPXA 1RVGA 1OYBA 2OR2A 1JZ5A 3N2CA 3GDRA 3KVJA 2X50A 2XVKA 2G95A 1OFRA 4I5XA 2NQLA 2PZNA 1MXGA 4JCMA 1TV7A 6ALDA 3AC0A 3PVFA 2DSWA 3I4KA 1J18A 1KCXA 3VNDA 1NU5A 2QF7A 3M0XA 2BSLA 4WLCA 4AY8A 4V27A 4C91A 4G7EA 3TXVA 5A6BA 4I7WA 3EEZA 4ZODA 1TB3A 2W27A 1UKOA 2I9EA 3IJ6A 3E0WA 2VDGA 3ZLGA 3DH9A 4G5DA 5BRBA 3MKCA 3ZLHA 3FOKA 3AIUA 3GX9A 3LMZA 3Q65A 4FX8A 2P88A 2XFWA 1HO1A 4DELA 4FLQA 3PNUA 3HQ1A 3IAQA 3MMTA 4KRTA 4D8LA 4IHCA 2A2IA 5CBBA 2J9XA 3AMZA 3UERA 2QJNA 4QHRA 1THFD 3QFBA 3VCRA 3KLLA 1AMYA 1T8XA 1ZCOA 3A24A 3B3DA 1JCNA 4DNHA 1GRFA 4O11A 4Z1BA 3MSYA 5IFPA 3GUWA 4XWUA 4GKLA 1WKEA 2ZTKA 1NIUA 2X0YA 4ZE5A 1FY6A 2ABBA 1LLOA 3CS2A 4NAEA 1ZALA 1QNSA 1TVPA 3R12A 2FFIA 4W89A 3ABSA 4JTAA 1DBTA 1LM1A 3COTA 1RVKA 4U3AA 5LZLA 3GH7A 2C79A 3CB8A 3RITA 1O94A 2JKPA 3IJIA 2OXNA 4NHVA 2YB4A 4JQ3A 3AQUA 3SCPA 4DWSA 1PB0A 2OCZA 3AIEA 4GK8A 4KFOA 3KL0A 5DBTA 1LUCA 4EOUA 4QJ4B 3F2CA 1M65A 4A29A 5KSWA 1EX1A 2DZVA 3E12A 4J3WA 4KT2A 4LTSA 4RW5A 2E09A 3WD0A 4JEJA 3B9JB 1GEHA 4B9ZA 5I07A 4H9TA 5A8OA 1OD8A 3SGGA 4XBJA 2HSAA 4MB5A 3T7VA 3WL1A 1NWUA 3OB8A 2V2HA 1ALDA 2XUCA 2W6RA 3V1HA 3P7YA 2E3TA 4WK9A 3BICA 1YPXA 5D2TA 5TD4A 2GL5A 1SO6A 5A95A 3WQGA 1ELSA 1ZS2A 4JDYA 2JGYA 4B5SA 5HJYA 1XLBA 3ARUA 3IWPA 2HEJA 1M7PA 1R2SA 4O4WA 3DK4A 2XVLA 4AVOA 1FWDC 4EQXA 3PTQA 2XZ7A 1QAPA 1W3LA 4YWIA 4IJCA 1JD7A 3WF2A 4XD5A 1H2JA 1EQCA 2J9ZA 1KD0A 2XVGA 2CHNA 4Z2JA 1UPMB 4F0LA 4DF0A 1E55A 1NP2A 1FFUC 1SZEA 3AOFA 1WKFA 1HJWA 2XIBA 1UJPA 1CENA 4GGHA 4QDMA 4FNPA 4B5XA 4X3ZA 2DW7A 1Y5WA 2WVSA 2R1NA 1W1YA 3U7VA 1R2RA 4B3KA 1VAHA 2XSXA 1LQAA 4D8AA 4Q8WA 1TJPA 1KTBA 3LXDA 4ZO8A 1GGOA 3C86A 3IARA 1H7PA 1MI3A 1CECA 2INZA 4DM1A 2X05A 1LBMA 5U1OA 3DGHA 1MEIA 4UZSA 1KV5A 2VO5A 3SFWA 2WOQA 2CBUA 4JN7A 4WKAA 1J0KA 1FWAC 5F2MA 5E09A 4H4UA 3MBDA 3DBPA 4V15A 4J28A 3VNJA 1UZ4A 1ONXA 2D73A 1K7XA 2JK6A 2X8GA 3L9CA 3AIWA 3L2LA 3R94A 1OF6A 1IWBA 4JL1A 4L64A 4B5VA 4MDOA 4YTQA 3WLRA 2JKAA 3O3RA 3SRDA 3NO5A 2WLYA 1J93A 2I14A 1GONA 2A5HA 2EQ7A 4ICNA 4LCRA 4QXIA 3T55A 3V7PA 4YVPA 4GXPA 3UZXA 4JNZA 3USZA 4DZIA 3R25A 3FFSA 3V36A 4RL3A 1ZMCA 4IL0A 2AAQA 3WNKA 3NQ8A 3TN4A 3IS4A 3WH5A 1AW1A 1AFSA 3B8TA 1POJA 3EA3A 3ARYA 1WDQA 4KW2A 4H8NA 3MVTA 5JH2A 1HKJA 4GYKA 1Y65A 1XH2A 2DFAA 3LERA 1ZRQA 4D1IA 2XN0A 1XM3A 5AC5A 4LOCA 3WQEA 1E72M 2GQWA 1FCVA 2ZRZA 3LPOA 2HNHA 2WSYA 3LCHA 1DIKA 2OT1A 3AWNA 3WMBA 3BG3A 3BQ6A 1R9ZA 1JDAA 2VWSA 3M0KA 3UYIA 1GRGA 3S46A 4IISA 3O07A 4OOZA 1EEXA 1JQVA 4NZJA 4FB7A 2CBVA 4AD2A 4K8DA 5JCKA 1RCOB 4DJDC 1VZWA 3IJ7A 1LLWA 4PGLA 5KVIA 1VEOA 1L2QA 3ZM8A 8A3HA 4CQCA 1XISA 4KFNA 1FX6A 3CLMA 3DZ1A 1TX2A 4NXKA 2OT0A 1EA9C 3LZ3A 1LUCB 1XLJA 1ZDLA 2QR6A 2YA2A 2Q09A 4DLMA 4IL2A 1NARA 1NM9A 3O6YX 4AH7A 1SFLA 1V93A 4LYQA 4GYPC 3P0XA 5I77A 2F61A 3FXGA 1FWWA 3L5AA 3SCUA 2O9RA 1AK5A 2GJPA 2DV0A 1R9XA 2PTDA 3BCFA 3O0KA 1DXFA 3CYJA 3SCTA 3KBSA 4QJ5B 2JFEX 1TR9A 3ATZA 3GNOA 5TBOA 3SRHA 2X09A 1DV7A 2XU2A 3A6OA 3NFUA 2YCIX 3BAYA 3CC1A 3EDFA 1TWDA 1GRHA 3MTWA 4BEUA 2GQ9A 4GACA 4BFAA 2DZBA 3CQHA 1WDPA 1NJJA 4V1XA 4IGNA 2Q02A 1V0NA 3UW6A 3UF9A 1HP4A 1VC4A 1OFEA 1A0EA 2OLAA 1QHZA 4EVZA 4CVWA 4X63A 3PAJA 2PRMA 1GZJA 5I3DA 1GW9A 3NA8A 3DHDA 4W8LA 5CPMA 4AZGA 2O56A 2I5QA 3LNPA 5FI8A 4HYWA 3O2LA 4YHEA 1JPDX 1PO9A 2WC3A 3VOJA 5KVHA 2QCNA 5CZSA 2EKGA 2Z29A 3W1RA 3FV9A 3NNTA 5BWAA 4Z0SA 3M1ZA 2EJ1A 3MA8A 5ABFB 2PFHA 2UY4A 4BY3A 4IMFA 1W8SA 4HQVA 4I3GA 3PJUA 3I65A 2XGBA 2EQ8A 1UG6A 1W37A 4W88A 2WHMA 2HE5A 5JMUA 4EPBC 4NIRA 4UQ9A 1UD2A 3EPOA 3W1MA 3IGHX 4MB1A 2BHYA 1Z48A 4XD4A 3G1FA 7ODCA 3A9IA 4UC5A 4D6JA 3WH9A 3SY1A 3QSRA 1QNVA 3ITOA 4AVNA 1PIIA 2FKPA 1A5CA 3I7QA 4O1CA 3DERA 2E8ZA 4H4SA 1X1NA 1MRQA 2W4XA 3ZWTA 4CNSA 4UBPC 4BR1A 1LBFA 1XKYA 3OYZA 2WANA 4CNOA 5A6MA 3IIZA 2VKZG 3GZ3A 4ZXLA 2WP6A 2HNEA 1PDZA 4XUYA 1UH2A 4V2XA 1J5TA 3KRZA 4GBUA 5AECA 1H7XA 1OCQA 3EZ4A 1KW1A 4U31A 2W62A 3TN5A 4L7ZA 1K7FA 4KIRA 2A7RA 3A7UA 2OWXA 2IXVA 4DBEA 1E70M 1UR4A 5HINA 9XIMA 4ATLA 1QU4A 2W79A 1CGXA 2FDSA 3N17A 2ZZ0A 1SVDA 4I8YA 1NOFA 1K4GA 1DJWA 2BVYA 1GQKA 2Z1VA 2XM2A 1Q8JA 2RKXA 3EB3A 4RXGA 4J3UA 3VZYA 5EYWA 3AXKA 4C5ZA 2QGHA 5AC8A 1AJ0A 4M8UA 5CPOA 1H60A 3LMYA 1D8CA 4CNPA 4WEVX 1H62A 1XYLA 4OUIA 4HSHA 4KBXA 1WPCA 1X97A 4LS0A 4G7FA 4KCVA 5ABEA 3EX6A 4K36A 4BEQA 2PWGA 3L66A 2QMKA 2A6NA 4L56A 1IYXA 4K7ZA 2YL6A 3GU2A 2R9ZA 3U2EA 3DDMA 1YADA 4LC6A 3HPAA 4Z08A 1WOBA 2CCRA 3TJIA 2JE8A 2W66A 3QLLA 2WWDA 3T07A 2WJDA 4MZ8A 3UWVA 1PX3A 3M5YA 1UQYA 5A6TC 2VHLA 4HK7A 3W9ZA 2G8ZA 5D9MA 4KQNA 1JULA 4QFUA 3LCIA 3O9NA 2C0HA 4MGGA 1GOWA 2J66A 1N60C 1HFBA 4PCSA 3THAA 3VGEA 5CCZA 3VE9A 4OV4A 2QAPA 4AX6A 3QMTA 1GQIA 1AD4A 3S9ZA 2GJNA 2QAEA 3KBMA 4EP8C 3WLSA 1ISXA 1JFXA 1TKKA 1VS1A 7REQB 1C91A 2ZUNA 1TVLA 3L4VA 4GYPA 3DESA 2XH7A 1GKQA 1R3TA 2A3AA 4FOUA 1Q85A 2V82A 2A3EA 4ZMGA 5K7JA 3LSCA 4XKMA 3SIZA 4GUFA 1XX1A 3FJNA 1S2VA 1RA5A 7ENLA 2C14A 1XLHA 2P5NA 3RR4A 1XPGA 4UTKA 2FZ8A 4H8HA 2GGHA 3C8NA 1ZSXA 3NRZB 1VRDA 1YXDA 5EMMA 4LIIA 2WO5A 1WE5A 1MFVA 3NQGA 1JQXA 5I79A 3W81A 2AKMA 3NDYA 4D72A 3W01A 5G5HB 1LWHA 3FKKA 3HG5A 4UFIA 1IEIA 3QXBA 3R8GA 2BWGA 3URQA 1R38A 4AHOA 5M2FX 1UKQA 3LK6A 2XTKA 2OSWA 2GGJA 3V0SA 1CNVA 2DORA 2VZVA 3RCMA 5C9UA 2YW3A 1LT7A 1EBGA 5CLWA 2AMXA 4AEOA 1ME9A 1HKWA 4JQAA 4JAWA 1FP9A 3QHMA 4WKHA 3NM1A 3QV8A 2NQ5A 2V8ZA 1ADOA 2A79A 5HUPA 2I1OA 4CKQA 1K9EA 4S3FA 1VHNA 2Y63A 2YB1A 4ATWA 3WIJA 4C1NB 2PGWA 1WQ5A 3VA8A 1IIHA 3G77A 1REQB 1WAUA 2PZ0A 3UZZA 3V5CA 1OC7A 4WDTA 3MY9A 4US5A 1KXTA 1QI3A 2FGBA 5CG7A 3R7MA 4PUMA 1IR2A 3TLQA 3NVVB 1JZ3A 1OBAA 3HIJA 4HA1A 5I0DA 1VPYA 1ONWA 1Z8AA 1M1BA 2AQVA 2QUVA 2ZVIA 5AKQA 4IFOA 4JD4A 1OC6A 4MTVA 2PAJA 3B0VC 2CLMA 1ZGDA 3PUOA 4M24A 1DJGA 2NXHA 1P6CA 2HVOA 1F8IA 2JKEA 3VKBA 1YDNA 4XZ9A 1V79A 1LG2A 2CERA 3H26A 4FNUA 4JTJA 5LHFA 4JL2A 4CCEA 2FZ9A 3UD6A 3H7UA 1PYMA 1RR2A 3L2IA 2X42A 2WJEA 4XISA 4IQLA 2PP0A 1YHTA 1UIOA 4E5TA 3UJSA 2ZYFA 2VC9A 3S83A 5DMNA 2QLYA 1AZ2A 3CZKA 2I56A 2PDYA 2O92A 4TV5A 3N3MA 4DRSA 1AD1A 2EPMX 3PZVA 4FAMA 3M41A 4WDXA 3P62A 2F38A 2ZUMA 4HNVA 2Y62A 5DRCA 4EX4A 2P10A 1EB3A 1GCYA 4NJHA 3GXFA 3ONCA 3GU9A 4MNJA 4JKLA 2F6UA 5AHNA 4R33A 5LNVA 4B5WA 4LS2A 3MI3A 3OEXA 3BCJA 1UMLA 3ALGA 1RJRA 3HGSA 4NAFB 2PDCA 4FLRA 2AGTA 1EL3A 4MJMA 1OM0A 5HULA 3ZR5A 2C19A 1RQHA 4HU3A 4AYGA 3F03K 4IMEA 4JQ4A 4MFDA 2E68A 3SR6B 1A5BA 4B5UA 1RZMA 4CU6A 3SGZA 3V0UA 3TJXA 2EPNA 4QEEA 3TDFA 4W7VA 4IFRA 3GKAA 4PUUA 4KPLA 3KOWA 3ZXWA 2DVUA 3FYPA 4Q7IA 1S1PA 2DP3A 1T99A 5AOUA 2A21A 1I6NA 2ISWA 1UP2A 5DELA 3VZXA 2OLSA 4LF2A 3NQ6A 3WEMA 3TYZA 1TRDA 2DIEA 5A6JA 1QK2A 3LGEA 1UCWA 3U2ZA 3C56A 3KCJA 4K3ZA 4YS1A 2PCEA 3TZNA 3WBAA 2P3EA 2G3JA 4FEZA 4PMYA 2RHGA 2W0UA 2G41A 4R85A 5FF0A 3EEGA 3VINA 1A5NC 1J96A 3DCPA 4WCJA 4A8NA 5CH9A 1FH7A 3EOEA 6XIAA 4FR6A 3TOYA 3QPYA 4PUEA 1W5OA 3W2UA 4IH3A 5G2WA 4LANA 5HQLA 4Y6GA 3G1RA 3W7QA 1TTPA 9XIAA 1ZAIA 4RPQA 4LYKA 1PWLA 5MF5A 3VNLA 2QZRA 4PRRA 4MYXA 1ZJIA 1OJXA 2BHZA 4GQGA 3LG3A 1XPYA 2D69A 2CC0A 4NYYA 2W55A 4JS3A 4X9YA 1XP3A 3MUZ1 2J78A 3BLLA 4UTTC 4POCA 1R3YA 3QRHA 3ANVA 4ZO6A 3VDBA 1TYTA 1G7VA 4BWLA 3TONA 1U2YA 3R4IA 3RPDA 3CMFA 3C3UA 4BV6A 4AIUA 1GTEA 1ZU8A 4R5EA 3W02A 4MAZA 5FL1A 1J0IA 2VC6A 3L23A 1WYIA 4YYFA 1V3HA 4J7RA 4MB4A 3K4AA 4PUWA 3W25A 3WDQA 1XW8A 1V08A 4O8AA 2PRHA 4DI8A 3G1YA 3MO7A 4L6DA 1NWTA 4S39A 3UJFA 1FHDA 1NQKA 1JI2A 3MWCA 4F66A 5K2ZA 2CPUA 3QVQA 3IIXA 3TFXA 3AJ7A 1A5UA 2CLOA 1UD8A 1XGZA 4ZFCA 2Y7DA 3ZT5A 2DJXA 2PU1A 3DJGX 1XDIA 3E5BA 3T1GA 3UWZA 3SN4A 1JCMP 2PC8A 4QG6A 2ZBTA 3RLHA 3U57A 5F1VA 1IE7C 3P3BA 2G3IA 2D2GA 1W1VA 1W9XA 1FWTA 2C3CA 1WBHA 2NLYA 1V59A 3EX3A 1UUQA 3QSTA 4JIEA 1Q7QA 2EF9A 1KO0A 2BX7A 1X7IA 3THQA 2DZAA 1YQ2A 1YDOA 2PGEA 1W1B1 3IGUA 5D2YA 3TYUA 3S9IA 4ZQCA 1LWIA 4KEUA 1W31A 4DUVA 5DANA 4LGXA 5LNWA 3CPUA 4YHGA 1R3VA 4RX0A 1H11A 4Z2GA 4MWAA 2Z7GA 3KL3A 4O54A 1V7AA 2V3FA 4NAEB 2VP8A 1EFZA 4AZ6A 1EJXC 3DN5A 4BWLC 4Q3MA 1G67A 3DAQA 4RE3A 3MI2A 4F9JA 4L1WA 3PTMA 2Y85A 2DY3A 5BROA 3CUJA 1H7WA 1YNQA 3M7WA 2ACQA 4TU1A 1XYMA 3WD2A 1XICA 5F2GA 1WYGA 1OX5A 4H4RA 1IT8A 1KNWA 2PA6A 3E38A 1GOOA 3WBEA 2QIWA 2XVPA 1EOKA 5IBXA 1JZ4A 2F9RA 2WC4A 4LU0A 3RM8A 3FKRA 1W1PA 3F4VA 4N6EA 4Z1YA 1ZK7A 5EY5A 2BHUA 3TW7A 2Y5EA 4BQ5A 2J9YA 5ER0A 3HQNA 1XGDA 4EM3A 3PY2A 1WAWA 4ATDA 1N8FA 1K8XA 3VNMA 2YA0A 4G7EB 4LUYA 3ARVA 2B7PA 3WK0A 4W4QA 3ICJA 1RHCA 3GHUA 1SU5A 2IPJA 1K8CA 3VYLA 4Q8MA 3VIJA 4NZFA 4PZVA 4RZ6A 4U3CA 2V81A 5EMJA 5FS7A 2RJHA 5HXMA 5E0KA 4IT1A 5AN7A 1IWPA 3C52A 4HNCA 2WPBA 3ZS4A 4IPPA 2C1GA 4W85A 3LA4A 4P8XA 4YTTA 5D2WA 4GIRA 4NX0A 4HCHA 1Q2RA 2PDHA 2W67A 3WK1A 4RNFA 2OEJA 1HIZA 2WW5A 1GKRA 4D2JA 4U5KA 3CUXA 2C3DA 2ZC1A 2R1MA 3PWIA 1UZ1A 4QCEA 2OEKA 3KTSA 1M7XA 3OGRA 5DF0A 3GR4A 2OEMA 1BFNA 3GDLA 1IT0A 3QEZA 3LCGA 5FL0A 4IX0A 2AL1A 3O16A 3GXTA 4RJEA 3SIMA 3V16A 4V33A 1SR0A 3VM7A 1XYAA 2J3NA 1PJ9A 3VKDA 2D24A 1E4MM 1V3MA 4Y8EA 4JIQA 3DGBA 4RZ5A 2J13A 3G0UA 1GK8A 5FS6A 1BYBA 4NP7A 4KGJA 3ZJ6A 2H90A 4FHAA 3IK2A 4S1FA 3ITCA 4Q4QA 5T8GA 4GYJA 3SCWA 3KWSA 1VYSX 2WVVB 2OJPA 4GD0A 2Y8VA 3R89A 1Y0EA 5DMYA 4ADTA 3GTFA 4TVCA 1SW7A 3EDKA 4S23A 2UY5A 4Z1AA 1OG6A 2BV9A 1L8NA 4GO8A 4BI7A 5C55A 3VDGA 2PDGA 3O15A 1NWRA 2KZHA 3SCQA 3KBJA 2PDKA 2DVXA 1V6TA 3ABQA 2AMGA 5A69A 3NDZA 4UZUA 3GO2A 3FJ6A 3UY8A 3EA2A 1G7UA 1P0BA 3QQ0A 4GIAA 4PUJA 4NNBA 3FVMA 3EPMA 1Y7VA 3VKAA 4N9BA 2NWRA 4QDPA 3VI2A 3WD1A 4HMCA 2NSXA 3SRKA 5CGMA 5U4NA 3R0KA 2VEKA 3PG8A 3QBUA 4I7UA 1UYQA 4FLOA 1DIDA 4HZ8A 1ZY8A 4PMZA 2O9PA 2UY3A 5DCBA 2VFIA 1IF2A 3EX1A 1CCWB 1S5VA 3WF1A 1MNSA 2CZVA 4ROPA 1TA3A 3GTXA 1OF8A 4TO8A 2RABA 2GWGA 2X41A 1B0IA 1ZAHA 1W56A 3PPHA 4LUTB 3VMNA 4FR1A 4QDWA 3HN3A 5C9RA 3GVQA 1Z3NA 3TXZA 1JYWA 3VX0A 5GNYA 1FCUA 1MZRA 3WKZA 2VOTA 5CSSA 3LHWA 2JGQA 2YYTA 4DPPA 3S1GA 1W3NA 2NSOA 5HPOA 4R27A 1XUUA 3BLFA 5JVLA 1A0CA 1QASA 3W1PA 3PTKA 1EJ7L 4ZTXA 1A53A 3DXIA 3VDCA 4O52A 3PJWA 3RN6A 2VZOA 4H4WA 4PCNA 3RAOA 3TYBA 4OE7A 4GNVA 1W1TA 2VGFA 4WOZA 3TTEA 3KLKA 4OKDA 2V3AA 4O10A 3P6LA 4D6IA 3UQNA 2WMHA 5EBAA 4GC4A 4FK9A 4YPJA 1WDDA 4AC1X 3FA4A 4JICA 5AHIA 3MYOA 1M01A 2ACUA 3ARZA 4PSPA 2YCJA 3ITGA 4WDWA 1MW0A 3EMCA 1KCKA 1GRBA 1UR3M 1EBHA 5AYXA 2NUYA 4E6MA 4LVBA 2DPEA 4JIPA 4LEQA 2XFYA 3OTRA 2HS8A 3B9NA 1OG0A 4GHRA 4Y9AA 3B97A 1WV2A 3ARSA 5CSUA 4Y96A 1OFAA 2E9BA 1IZCA 4IP5A 1LRQA 3C0QA 2BVWA 4YWOA 2PWEA 2QF8A 1QCWA 2V5BA 3NSXA 1R46A 1XCFA 3WUGA 4H9MA 2H9AB 4FF5A 1V6WA 1MVYA 3I68A 3I6RA 3EYPA 3NQ2A 3CB3A 3PAOA 1XUZA 2Z2UA 3S6DA 4EWJA 3BGAA 3CV1A 3AU2A 1EDGA 4NKCA 2PTXA 1NHPA 2GGIA 3ZVIA 4H8VA 4PTDA 1CDGA 1ISZA 1E1CB 1P43A 3DHUA 4JIIX 5U25A 3GIPA 1R2TA 3ENLA 2Q6ZA 3VD5A 4Q4PA 3TAOA 3CHDA 1NY1A 1R3RA 3ZFHA 1IZKA 4BQ4A 3H24A 1A5LC 1HVQA 3WBXA 2Y0FA 4RCXA 4HMEA 2PWFA 4PBFA 2PTYA 4LBUA 1Q6RA 2UZ9A 4GI4A 3UNTA 5GVJA 2NPXA 3N9KA 3ZJ7A 1EC9A 1R7AA 3U8GA 5C70A 4DXXA 3E3HA 1XD1A 4UOJA 4GQQA 4U5IA 1T41A 1JRCA 4FIQA 4JR5A 5GQBA 3SCSA 3WO8A 2H3BA 1E40A 4L61A 4LUJA 4CVUA 3U48A 2VD8A 3AMKA 4P7OA 4N7QA 4ZB5A 3WLKX 4LNCA 2VFGA 1GOMA 4XAZA 4YIWA 3A9BA 1VFSA 1B3ZA 2P3ZA 3JS3A 1EGVA 1GJUA 1TMLA 1LTDA 4FS9A 4R7WA 3QHOA 2DIJA 2PI6A 1DWAM 4M81A 4H9XA 3K8KA 3AS0A 5I7GA 3GD3A 5FJPA 3MCMA 3KXQA 2OZ0A 3UWQA 1VQTA 4UMBA 3W1LA 5FAJA 4Z1DA 4YCPA 3TW6A 1DEDA 5HJLA 3WLHA 1U5JA 4KCWA 1ICQA 4TX9A 2QCCA 4FOJA 3W7OA 3L5LA 2VEPA 3ISIX 3GB6A 4Y9PA 4LQ1A 3SUWA 5FS9A 4S3KA 1BG4A 4EK7A 4GCAA 4O1DA 4U4MA 4J3TA 1GG1A 4X61A 2PBGA 2QXWA 3TN3A 1RM6B 1ITXA 2E5DA 2E67A 4HK5A 1RBLA 1K3UA 3O06A 3WH8A 3LNMA 5AHEA 3WQWA 4GINA 4DLFA 2EQ6A 4PCFA 5C71A 3N11A 3W2NA 3UZJA 3H4XA 5L6UA 3JUGA 3KS6A 1S7MA 1RD5A 3I4EA 3DYOA 4H6KA 4JTEA 1JYNA 1EQPA 3KVLA 1UWUA 2WK2A 4MPQA 1E9YB 4KH2A 1ML1A 5C2GA 5J5RA 3UR8A 2WC7A 3GXNA 5DX7A 2OQHA 3QYQA 3B9OA 1P1MA 3GG0A 3VO0A 3EXRA 4MAVA 1FHUA 5FSEC 2ZA3A 4IFKA 3R07C 1E0UA 1XDMA 4ZB2A 2Z00A 4IQJA 4FALA 1ZP3A 1S2AA 1B31A 3RFAA 3RNDA 3RX3A 3N73A 4XUGA 2OFJA 2Y7GA 1TJ0A 3B0UX 1HZYA 2J62A 1IIGA 2AQWA 3DH7A 1JL8A 4WOQA 5I06A 1X6UA 3CH0A 4MWAD 3KOFA 2BY0A 3VCCA 5GJPA 1GPWA 4MKSA 2R9RA 3UR5A 3S5YA 3PM6A 3F4WA 4EE9A 3CPRA 3BK0A 4QG8A 1DKWA 1E71M 4L4OA 5CPQA 5G2IA 4MY9A 3TSBA 3E1F1 1OQFA 3RXZA 1K9TA 4AD3A 2PDIA 5EBUA 3A4AA 4FXSA 4CQDA 3BOLA 4CD8A 2E28A 3W23A 2V30A 1ZNNA 3OIHA 3W86A 4UXDA 2IKHA 1NDZA 2HS6A 1MYRA 1XIBA 2CESA 3LB8A 3PWAA 1VFHA 3ARWA 3VOHA 1FWIC 1D3CA 3CGTA 1HKVA 3KFTA 3CWNA 1WZMA 1M5WA 2NWSA 2PLKA 3W37A 4S2CA 3NS1B 2VFEA 4GRSA 3F4CA 2ODOA 3ES8A 3SM0A 5CJ5A 3LM7A 2PP3A 3QY7A 2GWNA 4JXCA 2ZUUA 4RV8A 3H2CA 1W3KA 2ZZ2A 4HNUA 2VRQA 4J3VA 2FTWA 1PTAA 5M3WA 1HF6A 2Z28A 2Z2AA 1A5MC 2E6YA 4TX6A 3ZT6A 1GUVA 1X98A 1U5VA 4KIEA 2RFGA 4MFEA 1L6YA 4HOZA 2WPFA 4BURA 1QW7A 5TR3A 2HK1A 1DXLA 3HJEA 2WVUA 3VIHA 1SO4A 5C8BB 3SSJA 5K4ZA 4DHGA 1I60A 5H6HA 2CBIA 3NYDA 7XIMA 5BMWA 3WDPP 3LGDA 3URHA 3SEPA 2NVAA 1OYCA 4DZHA 1S2UA 3WFLA 2H3DA 2VC7A 1G4TA 2TPRA 4HHMA 1PCKA 4E2DA 1JGIA 2IW0A 4K37A 2NQ9A 2PDMA 3EDJA 1XLKA 5KZ6A 2MANA 3QC0A 1TTIA 2WNQA 1KV8A 3SO7A 3DOPA 3JVAA 4A4AA 4H19A 3PUDA 5JCMA 1H5YA 3OC4A 1DQXA 3P8IA 3CYVA 3KBVA 1LOLA 1ECQA 1XIIA 3BAIA 1XS2A 4NL1A 2BGQA 1RLDA 1A5KC 2XN2A 1OFQA 1RBOB 5FA5A 4RE4A 1W54A 3A4JA 2FIQA 4OIFA 4ZGYA 4BS0A 5LIUX 4JY9A 1MW3A 1VFLA 4S38A 4HSOA 4X2RA 2D0GA 2A3LA 1NDYA 4PTNA 1KGUA 2C13A 2WZHA 2C7FA 3P80A 1OFPA 2BZNA 2BMBA 2OTDA 1JNDA 4AEEA 1G4EA 1NQ6A 5HDRA 3STGA 3HF3A 1ONFA 3XIMA 4ENLA 4XD3A 3GFYA 1QDSA 1P7TA 2PC4A 4AXKA 4NZ1A 4F79A 1F7BA 5A94A 3LXBA 4DUXA 3GNDA 3WLIA 3ITVA 3OBAA 1R47A 4J27A 4UIOA 4LB4A 4QAWA 2CLIA 1XIHA 4JX5A 2XINA 4H6QA 2ASHA 5LIKX 4JGDA 5CGQA 3M9YA 3DGRA 4ZZ9A 3POCA 4BZYA 1JIBA 1TV3A 3FAXA 3N04A 9RUBA 1P0EA 4OOUA 3TTQA 2ZADA 1Z7AA 4QIUA 4J3ZA 4M52A 3DKJA 1EIXA 1AQMA 5K3VA 4DZ5A 1WZKA 2WMFA 1P5BA 2ZUSA 4FI4A 2Z0IA 1HN1A 5HA7A 3ITLA 2J27A 1UUMA 1V02A 3S3GA 2J4GA 4Q7BA 3BVJA 1F8WA 2WYSA 2BOFX 3CV6A 1SJDA 3QR3A 2VEIA 4IM4A 1SYTA 1X8FA 1BPLB 5AZ0A 2VZUA 3DC8A 1KLYA 2WMKA 1UHVA 3C0LA 3MP5A 1YE4A 1VCFA 4HNTA 2EEXA 2GOUA 2Q8XA 5BW6A 3DYPA 3NCOA 5I02A 3FCPA 2CZFA 2VVNA 3IJ9A 4UR9A 2PDQA 1MXSA 4HP5A 3LZ5A 3T4CA 3H2OA 2Z7KA 3YPIA 4O17A 2X8RA 1BYCA 3H7RA 4ILSA 1YBQB 5XINA 5AYIA 2IKIA 4WRHA 3AUJA 4EXQA 3A5FA 2VOMA 3WQOA 5HNTA 2FHBA 4MWAB 4S3BA 3DG6A 2GSHA 3V75A 3BGGA 2WZTA 2HK0A 1OX4B 3GC5A 3SN0A 1C3FA 1UJQA 2QJMA 4LC8A 2HRWA 1YKWA 1W5NA 2J88A 1T3QC 4FX7A 3HPSA 2BODX 1D3HA 4H4TA 4AZCA 7A3HA 1QW9A 3BQ5A 1TTJA 5FAGA 1CGWA 3SY5A 2DZWA 1M9HA 1YTKA 1QFEA 4I7VA 1R3SA 1LROA 3WQ6A 4C6BA 1XHGA 3AHVA 5ABTA 1FH9A 3C2RA 2WPCA 4H04A 1E73M 2Y88A 4IOTA 1X39A 1K03A 2EHHA 3LTPA 2OU4A 3GW0A 1EXBA 3RYSA 3NSMA 3UPWA 2NQJA 3QPEA 1PIGA 4JCLA 3IIOA 3D47A 3S0CA 2O9OA 3H4WA 4F0KA 5H91A 4GH1A 1GVRA 4UQBA 3CZGA 2WKGA 3BC9A 2ZZ4A 4AZCB 5I3HA 4IPIA 3TU9A 3WFAA 4GX8A 1A80A 1X7FA 4IPLA 3RU6A 2UBPC 1OEPA 4LUTA 3M0IA 5AC6A 1ZENA 3L65A 2PDNA 4DUWA 2EJAA 3W7PA 1IV8A 1J6PA 5BZAA 1T40A 4KF1A 2FTYA 3UJ2A 3F1QA 4S3CA 2OODA 1ZX9A 1AJ2A 4LWWA 1S46A 2WMIA 1Q6CA 1WCGA 3GE7A 4PMUA 4QSHA 4UQDA 4KMQA 4TR9A 1JYVA 2VRJA 4ECLA 3BLEA 4JTQA 1XH0A 4AIEA 1Z9AA 2R82A 2PRLA 1VPXA 3TMLA 2PDJA 4OBSA 1GJWA 2YQUA 5D38A 3W24A 4CUCA 3MZ2A 3ALFA 2KAUC 1MQPA 2V5KA 2NT0A 1H2IA 2PWVA 2ONEA 5C2XA 4GVFA 2YCEA 3T81A 4KS0A 1QNOA 1D7FA 1BQGA 4DYJA 1BYDA 5I03A 4KEMA 1TPFA 3GM8A 3O1NA 4E8CA 3LPFA 5CKSA 3FAWA 1GT8A 1UIPA 3I3EA 3N2MA 3D6NA 5D03A 4MM1A 1EH9A 4G6CA 3HQOA 3W38A 2AL2A 5EMYA 2YDSA 1SZFA 4UFHA 3UVAA 3PZOA 1F3TA 1U33A 2QGYA 3SDOA 1MXDA 4H6RA 3WF4A 4JIRA 2INEA 2BGSA 5DBUA 4M1RA 4AIOA 1UR8A 1MEWA 1HL2A 3EOLA 4KRUA 4NAFA 1W1A1 3GUGA 3UXDA 2ZFAA 1EDTA 3VKJA 4Y8FA 4E2VA 1GERA 1QNRA 1TMQA 4H2HA 4ERIA 1CBGA 1GVSA 2PTZA 4IMAA 1DWIM 2DH3A 1KFLA 3H2NA 2AQOA 3GBDA 5E70A 1E6NA 3NM3A 3CWOX 5CAKA 3R2GA 2VMFA 4MJ2A 4XTIA 1QVBA 7TAAA 1G6CA 2G3NA 4H8UA 1KM3A 4PE8A 1QI0A 3THDA 3FK4A 3CUIA 4ZO9A 2B81A 2DGAA 5H8MA 4EQWA 3B9EA 1H09A 1NSJA 1H5VA 1UA7A 1ZJAA 4CD6A 1H49A 3IJLA 5HANA 1R30A 2FVLA 2G5WA 3VD3A 4FNTA 3T8LA 3AXHA 3UPBA 1OCNA 5BU6A 2Q3OA 3DG7A 1BWCA 2IPFA 4NQ1A 5EMKA 1U5HA 3M0LA 2VEMA 2RAGA 4TMBA 1E51A 1XYBA 1S1RA 2Q71A 3EB2A 4PA8A 4NJGA 4B15A 2GH5A 2VX6A 4DJFC 1XQLA 3LM3A 5G4WA 3RILA 1ZJBA 1VH7A 2NQZA 3V1PA 4UQCA 4ZOCA 5EU9A 2YX0A 1U22A 1DQWA 1UKPA 2WVVA 3KX6A 4Y90A 3HB9A 1W3IA 2WKLA 4GYFA 1TX0A 3VNYA 3EPNA 2CLKA 4YCOA 1UZDA 3CMGA 5GNXA 4FX9A 1MMFA 1JF6A 2DZSA 1OHLA 4MWAE 4RXFA 1RH9A 2PWDA 5GPRA 4MLJA 5HWNA 3N4AA 3AO0A 4JDRA 3FGCA 4PC8A 1VP5A 5DQPA 2H8ZA 3CZEA 3NPWA 3O6CA 2FLIA 1YXYA 5I00A 4O28A 3TQ0A 4BA0A 3T8QA 2Y1HA 4PH6A 4E4UA 2XN1A 2YCLA 4J5NA 2GJXA 2QCDB 2PDFA 3IANA 3VDAA 3NGFA 4UR8A 5IRPA 3WUBA 1LPFA 4KESA 2OWWA 1YQZA 3UXIA 4YL2A 1X38A 1BVZA 4DXKA 2WOVA 2WPEA 3NL5A 1B3YA 5DY3A 4XZMX 3C4UA 1RA0A 3LENA 1W32A 2OYLA 3IAPA 1OC5A 2IXUA 3WENA 3CL7A 4WQ6A 1NDVA 1LORA 3CGDA 1NHRA 3L67A 2YBTA 2X1UA 5HPCA 3FYOA 2R91A 1OD0A 4JFVA 4QS5A 3TVAA 2Q01A 3AMCA 4N6FA 2HPMA 3C0SA 3CIVA 2FPTA 4Y9OA 2E0PA 1M6IA 2PTWA 1J01A 1XANA 4ACYA 3VNKA 3JZEA 3N6HA 4JQ9A 1KWGA 2C8NA 2ZRUA 3WCZA 3EUB3 3SQPA 2E4TA 4L6OA 2QHAA 3MDWA 3K8MA 3L5MA 2YVGA 2V5LA 1FCBA 3QV6A 5F4XA 1BSLA 4WX2A 2FHFA 5HOSA 5J04A 3MV01 3FHAA 3PPCA 2OX1A 1J79A 3U6WA 3NZ1A 1GKPA 3IRDA 4GZEA 3PS7A 4AZBA 3HGOA 4ZE4A 2Q3RA 4JTGA 3AI0A 3QY6A 1OY0A 1MEHA 5PTDA 2JF7A 4NT0A 3BW2A 3K4WA 3M16A 4HA3A 1RK6A 4F2UA 1UPPA 3S1XA 1BVNP 2ZC8A 1HXJA 1OCBA 1FECA 1GVYA 4QE4A 3GRIA 3GH5A 2Y8UA 3KRBA 1W5QA 2J7EA 2J74A 3OG3A 5F1UA 3NYZA 3CIWA 1FHLA 3TWAA 6XIMA 1GRTA 4ES4A 4IGSA 4OGZA 3W82A 1KN0A 1B9ZA 2RH9A 3W3OA 4M5PA 1FWBC 3GK0A 1HW6A 1A0DA 2PE4A 3TLLA 3LX9A 4L6HA 2WLZA 4MJZA 3T6CA 1ZBCA 2NT1A 1PTDA 3Q6JA 1QPRA 2NUWA 3VMPA 1TV8A 3LYEA 3EAOA 4UTWC 1QOXA 2PWHA 1CXEA 1XBYA 3VNIA 4K6AA 3AIQA 4KCTA 3T42A 2CLPA 2I16A 1K77A 5BOEA 1GZGA 2OQYA 3Q45A 1KCZA 5C0QA 3ZIZA 3AHXA 5AYYA 2DUXA 1N8IA 3PBYA 1PZ1A 2E9MA 5T9BG 4ZQRA 3OZOA 4Q6XA 3A21A 1XFCA 5EPDA 4IIBA 1Q8AA 1TPUA 2QUMA 2NV1A 5FD0A 4I90A 1GQNA 3NVYB 4P2VA 1J0YA 3VFCA 3DENA 3KTXA 4HJWA 4M0XA 3WK3A 4P8VA 3VM5A 3W7CA 3BSGA 3AAMA 4RDWA 5KZDA 5AVHA 1KXQA 3VGBA 1JD9A 3WDHA 4UQEA 3CUZA 4I9TA 2I57A 3W74A 3M44A 3HFYA 1F61A 4FNQA 3MP4A 3ZVHA 5E0CA 1VENA 1O4UA 1RSCA 4C6EA 4UMCA 1Q45A 5AFDA 3G5EA 5DRIA 4GO9A 1AMKA 3TKFA 3OHIA 4GBDA 4WSKA 4DJFD 3LU2A 4ERAA 4C7FA 4W86A 2A4AA 1O5QA 4E2BA 2FVKA 2WP5A 5D9OA 1TPEA 4PMQA 4ZENA 2X8HA 2I5GA 5CPSA 1WUFA 2D1ZA 1KM2A 3WLTA 4KFPA 4E4FA 4PODA 4LH8A 1WDWA 4LVAA 1PL9A 3VIKA 2XIQA 1TPDA 4HHHA 2FPVA 1A5AA 2QCMA 1YYAA 4TUFA 1BWLA 4ZO7A 4WF7A 1T5AA 1BQCA 1FWRA 1EPXA 1O1ZA 3HURA 4MB3A 4UTWA 2BY1A 1UUOA 3LRKA 1QPKA 4XKYB 2PPGA 4DX3A 4NYUA 3M5ZA 3TYEA 3W7MA 3V5FA 3BAWA 5JBFA 3UGVA 5A1AA 2V2DA 3RPTA 2B31A 4Y2WA 2YKKA 1XL9A 4D9PA 4EAYA 3MHUA 4PFMA 2XG9A 4RV3A 1GHRA 1K02A 1OK4A 1LL7A 1L6SA 3KAOA 1KFWA 2FJUB 2IPWA 2H9AA 2Y7FA 1L8PA 2PGFA 3VGGA 1RLCL 3E02A 5EGRA 2CYGA 3N1AA 4RW3A 5CC5A 4JHZA 2QULA 3AYRA 3MJYA 2VDHA 3MUCA 4K1WA 1KXHA 4ZXOA 4S3GA 4XD6A 4X0VA 1KM5A 2Z4GA 1WXJA 1OIFA 3VXGA 4FA3A 5D8WA 4DI9A 5JUVA 4Z2LA 4O1EA 2O55A 2O4MA 2WNNA 4O50A 3URAA 1PWMA 4XVEA 3W7DA 1O60A 2EKCA 2QUNA 1UQZA 1ZAJA 2BP1A 3N19B 2EQ9A 2G0WA 2GVGA 5EB8A 3PC0A 3WQ4A 3FVDA 3HV8A 4ACZA 4AWSA 2VT0A 1SZGA 3GU1A 1XDJA 3SQSA 5DN1A 2O9TA 2HWGA 4J56A 2ZUVA 5F4WA 1I45A 1JUBA 3ZWSA 1OWQA 3DI0A 2BXZA 3QW3A 3FLUA 3GVVA 4EKJA 4IJBA 4MYAA 4B4FA 1J9YA 3PP7A 2IKJA 3IPWA 2GPTA 4GQBA 1AG1O 1XBVA 4QS6A 4US6A 5D2VA 1LJYA 1US2A 4BQ2A 5E9XA 2YGYA 2JALA 3HW2A 3T09A 3A3WA 3CUGA 3WJSA 4AYSA 2X7WA 2J75A 4B2DD 5G1TA 2PODA 4WHBA 3EWUA 2V0TA 4H9UA 1RCQA 2HXUA 2ATSA 3IVSA 4UTIA 5B7YA 5DXXA 2FH6A 3CL8A 5BXTA 2ISDA 1NH6A 1T96A 1CXLA 3Q94A 3W2JA 1YIXA 1OGSA 3AIVA 2INFA 3C2YA 1XQKA 4IG2B 2DT1A 4HPGA 4I6KA 2D22A 5CBIA 1FFQA 1QW8A 5HAOA 1XIJA 4ORIA 4ACZB 3BANA 5CJNA 2BY2A 2QV4A 3OVPA 4ML4A 4BF5A 3M64A 1YPFA 3QYSA 5E93A 3FXYA 3LHVA 1JFHA 3LV6A 1AH3A 3OVGA 2NV9A 1PDYA 1JRBA 4MJ4A 4LSBA 4DJDD 1W9DM 2H8XA 2ANUA 4UCGA 2PLCA 2GQAA 3DFNA 1PHWA 1J4EA 3M0YA 4D6DA 2BC0A 5SWUA 2DT2A 1YPIA 3S47A 1NFPA 1QXLA 1KQYA 4LYPA 1TIWA 3EMZA 4ZEPA 1UR1A 1J11A 3Q2DA 3NQFA 3W27A 2C0AA 5IBXC 5A6LA 3SI9A 3A4XA 4Z2KA 3GY1A 3TUUA 2J79A 4GNJA 5I3GA 4H9ZA 3VOGA 2RGMA 1AQHA 2ON3A 1CEOA 3N9RA 3QN3A 2EPLX 1JDFA 1OB0A 1PBGA 3E9AA 3WUEA 5A2CA 2C1HA 4YVXA 2WNZA 4HYVA 1OFBA 1Q13A 3CM4A 2P8BA 3SCNA 1PZ0A 3GDKA 4QISA 3IVUA 4AD0A 4YXGA 4DEFA 3QTGA 2VX5A 3WLNA 5FJOA 3FHQA 3ZR4A 4NZ3A 1Y5VA 3PZIA 2Z1SA 3G3MA 1E6XM 1DE6A 1XWYA 3G6MA 3MBFA 3UU0A 2QJJA 4O19A 2NVCA 1C9WA 3VDHA 1KR0A 3H22A 3W73A 2TODA 2V5DA 2OO6A 4QE1A 5LA2A 1EDQA 4H7CA 4C6JA 5CSYA 1FUYA 4CEXC 4RLIA 2TYSA 4UTLA 4W84A 3SW6A 3OQEA 2ISSA 3LSBA 1HJQA 4F9DA 2YDQA 5GRTA 2E1DA 3S2NA 3QZAA 1EP2A 3KW3A 4UMAA 3S2MA 4GABA 3LCWA 3OU8A 3L0NA 4QE5A 2OG9A 1TSIA 4ROQA 2DSZA 4XZIA 1S2WA 1VBHA 5MHBA 4OECA 1X1ZA 1A47A 1ME7A 1GW1A 2W9MA 1F6YA 4AXNA 1XSJA 5DO8A 3KS5A 1V0KA 3A3HA 1KGXA 2HZGA 1TTQA 3GTIA 1TREA 4NXSA 4GJJA 2D3NA 3SQMA 3TJ4A 1RPKA 2ZDSA 1BZLA 3ZJ8A 2CLFA 2W63A 5LGZA 1C8QA 2V68A 1LP6A 2V9DA 1VIZA 1FQ0A 3D3FA 1JZ7A 3SR7A 3IEBA 1PKNA 4Y9MA 1XLLA 3QFWA 1XLEA 4BF9A 2X99A 2OO0A 3W7HA 2BBFA 3GHRA 2ABAA 1KGWA 4EM4A 2EGZA 5AC4A 3VIIA 3T2QA 3QV9A 1EC7A 1UWAA 4DBUA 3QW4B 3STFA 1CXIA 3UETA 5I23A 3LI0A 3W7IA 1F3PA 3H21A 4XTDA 1V6XA 3L12A 4V28A 2PSNA 4ICCX 3D46A 1EXPA 3VX1A 3RG6A 3MU7A 1V0MA 2BTMA 1F2JA 5FF4A 3QR0A 3E2QA 3GXDA 3C2EA 4G8TA 1EIBA 1OABA 2A0NA 5LSMA 3GH4A 4IWWA 3CH9A 1BAGA 1W5PA 1XC4A 3VUPA 2R1PA 4IZGA 4MOZA 3IUHA 1V5XA 5D32A 1CYGA 3C3NA 3MUAA 3R79A 2VWTA 2AGKA 4NVTA 4YJ5A 3EX4A 1JPIA 3EWXA 3F5LA 1CXFA 5HUOA 1K6AA 3KP0A 1IEQA 1SW0A 3WLQA 4AF0A 3AZRA 5EMLA 3LTSA 3CGCA 1E15A 3WNMA 3DFYA 2QDHA 1ZXIC 1ITUA 1BRLA 3ZLFA 1F4HA 5ECVA 1MZHA 4H4PA 4XSLA 1QMLA 3POHA 1D7YA 1PIFA 3PZUA 4WIWA 1BHGA 3GDTA 2WB5A 1HGYA 1SW3A 4WXZA 3II4A 1VBUA 3CUFA 2J8FA 4AG0A 5FF2A 5BU9A 2DJLA 1UBPC 3TAKA 3VZZA 1PPIA 3FY1A 2V5CA 3K8LA 3LQLA 4ZB0A 3G3DA 1FHVA 2NLIA 3NL3A 3V0TA 4L4MA 2ADAA 2GQ3A 2WHJA 4QBXA 2JK2A 3F2BA 3CV2A 4GI6A 4YU1A 3NZGA 4A6GA 4MVAA 3A64A 2VNCA 4M51A 4J1OA 3VE7A 4IPNB 3HG3A 4QGCA 1UZHA 4GJ1A 1NTHA 3FJLA 1F76A 4JNMA 4QLLA 3B8VA 3W7KA 3NZQA 3FJ4A 3HO8A 4TVYA 2GOKA 1VB9A 4PBGA 2PGRA 1OX4A 3GNXA 1V0LA 3P74A 2WZMA 1YBQA 3U3HA 1EJVC 1QRQA 3R0UA 1REQA 4ZQMA 5J5DA 2F2KA 1AL7A 4D8ZA 1YTDA 3CT7A 4A2RA 3LQGA 2ZRWA 1UROA 3JW7A 2ZKMX 3G8EA 3E49A 3LV5A 1H1ZA 4CCZA 5KITA 1UMYA 1KKOA 5EFFA 3SRFA 3UCQA 3O63A 3V5OA 4P7RA 3EOOA 4DZAA 3TIMA 1VYRA 1FCQA 2ESCA 2W92A 1TVNA 5I2UA 4UFJA 3H7VA 5MKGB 5HWJA 3WY1A 2GK1B 4JX6A 4S3EA 3GAKA 3APGA 3K1GA 5HQMA 3JR2A 1ZHAA 1P1XA 3OBKA 3LCXA 6TAAA 1E6PA 3VOCA 3KOYA 2O0TA 1W91A 5D33A 1I75A 3F5KA 4NZCA 4CN4A 3FN9A 3G1SA 2GDQA 4V1YA 4L1XA 1MSSA 4WJEA 3M0VA 2ZXAA 4YVVA 3TSDA 3KCOA 1PKMA 1MUMA 4H50A 3WMSA 2IPGA 3TA6A 4B91A 4DJDA 1HVXA 2GJLA 4WSJA 1QOPA 2XZ9A 4AX7A 4JTHA 4GE8A 2F8QA 1EGZA 1EP3A 4GISA 3FSUA 3WK2A 3MT1A 4N9CA 1GETA 1K4QA 1A50A 4G1NA 3LUTA 1FDZA 3H12A 1RY8A 2JF6A 3PBMA 3MMDA 4HVXA 3ABRA 1FTXA 3IV8A 3REQB 3P81A 1HX0A 2D20A 4PTXA 4FZIA 3UT0A 2ZDRA 4GR1A 3RRAA 4GA8A 4A3QA 3W53A 2E1WA 1CB2A 2Z1WA 3PZQA 4A8RA 1FWHC 2E6DA 4A05A 3MVIA 3DU0A 1ISVA 2UV8G 1TWZA 1YTEA 3KDNA 2RDUA 3ATYA 4CQAA 1QOQA 2DZTA 1QTWA 3IACA 4W5UA 3VCNA 1AZ1A 3A7AA 3E96A 4B90A 4LXFA 4LY8A 1Z44A 1I9CB 4H83A 3RMJA 1WUEA 2QYGA 3BZGA 5FF7A 3EWYA 4HN4A 3ARPA 4QM1A 3AZSA 3WLJA 2BB0A 1Q7MA 3GW3A 3CEPA 3KUMA 4ML9A 3DJJA 4MIMA 1NVMA 2BNJA 3GD6A 4A8IA 4QTGA 1GORA 4NJJA 2GR1A 1IEXA 3ZYZA 5HJXA 1FDYA 1FA2A 1CPUA 3DIPA 3QJAA 3C5QA 3NOYA 5D2XA 3UA4A 3VGHA 3GQYA 8CGTA 4HSNA 3QH2A 3PHAA 1W9BM 1B2YA 2QAFA 3DK9A 2WNWA 3WEZA 1PKLA 4HYRA 1RJPA 4H4ZA 1X2GA 1GEQA 4GVGA 5HWMA 4O1BA 2DQWA 3IGSA 1E9LA 2HQMA 3E5PA 3URNA 3NSNA 3BMWA 2J7DA 3PB0A 1LQ0A 3GRSA 1NP0A 2FHCA 5G4EA 1L2UA 5C7HA 1ZTVA 1N61C 4FMVA 3UG4A 5MKGA 4PL1A 3UPMA 3GBEA 3EXTA 3P84A 4D1JA 2OYKA 2OMAA 4A22A 2W5FA 2BFGA 1W6TA 3ABOA 4GQ0A 1F5ZA 1RALA 1I8JA 5IFTA 4PUDA 1IGWA 3S2LA 2GUBA 2HXTA 3ZVHB 2PLJA 3W1TA 2Z24A 3VOIA 4DWSB 4CQ8A 4ZVJA 2ZQ0A 2FPYA 4S3DA 4NI8A 3MYPA 3R13A 4XZLX 1KM1A 2R24A 4IIHA 1UR2A 4IGMA 4B92A 3ELFA 3NPUA 4EMWA 2WM1A 3M0HA 2PDLA 2VGBA 1F9CA 1XRFA 2WZEA 1EP1A 1NOUA 1SMAA 5A8PA 2XH2A 5AHFA 3VFLA 4IMDA 5JU6A 1ONRA 2HBVA 1MNZA 3BW3A 2JIEA 4XO7A 1UD3A 1UWRA 3W7JA 3P60A 3EDDA 4HB7A 3W7NA 4TMCA 4H9VA 3W6YA 2V6AA 1LWJA 1VLWA 2Y24A 3E0IA 1KLZA 3HG4A 4DF2A 3AN1A 4ZOEA 4DJEA 4LAZA 4RNHA 3W7RA 4MWAC 1LOSA 3Q58A 5A2BA 2JBMA 3MSDA 4IQEA 2WOWA 2ZA2A 1YNYA 5AC7A 3BMXA 3RRXA 2QNEA 1KFJA 5E0FA 3DK8A 1QWKA 4M6VA 3CAWA 3WLPA 3WJXA 2Y2WA 2C91A 3F7JA 1NPXA 4JDBA 4BJHA 4GPNA 2ZE3A 1V8EA 4RR4A 4BHYA 1FWEC 3M43A 4GRTA 1XR2A 1DWFM 4JIHA 5FJRA 2WZIA 1SZNA 4G56A 1JG9A 3WF0A 2E5BA 3R1ZA 2PF8A 1SPQA 4WVXA 4DBWA 2NZLA 2W0HA 1FWCC 2XJ7A 2ZZ6A 3LRMA 3GR7A 4CN1A 1SMDA 2A7NA 1CZ1A 5M17A 4NILA 1EUNA 1TWIA 4FPSA 1HTIA 1NEYA 2QS8A 2Y8KA 2NW0A 4GX9A 1IXNA 4REQB 4WDUA 4X9SA 1H63A 1WZLA 4C1KA 3UJRA 1WDRA 2EPKX 2OZTA 1DJYA 4YNGA 5LNUA 4UB9A 1TZ9A 4R9XA 3E74A 3WQDA 5FESA 2QVNA 3KL5A 3LOTA 1PZ3A 3USBA 4XKYA 3UG8A 1WA3A 2C16A 1JPHA 2AL2B 3IV3A 4RK8A 3NAVA 1EJWC 2EPHA 2WCSA 3KRUA 3TE9A 3L7RA 1JDDA 1QJWA 5T9CE 4BI5A 3KP1A 4GIEA 3AMGA 5F2LA 4A3UA 3GXPA 3BSHA 3SJ3A 3EOUA 2XSAA 1UH4A 3LBOA 4O0QA 2YCLB 3NVZB 3W7EA 4W93A 2GLKA 4ZOAA 1B90A 2ALDA 1LL4A 2CITA 4B2DA 3RLVA 3NPVA 2Y61A 3K30A 3GDBA 3CLWA 3MV11 3H4GA 5FKYA 4UOQA 7TIMA 1JDEA 2XM1A 5KINA 3KHDA 4H00A 2MUCA 4AZ5A 1DJIA 1K7EA 1TCMA 3A13A 5LIYX 1XLDA 1A5OC 1O68A 3AALA 4NEVA 2HISA 1S5NA 3L0KA 1AUSL 1TELA 2ZXDA 3MSRA 3EKGA 3SY8A 1UKSA 1X6NA 2GGEA 3MPGA 4Q22A 1NHQA 3B9DA 1JAKA 4YMZA 1N62C 2YSWA 2ZX5A 2CHRA 2GZXA 2VEFA 5FJJA 1VEPA 3B8UA 4MF4A 2Z6JA 4Q32A 4QLJA 4RDVA 4K2SA 3TN6A 1CWYA 3C6CA 1HJVA 3B4YA 4B3LA 2BDQA 3U7BA 4F2BA 1TG7A 4C6IA 4Q8TA 3HFTA 3MKVA 1V6YA 4PMOA 3RU8X 2J6VA 1N7KA 1XLCA 3HRDC 3S5OA 1WKDA 3II1A 1GOKA 5TAOA 3PZGA 2HTMA 2QW5A 4W8AA 2VUNA 4RE2A 3P2VA 3PPGA 6TIMA 3BV7A 3PWGA 2QKFA 3VKKA 4QEHA 5K9XA 3E0VA 3HMJG 3AYVA 1TZ7A 4IMGA 3W84A 2L5HA 3WQFA 1EHAA 4K39A 1KBIA 1KM4A 3W7GA 1E6SM 3CU2A 4AAJA 1F6PA 3KVKA 3B04A 2I5IA 1X6LA 5DEZA 3O05A 4LRTA 2YXOA 3OW1A 5L9FA 2ISVA 3BLOA 3CMJA 1VBGA 3EMQA 5AZ1A 1H0GA 3C61A 4EPEC 4B16A 2VCCA 3UNDA 2QEZA 1I2QA 2XIMA 1TQXA 3LCFA 5HMDA 2RDTA 4JTRA 1QWGA 3UZWA 2Y4SA 5FEXA 1RQEA 4MNLA 3OZMA 2HCVA 2D23A 3M46A 3OA5A 2J8TA 3LXCA 1U30A 3PZTA 3SCOA 3RLGA 3CHEA 4G2DA 4HU0A 4IP7A 1TYPA 2D0HA 1FH8A 2OB3A 4JX4A 4LV4A 1GYLA 1STZA 2Z6IA 2V63A 3H54A 1F74A 2ACRA 4L9YA 1TO3A 3STPA 1RP9A 4O4VA 5CZJA 1T8QA 3TNBA 1AOGA 1N55A 1BXCA 1UD5A 3FS2A 1P0NA 2C1IA 2EQDA 4Q8OA 3PG9A 3F5JA 2WSKA 2VXNA 3AJXA 1L6WA 2OELA 2WPGA 2OKOA 3XISA 2D2OA 1HQTA 2YW4A 2OSYA 2E8YA 1UKTA 1XH1A 4XG1A 3CPGA 1Q1WA 4OZOA 1F4AA 3W6LA 4LUIA 1J2BA 4C6KA 1I1XA 5LGXA 2MNRA 3FX4A 5CJMA 1PYFA 4KRZA 2GDUA 2QCDA 2YJQA 5D30A 2RGLA 2VGIA 4GWEA 3B0PA 3ANYA 5AY7A 5HMFA 1TZZA 2QPSA 2PMQA 4AQLA 5LXXA 4LCQA 4L4LA 3TQKA 2PBOA 1W17A 3ONBA 5H8PA 2QCFA 1ODZA 2FMOA 1W8GA 3FSTA 4DUOA 3M6YA 4EPDC 3KDOA 1ISWA 2BS9A 3AYSA 2PD5A 2NVKX 5KTLA 4FP1A 2HV5A 4PMDA 2VC5A 1UR0A 4E3VA 1WBJA 1FXPA 2OWCA 2NVDA 4LVGA