3ZVIA

Methylaspartate ammonia lyase from clostridium tetanomorphum mutant l384a
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
415
structure length
415
Chain Sequence
MKIVDVLCTPGLTGFYFDDQRAIKKGAGHDGFTYTGSTVTEGFTQVRQKGESISVLLVLEDGQVAHGDCAAVQYSGAGGRDPLFLAKDFIPVIEKEIAPKLIGREITNFKPMAEEFDKMTVNGNRLHTAIRYGITQAILDAVAKTRKVTMAEVIRDEYNPGAEINAVPVFAQSGDDRYDNVDKMIIKEADVLPHALINNVEEKLGLKGEKLLEYVKWLRDRIIKLRVREDYAPIFHIDVYGTIGAAFDVDIKAMADYIQTLAEAAKPFHLRIEGPMDVEDRQKQMEAMRDLRAELDGRGVDAELVADEWCNTVEDVKFFTDNKAGHMVQIKTPDLGGVNNIADAIMYCKANGMGAYCGGTCNETNRSAEVTTNIGMACGARQVAAKPGMGVDEGMMIVKNEMNRVLALVGRRKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLASPARTATE AMMONIA-LYASE
publication title Engineering Methylaspartate Ammonia Lyase for the Asymmetric Synthesis of Unnatural Amino Acids.
pubmed doi rcsb
source organism Clostridium tetanomorphum
molecule tags Lyase
total genus 164
structure length 415
sequence length 415
chains with identical sequence B
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
A PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3zviA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3zviA01
3DGBA 4M6UA 3CAWA 4MKSA 2OZ3A 3RCYA 2OO6A 3VDGA 3STPA 3ZLHA 1R6WA 2AL2A 2XH7A 4H1ZA 3SSZA 3UCDA 1TZZA 3GC2A 3PWIA 3UJ2A 4DN1A 3D47A 3JZUA 4GMEA 3V4BA 4ZCWA 3RGTA 2PODA 2PMQA 4M0XA 5FJTA 2HXUA 1JPMA 1SJCA 3V3WA 4DWDA 4H19A 1EC8A 1DTNA 2QQ6A 2PTWA 4J3ZA 5FJUA 1NU5A 3R10A 3VC5A 3MZNA 3K1GA 3T8QA 3ZLFA 2ZC8A 6ENLA 2AKMA 4FP1A 1TKKA 1P48A 2ONEA 4K1WA 4GISA 4GYPA 4DX3A 4ROPA 4KT2A 3IJIA 3VCCA 3TCSA 1E9IA 1IYXA 3FV9A 3CXOA 3DERA 3TW9A 2PCEA 3H8AA 3R25A 1KCZA 4EWJA 2XGZA 3SN0A 2AL2B 3MY9A 1L8PA 3DESA 2QJNA 1P43A 4G8TA 2OQHA 2GGHA 4HCHA 1JPDX 2PSNA 2OQYA 3SQSA 4E4UA 3KUMA 1MDLA 4FI4A 4E4FA 2XH4A 1F9CA 2OZTA 2PA6A 4GYPC 3D46A 3HPFA 2HXTA 1FHUA 3PWGA 2GSHA 3T9PA 2I5QA 2PP3A 5BOEA 2P8BA 1EC9A 3QTPA 3FXGA 3MQTA 3TOYA 3B97A 3IK4A 3GD6A 1ELSA 2P3ZA 2PU0A 3DEQA 2PPGA 2HNEA 4MGGA 3FJ4A 1MRAA 2HZGA 4Z17A 3H12A 3UJEA 4JN8A 1WUEA 3RO6A 2FKPA 3R11A 5EU9A 3DFHA 3QN3A 3NXLA 3VC6A 2PU1A 3DFYA 4J1OA 1JCTA 3H7VA 5ENLA 2QVHA 4IHCA 4DXKA 3ZLGA 4E6MA 3V5FA 1MNSA 2GGGA 1JDFA 1WUFA 3UJRA 3I6EA 1MUCA 2CHRA 3P0WA 4GGHA 3DG7A 3TJ4A 3N4FA 3DG6A 3ZVHA 2PTYA 3ES7A 3TWAA 3QLDA 3U4FA 5FJOA 3P3BA 4DHGA 3OPSA 3DG3A 4ZA0A 2MNRA 3THUA 2PP0A 1XPYA 3BSMA 4A6GA 1KKRA 5J04A 2PGWA 2RDXA 4GFIA 3Q4DA 3FYYA 2QDEA 4K2SA 3QKEA 3UXLA 4GGBA 3OZYA 3CT2A 4IP5A 4JHMA 3MWCA 3ZVIA 4GIRA 2MUCA 4MMWA 3PFRA 3CB3A 3FVDA 2OLAA 4DYEA 1TE6A 2QJJA 2OG9A 5FJPA 2XH0A 2XSXA 2DW6A 1SJBA 1MDRA 7ENLA 3IJLA 3SBFA 4H83A 1ONEA 3S47A 2PGEA 3JW7A 1KKOA 4HNCA 3UXKA 3OW1A 2GL5A 3H70A 3UGVA 3TWBA 3UCCA 4IT1A 3ZVHB 3P93A 3SN4A 1PDYA 3IJQA 3VCNA 2PS2A 3R0KA 2OKTA 1BQGA 2OPJA 1RVKA 3N4EA 4E5TA 3RITA 1KD0A 1SJDA 3PK7A 3CK5A 3JVAA 3DIPA 4YWSA 2OZ8A 3MUCA 2PTZA 4IP4A 3SJNA 2O56A 3I4KA 3VFCA 4X2PA 3MKCA 4Z1YA 2AL1A 3T4WA 3NFUA 4HN8A 3U9IA 3EKGA 3UJFA 3ES8A 3Q45A 1EC7A 2GGJA 1EBGA 4IL0A 2GGEA 3V5CA 3QPEA 3UJSA 2ZADA 2QJMA 3RR1A 3BOXA 4JN7A 2AKZA 1FHVA 2P8CA 1XS2A 2PP1A 2OVLA 1EBHA 4HYRA 4HCDA 3SN1A 3GO2A 3OP2A 3NZGA 3DDMA 4KEMA 4IL2A 2OFJA 3MSYA 4E8GA 3GY1A 4A35A 3I6TA 4ENLA 2GGIA 2OX4A 4G7FA 2POZA 4KPLA 4KWSA 2FYMA 3R0UA 3TTEA 2NQLA 4HCLA 2PTXA 1R0MA 4H2HA 2XH2A 2P88A 3TJIA 4A3RA 3R1ZA 3RRAA 3EEZA 3S5SA 2DW7A 3FCPA 3OZMA 1BKHA 1SJAA 3ENLA 1PDZA 1NELA 5IDZA 2GDQA 5BOFA 1W6TA 3NO1A 3T6CA 3CYJA 4HNLA 1OEPA 1YEYA 5FJRA 3N6JA 3TQPA 3N6HA 4F4RA 3VA8A 1ECQA 2QGYA 4IZGA 2QDDA 3OTRA 3BJSA 4K8GA 2P0IA 4HPNA
chains in the Genus database with same CATH superfamily
4BV6A 5AHNA 3HPSA 4I5XA 1H51A 1R85A 4Q3MA 1J2BA 1K7EA 3PBVA 1DJYA 2D24A 2W27A 1UR8A 2WPFA 1QO2A 3ANVA 4HPJA 4Z2IA 3LQLA 4PMDA 4HZ8A 1GPFA 2GDUA 3OZOA 2J62A 3OYXA 5GJNA 1OC7A 1VFOA 3QR1A 4ACZA 4Z08A 1S5WA 4UFJA 2PODA 1CLXA 3EKZA 4Q8TA 2HXUA 4UMCA 3F2CA 3IJ8A 1TMHA 1N5XA 3UPMA 2DZWA 4J3ZA 4Q8QA 1KCKA 3R10A 2W66A 1KLZA 2NW0A 1AQHA 3VIGA 2C3DA 1YADA 2VOTA 3ZLFA 3BG5A 1GERA 2A21A 2INEA 4LT9A 3R7MA 2YDQA 4PUUA 3NQEA 1T5AA 2ZIDA 3IV3A 4DM2A 4NHVA 1JNDA 3HF3A 3Q2DA 1V5XA 4U28A 3O06A 4UZSA 1E3ZA 1NP0A 1SQ7A 1Q6DA 3WF1A 2OELA 4JTIA 1TWDA 2CDUA 2FVKA 4DAFA 1NPXA 4XK2A 1JZ8A 5HJXA 1HGWA 4AY1A 2X7VA 2E5CA 3OU8A 4LBRA 3O0FA 3OO2A 2WHLA 4PTDA 1JZ2A 2VNCA 4G8TA 1VCFA 3T40A 5FF0A 1BXCA 2NT0A 4L1WA 2Q71A 2OQYA 4DUOA 1BWCA 2V67A 1MDLA 2OKOA 3QKZA 5I3IA 3RU6A 2Y4SA 1I2OA 4LC8A 2V38A 3M0VA 3SGUA 2XIQA 2O4MA 3CU2A 1GKRA 1ZBWA 3B40A 4AD1A 1M65A 1U33A 1X7IA 3T9PA 2I5QA 3UNTA 4Z0SA 3RFAA 5HQMA 4TV6A 3QOKA 3AYVA 1NVMA 1E6PA 1B9ZA 3LRLA 3V7PA 4NI3A 4CD6A 1EP1A 1BWVA 5EMLA 2QCCA 1XRSA 4B16A 3FKRA 1OHLA 5D32A 2WJDA 1ZX9A 4F40A 4OUIA 3DHPA 1GPWA 3WMCA 1IT0A 1XYCA 4WJEA 4QDWA 5LNSA 1SZRA 3N04A 4EM3A 4MUZA 1XHGA 1XLAA 1CXFA 1OZMA 2BHYA 1F8WA 2QVHA 1M68A 3F7JA 4H8UA 4QXIA 3GXMA 4LAKA 5AC4A 4DO7A 2NXIA 5LNWA 6XIMA 4DYKA 3EWUA 4UFLA 4BEQA 3CMGA 2XIMA 2CITA 2NSXA 3CV1A 4OBRA 5FS6A 3L5AA 1WDDA 3NGJA 4AH7A 3DG6A 1EX1A 3KRUA 1HTIA 4C6IA 3LMYA 5AVNA 2QUVA 5DXXA 3E49A 2ACUA 4UMAA 2A3CA 3W7NA 1EDGA 1CB2A 4B5UA 1KCLA 1P7TB 3WLRA 3AM9A 4XSMA 3CT2A 5CPSA 1A5KC 1Y5XA 1TWIA 1CEOA 4XKYB 1JPKA 5HDRA 1A5UA 2IMRA 3APTA 3M5ZA 2FTPA 5TR3A 3CGCA 3V16A 1CW2A 1BPLB 2XSXA 2Z7GA 4LAOA 3PVFA 3FA4A 3PSVA 4UFHA 1GNXA 3WD3A 2PWUA 4LRTA 4K7ZA 1UWAA 4FX7A 3B06A 2FZMA 4LUTA 1UD4A 4A8NA 2B7PA 3W27A 4HPXA 1Q1RA 4IOTA 3HFTA 2NWSA 4CQ8A 1DVJA 3S42A 3FGCA 3HW2A 3OW1A 3PSWA 3O07A 1EP2A 1QFEA 1H1YA 2OKTA 2DSKA 1OB0A 5C9XA 2HPMA 4QM1A 4ZO8A 1ZZMA 1SJDA 3VDBA 2Z4GA 1QT1A 1JJKA 2GR3A 5K9DA 1G01A 4RE3A 1ZJBA 1L8NA 3CO4A 2HNHA 1B0IA 3LHUA 4CCDA 1E0TA 3RX4A 1ZJAA 3U3HA 2WZEA 3PM6A 1M5WA 3JRKA 5I78A 1XFBA 3W01A 3W1UA 1OK4A 3NL2A 1NWRA 3PUGA 3UJSA 4YJ5A 5L6UA 1W8SA 2XU2A 3STGA 3URQA 2A3AA 4MWAC 4FNUA 2D69A 3CZ8A 3CO8A 1SZNA 4NAFA 4UWMA 1YRRA 3NZGA 1RR2A 4GRTA 3MSYA 3UYIA 1RZMA 4YVPA 4X22A 4DELA 3KE0A 1R3TA 4HB7A 3IIVA 2GGIA 2ZTJA 1BWKA 4B3LA 4XZBA 5E0FA 4JTHA 4BQ2A 1JCJA 2V8ZA 1SO3A 5E70A 2EKCA 1GRAA 1XLMA 4MF4A 4QCFA 4IH3A 4A3RA 4HPGA 1LZOA 1BYAA 3G8EA 3EA1A 3CUJA 5G2IA 3ARWA 1NOUA 9XIMA 5I24A 1Z41A 1LP6A 3N29A 1SJAA 1V6XA 2VTFA 1NELA 2YKKA 1WQ5A 1XLGA 2A0NA 4C6QA 1ALDA 4J3VA 4URIA 3GKAA 1XH0A 1CECA 2XSBA 2W54A 6PTDA 1L6WA 3OIXA 1JI1A 5I03A 2WYSA 4C6EA 2WBKA 4IG2A 1UCWA 3WUGA 4BF9A 4IJRA 1ZY8A 5D9NA 1TYGA 1A0DA 1XSIA 3QRHA 7CGTA 3N1AA 2H3DA 3A5FA 1H0IA 1YX1A 4HU4A 4AD4A 2DZXA 4KESA 4UQ9A 4MKSA 3VNZA 1S2CA 1P0DA 2YL9A 2DZTA 3H7RA 2AL2A 1IZKA 3UCDA 3HMCA 1NAL1 2BC1A 2PF0A 2QJHA 2YJQA 3ARTA 3ZOAA 1DOSA 4GJ1A 4DF2A 1V79A 4LVGA 1E0WA 9RUBA 3PZUA 4I9MA 3M0MA 4H6EA 1TJ2A 4JY8A 4BCEA 2V6OA 2PLKA 1K4HA 4ZVJA 4RKAA 2FTWA 3GNRA 1ZCCA 5I00A 3URBA 4U3AA 2HBXA 3AJXA 4A3UA 5EB8A 3GD3A 3GW0A 3DKLA 3KL3A 2Q01A 3RLGA 2H90A 3OVRA 2AQWA 2J77A 1XF0A 8CGTA 3PUDA 2ONEA 2PCQA 3M5VA 3P61A 4PTMA 4S3AA 4Y7EA 3CJPA 4XO7A 1WKEA 2Y0FA 1E0XA 5CJ5A 4IMEA 3M6YA 4RL3A 2D2HA 5LIXX 1VB9A 4WXYA 6REQB 3IJ9A 3O8AA 4A3YA 3N73A 4DF0A 2P10A 3F4DA 4NJHA 1NJJA 1LVLA 1E4MM 3MANA 4BK9A 4Q4SA 1P0BA 3S1WA 4IGSA 3FSUA 1ZJHA 1J96A 4W5ZA 5KMYA 3WK1A 3AXIA 3PNZA 3L4ZA 2XSAA 1LQAA 1TX0A 4K7YA 1JYWA 3RUBL 1OFOA 1FXQA 4LQ1A 2GR2A 1HT6A 3NS1B 2X0SA 1UUMA 1OX6A 1C90A 1DBTA 2WAGA 4UNKA 4ERIA 1IWPA 1Z42A 2WOWA 1I1WA 3BPWA 1KTBA 3M5XA 3EXTA 3UXAA 4G9PA 1M9HA 4XZ9A 3W26A 3W1QA 5LXEA 1PZ0A 3QV8A 2ZQ0A 1GHSA 2B0MA 5LZLA 3TLQA 4KCUA 1W2PA 5CLWA 3WENA 1PX4A 1LBFA 4V28A 3WLNA 4XV0A 1W3KA 4KFNA 2HTMA 3CHFA 2P53A 3GC5A 3LTPA 4WDUA 3SM0A 1G1YA 3N6QA 1CXHA 5DBTA 5DXYA 6ALDA 3OBKA 5TF0A 3TK7A 4Q8UA 4NAEB 4O54A 3EWWA 1UYQA 1T99A 2VWSA 4GGHA 4Z0JA 3RN6A 1EZWA 1XSJA 4HHMA 3ETRB 1ZBVA 3MI6A 3VD9A 3PNUA 2BXVA 3HPAA 1W9BM 3MUIA 1LL7A 4FEZA 1YXCA 3R6IA 3C6CA 3EDDA 3T4CA 4QRNA 4LC6A 1F6YA 3W7HA 5JIWA 1RVGA 5B7YA 1QAPA 1VFUA 3OZYA 2HJPA 2ZDRA 3AS2A 4LF2A 4D72A 1H5YA 3RR4A 4CLMA 4XIMA 4NI8A 2V69A 5U25A 3GE7A 4NJIA 4BHYA 2V5LA 1T40A 4QX4A 5DMNA 1CBGA 1TJPA 1G69A 4FXFA 2A79A 4E2BA 3W84A 1ZPTA 1GESA 3MDWA 1JZ5A 2PWDA 4AIBA 3WBYA 3S1GA 3TV8A 5JCKA 4JIHA 2REQA 3BK0A 3CH9A 1BGAA 3VOCA 2WHKA 2OWXA 2E09A 4C5ZA 4NG3A 3WLQA 4L6HA 3FYOA 4AIEA 2CERA 1LUCB 3IJ7A 1V8EA 4KEVA 4LVFA 1CB7B 3TYBA 2XGBA 3HG2A 2J74A 1KB3A 1W0MA 1MQQA 1S39A 3E0FA 3AYRA 1PYMA 1DL3A 1G94A 2QPSA 1PBGA 4LUSA 1X2HA 4MJZA 4JTDA 3BJFA 4FMVA 5DCDA 4CD8A 1K4QA 3BJTA 1KW1A 4EQXA 1A5CA 3WEMA 3VDCA 1L6SA 3A7AA 2CEQA 3BWWA 3M1ZA 1TPEA 1YTDA 4KRTA 5C6MA 4R53A 3VIOA 1OFAA 4LXFA 1GOWA 4KETA 3W7EA 3E96A 3MU7A 5BROA 5DELA 3MCNA 2RJGA 5DANA 2AKZA 3CV2A 4PBEA 3DC8A 3HV8A 2XVNA 4O1FA 1RP9A 1NQKA 2WKGA 1GKPA 1ZMDA 5ER0A 5FAJA 4W9TA 2XYLA 2CWXA 2WNQA 4E8GA 4D6GA 3A9IA 3EX1A 3HA1A 1IHIA 4X63A 3WNPA 1WCGA 3WX7A 2VEPA 5MKGB 4EACA 4KWSA 2ZX8A 2EJAA 4YU1A 2YBTA 2BXYA 3WO8A 4CD5A 3U8GA 3CV7A 4XZIA 1OCQA 1PX8A 4HN4A 3UQNA 3USBA 1F4AA 3OGRA 4NRRA 5HR6A 3DI1A 3HG3A 2FQIA 1B4EA 4NJKA 3R07C 2QJGA 7ODCA 1OM0A 4LF1A 1FH8A 4FIQA 3R4IA 2B7OA 4GIAA 4B5XA 1H62A 2NV9A 3ZJ6A 2D2OA 3W73A 3N9RA 1C9WA 3W82A 4AZBA 3CZGA 3NQBA 1R3RA 2ACRA 4C6BA 1AQMA 2I17A 3BGAA 4PMNA 3AMCA 1J12A 3DGBA 4JTCA 4C6MA 3QSTA 2XTKA 1V02E 4UC5A 1REQB 3AUJA 3LXBA 1GVOA 4H00A 3AHYA 1US0A 2C91A 2QV4A 3GC2A 5C71A 3UJ2A 1RCOB 3IGUA 4UTWC 4N4PA 1UBPC 4H9YA 3KXQA 1ZNNA 1VKFA 3TSBA 2PMQA 3IIOA 4WJXA 3VDAA 3P60A 1XGDA 1DWAM 3T7VA 2Q8ZA 4ZB2A 4LCRA 3MJYA 5A1AA 4I5UA 2WVUA 4IMGA 2HPIA 3K2GA 4JFWA 3O6AA 4ICNA 2ALRA 3APYA 3KLLA 1N61C 1VP5A 2IS7A 3ME3A 2ZC8A 2P50A 4XUGA 4FXSA 3OGSA 4E2DA 4LCSA 1XDJA 1QNOA 2Z6IA 4C7FA 2V3GA 1MOKA 2FH6A 3DHDA 4MAZA 3WBWA 4M52A 2Z1SA 3LM3A 3E0IA 4MLRA 4B15A 1IGSA 4L4LA 2X0HA 5EL1A 1E9IA 4Q8VA 3B0PA 5T26A 2Z1WA 4YYFA 3MDUA 1EWEA 1XD0A 4ACYA 1UIOA 4BURA 4DBSA 2VQUA 1ZY9A 4R5EA 1TA3B 1TCDA 1H11A 3OJGA 4I6KA 4LS2A 2R82A 1D9EA 4EPKA 3B9NA 4U10A 2WP5A 4NZ5A 4E4FA 4MYXA 2Z1KA 4GYPC 4PMOA 4DWSD 3VNDA 4US6A 1KFJA 1LOSA 3UWEA 3IAPA 3GVQA 2P8BA 1AK5A 3SI9A 3B97A 4CQ9A 3GVWA 1UA3A 3GD6A 1TG7A 2PPGA 3KM8A 4CKQA 1G5AA 1M6IA 5FL0A 3GKFA 1F3WA 3B4UA 1Q6FA 4J2MA 1PV8A 3P8IA 3BAXA 1HP4A 4PTVA 3FG2P 2DVTA 4R7WA 5D03A 2GYIA 1BQCA 3KBJA 3LCIA 5M2FX 1UZHA 2ZWYA 5M1TA 1WUEA 5D09A 1SFSA 3LI1A 3WD1A 5BWAA 4JCLA 2HV5A 3TSMA 4RZBA 3DFYA 2VFIA 4PMJA 1GVSA 1I9CB 2F38A 4ECLA 3NG3A 1THFD 4DAIA 1X1NA 4D6DA 1V03A 2A4AA 2FPVA 4PZVA 1UG6A 4AX6A 1O5XA 3RPMA 1J9YA 2WPGA 5KETA 4OU1A 3KZSA 4U33A 4MIMA 2PTYA 3ES7A 1TZ9A 3PZNA 3THAA 3F5KA 2Q09A 4IQEA 3OPSA 5FL1A 1QI3A 3H2NA 3HPZA 5ECVA 2XFYA 1EDTA 4IGMA 1A47A 1CENA 1I0DA 4GGBA 1F05A 4Q8NA 4ZBCA 3ZVIA 4GX8A 4DJDC 3WNKA 4HOXA 3EUB3 4ZQPA 3AFBA 4FNTA 3N19B 4U5KA 4IXHA 3M64A 1EQPA 3FVDA 3MV01 1TTIA 4B92A 2OG9A 4DM1A 1QWKA 4JEJA 4EWND 2PRLA 1X6NA 1WYGA 5B7ZA 3NA8A 1G4PA 5H2ZA 3REQB 1DWGM 4DJFA 4WIWA 4J3XA 3HRDC 2QGHA 2IQTA 4GUHA 2PFHA 2DZBA 3PZIA 4PBFA 4LS0A 2BVDA 1UQYA 2WQDA 3B03A 3TQKA 4HNCA 3K4DA 1GOKA 4DEFA 1JEZA 3E9AA 2GL5A 4D8ZA 1P0KA 4GQ0A 1MEHA 1QPOA 5F4WA 3A3WA 2I7GA 4KGJA 3VIJA 1KO0A 2WBGA 3GDTA 3PS7A 2EGZA 1AD1A 4FDCB 1VRXA 1XIDA 1I60A 3WDHA 4Q22A 2WK2A 3EA3A 4DPPA 5LGXA 1CGVA 3P84A 3NURA 3BAJA 2JIWA 1PAMA 1KM3A 4HN8A 2YIHA 3FNDA 1UWSA 1KFLA 1FWAC 4AEEA 4P7LA 2Q3RA 2J24A 2PUZA 1ZJIA 2BASA 4D1JA 3BZJA 1ML1A 3FJLA 4GKLA 1LYXA 2QW5A 1XDIA 3UXIA 2YFOA 4GI9A 3SRKA 2F61A 1VAHA 2AGKA 4C65A 1HKMA 5REQB 1UOKA 3CL6A 2GJXA 1KBKA 3CZJA 1DORA 3DENA 3GNXA 3I7SA 2JFEX 5LIKX 1TVNA 3TONA 4QNWA 3VABA 1A53A 3TNBA 4AY7A 3XINA 1FWDC 5IRPA 2OX4A 2E6FA 2R1PA 4NZ4A 2OLHA 2GUBA 4PTWA 2VVNA 1NDVA 4K36A 4H2HA 5JCNA 2PWFA 1ONRA 3R1ZA 1JUKA 4O15A 3AMGA 4QJ1A 3I65A 2WNZA 1MQPA 3EWBX 1OD8A 3WK3A 3ZWSA 2OU4A 3ANYA 4C7GA 1DJGA 2BOGX 5GJMA 1N82A 4X2RA 4UTMA 3QV6A 3EAUA 4KGLA 1R3YA 4PMYA 2Y7FA 1Q63A 1FO4A 1TREA 3GHTA 2QCNA 4WVXA 2RABA 1LBLA 1VCGA 3NM1A 1G4SA 2P0IA 3LCWA 1LWIA 1H7PA 4MYAA 3WH8A 4H7CA 1R9YA 5CGQA 5JRBA 1QPRA 2QCHA 4OV9A 2GQ9A 4M81A 5BCAA 3WEOA 1BF6A 3S5OA 4LW7A 4MY8A 2WMGA 3RPDA 3IV8A 3KBSA 3II1A 4ZCWA 1IR1A 1M3UA 3GYCA 1EGZA 4L4MA 3NQMA 4AMCA 4W7UA 5F1VA 1TV8A 4YVXA 2DUXA 3THDA 3WZ0E 5FCZA 5K7JA 5BRBA 3G1AA 3DBPA 4HK6A 1KR0A 1AFSA 4PGLA 2DSWA 5AFDA 4HOWA 1X8FA 2ZX7A 2BZNA 3QXBA 1JYNA 1XIJA 2YB1A 2VEMA 4LS1A 6ENLA 3VYLA 5E93A 1HJVA 1XKYA 2IPFA 2VGFA 1YDOA 3CEUA 1OYCA 3W37A 1QVBA 2HDJA 3FHQA 4H50A 1LLOA 3AMLA 3CGBA 3ITGA 4GACA 2DQWA 4WEVX 2VYOA 1FFUC 5CPNA 1IYXA 3CXOA 3ARVA 1BVWA 1XLBA 1I75A 4M3PA 4O53A 3TKFA 4LA1A 3ZT7A 1QI0A 2PLMA 1KCZA 2ICSA 5T9BG 2CXEA 2C79A 2EJ1A 2O9TA 2QF8A 4QSHA 4DNAA 2E5DA 1C9DA 5G4EA 4JL1A 2WCSA 3WLTA 3KVJA 1ZL1A 4XBKA 3UZXA 2GGHA 1NF7A 1L9WA 3O0KA 1CYGA 1L6GA 4E38A 3PAOA 4S3FA 1F61A 3CIXA 1IT8A 3PZVA 3OQEA 3M43A 3GUWA 2GSHA 2X1RA 5HINA 2H9AA 4K68A 3RX2A 3BANA 4NYUA 2IPWA 5FS9A 4A29A 4N9CA 4PMRA 2GWNA 2DJXA 1Q2RA 4WGXA 3ALFA 1H6VA 1G7VA 1EUNA 3AJ7A 3GRTA 3MSGA 3BG3A 3CYVA 2NX1A 4JN8A 3A3HA 5A8NA 3GAKA 3DYPA 1OC6A 3PBUA 3AALA 3AHZA 5LNRA 2E40A 1G0CA 5AC6A 3VOGA 1IV8A 4MPQA 2XWEA 1R3SA 4K38A 4Z1CA 3QQWA 4NASA 4QDPA 2CBIA 4H8HA 3SFKA 1F5ZA 3NGFA 2VQTA 5BU9A 3GM8A 2CHRA 4DZAA 4PR4A 3DG7A 3N4FA 4ZQMA 1XP3A 5HMFA 4OECA 4UR9A 3WD0A 3O6DA 1K4GA 1OY0A 2F9RA 3CBWA 3DG3A 4ZA0A 2PP0A 5I77A 3WNOA 3AIWA 3K1DA 2OSYA 2YVFA 1IEVA 3G1VA 3HG4A 4DI8A 5CAHA 4FOKA 4KIEA 1EO7A 2EPOA 5A6KA 3MWCA 1JIBA 1PKLA 1UH4A 4H4SA 4J9JA 3V18A 4QJ5B 2NQHA 2WVVA 3WQ4A 3R8GA 3VD4A 2OLAA 4DYEA 4O8AA 4LWWA 1DIOA 3DBNA 1X39A 4IPLA 1EA0A 3ZT6A 2YZ5A 5I6SA 1BYBA 4RLIA 4BS0A 2FIQA 1D7KA 2A85A 3UY7A 4AWUA 1GQIA 4DJFD 1S2WA 4BKNA 2ODOA 4IX0A 4D6HA 1QOQA 2D23A 3L5OA 2EQDA 4H4UA 3ITTA 4AD2A 4HSHA 4IMDA 1YW1A 4H7VA 4Q6JA 4FSAA 2PS2A 4GY1A 5A3HA 3R0KA 1W54A 3O1NA 5ECUA 4LEFA 2H3BA 1CT5A 1WB0A 2CU0A 2IUZA 3LCGA 4HOZA 3E0WA 3VMPA 2KZHA 1FCUA 1XFCA 2O7SA 3LV5A 3FHAA 3EZ4A 3OIHA 2IXUA 2YCIX 3LU2A 1DWHM 2GDVA 1GRBA 4JTQA 3L65A 3HPXA 4S3DA 4DO6A 3TXVA 2QLYA 4ZB0A 1UPPA 3R94A 4B5WA 4W84A 3A4JA 3T8LA 3VNMA 3CPUA 4JN7A 5XINA 1R2RA 1D3GA 4Y6GA 1V7YA 3CQKA 4HYRA 3QR0A 3ICJA 2JF6A 4Q33A 1NFPA 1HJQA 2IQ0A 3M0YA 4LUJA 4AZ7A 3N2TA 4ZOEA 2ACSA 2G4FA 2Z00A 1YDVA 2Y7EA 1A5OC 2WHMA 1FEBA 3GR8A 3OLGA 4R7JA 4KPLA 2X41A 3AXMA 2ZA1A 4ZGYA 3CB8A 3T55A 3BLIA 1QW8A 1EDQA 2PDGA 5K4XA 3RRAA 4L4OA 4GUFA 3E2RA 4NT0A 3N2OA 2BB0A 3EPMA 3BUVA 8RUCA 1H7NA 1P6CA 4JQ9A 1BKHA 4GK8A 1UJPA 3KOZA 4Y2WA 2O4QA 1PDZA 2XHYA 3NO1A 3VIKA 5SWUA 5DEZA 4ZQRA 3LTSA 3M16A 4GQRA 1WO2A 3N3MA 4S39A 4ZSTA 5FI8A 2BY0A 1JQVA 2DQXA 2ISWA 3I3EA 4P7QA 3W00A 1IR2A 1C3FA 3G24A 3KHJA 5DT5A 2OGYA 3P2VA 1L0PA 1RUSA 2W6RA 1FWJC 5I3JA 3UGRA 3PPCA 1SSGA 4O17A 2EPMX 1XLFA 3QSRA 2GVYA 2YCJA 3WQOA 2WB5A 3GHUA 4E2VA 1JCMP 3A4WA 3KFTA 4HA1A 3CAWA 5I02A 4BZYA 5FJJA 1TQXA 2ZCGA 4L7ZA 4H1ZA 2WM1A 3W75A 1GVEA 3PWIA 1ADDA 3ZYZA 2QKFA 4PN2A 4S1FA 3WLIA 3PJXA 1AZ2A 1D2KA 5DX7A 2Q8XA 2YCKX 4IQDA 2PLJA 2IPGA 1EJTC 1ZBCA 4QLLA 4G2DA 1FP9A 3WQVA 1T8XA 3MZNA 2E5BA 3B8WA 3MKKA 1SB3B 2Y8UA 3B0VC 4JIIX 4BQ3A 4HZ6A 4K1WA 4DX3A 3KS6A 4C7DA 4C6OA 4ES4A 2G37A 2E5AA 3S46A 4TV5A 1I8JA 1Z3NA 5CZ0A 3PZTA 4I90A 1TPC1 3CXBA 4O1AA 2HROA 4OTKA 3TX9A 4FOJA 4P7NA 3VX1A 3MS8A 1VFHA 2F2HA 5JH1A 1LLWA 3CAQA 4L61A 5CPQA 2NVCA 3HQ1A 5HATA 3UWWA 3SGZA 1FWBC 2X1IA 4FNRA 4N2YA 3UCQA 1H1NA 4U31A 4PB5A 4LBSA 1P1MA 2FJUB 3R13A 1VHNA 3VNLA 4NZFA 1KLYA 4XAPA 1ZS2A 2OOFA 3S6OA 5M17A 4ZR8A 1RK6A 4ZXLA 5LNUA 3UR8A 2OZ0A 3ECQA 4LPCA 2C0AA 4KFOA 4XTDA 3ZSSA 1KM2A 3BLDA 4AIOA 4M80A 5BOEA 1CIUA 3UWQA 3TOYA 3YPIA 3VIMA 2C3CA 3ABQA 3HGSA 3LRMA 4P8VA 1P7TA 1UZ4A 1Q8AA 1XJBA 3BARA 3GG1A 2NV2A 3IPWA 4A8LA 2Q02A 2YDSA 4MGGA 3RLVA 4XKYA 3WBXA 2QV5A 3RO6A 4QP0A 2C16A 3LQGA 3R8HA 2O7QA 3D3AA 4H4IA 2W0UA 3DH9A 2YA2A 4KKXA 5FIPA 3EX4A 1XHCA 1E56A 1H7WA 3LLFA 3MVIA 3ATZA 3OOQA 4M6QA 3SRFA 3GZ3A 1E3XA 4EAYA 1PB0A 4MHBA 1FVPA 1ME8A 1E70M 1W17A 4DRSA 1HIZA 4L64A 1RQHA 3M4HA 4RZ6A 1LPFA 3GTNA 1VGAA 2DVUA 4WOZA 5E0CA 3VIHA 5D8ZA 1VQTA 1NHRA 3TWAA 1S3HA 4WKHA 1HNYA 3DJGX 4APNA 5MF5A 4FX8A 3NVDA 2ZZ0A 3CHCA 1XIMA 1VF8A 3CZEA 1KQZA 4GIEA 2ZZ6A 2NUWA 3WF4A 5H8MA 2XIOA 2XFRA 3AIRA 1E40A 2VRQA 3VKKA 1E1FA 2YGYA 1ZSXA 3SIMA 4GJIA 2PURA 3P67A 1U30A 5E6YA 1UASA 4GIRA 5A8OA 3MCMA 1OYBA 3P81A 2QUTA 3O6YX 2PC4A 2YVJA 1XD1A 2OSXA 3FAWA 1RXOB 4XD4A 4ROQA 4IIEA 2WMKA 1KCXA 2XH0A 4UTLA 3KBNA 1QW7A 1SJBA 4JY9A 3GXPA 1Y65A 1O6IA 4TQTA 3W38A 4MUPA 1YLVA 4QAWA 4EXAA 4BF5A 2J7CA 3GLCA 2AGTA 4JAWA 2FGLA 1KKOA 2PI6A 4WHBA 6TAAA 4M82A 3GG8A 1P6BA 3UERA 3NXFA 1M04A 3LXCA 3BL3A 4TMBA 2OPJA 1DXEA 3NQGA 4M24A 2VR4A 3LA4A 3QBUA 4EF9A 3MMUA 3G0UA 1GZGA 2ZFAA 3ZWTA 4QAIA 5I09A 3N2XA 5JBEA 1UC4A 1A50A 4NZ3A 3DIPA 5DBUA 1EHAA 3ELFA 3MUCA 1M41A 3KDOA 2TAAA 4HA3A 2BTMA 3EX3A 3W22A 4V27A 3FJ6A 4QG6A 2FZNA 4HNVA 3CMJA 3P62A 5EFFA 3NFUA 3OC4A 4A21A 1SFTA 3ES8A 5C7VA 3AZRA 1FKWA 1WZKA 2WZIA 3GIQA 3VKAA 3T0AA 3V5CA 5HNRA 2BCPA 3AO0A 2OXNA 3LB0A 4LVBA 4GZJA 1BSLA 4PTXA 3WMLA 2WLYA 4NQ1A 3WELA 3WF0A 4GNJA 1HUVA 1J2WA 3HO8A 1AZ1A 1DJHA 4MVAA 4INFA 2ZA3A 1KV8A 2GOKA 5AHEA 1H61A 1H7OA 4CD4A 1FCBA 2C15A 3GY1A 1W3TA 1Z32X 1FY6A 4GVGA 2V3AA 4TVYA 3EGJA 1S5TA 3SDOA 2Y88A 1TYPA 2VR2A 1PS9A 2VX7A 1PEZA 1XG4A 4Y8EA 3RIKA 3WD4A 3S5SA 3UG4A 2DW7A 1TMLA 5GJPA 3CZLA 2I57A 3EANA 3W1TA 1VIZA 1W56A 3EWZA 3E0LA 5IDZA 2PWHA 4AXKA 2CZ5A 3BQ5A 2PEVA 4H04A 2BGQA 3UZ5A 4D6EA 3UVAA 2NXGA 3N6JA 5I3DA 4IPIA 3VA8A 4RNFA 2XM1A 4BI5A 1GQLA 4JYFA 4PB3A 4AHPA 2QJIA 4HK7A 4IGHA 2HSAA 1ZQ5A 3GTFA 4H7ZA 3C0JA 2BY3A 2CLMA 1HO4A 4ZFCA 4M6UA 4JXCA 1KTNA 4AHOA 1T7LA 2E6DA 2IKGA 4OFCA 2QDHA 3I7QA 1XYLA 3W24A 1S7MA 1OIFA 6REQA 4J3WA 4MDPA 2XH7A 5A6BA 3DX5A 3TTQA 1RP8A 4PMZA 4D8LA 2BBFA 4PSRA 1ISWA 3WY1A 1GOIA 3QJAA 1TB3A 1DJXA 2LLEA 1GSNA 2XFWA 3UZWA 2GQ3A 3HQNA 1KXTA 3S1VA 3TVAA 1RV8A 2E4TA 1W91A 3RO8A 4DZ5A 1VHCA 2QQ6A 2PTWA 3OLEA 1U2YA 3TU9A 3L2IA 3N15A 3BE7A 3NPUA 3B0YA 3A3XA 1E6SM 3LPFA 3ABRA 4RUBA 2FGBA 3R0DA 2XDFA 1TKKA 5HANA 2OR2A 5FF3A 3LHWA 1M53A 3WDQA 3TC6A 2ZXQA 1QNQA 1PXGA 4Q4QA 4WJ8A 2VVSA 3QM3A 3M0XA 5C9WA 5C9UA 3VMNA 3SW6A 3SEPA 1XV8A 1XPGA 1FX6A 1AL8A 2XGZA 2PD9A 3SR6B 5GPRA 1SU5A 3DESA 4IX2A 3UG5A 2GR0A 4RW5A 4IQJA 1B90A 1VD6A 3VINA 1X7FA 3C0LA 2GH5A 2WOIA 2DZAA 3SQSA 1XANA 1QPQA 1UR0A 3DGZA 4EF8A 1W5NA 1A5MC 4NAEA 4WR3A 3CZKA 1TV3A 3L2MA 3MMWA 4IPJA 3LLXA 2OSWA 4O4VA 2PDIA 4FNSA 1E6XM 4S3GA 1V02A 1RBAA 2Z1VA 3C8FA 2VFGA 3NDOA 3W2KA 2PU0A 4GZIA 1Q1WA 1XC6A 1EXBA 2J78A 1U5VA 3GDMA 1BFNA 3C61A 1EL3A 1OJTA 2BC0A 3BC9A 4Z17A 4XB3A 1XX1A 4Z2HA 4GHRA 1VPQA 1GRHA 3MKVA 2FKPA 4AXNA 3T0TA 2W61A 4HZMA 5A8PA 4NXKA 2CLLA 2HWGA 2W9MA 3L5LA 3NVWB 2GZXA 3CT7A 1ZXIC 4F0LA 3EB3A 1DXIA 1PWLA 2J75A 3KBWA 1OG6A 4XD5A 3V5FA 3LHZA 4HVXA 1R87A 3LXDA 1FWTA 3RM4A 4M1BA 2PDMA 1WUFA 3O6CA 3HIJA 3SQPA 1QK0A 3GHRA 2A7NA 3I6EA 3LY0A 4EOUA 4YTUA 4PEKA 5CEWA 1UR4A 3H53A 4DJEA 3IUHA 4ZXOA 1TV5A 1LUCA 1XDMA 3PHAA 5A94A 2BS9A 5JUVA 3BLKA 4DBWA 4K37A 3WFZA 1Q6GA 3PZGA 1C8QA 1JL8A 3A24A 3UXLA 1V51A 1TV2A 2BSLA 1BG4A 4FF7A 1UROA 1OBAA 4IFKB 5CZKA 1TO3A 1ZMCA 1YNYA 2JK2A 3CB3A 3GSMA 2QMJA 4PCNA 3NQ8A 3H23A 1HVQA 1E15A 4QQUA 2BFGA 1O94A 1L2UA 3BZGA 5FACA 2DW6A 4QISA 1NFBA 1RD5A 3ARSA 3EOSA 3BH4A 5I3HA 2VC6A 3G2GA 4K8DA 3W28A 1HQTA 4GFSA 4FALA 2XZ9A 2PGEA 3H54A 3BLFA 3GDKA 3PULA 4EE9A 1EPVA 4YTRA 5EMUA 4PSPA 1WXZA 3P93A 5KZ6A 4N02A 3OVPA 4TX6A 1XLDA 1LT8A 2WVTA 1MRQA 3N4EA 1J10A 2GRTA 1Q65A 3QGKC 2RAGA 3W76A 4Z2KA 2OZ8A 3RK8A 1FECA 3G6LA 4YTTA 4IPPA 3LBOA 4UTKA 2A2IA 4JD4A 3ZS4A 3OVQA 4RE4A 1WAUA 4XD3A 4YLWA 3CAVA 1MXSA 4UMBA 3B04A 5AN7A 4LGXA 1POKA 3Q45A 2JKPA 1UB3A 4O14A 3QFAA 1QCWA 2V81A 3GNNA 3RYSA 4ATWA 1FWGC 3EOEA 3LK6A 3NO5A 3RAOA 2SFPA 4R85A 1VBGA 5DMYA 5H91A 5JMUA 4KIRA 3IUDA 3I10A 1EBHA 1H7XA 3SCVA 4E8DA 1PVNA 3DDMA 4K8HA 4CUCA 1REQA 3RNDA 1FWHC 1LQ2A 2EKGA 3WLJA 4AEFA 1R9ZA 5BYWA 4AHQA 2DZPA 4HCLA 1V6TA 1VYRA 2Y8VA 3A22A 2A8XA 4UNLA 3ZMRA 5FMHA 2ZVRA 2AQVA 4RJEA 5CGMA 1X2GA 1VLWA 4FLOA 1RHCA 4CN4A 2WNWA 3H4WA 2GDQA 1OFPA 2Q8LA 1W6TA 4TUFA 3I4EA 1K9FA 4H6QA 3XIMA 4W8AA 1YEYA 2C8NA 3DXIA 4JHZA 2BX7A 3TQPA 1JRPA 1MEIA 4ZQNA 3V35A 4Q7NA 2JE8A 4D2JA 3VO0A 1AQ0A 3OLDA 3NJ3A 2ISVA 4AB4A 1WP6A 3RDKA 5FSEC 4OHQA 2PWGA 1FXPA 2OEMA 1B9BA 3WQ6A 4YXGA 3GH5A 4ZEPA 3QMTA 2VZOA 3STPA 4UQAA 4ML9A 1LROA 2FB3A 4BQ5A 3LPGA 1B54A 1TA3A 1JDCA 1HJSA 1AG1O 3JZUA 4L9XA 2ZX9A 1UBSA 2YSWA 5A6BD 4EPEC 4JYDA 1RQBA 2QHAA 3MBFA 2EQ8A 1SJCA 3KP1A 2EEXA 4P8XA 4LBUA 1I4NA 5FS8A 2YCEA 3N9SA 2DV0A 2NUYA 3VE7A 2YLAA 3CPRA 1AJ2A 3O0HA 2W0HA 5DFAA 3WLMA 4G5DA 2PDKA 1A3XA 3O2LA 3QHNA 1W1TA 3W7KA 1J6PA 3W23A 4LFYA 3NNTA 5AYBA 1WPCA 3U2CA 4GYPA 4HKPA 3TW6A 3G1FA 3EMQA 3ZR5A 3W6MA 3RNMA 1VH7A 5HMDA 1ISYA 3NEVA 2CKSA 4H9VA 4FF5A 1S2TA 4UXDA 3FJNA 1KRCC 7REQB 3W81A 4ZMGA 1HN1A 3VU2A 1QNRA 2CLKA 5FAGA 2FZDA 2NX3A 5HR7A 3RF9A 4V1YA 5I3GA 1W9DM 3W7GA 4M56A 5HJYA 3G0SA 4ICCX 3ABXA 2Y89A 1ESWA 2Y2WA 3OGVA 1O95A 3M5YA 3TR2A 2OZTA 1SMAA 2ZZCA 1XSKA 2J47A 2WWCA 3QY6A 3W53A 1ADSA 1DE6A 3OHIA 4JICA 3B9OA 4JTGA 1RPKA 2HXTA 4O13A 4O50A 2BNJA 1HGYA 4NXSA 1LWHA 3OG3A 1AUSL 2Z28A 4QSFA 4E0CA 4GG9A 1KWKA 1O7AA 3CUXA 1TPFA 3KCLA 1WDPA 4UTTC 2D0HA 2J7DA 1T41A 3S1UA 1F7BA 3KOXA 2EPLX 2FB2A 1K8ZA 3RRXA 4ZTXA 2QVNA 3TQ0A 2YCLB 3W70A 2YBUA 3T07A 4M51A 3TCEA 3UJEA 4EXBA 4UR7A 4REQB 3QF0A 4JPGA 2CCRA 1AOGA 1KFBA 4F0RA 3O9NA 3QEZA 1GZ1A 4GIYA 3REQA 1PCKA 4BQ4A 4DJDA 1HVXA 4UZUA 3UZZA 5KTLA 2XIIA 1MNSA 4NRSA 2GGGA 2QYGA 3G22A 4HNUA 1J79A 1DQUA 3UXDA 4HBKA 2BLEA 1J0YA 1R7AA 4ML4A 1TWWA 4H6KA 1A0CA 3VGDA 2NVAA 1B3ZA 3NL6A 5F7UA 3E5PA 1VJIA 4DJED 3WIJA 4AZ6A 1OK6A 2R1NA 2CLEA 4QR6A 3BSMA 3H2FA 3GRIA 2CZFA 1YE4A 1NFGA 2RDXA 5IOBA 4KBXA 5F2MA 1JYXA 4JNZA 4J35A 2PF8A 1B3XA 1PCWA 3MZ2A 4J3UA 4CQCA 2YYUA 1LLZA 1HF6A 4PEEA 2X8HA 3U6WA 2UY2A 1FFRA 3NSXA 4FS9A 1MYRA 1Q7ZA 1XGEA 4XAGA 2VC9A 3ORWA 2FZ9A 7A3HA 1NP2A 4ZOCA 2YXOA 1K7XA 2HS6A 1QOPA 2FH8A 2Q3OA 1VPYA 1TWSA 1KBJA 5C9ZA 4WD0A 4LNCA 4JFSA 3IEBA 3Q37A 5J5DA 1EEXA 1JZ7A 1K1DA 5REQA 4IF2A 3CPGA 1BXBA 1DV7A 3N4AA 1EJVC 1FBAA 2DT3A 4L6DA 4J28A 2I9UA 2WJZA 3UCCA 4GY7A 4PUDA 1JOAA 1S3TC 2YBVA 1GVRA 1V6VA 1GQKA 2VGBA 3ITOA 2PDWA 1W8GA 4JKLA 4DYJA 4FNPA 5AY7A 3JVAA 5DLCA 4DWSC 2GLKA 4B2DA 1KM1A 2O56A 1ONWA 4H4VA 3TSDA 1RLDA 5I3KA 4NU7A 3JR2A 3KBVA 5CJNA 1NY1A 3W07A 4LY8A 4GPNA 3GNDA 4GC3A 2E6AA 4UFKA 3EWCA 2V5DA 3WK2A 1E72M 4DF1A 4I9JA 4AWEA 2D2JA 2O0TA 4BI7A 4DWSB 1LRNA 3SURA 3L4VA 3RR1A 5HWJA 4ZENA 1O1HA 1EX5A 1NHSA 3F4WA 4AWTA 3EWDA 4KEUA 3EDEA 3GO2A 1IXNA 2VOMA 4KEMA 1C8VA 1QI5A 4AZ5A 3TMLA 4OV4A 4Q4MA 3RCMA 4LJ3A 4NF7A 4H9MA 4M7TA 4E3VA 4G7FA 1H49A 1UKPA 4N7QA 1RAKA 5EYWA 3QGVA 4EK7A 1UR3M 2D22A 1NOFA 2EQ9A 3RMJA 3U57A 1UH2A 2V2HA 3S9IA 1KXHA 1R3VA 1HX0A 5BU6A 2WMIB 3RX3A 5EGRA 5JBFA 4OIFA 2VI0A 5U4NA 4P7OA 2QIIA 4IP7A 1ECEA 3USZA 3ENLA 1KV5A 3UA3A 3TFXA 1NWTA 5A5WA 1MQRA 1JDDA 3T6CA 2HK0A 4RK8A 1JZ4A 1W3NA 4WY0B 1OEPA 3MP5A 4TIMA 2Z25A 3WDJA 1R38A 2CZDA 1GHRA 1XRFA 1XM3A 1EYWA 3VAVA 2VL4A 1WZLA 2YA1A 3M0ZA 2CLOA 3CQIA 2F6XA 3TYUA 1DWIM 3B4YA 4FHAA 4LYPA 1EJXC 1PZ2A 4CNNA 2GFTA 3QPYA 4ADTA 2C18A 2D3NA 3W7CA 5AYYA 3G3MA 2X8CA 2X40A 5F4XA 2JEPA 1W5QA 3AZSA 3WKZA 1U1HA 2DSUA 1R3WA 2OZ3A 4S3CA 4GX9A 5IM51 3E2SA 2I9EA 2QT3A 2J25A 2YL5A 4PE8A 1YIXA 5D9MA 1P0EA 2E3ZA 4U2ZA 3A64A 5LA1A 1T96A 3IVUA 5M3WA 2WWDA 2XVPA 1E5JA 4M29A 2CBVA 2Z27A 4KEZA 5DMLA 1QR7A 3W83A 3WH9A 5IFPA 3G5EA 1F76A 3W6YA 3M0LA 5EBAA 4BWLA 5HA7A 2UY5A 4H6RA 3FYPA 3ATYA 3DAQA 3KTSA 1KA9F 3IJDA 4XX6A 1W5OA 3PJWA 3H2AA 3TXZA 4CNPA 4D71A 4MSSA 3DCPA 2G3FA 1GCYA 3PR2A 3GZAA 3FSTA 2QPUA 1IQ8A 4QS5A 4I9TA 4KMQA 1S2AA 3KBMA 4YYCA 3P80A 4FPSA 3TTOA 2X8RA 1IE7C 2HK1A 4QG8A 3HQPA 3VCCA 3FV9A 2XG9A 2C6QA 5C2GA 4HMDA 3GWQA 3R25A 3DECA 3WUBA 1MW1A 2PDNA 3MY9A 3GDLA 1GETA 1OT2A 2A6LA 3BURA 1GRFA 4YHGA 1HG3A 3W85A 2L5HA 4CU7A 2VRJA 1S1RA 5CQ1A 5FS7A 3W29A 1F9CA 4WSHA 5F2LA 1HKVA 1A3WA 1V6UA 4PMXA 1XISA 1RY0A 1XIIA 1G7UA 2NQ9A 3M41A 3AWOA 3E74A 1VBHA 3WJSA 3G3DA 3BGGA 3IK4A 2AAMA 4IJCA 6TIMA 2I5IA 1TUXA 1AVAA 2P3ZA 1XRVA 2YAUA 3LBMA 5C5YA 3C2OA 3MO4A 1R47A 4B5NA 2WKLA 5G1TA 1G4EA 1MZHA 3GTIA 3AOFA 1EEPA 5HWMA 1EUAA 1HL9A 3H12A 4ZSUA 3DK4A 4M6VA 1KM5A 1EZ2A 1WKYA 1ZP3A 3GNPA 3HBLA 1XH1A 4NVTA 1VCVA 1ZDLA 3KEHA 2EHHA 3LDVA 3SADA 5G5GB 1OQFA 4AC7C 1KGUA 1ME9A 1PIGA 3DN5A 1NHQA 4GVIA 1FWIC 3UWYA 3FFSA 1AW1A 3RXZA 3PPFA 3U7VA 3GRSA 1JCXA 5E09A 1TIMA 3OYZA 2QEZA 1V0NA 3UWVA 1FWFC 1RA5A 3F03K 4DJDD 2PDFA 5A6TC 3NPVA 2YW3A 5G4HC 4AMAA 1DYSA 4FIRA 1KXQA 1XLJA 1WDRA 3BAIA 3P0WA 3A47A 3GK0A 4QCEA 2OLSA 3QLDA 2ZUNA 2YXGA 3QTGA 2C1IA 4EMWA 2I1OA 3M7WA 4KF1A 1XYMA 3UR5A 4C6NA 3BDKA 5JBDA 4PMVA 1XYZA 4FX9A 4K2SA 3QMSA 4QE4A 1MMFA 4MWAB 4F0HA 2ESCA 4JHMA 4WDTA 1M7PA 1OX5A 4CCCA 3PFRA 3AQUA 3GDBA 2VZVA 4QJ4B 1HXJA 4HSNA 3PAJA 3UETA 5FJPA 5LIYX 1FDJA 3QC0A 4Q7BA 4MFEA 5F1UA 1E4NA 1BTMA 2CETA 4WDWA 4G1NA 1PHWA 2R1LA 1OABA 2D3LA 4B3ZA 4NILA 4Q4KA 3ZSTA 5JIPA 1TYTA 2Y61A 4W8BA 1U1UA 1WZMA 4FA3A 5KITA 5F2IA 1W3JA 5XIMA 3SUWA 3V36A 3UXKA 3KVLA 3PZQA 3UGVA 1X97A 1K8XA 3ARUA 4UB9A 1JRCA 4DQWA 1PDYA 3C4UA 4JTFA 3SCSA 3LADA 4NP7A 3V0SA 1ZBKA 3RITA 5HUPA 1M6JA 1AJZA 3FIGA 3WD2A 3F5JA 3TA6A 1LORA 4UBPC 2TSYA 2INZA 1U83A 4PMUA 4LAZA 3GYEA 4NNCA 1TJ0A 3VFCA 1TR9A 3P5ZA 4X2PA 3H26A 2R94A 4B2DD 3PPGA 5D8WA 2PTDA 2X7WA 1K3UA 3U9IA 1KBIA 1EHNA 4D8AA 1EIBA 4IL0A 4L56A 4V33A 1M7OA 1YPIA 1WX0A 2XN0A 4ZOBA 2VRKA 3MHFA 3W02A 4G7EB 4A22A 5JCIA 2P8CA 4UCFA 4GZEA 3E3HA 1FWSA 2FMOA 4DPQA 2OVLA 3B0XA 2DIKA 1PO9A 2QUMA 1TWZA 2VO5A 4UCGA 2VC5A 4L6OA 2WHJA 1BAGA 3ALGA 2ZUMA 3UESA 1GJWA 3EMCA 1JAKA 3L4YA 3UBPC 2GK1B 3A4XA 1OFQA 1J5SA 3ITLA 2ASHA 3P8JA 3CUIA 3HU7A 1JQXA 2FYMA 2PZ0A 2PGRA 1LRTA 2B7QA 3DHUA 2VD9A 3WDRA 2NQ5A 3GTXA 4KWVA 5DY3A 3GU1A 1OCBA 1RBOB 2Z29A 1J6OA 3KL0A 3W4RA 3K5XA 3KDNA 4TOQA 1ISXA 1Q4WA 2BOFX 3WQGA 5HAOA 1I0BA 3VGEA 5JCMA 4M6PA 2AAAA 1SFLA 1HKKA 1WNOA 3H55A 3VDHA 3VM7A 1R2TA 3FOKA 3QFBA 1EXPA 2A1YA 3NSNA 4FZIA 3IIXA 3ABZA 1XW8A 2OWWA 4F4RA 1R7OA 4X9YA 3S6TA 4NZ1A 4CEUC 4O12A 3G1RA 5LKYA 1TPVA 4MNKA 3DK9A 3BG9A 3TN3A 1ISVA 4N9DA 5K9XA 1BRLB 4F0KA 3BJSA 1K7FA 1MXDA 3PTQA 1G6CA 4BR1A 3WQ8A 5FJIA 1N60C 2D1ZA 2JKEA 3NDYA 1NWUA 2PZNA 3P7YA 1FH9A 3EKLA 1XIGA 1XGZA 1KM0A 5A8QA 1Q6RA 3BAYA 3WMBA 2VGGA 4YIWA 5D38A 4DJFC 3ZQ9A 4W7WA 2PAJA 4MWAE 1YBQB 2DH2A 4GE8A 3URAA 4GMEA 4Y9MA 1I1XA 1V77A 1D7FA 3P82A 2VX4A 2QCFA 1H50A 5KSWA 3V3WA 2X42A 2OJPA 3QYQA 2GJRA 4LAMA 3MUXA 3AN1A 2HE8A 1FCQA 1ZLPA 5IHRA 3WNMA 3EPOA 2E8YA 1SUXA 4DBUA 3LM7A 4RE2A 4GUGA 2XISA 4C6KA 2XVGA 3MYOA 5BWFA 2VM8A 1OIMA 1PTDA 3AU6A 5H6HA 4UQDA 1EGMA 1ME7A 4HU0A 3HOJA 4LY4A 4CNSA 3STCA 2I14A 1W9UA 3CUGA 1Q5MA 2DSZA 3F4NA 1A5NC 3S4TA 4H4QA 1ZRQA 5MHBA 4TMCA 3SN0A 4CQDA 4RV8A 2IW0A 2R6OA 3G1YA 2QJNA 3AS0A 2OQHA 3EBVA 4CVWA 3M46A 2VDIA 3M6DA 1FH7A 1JPHA 3DFOA 3KUMA 4ZO7A 1K02A 3H4KA 4GNVA 4TVDA 1N5WC 3QR3A 2QNEA 3CQ0A 3QW3A 4GY0A 4PTNA 3GU2A 4TU1A 3G1HA 3BSGA 1PZ3A 2XVKA 2VFFA 2CWNA 4QG9A 5FEXA 3NZ1A 3WLKX 2JK6A 1M7XA 3HM7A 2C19A 2GVGA 5ABFB 3HURA 1ELSA 3KLJA 2WW5A 2ZZ1A 2OOGA 4XZLX 4ZFMA 3JZEA 2CKRA 3LG3A 3AS3A 3UG8A 8A3HA 4V2XA 4GQBA 1ZUAX 1BTCA 2FMNA 3M44A 1BSIA 2D20A 3DFHA 3N12A 2J8FA 3GVRA 5J8LA 3NRZB 4JTTA 4DO5A 5FF7A 1F73A 3W7OA 2Y5EA 1UHVA 3N11A 5ENLA 3P6LA 2J66A 3C56A 4H4XA 4IHCA 3ISIX 4FR6A 1Z69A 5E6ZA 1WAWA 4E6MA 3HN3A 2RJHA 4OVXA 3FLUA 1JF5A 1QASA 4QROA 3WK0A 3OB8A 3BOLA 2VEIA 1FDZA 1UJQA 1FOBA 4S3JA 5D05A 3SR7A 2RH9A 4HPHA 5CJMA 4EMIA 4MLJA 5EY5A 5TAOA 1ONFA 4YNGA 1GVQA 2EBNA 3SZ8A 2VDHA 2GQAA 2FVMA 3P3BA 4PCSA 3VVGA 3WQPA 1XIEA 1XPYA 1E55A 3M9YA 4OOUA 4Y9AA 5BXSA 4ALDA 4HHLA 2CPUA 5D33A 1LG2A 1E4IA 4RDVA 1GKQA 3MI2A 4IP5A 5CSRA 1MFVA 4GH3A 4WKAA 4XAZA 2WZTA 3EB2A 3WLLA 2EPKX 2WZHA 3RM9A 2ADAA 3M7SA 4NJJA 4H8NA 4H9XA 4U4MA 1MO0A 4TVCA 1MDRA 4FK9A 7ENLA 3RM8A 3WFAA 3WEZA 1TV4A 5T8GA 3S83A 3W1XA 5CSUA 4XAFA 3SBFA 3SO7A 1WKFA 4XZWA 3MYPA 2CIPA 5PTDA 4RDZA 4EM4A 4JR5A 1TRIA 2DUAA 4I9AA 4OT7A 3VKJA 3SQMA 2DY3A 3TYEA 3H70A 3K4AA 4IT1A 2QDGA 3A23A 3E1F1 3VGGA 4MAVA 3TTSA 2CZEA 3G0XA 1MUMA 1UD8A 1I45A 4Z42C 3BCFA 2EAWA 3LLDA 4CGTA 2YL6A 2B7NA 3ZJ8A 4H3DA 3A21A 3GR7A 4QITA 4B3KA 4JQ4A 2WKJA 5FESA 4O11A 4YWSA 1C29A 4US5A 2E0PA 2FZBA 2BV9A 3RJXA 1E71M 4PFHA 2FPTA 4IXXA 3DH7A 1JI2A 1RK5A 3HGRA 4QS6A 2UV8G 4LX4A 3WYZA 3UVIA 1HKJA 2YW4A 2GGJA 5D04C 1BKSA 5TQLA 1QRQA 4Z1DA 1YDNA 3RILA 4F2BA 4LYRA 3AHTA 4HTBA 4ZODA 1P5BA 5B80A 2F84A 1SW3A 4C6DA 4HSOA 2CW6A 1M7JA 4J3SA 1FWNA 3RLUA 2YVGA 1UR1A 1AL7A 1PPIA 4RNIA 8TIMA 2J9ZA 3GFXA 4CNUA 1W1YA 2WO5A 1N8FA 3UZJA 3NVYB 1CPUA 1TPB1 4F0SA 3EOUA 5HPCA 4IGNA 3C52A 4MM1A 1RA0A 2V5BA 1L6FA 1Z7AA 3SCQA 3C0QA 1VBRA 4P2VA 3EEGA 2PTXA 2XH2A 2VR5A 4FOUA 2W3ZA 3TJIA 2XINA 4AWSA 3L4UA 3EEZA 2J7EA 1JEHA 4PUJA 3SCPA 5BOFA 4I8DA 1J0JA 1YQ2A 5T9CE 4PODA 5AHLA 1QO5A 3GS6A 3LI0A 3CM4A 2H6RA 3DFPA 4DB7A 1YHTA 4HHHA 1V93A 1DJWA 2X2GA 2VUYA 3VIIA 1E5NA 4GD0A 4QQ3A 1PX3A 2PWEA 2PDPA 4DI9A 4EMJA 3ONCA 5I23A 3APGA 4DZHA 4A4AA 3H22A 4I5RA 1F07A 3GFZA 3UT0A 3NM3A 1KTCA 2I16A 2HMCA 3W9ZA 3B8SA 1SFJA 3ARQA 2EG8A 5BW6A 3AISA 1E9LA 1LT7A 2WSQA 3OQ8A 1ZU8A 2P5NA 2C71A 4XG1A 4Y8FA 4F9JA 4WQ6A 1RD6A 1H3GA 3W2NA 1OT1A 3G77A 1R3QA 2XIJA 1FQ0A 1JPMA 3S5NA 1PTAA 1T8QA 4DWDA 1EP3A 3WSUA 4H01A 1R30A 3DI0A 5IBXC 3I68A 1CI1A 1Z9AA 4ZZ9A 3L7RA 1GJPA 3KHDA 1NDWA 2DVXA 5CC3A 4ORMA 3T8QA 2VFEA 1JPIA 1UUQA 4S3KA 1UMYA 3S0CA 3F4CA 3PG6A 3JS3A 1PKYA 5C54A 2QR6A 1T3QC 3MUAA 1TMQA 2FDSA 2J27A 1R9XA 3M07A 3UP8A 3LV6A 2X99A 5ABTA 1N63C 1J11A 3A9BA 5AECA 4BEUA 1Q3NA 2P1FA 1BYDA 4NZCA 1UWIA 4JNYA 1UP3A 1Z48A 2GUUA 3AC0A 4OBSA 1A5SA 4I3GA 2V9DA 5CG7A 3T44A 1LBMA 2PSNA 4QE5A 4D6CA 3P74A 1XYAA 3W2MA 2XH4A 3TA9A 3S9YA 1XBVA 3U5YA 1GRTA 3NEHA 3T05A 1TV7A 3HPFA 1HP5A 1UZ1A 1Q6QA 1Q7MA 1LQ0A 3Q6JA 2PE4A 3FXGA 3QZ6A 2RUSA 3IK2A 1S46A 4JTJA 3ZJKA 1DQXA 5GNXA 1W1IE 1TTPA 3GTHA 1TSIA 2VEKA 4AF0B 1GOXA 3LYEA 3M0JA 3C2VA 4AAJA 1YNQA 1HKIA 4IFKA 2ZXBA 4DUXA 2WPEA 3T2OA 4OGZA 1NM9A 1XLHA 3DFTA 5A2BA 1J0IA 3MBDA 3O15A 5KZEA 4A3HA 1A5BA 2XJ7A 3EDFA 1VR6A 3I7RA 2JKAA 5GNYA 1E6QM 1AD4A 4UQEA 1G67A 1QNVA 4C1LA 4MB3A 5C70A 5K9CA 3S5ZA 3VOIA 3H21A 3BICA 4ZOAA 2J7BA 3SCWA 1ODUA 1N55A 3MUZ1 3RPTA 4QLJA 5FEWA 1J4EA 3IUIA 2V5CA 4KQNA 4MB4A 3W1MA 4DLMA 4Q4OA 1JCYA 1JDAA 3GUGA 1R46A 2NT1A 2Z1XA 5C7HA 1XBXA 2YDAA 2WMJA 3GH4A 4MNLA 3K4WA 1FP8A 3AIUA 3B9AA 3AYSA 3DU0A 4PUNA 1VDVA 4MPKA 2ZRYA 4MMWA 4CCEA 1Y5WA 3S6DA 3LUTA 3UWZA 5BXRA 2R91A 1YPXA 1B3YA 3SFWA 1QHOA 4XVDA 4GA8A 2Z7KA 1XXXA 4XSLA 3RU8X 2C13A 3DGRA 1Q7QA 4A2RA 1HL8A 2NX9A 4GXMA 3AS1A 1GEUA 3W1LA 4B5VA 3WBEA 2WVSA 2IKIA 3QY8A 3JW7A 3VZYA 1WOAA 2Z6JA 4WLCA 5AYZA 3VI2A 3AXXA 1X1OA 1R86A 3PF3A 4JTLA 1IXPA 2G41A 5I2UA 4ZQOA 1V97A 2BXZA 1V3IA 4LEQA 1K70A 3AU2A 2YL8A 3ARRA 1KBLA 4PCFA 1BG9A 1FIQB 2BWGA 4GVHA 1M01A 3SJNA 1HJWA 2D2GA 5D9PA 8XIAA 4US5D 1K8YA 1XIFA 4Z1YA 3B9DA 1IT7A 3TOPA 3B0UX 3ITCA 1UW9A 2A6NA 4JX4A 2QAFA 1EC7A 3O05A 5XIAA 2GJLA 2ZVIA 1DNCA 4H4RA 3W7DA 2JF7A 4CQBA 3G18A 3K13A 1UD3A 1FHVA 2PDJA 3DUGA 3QC3A 4WDXA 2XGIA 1EQCA 4S3BA 4LAUA 4IL2A 3IRDA 2VURA 3VOFA 2Y62A 2BGNE 2W3SA 1B2YA 1OSEA 3EWYA 3PG8A 5HNUA 4H8VA 3CWNA 1SSDA 3CHEA 3UF9A 2HQMA 1XQLA 1ICQA 3PN8A 4DZIA 1ENUA 1MWOA 1JAEA 2NQLA 2EPNA 2G3JA 3CUZA 3L12A 3P0XA 2VCBA 4V1XA 3GD4A 4JHOA 4GRSA 1G4TA 3HJZA 4EAMA 3A5VA 4A8RA 1ITUA 2DH3A 2ZRVA 2QIWA 4GH1A 3UR2A 4WF7A 4W4QA 1KRMA 3W2JA 5LIWX 4NKCA 4XZNX 1GWJA 4K7VA 2XFFA 1LL4A 2J6XA 3V1PA 3TJLA 2ZUVA 5D2WA 4TX9A 2NVDA 3H4XA 3S3GA 4YPJA 3DJJA 1JUEA 1WBJA 5HJLA 2ZZ7A 2R9ZA 3C2RA 4EQWA 3OTRA 2A5HA 3FY1A 3T0BA 1Q13A 4D6IA 4K8GA 1RSCA 3WNNA 1NDYA 1LJYA 4WCJA 1DEDA 4LH8A 1KRBC 3FK4A 3L66A 3TYAA 1UH3A 4RDWA 4X9SA 7REQA 1GQJA 1OWQA 2O9PA 3W7RA 2J7HA 2RFGA 2V3FA 4LU0A 4W7VA 3Q58A 1R6WA 4WKFA 3W7MA 3BLEA 3PZOA 1UIPA 2OB3A 3SRDA 1BYCA 2WXDM 2BY1A 1GYNA 3GH7A 3OODA 2OCZA 3VUPA 1QNSA 1C7TA 4M0XA 5FJTA 1EOMA 3F2DA 3IC9A 3MC5A 4Q7IA 1N62C 1LF1A 1EC8A 3UY8A 4JDYA 3N9KA 4E3TA 1ADOA 4XAYA 4FX6M 4EKJA 4GZ7A 4C1NB 3H2MA 1QDSA 1LWJA 1S5VA 3W7PA 2DT2A 2WBAA 5RUBA 1UD5A 1DJZA 4XUYA 5I5RA 4GISA 1A5LC 4JOMA 1SO6A 4LNYA 1MW3A 2ZYFA 3LSCA 3KOWA 2BVWA 1JR1A 3URNA 2YCLA 3IJIA 3N2MA 4HHPA 4H9TA 1XCFA 3FW6A 4AY8A 1F6PA 1I6NA 1NOWA 1AMYA 4RZ4A 1GW9A 5D2TA 3C0SA 4REQA 2PCEA 3S9ZA 3IRSA 4IJBA 3NQDA 5D9OA 4UTTA 1G9HA 1OG0A 3LS9A 1CLVA 2G5WA 2TYSA 3TP4A 4JN6A 1RJQA 4KERA 1CGTA 5GVJA 5KEZA 2RHGA 2X1TA 4H4WA 4HCHA 1B4KA 3E02A 3TZFA 2PB1A 1H63A 4PUWA 3VE9A 2BOEX 3V1HA 1HW6A 3MW7A 3B3DA 1L2QA 4S2CA 2DP3A 5KVIA 2YYTA 1GREA 4KRZA 1VEOA 1JULA 4UOZA 3TN6A 3WUEA 2V3EA 3NZPA 3OLIA 2FTYA 2P76A 3GQYA 4PB4A 4KWOA 4HJWA 3EYPA 3W1RA 4E2OA 1W9XA 4MJMA 4HA4A 2G8ZA 3LHYA 3MA8A 1JRBA 1SO5A 5A2AA 3WL1A 3H24A 1BF2A 3PPHA 2FLIA 1PYFA 3VGBA 2ISDA 1V0LA 1TTQA 3B8UA 3G8RA 4J7RA 4UTIA 4LYQA 4Q8MA 5ABHA 1JUBA 2E6YA 5CPLA 1XG3A 3VC6A 3R43A 2PBOA 1PWMA 2Y24A 1EKOA 1LM1A 3WLPA 3N13A 4O1BA 4PL2A 3RHGA 3GXNA 2ABAA 2I56A 1JGMA 4WOQA 2QCDB 2RKXA 3BCJA 1W1VA 1ZB5A 4O4WA 1PHQA 6CGTA 1MUCA 3P14A 2PDQA 5HWNA 2QCLA 4BFAA 4IMFA 3ZFHA 4N9BA 1CWYA 4TX8A 1H2JA 2FJKA 1JF6A 2BHZA 1E6NA 4RR4A 1LOLA 1K9TA 4R9OA 3R79A 2QPXA 2VMFA 1MVYA 5C55A 5J04A 1QNPA 3N2BA 3LCXA 2X0YA 4JBRA 2ON3A 3WLOA 4GFIA 3N2CA 3SRHA 4PRWA 2FHCA 4G6CA 1Y7VA 1AW2A 1FFQA 3IGXA 1ZENA 1WV2A 5G1MA 2VEGA 4XD6A 1ZKQA 4GABA 1IGWA 3B05A 2HISA 2CFFA 4AZGA 2BVYA 3BMXA 5LA0A 4H4TA 1TJ1A 4HT3A 4DWSA 5LHEA 4C6CA 1UR2A 3DHFA 5GNZA 3IJLA 5DCBA 2OODA 4IFRA 4H83A 5C9RA 2W63A 1WBHA 1IZJA 4C6PA 2ZRZA 1Y8BA 1XQKA 2G3NA 4UR8A 2VD8A 1W5MA 3W7QA 3ZVHB 3PBGA 2B31A 3WQ5A 3G6MA 1JXKA 4RNJA 3IJQA 1NIUA 4FO4A 3EAOA 3TJXA 4JX5A 4Q8OA 5F2GA 2D0GA 1EF2A 5DCEA 4L80A 3ID7A 3NAVA 3BMVA 1QHPA 1SR0A 1TVPA 4FXRA 3PK7A 4NNAA 1U22A 2WMIA 3FN9A 4ERAA 1K6WA 1LG1A 4CU6A 2PTZA 2G3IA 2EO7A 5FF2A 3BV4A 3MKCA 4O8RA 1I2PA 3Q94A 3PY2A 4D6JA 2ZUWA 3SCTA 4WY0A 1NHPA 5LA2A 1EYEA 2GPTA 1EBGA 3LCLA 2OWCA 4PMQA 2G97A 3LNPA 1US3A 1A4LA 1W9PA 2C1GA 2J79A 3CC1A 4F8XA 1JZ3A 5AHIA 1JZ6A 4XKMA 2VZSA 1UWUA 8XIMA 3DZ1A 4B9ZA 1NEYA 3TFCA 2A3LA 3ABOA 1JCLA 3C86A 3B8VA 3TYZA 4IFOA 3V0UA 4EVZA 4WZHA 4A35A 3GXDA 4AZCB 1A0EA 1EJWC 1R5YA 1Q4NX 1KFWA 4QIUA 3AROA 3PWAA 2POZA 5LSMA 4O1EA 5TIMA 4LV9A 3EXRA 3BW4A 3MJMA 4CEXC 3NQAA 1Y5VA 5M03A 1V0KA 4IIFA 4F9DA 4QGCA 5KZDA 3QOMA 3BLOA 3SB0A 4R9XA 3GX9A 4JTKA 1WOBA 4DJEC 4Z1AA 4C90A 3EX2A 3H7UA 1DWFM 4UOJA 1C8YA 1CZ1A 3NYZA 3PJTA 4P5UA 1ZFJA 3TC3A 1KWGA 2ZICA 1MNZA 2RDWA 1FWEC 4GO8A 2FFIA 2IPJA 2GVLA 5HUOA 1UP2A 2TMDA 1XDLA 3VNYA 3QH2A 1TRDA 4ZTYA 2ZUSA 1WDQA 2NLIA 4I8YA 5GRTA 1W1PA 4LVDA 3R12A 1QU4A 2GJNA 3LN3A 4JDRA 1IEXA 1OFEA 2EQ7A 3RG6A 4OKDA 4B5SA 2TODA 3WJXA 1MO9A 4MY1A 2W92A 4HPNA 2OX1A 4O0ZA 2ATSA 3DOPA 3VKBA 3MVTA 4G1KA 2JEQA 4Y9PA 1MXGA 5I7GA 1OYAA 2CLHA 2NV1A 2ZUUA 4IMCA 3ZLHA 3S2NA 3TROA 1ICPA 3RJYA 4K39A 4JEQA 1JCNA 2WPBA 2ZRXA 1Z44A 1HO1A 3S5YA 1AA1B 3AIEA 4D9PA 1NDZA 3T0DA 4P7RA 2ACQA 4AU0A 3EX6A 3EMZA 1GXFA 2BGSA 1DTNA 3GDRA 2NQZA 3B9JB 4JCMA 4JIEA 2Y85A 1QTWA 1CGXA 1E9ZB 3VC5A 4AUBA 3EXSA 2GQ8A 4G56A 3BXWA 1XLIA 4W5UA 2BODX 5CPTA 3VK5A 4JQ2A 3W2UA 4FAMA 1LTDA 2O9RA 2ABBA 1KM4A 2WMHA 2WNNA 1IIGA 4KS0A 3QYSA 3GVVA 3VD7A 1O12A 5CC7A 1RQEA 5CZJA 4RV3A 1O68A 1E6ZA 1POJA 3UA4A 5LXXA 3STEA 4B4HA 3F4VA 1E9YB 4C6JA 4UTJA 1LCOA 1PZ1A 1BHGA 1QXLA 1YKWA 3NVZB 4Q6XA 5AVHA 1QI4A 3II4A 1P0NA 1MI3A 3CH0A 3BCDA 2NPXA 3PJUA 1RBLA 1V3LA 4AX7A 1WZAA 3FA3A 1J0ZA 3RMEA 1V3JA 1ICSA 3OBAA 1BWLA 2YR1A 4TVUA 1V6WA 4FI4A 4GOAA 3H4GA 1K9EA 1E0VA 1Z8AA 2VC7A 2VFDA 3I3DA 2BHUA 4I6VA 3U2EA 5A6MA 3IIPA 5E5CA 4DIAA 1EC9A 1Q2SA 3MQTA 1OGGA 1YXYA 1ZP4A 3DEQA 2ZZ5A 1IEIA 5E0KA 1TCMA 4PH6A 3A7RA 1Z6KA 2QULA 2Y1HA 3SCUA 4MWAA 1VBJA 1YNPA 1SW0A 3LMZA 1XL9A 4AYSA 5CKSA 2E68A 1IWAA 1H5VA 2HVOA 3MP4A 1AW5A 4YWOA 2UWFA 1TELA 3PP7A 1WYIA 1EBDA 3XISA 3EA2A 2BVTA 3KRZA 3WF2A 1OFDA 3GB6A 5EMJA 1X6LA 4NZJA 4WK9A 1Q6CA 1P4CA 1QK2A 2DJLA 4WXZA 1FRBA 1DP0A 3H7VA 2E1DA 1RALA 4UQCA 3TLLA 4GXPA 2WOQA 3TDFA 3R2GA 1OD0A 4HNOA 2UBPC 3DFNA 1K77A 3U7BA 2CLIA 4O0KA 4H4ZA 3N18A 3E0VA 2VGIA 3KZPA 1GVYA 1PIFA 4K8EA 3KL5A 2GQWA 6XIAA 1GVFA 3LGDA 5AHFA 5ABEA 3VGFA 3PZMA 3SJ3A 3CQHA 2HBVA 4WY0F 3KX6A 2DT1A 1MW2A 5IHSA 2Y6ZA 4C91A 3S2MA 1XKJA 3W7JA 3AHVA 4AIUA 1VEMA 2WCAA 1DIDA 4O52A 1AH3A 1RY8A 2DT0A 2V0TA 3PB2A 1MFUA 1SZFA 2ZZ3A 1RM6B 2X05A 3PTKA 3JU2A 1RCQA 1UUOA 2B81A 4EXQA 1B3OA 3SUSA 5K4ZA 1S1PA 3CTLA 4NSBA 3VCRA 1TE6A 2Z2UA 1CXKA 1S2UA 2ZZ2A 3N25A 3I6RA 4PL1A 2OGJA 3ZXWA 2FHBA 4LUIA 5BZAA 1AJ0A 1IXOA 1UP0A 2WPCA 2YB4A 5CGTA 3G1XA 3QHMA 4QLKA 2JALA 1OZQA 4XZMX 4G7EA 5CSYA 1V3MA 3VKCA 4DO4A 1A4MA 1V7AA 1P6WA 1B57A 4S3EA 1SYTA 3CHVA 3OBEA 4F0MA 5BNKA 2GK1A 4O28A 2WOVA 2A7RA 1QW9A 2WLZA 3VM5A 1KD0A 7TAAA 3GVGA 3EPNA 1VFFA 3CK5A 1X6UA 4RNHA 1VS1A 3IIZA 4ZOHB 4EQSA 5JCLA 4IP4A 1PKMA 3I4KA 2J8GA 2ZA2A 3UR7A 1WE5A 2E7FA 4S2BA 4CD7A 5G5HB 3WDPP 3EKGA 1XLLA 3NR0A 1PUDA 5EMYA 1DXLA 4A3QA 2PDHA 3O16A 1BVZA 2GGEA 5CXPA 1VPXA 1YDYA 1OX4B 2RDUA 1S38A 2FGZA 1BRLA 3N34A 3SCRA 5D2XA 4JQ3A 2I5GA 4HCDA 2FZ8A 2NUXA 2YPIA 1KRAC 1XYFA 5EFDA 2X8GA 2QS8A 1DJIA 2VENA 3EWXA 4E8CA 2QAEA 4D1IA 1F3TA 1W1B1 4PCTA 4A2SA 2HVMA 1ODZA 1CXLA 1JFXA 2CZVA 3PANA 3T1GA 3WLSA 1XWYA 1YBQA 4XZHA 3U0HA 2EG6A 3MSDA 3WH6A 2J13A 3ZIZA 1A80A 3W3OA 2FFCA 1XCWA 1V4YA 4IIBA 4GWEA 3CMFA 1H2IA 5I0DA 1GORA 1E1CB 1I2QA 2OQLA 3CYJA 4HNLA 1TPUA 3TUUA 3CGTA 2HVNA 4GJJA 3N6HA 1FTXA 4HK5A 1ECQA 4NUWA 3HB9A 1WDWA 2FHFA 4OUEA 3VMOA 4CQAA 4NL1A 4M7SA 3PC0A 2WMFA 5FOOA 1F74A 3PBWA 3R8RA 5HOSA 4QJ3B 4GXWA 3LXAA 5CBIA 4AD0A 3BSHA 3UD6A 5JXQA 3UEQA 4JKKA 3QZEA 1OGBA 1GOOA 5ABGA 5D30A 4AQLA 3CLWA 2V2CA 1GQNA 4Z2LA 1DIKA 2W62A 1TZZA 1H7RA 3AAMA 4XBJA 3AZTA 4MY9A 4DN1A 4UIOA 4TO8A 1XUUA 4J4KA 5G2WA 2UY4A 4PBGA 3CUFA 2J3NA 4Y96A 3KP0A 1CLKA 4LVAA 3LPOA 5FKYA 3K30A 4LCQA 3TYCA 4M8UA 1VYPX 1UD2A 4POCA 5C0QA 1D3CA 5AKQA 4M5PA 4AD5A 3OHMB 1XC4A 2W55A 4R3UA 2G96A 3IJ6A 4FLQA 3S1XA 3L0KA 1LL6A 4R27A 1P1XA 2WANA 4CN1A 3PTMA 1QATA 3MUY1 5HQLA 3K1GA 5AC5A 1UC5A 2HS8A 3VX0A 3VD3A 5ABFA 3PTDA 3OA3A 4AEOA 2VFHA 3WL0A 1AODA 1P48A 4ROPA 1XLKA 4RE0A 3AWNA 1GJUA 1TPH1 4ZE4A 1C92A 1V3KA 4GI8A 1W31A 4X60A 4K1GA 2B4GA 1LOQA 3H8AA 4HYWA 1UZDA 1NTHA 3ITVA 1SPQA 3AXKA 3W1PA 2IKJA 3WQFA 1JNEA 4ACZB 4GUIA 2PBGA 4LANA 3VNJA 3SCOA 3W74A 2R1MA 4GQQA 3KOFA 5U1OA 3B8DA 2PA6A 4M19A 3SIZA 3D46A 3H6OA 3L5MA 3TAKA 3EDKA 2P3EA 3TEVA 3CTTA 4FR1A 2CHNA 3ARYA 3D9XA 3GHSA 3QTPA 2YA0A 3BVJA 2ZDSA 5A69A 4MJ4A 1WDSA 4DY1A 1T0OA 5CC6A 5H1WA 1Z89A 1GONA 3S2JA 2HNEA 2C1HA 3CGEA 1SVDA 1MRAA 2AMGA 2EPHA 3TR9A 4JTRA 4MWAD 4DLFA 3GXIA 2QMKA 1S5NA 1X98A 3ITXA 2QCEA 3NZQA 2YX0A 4P61A 1PE1A 2PU1A 3TZNA 4J1OA 1JCTA 2CXGA 2AOSA 1UOZA 3BOFA 1IIHA 2ZX6A 4KH2A 3SUUA 3K8LA 4QDMA 5U7SA 4W8LA 4MKVA 3E6EA 4UTUA 7XIMA 5LYRA 3UJRA 3CIVA 1JG9A 3FS2A 1XBYA 1BLIA 5CC5A 2Z26A 3TJ4A 1L6YA 4C1KA 4AW7A 2W3RA 1K9DA 5FJOA 3U4AA 4DUVA 2F2KA 3E2VA 3T09A 4L1XA 3KTCA 3V5OA 1KKRA 2ZBTA 4UFMA 5AC8A 1W5PA 3L4WA 1X96A 4LUYA 1VQZA 4KWWA 3QKEA 2PWVA 5JH2A 4JNMA 3BQ6A 1FCVA 4NEVA 3ARPA 4BWLC 1JFHA 3HGOA 3ZR6A 3J7HA 3W7LA 1SMDA 2EG7A 1D3HA 1H60A 2WSRA 1VFSA 3CWHA 3WG6A 1KGWA 3C2EA 4PA8A 1JGIA 3UFYA 5G2HA 4LOCA 2G50A 2WP6A 2AAQA 4UTFA 1OC5A 4CNOA 4TVWA 3LHTA 3VOHA 1ZK7A 1GYLA 4UTWA 2NLYA 2X50A 1UWRA 2WC7A 4MOZA 2J6VA 4Y9OA 3DKJA 5HXMA 1VFLA 4JGDA 1KBBA 3TTYA 4GI4A 1EF3A 2J9XA 3HQOA 1RJPA 5T91A 1OGSA 3EOLA 4F3HA 3NOEA 4AD3A 3INPA 1C93A 4MZ1A 3W1NA 6A3HA 1US2A 4PRRA 1GG0A 1C91A 1TX2A 4I7WA 3VOJA 3U48A 3GBEA 1OVDA 4DBEA 3STFA 1JVNA 2QCGA 2FPYA 3GXTA 4QFUA 1I2RA 1HKWA 5BXTA 4K6AA 1J0HA 3LSBA 3T78A 4Q8PA 1N7KA 4AYGA 4JTUA 4ASTA 2F8QA 1WKDA 3MP3A 1HZYA 2V3BA 3AI0A 1MZRA 4HTYA 2ZKMX 2J8TA 3ZJ7A 4I7VA 4N6EA 2A3EA 1ZHAA 1M1BA 2DEPA 5EBUA 1X8CA 4EIVA 4X3ZA 1DKWA 3U2ZA 2TPSA 4J2PA 3WF3A 3NVVB 3W25A 3C8NA 3WNLA 2Y70A 1V6YA 3BOXA 3QFWA 4IIHA 4A05A 1GK8A 1TVLA 3AIVA 2EXOA 3FEMA 1GVIA 4QHRA 4LUTB 3WH5A 1JROA 4NY2A 3SN1A 3VIPA 1HJUA 3OG2A 2E9BA 3VNIA 1Y0EA 3FGCB 3IACA 4MZYA 3NIYA 3EB4A 4UFIA 4ENLA 3AMKA 4BJHA 1VEPA 3UYCA 4B9YA 3CNYA 1BGGA 1D8WA 5EPDA 3TTEA 5AYXA 2P88A 4FB7A 3M47A 3AICA 5LIUX 2ZXAA 3CWOX 1KM6A 4KCVA 4N6FA 5L9FA 5FEPA 1TPDA 3GW3A 4X0NA 4GYJA 2OMAA 4MFDA 1CTNA 1QI2A 3AXHA 3ARZA 3T2PA 3VTRA 5CG0A 2CYGA 3QZAA 2A7PA 5HK4A 3SECA 5DN1A 5AYIA 1HL2A 4D6FA 1GZJA 4F2TA 4IQLA 3GAYA 4PYSA 5FEZA 4W86A 4L9ZA 1ISZA 3POHA 3GBDA 5IBXA 1Q45A 2PDBA 2VZTA 4NAFB 3BLLA 3GR4A 1OFRA 2J4GA 3BLPX 3DYMA 3KCOA 4AVFA 2XM2A 3FX4A 4GNKB 3CV6A 4Q4RA 2OO6A 1HFBA 1K03A 1XLEA 4HZ7A 4KW2A 3HTWA 1OJXA 4TTGA 4L65A 3WJYA 3D47A 3K8KA 3DK8A 1NSJA 1W3HA 4NIRA 3IGSA 5F4SA 3S2LA 4UUIA 2WSYA 3ARXA 4QEEA 7PTDA 1W3LA 3F2BA 2XIBA 4DNHA 2GVEA 5I06A 3EOOA 2DPEA 1IXQA 2NWRA 4UTHA 2X16A 3P5YA 3PBYA 5FJUA 2C14A 3NQCA 5CZTA 1FUYA 2F7FA 5IXEA 1UWTA 2W5FA 4PUMA 4H2CA 4IG2B 5K2ZA 2V2DA 5IDIA 4FP1A 3VFLA 3SGGA 5A95A 3GU9A 4AF0A 4GKTA 2VELA 4O1DA 4Y90A 3LX9A 4KFPA 1QBBA 3TCSA 5HNTA 3TMQA 5C8BB 1E0UA 1UKTA 3DFQA 3ERPA 2PRMA 3TW9A 2CNCA 2OO0A 3W1AA 2YFNA 3A4AA 5CLTA 2OEJA 1EJ7L 2DZSA 1Q6EA 2AL2B 3TC7A 4KCTA 3VIFA 1B5TA 3CIWA 3CAKA 1W1ZA 1JPDX 2DZVA 1EB3A 1H4PA 2V6AA 3TN4A 4E4UA 2V82A 1DHKA 1V08A 2XUCA 3L4TA 3W88A 2Y5SA 4HQVA 4BF7A 5A6LA 3SUVA 4XIAA 1J0KA 3PG9A 4HA0A 1YPFA 1DIEA 2HEJA 5CBJA 5LNVA 4ADWA 4IM4A 2PP3A 4R88A 1J18A 2TRSA 1Q6OA 3IAQA 1B30A 3CL8A 3LPPA 5GQBA 4ZO6A 3FA5A 3QPZA 1OF8A 3OVGA 2C3ZA 2D0FA 3C3UA 3VZZA 3AIQA 3FJ4A 2GR1A 1RJRA 3L21A 3R11A 3W72A 5EU9A 1DPMA 1EWDA 3TIMA 4DNMA 2DIEA 4JTEA 3FKKA 3LBCA 5EA9A 4EX4A 3ZLGA 1F3EA 2X1SA 1MUWA 4MTVA 4ZQCA 1WXJA 1QOXA 2E77A 3FAXA 4H41A 3WMSA 4GO9A 4O0QA 4X61A 1SZEA 3U4FA 1W37A 5AZ0A 2KAUC 3V0TA 3B8TA 1GUVA 2XWDA 5TBOA 4W89A 3T0CA 2Z2AA 1FHDA 4O10A 1MSSA 4CU8A 3H2OA 4HMEA 3MMDA 2VDGA 1UA7A 1YE6A 4NEWA 2Y7DA 1NH6A 5J5RA