3OPSA

Crystal structure of mandelate racemase/muconate lactonizing protein from geobacillus sp. y412mc10 complexed with magnesium/tartrate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
386
structure length
386
Chain Sequence
b'SLNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title Crystal structure ofmandelate racemase/muconate lactonizing protein FROM GEOBACILLUS SP. Y412MC10 complexed with magnesium/tartrate
rcsb
source organism Geobacillus sp.
molecule tags Isomerase
total genus 117
structure length 386
sequence length 386
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3opsA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3opsA01
3EEZA 1KKOA 3H12A 3OTRA 2OFJA 3CB3A 1KCZA 3N6JA 2MUCA 2AL2A 2I5QA 3UJRA 3N4EA 2HZGA 1NELA 3JVAA 2QDDA 3UCDA 1IYXA 4G7FA 4A3RA 3TCSA 2OZ8A 5FJPA 3RITA 3OW1A 3UGVA 3K1GA 1FHUA 4JN7A 4JHMA 4GFIA 5FJRA 3SN4A 3IJQA 3PK7A 3I4KA 3CXOA 2OZ3A 3DEQA 3T4WA 4DYEA 3MQTA 3T9PA 2HXTA 3DIPA 3QN3A 1TKKA 3RO6A 3ZLGA 3DDMA 1MRAA 3RRAA 1OEPA 3TJ4A 2POZA 2AKMA 1R0MA 4GIRA 3FXGA 1MDRA 2OPJA 3MSYA 3IJLA 3OP2A 3MWCA 3FJ4A 2DW6A 3T6CA 2PP0A 4EWJA 2PU1A 4J1OA 3ZVHA 3QLDA 3H70A 5ENLA 4HCDA 4ZA0A 3I6EA 3S5SA 3ZLHA 4IT1A 3VA8A 5J04A 3JW7A 4E5TA 2GDQA 1L8PA 1SJCA 3FYYA 1MDLA 2HXUA 1JDFA 2GGJA 1EC7A 3DG6A 3GY1A 3SN0A 2OZTA 2QDEA 4X2PA 3BJSA 3ZLFA 2PPGA 2XGZA 3Q4DA 3DG7A 1E9IA 4FI4A 2PTWA 4KWSA 3P3BA 2RDXA 2PP3A 3CT2A 3MKCA 1TE6A 1RVKA 1SJDA 4HCLA 4KEMA 3NXLA 2QGYA 3CAWA 3VCNA 7ENLA 4M6UA 2P3ZA 2P88A 4ENLA 1EBGA 4H83A 3TJIA 5FJTA 1KD0A 4KT2A 1SJAA 2P0IA 3THUA 1ELSA 3HPFA 3DERA 2OKTA 4GGBA 2PCEA 3NO1A 4IL0A 3TOYA 4F4RA 1FHVA 4IL2A 3IK4A 4G8TA 3ENLA 2MNRA 3CK5A 1XS2A 3GC2A 3R11A 3I6TA 3ES7A 2FKPA 3BSMA 3VDGA 4Z1YA 4J3ZA 3VC5A 2ZADA 3NZGA 3SQSA 3GO2A 1PDZA 3DGBA 2PS2A 2NQLA 4DN1A 4HYRA 3V5FA 3R1ZA 2AKZA 4HN8A 2PP1A 2P8CA 2QJJA 3D46A 3U4FA 3DFHA 1JPDX 2DW7A 4HCHA 2GGIA 4M0XA 2CHRA 4DWDA 3IJIA 4DHGA 1R6WA 2P8BA 2QJMA 4K8GA 4DX3A 3DG3A 4H2HA 2AL2B 3NFUA 3H8AA 3SJNA 1MNSA 2PTYA 3OZMA 3QKEA 4K1WA 1BQGA 3OPSA 3V3WA 3PFRA 1P48A 2XH2A 2GSHA 4E4UA 3N6HA 1ONEA 3OZYA 4E4FA 1XPYA 3UJEA 1DTNA 3TTEA 3T8QA 1YEYA 4IZGA 3BOXA 2PTXA 3PWIA 3UJ2A 4IP5A 4K2SA 3D47A 5EU9A 3QTPA 3VCCA 2FYMA 3N4FA 1WUEA 2AL1A 2XH0A 2O56A 5BOEA 3CYJA 3S47A 3B97A 2OO6A 4FP1A 3QPEA 3V4BA 2PU0A 4IP4A 4E6MA 1KKRA 3V5CA 4H1ZA 3R0KA 4A35A 3UJFA 2PTZA 3MY9A 2XSXA 3H7VA 3TWBA 2PGWA 4HNCA 2GL5A 3RR1A 4ROPA 3ZVHB 3P0WA 4GGHA 5BOFA 1JPMA 3RCYA 2PA6A 2OX4A 3U9IA 2GGEA 3MUCA 1P43A 1MUCA 3UXLA 2PODA 2XH7A 3SN1A 3VC6A 3UJSA 4HPNA 4KPLA 5IDZA 3PWGA 6ENLA 4MKSA 3KUMA 3UCCA 4HNLA 3Q45A 3FV9A 4GISA 3EKGA 3FVDA 3ZVIA 2ZC8A 4A6GA 4YWSA 4H19A 4ZCWA 2XH4A 2GGGA 3MZNA 3TQPA 1WUFA 1EC8A 1ECQA 3STPA 1SJBA 3SSZA 2ONEA 3ES8A 1NU5A 3VFCA 2QJNA 3TWAA 3JZUA 3DFYA 1EC9A 3UXKA 3R10A 4IHCA 4E8GA 5FJOA 2QVHA 1JCTA 3TW9A 3RGTA 2OVLA 4GYPA 5FJUA 2OG9A 3R25A 4JN8A 2OQYA 4MMWA 3R0UA 4Z17A 1PDYA 3DESA 4GMEA 4DXKA 4GYPC 2OQHA 1TZZA 2PGEA 2QQ6A 4MGGA 1W6TA 2PMQA 3GD6A 3SBFA 2HNEA 3FCPA 1F9CA 1EBHA 1BKHA 2OLAA 2GGHA 2PSNA 3P93A
chains in the Genus database with same CATH superfamily
3T0TA 1XIMA 2GR2A 3V5OA 4MZ1A 3VNYA 4X63A 4CD4A 3N4EA 2E28A 3XIMA 2WNQA 3S2NA 3TYZA 2YDQA 2IS7A 5FS6A 1SMAA 5BXTA 4ZSUA 1IYXA 4JTTA 4KQNA 3WJSA 5C6MA 2ISSA 2GQ3A 3GHUA 2VFIA 3CHDA 2C8NA 3BDKA 1MQQA 3WQ5A 1H60A 4H50A 1FHUA 4CGTA 1TO3A 4JHMA 3LENA 3ARTA 1MUMA 1E0VA 4GC4A 1UPPA 3WF0A 4PMDA 3C0SA 4CD5A 1S2VA 2PURA 3W7LA 3MSRA 2H3DA 3LSCA 2VC7A 1P0EA 1W3IA 4MHBA 3ZSSA 2ZXDA 1US0A 4B90A 2V3AA 2CLFA 1ME7A 1OEPA 1OT2A 1TELA 2PRMA 2BS9A 2XVLA 1R9XA 3SZ8A 2WSYA 3A4AA 3URBA 4M1BA 4C7DA 1MDRA 1GK8A 3LHYA 4D72A 2CZ5A 5LZLA 2D69A 3APYA 2FFCA 1R86A 3S0CA 1HO1A 1W9DM 4GO9A 3W1AA 4LUSB 3KVMA 3NWRA 1OFEA 3QLDA 3H70A 4O17A 4IF2A 4RXFA 1VIWA 2QCFA 4MNLA 4W9TA 5EBUA 1QFEA 1IIGA 1ZBCA 2G3NA 3U5YA 1SO4A 4Q7IA 1TMQA 2OT1A 1EC7A 3CPRA 3N29A 2NSXA 3OB8A 3DFPA 3TJXA 1X7FA 4MWAC 1GRAA 3CT2A 4XWUA 2X0SA 3TX9A 1ZY8A 1HX0A 1OCJA 3W7QA 3G1VA 4DJDC 7ENLA 4PE8A 2XN2A 3P5YA 3EANA 3LPPA 4ZB5A 1JZ2A 3NQ6A 2DZUA 1PTAA 2Z2AA 3KBJA 1PCKA 1GOQA 4AVNA 1SR9A 2XISA 5JCMA 2PDQA 4N9BA 1EDTA 4GZEA 3L2IA 4PCFA 1KLYA 1NDYA 4MJ2A 4HNNA 3TC6A 1WNOA 1X6LA 3EX1A 3ABRA 1P0BA 2E9BA 5T91A 4LYPA 3DYOA 3WQEA 3GBDA 3UZWA 1HF6A 3LPFA 5D32A 2GSEA 1I2NA 3DCPA 3S1XA 3C61A 9CGTA 3OQ8A 1WZAA 3AC0A 2GJNA 3OZOA 1RH9A 2AKZA 2JK2A 3SIZA 1UKPA 3VOHA 1IQ8A 4ZO9A 3UETA 3ABSA 2PWDA 4MDPA 1C91A 3C2YA 4HCHA 1EP3A 2QAPA 5LNSA 1J0YA 3DFOA 4Z0SA 4FALA 1B3VA 5HINA 5CBJA 2CBVA 2VQTA 2CBUA 3GR4A 3SCSA 4IXXA 3PFMA 3PZIA 4A2SA 1BQGA 2CZEA 2YA2A 5T9BG 5EKYA 1A49A 1NF0A 1HG3A 3KCOA 3C6CA 3MANA 2CKSA 3P67A 5AZ1A 4JIEA 1EQPA 3N11A 3IPWA 3O7UA 2PTXA 3WQPA 1WDRA 2J88A 3OYZA 1KM4A 4GUHA 3RUBL 1E51A 3CUFA 1ZB5A 4IGNA 4GQ0A 4F2UA 1OFDA 4Q8MA 4H00A 2DZPA 3UR5A 1YLVA 4A3HA 2BCPA 3DKLA 2X05A 2A3CA 2A2IA 1HKWA 5E9XA 3MMDA 3S5YA 5JIPA 2PU0A 5D38A 3R0KA 1BYAA 3W4RA 4AD5A 3WFZA 3BAJA 4AIOA 4GIYA 1HL9A 1CXEA 2QCDB 4MY8A 1TREA 3HB9A 1UWUA 4JGDA 4WR3A 1LLOA 2V6OA 2RABA 4ROPA 3ZR6A 3SGZA 3MUXA 4JFWA 4D6FA 2F6XA 4OBTA 1W9UA 1E3ZA 4L9XA 2BVDA 3CC1A 3WF3A 5CLWA 1UC4A 4V1XA 4UR9A 2OR2A 1EYWA 4R7WA 3QFBA 4UFJA 1UR8A 4UNLA 3HJEA 3OBKA 4RR4A 3SCUA 3SN1A 2YBUA 4LNYA 1UKSA 3ZWSA 4QG6A 2I5GA 3KUMA 3S2JA 1N8FA 2AMGA 5AVNA 3IGXA 3F4VA 2C1HA 4U5IA 1ZDLA 1KXVA 4FX6M 3WK1A 4AXKA 3GXFA 3EA1A 3VGFA 4MNJA 2PWVA 3L66A 3WJWA 1NIUA 3URAA 3RLUA 6PTDA 2GH5A 1U2YA 1Q6GA 4ACZB 1FWAC 1RCQA 2VI0A 4P8XA 1M7OA 4ZXOA 3MI6A 2PWUA 2X16A 3BAIA 2ZZCA 3ABQA 3LA4A 3JZUA 1AFSA 3GTFA 1DJWA 3VMOA 1IWPA 1OBAA 3IIOA 1TWZA 4AYGA 3RG6A 4ZFMA 1KR1A 5E93A 1EEPA 5ECVA 3R25A 5DRIA 2NVKX 4G7EB 2WPFA 4MMWA 4X60A 3B8VA 3WJZA 3H4GA 4ZMGA 4ZB2A 2GSJA 2OQHA 1Z8AA 5I23A 5KINA 1BEUA 4LAOA 1W3JA 4IIGA 3MUAA 1QNVA 1TYPA 3GQYA 3VNZA 3O6CA 5JU6A 3OGSA 3LXAA 3T42A 2ACUA 2V9DA 1QXLA 3GD4A 4JDRA 2DVTA 3FJ6A 3AXMA 1XG3A 5GPRA 3TN4A 4Y6GA 1F9CA 1Q8AA 1QJWA 1UMYA 6ALDA 3M0YA 1DORA 3DHPA 1UA7A 3MBFA 5G1MA 4LYKA 3OLDA 1RK5A 4TVYA 2HWGA 1OHLA 2WLZA 3R12A 3VOCA 1V3IA 3AMDA 1H7XA 4F8XA 3JS3A 4IJRA 2YZRA 2WOIA 4G56A 4Q4SA 3PBVA 1AZ1A 3UWQA 4DZ5A 4YVXA 6CGTA 3DBNA 3BSHA 1ODZA 1EWEA 3K1GA 3MUIA 4BKNA 1BFNA 2XGBA 1I8JA 3ONBA 4Z2JA 1YE6A 2AMXA 4XV0A 4W8LA 4DB7A 4FNQA 3VGBA 2A6NA 3VD4A 1CTNA 1W1TA 4HU4A 2QUTA 4Z1DA 3OHIA 1XBYA 4KS0A 1P7TA 1T0OA 3DBPA 3W74A 5LHFA 3WK2A 4DXXA 2F61A 4QIUA 1LG1A 4WDTA 4EMIA 1F3XA 3TYBA 3T78A 5MKGB 4DY1A 4DI9A 2VFHA 3L9CA 2P1FA 5FKYA 4GUFA 5A1AA 3ARUA 2PWHA 2QJIA 2E5AA 3UZJA 1DIDA 2ZZ6A 4GK8A 2OSWA 2YPIA 4Q8WA 5ENLA 1ZMDA 1XICA 1BSLA 3AS1A 1OFOA 3BVJA 4GBDA 4KRZA 3IVTA 3JW7A 1BSIA 3O0KA 4H9VA 2XZ7A 4C5ZA 3W01A 4IFKB 3CUZA 2VCCA 3H21A 3NYZA 4PMNA 1BWKA 2QZRA 5XINA 5IXEA 3LCHA 1J0IA 1CENA 2A3BA 1RY0A 4W8AA 3S83A 2BVWA 1TJPA 2YL8A 1DQXA 4J28A 3P2VA 4R9XA 3GW0A 4WDUA 1MXGA 2CHOA 4TX8A 4L5ZA 2TMDA 5BZAA 4DM1A 1T40A 1VFOA 1BYDA 3R0DA 5M2FX 1H62A 4AEEA 4B16A 2D0FA 3CU2A 4ADWA 5U1OA 4CKQA 4Y9NA 3TR9A 2BGQA 1BYBA 4LCRA 3MMWA 2FZMA 3OA5A 3FGCB 3GC2A 3ZSTA 2Y4SA 3PULA 4QBXA 4LVBA 3LADA 3GRIA 3GO2A 4QLLA 5CPTA 2QYGA 3LNPA 2C3ZA 3GAYA 2BXYA 2W0UA 1JCYA 2PP1A 4FAMA 3CUGA 2WAGA 1EEXA 3PPFA 3VGEA 1WDSA 2QF8A 1U5JA 2VGIA 2ZZ2A 1ENUA 4MWAE 1R6WA 2GVEA 1EH9A 5LNWA 1XIHA 2YA1A 2G3FA 1F5ZA 5C9WA 3LERA 4W7WA 3NZPA 4R33A 3A7UA 3VE9A 3CTTA 2WMIB 2Y8KA 1DIKA 1OQFA 3EDKA 1J96A 5DXXA 5FL0A 3TV8A 1H7RA 3U4AA 1VPQA 2D1ZA 3MO7A 2EJ1A 1RY8A 1K7FA 3O6AA 2CU0A 4EP8C 4DJEA 4IZGA 4LS0A 3P80A 3W1UA 5FEZA 4RZ4A 4UBPC 3K4DA 3N3TA 2BGNE 2QR6A 5F2LA 3WNNA 2YXOA 3FJNA 4YXGA 5LXEA 1KM2A 4JDYA 3SY5A 2HPMA 5E0FA 3H24A 4E2VA 1QPKA 2PAJA 3TFCA 4IP4A 3M5YA 3LM3A 4K8EA 3B8SA 3P82A 3QW3A 2R9ZA 4UOJA 3VFLA 1OYBA 3LMZA 3B9EA 3AXKA 4K38A 1TIWA 1N8IA 2WCGA 4D6IA 4WY0B 4BEUA 3CMFA 3L5LA 3SECA 1I0BA 5EPDA 3PUDA 4R88A 1JQXA 3WYZA 4DO5A 5DMLA 4RV8A 5FL1A 2Q3RA 2CEQA 2VD9A 2CZFA 4GYFA 2NPXA 3MCNA 3FHAA 2FJUB 1WX0A 1V0MA 3PHAA 5FIPA 5GNZA 1OF6A 4HNVA 5K4XA 1M6JA 1ZAJA 2HCVA 2WZTA 2E4TA 2V67A 3EYPA 5A8MA 1FH9A 4NF7A 2D0HA 3V0UA 2A21A 5K9DA 2FGBA 5H6HA 5DO8A 1WB0A 3KL3A 3ARXA 2PD5A 3RO8A 1A5OC 4MB5A 4RE4A 2QCEA 2FHBA 4AEFA 4H19A 1BTMA 2Z1VA 2XH4A 3SI9A 3BLDA 3LOTA 1D7FA 1E9YB 1D3GA 1SGJA 3IAPA 3GTXA 4CNPA 3VM5A 3BJTA 3ES8A 4NJJA 1KN0A 4TR9A 4M29A 2D2OA 4GHRA 3TWAA 5KSWA 2ZUMA 3TYUA 2AAMA 1YYAA 3SGUA 2WO5A 4GCXA 1SYTA 3ABZA 4XQ6A 3N15A 3TW9A 1E6NA 3HFYA 5BRQA 4UTTC 1Q3NA 4B15A 2GOUA 2GWNA 1E4NA 1H61A 1GVEA 7A3HA 1V77A 3QY7A 5H91A 1Q7MA 3GG0A 1QTWA 3JR2A 4HPHA 3S9ZA 4MWAA 2PGEA 4AF0A 5EBAA 3EWZA 4PMRA 2NSOA 1NWRA 3WLHA 1S2AA 3IUHA 3G22A 2ACRA 1HJWA 3U2ZA 3VD3A 4PEKA 3OLIA 4X3ZA 3EX3A 4PL2A 1XYCA 4DJDA 1LZOA 1OC6A 1W3KA 4K7YA 3WN6A 3VMNA 2CPUA 5K3VA 1TJRA 3PVFA 1MRQA 1KM3A 2NQHA 2NQ9A 9RUBA 1XYLA 2KX9A 3BANA 4ERAA 4LEQA 1JZ3A 3NS1B 3E2RA 2DT1A 3E2VA 4OV4A 3P62A 4U4MA 2BODX 3A12A 2J6VA 4V28A 1UJQA 1WQ5A 2PFHA 4WJXA 4UQAA 3PJWA 3P8IA 5LIKX 3CGBA 4LB3A 4H6KA 1MI3A 4QRNA 4UQBA 3UG5A 4GQRA 3URHA 1LQ2A 5ABFA 1TVNA 1SU5A 4W87A 1N60C 5AYBA 4GE8A 1FP9A 5JCNA 3WFAA 3ATZA 2DT3A 1OC5A 1X7IA 5IRPA 2YB4A 2ALRA 1A5BA 1J18A 3L4UA 3FXGA 4JTGA 1UUMA 5CC6A 1XLAA 1J2WA 1QW7A 2XVPA 3F2DA 1TV8A 1WYGA 5JMUA 3IC9A 4JTRA 1E4LA 4KEUA 1UD6A 1JL8A 1K4HA 2FH6A 3S5SA 4GABA 1E72M 3UWWA 3AOFA 3L4YA 4FOJA 4C6LA 3QSTA 3G77A 1ISYA 3CHVA 1HKIA 5FF3A 1BXNA 2G5WA 1XRTA 4REQB 4YYFA 3EWUA 4C91A 3K2GA 3P0XA 5JCLA 1F3WA 1PCWA 2FZDA 4JTUA 2PP3A 4IP7A 2DIEA 1ZENA 4UCFA 1H51A 1JUBA 3L4VA 1V03A 1LT7A 1E70M 3K1DA 3MP4A 4XIMA 1QOPA 4O1AA 3GUGA 4PBGA 1TA3A 2RJHA 4TUFA 4O1FA 3W29A 3WLOA 3GNOA 5F2IA 4JHOA 3IUIA 3LRMA 3ZZ1A 3FS2A 3UP8A 3D3FA 2OQLA 3BW4A 1XRFA 1O12A 2W79A 4BEQA 5FF4A 3OZPA 4JS3A 2TPRA 3ES7A 4B4FA 3U6WA 2WMJA 3B0YA 3BCDA 1IT0A 3NXFA 5HXMA 1Z7AA 1I4NA 2VRJA 1ME8A 3WF1A 4XD6A 2G37A 1UP2A 3RPMA 4CQ9A 1RALA 4QFUA 2ZUVA 4Y9PA 1EB3A 4HMCA 3VGGA 4XD5A 3CZ8A 2GJPA 3OVRA 1GETA 3W88A 3B0VC 3GXNA 4LS1A 1QATA 3ARWA 2GGIA 2A3AA 3NIYA 3L12A 3ITOA 3SJNA 3SY1A 3QGAC 5A6TC 3WBAA 2H90A 3KRZA 5HDRA 1LJYA 3B3DA 5FCZA 1B4KA 3R43A 4IWWA 4K1WA 3WL0A 3KVLA 3CAVA 3GS6A 1RAKA 3PFRA 4ADTA 2J4GA 1P48A 4LBRA 4F2BA 1CB7B 2OOFA 3V0SA 2TRSA 3JRKA 3SUUA 1SPQA 1B31A 2GK1B 1CT5A 3KCLA 5D30A 2V5BA 1IEQA 3LS9A 5M17A 2P76A 2ZXAA 4BF5A 3TVAA 1TCDA 7PTDA 3QHMA 1GVIA 4CQBA 5FMHA 4A35A 3ERPA 3O6YX 2WHJA 3HO8A 4MAZA 3R6IA 4ZTXA 1T96A 3MY9A 1H1NA 3W7IA 1XGDA 1VH7A 2F84A 1PV8A 4C6DA 2RDUA 3ANYA 3AHZA 2GFTA 2UY2A 2V6AA 4EVZA 2XTKA 4UTWC 3SURA 1ISZA 4FLQA 4AD2A 4JIIX 3IACA 2NUWA 2ANUA 2WBGA 2UV8G 3VIOA 1AOGA 4HK5A 2EAWA 4EXBA 3WQOA 4R9OA 4N4PA 2DIJA 3BV7A 4NASA 1NQKA 3A9BA 3ZR5A 5BROA 2L5HA 2Y7EA 3HZ3A 3UESA 1SZNA 2PLCA 4PMOA 1U83A 4JTKA 2DZWA 5KEZA 4M5PA 2Z4GA 4EMJA 4QLJA 3A47A 3Q37A 3NO3A 2VWSA 3U5UA 3HGJA 1YXCA 1DXIA 4KIRA 5CSUA 1UIOA 3BCFA 2DVUA 1GV4A 1SO6A 1NEYA 2Z7KA 1UC5A 3BLLA 4A3QA 1ML1A 1YIXA 4ONVA 3GBEA 1WUFA 2WXDM 4RL3A 3ITYA 4NZ5A 4C6PA 4ACYA 1FP8A 3VFCA 3I3BA 5MHBA 1K9TA 3WNPA 1MNZA 3KDOA 3EDJA 1X2GA 1ZAIA 4I5UA 1TPVA 4B5TA 3IJ9A 4R34A 3WLKX 5I06A 2OVLA 4YCOA 1CXLA 3GFYA 5D2TA 3CNYA 5E09A 1XSJA 3FX4A 4CU7A 4GMEA 1LOLA 3VNKA 3UPMA 4MAVA 3BTNA 1VEPA 3SM0A 4MGGA 1J10A 4XKMA 3ORWA 1YBQB 4EX4A 4EQSA 2ZQ0A 1CYGA 3QGVA 5A6SA 1GVSA 4RDVA 5CH9A 4JX4A 1NWUA 1XUUA 2OYMA 3EWXA 1GEQA 1ADDA 4GINA 2FVLA 3BXWA 2NLYA 3FCPA 2Z6JA 4NAFB 3Q58A 1CGVA 1K8XA 4FNRA 1H2IA 4AU0A 2VNCA 4DPPA 3SADA 3GK0A 4XZWA 5KMYA 4DUVA 1G1YA 3B40A 3WNLA 3G8EA 1GXFA 2IXUA 4JYFA 3UCDA 1G67A 1W5PA 1KFJA 1K03A 2WCSA 5HNTA 4Q8VA 3FEMA 3IIPA 3B4YA 1MQRA 3RCNA 1JYWA 4IXHA 3AIEA 2YDSA 1FHLA 5FA5A 1K3UA 2BXVA 3O15A 2Y5EA 3PK7A 3HQNA 3SIMA 2VHLA 1DXFA 1TQJA 4I6KA 3E0LA 3HPAA 4GUIA 4DO4A 4YVVA 1K77A 2GQWA 1B4EA 1UR2A 3IVUA 1A80A 1EUNA 1VPXA 4JIPA 3VU2A 2Y85A 2POZA 1IZCA 4Z08A 4JFSA 3LG3A 2PDBA 3IJLA 1GVOA 1L6WA 4N7QA 4GQBA 4FIRA 2XFRA 2JF7A 4DXVA 1KCKA 2UY3A 3SCPA 4CNTA 3AWNA 1CDGA 1GKQA 3GXIA 1H3GA 1EL3A 3M0HA 5HWJA 4UQEA 3G5EA 5FF7A 3PNUA 3UWYA 1XSIA 3UZZA 1U5HA 2DZTA 2FFIA 1UD8A 3LQGA 5C8BB 4M52A 1NY1A 1B54A 3UR2A 3FYOA 4UMAA 3K5XA 2ZRUA 5TQLA 1JDEA 1BGGA 3AM9A 1HKKA 1E0UA 1ONRA 5KTLA 1K1DA 4QXIA 1BRLB 2Y0FA 4O0ZA 3MCOA 4BQ2A 4J7RA 1RUSA 5DMYA 3THUA 4FF5A 1QWKA 4BWLC 4HQVA 1DWAM 3NO1A 1ONWA 4QE5A 1ZZMA 5AYXA 3ITVA 3USBA 1E5NA 4OE7A 5HQMA 2DH2A 3KOYA 3PAJA 4PN2A 3LXBA 3MHUA 4S2BA 2C91A 4D6DA 3KBWA 1A3HA 2ZADA 3DN5A 3RNMA 4YVPA 1A3WA 1IR2A 4KESA 2CITA 3PAOA 4C1LA 1AA1B 5EB8A 1AZ2A 2LLEA 4RZ5A 1VS1A 2J8GA 1JPDX 4WGHA 3M1ZA 1CGYA 2ADAA 1PKNA 4DWDA 4F9JA 4HN4A 1SFTA 1Q6OA 2DY3A 4R7JA 3DYMA 2NVDA 4QEHA 1SW0A 1WDQA 1LLZA 3A22A 1EOMA 4A8IA 3LRKA 2J9ZA 2V81A 2HVNA 2VFFA 3OVQA 2YW4A 3AYRA 3CTLA 4O0KA 5I6SA 3R7MA 3QVQA 4JTFA 1FEAA 2DQXA 4GNVA 1KWKA 3OZYA 4Y96A 4E3TA 4Q8UA 3RLHA 3PB0A 3VOJA 3AIUA 5JVLA 1RD6A 4JCMA 3B8UA 4K68A 4L6OA 5KVHA 1JYNA 4LUYA 5G4EA 3W9ZA 1GTEA 3EB3A 2D3LA 3LHTA 1GJWA 1YE4A 4PH6A 1AQMA 1GYMA 4JHZA 4QJ5B 3W75A 3RM4A 1XC6A 1TWIA 4E6MA 3H6OA 2XIOA 1FCBA 1DWGM 4Q4KA 1BXCA 1S39A 3BQ6A 1SB3B 3VDAA 3ARYA 3H7VA 2F5ZA 3TWBA 1PHWA 2WB5A 4QSFA 2X2GA 3C8NA 3ARPA 2QT3A 1PTGA 3T7VA 5M5DA 3M0IA 1N5XA 1MOKA 5HR7A 3FDKA 4WF7A 1LF1A 2F2KA 4GH3A 1EJVC 1JYXA 2V38A 2NX1A 3PZNA 1T3QC 2WM0A 3CEPA 4H6RA 4LC6A 4HOZA 2PODA 5LNUA 4OGZA 3LHZA 1CXFA 3SAZA 4LF1A 1DTUA 4YWOA 3VD7A 2DP3A 1XD1A 3URQA 3UJSA 3CHCA 3WLPA 1OCQA 3R79A 1U33A 3UG8A 2BVTA 4LUSA 3SUTA 2G95A 5K9CA 4XKYB 3QF0A 2YCJA 5DT7A 1KFWA 2J9XA 1R3SA 1HIZA 2F8QA 3G1AA 1CX9A 4C6IA 1ZBWA 2ZC8A 5BNKA 1P0NA 1DJNA 4RPQA 1V3KA 2J6XA 2W92A 1MSSA 3UXIA 3TJLA 1FDYA 2VXNA 2WW5A 1V3JA 2WK2A 1L0PA 2GGGA 4H9XA 1H7OA 1SFSA 1ZKQA 2WKJA 4ZO6A 4JIHA 1GEUA 1EC8A 1V6VA 3STPA 5BRPA 3FKRA 3ZM8A 3DFSA 1OG0A 4BHYA 2GJRA 3FLUA 1WPCA 4BURA 4LCSA 3QJAA 4GVHA 1UWIA 1FFQA 5L6UA 5XIMA 3UXKA 4U3CA 2A79A 2QUMA 2QCCA 3PC0A 1GPFA 1E5JA 2R94A 3N25A 4J27A 1ZFJA 2YLAA 4TXEA 1L6GA 3SRKA 4AZBA 1PPIA 3NM3A 2ZCGA 4DO6A 4DXKA 1GREA 3PB2A 4GYPC 4AY1A 2G0WA 2ZX7A 3OA3A 4IICA 1GGOA 4P7QA 4B5NA 3ABXA 2PDYA 1W54A 2E3ZA 1GESA 2W3SA 4XZ9A 1W3TA 3HPXA 3W3OA 2W6RA 3VCRA 4FLSA 4IMAA 1UZDA 4AX6A 1CXIA 3AHYA 2PDXA 3CGTA 3E2SA 1BKHA 1FEBA 4HBKA 4QCEA 3NL3A 2OWXA 2XN1A 4XZLX 4V33A 1ZGDA 3H54A 4GFSA 2OFJA 5D05A 4MM1A 4V2XA 3KDNA 3UWZA 3N2BA 3BC9A 1I45A 3MP3A 4QJ3B 3JVAA 2VEKA 3R8HA 1KA9F 2W9MA 3B0XA 2FJKA 1XPGA 4FNPA 2ZXQA 1Q6EA 3W85A 2XINA 2WV8A 3VIIA 3C0QA 4O13A 4F9DA 1V0NA 1CW2A 3DHDA 1GUVA 2CLEA 1ZQ5A 3V35A 4NEWA 5EMUA 3OLGA 3VKDA 2R1NA 4IQEA 4XG1A 1UBSA 2CBJA 4LXFA 4PRTA 1H09A 3B8TA 3T4WA 1AK5A 2V3EA 2VWTA 1HJXA 3AXHA 2NVAA 4LRSA 4NX5A 2FZ8A 5AY7A 3QN3A 4IG2B 1IZJA 3KW3A 4HGXA 3CZKA 3TJ4A 2Y2WA 1H1YA 5GJMA 3SDOA 1JZ7A 2QCDA 4ERIA 1QI2A 2DW6A 3MWAA 3TE9A 4ROQA 4DRSA 2PU1A 3GNPA 1BHGA 2JK6A 3NQ7A 3IUDA 5IBXC 3APGA 3CASA 4B2DD 1W9PA 2BWGA 1U1HA 1XKYA 3F1QA 4IIDA 1XI3A 1VBHA 1K8ZA 3EDFA 1C3FA 3S6TA 3A13A 1VCVA 3SN0A 4GACA 1QI3A 2PDCA 3WUGA 1FWBC 1US2A 2INZA 1VC4A 4LH8A 4IIHA 4KCWA 4HHPA 3MW7A 5AVHA 4AC7C 3MMTA 1GERA 4PBEA 2VRKA 8CGTA 1UH2A 1OFRA 4BY3A 3VCNA 1EPXA 3UVAA 4Z2KA 4UTWA 1EBGA 1MEIA 5CGMA 2Y5JA 3T2QA 3NRZB 4WKHA 3HW2A 4RNFA 3NQEA 3SCOA 5CZ0A 1LWIA 1JCXA 4E8CA 3EPOA 1B3OA 2VMFA 3PTQA 3CAKA 3A24A 4ACZA 1HKVA 1NH6A 1JZ8A 1CLXA 4AD0A 1AD4A 4GO8A 2FKPA 3KS5A 3PPHA 4JPGA 4J3ZA 1WZLA 4GNKB 2XVGA 2D2GA 1A5CA 2WC7A 4XVDA 4ZOBA 4BCEA 3DGBA 4UTKA 2BHZA 1AH0A 2PDFA 2V3BA 3AUOA 2NQLA 4H6QA 1RPXA 1TVLA 4G7EA 3R1ZA 3WJYA 5A5WA 3V0TA 1PEZA 1RBAA 5D04C 1RQEA 4CQDA 2WSPA 3CT7A 3T0AA 5C0QA 3N2TA 4MB1A 1LP6A 2GUUA 3GNXA 4HA1A 3RAOA 2WOVA 3QR3A 3BMXA 4HYVA 3N9RA 3ZIZA 2YDAA 3C0LA 3VPLA 2ZWZA 4NZFA 3CHFA 2DFAA 1Y7VA 5A95A 4GUGA 2EG6A 4AMAA 2HVMA 2J7CA 3TTEA 3E0FA 2BY1A 2DZBA 1WP6A 2CCRA 2A4AA 4Q6XA 1U5VA 4GJ1A 1Z6KA 3H2FA 4L7ZA 4JL2A 3W7NA 3U0HA 4FPSA 3W7HA 3VOGA 2O56A 3PP7A 3P6LA 3K4WA 2F6UA 1IR1A 3APTA 1B1YA 1GW9A 2RUSA 1NP0A 3ZOAA 2CFFA 1W3NA 3QM3A 4S3KA 3S2CA 5ER0A 2ABAA 2DUAA 3UWVA 1UB3A 3M47A 3W00A 4XZIA 5DT5A 2PGWA 3WLSA 2QS8A 3PUEA 5CPNA 3TDFA 3QYSA 2QV4A 2E5CA 5F2GA 1C7TA 2EGZA 4MKVA 2A0NA 4XAFA 3HQPA 1L6YA 4A05A 3VMPA 1RJQA 1TCMA 2V5CA 5M1TA 1X2HA 3UXLA 4ASTA 3KTSA 3WD4A 2O9RA 3USZA 3IIVA 1VFMA 2GUBA 1AW5A 2JALA 2OZ0A 1ICSA 1WBJA 2A3HA 1Q63A 1EJSC 3FV9A 4U10A 5BXRA 1EHNA 1X39A 1XRVA 1TB3A 1KO0A 1S5MA 3G8RA 2ZUWA 1OX4B 4DYJA 4LY8A 4Q22A 5FESA 1R47A 5H8PA 4H9YA 4Y9AA 2P0OA 5HJYA 3DKJA 1XLBA 3GIPA 1WAUA 7CGTA 3FEQA 5I78A 1QK0A 3TMLA 4ATDA 1B9BA 2VQUA 5A8PA 1IWBA 3AROA 4F66A 1XG4A 1L6SA 1YADA 4MDOA 3T55A 4NJIA 1JCTA 3EOEA 4MZ8A 4H4XA 1V97A 5AC7A 5C54A 4DUOA 3IV8A 4JAWA 1JNDA 3F4WA 4GVGA 1OJTA 3EKZA 1E0XA 4LAUA 2NW0A 1C9WA 1CGUA 2E77A 1ZHAA 4EWND 1Q6LA 3DU0A 3FGCA 4UQCA 5EL1A 4CNNA 2R1LA 1W6TA 4KMQA 2DZVA 2O4MA 2D20A 2GDVA 1RLCL 3E96A 2PZNA 1L8NA 5I3KA 2Z6IA 3O1NA 3EPMA 2ASHA 2PRHA 3FA4A 1EBHA 1V6XA 2ZKMX 1Z44A 5BW6A 3OBEA 3UYCA 3W6MA 4BWLA 1YKWA 3W7PA 1XIGA 3R2GA 4E2OA 3PZOA 2OEMA 3CL7A 2HZGA 5D9NA 4M80A 4GZIA 4HJWA 4NEVA 1S1RA 3NEHA 4A2RA 3UQNA 4HMDA 3QW4B 5HK4A 5HR6A 4EF9A 2WQPA 4DAIA 1FXPA 4GFIA 1E6QM 1KRCC 3A4JA 3RNDA 4FSAA 3QTGA 1XLIA 1JRCA 1TV7A 2J7GA 1UKQA 1UOKA 1VYPX 4PMQA 4Z1BA 5ABHA 1C8XA 2JE8A 3MQTA 3LB8A 4YHEA 4NG3A 3T9PA 1A47A 8XIAA 5E9AA 3OVPA 3LCXA 3GG8A 4EPKA 1US3A 2VEPA 2HQMA 1DIOA 3GVRA 3QR0A 4L65A 3POCA 3LBOA 2D0GA 2YA0A 4Y2WA 1QASA 4WY0A 2IPJA 4GJJA 4HPGA 2VC9A 4MYAA 5CPLA 1FBAA 4XAGA 1J5SA 3U2OA 3EEGA 2VX4A 3MO4A 3RM9A 3SCQA 2X50A 1E56A 5EMYA 5IDIA 1EP2A 1KXQA 2XVKA 3WH9A 3VKJA 2ZIDA 1JDFA 2BHUA 4PGLA 4L1WA 2D22A 3DG6A 2PDWA 2Q02A 1FWRA 2QDEA 3BE7A 4FDCB 3GFXA 1BWCA 4JFTA 3AZTA 1G01A 3SSJA 3LXCA 3SCNA 2FPYA 4PC8A 1FVPA 1X96A 1F73A 3BG9A 5AHIA 3UG3A 1M6IA 4FHAA 4M6UA 5E1QA 2VEMA 4NRSA 1MO9A 3KS6A 2QCMA 1WXZA 3TJIA 3CZJA 2X99A 1P0KA 3H26A 1CGXA 2YL5A 3EWCA 4HK6A 4IL0A 1IF2A 2GOKA 5TNVA 3BG5A 5I03A 5LXXA 4V1YA 2DU2A 4K6AA 1BYCA 3NPUA 4XUGA 4IJBA 3LV5A 3W1XA 4S3CA 1ITCA 3PS7A 3VDGA 5REQA 3GU9A 3N2CA 1FQ0A 2NXHA 1LRNA 3NQDA 3O8AA 1XCFA 4IIEA 2X8RA 1QHPA 4Z1CA 3QZAA 4FR6A 3NPVA 1OB0A 5GJPA 3B4UA 2DW7A 2OODA 1EYEA 1EJ7L 3JZEA 1YDYA 3ZT6A 3DK8A 4GY0A 1DV7A 2AL2B 5AYIA 5C2GA 1LVLA 1Q7QA 2ZDRA 2SFPA 1JZ6A 2I9UA 4GVFA 4EQWA 2JEPA 1E3XA 1X38A 5D8WA 2VDGA 5HANA 4YTRA 4RZBA 2GR3A 2XIJA 2NUXA 4HB7A 3HPSA 3LHWA 1OVDA 5D2XA 2G3IA 3H2MA 1V02E 3AMKA 3MDUA 1D2KA 1XPYA 4H8HA 4EANA 1BTCA 2ZZ0A 4PZVA 1O6IA 3BO9A 4JCLA 1FCQA 2RDTA 3UJ2A 5E6ZA 5EU9A 2V68A 4P7NA 1TSIA 3T4CA 3W84A 1OF8A 2WZEA 4JQ3A 4QG9A 2XFYA 2VVNA 4J9JA 4UMBA 2ZZ4A 2QMKA 2WPBA 1GNXA 2ESCA 2IKIA 2V2CA 4AZIA 2GVYA 3A3WA 4U31A 5FAJA 1JFHA 2FMOA 3FK4A 4X2RA 1E1FA 4IPJA 5TAOA 3PTMA 4XSLA 4HNCA 2EQ6A 1W3HA 1DVJA 3LCLA 4M8UA 5M03A 3N73A 3QV6A 2CLMA 2YQUA 1KTCA 1W56A 3UF9A 1EO7A 3GTNA 1VBUA 3U9IA 4N9EA 1EQCA 4N6EA 2Z1BA 1GHSA 4Z2GA 1FWNA 1M53A 3CPUA 1P43A 5C55A 3AMZA 3THDA 4CCEA 4EOUA 2X2YA 2I5IA 4XZHA 2JKEA 3VZXA 3WQWA 2FIQA 3UA3A 3PBGA 3ZJ8A 1OYCA 3T0BA 3TUUA 3VD9A 2P10A 5HQEA 3F4NA 1J9YA 2C15A 1PIGA 1VFSA 3BLIA 3PJTA 4IUOA 3T40A 4M81A 5DF0A 1BVZA 1PE1A 1R2SA 1XLHA 4W86A 4TX6A 1OADA 2G50A 2ZX6A 1FIQB 2DZXA 4ILSA 1LUCB 2NT0A 1H49A 4DNMA 1UR4A 2J8TA 5DLCA 1A3XA 2EPMX 4XX6A 4LAZA 1TZ7A 1ITXA 3UWUA 4UTUA 1UR3M 5C7HA 2Z27A 5SWUA 1HZYA 3GXMA 3DFYA 4GRSA 5D9PA 1V6TA 4QLKA 3M6DA 4H4TA 1IXOA 5IBXA 3TNBA 3NQ2A 3KTCA 5BU9A 2OQYA 5C70A 1GYLA 4Z17A 3C2EA 3D3AA 2V69A 4UB9A 1XBZA 1TPEA 2WP6A 3INPA 3CYVA 4H4PA 5HWMA 2VR2A 2VGFA 2GR1A 2CESA 4RNHA 1BG4A 2WSRA 4IPNB 2PI6A 4XZNX 4PBFA 4KFOA 4K7ZA 1NFGA 3BUVA 4E4PA 1SM9A 3TU9A 3VNMA 2IW0A 4MPKA 3NVTA 4FF7A 3PJUA 3KZPA 3RX2A 4KFNA 2OLAA 1MW1A 1V02A 4US5D 4AW7A 5I79A 1FXQA 4HHHA 2OCZA 3C3UA 1IT8A 4GXPA 3WQ4A 1J93A 2A85A 3AWOA 3DYPA 3CB3A 2V2HA 1S2UA 5KZMA 5KZDA 1WDPA 4NI3A 5GQBA 3UJRA 1DJHA 4PTWA 1NELA 2QDDA 1C7SA 4WEVX 1WKEA 1GONA 1JD7A 4MOZA 4FXSA 3UGVA 4PSPA 4AZ5A 1AODA 1T6MA 1YQ2A 1M1BA 4JN7A 1KBIA 4IGSA 4QQUA 4O54A 4DBEA 2JFEX 4AZ6A 2QV5A 1JI1A 2WVTA 4X61A 1S5VA 4GH1A 3EF6A 3L4XA 3PBMA 3EGJA 1UWQA 2OZ3A 1G9HA 3LDVA 4JKMA 4L56A 3V16A 3FIGA 1FOBA 3WG6A 2TAAA 4PUEA 5BMXA 4HSOA 4I9AA 3VKCA 3AZSA 3WJXA 2ZYFA 3HG3A 3IRSA 2WOWA 1A4MA 4JNZA 4QX4A 2B7OA 3W7GA 3TSDA 1FFUC 1XLMA 4GVIA 2Z1SA 4ZFCA 3O9NA 3H2CA 3I3DA 2VL4A 1HJQA 3RF9A 3STEA 3VXGA 3O6DA 4S3JA 8TIMA 1GHRA 3U7VA 1O5KA 4AVFA 4B2DA 4XO7A 3TROA 4W8BA 1UG6A 4AIBA 4GOAA 4LBUA 3OIXA 2PWEA 1MDLA 3C2FA 2HXUA 1V6WA 3W22A 4B5WA 3Q2DA 4DJED 1G94A 2WNWA 2PPGA 4TTGA 3DG7A 4O19A 2PDLA 3RM8A 3OJGA 6XIMA 3TYDA 2Y7FA 2VEFA 1GZJA 1XDJA 2FHFA 5A6AA 1EDQA 1LTDA 4ZQPA 3QQ1A 4HCLA 2FHCA 1FWHC 2UY4A 4ZOAA 4AG0A 5I0DA 4O14A 3W72A 1KD0A 1EJUC 4ZENA 4UUIA 3XINA 1QDSA 3QFAA 1B5TA 1NFBA 2ZUTA 1ZU8A 3WLMA 4UNKA 3E12A 1XYFA 4IQLA 1S3TC 3EDEA 1JF5A 2HROA 3B0PA 3PG6A 2ZOXA 4O4VA 1PYMA 2NV2A 1F07A 1HNYA 3I6TA 4QNEA 3KEHA 1W1ZA 3CJPA 3E2QA 3DENA 4H01A 2G97A 3U8GA 4P61A 1Q13A 2E0PA 2XPKA 1LBMA 2Q8ZA 1PAMA 3GYCA 3C8FA 2ZRVA 3KRUA 1YNQA 4AIEA 4G5DA 2CHRA 4O1DA 3UR7A 1XDLA 1W8GA 3AYTA 1M68A 4DX3A 4H4ZA 1Y5XA 2CXEA 3NQMA 4L1GA 4QS6A 1JDDA 4A8LA 1O4UA 4KW2A 3QPZA 5E70A 4Q4PA 4UTFA 2HMCA 2AOSA 1OT1A 1KFKA 4ZTYA 2GQ8A 1HKMA 4BJHA 1DHPA 1VDVA 1LL4A 3VABA 2VFEA 2NVCA 2NX3A 2V3DA 3T08A 2J9YA 3A3HA 1LBLA 2GR0A 4LWWA 2Y1HA 1WDDA 1O95A 1Q6CA 1QAPA 2PDPA 1OYAA 4DJEC 1CPUA 3KP1A 1GOXA 1E6SM 2FZBA 1TPH1 2AL1A 1VFUA 5D2YA 4NAEA 1NVMA 3V4BA 2EKGA 1R30A 3KAOA 3V1PA 3W2KA 4I9TA 2Y6ZA 3F2BA 3VIMA 4Z0JA 3TKFA 1RJPA 1E0WA 4NNAA 3VIHA 1YTEA 3KTXA 2GL5A 1R3VA 3P84A 1J6OA 3VOIA 2NQJA 3E9AA 4WKFA 1QNRA 5LKYA 4ZQOA 1ZRQA 4M1RA 3W2JA 3VTRA 4U2ZA 3QMTA 5CXPA 4H8UA 4O12A 3B9DA 4XTDA 2GVLA 4AZ7A 3WEZA 2DJXA 2E67A 2GZXA 3QQWA 4DM2A 3GR7A 3EB2A 1V7YA 2GPTA 1AW2A 5AFDA 4L4LA 2XN0A 4ZO8A 1BF2A 4DBUA 3M0MA 1TMHA 1KQYA 3ARSA 3QR1A 4WUIA 1HJUA 1THFD 3GH7A 5C2XA 1A53A 1AMKA 1C9DA 4UR7A 3NVYB 5BYWA 4DF2A 4ZCWA 3L4ZA 4CN6A 4UR8A 3FAWA 2QUVA 1HFBA 2QPSA 3EXRA 3CV1A 2C16A 4FX8A 1G7VA 1JOAA 4OHQA 1HW6A 3GHRA 4CUCA 1CLKA 4IJCA 5C71A 3VIPA 5J5RA 1FTXA 4GR1A 1GRBA 4C6EA 3DXIA 3IS4A 4L1XA 3LGGA 1V93A 1ME9A 3TYCA 1TWDA 2FZ9A 4LTSA 3M0JA 1UZ1A 1XX1A 3MJYA 2DQWA 5KITA 1YDOA 4W5ZA 5JRBA 5KZ6A 2JGYA 2V8ZA 2QNEA 4HNOA 4LRTA 4IMGA 2BP1A 1PIIA 3AS2A 4X22A 3WH8A 2ZRYA 1H1ZA 1IE7C 2E1DA 3K46A 4I8YA 5HMDA 3A5FA 3WKZA 3S5NA 2WHLA 4CEXC 6A3HA 1CBGA 3SBFA 1JGIA 3PNZA 1UWRA 4J4KA 3WH5A 1W8SA 3NDYA 5CZKA 3LXDA 2GGHA 5FEPA 4Y9OA 4FX7A 4Z2LA 3RDKA 3WFLA 4MYXA 3RCMA 2Z2UA 1ZJIA 1EP1A 4V27A 2C3CA 4MB4A 1JPHA 4C6KA 1W31A 3WDIA 4PYSA 4WJ8A 3II1A 3E0VA 3NPXA 2OZ8A 4NI8A 4LALA 1T99A 3CV2A 3MT1A 3FSUA 4I5RA 3RPTA 3LZ3A 1HKJA 2ZZBA 1E9ZB 5HJLA 4XVEA 4AEOA 1VYRA 1YTKA 1KBLA 1UPMB 1Q66A 3ZXWA 2AQWA 3G1XA 3SUVA 4O28A 4HSNA 1J0JA 4OBRA 4QDWA 5H8UA 1EDGA 4KH2A 1JFXA 3S6OA 1JVNA 2FB2A 1S1PA 3J7HA 1SZEA 2QDHA 4OOZA 3QYQA 1NDWA 3ZLGA 1I0DA 4LJ3A 1GVYA 4JR5A 4N2YA 3FN9A 1D7KA 1HVXA 3GXDA 3G6MA 4GIRA 5CBIA 3BW3A 1F2JA 2QKFA 4QG8A 2X0HA 1OX6A 1R3QA 4PMVA 3KBNA 2PP0A 2YDRA 6REQB 3PTKA 4PTNA 3SGGA 1VJZA 4PCTA 4ZA0A 2OKOA 4C6BA 1GRGA 3WEMA 5J04A 2E8YA 4CN1A 2E6DA 3W23A 4RW5A 1XLEA 1GOOA 1PIFA 3NQVA 4I3GA 4R27A 3PSWA 2XGZA 2QJHA 1K4GA 1M7JA 1E0TA 3LTPA 4K37A 4NJKA 1HL8A 4NVTA 1LOQA 2XZ9A 4O1BA 1WYIA 2E9MA 1A0CA 4GZ7A 3QOKA 4XKYA 1WKDA 3RX3A 3DFQA 4W4QA 3W70A 3M43A 1F4AA 2VGGA 4WD0A 2BY2A 1FDJA 2J7DA 5EFFA 3TCEA 3AQUA 4GGBA 3IJDA 2QUNA 2PCEA 2JKPA 4F0KA 3TOYA 1JROA 4H8VA 2HBXA 2BY0A 4AC1X 5CPMA 5DEZA 3WQDA 2V5LA 5C9UA 2XYLA 4YTQA 5DFAA 3VC5A 4QAWA 1QPRA 1HP4A 2WVSA 3SQSA 2WBKA 1ZJAA 4XIAA 1VQZA 2YXXA 1Z42A 1UD5A 1EF3A 2P8CA 3A23A 3NQCA 1WE5A 3AXXA 3BCJA 2D3NA 3GSMA 4JKLA 5D33A 1ISWA 3LUTA 3M44A 3W83A 3GG7A 3EMQA 1IV8A 5K9XA 1EGZA 1MZHA 1HJVA 1OFAA 3UXAA 3HN3A 1SZRA 2POTA 2W0HA 1B0IA 4AZGA 4XZBA 2ZBTA 2QJGA 1MNSA 5FAGA 1MYRA 3LLDA 5F4XA 4QROA 4FA3A 1NDAA 3BAKA 1FWIC 4YCPA 4J3UA 2BLEA 2CKRA 3WLRA 4NL1A 1IXPA 2XWEA 5CGQA 4IIFA 2RKXA 4PMYA 4S3BA 1Q2SA 3W1PA 4C60A 1XHCA 3DI0A 3A21A 1H4PA 5ABTA 3CAQA 1TUFA 1GOWA 3FOKA 1TMLA 5IM51 5T8GA 4BI6A 3SUWA 2OOGA 5I3DA 1RM6B 1DNCA 5LA2A 2C3DA 3MBDA 1WXYA 2XH0A 4PB3A 4LX4A 2Y5SA 4GCAA 4DNHA 5LNVA 1OCBA 2E7FA 4TV6A 4H1ZA 1XIBA 3M7SA 1LROA 1NM9A 2F2HA 4Q6JA 1UZ4A 4MJZA 3CB8A 1U1JA 1S38A 1EBDA 3WBEA 2DGAA 3KL5A 4D6GA 1QU4A 2IKGA 2QPXA 1UCWA 4ORIA 3EUB3 4GGHA 2BTMA 4DVOA 4NXKA 5FJJA 3GB6A 2VZOA 2Y7GA 2PA6A 4QGCA 2BC1A 1QR7A 3CH9A 4IG2A 5D03A 2ZX5A 4MWAB 4LYRA 2OGYA 4PRRA 7REQA 3WENA 1TJ2A 2EG7A 4XBKA 1CECA 1B3YA 3JUGA 1GG1A 4RX0A 1V0LA 2FB3A 3NDZA 1ZSXA 4ZQNA 5JBEA 1Y8BA 5IFTA 4NILA 6ENLA 2VM8A 2ATSA 4GISA 7TIMA 1TV4A 4MY9A 3WDQA 3VD5A 2OEKA 3SY8A 3F5LA 5EMMA 2WJZA 2HDJA 4LSBA 2FDSA 3I7SA 4OBSA 1PSCA 2E5BA 2OWCA 2EF9A 1E4IA 4BQ5A 4CQCA 4FIQA 4YJ5A 3CIWA 1NFPA 3L5MA 2FLIA 1ZBVA 2OYKA 4KFPA 1KXTA 1OX5A 3THQA 3RU6A 1WZMA 4XB3A 1G69A 1QI4A 1MVYA 3ONCA 1AJZA 2VZUA 5FJOA 3BMWA 1PZ3A 3A9IA 1J0ZA 4HMNA 1GQLA 3VGHA 5A6BD 3OG3A 4ZO7A 2IPWA 3GWQA 3ZO9A 4INFA 4HA4A 1TPUA 2TPSA 4R3UA 5DANA 2CLPA 2EEXA 4PUWA 1TPDA 2B0MA 3CEUA 1Q4NX 3BLEA 1QNOA 4FOUA 4GY1A 2E6FA 1DWJM 4MVAA 1ADSA 3UA4A 4H04A 2ZTJA 3GXTA 5EMKA 2QF7A 3E5BA 4RE2A 2ABBA 1IWAA 1VEMA 1E6RA 4US5A 2VR4A 4YMZA 4Q4OA 3UY7A 5M3WA 1D3CA 1PZ2A 3EEZA 4D71A 1QCWA 1YPXA 2FMNA 5AHMA 2PUZA 3W7CA 3WQCA 1QBBA 4S3GA 4QDMA 2W3RA 5F2MA 2EPLX 2HRWA 1VB9A 3NQBA 2XFFA 4RUBA 3AISA 3GKAA 2OYLA 1C29A 1W0MA 4Z42C 4G7FA 4A3RA 3C0JA 3TXVA 3B05A 3WBXA 4WSJA 3OW1A 5KZEA 4GI4A 4L6HA 2E1WA 3KHJA 3D5HA 4CNSA 2X1RA 1UQYA 4A22A 2VDIA 4XD4A 1TA3B 2IQTA 3FSTA 2P50A 4GJIA 1VF8A 3CXOA 4QE1A 4MFEA 2RAGA 2KAUC 3F03K 2E9LA 4OIFA 3IJ6A 3HFTA 1U1UA 3PZMA 3QQ0A 5A8NA 3BARA 3DIPA 4IQDA 1EZ2A 1Q65A 1ZCOA 1P1XA 3WX7A 4UTHA 3AIWA 3WF2A 2ZDSA 2YYTA 5BCAA 3WK3A 1R0MA 4C6OA 1HO4A 1IGSA 2OLHA 3KBSA 1KM1A 1A0DA 4J40A 1GRTA 4P8UA 2VFGA 2IKJA 1DXLA 4D6CA 3E0IA 4HZ8A 1H50A 3MWCA 4QCFA 4I9MA 1V5XA 1P6BA 4A29A 4J1OA 3VUPA 4DWSD 3ZLHA 3XISA 1JQVA 3SR6B 4JDBA 4LVAA 2QXWA 2ZUNA 3WLTA 1XC4A 3RFAA 2QCHA 4MNKA 2G4FA 2YX0A 1D8WA 3D0CA 4MG4A 3M7WA 4Y7EA 1GORA 3WQFA 3NQGA 3COTA 3ZLFA 4JICA 4L9ZA 5G5GB 1NQ6A 3P3BA 4P7LA 4UZUA 2JQXA 4AISA 1UP3A 4S3FA 2AAQA 1TE6A 1EGVA 5LA0A 4NXSA 3LB0A 3TEVA 1E1CA 2QGYA 3R8GA 3UFYA 1GKPA 3LPGA 3NL2A 4ENLA 1XISA 3GDRA 4LYQA 2BMBA 2GJXB 4IFOA 3GRSA 1OX4A 2P0IA 1ISXA 2PLMA 3VGDA 1C90A 3RYSA 4LUIA 1TV3A 1R8LA 3UWEA 1AQHA 4LBSA 4YNGA 5D4YA 4CCDA 4F4RA 3TN3A 4AWEA 1PX3A 4ZB0A 2ZTKA 3MVIA 4W84A 3E5PA 3VKBA 3BLFA 3LTSA 1G6CA 2YCEA 1JEZA 3M5XA 2OXNA 3HGRA 3NZGA 3AIRA 1A5KC 1VRXA 1K8CA 1UW9A 3NUKA 1NHQA 4FMVA 1ZJBA 3W1TA 2HNHA 3EX4A 1KBBA 4NUWA 3KRSA 3OU8A 1QRQA 3PBUA 4Q33A 2A3EA 1QBAA 4Q7NA 2E6YA 1FWEC 3LI0A 4HMEA 4L64A 4J2MA 5A2AA 4S1FA 1FWCC 4WKAA 1GG0A 3F4DA 2OMAA 2P8BA 3IARA 3H55A 3CPGA 4GG9A 1AUSL 3CL8A 3BK0A 3W7JA 2I1OA 1V59A 1TRDA 3QKEA 1QI5A 3GM8A 2WJFA 2YL9A 1IZKA 2PDUA 3OPSA 1H0IA 3KX6A 1ADOA 4E4UA 5A2BA 4DWSC 1NSJA 1YW1A 3E49A 3UJEA 3S4TA 4AZCA 4WXZA 2H3BA 3KRBA 1PJ9A 1F05A 2WPCA 1XJBA 1VYSX 4K2SA 5A6MA 3WMLA 2DSVA 1CXHA 4BFAA 4EXQA 4JQ2A 5AC6A 3GRTA 3W26A 4LV4A 2AGTA 3SO7A 2UBPC 4PULA 3WQ8A 4NYYA 3S47A 1C93A 4G2DA 5IHRA 1OFBA 2WMGA 4EM3A 1NTHA 1W1PA 1DP0A 3UJFA 1ZMCA 2XSXA 1QWGA 3CGDA 5AECA 4KWUA 4CQ8A 1GOIA 1P4CA 4B92A 3RR1A 2VGBA 3W02A 3N19B 1K7XA 4P8VA 4NSBA 4JTIA 4PUMA 3S1VA 3K8MA 2QHAA 3RCYA 2VZTA 4NZJA 4YPJA 2FGLA 4GPNA 3B8DA 2Q6ZA 5D9OA 3QV8A 4DJFD 3G1YA 4XBJA 1WV2A 2YJQA 1V3HA 1TR1A 2YYUA 4NT0A 3PUGA 3TOPA 1AMYA 1I2PA 1RSCA 1AH4A 1B57A 3NQ8A 1OK6A 4XO6A 3Q6JA 3RLVA 3UR8A 4JTQA 1ODUA 3MC5A 3CUXA 2H9AA 1Z32X 1IT7A 1QPQA 1XGEA 1VENA 1HQTA 4ICMA 4DZIA 2R1PA 2YVJA 4LY4A 1NAL1 1OWQA 4YLWA 1F6YA 1JRPA 1V51A 4QNWA 2WOQA 2VVSA 1F4HA 3C4UA 4PMZA 4PTMA 2CWXA 4ORMA 2HQAA 2WNZA 2O7SA 4UTLA 1A50A 2B81A 3TQPA 3UU0A 4O0QA 1B9ZA 3A6OA 5JBDA 4HIBA 3WZ0E 3NEVA 4AHPA 4Q3MA 3CWNA 5C5YA 2Y8VA 2FH8A 5ABEA 4PMJA 2YCLA 2YKKA 3CWOX 3H4WA 3EMZA 1LG2A 1H63A 1AJ0A 4CNOA 3KLJA 5CPOA 4LT9A 1P1MA 1RJRA 2W91A 3WDHA 5FF0A 2CW6A 3UT0A 1FY6A 4Q4RA 4YS1A 4AUBA 1J0KA 3FJLA 2QQ6A 2PDNA 2EPKX 3TLQA 1BWVA 3TQKA 5BOOA 2A7NA 2O55A 2EPOA 2HTMA 3QZEA 2O4QA 4LAKA 3WLQA 1FO4A 2EPHA 5JCKA 3L65A 1KM6A 1Y5VA 2TODA 1UP0A 3I6RA 5TBOA 3N4AA 3ARVA 5HA7A 4F0LA 3P93A 1KFBA 2UWFA 3H7UA 4LW7A 1XYAA 3N6JA 4P5UA 1ZTVA 2AL2A 3SRDA 4DJFC 5H8MA 2FPVA 2WKLA 3O3RA 5G1YA 1KCLA 3EOUA 4LIIA 3MP5A 2BOGX 3DC0A 3PSVA 2CBIA 2RHGA 3WMCA 8RUCA 1VLWA 4ICCX 3CIVA 3RITA 1JPKA 1ITQA 2C79A 1LQ0A 2QUUA 5ABGA 3TQVA 2RGLA 4PCSA 1KR0A 2J13A 3GNDA 3LGDA 3OVGA 3TTYA 3LBCA 3HQOA 4ICNA 3NL6A 4GQGA 1WOAA 4TOQA 2GVGA 4OKDA 3AU2A 1ICPA 4DYEA 4TIMA 1WO2A 2J75A 3MJMA 1DPMA 1Q6DA 2Z25A 3OQEA 4B91A 1FECA 4XAYA 5U7SA 3QC3A 4J3SA 1MRAA 3PG8A 3GC4A 4BV6A 2ISFA 3I7QA 4QM1A 1GOMA 1UD3A 3GE7A 1KGUA 3DHFA 1DHKA 4PODA 5ECUA 3GHSA 2INFA 3G6LA 3T6CA 3P81A 1H11A 1NF7A 4UXDA 4PCNA 4RKAA 5GRTA 4Z2IA 3EX2A 2REQB 1XF0A 3I6EA 1K4QA 2OSYA 4EKJA 4IT1A 3LBMA 1V0KA 3DC8A 3UNTA 1TJ0A 2CWNA 1I60A 1L8PA 1SJCA 3DJJA 1Q1WA 5TF0A 1KWGA 4C1NB 2C0HA 4NRRA 3NJ3A 2WHKA 4H3DA 4YTSA 2QCLA 1BLIA 2WJEA 3L21A 5AKQA 4CU6A 1JYVA 3KVKA 3BJSA 3Q4DA 2BNJA 2P5NA 3SUSA 1QNSA 4TMCA 4NNBA 4Q8QA 4MUPA 4J57A 1QK2A 4J2PA 3EB4A 2J79A 3NXLA 3SCRA 4LF2A 4KCUA 1XHGA 3FVMA 1RPKA 3A4WA 3W86A 3AIVA 4C7GA 4AB4A 1LUCA 1SJAA 1ELSA 1XIDA 4FEZA 3IAQA 1XD0A 1EF2A 4WDXA 3BZGA 4GNJA 3KZSA 3W73A 4DBSA 3GDKA 1PB0A 2GRTA 1Q5MA 3ENLA 1IEWA 2MNRA 3CK5A 1Z48A 1XS2A 3GH5A 3GKFA 4X0VA 3R11A 3O63A 2WCAA 4UQDA 3DUGA 4UOZA 4WGXA 3AFBA 1VRDA 4ZQMA 2DVXA 3NVZB 3CQ0A 1UBPC 4DNAA 1B2YA 3AXIA 5CG7A 1DQWA 2X8GA 2DSUA 1JUKA 3OG2A 4F0HA 1YQZA 3P8JA 3M41A 2PB1A 5HMFA 1DJYA 2WLYA 5AHLA 5F1UA 2V82A 4Z2HA 2QVNA 3L0KA 3LEPA 5TD4A 4JN6A 3MS8A 2YXGA 3IRDA 1OGSA 1L9WA 2ZRWA 4L9YA 2EG8A 1YTDA 1GVQA 1BD0A 3IGUA 1CZ1A 3PBWA 4EPEC 4LVGA 1VBJA 1QOXA 2WVVA 3OGVA 5A8QA 1BZLA 3CL6A 3BOLA 3OYXA 3N2XA 3QH2A 2QCNA 1FX6A 5T9CE 1UH4A 1SQ7A 1OY0A 1S2TA 2GSHA 1NOUA 4N42A 4W93A 1ECEA 4MFDA 3WD0A 5F4SA 1PKYA 3I10A 2BB0A 4KERA 2VKZG 1O5QA 3O16A 3N1AA 4WZHA 3S46A 1H7NA 4JTAA 1X97A 1QPOA 1Y5WA 4R5EA 3FA5A 4C65A 5HULA 4DLFA 3D47A 1BWLA 2XIBA 2X7VA 5LIXX 1UMLA 3U57A 2FYMA 4LAMA 2UZ9A 3II4A 3ZJ7A 4K7VA 1W5QA 1GJUA 1PZ1A 1EIBA 2QLYA 3MI2A 3CYJA 5LIWX 1RP8A 3V1HA 4DAFA 4IM4A 1F8MA 1KGXA 5HUPA 3NQAA 2PTZA 4EMWA 4KRTA 1R7AA 1M41A 1HJSA 1LM1A 1A5SA 4FNSA 4W7VA 4BS0A 3TP4A 4S3DA 4GKTA 3T0DA 5E5CA 4JIQA 3R94A 3LPOA 4C7FA 3DGHA 4GIAA 5BOFA 2NV1A 4X9YA 4XK2A 2ZC1A 3UZXA 3OLEA 2IQDA 3RMEA 1J01A 2HISA 3PPCA 2R1MA 3ABOA 4Y8FA 2YFNA 3W7MA 1MUCA 1SZFA 2DSZA 4HHMA 3BLPX 4PTDA 5B7ZA 1I2OA 2E09A 2FTPA 2GJLA 1F61A 3AHTA 4BQ3A 1JJKA 3VC6A 1PO9A 5I00A 5JQ9A 4JQ9A 2QAEA 1VHCA 5HBFA 1TTIA 2JIWA 1O5XA 2B7QA 5F4WA 4U5KA 4ATLA 4I90A 1S46A 3GTIA 4JY8A 2H6RA 4IMFA 2XFWA 3LSBA 4BF9A 1TR9A 3DFTA 3WO8A 4OECA 1RD5A 4D8LA 1NHPA 1DJGA 1PS9A 2J78A 2X30A 2A5HA 4HA3A 3REQB 1ZAHA 1CCWB 3WNMA 4LUTA 1ECQA 2JBMA 1RHCA 4W88A 2EKCA 2QIIA 1NARA 2J27A 4HU8A 2QJNA 2BFGA 2W67A 5B7YA 5A6BA 4JZ5A 1T8QA 4OOUA 3NG3A 2OT0A 5I7GA 1I1XA 4IMDA 3HM7A 3GNNA 1GJPA 1W2PA 3AZRA 3GTHA 3NOEA 4H9TA 3QHOA 4C6NA 1VAHA 1QOQA 2J7HA 1W3LA 2CLIA 4O18A 4V15A 4NY2A 4DF0A 4H9UA 2J24A 5EY5A 4HVXA 4WOZA 1XIJA 5E6YA 1E55A 4A8NA 3AHVA 3MYPA 4JOMA 1E4MM 1UOZA 3MCMA 2WC3A 2PCQA 2AGKA 3H22A 4AVOA 3S2LA 4CN4A 4DZHA 3QBUA 2YCIX 4H9ZA 1M7PA 3RJXA 4RPPA 2EQDA 1JZ4A 1SO5A 3AS3A 4JEQA 1FUYA 3LYEA 3KE0A 1O60A 5IFPA 1E40A 1UWTA 1F7BA 1V3LA 2I5QA 3CQKA 1BF6A 3CZLA 4OU1A 1GYNA 1FH8A 1H41A 3ZYZA 1X1NA 2ZVIA 4W7UA 4ZE5A 3MHFA 4YL2A 2ZA1A 3AYSA 2EJAA 4CLMA 4J3XA 4H4UA 4MB3A 3TTSA 3TAOA 3FG2P 1SUXA 3VILA 2OELA 1OC7A 3M6YA 4DYKA 3DZ1A 2NLIA 5K7JA 3ARZA 5I3IA 1F8WA 1FKWA 1OCNA 4FO4A 1RCXB 4P2VA 3W7OA 3DDMA 3KBVA 2O92A 4MLJA 1MO0A 1TRIA 3PZVA 1W9BM 2R9RA 1N62C 4JYDA 3MB9A 1WXJA 3L0GA 1UKTA 3G0UA 2J7BA 1DJZA 4DWSA 4W5UA 2HE5A 4CCZA 3B9AA 5CC5A 3CGCA 2CC0A 2BOFX 3G1DA 5HNRA 2XSBA 2QCGA 2D2JA 4DQWA 1CI1A 5D02A 1PHQA 2J62A 2UY5A 5I77A 3VA8A 3W81A 3KL0A 3BGAA 3EAOA 1TYGA 4EE9A 3B8WA 4Z1AA 1XXXA 3HMJG 1HVQA 3NQFA 3GVVA 4X2PA 1TJ1A 3C56A 1LORA 1MFUA 3CO4A 4QHRA 1I9CB 2NWSA 3B9OA 3G2GA 3O05A 1FWJC 2DT2A 3RU8X 4OUIA 4U2YA 2WZHA 1DIEA 1PUDA 4UFKA 1G7UA 3G3DA 4F0RA 2EXOA 4RK8A 4GBUA 5BWAA 3C2OA 2P88A 4H83A 4QJ1A 1O94A 5FJTA 5CZTA 1XRSA 5A6JA 5U4NA 6XIAA 3LMYA 2OKTA 3HMCA 4NZCA 3SFWA 3N2OA 5HMEA 3D6NA 1FWDC 2BGSA 3PPGA 3W2NA 1R9YA 3UGRA 2PD9A 1ESWA 2Z29A 2Y63A 1XINA 4UTIA 4Q8OA 4ZBCA 3K4AA 3B06A 3HURA 1K9FA 4TV5A 1NPXA 1OD8A 3IEBA 4JIRA 2OSXA 2ZE3A 4PMUA 3NR0A 4Z1YA 3TZFA 4AQLA 5GVJA 3THAA 2CLOA 3RK8A 4G9PA 4EF8A 3QFEA 5JCIA 3MU7A 1GZGA 4ZOCA 4X9SA 3TXZA 1X98A 2CIPA 1S7MA 3CGEA 1Q6FA 1NDVA 4KGLA 2Y88A 4ZSTA 5I3JA 4P8WA 2H8XA 5G2WA 5D2WA 1V4YA 5JIWA 4RW3A 3MPGA 1AW1A 5CAHA 2DH3A 3WSUA 1L2QA 4O1CA 4HKPA 2JKAA 1EA0A 2PTYA 5TR3A 2PBGA 3IK2A 1NOWA 1JR1A 2PE4A 4KWWA 1G4PA 4WIWA 1TWWA 3B8IA 1W9XA 3ATYA 1VR6A 1MW2A 3ARQA 1UWSA 1ONFA 2IPFA 1Z69A 5DQPA 4J56A 1MEWA 1UD4A 1W32A 1JZ5A 1YEYA 3PWIA 1AL8A 1VP5A 4IP5A 3GUWA 1VFTA 1CIUA 1FFVC 4LA1A 4IGHA 5LSMA 2J7EA 4C1KA 2WVUA 4DUXA 3KFTA 1RBOB 1WUEA 3EX6A 1XQLA 3TLLA 1BKSA 5BOEA 2ZZ7A 4PTVA 2OO6A 8A3HA 1FCUA 3S42A 1FWFC 2R6OA 3W6YA 3DHUA 3ITGA 4CVUA 1Q6QA 1Q2RA 5C9ZA 5BMWA 4HOWA 1GWJA 2D2HA 5C2CA 2IPGA 3EZ4A 5CKSA 5D8ZA 3AMCA 4BF7A 2F38A 3ZVHB 3P0WA 3K13A 3BICA 1W1B1 2VR5A 1JPMA 4DJFA 3DK9A 2WSQA 4N9CA 2J66A 2OU4A 2VEIA 5H1WA 4HZ6A 3U7BA 4H4YA 3WLJA 3EWYA 3RILA 5A3HA 4TU1A 3G24A 1TIMA 4RV3A 4PRWA 2NV9A 3SB0A 1Z41A 3M0KA 2Y61A 1Q4WA 2PGRA 2EQ9A 1XUZA 4J3TA 1ALDA 4KPLA 6REQA 2VENA 1XLDA 5DMMA 1XIEA 4MKSA 4GC3A 3GC5A 3KCJA 1NWTA 4LU0A 4QE4A 1YDVA 1KM5A 1W9VA 3LK6A 4PR4A 2D24A 3QOMA 2V3GA 3R89A 1S5NA 1KFEA 2RJGA 4JNMA 3GZAA 2XUCA 4EACA 3TZNA 4YWSA 2JIEA 2B7PA 2V30A 1KM0A 4LV9A 4C6MA 1C92A 2X40A 4N0RA 3WLNA 3FNDA 5DMNA 4UWMA 3IGSA 4GA8A 2CLLA 3N6QA 3C52A 1TVPA 2HS6A 3WBWA 3HTWA 5G1TA 1RA0A 7XIMA 4WQ6A 1VJSA 1PL9A 1LL6A 4MY1A 4K8HA 2YVGA 1KGWA 5FEXA 3NGJA 3W28A 1N63C 3L2MA 4E8GA 3VDCA 5AHEA 2QVHA 3Q65A 1MWOA 3RGTA 4JD4A 2OG9A 4JN8A 4R7OA 2VFDA 3VK5A 2NX9A 1ZALA 2XVNA 4FR1A 1CNVA 4XUYA 4QEEA 1IIHA 4FK9A 4KBXA 3LU2A 1ICQA 2FVKA 5E0CA 1F74A 2BOEX 5AZ0A 5AC8A 3UY8A 3BWWA 3HG4A 2WZIA 3S5OA 4MZYA 4Q4QA 4EAYA 4LVFA 1VHNA 4I7VA 1BQCA 3I3EA 4XBSA 4R85A 1XFBA 4Y90A 4N9DA 3WMBA 7TAAA 1O1ZA 2V2DA 2P3EA 4E8DA 1KKOA 4C5YA 4FNUA 3CXBA 3WUFA 5A8OA 2QDGA 4ATWA 3QY8A 5C7VA 3N18A 3W0KA 1CGWA 4GUJA 2E5DA 3MSGA 2Q71A 1HTIA 3CV7A 3UBPC 3QKZA 2OWWA 3WQVA 1STZA 5G2HA 4QQ3A 5G4WA 3I68A 2HSAA 3GR8A 2D23A 1QT1A 1UZHA 2YBVA 4ZQRA 1GVRA 5FJRA 4HNTA 4TVWA 3JU2A 3VIJA 3URNA 1HGWA 2XU2A 1UASA 3U3HA 3AYVA 2ZUUA 3WL1A 4RXGA 2HVOA 2VZVA 4JYEA 4O52A 1X8CA 4N6FA 2CDUA 5FACA 4EPDC 2ZZ1A 3WDPP 4ECLA 2PDJA 4H4WA 3PM6A 4LVDA 1DOSA 4HP5A 1SFLA 4QR6A 4HU3A 1R3WA 5REQB 4CD8A 3NOYA 1GOKA 4IGMA 3SEPA 3FJ4A 2GYIA 4CQAA 1M3UA 1D3HA 2INEA 3VO0A 3NNTA 2ZZ5A 3G0SA 4TVDA 3P61A 2Z2BA 1AL7A 1PZ0A 4XAZA 1PTDA 2W27A 3BPWA 3BW2A 3WNKA 4RLIA 4F0MA 1XM3A 3R5EA 1PX8A 1WZKA 3KOZA 2AQVA 2VCAA 2F7FA 3ZWTA 5I3HA 1VLIA 1AG1O 4EQXA 3GYEA 3MKCA 2BX7A 4MADA 3VYLA 4PFHA 1H0GA 2CFYA 2X1TA 4F0SA 2E3TA 2D73A 1YXDA 1XBVA 1H7WA 2WZMA 3VNJA 4GI6A 3B9NA 3U2EA 1XH0A 4B5SA 1F3EA 3DERA 1M7XA 4JX5A 1XFCA 2C0AA 1J11A 4JTJA 1XLFA 1MZRA 3BG3A 1FHVA 3UW6A 3AHXA 4IL2A 2ISVA 4GD0A 3QHNA 4LGXA 2Q8LA 1VFFA 1QHZA 4JTSA 3NZRA 3WF4A 2W54A 2CETA 2WQDA 3AN1A 3W1NA 4AFYA 5MKGA 2GLKA 2BBFA 1XCWA 4U28A 4B5VA 2ALDA 1KRAC 3VZYA 3P5ZA 4H8NA 1VFLA 4LFYA 2VELA 3L68A 4MKNA 3VZZA 2FVMA 3ITLA 2W66A 4HU0A 4WDWA 2IMRA 1TV5A 3SQLA 1K8YA 4HTYA 3TQ0A 4UTMA 4HN8A 4L80A 4K36A 3C3NA 3L8KA 3UZ5A 3D46A 2DJLA 1A5LC 4B9YA 2ICSA 1K9DA 5FSDC 2R91A 3LLFA 4M0XA 1HN1A 1PWLA 3QZ6A 3T44A 4IFKA 2VD8A 4JX6A 4K8GA 3DG3A 5HQLA 1LL7A 3TN6A 3KHDA 1R2RA 3H8AA 3W27A 3QLLA 2YB1A 1R46A 1GQNA 1J79A 3B9JB 2OEJA 1EFZA 2Z26A 1LRTA 1YDNA 4GX9A 3O06A 1LLWA 4AD1A 3LNMA 7ODCA 1GVFA 2XIQA 5A2CA 4JTCA 2XH2A 4J3VA 2QGHA 4US6A 2EBNA 1JRBA 1Q1RA 1YX1A 3BZJA 1M03A 3LCWA 3STFA 5KETA 3BH4A 5HUOA 4ZR8A 5CJNA 4YIWA 4E2DA 3BMVA 5FS9A 4FB7A 4C90A 4H7ZA 4H7CA 3CWHA 5CC7A 3DJGX 4IPLA 4ZEPA 3W2LA 2XJ7A 1OGGA 3QPEA 1RR2A 1DYSA 5FOOA 3WK0A 3PG9A 4CU8A 1EWDA 2QEZA 4Q8NA 4NHVA 3KOFA 4G6CA 4WLCA 3UEQA 4NNCA 3M5ZA 3PF3A 2I16A 4S3EA 3WD3A 3M5VA 3T1GA 3PZ9A 3AALA 3W2MA 4ZL1A 3QSRA 1P5BA 4IIBA 4BK9A 4AHOA 2GQ9A 3AAMA 1XR2A 3NSNA 2NQZA 4AYSA 2GQAA 1TX0A 1GEHA 4BI5A 1G4TA 3NSMA 1YNYA 2FZNA 1EXBA 4HZMA 1SZGA 3MZ2A 4UZSA 2GGEA 3MUCA 2XGIA 1QI0A 5AN7A 4JKKA 5DBUA 1R87A 4PUUA 1JI2A 3T0CA 1V08A 4GYJA 5DY2A 3WDJA 1NHRA 3M64A 1X6NA 4C6QA 1T7LA 4K39A 4HPNA 2WYSA 3NYDA 1F8IA 1FWGC 2WMIA 4DPQA 4I5XA 3W71A 1D8CA 1RZMA 2FDMA 6TIMA 3PWGA 4DI8A 1Q45A 4HNLA 1REQB 1OD0A 2DEPA 4JNYA 1HGYA 1JEHA 1SSDA 1R3YA 2PC8A 1POJA 2J8FA 3N13A 3BAXA 2O7QA 2WJDA 4AXNA 5A6KA 3TW6A 1S5WA 1D9EA 2DV0A 3MZNA 1EA9C 4IISA 5CG0A 1LPFA 3M0ZA 2CERA 2VC6A 4YN5A 2WKGA 3WD2A 5D37A 3VIGA 4ADUA 1UROA 1PKLA 3T8LA 1EC9A 2RH9A 3ZMRA 5I09A 2VZSA 2GJXA 3CZGA 3CM4A 3OHMB 4C6CA 1DE6A 1JGMA 1TV2A 2EHHA 3L0NA 4GWEA 5FJUA 3NM1A 1L2UA 1QW9A 2BHYA 3IANA 3VM7A 3L4WA 1LT8A 2NXGA 1J0HA 4L4OA 4JFVA 4ZOHB 1OFQA 1R85A 2W5FA 3VI2A 3ITTA 3OO2A 3EDDA 3WD1A 4CEUC 3CIXA 4D8AA 3GD6A 4IFRA 5EBKA 1M9HA 4H2CA 3LRLA 4OV9A 2B31A 1RCOB 3NVVB 3QY6A 2W55A 2ODOA 4K8DA 2VUNA 1V79A 3AIQA 3SRFA 1XYZA 3H23A 3EBVA 1A5MC 2PDKA 3AMLA 3H12A 3RPDA 2EQ7A 4UFIA 1KCZA 3M0XA 1JIBA 2BY3A 2V5DA 4WHBA 3DI1A 3W76A 4HPJA 3VAVA 1A0EA 2X7WA 3LD5A 4BQ4A 2GVJA 1A4LA 2PDIA 4WSHA 3T2OA 1N55A 3W38A 4MUZA 1R2TA 1W5MA 3ANUA 3W1LA 4AY7A 2FTWA 4ZXLA 4GI9A 1LYXA 1H2JA 4PB5A 2FPTA 2ZA2A 1MXDA 2J74A 3E0WA 5G5HB 2WWDA 2V63A 2HJPA 3BAYA 3LCIA 3M46A 1V8EA 1P0DA 1EGMA 2P53A 3WLIA 2EQ8A 1UWAA 3GNRA 1UR9A 4UCGA 1UA3A 3TC3A 1JCLA 3MSYA 4HOXA 3GW3A 2WC4A 1FFRA 1QNPA 2PEVA 1TPWA 3W6LA 4RJEA 1JPIA 3SW6A 4GY7A 1CEOA 3UPWA 5A8GA 1BG9A 1KFLA 2QW5A 4M6PA 1EOKA 3C2RA 4E5TA 4F40A 5LHEA 1QW8A 1HL2A 3FYYA 1B90A 4FLOA 1VIZA 1E6PA 3MI3A 4GIEA 3MA8A 3E02A 4FX9A 3TW7A 1MQPA 2WWCA 4FI4A 3ITXA 3TA6A 1UIPA 2NXIA 1IEIA 1W5OA 4D6EA 1SJDA 1Z3NA 3CQJA 5I2UA 3LM7A 3QPYA 4OJYA 4Q8PA 3KLKA 2GWGA 2NWRA 4DLMA 4QJ4B 2HS8A 3ZFHA 3VOFA 5LIUX 1YRRA 3NL5A 1TPC1 1RVGA 4LS2A 5HPCA 4UQ9A 1GW1A 2G96A 1WBHA 2Y70A 5G4HC 1AJ2A 2WMFA 3EA2A 2AAAA 4NAEB 4MJ4A 5GNXA 1PXGA 5F7UA 2G41A 3K8KA 3ISIX 4BZYA 4U3AA 1YPFA 3W1RA 3VIFA 1XKJA 1VCGA 3VDBA 2PS2A 3M0LA 4DN1A 4HYRA 3S1UA 3EXTA 3M16A 1XYMA 3AJXA 2GUYA 1VBRA 3R8RA 3H53A 1G4EA 3WBYA 5JXQA 4L61A 4O53A 1EJRC 3DFHA 1DQUA 4I7UA 1XSKA 3TN5A 2PDGA 2HPIA 4RDWA 1JXKA 3RLGA 1GT8A 3VNDA 3NO5A 2XIMA 2CZDA 1UH3A 2W63A 2J77A 5CZJA 2R1KA 3PZGA 4REQA 3GLCA 5BXPA 2C1GA 2C18A 4CCCA 5I02A 3M0VA 5FSEC 1RP9A 1N2VA 4IH3A 4JBRA 3GVGA 3QGKC 2W3ZA 3G1HA 3ID7A 3TSMA 1AQFA 1ONEA 4AIUA 5RUBA 1DTNA 1ZP4A 3LN3A 4JY9A 3AI0A 2G4JA 2C7FA 1KW1A 4GXWA 3TMQA 2OX1A 1FH7A 4JQ4A 1O5RA 1U30A 1WCGA 1Q8JA 2R82A 4L6DA 3KWSA 4QS5A 4NIRA 4YU1A 5I24A 4KCVA 1Q85A 1FCVA 4IMCA 3GX9A 3ECQA 3OGRA 4FP1A 1KKRA 3V5CA 2ACQA 4FXJA 2X41A 1XGZA 3W25A 3OODA 1IEXA 3LQLA 1AH3A 4A3UA 2O9TA 3UG4A 3CZEA 3GDLA 1SSGA 3TTQA 3WLLA 3WEOA 4E2BA 3GIQA 2ZA3A 4HSHA 3VVGA 2VX5A 4S23A 2X1IA 2XG9A 1QUMA 1MXSA 5IOBA 4GKLA 1RQBA 2BZNA 5EYWA 5L9FA 4DELA 3S1WA 2Y24A 5AB3A 3OBAA 5T26A 3SCWA 4M51A 1Z9AA 2ZRZA 2OB3A 1SW7A 3VX0A 2DUZA 5IDZA 1W5NA 4A8RA 1DE5A 3UCCA 2REQA 5BRBA 3KM8A 2JEQA 2Q8XA 2HV5A 3EKGA 1T41A 1GQKA 1J6PA 2WM1A 4WSKA 4Y8EA 9XIMA 1NJJA 3P7YA 4C1NA 3Q94A 3BSGA 4TQTA 4UTJA 3DH9A 2GK1A 2DSKA 2PF8A 2H8ZA 4MTVA 2C71A 4B3KA 5XIAA 3FHQA 5B80A 1AQ0A 1TPFA 2IQ0A 1C8VA 2WANA 4D6JA 3LZ5A 1NU5A 4WXYA 4UTTA 1FWWA 3PANA 2OTDA 3EMCA 1W91A 3WQ6A 1H6VA 2E25A 3MYOA 1B30A 1P6CA 1KV8A 3SRHA 1J12A 1UYQA 4NP7A 1DJQA 2YIHA 1F6PA 2IUZA 4QP0A 5CLTA 2VJXA 1OZMA 3N14A 1FA2A 1OK4A 4R53A 4H4QA 1HXJA 3SCTA 4ZQCA 5CSYA 1TE1A 5I07A 3G0XA 3LY0A 4JEJA 2E40A 4AAJA 2CHNA 4AX7A 3EWWA 2PMQA 3BQ5A 3OIHA 2X1UA 1VQTA 2GDUA 1YHTA 2V0TA 3TSBA 3G1FA 1ZP3A 3R58A 3NZ1A 3SFKA 1F3TA 4XZMX 3R07C 2YAUA 1I1WA 2XWDA 1R5YA 3ZJ6A 3UD6A 3N3MA 1EZWA 3HV8A 2R8WA 3AO0A 1IGWA 2IKHA 5FI8A 1X1ZA 1TYTA 3CH0A 1JCMP 5DBTA 1ZS2A 2G8ZA 2MUCA 1B3XA 1LOSA 1KTBA 2V5JA 4O10A 5FS7A 2Y8UA 3EOLA 2O9OA 3CMJA 1P6WA 1W1A1 5CPSA 2ZUSA 3AU6A 4WRHA 1K70A 5LA1A 5IHSA 2BXZA 1VGAA 1OIFA 4AMCA 4AD3A 3SN4A 4YHGA 3G18A 3VNIA 3FY1A 3QV7A 1IHIA 2NT1A 4NZ4A 3S8HA 4J35A 3IV3A 1FWTA 3SCVA 5LIYX 3RMJA 4RCXA 4HYWA 4HHLA 1B3ZA 1JF6A 1I2RA 3RO6A 3D9XA 2ACSA 1DWHM 3PJXA 5G2IA 1XLJA 1KRBC 4JTEA 3NURA 3PN8A 3L4TA 4UNIA 1YBQA 4RNJA 2AQOA 3QV9A 2OPJA 5PTDA 3M07A 1RV8A 1RQHA 3W87A 4D9PA 3R13A 4UC5A 4EWJA 4EAMA 4NAFA 4ZOEA 2Y62A 3TONA 2QIWA 4ML9A 4BR1A 4UFHA 4APNA 1KB3A 2I17A 3TYEA 5CSRA 1WKFA 4UFMA 3ALGA 2GDQA 2A7RA 5DN1A 1Q6RA 1R3RA 2Z7GA 3N12A 2V5KA 4DZAA 3GY1A 1N8WA 4M24A 4Q4MA 2OZTA 1KV5A 1E71M 1RLDA 4O8AA 1N5WC 4OQVA 4GLEA 2PTWA 1W1VA 1GTHA 3BL3A 4PA8A 2ON3A 2TYSA 3T09A 2X8CA 1QMLA 3DGRA 2A6LA 4GX8A 3CLMA 2BASA 3W1MA 5AHFA 2P3ZA 4GQQA 1G5AA 1XBXA 4LQ1A 1NOFA 4A21A 1VPYA 3HU7A 4KEVA 3HPFA 3HJZA 1IEVA 3PWAA 3T05A 3C2VA 4JXCA 3QMSA 3GVWA 4ES4A 1RK6A 1A5AA 3REQA 4Y9MA 3TTOA 4S3AA 1KQZA 3W24A 4D1IA 2VURA 3RN6A 2VDHA 3BLOA 3DECA 1W1IE 4G1KA 4PUNA 1XDMA 1EHAA 1O66A 1VD6A 1W17A 4KF1A 2DDXA 3M9YA 3LX9A 4QSHA 2C6QA 1PKMA 3LI1A 3G3MA 3WUBA 5AOUA 4DBDA 2FQIA 5D9MA 3E74A 4D2JA 4O1EA