3OPSA

Crystal structure of mandelate racemase/muconate lactonizing protein from geobacillus sp. y412mc10 complexed with magnesium/tartrate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
386
structure length
386
Chain Sequence
SLNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure ofmandelate racemase/muconate lactonizing protein FROM GEOBACILLUS SP. Y412MC10 complexed with magnesium/tartrate
rcsb
source organism Geobacillus sp.
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing protein
total genus 117
structure length 386
sequence length 386
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3opsA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3opsA01
2HXUA 4E6MA 4KPLA 4JN8A 4FP1A 1JCTA 3DG3A 4KEMA 3MKCA 3DFHA 5BOFA 3U9IA 3VA8A 2AL2A 3TJ4A 2PP0A 3T9PA 3OZMA 2PS2A 4H1ZA 4K1WA 2PU1A 3QPEA 5FJTA 2MNRA 1P48A 1XPYA 4X2PA 3NO1A 2PP1A 4M0XA 4J1OA 2PTXA 3UCDA 3OP2A 1FHUA 1MDLA 1XS2A 3H70A 3JZUA 2HXTA 2AKZA 1SJAA 2AL1A 4Z1YA 2QVHA 1TE6A 4HCLA 3KUMA 4MMWA 3BSMA 3U4FA 2PU0A 2OFJA 4JHMA 3CT2A 4GGBA 3QN3A 3TJIA 3TWBA 4G7FA 3TW9A 2OX4A 3OTRA 3GO2A 3SN4A 1R6WA 3MQTA 1KKRA 2QGYA 2PGEA 4H83A 3VFCA 3BOXA 3ZLHA 1IYXA 2PTYA 2GGGA 3R1ZA 4ROPA 1SJBA 3PWIA 4GIRA 2P3ZA 4IP5A 4MKSA 3FXGA 2DW6A 4J3ZA 4DX3A 4A6GA 3QKEA 2OZ8A 3K1GA 3JW7A 3CAWA 2XH7A 1NU5A 3SN0A 1ONEA 3N6HA 4HNLA 1WUEA 2QQ6A 3CXOA 3R0KA 1FHVA 4E4UA 3SJNA 2POZA 3I6TA 3FV9A 3V4BA 5FJUA 3DFYA 4HPNA 3PK7A 3DIPA 1EC8A 1TZZA 3H8AA 4F4RA 1YEYA 2OZTA 3GC2A 5FJOA 2QDDA 1MDRA 4DHGA 4JN7A 4YWSA 3GD6A 5EU9A 3SSZA 2OG9A 3D46A 3MZNA 1EC7A 3S5SA 2OPJA 2GGJA 3CB3A 4GYPC 4HN8A 3ZVHA 3SQSA 2AL2B 3EEZA 3UXLA 2DW7A 3BJSA 3V3WA 3DERA 1PDZA 3PWGA 3IJIA 4ZA0A 1BKHA 1RVKA 4A35A 3NXLA 3UCCA 5ENLA 3TQPA 2GSHA 3SBFA 2P0IA 4E8GA 3RITA 4G8TA 4H2HA 2GDQA 3P3BA 3S47A 3Q45A 3T8QA 3P93A 1WUFA 2OZ3A 4A3RA 3OW1A 3RRAA 3R0UA 4DYEA 3OPSA 1ECQA 1SJCA 3R10A 3QLDA 2OO6A 4IL2A 4IHCA 3PFRA 3R11A 2P88A 1JPDX 3CK5A 3RO6A 3RR1A 1KD0A 3VDGA 3CYJA 2ZADA 1R0MA 3H12A 3TCSA 3VCCA 2PPGA 3Q4DA 3D47A 2ZC8A 1EC9A 1F9CA 3HPFA 1SJDA 4M6UA 4IL0A 1MRAA 3FCPA 3IJLA 3V5CA 3N4EA 2XH4A 4H19A 4DXKA 7ENLA 2FYMA 2PCEA 2FKPA 4GFIA 3T6CA 3STPA 2ONEA 3MSYA 3UXKA 3TWAA 3P0WA 3ZLGA 4E4FA 1KCZA 4Z17A 3FVDA 2PMQA 2OVLA 2OKTA 3MY9A 4ENLA 3SN1A 3UJEA 4GYPA 3DDMA 4GISA 3UGVA 5BOEA 1JDFA 3TTEA 1DTNA 2HNEA 2XH2A 3DGBA 3RGTA 4KWSA 2AKMA 2GGIA 4HNCA 3H7VA 3EKGA 4HCDA 1JPMA 3NZGA 4ZCWA 4IP4A 2RDXA 2PP3A 1TKKA 3IK4A 3UJRA 4DWDA 1EBHA 3DG7A 4HCHA 3N6JA 3I4KA 5IDZA 2GGEA 4GGHA 3OZYA 3DG6A 3R25A 1MUCA 4IT1A 1E9IA 2CHRA 4HYRA 3UJSA 1NELA 3FJ4A 3B97A 3N4FA 4KT2A 2P8CA 4IZGA 4FI4A 2QJJA 2PGWA 3VCNA 2GGHA 2XGZA 1MNSA 3DEQA 3ZVIA 3IJQA 2QJMA 3I6EA 3ZVHB 3RCYA 3NFUA 1BQGA 2HZGA 2XH0A 3ES7A 4GMEA 1L8PA 1EBGA 2OQYA 2OLAA 3THUA 3FYYA 3JVAA 3QTPA 1P43A 2P8BA 2NQLA 4MGGA 2QJNA 3V5FA 2XSXA 2PTWA 3TOYA 2I5QA 4EWJA 3MUCA 3ZLFA 3UJ2A 2O56A 5FJRA 2PODA 3T4WA 4K8GA 1PDYA 5FJPA 2PSNA 3VC6A 3ES8A 4DN1A 2QDEA 3DESA 1OEPA 2GL5A 3MWCA 3UJFA 2PA6A 1KKOA 2OQHA 2MUCA 2PTZA 3ENLA 4K2SA 1ELSA 4E5TA 6ENLA 3VC5A 1W6TA 5J04A 3GY1A
chains in the Genus database with same CATH superfamily
4MZYA 5ABEA 4ZL1A 2V3EA 3AUOA 5G2IA 1EWEA 1NHRA 1B1YA 4H6EA 4JD4A 4KEMA 4OFCA 3PZIA 4K8HA 3RK8A 1OD8A 5I24A 1KBLA 2QDHA 2JKAA 2OXNA 1FX6A 4LOCA 1UC4A 2OX1A 3PPCA 1JJKA 3STCA 2OSXA 3QPEA 3H4KA 1EIXA 5BWAA 2R91A 3FS2A 2NX9A 2V3GA 4URIA 5HPCA 4XKMA 4ZO9A 3WQOA 3TYUA 4BI7A 1ZQ5A 2BOGX 4OECA 2F38A 3OP2A 5D9MA 1VBGA 3NSMA 1A5CA 4PMJA 3EKLA 4F2BA 3JZUA 1JZ7A 3P81A 2X1RA 4FDCB 5FS7A 3UT0A 3HV9A 5K4XA 1EPVA 3MI6A 2QVHA 3M1ZA 4IQLA 2X8CA 1CENA 4TR9A 1G7UA 3PB0A 3GH4A 4RLIA 4DF0A 3NUKA 2CBIA 4GGBA 2JK6A 2TAAA 3OHMB 1TPFA 2GLKA 3RF9A 4P7QA 2B7QA 3B8WA 1KM2A 2CKRA 3M7WA 1WYGA 2H90A 1KR1A 4CU8A 2YIHA 3AMLA 2PD9A 2PDNA 4RDWA 2C19A 1N8IA 1R2TA 4AU0A 3EX6A 3R4IA 1XLJA 3WD3A 3L66A 2G3FA 4YYCA 1FEBA 2G0WA 4AH7A 1QT1A 4UTIA 2BXVA 1E9YB 1ZL1A 3I10A 5EYWA 1RCOB 3AU6A 4XWUA 3V18A 1EJRC 1E1EA 1P0BA 4W9TA 4TX9A 1ZAIA 1RJRA 3LRLA 1XJBA 1NWSA 3TN6A 4GC4A 1TJRA 1W3HA 2R14A 3QKEA 1KCKA 5EMKA 4KEUA 3K1GA 3WQCA 1NHPA 2QPUA 4F0KA 1NDVA 3MP4A 5FAJA 1K9EA 4HKPA 5LIUX 4FOUA 6XIAA 2BNJA 4RZBA 3R0KA 2POZA 4KEZA 2BCPA 1OD0A 1XH2A 1WPCA 4LCQA 2B81A 2ZDRA 1XCFA 1V79A 3T81A 3V1PA 3ZWSA 1FWRA 4HPNA 1MXGA 3GTFA 4P7OA 1YKWA 3S9IA 5CKSA 1EO7A 1AQMA 3KLJA 3EYPA 3W7NA 4I5UA 2V6OA 2BVYA 2Y8KA 1IXNA 4O52A 4W8AA 2C3ZA 3SAZA 3BGGA 2BOEX 1AOGA 2FB3A 3VD7A 4AISA 4XIMA 1LRNA 1K03A 3FKKA 2X2YA 2CZDA 3SQSA 1R3RA 1XIGA 4RCXA 1P5BA 5MKGA 1EJSC 4BY3A 1HO4A 3ZT5A 1UASA 1O1HA 2IXVA 4YTRA 3MJMA 3TTSA 3CPUA 5ENLA 1OK6A 4LU0A 2XGBA 3GFYA 2G41A 1IWPA 5BRPA 4DNHA 3OGRA 4MWAA 2CWXA 1ZB5A 2EO7A 2RGLA 3IWPA 2PLCA 4S3GA 2AGTA 2FJKA 4QE1A 3S0CA 2IPFA 1W1B1 4Q4KA 3BMXA 2WPCA 3A4JA 4ZFCA 2VDGA 4PFMA 4YVPA 3L65A 2PWGA 4MVAA 3RR1A 2GK1A 1LBMA 1LQAA 3PY2A 2PI6A 4IMEA 1SUXA 3VNLA 1JFHA 3D47A 2CERA 4J3SA 1F6PA 4Y8EA 4NXKA 4DO7A 3T05A 2B31A 2DDXA 4NIRA 2JEQA 3AXMA 1J01A 3FCPA 2VGBA 3W0KA 2XFWA 4AZ6A 3PZOA 2HVMA 2FH6A 3VDCA 7ENLA 3EAUA 1E1CA 3ARWA 4MLRA 1TWZA 3GQYA 2ZZCA 1ZP4A 4B2DA 3ZR5A 3O16A 1OYCA 1V93A 2VCCA 1GQNA 4GO9A 1XM3A 3TLLA 4NYUA 1ITCA 1UKPA 4AY7A 4QDWA 5DCEA 4IXHA 4CQBA 1PIFA 3E2VA 3PZTA 4LV4A 1Z44A 3KL3A 5CGTA 4JAWA 1VB9A 3A3WA 3S4TA 3W74A 1QNVA 2C15A 4GVGA 2A7RA 2Y70A 3GR7A 4FEZA 2F6KA 2G4JA 3LPOA 2ZX6A 2X42A 3VD4A 1DIEA 4KFPA 3DH9A 3UJRA 2OOFA 2Z7GA 1KW1A 2O9TA 1SR9A 1T7LA 3R25A 1ZTVA 1GJWA 5HQEA 1ITUA 2WJFA 3W22A 2HEJA 3B04A 3P67A 4X0NA 3W88A 4FI4A 4U3CA 3CLWA 4GYJA 1GVRA 3II1A 4UFJA 5J5RA 3THCA 3DK9A 1UHVA 4B16A 1TV4A 1EUAA 3H2EA 2WBAA 4J2PA 3C2YA 2A3LA 1XSJA 3I4EA 2Q3OA 3VOJA 2VYOA 4ZQMA 1SO4A 4AXNA 2BVTA 3NZQA 4IIHA 3C0LA 1A47A 4JX5A 3HMJG 1AFSA 2A3HA 4MGGA 3K2GA 3GHUA 4TIMA 5A8NA 4NL1A 2ZVIA 5E6YA 3M16A 2RGMA 3HU7A 2CESA 3W7GA 2E28A 3ZLFA 3IUDA 2EHHA 4OKDA 4M56A 2J25A 2GOKA 1XIFA 1NY1A 3WIJA 2QYGA 2QDEA 3SR7A 1CWYA 3WNMA 3LCIA 3ARYA 2C13A 4E3VA 4J28A 4IMAA 1GORA 4O4VA 2A21A 3R0DA 4L64A 1JRPA 1S1PA 2PTZA 1T8QA 4K2SA 2X8RA 4DXXA 3QHMA 4MWAC 5K9DA 1J4EA 3P84A 1FDJA 3URQA 4CCDA 3G77A 1J0HA 2V5CA 4WJXA 4JCMA 5HK4A 4IPPA 4R7WA 1E3XA 3TQ0A 3T0DA 1ZXIC 3F5JA 5FEWA 3R07C 1HIZA 2B4GA 3W6YA 1V3LA 8XIMA 4LBUA 4K1WA 3KL5A 2PU1A 2PLKA 2WNNA 1SMAA 4FNPA 2R8WA 3AWNA 1SFJA 2OGJA 1K9FA 3NAVA 2D0FA 1STZA 1TZ7A 3L5OA 3RX2A 4EQRA 3GFXA 4X0VA 2HXTA 3W1MA 1CECA 1YNPA 4FS9A 1M7JA 3S2MA 4ORMA 4NT0A 2WSKA 1TYTA 3L4TA 3RAOA 4F40A 4MMWA 3XINA 3MYOA 1YNYA 3VO0A 1CI1A 3QR0A 2VOMA 1TZ9A 2A3AA 4RPQA 3E0LA 3ANUA 2WSQA 4G7FA 1F5ZA 3VIOA 3OTRA 2XINA 1NFBA 1EGZA 1R6WA 1NDWA 5CZKA 4IP7A 4W85A 2GYIA 3SIMA 4DO4A 1DHKA 5FS6A 1VENA 3S2LA 1KLYA 3VNZA 1XLBA 3VIFA 3B0VC 3MZ2A 2W61A 1IF2A 2WAGA 1XWYA 3GC5A 5A8GA 3HPAA 3TK7A 7REQA 3PWIA 2WMIA 2J7GA 3OLDA 4KERA 3BV4A 5G4HC 3T2QA 1QK2A 3TAKA 4LVBA 5U1OA 3WK1A 4LTSA 3EUB3 1UA7A 4DWSC 3KBWA 2HPMA 5F2GA 3UWWA 2FZ9A 4AZHA 1K6WA 1VFTA 2CZ5A 1JDDA 2VZOA 4O1CA 4M3PA 5E0KA 3S42A 3SZ8A 4IQDA 3UBPC 1TPVA 2Y24A 3M43A 4GVIA 4DO5A 4WOZA 4UQCA 3L4UA 4UR9A 1ZMDA 3PK7A 3FG2P 3DIPA 3VD3A 3N12A 4HJWA 5G2WA 4PBFA 3B8SA 2VEMA 3RDKA 1BGGA 3C2OA 1HVQA 2C91A 5G2HA 3KRUA 2QCCA 1HFBA 2GK1B 4RUBA 2XUCA 4F0LA 1PE1A 1A53A 3VIJA 4R53A 1W56A 3NA8A 1GUVA 4JYEA 3C0JA 4FR6A 5DT5A 3CV2A 2X1SA 2NXGA 1GEUA 2ACSA 4FX8A 4GNJA 3S5SA 3OBAA 2Y4SA 2GGJA 5M03A 2ZA1A 3GKFA 3E74A 1JZ3A 2L5HA 1JCNA 3EX4A 3EDKA 4FPSA 1BKHA 4GXWA 4ZE4A 4A4AA 4RZ5A 5HQMA 1NIUA 5CH9A 1MO9A 4K7VA 1A50A 1FWFC 3FJ6A 1IXQA 5LYRA 2BG5A 5LA2A 1KCXA 1I60A 2XFRA 3VMPA 4MJMA 4MNJA 1LOLA 5CC5A 1R3SA 1T40A 4X2RA 1U83A 3WNOA 3L2LA 4BZYA 5CPQA 3VZYA 2DEPA 5DMNA 2UY5A 2P88A 2QULA 3EZ4A 2ZRUA 2E77A 4IUGA 5T91A 1R0MA 4Q33A 4ZXOA 3RPTA 4EE9A 4G1NA 3IIXA 3O8AA 4GKLA 4WD0A 2ZBTA 2B7NA 1DIDA 1VC4A 1LTDA 4TMBA 2WSPA 4Z2IA 2WJEA 3NQAA 2Y5EA 2FHFA 5G1TA 2DH3A 1J0JA 2VX5A 1CXLA 3EWZA 4EQXA 2C79A 3N9SA 4W89A 3W86A 1PVNA 4Q4PA 4XZBA 2YDSA 3T40A 4XZHA 1Q2RA 1H7NA 4LAZA 3W1PA 4EPDC 1WZMA 4LGXA 4JTHA 4YVXA 4HZ7A 1V3KA 1XBVA 4B4HA 2DZSA 3VABA 1W1VA 2DVXA 4NG3A 1Q1RA 1WNOA 3OQ8A 1LOQA 1ISXA 1GW1A 2I5GA 2X0SA 4LBRA 3UJEA 4CD5A 1W3TA 4TXEA 2E1DA 3BLDA 1Y5XA 5FJIA 3TTEA 1V0NA 2QLYA 2XH2A 5T9BG 4ZCWA 2RDXA 4H4QA 4D6DA 1TRDA 5C8BB 2VQUA 1KFLA 4Y7EA 4AF0B 1C8YA 1EHNA 1ZBWA 2UWFA 1XGDA 4C6JA 3LV5A 4JR5A 1UD5A 4I8DA 4F48A 1M7XA 3CZLA 2VFEA 1UOKA 1LOSA 3WLLA 4BWLA 2DZPA 2W6RA 5DMMA 2YA0A 2DZBA 2IQDA 3ZZ1A 2OODA 3EOLA 3PTKA 1L9WA 1R7AA 2JF6A 4AEEA 1D3CA 4GMEA 1KRMA 1XUZA 2PF8A 3S2CA 4H6RA 3ISIX 1CYGA 5AHLA 3JVAA 2AAMA 4GXPA 4AVFA 5HOSA 1I2PA 4UQBA 2VR4A 3MUY1 1LL7A 3WD4A 1F4HA 1QNSA 2UY4A 4N6EA 3CIXA 3SCOA 3L9CA 4EACA 5M2FX 1KM0A 1WOAA 1G4SA 1QATA 1EJWC 3VNMA 1T41A 1FHDA 3VC6A 4N02A 3L7RA 1UJPA 1OEPA 2QS8A 1UBSA 2YB4A 1IIHA 3BAIA 3QTGA 3MA8A 3NM3A 3T09A 1BGAA 3L4YA 1XIEA 1QOQA 1KBKA 5J04A 3GY1A 4DO6A 2ZRYA 3TTOA 3PANA 2R82A 1TIWA 3LB0A 1R86A 4PRRA 2GVLA 3VKDA 5SWUA 3C0SA 1UKSA 3WMBA 2WWDA 3S1GA 3VIKA 4Q6XA 3Q37A 2FZDA 3DXIA 3HQ1A 2PP0A 3W85A 2PRMA 4H01A 2OYKA 4INFA 3AISA 2RDTA 4W88A 1SR0A 1RH9A 4DBDA 1L2QA 5BYWA 3POCA 2X30A 2A3CA 1S2WA 4TX8A 4CQDA 3WH6A 4L5ZA 3WX7A 4QSFA 2NX3A 4UXDA 4BHYA 2HK1A 3VIMA 1C92A 3FN9A 1CXEA 3ARXA 1GOKA 4Z1AA 3BCJA 1KGWA 2A7NA 1UOZA 1EB3A 3LOTA 2R9RA 1X2HA 2EJ1A 4I7WA 4LSBA 1KGXA 1O4UA 3HBLA 1EJXC 4WR3A 5I2UA 1T5AA 4V33A 3VKAA 1G9HA 2XIMA 3TW9A 3KE0A 3QLLA 3BQ6A 3K46A 1EHAA 4C6IA 4EPEC 1E0UA 4YIWA 4YCOA 3IJ8A 3H26A 3VZXA 3L4XA 2BMBA 4H83A 4P5UA 2CLPA 3VFCA 3NYZA 4I7UA 4NU7A 4Q8VA 1GJPA 3VKBA 4NZFA 1J9YA 4WZHA 1ADDA 1ZBKA 5EMMA 3EWDA 1OFAA 3MT1A 2DZXA 3TSDA 3E02A 2WKJA 1SW7A 3LY0A 3NO3A 5DCBA 3S5ZA 4PCNA 3CAWA 5DRIA 1DXIA 1TV2A 5A6BD 2CLOA 4UFIA 3IARA 3WD2A 4TTUA 1A5UA 1V03A 1WUEA 4FHAA 5C9XA 1P6BA 4DAFA 3NGFA 5CLTA 3VNDA 3KBMA 3AN1A 3N18A 1BWKA 1WE5A 3OLEA 1UQYA 1D2KA 2E67A 4Y9AA 4KIEA 1Z9AA 3ITLA 3W24A 1SMDA 3THDA 1QNOA 2YVGA 4IMDA 3ARSA 3WEMA 1JZ2A 4LAKA 3AS3A 1PTDA 3ZO9A 4LC8A 1UCWA 1S3HA 4IIGA 2RJHA 4NF7A 1OWQA 4MZ8A 1ICPA 2QVNA 4OJYA 3A22A 4JN7A 2J4GA 4GK8A 1L6SA 1GEHA 3MUIA 4AXKA 4UUIA 3SSZA 1V02E 4RNIA 1XLMA 1ZHAA 1YNQA 2C7FA 2ZX5A 2NVCA 1B3OA 2ZC1A 5BOOA 4JKKA 2GUYA 1KGUA 3GNPA 4ADUA 3VDHA 1H49A 3BL3A 1R3QA 2E9BA 5KEZA 3A6OA 1KRAC 2GQAA 3KWXA 4S3JA 2JKEA 4LB3A 1YHTA 2Y8UA 1AZ1A 4DZIA 3ITCA 3P93A 1ME9A 3O63A 1UWIA 4GI4A 4A3RA 4F2TA 4ZBCA 1F3XA 3REQB 5HXMA 3OPSA 4S38A 1ECQA 3K30A 4WGHA 4G6CA 1T6MA 2EXOA 2I5IA 3C0QA 4IHCA 1KXTA 5D2YA 3TQVA 3CK5A 1GK8A 5D9PA 3GLCA 4LCSA 4KW2A 2HPIA 1FBAA 2PPGA 1HVXA 1XRTA 4ZO7A 1NPXA 1EQCA 3E38A 1Q5MA 3MVIA 2ISFA 1JCLA 4PA8A 4GQRA 1KM3A 2XIJA 2XISA 1UUOA 1HKWA 1EJUC 3AYRA 1U30A 3PG8A 3WF4A 3KVJA 1CGWA 3M0JA 4BEUA 2A5HA 2XVNA 3B9EA 5JCIA 3H2MA 3STPA 1ODUA 3OHIA 4EXBA 3PZUA 2AOSA 3RIKA 1GYMA 1XIIA 4B5NA 3AJXA 2X7WA 2ZZ2A 3BAKA 1A5SA 2INEA 3WD1A 5GPRA 1R38A 1XGEA 4MDOA 3UGVA 1TPH1 5JUVA 3NOYA 2J8TA 3EA3A 3MB9A 4ML4A 1J0IA 4QS6A 2XGIA 2FZBA 3KXQA 3URNA 2VRQA 3QBUA 2GGIA 4UC5A 4JDYA 5HMDA 4AZ7A 2HCVA 3L2IA 2BGNE 2E9LA 1XRFA 4JQAA 4LUTB 2QZRA 3KTXA 1Y5VA 1AA1B 4JCLA 2NQZA 3CWOX 1GV4A 4WKHA 4XK2A 1RY8A 5FF7A 2QCDA 3ICJA 4WF7A 1E1FA 1A80A 4JTSA 1RBLA 1QNRA 3CQHA 1KBJA 1VEMA 2HWGA 3WDRA 4F8XA 2BY0A 3VUSA 4AZGA 3RPMA 4WEVX 3EAOA 3PBMA 5TD4A 3IPWA 1JDCA 1NFPA 3CUFA 3M0XA 4MAVA 5BCAA 4C60A 1TMQA 2CXEA 5CQ1A 2O4QA 3RCYA 4DZAA 4O8AA 4BKNA 2XH0A 2Z24A 3G3MA 2DV0A 4U2YA 4GABA 1D7FA 1KO0A 3RJYA 1HW6A 3WF3A 1HX0A 1SZGA 3WH7A 4C6DA 2PDQA 3Q6JA 1HXJA 1JI1A 3POHA 1Q7ZA 1PB0A 5TNVA 2VELA 2EQ6A 1QOXA 2GVYA 3TZNA 2YAUA 2XM1A 5FCZA 5JCKA 3HOJA 1W1IE 3N9KA 4O1FA 3VE9A 3ME3A 3W1NA 5EKYA 4G9PA 3ITYA 4UNKA 4AFYA 3CHDA 3NDZA 2YA2A 3C86A 3EANA 4ZMGA 1IR1A 1GEQA 4JTQA 5JIPA 1ISVA 5E0FA 2OEMA 2FH8A 3A9IA 1I8JA 3LD5A 3OODA 3BCDA 3G8RA 4Z0JA 4YHEA 3TR9A 4XZIA 4NZCA 4TV5A 1XXXA 3HO8A 3HN3A 2DVUA 3QC3A 2GH5A 2WXDM 2ZDSA 2JGQA 4L9XA 4XSMA 2V81A 3O9NA 4MLJA 1OGSA 1JPHA 3KDNA 2DORA 1R47A 3LXAA 1DHPA 2IXUA 3NO1A 3N15A 4NX5A 3WQPA 4ZSUA 3G1XA 1XCXA 2PTXA 4G56A 8RUCA 3WFAA 1KN0A 4LNYA 2YR1A 2BX7A 4I9TA 2VNCA 2VTFA 2UV8G 2ZOXA 1VAHA 5TBOA 1HJQA 2WVUA 1MVYA 2XVPA 5F1UA 2PDMA 3T1GA 2WVTA 4LWWA 4ZQNA 4N2YA 5HPOA 1KLZA 2R1NA 4LS1A 2PBOA 3MP3A 4LUTA 2AAAA 3UWZA 2CYGA 1GSNA 1Y7VA 3TU9A 4BV6A 1UKTA 3JS3A 3T0BA 1OJTA 1ME8A 4JIQA 3EXTA 1Z69A 5BU9A 1K77A 2A1YA 3FYOA 3TROA 3NCOA 5HWNA 2WANA 1CB2A 4AIUA 5I5RA 3MQTA 5A1AA 3RRXA 2PWFA 3VAVA 4FB7A 5BRBA 1Y5WA 3KCJA 5A6TC 1M01A 4AIOA 4HB7A 2YA1A 3BZGA 3AROA 2G3MA 3Q67A 4JIHA 1XYBA 1S7MA 3G18A 2ZUMA 1FFRA 3C61A 1I1XA 4XB3A 2PLMA 4ADTA 6REQA 1SJBA 1GOQA 5JIWA 3EPMA 3UZZA 1XYFA 2NUYA 2P50A 4L6HA 1BXNA 1YPFA 2AAQA 3SCNA 3EA1A 2JKPA 2E40A 3RYSA 1JYWA 2ZUNA 1WDRA 4JFVA 1LQ2A 3C2VA 4KBXA 3A24A 1TFVA 4Z1DA 1ZS2A 4UQEA 4BCEA 4PTNA 2J27A 4UTWA 5H6HA 4GD0A 4QG9A 4I9JA 4GO8A 4O8RA 2YZ5A 3TDFA 3EMZA 4K8DA 1GRGA 3FIGA 1KRCC 5IXEA 3U6WA 4LS0A 3USBA 4Q4SA 4G7EA 3AIEA 4H4XA 1DORA 1OM0A 1NDZA 1Z89A 1TCDA 4AD4A 2CPUA 3VD5A 3UVIA 2PWEA 4TVDA 4XZLX 1EDGA 4HK5A 3HGOA 3U0HA 3MC5A 1MW3A 5AN7A 4MWAE 4KPRA 2QCGA 3OLGA 4Q8WA 5D2TA 4C5ZA 3K4AA 3U2ZA 3VCRA 3TUUA 3W7RA 5JCNA 5D04C 1MQQA 2ZXQA 3NQEA 4RZ4A 2DUZA 1Y8BA 1XYCA 3IIZA 1FCQA 3ITXA 2IKGA 5I09A 1AH4A 1F05A 1QRQA 1W3IA 2QIIA 1EX5A 4H2HA 2YW4A 2DU2A 4YNGA 2WYSA 1JULA 3AO0A 3T8QA 1V02A 1QDSA 4MWAD 3NQ8A 5D30A 5C2GA 2VFDA 4O0KA 3FK4A 3S1XA 4FAMA 1BSLA 2BODX 1CBGA 3WD0A 4KESA 4WJ8A 3DX5A 1JPDX 3FX4A 2VFIA 2V3DA 4Z1CA 2JFEX 2VX6A 2PZNA 5K9XA 3K4DA 1LWIA 3P82A 4AW7A 4GQQA 1B9ZA 1SJDA 3SUTA 1O5KA 2I16A 3V5CA 3W7CA 3DK4A 3V0TA 3ATYA 4OUIA 5A8MA 2A4AA 5HR6A 1TO3A 1CCWB 3JR2A 3CYVA 3OB8A 3L5MA 1HT6A 3GXTA 3HGRA 3ZR4A 2QF8A 3NS1B 5FOOA 4Y2WA 2J3NA 2O7SA 4E4FA 2VC7A 3GM8A 1VP5A 3OOQA 1H60A 2CZEA 5BXTA 5TQLA 1KFJA 1BTMA 4TVYA 2G4FA 1CGUA 2W91A 4D72A 2G95A 3WLSA 3FW6A 4DBUA 4POCA 2KAUC 2Y2WA 3CQ0A 3GTNA 4IICA 1JG9A 3ANYA 3INPA 3N11A 3AHTA 3WQGA 2E6AA 3IJ7A 2PWVA 3IVSA 5RUBA 3GRIA 1CLXA 4S3BA 1CB7B 4M52A 3U2CA 4MHBA 4OUEA 1XLKA 3SRFA 1QO5A 2EF9A 2GJPA 3T44A 3WLTA 1N7KA 4H41A 2YCIX 1UR3M 5IBXA 5LXXA 3LHTA 3N4FA 2D20A 4ERAA 1PYMA 3M0ZA 2HRWA 3CMFA 2EPLX 3IJQA 3S5OA 3MSRA 5IOBA 4MG4A 2PGRA 2VT0A 4CCEA 2W4XA 5CPOA 2WO5A 1CXKA 1BQGA 3BAWA 1GVEA 5BMXA 2EPKX 1XYZA 1GERA 2EJAA 5F4SA 2ZUWA 4ZTXA 4MB1A 1SPQA 4HA0A 3TXVA 3O6YX 2PTWA 4LY8A 5FIPA 4OBSA 3MCMA 1X38A 4OWGA 1J2WA 3CTLA 4U4MA 5DO8A 1EA9C 2YCLB 4K8GA 5CPNA 5FJPA 4QGCA 2Z1VA 4DN1A 4LYKA 4EXAA 1OB0A 3GG1A 1E6QM 3UWUA 3ITTA 4GUIA 2DY3A 4J2MA 1A0EA 4J9JA 3UZJA 4PTXA 3TC7A 4LANA 1MFUA 1GRTA 3CGBA 1W9VA 4BA0A 5HUPA 3F5LA 4O57A 1X1OA 1GJUA 2BHUA 4E6MA 4QDMA 2V0TA 1YXDA 3LQLA 4KWOA 3MKCA 3MWAA 1G5AA 4MJZA 1Q66A 1KXHA 4C6MA 4H9VA 3UXDA 2GWGA 5BMWA 4F3HA 2A85A 1HKVA 4Z2KA 4FLOA 4ML9A 2Z7KA 1BYCA 1ZBCA 1K8YA 1E4IA 3AIWA 4DB7A 4DLFA 3LN3A 1DBTA 3GDMA 2ZXAA 3HJEA 3BV7A 3MSDA 3SCUA 4HSNA 3W2JA 2CWNA 4WQ6A 4D6FA 2V5DA 1ISYA 1RQHA 2VC5A 1G7VA 1YRRA 4B5TA 2VRKA 1OC7A 2CU0A 4HZ6A 2IQTA 1F76A 4B3LA 1CLKA 2AKZA 3DYOA 1NOWA 4C5YA 1IHIA 3P2VA 3KUMA 2VKZG 2PU0A 3W00A 3BC9A 3KLLA 1H61A 1WDQA 1GVOA 2E0PA 2D24A 3MPGA 1EOKA 4FO4A 4P8UA 5C55A 5I3GA 2PWDA 3H2CA 2F5ZA 1GVIA 3TSBA 3NSXA 1BXBA 1DOSA 4NXSA 4BI6A 1TPC1 2VUYA 3SCQA 4PZVA 3TTYA 3ZLHA 4HNUA 2X41A 1J5TA 4UMCA 2DSZA 1UC5A 3VKCA 5AYIA 3VVGA 4XZWA 1XIHA 4LUJA 4ROPA 5F4WA 4UMAA 1WZAA 1EX1A 4BQ2A 4PUWA 1X7FA 3STGA 1S2UA 4WKAA 1PO9A 1AW1A 3PN8A 2VCAA 4IX0A 4ZVJA 4ADSA 3KOXA 3BW3A 2VZVA 1XC4A 3OVPA 4ORIA 2RAGA 1UPMB 2QXWA 3F1QA 3SSJA 1RVGA 1JCJA 3A64A 3ZSSA 3B4UA 7REQB 2HNHA 1E70M 1V77A 2A3BA 1DJZA 5AC7A 1UUMA 5DXYA 3WH8A 2Y8VA 4HQVA 1DNCA 1PHWA 4FNQA 2Z6JA 2FMOA 1AJ2A 3OVGA 4WY0B 1DJNA 1OADA 1VPQA 3BPWA 3RU6A 4L6OA 1JZ6A 2VR5A 3LA4A 3APYA 2WMGA 2FGBA 3U57A 1TMHA 2XWDA 4PL1A 4FX9A 3EB3A 5CLWA 4GI6A 3DI0A 1V6XA 2EG7A 3DBNA 1FH8A 3CQIA 2BGSA 3N2XA 1RM6B 3V7PA 4GX8A 4L1WA 2WBKA 2UY2A 1GKPA 3T78A 4LS2A 1G4TA 1I75A 3M5ZA 3P14A 1JCMP 1MMFA 1CGXA 4U31A 3CB3A 1BHGA 1E6XM 3APTA 1UZ4A 4Q4RA 2FJUB 1HTIA 3SDOA 4I5RA 1UWQA 3QH2A 4ACZA 1DQXA 4C6OA 1B4KA 1PX8A 3V3WA 1R85A 3TN4A 3W1RA 5GJMA 1H4PA 2GR3A 2ZWZA 1U1JA 2WPGA 4Q32A 4G8TA 3SECA 2OU4A 4RPPA 4FXRA 1D9EA 4DQWA 1WUFA 4I3GA 4GR1A 1E3ZA 3VI2A 1TJPA 5LA1A 3EB4A 2OO6A 4J56A 1A5AA 4KRZA 3F4NA 1K02A 1IXPA 2DIKA 3QZEA 1MI3A 3VIHA 3WJXA 4JKLA 3Q4DA 1OQFA 2PBGA 4MWAB 2MANA 2FHBA 4XO6A 2EKCA 3L0KA 3IC9A 5FKYA 3SCPA 4D6GA 2D2JA 2OO0A 3BSGA 5I03A 1KR0A 4F79A 2ALDA 1WZLA 5DLCA 1QHPA 1WBJA 3HG2A 2V5JA 2RUSA 4JDBA 1G94A 4ICCX 4Z17A 3WLKX 3BGJA 4E2VA 1A4LA 3MY9A 3WLIA 2CZVA 4J57A 1X39A 4GISA 4U3AA 1P0KA 2J7CA 3S46A 3G1FA 3BMVA 3MW7A 1DJWA 1Q3NA 1TB3A 1BSIA 1J11A 3LPFA 3K13A 3F2BA 1GXFA 1A3HA 2AKMA 2IPJA 3EKGA 8XIAA 5CSYA 1PKNA 4LBSA 3LS9A 1Y0EA 2DT1A 4X3ZA 1OF8A 4GJ1A 1HJUA 4IP4A 4B4FA 2GUBA 2J6XA 3LLXA 4QEHA 4FSAA 3P5ZA 4UZUA 4XAYA 4H7ZA 2A79A 1RY0A 1TYPA 4H9UA 2Y61A 1KFKA 1W1YA 4JFUA 1KV5A 1OFDA 3PB2A 4RDYA 3LM3A 1W3JA 4HVXA 3M41A 1TQJA 1NELA 1FIQB 5BNKA 4Y9PA 1OFBA 4LEFA 2WW5A 3O6DA 4CU6A 2CHOA 2GZXA 2DUAA 1QPRA 3NPWA 2WV8A 5DMYA 1TX2A 4PFHA 4MY1A 2QAEA 1Q6QA 3PBGA 5T8GA 2CLFA 4GX9A 4M82A 1TSIA 2VZUA 1PKYA 1RSCA 4JKMA 4QHRA 1X98A 2Z4GA 4RDVA 3GHSA 1AG1O 4R5EA 4HSHA 3UGRA 1GHRA 2VZTA 2OLAA 3A5VA 2PDKA 4IPJA 3QTPA 2X99A 1EP2A 4QRNA 3B0UX 3TOYA 1RP8A 3O0KA 2PURA 3ECQA 4JICA 4N0RA 1H7RA 3P8JA 3T7VA 5XINA 4DUOA 1WX0A 2PWUA 1P1XA 3WNKA 3MWCA 4ZOCA 1XLDA 5TF0A 4PMVA 4G1KA 3HFYA 3EOEA 4KS0A 4OOZA 1Q6GA 4AD0A 5AHNA 4NP7A 3H4XA 3CGDA 2OT0A 4WJEA 3CC1A 2NVKX 4CU7A 3ABXA 1Z6KA 3LYEA 4G5DA 1ZCOA 1JCTA 4MZ1A 3BJFA 5BOFA 4Z42C 2UY3A 3A47A 1XRSA 3GNNA 4LH8A 3ZSTA 4C6BA 4H4YA 2PS2A 1POKA 5KTLA 1S5NA 4LCRA 3FEMA 3PR2A 1LRQA 3WK0A 3HRDC 1T8XA 5EMJA 2EPMX 1TJ2A 2EG8A 1NEYA 3KTCA 1DWHM 3VDAA 4M0XA 1S5VA 1F4AA 3PZVA 4N6FA 2ZXBA 3TYZA 1TIMA 1A3WA 1XHCA 4L9YA 4BWLC 4IUOA 2EEXA 1PHQA 2BZNA 3G5EA 1AODA 1I2QA 4K7ZA 2CETA 1WDDA 4GIEA 3LADA 2WKGA 2PGFA 4LUYA 5HR7A 4HHLA 3ZMRA 3SR6B 2CBVA 2PB1A 2WP5A 1VIZA 2ESCA 3BE7A 3GXDA 1G4EA 3NL6A 2NSOA 3UQNA 4NSBA 4NILA 3GG8A 3QXBA 1FWEC 3G1YA 2PDHA 4UTKA 3SGGA 4PMYA 1Q8AA 1E4LA 4DNMA 4M24A 1Q6DA 3ZWTA 3N3MA 3RILA 2XN2A 5D2XA 4YXGA 4TVCA 1MW2A 3QSRA 4C6FA 4K7YA 3E49A 1XANA 3S6TA 1XLGA 4WKFA 3M5VA 1PX4A 3TX9A 2P3ZA 3CQKA 2DSKA 4J3ZA 4NAEB 1J6OA 4XSLA 4AD2A 2X1TA 3BMWA 3N13A 4JTRA 4GACA 3E0WA 5CAHA 1UIPA 1GRAA 3H2NA 1VFLA 3WNLA 3NQGA 1UD2A 1VYRA 2ZWYA 5MF5A 1P0NA 2V8ZA 1W3KA 2OB3A 3FV9A 1W9PA 5I02A 3G1RA 4HBKA 1GTEA 5HAOA 2YFOA 3AS2A 2ZZ0A 1K70A 4GY7A 1G01A 4NAFA 4I90A 4YU1A 4XAFA 3WH9A 1FDZA 3FAWA 2DIJA 4M81A 4PBEA 3NVVB 1CDGA 2UZ9A 5I06A 1EOMA 4DHGA 5FD0A 4O0QA 1EO5A 3NPVA 1R3YA 1RR2A 3R12A 1TMLA 3WZ0E 4KRTA 4QXIA 1M1BA 1I2OA 4WSHA 5AYZA 3K1DA 1OCNA 1KFBA 4XO7A 2AL2B 2NXHA 1KTNA 5EFDA 2RABA 3P6LA 2ZZBA 4ZB5A 4UR7A 4PMOA 3H4WA 1YBQA 5F1VA 3IJIA 4WRHA 3BICA 4DJFD 4BF5A 3PWAA 3HB9A 5GQBA 3H6OA 1W54A 2I7GA 4FIQA 3AIVA 4Z1BA 1Q13A 5AC4A 1HJSA 1NSJA 4CNPA 3SQLA 4JHZA 5C5YA 1RK5A 4RXGA 2BTMA 3QLDA 4I6VA 1P4CA 3PFRA 4O13A 2PF0A 5JMUA 1EZ2A 2CDUA 1J8VA 2ACUA 2QR6A 3TCSA 3VCCA 3U2OA 3BOFA 2ISSA 3W1LA 1XW8A 2ZC8A 3VE7A 5D32A 4XIAA 1D3GA 1EC9A 4H3DA 3G1SA 3ALGA 2OEKA 2WNQA 5IHRA 3THAA 3VNYA 5FL0A 4JQ1A 2XH4A 2PFHA 3HGSA 2VVNA 1ZY9A 5JBFA 2PCEA 1CGTA 2IQ0A 3IV3A 4RZ6A 2PDPA 3TYAA 3W76A 3L67A 4GC3A 3W01A 1K6AA 3W3OA 3UZWA 4IFKA 4TO8A 1UW9A 4GE8A 2YGYA 2X0YA 4R85A 1FWHC 1S38A 5DT7A 4UBPC 1RBAA 2FTPA 4EF9A 1G0CA 2XIBA 3Q94A 3GHRA 3HW2A 3N6QA 1EWDA 1IGSA 3MHUA 4WVXA 3T2OA 3U8GA 1RBOB 5TIMA 3MDUA 1M04A 3C52A 1FQ0A 3MI2A 3LU2A 3ZR6A 1XUUA 5E1QA 1HGYA 5REQB 3N17A 2E6DA 3LHZA 4MB4A 4C90A 3NQDA 1J10A 3V0SA 3R2GA 2ANUA 3QFBA 3AMGA 1HL8A 2CHRA 3UJSA 2O55A 5EA9A 3GVGA 1DTUA 1D7KA 5EGRA 2EQ8A 6CGTA 3TEVA 3EWWA 2GGHA 5CAKA 3ZVIA 5D8WA 3LSBA 4BEQA 2Z1BA 3QY6A 3TAOA 3EMQA 3GNOA 3NEVA 3UYIA 1PZ1A 3W7KA 4C7DA 2HZGA 1N55A 4CVUA 1L8PA 1X1ZA 1OC5A 1T99A 1XKYA 2NUWA 1B0IA 3B9DA 4FZIA 3WLOA 4O19A 1AQHA 3HZ3A 5CPTA 2OJPA 3KTSA 2VEIA 2ASHA 4X9SA 4WK9A 5DN1A 5AYXA 1JFXA 3BXWA 3TJXA 3ES8A 1SSGA 2WNWA 3N2CA 1GPWA 3QGVA 5A2AA 2PTDA 1MUWA 3UJFA 2PA6A 3AXXA 3VGFA 4HU4A 3TSMA 3EX3A 1LUCA 4GZEA 3SO7A 2GJLA 4JQ3A 5HMEA 4E5TA 3QGKC 5F2IA 1O6IA 3ALFA 4HU8A 4WY0F 2TRSA 3U5UA 1JZ5A 4QJ4B 3KOZA 3DG3A 4LX4A 3COTA 4I7VA 2XZ9A 1TUFA 4LEQA 2CIPA 2E8YA 6TIMA 1ICSA 4DUXA 5JH1A 5HWJA 1F3EA 2ZRVA 3QC0A 4NJKA 3QVQA 4CCZA 3SCVA 1MW0A 1QPNA 3SCRA 4Z08A 5IM51 4X2PA 1MEHA 2CLKA 1XLAA 2YCKX 4ROQA 4D1JA 2WP6A 4D6IA 4JY9A 1SFSA 3C8FA 1ONFA 5U7SA 1M7OA 1ZENA 3HA1A 1DKWA 2F61A 1C8XA 4O1AA 3G0XA 2WMJA 1PEZA 4C7GA 3WG6A 1WO2A 5GNYA 4V1YA 4Q4OA 3VZZA 3ITOA 1CXHA 1ISWA 2F7FA 5DY2A 3GVWA 4QR6A 3TTQA 1I0DA 2KX9A 1KKRA 3O6AA 3LNMA 3TZFA 4X22A 1L6WA 4UFLA 3BOXA 5A2BA 4IMGA 1Q6RA 2DT3A 2X1UA 4P2VA 1VR6A 4MPKA 9XIAA 1XLFA 5TR3A 4LV9A 5A2CA 1QI3A 2YVJA 5A6LA 4GIRA 1C9WA 4V27A 2XHYA 4MKSA 3E3HA 1G67A 2WHJA 4DJED 2JIEA 3ABRA 4JPGA 4ZFMA 3A21A 3WQWA 3PUGA 2VX7A 1K4QA 4XBSA 3G22A 4Q6JA 4DJFA 1W31A 1YTDA 2Z29A 4YWIA 2H8XA 3W7HA 2EPHA 1E51A 3MKVA 4JNMA 3GVRA 1FHVA 1NHQA 3IGXA 1X6NA 1TWSA 4M7SA 3I6TA 2XG9A 4C6PA 4OE7A 4IJRA 4ICMA 4HZMA 1TZZA 3WCZA 1LVLA 2ZX9A 4NKCA 1FWAC 4IGSA 3B9NA 1ZUAX 1TWWA 1EH9A 3DFNA 1H5YA 5ABFB 4H50A 1ZX9A 1QHZA 4Y8FA 2W63A 3ARVA 1ZBVA 3MMTA 2Z2UA 4RNJA 2HS8A 1US0A 3DFOA 4NNBA 2FIQA 3D0CA 4HNTA 3PBVA 3LI1A 4H7VA 4AY1A 4BI5A 5BXSA 1XDIA 3TJLA 3DGZA 4ATWA 3HGJA 3QSTA 1VFUA 1K9TA 3FHQA 3TNOA 4MAZA 1BEUA 3SBFA 2QJGA 5FJJA 1R2RA 3WKZA 2X09A 1S46A 3S47A 4FXSA 3TOPA 3BOLA 2BC0A 2GVGA 1VH7A 4HOZA 1A5LC 1NJJA 3MUXA 1R87A 2GUUA 2BVDA 4NVTA 4JQ2A 1BF6A 7CGTA 2D0GA 1QHOA 3GW0A 3PNUA 3R11A 3LRKA 5D33A 4GIAA 3U48A 2BDQA 3CMJA 3CL7A 4FXJA 3M0VA 3CYJA 5DFAA 3OZPA 3H12A 2QCEA 4C6CA 1VD6A 1HKKA 4UWMA 1XF0A 2D3LA 4H4IA 1DE5A 2Y5SA 2PDWA 3TA6A 1UR2A 1V6VA 4N9CA 4WXZA 5GJPA 1LLOA 3C4UA 5C9UA 3N4EA 3M0IA 3QV6A 2G50A 4GKTA 1ZPTA 1F3TA 1E6SM 4XISA 3T6CA 1UP0A 1W5PA 1NOUA 3MSYA 1JOAA 2D2OA 1XYAA 3C2FA 2H6RA 2Q6ZA 2XFFA 1A5OC 1SW3A 3CAVA 3S5NA 3CUJA 1K4GA 3W82A 4DM1A 3D6NA 3W26A 3GR4A 5C9ZA 5I07A 1N8WA 2YX0A 5D02A 3R8RA 4M19A 1NM9A 3DGBA 1C3FA 7A3HA 3UG5A 4KF1A 1GOOA 4MY8A 1TWIA 1OVDA 5I79A 1MUMA 3TKFA 5ABHA 4YTSA 3FJLA 2J6VA 1PKLA 1XFCA 4C1LA 4MUZA 1LCOA 3GKAA 5B7ZA 4S39A 4JQ4A 4K6AA 1DJGA 2GGEA 3H2AA 4AZCA 3RCNA 4XTIA 4CN4A 1KA9F 3KEHA 3RXZA 3CUHA 4NI3A 2IUZA 3WLHA 1PJ9A 2PGWA 3UA3A 3KBJA 1UP2A 4ZSTA 1M53A 3I6EA 4EQWA 3TCEA 1R3WA 3MBDA 1CT5A 4TOQA 4XTDA 2R24A 1XI3A 3VNKA 1RLDA 1XR2A 3U2EA 1B30A 2XYLA 3LZ3A 4A3QA 3M07A 1HL2A 3Q65A 1BPLB 2HQAA 2C1HA 5AHMA 4MADA 3ANVA 4TTGA 3DFQA 2J66A 1OFQA 1AD4A 1ZP3A 2R6OA 4MF4A 4H4SA 1L6GA 3DENA 3QF0A 4GG9A 3A4WA 3GNRA 1N8FA 2Z1XA 1O7AA 3QYSA 1FCVA 4D8LA 2VEGA 2EGZA 4C6QA 3E96A 3M0HA 4YN5A 3W7MA 1Q6FA 1FWNA 3ZJ8A 4AYGA 1REQB 3OIHA 1A5KC 2J8FA 1OF6A 3O15A 2Z0IA 3C56A 4GLEA 3LCXA 2GDUA 1NDYA 3GTXA 3MV11 3TXZA 2ZTKA 5AZ0A 4DUWA 1ONRA 3DHFA 4JFWA 1TR9A 2EQ9A 5E09A 1WYIA 4E2DA 1ADSA 2QUUA 4LPCA 3WUGA 3M6DA 3QR1A 2WVSA 2WOWA 1DWAM 1EJVC 3ABSA 3PVFA 4WSJA 5A6JA 3O3RA 2D23A 5G1YA 4M6QA 3I3BA 1J5SA 2FDSA 3WEOA 5BZAA 1RCQA 3LTSA 2YCLA 4JQ9A 2I9EA 4EANA 1RD5A 5LNUA 3FHAA 3O1NA 5HMSA 2Z6IA 3H21A 2QMKA 1R2SA 2C16A 5I7GA 5CGQA 4W7UA 3MV01 1O95A 3A23A 1GREA 3FEQA 3PZMA 4RE4A 3MTWA 2YBTA 4UFHA 2Z27A 3A13A 1ZU8A 2ZXDA 3PUOA 5A95A 1H62A 5D03A 4GUJA 3QKZA 1FCBA 2VURA 2OX4A 2HBVA 4LB4A 3UETA 4CGTA 1B2YA 1XHGA 5CZ0A 2NWRA 4GFSA 1A0DA 2B0MA 4H9ZA 1NDAA 1DV7A 5D9NA 3UPBA 4D2JA 1JEHA 3IJDA 3TN3A 4R34A 2PTYA 1W2VA 4XD5A 1M41A 3OYXA 1VQTA 3EA2A 2XVLA 4LC6A 1IZKA 4F0SA 4AWUA 3F2DA 3F4DA 3AALA 4XG1A 4K36A 1BRLB 4GY0A 3W75A 4A6GA 2OZ8A 1XDLA 1VHNA 3P7YA 5H2ZA 1PX3A 3R89A 2XH7A 3MS8A 1NU5A 2CW6A 3OYZA 3W1XA 2BSLA 1V6UA 1V3HA 2GVEA 2BB0A 5M5DA 5CJMA 3N9RA 1FXPA 3CUIA 2V38A 3RUBL 3NVWB 1KM4A 4CQAA 2GJNA 2NQHA 2WHLA 3H8AA 3NTYA 5HINA 2NLYA 4A2SA 4BQ4A 1XIBA 4F4RA 3GG7A 1WV2A 2XN1A 3RO8A 4B90A 2Z2BA 5FJOA 3ONBA 3R13A 1Q45A 3P61A 4F0RA 2PDGA 5EU9A 4HHHA 4Z2JA 2OLSA 3MZNA 2NV1A 3S2NA 2ABAA 3CGCA 1LL4A 1MOKA 3UXLA 1GVFA 4MSSA 1Z8AA 3UXAA 1X96A 3SW6A 3WMCA 2FPVA 3CH0A 3SRHA 2E09A 2FFIA 2ZZ6A 1VEPA 1XIJA 2GDQA 1XH1A 3OZOA 5JU6A 1JR1A 4XZMX 5G5HB 1H3GA 1QWKA 4KQNA 4PEEA 3OVRA 4LVFA 2Z2AA 1JPIA 4U2ZA 1H0GA 1SJCA 4JEQA 1K3UA 4PUJA 1C7TA 2E6YA 3K8LA 1XBZA 3EOUA 2WWCA 4LF2A 3R8HA 1O5XA 5K9CA 1PZ3A 2PRLA 2VDIA 4HPJA 3ZS4A 3GBEA 4DJFC 2YB1A 2JE8A 3GXIA 1EDTA 2ZCGA 7ODCA 1J18A 3H22A 4M51A 4UTMA 1ZCCA 3IJLA 1LG2A 3E0VA 3C6CA 4L4OA 4AF0A 2Z28A 5EY5A 1JI2A 1FWBC 1T0OA 3K8KA 3DC8A 5LIYX 2C18A 3VNJA 4QS5A 3LG3A 1GZJA 1V7YA 3AHVA 4P7RA 4EM4A 3N19B 3P60A 4G7EB 1JROA 2ZICA 4Q8MA 4E2BA 3W2LA 5LNWA 4HK7A 2W62A 3UU0A 1B3VA 6A3HA 2VEFA 5HWMA 2PDIA 3IS4A 5FF4A 1K4HA 4PUDA 4BJHA 3DDMA 5LGXA 1W3NA 4ZO8A 5AC6A 2VM8A 4JOMA 4GH3A 1JDFA 4B5WA 3BAJA 4O54A 1DWGM 3B03A 2ZX8A 4YMZA 5BW6A 1ZJBA 4PMUA 4C91A 3EXSA 4HNCA 4U5IA 3A3XA 4FA3A 4O18A 3GK0A 3UEQA 1QTWA 2PP3A 4O50A 4M1RA 4B2DD 2C0HA 3RLGA 1XICA 1HZYA 1OYBA 2OEJA 3KBVA 3PTQA 3QYQA 2ZKMX 3EWXA 1GZ1A 4LA1A 3LHVA 3IUHA 3NDYA 2XIOA 3NJ3A 3IK2A 3IIVA 1V97A 5DX7A 4LUSA 4XD3A 3FNDA 1X6UA 3FJ4A 2PDUA 3UR7A 4C6NA 5ER0A 2YBUA 3APGA 4JTEA 3VCNA 3G0SA 3DEQA 3AS0A 2V2CA 1E5JA 5CPMA 3L4ZA 1QFEA 2DZWA 4ONVA 2PUZA 3NQ7A 3CTTA 1QPQA 1A5BA 3DH7A 4ZOEA 1MRQA 2ZUTA 3G6LA 1CTNA 2VXNA 5GRTA 1J0YA 2OLHA 2W27A 1P1MA 1NWTA 3L23A 1H7PA 1WAUA 1D7YA 4D8ZA 3T8LA 1GQJA 1CPUA 1N82A 1KFCA 3W7DA 2ZRXA 4O17A 5FJRA 3BAYA 1UWAA 4NEWA 3CZGA 3EXRA 4F66A 4UQDA 1PDYA 3WNNA 3NZ1A 1HJVA 1E4NA 3KHJA 4TU1A 4H6QA 3RR4A 5LHEA 2VL4A 1XX1A 1KKOA 4CQCA 3CUGA 2D3NA 1PTGA 4DJDA 2YLAA 3WBWA 4YLWA 3HPXA 2WOIA 1LP6A 3VC5A 3I65A 3WENA 5K7JA 1ESWA 3FKRA 2JGYA 3TLQA 3B40A 3EF6A 1T96A 3SI9A 4I5XA 2DP3A 4PCPA 2V5LA 4IIEA 3KP1A 5CPLA 1M3UA 4JY8A 3U9IA 3W27A 3VA8A 3DU0A 2AL2A 5AC5A 4RK8A 1H5VA 1QMLA 4S3FA 4F0MA 1W1PA 3A5FA 4O11A 4J7RA 1S2TA 3BG3A 3CPRA 4LVAA 3VILA 4RE0A 1P0DA 2MNRA 3ARPA 1N2VA 3GDTA 1H2JA 2H9AB 1JF6A 4HPXA 1JZ4A 4D6JA 1SB3B 2YKKA 3WJYA 1QCWA 3LPPA 3AICA 4A8LA 1KQZA 3FAXA 3TFXA 2NXIA 4HPGA 5LIXX 4MB5A 5KETA 2J78A 5KZ6A 3G24A 3PPHA 4DF1A 3PFMA 1BYAA 3CWHA 1BF2A 3FLUA 1GKQA 3CT2A 4JHMA 4K1GA 3SQPA 1PCKA 5TAOA 3STEA 1MXDA 4H9TA 4GI8A 1SU5A 2HBXA 4NJJA 3BLFA 3VK5A 4I9MA 4RXFA 4UR8A 1Z41A 3AHXA 3EB2A 3GO2A 1SZFA 1UR8A 3EPOA 3LTPA 3NDOA 2DZTA 3W28A 3M0YA 2O92A 3AI0A 3W7EA 2O4MA 3H7RA 1ZJAA 4GRSA 1ZLPA 5C54A 3W2KA 3VNIA 1H7OA 4GUHA 1GQIA 3W37A 4V1XA 1YDYA 4DIAA 1RJPA 1JIBA 1X8FA 4XUGA 3CWNA 3GAYA 3GDKA 3GUWA 3UWVA 1IEIA 2I57A 4EK7A 3QV8A 4UOZA 1RP9A 4XKYB 4DX3A 3EWYA 4PC8A 1S5TA 4KWVA 1CZ1A 1UR1A 2IS7A 3IIPA 3U5YA 3LBCA 2VWTA 3RLVA 1DPMA 2XVGA 2YXGA 2NW0A 4L6DA 1H63A 5A6KA 1NARA 2NQJA 2QCLA 4FALA 2ZUVA 4YYFA 4ECLA 3NNTA 4D6EA 4Y9OA 4K8EA 1QPKA 1UZHA 1NQKA 4XAGA 4EMJA 4AZIA 4REQA 1UWUA 2NZLA 2Y7DA 5CCZA 3WDJA 4IIBA 3DCPA 1LRTA 3GX9A 4JTFA 4RJEA 1GVQA 3T0AA 3CGTA 1MO0A 1QR7A 4I9AA 4L61A 4BURA 2Y7FA 1VFHA 3TFCA 2WJDA 3H54A 4K39A 1XG4A 4CD6A 3TONA 1TPWA 1T3QC 4JIEA 4US5D 2WSRA 1QJWA 4ZOAA 4D8AA 1JQXA 3LUTA 3W7OA 3LCWA 4YWSA 2IPWA 2ISWA 3G6MA 3O05A 2C1IA 2F8QA 4RW5A 5H8PA 1X1NA 2VX4A 3EEZA 1X2GA 2O9PA 4ZODA 2DGAA 4AVNA 1RALA 2EKGA 4N4QA 3HFTA 1WKYA 2YL8A 3PWGA 3RJXA 5FF0A 4PMRA 4XD4A 4ZOBA 1SFLA 1IEQA 3UCCA 4IMFA 5J5DA 1JGMA 5KSWA 1OABA 1OFOA 5C9RA 4WXYA 3PBYA 4XQ6A 2ZUUA 4CNTA 1WDPA 1QPOA 4XAZA 4QLJA 2OWCA 1W5MA 1AJ0A 1UBPC 1K7XA 1S2AA 2OQLA 2ON3A 4GYFA 2V30A 3FJNA 2XSAA 3LI0A 5HBFA 3KS6A 5IFTA 2E3TA 1ECEA 3VKJA 3QRHA 1EXPA 4AC1X 3RLHA 1UJQA 3QQWA 3WQDA 2Z1SA 3NGJA 3GXMA 1EF2A 2V2DA 4M6PA 1B3YA 1C90A 3CV1A 1W9UA 3QOMA 2YVFA 2F84A 3OQEA 4QAIA 3WQFA 3CPGA 1OHLA 5JCLA 3WSUA 3ZLGA 2F6XA 1YDVA 4FX6M 1KCZA 3OG3A 3VYLA 1N60C 3HQNA 1X7IA 1TJ0A 3UD6A 3PPGA 2CXGA 3W6LA 1B54A 1VYSX 1XSIA 4DWSB 4NJIA 3BSHA 1VBUA 3J7HA 4DBSA 3RGTA 4H7CA 4GA8A 3OA3A 1RHCA 1BG9A 2WC7A 3EDDA 4YWOA 2QIWA 3KZSA 1YDNA 1TKKA 2Q8ZA 3LK6A 2W92A 5D05A 5EB8A 2OTDA 4IISA 3NVTA 2X1IA 3VIPA 3W07A 2WQDA 5I3JA 1QI2A 3GNDA 1SGJA 1TWDA 3UP8A 1EPXA 2ZIDA 1LZOA 3W7JA 1BQCA 1UZ1A 4GINA 2Q3RA 1P7TA 4HYRA 4L4PA 3GS6A 4X63A 1JNEA 1XLCA 1Q4NX 4QJ5B 4W87A 1LUCB 3E12A 2BXYA 3ZVHB 4MYXA 5BU6A 4JTUA 2AMXA 3UESA 2E68A 2NQ9A 2ZZ7A 1GKRA 1MEIA 4W8BA 2WBGA 4UNIA 3SFWA 3C2RA 2BWGA 1KTCA 2OQYA 2PE4A 2GRTA 1LF1A 1XBYA 4Z0SA 4ATLA 1DXLA 4A22A 4OOUA 1FA2A 5DELA 3RM8A 1AUSL 1VEOA 1NP0A 4GH1A 4CLMA 1YYAA 4LT9A 1QNPA 4CQ8A 4HNNA 4W84A 4CEXC 2X8HA 4DVOA 5H1WA 2CZFA 3R58A 1OFEA 2QPXA 3K5XA 4HYVA 1LWHA 1LBLA 1VPYA 2PAJA 4W5UA 5CSSA 2YYTA 1F2JA 1E6NA 3WLJA 1I45A 4AZCB 4EM3A 3UW6A 1M7PA 1WCGA 1E0VA 5EMYA 4W5ZA 2DSUA 4I6KA 4Q22A 4NAEA 3NVZB 1VIWA 3I3DA 3W9ZA 1W5NA 3WJZA 2Y85A 5EBKA 2Y7GA 4Q7NA 2PDJA 3IJ9A 3W7PA 1GG1A 1EXBA 1Z3NA 1JDAA 3KRSA 4JDRA 2V82A 3B0XA 4JYDA 1DP0A 1VJIA 3HPSA 5G4WA 3M5YA 1ZNNA 3VGEA 1X8CA 1NHSA 5LZLA 3MUAA 3GW3A 3AHZA 3CV7A 3SY8A 4H9XA 4NY2A 2J7HA 3TMLA 1EQPA 1KXQA 1XH0A 3U7BA 5FMHA 2ZTJA 2GQ8A 4MUPA 2QAPA 4M80A 1KXVA 1TTJA 1GZGA 2YBVA 3WO8A 3AIBA 2UBPC 3MI3A 1Q6OA 3MYPA 3VIGA 3QPZA 4DI8A 2QJIA 1GHSA 1A0CA 1UKOA 4HTBA 4H04A 2V3BA 3CMGA 4BQ5A 3KP0A 1FRBA 3GXFA 5D9OA 3QQ0A 4O12A 3QMTA 3A4AA 2W79A 1B5TA 2Q8XA 3TW6A 1MSSA 3PSWA 2DVTA 1G6CA 2Q09A 3W4RA 4LYQA 1D3HA 1W2PA 2PWHA 2HVNA 5HNTA 5DANA 3SUVA 3WBAA 1IT8A 4F2UA 1WBHA 4KMQA 5ABTA 1TELA 4B5SA 3WQEA 1IGWA 1W9DM 1JYNA 2BFGA 1S2VA 4DWSD 1SQ7A 3PBWA 4QQUA 1J6PA 1FFUC 2PDCA 3TIMA 3F7JA 3UNTA 4NZ4A 4ACYA 1AVAA 3W2NA 1YMYA 2EPNA 1OFPA 5EFFA 3AUJA 3FA4A 2Y0FA 4H8UA 2CFFA 1VF8A 2GJRA 4IIFA 4ZTYA 3GC2A 2QV4A 1CLVA 1DJQA 4F0HA 1CXFA 2VFHA 3E9AA 2ADAA 1MZHA 4RE3A 2C0AA 3WYZA 1EFZA 1ZSXA 2QT3A 2VO5A 1J96A 1P6CA 4EPBC 4DJEC 1NF0A 3SCSA 3KWSA 3CUZA 3M7SA 1C8VA 4HGXA 3VXGA 3PJWA 4CKQA 2CBJA 3MMDA 4NNAA 4FK9A 4WY0A 4JNZA 4GXMA 4JTTA 4GRTA 3RN6A 4PMDA 2C3DA 4BF7A 5PTDA 1YQZA 5A8OA 4GJIA 1S5MA 1UMLA 3VX0A 1L0PA 3F4WA 3P8IA 1TPUA 1US2A 4MTVA 3VDBA 4LIIA 1Q6LA 4LRTA 5DRCA 4IL2A 1B31A 3R8GA 5KVIA 4XUYA 2VGGA 3DKLA 3U3HA 1O66A 3G1AA 1UA3A 1KD0A 3PUEA 1F8MA 5LIKX 2TYSA 4E3TA 3QHOA 1IWBA 3UPMA 3KZPA 4GUGA 3AWOA 3B9OA 4Y9MA 3AYTA 1MRAA 3UWQA 1WA3A 2A3EA 4S23A 4ZQRA 4ERIA 4DNAA 4OIFA 1QW7A 3LHYA 4HNVA 4N42A 4GFIA 3NQ6A 4OV4A 1QOPA 3A7RA 2X40A 1ZY8A 1FXQA 4IOTA 3LGDA 4TQTA 5JCMA 3AZSA 3W7QA 1UQZA 4DYJA 5HJYA 3ZFHA 1PKMA 3VGHA 4IMCA 3AYSA 3GE7A 2OKTA 4LUSB 1JDEA 2OCZA 4GY1A 1GRBA 1WXZA 1GTHA 4GJJA 3UR5A 1R9YA 4GYPA 4GCXA 5BOEA 2ZX7A 5A5WA 1OYAA 4HMNA 3LMYA 4HA3A 1DXFA 4LUIA 3RPDA 4IGHA 5A6BA 1E9ZB 4GUFA 1DTNA 1E56A 4KWSA 3EWBX 4JTAA 4W93A 5G5IA 2R94A 3OIXA 3GRSA 1JPMA 4M7TA 5LIWX 3I6RA 4WDTA 1LG1A 2E9MA 5DF0A 1TG7A 5K3VA 2W3ZA 4Q8NA 4DWDA 3ARZA 3GZ3A 3N6JA 3TNBA 2VHLA 3G1DA 1RCXB 3DG6A 2RHGA 1QNQA 3NM1A 4W8LA 1JVNA 3DYMA 2ZRWA 2J9YA 5CZJA 3WLNA 4KT2A 2P8CA 2VFGA 3H55A 5CBBA 4S3EA 1C9DA 3ITGA 3QPYA 4A3HA 4CEUC 1EYEA 1FWIC 4BFAA 1G69A 2E5DA 8CGTA 3NFUA 3PZQA 4JTJA 3W71A 3CU2A 4ACZB 4YS1A 3BZJA 4QE4A 4QNWA 1TREA 3P5YA 1E40A 2Y7EA 5FA5A 3THUA 4J3TA 2TSYA 4O14A 3QV9A 2FVKA 5KVHA 4HHMA 3MHFA 1JRCA 5E5CA 4EWJA 3FXYA 3T0CA 4U10A 4H4VA 3NZPA 3VOIA 1MZRA 1PBGA 4UFMA 2PODA 4ZQPA 4EQSA 3T4WA 4REQB 3XISA 4Q8TA 1I2NA 2PSNA 3E5BA 1IEVA 2VC6A 1N63C 4KCTA 1IIGA 4EP8C 4TVWA 4GCAA 3PG6A 1QW8A 3W84A 2GR0A 2WZHA 4Q8UA 3N73A 2MUCA 4PTDA 1M9HA 4UQ9A 2ALRA 1H1YA 1KTBA 2X2GA 2PEVA 3BLOA 4EXQA 1OX6A 2WPFA 4N4PA 3L0NA 1MYRA 4L1XA 1NH6A 2C1GA 2WPEA 3WQ5A 3IUIA 4IQJA 4PSRA 3WJSA 1OGBA 1TPDA 3NQBA 3L2MA 5A6MA 3W25A 5D38A 4MNLA 1MW1A 1K9DA 4H1ZA 1GOIA 1PL9A 1W3LA 1TPB1 3RMJA 2D2HA 3O07A 1RPXA 1XPYA 4HYWA 2NUXA 4GBDA 3JUGA 3TC6A 1Q85A 4NUWA 4PB4A 5C7VA 3AMDA 2YW3A 2REQA 4HD5A 2Y62A 2HV5A 5CBIA 1XS2A 3H70A 4ZO6A 1WXJA 2AL1A 3M47A 3CV6A 4UZSA 4Z1YA 1UG6A 1EA0A 5CJNA 4AVOA 1XLIA 4HA1A 4AHOA 3N2MA 4E4PA 5IDIA 3KBSA 1MEWA 1FKWA 3HTWA 3QN3A 3UZ5A 2CHNA 4PSPA 1CXIA 3FDKA 1XBXA 1VS1A 3V35A 3SUUA 1JL8A 3N29A 4J35A 4PN2A 2E3ZA 3AAMA 2QHAA 3DZ1A 3TC3A 2P10A 4FNRA 5I3FA 2E8ZA 3M0KA 4OGZA 3DJGX 5HNUA 4W4QA 5D09A 3L0GA 3B9JB 3ARRA 3ATZA 3RX3A 1HQTA 1QVBA 1OIMA 5ABFA 1WXYA 4GQBA 2J47A 3CAKA 3LPGA 2WNZA 4QM1A 1VLWA 4KCVA 4HZ8A 5JRBA 3KOWA 1KNWA 1DWIM 4H4UA 3NL3A 4AEFA 1ZKQA 1LLZA 3BQ5A 3CO8A 1I6NA 3A12A 4XV0A 3JW7A 3EKZA 2D22A 3WLPA 3S9ZA 2XFYA 4ZEPA 4ICNA 3GAKA 3D5HA 5D2WA 4RL3A 1TQXA 1Q1WA 2QPSA 5A6AA 2YYUA 3Q58A 1BVWA 3NQCA 4YTTA 2IKJA 4AG0A 3WDIA 5JVLA 1W5OA 3QJAA 1RJQA 5GNXA 4JS3A 3A4XA 2Y1HA 2FB2A 2FHCA 1F07A 1ONXA 5FL1A 3BO9A 4QSHA 1J0ZA 3GD6A 2YLLA 1WKEA 5LKYA 1DYSA 4V28A 1VQZA 3CM4A 2DSVA 4MDPA 4JTCA 4BQ3A 5GVJA 2G5WA 2DZAA 2PDXA 2ATSA 4TX6A 1BYBA 1E6RA 3AIQA 1BZLA 1S1RA 1EYWA 2NSXA 3A7AA 2DT0A 4K38A 5M17A 3BCFA 3UVAA 2P1FA 1RQEA 2QV5A 2ZZ1A 3OGSA 2EQDA 3NXLA 1ITXA 4AX6A 5K4ZA 3IACA 1RD6A 2GQWA 2J7BA 1JF5A 4YHGA 1P0EA 2VZSA 4EPKA 5AOUA 1ZALA 4P7LA 3P3BA 4A3UA 2CLIA 3N4AA 3TVAA 3OLIA 2OYMA 1XIMA 1B3ZA 3V75A 3VIIA 3EDEA 2QUTA 3WFLA 3LXBA 3T2PA 1E1CB 3WH5A 1FKXA 1B3XA 3HG3A 4RX0A 1N62C 4MY9A 4NZJA 2G3IA 2WMIB 3RNMA 4JFTA 3WUEA 3R5EA 1VCVA 3ARTA 1CW2A 1ZJHA 2QCHA 3FFSA 1GG0A 3CAQA 1FO4A 1NAL1 2GR1A 5A94A 2XN0A 4DXKA 1BKSA 1BD0A 4R9XA 2FYMA 5M3WA 1POJA 4L7ZA 4BK9A 4OBRA 3GNXA 4UNLA 2PCQA 3PJXA 1NOFA 3W29A 3URBA 4C6LA 3NZRA 4QQ3A 3EPNA 3NL5A 1KWKA 3FYPA 3O2LA 3IGSA 3WK2A 1NP2A 2OVLA 1E6PA 3NRZB 2YDAA 1R5YA 2BP1A 4GZJA 2CKSA 2G3JA 3GIYA 3F2CA 3KX6A 1A5NC 2D73A 5JQ9A 2HVOA 3W2MA 1TTIA 1FOBA 3M5XA 4HU3A 2D1ZA 4HJFA 3NOEA 4NASA 1O68A 1CEOA 1EGMA 5AHIA 3T0TA 3T4CA 3FA3A 1OY0A 4X61A 3URAA 5J8LA 5CSRA 4DLMA 3R43A 1UH4A 2RJGA 2GVJA 1Q65A 4OZOA 4PBGA 2OSYA 1OZMA 4D9PA 3CUXA 1PWMA 3IAQA 3UY8A 1EBHA 4DXVA 3KBNA 4ZOHB 4NAFB 2ZYFA 3WY1A 2FLIA 1OGGA 3GDBA 3KM8A 5D4YA 2OOGA 1E0XA 1AJZA 2TODA 1VLIA 4H9MA 1ADOA 1FWSA 4EX4A 2FZ8A 1TVPA 3U4AA 1AH3A 2FPTA 2CITA 3QY7A 3SY5A 4PUEA 2J8GA 2W0HA 2GQ3A 2BHYA 1TYGA 2GFTA 2X16A 1TPEA 4XVDA 4Q8PA 1BXCA 3CHVA 1LBFA 2ZA2A 1WP6A 1AL8A 3T07A 4HPHA 1LROA 2NQLA 3PG9A 3V5FA 3VM5A 1FWDC 1GESA 5F2MA 2JIWA 2YL6A 4MJ2A 3VX1A 2FGLA 3A7UA 1WB0A 1E0TA 4JL2A 3PJUA 1FTXA 1UWTA 4MKVA 5F7UA 3AJ7A 3HQPA 5CPSA 1M68A 1V7AA 4S3CA 2DJLA 1WDSA 3V16A 2D0HA 2J77A 3W23A 4AC7C 3AXIA 3ID7A 4ZR8A 1SZEA 3LLDA 1CNVA 1PPIA 4HK6A 1I4NA 1UH3A 1XSKA 3LGGA 1HP4A 3CS2A 2BC1A 3O6CA 3TJ4A 3SADA 1V6YA 3KRBA 5CC3A 5ABGA 3OZMA 1ALDA 5AHFA 4K68A 3WLQA 3GU9A 1LWJA 5FJTA 3B8DA 3S5YA 3RX4A 2P76A 1H11A 3UZXA 2PP1A 3NURA 1QI4A 2W0UA 3MJYA 4F9DA 1S39A 1HKIA 2DZVA 1FY6A 3UR8A 4AIBA 1FHUA 1GETA 1HJXA 3LV6A 5LXEA 1W9BM 1SJAA 1PUDA 1F8IA 1SW0A 4C1NB 3BSMA 3UY7A 1AQ0A 2ZZ3A 2YZRA 4PEKA 5AYBA 3LMZA 3AM9A 5BRQA 1U1UA 4YVVA 1PAMA 1YW1A 3F5KA 3W6MA 3EOOA 1V0MA 2FZNA 1DWJM 2RKXA 3CXBA 3WELA 1FECA 1AL7A 3H4GA 2F6UA 4J5NA 4AZBA 1KBIA 1EBDA 3R79A 4CD4A 4QROA 4CUCA 2X8GA 3W7LA 2CLMA 2VD8A 2J79A 4JNYA 5DMLA 3H24A 3RG6A 1J93A 4W7VA 2VP8A 4B5UA 2VQTA 3QW3A 5ECUA 1OSEA 3M9YA 4XZ9A 3TV8A 4NZ5A 2XDFA 4GNVA 2WZEA 1VRXA 4RE2A 1JXJA 5E93A 5KZEA 4N7QA 4LAOA 4PULA 4L65A 3BVJA 4HN4A 4R7OA 4ZENA 3H53A 1JQVA 1AK5A 3L4VA 1KWGA 2YDRA 1A5MC 3R94A 5C7HA 2V68A 3FSTA 3AS1A 1QK0A 3U7VA 3CHCA 1GWJA 2VEKA 4GI9A 1B3WA 2ZE3A 1VBHA 1IE7C 3TR2A 7XIMA 2WMFA 3L12A 1GONA 3MCOA 4QJ3B 1Q6CA 3VGBA 2VOTA 3OEXA 4O15A 5C0QA 5HMFA 3VMNA 4MNMA 4IPIA 4HOWA 3G1VA 3K8MA 4PMZA 4MB3A 4HN8A 2Z1WA 2C8NA 3M4HA 1OCBA 4NNCA 1KRBC 2CLHA 2DW7A 2NVAA 4R33A 2HQMA 4ZA0A 4ZQOA 4YJ5A 3M46A 1RAKA 4O1BA 3PULA 1V0LA 3OU8A 1RXOB 1RK6A 3BUVA 5L9FA 4AY8A 3OW1A 3AU2A 1VDVA 3B3DA 3RRAA 1B4EA 2TPSA 4DYEA 4PRTA 4PTMA 3GD3A 4UTJA 2D2GA 1RUSA 3PTMA 4HMEA 4IX2A 3DC0A 4ZGYA 3UNDA 3CASA 3VDGA 4LVGA 4H4ZA 2WMKA 2A6LA 3CNYA 3HV8A 1JZ8A 2HTMA 2E25A 3VKKA 4KCWA 7TIMA 3KVLA 4UCGA 2OKOA 1KB3A 2F2KA 1HG3A 2OR2A 2W9MA 4WHBA 1LJYA 1W1A1 4J27A 1H2IA 5BXRA 1UR4A 1EGVA 4QJ1A 2C71A 2G37A 3MCNA 4WSKA 4IWWA 2DJXA 1GNXA 4S3KA 2J62A 3MDWA 4KETA 4A3YA 4IH3A 4AIEA 1E6ZA 1W91A 4U33A 3FGCB 3AMZA 4AAJA 2DH2A 5B7YA 1V59A 2WVVA 2BASA 5F2LA 1E71M 4NRRA 5A8PA 1R9XA 3P62A 5FSEC 1BRLA 2G8ZA 4NRSA 4PTVA 3QY8A 4UIOA 3UWYA 3QZ6A 4IQEA 3CL6A 1E5NA 5CEWA 8A3HA 3CZKA 3VUPA 4D6CA 4RNFA 3LRMA 1CIUA 2HS6A 1XP3A 4GPNA 2PD5A 5AB3A 2PDLA 3KHDA 3UG8A 1DIOA 3DFPA 3STFA 4AEOA 3TMQA 5E9XA 4ADWA 2FPYA 3IK4A 4QFUA 1HL9A 4QG6A 2EG6A 4UTWC 4GIYA 1YPXA 1YQ2A 2QF7A 3DG7A 4V2XA 2W5FA 3LZ5A 4RV8A 3A3HA 2PRHA 1GT8A 3AFBA 4QCEA 4AD1A 2WSYA 3MP5A 3GG0A 2YDQA 3BANA 3B97A 4DELA 2AMGA 4IFKB 1MXSA 2WKLA 2WHKA 3GTIA 4C6EA 4D71A 2QJJA 4GZ7A 5LGZA 1EUNA 1UROA 2QNEA 3CBWA 3USZA 1H09A 3OBEA 4Z2HA 5FACA 5EPDA 3LDVA 3W02A 4Z2LA 3N2OA 1K8XA 3CHEA 1EP3A 2ZVRA 3AOFA 3FY1A 3E0FA 1ONWA 1KV8A 3B8VA 4LYPA 1LDCA 2YXOA 1IWAA 4MFDA 3SRKA 3PHAA 4EOUA 1L2UA 5FS9A 4AWEA 3T42A 1G4PA 4LYRA 4KRUA 1I1WA 2WLZA 5FI8A 4GVFA 3LHWA 3WDPP 4JL1A 5A8QA 3ZJ7A 4JX4A 2FFCA 1M65A 1G1YA 1MNZA 1TR1A 3KS5A 3CL8A 2CNCA 1DWFM 3E0IA 1TE1A 3WF0A 4GWEA 3BURA 1HKMA 4QNEA 3WQ4A 1JYVA 3ELFA 3KLKA 3AXHA 1PIGA 2VGIA 2Y89A 3WFZA 2DQWA 3TE9A 6ENLA 4IGMA 2ZZ4A 3A9BA 1HO1A 1IZCA 3R7MA 1XIDA 3T55A 1RA5A 3ZM8A 3HMCA 3WLRA 1K7FA 1KQYA 3RCMA 3DFHA 4KWUA 1VFMA 1UD4A 1XKJA 4KCUA 4M5PA 2WM1A 1GPFA 1BFNA 2PC4A 4TUFA 4AX7A 4EAYA 4H9YA 3T08A 2P3EA 2VVSA 4UTFA 3NEHA 4WCJA 4AMAA 3GWQA 2QGHA 3CQJA 3BDKA 4M8UA 2GOUA 3B4YA 3PBUA 4PGLA 4AD5A 4A21A 4AD3A 4E8CA 2GQ9A 1W32A 2VR2A 4O0ZA 4AWSA 4LW7A 1HP5A 3VM7A 3UCDA 2NVDA 4NZ1A 3PC0A 1RLCL 1TV7A 1XPGA 1MDLA 2J7FA 5FSDC 4P8VA 1VRDA 4XKYA 2ISVA 3IANA 4OTKA 4QE5A 4O28A 1XGZA 2OGYA 1TE6A 2ZZ5A 1UPPA 4HT3A 4LY4A 1W9XA 5L6UA 2V2HA 1GVSA 2BBFA 1V4YA 1TA3A 3RMEA 2VMFA 3TJIA 4EMIA 1SZNA 3VTRA 3L8KA 5AKQA 4MM1A 2WPBA 3AYVA 3LENA 3NSNA 1QO2A 3SJ3A 4KGJA 4IPLA 1XRVA 3ZIZA 4FR1A 4Y6GA 3MSGA 3P74A 3WMSA 5CBJA 2GJXB 2OZ0A 5C6MA 3F03K 1W1TA 3W83A 3GVVA 1EDQA 4CNUA 3EX2A 3DGHA 4HOXA 3R1ZA 2BHZA 1PS9A 3QQ1A 1YE4A 3HPZA 4B15A 4IP5A 3E2QA 1EP1A 3M44A 3LCLA 3I7QA 4S3DA 5BWFA 1I0BA 2VGFA 1RA0A 3NPUA 3UFYA 1ZAHA 4HNLA 1XFBA 1V8EA 3SURA 3WDQA 3AIRA 1V6WA 1TV8A 3BTNA 9XIMA 3V4BA 2XSBA 1W37A 2ZRZA 3DFYA 5FF3A 2RDWA 4AHQA 2J13A 1EC8A 1R30A 3TH6A 4ES4A 4L9ZA 1JNDA 4OV9A 3GVQA 3V5OA 3BG5A 3PAJA 4JGDA 1PXGA 3S1WA 4UB9A 5I6SA 2QDDA 1XLHA 1BLIA 2VD9A 1MDRA 3H2FA 4UOQA 4A05A 2J74A 3QFWA 4KEVA 1K1DA 3BLEA 3Q2DA 2OPJA 2HE5A 3ZVHA 2V5BA 2HROA 1N5WC 1K7EA 4JTGA 4H4RA 1FWGC 1ML1A 4OT7A 4JHOA 3M64A 4N9BA 2ZFAA 5I3IA 4P7NA 1KM5A 1SSDA 5I77A 3AQUA 1HF6A 4KWWA 4PB5A 3LB8A 1YBQB 4S2BA 2OT1A 2P0IA 3PPFA 3BK0A 2JQXA 4B92A 2YOCA 3S8HA 4A29A 3AXKA 4B3ZA 1ZGDA 3BH4A 4CVWA 1HJWA 1UH2A 4DPQA 1Z32X 3AZRA 3ZQ9A 4ERGA 5I3HA 4XX6A 1S3TC 3SCWA 2WVVB 4M1BA 3RO6A 4QP0A 2CBUA 2WK2A 2YL9A 2ZADA 3F4CA 2X50A 4DWSA 3TN5A 4EAMA 1F9CA 2DPEA 4W86A 1DJIA 3DK8A 3JRKA 4IL0A 1ZRQA 2NPXA 6ALDA 1Q4WA 2J24A 1E72M 3QFAA 1JUEA 4P61A 4US6A 4NI8A 1J2BA 3E5PA 4PUNA 1OX4A 2ONEA 2QCNA 1XG3A 3HG5A 3RM4A 4CCCA 1PWLA 3TWAA 5F4XA 2VUNA 1FP8A 2GR2A 2XIIA 5XIAA 1LT7A 2BY2A 2J88A 3URHA 1YTKA 4TV6A 2NQ5A 4ASTA 3GD4A 4ALDA 1Q2SA 1OT1A 3WL1A 3PJTA 3W87A 3GDRA 1SO3A 1DJYA 1GOWA 5C2CA 2Z26A 3S6OA 1H51A 2Z25A 2JEPA 3VFLA 1F61A 9CGTA 3L4WA 1QXLA 4S2CA 4CD8A 2NV9A 1JXKA 4WUIA 1BG4A 3EOSA 4P8WA 4PR4A 4HSOA 4J40A 4BS0A 4EKJA 3NXFA 2YSWA 5CC7A 1GOMA 4EF8A 3HF3A 1THFD 4B9ZA 2WZTA 3QR3A 4B5XA 3D9XA 3AMCA 1QWGA 3FOKA 1DE6A 4WDUA 4LXFA 1GW9A 4JXCA 3GR8A 1U5VA 5C2XA 2Z1KA 2E1WA 1TJ1A 4P8XA 4GNKB 2W66A 1DQUA 2XGZA 1R3TA 2QJMA 1Z48A 1SZRA 2I14A 2TPRA 3GU1A 3KRZA 3O0HA 3PP7A 2R9ZA 3UG3A 3NVYB 1FH9A 4GQGA 1JEZA 4HMCA 4XBJA 3I3EA 4AUBA 3QFEA 2I5QA 4NZ3A 4B5VA 2X05A 4PUMA 2V6AA 2NX1A 3PM6A 1UD3A 4BR1A 2O56A 1NTHA 3PS7A 3SFKA 4E2OA 4JX6A 2Z00A 3IVUA 3KW3A 4OU1A 4FMVA 1AW5A 1H7XA 3GYCA 3ZYZA 5E0CA 2GWNA 2V69A 1Q7MA 4FX7A 5BXPA 2GL5A 3S3GA 1OCJA 2OQHA 3IV8A 3E2RA 3N1AA 3QMRA 3RNDA 4ZE5A 1GGOA 2B7OA 4NYYA 3WLMA 3GXPA 5JBEA 2X7VA 3ZT6A 2BLEA 2FQIA 1A4MA 5H8UA 2QCFA 1VGAA 5DBTA 4AMCA 3TYCA 3DFSA 4MFEA 3MMWA 1XDMA 3KL0A 3WDHA 2XPKA 4ATDA 3HJZA 5C9WA 4QLKA 3T9PA 1JPKA 4KH2A 2QJHA 3N3TA 4AHPA 5AECA 1O12A 4LAMA 5HULA 5AY7A 1B57A 1ZJIA 4IGNA 1XLLA 3GIQA 4UQAA 1KFWA 1XC6A 1E43A 1K8CA 5CC6A 2CLEA 2Y63A 3G3DA 4Y96A 1IR2A 1UYQA 3W7IA 3MO7A 1R7OA 5JXQA 2E5BA 3CJPA 5CG0A 1U1HA 4FOJA 3V1HA 4DYKA 4M29A 3RLUA 5FESA 1H6VA 1KBBA 1F3PA 1ZK7A 4KGLA 3S6DA 1YLVA 2GJXA 2VI0A 3IEBA 3NR0A 3W53A 2NT1A 3TWBA 4Q7IA 2QW5A 3PF3A 2C14A 2RFGA 1QAPA 1AW2A 4EMWA 2GDVA 4HMDA 1DIKA 4ILSA 3S2JA 4OVXA 2P53A 4J3XA 4FF7A 2VFFA 1UZDA 2JBMA 3VINA 1EL3A 4DBEA 3EDJA 1NWRA 1OX4B 4GVHA 1TA3B 1IYXA 5AC8A 4UTLA 3FSUA 2G97A 1IEWA 2GGGA 3WMLA 1GYNA 5FS8A 2Q01A 4X60A 4E38A 3N2BA 1LT8A 3MU7A 3GB6A 4DY1A 4QIUA 3G1HA 3QV7A 2DW6A 4NQ1A 3VGDA 1ZFJA 1PZ2A 4PTWA 2QUNA 2YXXA 5FEXA 1SO6A 2YCEA 5BROA 4B91A 2FTWA 4MOZA 4ZZ9A 1GRFA 1J79A 1PSCA 3REQA 4DZ5A 3WK3A 2HDJA 1KC7A 1OG0A 1Z42A 1F6YA 3WQ6A 1IQ8A 1EKOA 3S1UA 4QDPA 1TV5A 2BY1A 3LBOA 2A8XA 1IT7A 1OX5A 3LM7A 4IM4A 3LLFA 4RDZA 1M6JA 1YTEA 3WBEA 1AD1A 4DEFA 5HNNA 2QUVA 4KIRA 2OZTA 1ZZMA 4J4KA 1DJXA 5C70A 1FHLA 3ZJ6A 4IF2A 1AMYA 3SUSA 4C1KA 4O1DA 4PUUA 3MANA 1E9LA 4EWND 1EIBA 2W55A 3W73A 1OJXA 1UD6A 4O53A 2W67A 1M6IA 2CEQA 3KCLA 2EPOA 5KMYA 4A35A 5IRPA 2W54A 4HNOA 3TQPA 4H00A 2H9AA 4E8GA 3RITA 3NG3A 1S2CA 1UWSA 4UMBA 2TMDA 4MKNA 2JF7A 3PSVA 1DJHA 2E7FA 1PYFA 2G3NA 2OZ3A 2R1LA 3FDGA 3L68A 5HJLA 4E8DA 1NFGA 1R46A 4JFSA 4R88A 1ICQA 3R0UA 4IPNB 1W5QA 4PYSA 2CC0A 5AVNA 4KKXA 2QCDB 2HE8A