3OPSA

Crystal structure of mandelate racemase/muconate lactonizing protein from geobacillus sp. y412mc10 complexed with magnesium/tartrate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
386
structure length
386
Chain Sequence
SLNITGIQSDWKVEKIEFAKLTGERARSAGANGRIGVHGKSCTVDIARITIDGQTGYGSSIHMTPEWAEDVIGRRLLDLFDDRGRLREAYRLQLEYPVLDWLGQRQGKPVYDLVSGAHLETGASLVVPCYDTSLYFDDLHLADERAAVALMQEEAMQGYAKGQRHFKIKVGRGGRHMPLWEGTKRDIAIVRGISEVAGPAGKIMIDANNAYNLNLTKEVLAALSDVNLYWLEEAFHEDEALYEDLKEWLGQRGQNVLIADGEGLASPHLIEWATRGRVDVLQYDIIWPGFTHWMELGEKLDAHGLRSAPHCYGNAYGIYASGHLSAAVRNFEFVEYDDITIEGMDVSGYRIENGEIHVPATPGFGIVFDDELVTYLINRSGWSEGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Mandelate racemase/muconate lactonizing protein
publication title Crystal structure ofmandelate racemase/muconate lactonizing protein FROM GEOBACILLUS SP. Y412MC10 complexed with magnesium/tartrate
rcsb
source organism Geobacillus sp.
total genus 117
structure length 386
sequence length 386
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3opsA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3opsA01
2HXTA 3SJNA 2ONEA 2GL5A 3MSYA 3OP2A 3UJSA 4IZGA 2XH7A 1PDYA 1MNSA 1FHVA 1ELSA 3K1GA 3MY9A 3VC5A 2OKTA 1OEPA 1FHUA 4JN7A 2PODA 1EC7A 3CYJA 1SJDA 4GIRA 4HCDA 3R10A 2PA6A 3U4FA 3SN1A 3FVDA 1L8PA 4J3ZA 3UJ2A 2I5QA 3ZLFA 1P48A 2GSHA 3OTRA 2PP0A 2QDEA 2MNRA 3KUMA 2P3ZA 1SJCA 4DHGA 1SJAA 2PCEA 2P88A 2O56A 5FJPA 3STPA 3CK5A 4E4FA 3OPSA 2FYMA 3SBFA 4G7FA 4E6MA 2GGJA 2PS2A 2NQLA 2PP3A 3R11A 3V5FA 4HYRA 3DFYA 3SN4A 1DTNA 2AL1A 1KKOA 3H12A 4IL2A 1ECQA 4H1ZA 3UCDA 3VC6A 3NFUA 4IL0A 1TE6A 3R25A 2PU1A 3FJ4A 2GGHA 3RO6A 1KD0A 2PGEA 1SJBA 3DG7A 3ENLA 3CXOA 3IJQA 4Z1YA 3R0UA 3QLDA 4M0XA 4HCHA 3V3WA 2RDXA 2OG9A 4GGHA 1BQGA 1R0MA 2GDQA 3BSMA 3UXKA 3BJSA 2P8BA 1XS2A 2P8CA 5IDZA 4HNCA 3PFRA 3UXLA 2MUCA 4GYPC 2QGYA 3P0WA 3TTEA 1EBHA 4J1OA 2GGEA 3QN3A 4JN8A 3SN0A 3MWCA 3OW1A 3R0KA 5FJRA 3ES7A 3TJ4A 2QJNA 2XH0A 3QKEA 3Q45A 3H8AA 3RR1A 3EKGA 4IP4A 2PMQA 3BOXA 2ZADA 3UJFA 1JCTA 3PK7A 3EEZA 4A3RA 3ZLHA 2QVHA 4IT1A 3DESA 1EC9A 3DEQA 3RRAA 2OZ3A 3PWGA 4MKSA 3JZUA 5BOEA 3ZLGA 3JW7A 3N4FA 4IP5A 2PTZA 4E5TA 3TCSA 3GC2A 1RVKA 3R1ZA 1F9CA 3UJRA 1XPYA 3MUCA 2OX4A 4GISA 3VFCA 4IHCA 2QJJA 1JPMA 4ZA0A 2PP1A 2XH2A 5J04A 3I4KA 3FYYA 2GGGA 3FV9A 1JDFA 3DERA 4KT2A 3MZNA 4DXKA 3GD6A 1MDLA 1PDZA 2GGIA 3GO2A 4HCLA 2OVLA 4DN1A 1JPDX 3D46A 4E8GA 4GGBA 3UJEA 3CT2A 3ZVIA 3I6TA 4ENLA 3FCPA 3ES8A 5FJUA 4K1WA 3T6CA 3TJIA 5FJTA 4KWSA 2PTXA 3U9IA 3CB3A 4FP1A 2PTYA 3DFHA 3P93A 4HNLA 3SSZA 2OFJA 3TW9A 3DG3A 3T9PA 2OQHA 4A35A 4MGGA 3V4BA 3N6HA 5BOFA 4M6UA 3TOYA 3P3BA 4KPLA 4ROPA 4MMWA 3DDMA 5EU9A 4H83A 2QQ6A 3T4WA 2OPJA 3TQPA 3DG6A 1IYXA 3N4EA 4DX3A 4K8GA 1W6TA 2HNEA 3VCCA 3V5CA 2XH4A 4GFIA 4KEMA 1R6WA 1E9IA 2XGZA 2HZGA 2POZA 3RITA 3IK4A 1TZZA 4HN8A 2DW6A 5FJOA 2FKPA 4X2PA 2PPGA 3FXGA 1NELA 2AKMA 3UGVA 2AKZA 2AL2B 3NXLA 4A6GA 4G8TA 3QTPA 2OZ8A 5ENLA 1KCZA 4JHMA 4H2HA 2PGWA 3TWAA 4DWDA 2OZTA 1P43A 3VCNA 2P0IA 3UCCA 6ENLA 3ZVHA 1MRAA 3H70A 3S5SA 2HXUA 3D47A 1WUEA 3VDGA 1YEYA 3NZGA 2PU0A 3RCYA 2OLAA 2OO6A 3MKCA 1NU5A 3S47A 2QDDA 3GY1A 3OZMA 3VA8A 3IJLA 1EBGA 4Z17A 4GYPA 3HPFA 2CHRA 3TWBA 1EC8A 1KKRA 1WUFA 4ZCWA 3B97A 3SQSA 2OQYA 4K2SA 4YWSA 3JVAA 2PTWA 2AL2A 3QPEA 4F4RA 3H7VA 1MDRA 1MUCA 4FI4A 1ONEA 3I6EA 3NO1A 3ZVHB 1TKKA 3DGBA 3DIPA 3MQTA 3N6JA 3T8QA 4HPNA 3IJIA 4E4UA 2PSNA 7ENLA 4DYEA 3PWIA 2DW7A 3Q4DA 4EWJA 4GMEA 3THUA 2QJMA 3RGTA 3CAWA 1BKHA 4H19A 2XSXA 3OZYA 2ZC8A
chains in the Genus database with same CATH superfamily
5FACA 3M5ZA 5JIWA 1WKEA 3EGJA 2A3LA 3YPIA 2FZBA 4AWSA 4JTLA 5I3JA 1ZU8A 4JBRA 4WJXA 4PGLA 3NR0A 3HF3A 2V3FA 5AYIA 1B3OA 3RK8A 2WSKA 2Q09A 2PODA 1R3WA 1LPFA 3R10A 5I03A 4MZYA 3CUZA 1FY6A 1K3UA 4Z42C 4GABA 3LCHA 1HFBA 2HVOA 4HNOA 3WFAA 3HGJA 1Y0EA 4GI9A 2ZDSA 5A8GA 3WD3A 2MNRA 1XYBA 3WIJA 3AYSA 3MUZ1 3W7HA 4GRTA 1A80A 4UMBA 3PC0A 3SDOA 2JIWA 3PAJA 4IIGA 4H4PA 3A9BA 1QK0A 4F2TA 5HPOA 3QRHA 2CXGA 4E6MA 3CBWA 4H4XA 2HBXA 1E72M 2HS6A 2PDCA 1PIFA 1UD8A 2CEQA 1DWFM 2Z0IA 2GJLA 4WSKA 5C2XA 4A29A 1RD6A 2HK0A 4UMAA 5LNWA 2X8HA 3W1PA 4KFNA 1KKOA 4OT7A 2RJGA 5T9CE 3OBKA 3OEXA 3A64A 4IL0A 2YFOA 1JUKA 4X61A 1FVPA 2WYSA 3GNNA 3CS2A 4W88A 2PGEA 1NJJA 4NSBA 2P53A 3WKZA 3IIZA 3KAOA 3U5UA 2F9RA 3N29A 5EBKA 3WH8A 1XIHA 4IX0A 5D37A 4JR5A 2VZSA 4KCWA 2Z28A 1BGAA 1XGZA 4HA4A 3A21A 3P60A 3ZJKA 1MEHA 4GPNA 1TPDA 2EG8A 1G4TA 5CAKA 4KEVA 1IWAA 4FLQA 4PFHA 3MSDA 5E0FA 3WK0A 1GHSA 2E67A 1KNWA 3GNDA 4MAVA 1OZMA 1JCNA 5FJJA 4LAOA 3NOYA 3WDIA 2YYUA 3APTA 4G9PA 1O95A 1VFMA 4O0ZA 3PNZA 5A94A 1GEUA 4G5DA 3ALFA 3QKEA 4CNUA 5I06A 3W1LA 3CYVA 1IEVA 2I9EA 3ICJA 2C0HA 1GRAA 1CXFA 1NARA 2C3ZA 3OG3A 4H9VA 5TNVA 3L0NA 2C91A 4K36A 2E77A 1QJWA 3FIGA 3EWYA 5KVHA 1EO7A 3MANA 2VGBA 3ZJ6A 4BEUA 1NWUA 1EP1A 1QOPA 4JTDA 4AHOA 4RCXA 3JW7A 3AWOA 3GQYA 1DKWA 1AMKA 5D2VA 2CLOA 3TUUA 3NQBA 3PBGA 3ZZ1A 4FB7A 4TTGA 1SMDA 2RH9A 3E74A 3VGBA 2YW4A 4H8HA 3H23A 2FZDA 3EB3A 3SURA 4IUOA 3R8HA 4B92A 2WWDA 1RK5A 1CXHA 2ZZ4A 1YTDA 1JDFA 1V51A 3DERA 4MNLA 1L2QA 1W37A 3S5OA 2IPFA 3MDUA 4DVOA 4DXKA 1N7KA 4DBEA 3JU2A 1V6TA 1GOKA 3TU9A 1ZL1A 1PWMA 3MU7A 3GO2A 2RDWA 1XBXA 4UQEA 1VPXA 1W5NA 3KBMA 5KZ6A 4PULA 5HULA 5CPLA 3ZM8A 3QY8A 5EMKA 2R1KA 2H9AA 2C13A 2PTYA 1Q5MA 4O52A 1ITQA 4K8DA 4CQ8A 4LCRA 3DH9A 2WQPA 4HOWA 4JIPA 3H2NA 4MKNA 3NS1B 2DVXA 4DNHA 4UXDA 1PV8A 3NDZA 4LYKA 1HKJA 3STCA 2O9PA 1EUAA 3T4CA 1XUUA 1HG3A 4CEUC 4YS1A 2G5WA 3ONBA 4PBFA 2OELA 1E5JA 2QV5A 2PZNA 1FEAA 4F0RA 1RBLA 3OJGA 1A5KC 3EEGA 3G8RA 3FXGA 1GJPA 3QV7A 1R2TA 5AFDA 4DZAA 1J0JA 3G3DA 4NYUA 4I5XA 1KBKA 4G8TA 4U3AA 1VEMA 1XUZA 3GVRA 4IFKA 1E0VA 2H6RA 3BCDA 3RU8X 4F48A 1YTKA 3M0LA 4TVDA 1MRAA 5I3FA 3S5SA 3TAOA 1S1RA 1A3XA 2R1PA 3LS9A 1TPUA 1DTUA 3P14A 1YEYA 2ZRYA 2B7NA 3EX4A 1PZ3A 3LHYA 5F1VA 2CZDA 5I6SA 2X2YA 2VUNA 4LAKA 3DFQA 2EKCA 4N6EA 2BGSA 1XDIA 5K9XA 1YQ2A 1EJXC 3KRUA 3CLMA 3WDHA 3UZJA 4IOTA 3NYZA 1EBGA 2O7QA 4Z17A 4AZ6A 2JEQA 3GTXA 2PF8A 3RUBL 2OWWA 4C7FA 4KIRA 3SQSA 3BAIA 4FEZA 1TV5A 5A6KA 1V59A 2PTWA 4ATLA 3AM9A 5BU6A 3N1AA 2OWXA 4C6KA 5C71A 3EOLA 1MVYA 1POKA 3BLEA 2FLIA 3KTCA 5CC7A 4UR7A 1F6YA 2X8CA 1TV8A 3OBEA 1J0HA 1KTBA 1GJUA 4UNIA 3W7QA 2DIKA 2C19A 3E2VA 4ZB2A 3QYSA 3AS3A 2ZYFA 4MWAB 3PY2A 3VE9A 3OHIA 4PUWA 3OVQA 4FNUA 1W9XA 2J79A 4Y9MA 2OMAA 1XPGA 4IPNB 3UESA 2X1RA 4C6DA 5DRCA 3S6DA 4H3DA 1BYBA 3ARWA 4KGLA 3C2RA 4P7OA 4KGJA 5DY3A 3N2OA 4I7UA 2ZC8A 4JQ3A 4ZEPA 1W3JA 3QSRA 5AHLA 1T6MA 4Q4KA 4RE4A 3WBXA 1DJQA 3QMTA 4JQ9A 2ZX8A 4RDWA 2GK1B 2VNCA 4MPKA 3AO0A 1QRQA 3AYTA 3NSXA 4RXFA 5MHBA 1CTNA 5I23A 3N9RA 4H4VA 1VBRA 4LX4A 2DQXA 5K7JA 4Q8NA 1VD6A 4HN4A 2CZVA 3FNDA 2FZNA 1S3HA 3GFXA 1OT1A 1LBFA 3HO8A 5CPMA 1RXOB 3TQVA 4MB3A 1T5AA 4HU3A 2E5BA 1C9WA 2GQWA 3ZQ9A 4DF1A 4EK7A 2PGRA 3SY1A 3OGSA 5GNZA 2ZICA 2X1UA 4AHQA 4J28A 1OIFA 3ITOA 1OF8A 3PZ9A 4RNFA 4LUSB 1Q6EA 4Q4QA 3WF1A 4GCXA 1HXJA 5A2AA 1A5MC 1PIGA 2WSQA 5HR6A 3QSTA 2CITA 4WDUA 2O9OA 2GVJA 2VGFA 1MQPA 2FFIA 2XYLA 1SB3B 4NKCA 3W53A 1GRTA 2ZUTA 5FAGA 3GUWA 1UOKA 3TMQA 1QPRA 2BV9A 5CSUA 2RDUA 1GTEA 5MKGA 4HHMA 3AZTA 3LI0A 1HJXA 3SUTA 2NUWA 2GUBA 4ZXLA 3TYDA 5E9XA 3WBAA 4J3TA 2G4FA 3XISA 1DEDA 4Q8QA 4UUIA 1V3LA 3WLRA 4LGXA 5A6JA 3GIYA 3RLUA 4NASA 1ZLPA 3H4GA 1TYGA 4NQ1A 3KM8A 3CAVA 3R07C 3TR9A 4O0KA 1Z9AA 2GDQA 4LRSA 4H04A 3ZJ7A 3VOIA 1AH4A 1MFUA 2P8BA 4NRSA 5GQBA 2V2DA 1E1CB 1W9UA 5F2LA 1RSCA 2QCDB 3R8GA 2Z6IA 4H4UA 3C3UA 3TVAA 4DUXA 3OLEA 4GYPC 5LHFA 4KQNA 1P0DA 3W70A 3VDBA 1ZDLA 4IMCA 1HIZA 3MCNA 1M3UA 1WDWA 2GGEA 1PKNA 3AICA 1QK2A 1FECA 1MUMA 3MJYA 1N5WC 4XO7A 4XK2A 3LU2A 3FJLA 4NUWA 5HQMA 5A69A 2HK1A 3I3DA 1T0OA 4A2RA 2WOVA 3ARQA 2Q6ZA 1NHSA 3GDLA 1H7WA 3TDFA 4WEVX 1VGAA 3SQMA 4GIAA 2WHJA 4DZ5A 3BSGA 2QVHA 1B5TA 3DESA 5I00A 2OZ3A 2V2CA 2B7OA 5CC6A 2ZRVA 4UTWC 5CBIA 3H22A 3LPFA 3S6TA 3A22A 4MZ8A 3WG6A 1XJBA 3N17A 4B15A 3F7JA 1W1YA 1VHNA 1LUCA 3P8JA 4FR6A 4JTIA 1G4EA 4K3ZA 1GPFA 1XPYA 3AJ7A 3AS1A 3A7UA 4OVXA 3BZJA 4HPHA 1W3KA 1P0NA 1F7BA 3PFMA 3FYYA 1AH3A 3PUGA 2GGGA 4HOZA 2AGTA 2YIHA 3NOEA 3LLDA 2YL6A 3O15A 1MZHA 4F0LA 3W84A 3G1SA 3M4HA 5DEZA 1RVGA 1FDZA 4V33A 4P7LA 1KFBA 4PEEA 3G0UA 5D03A 2H8XA 1X8FA 2WZMA 3VNZA 1QW9A 2WANA 3GTFA 2XFYA 1KFJA 1JUBA 4FX6M 4Q33A 2NQZA 4S3KA 3K46A 1MRQA 5KINA 5I7GA 4JFVA 2QZRA 6XIAA 4XSLA 1EOKA 4KBXA 2WMIB 5CG7A 1TTJA 2VFGA 4EMIA 1QUMA 4MDPA 4ICMA 1F74A 2WMKA 4LXFA 3TOYA 3AU6A 1HQTA 1F3EA 3MP4A 3WDRA 4RX0A 3T4WA 5FF7A 2JF7A 2VD8A 2VZVA 4UQAA 3QR0A 1MOKA 4U5KA 2OYLA 1PKYA 3IVSA 2BMBA 4AD4A 4JXCA 1U83A 2C14A 4DUVA 3M0JA 3FYPA 1G9HA 1PZ0A 4HU0A 5DN1A 4FXSA 2DIEA 5BRPA 1A0DA 4HHLA 2J7HA 3W83A 1G01A 4GI8A 3QQWA 5REQA 3GXDA 2R82A 1LWIA 4QSFA 1V02A 1OFEA 1NAL1 1YDNA 5KZEA 1FCQA 2C71A 2W3ZA 3UW6A 1FWJC 6ENLA 3LQGA 1XG4A 1I9CB 4XZNX 2CLPA 2I16A 2GDUA 2NUYA 4EM3A 3MB9A 1W56A 2V3DA 5AHEA 3DK9A 2GH5A 3DGZA 3CQKA 1ITUA 3N18A 2OEJA 1EGMA 2NLIA 3PNUA 1XH1A 3ATZA 2GR1A 2F6KA 4GI6A 4E3VA 1S2UA 4X22A 4QDPA 3HPFA 2DU2A 4YTUA 3KTXA 1XV8A 4ZQMA 5T91A 4AEEA 5A1AA 3TTSA 1MQQA 4H8VA 3CEUA 5JIPA 4LUTB 1Q45A 4POCA 4FI4A 4AYSA 3T05A 3ZVHB 4E8DA 3P84A 3L5LA 3DIPA 1WZAA 5GRTA 4HA1A 3M9YA 4KWUA 1DE6A 1N8IA 1KM3A 1QNRA 3PVFA 7ENLA 4JY9A 1TX2A 5BWFA 3W6LA 4ZBCA 4NY2A 3RM8A 3MMTA 2P50A 3CAWA 1H1NA 3UXIA 3IANA 4IQEA 3FY1A 2E1DA 1PSCA 2WC4A 3GVWA 4H4ZA 2EG6A 3DFNA 5DBTA 3M44A 4NX5A 5AC4A 3LZ3A 2V82A 1E71M 3GD3A 2Z1XA 3KRBA 2BASA 1QASA 3M7WA 1GOIA 3DK8A 2QCMA 1WOBA 3E6EA 2RDTA 1K6WA 3EA2A 3DAQA 3HV8A 2Z2AA 1L8NA 4XQ6A 4D8ZA 1BQCA 3ISIX 4IPJA 3EDEA 3B40A 3LV5A 4CCZA 4ZOEA 4EQSA 1OCBA 1K6AA 1US2A 4XKMA 4WKHA 3TC3A 1ZB5A 3H6OA 3QJAA 2PTDA 2IKIA 3ITVA 5D04C 2V67A 3KLLA 3CHFA 5C8BB 3UA4A 2O56A 1QBBA 1XXXA 1MW3A 1P6WA 3GAYA 4X9SA 1EJTC 3C0JA 4GH1A 4LH8A 2PS2A 2V9DA 4LS2A 2ZZ7A 2VX5A 2Y61A 4IPLA 3F5LA 2J77A 2YLAA 1VKFA 2WOIA 5DY2A 1H11A 1A49A 2ESCA 4AFYA 5HWMA 4INFA 2X30A 3ME3A 3LTYA 3J7HA 1IXOA 4HJFA 3GG7A 4GUHA 1V8EA 4IIHA 4FHAA 2QYGA 3MMWA 3A23A 3GH7A 3S5ZA 3SSJA 3EMCA 3G8EA 1BG9A 1Q4WA 1OYBA 1WXJA 3F4CA 5TF0A 4CQAA 5DMYA 1BRLB 1OG0A 2PC4A 3D3AA 5AVNA 4C5YA 2DZPA 4DJEA 5DRIA 4OHQA 3HGSA 1D7KA 2ZUNA 1HKIA 3ERPA 1R0MA 2YA2A 4DXXA 1OYAA 2YVFA 3DHUA 3V7PA 1QNPA 5DCDA 3GBDA 4AAJA 1KC7A 2BGQA 5AHIA 4NZCA 3GIPA 3MCMA 3QR3A 1V4YA 2EO7A 1W2PA 3SGZA 1PBGA 2Y5SA 3I68A 2F38A 3PWAA 1VC4A 3O6YX 3WDJA 2XIBA 4C6BA 3BAYA 2D1ZA 3RNMA 1JPHA 4UTFA 4MADA 2ZADA 4E38A 4TVWA 3PPGA 4E2OA 2VENA 4AY8A 1GT8A 1TTPA 1B90A 1DE5A 1RH9A 2WCSA 1YDYA 3RRAA 3NA8A 6A3HA 3SAZA 4FSAA 4MKSA 2DUZA 3FVMA 1WXYA 4PH6A 5HJYA 3GH5A 4KRZA 3TJLA 4ERGA 2PRHA 1OG6A 3W1MA 2V5CA 1XDMA 2ZUMA 4O1EA 1XGDA 3DBPA 4BI6A 2QCEA 2PI6A 3KHDA 1KO0A 1GUVA 2WV8A 1D8CA 4C6JA 4UR8A 1WKDA 1RQBA 2V5DA 5HA7A 2Z29A 3PZGA 1IGWA 4B3ZA 3MMDA 5IFTA 1GERA 4UB9A 4NX0A 1P1XA 2WB5A 3W74A 5KTLA 2KX9A 1PDZA 1RPXA 3D46A 1OFDA 4D1JA 2Z2UA 4UFLA 2EQ8A 2Q01A 2V6OA 1TVLA 4PUMA 3W1QA 3WLSA 2PB1A 1EFZA 2DJLA 1VEPA 1Y5WA 3NURA 5F2MA 5ER0A 1HP4A 3POCA 4EE9A 1UHVA 3B9DA 4I7VA 3CU2A 4KWSA 4F9JA 4QG8A 3VX1A 1ZKQA 1HKKA 3GG8A 1U5JA 4MGGA 3T2PA 3BURA 3T08A 1N8FA 1XM3A 1CNVA 3SB0A 4H8NA 3W7OA 5D9NA 3SUWA 4XZBA 4X0VA 2J74A 3HMJG 1TV4A 3H54A 3NVWB 1QNOA 1XDLA 4QR6A 2G3IA 3N2XA 1EA9C 5HATA 4P7QA 1A5OC 5CZKA 2PDBA 4U28A 4R85A 3PUOA 2ZZCA 3U4AA 4F3HA 4W8AA 2XGZA 4DY1A 3GXFA 4MUPA 2DW6A 3TJXA 1WZMA 2BOGX 2X1SA 1UKQA 2J8FA 3LLFA 4C60A 3FA3A 1EF2A 4A6GA 2HQAA 4AY1A 4M7TA 2PGWA 1OM0A 4AMAA 2BDQA 2OXNA 1AQMA 2D0GA 2VQUA 4CD4A 1E0WA 4CCEA 2XVPA 3GIQA 3W87A 3WQPA 2OGJA 1Q1WA 4DO6A 4GIEA 1ZQ5A 4PTVA 3VDGA 3MJMA 3GK0A 3B8DA 3HG4A 1CGVA 2PU0A 3G1DA 1PE1A 2DT0A 5BMWA 1NDZA 3GH4A 4WD0A 1XH0A 1KWKA 3OZMA 3UG5A 1DXEA 4FLRA 2FPTA 2B0MA 4C1NA 1GVQA 3E0VA 1LCOA 1OFQA 4MKVA 1K70A 3Q37A 3SEPA 3C0QA 1ESWA 2CHRA 1JD9A 5B7ZA 1EC8A 3NDYA 2A3HA 3KWSA 3BUVA 3IS4A 3ARXA 4GJIA 5FI8A 2CNCA 4D6JA 4QBXA 2O7SA 4XWUA 3QXBA 3TXZA 3UA3A 4N7QA 3IUIA 4AZBA 8XIMA 2IUZA 4GC3A 1PYFA 4BA0A 5XINA 3S2JA 1JZ3A 1PWLA 3CEPA 4CNTA 2ABAA 4XTDA 2XGIA 4M3PA 1JCYA 1UD4A 3AHYA 1UR4A 3CZ8A 2PSNA 3MC5A 3PWIA 3Q4DA 5FF0A 4AF0A 1REQB 4CQ9A 3M0IA 3TYBA 1LBMA 4JTTA 4DO4A 1NY1A 1JYXA 1O7AA 2VGIA 5B7YA 1B54A 4Y9NA 2VEMA 3SJNA 3M5VA 2NVKX 3NQGA 4I9AA 4GNKB 3VIFA 1CGTA 4ML9A 1UP2A 5BOOA 3VAVA 1GRHA 1LOSA 3WMCA 3ZR6A 2A7NA 1QWGA 2D2OA 1O4UA 5GJNA 1G4SA 1TTIA 1J79A 5DANA 2QCNA 4HHPA 1IV8A 1GYMA 5C9XA 3VMPA 4IGSA 4QDMA 5DT5A 4GX8A 1S5VA 5CPOA 1EDQA 2PA6A 3U48A 1F8IA 1QT1A 4YHEA 5DCBA 4GZ7A 3CWHA 3BXWA 2GJXA 6CGTA 4G1KA 4QLLA 3ZWSA 4BQ5A 4CVWA 4HZ6A 3KBJA 3DI0A 4ERAA 4DJFA 3EWCA 1P6BA 4DWSA 1YNYA 1NVMA 1HF6A 3GVVA 2OOFA 3NZRA 1U22A 3C0LA 1JCMP 4UQ9A 1ISVA 2XN2A 1GSNA 3VIJA 1UH3A 3GS6A 4LUIA 1VPYA 1DWIM 4HNTA 2ACRA 1KR0A 5H1WA 4LUYA 3PJWA 1TMHA 1DNCA 1TWDA 4LVAA 1I2QA 3NVVB 2EJAA 3AIQA 3WENA 3F4NA 3GDRA 4M6PA 1SZGA 4S3AA 5HQEA 1ECQA 1KA9F 1OT2A 3H4KA 1DP0A 2GGHA 1S2CA 3LSBA 1QW7A 1J5TA 3ITYA 4RE3A 3N13A 1LOQA 1EKOA 4O0QA 4X63A 4XTIA 3QM3A 2JGYA 2VVNA 4HQVA 3W37A 3S2NA 1O68A 5FOOA 4JYFA 3NXFA 3ITGA 3UXKA 4ZL1A 2FZ9A 1SFSA 4N4QA 3LA4A 4XBKA 2XG9A 2R9ZA 1FWFC 4AVFA 3SCOA 2XN1A 3PZMA 2MUCA 1QCWA 3CUIA 1H60A 3IUDA 4A3YA 1QPOA 2OKOA 2WKGA 1C90A 1XF0A 2ALDA 3KW3A 3MWCA 2GSEA 3FGCA 4LAZA 3UD6A 2QJNA 4URIA 1S39A 2XH0A 3Q45A 1WXZA 4BKNA 5CJ5A 3KOWA 3EKGA 3HU7A 2ZZ3A 3C2YA 1VENA 3WFLA 3BMWA 1F6PA 3I3BA 3TLLA 4K8EA 1PIIA 1HN1A 3RILA 5EFDA 2BLEA 3PPHA 1T7LA 1KM2A 1D3GA 1IEQA 4AVNA 4JTEA 3MKKA 1V3MA 2EPNA 3CZJA 4JFUA 1OFOA 2A3CA 2G3FA 4JX4A 2WVSA 1M9HA 4S3CA 3CM4A 3QW3A 2ZDRA 2BODX 3WNMA 1DQXA 3H21A 1XSKA 3CH0A 3L0KA 4ZQNA 4D6GA 3VGEA 2QVNA 4XAFA 1AMYA 1TPWA 1DPMA 4LEFA 1YBQA 2D24A 3VNDA 1Q1RA 1JPMA 4JTSA 5T8GA 3M0XA 3VIMA 1K7EA 2OO0A 3EKZA 4F9DA 1C9DA 4EF9A 4GRSA 1U1JA 4JQ4A 2CETA 1QTWA 1AUSL 4QIUA 5E0KA 4DF2A 1H1ZA 4MFDA 3QF0A 3G6MA 5D02A 1H41A 1PKMA 1B3WA 2RGLA 4UTLA 3PBWA 2ATMA 2HSAA 3W2KA 2C1IA 2BBFA 3GNPA 2O55A 3UJEA 3TA9A 3S0CA 1X7FA 2XFFA 2BWGA 5FD0A 1F07A 4GQQA 1Z7AA 1FXPA 1DIDA 3LOTA 4G7EB 4ACZB 3IC9A 4FP1A 2XM2A 3DFHA 3TN6A 4YTRA 1XGEA 4B5WA 2A85A 1V0MA 4D6HA 4KW2A 3NQDA 2VDIA 5LSMA 1DWHM 2WBAA 1OX4A 2VOTA 4HB7A 3IJ6A 3LSCA 2F8QA 5DMNA 2WZIA 3TNBA 3QQ1A 2ZZ5A 5AZ0A 4JQAA 1ENUA 1W3HA 4W93A 1IYXA 4QRNA 4YU1A 3BE7A 2XH4A 4DJEC 1E9IA 3AYVA 1DWJM 1GONA 3WUFA 2NV1A 4GA8A 3SRDA 4F40A 2BVYA 3NVDA 1XSIA 5G2HA 3OODA 3HMCA 4D9PA 3CV7A 4LB4A 4RNJA 3REQB 2V0TA 3UZ5A 3AMDA 2Y1HA 1HGWA 3TWAA 7TIMA 3LCXA 3CTLA 4PBEA 3UQNA 1R8LA 4DJED 3W38A 3B0YA 3H70A 6PTDA 1CWYA 1R87A 4LUJA 4EF8A 3DC8A 1GEQA 3D47A 3EXTA 1R3QA 3TCEA 3P80A 2VWSA 3WJZA 4TU1A 3EWUA 4FOKA 4AZCA 5EFFA 2R1NA 3WQ6A 2Y7FA 3VD9A 3MI2A 3C2VA 3QZEA 3T7VA 2BXYA 3KX6A 1BHGA 1V3KA 3NTYA 2TYSA 2VZOA 1Z32X 4NXSA 4FR1A 1J4EA 3EZ4A 3ALGA 4LCSA 4ICCX 1ZMDA 1ZXIC 2C8NA 3VNKA 3INPA 1PUDA 1V6UA 3DXIA 1AZ1A 3EOEA 1QNVA 3VIHA 3P2VA 4D6EA 4DAIA 1B1YA 4TUFA 4B3KA 3JVAA 3VD7A 3VFLA 3W1NA 5G1MA 3BVJA 1RBOB 3QOMA 4W7WA 4O53A 3SCQA 4P5UA 1XIMA 3QZ6A 2JE8A 2VRJA 1KB3A 3H2AA 3DHPA 4L4MA 1TKKA 1ADOA 3UT0A 3N6JA 5DQPA 3TC6A 3BLIA 1KCKA 1E6ZA 2ZX7A 1GQKA 3T44A 1TPH1 3GX9A 1LYXA 1TWZA 4EWJA 3ANUA 4GMEA 3NL6A 3RGTA 1NQKA 1A53A 3UR2A 3BGGA 4QISA 1JZ5A 3EYPA 4Y8EA 2Z6JA 3CZLA 3ZFHA 3A5FA 3EAOA 2ONEA 1EX5A 4Y96A 3UG8A 3TYUA 1L9WA 1I1WA 1UP0A 3LEPA 4KCUA 3SRHA 5PTDA 5HNTA 3MY9A 8CGTA 2XJ7A 3ARYA 1XRVA 2HVMA 2OLHA 4LSBA 2V5BA 4R5EA 4B5XA 4DQWA 4I8DA 1L6YA 1W9DM 3E96A 4F8XA 1GOOA 1L8PA 4PSRA 3TZNA 3OC4A 1B0IA 1FWTA 3WBYA 1PKLA 4J3ZA 4V1XA 2WW5A 3WNLA 1SR9A 4ZO7A 2R91A 1I4NA 5EL1A 1JCLA 3LTPA 3W0KA 2GQAA 4JTKA 3QGAC 1TFVA 1XLIA 3STPA 4J2PA 1E56A 1Z8AA 1LQAA 1ONXA 2CWNA 2A21A 1GESA 3OVRA 3ARUA 2ABBA 3V5FA 3OZPA 3T0AA 4E2VA 1K77A 1RQEA 2WZEA 5FSEC 3AAMA 2AL1A 4UFKA 4WX2A 4UQDA 4ZQOA 4HU8A 3BJTA 3PJXA 4Z0JA 4R7OA 4S1FA 4RR4A 1BVWA 3QFWA 1G94A 1LL7A 1S5TA 2PRMA 3H24A 4B5SA 1RP8A 1C8VA 1YPXA 4A05A 1B3YA 5D38A 4TV6A 3N6QA 3QC0A 2Y2WA 2Y4SA 4GGHA 3IK2A 4GVIA 1OCJA 1MXSA 3PG6A 5I5RA 2XSAA 3IAPA 4QROA 3C2OA 3KCOA 2XFRA 4WLCA 3ARPA 3PFRA 1CGUA 6XIMA 4DNAA 3UPWA 3D9XA 1QI3A 2YCJA 1NP0A 4XZ9A 1L6FA 2UY4A 2A7PA 1GRFA 2QPSA 4OECA 3U8GA 3QN3A 4Y90A 3SN0A 3OW1A 3TQ0A 3IPWA 2I56A 1KFKA 4AXNA 1VRDA 4I7WA 1ONWA 2ZRZA 3T42A 3C61A 2E28A 3VPLA 3UR5A 3TV8A 1ICPA 4BS0A 1VJIA 3TNOA 1OFPA 2J62A 1KBIA 1XBZA 3EEZA 4R34A 2EJ1A 5CQ1A 4UTUA 4BQ2A 5JQ9A 3FKRA 3LBOA 4IT1A 3IJ8A 1GYNA 4R33A 4W85A 3QGKC 2HS8A 4ZVJA 1B3XA 3CMFA 4D6CA 1EJRC 4RUBA 1MSSA 1TX0A 5GNYA 1RV8A 1TV2A 3ABQA 1RAKA 3GC2A 1FX6A 5LA1A 4MY9A 1RLDA 1YNPA 4IJCA 2ZWYA 3HB9A 2OSXA 2PC8A 4IHCA 4GI4A 1VF8A 4AC7C 2OOGA 1BTCA 4WJEA 3AZSA 3NG3A 1P7TA 2BCPA 4QSHA 4MJ2A 4Q22A 3P67A 5M03A 4GUFA 2CC0A 1HKMA 4L6DA 3CHDA 4DO5A 2GOKA 2D73A 4O1AA 3B9NA 1B3ZA 5G2IA 4YYFA 3O8AA 1BYCA 1Q7QA 3ORWA 3UZZA 3K4AA 3ARSA 4BR1A 1UMYA 3TONA 1Q6LA 5AKQA 2PWGA 3G1VA 3SR7A 3S1VA 2XVGA 1UD5A 3CIXA 4DJFC 3WLOA 4TTUA 2KZHA 2D23A 4DWSC 1U33A 4Q8OA 3STGA 3ES8A 3S5NA 1EP2A 1S5WA 3DJGX 5FJTA 4JHOA 3UWWA 5LNRA 4YTSA 3TSBA 5HUPA 4PA8A 2ACUA 1D2KA 3S9YA 4DXVA 1Q6FA 2OFJA 4DJFD 2G37A 1V97A 4Q8WA 3N6HA 4AU0A 4DWSD 4IMFA 3VNMA 2V6AA 4HMDA 2VFEA 2QCCA 3WSUA 2W91A 5LYRA 3MPGA 4HPXA 1FCVA 5HNNA 4UTHA 1GQIA 4REQB 4J3VA 3ZS4A 1MXDA 1TA3B 3UBPC 1MO9A 1CI1A 4LALA 5LA2A 2PDPA 4M52A 1M7JA 2PDXA 1GVOA 3EPNA 4CCCA 1TZZA 2DZVA 2YSWA 3OZOA 3B0PA 6TAAA 4WY0A 1YX1A 3KXQA 5DCEA 2I57A 1E1FA 2J8TA 1NOWA 3BTNA 2YLLA 4AD0A 2OZTA 3PSVA 3KVKA 5DELA 1UIOA 2ZRUA 4NAFA 3D3FA 5T9BG 2HXUA 3AROA 3BC9A 3TSDA 3S2MA 3SCSA 4RJEA 1F61A 5C55A 4LV9A 1YNQA 3VGDA 1EYWA 3TIMA 1BWKA 1ZTVA 1R47A 2QDDA 3L4VA 2RABA 2E5CA 2HJPA 5XIAA 2WPFA 2V8ZA 1O1HA 4JIRA 4B5NA 4JCLA 4LF2A 3W6MA 4IX2A 4KFOA 1X96A 3NO5A 4U10A 3H2EA 1N60C 1R7OA 1WOAA 3SY5A 4JKMA 1JPKA 3BG9A 1XSJA 3BV4A 2BVTA 3UF9A 3GUGA 3B9JB 4TIMA 1NWSA 3LM7A 3ZT5A 1MDRA 4B5VA 1AQFA 1DORA 3N9KA 4FMVA 1EO5A 1PTAA 3QQ0A 1WPCA 3O05A 4FXRA 3HPSA 4UWMA 2NT1A 2WP5A 4E4UA 2HWGA 4QLKA 1DJYA 4YN5A 1ZAHA 1FH9A 4UC5A 1OFAA 4GXWA 4E0CA 4Z2IA 2PF0A 1V0LA 1VLIA 1E4LA 1F3TA 3OZYA 3NUKA 1XFCA 3B06A 4JL1A 4LANA 2YA0A 1LDCA 3MP5A 1Z41A 2X0YA 4TOQA 3L4TA 1XQKA 2V3BA 2HTMA 1G69A 3RLVA 3GXIA 1NPXA 3VC5A 3WJWA 4IJBA 3R89A 3MP3A 1SGJA 1EC7A 4GIRA 1UKTA 1UR2A 1EF3A 1RJQA 4WGHA 1AJ0A 1PZ1A 3M0HA 3BQ5A 3AXXA 2IXUA 4OOUA 3UYCA 3ABOA 1G7VA 3PTDA 4ZE4A 5ABHA 3FAXA 1CECA 1F73A 1JEZA 3B04A 2ZUVA 5FMHA 2OU4A 3ITLA 1L0PA 4NXKA 3CHCA 1QI2A 1XLKA 2WVTA 3B0VC 4P61A 1EX1A 2HV5A 1EQPA 2E3TA 3CXBA 3G1RA 1QFEA 2ZC1A 3WQFA 5EMJA 1OK4A 1RA5A 1TPC1 3H26A 1E3XA 2XDFA 2GYIA 4IL2A 2DT1A 4AWTA 5A6MA 2QHAA 5DF0A 1K4HA 3TROA 1J5SA 2CU0A 3GHRA 5CSSA 5K9DA 1DWAM 4P2VA 3CT7A 1DIEA 4QNWA 2W54A 5CEWA 4CD5A 2AMXA 2J3NA 3W01A 5AC6A 3LNMA 3M47A 1DQWA 1V7AA 2EXOA 1QOQA 3GXTA 5CPTA 5LA0A 4QAWA 9XIMA 1WZKA 3BJSA 3VDCA 1XS2A 1F8WA 3QLLA 1KFCA 3QFAA 4LW7A 4UTKA 2DZWA 2EPOA 3WBWA 4JEJA 1JAKA 4PSPA 1E1EA 4LS0A 1GKQA 3K4DA 5GNXA 3EPMA 2SFPA 2OLSA 4PMQA 1VYPX 4AX6A 2QS8A 1OABA 1JUEA 2CLEA 3BW2A 3W76A 3WJYA 1AODA 3RAOA 3H8AA 1DXLA 3PR2A 4IP4A 5JBEA 3Q58A 3PZOA 1EL3A 4IIEA 1W3LA 2ZXDA 4D6IA 5C9ZA 3RM4A 4CN6A 1QBAA 5CJNA 1UWRA 1ZRQA 5KMYA 2X7VA 3R0DA 1GVEA 4IWWA 4RW5A 1HJVA 1BAGA 2F2KA 2ZKMX 1AVAA 2VXNA 3GVQA 4LRTA 4MM1A 4E5TA 1E1CA 5D2YA 5D8ZA 4CU8A 2PDFA 2A3BA 2QCDA 1UA7A 4H7VA 1J01A 1P0BA 4H6EA 1SU5A 1NFPA 4M7SA 2NX9A 1ODUA 4CNOA 1ZJHA 3HIJA 2P1FA 2QCLA 2XH2A 1UMLA 1YQZA 4CQDA 4GC4A 4C7GA 3GM8A 4YCOA 2Z1WA 4Z08A 1NSJA 5CPQA 3BDKA 4MVAA 3TW6A 4FX8A 3JZEA 1UB3A 4JX6A 4DB7A 1JF6A 4JQ2A 9RUBA 4MJZA 3ITTA 1P5BA 4HCLA 4H9TA 3RIKA 2PFHA 5JH2A 1C7SA 4GGBA 1ZNNA 3GRIA 4XAYA 3VOGA 3C2FA 3VNIA 2IKGA 1JZ6A 4ENLA 1D9EA 3FCPA 4FPSA 1ZMCA 3TJIA 3VMOA 4B9YA 4Z2LA 3B9OA 1FWDC 3N73A 4WGXA 3ZT6A 4JIQA 4Z2JA 4AZHA 2DZTA 3E49A 4GNJA 1BWCA 2VKZG 2E9LA 2R9RA 2O9TA 4O1CA 1JI1A 1XQLA 1UUMA 4OU1A 3VIPA 2J7DA 2OQHA 4A35A 1EWEA 4KRTA 2EPKX 4BI5A 4Z2HA 1JDEA 4NVTA 3OGRA 2XISA 4PUEA 4L64A 3N2CA 1HL2A 1UG6A 4HD5A 2G3NA 1EJ7L 3W7DA 1XKJA 3NIYA 4XIAA 3HM7A 4NNCA 5CXPA 1W5PA 2C79A 2R1LA 3NEHA 3DI1A 4JY8A 1OY0A 4NILA 3SRKA 2XGBA 4JTGA 2BHYA 2IQTA 4KCVA 4Z1DA 3AJXA 1W17A 3QC3A 1LWHA 3EXSA 3RITA 2IQDA 3EDKA 1KRBC 3CLWA 2FKPA 2KAUC 4NI3A 4JDBA 2YKKA 2NPXA 4Q8MA 3TYEA 4FLOA 2OZ8A 5ENLA 1QVBA 3HQOA 1XIGA 3HGOA 3C8FA 1YE6A 1RK6A 3BGJA 5G4EA 3CNYA 1AW1A 5HMFA 3T2OA 4ZE5A 1ADSA 3CHVA 2H3BA 1ZS2A 2G0WA 1ADDA 4IMEA 3AI0A 3EDFA 4IIBA 4N9DA 3LHWA 3UZXA 3AU2A 1TPVA 3OIHA 2NLYA 4DRSA 2W27A 3VIGA 4DUWA 5D2WA 2FJKA 3BAXA 2G97A 1S3TC 4EQWA 5BCAA 4N9EA 3MO7A 3HG3A 2FZMA 2J7CA 5BRBA 1US0A 4GWEA 4DLMA 3OLIA 4KRUA 5L6UA 3TWBA 3GW3A 1WUFA 1KBBA 4CVUA 3DN5A 4QCEA 2EGZA 2FVLA 1KCXA 1X7IA 2QAPA 4WXZA 2V63A 4IFKB 1DJNA 4XVDA 4M5PA 5JCLA 3H7VA 4FO4A 1MUCA 2XIJA 4NJJA 2A6LA 1ONEA 4ZENA 3E0FA 3NO1A 1I45A 5KVIA 4PZVA 3U7VA 3MVIA 3GRTA 5AY7A 3TOPA 3W07A 1RY0A 5AYZA 2WQDA 2Y0FA 1ZPTA 5IM51 1GOQA 5CCZA 3B0UX 3W7CA 1WNOA 3MMUA 7REQB 1F4AA 2DSZA 1FCUA 3SCWA 3WO8A 5I02A 4H4YA 4XV0A 1JCJA 3L4XA 1VBJA 5DMLA 5I3HA 4FX9A 3QW4B 3V0UA 3UZWA 4ZTYA 1Q6GA 1HKWA 4S39A 2PE4A 2VZUA 3S1XA 2VO5A 4AWEA 4GZEA 1DHPA 4C1KA 1X2HA 3C2EA 5LHEA 4RZ4A 1FHUA 3AIVA 3Q94A 1TJ0A 2PLKA 2X99A 4TVUA 4LUTA 1E0UA 4XUGA 3L21A 1K03A 5CLTA 2TAAA 5AZ1A 1Q6DA 5AHNA 1BYDA 4AD5A 3GXMA 4KF1A 3NM1A 3MV01 1ITXA 4XZWA 5I3GA 4AYGA 3S8HA 4S3BA 1HNYA 3H55A 1EPVA 2XVNA 1S38A 5A95A 5AHFA 1QR7A 3SCRA 4B5TA 7TAAA 1W54A 4M24A 2BOFX 3SIZA 4HYRA 1N8WA 3CWNA 3DFYA 1KM5A 4AZGA 3WQGA 2VYOA 5BRQA 3VOFA 2FHBA 2PLMA 3B8WA 2Y7GA 3VOCA 2VEKA 2XZ7A 3NFUA 1EA0A 1G6CA 3PP7A 2YXXA 2Y62A 3NGJA 4LVDA 1OC6A 1KD0A 5A6AA 2CBIA 1UOZA 4P8WA 2WPGA 2NWSA 3ENLA 2WMGA 3C52A 1GWJA 3R0UA 1DJHA 4HP5A 2OYMA 4HCHA 3V3WA 4DBSA 8TIMA 4K39A 3U2CA 3AQUA 5CJMA 2QJGA 3KBNA 4LV4A 3WBEA 2GQ3A 1IQ8A 5IHSA 5JVLA 5BXSA 1W5OA 1C7TA 1SZRA 1BLIA 1IE7C 3KBWA 4H4QA 1TPFA 3W22A 1VJZA 3B05A 1MYRA 4CCDA 2QGYA 1MWOA 3TTEA 4J1OA 1UJPA 1UWIA 2ZE3A 1WDRA 3PHAA 2E09A 3PZVA 4KMQA 1D8WA 3MUY1 4I9JA 1KFWA 5MKGB 2Y7DA 3EA1A 3VVGA 4KWVA 2XM1A 3MUIA 1XD0A 3F2CA 2WNZA 2PWEA 4OE7A 4XD3A 3GTHA 1V08A 1D7YA 4WSHA 2ISVA 4C1LA 5DBUA 5JU6A 1EC9A 4F66A 3ATYA 5A3HA 1AH0A 4J2MA 3W82A 1CYGA 1XBVA 4PCFA 1CX9A 4M51A 1I60A 3WEZA 2EPMX 4Q8PA 2WVVA 3AS0A 3MBFA 4IMAA 3G1FA 2J4GA 4GISA 4WDXA 2ZBTA 1TV7A 4M82A 5E09A 2QAEA 3ZSTA 2WC3A 4U31A 3N2TA 1GXFA 3G0SA 1OX6A 2E9BA 3TSMA 2Y8UA 3LB0A 3MZ2A 1B30A 2I17A 1A5LC 1ZX9A 3VM5A 4IXXA 2D22A 4LVGA 2HQMA 1IF2A 2XSBA 4KWWA 1OJXA 4NG3A 3NM3A 3WL0A 2BGNE 1NP2A 3LXBA 3NQAA 4C65A 3GNOA 1VBGA 4M6VA 2YA1A 3A12A 4I6KA 3T6CA 2F6XA 3WQCA 3QY6A 1HJQA 1EXPA 4DZIA 4BHYA 2QCHA 1LUCB 3A5VA 1E0XA 1SSGA 4MWAD 3T9PA 4EX4A 5G4WA 4K1GA 1Q6CA 2VELA 3DX5A 3SZ8A 1HZYA 3THCA 3P3BA 3W7GA 1OF6A 2WOWA 2BFGA 3LCLA 3LQLA 2V3GA 4GG9A 1ZJIA 3FXYA 2X40A 3P81A 5CBBA 3N4EA 3MUAA 4IF2A 3SQLA 3PTKA 4YNGA 4UTJA 4L1WA 1RD5A 2VEIA 5FJOA 4X2PA 5TAOA 4EPEC 1WKFA 3WYZA 4EXQA 5HR7A 3LB8A 4PMRA 1WAWA 1W1ZA 1OADA 1KCZA 3CGTA 1HP5A 1V3IA 5GJPA 3FAWA 1JCXA 2HE5A 4BEQA 1EZWA 2IQ0A 1W1PA 4H6KA 1P6CA 4FIQA 4F0SA 3QFBA 1CT5A 1TMQA 4L61A 3K13A 2NX3A 5FA5A 3BH4A 3H7RA 1EIBA 4MNMA 2OR2A 3G24A 2INFA 5G1TA 3UWQA 2R14A 4V1YA 2CDUA 1SZNA 3NL3A 1RJPA 4GKLA 2E5DA 1ZSXA 7A3HA 1FWEC 4JTAA 4UFHA 3PZQA 1SZEA 4YTQA 3HPAA 4ACYA 5BW6A 1FA2A 2WWCA 3EB4A 3ZSSA 3FDKA 5G5GB 3H53A 5REQB 2DZSA 5D9MA 3M1ZA 1YKWA 3RPDA 1BXNA 3RJXA 4B2DD 3ARRA 5M5DA 1KRCC 3SCNA 3M6DA 4LFYA 4MB5A 3IWPA 1XHCA 5K4XA 3N04A 4CN1A 2XIMA 2RFGA 5AYYA 3UNTA 5I24A 5CZJA 5C9UA 1XCXA 4W7VA 2E6FA 4MUZA 1UBSA 4O8RA 3PANA 1ICQA 2E40A 3OP2A 1IIGA 3BWWA 1GZGA 3GR7A 3SCTA 4QE1A 1TWIA 3HRDC 1E5NA 1E9LA 3W9ZA 1DJWA 4M1RA 4Y8FA 4U3CA 1OEPA 3T1GA 1UR9A 4WRHA 3W88A 2EQDA 4Q8TA 2YBVA 3HFTA 2W4XA 3TEVA 3QHMA 4AIOA 3P82A 2ZRXA 3DK4A 2PAJA 3UNDA 3S1GA 5D4YA 1XISA 3FKKA 1A3WA 2GUYA 3AMLA 3EXRA 2X0HA 4I5RA 3AHVA 3W28A 1I2RA 3L5MA 4FALA 4FK9A 2C1HA 3OPSA 4JTQA 2OEMA 1ME9A 4PTXA 5FS6A 5HDRA 4O10A 3TE9A 2GGJA 4C6LA 2PP3A 1M03A 3R12A 1W1B1 5C9RA 1I0BA 1DTNA 2QDGA 2F5ZA 5CZ0A 3AS2A 4ZZ9A 3W7IA 4H7ZA 3IVUA 8RUCA 1XWYA 2WZHA 4Y7EA 1KTCA 4XIMA 4H9YA 4EOUA 2Y5JA 4Y2WA 4Z1CA 3LI1A 4AG0A 1K8CA 3CXOA 4C6IA 3OLGA 1B57A 2BY3A 3A3WA 4BF7A 3E0LA 3M5XA 4PCPA 2RDXA 1DBTA 1OQFA 3QV8A 5HINA 1PX8A 2YZRA 3WLIA 4H9MA 1SO4A 2V5LA 4JTHA 3LRMA 1KBJA 2PDGA 4GBDA 7XIMA 4WOZA 4ZOCA 4QXIA 2GQ8A 1GPWA 2P8CA 1FEBA 4IM4A 3AZRA 1UH2A 4JFTA 4LS1A 2QW5A 2JGQA 3LGDA 1IIHA 3HJZA 3UP8A 3QPZA 1B31A 3VI2A 5J8LA 4ASTA 1NF7A 3URQA 4MY8A 3WD4A 1X98A 2L5HA 4DIAA 1G67A 1PHQA 3ANYA 4XISA 5E93A 4BFAA 4YPJA 4UR9A 5HBFA 3W4RA 1BD0A 2PMQA 3BOXA 3TK7A 4AVOA 4MOZA 3KL3A 1FWSA 3TLQA 2NV9A 5FCZA 4C5ZA 4GXPA 2BVDA 3NQ2A 2ANUA 3KS6A 2CKSA 1K4GA 2C18A 3NQFA 3BG5A 5IOBA 2HISA 3EDJA 3VUPA 3MI6A 1XINA 2ZE0A 1V7YA 2QMJA 4QP0A 1JNEA 3VZXA 2G3MA 2ZVRA 4ZA0A 1DYSA 1CZ1A 1AZ2A 4BCEA 1VJSA 2YAUA 1OGBA 3DUGA 4KT2A 5FJIA 3VX0A 2BY1A 3VE7A 2IKJA 2OQLA 5CGTA 1TJ1A 3VIOA 1LRQA 4WXYA 1QHPA 2RGMA 3CTTA 1K7FA 2GGIA 3G3MA 4O1BA 1WDPA 3GKFA 3FYOA 1KR1A 2QIWA 2REQB 4HA0A 2D0HA 3KP1A 1B3VA 1GG0A 3H7UA 2BXZA 2BY2A 4R27A 4DI9A 2E6YA 3MA8A 3M41A 1FUYA 3STFA 1FWWA 4GQBA 3VDHA 1IZCA 1V0NA 1QO5A 5BXRA 3CB3A 3Q67A 1F2JA 3P93A 1XP3A 4GYJA 2Y7EA 1ZBVA 1JGIA 1RLCL 4LNCA 4XVEA 5EBUA 2VGGA 3M0ZA 3V1PA 1OGGA 3U0HA 2C16A 4I3GA 4V2XA 1HX0A 3S3GA 5JH1A 5ABEA 2R24A 1XIJA 5XIMA 1VFLA 1FH8A 2DGAA 4QS5A 3DDMA 3W23A 1E55A 3W27A 3MHGA 4QQ3A 3KOYA 4GUGA 3FA5A 2WP6A 5D05A 2D2HA 4K8GA 2TPSA 5LNUA 2VWTA 2G41A 1XC4A 4NEWA 2ASHA 1J2WA 3N2BA 2FHCA 2J27A 4LBSA 3SY8A 1OC7A 5F4XA 2POZA 2QCFA 3VIIA 1BWLA 3O0FA 1GTHA 2IW0A 3OHMB 3A4XA 1Z48A 2PBGA 1LLOA 1CDGA 4DJDD 4LEQA 4UTIA 3WJXA 1Q3NA 3DU0A 3WZ0E 4G7EA 2E25A 4GACA 2WM1A 3WD1A 1LJYA 4H41A 1A5AA 2P0IA 4ZFMA 2GRTA 3NVYB 3WNKA 1LL6A 4AEFA 1U5HA 1O1ZA 3HGRA 1KRMA 1M5WA 2VP8A 2ZXAA 4CD6A 4W86A 5DMMA 1Q6OA 4IQJA 2ACSA 4GVGA 3V0SA 3MS8A 3C56A 1AK5A 1Q2SA 4LBRA 3QR1A 3GHSA 2PD5A 3WD2A 1V79A 1ZUAX 2AOSA 1ISWA 1QAPA 3IJLA 3OIXA 4JEQA 5A6TC 1DWGM 1RPKA 4TX6A 1WE5A 1VIWA 3FHAA 2GJRA 2CZ5A 2ZRWA 4K2SA 2A8XA 1TIMA 1QOXA 3IJDA 3KDNA 3ONCA 2NT0A 1YIXA 3W24A 3XINA 4DBWA 3JRKA 5EMLA 2OT0A 3GDKA 2CXEA 2QGHA 1T3QC 3REQA 2ALRA 4CNSA 2PEVA 3I6EA 5JCKA 4C6PA 1G5AA 1Q66A 3GZ3A 3L7RA 4CN4A 1ONRA 4ML4A 1XIEA 3K8KA 1W1IE 4NL1A 3IJIA 4PCNA 3WFZA 3RO8A 3I7SA 4M8UA 1E6XM 3VINA 2QUUA 1HTIA 2PDHA 1VR6A 1A5NC 1XDJA 4E2BA 1KXVA 1OK6A 1KXHA 3W75A 5EMUA 3NQVA 4LYRA 4OJYA 2BZNA 1NWRA 1DL3A 1ZP4A 3WCZA 1JF5A 1T41A 2BVWA 4C1NB 5G4HC 3M0KA 2IPGA 2XH7A 4IZGA 3PULA 1UKOA 5H8UA 3NQ6A 3MBDA 1ELSA 2GQ9A 1NDAA 3SFWA 4GNVA 2DSKA 4H4TA 4GJ1A 1WA3A 3AIRA 3EOUA 3FJNA 1BTMA 3R79A 2XIIA 1DQUA 4YTTA 2VD9A 2GWGA 4A3HA 5C5YA 2GVLA 2DY3A 4JTCA 3IJ7A 4YLWA 4PMZA 3ZLFA 5LIXX 3MV11 5ABGA 1C91A 3KUMA 5DLCA 1UR0A 4ALDA 4WK9A 1K7XA 4GD0A 3BOLA 4R7JA 4YIWA 4OTKA 5FJPA 3CK5A 4MIMA 2FYMA 3CQ0A 3U5YA 3SBFA 2W79A 3WH6A 2PURA 3ZT7A 3RPMA 1OSEA 1SPQA 2NQLA 3DECA 2YCEA 1Z44A 2HBVA 4H6RA 5M3WA 4GOAA 3DHFA 3NAVA 1TR9A 4K38A 1FHDA 2TSYA 2ZOXA 2DVUA 2BTMA 1E51A 1NDWA 1S2TA 4NU7A 1Y7VA 2WO5A 3H12A 4Q8VA 3FOKA 3W7NA 1XLEA 4Q4OA 1MI3A 2QXWA 3O63A 1LG2A 4L5ZA 5I07A 1H2IA 2FZ8A 4B91A 3OGVA 1IR2A 2VRKA 2QAFA 4MHBA 3UWEA 4UMCA 2EQ9A 2J8GA 3OOQA 2GJXB 3KZSA 4BJHA 2XFWA 4RK8A 4WDWA 3BLFA 3VILA 2BXVA 4L56A 4NF7A 4RPPA 3WMBA 4QEHA 1SZFA 1DV7A 3S1UA 2YZ5A 1ZJBA 1M7OA 3CJPA 1GJWA 1GREA 3SCPA 2ZZ1A 5LXXA 5IDZA 3PG8A 4KEZA 4OBSA 2W61A 3PTQA 3RMEA 4MYXA 4FOUA 3R13A 3UXLA 1C93A 2WBKA 2XVLA 3LPOA 2PZ0A 1XLFA 4E2DA 3D5HA 1BG4A 2VC9A 1BF6A 3FSTA 4MTVA 1M68A 4L80A 2VHLA 1UD2A 4TO8A 2BOEX 1LROA 3H4XA 1BVZA 3QBUA 2YPIA 3DOPA 3ZYZA 3CPGA 3DYMA 2V30A 1K9TA 4QITA 2EF9A 5FEWA 5D9OA 2VC7A 3CV6A 5E9AA 1JCTA 4A3RA 2J75A 4DF0A 4LQ1A 4D2JA 3MI3A 5C7HA 3RYSA 1K9FA 3W2UA 5A6BA 3PF3A 1M6JA 1X1NA 3FK4A 3QGVA 2CCRA 4AMCA 1E4IA 1W31A 1S2AA 1A0EA 4IP5A 3TCSA 1V93A 3B03A 3AISA 1VS1A 4MLJA 3UJRA 2I14A 4H2CA 3CPRA 4HHHA 5DFAA 3HN3A 4WQ6A 3EWXA 4EM4A 1R9ZA 4NNAA 3W2LA 4HSHA 3AXIA 1W3TA 2FDSA 3LADA 1X8CA 3OA5A 4N9CA 4PMJA 1YADA 3EMZA 3FGCB 4O13A 1NFBA 1H61A 2Z24A 1N61C 4JTRA 5FS8A 3CV2A 5LKYA 7PTDA 3LHUA 2BP1A 2E6DA 1BWVA 3O7UA 1T8QA 2I7GA 2TRSA 3UU0A 2Y8KA 3MCOA 4ADWA 2WNQA 3KLKA 1SMAA 3TFXA 4IG2A 3WLLA 1MW0A 4NJIA 3KZPA 1XLMA 3THAA 3WQVA 3G18A 1RA0A 3SW6A 4L65A 5CKSA 1LF1A 3LTSA 1CLVA 1WCGA 3U9IA 3WF4A 1GYLA 2AAQA 3RG6A 2HE8A 3W7PA 3SCUA 5JMUA 3VOJA 2X8GA 5FS7A 2R1MA 5LZLA 3UG3A 3DJJA 1FRBA 3EX3A 1B9ZA 5BOFA 1H4PA 4OOZA 4M6UA 1H3GA 3M0VA 3A13A 1JDCA 3N25A 1QWKA 3SQPA 2V68A 4OUIA 1CENA 4O28A 5IBXA 5FEXA 4UNLA 4YXGA 3R43A 2GLKA 2X09A 1JZ2A 2JF6A 4JYDA 4AY7A 1JD7A 4QG6A 4GFIA 1R6WA 1NOUA 4D6FA 5TR3A 4ORIA 3K8LA 4WJ8A 3IK4A 4B90A 1ZY9A 2O92A 2DT2A 4LA1A 3UCQA 4Y9OA 3FDGA 3UVIA 3KHJA 1J0YA 3EAUA 2A3EA 3E02A 2J25A 3BARA 4H2HA 4BK9A 1P43A 1UQZA 1ZP3A 3WK1A 1RALA 3UCCA 1EUNA 1XC6A 1JRCA 2WMHA 4QE5A 1J6OA 3LV6A 4AHPA 3V18A 3WD0A 2FB3A 3K30A 1IEIA 1OX4B 2E9MA 4UOZA 2FPVA 4ZFCA 2GUUA 3RCYA 1UR3M 4REQA 1OYCA 1GEHA 1QNQA 1OJTA 4XAPA 1TA3A 1R86A 1TR1A 4HK5A 2VFIA 3S83A 3E5BA 3BG3A 3CAQA 3LCGA 3GVGA 1TZ7A 1GKPA 3IIPA 3TP4A 2VEFA 3HJEA 3FX4A 3B97A 4FNSA 3GHUA 4Y9PA 3A3HA 2YCLB 5CC5A 1OD8A 1OB0A 4RW3A 4MWAE 1OWQA 4ZOBA 4ADUA 2UV8G 2W3SA 1W1VA 3KRSA 1WP6A 5I3DA 1H09A 1KM6A 3VZZA 1ZFJA 1CGYA 4OWGA 1UC5A 4OBTA 1O94A 3F03K 4EMJA 1F4HA 5LGZA 3L67A 1JXKA 3BLOA 1R3YA 2X05A 2WKLA 1VZWA 1C8YA 1LRTA 1PX4A 4OKDA 2PDWA 5KSWA 5AC7A 4NEVA 3THUA 1JDDA 4AZCB 2BHUA 3DKLA 5E1QA 1BXBA 1LTDA 5G5IA 3CV1A 2E8YA 3R2GA 3W2NA 1UWTA 2WXDM 4J5NA 3UJSA 4J7RA 3WH5A 4PFMA 1THFD 1PDYA 2BC1A 2ODOA 1RQHA 5C7VA 1CPUA 4RL3A 1W1TA 5AC8A 2VX7A 1DJZA 1PTDA 3GFYA 1FH7A 4H4IA 5EBAA 1TRIA 3T8LA 4JIIX 4Y6GA 3VUSA 2J7EA 3KBSA 4XX6A 3QMSA 4GX9A 4HCDA 5EPDA 4GIYA 4RE0A 3SN1A 2EQ7A 1EGZA 1A4MA 3THDA 3SO7A 2I5QA 5CPSA 3APGA 2OB3A 2GSHA 4KETA 1V6WA 4H01A 1BXCA 3II1A 3OU8A 4QGCA 5FKYA 2P3ZA 4EIVA 1SJAA 3O6AA 2DSVA 3GC5A 4LY4A 2PLJA 2DJXA 3UWUA 1X6NA 2DZAA 2UWFA 4E4FA 3VMNA 5I78A 2EBNA 1FKWA 1N5XA 1E6SM 1VH7A 1EP3A 3DFPA 3V16A 1PHWA 4HZMA 3RF9A 2VDGA 3L12A 1LQ0A 1MNZA 2JEPA 3Q65A 3CO4A 2WAGA 1LLZA 2PDMA 3CO8A 4N02A 5TIMA 3R7MA 4LNYA 5KITA 1OFRA 3L8KA 3WK2A 2D2GA 2NXGA 3R25A 2FB2A 3NZ1A 4R9XA 1LZOA 4WSJA 1U5VA 2Z2BA 1KFLA 2EHHA 5RUBA 2YXOA 4ZO6A 4L9ZA 3TMLA 3CC1A 2XPKA 3ITXA 1A5CA 4H50A 4NAEB 1ZAJA 1BQGA 2FH6A 1QI5A 1TB3A 1JG9A 2A5HA 1JXJA 3KOXA 5IXEA 1FCBA 4TXEA 4HU4A 2TPRA 3I3EA 3VKBA 1PPIA 1UC4A 4YVVA 2Y8VA 3URNA 3IVTA 3TX9A 4UOJA 1EBHA 5EKYA 1ZK7A 1WBJA 2UZ9A 1DIOA 4MNJA 3QMRA 1XLLA 3G2GA 5FJRA 4C90A 1VB9A 4D8LA 2QT3A 1RCXB 3VK5A 3WMLA 3VKKA 4QCFA 4UTTA 1TSIA 4QQUA 1FDYA 2QUNA 4IMGA 1J6PA 3N15A 2A1YA 3WLPA 3PK7A 3JS3A 4DUOA 1T8XA 4JDYA 4LYQA 4JIHA 3EPOA 4GYFA 1K9DA 2DFAA 4IMDA 4NHVA 1H1YA 4EXAA 1QPNA 5BOEA 3AYRA 4NZ1A 4RZ5A 3AXHA 4HA3A 3N4AA 2PWFA 1QDSA 5JXQA 3UWVA 4I6VA 4Z1BA 2Z7KA 1R7AA 3LHVA 3S2LA 4HSOA 1H0IA 2Z1VA 3URAA 1KGWA 4FNQA 2X42A 5AOUA 2QJJA 4ADTA 2J9YA 3WF2A 2VJXA 4ES4A 3WQOA 4QM1A 3DBNA 5D09A 5FS9A 3W1AA 2JQXA 3VNJA 1NOFA 1QO2A 1Q63A 2J66A 3UVAA 2OWCA 1KV8A 5HJLA 3OYXA 4CD8A 2LLEA 2UY5A 3U3HA 3VD5A 3V35A 2ZXBA 1FDJA 5J5RA 5JUVA 5A8PA 5D33A 4APNA 4O4WA 3BLDA 1S46A 4S2CA 3NL5A 1A3HA 1XLBA 2WC7A 3LXDA 3W7MA 1TYTA 2PDJA 3DENA 1FWGC 5A8QA 5LIUX 1V6YA 4UZSA 1XH2A 5C9WA 3PN8A 3U57A 1RCOB 4O19A 2OYKA 4ATWA 5FSDC 3L66A 3SSZA 5K3VA 3E38A 1TRDA 3BCFA 2RUSA 3QYQA 2CFFA 3HURA 2V3EA 3S9IA 1TIWA 5BROA 5ECVA 1XR2A 1P7TB 2A7RA 4FNPA 2EAWA 3N12A 2FHFA 2W0HA 2YYTA 4ROPA 2E0PA 1EBDA 1PB0A 2DQWA 2BS9A 4S2BA 2FFCA 1KCLA 1F5ZA 2Y5EA 5HNRA 1Z3NA 4MZ1A 1GW9A 4WF7A 3VCCA 4CLMA 4HMNA 3PS7A 4KEMA 2I1OA 4G1NA 5BXTA 5FEPA 3S4TA 4WY0F 5C54A 3NZPA 2W9MA 1A5SA 3L5AA 3BZGA 3IUHA 1QMLA 3UYIA 4I5UA 1Q4NX 2BC0A 3G1YA 4ZGYA 1H49A 1VPQA 1E4NA 4O57A 3PUDA 3T0TA 1KLZA 1TPB1 3B0XA 4LF1A 4QTGA 5EA9A 3PSWA 1ISZA 1TWWA 1GQJA 2WSRA 1J0ZA 1XX1A 3E2RA 1NU5A 3S47A 1YW1A 2XIQA 1CXIA 2AAAA 1TPEA 3VA8A 1ONFA 5U4NA 3WQWA 1OCNA 4Q3MA 2X7WA 1GVIA 3BCJA 4YVPA 4O1FA 4AH7A 1O12A 4F2UA 1WYIA 2Z25A 1JL8A 1KKRA 1U30A 1KN0A 3CMGA 4OGZA 3SGUA 1WX0A 4WY0B 3F5KA 5AC5A 1QHOA 2OCZA 3AIEA 3STEA 4V28A 4FOJA 1XLHA 1KXTA 2FMNA 3NL2A 3PPCA 4JNZA 5AN7A 1ZBCA 3LX9A 5CSYA 1NH6A 1IGSA 4JPGA 3GZAA 4NAFB 1TWSA 4PTDA 1SVDA 1XYMA 4EAYA 2WPCA 1GVYA 2D3NA 1WDDA 3TYCA 4F0HA 4ZR8A 4ROQA 4ZOHB 5A6BD 3CQJA 3L0GA 2AQVA 3FFSA 4PUUA 4DYEA 4KFPA 4GLEA 1JNDA 5A6SA 3FW6A 2F84A 3VCRA 3W1RA 4PC8A 1XICA 4K68A 1JJKA 2G8ZA 4TR9A 2HXTA 1CB7B 1UCWA 2GL5A 3T81A 4O50A 1QHZA 2BX7A 4J9JA 4DBDA 2PWDA 3QVQA 5KEZA 4EPKA 1FHVA 1F8MA 1PVNA 2DEPA 4WR3A 3QKZA 5FL1A 5H8MA 2QF8A 3L4WA 2OGYA 2CBJA 4B4FA 1E40A 1R3VA 2QPXA 2PGFA 1I1XA 4OBRA 3W02A 3IAQA 4W87A 3PBMA 2OZ0A 3VD4A 3GB6A 1SO6A 1KBLA 3OTRA 2PP0A 1TVPA 4LJ3A 4KCTA 1UPMB 1AJ2A 3L4YA 1SJCA 2P88A 2XVKA 4L9YA 5IBXC 3T0BA 5A8OA 2Q8LA 3PJTA 5BNKA 3VGHA 2J7FA 2VC6A 4M19A 3NWRA 2X1IA 2YL5A 4ONVA 1EHAA 2V38A 1FWHC 1KFEA 4RKAA 1RP9A 7REQA 4YWOA 5CH9A 3T09A 3EDDA 7CGTA 2G96A 2E68A 1XW8A 1H7PA 1KWGA 1V0KA 4HZ8A 4R7WA 1QATA 2BB0A 1LLWA 3SN4A 2J6VA 1HVXA 1UR8A 1K8ZA 1YDOA 1RR2A 3BQ6A 3UCDA 4GK8A 2ZZ0A 3U7BA 2GR2A 1KW1A 4MY1A 2VFFA 4C6CA 1H7RA 4AD1A 4JIEA 1VFUA 1A5UA 2GVYA 1NEYA 1EJWC 1EXBA 5E0CA 5TBOA 6ALDA 2WPBA 1LG1A 3BOFA 2HMCA 5CSRA 3EWDA 3QLDA 1FWAC 4EXBA 2PDIA 4NJHA 4JN6A 2W92A 2OSYA 1TQJA 3FHQA 3WQ5A 3QH2A 1XI3A 3C0SA 3MSGA 4WVXA 2WPEA 1PCKA 4KESA 3UY8A 3EX6A 3JR2A 1JR1A 4QAIA 2W3RA 4S3FA 5F1UA 4AZIA 1LVLA 1W1A1 4NRRA 1EYEA 3P0WA 1Q6QA 1FBAA 1E4MM 4RV8A 4PTMA 3GG1A 2FGLA 1U2YA 3W6YA 3R0KA 3RR4A 3O3RA 2ICSA 4E8CA 4ZB5A 5BZAA 4JZ5A 2GJPA 2NVCA 3RR1A 4YMZA 3GXPA 5IFPA 5HOSA 2OEKA 2VX4A 3S2CA 4S3GA 3CUXA 1M6IA 4Q32A 2WOQA 4EPDC 4CNPA 4H9XA 3CUFA 1ZHAA 4GCAA 3EWZA 1H7NA 3MKVA 2Z1SA 1F05A 1NQ6A 1PEZA 4TX9A 4EANA 2HDJA 4A2SA 2IKHA 3V75A 1RM6B 1XHGA 4JTUA 4ZB0A 1QI4A 3R1ZA 1TG7A 1J9YA 3WK3A 1XG3A 1W8GA 1DIKA 2J9XA 1DXIA 1XYCA 5J04A 3CGDA 2F2HA 1EQCA 3SUSA 4WHBA 3VKJA 4IP7A 2FQIA 4W5ZA 4ZODA 3GYCA 1LBLA 1JEHA 2DZBA 1HT6A 3GD6A 3O9NA 4K37A 3IGUA 5AYXA 1XRFA 5I77A 2Z27A 3L65A 2OVLA 3W2JA 3APYA 3IACA 4XKYB 4E8GA 5LNSA 2B31A 2ZXQA 3WQEA 3ZVIA 5K2ZA 4ZO9A 4TQTA 4PMYA 3NPXA 1W91A 1SW0A 2VZTA 2HVNA 3LG3A 2CIPA 3E3HA 1E43A 2CESA 2C3CA 2WCGA 3VNLA 2WLZA 4DELA 3LHZA 1O60A 1TYPA 4AB4A 4AEOA 3ABZA 5JCMA 2DV0A 3WQ4A 1MQRA 3H4WA 2DVTA 3WLKX 3BLLA 4LVFA 5H6HA 4TX8A 1W3NA 4KPLA 3EKLA 2F7FA 3W1XA 1C8QA 3V5OA 4EPBC 3DH7A 1UD3A 1FWIC 3HBLA 2E3ZA 3XIMA 6TIMA 4LC8A 1V3HA 3TQPA 3RLHA 3M5YA 2Q8ZA 3WEOA 3V5CA 3N19B 3EANA 2ISWA 2QEZA 1V77A 4MJ4A 3A24A 1XRTA 1T96A 1SFLA 1AD4A 4O15A 1NHPA 3BGAA 2AKMA 4HMCA 5LNVA 4PMDA 4US5A 3KOZA 4LU0A 4GKTA 2DIJA 3QTPA 3QTGA 3WLQA 1JRPA 1BFNA 3GDMA 1E6QM 1R9YA 3VCNA 5JRBA 3M43A 4YL2A 1DOSA 3GNRA 2NQJA 2W5FA 1LT7A 1G0CA 3UGRA 1Z89A 3A4AA 1KLYA 2G4JA 1LT8A 1XD1A 3ITCA 1I2OA 1IEXA 2C3DA 3GR4A 1TJPA 3OBAA 3HQ1A 1ME8A 4AWUA 3EOOA 3W2MA 4UTTC 3QFEA 4MSSA 4UZUA 3W00A 5FAJA 1YMYA 1KXQA 1OZQA 1HW6A 3RJYA 1EHNA 1ICSA 1TJ2A 4I90A 3B9EA 2A3AA 3P62A 4GO8A 3KL5A 3CAKA 3ZXWA 1BPLB 3MSRA 2VOMA 4FAMA 2RKXA 2W67A 4J4KA 4F4RA 3T0CA 4DYKA 4MF4A 1NHRA 3MYPA 2HROA 3MQTA 3WJSA 3T8QA 1PS9A 2P3EA 1YHTA 4EWND 1RJRA 2FJUB 1XLDA 4NJGA 3MHFA 2CBUA 1AQHA 4K7ZA 3RFAA 4WIWA 3KS5A 4UFJA 1VHCA 5ABTA 4PB4A 1TCDA 3EX2A 1TQXA 1FFQA 5TD4A 2RAGA 3UR8A 4S23A 4LY8A 4AQLA 5EGRA 3OLDA 2INZA 2PDUA 1I2NA 5LGXA 2G95A 2Z7GA 3AIUA 3NJ3A 3UR7A 1PL9A 3LY0A 2VX6A 3VTRA 2I5GA 4IUGA 2YB4A 3RDKA 3VD3A 3NSMA 2NXHA 3OVGA 3PTMA 4YYCA 1U1UA 2DPEA 4JN7A 4AXKA 3I6RA 3Q6JA 2HEJA 3BANA 2CHNA 4QDWA 3SUUA 3UXDA 4ZO8A 3UEQA 1ISXA 5HMSA 3N34A 3GU1A 3AUJA 3KCJA 3UWYA 3LPPA 1H5VA 2FIQA 5KZDA 1X97A 3GYEA 1BZLA 2CZEA 2O0TA 2ZIDA 3R4IA 4RZ6A 1MUWA 4DI8A 1ZBKA 2FH8A 3RX3A 3MHUA 3FEMA 4LAUA 2WM0A 2NWRA 1RZMA 1SW7A 3CZKA 4JCMA 4TMCA 4W84A 2VCAA 3ANVA 3BAJA 2ZA3A 1R2SA 2YB1A 2YW3A 1JULA 3VM7A 3P61A 4FX7A 4IISA 3WUEA 2WMFA 3EA3A 4B5UA 2OT1A 1E0TA 1UP3A 4H1ZA 1I0DA 3VC6A 3GHTA 3O6DA 4DEFA 4EKJA 1EGVA 1O5QA 1O5RA 3NQCA 1B2YA 3LERA 4FDCB 5CBJA 4Y9AA 3B8SA 4HPJA 3RM9A 1N63C 1QPKA 1ALDA 4K6AA 1BGGA 4NZ3A 3QHNA 4W5UA 2I5IA 3W29A 2WBGA 3HPZA 3OYZA 3HZ3A 1Z6KA 1A50A 4L7ZA 6REQB 2YL9A 4K8HA 2VI0A 3T78A 1R46A 1M7PA 1ZY8A 4W7UA 3GU2A 4A3QA 2QNEA 3ZJ8A 2AGKA 1J0IA 3GU9A 3ETRB 5TQLA 3HV9A 3RXZA 3TFCA 1A4LA 2ISSA 2ZX9A 2J7GA 1Z69A 3ABSA 1H5YA 3LMYA 3EX1A 1ZJAA 3SUVA 1UWSA 3I4EA 3ABRA 2WHMA 5G5HB 3B4UA 1VQZA 4PYSA 2W0UA 1VP5A 3M0MA 2JKEA 4EQXA 3AIBA 3UG4A 4V15A 3V0TA 5D8WA 4C6NA 3VKDA 5BXPA 4L4LA 1F3XA 2NQHA 1MXGA 4EACA 5L9FA 1IT7A 1VQTA 4XAGA 4GINA 1CXEA 3WNNA 4ZMGA 4MLRA 1MW1A 3WY1A 2V5JA 4LCQA 1RVKA 2H90A 4Q7NA 3RHGA 3E0IA 3N3MA 1UPPA 3VFCA 3UZYA 2IMRA 1HJSA 1VFTA 1EB3A 1W9VA 3R94A 1GVFA 2ZX5A 4QJ3B 3O2LA 1SQ7A 1TJRA 4PMXA 3CIVA 5BYWA 2Z1KA 1Q65A 4HOXA 2QULA 5J5DA 1YXYA 3GE7A 4KEUA 3L2MA 2X1TA 3CUGA 1Y65A 2NXIA 3FA4A 4BV6A 2NW0A 3HG5A 2J88A 5CG0A 3R8RA 3CT2A 1CXKA 1W8SA 1NDVA 1K4QA 4IPIA 5F4SA 4FS9A 3LN3A 4DAFA 5FEZA 3ZR5A 1UKSA 2CERA 2WVVB 2UBPC 3BMVA 4HNLA 5A5WA 2JBMA 3ZOAA 1X39A 3DG3A 1NFGA 1OX5A 3SADA 4UQCA 3V1HA 4UTMA 2YDAA 1A0CA 1N82A 3B9AA 1JZ8A 1B9BA 4KKXA 3CHEA 4FNTA 2DSWA 2DUXA 5CLWA 2QQ6A 3DYPA 1R38A 3CUJA 1VCVA 4LPCA 2XHYA 4LVBA 2Y63A 1JFXA 3LGEA 4K7VA 3MTWA 2VUYA 2HZGA 3QZAA 3LRLA 2VMFA 3CQHA 2QR6A 2REQA 4XBSA 3P8IA 2JFEX 4N0RA 3EOSA 4PTNA 4C6QA 2AKZA 3PZTA 2AL2B 4GXMA 4R9OA 1XYZA 2EPLX 4JFWA 4JHMA 2DZXA 3WNPA 2EEXA 1OD0A 1ME7A 2F61A 5ABFB 4NYYA 5A2BA 3GBEA 4JYEA 3RLGA 3AMGA 1JQXA 4MWAA 3AIWA 3IRDA 3BPWA 4XD6A 3A7AA 1GOMA 2FDMA 2FTYA 4N4PA 4RDVA 1H50A 4S3JA 3F4WA 3PM6A 3MKCA 4CKQA 3A4WA 4QJ4B 1JAEA 1GVRA 1GHRA 4P8VA 4MG4A 2YBUA 4B4HA 4DO7A 4A8IA 1F6KA 2GK1A 2Q02A 5AVHA 4JS3A 1UZ1A 2DP3A 2PWVA 5IDIA 2VEGA 2WHLA 2QLYA 2CLLA 4B16A 1QW8A 1UJQA 3B4YA 1BYAA 1O66A 2XIOA 4HZ7A 1KGUA 3QY7A 1STZA 2J24A 5EY5A 4XSMA 3WNOA 2WJFA 2P76A 3WL1A 4XG1A 1FTXA 1Z42A 1TE1A 3LYEA 3DGBA 2NQ9A 4MAZA 3GXNA 4EMWA 4C7DA 4HK7A 2Q71A 3FEQA 3L4ZA 1GNXA 4X9YA 3BW4A 4LUSA 4FXJA 3LGGA 4H00A 4PCSA 1I2PA 2PDQA 4NZ5A 1BF2A 1JOAA 1S1PA 5KZMA 2ZA1A 3MW7A 1HL8A 3SGGA 3UY7A 3GAKA 1LQ2A 3K8MA 2PWUA 1UIPA 1OCQA 1MNSA 4PMVA 4HYWA 3M0YA 4E4PA 1FWNA 1XYAA 2BSLA 3AXKA 1AL7A 1AFSA 4IGMA 4FXFA 3M07A 5D32A 2B7QA 1JZ4A 3TN4A 3UPMA 3IJ9A 1QI0A 3MDWA 4B2DA 4LT9A 1P0EA 5IHRA 1L2UA 3KTSA 1N55A 8A3HA 2Z26A 2CZFA 2QDEA 3PBYA 3G22A 2WVUA 2NUXA 1UQYA 1GETA 1ZALA 1P1MA 2X8RA 2NSOA 3O6CA 4G56A 3RNDA 1XYFA 3PBUA 4HTYA 3B8TA 2ISDA 2D69A 4BURA 4Q7IA 4OFCA 2YCKX 2ZUSA 4G2DA 4DPPA 4OIFA 4F79A 4QS6A 2ACQA 4LOCA 1EEPA 1YXCA 1J0KA 2V81A 1EJSC 3Q2DA 1UWAA 5B80A 4Q4MA 3GFZA 1TE6A 2PU1A 3VYLA 3EUB3 5E70A 2TMDA 3RO6A 3AC0A 1A47A 4Q4SA 2IPJA 4PRWA 3CH9A 2INEA 2OSWA 4AC1X 4IPPA 5CC3A 1MZRA 1XLCA 3PZNA 1NF0A 5DX7A 3USBA 2CWXA 4JICA 4YCPA 3FS2A 4US5D 3GSMA 3TH6A 1N2VA 2ZTKA 4R53A 2WKJA 1H63A 3HA1A 3QPYA 2YQUA 1GG1A 1NTHA 2C6QA 3NVZB 5G2WA 3NSNA 4PCTA 3I10A 3KEHA 3VGGA 1S5MA 3UERA 2F6UA 1WV2A 4FA3A 1BSIA 2NSXA 1MW2A 3P0XA 4C6MA 1JROA 4G6CA 3DGHA 3V36A 1IEWA 3P7YA 4L4PA 4QFUA 3C4UA 5HUOA 3W72A 4JFSA 2PWHA 4S3DA 1V03A 5JBDA 4Q4PA 1YPIA 2D2JA 1FFUC 1KV5A 4FLSA 3GD4A 5F2IA 1CLKA 2Z1BA 2AQWA 4PL1A 1ODZA 3UJFA 2QUMA 4JTFA 1HJUA 4US6A 1O5XA 4L4OA 1JDAA 1YRRA 3GLCA 1FWCC 3PWGA 4MFEA 1WDQA 2Z00A 3S1WA 1SFTA 4NZ4A 2H9AB 3AXMA 2PTZA 1JPIA 4HPGA 1AQ0A 5A2CA 3NQEA 4UQBA 3TW7A 1CEOA 3W7LA 3T40A 2GR0A 2WMIA 2PLCA 1SYTA 2IXVA 2ADAA 3WLMA 4XD5A 2PDYA 2QPUA 4M81A 2Q8XA 4A22A 4HK6A 4AIEA 3O16A 3KRZA 4UFIA 1GRGA 3L5OA 1KGXA 3W7JA 3PZUA 2Y88A 2DSUA 5C0QA 1GQLA 3GW0A 1SO5A 1VEOA 3AMKA 4P8XA 3WX7A 5A8NA 5HJXA 3LNPA 5CZTA 3ARVA 4GYKA 1VAHA 2TODA 5FF4A 4DN1A 3FG2P 3TXVA 1ZZMA 2AMGA 4I9TA 1JRBA 3KVJA 2XN0A 3BLPX 4W8LA 4O4VA 2YDSA 4K1WA 5I3IA 2HNHA 4PRTA 1K9EA 3O0KA 3W7KA 2GWNA 1K8YA 3LD5A 4XD4A 2E8ZA 3JUGA 4WOQA 3II4A 1AG1O 3IEBA 1YYAA 3A4JA 4LB3A 4DM1A 4ZSUA 4LC6A 5DXXA 3LCIA 2VFHA 4F0MA 1E6NA 1AD1A 4J3XA 5I79A 4CU6A 3HQNA 2FGZA 4M56A 4MMWA 4D6DA 4ZTXA 3CGEA 4M6QA 1SUXA 3BW3A 4O17A 1POJA 4NZJA 1HKVA 5JCNA 3BLKA 2O4QA 4XO6A 1W6TA 3FN9A 4C6FA 4YJ5A 1UZDA 3E0WA 4UFMA 4MPQA 4J27A 3B8VA 1NELA 2PDLA 3B8IA 5EYWA 1V6VA 2B7PA 2P10A 4GE8A 1MFVA 3S46A 4FIRA 1I8JA 2UY3A 3KDOA 1H2JA 1DHKA 2C7FA 4DWDA 4KWOA 4PMNA 4JHZA 3E2QA 4HYVA 1Q6RA 4Q4RA 3TTYA 3ZVHA 4MB4A 2GJNA 1XL9A 3LPGA 1W2VA 1Q2RA 5T26A 1PO9A 1MMFA 2E6AA 1UROA 3M64A 3KOFA 3NZGA 4U5IA 2IPWA 1EEXA 2Y24A 2G3JA 1G7UA 5SWUA 2O9RA 3NQMA 5D2XA 2D20A 2GOUA 2PCQA 5AECA 1HVQA 4A21A 2E4TA 3GY1A 3VXGA 1TV3A 4QLJA 2GVEA 2VM8A 3D6NA 1PYMA 1J11A 2XUCA 1J93A 1CGXA 1LM1A 4Z1AA 1K02A 1LRNA 1XANA 4ERIA 4P7RA 4Z2KA 3RN6A 1IR1A 1VFSA 1E15A 3BJFA 3ECQA 3NO3A 1EJUC 1K8XA 3NYDA 4JD4A 3COTA 3MVTA 3PZIA 1S2WA 3E12A 3QPEA 4GY7A 4AZ5A 4DJDA 3ID7A 1W9BM 4BI7A 1FXQA 1UKPA 4QHRA 4ZSTA 5HNUA 1D3HA 4DM2A 3URHA 3H2OA 5M1TA 3DZ1A 1JYVA 3CWOX 5HXMA 5M2FX 2ZTJA 3LCWA 2CLIA 4FZIA 5EMMA 3CIWA 2Q3OA 1MEIA 2WNWA 3VU2A 1TUFA 2ZZBA 4AIBA 2VEPA 3T2QA 1ZCOA 2EPHA 2RHGA 4HTBA 2PD9A 3MSYA 3HPXA 1YPFA 2Z4GA 4PBGA 4H4SA 1M01A 3DKJA 1X1ZA 4QX4A 3K1GA 3HQPA 2OKTA 1UH4A 3S42A 4O18A 2YCLA 4RDZA 4O1DA 3PAOA 3G0XA 1H7OA 3CYJA 1WZLA 1TELA 4YWIA 4OUEA 3FSUA 3RX2A 1TO3A 5GPRA 1E6RA 1JZ7A 1R9XA 1HUVA 1BRLA 1J8VA 4A3UA 4CD7A 3WLTA 3GG0A 2YX0A 1H62A 4R3UA 5G1YA 4X2RA 4A8LA 4FF7A 3O0HA 1ITCA 4U2ZA 4ATDA 3N2MA 3KE0A 3L4UA 2P0OA 4NP7A 4CUCA 1US3A 4CEXC 3SCVA 1YLVA 2ZCGA 4N9BA 2Y85A 4N2YA 2WNNA 1H7XA 1VYSX 3KWXA 3U6WA 1X6UA 2WK2A 4IJRA 1FQ0A 3TN5A 3AN1A 2O4MA 4KS0A 4BQ4A 3H2CA 3R58A 2R6OA 2IS7A 4HNVA 2H8ZA 3FJ4A 1S7MA 5HANA 1KTNA 4QJ1A 4ICNA 4LBUA 1SJBA 1Q7ZA 1PXGA 3C3NA 3DG7A 3OB8A 4H9UA 4JKLA 5FL0A 1VIZA 1PJ9A 1AOGA 1OC5A 4Z1YA 4J3UA 4MWAC 3AMZA 3G5EA 3KVLA 2YOCA 5F7UA 1PTGA 4JNYA 2OG9A 4ZQPA 2VRQA 2YGYA 3IGXA